4CHKA

Crystal structure of the arf5 oligomerization domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
98
structure length
98
Chain Sequence
RTYTKVQKTGSVGRSIDVTSFKDYEELKSAIECMFGLEGLLTHPQSSGWKLVYVDYESDVLLVGDDPWEEFVGCVRCIRILSPTEVQQMSEEGMKLLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AUXIN RESPONSE FACTOR 5
publication title Structural Basis for Oligomerisation of Auxin Transcriptional Regulators
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transcription
total genus 27
structure length 98
sequence length 98
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4chkA00
2LVPA 3GZNI 3PV1A 3R7QA 3JYUA 4EZJA 3H1UA 3KVFB 1E8ZA 2MBQA 1V5TA 2MBEA 2L0TA 4IM3A 3SDLC 2IYDB 2JUOA 2V1YA 2G4SA 4KIKB 2AL3A 2ZCBA 3PHXB 4HPMB 5D94A 2MQJA 4F7ZA 1WM2A 3APCA 2KTRA 1E8WA 1WGRA 1Y8RC 3DVGX 3VUWA 2KHWB 4NJ7A 1GC7A 3RYTA 3DBHI 4TKNA 1E7VA 3DBRI 3EECA 2LGYA 2Z0DB 3L10B 5CX3A 2GBKA 1ZKHA 2FIDA 3CMMB 2O6VB 4NNJB 4GMVA 5CHFA 1IP9A 4KVGB 1LXDA 5D6JB 2MRPA 2MW5A 3DPDA 4P7IA 3ZTCA 2DZIA 2FNJB 2N4FA 2AWTA 3Q3JA 2DENB 3WAPA 1ZGUB 1F9JA 2KWVB 3SU8X 3VAWA 1JRUA 1WGGA 4FA6A 3ENEA 3ZKJC 2LJ5A 4KDLB 4X57B 4NPNA 5LXIB 1U4AA 4MM3A 1IPGA 1WJ6A 3ZIMA 1YX6B 2KX0A 2CS4A 4F8CB 4YL8A 3EC8A 3ZUNA 4B9KA 3ZNHB 4M8MA 4DDGD 4EEWA 3HK0A 2KWUB 3N30A 4GXBA 5J2RA 3APDA 2HD5B 2MLBA 3PRMB 3DDCB 3ZNID 1TZ1A 2KK8A 3UQAA 1V5OA 3DVNU 3QA8A 3QARA 4EZKA 1TBEA 1C1YB 3TCAA 2IO0B 3PPAA 4FLHA 1NDDA 2J0MA 1XD3B 4KSKC 1WJUA 2N7EA 4ANXA 2WX0A 5E6PA 5DPRA 2LGXA 2RR9A 4DHJD 3ZO5B 1RRBA 2QHOA 1YX5B 4ASWC 4JGHB 2PPHA 4IW0A 1E8XA 1E7UA 3KUZA 3KH0A 1LFDA 1OEYJ 4LJOB 2LXCA 4IUMB 4F1SA 1H4RA 4TUUA 4JL9A 1EUVB 2KX3A 5D7GA 2BWFA 4JIOU 3V6EB 2FCQA 2BKRB 3JW0X 2AYOB 3DVNV 2J0JA 2KLCA 2UWQA 4ZRIA 2KQ7A 2LRWA 2REXA 3LJ3A 2LWPA 3TMPB 1SIFA 3H7PB 1H8CA 4GDLA 4HK2A 1WZ3A 3M62B 2WYQA 2PE9A 2L7RA 1Q0WB 3PTFC 1VCBA 2CU1A 2LXAA 3PLUA 3RCZA 4MJSA 1WI0A 5J17A 4E74A 2IY0B 2I1JA 3DBSA 2L3ZA 1GJZA 2EMTA 2KJ6A 1AARA 4FULA 3NY5A 2N7DA 2K8CA 4KV2A 4KIKA 4LDTB 2KZRA 1SE9A 3ZNZB 3CF6E 2HTHA 4I6PA 4A3OA 4PYZA 4EOYA 3M95A 4KZ0A 2KLGA 2KMAA 3RULA 2VRRB 2YVCA 2KFKB 1WFYA 2RGFA 2FCSA 3QC8B 2M0XA 2V4LA 2O6VA 4CHKA 1WZ0A 5EDSA 3ALBA 4II2B 2KDFB 4W9DA 2KWCA 2FCNA 1KM7A 1WMHB 2JWZA 4MGIE 4ANUA 4BKSD 1UELA 3A4SC 4J6IA 4BKTA 1UBIA 3Q3FA 1L7YA 3MJWA 5TR5A 2JVCA 3DBLI 5J18A 2LI5A 1P3QU 3HM3A 3VH4B 4FJVB 3PVLA 1MG8A 3QX1A 1RLFA 1WJ4A 4JLCA 1NBFC 2K1FA 5CHWA 2M1MA 3PT2B 2Z59B 2B3AA 2CHWA 4MEMA 3W1SA 2L76A 3ZVVA 2ZNVB 2KANA 5AZHA 2JY6A 2CKHB 4GIVA 3U8ZA 5LXHA 2ZNVC 4W9FA 2ZPYA 3KYCD 3RD2A 2KO3A 2R2QA 2M17A 3QWZB 4KSLC 3PZDA 3ML8A 2MX2A 1D3ZA 1TGZB 1WR6E 3T8MA 1OGWA 3TL5A 1G6JA 1UZXB 3P2BA 5FR6A 3ZRFA 4IG7B 2IBIB 1UH6A 4K81A 4HXDA 2A4ZA 3OJ3A 4BVUC 3R3MA 2GBRA 2G3QB 1WF9A 1WJNA 2KJRA 2UYZB 4K1RB 2C7MB 3DVGY 2K6QA 3QQ8B 2HJ8A 2LD9A 4HDQA 4AUQC 4E3CA 2JRHA 1V86A 2LVOA 4FBJB 2MCNB 2RPQA 1CMXB 2V3SA 2KKCA 2ZZPB 4FHJA 4WWOA 1LM8B 2M4NA 4WWNA 3ZDMC 3LDZE 3H7PA 4GB9A 4WJQA 2BF8B 2ZJDA 3M3JA 1P9DU 3W1SC 4W9HA 4TQ1A 4M0WB 3M63B 2BPSA 4DDID 1WYWB 1I35A 3MTNB 2MSED 4GU2A 4AWJA 2G45B 2NBVB 2JZZA 1P0RA 2MWSB 3ECIA 4B6WA 3GOEA 4URKA 4ICUA 3PHWB 4WWPA 3AU4A 3VQIA 4G0NB 3HHMA 1XT9B 4DHZE 3APFA 2C7NB 3QK0A 5JZEB 3ONSA 4LDTD 3VUYA 4W9CA 3CSFA 4IM2A 1WXSA 1WXMA 1WGDA 2NBWB 3IVFA 3B1LX 3VVWB 2FCMA 2DYBA 4FADA 2KVRA 4W9IA 2DZMA 2JXXA 2NPTB 2XK5B 4W9EA 4HCPB 3VXWA 3N32A 2KC1A 2KFKA 3H6NA 2RSUA 2CR5A 2MBOA 1PQSA 4IWOA 1E8YA 2AL6A 4BKGA 2DX5B 3H7SA 3VTUA 2BGFA 2KOXA 3OLMD 4N9F4 5E6NA 4HWIB 1WGYA 1IYFA 5HKHA 1WMHA 3WALA 4DHZB 4EKUA 4AJWA 2D10A 4PYUA 3L54A 4AP4C 2JF5A 3UQBA 1V2YA 5C1ZA 4AJYB 2EKEC 1RFAA 2N1WA 3HM6X 4XC2A 4G3XB 3VHTC 5GMVA 2BWES 4LCDE 1J0GA 2JT4B 1YJ1A 1YD8U 5E6OA 5C23A 2MBBB 3L0WB 1YQBA 3PLVA 1Z5SB 4I6NB 1WR1A 4W9LA 3MHSD 1E90A 4W9GA 1FXTB 5IAAC 3VH3B 2K25A 4A3PA 2D11A 2ZEQA 4HJKA 4NAWB 3JSVB 1WX9A 4IWQA 4W9KA 4WJPA 3S2AA 3ZTDA 1T0YA 2W9NA 3PRPB 2C7HA 4II3B 2KDIA 2KC2A 2IO2B 1KLVA 1UGMA 2FIFA 4GOCA 4CO7A 4K7WA 5BO4B 2L0FA 4K7SA 1V49A 3H9DA 5CHVC 1P1AA 3O65B 4FJYA 4HPLB 1K8RB 3A9KB 2O6VD 2KDEB 4K7UA 4HCNB 3WA0A 1M94A 3ZW3A 4MELA 1V80A 2D3GA 4OVUA 1P98A 4JQWC 3DCGA 4PS7A 2D2QA 4HLEA 5JH5C 1OQYA 4PS8A 3KUCB 4RMAA 5D2MB 3PRZA 1LQBA 2XBBC 4EFOA 3X0WA 1WE7A 1WX7A 4MDKE 1WX8A 3WANA 2N9XA 3V6CB 1GG3A 4GDKB 5DPWA 1Q1OA 2LVQA 5L95C 2K6DB 2BYFA 3OAWA 2N1VA 3A33B 4DBGA 1A5RA 2ZVNA 2DYMA 4FHKA 2FAZA 3VFKA 5CTRC 4IWPA 2M8SA 3K9OB 3ZLZA 2I1KA 3A9JB 1WE6A 2DHZA 3A1QB 1WXVA 4MGKE 4BBNF 3C0RB 2KMCA 2KTFA 4NY0A 3ZRCA 1X1MA 2DZKA 4MSMB 1R4MI 2G4DB 2GBJA 3B08A 2C5LC 4EZLA 1NI2A 3TBLD 2C9WB 3RZWC 4MGZE 3KW5B 2PJHA 3ZDTA 4WJNA 3A4RA 1V81A 4W9JA 2CHZA 3UF8A 4XZ4A 3UGBB 4AOFA 2KJHB 2KN5A 4GGQA 1BT0A 2O2VB 1HE8A 4XX5A 2LRUA 3QHTA 1S1QB 4HDOA 2ASQA 1L2NA 3AI5A 3BINA 2K8HA 2NPTA 2XK5A 1KOTA 4BOSC 3VTVA 1RAXA 2DZJA 2MA9B 3CSTA 1XQQA 3AULA 3R7RA 3PGEA 4RM8A 3T9LA 2GBMA 4TQ0A 3D32A 1ZW7A 1WIAA 3QCAA 5JHBA 3PSEB 4HVBA 2AEHA 3W1YA 3RT3B 2EMSA 3UIOB 4CYEA 4MSQB 4OVVA 3IBEA 3RZFA 1WXAA 3WAMA 1EF1A 2BKFA 1OEYA 2BYEA 2GOWA 2XEWA 3L16A 4NQKE 2MP2B 3ZNGC 5JHAA 2ZVOA 2NCNA 3SHQA 3VTWA 1KJTA 2WDTB 1QZEA 5AZFA 3NHEB 3KYDD 2ZPNA 1OTRB 3L17A 3WIMA 4KZCA 4KDIC 3L13A 3TJPA 3EHVA 4NAWA 3JSVA 2LZ6A 5KHOA 3VDZA 2DAFA 2ZCCA 3QJZA 3KUDB 1ISNA 3AU5A 1WGHA 2JPHA 4WJOA 3PS6A 2KTRB 5G55A 3RUIB 2KDBA 1SGHA 2DYOA 4G50A 4WAAA 3AXCA 2LGDA 4IC7B 3A9KA 2L05A 3V62A 3X23A 5KHQA 3QIJA 3IHPC 3NS8A 4G11A 1C3TA 4FN2A 3HIZA 2IO3B 2JZ3B 4GSWA 4M8NA 4NQLB 1WRDB 2JRIB 3NZUA 4ZRKA 1GUAB 3U7DA 2IO1B 4ZYNA 2MBHA 2A5UA 2OJRA 3V61A 5AEKB 1Z2MA 2J7QB 4ANWA 2NS5A 2LUEA 4WQOB 1J19A 1YIWA 4DK5A 1WY8A 3WAOA 1UD7A 4GN1A 2K8BA 2KXJA 3R66C 5DPTA 2K39A 2N9EB 4BFRA 4GDKA 2N9PC 4BOZB 4NJ6A 3DQVA 5AZGA 2LASA 2KQSA 3UIPB 5IA7A 3L08A 1Q5WB 2YLMA 3U30A 2IZVB 2R2OA 4LJPB 4B95A 4MGYE 3A9JA 3A1QA 1V6EA 2NVUI 2KNBA 1UBQA 2RD0A 2Y5BB 3BY4B 3QAQA 4MH0E 4TV3A 1EO6A 2HE7A 3I3TB 4ICVA 3V60A 4ANVA 3B0AA 2GBNA 2C60A 4IM0A 4E71A 2PE6B 1TTNA 3K9PB 2KFJA 2NR2A 2PEAA 4ZDVA 1J8CA 4A20A 2J0KA 2DAJA 5DCNA 3SD5A 4RM9A 2Z0EB 3PREA 4DHJB 1EF5A 3IFWB 2CHXA 2OOBB 2O2VA 3VUXA 2WX1A 2IY1B 3JVZX 4DXAB 2BYVE 3IG3A 1I42A 2D07B 1R4NI 1WH3A 5G2NA 5LLIA 2WWZA 4BBNC 3NZSA 2GMIC 3DOWA 5DPSA 3OJ4B 4GDLB 4FJZA 3N3KB 4I6LB 1GNUA 4BKSA 3ML9A 3TIXA 1VD2A 2MP2A 2FUHB 3NOBA 4ZRJA 3UINB 5L83A 1V9JA 2KD0A 2L8JA 4MJSB 1WM3A 4PS3A 4EUTA 4DWFA 1S3SG 1E5WA 2NBUA 1GC6A 3EFUA 2L00B
chains in the Genus database with same CATH superfamily
