2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
b'MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
1CJEA 3AE1B 1N61A 3HRDD 4USAA 2WDQB 3AECB 3SFDB 2K22A 2MJEA 2H89B 1QOGA 1XLOA 2W54A 3KWLA 4WQMA 1YJIA 2AX5A 4ZHPA 1KRHA 1NYRA 1TKYA 3NVZA 3W5UB 1VLBA 5EE0A 1GT8A 1OQRA 3SR6A 2WQYB 5H8YE 2M56B 2CJNA 2K9XA 3ZYYX 2KAJA 3CIRB 2PVGC 3B9JA 3CWIA 1WRIA 1FMAD 3ABVB 1SB3C 4HROA 1GAQB 3VRAB 2EKIA 3ETRA 1OQQA 3RPFC 1H7XA 3AEBB 4YTMB 3VR8B 1A70A 2W3RA 2BS2B 3P63A 5EE3A 4N6EB 1AWDA 3FAHA 3NVVA 2N0SB 3AEEB 3VRBB 2PKOA 3B2GA 3SFEB 3FC4A 5C2TB 4KX6B 1WYGA 4YT0B 2JX5A 4ZOHC 2G1EA 1FIQA 1I7HA 1XLQA 5AUKA 5H92C 1N60A 4WWMA 2WP9B 2FBWB 3AE7B 5AUIA 4YSYB 1E6EB 1FXAA 2WU5B 2WLBA 4US8A 1E7PB 5EE9A 3AE2B 1DGJA 1RWSA 3AEAB 1ZUD2 2Y5CA 3L4PA 1GTHA 1YQ3B 2WDRB 1IUEA 1L6UA 3AE8B 1N5WA 1NI3A 1NVID 3CF4A 1R7SA 1VDVA 1JWBD 2K5PA 2MJ3A 1L6VA 3EUB2 4P6VF 1FXIA 2ACZB 1GTEA 2MJDA 4ZHOA 1PDXA 3AE4B 1KF6B 1J7BA 3DWGC 1OFFA 1JQ4A 2WU2B 2L83A 3AB5A 2WDVB 5C3JB 3NVWA 5MPOA 1NEKB 3P4QB 1F0ZA 1J7AA 4JX1C 4A9AA 3HUIA 1NENB 1UWMA 1V97A 1YQ4B 1QOFA 2QJLA 2L52A 3DWMA 2BS3B 1PFDA 2W3SA 3BIID 4C7YA 1ZP0B 1TKGA 3AE9B 1J7CA 1ROEA 1XLNA 2CJOA 4IDIA 2QIEB 2W55A 1FM0D 3P4PB 2E3TA 2PIAA 4JWSC 4ITKA 1QF6A 1SIJA 1XO3A 4YTPB 1QOBA 4JWUC 4YXDB 2MH7A 1NYQA 1EWYC 1E0ZA 1QT9A 1TJEA 1FO4A 1TKEA 2Q5WD 2KMMA 3AE6B 4US9A 1PUTA 1WGKA 3W5VB 3P4SB 5EE1A 4C80A 3AN1A 1E9MA 1ZOYB 4N59A 1V8CA 3VR9B 1FFUA 2JQRB 4C7ZA 1JALA 2M19A 1QLBB 1RM6C 1WWTA 1KFYB 2B76B 1FFVA 2PVOD 1RYJA 1N5XA 1ZXIA 3B2FA 3NRZA 1JWAD 3PO0A 1E10A 2CU3A 1JROA 3HVZA 1N63A 3W9CB 1FRRA 3AEGB 1DOIA 1L0VB 1RFKA 3P4RB 2BS4B 2WS3B 3AE5B 2BT6A 1DOXA 3AV8A 1SF0A 1DOYA 1JRPA 5G5HA 2DBYA 1AYFA 3NS1A 4YTNB 3AE3B 2DWQA 1CZPA 3AM9A 1VJKA 5GXGB 2LEKA 4YSXB 2HTME 1TYGB 4YSZB 1YJJA 3AH7A 1T3QA 3LXFA 2H88B 1FRDA 4HRSA 1QOAA 1H7WA 1WXQA 3AMZA 4FXCA 3AEDB 1XLPA 3WCQA 1GPXA 3LB8C 4N58A 2OHFA 5G5GA 3AEFB 3P1MA 1JW9D 1B9RA 1L5PA 3NVYA 1N62A 4LTUA
