2CKHB

Senp1-sumo2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
b'NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
molecule tags Hydrolase
source organism Homo sapiens
publication title The Structure of Senp1-Sumo-2 Complex Suggests a Structural Basis for Discrimination between Sumo Paralogues During Processing.
pubmed doi rcsb
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ckhB00
4MJSB 3ZRCA 5JHBA 3EFUA 5CHVC 3RCZA 3UQBA 2ZPYA 2IO0B 4BOSC 1KM7A 3UIPB 2FNJB 4HLEA 1NDDA 2N9PC 1WZ3A 4BKSA 4GIVA 1GG3A 3W1SC 1UZXB 3KH0A 1Z2MA 3I3TB 1V86A 4IM0A 1E7VA 2BKRB 2L0FA 3VUXA 2MRPA 2KC1A 4AJYB 1LQBA 2NBVB 2BKFA 3TBLD 3ZO5B 2LRUA 1KJTA 2KLCA 4JGHB 3ECIA 3R66C 2KVRA 3IVFA 1WJUA 1RRBA 1FXTB 4IWOA 1WXSA 2JUOA 2LUEA 1P3QU 3X23A 4BKGA 3CF6E 3RZWC 3QJZA 1F9JA 1K8RB 2CS4A 4IM3A 4BVUC 3PRZA 3PHWB 2Z0EB 2ZCBA 4ICVA 4GMVA 4MSQB 2D2QA 2N7EA 5D94A 1I35A 2CHXA 3DVGY 4K7SA 4NJ7A 1E90A 2KDFB 2NBWB 4GB9A 2DAFA 1YX5B 2RR9A 2WX1A 1WMHB 4FLHA 4XZ4A 4CO7A 2KJRA 3ML9A 1WZ0A 1IPGA 3QQ8B 1GJZA 1GC6A 2MCNB 2N1VA 2JF5A 2BYVE 1SGHA 4XC2A 4EZLA 2M8SA 1QZEA 2C9WB 4JLCA 4RM8A 5J17A 5D7GA 1IP9A 3UIOB 4TUUA 1J8CA 4FJZA 1VCBA 3QX1A 2XK5B 2JVCA 4LDTD 2C7HA 3VVWB 2RGFA 5DPSA 5J18A 3JSVA 4W9DA 3IBEA 2CR5A 2LJ5A 1WJNA 3VUWA 4EUTA 3DVGX 3DDCB 1V5OA 4WWOA 3DBRI 3WAOA 1OGWA 5AEKB 2K39A 3KYCD 2RPQA 4FHJA 2KK8A 3ZW3A 1WYWB 5JHAA 3PRPB 4IM2A 3UINB 4MJSA 1WR1A 1V9JA 4AJWA 3U8ZA 2M0XA 3ZIMA 4GN1A 2MP2A 2FCSA 3BY4B 4GGQA 3QA8A 4FULA 2MX2A 1Z5SB 1NBFC 3M95A 2MBQA 2BF8B 1AARA 2ASQA 4BBNC 2K8BA 4KDIC 4A3OA 1E8WA 4MGKE 4HCNB 3V6EB 5GMVA 2JWZA 2ZJDA 3H9DA 4GDLB 5LXHA 3MHSD 2WYQA 1MG8A 4CHKA 2DENB 1WGRA 3L08A 4KIKB 2D11A 3B08A 1UBQA 1WGDA 2M4NA 3ZLZA 1WR6E 3TCAA 2KX3A 3EECA 4W9EA 4II2B 2NS5A 3OJ4B 2FUHB 4N9F4 2FIFA 2LVOA 1C1YB 2IO2B 1KOTA 1XD3B 5IA7A 3ZUNA 3KUZA 2D10A 1JRUA 1XT9B 3ZTDA 2O6VD 3S2AA 2MBEA 5CHFA 1L7YA 3NHEB 4K1RB 3CSFA 3RYTA 5AZFA 4MDKE 2AL6A 1WX9A 4W9GA 4YL8A 2KFKB 1UD7A 3IFWB 4IWPA 1ISNA 1P98A 2R2QA 4ZRJA 1E7UA 1OEYJ 2DHZA 5C23A 3VTVA 1RAXA 4OVVA 4IW0A 3A9JA 4I6PA 2NPTB 2A5UA 3RD2A 3VHTC 3A1QB 1Q1OA 4ZYNA 3PVLA 1LM8B 1E8XA 4FN2A 3PRMB 2NR2A 4DHZB 1WXVA 4DXAB 2LD9A 2KC2A 2KDEB 2XK5A 4EZKA 4NAWA 1H8CA 3DQVA 4W9IA 4FJYA 3HK0A 4W9CA 3QARA 5HKHA 3L16A 4MH0E 4HCPB 4MGIE 1GUAB 4WWNA 5DPTA 5L95C 1J0GA 4GOCA 4JQWC 3MJWA 1WI0A 2CKHB 2MBBB 2N4FA 3BINA 1WGYA 2RD0A 4HJKA 4DWFA 4EOYA 4LJPB 3DOWA 2J0JA 1WE7A 2DAJA 4P7IA 1D3ZA 3T9LA 4HPLB 3NOBA 3R3MA 4PYZA 3SDLC 4TQ0A 1WMHA 2LZ6A 5J2RA 4GDKB 3NY5A 4B95A 2DYBA 2ZVNA 5LLIA 3L13A 2MSED 1KLVA 2KFKA 3A33B 3AXCA 1ZGUB 3HM3A 3R7RA 3VQIA 2KTRA 4GU2A 2GBRA 3N32A 1M94A 1S1QB 4KSLC 4M8MA 2JY6A 2KWCA 4W9LA 2PJHA 1LFDA 5DCNA 2XBBC 2HD5B 2KX0A 3DBLI 3UQAA 4GSWA 5IAAC 2MA9B 4HDQA 1S3SG 4DBGA 4G0NB 1WF9A 4CYEA 2LGYA 5D6JB 4DHJB 3PS6A 3RZFA 3PV1A 4DDID 3OAWA 1GC7A 4I6NB 1NI2A 4ANUA 3VH4B 5G55A 1WGGA 4WAAA 3WALA 1WX7A 2O2VA 4TV3A 3PLUA 4IG7B 3L54A 3U7DA 3SHQA 3PGEA 1WIAA 3APFA 3U30A 2J7QB 4HVBA 3UF8A 4AUQC 3B1LX 2KN5A 2BGFA 1PQSA 3H7SA 4ANWA 3V6CB 2BWFA 2CHZA 1RFAA 3ZKJC 4E74A 2AWTA 3M63B 4PS3A 2JXXA 4MELA 1WJ4A 3AULA 3PZDA 4JL9A 4K81A 1P0RA 4WJQA 3DBSA 5JZEB 1U4AA 2O2VB 1J19A 4HDOA 1IYFA 2M1MA 1E8ZA 3ZNGC 3ZVVA 3LJ3A 2L76A 2N9EB 2XEWA 1VD2A 5CTRC 3APDA 5TR5A 3QHTA 1X1MA 2MW5A 2IO3B 2D07B 1YQBA 4KVGB 2NPTA 1G6JA 3A1QA 3SU8X 3TMPB 4W9JA 4G11A 4HWIB 2FCMA 2DZIA 2VRRB 1V81A 2KNBA 2OOBB 3Q3JA 2LGXA 3OLMD 3A9KA 3A4SC 3QIJA 1UBIA 2KTRB 3PLVA 4EZJA 2MBHA 2EMSA 3W1SA 5G2NA 1E8YA 2GBMA 1OTRB 2N7DA 3VTUA 1BT0A 1EUVB 2IY1B 2DYMA 3PPAA 4II3B 2MBOA 4B9KA 4WWPA 3TIXA 1OEYA 2KTFA 3PT2B 4F1SA 5BO4B 4ZDVA 2L7RA 2L05A 3A9KB 2L00B 2RSUA 2ZZPB 3Q3FA 2Z59B 4DDGD 5L83A 2ZCCA 4EFOA 2BYEA 3V61A 4FA6A 3HHMA 2HJ8A 1I42A 2FAZA 3ONSA 4HPMB 1OQYA 3ZDTA 3KW5B 3ZNID 2L3ZA 1UH6A 3ENEA 2GBJA 3QAQA 4NY0A 3GZNI 4HXDA 2BYFA 2MP2B 4XX5A 2V3SA 2Z0DB 3NZUA 1WXMA 3IG3A 5CX3A 3WAPA 2G4SA 3RT3B 1UGMA 2KO3A 2C5LC 4GDLA 4AWJA 2C7NB 2I1KA 4FJVB 4KZCA 2AYOB 2KFJA 4G50A 2LXAA 3HM6X 2FCQA 2JT4B 2JZZA 2ZVOA 1P9DU 3APCA 4W9HA 4K7WA 3ML8A 2IBIB 3A4RA 5KHOA 1SE9A 1XQQA 4WQOB 3V60A 5JH5C 2EMTA 1SIFA 3IHPC 2KZRA 1UELA 1P1AA 3L0WB 4M8NA 1Q0WB 1A5RA 1WM2A 3ZDMC 1V80A 4J6IA 3AU4A 2K1FA 3LDZE 3TJPA 5KHQA 5C1ZA 3QK0A 1YD8U 2KXJA 3ZRFA 1CMXB 4NQLB 1Q5WB 2KWVB 5E6NA 5LXIB 2IY0B 4F8CB 1L2NA 3AI5A 2HTHA 2KWUB 2L0TA 2N9XA 4KSKC 4MEMA 2CU1A 2YLMA 4LJOB 3RUIB 3ZTCA 2JRIB 4NJ6A 4DHZE 4OVUA 3WA0A 2GBKA 2Y5BB 4F7ZA 1R4NI 4GDKA 4IWQA 3KUCB 3N3KB 2W9NA 1V6EA 4LCDE 4WJPA 5DPRA 4ANXA 3DBHI 2WWZA 3H6NA 4IUMB 1C3TA 2C60A 1TZ1A 4LDTB 2MWSB 4DK5A 3EHVA 4A20A 2GOWA 2KJHB 4PYUA 2AL3A 5E6OA 2JRHA 2KLGA 4KZ0A 3TL5A 4MGZE 2J0KA 3PREA 2N1WA 2G45B 2LI5A 2KHWB 1WX8A 5E6PA 1R4MI 1EO6A 2NCNA 3H7PB 3K9PB 2KKCA 2DZJA 4W9FA 4FBJB 3M62B 3DVNV 1WH3A 2CHWA 2K6DB 3M3JA 3KYDD 4HK2A 4AOFA 2K8CA 2A4ZA 2KANA 2LXCA 4TKNA 1Y8RC 2B3AA 3UGBB 5EDSA 3GOEA 2ZPNA 4M0WB 4ZRIA 2GMIC 2V4LA 3QCAA 4TQ1A 3WAMA 2LWPA 4PS7A 1WGHA 1T0YA 2NVUI 2KD0A 2JZ3B 3W1YA 2KMCA 3JYUA 2R2OA 4ANVA 1WM3A 2IO1B 2LVPA 3QWZB 4EKUA 4BOZB 1WJ6A 3RULA 2WDTB 1EF1A 2QHOA 2MLBA 3CMMB 3PHXB 4GXBA 4MGYE 1E5WA 3DPDA 3DVNU 5AZHA 1V2YA 2FIDA 4NPNA 1RLFA 4FADA 1WE6A 2KMAA 4DHJD 4KIKA 2D3GA 2G3QB 4G3XB 3VUYA 2L8JA 3VAWA 2LRWA 2KOXA 2V1YA 3B0AA 3NS8A 4URKA 2REXA 2MQJA 1ZW7A 3D32A 2LASA 1HE8A 5D2MB 3KUDB 2PE6B 3HIZA 4W9KA 1WXAA 4KV2A 3VFKA 2KJ6A 3X0WA 3ZNZB 2M17A 4AP4C 4PS8A 2BPSA 3JW0X 4I6LB 1ZKHA 2O6VB 4NNJB 4WJOA 2K6QA 3ALBA 3CSTA 2G4DB 3QC8B 4MSMB 4X57B 1V49A 3VTWA 3NZSA 2ZEQA 3PTFC 5FR6A 4K7UA 3MTNB 3EC8A 3DCGA 2NBUA 3PSEB 3WANA 3H1UA 1WFYA 5CHWA 2DZMA 1H4RA 2KQ7A 3AU5A 1YX6B 2PE9A 4JIOU 3VH3B 2K8HA 2JPHA 2YVCA 3A9JB 4ICUA 4E3CA 2KQSA 1YJ1A 2O6VA 3JVZX 3WIMA 4FHKA 4ZRKA 2EKEC 4EEWA 4BKSD 4BBNF 2PPHA 1WY8A 3O65B 2ZNVB 4IC7B 1GNUA 4RMAA 1TBEA 2IZVB 3H7PA 2LVQA 1TTNA 2I1JA 2PEAA 3OJ3A 4MM3A 4NAWB 3T8MA 4E71A 2ZNVC 2KDBA 1TGZB 2HE7A 3N30A 1LXDA 2WX0A 4B6WA 2DZKA 4BFRA 2FCNA 3VDZA 2K25A 2UWQA 3JSVB 3L10B 2IYDB 5DPWA 2DX5B 4BKTA 2LGDA 3L17A 3R7QA 4KDLB 2GBNA 4NQKE 3ZNHB 2AEHA 4RM9A 1WRDB 3P2BA 2KDIA 3K9OB 2DYOA 1EF5A 2J0MA 2OJRA 3KVFB 2C7MB 1YIWA 4A3PA 3V62A 5AZGA 4ASWC 3C0RB 3SD5A 1V5TA 3VXWA 2BWES 4WJNA 2UYZB
chains in the Genus database with same CATH superfamily
