2C9WB

Crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulation
molecule keywords SUPPRESSOR OF CYTOKINE SIGNALING 2
publication title Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c9wB00
2JY6A 4MJSB 2KQSA 3VTVA 3Q3JA 4HXDA 2O6VB 2AL3A 4FJVB 2XK5A 4IW0A 1QZEA 2MX2A 3A4RA 3R3MA 4W9HA 2RR9A 2L05A 1E7UA 1VD2A 1GNUA 2BYFA 2FIDA 3KUZA 3QWZB 4CYEA 2JF5A 2N7EA 2J7QB 1LFDA 2RD0A 3DBLI 2K6QA 2LRUA 1WF9A 2L0TA 4ANWA 2GBNA 3ZVVA 1WMHA 1AARA 3VTUA 2LGYA 5DCNA 2MP2A 3TMPB 1C3TA 1WGRA 3PRMB 2YVCA 2DAFA 1YJ1A 4G50A 4MSQB 4HJKA 5KHOA 3VTWA 3WANA 4KVGB 4DDGD 4NPNA 1WM2A 4GDLA 3QJZA 4FA6A 2ZNVB 2I1KA 4A3PA 3ENEA 3ZTCA 1HE8A 2DYOA 2IY0B 3L17A 3PZDA 3DBRI 4W9JA 4DHJD 1Q1OA 2CHWA 2ZJDA 5DPWA 3VXWA 4RM8A 4IWPA 2HJ8A 4DBGA 2JRHA 1TGZB 2KX0A 1OTRB 2MW5A 1Q5WB 4EOYA 3RD2A 2KWVB 4M0WB 5D2MB 4I6PA 2JRIB 4ASWC 1WJ6A 3GOEA 4MGZE 4NQKE 5D6JB 4DHJB 2L76A 4ZRJA 2ZEQA 2LGDA 3H7PA 4XZ4A 1WGDA 5AZGA 3M95A 5CHVC 4BBNC 1VCBA 4GGQA 3RCZA 1GUAB 1R4NI 1LM8B 3W1SC 1P0RA 4P7IA 2L3ZA 2BYVE 3MHSD 4JQWC 3VH4B 2J0JA 3LDZE 2KDBA 4NAWB 3VAWA 3RULA 1WM3A 1MG8A 2BYEA 3ZTDA 4W9CA 3TIXA 2DYBA 2AL6A 4PYUA 3NHEB 1WE6A 1YX5B 2MBOA 4GU2A 1V86A 1L2NA 2ZPYA 3VHTC 3AI5A 3DOWA 4FULA 4IC7B 2BWFA 2KJHB 3U7DA 2DYMA 2M4NA 3ZO5B 4ANXA 1SE9A 2N1VA 4DK5A 1WY8A 2KD0A 3D32A 1ISNA 3X0WA 4BKSA 3ZNZB 4DDID 3HK0A 4IWQA 1U4AA 5LXHA 2ZVOA 1NDDA 2KX3A 3L16A 4OVVA 5GMVA 3QCAA 2M0XA 1H8CA 1J19A 3MTNB 2PJHA 2KFKA 1WGHA 2N9PC 4K7UA 2JXXA 1OQYA 2YLMA 2KWUB 1GC6A 5AZHA 2GBRA 3KYDD 4MELA 3B0AA 3WAMA 2C60A 4E71A 2GOWA 2V4LA 4BKGA 1J0GA 4FJYA 2Y5BB 2G3QB 2DZJA 3JVZX 1WXMA 4W9GA 4IM2A 4B9KA 4F1SA 3PLVA 2G45B 2BWES 4M8NA 2LJ5A 1ZGUB 2NBVB 1WX7A 3BINA 1OEYA 2KDEB 2W9NA 3OLMD 2MA9B 3DDCB 3ONSA 4FHJA 4NQLB 1P9DU 1XD3B 3UIPB 2D2QA 2FCSA 3H1UA 4II2B 1G6JA 2KLGA 4F8CB 3ZNHB 3N32A 1CMXB 2L7RA 4GSWA 4LDTD 1WYWB 3DVGX 4ZRIA 5E6NA 3QQ8B 4J6IA 3KYCD 4EEWA 1UZXB 3APCA 1WX9A 2C5LC 2L0FA 2NBUA 3A33B 2ZCBA 3M3JA 4XX5A 3AULA 2CHXA 2MBQA 1V2YA 1UD7A 2XK5B 3B08A 2BKRB 2K8CA 3KW5B 2LD9A 3NS8A 4AP4C 3TBLD 1E5WA 4HPLB 1NBFC 2IO3B 2XBBC 3V6EB 2KTRA 2K39A 2DX5B 4HK2A 4X57B 2REXA 2M1MA 3DBHI 3QC8B 1OEYJ 5JZEB 3QHTA 3VUWA 4ZDVA 3ZKJC 4ZRKA 4ICVA 3RUIB 1WE7A 4IWOA 4IG7B 3ZUNA 2K6DB 2FUHB 1IP9A 4LJPB 3H7SA 1V6EA 4BOSC 1KLVA 3ZDTA 3P2BA 4G3XB 4GIVA 3OJ4B 4ANVA 2LRWA 2V1YA 4CO7A 4ZYNA 1WJUA 1UBIA 2NS5A 3DPDA 1WX8A 3UIOB 1Y8RC 1GJZA 3NY5A 3PSEB 1WR6E 1BT0A 5HKHA 1P98A 2WX1A 3ECIA 3DBSA 3WALA 3PT2B 2MLBA 4MM3A 2ZZPB 2LASA 4PS8A 5E6OA 3U30A 4CHKA 1UBQA 4IM3A 3KUDB 2UWQA 2KTFA 1WJNA 3PHXB 2GBMA 4EZKA 2O6VA 3M63B 1YIWA 2O2VB 3A4SC 2IO2B 5IAAC 4BFRA 1J8CA 4GB9A 2JZZA 2AEHA 2OOBB 4IM0A 5D94A 3VFKA 4HLEA 2HTHA 4JIOU 3VUXA 3PPAA 3W1YA 3HIZA 3K9OB 2NBWB 3LJ3A 2Z0DB 3JSVA 2NR2A 4AJYB 4WAAA 2FCMA 3AU5A 4FHKA 3PS6A 4W9FA 2KDIA 2KOXA 4FBJB 2Z0EB 2IO1B 4MGIE 2L00B 5LXIB 1E8XA 3PLUA 5DPSA 3DVNU 4OVUA 1WZ0A 3PREA 1Z2MA 4RMAA 2I1JA 1JRUA 4KSLC 3QA8A 4G11A 4MH0E 5E6PA 4F7ZA 4KDIC 3L0WB 2HD5B 3K9PB 2RPQA 4EFOA 3APFA 1YX6B 3CSFA 2NPTB 1EO6A 2CR5A 2LVPA 1KOTA 4ANUA 3WA0A 2KWCA 2CS4A 3KUCB 5AZFA 2IY1B 2KFKB 3ML8A 2D10A 1OGWA 2KC1A 2LZ6A 1XT9B 5CHFA 4DWFA 2AWTA 4KZ0A 3U8ZA 1UELA 1E8YA 3RT3B 3M62B 2CHZA 4IUMB 2KLCA 3A9KA 4KDLB 4NJ6A 3QIJA 3SU8X 1NI2A 2G4SA 2IZVB 4BBNF 1RLFA 3JW0X 2FIFA 5CHWA 2MQJA 2MBBB 2PPHA 4EKUA 4KZCA 4WQOB 3VQIA 3EC8A 3V62A 2RSUA 4FADA 2KHWB 4WWOA 2UYZB 3APDA 4HPMB 4BVUC 4WWNA 2KK8A 2D3GA 1V5OA 2K8HA 4GDKA 2ZPNA 3UINB 2LI5A 2ZCCA 2PE9A 2JWZA 2VRRB 2LVOA 2EMSA 1D3ZA 5C1ZA 2KXJA 3RZFA 3RYTA 4KIKA 1WXAA 4AJWA 3AXCA 5G2NA 2L8JA 1RFAA 2B3AA 5TR5A 3VH3B 4AUQC 1SIFA 1I35A 5J17A 2JZ3B 4DXAB 2GMIC 2EKEC 1XQQA 1PQSA 2KMCA 5KHQA 4JLCA 2KKCA 3PTFC 5DPTA 4A3OA 2MSED 4LCDE 4I6NB 2D07B 2DZKA 3NZUA 4I6LB 2BPSA 4URKA 5JHBA 1UGMA 2A4ZA 3SDLC 3PRPB 3CF6E 3DVNV 3VUYA 4HVBA 2LWPA 5L83A 2DAJA 4MGYE 2LGXA 4JL9A 1V9JA 1WMHB 4PS7A 3X23A 1WH3A 1FXTB 1YD8U 2MP2B 3CSTA 3KVFB 4FLHA 2JUOA 3PGEA 3L10B 4GOCA 4WJNA 5J2RA 3QAQA 2KC2A 2ZVNA 2K25A 2KNBA 3I3TB 2JT4B 4GDLB 1EUVB 2PE6B 2MCNB 3O65B 3ZRFA 5J18A 4GN1A 1GC7A 1TTNA 2BGFA 2KZRA 1WXSA 4FN2A 1ZKHA 3GZNI 1S1QB 1L7YA 3T9LA 1V80A 1KM7A 1T0YA 2NVUI 2XEWA 4K7SA 4W9IA 2WWZA 4HDOA 3A9JA 1IPGA 2FAZA 2KDFB 5DPRA 3L13A 2PEAA 3PVLA 2DENB 3A1QA 4JGHB 3ML9A 3V6CB 3HHMA 1P3QU 4MJSA 4MGKE 3ZW3A 3JSVB 4WJPA 3B1LX 4NY0A 3H7PB 1WZ3A 4HWIB 2FCQA 3R66C 4KSKC 3V60A 2A5UA 2R2QA 2ASQA 2JVCA 3UQAA 1I42A 1TZ1A 2G4DB 1WGYA 3EECA 2LUEA 3N30A 4K1RB 3Q3FA 3PV1A 3QARA 5FR6A 4HDQA 4BKSD 3TJPA 2C9WB 2M17A 2QHOA 5G55A 1RAXA 2DZMA 2K1FA 1WI0A 3IVFA 2WX0A 2M8SA 4MSMB 3R7QA 2N4FA 5JHAA 1E8ZA 2D11A 1UH6A 4MDKE 1M94A 3UQBA 2KANA 3EHVA 1Z5SB 2N7DA 2JPHA 2BKFA 4E3CA 1S3SG 5CX3A 1WIAA 4EZJA 3HM3A 3ZNID 3N3KB 1E8WA 4LJOB 1V49A 1SGHA 1YQBA 3DCGA 2O2VA 4E74A 1K8RB 1P1AA 2IO0B 3S2AA 1Q0WB 4TQ0A 2NCNA 3L54A 2MRPA 4MEMA 4TQ1A 4XC2A 3V61A 2N9EB 2LXCA 3A9KB 3KH0A 4AOFA 2KO3A 2KMAA 1WRDB 3IG3A 2EMTA 2MBHA 2RGFA 2R2OA 1E90A 3RZWC 4AWJA 3OJ3A 4DHZB 1E7VA 2IYDB 2BF8B 4II3B 1WXVA 2DHZA 3TCAA 3WIMA 3QK0A 3ALBA 3ZDMC 4N9F4 4BOZB 3L08A 3SHQA 1H4RA 2OJRA 3PRZA 4GDKB 4WJQA 2KJRA 4BKTA 4NAWA 5JH5C 3OAWA 2KJ6A 3CMMB 1ZW7A 4YL8A 4NNJB 3VDZA 2KN5A 2KQ7A 1X1MA 5IA7A 4KIKB 5LLIA 2FNJB 4M8MA 1R4MI 2DZIA 2NPTA 2WDTB 1C1YB 4EZLA 3AU4A 5EDSA 2J0KA 4WWPA 3R7RA 3QX1A 2WYQA 2AYOB 1F9JA 3ZLZA 1EF1A 3PHWB 4HCNB 5D7GA 3DVGY 3H9DA 4KV2A 1EF5A 4W9KA 4HCPB 2MWSB 5L95C 2CU1A 3SD5A 2C7MB 2GBKA 2KTRB 1IYFA 3DQVA 3VVWB 2LVQA 2C7HA 5BO4B 4G0NB 1RRBA 4A20A 3IFWB 3TL5A 4W9EA 1V5TA 2ZNVC 1KJTA 4FJZA 1WR1A 3ZIMA 3NZSA 4TUUA 4PYZA 1V81A 3BY4B 2KVRA 2IBIB 3IBEA 1TBEA 2J0MA 3ZNGC 4EUTA 2Z59B 4ICUA 4B6WA 3H6NA 2HE7A 5AEKB 1A5RA 1LQBA 3HM6X 3WAOA 2C7NB 1GG3A 4PS3A 3UF8A 4RM9A 1WJ4A 4DHZE 3IHPC 3WAPA 3ZRCA 2CKHB 2MBEA 4W9DA 1WGGA 2O6VD 2KFJA 4WJOA 4W9LA 3C0RB 3JYUA 4NJ7A 4K7WA 2K8BA 3UGBB 5CTRC 1LXDA 2V3SA 4GMVA 4TV3A 2N1WA 3MJWA 3EFUA 3NOBA 3A9JB 4K81A 1WFYA 3W1SA 5C23A 2FCNA 2LXAA 4GXBA 4TKNA 3T8MA 2N9XA 3A1QB 4B95A 2GBJA 4LDTB
chains in the Genus database with same CATH superfamily
4HEA1 2TSSA 2KQSA 1VJKA 4MJSB 5IP4D 4HXDA 4FJVB 2XK5A 1QZEA 2MX2A 4W9HA 1E7UA 1LFDA 2K6QA 2LRUA 1WF9A 1T3QA 4ANWA 2GBNA 4WAFA 3ZVVA 4B0EA 4PK1A 1WMHA 3VTUA 2LGYA 3P42A 3NZ3A 4BAXA 4DXFA 3P63A 4G50A 1EWCA 4MSQB 4HJKA 3WANA 3VTWA 4GDLA 2L52A 3LB8C 2I1KA 1YOVB 3BZDB 1PFDA 1SXTA 2L32A 1Q1OA 2CHWA 4HPPA 4IWPA 4RM8A 4UDUC 3AMZA 3GZNB 2JRHA 4IOIE 1TGZB 5D2MB 4I6PA 4MGZE 5D6JB 4JE3B 2ZEQA 5AZGA 2DWQA 4GGQA 4TSSA 3W1SC 1P0RA 2WDRB 4P7IA 2XNAC 3LDZE 2Y5PA 2DYBA 2AL6A 3CIRB 4FULA 3U7DA 2M4NA 3ZO5B 4ANXA 3WCQA 1ET9A 1IGCA 1ISNA 3X0WA 4BKSA 3ZNZB 5LXHA 1YN4A 1UUPA 2CJNA 2JZPA 1H8CA 2PJHA 1SE3A 4YT0B 1OQYA 3ZGZA 2KWUB 1N61A 4MELA 4E71A 2V4LA 1CQVA 4FJYA 4RNAA 4IM2A 3EUB2 4F1SA 3PLVA 1I4XA 1ZPSA 4M8NA 3U7ZA 1D6EC 2D2QA 4HROA 2KLGA 3ZNHB 4LDTD 3QQ8B 4OZAA 2L0FA 2NBUA 2MBQA 4XDDA 3TUOA 2KMMA 2LD9A 2IO3B 3V6EB 2WXQA 1OEYJ 1AN8A 3QHTA 4ZRKA 4ICVA 4IWOA 3H7SA 1L4DB 5BYQA 4CO7A 1XCTL 1YQ4B 1C78A 3UIOB 4AS1A 3PSEB 1WR6E 1BT0A 3ECIA 1FCCC 4KKJA 4MM3A 1ZE3D 2LASA 2ZW0A 1ROEA 5E6OA 2VH1A 1AWDA 5BMGA 1YIWA 1C4AA 3ZYYX 5IAAC 4GB9A 4C4VA 4KX6B 2OOBB 2L1AA 3PPAA 