3GZNI 3PV1A 4EZJA 3JYUA 3H1UA 1SE3A 1E8ZA 1ZXIA 4IM3A 1TYGB 1FPYA 1WM2A 5LNK1 4M01A 2BTEA 2BVCA 1QF6A 3RYTA 3DBHI 3V05A 2LGYA 2WDRB 2N0SB 5G5HA 2FIDA 1TT5B 4GMVA 1IP9A 1RYJA 5FR3A 2MRPA 2MW5A 3ZTCA 2DZIA 3NVYA 1FEHA 3Q3JA 1XCTL 4GLSC 5HHDG 1ZGUB 1I4RA 3WAPA 1JRUA 4RGMA 4FA6A 1B9RA 1HEZE 4NPNA 2FE8A 3AE4B 1IPGA 3LYYA 2KX0A 4F8CB 3ZNHB 1VR9A 3IT6B 1J7AA 3HK0A 2ZW1A 5J2RA 3APDA 3P4PB 3PRMB 1FFUA 1PYWD 3E56A 1V5OA 3DVNU 3QARA 1TBEA 3I57A 2IO0B 4FLHA 3SFDB 4KSKC 2N7EA 5E6JA 5DPRA 2LGXA 4ASWC 1YX5B 4LNNA 1L4ZB 2D3AA 2PPHA 2VH2A 1E8XA 1E7UA 3KUZA 3EFCA 3U4EG 2BWFA 3T3OA 2J0JA 3AEAB 2KQ7A 3AV8A 1JROA 5EE9A 3ZYYX 4LK0M 4XGAB 2CU1A 2LXAA 3PLUA 5J17A 3U7ZA 4P1BC 1DOIA 2G1EA 4A9AA 2EMTA 2KJ6A 1SXTA 4YTNB 4LDTB 2MJDA 2KZRA 1DOYA 5BYRA 2HTHA 3TSSA 1VLBA 4PYZA 4RCOA 4KZ0A 1D5ZC 2FCSA 3QC8B 2M0XA 4N6EB 4P16A 1WZ0A 1MG4A 2WP9B 2KDFB 4AS1A 1L5PA 2W3RA 4M00A 2FCNA 1L7YA 5J18A 1YN3A 1JW9D 2JVCA 3B2GA 4FJVB 1MG8A 3QX1A 1RLFA 2SEBD 2Z59B 2CHWA 2VZKD 2CKHB 4LNIA 4O1NA 1LO5D 3R8BA 3RD2A 3ZGZA 2M17A 1TGZB 5TSSA 3TL5A 4XDDA 2WXKA 4K81A 2JX5A 4BVUC 2GBRA 2KJRA 2UYZB 2GB1A 2GI9A 3NVVA 3I63C 2JRHA 4RGNA 1ZDXA 2LVOA 2NMQA 3I5JC 2RPQA 5JXVA 2ZZPB 2V3SA 2KKCA 3GE8C 1AN8A 3M3JA 1P9DU 2KVZA 4US9A 4W9HA 1ZP0B 1TKEA 5GXGB 1I4XA 3P1MA 1XF5L 2RPVA 2ZW0A 5JZEB 1JWBD 2LJIA 3VUYA 4IM2A 1WXSA 2FCMA 2DYBA 2DZMA 2NPTB 2XK5B 4HCPB 2KC1A 3PZ8A 2MBOA 2KOXA 5HKHA 5BMIA 2J52A 1OFFA 5C1ZA 4AJYB 4G3XB 2WDVB 2WXMA 4C7YA 2FBWB 4Q2JA 2MBBB 3L0WB 2KACA 4W9KA 1T3QA 2W9NA 4II3B 4GOCA 4K7WA 5CHVC 3O65B 1VRAB 3U52E 4JQWC 4ZYSA 5IN7A 2V0GA 2DWQA 1N61A 1EU4A 4RMAA 3PRZA 2XBBC 3HVDA 4EFOA 4MDKE 2WXQA 3HRDD 5L95C 2LVQA 2N1VA 3A33B 2WNMA 4KKJA 1I4GA 5CTRC 1DGJA 3AECB 2K22A 4DXFA 1EU3A 2AQ2B 4NY0A 1R4MI 2G4DB 1JALA 1E7PB 2C5LC 1HXYD 3IAS1 2C9WB 3RZWC 1FFVA 3ZDTA 3BZDB 4WJNA 1GB4A 1KFYB 2CHZA 1HZ5A 3UGBB 2KN5A 3RNAC 3EGRA 2LEKA 1HE8A 2LRUA 3Q8BA 1S1QB 4HDOA 3BINA 2NPTA 2XK5A 5I4DA 4BOSC 3RMKC 1XQQA 3BK2A 3PGEA 1K52A 4TQ0A 3QCAA 4WWMA 3PSEB 2WXNA 4HVBA 2M0AA 3RT3B 3UIOB 4CYEA 4MSQB 4OVVA 3RZFA 1SB3C 4JPSA 3WAMA 2BKFA 2BYEA 3ZNGC 5JHAA 3SEBA 2ON8A 1QZEA 3WIMA 3N20C 4KDIC 3L13A 4QAYA 3TJPA 3EHVA 3VR8B 5EE1A 3RNGC 2L52A 5KHOA 3VDZA 1ISNA 4IKGA 3RUIB 4WAAA 1TKYA 1Y56A 2QEJC 3NS8A 1C3TA 3R2IA 3ZXRA 3NZUA 1WYGA 4M02A 2MBHA 1XXGA 5AEKB 1WSPA 1Z2MA 4WURA 4ANWA 2NS5A 1J19A 1YIWA 4RGOS 4DK5A 1UD7A 2K8BA 2KXJA 4BOZB 4MM3B 3UIPB 1E0ZA 3TEYA 1F0ZA 1V6EA 2NVUI 1LGRA 2J42A 2HE7A 3I3TB 1SE4A 3K9PB 2NR2A 2PEAA 3BVGA 2DAJA 4S17A 4D2KA 2D3BA 3VUXA 2PVGC 2JYEA 1STEA 1GAQB 1D5XC 1UUPA 3Q8AA 5LLIA 2WWZA 1K50A 3DOWA 1E9MA 1P7FA 2K0PA 4FJZA 5HFYA 5L83A 1V9JA 4DWFA 1S3SG 1E5WA 1FXAA 1GC6A 4EE2A 2LVPA 3IAM1 4YTPB 2AL3A 1C4PA 2MQJA 4F7ZA 3APCA 1WGRA 1Y8RC 2KHWB 4TKNA 1XLOA 3DBRI 3RN9C 2O6VB 4IDIA 2WXOA 2FNJB 5EE0A 3CWIA 1MPEA 1TY2A 1WGKA 2W55A 1WGGA 1AWDA 3ZKJC 2LJ5A 4MM3A 1WJ6A 3SR6A 1SEBD 4YL8A 1F77A 2VH1A 4L23A 2LUMA 3DDCB 3ZNID 5BYSA 1FCCC 1IUEA 3TCAA 3MC8A 2GLSA 4JWSC 3PPAA 1K51A 3BYTB 1C4AA 2K9XA 1WJUA 1BMLC 1AW7A 5E6PA 4B0EA 1RRBA 2QHOA 4XWWA 2IGHA 1SJED 1OEYJ 4IUMB 4TUUA 3W5VB 2AYOB 3DVNV 2KLCA 4ZRIA 2ICIA 2LRWA 3P42A 3TMPB 2V3PA 1UWXA 3AB5A 2WYQA 1ROEA 3NUHB 1L0VB 3NS1A 2IY0B 3DBSA 2BS4B 3P4RB 4FULA 1JWUD 2DNFA 2K8CA 2N7DA 4KV2A 5C2TB 3CF6E 2BB6A 4EOYA 3RULA 4ACFA 4KGSA 3AE3B 1MVKA 2O6VA 4II2B 4W9DA 2KAJA 1ET6A 1KM7A 1WMHB 5FKAC 3EUB2 3MC9A 3NVWA 4J3OD 3DBLI 4ZOHC 2Z8LA 4MH8A 2LGSA 4HEA1 2L76A 2KANA 5HG2A 2IGGA 2JY6A 2LHEA 2MJ3A 2ZNVC 5LXHA 3ZJVA 4UDUC 3KYCD 3KWLA 2KO3A 3N1YC 2MX2A 4RH6A 4XWTA 1FXIA 1UZXB 5FR6A 3HUIA 1UH6A 3R3MA 1WF9A 1WJNA 1WWTA 1IGCA 1C77A 2HJ8A 2LD9A 4OZCA 4HPPA 1V86A 2W54A 1LM8B 2ACZB 4WWNA 3ZDMC 3MC0B 1I4PA 1N60A 4TQ1A 1QILA 2BPSA 4C4VB 3MTNB 2NBVB 2JZZA 3ECIA 2LFIA 4DHZE 3RPFC 1SSNA 4XE0A 1UF0A 1N6ZA 1L6UA 4FADA 1L0XB 1WXQA 2KVRA 1I4QA 1YQ3B 3H6NA 2RSUA 2CR5A 1IBXB 4NJCA 1E8YA 2DX5B 3H7SA 2L83A 2WU5B 4N9F4 5E6NA 1IYFA 1WMHA 4EKUA 4AJWA 2HDEA 1V2YA 2BW2A 3BYYB 1RFAA 4XC2A 4LCDE 2JT4B 2MJEA 3AM9A 1TZOA 1YQBA 4W9LA 1Z5SB 5IAAC 3MHSD 4W9GA 1TJEA 3IT4B 1QQRA 3ZTDA 2C7HA 2KC2A 1BXTA 2KDIA 3NJTA 5BO4B 3UI3A 1V49A 3FAHA 3DWMA 1XO3A 4FJYA 2OJWA 1M4VA 1F1HA 3GZNB 2O6VD 1QOGA 2QMTA 3WA0A 3ZW3A 2D3CA 1V80A 2D2QA 4HLEA 4DQOC 3DBHB 3V6CB 2DBYA 4GDKB 1PGBA 4A8XC 2G9HD 2K6DB 4NZLB 2BYFA 2FUG1 4DBGA 3Q3MC 2XNAC 2PLPA 2D5GA 2FAZA 2QCZA 3VFKA 3K9OB 3MHZA 2I1KA 3A9JB 2DHZA 2SAKA 1V8CA 4C4VA 3RNBC 3C0RB 3ZRCA 1X1MA 2DZKA 4MSMB 1KLUD 3AE6B 3KW5B 2QC8A 3A4RA 2DLBA 1V81A 2WS3B 1GPXA 4USAA 2KJHB 3QHTA 2ASQA 3AI5A 2K8HA 3ZJUA 1YQ4B 1RAXA 3AULA 3T9LA 1N5XA 1IBXA 4RF0A 3Q2AC 1WIAA 2Y3AA 1T6BX 3BIID 2EMSA 1I7HA 1WXAA 4HKQA 3B9JA 4C00A 1KOTA 2GOWA 1D6EC 2CJNA 3VTWA 3DHIC 3NHEB 3AMZA 1Q10A 5BMHA 1KF6B 2K3UA 2ZCCA 3AU5A 4WJOA 2WLBA 2DYOA 2KT7A 3DHGC 3QIJA 2N9KA 4KGRA 4FN2A 2WGSA 1WRDB 4ZRKA 3MJ5A 1GUAB 3Q3OC 3U7DA 4ZYNA 4A6QA 2A5UA 2J7QB 4WQOB 1TS4A 1KTKA 4BFRA 4GDKA 1EWCA 3V3XA 3VR9B 5IA7A 2YLMA 3U30A 2IZVB 4YXDB 3A9JA 2KNBA 1UBQA 2CJOA 3BY4B 4MH0E 1EO6A 4ICVA 4ANVA 4IM0A 2PE6B 2KFJA 2J0KA 3SD5A 4C7ZA 3PREA 1EF5A 1KH0A 4XYCA 4WAFA 3DWGC 4DXAB 1AYFA 2BYVE 3SFEB 3TUOA 1T0RC 1T0QC 1R4NI 1WH3A 5G2NA 3NZSA 3AN1A 1F2RI 2JQRB 4I6LB 4BKSA 2LGIA 4WIPA 3TIXA 4ZRJA 3NOBA 3LB8C 4ZDVA 2NBUA 3CMMB 3R7QA 1V1PB 5H8YE 3GS2A 3KVFB 1RM6C 3RNEC 4L1BA 4N59A 1V5TA 2L0TA 2IYDB 2JUOA 2WXLA 4KIKB 3LXFA 3PHXB 4HPMB 5D94A 4KGTA 1TS3A 5HI1A 2MHJA 1YNTE 1FCLA 1E8WA 3VUWA 1JWAD 4NJ7A 1E7VA 3EECA 2H89B 3L10B 5CX3A 4B0MA 1ZKHA 5CHFA 2AQ3B 3Q8FA 4NNJB 3P63A 1UNSA 4KVGB 1LXDA 5D6JB 4P7IA 2AWTA 2DENB 1MHXA 5LXIB 1U4AA 3DHHC 3ZIMA 2MEKA 4TSSA 3EC8A 4B9KA 4OZBA 4EEWA 2KWUB 4GXBA 4ZHPA 2HD5B 1FD6A 2KN4A 1TZ1A 2RMMA 2KK8A 3UQAA 1C76A 3QA8A 1C1YB 3HVZA 2I38A 1NDDA 1YN4A 1ZUD2 1QT9A 1PDXA 2RR9A 2JZPA 4IW0A 4BZAA 4F1SA 1EUVB 4LNOA 3RNFC 1FMAD 2UWQA 2REXA 1H8CA 4S0RA 1CQVA 1WZ3A 2PE9A 2L7RA 3RCZA 1WI0A 2BB5A 1NEKB 1V1PA 1GJZA 1QOFA 2PIAA 2H88B 4XDCA 3NY5A 4KIKA 3ZNZB 4I6PA 1GOZA 1R4MB 4A3OA 2KMAA 1N5WA 2VRRB 1WFYA 2RGFA 3B2FA 4CHKA 3ZQ4A 5EDSA 3ALBA 2KWCA 4MGIE 2JWZA 4ZRPA 4BKSD 1UELA 1UBIA 3Q3FA 3AE7B 1FNUA 3VH4B 3L4PA 1WJ4A 2K1FA 4CQNA 2M1MA 3PT2B 4BAXA 2M56B 1IGDA 2B3AA 1K53A 2AX5A 1QOBA 4MEMA 3ZVVA 3VRAB 5AZHA 1YJJA 2V9HA 2I2YA 4GIVA 1PGXA 4W9FA 2JU6X 2ZPYA 4YTMB 1ZDVA 1VJKA 2J53A 4KSLC 3AE1B 1FO4A 1G6JA 4R3DA 2WHIA 3N1XC 4HXDA 3OJ3A 1HTOA 4LNFA 3DVGY 4WH4A 4AUQC 4E3CA 2INNE 1NENB 1XLPA 2RDHA 4FHJA 4WWOA 4K3BA 4WJQA 3AEFB 3W1SC 2WXIA 1TIFA 4M0WB 3M63B 4DDID 1I35A 2MSED 4GU2A 1XLNA 4B6WA 2INDC 3GOEA 1CZPA 4URKA 4ICUA 3PHWB 1OQQA 4WWPA 4ZRQA 3VQIA 2R61A 1GB1A 3HHMA 3QK0A 3ONSA 2PTLA 3CSFA 1WGDA 2NBWB 3B1LX 3KQ4A 3VVWB 4W9IA 4W9EA 3AEBB 1JWMD 3VXWA 3PZ7A 1XCQL 4IWOA 1PQSA 1A70A 2J4XA 2AL6A 4BKGA 2BGFA 1L4DB 3OLMD 1WGYA 3AE2B 5IKCM 4DHZB 2D10A 3GE3C 3MFGA 5AUIA 5C3JB 4AQ7A 4AP4C 2JF5A 3UQBA 2EKEC 4YWGG 2N1WA 3VHTC 5GMVA 1B1ZA 1YD8U 2MH7A 5C23A 1VZ7A 1JRPA 3PLVA 3ABVB 4I6NB 4A3PA 1E90A 1FXTB 2K25A 2D11A 2ZEQA 4HJKA 4IWQA 3S2AA 3PRPB 1KLVA 2IO2B 2FIFA 4CO7A 2EKIA 3H9DA 1P1AA 4MT5A 3A9KB 3VRBB 4K7UA 1FNVA 4MELA 4ITKA 4OVUA 5D3DA 3KUCB 1YJIA 5D2MB 1LQBA 1TY0A 3WANA 3BVMA 3DBRB 2N9XA 5DPWA 1Q1OA 3OAWA 1A5RA 2DYMA 1N63A 4JX1C 4IWPA 3ZLZA 3N1ZC 4M0WA 1WE6A 3A1QB 1WXVA 2KTFA 4C80A 3B08A 4RFBA 1F52A 1SBBB 4EZLA 2BT6A 2WXGA 2IGDA 4TMAB 1HA5A 3AEDB 4W9JA 2QIEB 1UGJA 4GGQA 4XX5A 2INPE 3CSTA 3R7RA 4RM8A 2GBMA 3D32A 4L2YA 1ZW7A 3OG5A 5JHBA 3W1YA 3RFZB 1MJDA 1KRHA 1QKZA 1EF1A 3PO0A 3L16A 4NQKE 2MP2B 2KWDA 2NCNA 3BWUD 1KJTA 5H92C 3KYDD 3AEGB 1OTRB 4PT5A 4DXGA 1XEEA 2E6XA 3NZ3A 5BYQA 3QJZA 3KUDB 4HROA 1WGHA 3Q8EA 2KTRB 2KDBA 3V62A 5KHQA 3A9KA 3Q8CA 3WCQA 3HIZA 2IO3B 4K3CA 2JZ3B 4GSWA 1V97A 5IO9A 2IO1B 2OJRA 3V61A 2V4IB 2UU7A 1WY8A 3WAOA 4GN1A 1D4BA 4PK1A 3R66C 5DPTA 2K39A 3W5UB 3ETRA 4NJ6A 2KDMA 4US8A 2LASA 2KQSA 3L08A 2E3TA 2PKOA 4LJPB 1FNWA 3GB1A 2OHFA 3A1QA 4YSZB 1F2RC 3DBLB 1VZ8A 3QAQA 1QLBB 3KLSX 1PGAA 1CJEA 3V60A 3B0AA 