4CHKA

Crystal structure of the arf5 oligomerization domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
RTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords AUXIN RESPONSE FACTOR 5
publication title Structural Basis for Oligomerisation of Auxin Transcriptional Regulators
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4chkA00
4BOSC 1EUVB 1TBEA 2JRIB 1VD2A 3VVWB 3KUZA 3EC8A 2LRUA 2JZZA 2WX1A 4GXBA 2FCSA 1TZ1A 2J7QB 4FHJA 2W9NA 2IY0B 4KDLB 3P2BA 4CHKA 4DWFA 4RM8A 1R4NI 2WDTB 3K9OB 2MQJA 2MX2A 2AYOB 3JW0X 1LFDA 1NDDA 3U30A 4FA6A 3L17A 4IUMB 5GMVA 3VQIA 3WAMA 4AUQC 2RSUA 3DPDA 4CYEA 4DHJB 4LCDE 2LVQA 3A33B 2O2VA 3R66C 3LJ3A 2N7EA 2MBQA 2V1YA 4A3PA 2C60A 1E8YA 3SD5A 3CSTA 4NNJB 3PV1A 2V3SA 4ANWA 1V2YA 1WM3A 5HKHA 1C1YB 3BINA 3A9JB 2C5LC 2D10A 3WAPA 3UQBA 2AEHA 1E8XA 2KX3A 3W1SC 1UBIA 2IBIB 3KYCD 3JSVB 3B0AA 2YVCA 3H9DA 2BF8B 3OJ4B 3QK0A 4JGHB 3RT3B 2R2QA 3U8ZA 4E71A 4MJSA 3T9LA 5L83A 2D3GA 2JT4B 2KTRB 3N32A 4DHZE 2EMTA 3BY4B 1V5OA 2FIFA 4HPMB 2M0XA 2G45B 2BWFA 1XD3B 2I1JA 3ZDTA 3RZFA 2ZVNA 2L3ZA 4FLHA 1OQYA 1WFYA 3DOWA 4GDLB 3ZIMA 2LUEA 3DDCB 3VAWA 1AARA 2NBWB 5D6JB 1L2NA 1WZ3A 2K39A 2N9EB 2MBEA 2KD0A 2BKRB 4W9DA 1WR6E 2CR5A 2BWES 3R7RA 3PVLA 4NJ7A 3L08A 1ISNA 2FUHB 3W1SA 5CHVC 4GB9A 3GOEA 4ANXA 2FNJB 3DVGX 2GBNA 3M95A 2PPHA 2BKFA 3IBEA 5AZFA 3A9JA 2CHXA 3Q3JA 2KDFB 1ZGUB 3H7PB 4NQLB 4IM0A 1Q1OA 4KV2A 4EZKA 4MGYE 5C23A 2IYDB 2MSED 2GBJA 4IG7B 4KIKB 4EOYA 1WYWB 2M4NA 1Z5SB 3H7SA 2IY1B 1LQBA 3DVNU 3VH4B 4FULA 3M3JA 3A1QB 2XK5B 2ZJDA 2VRRB 4WJNA 3R7QA 3T8MA 2KVRA 3DBLI 4M8MA 4FN2A 4DXAB 4K1RB 1BT0A 3V62A 3D32A 4M0WB 4GDLA 4PS3A 2N7DA 2PE9A 4HCPB 3V61A 4EZLA 5G55A 3ZO5B 4MGKE 2KJ6A 2GBKA 2AL6A 2DAFA 2C7HA 2AL3A 3NS8A 2KDEB 4W9IA 2LI5A 3PHWB 3K9PB 4K7SA 3UINB 1V6EA 2DYBA 2KQSA 2KC2A 3TMPB 2OOBB 5DPWA 3QHTA 2JVCA 4F8CB 1WJUA 2L00B 1WZ0A 3Q3FA 2LRWA 4EKUA 2KTFA 3I3TB 3RYTA 1D3ZA 2KXJA 4KZ0A 5L95C 3WANA 1YX5B 1EF5A 4FHKA 4KIKA 3HIZA 2NPTB 3A9KA 4OVUA 3A1QA 4NJ6A 2XK5A 4TQ0A 4LJOB 1E8ZA 1EF1A 3IVFA 2EMSA 2FAZA 2QHOA 3VTWA 2OJRA 3PRPB 3TJPA 1WXMA 3DBSA 4MM3A 3TCAA 3L0WB 2CU1A 1E90A 1WX7A 2KDIA 2WX0A 3O65B 3JYUA 4GGQA 4IM2A 2L05A 2FIDA 1E8WA 1YIWA 3DBRI 4F7ZA 4K7UA 2KLCA 3QCAA 3VTVA 3UIPB 3IG3A 1P98A 3X23A 3ML9A 4IWQA 3TIXA 3AU5A 1WGYA 4WAAA 2N1VA 4JQWC 3RULA 2LGXA 3PZDA 4NQKE 4PS8A 1VCBA 4I6LB 4A3OA 2N9XA 3EFUA 2XBBC 3X0WA 3A4RA 1WJNA 4WQOB 3CMMB 1V9JA 2N9PC 4K7WA 4MGZE 3PLVA 1LM8B 3HHMA 3JVZX 5JH5C 3VDZA 4PYZA 2NPTA 2M8SA 3DVGY 5TR5A 1Q5WB 3PLUA 2KQ7A 4RMAA 3WALA 2FCQA 3GZNI 2GBMA 3S2AA 2L0TA 2ASQA 5C1ZA 2REXA 4II2B 2YLMA 3DVNV 2M17A 2HTHA 2KDBA 2KNBA 2L7RA 2PJHA 4FJVB 4MSQB 4TUUA 1WXVA 1WX9A 2LGYA 2IO2B 1SIFA 5KHOA 2G4DB 4G3XB 4WJOA 4W9GA 3QJZA 2LXAA 4ANVA 5E6PA 2KLGA 4WWNA 3RZWC 2RPQA 2KC1A 3EECA 4W9JA 1NBFC 2GMIC 3NY5A 3RD2A 2KWCA 3VH3B 2MRPA 2L8JA 1T0YA 1HE8A 3ZUNA 3ZTDA 3QIJA 2LXCA 4N9F4 3H1UA 2NVUI 3PHXB 2LJ5A 4HPLB 3QX1A 4FJZA 1P0RA 1PQSA 4KSKC 3NOBA 2K1FA 4BBNF 4EEWA 5G2NA 3V6CB 1I35A 3ZDMC 1ZKHA 1GJZA 3B1LX 3ZTCA 3HK0A 3PS6A 4ZRIA 5LLIA 3WA0A 4BKGA 3KUCB 3VFKA 3M63B 3PREA 1UBQA 1WM2A 2K8HA 3B08A 2K6DB 3KVFB 2KKCA 1V86A 4AJYB 2LD9A 3IFWB 4OVVA 3UIOB 3DCGA 3A9KB 1G6JA 3MHSD 4EUTA 2KX0A 4AJWA 3VTUA 3ML8A 4WWPA 4HLEA 1I42A 1X1MA 4HDQA 4IWPA 3VXWA 2DHZA 1P9DU 4AOFA 2MBHA 2JXXA 1WH3A 2Z0EB 3NZSA 4HDOA 3TBLD 4MGIE 1UZXB 1UGMA 4W9HA 2KHWB 1SE9A 3SU8X 1CMXB 2N1WA 4ASWC 3H6NA 2BPSA 4BFRA 3OJ3A 5CTRC 5DPTA 4GN1A 1P1AA 2JRHA 3LDZE 3V6EB 1OEYA 4HVBA 3VUYA 1E7UA 3AU4A 2BYFA 2KZRA 1YQBA 4W9FA 1V49A 1YJ1A 1YD8U 1RLFA 4LDTB 2DZMA 1WI0A 1WXSA 1WMHB 4G50A 1TGZB 4JL9A 5D2MB 2B3AA 3N30A 3PRZA 2J0KA 5LXIB 1Q0WB 4BOZB 1WRDB 2JY6A 1ZW7A 4LJPB 1XQQA 2GBRA 3AI5A 3APCA 4PS7A 3QQ8B 2ZVOA 2CKHB 4WJPA 2LWPA 4GMVA 5J2RA 5AZGA 2ZCCA 4GOCA 5E6OA 3ZW3A 2KK8A 4NY0A 3ZRCA 3PSEB 4G11A 1J8CA 2K8CA 2J0JA 3ZRFA 2G4SA 2MP2A 2MBBB 4ZRJA 5J18A 4XX5A 3APDA 4DDGD 2BYVE 2V4LA 1UELA 3SHQA 2O6VB 3VUXA 3CF6E 2N4FA 3L13A 1WGDA 2JWZA 3PTFC 4HXDA 2Y5BB 3AXCA 4NAWB 1WGGA 4KVGB 1UD7A 3ZKJC 1KM7A 4KSLC 4CO7A 5IAAC 4DK5A 2J0MA 4B6WA 2DAJA 5JHAA 1WX8A 2D07B 1YX6B 2HE7A 4IM3A 3V60A 4ZDVA 1M94A 1WMHA 2RGFA 3WAOA 1UH6A 1WF9A 5KHQA 2ZPNA 2WYQA 2MA9B 2NS5A 4HCNB 4ICUA 4WJQA 2ZNVC 4FADA 2G3QB 2DZJA 3U7DA 1MG8A 2IZVB 4NPNA 2KANA 4IWOA 2Z59B 4I6NB 5CX3A 3ENEA 1QZEA 1Z2MA 2K6QA 4AWJA 1E5WA 2EKEC 2RD0A 2CHWA 1WGRA 2JUOA 1EO6A 1E7VA 1C3TA 3ECIA 3UQAA 2RR9A 4GSWA 1RAXA 2UWQA 2HJ8A 1S1QB 2M1MA 1WGHA 4P7IA 2HD5B 4XC2A 5CHWA 5E6NA 3SDLC 3ZNZB 3ZNHB 2KWUB 4HJKA 2ZCBA 4GIVA 2O6VA 2MWSB 3UF8A 3HM3A 4J6IA 4FJYA 4KZCA 4W9KA 4MDKE 3TL5A 1WR1A 3OAWA 4MELA 4NAWA 5EDSA 4ANUA 2XEWA 2I1KA 2KO3A 2MLBA 2GOWA 3PT2B 3QC8B 3PGEA 1KJTA 1SGHA 2BYEA 4B9KA 4DBGA 1FXTB 1OGWA 3M62B 3N3KB 4II3B 3QA8A 2DYMA 1TTNA 4IC7B 3L10B 4RM9A 5BO4B 3R3MA 4URKA 5JHBA 4DHZB 2A5UA 3L54A 1IPGA 1S3SG 2D2QA 2PEAA 3KH0A 3RCZA 4ZRKA 3ZVVA 1WIAA 1P3QU 2KWVB 2PE6B 2AWTA 2FCMA 2CHZA 2ZEQA 3VHTC 2NBUA 2NBVB 3KUDB 3A4SC 3EHVA 1H8CA 1R4MI 4TKNA 2MW5A 4ICVA 5DPSA 4BKSA 4FBJB 1OEYJ 1Y8RC 3QWZB 1J0GA 5DCNA 3L16A 4LDTD 1OTRB 1V81A 5D7GA 1XT9B 1J19A 3VUWA 2DZKA 4MEMA 4F1SA 3HM6X 4TV3A 3NHEB 2WWZA 4E3CA 2LVOA 2BGFA 2KFKB 2MP2B 4EZJA 4JIOU 4WWOA 4K81A 3QARA 2FCNA 2NR2A 5D94A 5AZHA 4DDID 4GDKB 2KJHB 2K25A 1RRBA 4B95A 1IP9A 3DQVA 2KMAA 2MBOA 4M8NA 3APFA 3ONSA 4XZ4A 3JSVA 2LGDA 4A20A 2L0FA 1IYFA 2KJRA 2KMCA 2KOXA 1WE7A 3OLMD 3AULA 3CSFA 3PRMB 1U4AA 3DBHI 3ZNID 4E74A 4GU2A 2KTRA 4I6PA 1L7YA 2NCNA 3MJWA 1GG3A 1H4RA 1GC6A 2O6VD 5CHFA 1WY8A 2KFJA 2DX5B 3MTNB 1GC7A 3RUIB 1GNUA 2K8BA 4AP4C 2DENB 1KLVA 4PYUA 2C7MB 2L76A 4W9CA 4EFOA 4W9EA 2LASA 4JLCA 4MSMB 3C0RB 4TQ1A 4BVUC 2DZIA 4X57B 5AEKB 2JPHA 2A4ZA 2ZZPB 3IHPC 4HWIB 2R2OA 2MCNB 4YL8A 3W1YA 5FR6A 4BKTA 2C7NB 3UGBB 1V80A 2KFKA 3ZLZA 4ZYNA 2Z0DB 1F9JA 2CS4A 1WJ6A 3PPAA 4MH0E 5LXHA 4GDKA 2LVPA 1RFAA 3KW5B 2LZ6A 4G0NB 4IW0A 3ZNGC 2IO1B 3H7PA 1WE6A 1LXDA 2IO0B 2O2VB 2ZPYA 4BKSD 1KOTA 1JRUA 1WJ4A 2UYZB 1WXAA 2C9WB 1A5RA 2ZNVB 3ALBA 4W9LA 5IA7A 3QAQA 4BBNC 4DHJD 3WIMA 1V5TA 1GUAB 2D11A 1NI2A 2JF5A 4HK2A 5DPRA 5JZEB 2DYOA 2JZ3B 5J17A 3NZUA 2IO3B 4KDIC 1K8RB 2KN5A 3KYDD 4MJSB
chains in the Genus database with same CATH superfamily
