2C9WB

Crystal structure of socs-2 in complex with elongin-b and elongin-c at 1.9a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
DVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPPRESSOR OF CYTOKINE SIGNALING 2
publication title Crystal structure of the SOCS2-elongin C-elongin B complex defines a prototypical SOCS box ubiquitin ligase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c9wB00
5G55A 1Y8RC 5JHAA 1LQBA 1P0RA 3QCAA 4XZ4A 2ZVNA 2G3QB 2LD9A 3S2AA 2MQJA 1WXAA 3QQ8B 2KX3A 4WWPA 2CS4A 3VFKA 4GN1A 4IWOA 2EKEC 2FCMA 2N9EB 2M1MA 1FXTB 1UH6A 4M8NA 4F8CB 1D3ZA 4MGYE 1Q0WB 1WGGA 1XT9B 2GBNA 4TQ0A 3RD2A 3IBEA 1WR1A 2KFJA 5L95C 4GOCA 5D2MB 3N30A 3H6NA 4A20A 4IC7B 2XK5B 3DCGA 4WJPA 2KJ6A 1WIAA 2KO3A 3PS6A 2LRUA 3A9JB 3PRZA 4KIKA 4YL8A 2O2VA 2WYQA 3TCAA 1RAXA 2KLGA 5E6PA 1H8CA 2DZJA 4II2B 4GDLA 4A3PA 2GMIC 4W9JA 2IZVB 3R7RA 3QARA 3VVWB 2LXCA 2R2QA 1E5WA 4E3CA 3NZUA 4B6WA 1GC7A 1TTNA 4NAWB 3ZNHB 2KTFA 4HLEA 2K39A 4GU2A 2MBOA 4HPLB 2REXA 4KV2A 3L17A 4ZYNA 4AUQC 5D6JB 3ZNZB 1WYWB 2MBBB 5J2RA 4X57B 2BYEA 4BKGA 4PS8A 4B9KA 1YJ1A 1NI2A 3APFA 2BWES 4XC2A 1KLVA 2C7MB 3ZRCA 4DDID 4KZ0A 3ZTDA 2Z0EB 3VXWA 1EF1A 1WGHA 2PEAA 2JZ3B 2KTRA 2O6VA 3NS8A 4AP4C 2AEHA 4BVUC 4IM3A 3H7PB 2DYBA 3ML9A 4TQ1A 4LDTD 4IWQA 1ZW7A 1WX8A 1YIWA 4EZLA 5FR6A 1UZXB 3QIJA 3IHPC 3RULA 3MTNB 4OVVA 1WR6E 1WM2A 2MA9B 3DVGY 3T8MA 1V49A 2AL3A 2ZPYA 1EO6A 2G4SA 2J7QB 2MLBA 2WDTB 4KSKC 4WJOA 4EZKA 3DVGX 1WZ0A 3PLUA 4N9F4 4PS3A 4RM9A 4W9KA 2J0JA 4AJYB 1V9JA 3VTUA 1YX5B 2DYMA 4K7SA 3NHEB 2KC1A 1SE9A 2ZCCA 3JW0X 4NNJB 2ZZPB 1V6EA 2BPSA 4HWIB 3WALA 4GDKA 2JZZA 1WGRA 2MP2B 3QJZA 1OQYA 1CMXB 4ZRKA 3ZKJC 3PSEB 4DHZE 2KWUB 3R66C 2CHZA 2GBJA 3EHVA 1S3SG 4AOFA 4FHJA 3T9LA 2N7DA 4GDLB 5J18A 4EZJA 2FAZA 3D32A 1WZ3A 2K25A 3PGEA 1BT0A 4EOYA 4G3XB 1J19A 2XEWA 2ASQA 2N9XA 1L2NA 3C0RB 3QAQA 2Z59B 4MJSA 4F7ZA 2BWFA 3DBRI 1EF5A 2BF8B 1KM7A 2BYFA 2V1YA 1WFYA 2A5UA 2I1JA 3VAWA 3ZLZA 2IY1B 2N9PC 1WX9A 3HIZA 3DVNU 4TV3A 5LXIB 3M95A 1H4RA 1RRBA 1XD3B 2ZJDA 5CHFA 3VDZA 5DCNA 3VTWA 3ZO5B 2L05A 3X23A 3OJ3A 4BKTA 2KWCA 2KTRB 2CR5A 1UGMA 3L54A 5E6NA 2FIFA 4JLCA 4II3B 2JT4B 2RSUA 2M0XA 1E90A 2KXJA 3QA8A 3ZW3A 4F1SA 3V6CB 4RM8A 3QK0A 3TJPA 2M17A 1S1QB 2MBEA 1GG3A 2Y5BB 2DHZA 4MM3A 1OGWA 1X1MA 1Q1OA 2HE7A 3ALBA 2MWSB 3L13A 2RR9A 4FHKA 4MELA 4W9HA 3KUDB 3L16A 4FN2A 4MSQB 4HPMB 1F9JA 4PS7A 4WQOB 4W9IA 2DZMA 3QHTA 4LDTB 2ZPNA 3ONSA 2IO1B 2VRRB 2L7RA 3TIXA 4AWJA 3DBHI 1G6JA 5KHOA 2FCNA 5EDSA 2PJHA 3L08A 2G4DB 4GDKB 4W9FA 2D2QA 1WXSA 3B0AA 1E8WA 3VTVA 1P1AA 3W1SA 2L0FA 2BKFA 3DBSA 4BBNC 3VQIA 1MG8A 1GJZA 1P98A 1WRDB 3JSVA 2WWZA 5AZGA 2KC2A 3ML8A 3LJ3A 2DAFA 5CX3A 1U4AA 4G0NB 1RLFA 1ZGUB 2MSED 1XQQA 2LJ5A 3K9PB 2KNBA 3ZTCA 2HJ8A 1E8XA 3N3KB 2W9NA 5AEKB 3WA0A 4EEWA 1E8YA 1Z2MA 3WAPA 2KD0A 3UQAA 3VH3B 4JGHB 2V3SA 3A33B 3PRMB 2K8HA 2IYDB 2BKRB 3DQVA 3IVFA 2O6VD 3N32A 1ZKHA 5D7GA 2D10A 2A4ZA 2JXXA 2KK8A 2UYZB 3CSTA 4W9EA 2DYOA 2ZEQA 1EUVB 2FIDA 4LCDE 2R2OA 5C23A 2KDEB 3PPAA 3UIPB 3ENEA 3V6EB 4JQWC 3KUCB 2L8JA 4P7IA 4GB9A 5C1ZA 2NBWB 4K81A 4NJ7A 3CMMB 1P9DU 1WE7A 2MCNB 3EECA 2LVQA 2MX2A 2FCSA 3H1UA 4CHKA 5JHBA 2WX0A 1NDDA 4BKSD 3W1SC 1P3QU 1PQSA 4IM0A 5J17A 1Q5WB 3UQBA 3P2BA 3U7DA 5BO4B 1C3TA 2K8CA 3V62A 2D3GA 2KKCA 2NBUA 1V5TA 3VHTC 2MBQA 2KFKA 4EFOA 3SD5A 2N1VA 1WGDA 2JY6A 1SGHA 4G11A 3JVZX 2C5LC 4I6LB 1WJ6A 3DOWA 1J8CA 2C7NB 4TKNA 1V2YA 2QHOA 2IO2B 4BKSA 4CO7A 3APDA 3PZDA 3R3MA 4WWOA 2N7EA 4TUUA 3UF8A 4DHJD 3UIOB 3H7SA 2L3ZA 2LXAA 3JSVB 4NY0A 4FA6A 4G50A 1WF9A 1TZ1A 4BBNF 3RZWC 4ANUA 5JH5C 2C9WB 3ZDMC 3AULA 3PVLA 4KIKB 4IWPA 1A5RA 5AZFA 1WGYA 3DPDA 3IFWB 1AARA 2O2VB 4OVUA 5HKHA 3W1YA 1WJ4A 4KSLC 2KWVB 1NBFC 4ANVA 1WE6A 3PTFC 2YVCA 2LGYA 2N4FA 1KOTA 3A4RA 1I35A 4FLHA 3VUWA 4DK5A 2JRHA 2LUEA 1K8RB 2JPHA 4MEMA 5DPRA 2B3AA 1R4NI 2K1FA 5G2NA 2LVOA 4M0WB 3RCZA 1T0YA 3SU8X 1UBIA 4ICVA 4ANWA 2K8BA 2J0MA 2FCQA 4IG7B 3KUZA 1KJTA 4LJOB 5D94A 2LI5A 4HJKA 3A1QA 2WX1A 4CYEA 2HD5B 2XBBC 2O6VB 3AU4A 3PLVA 1VCBA 2L76A 2C60A 2NPTA 3DVNV 3NOBA 3A9JA 4K7WA 2ZVOA 2LASA 2JRIB 1WMHA 1OEYA 4MGZE 3PHWB 3TMPB 3ECIA 4NQKE 3GZNI 1L7YA 2KQSA 3X0WA 1GUAB 4DBGA 4FJZA 3TBLD 2IO3B 3QC8B 3KVFB 2ZNVC 4NAWA 1WY8A 5DPSA 5DPWA 3KH0A 3NZSA 4DWFA 3NY5A 4FJYA 2LWPA 3K9OB 5JZEB 3Q3FA 1ISNA 1Z5SB 3EFUA 3QX1A 4W9GA 4BFRA 3TL5A 1QZEA 2LZ6A 4W9DA 4HCNB 4MGIE 3BINA 4FBJB 2J0KA 3GOEA 4M8MA 2ZNVB 2KDBA 3KW5B 4B95A 4FADA 3H7PA 1JRUA 4KDLB 1YD8U 3H9DA 5AZHA 2RGFA 3A9KA 4GMVA 4J6IA 5CHVC 2AL6A 3ZRFA 1UD7A 2NCNA 4IW0A 5L83A 1WJNA 3JYUA 4DHJB 3HM3A 5DPTA 1C1YB 4MJSB 3ZUNA 4GGQA 1RFAA 2K6DB 4JIOU 1WI0A 1LXDA 2V4LA 3AI5A 1V5OA 3B1LX 2KANA 3ZNID 2GOWA 1VD2A 1GC6A 3DBLI 1WJUA 1M94A 1WM3A 3UINB 3ZIMA 1E8ZA 2M8SA 3PV1A 1YQBA 3A1QB 3VUYA 2MP2A 3PRPB 4W9CA 3MJWA 3OAWA 2KMAA 5IA7A 3L10B 4HDOA 2NPTB 1V80A 4AJWA 3APCA 3KYCD 3AU5A 2GBRA 2MBHA 1WMHB 3BY4B 2KX0A 2N1WA 1E7UA 4KDIC 2CHWA 3U30A 2CHXA 4LJPB 2AYOB 3IG3A 3OJ4B 1GNUA 3U8ZA 4ASWC 2CKHB 3I3TB 3Q3JA 3WAOA 1WX7A 2L0TA 2OJRA 3L0WB 1LFDA 2AWTA 2NBVB 4WJQA 4IM2A 3M62B 3A4SC 2KVRA 4WJNA 4IUMB 5CTRC 3CF6E 3M3JA 2G45B 1IPGA 2UWQA 4K7UA 4HK2A 3UGBB 2DX5B 4HVBA 5TR5A 4GIVA 2CU1A 1WXMA 2C7HA 4NJ6A 1I42A 2LRWA 3SDLC 4K1RB 4URKA 1OEYJ 2NR2A 2ZCBA 2JWZA 3A9KB 1IP9A 2M4NA 2FNJB 4MH0E 4XX5A 5LLIA 1WXVA 3HHMA 2MRPA 2BGFA 2PE6B 3VUXA 4ANXA 4WWNA 2KDFB 2EMSA 3PREA 3OLMD 2DZKA 4GXBA 1OTRB 1YX6B 3SHQA 3PT2B 3V60A 3R7QA 4E74A 3CSFA 2KMCA 2KQ7A 2PE9A 3VH4B 2DZIA 2YLMA 2IY0B 1SIFA 5LXHA 2KOXA 2JUOA 2KHWB 1UELA 2NS5A 3MHSD 2KN5A 1J0GA 4EUTA 1LM8B 2DENB 2BYVE 3QWZB 5GMVA 3ZVVA 2LGXA 3KYDD 4DHZB 3RT3B 2OOBB 5E6OA 1V86A 3ZDTA 1HE8A 4BOSC 2L00B 2HTHA 4JL9A 4WAAA 5IAAC 3LDZE 1TGZB 2GBKA 4HCPB 4PYUA 4PYZA 3WIMA 2XK5A 4HDQA 2IBIB 2JF5A 4KZCA 4RMAA 1E7VA 3HK0A 4MSMB 4DDGD 4ICUA 3RYTA 2PPHA 4ZRIA 4DXAB 2IO0B 2KLCA 4E71A 4I6PA 2KDIA 2RD0A 2KJRA 3WAMA 3WANA 4A3OA 4BOZB 2LVPA 2FUHB 2I1KA 1UBQA 2KJHB 2RPQA 4MGKE 2KFKB 2D11A 3ZNGC 1IYFA 3DDCB 4ZRJA 4EKUA 4FULA 1R4MI 4NQLB 1TBEA 4I6NB 2NVUI 3RZFA 2DAJA 2KZRA 5CHWA 3M63B 5KHQA 2Z0DB 4W9LA 2MW5A 4KVGB 4FJVB 1WH3A 2D07B 2JVCA 4NPNA 2LGDA 4ZDVA 3AXCA 1V81A 2K6QA 2GBMA 3HM6X 3B08A 3O65B 3V61A 3RUIB 3EC8A 3PHXB 4HXDA 2EMTA 4GSWA 4MDKE
chains in the Genus database with same CATH superfamily