2GBNA 4E71A 4A55A 1TTNA 4A20A 5IP4D 4YSYB 4RM9A 2IPKD 2Z0EB 3FKYA 3IFWB 2OOBB 1D5MC 2WX1A 2IY1B 1ZXHA 4N58A 3JVZX 1L0YB 1HQRD 1T5XD 3IG3A 2D07B 4BBNC 3RNCC 2GMIC 5DPSA 3O13A 2LMCA 4GDLB 2W3SA 1DYQA 1GNUA 2MP2A 3UINB 2BBCA 2KD0A 1FIQA 2L8JA 4MJSB 1JWSD 1WM3A 3EFUA 2N7JA 2W82A 2L32A 3W2DA 2BQQA 1J7CA 2MBQA 2MBEA 4YSXB 3SDLC 2V1YA 2G4SA 2ZCBA 2KTRA 3IXSA 3DVGX 3FILB 1GC7A 1NYRA 2Z0DB 2M19A 3KWVA 2GBKA 2EELA 4YT0B 5MPOA 3DPDA 2N4FA 1JCKB 3URYA 2Q5WD 2JSVX 3SU8X 1F9JA 2KWVB 3VAWA 3C8YA 3CIRB 3ENEA 4KDLB 4X57B 1P7EA 2GRIA 1YX6B 1PFDA 2CS4A 1RWSA 3ZUNA 4DDGD 4M8MA 4P6VF 2KQ4X 3N30A 5AUKA 3W9CB 2MLBA 3AE5B 1C4CA 4JWUC 2X38A 3AE9B 3NG0A 4EZKA 2J0MA 1XD3B 4ANXA 2WX0A 4DHJD 3ZO5B 3GP7A 3NVZA 4JGHB 1OQRA 3KH0A 1LFDA 4LJOB 2LXCA 1FRRA 1H4RA 4JL9A 1TS5A 2KX3A 5D7GA 4JIOU 3V6EB 2FCQA 2BKRB 3JW0X 2CU3A 4IOIE 3C19A 3ZXVA 3LJ3A 2LWPA 1SIFA 3H7PB 2HTME 4OVZA 2PW9A 4GDLA 4HK2A 3M62B 1Q0WB 3PTFC 1KLGD 1VCBA 2Y5CA 4MJSA 5EE3A 2IJ0A 4E74A 2I1JA 2L3ZA 4RF1A 1HZ6A 1AARA 3AH7A 4ARCA 1SE9A 2WXJA 2HJ1A 3FILA 3M95A 5FK9C 2KLGA 1DOXA 1RFKA 2YVCA 2KFKB 1CK1A 2V4LA 2KYWA 1PUTA 4ANUA 3NRZA 3A4SC 4J6IA 4BKTA 3MJWA 5IOIA 5TR5A 2LI5A 1P3QU 1C78A 3HM3A 2RDBC 3PVLA 4JLCA 1NBFC 5CHWA 1VZ6A 1MFWA 2INCC 2XN9C 3FC4A 2QILA 3W1SA 2ZNVB 2K5PA 4ZHOA 3U8ZA 2NTSA 2X8XX 2R2QA 4NAMA 3QWZB 3PZDA 3ML8A 1UWMA 1D3ZA 1WR6E 3T8MA 1OGWA 3P2BA 4HJGE 3ZRFA 2QDFA 4IG7B 3MP9A 1L6VA 2IBIB 1R7SA 2A4ZA 2G3QB 1SJHD 4K1RB 2C7MB 3Q14C 2K6QA 3QQ8B 1ZOYB 4HDQA 4FBJB 2MCNB 2LHDA 1CMXB 2M4NA 1MHHE 3LDZE 3H7PA 2ONQA 4GB9A 2BF8B 2ZJDA 2PMVA 1WYWB 3ZJTA 4AWJA 2G45B 5G5GA 3TEXA 1V1OA 1P0RA 2MWSB 2WQYB 1TS2A 3AU4A 4G0NB 1XT9B 3APFA 2C7NB 3N9YC 2KMMA 4LDTD 1C79A 4W9CA 1WXMA 3IVFA 4FXCA 2JYTA 2JXXA 4OW0A 2WXRA 3N32A 2KFKA 3VTUA 4HWIB 2L1AA 3WALA 4PYUA 3L54A 4OHJA 3HM6X 2BWES 1QOAA 4LLGM 1J0GA 1YJ1A 3TEWA 5E6OA 2AQ1B 2WXPA 1R4NB 1WR1A 3VH3B 4NAWB 3JSVB 1WX9A 3U2SC 4WJPA 1T0YA 1YMHE 1ET9A 1UGMA 1NI3A 2L0FA 4K7SA 1SE2A 1FM0D 4HPLB 1K8RB 2BYTA 1WRIA 4KX6B 2KDEB 4HCNB 1M94A 1T0SC 1J7BA 2D3GA 3Q3NC 3R2TA 1P98A 2BS3B 3Q69A 3DCGA 4PS7A 4A90A 5JH5C 1OQYA 4PS8A 4LNKA 3P4QB 2RDGA 2JXTA 2QJLA 2WDQB 4REZA 3X0WA 1WE7A 1WX7A 4ARIA 1WX8A 1NVID 3EA6A 1GG3A 1ZE3D 3H8HA 2ZVNA 4FHKA 1JQ4A 1E6EB 2M8SA 4MGKE 4MACA 4BBNF 2KMCA 1VDVA 2GBJA 1NI2A 3TBLD 3Q6BA 4HRSA 4MGZE 2PJHA 4H2AA 1ACCA 1N62A 3J9CA 3E9SA 3UF8A 4XZ4A 4AOFA 1BT0A 2O2VB 1L2NA 4RNAA 5T8IA 3I9V1 2N9LA 3VTVA 2DZJA 2MA9B 1SIJA 2QSDA 1SF0A 2YEPB 1YOVB 2IDYA 2WXHA 4C56C 2AEHA 1C9FA 3AEEB 3IBEA 2YEPF 3AE8B 1OEYA 2WXFA 2XEWA 2ZVOA 3SHQA 2WDTB 5AZFA 2ZPNA 3L17A 3P4SB 4KZCA 3T3NA 2PVOD 4KKIA 1JMLA 4NAWA 2Y5PA 3JSVA 2LZ6A 5BMGA 2VZKB 2DAFA 1FRDA 3TEZA 2JPHA 3PS6A 2TSSA 2B76B 5G55A 1SGHA 4G50A 3AXCA 2LGDA 4IC7B 3X23A 2L05A 3IHPC 4G11A 1ZPSA 4M8NA 4NQLB 1TKGA 2JRIB 3RI7C 1XLQA 2LUEA 2N9EB 2OEDA 2N9PC 1ESFA 3DQVA 5AZGA 2V3NA 1I4HA 1Q5WB 2R2OA 4B95A 1BUIC 4MGYE 2NTTA 1EWYC 2BS2B 2RD0A 2Y5BB 2JWUA 2WU2B 4TV3A 1EM7A 2C60A 5D3IB 1J8CA 5DCNA 3OWEB 1MI0A 4JE3B 4DHJB 2CHXA 4HKZE 2O2VA 1HTQA 1E10A 4OZAA 1YN5A 1I42A 4WQMA 4P1CC 1NYQA 3BVZA 3OJ4B 3N3KB 4RGTA 1ENFA 3BK1A 3ML9A 1VD2A 2FUHB 4EUTA 4PS3A 4LTUA 2L00B
chains in the Genus database with same CATH topology
2LVPA 3GZNI 3PV1A 3R7QA 3JYUA 4EZJA 3H1UA 3KVFB 1E8ZA 2MBQA 1V5TA 2MBEA 2L0TA 4IM3A 3SDLC 2IYDB 2JUOA 2V1YA 2G4SA 4KIKB 2AL3A 2ZCBA 3PHXB 4HPMB 5D94A 2MQJA 4F7ZA 1WM2A 3APCA 2KTRA 1E8WA 1WGRA 1Y8RC 3DVGX 3VUWA 2KHWB 4NJ7A 1GC7A 3RYTA 3DBHI 4TKNA 1E7VA 3DBRI 3EECA 2LGYA 2Z0DB 3L10B 5CX3A 2GBKA 1ZKHA 2FIDA 3CMMB 2O6VB 4NNJB 4GMVA 5CHFA 1IP9A 4KVGB 1LXDA 5D6JB 2MRPA 2MW5A 3DPDA 4P7IA 3ZTCA 2DZIA 2FNJB 2N4FA 2AWTA 3Q3JA 2DENB 3WAPA 1ZGUB 1F9JA 2KWVB 3SU8X 3VAWA 1JRUA 1WGGA 4FA6A 3ENEA 3ZKJC 2LJ5A 4KDLB 4X57B 4NPNA 5LXIB 1U4AA 4MM3A 1IPGA 1WJ6A 3ZIMA 1YX6B 2KX0A 2CS4A 4F8CB 4YL8A 3EC8A 3ZUNA 4B9KA 3ZNHB 4M8MA 4DDGD 4EEWA 3HK0A 2KWUB 3N30A 4GXBA 5J2RA 3APDA 2HD5B 2MLBA 3PRMB 3DDCB 3ZNID 1TZ1A 2KK8A 3UQAA 1V5OA 3DVNU 3QA8A 3QARA 4EZKA 1TBEA 1C1YB 3TCAA 2IO0B 3PPAA 4FLHA 1NDDA 2J0MA 1XD3B 4KSKC 1WJUA 2N7EA 4ANXA 2WX0A 5E6PA 5DPRA 2LGXA 2RR9A 4DHJD 3ZO5B 1RRBA 2QHOA 1YX5B 4ASWC 4JGHB 2PPHA 4IW0A 1E8XA 1E7UA 3KUZA 3KH0A 1LFDA 1OEYJ 4LJOB 2LXCA 4IUMB 4F1SA 1H4RA 4TUUA 4JL9A 1EUVB 2KX3A 5D7GA 2BWFA 4JIOU 3V6EB 2FCQA 2BKRB 3JW0X 2AYOB 3DVNV 2J0JA 2KLCA 2UWQA 4ZRIA 2KQ7A 2LRWA 2REXA 3LJ3A 2LWPA 3TMPB 1SIFA 3H7PB 1H8CA 4GDLA 4HK2A 1WZ3A 3M62B 2WYQA 2PE9A 2L7RA 1Q0WB 3PTFC 1VCBA 2CU1A 2LXAA 3PLUA 3RCZA 4MJSA 1WI0A 5J17A 4E74A 2IY0B 2I1JA 3DBSA 2L3ZA 1GJZA 2EMTA 2KJ6A 1AARA 4FULA 3NY5A 2N7DA 2K8CA 4KV2A 4KIKA 4LDTB 2KZRA 1SE9A 3ZNZB 3CF6E 2HTHA 4I6PA 4A3OA 4PYZA 4EOYA 3M95A 4KZ0A 2KLGA 2KMAA 3RULA 2VRRB 2YVCA 2KFKB 1WFYA 2RGFA 2FCSA 3QC8B 2M0XA 2V4LA 2O6VA 4CHKA 1WZ0A 5EDSA 3ALBA 4II2B 2KDFB 4W9DA 2KWCA 2FCNA 1KM7A 1WMHB 2JWZA 4MGIE 4ANUA 4BKSD 1UELA 3A4SC 4J6IA 4BKTA 1UBIA 3Q3FA 1L7YA 3MJWA 5TR5A 2JVCA 3DBLI 5J18A 2LI5A 1P3QU 3HM3A 3VH4B 4FJVB 3PVLA 1MG8A 3QX1A 1RLFA 1WJ4A 4JLCA 1NBFC 2K1FA 5CHWA 2M1MA 3PT2B 2Z59B 2B3AA 2CHWA 4MEMA 3W1SA 2L76A 3ZVVA 2ZNVB 2KANA 5AZHA 2JY6A 2CKHB 4GIVA 3U8ZA 5LXHA 2ZNVC 4W9FA 2ZPYA 3KYCD 3RD2A 2KO3A 2R2QA 2M17A 3QWZB 4KSLC 3PZDA 3ML8A 2MX2A 1D3ZA 1TGZB 1WR6E 3T8MA 1OGWA 3TL5A 1G6JA 1UZXB 3P2BA 5FR6A 3ZRFA 4IG7B 2IBIB 1UH6A 4K81A 4HXDA 2A4ZA 3OJ3A 4BVUC 3R3MA 2GBRA 2G3QB 1WF9A 1WJNA 2KJRA 2UYZB 4K1RB 2C7MB 3DVGY 2K6QA 3QQ8B 2HJ8A 2LD9A 4HDQA 4AUQC 4E3CA 2JRHA 1V86A 2LVOA 4FBJB 2MCNB 2RPQA 1CMXB 2V3SA 2KKCA 2ZZPB 4FHJA 4WWOA 1LM8B 2M4NA 4WWNA 3ZDMC 3LDZE 3H7PA 4GB9A 4WJQA 2BF8B 2ZJDA 3M3JA 1P9DU 3W1SC 4W9HA 4TQ1A 4M0WB 3M63B 2BPSA 4DDID 1WYWB 1I35A 3MTNB 2MSED 4GU2A 4AWJA 2G45B 2NBVB 2JZZA 1P0RA 2MWSB 3ECIA 4B6WA 3GOEA 4URKA 4ICUA 3PHWB 4WWPA 3AU4A 3VQIA 4G0NB 3HHMA 1XT9B 4DHZE 3APFA 2C7NB 3QK0A 5JZEB 3ONSA 4LDTD 3VUYA 4W9CA 3CSFA 4IM2A 1WXSA 1WXMA 1WGDA 2NBWB 3IVFA 3B1LX 3VVWB 2FCMA 2DYBA 4FADA 2KVRA 4W9IA 2DZMA 2JXXA 2NPTB 2XK5B 4W9EA 4HCPB 3VXWA 3N32A 2KC1A 2KFKA 3H6NA 2RSUA 2CR5A 2MBOA 1PQSA 4IWOA 1E8YA 2AL6A 4BKGA 2DX5B 3H7SA 3VTUA 2BGFA 2KOXA 3OLMD 4N9F4 5E6NA 4HWIB 1WGYA 1IYFA 5HKHA 1WMHA 3WALA 4DHZB 4EKUA 4AJWA 2D10A 4PYUA 3L54A 4AP4C 2JF5A 3UQBA 1V2YA 5C1ZA 4AJYB 2EKEC 1RFAA 2N1WA 3HM6X 4XC2A 4G3XB 3VHTC 5GMVA 2BWES 4LCDE 1J0GA 2JT4B 1YJ1A 1YD8U 5E6OA 5C23A 2MBBB 3L0WB 1YQBA 3PLVA 1Z5SB 4I6NB 1WR1A 4W9LA 3MHSD 1E90A 4W9GA 1FXTB 5IAAC 3VH3B 2K25A 4A3PA 2D11A 2ZEQA 4HJKA 4NAWB 3JSVB 1WX9A 4IWQA 4W9KA 4WJPA 3S2AA 3ZTDA 1T0YA 2W9NA 3PRPB 2C7HA 4II3B 2KDIA 2KC2A 2IO2B 1KLVA 1UGMA 2FIFA 4GOCA 4CO7A 4K7WA 5BO4B 2L0FA 4K7SA 1V49A 3H9DA 5CHVC 1P1AA 3O65B 4FJYA 4HPLB 1K8RB 3A9KB 2O6VD 2KDEB 4K7UA 4HCNB 3WA0A 1M94A 3ZW3A 4MELA 1V80A 2D3GA 4OVUA 1P98A 4JQWC 3DCGA 4PS7A 2D2QA 4HLEA 5JH5C 1OQYA 4PS8A 3KUCB 4RMAA 5D2MB 3PRZA 1LQBA 2XBBC 4EFOA 3X0WA 1WE7A 1WX7A 4MDKE 1WX8A 3WANA 2N9XA 3V6CB 1GG3A 4GDKB 5DPWA 1Q1OA 2LVQA 5L95C 2K6DB 2BYFA 3OAWA 2N1VA 3A33B 4DBGA 1A5RA 2ZVNA 2DYMA 4FHKA 2FAZA 3VFKA 5CTRC 4IWPA 2M8SA 3K9OB 3ZLZA 2I1KA 3A9JB 1WE6A 2DHZA 3A1QB 1WXVA 4MGKE 4BBNF 3C0RB 2KMCA 2KTFA 4NY0A 3ZRCA 1X1MA 2DZKA 4MSMB 1R4MI 2G4DB 2GBJA 3B08A 2C5LC 4EZLA 1NI2A 3TBLD 2C9WB 3RZWC 4MGZE 