2CKHB

Senp1-sumo2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title The Structure of Senp1-Sumo-2 Complex Suggests a Structural Basis for Discrimination between Sumo Paralogues During Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ckhB00
4MEMA 2QHOA 5DPTA 2G3QB 4K7SA 2JZ3B 5E6PA 3DDCB 3HK0A 3R66C 2UYZB 4W9LA 3ZNZB 1WXVA 4WQOB 2W9NA 3WANA 4ASWC 4WAAA 1JRUA 4PS7A 1GUAB 5LXIB 2LASA 4KDLB 1G6JA 2REXA 3S2AA 4JQWC 4DHZE 2KVRA 4TUUA 2MBQA 3DOWA 2O6VD 2DENB 3ZTCA 4FA6A 1RFAA 3WIMA 1GNUA 3OAWA 2K8BA 2KJHB 3RYTA 2KTRB 4NY0A 3M62B 2KTRA 1EF1A 3M3JA 3RD2A 2CHXA 5JZEB 4MELA 2KQ7A 3EHVA 3CMMB 3DQVA 3KUDB 3TCAA 1RLFA 2NS5A 3VUYA 2KC1A 4N9F4 3QAQA 4HLEA 5LXHA 2G4SA 2LUEA 3PGEA 4DWFA 2WX0A 3ZUNA 1YD8U 4HDOA 1WGGA 3DBSA 2LRUA 3Q3FA 2K8CA 4AOFA 1NBFC 1WR6E 1WGHA 2JXXA 4W9IA 2NVUI 4BVUC 3PRMB 5FR6A 3KYDD 3R3MA 2VRRB 3VAWA 1E90A 1NDDA 3KVFB 4P7IA 5DPRA 1TGZB 2J0KA 4ZDVA 3HHMA 4W9GA 4LJPB 1ZGUB 4KV2A 5HKHA 5JHAA 4MGYE 2C7HA 1WXSA 2N9XA 4G0NB 4HVBA 4RM8A 1KJTA 3ZRFA 2L00B 4KVGB 1C3TA 1L7YA 3NS8A 1E7UA 2MP2B 3A1QB 3IBEA 3KW5B 2MP2A 3A1QA 4J6IA 2KZRA 4FHKA 3DCGA 2DZMA 3ZDTA 3MJWA 3W1SA 4CHKA 3SU8X 2KMAA 1XQQA 2M8SA 4W9JA 2V3SA 3L17A 4B95A 4DDID 5CHVC 4GN1A 3M95A 2JZZA 5G55A 4W9CA 1WM3A 3U30A 4NNJB 3QX1A 4HXDA 2OOBB 2FCSA 2FCQA 1J19A 3RZWC 3L08A 2FUHB 2JUOA 2XEWA 2DYOA 3JYUA 1WX9A 4W9KA 3CF6E 3AI5A 4I6LB 3VUXA 3NOBA 3ZNHB 4MJSB 3L13A 4MJSA 2AWTA 5D7GA 1WI0A 2AYOB 2ZVOA 4TQ0A 3O65B 4NQKE 1KM7A 2KQSA 2UWQA 2ZPNA 3DVGX 2HJ8A 2OJRA 4CO7A 2M0XA 2KWVB 2ZEQA 2PJHA 4DDGD 1WZ0A 1UBQA 3AU5A 3PHXB 1YQBA 4BBNC 1BT0A 1WE7A 2J7QB 3KH0A 4K7WA 3IG3A 3R7RA 3EECA 2RGFA 2ZCBA 4YL8A 4AWJA 4IUMB 3GZNI 2KXJA 5EDSA 3ONSA 4G11A 2MW5A 4AJYB 2MCNB 1YIWA 3ZVVA 3C0RB 3L16A 1WX7A 3VFKA 1V86A 5J17A 5CHFA 2WWZA 4FJYA 2IO2B 2D3GA 2LJ5A 1WH3A 2R2QA 4MGKE 1IPGA 4GB9A 2Z59B 5L83A 4I6PA 1WJ4A 2K6DB 3A4RA 4G3XB 1EUVB 4LCDE 2CKHB 2MBOA 5DPWA 1X1MA 3V60A 4AP4C 1WY8A 2FNJB 5J18A 2CHWA 2KFKB 2KWCA 2MX2A 4I6NB 2KFKA 4BOZB 3N30A 4OVUA 3MTNB 2KDIA 3NY5A 2C7MB 2RPQA 2KO3A 2C9WB 2K25A 4HJKA 3LJ3A 1WJNA 2NBUA 2FCMA 2C5LC 4KIKB 2EMSA 4IW0A 2HTHA 4KIKA 3QCAA 2ZNVC 4X57B 1WXMA 4TKNA 1TBEA 1XD3B 2DX5B 3QK0A 5KHOA 2FIFA 1WM2A 4IM0A 1Q0WB 2ASQA 5JH5C 2XBBC 4PYUA 5E6NA 2MBBB 1I35A 3RCZA 3A4SC 5AZHA 2C60A 2KLCA 5CTRC 4XC2A 2NBVB 1YX6B 1V49A 1UH6A 2N7DA 3WALA 2Y5BB 4HK2A 2KDFB 2MWSB 5KHQA 1U4AA 4AUQC 1GJZA 2FIDA 1V5OA 2GOWA 2M1MA 2R2OA 4FLHA 2HE7A 3QC8B 1GG3A 5C23A 3UIPB 2N9EB 3VQIA 3L0WB 4IWPA 1ZKHA 3HIZA 2DZIA 4GU2A 2L0TA 5CHWA 3VHTC 2D11A 3JSVB 3JSVA 4K81A 1NI2A 2JRHA 5LLIA 1WJ6A 5CX3A 3BINA 3U7DA 1LFDA 2LGDA 2A4ZA 3I3TB 3TMPB 3WAPA 2IY1B 1WIAA 2N9PC 4F8CB 3QJZA 4FHJA 1FXTB 4K1RB 2MLBA 4HWIB 5C1ZA 2KMCA 2DZKA 1Z2MA 1UZXB 3UGBB 3ZRCA 2KNBA 5AZFA 2RD0A 4F1SA 3VVWB 4GIVA 3ZNID 3ZW3A 2RSUA 2GBMA 3QQ8B 1RRBA 2LWPA 3V6EB 4WJQA 4GGQA 5D2MB 3H7SA 4CYEA 1T0YA 2BWES 3D32A 4NPNA 2DYBA 4XX5A 3DBRI 3GOEA 3PTFC 4WWOA 3DVNU 5TR5A 3DBHI 3OJ4B 2AL6A 2DAFA 4IWQA 2D10A 2MA9B 3AXCA 4A3PA 2WX1A 1S3SG 2GBNA 3ECIA 4IM3A 2IO0B 4KZ0A 1ISNA 3DVNV 4EEWA 3KUZA 4HDQA 4HPLB 4WWPA 2M4NA 2RR9A 3T9LA 4GDKB 4IG7B 2KTFA 1EO6A 4ICUA 3KUCB 3ALBA 2D2QA 4GDKA 5G2NA 3DBLI 2ZVNA 4ICVA 1D3ZA 1OGWA 2YLMA 2PEAA 4ANUA 5GMVA 1MG8A 2KKCA 3PZDA 2KANA 3VH3B 3VTWA 4TQ1A 1Q5WB 3QA8A 4MGZE 2GBJA 3APDA 2AL3A 1UBIA 2LI5A 2LZ6A 3PRPB 4MH0E 2Z0DB 1P0RA 4BKSD 3B08A 3RZFA 3UQAA 1WX8A 2GBRA 4FULA 3EC8A 1VCBA 1V5TA 1YJ1A 3R7QA 2KWUB 2DHZA 1E7VA 4GOCA 4JLCA 3QWZB 3PT2B 4DHZB 2JPHA 3PLUA 4ZYNA 2Z0EB 3ML8A 2NBWB 2IY0B 1F9JA 3DPDA 2MQJA 2EMTA 3L10B 4NJ6A 2BKRB 2JT4B 4LDTB 1Y8RC 4RM9A 1WR1A 2BYEA 4NJ7A 4OVVA 3VTUA 1J8CA 3IHPC 5AZGA 2J0JA 3N32A 2KK8A 3SDLC 1CMXB 2L8JA 1KOTA 4IC7B 1TTNA 3CSTA 1RAXA 2BPSA 3HM6X 1P1AA 4B6WA 1OQYA 2KJRA 4TV3A 3RUIB 1V6EA 5IA7A 3KYCD 2IBIB 1YX5B 2DAJA 3VH4B 5AEKB 3L54A 1WMHB 2V1YA 3K9OB 4WJNA 1WMHA 4EKUA 1SGHA 1VD2A 3AU4A 2ZCCA 2WDTB 4KDIC 3NZSA 4JIOU 2JWZA 2GMIC 3T8MA 3MHSD 1WGRA 1KLVA 3WAOA 2KHWB 1V9JA 1SIFA 2JRIB 2JVCA 2LRWA 1UD7A 2C7NB 3RULA 4DHJB 4FN2A 3ML9A 4LJOB 2NPTB 2NPTA 3VUWA 2L05A 3RT3B 4BKSA 1LXDA 3N3KB 1V80A 1OEYA 3IVFA 2ZNVB 4GSWA 1ZW7A 2JF5A 4II2B 2BF8B 1WGDA 1IYFA 1V2YA 4KZCA 1C1YB 5BO4B 3A33B 2ZJDA 3SHQA 2YVCA 4ZRJA 3HM3A 2LVOA 3PPAA 4MGIE 3V61A 4EFOA 3JVZX 5DCNA 3PSEB 1OEYJ 3H7PB 3Q3JA 2KN5A 2LD9A 3H7PA 3QIJA 4E71A 2WYQA 4M0WB 4BKGA 1E8YA 3ENEA 2K39A 1PQSA 2KX0A 4WJPA 2L76A 4IM2A 2IZVB 4WJOA 2FCNA 2KC2A 4EZKA 2FAZA 2M17A 1UGMA 3NZUA 4E3CA 4KSKC 1XT9B 4LDTD 2O2VB 3B0AA 3APCA 3NHEB 3U8ZA 2O2VA 2I1JA 4ANWA 4DXAB 4RMAA 4EOYA 3DVGY 4MM3A 2N4FA 2NR2A 4MSMB 1GC6A 3ZLZA 1WRDB 3QHTA 2ZPYA 4GDLB 2N7EA 1Q1OA 2L0FA 4FJZA 4GDLA 4M8NA 2L7RA 5D6JB 3P2BA 5J2RA 2LGXA 3WAMA 1S1QB 1AARA 3TJPA 4F7ZA 3BY4B 5D94A 4W9FA 3X0WA 1UELA 2LVPA 1I42A 4NAWB 4FJVB 3APFA 2IO3B 3CSFA 4NAWA 3W1SC 5IAAC 1WZ3A 1HE8A 3H9DA 3OJ3A 2EKEC 4II3B 1WF9A 3UIOB 4BKTA 4DK5A 5E6OA 1WXAA 2LGYA 5L95C 2K6QA 2KD0A 4AJWA 3PHWB 1A5RA 2CU1A 3PV1A 4B9KA 2MSED 1R4MI 4WWNA 4PS3A 2BKFA 4G50A 1E5WA 3ZO5B 2N1WA 2KDEB 4DHJD 1L2NA 1IP9A 3V6CB 4BFRA 3H1UA 4FADA 2KLGA 1LM8B 4KSLC 4M8MA 3ZTDA 3PRZA 2I1KA 5DPSA 4PYZA 3JW0X 4PS8A 2V4LA 1LQBA 1M94A 2KX3A 2KJ6A 1TZ1A 2LVQA 2LXAA 2J0MA 2O6VA 2BYFA 2O6VB 2ZZPB 3K9PB 4W9EA 3UF8A 4XZ4A 1SE9A 1J0GA 3H6NA 4BOSC 2XK5B 4W9DA 4GXBA 2XK5A 2MBHA 4NQLB 3ZIMA 2N1VA 2CHZA 3PS6A 1P9DU 3QARA 3W1YA 4A20A 4MSQB 4JL9A 2KFJA 2CR5A 1WYWB 1WJUA 5JHBA 4A3OA 4DBGA 4EZJA 2PPHA 3VXWA 4BBNF 2MRPA 3UQBA 2HD5B 2KOXA 3UINB 3SD5A 1GC7A 1R4NI 2KDBA 3M63B 2G4DB 3TBLD 1E8WA 2BGFA 4W9HA 1H8CA 4ZRKA 1K8RB 2IYDB 2JY6A 3ZDMC 1P3QU 3A9KB 2BWFA 4JGHB 3ZKJC 3A9KA 2PE9A 4EZLA 2PE6B 4EUTA 2G45B 2MBEA 1QZEA 2IO1B 1E8ZA 3VTVA 3B1LX 3TL5A 2L3ZA 4HCNB 1WGYA 3PREA 3VDZA 4URKA 2D07B 4IWOA 4HPMB 3PLVA 3LDZE 3EFUA 4ZRIA 3PVLA 1P98A 3TIXA 3WA0A 1WE6A 3OLMD 1EF5A 2LXCA 1H4RA 4FBJB 4E74A 3V62A 1Z5SB 3ZNGC 2K8HA 3AULA 2DZJA 2B3AA 2GBKA 3IFWB 4HCPB 2A5UA 4MDKE 1V81A 3A9JB 3A9JA 1E8XA 2AEHA 2NCNA 4GMVA 4ANXA 1WFYA 2DYMA 2CS4A 2BYVE 2K1FA 1OTRB 3X23A 4ANVA 4K7UA
chains in the Genus database with same CATH superfamily