5CHVC 3N20C 2IO0B 2RPVA 4GIVA 3W1SC 1UZXB 2NMQA 2INNE 1V86A 3J9CA 2MRPA 2KC1A 2GLSA 3TBLD 1KJTA 4OZBA 2KLCA 4JGHB 2INDC 2IGHA 3ETRA 3AE4B 3RZWC 1T6BX 2V4IB 1F9JA 4IM3A 3Q69A 2EKIA 2VZKD 5FKAC 5D94A 3DVGY 1E90A 2M19A 3Q8EA 3DWGC 3MC0B 1WMHB 1JWAD 3QQ8B 2QIEB 1GC6A 1B1ZA 2MCNB 5BMIA 4ZHPA 1SGHA 4EZLA 4ZHOA 1QZEA 2GI9A 1JALA 3Q8CA 3VVWB 4S0RA 3JSVA 2KVZA 2FBWB 3IAS1 3GZNB 3VUWA 4EUTA 2BVCA 4BAXA 1GB4A 3RI7C 3WAOA 5AEKB 3VRAB 1WYWB 3ZJVA 5JHAA 3PRPB 3NZ3A 1GB1A 1VJKA 3RNCC 4GN1A 2MP2A 2OJWA 2PIAA 4GGQA 3QA8A 2MX2A 1Z5SB 1JWBD 3AEBB 2PMVA 1AYFA 1TY2A 4MGKE 3NJTA 4HPPA 5BYQA 3V6EB 4J3OD 2JWZA 4L1BA 4CHKA 1WGDA 3P4PB 3IAM1 1WR6E 3EECA 3OJ4B 2WXFA 3TEYA 1C1YB 2IO2B 1C79A 1KOTA 4KGTA 3ZUNA 4ZRPA 4P1CC 2LJIA 2LUMA 1TS2A 3S2AA 3N9YC 3RYTA 4OVZA 2AL6A 1EU4A 1UD7A 5AUKA 3IFWB 2FUG1 4LNIA 3VTVA 1FRRA 4OVVA 1L6UA 3Q8FA 3Q6BA 3VHTC 5EE0A 3A1QB 2VH1A 1FD6A 4ZYNA 1I4GA 2MJ3A 3PRMB 4XYCA 3BK2A 3HVZA 4EZKA 4N6EB 3HK0A 2MH7A 3ZQ4A 3L16A 4WWNA 5DPTA 3FKYA 3MJWA 1WI0A 2LMCA 4EOYA 4P7IA 3SDLC 3R3MA 4TQ0A 1WMHA 2LZ6A 4GDKB 4B95A 2DYBA 5LLIA 1KLVA 3A33B 1AN8A 2JYEA 1XLPA 3N32A 1M94A 1S1QB 1LFDA 2XBBC 2HD5B 3DBLI 1TYGB 2MA9B 4HDQA 4IDIA 1WF9A 2LGYA 4DHJB 3OAWA 1NI2A 3BWUD 5G55A 3NVYA 2IJ0A 3WALA 3AE9B 3TSSA 3PLUA 2R61A 3U7DA 1I7HA 3PGEA 3APFA 4KGSA 3B1LX 2BGFA 1PQSA 4NAMA 2CHZA 1RFAA 4E74A 3AULA 4JL9A 1P0RA 1IYFA 1FXAA 2N9EB 1X1MA 1MG4A 1E0ZA 4KVGB 4RH6A 4G11A 4HWIB 1V81A 2KNBA 2OOBB 3Q3JA 3ZJTA 1UBIA 2KTRB 1SIJA 3PLVA 4EZJA 1R4MB 1BXTA 3C19A 5E6JA 3DBLB 3PPAA 4II3B 3RNGC 2MBOA 4B9KA 3BK1A 5BO4B 2L05A 2RSUA 2JSVX 4DDGD 2BYEA 4FA6A 2Y3AA 3HHMA 2FAZA 3ONSA 1N5WA 4XDDA 2RDHA 3N1XC 4HXDA 2BYFA 2L1AA 3NZUA 3WAPA 3RT3B 3OWEB 2KO3A 1SBBB 4TSSA 2I1KA 2Q5WD 4FJVB 4KZCA 2KFJA 2JZZA 1HA5A 1P9DU 3ML8A 3A4RA 4C7ZA 3Q3NC 2PVOD 2WXMA 3V60A 1RYJA 3IHPC 4XE0A 1P1AA 4M8NA 4D2KA 1SB3C 3GE3C 4J6IA 3AU4A 3LDZE 4LNFA 1VR9A 1TY0A 2IY0B 5C3JB 3AI5A 2L0TA 2YLMA 3RUIB 3ZTCA 4DHZE 3WA0A 3U52E 1V6EA 1JROA 2WWZA 1XF5L 4YXDB 1JMLA 1YOVB 1TZ1A 1FIQA 2GOWA 2KJHB 2AL3A 4KZ0A 2JU6X 3PREA 2N1WA 3RMKC 1KTKA 3B9JA 2NCNA 4MM3B 4W9FA 1L0XB 2ONQA 1QOGA 3DVNV 4AOFA 4HK2A 2K8CA 2A4ZA 3KLSX 4M0WB 2V4LA 4TQ1A 3P4SB 3WCQA 4GLSC 2ICIA 1D5XC 2BBCA 2KMCA 4CQNA 3CWIA 2LVPA 1WJ6A 2WDTB 2QHOA 2MLBA 4M02A 2FIDA 1CZPA 4FADA 1M4VA 1AWDA 2D3GA 2JWUA 2G3QB 3N1ZC 3VUYA 4REZA 3VAWA 1QOAA 2MQJA 3V3XA 3D32A 3HIZA 2EELA 1E7PB 5EE9A 2M17A 4AP4C 2ZW1A 4ZRQA 2O6VB 3Q8BA 4MSMB 1STEA 3E56A 5FR6A 4K7UA 3MTNB 3DCGA 4C4VA 2DZMA 2KQ7A 3AU5A 4JIOU 1YX6B 4HRSA 2YVCA 3A9JB 4C7YA 2SAKA 1FFUA 3JVZX 4RFBA 1OQRA 3KQ4A 4L23A 3O65B 4PT5A 1HQRD 1YQ4B 1TBEA 1KLUD 1XCQL 2LVQA 3OJ3A 4NAWB 4E71A 3N30A 2WX0A 2FCNA 2UWQA 3JSVB 5DPWA 3L17A 2GBNA 3KWLA 4NQKE 4OW0A 1WRDB 4TMAB 4R3DA 3K9OB 2OJRA 1YIWA 3FAHA 5G5GA 1MHHE 3SD5A 2KDMA 1V5TA 2AQ2B 4MJSB 3ZRCA 5JHBA 1MI0A 2IGDA 3DWMA 3EFUA 4MH8A 1L6VA 2ZPYA 3UIPB 4C00A 2N9PC 3AE2B 5HG2A 1GG3A 3MHZA 3KH0A 1SEBD 1WYGA 2BKRB 2L0FA 3VUXA 2MHJA 1LQBA 4UDUC 2NBVB 4WQMA 3ZO5B 3R2IA 1C77A 3TEWA 2N0SB 4M0WA 3NG0A 4IWOA 1HZ5A 2KACA 2JUOA 1CK1A 1EU3A 2PKOA 3CF6E 1VZ6A 3MJ5A 4JPSA 1Q10A 4ICVA 2N7EA 1K50A 2CHXA 4NJ7A 1FFVA 2KDFB 4RGNA 2DAFA 1DGJA 4CO7A 1WZ0A 1IPGA 1GJZA 2BQQA 2BYVE 4XC2A 2M8SA 1CQVA 4JLCA 1PGXA 2C9WB 1UUPA 5J17A 1PGBA 4TUUA 4YTNB 1VCBA 3QX1A 1UWXA 2XK5B 1F2RC 4W9DA 3IBEA 2LJ5A 2WXJA 4AS1A 1MHXA 1TJEA 4WWOA 1OGWA 2I38A 4FHJA 2E6XA 2KK8A 3ZW3A 2GB1A 4IM2A 4MJSA 1YMHE 4AJWA 2K5PA 4HJGE 3IT4B 2FCSA 1YN5A 3EA6A 2JZPA 3LB8C 2MBQA 1YN4A 1N5XA 4A3OA 1E8WA 2D5GA 3U2SC 2ZJDA 3H9DA 1T3QA 4GDLB 1TZOA 3MHSD 4ARIA 1MG8A 1WGRA 3L08A 3OG5A 4W9EA 4II2B 2NS5A 2FIFA 2LVOA 1XD3B 1PUTA 2IPKD 4RF0A 3FILB 3HVDA 2M56B 1L7YA 3NHEB 5AZFA 4YL8A 5FR3A 1P98A 3AEFB 4ZRJA 1E7UA 1EWCA 3CIRB 2DHZA 2WU2B 2XN9C 1MFWA 1C4AA 3RD2A 2A5UA 2WXRA 2KWDA 1Q1OA 1E8XA 4DHZB 3BVZA 4JE3B 2KC2A 2H89B 2RDBC 1Y56A 3DQVA 4W9IA 4W9CA 4K3CA 3QARA 3Q3MC 3BYTB 4MGIE 4MH0E 1J0GA 4JQWC 2CKHB 2WXHA 2L83A 3DOWA 1D3ZA 2DAJA 3NOBA 4LTUA 3NY5A 1XO3A 2ZVNA 4H2AA 3RNAC 3HM3A 2L52A 4GU2A 4M8MA 2PJHA 2PW9A 2KX0A 3P63A 4GSWA 5IAAC 4G0NB 4CYEA 5D6JB 3RZFA 4DDID 1GC7A 1V1PA 4I6NB 3N1YC 4ANUA 2I2YA 3P4RB 4WAAA 2G1EA 4TV3A 1WIAA 2Z8LA 3AEGB 2J7QB 3UF8A 2KN5A 4ANWA 3V6CB 3M63B 4MELA 4L2YA 1WJ4A 3PZDA 4K81A 4WJQA 1U4AA 2PLPA 1E8ZA 3ZNGC 2XEWA 2NTTA 1VD2A 4C4VB 3QHTA 4XGAB 2MW5A 3NVVA 1SSNA 1YQBA 5GXGB 1G6JA 3A1QA 3SU8X 3TMPB 1ZDVA 2LGXA 3AH7A 3A4SC 3QIJA 4US9A 4JWSC 3FC4A 1DOYA 2DYMA 1QQRA 1N6ZA 1OEYA 2KTFA 3PT2B 4OZAA 2KQ4X 2Z59B 1NENB 1GAQB 1F77A 4K3BA 4HPMB 1ET6A 3ZDTA 2L3ZA 1UH6A 1F1HA 2MP2B 2V3SA 5HFYA 5BYRA 1UGMA 3PZ7A 2INPE 2C5LC 2AYOB 3AE7B 2IDYA 3HM6X 1WWTA 2W54A 1PGAA 1J7BA 4RGMA 1TKYA 2IBIB 4BZAA 1V97A 1SIFA 2KZRA 3L0WB 1Q0WB 5I4DA 1V80A 2K1FA 2N9LA 5KHQA 1CMXB 5E6NA 1TKGA 2HTHA 2KWUB 2N9XA 4KSKC 3ZXVA 4MEMA 2CU1A 1FRDA 1IUEA 2VH2A 2WXPA 3SFDB 2W9NA 1MVKA 4YSXB 3DBHI 3DHIC 4IUMB 2MWSB 1T0QC 2QMTA 1XLNA 5E6OA 1NYRA 2CU3A 3Q8AA 2J0KA 2G45B 2KHWB 1K52A 1R4MI 1CJEA 1QF6A 2LGSA 1VZ7A 1ZOYB 1WH3A 4C80A 1SXTA 2KANA 2LXCA 2MJDA 2B3AA 4TKNA 3UGBB 5EDSA 2ZPNA 4ZRIA 1P7FA 5EE1A 3WAMA 4PS7A 1N61A 1P7EA 1T0YA 3JYUA 3RN9C 2R2OA 4ANVA 4BOZB 2QEJC 1EF1A 1E5WA 3DVNU 5AZHA 4NPNA 1JWSD 2KMAA 4KIKA 2LHEA 4C56C 1I4RA 3B0AA 3EFCA 2BB5A 1HE8A 4NJCA 3VFKA 3X0WA 1PFDA 4KKJA 3LXFA 1SF0A 3I57A 4NNJB 1KFYB 1JQ4A 1IGCA 3DHHC 4X57B 3BZDB 3VTWA 1D4BA 3NZSA 1L0VB 3EC8A 2ACZB 2H88B 5CHWA 1WFYA 4HVBA 1T0SC 1VZ8A 2JPHA 4E3CA 2KQSA 3O13A 2O6VA 3WIMA 5IOIA 2EKEC 1IBXB 1WY8A 5IP4D 5BMGA 1GNUA 1FNVA 4S17A 1FO4A 2NTSA 2KYWA 1TTNA 2I1JA 2PEAA 1F0ZA 1KH0A 1XCTL 3AE5B 3T8MA 1TGZB 4B6WA 3VDZA 2K25A 3AE1B 2IYDB 2K9XA 2DX5B 2LGIA 3R7QA 1JWMD 1T0RC 1RM6C 3IXSA 2WU5B 5AZGA 2W3SA 2DWQA 3VXWA 2J53A 2PVGC 1KLGD 2KN4A 1J7CA 1ET9A 1FEHA 4HKZE 4RCOA 4BOSC 1KM7A 1ZDXA 4HEA1 4LNKA 1Z2MA 4IM0A 4A8XC 2LHDA 4AQ7A 1N63A 2BKFA 2LRUA 1FMAD 2AX5A 2KVRA 3IVFA 1WJUA 1RRBA 1FXTB 1WXSA 1P3QU 2QDFA 3RFZB 3QJZA 3U4EG 3PRZA 3PHWB 2ZCBA 4MSQB 4GMVA 1I35A 2D2QA 2NBWB 1NI3A 1YX5B 2RR9A 2DBYA 1F52A 4FLHA 3NUHB 2KJRA 3HRDD 2HTME 2N1VA 2JF5A 4DXFA 1BUIC 2QJLA 4RM8A 4WAFA 1ZXIA 1IP9A 4FJZA 4RF1A 4JX1C 1D5MC 2C7HA 2RGFA 1V8CA 4B0MA 5J18A 2D3CA 2J52A 3AMZA 4ARCA 1WJNA 1I4XA 2BW2A 4DXGA 5G5HA 4XWWA 1AW7A 3DBRI 2K39A 2M0AA 4N58A 2X38A 3MP9A 1N60A 5TSSA 3UINB 4O1NA 4P6VF 3E9SA 3BY4B 4FULA 1QKZA 1NBFC 3M95A 3VR8B 2ASQA 2QILA 3VRBB 3AB5A 2KAJA 2PTLA 4HKQA 4KIKB 1XEEA 1V1PB 2M4NA 3ZLZA 2FUHB 1C4PA 3FILA 3KWVA 4WH4A 1EWYC 1XT9B 3GE8C 2MBEA 4ZYSA 2JQRB 4WWMA 4K1RB 4M00A 3AE6B 2BYTA 2KFKB 4YSZB 4IWPA 1ISNA 2R2QA 3URYA 2BB6A 1RAXA 3VR9B 4IW0A 2NPTB 1LM8B 2D3AA 4FN2A 2BS2B 4DXAB 2LD9A 2KDEB 1H8CA 4FJYA 5HKHA 4HCPB 2MBBB 3BINA 2RD0A 4DWFA 2CJOA 4N59A 4LJPB 2J0JA 4PYZA 5J2RA 4QAYA 2YEPB 1VDVA 1FNWA 2Y5PA 2MSED 2KFKA 1KRHA 3SFEB 1FCLA 3AXCA 3RNFC 1GPXA 3VQIA 2KTRA 4KSLC 4W9LA 4KGRA 1WRIA 1S3SG 3PS6A 4DQOC 1WX7A 3SHQA 2WDRB 3SR6A 1K51A 1JRPA 2WXKA 2BWFA 3HUIA 3ZKJC 3B2FA 4PS3A 2JXXA 1R7SA 2SEBD 1B9RA 3ZVVA 2LFIA 2VZKB 3LJ3A 4OZCA 5CTRC 3AEDB 1ACCA 3APDA 5TR5A 2NPTA 1A70A 4W9JA 2VRRB 2DZIA 3P42A 3OLMD 1TKEA 3A9KA 2MBHA 1JWUD 1BMLC 5G2NA 1HTQA 2GBMA 1SJHD 3VTUA 1EUVB 3Q14C 1LGRA 2GRIA 3TIXA 1OQQA 4F1SA 5BMHA 3A9KB 2L00B 3Q3FA 5L83A 1UWMA 1L4ZB 2ZCCA 4EFOA 3PZ8A 2FE8A 1OQYA 3ZNID 3NS1A 1UF0A 3I63C 1C76A 3AV8A 3ENEA 4NY0A 3AE8B 3GZNI 5LNK1 4XX5A 2Z0DB 1WXMA 1V1OA 2G4SA 1SE3A 2JYTA 4JWUC 2V0GA 1UGJA 4AWJA 2C7NB 3W9CB 1T5XD 3TUOA 2LXAA 2FCQA 2JT4B 4W9HA 3APCA 1QT9A 4K7WA 1I4QA 2WXOA 4WQOB 2EMTA 3AM9A 4A9AA 1A5RA 1WM2A 1WXQA 3QK0A 2RMMA 4NQLB 1Q5WB 2KWVB 4F8CB 4P1BC 1L2NA 1D6EC 2HDEA 4LJOB 4IKGA 2JRIB 1VLBA 4NJ6A 4PK1A 2Y5BB 2W55A 5EE3A 3KUCB 3N3KB 4LCDE 5DPRA 4LLGM 3H6NA 2C60A 2WS3B 4DK5A 4A20A 2KLGA 3TL5A 4MGZE 2N9KA 1WX8A 1E6EB 1NEKB 3AE3B 2WHIA 1EO6A 4ZOHC 2BS4B 3K9PB 2DZJA 4FBJB 3M62B 3R8BA 2K6DB 1C4CA 2RDGA 1Y8RC 3GOEA 2W3RA 3QCAA 2ZW0A 2KD0A 1NVID 4EKUA 2IO1B 1L0YB 1MPEA 3PHXB 4GXBA 2WP9B 3DPDA 1V2YA 1RLFA 2L8JA 2V3PA 2LRWA 2KOXA 3H8HA 1SJED 4URKA 2REXA 1FNUA 1WSPA 2LASA 5D2MB 3KUDB 2PE6B 1WXAA 4KV2A 3ZNZB 2KJ6A 1K53A 4USAA 3W5UB 2BPSA 