3KW5B 2PJHA 3ZDTA 4WJNA 3A4RA 1V81A 4W9JA 2CHZA 3UF8A 4XZ4A 3UGBB 4AOFA 2KJHB 2KN5A 4GGQA 1BT0A 2O2VB 1HE8A 4XX5A 2LRUA 3QHTA 1S1QB 4HDOA 2ASQA 1L2NA 3AI5A 3BINA 2K8HA 2NPTA 2XK5A 1KOTA 4BOSC 3VTVA 1RAXA 2DZJA 2MA9B 3CSTA 1XQQA 3AULA 3R7RA 3PGEA 4RM8A 3T9LA 2GBMA 4TQ0A 3D32A 1ZW7A 1WIAA 3QCAA 5JHBA 3PSEB 4HVBA 2AEHA 3W1YA 3RT3B 2EMSA 3UIOB 4CYEA 4MSQB 4OVVA 3IBEA 3RZFA 1WXAA 3WAMA 1EF1A 2BKFA 1OEYA 2BYEA 2GOWA 2XEWA 3L16A 4NQKE 2MP2B 3ZNGC 5JHAA 2ZVOA 2NCNA 3SHQA 3VTWA 1KJTA 2WDTB 1QZEA 5AZFA 3NHEB 3KYDD 2ZPNA 1OTRB 3L17A 3WIMA 4KZCA 4KDIC 3L13A 3TJPA 3EHVA 4NAWA 3JSVA 2LZ6A 5KHOA 3VDZA 2DAFA 2ZCCA 3QJZA 3KUDB 1ISNA 3AU5A 1WGHA 2JPHA 4WJOA 3PS6A 2KTRB 5G55A 3RUIB 2KDBA 1SGHA 2DYOA 4G50A 4WAAA 3AXCA 2LGDA 4IC7B 3A9KA 2L05A 3V62A 3X23A 5KHQA 3QIJA 3IHPC 3NS8A 4G11A 1C3TA 4FN2A 3HIZA 2IO3B 2JZ3B 4GSWA 4M8NA 4NQLB 1WRDB 2JRIB 3NZUA 4ZRKA 1GUAB 3U7DA 2IO1B 4ZYNA 2MBHA 2A5UA 2OJRA 3V61A 5AEKB 1Z2MA 2J7QB 4ANWA 2NS5A 2LUEA 4WQOB 1J19A 1YIWA 4DK5A 1WY8A 3WAOA 1UD7A 4GN1A 2K8BA 2KXJA 3R66C 5DPTA 2K39A 2N9EB 4BFRA 4GDKA 2N9PC 4BOZB 4NJ6A 3DQVA 5AZGA 2LASA 2KQSA 3UIPB 5IA7A 3L08A 1Q5WB 2YLMA 3U30A 2IZVB 2R2OA 4LJPB 4B95A 4MGYE 3A9JA 3A1QA 1V6EA 2NVUI 2KNBA 1UBQA 2RD0A 2Y5BB 3BY4B 3QAQA 4MH0E 4TV3A 1EO6A 2HE7A 3I3TB 4ICVA 3V60A 4ANVA 3B0AA 2GBNA 2C60A 4IM0A 4E71A 2PE6B 1TTNA 3K9PB 2KFJA 2NR2A 2PEAA 4ZDVA 1J8CA 4A20A 2J0KA 2DAJA 5DCNA 3SD5A 4RM9A 2Z0EB 3PREA 4DHJB 1EF5A 3IFWB 2CHXA 2OOBB 2O2VA 3VUXA 2WX1A 2IY1B 3JVZX 4DXAB 2BYVE 3IG3A 1I42A 2D07B 1R4NI 1WH3A 5G2NA 5LLIA 2WWZA 4BBNC 3NZSA 2GMIC 3DOWA 5DPSA 3OJ4B 4GDLB 4FJZA 3N3KB 4I6LB 1GNUA 4BKSA 3ML9A 3TIXA 1VD2A 2MP2A 2FUHB 3NOBA 4ZRJA 3UINB 5L83A 1V9JA 2KD0A 2L8JA 4MJSB 1WM3A 4PS3A 4EUTA 4DWFA 1S3SG 1E5WA 2NBUA 1GC6A 3EFUA 2L00B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVP A;  3GZN I;  3PV1 A;  3R7Q A;  3JYU A;  4EZJ A;  3H1U A;  3KVF B;  1E8Z A;  2MBQ A;  1V5T A;  2MBE A;  2L0T A;  4IM3 A;  3SDL C;  2IYD B;  2JUO A;  2V1Y A;  2G4S A;  4KIK B;  2AL3 A;  2ZCB A;  3PHX B;  4HPM B;  5D94 A;  2MQJ A;  4F7Z A;  1WM2 A;  3APC A;  2KTR A;  1E8W A;  1WGR A;  1Y8R C;  3DVG X;  3VUW A;  2KHW B;  4NJ7 A;  1GC7 A;  3RYT A;  3DBH I;  4TKN A;  1E7V A;  3DBR I;  3EEC A;  2LGY A;  2Z0D B;  3L10 B;  5CX3 A;  2GBK A;  1ZKH A;  2FID A;  3CMM B;  2O6V B;  4NNJ B;  4GMV A;  5CHF A;  1IP9 A;  4KVG B;  1LXD A;  5D6J B;  2MRP A;  2MW5 A;  3DPD A;  4P7I A;  3ZTC A;  2DZI A;  2FNJ B;  2N4F A;  2AWT A;  3Q3J A;  2DEN B;  3WAP A;  1ZGU B;  1F9J A;  2KWV B;  3SU8 X;  3VAW A;  1JRU A;  1WGG A;  4FA6 A;  3ENE A;  3ZKJ C;  2LJ5 A;  4KDL B;  4X57 B;  4NPN A;  5LXI B;  1U4A A;  4MM3 A;  1IPG A;  1WJ6 A;  3ZIM A;  1YX6 B;  2KX0 A;  2CS4 A;  4F8C B;  4YL8 A;  3EC8 A;  3ZUN A;  4B9K A;  3ZNH B;  4M8M A;  4DDG D;  4EEW A;  3HK0 A;  2KWU B;  3N30 A;  4GXB A;  5J2R A;  3APD A;  2HD5 B;  2MLB A;  3PRM B;  3DDC B;  3ZNI D;  1TZ1 A;  2KK8 A;  3UQA A;  1V5O A;  3DVN U;  3QA8 A;  3QAR A;  4EZK A;  1TBE A;  1C1Y B;  3TCA A;  2IO0 B;  3PPA A;  4FLH A;  1NDD A;  2J0M A;  1XD3 B;  4KSK C;  1WJU A;  2N7E A;  4ANX A;  2WX0 A;  5E6P A;  5DPR A;  2LGX A;  2RR9 A;  4DHJ D;  3ZO5 B;  1RRB A;  2QHO A;  1YX5 B;  4ASW C;  4JGH B;  2PPH A;  4IW0 A;  1E8X A;  1E7U A;  3KUZ A;  3KH0 A;  1LFD A;  1OEY J;  4LJO B;  2LXC A;  4IUM B;  4F1S A;  1H4R A;  4TUU A;  4JL9 A;  1EUV B;  2KX3 A;  5D7G A;  2BWF A;  4JIO U;  3V6E B;  2FCQ A;  2BKR B;  3JW0 X;  2AYO B;  3DVN V;  2J0J A;  2KLC A;  2UWQ A;  4ZRI A;  2KQ7 A;  2LRW A;  2REX A;  3LJ3 A;  2LWP A;  3TMP B;  1SIF A;  3H7P B;  1H8C A;  4GDL A;  4HK2 A;  1WZ3 A;  3M62 B;  2WYQ A;  2PE9 A;  2L7R A;  1Q0W B;  3PTF C;  1VCB A;  2CU1 A;  2LXA A;  3PLU A;  3RCZ A;  4MJS A;  1WI0 A;  5J17 A;  4E74 A;  2IY0 B;  2I1J A;  3DBS A;  2L3Z A;  1GJZ A;  2EMT A;  2KJ6 A;  1AAR A;  4FUL A;  3NY5 A;  2N7D A;  2K8C A;  4KV2 A;  4KIK A;  4LDT B;  2KZR A;  1SE9 A;  3ZNZ B;  3CF6 E;  2HTH A;  4I6P A;  4A3O A;  4PYZ A;  4EOY A;  3M95 A;  4KZ0 A;  2KLG A;  2KMA A;  3RUL A;  2VRR B;  2YVC A;  2KFK B;  1WFY A;  2RGF A;  2FCS A;  3QC8 B;  2M0X A;  2V4L A;  2O6V A;  4CHK A;  1WZ0 A;  5EDS A;  3ALB A;  4II2 B;  2KDF B;  4W9D A;  2KWC A;  2FCN A;  1KM7 A;  1WMH B;  2JWZ A;  4MGI E;  4ANU A;  4BKS D;  1UEL A;  3A4S C;  4J6I A;  4BKT A;  1UBI A;  3Q3F A;  1L7Y A;  3MJW A;  5TR5 A;  2JVC A;  3DBL I;  5J18 A;  2LI5 A;  1P3Q U;  3HM3 A;  3VH4 B;  4FJV B;  3PVL A;  1MG8 A;  3QX1 A;  1RLF A;  1WJ4 A;  4JLC A;  1NBF C;  2K1F A;  5CHW A;  2M1M A;  3PT2 B;  2Z59 B;  2B3A A;  2CHW A;  4MEM A;  3W1S A;  2L76 A;  3ZVV A;  2ZNV B;  2KAN A;  5AZH A;  2JY6 A;  2CKH B;  4GIV A;  3U8Z A;  5LXH A;  2ZNV C;  4W9F A;  2ZPY A;  3KYC D;  3RD2 A;  2KO3 A;  2R2Q A;  2M17 A;  3QWZ B;  4KSL C;  3PZD A;  3ML8 A;  2MX2 A;  1D3Z A;  1TGZ B;  1WR6 E;  3T8M A;  1OGW A;  3TL5 A;  1G6J A;  1UZX B;  3P2B A;  5FR6 A;  3ZRF A;  4IG7 B;  2IBI B;  1UH6 A;  4K81 A;  4HXD A;  2A4Z A;  3OJ3 A;  4BVU C;  3R3M A;  2GBR A;  2G3Q B;  1WF9 A;  1WJN A;  2KJR A;  2UYZ B;  4K1R B;  2C7M B;  3DVG Y;  2K6Q A;  3QQ8 B;  2HJ8 A;  2LD9 A;  4HDQ A;  4AUQ C;  4E3C A;  2JRH A;  1V86 A;  2LVO A;  4FBJ B;  2MCN B;  2RPQ A;  1CMX B;  2V3S A;  2KKC A;  2ZZP B;  4FHJ A;  4WWO A;  1LM8 B;  2M4N A;  4WWN A;  3ZDM C;  3LDZ E;  3H7P A;  4GB9 A;  4WJQ A;  2BF8 B;  2ZJD A;  3M3J A;  1P9D U;  3W1S C;  4W9H A;  4TQ1 A;  4M0W B;  3M63 B;  2BPS A;  4DDI D;  1WYW B;  1I35 A;  3MTN B;  2MSE D;  4GU2 A;  4AWJ A;  2G45 B;  2NBV B;  2JZZ A;  1P0R A;  2MWS B;  3ECI A;  4B6W A;  3GOE A;  4URK A;  4ICU A;  3PHW B;  4WWP A;  3AU4 A;  3VQI A;  4G0N B;  3HHM A;  1XT9 B;  4DHZ E;  3APF A;  2C7N B;  3QK0 A;  5JZE B;  3ONS A;  4LDT D;  3VUY A;  4W9C A;  3CSF A;  4IM2 A;  1WXS A;  1WXM A;  1WGD A;  2NBW B;  3IVF A;  3B1L X;  3VVW B;  2FCM A;  2DYB A;  4FAD A;  2KVR A;  4W9I A;  2DZM A;  2JXX A;  2NPT B;  2XK5 B;  4W9E A;  4HCP B;  3VXW A;  3N32 A;  2KC1 A;  2KFK A;  3H6N A;  2RSU A;  2CR5 A;  2MBO A;  1PQS A;  4IWO A;  1E8Y A;  2AL6 A;  4BKG A;  2DX5 B;  3H7S A;  3VTU A;  2BGF A;  2KOX A;  3OLM D;  4N9F 4;  5E6N A;  4HWI B;  1WGY A;  1IYF A;  5HKH A;  1WMH A;  3WAL A;  4DHZ B;  4EKU A;  4AJW A;  2D10 A;  4PYU A;  3L54 A;  4AP4 C;  2JF5 A;  3UQB A;  1V2Y A;  5C1Z A;  4AJY B;  2EKE C;  1RFA A;  2N1W A;  3HM6 X;  4XC2 A;  4G3X B;  3VHT C;  5GMV A;  2BWE S;  4LCD E;  1J0G A;  2JT4 B;  1YJ1 A;  1YD8 U;  5E6O A;  5C23 A;  2MBB B;  3L0W B;  1YQB A;  3PLV A;  1Z5S B;  4I6N B;  1WR1 A;  4W9L A;  3MHS D;  1E90 A;  4W9G A;  1FXT B;  5IAA C;  3VH3 B;  2K25 A;  4A3P A;  2D11 A;  2ZEQ A;  4HJK A;  4NAW B;  3JSV B;  1WX9 A;  4IWQ A;  4W9K A;  4WJP A;  3S2A A;  3ZTD A;  1T0Y A;  2W9N A;  3PRP B;  2C7H A;  4II3 B;  2KDI A;  2KC2 A;  2IO2 B;  1KLV A;  1UGM A;  2FIF A;  4GOC A;  4CO7 A;  4K7W A;  5BO4 B;  2L0F A;  4K7S A;  1V49 A;  3H9D A;  5CHV C;  1P1A A;  3O65 B;  4FJY A;  4HPL B;  1K8R B;  3A9K B;  2O6V D;  2KDE B;  4K7U A;  4HCN B;  3WA0 A;  1M94 A;  3ZW3 A;  4MEL A;  1V80 A;  2D3G A;  4OVU A;  1P98 A;  4JQW C;  3DCG A;  4PS7 A;  2D2Q A;  4HLE A;  5JH5 C;  1OQY A;  4PS8 A;  3KUC