5G55A 2M0AA 1P0RA 4NZLB 4WWPA 2CS4A 2FCMA 1IGCA 4DXGA 2R61A 3R8BA 4MGYE 1WGGA 1XT9B 5L95C 2XK5B 1K50A 1L6UA 2LRUA 3A9JB 2LEKA 1RAXA 3FILB 5E6PA 2DZJA 2GMIC 4C4VA 3C8YA 3NZUA 4B6WA 4RFBA 1GC7A 5IP4D 2KTFA 1TYGB 2WXMA 2BVCA 3L17A 3DBRB 4ZYNA 4C80A 1TY0A 2BYEA 2H89B 1HA5A 4PS8A 1YJ1A 1NI2A 4LTUA 1TKEA 1KLVA 5EE0A 2C7MB 1T5XD 3MP9A 3ZTDA 2Z0EB 3W5UB 1MFWA 3U7ZA 4IM3A 2DYBA 2BYTA 5FR6A 5FKAC 3DVGY 1E0ZA 5T8IA 2KMMA 1ZOYB 1SE9A 4IOIE 1HTQA 2M19A 3HRDD 3Q6BA 1I4PA 2YEPF 3NUHB 4GDKA 2WXQA 1OQYA 2GRIA 1ZP0B 1TS2A 2CHZA 1S3SG 4FHJA 2N7DA 4GDLB 2IGDA 2LJIA 1ACCA 3PGEA 1WZ3A 3P4SB 4F7ZA 4KGTA 4US8A 3RFZB 2BWFA 3DBRI 1T0SC 5GXGB 1KM7A 2BYFA 2LGIA 2I1JA 2PKOA 3KLSX 3DVNU 1AWDA 1XLOA 3M95A 5CHFA 1RRBA 3VTWA 1AW7A 3ZO5B 1QF6A 2L05A 3X23A 2JSVX 4XDCA 3WCQA 4BKTA 2CR5A 2Y3AA 4ACFA 2FIFA 4JLCA 2M0XA 1V97A 4F1SA 3QA8A 3Q3MC 1XXGA 2HE7A 2MWSB 4FHKA 4W9HA 2J4XA 3L16A 4S17A 4MSQB 4WQOB 2QEJC 2DZMA 3ZYYX 2VRRB 2JWUA 2D3AA 2L7RA 1L0YB 2PIAA 2V9HA 4XDDA 1UGJA 1I4GA 2L0FA 1WGKA 4LNOA 1GJZA 1WRDB 1JROA 3JSVA 2AQ1B 4RGTA 1U4AA 2D3CA 1RLFA 2J52A 1DYQA 1RM6C 2BQQA 2KNBA 3N3KB 1F52A 2W9NA 3WA0A 1IGDA 3U52E 1C79A 2HDEA 4JGHB 1EWYC 4CQNA 3N32A 2BKRB 2NTSA 1QILA 3AEGB 3AM9A 3FC4A 2FIDA 2KDEB 3UIPB 4ARIA 1I4HA 4JQWC 1ZUD2 4GB9A 4NJ7A 3RPFC 1WE7A 4XYCA 2MX2A 2M56B 5JHBA 1NDDA 5J17A 2E6XA 3U7DA 5BO4B 2KKCA 2NBUA 1BUIC 1SE3A 2KFKA 2K0PA 3AEEB 2N1VA 2JY6A 1SGHA 1PUTA 3JVZX 3DOWA 3DHHC 2IO2B 4TMAB 4BKSA 5E6JA 5H92C 4TUUA 5IO9A 2L3ZA 2LXAA 5BYQA 1WF9A 4ANUA 5JH5C 2C9WB 3ZDMC 4HKQA 3RMKC 1N5XA 1J7CA 1ET9A 2L52A 2WXJA 3IFWB 1FXAA 2KWVB 2E3TA 1WE6A 2RMMA 2N4FA 1KOTA 4JX1C 1I35A 3VUWA 4DK5A 2LUEA 3IXSA 4KX6B 2JPHA 4MEMA 2B3AA 3W2DA 1XLNA 3PZ8A 1D4BA 1JWMD 2FCQA 2WXRA 3KUZA 1KJTA 4ARCA 2BW2A 2LI5A 1JCKB 1V1PB 3AU4A 1VCBA 1XCQL 2KYWA 3RN9C 2ZVOA 4ZYSA 1QT9A 4MGZE 3TMPB 3ECIA 2KQSA 1GUAB 4FJZA 2BTEA 1SF0A 4WWMA 1WY8A 3Q3FA 1Z5SB 4W9GA 3KWLA 1QZEA 1XO3A 2N7JA 1WYGA 1NENB 5IKCM 1JRUA 4KDLB 1YD8U 3H9DA 3ZRFA 1UD7A 4OZBA 3DHGC 4LNNA 3JYUA 1KFYB 1GB1A 1IUEA 3V3XA 2K5PA 3LYYA 1GC6A 3DHIC 3UINB 3ZIMA 1AYFA 3B9JA 3PV1A 1IBXA 3TSSA 3A1QB 3VUYA 3GE8C 3OAWA 2NPTB 1V80A 3HVZA 3AMZA 5G5GA 1WMHB 4KDIC 3U30A 2CKHB 3GP7A 1FFUA 2L0TA 1LFDA 4IM2A 3M62B 5FK9C 3PZ7A 4WJNA 1FCCC 4IUMB 1QOFA 5CTRC 3TEWA 1C76A 2UWQA 2W54A 2DX5B 4HVBA 1WXMA 1K52A 1OFFA 2WXHA 1SJHD 3SDLC 1OEYJ 1CQVA 1WXVA 2PLPA 5EE9A 4GLSC 4JPSA 3AE3B 4ANXA 5D3IB 4E74A 3I57A 2KQ7A 3VH4B 2DZIA 2YLMA 2KOXA 1J0GA 4EUTA 2GB1A 2LGXA 3KYDD 3RT3B 3ZXRA 4BOSC 4YTNB 2WQYB 2RDHA 3NS1A 1RYJA 2G1EA 2WXFA 1D5ZC 4PYZA 3W5VB 3TEZA 2IO0B 2KLCA 4I6PA 3RNAC 1UBQA 2RPQA 2K9XA 2D11A 1YOVB 2BS3B 4ZRJA 3AE5B 3AV8A 1TBEA 2MHJA 4HEA1 3BVZA 3Q69A 4W9LA 2MW5A 4FJVB 5H8YE 1WH3A 2JVCA 2WP9B 1UWXA 1V81A 2DNFA 3HM6X 3O65B 1N60A 3RUIB 4HXDA 1N63A 1E8YA 4MDKE 1ZPSA 1JWAD 3Q8CA 2G3QB 2KX3A 4WQMA 4GN1A 1FXTB 1UH6A 2QIEB 1QOBA 1SEBD 2WU2B 1D3ZA 1Q0WB 2GBNA 3RD2A 3P42A 3AE1B 4HJGE 3I9V1 4GOCA 2IPKD 5D2MB 4IC7B 1QOGA 1E7PB 1K51A 2KO3A 3PRZA 2O2VA 1L4DB 1H8CA 4AS1A 4A3PA 4W9JA 3R7RA 3N1YC 4E3CA 3BWUD 1TTNA 4HLEA 2K39A 4Q2JA 2REXA 4AUQC 5D6JB 5J2RA 2X8XX 1SB3C 4KKJA 1TS4A 4XC2A 2W3SA 4DDID 1XCTL 2JZPA 3ML9A 3BYTB 1ZW7A 1JW9D 1YIWA 4MT5A 1WM2A 2WXPA 3T8MA 2ZPYA 4EZKA 2G9HD 1WZ0A 4RM9A 4N9F4 1N5WA 5BYRA 1V9JA 1YX5B 4K7SA 2ZCCA 3JW0X 1NI3A 3T3OA 2ZZPB 3WALA 2BS2B 2JZZA 1WGRA 3QJZA 3ZKJC 3PSEB 2KWUB 3R66C 1PFDA 4N6EB 4AOFA 2B76B 1MHHE 1N6ZA 3R2TA 4C4VB 4EZJA 1C4CA 3D32A 4EOYA 4G3XB 2XEWA 2Z59B 2LGSA 4ZRQA 5IN7A 1VRAB 3W9CB 4WH4A 3ZLZA 2N9PC 1WX9A 3BVMA 3HIZA 4TV3A 1H4RA 2ZJDA 3AEAB 1EU4A 1I4QA 1JRPA 4TSSA 3L54A 2QMTA 1MI0A 3CWIA 2QC8A 3TJPA 3QK0A 4JWSC 2ON8A 2Q5WD 3NRZA 4MM3A 1OGWA 1Q1OA 3ALBA 3L13A 3KWVA 2RR9A 1HZ5A 4FN2A 4W9IA 4LDTB 1PYWD 4HKZE 2ZPNA 3ONSA 3V05A 1G6JA 5KHOA 2PJHA 1QQRA 4GDKB 1EM7A 4W9FA 3VTVA 3DBSA 5EE3A 2WWZA 2Z8LA 5AZGA 2BS4B 2DAFA 1I4XA 3NZ3A 1C9FA 2MSED 2DBYA 1E8XA 3P4QB 5AEKB 4EEWA 2AQ3B 3VR9B 1F2RI 3PRMB 1ZKHA 1R4NB 1ESFA 5BMGA 2JXXA 2KK8A 4M0WA 4W9EA 1YMHE 4LCDE 2R2OA 3N20C 3I5JC 3KUCB 2L8JA 3R2IA 3NVYA 3ABVB 1JQ4A 3NVZA 1TS3A 2NBWB 2MCNB 3EECA 4K3BA 3H1UA 4CHKA 5IOIA 3UQBA 3P2BA 3P4RB 3GZNB 1E6EB 2MBQA 3U2SC 4EFOA 1Y56A 2C5LC 1XF5L 3AE7B 4REZA 2N7EA 3UF8A 4FA6A 3H7SA 3JSVB 3MJ5A 4N58A 4G50A 1TZ1A 2HJ1A 3RZWC 3SEBA 2KQ4X 4YT0B 5MPOA 4KIKB 2W55A 3DPDA 1WJ4A 3AE6B 4ANVA 2YVCA 4FXCA 1I7HA 1YNTE 1K8RB 4RF0A 1HZ6A 1R4NI 3L4PA 2K1FA 5G2NA 2LVOA 3RCZA 2ONQA 1UBIA 4ICVA 4ANWA 1P7EA 1OQRA 4LJOB 5D94A 4XWTA 1JWSD 2O6VB 1MHXA 2L76A 3E56A 3A9JA 3CIRB 3FILA 1OEYA 1CK1A 3GZNI 2VH1A 2SEBD 1FMAD 2IO3B 3QC8B 3KVFB 3KQ4A 3NZSA 3RNEC 2GLSA 2VH2A 4KGRA 2LZ6A 4HCNB 2VZKB 4MGIE 1F1HA 4M8MA 3UI3A 1FXIA 4B95A 4FADA 5HG2A 4J6IA 4C7YA 3LB8C 1HXYD 1C1YB 4MJSB 1FNWA 4JIOU 1WI0A 2PW9A 1LXDA 2V4LA 3B1LX 2GOWA 1GAQB 1NEKB 1WM3A 4XWWA 2M8SA 4W9CA 3MJWA 2KMAA 3L10B 2Y5PA 2BB6A 2GBRA 3Q8AA 2CHWA 2CHXA 4N59A 2WHIA 1GNUA 3I3TB 3GB1A 3TUOA 2OJRA 3BYYB 2AWTA 4WJQA 2WXLA 3A4SC 1A70A 2MJ3A 4P16A 1IPGA 2W82A 3UGBB 1R4MB 1SE4A 1WXQA 4ZOHC 4PK1A 4K1RB 3MC8A 2PE6B 2BGFA 3VUXA 1C77A 2KDFB 3OLMD 2DZKA 4GXBA 4DXFA 1OTRB 3V60A 3CSFA 3Q3OC 4LK0M 1SIFA 2JUOA 2KHWB 3MHSD 1FFVA 3Q2AC 5GMVA 2KAJA 4DHZB 2WXGA 5E6OA 1V86A 2BBCA 1HE8A 1MPEA 3EUB2 4JL9A 1PGBA 1V1OA 1OQQA 5IAAC 3EGRA 1TGZB 3ZJTA 4HDQA 2JF5A 1DOXA 4RMAA 3N9YC 3SFEB 3E9SA 2PPHA 1XLQA 4E71A 2KDIA 1V8CA 2KJRA 3OG5A 4BOZB 2FUHB 2I1KA 4C56C 3ZNGC 3DWGC 4EKUA 4FULA 1L5PA 1R4MI 2LHDA 4I6NB 1VZ7A 2NVUI 5CHWA 3GE3C 2RDBC 4HRSA 1TT5B 4NPNA 2LGDA 3AXCA 5HI1A 4MH8A 1LGRA 3V61A 3PHXB 2H88B 1LQBA 3QCAA 3BK2A 4XZ4A 2ZVNA 2LD9A 2MQJA 1WXAA 3VFKA 4J3OD 2N9EB 5JXVA 2M1MA 3EA6A 2QCZA 1EU3A 4M8NA 4F8CB 3H8HA 4TQ0A 1L6VA 3IBEA 1VR9A 1WR1A 3GS2A 3N30A 3P1MA 2AX5A 3DCGA 4WJPA 2KJ6A 4YL8A 2WYQA 2IZVB 3VVWB 2LXCA 2R2QA 3RNFC 4NAWB 3ZNHB 4KV2A 4HROA 2MBBB 4X57B 1UUPA 4B9KA 3TEYA 1F0ZA 3APFA 2D3BA 3ZRCA 4KZ0A 3VXWA 3O13A 2V3NA 2PEAA 2JZ3B 2KTRA 4AP4C 4RCOA 4BVUC 1GB4A 3H7PB 5FR3A 4LDTD 4M01A 4EZLA 1ENFA 1UZXB 3RULA 1D5MC 3MTNB 4OVVA 2MA9B 1V49A 4ITKA 2G4SA 2J7QB 2MLBA 4YWGG 4KSKC 4WJOA 1CZPA 1T6BX 3DVGX 3PLUA 2J0JA 1SJED 5AUIA 2DYMA 3ZQ4A 4M00A 4XE0A 2KDMA 2KC1A 3NHEB 4NNJB 3RNGC 3VRBB 3VRAB 1V6EA 1MJDA 3DBHB 2WNMA 4HWIB 2MP2B 2WLBA 4P1CC 4DHZE 2GBJA 3EHVA 1JWBD 1KTKA 1L0VB 1BT0A 1J19A 2ASQA 2N9XA 1L2NA 3C0RB 3QAQA 2L83A 1KH0A 1R7SA 2N0SB 1SSNA 1EF5A 2WDRB 2V1YA 1WFYA 2A5UA 3VAWA 1AN8A 1JMLA 2IY1B 1WSPA 3VDZA 5DCNA 3EFCA 3OJ3A 2KWCA 5E6NA 1UGMA 2JT4B 2KXJA 4EE2A 4RM8A 4YSZB 1S1QB 1GG3A 1DGJA 2Y5BB 1JWUD 4MELA 2L1AA 2FE8A 4PS7A 1TJEA 4WURA 2GI9A 1LO5D 2IO1B 3ZJVA 3B2FA 3TIXA 4AWJA 3DBHI 2FCNA 1T3QA 3L08A 2G4DB 3NG0A 2D2QA 3B0AA 1E8WA 3VR8B 3W1SA 3VQIA 4K3CA 2J42A 1MG8A 3P4PB 4IDIA 1P98A 3AEFB 2KC2A 3HUIA 1CJEA 1ZGUB 2LJ5A 3K9PB 1E9MA 3WAPA 3MC0B 4LNKA 3UQAA 3VH3B 2V3SA 3A33B 3DQVA 4A9AA 2O6VD 2D10A 3CSTA 2DYOA 3PPAA 3ENEA 4P7IA 5C1ZA 4K81A 3CMMB 1P9DU 2LVQA 3AECB 2FCSA 2WX0A 4BKSD 1PQSA 1Q5WB 2L32A 1C3TA 4USAA 3V62A 1L4ZB 1VZ6A 2VZKD 3ETRA 2MEKA 2PVOD 2IDYA 1J8CA 3J9CA 2C7NB 4TKNA 1V2YA 3NJTA 2QHOA 1B9RA 3APDA 3PZDA 4WWOA 4LNIA 1FO4A 2W3RA 2JYEA 3PVLA 4IWPA 1A5RA 2FBWB 1WGYA 5AZFA 4OVUA 2PVGC 1F2RC 4KSLC 1NBFC 5HFYA 1FM0D 3PTFC 2LGYA 3A4RA 5DPRA 3ZJUA 1NYRA 4M0WB 2INNE 1HQRD 2V3PA 2K8BA 2J0MA 2Y5CA 3ZGZA 5BYSA 2WX1A 2HD5B 2XBBC 3BK1A 4RGMA 2CU3A 2LASA 4L23A 4MACA 3PHWB 4NQKE 4DBGA 4YTMB 1FPYA 5BMHA 5DPSA 1PDXA 2WDQB 3MHZA 2LWPA 4YSYB 3BINA 3KW5B 4B0EA 5AZHA 2RGFA 3A9KA 4GMVA 2AL6A 2LHEA 2JXTA 2NCNA 4IW0A 1BXTA 4JE3B 1WJNA 4DHJB 2RPVA 5DPTA 4GGQA 1RFAA 1T0RC 1V5OA 2KANA 3ZNID 3LXFA 1MVKA 1VD2A 3DBLI 1WJUA 1M94A 1NVID 1E8ZA 1YQBA 4YXDB 5IA7A 3AU5A 3BY4B 2YEPB 4LJPB 3IG3A 3N1ZC 1DOIA 3OJ4B 4PT5A 1C78A 3U8ZA 4ASWC 2DLBA 3Q3JA 3WAOA 1WX7A 3L0WB 1HEZE 2KVRA 2LFIA 2N9LA 4HK2A 5BMIA 2JQRB 1I42A 2OHFA 1GOZA 4URKA 2NR2A 2JWZA 2ZW1A 2I2YA 2KN4A 2FNJB 4LNFA 5LLIA 2MJDA 3HHMA 2MRPA 4H2AA 2DWQA 1UNSA 2EMSA 2RDGA 3SHQA 3PT2B 1TY2A 3R7QA 2PE9A 1PGAA 2NS5A 2KN5A 2BYVE 2OOBB 1ZDXA 2HTME 3ZDTA 2HTHA 2WU5B 4WAAA 2QDFA 4HCPB 4PYUA 3WIMA 2XK5A 4YSXB 1FRRA 1E7VA 4KGSA 2IJ0A 3HK0A 