2HJ1A 4IOIE 5D3IB 2K6QA 3ALBA 3CSTA 1RFKA 3QC8B 1V49A 3PTFC 2ZEQA 2NBUA 5HHDG 3PSEB 3H1UA 3VH3B 2PE9A 2K8HA 4ICUA 1YJ1A 1QILA 4FHKA 4ZRKA 1IBXA 4EEWA 4BKSD 2ZNVB 4IC7B 4RMAA 2IZVB 2QCZA 4A6QA 2ZNVC 5IN7A 1DYQA 2HE7A 1LXDA 4BFRA 2DZKA 3P1MA 4M01A 3DHGC 4BKTA 2LGDA 4EE2A 4RM9A 5MPOA 1TS5A 2KDIA 1EF5A 2J0MA 3KVFB 1ZP0B 3P4QB 1FPYA 4LK0M 3C0RB 1PDXA 1FCCC 4WJPA 2UYZB 3ZJUA 3DBHB 3RCZA 3UQBA 3NRZA 2FNJB 4HLEA 2J4XA 1NDDA 2WXQA 1WZ3A 4BKSA 3I3TB 1E7VA 4KKIA 4AJYB 2WXIA 3BVGA 4NZLB 3ECIA 2WNMA 3R66C 2DNFA 2LUEA 2W82A 1HXYD 3X23A 4BKGA 2CJNA 3EGRA 1K8RB 2CS4A 4BVUC 2Z0EB 2UU7A 4Q2JA 4K7SA 2MJEA 4GB9A 3GB1A 2WX1A 5H92C 4XZ4A 3ML9A 3AN1A 1PYWD 1ZUD2 4A55A 5D7GA 3UIOB 4P16A 1J8CA 3GP7A 2JVCA 4LDTD 5DPSA 2CR5A 3T3OA 1L4DB 1YNTE 3DVGX 3TEXA 3DDCB 3I5JC 1V5OA 3KYCD 1XXGA 2RPQA 1IGDA 2G9HD 1JCKB 1WR1A 1V9JA 4OHJA 5T8IA 3U8ZA 2M0XA 5HI1A 3ZIMA 1UNSA 4B0EA 2JX5A 1EM7A 2WDVB 2BF8B 3SEBA 1AARA 2ON8A 4BBNC 2K8BA 4KDIC 4HCNB 5AUIA 3Q2AC 5GMVA 1DOIA 4ITKA 2WYQA 5LXHA 2DENB 2D11A 3B08A 1UBQA 2AQ3B 3TCAA 4KX6B 2KX3A 4N9F4 5IA7A 1FXIA 2DLBA 2V3NA 2XNAC 3KUZA 1ZPSA 2D10A 1JRUA 3ZTDA 2O6VD 3MC8A 5CHFA 3W5VB 5H8YE 3CSFA 1HTOA 4MDKE 1WX9A 4W9GA 1ENFA 1YJIA 3ZYYX 1OEYJ 5C23A 1YN3A 4LNOA 1GOZA 3A9JA 4I6PA 1SE4A 3AEEB 3PVLA 5BYSA 3I9V1 1MJDA 2NR2A 1YJJA 1WXVA 3UI3A 2TSSA 2XK5A 4NAWA 5L95C 1GUAB 4GOCA 2N4FA 4HJKA 1WGYA 1WE7A 3T9LA 4HPLB 1C78A 3L13A 1TS3A 3GS2A 2K22A 1ZGUB 3R7RA 1FM0D 2BTEA 4RGOS 1E10A 2GBRA 2JY6A 2KWCA 2V9HA 2IGGA 5DCNA 3UQAA 4DBGA 4WURA 2BS3B 3PV1A 1D5ZC 3VH4B 4ACFA 1WGGA 1E9MA 4FXCA 2O2VA 4IG7B 3L54A 3U30A 4AUQC 1TIFA 4RGTA 3H7SA 1NYQA 2AWTA 4YSYB 2WXGA 4HROA 5JZEB 3RPFC 3DBSA 2O2VB 1J19A 4HDOA 2M1MA 2L76A 1N62A 2IO3B 1QLBB 2D07B 4MT5A 2Y5CA 1KF6B 1TT5B 1QOBA 2FCMA 3R2TA 2EMSA 3W1SA 3AEAB 1E8YA 3MC9A 1OTRB 1ZXHA 2N7DA 4YTPB 1BT0A 2IY1B 5IKCM 4WWPA 1ROEA 2B76B 4ZDVA 2L7RA 2ZZPB 3V61A 2JXTA 2KMMA 2HJ8A 2QSDA 1I42A 3KW5B 1C9FA 3QAQA 2GBJA 3C8YA 1L5PA 2OHFA 3IG3A 5CX3A 2MEKA 4GDLA 1ZE3D 2X8XX 1ESFA 4G50A 1RWSA 1XLQA 2D3BA 2ZVOA 4YT0B 2WXNA 3RNBC 4XDCA 3ZGZA 2WGSA 4LNNA 5KHOA 1F2RI 1SE9A 1XQQA 5JH5C 2WQYB 1UELA 3ZDMC 1LO5D 3TJPA 5C1ZA 1HEZE 1YD8U 5FK9C 2KXJA 3ZRFA 5LXIB 4XWTA 4A90A 2INCC 1I4PA 4US8A 4OVUA 2GBKA 2K0PA 1R4NI 4GDKA 4IWQA 4F7ZA 2E3TA 4ANXA 3L4PA 3LYYA 2YEPF 1C3TA 3DBRB 2WLBA 4LDTB 3EHVA 4PYUA 2JRHA 1YQ3B 5D3DA 2LI5A 2WDQB 3AECB 5E6PA 3H7PB 3V05A 1JW9D 3BYYB 2KKCA 1R4NB 2AQ1B 2CHWA 3M3JA 3KYDD 3MFGA 3B2GA 3NVWA 2L32A 2GMIC 2OEDA 2LWPA 1VRAB 1WGHA 5IO9A 4YTMB 2NVUI 2JZ3B 3W1YA 3RNEC 1QOFA 2K3UA 1WM3A 3QWZB 3RULA 1TS4A 1HZ6A 3CMMB 3U7ZA 4MGYE 1WGKA 1WE6A 4DHJD 4G3XB 2LEKA 2V1YA 3NS8A 1ZW7A 2BT6A 4W9KA 3Q3OC 4MACA 1OFFA 4PS8A 2WXLA 3JW0X 4I6LB 1ZKHA 5JXVA 3PO0A 4WJOA 2G4DB 3ABVB 1DOXA 3WANA 1H4RA 3EUB2 2KT7A 2J42A 3IT6B 4YWGG 4BBNF 2PPHA 1I4HA 3H7PA 1XLOA 4MM3A 2N7JA 2KDBA 3BVMA 3L10B 1SE2A 3W2DA 4KDLB 3T3NA 3ZNHB 2AEHA 1J7AA 5C2TB 3P2BA 3NVZA 2DYOA 2QC8A 3TEZA 2C7MB 4A3PA 3V62A 4ASWC 3BIID 3ZXRA 4RNAA 2BWES 4WJNA 4WIPA
chains in the Genus database with same CATH topology
4MJSB 3ZRCA 5JHBA 3EFUA 5CHVC 3RCZA 3UQBA 2ZPYA 2IO0B 4BOSC 1KM7A 3UIPB 2FNJB 4HLEA 1NDDA 2N9PC 1WZ3A 4BKSA 4GIVA 1GG3A 3W1SC 1UZXB 3KH0A 1Z2MA 3I3TB 1V86A 4IM0A 1E7VA 2BKRB 2L0FA 3VUXA 2MRPA 2KC1A 4AJYB 1LQBA 2NBVB 2BKFA 3TBLD 3ZO5B 2LRUA 1KJTA 2KLCA 4JGHB 3ECIA 3R66C 2KVRA 3IVFA 1WJUA 1RRBA 1FXTB 4IWOA 1WXSA 2JUOA 2LUEA 1P3QU 3X23A 4BKGA 3CF6E 3RZWC 3QJZA 1F9JA 1K8RB 2CS4A 4IM3A 4BVUC 3PRZA 3PHWB 2Z0EB 2ZCBA 4ICVA 4GMVA 4MSQB 2D2QA 2N7EA 5D94A 1I35A 2CHXA 3DVGY 4K7SA 4NJ7A 1E90A 2KDFB 2NBWB 4GB9A 2DAFA 1YX5B 2RR9A 2WX1A 1WMHB 4FLHA 4XZ4A 4CO7A 2KJRA 3ML9A 1WZ0A 1IPGA 3QQ8B 1GJZA 1GC6A 2MCNB 2N1VA 2JF5A 2BYVE 1SGHA 4XC2A 4EZLA 2M8SA 1QZEA 2C9WB 4JLCA 4RM8A 5J17A 5D7GA 1IP9A 3UIOB 4TUUA 1J8CA 4FJZA 1VCBA 3QX1A 2XK5B 2JVCA 4LDTD 2C7HA 3VVWB 2RGFA 5DPSA 5J18A 3JSVA 4W9DA 3IBEA 2CR5A 2LJ5A 1WJNA 3VUWA 4EUTA 3DVGX 3DDCB 1V5OA 4WWOA 3DBRI 3WAOA 1OGWA 5AEKB 2K39A 3KYCD 2RPQA 4FHJA 2KK8A 3ZW3A 1WYWB 5JHAA 3PRPB 4IM2A 3UINB 4MJSA 1WR1A 1V9JA 4AJWA 3U8ZA 2M0XA 3ZIMA 4GN1A 2MP2A 2FCSA 3BY4B 4GGQA 3QA8A 4FULA 2MX2A 1Z5SB 1NBFC 3M95A 2MBQA 2BF8B 1AARA 2ASQA 4BBNC 2K8BA 4KDIC 4A3OA 1E8WA 4MGKE 4HCNB 3V6EB 5GMVA 2JWZA 2ZJDA 3H9DA 4GDLB 5LXHA 3MHSD 2WYQA 1MG8A 4CHKA 2DENB 1WGRA 3L08A 4KIKB 2D11A 3B08A 1UBQA 1WGDA 2M4NA 3ZLZA 1WR6E 3TCAA 2KX3A 3EECA 4W9EA 4II2B 2NS5A 3OJ4B 2FUHB 4N9F4 2FIFA 2LVOA 1C1YB 2IO2B 1KOTA 1XD3B 5IA7A 3ZUNA 3KUZA 2D10A 1JRUA 1XT9B 3ZTDA 2O6VD 3S2AA 2MBEA 5CHFA 1L7YA 3NHEB 4K1RB 3CSFA 3RYTA 5AZFA 4MDKE 2AL6A 1WX9A 4W9GA 4YL8A 2KFKB 1UD7A 3IFWB 4IWPA 1ISNA 1P98A 2R2QA 4ZRJA 1E7UA 1OEYJ 2DHZA 5C23A 3VTVA 1RAXA 4OVVA 4IW0A 3A9JA 4I6PA 2NPTB 2A5UA 3RD2A 3VHTC 3A1QB 1Q1OA 4ZYNA 3PVLA 1LM8B 1E8XA 4FN2A 3PRMB 2NR2A 4DHZB 1WXVA 4DXAB 2LD9A 2KC2A 2KDEB 2XK5A 4EZKA 4NAWA 1H8CA 3DQVA 4W9IA 4FJYA 3HK0A 4W9CA 3QARA 5HKHA 3L16A 4MH0E 4HCPB 4MGIE 1GUAB 4WWNA 5DPTA 5L95C 1J0GA 4GOCA 4JQWC 3MJWA 1WI0A 2CKHB 2MBBB 2N4FA 3BINA 1WGYA 2RD0A 4HJKA 4DWFA 4EOYA 4LJPB 3DOWA 2J0JA 1WE7A 2DAJA 4P7IA 1D3ZA 3T9LA 4HPLB 3NOBA 3R3MA 4PYZA 3SDLC 4TQ0A 1WMHA 2LZ6A 5J2RA 4GDKB 3NY5A 4B95A 2DYBA 2ZVNA 5LLIA 3L13A 2MSED 1KLVA 2KFKA 3A33B 3AXCA 1ZGUB 3HM3A 3R7RA 3VQIA 2KTRA 4GU2A 2GBRA 3N32A 1M94A 1S1QB 4KSLC 4M8MA 2JY6A 2KWCA 4W9LA 2PJHA 1LFDA 5DCNA 2XBBC 2HD5B 2KX0A 3DBLI 3UQAA 4GSWA 5IAAC 2MA9B 4HDQA 1S3SG 4DBGA 4G0NB 1WF9A 4CYEA 2LGYA 5D6JB 4DHJB 3PS6A 3RZFA 3PV1A 4DDID 3OAWA 1GC7A 4I6NB 1NI2A 4ANUA 3VH4B 5G55A 1WGGA 4WAAA 3WALA 1WX7A 2O2VA 4TV3A 3PLUA 4IG7B 3L54A 3U7DA 3SHQA 3PGEA 1WIAA 3APFA 3U30A 2J7QB 4HVBA 3UF8A 4AUQC 3B1LX 2KN5A 2BGFA 1PQSA 3H7SA 4ANWA 3V6CB 2BWFA 2CHZA 1RFAA 3ZKJC 4E74A 2AWTA 3M63B 4PS3A 2JXXA 4MELA 1WJ4A 3AULA 3PZDA 4JL9A 4K81A 1P0RA 4WJQA 3DBSA 5JZEB 1U4AA 2O2VB 1J19A 4HDOA 1IYFA 2M1MA 1E8ZA 3ZNGC 3ZVVA 3LJ3A 2L76A 2N9EB 2XEWA 1VD2A 5CTRC 3APDA 5TR5A 3QHTA 1X1MA 2MW5A 2IO3B 2D07B 1YQBA 4KVGB 2NPTA 1G6JA 3A1QA 3SU8X 3TMPB 4W9JA 4G11A 4HWIB 2FCMA 2DZIA 2VRRB 1V81A 2KNBA 2OOBB 3Q3JA 2LGXA 3OLMD 3A9KA 3A4SC 3QIJA 1UBIA 2KTRB 3PLVA 4EZJA 2MBHA 2EMSA 3W1SA 5G2NA 1E8YA 2GBMA 1OTRB 2N7DA 3VTUA 1BT0A 1EUVB 2IY1B 2DYMA 3PPAA 4II3B 2MBOA 4B9KA 4WWPA 3TIXA 1OEYA 2KTFA 3PT2B 4F1SA 5BO4B 4ZDVA 2L7RA 2L05A 3A9KB 2L00B 2RSUA 2ZZPB 3Q3FA 2Z59B 4DDGD 5L83A 2ZCCA 4EFOA 2BYEA 3V61A 4FA6A 3HHMA 2HJ8A 1I42A 2FAZA 3ONSA 4HPMB 1OQYA 3ZDTA 3KW5B 3ZNID 2L3ZA 1UH6A 3ENEA 2GBJA 3QAQA 4NY0A 3GZNI 4HXDA 2BYFA 2MP2B 4XX5A 2V3SA 2Z0DB 3NZUA 1WXMA 3IG3A 5CX3A 3WAPA 2G4SA 3RT3B 1UGMA 2KO3A 2C5LC 4GDLA 4AWJA 2C7NB 2I1KA 4FJVB 4KZCA 2AYOB 2KFJA 4G50A 2LXAA 3HM6X 2FCQA 2JT4B 2JZZA 2ZVOA 1P9DU 3APCA 4W9HA 4K7WA 3ML8A 2IBIB 3A4RA 5KHOA 1SE9A 1XQQA 4WQOB 3V60A 5JH5C 2EMTA 1SIFA 3IHPC 2KZRA 1UELA 1P1AA 3L0WB 4M8NA 1Q0WB 1A5RA 1WM2A 3ZDMC 1V80A 4J6IA 3AU4A 2K1FA 3LDZE 3TJPA 5KHQA 5C1ZA 3QK0A 1YD8U 2KXJA 3ZRFA 1CMXB 4NQLB 1Q5WB 2KWVB 5E6NA 5LXIB 2IY0B 4F8CB 1L2NA 3AI5A 2HTHA 2KWUB 2L0TA 2N9XA 4KSKC 4MEMA 2CU1A 2YLMA 4LJOB 3RUIB 3ZTCA 2JRIB 4NJ6A 4DHZE 4OVUA 3WA0A 2GBKA 2Y5BB 4F7ZA 1R4NI 4GDKA 4IWQA 3KUCB 3N3KB 2W9NA 1V6EA 4LCDE 4WJPA 5DPRA 4ANXA 