4GLSC 4MEMA 2V0GA 2JZ3B 2JU6X 1UNSA 1HQRD 2GI9A 4WIPA 3SR6A 1D5MC 3S2AA 4JQWC 2K3UA 2KVRA 4OHJA 2DENB 4FA6A 3KLSX 3T3OA 1GNUA 2K8BA 1FNUA 2KJHB 3RYTA 3M62B 1VZ6A 2KTRA 1EF1A 3TCAA 4WQMA 3PGEA 4MT5A 4DWFA 4US8A 4HDOA 1WGGA 1MHHE 3Q14C 2LRUA 3Q3FA 4AOFA 2JXXA 4LNIA 1E90A 1NDDA 5DPRA 4P16A 1TGZB 2J0KA 4ZDVA 2ICIA 4W9GA 1ZGUB 1XLOA 1DOIA 5HKHA 4JWUC 5BYQA 4G0NB 3ZRFA 1KH0A 2H88B 1E7UA 3KW5B 3Q3MC 3AECB 3CIRB 3AV8A 3DCGA 3ZDTA 1FFVA 4YT0B 1TYGB 1C77A 4HJGE 4W9JA 4DDID 1XCQL 4W9CA 1WM3A 2RDBC 4LK0M 1ACCA 2FUHB 4W9KA 3VUXA 3EGRA 1CJEA 1WI0A 2AYOB 1VZ8A 3L4PA 4OZCA 4TQ0A 2JSVX 1KM7A 1JWUD 4BBNC 5HHDG 2Y5PA 1EWYC 3I5JC 3AE7B 3R2TA 4A55A 3R7RA 5EE9A 3P1MA 3EECA 4ZHPA 3GZNI 2KXJA 1OQQA 2QMTA 1I4GA 1YIWA 3ZVVA 3C0RB 3NG0A 5J17A 3EA6A 2BS3B 3RFZB 4FJYA 1VR9A 3N1ZC 4MGKE 1ZE3D 2Z59B 5L83A 2L83A 4I6PA 4LCDE 4YTPB 1X1MA 3MP9A 4I6NB 2KFKB 1TJEA 4M01A 4YSZB 3TEYA 1FEHA 2PIAA 2EMSA 1HTQA 4IW0A 4KIKA 1TS4A 4L23A 3RN9C 3NVWA 2K5PA 2MBBB 5AZHA 5CTRC 1V49A 1UH6A 2N7DA 4JX1C 4LNKA 5KHQA 1U4AA 4AUQC 1GJZA 2M1MA 3UIPB 1FFUA 2V9HA 3L0WB 3HIZA 1RYJA 2L0TA 2D11A 3JSVB 4K81A 5BMGA 4YXDB 1XCTL 2LGDA 3TMPB 3WAPA 1MG4A 2IGDA 4F8CB 1HZ6A 4H2AA 4HWIB 1JWSD 2KMCA 1Y56A 2WS3B 5AZFA 2NMQA 2QCZA 1DOXA 1C76A 2KT7A 3ZW3A 1QOGA 2RSUA 3QQ8B 1WGKA 1RRBA 3W9CB 3V6EB 4WJQA 1VZ7A 1T0YA 3D32A 1E7PB 4M00A 3PTFC 1XLNA 2MA9B 3V05A 4A3PA 2GBNA 2DWQA 1ISNA 1ZXIA 1GAQB 4RGMA 3T9LA 4GDKB 5G2NA 2PEAA 1MG8A 2PW9A 3Q69A 1UWXA 3QA8A 3APDA 3GB1A 3DHGC 3UQAA 2GBRA 1XLQA 4Q2JA 1BXTA 1V5TA 2WLBA 2DHZA 1E7VA 4JLCA 1FRDA 3QWZB 1I4PA 1FNVA 1UGJA 2EMTA 3L10B 4N58A 4KGTA 4P6VF 3SDLC 4IC7B 1RWSA 5AEKB 1WMHB 2V1YA 1I7HA 3RNAC 4B0MA 4KDIC 4JIOU 4OVZA 2JWZA 1V8CA 1YN5A 2JZPA 5C3JB 2JRIB 2JVCA 3VRBB 1UD7A 2C7NB 4C56C 2INDC 4DHJB 4LJOB 2NPTB 3AEBB 2D3BA 1LXDA 2K22A 1V80A 5JXVA 1OEYA 3IVFA 4GSWA 2BF8B 1WGDA 5IKCM 1IYFA 1QT9A 3SHQA 2E6XA 2OJWA 4MGIE 3JVZX 5DCNA 3PSEB 4HROA 3H7PB 4LLGM 3U4EG 4M0WB 4BKGA 1IUEA 2VZKB 3HUIA 2N9KA 3FILA 2K39A 2KX0A 4IM2A 2IZVB 2QC8A 3ZJUA 2FAZA 2M17A 1UGMA 3NZUA 4KSKC 4LDTD 2O2VB 3U8ZA 5IOIA 4MM3B 3ZLZA 2L0FA 4FJZA 4GDLA 2M19A 2BYTA 3P2BA 5J2RA 1QOAA 3WAMA 3TJPA 2HJ1A 2VH2A 4FJVB 4NAWA 3CSFA 1WYGA 3OJ3A 1VRAB 1JMLA 2K6QA 2KACA 4AJWA 4DXGA 2MSED 1R4MI 4P1BC 3RPFC 4G50A 3ZO5B 2N1WA 4XDDA 3V6CB 2ON8A 5AUIA 3ZTDA 2VH1A 2BS2B 3VR9B 3PRZA 1T3QA 1PDXA 1LQBA 1M94A 2LXAA 4W9EA 1J0GA 2E3TA 4GXBA 4NQLB 1J7AA 4YTNB 1V1PB 3IT6B 1P9DU 4A20A 1BMLC 3Q6BA 2CR5A 1DOYA 2LEKA 2LGSA 3I63C 4BBNF 2MRPA 3SD5A 2UU7A 2BGFA 4W9HA 4ZRQA 2JY6A 1I4HA 3ZKJC 3A9KA 1XLPA 2MBEA 2IO1B 3B1LX 4HCNB 1NYRA 4S0RA 3PVLA 1P98A 3PZ8A 1V1OA 3FC4A 4US9A 2OHFA 3IFWB 1YNTE 1C79A 1E8XA 2NCNA 3T3NA 3SFEB 2YEPF 2WDQB 2K1FA 3AE5B 3X23A 4K7UA 5DPTA 2G3QB 5E6PA 4UDUC 3DDCB 1JWAD 1KF6B 4W9LA 5G5GA 5AUKA 4WQOB 1XXGA 1QF6A 3WANA 4ASWC 1JRUA 1GUAB 1G6JA 3ZTCA 2O6VD 1N6ZA 1RFAA 1FNWA 2KTRB 3P42A 4NY0A 3M3JA 3RD2A 5JZEB 4MELA 1RLFA 3VUYA 2KC1A 3R2IA 4HLEA 2G4SA 1LO5D 2KQ4X 2LUEA 3AB5A 2H89B 3ZUNA 1QILA 3DBSA 4OZAA 1R4MB 1WGHA 3U52E 1VDVA 4BVUC 3PRMB 2LGIA 2WXJA 3R3MA 3VAWA 4NJCA 4C00A 2AQ2B 3KVFB 4IKGA 1D5ZC 2GB1A 2LFIA 4HVBA 4RM8A 1KJTA 1F77A 1L7YA 4CQNA 4OZBA 2MP2A 3A1QA 3TEWA 3URYA 3SEBA 2R61A 3MJWA 3W1SA 4MH8A 2KMAA 4B95A 4DXFA 4GN1A 1PFDA 2JZZA 2OEDA 4HXDA 2BB6A 3TEXA 3RZWC 3L08A 2XEWA 2DYOA 1WX9A 3W5UB 4I6LB 3L13A 4MACA 4CO7A 2M0XA 2N7JA 2PJHA 1WXQA 2WXIA 1UBQA 1OFFA 4N59A 1WE7A 2J7QB 2N9LA 3FAHA 4K7WA 3IG3A 1TS5A 2ZCBA 4AWJA 4IUMB 1T5XD 1TY2A 4G11A 3AEAB 4AJYB 2LUMA 1C4PA 4FXCA 2D3GA 1IPGA 4GB9A 3AE3B 2X8XX 2K6DB 4G3XB 1EUVB 5DPWA 3V60A 3W5VB 1WY8A 2FNJB 4AP4C 4YSXB 5J18A 2KWCA 2DBYA 2KDIA 2RPQA 2C9WB 1WJNA 2V3NA 1T6BX 4KIKB 4X57B 2ZNVC 4TKNA 2WGSA 3QK0A 2FIFA 3RNEC 2ASQA 5E6NA 1I35A 3RCZA 2C60A 1FXAA 1YX6B 2J53A 1AN8A 2J4XA 2MWSB 2GOWA 1ZP0B 2HE7A 1GG3A 2DZIA 4GU2A 2BTEA 4HEA1 1WJ6A 3BINA 3Q3OC 1LFDA 2A4ZA 4RNAA 2IY1B 1WIAA 3P4RB 2KYWA 3QJZA 2MLBA 2DZKA 1GOZA 1K53A 4F1SA 1AWDA 3ZNID 2J42A 3NS1A 3AEEB 1F52A 1FRRA 3FKYA 2WXPA 1DGJA 4ITKA 3N9YC 4XWWA 2DYBA 3GOEA 4WWOA 4RGNA 3DVNU 2AL6A 1F0ZA 2L1AA 4ZHOA 4IM3A 4KZ0A 1YOVB 4WWPA 2M4NA 4IG7B 1EO6A 3KUCB 1D3ZA 2GBJA 1UBIA 2AX5A 3B08A 2W54A 4FULA 4A8XC 3EC8A 4WURA 2D5GA 3PT2B 4DHZB 3PLUA 2MQJA 2JT4B 4RM9A 4JWSC 4OVVA 2PKOA 1MHXA 4S17A 5AZGA 2KK8A 4YSYB 3WCQA 1FM0D 3HM6X 4M02A 5FKAC 1V6EA 3PO0A 1YX5B 3VH4B 3MHZA 4WJNA 1XO3A 2D3AA 1ET6A 2ZCCA 3NZSA 2GMIC 1FPYA 3Q2AC 1KLVA 2KHWB 1V9JA 2D3CA 2LRWA 2ZW0A 4PK1A 1L0VB 3VUWA 2CJNA 1SBBB 1UUPA 3N3KB 2ZNVB 4II2B 3W2DA 3E9SA 4KZCA 1JALA 1CQVA 5BO4B 4RF1A 1TIFA 3IXSA 2INCC 3HM3A 5FR3A 3V61A 4ARCA 1OEYJ 2L32A 4E71A 3QIJA 2IDYA 3R8BA 3NRZA 3FILB 3ENEA 1I4RA 4YTMB 1YN4A 2FCNA 1SF0A 1XEEA 3TUOA 1IGDA 3APCA 4DXAB 4ANWA 4EOYA 2I2YA 2INNE 4L2YA 1GC6A 1WRDB 4GDLB 4LNOA 2L7RA 5D6JB 4ZRPA 4RCOA 1FD6A 1KTKA 3BY4B 3X0WA 2LVPA 1IBXA 1I42A 1YQ3B 4NAWB 2L52A 3W1SC 5IAAC 2Q5WD 1JW9D 1HE8A 1TY0A 4II3B 1WF9A 4XYCA 3Q8CA 5E6OA 2LGYA 1A5RA 3PHWB 4PS3A 2BKFA 2GRIA 2Z8LA 4DHJD 1L2NA 4FADA 2B76B 4M8MA 5DPSA 4PYZA 3AE1B 3JW0X 4PS8A 2V4LA 1L0YB 1TZ1A 2ZZPB 1SE9A 4W9DA 2PVOD 2HDEA 2NTTA 2N1VA 2CHZA 3PS6A 3RNGC 2WXMA 4ZYSA 2VZKD 1E6EB 3B9JA 4AQ7A 4N6EB 4A90A 2QJLA 5JHBA 3ZQ4A 5BMHA 1R4NI 2KDBA 2AQ1B 1H8CA 1KLUD 1NEKB 3A9KB 1WRIA 3NVYA 4EZLA 1E8ZA 4XDCA 2EELA 3PREA 4URKA 2D07B 3TIXA 3RNFC 1STEA 2IGHA 1EF5A 1C9FA 4E74A 1K51A 1Z5SB 3ZNGC 3DWMA 2B3AA 3A9JA 3LYYA 2DYMA 2CS4A 4ANVA 5G5HA 2QHOA 3RI7C 4K7SA 3P4SB 3R66C 3ZNZB 4WAAA 4PS7A 5LXIB 2LASA 4KDLB 2REXA 1N5XA 1J7BA 3WIMA 1M4VA 3AE9B 2ZW1A 4C4VA 1CK1A 3ZYYX 2CHXA 3EUB2 2NS5A 1TS3A 3QAQA 4N9F4 3BYTB 2WHIA 2WX0A 1FCLA 1TT5B 1L5PA 3DWGC 3ZJVA 5FR6A 3NVVA 3KYDD 2WDRB 2AQ3B 4WH4A 1NI3A 3HHMA 4PT5A 2N9XA 2L00B 3MC8A 3GE8C 3HVZA 3NS8A 2BT6A 2MP2B 2FE8A 3A1QB 4J6IA 1T0QC 2KZRA 1ZDVA 4CHKA 1L4ZB 2PVGC 2M8SA 2V3SA 5CHVC 1VLBA 1PYWD 5H92C 2J52A 1WSPA 5G55A 2RPVA 3U30A 3QX1A 4B0EA 2OOBB 2FCQA 1R4NB 3DHIC 2JUOA 3JYUA 3CF6E 3ZNHB 4MJSA 5D7GA 1SE2A 2ZVOA 2ZPNA 2HJ8A 4BZAA 2PMVA 5BYRA 2ZEQA 4DDGD 1WZ0A 3B2FA 3BZDB 4HPPA 3AE4B 3KH0A 1FO4A 1EU3A 1OTRB 4YL8A 1MJDA 1XF5L 5EDSA 3IAM1 4NZLB 1WX7A 3VFKA 2MHJA 1K50A 2WWZA 2MEKA 2LJ5A 1HXYD 3BVGA 2MH7A 4HKQA 2M0AA 5EE0A 1WJ4A 5GXGB 1FCCC 4BOZB 1ROEA 4OVUA 3MTNB 3NY5A 3Q8FA 4LTUA 2KO3A 2K25A 3I57A 1TKYA 3NZ3A 2XN9C 2NBUA 2FCMA 2C5LC 1N62A 2HTHA 1WXMA 2DX5B 2WXRA 1WM2A 1C4AA 1Q0WB 5JH5C 2XBBC 3A4SC 4KX6B 2NBVB 4HK2A 3BVMA 5H8YE 4FLHA 5C23A 2QDFA 1C4CA 1MI0A 2N9EB 2KAJA 3VHTC 1ZKHA 2WDVB 1TS2A 2JRHA 5LLIA 1Q10A 5CX3A 1I4XA 1ET9A 5MPOA 2N9PC 5D3IB 4K3BA 1FXTB 4K1RB 5C1ZA 2IJ0A 1UZXB 3ZRCA 2KNBA 1JWBD 3BYYB 2BQQA 2BB5A 5EE1A 2WXNA 2GBMA 1ENFA 5I4DA 4ARIA 3N1XC 3H7SA 4CYEA 1K52A 1E10A 4XX5A 3DBRI 2DAFA 4IWQA 4BAXA 3ZGZA 3U2SC 3ECIA 2IO0B 4EEWA 1GPXA 1OQRA 4HDQA 4HPLB 1QOFA 1L0XB 2RR9A 2MJEA 4ICUA 2D2QA 2ZVNA 5BYSA 2YLMA 4ANUA 5GMVA 2KKCA 1JWMD 2KANA 4TQ1A 3PRPB 2LZ6A 4MH0E 3NUHB 1P0RA 3RZFA 1WX8A 3AEDB 3RNCC 2Y3AA 1VCBA 1YJ1A 4KKIA 3ZXVA 2HTME 4GOCA 1KLGD 2WXQA 2QIEB 5BMIA 3GS2A 2Z0EB 2NBWB 1F9JA 3B2GA 3DPDA 4HKZE 2MJDA 1Y8RC 1WR1A 2BW2A 2WP9B 2WXKA 4ACFA 4JPSA 2J0JA 3N32A 1TTNA 3CSTA 1RAXA 1P1AA 1N61A 3RUIB 3BK1A 2IBIB 2DAJA 3KQ4A 2QILA 3L54A 3K9OB 1NENB 1SGHA 3AU4A 1JCKB 1HA5A 3GP7A 3WAOA 2WNMA 1SIFA 1SEBD 3RULA 3AEFB 3EFCA 4XWTA 1GB4A 2L05A 3RT3B 4BKSA 2GLSA 1ZW7A 3ABVB 4RGTA 1V2YA 1YJJA 1C1YB 2JX5A 2ZJDA 2WXGA 2YVCA 2WXHA 4EFOA 2LVOA 1BUIC 2JQRB 2LD9A 4KGRA 3TSSA 1E8YA 3H8HA 3DBRB 2LHDA 2BBCA 2RDGA 2KC2A 3C8YA 4E3CA 1XT9B 3NHEB 3B0AA 1QQRA 2I1JA 4RMAA 3DVGY 2WXFA 4MSMB 4RF0A 3MJ5A 1NYQA 3QHTA 2ZPYA 1A70A 2N7EA 1Q1OA 4M8NA 2LGXA 3Q8EA 1S1QB 4W9FA 1IBXB 4XE0A 1UELA 5HG2A 1DYQA 3OG5A 5HFYA 1SB3C 1WZ3A 3H9DA 2EKEC 4BKTA 4DK5A 1WXAA 1EWCA 5L95C 2KD0A 2CU1A 3PV1A 1RM6C 1MFWA 1E5WA 2KDEB 1IP9A 4BFRA 3H1UA 2KLGA 1LM8B 4KSLC 1SE4A 1T0RC 1YQ4B 2FBWB 5EE3A 2I1KA 3WA0A 2O6VA 1E0ZA 4LNNA 4BOSC 1L6VA 1P7EA 2XK5A 1IGCA 2MBHA 3ZIMA 1ZUD2 4C7YA 4KGSA 3QARA 3MC0B 2EKIA 4A3OA 4DBGA 3VXWA 2KVZA 2KOXA 3UINB 1GC7A 3M63B 2M56B 1F1HA 3DHHC 2SAKA 1GB1A 1JRPA 4NAMA 1P3QU 3Q3NC 2BWFA 4JGHB 4JE3B 2PE9A 4WWMA 4EUTA 2ACZB 2G45B 4DQOC 1ZDXA 4HPMB 2INPE 3LDZE 3AE6B 1WE6A 1H4RA 4REZA 5HI1A 2K8HA 3AULA 4TMAB 2DZJA 2GBKA 4HCPB 3TEZA 