4MSMB 5AUKA 4ICUA 3RYTA 4ZRIA 4DDGD 2V0GA 2RD0A 3AN1A 1UWMA 4MGKE 2KFKB 1IYFA 3DDCB 5EE1A 4NQLB 2NMQA 2PTLA 2KZRA 3M63B 5KHQA 4BZAA 1RWSA 2Z0DB 4KVGB 4QAYA 4ZDVA 2N9KA 2K6QA 3B08A 3NVVA 3RNCC 2EMTA 4R3DA 2X38A 1KLGD 1Y8RC 5JHAA 1ROEA 3S2AA 1YN3A 3QQ8B 1F77A 1D5XC 4IWOA 2EKEC 3RNBC 1VZ8A 2INCC 4S0RA 4RH6A 1YJIA 3Q8EA 2KFJA 1C4AA 3H6NA 4A20A 1YJJA 1WIAA 4KIKA 3PS6A 3TCAA 2KT7A 2KLGA 4II2B 4GDLA 2V4IB 3QARA 1SXTA 1E5WA 1FIQA 4GU2A 2MBOA 2BT6A 4HPLB 2I38A 1DOYA 3ZNZB 1WYWB 4WIPA 2QILA 2LUMA 4BKGA 2WXNA 2BWES 2D5GA 2UU7A 2CJNA 1EF1A 1WGHA 3NVWA 2O6VA 3NS8A 3U4EG 2AEHA 2JU6X 3IT6B 4TQ1A 4IWQA 2QJLA 1WX8A 3QIJA 2ZW0A 3IHPC 1WR6E 1KRHA 1TKYA 2AL3A 1EO6A 2WDTB 3T3NA 4PS3A 4W9KA 1ZXIA 2TSSA 3SFDB 4AJYB 3VTUA 4O1NA 4KKIA 4WAFA 2BPSA 1IBXB 4LLGM 4ZRKA 1CMXB 5C3JB 1ZDVA 3T9LA 5J18A 2MJEA 4OVZA 2FAZA 2K25A 2EKIA 4MJSA 2ACZB 2BF8B 1I4RA 1N61A 3Q3NC 2J53A 2FUG1 3MC9A 1KLUD 5LXIB 2XN9C 1XD3B 2NTTA 4A55A 1M4VA 2KTRB 3FAHA 3BIID 2JYTA 2PMVA 4II3B 2RSUA 1E90A 3ZW3A 2INPE 3V6CB 3DWMA 1TS5A 2M17A 2MBEA 1WRIA 4NJCA 3Q8BA 2KACA 2DHZA 1X1MA 3KUDB 1SIJA 2LMCA 4HPPA 4HPMB 1F9JA 4L1BA 3QHTA 5EDSA 1J7AA 4L2YA 1WXSA 3AE4B 1P1AA 2BKFA 4BBNC 3HVDA 4JWUC 4C7ZA 3AH7A 1GPXA 3ML8A 3LJ3A 5CX3A 4A90A 4G0NB 1XQQA 3ZTCA 2HJ8A 5C2TB 1Z2MA 2KD0A 5G5HA 3BVGA 2K8HA 2IYDB 3IVFA 1FNVA 1B1ZA 5D7GA 2A4ZA 2UYZB 4P6VF 2ZEQA 1EUVB 5C23A 3V6EB 1N62A 3AB5A 1V1PA 3AEDB 1P7FA 1YN4A 4US9A 1T0QC 1PGXA 4YTPB 3W1SC 1P3QU 4OHJA 4IM0A 2OEDA 2K8CA 2D3GA 1V5TA 2WDVB 3VHTC 1E10A 3SD5A 1WGDA 5D3DA 4G11A 2IGGA 4I6LB 3AE2B 1WJ6A 1FNUA 3Q8FA 1FD6A 2OJWA 4CO7A 3R3MA 4AQ7A 4DHJD 3UIOB 4NY0A 4BBNF 1MG4A 3AULA 2INDC 1AARA 2O2VB 5HKHA 3W1YA 1RFKA 4FLHA 2JRHA 1FRDA 1SE2A 1T0YA 3SU8X 1QKZA 3Q14C 2WXIA 4UDUC 4IG7B 1YN5A 1C4PA 4HJKA 3A1QA 4CYEA 4M02A 3PLVA 2C60A 2XNAC 2NPTA 2IGHA 3DVNV 3NOBA 4K7WA 2JRIB 1WMHA 3TEXA 1L7YA 3X0WA 3TBLD 2ZNVC 4NAWA 1TZOA 1QLBB 5DPWA 3KH0A 4DWFA 1SBBB 3NY5A 2CJOA 4FJYA 1Q10A 3K9OB 4RGNA 5JZEB 1ISNA 3EFUA 1WWTA 3QX1A 4BFRA 3TL5A 4W9DA 4FBJB 2J0KA 2MH7A 2WS3B 3GOEA 2ZNVB 2KDBA 3OWEB 1YQ4B 4IKGA 3H7PA 5CHVC 1ET6A 2BB5A 5L83A 2WXOA 3HM3A 1VLBA 3ZUNA 4ZRPA 2K6DB 3ZXVA 4RGOS 3AI5A 2ICIA 2WGSA 4C00A 4A8XC 2MP2A 3PRPB 1BMLC 1EWCA 5I4DA 3AE8B 1JALA 3AE9B 4RF1A 1YQ3B 4HDOA 4AJWA 3APCA 3KYCD 2MBHA 3BZDB 3IAS1 2KX0A 2N1WA 1E7UA 2AYOB 4MM3B 1ZE3D 1FEHA 3N1XC 3RI7C 1TIFA 2NBVB 1XLPA 1XEEA 1QOAA 4ZHOA 4B0MA 1K53A 3B2GA 3CF6E 3M3JA 2G45B 4K7UA 5TR5A 3MFGA 4GIVA 2CU1A 2C7HA 4NJ6A 2WXKA 2K22A 3FKYA 2LRWA 1KF6B 2ZCBA 3A9KB 1IP9A 2M4NA 1TKGA 4MH0E 4XX5A 4D2KA 1HTOA 4WWNA 3PREA 4A6QA 3PO0A 1YX6B 1J7BA 1D6EC 4DQOC 2KMCA 5HHDG 4XGAB 2IY0B 5LXHA 3IAM1 3IT4B 1UELA 4ZHPA 1LM8B 1FCLA 2DENB 3QWZB 3ZVVA 1STEA 1UF0A 4OW0A 3DBLB 2KVZA 3URYA 2L00B 3C19A 3SR6A 2KWDA 3LDZE 1L0XB 2GBKA 2K3UA 2IBIB 4KZCA 1ZXHA 4RNAA 4DXAB 1VJKA 3WAMA 3AEBB 4A3OA 3WANA 2LVPA 2KJHB 1VDVA 5LNK1 2AQ2B 3P63A 3I63C 3RZFA 2DAJA 4OZAA 2JX5A 2D07B 4P1BC 5TSSA 2SAKA 1NYQA 2QSDA 2GBMA 4NAMA 2EELA 4OZCA 3EC8A 4BAXA 4GSWA
chains in the Genus database with same CATH topology
5G55A 1Y8RC 5JHAA 1LQBA 1P0RA 3QCAA 4XZ4A 2ZVNA 2G3QB 2LD9A 3S2AA 2MQJA 1WXAA 3QQ8B 2KX3A 4WWPA 2CS4A 3VFKA 4GN1A 4IWOA 2EKEC 2FCMA 2N9EB 2M1MA 1FXTB 1UH6A 4M8NA 4F8CB 1D3ZA 4MGYE 1Q0WB 1WGGA 1XT9B 2GBNA 4TQ0A 3RD2A 3IBEA 1WR1A 2KFJA 5L95C 4GOCA 5D2MB 3N30A 3H6NA 4A20A 4IC7B 2XK5B 3DCGA 4WJPA 2KJ6A 1WIAA 2KO3A 3PS6A 2LRUA 3A9JB 3PRZA 4KIKA 4YL8A 2O2VA 2WYQA 3TCAA 1RAXA 2KLGA 5E6PA 1H8CA 2DZJA 4II2B 4GDLA 4A3PA 2GMIC 4W9JA 2IZVB 3R7RA 3QARA 3VVWB 2LXCA 2R2QA 1E5WA 4E3CA 3NZUA 4B6WA 1GC7A 1TTNA 4NAWB 3ZNHB 2KTFA 4HLEA 2K39A 4GU2A 2MBOA 4HPLB 2REXA 4KV2A 3L17A 4ZYNA 4AUQC 5D6JB 3ZNZB 1WYWB 2MBBB 5J2RA 4X57B 2BYEA 4BKGA 4PS8A 4B9KA 1YJ1A 1NI2A 3APFA 2BWES 4XC2A 1KLVA 2C7MB 3ZRCA 4DDID 4KZ0A 3ZTDA 2Z0EB 3VXWA 1EF1A 1WGHA 2PEAA 2JZ3B 2KTRA 2O6VA 3NS8A 4AP4C 2AEHA 4BVUC 4IM3A 3H7PB 2DYBA 3ML9A 4TQ1A 4LDTD 4IWQA 1ZW7A 1WX8A 1YIWA 4EZLA 5FR6A 1UZXB 3QIJA 3IHPC 3RULA 3MTNB 4OVVA 1WR6E 1WM2A 2MA9B 3DVGY 3T8MA 1V49A 2AL3A 2ZPYA 1EO6A 2G4SA 2J7QB 2MLBA 2WDTB 4KSKC 4WJOA 4EZKA 3DVGX 1WZ0A 3PLUA 4N9F4 4PS3A 4RM9A 4W9KA 2J0JA 4AJYB 1V9JA 3VTUA 1YX5B 2DYMA 4K7SA 3NHEB 2KC1A 1SE9A 2ZCCA 3JW0X 4NNJB 2ZZPB 1V6EA 2BPSA 4HWIB 3WALA 4GDKA 2JZZA 1WGRA 2MP2B 3QJZA 1OQYA 1CMXB 4ZRKA 3ZKJC 3PSEB 4DHZE 2KWUB 3R66C 2CHZA 2GBJA 3EHVA 1S3SG 4AOFA 4FHJA 3T9LA 2N7DA 4GDLB 5J18A 4EZJA 2FAZA 3D32A 1WZ3A 2K25A 3PGEA 1BT0A 4EOYA 4G3XB 1J19A 2XEWA 2ASQA 2N9XA 1L2NA 3C0RB 3QAQA 2Z59B 4MJSA 4F7ZA 2BWFA 3DBRI 1EF5A 2BF8B 1KM7A 2BYFA 2V1YA 1WFYA 2A5UA 2I1JA 3VAWA 3ZLZA 2IY1B 2N9PC 1WX9A 3HIZA 3DVNU 4TV3A 5LXIB 3M95A 1H4RA 1RRBA 1XD3B 2ZJDA 5CHFA 3VDZA 5DCNA 3VTWA 3ZO5B 2L05A 3X23A 3OJ3A 4BKTA 2KWCA 2KTRB 2CR5A 1UGMA 3L54A 5E6NA 2FIFA 4JLCA 4II3B 2JT4B 2RSUA 2M0XA 1E90A 2KXJA 3QA8A 3ZW3A 4F1SA 3V6CB 4RM8A 3QK0A 3TJPA 2M17A 1S1QB 2MBEA 1GG3A 2Y5BB 2DHZA 4MM3A 1OGWA 1X1MA 1Q1OA 2HE7A 3ALBA 2MWSB 3L13A 2RR9A 4FHKA 4MELA 4W9HA 3KUDB 3L16A 4FN2A 4MSQB 4HPMB 1F9JA 4PS7A 4WQOB 4W9IA 2DZMA 3QHTA 4LDTB 2ZPNA 3ONSA 2IO1B 2VRRB 2L7RA 3TIXA 4AWJA 3DBHI 1G6JA 5KHOA 2FCNA 5EDSA 2PJHA 3L08A 2G4DB 4GDKB 4W9FA 2D2QA 1WXSA 3B0AA 1E8WA 3VTVA 1P1AA 3W1SA 2L0FA 2BKFA 3DBSA 4BBNC 3VQIA 1MG8A 1GJZA 1P98A 1WRDB 3JSVA 2WWZA 5AZGA 2KC2A 3ML8A 3LJ3A 2DAFA 5CX3A 1U4AA 4G0NB 1RLFA 1ZGUB 2MSED 1XQQA 2LJ5A 3K9PB 2KNBA 3ZTCA 2HJ8A 1E8XA 3N3KB 2W9NA 5AEKB 3WA0A 4EEWA 1E8YA 1Z2MA 3WAPA 2KD0A 3UQAA 3VH3B 4JGHB 2V3SA 3A33B 3PRMB 2K8HA 2IYDB 2BKRB 3DQVA 3IVFA 2O6VD 3N32A 1ZKHA 5D7GA 2D10A 2A4ZA 2JXXA 2KK8A 2UYZB 3CSTA 4W9EA 2DYOA 2ZEQA 1EUVB 2FIDA 4LCDE 2R2OA 5C23A 2KDEB 3PPAA 3UIPB 3ENEA 3V6EB 4JQWC 3KUCB 2L8JA 4P7IA 4GB9A 5C1ZA 2NBWB 4K81A 4NJ7A 3CMMB 1P9DU 1WE7A 2MCNB 3EECA 2LVQA 2MX2A 2FCSA 3H1UA 4CHKA 5JHBA 2WX0A 1NDDA 4BKSD 3W1SC 1P3QU 1PQSA 4IM0A 5J17A 1Q5WB 3UQBA 3P2BA 3U7DA 5BO4B 1C3TA 2K8CA 3V62A 2D3GA 2KKCA 2NBUA 1V5TA 3VHTC 2MBQA 2KFKA 4EFOA 3SD5A 2N1VA 1WGDA 2JY6A 1SGHA 4G11A 3JVZX 2C5LC 4I6LB 1WJ6A 3DOWA 1J8CA 2C7NB 4TKNA 1V2YA 2QHOA 2IO2B 4BKSA 4CO7A 3APDA 3PZDA 3R3MA 4WWOA 2N7EA 4TUUA 3UF8A 4DHJD 3UIOB 3H7SA 2L3ZA 2LXAA 3JSVB 4NY0A 4FA6A 4G50A 1WF9A 1TZ1A 4BBNF 3RZWC 4ANUA 5JH5C 2C9WB 3ZDMC 3AULA 3PVLA 4KIKB 4IWPA 1A5RA 5AZFA 1WGYA 3DPDA 3IFWB 1AARA 2O2VB 4OVUA 5HKHA 3W1YA 1WJ4A 4KSLC 2KWVB 1NBFC 4ANVA 1WE6A 3PTFC 2YVCA 2LGYA 2N4FA 1KOTA 3A4RA 1I35A 4FLHA 3VUWA 4DK5A 2JRHA 2LUEA 1K8RB 2JPHA 4MEMA 5DPRA 2B3AA 1R4NI 2K1FA 5G2NA 2LVOA 4M0WB 3RCZA 1T0YA 3SU8X 1UBIA 4ICVA 4ANWA 2K8BA 2J0MA 2FCQA 4IG7B 3KUZA 1KJTA 4LJOB 5D94A 2LI5A 4HJKA 3A1QA 2WX1A 4CYEA 2HD5B 2XBBC 2O6VB 3AU4A 3PLVA 1VCBA 2L76A 2C60A 2NPTA 3DVNV 3NOBA 3A9JA 4K7WA 2ZVOA 2LASA 2JRIB 1WMHA 1OEYA 4MGZE 3PHWB 3TMPB 3ECIA 4NQKE 3GZNI 1L7YA 2KQSA 3X0WA 1GUAB 4DBGA 4FJZA 3TBLD 2IO3B 3QC8B 3KVFB 2ZNVC 4NAWA 1WY8A 5DPSA 5DPWA 3KH0A 3NZSA 4DWFA 3NY5A 4FJYA 2LWPA 3K9OB 5JZEB 3Q3FA 1ISNA 1Z5SB 3EFUA 3QX1A 4W9GA 4BFRA 3TL5A 1QZEA 2LZ6A 4W9DA 4HCNB 4MGIE 3BINA 4FBJB 2J0KA 3GOEA 4M8MA 2ZNVB 2KDBA 3KW5B 4B95A 4FADA 3H7PA 1JRUA 4KDLB 1YD8U 3H9DA 5AZHA 2RGFA 3A9KA 4GMVA 4J6IA 5CHVC 2AL6A 3ZRFA 1UD7A 2NCNA 4IW0A 5L83A 1WJNA 