4BOSC 2LRUA 2FCSA 4FHJA 2OEDA 3KQ4A 3RNBC 4CHKA 2N9KA 2BT6A 4RM8A 1SF0A 3JW0X 3AEDB 4C00A 4FA6A 5GMVA 5HFYA 4DHJB 3DPDA 4CYEA 1TS2A 3A33B 3ZXVA 3FILA 2C60A 4C4VA 1L4DB 3SD5A 3CSTA 5HKHA 3WAPA 2D10A 2AEHA 1FNWA 3L4PA 1QOAA 2IBIB 4WIPA 3B0AA 3H9DA 2PTLA 3QK0A 3RT3B 2R2QA 2INDC 4MJSA 3T9LA 3AN1A 2KTRB 4PK1A 1TY2A 4ACFA 2G45B 1XEEA 2XN9C 4RGNA 3GE8C 1BUIC 3RZFA 2ZVNA 4FLHA 2JU6X 2LHEA 1OQYA 1WFYA 3BIID 4GDLB 3ZIMA 2LUEA 1AARA 2G1EA 5D6JB 3SEBA 1L2NA 4RF0A 5IOIA 1OQQA 1WR6E 2CR5A 2BWES 4P16A 2V3NA 2N7JA 1SSNA 3KWVA 5AZFA 3TSSA 3Q3JA 1ZGUB 2V3PA 3H7PB 4IM0A 4M02A 1HQRD 4MGYE 4US9A 4EOYA 1FCLA 2IY1B 4USAA 5G5GA 3U4EG 2XK5B 1D5ZC 1RFKA 1AYFA 3T8MA 1KFYB 3IT4B 2WXIA 2M56B 5E6JA 4DXAB 3BZDB 3V62A 3OWEB 5D3DA 4HPPA 1PYWD 2N7DA 1P7FA 4EZLA 5G55A 1ROEA 2KJ6A 2DAFA 1HZ5A 3PHWB 4K7SA 2KQSA 4RNAA 2RPVA 2JVCA 1TS5A 2RMMA 4KZ0A 5FR3A 4C4VB 5L95C 2WHIA 4KIKA 5MPOA 4LNNA 3W2DA 4AQ7A 2GI9A 4LJOB 1EF1A 1E8ZA 1KRHA 1C4CA 2EMSA 2FAZA 2KQ4X 2OJRA 3TJPA 4MM3A 3PZ7A 4S0RA 3FC4A 4CQNA 4K7UA 1RWSA 3IG3A 3ML9A 2D5GA 4JQWC 1PGBA 3Q8CA 2WDVB 1N62A 1VCBA 3T3OA 4A3OA 2XBBC 3A4RA 2FE8A 2N9PC 4MGZE 3PLVA 4K3CA 1V8CA 1M4VA 3WALA 4Q2JA 2KQ7A 3GZNI 5IN7A 3S2AA 2L0TA 3URYA 2ASQA 2V4IB 5TSSA 2KMMA 2M17A 4MSQB 2PJHA 4RF1A 3RNFC 1WX9A 1LO5D 2IO2B 3B2FA 2DLBA 2E6XA 4W9GA 4ANVA 2LXAA 2LGIA 1J7AA 2KLGA 3RZWC 2RPQA 4XYCA 1NBFC 1DOYA 4YSZB 3ZTDA 1TKEA 3QIJA 4N9F4 4XGAB 2NVUI 5JXVA 3E56A 2K1FA 2IGHA 4TSSA 3Q3MC 3ZTCA 1N6ZA 3GB1A 3P4QB 4RGMA 3MP9A 3KUCB 2KWDA 3M63B 3PREA 1QILA 1E7PB 1IBXA 4AJYB 3MHSD 1WYGA 1T6BX 3VXWA 2DHZA 4MM3B 5EE3A 3TBLD 3NZSA 2DWQA 4MH8A 1WSPA 2KHWB 3AE6B 1SE9A 4ASWC 3H6NA 4ZOHC 3GZNB 4J3OD 3LDZE 4R3DA 3VUYA 2LEKA 4LNOA 1SJED 1YJ1A 2MJ3A 1B1ZA 3RN9C 4G50A 4JL9A 2B3AA 4TMAB 3SFEB 3AE4B 2W82A 1Q0WB 2E3TA 2R61A 3N20C 4WWMA 3W5UB 1XQQA 3APCA 4PS7A 1EU4A 5AZGA 3ZW3A 2X38A 4NY0A 2K8CA 2J0JA 2SAKA 3ZRFA 2G4SA 2MP2A 1GB1A 4XX5A 1UWXA 2PVOD 4DDGD 1UELA 3P1MA 1F2RC 4ARCA 3CF6E 2HJ1A 2PLPA 3CWIA 1YJJA 2Y5BB 1I7HA 1KM7A 2WXLA 4WURA 2Y5PA 2MJDA 1MPEA 3B9JA 3MFGA 1M94A 1WMHA 2RGFA 1YN3A 3WAOA 1UH6A 5KHQA 2MA9B 2NS5A 4HCNB 1N5WA 2LHDA 4RCOA 2JQRB 2INCC 3RNAC 1VJKA 3U2SC 3ZXRA 4BZAA 4I6NB 4IDIA 1Z2MA 3DWGC 4AWJA 2EKEC 2RD0A 1PGAA 2CHWA 2JUOA 1JCKB 2UWQA 2HJ8A 2HD5B 4ZHPA 1UNSA 4MDKE 1WR1A 2XEWA 2KO3A 2MLBA 1N61A 2PVGC 1SXTA 3N3KB 4II3B 2DYMA 3R2TA 4RM9A 3L10B 1C78A 4URKA 1GOZA 1S3SG 2D2QA 2PEAA 2ON8A 4ZRQA 2AWTA 2ZEQA 1H8CA 1R4MI 4TKNA 4ICVA 1OEYJ 4HROA 3VRBB 3L16A 5AUIA 1V81A 4LLGM 1J19A 2PIAA 2KFKB 2MP2B 3O13A 4IKGA 4JIOU 4WQMA 3I9V1 4WWOA 2FCNA 5AZHA 4DDID 4RFBA 2KMAA 3APFA 3ONSA 2KMCA 2KOXA 1VZ7A 3AULA 4E74A 1GG3A 1JWBD 3Q2AC 1WY8A 2KFJA 1GC7A 1GNUA 2K8BA 4AP4C 1KLVA 1C76A 4W9EA 2WLBA 4JLCA 5AEKB 2INNE 2FUG1 3P42A 4S17A 4BKTA 2C7NB 4L23A 3UGBB 1F9JA 1WJ6A 1XCQL 2KACA 2LVPA 3NVWA 1PGXA 2V0GA 2LZ6A 3ZNGC 2IO1B 1LXDA 1GAQB 1JRUA 3ABVB 1TKYA 2UYZB 2C9WB 3MC0B 2K5PA 4C80A 3ALBA 4W9LA 3LYYA 4BBNC 4XWWA 1NI2A 3Q14C 2DYOA 1JROA 5J17A 3NZUA 4M0WA 1EUVB 1TBEA 2JRIB 2J52A 1KH0A 4DWFA 1R4NI 1FNVA 2WDTB 3SR6A 4REZA 2MX2A 4KKIA 2AYOB 3R8BA 1FRDA 4IUMB 4LNFA 1T0RC 4C7YA 1FIQA 1N5XA 2O2VA 2MBQA 2V1YA 3HUIA 1CJEA 3TUOA 4AS1A 2V3SA 1C1YB 3BINA 3A9JB 3UQBA 1UBIA 3HVDA 3KYCD 1D5MC 2QJLA 3OJ4B 2L52A 3U8ZA 2Y3AA 5L83A 2D3GA 4DHZE 1V5OA 2FIFA 4HPMB 4XE0A 3ZDTA 1KLUD 2L3ZA 3BK2A 3P4RB 1RM6C 2K39A 2N9EB 2KD0A 5EE1A 2SEBD 4ITKA 4D2KA 3L08A 5CHVC 4GB9A 3DVGX 4XWTA 3AE3B 1Q1OA 1WYWB 3H7SA 3DVNU 3M3JA 2ZJDA 2WQYB 2KVRA 2BTEA 2ONQA 1FCCC 4M0WB 2WS3B 4GDLA 2PE9A 1P7EA 1T5XD 1F0ZA 3ZO5B 2V9HA 3MC9A 4MGKE 3Q6BA 1NI3A 2AL3A 2WNMA 2KDEB 2LI5A 4YXDB 3C19A 4HJGE 1JWMD 1V6EA 1ENFA 2G9HD 5DPWA 4JWSC 4EKUA 1ZDVA 4OZBA 3RYTA 2KXJA 1I4XA 2WGSA 3R2IA 1DGJA 2NPTB 1FD6A 3V05A 4NJ6A 2XK5A 4K3BA 4TQ0A 4YSYB 3IVFA 2QHOA 3PRPB 1WXMA 3PO0A 4KGRA 2N0SB 3L0WB 3NRZA 4GGQA 4IM2A 2L05A 1YIWA 1HTOA 1L5PA 3TIXA 3AU5A 4WAAA 2JSVX 2Q5WD 2N1VA 3RULA 3PZDA 1C77A 1TJEA 4PS8A 2VH1A 1ZOYB 2QILA 2YEPB 3EFUA 1F52A 4N59A 4A6QA 1V9JA 1UGJA 1LM8B 3HHMA 2RDGA 3JVZX 1EM7A 3VDZA 5JH5C 3DVGY 1TIFA 4ARIA 4RMAA 3Q8EA 5D3IB 2GBMA 1C79A 2HTHA 2KDBA 2KNBA 2L7RA 1FFVA 2LGYA 3RNCC 1SIFA 2W3RA 4G3XB 3TEZA 3QJZA 5E6PA 1I4PA 3AE2B 3EECA 3RD2A 2KWCA 5BMGA 3VH3B 2L8JA 2VZKB 1VDVA 1WRIA 1FPYA 3Q8AA 1PQSA 3Q8FA 4KSKC 4EEWA 5G2NA 3V6CB 1ZKHA 2BYTA 4ZRIA 3NVVA 1PDXA 3VFKA 1T0SC 5HG2A 1TS3A 3UIOB 4OVVA 3DCGA 3MC8A 5H8YE 3P4SB 4WWPA 1YOVB 1TY0A 4HDQA 2JXXA 1YJIA 1WWTA 2Z0EB 4HDOA 4JWUC 2L1AA 4W9HA 4YTNB 3IAS1 3SU8X 1E0ZA 2MJEA 2N1WA 2BPSA 5CTRC 2JRHA 2BYFA 1RLFA 1KLGD 1WI0A 1WXSA 2DZMA 4OZAA 1KF6B 2KAJA 1NYRA 5LXIB 1F77A 1WRDB 2JY6A 4LJPB 3QQ8B 2ZVOA 4GMVA 2ZCCA 2IDYA 2NTTA 3ZRCA 3PSEB 4G11A 1J8CA 2QDFA 3MHZA 4ZRJA 3I57A 2J53A 2BYVE 3SHQA 2N4FA 2OHFA 2JWZA 1F1HA 1UF0A 1MFWA 3ZKJC 3PZ8A 1N63A 2DAJA 4ZDVA 4JPSA 1FRRA 2ZPNA 2WYQA 1QQRA 1SIJA 1HZ6A 1MG8A 1PUTA 3LXFA 5CX3A 3ENEA 4C56C 1E5WA 1WGRA 1JRPA 2LFIA 1VRAB 3ECIA 4NZLB 1SE3A 3HVZA 4XC2A 3ZNZB 1Y56A 2KWUB 2ZCBA 3B2GA 4WAFA 4OVZA 4FJYA 2KDMA 4A9AA 2NTSA 2K9XA 4P1CC 1KJTA 4DBGA 1FXTB 1OGWA 2QMTA 3QA8A 1TTNA 5JHBA 2EKIA 3RFZB 2I2YA 2WXOA 4QAYA 2ZW1A 3KH0A 1P3QU 1YQ3B 2NBUA 5IP4D 2NBVB 3KUDB 4BKSA 2JX5A 1BMLC 2BS4B 1HTQA 3VUWA 2DZKA 3HM6X 1XLPA 4E3CA 3ZJTA 2LVOA 4EZJA 3QARA 5D94A 2NR2A 1STEA 2KJHB 2MBOA 4M8NA 4XZ4A 3JSVA 3I5JC 1HEZE 1U4AA 3DBHI 3ZNID 2D3AA 3AE5B 2AQ1B 1H4RA 1V97A 2O6VD 5CHFA 2DX5B 4KKJA 4PYUA 4EFOA 4MSMB 4TQ1A 2DZIA 2JPHA 2WU5B 4ZYSA 4HWIB 2MCNB 2JWUA 1QOGA 1FO4A 3W1YA 1E6EB 5FR6A 4DXFA 1V80A 2KFKA 4ZYNA 2CU3A 2DBYA 2CS4A 1RFAA 3KW5B 4G0NB 1WE6A 2IO0B 5HI1A 1VZ6A 1A5RA 5BYSA 1ZPSA 1DOXA 1C9FA 4DHJD 1K50A 2PMVA 4HK2A 5DPRA 5JZEB 3AE1B 4OZCA 5FK9C 1GB4A 2KN5A 3KYDD 1D5XC 2HTME 1EU3A 3EC8A 4GXBA 3ETRA 1TZ1A 3Q3OC 2W9NA 2IY0B 3P2BA 2LJIA 2GRIA 1NYQA 1LFDA 1NDDA 3U30A 2IPKD 1YNTE 3VQIA 4AUQC 2RSUA 4LCDE 2LVQA 4BAXA 1E8YA 1TS4A 4HEA1 3PV1A 4ANWA 1V2YA 1WM3A 1TKGA 1AWDA 3RNGC 3AEGB 4C7ZA 4JX1C 3W1SC 3JSVB 4E71A 3NG0A 3NVZA 2JT4B 4WH4A 1PFDA 2EMTA 1XCTL 2M0XA 2BWFA 4N6EB 4M01A 1I4QA 3VAWA 1JMLA 2WP9B 2MBEA 2BKRB 4W9DA 2BQQA 1ET6A 4NJ7A 1K52A 1ISNA 2FUHB 4OHJA 3W1SA 4ANXA 2FNJB 1NVID 2GBNA 3A9JA 2CHXA 2KDFB 1JWSD 2WXPA 2PKOA 4NQLB 4KGTA 1JALA 1QT9A 4KV2A 4EZKA 4YT0B 5C23A 2IYDB 2MSED 3Q3NC 1HXYD 2M4NA 3J9CA 1LQBA 3VH4B 4FULA 1EWYC 3A1QB 3IT6B 4WJNA 3R7QA 1MJDA 5I4DA 1YQ4B 3DBLI 4FN2A 4K1RB 3D32A 1A70A 1ZXHA 2QEJC 2C7HA 3NS8A 3UINB 2DYBA 3AH7A 1TYGB 1WJUA 3EUB2 1WZ0A 3Q3FA 2WU2B 3BVMA 2KTFA 3I3TB 1YN4A 1D3ZA 1R4MB 2WXKA 1JW9D 3WANA 1YX5B 1EF5A 4FHKA 4N58A 1YMHE 3A9KA 3NS1A 4OVUA 1HA5A 2L32A 1IUEA 3DBSA 3TCAA 4A8XC 4KGSA 1WX7A 3ZJVA 3ZYYX 1E8WA 2FIDA 2GB1A 2WXHA 1EWCA 1QF6A 3QCAA 3UIPB 1P98A 4IWQA 1WGYA 2LGSA 3RI7C 4HKZE 5T8IA 3TEXA 4LK0M 1WJNA 4WQOB 4XDDA 1ESFA 1XXGA 4KX6B 4OW0A 4PYZA 2NPTA 2QIEB 4LNKA 5TR5A 1V1PB 2FCQA 5C1ZA 2REXA 4II2B 3ZJUA 4HRSA 3HRDD 3DVNV 1SJHD 3AEAB 1WXVA 1NENB 5EE0A 1L0XB 5KHOA 3N9YC 2G4DB 4FXCA 4WWNA 4W9JA 3NY5A 1T0YA 1HE8A 3DHIC 3H1UA 1V1OA 2D3CA 2LJ5A 4HPLB 1P0RA 1DOIA 1E9MA 3NOBA 3N1XC 4A90A 3ZDMC 1GJZA 3PS6A 1RYJA 5LLIA 4RGTA 2K6DB 1R4NB 2KKCA 4US8A 3IFWB 2WXNA 3A9KB 1G6JA 2AQ2B 4EUTA 4AJWA 3SFDB 3VTUA 3UI3A 4HLEA 1I42A 1X1MA 4ZHOA 4IWPA 2QC8A 1WH3A 4MGIE 1CMXB 2IGDA 4BFRA 3AE7B 4GN1A 3V6EB 4NAMA 1OEYA 4HVBA 3AU4A 4W9FA 2KZRA 1YQBA 3ZQ4A 5D2MB 2J0KA 4BOZB 1FMAD 2GBRA 4P6VF 4YTMB 2CKHB 5E6OA 3KLSX 1IGDA 5EE9A 3AB5A 2MBBB 1R7SA 1T3QA 5C3JB 2V4LA 2O6VB 3VUXA 3W5VB 3PTFC 4HXDA 4NAWB 1WGGA 1UD7A 4KSLC 4DK5A 2J0MA 4B6WA 4EE2A 5JHAA 1WX8A 2D07B 2CJOA 3DWMA 4IM3A 3V60A 1XLNA 2W54A 1WF9A 4ICUA 2DZJA 3U7DA 4NPNA 2KANA 1C4PA 2Z59B 1EO6A 3UQAA 2RR9A 1DYQA 1S1QB 1WGHA 4P7IA 3AE9B 4GIVA 2H88B 3HM3A 4J6IA 4YTPB 3Q69A 4KZCA 3TL5A 4MELA 5BYRA 3QC8B 3PT2B 2BW2A 1SBBB 1SGHA 4B9KA 3M62B 1K51A 5BO4B 3R3MA 3L54A 2QSDA 1IPGA 1YN5A 4JE3B 4ZRKA 3TEWA 1L4ZB 1WIAA 2KWVB 2PE6B 2BBCA 3VHTC 1SE4A 3EHVA 2HDEA 1FEHA 5DPSA 4FBJB 1Y8RC 4O1NA 1J0GA 3AEEB 2ZW0A 4LDTD 1OTRB 4MT5A 1UUPA 5D7GA 3I63C 1MI0A 1XT9B 4MEMA 4F1SA 3NHEB 2B76B 2WWZA 3TEYA 3NUHB 1L6UA 2IGGA 4K81A 2K22A 4GDKB 1ZDXA 4B95A 1RRBA 3DQVA 4LNIA 2RDBC 1IYFA 2LGDA 2KJRA 3OLMD 