2C9WB

Crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
b'DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPPRESSOR OF CYTOKINE SIGNALING 2
molecule tags Transcription regulation
source organism Homo sapiens
publication title Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
pubmed doi rcsb
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c9wB00
1P98A 2KQ7A 1WZ3A 2G3QB 3Q3FA 3ZRCA 3PTFC 1VD2A 3ZIMA 1E5WA 3D32A 2PE6B 3NZSA 4JQWC 5JZEB 4W9HA 3LJ3A 3TBLD 4CYEA 2ZEQA 4A3PA 2O6VD 1G6JA 4GXBA 2KDFB 3NOBA 2BYVE 3NHEB 4DBGA 3A9JA 3UQAA 1KJTA 3ZTDA 2I1KA 1R4MI 4LJOB 2NBVB 3VDZA 3A9KA 1L2NA 2MBQA 4W9LA 4GDKB 4FLHA 4HPLB 4WQOB 3RT3B 5JHAA 1LM8B 1YJ1A 1V5OA 1WRDB 2WWZA 3CMMB 2KO3A 3JSVB 3KW5B 3DBSA 4FULA 4K7SA 3VHTC 3PZDA 2L7RA 4CO7A 2K8CA 3APDA 1Q5WB 4AUQC 2LVQA 2BYEA 3V62A 4URKA 5JH5C 3DPDA 1S1QB 3VUWA 4MH0E 3PRMB 3QHTA 3RD2A 4LDTB 4KVGB 5BO4B 2Z0EB 2JZZA 3DBLI 4WJOA 1OTRB 1NI2A 2BWES 3KYDD 1RRBA 2JZ3B 2BKFA 1M94A 1WJUA 3QARA 4WJNA 3JVZX 1LQBA 3KUDB 4GB9A 5C23A 2MA9B 4HVBA 4ZRJA 3PRPB 1J0GA 3DQVA 4GU2A 1WH3A 3U7DA 5C1ZA 3QIJA 4BBNF 2G45B 2OJRA 3PV1A 4GSWA 1EO6A 3ML9A 2D3GA 2N9XA 2KX0A 3VH4B 2FNJB 3A4RA 1UD7A 3AXCA 4BOZB 3QWZB 4CHKA 1OEYJ 4TKNA 4WWPA 4E3CA 1OQYA 1ISNA 2G4SA 1L7YA 2JRHA 3ZDMC 5JHBA 2LASA 4IUMB 2KMAA 1E8XA 4G3XB 3W1SA 4F7ZA 2KXJA 3APFA 3VQIA 3K9OB 4MGYE 2KDIA 2A4ZA 4FBJB 2K25A 2MBHA 5TR5A 2K1FA 3S2AA 2REXA 4BVUC 3A9JB 2MBBB 2NBUA 3X0WA 2LWPA 2JWZA 2CHZA 1Z5SB 4ZRKA 5LXHA 3KUCB 1WX8A 2EKEC 1WJNA 3DVGX 5G2NA 4NQKE 3ZKJC 4GDKA 2AL6A 2JF5A 3HM6X 3ONSA 2KJ6A 4M8MA 1WR1A 2K6DB 3T8MA 1C1YB 2FIFA 2MSED 5IA7A 1T0YA 3PVLA 3C0RB 1GG3A 2AEHA 2FCNA 1WIAA 2ZPYA 5LLIA 3PHXB 5E6PA 1MG8A 4WJQA 3RULA 4AJYB 4BKSD 2L0TA 2VRRB 1J8CA 2C60A 2DZJA 3RCZA 2IO1B 1IPGA 3SHQA 3ZVVA 3QA8A 2ZVNA 2D11A 3EHVA 4KIKA 3VAWA 1H8CA 4IM0A 1WJ6A 2DZIA 2KNBA 2DENB 2GBNA 3ZTCA 2DYMA 3EC8A 4HK2A 4MJSB 3L16A 3AI5A 2KDBA 2J0JA 4G0NB 2KMCA 2V4LA 3EFUA 3ZRFA 3W1YA 2KLGA 2DYOA 4WWNA 4KSLC 4P7IA 2KLCA 2DZKA 3BINA 4NJ6A 3L08A 3KH0A 4ANVA 4MSMB 4MJSA 5KHOA 3V60A 2K6QA 3QCAA 2W9NA 4MGZE 1FXTB 3V6CB 3PGEA 1E8ZA 1Q1OA 1IP9A 2N1VA 3UF8A 2C5LC 2LRUA 1EUVB 1E7VA 2KD0A 3A1QB 3M3JA 1EF5A 3HK0A 1RLFA 1AARA 4NNJB 1Q0WB 2ZVOA 1WY8A 2AYOB 1GUAB 2GBMA 4HDOA 3TL5A 2MQJA 2GBJA 1TBEA 2KK8A 3KUZA 4MEMA 1LXDA 4PS7A 4DHJD 1R4NI 2RGFA 3WANA 3WIMA 2RD0A 2G4DB 1OGWA 2M0XA 3V6EB 1JRUA 5EDSA 2JY6A 5AZGA 3RUIB 4MELA 2FIDA 2IZVB 4KZCA 4RM9A 3M63B 2B3AA 2ZJDA 1WGDA 2Z59B 4W9CA 1CMXB 3WAPA 4BOSC 3ML8A 1E90A 1V6EA 1ZW7A 4PYZA 4XX5A 3QQ8B 2FUHB 4KDLB 2NPTB 3O65B 3AU4A 5E6NA 4W9GA 4BKSA 2J7QB 1WI0A 2BGFA 3NS8A 1WXSA 4LCDE 3JYUA 4LJPB 5LXIB 3DCGA 4HCNB 2IO3B 4M8NA 2KC1A 4TUUA 2V1YA 4W9DA 3ZNHB 3GOEA 2C7MB 4KIKB 3V61A 4BBNC 5CHVC 4W9FA 2KOXA 3H7SA 2Y5BB 5E6OA 2L8JA 2ZCCA 5DPWA 4JL9A 1V81A 3M95A 2LZ6A 5J18A 3VXWA 3H6NA 4ZDVA 3R7RA 4NJ7A 5IAAC 3B1LX 4NAWA 3KVFB 1WXAA 1XD3B 1WX9A 2LRWA 3A9KB 1WX7A 2IBIB 1RAXA 2LXCA 2NVUI 3VTWA 2A5UA 2YVCA 2FCMA 2ZCBA 1E8YA 3LDZE 1TTNA 2MW5A 2N7EA 2M1MA 4II3B 4MSQB 3ZO5B 1UELA 2CHWA 3JSVA 2PPHA 1WM3A 2LJ5A 3UINB 2CU1A 2KWVB 4ANWA 3H7PA 2OOBB 2KKCA 4GDLB 4JLCA 3DOWA 4DDGD 4W9KA 1Y8RC 2KTRB 3L0WB 1WMHB 2IO0B 2HTHA 2KC2A 5CHFA 5D6JB 1IYFA 4ZRIA 3ZW3A 2UYZB 2KANA 2L3ZA 1UBIA 4LDTD 3UIOB 3VH3B 2JT4B 2YLMA 3DVNU 2WX1A 4WJPA 2KFKB 4EOYA 4IM3A 2KWCA 3OAWA 4A20A 2GBKA 1BT0A 2FAZA 1V86A 1QZEA 3VTUA 2GBRA 1UZXB 1TGZB 2LGXA 3DBRI 3B08A 2KDEB 3WAMA 2FCQA 3DVGY 3N3KB 4IC7B 5D94A 1ZKHA 1OEYA 3DBHI 3MHSD 4TQ0A 2RSUA 2JVCA 2M17A 2XK5B 2DAFA 4HDQA 2J0MA 2MCNB 1WGGA 2DYBA 1EF1A 4GIVA 2NS5A 3ZNGC 2L0FA 4ASWC 3W1SC 2WYQA 3VUXA 4AP4C 2HJ8A 5L83A 5CHWA 1KOTA 2CKHB 3OJ4B 2ZPNA 2DHZA 5AZHA 4W9IA 3TJPA 1V49A 1NBFC 1WGHA 2N1WA 1S3SG 2RPQA 2RR9A 2K39A 4FJYA 4MGKE 2JRIB 4EKUA 3IFWB 2L05A 2EMTA 4GGQA 5FR6A 3TIXA 2M4NA 3PT2B 2KX3A 2MRPA 4OVUA 1PQSA 2NR2A 3ZDTA 3ECIA 1NDDA 1V9JA 4FHJA 3R7QA 1WE6A 2KTFA 2C7NB 4MDKE 5KHQA 1WXVA 2GOWA 3L10B 2AL3A 4GOCA 2L00B 4K7WA 1P9DU 2MBEA 1WGRA 4KDIC 2MWSB 1E7UA 2HD5B 4MM3A 1UH6A 4KV2A 1C3TA 4IM2A 2PJHA 2L76A 3N30A 1V2YA 3OJ3A 5AEKB 3H7PB 3WA0A 3APCA 1Z2MA 3OLMD 5G55A 4FJVB 2DZMA 2Z0DB 3SU8X 2AWTA 2DAJA 2IYDB 3QAQA 2LUEA 4B9KA 4DWFA 1V80A 2PEAA 4K1RB 3EECA 4I6PA 2CS4A 4XZ4A 1SGHA 4B6WA 3GZNI 4FADA 1F9JA 1V5TA 4IWQA 2K8HA 4EEWA 2NBWB 1ZGUB 2JPHA 2R2OA 3P2BA 3VFKA 2BF8B 3CSTA 2DX5B 3UIPB 2BKRB 4M0WB 4PS8A 2M8SA 2KHWB 2C7HA 5AZFA 3L13A 2O2VB 4W9EA 2MLBA 4XC2A 1WJ4A 4BFRA 3A4SC 3MJWA 3L54A 5D7GA 2KQSA 3L17A 2XK5A 4I6LB 2ZNVC 1KM7A 2D07B 2KFJA 2KVRA 2XEWA 4RM8A 2KN5A 4WAAA 3VTVA 2KJRA 1WMHA 4HWIB 3QX1A 2C9WB 4NQLB 2O2VA 1WGYA 4ZYNA 4EFOA 3H9DA 4X57B 4ANXA 4GMVA 1WXMA 4K7UA 3QJZA 4W9JA 4JGHB 3ALBA 4F8CB 2LVPA 1WM2A 4YL8A 1P3QU 2V3SA 3HIZA 4II2B 1A5RA 4ICUA 4NY0A 4IW0A 4EZLA 2JUOA 4G11A 2MP2A 4MGIE 2N4FA 1KLVA 3ENEA 3N32A 3IHPC 3PSEB 2MBOA 2IY1B 3T9LA 2IY0B 2WDTB 2HE7A 4HJKA 4A3OA 3HHMA 2UWQA 4FA6A 2QHOA 3HM3A 3QK0A 4J6IA 3NZUA 5CTRC 3PHWB 4F1SA 2N9PC 5DPTA 2ASQA 4E74A 1YD8U 2R2QA 1K8RB 1YQBA 1GNUA 4KSKC 3UQBA 2JXXA 1U4AA 1SIFA 1WE7A 2N9EB 3U30A 3R66C 4DXAB 5L95C 2LGYA 4HLEA 1LFDA 3TCAA 4N9F4 4EZKA 4DHZB 4NPNA 1UBQA 4KZ0A 5GMVA 2PE9A 4AWJA 3VUYA 1GC6A 4AOFA 3NY5A 3RZFA 2ZNVB 4ICVA 3CSFA 2O6VB 2CHXA 4BKTA 2KJHB 1TZ1A 4NAWB 4FHKA 3U8ZA 4DHZE 3H1UA 2K8BA 2KWUB 3AULA 4WWOA 2CR5A 2I1JA 4K81A 4IG7B 3ZNZB 4RMAA 3WAOA 3ZUNA 3JW0X 4G50A 2NCNA 1WF9A 4ANUA 4DK5A 4IWOA 2O6VA 1J19A 3I3TB 1I35A 2LI5A 2KZRA 3PLUA 3PLVA 2WX0A 4HXDA 1SE9A 4TV3A 3A33B 3ZLZA 5CX3A 1X1MA 4E71A 1GJZA 4GDLA 1H4RA 3BY4B 3PS6A 3PRZA 4AJWA 1RFAA 4FJZA 3ZNID 3DDCB 2D2QA 5D2MB 3WALA 2KTRA 5DPSA 3X23A 3K9PB 3PREA 1E8WA 3Q3JA 3SD5A 1YIWA 4JIOU 2LXAA 2BPSA 3RZWC 3MTNB 2KFKA 2MX2A 1P1AA 3KYCD 2LGDA 4PS3A 1I42A 3QC8B 3A1QA 4DDID 4EZJA 1WR6E 1XT9B 1WFYA 3DVNV 4IWPA 1WZ0A 2LVOA 4HCPB 1D3ZA 3AU5A 1GC7A 1P0RA 2XBBC 4FN2A 2BYFA 3TMPB 1YX5B 5J17A 3RYTA 1YX6B 5J2RA 1HE8A 2BWFA 2IO2B 3B0AA 3M62B 3IVFA 5DCNA 1WYWB 2EMSA 3R3MA 2N7DA 4BKGA 2GMIC 3IG3A 4HPMB 2LD9A 2MP2B 2ZZPB 4B95A 4GN1A 1UGMA 5DPRA 1XQQA 4DHJB 4I6NB 1VCBA 5HKHA 2FCSA 3SDLC 3IBEA 3VVWB 2D10A 4PYUA 4OVVA 4EUTA 3CF6E 3PPAA 2NPTA 4TQ1A 2J0KA 3UGBB
chains in the Genus database with same CATH superfamily
