2CKHB

Senp1-sumo2 complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title The Structure of Senp1-Sumo-2 Complex Suggests a Structural Basis for Discrimination between Sumo Paralogues During Processing.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2ckhB00
2LI5A 3A1QA 3ZRCA 4IW0A 2DZJA 4G3XB 3ZNZB 4EEWA 1VCBA 3DBSA 2BKRB 5EDSA 2KOXA 3QQ8B 4EFOA 2V4LA 3PSEB 2LUEA 5E6PA 3DBHI 4N9F4 3ZKJC 1IP9A 2O2VB 5CHWA 2AL6A 3SU8X 1E8YA 3T9LA 2MLBA 3HHMA 3K9PB 2C60A 3PREA 4DDID 4FBJB 1GG3A 4DHJD 3H9DA 1UD7A 1WJ6A 4KIKB 1YX6B 2K8CA 4FJYA 2ZCCA 1SIFA 3DQVA 3ZUNA 5BO4B 1EUVB 2NR2A 3N30A 1XD3B 2KDBA 2KLGA 3W1SA 4FHJA 2XK5A 2LD9A 4B6WA 4BKSD 3P2BA 3ECIA 3H7SA 4BOZB 2KWUB 1A5RA 2K1FA 2N7EA 1KLVA 2K6DB 4E71A 3B08A 3UGBB 2IYDB 3APFA 1I35A 3AU4A 3JSVB 3BY4B 5G2NA 1H8CA 4BKSA 3AI5A 3L54A 4E3CA 4W9FA 5L83A 1R4NI 5J17A 3DCGA 2K6QA 1J0GA 3RCZA 2HTHA 4IUMB 1G6JA 2Z59B 3QCAA 4HXDA 3TIXA 3VTWA 2AWTA 2RPQA 4FLHA 3VH3B 2A4ZA 1FXTB 2EMTA 2LASA 4MJSA 2KJ6A 3APDA 3CSTA 1R4MI 2NS5A 1C3TA 3VVWB 4ANUA 3JYUA 2C7MB 1L7YA 1RAXA 4HLEA 2L0FA 3KW5B 2DYMA 1T0YA 4TQ0A 4MDKE 2HJ8A 1P0RA 2WX0A 2KDIA 2WYQA 2J7QB 1WGRA 4DHZE 1H4RA 2IY0B 4JL9A 1EF5A 1WXVA 4GGQA 3VAWA 4OVVA 3RYTA 3ALBA 2RSUA 2RD0A 3GZNI 2B3AA 2KLCA 1TGZB 2FCMA 2GMIC 2JPHA 2MRPA 2Z0DB 2ZZPB 4MSQB 1TBEA 1WX8A 2DZKA 4LDTB 5G55A 1WJUA 4TKNA 1WZ0A 2JF5A 2XK5B 4JGHB 1YX5B 1OQYA 3N3KB 2D07B 2PJHA 4HCNB 4A3OA 1UBQA 1RFAA 2IBIB 2FCQA 2WX1A 2KC1A 3H1UA 3L08A 4I6NB 4GDLA 2M0XA 5CHFA 2V1YA 3UF8A 3WAMA 4WJQA 1P3QU 3PRMB 3VUYA 2LWPA 1WR6E 2C7NB 3TL5A 1Q1OA 3SD5A 2N9PC 3ZNID 2A5UA 2MBBB 2MW5A 2N9EB 4ZRKA 3QX1A 2KX3A 3QHTA 4P7IA 5TR5A 2RR9A 4M0WB 4NY0A 4AUQC 5J18A 2KKCA 3DDCB 4LCDE 1J19A 2FNJB 3HM6X 4DDGD 4MJSB 3MJWA 4ZRJA 1UZXB 4IG7B 4HDOA 4HK2A 4ICUA 2FCSA 1V5TA 2BGFA 4BKTA 2VRRB 2NBVB 2JVCA 2L76A 3U8ZA 3DBLI 2CHXA 2KHWB 2NPTA 3W1YA 2L3ZA 3OJ4B 1E5WA 2XBBC 4IC7B 2KK8A 3M63B 1GC7A 4G0NB 4W9DA 3WIMA 4URKA 2CHWA 3C0RB 4HPMB 3B0AA 3KUZA 2J0JA 4EZLA 2D10A 3KUCB 2GBMA 3H7PB 2MBEA 3D32A 2BYVE 5KHOA 4XZ4A 2M1MA 3KH0A 2L0TA 4J6IA 2KDFB 5J2RA 3A9KB 1NDDA 4K7UA 1ZW7A 3TBLD 2DYOA 3PVLA 3HM3A 1HE8A 3WANA 4PYUA 3VFKA 2N7DA 1Z2MA 4EZJA 2MQJA 4GOCA 2OJRA 4KV2A 4ASWC 2KNBA 5AZHA 3VUWA 1QZEA 2K8HA 2K39A 4I6PA 3QA8A 3ZNGC 1Y8RC 2BKFA 3A9JA 4MEMA 4GSWA 2HD5B 3HIZA 4II2B 2AYOB 2GBRA 4MGZE 2L05A 4K7SA 2NPTB 3M95A 3L0WB 4IWPA 4TV3A 2DAFA 2LGXA 2YLMA 4LDTD 4ZRIA 4A3PA 3X0WA 3VQIA 1ZKHA 5AEKB 2G3QB 3UIPB 4MSMB 4GIVA 3RD2A 2ZCBA 4NJ6A 1GJZA 4F7ZA 2JWZA 1WY8A 2BF8B 3DBRI 4CYEA 4WJPA 5CX3A 3MTNB 2C9WB 3APCA 3IG3A 2M4NA 2PE9A 3WAPA 2CKHB 1WI0A 3AXCA 3QIJA 1XT9B 3L13A 2LGDA 3VTVA 3PLUA 4RM8A 3IHPC 4MELA 1WE6A 2MSED 3LDZE 2LRWA 2ZNVC 1GNUA 1YJ1A 1L2NA 2M17A 4CHKA 4YL8A 1Q0WB 1WGYA 1WX9A 4RM9A 2FIDA 3ZTDA 3PGEA 4BBNF 2KVRA 5DPWA 2D2QA 4WWPA 1LQBA 2KTFA 3KYCD 2IO0B 3IVFA 3A9JB 1UGMA 1E7UA 3ZO5B 2V3SA 2ZPYA 3QJZA 1JRUA 3OJ3A 4B95A 2MBHA 4JQWC 1SE9A 4FN2A 3QC8B 2MP2A 1ISNA 1EF1A 2R2OA 2NVUI 3ZIMA 3ONSA 2M8SA 2ZNVB 4W9CA 3L10B 4BVUC 5LXHA 1WFYA 3UINB 4TUUA 3VXWA 4BOSC 3H7PA 4NQKE 1LXDA 5D6JB 1UELA 3JVZX 1WIAA 2CS4A 2BPSA 4WWNA 4PS7A 1SGHA 3A9KA 4ANWA 1E90A 2IO1B 2PEAA 3QK0A 4FULA 2O6VB 4M8MA 4WQOB 3IFWB 3PRZA 1WJ4A 2AL3A 3I3TB 2IO3B 2Z0EB 3VUXA 4AJWA 2YVCA 2JXXA 5IA7A 5L95C 2LVPA 2N4FA 4GU2A 3DVNV 1C1YB 4W9IA 2MA9B 5LLIA 2JRHA 4HWIB 3M3JA 3PRPB 5DPTA 5AZGA 3TCAA 4IM2A 4EZKA 4EUTA 4NJ7A 1D3ZA 1RRBA 1X1MA 2EMSA 3PS6A 2PPHA 3ZDTA 3L16A 2KMCA 1WMHA 4FADA 1V80A 3ZVVA 2MP2B 3A4SC 4NAWB 3ZLZA 2ZVOA 3O65B 1V9JA 3N32A 4FA6A 2G4SA 1UH6A 4E74A 1WX7A 3PLVA 4I6LB 1E7VA 1YQBA 3DPDA 1RLFA 1AARA 3X23A 3T8MA 3NZSA 1EO6A 1U4AA 2REXA 4JIOU 5AZFA 1TTNA 5C1ZA 1PQSA 2MCNB 1V86A 3A33B 1WR1A 4DHZB 4EOYA 1V81A 4F8CB 1WH3A 2AEHA 4GN1A 4XC2A 3V61A 2K25A 3ZNHB 1E8ZA 5IAAC 2KWCA 2N9XA 3R66C 4TQ1A 4DK5A 3NOBA 2L00B 1E8WA 2KTRB 4EKUA 4K1RB 3DVGY 3OLMD 3EFUA 4W9LA 2GBJA 3QARA 3TJPA 2L7RA 2ZJDA 2L8JA 4WJNA 1KM7A 4CO7A 3K9OB 3BINA 3NS8A 2UYZB 3ENEA 2NCNA 2LXAA 1IYFA 2DZMA 2HE7A 2WWZA 3U7DA 2KN5A 4HDQA 2KC2A 3PHXB 3V60A 2NBUA 1WF9A 2ZPNA 4PYZA 1K8RB 4ZDVA 5JH5C 1WZ3A 2G4DB 1WMHB 4M8NA 1YD8U 3L17A 2KJHB 4KVGB 2KJRA 4BFRA 3LJ3A 4WAAA 3RT3B 2MWSB 3U30A 2CHZA 3Q3FA 1S3SG 2DAJA 4W9KA 2LJ5A 3GOEA 2DHZA 2O6VD 1WXMA 2WDTB 2KO3A 4W9HA 2LVQA 1V2YA 2CR5A 2JY6A 1Z5SB 2XEWA 2JUOA 4AOFA 2DENB 5D7GA 5CHVC 4ICVA 4KZCA 1V5OA 4PS8A 1BT0A 2MBQA 2LGYA 3R3MA 3ZDMC 2O6VA 3UQBA 4W9JA 5C23A 3KUDB 4FHKA 4MM3A 4MH0E 4A20A 2W9NA 3RZWC 2JRIB 1GUAB 1WM3A 3ZTCA 1ZGUB 2CU1A 3ZRFA 1P98A 3IBEA 2ZEQA 4W9GA 3R7QA 2FAZA 1WGDA 3EECA 2OOBB 4G11A 4IM3A 1GC6A 3Q3JA 4PS3A 3PHWB 4KSLC 1OEYJ 4OVUA 3AU5A 4IM0A 2D11A 5DPRA 4ANXA 3PPAA 4DBGA 3NY5A 3PTFC 4K7WA 3ZW3A 1NBFC 2BYEA 3KYDD 2KANA 3V62A 2KFKB 4NAWA 2ASQA 3EHVA 2D3GA 4LJPB 3WAOA 2JZ3B 1OEYA 3EC8A 2UWQA 3W1SC 4IWQA 4HJKA 3A1QB 3ML9A 3RZFA 4HVBA 2C7HA 2MBOA 5CTRC 2MX2A 3SDLC 1P9DU 4GDKA 3RUIB 3PZDA 1WGHA 3JW0X 3CSFA 2KZRA 1NI2A 2JT4B 3M62B 1V49A 4KSKC 4RMAA 4ANVA 1YIWA 3B1LX 1E8XA 1V6EA 4HCPB 1WE7A 2C5LC 1LM8B 2IO2B 5JZEB 2KTRA 3V6EB 2J0MA 4KDLB 2KD0A 1KOTA 2N1VA 5KHQA 3R7RA 4IWOA 2KQ7A 1WGGA 4WJOA 4DHJB 2FIFA 4ZYNA 4GXBA 2LVOA 1LFDA 2KDEB 3A4RA 2KXJA 5D2MB 2KMAA 4NNJB 2ZVNA 1VD2A 3AULA 3QWZB 4FJVB 2I1JA 3RULA 4G50A 1KJTA 3DVNU 3WA0A 1CMXB 2BYFA 3UIOB 5E6OA 3VDZA 2FUHB 3OAWA 4GMVA 3HK0A 2NBWB 1J8CA 4X57B 1WJNA 2QHOA 1WYWB 3WALA 2GOWA 2PE6B 2EKEC 4II3B 3V6CB 4LJOB 4DXAB 1WXSA 2KQSA 2LXCA 2Y5BB 4GDKB 2FCNA 3SHQA 2LZ6A 4AJYB 4XX5A 2J0KA 3CF6E 5DPSA 5JHAA 4B9KA 5HKHA 2O2VA 1IPGA 2R2QA 4DWFA 3VTUA 4BBNC 4GB9A 3UQAA 2KFJA 3KVFB 1XQQA 2K8BA 2N1WA 4KIKA 3CMMB 4MGKE 2G45B 5DCNA 1WM2A 1TZ1A 3S2AA 4F1SA 1UBIA 3DOWA 4FJZA 1I42A 5LXIB 4W9EA 4BKGA 2IY1B 4AP4C 3VH4B 2DYBA 3NHEB 3VHTC 5E6NA 4KZ0A 2KX0A 4MGYE 1P1AA 3MHSD 4HPLB 3DVGX 2JZZA 3ML8A 4K81A 4GDLB 4AWJA 4MGIE 4NQLB 1Q5WB 4KDIC 5D94A 2BWES 5JHBA 1MG8A 3JSVA 2DZIA 4NPNA 3H6NA 1S1QB 4JLCA 1OTRB 1WXAA 2KWVB 2LRUA 4WWOA 5FR6A 1OGWA 3PT2B 2IZVB 1F9JA 2I1KA 1M94A 2KFKA 3NZUA 2DX5B 1WRDB 3PV1A 3TMPB 2GBNA 5GMVA 2RGFA 2GBKA 2BWFA 3QAQA
chains in the Genus database with same CATH superfamily