1V81A 3A9JB 3KWVA 4GMVA 4ANXA 1WFYA 4J3OD 3N1YC 2PTLA 4D2KA 2WU5B 3HK0A 2UYZB 1WXVA 1UWMA 3P63A 2W9NA 4DHZE 4TUUA 2MBQA 3DOWA 2V4IB 3OAWA 4C4VB 2KQ7A 3EHVA 3CMMB 3DQVA 3KUDB 4RGOS 5LXHA 1QKZA 1YD8U 1KFYB 2FUG1 3BK2A 2K8CA 2WQYB 1NBFC 1WR6E 3I9V1 4W9IA 1SJHD 2NVUI 2VRRB 1PUTA 2KWDA 4P7IA 1D4BA 4LJPB 4KV2A 1B1ZA 5JHAA 4MGYE 2C7HA 1WXSA 4KVGB 3IBEA 1FXIA 4FHKA 3SFDB 2DZMA 1SE3A 5T8IA 1SXTA 4YWGG 2W3SA 3SU8X 1XQQA 1WWTA 2SEBD 1I4QA 3L17A 3M95A 3E56A 3AM9A 4NNJB 2FCSA 1J19A 1N63A 2WU2B 3GZNB 3ZJTA 3AI5A 3ETRA 3NOBA 4MJSB 3NVZA 3CWIA 2AWTA 4AS1A 3GE3C 3O65B 4NQKE 3MFGA 2KQSA 2UWQA 3DVGX 2OJRA 2KWVB 1SJED 3PHXB 3AU5A 1YQBA 1BT0A 4O1NA 4USAA 1JROA 2RGFA 2JXTA 3AMZA 3BIID 3ONSA 2MW5A 2MCNB 1EM7A 3L16A 1V86A 1ESFA 5CHFA 3O13A 4TSSA 2IO2B 4XGAB 1WH3A 2R2QA 1NVID 4P1CC 2PLPA 4EE2A 1YJIA 3A4RA 5FK9C 2CKHB 2MBOA 2W82A 5E6JA 1N60A 2CHWA 2JYTA 2MX2A 2KFKA 3BWUD 3N30A 3PZ7A 2C7MB 1PGXA 2LHEA 4HJKA 3LJ3A 3QCAA 1TBEA 1XD3B 2YEPB 5KHOA 4IM0A 4PYUA 1CZPA 2KLCA 4XC2A 4OW0A 3WALA 2Y5BB 2KDFB 5IN7A 2FIDA 1QLBB 1V5OA 2R2OA 4L1BA 3ZXRA 3HVDA 3VQIA 3P4QB 4IWPA 5CHWA 3JSVA 1NI2A 1V97A 1TKGA 3U7DA 3I3TB 4FHJA 1MVKA 1Z2MA 3UGBB 1J7CA 2WXOA 2RD0A 4RFBA 2W3RA 3VVWB 3RMKC 1KRHA 4GIVA 2K9XA 1QOBA 2LWPA 2RMMA 3VRAB 3LXFA 2ONQA 4GGQA 5D2MB 2JYEA 2BWES 4NPNA 2JWUA 5D3DA 3P4PB 5TR5A 4C80A 3DBHI 3OJ4B 2D10A 3AXCA 2WX1A 1S3SG 1YN3A 4LNFA 3LB8C 3DVNV 3KUZA 2I38A 4ZOHC 2KTFA 4GDKA 3ALBA 3DBLI 4ICVA 2K0PA 1AW7A 1OGWA 2G1EA 3PZDA 3VH3B 3VTWA 1Q5WB 4MGZE 2AL3A 2BVCA 2LI5A 2Z0DB 4BKSD 1PGAA 2X38A 1N5WA 3R7QA 2KWUB 2JPHA 2NTSA 4ZYNA 3ML8A 1P7FA 2IY0B 4NJ6A 5IP4D 2BKRB 4LDTB 2BYEA 4NJ7A 3VTUA 1J8CA 5TSSA 3IHPC 1EU4A 1CMXB 2L8JA 3AE2B 1KOTA 2BPSA 2RDHA 4B6WA 1T0SC 1OQYA 2KJRA 4TV3A 1HZ5A 5IA7A 3KYCD 5IO9A 1WMHA 4EKUA 1VD2A 2WDTB 2DLBA 1ZXHA 3AH7A 3VR8B 1L4DB 3T8MA 3MHSD 1WGRA 1LGRA 1F2RC 3J9CA 2XNAC 1C78A 4FN2A 3ML9A 3V3XA 4RH6A 2NPTA 3AEGB 2JF5A 2V3PA 3BVZA 3Q8BA 2W55A 3A33B 4QAYA 1R7SA 4ZRJA 2TSSA 3PPAA 1JQ4A 1D5XC 3Q3JA 2KN5A 3H7PA 3IAS1 1HEZE 2WYQA 4M0WA 4WAFA 3AN1A 1PQSA 4WJPA 2L76A 3DBHB 1UF0A 4WJOA 1F2RI 4EZKA 4K3CA 2WXLA 2KDMA 2O2VA 1TZOA 4MM3A 2N4FA 2NR2A 1RFKA 3UI3A 3DBLB 1AARA 2LJIA 4F7ZA 5D94A 1YMHE 2QSDA 2QEJC 3APFA 1HTOA 2IO3B 1ZOYB 3NJTA 4A9AA 3UIOB 2BS4B 3MC9A 1SIJA 4IDIA 1MPEA 2CU3A 4B9KA 2IGGA 4WWNA 2KN4A 3OWEB 3QC8B 2KX3A 2KJ6A 2O6VB 1C3TA 2LVQA 3C19A 2J0MA 3K9PB 2BYFA 2DNFA 2KMMA 1L6UA 3UF8A 4XZ4A 3H6NA 1VJKA 2XK5B 4HRSA 3IT4B 1V1PA 3RNBC 1B9RA 1D6EC 3W1YA 5LNK1 1PGBA 2MJ3A 4MSQB 4JL9A 2KFJA 2IPKD 3U7ZA 1WYWB 4IOIE 1WJUA 3KWLA 4EZJA 2PPHA 3UQBA 2HD5B 1E9MA 3Q8AA 3AE8B 2N0SB 2G4DB 3TBLD 1E8WA 1ZPSA 4ZRKA 1K8RB 2IYDB 3ZDMC 4KKJA 2G9HD 2PE6B 1FMAD 1QZEA 1FIQA 3VTVA 4A6QA 3TL5A 2L3ZA 1WGYA 3VDZA 4IWOA 3PLVA 3HRDD 1AYFA 1SSNA 3EFUA 4ZRIA 3OLMD 2LXCA 4FBJB 3V62A 3N20C 2LMCA 4MDKE 2A5UA 4C7ZA 1TKEA 5C2TB 2AEHA 2Y5CA 2BYVE 2CJOA 4R3DA
chains in the Genus database with same CATH topology
4MEMA 2QHOA 5DPTA 2G3QB 4K7SA 2JZ3B 5E6PA 3DDCB 3HK0A 3R66C 2UYZB 4W9LA 3ZNZB 1WXVA 4WQOB 2W9NA 3WANA 4ASWC 4WAAA 1JRUA 4PS7A 1GUAB 5LXIB 2LASA 4KDLB 1G6JA 2REXA 3S2AA 4JQWC 4DHZE 2KVRA 4TUUA 2MBQA 3DOWA 2O6VD 2DENB 3ZTCA 4FA6A 1RFAA 3WIMA 1GNUA 3OAWA 2K8BA 2KJHB 3RYTA 2KTRB 4NY0A 3M62B 2KTRA 1EF1A 3M3JA 3RD2A 2CHXA 5JZEB 4MELA 2KQ7A 3EHVA 3CMMB 3DQVA 3KUDB 3TCAA 1RLFA 2NS5A 3VUYA 2KC1A 4N9F4 3QAQA 4HLEA 5LXHA 2G4SA 2LUEA 3PGEA 4DWFA 2WX0A 3ZUNA 1YD8U 4HDOA 1WGGA 3DBSA 2LRUA 3Q3FA 2K8CA 4AOFA 1NBFC 1WR6E 1WGHA 2JXXA 4W9IA 2NVUI 4BVUC 3PRMB 5FR6A 3KYDD 3R3MA 2VRRB 3VAWA 1E90A 1NDDA 3KVFB 4P7IA 5DPRA 1TGZB 2J0KA 4ZDVA 3HHMA 4W9GA 4LJPB 1ZGUB 4KV2A 5HKHA 5JHAA 4MGYE 2C7HA 1WXSA 2N9XA 4G0NB 4HVBA 4RM8A 1KJTA 3ZRFA 2L00B 4KVGB 1C3TA 1L7YA 3NS8A 1E7UA 2MP2B 3A1QB 3IBEA 3KW5B 2MP2A 3A1QA 4J6IA 2KZRA 4FHKA 3DCGA 2DZMA 3ZDTA 3MJWA 3W1SA 4CHKA 3SU8X 2KMAA 1XQQA 2M8SA 4W9JA 2V3SA 3L17A 4B95A 4DDID 5CHVC 4GN1A 3M95A 2JZZA 5G55A 4W9CA 1WM3A 3U30A 4NNJB 3QX1A 4HXDA 2OOBB 2FCSA 2FCQA 1J19A 3RZWC 3L08A 2FUHB 2JUOA 2XEWA 2DYOA 3JYUA 1WX9A 4W9KA 3CF6E 3AI5A 4I6LB 3VUXA 3NOBA 3ZNHB 4MJSB 3L13A 4MJSA 2AWTA 5D7GA 1WI0A 2AYOB 2ZVOA 4TQ0A 3O65B 4NQKE 1KM7A 2KQSA 2UWQA 2ZPNA 3DVGX 2HJ8A 2OJRA 4CO7A 2M0XA 2KWVB 2ZEQA 2PJHA 4DDGD 1WZ0A 1UBQA 3AU5A 3PHXB 1YQBA 4BBNC 1BT0A 1WE7A 2J7QB 3KH0A 4K7WA 3IG3A 3R7RA 3EECA 2RGFA 2ZCBA 4YL8A 4AWJA 4IUMB 3GZNI 2KXJA 5EDSA 3ONSA 4G11A 2MW5A 4AJYB 2MCNB 1YIWA 3ZVVA 3C0RB 3L16A 1WX7A 3VFKA 1V86A 5J17A 5CHFA 2WWZA 4FJYA 2IO2B 2D3GA 2LJ5A 1WH3A 2R2QA 4MGKE 1IPGA 4GB9A 2Z59B 5L83A 4I6PA 1WJ4A 2K6DB 3A4RA 4G3XB 1EUVB 4LCDE 2CKHB 2MBOA 5DPWA 1X1MA 3V60A 4AP4C 1WY8A 2FNJB 5J18A 2CHWA 2KFKB 2KWCA 2MX2A 4I6NB 2KFKA 4BOZB 3N30A 4OVUA 3MTNB 2KDIA 3NY5A 2C7MB 2RPQA 2KO3A 2C9WB 2K25A 4HJKA 3LJ3A 1WJNA 2NBUA 2FCMA 2C5LC 4KIKB 2EMSA 4IW0A 2HTHA 4KIKA 3QCAA 2ZNVC 4X57B 1WXMA 4TKNA 1TBEA 1XD3B 2DX5B 3QK0A 5KHOA 2FIFA 1WM2A 4IM0A 1Q0WB 2ASQA 5JH5C 2XBBC 4PYUA 5E6NA 2MBBB 1I35A 3RCZA 3A4SC 5AZHA 2C60A 2KLCA 5CTRC 4XC2A 2NBVB 1YX6B 1V49A 1UH6A 2N7DA 3WALA 2Y5BB 4HK2A 2KDFB 2MWSB 5KHQA 1U4AA 4AUQC 1GJZA 2FIDA 1V5OA 2GOWA 2M1MA 2R2OA 4FLHA 2HE7A 3QC8B 1GG3A 5C23A 3UIPB 2N9EB 3VQIA 3L0WB 4IWPA 1ZKHA 3HIZA 2DZIA 4GU2A 2L0TA 5CHWA 3VHTC 2D11A 3JSVB 3JSVA 4K81A 1NI2A 2JRHA 5LLIA 1WJ6A 5CX3A 3BINA 3U7DA 1LFDA 2LGDA 2A4ZA 3I3TB 3TMPB 3WAPA 2IY1B 1WIAA 2N9PC 4F8CB 3QJZA 4FHJA 1FXTB 4K1RB 2MLBA 4HWIB 5C1ZA 2KMCA 2DZKA 1Z2MA 1UZXB 3UGBB 3ZRCA 2KNBA 5AZFA 2RD0A 4F1SA 3VVWB 4GIVA 3ZNID 3ZW3A 2RSUA 2GBMA 3QQ8B 1RRBA 2LWPA 3V6EB 4WJQA 4GGQA 5D2MB 3H7SA 4CYEA 1T0YA 2BWES 3D32A 4NPNA 2DYBA 4XX5A 3DBRI 3GOEA 3PTFC 4WWOA 3DVNU 5TR5A 3DBHI 3OJ4B 2AL6A 2DAFA 4IWQA 2D10A 2MA9B 3AXCA 4A3PA 2WX1A 1S3SG 2GBNA 3ECIA 4IM3A 2IO0B 4KZ0A 1ISNA 3DVNV 4EEWA 3KUZA 4HDQA 4HPLB 4WWPA 2M4NA 2RR9A 3T9LA 4GDKB 4IG7B 2KTFA 1EO6A 4ICUA 3KUCB 3ALBA 2D2QA 4GDKA 5G2NA 3DBLI 2ZVNA 4ICVA 1D3ZA 1OGWA 2YLMA 2PEAA 4ANUA 5GMVA 1MG8A 2KKCA 3PZDA 2KANA 3VH3B 3VTWA 4TQ1A 1Q5WB 3QA8A 4MGZE 2GBJA 3APDA 2AL3A 1UBIA 2LI5A 2LZ6A 3PRPB 4MH0E 2Z0DB 1P0RA 4BKSD 3B08A 3RZFA 3UQAA 1WX8A 2GBRA 4FULA 3EC8A 1VCBA 1V5TA 1YJ1A 3R7QA 2KWUB 2DHZA 1E7VA 4GOCA 4JLCA 3QWZB 3PT2B 4DHZB 2JPHA 3PLUA 4ZYNA 2Z0EB 3ML8A 2NBWB 2IY0B 1F9JA 3DPDA 2MQJA 2EMTA 3L10B 4NJ6A 2BKRB 2JT4B 4LDTB 1Y8RC 4RM9A 1WR1A 2BYEA 4NJ7A 4OVVA 3VTUA 1J8CA 3IHPC 5AZGA 2J0JA 3N32A 2KK8A 3SDLC 1CMXB 2L8JA 1KOTA 4IC7B 1TTNA 3CSTA 1RAXA 2BPSA 3HM6X 1P1AA 4B6WA 1OQYA 2KJRA 4TV3A 3RUIB 1V6EA 5IA7A 3KYCD 2IBIB 1YX5B 2DAJA 3VH4B 5AEKB 3L54A 1WMHB 2V1YA 3K9OB 4WJNA 1WMHA 4EKUA 1SGHA 1VD2A 3AU4A 2ZCCA 2WDTB 4KDIC 3NZSA 4JIOU 2JWZA 2GMIC 3T8MA 3MHSD 1WGRA 1KLVA 3WAOA 2KHWB 1V9JA 1SIFA 2JRIB 2JVCA 2LRWA 1UD7A 2C7NB 3RULA 4DHJB 4FN2A 3ML9A 4LJOB 2NPTB 2NPTA 3VUWA 2L05A 3RT3B 4BKSA 1LXDA 3N3KB 1V80A 1OEYA 3IVFA 2ZNVB 4GSWA 1ZW7A 2JF5A 4II2B 2BF8B 1WGDA 1IYFA 1V2YA 4KZCA 1C1YB 5BO4B 3A33B 2ZJDA 3SHQA 2YVCA 4ZRJA 3HM3A 2LVOA 3PPAA 4MGIE 3V61A 4EFOA 3JVZX 5DCNA 3PSEB 1OEYJ 3H7PB 3Q3JA 2KN5A 2LD9A 3H7PA 3QIJA 4E71A 2WYQA 4M0WB 4BKGA 1E8YA 3ENEA 2K39A 1PQSA 2KX0A 4WJPA 2L76A 4IM2A 2IZVB 4WJOA 2FCNA 2KC2A 4EZKA 2FAZA 2M17A 1UGMA 