3AV8A 4I6PA 1L7YA 2NCNA 3MJWA 3IAM1 1GC6A 1UWMA 3RUIB 2DENB 3BWUD 2C7MB 4X57B 2TSSA 2A4ZA 2ZZPB 4YL8A 2J4XA 2KYWA 2PW9A 3AE8B 3ZLZA 3FAHA 4MH0E 3PPAA 3AECB 3FILB 1KOTA 1WJ4A 1WXAA 5IA7A 2DNFA 1XLOA 5FKAC 2CJNA 1GUAB 2JF5A 3EGRA 3GP7A 2JZ3B 1ET9A 3C8YA 2IO3B 3N1ZC 4KDIC 2IJ0A 2W55A 1AN8A 4MJSB 4M8MA 3Q8BA 1VD2A 3VVWB 2GLSA 3KUZA 2NMQA 2JZZA 2WX1A 2J7QB 4KDLB 3K9OB 2MQJA 3EA6A 5IKCM 3L17A 3WAMA 1KTKA 4YWGG 3R66C 3LJ3A 2N7EA 4A3PA 4ZRPA 4NNJB 1ACCA 2C5LC 1E8XA 2RDHA 2KX3A 2YVCA 1SB3C 2BB5A 2BF8B 3H8HA 4JGHB 3N32A 3BY4B 2H89B 1XD3B 2I1JA 1QOFA 4L1BA 3NZ3A 3DOWA 3DDCB 2NBWB 1WZ3A 3IXSA 1OQRA 3V3XA 1FXIA 1I4GA 3AEBB 1L0YB 3R7RA 3U7ZA 3PVLA 3RPFC 2VH2A 1OFFA 3GOEA 3M95A 2PPHA 2Y5CA 2BKFA 3IBEA 2INPE 3VR9B 2WDRB 2BS2B 3DHHC 2GBJA 4IG7B 2LMCA 4KIKB 1Z5SB 2Z8LA 1L6VA 2UU7A 2VRRB 1BT0A 2JYTA 4PS3A 1T0QC 2MEKA 4HCPB 3V61A 5IO9A 1C4AA 2GBKA 2AL6A 1JWAD 4W9IA 3K9PB 2KC2A 3TMPB 2M19A 2OOBB 3QHTA 4F8CB 2KN4A 5G5HA 2L00B 2LRWA 1WGKA 3HIZA 2J42A 3A1QA 3P4PB 2WXMA 1FM0D 1MG4A 1QKZA 3NJTA 3VTWA 2CU1A 1E90A 2KDIA 3O65B 2WX0A 1FFUA 3JYUA 3BYYB 3DBRI 4F7ZA 1XLQA 2KLCA 1MVKA 3VTVA 1JWUD 3KWLA 3X23A 3RMKC 3ZGZA 2LGXA 4NQKE 5AUKA 3DBHB 4I6LB 2JZPA 2N9XA 3X0WA 3BK1A 3CMMB 3BYTB 4K7WA 2M8SA 2VZKD 1Q5WB 3PLUA 3N1YC 3AEFB 3MJ5A 2YLMA 2BVCA 1ZP0B 1IBXB 1SE2A 4FJVB 4TUUA 5HHDG 1MHXA 1LGRA 4WJOA 2JYEA 4H2AA 2KVZA 1TT5B 1K53A 2KC1A 2GMIC 2AX5A 1JQ4A 2MRPA 3ZUNA 1F2RI 2LXCA 3PHXB 1WXQA 3QX1A 4FJZA 4BBNF 1I35A 3DBRB 3B1LX 3HK0A 1CK1A 5C2TB 3WA0A 1V1PA 4BKGA 2WXFA 4XDCA 1UBQA 1WM2A 2K8HA 3B08A 2WXGA 3FKYA 3KVFB 1V86A 2LD9A 4RGOS 2KX0A 3ML8A 2D3BA 1D4BA 1ZUD2 1J7BA 1P9DU 4AOFA 2MBHA 4B0MA 1UZXB 1UGMA 2I38A 1SEBD 1FNUA 2ACZB 3BVZA 2WDQB 4P1BC 3OJ3A 5DPTA 1D6EC 2YEPF 1P1AA 2JXTA 2BB6A 5BYQA 1E7UA 1V49A 2K3UA 1YD8U 4LDTB 1WMHB 1TGZB 3N30A 4M00A 3PRZA 2WXJA 1N60A 1ZW7A 3VR8B 3AI5A 2KT7A 4WJPA 2LWPA 5J2RA 1VLBA 3NVYA 1TZOA 4GOCA 2KK8A 5J18A 3APDA 2N9LA 1I4HA 3L13A 1WGDA 1ZXIA 3AXCA 2W3SA 4KVGB 2L83A 4CO7A 5IAAC 2LUMA 3GE3C 1YX6B 2HE7A 3DHGC 4A55A 3DBLB 4WJQA 3T3NA 2ZNVC 4FADA 4DQOC 2G3QB 4RH6A 2X8XX 2IZVB 4IWOA 3E9SA 1QZEA 2K6QA 1QLBB 1E7VA 1C3TA 4GLSC 1Q10A 4GSWA 1RAXA 2M1MA 1CZPA 1I4RA 3AM9A 1E10A 3SDLC 3ZNHB 5E6NA 5CHWA 1VR9A 4HJKA 1IGCA 3CIRB 2WXQA 4L2YA 2O6VA 2MWSB 3UF8A 1GPXA 3BVGA 4W9KA 3OAWA 4NAWA 5EDSA 4ANUA 2I1KA 2K0PA 2GOWA 2WXRA 3PGEA 3AMZA 1ZE3D 2BYEA 3LB8C 1XO3A 4IC7B 5LNK1 4DHZB 4IOIE 1B9RA 3OG5A 2A5UA 3RCZA 3ZVVA 5BMHA 2FCMA 2CHZA 3VRAB 3A4SC 3P63A 2MW5A 3QWZB 5DCNA 2M0AA 2MHJA 1CQVA 4TV3A 2BGFA 5GXGB 2AQ3B 2BS3B 1BXTA 1QOBA 4NJCA 1XF5L 1AW7A 2K25A 3WCQA 1IP9A 4A20A 2L0FA 1WE7A 3PRMB 3CSFA 4B0EA 4GU2A 1J7CA 2KTRA 3MTNB 3U52E 4YSXB 4W9CA 2L76A 2LASA 5BMIA 3C0RB 4BVUC 2XNAC 4PT5A 4LTUA 3IHPC 1FXAA 2R2OA 4MACA 2ICIA 3RNEC 1VZ8A 3EFCA 1L0VB 2MH7A 4DXGA 2Z0DB 5LXHA 4GDKA 4IW0A 4UDUC 3H7PA 3GS2A 5H92C 2O2VB 2ZPYA 4BKSD 2OJWA 4HKQA 2QCZA 2ZNVB 3W9CB 1MHHE 3QAQA 2FBWB 3WIMA 1V5TA 2D11A 2EELA 1NEKB 1K8RB
chains in the Genus database with same CATH topology
4BOSC 1EUVB 1TBEA 2JRIB 1VD2A 3VVWB 3KUZA 3EC8A 2LRUA 2JZZA 2WX1A 4GXBA 2FCSA 1TZ1A 2J7QB 4FHJA 2W9NA 2IY0B 4KDLB 3P2BA 4CHKA 4DWFA 4RM8A 1R4NI 2WDTB 3K9OB 2MQJA 2MX2A 2AYOB 3JW0X 1LFDA 1NDDA 3U30A 4FA6A 3L17A 4IUMB 5GMVA 3VQIA 3WAMA 4AUQC 2RSUA 3DPDA 4CYEA 4DHJB 4LCDE 2LVQA 3A33B 2O2VA 3R66C 3LJ3A 2N7EA 2MBQA 2V1YA 4A3PA 2C60A 1E8YA 3SD5A 3CSTA 4NNJB 3PV1A 2V3SA 4ANWA 1V2YA 1WM3A 5HKHA 1C1YB 3BINA 3A9JB 2C5LC 2D10A 3WAPA 3UQBA 2AEHA 1E8XA 2KX3A 3W1SC 1UBIA 2IBIB 3KYCD 3JSVB 3B0AA 2YVCA 3H9DA 2BF8B 3OJ4B 3QK0A 4JGHB 3RT3B 2R2QA 3U8ZA 4E71A 4MJSA 3T9LA 5L83A 2D3GA 2JT4B 2KTRB 3N32A 4DHZE 2EMTA 3BY4B 1V5OA 2FIFA 4HPMB 2M0XA 2G45B 2BWFA 1XD3B 2I1JA 3ZDTA 3RZFA 2ZVNA 2L3ZA 4FLHA 1OQYA 1WFYA 3DOWA 4GDLB 3ZIMA 2LUEA 3DDCB 3VAWA 1AARA 2NBWB 5D6JB 1L2NA 1WZ3A 2K39A 2N9EB 2MBEA 2KD0A 2BKRB 4W9DA 1WR6E 2CR5A 2BWES 3R7RA 3PVLA 4NJ7A 3L08A 1ISNA 2FUHB 3W1SA 5CHVC 4GB9A 3GOEA 4ANXA 2FNJB 3DVGX 2GBNA 3M95A 2PPHA 2BKFA 3IBEA 5AZFA 3A9JA 2CHXA 3Q3JA 2KDFB 1ZGUB 3H7PB 4NQLB 4IM0A 1Q1OA 4KV2A 4EZKA 4MGYE 5C23A 2IYDB 2MSED 2GBJA 4IG7B 4KIKB 4EOYA 1WYWB 2M4NA 1Z5SB 3H7SA 2IY1B 1LQBA 3DVNU 3VH4B 4FULA 3M3JA 3A1QB 2XK5B 2ZJDA 2VRRB 4WJNA 3R7QA 3T8MA 2KVRA 3DBLI 4M8MA 4FN2A 4DXAB 4K1RB 1BT0A 3V62A 3D32A 4M0WB 4GDLA 4PS3A 2N7DA 2PE9A 4HCPB 3V61A 4EZLA 5G55A 3ZO5B 4MGKE 2KJ6A 2GBKA 2AL6A 2DAFA 2C7HA 2AL3A 3NS8A 2KDEB 4W9IA 2LI5A 3PHWB 3K9PB 4K7SA 3UINB 1V6EA 2DYBA 2KQSA 2KC2A 3TMPB 2OOBB 5DPWA 3QHTA 2JVCA 4F8CB 1WJUA 2L00B 1WZ0A 3Q3FA 2LRWA 4EKUA 2KTFA 3I3TB 3RYTA 1D3ZA 2KXJA 4KZ0A 5L95C 3WANA 1YX5B 1EF5A 4FHKA 4KIKA 3HIZA 2NPTB 3A9KA 4OVUA 3A1QA 4NJ6A 2XK5A 4TQ0A 4LJOB 1E8ZA 1EF1A 3IVFA 2EMSA 2FAZA 2QHOA 3VTWA 2OJRA 3PRPB 3TJPA 1WXMA 3DBSA 4MM3A 3TCAA 3L0WB 2CU1A 1E90A 1WX7A 2KDIA 2WX0A 3O65B 3JYUA 4GGQA 4IM2A 2L05A 2FIDA 1E8WA 1YIWA 3DBRI 4F7ZA 4K7UA 2KLCA 3QCAA 3VTVA 3UIPB 3IG3A 1P98A 3X23A 3ML9A 4IWQA 3TIXA 3AU5A 1WGYA 4WAAA 2N1VA 4JQWC 3RULA 2LGXA 3PZDA 4NQKE 4PS8A 1VCBA 4I6LB 4A3OA 2N9XA 3EFUA 2XBBC 3X0WA 3A4RA 1WJNA 4WQOB 3CMMB 1V9JA 2N9PC 4K7WA 4MGZE 3PLVA 1LM8B 3HHMA 3JVZX 5JH5C 3VDZA 4PYZA 2NPTA 2M8SA 3DVGY 5TR5A 1Q5WB 3PLUA 2KQ7A 4RMAA 3WALA 2FCQA 3GZNI 2GBMA 3S2AA 2L0TA 2ASQA 5C1ZA 2REXA 4II2B 2YLMA 3DVNV 2M17A 2HTHA 2KDBA 2KNBA 2L7RA 2PJHA 4FJVB 4MSQB 4TUUA 1WXVA 1WX9A 2LGYA 2IO2B 1SIFA 5KHOA 2G4DB 4G3XB 4WJOA 4W9GA 3QJZA 2LXAA 4ANVA 5E6PA 2KLGA 4WWNA 3RZWC 2RPQA 2KC1A 3EECA 4W9JA 1NBFC 2GMIC 3NY5A 3RD2A 2KWCA 3VH3B 2MRPA 2L8JA 1T0YA 1HE8A 3ZUNA 3ZTDA 3QIJA 2LXCA 4N9F4 3H1UA 2NVUI 3PHXB 2LJ5A 4HPLB 3QX1A 4FJZA 1P0RA 1PQSA 4KSKC 3NOBA 2K1FA 4BBNF 4EEWA 5G2NA 3V6CB 1I35A 3ZDMC 1ZKHA 1GJZA 3B1LX 3ZTCA 3HK0A 3PS6A 4ZRIA 5LLIA 3WA0A 4BKGA 3KUCB 3VFKA 3M63B 3PREA 1UBQA 1WM2A 2K8HA 3B08A 2K6DB 3KVFB 2KKCA 1V86A 4AJYB 2LD9A 3IFWB 4OVVA 3UIOB 3DCGA 3A9KB 1G6JA 3MHSD 4EUTA 2KX0A 4AJWA 3VTUA 3ML8A 4WWPA 4HLEA 1I42A 1X1MA 4HDQA 4IWPA 3VXWA 2DHZA 1P9DU 4AOFA 2MBHA 2JXXA 1WH3A 2Z0EB 3NZSA 4HDOA 3TBLD 4MGIE 1UZXB 1UGMA 4W9HA 2KHWB 1SE9A 3SU8X 1CMXB 2N1WA 4ASWC 3H6NA 2BPSA 4BFRA 3OJ3A 5CTRC 5DPTA 4GN1A 1P1AA 2JRHA 3LDZE 3V6EB 1OEYA 4HVBA 3VUYA 1E7UA 3AU4A 2BYFA 2KZRA 1YQBA 4W9FA 1V49A 1YJ1A 1YD8U 1RLFA 4LDTB 2DZMA 1WI0A 1WXSA 1WMHB 4G50A 1TGZB 4JL9A 5D2MB 2B3AA 3N30A 3PRZA 2J0KA 5LXIB 1Q0WB 4BOZB 1WRDB 2JY6A 1ZW7A 4LJPB 1XQQA 2GBRA 3AI5A 3APCA 4PS7A 3QQ8B 2ZVOA 2CKHB 4WJPA 2LWPA 4GMVA 5J2RA 5AZGA 2ZCCA 4GOCA 5E6OA 3ZW3A 2KK8A 4NY0A 3ZRCA 3PSEB 4G11A 1J8CA 2K8CA 2J0JA 3ZRFA 2G4SA 2MP2A 2MBBB 4ZRJA 5J18A 4XX5A 3APDA 4DDGD 2BYVE 2V4LA 1UELA 3SHQA 2O6VB 3VUXA 3CF6E 2N4FA 3L13A 1WGDA 2JWZA 3PTFC 4HXDA 2Y5BB 3AXCA 4NAWB 1WGGA 4KVGB 1UD7A 3ZKJC 1KM7A 4KSLC 4CO7A 5IAAC 4DK5A 2J0MA 4B6WA 2DAJA 5JHAA 1WX8A 2D07B 1YX6B 2HE7A 4IM3A 3V60A 4ZDVA 1M94A 1WMHA 2RGFA 3WAOA 1UH6A 1WF9A 5KHQA 2ZPNA 2WYQA 2MA9B 2NS5A 4HCNB 4ICUA 4WJQA 2ZNVC 4FADA 2G3QB 2DZJA 3U7DA 1MG8A 2IZVB 4NPNA 2KANA 4IWOA 2Z59B 4I6NB 5CX3A 3ENEA 1QZEA 1Z2MA 2K6QA 4AWJA 1E5WA 2EKEC 2RD0A 2CHWA 1WGRA 2JUOA 1EO6A 1E7VA 1C3TA 3ECIA 3UQAA 2RR9A 4GSWA 1RAXA 2UWQA 2HJ8A 1S1QB 2M1MA 1WGHA 4P7IA 2HD5B 4XC2A 5CHWA 5E6NA 3SDLC 