1NYQA 2BW2A 3ZNZB 4EEWA 3QQ8B 2V4LA 1IBXB 2VH1A 1JALA 4DDID 2MLBA 1HA5A 1GG3A 1YX6B 4FJYA 1AYFA 3DQVA 4LNNA 1SF0A 2KLGA 3N30A 2XK5A 3L4PA 3ECIA 3ZYYX 2PW9A 3AEDB 1A5RA 2K6DB 3B08A 1I35A 3APFA 3AU4A 3BY4B 5G2NA 1H8CA 3LB8C 5J17A 3AEAB 2AQ2B 1L5PA 4ZHOA 2BVCA 2JWUA 4IUMB 4QAYA 2FE8A 2I2YA 1ACCA 1FXTB 4MJSA 3CSTA 1FCCC 1OFFA 3VVWB 3N9YC 1TJEA 3PZ7A 2HJ8A 2J7QB 4JPSA 3B2FA 1F77A 1STEA 5EE3A 4OVVA 3RFZB 2RSUA 1TT5B 2GMIC 2JPHA 2ZZPB 5BMHA 2NTSA 1WX8A 4LDTB 2KDMA 2IJ0A 1KRHA 1TS2A 2E6XA 1RFAA 2WX1A 2KC1A 4GDLA 3UF8A 3WAMA 4A9AA 1P3QU 3VUYA 2LWPA 1D5ZC 2A5UA 2MBBB 1I4PA 3QHTA 5TR5A 4NY0A 2VH2A 1SJED 1C79A 1BXTA 4DDGD 4GLSC 1HEZE 2KWDA 4ZRJA 4HK2A 3Q8BA 5HHDG 2VRRB 2JVCA 2L76A 3DBLI 3W1YA 2L3ZA 4A6QA 1GC7A 3WIMA 1IUEA 2D10A 3VR8B 1FO4A 2GBMA 2MBEA 3TUOA 1P7FA 2M1MA 3KH0A 1CJEA 4WWMA 2L0TA 5J2RA 3A9KB 2RMMA 1NDDA 4K7UA 3TBLD 2DYOA 1FIQA 4P1CC 3VFKA 2N7DA 4ASWC 2KNBA 1QZEA 2K8HA 2K39A 1SIJA 4MEMA 1JWUD 3HIZA 2GBRA 1GB1A 4IWPA 3Q2AC 1CK1A 1LGRA 4MSMB 4LTUA 4HEA1 2NMQA 2EELA 1WY8A 5CX3A 2PVGC 3ZJVA 3WAPA 3N1XC 1WGKA 1L6VA 2D5GA 3L13A 4MELA 1XXGA 2ICIA 2LRWA 5IN7A 4M0WA 3HRDD 2M17A 4YL8A 1V97A 4RM9A 2FIDA 3ZTDA 1TZOA 2BTEA 4WWPA 2BYTA 1QQRA 2IDYA 4XDDA 3NUHB 3A9JB 1E7UA 2X38A 2N7JA 3OJ3A 2MBHA 4FN2A 3QC8B 4O1NA 2MP2A 1ISNA 1EF1A 4BVUC 5LXHA 1FMAD 3GB1A 4TUUA 3VXWA 3H7PA 3BYYB 5D6JB 1UELA 1K50A 2JU6X 2BPSA 4WWNA 4ANWA 1E90A 3QK0A 2PEAA 1RM6C 1RYJA 2O6VB 1B9RA 2Z0EB 2W3SA 2YVCA 2L83A 2FUG1 2LVPA 4GU2A 1C1YB 2LGIA 4IM2A 2QEJC 4OHJA 4OZAA 3AV8A 2XN9C 1P7EA 1QOAA 2KMCA 1WMHA 3DWGC 4OW0A 3H8HA 3A4SC 1HQRD 3ZLZA 1UWXA 4TMAB 3DHHC 1F2RI 3DPDA 1RLFA 3NS1A 3X23A 1XLQA 3T8MA 4ACFA 4JIOU 4S0RA 1WR1A 4DHZB 3AH7A 3RNGC 2AEHA 3AE6B 2KWCA 3R66C 4TQ1A 2L00B 4EKUA 3DVGY 4W9LA 5BYQA 2GBJA 1ZPSA 5D3DA 3TJPA 2L8JA 3KWLA 4WJNA 3NS8A 2UYZB 5TSSA 1IYFA 2DZMA 2HE7A 3MC9A 1XCQL 2KC2A 1FEHA 4N59A 3CIRB 4ZDVA 5JH5C 4BFRA 1SJHD 4WAAA 1VLBA 2CHZA 5IO9A 2Y5PA 1SE3A 1PDXA 2KO3A 4W9HA 1QT9A 1MVKA 2CR5A 2JY6A 1QILA 2JUOA 4UDUC 2QDFA 4KZCA 1V5OA 1BT0A 2MBQA 3KUDB 3U52E 1MPEA 2WU2B 2YEPB 3U7ZA 1WM3A 3ZTCA 1ZGUB 2SEBD 1P98A 3IBEA 2FAZA 2SAKA 1WGDA 3EECA 1OQQA 5AUKA 1R4NB 4JWUC 4XDCA 2BYEA 1SE2A 1R4MB 2CU3A 4LJPB 2UWQA 4WH4A 3ML9A 2MBOA 5CTRC 2ZW1A 1P9DU 1J7AA 1QLBB 1WGHA 3I57A 3M62B 4MM3B 1E8XA 1LM8B 4MACA 5GXGB 4KDLB 5EE9A 1C4CA 1VZ6A 3R7RA 1FFVA 1WGGA 3AE1B 4WJOA 2FIFA 4ZYNA 5H8YE 4LNIA 3AULA 3QWZB 4FJVB 1TKEA 3WA0A 3DVNU 1N5WA 2WXGA 3OAWA 2NBWB 1ROEA 2QC8A 1WJNA 2QHOA 3WALA 4LLGM 2ZW0A 4II3B 3MHZA 1MHHE 2Y5BB 4WAFA 2FCNA 2LZ6A 4B9KA 2PLPA 1XLPA 2HDEA 1DOXA 2KFJA 3KVFB 3U2SC 1HTQA 1UBIA 3DOWA 1I42A 4S17A 2DYBA 2KT7A 3KQ4A 4MGYE 3MHSD 3DVGX 4GDLB 3AE5B 4MGIE 2TSSA 4KDIC 2BWES 3MJ5A 4P1BC 3JSVA 4NPNA 2HTME 1OTRB 4ZYSA 3RMKC 3W5UB 2IZVB 2KFKA 1M94A 3TMPB 2RGFA 2M0AA 4MH8A 2JQRB 1J7BA 1V1OA 4US8A 2VZKD 3DHIC 2ACZB 3K9PB 2H89B 3PREA 4DHJD 1RFKA 3ZUNA 2IGHA 2NR2A 1XD3B 1L4DB 2LD9A 4BKSD 4XYCA 3P63A 2N7EA 1KLVA 4JWSC 2Z8LA 3AI5A 1J0GA 2DWQA 2HTHA 2A4ZA 2LASA 3APDA 4C4VA 4ANUA 2C7MB 4HLEA 5D3IB 2L0FA 2DYMA 2AQ3B 3C8YA 3GZNB 4MDKE 2BS4B 1WGRA 1TKYA 5EE0A 1EF5A 1WXVA 3RYTA 2RD0A 2WXIA 3N1ZC 2FCMA 4YWGG 4MSQB 1NEKB 1ZP0B 1LO5D 1TBEA 2MH7A 5G55A 2J53A 1UUPA 3H1UA 4I6NB 5CHFA 2M0XA 4WJQA 3PRMB 1N60A 2C7NB 2N9PC 1YQ4B 3IAM1 3Q8EA 3ZNID 2MW5A 4ZRKA 3QX1A 2KX3A 4M0WB 1J19A 3HM6X 2MEKA 4B0EA 2WHIA 1PGBA 4WURA 1SBBB 4IG7B 4BKTA 3DHGC 2CHXA 3PZ8A 1QOBA 1E5WA 2X8XX 2XBBC 5IP4D 1BMLC 4W9DA 3P4SB 2CHWA 4HPMB 3B0AA 1N63A 4OZBA 2J0JA 4DQOC 3H7PB 1KH0A 2XNAC 1ZDVA 2OEDA 3RNCC 4J6IA 3FAHA 1ZW7A 3NRZA 4LNOA 4BAXA 3VRBB 2BS2B 3HM3A 1HE8A 3WANA 3R2IA 3AEEB 2OJRA 2WXJA 1F1HA 4I6PA 3E9SA 3QA8A 1VDVA 1KLGD 4II2B 4MGZE 3T3OA 1HZ6A 2AYOB 4ZRQA 2NPTB 3W2DA 2PTLA 2PKOA 2N9LA 4KKJA 5AEKB 3UIPB 5AUIA 4MT5A 1GJZA 4F7ZA 2JWZA 5T8IA 2BF8B 3DBRI 4HRSA 4CYEA 4K3BA 3IG3A 2WU5B 2M4NA 2PE9A 2WDQB 5G5HA 2CKHB 1WI0A 4A8XC 1XT9B 4YTPB 1E7PB 3VTVA 1I4QA 1WE6A 2PIAA 4N6EB 1YJ1A 1L2NA 4EE2A 1JMLA 1WGYA 1V1PA 3PGEA 1HTOA 2KVRA 1LQBA 1ET9A 2FBWB 2V3NA 2JZPA 4KGRA 3NVZA 3IVFA 4RF1A 1UGMA 2V3SA 2ZPYA 3QJZA 1L0YB 4JQWC 2K9XA 1SE9A 3Q3NC 4C56C 2R2OA 3AE2B 3ONSA 1WFYA 3GE3C 1ET6A 1ZXHA 4ZRPA 1ZOYB 4RF0A 1QOGA 1C76A 1T0RC 3JVZX 1SGHA 4FULA 4M8MA 4WQOB 5BYSA 3TEZA 2IO3B 3VUXA 2WP9B 2WXQA 2JXXA 3DVNV 2JRHA 1IGCA 1EU4A 1D3ZA 1RRBA 1X1MA 2EMSA 1PFDA 5C2TB 3L16A 3MFGA 4N58A 1GOZA 3ZVVA 1PUTA 3ZXRA 3N32A 4FA6A 1UH6A 3PLVA 4CQNA 1E7VA 1AN8A 1EO6A 2J52A 2W55A 2B76B 1PQSA 4L1BA 3MP9A 3TSSA 3V61A 2K25A 1PYWD 1E8ZA 4YSYB 2N9XA 3NG0A 4JX1C 1NYRA 1E8WA 2HJ1A 4K1RB 3OLMD 3EFUA 4RGNA 2ZJDA 5LNK1 2JSVX 1KLUD 3BINA 3ENEA 1YQ3B 3MC8A 2ZPNA 1GAQB 2K3UA 2LHDA 2GI9A 2LJIA 1TS4A 2AX5A 3LJ3A 3RT3B 2MWSB 4YSXB 1S3SG 1KTKA 2GLSA 2WXLA 1GB4A 1WXMA 2WDTB 3AE9B 1I4RA 1V2YA 5IKCM 2RPVA 2W3RA 5JXVA 2NTTA 2DENB 5D7GA 5CHVC 4ICVA 4KX6B 4W9JA 1HXYD 3AE8B 3RZWC 2INCC 3ZJTA 2OOBB 1GC6A 1MFWA 3HUIA 2LEKA 4WIPA 4KSLC 1PGXA 2KN4A 3RI7C 3IXSA 1FNVA 5DPRA 3NY5A 2QJLA 3PTFC 3ZW3A 2AQ1B 3KYDD 1RWSA 1MI0A 3I9V1 3V62A 2KFKB 4NAWA 2G1EA 3N20C 3P4RB 3BVMA 2INPE 3Q14C 4D2KA 4HVBA 4GDKA 2KZRA 4IDIA 2LGSA 4KSKC 4RMAA 4HCPB 2C5LC 3V6EB 2J0MA 2KD0A 1KOTA 4IWOA 3R8BA 2GB1A 3BIID 2KDEB 1I7HA 1XLOA 2M19A 4P6VF 3HVDA 4TSSA 1KJTA 2LHEA 4GMVA 1J8CA 2Y3AA 3V6CB 2WXPA 1N6ZA 5JHAA 3CF6E 5DPSA 4DWFA 3NJTA 3N1YC 3AEFB 1XQQA 3CMMB 4MGKE 2N0SB 5DCNA 1TZ1A 4F1SA 4W9EA 3E56A 2IPKD 3NHEB 1YJJA 3VHTC 5E6NA 4KZ0A 2KX0A 3P1MA 1EWYC 3ML8A 5D94A 1F0ZA 1MG8A 1S1QB 4JLCA 3FKYA 3NZUA 1JWSD 3Q8AA 5GMVA 2V0GA 2WDRB 2BWFA 3DBHB 2LI5A 1JW9D 3ZRCA 3Q8CA 4IW0A 2DZJA 4G3XB 1ESFA 1VCBA 3DBSA 2BKRB 2KOXA 3OG5A 3PSEB 5HFYA 3ZKJC 1IP9A 2O2VB 3T9LA 5KHQA 3HHMA 2C60A 2D3BA 3C19A 1WJ6A 4KIKB 3AN1A 2ZCCA 5BO4B 2KDBA 4FHJA 3P2BA 3AE3B 3H7SA 2KWUB 3KWVA 3ZXVA 3VR9B 1GPXA 4BKSA 3L54A 4HPPA 5L83A 4W9FA 3DCGA 1Q10A 2K6QA 3P4PB 2Z59B 3R2TA 4HXDA 3VTWA 1MJDA 2AWTA 2RPQA 2EMTA 2KJ6A 2WXRA 1C3TA 1UWMA 4XWWA 1L7YA 1RAXA 1T0YA 1EM7A 2WX0A 2WYQA 3IT6B 3SEBA 4GGQA 3VAWA 1WSPA 1TKGA 3GZNI 2KLCA 4A55A 1TY2A 4TKNA 1WZ0A 2JF5A 2XK5B 3N3KB 1OQYA 2D07B 4HCNB 1UBQA 3L08A 2K0PA 1EWCA 3SD5A 4P7IA 2RDHA 1D5XC 5H92C 3KLSX 1DOYA 1AWDA 2KKCA 1E0ZA 3DDCB 4LCDE 3AEBB 1V1PB 4MJSB 3MJWA 1UZXB 4HDOA 1V5TA 2BGFA 3V05A 3OJ4B 2WXFA 1KF6B 2KK8A 1N61A 4G0NB 4XWTA 4URKA 3C0RB 5EE1A 1D4BA 2L52A 3KUCB 3D32A 2BYVE 1JRPA 1CQVA 3OWEB 2QILA 4ARIA 3PVLA 4AS1A 2KACA 1Z2MA 2MQJA 1FRRA 4GOCA 1Y56A 5C3JB 1FM0D 3B9JA 5AZHA 1IGDA 2BT6A 1JWMD 2BKFA 3A9JA 3M95A 2DAFA 2LGXA 3FILA 4LDTD 1TS3A 3X0WA 1ZKHA 2G3QB 2ZCBA 4KKIA 4WJPA 1L4ZB 3MTNB 3APCA 3SFEB 3AXCA 2V4IB 3EGRA 3PLUA 1XF5L 4RM8A 2MSED 4C7ZA 4XGAB 1Q0WB 2L32A 4BBNF 5DPWA 2IO0B 1SXTA 3ZO5B 3RPFC 3ZJUA 2J4XA 1XLNA 1ZUD2 2W54A 3ABVB 4B95A 1J7CA 1E9MA 2JYEA 1DOIA 2M8SA 2JYTA 1VZ7A 2KAJA 4YSZB 4NQKE 3NZ3A 3AEGB 2CS4A 4PS7A 3PRZA 1WJ4A 2AL3A 3TEWA 2WS3B 3P4QB 2N4FA 4HKQA 3RNEC 5LLIA 3W9CB 4HWIB 3PRPB 4EZKA 3TCAA 4EUTA 4H2AA 4NJ7A 2INDC 2EKIA 2OJWA 2DLBA 2PPHA 1SE4A 3EA6A 3BZDB 4FADA 5FKAC 2MP2B 4NAWB 2ZVOA 3NVWA 4B0MA 1V9JA 2K5PA 3I5JC 4IKGA 2G4SA 4E74A 4I6LB 1YQBA 3UI3A 1U4AA 4WQMA 1TTNA 2MCNB 1V86A 4EOYA 1D6EC 4F8CB 4GN1A 5IAAC 1JWAD 4L2YA 2D3AA 4K3CA 2W82A 5E6JA 1T0QC 3BWUD 4DXGA 3K9OB 2WXKA 1BUIC 2WWZA 1YMHE 4HDQA 3T3NA 1C4AA 3AMZA 3V60A 2NBUA 4PYZA 1K8RB 1WZ3A 1WMHB 4M8NA 1YD8U 1K52A 3L17A 3U30A 1E10A 2DAJA 2LJ5A 2DHZA 2O6VD 2LVQA 4M01A 1KFYB 1Z5SB 1ZDXA 2XEWA 1FNWA 3O13A 4PS8A 2LGYA 4YTNB 4PK1A 4A20A 4FHKA 4MM3A 2N9KA 4KGTA 3BK2A 1GUAB 2CU1A 2ZEQA 4W9GA 4ARCA 1FRDA 2RDGA 3Q3JA 4PS3A 1NI3A 1A70A 3AU5A 2MJDA 4IM0A 2D11A 5I4DA 3PPAA 1MG4A 4K7WA 2Y5CA 3Q69A 2WXHA 3EHVA 2D3GA 1WRIA 1DGJA 1OEYA 4JE3B 4IWQA 4HJKA 2OHFA 2C7HA 2MX2A 3SDLC 4YTMB 4US9A 3RUIB 3PZDA 3P42A 2JT4B 1V49A 4YT0B 5MPOA 3B1LX 3NVYA 1V6EA 1WE7A 3U4EG 2LMCA 2IO2B 5JZEB 2KTRA 1FXIA 2VZKB 2KQ7A 1ZE3D 5BMIA 4DHJB 2LVOA 1LFDA 2KXJA 1E6EB 4NNJB 1VD2A 2I1JA 4C7YA 3RULA 4G50A 4REZA 2BYFA 2KYWA 3UIOB 3VDZA 2FUHB 3HK0A 4X57B 1WYWB 1T5XD 1WXSA 2KQSA 2LXCA 4AJYB 4XX5A 1B1ZA 4GB9A 2K22A 3UQAA 2K8BA 1YNTE 1WYGA 4HROA 1WM2A 2JX5A 1WWTA 3S2AA 4FJZA 2R61A 2WDVB 4BKGA 3BVZA 5FK9C 3VH4B 1AW7A 2BBCA 2MJ3A 3IT4B 5G5GA 4HPLB 2JZZA 4AWJA 4NQLB 1Q5WB 3ZGZA 5JHBA 1XEEA 