3DBHI 2WWZA 3H6NA 4IUMB 1C3TA 2C60A 1TZ1A 4LDTB 2MWSB 4DK5A 3EHVA 4A20A 2GOWA 2KJHB 4PYUA 2AL3A 5E6OA 2JRHA 2KLGA 4KZ0A 3TL5A 4MGZE 2J0KA 3PREA 2N1WA 2G45B 2LI5A 2KHWB 1WX8A 5E6PA 1R4MI 1EO6A 2NCNA 3H7PB 3K9PB 2KKCA 2DZJA 4W9FA 4FBJB 3M62B 3DVNV 1WH3A 2CHWA 2K6DB 3M3JA 3KYDD 4HK2A 4AOFA 2K8CA 2A4ZA 2KANA 2LXCA 4TKNA 1Y8RC 2B3AA 3UGBB 5EDSA 3GOEA 2ZPNA 4M0WB 4ZRIA 2GMIC 2V4LA 3QCAA 4TQ1A 3WAMA 2LWPA 4PS7A 1WGHA 1T0YA 2NVUI 2KD0A 2JZ3B 3W1YA 2KMCA 3JYUA 2R2OA 4ANVA 1WM3A 2IO1B 2LVPA 3QWZB 4EKUA 4BOZB 1WJ6A 3RULA 2WDTB 1EF1A 2QHOA 2MLBA 3CMMB 3PHXB 4GXBA 4MGYE 1E5WA 3DPDA 3DVNU 5AZHA 1V2YA 2FIDA 4NPNA 1RLFA 4FADA 1WE6A 2KMAA 4DHJD 4KIKA 2D3GA 2G3QB 4G3XB 3VUYA 2L8JA 3VAWA 2LRWA 2KOXA 2V1YA 3B0AA 3NS8A 4URKA 2REXA 2MQJA 1ZW7A 3D32A 2LASA 1HE8A 5D2MB 3KUDB 2PE6B 3HIZA 4W9KA 1WXAA 4KV2A 3VFKA 2KJ6A 3X0WA 3ZNZB 2M17A 4AP4C 4PS8A 2BPSA 3JW0X 4I6LB 1ZKHA 2O6VB 4NNJB 4WJOA 2K6QA 3ALBA 3CSTA 2G4DB 3QC8B 4MSMB 4X57B 1V49A 3VTWA 3NZSA 2ZEQA 3PTFC 5FR6A 4K7UA 3MTNB 3EC8A 3DCGA 2NBUA 3PSEB 3WANA 3H1UA 1WFYA 5CHWA 2DZMA 1H4RA 2KQ7A 3AU5A 1YX6B 2PE9A 4JIOU 3VH3B 2K8HA 2JPHA 2YVCA 3A9JB 4ICUA 4E3CA 2KQSA 1YJ1A 2O6VA 3JVZX 3WIMA 4FHKA 4ZRKA 2EKEC 4EEWA 4BKSD 4BBNF 2PPHA 1WY8A 3O65B 2ZNVB 4IC7B 1GNUA 4RMAA 1TBEA 2IZVB 3H7PA 2LVQA 1TTNA 2I1JA 2PEAA 3OJ3A 4MM3A 4NAWB 3T8MA 4E71A 2ZNVC 2KDBA 1TGZB 2HE7A 3N30A 1LXDA 2WX0A 4B6WA 2DZKA 4BFRA 2FCNA 3VDZA 2K25A 2UWQA 3JSVB 3L10B 2IYDB 5DPWA 2DX5B 4BKTA 2LGDA 3L17A 3R7QA 4KDLB 2GBNA 4NQKE 3ZNHB 2AEHA 4RM9A 1WRDB 3P2BA 2KDIA 3K9OB 2DYOA 1EF5A 2J0MA 2OJRA 3KVFB 2C7MB 1YIWA 4A3PA 3V62A 5AZGA 4ASWC 3C0RB 3SD5A 1V5TA 3VXWA 2BWES 4WJNA 2UYZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS B;  3ZRC A;  5JHB A;  3EFU A;  5CHV C;  3RCZ A;  3UQB A;  2ZPY A;  2IO0 B;  4BOS C;  1KM7 A;  3UIP B;  2FNJ B;  4HLE A;  1NDD A;  2N9P C;  1WZ3 A;  4BKS A;  4GIV A;  1GG3 A;  3W1S C;  1UZX B;  3KH0 A;  1Z2M A;  3I3T B;  1V86 A;  4IM0 A;  1E7V A;  2BKR B;  2L0F A;  3VUX A;  2MRP A;  2KC1 A;  4AJY B;  1LQB A;  2NBV B;  2BKF A;  3TBL D;  3ZO5 B;  2LRU A;  1KJT A;  2KLC A;  4JGH B;  3ECI A;  3R66 C;  2KVR A;  3IVF A;  1WJU A;  1RRB A;  1FXT B;  4IWO A;  1WXS A;  2JUO A;  2LUE A;  1P3Q U;  3X23 A;  4BKG A;  3CF6 E;  3RZW C;  3QJZ A;  1F9J A;  1K8R B;  2CS4 A;  4IM3 A;  4BVU C;  3PRZ A;  3PHW B;  2Z0E B;  2ZCB A;  4ICV A;  4GMV A;  4MSQ B;  2D2Q A;  2N7E A;  5D94 A;  1I35 A;  2CHX A;  3DVG Y;  4K7S A;  4NJ7 A;  1E90 A;  2KDF B;  2NBW B;  4GB9 A;  2DAF A;  1YX5 B;  2RR9 A;  2WX1 A;  1WMH B;  4FLH A;  4XZ4 A;  4CO7 A;  2KJR A;  3ML9 A;  1WZ0 A;  1IPG A;  3QQ8 B;  1GJZ A;  1GC6 A;  2MCN B;  2N1V A;  2JF5 A;  2BYV E;  1SGH A;  4XC2 A;  4EZL A;  2M8S A;  1QZE A;  2C9W B;  4JLC A;  4RM8 A;  5J17 A;  5D7G A;  1IP9 A;  3UIO B;  4TUU A;  1J8C A;  4FJZ A;  1VCB A;  3QX1 A;  2XK5 B;  2JVC A;  4LDT D;  2C7H A;  3VVW B;  2RGF A;  5DPS A;  5J18 A;  3JSV A;  4W9D A;  3IBE A;  2CR5 A;  2LJ5 A;  1WJN A;  3VUW A;  4EUT A;  3DVG X;  3DDC B;  1V5O A;  4WWO A;  3DBR I;  3WAO A;  1OGW A;  5AEK B;  2K39 A;  3KYC D;  2RPQ A;  4FHJ A;  2KK8 A;  3ZW3 A;  1WYW B;  5JHA A;  3PRP B;  4IM2 A;  3UIN B;  4MJS A;  1WR1 A;  1V9J A;  4AJW A;  3U8Z A;  2M0X A;  3ZIM A;  4GN1 A;  2MP2 A;  2FCS A;  3BY4 B;  4GGQ A;  3QA8 A;  4FUL A;  2MX2 A;  1Z5S B;  1NBF C;  3M95 A;  2MBQ A;  2BF8 B;  1AAR A;  2ASQ A;  4BBN C;  2K8B A;  4KDI C;  4A3O A;  1E8W A;  4MGK E;  4HCN B;  3V6E B;  5GMV A;  2JWZ A;  2ZJD A;  3H9D A;  4GDL B;  5LXH A;  3MHS D;  2WYQ A;  1MG8 A;  4CHK A;  2DEN B;  1WGR A;  3L08 A;  4KIK B;  2D11 A;  3B08 A;  1UBQ A;  1WGD A;  2M4N A;  3ZLZ A;  1WR6 E;  3TCA A;  2KX3 A;  3EEC A;  4W9E A;  4II2 B;  2NS5 A;  3OJ4 B;  2FUH B;  4N9F 4;  2FIF A;  2LVO A;  1C1Y B;  2IO2 B;  1KOT A;  1XD3 B;  5IA7 A;  3ZUN A;  3KUZ A;  2D10 A;  1JRU A;  1XT9 B;  3ZTD A;  2O6V D;  3S2A A;  2MBE A;  5CHF A;  1L7Y A;  3NHE B;  4K1R B;  3CSF A;  3RYT A;  5AZF A;  4MDK E;  2AL6 A;  1WX9 A;  4W9G A;  4YL8 A;  2KFK B;  1UD7 A;  3IFW B;  4IWP A;  1ISN A;  1P98 A;  2R2Q A;  4ZRJ A;  1E7U A;  1OEY J;  2DHZ A;  5C23 A;  3VTV A;  1RAX A;  4OVV A;  4IW0 A;  3A9J A;  4I6P A;  2NPT B;  2A5U A;  3RD2 A;  3VHT C;  3A1Q B;  1Q1O A;  4ZYN A;  3PVL A;  1LM8 B;  1E8X A;  4FN2 A;  3PRM B;  2NR2 A;  4DHZ B;  1WXV A;  4DXA B;  2LD9 A;  2KC2 A;  2KDE B;  2XK5 A;  4EZK A;  4NAW A;  1H8C A;  3DQV A;  4W9I A;  4FJY A;  3HK0 A;  4W9C A;  3QAR A;  5HKH A;  3L16 A;  4MH0 E;  4HCP B;  4MGI E;  1GUA B;  4WWN A;  5DPT A;  5L95 C;  1J0G A;  4GOC A;  4JQW C;  3MJW A;  1WI0 A;  2CKH B;  2MBB B;  2N4F A;  3BIN A;  1WGY A;  2RD0 A;  4HJK A;  4DWF A;  4EOY A;  4LJP B;  3DOW A;  2J0J A;  1WE7 A;  2DAJ A;  4P7I A;  1D3Z A;  3T9L A;  4HPL B;  3NOB A;  3R3M A;  4PYZ A;  3SDL C;  4TQ0 A;  1WMH A;  2LZ6 A;  5J2R A;  4GDK B;  3NY5 A;  4B95 A;  2DYB A;  2ZVN A;  5LLI A;  3L13 A;  2MSE D;  1KLV A;  2KFK A;  3A33 B;  3AXC A;  1ZGU B;  3HM3 A;  3R7R A;  3VQI A;  2KTR A;  4GU2 A;  2GBR A;  3N32 A;  1M94 A;  1S1Q B;  4KSL C;  4M8M A;  2JY6 A;  2KWC A;  4W9L A;  2PJH A;  1LFD A;  5DCN A;  2XBB C;  2HD5 B;  2KX0 A;  3DBL I;  3UQA A;  4GSW A;  5IAA C;  2MA9 B;  4HDQ A;  1S3S G;  4DBG A;  4G0N B;  1WF9 A;  4CYE A;  2LGY A;  5D6J B;  4DHJ B;  3PS6 A;  3RZF A;  3PV1 A;  4DDI D;  3OAW A;  1GC7 A;  4I6N B;  1NI2 A;  4ANU A;  3VH4 B;  5G55 A;  1WGG A;  4WAA A;  3WAL A;  1WX7 A;  2O2V A;  4TV3 A;  3PLU A;  4IG7 B;  3L54 A;  3U7D A;  3SHQ A;  3PGE A;  1WIA A;  3APF A;  3U30 A;  2J7Q B;  4HVB A;  3UF8 A;  4AUQ C;  3B1L X;  2KN5 A;  2BGF A;  1PQS A;  3H7S A;  4ANW A;  3V6C B;  2BWF A;  2CHZ A;  1RFA A;  3ZKJ C;  4E74 A;  2AWT A;  3M63 B;  4PS3 A;  2JXX A;  4MEL A;  1WJ4 A;  3AUL A;  3PZD A;  4JL9 A;  4K81 A;  1P0R A;  4WJQ A;  3DBS A;  5JZE B;  1U4A A;  2O2V B;  1J19 A;  4HDO A;  1IYF A;  2M1M A;  1E8Z A;  3ZNG C;  3ZVV A;  3LJ3 A;  2L76 A;  2N9E B;  2XEW A;  1VD2 A;  5CTR C;  3APD A;  5TR5 A;  3QHT A;  1X1M A;  2MW5 A;  2IO3 B;  2D07 B;  1YQB A;  4KVG B;  2NPT A;  1G6J A;  3A1Q A;  3SU8 X;  3TMP B;  4W9J A;  4G11 A;  4HWI B;  2FCM A;  2DZI A;  2VRR B;  1V81 A;  2KNB A;  2OOB B;  3Q3J A;  2LGX A;  3OLM D;  3A9K A;  3A4S C;  3QIJ A;  1UBI A;  2KTR B;  3PLV A;  4EZJ A;  2MBH A;  2EMS A;  3W1S A;  5G2N A;  1E8Y A;  2GBM A;  1OTR B;  2N7D A;  3VTU A;  1BT0 A;  1EUV B;  2IY1 B;  2DYM A;  3PPA A;  4II3 B;  2MBO A;  4B9K A;  4WWP A;  3TIX A;  1OEY A;  2KTF A;  3PT2 B;  4F1S A;  5BO4 B;  4ZDV A;  2L7R A;  2L05 A;  3A9K B;  2L00 B;  2RSU A;  2ZZP B;  3Q3F A;  2Z59 B;  4DDG D;  5L83 A;  2ZCC A;  4EFO A;  2BYE A;  3V61 A;  4FA6 A;  3HHM A;  2HJ8 A;  1I42 A;  2FAZ A;  3ONS A;  4HPM B;  1OQY A;  3ZDT A;  3KW5 B;  3ZNI D;  2L3Z A;  1UH6 A;  3ENE A;  2GBJ A;  3QAQ A;  4NY0 A;  3GZN I;  4HXD A;  2BYF A;  2MP2 B;  4XX5 A;  2V3S A;  2Z0D B;  3NZU A;  1WXM A;  3IG3 A;  5CX3 A;  3WAP A;  2G4S A;  3RT3 B;  1UGM A;  2KO3 A;  2C5L C;  4GDL A;  4AWJ A;  2C7N B;  2I1K A;  4FJV B;  4KZC A;  2AYO B;  2KFJ A;  4G50 A;  2LXA A;  3HM6 X;  2FCQ A;  2JT4 B;  2JZZ A;  2ZVO A;  1P9D U;  3APC A;  4W9H A;  4K7W A;  3ML8 