3JYUA 4DHJB 3HM3A 5DPTA 1C1YB 4MJSB 3ZUNA 4GGQA 1RFAA 2K6DB 4JIOU 1WI0A 1LXDA 2V4LA 3AI5A 1V5OA 3B1LX 2KANA 3ZNID 2GOWA 1VD2A 1GC6A 3DBLI 1WJUA 1M94A 1WM3A 3UINB 3ZIMA 1E8ZA 2M8SA 3PV1A 1YQBA 3A1QB 3VUYA 2MP2A 3PRPB 4W9CA 3MJWA 3OAWA 2KMAA 5IA7A 3L10B 4HDOA 2NPTB 1V80A 4AJWA 3APCA 3KYCD 3AU5A 2GBRA 2MBHA 1WMHB 3BY4B 2KX0A 2N1WA 1E7UA 4KDIC 2CHWA 3U30A 2CHXA 4LJPB 2AYOB 3IG3A 3OJ4B 1GNUA 3U8ZA 4ASWC 2CKHB 3I3TB 3Q3JA 3WAOA 1WX7A 2L0TA 2OJRA 3L0WB 1LFDA 2AWTA 2NBVB 4WJQA 4IM2A 3M62B 3A4SC 2KVRA 4WJNA 4IUMB 5CTRC 3CF6E 3M3JA 2G45B 1IPGA 2UWQA 4K7UA 4HK2A 3UGBB 2DX5B 4HVBA 5TR5A 4GIVA 2CU1A 1WXMA 2C7HA 4NJ6A 1I42A 2LRWA 3SDLC 4K1RB 4URKA 1OEYJ 2NR2A 2ZCBA 2JWZA 3A9KB 1IP9A 2M4NA 2FNJB 4MH0E 4XX5A 5LLIA 1WXVA 3HHMA 2MRPA 2BGFA 2PE6B 3VUXA 4ANXA 4WWNA 2KDFB 2EMSA 3PREA 3OLMD 2DZKA 4GXBA 1OTRB 1YX6B 3SHQA 3PT2B 3V60A 3R7QA 4E74A 3CSFA 2KMCA 2KQ7A 2PE9A 3VH4B 2DZIA 2YLMA 2IY0B 1SIFA 5LXHA 2KOXA 2JUOA 2KHWB 1UELA 2NS5A 3MHSD 2KN5A 1J0GA 4EUTA 1LM8B 2DENB 2BYVE 3QWZB 5GMVA 3ZVVA 2LGXA 3KYDD 4DHZB 3RT3B 2OOBB 5E6OA 1V86A 3ZDTA 1HE8A 4BOSC 2L00B 2HTHA 4JL9A 4WAAA 5IAAC 3LDZE 1TGZB 2GBKA 4HCPB 4PYUA 4PYZA 3WIMA 2XK5A 4HDQA 2IBIB 2JF5A 4KZCA 4RMAA 1E7VA 3HK0A 4MSMB 4DDGD 4ICUA 3RYTA 2PPHA 4ZRIA 4DXAB 2IO0B 2KLCA 4E71A 4I6PA 2KDIA 2RD0A 2KJRA 3WAMA 3WANA 4A3OA 4BOZB 2LVPA 2FUHB 2I1KA 1UBQA 2KJHB 2RPQA 4MGKE 2KFKB 2D11A 3ZNGC 1IYFA 3DDCB 4ZRJA 4EKUA 4FULA 1R4MI 4NQLB 1TBEA 4I6NB 2NVUI 3RZFA 2DAJA 2KZRA 5CHWA 3M63B 5KHQA 2Z0DB 4W9LA 2MW5A 4KVGB 4FJVB 1WH3A 2D07B 2JVCA 4NPNA 2LGDA 4ZDVA 3AXCA 1V81A 2K6QA 2GBMA 3HM6X 3B08A 3O65B 3V61A 3RUIB 3EC8A 3PHXB 4HXDA 2EMTA 4GSWA 4MDKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G55 A;  1Y8R C;  5JHA A;  1LQB A;  1P0R A;  3QCA A;  4XZ4 A;  2ZVN A;  2G3Q B;  2LD9 A;  3S2A A;  2MQJ A;  1WXA A;  3QQ8 B;  2KX3 A;  4WWP A;  2CS4 A;  3VFK A;  4GN1 A;  4IWO A;  2EKE C;  2FCM A;  2N9E B;  2M1M A;  1FXT B;  1UH6 A;  4M8N A;  4F8C B;  1D3Z A;  4MGY E;  1Q0W B;  1WGG A;  1XT9 B;  2GBN A;  4TQ0 A;  3RD2 A;  3IBE A;  1WR1 A;  2KFJ A;  5L95 C;  4GOC A;  5D2M B;  3N30 A;  3H6N A;  4A20 A;  4IC7 B;  2XK5 B;  3DCG A;  4WJP A;  2KJ6 A;  1WIA A;  2KO3 A;  3PS6 A;  2LRU A;  3A9J B;  3PRZ A;  4KIK A;  4YL8 A;  2O2V A;  2WYQ A;  3TCA A;  1RAX A;  2KLG A;  5E6P A;  1H8C A;  2DZJ A;  4II2 B;  4GDL A;  4A3P A;  2GMI C;  4W9J A;  2IZV B;  3R7R A;  3QAR A;  3VVW B;  2LXC A;  2R2Q A;  1E5W A;  4E3C A;  3NZU A;  4B6W A;  1GC7 A;  1TTN A;  4NAW B;  3ZNH B;  2KTF A;  4HLE A;  2K39 A;  4GU2 A;  2MBO A;  4HPL B;  2REX A;  4KV2 A;  3L17 A;  4ZYN A;  4AUQ C;  5D6J B;  3ZNZ B;  1WYW B;  2MBB B;  5J2R A;  4X57 B;  2BYE A;  4BKG A;  4PS8 A;  4B9K A;  1YJ1 A;  1NI2 A;  3APF A;  2BWE S;  4XC2 A;  1KLV A;  2C7M B;  3ZRC A;  4DDI D;  4KZ0 A;  3ZTD A;  2Z0E B;  3VXW A;  1EF1 A;  1WGH A;  2PEA A;  2JZ3 B;  2KTR A;  2O6V A;  3NS8 A;  4AP4 C;  2AEH A;  4BVU C;  4IM3 A;  3H7P B;  2DYB A;  3ML9 A;  4TQ1 A;  4LDT D;  4IWQ A;  1ZW7 A;  1WX8 A;  1YIW A;  4EZL A;  5FR6 A;  1UZX B;  3QIJ A;  3IHP C;  3RUL A;  3MTN B;  4OVV A;  1WR6 E;  1WM2 A;  2MA9 B;  3DVG Y;  3T8M A;  1V49 A;  2AL3 A;  2ZPY A;  1EO6 A;  2G4S A;  2J7Q B;  2MLB A;  2WDT B;  4KSK C;  4WJO A;  4EZK A;  3DVG X;  1WZ0 A;  3PLU A;  4N9F 4;  4PS3 A;  4RM9 A;  4W9K A;  2J0J A;  4AJY B;  1V9J A;  3VTU A;  1YX5 B;  2DYM A;  4K7S A;  3NHE B;  2KC1 A;  1SE9 A;  2ZCC A;  3JW0 X;  4NNJ B;  2ZZP B;  1V6E A;  2BPS A;  4HWI B;  3WAL A;  4GDK A;  2JZZ A;  1WGR A;  2MP2 B;  3QJZ A;  1OQY A;  1CMX B;  4ZRK A;  3ZKJ C;  3PSE B;  4DHZ E;  2KWU B;  3R66 C;  2CHZ A;  2GBJ A;  3EHV A;  1S3S G;  4AOF A;  4FHJ A;  3T9L A;  2N7D A;  4GDL B;  5J18 A;  4EZJ A;  2FAZ A;  3D32 A;  1WZ3 A;  2K25 A;  3PGE A;  1BT0 A;  4EOY A;  4G3X B;  1J19 A;  2XEW A;  2ASQ A;  2N9X A;  1L2N A;  3C0R B;  3QAQ A;  2Z59 B;  4MJS A;  4F7Z A;  2BWF A;  3DBR I;  1EF5 A;  2BF8 B;  1KM7 A;  2BYF A;  2V1Y A;  1WFY A;  2A5U A;  2I1J A;  3VAW A;  3ZLZ A;  2IY1 B;  2N9P C;  1WX9 A;  3HIZ A;  3DVN U;  4TV3 A;  5LXI B;  3M95 A;  1H4R A;  1RRB A;  1XD3 B;  2ZJD A;  5CHF A;  3VDZ A;  5DCN A;  3VTW A;  3ZO5 B;  2L05 A;  3X23 A;  3OJ3 A;  4BKT A;  2KWC A;  2KTR B;  2CR5 A;  1UGM A;  3L54 A;  5E6N A;  2FIF A;  4JLC A;  4II3 B;  2JT4 B;  2RSU A;  2M0X A;  1E90 A;  2KXJ A;  3QA8 A;  3ZW3 A;  4F1S A;  3V6C B;  4RM8 A;  3QK0 A;  3TJP A;  2M17 A;  1S1Q B;  2MBE A;  1GG3 A;  2Y5B B;  2DHZ A;  4MM3 A;  1OGW A;  1X1M A;  1Q1O A;  2HE7 A;  3ALB A;  2MWS B;  3L13 A;  2RR9 A;  4FHK A;  4MEL A;  4W9H A;  3KUD B;  3L16 A;  4FN2 A;  4MSQ B;  4HPM B;  1F9J A;  4PS7 A;  4WQO B;  4W9I A;  2DZM A;  3QHT A;  4LDT B;  2ZPN A;  3ONS A;  2IO1 B;  2VRR B;  2L7R A;  3TIX A;  4AWJ A;  3DBH I;  1G6J A;  5KHO A;  2FCN A;  5EDS A;  2PJH A;  3L08 A;  2G4D B;  4GDK B;  4W9F A;  2D2Q A;  1WXS A;  3B0A A;  1E8W A;  3VTV A;  1P1A A;  3W1S A;  2L0F A;  2BKF A;  3DBS A;  4BBN C;  3VQI A;  1MG8 A;  1GJZ A;  1P98 A;  1WRD B;  3JSV A;  2WWZ A;  5AZG A;  2KC2 A;  3ML8 A;  3LJ3 A;  2DAF A;  5CX3 A;  1U4A A;  4G0N B;  1RLF A;  1ZGU B;  2MSE D;  1XQQ A;  2LJ5 A;  3K9P B;  2KNB A;  3ZTC A;  2HJ8 A;  1E8X A;  3N3K B;  2W9N A;  5AEK B;  3WA0 A;  4EEW A;  1E8Y A;  1Z2M A;  3WAP A;  2KD0 A;  3UQA A;  3VH3 B;  4JGH B;  2V3S A;  3A33 B;  3PRM B;  2K8H A;  2IYD B;  2BKR B;  3DQV A;  3IVF A;  2O6V D;  3N32 A;  1ZKH A;  5D7G A;  2D10 A;  2A4Z A;  2JXX A;  2KK8 A;  2UYZ B;  3CST A;  4W9E A;  2DYO A;  2ZEQ A;  1EUV B;  2FID A;  4LCD E;  2R2O A;  5C23 A;  2KDE B;  3PPA A;  3UIP B;  3ENE A;  3V6E B;  4JQW C;  3KUC B;  2L8J A;  4P7I A;  4GB9 A;  5C1Z A;  2NBW B;  4K81 A;  4NJ7 A;  3CMM B;  1P9D U;  1WE7 A;  2MCN B;  3EEC A;  2LVQ A;  2MX2 A;  2FCS A;  3H1U A;  4CHK A;  5JHB A;  2WX0 A;  1NDD A;  4BKS D;  3W1S C;  1P3Q U;  1PQS A;  4IM0 A;  5J17 A;  1Q5W B;  3UQB A;  3P2B A;  3U7D A;  5BO4 B;  1C3T A;  2K8C A;  3V62 A;  2D3G A;  2KKC A;  2NBU A;  1V5T A;  3VHT C;  2MBQ A;  2KFK A;  4EFO A;  3SD5 A;  2N1V A;  1WGD A;  2JY6 A;  1SGH A;  4G11 A;  3JVZ X;  2C5L C;  4I6L B;  1WJ6 A;  3DOW A;  1J8C A;  2C7N B;  4TKN A;  1V2Y A;  2QHO A;  2IO2 B;  4BKS A;  4CO7 A;  3APD A;  3PZD A;  3R3M A;  4WWO A;  2N7E A;  4TUU A;  3UF8 A;  4DHJ D;  3UIO B;  3H7S A;  2L3Z A;  2LXA A;  3JSV B;  4NY0 A;  4FA6 A;  4G50 A;  1WF9 A;  1TZ1 A;  4BBN F;  3RZW C;  4ANU A;  5JH5 C;  2C9W B;  3ZDM C;  3AUL A;  3PVL A;  4KIK B;  4IWP A;  1A5R A;  5AZF A;  1WGY A;  3DPD A;  3IFW B;  1AAR A;  2O2V B;  4OVU A;  5HKH A;  3W1Y A;  1WJ4 A;  4KSL C;  2KWV B;  1NBF C;  4ANV A;  1WE6 A;  3PTF C;  2YVC A;  2LGY A;  2N4F A;  1KOT A;  3A4R A;  1I35 A;  4FLH A;  3VUW A;  4DK5 A;  2JRH A;  2LUE A;  1K8R B;  2JPH A;  4MEM A;  5DPR A;  2B3A A;  1R4N I;  2K1F A;  5G2N A;  2LVO A;  4M0W B;  3RCZ A;  1T0Y A;  3SU8 X;  1UBI A;  4ICV A;  4ANW A;  2K8B A;  2J0M A;  2FCQ A;  4IG7 B;  3KUZ A;  1KJT A;  4LJO B;  5D94 A;  2LI5 A;  4HJK A;  3A1Q A;  2WX1 A;  4CYE A;  2HD5 B;  2XBB C;  2O6V B;  3AU4 A;  3PLV A;  1VCB A;  2L76 A;  2C60 A;  2NPT A;  3DVN V;  3NOB A;  3A9J A;  4K7W A;  2ZVO A;  2LAS A;  