4ZHPA 1WXAA 2KWVB 2LRUA 4USAA 3FC4A 1OGWA 3PT2B 3PV1A 1SB3C 2GBNA 2UU7A 3QAQA 3A1QA 5EDSA 4EFOA 2LUEA 5E6PA 3DBHI 2KVZA 4N9F4 4OVZA 3IAS1 3MC0B 5CHWA 1FXAA 2AL6A 3SU8X 1E8YA 4FBJB 1VR9A 3DBRB 3H9DA 1UD7A 2K8CA 1SIFA 2WGSA 1EUVB 3W1SA 1L0VB 3SR6A 4B6WA 4BOZB 2K1FA 4E71A 3UGBB 1YOVB 2IYDB 3JSVB 4E3CA 1R4NI 4RGOS 3RCZA 3I63C 1G6JA 1C4PA 3QCAA 3TIXA 4FLHA 4ITKA 3VH3B 3BYTB 1R4MI 4FXCA 2NS5A 3JYUA 5BMGA 2GRIA 3KW5B 1FNUA 4NJCA 4TQ0A 1P0RA 2KDIA 4DHZE 1H4RA 2IY0B 3ETRA 3FILB 4JL9A 1N62A 3ALBA 1QOFA 1TS5A 1YN3A 2B3AA 1UNSA 1TGZB 3SFDB 2MRPA 4M02A 2Z0DB 2YEPF 2DZKA 1I4HA 1WJUA 1EU3A 1FPYA 1TIFA 4JGHB 1YX5B 2H88B 2PJHA 4A3OA 2IBIB 2FCQA 2V1YA 1WR6E 3TL5A 1Q1OA 2N9EB 4AUQC 2RR9A 1WXQA 5J18A 3DBLB 2FNJB 4C4VB 5IOIA 4ICUA 2FCSA 3PO0A 2NBVB 1UF0A 2MHJA 3U8ZA 1IBXA 2NPTA 2KHWB 4IC7B 3M63B 1FCLA 2I38A 1QKZA 3KUZA 4HKZE 4EZLA 1XO3A 4XE0A 3VRAB 5KHOA 4XZ4A 2KDFB 1K53A 4RGMA 1V8CA 2WQYB 2Q5WD 4PYUA 4EZJA 3BK1A 4KV2A 3HVZA 3Q3OC 3VUWA 2WLBA 2QMTA 5BYRA 3ZNGC 1I4GA 1Y8RC 4GSWA 2HD5B 3GE8C 2L05A 1VRAB 2D3CA 4K7SA 2WXOA 3L0WB 4TV3A 1JWBD 1K51A 2YLMA 4ZRIA 4A3PA 2IGGA 3VQIA 2G9HD 2IGDA 2WXMA 3EUB2 3AECB 4GIVA 3RD2A 4NJ6A 1JROA 4RNAA 3RN9C 1YJIA 2C9WB 2RDBC 3AE4B 1DYQA 3QIJA 2LGDA 3IHPC 1T3QA 1FFUA 2ZNVC 3LDZE 1GNUA 1VJKA 4NZLB 1OQRA 4KGSA 4CHKA 2BB5A 1WX9A 4C00A 2D2QA 2KTFA 1JCKB 3Q8FA 3KYCD 2PMVA 4P16A 3BVGA 4HJGE 1JRUA 4IOIE 2NVUI 3ZIMA 2ZNVB 4W9CA 3L10B 4A90A 5FR3A 4Q2JA 3UINB 3AE7B 3Q3MC 1SEBD 4BOSC 4NAMA 1LXDA 3Q6BA 1WIAA 3A9KA 2IO1B 1VZ8A 3DWMA 1F2RC 3IFWB 4LNKA 3I3TB 4AJWA 5IA7A 1NVID 2WNMA 5L95C 3LXFA 1ENFA 4RCOA 3GP7A 4W9IA 5HI1A 2MA9B 2BB6A 1F52A 3M3JA 4RGTA 5DPTA 5AZGA 3URYA 3PS6A 3RNBC 2M56B 4DXFA 3ZDTA 2LFIA 2INNE 4M00A 1V80A 1N5XA 3O65B 1WX7A 1AARA 4J3OD 3NZSA 2REXA 3B2GA 1ZXIA 5AZFA 5C1ZA 4RFBA 3AB5A 3A33B 3CWIA 1V81A 1WH3A 1TY0A 1T0SC 4XC2A 3ZNHB 4DK5A 3NOBA 2KTRB 3QARA 2L7RA 1KM7A 4CO7A 1MHXA 4C80A 2V9HA 2NCNA 1UGJA 2LXAA 2KQ4X 3U7DA 2KN5A 2ON8A 3PHXB 1WF9A 2JXTA 2G4DB 1JQ4A 2DNFA 2KJHB 4KVGB 2KJRA 4LNFA 1NENB 1HZ5A 3J9CA 3Q3FA 4W9KA 3TEYA 3GOEA 2QCZA 2QSDA 4AOFA 4ANXA 3W5VB 3ZDMC 3R3MA 3UQBA 2O6VA 5C23A 4MH0E 1D5MC 2W9NA 2JRIB 1R7SA 2ONQA 3ZRFA 3R7QA 4G11A 4IM3A 3PHWB 1OEYJ 4OVUA 3NVVA 4ZOHC 4DBGA 4PT5A 1NBFC 2KANA 1C78A 3WCQA 3RNAC 4AQ7A 2ASQA 1YN4A 3WAOA 1TYGB 2JZ3B 3EC8A 3W1SC 3A1QB 3RZFA 2CJNA 3LYYA 4L23A 1CZPA 3JW0X 2PVOD 3CSFA 1NI2A 3AM9A 4ANVA 1YIWA 2BQQA 1PGAA 4R3DA 2N1VA 1SSNA 2WXNA 4OZCA 3RNFC 5HG2A 2CJOA 4GXBA 3GS2A 1FD6A 1C77A 3A4RA 5D2MB 2KMAA 2ZVNA 3ZQ4A 1CMXB 5E6OA 1XCTL 4LK0M 2GOWA 2PE6B 2EKEC 2LUMA 3TEXA 4LJOB 4DXAB 4GDKB 3SHQA 1C9FA 2J0KA 1L6UA 1L0XB 2BS3B 5HKHA 2J42A 3EFCA 2O2VA 1IPGA 2R2QA 2V3PA 3VTUA 4BBNC 2N1WA 4RH6A 2MJEA 4KIKA 1T6BX 2G45B 2DBYA 5LXIB 2IY1B 4AP4C 2KMMA 4BZAA 1P1AA 1QF6A 4K81A 1I4XA 2DZIA 2QIEB 3H6NA 4WWOA 2L1AA 5FR6A 1F9JA 2I1KA 3V3XA 2DX5B 1WRDB 1YN5A 4YXDB 2GBKA 2E3TA 1M4VA
chains in the Genus database with same CATH topology
2LI5A 3A1QA 3ZRCA 4IW0A 2DZJA 4G3XB 3ZNZB 4EEWA 1VCBA 3DBSA 2BKRB 5EDSA 2KOXA 3QQ8B 4EFOA 2V4LA 3PSEB 2LUEA 5E6PA 3DBHI 4N9F4 3ZKJC 1IP9A 2O2VB 5CHWA 2AL6A 3SU8X 1E8YA 3T9LA 2MLBA 3HHMA 3K9PB 2C60A 3PREA 4DDID 4FBJB 1GG3A 4DHJD 3H9DA 1UD7A 1WJ6A 4KIKB 1YX6B 2K8CA 4FJYA 2ZCCA 1SIFA 3DQVA 3ZUNA 5BO4B 1EUVB 2NR2A 3N30A 1XD3B 2KDBA 2KLGA 3W1SA 4FHJA 2XK5A 2LD9A 4B6WA 4BKSD 3P2BA 3ECIA 3H7SA 4BOZB 2KWUB 1A5RA 2K1FA 2N7EA 1KLVA 2K6DB 4E71A 3B08A 3UGBB 2IYDB 3APFA 1I35A 3AU4A 3JSVB 3BY4B 5G2NA 1H8CA 4BKSA 3AI5A 3L54A 4E3CA 4W9FA 5L83A 1R4NI 5J17A 3DCGA 2K6QA 1J0GA 3RCZA 2HTHA 4IUMB 1G6JA 2Z59B 3QCAA 4HXDA 3TIXA 3VTWA 2AWTA 2RPQA 4FLHA 3VH3B 2A4ZA 1FXTB 2EMTA 2LASA 4MJSA 2KJ6A 3APDA 3CSTA 1R4MI 2NS5A 1C3TA 3VVWB 4ANUA 3JYUA 2C7MB 1L7YA 1RAXA 4HLEA 2L0FA 3KW5B 2DYMA 1T0YA 4TQ0A 4MDKE 2HJ8A 1P0RA 2WX0A 2KDIA 2WYQA 2J7QB 1WGRA 4DHZE 1H4RA 2IY0B 4JL9A 1EF5A 1WXVA 4GGQA 3VAWA 4OVVA 3RYTA 3ALBA 2RSUA 2RD0A 3GZNI 2B3AA 2KLCA 1TGZB 2FCMA 2GMIC 2JPHA 2MRPA 2Z0DB 2ZZPB 4MSQB 1TBEA 1WX8A 2DZKA 4LDTB 5G55A 1WJUA 4TKNA 1WZ0A 2JF5A 2XK5B 4JGHB 1YX5B 1OQYA 3N3KB 2D07B 2PJHA 4HCNB 4A3OA 1UBQA 1RFAA 2IBIB 2FCQA 2WX1A 2KC1A 3H1UA 3L08A 4I6NB 4GDLA 2M0XA 5CHFA 2V1YA 3UF8A 3WAMA 4WJQA 1P3QU 3PRMB 3VUYA 2LWPA 1WR6E 2C7NB 3TL5A 1Q1OA 3SD5A 2N9PC 3ZNID 2A5UA 2MBBB 2MW5A 2N9EB 4ZRKA 3QX1A 2KX3A 3QHTA 4P7IA 5TR5A 2RR9A 4M0WB 4NY0A 4AUQC 5J18A 2KKCA 3DDCB 4LCDE 1J19A 2FNJB 3HM6X 4DDGD 4MJSB 3MJWA 4ZRJA 1UZXB 4IG7B 4HDOA 4HK2A 4ICUA 2FCSA 1V5TA 2BGFA 4BKTA 2VRRB 2NBVB 2JVCA 2L76A 3U8ZA 3DBLI 2CHXA 2KHWB 2NPTA 3W1YA 2L3ZA 3OJ4B 1E5WA 2XBBC 4IC7B 2KK8A 3M63B 1GC7A 4G0NB 4W9DA 3WIMA 4URKA 2CHWA 3C0RB 4HPMB 3B0AA 3KUZA 2J0JA 4EZLA 2D10A 3KUCB 2GBMA 3H7PB 2MBEA 3D32A 2BYVE 5KHOA 4XZ4A 2M1MA 3KH0A 2L0TA 4J6IA 2KDFB 5J2RA 3A9KB 1NDDA 4K7UA 1ZW7A 3TBLD 2DYOA 3PVLA 3HM3A 1HE8A 3WANA 4PYUA 3VFKA 2N7DA 1Z2MA 4EZJA 2MQJA 4GOCA 2OJRA 4KV2A 4ASWC 2KNBA 5AZHA 3VUWA 1QZEA 2K8HA 2K39A 4I6PA 3QA8A 3ZNGC 1Y8RC 2BKFA 3A9JA 4MEMA 4GSWA 2HD5B 3HIZA 4II2B 2AYOB 2GBRA 4MGZE 2L05A 4K7SA 2NPTB 3M95A 3L0WB 4IWPA 4TV3A 2DAFA 2LGXA 2YLMA 4LDTD 4ZRIA 4A3PA 3X0WA 3VQIA 1ZKHA 5AEKB 2G3QB 3UIPB 4MSMB 4GIVA 3RD2A 2ZCBA 4NJ6A 1GJZA 4F7ZA 2JWZA 1WY8A 2BF8B 3DBRI 4CYEA 4WJPA 5CX3A 3MTNB 2C9WB 3APCA 3IG3A 2M4NA 2PE9A 3WAPA 2CKHB 1WI0A 3AXCA 3QIJA 1XT9B 3L13A 2LGDA 3VTVA 3PLUA 4RM8A 3IHPC 4MELA 1WE6A 2MSED 3LDZE 2LRWA 2ZNVC 1GNUA 1YJ1A 1L2NA 2M17A 4CHKA 4YL8A 1Q0WB 1WGYA 1WX9A 4RM9A 2FIDA 3ZTDA 3PGEA 4BBNF 2KVRA 5DPWA 2D2QA 4WWPA 1LQBA 2KTFA 3KYCD 2IO0B 3IVFA 3A9JB 1UGMA 1E7UA 3ZO5B 2V3SA 2ZPYA 3QJZA 1JRUA 3OJ3A 4B95A 2MBHA 4JQWC 1SE9A 4FN2A 3QC8B 2MP2A 1ISNA 1EF1A 2R2OA 2NVUI 3ZIMA 3ONSA 2M8SA 2ZNVB 4W9CA 3L10B 4BVUC 5LXHA 1WFYA 3UINB 4TUUA 3VXWA 4BOSC 3H7PA 4NQKE 1LXDA 5D6JB 1UELA 3JVZX 1WIAA 2CS4A 2BPSA 4WWNA 4PS7A 1SGHA 3A9KA 4ANWA 1E90A 2IO1B 2PEAA 3QK0A 4FULA 2O6VB 4M8MA 4WQOB 3IFWB 3PRZA 1WJ4A 2AL3A 3I3TB 2IO3B 2Z0EB 3VUXA 4AJWA 2YVCA 2JXXA 5IA7A 5L95C 2LVPA 2N4FA 4GU2A 3DVNV 1C1YB 4W9IA 2MA9B 5LLIA 2JRHA 4HWIB 3M3JA 3PRPB 5DPTA 5AZGA 3TCAA 4IM2A 4EZKA 4EUTA 4NJ7A 1D3ZA 1RRBA 1X1MA 2EMSA 3PS6A 2PPHA 3ZDTA 3L16A 2KMCA 1WMHA 4FADA 1V80A 3ZVVA 2MP2B 3A4SC 4NAWB 3ZLZA 2ZVOA 3O65B 1V9JA 3N32A 4FA6A 2G4SA 1UH6A 4E74A 1WX7A 3PLVA 4I6LB 1E7VA 1YQBA 3DPDA 1RLFA 1AARA 3X23A 3T8MA 3NZSA 1EO6A 1U4AA 2REXA 4JIOU 5AZFA 1TTNA 5C1ZA 1PQSA 2MCNB 1V86A 3A33B 1WR1A 4DHZB 4EOYA 1V81A 4F8CB 1WH3A 2AEHA 4GN1A 4XC2A 3V61A 2K25A 3ZNHB 1E8ZA 5IAAC 2KWCA 2N9XA 3R66C 4TQ1A 4DK5A 3NOBA 2L00B 1E8WA 2KTRB 4EKUA 4K1RB 3DVGY 3OLMD 3EFUA 4W9LA 2GBJA 3QARA 3TJPA 2L7RA 2ZJDA 2L8JA 4WJNA 1KM7A 4CO7A 3K9OB 3BINA 3NS8A 2UYZB 3ENEA 2NCNA 2LXAA 1IYFA 2DZMA 2HE7A 2WWZA 3U7DA 2KN5A 4HDQA 2KC2A 3PHXB 3V60A 2NBUA 1WF9A 2ZPNA 4PYZA 1K8RB 4ZDVA 5JH5C 1WZ3A 2G4DB 1WMHB 4M8NA 1YD8U 3L17A 2KJHB 4KVGB 2KJRA 4BFRA 3LJ3A 4WAAA 3RT3B 2MWSB 3U30A 2CHZA 3Q3FA 1S3SG 2DAJA 4W9KA 2LJ5A 3GOEA 2DHZA 2O6VD 1WXMA 2WDTB 2KO3A 4W9HA 2LVQA 1V2YA 2CR5A 2JY6A 1Z5SB 2XEWA 2JUOA 4AOFA 2DENB 5D7GA 5CHVC 4ICVA 4KZCA 1V5OA 4PS8A 1BT0A 2MBQA 2LGYA 3R3MA 3ZDMC 2O6VA 3UQBA 4W9JA 5C23A 3KUDB 4FHKA 4MM3A 4MH0E 4A20A 2W9NA 3RZWC 