A;  2IBI B;  3A4R A;  5KHO A;  1SE9 A;  1XQQ A;  4WQO B;  3V60 A;  5JH5 C;  2EMT A;  1SIF A;  3IHP C;  2KZR A;  1UEL A;  1P1A A;  3L0W B;  4M8N A;  1Q0W B;  1A5R A;  1WM2 A;  3ZDM C;  1V80 A;  4J6I A;  3AU4 A;  2K1F A;  3LDZ E;  3TJP A;  5KHQ A;  5C1Z A;  3QK0 A;  1YD8 U;  2KXJ A;  3ZRF A;  1CMX B;  4NQL B;  1Q5W B;  2KWV B;  5E6N A;  5LXI B;  2IY0 B;  4F8C B;  1L2N A;  3AI5 A;  2HTH A;  2KWU B;  2L0T A;  2N9X A;  4KSK C;  4MEM A;  2CU1 A;  2YLM A;  4LJO B;  3RUI B;  3ZTC A;  2JRI B;  4NJ6 A;  4DHZ E;  4OVU A;  3WA0 A;  2GBK A;  2Y5B B;  4F7Z A;  1R4N I;  4GDK A;  4IWQ A;  3KUC B;  3N3K B;  2W9N A;  1V6E A;  4LCD E;  4WJP A;  5DPR A;  4ANX A;  3DBH I;  2WWZ A;  3H6N A;  4IUM B;  1C3T A;  2C60 A;  1TZ1 A;  4LDT B;  2MWS B;  4DK5 A;  3EHV A;  4A20 A;  2GOW A;  2KJH B;  4PYU A;  2AL3 A;  5E6O A;  2JRH A;  2KLG A;  4KZ0 A;  3TL5 A;  4MGZ E;  2J0K A;  3PRE A;  2N1W A;  2G45 B;  2LI5 A;  2KHW B;  1WX8 A;  5E6P A;  1R4M I;  1EO6 A;  2NCN A;  3H7P B;  3K9P B;  2KKC A;  2DZJ A;  4W9F A;  4FBJ B;  3M62 B;  3DVN V;  1WH3 A;  2CHW A;  2K6D B;  3M3J A;  3KYD D;  4HK2 A;  4AOF A;  2K8C A;  2A4Z A;  2KAN A;  2LXC A;  4TKN A;  1Y8R C;  2B3A A;  3UGB B;  5EDS A;  3GOE A;  2ZPN A;  4M0W B;  4ZRI A;  2GMI C;  2V4L A;  3QCA A;  4TQ1 A;  3WAM A;  2LWP A;  4PS7 A;  1WGH A;  1T0Y A;  2NVU I;  2KD0 A;  2JZ3 B;  3W1Y A;  2KMC A;  3JYU A;  2R2O A;  4ANV A;  1WM3 A;  2IO1 B;  2LVP A;  3QWZ B;  4EKU A;  4BOZ B;  1WJ6 A;  3RUL A;  2WDT B;  1EF1 A;  2QHO A;  2MLB A;  3CMM B;  3PHX B;  4GXB A;  4MGY E;  1E5W A;  3DPD A;  3DVN U;  5AZH A;  1V2Y A;  2FID A;  4NPN A;  1RLF A;  4FAD A;  1WE6 A;  2KMA A;  4DHJ D;  4KIK A;  2D3G A;  2G3Q B;  4G3X B;  3VUY A;  2L8J A;  3VAW A;  2LRW A;  2KOX A;  2V1Y A;  3B0A A;  3NS8 A;  4URK A;  2REX A;  2MQJ A;  1ZW7 A;  3D32 A;  2LAS A;  1HE8 A;  5D2M B;  3KUD B;  2PE6 B;  3HIZ A;  4W9K A;  1WXA A;  4KV2 A;  3VFK A;  2KJ6 A;  3X0W A;  3ZNZ B;  2M17 A;  4AP4 C;  4PS8 A;  2BPS A;  3JW0 X;  4I6L B;  1ZKH A;  2O6V B;  4NNJ B;  4WJO A;  2K6Q A;  3ALB A;  3CST A;  2G4D B;  3QC8 B;  4MSM B;  4X57 B;  1V49 A;  3VTW A;  3NZS A;  2ZEQ A;  3PTF C;  5FR6 A;  4K7U A;  3MTN B;  3EC8 A;  3DCG A;  2NBU A;  3PSE B;  3WAN A;  3H1U A;  1WFY A;  5CHW A;  2DZM A;  1H4R A;  2KQ7 A;  3AU5 A;  1YX6 B;  2PE9 A;  4JIO U;  3VH3 B;  2K8H A;  2JPH A;  2YVC A;  3A9J B;  4ICU A;  4E3C A;  2KQS A;  1YJ1 A;  2O6V A;  3JVZ X;  3WIM A;  4FHK A;  4ZRK A;  2EKE C;  4EEW A;  4BKS D;  4BBN F;  2PPH A;  1WY8 A;  3O65 B;  2ZNV B;  4IC7 B;  1GNU A;  4RMA A;  1TBE A;  2IZV B;  3H7P A;  2LVQ A;  1TTN A;  2I1J A;  2PEA A;  3OJ3 A;  4MM3 A;  4NAW B;  3T8M A;  4E71 A;  2ZNV C;  2KDB A;  1TGZ B;  2HE7 A;  3N30 A;  1LXD A;  2WX0 A;  4B6W A;  2DZK A;  4BFR A;  2FCN A;  3VDZ A;  2K25 A;  2UWQ A;  3JSV B;  3L10 B;  2IYD B;  5DPW A;  2DX5 B;  4BKT A;  2LGD A;  3L17 A;  3R7Q A;  4KDL B;  2GBN A;  4NQK E;  3ZNH B;  2AEH A;  4RM9 A;  1WRD B;  3P2B A;  2KDI A;  3K9O B;  2DYO A;  1EF5 A;  2J0M A;  2OJR A;  3KVF B;  2C7M B;  1YIW A;  4A3P A;  3V62 A;  5AZG A;  4ASW C;  3C0R B;  3SD5 A;  1V5T A;  3VXW A;  2BWE S;  4WJN A;  2UYZ B; 
#chains in the Genus database with same CATH topology
 5CHV C;  3N20 C;  2IO0 B;  2RPV A;  4GIV A;  3W1S C;  1UZX B;  2NMQ A;  2INN E;  1V86 A;  3J9C A;  2MRP A;  2KC1 A;  2GLS A;  3TBL D;  1KJT A;  4OZB A;  2KLC A;  4JGH B;  2IND C;  2IGH A;  3ETR A;  3AE4 B;  3RZW C;  1T6B X;  2V4I B;  1F9J A;  4IM3 A;  3Q69 A;  2EKI A;  2VZK D;  5FKA C;  5D94 A;  3DVG Y;  1E90 A;  2M19 A;  3Q8E A;  3DWG C;  3MC0 B;  1WMH B;  1JWA D;  3QQ8 B;  2QIE B;  1GC6 A;  1B1Z A;  2MCN B;  5BMI A;  4ZHP A;  1SGH A;  4EZL A;  4ZHO A;  1QZE A;  2GI9 A;  1JAL A;  3Q8C A;  3VVW B;  4S0R A;  3JSV A;  2KVZ A;  2FBW B;  3IAS 1;  3GZN B;  3VUW A;  4EUT A;  2BVC A;  4BAX A;  1GB4 A;  3RI7 C;  3WAO A;  5AEK B;  3VRA B;  1WYW B;  3ZJV A;  5JHA A;  3PRP B;  3NZ3 A;  1GB1 A;  1VJK A;  3RNC C;  4GN1 A;  2MP2 A;  2OJW A;  2PIA A;  4GGQ A;  3QA8 A;  2MX2 A;  1Z5S B;  1JWB D;  3AEB B;  2PMV A;  1AYF A;  1TY2 A;  4MGK E;  3NJT A;  4HPP A;  5BYQ A;  3V6E B;  4J3O D;  2JWZ A;  4L1B A;  4CHK A;  1WGD A;  3P4P B;  3IAM 1;  1WR6 E;  3EEC A;  3OJ4 B;  2WXF A;  3TEY A;  1C1Y B;  2IO2 B;  1C79 A;  1KOT A;  4KGT A;  3ZUN A;  4ZRP A;  4P1C C;  2LJI A;  2LUM A;  1TS2 A;  3S2A A;  3N9Y C;  3RYT A;  4OVZ A;  2AL6 A;  1EU4 A;  1UD7 A;  5AUK A;  3IFW B;  2FUG 1;  4LNI A;  3VTV A;  1FRR A;  4OVV A;  1L6U A;  3Q8F A;  3Q6B A;  3VHT C;  5EE0 A;  3A1Q B;  2VH1 A;  1FD6 A;  4ZYN A;  1I4G A;  2MJ3 A;  3PRM B;  4XYC A;  3BK2 A;  3HVZ A;  4EZK A;  4N6E B;  3HK0 A;  2MH7 A;  3ZQ4 A;  3L16 A;  4WWN A;  5DPT A;  3FKY A;  3MJW A;  1WI0 A;  2LMC A;  4EOY A;  4P7I A;  3SDL C;  3R3M A;  4TQ0 A;  1WMH A;  2LZ6 A;  4GDK B;  4B95 A;  2DYB A;  5LLI A;  1KLV A;  3A33 B;  1AN8 A;  2JYE A;  1XLP A;  3N32 A;  1M94 A;  1S1Q B;  1LFD A;  2XBB C;  2HD5 B;  3DBL I;  1TYG B;  2MA9 B;  4HDQ A;  4IDI A;  1WF9 A;  2LGY A;  4DHJ B;  3OAW A;  1NI2 A;  3BWU D;  5G55 A;  3NVY A;  2IJ0 A;  3WAL A;  3AE9 B;  3TSS A;  3PLU A;  2R61 A;  3U7D A;  1I7H A;  3PGE A;  3APF A;  4KGS A;  3B1L X;  2BGF A;  1PQS A;  4NAM A;  2CHZ A;  1RFA A;  4E74 A;  3AUL A;  4JL9 A;  1P0R A;  1IYF A;  1FXA A;  2N9E B;  1X1M A;  1MG4 A;  1E0Z A;  4KVG B;  4RH6 A;  4G11 A;  4HWI B;  1V81 A;  2KNB A;  2OOB B;  3Q3J A;  3ZJT A;  1UBI A;  2KTR B;  1SIJ A;  3PLV A;  4EZJ A;  1R4M B;  1BXT A;  3C19 A;  5E6J A;  3DBL B;  3PPA A;  4II3 B;  3RNG C;  2MBO A;  4B9K A;  3BK1 A;  5BO4 B;  2L05 A;  2RSU A;  2JSV X;  4DDG D;  2BYE A;  4FA6 A;  2Y3A A;  3HHM A;  2FAZ A;  3ONS A;  1N5W A;  4XDD A;  2RDH A;  3N1X C;  4HXD A;  2BYF A;  2L1A A;  3NZU A;  3WAP A;  3RT3 B;  3OWE B;  2KO3 A;  1SBB B;  4TSS A;  2I1K A;  2Q5W D;  4FJV B;  4KZC A;  2KFJ A;  2JZZ A;  1HA5 A;  1P9D U;  3ML8 A;  3A4R A;  4C7Z A;  3Q3N C;  2PVO D;  2WXM A;  3V60 A;  1RYJ A;  3IHP C;  4XE0 A;  1P1A A;  4M8N A;  4D2K A;  1SB3 C;  3GE3 C;  4J6I A;  3AU4 A;  3LDZ E;  4LNF A;  1VR9 A;  1TY0 A;  2IY0 B;  5C3J B;  3AI5 A;  2L0T A;  2YLM A;  3RUI B;  3ZTC A;  4DHZ E;  3WA0 A;  3U52 E;  1V6E A;  1JRO A;  2WWZ A;  1XF5 L;  4YXD B;  1JML A;  1YOV B;  1TZ1 A;  1FIQ A;  2GOW A;  2KJH B;  2AL3 A;  4KZ0 A;  2JU6 X;  3PRE A;  2N1W A;  3RMK C;  1KTK A;  3B9J A;  2NCN A;  4MM3 B;  4W9F A;  1L0X B;  2ONQ A;  1QOG A;  3DVN V;  4AOF A;  4HK2 A;  2K8C A;  2A4Z A;  3KLS X;  4M0W B;  2V4L A;  4TQ1 A;  3P4S B;  3WCQ A;  4GLS C;  2ICI A;  1D5X C;  2BBC A;  2KMC A;  4CQN A;  3CWI A;  2LVP A;  1WJ6 A;  2WDT B;  2QHO A;  2MLB A;  4M02 A;  2FID A;  1CZP A;  4FAD A;  1M4V A;  1AWD A;  2D3G A;  2JWU A;  2G3Q B;  3N1Z C;  3VUY A;  4REZ A;  3VAW A;  1QOA A;  2MQJ A;  3V3X A;  3D32 A;  3HIZ A;  2EEL A;  1E7P B;  5EE9 A;  2M17 A;  4AP4 C;  2ZW1 A;  4ZRQ A;  2O6V B;  3Q8B A;  4MSM B;  1STE A;  3E56 A;  5FR6 A;  4K7U A;  3MTN B;  3DCG A;  4C4V A;  2DZM A;  2KQ7 A;  3AU5 A;  4JIO U;  1YX6 B;  4HRS A;  2YVC A;  3A9J B;  4C7Y A;  2SAK A;  1FFU A;  3JVZ X;  4RFB A;  1OQR A;  3KQ4 A;  4L23 A;  3O65 B;  