3ZNZB 3ZNHB 2KWUB 4HJKA 2ZCBA 4GIVA 2O6VA 2MWSB 3UF8A 3HM3A 4J6IA 4FJYA 4KZCA 4W9KA 4MDKE 3TL5A 1WR1A 3OAWA 4MELA 4NAWA 5EDSA 4ANUA 2XEWA 2I1KA 2KO3A 2MLBA 2GOWA 3PT2B 3QC8B 3PGEA 1KJTA 1SGHA 2BYEA 4B9KA 4DBGA 1FXTB 1OGWA 3M62B 3N3KB 4II3B 3QA8A 2DYMA 1TTNA 4IC7B 3L10B 4RM9A 5BO4B 3R3MA 4URKA 5JHBA 4DHZB 2A5UA 3L54A 1IPGA 1S3SG 2D2QA 2PEAA 3KH0A 3RCZA 4ZRKA 3ZVVA 1WIAA 1P3QU 2KWVB 2PE6B 2AWTA 2FCMA 2CHZA 2ZEQA 3VHTC 2NBUA 2NBVB 3KUDB 3A4SC 3EHVA 1H8CA 1R4MI 4TKNA 2MW5A 4ICVA 5DPSA 4BKSA 4FBJB 1OEYJ 1Y8RC 3QWZB 1J0GA 5DCNA 3L16A 4LDTD 1OTRB 1V81A 5D7GA 1XT9B 1J19A 3VUWA 2DZKA 4MEMA 4F1SA 3HM6X 4TV3A 3NHEB 2WWZA 4E3CA 2LVOA 2BGFA 2KFKB 2MP2B 4EZJA 4JIOU 4WWOA 4K81A 3QARA 2FCNA 2NR2A 5D94A 5AZHA 4DDID 4GDKB 2KJHB 2K25A 1RRBA 4B95A 1IP9A 3DQVA 2KMAA 2MBOA 4M8NA 3APFA 3ONSA 4XZ4A 3JSVA 2LGDA 4A20A 2L0FA 1IYFA 2KJRA 2KMCA 2KOXA 1WE7A 3OLMD 3AULA 3CSFA 3PRMB 1U4AA 3DBHI 3ZNID 4E74A 4GU2A 2KTRA 4I6PA 1L7YA 2NCNA 3MJWA 1GG3A 1H4RA 1GC6A 2O6VD 5CHFA 1WY8A 2KFJA 2DX5B 3MTNB 1GC7A 3RUIB 1GNUA 2K8BA 4AP4C 2DENB 1KLVA 4PYUA 2C7MB 2L76A 4W9CA 4EFOA 4W9EA 2LASA 4JLCA 4MSMB 3C0RB 4TQ1A 4BVUC 2DZIA 4X57B 5AEKB 2JPHA 2A4ZA 2ZZPB 3IHPC 4HWIB 2R2OA 2MCNB 4YL8A 3W1YA 5FR6A 4BKTA 2C7NB 3UGBB 1V80A 2KFKA 3ZLZA 4ZYNA 2Z0DB 1F9JA 2CS4A 1WJ6A 3PPAA 4MH0E 5LXHA 4GDKA 2LVPA 1RFAA 3KW5B 2LZ6A 4G0NB 4IW0A 3ZNGC 2IO1B 3H7PA 1WE6A 1LXDA 2IO0B 2O2VB 2ZPYA 4BKSD 1KOTA 1JRUA 1WJ4A 2UYZB 1WXAA 2C9WB 1A5RA 2ZNVB 3ALBA 4W9LA 5IA7A 3QAQA 4BBNC 4DHJD 3WIMA 1V5TA 1GUAB 2D11A 1NI2A 2JF5A 4HK2A 5DPRA 5JZEB 2DYOA 2JZ3B 5J17A 3NZUA 2IO3B 4KDIC 1K8RB 2KN5A 3KYDD 4MJSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BOS C;  1EUV B;  1TBE A;  2JRI B;  1VD2 A;  3VVW B;  3KUZ A;  3EC8 A;  2LRU A;  2JZZ A;  2WX1 A;  4GXB A;  2FCS A;  1TZ1 A;  2J7Q B;  4FHJ A;  2W9N A;  2IY0 B;  4KDL B;  3P2B A;  4CHK A;  4DWF A;  4RM8 A;  1R4N I;  2WDT B;  3K9O B;  2MQJ A;  2MX2 A;  2AYO B;  3JW0 X;  1LFD A;  1NDD A;  3U30 A;  4FA6 A;  3L17 A;  4IUM B;  5GMV A;  3VQI A;  3WAM A;  4AUQ C;  2RSU A;  3DPD A;  4CYE A;  4DHJ B;  4LCD E;  2LVQ A;  3A33 B;  2O2V A;  3R66 C;  3LJ3 A;  2N7E A;  2MBQ A;  2V1Y A;  4A3P A;  2C60 A;  1E8Y A;  3SD5 A;  3CST A;  4NNJ B;  3PV1 A;  2V3S A;  4ANW A;  1V2Y A;  1WM3 A;  5HKH A;  1C1Y B;  3BIN A;  3A9J B;  2C5L C;  2D10 A;  3WAP A;  3UQB A;  2AEH A;  1E8X A;  2KX3 A;  3W1S C;  1UBI A;  2IBI B;  3KYC D;  3JSV B;  3B0A A;  2YVC A;  3H9D A;  2BF8 B;  3OJ4 B;  3QK0 A;  4JGH B;  3RT3 B;  2R2Q A;  3U8Z A;  4E71 A;  4MJS A;  3T9L A;  5L83 A;  2D3G A;  2JT4 B;  2KTR B;  3N32 A;  4DHZ E;  2EMT A;  3BY4 B;  1V5O A;  2FIF A;  4HPM B;  2M0X A;  2G45 B;  2BWF A;  1XD3 B;  2I1J A;  3ZDT A;  3RZF A;  2ZVN A;  2L3Z A;  4FLH A;  1OQY A;  1WFY A;  3DOW A;  4GDL B;  3ZIM A;  2LUE A;  3DDC B;  3VAW A;  1AAR A;  2NBW B;  5D6J B;  1L2N A;  1WZ3 A;  2K39 A;  2N9E B;  2MBE A;  2KD0 A;  2BKR B;  4W9D A;  1WR6 E;  2CR5 A;  2BWE S;  3R7R A;  3PVL A;  4NJ7 A;  3L08 A;  1ISN A;  2FUH B;  3W1S A;  5CHV C;  4GB9 A;  3GOE A;  4ANX A;  2FNJ B;  3DVG X;  2GBN A;  3M95 A;  2PPH A;  2BKF A;  3IBE A;  5AZF A;  3A9J A;  2CHX A;  3Q3J A;  2KDF B;  1ZGU B;  3H7P B;  4NQL B;  4IM0 A;  1Q1O A;  4KV2 A;  4EZK A;  4MGY E;  5C23 A;  2IYD B;  2MSE D;  2GBJ A;  4IG7 B;  4KIK B;  4EOY A;  1WYW B;  2M4N A;  1Z5S B;  3H7S A;  2IY1 B;  1LQB A;  3DVN U;  3VH4 B;  4FUL A;  3M3J A;  3A1Q B;  2XK5 B;  2ZJD A;  2VRR B;  4WJN A;  3R7Q A;  3T8M A;  2KVR A;  3DBL I;  4M8M A;  4FN2 A;  4DXA B;  4K1R B;  1BT0 A;  3V62 A;  3D32 A;  4M0W B;  4GDL A;  4PS3 A;  2N7D A;  2PE9 A;  4HCP B;  3V61 A;  4EZL A;  5G55 A;  3ZO5 B;  4MGK E;  2KJ6 A;  2GBK A;  2AL6 A;  2DAF A;  2C7H A;  2AL3 A;  3NS8 A;  2KDE B;  4W9I A;  2LI5 A;  3PHW B;  3K9P B;  4K7S A;  3UIN B;  1V6E A;  2DYB A;  2KQS A;  2KC2 A;  3TMP B;  2OOB B;  5DPW A;  3QHT A;  2JVC A;  4F8C B;  1WJU A;  2L00 B;  1WZ0 A;  3Q3F A;  2LRW A;  4EKU A;  2KTF A;  3I3T B;  3RYT A;  1D3Z A;  2KXJ A;  4KZ0 A;  5L95 C;  3WAN A;  1YX5 B;  1EF5 A;  4FHK A;  4KIK A;  3HIZ A;  2NPT B;  3A9K A;  4OVU A;  3A1Q A;  4NJ6 A;  2XK5 A;  4TQ0 A;  4LJO B;  1E8Z A;  1EF1 A;  3IVF A;  2EMS A;  2FAZ A;  2QHO A;  3VTW A;  2OJR A;  3PRP B;  3TJP A;  1WXM A;  3DBS A;  4MM3 A;  3TCA A;  3L0W B;  2CU1 A;  1E90 A;  1WX7 A;  2KDI A;  2WX0 A;  3O65 B;  3JYU A;  4GGQ A;  4IM2 A;  2L05 A;  2FID A;  1E8W A;  1YIW A;  3DBR I;  4F7Z A;  4K7U A;  2KLC A;  3QCA A;  3VTV A;  3UIP B;  3IG3 A;  1P98 A;  3X23 A;  3ML9 A;  4IWQ A;  3TIX A;  3AU5 A;  1WGY A;  4WAA A;  2N1V A;  4JQW C;  3RUL A;  2LGX A;  3PZD A;  4NQK E;  4PS8 A;  1VCB A;  4I6L B;  4A3O A;  2N9X A;  3EFU A;  2XBB C;  3X0W A;  3A4R A;  1WJN A;  4WQO B;  3CMM B;  1V9J A;  2N9P C;  4K7W A;  4MGZ E;  3PLV A;  1LM8 B;  3HHM A;  3JVZ X;  5JH5 C;  3VDZ A;  4PYZ A;  2NPT A;  2M8S A;  3DVG Y;  5TR5 A;  1Q5W B;  3PLU A;  2KQ7 A;  4RMA A;  3WAL A;  2FCQ A;  3GZN I;  2GBM A;  3S2A A;  2L0T A;  2ASQ A;  5C1Z A;  2REX A;  4II2 B;  2YLM A;  3DVN V;  2M17 A;  2HTH A;  2KDB A;  2KNB A;  2L7R A;  2PJH A;  4FJV B;  4MSQ B;  4TUU A;  1WXV A;  1WX9 A;  2LGY A;  2IO2 B;  1SIF A;  5KHO A;  2G4D B;  4G3X B;  4WJO A;  4W9G A;  3QJZ A;  2LXA A;  4ANV A;  5E6P A;  2KLG A;  4WWN A;  3RZW C;  2RPQ A;  2KC1 A;  3EEC A;  4W9J A;  1NBF C;  2GMI C;  3NY5 A;  3RD2 A;  2KWC A;  3VH3 B;  2MRP A;  2L8J A;  1T0Y A;  1HE8 A;  3ZUN A;  3ZTD A;  3QIJ A;  2LXC A;  4N9F 4;  3H1U A;  2NVU I;  3PHX B;  2LJ5 A;  4HPL B;  3QX1 A;  4FJZ A;  1P0R A;  1PQS A;  4KSK C;  3NOB A;  2K1F A;  4BBN F;  4EEW A;  5G2N A;  3V6C B;  1I35 A;  3ZDM C;  1ZKH A;  1GJZ A;  3B1L X;  3ZTC A;  3HK0 A;  3PS6 A;  4ZRI A;  5LLI A;  3WA0 A;  4BKG A;  3KUC B;  3VFK A;  3M63 B;  3PRE A;  1UBQ A;  1WM2 A;  2K8H A;  3B08 A;  2K6D B;  3KVF B;  2KKC A;  1V86 A;  4AJY B;  2LD9 A;  3IFW B;  4OVV A;  3UIO B;  3DCG A;  3A9K B;  1G6J A;  3MHS D;  4EUT A;  2KX0 A;  4AJW A;  3VTU A;  3ML8 A;  4WWP A;  4HLE A;  1I42 A;  1X1M A;  4HDQ A;  4IWP A;  3VXW A;  2DHZ A;  1P9D U;  4AOF A;  2MBH A;  2JXX A;  1WH3 A;  2Z0E B;  3NZS A;  4HDO A;  3TBL D;  4MGI E;  1UZX B;  1UGM A;  4W9H A;  2KHW B;  1SE9 A;  3SU8 X;  1CMX B;  2N1W A;  4ASW C;  3H6N A;  2BPS A;  4BFR A;  3OJ3 A;  5CTR C;  5DPT A;  4GN1 A;  1P1A A;  2JRH A;  3LDZ E;  3V6E B;  1OEY A;  4HVB A;  3VUY A;  1E7U A;  3AU4 A;  2BYF A;  2KZR A;  1YQB A;  4W9F A;  1V49 A;  1YJ1 A;  1YD8 U;  1RLF A;  4LDT B;  2DZM A;  1WI0 A;  1WXS A;  1WMH B;  4G50 A;  1TGZ B;  4JL9 A;  5D2M B;  2B3A A;  3N30 A;  3PRZ A;  2J0K A;  5LXI B;  1Q0W B;  4BOZ B;  1WRD B;  2JY6 A;  1ZW7 A;  4LJP B;  1XQQ A;  2GBR A;  3AI5 A;  3APC A;  4PS7 A;  3QQ8 B;  2ZVO A;  2CKH B;  4WJP A;  2LWP A;  4GMV A;  5J2R A;  5AZG A;  2ZCC A;  4GOC A;  5E6O A;  3ZW3 A;  2KK8 A;  4NY0 A;  3ZRC A;  3PSE B;  4G11 A;  1J8C A;  2K8C A;  2J0J A;  3ZRF A;  2G4S A;  2MP2 A;  2MBB B;  4ZRJ A;  5J18 A;  4XX5 A;  3APD A;  4DDG D;  2BYV E;  2V4L A;  1UEL A;  3SHQ A;  2O6V B;  3VUX A;  3CF6 E;  2N4F A;  3L13 A;  1WGD A;  2JWZ A;  3PTF C;  4HXD A;  2Y5B B;  3AXC A;  4NAW B;  1WGG A;  4KVG