2C9WB

Crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords SUPPRESSOR OF CYTOKINE SIGNALING 2
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c9wB00
3SHQA 2GBRA 4FHKA 2WWZA 3DVGX 1J8CA 4F8CB 2KVRA 2HD5B 1UBQA 1WR6E 4DHZB 3ZNID 1WJUA 4KZ0A 4GXBA 1WE6A 2L00B 4GN1A 4HK2A 2GMIC 4KV2A 1IYFA 2HJ8A 2G4SA 3QK0A 2NBWB 4IM2A 3K9OB 4W9FA 2KANA 5JHBA 2KJ6A 3H7PB 3JW0X 3U7DA 3QWZB 4F1SA 2KMCA 4GDKA 4BVUC 3ZNZB 3W1SA 3H7PA 1WGYA 3N32A 2NCNA 4ZYNA 2N9PC 1OQYA 2G45B 1XD3B 4AOFA 3HM3A 2REXA 3TMPB 4JIOU 5AZGA 1WE7A 1WH3A 2DAJA 2NPTA 3H9DA 3ML8A 3ZRCA 2HTHA 3CSTA 2ASQA 1XT9B 2PEAA 4CO7A 1V86A 2OJRA 3KUDB 3DVGY 3NZSA 4M0WB 2HE7A 1NBFC 2I1JA 3EFUA 5CHWA 2DX5B 5AZFA 1LQBA 4MDKE 5IAAC 4NY0A 3M95A 2BWES 3WAOA 4B95A 3DQVA 4E71A 1BT0A 3NHEB 3KYCD 2KFKA 3ML9A 2IO2B 4NAWA 2KN5A 3A1QB 1EUVB 3JYUA 4DDID 2MX2A 4HCPB 1WRDB 2BWFA 2W9NA 4FJVB 3WIMA 3QHTA 2KXJA 3DBLI 1E8ZA 2IY0B 4GMVA 4FBJB 1TZ1A 4HJKA 2N9EB 4MELA 4DK5A 4II3B 4WWPA 3V6CB 3ZW3A 1MG8A 2M0XA 2PE9A 3U8ZA 5KHQA 4BFRA 2XBBC 4TV3A 4AUQC 4OVUA 2CHWA 1PQSA 1KJTA 5AEKB 2BYVE 4G3XB 4W9HA 2ZEQA 4WJNA 3ALBA 3DVNU 2IZVB 4NAWB 2KWUB 2NR2A 5JZEB 4MH0E 5JH5C 3UF8A 1GG3A 1V80A 4RMAA 4TKNA 4M8NA 1R4MI 2KC2A 1QZEA 4ANWA 2IO0B 5IA7A 3KW5B 2A4ZA 4FA6A 4CYEA 4HVBA 4MSMB 1XQQA 1Q1OA 1V5OA 2FNJB 3HK0A 2KTFA 4LJPB 4GSWA 3V62A 4HCNB 2GBKA 3ZTCA 2R2QA 3D32A 2J0JA 3JVZX 4YL8A 2DZIA 3KH0A 2ZPYA 3PZDA 1WGHA 2XK5A 2QHOA 4N9F4 1F9JA 1J0GA 1KOTA 1WMHA 1WIAA 3PVLA 2MW5A 2BKFA 4NPNA 3WAPA 4CHKA 2KFJA 5L95C 2NBVB 4GDKB 3RZFA 2MWSB 3ZVVA 1GC6A 1TGZB 3ZO5B 3L54A 3DBRI 2C9WB 5DPRA 4XC2A 1Z2MA 1KM7A 3RT3B 3X23A 5C1ZA 2L7RA 2MBOA 2KDFB 4XZ4A 2K39A 2LZ6A 3VUYA 3A33B 2N1WA 3APDA 2ZVNA 2K6QA 2IO3B 1WJ6A 3PLVA 2XK5B 4IC7B 2WYQA 4G11A 4KZCA 2O6VB 3PRPB 4B6WA 2CKHB 1VCBA 2M17A 3IFWB 1AARA 2O2VB 3X0WA 3NOBA 2LASA 2AYOB 3WA0A 4A20A 2LGYA 4PYZA 1YD8U 2KTRA 4FN2A 3KVFB 2D2QA 4ZRJA 2NS5A 1P3QU 4GDLA 1SE9A 3QQ8B 1YQBA 1JRUA 2KDBA 3M62B 5E6PA 3UQAA 3A9JA 3AU4A 3PHXB 3B08A 4DHZE 2BF8B 2KC1A 3IVFA 2DZJA 4MGKE 3R66C 2OOBB 3L13A 3AI5A 5EDSA 2AL3A 1IP9A 2MRPA 3VH3B 1HE8A 5CTRC 3TIXA 4GDLB 5CX3A 4K7WA 4P7IA 5GMVA 2G3QB 3A9KA 3DBHI 2MQJA 4KSKC 4XX5A 5DPTA 4AP4C 2LGXA 4WWNA 1RLFA 1LFDA 3HM6X 1H8CA 3IG3A 2NVUI 1YX5B 2I1KA 4W9GA 2LJ5A 4IM0A 1C3TA 3H6NA 4BKTA 3QCAA 4I6NB 1E7VA 2DYOA 2Z0EB 4DBGA 5LXIB 2LGDA 2D3GA 4WJOA 1YJ1A 2PE6B 3WANA 4MEMA 5BO4B 4HXDA 3GZNI 3I3TB 3OJ4B 1ZGUB 3PLUA 2WDTB 2WX1A 4FULA 3SD5A 2ZCBA 5J18A 3SU8X 1U4AA 2K8BA 2V1YA 1K8RB 2LUEA 4I6LB 2LXCA 4II2B 1SGHA 1WJ4A 2AL6A 1WMHB 4EZKA 2UYZB 3A9JB 1V9JA 3NS8A 3VDZA 4TQ1A 2JWZA 3CSFA 3K9PB 2J0KA 1WX7A 1GC7A 2K8HA 2D10A 4W9KA 1WZ0A 4FHJA 2YLMA 3EECA 3QA8A 3RULA 3V60A 3B1LX 2KWVB 3AULA 3VUXA 4MJSB 3PGEA 1YIWA 2MBEA 3PS6A 1WXMA 2N7EA 2KX3A 1P98A 3MHSD 5D94A 4IG7B 3Q3FA 4J6IA 2C7MB 2KX0A 2LXAA 2DYBA 1GNUA 2MBHA 2C60A 3GOEA 1SIFA 3ZUNA 3ECIA 1EO6A 3QARA 4NJ6A 4HDQA 2KNBA 4LDTD 2C7HA 1WF9A 3KUZA 2KK8A 4GOCA 4DHJD 2JPHA 4JL9A 1I35A 4PYUA 1UELA 4DWFA 4WJPA 1C1YB 5KHOA 4TUUA 1S3SG 3L16A 2MLBA 4IW0A 2FIFA 3VXWA 2C7NB 1D3ZA 3IHPC 2DHZA 1WXVA 2KDIA 4PS3A 2L76A 1EF5A 2KFKB 2MBBB 3R7RA 4LCDE 3DBSA 1RAXA 1Y8RC 3AU5A 4K7UA 1RRBA 3W1SC 4AWJA 4ANXA 3DPDA 4KDIC 3VVWB 1TBEA 2LVOA 3DCGA 2EMSA 2JF5A 1WGDA 3ZTDA 1P1AA 3JSVA 3SDLC 2BYFA 4KIKA 4W9IA 2JY6A 2JRHA 3T8MA 3PPAA 4WWOA 2CU1A 1WM2A 3TJPA 2MCNB 3B0AA 2R2OA 2RGFA 4FJYA 3ZIMA 2CHZA 3PHWB 2G4DB 3PTFC 4MJSA 2DENB 4NQKE 2KJRA 4EUTA 3RD2A 2GOWA 5HKHA 1E7UA 4WQOB 1WJNA 1X1MA 2KO3A 4GU2A 4AJWA 2D11A 4EOYA 3QIJA 3BY4B 3ZLZA 3UINB 2JT4B 4I6PA 2DAFA 3RUIB 2O2VA 5CHFA 2FIDA 2ZJDA 4FLHA 5E6OA 3BINA 2O6VA 4GB9A 1E8YA 2KKCA 3HIZA 4KSLC 1ISNA 2V4LA 1E90A 1UGMA 3L0WB 2K6DB 4K81A 2GBNA 4ZDVA 1IPGA 5G55A 3WAMA 2XEWA 1GUAB 2YVCA 4DXAB 4MGZE 3PRZA 3H1UA 2IO1B 4FJZA 3L08A 4LJOB 1LXDA 5FR6A 3RZWC 4TQ0A 1E5WA 2FCQA 2KOXA 4WAAA 3TBLD 4GGQA 4B9KA 3OJ3A 1UH6A 4K7SA 5L83A 3VFKA 3ZNGC 3HHMA 3R7QA 2L0TA 3CMMB 1T0YA 3EHVA 2ZVOA 3T9LA 2KHWB 4LDTB 3L17A 3VH4B 3VUWA 4BKSD 4MSQB 2GBJA 2UWQA 3V6EB 3VHTC 2B3AA 3A4RA 2Z0DB 1WXAA 3TCAA 5J2RA 4JGHB 2J0MA 2IY1B 4EZLA 2ZZPB 3TL5A 1Z5SB 3M63B 3UGBB 5C23A 3ZNHB 4GIVA 2CHXA 2Y5BB 4HPMB 4KIKB 1P9DU 4RM8A 2ZPNA 4HLEA 2L05A 1WFYA 3AXCA 1WXSA 4NNJB 3DOWA 2LD9A 3OLMD 3UIOB 4M8MA 2KTRB 4ICVA 1R4NI 1FXTB 1H4RA 2LVPA 2M8SA 2KWCA 4JLCA 2N1VA 3W1YA 1J19A 4KDLB 1OGWA 1OTRB 3RYTA 3MJWA 3VTWA 2K8CA 3PV1A 1WX8A 2MBQA 4WJQA 2RD0A 2AEHA 2Z59B 1V5TA 3S2AA 4ANUA 4EEWA 4E3CA 3ZDTA 1EF1A 4W9LA 4MM3A 2JRIB 4ICUA 3C0RB 2FAZA 2N9XA 1WR1A 2DYMA 2NBUA 3ZDMC 4IM3A 1I42A 1WI0A 5DPWA 3MTNB 4MGIE 1TTNA 3PREA 4DDGD 2CR5A 3JSVB 1G6JA 2MA9B 1WY8A 3IBEA 3VQIA 1WZ3A 5G2NA 2MP2A 1L2NA 2PJHA 1M94A 2V3SA 4BOZB 3NY5A 3NZUA 4NJ7A 3VAWA 3WALA 2LWPA 3PSEB 2JVCA 2JZ3B 4W9JA 5LXHA 4G50A 4URKA 2WX0A 5DPSA 4JQWC 4PS8A 2JUOA 1CMXB 5LLIA 4BOSC 1OEYA 4ZRKA 2IBIB 5D2MB 2FCNA 2KDEB 2KQSA 1WGRA 2CS4A 1NDDA 3PT2B 4OVVA 5DCNA 5AZHA 2LRWA 3VTUA 2D07B 2MP2B 2M4NA 3QX1A 3UQBA 1L7YA 3Q3JA 2KQ7A 2O6VD 2RR9A 3L10B 2L3ZA 4K1RB 3CF6E 1GJZA 2N7DA 1OEYJ 2MSED 4IWPA 3RCZA 4FADA 5D6JB 2ZNVC 4MGYE 4ANVA 1UZXB 1WYWB 3O65B 3M3JA 4X57B 3UIPB 2LRUA 1V49A 3V61A 3A4SC 2KJHB 3OAWA 4IUMB 5JHAA 3DVNV 1VD2A 3EC8A 2PPHA 2DZMA 2GBMA 2DZKA 2JXXA 2LI5A 4HPLB 4KVGB 4PS7A 2FCSA 2IYDB 2VRRB 1NI2A 1P0RA 3PRMB 2BYEA 2L0FA 4W9DA 2BKRB 4EZJA 4ASWC 4DHJB 2ZCCA 2AWTA 3APCA 3A1QA 3R3MA 3N30A 4NQLB 1WGGA 2RPQA 4HDOA 4W9EA 5TR5A 5J17A 3KYDD 4F7ZA 1RFAA 1V2YA 1A5RA 4RM9A 4EKUA 2M1MA 2EMTA 1ZW7A 3P2BA 3QJZA 3ZKJC 2ZNVB 3A9KB 2L8JA 3H7SA 1ZKHA 2BPSA 1Q5WB 2KMAA 4W9CA 3U30A 4IWOA 3LDZE 4BBNC 1Q0WB 2K1FA 2JZZA 1UD7A 3QAQA 1KLVA 2KLCA 1WX9A 2NPTB 4G0NB 4EFOA 1LM8B 1UBIA 3LJ3A 1YX6B 4BKGA 5E6NA 4BBNF 1S1QB 2FCMA 4IWQA 5CHVC 2C5LC 2KZRA 2J7QB 2EKEC 3KUCB 3N3KB 4ZRIA 2RSUA 4A3OA 3ONSA 2FUHB 1E8WA 3ZRFA 1V81A 4A3PA 2A5UA 3ENEA 3APFA 2N4FA 3QC8B 3VTVA 1WM3A 4BKSA 2KLGA 1V6EA 2BGFA 4E74A 2LVQA 4HWIB 5D7GA 2K25A 3DDCB 1E8XA 2KD0A 4AJYB
chains in the Genus database with same CATH superfamily
4FHKA 2WWZA 1J8CA 4F8CB 2KVRA 2HD5B 3KWVA 1UBQA 1L4ZB 2XNAC 1WE6A 2L00B 1HTQA 2GMIC 1IYFA 1KRHA 2G4SA 4W9FA 2KANA 3H7PB 2KN4A 4OZAA 4F1SA 4BVUC 3ZNZB 3H7PA 1OQYA 2G45B 5T8IA 3TMPB 4JIOU 3ZJVA 1NI3A 2WXHA 3MP9A 2ASQA 2AQ2B 1V86A 4M0WB 2HE7A 3IT6B 2LFIA 1I4HA 5AZFA 3I5JC 2G9HD 2LGSA 3NHEB 1EU3A 4DDID 1WRDB 3BWUD 1CQVA 2KXJA 2ONQA 4WIPA 2N9EB 3DBRB 1MG8A 2N9LA 1VRAB 3U2SC 5KHQA 1PQSA 3AEDB 3ZXVA 1PGBA 3ALBA 2IZVB 2KWUB 2NR2A 3MC0B 4TKNA 1R4MI 1UGJA 4MACA 2A4ZA 4FA6A 3CIRB 4MSMB 2MHJA 4ITKA 3HK0A 2KTFA 3V62A 4AS1A 3ZTCA 3AECB 4YL8A 2DZIA 3PZDA 3W2DA 2QHOA 1F9JA 1J0GA 1KOTA 1L5PA 2BKFA 5L95C 1HA5A 1TS5A 1GC6A 5H92C 3L54A 3DBRI 4J3OD 4XC2A 3RT3B 2L7RA 5BMGA 3VUYA 1HXYD 4P16A 1I4GA 3PLVA 2XK5B 4IC7B 2WYQA 1L0VB 2WDQB 2KAJA 1QQRA 3PRPB 3URYA 2CKHB 2M17A 4ARCA 3X0WA 4HPPA 3NOBA 3N20C 4ZRJA 2BT6A 2GI9A 1P3QU 2UU7A 2KDBA 1SJED 3B08A 1ZDVA 2KC1A 4XDDA 2D3BA 4MGKE 2J4XA 3AI5A 2AL3A 2MRPA 3TIXA 4GDLB 4K7WA 3A9KA 2WXJA 2MQJA 1DOXA 1IUEA 5DPTA 3B2GA 1VR9A 1L0YB 2LJ5A 3H6NA 1QT9A 4I6NB 4DBGA 5LXIB 2LGDA 4WJOA 2CJNA 3R8BA 3WANA 5BO4B 4HXDA 1L4DB 2CU3A 2WDTB 4FULA 5G5HA 2K8BA 1MG4A 1HZ5A 