3W1YA 2JX5A 3AH7A 1BMLC 3RPFC 4AJYB 3ABVB 3AU5A 5TSSA 4FBJB 4DXGA 1NENB 2LUMA 4OVUA 1C4PA 3QA8A 4G11A 2INNE 4USAA 4US9A 4YXDB 3NRZA 3CSFA 2NPTB 4RF1A 2LVPA 1YNTE 3WA0A 4OHJA 2CS4A 1TKEA 2UU7A 5AZFA 3ML8A 3B2FA 2D10A 2KC1A 2LZ6A 1DOYA 4XGAB 4NJ6A 3AE6B 2G4SA 2IZVB 2FIFA 5CHWA 4EKUA 1R4NB 1NYQA 4WQOB 3RI7C 4WWOA 3MC9A 1LO5D 4BVUC 1PDXA 4XWWA 2JWUA 2ZPNA 3UINB 1I4PA 2LI5A 1SSNA 1ZXHA 2PE9A 2ZCCA 1D5XC 4HKQA 5E6JA 4US8A 5TR5A 2JZ3B 4DXAB 2EKEC 1PQSA 4P16A 2KKCA 1FFUA 5DPTA 2D07B 4URKA 1GB1A 2N9LA 3CF6E 4JL9A 2M56B 5EE1A 3AE3B 1FD6A 4GOCA 3BVGA 2IGGA 2ZVNA 2MEKA 2WXLA 3EGRA 2KNBA 3I3TB 1EUVB 1V1PA 3V05A 1HTOA 1VRAB 2BGFA 2KZRA 1OQQA 4FN2A 1ZKHA 2NVUI 1T0YA 4A6QA 2X38A 5H8YE 3AE1B 2KDFB 4O1NA 2R61A 5IN7A 3HHMA 1P3QU 4YWGG 5T8IA 2N7JA 3ZW3A 3JSVB 3AN1A 3B1LX 1UF0A 3DBHB 3R66C 4KSKC 4L2YA 2A5UA 4A90A 1PUTA 2G4DB 2QJLA 3N30A 3QARA 1TKGA 4HDQA 1QOFA 3TJPA 2M17A 2WU2B 1DYQA 2K1FA 2LFIA 3R2TA 4S17A 4LNIA 2M8SA 2WXOA 4MDKE 3AE5B 1WIAA 4RGTA 3CWIA 2KWDA 1E8WA 1QQRA 4HJGE 2IGHA 3L54A 4XC2A 1NVID 2D3BA 2EMTA 2WS3B 4ZOHC 1GOZA 4DHZB 4QAYA 1NEKB 3TCAA 3QK0A 1H4RA 4NAWA 5BMHA 5H92C 5IA7A 5LLIA 1WWTA 1EU3A 2WDTB 1MI0A 2NPTA 1C1YB 3R7RA 3QX1A 4LTUA 3HUIA 2BS2B 1AW7A 4KV2A 4HCPB 5L95C 2CU1A 3VVWB 3P4PB 4W9EA 1V5TA 3W5VB 1KJTA 1WR1A 3NZSA 2JSVX 4TUUA 1V81A 4EUTA 1I4QA 4M01A 2LMCA 3BK1A 2HE7A 2C7NB 1GG3A 1TS5A 1WJ4A 2L83A 1KF6B 2MBEA 2O6VD 2KFJA 4W9LA 1FEHA 3C0RB 1HTQA 4NJ7A 4K7WA 2K8BA 5CTRC 2V3SA 3DWMA 4TV3A 2PMVA 1K53A 4BZAA 3UI3A 4TKNA 3T8MA 4LNKA 2WGSA 1JALA 1DOIA 4OVZA 4M02A 1PGAA 2O6VB 2AL3A 3R3MA 2L05A 1VD2A 2BYFA 3KUZA 2JF5A 2N7EA 2J7QB 3DBLI 4C56C 3Q69A 2L0TA 3NVZA 2VH2A 3PRMB 2WXJA 2YVCA 2K22A 3T3OA 4A8XC 4LNNA 2MH7A 2J52A 4FA6A 1MJDA 1XLPA 2ZNVB 1HA5A 1HE8A 2DYOA 2IY0B 3PZDA 5DPWA 1MPEA 3VXWA 3IXSA 3R8BA 2KX0A 1Q5WB 4C00A 3RD2A 1QLBB 4P6VF 2KWVB 2JRIB 1FO4A 4XZ4A 2YEPF 3M95A 1VCBA 1KLGD 1JW9D 1LM8B 1TY0A 1WYGA 3RN9C 2L3ZA 2BYVE 2J0JA 2KDBA 3AEDB 3VAWA 2BYEA 4PYUA 1C79A 1YX5B 4GU2A 1L2NA 2ZPYA 3AI5A 3DOWA 2GLSA 2BWFA 2KJHB 3MP9A 2B76B 2KN4A 3ZJVA 3GS2A 2KVZA 3D32A 1E7PB 4YTMB 3HK0A 4IWQA 1L6UA 1SB3C 4OZBA 1J19A 2WXGA 2KFKA 2PTLA 4K7UA 2YLMA 5AZHA 3KYDD 1TIFA 3P4RB 2CJOA 4LK0M 1J0GA 3NVVA 4LLGM 1ZUD2 2DZJA 1RFKA 4B9KA 4RGOS 2BT6A 1ZGUB 2MJ3A 2KDEB 4F7ZA 1JMLA 2MA9B 3DDCB 4OZCA 4WQMA 1EM7A 2OJWA 4II2B 3N32A 2L7RA 1WYWB 4ZRIA 3V3XA 3W2DA 1UZXB 1WX9A 1R4MB 2ZCBA 3M3JA 2CHXA 1V2YA 2WU5B 2K8CA 3NS8A 1QOBA 2K39A 2DX5B 4HK2A 4X57B 2REXA 1Y56A 3QC8B 4IKGA 1YN5A 3NG0A 2WNMA 3VUWA 3ZKJC 1DGJA 2MJDA 1V6EA 4GIVA 2PIAA 2G1EA 1JRPA 1UBIA 3E9SA 2NS5A 3I57A 1Y8RC 2RMMA 1P98A 3DBSA 3WALA 2ZZPB 5EE9A 1WJNA 2O6VA 2DNFA 2I2YA 4XWTA 2JZZA 2AEHA 2KACA 4IM0A 3VFKA 1ZP0B 1I7HA 2FCMA 4FHKA 3PS6A 3R2IA 4W9FA 2KDMA 2SEBD 5HI1A 2L00B 2KQ4X 3URYA 5DPSA 5BYSA 3DVNU 2QC8A 4RMAA 1Z2MA 2EELA 4KSLC 2LHEA 2G9HD 5E6PA 4YTPB 2HD5B 3APFA 2CR5A 2RDHA 3Q8CA 5MPOA 1OGWA 4P1CC 4DWFA 2BYTA 3RT3B 1N6ZA 3AV8A 3A9KA 5HHDG 3QIJA 1NI2A 1IGDA 4ZRPA 3EA6A 4WWMA 4FADA 1TZOA 2UYZB 1Q10A 2Y5CA 2V9HA 1V5OA 5JXVA 4GDKA 4ITKA 2OEDA 4WIPA 1WSPA 4WH4A 2JWZA 2VRRB 1FNVA 5C1ZA 2KXJA 2ZW1A 1E0ZA 2L8JA 2V3PA 1SIFA 5J17A 2GMIC 2LGSA 2BB6A 2HDEA 4I6LB 2BPSA 3SDLC 3DVNV 3NJTA 2LWPA 2LGXA 4FXCA 3X23A 1FXTB 2MP2B 2V0GA 3RNAC 2JUOA 3PGEA 3L10B 5J2RA 4WJNA 2OHFA 3QAQA 3O65B 4JX1C 3ZRFA 4GN1A 1TTNA 3T3NA 1KLUD 1S1QB 1KM7A 1R7SA 2I38A 2Y3AA 2HJ1A 3VR9B 3A9JA 2FAZA 3ETRA 2PEAA 3PVLA 2DENB 4K3CA 3V6CB 3Q8EA 3IT4B 3BVMA 4MJSA 4MGKE 4WJPA 1C9FA 4HRSA 2R2QA 1I42A 2BTEA 1JWBD 5C2TB 2JU6X 3PO0A 1RAXA 3AE7B 2DZMA 3GE3C 5G55A 1B9RA 1QKZA 5JHAA 2N4FA 1E8ZA 2D11A 3UQBA 2N7DA 2DLBA 2BKFA 1FXAA 3J9CA 4EZJA 3ZNID 4C80A 3N3KB 2K5PA 3DCGA 4E74A 3S2AA 2IO0B 5LNK1 4A9AA 3FKYA 2NCNA 3DBRB 2MRPA 3V61A 4AOFA 2X8XX 3U4EG 2MBHA 2R2OA 1FXIA 3BIID 4AWJA 2IYDB 2DHZA 5IKCM 3TEYA 3ZDMC 4N9F4 2OJRA 2XN9C 2KJRA 1C76A 3OAWA 2WXIA 1N63A 1SIJA 4YL8A 4NNJB 3VDZA 4KIKB 2FNJB 3VRAB 4M8MA 1T5XD 3AU4A 5EDSA 2J0KA 2WYQA 1TKYA 2GRIA 3N9YC 3I9V1 1SJHD 3H9DA 1EF5A 1XLNA 2WLBA 2C7MB 5G5GA 2KTRB 2LVQA 1RRBA 3IFWB 1XCQL 2BB5A 2IBIB 2KVRA 2J0MA 3AEFB 3BVZA 3IBEA 4C7YA 4B6WA 1A5RA 1LQBA 4Q2JA 3NS1A 3UF8A 2K0PA 2INDC 4RM9A 3ZRCA 2CKHB 4W9DA 4WJOA 1LXDA 3NOBA 5C23A 2FCNA 2LXAA 2N9XA 3A1QB 4ZHOA 1C77A 2JY6A 1YN3A 3IT6B 1AYFA 4IW0A 3A4RA 1T0SC 2FIDA 3QWZB 3N1ZC 1MG4A 5HG2A 3U2SC 3RNGC 3MJ5A 4YSZB 1AARA 5DCNA 2MP2A 3TMPB 1C3TA 2JYTA 1WGRA 2DAFA 1SJED 1TS3A 1YJ1A 4KGSA 4NPNA 3QJZA 2KT7A 4A3PA 3ENEA 3L17A 4ZRQA 4DHJD 3Q6BA 3GP7A 1V8CA 2ZJDA 1ET6A 1ZOYB 4DBGA 1FNWA 2QIEB 2BVCA 1OTRB 1PYWD 4M0WB 1WJ6A 3GOEA 4NQKE 5EE0A 4DHJB 2L76A 4BBNC 5CHVC 4R3DA 3BYTB 1T0RC 3AEEB 1F1HA 1QT9A 2PW9A 1QILA 4MACA 1UNSA 1TS2A 4W9CA 2FE8A 3NHEB 1WE6A 2MJEA 2VZKB 1V86A 1STEA 2IPKD 3VHTC 4IC7B 2DYMA 2YEPB 1SE9A 2N1VA 2E3TA 2W54A 1C4CA 1WRIA 1WY8A 1P7EA 3Q8FA 1I4HA 2ZVOA 1NDDA 2KX3A 3L16A 4OVVA 5GMVA 3MTNB 1WGHA 1VDVA 1GC6A 3NVWA 1CZPA 3B0AA 3WAMA 2M0AA 4A55A 4N6EB 2Y5BB 4W9GA 1WXMA 4OW0A 1JROA 2J53A 2G45B 3Q3MC 2W3RA 2NBVB 1WX7A 3BINA 1OEYA 3OLMD 3ONSA 3E56A 4NQLB 1P9DU 3H1UA 2FCSA 4GSWA 1SF0A 5E6NA 3AE2B 3KYCD 4EEWA 1ZXIA 3A33B 4XX5A 1YJIA 2XK5B 1UD7A 2BKRB 2WP9B 4AP4C 1I4GA 2KTRA 2M1MA 5JZEB 2W82A 1B1ZA 1WE7A 4IG7B 3ZUNA 2BBCA 1JCKB 2FUHB 1IP9A 4LJPB 4BOSC 3ZDTA 3P2BA 4G3XB 3OJ4B 2WXRA 2LRWA 1L0XB 1OFFA 4JPSA 3DHIC 3BYYB 1F52A 1WX8A 2J4XA 2Q5WD 2WQYB 3DPDA 1GJZA 3NY5A 3RMKC 4L23A 1L5PA 3PT2B 3W9CB 1F0ZA 3U30A 3HVZA 1N62A 4IM3A 1K50A 3AE8B 1HQRD 2UWQA 4EZKA 2GBMA 1L6VA 4C7ZA 3OWEB 2IO2B 1F2RC 4BFRA 4D2KA 2BS3B 1J8CA 4HLEA 4JIOU 3VUXA 3KWLA 3K9OB 2NBWB 1YMHE 3JSVA 3LYYA 3DBLB 3NVYA 1IUEA 4N58A 2KDIA 2KOXA 3AEGB 2I1JA 3N1YC 2BQQA 4YTNB 2ACZB 1LGRA 3K9PB 2RPQA 4EFOA 1YX6B 1MHXA 1J7BA 4ANUA 3IAM1 2IY1B 1QOAA 4JWSC 5CHFA 1RYJA 4M0WA 3Q8AA 1KRHA 3BK2A 3U8ZA 1E8YA 3M62B 2CHZA 4IUMB 2KLCA 3TSSA 4EE2A 4ARCA 1RLFA 4ACFA 5IO9A 2MQJA 4NJCA 2MBBB 2PPHA 4KZCA 3VQIA 1FNUA 2RSUA 2D5GA 1HZ6A 1MVKA 4HPMB 1MHHE 4LNFA 4WWNA 2D3GA 1QOGA 2K8HA 3I63C 4RF0A 2LVOA 1D3ZA 3P4QB 4KGTA 3RYTA 1WXAA 4AJWA 5G2NA 3VH3B 4AUQC 1I35A 2WDVB 1D5MC 1XQQA 1HEZE 2ON8A 3PTFC 2AQ2B 4I6NB 2DZKA 4RH6A 4RFBA 1UGMA 3TEXA 1P7FA 5L83A 4YSYB 4MGYE 1V9JA 4PS7A 1DOXA 1WH3A 1JWUD 1YD8U 3CSTA 4WURA 2EKIA 1UGJA 2AX5A 2KC2A 2K25A 2JT4B 4XYCA 4MM3B 2FBWB 5J18A 3GZNI 3T9LA 1L7YA 1V80A 2XEWA 4K7SA 2WWZA 4HDOA 2RDBC 2E6XA 5FK9C 1IPGA 5DPRA 3L13A 4C4VB 3KWVA 3HVDA 1XXGA 2WXKA 2PKOA 3H7PB 1WZ3A 2FCQA 2ASQA 2HTME 2H89B 1N60A 1FCLA 5FR6A 1JWMD 2C9WB 2QDFA 1TY2A 1WI0A 4K3BA 4MSMB 1UH6A 1E6EB 1M94A 2M19A 3EHVA 1Z5SB 1S3SG 3N20C 3H8HA 1V49A 2KYWA 4TQ0A 1K8RB 1P1AA 2JXTA 3Q8BA 4MEMA 4TQ1A 3SR6A 2N9EB 2LXCA 3KH0A 2KO3A 1E9MA 2RGFA 1BXTA 1E90A 2BF8B 1ESFA 2H88B 4II3B 3WIMA 3ALBA 1TYGB 4BOZB 3PRZA 4WJQA 3Q3OC 4ZHPA 2QILA 2ICIA 3CMMB 1ZW7A 2KN5A 2WXHA 4IDIA 2ONQA 4YSXB 1UWMA 1E10A 3AB5A 1VLBA 3TEZA 1KTKA 4EZLA 2N0SB 4WWPA 1N5XA 3ZLZA 1EF1A 4HCNB 1JWAD 2WXFA 4W9KA 3L4PA 1VZ6A 3SD5A 5BO4B 4A20A 3ZIMA 4FJZA 3ZNGC 3SEBA 4ICUA 3AEAB 3H6NA 3HM6X 3WAOA 4PS3A 4B0MA 3IHPC 3WAPA 4ARIA 1V1PB 1WGGA 3JYUA 2Z8LA 2N1WA 3EFUA 3Q2AC 4K81A 4KGRA 3W1SA 4LNOA 2IDYA 4GXBA 1GAQB 4LDTB 4N59A 