4PT5 A;  1HQR D;  1YQ4 B;  1TBE A;  1KLU D;  1XCQ L;  2LVQ A;  3OJ3 A;  4NAW B;  4E71 A;  3N30 A;  2WX0 A;  2FCN A;  2UWQ A;  3JSV B;  5DPW A;  3L17 A;  2GBN A;  3KWL A;  4NQK E;  4OW0 A;  1WRD B;  4TMA B;  4R3D A;  3K9O B;  2OJR A;  1YIW A;  3FAH A;  5G5G A;  1MHH E;  3SD5 A;  2KDM A;  1V5T A;  2AQ2 B;  4MJS B;  3ZRC A;  5JHB A;  1MI0 A;  2IGD A;  3DWM A;  3EFU A;  4MH8 A;  1L6V A;  2ZPY A;  3UIP B;  4C00 A;  2N9P C;  3AE2 B;  5HG2 A;  1GG3 A;  3MHZ A;  3KH0 A;  1SEB D;  1WYG A;  2BKR B;  2L0F A;  3VUX A;  2MHJ A;  1LQB A;  4UDU C;  2NBV B;  4WQM A;  3ZO5 B;  3R2I A;  1C77 A;  3TEW A;  2N0S B;  4M0W A;  3NG0 A;  4IWO A;  1HZ5 A;  2KAC A;  2JUO A;  1CK1 A;  1EU3 A;  2PKO A;  3CF6 E;  1VZ6 A;  3MJ5 A;  4JPS A;  1Q10 A;  4ICV A;  2N7E A;  1K50 A;  2CHX A;  4NJ7 A;  1FFV A;  2KDF B;  4RGN A;  2DAF A;  1DGJ A;  4CO7 A;  1WZ0 A;  1IPG A;  1GJZ A;  2BQQ A;  2BYV E;  4XC2 A;  2M8S A;  1CQV A;  4JLC A;  1PGX A;  2C9W B;  1UUP A;  5J17 A;  1PGB A;  4TUU A;  4YTN B;  1VCB A;  3QX1 A;  1UWX A;  2XK5 B;  1F2R C;  4W9D A;  3IBE A;  2LJ5 A;  2WXJ A;  4AS1 A;  1MHX A;  1TJE A;  4WWO A;  1OGW A;  2I38 A;  4FHJ A;  2E6X A;  2KK8 A;  3ZW3 A;  2GB1 A;  4IM2 A;  4MJS A;  1YMH E;  4AJW A;  2K5P A;  4HJG E;  3IT4 B;  2FCS A;  1YN5 A;  3EA6 A;  2JZP A;  3LB8 C;  2MBQ A;  1YN4 A;  1N5X A;  4A3O A;  1E8W A;  2D5G A;  3U2S C;  2ZJD A;  3H9D A;  1T3Q A;  4GDL B;  1TZO A;  3MHS D;  4ARI A;  1MG8 A;  1WGR A;  3L08 A;  3OG5 A;  4W9E A;  4II2 B;  2NS5 A;  2FIF A;  2LVO A;  1XD3 B;  1PUT A;  2IPK D;  4RF0 A;  3FIL B;  3HVD A;  2M56 B;  1L7Y A;  3NHE B;  5AZF A;  4YL8 A;  5FR3 A;  1P98 A;  3AEF B;  4ZRJ A;  1E7U A;  1EWC A;  3CIR B;  2DHZ A;  2WU2 B;  2XN9 C;  1MFW A;  1C4A A;  3RD2 A;  2A5U A;  2WXR A;  2KWD A;  1Q1O A;  1E8X A;  4DHZ B;  3BVZ A;  4JE3 B;  2KC2 A;  2H89 B;  2RDB C;  1Y56 A;  3DQV A;  4W9I A;  4W9C A;  4K3C A;  3QAR A;  3Q3M C;  3BYT B;  4MGI E;  4MH0 E;  1J0G A;  4JQW C;  2CKH B;  2WXH A;  2L83 A;  3DOW A;  1D3Z A;  2DAJ A;  3NOB A;  4LTU A;  3NY5 A;  1XO3 A;  2ZVN A;  4H2A A;  3RNA C;  3HM3 A;  2L52 A;  4GU2 A;  4M8M A;  2PJH A;  2PW9 A;  2KX0 A;  3P63 A;  4GSW A;  5IAA C;  4G0N B;  4CYE A;  5D6J B;  3RZF A;  4DDI D;  1GC7 A;  1V1P A;  4I6N B;  3N1Y C;  4ANU A;  2I2Y A;  3P4R B;  4WAA A;  2G1E A;  4TV3 A;  1WIA A;  2Z8L A;  3AEG B;  2J7Q B;  3UF8 A;  2KN5 A;  4ANW A;  3V6C B;  3M63 B;  4MEL A;  4L2Y A;  1WJ4 A;  3PZD A;  4K81 A;  4WJQ A;  1U4A A;  2PLP A;  1E8Z A;  3ZNG C;  2XEW A;  2NTT A;  1VD2 A;  4C4V B;  3QHT A;  4XGA B;  2MW5 A;  3NVV A;  1SSN A;  1YQB A;  5GXG B;  1G6J A;  3A1Q A;  3SU8 X;  3TMP B;  1ZDV A;  2LGX A;  3AH7 A;  3A4S C;  3QIJ A;  4US9 A;  4JWS C;  3FC4 A;  1DOY A;  2DYM A;  1QQR A;  1N6Z A;  1OEY A;  2KTF A;  3PT2 B;  4OZA A;  2KQ4 X;  2Z59 B;  1NEN B;  1GAQ B;  1F77 A;  4K3B A;  4HPM B;  1ET6 A;  3ZDT A;  2L3Z A;  1UH6 A;  1F1H A;  2MP2 B;  2V3S A;  5HFY A;  5BYR A;  1UGM A;  3PZ7 A;  2INP E;  2C5L C;  2AYO B;  3AE7 B;  2IDY A;  3HM6 X;  1WWT A;  2W54 A;  1PGA A;  1J7B A;  4RGM A;  1TKY A;  2IBI B;  4BZA A;  1V97 A;  1SIF A;  2KZR A;  3L0W B;  1Q0W B;  5I4D A;  1V80 A;  2K1F A;  2N9L A;  5KHQ A;  1CMX B;  5E6N A;  1TKG A;  2HTH A;  2KWU B;  2N9X A;  4KSK C;  3ZXV A;  4MEM A;  2CU1 A;  1FRD A;  1IUE A;  2VH2 A;  2WXP A;  3SFD B;  2W9N A;  1MVK A;  4YSX B;  3DBH I;  3DHI C;  4IUM B;  2MWS B;  1T0Q C;  2QMT A;  1XLN A;  5E6O A;  1NYR A;  2CU3 A;  3Q8A A;  2J0K A;  2G45 B;  2KHW B;  1K52 A;  1R4M I;  1CJE A;  1QF6 A;  2LGS A;  1VZ7 A;  1ZOY B;  1WH3 A;  4C80 A;  1SXT A;  2KAN A;  2LXC A;  2MJD A;  2B3A A;  4TKN A;  3UGB B;  5EDS A;  2ZPN A;  4ZRI A;  1P7F A;  5EE1 A;  3WAM A;  4PS7 A;  1N61 A;  1P7E A;  1T0Y A;  3JYU A;  3RN9 C;  2R2O A;  4ANV A;  4BOZ B;  2QEJ C;  1EF1 A;  1E5W A;  3DVN U;  5AZH A;  4NPN A;  1JWS D;  2KMA A;  4KIK A;  2LHE A;  4C56 C;  1I4R A;  3B0A A;  3EFC A;  2BB5 A;  1HE8 A;  4NJC A;  3VFK A;  3X0W A;  1PFD A;  4KKJ A;  3LXF A;  1SF0 A;  3I57 A;  4NNJ B;  1KFY B;  1JQ4 A;  1IGC A;  3DHH C;  4X57 B;  3BZD B;  3VTW A;  1D4B A;  3NZS A;  1L0V B;  3EC8 A;  2ACZ B;  2H88 B;  5CHW A;  1WFY A;  4HVB A;  1T0S C;  1VZ8 A;  2JPH A;  4E3C A;  2KQS A;  3O13 A;  2O6V A;  3WIM A;  5IOI A;  2EKE C;  1IBX B;  1WY8 A;  5IP4 D;  5BMG A;  1GNU A;  1FNV A;  4S17 A;  1FO4 A;  2NTS A;  2KYW A;  1TTN A;  2I1J A;  2PEA A;  1F0Z A;  1KH0 A;  1XCT L;  3AE5 B;  3T8M A;  1TGZ B;  4B6W A;  3VDZ A;  2K25 A;  3AE1 B;  2IYD B;  2K9X A;  2DX5 B;  2LGI A;  3R7Q A;  1JWM D;  1T0R C;  1RM6 C;  3IXS A;  2WU5 B;  5AZG A;  2W3S A;  2DWQ A;  3VXW A;  2J53 A;  2PVG C;  1KLG D;  2KN4 A;  1J7C A;  1ET9 A;  1FEH A;  4HKZ E;  4RCO A;  4BOS C;  1KM7 A;  1ZDX A;  4HEA 1;  4LNK A;  1Z2M A;  4IM0 A;  4A8X C;  2LHD A;  4AQ7 A;  1N63 A;  2BKF A;  2LRU A;  1FMA D;  2AX5 A;  2KVR A;  3IVF A;  1WJU A;  1RRB A;  1FXT B;  1WXS A;  1P3Q U;  2QDF A;  3RFZ B;  3QJZ A;  3U4E G;  3PRZ A;  3PHW B;  2ZCB A;  4MSQ B;  4GMV A;  1I35 A;  2D2Q A;  2NBW B;  1NI3 A;  1YX5 B;  2RR9 A;  2DBY A;  1F52 A;  4FLH A;  3NUH B;  2KJR A;  3HRD D;  2HTM E;  2N1V A;  2JF5 A;  4DXF A;  1BUI C;  2QJL A;  4RM8 A;  4WAF A;  1ZXI A;  1IP9 A;  4FJZ A;  4RF1 A;  4JX1 C;  1D5M C;  2C7H A;  2RGF A;  1V8C A;  4B0M A;  5J18 A;  2D3C A;  2J52 A;  3AMZ A;  4ARC A;  1WJN A;  1I4X A;  2BW2 A;  4DXG A;  5G5H A;  4XWW A;  1AW7 A;  3DBR I;  2K39 A;  2M0A A;  4N58 A;  2X38 A;  3MP9 A;  1N60 A;  5TSS A;  3UIN B;  4O1N A;  4P6V F;  3E9S A;  3BY4 B;  4FUL A;  1QKZ A;  1NBF C;  3M95 A;  3VR8 B;  2ASQ A;  2QIL A;  3VRB B;  3AB5 A;  2KAJ A;  2PTL A;  4HKQ A;  4KIK B;  1XEE A;  1V1P B;  2M4N A;  3ZLZ A;  2FUH B;  1C4P A;  3FIL A;  3KWV A;  4WH4 A;  1EWY C;  1XT9 B;  3GE8 C;  2MBE A;  4ZYS A;  2JQR B;  4WWM A;  4K1R B;  4M00 A;  3AE6 B;  2BYT A;  2KFK B;  4YSZ B;  4IWP A;  1ISN A;  2R2Q A;  3URY A;  2BB6 A;  1RAX A;  3VR9 B;  4IW0 A;  2NPT B;  1LM8 B;  2D3A A;  4FN2 A;  2BS2 B;  4DXA B;  2LD9 A;  2KDE B;  1H8C A;  4FJY A;  5HKH A;  4HCP B;  2MBB B;  3BIN A;  2RD0 A;  4DWF A;  2CJO A;  4N59 A;  4LJP B;  2J0J A;  4PYZ A;  5J2R A;  4QAY A;  2YEP B;  1VDV A;  1FNW A;  2Y5P A;  2MSE D;  2KFK A;  1KRH A;  3SFE B;  1FCL A;  3AXC A;  3RNF C;  1GPX A;  3VQI A;  2KTR A;  4KSL C;  4W9L A;  4KGR A;  1WRI A;  1S3S G;  3PS6 A;  4DQO C;  1WX7 A;  3SHQ A;  2WDR B;  3SR6 A;  1K51 A;  1JRP A;  2WXK A;  2BWF A;  3HUI A;  3ZKJ C;  3B2F A;  4PS3 A;  2JXX A;  1R7S A;  2SEB D;  1B9R A;  3ZVV A;  2LFI A;  2VZK B;  3LJ3 A;  4OZC A;  5CTR C;  3AED B;  1ACC A;  3APD A;  5TR5 A;  2NPT A;  1A70 A;  4W9J A;  2VRR B;  2DZI A;  3P42 A;  3OLM D;  1TKE A;  3A9K A;  2MBH A;  1JWU D;  1BML C;  5G2N A;  1HTQ A;  2GBM A;  1SJH D;  3VTU A;  1EUV B;  3Q14 C;  1LGR A;  2GRI A;  3TIX A;  1OQQ A;  4F1S A;  5BMH A;  3A9K B;  2L00 B;  3Q3F A;  5L83 A;  1UWM A;  1L4Z B;  2ZCC A;  4EFO A;  3PZ8 A;  2FE8 A;  1OQY A;  3ZNI D;  3NS1 A;  1UF0 A;  3I63 C;  1C76 A;  3AV8 A;  3ENE A;  4NY0 A;  3AE8 B;  3GZN I;  5LNK 1;  4XX5 A;  2Z0D B;  1WXM A;  1V1O A;  2G4S A;  1SE3 A;  2JYT A;  4JWU C;  2V0G