B;  1UD7 A;  3ZKJ C;  1KM7 A;  4KSL C;  4CO7 A;  5IAA C;  4DK5 A;  2J0M A;  4B6W A;  2DAJ A;  5JHA A;  1WX8 A;  2D07 B;  1YX6 B;  2HE7 A;  4IM3 A;  3V60 A;  4ZDV A;  1M94 A;  1WMH A;  2RGF A;  3WAO A;  1UH6 A;  1WF9 A;  5KHQ A;  2ZPN A;  2WYQ A;  2MA9 B;  2NS5 A;  4HCN B;  4ICU A;  4WJQ A;  2ZNV C;  4FAD A;  2G3Q B;  2DZJ A;  3U7D A;  1MG8 A;  2IZV B;  4NPN A;  2KAN A;  4IWO A;  2Z59 B;  4I6N B;  5CX3 A;  3ENE A;  1QZE A;  1Z2M A;  2K6Q A;  4AWJ A;  1E5W A;  2EKE C;  2RD0 A;  2CHW A;  1WGR A;  2JUO A;  1EO6 A;  1E7V A;  1C3T A;  3ECI A;  3UQA A;  2RR9 A;  4GSW A;  1RAX A;  2UWQ A;  2HJ8 A;  1S1Q B;  2M1M A;  1WGH A;  4P7I A;  2HD5 B;  4XC2 A;  5CHW A;  5E6N A;  3SDL C;  3ZNZ B;  3ZNH B;  2KWU B;  4HJK A;  2ZCB A;  4GIV A;  2O6V A;  2MWS B;  3UF8 A;  3HM3 A;  4J6I A;  4FJY A;  4KZC A;  4W9K A;  4MDK E;  3TL5 A;  1WR1 A;  3OAW A;  4MEL A;  4NAW A;  5EDS A;  4ANU A;  2XEW A;  2I1K A;  2KO3 A;  2MLB A;  2GOW A;  3PT2 B;  3QC8 B;  3PGE A;  1KJT A;  1SGH A;  2BYE A;  4B9K A;  4DBG A;  1FXT B;  1OGW A;  3M62 B;  3N3K B;  4II3 B;  3QA8 A;  2DYM A;  1TTN A;  4IC7 B;  3L10 B;  4RM9 A;  5BO4 B;  3R3M A;  4URK A;  5JHB A;  4DHZ B;  2A5U A;  3L54 A;  1IPG A;  1S3S G;  2D2Q A;  2PEA A;  3KH0 A;  3RCZ A;  4ZRK A;  3ZVV A;  1WIA A;  1P3Q U;  2KWV B;  2PE6 B;  2AWT A;  2FCM A;  2CHZ A;  2ZEQ A;  3VHT C;  2NBU A;  2NBV B;  3KUD B;  3A4S C;  3EHV A;  1H8C A;  1R4M I;  4TKN A;  2MW5 A;  4ICV A;  5DPS A;  4BKS A;  4FBJ B;  1OEY J;  1Y8R C;  3QWZ B;  1J0G A;  5DCN A;  3L16 A;  4LDT D;  1OTR B;  1V81 A;  5D7G A;  1XT9 B;  1J19 A;  3VUW A;  2DZK A;  4MEM A;  4F1S A;  3HM6 X;  4TV3 A;  3NHE B;  2WWZ A;  4E3C A;  2LVO A;  2BGF A;  2KFK B;  2MP2 B;  4EZJ A;  4JIO U;  4WWO A;  4K81 A;  3QAR A;  2FCN A;  2NR2 A;  5D94 A;  5AZH A;  4DDI D;  4GDK B;  2KJH B;  2K25 A;  1RRB A;  4B95 A;  1IP9 A;  3DQV A;  2KMA A;  2MBO A;  4M8N A;  3APF A;  3ONS A;  4XZ4 A;  3JSV A;  2LGD A;  4A20 A;  2L0F A;  1IYF A;  2KJR A;  2KMC A;  2KOX A;  1WE7 A;  3OLM D;  3AUL A;  3CSF A;  3PRM B;  1U4A A;  3DBH I;  3ZNI D;  4E74 A;  4GU2 A;  2KTR A;  4I6P A;  1L7Y A;  2NCN A;  3MJW A;  1GG3 A;  1H4R A;  1GC6 A;  2O6V D;  5CHF A;  1WY8 A;  2KFJ A;  2DX5 B;  3MTN B;  1GC7 A;  3RUI B;  1GNU A;  2K8B A;  4AP4 C;  2DEN B;  1KLV A;  4PYU A;  2C7M B;  2L76 A;  4W9C A;  4EFO A;  4W9E A;  2LAS A;  4JLC A;  4MSM B;  3C0R B;  4TQ1 A;  4BVU C;  2DZI A;  4X57 B;  5AEK B;  2JPH A;  2A4Z A;  2ZZP B;  3IHP C;  4HWI B;  2R2O A;  2MCN B;  4YL8 A;  3W1Y A;  5FR6 A;  4BKT A;  2C7N B;  3UGB B;  1V80 A;  2KFK A;  3ZLZ A;  4ZYN A;  2Z0D B;  1F9J A;  2CS4 A;  1WJ6 A;  3PPA A;  4MH0 E;  5LXH A;  4GDK A;  2LVP A;  1RFA A;  3KW5 B;  2LZ6 A;  4G0N B;  4IW0 A;  3ZNG C;  2IO1 B;  3H7P A;  1WE6 A;  1LXD A;  2IO0 B;  2O2V B;  2ZPY A;  4BKS D;  1KOT A;  1JRU A;  1WJ4 A;  2UYZ B;  1WXA A;  2C9W B;  1A5R A;  2ZNV B;  3ALB A;  4W9L A;  5IA7 A;  3QAQ A;  4BBN C;  4DHJ D;  3WIM A;  1V5T A;  1GUA B;  2D11 A;  1NI2 A;  2JF5 A;  4HK2 A;  5DPR A;  5JZE B;  2DYO A;  2JZ3 B;  5J17 A;  3NZU A;  2IO3 B;  4KDI C;  1K8R B;  2KN5 A;  3KYD D;  4MJS B; 
#chains in the Genus database with same CATH topology
 4BOS C;  2LRU A;  2FCS A;  4FHJ A;  2OED A;  3KQ4 A;  3RNB C;  4CHK A;  2N9K A;  2BT6 A;  4RM8 A;  1SF0 A;  3JW0 X;  3AED B;  4C00 A;  4FA6 A;  5GMV A;  5HFY A;  4DHJ B;  3DPD A;  4CYE A;  1TS2 A;  3A33 B;  3ZXV A;  3FIL A;  2C60 A;  4C4V A;  1L4D B;  3SD5 A;  3CST A;  5HKH A;  3WAP A;  2D10 A;  2AEH A;  1FNW A;  3L4P A;  1QOA A;  2IBI B;  4WIP A;  3B0A A;  3H9D A;  2PTL A;  3QK0 A;  3RT3 B;  2R2Q A;  2IND C;  4MJS A;  3T9L A;  3AN1 A;  2KTR B;  4PK1 A;  1TY2 A;  4ACF A;  2G45 B;  1XEE A;  2XN9 C;  4RGN A;  3GE8 C;  1BUI C;  3RZF A;  2ZVN A;  4FLH A;  2JU6 X;  2LHE A;  1OQY A;  1WFY A;  3BII D;  4GDL B;  3ZIM A;  2LUE A;  1AAR A;  2G1E A;  5D6J B;  3SEB A;  1L2N A;  4RF0 A;  5IOI A;  1OQQ A;  1WR6 E;  2CR5 A;  2BWE S;  4P16 A;  2V3N A;  2N7J A;  1SSN A;  3KWV A;  5AZF A;  3TSS A;  3Q3J A;  1ZGU B;  2V3P A;  3H7P B;  4IM0 A;  4M02 A;  1HQR D;  4MGY E;  4US9 A;  4EOY A;  1FCL A;  2IY1 B;  4USA A;  5G5G A;  3U4E G;  2XK5 B;  1D5Z C;  1RFK A;  1AYF A;  3T8M A;  1KFY B;  3IT4 B;  2WXI A;  2M56 B;  5E6J A;  4DXA B;  3BZD B;  3V62 A;  3OWE B;  5D3D A;  4HPP A;  1PYW D;  2N7D A;  1P7F A;  4EZL A;  5G55 A;  1ROE A;  2KJ6 A;  2DAF A;  1HZ5 A;  3PHW B;  4K7S A;  2KQS A;  4RNA A;  2RPV A;  2JVC A;  1TS5 A;  2RMM A;  4KZ0 A;  5FR3 A;  4C4V B;  5L95 C;  2WHI A;  4KIK A;  5MPO A;  4LNN A;  3W2D A;  4AQ7 A;  2GI9 A;  4LJO B;  1EF1 A;  1E8Z A;  1KRH A;  1C4C A;  2EMS A;  2FAZ A;  2KQ4 X;  2OJR A;  3TJP A;  4MM3 A;  3PZ7 A;  4S0R A;  3FC4 A;  4CQN A;  4K7U A;  1RWS A;  3IG3 A;  3ML9 A;  2D5G A;  4JQW C;  1PGB A;  3Q8C A;  2WDV B;  1N62 A;  1VCB A;  3T3O A;  4A3O A;  2XBB C;  3A4R A;  2FE8 A;  2N9P C;  4MGZ E;  3PLV A;  4K3C A;  1V8C A;  1M4V A;  3WAL A;  4Q2J A;  2KQ7 A;  3GZN I;  5IN7 A;  3S2A A;  2L0T A;  3URY A;  2ASQ A;  2V4I B;  5TSS A;  2KMM A;  2M17 A;  4MSQ B;  2PJH A;  4RF1 A;  3RNF C;  1WX9 A;  1LO5 D;  2IO2 B;  3B2F A;  2DLB A;  2E6X A;  4W9G A;  4ANV A;  2LXA A;  2LGI A;  1J7A A;  2KLG A;  3RZW C;  2RPQ A;  4XYC A;  1NBF C;  1DOY A;  4YSZ B;  3ZTD A;  1TKE A;  3QIJ A;  4N9F 4;  4XGA B;  2NVU I;  5JXV A;  3E56 A;  2K1F A;  2IGH A;  4TSS A;  3Q3M C;  3ZTC A;  1N6Z A;  3GB1 A;  3P4Q B;  4RGM A;  3MP9 A;  3KUC B;  2KWD A;  3M63 B;  3PRE A;  1QIL A;  1E7P B;  1IBX A;  4AJY B;  3MHS D;  1WYG A;  1T6B X;  3VXW A;  2DHZ A;  4MM3 B;  5EE3 A;  3TBL D;  3NZS A;  2DWQ A;  4MH8 A;  1WSP A;  2KHW B;  3AE6 B;  1SE9 A;  4ASW C;  3H6N A;  4ZOH C;  3GZN B;  4J3O D;  3LDZ E;  4R3D A;  3VUY A;  2LEK A;  4LNO A;  1SJE D;  1YJ1 A;  2MJ3 A;  1B1Z A;  3RN9 C;  4G50 A;  4JL9 A;  2B3A A;  4TMA B;  3SFE B;  3AE4 B;  2W82 A;  1Q0W B;  2E3T A;  2R61 A;  3N20 C;  4WWM A;  3W5U B;  1XQQ A;  3APC A;  4PS7 A;  1EU4 A;  5AZG A;  3ZW3 A;  2X38 A;  4NY0 A;  2K8C A;  2J0J A;  2SAK A;  3ZRF A;  2G4S A;  2MP2 A;  1GB1 A;  4XX5 A;  1UWX A;  2PVO D;  4DDG D;  1UEL A;  3P1M A;  1F2R C;  4ARC A;  3CF6 E;  2HJ1 A;  2PLP A;  3CWI A;  1YJJ A;  2Y5B B;  1I7H A;  1KM7 A;  2WXL A;  4WUR A;  2Y5P A;  2MJD A;  1MPE A;  3B9J A;  3MFG A;  1M94 A;  1WMH A;  2RGF A;  1YN3 A;  3WAO A;  1UH6 A;  5KHQ A;  2MA9 B;  2NS5 A;  4HCN B;  1N5W A;  2LHD A;  4RCO A;  2JQR B;  2INC C;  3RNA C;  1VJK A;  3U2S C;  3ZXR A;  4BZA A;  4I6N B;  4IDI A;  1Z2M A;  3DWG C;  4AWJ A;  2EKE C;  2RD0 A;  1PGA A;  2CHW A;  2JUO A;  1JCK B;  2UWQ A;  2HJ8 A;  2HD5 B;  4ZHP A;  1UNS A;  4MDK E;  1WR1 A;  2XEW A;  2KO3 A;  2MLB A;  1N61 A;  2PVG C;  1SXT A;  3N3K B;  4II3 B;  2DYM A;  3R2T A;  4RM9 A;  3L10 B;  1C78 A;  4URK A;  1GOZ A;  1S3S G;  2D2Q A;  2PEA A;  2ON8 A;  4ZRQ A;  2AWT A;  2ZEQ A;  1H8C A;  1R4M I;  4TKN A;  4ICV A;  1OEY J;  4HRO A;  3VRB B;  3L16 A;  5AUI A;  1V81 A;  4LLG M;  1J19 A;  2PIA A;  2KFK B;  2MP2 B;  3O13 A;  4IKG A;  4JIO U;  4WQM A;  3I9V 1;  4WWO A;  2FCN A;  5AZH A;  4DDI D;  4RFB A;  2KMA A;  3APF A;  3ONS A;  