B;  4RMA A;  5D2M B;  3PRZ A;  1LQB A;  2XBB C;  4EFO A;  3X0W A;  1WE7 A;  1WX7 A;  4MDK E;  1WX8 A;  3WAN A;  2N9X A;  3V6C B;  1GG3 A;  4GDK B;  5DPW A;  1Q1O A;  2LVQ A;  5L95 C;  2K6D B;  2BYF A;  3OAW A;  2N1V A;  3A33 B;  4DBG A;  1A5R A;  2ZVN A;  2DYM A;  4FHK A;  2FAZ A;  3VFK A;  5CTR C;  4IWP A;  2M8S A;  3K9O B;  3ZLZ A;  2I1K A;  3A9J B;  1WE6 A;  2DHZ A;  3A1Q B;  1WXV A;  4MGK E;  4BBN F;  3C0R B;  2KMC A;  2KTF A;  4NY0 A;  3ZRC A;  1X1M A;  2DZK A;  4MSM B;  1R4M I;  2G4D B;  2GBJ A;  3B08 A;  2C5L C;  4EZL A;  1NI2 A;  3TBL D;  2C9W B;  3RZW C;  4MGZ E;  3KW5 B;  2PJH A;  3ZDT A;  4WJN A;  3A4R A;  1V81 A;  4W9J A;  2CHZ A;  3UF8 A;  4XZ4 A;  3UGB B;  4AOF A;  2KJH B;  2KN5 A;  4GGQ A;  1BT0 A;  2O2V B;  1HE8 A;  4XX5 A;  2LRU A;  3QHT A;  1S1Q B;  4HDO A;  2ASQ A;  1L2N A;  3AI5 A;  3BIN A;  2K8H A;  2NPT A;  2XK5 A;  1KOT A;  4BOS C;  3VTV A;  1RAX A;  2DZJ A;  2MA9 B;  3CST A;  1XQQ A;  3AUL A;  3R7R A;  3PGE A;  4RM8 A;  3T9L A;  2GBM A;  4TQ0 A;  3D32 A;  1ZW7 A;  1WIA A;  3QCA A;  5JHB A;  3PSE B;  4HVB A;  2AEH A;  3W1Y A;  3RT3 B;  2EMS A;  3UIO B;  4CYE A;  4MSQ B;  4OVV A;  3IBE A;  3RZF A;  1WXA A;  3WAM A;  1EF1 A;  2BKF A;  1OEY A;  2BYE A;  2GOW A;  2XEW A;  3L16 A;  4NQK E;  2MP2 B;  3ZNG C;  5JHA A;  2ZVO A;  2NCN A;  3SHQ A;  3VTW A;  1KJT A;  2WDT B;  1QZE A;  5AZF A;  3NHE B;  3KYD D;  2ZPN A;  1OTR B;  3L17 A;  3WIM A;  4KZC A;  4KDI C;  3L13 A;  3TJP A;  3EHV A;  4NAW A;  3JSV A;  2LZ6 A;  5KHO A;  3VDZ A;  2DAF A;  2ZCC A;  3QJZ A;  3KUD B;  1ISN A;  3AU5 A;  1WGH A;  2JPH A;  4WJO A;  3PS6 A;  2KTR B;  5G55 A;  3RUI B;  2KDB A;  1SGH A;  2DYO A;  4G50 A;  4WAA A;  3AXC A;  2LGD A;  4IC7 B;  3A9K A;  2L05 A;  3V62 A;  3X23 A;  5KHQ A;  3QIJ A;  3IHP C;  3NS8 A;  4G11 A;  1C3T A;  4FN2 A;  3HIZ A;  2IO3 B;  2JZ3 B;  4GSW A;  4M8N A;  4NQL B;  1WRD B;  2JRI B;  3NZU A;  4ZRK A;  1GUA B;  3U7D A;  2IO1 B;  4ZYN A;  2MBH A;  2A5U A;  2OJR A;  3V61 A;  5AEK B;  1Z2M A;  2J7Q B;  4ANW A;  2NS5 A;  2LUE A;  4WQO B;  1J19 A;  1YIW A;  4DK5 A;  1WY8 A;  3WAO A;  1UD7 A;  4GN1 A;  2K8B A;  2KXJ A;  3R66 C;  5DPT A;  2K39 A;  2N9E B;  4BFR A;  4GDK A;  2N9P C;  4BOZ B;  4NJ6 A;  3DQV A;  5AZG A;  2LAS A;  2KQS A;  3UIP B;  5IA7 A;  3L08 A;  1Q5W B;  2YLM A;  3U30 A;  2IZV B;  2R2O A;  4LJP B;  4B95 A;  4MGY E;  3A9J A;  3A1Q A;  1V6E A;  2NVU I;  2KNB A;  1UBQ A;  2RD0 A;  2Y5B B;  3BY4 B;  3QAQ A;  4MH0 E;  4TV3 A;  1EO6 A;  2HE7 A;  3I3T B;  4ICV A;  3V60 A;  4ANV A;  3B0A A;  2GBN A;  2C60 A;  4IM0 A;  4E71 A;  2PE6 B;  1TTN A;  3K9P B;  2KFJ A;  2NR2 A;  2PEA A;  4ZDV A;  1J8C A;  4A20 A;  2J0K A;  2DAJ A;  5DCN A;  3SD5 A;  4RM9 A;  2Z0E B;  3PRE A;  4DHJ B;  1EF5 A;  3IFW B;  2CHX A;  2OOB B;  2O2V A;  3VUX A;  2WX1 A;  2IY1 B;  3JVZ X;  4DXA B;  2BYV E;  3IG3 A;  1I42 A;  2D07 B;  1R4N I;  1WH3 A;  5G2N A;  5LLI A;  2WWZ A;  4BBN C;  3NZS A;  2GMI C;  3DOW A;  5DPS A;  3OJ4 B;  4GDL B;  4FJZ A;  3N3K B;  4I6L B;  1GNU A;  4BKS A;  3ML9 A;  3TIX A;  1VD2 A;  2MP2 A;  2FUH B;  3NOB A;  4ZRJ A;  3UIN B;  5L83 A;  1V9J A;  2KD0 A;  2L8J A;  4MJS B;  1WM3 A;  4PS3 A;  4EUT A;  4DWF A;  1S3S G;  1E5W A;  2NBU A;  1GC6 A;  3EFU A;  2L00 B; 
#chains in the Genus database with same CATH topology
 3GZN I;  3PV1 A;  4EZJ A;  3JYU A;  3H1U A;  1SE3 A;  1E8Z A;  1ZXI A;  4IM3 A;  1TYG B;  1FPY A;  1WM2 A;  5LNK 1;  4M01 A;  2BTE A;  2BVC A;  1QF6 A;  3RYT A;  3DBH I;  3V05 A;  2LGY A;  2WDR B;  2N0S B;  5G5H A;  2FID A;  1TT5 B;  4GMV A;  1IP9 A;  1RYJ A;  5FR3 A;  2MRP A;  2MW5 A;  3ZTC A;  2DZI A;  3NVY A;  1FEH A;  3Q3J A;  1XCT L;  4GLS C;  5HHD G;  1ZGU B;  1I4R A;  3WAP A;  1JRU A;  4RGM A;  4FA6 A;  1B9R A;  1HEZ E;  4NPN A;  2FE8 A;  3AE4 B;  1IPG A;  3LYY A;  2KX0 A;  4F8C B;  3ZNH B;  1VR9 A;  3IT6 B;  1J7A A;  3HK0 A;  2ZW1 A;  5J2R A;  3APD A;  3P4P B;  3PRM B;  1FFU A;  1PYW D;  3E56 A;  1V5O A;  3DVN U;  3QAR A;  1TBE A;  3I57 A;  2IO0 B;  4FLH A;  3SFD B;  4KSK C;  2N7E A;  5E6J A;  5DPR A;  2LGX A;  4ASW C;  1YX5 B;  4LNN A;  1L4Z B;  2D3A A;  2PPH A;  2VH2 A;  1E8X A;  1E7U A;  3KUZ A;  3EFC A;  3U4E G;  2BWF A;  3T3O A;  2J0J A;  3AEA B;  2KQ7 A;  3AV8 A;  1JRO A;  5EE9 A;  3ZYY X;  4LK0 M;  4XGA B;  2CU1 A;  2LXA A;  3PLU A;  5J17 A;  3U7Z A;  4P1B C;  1DOI A;  2G1E A;  4A9A A;  2EMT A;  2KJ6 A;  1SXT A;  4YTN B;  4LDT B;  2MJD A;  2KZR A;  1DOY A;  5BYR A;  2HTH A;  3TSS A;  1VLB A;  4PYZ A;  4RCO A;  4KZ0 A;  1D5Z C;  2FCS A;  3QC8 B;  2M0X A;  4N6E B;  4P16 A;  1WZ0 A;  1MG4 A;  2WP9 B;  2KDF B;  4AS1 A;  1L5P A;  2W3R A;  4M00 A;  2FCN A;  1L7Y A;  5J18 A;  1YN3 A;  1JW9 D;  2JVC A;  3B2G A;  4FJV B;  1MG8 A;  3QX1 A;  1RLF A;  2SEB D;  2Z59 B;  2CHW A;  2VZK D;  2CKH B;  4LNI A;  4O1N A;  1LO5 D;  3R8B A;  3RD2 A;  3ZGZ A;  2M17 A;  1TGZ B;  5TSS A;  3TL5 A;  4XDD A;  2WXK A;  4K81 A;  2JX5 A;  4BVU C;  2GBR A;  2KJR A;  2UYZ B;  2GB1 A;  2GI9 A;  3NVV A;  3I63 C;  2JRH A;  4RGN A;  1ZDX A;  2LVO A;  2NMQ A;  3I5J C;  2RPQ A;  5JXV A;  2ZZP B;  2V3S A;  2KKC A;  3GE8 C;  1AN8 A;  3M3J A;  1P9D U;  2KVZ A;  4US9 A;  4W9H A;  1ZP0 B;  1TKE A;  5GXG B;  1I4X A;  3P1M A;  1XF5 L;  2RPV A;  2ZW0 A;  5JZE B;  1JWB D;  2LJI A;  3VUY A;  4IM2 A;  1WXS A;  2FCM A;  2DYB A;  2DZM A;  2NPT B;  2XK5 B;  4HCP B;  2KC1 A;  3PZ8 A;  2MBO A;  2KOX A;  5HKH A;  5BMI A;  2J52 A;  1OFF A;  5C1Z A;  4AJY B;  4G3X B;  2WDV B;  2WXM A;  4C7Y A;  2FBW B;  4Q2J A;  2MBB B;  3L0W B;  2KAC A;  4W9K A;  1T3Q A;  2W9N A;  4II3 B;  4GOC A;  4K7W A;  5CHV C;  3O65 B;  1VRA B;  3U52 E;  4JQW C;  4ZYS A;  5IN7 A;  2V0G A;  2DWQ A;  1N61 A;  1EU4 A;  4RMA A;  3PRZ A;  2XBB C;  3HVD A;  4EFO A;  4MDK E;  2WXQ A;  3HRD D;  5L95 C;  2LVQ A;  2N1V A;  3A33 B;  2WNM A;  4KKJ A;  1I4G A;  5CTR C;  1DGJ A;  3AEC B;  2K22 A;  4DXF A;  1EU3 A;  2AQ2 B;  4NY0 A;  1R4M I;  2G4D B;  1JAL A;  1E7P B;  2C5L C;  1HXY D;  3IAS 1;  2C9W B;  3RZW C;  1FFV A;  3ZDT A;  3BZD B;  4WJN A;  1GB4 A;  1KFY B;  2CHZ A;  1HZ5 A;  3UGB B;  2KN5 A;  3RNA C;  3EGR A;  2LEK A;  1HE8 A;  2LRU A;  3Q8B A;  1S1Q B;  4HDO A;  3BIN A;  2NPT A;  2XK5 A;  5I4D A;  4BOS C;  3RMK C;  1XQQ A;  3BK2 A;  3PGE A;  1K52 A;  4TQ0 A;  3QCA A;  4WWM A;  3PSE B;  2WXN A;  4HVB A;  2M0A A;  3RT3 B;  3UIO B;  4CYE A;  4MSQ B;  4OVV A;  3RZF A;  1SB3 C;  4JPS A;  3WAM A;  2BKF A;  2BYE A;  3ZNG C;  5JHA A;  3SEB A;  2ON8 A;  1QZE A;  3WIM A;  3N20 C;  4KDI C;  3L13 A;  4QAY A;  3TJP A;  3EHV A;  3VR8 B;  5EE1 A;  3RNG C;  2L52 A;  5KHO A;  3VDZ A;  1ISN A;  4IKG A;  3RUI B;  4WAA A;  1TKY A;  1Y56 A;  2QEJ C;  3NS8 A;  1C3T A;  3R2I A;  3ZXR A;  3NZU A;  1WYG A;  4M02 A;  2MBH A;  1XXG A;  5AEK B;  1WSP A;  1Z2M A;  4WUR A;  4ANW A;  2NS5 A;  1J19 A;  1YIW A;  4RGO S;  4DK5 A;  1UD7 A;  2K8B A;  2KXJ A;  4BOZ B;  4MM3 B;  3UIP B;  1E0Z A;  3TEY A;  1F0Z A;  1V6E A;  2NVU I;  1LGR A;  2J42 A;  2HE7 A;  3I3T B;  1SE4 A;  3K9P B;  2NR2 A;  2PEA A;  3BVG A;  2DAJ A;  4S17 A;  4D2K A;  2D3B A;  3VUX A;  2PVG C;  2JYE A;  1STE A;  