2JRIB 1GUAB 1WM3A 3ZTCA 1ZGUB 2CU1A 3ZRFA 1P98A 3IBEA 2ZEQA 4W9GA 3R7QA 2FAZA 1WGDA 3EECA 2OOBB 4G11A 4IM3A 1GC6A 3Q3JA 4PS3A 3PHWB 4KSLC 1OEYJ 4OVUA 3AU5A 4IM0A 2D11A 5DPRA 4ANXA 3PPAA 4DBGA 3NY5A 3PTFC 4K7WA 3ZW3A 1NBFC 2BYEA 3KYDD 2KANA 3V62A 2KFKB 4NAWA 2ASQA 3EHVA 2D3GA 4LJPB 3WAOA 2JZ3B 1OEYA 3EC8A 2UWQA 3W1SC 4IWQA 4HJKA 3A1QB 3ML9A 3RZFA 4HVBA 2C7HA 2MBOA 5CTRC 2MX2A 3SDLC 1P9DU 4GDKA 3RUIB 3PZDA 1WGHA 3JW0X 3CSFA 2KZRA 1NI2A 2JT4B 3M62B 1V49A 4KSKC 4RMAA 4ANVA 1YIWA 3B1LX 1E8XA 1V6EA 4HCPB 1WE7A 2C5LC 1LM8B 2IO2B 5JZEB 2KTRA 3V6EB 2J0MA 4KDLB 2KD0A 1KOTA 2N1VA 5KHQA 3R7RA 4IWOA 2KQ7A 1WGGA 4WJOA 4DHJB 2FIFA 4ZYNA 4GXBA 2LVOA 1LFDA 2KDEB 3A4RA 2KXJA 5D2MB 2KMAA 4NNJB 2ZVNA 1VD2A 3AULA 3QWZB 4FJVB 2I1JA 3RULA 4G50A 1KJTA 3DVNU 3WA0A 1CMXB 2BYFA 3UIOB 5E6OA 3VDZA 2FUHB 3OAWA 4GMVA 3HK0A 2NBWB 1J8CA 4X57B 1WJNA 2QHOA 1WYWB 3WALA 2GOWA 2PE6B 2EKEC 4II3B 3V6CB 4LJOB 4DXAB 1WXSA 2KQSA 2LXCA 2Y5BB 4GDKB 2FCNA 3SHQA 2LZ6A 4AJYB 4XX5A 2J0KA 3CF6E 5DPSA 5JHAA 4B9KA 5HKHA 2O2VA 1IPGA 2R2QA 4DWFA 3VTUA 4BBNC 4GB9A 3UQAA 2KFJA 3KVFB 1XQQA 2K8BA 2N1WA 4KIKA 3CMMB 4MGKE 2G45B 5DCNA 1WM2A 1TZ1A 3S2AA 4F1SA 1UBIA 3DOWA 4FJZA 1I42A 5LXIB 4W9EA 4BKGA 2IY1B 4AP4C 3VH4B 2DYBA 3NHEB 3VHTC 5E6NA 4KZ0A 2KX0A 4MGYE 1P1AA 3MHSD 4HPLB 3DVGX 2JZZA 3ML8A 4K81A 4GDLB 4AWJA 4MGIE 4NQLB 1Q5WB 4KDIC 5D94A 2BWES 5JHBA 1MG8A 3JSVA 2DZIA 4NPNA 3H6NA 1S1QB 4JLCA 1OTRB 1WXAA 2KWVB 2LRUA 4WWOA 5FR6A 1OGWA 3PT2B 2IZVB 1F9JA 2I1KA 1M94A 2KFKA 3NZUA 2DX5B 1WRDB 3PV1A 3TMPB 2GBNA 5GMVA 2RGFA 2GBKA 2BWFA 3QAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LI5 A;  3A1Q A;  3ZRC A;  4IW0 A;  2DZJ A;  4G3X B;  3ZNZ B;  4EEW A;  1VCB A;  3DBS A;  2BKR B;  5EDS A;  2KOX A;  3QQ8 B;  4EFO A;  2V4L A;  3PSE B;  2LUE A;  5E6P A;  3DBH I;  4N9F 4;  3ZKJ C;  1IP9 A;  2O2V B;  5CHW A;  2AL6 A;  3SU8 X;  1E8Y A;  3T9L A;  2MLB A;  3HHM A;  3K9P B;  2C60 A;  3PRE A;  4DDI D;  4FBJ B;  1GG3 A;  4DHJ D;  3H9D A;  1UD7 A;  1WJ6 A;  4KIK B;  1YX6 B;  2K8C A;  4FJY A;  2ZCC A;  1SIF A;  3DQV A;  3ZUN A;  5BO4 B;  1EUV B;  2NR2 A;  3N30 A;  1XD3 B;  2KDB A;  2KLG A;  3W1S A;  4FHJ A;  2XK5 A;  2LD9 A;  4B6W A;  4BKS D;  3P2B A;  3ECI A;  3H7S A;  4BOZ B;  2KWU B;  1A5R A;  2K1F A;  2N7E A;  1KLV A;  2K6D B;  4E71 A;  3B08 A;  3UGB B;  2IYD B;  3APF A;  1I35 A;  3AU4 A;  3JSV B;  3BY4 B;  5G2N A;  1H8C A;  4BKS A;  3AI5 A;  3L54 A;  4E3C A;  4W9F A;  5L83 A;  1R4N I;  5J17 A;  3DCG A;  2K6Q A;  1J0G A;  3RCZ A;  2HTH A;  4IUM B;  1G6J A;  2Z59 B;  3QCA A;  4HXD A;  3TIX A;  3VTW A;  2AWT A;  2RPQ A;  4FLH A;  3VH3 B;  2A4Z A;  1FXT B;  2EMT A;  2LAS A;  4MJS A;  2KJ6 A;  3APD A;  3CST A;  1R4M I;  2NS5 A;  1C3T A;  3VVW B;  4ANU A;  3JYU A;  2C7M B;  1L7Y A;  1RAX A;  4HLE A;  2L0F A;  3KW5 B;  2DYM A;  1T0Y A;  4TQ0 A;  4MDK E;  2HJ8 A;  1P0R A;  2WX0 A;  2KDI A;  2WYQ A;  2J7Q B;  1WGR A;  4DHZ E;  1H4R A;  2IY0 B;  4JL9 A;  1EF5 A;  1WXV A;  4GGQ A;  3VAW A;  4OVV A;  3RYT A;  3ALB A;  2RSU A;  2RD0 A;  3GZN I;  2B3A A;  2KLC A;  1TGZ B;  2FCM A;  2GMI C;  2JPH A;  2MRP A;  2Z0D B;  2ZZP B;  4MSQ B;  1TBE A;  1WX8 A;  2DZK A;  4LDT B;  5G55 A;  1WJU A;  4TKN A;  1WZ0 A;  2JF5 A;  2XK5 B;  4JGH B;  1YX5 B;  1OQY A;  3N3K B;  2D07 B;  2PJH A;  4HCN B;  4A3O A;  1UBQ A;  1RFA A;  2IBI B;  2FCQ A;  2WX1 A;  2KC1 A;  3H1U A;  3L08 A;  4I6N B;  4GDL A;  2M0X A;  5CHF A;  2V1Y A;  3UF8 A;  3WAM A;  4WJQ A;  1P3Q U;  3PRM B;  3VUY A;  2LWP A;  1WR6 E;  2C7N B;  3TL5 A;  1Q1O A;  3SD5 A;  2N9P C;  3ZNI D;  2A5U A;  2MBB B;  2MW5 A;  2N9E B;  4ZRK A;  3QX1 A;  2KX3 A;  3QHT A;  4P7I A;  5TR5 A;  2RR9 A;  4M0W B;  4NY0 A;  4AUQ C;  5J18 A;  2KKC A;  3DDC B;  4LCD E;  1J19 A;  2FNJ B;  3HM6 X;  4DDG D;  4MJS B;  3MJW A;  4ZRJ A;  1UZX B;  4IG7 B;  4HDO A;  4HK2 A;  4ICU A;  2FCS A;  1V5T A;  2BGF A;  4BKT A;  2VRR B;  2NBV B;  2JVC A;  2L76 A;  3U8Z A;  3DBL I;  2CHX A;  2KHW B;  2NPT A;  3W1Y A;  2L3Z A;  3OJ4 B;  1E5W A;  2XBB C;  4IC7 B;  2KK8 A;  3M63 B;  1GC7 A;  4G0N B;  4W9D A;  3WIM A;  4URK A;  2CHW A;  3C0R B;  4HPM B;  3B0A A;  3KUZ A;  2J0J A;  4EZL A;  2D10 A;  3KUC B;  2GBM A;  3H7P B;  2MBE A;  3D32 A;  2BYV E;  5KHO A;  4XZ4 A;  2M1M A;  3KH0 A;  2L0T A;  4J6I A;  2KDF B;  5J2R A;  3A9K B;  1NDD A;  4K7U A;  1ZW7 A;  3TBL D;  2DYO A;  3PVL A;  3HM3 A;  1HE8 A;  3WAN A;  4PYU A;  3VFK A;  2N7D A;  1Z2M A;  4EZJ A;  2MQJ A;  4GOC A;  2OJR A;  4KV2 A;  4ASW C;  2KNB A;  5AZH A;  3VUW A;  1QZE A;  2K8H A;  2K39 A;  4I6P A;  3QA8 A;  3ZNG C;  1Y8R C;  2BKF A;  3A9J A;  4MEM A;  4GSW A;  2HD5 B;  3HIZ A;  4II2 B;  2AYO B;  2GBR A;  4MGZ E;  2L05 A;  4K7S A;  2NPT B;  3M95 A;  3L0W B;  4IWP A;  4TV3 A;  2DAF A;  2LGX A;  2YLM A;  4LDT D;  4ZRI A;  4A3P A;  3X0W A;  3VQI A;  1ZKH A;  5AEK B;  2G3Q B;  3UIP B;  4MSM B;  4GIV A;  3RD2 A;  2ZCB A;  4NJ6 A;  1GJZ A;  4F7Z A;  2JWZ A;  1WY8 A;  2BF8 B;  3DBR I;  4CYE A;  4WJP A;  5CX3 A;  3MTN B;  2C9W B;  3APC A;  3IG3 A;  2M4N A;  2PE9 A;  3WAP A;  2CKH B;  1WI0 A;  3AXC A;  3QIJ A;  1XT9 B;  3L13 A;  2LGD A;  3VTV A;  3PLU A;  4RM8 A;  3IHP C;  4MEL A;  1WE6 A;  2MSE D;  3LDZ E;  2LRW A;  2ZNV C;  1GNU A;  1YJ1 A;  1L2N A;  2M17 A;  4CHK A;  4YL8 A;  1Q0W B;  1WGY A;  1WX9 A;  4RM9 A;  2FID A;  3ZTD A;  3PGE A;  4BBN F;  2KVR A;  5DPW A;  2D2Q A;  4WWP A;  1LQB A;  2KTF A;  3KYC D;  2IO0 B;  3IVF A;  3A9J B;  1UGM A;  1E7U A;  3ZO5 B;  2V3S A;  2ZPY A;  3QJZ A;  1JRU A;  3OJ3 A;  4B95 A;  2MBH A;  4JQW C;  1SE9 A;  4FN2 A;  3QC8 B;  2MP2 A;  1ISN A;  1EF1 A;  2R2O A;  2NVU I;  3ZIM A;  3ONS A;  2M8S A;  2ZNV B;  4W9C A;  3L10 B;  4BVU C;  5LXH A;  1WFY A;  3UIN B;  4TUU A;  3VXW A;  4BOS C;  3H7P A;  4NQK E;  1LXD A;  5D6J B;  1UEL A;  3JVZ X;  1WIA A;  2CS4 A;  2BPS A;  4WWN A;  4PS7 A;  1SGH A;  3A9K A;  4ANW A;  1E90 A;  2IO1 B;  2PEA A;  3QK0 A;  4FUL A;  2O6V B;  4M8M A;  4WQO B;  3IFW B;  3PRZ A;  1WJ4 A;  2AL3 A;  3I3T B;  2IO3 B;  2Z0E B;  3VUX A;  4AJW A;  2YVC A;  2JXX A;  5IA7 A;  5L95 C;  2LVP A;  2N4F A;  4GU2 A;  3DVN V;  1C1Y B;  4W9I A;  2MA9 B;  5LLI A;  2JRH A;  4HWI B;  3M3J A;  3PRP B;  5DPT A;  5AZG A;  3TCA A;  4IM2 A;  4EZK A;  4EUT A;  4NJ7 A;  1D3Z A;  1RRB A;  1X1M A;  2EMS A;  3PS6 A;  2PPH A;  3ZDT A;  3L16 A;  2KMC A;  1WMH A;  4FAD A;  1V80 A;  3ZVV A;  2MP2 B;  3A4S C;  4NAW B;  3ZLZ A;  2ZVO A;  3O65 B;  1V9J A;  3N32 A;  4FA6 A;  2G4S A;  1UH6 A;  4E74 A;  1WX7 A;  3PLV A;  4I6L B;  1E7V A;  1YQB A;  3DPD A;  1RLF A;  1AAR A;  3X23 A;  3T8M A;  3NZS A;  1EO6 A;  1U4A A;  2REX A;  4JIO U;  5AZF A;  1TTN A;  5C1Z A;  1PQS A;  2MCN B;  1V86 A;  3A33 B;  1WR1 A;  4DHZ B;  4EOY A;  1V81 A;  4F8C B;  1WH3 A;  2AEH A;  4GN1 A;  4XC2 A;  3V61 A;  2K25 A;  3ZNH B;  1E8Z A;  5IAA C;  2KWC A;  2N9X A;  3R66 C;  4TQ1 A;  4DK5 A;  3NOB A;  2L00 B;  1E8W A;  2KTR B;  4EKU A;  4K1R B;  3DVG Y;  3OLM D;  3EFU A;  4W9L A;  2GBJ A;  3QAR A;  3TJP A;  2L7R A;  2ZJD A;  2L8J A;  4WJN A;  1KM7 A;  4CO7 A;  3K9O B;  3BIN A;  3NS8 A;  2UYZ B;  3ENE A;  2NCN A;  2LXA A;  1IYF A;  2DZM A;  2HE7 A;  2WWZ A;  3U7D A;  2KN5 A;  4HDQ A;  2KC2 A;  3PHX B;  3V60 A;  2NBU A;  1WF9 A;  2ZPN A;  4PYZ A;  1K8R B;  4ZDV A;  5JH5 C;  1WZ3 A;  2G4D B;  1WMH B;  4M8N A;  1YD8 U;  3L17 A;  2KJH B;  4KVG B;  2KJR A;  4BFR A;  3LJ3 A;  4WAA A;  3RT3 B;  2MWS B;  3U30 A;  2CHZ A;  3Q3F A;  1S3S G;  2DAJ A;  4W9K A;  2LJ5 A;  3GOE A;  2DHZ A;  2O6V D;  1WXM A;  2WDT B;  2KO3 A;  4W9H A;  2LVQ A;  1V2Y A;  2CR5 A;  2JY6 A;  1Z5S B;  2XEW A;  2JUO A;  4AOF A;  2DEN B;  5D7G A;  5CHV C;  4ICV A;  4KZC A;  1V5O A;  4PS8 A;  1BT0 A;  2MBQ A;  2LGY A;  3R3M A;  3ZDM C;  2O6V A;  3UQB A;  4W9J A;  5C23 A;  3KUD B;  4FHK A;  4MM3 A;  4MH0 E;  4A20 A;  2W9N A;  3RZW C;  2JRI B;  1GUA B;  1WM3 A;  3ZTC A;  1ZGU B;  2CU1 A;  3ZRF A;  1P98 A;  3IBE A;  2ZEQ A;  4W9G A;  3R7Q A;  2FAZ A;  1WGD A;  3EEC A;  2OOB B;  4G11 A;  4IM3 A;  1GC6 A;  3Q3J A;  4PS3 A;  3PHW B;  4KSL C;  1OEY J;  4OVU A;  3AU5 A;  4IM0 A;  2D11 A;  5DPR A;  4ANX A;  3PPA A;  4DBG A;  3NY5 A;  3PTF C;  4K7W A;  3ZW3 A;  1NBF C;  2BYE A;  3KYD D;  2KAN A;  3V62 A;  2KFK B;  4NAW A;  2ASQ A;  3EHV A;  2D3G A;  4LJP B;  3WAO A;  2JZ3 B;  1OEY A;  3EC8 A;  2UWQ A;  3W1S C;  4IWQ A;  4HJK A;  3A1Q B;  3ML9 A;  3RZF A;  4HVB A;  2C7H A;  2MBO A;  5CTR C;  2MX2 A;  3SDL C;  1P9D U;  4GDK A;  3RUI B;  3PZD A;  1WGH A;  3JW0 X;  3CSF A;  2KZR A;  1NI2 A;  2JT4 B;  3M62 B;  1V49 A;  4KSK C;  4RMA A;  4ANV A;  1YIW A;  3B1L X;  1E8X A;  1V6E A;  4HCP B;  1WE7 A;  2C5L C;  1LM8 B;  2IO2 B;  5JZE B;  2KTR A;  3V6E B;  2J0M A;  4KDL B;  2KD0 A;  1KOT A;  2N1V A;  5KHQ A;  3R7R A;  4IWO A;  2KQ7 A;  1WGG A;  4WJO A;  4DHJ B;  2FIF A;  4ZYN A;  4GXB A;  2LVO A;  1LFD A;  2KDE B;  3A4R A;  2KXJ A;  5D2M B;  2KMA A;  4NNJ B;  2ZVN A;  1VD2 A;  3AUL A;  3QWZ B;  4FJV B;  2I1J A;  3RUL A;  4G50 A;  1KJT A;  3DVN U;  3WA0 A;  1CMX B;  2BYF A;  3UIO B;  5E6O A;  3VDZ A;  2FUH B;  3OAW A;  4GMV A;  3HK0 A;  2NBW B;  1J8C A;  4X57 B;  1WJN A;  2QHO A;  1WYW B;  3WAL A;  2GOW A;  2PE6 B;  2EKE C;  4II3 B;  3V6C B;  4LJO B;  4DXA B;  1WXS A;  2KQS A;  2LXC A;  2Y5B B;  4GDK B;  2FCN A;  3SHQ A;  2LZ6 A;  4AJY B;  4XX5 A;  2J0K A;  3CF6 E;  5DPS A;  5JHA A;  4B9K A;  5HKH A;  2O2V A;  1IPG A;  2R2Q A;  4DWF A;  3VTU A;  4BBN C;  4GB9 A;  3UQA A;  2KFJ A;  3KVF B;  1XQQ A;  2K8B A;  2N1W A;  4KIK A;  3CMM B;  4MGK E;  2G45 B;  5DCN A;  1WM2 A;  1TZ1 A;  3S2A A;  4F1S A;  1UBI A;  3DOW A;  4FJZ A;  1I42 A;  5LXI B;  4W9E A;  4BKG A;  2IY1 B;  4AP4 C;  3VH4 B;  2DYB A;  3NHE B;  3VHT C;  5E6N A;  4KZ0 A;  2KX0 A;  4MGY E;  1P1A A;  3MHS D;  4HPL B;  3DVG X;  2JZZ A;  3ML8 A;  4K81 A;  4GDL B;  4AWJ A;  4MGI E;  4NQL B;  1Q5W B;  4KDI C;  5D94 A;  2BWE S;  5JHB A;  1MG8 A;  3JSV A;  2DZI A;  4NPN A;  3H6N A;  1S1Q B;  4JLC A;  1OTR B;  1WXA A;  2KWV B;  2LRU A;  4WWO A;  5FR6 A;  1OGW A;  3PT2 B;  2IZV B;  1F9J A;  2I1K A;  1M94 A;  2KFK A;  3NZU A;  2DX5 B;  1WRD B;  3PV1 A;  3TMP B;  2GBN A;  5GMV A;  2RGF A;  2GBK A;  2BWF A;  3QAQ A; 
#chains in the Genus database with same CATH topology
 1NYQ A;  2BW2 A;  3ZNZ B;  4EEW A;  3QQ8 B;  2V4L A;  1IBX B;  2VH1 A;  1JAL A;  4DDI D;  2MLB A;  1HA5 A;  1GG3 A;  1YX6 B;  4FJY A;  1AYF A;  3DQV A;  4LNN A;  1SF0 A;  2KLG A;  3N30 A;  2XK5 A;  3L4P A;  3ECI A;  3ZYY X;  2PW9 A;  3AED B;  1A5R A;  2K6D B;  3B08 A;  1I35 A;  3APF A;  3AU4 A;  3BY4 B;  5G2N A;  1H8C A;  3LB8 C;  5J17 A;  3AEA B;  2AQ2 B;  1L5P A;  4ZHO A;  2BVC A;  2JWU A;  4IUM B;  4QAY A;  2FE8 A;  2I2Y A;  1ACC A;  1FXT B;  4MJS A;  3CST A;  1FCC C;  1OFF A;  3VVW B;  3N9Y C;  1TJE A;  3PZ7 A;  2HJ8 A;  2J7Q B;  4JPS A;  3B2F A;  1F77 A;  1STE A;  5EE3 A;  4OVV A;  3RFZ B;  2RSU A;  1TT5 B;  2GMI C;  2JPH A;  2ZZP B;  5BMH A;  2NTS A;  1WX8 A;  4LDT B;  2KDM A;  2IJ0 A;  1KRH A;  1TS2 A;  2E6X A;  1RFA A;  2WX1 A;  2KC1 A;  4GDL A;  3UF8 A;  3WAM A;  4A9A A;  1P3Q U;  3VUY A;  2LWP A;  1D5Z C;  2A5U A;  2MBB B;  1I4P A;  3QHT A;  5TR5 A;  4NY0 A;  2VH2 A;  1SJE D;  1C79 A;  1BXT A;  4DDG D;  4GLS C;  1HEZ E;  2KWD A;  4ZRJ A;  4HK2 A;  3Q8B A;  5HHD G;  2VRR B;  2JVC A;  2L76 A;  3DBL I;  3W1Y A;  2L3Z A;  4A6Q A;  1GC7 A;  3WIM A;  1IUE A;  2D10 A;  3VR8 B;  1FO4 A;  2GBM A;  2MBE A;  3TUO A;  1P7F A;  2M1M A;  3KH0 A;  1CJE A;  4WWM A;  2L0T A;  5J2R A;  3A9K B;  2RMM A;  1NDD A;  4K7U A;  3TBL D;  2DYO A;  1FIQ A;  4P1C C;  3VFK A;  2N7D A;  4ASW C;  2KNB A;  1QZE A;  2K8H A;  2K39 A;  1SIJ A;  4MEM A;  1JWU D;  3HIZ A;  2GBR A;  1GB1 A;  4IWP A;  3Q2A C;  1CK1 A;  1LGR A;  4MSM B;  4LTU A;  4HEA 1;  2NMQ A;  2EEL A;  1WY8 A;  5CX3 A;  2PVG C;  3ZJV A;  3WAP A;  3N1X C;  1WGK A;  1L6V A;  2D5G A;  3L13 A;  4MEL A;  1XXG A;  2ICI A;  2LRW A;  5IN7 A;  4M0W A;  3HRD D;  2M17 A;  4YL8 A;  1V97 A;  4RM9 A;  2FID A;  3ZTD A;  1TZO A;  2BTE A;  4WWP A;  2BYT A;  1QQR A;  2IDY A;  4XDD A;  3NUH B;  3A9J B;  1E7U A;  2X38 A;  2N7J A;  3OJ3 A;  2MBH A;  4FN2 A;  3QC8 B;  4O1N A;  2MP2 A;  1ISN A;  1EF1 A;  4BVU C;  5LXH A;  1FMA D;  3GB1 A;  4TUU A;  3VXW A;  3H7P A;  3BYY B;  5D6J B;  1UEL A;  1K50 A;  2JU6 X;  2BPS A;  4WWN A;  4ANW A;  1E90 A;  3QK0 A;  2PEA A;  1RM6 C;  1RYJ A;  2O6V B;  1B9R A;  2Z0E B;  2W3S A;  2YVC A;  2L83 A;  2FUG 1;  2LVP A;  4GU2 A;  1C1Y B;  2LGI A;  4IM2 A;  2QEJ C;  4OHJ A;  4OZA A;  3AV8 A;  2XN9 C;  1P7E A;  1QOA A;  2KMC A;  1WMH A;  3DWG C;  4OW0 A;  3H8H A;  3A4S C;  1HQR D;  3ZLZ A;  1UWX A;  4TMA B;  3DHH C;  1F2R I;  3DPD A;  1RLF A;  3NS1 A;  3X23 A;  1XLQ A;  3T8M A;  4ACF A;  4JIO U;  4S0R A;  1WR1 A;  4DHZ B;  3AH7 A;  3RNG C;  2AEH A;  3AE6 B;  2KWC A;  3R66 C;  4TQ1 A;  2L00 B;  4EKU A;  3DVG Y;  4W9L A;  5BYQ A;  2GBJ A;  1ZPS A;  5D3D A;  3TJP A;  2L8J A;  3KWL A;  4WJN A;  3NS8 A;  2UYZ B;  5TSS A;  1IYF A;  2DZM A;  2HE7 A;  3MC9 A;  1XCQ L;  2KC2 A;  1FEH A;  4N59 A;  3CIR B;  4ZDV A;  5JH5 C;  4BFR A;  1SJH D;  4WAA A;  1VLB A;  2CHZ A;  5IO9 A;  2Y5P A;  1SE3 A;  1PDX A;  2KO3 A;  4W9H A;  1QT9 A;  1MVK A;  2CR5 A;  2JY6 A;  1QIL A;  2JUO A;  4UDU C;  2QDF A;  4KZC A;  1V5O A;  1BT0 A;  2MBQ A;  3KUD B;  3U52 E;  1MPE A;  2WU2 B;  2YEP B;  3U7Z A;  1WM3 A;  3ZTC A;  1ZGU B;  2SEB D;  1P98 A;  3IBE A;  2FAZ A;  2SAK A;  1WGD A;  3EEC A;  1OQQ A;  5AUK A;  1R4N B;  4JWU C;  4XDC A;  2BYE A;  1SE2 A;  1R4M B;  2CU3 A;  4LJP B;  2UWQ A;  4WH4 A;  3ML9 A;  2MBO A;  5CTR C;  2ZW1 A;  1P9D U;  1J7A A;  1QLB B;  1WGH A;  3I57 A;  3M62 B;  4MM3 B;  1E8X A;  1LM8 B;  4MAC A;  5GXG B;  4KDL B;  5EE9 A;  1C4C A;  1VZ6 A;  3R7R A;  1FFV A;  1WGG A;  3AE1 B;  4WJO A;  2FIF A;  4ZYN A;  5H8Y E;  4LNI A;  3AUL A;  3QWZ B;  4FJV B;  1TKE A;  3WA0 A;  3DVN U;  1N5W A;  2WXG A;  3OAW A;  2NBW B;  1ROE A;  2QC8 A;  1WJN A;  2QHO A;  3WAL A;  4LLG M;  2ZW0 A;  4II3 B;  3MHZ A;  1MHH E;  2Y5B B;  4WAF A;  2FCN A;  2LZ6 A;  4B9K A;  2PLP A;  1XLP A;  2HDE A;  1DOX A;  2KFJ A;  3KVF B;  3U2S C;  1HTQ A;  1UBI A;  3DOW A;  1I42 A;  4S17 A;  2DYB