2JRI B;  1WMH A;  1OEY A;  4MGZ E;  3PHW B;  3TMP B;  3ECI A;  4NQK E;  3GZN I;  1L7Y A;  2KQS A;  3X0W A;  1GUA B;  4DBG A;  4FJZ A;  3TBL D;  2IO3 B;  3QC8 B;  3KVF B;  2ZNV C;  4NAW A;  1WY8 A;  5DPS A;  5DPW A;  3KH0 A;  3NZS A;  4DWF A;  3NY5 A;  4FJY A;  2LWP A;  3K9O B;  5JZE B;  3Q3F A;  1ISN A;  1Z5S B;  3EFU A;  3QX1 A;  4W9G A;  4BFR A;  3TL5 A;  1QZE A;  2LZ6 A;  4W9D A;  4HCN B;  4MGI E;  3BIN A;  4FBJ B;  2J0K A;  3GOE A;  4M8M A;  2ZNV B;  2KDB A;  3KW5 B;  4B95 A;  4FAD A;  3H7P A;  1JRU A;  4KDL B;  1YD8 U;  3H9D A;  5AZH A;  2RGF A;  3A9K A;  4GMV A;  4J6I A;  5CHV C;  2AL6 A;  3ZRF A;  1UD7 A;  2NCN A;  4IW0 A;  5L83 A;  1WJN A;  3JYU A;  4DHJ B;  3HM3 A;  5DPT A;  1C1Y B;  4MJS B;  3ZUN A;  4GGQ A;  1RFA A;  2K6D B;  4JIO U;  1WI0 A;  1LXD A;  2V4L A;  3AI5 A;  1V5O A;  3B1L X;  2KAN A;  3ZNI D;  2GOW A;  1VD2 A;  1GC6 A;  3DBL I;  1WJU A;  1M94 A;  1WM3 A;  3UIN B;  3ZIM A;  1E8Z A;  2M8S A;  3PV1 A;  1YQB A;  3A1Q B;  3VUY A;  2MP2 A;  3PRP B;  4W9C A;  3MJW A;  3OAW A;  2KMA A;  5IA7 A;  3L10 B;  4HDO A;  2NPT B;  1V80 A;  4AJW A;  3APC A;  3KYC D;  3AU5 A;  2GBR A;  2MBH A;  1WMH B;  3BY4 B;  2KX0 A;  2N1W A;  1E7U A;  4KDI C;  2CHW A;  3U30 A;  2CHX A;  4LJP B;  2AYO B;  3IG3 A;  3OJ4 B;  1GNU A;  3U8Z A;  4ASW C;  2CKH B;  3I3T B;  3Q3J A;  3WAO A;  1WX7 A;  2L0T A;  2OJR A;  3L0W B;  1LFD A;  2AWT A;  2NBV B;  4WJQ A;  4IM2 A;  3M62 B;  3A4S C;  2KVR A;  4WJN A;  4IUM B;  5CTR C;  3CF6 E;  3M3J A;  2G45 B;  1IPG A;  2UWQ A;  4K7U A;  4HK2 A;  3UGB B;  2DX5 B;  4HVB A;  5TR5 A;  4GIV A;  2CU1 A;  1WXM A;  2C7H A;  4NJ6 A;  1I42 A;  2LRW A;  3SDL C;  4K1R B;  4URK A;  1OEY J;  2NR2 A;  2ZCB A;  2JWZ A;  3A9K B;  1IP9 A;  2M4N A;  2FNJ B;  4MH0 E;  4XX5 A;  5LLI A;  1WXV A;  3HHM A;  2MRP A;  2BGF A;  2PE6 B;  3VUX A;  4ANX A;  4WWN A;  2KDF B;  2EMS A;  3PRE A;  3OLM D;  2DZK A;  4GXB A;  1OTR B;  1YX6 B;  3SHQ A;  3PT2 B;  3V60 A;  3R7Q A;  4E74 A;  3CSF A;  2KMC A;  2KQ7 A;  2PE9 A;  3VH4 B;  2DZI A;  2YLM A;  2IY0 B;  1SIF A;  5LXH A;  2KOX A;  2JUO A;  2KHW B;  1UEL A;  2NS5 A;  3MHS D;  2KN5 A;  1J0G A;  4EUT A;  1LM8 B;  2DEN B;  2BYV E;  3QWZ B;  5GMV A;  3ZVV A;  2LGX A;  3KYD D;  4DHZ B;  3RT3 B;  2OOB B;  5E6O A;  1V86 A;  3ZDT A;  1HE8 A;  4BOS C;  2L00 B;  2HTH A;  4JL9 A;  4WAA A;  5IAA C;  3LDZ E;  1TGZ B;  2GBK A;  4HCP B;  4PYU A;  4PYZ A;  3WIM A;  2XK5 A;  4HDQ A;  2IBI B;  2JF5 A;  4KZC A;  4RMA A;  1E7V A;  3HK0 A;  4MSM B;  4DDG D;  4ICU A;  3RYT A;  2PPH A;  4ZRI A;  4DXA B;  2IO0 B;  2KLC A;  4E71 A;  4I6P A;  2KDI A;  2RD0 A;  2KJR A;  3WAM A;  3WAN A;  4A3O A;  4BOZ B;  2LVP A;  2FUH B;  2I1K A;  1UBQ A;  2KJH B;  2RPQ A;  4MGK E;  2KFK B;  2D11 A;  3ZNG C;  1IYF A;  3DDC B;  4ZRJ A;  4EKU A;  4FUL A;  1R4M I;  4NQL B;  1TBE A;  4I6N B;  2NVU I;  3RZF A;  2DAJ A;  2KZR A;  5CHW A;  3M63 B;  5KHQ A;  2Z0D B;  4W9L A;  2MW5 A;  4KVG B;  4FJV B;  1WH3 A;  2D07 B;  2JVC A;  4NPN A;  2LGD A;  4ZDV A;  3AXC A;  1V81 A;  2K6Q A;  2GBM A;  3HM6 X;  3B08 A;  3O65 B;  3V61 A;  3RUI B;  3EC8 A;  3PHX B;  4HXD A;  2EMT A;  4GSW A;  4MDK E; 
#chains in the Genus database with same CATH topology
 5G55 A;  2M0A A;  1P0R A;  4NZL B;  4WWP A;  2CS4 A;  2FCM A;  1IGC A;  4DXG A;  2R61 A;  3R8B A;  4MGY E;  1WGG A;  1XT9 B;  5L95 C;  2XK5 B;  1K50 A;  1L6U A;  2LRU A;  3A9J B;  2LEK A;  1RAX A;  3FIL B;  5E6P A;  2DZJ A;  2GMI C;  4C4V A;  3C8Y A;  3NZU A;  4B6W A;  4RFB A;  1GC7 A;  5IP4 D;  2KTF A;  1TYG B;  2WXM A;  2BVC A;  3L17 A;  3DBR B;  4ZYN A;  4C80 A;  1TY0 A;  2BYE A;  2H89 B;  1HA5 A;  4PS8 A;  1YJ1 A;  1NI2 A;  4LTU A;  1TKE A;  1KLV A;  5EE0 A;  2C7M B;  1T5X D;  3MP9 A;  3ZTD A;  2Z0E B;  3W5U B;  1MFW A;  3U7Z A;  4IM3 A;  2DYB A;  2BYT A;  5FR6 A;  5FKA C;  3DVG Y;  1E0Z A;  5T8I A;  2KMM A;  1ZOY B;  1SE9 A;  4IOI E;  1HTQ A;  2M19 A;  3HRD D;  3Q6B A;  1I4P A;  2YEP F;  3NUH B;  4GDK A;  2WXQ A;  1OQY A;  2GRI A;  1ZP0 B;  1TS2 A;  2CHZ A;  1S3S G;  4FHJ A;  2N7D A;  4GDL B;  2IGD A;  2LJI A;  1ACC A;  3PGE A;  1WZ3 A;  3P4S B;  4F7Z A;  4KGT A;  4US8 A;  3RFZ B;  2BWF A;  3DBR I;  1T0S C;  5GXG B;  1KM7 A;  2BYF A;  2LGI A;  2I1J A;  2PKO A;  3KLS X;  3DVN U;  1AWD A;  1XLO A;  3M95 A;  5CHF A;  1RRB A;  3VTW A;  1AW7 A;  3ZO5 B;  1QF6 A;  2L05 A;  3X23 A;  2JSV X;  4XDC A;  3WCQ A;  4BKT A;  2CR5 A;  2Y3A A;  4ACF A;  2FIF A;  4JLC A;  2M0X A;  1V97 A;  4F1S A;  3QA8 A;  3Q3M C;  1XXG A;  2HE7 A;  2MWS B;  4FHK A;  4W9H A;  2J4X A;  3L16 A;  4S17 A;  4MSQ B;  4WQO B;  2QEJ C;  2DZM A;  3ZYY X;  2VRR B;  2JWU A;  2D3A A;  2L7R A;  1L0Y B;  2PIA A;  2V9H A;  4XDD A;  1UGJ A;  1I4G A;  2L0F A;  1WGK A;  4LNO A;  1GJZ A;  1WRD B;  1JRO A;  3JSV A;  2AQ1 B;  4RGT A;  1U4A A;  2D3C A;  1RLF A;  2J52 A;  1DYQ A;  1RM6 C;  2BQQ A;  2KNB A;  3N3K B;  1F52 A;  2W9N A;  3WA0 A;  1IGD A;  3U52 E;  1C79 A;  2HDE A;  4JGH B;  1EWY C;  4CQN A;  3N32 A;  2BKR B;  2NTS A;  1QIL A;  3AEG B;  3AM9 A;  3FC4 A;  2FID A;  2KDE B;  3UIP B;  4ARI A;  1I4H A;  4JQW C;  1ZUD 2;  4GB9 A;  4NJ7 A;  3RPF C;  1WE7 A;  4XYC A;  2MX2 A;  2M56 B;  5JHB A;  1NDD A;  5J17 A;  2E6X A;  3U7D A;  5BO4 B;  2KKC A;  2NBU A;  1BUI C;  1SE3 A;  2KFK A;  2K0P A;  3AEE B;  2N1V A;  2JY6 A;  1SGH A;  1PUT A;  3JVZ X;  3DOW A;  3DHH C;  2IO2 B;  4TMA B;  4BKS A;  5E6J A;  5H92 C;  4TUU A;  5IO9 A;  2L3Z A;  2LXA A;  5BYQ A;  1WF9 A;  4ANU A;  5JH5 C;  2C9W B;  3ZDM C;  4HKQ A;  3RMK C;  1N5X A;  1J7C A;  1ET9 A;  2L52 A;  2WXJ A;  3IFW B;  1FXA A;  2KWV B;  2E3T A;  1WE6 A;  2RMM A;  2N4F A;  1KOT A;  4JX1 C;  1I35 A;  3VUW A;  4DK5 A;  2LUE A;  3IXS A;  4KX6 B;  2JPH A;  4MEM A;  2B3A A;  3W2D A;  1XLN A;  3PZ8 A;  1D4B A;  1JWM D;  2FCQ A;  2WXR A;  3KUZ A;  1KJT A;  4ARC A;  2BW2 A;  2LI5 A;  1JCK B;  1V1P B;  3AU4 A;  1VCB A;  1XCQ L;  2KYW A;  3RN9 C;  2ZVO A;  4ZYS A;  1QT9 A;  4MGZ E;  3TMP B;  3ECI A;  2KQS A;  1GUA B;  4FJZ A;  2BTE A;  1SF0 A;  4WWM A;  1WY8 A;  3Q3F A;  1Z5S B;  4W9G A;  3KWL A;  1QZE A;  1XO3 A;  2N7J A;  1WYG A;  1NEN B;  5IKC M;  1JRU A;  4KDL B;  1YD8 U;  3H9D A;  3ZRF A;  1UD7 A;  4OZB A;  3DHG C;  4LNN A;  3JYU A;  1KFY B;  1GB1 A;  1IUE A;  3V3X A;  2K5P A;  3LYY A;  1GC6 A;  3DHI C;  3UIN B;  3ZIM A;  1AYF A;  3B9J A;  3PV1 A;  1IBX A;  3TSS A;  3A1Q B;  3VUY A;  3GE8 C;  3OAW A;  2NPT B;  1V80 A;  3HVZ A;  3AMZ A;  5G5G A;  1WMH B;  4KDI C;  3U30 A;  2CKH B;  3GP7 A;  1FFU A;  2L0T A;  1LFD A;  4IM2 A;  3M62 B;  5FK9 C;  3PZ7 A;  4WJN A;  1FCC C;  4IUM B;  1QOF A;  5CTR C;  3TEW A;  1C76 A;  2UWQ A;  2W54 A;  2DX5 B;  4HVB A;  1WXM A;  1K52 A;  1OFF A;  2WXH A;  1SJH D;  3SDL C;  1OEY J;  1CQV A;  1WXV A;  2PLP A;  5EE9 A;  4GLS C;  4JPS A;  3AE3 B;  4ANX A;  5D3I B;  4E74 A;  3I57 A;  2KQ7 A;  3VH4 B;  2DZI A;  2YLM A;  2KOX A;  1J0G A;  4EUT A;  2GB1 A;  2LGX A;  3KYD D;  3RT3 B;  3ZXR A;  4BOS C;  4YTN B;  2WQY B;  2RDH A;  3NS1 A;  1RYJ A;  2G1E A;  2WXF A;  1D5Z C;  4PYZ A;  3W5V B;  3TEZ A;  2IO0 B;  2KLC A;  4I6P