chains in the Genus database with same CATH superfamily
1FNUA 3PHWB 2W82A 3DHHC 2BVCA 3A1QA 1VLBA 2J0KA 4OVZA 1TT5B 2MSED 3ETRA 3RPFC 4ACFA 3QAQA 5KHOA 2N7DA 4IC7B 4WH4A 4BKTA 4NPNA 3NJTA 4YSYB 2J53A 3AE2B 1RWSA 4LNNA 1WY8A 5HI1A 4HPLB 1NI3A 1H4RA 1V1PA 1TGZB 1L0YB 2VZKB 2V9HA 2KC2A 2MBEA 1XEEA 4ZRKA 1R4NI 2DZJA 5JXVA 1NENB 3Q8BA 5BMHA 3BIID 3GE3C 1GC7A 4FJYA 4M8MA 4W9DA 4C7YA 1EU3A 2W55A 2D07B 2E3TA 4JWSC 4A3OA 3KWVA 4EZLA 4A3PA 4RNAA 4IWOA 3RZFA 1WE6A 3HIZA 1L7YA 3P4SB 4XWTA 1SE4A 4NJ7A 2JF5A 4MH0E 2ZZPB 3NRZA 1WH3A 3QWZB 2WX1A 1RFAA 2LMCA 2KJRA 3KW5B 4XWWA 1YX6B 1CZPA 2KOXA 1L4ZB 1C4AA 4P7IA 3IXSA 4EKUA 1PGBA 2NS5A 2M0XA 3RYTA 1UWXA 4PYUA 3VTWA 3HHMA 2N9EB 5IAAC 1C4CA 2MJEA 3KYDD 3I63C 2DLBA 2FE8A 1WRIA 4E71A 1OQQA 1IBXA 1FNWA 2NPTA 1NI2A 3U52E 5L83A 1FIQA 4GIVA 2WU5B 2INCC 2OEDA 3AU4A 1WGRA 2FUHB 4KIKB 2WXRA 3Q2AC 4HCNB 1GB4A 3R7QA 4JL9A 2ACZB 3UQBA 2KWDA 2MJDA 3W1SC 1MHXA 2WDVB 5C3JB 4RGNA 4JX1C 3DWMA 2KQ4X 2VH2A 4WWOA 2V0GA 2JYTA 1F2RC 2IDYA 1R4NB 1WXAA 3N30A 2MBHA 5BO4B 2ZNVC 3AE6B 1PUTA 3RT3B 1JALA 2DHZA 1TTNA 1Y8RC 3B2FA 2J52A 4BOSC 3AULA 4XGAB 3S2AA 3M95A 4NAMA 4FHJA 1VCBA 3A1QB 1GB1A 1GUAB 1Q0WB 3O13A 2L76A 5GXGB 3A33B 3T8MA 4B0MA 5TR5A 4CHKA 2G9HD 2IY0B 3Q6BA 3IT6B 1I4HA 2L0TA 1MG8A 3ZJVA 3PTFC 5IKCM 2PW9A 4NZLB 1N61A 3VUXA 4ARCA 1IPGA 4NAWA 3VAWA 3JSVA 5EE0A 4AP4C 2KAJA 4UDUC 3APDA 2LGIA 1V1PB 2OOBB 1UGJA 3L17A 4P1CC 3QJZA 3R8BA 2PKOA 2G1EA 5AUKA 1V49A 4KDIC 2KQSA 2X8XX 2K5PA 3T3NA 2QC8A 4G3XB 2CHWA 3I57A 3ONSA 2PE6B 3ZVVA 1EF5A 2O2VA 1I4PA 2K8HA 4MJSA 5MPOA 1F0ZA 5IP4D 1LGRA 2BYVE 2MP2B 1T0YA 1BXTA 2QJLA 1PFDA 2QDFA 1OEYJ 1KJTA 1FCCC 4ZYNA 1TJEA 4WJOA 2LWPA 3IG3A 2XK5A 4KZCA 5EE1A 2RDBC 1J8CA 2PJHA 3WAMA 3PO0A 1K52A 1JROA 2LVPA 3Q69A 4YL8A 1MPEA 2JZZA 2NBUA 3IAS1 2KNBA 1ZDVA 2I1KA 3LXFA 1FRDA 