3NZUA 4E3CA 4KSKC 1XT9B 4LDTD 2O2VB 3B0AA 3APCA 3NHEB 3U8ZA 2O2VA 2I1JA 4ANWA 4DXAB 4RMAA 4EOYA 3DVGY 4MM3A 2N4FA 2NR2A 4MSMB 1GC6A 3ZLZA 1WRDB 3QHTA 2ZPYA 4GDLB 2N7EA 1Q1OA 2L0FA 4FJZA 4GDLA 4M8NA 2L7RA 5D6JB 3P2BA 5J2RA 2LGXA 3WAMA 1S1QB 1AARA 3TJPA 4F7ZA 3BY4B 5D94A 4W9FA 3X0WA 1UELA 2LVPA 1I42A 4NAWB 4FJVB 3APFA 2IO3B 3CSFA 4NAWA 3W1SC 5IAAC 1WZ3A 1HE8A 3H9DA 3OJ3A 2EKEC 4II3B 1WF9A 3UIOB 4BKTA 4DK5A 5E6OA 1WXAA 2LGYA 5L95C 2K6QA 2KD0A 4AJWA 3PHWB 1A5RA 2CU1A 3PV1A 4B9KA 2MSED 1R4MI 4WWNA 4PS3A 2BKFA 4G50A 1E5WA 3ZO5B 2N1WA 2KDEB 4DHJD 1L2NA 1IP9A 3V6CB 4BFRA 3H1UA 4FADA 2KLGA 1LM8B 4KSLC 4M8MA 3ZTDA 3PRZA 2I1KA 5DPSA 4PYZA 3JW0X 4PS8A 2V4LA 1LQBA 1M94A 2KX3A 2KJ6A 1TZ1A 2LVQA 2LXAA 2J0MA 2O6VA 2BYFA 2O6VB 2ZZPB 3K9PB 4W9EA 3UF8A 4XZ4A 1SE9A 1J0GA 3H6NA 4BOSC 2XK5B 4W9DA 4GXBA 2XK5A 2MBHA 4NQLB 3ZIMA 2N1VA 2CHZA 3PS6A 1P9DU 3QARA 3W1YA 4A20A 4MSQB 4JL9A 2KFJA 2CR5A 1WYWB 1WJUA 5JHBA 4A3OA 4DBGA 4EZJA 2PPHA 3VXWA 4BBNF 2MRPA 3UQBA 2HD5B 2KOXA 3UINB 3SD5A 1GC7A 1R4NI 2KDBA 3M63B 2G4DB 3TBLD 1E8WA 2BGFA 4W9HA 1H8CA 4ZRKA 1K8RB 2IYDB 2JY6A 3ZDMC 1P3QU 3A9KB 2BWFA 4JGHB 3ZKJC 3A9KA 2PE9A 4EZLA 2PE6B 4EUTA 2G45B 2MBEA 1QZEA 2IO1B 1E8ZA 3VTVA 3B1LX 3TL5A 2L3ZA 4HCNB 1WGYA 3PREA 3VDZA 4URKA 2D07B 4IWOA 4HPMB 3PLVA 3LDZE 3EFUA 4ZRIA 3PVLA 1P98A 3TIXA 3WA0A 1WE6A 3OLMD 1EF5A 2LXCA 1H4RA 4FBJB 4E74A 3V62A 1Z5SB 3ZNGC 2K8HA 3AULA 2DZJA 2B3AA 2GBKA 3IFWB 4HCPB 2A5UA 4MDKE 1V81A 3A9JB 3A9JA 1E8XA 2AEHA 2NCNA 4GMVA 4ANXA 1WFYA 2DYMA 2CS4A 2BYVE 2K1FA 1OTRB 3X23A 4ANVA 4K7UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MEM A;  2QHO A;  5DPT A;  2G3Q B;  4K7S A;  2JZ3 B;  5E6P A;  3DDC B;  3HK0 A;  3R66 C;  2UYZ B;  4W9L A;  3ZNZ B;  1WXV A;  4WQO B;  2W9N A;  3WAN A;  4ASW C;  4WAA A;  1JRU A;  4PS7 A;  1GUA B;  5LXI B;  2LAS A;  4KDL B;  1G6J A;  2REX A;  3S2A A;  4JQW C;  4DHZ E;  2KVR A;  4TUU A;  2MBQ A;  3DOW A;  2O6V D;  2DEN B;  3ZTC A;  4FA6 A;  1RFA A;  3WIM A;  1GNU A;  3OAW A;  2K8B A;  2KJH B;  3RYT A;  2KTR B;  4NY0 A;  3M62 B;  2KTR A;  1EF1 A;  3M3J A;  3RD2 A;  2CHX A;  5JZE B;  4MEL A;  2KQ7 A;  3EHV A;  3CMM B;  3DQV A;  3KUD B;  3TCA A;  1RLF A;  2NS5 A;  3VUY A;  2KC1 A;  4N9F 4;  3QAQ A;  4HLE A;  5LXH A;  2G4S A;  2LUE A;  3PGE A;  4DWF A;  2WX0 A;  3ZUN A;  1YD8 U;  4HDO A;  1WGG A;  3DBS A;  2LRU A;  3Q3F A;  2K8C A;  4AOF A;  1NBF C;  1WR6 E;  1WGH A;  2JXX A;  4W9I A;  2NVU I;  4BVU C;  3PRM B;  5FR6 A;  3KYD D;  3R3M A;  2VRR B;  3VAW A;  1E90 A;  1NDD A;  3KVF B;  4P7I A;  5DPR A;  1TGZ B;  2J0K A;  4ZDV A;  3HHM A;  4W9G A;  4LJP B;  1ZGU B;  4KV2 A;  5HKH A;  5JHA A;  4MGY E;  2C7H A;  1WXS A;  2N9X A;  4G0N B;  4HVB A;  4RM8 A;  1KJT A;  3ZRF A;  2L00 B;  4KVG B;  1C3T A;  1L7Y A;  3NS8 A;  1E7U A;  2MP2 B;  3A1Q B;  3IBE A;  3KW5 B;  2MP2 A;  3A1Q A;  4J6I A;  2KZR A;  4FHK A;  3DCG A;  2DZM A;  3ZDT A;  3MJW A;  3W1S A;  4CHK A;  3SU8 X;  2KMA A;  1XQQ A;  2M8S A;  4W9J A;  2V3S A;  3L17 A;  4B95 A;  4DDI D;  5CHV C;  4GN1 A;  3M95 A;  2JZZ A;  5G55 A;  4W9C A;  1WM3 A;  3U30 A;  4NNJ B;  3QX1 A;  4HXD A;  2OOB B;  2FCS A;  2FCQ A;  1J19 A;  3RZW C;  3L08 A;  2FUH B;  2JUO A;  2XEW A;  2DYO A;  3JYU A;  1WX9 A;  4W9K A;  3CF6 E;  3AI5 A;  4I6L B;  3VUX A;  3NOB A;  3ZNH B;  4MJS B;  3L13 A;  4MJS A;  2AWT A;  5D7G A;  1WI0 A;  2AYO B;  2ZVO A;  4TQ0 A;  3O65 B;  4NQK E;  1KM7 A;  2KQS A;  2UWQ A;  2ZPN A;  3DVG X;  2HJ8 A;  2OJR A;  4CO7 A;  2M0X A;  2KWV B;  2ZEQ A;  2PJH A;  4DDG D;  1WZ0 A;  1UBQ A;  3AU5 A;  3PHX B;  1YQB A;  4BBN C;  1BT0 A;  1WE7 A;  2J7Q B;  3KH0 A;  4K7W A;  3IG3 A;  3R7R A;  3EEC A;  2RGF A;  2ZCB A;  4YL8 A;  4AWJ A;  4IUM B;  3GZN I;  2KXJ A;  5EDS A;  3ONS A;  4G11 A;  2MW5 A;  4AJY B;  2MCN B;  1YIW A;  3ZVV A;  3C0R B;  3L16 A;  1WX7 A;  3VFK A;  1V86 A;  5J17 A;  5CHF A;  2WWZ A;  4FJY A;  2IO2 B;  2D3G A;  2LJ5 A;  1WH3 A;  2R2Q A;  4MGK E;  1IPG A;  4GB9 A;  2Z59 B;  5L83 A;  4I6P A;  1WJ4 A;  2K6D B;  3A4R A;  4G3X B;  1EUV B;  4LCD E;  2CKH B;  2MBO A;  5DPW A;  1X1M A;  3V60 A;  4AP4 C;  1WY8 A;  2FNJ B;  5J18 A;  2CHW A;  2KFK B;  2KWC A;  2MX2 A;  4I6N B;  2KFK A;  4BOZ B;  3N30 A;  4OVU A;  3MTN B;  2KDI A;  3NY5 A;  2C7M B;  2RPQ A;  2KO3 A;  2C9W B;  2K25 A;  4HJK A;  3LJ3 A;  1WJN A;  2NBU A;  2FCM A;  2C5L C;  4KIK B;  2EMS A;  4IW0 A;  2HTH A;  4KIK A;  3QCA A;  2ZNV C;  4X57 B;  1WXM A;  4TKN A;  1TBE A;  1XD3 B;  2DX5 B;  3QK0 A;  5KHO A;  2FIF A;  1WM2 A;  4IM0 A;  1Q0W B;  2ASQ A;  5JH5 C;  2XBB C;  4PYU A;  5E6N A;  2MBB B;  1I35 A;  3RCZ A;  3A4S C;  5AZH A;  2C60 A;  2KLC A;  5CTR C;  4XC2 A;  2NBV B;  1YX6 B;  1V49 A;  1UH6 A;  2N7D A;  3WAL A;  2Y5B B;  4HK2 A;  2KDF B;  2MWS B;  5KHQ A;  1U4A A;  4AUQ C;  1GJZ A;  2FID A;  1V5O A;  2GOW A;  2M1M A;  2R2O A;  4FLH A;  2HE7 A;  3QC8 B;  1GG3 A;  5C23 A;  3UIP B;  2N9E B;  3VQI A;  3L0W B;  4IWP A;  1ZKH A;  3HIZ A;  2DZI A;  4GU2 A;  2L0T A;  5CHW A;  3VHT C;  2D11 A;  3JSV B;  3JSV A;  4K81 A;  1NI2 A;  2JRH A;  5LLI A;  1WJ6 A;  5CX3 A;  3BIN A;  3U7D A;  1LFD A;  2LGD A;  2A4Z A;  3I3T B;  3TMP B;  3WAP A;  2IY1 B;  1WIA A;  2N9P C;  4F8C B;  3QJZ A;  4FHJ A;  1FXT B;  4K1R B;  2MLB A;  4HWI B;  5C1Z A;  2KMC A;  2DZK A;  1Z2M A;  1UZX B;  3UGB B;  3ZRC A;  2KNB A;  5AZF A;  2RD0 A;  4F1S A;  3VVW B;  4GIV A;  3ZNI D;  3ZW3 A;  2RSU A;  2GBM A;  3QQ8 B;  1RRB A;  2LWP A;  3V6E B;  4WJQ A;  4GGQ A;  5D2M B;  3H7S A;  4CYE A;  1T0Y A;  2BWE S;  3D32 A;  4NPN A;  2DYB A;  4XX5 A;  3DBR I;  3GOE A;  3PTF C;  4WWO A;  3DVN U;  5TR5 A;  3DBH I;  3OJ4 B;  2AL6 A;  2DAF A;  4IWQ A;  2D10 A;  2MA9 B;  3AXC A;  4A3P A;  2WX1 A;  1S3S G;  2GBN A;  3ECI A;  4IM3 A;  2IO0 B;  4KZ0 A;  1ISN A;  3DVN V;  4EEW A;  3KUZ A;  4HDQ A;  4HPL B;  4WWP A;  2M4N A;  2RR9 A;  3T9L A;  4GDK B;  4IG7 B;  2KTF A;  1EO6 A;  4ICU A;  3KUC B;  3ALB A;  2D2Q A;  4GDK A;  5G2N A;  3DBL I;  2ZVN A;  4ICV A;  1D3Z A;  1OGW A;  2YLM A;  2PEA A;  4ANU A;  5GMV A;  1MG8 A;  2KKC A;  3PZD A;  2KAN A;  3VH3 B;  3VTW A;  4TQ1 A;  1Q5W B;  3QA8 A;  4MGZ E;  2GBJ A;  3APD A;  2AL3 A;  1UBI A;  2LI5 A;  2LZ6 A;  3PRP B;  4MH0 E;  2Z0D B;  1P0R A;  4BKS D;  3B08 A;  3RZF A;  3UQA A;  1WX8 A;  2GBR A;  4FUL A;  3EC8 A;  1VCB A;  1V5T A;  1YJ1 A;  3R7Q A;  2KWU B;  2DHZ A;  1E7V A;  4GOC A;  4JLC A;  3QWZ B;  3PT2 B;  4DHZ B;  2JPH A;  3PLU A;  4ZYN A;  2Z0E B;  3ML8 A;  2NBW B;  2IY0 B;  1F9J A;  3DPD A;  2MQJ A;  2EMT A;  3L10 B;  4NJ6 A;  2BKR B;  2JT4 B;  4LDT B;  1Y8R C;  4RM9 A;  1WR1 A;  2BYE A;  4NJ7 A;  4OVV A;  3VTU A;  1J8C A;  3IHP C;  5AZG A;  2J0J A;  3N32 A;  2KK8 A;  3SDL C;  1CMX B;  2L8J A;  1KOT A;  4IC7 B;  1TTN A;  3CST A;  1RAX A;  2BPS A;  3HM6 X;  1P1A A;  4B6W A;  1OQY A;  2KJR A;  4TV3 A;  3RUI B;  1V6E A;  5IA7 A;  3KYC D;  2IBI B;  1YX5 B;  2DAJ A;  3VH4 B;  5AEK B;  3L54 A;  1WMH B;  2V1Y A;  3K9O B;  4WJN A;  1WMH A;  4EKU A;  1SGH A;  1VD2 A;  3AU4 A;  2ZCC A;  2WDT B;  4KDI C;  3NZS A;  4JIO U;  2JWZ A;  2GMI C;  3T8M A;  3MHS