A;  3RNA C;  1UBQ A;  2RPQ A;  2K9X A;  2D11 A;  1YOV B;  2BS3 B;  4ZRJ A;  3AE5 B;  3AV8 A;  1TBE A;  2MHJ A;  4HEA 1;  3BVZ A;  3Q69 A;  4W9L A;  2MW5 A;  4FJV B;  5H8Y E;  1WH3 A;  2JVC A;  2WP9 B;  1UWX A;  1V81 A;  2DNF A;  3HM6 X;  3O65 B;  1N60 A;  3RUI B;  4HXD A;  1N63 A;  1E8Y A;  4MDK E;  1ZPS A;  1JWA D;  3Q8C A;  2G3Q B;  2KX3 A;  4WQM A;  4GN1 A;  1FXT B;  1UH6 A;  2QIE B;  1QOB A;  1SEB D;  2WU2 B;  1D3Z A;  1Q0W B;  2GBN A;  3RD2 A;  3P42 A;  3AE1 B;  4HJG E;  3I9V 1;  4GOC A;  2IPK D;  5D2M B;  4IC7 B;  1QOG A;  1E7P B;  1K51 A;  2KO3 A;  3PRZ A;  2O2V A;  1L4D B;  1H8C A;  4AS1 A;  4A3P A;  4W9J A;  3R7R A;  3N1Y C;  4E3C A;  3BWU D;  1TTN A;  4HLE A;  2K39 A;  4Q2J A;  2REX A;  4AUQ C;  5D6J B;  5J2R A;  2X8X X;  1SB3 C;  4KKJ A;  1TS4 A;  4XC2 A;  2W3S A;  4DDI D;  1XCT L;  2JZP A;  3ML9 A;  3BYT B;  1ZW7 A;  1JW9 D;  1YIW A;  4MT5 A;  1WM2 A;  2WXP A;  3T8M A;  2ZPY A;  4EZK A;  2G9H D;  1WZ0 A;  4RM9 A;  4N9F 4;  1N5W A;  5BYR A;  1V9J A;  1YX5 B;  4K7S A;  2ZCC A;  3JW0 X;  1NI3 A;  3T3O A;  2ZZP B;  3WAL A;  2BS2 B;  2JZZ A;  1WGR A;  3QJZ A;  3ZKJ C;  3PSE B;  2KWU B;  3R66 C;  1PFD A;  4N6E B;  4AOF A;  2B76 B;  1MHH E;  1N6Z A;  3R2T A;  4C4V B;  4EZJ A;  1C4C A;  3D32 A;  4EOY A;  4G3X B;  2XEW A;  2Z59 B;  2LGS A;  4ZRQ A;  5IN7 A;  1VRA B;  3W9C B;  4WH4 A;  3ZLZ A;  2N9P C;  1WX9 A;  3BVM A;  3HIZ A;  4TV3 A;  1H4R A;  2ZJD A;  3AEA B;  1EU4 A;  1I4Q A;  1JRP A;  4TSS A;  3L54 A;  2QMT A;  1MI0 A;  3CWI A;  2QC8 A;  3TJP A;  3QK0 A;  4JWS C;  2ON8 A;  2Q5W D;  3NRZ A;  4MM3 A;  1OGW A;  1Q1O A;  3ALB A;  3L13 A;  3KWV A;  2RR9 A;  1HZ5 A;  4FN2 A;  4W9I A;  4LDT B;  1PYW D;  4HKZ E;  2ZPN A;  3ONS A;  3V05 A;  1G6J A;  5KHO A;  2PJH A;  1QQR A;  4GDK B;  1EM7 A;  4W9F A;  3VTV A;  3DBS A;  5EE3 A;  2WWZ A;  2Z8L A;  5AZG A;  2BS4 B;  2DAF A;  1I4X A;  3NZ3 A;  1C9F A;  2MSE D;  2DBY A;  1E8X A;  3P4Q B;  5AEK B;  4EEW A;  2AQ3 B;  3VR9 B;  1F2R I;  3PRM B;  1ZKH A;  1R4N B;  1ESF A;  5BMG A;  2JXX A;  2KK8 A;  4M0W A;  4W9E A;  1YMH E;  4LCD E;  2R2O A;  3N20 C;  3I5J C;  3KUC B;  2L8J A;  3R2I A;  3NVY A;  3ABV B;  1JQ4 A;  3NVZ A;  1TS3 A;  2NBW B;  2MCN B;  3EEC A;  4K3B A;  3H1U A;  4CHK A;  5IOI A;  3UQB A;  3P2B A;  3P4R B;  3GZN B;  1E6E B;  2MBQ A;  3U2S C;  4EFO A;  1Y56 A;  2C5L C;  1XF5 L;  3AE7 B;  4REZ A;  2N7E A;  3UF8 A;  4FA6 A;  3H7S A;  3JSV B;  3MJ5 A;  4N58 A;  4G50 A;  1TZ1 A;  2HJ1 A;  3RZW C;  3SEB A;  2KQ4 X;  4YT0 B;  5MPO A;  4KIK B;  2W55 A;  3DPD A;  1WJ4 A;  3AE6 B;  4ANV A;  2YVC A;  4FXC A;  1I7H A;  1YNT E;  1K8R B;  4RF0 A;  1HZ6 A;  1R4N I;  3L4P A;  2K1F A;  5G2N A;  2LVO A;  3RCZ A;  2ONQ A;  1UBI A;  4ICV A;  4ANW A;  1P7E A;  1OQR A;  4LJO B;  5D94 A;  4XWT A;  1JWS D;  2O6V B;  1MHX A;  2L76 A;  3E56 A;  3A9J A;  3CIR B;  3FIL A;  1OEY A;  1CK1 A;  3GZN I;  2VH1 A;  2SEB D;  1FMA D;  2IO3 B;  3QC8 B;  3KVF B;  3KQ4 A;  3NZS A;  3RNE C;  2GLS A;  2VH2 A;  4KGR A;  2LZ6 A;  4HCN B;  2VZK B;  4MGI E;  1F1H A;  4M8M A;  3UI3 A;  1FXI A;  4B95 A;  4FAD A;  5HG2 A;  4J6I A;  4C7Y A;  3LB8 C;  1HXY D;  1C1Y B;  4MJS B;  1FNW A;  4JIO U;  1WI0 A;  2PW9 A;  1LXD A;  2V4L A;  3B1L X;  2GOW A;  1GAQ B;  1NEK B;  1WM3 A;  4XWW A;  2M8S A;  4W9C A;  3MJW A;  2KMA A;  3L10 B;  2Y5P A;  2BB6 A;  2GBR A;  3Q8A A;  2CHW A;  2CHX A;  4N59 A;  2WHI A;  1GNU A;  3I3T B;  3GB1 A;  3TUO A;  2OJR A;  3BYY B;  2AWT A;  4WJQ A;  2WXL A;  3A4S C;  1A70 A;  2MJ3 A;  4P16 A;  1IPG A;  2W82 A;  3UGB B;  1R4M B;  1SE4 A;  1WXQ A;  4ZOH C;  4PK1 A;  4K1R B;  3MC8 A;  2PE6 B;  2BGF A;  3VUX A;  1C77 A;  2KDF B;  3OLM D;  2DZK A;  4GXB A;  4DXF A;  1OTR B;  3V60 A;  3CSF A;  3Q3O C;  4LK0 M;  1SIF A;  2JUO A;  2KHW B;  3MHS D;  1FFV A;  3Q2A C;  5GMV A;  2KAJ A;  4DHZ B;  2WXG A;  5E6O A;  1V86 A;  2BBC A;  1HE8 A;  1MPE A;  3EUB 2;  4JL9 A;  1PGB A;  1V1O A;  1OQQ A;  5IAA C;  3EGR A;  1TGZ B;  3ZJT A;  4HDQ A;  2JF5 A;  1DOX A;  4RMA A;  3N9Y C;  3SFE B;  3E9S A;  2PPH A;  1XLQ A;  4E71 A;  2KDI A;  1V8C A;  2KJR A;  3OG5 A;  4BOZ B;  2FUH B;  2I1K A;  4C56 C;  3ZNG C;  3DWG C;  4EKU A;  4FUL A;  1L5P A;  1R4M I;  2LHD A;  4I6N B;  1VZ7 A;  2NVU I;  5CHW A;  3GE3 C;  2RDB C;  4HRS A;  1TT5 B;  4NPN A;  2LGD A;  3AXC A;  5HI1 A;  4MH8 A;  1LGR A;  3V61 A;  3PHX B;  2H88 B;  1LQB A;  3QCA A;  3BK2 A;  4XZ4 A;  2ZVN A;  2LD9 A;  2MQJ A;  1WXA A;  3VFK A;  4J3O D;  2N9E B;  5JXV A;  2M1M A;  3EA6 A;  2QCZ A;  1EU3 A;  4M8N A;  4F8C B;  3H8H A;  4TQ0 A;  1L6V A;  3IBE A;  1VR9 A;  1WR1 A;  3GS2 A;  3N30 A;  3P1M A;  2AX5 A;  3DCG A;  4WJP A;  2KJ6 A;  4YL8 A;  2WYQ A;  2IZV B;  3VVW B;  2LXC A;  2R2Q A;  3RNF C;  4NAW B;  3ZNH B;  4KV2 A;  4HRO A;  2MBB B;  4X57 B;  1UUP A;  4B9K A;  3TEY A;  1F0Z A;  3APF A;  2D3B A;  3ZRC A;  4KZ0 A;  3VXW A;  3O13 A;  2V3N A;  2PEA A;  2JZ3 B;  2KTR A;  4AP4 C;  4RCO A;  4BVU C;  1GB4 A;  3H7P B;  5FR3 A;  4LDT D;  4M01 A;  4EZL A;  1ENF A;  1UZX B;  3RUL A;  1D5M C;  3MTN B;  4OVV A;  2MA9 B;  1V49 A;  4ITK A;  2G4S A;  2J7Q B;  2MLB A;  4YWG G;  4KSK C;  4WJO A;  1CZP A;  1T6B X;  3DVG X;  3PLU A;  2J0J A;  1SJE D;  5AUI A;  2DYM A;  3ZQ4 A;  4M00 A;  4XE0 A;  2KDM A;  2KC1 A;  3NHE B;  4NNJ B;  3RNG C;  3VRB B;  3VRA B;  1V6E A;  1MJD A;  3DBH B;  2WNM A;  4HWI B;  2MP2 B;  2WLB A;  4P1C C;  4DHZ E;  2GBJ A;  3EHV A;  1JWB D;  1KTK A;  1L0V B;  1BT0 A;  1J19 A;  2ASQ A;  2N9X A;  1L2N A;  3C0R B;  3QAQ A;  2L83 A;  1KH0 A;  1R7S A;  2N0S B;  1SSN A;  1EF5 A;  2WDR B;  2V1Y A;  1WFY A;  2A5U A;  3VAW A;  1AN8 A;  1JML A;  2IY1 B;  1WSP A;  3VDZ A;  5DCN A;  3EFC A;  3OJ3 A;  2KWC A;  5E6N A;  1UGM A;  2JT4 B;  2KXJ A;  4EE2 A;  4RM8 A;  4YSZ B;  1S1Q B;  1GG3 A;  1DGJ A;  2Y5B B;  1JWU D;  4MEL A;  2L1A A;  2FE8 A;  4PS7 A;  1TJE A;  4WUR A;  2GI9 A;  1LO5 D;  2IO1 B;  3ZJV A;  3B2F A;  3TIX A;  4AWJ A;  3DBH I;  2FCN A;  1T3Q A;  3L08 A;  2G4D B;  3NG0 A;  2D2Q A;  3B0A A;  1E8W A;  3VR8 B;  3W1S A;  3VQI A;  4K3C A;  2J42 A;  1MG8 A;  3P4P B;  4IDI A;  1P98 A;  3AEF B;  2KC2 A;  3HUI A;  1CJE A;  1ZGU B;  2LJ5 A;  3K9P B;  1E9M A;  3WAP A;  3MC0 B;  4LNK A;  3UQA A;  3VH3 B;  2V3S A;  3A33 B;  3DQV A;  4A9A A;  2O6V D;  2D10 A;  3CST A;  2DYO A;  3PPA A;  3ENE A;  4P7I A;  5C1Z A;  4K81 A;  3CMM B;  1P9D U;  2LVQ A;  3AEC B;  2FCS A;  2WX0 A;  4BKS D;  1PQS A;  1Q5W B;  2L32 A;  1C3T A;  4USA A;  3V62 A;  1L4Z B;  1VZ6 A;  2VZK D;  3ETR A;  2MEK A;  2PVO D;  2IDY A;  1J8C A;  3J9C A;  2C7N B;  4TKN A;  1V2Y A;  3NJT A;  2QHO A;  1B9R A;  3APD A;  3PZD A;  4WWO A;  4LNI A;  1FO4 A;  2W3R A;  2JYE A;  3PVL A;  4IWP A;  1A5R A;  2FBW B;  1WGY A;  5AZF A;  4OVU A;  2PVG C;  1F2R C;  4KSL C;  1NBF C;  5HFY A;  1FM0 D;  3PTF C;  2LGY A;  3A4R A;  5DPR A;  3ZJU A;  1NYR A;  4M0W B;  2INN E;  1HQR D;  2V3P A;  2K8B A;  2J0M A;  2Y5C A;  3ZGZ A;  5BYS A;  2WX1 A;  2HD5 B;  2XBB C;  3BK1 A;  4RGM A;  2CU3 A;  2LAS A;  4L23 A;  4MAC A;  3PHW B;  4NQK E;  4DBG A;  4YTM B;  1FPY A;  5BMH A;  5DPS A;  1PDX