1P98A 2G3QB 2JYEA 3EGRA 1AW7A 1ENFA 2CJNA 1YN5A 5JZEB 3U52E 1MHHE 4W9HA 3TBLD 1D5MC 2KQ4X 2N9KA 4CYEA 2YEPB 4RH6A 1I4QA 3Q8FA 4DBGA 1TYGB 3UQAA 4LJOB 2SAKA 3HVZA 4YTMB 5H92C 4WQOB 3DBLB 4OZBA 2WWZA 1C77A 4XGAB 3VHTC 4CQNA 1FRRA 2JSVX 4AUQC 3V62A 5JH5C 1S1QB 3PRMB 3RN9C 3NS1A 1ET9A 1N63A 2JZ3B 3W5VB 2BKFA 5C23A 2MA9B 3P4SB 3PRPB 3MC9A 2LGSA 1RWSA 4BZAA 1VR9A 1EO6A 4GSWA 3ML9A 4UDUC 1C76A 2FNJB 3GZNB 2YEPF 3A4RA 4CHKA 1CJEA 2G4SA 2WXMA 3BZDB 4OVZA 2MH7A 4IUMB 2KMAA 3W1SA 4NAMA 3VQIA 3APFA 1PDXA 3K9OB 2A4ZA 2MBHA 2K1FA 4BVUC 2MBBB 2NBUA 1V1PB 3NVZA 3ZJVA 1J7BA 2EKEC 4NQKE 4US8A 3HM6X 1PGAA 1TY0A 2KJ6A 1WR1A 4B0MA 5IN7A 3T8MA 1T0RC 2MSED 3C0RB 1GG3A 5C3JB 4IDIA 1I4PA 3TSSA 3IAS1 1GPXA 1PGBA 4ZRPA 2L0TA 3RPFC 2H88B 1HTQA 2L83A 1WWTA 3P4RB 3AN1A 2MJEA 4KIKA 1QQRA 3VAWA 4IM0A 2KNBA 3TEZA 2IGGA 4G0NB 3Q8CA 2KMCA 3ZRFA 1JCKB 2DYOA 4WWNA 1K51A 1F0ZA 3DHGC 1I4RA 1HA5A 1EU3A 4ANVA 1AN8A 4MJSA 5KHOA 3QCAA 3ZQ4A 4MGZE 4C7YA 1UGJA 3V6CB 1DGJA 2N1VA 4USAA 1EUVB 2PTLA 3HK0A 3M3JA 4M02A 2GBMA 4AQ7A 2AQ3B 1RM6C 1L5PA 2RMMA 4TMAB 2GBJA 1OFFA 4D2KA 2WXJA 4PS7A 1OGWA 3MP9A 4PT5A 1JRUA 2D3AA 2BB5A 4MELA 1WGDA 2Z59B 4C4VB 4PYZA 4XX5A 2FUHB 2KVZA 5E6NA 2J7QB 1WI0A 1FNVA 2KC1A 2C7MB 4BBNC 4W9FA 3H7SA 5DPWA 4NAWA 1WXAA 1XD3B 1WX9A 3EFCA 1WX7A 1RAXA 2DWQA 2LXCA 5AUKA 3VTWA 2YVCA 3LDZE 3RNBC 3BWUD 3JSVA 1SF0A 2LJ5A 2CU1A 3H7PA 1JROA 1DOXA 1JWBD 3DOWA 3RI7C 2FUG1 1WMHB 2KC2A 1FXIA 3ZW3A 2QC8A 3NRZA 2L3ZA 4WJPA 2WX1A 1QZEA 3N9YC 1C78A 3N1ZC 3AEEB 3N3KB 1ZOYB 4US9A 3MHSD 2RSUA 1D5ZC 2MEKA 3AE2B 2DAFA 1I4GA 2PIAA 1UF0A 3ZNGC 4DXGA 1TKYA 1SSNA 2WYQA 3W1SC 3VUXA 4ARIA 2K22A 1L0YB 5L83A 5CHWA 2ZPNA 2V3NA 3TJPA 3CWIA 3T3OA 3E9SA 4MGKE 2PVGC 2L05A 3TIXA 4GLSC 2M4NA 2Y3AA 1VJKA 5T8IA 5FR3A 1TKGA 1L4ZB 1WE6A 2KTFA 2C7NB 4MDKE 5KHQA 3AEDB 4GOCA 4L2YA 2L00B 1P9DU 1D6EC 1SEBD 4KDIC 1TS4A 1UH6A 1C3TA 1YQ4B 4IM2A 2JX5A 3L4PA 2OHFA 3H7PB 3SFDB 3SU8X 2DZMA 3MFGA 1EM7A 4DWFA 2PEAA 3EECA 2CS4A 4XZ4A 1F9JA 2K8HA 4EEWA 2JPHA 3P2BA 2QJLA 2BF8B 2V0GA 3UIPB 2M8SA 5FK9C 2KHWB 4DQOC 4WIPA 3AV8A 2AX5A 2DNFA 2KFJA 4RM8A 1FMAD 2KN5A 1FO4A 2KJRA 2KT7A 5HFYA 2WXRA 1WGYA 4EFOA 4ANXA 3W9CB 3QJZA 4JGHB 4YL8A 3HIZA 1C4AA 4J3OD 2PLPA 1T0QC 2CU3A 1KLVA 4Q2JA 2JU6X 1WYGA 2WDTB 4JWUC 3RNFC 2UWQA 2WU2B 3QK0A 4JE3B 3R2TA 4E74A 1YD8U 2IGHA 4YTPB 4DXAB 5L95C 2LGYA 2INDC 3NVVA 4EZKA 4KZ0A 1VZ7A 2G9HD 4AOFA 4ICVA 4BKTA 4QAYA 1TZ1A 4LTUA 4FHKA 2M56B 2WXQA 2CR5A 4WAFA 3NVYA 3JW0X 2M19A 1I35A 4XE0A 3PLVA 4HXDA 1SE9A 1JALA 3ZLZA 3PS6A 2EKIA 4FJZA 3ZNID 1YOVB 2D2QA 5D2MB 4XDDA 1FCCC 1E8WA 2J42A 1L4DB 1YIWA 3KWVA 2BYTA 3RZWC 1I42A 2WS3B 1WR6E 4K3BA 3DVNV 4IWPA 1KRHA 4HCPB 2XBBC 1GC7A 1T0SC 1VDVA 2BWFA 4P1CC 2RDGA 3FAHA 4BKGA 1FM0D 2V4IB 3IG3A 2MP2B 2QEJC 2ZZPB 4I6NB 2JWUA 5HKHA 1E9MA 4OVVA 4XDCA 3PPAA 3OWEB 4TQ1A 2J0KA 3UGBB 1WZ3A 3ZRCA 1HZ5A 3LJ3A 1TY2A 1Y56A 4GXBA 2KDFB 2RDBC 1FEHA 3NHEB 3VRAB 1KJTA 1R4MI 1HQRD 3Q3MC 2NBVB 5EE9A 1VRAB 5BMIA 2BW2A 1JWMD 2Q5WD 4HPLB 3FKYA 4N6EB 3RT3B 2ON8A 1WRDB 1QF6A 3CMMB 2KO3A 4FULA 3PZDA 4CO7A 2K8CA 4URKA 2K0PA 3VUWA 4MH0E 2MHJA 3QHTA 3RD2A 4LDTB 1OTRB 2KACA 1RRBA 4WJNA 1WJUA 3W2DA 1UUPA 3SEBA 4ZRJA 4GU2A 3U7DA 2KN4A 2N9XA 2KX0A 4BOZB 4TKNA 4WWPA 1OQYA 1ISNA 3PO0A 3ZDMC 3AMZA 1SB3C 2LASA 2GRIA 2KXJA 5BYRA 2CJOA 3A9JB 1E6EB 3B9JA 3TUOA 3KUCB 1WX8A 3DVGX 1MJDA 2JF5A 1EWCA 2K6DB 4IKGA 1C1YB 1V97A 2FIFA 3PVLA 4HROA 4MH8A 1AWDA 1WIAA 2WXIA 2ZPYA 5I4DA 1ROEA 1MG8A 4AJYB 2NMQA 2VRRB 4R3DA 2N0SB 2D11A 3EHVA 3PZ7A 2WGSA 3BIID 1TZOA 1ZDVA 2WU5B 2DENB 2GBNA 4WH4A 5TSSA 3Q8AA 4HK2A 3VRBB 5H8YE 1T3QA 3L16A 2J0JA 2QSDA 2KLGA 2GB1A 1JWSD 4KSLC 5BYSA 4LNOA 2DZKA 1FIQA 3KH0A 1QOBA 1XLOA 3V60A 1C9FA 2K6QA 4JWSC 1QLBB 1R4MB 4REZA 1IP9A 1F2RC 3UF8A 1E7VA 3A1QB 4KKJA 3UI3A 1JWAD 2ZVOA 2AYOB 1N61A 3TL5A 4HDOA 3AEAB 2K9XA 2G4DB 1TKEA 4TSSA 2JY6A 5EDSA 4RM9A 1ZP0B 2B3AA 2ZJDA 4W9CA 3WAPA 4BOSC 3ML8A 1E90A 1V6EA 2WXGA 3QQ8B 4KDLB 3O65B 1V8CA 4W9GA 2ZW1A 1XLQA 1V1PA 2V1YA 3GOEA 2ACZB 4KIKB 1XXGA 5CHVC 3DBRB 2L32A 1XO3A 2L8JA 5J18A 2IGDA 3H6NA 4LNFA 3Q3NC 1JQ4A 3A9KB 2WP9B 1ESFA 4B0EA 2FCMA 2AQ2B 1MHXA 4II3B 3MHZA 4MSQB 3AEBB 3ZXRA 1WM3A 3BYTB 3EUB2 2KKCA 1CQVA 4DDGD 4ZHOA 1MI0A 3L0WB 2LJIA 5BMGA 1KTKA 2BBCA 2UYZB 4XWWA 4LNIA 3VH3B 3DVNU 2YLMA 2GBKA 2FAZA 1V86A 2OEDA 3DBRI 4IC7B 5D94A 1ZKHA 4TQ0A 1N5XA 2XK5B 4HDQA 3KLSX 4GIVA 4ASWC 3OJ4B 2BS3B 4OHJA 2W55A 2INCC 1NBFC 1WGHA 2RR9A 4FJYA 2K39A 3R2IA 1ZDXA 4P1BC 4HPPA 3IFWB 4GGQA 3ECIA 1OQQA 1V9JA 2PW9A 3GB1A 4K7WA 1GB4A 2MBEA 2PJHA 2L76A 3N30A 3OJ3A 5AEKB 3BK1A 3WA0A 3APCA 1Z2MA 3CIRB 4KGSA 5G55A 1XLNA 2DAJA 2LUEA 3VFKA 3N20C 3CSTA 2BKRB 1I7HA 4KKIA 1VZ8A 4W9EA 1WJ4A 2SEBD 3L54A 2KQSA 3PZ8A 1STEA 2XK5A 1KM7A 2KVRA 4WAAA 3RNGC 3QX1A 2C9WB 4NQLB 1UWMA 4HEA1 4ZYNA 4ZRQA 3BYYB 4X57B 4GMVA 1WXMA 4RCOA 1F1HA 1T5XD 3I63C 4WQMA 2BTEA 4EZLA 2JUOA 5EE3A 2N4FA 3B2FA 1KLGD 3N32A 3IHPC 2HE7A 3HHMA 4MM3B 2QHOA 3NZUA 3BVMA 3DWMA 1MFWA 3P4QB 5DPTA 2QIEB 4M00A 2J4XA 2R2QA 2HJ1A 1YQBA 4KSKC 2JXXA 3VR8B 2N9EB 2WLBA 3SR6A 3AE4B 4IOIE 3TCAA 4N9F4 2E6XA 4DHZB 2PE9A 1XLPA 3VUYA 1GC6A 3RZFA 2CHXA 3AE3B 4NAWB 3H1UA 2QMTA 2I1JA 3ZNZB 4DK5A 1YMHE 2WX0A 1AYFA 5HHDG 3A33B 5D3IB 3DHHC 1YJJA 1GJZA 3HVDA 3BY4B 1WSPA 1MPEA 3PRZA 3AE8B 4AJWA 3DDCB 1XCTL 2KTRA 5DPSA 2KMMA 3K9PB 1R4NB 1ZXIA 3NG0A 1JMLA 1JW9D 2KFKA 2MJDA 2MX2A 2LGDA 3AH7A 5IP4D 1QOAA 1QOFA 1XT9B 2WXPA 4RGTA 4FN2A 2LMCA 1N62A 2BYFA 1DYQA 3RYTA 1YX6B 1EWYC 2ZW0A 2IO2B 3B0AA 4KGTA 3NJTA 2N7DA 2GMIC 4HPMB 4YSZB 2AQ1B 2GI9A 1B9RA 4GN1A 1UGMA 3AB5A 1VCBA 2FCSA 3TEWA 3SDLC 3IBEA 4PYUA 3CF6E 2L1AA 1WXQA 3I57A 1PYWD 3AE5B 1J7CA 3Q3FA 3PTFC 1VD2A 3R8BA 3ZIMA 2WXKA 2JZPA 1NENB 1SE3A 2PE6B 2KWDA 4A3PA 4RFBA 4JPSA 3NOBA 3ZJUA 1GB1A 3A9JA 1E10A 5G5HA 3VDZA 3A9KA 2MBQA 1RFKA 4A8XC 2ICIA 2XN9C 5JHAA 1XEEA 1LM8B 1V5OA 3JSVB 3DBSA 4K7SA 2L7RA 3RMKC 4ITKA 1Q5WB 4LNKA 4NZLB 2LVQA 3RNCC 2BYEA 4YWGG 3GE8C 3LXFA 4KVGB 2Z0EB 3TEXA 3AEFB 1TIFA 3DBLI 2BWES 1M94A 3QARA 3JVZX 4GB9A 1XCQL 1PUTA 3DQVA 1WH3A 4MACA 4BBNF 2OJRA 3PV1A 4C80A 1TJEA 2DBYA 1UD7A 3AXCA 3P63A 3QWZB 4S0RA 1E8XA 4F7ZA 1HEZE 2KDIA 2R61A 1IBXB 3S2AA 2REXA 2JWZA 2PKOA 2CHZA 1ACCA 1Z5SB 4ZRKA 5LXHA 3ZKJC 1WJNA 4GDKA 1NYRA 1NVID 4RNAA 4L23A 2E3TA 4ACFA 1FXAA 1T0YA 1L6VA 2N9LA 2X8XX 2LUMA 1I4XA 3ABVB 3PHXB 3MC8A 3RULA 1J8CA 2DZJA 3RCZA 1FD6A 1F2RI 1KH0A 3ZVVA 3QA8A 2ZVNA 3N1XC 3LYYA 3DHIC 1WJ6A 5EE0A 3ZTCA 3EC8A 5BMHA 3AI5A 2KDBA 2V4LA 3W1YA 1SJHD 4YTNB 3BINA 3I5JC 3L08A 1ZPSA 2W9NA 1E8ZA 1Q1OA 1HTOA 2C5LC 4NNJB 1Q0WB 2W3RA 1IBXA 2FBWB 1TBEA 2KK8A 4MEMA 1DOIA 2RGFA 2RD0A 2Y5PA 2KDMA 3NUHB 5AZGA 3RUIB 3M63B 1K52A 4WURA 1L0VB 2NTSA 1ZW7A 2I2YA 5JXVA 2NPTB 1RYJA 2BGFA 3NS8A 4LCDE 3JYUA 3DCGA 4HCNB 4LK0M 3HUIA 1L0XB 2WXLA 4M8NA 4TUUA 4W9DA 3ZNHB 4YXDB 1SXTA 5E6OA 1SJED 3M95A 2LZ6A 4N58A 4ZDVA 4NJ7A 5G5GA 2G1EA 3B1LX 5C2TB 1BMLC 2A5UA 1TTNA 2MW5A 2N7EA 2M1MA 4XYCA 2HDEA 1UELA 2CHWA 2BS4B 4ANWA 3UINB 2KWVB 3C19A 1N5WA 4GDLB 3O13A 1Y8RC 1F52A 1QILA 5D6JB 3AM9A 4ZRIA 2KANA 2LGIA 4LDTD 1UBIA 4IM3A 4P16A 4A20A 3IT4B 3VTUA 1IUEA 2GBRA 1TGZB 3B08A 2KDEB 3WAMA 3GE3C 2B76B 4K3CA 3J9CA 1D4BA 1OEYA 3Q8BA 4C56C 1LGRA 2J0MA 1KF6B 1WGGA 1YN4A 2L0FA 3Q2AC 2JYTA 1WGKA 4W9IA 4YSYB 1V49A 2N1WA 2JRIB 4N59A 3ZJTA 2EMTA 5FR6A 3U4EG 3PT2B 2KYWA 3BVZA 3NVWA 4OVUA 1PQSA 2K3UA 2NR2A 3ZDTA 4FHJA 5BYQA 2MJ3A 1WXVA 3L10B 3RFZB 2V9HA 2MWSB 3DWGC 4MM3A 3LB8C 1TT5B 1YNTE 2WXNA 1BXTA 3OLMD 4H2AA 2AWTA 2IYDB 4B9KA 1FFUA 3HRDD 4I6PA 3GZNI 4FADA 2DX5B 4PS8A 4M0WB 2C7HA 3IAM1 5AZFA 4M01A 3B2GA 2O2VB 1UNSA 2MLBA 4XC2A 1SE2A 3MJWA 4I6LB 2ZNVC 2XEWA 3VTVA 1V1OA 1K53A 1CZPA 1QT9A 2O2VA 3TEYA 2RDHA 3H9DA 4K7UA 4P6VF 4F8CB 2LVPA 1I4HA 1P3QU 4II2B 2HTME 2QDFA 1A5RA 4ICUA 4IW0A 1QOGA 4G11A 2WXFA 3ENEA 2MBOA 2IY1B 3T9LA 2IY0B 1N60A 1ET6A 3HM3A 5CTRC 1P7EA 2INPE 3PHWB 3ZXVA 1A70A 2ASQA 4HJGE 1GNUA 3UQBA 1SIFA 2VH2A 3U30A 3R66C 1NI3A 4KX6B 1SE4A 4HLEA 2QILA 1UBQA 4AWJA 2ZNVB 3GP7A 4ARCA 2M0AA 3AULA 4WWOA 4K81A 4G50A 3VR9B 2BQQA 4IWOA 2O6VA 1J19A 2LI5A 1LO5D 2W82A 5CX3A 1X1MA 4E71A 1H4RA 3AE9B 4OW0A 3X23A 2IJ0A 1IGCA 2L52A 1ZUD2 3Q8EA 3MC0B 3SD5A 2BT6A 