D;  1WGR A;  1KLV A;  3WAO A;  2KHW B;  1V9J A;  1SIF A;  2JRI B;  2JVC A;  2LRW A;  1UD7 A;  2C7N B;  3RUL A;  4DHJ B;  4FN2 A;  3ML9 A;  4LJO B;  2NPT B;  2NPT A;  3VUW A;  2L05 A;  3RT3 B;  4BKS A;  1LXD A;  3N3K B;  1V80 A;  1OEY A;  3IVF A;  2ZNV B;  4GSW A;  1ZW7 A;  2JF5 A;  4II2 B;  2BF8 B;  1WGD A;  1IYF A;  1V2Y A;  4KZC A;  1C1Y B;  5BO4 B;  3A33 B;  2ZJD A;  3SHQ A;  2YVC A;  4ZRJ A;  3HM3 A;  2LVO A;  3PPA A;  4MGI E;  3V61 A;  4EFO A;  3JVZ X;  5DCN A;  3PSE B;  1OEY J;  3H7P B;  3Q3J A;  2KN5 A;  2LD9 A;  3H7P A;  3QIJ A;  4E71 A;  2WYQ A;  4M0W B;  4BKG A;  1E8Y A;  3ENE A;  2K39 A;  1PQS A;  2KX0 A;  4WJP A;  2L76 A;  4IM2 A;  2IZV B;  4WJO A;  2FCN A;  2KC2 A;  4EZK A;  2FAZ A;  2M17 A;  1UGM A;  3NZU A;  4E3C A;  4KSK C;  1XT9 B;  4LDT D;  2O2V B;  3B0A A;  3APC A;  3NHE B;  3U8Z A;  2O2V A;  2I1J A;  4ANW A;  4DXA B;  4RMA A;  4EOY A;  3DVG Y;  4MM3 A;  2N4F A;  2NR2 A;  4MSM B;  1GC6 A;  3ZLZ A;  1WRD B;  3QHT A;  2ZPY A;  4GDL B;  2N7E A;  1Q1O A;  2L0F A;  4FJZ A;  4GDL A;  4M8N A;  2L7R A;  5D6J B;  3P2B A;  5J2R A;  2LGX A;  3WAM A;  1S1Q B;  1AAR A;  3TJP A;  4F7Z A;  3BY4 B;  5D94 A;  4W9F A;  3X0W A;  1UEL A;  2LVP A;  1I42 A;  4NAW B;  4FJV B;  3APF A;  2IO3 B;  3CSF A;  4NAW A;  3W1S C;  5IAA C;  1WZ3 A;  1HE8 A;  3H9D A;  3OJ3 A;  2EKE C;  4II3 B;  1WF9 A;  3UIO B;  4BKT A;  4DK5 A;  5E6O A;  1WXA A;  2LGY A;  5L95 C;  2K6Q A;  2KD0 A;  4AJW A;  3PHW B;  1A5R A;  2CU1 A;  3PV1 A;  4B9K A;  2MSE D;  1R4M I;  4WWN A;  4PS3 A;  2BKF A;  4G50 A;  1E5W A;  3ZO5 B;  2N1W A;  2KDE B;  4DHJ D;  1L2N A;  1IP9 A;  3V6C B;  4BFR A;  3H1U A;  4FAD A;  2KLG A;  1LM8 B;  4KSL C;  4M8M A;  3ZTD A;  3PRZ A;  2I1K A;  5DPS A;  4PYZ A;  3JW0 X;  4PS8 A;  2V4L A;  1LQB A;  1M94 A;  2KX3 A;  2KJ6 A;  1TZ1 A;  2LVQ A;  2LXA A;  2J0M A;  2O6V A;  2BYF A;  2O6V B;  2ZZP B;  3K9P B;  4W9E A;  3UF8 A;  4XZ4 A;  1SE9 A;  1J0G A;  3H6N A;  4BOS C;  2XK5 B;  4W9D A;  4GXB A;  2XK5 A;  2MBH A;  4NQL B;  3ZIM A;  2N1V A;  2CHZ A;  3PS6 A;  1P9D U;  3QAR A;  3W1Y A;  4A20 A;  4MSQ B;  4JL9 A;  2KFJ A;  2CR5 A;  1WYW B;  1WJU A;  5JHB A;  4A3O A;  4DBG A;  4EZJ A;  2PPH A;  3VXW A;  4BBN F;  2MRP A;  3UQB A;  2HD5 B;  2KOX A;  3UIN B;  3SD5 A;  1GC7 A;  1R4N I;  2KDB A;  3M63 B;  2G4D B;  3TBL D;  1E8W A;  2BGF A;  4W9H A;  1H8C A;  4ZRK A;  1K8R B;  2IYD B;  2JY6 A;  3ZDM C;  1P3Q U;  3A9K B;  2BWF A;  4JGH B;  3ZKJ C;  3A9K A;  2PE9 A;  4EZL A;  2PE6 B;  4EUT A;  2G45 B;  2MBE A;  1QZE A;  2IO1 B;  1E8Z A;  3VTV A;  3B1L X;  3TL5 A;  2L3Z A;  4HCN B;  1WGY A;  3PRE A;  3VDZ A;  4URK A;  2D07 B;  4IWO A;  4HPM B;  3PLV A;  3LDZ E;  3EFU A;  4ZRI A;  3PVL A;  1P98 A;  3TIX A;  3WA0 A;  1WE6 A;  3OLM D;  1EF5 A;  2LXC A;  1H4R A;  4FBJ B;  4E74 A;  3V62 A;  1Z5S B;  3ZNG C;  2K8H A;  3AUL A;  2DZJ A;  2B3A A;  2GBK A;  3IFW B;  4HCP B;  2A5U A;  4MDK E;  1V81 A;  3A9J B;  3A9J A;  1E8X A;  2AEH A;  2NCN A;  4GMV A;  4ANX A;  1WFY A;  2DYM A;  2CS4 A;  2BYV E;  2K1F A;  1OTR B;  3X23 A;  4ANV A;  4K7U A; 
#chains in the Genus database with same CATH topology
 4GLS C;  4MEM A;  2V0G A;  2JZ3 B;  2JU6 X;  1UNS A;  1HQR D;  2GI9 A;  4WIP A;  3SR6 A;  1D5M C;  3S2A A;  4JQW C;  2K3U A;  2KVR A;  4OHJ A;  2DEN B;  4FA6 A;  3KLS X;  3T3O A;  1GNU A;  2K8B A;  1FNU A;  2KJH B;  3RYT A;  3M62 B;  1VZ6 A;  2KTR A;  1EF1 A;  3TCA A;  4WQM A;  3PGE A;  4MT5 A;  4DWF A;  4US8 A;  4HDO A;  1WGG A;  1MHH E;  3Q14 C;  2LRU A;  3Q3F A;  4AOF A;  2JXX A;  4LNI A;  1E90 A;  1NDD A;  5DPR A;  4P16 A;  1TGZ B;  2J0K A;  4ZDV A;  2ICI A;  4W9G A;  1ZGU B;  1XLO A;  1DOI A;  5HKH A;  4JWU C;  5BYQ A;  4G0N B;  3ZRF A;  1KH0 A;  2H88 B;  1E7U A;  3KW5 B;  3Q3M C;  3AEC B;  3CIR B;  3AV8 A;  3DCG A;  3ZDT A;  1FFV A;  4YT0 B;  1TYG B;  1C77 A;  4HJG E;  4W9J A;  4DDI D;  1XCQ L;  4W9C A;  1WM3 A;  2RDB C;  4LK0 M;  1ACC A;  2FUH B;  4W9K A;  3VUX A;  3EGR A;  1CJE A;  1WI0 A;  2AYO B;  1VZ8 A;  3L4P A;  4OZC A;  4TQ0 A;  2JSV X;  1KM7 A;  1JWU D;  4BBN C;  5HHD G;  2Y5P A;  1EWY C;  3I5J C;  3AE7 B;  3R2T A;  4A55 A;  3R7R A;  5EE9 A;  3P1M A;  3EEC A;  4ZHP A;  3GZN I;  2KXJ A;  1OQQ A;  2QMT A;  1I4G A;  1YIW A;  3ZVV A;  3C0R B;  3NG0 A;  5J17 A;  3EA6 A;  2BS3 B;  3RFZ B;  4FJY A;  1VR9 A;  3N1Z C;  4MGK E;  1ZE3 D;  2Z59 B;  5L83 A;  2L83 A;  4I6P A;  4LCD E;  4YTP B;  1X1M A;  3MP9 A;  4I6N B;  2KFK B;  1TJE A;  4M01 A;  4YSZ B;  3TEY A;  1FEH A;  2PIA A;  2EMS A;  1HTQ A;  4IW0 A;  4KIK A;  1TS4 A;  4L23 A;  3RN9 C;  3NVW A;  2K5P A;  2MBB B;  5AZH A;  5CTR C;  1V49 A;  1UH6 A;  2N7D A;  4JX1 C;  4LNK A;  5KHQ A;  1U4A A;  4AUQ C;  1GJZ A;  2M1M A;  3UIP B;  1FFU A;  2V9H A;  3L0W B;  3HIZ A;  1RYJ A;  2L0T A;  2D11 A;  3JSV B;  4K81 A;  5BMG A;  4YXD B;  1XCT L;  2LGD A;  3TMP B;  3WAP A;  1MG4 A;  2IGD A;  4F8C B;  1HZ6 A;  4H2A A;  4HWI B;  1JWS D;  2KMC A;  1Y56 A;  2WS3 B;  5AZF A;  2NMQ A;  2QCZ A;  1DOX A;  1C76 A;  2KT7 A;  3ZW3 A;  1QOG A;  2RSU A;  3QQ8 B;  1WGK A;  1RRB A;  3W9C B;  3V6E B;  4WJQ A;  1VZ7 A;  1T0Y A;  3D32 A;  1E7P B;  4M00 A;  3PTF C;  1XLN A;  2MA9 B;  3V05 A;  4A3P A;  2GBN A;  2DWQ A;  1ISN A;  1ZXI A;  1GAQ B;  4RGM A;  3T9L A;  4GDK B;  5G2N A;  2PEA A;  1MG8 A;  2PW9 A;  3Q69 A;  1UWX A;  3QA8 A;  3APD A;  3GB1 A;  3DHG C;  3UQA A;  2GBR A;  1XLQ A;  4Q2J A;  1BXT A;  1V5T A;  2WLB A;  2DHZ A;  1E7V A;  4JLC A;  1FRD A;  3QWZ B;  1I4P A;  1FNV A;  1UGJ A;  2EMT A;  3L10 B;  4N58 A;  4KGT A;  4P6V F;  3SDL C;  4IC7 B;  1RWS A;  5AEK B;  1WMH B;  2V1Y A;  1I7H A;  3RNA C;  4B0M A;  4KDI C;  4JIO U;  4OVZ A;  2JWZ A;  1V8C A;  1YN5 A;  2JZP A;  5C3J B;  2JRI B;  2JVC A;  3VRB B;  1UD7 A;  2C7N B;  4C56 C;  2IND C;  4DHJ B;  4LJO B;  2NPT B;  3AEB B;  2D3B A;  1LXD A;  2K22 A;  1V80 A;  5JXV A;  1OEY A;  3IVF A;  4GSW A;  2BF8 B;  1WGD A;  5IKC M;  1IYF A;  1QT9 A;  3SHQ A;  2E6X A;  2OJW A;  4MGI E;  3JVZ X;  5DCN A;  3PSE B;  4HRO A;  3H7P B;  4LLG M;  3U4E G;  4M0W B;  4BKG A;  1IUE A;  2VZK B;  3HUI A;  2N9K A;  3FIL A;  2K39 A;  2KX0 A;  4IM2 A;  2IZV B;  2QC8 A;  3ZJU A;  2FAZ A;  2M17 A;  1UGM A;  3NZU A;  4KSK C;  4LDT D;  2O2V B;  3U8Z A;  5IOI A;  4MM3 B;  3ZLZ A;  2L0F A;  4FJZ A;  4GDL A;  2M19 A;  2BYT A;  3P2B A;  5J2R A;  1QOA A;  3WAM A;  3TJP A;  2HJ1 A;  2VH2 A;  4FJV B;  4NAW A;  3CSF A;  1WYG A;  3OJ3 A;  1VRA B;  1JML A;  2K6Q A;  2KAC A;  4AJW A;  4DXG A;  2MSE D;  1R4M I;  4P1B C;  3RPF C;  4G50 A;  3ZO5 B;  2N1W A;  4XDD A;  3V6C B;  2ON8 A;  5AUI A;  3ZTD A;  2VH1 A;  2BS2 B;  3VR9 B;  3PRZ A;  1T3Q A;  1PDX A;  1LQB A;  1M94 A;  2LXA A;  4W9E A;  1J0G A;  2E3T A;  4GXB A;  4NQL B;  1J7A A;  4YTN B;  1V1P B;  3IT6 B;  1P9D U;  4A20 A;  1BML C;  3Q6B A;  2CR5 A;  1DOY A;  2LEK A;  2LGS A;  3I63 C;  4BBN F;  2MRP A;  3SD5 A;  2UU7 A;  2BGF A;  4W9H A;  4ZRQ A;  2JY6 A;  1I4H A;  3ZKJ C;  3A9K A;  1XLP A;  2MBE A;  2IO1 B;  3B1L X;  4HCN B;  1NYR A;  4S0R A;  3PVL A;  1P98 A;  3PZ8 A;  1V1O A;  3FC4 A;  4US9 A;  