1GAQ B;  1D5X C;  1UUP A;  3Q8A A;  5LLI A;  2WWZ A;  1K50 A;  3DOW A;  1E9M A;  1P7F A;  2K0P A;  4FJZ A;  5HFY A;  5L83 A;  1V9J A;  4DWF A;  1S3S G;  1E5W A;  1FXA A;  1GC6 A;  4EE2 A;  2LVP A;  3IAM 1;  4YTP B;  2AL3 A;  1C4P A;  2MQJ A;  4F7Z A;  3APC A;  1WGR A;  1Y8R C;  2KHW B;  4TKN A;  1XLO A;  3DBR I;  3RN9 C;  2O6V B;  4IDI A;  2WXO A;  2FNJ B;  5EE0 A;  3CWI A;  1MPE A;  1TY2 A;  1WGK A;  2W55 A;  1WGG A;  1AWD A;  3ZKJ C;  2LJ5 A;  4MM3 A;  1WJ6 A;  3SR6 A;  1SEB D;  4YL8 A;  1F77 A;  2VH1 A;  4L23 A;  2LUM A;  3DDC B;  3ZNI D;  5BYS A;  1FCC C;  1IUE A;  3TCA A;  3MC8 A;  2GLS A;  4JWS C;  3PPA A;  1K51 A;  3BYT B;  1C4A A;  2K9X A;  1WJU A;  1BML C;  1AW7 A;  5E6P A;  4B0E A;  1RRB A;  2QHO A;  4XWW A;  2IGH A;  1SJE D;  1OEY J;  4IUM B;  4TUU A;  3W5V B;  2AYO B;  3DVN V;  2KLC A;  4ZRI A;  2ICI A;  2LRW A;  3P42 A;  3TMP B;  2V3P A;  1UWX A;  3AB5 A;  2WYQ A;  1ROE A;  3NUH B;  1L0V B;  3NS1 A;  2IY0 B;  3DBS A;  2BS4 B;  3P4R B;  4FUL A;  1JWU D;  2DNF A;  2K8C A;  2N7D A;  4KV2 A;  5C2T B;  3CF6 E;  2BB6 A;  4EOY A;  3RUL A;  4ACF A;  4KGS A;  3AE3 B;  1MVK A;  2O6V A;  4II2 B;  4W9D A;  2KAJ A;  1ET6 A;  1KM7 A;  1WMH B;  5FKA C;  3EUB 2;  3MC9 A;  3NVW A;  4J3O D;  3DBL I;  4ZOH C;  2Z8L A;  4MH8 A;  2LGS A;  4HEA 1;  2L76 A;  2KAN A;  5HG2 A;  2IGG A;  2JY6 A;  2LHE A;  2MJ3 A;  2ZNV C;  5LXH A;  3ZJV A;  4UDU C;  3KYC D;  3KWL A;  2KO3 A;  3N1Y C;  2MX2 A;  4RH6 A;  4XWT A;  1FXI A;  1UZX B;  5FR6 A;  3HUI A;  1UH6 A;  3R3M A;  1WF9 A;  1WJN A;  1WWT A;  1IGC A;  1C77 A;  2HJ8 A;  2LD9 A;  4OZC A;  4HPP A;  1V86 A;  2W54 A;  1LM8 B;  2ACZ B;  4WWN A;  3ZDM C;  3MC0 B;  1I4P A;  1N60 A;  4TQ1 A;  1QIL A;  2BPS A;  4C4V B;  3MTN B;  2NBV B;  2JZZ A;  3ECI A;  2LFI A;  4DHZ E;  3RPF C;  1SSN A;  4XE0 A;  1UF0 A;  1N6Z A;  1L6U A;  4FAD A;  1L0X B;  1WXQ A;  2KVR A;  1I4Q A;  1YQ3 B;  3H6N A;  2RSU A;  2CR5 A;  1IBX B;  4NJC A;  1E8Y A;  2DX5 B;  3H7S A;  2L83 A;  2WU5 B;  4N9F 4;  5E6N A;  1IYF A;  1WMH A;  4EKU A;  4AJW A;  2HDE A;  1V2Y A;  2BW2 A;  3BYY B;  1RFA A;  4XC2 A;  4LCD E;  2JT4 B;  2MJE A;  3AM9 A;  1TZO A;  1YQB A;  4W9L A;  1Z5S B;  5IAA C;  3MHS D;  4W9G A;  1TJE A;  3IT4 B;  1QQR A;  3ZTD A;  2C7H A;  2KC2 A;  1BXT A;  2KDI A;  3NJT A;  5BO4 B;  3UI3 A;  1V49 A;  3FAH A;  3DWM A;  1XO3 A;  4FJY A;  2OJW A;  1M4V A;  1F1H A;  3GZN B;  2O6V D;  1QOG A;  2QMT A;  3WA0 A;  3ZW3 A;  2D3C A;  1V80 A;  2D2Q A;  4HLE A;  4DQO C;  3DBH B;  3V6C B;  2DBY A;  4GDK B;  1PGB A;  4A8X C;  2G9H D;  2K6D B;  4NZL B;  2BYF A;  2FUG 1;  4DBG A;  3Q3M C;  2XNA C;  2PLP A;  2D5G A;  2FAZ A;  2QCZ A;  3VFK A;  3K9O B;  3MHZ A;  2I1K A;  3A9J B;  2DHZ A;  2SAK A;  1V8C A;  4C4V A;  3RNB C;  3C0R B;  3ZRC A;  1X1M A;  2DZK A;  4MSM B;  1KLU D;  3AE6 B;  3KW5 B;  2QC8 A;  3A4R A;  2DLB A;  1V81 A;  2WS3 B;  1GPX A;  4USA A;  2KJH B;  3QHT A;  2ASQ A;  3AI5 A;  2K8H A;  3ZJU A;  1YQ4 B;  1RAX A;  3AUL A;  3T9L A;  1N5X A;  1IBX A;  4RF0 A;  3Q2A C;  1WIA A;  2Y3A A;  1T6B X;  3BII D;  2EMS A;  1I7H A;  1WXA A;  4HKQ A;  3B9J A;  4C00 A;  1KOT A;  2GOW A;  1D6E C;  2CJN A;  3VTW A;  3DHI C;  3NHE B;  3AMZ A;  1Q10 A;  5BMH A;  1KF6 B;  2K3U A;  2ZCC A;  3AU5 A;  4WJO A;  2WLB A;  2DYO A;  2KT7 A;  3DHG C;  3QIJ A;  2N9K A;  4KGR A;  4FN2 A;  2WGS A;  1WRD B;  4ZRK A;  3MJ5 A;  1GUA B;  3Q3O C;  3U7D A;  4ZYN A;  4A6Q A;  2A5U A;  2J7Q B;  4WQO B;  1TS4 A;  1KTK A;  4BFR A;  4GDK A;  1EWC A;  3V3X A;  3VR9 B;  5IA7 A;  2YLM A;  3U30 A;  2IZV B;  4YXD B;  3A9J A;  2KNB A;  1UBQ A;  2CJO A;  3BY4 B;  4MH0 E;  1EO6 A;  4ICV A;  4ANV A;  4IM0 A;  2PE6 B;  2KFJ A;  2J0K A;  3SD5 A;  4C7Z A;  3PRE A;  1EF5 A;  1KH0 A;  4XYC A;  4WAF A;  3DWG C;  4DXA B;  1AYF A;  2BYV E;  3SFE B;  3TUO A;  1T0R C;  1T0Q C;  1R4N I;  1WH3 A;  5G2N A;  3NZS A;  3AN1 A;  1F2R I;  2JQR B;  4I6L B;  4BKS A;  2LGI A;  4WIP A;  3TIX A;  4ZRJ A;  3NOB A;  3LB8 C;  4ZDV A;  2NBU A;  3CMM B;  3R7Q A;  1V1P B;  5H8Y E;  3GS2 A;  3KVF B;  1RM6 C;  3RNE C;  4L1B A;  4N59 A;  1V5T A;  2L0T A;  2IYD B;  2JUO A;  2WXL A;  4KIK B;  3LXF A;  3PHX B;  4HPM B;  5D94 A;  4KGT A;  1TS3 A;  5HI1 A;  2MHJ A;  1YNT E;  1FCL A;  1E8W A;  3VUW A;  1JWA D;  4NJ7 A;  1E7V A;  3EEC A;  2H89 B;  3L10 B;  5CX3 A;  4B0M A;  1ZKH A;  5CHF A;  2AQ3 B;  3Q8F A;  4NNJ B;  3P63 A;  1UNS A;  4KVG B;  1LXD A;  5D6J B;  4P7I A;  2AWT A;  2DEN B;  1MHX A;  5LXI B;  1U4A A;  3DHH C;  3ZIM A;  2MEK A;  4TSS A;  3EC8 A;  4B9K A;  4OZB A;  4EEW A;  2KWU B;  4GXB A;  4ZHP A;  2HD5 B;  1FD6 A;  2KN4 A;  1TZ1 A;  2RMM A;  2KK8 A;  3UQA A;  1C76 A;  3QA8 A;  1C1Y B;  3HVZ A;  2I38 A;  1NDD A;  1YN4 A;  1ZUD 2;  1QT9 A;  1PDX A;  2RR9 A;  2JZP A;  4IW0 A;  4BZA A;  4F1S A;  1EUV B;  4LNO A;  3RNF C;  1FMA D;  2UWQ A;  2REX A;  1H8C A;  4S0R A;  1CQV A;  1WZ3 A;  2PE9 A;  2L7R A;  3RCZ A;  1WI0 A;  2BB5 A;  1NEK B;  1V1P A;  1GJZ A;  1QOF A;  2PIA A;  2H88 B;  4XDC A;  3NY5 A;  4KIK A;  3ZNZ B;  4I6P A;  1GOZ A;  1R4M B;  4A3O A;  2KMA A;  1N5W A;  2VRR B;  1WFY A;  2RGF A;  3B2F A;  4CHK A;  3ZQ4 A;  5EDS A;  3ALB A;  2KWC A;  4MGI E;  2JWZ A;  4ZRP A;  4BKS D;  1UEL A;  1UBI A;  3Q3F A;  3AE7 B;  1FNU A;  3VH4 B;  3L4P A;  1WJ4 A;  2K1F A;  4CQN A;  2M1M A;  3PT2 B;  4BAX A;  2M56 B;  1IGD A;  2B3A A;  1K53 A;  2AX5 A;  1QOB A;  4MEM A;  3ZVV A;  3VRA B;  5AZH A;  1YJJ A;  2V9H A;  2I2Y A;  4GIV A;  1PGX A;  4W9F A;  2JU6 X;  2ZPY A;  4YTM B;  1ZDV A;  1VJK A;  2J53 A;  4KSL C;  3AE1 B;  1FO4 A;  1G6J A;  4R3D A;  2WHI A;  3N1X C;  4HXD A;  3OJ3 A;  1HTO A;  4LNF A;  3DVG Y;  4WH4 A;  4AUQ C;  4E3C A;  2INN E;  1NEN B;  1XLP A;  2RDH A;  4FHJ A;  4WWO A;  4K3B A;  4WJQ A;  3AEF B;  3W1S C;  2WXI A;  1TIF A;  4M0W B;  3M63 B;  4DDI D;  1I35 A;  2MSE D;  4GU2 A;  1XLN A;  4B6W A;  2IND C;  3GOE A;  1CZP A;  4URK A;  4ICU A;  3PHW B;  1OQQ A;  4WWP A;  4ZRQ A;  3VQI A;  2R61 A;  1GB1 A;  3HHM A;  3QK0 A;  3ONS A;  2PTL A;  3CSF A;  1WGD A;  2NBW B;  3B1L X;  3KQ4 A;  3VVW B;  4W9I A;  4W9E A;  3AEB B;  1JWM D;  3VXW A;  3PZ7 A;  1XCQ L;  4IWO A;  1PQS A;  1A70 A;  2J4X A;  2AL6 A;  4BKG A;  2BGF A;  1L4D B;  3OLM D;  1WGY A;  3AE2 B;  5IKC M;  4DHZ B;  2D10 A;  3GE3 C;  3MFG A;  5AUI A;  5C3J B;  4AQ7 A;  4AP4 C;  2JF5 A;  3UQB A;  2EKE C;  4YWG G;  2N1W A;  3VHT C;  5GMV A;  1B1Z A;  1YD8 U;  2MH7 A;  5C23 A;  1VZ7 A;  1JRP A;  3PLV A;  3ABV B;  4I6N B;  4A3P A;  1E90 A;  1FXT B;  2K25 A;  2D11 A;  2ZEQ A;  4HJK A;  4IWQ A;  3S2A A;  3PRP B;  1KLV A;  2IO2 B;  2FIF A;  4CO7 A;  2EKI A;  3H9D A;  1P1A A;  4MT5 A;  3A9K B;  3VRB B;  4K7U A;  1FNV A;  4MEL A;  4ITK A;  4OVU A;  5D3D A;  3KUC B;  1YJI A;  5D2M B;  1LQB A;  1TY0 A;  3WAN A;  3BVM A;  3DBR B;  2N9X A;  5DPW A;  1Q1O A;  3OAW A;  1A5R A;  2DYM A;  1N63 A;  4JX1 C;  4IWP A;  3ZLZ A;  3N1Z C;  4M0W A;  1WE6 A;  3A1Q B;  1WXV A;  2KTF A;  4C80 A;  3B08 A;  4RFB A;  1F52 A;  1SBB B;  4EZL A;  2BT6 A;  2WXG A;  2IGD A;  4TMA B;  1HA5 A;  3AED B;  4W9J A;  2QIE B;  1UGJ A;  4GGQ A;  4XX5 A;  