1R7SA 5IKCM 3MTNB 3KYCD 3AE6B 4A90A 2D3BA 1WFYA 3W5UB 4PK1A 5IO9A 2LVOA 2LHEA 1P0RA 5J2RA 5J17A 4OZCA 1YX5B 5DCNA 2EMSA 5E6JA 4C00A 2J52A 3FC4A 1N6ZA 1HZ6A 4B95A 1YN3A 5DPRA 1XQQA 3GS2A 4C4VA 3VVWB 2D10A 1TS2A 4FXCA 4O1NA 4EUTA 2NPTA 3Q69A 2W54A 2VZKB 4KGRA 2KQ7A 3KWLA 4YT0B 1E5WA 3D32A 3NZSA 4JQWC 2ZEQA 2O6VD 1G6JA 2BYVE 3ZTDA 4ZYSA 2I1KA 1L2NA 4W9LA 4S17A 3I9V1 2LFIA 2RPVA 4GDKB 4OZAA 4FLHA 2WXOA 1YJ1A 1M4VA 1PFDA 2WHIA 3KW5B 1JWUD 3APDA 1QKZA 4M0WA 1GAQB 1C79A 1FCLA 3DPDA 1ZXHA 1E7PB 2WXHA 2OJWA 3ZGZA 2KAJA 5BO4B 1XF5L 1K50A 3MJ5A 2JZZA 4WJOA 1NI2A 3KYDD 4LNNA 5EE1A 1BUIC 3KUDB 1LQBA 2LHDA 4HVBA 1J0GA 3Q6BA 5C1ZA 4ZOHC 3QIJA 2G45B 3Q3OC 2D3GA 3VH4B 1FPYA 1OEYJ 5MPOA 4BAXA 4E3CA 4EE2A 1L7YA 2JRHA 5JHBA 4RF1A 2D3CA 4G3XB 3E56A 2IDYA 4MGYE 4FBJB 2K25A 5TR5A 3X0WA 2LWPA 3IT6B 5G2NA 3RNAC 2TSSA 2V3PA 2AL6A 4DXFA 3ONSA 4A55A 4M8MA 3U2SC 5IA7A 2AEHA 2WQYB 3OG5A 2FCNA 1E0ZA 2ONQA 5LLIA 1J7AA 5E6PA 4HKZE 4WJQA 4BKSD 2C60A 2IO1B 1IPGA 3SHQA 1H8CA 1VLBA 2DZIA 4HRSA 2DYMA 4MJSB 1FNWA 2JXTA 3EFUA 2D5GA 4P7IA 1HXYD 2KLCA 5D3DA 4NJ6A 1CK1A 4MSMB 1FXTB 3AECB 3BK2A 3PGEA 2LRUA 1D5XC 2KD0A 2GLSA 1EF5A 1RLFA 1AARA 1WY8A 1GUAB 2MQJA 3KUZA 1T6BX 1LXDA 4DHJD 2H89B 1R4NI 3WANA 3WIMA 2M0XA 3V6EB 3V05A 2FIDA 2IZVB 4KZCA 2QCZA 5AUIA 5HI1A 3AEGB 3AE7B 1CMXB 3AU4A 4BKSA 1WXSA 4LJPB 1Q10A 5LXIB 3N1YC 2IO3B 1L6UA 3V61A 4WWMA 3RNEC 2KOXA 1PGXA 2Y5BB 2ZCCA 4JL9A 1V81A 3VXWA 3R7RA 2PMVA 5IAAC 3KVFB 2BVCA 2LRWA 5FKAC 2IBIB 2NVUI 4XWTA 3WCQA 2ZCBA 1E8YA 3T3NA 3ZYYX 3ZO5B 2PPHA 1KLUD 2OOBB 4JLCA 4W9KA 2KTRB 3ETRA 1IGDA 2HTHA 1TS5A 2IO0B 5CHFA 1IYFA 2JQRB 3UIOB 2JT4B 4EOYA 2KFKB 2KWCA 3OAWA 1BT0A 1P7FA 1UZXB 3URYA 2FE8A 2LGXA 2FCQA 3DVGY 3P42A 3H8HA 3DBHI 4L1BA 2JVCA 2N7JA 4RGOS 2M17A 2MCNB 1MG4A 2DYBA 1EF1A 2NS5A 4AP4C 2HJ8A 1KOTA 2CKHB 2PVOD 2DHZA 5AZHA 1KFYB 1S3SG 2RPQA 4EKUA 3P1MA 4A6QA 2KX3A 2MRPA 2J53A 2INNE 2UU7A 3Q14C 1NDDA 3R7QA 5IOIA 2GOWA 1TS3A 2AL3A 3AE1B 3DBHB 1WGRA 1E7UA 2HD5B 4KV2A 1V2YA 5LNK1 2DLBA 4YSXB 4NJCA 4FJVB 2IPKD 2Z0DB 1NYQA 3QAQA 1F77A 3C8YA 1NEKB 2VZKD 1V80A 1JRPA 4K1RB 4C7ZA 1SGHA 4B6WA 4RF0A 4IWQA 1V5TA 2NBWB 1ZGUB 2R2OA 2Z8LA 4RGNA 1YJIA 3L13A 4BFRA 3A4SC 5D7GA 2LEKA 3L17A 2D07B 1VZ6A 1WMHA 4HWIB 4HKQA 1FNUA 4ZHPA 1UWXA 4W9JA 3U7ZA 3ALBA 1WM2A 2V3SA 4NY0A 2MP2A 4MGIE 1SBBB 3PSEB 4JX1C 4RGMA 4HJKA 4A3OA 2XNAC 4FA6A 1WRIA 2EELA 4J6IA 4F1SA 2N9PC 1SIJA 1K8RB 1C4PA 1U4AA 3BVGA 1WE7A 1B1ZA 2K5PA 2X38A 1LFDA 2Y5CA 4NPNA 2BS2B 5GMVA 1C4CA 1FRDA 1FFVA 3NY5A 3CSFA 2O6VB 4A9AA 4MT5A 5GXGB 2KJHB 3SFEB 1OQRA 3U8ZA 4DHZE 2K8BA 4LLGM 2KWUB 2NTTA 4IG7B 4RMAA 3WAOA 3ZUNA 2NCNA 1WF9A 2W3SA 2WNMA 4ANUA 3I3TB 2KZRA 2WDRB 1ZE3D 4AS1A 3V3XA 3PLUA 4TV3A 4GDLA 2WDQB 1RFAA 3WALA 3P4PB 3PREA 2BB6A 3IXSA 3Q3JA 4JIOU 3FILB 2LXAA 1GOZA 2BPSA 1P1AA 2I38A 4PS3A 3QC8B 3A1QA 4DDID 1DOYA 4EZJA 1WZ0A 1D3ZA 3AU5A 3TMPB 3FILA 3KQ4A 2WDVB 1HE8A 3M62B 3IVFA 1WYWB 3R3MA 3EA6A 1YQ3B 2VH1A 1MVKA 3NZ3A 2LD9A 4DHJB 1EU4A 5HG2A
chains in the Genus database with same CATH topology
1P98A 2KQ7A 1WZ3A 2G3QB 3Q3FA 3ZRCA 3PTFC 1VD2A 3ZIMA 1E5WA 3D32A 2PE6B 3NZSA 4JQWC 5JZEB 4W9HA 3LJ3A 3TBLD 4CYEA 2ZEQA 4A3PA 2O6VD 1G6JA 4GXBA 2KDFB 3NOBA 2BYVE 3NHEB 4DBGA 3A9JA 3UQAA 1KJTA 3ZTDA 2I1KA 1R4MI 4LJOB 2NBVB 3VDZA 3A9KA 1L2NA 2MBQA 4W9LA 4GDKB 4FLHA 4HPLB 4WQOB 3RT3B 5JHAA 1LM8B 1YJ1A 1V5OA 1WRDB 2WWZA 3CMMB 2KO3A 3JSVB 3KW5B 3DBSA 4FULA 4K7SA 3VHTC 3PZDA 2L7RA 4CO7A 2K8CA 3APDA 1Q5WB 4AUQC 2LVQA 2BYEA 3V62A 4URKA 5JH5C 3DPDA 1S1QB 3VUWA 4MH0E 3PRMB 3QHTA 3RD2A 4LDTB 4KVGB 5BO4B 2Z0EB 2JZZA 3DBLI 4WJOA 1OTRB 1NI2A 2BWES 3KYDD 1RRBA 2JZ3B 2BKFA 1M94A 1WJUA 3QARA 4WJNA 3JVZX 1LQBA 3KUDB 4GB9A 5C23A 2MA9B 4HVBA 4ZRJA 3PRPB 1J0GA 3DQVA 4GU2A 1WH3A 3U7DA 5C1ZA 3QIJA 4BBNF 2G45B 2OJRA 3PV1A 4GSWA 1EO6A 3ML9A 2D3GA 2N9XA 2KX0A 3VH4B 2FNJB 3A4RA 1UD7A 3AXCA 4BOZB 3QWZB 4CHKA 1OEYJ 4TKNA 4WWPA 4E3CA 1OQYA 1ISNA 2G4SA 1L7YA 2JRHA 3ZDMC 5JHBA 2LASA 4IUMB 2KMAA 1E8XA 4G3XB 3W1SA 4F7ZA 2KXJA 3APFA 3VQIA 3K9OB 4MGYE 2KDIA 2A4ZA 4FBJB 2K25A 2MBHA 5TR5A 2K1FA 3S2AA 2REXA 4BVUC 3A9JB 2MBBB 2NBUA 3X0WA 2LWPA 2JWZA 2CHZA 1Z5SB 4ZRKA 5LXHA 3KUCB 1WX8A 2EKEC 1WJNA 3DVGX 5G2NA 4NQKE 3ZKJC 4GDKA 2AL6A 2JF5A 3HM6X 3ONSA 2KJ6A 4M8MA 1WR1A 2K6DB 3T8MA 1C1YB 2FIFA 2MSED 5IA7A 1T0YA 3PVLA 3C0RB 1GG3A 2AEHA 2FCNA 1WIAA 2ZPYA 5LLIA 3PHXB 5E6PA 1MG8A 4WJQA 3RULA 4AJYB 4BKSD 2L0TA 2VRRB 1J8CA 2C60A 2DZJA 3RCZA 2IO1B 1IPGA 3SHQA 3ZVVA 3QA8A 2ZVNA 2D11A 3EHVA 4KIKA 3VAWA 1H8CA 4IM0A 1WJ6A 2DZIA 2KNBA 2DENB 2GBNA 3ZTCA 2DYMA 3EC8A 4HK2A 4MJSB 3L16A 3AI5A 2KDBA 2J0JA 4G0NB 2KMCA 2V4LA 3EFUA 3ZRFA 3W1YA 2KLGA 2DYOA 4WWNA 4KSLC 4P7IA 2KLCA 2DZKA 3BINA 4NJ6A 3L08A 3KH0A 4ANVA 4MSMB 4MJSA 5KHOA 3V60A 2K6QA 3QCAA 2W9NA 4MGZE 1FXTB 3V6CB 3PGEA 1E8ZA 1Q1OA 1IP9A 2N1VA 3UF8A 2C5LC 2LRUA 1EUVB 1E7VA 2KD0A 3A1QB 3M3JA 1EF5A 3HK0A 1RLFA 1AARA 4NNJB 1Q0WB 2ZVOA 1WY8A 2AYOB 1GUAB 2GBMA 4HDOA 3TL5A 2MQJA 2GBJA 1TBEA 2KK8A 3KUZA 4MEMA 1LXDA 4PS7A 4DHJD 1R4NI 2RGFA 3WANA 3WIMA 2RD0A 2G4DB 1OGWA 2M0XA 3V6EB 1JRUA 5EDSA 2JY6A 5AZGA 3RUIB 4MELA 2FIDA 2IZVB 4KZCA 4RM9A 3M63B 2B3AA 2ZJDA 1WGDA 2Z59B 4W9CA 1CMXB 3WAPA 4BOSC 3ML8A 1E90A 1V6EA 1ZW7A 4PYZA 4XX5A 3QQ8B 2FUHB 4KDLB 2NPTB 3O65B 3AU4A 5E6NA 4W9GA 4BKSA 2J7QB 1WI0A 2BGFA 3NS8A 1WXSA 4LCDE 3JYUA 4LJPB 5LXIB 3DCGA 4HCNB 2IO3B 4M8NA 2KC1A 4TUUA 2V1YA 4W9DA 3ZNHB 3GOEA 2C7MB 4KIKB 3V61A 4BBNC 5CHVC 4W9FA 2KOXA 3H7SA 2Y5BB 5E6OA 2L8JA 2ZCCA 5DPWA 4JL9A 1V81A 3M95A 2LZ6A 5J18A 3VXWA 3H6NA 4ZDVA 3R7RA 4NJ7A 5IAAC 3B1LX 4NAWA 3KVFB 1WXAA 1XD3B 1WX9A 2LRWA 3A9KB 1WX7A 2IBIB 1RAXA 2LXCA 2NVUI 3VTWA 2A5UA 2YVCA 2FCMA 2ZCBA 1E8YA 3LDZE 1TTNA 2MW5A 2N7EA 2M1MA 4II3B 4MSQB 3ZO5B 1UELA 2CHWA 3JSVA 2PPHA 1WM3A 2LJ5A 3UINB 2CU1A 2KWVB 4ANWA 3H7PA 2OOBB 2KKCA 4GDLB 4JLCA 3DOWA 4DDGD 4W9KA 1Y8RC 2KTRB 3L0WB 1WMHB 2IO0B 2HTHA 2KC2A 5CHFA 5D6JB 1IYFA 4ZRIA 3ZW3A 2UYZB 2KANA 2L3ZA 1UBIA 4LDTD 3UIOB 3VH3B 2JT4B 2YLMA 3DVNU 2WX1A 4WJPA 2KFKB 4EOYA 4IM3A 2KWCA 3OAWA 4A20A 2GBKA 1BT0A 2FAZA 1V86A 1QZEA 3VTUA 2GBRA 1UZXB 1TGZB 2LGXA 3DBRI 3B08A 2KDEB 3WAMA 2FCQA 3DVGY 3N3KB 4IC7B 5D94A 1ZKHA 1OEYA 3DBHI 3MHSD 4TQ0A 2RSUA 2JVCA 2M17A 2XK5B 2DAFA 4HDQA 2J0MA 2MCNB 1WGGA 2DYBA 1EF1A 4GIVA 2NS5A 3ZNGC 2L0FA 4ASWC 3W1SC 2WYQA 3VUXA 4AP4C 2HJ8A 5L83A 5CHWA 1KOTA 2CKHB 3OJ4B 2ZPNA 2DHZA 5AZHA 4W9IA 3TJPA 1V49A 1NBFC 1WGHA 2N1WA 1S3SG 2RPQA 2RR9A 2K39A 4FJYA 4MGKE 2JRIB 4EKUA 3IFWB 2L05A 2EMTA 4GGQA 5FR6A 3TIXA 2M4NA 3PT2B 2KX3A 2MRPA 4OVUA 1PQSA 2NR2A 3ZDTA 3ECIA 1NDDA 1V9JA 4FHJA 3R7QA 1WE6A 2KTFA 2C7NB 4MDKE 5KHQA 1WXVA 2GOWA 3L10B 2AL3A 4GOCA 2L00B 4K7WA 1P9DU 2MBEA 1WGRA 4KDIC 2MWSB 1E7UA 2HD5B 4MM3A 1UH6A 4KV2A 1C3TA 4IM2A 2PJHA 2L76A 3N30A 1V2YA 3OJ3A 5AEKB 3H7PB 3WA0A 3APCA 1Z2MA 3OLMD 5G55A 4FJVB 2DZMA 2Z0DB 3SU8X 2AWTA 2DAJA 2IYDB 3QAQA 2LUEA 4B9KA 4DWFA 1V80A 2PEAA 4K1RB 3EECA 4I6PA 2CS4A 4XZ4A 1SGHA 4B6WA 3GZNI 4FADA 1F9JA 1V5TA 4IWQA 2K8HA 4EEWA 2NBWB 1ZGUB 2JPHA 2R2OA 3P2BA 3VFKA 2BF8B 3CSTA 2DX5B 3UIPB 2BKRB 4M0WB 4PS8A 2M8SA 2KHWB 2C7HA 5AZFA 3L13A 2O2VB 4W9EA 2MLBA 4XC2A 1WJ4A 4BFRA 3A4SC 3MJWA 3L54A 5D7GA 2KQSA 3L17A 2XK5A 4I6LB 