2LGXA 4IWPA 3NZ3A 3BK1A 1IBXB 2NPTB 2Z59B 4RM9A 3HM6X 2GBRA 2HE7A 2LASA 4L2YA 4C56C 4B95A 3U2SC 5JH5C 1ENFA 2W54A 1WJNA 2YEPF 4JGHB 3U30A 3UF8A 1E90A 1ZGUB 4GDLA 1SB3C 1GOZA 3A4RA 3RULA 4BAXA 3T3OA 1AWDA 4FJZA 1TIFA 4KZ0A 4WIPA 1N60A 4LNKA 2AWTA 2QMTA 1FXAA 1WM3A 2V3NA 3L4PA 1GTHA 4NJ6A 2N1VA 2N7EA 3VFKA 3KYCD 2N1WA 5BYSA 2QSDA 4RGOS 3DWGC 4AUQC 2JVCA 3NVWA 1J7AA 1KM7A 4B6WA 4K7UA 3BWUD 1C1YB 1I4GA 4IM3A 2BGFA 4C4VA 2WXQA 4K81A 2DYOA 2GRIA 4XE0A 4GMVA 3AN1A 2DYBA 4HKZE 4FN2A 3NZSA 2ZJDA 3N3KB 4WAAA 1VZ8A 3LJ3A 2MWSB 3A9JA 2TSSA 3HM3A 4DDGD 3SEBA 2J7QB 4GOCA 3QHTA 4IW0A 4ZRPA 4NAWB 4WQOB 3JSVB 2I38A 1SE2A 4WAFA 1P98A 3AMZA 3DVGY 1XF5L 4N58A 2V4LA 2BTEA 3PRMB 3WALA 2KK8A 3PT2B 4LCDE 5H8YE 3UIOB 5IO9A 2AQ1B 5HFYA 1V9JA 2L00B 5AEKB 1P7FA 3N1YC 4HJKA 3DDCB 5C2TB 1KLVA 1TZOA 2O2VB 4MJSB 2WLBA 3V61A 2CHXA 2ICIA 3AEAB 5E6OA 5D3DA 4ANXA 4MT5A 1EWCA 3PZ7A 3DHGC 1WE7A 3ZKJC 1CK1A 3U8ZA 2KDIA 1WI0A 4RMAA 2L83A 5HHDG 3L10B 2V3PA 2JWUA 1XCQL 3PGEA 1ZP0B 3JVZX 3Q8CA 2PIAA 5J2RA 4CQNA 1QF6A 2KTRB 4JWUC 3W1YA 1SJED 1JWMD 3MC8A 1TKEA 2NBWB 1V1OA 1BUIC 5BYQA 3OWEB 4NQKE 2AQ2B 4MSMB 2AL6A 2FUG1 3TEYA 4F7ZA 5LNK1 1N63A 4KIKA 1WR6E 1QILA 4E74A 5T8IA 4EE2A 2JY6A 1JRPA 2KMCA 2LGSA 2RSUA 3BZDB 5G55A 1QZEA 2HTME 3QK0A 5LLIA 3KH0A 2GMIC 2MCNB 4BBNF 1I35A 1WGHA 2N9KA 2LJIA 3AE1B 3EC8A 2CU1A 2GB1A 2KYWA 2D3GA 1QOGA 1YOVB 1P1AA 2KLCA 4QAYA 5AZHA 2K6QA 2X38A 4NY0A 1IYFA 5D3IB 1ESFA 1HEZE 3RMKC 3VR8B 1L4DB 4GLSC 1J19A 2GLSA 2KFKB 3U7ZA 3SFEB 1WYGA 3GOEA 2JT4B 2KJHB 3H8HA 4BKSA 3RZWC 4LDTD 3L16A 4W9EA 1R7SA 4TSSA 1UUPA 1AARA 2L7RA 1Q10A 4HEA1 4TQ1A 1C4PA 2N7JA 3R3MA 2C60A 1YQBA 4HJGE 4C4VB 4EEWA 2R2OA 2WU2B 2KLGA 1UH6A 4K3CA 1UWMA 1YQ4B 1P7EA 4W9HA 1XT9B 3AE9B 1J7CA 2KTFA 3RN9C 3A9JB 3P4PB 1C79A 4YXDB 1UF0A 2UU7A 4FLHA 2O6VA 2WXOA 2KMMA 1FFUA 3V60A 2PVOD 5KHQA 4DWFA 3VHTC 1MG4A 2N4FA 3IFWB 1DOIA 2WS3B 