2AL6A 1R4NB 1AN8A 3NS8A 3VDZA 4TQ1A 2JWZA 2J0KA 1WZ0A 2YLMA 3V60A 2KWVB 3AULA 3VUXA 4MJSB 1YIWA 4PK1A 4KGSA 5HI1A 2BB6A 1P98A 3MHSD 3Q3FA 2PVOD 4J6IA 2KX0A 2LXAA 4Q2JA 2LUMA 3GOEA 2PMVA 4LDTD 4GOCA 2JPHA 4RGTA 2WDRB 4DWFA 2NMQA 5KHOA 1S3SG 2EELA 2MLBA 2FIFA 3GZNB 1D3ZA 4PS3A 1WXVA 2KDIA 2J52A 3AE8B 4LTUA 4C7ZA 4DXFA 4K7UA 1RAXA 1Y8RC 3W1SC 1TBEA 2EMSA 3ZTDA 1D4BA 1YJIA 1P1AA 4NJCA 2X38A 3SDLC 2QC8A 4WWOA 3P63A 3TJPA 3B0AA 3NVYA 1HZ6A 2YEPB 3ZIMA 2CHZA 1F2RC 3PTFC 3NVZA 4WH4A 2D5GA 1MFWA 3VR9B 3TEZA 4GU2A 1VJKA 3ZLZA 4C56C 1QLBB 2VH1A 4I6PA 5AUIA 2DAFA 2PW9A 3AEEB 2FIDA 2KQ4X 1YOVB 4KX6B 5E6OA 3HIZA 3NS1A 1ISNA 2JZPA 2V4LA 3L0WB 1EM7A 2K6DB 2H89B 2M0AA 2GBNA 5G55A 4C00A 1N6ZA 2QCZA 2M19A 2IO1B 3H1UA 5EE3A 3L08A 4LJOB 4TQ0A 2LMCA 3RZWC 4GGQA 2BBCA 3HHMA 3R7QA 3ABVB 2KHWB 2BYTA 1I4QA 3W9CB 3VUWA 1K51A 1XLNA 4MSQB 1XLOA 1AWDA 1XF5L 2WDVB 2D3AA 3AEFB 2UWQA 3VHTC 1D6EC 2J53A 2B3AA 4KGTA 4A9AA 4EZLA 2ZZPB 1ENFA 1KLGD 1WGKA 1T0RC 1WFYA 3ZJUA 2IDYA 2D3CA 4M8MA 2KTRB 2WXRA 4JLCA 2N1VA 3EUB2 1N61A 3GP7A 4RH6A 1OTRB 3VTWA 1NYQA 2PKOA 2MBQA 2OJWA 4M00A 1OQRA 1V5TA 3S2AA 2WP9B 4W9LA 3ZDMC 3DHIC 3JSVB 2MA9B 3RI7C 2WXIA 1AYFA 1P7EA 4N58A 4US9A 3NY5A 3NZUA 3VAWA 3PSEB 4W9JA 1TZOA 3TEYA 5DPSA 3I57A 1OEYA 4ZRKA 5DCNA 5AZHA 2LRWA 2M4NA 2WXOA 4GLSC 2O6VD 2RR9A 3BK2A 1V1PA 2N7DA 5D6JB 2ZNVC 4MGYE 2MEKA 4NZLB 3AN1A 3IAM1 3UIPB 2WNMA 4DXGA 2PPHA 2JXXA 3FC4A 2FCSA 2JYEA 2HJ1A 3C19A 4W9DA 1YQ3B 1QILA 4EZJA 2AWTA 3APCA 1OFFA 2RPQA 5FK9C 2M1MA 3QJZA 3ZKJC 2ZNVB 3A9KB 2L8JA 2JSVX 3P42A 2Y3AA 1RFKA 2K1FA 1UD7A 1L6UA 2KLCA 3Q8FA 4EFOA 4A90A 2WXMA 2AQ3B 2N0SB 1FCCC 3P4SB 1QOFA 2EKEC 2RSUA 1WXQA 3ZRFA 1C4AA 3ENEA 4BKSA 1V6EA 4E74A 5D7GA 3IHPC 5J18A 4M0WA 3ZXRA 4RGNA 3E56A 1WR6E 4DHZB 4AQ7A 2TSSA 3ZNID 4MT5A 1C79A 1V1PB 3ETRA 3QK0A 1TJEA 2KYWA 4IM2A 3PZ8A 1YN3A 3QWZB 4FXCA 4GDKA 3W1SA 3N32A 1IGCA 1QOAA 2N9PC 2QEJC 1SSNA 4XYCA 3P4QB 5AZGA 1WH3A 2DAJA 1FRRA 2NPTA 3ML8A 2HTHA 1FM0D 4RF1A 1V8CA 1LQBA 5IAAC 2BWES 4B95A 2IGGA 3LB8C 2IO2B 3JYUA 1GAQB 4FJVB 3WIMA 3DBLI 1TZ1A 1TT5B 4A6QA 4DK5A 4II3B 4WWPA 3ZW3A 1QOBA 1D5ZC 1NYRA 4BFRA 4AUQC 4OVUA 3V05A 2INDC 2CJOA 1KJTA 1I4XA 2BYVE 5IKCM 2ZEQA 4P6VF 4NAWB 4MH0E 3UF8A 1GG3A 4ARIA 1V80A 1E0ZA 1IBXA 2XN9C 4CYEA 1Q1OA 4K3CA 4LJPB 1UWMA 4HCNB 1YN5A 4C4VA 1KFYB 1WGHA 4N9F4 1WMHA 1WIAA 5IO9A 4CHKA 3RZFA 1TGZB 3ZO5B 2V9HA 2C9WB 1YQ4B 1KM7A 2MBOA 2KDFB 2QIEB 2K39A 1N60A 2ZVNA 3N9YC 2IO3B 1JALA 4DQOC 2O6VB 2WGSA 2HTME 1JROA 1DOIA 1K50A 2O2VB 2LASA 4A20A 3U7ZA 2LGYA 1YD8U 2KTRA 3ZYYX 2R61A 3KVFB 3RNFC 5D3IB 4BZAA 4GDLA 1SE9A 2JU6X 3R2IA 3A9JA 1XLQA 3I63C 1YNTE 2DZJA 5IP4D 5EDSA 2WU2B 1HE8A 3C8YA 3DBHB 2G3QB 3DBHI 4KSKC 4XX5A 3VRBB 4YTNB 1H8CA 2WS3B 1C3TA 4BKTA 4XWTA 1C4PA 2DYOA 1UNSA 2D3GA 4XGAB 3AE4B 2PE6B 4LNKA 4MEMA 1ZGUB 3PLUA 4JWUC 2ZCBA 3SU8X 1K8RB 2LUEA 2DWQA 3N1ZC 4II2B 1WJ4A 1WMHB 3GE3C 4C80A 2UYZB 3EA6A 1WX7A 1GC7A 2K8HA 4W9KA 1F0ZA 2MBEA 3UI3A 1WXMA 1IBXB 2KX3A 3MJ5A 2NTTA 1JWMD 2DYBA 4YSYB 2WHIA 2MBHA 2C60A 1SIFA 1QOGA 4DHJD 3NG0A 2Y5PA 3AE2B 4PYUA 2JQRB 3J9CA 3OG5A 2VZKB 4IW0A 2C7NB 1QKZA 2DHZA 2M56B 4WAFA 2MBBB 3R7RA 3U4EG 4ANXA 4YSZB 4KIKA 2JY6A 3T8MA 2MCNB 3BZDB 2RGFA 2K3UA 1J7CA 2L1AA 4MJSA 2IGHA 3RD2A 2GOWA 4L2YA 2BTEA 3QIJA 2DBYA 2V0GA 2JWUA 2JT4B 1JWSD 5CHFA 1NVID 4A55A 4KSLC 4OW0A 4K81A 3MFGA 2WU5B 3WAMA 1GUAB 2KVZA 1E5WA 4B9KA 3VFKA 3ZNGC 3Q8AA 3CMMB 3L4PA 3EHVA 5MPOA 2ZVOA 1XXGA 2SEBD 1JRPA 3A4RA 5IOIA 1WXAA 3GS2A 4RFBA 1TKGA 3M63B 5HHDG 5C23A 4M02A 2CHXA 1P9DU 1R7SA 5AUKA 4NNJB 3DOWA 1EU4A 3UIOB 4ICVA 1FXTB 1H4RA 1UUPA 2M8SA 3W1YA 3AE5B 2QSDA 4KDLB 2MH7A 3MJWA 2K8CA 2PVGC 4TMAB 1WX8A 3TUOA 4EEWA 4E3CA 3ZDTA 1EF1A 5TSSA 4LNIA 2FAZA 2N9XA 2DYMA 4IM3A 3MTNB 4MGIE 3PREA 2CR5A 3VQIA 5G2NA 1L2NA 2PJHA 1M94A 3N1XC 4NJ7A 3WALA 4ZRPA 2LWPA 2JVCA 2JXTA 1TY2A 2JZ3B 3ZQ4A 5LXHA 1T6BX 2WX0A 3B2FA 5LLIA 2E6XA 1ZPSA 2IBIB 1OQQA 4R3DA 3Q3OC 2ACZB 2FCNA 2KDEB 3IAS1 1WGRA 3PT2B 1FPYA 3VTUA 2BS3B 2ON8A 3AE3B 3ZGZA 1L7YA 3Q8BA 1FO4A 1TYGB 2KQ7A 2Q5WD 1C4CA 3L10B 3CF6E 2QILA 4FADA 1RYJA 3BVGA 3M3JA 1V49A 3V61A 3VRAB 5JHAA 2IJ0A 1A70A 1VD2A 3DVNV 2DZMA 2LI5A 4HPLB 1PDXA 2IYDB 2PTLA 2BYEA 4IDIA 1J7AA 2BKRB 4O1NA 5G5GA 4DHJB 4NQLB 3A1QA 1A5RA 1RFAA 1V2YA 4YTPB 2EMTA 3P2BA 2BPSA 4W9CA 1HEZE 4BBNC 1ZE3D 3BYTB 1KLVA 1LM8B 3Q8CA 5H8YE 2FCMA 2KDMA 2INPE 4IWQA 2FUHB 4A3PA 3APFA 2N4FA 1WM3A 4IKGA 2K25A 1FNWA 1E8XA 2GBRA 3DVGX 4L23A 2GRIA 3PZ7A 1WJUA 2V4IB 4KZ0A 4GXBA 4RCOA 4GN1A 4HK2A 2HJ8A 5JHBA 2NBWB 3U7DA 3DHGC 2KMCA 2NCNA 4ZYNA 1SE3A 1E10A 1WE7A 3H9DA 3CSTA 1J7BA 4KKJA 5EE1A 2MJDA 3TEXA 3DVGY 3NZSA 5GXGB 2I1JA 3EFUA 5CHWA 3Q2AC 3EGRA 2MJ3A 5BMHA 4MDKE 4NY0A 3WAOA 4E71A 3KYCD 5BYRA 3ML9A 2MX2A 4HCPB 2BWFA 2W9NA 3MHZA 3QHTA 4GMVA 4FBJB 2RDHA 2M0XA 2W3RA 2XBBC 3AE7B 4TV3A 1T0QC 4W9HA 1MVKA 4WJNA 1I7HA 3DVNU 2K9XA 1FXAA 5JZEB 5JH5C 4M8NA 2KC2A 5IA7A 3AB5A 1XQQA 1V5OA 2FNJB 4GSWA 3W5VB 3D32A 1CZPA 3JVZX 3DWMA 2ZPYA 3TEWA 2X8XX 1N62A 4LNFA 2KFJA 2MWSB 3ZVVA 4EE2A 1ZOYB 1Z2MA 1MI0A 3X23A 1L6VA 3A33B 2N1WA 1UF0A 2ZW1A 3SEBA 5JXVA 2FUG1 2AYOB 2WXGA 5I4DA 2D2QA 1JW9D 3QQ8B 1I4RA 1YQBA 1JRUA 3PHXB 1QF6A 1F1HA 2BF8B 2W54A 3R66C 2OOBB 3L13A 1JWUD 4ZYSA 1E7PB 3OWEB 1IP9A 5C2TB 4B0MA 3VH3B 1P7FA 5CX3A 2JYTA 4P7IA 5GMVA 4WWNA 1LFDA 3HM6X 1YX5B 2I1KA 4W9GA 1GB4A 5EE9A 3QCAA 1E7VA 2Z0EB 1YJJA 4OZCA 4ACFA 1YJ1A 4L1BA 3TSSA 3OJ4B 3KLSX 3SD5A 2Z8LA 1U4AA 2N9KA 4MH8A 2NTSA 4I6LB 1SGHA 4EZKA 3A9JB 2D10A 4FHJA 3B1LX 3NVVA 1XEEA 1YN4A 3I9V1 3PS6A 2N7EA 1XLPA 4IG7B 2C7MB 3IT4B 2INCC 4US8A 1C78A 1SF0A 4HJGE 1GNUA 1ET6A 2KACA 3ECIA 2BVCA 4HDQA 4NJ6A 1N63A 1LO5D 2SAKA 2C7HA 1WF9A 4XE0A 1I35A 2WXPA 1UELA 1R4MB 3LXFA 1I4PA 2QDFA 2W82A 3L16A 4JX1C 3P4PB 1DYQA 1FIQA 2OEDA 4OZBA 1RWSA 2K0PA 1SE2A 4LCDE 4AWJA 3DPDA 1VLBA 3VVWB 1MPEA 3DCGA 1FMAD 2JF5A 2L83A 2RDGA 4WQMA 3JSVA 1TS2A 2BYFA 4RNAA 3B9JA 3PPAA 1ET9A 4P1CC 1JMLA 4P1BC 3PHWB 1K53A 2G4DB 4NQKE 2DENB 4EUTA 5HKHA 1E7UA 1WJNA 1X1MA 1JWBD 1VZ6A 4EOYA 3BY4B 2OHFA 2QMTA 3RUIB 4YSXB 2ZJDA 4FLHA 1AW7A 3BINA 2L52A 2KKCA 1E90A 1UGMA 1C9FA 1MHXA 1IPGA 1PGAA 2XEWA 3AE9B 4MGZE 3DBLB 4DXAB 1D5XC 4FJZA 2EKIA 1LXDA 5FR6A 4ZHPA 2FCQA 4WAAA 3TBLD 3NRZA 1UH6A 2BQQA 1N5XA 5LNK1 2H88B 1E6EB 3L17A 4BKSD 1TS3A 4M01A 3MC9A 1FRDA 3V6EB 3AEGB 1DOYA 3TCAA 5J2RA 2J0MA 2IY1B 3TL5A 4B0EA 1Z5SB 2WXFA 1CK1A 3ZNHB 4GIVA 4BAXA 4RM8A 2ZPNA 4HLEA 2L05A 3AXCA 3KWLA 2LD9A 3OLMD 4HROA 1R4NI 2HDEA 1J19A 2KT7A 3H8HA 4WJQA 2RD0A 4ANUA 2E3TA 2I38A 4MM3A 4ICUA 1BXTA 4UDUC 2K5PA 1I42A 1ZXHA 3RNEC 1TTNA 3DHHC 1WY8A 1WZ3A 2MP2A 2V3SA 1HQRD 4JQWC 1V1OA 1IGDA 4PS8A 1CMXB 1EWYC 3AE1B 5D2MB 1ZXIA 1NEKB 2LHEA 1ACCA 2D07B 1SB3C 1MHHE 2V3NA 2ICIA 2ZW0A 5IN7A 2L3ZA 4K1RB 4RF0A 3HRDD 4IWPA 2RDBC 3RCZA 2JX5A 4ANVA 3O65B 4X57B 1SE4A 2LRUA 1TIFA 3AE6B 2KJHB 3OAWA 3U52E 2AQ1B 4USAA 3EC8A 4PS7A 2GBMA 2DZKA 2VRRB 1NI2A 1P0RA 3PRMB 2I2YA 2ZCCA 4ZRQA 4S0RA 3N30A 5TR5A 5J17A 4W9EA 3NJTA 2IPKD 1GOZA 3KYDD 4F7ZA 3RFZB 4RM9A 4EKUA 2B76B 1ZW7A 2RMMA 2W3SA 3MC8A 2VZKD 1Q5WB 1FFUA 2KMAA 3U30A 4HKQA 2JZZA 3QAQA 5C3JB 3HVDA 1YMHE 1UBIA 4REZA 3LJ3A 1FD6A 1STEA 4S17A 3CWIA 3BYYB 5CHVC 