3VTVA 3Q3JA 1XLOA 3Q3NC 1SE2A 2RR9A 5FR3A 1GNUA 4CYEA 1D4BA 2D3AA 2RD0A 2INCC 2CU3A 3MC8A 1M4VA 1XF5L 3AE9B 4MH8A 5EE3A 2PLPA 3DHGC 5GXGB 3ZXRA 1L0YB 2LEKA 5KHOA 3RNFC 4KVGB 4DDGD 4PT5A 1WM2A 4XE0A 3ZTCA 1J7AA 3DBRI 4RGMA 4W9JA 1XEEA 1ENFA 2HJ8A 3VRBB 2NMQA 2W55A 2GB1A 4XDCA 2MW5A 4EOYA 1K51A 2WHIA 4ASWC 2QSDA 3ZJUA 4ZRJA 3H7PA 2LGDA 1WGDA 2RPVA 3RCZA 1GUAB 1R4NI 2D3CA 1V97A 3MHSD 4JQWC 3VH4B 2QEJC 4NAWB 3RULA 1SBBB 1A70A 1MG8A 1WM3A 1YJJA 2QMTA 3TIXA 3ZTDA 2MBOA 1TT5B 1GB4A 1NYRA 1JQ4A 1FRDA 2BW2A 1ACCA 4DK5A 1HZ5A 2KD0A 5AUKA 3C19A 3KLSX 2QCZA 5G5HA 4DDID 3IAS1 1BUIC 3OG5A 1U4AA 2W3SA 3QCAA 2M0XA 3AEBB 2N9PC 3ZXVA 2DBYA 2JXXA 2INPE 2GBRA 1T6BX 3AE4B 2C60A 3RNEC 2GOWA 4BKGA 5BMIA 2G3QB 3MHZA 3JVZX 5AUIA 1FRRA 2BWES 2LJ5A 2NTSA 2W9NA 3V62A 4FHJA 3UIPB 1XD3B 3MFGA 1G6JA 3MC0B 4F8CB 2NTTA 1CMXB 3DVGX 4KKIA 2IJ0A 4J6IA 3P4SB 5IOIA 2PVGC 3APCA 2C5LC 3AULA 2WXPA 3B08A 3KW5B 4H2AA 3TBLD 1E5WA 4HPLB 1NBFC 2XBBC 2KAJA 3DBHI 1T0QC 4S0RA 4CQNA 4ZDVA 3I5JC 3RUIB 1WXQA 2K6DB 3SFEB 1KLVA 1XLQA 1D5ZC 4ANVA 4AQ7A 2LHDA 2V1YA 4ZYNA 5C3JB 5D3DA 1WJUA 2JQRB 4DQOC 5HKHA 2WX1A 2AQ1B 1KFYB 1FFVA 2MLBA 4PS8A 4CHKA 2BS4B 1UBQA 3KUDB 2KTFA 3PZ8A 3EFCA 1V1OA 3PHXB 1XO3A 3M63B 2O2VB 3VR8B 3A4SC 5D94A 1QF6A 2HTHA 1IBXB 1EU4A 3PZ7A 3HIZA 3LJ3A 2Z0DB 2NR2A 4WAAA 2VZKD 3SFDB 5BYRA 5HFYA 2WXMA 2Z0EB 2JYEA 5D3IB 2IO1B 4MGIE 5LXIB 1E8XA 3PLUA 5I4DA 1F2RI 1J7CA 1WZ0A 3PREA 1JRUA 3Q14C 4MH0E 1NI3A 4KDIC 3L0WB 1RWSA 1EO6A 3FC4A 3TEWA 1KOTA 2KWCA 3KUCB 2KFKB 1XT9B 4M00A 2AWTA 1TS4A 4KZ0A 1UELA 4MT5A 4KDLB 3SU8X 4BBNF 3JW0X 2AQ3B 2LGIA 3EC8A 2KHWB 3APDA 1OQRA 1HXYD 2KK8A 1FMAD 1VZ7A 5FKAC 2EMSA 3FILB 3RZFA 1FIQA 3C8YA 4KIKA 3AXCA 4HKZE 2WDQB 1RFAA 2B3AA 1CJEA 4J3OD 1PGBA 3O13A 4RGNA 1ZDXA 2KMCA 5KHQA 4JLCA 1VZ8A 4A3OA 2MSED 4LCDE 4NZLB 1JWSD 3ZJTA 3NZUA 5JHBA 2K3UA 2A4ZA 3PRPB 1FM0D 1MFWA 3VUYA 4HVBA 1ZDVA 2DAJA 1WMHB 3LXFA 3KVFB 4FLHA 4NAMA 1N5WA 3DHHC 4GDLB 2PVOD 2PE6B 3NUHB 1F77A 2MCNB 1GC7A 1WXSA 2J42A 1L0VB 4W9IA 1SE4A 4ZYSA 1EWYC 3A1QA 4JGHB 1CK1A 1RM6C 1FPYA 1VR9A 3FAHA 3ML9A 2V3NA 1SEBD 4NY0A 4HWIB 2GI9A 3V60A 2JVCA 3UQAA 1TZ1A 1WGYA 3EECA 4P1BC 2LUEA 4K1RB 3Q3FA 3PV1A 4BKSD 2QHOA 2N9KA 3IVFA 1KH0A 2WX0A 3R7QA 1UWXA 2KANA 3GB1A 2JPHA 4E3CA 5CX3A 2RDGA 3HM3A 4LJOB 1YQBA 1SGHA 2O2VA 2V4IB 1Q0WB 3ZQ4A 3BWUD 3B9JA 3A9KB 1IBXA 2KMAA 1WRDB 3IG3A 3RZWC 2WXNA 4L1BA 3DWGC 3OJ3A 1E7VA 1WXVA 2IGDA 3N1XC 3W5UB 3L08A 3SHQA 4GDKB 4BKTA 3AM9A 5JH5C 2LJIA 1K52A 2KJ6A 2FUG1 3B2GA 2KQ7A 1X1MA 1R4MI 2DZIA 4GLSC 2AYOB 1F9JA 3PHWB 5D7GA 2MHJA 3DVGY 4TMAB 1TJEA 4REZA 3AECB 2SAKA 2MWSB 2K9XA 2GBKA 1PGXA 1IYFA 3DQVA 3HRDD 2C7HA 4G0NB 3TL5A 2ZNVC 4PYZA 3KQ4A 3BY4B 1TBEA 2Z59B 3GE8C 5AEKB 3RNBC 4DHZE 3RNCC 1YQ3B 3U52E 1L4ZB 3UGBB 3FILA 4GMVA 3MJWA 1I4RA 3A9JB 1WFYA 1GPXA 4RCOA 3RFZB 4B95A 2GBJA 1WGKA 4JWUC 3P1MA
chains in the Genus database with same CATH topology
2JY6A 4MJSB 2KQSA 3VTVA 3Q3JA 4HXDA 2O6VB 2AL3A 4FJVB 2XK5A 4IW0A 1QZEA 2MX2A 3A4RA 3R3MA 4W9HA 2RR9A 2L05A 1E7UA 1VD2A 1GNUA 2BYFA 2FIDA 3KUZA 3QWZB 4CYEA 2JF5A 2N7EA 2J7QB 1LFDA 2RD0A 3DBLI 2K6QA 2LRUA 1WF9A 2L0TA 4ANWA 2GBNA 3ZVVA 1WMHA 1AARA 3VTUA 2LGYA 5DCNA 2MP2A 3TMPB 1C3TA 1WGRA 3PRMB 2YVCA 2DAFA 1YJ1A 4G50A 4MSQB 4HJKA 5KHOA 3VTWA 3WANA 4KVGB 4DDGD 4NPNA 1WM2A 4GDLA 3QJZA 4FA6A 2ZNVB 2I1KA 4A3PA 3ENEA 3ZTCA 1HE8A 2DYOA 2IY0B 3L17A 3PZDA 3DBRI 4W9JA 4DHJD 1Q1OA 2CHWA 2ZJDA 5DPWA 3VXWA 4RM8A 4IWPA 2HJ8A 4DBGA 2JRHA 1TGZB 2KX0A 1OTRB 2MW5A 1Q5WB 4EOYA 3RD2A 2KWVB 4M0WB 5D2MB 4I6PA 2JRIB 4ASWC 1WJ6A 3GOEA 4MGZE 4NQKE 5D6JB 4DHJB 2L76A 4ZRJA 2ZEQA 2LGDA 3H7PA 4XZ4A 1WGDA 5AZGA 3M95A 5CHVC 4BBNC 1VCBA 4GGQA 3RCZA 1GUAB 1R4NI 1LM8B 3W1SC 1P0RA 4P7IA 2L3ZA 2BYVE 3MHSD 4JQWC 3VH4B 2J0JA 3LDZE 2KDBA 4NAWB 3VAWA 3RULA 1WM3A 1MG8A 2BYEA 3ZTDA 4W9CA 3TIXA 2DYBA 2AL6A 4PYUA 3NHEB 1WE6A 1YX5B 2MBOA 4GU2A 1V86A 1L2NA 2ZPYA 3VHTC 3AI5A 3DOWA 4FULA 4IC7B 2BWFA 2KJHB 3U7DA 2DYMA 2M4NA 3ZO5B 4ANXA 1SE9A 2N1VA 4DK5A 1WY8A 2KD0A 3D32A 1ISNA 3X0WA 4BKSA 3ZNZB 4DDID 3HK0A 4IWQA 1U4AA 5LXHA 2ZVOA 1NDDA 2KX3A 3L16A 4OVVA 5GMVA 3QCAA 2M0XA 1H8CA 1J19A 3MTNB 2PJHA 2KFKA 1WGHA 2N9PC 4K7UA 2JXXA 1OQYA 2YLMA 2KWUB 1GC6A 5AZHA 2GBRA 3KYDD 4MELA 3B0AA 3WAMA 2C60A 4E71A 2GOWA 2V4LA 4BKGA 1J0GA 4FJYA 2Y5BB 2G3QB 2DZJA 3JVZX 1WXMA 4W9GA 4IM2A 4B9KA 4F1SA 3PLVA 2G45B 2BWES 4M8NA 2LJ5A 1ZGUB 2NBVB 1WX7A 3BINA 1OEYA 2KDEB 2W9NA 3OLMD 2MA9B 3DDCB 3ONSA 4FHJA 4NQLB 1P9DU 1XD3B 3UIPB 2D2QA 2FCSA 3H1UA 4II2B 1G6JA 2KLGA 4F8CB 3ZNHB 3N32A 1CMXB 2L7RA 4GSWA 4LDTD 1WYWB 3DVGX 4ZRIA 5E6NA 3QQ8B 4J6IA 3KYCD 4EEWA 1UZXB 3APCA 1WX9A 2C5LC 2L0FA 2NBUA 3A33B 2ZCBA 3M3JA 4XX5A 3AULA 2CHXA 2MBQA 1V2YA 1UD7A 2XK5B 3B08A 2BKRB 2K8CA 3KW5B 2LD9A 3NS8A 4AP4C 3TBLD 1E5WA 4HPLB 1NBFC 2IO3B 2XBBC 3V6EB 2KTRA 2K39A 2DX5B 4HK2A 4X57B 2REXA 2M1MA 3DBHI 3QC8B 1OEYJ 5JZEB 3QHTA 3VUWA 4ZDVA 3ZKJC 4ZRKA 4ICVA 3RUIB 1WE7A 4IWOA 4IG7B 3ZUNA 2K6DB 2FUHB 1IP9A 4LJPB 3H7SA 1V6EA 4BOSC 1KLVA 3ZDTA 3P2BA 4G3XB 4GIVA 3OJ4B 4ANVA 2LRWA 2V1YA 4CO7A 4ZYNA 1WJUA 1UBIA 2NS5A 3DPDA 1WX8A 3UIOB 1Y8RC 1GJZA 3NY5A 3PSEB 1WR6E 1BT0A 5HKHA 1P98A 2WX1A 3ECIA 3DBSA 3WALA 3PT2B 2MLBA 4MM3A 2ZZPB 2LASA 4PS8A 5E6OA 3U30A 4CHKA 1UBQA 4IM3A 3KUDB 2UWQA 2KTFA 1WJNA 3PHXB 2GBMA 4EZKA 2O6VA 3M63B 1YIWA 2O2VB 3A4SC 2IO2B 5IAAC 4BFRA 1J8CA 4GB9A 2JZZA 2AEHA 2OOBB 4IM0A 5D94A 3VFKA 4HLEA 2HTHA 4JIOU 3VUXA 3PPAA 3W1YA 3HIZA 3K9OB 2NBWB 3LJ3A 2Z0DB 3JSVA 2NR2A 4AJYB 4WAAA 2FCMA 3AU5A 4FHKA 3PS6A 4W9FA 2KDIA 2KOXA 4FBJB 2Z0EB 2IO1B 4MGIE 2L00B 5LXIB 1E8XA 3PLUA 5DPSA 3DVNU 4OVUA 1WZ0A 3PREA 1Z2MA 4RMAA 2I1JA 1JRUA 4KSLC 3QA8A 4G11A 4MH0E 5E6PA 4F7ZA 4KDIC 3L0WB 2HD5B 3K9PB 2RPQA 4EFOA 3APFA 1YX6B 3CSFA 2NPTB 1EO6A 2CR5A 2LVPA 1KOTA 4ANUA 3WA0A 2KWCA 2CS4A 3KUCB 5AZFA 2IY1B 2KFKB 3ML8A 2D10A 1OGWA 2KC1A 2LZ6A 1XT9B 5CHFA 4DWFA 2AWTA 4KZ0A 3U8ZA 1UELA 1E8YA 3RT3B 3M62B 2CHZA 4IUMB 2KLCA 3A9KA 4KDLB 4NJ6A 3QIJA 3SU8X 1NI2A 2G4SA 2IZVB 4BBNF 1RLFA 3JW0X 2FIFA 5CHWA 2MQJA 2MBBB 2PPHA 4EKUA 4KZCA 4WQOB 3VQIA 3EC8A 3V62A 2RSUA 4FADA 2KHWB 4WWOA 2UYZB 3APDA 4HPMB 4BVUC 4WWNA 2KK8A 2D3GA 1V5OA 2K8HA 4GDKA 2ZPNA 3UINB 2LI5A 2ZCCA 2PE9A 2JWZA 2VRRB 2LVOA 2EMSA 1D3ZA 5C1ZA 2KXJA 3RZFA 3RYTA 4KIKA 1WXAA 4AJWA 3AXCA 5G2NA 2L8JA 1RFAA 2B3AA 5TR5A 3VH3B 4AUQC 1SIFA 1I35A 5J17A 2JZ3B 4DXAB 2GMIC 2EKEC 1XQQA 1PQSA 2KMCA 5KHQA 4JLCA 2KKCA 3PTFC 5DPTA 4A3OA 2MSED 4LCDE 4I6NB 2D07B 2DZKA 3NZUA 4I6LB 2BPSA 4URKA 5JHBA 1UGMA 2A4ZA 3SDLC 3PRPB 3CF6E 3DVNV 3VUYA 4HVBA 2LWPA 5L83A 2DAJA 4MGYE 2LGXA 4JL9A 1V9JA 1WMHB 4PS7A 3X23A 1WH3A 1FXTB 1YD8U 2MP2B 3CSTA 3KVFB 4FLHA 2JUOA 3PGEA 3L10B 4GOCA 4WJNA 5J2RA 3QAQA 2KC2A 2ZVNA 2K25A 2KNBA 3I3TB 2JT4B 4GDLB 1EUVB 2PE6B 2MCNB 3O65B 3ZRFA 5J18A 4GN1A 1GC7A 1TTNA 2BGFA 2KZRA 1WXSA 4FN2A 1ZKHA 3GZNI 1S1QB 1L7YA 3T9LA 1V80A 1KM7A 1T0YA 2NVUI 2XEWA 4K7SA 4W9IA 2WWZA 4HDOA 3A9JA 1IPGA 2FAZA 2KDFB 5DPRA 3L13A 2PEAA 3PVLA 2DENB 3A1QA 4JGHB 3ML9A 3V6CB 3HHMA 1P3QU 4MJSA 4MGKE 3ZW3A 3JSVB 4WJPA 3B1LX 4NY0A 3H7PB 1WZ3A 4HWIB 2FCQA 3R66C 4KSKC 3V60A 2A5UA 2R2QA 2ASQA 2JVCA 3UQAA 1I42A 1TZ1A 2G4DB 1WGYA 3EECA 2LUEA 3N30A 