A;  2WDQ B;  3MHZ A;  2LWP A;  4YSY B;  3BIN A;  3KW5 B;  4B0E A;  5AZH A;  2RGF A;  3A9K A;  4GMV A;  2AL6 A;  2LHE A;  2JXT A;  2NCN A;  4IW0 A;  1BXT A;  4JE3 B;  1WJN A;  4DHJ B;  2RPV A;  5DPT A;  4GGQ A;  1RFA A;  1T0R C;  1V5O A;  2KAN A;  3ZNI D;  3LXF A;  1MVK A;  1VD2 A;  3DBL I;  1WJU A;  1M94 A;  1NVI D;  1E8Z A;  1YQB A;  4YXD B;  5IA7 A;  3AU5 A;  3BY4 B;  2YEP B;  4LJP B;  3IG3 A;  3N1Z C;  1DOI A;  3OJ4 B;  4PT5 A;  1C78 A;  3U8Z A;  4ASW C;  2DLB A;  3Q3J A;  3WAO A;  1WX7 A;  3L0W B;  1HEZ E;  2KVR A;  2LFI A;  2N9L A;  4HK2 A;  5BMI A;  2JQR B;  1I42 A;  2OHF A;  1GOZ A;  4URK A;  2NR2 A;  2JWZ A;  2ZW1 A;  2I2Y A;  2KN4 A;  2FNJ B;  4LNF A;  5LLI A;  2MJD A;  3HHM A;  2MRP A;  4H2A A;  2DWQ A;  1UNS A;  2EMS A;  2RDG A;  3SHQ A;  3PT2 B;  1TY2 A;  3R7Q A;  2PE9 A;  1PGA A;  2NS5 A;  2KN5 A;  2BYV E;  2OOB B;  1ZDX A;  2HTM E;  3ZDT A;  2HTH A;  2WU5 B;  4WAA A;  2QDF A;  4HCP B;  4PYU A;  3WIM A;  2XK5 A;  4YSX B;  1FRR A;  1E7V A;  4KGS A;  2IJ0 A;  3HK0 A;  4MSM B;  5AUK A;  4ICU A;  3RYT A;  4ZRI A;  4DDG D;  2V0G A;  2RD0 A;  3AN1 A;  1UWM A;  4MGK E;  2KFK B;  1IYF A;  3DDC B;  5EE1 A;  4NQL B;  2NMQ A;  2PTL A;  2KZR A;  3M63 B;  5KHQ A;  4BZA A;  1RWS A;  2Z0D B;  4KVG B;  4QAY A;  4ZDV A;  2N9K A;  2K6Q A;  3B08 A;  3NVV A;  3RNC C;  2EMT A;  4R3D A;  2X38 A;  1KLG D;  1Y8R C;  5JHA A;  1ROE A;  3S2A A;  1YN3 A;  3QQ8 B;  1F77 A;  1D5X C;  4IWO A;  2EKE C;  3RNB C;  1VZ8 A;  2INC C;  4S0R A;  4RH6 A;  1YJI A;  3Q8E A;  2KFJ A;  1C4A A;  3H6N A;  4A20 A;  1YJJ A;  1WIA A;  4KIK A;  3PS6 A;  3TCA A;  2KT7 A;  2KLG A;  4II2 B;  4GDL A;  2V4I B;  3QAR A;  1SXT A;  1E5W A;  1FIQ A;  4GU2 A;  2MBO A;  2BT6 A;  4HPL B;  2I38 A;  1DOY A;  3ZNZ B;  1WYW B;  4WIP A;  2QIL A;  2LUM A;  4BKG A;  2WXN A;  2BWE S;  2D5G A;  2UU7 A;  2CJN A;  1EF1 A;  1WGH A;  3NVW A;  2O6V A;  3NS8 A;  3U4E G;  2AEH A;  2JU6 X;  3IT6 B;  4TQ1 A;  4IWQ A;  2QJL A;  1WX8 A;  3QIJ A;  2ZW0 A;  3IHP C;  1WR6 E;  1KRH A;  1TKY A;  2AL3 A;  1EO6 A;  2WDT B;  3T3N A;  4PS3 A;  4W9K A;  1ZXI A;  2TSS A;  3SFD B;  4AJY B;  3VTU A;  4O1N A;  4KKI A;  4WAF A;  2BPS A;  1IBX B;  4LLG M;  4ZRK A;  1CMX B;  5C3J B;  1ZDV A;  3T9L A;  5J18 A;  2MJE A;  4OVZ A;  2FAZ A;  2K25 A;  2EKI A;  4MJS A;  2ACZ B;  2BF8 B;  1I4R A;  1N61 A;  3Q3N C;  2J53 A;  2FUG 1;  3MC9 A;  1KLU D;  5LXI B;  2XN9 C;  1XD3 B;  2NTT A;  4A55 A;  1M4V A;  2KTR B;  3FAH A;  3BII D;  2JYT A;  2PMV A;  4II3 B;  2RSU A;  1E90 A;  3ZW3 A;  2INP E;  3V6C B;  3DWM A;  1TS5 A;  2M17 A;  2MBE A;  1WRI A;  4NJC A;  3Q8B A;  2KAC A;  2DHZ A;  1X1M A;  3KUD B;  1SIJ A;  2LMC A;  4HPP A;  4HPM B;  1F9J A;  4L1B A;  3QHT A;  5EDS A;  1J7A A;  4L2Y A;  1WXS A;  3AE4 B;  1P1A A;  2BKF A;  4BBN C;  3HVD A;  4JWU C;  4C7Z A;  3AH7 A;  1GPX A;  3ML8 A;  3LJ3 A;  5CX3 A;  4A90 A;  4G0N B;  1XQQ A;  3ZTC A;  2HJ8 A;  5C2T B;  1Z2M A;  2KD0 A;  5G5H A;  3BVG A;  2K8H A;  2IYD B;  3IVF A;  1FNV A;  1B1Z A;  5D7G A;  2A4Z A;  2UYZ B;  4P6V F;  2ZEQ A;  1EUV B;  5C23 A;  3V6E B;  1N62 A;  3AB5 A;  1V1P A;  3AED B;  1P7F A;  1YN4 A;  4US9 A;  1T0Q C;  1PGX A;  4YTP B;  3W1S C;  1P3Q U;  4OHJ A;  4IM0 A;  2OED A;  2K8C A;  2D3G A;  1V5T A;  2WDV B;  3VHT C;  1E10 A;  3SD5 A;  1WGD A;  5D3D A;  4G11 A;  2IGG A;  4I6L B;  3AE2 B;  1WJ6 A;  1FNU A;  3Q8F A;  1FD6 A;  2OJW A;  4CO7 A;  3R3M A;  4AQ7 A;  4DHJ D;  3UIO B;  4NY0 A;  4BBN F;  1MG4 A;  3AUL A;  2IND C;  1AAR A;  2O2V B;  5HKH A;  3W1Y A;  1RFK A;  4FLH A;  2JRH A;  1FRD A;  1SE2 A;  1T0Y A;  3SU8 X;  1QKZ A;  3Q14 C;  2WXI A;  4UDU C;  4IG7 B;  1YN5 A;  1C4P A;  4HJK A;  3A1Q A;  4CYE A;  4M02 A;  3PLV A;  2C60 A;  2XNA C;  2NPT A;  2IGH A;  3DVN V;  3NOB A;  4K7W A;  2JRI B;  1WMH A;  3TEX A;  1L7Y A;  3X0W A;  3TBL D;  2ZNV C;  4NAW A;  1TZO A;  1QLB B;  5DPW A;  3KH0 A;  4DWF A;  1SBB B;  3NY5 A;  2CJO A;  4FJY A;  1Q10 A;  3K9O B;  4RGN A;  5JZE B;  1ISN A;  3EFU A;  1WWT A;  3QX1 A;  4BFR A;  3TL5 A;  4W9D A;  4FBJ B;  2J0K A;  2MH7 A;  2WS3 B;  3GOE A;  2ZNV B;  2KDB A;  3OWE B;  1YQ4 B;  4IKG A;  3H7P A;  5CHV C;  1ET6 A;  2BB5 A;  5L83 A;  2WXO A;  3HM3 A;  1VLB A;  3ZUN A;  4ZRP A;  2K6D B;  3ZXV A;  4RGO S;  3AI5 A;  2ICI A;  2WGS A;  4C00 A;  4A8X C;  2MP2 A;  3PRP B;  1BML C;  1EWC A;  5I4D A;  3AE8 B;  1JAL A;  3AE9 B;  4RF1 A;  1YQ3 B;  4HDO A;  4AJW A;  3APC A;  3KYC D;  2MBH A;  3BZD B;  3IAS 1;  2KX0 A;  2N1W A;  1E7U A;  2AYO B;  4MM3 B;  1ZE3 D;  1FEH A;  3N1X C;  3RI7 C;  1TIF A;  2NBV B;  1XLP A;  1XEE A;  1QOA A;  4ZHO A;  4B0M A;  1K53 A;  3B2G A;  3CF6 E;  3M3J A;  2G45 B;  4K7U A;  5TR5 A;  3MFG A;  4GIV A;  2CU1 A;  2C7H A;  4NJ6 A;  2WXK A;  2K22 A;  3FKY A;  2LRW A;  1KF6 B;  2ZCB A;  3A9K B;  1IP9 A;  2M4N A;  1TKG A;  4MH0 E;  4XX5 A;  4D2K A;  1HTO A;  4WWN A;  3PRE A;  4A6Q A;  3PO0 A;  1YX6 B;  1J7B A;  1D6E C;  4DQO C;  2KMC A;  5HHD G;  4XGA B;  2IY0 B;  5LXH A;  3IAM 1;  3IT4 B;  1UEL A;  4ZHP A;  1LM8 B;  1FCL A;  2DEN B;  3QWZ B;  3ZVV A;  1STE A;  1UF0 A;  4OW0 A;  3DBL B;  2KVZ A;  3URY A;  2L00 B;  3C19 A;  3SR6 A;  2KWD A;  3LDZ E;  1L0X B;  2GBK A;  2K3U A;  2IBI B;  4KZC A;  1ZXH A;  4RNA A;  4DXA B;  1VJK A;  3WAM A;  3AEB B;  4A3O A;  3WAN A;  2LVP A;  2KJH B;  1VDV A;  5LNK 1;  2AQ2 B;  3P63 A;  3I63 C;  3RZF A;  2DAJ A;  4OZA A;  2JX5 A;  2D07 B;  4P1B C;  5TSS A;  2SAK A;  1NYQ A;  2QSD A;  2GBM A;  4NAM A;  2EEL A;  4OZC A;  3EC8 A;  4BAX A;  4GSW A; 
#chains in the Genus database with same CATH homology
 5G55 A;  1Y8R C;  5JHA A;  1LQB A;  1P0R A;  3QCA A;  4XZ4 A;  2ZVN A;  2G3Q B;  2LD9 A;  3S2A A;  2MQJ A;  1WXA A;  3QQ8 B;  2KX3 A;  4WWP A;  2CS4 A;  3VFK A;  4GN1 A;  4IWO A;  2EKE C;  2FCM A;  2N9E B;  2M1M A;  1FXT B;  1UH6 A;  4M8N A;  4F8C B;  1D3Z A;  4MGY E;  1Q0W B;  1WGG A;  1XT9 B;  2GBN A;  4TQ0 A;  3RD2 A;  3IBE A;  1WR1 A;  2KFJ A;  5L95 C;  4GOC A;  5D2M B;  3N30 A;  3H6N A;  4A20 A;  4IC7 B;  2XK5 B;  3DCG A;  4WJP A;  2KJ6 A;  1WIA A;  2KO3 A;  3PS6 A;  2LRU A;  3A9J B;  3PRZ A;  4KIK A;  4YL8 A;  2O2V A;  2WYQ A;  3TCA A;  1RAX A;  2KLG A;  5E6P A;  1H8C A;  2DZJ A;  4II2 B;  4GDL A;  4A3P A;  2GMI C;  4W9J A;  2IZV B;  3R7R A;  3QAR A;  3VVW B;  2LXC A;  2R2Q A;  1E5W A;  4E3C A;  3NZU A;  4B6W A;  1GC7 A;  1TTN A;  4NAW B;  3ZNH B;  2KTF A;  4HLE A;  2K39 A;  4GU2 A;  2MBO A;  4HPL B;  2REX A;  4KV2 A;  3L17 A;  4ZYN A;  4AUQ C;  5D6J B;  3ZNZ B;  1WYW B;  2MBB B;  5J2R A;  4X57 B;  2BYE A;  4BKG A;  4PS8 A;  4B9K A;  1YJ1 A;  1NI2 A;  3APF A;  2BWE S;  4XC2 A;  1KLV A;  2C7M B;  3ZRC A;  4DDI D;  4KZ0 A;  3ZTD A;  2Z0E B;  3VXW A;  1EF1 A;  1WGH A;  2PEA A;  2JZ3 B;  2KTR A;  2O6V A;  3NS8 A;  4AP4 C;  2AEH A;  4BVU C;  4IM3 A;  3H7P B;  2DYB A;  3ML9 A;  4TQ1 A;  4LDT D;  4IWQ A;  1ZW7 A;  1WX8 A;  1YIW A;  4EZL A;  5FR6 A;  1UZX B;  3QIJ A;  3IHP C;  3RUL A;  3MTN B;  4OVV A;  1WR6 E;  1WM2 A;  2MA9 B;  3DVG Y;  3T8M A;  1V49 A;  2AL3 A;  2ZPY A;  1EO6 A;  2G4S A;  2J7Q B;  2MLB A;  2WDT B;  4KSK C;  