2C5LC 2J7QB 3KUCB 3N3KB 4YWGG 4ZRIA 3ONSA 1V81A 1K52A 1N5WA 3AEBB 3VTVA 4CQNA 1FNVA 3PO0A 1FFVA 2KLGA 2IGDA 4HWIB 3DDCB 3KH0A 2KD0A 2LEKA 3SHQA 2KWDA 1XCQL 1FCLA 4KV2A 3K9OB 2KJ6A 3JW0X 3NUHB 4KKIA 1WGYA 1XD3B 4K3BA 4AOFA 1T3QA 1M4VA 3HM3A 2REXA 4C4VB 3ZRCA 1EWCA 1GB1A 5FR3A 1XT9B 2PEAA 4CO7A 2OJRA 3GE8C 1JCKB 3KUDB 4N59A 5EE0A 4N6EB 1NBFC 4XDCA 1TS4A 1ZDXA 2DX5B 3T3OA 3M95A 1SJHD 4C7YA 3DQVA 1BT0A 2KFKA 4NAWA 2KN5A 3A1QB 1EUVB 3W5UB 1E8ZA 2IY0B 4MELA 4HJKA 1B1ZA 3IXSA 3AV8A 3V6CB 3BVMA 2J42A 5BMIA 2PE9A 3U8ZA 2WXLA 1B9RA 1VZ8A 1Y56A 2CHWA 5AEKB 1FEHA 4G3XB 4JWSC 3R2TA 4JE3B 2VH2A 1KH0A 1C76A 4WURA 1ZP0B 4RMAA 1BUIC 1VDVA 1QZEA 4ANWA 2IO0B 3KW5B 4HVBA 3BVZA 2KMMA 3RNGC 2GBKA 2R2QA 2J0JA 3E9SA 2XK5A 2WQYB 2N7JA 3PVLA 2MW5A 4NPNA 5HG2A 3WAPA 2NBVB 4GDKB 1SBBB 1ROEA 1WSPA 2FE8A 3NZ3A 5DPRA 3RPFC 5C1ZA 4XZ4A 2LZ6A 3APDA 2K6QA 1WJ6A 4KZCA 4G11A 4LLGM 4B6WA 1VCBA 3IFWB 2INNE 1AARA 3WA0A 4NAMA 4PYZA 4FN2A 4QAYA 1PYWD 2NS5A 4LK0M 1L0XB 1ESFA 3M62B 5E6PA 3UQAA 2GLSA 3AU4A 4DHZE 2LGIA 3IVFA 1SEBD 3NVWA 4HRSA 5FKAC 5CTRC 1SIJA 4KGRA 2WXQA 4AP4C 2LGXA 1RLFA 3AH7A 3IG3A 2NVUI 4IM0A 3FILB 1FNUA 1TKEA 1WWTA 4YT0B 3Q6BA 1F77A 3FKYA 4RGMA 3RNCC 3GZNI 2FBWB 3I3TB 3ZJTA 3SFDB 2WX1A 1NENB 4ZOHC 2V1YA 1T5XD 4HKZE 2LXCA 3RMKC 1JWAD 3HUIA 4XWWA 2WLBA 1V9JA 5BYSA 3CSFA 4IOIE 3K9PB 3RNAC 1KLUD 3EECA 3QA8A 3RULA 2GB1A 3PGEA 5D3DA 2PLPA 3AM9A 3P4RB 5D94A 2WXKA 1GPXA 1F52A 3AMZA 3ZUNA 3QARA 1EO6A 3GB1A 4LNNA 3P1MA 2KNBA 3KUZA 2KK8A 4JL9A 3SFEB 1ZUD2 4WJPA 1HTOA 1C1YB 4TUUA 1XO3A 2MJEA 1F2RI 3VXWA 4YTMB 2L76A 1EF5A 2KFKB 3DBSA 3AU5A 4OHJA 1RRBA 1PUTA 4KDIC 2LVOA 2BB5A 1WGDA 1WYGA 3AEAB 1WRIA 4W9IA 2JRHA 2V3PA 2CU1A 1T0SC 1TKYA 1TY0A 1WM2A 1KTKA 2R2OA 4FJYA 1V97A 2KJRA 3BIID 4WQOB 2KO3A 4AJWA 2D11A 2L32A 3UINB 2G1EA 2O2VA 3SR6A 3V3XA 1PGXA 2O6VA 2RPVA 4GB9A 1E8YA 5E6JA 3Q3MC 4ZDVA 3O13A 1UWXA 2YVCA 3PRZA 4H2AA 2YEPF 2KOXA 4A8XC 3OJ3A 4K7SA 5L83A 1FXIA 3KQ4A 4ZHOA 2L0TA 4TSSA 1T0YA 3T9LA 4LDTB 3VH4B 3N1YC 2GBJA 1C77A 4RGOS 2Z0DB 1CJEA 2BS2B 1SXTA 4JGHB 1LGRA 3UGBB 1MJDA 1KF6B 2Y5BB 4HPMB 4KIKB 1WXSA 4YXDB 2LVPA 2KWCA 1OGWA 3RYTA 1E9MA 4HEA1 1PFDA 3PV1A 1JQ4A 2AEHA 2Z59B 3FAHA 3Q14C 2JRIB 1XCTL 3C0RB 1WR1A 2NBUA 2QJLA 1WI0A 5DPWA 4DDGD 1G6JA 3IBEA 4BOZB 4D2KA 4G50A 4URKA 1VZ7A 2JUOA 4BOSC 1BMLC 2KQSA 4OVVA 2CS4A 1NDDA 2K22A 3Q8EA 2MP2B 3QX1A 3UQBA 3Q3JA 3WCQA 1D5MC 3RNBC 1GJZA 5HFYA 1OEYJ 2MSED 1DGJA 1UZXB 2AX5A 1WYWB 4MM3B 3DWGC 3A4SC 4IUMB 4OVZA 3LYYA 2BW2A 4KVGB 2LHDA 2DLBA 2W55A 2L0FA 4ASWC 3R3MA 1WGGA 4HDOA 3Q3NC 5BYQA 2LJIA 3EFCA 3H7SA 1ZKHA 4LNOA 3RN9C 4IWOA 4WWMA 2BS4B 3T3NA 3LDZE 1Q0WB 4JPSA 1Q10A 1WX9A 2NPTB 4G0NB 2PIAA 2WXNA 2Y5CA 1YX6B 4BKGA 3BK1A 5E6NA 4BBNF 3FILA 1S1QB 3HVZA 2KZRA 4PT5A 4A3OA 3Q69A 1E8WA 2DNFA 2A5UA 1RM6C 3VR8B 3QC8B 2BGFA 2LVQA 4AJYB
chains in the Genus database with same CATH topology
3SHQA 2GBRA 4FHKA 2WWZA 3DVGX 1J8CA 4F8CB 2KVRA 2HD5B 1UBQA 1WR6E 4DHZB 3ZNID 1WJUA 4KZ0A 4GXBA 1WE6A 2L00B 4GN1A 4HK2A 2GMIC 4KV2A 1IYFA 2HJ8A 2G4SA 3QK0A 2NBWB 4IM2A 3K9OB 4W9FA 2KANA 5JHBA 2KJ6A 3H7PB 3JW0X 3U7DA 3QWZB 4F1SA 2KMCA 4GDKA 4BVUC 3ZNZB 3W1SA 3H7PA 1WGYA 3N32A 2NCNA 4ZYNA 2N9PC 1OQYA 2G45B 1XD3B 4AOFA 3HM3A 2REXA 3TMPB 4JIOU 5AZGA 1WE7A 1WH3A 2DAJA 2NPTA 3H9DA 3ML8A 3ZRCA 2HTHA 3CSTA 2ASQA 1XT9B 2PEAA 4CO7A 1V86A 2OJRA 3KUDB 3DVGY 3NZSA 4M0WB 2HE7A 1NBFC 2I1JA 3EFUA 5CHWA 2DX5B 5AZFA 1LQBA 4MDKE 5IAAC 4NY0A 3M95A 2BWES 3WAOA 4B95A 3DQVA 4E71A 1BT0A 3NHEB 3KYCD 2KFKA 3ML9A 2IO2B 4NAWA 2KN5A 3A1QB 1EUVB 3JYUA 4DDID 2MX2A 4HCPB 1WRDB 2BWFA 2W9NA 4FJVB 3WIMA 3QHTA 2KXJA 3DBLI 1E8ZA 2IY0B 4GMVA 4FBJB 1TZ1A 4HJKA 2N9EB 4MELA 4DK5A 4II3B 4WWPA 3V6CB 3ZW3A 1MG8A 2M0XA 2PE9A 3U8ZA 5KHQA 4BFRA 2XBBC 4TV3A 4AUQC 4OVUA 2CHWA 1PQSA 1KJTA 5AEKB 2BYVE 4G3XB 4W9HA 2ZEQA 4WJNA 3ALBA 3DVNU 2IZVB 4NAWB 2KWUB 2NR2A 5JZEB 4MH0E 5JH5C 3UF8A 1GG3A 1V80A 4RMAA 4TKNA 4M8NA 1R4MI 2KC2A 1QZEA 4ANWA 2IO0B 5IA7A 3KW5B 2A4ZA 4FA6A 4CYEA 4HVBA 4MSMB 1XQQA 1Q1OA 1V5OA 2FNJB 3HK0A 2KTFA 4LJPB 4GSWA 3V62A 4HCNB 2GBKA 3ZTCA 2R2QA 3D32A 2J0JA 3JVZX 4YL8A 2DZIA 3KH0A 2ZPYA 3PZDA 1WGHA 2XK5A 2QHOA 4N9F4 1F9JA 1J0GA 1KOTA 1WMHA 1WIAA 3PVLA 2MW5A 2BKFA 4NPNA 3WAPA 4CHKA 2KFJA 5L95C 2NBVB 4GDKB 3RZFA 2MWSB 3ZVVA 1GC6A 1TGZB 3ZO5B 3L54A 3DBRI 2C9WB 5DPRA 4XC2A 1Z2MA 1KM7A 3RT3B 3X23A 5C1ZA 2L7RA 2MBOA 2KDFB 4XZ4A 2K39A 2LZ6A 3VUYA 3A33B 2N1WA 3APDA 2ZVNA 2K6QA 2IO3B 1WJ6A 3PLVA 2XK5B 4IC7B 2WYQA 4G11A 4KZCA 2O6VB 3PRPB 4B6WA 2CKHB 1VCBA 2M17A 3IFWB 1AARA 2O2VB 3X0WA 3NOBA 2LASA 2AYOB 3WA0A 4A20A 2LGYA 4PYZA 1YD8U 2KTRA 4FN2A 3KVFB 2D2QA 4ZRJA 2NS5A 1P3QU 4GDLA 1SE9A 3QQ8B 1YQBA 1JRUA 2KDBA 3M62B 5E6PA 3UQAA 3A9JA 3AU4A 3PHXB 3B08A 4DHZE 2BF8B 2KC1A 3IVFA 2DZJA 4MGKE 3R66C 2OOBB 3L13A 3AI5A 5EDSA 2AL3A 1IP9A 2MRPA 3VH3B 1HE8A 5CTRC 3TIXA 4GDLB 5CX3A 4K7WA 4P7IA 5GMVA 2G3QB 3A9KA 3DBHI 2MQJA 4KSKC 4XX5A 5DPTA 4AP4C 2LGXA 4WWNA 1RLFA 1LFDA 3HM6X 1H8CA 3IG3A 2NVUI 1YX5B 2I1KA 4W9GA 2LJ5A 4IM0A 1C3TA 3H6NA 4BKTA 3QCAA 4I6NB 1E7VA 2DYOA 2Z0EB 4DBGA 5LXIB 2LGDA 2D3GA 4WJOA 1YJ1A 2PE6B 3WANA 4MEMA 5BO4B 4HXDA 3GZNI 3I3TB 3OJ4B 1ZGUB 3PLUA 2WDTB 2WX1A 4FULA 3SD5A 2ZCBA 5J18A 3SU8X 1U4AA 2K8BA 2V1YA 1K8RB 2LUEA 4I6LB 2LXCA 4II2B 1SGHA 1WJ4A 2AL6A 1WMHB 4EZKA 2UYZB 3A9JB 1V9JA 3NS8A 3VDZA 4TQ1A 2JWZA 3CSFA 3K9PB 2J0KA 1WX7A 1GC7A 2K8HA 2D10A 4W9KA 1WZ0A 4FHJA 2YLMA 3EECA 3QA8A 3RULA 3V60A 3B1LX 2KWVB 3AULA 3VUXA 4MJSB 3PGEA 1YIWA 2MBEA 3PS6A 1WXMA 2N7EA 2KX3A 1P98A 3MHSD 5D94A 4IG7B 3Q3FA 4J6IA 2C7MB 2KX0A 2LXAA 2DYBA 1GNUA 2MBHA 2C60A 3GOEA 1SIFA 3ZUNA 3ECIA 1EO6A 3QARA 4NJ6A 4HDQA 2KNBA 4LDTD 2C7HA 1WF9A 3KUZA 2KK8A 4GOCA 4DHJD 2JPHA 4JL9A 1I35A 4PYUA 1UELA 4DWFA 4WJPA 1C1YB 5KHOA 4TUUA 1S3SG 3L16A 2MLBA 4IW0A 2FIFA 3VXWA 2C7NB 1D3ZA 3IHPC 2DHZA 1WXVA 2KDIA 4PS3A 2L76A 1EF5A 2KFKB 2MBBB 3R7RA 4LCDE 3DBSA 1RAXA 1Y8RC 3AU5A 4K7UA 1RRBA 3W1SC 4AWJA 4ANXA 3DPDA 4KDIC 3VVWB 1TBEA 2LVOA 3DCGA 2EMSA 2JF5A 1WGDA 3ZTDA 1P1AA 3JSVA 3SDLC 2BYFA 4KIKA 4W9IA 2JY6A 2JRHA 3T8MA 3PPAA 4WWOA 2CU1A 1WM2A 3TJPA 2MCNB 3B0AA 2R2OA 2RGFA 4FJYA 3ZIMA 2CHZA 3PHWB 2G4DB 3PTFC 4MJSA 2DENB 4NQKE 2KJRA 4EUTA 3RD2A 2GOWA 5HKHA 1E7UA 4WQOB 1WJNA 1X1MA 2KO3A 4GU2A 4AJWA 2D11A 4EOYA 3QIJA 3BY4B 3ZLZA 3UINB 2JT4B 4I6PA 2DAFA 3RUIB 2O2VA 5CHFA 2FIDA 2ZJDA 4FLHA 5E6OA 3BINA 2O6VA 4GB9A 1E8YA 2KKCA 3HIZA 4KSLC 1ISNA 2V4LA 1E90A 1UGMA 3L0WB 2K6DB 4K81A 2GBNA 4ZDVA 1IPGA 5G55A 3WAMA 2XEWA 1GUAB 2YVCA 4DXAB 4MGZE 3PRZA 3H1UA 2IO1B 4FJZA 3L08A 4LJOB 1LXDA 5FR6A 3RZWC 4TQ0A 1E5WA 2FCQA 2KOXA 4WAAA 3TBLD 4GGQA 4B9KA 3OJ3A 1UH6A 4K7SA 5L83A 3VFKA 3ZNGC 3HHMA 3R7QA 2L0TA 3CMMB 1T0YA 3EHVA 2ZVOA 3T9LA 2KHWB 4LDTB 3L17A 3VH4B 3VUWA 4BKSD 4MSQB 2GBJA 2UWQA 3V6EB 3VHTC 2B3AA 3A4RA 2Z0DB 1WXAA 3TCAA 5J2RA 4JGHB 2J0MA 2IY1B 4EZLA 2ZZPB 3TL5A 1Z5SB 3M63B 3UGBB 5C23A 3ZNHB 4GIVA 2CHXA 2Y5BB 4HPMB 4KIKB 1P9DU 4RM8A 2ZPNA 4HLEA 2L05A 1WFYA 3AXCA 1WXSA 4NNJB 3DOWA 2LD9A 3OLMD 3UIOB 4M8MA 2KTRB 4ICVA 1R4NI 1FXTB 1H4RA 2LVPA 2M8SA 2KWCA 4JLCA 2N1VA 3W1YA 1J19A 4KDLB 1OGWA 1OTRB 3RYTA 3MJWA 3VTWA 2K8CA 3PV1A 1WX8A 2MBQA 4WJQA 2RD0A 2AEHA 2Z59B 1V5TA 