2ZNVC 1KM7A 2D07B 2KFJA 2KVRA 2XEWA 4RM8A 2KN5A 4WAAA 3VTVA 2KJRA 1WMHA 4HWIB 3QX1A 2C9WB 4NQLB 2O2VA 1WGYA 4ZYNA 4EFOA 3H9DA 4X57B 4ANXA 4GMVA 1WXMA 4K7UA 3QJZA 4W9JA 4JGHB 3ALBA 4F8CB 2LVPA 1WM2A 4YL8A 1P3QU 2V3SA 3HIZA 4II2B 1A5RA 4ICUA 4NY0A 4IW0A 4EZLA 2JUOA 4G11A 2MP2A 4MGIE 2N4FA 1KLVA 3ENEA 3N32A 3IHPC 3PSEB 2MBOA 2IY1B 3T9LA 2IY0B 2WDTB 2HE7A 4HJKA 4A3OA 3HHMA 2UWQA 4FA6A 2QHOA 3HM3A 3QK0A 4J6IA 3NZUA 5CTRC 3PHWB 4F1SA 2N9PC 5DPTA 2ASQA 4E74A 1YD8U 2R2QA 1K8RB 1YQBA 1GNUA 4KSKC 3UQBA 2JXXA 1U4AA 1SIFA 1WE7A 2N9EB 3U30A 3R66C 4DXAB 5L95C 2LGYA 4HLEA 1LFDA 3TCAA 4N9F4 4EZKA 4DHZB 4NPNA 1UBQA 4KZ0A 5GMVA 2PE9A 4AWJA 3VUYA 1GC6A 4AOFA 3NY5A 3RZFA 2ZNVB 4ICVA 3CSFA 2O6VB 2CHXA 4BKTA 2KJHB 1TZ1A 4NAWB 4FHKA 3U8ZA 4DHZE 3H1UA 2K8BA 2KWUB 3AULA 4WWOA 2CR5A 2I1JA 4K81A 4IG7B 3ZNZB 4RMAA 3WAOA 3ZUNA 3JW0X 4G50A 2NCNA 1WF9A 4ANUA 4DK5A 4IWOA 2O6VA 1J19A 3I3TB 1I35A 2LI5A 2KZRA 3PLUA 3PLVA 2WX0A 4HXDA 1SE9A 4TV3A 3A33B 3ZLZA 5CX3A 1X1MA 4E71A 1GJZA 4GDLA 1H4RA 3BY4B 3PS6A 3PRZA 4AJWA 1RFAA 4FJZA 3ZNID 3DDCB 2D2QA 5D2MB 3WALA 2KTRA 5DPSA 3X23A 3K9PB 3PREA 1E8WA 3Q3JA 3SD5A 1YIWA 4JIOU 2LXAA 2BPSA 3RZWC 3MTNB 2KFKA 2MX2A 1P1AA 3KYCD 2LGDA 4PS3A 1I42A 3QC8B 3A1QA 4DDID 4EZJA 1WR6E 1XT9B 1WFYA 3DVNV 4IWPA 1WZ0A 2LVOA 4HCPB 1D3ZA 3AU5A 1GC7A 1P0RA 2XBBC 4FN2A 2BYFA 3TMPB 1YX5B 5J17A 3RYTA 1YX6B 5J2RA 1HE8A 2BWFA 2IO2B 3B0AA 3M62B 3IVFA 5DCNA 1WYWB 2EMSA 3R3MA 2N7DA 4BKGA 2GMIC 3IG3A 4HPMB 2LD9A 2MP2B 2ZZPB 4B95A 4GN1A 1UGMA 5DPRA 1XQQA 4DHJB 4I6NB 1VCBA 5HKHA 2FCSA 3SDLC 3IBEA 3VVWB 2D10A 4PYUA 4OVVA 4EUTA 3CF6E 3PPAA 2NPTA 4TQ1A 2J0KA 3UGBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P98 A;  2KQ7 A;  1WZ3 A;  2G3Q B;  3Q3F A;  3ZRC A;  3PTF C;  1VD2 A;  3ZIM A;  1E5W A;  3D32 A;  2PE6 B;  3NZS A;  4JQW C;  5JZE B;  4W9H A;  3LJ3 A;  3TBL D;  4CYE A;  2ZEQ A;  4A3P A;  2O6V D;  1G6J A;  4GXB A;  2KDF B;  3NOB A;  2BYV E;  3NHE B;  4DBG A;  3A9J A;  3UQA A;  1KJT A;  3ZTD A;  2I1K A;  1R4M I;  4LJO B;  2NBV B;  3VDZ A;  3A9K A;  1L2N A;  2MBQ A;  4W9L A;  4GDK B;  4FLH A;  4HPL B;  4WQO B;  3RT3 B;  5JHA A;  1LM8 B;  1YJ1 A;  1V5O A;  1WRD B;  2WWZ A;  3CMM B;  2KO3 A;  3JSV B;  3KW5 B;  3DBS A;  4FUL A;  4K7S A;  3VHT C;  3PZD A;  2L7R A;  4CO7 A;  2K8C A;  3APD A;  1Q5W B;  4AUQ C;  2LVQ A;  2BYE A;  3V62 A;  4URK A;  5JH5 C;  3DPD A;  1S1Q B;  3VUW A;  4MH0 E;  3PRM B;  3QHT A;  3RD2 A;  4LDT B;  4KVG B;  5BO4 B;  2Z0E B;  2JZZ A;  3DBL I;  4WJO A;  1OTR B;  1NI2 A;  2BWE S;  3KYD D;  1RRB A;  2JZ3 B;  2BKF A;  1M94 A;  1WJU A;  3QAR A;  4WJN A;  3JVZ X;  1LQB A;  3KUD B;  4GB9 A;  5C23 A;  2MA9 B;  4HVB A;  4ZRJ A;  3PRP B;  1J0G A;  3DQV A;  4GU2 A;  1WH3 A;  3U7D A;  5C1Z A;  3QIJ A;  4BBN F;  2G45 B;  2OJR A;  3PV1 A;  4GSW A;  1EO6 A;  3ML9 A;  2D3G A;  2N9X A;  2KX0 A;  3VH4 B;  2FNJ B;  3A4R A;  1UD7 A;  3AXC A;  4BOZ B;  3QWZ B;  4CHK A;  1OEY J;  4TKN A;  4WWP A;  4E3C A;  1OQY A;  1ISN A;  2G4S A;  1L7Y A;  2JRH A;  3ZDM C;  5JHB A;  2LAS A;  4IUM B;  2KMA A;  1E8X A;  4G3X B;  3W1S A;  4F7Z A;  2KXJ A;  3APF A;  3VQI A;  3K9O B;  4MGY E;  2KDI A;  2A4Z A;  4FBJ B;  2K25 A;  2MBH A;  5TR5 A;  2K1F A;  3S2A A;  2REX A;  4BVU C;  3A9J B;  2MBB B;  2NBU A;  3X0W A;  2LWP A;  2JWZ A;  2CHZ A;  1Z5S B;  4ZRK A;  5LXH A;  3KUC B;  1WX8 A;  2EKE C;  1WJN A;  3DVG X;  5G2N A;  4NQK E;  3ZKJ C;  4GDK A;  2AL6 A;  2JF5 A;  3HM6 X;  3ONS A;  2KJ6 A;  4M8M A;  1WR1 A;  2K6D B;  3T8M A;  1C1Y B;  2FIF A;  2MSE D;  5IA7 A;  1T0Y A;  3PVL A;  3C0R B;  1GG3 A;  2AEH A;  2FCN A;  1WIA A;  2ZPY A;  5LLI A;  3PHX B;  5E6P A;  1MG8 A;  4WJQ A;  3RUL A;  4AJY B;  4BKS D;  2L0T A;  2VRR B;  1J8C A;  2C60 A;  2DZJ A;  3RCZ A;  2IO1 B;  1IPG A;  3SHQ A;  3ZVV A;  3QA8 A;  2ZVN A;  2D11 A;  3EHV A;  4KIK A;  3VAW A;  1H8C A;  4IM0 A;  1WJ6 A;  2DZI A;  2KNB A;  2DEN B;  2GBN A;  3ZTC A;  2DYM A;  3EC8 A;  4HK2 A;  4MJS B;  3L16 A;  3AI5 A;  2KDB A;  2J0J A;  4G0N B;  2KMC A;  2V4L A;  3EFU A;  3ZRF A;  3W1Y A;  2KLG A;  2DYO A;  4WWN A;  4KSL C;  4P7I A;  2KLC A;  2DZK A;  3BIN A;  4NJ6 A;  3L08 A;  3KH0 A;  4ANV A;  4MSM B;  4MJS A;  5KHO A;  3V60 A;  2K6Q A;  3QCA A;  2W9N A;  4MGZ E;  1FXT B;  3V6C B;  3PGE A;  1E8Z A;  1Q1O A;  1IP9 A;  2N1V A;  3UF8 A;  2C5L C;  2LRU A;  1EUV B;  1E7V A;  2KD0 A;  3A1Q B;  3M3J A;  1EF5 A;  3HK0 A;  1RLF A;  1AAR A;  4NNJ B;  1Q0W B;  2ZVO A;  1WY8 A;  2AYO B;  1GUA B;  2GBM A;  4HDO A;  3TL5 A;  2MQJ A;  2GBJ A;  1TBE A;  2KK8 A;  3KUZ A;  4MEM A;  1LXD A;  4PS7 A;  4DHJ D;  1R4N I;  2RGF A;  3WAN A;  3WIM A;  2RD0 A;  2G4D B;  1OGW A;  2M0X A;  3V6E B;  1JRU A;  5EDS A;  2JY6 A;  5AZG A;  3RUI B;  4MEL A;  2FID A;  2IZV B;  4KZC A;  4RM9 A;  3M63 B;  2B3A A;  2ZJD A;  1WGD A;  2Z59 B;  4W9C A;  1CMX B;  3WAP A;  4BOS C;  3ML8 A;  1E90 A;  1V6E A;  1ZW7 A;  4PYZ A;  4XX5 A;  3QQ8 B;  2FUH B;  4KDL B;  2NPT B;  3O65 B;  3AU4 A;  5E6N A;  4W9G A;  4BKS A;  2J7Q B;  1WI0 A;  2BGF A;  3NS8 A;  1WXS A;  4LCD E;  3JYU A;  4LJP B;  5LXI B;  3DCG A;  4HCN B;  2IO3 B;  4M8N A;  2KC1 A;  4TUU A;  2V1Y A;  4W9D A;  3ZNH B;  3GOE A;  2C7M B;  4KIK B;  3V61 A;  4BBN C;  5CHV C;  4W9F A;  2KOX A;  3H7S A;  2Y5B B;  5E6O A;  2L8J A;  2ZCC A;  5DPW A;  4JL9 A;  1V81 A;  3M95 A;  2LZ6 A;  5J18 A;  3VXW A;  3H6N A;  4ZDV A;  3R7R A;  4NJ7 A;  5IAA C;  3B1L X;  4NAW A;  3KVF B;  1WXA A;  1XD3 B;  1WX9 A;  2LRW A;  3A9K B;  1WX7 A;  2IBI B;  1RAX A;  2LXC A;  2NVU I;  3VTW A;  2A5U A;  2YVC A;  2FCM A;  2ZCB A;  1E8Y A;  3LDZ E;  1TTN A;  2MW5 A;  2N7E A;  2M1M A;  4II3 B;  4MSQ B;  3ZO5 B;  1UEL A;  2CHW A;  3JSV A;  2PPH A;  1WM3 A;  2LJ5 A;  3UIN B;  2CU1 A;  2KWV B;  4ANW A;  3H7P A;  2OOB B;  2KKC A;  4GDL B;  4JLC A;  3DOW A;  4DDG D;  4W9K A;  1Y8R C;  2KTR B;  3L0W B;  1WMH B;  2IO0 B;  2HTH A;  2KC2 A;  5CHF A;  5D6J B;  1IYF A;  4ZRI A;  3ZW3 A;  2UYZ B;  2KAN A;  2L3Z A;  1UBI A;  4LDT D;  3UIO B;  3VH3 B;  2JT4 B;  2YLM A;  3DVN U;  2WX1 A;  4WJP A;  2KFK B;  4EOY A;  4IM3 A;  2KWC A;  3OAW A;  4A20 A;  2GBK A;  1BT0 A;  2FAZ A;  1V86 A;  1QZE A;  3VTU A;  2GBR A;  1UZX B;  1TGZ B;  2LGX A;  3DBR I;  3B08 A;  2KDE B;  3WAM A;  2FCQ A;  3DVG Y;  3N3K B;  4IC7 B;  5D94 A;  1ZKH A;  1OEY A;  3DBH I;  3MHS D;  4TQ0 A;  2RSU A;  2JVC A;  2M17 A;  2XK5 B;  2DAF A;  4HDQ A;  2J0M A;  2MCN B;  1WGG A;  2DYB A;  1EF1 A;  4GIV A;  2NS5 A;  3ZNG C;  2L0F A;  4ASW C;  3W1S C;  2WYQ A;  3VUX A;  4AP4 C;  2HJ8 A;  5L83 A;  5CHW A;  1KOT A;  2CKH B;  3OJ4 B;  2ZPN A;  2DHZ A;  5AZH A;  4W9I A;  3TJP A;  1V49 A;  1NBF C;  1WGH A;  2N1W A;  1S3S G;  2RPQ A;  2RR9 A;  2K39 A;  4FJY A;  4MGK E;  2JRI B;  4EKU A;  3IFW B;  2L05 A;  2EMT A;  4GGQ A;  5FR6 A;  3TIX A;  2M4N A;  3PT2 B;  2KX3 A;  2MRP A;  4OVU A;  1PQS A;  2NR2 A;  3ZDT A;  3ECI A;  1NDD A;  1V9J A;  4FHJ A;  3R7Q A;  1WE6 A;  2KTF A;  2C7N B;  4MDK E;  5KHQ A;  1WXV A;  2GOW A;  3L10 B;  2AL3 A;  4GOC A;  2L00 B;  4K7W A;  1P9D U;  2MBE A;  1WGR A;  4KDI C;  2MWS B;  1E7U A;  2HD5 B;  4MM3 A;  1UH6 