A;  2KT7 A;  3KQ4 A;  4MGY E;  3MHS D;  3DVG X;  4GDL B;  3AE5 B;  4MGI E;  2TSS A;  4KDI C;  2BWE S;  3MJ5 A;  4P1B C;  3JSV A;  4NPN A;  2HTM E;  1OTR B;  4ZYS A;  3RMK C;  3W5U B;  2IZV B;  2KFK A;  1M94 A;  3TMP B;  2RGF A;  2M0A A;  4MH8 A;  2JQR B;  1J7B A;  1V1O A;  4US8 A;  2VZK D;  3DHI C;  2ACZ B;  3K9P B;  2H89 B;  3PRE A;  4DHJ D;  1RFK A;  3ZUN A;  2IGH A;  2NR2 A;  1XD3 B;  1L4D B;  2LD9 A;  4BKS D;  4XYC A;  3P63 A;  2N7E A;  1KLV A;  4JWS C;  2Z8L A;  3AI5 A;  1J0G A;  2DWQ A;  2HTH A;  2A4Z A;  2LAS A;  3APD A;  4C4V A;  4ANU A;  2C7M B;  4HLE A;  5D3I B;  2L0F A;  2DYM A;  2AQ3 B;  3C8Y A;  3GZN B;  4MDK E;  2BS4 B;  1WGR A;  1TKY A;  5EE0 A;  1EF5 A;  1WXV A;  3RYT A;  2RD0 A;  2WXI A;  3N1Z C;  2FCM A;  4YWG G;  4MSQ B;  1NEK B;  1ZP0 B;  1LO5 D;  1TBE A;  2MH7 A;  5G55 A;  2J53 A;  1UUP A;  3H1U A;  4I6N B;  5CHF A;  2M0X A;  4WJQ A;  3PRM B;  1N60 A;  2C7N B;  2N9P C;  1YQ4 B;  3IAM 1;  3Q8E A;  3ZNI D;  2MW5 A;  4ZRK A;  3QX1 A;  2KX3 A;  4M0W B;  1J19 A;  3HM6 X;  2MEK A;  4B0E A;  2WHI A;  1PGB A;  4WUR A;  1SBB B;  4IG7 B;  4BKT A;  3DHG C;  2CHX A;  3PZ8 A;  1QOB A;  1E5W A;  2X8X X;  2XBB C;  5IP4 D;  1BML C;  4W9D A;  3P4S B;  2CHW A;  4HPM B;  3B0A A;  1N63 A;  4OZB A;  2J0J A;  4DQO C;  3H7P B;  1KH0 A;  2XNA C;  1ZDV A;  2OED A;  3RNC C;  4J6I A;  3FAH A;  1ZW7 A;  3NRZ A;  4LNO A;  4BAX A;  3VRB B;  2BS2 B;  3HM3 A;  1HE8 A;  3WAN A;  3R2I A;  3AEE B;  2OJR A;  2WXJ A;  1F1H A;  4I6P A;  3E9S A;  3QA8 A;  1VDV A;  1KLG D;  4II2 B;  4MGZ E;  3T3O A;  1HZ6 A;  2AYO B;  4ZRQ A;  2NPT B;  3W2D A;  2PTL A;  2PKO A;  2N9L A;  4KKJ A;  5AEK B;  3UIP B;  5AUI A;  4MT5 A;  1GJZ A;  4F7Z A;  2JWZ A;  5T8I A;  2BF8 B;  3DBR I;  4HRS A;  4CYE A;  4K3B A;  3IG3 A;  2WU5 B;  2M4N A;  2PE9 A;  2WDQ B;  5G5H A;  2CKH B;  1WI0 A;  4A8X C;  1XT9 B;  4YTP B;  1E7P B;  3VTV A;  1I4Q A;  1WE6 A;  2PIA A;  4N6E B;  1YJ1 A;  1L2N A;  4EE2 A;  1JML A;  1WGY A;  1V1P A;  3PGE A;  1HTO A;  2KVR A;  1LQB A;  1ET9 A;  2FBW B;  2V3N A;  2JZP A;  4KGR A;  3NVZ A;  3IVF A;  4RF1 A;  1UGM A;  2V3S A;  2ZPY A;  3QJZ A;  1L0Y B;  4JQW C;  2K9X A;  1SE9 A;  3Q3N C;  4C56 C;  2R2O A;  3AE2 B;  3ONS A;  1WFY A;  3GE3 C;  1ET6 A;  1ZXH A;  4ZRP A;  1ZOY B;  4RF0 A;  1QOG A;  1C76 A;  1T0R C;  3JVZ X;  1SGH A;  4FUL A;  4M8M A;  4WQO B;  5BYS A;  3TEZ A;  2IO3 B;  3VUX A;  2WP9 B;  2WXQ A;  2JXX A;  3DVN V;  2JRH A;  1IGC A;  1EU4 A;  1D3Z A;  1RRB A;  1X1M A;  2EMS A;  1PFD A;  5C2T B;  3L16 A;  3MFG A;  4N58 A;  1GOZ A;  3ZVV A;  1PUT A;  3ZXR A;  3N32 A;  4FA6 A;  1UH6 A;  3PLV A;  4CQN A;  1E7V A;  1AN8 A;  1EO6 A;  2J52 A;  2W55 A;  2B76 B;  1PQS A;  4L1B A;  3MP9 A;  3TSS A;  3V61 A;  2K25 A;  1PYW D;  1E8Z A;  4YSY B;  2N9X A;  3NG0 A;  4JX1 C;  1NYR A;  1E8W A;  2HJ1 A;  4K1R B;  3OLM D;  3EFU A;  4RGN A;  2ZJD A;  5LNK 1;  2JSV X;  1KLU D;  3BIN A;  3ENE A;  1YQ3 B;  3MC8 A;  2ZPN A;  1GAQ B;  2K3U A;  2LHD A;  2GI9 A;  2LJI A;  1TS4 A;  2AX5 A;  3LJ3 A;  3RT3 B;  2MWS B;  4YSX B;  1S3S G;  1KTK A;  2GLS A;  2WXL A;  1GB4 A;  1WXM A;  2WDT B;  3AE9 B;  1I4R A;  1V2Y A;  5IKC M;  2RPV A;  2W3R A;  5JXV A;  2NTT A;  2DEN B;  5D7G A;  5CHV C;  4ICV A;  4KX6 B;  4W9J A;  1HXY D;  3AE8 B;  3RZW C;  2INC C;  3ZJT A;  2OOB B;  1GC6 A;  1MFW A;  3HUI A;  2LEK A;  4WIP A;  4KSL C;  1PGX A;  2KN4 A;  3RI7 C;  3IXS A;  1FNV A;  5DPR A;  3NY5 A;  2QJL A;  3PTF C;  3ZW3 A;  2AQ1 B;  3KYD D;  1RWS A;  1MI0 A;  3I9V 1;  3V62 A;  2KFK B;  4NAW A;  2G1E A;  3N20 C;  3P4R B;  3BVM A;  2INP E;  3Q14 C;  4D2K A;  4HVB A;  4GDK A;  2KZR A;  4IDI A;  2LGS A;  4KSK C;  4RMA A;  4HCP B;  2C5L C;  3V6E B;  2J0M A;  2KD0 A;  1KOT A;  4IWO A;  3R8B A;  2GB1 A;  3BII D;  2KDE B;  1I7H A;  1XLO A;  2M19 A;  4P6V F;  3HVD A;  4TSS A;  1KJT A;  2LHE A;  4GMV A;  1J8C A;  2Y3A A;  3V6C B;  2WXP A;  1N6Z A;  5JHA A;  3CF6 E;  5DPS A;  4DWF A;  3NJT A;  3N1Y C;  3AEF B;  1XQQ A;  3CMM B;  4MGK E;  2N0S B;  5DCN A;  1TZ1 A;  4F1S A;  4W9E A;  3E56 A;  2IPK D;  3NHE B;  1YJJ A;  3VHT C;  5E6N A;  4KZ0 A;  2KX0 A;  3P1M A;  1EWY C;  3ML8 A;  5D94 A;  1F0Z A;  1MG8 A;  1S1Q B;  4JLC A;  3FKY A;  3NZU A;  1JWS D;  3Q8A A;  5GMV A;  2V0G A;  2WDR B;  2BWF A;  3DBH B;  2LI5 A;  1JW9 D;  3ZRC A;  3Q8C A;  4IW0 A;  2DZJ A;  4G3X B;  1ESF A;  1VCB A;  3DBS A;  2BKR B;  2KOX A;  3OG5 A;  3PSE B;  5HFY A;  3ZKJ C;  1IP9 A;  2O2V B;  3T9L A;  5KHQ A;  3HHM A;  2C60 A;  2D3B A;  3C19 A;  1WJ6 A;  4KIK B;  3AN1 A;  2ZCC A;  5BO4 B;  2KDB A;  4FHJ A;  3P2B A;  3AE3 B;  3H7S A;  2KWU B;  3KWV A;  3ZXV A;  3VR9 B;  1GPX A;  4BKS A;  3L54 A;  4HPP A;  5L83 A;  4W9F A;  3DCG A;  1Q10 A;  2K6Q A;  3P4P B;  2Z59 B;  3R2T A;  4HXD A;  3VTW A;  1MJD A;  2AWT A;  2RPQ A;  2EMT A;  2KJ6 A;  2WXR A;  1C3T A;  1UWM A;  4XWW A;  1L7Y A;  1RAX A;  1T0Y A;  1EM7 A;  2WX0 A;  2WYQ A;  3IT6 B;  3SEB A;  4GGQ A;  3VAW A;  1WSP A;  1TKG A;  3GZN I;  2KLC A;  4A55 A;  1TY2 A;  4TKN A;  1WZ0 A;  2JF5 A;  2XK5 B;  3N3K B;  1OQY A;  2D07 B;  4HCN B;  1UBQ A;  3L08 A;  2K0P A;  1EWC A;  3SD5 A;  4P7I A;  2RDH A;  1D5X C;  5H92 C;  3KLS X;  1DOY A;  1AWD A;  2KKC A;  1E0Z A;  3DDC B;  4LCD E;  3AEB B;  1V1P B;  4MJS B;  3MJW A;  1UZX B;  4HDO A;  1V5T A;  2BGF A;  3V05 A;  3OJ4 B;  2WXF A;  1KF6 B;  2KK8 A;  1N61 A;  4G0N B;  4XWT A;  4URK A;  3C0R B;  5EE1 A;  1D4B A;  2L52 A;  3KUC B;  3D32 A;  2BYV E;  1JRP A;  1CQV A;  3OWE B;  2QIL A;  4ARI A;  3PVL A;  4AS1 A;  2KAC A;  1Z2M A;  2MQJ A;  1FRR A;  4GOC A;  1Y56 A;  5C3J B;  1FM0 D;  3B9J A;  5AZH A;  1IGD A;  2BT6 A;  1JWM D;  2BKF A;  3A9J A;  3M95 A;  2DAF A;  2LGX A;  3FIL A;  4LDT D;  1TS3 A;  3X0W A;  1ZKH A;  2G3Q B;  2ZCB A;  4KKI A;  4WJP A;  1L4Z B;  3MTN B;  3APC A;  3SFE B;  3AXC A;  2V4I B;  3EGR A;  3PLU A;  1XF5 L;  4RM8 A;  2MSE D;  4C7Z A;  4XGA B;  1Q0W B;  2L32 A;  4BBN F;  5DPW A;  2IO0 B;  1SXT A;  3ZO5 B;  3RPF C;  3ZJU A;  2J4X A;  1XLN A;  1ZUD 2;  2W54 A;  3ABV B;  4B95 A;  1J7C A;  1E9M A;  2JYE A;  1DOI A;  2M8S A;  2JYT A;  1VZ7 A;  2KAJ A;  4YSZ B;  4NQK E;  3NZ3 A;  3AEG B;  2CS4 A;  4PS7 A;  3PRZ A;  1WJ4 A;  2AL3 A;  3TEW A;  2WS3 B;  3P4Q B;  2N4F A;  4HKQ A;  3RNE C;  5LLI A;  3W9C B;  4HWI B;  3PRP B;  4EZK A;  3TCA A;  4EUT A;  4H2A A;  4NJ7 A;  2IND C;  2EKI A;  2OJW A;  2DLB A;  2PPH A;  1SE4 A;  3EA6 A;  3BZD B;  4FAD A;  5FKA C;  2MP2 B;  4NAW B;  2ZVO A;  3NVW A;  4B0M A;  1V9J A;  2K5P A;  3I5J C;  4IKG A;  2G4S A;  4E74 A;  4I6L B;  1YQB A;  3UI3 A;  1U4A A;  4WQM A;  1TTN A;  2MCN B;  1V86 A;  4EOY A;  1D6E C;  4F8C B;  4GN1 A;  5IAA C;  1JWA D;  4L2Y A;  2D3A A;  4K3C A;  2W82 A;  5E6J A;  1T0Q C;  3BWU D;  4DXG A;  3K9O B;  2WXK A;  1BUI C;  2WWZ A;  1YMH E;  4HDQ A;  3T3N A;  1C4A A;  3AMZ A;  3V60 A;  2NBU A;  4PYZ A;  1K8R B;  1WZ3 A;  1WMH B;  4M8N A;  1YD8 U;  1K52 A;  3L17 A;  3U30 A;  1E10 A;  2DAJ A;  2LJ5 A;  2DHZ A;  2O6V D;  2LVQ A;  4M01 A;  1KFY B;  1Z5S B;  1ZDX A;  2XEW A;  1FNW A;  3O13 A;  4PS8 A;  