2INP E;  3CST A;  3R7R A;  4RM8 A;  2GBM A;  3D32 A;  4L2Y A;  1ZW7 A;  3OG5 A;  5JHB A;  3W1Y A;  3RFZ B;  1MJD A;  1KRH A;  1QKZ A;  1EF1 A;  3PO0 A;  3L16 A;  4NQK E;  2MP2 B;  2KWD A;  2NCN A;  3BWU D;  1KJT A;  5H92 C;  3KYD D;  3AEG B;  1OTR B;  4PT5 A;  4DXG A;  1XEE A;  2E6X A;  3NZ3 A;  5BYQ A;  3QJZ A;  3KUD B;  4HRO A;  1WGH A;  3Q8E A;  2KTR B;  2KDB A;  3V62 A;  5KHQ A;  3A9K A;  3Q8C A;  3WCQ A;  3HIZ A;  2IO3 B;  4K3C A;  2JZ3 B;  4GSW A;  1V97 A;  5IO9 A;  2IO1 B;  2OJR A;  3V61 A;  2V4I B;  2UU7 A;  1WY8 A;  3WAO A;  4GN1 A;  1D4B A;  4PK1 A;  3R66 C;  5DPT A;  2K39 A;  3W5U B;  3ETR A;  4NJ6 A;  2KDM A;  4US8 A;  2LAS A;  2KQS A;  3L08 A;  2E3T A;  2PKO A;  4LJP B;  1FNW A;  3GB1 A;  2OHF A;  3A1Q A;  4YSZ B;  1F2R C;  3DBL B;  1VZ8 A;  3QAQ A;  1QLB B;  3KLS X;  1PGA A;  1CJE A;  3V60 A;  3B0A A;  2GBN A;  4E71 A;  4A55 A;  1TTN A;  4A20 A;  5IP4 D;  4YSY B;  4RM9 A;  2IPK D;  2Z0E B;  3FKY A;  3IFW B;  2OOB B;  1D5M C;  2WX1 A;  2IY1 B;  1ZXH A;  4N58 A;  3JVZ X;  1L0Y B;  1HQR D;  1T5X D;  3IG3 A;  2D07 B;  4BBN C;  3RNC C;  2GMI C;  5DPS A;  3O13 A;  2LMC A;  4GDL B;  2W3S A;  1DYQ A;  1GNU A;  2MP2 A;  3UIN B;  2BBC A;  2KD0 A;  1FIQ A;  2L8J A;  4MJS B;  1JWS D;  1WM3 A;  3EFU A;  2N7J A;  2W82 A;  2L32 A;  3W2D A;  2BQQ A;  1J7C A;  2MBQ A;  2MBE A;  4YSX B;  3SDL C;  2V1Y A;  2G4S A;  2ZCB A;  2KTR A;  3IXS A;  3DVG X;  3FIL B;  1GC7 A;  1NYR A;  2Z0D B;  2M19 A;  3KWV A;  2GBK A;  2EEL A;  4YT0 B;  5MPO A;  3DPD A;  2N4F A;  1JCK B;  3URY A;  2Q5W D;  2JSV X;  3SU8 X;  1F9J A;  2KWV B;  3VAW A;  3C8Y A;  3CIR B;  3ENE A;  4KDL B;  4X57 B;  1P7E A;  2GRI A;  1YX6 B;  1PFD A;  2CS4 A;  1RWS A;  3ZUN A;  4DDG D;  4M8M A;  4P6V F;  2KQ4 X;  3N30 A;  5AUK A;  3W9C B;  2MLB A;  3AE5 B;  1C4C A;  4JWU C;  2X38 A;  3AE9 B;  3NG0 A;  4EZK A;  2J0M A;  1XD3 B;  4ANX A;  2WX0 A;  4DHJ D;  3ZO5 B;  3GP7 A;  3NVZ A;  4JGH B;  1OQR A;  3KH0 A;  1LFD A;  4LJO B;  2LXC A;  1FRR A;  1H4R A;  4JL9 A;  1TS5 A;  2KX3 A;  5D7G A;  4JIO U;  3V6E B;  2FCQ A;  2BKR B;  3JW0 X;  2CU3 A;  4IOI E;  3C19 A;  3ZXV A;  3LJ3 A;  2LWP A;  1SIF A;  3H7P B;  2HTM E;  4OVZ A;  2PW9 A;  4GDL A;  4HK2 A;  3M62 B;  1Q0W B;  3PTF C;  1KLG D;  1VCB A;  2Y5C A;  4MJS A;  5EE3 A;  2IJ0 A;  4E74 A;  2I1J A;  2L3Z A;  4RF1 A;  1HZ6 A;  1AAR A;  3AH7 A;  4ARC A;  1SE9 A;  2WXJ A;  2HJ1 A;  3FIL A;  3M95 A;  5FK9 C;  2KLG A;  1DOX A;  1RFK A;  2YVC A;  2KFK B;  1CK1 A;  2V4L A;  2KYW A;  1PUT A;  4ANU A;  3NRZ A;  3A4S C;  4J6I A;  4BKT A;  3MJW A;  5IOI A;  5TR5 A;  2LI5 A;  1P3Q U;  1C78 A;  3HM3 A;  2RDB C;  3PVL A;  4JLC A;  1NBF C;  5CHW A;  1VZ6 A;  1MFW A;  2INC C;  2XN9 C;  3FC4 A;  2QIL A;  3W1S A;  2ZNV B;  2K5P A;  4ZHO A;  3U8Z A;  2NTS A;  2X8X X;  2R2Q A;  4NAM A;  3QWZ B;  3PZD A;  3ML8 A;  1UWM A;  1D3Z A;  1WR6 E;  3T8M A;  1OGW A;  3P2B A;  4HJG E;  3ZRF A;  2QDF A;  4IG7 B;  3MP9 A;  1L6V A;  2IBI B;  1R7S A;  2A4Z A;  2G3Q B;  1SJH D;  4K1R B;  2C7M B;  3Q14 C;  2K6Q A;  3QQ8 B;  1ZOY B;  4HDQ A;  4FBJ B;  2MCN B;  2LHD A;  1CMX B;  2M4N A;  1MHH E;  3LDZ E;  3H7P A;  2ONQ A;  4GB9 A;  2BF8 B;  2ZJD A;  2PMV A;  1WYW B;  3ZJT A;  4AWJ A;  2G45 B;  5G5G A;  3TEX A;  1V1O A;  1P0R A;  2MWS B;  2WQY B;  1TS2 A;  3AU4 A;  4G0N B;  1XT9 B;  3APF A;  2C7N B;  3N9Y C;  2KMM A;  4LDT D;  1C79 A;  4W9C A;  1WXM A;  3IVF A;  4FXC A;  2JYT A;  2JXX A;  4OW0 A;  2WXR A;  3N32 A;  2KFK A;  3VTU A;  4HWI B;  2L1A A;  3WAL A;  4PYU A;  3L54 A;  4OHJ A;  3HM6 X;  2BWE S;  1QOA A;  4LLG M;  1J0G A;  1YJ1 A;  3TEW A;  5E6O A;  2AQ1 B;  2WXP A;  1R4N B;  1WR1 A;  3VH3 B;  4NAW B;  3JSV B;  1WX9 A;  3U2S C;  4WJP A;  1T0Y A;  1YMH E;  1ET9 A;  1UGM A;  1NI3 A;  2L0F A;  4K7S A;  1SE2 A;  1FM0 D;  4HPL B;  1K8R B;  2BYT A;  1WRI A;  4KX6 B;  2KDE B;  4HCN B;  1M94 A;  1T0S C;  1J7B A;  2D3G A;  3Q3N C;  3R2T A;  1P98 A;  2BS3 B;  3Q69 A;  3DCG A;  4PS7 A;  4A90 A;  5JH5 C;  1OQY A;  4PS8 A;  4LNK A;  3P4Q B;  2RDG A;  2JXT A;  2QJL A;  2WDQ B;  4REZ A;  3X0W A;  1WE7 A;  1WX7 A;  4ARI A;  1WX8 A;  1NVI D;  3EA6 A;  1GG3 A;  1ZE3 D;  3H8H A;  2ZVN A;  4FHK A;  1JQ4 A;  1E6E B;  2M8S A;  4MGK E;  4MAC A;  4BBN F;  2KMC A;  1VDV A;  2GBJ A;  1NI2 A;  3TBL D;  3Q6B A;  4HRS A;  4MGZ E;  2PJH A;  4H2A A;  1ACC A;  1N62 A;  3J9C A;  3E9S A;  3UF8 A;  4XZ4 A;  4AOF A;  1BT0 A;  2O2V B;  1L2N A;  4RNA A;  5T8I A;  3I9V 1;  2N9L A;  3VTV A;  2DZJ A;  2MA9 B;  1SIJ A;  2QSD A;  1SF0 A;  2YEP B;  1YOV B;  2IDY A;  2WXH A;  4C56 C;  2AEH A;  1C9F A;  3AEE B;  3IBE A;  2YEP F;  3AE8 B;  1OEY A;  2WXF A;  2XEW A;  2ZVO A;  3SHQ A;  2WDT B;  5AZF A;  2ZPN A;  3L17 A;  3P4S B;  4KZC A;  3T3N A;  2PVO D;  4KKI A;  1JML A;  4NAW A;  2Y5P A;  3JSV A;  2LZ6 A;  5BMG A;  2VZK B;  2DAF A;  1FRD A;  3TEZ A;  2JPH A;  3PS6 A;  2TSS A;  2B76 B;  5G55 A;  1SGH A;  4G50 A;  3AXC A;  2LGD A;  4IC7 B;  3X23 A;  2L05 A;  3IHP C;  4G11 A;  1ZPS A;  4M8N A;  4NQL B;  1TKG A;  2JRI B;  3RI7 C;  1XLQ A;  2LUE A;  2N9E B;  2OED A;  2N9P C;  1ESF A;  3DQV A;  5AZG A;  2V3N A;  1I4H A;  1Q5W B;  2R2O A;  4B95 A;  1BUI C;  4MGY E;  2NTT A;  1EWY C;  2BS2 B;  2RD0 A;  2Y5B B;  2JWU A;  2WU2 B;  4TV3 A;  1EM7 A;  2C60 A;  5D3I B;  1J8C A;  5DCN A;  3OWE B;  1MI0 A;  4JE3 B;  4DHJ B;  2CHX A;  4HKZ E;  2O2V A;  1HTQ A;  1E10 A;  4OZA A;  1YN5 A;  1I42 A;  4WQM A;  4P1C C;  1NYQ A;  3BVZ A;  3OJ4 B;  3N3K B;  4RGT A;  1ENF A;  3BK1 A;  3ML9 A;  1VD2 A;  2FUH B;  4EUT A;  4PS3 A;  4LTU A;  2L00 B; 
#chains in the Genus database with same CATH homology
 2LVP A;  3GZN I;  3PV1 A;  3R7Q A;  3JYU A;  4EZJ A;  3H1U A;  3KVF B;  1E8Z A;  2MBQ A;  1V5T A;  2MBE A;  2L0T A;  4IM3 A;  3SDL C;  2IYD B;  2JUO A;  2V1Y A;  2G4S A;  4KIK B;  2AL3 A;  2ZCB A;  3PHX B;  4HPM B;  5D94 A;  2MQJ A;  4F7Z A;  1WM2 A;  3APC A;  2KTR A;  1E8W A;  1WGR A;  1Y8R C;  3DVG X;  3VUW A;  2KHW B;  4NJ7 A;  1GC7 A;  3RYT A;  3DBH I;  4TKN A;  1E7V A;  3DBR I;  3EEC A;  2LGY A;  2Z0D B;  3L10 B;  5CX3 A;  2GBK A;  1ZKH A;  2FID A;  3CMM B;  2O6V B;  4NNJ B;  4GMV A;  5CHF A;  1IP9 A;  4KVG B;  1LXD A;  5D6J B;  2MRP A;  2MW5 A;  3DPD A;  4P7I A;  3ZTC A;  2DZI A;  2FNJ B;  2N4F A;  2AWT A;  3Q3J A;  2DEN B;  3WAP A;  1ZGU B;  1F9J A;  2KWV B;  3SU8 X;  3VAW A;  1JRU A;  1WGG A;  4FA6 A;  3ENE A;  3ZKJ C;  2LJ5 A;  4KDL B;  4X57 B;  4NPN A;  5LXI B;  1U4A A;  4MM3 A;  1IPG A;  1WJ6 A;  3ZIM A;  1YX6 B;  2KX0 A;  2CS4 A;  4F8C B;  4YL8 A;  3EC8 A;  3ZUN A;  4B9K A;  3ZNH B;  4M8M A;  4DDG D;  4EEW A;  3HK0 A;  2KWU B;  3N30 A;  4GXB A;  5J2R A;  3APD A;  2HD5 B;  2MLB A;  3PRM B;  3DDC B;  3ZNI D;  1TZ1 A;  2KK8 A;  3UQA A;  1V5O A;  3DVN U;  3QA8 A;  3QAR A;  4EZK A;  1TBE A;  1C1Y B;  3TCA A;  2IO0 B;  3PPA A;  4FLH A;  1NDD A;  2J0M A;  1XD3 B;  4KSK C;  1WJU A;  2N7E A;  4ANX A;  2WX0 A;  5E6P A;  5DPR A;  2LGX A;  2RR9 A;  4DHJ D;  3ZO5 B;  1RRB A;  2QHO A;  1YX5 B;  4ASW C;  4JGH B;  2PPH A;  4IW0 A;  1E8X A;  1E7U A;  3KUZ A;  3KH0 A;  1LFD A;  1OEY J;  4LJO B;  2LXC A;  4IUM