4MH8A 1DOYA 3DVNU 4TKNA 4YTNB 3PRZA 2MA9B 1X1MA 1GNUA 1CQVA 3PLUA 2MP2A 4PS3A 2E6XA 4KV2A 4ZDVA 1WFYA 3PZDA 2H89B 3KWLA 1XLOA 2M0AA 4AWJA 2AX5A 4REZA 1BT0A 4PK1A 1ZW7A 1GT8A 1HTQA 3Q8EA 4ARIA 4D2KA 4MEMA 2QEJC 1HTOA 1VR9A 1WRDB 4WJNA 4KX6B 1XLQA 2DENB 2DX5B 1XQQA 2ONQA 2FAZA 3B08A 3PHXB 1P0RA 3IT4B 4C00A 5J18A 2LUEA 1M4VA 3BVZA 3SHQA 3U7DA 4M02A 1RRBA 5BMIA 3TJPA 2DNFA 1WJ6A 5CHWA 1YN4A 2PMVA 1F77A 2RD0A 3IVFA 1XLNA 3C0RB 4EZJA 2IGHA 3RNFC 1XO3A 4GB9A 4YTPB 4JPSA 1TZ1A 2MH7A 1NYQA 5JZEB 3QIJA 3TUOA 1M94A 1FO4A 2Q5WD 5JHAA 1JRUA 3AI5A 4JE3B 2JZPA 4LK0M 4ANWA 4CO7A 1LFDA 3Q3NC 3VH4B 1VZ6A 2B76B 1RYJA 1FCLA 2Y5BB 2NMQA 3RNBC 3MJWA 5DPWA 3QA8A 1DOXA 1DYQA 1A5RA 2WXJA 4ICVA 2UYZB 3DOWA 4IG7B 2BB6A 3KUZA 4YSZB 4GXBA 1ZE3D 1TY2A 2M1MA 1WJUA 4HKQA 2K6DB 3P1MA 4AQ7A 3NVYA 2WDQB 1OQYA 3M63B 1D5ZC 1XD3B 2ZCCA 2D2QA 5AZFA 2KDEB 4ICUA 5CHFA 4BZAA 3ECIA 3SR6A 2M56B 4OVUA 3OG5A 4DXFA 5FR3A 2IZVB 5E6NA 2K0PA 4GN1A 4XZ4A 3Q3JA 4GDKA 1GG3A 1KTKA 4GGQA 5H92C 2INDC 2WHIA 4DHJD 5DPSA 1L2NA 3ZXRA 2W9NA 1NVID 5C23A 1VDVA 3K9PB 1F1HA 1T0RC 3ALBA 2N9XA 3ZRFA 1ACCA 1HA5A 3V3XA 3WA0A 2MEKA 2DZKA 1GTEA 4MGZE 4ZHOA 4J3OD 2MBBB 2G3QB 1V5TA 2O6VB 2MX2A 2WYQA 3ZJTA 4MDKE 3H6NA 4IUMB 3A4SC 2MBQA 4OZBA 4DBGA 2YLMA 2IJ0A 1E8YA 2IBIB 2IO3B 3GE8C 3FKYA 1Z5SB 2M4NA 1U4AA 4JIOU 4B9KA 1QT9A 3Q3MC 4RGMA 5E6PA 3UIPB 4OVVA 2BW2A 3DBHI 3W5VB 2JXXA 1ZOYB 4HPPA 4IOIE 2VZKD 3BY4B 1KFYB 1YMHE 3ZXVA 3ZJUA 4BKGA 2FCSA 1YD8U 1IP9A 4PS8A 3MFGA 3P4RB 4K7SA 3AE5B 2KVRA 2KQ7A 5G5HA 1AYFA 2XBBC 3L13A 2FIDA 2NBVB 4KGRA 2SAKA 2OJWA 1TYGB 3I9V1 1YJJA 5JHBA 2G45B 1L5PA 5EDSA 1PQSA 4JQWC 2KTRA 1HQRD 3QC8B 4HCPB 2NCNA 3QQ8B 3BVMA 2WGSA 1ZPSA 2L32A 1WXMA 3NUHB 2Y5PA 2EKEC 2KWUB 2WX0A 2A4ZA 2NTSA 1GAQB 2BKFA 3P63A 1UBQA 1E5WA 4XDDA 3VRBB 1WGYA 1EUVB 4II3B 2WP9B 2B3AA 4W9CA 2KFJA 1MVKA 1DGJA 3PS6A 1IUEA 5TSSA 1N5WA 3KLSX 2KDMA 2JSVX 1PDXA 