2KMC A;  2KOX A;  1VZ7 A;  3AUL A;  4E74 A;  1GG3 A;  1JWB D;  3Q2A C;  1WY8 A;  2KFJ A;  1GC7 A;  1GNU A;  2K8B A;  4AP4 C;  1KLV A;  1C76 A;  4W9E A;  2WLB A;  4JLC A;  5AEK B;  2INN E;  2FUG 1;  3P42 A;  4S17 A;  4BKT A;  2C7N B;  4L23 A;  3UGB B;  1F9J A;  1WJ6 A;  1XCQ L;  2KAC A;  2LVP A;  3NVW A;  1PGX A;  2V0G A;  2LZ6 A;  3ZNG C;  2IO1 B;  1LXD A;  1GAQ B;  1JRU A;  3ABV B;  1TKY A;  2UYZ B;  2C9W B;  3MC0 B;  2K5P A;  4C80 A;  3ALB A;  4W9L A;  3LYY A;  4BBN C;  4XWW A;  1NI2 A;  3Q14 C;  2DYO A;  1JRO A;  5J17 A;  3NZU A;  4M0W A;  1EUV B;  1TBE A;  2JRI B;  2J52 A;  1KH0 A;  4DWF A;  1R4N I;  1FNV A;  2WDT B;  3SR6 A;  4REZ A;  2MX2 A;  4KKI A;  2AYO B;  3R8B A;  1FRD A;  4IUM B;  4LNF A;  1T0R C;  4C7Y A;  1FIQ A;  1N5X A;  2O2V A;  2MBQ A;  2V1Y A;  3HUI A;  1CJE A;  3TUO A;  4AS1 A;  2V3S A;  1C1Y B;  3BIN A;  3A9J B;  3UQB A;  1UBI A;  3HVD A;  3KYC D;  1D5M C;  2QJL A;  3OJ4 B;  2L52 A;  3U8Z A;  2Y3A A;  5L83 A;  2D3G A;  4DHZ E;  1V5O A;  2FIF A;  4HPM B;  4XE0 A;  3ZDT A;  1KLU D;  2L3Z A;  3BK2 A;  3P4R B;  1RM6 C;  2K39 A;  2N9E B;  2KD0 A;  5EE1 A;  2SEB D;  4ITK A;  4D2K A;  3L08 A;  5CHV C;  4GB9 A;  3DVG X;  4XWT A;  3AE3 B;  1Q1O A;  1WYW B;  3H7S A;  3DVN U;  3M3J A;  2ZJD A;  2WQY B;  2KVR A;  2BTE A;  2ONQ A;  1FCC C;  4M0W B;  2WS3 B;  4GDL A;  2PE9 A;  1P7E A;  1T5X D;  1F0Z A;  3ZO5 B;  2V9H A;  3MC9 A;  4MGK E;  3Q6B A;  1NI3 A;  2AL3 A;  2WNM A;  2KDE B;  2LI5 A;  4YXD B;  3C19 A;  4HJG E;  1JWM D;  1V6E A;  1ENF A;  2G9H D;  5DPW A;  4JWS C;  4EKU A;  1ZDV A;  4OZB A;  3RYT A;  2KXJ A;  1I4X A;  2WGS A;  3R2I A;  1DGJ A;  2NPT B;  1FD6 A;  3V05 A;  4NJ6 A;  2XK5 A;  4K3B A;  4TQ0 A;  4YSY B;  3IVF A;  2QHO A;  3PRP B;  1WXM A;  3PO0 A;  4KGR A;  2N0S B;  3L0W B;  3NRZ A;  4GGQ A;  4IM2 A;  2L05 A;  1YIW A;  1HTO A;  1L5P A;  3TIX A;  3AU5 A;  4WAA A;  2JSV X;  2Q5W D;  2N1V A;  3RUL A;  3PZD A;  1C77 A;  1TJE A;  4PS8 A;  2VH1 A;  1ZOY B;  2QIL A;  2YEP B;  3EFU A;  1F52 A;  4N59 A;  4A6Q A;  1V9J A;  1UGJ A;  1LM8 B;  3HHM A;  2RDG A;  3JVZ X;  1EM7 A;  3VDZ A;  5JH5 C;  3DVG Y;  1TIF A;  4ARI A;  4RMA A;  3Q8E A;  5D3I B;  2GBM A;  1C79 A;  2HTH A;  2KDB A;  2KNB A;  2L7R A;  1FFV A;  2LGY A;  3RNC C;  1SIF A;  2W3R A;  4G3X B;  3TEZ A;  3QJZ A;  5E6P A;  1I4P A;  3AE2 B;  3EEC A;  3RD2 A;  2KWC A;  5BMG A;  3VH3 B;  2L8J A;  2VZK B;  1VDV A;  1WRI A;  1FPY A;  3Q8A A;  1PQS A;  3Q8F A;  4KSK C;  4EEW A;  5G2N A;  3V6C B;  1ZKH A;  2BYT A;  4ZRI A;  3NVV A;  1PDX A;  3VFK A;  1T0S C;  5HG2 A;  1TS3 A;  3UIO B;  4OVV A;  3DCG A;  3MC8 A;  5H8Y E;  3P4S B;  4WWP A;  1YOV B;  1TY0 A;  4HDQ A;  2JXX A;  1YJI A;  1WWT A;  2Z0E B;  4HDO A;  4JWU C;  2L1A A;  4W9H A;  4YTN B;  3IAS 1;  3SU8 X;  1E0Z A;  2MJE A;  2N1W A;  2BPS A;  5CTR C;  2JRH A;  2BYF A;  1RLF A;  1KLG D;  1WI0 A;  1WXS A;  2DZM A;  4OZA A;  1KF6 B;  2KAJ A;  1NYR A;  5LXI B;  1F77 A;  1WRD B;  2JY6 A;  4LJP B;  3QQ8 B;  2ZVO A;  4GMV A;  2ZCC A;  2IDY A;  2NTT A;  3ZRC A;  3PSE B;  4G11 A;  1J8C A;  2QDF A;  3MHZ A;  4ZRJ A;  3I57 A;  2J53 A;  2BYV E;  3SHQ A;  2N4F A;  2OHF A;  2JWZ A;  1F1H A;  1UF0 A;  1MFW A;  3ZKJ C;  3PZ8 A;  1N63 A;  2DAJ A;  4ZDV A;  4JPS A;  1FRR A;  2ZPN A;  2WYQ A;  1QQR A;  1SIJ A;  1HZ6 A;  1MG8 A;  1PUT A;  3LXF A;  5CX3 A;  3ENE A;  4C56 C;  1E5W A;  1WGR A;  1JRP A;  2LFI A;  1VRA B;  3ECI A;  4NZL B;  1SE3 A;  3HVZ A;  4XC2 A;  3ZNZ B;  1Y56 A;  2KWU B;  2ZCB A;  3B2G A;  4WAF A;  4OVZ A;  4FJY A;  2KDM A;  4A9A A;  2NTS A;  2K9X A;  4P1C C;  1KJT A;  4DBG A;  1FXT B;  1OGW A;  2QMT A;  3QA8 A;  1TTN A;  5JHB A;  2EKI A;  3RFZ B;  2I2Y A;  2WXO A;  4QAY A;  2ZW1 A;  3KH0 A;  1P3Q U;  1YQ3 B;  2NBU A;  5IP4 D;  2NBV B;  3KUD B;  4BKS A;  2JX5 A;  1BML C;  2BS4 B;  1HTQ A;  3VUW A;  2DZK A;  3HM6 X;  1XLP A;  4E3C A;  3ZJT A;  2LVO A;  4EZJ A;  3QAR A;  5D94 A;  2NR2 A;  1STE A;  2KJH B;  2MBO A;  4M8N A;  4XZ4 A;  3JSV A;  3I5J C;  1HEZ E;  1U4A A;  3DBH I;  3ZNI D;  2D3A A;  3AE5 B;  2AQ1 B;  1H4R A;  1V97 A;  2O6V D;  5CHF A;  2DX5 B;  4KKJ A;  4PYU A;  4EFO A;  4MSM B;  4TQ1 A;  2DZI A;  2JPH A;  2WU5 B;  4ZYS A;  4HWI B;  2MCN B;  2JWU A;  1QOG A;  1FO4 A;  3W1Y A;  1E6E B;  5FR6 A;  4DXF A;  1V80 A;  2KFK A;  4ZYN A;  2CU3 A;  2DBY A;  2CS4 A;  1RFA A;  3KW5 B;  4G0N B;  1WE6 A;  2IO0 B;  5HI1 A;  1VZ6 A;  1A5R A;  5BYS A;  1ZPS A;  1DOX A;  1C9F A;  4DHJ D;  1K50 A;  2PMV A;  4HK2 A;  5DPR A;  5JZE B;  3AE1 B;  4OZC A;  5FK9 C;  1GB4 A;  2KN5 A;  3KYD D;  1D5X C;  2HTM E;  1EU3 A;  3EC8 A;  4GXB A;  3ETR A;  1TZ1 A;  3Q3O C;  2W9N A;  2IY0 B;  3P2B A;  2LJI A;  2GRI A;  1NYQ A;  1LFD A;  1NDD A;  3U30 A;  2IPK D;  1YNT E;  3VQI A;  4AUQ C;  2RSU A;  4LCD E;  2LVQ A;  4BAX A;  1E8Y A;  1TS4 A;  4HEA 1;  3PV1 A;  4ANW A;  1V2Y A;  1WM3 A;  1TKG A;  1AWD A;  3RNG C;  3AEG B;  4C7Z A;  4JX1 C;  3W1S C;  3JSV B;  4E71 A;  3NG0 A;  3NVZ A;  2JT4 B;  4WH4 A;  1PFD A;  2EMT A;  1XCT L;  2M0X A;  2BWF A;  4N6E B;  4M01 A;  1I4Q A;  3VAW A;  1JML A;  2WP9 B;  2MBE A;  2BKR B;  4W9D A;  2BQQ A;  1ET6 A;  4NJ7 A;  1K52 A;  1ISN A;  2FUH B;  4OHJ A;  3W1S A;  4ANX A;  2FNJ B;  1NVI D;  2GBN A;  3A9J A;  2CHX A;  2KDF B;  1JWS D;  2WXP A;  2PKO A;  4NQL B;  4KGT A;  1JAL A;  1QT9 A;  4KV2 A;  4EZK A;  4YT0 B;  5C23 A;  2IYD B;  2MSE D;  3Q3N C;  1HXY D;  2M4N A;  3J9C A;  1LQB A;  3VH4 B;  4FUL A;  1EWY C;  3A1Q B;  3IT6 B;  4WJN A;  3R7Q A;  1MJD A;  5I4D A;  1YQ4 B;  3DBL I;  4FN2 A;  4K1R B;  3D32 A;  1A70 A;  1ZXH A;  2QEJ C;  2C7H A;  3NS8 A;  3UIN B;  2DYB A;  3AH7 A;  1TYG B;  1WJU A;  3EUB 2;  1WZ0 A;  3Q3F A;  2WU2 B;  3BVM A;  2KTF A;  3I3T B;  1YN4 A;  1D3Z A;  1R4M B;  2WXK A;  1JW9 D;  3WAN A;  1YX5 B;  1EF5 A;  4FHK A;  4N58 A;  1YMH E;  3A9K A;  3NS1 A;  4OVU A;  1HA5 A;  2L32 A;  1IUE A;  3DBS A;  3TCA A;  4A8X C;  4KGS A;  1WX7 A;  3ZJV A;  3ZYY X;  1E8W A;  2FID A;  2GB1 A;  2WXH A;  1EWC A;  1QF6 A;  3QCA A;  3UIP B;  1P98 A;  4IWQ A;  1WGY A;  2LGS A;  3RI7 C;  4HKZ E;  5T8I A;  3TEX A;  4LK0 M;  1WJN A;  4WQO B;  4XDD A;  1ESF A;  1XXG A;  4KX6 B;  4OW0 A;  4PYZ A;  2NPT A;  2QIE B;  4LNK A;  5TR5 A;  1V1P B;  2FCQ A;  5C1Z A;  2REX A;  4II2 B;  3ZJU A;  4HRS A;  3HRD D;  3DVN V;  1SJH D;  3AEA B;  1WXV A;  1NEN B;  5EE0 A;  1L0X B;  5KHO A;  3N9Y C;  2G4D B;  4FXC A;  4WWN A;  4W9J A;  3NY5 A;  1T0Y A;  1HE8 A;  3DHI C;  3H1U A;  1V1O A;  2D3C A;  2LJ5 A;  4HPL B;  1P0R A;  1DOI A;  1E9M A;  3NOB A;  3N1X C;  4A90 A;  3ZDM C;  1GJZ A;  3PS6 A;  1RYJ A;  5LLI A;  4RGT A;  2K6D B;  1R4N B;  2KKC A;  4US8 A;  3IFW B;  2WXN A;  3A9K B;  1G6J A;  2AQ2 B;  4EUT A;  4AJW A;  3SFD B;  3VTU A;  3UI3 A;  4HLE A;  1I42 A;  1X1M A;  4ZHO A;  4IWP A;  2QC8 A;  1WH3 A;  4MGI E;  1CMX B;  2IGD A;  4BFR A;  3AE7 B;  4GN1 A;  3V6E B;  4NAM A;  1OEY A;  4HVB A;  3AU4 A;  4W9F A;  2KZR A;  1YQB A;  3ZQ4 A;  5D2M B;  2J0K A;  4BOZ B;  1FMA D;  2GBR A;  4P6V F;  4YTM B;  2CKH B;  5E6O A;  3KLS X;  1IGD A;  5EE9 A;  3AB5 A;  2MBB B;  1R7S A;  1T3Q A;  5C3J B;  2V4L A;  2O6V B;  3VUX A;  3W5V B;  3PTF C;  4HXD A;  4NAW B;  1WGG A;  1UD7 A;  4KSL C;  4DK5 A;  2J0M A;  4B6W A;  4EE2 A;  5JHA A;  1WX8 A;  2D07 B;  2CJO A;  3DWM A;  4IM3 A;  3V60 A;  1XLN A;  2W54 A;  1WF9 A;  4ICU A;  2DZJ A;  3U7D A;  4NPN A;  2KAN A;  1C4P A;  2Z59 B;  1EO6 A;  3UQA A;  2RR9 A;  1DYQ A;  1S1Q B;  1WGH A;  4P7I A;  3AE9 B;  4GIV A;  2H88 B;  3HM3 A;  4J6I A;  4YTP B;  3Q69 A;  4KZC A;  3TL5 A;  4MEL A;  5BYR A;  3QC8 B;  3PT2 B;  2BW2 A;  1SBB B;  1SGH A;  4B9K A;  3M62 B;  1K51 A;  5BO4 B;  3R3M A;  3L54 A;  2QSD A;  1IPG A;  1YN5 A;  4JE3 B;  4ZRK A;  3TEW A;  1L4Z B;  1WIA A;  2KWV B;  2PE6 B;  2BBC A;  3VHT C;  1SE4 A;  3EHV A;  2HDE A;  1FEH A;  5DPS A;  4FBJ B;  1Y8R C;  4O1N A;  1J0G A;  3AEE B;  2ZW0 A;  4LDT D;  1OTR B;  4MT5 A;  1UUP A;  5D7G A;  3I63 C;  1MI0 A;  1XT9 B;  4MEM A;  4F1S A;  3NHE B;  2B76 B;  2WWZ A;  3TEY A;  3NUH B;  1L6U A;  2IGG A;  4K81 A;  2K22 A;  4GDK B;  1ZDX A;  4B95 A;  1RRB A;  3DQV A;  4LNI A;  2RDB C;  1IYF A;  2LGD A;  2KJR A;  3OLM D;  3AV8 A;  4I6P A;  1L7Y A;  2NCN A;  3MJW A;  3IAM 1;  1GC6 A;  1UWM A;  3RUI B;  2DEN B;  3BWU D;  2C7M B;  4X57 B;  2TSS A;  2A4Z A;  2ZZP B;  4YL8 A;  2J4X A;  2KYW A;  2PW9 A;  3AE8 B;  3ZLZ A;  3FAH A;  4MH0 E;  3PPA A;  3AEC B;  3FIL B;  1KOT A;  1WJ4 A;  1WXA A;  5IA7 A;  2DNF A;  1XLO A;  5FKA C;  2CJN A;  1GUA B;  2JF5 A;  3EGR A;  3GP7 A;  2JZ3 B;  1ET9 A;  3C8Y A;  2IO3 B;  3N1Z C;  4KDI C;  2IJ0 A;  2W55 A;  1AN8 A;  4MJS B;  4M8M A;  3Q8B A;  1VD2 A;  3VVW B;  2GLS A;  3KUZ A;  2NMQ A;  2JZZ A;  2WX1 A;  2J7Q B;  4KDL B;  3K9O B;  2MQJ A;  3EA6 A;  5IKC M;  3L17 A;  3WAM A;  1KTK A;  4YWG G;  3R66 C;  3LJ3 A;  2N7E A;  4A3P A;  4ZRP A;  4NNJ B;  1ACC A;  2C5L C;  1E8X A;  2RDH A;  2KX3 A;  2YVC A;  1SB3 C;  2BB5 A;  2BF8 B;  3H8H A;  4JGH B;  3N32 A;  3BY4 B;  2H89 B;  1XD3 B;  2I1J A;  1QOF A;  4L1B A;  3NZ3 A;  3DOW A;  3DDC B;  2NBW B;  1WZ3 A;  3IXS A;  1OQR A;  3V3X A;  1FXI A;  1I4G A;  3AEB B;  1L0Y B;  3R7R A;  3U7Z A;  3PVL A;  3RPF C;  2VH2 A;  1OFF A;  3GOE A;  3M95 A;  2PPH A;  2Y5C A;  2BKF A;  3IBE A;  2INP E;  3VR9 B;  2WDR B;  2BS2 B;  3DHH C;  2GBJ A;  4IG7 B;  2LMC A;  4KIK B;  1Z5S B;  2Z8L A;  1L6V A;  2UU7 A;  2VRR B;  1BT0 A;  2JYT A;  4PS3 A;  1T0Q C;  2MEK A;  4HCP B;  3V61 A;  5IO9 A;  1C4A A;  2GBK A;  2AL6 A;  1JWA D;  4W9I A;  3K9P B;  2KC2 A;  3TMP B;  2M19 A;  2OOB B;  3QHT A;  4F8C B;  2KN4 A;  5G5H A;  2L00 B;  2LRW A;  1WGK A;  3HIZ A;  2J42 A;  3A1Q A;  3P4P B;  2WXM A;  1FM0 D;  1MG4 A;  1QKZ A;  3NJT A;  3VTW A;  2CU1 A;  1E90 A;  2KDI A;  3O65 B;  2WX0 A;  1FFU A;  3JYU A;  3BYY B;  3DBR I;  4F7Z A;  1XLQ A;  2KLC A;  1MVK A;  3VTV A;  1JWU D;  3KWL A;  3X23 A;  3RMK C;  3ZGZ A;  2LGX A;  4NQK E;  5AUK A;  3DBH B;  4I6L B;  2JZP A;  2N9X A;  3X0W A;  3BK1 A;  3CMM B;  3BYT B;  4K7W A;  2M8S A;  2VZK D;  1Q5W B;  3PLU A;  3N1Y C;  3AEF B;  3MJ5 A;  2YLM A;  2BVC A;  1ZP0 B;  1IBX B;  1SE2 A;  4FJV B;  4TUU A;  5HHD G;  1MHX A;  1LGR A;  4WJO A;  2JYE A;  4H2A A;  2KVZ A;  1TT5 B;  1K53 A;  2KC1 A;  2GMI C;  2AX5 A;  1JQ4 A;  2MRP A;  3ZUN A;  1F2R I;  2LXC A;  3PHX B;  1WXQ A;  3QX1 A;  4FJZ A;  4BBN F;  1I35 A;  3DBR B;  3B1L X;  3HK0 A;  1CK1 A;  5C2T B;  3WA0 A;  1V1P A;  4BKG A;  2WXF A;  4XDC A;  1UBQ A;  1WM2 A;  2K8H A;  3B08 A;  2WXG A;  3FKY A;  3KVF B;  1V86 A;  2LD9 A;  4RGO S;  2KX0 A;  3ML8 A;  2D3B A;  1D4B A;  1ZUD 2;  1J7B A;  1P9D U;  4AOF A;  2MBH A;  4B0M A;  1UZX B;  1UGM A;  2I38 A;  1SEB D;  1FNU A;  2ACZ B;  3BVZ A;  2WDQ B;  4P1B C;  3OJ3 A;  5DPT A;  1D6E C;  2YEP F;  1P1A A;  2JXT A;  2BB6 A;  5BYQ A;  1E7U A;  1V49 A;  2K3U A;  1YD8 U;  4LDT B;  1WMH B;  1TGZ B;  3N30 A;  4M00 A;  3PRZ A;  2WXJ A;  1N60 A;  1ZW7 A;  3VR8 B;  3AI5 A;  2KT7 A;  4WJP A;  2LWP A;  5J2R A;  1VLB A;  3NVY A;  1TZO A;  4GOC A;  2KK8 A;  5J18 A;  3APD A;  2N9L A;  1I4H A;  3L13 A;  1WGD A;  1ZXI A;  3AXC A;  2W3S A;  4KVG B;  2L83 A;  4CO7 A;  5IAA C;  2LUM A;  3GE3 C;  1YX6 B;  2HE7 A;  3DHG C;  4A55 A;  3DBL B;  4WJQ A;  3T3N A;  2ZNV C;  4FAD A;  4DQO C;  2G3Q B;  4RH6 A;  2X8X X;  2IZV B;  4IWO A;  3E9S A;  1QZE A;  2K6Q A;  1QLB B;  1E7V A;  1C3T A;  4GLS C;  1Q10 A;  4GSW A;  1RAX A;  2M1M A;  1CZP A;  1I4R A;  3AM9 A;  1E10 A;  3SDL C;  3ZNH B;  5E6N A;  5CHW A;  1VR9 A;  4HJK A;  1IGC A;  3CIR B;  2WXQ A;  4L2Y A;  2O6V A;  2MWS B;  3UF8 A;  1GPX A;  3BVG A;  4W9K A;  3OAW A;  4NAW A;  5EDS A;  4ANU A;  2I1K A;  2K0P A;  2GOW A;  2WXR A;  3PGE A;  3AMZ A;  1ZE3 D;  2BYE A;  3LB8 C;  1XO3 A;  4IC7 B;  5LNK 1;  4DHZ B;  4IOI E;  1B9R A;  3OG5 A;  2A5U A;  3RCZ A;  3ZVV A;  5BMH A;  2FCM A;  2CHZ A;  3VRA B;  3A4S C;  3P63 A;  2MW5 A;  3QWZ B;  5DCN A;  2M0A A;  2MHJ A;  1CQV A;  4TV3 A;  2BGF A;  5GXG B;  2AQ3 B;  2BS3 B;  1BXT A;  1QOB A;  4NJC A;  1XF5 L;  1AW7 A;  2K25 A;  3WCQ A;  1IP9 A;  4A20 A;  2L0F A;  1WE7 A;  3PRM B;  3CSF A;  4B0E A;  4GU2 A;  1J7C A;  2KTR A;  3MTN B;  3U52 E;  4YSX B;  4W9C A;  2L76 A;  2LAS A;  5BMI A;  3C0R B;  4BVU C;  2XNA C;  4PT5 A;  4LTU A;  3IHP C;  1FXA A;  2R2O A;  4MAC A;  2ICI A;  3RNE C;  1VZ8 A;  3EFC A;  1L0V B;  2MH7 A;  4DXG A;  2Z0D B;  5LXH A;  4GDK A;  4IW0 A;  4UDU C;  3H7P A;  3GS2 A;  5H92 C;  2O2V B;  2ZPY A;  4BKS D;  2OJW A;  4HKQ A;  2QCZ A;  2ZNV B;  3W9C B;  1MHH E;  3QAQ A;  2FBW B;  3WIM A;  1V5T A;  2D11 A;  2EEL A;  1NEK B;  1K8R B; 
#chains in the Genus database with same CATH homology
 4BOS C;  1EUV B;  1TBE A;  2JRI B;  1VD2 A;  3VVW B;  3KUZ A;  3EC8 A;  2LRU A;  2JZZ A;  2WX1 A;  4GXB A;  2FCS A;  1TZ1 A;  2J7Q B;  4FHJ A;  2W9N A;  2IY0 B;  4KDL B;  3P2B A;  4CHK A;  4DWF A;  4RM8 A;  1R4N I;  2WDT B;  3K9O B;  2MQJ A;  2MX2 A;  2AYO B;  3JW0 X;  1LFD A;  1NDD A;  3U30 A;  4FA6 A;  3L17 A;  4IUM B;  5GMV A;  3VQI A;  3WAM A;  4AUQ C;  2RSU A;  3DPD A;  4CYE A;  4DHJ B;  4LCD E;  2LVQ A;  3A33 B;  2O2V A;  3R66 C;  3LJ3 A;  2N7E A;  2MBQ A;  2V1Y A;  4A3P A;  2C60 A;  1E8Y A;  3SD5 A;  3CST A;  4NNJ B;  3PV1 A;  2V3S A;  4ANW A;  1V2Y A;  1WM3 A;  5HKH A;  1C1Y B;  3BIN A;  3A9J B;  2C5L C;  2D10 A;  3WAP A;  3UQB A;  2AEH A;  1E8X A;  2KX3 A;  3W1S C;  1UBI A;  2IBI B;  3KYC D;  3JSV B;  3B0A A;  2YVC A;  3H9D A;  2BF8 B;  3OJ4 B;  3QK0 A;  4JGH B;  3RT3 B;  2R2Q A;  3U8Z A;  4E71 A;  4MJS A;  3T9L A;  5L83 A;  2D3G A;  2JT4 B;  2KTR B;  3N32 A;  4DHZ E;  2EMT A;  3BY4 B;  1V5O A;  2FIF A;  4HPM B;  2M0X A;  2G45 B;  2BWF A;  1XD3 B;  2I1J A;  3ZDT A;  3RZF A;  2ZVN A;  2L3Z A;  4FLH A;  1OQY A;  1WFY A;  3DOW A;  4GDL B;  3ZIM A;  2LUE A;  3DDC B;  3VAW A;  1AAR A;  2NBW B;  5D6J B;  1L2N A;  1WZ3 A;  2K39 A;  2N9E B;  2MBE A;  2KD0 A;  2BKR B;  4W9D A;  1WR6 E;  2CR5 A;  2BWE S;  3R7R A;  3PVL A;  4NJ7 A;  3L08 A;  1ISN A;  2FUH B;  3W1S A;  5CHV C;  4GB9 A;  3GOE A;  4ANX A;  2FNJ B;  3DVG X;  2GBN A;  3M95 A;  2PPH A;  2BKF A;  3IBE A;  5AZF A;  3A9J A;  2CHX A;  3Q3J A;  2KDF B;  1ZGU B;  3H7P B;  4NQL B;  