B;  4F1S A;  1H4R A;  4TUU A;  4JL9 A;  1EUV B;  2KX3 A;  5D7G A;  2BWF A;  4JIO U;  3V6E B;  2FCQ A;  2BKR B;  3JW0 X;  2AYO B;  3DVN V;  2J0J A;  2KLC A;  2UWQ A;  4ZRI A;  2KQ7 A;  2LRW A;  2REX A;  3LJ3 A;  2LWP A;  3TMP B;  1SIF A;  3H7P B;  1H8C A;  4GDL A;  4HK2 A;  1WZ3 A;  3M62 B;  2WYQ A;  2PE9 A;  2L7R A;  1Q0W B;  3PTF C;  1VCB A;  2CU1 A;  2LXA A;  3PLU A;  3RCZ A;  4MJS A;  1WI0 A;  5J17 A;  4E74 A;  2IY0 B;  2I1J A;  3DBS A;  2L3Z A;  1GJZ A;  2EMT A;  2KJ6 A;  1AAR A;  4FUL A;  3NY5 A;  2N7D A;  2K8C A;  4KV2 A;  4KIK A;  4LDT B;  2KZR A;  1SE9 A;  3ZNZ B;  3CF6 E;  2HTH A;  4I6P A;  4A3O A;  4PYZ A;  4EOY A;  3M95 A;  4KZ0 A;  2KLG A;  2KMA A;  3RUL A;  2VRR B;  2YVC A;  2KFK B;  1WFY A;  2RGF A;  2FCS A;  3QC8 B;  2M0X A;  2V4L A;  2O6V A;  4CHK A;  1WZ0 A;  5EDS A;  3ALB A;  4II2 B;  2KDF B;  4W9D A;  2KWC A;  2FCN A;  1KM7 A;  1WMH B;  2JWZ A;  4MGI E;  4ANU A;  4BKS D;  1UEL A;  3A4S C;  4J6I A;  4BKT A;  1UBI A;  3Q3F A;  1L7Y A;  3MJW A;  5TR5 A;  2JVC A;  3DBL I;  5J18 A;  2LI5 A;  1P3Q U;  3HM3 A;  3VH4 B;  4FJV B;  3PVL A;  1MG8 A;  3QX1 A;  1RLF A;  1WJ4 A;  4JLC A;  1NBF C;  2K1F A;  5CHW A;  2M1M A;  3PT2 B;  2Z59 B;  2B3A A;  2CHW A;  4MEM A;  3W1S A;  2L76 A;  3ZVV A;  2ZNV B;  2KAN A;  5AZH A;  2JY6 A;  2CKH B;  4GIV A;  3U8Z A;  5LXH A;  2ZNV C;  4W9F A;  2ZPY A;  3KYC D;  3RD2 A;  2KO3 A;  2R2Q A;  2M17 A;  3QWZ B;  4KSL C;  3PZD A;  3ML8 A;  2MX2 A;  1D3Z A;  1TGZ B;  1WR6 E;  3T8M A;  1OGW A;  3TL5 A;  1G6J A;  1UZX B;  3P2B A;  5FR6 A;  3ZRF A;  4IG7 B;  2IBI B;  1UH6 A;  4K81 A;  4HXD A;  2A4Z A;  3OJ3 A;  4BVU C;  3R3M A;  2GBR A;  2G3Q B;  1WF9 A;  1WJN A;  2KJR A;  2UYZ B;  4K1R B;  2C7M B;  3DVG Y;  2K6Q A;  3QQ8 B;  2HJ8 A;  2LD9 A;  4HDQ A;  4AUQ C;  4E3C A;  2JRH A;  1V86 A;  2LVO A;  4FBJ B;  2MCN B;  2RPQ A;  1CMX B;  2V3S A;  2KKC A;  2ZZP B;  4FHJ A;  4WWO A;  1LM8 B;  2M4N A;  4WWN A;  3ZDM C;  3LDZ E;  3H7P A;  4GB9 A;  4WJQ A;  2BF8 B;  2ZJD A;  3M3J A;  1P9D U;  3W1S C;  4W9H A;  4TQ1 A;  4M0W B;  3M63 B;  2BPS A;  4DDI D;  1WYW B;  1I35 A;  3MTN B;  2MSE D;  4GU2 A;  4AWJ A;  2G45 B;  2NBV B;  2JZZ A;  1P0R A;  2MWS B;  3ECI A;  4B6W A;  3GOE A;  4URK A;  4ICU A;  3PHW B;  4WWP A;  3AU4 A;  3VQI A;  4G0N B;  3HHM A;  1XT9 B;  4DHZ E;  3APF A;  2C7N B;  3QK0 A;  5JZE B;  3ONS A;  4LDT D;  3VUY A;  4W9C A;  3CSF A;  4IM2 A;  1WXS A;  1WXM A;  1WGD A;  2NBW B;  3IVF A;  3B1L X;  3VVW B;  2FCM A;  2DYB A;  4FAD A;  2KVR A;  4W9I A;  2DZM A;  2JXX A;  2NPT B;  2XK5 B;  4W9E A;  4HCP B;  3VXW A;  3N32 A;  2KC1 A;  2KFK A;  3H6N A;  2RSU A;  2CR5 A;  2MBO A;  1PQS A;  4IWO A;  1E8Y A;  2AL6 A;  4BKG A;  2DX5 B;  3H7S A;  3VTU A;  2BGF A;  2KOX A;  3OLM D;  4N9F 4;  5E6N A;  4HWI B;  1WGY A;  1IYF A;  5HKH A;  1WMH A;  3WAL A;  4DHZ B;  4EKU A;  4AJW A;  2D10 A;  4PYU A;  3L54 A;  4AP4 C;  2JF5 A;  3UQB A;  1V2Y A;  5C1Z A;  4AJY B;  2EKE C;  1RFA A;  2N1W A;  3HM6 X;  4XC2 A;  4G3X B;  3VHT C;  5GMV A;  2BWE S;  4LCD E;  1J0G A;  2JT4 B;  1YJ1 A;  1YD8 U;  5E6O A;  5C23 A;  2MBB B;  3L0W B;  1YQB A;  3PLV A;  1Z5S B;  4I6N B;  1WR1 A;  4W9L A;  3MHS D;  1E90 A;  4W9G A;  1FXT B;  5IAA C;  3VH3 B;  2K25 A;  4A3P A;  2D11 A;  2ZEQ A;  4HJK A;  4NAW B;  3JSV B;  1WX9 A;  4IWQ A;  4W9K A;  4WJP A;  3S2A A;  3ZTD A;  1T0Y A;  2W9N A;  3PRP B;  2C7H A;  4II3 B;  2KDI A;  2KC2 A;  2IO2 B;  1KLV A;  1UGM A;  2FIF A;  4GOC A;  4CO7 A;  4K7W A;  5BO4 B;  2L0F A;  4K7S A;  1V49 A;  3H9D A;  5CHV C;  1P1A A;  3O65 B;  4FJY A;  4HPL B;  1K8R B;  3A9K B;  2O6V D;  2KDE B;  4K7U A;  4HCN B;  3WA0 A;  1M94 A;  3ZW3 A;  4MEL A;  1V80 A;  2D3G A;  4OVU A;  1P98 A;  4JQW C;  3DCG A;  4PS7 A;  2D2Q A;  4HLE A;  5JH5 C;  1OQY A;  4PS8 A;  3KUC B;  4RMA A;  5D2M B;  3PRZ A;  1LQB A;  2XBB C;  4EFO A;  3X0W A;  1WE7 A;  1WX7 A;  4MDK E;  1WX8 A;  3WAN A;  2N9X A;  3V6C B;  1GG3 A;  4GDK B;  5DPW A;  1Q1O A;  2LVQ A;  5L95 C;  2K6D B;  2BYF A;  3OAW A;  2N1V A;  3A33 B;  4DBG A;  1A5R A;  2ZVN A;  2DYM A;  4FHK A;  2FAZ A;  3VFK A;  5CTR C;  4IWP A;  2M8S A;  3K9O B;  3ZLZ A;  2I1K A;  3A9J B;  1WE6 A;  2DHZ A;  3A1Q B;  1WXV A;  4MGK E;  4BBN F;  3C0R B;  2KMC A;  2KTF A;  4NY0 A;  3ZRC A;  1X1M A;  2DZK A;  4MSM B;  1R4M I;  2G4D B;  2GBJ A;  3B08 A;  2C5L C;  4EZL A;  1NI2 A;  3TBL D;  2C9W B;  3RZW C;  4MGZ E;  3KW5 B;  2PJH A;  3ZDT A;  4WJN A;  3A4R A;  1V81 A;  4W9J A;  2CHZ A;  3UF8 A;  4XZ4 A;  3UGB B;  4AOF A;  2KJH B;  2KN5 A;  4GGQ A;  1BT0 A;  2O2V B;  1HE8 A;  4XX5 A;  2LRU A;  3QHT A;  1S1Q B;  4HDO A;  2ASQ A;  1L2N A;  3AI5 A;  3BIN A;  2K8H A;  2NPT A;  2XK5 A;  1KOT A;  4BOS C;  3VTV A;  1RAX A;  2DZJ A;  2MA9 B;  3CST A;  1XQQ A;  3AUL A;  3R7R A;  3PGE A;  4RM8 A;  3T9L A;  2GBM A;  4TQ0 A;  3D32 A;  1ZW7 A;  1WIA A;  3QCA A;  5JHB A;  3PSE B;  4HVB A;  2AEH A;  3W1Y A;  3RT3 B;  2EMS A;  3UIO B;  4CYE A;  4MSQ B;  4OVV A;  3IBE A;  3RZF A;  1WXA A;  3WAM A;  1EF1 A;  2BKF A;  1OEY A;  2BYE A;  2GOW A;  2XEW A;  3L16 A;  4NQK E;  2MP2 B;  3ZNG C;  5JHA A;  2ZVO A;  2NCN A;  3SHQ A;  3VTW A;  1KJT A;  2WDT B;  1QZE A;  5AZF A;  3NHE B;  3KYD D;  2ZPN A;  1OTR B;  3L17 A;  3WIM A;  4KZC A;  4KDI C;  3L13 A;  3TJP A;  3EHV A;  4NAW A;  3JSV A;  2LZ6 A;  5KHO A;  3VDZ A;  2DAF A;  2ZCC A;  3QJZ A;  3KUD B;  1ISN A;  3AU5 A;  1WGH A;  2JPH A;  4WJO A;  3PS6 A;  2KTR B;  5G55 A;  3RUI B;  2KDB A;  1SGH A;  2DYO A;  4G50 A;  4WAA A;  3AXC A;  2LGD A;  4IC7 B;  3A9K A;  2L05 A;  3V62 A;  3X23 A;  5KHQ A;  3QIJ A;  3IHP C;  3NS8 A;  4G11 A;  1C3T A;  4FN2 A;  3HIZ A;  2IO3 B;  2JZ3 B;  4GSW A;  4M8N A;  4NQL B;  1WRD B;  2JRI B;  3NZU A;  4ZRK A;  1GUA B;  3U7D A;  2IO1 B;  4ZYN A;  2MBH A;  2A5U A;  2OJR A;  3V61 A;  5AEK B;  1Z2M A;  2J7Q B;  4ANW A;  2NS5 A;  2LUE A;  4WQO B;  1J19 A;  1YIW A;  4DK5 A;  1WY8 A;  3WAO A;  1UD7 A;  4GN1 A;  2K8B A;  2KXJ A;  3R66 C;  5DPT A;  2K39 A;  2N9E B;  4BFR A;  4GDK A;  2N9P C;  4BOZ B;  4NJ6 A;  3DQV A;  5AZG A;  2LAS A;  2KQS A;  3UIP B;  5IA7 A;  3L08 A;  1Q5W B;  2YLM A;  3U30 A;  2IZV B;  2R2O A;  4LJP B;  4B95 A;  4MGY E;  3A9J A;  3A1Q A;  1V6E A;  2NVU I;  2KNB A;  1UBQ A;  2RD0 A;  2Y5B B;  3BY4 B;  3QAQ A;  4MH0 E;  4TV3 A;  1EO6 A;  2HE7 A;  3I3T B;  4ICV A;  3V60 A;  4ANV A;  3B0A A;  2GBN A;  2C60 A;  4IM0 A;  4E71 A;  2PE6 B;  1TTN A;  3K9P B;  2KFJ A;  2NR2 A;  2PEA A;  4ZDV A;  1J8C A;  4A20 A;  2J0K A;  2DAJ A;  5DCN A;  3SD5 A;  4RM9 A;  2Z0E B;  3PRE A;  4DHJ B;  1EF5 A;  3IFW B;  2CHX A;  2OOB B;  2O2V A;  3VUX A;  2WX1 A;  2IY1 B;  3JVZ X;  4DXA B;  2BYV E;  3IG3 A;  1I42 A;  2D07 B;  1R4N I;  1WH3 A;  5G2N A;  5LLI A;  2WWZ A;  4BBN C;  3NZS A;  2GMI C;  3DOW A;  5DPS A;  3OJ4 B;  4GDL B;  4FJZ A;  3N3K B;  4I6L B;  1GNU A;  4BKS A;  3ML9 A;  3TIX A;  1VD2 A;  2MP2 A;  2FUH B;  3NOB A;  4ZRJ A;  3UIN B;  5L83 A;  1V9J A;  2KD0 A;  2L8J A;  4MJS B;  1WM3 A;  4PS3 A;  4EUT A;  4DWF A;  1S3S G;  1E5W A;  2NBU A;  1GC6 A;  3EFU A;  2L00 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...