2OHF A;  3IFW B;  1YNT E;  1C79 A;  1E8X A;  2NCN A;  3T3N A;  3SFE B;  2YEP F;  2WDQ B;  2K1F A;  3AE5 B;  3X23 A;  4K7U A;  5DPT A;  2G3Q B;  5E6P A;  4UDU C;  3DDC B;  1JWA D;  1KF6 B;  4W9L A;  5G5G A;  5AUK A;  4WQO B;  1XXG A;  1QF6 A;  3WAN A;  4ASW C;  1JRU A;  1GUA B;  1G6J A;  3ZTC A;  2O6V D;  1N6Z A;  1RFA A;  1FNW A;  2KTR B;  3P42 A;  4NY0 A;  3M3J A;  3RD2 A;  5JZE B;  4MEL A;  1RLF A;  3VUY A;  2KC1 A;  3R2I A;  4HLE A;  2G4S A;  1LO5 D;  2KQ4 X;  2LUE A;  3AB5 A;  2H89 B;  3ZUN A;  1QIL A;  3DBS A;  4OZA A;  1R4M B;  1WGH A;  3U52 E;  1VDV A;  4BVU C;  3PRM B;  2LGI A;  2WXJ A;  3R3M A;  3VAW A;  4NJC A;  4C00 A;  2AQ2 B;  3KVF B;  4IKG A;  1D5Z C;  2GB1 A;  2LFI A;  4HVB A;  4RM8 A;  1KJT A;  1F77 A;  1L7Y A;  4CQN A;  4OZB A;  2MP2 A;  3A1Q A;  3TEW A;  3URY A;  3SEB A;  2R61 A;  3MJW A;  3W1S A;  4MH8 A;  2KMA A;  4B95 A;  4DXF A;  4GN1 A;  1PFD A;  2JZZ A;  2OED A;  4HXD A;  2BB6 A;  3TEX A;  3RZW C;  3L08 A;  2XEW A;  2DYO A;  1WX9 A;  3W5U B;  4I6L B;  3L13 A;  4MAC A;  4CO7 A;  2M0X A;  2N7J A;  2PJH A;  1WXQ A;  2WXI A;  1UBQ A;  1OFF A;  4N59 A;  1WE7 A;  2J7Q B;  2N9L A;  3FAH A;  4K7W A;  3IG3 A;  1TS5 A;  2ZCB A;  4AWJ A;  4IUM B;  1T5X D;  1TY2 A;  4G11 A;  3AEA B;  4AJY B;  2LUM A;  1C4P A;  4FXC A;  2D3G A;  1IPG A;  4GB9 A;  3AE3 B;  2X8X X;  2K6D B;  4G3X B;  1EUV B;  5DPW A;  3V60 A;  3W5V B;  1WY8 A;  2FNJ B;  4AP4 C;  4YSX B;  5J18 A;  2KWC A;  2DBY A;  2KDI A;  2RPQ A;  2C9W B;  1WJN A;  2V3N A;  1T6B X;  4KIK B;  4X57 B;  2ZNV C;  4TKN A;  2WGS A;  3QK0 A;  2FIF A;  3RNE C;  2ASQ A;  5E6N A;  1I35 A;  3RCZ A;  2C60 A;  1FXA A;  1YX6 B;  2J53 A;  1AN8 A;  2J4X A;  2MWS B;  2GOW A;  1ZP0 B;  2HE7 A;  1GG3 A;  2DZI A;  4GU2 A;  2BTE A;  4HEA 1;  1WJ6 A;  3BIN A;  3Q3O C;  1LFD A;  2A4Z A;  4RNA A;  2IY1 B;  1WIA A;  3P4R B;  2KYW A;  3QJZ A;  2MLB A;  2DZK A;  1GOZ A;  1K53 A;  4F1S A;  1AWD A;  3ZNI D;  2J42 A;  3NS1 A;  3AEE B;  1F52 A;  1FRR A;  3FKY A;  2WXP A;  1DGJ A;  4ITK A;  3N9Y C;  4XWW A;  2DYB A;  3GOE A;  4WWO A;  4RGN A;  3DVN U;  2AL6 A;  1F0Z A;  2L1A A;  4ZHO A;  4IM3 A;  4KZ0 A;  1YOV B;  4WWP A;  2M4N A;  4IG7 B;  1EO6 A;  3KUC B;  1D3Z A;  2GBJ A;  1UBI A;  2AX5 A;  3B08 A;  2W54 A;  4FUL A;  4A8X C;  3EC8 A;  4WUR A;  2D5G A;  3PT2 B;  4DHZ B;  3PLU A;  2MQJ A;  2JT4 B;  4RM9 A;  4JWS C;  4OVV A;  2PKO A;  1MHX A;  4S17 A;  5AZG A;  2KK8 A;  4YSY B;  3WCQ A;  1FM0 D;  3HM6 X;  4M02 A;  5FKA C;  1V6E A;  3PO0 A;  1YX5 B;  3VH4 B;  3MHZ A;  4WJN A;  1XO3 A;  2D3A A;  1ET6 A;  2ZCC A;  3NZS A;  2GMI C;  1FPY A;  3Q2A C;  1KLV A;  2KHW B;  1V9J A;  2D3C A;  2LRW A;  2ZW0 A;  4PK1 A;  1L0V B;  3VUW A;  2CJN A;  1SBB B;  1UUP A;  3N3K B;  2ZNV B;  4II2 B;  3W2D A;  3E9S A;  4KZC A;  1JAL A;  1CQV A;  5BO4 B;  4RF1 A;  1TIF A;  3IXS A;  2INC C;  3HM3 A;  5FR3 A;  3V61 A;  4ARC A;  1OEY J;  2L32 A;  4E71 A;  3QIJ A;  2IDY A;  3R8B A;  3NRZ A;  3FIL B;  3ENE A;  1I4R A;  4YTM B;  1YN4 A;  2FCN A;  1SF0 A;  1XEE A;  3TUO A;  1IGD A;  3APC A;  4DXA B;  4ANW A;  4EOY A;  2I2Y A;  2INN E;  4L2Y A;  1GC6 A;  1WRD B;  4GDL B;  4LNO A;  2L7R A;  5D6J B;  4ZRP A;  4RCO A;  1FD6 A;  1KTK A;  3BY4 B;  3X0W A;  2LVP A;  1IBX A;  1I42 A;  1YQ3 B;  4NAW B;  2L52 A;  3W1S C;  5IAA C;  2Q5W D;  1JW9 D;  1HE8 A;  1TY0 A;  4II3 B;  1WF9 A;  4XYC A;  3Q8C A;  5E6O A;  2LGY A;  1A5R A;  3PHW B;  4PS3 A;  2BKF A;  2GRI A;  2Z8L A;  4DHJ D;  1L2N A;  4FAD A;  2B76 B;  4M8M A;  5DPS A;  4PYZ A;  3AE1 B;  3JW0 X;  4PS8 A;  2V4L A;  1L0Y B;  1TZ1 A;  2ZZP B;  1SE9 A;  4W9D A;  2PVO D;  2HDE A;  2NTT A;  2N1V A;  2CHZ A;  3PS6 A;  3RNG C;  2WXM A;  4ZYS A;  2VZK D;  1E6E B;  3B9J A;  4AQ7 A;  4N6E B;  4A90 A;  2QJL A;  5JHB A;  3ZQ4 A;  5BMH A;  1R4N I;  2KDB A;  2AQ1 B;  1H8C A;  1KLU D;  1NEK B;  3A9K B;  1WRI A;  3NVY A;  4EZL A;  1E8Z A;  4XDC A;  2EEL A;  3PRE A;  4URK A;  2D07 B;  3TIX A;  3RNF C;  1STE A;  2IGH A;  1EF5 A;  1C9F A;  4E74 A;  1K51 A;  1Z5S B;  3ZNG C;  3DWM A;  2B3A A;  3A9J A;  3LYY A;  2DYM A;  2CS4 A;  4ANV A;  5G5H A;  2QHO A;  3RI7 C;  4K7S A;  3P4S B;  3R66 C;  3ZNZ B;  4WAA A;  4PS7 A;  5LXI B;  2LAS A;  4KDL B;  2REX A;  1N5X A;  1J7B A;  3WIM A;  1M4V A;  3AE9 B;  2ZW1 A;  4C4V A;  1CK1 A;  3ZYY X;  2CHX A;  3EUB 2;  2NS5 A;  1TS3 A;  3QAQ A;  4N9F 4;  3BYT B;  2WHI A;  2WX0 A;  1FCL A;  1TT5 B;  1L5P A;  3DWG C;  3ZJV A;  5FR6 A;  3NVV A;  3KYD D;  2WDR B;  2AQ3 B;  4WH4 A;  1NI3 A;  3HHM A;  4PT5 A;  2N9X A;  2L00 B;  3MC8 A;  3GE8 C;  3HVZ A;  3NS8 A;  2BT6 A;  2MP2 B;  2FE8 A;  3A1Q B;  4J6I A;  1T0Q C;  2KZR A;  1ZDV A;  4CHK A;  1L4Z B;  2PVG C;  2M8S A;  2V3S A;  5CHV C;  1VLB A;  1PYW D;  5H92 C;  2J52 A;  1WSP A;  5G55 A;  2RPV A;  3U30 A;  3QX1 A;  4B0E A;  2OOB B;  2FCQ A;  1R4N B;  3DHI C;  2JUO A;  3JYU A;  3CF6 E;  3ZNH B;  4MJS A;  5D7G A;  1SE2 A;  2ZVO A;  2ZPN A;  2HJ8 A;  4BZA A;  2PMV A;  5BYR A;  2ZEQ A;  4DDG D;  1WZ0 A;  3B2F A;  3BZD B;  4HPP A;  3AE4 B;  3KH0 A;  1FO4 A;  1EU3 A;  1OTR B;  4YL8 A;  1MJD A;  1XF5 L;  5EDS A;  3IAM 1;  4NZL B;  1WX7 A;  3VFK A;  2MHJ A;  1K50 A;  2WWZ A;  2MEK A;  2LJ5 A;  1HXY D;  3BVG A;  2MH7 A;  4HKQ A;  2M0A A;  5EE0 A;  1WJ4 A;  5GXG B;  1FCC C;  4BOZ B;  1ROE A;  4OVU A;  3MTN B;  3NY5 A;  3Q8F A;  4LTU A;  2KO3 A;  2K25 A;  3I57 A;  1TKY A;  3NZ3 A;  2XN9 C;  2NBU A;  2FCM A;  2C5L C;  1N62 A;  2HTH A;  1WXM A;  2DX5 B;  2WXR A;  1WM2 A;  1C4A A;  1Q0W B;  5JH5 C;  2XBB C;  3A4S C;  4KX6 B;  2NBV B;  4HK2 A;  3BVM A;  5H8Y E;  4FLH A;  5C23 A;  2QDF A;  1C4C A;  1MI0 A;  2N9E B;  2KAJ A;  3VHT C;  1ZKH A;  2WDV B;  1TS2 A;  2JRH A;  5LLI A;  1Q10 A;  5CX3 A;  1I4X A;  1ET9 A;  5MPO A;  2N9P C;  5D3I B;  4K3B A;  1FXT B;  4K1R B;  5C1Z A;  2IJ0 A;  1UZX B;  3ZRC A;  2KNB A;  1JWB D;  3BYY B;  2BQQ A;  2BB5 A;  5EE1 A;  2WXN A;  2GBM A;  1ENF A;  5I4D A;  4ARI A;  3N1X C;  3H7S A;  4CYE A;  1K52 A;  1E10 A;  4XX5 A;  3DBR I;  2DAF A;  4IWQ A;  4BAX A;  3ZGZ A;  3U2S C;  3ECI A;  2IO0 B;  4EEW A;  1GPX A;  1OQR A;  4HDQ A;  4HPL B;  1QOF A;  1L0X B;  2RR9 A;  2MJE A;  4ICU A;  2D2Q A;  2ZVN A;  5BYS A;  2YLM A;  4ANU A;  5GMV A;  2KKC A;  1JWM D;  2KAN A;  4TQ1 A;  3PRP B;  2LZ6 A;  4MH0 E;  3NUH B;  1P0R A;  3RZF A;  1WX8 A;  3AED B;  3RNC C;  2Y3A A;  1VCB A;  1YJ1 A;  4KKI A;  3ZXV A;  2HTM E;  4GOC A;  1KLG D;  2WXQ A;  2QIE B;  5BMI A;  3GS2 A;  2Z0E B;  2NBW B;  1F9J A;  3B2G A;  3DPD A;  4HKZ E;  2MJD A;  1Y8R C;  1WR1 A;  2BW2 A;  2WP9 B;  2WXK A;  4ACF A;  4JPS A;  2J0J A;  3N32 A;  1TTN A;  3CST A;  1RAX A;  1P1A A;  1N61 A;  3RUI B;  3BK1 A;  2IBI B;  2DAJ A;  3KQ4 A;  2QIL A;  3L54 A;  3K9O B;  1NEN B;  1SGH A;  3AU4 A;  1JCK B;  1HA5 A;  3GP7 A;  3WAO A;  2WNM A;  1SIF A;  1SEB D;  3RUL A;  3AEF B;  3EFC A;  4XWT A;  1GB4 A;  2L05 A;  3RT3 B;  4BKS A;  2GLS A;  1ZW7 A;  3ABV B;  4RGT A;  1V2Y A;  1YJJ A;  1C1Y B;  2JX5 A;  2ZJD A;  2WXG A;  2YVC A;  2WXH A;  4EFO A;  2LVO A;  1BUI C;  2JQR B;  2LD9 A;  4KGR A;  3TSS