4K1RB 3Q3FA 3PV1A 3QARA 5FR6A 4HDQA 4BKSD 3TJPA 2C9WB 2M17A 2QHOA 5G55A 1RAXA 2DZMA 2K1FA 1WI0A 3IVFA 2WX0A 2M8SA 4MSMB 3R7QA 2N4FA 5JHAA 1E8ZA 2D11A 1UH6A 4MDKE 1M94A 3UQBA 2KANA 3EHVA 1Z5SB 2N7DA 2JPHA 2BKFA 4E3CA 1S3SG 5CX3A 1WIAA 4EZJA 3HM3A 3ZNID 3N3KB 1E8WA 4LJOB 1V49A 1SGHA 1YQBA 3DCGA 2O2VA 4E74A 1K8RB 1P1AA 2IO0B 3S2AA 1Q0WB 4TQ0A 2NCNA 3L54A 2MRPA 4MEMA 4TQ1A 4XC2A 3V61A 2N9EB 2LXCA 3A9KB 3KH0A 4AOFA 2KO3A 2KMAA 1WRDB 3IG3A 2EMTA 2MBHA 2RGFA 2R2OA 1E90A 3RZWC 4AWJA 3OJ3A 4DHZB 1E7VA 2IYDB 2BF8B 4II3B 1WXVA 2DHZA 3TCAA 3WIMA 3QK0A 3ALBA 3ZDMC 4N9F4 4BOZB 3L08A 3SHQA 1H4RA 2OJRA 3PRZA 4GDKB 4WJQA 2KJRA 4BKTA 4NAWA 5JH5C 3OAWA 2KJ6A 3CMMB 1ZW7A 4YL8A 4NNJB 3VDZA 2KN5A 2KQ7A 1X1MA 5IA7A 4KIKB 5LLIA 2FNJB 4M8MA 1R4MI 2DZIA 2NPTA 2WDTB 1C1YB 4EZLA 3AU4A 5EDSA 2J0KA 4WWPA 3R7RA 3QX1A 2WYQA 2AYOB 1F9JA 3ZLZA 1EF1A 3PHWB 4HCNB 5D7GA 3DVGY 3H9DA 4KV2A 1EF5A 4W9KA 4HCPB 2MWSB 5L95C 2CU1A 3SD5A 2C7MB 2GBKA 2KTRB 1IYFA 3DQVA 3VVWB 2LVQA 2C7HA 5BO4B 4G0NB 1RRBA 4A20A 3IFWB 3TL5A 4W9EA 1V5TA 2ZNVC 1KJTA 4FJZA 1WR1A 3ZIMA 3NZSA 4TUUA 4PYZA 1V81A 3BY4B 2KVRA 2IBIB 3IBEA 1TBEA 2J0MA 3ZNGC 4EUTA 2Z59B 4ICUA 4B6WA 3H6NA 2HE7A 5AEKB 1A5RA 1LQBA 3HM6X 3WAOA 2C7NB 1GG3A 4PS3A 3UF8A 4RM9A 1WJ4A 4DHZE 3IHPC 3WAPA 3ZRCA 2CKHB 2MBEA 4W9DA 1WGGA 2O6VD 2KFJA 4WJOA 4W9LA 3C0RB 3JYUA 4NJ7A 4K7WA 2K8BA 3UGBB 5CTRC 1LXDA 2V3SA 4GMVA 4TV3A 2N1WA 3MJWA 3EFUA 3NOBA 3A9JB 4K81A 1WFYA 3W1SA 5C23A 2FCNA 2LXAA 4GXBA 4TKNA 3T8MA 2N9XA 3A1QB 4B95A 2GBJA 4LDTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JY6 A;  4MJS B;  2KQS A;  3VTV A;  3Q3J A;  4HXD A;  2O6V B;  2AL3 A;  4FJV B;  2XK5 A;  4IW0 A;  1QZE A;  2MX2 A;  3A4R A;  3R3M A;  4W9H A;  2RR9 A;  2L05 A;  1E7U A;  1VD2 A;  1GNU A;  2BYF A;  2FID A;  3KUZ A;  3QWZ B;  4CYE A;  2JF5 A;  2N7E A;  2J7Q B;  1LFD A;  2RD0 A;  3DBL I;  2K6Q A;  2LRU A;  1WF9 A;  2L0T A;  4ANW A;  2GBN A;  3ZVV A;  1WMH A;  1AAR A;  3VTU A;  2LGY A;  5DCN A;  2MP2 A;  3TMP B;  1C3T A;  1WGR A;  3PRM B;  2YVC A;  2DAF A;  1YJ1 A;  4G50 A;  4MSQ B;  4HJK A;  5KHO A;  3VTW A;  3WAN A;  4KVG B;  4DDG D;  4NPN A;  1WM2 A;  4GDL A;  3QJZ A;  4FA6 A;  2ZNV B;  2I1K A;  4A3P A;  3ENE A;  3ZTC A;  1HE8 A;  2DYO A;  2IY0 B;  3L17 A;  3PZD A;  3DBR I;  4W9J A;  4DHJ D;  1Q1O A;  2CHW A;  2ZJD A;  5DPW A;  3VXW A;  4RM8 A;  4IWP A;  2HJ8 A;  4DBG A;  2JRH A;  1TGZ B;  2KX0 A;  1OTR B;  2MW5 A;  1Q5W B;  4EOY A;  3RD2 A;  2KWV B;  4M0W B;  5D2M B;  4I6P A;  2JRI B;  4ASW C;  1WJ6 A;  3GOE A;  4MGZ E;  4NQK E;  5D6J B;  4DHJ B;  2L76 A;  4ZRJ A;  2ZEQ A;  2LGD A;  3H7P A;  4XZ4 A;  1WGD A;  5AZG A;  3M95 A;  5CHV C;  4BBN C;  1VCB A;  4GGQ A;  3RCZ A;  1GUA B;  1R4N I;  1LM8 B;  3W1S C;  1P0R A;  4P7I A;  2L3Z A;  2BYV E;  3MHS D;  4JQW C;  3VH4 B;  2J0J A;  3LDZ E;  2KDB A;  4NAW B;  3VAW A;  3RUL A;  1WM3 A;  1MG8 A;  2BYE A;  3ZTD A;  4W9C A;  3TIX A;  2DYB A;  2AL6 A;  4PYU A;  3NHE B;  1WE6 A;  1YX5 B;  2MBO A;  4GU2 A;  1V86 A;  1L2N A;  2ZPY A;  3VHT C;  3AI5 A;  3DOW A;  4FUL A;  4IC7 B;  2BWF A;  2KJH B;  3U7D A;  2DYM A;  2M4N A;  3ZO5 B;  4ANX A;  1SE9 A;  2N1V A;  4DK5 A;  1WY8 A;  2KD0 A;  3D32 A;  1ISN A;  3X0W A;  4BKS A;  3ZNZ B;  4DDI D;  3HK0 A;  4IWQ A;  1U4A A;  5LXH A;  2ZVO A;  1NDD A;  2KX3 A;  3L16 A;  4OVV A;  5GMV A;  3QCA A;  2M0X A;  1H8C A;  1J19 A;  3MTN B;  2PJH A;  2KFK A;  1WGH A;  2N9P C;  4K7U A;  2JXX A;  1OQY A;  2YLM A;  2KWU B;  1GC6 A;  5AZH A;  2GBR A;  3KYD D;  4MEL A;  3B0A A;  3WAM A;  2C60 A;  4E71 A;  2GOW A;  2V4L A;  4BKG A;  1J0G A;  4FJY A;  2Y5B B;  2G3Q B;  2DZJ A;  3JVZ X;  1WXM A;  4W9G A;  4IM2 A;  4B9K A;  4F1S A;  3PLV A;  2G45 B;  2BWE S;  4M8N A;  2LJ5 A;  1ZGU B;  2NBV B;  1WX7 A;  3BIN A;  1OEY A;  2KDE B;  2W9N A;  3OLM D;  2MA9 B;  3DDC B;  3ONS A;  4FHJ A;  4NQL B;  1P9D U;  1XD3 B;  3UIP B;  2D2Q A;  2FCS A;  3H1U A;  4II2 B;  1G6J A;  2KLG A;  4F8C B;  3ZNH B;  3N32 A;  1CMX B;  2L7R A;  4GSW A;  4LDT D;  1WYW B;  3DVG X;  4ZRI A;  5E6N A;  3QQ8 B;  4J6I A;  3KYC D;  4EEW A;  1UZX B;  3APC A;  1WX9 A;  2C5L C;  2L0F A;  2NBU A;  3A33 B;  2ZCB A;  3M3J A;  4XX5 A;  3AUL A;  2CHX A;  2MBQ A;  1V2Y A;  1UD7 A;  2XK5 B;  3B08 A;  2BKR B;  2K8C A;  3KW5 B;  2LD9 A;  3NS8 A;  4AP4 C;  3TBL D;  1E5W A;  4HPL B;  1NBF C;  2IO3 B;  2XBB C;  3V6E B;  2KTR A;  2K39 A;  2DX5 B;  4HK2 A;  4X57 B;  2REX A;  2M1M A;  3DBH I;  3QC8 B;  1OEY J;  5JZE B;  3QHT A;  3VUW A;  4ZDV A;  3ZKJ C;  4ZRK A;  4ICV A;  3RUI B;  1WE7 A;  4IWO A;  4IG7 B;  3ZUN A;  2K6D B;  2FUH B;  1IP9 A;  4LJP B;  3H7S A;  1V6E A;  4BOS C;  1KLV A;  3ZDT A;  3P2B A;  4G3X B;  4GIV A;  3OJ4 B;  4ANV A;  2LRW A;  2V1Y A;  4CO7 A;  4ZYN A;  1WJU A;  1UBI A;  2NS5 A;  3DPD A;  1WX8 A;  3UIO B;  1Y8R C;  1GJZ A;  3NY5 A;  3PSE B;  1WR6 E;  1BT0 A;  5HKH A;  1P98 A;  2WX1 A;  3ECI A;  3DBS A;  3WAL A;  3PT2 B;  2MLB A;  4MM3 A;  2ZZP B;  2LAS A;  4PS8 A;  5E6O A;  3U30 A;  4CHK A;  1UBQ A;  4IM3 A;  3KUD B;  2UWQ A;  2KTF A;  1WJN A;  3PHX B;  2GBM A;  4EZK A;  2O6V A;  3M63 B;  1YIW A;  2O2V B;  3A4S C;  2IO2 B;  5IAA C;  4BFR A;  1J8C A;  4GB9 A;  2JZZ A;  2AEH A;  2OOB B;  4IM0 A;  5D94 A;  3VFK A;  4HLE A;  2HTH A;  4JIO U;  3VUX A;  3PPA A;  3W1Y A;  3HIZ A;  3K9O B;  2NBW B;  3LJ3 A;  2Z0D B;  3JSV A;  2NR2 A;  4AJY B;  4WAA A;  2FCM A;  3AU5 A;  4FHK A;  3PS6 A;  4W9F A;  2KDI A;  2KOX A;  4FBJ B;  2Z0E B;  2IO1 B;  4MGI E;  2L00 B;  5LXI B;  1E8X A;  3PLU A;  5DPS A;  3DVN U;  4OVU A;  1WZ0 A;  3PRE A;  1Z2M A;  4RMA A;  2I1J A;  1JRU A;  4KSL C;  3QA8 A;  4G11 A;  4MH0 E;  5E6P A;  4F7Z A;  4KDI C;  3L0W B;  2HD5 B;  3K9P B;  2RPQ A;  4EFO A;  3APF A;  1YX6 B;  3CSF A;  2NPT B;  1EO6 A;  2CR5 A;  2LVP A;  1KOT A;  4ANU A;  3WA0 A;  2KWC A;  2CS4 A;  3KUC B;  5AZF A;  2IY1 B;  2KFK B;  3ML8 A;  2D10 A;  1OGW A;  2KC1 A;  2LZ6 A;  1XT9 B;  5CHF A;  4DWF A;  2AWT A;  4KZ0 A;  3U8Z A;  1UEL A;  1E8Y A;  3RT3 B;  3M62 B;  2CHZ A;  4IUM B;  2KLC A;  3A9K A;  4KDL B;  4NJ6 A;  3QIJ A;  3SU8 X;  1NI2 A;  2G4S A;  2IZV B;  4BBN F;  1RLF A;  3JW0 X;  2FIF A;  5CHW A;  2MQJ A;  2MBB B;  2PPH A;  4EKU A;  4KZC A;  4WQO B;  3VQI A;  3EC8 A;  3V62 A;  2RSU A;  4FAD A;  2KHW B;  4WWO A;  2UYZ B;  3APD A;  4HPM B;  4BVU C;  4WWN A;  2KK8 A;  2D3G A;  1V5O A;  2K8H A;  4GDK A;  2ZPN A;  3UIN B;  2LI5 A;  2ZCC A;  2PE9 A;  2JWZ A;  2VRR B;  2LVO A;  2EMS A;  1D3Z A;  5C1Z A;  2KXJ A;  3RZF A;  3RYT A;  4KIK A;  1WXA A;  4AJW A;  3AXC A;  5G2N A;  2L8J A;  1RFA A;  2B3A A;  5TR5 A;  3VH3 B;  4AUQ C;  1SIF A;  1I35 A;  5J17 A;  2JZ3 B;  4DXA B;  2GMI C;  2EKE C;  1XQQ A;  1PQS A;  2KMC A;  5KHQ A;  4JLC A;  2KKC A;  3PTF C;  5DPT A;  4A3O A;  2MSE D;  4LCD E;  4I6N B;  2D07 B;  2DZK A;  3NZU A;  4I6L B;  2BPS A;  4URK A;  5JHB A;  1UGM A;  2A4Z A;  3SDL C;  3PRP B;  3CF6 E;  3DVN V;  3VUY A;  4HVB A;  2LWP A;  5L83 A;  2DAJ A;  4MGY E;  2LGX A;  4JL9 A;  1V9J A;  1WMH B;  4PS7 A;  3X23 A;  1WH3 A;  1FXT B;  1YD8 U;  2MP2 B;  3CST A;  3KVF