2PPHA 1J0GA 4KGSA 2IO0B 5BYRA 1J7BA 2CS4A 1OFFA 4F8CB 2ZPNA 1C9FA 4WJPA 4XDCA 3CSFA 3KQ4A 2WNMA 1WX9A 1WXSA 3QX1A 4OW0A 3VTUA 2VH1A 3SU8X 1WZ3A 1E0ZA 3WAPA 2LZ6A 2WXPA 1S1QB 2WWZA 2DAJA 2M17A 2KFKA 4W9FA 2KMAA 1V8CA 3URYA 4RH6A 2JQRB 1FFVA 3DBHB 4HWIB 2JU6X 4K1RB 2BT6A 3AV8A 4S0RA 1SF0A 1YNTE 2QILA 1Z2MA 1QQRA 3CF6E 3ML9A 2WXIA 1H7WA 4YWGG 3C8YA 4GDKB 3ZO5B 1JW9D 2IY1B 1C76A 3I3TB 1H8CA 3ZDMC 1WX8A 3NVZA 3TSSA 4W9LA 4BKSD 3ZYYX 4MACA 1G6JA 3B9JA 1FMAD 3VRAB 1H7XA 3GS2A 2GBNA 1SEBD 2ZW1A 3TCAA 1WMHB 1N6ZA 3Q8FA 3FC4A 3MJ5A 2JX5A 4YT0B 1NDDA 1K51A 2WXHA 4FULA 4ZRJA 2FBWB 4US8A 2FCQA 1OEYA 5DCNA 5DPRA 3N1XC 2MJ3A 3OAWA 1SE3A 2GOWA 2WXMA 3DCGA 3AE4B 4ANVA 4AJYB 3NS8A 5G2NA 2RPVA 3PLVA 1ZDXA 1NEKB 3VH3B 4TMAB 1TY0A 3APCA 2BS3B 2JYEA 3H9DA 3P2BA 2D3BA 4DHZE 2QIEB 1B1ZA 4RF0A 4IM0A 2ZCBA 3RNAC 1EU4A 3R7RA 5CX3A 1YJ1A 2PLPA 4IKGA 3HVZA 2N9PC 3PZ8A 1VRAB 3OJ3A 3ML8A 4A8XC 5HKHA 1C3TA 3APFA 2XEWA 2YEPB 3R2IA 1V6EA 2KC1A 5C1ZA 1T6BX 1D5MC 3X0WA 3LYYA 4RCOA 3AEDB 1XLPA 4W9JA 2BWFA 3PVLA 3DPDA 1E8ZA 2HD5B 1WIAA 4KVGB 4USAA 3KVFB 3SFDB 2G4DB 3L54A 2RPQA 3TEZA 1FPYA 3U4EG 4II2B 1KH0A 3DVNV 3CIRB 3KUDB 4N6EB 3FAHA 2MLBA 4JLCA 5AUIA 2WXFA 3J9CA 1XXGA 1KLGD 1JWUD 1MHHE 1P3QU 2KZRA 1Q5WB 1ZUD2 3NZUA 2Y5CA 3RUIB 2JPHA 2C7MB 1L6VA 1WGGA 2R2QA 4B0EA 3RD2A 2RMMA 2D10A 1WGDA 2BYEA 4LJPB 1D5XC 3TEXA 3NG0A 1PGXA 3CSTA 2GI9A 1V5OA 1TBEA 3H7PB 4S17A 4I6NB 3W2DA 1WXVA 1FM0D 1TS2A 3D32A 2ZVOA 1SIJA 3WIMA 2V1YA 4WURA 1QOBA 2HDEA 2N9LA 3L08A 4RFBA 4A55A 4EZKA 4LLGM 3IBEA 4OZAA 5DPTA 2DYMA 2LFIA 1FNVA 2K39A 4DHJB 4KKJA 2M19A 3RI7C 2L3ZA 4HXDA 1WM2A 1GJZA 2CU3A 1KOTA 4BVUC 4MSQB 3DBRI 4EUTA 2LXCA 4R3DA 3SDLC 1FRRA 4KDLB 4ZYSA 4MELA 4EFOA 2WXGA 4IM2A 1MFWA 4NNJB 5IA7A 2K8CA 2C7HA 4BFRA 4M8NA 4XX5A 2K8BA 2GBMA 3VXWA 5LXHA 1F9JA 3TBLD 1LM8B 4YSXB 2LVQA 3BYYB 4ASWC 5D6JB 2H88B 1QOAA 1WXQA 3MTNB 2EMSA 2MHJA 