A;  4KV2 A;  1C3T A;  4IM2 A;  2PJH A;  2L76 A;  3N30 A;  1V2Y A;  3OJ3 A;  5AEK B;  3H7P B;  3WA0 A;  3APC A;  1Z2M A;  3OLM D;  5G55 A;  4FJV B;  2DZM A;  2Z0D B;  3SU8 X;  2AWT A;  2DAJ A;  2IYD B;  3QAQ A;  2LUE A;  4B9K A;  4DWF A;  1V80 A;  2PEA A;  4K1R B;  3EEC A;  4I6P A;  2CS4 A;  4XZ4 A;  1SGH A;  4B6W A;  3GZN I;  4FAD A;  1F9J A;  1V5T A;  4IWQ A;  2K8H A;  4EEW A;  2NBW B;  1ZGU B;  2JPH A;  2R2O A;  3P2B A;  3VFK A;  2BF8 B;  3CST A;  2DX5 B;  3UIP B;  2BKR B;  4M0W B;  4PS8 A;  2M8S A;  2KHW B;  2C7H A;  5AZF A;  3L13 A;  2O2V B;  4W9E A;  2MLB A;  4XC2 A;  1WJ4 A;  4BFR A;  3A4S C;  3MJW A;  3L54 A;  5D7G A;  2KQS A;  3L17 A;  2XK5 A;  4I6L B;  2ZNV C;  1KM7 A;  2D07 B;  2KFJ A;  2KVR A;  2XEW A;  4RM8 A;  2KN5 A;  4WAA A;  3VTV A;  2KJR A;  1WMH A;  4HWI B;  3QX1 A;  2C9W B;  4NQL B;  2O2V A;  1WGY A;  4ZYN A;  4EFO A;  3H9D A;  4X57 B;  4ANX A;  4GMV A;  1WXM A;  4K7U A;  3QJZ A;  4W9J A;  4JGH B;  3ALB A;  4F8C B;  2LVP A;  1WM2 A;  4YL8 A;  1P3Q U;  2V3S A;  3HIZ A;  4II2 B;  1A5R A;  4ICU A;  4NY0 A;  4IW0 A;  4EZL A;  2JUO A;  4G11 A;  2MP2 A;  4MGI E;  2N4F A;  1KLV A;  3ENE A;  3N32 A;  3IHP C;  3PSE B;  2MBO A;  2IY1 B;  3T9L A;  2IY0 B;  2WDT B;  2HE7 A;  4HJK A;  4A3O A;  3HHM A;  2UWQ A;  4FA6 A;  2QHO A;  3HM3 A;  3QK0 A;  4J6I A;  3NZU A;  5CTR C;  3PHW B;  4F1S A;  2N9P C;  5DPT A;  2ASQ A;  4E74 A;  1YD8 U;  2R2Q A;  1K8R B;  1YQB A;  1GNU A;  4KSK C;  3UQB A;  2JXX A;  1U4A A;  1SIF A;  1WE7 A;  2N9E B;  3U30 A;  3R66 C;  4DXA B;  5L95 C;  2LGY A;  4HLE A;  1LFD A;  3TCA A;  4N9F 4;  4EZK A;  4DHZ B;  4NPN A;  1UBQ A;  4KZ0 A;  5GMV A;  2PE9 A;  4AWJ A;  3VUY A;  1GC6 A;  4AOF A;  3NY5 A;  3RZF A;  2ZNV B;  4ICV A;  3CSF A;  2O6V B;  2CHX A;  4BKT A;  2KJH B;  1TZ1 A;  4NAW B;  4FHK A;  3U8Z A;  4DHZ E;  3H1U A;  2K8B A;  2KWU B;  3AUL A;  4WWO A;  2CR5 A;  2I1J A;  4K81 A;  4IG7 B;  3ZNZ B;  4RMA A;  3WAO A;  3ZUN A;  3JW0 X;  4G50 A;  2NCN A;  1WF9 A;  4ANU A;  4DK5 A;  4IWO A;  2O6V A;  1J19 A;  3I3T B;  1I35 A;  2LI5 A;  2KZR A;  3PLU A;  3PLV A;  2WX0 A;  4HXD A;  1SE9 A;  4TV3 A;  3A33 B;  3ZLZ A;  5CX3 A;  1X1M A;  4E71 A;  1GJZ A;  4GDL A;  1H4R A;  3BY4 B;  3PS6 A;  3PRZ A;  4AJW A;  1RFA A;  4FJZ A;  3ZNI D;  3DDC B;  2D2Q A;  5D2M B;  3WAL A;  2KTR A;  5DPS A;  3X23 A;  3K9P B;  3PRE A;  1E8W A;  3Q3J A;  3SD5 A;  1YIW A;  4JIO U;  2LXA A;  2BPS A;  3RZW C;  3MTN B;  2KFK A;  2MX2 A;  1P1A A;  3KYC D;  2LGD A;  4PS3 A;  1I42 A;  3QC8 B;  3A1Q A;  4DDI D;  4EZJ A;  1WR6 E;  1XT9 B;  1WFY A;  3DVN V;  4IWP A;  1WZ0 A;  2LVO A;  4HCP B;  1D3Z A;  3AU5 A;  1GC7 A;  1P0R A;  2XBB C;  4FN2 A;  2BYF A;  3TMP B;  1YX5 B;  5J17 A;  3RYT A;  1YX6 B;  5J2R A;  1HE8 A;  2BWF A;  2IO2 B;  3B0A A;  3M62 B;  3IVF A;  5DCN A;  1WYW B;  2EMS A;  3R3M A;  2N7D A;  4BKG A;  2GMI C;  3IG3 A;  4HPM B;  2LD9 A;  2MP2 B;  2ZZP B;  4B95 A;  4GN1 A;  1UGM A;  5DPR A;  1XQQ A;  4DHJ B;  4I6N B;  1VCB A;  5HKH A;  2FCS A;  3SDL C;  3IBE A;  3VVW B;  2D10 A;  4PYU A;  4OVV A;  4EUT A;  3CF6 E;  3PPA A;  2NPT A;  4TQ1 A;  2J0K A;  3UGB B; 
#chains in the Genus database with same CATH topology
 1P98 A;  2G3Q B;  2JYE A;  3EGR A;  1AW7 A;  1ENF A;  2CJN A;  1YN5 A;  5JZE B;  3U52 E;  1MHH E;  4W9H A;  3TBL D;  1D5M C;  2KQ4 X;  2N9K A;  4CYE A;  2YEP B;  4RH6 A;  1I4Q A;  3Q8F A;  4DBG A;  1TYG B;  3UQA A;  4LJO B;  2SAK A;  3HVZ A;  4YTM B;  5H92 C;  4WQO B;  3DBL B;  4OZB A;  2WWZ A;  1C77 A;  4XGA B;  3VHT C;  4CQN A;  1FRR A;  2JSV X;  4AUQ C;  3V62 A;  5JH5 C;  1S1Q B;  3PRM B;  3RN9 C;  3NS1 A;  1ET9 A;  1N63 A;  2JZ3 B;  3W5V B;  2BKF A;  5C23 A;  2MA9 B;  3P4S B;  3PRP B;  3MC9 A;  2LGS A;  1RWS A;  4BZA A;  1VR9 A;  1EO6 A;  4GSW A;  3ML9 A;  4UDU C;  1C76 A;  2FNJ B;  3GZN B;  2YEP F;  3A4R A;  4CHK A;  1CJE A;  2G4S A;  2WXM A;  3BZD B;  4OVZ A;  2MH7 A;  4IUM B;  2KMA A;  3W1S A;  4NAM A;  3VQI A;  3APF A;  1PDX A;  3K9O B;  2A4Z A;  2MBH A;  2K1F A;  4BVU C;  2MBB B;  2NBU A;  1V1P B;  3NVZ A;  3ZJV A;  1J7B A;  2EKE C;  4NQK E;  4US8 A;  3HM6 X;  1PGA A;  1TY0 A;  2KJ6 A;  1WR1 A;  4B0M A;  5IN7 A;  3T8M A;  1T0R C;  2MSE D;  3C0R B;  1GG3 A;  5C3J B;  4IDI A;  1I4P A;  3TSS A;  3IAS 1;  1GPX A;  1PGB A;  4ZRP A;  2L0T A;  3RPF C;  2H88 B;  1HTQ A;  2L83 A;  1WWT A;  3P4R B;  3AN1 A;  2MJE A;  4KIK A;  1QQR A;  3VAW A;  4IM0 A;  2KNB A;  3TEZ A;  2IGG A;  4G0N B;  3Q8C A;  2KMC A;  3ZRF A;  1JCK B;  2DYO A;  4WWN A;  1K51 A;  1F0Z A;  3DHG C;  1I4R A;  1HA5 A;  1EU3 A;  4ANV A;  1AN8 A;  4MJS A;  5KHO A;  3QCA A;  3ZQ4 A;  4MGZ E;  4C7Y A;  1UGJ A;  3V6C B;  1DGJ A;  2N1V A;  4USA A;  1EUV B;  2PTL A;  3HK0 A;  3M3J A;  4M02 A;  2GBM A;  4AQ7 A;  2AQ3 B;  1RM6 C;  1L5P A;  2RMM A;  4TMA B;  2GBJ A;  1OFF A;  4D2K A;  2WXJ A;  4PS7 A;  1OGW A;  3MP9 A;  4PT5 A;  1JRU A;  2D3A A;  2BB5 A;  4MEL A;  1WGD A;  2Z59 B;  4C4V B;  4PYZ A;  4XX5 A;  2FUH B;  2KVZ A;  5E6N A;  2J7Q B;  1WI0 A;  1FNV A;  2KC1 A;  2C7M B;  4BBN C;  4W9F A;  3H7S A;  5DPW A;  4NAW A;  1WXA A;  1XD3 B;  1WX9 A;  3EFC A;  1WX7 A;  1RAX A;  2DWQ A;  2LXC A;  5AUK A;  3VTW A;  2YVC A;  3LDZ E;  3RNB C;  3BWU D;  3JSV A;  1SF0 A;  2LJ5 A;  2CU1 A;  3H7P A;  1JRO A;  1DOX A;  1JWB D;  3DOW A;  3RI7 C;  2FUG 1;  1WMH B;  2KC2 A;  1FXI A;  3ZW3 A;  2QC8 A;  3NRZ A;  2L3Z A;  4WJP A;  2WX1 A;  1QZE A;  3N9Y C;  1C78 A;  3N1Z C;  3AEE B;  3N3K B;  1ZOY B;  4US9 A;  3MHS D;  2RSU A;  1D5Z C;  2MEK A;  3AE2 B;  2DAF A;  1I4G A;  2PIA A;  1UF0 A;  3ZNG C;  4DXG A;  1TKY A;  1SSN A;  2WYQ A;  3W1S C;  3VUX A;  4ARI A;  2K22 A;  1L0Y B;  5L83 A;  5CHW A;  2ZPN A;  2V3N A;  3TJP A;  3CWI A;  3T3O A;  3E9S A;  4MGK E;  2PVG C;  2L05 A;  3TIX A;  4GLS C;  2M4N A;  2Y3A A;  1VJK A;  5T8I A;  5FR3 A;  1TKG A;  1L4Z B;  1WE6 A;  2KTF A;  2C7N B;  4MDK E;  5KHQ A;  3AED B;  4GOC A;  4L2Y A;  2L00 B;  1P9D U;  1D6E C;  1SEB D;  4KDI C;  1TS4 A;  1UH6 A;  1C3T A;  1YQ4 B;  4IM2 A;  2JX5 A;  3L4P A;  2OHF A;  3H7P B;  3SFD B;  3SU8 X;  2DZM A;  3MFG A;  1EM7 A;  4DWF A;  2PEA A;  3EEC A;  2CS4 A;  4XZ4 A;  1F9J A;  2K8H A;  4EEW A;  2JPH A;  3P2B A;  2QJL A;  2BF8 B;  2V0G A;  3UIP B;  2M8S A;  5FK9 C;  2KHW B;  4DQO C;  4WIP A;  3AV8 A;  2AX5 A;  2DNF A;  2KFJ A;  4RM8 A;  1FMA D;  2KN5 A;  1FO4 A;  2KJR A;  2KT7 A;  5HFY A;  2WXR A;  1WGY A;  4EFO A;  4ANX A;  3W9C B;  3QJZ A;  4JGH B;  4YL8 A;  3HIZ A;  1C4A A;  4J3O D;  2PLP A;  1T0Q C;  2CU3 A;  1KLV A;  4Q2J A;  2JU6 X;  1WYG A;  2WDT B;  4JWU C;  3RNF C;  2UWQ A;  2WU2 B;  3QK0 A;  4JE3 B;  3R2T A;  4E74 A;  1YD8 U;  2IGH A;  4YTP B;  4DXA B;  5L95 C;  2LGY A;  2IND C;  3NVV A;  4EZK A;  4KZ0 A;  1VZ7 A;  2G9H D;  4AOF A;  4ICV A;  4BKT A;  4QAY A;  1TZ1 A;  4LTU A;  4FHK A;  2M56 B;  2WXQ A;  2CR5 A;  4WAF A;  3NVY A;  3JW0 X;  2M19 A;  1I35 A;  4XE0 A;  3PLV A;  4HXD A;  1SE9 A;  1JAL A;  3ZLZ A;  3PS6 A;  2EKI A;  4FJZ A;  3ZNI D;  1YOV B;  2D2Q A;  5D2M B;  4XDD A;  1FCC C;  1E8W A;  2J42 A;  1L4D B;  1YIW A;  3KWV A;  2BYT