B;  4FLH A;  2JUO A;  3PGE A;  3L10 B;  4GOC A;  4WJN A;  5J2R A;  3QAQ A;  2KC2 A;  2ZVN A;  2K25 A;  2KNB A;  3I3T B;  2JT4 B;  4GDL B;  1EUV B;  2PE6 B;  2MCN B;  3O65 B;  3ZRF A;  5J18 A;  4GN1 A;  1GC7 A;  1TTN A;  2BGF A;  2KZR A;  1WXS A;  4FN2 A;  1ZKH A;  3GZN I;  1S1Q B;  1L7Y A;  3T9L A;  1V80 A;  1KM7 A;  1T0Y A;  2NVU I;  2XEW A;  4K7S A;  4W9I A;  2WWZ A;  4HDO A;  3A9J A;  1IPG A;  2FAZ A;  2KDF B;  5DPR A;  3L13 A;  2PEA A;  3PVL A;  2DEN B;  3A1Q A;  4JGH B;  3ML9 A;  3V6C B;  3HHM A;  1P3Q U;  4MJS A;  4MGK E;  3ZW3 A;  3JSV B;  4WJP A;  3B1L X;  4NY0 A;  3H7P B;  1WZ3 A;  4HWI B;  2FCQ A;  3R66 C;  4KSK C;  3V60 A;  2A5U A;  2R2Q A;  2ASQ A;  2JVC A;  3UQA A;  1I42 A;  1TZ1 A;  2G4D B;  1WGY A;  3EEC A;  2LUE A;  3N30 A;  4K1R B;  3Q3F A;  3PV1 A;  3QAR A;  5FR6 A;  4HDQ A;  4BKS D;  3TJP A;  2C9W B;  2M17 A;  2QHO A;  5G55 A;  1RAX A;  2DZM A;  2K1F A;  1WI0 A;  3IVF A;  2WX0 A;  2M8S A;  4MSM B;  3R7Q A;  2N4F A;  5JHA A;  1E8Z A;  2D11 A;  1UH6 A;  4MDK E;  1M94 A;  3UQB A;  2KAN A;  3EHV A;  1Z5S B;  2N7D A;  2JPH A;  2BKF A;  4E3C A;  1S3S G;  5CX3 A;  1WIA A;  4EZJ A;  3HM3 A;  3ZNI D;  3N3K B;  1E8W A;  4LJO B;  1V49 A;  1SGH A;  1YQB A;  3DCG A;  2O2V A;  4E74 A;  1K8R B;  1P1A A;  2IO0 B;  3S2A A;  1Q0W B;  4TQ0 A;  2NCN A;  3L54 A;  2MRP A;  4MEM A;  4TQ1 A;  4XC2 A;  3V61 A;  2N9E B;  2LXC A;  3A9K B;  3KH0 A;  4AOF A;  2KO3 A;  2KMA A;  1WRD B;  3IG3 A;  2EMT A;  2MBH A;  2RGF A;  2R2O A;  1E90 A;  3RZW C;  4AWJ A;  3OJ3 A;  4DHZ B;  1E7V A;  2IYD B;  2BF8 B;  4II3 B;  1WXV A;  2DHZ A;  3TCA A;  3WIM A;  3QK0 A;  3ALB A;  3ZDM C;  4N9F 4;  4BOZ B;  3L08 A;  3SHQ A;  1H4R A;  2OJR A;  3PRZ A;  4GDK B;  4WJQ A;  2KJR A;  4BKT A;  4NAW A;  5JH5 C;  3OAW A;  2KJ6 A;  3CMM B;  1ZW7 A;  4YL8 A;  4NNJ B;  3VDZ A;  2KN5 A;  2KQ7 A;  1X1M A;  5IA7 A;  4KIK B;  5LLI A;  2FNJ B;  4M8M A;  1R4M I;  2DZI A;  2NPT A;  2WDT B;  1C1Y B;  4EZL A;  3AU4 A;  5EDS A;  2J0K A;  4WWP A;  3R7R A;  3QX1 A;  2WYQ A;  2AYO B;  1F9J A;  3ZLZ A;  1EF1 A;  3PHW B;  4HCN B;  5D7G A;  3DVG Y;  3H9D A;  4KV2 A;  1EF5 A;  4W9K A;  4HCP B;  2MWS B;  5L95 C;  2CU1 A;  3SD5 A;  2C7M B;  2GBK A;  2KTR B;  1IYF A;  3DQV A;  3VVW B;  2LVQ A;  2C7H A;  5BO4 B;  4G0N B;  1RRB A;  4A20 A;  3IFW B;  3TL5 A;  4W9E A;  1V5T A;  2ZNV C;  1KJT A;  4FJZ A;  1WR1 A;  3ZIM A;  3NZS A;  4TUU A;  4PYZ A;  1V81 A;  3BY4 B;  2KVR A;  2IBI B;  3IBE A;  1TBE A;  2J0M A;  3ZNG C;  4EUT A;  2Z59 B;  4ICU A;  4B6W A;  3H6N A;  2HE7 A;  5AEK B;  1A5R A;  1LQB A;  3HM6 X;  3WAO A;  2C7N B;  1GG3 A;  4PS3 A;  3UF8 A;  4RM9 A;  1WJ4 A;  4DHZ E;  3IHP C;  3WAP A;  3ZRC A;  2CKH B;  2MBE A;  4W9D A;  1WGG A;  2O6V D;  2KFJ A;  4WJO A;  4W9L A;  3C0R B;  3JYU A;  4NJ7 A;  4K7W A;  2K8B A;  3UGB B;  5CTR C;  1LXD A;  2V3S A;  4GMV A;  4TV3 A;  2N1W A;  3MJW A;  3EFU A;  3NOB A;  3A9J B;  4K81 A;  1WFY A;  3W1S A;  5C23 A;  2FCN A;  2LXA A;  4GXB A;  4TKN A;  3T8M A;  2N9X A;  3A1Q B;  4B95 A;  2GBJ A;  4LDT B; 
#chains in the Genus database with same CATH topology
 4HEA 1;  2TSS A;  2KQS A;  1VJK A;  4MJS B;  5IP4 D;  4HXD A;  4FJV B;  2XK5 A;  1QZE A;  2MX2 A;  4W9H A;  1E7U A;  1LFD A;  2K6Q A;  2LRU A;  1WF9 A;  1T3Q A;  4ANW A;  2GBN A;  4WAF A;  3ZVV A;  4B0E A;  4PK1 A;  1WMH A;  3VTU A;  2LGY A;  3P42 A;  3NZ3 A;  4BAX A;  4DXF A;  3P63 A;  4G50 A;  1EWC A;  4MSQ B;  4HJK A;  3WAN A;  3VTW A;  4GDL A;  2L52 A;  3LB8 C;  2I1K A;  1YOV B;  3BZD B;  1PFD A;  1SXT A;  2L32 A;  1Q1O A;  2CHW A;  4HPP A;  4IWP A;  4RM8 A;  4UDU C;  3AMZ A;  3GZN B;  2JRH A;  4IOI E;  1TGZ B;  5D2M B;  4I6P A;  4MGZ E;  5D6J B;  4JE3 B;  2ZEQ A;  5AZG A;  2DWQ A;  4GGQ A;  4TSS A;  3W1S C;  1P0R A;  2WDR B;  4P7I A;  2XNA C;  3LDZ E;  2Y5P A;  2DYB A;  2AL6 A;  3CIR B;  4FUL A;  3U7D A;  2M4N A;  3ZO5 B;  4ANX A;  3WCQ A;  1ET9 A;  1IGC A;  1ISN A;  3X0W A;  4BKS A;  3ZNZ B;  5LXH A;  1YN4 A;  1UUP A;  2CJN A;  2JZP A;  1H8C A;  2PJH A;  1SE3 A;  4YT0 B;  1OQY A;  3ZGZ A;  2KWU B;  1N61 A;  4MEL A;  4E71 A;  2V4L A;  1CQV A;  4FJY A;  4RNA A;  4IM2 A;  3EUB 2;  4F1S A;  3PLV A;  1I4X A;  1ZPS A;  4M8N A;  3U7Z A;  1D6E C;  2D2Q A;  4HRO A;  2KLG A;  3ZNH B;  4LDT D;  3QQ8 B;  4OZA A;  2L0F A;  2NBU A;  2MBQ A;  4XDD A;  3TUO A;  2KMM A;  2LD9 A;  2IO3 B;  3V6E B;  2WXQ A;  1OEY J;  1AN8 A;  3QHT A;  4ZRK A;  4ICV A;  4IWO A;  3H7S A;  1L4D B;  5BYQ A;  4CO7 A;  1XCT L;  1YQ4 B;  1C78 A;  3UIO B;  4AS1 A;  3PSE B;  1WR6 E;  1BT0 A;  3ECI A;  1FCC C;  4KKJ A;  4MM3 A;  1ZE3 D;  2LAS A;  2ZW0 A;  1ROE A;  5E6O A;  2VH1 A;  1AWD A;  5BMG A;  1YIW A;  1C4A A;  3ZYY X;  5IAA C;  4GB9 A;  4C4V A;  4KX6 B;  2OOB B;  2L1A A;  3PPA A;  3W1Y A;  2JX5 A;  3AH7 A;  1BML C;  3RPF C;  4AJY B;  3ABV B;  3AU5 A;  5TSS A;  4FBJ B;  4DXG A;  1NEN B;  2LUM A;  4OVU A;  1C4P A;  3QA8 A;  4G11 A;  2INN E;  4USA A;  4US9 A;  4YXD B;  3NRZ A;  3CSF A;  2NPT B;  4RF1 A;  2LVP A;  1YNT E;  3WA0 A;  4OHJ A;  2CS4 A;  1TKE A;  2UU7 A;  5AZF A;  3ML8 A;  3B2F A;  2D10 A;  2KC1 A;  2LZ6 A;  1DOY A;  4XGA B;  4NJ6 A;  3AE6 B;  2G4S A;  2IZV B;  2FIF A;  5CHW A;  4EKU A;  1R4N B;  1NYQ A;  4WQO B;  3RI7 C;  4WWO A;  3MC9 A;  1LO5 D;  4BVU C;  1PDX A;  4XWW A;  2JWU A;  2ZPN A;  3UIN B;  1I4P A;  2LI5 A;  1SSN A;  1ZXH A;  2PE9 A;  2ZCC A;  1D5X C;  4HKQ A;  5E6J A;  4US8 A;  5TR5 A;  2JZ3 B;  4DXA B;  2EKE C;  1PQS A;  4P16 A;  2KKC A;  1FFU A;  5DPT A;  2D07 B;  4URK A;  1GB1 A;  2N9L A;  3CF6 E;  4JL9 A;  2M56 B;  5EE1 A;  3AE3 B;  1FD6 A;  4GOC A;  3BVG A;  2IGG A;  2ZVN A;  2MEK A;  2WXL A;  3EGR A;  2KNB A;  3I3T B;  1EUV B;  1V1P A;  3V05 A;  1HTO A;  1VRA B;  2BGF A;  2KZR A;  1OQQ A;  4FN2 A;  1ZKH A;  2NVU I;  1T0Y A;  4A6Q A;  2X38 A;  5H8Y E;  3AE1 B;  2KDF B;  4O1N A;  2R61 A;  5IN7 A;  3HHM A;  1P3Q U;  4YWG G;  5T8I A;  2N7J A;  3ZW3 A;  3JSV B;  3AN1 A;  3B1L X;  1UF0 A;  3DBH B;  3R66 C;  4KSK C;  4L2Y A;  2A5U A;  4A90 A;  1PUT A;  2G4D B;  2QJL A;  3N30 A;  3QAR A;  1TKG A;  4HDQ A;  1QOF A;  3TJP A;  2M17 A;  2WU2 B;  1DYQ A;  2K1F A;  2LFI A;  3R2T A;  4S17 A;  4LNI A;  2M8S A;  2WXO A;  4MDK E;  3AE5 B;  1WIA A;  4RGT A;  3CWI A;  2KWD A;  1E8W A;  1QQR A;  4HJG E;  2IGH A;  3L54 A;  4XC2 A;  1NVI D;  2D3B A;  2EMT A;  2WS3 B;  4ZOH C;  1GOZ A;  4DHZ B;  4QAY A;  1NEK B;  3TCA A;  3QK0 A;  1H4R A;  4NAW A;  5BMH A;  5H92 C;  5IA7 A;  5LLI A;  1WWT A;  1EU3 A;  2WDT B;  1MI0 A;  2NPT A;  1C1Y B;  3R7R A;  3QX1 A;  4LTU A;  3HUI A;  2BS2 B;  1AW7 A;  4KV2 A;  4HCP B;  5L95 C;  2CU1 A;  3VVW B;  3P4P B;  4W9E A;  1V5T A;  3W5V B;  1KJT A;  1WR1 A;  3NZS A;  2JSV X;  4TUU A;  1V81 A;  4EUT A;  1I4Q A;  4M01 A;  2LMC A;  3BK1 A;  2HE7 A;  2C7N B;  1GG3 A;  1TS5 A;  1WJ4 A;  2L83 A;  1KF6 B;  2MBE A;  2O6V D;  2KFJ A;  4W9L A;  1FEH A;  3C0R B;  1HTQ A;  4NJ7 A;  4K7W A;  2K8B A;  5CTR C;  2V3S A;  3DWM A;  4TV3 A;  2PMV A;  1K53 A;  4BZA A;  3UI3 A;  4TKN A;  3T8M A;  4LNK A;  2WGS A;  1JAL A;  1DOI A;  4OVZ A;  4M02 A;  1PGA A;  2O6V B;  2AL3 A;  3R3M A;  2L05 A;  1VD2 A;  2BYF A;  3KUZ A;  2JF5 A;  2N7E A;  2J7Q B;  3DBL I;  4C56 C;  3Q69 A;  2L0T A;  3NVZ A;  2VH2 A;  3PRM B;  2WXJ A;  2YVC A;  2K22 A;  3T3O A;  4A8X C;  4LNN A;  2MH7 A;  2J52 A;  4FA6 A;  1MJD A;  1XLP A;  2ZNV B;  1HA5 A;  1HE8 A;  2DYO A;  2IY0 B;  3PZD A;  5DPW A;  1MPE A;  3VXW A;  3IXS A;  3R8B A;  2KX0 A;  1Q5W B;  4C00 A;  3RD2 A;  1QLB B;  4P6V F;  2KWV B;  2JRI B;  1FO4 A;  4XZ4 A;  2YEP F;  3M95 A;  1VCB A;  1KLG D;  1JW9 D;  1LM8 B;  1TY0 A;  1WYG A;  3RN9 C;  2L3Z A;  2BYV E;  2J0J A;  2KDB A;  3AED B;  3VAW A;  2BYE A;  4PYU A;  1C79 A;  1YX5 B;  4GU2 A;  1L2N A;  2ZPY A;  3AI5 A;  3DOW A;  2GLS A;  2BWF A;  2KJH B;  3MP9 A;  2B76 B;  2KN4 A;  3ZJV A;  3GS2 A;  2KVZ A;  3D32 A;  1E7P B;  4YTM B;  3HK0 A;  4IWQ A;  1L6U A;  1SB3 C;  4OZB A;  1J19 A;  2WXG A;  2KFK A;  2PTL A;  4K7U A;  2YLM A;  5AZH A;  3KYD D;  1TIF A;  3P4R B;  2CJO A;  4LK0 M;  1J0G A;  3NVV A;  4LLG M;  1ZUD 2;  2DZJ A;  1RFK A;  4B9K A;  4RGO S;  2BT6 A;  1ZGU B;  2MJ3 A;  2KDE B;  4F7Z A;  1JML A;  2MA9 B;  3DDC B;  4OZC A;  4WQM A;  1EM7 A;  2OJW A;  4II2 B;  3N32 A;  2L7R A;  1WYW B;  4ZRI A;  3V3X A;  3W2D A;  1UZX B;  1WX9 A;  1R4M B;  2ZCB A;  3M3J A;  2CHX A;  1V2Y A;  2WU5 B;  2K8C A;  3NS8 A;  1QOB A;  2K39 A;  2DX5 B;  4HK2 A;  4X57 B;  2REX A;  1Y56 A;  3QC8 B;  4IKG A;  1YN5 A;  3NG0 A;  2WNM A;  3VUW A;  3ZKJ C;  1DGJ A;  2MJD A;  1V6E A;  4GIV A;  2PIA A;  2G1E A;  1JRP A;  1UBI A;  3E9S A;  2NS5 A;  3I57 A;  1Y8R C;  2RMM A;  1P98 A;  3DBS A;  3WAL A;  2ZZP B;  5EE9 A;  1WJN A;  2O6V A;  2DNF A;  2I2Y A;  4XWT A;  2JZZ A;  2AEH A;  2KAC A;  4IM0 A;  3VFK A;  1ZP0 B;  1I7H A;  2FCM A;  4FHK A;  3PS6 A;  3R2I A;  4W9F A;  2KDM A;  2SEB D;  5HI1 A;  2L00 B;  2KQ4 X;  3URY A;  5DPS A;  5BYS A;  3DVN U;  2QC8 A;  4RMA A;  1Z2M A;  2EEL A;  4KSL C;  2LHE A;  2G9H D;  5E6P A;  4YTP B;  2HD5 B;  3APF A;  2CR5 A;  2RDH A;  3Q8C A;  5MPO A;  1OGW A;  4P1C C;  4DWF A;  2BYT A;  3RT3 B;  1N6Z A;  3AV8 A;  3A9K A;  5HHD G;  3QIJ A;  1NI2 A;  1IGD A;  4ZRP A;  3EA6 A;  4WWM A;  4FAD A;  1TZO A;  2UYZ B;  1Q10 A;  2Y5C A;  2V9H A;  1V5O A;  5JXV A;  4GDK A;  4ITK A;  2OED A;  4WIP A;  1WSP A;  4WH4 A;  2JWZ A;  2VRR B;  1FNV A;  5C1Z A;  2KXJ A;  2ZW1 A;  1E0Z A;  2L8J A;  2V3P A;  1SIF A;  5J17 A;  2GMI C;  2LGS A;  2BB6 A;  2HDE A;  4I6L B;  2BPS A;  3SDL C;  3DVN V;  3NJT A;  2LWP A;  2LGX A;  4FXC A;  3X23 A;  1FXT B;  2MP2 B;  2V0G A;  3RNA C;  2JUO A;  3PGE A;  3L10 B;  5J2R A;  4WJN A;  2OHF A;  3QAQ A;  3O65 B;  4JX1 C;  3ZRF A;  4GN1 A;  1TTN A;  3T3N A;  1KLU D;  1S1Q B;  1KM7 A;  1R7S A;  2I38 A;  2Y3A A;  2HJ1 A;  3VR9 B;  3A9J A;  2FAZ A;  3ETR A;  2PEA A;  3PVL A;  2DEN B;  4K3C A;  3V6C B;  3Q8E A;  3IT4 B;  3BVM A;  4MJS A;  4MGK E;  4WJP A;  1C9F A;  4HRS A;  2R2Q A;  1I42 A;  2BTE A;  1JWB D;  5C2T B;  2JU6 X;  3PO0 A;  1RAX A;  3AE7 B;  2DZM A;  3GE3 C;  5G55 A;  1B9R A;  1QKZ A;  5JHA A;  2N4F A;  1E8Z A;  2D11 A;  3UQB A;  2N7D A;  2DLB A;  2BKF A;  1FXA A;  3J9C A;  4EZJ A;  3ZNI D;  4C80 A;  3N3K B;  2K5P A;  3DCG A;  4E74 A;  3S2A A;  2IO0 B;  5LNK 1;  4A9A A;  3FKY A;  2NCN A;  3DBR B;  2MRP A;  3V61 A;  4AOF A;  2X8X X;  3U4E G;  2MBH A;  2R2O A;  1FXI A;  3BII D;  4AWJ A;  2IYD B;  2DHZ A;  5IKC M;  3TEY A;  3ZDM C;  4N9F 4;  2OJR A;  2XN9 C;  2KJR A;  1C76 A;  3OAW A;  2WXI A;  1N63 A;  1SIJ A;  4YL8 A;  4NNJ B;  3VDZ A;  4KIK B;  2FNJ B;  3VRA B;  4M8M A;  1T5X D;  3AU4 A;  5EDS A;  2J0K A;  2WYQ A;  1TKY A;  2GRI A;  3N9Y C;  3I9V 1;  1SJH D;  3H9D A;  1EF5 A;  1XLN A;  2WLB A;  2C7M B;  5G5G A;  2KTR B;  2LVQ A;  1RRB A;  3IFW B;  1XCQ L;  2BB5 A;  2IBI B;  2KVR A;  2J0M A;  3AEF B;  3BVZ A;  3IBE A;  4C7Y A;  4B6W A;  1A5R A;  1LQB A;  4Q2J A;  3NS1 A;  3UF8 A;  2K0P A;  2IND C;  4RM9 A;  3ZRC A;  2CKH B;  4W9D A;  4WJO A;  1LXD A;  3NOB A;  5C23 A;  2FCN A;  2LXA A;  2N9X A;  3A1Q B;  4ZHO A;  1C77 A;  2JY6 A;  1YN3 A;  3IT6 B;  1AYF A;  4IW0 A;  3A4R A;  1T0S C;  2FID A;  3QWZ B;  3N1Z C;  1MG4 A;  5HG2 A;  3U2S C;  3RNG C;  3MJ5 A;  4YSZ B;  1AAR A;  5DCN A;  2MP2 A;  3TMP B;  1C3T A;  2JYT A;  1WGR A;  2DAF A;  1SJE D;  1TS3 A;  1YJ1 A;  4KGS A;  4NPN A;  3QJZ A;  2KT7 A;  4A3P A;  3ENE A;  3L17 A;  4ZRQ A;  4DHJ D;  3Q6B A;  3GP7 A;  1V8C A;  2ZJD A;  1ET6 A;  1ZOY B;  4DBG A;  1FNW A;  2QIE B;  2BVC A;  1OTR B;  1PYW D;  4M0W B;  1WJ6 A;  3GOE A;  4NQK E;  5EE0 A;  4DHJ B;  2L76 A;  4BBN C;  5CHV C;  4R3D A;  3BYT B;  1T0R C;  3AEE B;  1F1H A;  1QT9 A;  2PW9 A;  1QIL A;  4MAC A;  1UNS A;  1TS2 A;  4W9C A;  2FE8 A;  3NHE B;  1WE6 A;  2MJE A;  2VZK B;  1V86 A;  1STE A;  2IPK D;  3VHT C;  4IC7 B;  2DYM A;  2YEP B;  1SE9 A;  2N1V A;  2E3T A;  2W54 A;  1C4C A;  1WRI A;  1WY8 A;  1P7E A;  3Q8F A;  1I4H A;  2ZVO A;  1NDD A;  2KX3 A;  3L16 A;  4OVV A;  5GMV A;  3MTN B;  1WGH A;  1VDV A;  1GC6 A;  3NVW A;  1CZP A;  3B0A A;  3WAM A;  2M0A A;  4A55 A;  4N6E B;  2Y5B B;  4W9G A;  1WXM A;  4OW0 A;  1JRO A;  2J53 A;  2G45 B;  3Q3M C;  2W3R A;  2NBV B;  1WX7 A;  3BIN A;  1OEY A;  3OLM D;  3ONS A;  3E56 A;  4NQL B;  1P9D U;  3H1U A;  2FCS A;  4GSW A;  1SF0 A;  5E6N A;  3AE2 B;  3KYC D;  4EEW A;  1ZXI A;  3A33 B;  4XX5 A;  1YJI A;  2XK5 B;  1UD7 A;  2BKR B;  2WP9 B;  4AP4 C;  1I4G A;  2KTR A;  2M1M A;  5JZE B;  2W82 A;  1B1Z A;  1WE7 A;  4IG7 B;  3ZUN A;  2BBC A;  1JCK B;  2FUH B;  1IP9 A;  4LJP B;  4BOS C;  3ZDT A;  3P2B A;  4G3X B;  3OJ4 B;  2WXR A;  2LRW A;  1L0X B;  1OFF A;  4JPS A;  3DHI C;  3BYY B;  1F52 A;  1WX8 A;  2J4X A;  2Q5W D;  2WQY B;  3DPD A;  1GJZ A;  3NY5 A;  3RMK C;  4L23 A;  1L5P A;  3PT2 B;  3W9C B;  1F0Z A;  3U30 A;  3HVZ A;  1N62 A;  4IM3 A;  1K50 A;  3AE8 B;  1HQR D;  2UWQ A;  4EZK A;  2GBM A;  1L6V A;  4C7Z A;  3OWE B;  2IO2 B;  1F2R C;  4BFR A;  4D2K A;  2BS3 B;  1J8C A;  4HLE A;  4JIO U;  3VUX A;  3KWL A;  3K9O B;  2NBW B;  1YMH E;  3JSV A;  3LYY A;  3DBL B;  3NVY A;  1IUE A;  4N58 A;  2KDI A;  2KOX A;  3AEG B;  2I1J A;  3N1Y C;  2BQQ A;  4YTN B;  2ACZ B;  1LGR A;  3K9P B;  2RPQ A;  4EFO A;  1YX6 B;  1MHX A;  1J7B A;  4ANU A;  3IAM 1;  2IY1 B;  1QOA A;  4JWS C;  5CHF A;  1RYJ A;  4M0W A;  3Q8A A;  1KRH A;  3BK2 A;  3U8Z A;  1E8Y A;  3M62 B;  2CHZ A;  4IUM B;  2KLC A;  3TSS A;  4EE2 A;  4ARC A;  1RLF A;  4ACF A;  5IO9 A;  2MQJ A;  4NJC A;  2MBB B;  2PPH A;  4KZC A;  3VQI A;  1FNU A;  2RSU A;  2D5G A;  1HZ6 A;  1MVK A;  4HPM B;  1MHH E;  4LNF A;  4WWN A;  2D3G A;  1QOG A;  2K8H A;  3I63 C;  4RF0 A;  2LVO A;  1D3Z A;  3P4Q B;  4KGT A;  3RYT A;  1WXA A;  4AJW A;  5G2N A;  3VH3 B;  4AUQ C;  1I35 A;  2WDV B;  1D5M C;  1XQQ A;  1HEZ E;  2ON8 A;  3PTF C;  2AQ2 B;  4I6N B;  2DZK A;  4RH6 A;  4RFB A;  1UGM A;  3TEX A;  1P7F A;  5L83 A;  4YSY B;  4MGY E;  1V9J A;  4PS7 A;  1DOX A;  1WH3 A;  1JWU D;  1YD8 U;  3CST A;  4WUR A;  2EKI A;  1UGJ A;  2AX5 A;  2KC2 A;  2K25 A;  2JT4 B;  4XYC A;  4MM3 B;  2FBW B;  5J18 A;  3GZN I;  3T9L A;  1L7Y A;  1V80 A;  