4WJO A;  4EZK A;  3DVG X;  1WZ0 A;  3PLU A;  4N9F 4;  4PS3 A;  4RM9 A;  4W9K A;  2J0J A;  4AJY B;  1V9J A;  3VTU A;  1YX5 B;  2DYM A;  4K7S A;  3NHE B;  2KC1 A;  1SE9 A;  2ZCC A;  3JW0 X;  4NNJ B;  2ZZP B;  1V6E A;  2BPS A;  4HWI B;  3WAL A;  4GDK A;  2JZZ A;  1WGR A;  2MP2 B;  3QJZ A;  1OQY A;  1CMX B;  4ZRK A;  3ZKJ C;  3PSE B;  4DHZ E;  2KWU B;  3R66 C;  2CHZ A;  2GBJ A;  3EHV A;  1S3S G;  4AOF A;  4FHJ A;  3T9L A;  2N7D A;  4GDL B;  5J18 A;  4EZJ A;  2FAZ A;  3D32 A;  1WZ3 A;  2K25 A;  3PGE A;  1BT0 A;  4EOY A;  4G3X B;  1J19 A;  2XEW A;  2ASQ A;  2N9X A;  1L2N A;  3C0R B;  3QAQ A;  2Z59 B;  4MJS A;  4F7Z A;  2BWF A;  3DBR I;  1EF5 A;  2BF8 B;  1KM7 A;  2BYF A;  2V1Y A;  1WFY A;  2A5U A;  2I1J A;  3VAW A;  3ZLZ A;  2IY1 B;  2N9P C;  1WX9 A;  3HIZ A;  3DVN U;  4TV3 A;  5LXI B;  3M95 A;  1H4R A;  1RRB A;  1XD3 B;  2ZJD A;  5CHF A;  3VDZ A;  5DCN A;  3VTW A;  3ZO5 B;  2L05 A;  3X23 A;  3OJ3 A;  4BKT A;  2KWC A;  2KTR B;  2CR5 A;  1UGM A;  3L54 A;  5E6N A;  2FIF A;  4JLC A;  4II3 B;  2JT4 B;  2RSU A;  2M0X A;  1E90 A;  2KXJ A;  3QA8 A;  3ZW3 A;  4F1S A;  3V6C B;  4RM8 A;  3QK0 A;  3TJP A;  2M17 A;  1S1Q B;  2MBE A;  1GG3 A;  2Y5B B;  2DHZ A;  4MM3 A;  1OGW A;  1X1M A;  1Q1O A;  2HE7 A;  3ALB A;  2MWS B;  3L13 A;  2RR9 A;  4FHK A;  4MEL A;  4W9H A;  3KUD B;  3L16 A;  4FN2 A;  4MSQ B;  4HPM B;  1F9J A;  4PS7 A;  4WQO B;  4W9I A;  2DZM A;  3QHT A;  4LDT B;  2ZPN A;  3ONS A;  2IO1 B;  2VRR B;  2L7R A;  3TIX A;  4AWJ A;  3DBH I;  1G6J A;  5KHO A;  2FCN A;  5EDS A;  2PJH A;  3L08 A;  2G4D B;  4GDK B;  4W9F A;  2D2Q A;  1WXS A;  3B0A A;  1E8W A;  3VTV A;  1P1A A;  3W1S A;  2L0F A;  2BKF A;  3DBS A;  4BBN C;  3VQI A;  1MG8 A;  1GJZ A;  1P98 A;  1WRD B;  3JSV A;  2WWZ A;  5AZG A;  2KC2 A;  3ML8 A;  3LJ3 A;  2DAF A;  5CX3 A;  1U4A A;  4G0N B;  1RLF A;  1ZGU B;  2MSE D;  1XQQ A;  2LJ5 A;  3K9P B;  2KNB A;  3ZTC A;  2HJ8 A;  1E8X A;  3N3K B;  2W9N A;  5AEK B;  3WA0 A;  4EEW A;  1E8Y A;  1Z2M A;  3WAP A;  2KD0 A;  3UQA A;  3VH3 B;  4JGH B;  2V3S A;  3A33 B;  3PRM B;  2K8H A;  2IYD B;  2BKR B;  3DQV A;  3IVF A;  2O6V D;  3N32 A;  1ZKH A;  5D7G A;  2D10 A;  2A4Z A;  2JXX A;  2KK8 A;  2UYZ B;  3CST A;  4W9E A;  2DYO A;  2ZEQ A;  1EUV B;  2FID A;  4LCD E;  2R2O A;  5C23 A;  2KDE B;  3PPA A;  3UIP B;  3ENE A;  3V6E B;  4JQW C;  3KUC B;  2L8J A;  4P7I A;  4GB9 A;  5C1Z A;  2NBW B;  4K81 A;  4NJ7 A;  3CMM B;  1P9D U;  1WE7 A;  2MCN B;  3EEC A;  2LVQ A;  2MX2 A;  2FCS A;  3H1U A;  4CHK A;  5JHB A;  2WX0 A;  1NDD A;  4BKS D;  3W1S C;  1P3Q U;  1PQS A;  4IM0 A;  5J17 A;  1Q5W B;  3UQB A;  3P2B A;  3U7D A;  5BO4 B;  1C3T A;  2K8C A;  3V62 A;  2D3G A;  2KKC A;  2NBU A;  1V5T A;  3VHT C;  2MBQ A;  2KFK A;  4EFO A;  3SD5 A;  2N1V A;  1WGD A;  2JY6 A;  1SGH A;  4G11 A;  3JVZ X;  2C5L C;  4I6L B;  1WJ6 A;  3DOW A;  1J8C A;  2C7N B;  4TKN A;  1V2Y A;  2QHO A;  2IO2 B;  4BKS A;  4CO7 A;  3APD A;  3PZD A;  3R3M A;  4WWO A;  2N7E A;  4TUU A;  3UF8 A;  4DHJ D;  3UIO B;  3H7S A;  2L3Z A;  2LXA A;  3JSV B;  4NY0 A;  4FA6 A;  4G50 A;  1WF9 A;  1TZ1 A;  4BBN F;  3RZW C;  4ANU A;  5JH5 C;  2C9W B;  3ZDM C;  3AUL A;  3PVL A;  4KIK B;  4IWP A;  1A5R A;  5AZF A;  1WGY A;  3DPD A;  3IFW B;  1AAR A;  2O2V B;  4OVU A;  5HKH A;  3W1Y A;  1WJ4 A;  4KSL C;  2KWV B;  1NBF C;  4ANV A;  1WE6 A;  3PTF C;  2YVC A;  2LGY A;  2N4F A;  1KOT A;  3A4R A;  1I35 A;  4FLH A;  3VUW A;  4DK5 A;  2JRH A;  2LUE A;  1K8R B;  2JPH A;  4MEM A;  5DPR A;  2B3A A;  1R4N I;  2K1F A;  5G2N A;  2LVO A;  4M0W B;  3RCZ A;  1T0Y A;  3SU8 X;  1UBI A;  4ICV A;  4ANW A;  2K8B A;  2J0M A;  2FCQ A;  4IG7 B;  3KUZ A;  1KJT A;  4LJO B;  5D94 A;  2LI5 A;  4HJK A;  3A1Q A;  2WX1 A;  4CYE A;  2HD5 B;  2XBB C;  2O6V B;  3AU4 A;  3PLV A;  1VCB A;  2L76 A;  2C60 A;  2NPT A;  3DVN V;  3NOB A;  3A9J A;  4K7W A;  2ZVO A;  2LAS A;  2JRI B;  1WMH A;  1OEY A;  4MGZ E;  3PHW B;  3TMP B;  3ECI A;  4NQK E;  3GZN I;  1L7Y A;  2KQS A;  3X0W A;  1GUA B;  4DBG A;  4FJZ A;  3TBL D;  2IO3 B;  3QC8 B;  3KVF B;  2ZNV C;  4NAW A;  1WY8 A;  5DPS A;  5DPW A;  3KH0 A;  3NZS A;  4DWF A;  3NY5 A;  4FJY A;  2LWP A;  3K9O B;  5JZE B;  3Q3F A;  1ISN A;  1Z5S B;  3EFU A;  3QX1 A;  4W9G A;  4BFR A;  3TL5 A;  1QZE A;  2LZ6 A;  4W9D A;  4HCN B;  4MGI E;  3BIN A;  4FBJ B;  2J0K A;  3GOE A;  4M8M A;  2ZNV B;  2KDB A;  3KW5 B;  4B95 A;  4FAD A;  3H7P A;  1JRU A;  4KDL B;  1YD8 U;  3H9D A;  5AZH A;  2RGF A;  3A9K A;  4GMV A;  4J6I A;  5CHV C;  2AL6 A;  3ZRF A;  1UD7 A;  2NCN A;  4IW0 A;  5L83 A;  1WJN A;  3JYU A;  4DHJ B;  3HM3 A;  5DPT A;  1C1Y B;  4MJS B;  3ZUN A;  4GGQ A;  1RFA A;  2K6D B;  4JIO U;  1WI0 A;  1LXD A;  2V4L A;  3AI5 A;  1V5O A;  3B1L X;  2KAN A;  3ZNI D;  2GOW A;  1VD2 A;  1GC6 A;  3DBL I;  1WJU A;  1M94 A;  1WM3 A;  3UIN B;  3ZIM A;  1E8Z A;  2M8S A;  3PV1 A;  1YQB A;  3A1Q B;  3VUY A;  2MP2 A;  3PRP B;  4W9C A;  3MJW A;  3OAW A;  2KMA A;  5IA7 A;  3L10 B;  4HDO A;  2NPT B;  1V80 A;  4AJW A;  3APC A;  3KYC D;  3AU5 A;  2GBR A;  2MBH A;  1WMH B;  3BY4 B;  2KX0 A;  2N1W A;  1E7U A;  4KDI C;  2CHW A;  3U30 A;  2CHX A;  4LJP B;  2AYO B;  3IG3 A;  3OJ4 B;  1GNU A;  3U8Z A;  4ASW C;  2CKH B;  3I3T B;  3Q3J A;  3WAO A;  1WX7 A;  2L0T A;  2OJR A;  3L0W B;  1LFD A;  2AWT A;  2NBV B;  4WJQ A;  4IM2 A;  3M62 B;  3A4S C;  2KVR A;  4WJN A;  4IUM B;  5CTR C;  3CF6 E;  3M3J A;  2G45 B;  1IPG A;  2UWQ A;  4K7U A;  4HK2 A;  3UGB B;  2DX5 B;  4HVB A;  5TR5 A;  4GIV A;  2CU1 A;  1WXM A;  2C7H A;  4NJ6 A;  1I42 A;  2LRW A;  3SDL C;  4K1R B;  4URK A;  1OEY J;  2NR2 A;  2ZCB A;  2JWZ A;  3A9K B;  1IP9 A;  2M4N A;  2FNJ B;  4MH0 E;  4XX5 A;  5LLI A;  1WXV A;  3HHM A;  2MRP A;  2BGF A;  2PE6 B;  3VUX A;  4ANX A;  4WWN A;  2KDF B;  2EMS A;  3PRE A;  3OLM D;  2DZK A;  4GXB A;  1OTR B;  1YX6 B;  3SHQ A;  3PT2 B;  3V60 A;  3R7Q A;  4E74 A;  3CSF A;  2KMC A;  2KQ7 A;  2PE9 A;  3VH4 B;  2DZI A;  2YLM A;  2IY0 B;  1SIF A;  5LXH A;  2KOX A;  2JUO A;  2KHW B;  1UEL A;  2NS5 A;  3MHS D;  2KN5 A;  1J0G A;  4EUT A;  1LM8 B;  2DEN B;  2BYV E;  3QWZ B;  5GMV A;  3ZVV A;  2LGX A;  3KYD D;  4DHZ B;  3RT3 B;  2OOB B;  5E6O A;  1V86 A;  3ZDT A;  1HE8 A;  4BOS C;  2L00 B;  2HTH A;  4JL9 A;  4WAA A;  5IAA C;  3LDZ E;  1TGZ B;  2GBK A;  4HCP B;  4PYU A;  4PYZ A;  3WIM A;  2XK5 A;  4HDQ A;  2IBI B;  2JF5 A;  4KZC A;  4RMA A;  1E7V A;  3HK0 A;  4MSM B;  4DDG D;  4ICU A;  3RYT A;  2PPH A;  4ZRI A;  4DXA B;  2IO0 B;  2KLC A;  4E71 A;  4I6P A;  2KDI A;  2RD0 A;  2KJR A;  3WAM A;  3WAN A;  4A3O A;  4BOZ B;  2LVP A;  2FUH B;  2I1K A;  1UBQ A;  2KJH B;  2RPQ A;  4MGK E;  2KFK B;  2D11 A;  3ZNG C;  1IYF A;  3DDC B;  4ZRJ A;  4EKU A;  4FUL A;  1R4M I;  4NQL B;  1TBE A;  4I6N B;  2NVU I;  3RZF A;  2DAJ A;  2KZR A;  5CHW A;  3M63 B;  5KHQ A;  2Z0D B;  4W9L A;  2MW5 A;  4KVG B;  4FJV B;  1WH3 A;  2D07 B;  2JVC A;  4NPN A;  2LGD A;  4ZDV A;  3AXC A;  1V81 A;  2K6Q A;  2GBM A;  3HM6 X;  3B08 A;  3O65 B;  3V61 A;  3RUI B;  3EC8 A;  3PHX B;  4HXD A;  2EMT A;  4GSW A;  4MDK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...