2LGY A;  4YTN B;  4PK1 A;  4A20 A;  4FHK A;  4MM3 A;  2N9K A;  4KGT A;  3BK2 A;  1GUA B;  2CU1 A;  2ZEQ A;  4W9G A;  4ARC A;  1FRD A;  2RDG A;  3Q3J A;  4PS3 A;  1NI3 A;  1A70 A;  3AU5 A;  2MJD A;  4IM0 A;  2D11 A;  5I4D A;  3PPA A;  1MG4 A;  4K7W A;  2Y5C A;  3Q69 A;  2WXH A;  3EHV A;  2D3G A;  1WRI A;  1DGJ A;  1OEY A;  4JE3 B;  4IWQ A;  4HJK A;  2OHF A;  2C7H A;  2MX2 A;  3SDL C;  4YTM B;  4US9 A;  3RUI B;  3PZD A;  3P42 A;  2JT4 B;  1V49 A;  4YT0 B;  5MPO A;  3B1L X;  3NVY A;  1V6E A;  1WE7 A;  3U4E G;  2LMC A;  2IO2 B;  5JZE B;  2KTR A;  1FXI A;  2VZK B;  2KQ7 A;  1ZE3 D;  5BMI A;  4DHJ B;  2LVO A;  1LFD A;  2KXJ A;  1E6E B;  4NNJ B;  1VD2 A;  2I1J A;  4C7Y A;  3RUL A;  4G50 A;  4REZ A;  2BYF A;  2KYW A;  3UIO B;  3VDZ A;  2FUH B;  3HK0 A;  4X57 B;  1WYW B;  1T5X D;  1WXS A;  2KQS A;  2LXC A;  4AJY B;  4XX5 A;  1B1Z A;  4GB9 A;  2K22 A;  3UQA A;  2K8B A;  1YNT E;  1WYG A;  4HRO A;  1WM2 A;  2JX5 A;  1WWT A;  3S2A A;  4FJZ A;  2R61 A;  2WDV B;  4BKG A;  3BVZ A;  5FK9 C;  3VH4 B;  1AW7 A;  2BBC A;  2MJ3 A;  3IT4 B;  5G5G A;  4HPL B;  2JZZ A;  4AWJ A;  4NQL B;  1Q5W B;  3ZGZ A;  5JHB A;  1XEE A;  4ZHP A;  1WXA A;  2KWV B;  2LRU A;  4USA A;  3FC4 A;  1OGW A;  3PT2 B;  3PV1 A;  1SB3 C;  2GBN A;  2UU7 A;  3QAQ A;  3A1Q A;  5EDS A;  4EFO A;  2LUE A;  5E6P A;  3DBH I;  2KVZ A;  4N9F 4;  4OVZ A;  3IAS 1;  3MC0 B;  5CHW A;  1FXA A;  2AL6 A;  3SU8 X;  1E8Y A;  4FBJ B;  1VR9 A;  3DBR B;  3H9D A;  1UD7 A;  2K8C A;  1SIF A;  2WGS A;  1EUV B;  3W1S A;  1L0V B;  3SR6 A;  4B6W A;  4BOZ B;  2K1F A;  4E71 A;  3UGB B;  1YOV B;  2IYD B;  3JSV B;  4E3C A;  1R4N I;  4RGO S;  3RCZ A;  3I63 C;  1G6J A;  1C4P A;  3QCA A;  3TIX A;  4FLH A;  4ITK A;  3VH3 B;  3BYT B;  1R4M I;  4FXC A;  2NS5 A;  3JYU A;  5BMG A;  2GRI A;  3KW5 B;  1FNU A;  4NJC A;  4TQ0 A;  1P0R A;  2KDI A;  4DHZ E;  1H4R A;  2IY0 B;  3ETR A;  3FIL B;  4JL9 A;  1N62 A;  3ALB A;  1QOF A;  1TS5 A;  1YN3 A;  2B3A A;  1UNS A;  1TGZ B;  3SFD B;  2MRP A;  4M02 A;  2Z0D B;  2YEP F;  2DZK A;  1I4H A;  1WJU A;  1EU3 A;  1FPY A;  1TIF A;  4JGH B;  1YX5 B;  2H88 B;  2PJH A;  4A3O A;  2IBI B;  2FCQ A;  2V1Y A;  1WR6 E;  3TL5 A;  1Q1O A;  2N9E B;  4AUQ C;  2RR9 A;  1WXQ A;  5J18 A;  3DBL B;  2FNJ B;  4C4V B;  5IOI A;  4ICU A;  2FCS A;  3PO0 A;  2NBV B;  1UF0 A;  2MHJ A;  3U8Z A;  1IBX A;  2NPT A;  2KHW B;  4IC7 B;  3M63 B;  1FCL A;  2I38 A;  1QKZ A;  3KUZ A;  4HKZ E;  4EZL A;  1XO3 A;  4XE0 A;  3VRA B;  5KHO A;  4XZ4 A;  2KDF B;  1K53 A;  4RGM A;  1V8C A;  2WQY B;  2Q5W D;  4PYU A;  4EZJ A;  3BK1 A;  4KV2 A;  3HVZ A;  3Q3O C;  3VUW A;  2WLB A;  2QMT A;  5BYR A;  3ZNG C;  1I4G A;  1Y8R C;  4GSW A;  2HD5 B;  3GE8 C;  2L05 A;  1VRA B;  2D3C A;  4K7S A;  2WXO A;  3L0W B;  4TV3 A;  1JWB D;  1K51 A;  2YLM A;  4ZRI A;  4A3P A;  2IGG A;  3VQI A;  2G9H D;  2IGD A;  2WXM A;  3EUB 2;  3AEC B;  4GIV A;  3RD2 A;  4NJ6 A;  1JRO A;  4RNA A;  3RN9 C;  1YJI A;  2C9W B;  2RDB C;  3AE4 B;  1DYQ A;  3QIJ A;  2LGD A;  3IHP C;  1T3Q A;  1FFU A;  2ZNV C;  3LDZ E;  1GNU A;  1VJK A;  4NZL B;  1OQR A;  4KGS A;  4CHK A;  2BB5 A;  1WX9 A;  4C00 A;  2D2Q A;  2KTF A;  1JCK B;  3Q8F A;  3KYC D;  2PMV A;  4P16 A;  3BVG A;  4HJG E;  1JRU A;  4IOI E;  2NVU I;  3ZIM A;  2ZNV B;  4W9C A;  3L10 B;  4A90 A;  5FR3 A;  4Q2J A;  3UIN B;  3AE7 B;  3Q3M C;  1SEB D;  4BOS C;  4NAM A;  1LXD A;  3Q6B A;  1WIA A;  3A9K A;  2IO1 B;  1VZ8 A;  3DWM A;  1F2R C;  3IFW B;  4LNK A;  3I3T B;  4AJW A;  5IA7 A;  1NVI D;  2WNM A;  5L95 C;  3LXF A;  1ENF A;  4RCO A;  3GP7 A;  4W9I A;  5HI1 A;  2MA9 B;  2BB6 A;  1F52 A;  3M3J A;  4RGT A;  5DPT A;  5AZG A;  3URY A;  3PS6 A;  3RNB C;  2M56 B;  4DXF A;  3ZDT A;  2LFI A;  2INN E;  4M00 A;  1V80 A;  1N5X A;  3O65 B;  1WX7 A;  1AAR A;  4J3O D;  3NZS A;  2REX A;  3B2G A;  1ZXI A;  5AZF A;  5C1Z A;  4RFB A;  3AB5 A;  3A33 B;  3CWI A;  1V81 A;  1WH3 A;  1TY0 A;  1T0S C;  4XC2 A;  3ZNH B;  4DK5 A;  3NOB A;  2KTR B;  3QAR A;  2L7R A;  1KM7 A;  4CO7 A;  1MHX A;  4C80 A;  2V9H A;  2NCN A;  1UGJ A;  2LXA A;  2KQ4 X;  3U7D A;  2KN5 A;  2ON8 A;  3PHX B;  1WF9 A;  2JXT A;  2G4D B;  1JQ4 A;  2DNF A;  2KJH B;  4KVG B;  2KJR A;  4LNF A;  1NEN B;  1HZ5 A;  3J9C A;  3Q3F A;  4W9K A;  3TEY A;  3GOE A;  2QCZ A;  2QSD A;  4AOF A;  4ANX A;  3W5V B;  3ZDM C;  3R3M A;  3UQB A;  2O6V A;  5C23 A;  4MH0 E;  1D5M C;  2W9N A;  2JRI B;  1R7S A;  2ONQ A;  3ZRF A;  3R7Q A;  4G11 A;  4IM3 A;  3PHW B;  1OEY J;  4OVU A;  3NVV A;  4ZOH C;  4DBG A;  4PT5 A;  1NBF C;  2KAN A;  1C78 A;  3WCQ A;  3RNA C;  4AQ7 A;  2ASQ A;  1YN4 A;  3WAO A;  1TYG B;  2JZ3 B;  3EC8 A;  3W1S C;  3A1Q B;  3RZF A;  2CJN A;  3LYY A;  4L23 A;  1CZP A;  3JW0 X;  2PVO D;  3CSF A;  1NI2 A;  3AM9 A;  4ANV A;  1YIW A;  2BQQ A;  1PGA A;  4R3D A;  2N1V A;  1SSN A;  2WXN A;  4OZC A;  3RNF C;  5HG2 A;  2CJO A;  4GXB A;  3GS2 A;  1FD6 A;  1C77 A;  3A4R A;  5D2M B;  2KMA A;  2ZVN A;  3ZQ4 A;  1CMX B;  5E6O A;  1XCT L;  4LK0 M;  2GOW A;  2PE6 B;  2EKE C;  2LUM A;  3TEX A;  4LJO B;  4DXA B;  4GDK B;  3SHQ A;  1C9F A;  2J0K A;  1L6U A;  1L0X B;  2BS3 B;  5HKH A;  2J42 A;  3EFC A;  2O2V A;  1IPG A;  2R2Q A;  2V3P A;  3VTU A;  4BBN C;  2N1W A;  4RH6 A;  2MJE A;  4KIK A;  1T6B X;  2G45 B;  2DBY A;  5LXI B;  2IY1 B;  4AP4 C;  2KMM A;  4BZA A;  1P1A A;  1QF6 A;  4K81 A;  1I4X A;  2DZI A;  2QIE B;  3H6N A;  4WWO A;  2L1A A;  5FR6 A;  1F9J A;  2I1K A;  3V3X A;  2DX5 B;  1WRD B;  1YN5 A;  4YXD B;  2GBK A;  2E3T A;  1M4V A; 
#chains in the Genus database with same CATH homology
 2LI5 A;  3A1Q A;  3ZRC A;  4IW0 A;  2DZJ A;  4G3X B;  3ZNZ B;  4EEW A;  1VCB A;  3DBS A;  2BKR B;  5EDS A;  2KOX A;  3QQ8 B;  4EFO A;  2V4L A;  3PSE B;  2LUE A;  5E6P A;  3DBH I;  4N9F 4;  3ZKJ C;  1IP9 A;  2O2V B;  5CHW A;  2AL6 A;  3SU8 X;  1E8Y A;  3T9L A;  2MLB A;  3HHM A;  3K9P B;  2C60 A;  3PRE A;  4DDI D;  4FBJ B;  1GG3 A;  4DHJ D;  3H9D A;  1UD7 A;  1WJ6 A;  4KIK B;  1YX6 B;  2K8C A;  4FJY A;  2ZCC A;  1SIF A;  3DQV A;  3ZUN A;  5BO4 B;  1EUV B;  2NR2 A;  3N30 A;  1XD3 B;  2KDB A;  2KLG A;  3W1S A;  4FHJ A;  2XK5 A;  2LD9 A;  4B6W A;  4BKS D;  3P2B A;  3ECI A;  3H7S A;  4BOZ B;  2KWU B;  1A5R A;  2K1F A;  2N7E A;  1KLV A;  2K6D B;  4E71 A;  3B08 A;  3UGB B;  2IYD B;  3APF A;  1I35 A;  3AU4 A;  3JSV B;  3BY4 B;  5G2N A;  1H8C A;  4BKS A;  3AI5 A;  3L54 A;  4E3C A;  4W9F A;  5L83 A;  1R4N I;  5J17 A;  3DCG A;  2K6Q A;  1J0G A;  3RCZ A;  2HTH A;  4IUM B;  1G6J A;  2Z59 B;  3QCA A;  4HXD A;  3TIX A;  3VTW A;  2AWT A;  2RPQ A;  4FLH A;  3VH3 B;  2A4Z A;  1FXT B;  2EMT A;  2LAS A;  4MJS A;  2KJ6 A;  3APD A;  3CST A;  1R4M I;  2NS5 A;  1C3T A;  3VVW B;  4ANU A;  3JYU A;  2C7M B;  1L7Y A;  1RAX A;  4HLE A;  2L0F A;  3KW5 B;  2DYM A;  1T0Y A;  4TQ0 A;  4MDK E;  2HJ8 A;  1P0R A;  2WX0 A;  2KDI A;  2WYQ A;  2J7Q B;  1WGR A;  4DHZ E;  1H4R A;  2IY0 B;  4JL9 A;  1EF5 A;  1WXV A;  4GGQ A;  3VAW A;  4OVV A;  3RYT A;  3ALB A;  2RSU A;  2RD0 A;  3GZN I;  2B3A A;  2KLC A;  1TGZ B;  2FCM A;  2GMI C;  2JPH A;  2MRP A;  2Z0D B;  2ZZP B;  4MSQ B;  1TBE A;  