2XEW A;  4K7S A;  2WWZ A;  4HDO A;  2RDB C;  2E6X A;  5FK9 C;  1IPG A;  5DPR A;  3L13 A;  4C4V B;  3KWV A;  3HVD A;  1XXG A;  2WXK A;  2PKO A;  3H7P B;  1WZ3 A;  2FCQ A;  2ASQ A;  2HTM E;  2H89 B;  1N60 A;  1FCL A;  5FR6 A;  1JWM D;  2C9W B;  2QDF A;  1TY2 A;  1WI0 A;  4K3B A;  4MSM B;  1UH6 A;  1E6E B;  1M94 A;  2M19 A;  3EHV A;  1Z5S B;  1S3S G;  3N20 C;  3H8H A;  1V49 A;  2KYW A;  4TQ0 A;  1K8R B;  1P1A A;  2JXT A;  3Q8B A;  4MEM A;  4TQ1 A;  3SR6 A;  2N9E B;  2LXC A;  3KH0 A;  2KO3 A;  1E9M A;  2RGF A;  1BXT A;  1E90 A;  2BF8 B;  1ESF A;  2H88 B;  4II3 B;  3WIM A;  3ALB A;  1TYG B;  4BOZ B;  3PRZ A;  4WJQ A;  3Q3O C;  4ZHP A;  2QIL A;  2ICI A;  3CMM B;  1ZW7 A;  2KN5 A;  2WXH A;  4IDI A;  2ONQ A;  4YSX B;  1UWM A;  1E10 A;  3AB5 A;  1VLB A;  3TEZ A;  1KTK A;  4EZL A;  2N0S B;  4WWP A;  1N5X A;  3ZLZ A;  1EF1 A;  4HCN B;  1JWA D;  2WXF A;  4W9K A;  3L4P A;  1VZ6 A;  3SD5 A;  5BO4 B;  4A20 A;  3ZIM A;  4FJZ A;  3ZNG C;  3SEB A;  4ICU A;  3AEA B;  3H6N A;  3HM6 X;  3WAO A;  4PS3 A;  4B0M A;  3IHP C;  3WAP A;  4ARI A;  1V1P B;  1WGG A;  3JYU A;  2Z8L A;  2N1W A;  3EFU A;  3Q2A C;  4K81 A;  4KGR A;  3W1S A;  4LNO A;  2IDY A;  4GXB A;  1GAQ B;  4LDT B;  4N59 A;  3VTV A;  3Q3J A;  1XLO A;  3Q3N C;  1SE2 A;  2RR9 A;  5FR3 A;  1GNU A;  4CYE A;  1D4B A;  2D3A A;  2RD0 A;  2INC C;  2CU3 A;  3MC8 A;  1M4V A;  1XF5 L;  3AE9 B;  4MH8 A;  5EE3 A;  2PLP A;  3DHG C;  5GXG B;  3ZXR A;  1L0Y B;  2LEK A;  5KHO A;  3RNF C;  4KVG B;  4DDG D;  4PT5 A;  1WM2 A;  4XE0 A;  3ZTC A;  1J7A A;  3DBR I;  4RGM A;  4W9J A;  1XEE A;  1ENF A;  2HJ8 A;  3VRB B;  2NMQ A;  2W55 A;  2GB1 A;  4XDC A;  2MW5 A;  4EOY A;  1K51 A;  2WHI A;  4ASW C;  2QSD A;  3ZJU A;  4ZRJ A;  3H7P A;  2LGD A;  1WGD A;  2RPV A;  3RCZ A;  1GUA B;  1R4N I;  2D3C A;  1V97 A;  3MHS D;  4JQW C;  3VH4 B;  2QEJ C;  4NAW B;  3RUL A;  1SBB B;  1A70 A;  1MG8 A;  1WM3 A;  1YJJ A;  2QMT A;  3TIX A;  3ZTD A;  2MBO A;  1TT5 B;  1GB4 A;  1NYR A;  1JQ4 A;  1FRD A;  2BW2 A;  1ACC A;  4DK5 A;  1HZ5 A;  2KD0 A;  5AUK A;  3C19 A;  3KLS X;  2QCZ A;  5G5H A;  4DDI D;  3IAS 1;  1BUI C;  3OG5 A;  1U4A A;  2W3S A;  3QCA A;  2M0X A;  3AEB B;  2N9P C;  3ZXV A;  2DBY A;  2JXX A;  2INP E;  2GBR A;  1T6B X;  3AE4 B;  2C60 A;  3RNE C;  2GOW A;  4BKG A;  5BMI A;  2G3Q B;  3MHZ A;  3JVZ X;  5AUI A;  1FRR A;  2BWE S;  2LJ5 A;  2NTS A;  2W9N A;  3V62 A;  4FHJ A;  3UIP B;  1XD3 B;  3MFG A;  1G6J A;  3MC0 B;  4F8C B;  2NTT A;  1CMX B;  3DVG X;  4KKI A;  2IJ0 A;  4J6I A;  3P4S B;  5IOI A;  2PVG C;  3APC A;  2C5L C;  3AUL A;  2WXP A;  3B08 A;  3KW5 B;  4H2A A;  3TBL D;  1E5W A;  4HPL B;  1NBF C;  2XBB C;  2KAJ A;  3DBH I;  1T0Q C;  4S0R A;  4CQN A;  4ZDV A;  3I5J C;  3RUI B;  1WXQ A;  2K6D B;  3SFE B;  1KLV A;  1XLQ A;  1D5Z C;  4ANV A;  4AQ7 A;  2LHD A;  2V1Y A;  4ZYN A;  5C3J B;  5D3D A;  1WJU A;  2JQR B;  4DQO C;  5HKH A;  2WX1 A;  2AQ1 B;  1KFY B;  1FFV A;  2MLB A;  4PS8 A;  4CHK A;  2BS4 B;  1UBQ A;  3KUD B;  2KTF A;  3PZ8 A;  3EFC A;  1V1O A;  3PHX B;  1XO3 A;  3M63 B;  2O2V B;  3VR8 B;  3A4S C;  5D94 A;  1QF6 A;  2HTH A;  1IBX B;  1EU4 A;  3PZ7 A;  3HIZ A;  3LJ3 A;  2Z0D B;  2NR2 A;  4WAA A;  2VZK D;  3SFD B;  5BYR A;  5HFY A;  2WXM A;  2Z0E B;  2JYE A;  5D3I B;  2IO1 B;  4MGI E;  5LXI B;  1E8X A;  3PLU A;  5I4D A;  1F2R I;  1J7C A;  1WZ0 A;  3PRE A;  1JRU A;  3Q14 C;  4MH0 E;  1NI3 A;  4KDI C;  3L0W B;  1RWS A;  1EO6 A;  3FC4 A;  3TEW A;  1KOT A;  2KWC A;  3KUC B;  2KFK B;  1XT9 B;  4M00 A;  2AWT A;  1TS4 A;  4KZ0 A;  1UEL A;  4MT5 A;  4KDL B;  3SU8 X;  4BBN F;  3JW0 X;  2AQ3 B;  2LGI A;  3EC8 A;  2KHW B;  3APD A;  1OQR A;  1HXY D;  2KK8 A;  1FMA D;  1VZ7 A;  5FKA C;  2EMS A;  3FIL B;  3RZF A;  1FIQ A;  3C8Y A;  4KIK A;  3AXC A;  4HKZ E;  2WDQ B;  1RFA A;  2B3A A;  1CJE A;  4J3O D;  1PGB A;  3O13 A;  4RGN A;  1ZDX A;  2KMC A;  5KHQ A;  4JLC A;  1VZ8 A;  4A3O A;  2MSE D;  4LCD E;  4NZL B;  1JWS D;  3ZJT A;  3NZU A;  5JHB A;  2K3U A;  2A4Z A;  3PRP B;  1FM0 D;  1MFW A;  3VUY A;  4HVB A;  1ZDV A;  2DAJ A;  1WMH B;  3LXF A;  3KVF B;  4FLH A;  4NAM A;  1N5W A;  3DHH C;  4GDL B;  2PVO D;  2PE6 B;  3NUH B;  1F77 A;  2MCN B;  1GC7 A;  1WXS A;  2J42 A;  1L0V B;  4W9I A;  1SE4 A;  4ZYS A;  1EWY C;  3A1Q A;  4JGH B;  1CK1 A;  1RM6 C;  1FPY A;  1VR9 A;  3FAH A;  3ML9 A;  2V3N A;  1SEB D;  4NY0 A;  4HWI B;  2GI9 A;  3V60 A;  2JVC A;  3UQA A;  1TZ1 A;  1WGY A;  3EEC A;  4P1B C;  2LUE A;  4K1R B;  3Q3F A;  3PV1 A;  4BKS D;  2QHO A;  2N9K A;  3IVF A;  1KH0 A;  2WX0 A;  3R7Q A;  1UWX A;  2KAN A;  3GB1 A;  2JPH A;  4E3C A;  5CX3 A;  2RDG A;  3HM3 A;  4LJO B;  1YQB A;  1SGH A;  2O2V A;  2V4I B;  1Q0W B;  3ZQ4 A;  3BWU D;  3B9J A;  3A9K B;  1IBX A;  2KMA A;  1WRD B;  3IG3 A;  3RZW C;  2WXN A;  4L1B A;  3DWG C;  3OJ3 A;  1E7V A;  1WXV A;  2IGD A;  3N1X C;  3W5U B;  3L08 A;  3SHQ A;  4GDK B;  4BKT A;  3AM9 A;  5JH5 C;  2LJI A;  1K52 A;  2KJ6 A;  2FUG 1;  3B2G A;  2KQ7 A;  1X1M A;  1R4M I;  2DZI A;  4GLS C;  2AYO B;  1F9J A;  3PHW B;  5D7G A;  2MHJ A;  3DVG Y;  4TMA B;  1TJE A;  4REZ A;  3AEC B;  2SAK A;  2MWS B;  2K9X A;  2GBK A;  1PGX A;  1IYF A;  3DQV A;  3HRD D;  2C7H A;  4G0N B;  3TL5 A;  2ZNV C;  4PYZ A;  3KQ4 A;  3BY4 B;  1TBE A;  2Z59 B;  3GE8 C;  5AEK B;  3RNB C;  4DHZ E;  3RNC C;  1YQ3 B;  3U52 E;  1L4Z B;  3UGB B;  3FIL A;  4GMV A;  3MJW A;  1I4R A;  3A9J B;  1WFY A;  1GPX A;  4RCO A;  3RFZ B;  4B95 A;  2GBJ A;  1WGK A;  4JWU C;  3P1M A; 
#chains in the Genus database with same CATH homology
 2JY6 A;  4MJS B;  2KQS A;  3VTV A;  3Q3J A;  4HXD A;  2O6V B;  2AL3 A;  4FJV B;  2XK5 A;  4IW0 A;  1QZE A;  2MX2 A;  3A4R A;  3R3M A;  4W9H A;  2RR9 A;  2L05 A;  1E7U A;  1VD2 A;  1GNU A;  2BYF A;  2FID A;  3KUZ A;  3QWZ B;  4CYE A;  2JF5 A;  2N7E A;  2J7Q B;  1LFD A;  2RD0 A;  3DBL I;  2K6Q A;  2LRU A;  1WF9 A;  2L0T A;  4ANW A;  2GBN A;  3ZVV A;  1WMH A;  1AAR A;  3VTU A;  2LGY A;  5DCN A;  2MP2 A;  3TMP B;  1C3T A;  1WGR A;  3PRM B;  2YVC A;  2DAF A;  1YJ1 A;  4G50 A;  4MSQ B;  4HJK A;  5KHO A;  3VTW A;  3WAN A;  4KVG B;  4DDG D;  4NPN A;  1WM2 A;  4GDL A;  3QJZ A;  4FA6 A;  2ZNV B;  2I1K A;  4A3P A;  3ENE A;  3ZTC A;  1HE8 A;  2DYO A;  2IY0 B;  3L17 A;  3PZD A;  3DBR I;  4W9J A;  4DHJ D;  1Q1O A;  2CHW A;  2ZJD A;  5DPW A;  3VXW A;  4RM8 A;  4IWP A;  2HJ8 A;  4DBG A;  2JRH A;  1TGZ B;  2KX0 A;  1OTR B;  2MW5 A;  1Q5W B;  4EOY A;  3RD2 A;  2KWV B;  4M0W B;  5D2M B;  4I6P A;  2JRI B;  4ASW C;  1WJ6 A;  3GOE A;  4MGZ E;  4NQK E;  5D6J B;  4DHJ B;  2L76 A;  4ZRJ A;  2ZEQ A;  2LGD A;  3H7P A;  4XZ4 A;  1WGD A;  5AZG A;  3M95 A;  5CHV C;  4BBN C;  1VCB A;  4GGQ A;  3RCZ A;  1GUA B;  1R4N I;  1LM8 B;  3W1S C;  1P0R A;  4P7I A;  2L3Z A;  2BYV E;  3MHS D;  4JQW C;  3VH4 B;  2J0J A;  3LDZ E;  2KDB A;  4NAW B;  3VAW A;  3RUL A;  1WM3 A;  1MG8 A;  2BYE A;  3ZTD A;  4W9C A;  3TIX A;  2DYB A;  2AL6 A;  4PYU A;  3NHE B;  1WE6 A;  1YX5 B;  2MBO A;  4GU2 A;  1V86 A;  1L2N A;  2ZPY A;  3VHT C;  3AI5 A;  3DOW A;  4FUL A;  4IC7 B;  2BWF A;  2KJH B;  3U7D A;  2DYM A;  