A;  3RZW C;  1I42 A;  2WS3 B;  1WR6 E;  4K3B A;  3DVN V;  4IWP A;  1KRH A;  4HCP B;  2XBB C;  1GC7 A;  1T0S C;  1VDV A;  2BWF A;  4P1C C;  2RDG A;  3FAH A;  4BKG A;  1FM0 D;  2V4I B;  3IG3 A;  2MP2 B;  2QEJ C;  2ZZP B;  4I6N B;  2JWU A;  5HKH A;  1E9M A;  4OVV A;  4XDC A;  3PPA A;  3OWE B;  4TQ1 A;  2J0K A;  3UGB B;  1WZ3 A;  3ZRC A;  1HZ5 A;  3LJ3 A;  1TY2 A;  1Y56 A;  4GXB A;  2KDF B;  2RDB C;  1FEH A;  3NHE B;  3VRA B;  1KJT A;  1R4M I;  1HQR D;  3Q3M C;  2NBV B;  5EE9 A;  1VRA B;  5BMI A;  2BW2 A;  1JWM D;  2Q5W D;  4HPL B;  3FKY A;  4N6E B;  3RT3 B;  2ON8 A;  1WRD B;  1QF6 A;  3CMM B;  2KO3 A;  4FUL A;  3PZD A;  4CO7 A;  2K8C A;  4URK A;  2K0P A;  3VUW A;  4MH0 E;  2MHJ A;  3QHT A;  3RD2 A;  4LDT B;  1OTR B;  2KAC A;  1RRB A;  4WJN A;  1WJU A;  3W2D A;  1UUP A;  3SEB A;  4ZRJ A;  4GU2 A;  3U7D A;  2KN4 A;  2N9X A;  2KX0 A;  4BOZ B;  4TKN A;  4WWP A;  1OQY A;  1ISN A;  3PO0 A;  3ZDM C;  3AMZ A;  1SB3 C;  2LAS A;  2GRI A;  2KXJ A;  5BYR A;  2CJO A;  3A9J B;  1E6E B;  3B9J A;  3TUO A;  3KUC B;  1WX8 A;  3DVG X;  1MJD A;  2JF5 A;  1EWC A;  2K6D B;  4IKG A;  1C1Y B;  1V97 A;  2FIF A;  3PVL A;  4HRO A;  4MH8 A;  1AWD A;  1WIA A;  2WXI A;  2ZPY A;  5I4D A;  1ROE A;  1MG8 A;  4AJY B;  2NMQ A;  2VRR B;  4R3D A;  2N0S B;  2D11 A;  3EHV A;  3PZ7 A;  2WGS A;  3BII D;  1TZO A;  1ZDV A;  2WU5 B;  2DEN B;  2GBN A;  4WH4 A;  5TSS A;  3Q8A A;  4HK2 A;  3VRB B;  5H8Y E;  1T3Q A;  3L16 A;  2J0J A;  2QSD A;  2KLG A;  2GB1 A;  1JWS D;  4KSL C;  5BYS A;  4LNO A;  2DZK A;  1FIQ A;  3KH0 A;  1QOB A;  1XLO A;  3V60 A;  1C9F A;  2K6Q A;  4JWS C;  1QLB B;  1R4M B;  4REZ A;  1IP9 A;  1F2R C;  3UF8 A;  1E7V A;  3A1Q B;  4KKJ A;  3UI3 A;  1JWA D;  2ZVO A;  2AYO B;  1N61 A;  3TL5 A;  4HDO A;  3AEA B;  2K9X A;  2G4D B;  1TKE A;  4TSS A;  2JY6 A;  5EDS A;  4RM9 A;  1ZP0 B;  2B3A A;  2ZJD A;  4W9C A;  3WAP A;  4BOS C;  3ML8 A;  1E90 A;  1V6E A;  2WXG A;  3QQ8 B;  4KDL B;  3O65 B;  1V8C A;  4W9G A;  2ZW1 A;  1XLQ A;  1V1P A;  2V1Y A;  3GOE A;  2ACZ B;  4KIK B;  1XXG A;  5CHV C;  3DBR B;  2L32 A;  1XO3 A;  2L8J A;  5J18 A;  2IGD A;  3H6N A;  4LNF A;  3Q3N C;  1JQ4 A;  3A9K B;  2WP9 B;  1ESF A;  4B0E A;  2FCM A;  2AQ2 B;  1MHX A;  4II3 B;  3MHZ A;  4MSQ B;  3AEB B;  3ZXR A;  1WM3 A;  3BYT B;  3EUB 2;  2KKC A;  1CQV A;  4DDG D;  4ZHO A;  1MI0 A;  3L0W B;  2LJI A;  5BMG A;  1KTK A;  2BBC A;  2UYZ B;  4XWW A;  4LNI A;  3VH3 B;  3DVN U;  2YLM A;  2GBK A;  2FAZ A;  1V86 A;  2OED A;  3DBR I;  4IC7 B;  5D94 A;  1ZKH A;  4TQ0 A;  1N5X A;  2XK5 B;  4HDQ A;  3KLS X;  4GIV A;  4ASW C;  3OJ4 B;  2BS3 B;  4OHJ A;  2W55 A;  2INC C;  1NBF C;  1WGH A;  2RR9 A;  4FJY A;  2K39 A;  3R2I A;  1ZDX A;  4P1B C;  4HPP A;  3IFW B;  4GGQ A;  3ECI A;  1OQQ A;  1V9J A;  2PW9 A;  3GB1 A;  4K7W A;  1GB4 A;  2MBE A;  2PJH A;  2L76 A;  3N30 A;  3OJ3 A;  5AEK B;  3BK1 A;  3WA0 A;  3APC A;  1Z2M A;  3CIR B;  4KGS A;  5G55 A;  1XLN A;  2DAJ A;  2LUE A;  3VFK A;  3N20 C;  3CST A;  2BKR B;  1I7H A;  4KKI A;  1VZ8 A;  4W9E A;  1WJ4 A;  2SEB D;  3L54 A;  2KQS A;  3PZ8 A;  1STE A;  2XK5 A;  1KM7 A;  2KVR A;  4WAA A;  3RNG C;  3QX1 A;  2C9W B;  4NQL B;  1UWM A;  4HEA 1;  4ZYN A;  4ZRQ A;  3BYY B;  4X57 B;  4GMV A;  1WXM A;  4RCO A;  1F1H A;  1T5X D;  3I63 C;  4WQM A;  2BTE A;  4EZL A;  2JUO A;  5EE3 A;  2N4F A;  3B2F A;  1KLG D;  3N32 A;  3IHP C;  2HE7 A;  3HHM A;  4MM3 B;  2QHO A;  3NZU A;  3BVM A;  3DWM A;  1MFW A;  3P4Q B;  5DPT A;  2QIE B;  4M00 A;  2J4X A;  2R2Q A;  2HJ1 A;  1YQB A;  4KSK C;  2JXX A;  3VR8 B;  2N9E B;  2WLB A;  3SR6 A;  3AE4 B;  4IOI E;  3TCA A;  4N9F 4;  2E6X A;  4DHZ B;  2PE9 A;  1XLP A;  3VUY A;  1GC6 A;  3RZF A;  2CHX A;  3AE3 B;  4NAW B;  3H1U A;  2QMT A;  2I1J A;  3ZNZ B;  4DK5 A;  1YMH E;  2WX0 A;  1AYF A;  5HHD G;  3A33 B;  5D3I B;  3DHH C;  1YJJ A;  1GJZ A;  3HVD A;  3BY4 B;  1WSP A;  1MPE A;  3PRZ A;  3AE8 B;  4AJW A;  3DDC B;  1XCT L;  2KTR A;  5DPS A;  2KMM A;  3K9P B;  1R4N B;  1ZXI A;  3NG0 A;  1JML A;  1JW9 D;  2KFK A;  2MJD A;  2MX2 A;  2LGD A;  3AH7 A;  5IP4 D;  1QOA A;  1QOF A;  1XT9 B;  2WXP A;  4RGT A;  4FN2 A;  2LMC A;  1N62 A;  2BYF A;  1DYQ A;  3RYT A;  1YX6 B;  1EWY C;  2ZW0 A;  2IO2 B;  3B0A A;  4KGT A;  3NJT A;  2N7D A;  2GMI C;  4HPM B;  4YSZ B;  2AQ1 B;  2GI9 A;  1B9R A;  4GN1 A;  1UGM A;  3AB5 A;  1VCB A;  2FCS A;  3TEW A;  3SDL C;  3IBE A;  4PYU A;  3CF6 E;  2L1A A;  1WXQ A;  3I57 A;  1PYW D;  3AE5 B;  1J7C A;  3Q3F A;  3PTF C;  1VD2 A;  3R8B A;  3ZIM A;  2WXK A;  2JZP A;  1NEN B;  1SE3 A;  2PE6 B;  2KWD A;  4A3P A;  4RFB A;  4JPS A;  3NOB A;  3ZJU A;  1GB1 A;  3A9J A;  1E10 A;  5G5H A;  3VDZ A;  3A9K A;  2MBQ A;  1RFK A;  4A8X C;  2ICI A;  2XN9 C;  5JHA A;  1XEE A;  1LM8 B;  1V5O A;  3JSV B;  3DBS A;  4K7S A;  2L7R A;  3RMK C;  4ITK A;  1Q5W B;  4LNK A;  4NZL B;  2LVQ A;  3RNC C;  2BYE A;  4YWG G;  3GE8 C;  3LXF A;  4KVG B;  2Z0E B;  3TEX A;  3AEF B;  1TIF A;  3DBL I;  2BWE S;  1M94 A;  3QAR A;  3JVZ X;  4GB9 A;  1XCQ L;  1PUT A;  3DQV A;  1WH3 A;  4MAC A;  4BBN F;  2OJR A;  3PV1 A;  4C80 A;  1TJE A;  2DBY A;  1UD7 A;  3AXC A;  3P63 A;  3QWZ B;  4S0R A;  1E8X A;  4F7Z A;  1HEZ E;  2KDI A;  2R61 A;  1IBX B;  3S2A A;  2REX A;  2JWZ A;  2PKO A;  2CHZ A;  1ACC A;  1Z5S B;  4ZRK A;  5LXH A;  3ZKJ C;  1WJN A;  4GDK A;  1NYR A;  1NVI D;  4RNA A;  4L23 A;  2E3T A;  4ACF A;  1FXA A;  1T0Y A;  1L6V A;  2N9L A;  2X8X X;  2LUM A;  1I4X A;  3ABV B;  3PHX B;  3MC8 A;  3RUL A;  1J8C A;  2DZJ A;  3RCZ A;  1FD6 A;  1F2R I;  1KH0 A;  3ZVV A;  3QA8 A;  2ZVN A;  3N1X C;  3LYY A;  3DHI C;  1WJ6 A;  5EE0 A;  3ZTC A;  3EC8 A;  5BMH A;  3AI5 A;  2KDB A;  2V4L A;  3W1Y A;  1SJH D;  4YTN B;  3BIN A;  3I5J C;  3L08 A;  1ZPS A;  2W9N A;  1E8Z A;  1Q1O A;  1HTO A;  2C5L C;  4NNJ B;  1Q0W B;  2W3R A;  1IBX A;  2FBW B;  1TBE A;  2KK8 A;  4MEM A;  1DOI A;  2RGF A;  2RD0 A;  2Y5P A;  2KDM A;  3NUH B;  5AZG A;  3RUI B;  3M63 B;  1K52 A;  4WUR A;  1L0V B;  2NTS A;  1ZW7 A;  2I2Y A;  5JXV A;  2NPT B;  1RYJ A;  2BGF A;  3NS8 A;  4LCD E;  3JYU A;  3DCG A;  4HCN B;  4LK0 M;  3HUI A;  1L0X B;  2WXL A;  4M8N A;  4TUU A;  4W9D A;  3ZNH B;  4YXD B;  1SXT A;  5E6O A;  1SJE D;  3M95 A;  2LZ6 A;  4N58 A;  4ZDV A;  4NJ7 A;  5G5G A;  2G1E A;  3B1L X;  5C2T B;  1BML C;  2A5U A;  1TTN A;  2MW5 A;  2N7E A;  2M1M A;  4XYC A;  2HDE A;  1UEL A;  2CHW A;  2BS4 B;  4ANW A;  3UIN B;  2KWV B;  3C19 A;  1N5W A;  4GDL B;  3O13 A;  1Y8R C;  1F52 A;  1QIL A;  5D6J B;  3AM9 A;  4ZRI A;  2KAN A;  2LGI A;  4LDT D;  1UBI A;  4IM3 A;  4P16 A;  4A20 A;  3IT4 B;  3VTU A;  1IUE A;  2GBR A;  1TGZ B;  3B08 A;  2KDE B;  3WAM A;  3GE3 C;  2B76 B;  4K3C A;  3J9C A;  1D4B A;  1OEY A;  3Q8B A;  4C56 C;  1LGR A;  2J0M A;  1KF6 B;  1WGG A;  1YN4 A;  2L0F A;  3Q2A C;  2JYT A;  1WGK A;  4W9I A;  4YSY B;  1V49 A;  2N1W A;  2JRI B;  4N59 A;  3ZJT A;  2EMT A;  5FR6 A;  3U4E G;  3PT2 B;  2KYW A;  3BVZ A;  3NVW A;  4OVU A;  1PQS A;  2K3U A;  2NR2 A;  3ZDT A;  4FHJ A;  5BYQ A;  2MJ3 A;  1WXV A;  3L10 B;  3RFZ B;  2V9H A;  2MWS B;  3DWG C;  4MM3 A;  3LB8 C;  1TT5 