3S2AA 4ANUA 4EEWA 4E3CA 3ZDTA 1EF1A 4W9LA 4MM3A 2JRIB 4ICUA 3C0RB 2FAZA 2N9XA 1WR1A 2DYMA 2NBUA 3ZDMC 4IM3A 1I42A 1WI0A 5DPWA 3MTNB 4MGIE 1TTNA 3PREA 4DDGD 2CR5A 3JSVB 1G6JA 2MA9B 1WY8A 3IBEA 3VQIA 1WZ3A 5G2NA 2MP2A 1L2NA 2PJHA 1M94A 2V3SA 4BOZB 3NY5A 3NZUA 4NJ7A 3VAWA 3WALA 2LWPA 3PSEB 2JVCA 2JZ3B 4W9JA 5LXHA 4G50A 4URKA 2WX0A 5DPSA 4JQWC 4PS8A 2JUOA 1CMXB 5LLIA 4BOSC 1OEYA 4ZRKA 2IBIB 5D2MB 2FCNA 2KDEB 2KQSA 1WGRA 2CS4A 1NDDA 3PT2B 4OVVA 5DCNA 5AZHA 2LRWA 3VTUA 2D07B 2MP2B 2M4NA 3QX1A 3UQBA 1L7YA 3Q3JA 2KQ7A 2O6VD 2RR9A 3L10B 2L3ZA 4K1RB 3CF6E 1GJZA 2N7DA 1OEYJ 2MSED 4IWPA 3RCZA 4FADA 5D6JB 2ZNVC 4MGYE 4ANVA 1UZXB 1WYWB 3O65B 3M3JA 4X57B 3UIPB 2LRUA 1V49A 3V61A 3A4SC 2KJHB 3OAWA 4IUMB 5JHAA 3DVNV 1VD2A 3EC8A 2PPHA 2DZMA 2GBMA 2DZKA 2JXXA 2LI5A 4HPLB 4KVGB 4PS7A 2FCSA 2IYDB 2VRRB 1NI2A 1P0RA 3PRMB 2BYEA 2L0FA 4W9DA 2BKRB 4EZJA 4ASWC 4DHJB 2ZCCA 2AWTA 3APCA 3A1QA 3R3MA 3N30A 4NQLB 1WGGA 2RPQA 4HDOA 4W9EA 5TR5A 5J17A 3KYDD 4F7ZA 1RFAA 1V2YA 1A5RA 4RM9A 4EKUA 2M1MA 2EMTA 1ZW7A 3P2BA 3QJZA 3ZKJC 2ZNVB 3A9KB 2L8JA 3H7SA 1ZKHA 2BPSA 1Q5WB 2KMAA 4W9CA 3U30A 4IWOA 3LDZE 4BBNC 1Q0WB 2K1FA 2JZZA 1UD7A 3QAQA 1KLVA 2KLCA 1WX9A 2NPTB 4G0NB 4EFOA 1LM8B 1UBIA 3LJ3A 1YX6B 4BKGA 5E6NA 4BBNF 1S1QB 2FCMA 4IWQA 5CHVC 2C5LC 2KZRA 2J7QB 2EKEC 3KUCB 3N3KB 4ZRIA 2RSUA 4A3OA 3ONSA 2FUHB 1E8WA 3ZRFA 1V81A 4A3PA 2A5UA 3ENEA 3APFA 2N4FA 3QC8B 3VTVA 1WM3A 4BKSA 2KLGA 1V6EA 2BGFA 4E74A 2LVQA 4HWIB 5D7GA 2K25A 3DDCB 1E8XA 2KD0A 4AJYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SHQ A;  2GBR A;  4FHK A;  2WWZ A;  3DVG X;  1J8C A;  4F8C B;  2KVR A;  2HD5 B;  1UBQ A;  1WR6 E;  4DHZ B;  3ZNI D;  1WJU A;  4KZ0 A;  4GXB A;  1WE6 A;  2L00 B;  4GN1 A;  4HK2 A;  2GMI C;  4KV2 A;  1IYF A;  2HJ8 A;  2G4S A;  3QK0 A;  2NBW B;  4IM2 A;  3K9O B;  4W9F A;  2KAN A;  5JHB A;  2KJ6 A;  3H7P B;  3JW0 X;  3U7D A;  3QWZ B;  4F1S A;  2KMC A;  4GDK A;  4BVU C;  3ZNZ B;  3W1S A;  3H7P A;  1WGY A;  3N32 A;  2NCN A;  4ZYN A;  2N9P C;  1OQY A;  2G45 B;  1XD3 B;  4AOF A;  3HM3 A;  2REX A;  3TMP B;  4JIO U;  5AZG A;  1WE7 A;  1WH3 A;  2DAJ A;  2NPT A;  3H9D A;  3ML8 A;  3ZRC A;  2HTH A;  3CST A;  2ASQ A;  1XT9 B;  2PEA A;  4CO7 A;  1V86 A;  2OJR A;  3KUD B;  3DVG Y;  3NZS A;  4M0W B;  2HE7 A;  1NBF C;  2I1J A;  3EFU A;  5CHW A;  2DX5 B;  5AZF A;  1LQB A;  4MDK E;  5IAA C;  4NY0 A;  3M95 A;  2BWE S;  3WAO A;  4B95 A;  3DQV A;  4E71 A;  1BT0 A;  3NHE B;  3KYC D;  2KFK A;  3ML9 A;  2IO2 B;  4NAW A;  2KN5 A;  3A1Q B;  1EUV B;  3JYU A;  4DDI D;  2MX2 A;  4HCP B;  1WRD B;  2BWF A;  2W9N A;  4FJV B;  3WIM A;  3QHT A;  2KXJ A;  3DBL I;  1E8Z A;  2IY0 B;  4GMV A;  4FBJ B;  1TZ1 A;  4HJK A;  2N9E B;  4MEL A;  4DK5 A;  4II3 B;  4WWP A;  3V6C B;  3ZW3 A;  1MG8 A;  2M0X A;  2PE9 A;  3U8Z A;  5KHQ A;  4BFR A;  2XBB C;  4TV3 A;  4AUQ C;  4OVU A;  2CHW A;  1PQS A;  1KJT A;  5AEK B;  2BYV E;  4G3X B;  4W9H A;  2ZEQ A;  4WJN A;  3ALB A;  3DVN U;  2IZV B;  4NAW B;  2KWU B;  2NR2 A;  5JZE B;  4MH0 E;  5JH5 C;  3UF8 A;  1GG3 A;  1V80 A;  4RMA A;  4TKN A;  4M8N A;  1R4M I;  2KC2 A;  1QZE A;  4ANW A;  2IO0 B;  5IA7 A;  3KW5 B;  2A4Z A;  4FA6 A;  4CYE A;  4HVB A;  4MSM B;  1XQQ A;  1Q1O A;  1V5O A;  2FNJ B;  3HK0 A;  2KTF A;  4LJP B;  4GSW A;  3V62 A;  4HCN B;  2GBK A;  3ZTC A;  2R2Q A;  3D32 A;  2J0J A;  3JVZ X;  4YL8 A;  2DZI A;  3KH0 A;  2ZPY A;  3PZD A;  1WGH A;  2XK5 A;  2QHO A;  4N9F 4;  1F9J A;  1J0G A;  1KOT A;  1WMH A;  1WIA A;  3PVL A;  2MW5 A;  2BKF A;  4NPN A;  3WAP A;  4CHK A;  2KFJ A;  5L95 C;  2NBV B;  4GDK B;  3RZF A;  2MWS B;  3ZVV A;  1GC6 A;  1TGZ B;  3ZO5 B;  3L54 A;  3DBR I;  2C9W B;  5DPR A;  4XC2 A;  1Z2M A;  1KM7 A;  3RT3 B;  3X23 A;  5C1Z A;  2L7R A;  2MBO A;  2KDF B;  4XZ4 A;  2K39 A;  2LZ6 A;  3VUY A;  3A33 B;  2N1W A;  3APD A;  2ZVN A;  2K6Q A;  2IO3 B;  1WJ6 A;  3PLV A;  2XK5 B;  4IC7 B;  2WYQ A;  4G11 A;  4KZC A;  2O6V B;  3PRP B;  4B6W A;  2CKH B;  1VCB A;  2M17 A;  3IFW B;  1AAR A;  2O2V B;  3X0W A;  3NOB A;  2LAS A;  2AYO B;  3WA0 A;  4A20 A;  2LGY A;  4PYZ A;  1YD8 U;  2KTR A;  4FN2 A;  3KVF B;  2D2Q A;  4ZRJ A;  2NS5 A;  1P3Q U;  4GDL A;  1SE9 A;  3QQ8 B;  1YQB A;  1JRU A;  2KDB A;  3M62 B;  5E6P A;  3UQA A;  3A9J A;  3AU4 A;  3PHX B;  3B08 A;  4DHZ E;  2BF8 B;  2KC1 A;  3IVF A;  2DZJ A;  4MGK E;  3R66 C;  2OOB B;  3L13 A;  3AI5 A;  5EDS A;  2AL3 A;  1IP9 A;  2MRP A;  3VH3 B;  1HE8 A;  5CTR C;  3TIX A;  4GDL B;  5CX3 A;  4K7W A;  4P7I A;  5GMV A;  2G3Q B;  3A9K A;  3DBH I;  2MQJ A;  4KSK C;  4XX5 A;  5DPT A;  4AP4 C;  2LGX A;  4WWN A;  1RLF A;  1LFD A;  3HM6 X;  1H8C A;  3IG3 A;  2NVU I;  1YX5 B;  2I1K A;  4W9G A;  2LJ5 A;  4IM0 A;  1C3T A;  3H6N A;  4BKT A;  3QCA A;  4I6N B;  1E7V A;  2DYO A;  2Z0E B;  4DBG A;  5LXI B;  2LGD A;  2D3G A;  4WJO A;  1YJ1 A;  2PE6 B;  3WAN A;  4MEM A;  5BO4 B;  4HXD A;  3GZN I;  3I3T B;  3OJ4 B;  1ZGU B;  3PLU A;  2WDT B;  2WX1 A;  4FUL A;  3SD5 A;  2ZCB A;  5J18 A;  3SU8 X;  1U4A A;  2K8B A;  2V1Y A;  1K8R B;  2LUE A;  4I6L B;  2LXC A;  4II2 B;  1SGH A;  1WJ4 A;  2AL6 A;  1WMH B;  4EZK A;  2UYZ B;  3A9J B;  1V9J A;  3NS8 A;  3VDZ A;  4TQ1 A;  2JWZ A;  3CSF A;  3K9P B;  2J0K A;  1WX7 A;  1GC7 A;  2K8H A;  2D10 A;  4W9K A;  1WZ0 A;  4FHJ A;  2YLM A;  3EEC A;  3QA8 A;  3RUL A;  3V60 A;  3B1L X;  2KWV B;  3AUL A;  3VUX A;  4MJS B;  3PGE A;  1YIW A;  2MBE A;  3PS6 A;  1WXM A;  2N7E A;  2KX3 A;  1P98 A;  3MHS D;  5D94 A;  4IG7 B;  3Q3F A;  4J6I A;  2C7M B;  2KX0 A;  2LXA A;  2DYB A;  1GNU A;  2MBH A;  2C60 A;  3GOE A;  1SIF A;  3ZUN A;  3ECI A;  1EO6 A;  3QAR A;  4NJ6 A;  4HDQ A;  2KNB A;  4LDT D;  2C7H A;  1WF9 A;  3KUZ A;  2KK8 A;  4GOC A;  4DHJ D;  2JPH A;  4JL9 A;  1I35 A;  4PYU A;  1UEL A;  4DWF A;  4WJP A;  1C1Y B;  5KHO A;  4TUU A;  1S3S G;  3L16 A;  2MLB A;  4IW0 A;  2FIF A;  3VXW A;  2C7N B;  1D3Z A;  3IHP C;  2DHZ A;  1WXV A;  2KDI A;  4PS3 A;  2L76 A;  1EF5 A;  2KFK B;  2MBB B;  3R7R A;  4LCD E;  3DBS A;  1RAX A;  1Y8R C;  3AU5 A;  4K7U A;  1RRB A;  3W1S C;  4AWJ A;  4ANX A;  3DPD A;  4KDI C;  3VVW B;  1TBE A;  2LVO A;  3DCG A;  2EMS A;  2JF5 A;  1WGD A;  3ZTD A;  1P1A A;  3JSV A;  3SDL C;  2BYF A;  4KIK A;  4W9I A;  2JY6 A;  2JRH A;  3T8M A;  3PPA A;  4WWO A;  2CU1 A;  1WM2 A;  3TJP A;  2MCN B;  3B0A A;  2R2O A;  2RGF A;  4FJY A;  3ZIM A;  2CHZ A;  3PHW B;  2G4D B;  3PTF C;  4MJS A;  2DEN B;  4NQK E;  2KJR A;  4EUT A;  3RD2 A;  2GOW A;  5HKH A;  1E7U A;  4WQO B;  1WJN A;  1X1M A;  2KO3 A;  4GU2 A;  4AJW A;  2D11 A;  4EOY A;  3QIJ A;  3BY4 B;  3ZLZ A;  3UIN B;  2JT4 B;  4I6P A;  2DAF A;  3RUI B;  2O2V A;  5CHF A;  2FID A;  2ZJD A;  4FLH A;  5E6O A;  3BIN A;  2O6V A;  4GB9 A;  1E8Y A;  2KKC A;  3HIZ A;  4KSL C;  1ISN A;  2V4L A;  1E90 A;  1UGM A;  3L0W B;  2K6D B;  4K81 A;  2GBN A;  4ZDV A;  1IPG A;  5G55 A;  3WAM A;  2XEW A;  1GUA B;  2YVC A;  4DXA B;  4MGZ E;  3PRZ A;  3H1U A;  2IO1 B;  4FJZ A;  3L08 A;  4LJO B;  1LXD A;  5FR6 A;  3RZW C;  4TQ0 A;  1E5W A;  2FCQ A;  2KOX A;  4WAA A;  3TBL D;  4GGQ A;  4B9K A;  3OJ3 A;  1UH6 A;  4K7S