A;  1E8Y A;  3H8H A;  3DBR B;  2LHD A;  2BBC A;  2RDG A;  2KC2 A;  3C8Y A;  4E3C A;  1XT9 B;  3NHE B;  3B0A A;  1QQR A;  2I1J A;  4RMA A;  3DVG Y;  2WXF A;  4MSM B;  4RF0 A;  3MJ5 A;  1NYQ A;  3QHT A;  2ZPY A;  1A70 A;  2N7E A;  1Q1O A;  4M8N A;  2LGX A;  3Q8E A;  1S1Q B;  4W9F A;  1IBX B;  4XE0 A;  1UEL A;  5HG2 A;  1DYQ A;  3OG5 A;  5HFY A;  1SB3 C;  1WZ3 A;  3H9D A;  2EKE C;  4BKT A;  4DK5 A;  1WXA A;  1EWC A;  5L95 C;  2KD0 A;  2CU1 A;  3PV1 A;  1RM6 C;  1MFW A;  1E5W A;  2KDE B;  1IP9 A;  4BFR A;  3H1U A;  2KLG A;  1LM8 B;  4KSL C;  1SE4 A;  1T0R C;  1YQ4 B;  2FBW B;  5EE3 A;  2I1K A;  3WA0 A;  2O6V A;  1E0Z A;  4LNN A;  4BOS C;  1L6V A;  1P7E A;  2XK5 A;  1IGC A;  2MBH A;  3ZIM A;  1ZUD 2;  4C7Y A;  4KGS A;  3QAR A;  3MC0 B;  2EKI A;  4A3O A;  4DBG A;  3VXW A;  2KVZ A;  2KOX A;  3UIN B;  1GC7 A;  3M63 B;  2M56 B;  1F1H A;  3DHH C;  2SAK A;  1GB1 A;  1JRP A;  4NAM A;  1P3Q U;  3Q3N C;  2BWF A;  4JGH B;  4JE3 B;  2PE9 A;  4WWM A;  4EUT A;  2ACZ B;  2G45 B;  4DQO C;  1ZDX A;  4HPM B;  2INP E;  3LDZ E;  3AE6 B;  1WE6 A;  1H4R A;  4REZ A;  5HI1 A;  2K8H A;  3AUL A;  4TMA B;  2DZJ A;  2GBK A;  4HCP B;  3TEZ A;  1V81 A;  3A9J B;  3KWV A;  4GMV A;  4ANX A;  1WFY A;  4J3O D;  3N1Y C;  2PTL A;  4D2K A;  2WU5 B;  3HK0 A;  2UYZ B;  1WXV A;  1UWM A;  3P63 A;  2W9N A;  4DHZ E;  4TUU A;  2MBQ A;  3DOW A;  2V4I B;  3OAW A;  4C4V B;  2KQ7 A;  3EHV A;  3CMM B;  3DQV A;  3KUD B;  4RGO S;  5LXH A;  1QKZ A;  1YD8 U;  1KFY B;  2FUG 1;  3BK2 A;  2K8C A;  2WQY B;  1NBF C;  1WR6 E;  3I9V 1;  4W9I A;  1SJH D;  2NVU I;  2VRR B;  1PUT A;  2KWD A;  4P7I A;  1D4B A;  4LJP B;  4KV2 A;  1B1Z A;  5JHA A;  4MGY E;  2C7H A;  1WXS A;  4KVG B;  3IBE A;  1FXI A;  4FHK A;  3SFD B;  2DZM A;  1SE3 A;  5T8I A;  1SXT A;  4YWG G;  2W3S A;  3SU8 X;  1XQQ A;  1WWT A;  2SEB D;  1I4Q A;  3L17 A;  3M95 A;  3E56 A;  3AM9 A;  4NNJ B;  2FCS A;  1J19 A;  1N63 A;  2WU2 B;  3GZN B;  3ZJT A;  3AI5 A;  3ETR A;  3NOB A;  4MJS B;  3NVZ A;  3CWI A;  2AWT A;  4AS1 A;  3GE3 C;  3O65 B;  4NQK E;  3MFG A;  2KQS A;  2UWQ A;  3DVG X;  2OJR A;  2KWV B;  1SJE D;  3PHX B;  3AU5 A;  1YQB A;  1BT0 A;  4O1N A;  4USA A;  1JRO A;  2RGF A;  2JXT A;  3AMZ A;  3BII D;  3ONS A;  2MW5 A;  2MCN B;  1EM7 A;  3L16 A;  1V86 A;  1ESF A;  5CHF A;  3O13 A;  4TSS A;  2IO2 B;  4XGA B;  1WH3 A;  2R2Q A;  1NVI D;  4P1C C;  2PLP A;  4EE2 A;  1YJI A;  3A4R A;  5FK9 C;  2CKH B;  2MBO A;  2W82 A;  5E6J A;  1N60 A;  2CHW A;  2JYT A;  2MX2 A;  2KFK A;  3BWU D;  3N30 A;  3PZ7 A;  2C7M B;  1PGX A;  2LHE A;  4HJK A;  3LJ3 A;  3QCA A;  1TBE A;  1XD3 B;  2YEP B;  5KHO A;  4IM0 A;  4PYU A;  1CZP A;  2KLC A;  4XC2 A;  4OW0 A;  3WAL A;  2Y5B B;  2KDF B;  5IN7 A;  2FID A;  1QLB B;  1V5O A;  2R2O A;  4L1B A;  3ZXR A;  3HVD A;  3VQI A;  3P4Q B;  4IWP A;  5CHW A;  3JSV A;  1NI2 A;  1V97 A;  1TKG A;  3U7D A;  3I3T B;  4FHJ A;  1MVK A;  1Z2M A;  3UGB B;  1J7C A;  2WXO A;  2RD0 A;  4RFB A;  2W3R A;  3VVW B;  3RMK C;  1KRH A;  4GIV A;  2K9X A;  1QOB A;  2LWP A;  2RMM A;  3VRA B;  3LXF A;  2ONQ A;  4GGQ A;  5D2M B;  2JYE A;  2BWE S;  4NPN A;  2JWU A;  5D3D A;  3P4P B;  5TR5 A;  4C80 A;  3DBH I;  3OJ4 B;  2D10 A;  3AXC A;  2WX1 A;  1S3S G;  1YN3 A;  4LNF A;  3LB8 C;  3DVN V;  3KUZ A;  2I38 A;  4ZOH C;  2KTF A;  4GDK A;  3ALB A;  3DBL I;  4ICV A;  2K0P A;  1AW7 A;  1OGW A;  2G1E A;  3PZD A;  3VH3 B;  3VTW A;  1Q5W B;  4MGZ E;  2AL3 A;  2BVC A;  2LI5 A;  2Z0D B;  4BKS D;  1PGA A;  2X38 A;  1N5W A;  3R7Q A;  2KWU B;  2JPH A;  2NTS A;  4ZYN A;  3ML8 A;  1P7F A;  2IY0 B;  4NJ6 A;  5IP4 D;  2BKR B;  4LDT B;  2BYE A;  4NJ7 A;  3VTU A;  1J8C A;  5TSS A;  3IHP C;  1EU4 A;  1CMX B;  2L8J A;  3AE2 B;  1KOT A;  2BPS A;  2RDH A;  4B6W A;  1T0S C;  1OQY A;  2KJR A;  4TV3 A;  1HZ5 A;  5IA7 A;  3KYC D;  5IO9 A;  1WMH A;  4EKU A;  1VD2 A;  2WDT B;  2DLB A;  1ZXH A;  3AH7 A;  3VR8 B;  1L4D B;  3T8M A;  3MHS D;  1WGR A;  1LGR A;  1F2R C;  3J9C A;  2XNA C;  1C78 A;  4FN2 A;  3ML9 A;  3V3X A;  4RH6 A;  2NPT A;  3AEG B;  2JF5 A;  2V3P A;  3BVZ A;  3Q8B A;  2W55 A;  3A33 B;  4QAY A;  1R7S A;  4ZRJ A;  2TSS A;  3PPA A;  1JQ4 A;  1D5X C;  3Q3J A;  2KN5 A;  3H7P A;  3IAS 1;  1HEZ E;  2WYQ A;  4M0W A;  4WAF A;  3AN1 A;  1PQS A;  4WJP A;  2L76 A;  3DBH B;  1UF0 A;  4WJO A;  1F2R I;  4EZK A;  4K3C A;  2WXL A;  2KDM A;  2O2V A;  1TZO A;  4MM3 A;  2N4F A;  2NR2 A;  1RFK A;  3UI3 A;  3DBL B;  1AAR A;  2LJI A;  4F7Z A;  5D94 A;  1YMH E;  2QSD A;  2QEJ C;  3APF A;  1HTO A;  2IO3 B;  1ZOY B;  3NJT A;  4A9A A;  3UIO B;  2BS4 B;  3MC9 A;  1SIJ A;  4IDI A;  1MPE A;  2CU3 A;  4B9K A;  2IGG A;  4WWN A;  2KN4 A;  3OWE B;  3QC8 B;  2KX3 A;  2KJ6 A;  2O6V B;  1C3T A;  2LVQ A;  3C19 A;  2J0M A;  3K9P B;  2BYF A;  2DNF A;  2KMM A;  1L6U A;  3UF8 A;  4XZ4 A;  3H6N A;  1VJK A;  2XK5 B;  4HRS A;  3IT4 B;  1V1P A;  3RNB C;  1B9R A;  1D6E C;  3W1Y A;  5LNK 1;  1PGB A;  2MJ3 A;  4MSQ B;  4JL9 A;  2KFJ A;  2IPK D;  3U7Z A;  1WYW B;  4IOI E;  1WJU A;  3KWL A;  4EZJ A;  2PPH A;  3UQB A;  2HD5 B;  1E9M A;  3Q8A A;  3AE8 B;  2N0S B;  2G4D B;  3TBL D;  1E8W A;  1ZPS A;  4ZRK A;  1K8R B;  2IYD B;  3ZDM C;  4KKJ A;  2G9H D;  2PE6 B;  1FMA D;  1QZE A;  1FIQ A;  3VTV A;  4A6Q A;  3TL5 A;  2L3Z A;  1WGY A;  3VDZ A;  4IWO A;  3PLV A;  3HRD D;  1AYF A;  1SSN A;  3EFU A;  4ZRI A;  3OLM D;  2LXC A;  4FBJ B;  3V62 A;  3N20 C;  2LMC A;  4MDK E;  2A5U A;  4C7Z A;  1TKE A;  5C2T B;  2AEH A;  2Y5C A;  2BYV E;  2CJO A;  4R3D A; 
#chains in the Genus database with same CATH homology
 4MEM A;  2QHO A;  5DPT A;  2G3Q B;  4K7S A;  2JZ3 B;  5E6P A;  3DDC B;  3HK0 A;  3R66 C;  2UYZ B;  4W9L A;  3ZNZ B;  1WXV A;  4WQO B;  2W9N A;  3WAN A;  4ASW C;  4WAA A;  1JRU A;  4PS7 A;  1GUA B;  5LXI B;  2LAS A;  4KDL B;  1G6J A;  2REX A;  3S2A A;  4JQW C;  4DHZ E;  2KVR A;  4TUU A;  2MBQ A;  3DOW A;  2O6V D;  2DEN B;  3ZTC A;  4FA6 A;  1RFA A;  3WIM A;  1GNU A;  3OAW A;  2K8B A;  2KJH B;  3RYT A;  2KTR B;  4NY0 A;  3M62 B;  2KTR A;  1EF1 A;  3M3J A;  3RD2 A;  2CHX A;  5JZE B;  4MEL A;  2KQ7 A;  3EHV A;  3CMM B;  3DQV A;  3KUD B;  3TCA A;  1RLF A;  2NS5 A;  3VUY A;  2KC1 A;  4N9F 4;  3QAQ A;  4HLE A;  5LXH A;  2G4S A;  2LUE A;  3PGE A;  4DWF A;  2WX0 A;  3ZUN A;  1YD8 U;  4HDO A;  1WGG A;  3DBS A;  2LRU A;  3Q3F A;  2K8C A;  4AOF A;  1NBF C;  1WR6 E;  1WGH A;  2JXX A;  4W9I A;  2NVU I;  4BVU C;  3PRM B;  5FR6 A;  3KYD D;  3R3M A;  2VRR B;  3VAW A;  1E90 A;  1NDD A;  3KVF B;  4P7I A;  5DPR A;  1TGZ B;  2J0K A;  4ZDV A;  3HHM A;  4W9G A;  4LJP B;  1ZGU B;  4KV2 A;  5HKH A;  5JHA A;  4MGY E;  2C7H A;  1WXS A;  2N9X A;  4G0N B;  4HVB A;  4RM8 A;  1KJT A;  3ZRF A;  2L00 B;  4KVG B;  1C3T A;  1L7Y A;  3NS8 A;  1E7U A;  2MP2 B;  3A1Q B;  3IBE A;  3KW5 B;  2MP2 A;  3A1Q A;  4J6I A;  2KZR A;  4FHK A;  3DCG A;  2DZM A;  3ZDT A;  3MJW A;  3W1S A;  4CHK A;  3SU8 X;  2KMA A;  1XQQ A;  2M8S A;  4W9J A;  2V3S A;  3L17 A;  4B95 A;  4DDI D;  5CHV C;  4GN1 A;  3M95 A;  2JZZ A;  5G55 A;  4W9C A;  1WM3 A;  3U30 A;  4NNJ B;  3QX1 A;  4HXD A;  2OOB B;  2FCS A;  