B;  1YNT E;  2WXN A;  1BXT A;  3OLM D;  4H2A A;  2AWT A;  2IYD B;  4B9K A;  1FFU A;  3HRD D;  4I6P A;  3GZN I;  4FAD A;  2DX5 B;  4PS8 A;  4M0W B;  2C7H A;  3IAM 1;  5AZF A;  4M01 A;  3B2G A;  2O2V B;  1UNS A;  2MLB A;  4XC2 A;  1SE2 A;  3MJW A;  4I6L B;  2ZNV C;  2XEW A;  3VTV A;  1V1O A;  1K53 A;  1CZP A;  1QT9 A;  2O2V A;  3TEY A;  2RDH A;  3H9D A;  4K7U A;  4P6V F;  4F8C B;  2LVP A;  1I4H A;  1P3Q U;  4II2 B;  2HTM E;  2QDF A;  1A5R A;  4ICU A;  4IW0 A;  1QOG A;  4G11 A;  2WXF A;  3ENE A;  2MBO A;  2IY1 B;  3T9L A;  2IY0 B;  1N60 A;  1ET6 A;  3HM3 A;  5CTR C;  1P7E A;  2INP E;  3PHW B;  3ZXV A;  1A70 A;  2ASQ A;  4HJG E;  1GNU A;  3UQB A;  1SIF A;  2VH2 A;  3U30 A;  3R66 C;  1NI3 A;  4KX6 B;  1SE4 A;  4HLE A;  2QIL A;  1UBQ A;  4AWJ A;  2ZNV B;  3GP7 A;  4ARC A;  2M0A A;  3AUL A;  4WWO A;  4K81 A;  4G50 A;  3VR9 B;  2BQQ A;  4IWO A;  2O6V A;  1J19 A;  2LI5 A;  1LO5 D;  2W82 A;  5CX3 A;  1X1M A;  4E71 A;  1H4R A;  3AE9 B;  4OW0 A;  3X23 A;  2IJ0 A;  1IGC A;  2L52 A;  1ZUD 2;  3Q8E A;  3MC0 B;  3SD5 A;  2BT6 A;  1R7S A;  5IKC M;  3MTN B;  3KYC D;  3AE6 B;  4A90 A;  2D3B A;  1WFY A;  3W5U B;  4PK1 A;  5IO9 A;  2LVO A;  2LHE A;  1P0R A;  5J2R A;  5J17 A;  4OZC A;  1YX5 B;  5DCN A;  2EMS A;  5E6J A;  4C00 A;  2J52 A;  3FC4 A;  1N6Z A;  1HZ6 A;  4B95 A;  1YN3 A;  5DPR A;  1XQQ A;  3GS2 A;  4C4V A;  3VVW B;  2D10 A;  1TS2 A;  4FXC A;  4O1N A;  4EUT A;  2NPT A;  3Q69 A;  2W54 A;  2VZK B;  4KGR A;  2KQ7 A;  3KWL A;  4YT0 B;  1E5W A;  3D32 A;  3NZS A;  4JQW C;  2ZEQ A;  2O6V D;  1G6J A;  2BYV E;  3ZTD A;  4ZYS A;  2I1K A;  1L2N A;  4W9L A;  4S17 A;  3I9V 1;  2LFI A;  2RPV A;  4GDK B;  4OZA A;  4FLH A;  2WXO A;  1YJ1 A;  1M4V A;  1PFD A;  2WHI A;  3KW5 B;  1JWU D;  3APD A;  1QKZ A;  4M0W A;  1GAQ B;  1C79 A;  1FCL A;  3DPD A;  1ZXH A;  1E7P B;  2WXH A;  2OJW A;  3ZGZ A;  2KAJ A;  5BO4 B;  1XF5 L;  1K50 A;  3MJ5 A;  2JZZ A;  4WJO A;  1NI2 A;  3KYD D;  4LNN A;  5EE1 A;  1BUI C;  3KUD B;  1LQB A;  2LHD A;  4HVB A;  1J0G A;  3Q6B A;  5C1Z A;  4ZOH C;  3QIJ A;  2G45 B;  3Q3O C;  2D3G A;  3VH4 B;  1FPY A;  1OEY J;  5MPO A;  4BAX A;  4E3C A;  4EE2 A;  1L7Y A;  2JRH A;  5JHB A;  4RF1 A;  2D3C A;  4G3X B;  3E56 A;  2IDY A;  4MGY E;  4FBJ B;  2K25 A;  5TR5 A;  3X0W A;  2LWP A;  3IT6 B;  5G2N A;  3RNA C;  2TSS A;  2V3P A;  2AL6 A;  4DXF A;  3ONS A;  4A55 A;  4M8M A;  3U2S C;  5IA7 A;  2AEH A;  2WQY B;  3OG5 A;  2FCN A;  1E0Z A;  2ONQ A;  5LLI A;  1J7A A;  5E6P A;  4HKZ E;  4WJQ A;  4BKS D;  2C60 A;  2IO1 B;  1IPG A;  3SHQ A;  1H8C A;  1VLB A;  2DZI A;  4HRS A;  2DYM A;  4MJS B;  1FNW A;  2JXT A;  3EFU A;  2D5G A;  4P7I A;  1HXY D;  2KLC A;  5D3D A;  4NJ6 A;  1CK1 A;  4MSM B;  1FXT B;  3AEC B;  3BK2 A;  3PGE A;  2LRU A;  1D5X C;  2KD0 A;  2GLS A;  1EF5 A;  1RLF A;  1AAR A;  1WY8 A;  1GUA B;  2MQJ A;  3KUZ A;  1T6B X;  1LXD A;  4DHJ D;  2H89 B;  1R4N I;  3WAN A;  3WIM A;  2M0X A;  3V6E B;  3V05 A;  2FID A;  2IZV B;  4KZC A;  2QCZ A;  5AUI A;  5HI1 A;  3AEG B;  3AE7 B;  1CMX B;  3AU4 A;  4BKS A;  1WXS A;  4LJP B;  1Q10 A;  5LXI B;  3N1Y C;  2IO3 B;  1L6U A;  3V61 A;  4WWM A;  3RNE C;  2KOX A;  1PGX A;  2Y5B B;  2ZCC A;  4JL9 A;  1V81 A;  3VXW A;  3R7R A;  2PMV A;  5IAA C;  3KVF B;  2BVC A;  2LRW A;  5FKA C;  2IBI B;  2NVU I;  4XWT A;  3WCQ A;  2ZCB A;  1E8Y A;  3T3N A;  3ZYY X;  3ZO5 B;  2PPH A;  1KLU D;  2OOB B;  4JLC A;  4W9K A;  2KTR B;  3ETR A;  1IGD A;  2HTH A;  1TS5 A;  2IO0 B;  5CHF A;  1IYF A;  2JQR B;  3UIO B;  2JT4 B;  4EOY A;  2KFK B;  2KWC A;  3OAW A;  1BT0 A;  1P7F A;  1UZX B;  3URY A;  2FE8 A;  2LGX A;  2FCQ A;  3DVG Y;  3P42 A;  3H8H A;  3DBH I;  4L1B A;  2JVC A;  2N7J A;  4RGO S;  2M17 A;  2MCN B;  1MG4 A;  2DYB A;  1EF1 A;  2NS5 A;  4AP4 C;  2HJ8 A;  1KOT A;  2CKH B;  2PVO D;  2DHZ A;  5AZH A;  1KFY B;  1S3S G;  2RPQ A;  4EKU A;  3P1M A;  4A6Q A;  2KX3 A;  2MRP A;  2J53 A;  2INN E;  2UU7 A;  3Q14 C;  1NDD A;  3R7Q A;  5IOI A;  2GOW A;  1TS3 A;  2AL3 A;  3AE1 B;  3DBH B;  1WGR A;  1E7U A;  2HD5 B;  4KV2 A;  1V2Y A;  5LNK 1;  2DLB A;  4YSX B;  4NJC A;  4FJV B;  2IPK D;  2Z0D B;  1NYQ A;  3QAQ A;  1F77 A;  3C8Y A;  1NEK B;  2VZK D;  1V80 A;  1JRP A;  4K1R B;  4C7Z A;  1SGH A;  4B6W A;  4RF0 A;  4IWQ A;  1V5T A;  2NBW B;  1ZGU B;  2R2O A;  2Z8L A;  4RGN A;  1YJI A;  3L13 A;  4BFR A;  3A4S C;  5D7G A;  2LEK A;  3L17 A;  2D07 B;  1VZ6 A;  1WMH A;  4HWI B;  4HKQ A;  1FNU A;  4ZHP A;  1UWX A;  4W9J A;  3U7Z A;  3ALB A;  1WM2 A;  2V3S A;  4NY0 A;  2MP2 A;  4MGI E;  1SBB B;  3PSE B;  4JX1 C;  4RGM A;  4HJK A;  4A3O A;  2XNA C;  4FA6 A;  1WRI A;  2EEL A;  4J6I A;  4F1S A;  2N9P C;  1SIJ A;  1K8R B;  1C4P A;  1U4A A;  3BVG A;  1WE7 A;  1B1Z A;  2K5P A;  2X38 A;  1LFD A;  2Y5C A;  4NPN A;  2BS2 B;  5GMV A;  1C4C A;  1FRD A;  1FFV A;  3NY5 A;  3CSF A;  2O6V B;  4A9A A;  4MT5 A;  5GXG B;  2KJH B;  3SFE B;  1OQR A;  3U8Z A;  4DHZ E;  2K8B A;  4LLG M;  2KWU B;  2NTT A;  4IG7 B;  4RMA A;  3WAO A;  3ZUN A;  2NCN A;  1WF9 A;  2W3S A;  2WNM A;  4ANU A;  3I3T B;  2KZR A;  2WDR B;  1ZE3 D;  4AS1 A;  3V3X A;  3PLU A;  4TV3 A;  4GDL A;  2WDQ B;  1RFA A;  3WAL A;  3P4P B;  3PRE A;  2BB6 A;  3IXS A;  3Q3J A;  4JIO U;  3FIL B;  2LXA A;  1GOZ A;  2BPS A;  1P1A A;  2I38 A;  4PS3 A;  3QC8 B;  3A1Q A;  4DDI D;  1DOY A;  4EZJ A;  1WZ0 A;  1D3Z A;  3AU5 A;  3TMP B;  3FIL A;  3KQ4 A;  2WDV B;  1HE8 A;  3M62 B;  3IVF A;  1WYW B;  3R3M A;  3EA6 A;  1YQ3 B;  2VH1 A;  1MVK A;  3NZ3 A;  2LD9 A;  4DHJ B;  1EU4 A;  5HG2 A; 
#chains in the Genus database with same CATH homology
 1P98 A;  2KQ7 A;  1WZ3 A;  2G3Q B;  3Q3F A;  3ZRC A;  3PTF C;  1VD2 A;  3ZIM A;  1E5W A;  3D32 A;  2PE6 B;  3NZS A;  4JQW C;  5JZE B;  4W9H A;  3LJ3 A;  3TBL D;  4CYE A;  2ZEQ A;  4A3P A;  2O6V D;  1G6J A;  4GXB A;  2KDF B;  3NOB A;  2BYV E;  3NHE B;  4DBG A;  3A9J A;  3UQA A;  1KJT A;  3ZTD A;  2I1K A;  1R4M I;  4LJO B;  2NBV B;  3VDZ A;  3A9K A;  1L2N A;  2MBQ A;  4W9L A;  4GDK B;  4FLH A;  4HPL B;  4WQO B;  3RT3 B;  5JHA A;  1LM8 B;  1YJ1 A;  1V5O A;  1WRD B;  2WWZ A;  3CMM B;  2KO3 A;  3JSV B;  3KW5 B;  3DBS A;  4FUL A;  4K7S A;  3VHT C;  3PZD A;  2L7R A;  4CO7 A;  2K8C A;  3APD A;  1Q5W B;  4AUQ C;  2LVQ A;  2BYE A;  3V62 A;  4URK A;  5JH5 C;  3DPD A;  1S1Q B;  3VUW A;  4MH0 E;  3PRM B;  3QHT A;  3RD2 A;  4LDT B;  4KVG B;  5BO4 B;  2Z0E B;  2JZZ A;  3DBL I;  4WJO A;  1OTR B;  1NI2 A;  2BWE S;  3KYD D;  1RRB A;  2JZ3 B;  2BKF A;  1M94 A;  1WJU A;  3QAR A;  4WJN A;  3JVZ X;  1LQB A;  3KUD B;  4GB9 A;  5C23 A;  2MA9 B;  4HVB A;  4ZRJ A;  3PRP B;  1J0G A;  3DQV A;  4GU2 A;  1WH3 A;  3U7D A;  5C1Z A;  3QIJ A;  4BBN F;  2G45 B;  2OJR A;  3PV1 A;  4GSW A;  1EO6 A;  3ML9 A;  2D3G A;  2N9X A;  2KX0 A;  3VH4 B;  2FNJ B;  3A4R A;  1UD7 A;  3AXC A;  4BOZ B;  3QWZ B;  4CHK A;  1OEY J;  4TKN A;  4WWP A;  4E3C A;  1OQY A;  1ISN A;  2G4S A;  1L7Y A;  2JRH A;  3ZDM C;  5JHB A;  2LAS A;  4IUM B;  2KMA A;  1E8X A;  4G3X B;  3W1S A;  4F7Z A;  2KXJ A;  3APF A;  3VQI A;  3K9O B;  4MGY E;  2KDI A;  2A4Z A;  4FBJ B;  2K25 A;  2MBH A;  5TR5 A;  2K1F