A;  1UGJ A;  4AWJ A;  2C7N B;  3W9C B;  1T5X D;  3TUO A;  2LXA A;  2FCQ A;  2JT4 B;  4W9H A;  3APC A;  1QT9 A;  4K7W A;  1I4Q A;  2WXO A;  4WQO B;  2EMT A;  3AM9 A;  4A9A A;  1A5R A;  1WM2 A;  1WXQ A;  3QK0 A;  2RMM A;  4NQL B;  1Q5W B;  2KWV B;  4F8C B;  4P1B C;  1L2N A;  1D6E C;  2HDE A;  4LJO B;  4IKG A;  2JRI B;  1VLB A;  4NJ6 A;  4PK1 A;  2Y5B B;  2W55 A;  5EE3 A;  3KUC B;  3N3K B;  4LCD E;  5DPR A;  4LLG M;  3H6N A;  2C60 A;  2WS3 B;  4DK5 A;  4A20 A;  2KLG A;  3TL5 A;  4MGZ E;  2N9K A;  1WX8 A;  1E6E B;  1NEK B;  3AE3 B;  2WHI A;  1EO6 A;  4ZOH C;  2BS4 B;  3K9P B;  2DZJ A;  4FBJ B;  3M62 B;  3R8B A;  2K6D B;  1C4C A;  2RDG A;  1Y8R C;  3GOE A;  2W3R A;  3QCA A;  2ZW0 A;  2KD0 A;  1NVI D;  4EKU A;  2IO1 B;  1L0Y B;  1MPE A;  3PHX B;  4GXB A;  2WP9 B;  3DPD A;  1V2Y A;  1RLF A;  2L8J A;  2V3P A;  2LRW A;  2KOX A;  3H8H A;  1SJE D;  4URK A;  2REX A;  1FNU A;  1WSP A;  2LAS A;  5D2M B;  3KUD B;  2PE6 B;  1WXA A;  4KV2 A;  3ZNZ B;  2KJ6 A;  1K53 A;  4USA A;  3W5U B;  2BPS A;  2HJ1 A;  4IOI E;  5D3I B;  2K6Q A;  3ALB A;  3CST A;  1RFK A;  3QC8 B;  1V49 A;  3PTF C;  2ZEQ A;  2NBU A;  5HHD G;  3PSE B;  3H1U A;  3VH3 B;  2PE9 A;  2K8H A;  4ICU A;  1YJ1 A;  1QIL A;  4FHK A;  4ZRK A;  1IBX A;  4EEW A;  4BKS D;  2ZNV B;  4IC7 B;  4RMA A;  2IZV B;  2QCZ A;  4A6Q A;  2ZNV C;  5IN7 A;  1DYQ A;  2HE7 A;  1LXD A;  4BFR A;  2DZK A;  3P1M A;  4M01 A;  3DHG C;  4BKT A;  2LGD A;  4EE2 A;  4RM9 A;  5MPO A;  1TS5 A;  2KDI A;  1EF5 A;  2J0M A;  3KVF B;  1ZP0 B;  3P4Q B;  1FPY A;  4LK0 M;  3C0R B;  1PDX A;  1FCC C;  4WJP A;  2UYZ B;  3ZJU A;  3DBH B;  3RCZ A;  3UQB A;  3NRZ A;  2FNJ B;  4HLE A;  2J4X A;  1NDD A;  2WXQ A;  1WZ3 A;  4BKS A;  3I3T B;  1E7V A;  4KKI A;  4AJY B;  2WXI A;  3BVG A;  4NZL B;  3ECI A;  2WNM A;  3R66 C;  2DNF A;  2LUE A;  2W82 A;  1HXY D;  3X23 A;  4BKG A;  2CJN A;  3EGR A;  1K8R B;  2CS4 A;  4BVU C;  2Z0E B;  2UU7 A;  4Q2J A;  4K7S A;  2MJE A;  4GB9 A;  3GB1 A;  2WX1 A;  5H92 C;  4XZ4 A;  3ML9 A;  3AN1 A;  1PYW D;  1ZUD 2;  4A55 A;  5D7G A;  3UIO B;  4P16 A;  1J8C A;  3GP7 A;  2JVC A;  4LDT D;  5DPS A;  2CR5 A;  3T3O A;  1L4D B;  1YNT E;  3DVG X;  3TEX A;  3DDC B;  3I5J C;  1V5O A;  3KYC D;  1XXG A;  2RPQ A;  1IGD A;  2G9H D;  1JCK B;  1WR1 A;  1V9J A;  4OHJ A;  5T8I A;  3U8Z A;  2M0X A;  5HI1 A;  3ZIM A;  1UNS A;  4B0E A;  2JX5 A;  1EM7 A;  2WDV B;  2BF8 B;  3SEB A;  1AAR A;  2ON8 A;  4BBN C;  2K8B A;  4KDI C;  4HCN B;  5AUI A;  3Q2A C;  5GMV A;  1DOI A;  4ITK A;  2WYQ A;  5LXH A;  2DEN B;  2D11 A;  3B08 A;  1UBQ A;  2AQ3 B;  3TCA A;  4KX6 B;  2KX3 A;  4N9F 4;  5IA7 A;  1FXI A;  2DLB A;  2V3N A;  2XNA C;  3KUZ A;  1ZPS A;  2D10 A;  1JRU A;  3ZTD A;  2O6V D;  3MC8 A;  5CHF A;  3W5V B;  5H8Y E;  3CSF A;  1HTO A;  4MDK E;  1WX9 A;  4W9G A;  1ENF A;  1YJI A;  3ZYY X;  1OEY J;  5C23 A;  1YN3 A;  4LNO A;  1GOZ A;  3A9J A;  4I6P A;  1SE4 A;  3AEE B;  3PVL A;  5BYS A;  3I9V 1;  1MJD A;  2NR2 A;  1YJJ A;  1WXV A;  3UI3 A;  2TSS A;  2XK5 A;  4NAW A;  5L95 C;  1GUA B;  4GOC A;  2N4F A;  4HJK A;  1WGY A;  1WE7 A;  3T9L A;  4HPL B;  1C78 A;  3L13 A;  1TS3 A;  3GS2 A;  2K22 A;  1ZGU B;  3R7R A;  1FM0 D;  2BTE A;  4RGO S;  1E10 A;  2GBR A;  2JY6 A;  2KWC A;  2V9H A;  2IGG A;  5DCN A;  3UQA A;  4DBG A;  4WUR A;  2BS3 B;  3PV1 A;  1D5Z C;  3VH4 B;  4ACF A;  1WGG A;  1E9M A;  4FXC A;  2O2V A;  4IG7 B;  3L54 A;  3U30 A;  4AUQ C;  1TIF A;  4RGT A;  3H7S A;  1NYQ A;  2AWT A;  4YSY B;  2WXG A;  4HRO A;  5JZE B;  3RPF C;  3DBS A;  2O2V B;  1J19 A;  4HDO A;  2M1M A;  2L76 A;  1N62 A;  2IO3 B;  1QLB B;  2D07 B;  4MT5 A;  2Y5C A;  1KF6 B;  1TT5 B;  1QOB A;  2FCM A;  3R2T A;  2EMS A;  3W1S A;  3AEA B;  1E8Y A;  3MC9 A;  1OTR B;  1ZXH A;  2N7D A;  4YTP B;  1BT0 A;  2IY1 B;  5IKC M;  4WWP A;  1ROE A;  2B76 B;  4ZDV A;  2L7R A;  2ZZP B;  3V61 A;  2JXT A;  2KMM A;  2HJ8 A;  2QSD A;  1I42 A;  3KW5 B;  1C9F A;  3QAQ A;  2GBJ A;  3C8Y A;  1L5P A;  2OHF A;  3IG3 A;  5CX3 A;  2MEK A;  4GDL A;  1ZE3 D;  2X8X X;  1ESF A;  4G50 A;  1RWS A;  1XLQ A;  2D3B A;  2ZVO A;  4YT0 B;  2WXN A;  3RNB C;  4XDC A;  3ZGZ A;  2WGS A;  4LNN A;  5KHO A;  1F2R I;  1SE9 A;  1XQQ A;  5JH5 C;  2WQY B;  1UEL A;  3ZDM C;  1LO5 D;  3TJP A;  5C1Z A;  1HEZ E;  1YD8 U;  5FK9 C;  2KXJ A;  3ZRF A;  5LXI B;  4XWT A;  4A90 A;  2INC C;  1I4P A;  4US8 A;  4OVU A;  2GBK A;  2K0P A;  1R4N I;  4GDK A;  4IWQ A;  4F7Z A;  2E3T A;  4ANX A;  3L4P A;  3LYY A;  2YEP F;  1C3T A;  3DBR B;  2WLB A;  4LDT B;  3EHV A;  4PYU A;  2JRH A;  1YQ3 B;  5D3D A;  2LI5 A;  2WDQ B;  3AEC B;  5E6P A;  3H7P B;  3V05 A;  1JW9 D;  3BYY B;  2KKC A;  1R4N B;  2AQ1 B;  2CHW A;  3M3J A;  3KYD D;  3MFG A;  3B2G A;  3NVW A;  2L32 A;  2GMI C;  2OED A;  2LWP A;  1VRA B;  1WGH A;  5IO9 A;  4YTM B;  2NVU I;  2JZ3 B;  3W1Y A;  3RNE C;  1QOF A;  2K3U A;  1WM3 A;  3QWZ B;  3RUL A;  1TS4 A;  1HZ6 A;  3CMM B;  3U7Z A;  4MGY E;  1WGK A;  1WE6 A;  4DHJ D;  4G3X B;  2LEK A;  2V1Y A;  3NS8 A;  1ZW7 A;  2BT6 A;  4W9K A;  3Q3O C;  4MAC A;  1OFF A;  4PS8 A;  2WXL A;  3JW0 X;  4I6L B;  1ZKH A;  5JXV A;  3PO0 A;  4WJO A;  2G4D B;  3ABV B;  1DOX A;  3WAN A;  1H4R A;  3EUB 2;  2KT7 A;  2J42 A;  3IT6 B;  4YWG G;  4BBN F;  2PPH A;  1I4H A;  3H7P A;  1XLO A;  4MM3 A;  2N7J A;  2KDB A;  3BVM A;  3L10 B;  1SE2 A;  3W2D A;  4KDL B;  3T3N A;  3ZNH B;  2AEH A;  1J7A A;  5C2T B;  3P2B A;  3NVZ A;  2DYO A;  2QC8 A;  3TEZ A;  2C7M B;  4A3P A;  3V62 A;  4ASW C;  3BII D;  3ZXR A;  4RNA A;  2BWE S;  4WJN A;  4WIP A; 
#chains in the Genus database with same CATH homology
 4MJS B;  3ZRC A;  5JHB A;  3EFU A;  5CHV C;  3RCZ A;  3UQB A;  2ZPY A;  2IO0 B;  4BOS C;  1KM7 A;  3UIP B;  2FNJ B;  4HLE A;  1NDD A;  2N9P C;  1WZ3 A;  4BKS A;  4GIV A;  1GG3 A;  3W1S C;  1UZX B;  3KH0 A;  1Z2M A;  3I3T B;  1V86 A;  4IM0 A;  1E7V A;  2BKR B;  2L0F A;  3VUX A;  2MRP A;  2KC1 A;  4AJY B;  1LQB A;  2NBV B;  2BKF A;  3TBL D;  3ZO5 B;  2LRU A;  1KJT A;  2KLC A;  4JGH B;  3ECI A;  3R66 C;  2KVR A;  3IVF A;  1WJU A;  1RRB A;  1FXT B;  4IWO A;  1WXS A;  2JUO A;  2LUE A;  1P3Q U;  3X23 A;  4BKG A;  3CF6 E;  3RZW C;  3QJZ A;  1F9J A;  1K8R B;  2CS4 A;  4IM3 A;  4BVU C;  3PRZ A;  3PHW B;  2Z0E B;  2ZCB A;  4ICV A;  4GMV A;  4MSQ B;  2D2Q A;  2N7E A;  5D94 A;  1I35 A;  2CHX A;  3DVG Y;  4K7S A;  4NJ7 A;  1E90 A;  2KDF B;  2NBW B;  4GB9 A;  2DAF A;  1YX5 B;  2RR9 A;  2WX1 A;  1WMH B;  4FLH A;  4XZ4 A;  4CO7 A;  2KJR A;  3ML9 A;  1WZ0 A;  1IPG A;  3QQ8 B;  1GJZ A;  1GC6 A;  2MCN B;  2N1V A;  2JF5 A;  2BYV E;  1SGH A;  4XC2 A;  4EZL A;  2M8S A;  1QZE A;  2C9W B;  4JLC A;  4RM8 A;  5J17 A;  5D7G A;  1IP9 A;  3UIO B;  4TUU A;  1J8C A;  4FJZ A;  1VCB A;  3QX1 A;  2XK5 B;  2JVC A;  4LDT D;  2C7H A;  3VVW B;  2RGF A;  5DPS A;  5J18 A;  3JSV A;  4W9D A;  3IBE A;  2CR5 A;  2LJ5 A;  1WJN A;  3VUW A;  4EUT A;  3DVG X;  3DDC B;  1V5O A;  4WWO A;  3DBR I;  3WAO A;  1OGW A;  5AEK B;  2K39 A;  3KYC D;  2RPQ A;  4FHJ A;  2KK8 A;  3ZW3 A;  1WYW B;  5JHA A;  3PRP B;  4IM2 A;  3UIN B;  4MJS A;  1WR1 A;  1V9J A;  4AJW A;  3U8Z A;  2M0X A;  