A;  5L83 A;  3VFK A;  3ZNG C;  3HHM A;  3R7Q A;  2L0T A;  3CMM B;  1T0Y A;  3EHV A;  2ZVO A;  3T9L A;  2KHW B;  4LDT B;  3L17 A;  3VH4 B;  3VUW A;  4BKS D;  4MSQ B;  2GBJ A;  2UWQ A;  3V6E B;  3VHT C;  2B3A A;  3A4R A;  2Z0D B;  1WXA A;  3TCA A;  5J2R A;  4JGH B;  2J0M A;  2IY1 B;  4EZL A;  2ZZP B;  3TL5 A;  1Z5S B;  3M63 B;  3UGB B;  5C23 A;  3ZNH B;  4GIV A;  2CHX A;  2Y5B B;  4HPM B;  4KIK B;  1P9D U;  4RM8 A;  2ZPN A;  4HLE A;  2L05 A;  1WFY A;  3AXC A;  1WXS A;  4NNJ B;  3DOW A;  2LD9 A;  3OLM D;  3UIO B;  4M8M A;  2KTR B;  4ICV A;  1R4N I;  1FXT B;  1H4R A;  2LVP A;  2M8S A;  2KWC A;  4JLC A;  2N1V A;  3W1Y A;  1J19 A;  4KDL B;  1OGW A;  1OTR B;  3RYT A;  3MJW A;  3VTW A;  2K8C A;  3PV1 A;  1WX8 A;  2MBQ A;  4WJQ A;  2RD0 A;  2AEH A;  2Z59 B;  1V5T A;  3S2A A;  4ANU A;  4EEW A;  4E3C A;  3ZDT A;  1EF1 A;  4W9L A;  4MM3 A;  2JRI B;  4ICU A;  3C0R B;  2FAZ A;  2N9X A;  1WR1 A;  2DYM A;  2NBU A;  3ZDM C;  4IM3 A;  1I42 A;  1WI0 A;  5DPW A;  3MTN B;  4MGI E;  1TTN A;  3PRE A;  4DDG D;  2CR5 A;  3JSV B;  1G6J A;  2MA9 B;  1WY8 A;  3IBE A;  3VQI A;  1WZ3 A;  5G2N A;  2MP2 A;  1L2N A;  2PJH A;  1M94 A;  2V3S A;  4BOZ B;  3NY5 A;  3NZU A;  4NJ7 A;  3VAW A;  3WAL A;  2LWP A;  3PSE B;  2JVC A;  2JZ3 B;  4W9J A;  5LXH A;  4G50 A;  4URK A;  2WX0 A;  5DPS A;  4JQW C;  4PS8 A;  2JUO A;  1CMX B;  5LLI A;  4BOS C;  1OEY A;  4ZRK A;  2IBI B;  5D2M B;  2FCN A;  2KDE B;  2KQS A;  1WGR A;  2CS4 A;  1NDD A;  3PT2 B;  4OVV A;  5DCN A;  5AZH A;  2LRW A;  3VTU A;  2D07 B;  2MP2 B;  2M4N A;  3QX1 A;  3UQB A;  1L7Y A;  3Q3J A;  2KQ7 A;  2O6V D;  2RR9 A;  3L10 B;  2L3Z A;  4K1R B;  3CF6 E;  1GJZ A;  2N7D A;  1OEY J;  2MSE D;  4IWP A;  3RCZ A;  4FAD A;  5D6J B;  2ZNV C;  4MGY E;  4ANV A;  1UZX B;  1WYW B;  3O65 B;  3M3J A;  4X57 B;  3UIP B;  2LRU A;  1V49 A;  3V61 A;  3A4S C;  2KJH B;  3OAW A;  4IUM B;  5JHA A;  3DVN V;  1VD2 A;  3EC8 A;  2PPH A;  2DZM A;  2GBM A;  2DZK A;  2JXX A;  2LI5 A;  4HPL B;  4KVG B;  4PS7 A;  2FCS A;  2IYD B;  2VRR B;  1NI2 A;  1P0R A;  3PRM B;  2BYE A;  2L0F A;  4W9D A;  2BKR B;  4EZJ A;  4ASW C;  4DHJ B;  2ZCC A;  2AWT A;  3APC A;  3A1Q A;  3R3M A;  3N30 A;  4NQL B;  1WGG A;  2RPQ A;  4HDO A;  4W9E A;  5TR5 A;  5J17 A;  3KYD D;  4F7Z A;  1RFA A;  1V2Y A;  1A5R A;  4RM9 A;  4EKU A;  2M1M A;  2EMT A;  1ZW7 A;  3P2B A;  3QJZ A;  3ZKJ C;  2ZNV B;  3A9K B;  2L8J A;  3H7S A;  1ZKH A;  2BPS A;  1Q5W B;  2KMA A;  4W9C A;  3U30 A;  4IWO A;  3LDZ E;  4BBN C;  1Q0W B;  2K1F A;  2JZZ A;  1UD7 A;  3QAQ A;  1KLV A;  2KLC A;  1WX9 A;  2NPT B;  4G0N B;  4EFO A;  1LM8 B;  1UBI A;  3LJ3 A;  1YX6 B;  4BKG A;  5E6N A;  4BBN F;  1S1Q B;  2FCM A;  4IWQ A;  5CHV C;  2C5L C;  2KZR A;  2J7Q B;  2EKE C;  3KUC B;  3N3K B;  4ZRI A;  2RSU A;  4A3O A;  3ONS A;  2FUH B;  1E8W A;  3ZRF A;  1V81 A;  4A3P A;  2A5U A;  3ENE A;  3APF A;  2N4F A;  3QC8 B;  3VTV A;  1WM3 A;  4BKS A;  2KLG A;  1V6E A;  2BGF A;  4E74 A;  2LVQ A;  4HWI B;  5D7G A;  2K25 A;  3DDC B;  1E8X A;  2KD0 A;  4AJY B; 
#chains in the Genus database with same CATH topology
 4FHK A;  2WWZ A;  1J8C A;  4F8C B;  2KVR A;  2HD5 B;  3KWV A;  1UBQ A;  1L4Z B;  2XNA C;  1WE6 A;  2L00 B;  1HTQ A;  2GMI C;  1IYF A;  1KRH A;  2G4S A;  4W9F A;  2KAN A;  3H7P B;  2KN4 A;  4OZA A;  4F1S A;  4BVU C;  3ZNZ B;  3H7P A;  1OQY A;  2G45 B;  5T8I A;  3TMP B;  4JIO U;  3ZJV A;  1NI3 A;  2WXH A;  3MP9 A;  2ASQ A;  2AQ2 B;  1V86 A;  4M0W B;  2HE7 A;  3IT6 B;  2LFI A;  1I4H A;  5AZF A;  3I5J C;  2G9H D;  2LGS A;  3NHE B;  1EU3 A;  4DDI D;  1WRD B;  3BWU D;  1CQV A;  2KXJ A;  2ONQ A;  4WIP A;  2N9E B;  3DBR B;  1MG8 A;  2N9L A;  1VRA B;  3U2S C;  5KHQ A;  1PQS A;  3AED B;  3ZXV A;  1PGB A;  3ALB A;  2IZV B;  2KWU B;  2NR2 A;  3MC0 B;  4TKN A;  1R4M I;  1UGJ A;  4MAC A;  2A4Z A;  4FA6 A;  3CIR B;  4MSM B;  2MHJ A;  4ITK A;  3HK0 A;  2KTF A;  3V62 A;  4AS1 A;  3ZTC A;  3AEC B;  4YL8 A;  2DZI A;  3PZD A;  3W2D A;  2QHO A;  1F9J A;  1J0G A;  1KOT A;  1L5P A;  2BKF A;  5L95 C;  1HA5 A;  1TS5 A;  1GC6 A;  5H92 C;  3L54 A;  3DBR I;  4J3O D;  4XC2 A;  3RT3 B;  2L7R A;  5BMG A;  3VUY A;  1HXY D;  4P16 A;  1I4G A;  3PLV A;  2XK5 B;  4IC7 B;  2WYQ A;  1L0V B;  2WDQ B;  2KAJ A;  1QQR A;  3PRP B;  3URY A;  2CKH B;  2M17 A;  4ARC A;  3X0W A;  4HPP A;  3NOB A;  3N20 C;  4ZRJ A;  2BT6 A;  2GI9 A;  1P3Q U;  2UU7 A;  2KDB A;  1SJE D;  3B08 A;  1ZDV A;  2KC1 A;  4XDD A;  2D3B A;  4MGK E;  2J4X A;  3AI5 A;  2AL3 A;  2MRP A;  3TIX A;  4GDL B;  4K7W A;  3A9K A;  2WXJ A;  2MQJ A;  1DOX A;  1IUE A;  5DPT A;  3B2G A;  1VR9 A;  1L0Y B;  2LJ5 A;  3H6N A;  1QT9 A;  4I6N B;  4DBG A;  5LXI B;  2LGD A;  4WJO A;  2CJN A;  3R8B A;  3WAN A;  5BO4 B;  4HXD A;  1L4D B;  2CU3 A;  2WDT B;  4FUL A;  5G5H A;  2K8B A;  1MG4 A;  1HZ5 A;  2AL6 A;  1R4N B;  1AN8 A;  3NS8 A;  3VDZ A;  4TQ1 A;  2JWZ A;  2J0K A;  1WZ0 A;  2YLM A;  3V60 A;  2KWV B;  3AUL A;  3VUX A;  4MJS B;  1YIW A;  4PK1 A;  4KGS A;  5HI1 A;  2BB6 A;  1P98 A;  3MHS D;  3Q3F A;  2PVO D;  4J6I A;  2KX0 A;  2LXA A;  4Q2J A;  2LUM A;  3GOE A;  2PMV A;  4LDT D;  4GOC A;  2JPH A;  4RGT A;  2WDR B;  4DWF A;  2NMQ A;  5KHO A;  1S3S G;  2EEL A;  2MLB A;  2FIF A;  3GZN B;  1D3Z A;  4PS3 A;  1WXV A;  2KDI A;  2J52 A;  3AE8 B;  4LTU A;  4C7Z A;  4DXF A;  4K7U A;  1RAX A;  1Y8R C;  3W1S C;  1TBE A;  2EMS A;  3ZTD A;  1D4B A;  1YJI A;  1P1A A;  4NJC A;  2X38 A;  3SDL C;  2QC8 A;  4WWO A;  3P63 A;  3TJP A;  3B0A A;  3NVY A;  1HZ6 A;  2YEP B;  3ZIM A;  2CHZ A;  1F2R C;  3PTF C;  3NVZ A;  4WH4 A;  2D5G A;  1MFW A;  3VR9 B;  3TEZ A;  4GU2 A;  1VJK A;  3ZLZ A;  4C56 C;  1QLB B;  2VH1 A;  4I6P A;  5AUI A;  2DAF A;  2PW9 A;  3AEE B;  2FID A;  2KQ4 X;  1YOV B;  4KX6 B;  5E6O A;  3HIZ A;  3NS1 A;  1ISN A;  2JZP A;  2V4L A;  3L0W B;  1EM7 A;  2K6D B;  2H89 B;  2M0A A;  2GBN A;  5G55 A;  4C00 A;  1N6Z A;  2QCZ A;  2M19 A;  2IO1 B;  3H1U A;  5EE3 A;  3L08 A;  4LJO B;  4TQ0 A;  2LMC A;  3RZW C;  4GGQ A;  2BBC A;  3HHM A;  3R7Q A;  3ABV B;  2KHW B;  2BYT A;  1I4Q A;  3W9C B;  3VUW A;  1K51 A;  1XLN A;  4MSQ B;  1XLO A;  1AWD A;  1XF5 L;  2WDV B;  2D3A A;  3AEF B;  2UWQ A;  3VHT C;  1D6E C;  2J53 A;  2B3A A;  4KGT A;  4A9A A;  4EZL A;  2ZZP B;  1ENF A;  1KLG D;  1WGK A;  1T0R C;  1WFY A;  3ZJU A;  2IDY A;  2D3C A;  4M8M A;  2KTR B;  2WXR A;  4JLC A;  2N1V A;  3EUB 2;  1N61 A;  3GP7 A;  4RH6 A;  1OTR B;  3VTW A;  1NYQ A;  2PKO A;  2MBQ A;  2OJW A;  4M00 A;  1OQR A;  1V5T A;  3S2A A;  2WP9 B;  4W9L A;  3ZDM C;  3DHI C;  3JSV B;  2MA9 B;  3RI7 C;  2WXI A;  1AYF A;  1P7E A;  4N58 A;  4US9 A;  3NY5 A;  3NZU A;  3VAW A;  3PSE B;  4W9J A;  1TZO A;  3TEY A;  5DPS A;  3I57 A;  1OEY A;  4ZRK A;  5DCN A;  5AZH A;  2LRW A;  2M4N A;  2WXO A;  4GLS C;  2O6V D;  2RR9 A;  3BK2 A;  1V1P A;  2N7D A;  5D6J B;  2ZNV C;  4MGY E;  2MEK A;  4NZL B;  3AN1 A;  3IAM 1;  3UIP B;  2WNM A;  4DXG A;  2PPH A;  2JXX A;  3FC4 A;  2FCS A;  2JYE A;  2HJ1 A;  3C19 A;  4W9D A;  1YQ3 B;  1QIL A;  4EZJ A;  2AWT A;  3APC A;  1OFF A;  2RPQ A;  5FK9 C;  2M1M A;  3QJZ A;  