A;  3S2A A;  2REX A;  4BVU C;  3A9J B;  2MBB B;  2NBU A;  3X0W A;  2LWP A;  2JWZ A;  2CHZ A;  1Z5S B;  4ZRK A;  5LXH A;  3KUC B;  1WX8 A;  2EKE C;  1WJN A;  3DVG X;  5G2N A;  4NQK E;  3ZKJ C;  4GDK A;  2AL6 A;  2JF5 A;  3HM6 X;  3ONS A;  2KJ6 A;  4M8M A;  1WR1 A;  2K6D B;  3T8M A;  1C1Y B;  2FIF A;  2MSE D;  5IA7 A;  1T0Y A;  3PVL A;  3C0R B;  1GG3 A;  2AEH A;  2FCN A;  1WIA A;  2ZPY A;  5LLI A;  3PHX B;  5E6P A;  1MG8 A;  4WJQ A;  3RUL A;  4AJY B;  4BKS D;  2L0T A;  2VRR B;  1J8C A;  2C60 A;  2DZJ A;  3RCZ A;  2IO1 B;  1IPG A;  3SHQ A;  3ZVV A;  3QA8 A;  2ZVN A;  2D11 A;  3EHV A;  4KIK A;  3VAW A;  1H8C A;  4IM0 A;  1WJ6 A;  2DZI A;  2KNB A;  2DEN B;  2GBN A;  3ZTC A;  2DYM A;  3EC8 A;  4HK2 A;  4MJS B;  3L16 A;  3AI5 A;  2KDB A;  2J0J A;  4G0N B;  2KMC A;  2V4L A;  3EFU A;  3ZRF A;  3W1Y A;  2KLG A;  2DYO A;  4WWN A;  4KSL C;  4P7I A;  2KLC A;  2DZK A;  3BIN A;  4NJ6 A;  3L08 A;  3KH0 A;  4ANV A;  4MSM B;  4MJS A;  5KHO A;  3V60 A;  2K6Q A;  3QCA A;  2W9N A;  4MGZ E;  1FXT B;  3V6C B;  3PGE A;  1E8Z A;  1Q1O A;  1IP9 A;  2N1V A;  3UF8 A;  2C5L C;  2LRU A;  1EUV B;  1E7V A;  2KD0 A;  3A1Q B;  3M3J A;  1EF5 A;  3HK0 A;  1RLF A;  1AAR A;  4NNJ B;  1Q0W B;  2ZVO A;  1WY8 A;  2AYO B;  1GUA B;  2GBM A;  4HDO A;  3TL5 A;  2MQJ A;  2GBJ A;  1TBE A;  2KK8 A;  3KUZ A;  4MEM A;  1LXD A;  4PS7 A;  4DHJ D;  1R4N I;  2RGF A;  3WAN A;  3WIM A;  2RD0 A;  2G4D B;  1OGW A;  2M0X A;  3V6E B;  1JRU A;  5EDS A;  2JY6 A;  5AZG A;  3RUI B;  4MEL A;  2FID A;  2IZV B;  4KZC A;  4RM9 A;  3M63 B;  2B3A A;  2ZJD A;  1WGD A;  2Z59 B;  4W9C A;  1CMX B;  3WAP A;  4BOS C;  3ML8 A;  1E90 A;  1V6E A;  1ZW7 A;  4PYZ A;  4XX5 A;  3QQ8 B;  2FUH B;  4KDL B;  2NPT B;  3O65 B;  3AU4 A;  5E6N A;  4W9G A;  4BKS A;  2J7Q B;  1WI0 A;  2BGF A;  3NS8 A;  1WXS A;  4LCD E;  3JYU A;  4LJP B;  5LXI B;  3DCG A;  4HCN B;  2IO3 B;  4M8N A;  2KC1 A;  4TUU A;  2V1Y A;  4W9D A;  3ZNH B;  3GOE A;  2C7M B;  4KIK B;  3V61 A;  4BBN C;  5CHV C;  4W9F A;  2KOX A;  3H7S A;  2Y5B B;  5E6O A;  2L8J A;  2ZCC A;  5DPW A;  4JL9 A;  1V81 A;  3M95 A;  2LZ6 A;  5J18 A;  3VXW A;  3H6N A;  4ZDV A;  3R7R A;  4NJ7 A;  5IAA C;  3B1L X;  4NAW A;  3KVF B;  1WXA A;  1XD3 B;  1WX9 A;  2LRW A;  3A9K B;  1WX7 A;  2IBI B;  1RAX A;  2LXC A;  2NVU I;  3VTW A;  2A5U A;  2YVC A;  2FCM A;  2ZCB A;  1E8Y A;  3LDZ E;  1TTN A;  2MW5 A;  2N7E A;  2M1M A;  4II3 B;  4MSQ B;  3ZO5 B;  1UEL A;  2CHW A;  3JSV A;  2PPH A;  1WM3 A;  2LJ5 A;  3UIN B;  2CU1 A;  2KWV B;  4ANW A;  3H7P A;  2OOB B;  2KKC A;  4GDL B;  4JLC A;  3DOW A;  4DDG D;  4W9K A;  1Y8R C;  2KTR B;  3L0W B;  1WMH B;  2IO0 B;  2HTH A;  2KC2 A;  5CHF A;  5D6J B;  1IYF A;  4ZRI A;  3ZW3 A;  2UYZ B;  2KAN A;  2L3Z A;  1UBI A;  4LDT D;  3UIO B;  3VH3 B;  2JT4 B;  2YLM A;  3DVN U;  2WX1 A;  4WJP A;  2KFK B;  4EOY A;  4IM3 A;  2KWC A;  3OAW A;  4A20 A;  2GBK A;  1BT0 A;  2FAZ A;  1V86 A;  1QZE A;  3VTU A;  2GBR A;  1UZX B;  1TGZ B;  2LGX A;  3DBR I;  3B08 A;  2KDE B;  3WAM A;  2FCQ A;  3DVG Y;  3N3K B;  4IC7 B;  5D94 A;  1ZKH A;  1OEY A;  3DBH I;  3MHS D;  4TQ0 A;  2RSU A;  2JVC A;  2M17 A;  2XK5 B;  2DAF A;  4HDQ A;  2J0M A;  2MCN B;  1WGG A;  2DYB A;  1EF1 A;  4GIV A;  2NS5 A;  3ZNG C;  2L0F A;  4ASW C;  3W1S C;  2WYQ A;  3VUX A;  4AP4 C;  2HJ8 A;  5L83 A;  5CHW A;  1KOT A;  2CKH B;  3OJ4 B;  2ZPN A;  2DHZ A;  5AZH A;  4W9I A;  3TJP A;  1V49 A;  1NBF C;  1WGH A;  2N1W A;  1S3S G;  2RPQ A;  2RR9 A;  2K39 A;  4FJY A;  4MGK E;  2JRI B;  4EKU A;  3IFW B;  2L05 A;  2EMT A;  4GGQ A;  5FR6 A;  3TIX A;  2M4N A;  3PT2 B;  2KX3 A;  2MRP A;  4OVU A;  1PQS A;  2NR2 A;  3ZDT A;  3ECI A;  1NDD A;  1V9J A;  4FHJ A;  3R7Q A;  1WE6 A;  2KTF A;  2C7N B;  4MDK E;  5KHQ A;  1WXV A;  2GOW A;  3L10 B;  2AL3 A;  4GOC A;  2L00 B;  4K7W A;  1P9D U;  2MBE A;  1WGR A;  4KDI C;  2MWS B;  1E7U A;  2HD5 B;  4MM3 A;  1UH6 A;  4KV2 A;  1C3T A;  4IM2 A;  2PJH A;  2L76 A;  3N30 A;  1V2Y A;  3OJ3 A;  5AEK B;  3H7P B;  3WA0 A;  3APC A;  1Z2M A;  3OLM D;  5G55 A;  4FJV B;  2DZM A;  2Z0D B;  3SU8 X;  2AWT A;  2DAJ A;  2IYD B;  3QAQ A;  2LUE A;  4B9K A;  4DWF A;  1V80 A;  2PEA A;  4K1R B;  3EEC A;  4I6P A;  2CS4 A;  4XZ4 A;  1SGH A;  4B6W A;  3GZN I;  4FAD A;  1F9J A;  1V5T A;  4IWQ A;  2K8H A;  4EEW A;  2NBW B;  1ZGU B;  2JPH A;  2R2O A;  3P2B A;  3VFK A;  2BF8 B;  3CST A;  2DX5 B;  3UIP B;  2BKR B;  4M0W B;  4PS8 A;  2M8S A;  2KHW B;  2C7H A;  5AZF A;  3L13 A;  2O2V B;  4W9E A;  2MLB A;  4XC2 A;  1WJ4 A;  4BFR A;  3A4S C;  3MJW A;  3L54 A;  5D7G A;  2KQS A;  3L17 A;  2XK5 A;  4I6L B;  2ZNV C;  1KM7 A;  2D07 B;  2KFJ A;  2KVR A;  2XEW A;  4RM8 A;  2KN5 A;  4WAA A;  3VTV A;  2KJR A;  1WMH A;  4HWI B;  3QX1 A;  2C9W B;  4NQL B;  2O2V A;  1WGY A;  4ZYN A;  4EFO A;  3H9D A;  4X57 B;  4ANX A;  4GMV A;  1WXM A;  4K7U A;  3QJZ A;  4W9J A;  4JGH B;  3ALB A;  4F8C B;  2LVP A;  1WM2 A;  4YL8 A;  1P3Q U;  2V3S A;  3HIZ A;  4II2 B;  1A5R A;  4ICU A;  4NY0 A;  4IW0 A;  4EZL A;  2JUO A;  4G11 A;  2MP2 A;  4MGI E;  2N4F A;  1KLV A;  3ENE A;  3N32 A;  3IHP C;  3PSE B;  2MBO A;  2IY1 B;  3T9L A;  2IY0 B;  2WDT B;  2HE7 A;  4HJK A;  4A3O A;  3HHM A;  2UWQ A;  4FA6 A;  2QHO A;  3HM3 A;  3QK0 A;  4J6I A;  3NZU A;  5CTR C;  3PHW B;  4F1S A;  2N9P C;  5DPT A;  2ASQ A;  4E74 A;  1YD8 U;  2R2Q A;  1K8R B;  1YQB A;  1GNU A;  4KSK C;  3UQB A;  2JXX A;  1U4A A;  1SIF A;  1WE7 A;  2N9E B;  3U30 A;  3R66 C;  4DXA B;  5L95 C;  2LGY A;  4HLE A;  1LFD A;  3TCA A;  4N9F 4;  4EZK A;  4DHZ B;  4NPN A;  1UBQ A;  4KZ0 A;  5GMV A;  2PE9 A;  4AWJ A;  3VUY A;  1GC6 A;  4AOF A;  3NY5 A;  3RZF A;  2ZNV B;  4ICV A;  3CSF A;  2O6V B;  2CHX A;  4BKT A;  2KJH B;  1TZ1 A;  4NAW B;  4FHK A;  3U8Z A;  4DHZ E;  3H1U A;  2K8B A;  2KWU B;  3AUL A;  4WWO A;  2CR5 A;  2I1J A;  4K81 A;  4IG7 B;  3ZNZ B;  4RMA A;  3WAO A;  3ZUN A;  3JW0 X;  4G50 A;  2NCN A;  1WF9 A;  4ANU A;  4DK5 A;  4IWO A;  2O6V A;  1J19 A;  3I3T B;  1I35 A;  2LI5 A;  2KZR A;  3PLU A;  3PLV A;  2WX0 A;  4HXD A;  1SE9 A;  4TV3 A;  3A33 B;  3ZLZ A;  5CX3 A;  1X1M A;  4E71 A;  1GJZ A;  4GDL A;  1H4R A;  3BY4 B;  3PS6 A;  3PRZ A;  4AJW A;  1RFA A;  4FJZ A;  3ZNI D;  3DDC B;  2D2Q A;  5D2M B;  3WAL A;  2KTR A;  5DPS A;  3X23 A;  3K9P B;  3PRE A;  1E8W A;  3Q3J A;  3SD5 A;  1YIW A;  4JIO U;  2LXA A;  2BPS A;  3RZW C;  3MTN B;  2KFK A;  2MX2 A;  1P1A A;  3KYC D;  2LGD A;  4PS3 A;  1I42 A;  3QC8 B;  3A1Q A;  4DDI D;  4EZJ A;  1WR6 E;  1XT9 B;  1WFY A;  3DVN V;  4IWP A;  1WZ0 A;  2LVO A;  4HCP B;  1D3Z A;  3AU5 A;  1GC7 A;  1P0R A;  2XBB C;  4FN2 A;  2BYF A;  3TMP B;  1YX5 B;  5J17 A;  3RYT A;  1YX6 B;  5J2R A;  1HE8 A;  2BWF A;  2IO2 B;  3B0A A;  3M62 B;  3IVF A;  5DCN A;  1WYW B;  2EMS A;  3R3M A;  2N7D A;  4BKG A;  2GMI C;  3IG3 A;  4HPM B;  2LD9 A;  2MP2 B;  2ZZP B;  4B95 A;  4GN1 A;  1UGM A;  5DPR A;  1XQQ A;  4DHJ B;  4I6N B;  1VCB A;  5HKH A;  2FCS A;  3SDL C;  3IBE A;  3VVW B;  2D10 A;  4PYU A;  4OVV A;  4EUT A;  3CF6 E;  3PPA A;  2NPT A;  4TQ1 A;  2J0K A;  3UGB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...