4IM0 A;  1Q1O A;  4KV2 A;  4EZK A;  4MGY E;  5C23 A;  2IYD B;  2MSE D;  2GBJ A;  4IG7 B;  4KIK B;  4EOY A;  1WYW B;  2M4N A;  1Z5S B;  3H7S A;  2IY1 B;  1LQB A;  3DVN U;  3VH4 B;  4FUL A;  3M3J A;  3A1Q B;  2XK5 B;  2ZJD A;  2VRR B;  4WJN A;  3R7Q A;  3T8M A;  2KVR A;  3DBL I;  4M8M A;  4FN2 A;  4DXA B;  4K1R B;  1BT0 A;  3V62 A;  3D32 A;  4M0W B;  4GDL A;  4PS3 A;  2N7D A;  2PE9 A;  4HCP B;  3V61 A;  4EZL A;  5G55 A;  3ZO5 B;  4MGK E;  2KJ6 A;  2GBK A;  2AL6 A;  2DAF A;  2C7H A;  2AL3 A;  3NS8 A;  2KDE B;  4W9I A;  2LI5 A;  3PHW B;  3K9P B;  4K7S A;  3UIN B;  1V6E A;  2DYB A;  2KQS A;  2KC2 A;  3TMP B;  2OOB B;  5DPW A;  3QHT A;  2JVC A;  4F8C B;  1WJU A;  2L00 B;  1WZ0 A;  3Q3F A;  2LRW A;  4EKU A;  2KTF A;  3I3T B;  3RYT A;  1D3Z A;  2KXJ A;  4KZ0 A;  5L95 C;  3WAN A;  1YX5 B;  1EF5 A;  4FHK A;  4KIK A;  3HIZ A;  2NPT B;  3A9K A;  4OVU A;  3A1Q A;  4NJ6 A;  2XK5 A;  4TQ0 A;  4LJO B;  1E8Z A;  1EF1 A;  3IVF A;  2EMS A;  2FAZ A;  2QHO A;  3VTW A;  2OJR A;  3PRP B;  3TJP A;  1WXM A;  3DBS A;  4MM3 A;  3TCA A;  3L0W B;  2CU1 A;  1E90 A;  1WX7 A;  2KDI A;  2WX0 A;  3O65 B;  3JYU A;  4GGQ A;  4IM2 A;  2L05 A;  2FID A;  1E8W A;  1YIW A;  3DBR I;  4F7Z A;  4K7U A;  2KLC A;  3QCA A;  3VTV A;  3UIP B;  3IG3 A;  1P98 A;  3X23 A;  3ML9 A;  4IWQ A;  3TIX A;  3AU5 A;  1WGY A;  4WAA A;  2N1V A;  4JQW C;  3RUL A;  2LGX A;  3PZD A;  4NQK E;  4PS8 A;  1VCB A;  4I6L B;  4A3O A;  2N9X A;  3EFU A;  2XBB C;  3X0W A;  3A4R A;  1WJN A;  4WQO B;  3CMM B;  1V9J A;  2N9P C;  4K7W A;  4MGZ E;  3PLV A;  1LM8 B;  3HHM A;  3JVZ X;  5JH5 C;  3VDZ A;  4PYZ A;  2NPT A;  2M8S A;  3DVG Y;  5TR5 A;  1Q5W B;  3PLU A;  2KQ7 A;  4RMA A;  3WAL A;  2FCQ A;  3GZN I;  2GBM A;  3S2A A;  2L0T A;  2ASQ A;  5C1Z A;  2REX A;  4II2 B;  2YLM A;  3DVN V;  2M17 A;  2HTH A;  2KDB A;  2KNB A;  2L7R A;  2PJH A;  4FJV B;  4MSQ B;  4TUU A;  1WXV A;  1WX9 A;  2LGY A;  2IO2 B;  1SIF A;  5KHO A;  2G4D B;  4G3X B;  4WJO A;  4W9G A;  3QJZ A;  2LXA A;  4ANV A;  5E6P A;  2KLG A;  4WWN A;  3RZW C;  2RPQ A;  2KC1 A;  3EEC A;  4W9J A;  1NBF C;  2GMI C;  3NY5 A;  3RD2 A;  2KWC A;  3VH3 B;  2MRP A;  2L8J A;  1T0Y A;  1HE8 A;  3ZUN A;  3ZTD A;  3QIJ A;  2LXC A;  4N9F 4;  3H1U A;  2NVU I;  3PHX B;  2LJ5 A;  4HPL B;  3QX1 A;  4FJZ A;  1P0R A;  1PQS A;  4KSK C;  3NOB A;  2K1F A;  4BBN F;  4EEW A;  5G2N A;  3V6C B;  1I35 A;  3ZDM C;  1ZKH A;  1GJZ A;  3B1L X;  3ZTC A;  3HK0 A;  3PS6 A;  4ZRI A;  5LLI A;  3WA0 A;  4BKG A;  3KUC B;  3VFK A;  3M63 B;  3PRE A;  1UBQ A;  1WM2 A;  2K8H A;  3B08 A;  2K6D B;  3KVF B;  2KKC A;  1V86 A;  4AJY B;  2LD9 A;  3IFW B;  4OVV A;  3UIO B;  3DCG A;  3A9K B;  1G6J A;  3MHS D;  4EUT A;  2KX0 A;  4AJW A;  3VTU A;  3ML8 A;  4WWP A;  4HLE A;  1I42 A;  1X1M A;  4HDQ A;  4IWP A;  3VXW A;  2DHZ A;  1P9D U;  4AOF A;  2MBH A;  2JXX A;  1WH3 A;  2Z0E B;  3NZS A;  4HDO A;  3TBL D;  4MGI E;  1UZX B;  1UGM A;  4W9H A;  2KHW B;  1SE9 A;  3SU8 X;  1CMX B;  2N1W A;  4ASW C;  3H6N A;  2BPS A;  4BFR A;  3OJ3 A;  5CTR C;  5DPT A;  4GN1 A;  1P1A A;  2JRH A;  3LDZ E;  3V6E B;  1OEY A;  4HVB A;  3VUY A;  1E7U A;  3AU4 A;  2BYF A;  2KZR A;  1YQB A;  4W9F A;  1V49 A;  1YJ1 A;  1YD8 U;  1RLF A;  4LDT B;  2DZM A;  1WI0 A;  1WXS A;  1WMH B;  4G50 A;  1TGZ B;  4JL9 A;  5D2M B;  2B3A A;  3N30 A;  3PRZ A;  2J0K A;  5LXI B;  1Q0W B;  4BOZ B;  1WRD B;  2JY6 A;  1ZW7 A;  4LJP B;  1XQQ A;  2GBR A;  3AI5 A;  3APC A;  4PS7 A;  3QQ8 B;  2ZVO A;  2CKH B;  4WJP A;  2LWP A;  4GMV A;  5J2R A;  5AZG A;  2ZCC A;  4GOC A;  5E6O A;  3ZW3 A;  2KK8 A;  4NY0 A;  3ZRC A;  3PSE B;  4G11 A;  1J8C A;  2K8C A;  2J0J A;  3ZRF A;  2G4S A;  2MP2 A;  2MBB B;  4ZRJ A;  5J18 A;  4XX5 A;  3APD A;  4DDG D;  2BYV E;  2V4L A;  1UEL A;  3SHQ A;  2O6V B;  3VUX A;  3CF6 E;  2N4F A;  3L13 A;  1WGD A;  2JWZ A;  3PTF C;  4HXD A;  2Y5B B;  3AXC A;  4NAW B;  1WGG A;  4KVG B;  1UD7 A;  3ZKJ C;  1KM7 A;  4KSL C;  4CO7 A;  5IAA C;  4DK5 A;  2J0M A;  4B6W A;  2DAJ A;  5JHA A;  1WX8 A;  2D07 B;  1YX6 B;  2HE7 A;  4IM3 A;  3V60 A;  4ZDV A;  1M94 A;  1WMH A;  2RGF A;  3WAO A;  1UH6 A;  1WF9 A;  5KHQ A;  2ZPN A;  2WYQ A;  2MA9 B;  2NS5 A;  4HCN B;  4ICU A;  4WJQ A;  2ZNV C;  4FAD A;  2G3Q B;  2DZJ A;  3U7D A;  1MG8 A;  2IZV B;  4NPN A;  2KAN A;  4IWO A;  2Z59 B;  4I6N B;  5CX3 A;  3ENE A;  1QZE A;  1Z2M A;  2K6Q A;  4AWJ A;  1E5W A;  2EKE C;  2RD0 A;  2CHW A;  1WGR A;  2JUO A;  1EO6 A;  1E7V A;  1C3T A;  3ECI A;  3UQA A;  2RR9 A;  4GSW A;  1RAX A;  2UWQ A;  2HJ8 A;  1S1Q B;  2M1M A;  1WGH A;  4P7I A;  2HD5 B;  4XC2 A;  5CHW A;  5E6N A;  3SDL C;  3ZNZ B;  3ZNH B;  2KWU B;  4HJK A;  2ZCB A;  4GIV A;  2O6V A;  2MWS B;  3UF8 A;  3HM3 A;  4J6I A;  4FJY A;  4KZC A;  4W9K A;  4MDK E;  3TL5 A;  1WR1 A;  3OAW A;  4MEL A;  4NAW A;  5EDS A;  4ANU A;  2XEW A;  2I1K A;  2KO3 A;  2MLB A;  2GOW A;  3PT2 B;  3QC8 B;  3PGE A;  1KJT A;  1SGH A;  2BYE A;  4B9K A;  4DBG A;  1FXT B;  1OGW A;  3M62 B;  3N3K B;  4II3 B;  3QA8 A;  2DYM A;  1TTN A;  4IC7 B;  3L10 B;  4RM9 A;  5BO4 B;  3R3M A;  4URK A;  5JHB A;  4DHZ B;  2A5U A;  3L54 A;  1IPG A;  1S3S G;  2D2Q A;  2PEA A;  3KH0 A;  3RCZ A;  4ZRK A;  3ZVV A;  1WIA A;  1P3Q U;  2KWV B;  2PE6 B;  2AWT A;  2FCM A;  2CHZ A;  2ZEQ A;  3VHT C;  2NBU A;  2NBV B;  3KUD B;  3A4S C;  3EHV A;  1H8C A;  1R4M I;  4TKN A;  2MW5 A;  4ICV A;  5DPS A;  4BKS A;  4FBJ B;  1OEY J;  1Y8R C;  3QWZ B;  1J0G A;  5DCN A;  3L16 A;  4LDT D;  1OTR B;  1V81 A;  5D7G A;  1XT9 B;  1J19 A;  3VUW A;  2DZK A;  4MEM A;  4F1S A;  3HM6 X;  4TV3 A;  3NHE B;  2WWZ A;  4E3C A;  2LVO A;  2BGF A;  2KFK B;  2MP2 B;  4EZJ A;  4JIO U;  4WWO A;  4K81 A;  3QAR A;  2FCN A;  2NR2 A;  5D94 A;  5AZH A;  4DDI D;  4GDK B;  2KJH B;  2K25 A;  1RRB A;  4B95 A;  1IP9 A;  3DQV A;  2KMA A;  2MBO A;  4M8N A;  3APF A;  3ONS A;  4XZ4 A;  3JSV A;  2LGD A;  4A20 A;  2L0F A;  1IYF A;  2KJR A;  2KMC A;  2KOX A;  1WE7 A;  3OLM D;  3AUL A;  3CSF A;  3PRM B;  1U4A A;  3DBH I;  3ZNI D;  4E74 A;  4GU2 A;  2KTR A;  4I6P A;  1L7Y A;  2NCN A;  3MJW A;  1GG3 A;  1H4R A;  1GC6 A;  2O6V D;  5CHF A;  1WY8 A;  2KFJ A;  2DX5 B;  3MTN B;  1GC7 A;  3RUI B;  1GNU A;  2K8B A;  4AP4 C;  2DEN B;  1KLV A;  4PYU A;  2C7M B;  2L76 A;  4W9C A;  4EFO A;  4W9E A;  2LAS A;  4JLC A;  4MSM B;  3C0R B;  4TQ1 A;  4BVU C;  2DZI A;  4X57 B;  5AEK B;  2JPH A;  2A4Z A;  2ZZP B;  3IHP C;  4HWI B;  2R2O A;  2MCN B;  4YL8 A;  3W1Y A;  5FR6 A;  4BKT A;  2C7N B;  3UGB B;  1V80 A;  2KFK A;  3ZLZ A;  4ZYN A;  2Z0D B;  1F9J A;  2CS4 A;  1WJ6 A;  3PPA A;  4MH0 E;  5LXH A;  4GDK A;  2LVP A;  1RFA A;  3KW5 B;  2LZ6 A;  4G0N B;  4IW0 A;  3ZNG C;  2IO1 B;  3H7P A;  1WE6 A;  1LXD A;  2IO0 B;  2O2V B;  2ZPY A;  4BKS D;  1KOT A;  1JRU A;  1WJ4 A;  2UYZ B;  1WXA A;  2C9W B;  1A5R A;  2ZNV B;  3ALB A;  4W9L A;  5IA7 A;  3QAQ A;  4BBN C;  4DHJ D;  3WIM A;  1V5T A;  1GUA B;  2D11 A;  1NI2 A;  2JF5 A;  4HK2 A;  5DPR A;  5JZE B;  2DYO A;  2JZ3 B;  5J17 A;  3NZU A;  2IO3 B;  4KDI C;  1K8R B;  2KN5 A;  3KYD D;  4MJS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...