3ZKJ C;  2ZNV B;  3A9K B;  2L8J A;  2JSV X;  3P42 A;  2Y3A A;  1RFK A;  2K1F A;  1UD7 A;  1L6U A;  2KLC A;  3Q8F A;  4EFO A;  4A90 A;  2WXM A;  2AQ3 B;  2N0S B;  1FCC C;  3P4S B;  1QOF A;  2EKE C;  2RSU A;  1WXQ A;  3ZRF A;  1C4A A;  3ENE A;  4BKS A;  1V6E A;  4E74 A;  5D7G A;  3IHP C;  5J18 A;  4M0W A;  3ZXR A;  4RGN A;  3E56 A;  1WR6 E;  4DHZ B;  4AQ7 A;  2TSS A;  3ZNI D;  4MT5 A;  1C79 A;  1V1P B;  3ETR A;  3QK0 A;  1TJE A;  2KYW A;  4IM2 A;  3PZ8 A;  1YN3 A;  3QWZ B;  4FXC A;  4GDK A;  3W1S A;  3N32 A;  1IGC A;  1QOA A;  2N9P C;  2QEJ C;  1SSN A;  4XYC A;  3P4Q B;  5AZG A;  1WH3 A;  2DAJ A;  1FRR A;  2NPT A;  3ML8 A;  2HTH A;  1FM0 D;  4RF1 A;  1V8C A;  1LQB A;  5IAA C;  2BWE S;  4B95 A;  2IGG A;  3LB8 C;  2IO2 B;  3JYU A;  1GAQ B;  4FJV B;  3WIM A;  3DBL I;  1TZ1 A;  1TT5 B;  4A6Q A;  4DK5 A;  4II3 B;  4WWP A;  3ZW3 A;  1QOB A;  1D5Z C;  1NYR A;  4BFR A;  4AUQ C;  4OVU A;  3V05 A;  2IND C;  2CJO A;  1KJT A;  1I4X A;  2BYV E;  5IKC M;  2ZEQ A;  4P6V F;  4NAW B;  4MH0 E;  3UF8 A;  1GG3 A;  4ARI A;  1V80 A;  1E0Z A;  1IBX A;  2XN9 C;  4CYE A;  1Q1O A;  4K3C A;  4LJP B;  1UWM A;  4HCN B;  1YN5 A;  4C4V A;  1KFY B;  1WGH A;  4N9F 4;  1WMH A;  1WIA A;  5IO9 A;  4CHK A;  3RZF A;  1TGZ B;  3ZO5 B;  2V9H A;  2C9W B;  1YQ4 B;  1KM7 A;  2MBO A;  2KDF B;  2QIE B;  2K39 A;  1N60 A;  2ZVN A;  3N9Y C;  2IO3 B;  1JAL A;  4DQO C;  2O6V B;  2WGS A;  2HTM E;  1JRO A;  1DOI A;  1K50 A;  2O2V B;  2LAS A;  4A20 A;  3U7Z A;  2LGY A;  1YD8 U;  2KTR A;  3ZYY X;  2R61 A;  3KVF B;  3RNF C;  5D3I B;  4BZA A;  4GDL A;  1SE9 A;  2JU6 X;  3R2I A;  3A9J A;  1XLQ A;  3I63 C;  1YNT E;  2DZJ A;  5IP4 D;  5EDS A;  2WU2 B;  1HE8 A;  3C8Y A;  3DBH B;  2G3Q B;  3DBH I;  4KSK C;  4XX5 A;  3VRB B;  4YTN B;  1H8C A;  2WS3 B;  1C3T A;  4BKT A;  4XWT A;  1C4P A;  2DYO A;  1UNS A;  2D3G A;  4XGA B;  3AE4 B;  2PE6 B;  4LNK A;  4MEM A;  1ZGU B;  3PLU A;  4JWU C;  2ZCB A;  3SU8 X;  1K8R B;  2LUE A;  2DWQ A;  3N1Z C;  4II2 B;  1WJ4 A;  1WMH B;  3GE3 C;  4C80 A;  2UYZ B;  3EA6 A;  1WX7 A;  1GC7 A;  2K8H A;  4W9K A;  1F0Z A;  2MBE A;  3UI3 A;  1WXM A;  1IBX B;  2KX3 A;  3MJ5 A;  2NTT A;  1JWM D;  2DYB A;  4YSY B;  2WHI A;  2MBH A;  2C60 A;  1SIF A;  1QOG A;  4DHJ D;  3NG0 A;  2Y5P A;  3AE2 B;  4PYU A;  2JQR B;  3J9C A;  3OG5 A;  2VZK B;  4IW0 A;  2C7N B;  1QKZ A;  2DHZ A;  2M56 B;  4WAF A;  2MBB B;  3R7R A;  3U4E G;  4ANX A;  4YSZ B;  4KIK A;  2JY6 A;  3T8M A;  2MCN B;  3BZD B;  2RGF A;  2K3U A;  1J7C A;  2L1A A;  4MJS A;  2IGH A;  3RD2 A;  2GOW A;  4L2Y A;  2BTE A;  3QIJ A;  2DBY A;  2V0G A;  2JWU A;  2JT4 B;  1JWS D;  5CHF A;  1NVI D;  4A55 A;  4KSL C;  4OW0 A;  4K81 A;  3MFG A;  2WU5 B;  3WAM A;  1GUA B;  2KVZ A;  1E5W A;  4B9K A;  3VFK A;  3ZNG C;  3Q8A A;  3CMM B;  3L4P A;  3EHV A;  5MPO A;  2ZVO A;  1XXG A;  2SEB D;  1JRP A;  3A4R A;  5IOI A;  1WXA A;  3GS2 A;  4RFB A;  1TKG A;  3M63 B;  5HHD G;  5C23 A;  4M02 A;  2CHX A;  1P9D U;  1R7S A;  5AUK A;  4NNJ B;  3DOW A;  1EU4 A;  3UIO B;  4ICV A;  1FXT B;  1H4R A;  1UUP A;  2M8S A;  3W1Y A;  3AE5 B;  2QSD A;  4KDL B;  2MH7 A;  3MJW A;  2K8C A;  2PVG C;  4TMA B;  1WX8 A;  3TUO A;  4EEW A;  4E3C A;  3ZDT A;  1EF1 A;  5TSS A;  4LNI A;  2FAZ A;  2N9X A;  2DYM A;  4IM3 A;  3MTN B;  4MGI E;  3PRE A;  2CR5 A;  3VQI A;  5G2N A;  1L2N A;  2PJH A;  1M94 A;  3N1X C;  4NJ7 A;  3WAL A;  4ZRP A;  2LWP A;  2JVC A;  2JXT A;  1TY2 A;  2JZ3 B;  3ZQ4 A;  5LXH A;  1T6B X;  2WX0 A;  3B2F A;  5LLI A;  2E6X A;  1ZPS A;  2IBI B;  1OQQ A;  4R3D A;  3Q3O C;  2ACZ B;  2FCN A;  2KDE B;  3IAS 1;  1WGR A;  3PT2 B;  1FPY A;  3VTU A;  2BS3 B;  2ON8 A;  3AE3 B;  3ZGZ A;  1L7Y A;  3Q8B A;  1FO4 A;  1TYG B;  2KQ7 A;  2Q5W D;  1C4C A;  3L10 B;  3CF6 E;  2QIL A;  4FAD A;  1RYJ A;  3BVG A;  3M3J A;  1V49 A;  3V61 A;  3VRA B;  5JHA A;  2IJ0 A;  1A70 A;  1VD2 A;  3DVN V;  2DZM A;  2LI5 A;  4HPL B;  1PDX A;  2IYD B;  2PTL A;  2BYE A;  4IDI A;  1J7A A;  2BKR B;  4O1N A;  5G5G A;  4DHJ B;  4NQL B;  3A1Q A;  1A5R A;  1RFA A;  1V2Y A;  4YTP B;  2EMT A;  3P2B A;  2BPS A;  4W9C A;  1HEZ E;  4BBN C;  1ZE3 D;  3BYT B;  1KLV A;  1LM8 B;  3Q8C A;  5H8Y E;  2FCM A;  2KDM A;  2INP E;  4IWQ A;  2FUH B;  4A3P A;  3APF A;  2N4F A;  1WM3 A;  4IKG A;  2K25 A;  1FNW A;  1E8X A;  2GBR A;  3DVG X;  4L23 A;  2GRI A;  3PZ7 A;  1WJU A;  2V4I B;  4KZ0 A;  4GXB A;  4RCO A;  4GN1 A;  4HK2 A;  2HJ8 A;  5JHB A;  2NBW B;  3U7D A;  3DHG C;  2KMC A;  2NCN A;  4ZYN A;  1SE3 A;  1E10 A;  1WE7 A;  3H9D A;  3CST A;  1J7B A;  4KKJ A;  5EE1 A;  2MJD A;  3TEX A;  3DVG Y;  3NZS A;  5GXG B;  2I1J A;  3EFU A;  5CHW A;  3Q2A C;  3EGR A;  2MJ3 A;  5BMH A;  4MDK E;  4NY0 A;  3WAO A;  4E71 A;  3KYC D;  5BYR A;  3ML9 A;  2MX2 A;  4HCP B;  2BWF A;  2W9N A;  3MHZ A;  3QHT A;  4GMV A;  4FBJ B;  2RDH A;  2M0X A;  2W3R A;  2XBB C;  3AE7 B;  4TV3 A;  1T0Q C;  4W9H A;  1MVK A;  4WJN A;  1I7H A;  3DVN U;  2K9X A;  1FXA A;  5JZE B;  5JH5 C;  4M8N A;  2KC2 A;  5IA7 A;  3AB5 A;  1XQQ A;  1V5O A;  2FNJ B;  4GSW A;  3W5V B;  3D32 A;  1CZP A;  3JVZ X;  3DWM A;  2ZPY A;  3TEW A;  2X8X X;  1N62 A;  4LNF A;  2KFJ A;  2MWS B;  3ZVV A;  4EE2 A;  1ZOY B;  1Z2M A;  1MI0 A;  3X23 A;  1L6V A;  3A33 B;  2N1W A;  1UF0 A;  2ZW1 A;  3SEB A;  5JXV A;  2FUG 1;  2AYO B;  2WXG A;  5I4D A;  2D2Q A;  1JW9 D;  3QQ8 B;  1I4R A;  1YQB A;  1JRU A;  3PHX B;  1QF6 A;  1F1H A;  2BF8 B;  2W54 A;  3R66 C;  2OOB B;  3L13 A;  1JWU D;  4ZYS A;  1E7P B;  3OWE B;  1IP9 A;  5C2T B;  4B0M A;  3VH3 B;  1P7F A;  5CX3 A;  2JYT A;  4P7I A;  5GMV A;  4WWN A;  1LFD A;  3HM6 X;  1YX5 B;  2I1K A;  4W9G A;  1GB4 A;  5EE9 A;  3QCA A;  1E7V A;  2Z0E B;  1YJJ A;  4OZC A;  4ACF A;  1YJ1 A;  4L1B A;  3TSS A;  3OJ4 B;  3KLS X;  3SD5 A;  2Z8L A;  1U4A A;  2N9K A;  4MH8 A;  2NTS A;  4I6L B;  1SGH A;  4EZK A;  3A9J B;  2D10 A;  4FHJ A;  3B1L X;  3NVV A;  1XEE A;  1YN4 A;  3I9V 1;  3PS6 A;  2N7E A;  1XLP A;  4IG7 B;  2C7M B;  3IT4 B;  2INC C;  4US8 A;  1C78 A;  1SF0 A;  4HJG E;  1GNU A;  1ET6 A;  2KAC A;  3ECI A;  2BVC A;  4HDQ A;  4NJ6 A;  1N63 A;  1LO5 D;  2SAK A;  2C7H A;  1WF9 A;  4XE0 A;  1I35 A;  2WXP A;  1UEL A;  1R4M B;  3LXF A;  1I4P A;  2QDF A;  2W82 A;  3L16 A;  4JX1 C;  3P4P B;  1DYQ A;  1FIQ A;  2OED A;  4OZB A;  1RWS A;  2K0P A;  1SE2 A;  4LCD E;  4AWJ A;  3DPD A;  1VLB A;  3VVW B;  1MPE A;  3DCG A;  1FMA D;  2JF5 A;  2L83 A;  2RDG A;  4WQM A;  3JSV A;  1TS2 A;  2BYF A;  4RNA A;  3B9J A;  3PPA A;  1ET9 A;  4P1C C;  1JML A;  4P1B C;  3PHW B;  1K53 A;  2G4D B;  4NQK E;  2DEN B;  4EUT A;  5HKH A;  1E7U A;  1WJN A;  1X1M A;  1JWB D;  1VZ6 A;  4EOY A;  3BY4 B;  2OHF A;  2QMT A;  3RUI B;  4YSX B;  2ZJD A;  4FLH A;  1AW7 A;  3BIN A;  2L52 A;  2KKC A;  1E90 A;  1UGM A;  1C9F A;  1MHX A;  1IPG A;  1PGA A;  2XEW A;  3AE9 B;  4MGZ E;  3DBL B;  4DXA B;  1D5X C;  4FJZ A;  2EKI A;  1LXD A;  5FR6 A;  4ZHP A;  2FCQ A;  4WAA A;  3TBL D;  3NRZ A;  1UH6 A;  2BQQ A;  1N5X A;  5LNK 1;  2H88 B;  1E6E B;  3L17 A;  4BKS D;  1TS3 A;  4M01 A;  3MC9 A;  1FRD A;  3V6E B;  3AEG B;  1DOY A;  