2FCQ A;  1J19 A;  3RZW C;  3L08 A;  2FUH B;  2JUO A;  2XEW A;  2DYO A;  3JYU A;  1WX9 A;  4W9K A;  3CF6 E;  3AI5 A;  4I6L B;  3VUX A;  3NOB A;  3ZNH B;  4MJS B;  3L13 A;  4MJS A;  2AWT A;  5D7G A;  1WI0 A;  2AYO B;  2ZVO A;  4TQ0 A;  3O65 B;  4NQK E;  1KM7 A;  2KQS A;  2UWQ A;  2ZPN A;  3DVG X;  2HJ8 A;  2OJR A;  4CO7 A;  2M0X A;  2KWV B;  2ZEQ A;  2PJH A;  4DDG D;  1WZ0 A;  1UBQ A;  3AU5 A;  3PHX B;  1YQB A;  4BBN C;  1BT0 A;  1WE7 A;  2J7Q B;  3KH0 A;  4K7W A;  3IG3 A;  3R7R A;  3EEC A;  2RGF A;  2ZCB A;  4YL8 A;  4AWJ A;  4IUM B;  3GZN I;  2KXJ A;  5EDS A;  3ONS A;  4G11 A;  2MW5 A;  4AJY B;  2MCN B;  1YIW A;  3ZVV A;  3C0R B;  3L16 A;  1WX7 A;  3VFK A;  1V86 A;  5J17 A;  5CHF A;  2WWZ A;  4FJY A;  2IO2 B;  2D3G A;  2LJ5 A;  1WH3 A;  2R2Q A;  4MGK E;  1IPG A;  4GB9 A;  2Z59 B;  5L83 A;  4I6P A;  1WJ4 A;  2K6D B;  3A4R A;  4G3X B;  1EUV B;  4LCD E;  2CKH B;  2MBO A;  5DPW A;  1X1M A;  3V60 A;  4AP4 C;  1WY8 A;  2FNJ B;  5J18 A;  2CHW A;  2KFK B;  2KWC A;  2MX2 A;  4I6N B;  2KFK A;  4BOZ B;  3N30 A;  4OVU A;  3MTN B;  2KDI A;  3NY5 A;  2C7M B;  2RPQ A;  2KO3 A;  2C9W B;  2K25 A;  4HJK A;  3LJ3 A;  1WJN A;  2NBU A;  2FCM A;  2C5L C;  4KIK B;  2EMS A;  4IW0 A;  2HTH A;  4KIK A;  3QCA A;  2ZNV C;  4X57 B;  1WXM A;  4TKN A;  1TBE A;  1XD3 B;  2DX5 B;  3QK0 A;  5KHO A;  2FIF A;  1WM2 A;  4IM0 A;  1Q0W B;  2ASQ A;  5JH5 C;  2XBB C;  4PYU A;  5E6N A;  2MBB B;  1I35 A;  3RCZ A;  3A4S C;  5AZH A;  2C60 A;  2KLC A;  5CTR C;  4XC2 A;  2NBV B;  1YX6 B;  1V49 A;  1UH6 A;  2N7D A;  3WAL A;  2Y5B B;  4HK2 A;  2KDF B;  2MWS B;  5KHQ A;  1U4A A;  4AUQ C;  1GJZ A;  2FID A;  1V5O A;  2GOW A;  2M1M A;  2R2O A;  4FLH A;  2HE7 A;  3QC8 B;  1GG3 A;  5C23 A;  3UIP B;  2N9E B;  3VQI A;  3L0W B;  4IWP A;  1ZKH A;  3HIZ A;  2DZI A;  4GU2 A;  2L0T A;  5CHW A;  3VHT C;  2D11 A;  3JSV B;  3JSV A;  4K81 A;  1NI2 A;  2JRH A;  5LLI A;  1WJ6 A;  5CX3 A;  3BIN A;  3U7D A;  1LFD A;  2LGD A;  2A4Z A;  3I3T B;  3TMP B;  3WAP A;  2IY1 B;  1WIA A;  2N9P C;  4F8C B;  3QJZ A;  4FHJ A;  1FXT B;  4K1R B;  2MLB A;  4HWI B;  5C1Z A;  2KMC A;  2DZK A;  1Z2M A;  1UZX B;  3UGB B;  3ZRC A;  2KNB A;  5AZF A;  2RD0 A;  4F1S A;  3VVW B;  4GIV A;  3ZNI D;  3ZW3 A;  2RSU A;  2GBM A;  3QQ8 B;  1RRB A;  2LWP A;  3V6E B;  4WJQ A;  4GGQ A;  5D2M B;  3H7S A;  4CYE A;  1T0Y A;  2BWE S;  3D32 A;  4NPN A;  2DYB A;  4XX5 A;  3DBR I;  3GOE A;  3PTF C;  4WWO A;  3DVN U;  5TR5 A;  3DBH I;  3OJ4 B;  2AL6 A;  2DAF A;  4IWQ A;  2D10 A;  2MA9 B;  3AXC A;  4A3P A;  2WX1 A;  1S3S G;  2GBN A;  3ECI A;  4IM3 A;  2IO0 B;  4KZ0 A;  1ISN A;  3DVN V;  4EEW A;  3KUZ A;  4HDQ A;  4HPL B;  4WWP A;  2M4N A;  2RR9 A;  3T9L A;  4GDK B;  4IG7 B;  2KTF A;  1EO6 A;  4ICU A;  3KUC B;  3ALB A;  2D2Q A;  4GDK A;  5G2N A;  3DBL I;  2ZVN A;  4ICV A;  1D3Z A;  1OGW A;  2YLM A;  2PEA A;  4ANU A;  5GMV A;  1MG8 A;  2KKC A;  3PZD A;  2KAN A;  3VH3 B;  3VTW A;  4TQ1 A;  1Q5W B;  3QA8 A;  4MGZ E;  2GBJ A;  3APD A;  2AL3 A;  1UBI A;  2LI5 A;  2LZ6 A;  3PRP B;  4MH0 E;  2Z0D B;  1P0R A;  4BKS D;  3B08 A;  3RZF A;  3UQA A;  1WX8 A;  2GBR A;  4FUL A;  3EC8 A;  1VCB A;  1V5T A;  1YJ1 A;  3R7Q A;  2KWU B;  2DHZ A;  1E7V A;  4GOC A;  4JLC A;  3QWZ B;  3PT2 B;  4DHZ B;  2JPH A;  3PLU A;  4ZYN A;  2Z0E B;  3ML8 A;  2NBW B;  2IY0 B;  1F9J A;  3DPD A;  2MQJ A;  2EMT A;  3L10 B;  4NJ6 A;  2BKR B;  2JT4 B;  4LDT B;  1Y8R C;  4RM9 A;  1WR1 A;  2BYE A;  4NJ7 A;  4OVV A;  3VTU A;  1J8C A;  3IHP C;  5AZG A;  2J0J A;  3N32 A;  2KK8 A;  3SDL C;  1CMX B;  2L8J A;  1KOT A;  4IC7 B;  1TTN A;  3CST A;  1RAX A;  2BPS A;  3HM6 X;  1P1A A;  4B6W A;  1OQY A;  2KJR A;  4TV3 A;  3RUI B;  1V6E A;  5IA7 A;  3KYC D;  2IBI B;  1YX5 B;  2DAJ A;  3VH4 B;  5AEK B;  3L54 A;  1WMH B;  2V1Y A;  3K9O B;  4WJN A;  1WMH A;  4EKU A;  1SGH A;  1VD2 A;  3AU4 A;  2ZCC A;  2WDT B;  4KDI C;  3NZS A;  4JIO U;  2JWZ A;  2GMI C;  3T8M A;  3MHS D;  1WGR A;  1KLV A;  3WAO A;  2KHW B;  1V9J A;  1SIF A;  2JRI B;  2JVC A;  2LRW A;  1UD7 A;  2C7N B;  3RUL A;  4DHJ B;  4FN2 A;  3ML9 A;  4LJO B;  2NPT B;  2NPT A;  3VUW A;  2L05 A;  3RT3 B;  4BKS A;  1LXD A;  3N3K B;  1V80 A;  1OEY A;  3IVF A;  2ZNV B;  4GSW A;  1ZW7 A;  2JF5 A;  4II2 B;  2BF8 B;  1WGD A;  1IYF A;  1V2Y A;  4KZC A;  1C1Y B;  5BO4 B;  3A33 B;  2ZJD A;  3SHQ A;  2YVC A;  4ZRJ A;  3HM3 A;  2LVO A;  3PPA A;  4MGI E;  3V61 A;  4EFO A;  3JVZ X;  5DCN A;  3PSE B;  1OEY J;  3H7P B;  3Q3J A;  2KN5 A;  2LD9 A;  3H7P A;  3QIJ A;  4E71 A;  2WYQ A;  4M0W B;  4BKG A;  1E8Y A;  3ENE A;  2K39 A;  1PQS A;  2KX0 A;  4WJP A;  2L76 A;  4IM2 A;  2IZV B;  4WJO A;  2FCN A;  2KC2 A;  4EZK A;  2FAZ A;  2M17 A;  1UGM A;  3NZU A;  4E3C A;  4KSK C;  1XT9 B;  4LDT D;  2O2V B;  3B0A A;  3APC A;  3NHE B;  3U8Z A;  2O2V A;  2I1J A;  4ANW A;  4DXA B;  4RMA A;  4EOY A;  3DVG Y;  4MM3 A;  2N4F A;  2NR2 A;  4MSM B;  1GC6 A;  3ZLZ A;  1WRD B;  3QHT A;  2ZPY A;  4GDL B;  2N7E A;  1Q1O A;  2L0F A;  4FJZ A;  4GDL A;  4M8N A;  2L7R A;  5D6J B;  3P2B A;  5J2R A;  2LGX A;  3WAM A;  1S1Q B;  1AAR A;  3TJP A;  4F7Z A;  3BY4 B;  5D94 A;  4W9F A;  3X0W A;  1UEL A;  2LVP A;  1I42 A;  4NAW B;  4FJV B;  3APF A;  2IO3 B;  3CSF A;  4NAW A;  3W1S C;  5IAA C;  1WZ3 A;  1HE8 A;  3H9D A;  3OJ3 A;  2EKE C;  4II3 B;  1WF9 A;  3UIO B;  4BKT A;  4DK5 A;  5E6O A;  1WXA A;  2LGY A;  5L95 C;  2K6Q A;  2KD0 A;  4AJW A;  3PHW B;  1A5R A;  2CU1 A;  3PV1 A;  4B9K A;  2MSE D;  1R4M I;  4WWN A;  4PS3 A;  2BKF A;  4G50 A;  1E5W A;  3ZO5 B;  2N1W A;  2KDE B;  4DHJ D;  1L2N A;  1IP9 A;  3V6C B;  4BFR A;  3H1U A;  4FAD A;  2KLG A;  1LM8 B;  4KSL C;  4M8M A;  3ZTD A;  3PRZ A;  2I1K A;  5DPS A;  4PYZ A;  3JW0 X;  4PS8 A;  2V4L A;  1LQB A;  1M94 A;  2KX3 A;  2KJ6 A;  1TZ1 A;  2LVQ A;  2LXA A;  2J0M A;  2O6V A;  2BYF A;  2O6V B;  2ZZP B;  3K9P B;  4W9E A;  3UF8 A;  4XZ4 A;  1SE9 A;  1J0G A;  3H6N A;  4BOS C;  2XK5 B;  4W9D A;  4GXB A;  2XK5 A;  2MBH A;  4NQL B;  3ZIM A;  2N1V A;  2CHZ A;  3PS6 A;  1P9D U;  3QAR A;  3W1Y A;  4A20 A;  4MSQ B;  4JL9 A;  2KFJ A;  2CR5 A;  1WYW B;  1WJU A;  5JHB A;  4A3O A;  4DBG A;  4EZJ A;  2PPH A;  3VXW A;  4BBN F;  2MRP A;  3UQB A;  2HD5 B;  2KOX A;  3UIN B;  3SD5 A;  1GC7 A;  1R4N I;  2KDB A;  3M63 B;  2G4D B;  3TBL D;  1E8W A;  2BGF A;  4W9H A;  1H8C A;  4ZRK A;  1K8R B;  2IYD B;  2JY6 A;  3ZDM C;  1P3Q U;  3A9K B;  2BWF A;  4JGH B;  3ZKJ C;  3A9K A;  2PE9 A;  4EZL A;  2PE6 B;  4EUT A;  2G45 B;  2MBE A;  1QZE A;  2IO1 B;  1E8Z A;  3VTV A;  3B1L X;  3TL5 A;  2L3Z A;  4HCN B;  1WGY A;  3PRE A;  3VDZ A;  4URK A;  2D07 B;  4IWO A;  4HPM B;  3PLV A;  3LDZ E;  3EFU A;  4ZRI A;  3PVL A;  1P98 A;  3TIX A;  3WA0 A;  1WE6 A;  3OLM D;  1EF5 A;  2LXC A;  1H4R A;  4FBJ B;  4E74 A;  3V62 A;  1Z5S B;  3ZNG C;  2K8H A;  3AUL A;  2DZJ A;  2B3A A;  2GBK A;  3IFW B;  4HCP B;  2A5U A;  4MDK E;  1V81 A;  3A9J B;  3A9J A;  1E8X A;  2AEH A;  2NCN A;  4GMV A;  4ANX A;  1WFY A;  2DYM A;  2CS4 A;  2BYV E;  2K1F A;  1OTR B;  3X23 A;  4ANV A;  4K7U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...