2M4N A;  3ZO5 B;  4ANX A;  1SE9 A;  2N1V A;  4DK5 A;  1WY8 A;  2KD0 A;  3D32 A;  1ISN A;  3X0W A;  4BKS A;  3ZNZ B;  4DDI D;  3HK0 A;  4IWQ A;  1U4A A;  5LXH A;  2ZVO A;  1NDD A;  2KX3 A;  3L16 A;  4OVV A;  5GMV A;  3QCA A;  2M0X A;  1H8C A;  1J19 A;  3MTN B;  2PJH A;  2KFK A;  1WGH A;  2N9P C;  4K7U A;  2JXX A;  1OQY A;  2YLM A;  2KWU B;  1GC6 A;  5AZH A;  2GBR A;  3KYD D;  4MEL A;  3B0A A;  3WAM A;  2C60 A;  4E71 A;  2GOW A;  2V4L A;  4BKG A;  1J0G A;  4FJY A;  2Y5B B;  2G3Q B;  2DZJ A;  3JVZ X;  1WXM A;  4W9G A;  4IM2 A;  4B9K A;  4F1S A;  3PLV A;  2G45 B;  2BWE S;  4M8N A;  2LJ5 A;  1ZGU B;  2NBV B;  1WX7 A;  3BIN A;  1OEY A;  2KDE B;  2W9N A;  3OLM D;  2MA9 B;  3DDC B;  3ONS A;  4FHJ A;  4NQL B;  1P9D U;  1XD3 B;  3UIP B;  2D2Q A;  2FCS A;  3H1U A;  4II2 B;  1G6J A;  2KLG A;  4F8C B;  3ZNH B;  3N32 A;  1CMX B;  2L7R A;  4GSW A;  4LDT D;  1WYW B;  3DVG X;  4ZRI A;  5E6N A;  3QQ8 B;  4J6I A;  3KYC D;  4EEW A;  1UZX B;  3APC A;  1WX9 A;  2C5L C;  2L0F A;  2NBU A;  3A33 B;  2ZCB A;  3M3J A;  4XX5 A;  3AUL A;  2CHX A;  2MBQ A;  1V2Y A;  1UD7 A;  2XK5 B;  3B08 A;  2BKR B;  2K8C A;  3KW5 B;  2LD9 A;  3NS8 A;  4AP4 C;  3TBL D;  1E5W A;  4HPL B;  1NBF C;  2IO3 B;  2XBB C;  3V6E B;  2KTR A;  2K39 A;  2DX5 B;  4HK2 A;  4X57 B;  2REX A;  2M1M A;  3DBH I;  3QC8 B;  1OEY J;  5JZE B;  3QHT A;  3VUW A;  4ZDV A;  3ZKJ C;  4ZRK A;  4ICV A;  3RUI B;  1WE7 A;  4IWO A;  4IG7 B;  3ZUN A;  2K6D B;  2FUH B;  1IP9 A;  4LJP B;  3H7S A;  1V6E A;  4BOS C;  1KLV A;  3ZDT A;  3P2B A;  4G3X B;  4GIV A;  3OJ4 B;  4ANV A;  2LRW A;  2V1Y A;  4CO7 A;  4ZYN A;  1WJU A;  1UBI A;  2NS5 A;  3DPD A;  1WX8 A;  3UIO B;  1Y8R C;  1GJZ A;  3NY5 A;  3PSE B;  1WR6 E;  1BT0 A;  5HKH A;  1P98 A;  2WX1 A;  3ECI A;  3DBS A;  3WAL A;  3PT2 B;  2MLB A;  4MM3 A;  2ZZP B;  2LAS A;  4PS8 A;  5E6O A;  3U30 A;  4CHK A;  1UBQ A;  4IM3 A;  3KUD B;  2UWQ A;  2KTF A;  1WJN A;  3PHX B;  2GBM A;  4EZK A;  2O6V A;  3M63 B;  1YIW A;  2O2V B;  3A4S C;  2IO2 B;  5IAA C;  4BFR A;  1J8C A;  4GB9 A;  2JZZ A;  2AEH A;  2OOB B;  4IM0 A;  5D94 A;  3VFK A;  4HLE A;  2HTH A;  4JIO U;  3VUX A;  3PPA A;  3W1Y A;  3HIZ A;  3K9O B;  2NBW B;  3LJ3 A;  2Z0D B;  3JSV A;  2NR2 A;  4AJY B;  4WAA A;  2FCM A;  3AU5 A;  4FHK A;  3PS6 A;  4W9F A;  2KDI A;  2KOX A;  4FBJ B;  2Z0E B;  2IO1 B;  4MGI E;  2L00 B;  5LXI B;  1E8X A;  3PLU A;  5DPS A;  3DVN U;  4OVU A;  1WZ0 A;  3PRE A;  1Z2M A;  4RMA A;  2I1J A;  1JRU A;  4KSL C;  3QA8 A;  4G11 A;  4MH0 E;  5E6P A;  4F7Z A;  4KDI C;  3L0W B;  2HD5 B;  3K9P B;  2RPQ A;  4EFO A;  3APF A;  1YX6 B;  3CSF A;  2NPT B;  1EO6 A;  2CR5 A;  2LVP A;  1KOT A;  4ANU A;  3WA0 A;  2KWC A;  2CS4 A;  3KUC B;  5AZF A;  2IY1 B;  2KFK B;  3ML8 A;  2D10 A;  1OGW A;  2KC1 A;  2LZ6 A;  1XT9 B;  5CHF A;  4DWF A;  2AWT A;  4KZ0 A;  3U8Z A;  1UEL A;  1E8Y A;  3RT3 B;  3M62 B;  2CHZ A;  4IUM B;  2KLC A;  3A9K A;  4KDL B;  4NJ6 A;  3QIJ A;  3SU8 X;  1NI2 A;  2G4S A;  2IZV B;  4BBN F;  1RLF A;  3JW0 X;  2FIF A;  5CHW A;  2MQJ A;  2MBB B;  2PPH A;  4EKU A;  4KZC A;  4WQO B;  3VQI A;  3EC8 A;  3V62 A;  2RSU A;  4FAD A;  2KHW B;  4WWO A;  2UYZ B;  3APD A;  4HPM B;  4BVU C;  4WWN A;  2KK8 A;  2D3G A;  1V5O A;  2K8H A;  4GDK A;  2ZPN A;  3UIN B;  2LI5 A;  2ZCC A;  2PE9 A;  2JWZ A;  2VRR B;  2LVO A;  2EMS A;  1D3Z A;  5C1Z A;  2KXJ A;  3RZF A;  3RYT A;  4KIK A;  1WXA A;  4AJW A;  3AXC A;  5G2N A;  2L8J A;  1RFA A;  2B3A A;  5TR5 A;  3VH3 B;  4AUQ C;  1SIF A;  1I35 A;  5J17 A;  2JZ3 B;  4DXA B;  2GMI C;  2EKE C;  1XQQ A;  1PQS A;  2KMC A;  5KHQ A;  4JLC A;  2KKC A;  3PTF C;  5DPT A;  4A3O A;  2MSE D;  4LCD E;  4I6N B;  2D07 B;  2DZK A;  3NZU A;  4I6L B;  2BPS A;  4URK A;  5JHB A;  1UGM A;  2A4Z A;  3SDL C;  3PRP B;  3CF6 E;  3DVN V;  3VUY A;  4HVB A;  2LWP A;  5L83 A;  2DAJ A;  4MGY E;  2LGX A;  4JL9 A;  1V9J A;  1WMH B;  4PS7 A;  3X23 A;  1WH3 A;  1FXT B;  1YD8 U;  2MP2 B;  3CST A;  3KVF B;  4FLH A;  2JUO A;  3PGE A;  3L10 B;  4GOC A;  4WJN A;  5J2R A;  3QAQ A;  2KC2 A;  2ZVN A;  2K25 A;  2KNB A;  3I3T B;  2JT4 B;  4GDL B;  1EUV B;  2PE6 B;  2MCN B;  3O65 B;  3ZRF A;  5J18 A;  4GN1 A;  1GC7 A;  1TTN A;  2BGF A;  2KZR A;  1WXS A;  4FN2 A;  1ZKH A;  3GZN I;  1S1Q B;  1L7Y A;  3T9L A;  1V80 A;  1KM7 A;  1T0Y A;  2NVU I;  2XEW A;  4K7S A;  4W9I A;  2WWZ A;  4HDO A;  3A9J A;  1IPG A;  2FAZ A;  2KDF B;  5DPR A;  3L13 A;  2PEA A;  3PVL A;  2DEN B;  3A1Q A;  4JGH B;  3ML9 A;  3V6C B;  3HHM A;  1P3Q U;  4MJS A;  4MGK E;  3ZW3 A;  3JSV B;  4WJP A;  3B1L X;  4NY0 A;  3H7P B;  1WZ3 A;  4HWI B;  2FCQ A;  3R66 C;  4KSK C;  3V60 A;  2A5U A;  2R2Q A;  2ASQ A;  2JVC A;  3UQA A;  1I42 A;  1TZ1 A;  2G4D B;  1WGY A;  3EEC A;  2LUE A;  3N30 A;  4K1R B;  3Q3F A;  3PV1 A;  3QAR A;  5FR6 A;  4HDQ A;  4BKS D;  3TJP A;  2C9W B;  2M17 A;  2QHO A;  5G55 A;  1RAX A;  2DZM A;  2K1F A;  1WI0 A;  3IVF A;  2WX0 A;  2M8S A;  4MSM B;  3R7Q A;  2N4F A;  5JHA A;  1E8Z A;  2D11 A;  1UH6 A;  4MDK E;  1M94 A;  3UQB A;  2KAN A;  3EHV A;  1Z5S B;  2N7D A;  2JPH A;  2BKF A;  4E3C A;  1S3S G;  5CX3 A;  1WIA A;  4EZJ A;  3HM3 A;  3ZNI D;  3N3K B;  1E8W A;  4LJO B;  1V49 A;  1SGH A;  1YQB A;  3DCG A;  2O2V A;  4E74 A;  1K8R B;  1P1A A;  2IO0 B;  3S2A A;  1Q0W B;  4TQ0 A;  2NCN A;  3L54 A;  2MRP A;  4MEM A;  4TQ1 A;  4XC2 A;  3V61 A;  2N9E B;  2LXC A;  3A9K B;  3KH0 A;  4AOF A;  2KO3 A;  2KMA A;  1WRD B;  3IG3 A;  2EMT A;  2MBH A;  2RGF A;  2R2O A;  1E90 A;  3RZW C;  4AWJ A;  3OJ3 A;  4DHZ B;  1E7V A;  2IYD B;  2BF8 B;  4II3 B;  1WXV A;  2DHZ A;  3TCA A;  3WIM A;  3QK0 A;  3ALB A;  3ZDM C;  4N9F 4;  4BOZ B;  3L08 A;  3SHQ A;  1H4R A;  2OJR A;  3PRZ A;  4GDK B;  4WJQ A;  2KJR A;  4BKT A;  4NAW A;  5JH5 C;  3OAW A;  2KJ6 A;  3CMM B;  1ZW7 A;  4YL8 A;  4NNJ B;  3VDZ A;  2KN5 A;  2KQ7 A;  1X1M A;  5IA7 A;  4KIK B;  5LLI A;  2FNJ B;  4M8M A;  1R4M I;  2DZI A;  2NPT A;  2WDT B;  1C1Y B;  4EZL A;  3AU4 A;  5EDS A;  2J0K A;  4WWP A;  3R7R A;  3QX1 A;  2WYQ A;  2AYO B;  1F9J A;  3ZLZ A;  1EF1 A;  3PHW B;  4HCN B;  5D7G A;  3DVG Y;  3H9D A;  4KV2 A;  1EF5 A;  4W9K A;  4HCP B;  2MWS B;  5L95 C;  2CU1 A;  3SD5 A;  2C7M B;  2GBK A;  2KTR B;  1IYF A;  3DQV A;  3VVW B;  2LVQ A;  2C7H A;  5BO4 B;  4G0N B;  1RRB A;  4A20 A;  3IFW B;  3TL5 A;  4W9E A;  1V5T A;  2ZNV C;  1KJT A;  4FJZ A;  1WR1 A;  3ZIM A;  3NZS A;  4TUU A;  4PYZ A;  1V81 A;  3BY4 B;  2KVR A;  2IBI B;  3IBE A;  1TBE A;  2J0M A;  3ZNG C;  4EUT A;  2Z59 B;  4ICU A;  4B6W A;  3H6N A;  2HE7 A;  5AEK B;  1A5R A;  1LQB A;  3HM6 X;  3WAO A;  2C7N B;  1GG3 A;  4PS3 A;  3UF8 A;  4RM9 A;  1WJ4 A;  4DHZ E;  3IHP C;  3WAP A;  3ZRC A;  2CKH B;  2MBE A;  4W9D A;  1WGG A;  2O6V D;  2KFJ A;  4WJO A;  4W9L A;  3C0R B;  3JYU A;  4NJ7 A;  4K7W A;  2K8B A;  3UGB B;  5CTR C;  1LXD A;  2V3S A;  4GMV A;  4TV3 A;  2N1W A;  3MJW A;  3EFU A;  3NOB A;  3A9J B;  4K81 A;  1WFY A;  3W1S A;  5C23 A;  2FCN A;  2LXA A;  4GXB A;  4TKN A;  3T8M A;  2N9X A;  3A1Q B;  4B95 A;  2GBJ A;  4LDT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...