3ZIM A;  4GN1 A;  2MP2 A;  2FCS A;  3BY4 B;  4GGQ A;  3QA8 A;  4FUL A;  2MX2 A;  1Z5S B;  1NBF C;  3M95 A;  2MBQ A;  2BF8 B;  1AAR A;  2ASQ A;  4BBN C;  2K8B A;  4KDI C;  4A3O A;  1E8W A;  4MGK E;  4HCN B;  3V6E B;  5GMV A;  2JWZ A;  2ZJD A;  3H9D A;  4GDL B;  5LXH A;  3MHS D;  2WYQ A;  1MG8 A;  4CHK A;  2DEN B;  1WGR A;  3L08 A;  4KIK B;  2D11 A;  3B08 A;  1UBQ A;  1WGD A;  2M4N A;  3ZLZ A;  1WR6 E;  3TCA A;  2KX3 A;  3EEC A;  4W9E A;  4II2 B;  2NS5 A;  3OJ4 B;  2FUH B;  4N9F 4;  2FIF A;  2LVO A;  1C1Y B;  2IO2 B;  1KOT A;  1XD3 B;  5IA7 A;  3ZUN A;  3KUZ A;  2D10 A;  1JRU A;  1XT9 B;  3ZTD A;  2O6V D;  3S2A A;  2MBE A;  5CHF A;  1L7Y A;  3NHE B;  4K1R B;  3CSF A;  3RYT A;  5AZF A;  4MDK E;  2AL6 A;  1WX9 A;  4W9G A;  4YL8 A;  2KFK B;  1UD7 A;  3IFW B;  4IWP A;  1ISN A;  1P98 A;  2R2Q A;  4ZRJ A;  1E7U A;  1OEY J;  2DHZ A;  5C23 A;  3VTV A;  1RAX A;  4OVV A;  4IW0 A;  3A9J A;  4I6P A;  2NPT B;  2A5U A;  3RD2 A;  3VHT C;  3A1Q B;  1Q1O A;  4ZYN A;  3PVL A;  1LM8 B;  1E8X A;  4FN2 A;  3PRM B;  2NR2 A;  4DHZ B;  1WXV A;  4DXA B;  2LD9 A;  2KC2 A;  2KDE B;  2XK5 A;  4EZK A;  4NAW A;  1H8C A;  3DQV A;  4W9I A;  4FJY A;  3HK0 A;  4W9C A;  3QAR A;  5HKH A;  3L16 A;  4MH0 E;  4HCP B;  4MGI E;  1GUA B;  4WWN A;  5DPT A;  5L95 C;  1J0G A;  4GOC A;  4JQW C;  3MJW A;  1WI0 A;  2CKH B;  2MBB B;  2N4F A;  3BIN A;  1WGY A;  2RD0 A;  4HJK A;  4DWF A;  4EOY A;  4LJP B;  3DOW A;  2J0J A;  1WE7 A;  2DAJ A;  4P7I A;  1D3Z A;  3T9L A;  4HPL B;  3NOB A;  3R3M A;  4PYZ A;  3SDL C;  4TQ0 A;  1WMH A;  2LZ6 A;  5J2R A;  4GDK B;  3NY5 A;  4B95 A;  2DYB A;  2ZVN A;  5LLI A;  3L13 A;  2MSE D;  1KLV A;  2KFK A;  3A33 B;  3AXC A;  1ZGU B;  3HM3 A;  3R7R A;  3VQI A;  2KTR A;  4GU2 A;  2GBR A;  3N32 A;  1M94 A;  1S1Q B;  4KSL C;  4M8M A;  2JY6 A;  2KWC A;  4W9L A;  2PJH A;  1LFD A;  5DCN A;  2XBB C;  2HD5 B;  2KX0 A;  3DBL I;  3UQA A;  4GSW A;  5IAA C;  2MA9 B;  4HDQ A;  1S3S G;  4DBG A;  4G0N B;  1WF9 A;  4CYE A;  2LGY A;  5D6J B;  4DHJ B;  3PS6 A;  3RZF A;  3PV1 A;  4DDI D;  3OAW A;  1GC7 A;  4I6N B;  1NI2 A;  4ANU A;  3VH4 B;  5G55 A;  1WGG A;  4WAA A;  3WAL A;  1WX7 A;  2O2V A;  4TV3 A;  3PLU A;  4IG7 B;  3L54 A;  3U7D A;  3SHQ A;  3PGE A;  1WIA A;  3APF A;  3U30 A;  2J7Q B;  4HVB A;  3UF8 A;  4AUQ C;  3B1L X;  2KN5 A;  2BGF A;  1PQS A;  3H7S A;  4ANW A;  3V6C B;  2BWF A;  2CHZ A;  1RFA A;  3ZKJ C;  4E74 A;  2AWT A;  3M63 B;  4PS3 A;  2JXX A;  4MEL A;  1WJ4 A;  3AUL A;  3PZD A;  4JL9 A;  4K81 A;  1P0R A;  4WJQ A;  3DBS A;  5JZE B;  1U4A A;  2O2V B;  1J19 A;  4HDO A;  1IYF A;  2M1M A;  1E8Z A;  3ZNG C;  3ZVV A;  3LJ3 A;  2L76 A;  2N9E B;  2XEW A;  1VD2 A;  5CTR C;  3APD A;  5TR5 A;  3QHT A;  1X1M A;  2MW5 A;  2IO3 B;  2D07 B;  1YQB A;  4KVG B;  2NPT A;  1G6J A;  3A1Q A;  3SU8 X;  3TMP B;  4W9J A;  4G11 A;  4HWI B;  2FCM A;  2DZI A;  2VRR B;  1V81 A;  2KNB A;  2OOB B;  3Q3J A;  2LGX A;  3OLM D;  3A9K A;  3A4S C;  3QIJ A;  1UBI A;  2KTR B;  3PLV A;  4EZJ A;  2MBH A;  2EMS A;  3W1S A;  5G2N A;  1E8Y A;  2GBM A;  1OTR B;  2N7D A;  3VTU A;  1BT0 A;  1EUV B;  2IY1 B;  2DYM A;  3PPA A;  4II3 B;  2MBO A;  4B9K A;  4WWP A;  3TIX A;  1OEY A;  2KTF A;  3PT2 B;  4F1S A;  5BO4 B;  4ZDV A;  2L7R A;  2L05 A;  3A9K B;  2L00 B;  2RSU A;  2ZZP B;  3Q3F A;  2Z59 B;  4DDG D;  5L83 A;  2ZCC A;  4EFO A;  2BYE A;  3V61 A;  4FA6 A;  3HHM A;  2HJ8 A;  1I42 A;  2FAZ A;  3ONS A;  4HPM B;  1OQY A;  3ZDT A;  3KW5 B;  3ZNI D;  2L3Z A;  1UH6 A;  3ENE A;  2GBJ A;  3QAQ A;  4NY0 A;  3GZN I;  4HXD A;  2BYF A;  2MP2 B;  4XX5 A;  2V3S A;  2Z0D B;  3NZU A;  1WXM A;  3IG3 A;  5CX3 A;  3WAP A;  2G4S A;  3RT3 B;  1UGM A;  2KO3 A;  2C5L C;  4GDL A;  4AWJ A;  2C7N B;  2I1K A;  4FJV B;  4KZC A;  2AYO B;  2KFJ A;  4G50 A;  2LXA A;  3HM6 X;  2FCQ A;  2JT4 B;  2JZZ A;  2ZVO A;  1P9D U;  3APC A;  4W9H A;  4K7W A;  3ML8 A;  2IBI B;  3A4R A;  5KHO A;  1SE9 A;  1XQQ A;  4WQO B;  3V60 A;  5JH5 C;  2EMT A;  1SIF A;  3IHP C;  2KZR A;  1UEL A;  1P1A A;  3L0W B;  4M8N A;  1Q0W B;  1A5R A;  1WM2 A;  3ZDM C;  1V80 A;  4J6I A;  3AU4 A;  2K1F A;  3LDZ E;  3TJP A;  5KHQ A;  5C1Z A;  3QK0 A;  1YD8 U;  2KXJ A;  3ZRF A;  1CMX B;  4NQL B;  1Q5W B;  2KWV B;  5E6N A;  5LXI B;  2IY0 B;  4F8C B;  1L2N A;  3AI5 A;  2HTH A;  2KWU B;  2L0T A;  2N9X A;  4KSK C;  4MEM A;  2CU1 A;  2YLM A;  4LJO B;  3RUI B;  3ZTC A;  2JRI B;  4NJ6 A;  4DHZ E;  4OVU A;  3WA0 A;  2GBK A;  2Y5B B;  4F7Z A;  1R4N I;  4GDK A;  4IWQ A;  3KUC B;  3N3K B;  2W9N A;  1V6E A;  4LCD E;  4WJP A;  5DPR A;  4ANX A;  3DBH I;  2WWZ A;  3H6N A;  4IUM B;  1C3T A;  2C60 A;  1TZ1 A;  4LDT B;  2MWS B;  4DK5 A;  3EHV A;  4A20 A;  2GOW A;  2KJH B;  4PYU A;  2AL3 A;  5E6O A;  2JRH A;  2KLG A;  4KZ0 A;  3TL5 A;  4MGZ E;  2J0K A;  3PRE A;  2N1W A;  2G45 B;  2LI5 A;  2KHW B;  1WX8 A;  5E6P A;  1R4M I;  1EO6 A;  2NCN A;  3H7P B;  3K9P B;  2KKC A;  2DZJ A;  4W9F A;  4FBJ B;  3M62 B;  3DVN V;  1WH3 A;  2CHW A;  2K6D B;  3M3J A;  3KYD D;  4HK2 A;  4AOF A;  2K8C A;  2A4Z A;  2KAN A;  2LXC A;  4TKN A;  1Y8R C;  2B3A A;  3UGB B;  5EDS A;  3GOE A;  2ZPN A;  4M0W B;  4ZRI A;  2GMI C;  2V4L A;  3QCA A;  4TQ1 A;  3WAM A;  2LWP A;  4PS7 A;  1WGH A;  1T0Y A;  2NVU I;  2KD0 A;  2JZ3 B;  3W1Y A;  2KMC A;  3JYU A;  2R2O A;  4ANV A;  1WM3 A;  2IO1 B;  2LVP A;  3QWZ B;  4EKU A;  4BOZ B;  1WJ6 A;  3RUL A;  2WDT B;  1EF1 A;  2QHO A;  2MLB A;  3CMM B;  3PHX B;  4GXB A;  4MGY E;  1E5W A;  3DPD A;  3DVN U;  5AZH A;  1V2Y A;  2FID A;  4NPN A;  1RLF A;  4FAD A;  1WE6 A;  2KMA A;  4DHJ D;  4KIK A;  2D3G A;  2G3Q B;  4G3X B;  3VUY A;  2L8J A;  3VAW A;  2LRW A;  2KOX A;  2V1Y A;  3B0A A;  3NS8 A;  4URK A;  2REX A;  2MQJ A;  1ZW7 A;  3D32 A;  2LAS A;  1HE8 A;  5D2M B;  3KUD B;  2PE6 B;  3HIZ A;  4W9K A;  1WXA A;  4KV2 A;  3VFK A;  2KJ6 A;  3X0W A;  3ZNZ B;  2M17 A;  4AP4 C;  4PS8 A;  2BPS A;  3JW0 X;  4I6L B;  1ZKH A;  2O6V B;  4NNJ B;  4WJO A;  2K6Q A;  3ALB A;  3CST A;  2G4D B;  3QC8 B;  4MSM B;  4X57 B;  1V49 A;  3VTW A;  3NZS A;  2ZEQ A;  3PTF C;  5FR6 A;  4K7U A;  3MTN B;  3EC8 A;  3DCG A;  2NBU A;  3PSE B;  3WAN A;  3H1U A;  1WFY A;  5CHW A;  2DZM A;  1H4R A;  2KQ7 A;  3AU5 A;  1YX6 B;  2PE9 A;  4JIO U;  3VH3 B;  2K8H A;  2JPH A;  2YVC A;  3A9J B;  4ICU A;  4E3C A;  2KQS A;  1YJ1 A;  2O6V A;  3JVZ X;  3WIM A;  4FHK A;  4ZRK A;  2EKE C;  4EEW A;  4BKS D;  4BBN F;  2PPH A;  1WY8 A;  3O65 B;  2ZNV B;  4IC7 B;  1GNU A;  4RMA A;  1TBE A;  2IZV B;  3H7P A;  2LVQ A;  1TTN A;  2I1J A;  2PEA A;  3OJ3 A;  4MM3 A;  4NAW B;  3T8M A;  4E71 A;  2ZNV C;  2KDB A;  1TGZ B;  2HE7 A;  3N30 A;  1LXD A;  2WX0 A;  4B6W A;  2DZK A;  4BFR A;  2FCN A;  3VDZ A;  2K25 A;  2UWQ A;  3JSV B;  3L10 B;  2IYD B;  5DPW A;  2DX5 B;  4BKT A;  2LGD A;  3L17 A;  3R7Q A;  4KDL B;  2GBN A;  4NQK E;  3ZNH B;  2AEH A;  4RM9 A;  1WRD B;  3P2B A;  2KDI A;  3K9O B;  2DYO A;  1EF5 A;  2J0M A;  2OJR A;  3KVF B;  2C7M B;  1YIW A;  4A3P A;  3V62 A;  5AZG A;  4ASW C;  3C0R B;  3SD5 A;  1V5T A;  3VXW A;  2BWE S;  4WJN A;  2UYZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...