1WX8 A;  2DZK A;  4LDT B;  5G55 A;  1WJU A;  4TKN A;  1WZ0 A;  2JF5 A;  2XK5 B;  4JGH B;  1YX5 B;  1OQY A;  3N3K B;  2D07 B;  2PJH A;  4HCN B;  4A3O A;  1UBQ A;  1RFA A;  2IBI B;  2FCQ A;  2WX1 A;  2KC1 A;  3H1U A;  3L08 A;  4I6N B;  4GDL A;  2M0X A;  5CHF A;  2V1Y A;  3UF8 A;  3WAM A;  4WJQ A;  1P3Q U;  3PRM B;  3VUY A;  2LWP A;  1WR6 E;  2C7N B;  3TL5 A;  1Q1O A;  3SD5 A;  2N9P C;  3ZNI D;  2A5U A;  2MBB B;  2MW5 A;  2N9E B;  4ZRK A;  3QX1 A;  2KX3 A;  3QHT A;  4P7I A;  5TR5 A;  2RR9 A;  4M0W B;  4NY0 A;  4AUQ C;  5J18 A;  2KKC A;  3DDC B;  4LCD E;  1J19 A;  2FNJ B;  3HM6 X;  4DDG D;  4MJS B;  3MJW A;  4ZRJ A;  1UZX B;  4IG7 B;  4HDO A;  4HK2 A;  4ICU A;  2FCS A;  1V5T A;  2BGF A;  4BKT A;  2VRR B;  2NBV B;  2JVC A;  2L76 A;  3U8Z A;  3DBL I;  2CHX A;  2KHW B;  2NPT A;  3W1Y A;  2L3Z A;  3OJ4 B;  1E5W A;  2XBB C;  4IC7 B;  2KK8 A;  3M63 B;  1GC7 A;  4G0N B;  4W9D A;  3WIM A;  4URK A;  2CHW A;  3C0R B;  4HPM B;  3B0A A;  3KUZ A;  2J0J A;  4EZL A;  2D10 A;  3KUC B;  2GBM A;  3H7P B;  2MBE A;  3D32 A;  2BYV E;  5KHO A;  4XZ4 A;  2M1M A;  3KH0 A;  2L0T A;  4J6I A;  2KDF B;  5J2R A;  3A9K B;  1NDD A;  4K7U A;  1ZW7 A;  3TBL D;  2DYO A;  3PVL A;  3HM3 A;  1HE8 A;  3WAN A;  4PYU A;  3VFK A;  2N7D A;  1Z2M A;  4EZJ A;  2MQJ A;  4GOC A;  2OJR A;  4KV2 A;  4ASW C;  2KNB A;  5AZH A;  3VUW A;  1QZE A;  2K8H A;  2K39 A;  4I6P A;  3QA8 A;  3ZNG C;  1Y8R C;  2BKF A;  3A9J A;  4MEM A;  4GSW A;  2HD5 B;  3HIZ A;  4II2 B;  2AYO B;  2GBR A;  4MGZ E;  2L05 A;  4K7S A;  2NPT B;  3M95 A;  3L0W B;  4IWP A;  4TV3 A;  2DAF A;  2LGX A;  2YLM A;  4LDT D;  4ZRI A;  4A3P A;  3X0W A;  3VQI A;  1ZKH A;  5AEK B;  2G3Q B;  3UIP B;  4MSM B;  4GIV A;  3RD2 A;  2ZCB A;  4NJ6 A;  1GJZ A;  4F7Z A;  2JWZ A;  1WY8 A;  2BF8 B;  3DBR I;  4CYE A;  4WJP A;  5CX3 A;  3MTN B;  2C9W B;  3APC A;  3IG3 A;  2M4N A;  2PE9 A;  3WAP A;  2CKH B;  1WI0 A;  3AXC A;  3QIJ A;  1XT9 B;  3L13 A;  2LGD A;  3VTV A;  3PLU A;  4RM8 A;  3IHP C;  4MEL A;  1WE6 A;  2MSE D;  3LDZ E;  2LRW A;  2ZNV C;  1GNU A;  1YJ1 A;  1L2N A;  2M17 A;  4CHK A;  4YL8 A;  1Q0W B;  1WGY A;  1WX9 A;  4RM9 A;  2FID A;  3ZTD A;  3PGE A;  4BBN F;  2KVR A;  5DPW A;  2D2Q A;  4WWP A;  1LQB A;  2KTF A;  3KYC D;  2IO0 B;  3IVF A;  3A9J B;  1UGM A;  1E7U A;  3ZO5 B;  2V3S A;  2ZPY A;  3QJZ A;  1JRU A;  3OJ3 A;  4B95 A;  2MBH A;  4JQW C;  1SE9 A;  4FN2 A;  3QC8 B;  2MP2 A;  1ISN A;  1EF1 A;  2R2O A;  2NVU I;  3ZIM A;  3ONS A;  2M8S A;  2ZNV B;  4W9C A;  3L10 B;  4BVU C;  5LXH A;  1WFY A;  3UIN B;  4TUU A;  3VXW A;  4BOS C;  3H7P A;  4NQK E;  1LXD A;  5D6J B;  1UEL A;  3JVZ X;  1WIA A;  2CS4 A;  2BPS A;  4WWN A;  4PS7 A;  1SGH A;  3A9K A;  4ANW A;  1E90 A;  2IO1 B;  2PEA A;  3QK0 A;  4FUL A;  2O6V B;  4M8M A;  4WQO B;  3IFW B;  3PRZ A;  1WJ4 A;  2AL3 A;  3I3T B;  2IO3 B;  2Z0E B;  3VUX A;  4AJW A;  2YVC A;  2JXX A;  5IA7 A;  5L95 C;  2LVP A;  2N4F A;  4GU2 A;  3DVN V;  1C1Y B;  4W9I A;  2MA9 B;  5LLI A;  2JRH A;  4HWI B;  3M3J A;  3PRP B;  5DPT A;  5AZG A;  3TCA A;  4IM2 A;  4EZK A;  4EUT A;  4NJ7 A;  1D3Z A;  1RRB A;  1X1M A;  2EMS A;  3PS6 A;  2PPH A;  3ZDT A;  3L16 A;  2KMC A;  1WMH A;  4FAD A;  1V80 A;  3ZVV A;  2MP2 B;  3A4S C;  4NAW B;  3ZLZ A;  2ZVO A;  3O65 B;  1V9J A;  3N32 A;  4FA6 A;  2G4S A;  1UH6 A;  4E74 A;  1WX7 A;  3PLV A;  4I6L B;  1E7V A;  1YQB A;  3DPD A;  1RLF A;  1AAR A;  3X23 A;  3T8M A;  3NZS A;  1EO6 A;  1U4A A;  2REX A;  4JIO U;  5AZF A;  1TTN A;  5C1Z A;  1PQS A;  2MCN B;  1V86 A;  3A33 B;  1WR1 A;  4DHZ B;  4EOY A;  1V81 A;  4F8C B;  1WH3 A;  2AEH A;  4GN1 A;  4XC2 A;  3V61 A;  2K25 A;  3ZNH B;  1E8Z A;  5IAA C;  2KWC A;  2N9X A;  3R66 C;  4TQ1 A;  4DK5 A;  3NOB A;  2L00 B;  1E8W A;  2KTR B;  4EKU A;  4K1R B;  3DVG Y;  3OLM D;  3EFU A;  4W9L A;  2GBJ A;  3QAR A;  3TJP A;  2L7R A;  2ZJD A;  2L8J A;  4WJN A;  1KM7 A;  4CO7 A;  3K9O B;  3BIN A;  3NS8 A;  2UYZ B;  3ENE A;  2NCN A;  2LXA A;  1IYF A;  2DZM A;  2HE7 A;  2WWZ A;  3U7D A;  2KN5 A;  4HDQ A;  2KC2 A;  3PHX B;  3V60 A;  2NBU A;  1WF9 A;  2ZPN A;  4PYZ A;  1K8R B;  4ZDV A;  5JH5 C;  1WZ3 A;  2G4D B;  1WMH B;  4M8N A;  1YD8 U;  3L17 A;  2KJH B;  4KVG B;  2KJR A;  4BFR A;  3LJ3 A;  4WAA A;  3RT3 B;  2MWS B;  3U30 A;  2CHZ A;  3Q3F A;  1S3S G;  2DAJ A;  4W9K A;  2LJ5 A;  3GOE A;  2DHZ A;  2O6V D;  1WXM A;  2WDT B;  2KO3 A;  4W9H A;  2LVQ A;  1V2Y A;  2CR5 A;  2JY6 A;  1Z5S B;  2XEW A;  2JUO A;  4AOF A;  2DEN B;  5D7G A;  5CHV C;  4ICV A;  4KZC A;  1V5O A;  4PS8 A;  1BT0 A;  2MBQ A;  2LGY A;  3R3M A;  3ZDM C;  2O6V A;  3UQB A;  4W9J A;  5C23 A;  3KUD B;  4FHK A;  4MM3 A;  4MH0 E;  4A20 A;  2W9N A;  3RZW C;  2JRI B;  1GUA B;  1WM3 A;  3ZTC A;  1ZGU B;  2CU1 A;  3ZRF A;  1P98 A;  3IBE A;  2ZEQ A;  4W9G A;  3R7Q A;  2FAZ A;  1WGD A;  3EEC A;  2OOB B;  4G11 A;  4IM3 A;  1GC6 A;  3Q3J A;  4PS3 A;  3PHW B;  4KSL C;  1OEY J;  4OVU A;  3AU5 A;  4IM0 A;  2D11 A;  5DPR A;  4ANX A;  3PPA A;  4DBG A;  3NY5 A;  3PTF C;  4K7W A;  3ZW3 A;  1NBF C;  2BYE A;  3KYD D;  2KAN A;  3V62 A;  2KFK B;  4NAW A;  2ASQ A;  3EHV A;  2D3G A;  4LJP B;  3WAO A;  2JZ3 B;  1OEY A;  3EC8 A;  2UWQ A;  3W1S C;  4IWQ A;  4HJK A;  3A1Q B;  3ML9 A;  3RZF A;  4HVB A;  2C7H A;  2MBO A;  5CTR C;  2MX2 A;  3SDL C;  1P9D U;  4GDK A;  3RUI B;  3PZD A;  1WGH A;  3JW0 X;  3CSF A;  2KZR A;  1NI2 A;  2JT4 B;  3M62 B;  1V49 A;  4KSK C;  4RMA A;  4ANV A;  1YIW A;  3B1L X;  1E8X A;  1V6E A;  4HCP B;  1WE7 A;  2C5L C;  1LM8 B;  2IO2 B;  5JZE B;  2KTR A;  3V6E B;  2J0M A;  4KDL B;  2KD0 A;  1KOT A;  2N1V A;  5KHQ A;  3R7R A;  4IWO A;  2KQ7 A;  1WGG A;  4WJO A;  4DHJ B;  2FIF A;  4ZYN A;  4GXB A;  2LVO A;  1LFD A;  2KDE B;  3A4R A;  2KXJ A;  5D2M B;  2KMA A;  4NNJ B;  2ZVN A;  1VD2 A;  3AUL A;  3QWZ B;  4FJV B;  2I1J A;  3RUL A;  4G50 A;  1KJT A;  3DVN U;  3WA0 A;  1CMX B;  2BYF A;  3UIO B;  5E6O A;  3VDZ A;  2FUH B;  3OAW A;  4GMV A;  3HK0 A;  2NBW B;  1J8C A;  4X57 B;  1WJN A;  2QHO A;  1WYW B;  3WAL A;  2GOW A;  2PE6 B;  2EKE C;  4II3 B;  3V6C B;  4LJO B;  4DXA B;  1WXS A;  2KQS A;  2LXC A;  2Y5B B;  4GDK B;  2FCN A;  3SHQ A;  2LZ6 A;  4AJY B;  4XX5 A;  2J0K A;  3CF6 E;  5DPS A;  5JHA A;  4B9K A;  5HKH A;  2O2V A;  1IPG A;  2R2Q A;  4DWF A;  3VTU A;  4BBN C;  4GB9 A;  3UQA A;  2KFJ A;  3KVF B;  1XQQ A;  2K8B A;  2N1W A;  4KIK A;  3CMM B;  4MGK E;  2G45 B;  5DCN A;  1WM2 A;  1TZ1 A;  3S2A A;  4F1S A;  1UBI A;  3DOW A;  4FJZ A;  1I42 A;  5LXI B;  4W9E A;  4BKG A;  2IY1 B;  4AP4 C;  3VH4 B;  2DYB A;  3NHE B;  3VHT C;  5E6N A;  4KZ0 A;  2KX0 A;  4MGY E;  1P1A A;  3MHS D;  4HPL B;  3DVG X;  2JZZ A;  3ML8 A;  4K81 A;  4GDL B;  4AWJ A;  4MGI E;  4NQL B;  1Q5W B;  4KDI C;  5D94 A;  2BWE S;  5JHB A;  1MG8 A;  3JSV A;  2DZI A;  4NPN A;  3H6N A;  1S1Q B;  4JLC A;  1OTR B;  1WXA A;  2KWV B;  2LRU A;  4WWO A;  5FR6 A;  1OGW A;  3PT2 B;  2IZV B;  1F9J A;  2I1K A;  1M94 A;  2KFK A;  3NZU A;  2DX5 B;  1WRD B;  3PV1 A;  3TMP B;  2GBN A;  5GMV A;  2RGF A;  2GBK A;  2BWF A;  3QAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...