3TCA A;  5J2R A;  2J0M A;  2IY1 B;  3TL5 A;  4B0E A;  1Z5S B;  2WXF A;  1CK1 A;  3ZNH B;  4GIV A;  4BAX A;  4RM8 A;  2ZPN A;  4HLE A;  2L05 A;  3AXC A;  3KWL A;  2LD9 A;  3OLM D;  4HRO A;  1R4N I;  2HDE A;  1J19 A;  2KT7 A;  3H8H A;  4WJQ A;  2RD0 A;  4ANU A;  2E3T A;  2I38 A;  4MM3 A;  4ICU A;  1BXT A;  4UDU C;  2K5P A;  1I42 A;  1ZXH A;  3RNE C;  1TTN A;  3DHH C;  1WY8 A;  1WZ3 A;  2MP2 A;  2V3S A;  1HQR D;  4JQW C;  1V1O A;  1IGD A;  4PS8 A;  1CMX B;  1EWY C;  3AE1 B;  5D2M B;  1ZXI A;  1NEK B;  2LHE A;  1ACC A;  2D07 B;  1SB3 C;  1MHH E;  2V3N A;  2ICI A;  2ZW0 A;  5IN7 A;  2L3Z A;  4K1R B;  4RF0 A;  3HRD D;  4IWP A;  2RDB C;  3RCZ A;  2JX5 A;  4ANV A;  3O65 B;  4X57 B;  1SE4 A;  2LRU A;  1TIF A;  3AE6 B;  2KJH B;  3OAW A;  3U52 E;  2AQ1 B;  4USA A;  3EC8 A;  4PS7 A;  2GBM A;  2DZK A;  2VRR B;  1NI2 A;  1P0R A;  3PRM B;  2I2Y A;  2ZCC A;  4ZRQ A;  4S0R A;  3N30 A;  5TR5 A;  5J17 A;  4W9E A;  3NJT A;  2IPK D;  1GOZ A;  3KYD D;  4F7Z A;  3RFZ B;  4RM9 A;  4EKU A;  2B76 B;  1ZW7 A;  2RMM A;  2W3S A;  3MC8 A;  2VZK D;  1Q5W B;  1FFU A;  2KMA A;  3U30 A;  4HKQ A;  2JZZ A;  3QAQ A;  5C3J B;  3HVD A;  1YMH E;  1UBI A;  4REZ A;  3LJ3 A;  1FD6 A;  1STE A;  4S17 A;  3CWI A;  3BYY B;  5CHV C;  2C5L C;  2J7Q B;  3KUC B;  3N3K B;  4YWG G;  4ZRI A;  3ONS A;  1V81 A;  1K52 A;  1N5W A;  3AEB B;  3VTV A;  4CQN A;  1FNV A;  3PO0 A;  1FFV A;  2KLG A;  2IGD A;  4HWI B;  3DDC B;  3KH0 A;  2KD0 A;  2LEK A;  3SHQ A;  2KWD A;  1XCQ L;  1FCL A;  4KV2 A;  3K9O B;  2KJ6 A;  3JW0 X;  3NUH B;  4KKI A;  1WGY A;  1XD3 B;  4K3B A;  4AOF A;  1T3Q A;  1M4V A;  3HM3 A;  2REX A;  4C4V B;  3ZRC A;  1EWC A;  1GB1 A;  5FR3 A;  1XT9 B;  2PEA A;  4CO7 A;  2OJR A;  3GE8 C;  1JCK B;  3KUD B;  4N59 A;  5EE0 A;  4N6E B;  1NBF C;  4XDC A;  1TS4 A;  1ZDX A;  2DX5 B;  3T3O A;  3M95 A;  1SJH D;  4C7Y A;  3DQV A;  1BT0 A;  2KFK A;  4NAW A;  2KN5 A;  3A1Q B;  1EUV B;  3W5U B;  1E8Z A;  2IY0 B;  4MEL A;  4HJK A;  1B1Z A;  3IXS A;  3AV8 A;  3V6C B;  3BVM A;  2J42 A;  5BMI A;  2PE9 A;  3U8Z A;  2WXL A;  1B9R A;  1VZ8 A;  1Y56 A;  2CHW A;  5AEK B;  1FEH A;  4G3X B;  4JWS C;  3R2T A;  4JE3 B;  2VH2 A;  1KH0 A;  1C76 A;  4WUR A;  1ZP0 B;  4RMA A;  1BUI C;  1VDV A;  1QZE A;  4ANW A;  2IO0 B;  3KW5 B;  4HVB A;  3BVZ A;  2KMM A;  3RNG C;  2GBK A;  2R2Q A;  2J0J A;  3E9S A;  2XK5 A;  2WQY B;  2N7J A;  3PVL A;  2MW5 A;  4NPN A;  5HG2 A;  3WAP A;  2NBV B;  4GDK B;  1SBB B;  1ROE A;  1WSP A;  2FE8 A;  3NZ3 A;  5DPR A;  3RPF C;  5C1Z A;  4XZ4 A;  2LZ6 A;  3APD A;  2K6Q A;  1WJ6 A;  4KZC A;  4G11 A;  4LLG M;  4B6W A;  1VCB A;  3IFW B;  2INN E;  1AAR A;  3WA0 A;  4NAM A;  4PYZ A;  4FN2 A;  4QAY A;  1PYW D;  2NS5 A;  4LK0 M;  1L0X B;  1ESF A;  3M62 B;  5E6P A;  3UQA A;  2GLS A;  3AU4 A;  4DHZ E;  2LGI A;  3IVF A;  1SEB D;  3NVW A;  4HRS A;  5FKA C;  5CTR C;  1SIJ A;  4KGR A;  2WXQ A;  4AP4 C;  2LGX A;  1RLF A;  3AH7 A;  3IG3 A;  2NVU I;  4IM0 A;  3FIL B;  1FNU A;  1TKE A;  1WWT A;  4YT0 B;  3Q6B A;  1F77 A;  3FKY A;  4RGM A;  3RNC C;  3GZN I;  2FBW B;  3I3T B;  3ZJT A;  3SFD B;  2WX1 A;  1NEN B;  4ZOH C;  2V1Y A;  1T5X D;  4HKZ E;  2LXC A;  3RMK C;  1JWA D;  3HUI A;  4XWW A;  2WLB A;  1V9J A;  5BYS A;  3CSF A;  4IOI E;  3K9P B;  3RNA C;  1KLU D;  3EEC A;  3QA8 A;  3RUL A;  2GB1 A;  3PGE A;  5D3D A;  2PLP A;  3AM9 A;  3P4R B;  5D94 A;  2WXK A;  1GPX A;  1F52 A;  3AMZ A;  3ZUN A;  3QAR A;  1EO6 A;  3GB1 A;  4LNN A;  3P1M A;  2KNB A;  3KUZ A;  2KK8 A;  4JL9 A;  3SFE B;  1ZUD 2;  4WJP A;  1HTO A;  1C1Y B;  4TUU A;  1XO3 A;  2MJE A;  1F2R I;  3VXW A;  4YTM B;  2L76 A;  1EF5 A;  2KFK B;  3DBS A;  3AU5 A;  4OHJ A;  1RRB A;  1PUT A;  4KDI C;  2LVO A;  2BB5 A;  1WGD A;  1WYG A;  3AEA B;  1WRI A;  4W9I A;  2JRH A;  2V3P A;  2CU1 A;  1T0S C;  1TKY A;  1TY0 A;  1WM2 A;  1KTK A;  2R2O A;  4FJY A;  1V97 A;  2KJR A;  3BII D;  4WQO B;  2KO3 A;  4AJW A;  2D11 A;  2L32 A;  3UIN B;  2G1E A;  2O2V A;  3SR6 A;  3V3X A;  1PGX A;  2O6V A;  2RPV A;  4GB9 A;  1E8Y A;  5E6J A;  3Q3M C;  4ZDV A;  3O13 A;  1UWX A;  2YVC A;  3PRZ A;  4H2A A;  2YEP F;  2KOX A;  4A8X C;  3OJ3 A;  4K7S A;  5L83 A;  1FXI A;  3KQ4 A;  4ZHO A;  2L0T A;  4TSS A;  1T0Y A;  3T9L A;  4LDT B;  3VH4 B;  3N1Y C;  2GBJ A;  1C77 A;  4RGO S;  2Z0D B;  1CJE A;  2BS2 B;  1SXT A;  4JGH B;  1LGR A;  3UGB B;  1MJD A;  1KF6 B;  2Y5B B;  4HPM B;  4KIK B;  1WXS A;  4YXD B;  2LVP A;  2KWC A;  1OGW A;  3RYT A;  1E9M A;  4HEA 1;  1PFD A;  3PV1 A;  1JQ4 A;  2AEH A;  2Z59 B;  3FAH A;  3Q14 C;  2JRI B;  1XCT L;  3C0R B;  1WR1 A;  2NBU A;  2QJL A;  1WI0 A;  5DPW A;  4DDG D;  1G6J A;  3IBE A;  4BOZ B;  4D2K A;  4G50 A;  4URK A;  1VZ7 A;  2JUO A;  4BOS C;  1BML C;  2KQS A;  4OVV A;  2CS4 A;  1NDD A;  2K22 A;  3Q8E A;  2MP2 B;  3QX1 A;  3UQB A;  3Q3J A;  3WCQ A;  1D5M C;  3RNB C;  1GJZ A;  5HFY A;  1OEY J;  2MSE D;  1DGJ A;  1UZX B;  2AX5 A;  1WYW B;  4MM3 B;  3DWG C;  3A4S C;  4IUM B;  4OVZ A;  3LYY A;  2BW2 A;  4KVG B;  2LHD A;  2DLB A;  2W55 A;  2L0F A;  4ASW C;  3R3M A;  1WGG A;  4HDO A;  3Q3N C;  5BYQ A;  2LJI A;  3EFC A;  3H7S A;  1ZKH A;  4LNO A;  3RN9 C;  4IWO A;  4WWM A;  2BS4 B;  3T3N A;  3LDZ E;  1Q0W B;  4JPS A;  1Q10 A;  1WX9 A;  2NPT B;  4G0N B;  2PIA A;  2WXN A;  2Y5C A;  1YX6 B;  4BKG A;  3BK1 A;  5E6N A;  4BBN F;  3FIL A;  1S1Q B;  3HVZ A;  2KZR A;  4PT5 A;  4A3O A;  3Q69 A;  1E8W A;  2DNF A;  2A5U A;  1RM6 C;  3VR8 B;  3QC8 B;  2BGF A;  2LVQ A;  4AJY B; 
#chains in the Genus database with same CATH homology
 3SHQ A;  2GBR A;  4FHK A;  2WWZ A;  3DVG X;  1J8C A;  4F8C B;  2KVR A;  2HD5 B;  1UBQ A;  1WR6 E;  4DHZ B;  3ZNI D;  1WJU A;  4KZ0 A;  4GXB A;  1WE6 A;  2L00 B;  4GN1 A;  4HK2 A;  2GMI C;  4KV2 A;  1IYF A;  2HJ8 A;  2G4S A;  3QK0 A;  2NBW B;  4IM2 A;  3K9O B;  4W9F A;  2KAN A;  5JHB A;  2KJ6 A;  3H7P B;  3JW0 X;  3U7D A;  3QWZ B;  4F1S A;  2KMC A;  4GDK A;  4BVU C;  3ZNZ B;  3W1S A;  3H7P A;  1WGY A;  3N32 A;  2NCN A;  4ZYN A;  2N9P C;  1OQY A;  2G45 B;  1XD3 B;  4AOF A;  3HM3 A;  2REX A;  3TMP B;  4JIO U;  5AZG A;  1WE7 A;  1WH3 A;  2DAJ A;  2NPT A;  3H9D A;  3ML8 A;  3ZRC A;  2HTH A;  3CST A;  2ASQ A;  1XT9 B;  2PEA A;  4CO7 A;  1V86 A;  2OJR A;  3KUD B;  3DVG Y;  3NZS A;  4M0W B;  2HE7 A;  1NBF C;  2I1J A;  3EFU A;  5CHW A;  2DX5 B;  5AZF A;  1LQB A;  4MDK E;  5IAA C;  4NY0 A;  3M95 A;  2BWE S;  3WAO A;  4B95 A;  3DQV A;  4E71 A;  1BT0 A;  3NHE B;  3KYC D;  2KFK A;  3ML9 A;  2IO2 B;  4NAW A;  2KN5 A;  3A1Q B;  1EUV B;  3JYU A;  4DDI D;  2MX2 A;  4HCP B;  1WRD B;  2BWF A;  2W9N A;  4FJV B;  3WIM A;  3QHT A;  2KXJ A;  3DBL I;  1E8Z A;  2IY0 B;  4GMV A;  4FBJ B;  1TZ1 A;  4HJK A;  2N9E B;  4MEL A;  4DK5 A;  4II3 B;  4WWP A;  3V6C B;  3ZW3 A;  1MG8 A;  2M0X A;  2PE9 A;  3U8Z A;  5KHQ A;  4BFR A;  2XBB C;  4TV3 A;  4AUQ C;  4OVU A;  2CHW A;  1PQS A;  1KJT A;  5AEK B;  2BYV E;  4G3X B;  4W9H A;  2ZEQ A;  4WJN A;  3ALB A;  3DVN U;  2IZV B;  4NAW B;  2KWU B;  2NR2 A;  5JZE B;  4MH0 E;  5JH5 C;  3UF8 A;  1GG3 A;  1V80 A;  4RMA A;  4TKN A;  4M8N A;  1R4M I;  2KC2 A;  1QZE A;  4ANW A;  2IO0 B;  5IA7 A;  3KW5 B;  2A4Z A;  4FA6 A;  4CYE A;  4HVB A;  4MSM B;  1XQQ A;  1Q1O A;  1V5O A;  2FNJ B;  3HK0 A;  2KTF A;  4LJP B;  4GSW A;  3V62 A;  4HCN B;  2GBK A;  3ZTC A;  2R2Q A;  3D32 A;  2J0J A;  3JVZ X;  4YL8 A;  2DZI A;  3KH0 A;  2ZPY A;  3PZD A;  1WGH A;  2XK5 A;  2QHO A;  4N9F 4;  1F9J A;  1J0G A;  1KOT A;  1WMH A;  1WIA A;  3PVL A;  2MW5 A;  2BKF A;  4NPN A;  3WAP A;  4CHK A;  2KFJ A;  5L95 C;  2NBV B;  4GDK B;  3RZF A;  2MWS B;  3ZVV A;  1GC6 A;  1TGZ B;  3ZO5 B;  3L54 A;  3DBR I;  2C9W B;  5DPR A;  4XC2 A;  1Z2M A;  1KM7 A;  3RT3 B;  3X23 A;  5C1Z A;  2L7R A;  2MBO A;  2KDF B;  4XZ4 A;  2K39 A;  2LZ6 A;  3VUY A;  3A33 B;  2N1W A;  3APD A;  2ZVN A;  2K6Q A;  2IO3 B;  1WJ6 A;  3PLV A;  2XK5 B;  4IC7 B;  2WYQ A;  4G11 A;  4KZC A;  2O6V B;  3PRP B;  4B6W A;  2CKH B;  1VCB A;  2M17 A;  3IFW B;  1AAR A;  2O2V B;  3X0W A;  3NOB A;  2LAS A;  2AYO B;  3WA0 A;  4A20 A;  2LGY A;  4PYZ A;  1YD8 U;  2KTR A;  4FN2 A;  3KVF B;  2D2Q A;  4ZRJ A;  2NS5 A;  1P3Q U;  4GDL A;  1SE9 A;  3QQ8 B;  1YQB A;  1JRU A;  2KDB A;  3M62 B;  5E6P A;  3UQA A;  3A9J A;  3AU4 A;  3PHX B;  3B08 A;  4DHZ E;  2BF8 B;  2KC1 A;  3IVF A;  2DZJ A;  4MGK E;  3R66 C;  2OOB B;  3L13 A;  3AI5 A;  5EDS A;  2AL3 A;  1IP9 A;  2MRP A;  3VH3 B;  1HE8 A;  5CTR C;  3TIX A;  4GDL B;  5CX3 A;  4K7W A;  4P7I A;  5GMV A;  2G3Q B;  3A9K A;  3DBH I;  2MQJ A;  4KSK C;  4XX5 A;  5DPT A;  4AP4 C;  2LGX A;  4WWN A;  1RLF A;  1LFD A;  3HM6 X;  1H8C A;  3IG3 A;  2NVU I;  1YX5 B;  2I1K A;  4W9G A;  2LJ5 A;  4IM0 A;  1C3T A;  3H6N A;  4BKT A;  3QCA A;  4I6N B;  1E7V A;  2DYO A;  2Z0E B;  4DBG A;  5LXI B;  2LGD A;  2D3G A;  4WJO A;  1YJ1 A;  2PE6 B;  3WAN A;  4MEM A;  5BO4 B;  4HXD A;  3GZN I;  3I3T B;  3OJ4 B;  1ZGU B;  3PLU A;  2WDT B;  2WX1 A;  4FUL A;  3SD5 A;  2ZCB A;  5J18 A;  3SU8 X;  1U4A A;  2K8B A;  2V1Y A;  1K8R B;  2LUE A;  4I6L B;  2LXC A;  4II2 B;  1SGH A;  1WJ4 A;  2AL6 A;  1WMH B;  4EZK A;  2UYZ B;  3A9J B;  1V9J A;  3NS8 A;  3VDZ A;  4TQ1 A;  2JWZ A;  3CSF A;  3K9P B;  2J0K A;  1WX7 A;  1GC7 A;  2K8H A;  2D10 A;  4W9K A;  1WZ0 A;  4FHJ A;  2YLM A;  3EEC A;  3QA8 A;  3RUL A;  3V60 A;  3B1L X;  2KWV B;  3AUL A;  3VUX A;  4MJS B;  3PGE A;  1YIW A;  2MBE A;  3PS6 A;  1WXM A;  2N7E A;  2KX3 A;  1P98 A;  3MHS D;  5D94 A;  4IG7 B;  3Q3F A;  4J6I A;  2C7M B;  2KX0 A;  2LXA A;  2DYB A;  1GNU A;  2MBH A;  2C60 A;  3GOE A;  1SIF A;  3ZUN A;  3ECI A;  1EO6 A;  3QAR A;  4NJ6 A;  4HDQ A;  2KNB A;  4LDT D;  2C7H A;  1WF9 A;  3KUZ A;  2KK8 A;  4GOC A;  4DHJ D;  2JPH A;  4JL9 A;  1I35 A;  4PYU A;  1UEL A;  4DWF A;  4WJP A;  1C1Y B;  5KHO A;  4TUU A;  1S3S G;  3L16 A;  2MLB A;  4IW0 A;  2FIF A;  3VXW A;  2C7N B;  1D3Z A;  3IHP C;  2DHZ A;  1WXV A;  2KDI A;  4PS3 A;  2L76 A;  1EF5 A;  2KFK B;  2MBB B;  3R7R A;  4LCD E;  3DBS A;  1RAX A;  1Y8R C;  3AU5 A;  4K7U A;  1RRB A;  3W1S C;  4AWJ A;  4ANX A;  3DPD A;  4KDI C;  3VVW B;  1TBE A;  2LVO A;  3DCG A;  2EMS A;  2JF5 A;  1WGD A;  3ZTD A;  1P1A A;  3JSV A;  3SDL C;  2BYF A;  4KIK A;  4W9I A;  2JY6 A;  2JRH A;  3T8M A;  3PPA A;  4WWO A;  2CU1 A;  1WM2 A;  3TJP A;  2MCN B;  3B0A A;  2R2O A;  2RGF A;  4FJY A;  3ZIM A;  2CHZ A;  3PHW B;  2G4D B;  3PTF C;  4MJS A;  2DEN B;  4NQK E;  2KJR A;  4EUT A;  3RD2 A;  2GOW A;  5HKH A;  1E7U A;  4WQO B;  1WJN A;  1X1M A;  2KO3 A;  4GU2 A;  4AJW A;  2D11 A;  4EOY A;  3QIJ A;  3BY4 B;  3ZLZ A;  3UIN B;  2JT4 B;  4I6P A;  2DAF A;  3RUI B;  2O2V A;  5CHF A;  2FID A;  2ZJD A;  4FLH A;  5E6O A;  3BIN A;  2O6V A;  4GB9 A;  1E8Y A;  2KKC A;  3HIZ A;  4KSL C;  1ISN A;  2V4L A;  1E90 A;  1UGM A;  3L0W B;  2K6D B;  4K81 A;  2GBN A;  4ZDV A;  1IPG A;  5G55 A;  3WAM A;  2XEW A;  1GUA B;  2YVC A;  4DXA B;  4MGZ E;  3PRZ A;  3H1U A;  2IO1 B;  4FJZ A;  3L08 A;  4LJO B;  1LXD A;  5FR6 A;  3RZW C;  4TQ0 A;  1E5W A;  2FCQ A;  2KOX A;  4WAA A;  3TBL D;  4GGQ A;  4B9K A;  3OJ3 A;  1UH6 A;  4K7S A;  5L83 A;  3VFK A;  3ZNG C;  3HHM A;  3R7Q A;  2L0T A;  3CMM B;  1T0Y A;  3EHV A;  2ZVO A;  3T9L A;  2KHW B;  4LDT B;  3L17 A;  3VH4 B;  3VUW A;  4BKS D;  4MSQ B;  2GBJ A;  2UWQ A;  3V6E B;  3VHT C;  2B3A A;  3A4R A;  2Z0D B;  1WXA A;  3TCA A;  5J2R A;  4JGH B;  2J0M A;  2IY1 B;  4EZL A;  2ZZP B;  3TL5 A;  1Z5S B;  3M63 B;  3UGB B;  5C23 A;  3ZNH B;  4GIV A;  2CHX A;  2Y5B B;  4HPM B;  4KIK B;  1P9D U;  4RM8 A;  2ZPN A;  4HLE A;  2L05 A;  1WFY A;  3AXC A;  1WXS A;  4NNJ B;  3DOW A;  2LD9 A;  3OLM D;  3UIO B;  4M8M A;  2KTR B;  4ICV A;  1R4N I;  1FXT B;  1H4R A;  2LVP A;  2M8S A;  2KWC A;  4JLC A;  2N1V A;  3W1Y A;  1J19 A;  4KDL B;  1OGW A;  1OTR B;  3RYT A;  3MJW A;  3VTW A;  2K8C A;  3PV1 A;  1WX8 A;  2MBQ A;  4WJQ A;  2RD0 A;  2AEH A;  2Z59 B;  1V5T A;  3S2A A;  4ANU A;  4EEW A;  4E3C A;  3ZDT A;  1EF1 A;  4W9L A;  4MM3 A;  2JRI B;  4ICU A;  3C0R B;  2FAZ A;  2N9X A;  1WR1 A;  2DYM A;  2NBU A;  3ZDM C;  4IM3 A;  1I42 A;  1WI0 A;  5DPW A;  3MTN B;  4MGI E;  1TTN A;  3PRE A;  4DDG D;  2CR5 A;  3JSV B;  1G6J A;  2MA9 B;  1WY8 A;  3IBE A;  3VQI A;  1WZ3 A;  5G2N A;  2MP2 A;  1L2N A;  2PJH A;  1M94 A;  2V3S A;  4BOZ B;  3NY5 A;  3NZU A;  4NJ7 A;  3VAW A;  3WAL A;  2LWP A;  3PSE B;  2JVC A;  2JZ3 B;  4W9J A;  5LXH A;  4G50 A;  4URK A;  2WX0 A;  5DPS A;  4JQW C;  4PS8 A;  2JUO A;  1CMX B;  5LLI A;  4BOS C;  1OEY A;  4ZRK A;  2IBI B;  5D2M B;  2FCN A;  2KDE B;  2KQS A;  1WGR A;  2CS4 A;  1NDD A;  3PT2 B;  4OVV A;  5DCN A;  5AZH A;  2LRW A;  3VTU A;  2D07 B;  2MP2 B;  2M4N A;  3QX1 A;  3UQB A;  1L7Y A;  3Q3J A;  2KQ7 A;  2O6V D;  2RR9 A;  3L10 B;  2L3Z A;  4K1R B;  3CF6 E;  1GJZ A;  2N7D A;  1OEY J;  2MSE D;  4IWP A;  3RCZ A;  4FAD A;  5D6J B;  2ZNV C;  4MGY E;  4ANV A;  1UZX B;  1WYW B;  3O65 B;  3M3J A;  4X57 B;  3UIP B;  2LRU A;  1V49 A;  3V61 A;  3A4S C;  2KJH B;  3OAW A;  4IUM B;  5JHA A;  3DVN V;  1VD2 A;  3EC8 A;  2PPH A;  2DZM A;  2GBM A;  2DZK A;  2JXX A;  2LI5 A;  4HPL B;  4KVG B;  4PS7 A;  2FCS A;  2IYD B;  2VRR B;  1NI2 A;  1P0R A;  3PRM B;  2BYE A;  2L0F A;  4W9D A;  2BKR B;  4EZJ A;  4ASW C;  4DHJ B;  2ZCC A;  2AWT A;  3APC A;  3A1Q A;  3R3M A;  3N30 A;  4NQL B;  1WGG A;  2RPQ A;  4HDO A;  4W9E A;  5TR5 A;  5J17 A;  3KYD D;  4F7Z A;  1RFA A;  1V2Y A;  1A5R A;  4RM9 A;  4EKU A;  2M1M A;  2EMT A;  1ZW7 A;  3P2B A;  3QJZ A;  3ZKJ C;  2ZNV B;  3A9K B;  2L8J A;  3H7S A;  1ZKH A;  2BPS A;  1Q5W B;  2KMA A;  4W9C A;  3U30 A;  4IWO A;  3LDZ E;  4BBN C;  1Q0W B;  2K1F A;  2JZZ A;  1UD7 A;  3QAQ A;  1KLV A;  2KLC A;  1WX9 A;  2NPT B;  4G0N B;  4EFO A;  1LM8 B;  1UBI A;  3LJ3 A;  1YX6 B;  4BKG A;  5E6N A;  4BBN F;  1S1Q B;  2FCM A;  4IWQ A;  5CHV C;  2C5L C;  2KZR A;  2J7Q B;  2EKE C;  3KUC B;  3N3K B;  4ZRI A;  2RSU A;  4A3O A;  3ONS A;  2FUH B;  1E8W A;  3ZRF A;  1V81 A;  4A3P A;  2A5U A;  3ENE A;  3APF A;  2N4F A;  3QC8 B;  3VTV A;  1WM3 A;  4BKS A;  2KLG A;  1V6E A;  2BGF A;  4E74 A;  2LVQ A;  4HWI B;  5D7G A;  2K25 A;  3DDC B;  1E8X A;  2KD0 A;  4AJY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...