2LHEA 4URKA 1ISNA 1VZ7A 2KN4A 2OHFA 5G5GA 1GPXA 3RCZA 4A6QA 1EM7A 2IPKD 4FA6A 1T0QC 2LUMA 1L0XB 2K22A 3C19A 1YJIA 4ZHPA 2BYFA 3W5UB 4MGIE 2AYOB 2PVGC 2LRUA 4J6IA 3AEBB 1Y56A 1FXTB 2KHWB 5FK9C 1VD2A 1JMLA 1S3SG 2BQQA 4NQLB 4RF1A 4AS1A 3PSEB 2UWQA 5GMVA 4LNOA 3EFCA 2Z0EB 1YN5A 1LQBA 4N9F4 1E7UA 1ET9A 1V86A 1I4XA 3E56A 2K1FA 2WDRB 1UZXB 1ZXHA 1SJHD 3RNCC 3IHPC 4GSWA 1WX7A 1V81A 4WWPA 2AL3A 2LRWA 3BYTB 4WWNA 3BK2A 1ZKHA 1QOFA 2KX0A 2XNAC 4LJOB 4IDIA 1OTRB 1V2YA 4GU2A 1LXDA 1HXYD 3NY5A 2DZIA 1T5XD 1WGKA 3LDZE 2HJ1A 2G4SA 1R4MI 1WWTA 2KKCA 2MRPA 1ZXIA 2FIFA 2LJ5A 4H2AA 1I42A 2JZ3B 1PYWD 1RFKA 2JWZA 2IO2B 3FILB 4LNIA 2R61A 4A20A 4HVBA 2DBYA 4HK2A 2YVCA 4K7WA 4DXAB 3AE3B 1C78A 3DBRB 2PE9A 1FEHA 4HRSA 4M01A 1AW7A 2KACA 3ZNGC 2AQ3B 3WCQA 2KXJA 1E8WA 2K3UA 2J4XA 1CJEA 3HRDD 2MQJA 1HZ6A 3AECB 3DVGX 4P1BC 3H1UA 4WQMA 1TKYA 3MC0B 3K9OB 4G50A 3RFZB 2VRRB 2RR9A 4PS7A 2BWES 2HJ8A 2W3RA 2KT7A 2BS2B 1V80A 1WR1A 3NVVA 1AN8A 1E8XA 3OLMD 4MM3B 3ZW3A 3HK0A 1SE9A 4DXGA 3V6EB 4G0NB 4FBJB 3VUYA 3BINA 3VDZA 3M62B 1CMXB 1FXIA 5E6JA 4A90A 1T0SC 2AEHA 2BB5A 1KF6B 3WAOA 3HVDA 3P4QB 1PGAA 1WJ4A 2FCNA 3X23A 1V97A 3QARA 4KGTA 1MI0A 4DHZB 1OGWA 2LXAA 3OJ4B 3V05A 2C7NB 3PV1A 4AJWA 3EA6A 4US9A 1WMHA 1YN3A 4C80A 4KKIA 1E9MA 4N59A 2JRHA 3ZIMA 2J0MA 3RNGC 3VTVA 3MP9A 1I4RA 3H7SA 2REXA 3E9SA 4XC2A 4OZCA 1L0VB 1IGCA 3ENEA 2BS4B 1R4MB 4HDOA 3VQIA 1IGDA 3N1ZC 3ZNHB 1UELA 3GZNI 1LO5D 2LEKA 1K53A 3BVGA 3Q8AA 1YIWA 2GBKA 3ZTCA 4L1BA 3DBLI 4ANUA 4TUUA 3DQVA 3EFUA 3V6CB 1B9RA 1YX5B 2D3CA 3AU5A 4FJVB 3MHZA 2KDBA 3JYUA 1KRHA 3GP7A 2PTLA 2J0JA 3JW0X 3VVWB 1KLUD 3CWIA 3MC9A 4PT5A 2C9WB 4WJQA 5EE3A 1SXTA 2WDTB 1MJDA 4ZOHC 3B0AA 1WSPA 1I7HA 1TS5A 2LGDA 4MGKE 4DQOC 3ZUNA 1XCTL 2ZPYA 5I4DA 2JRIB 2CHZA 5EE9A 1UNSA 4ZRQA 2I2YA 2LI5A 3W1SA 1SSNA 3IAM1 2KWCA 1RAXA 1P9DU 1WYWB 1JQ4A 3L0WB 3I5JC 3AB5A 3Q14C 3RNEC 3EHVA 2QHOA 3DHIC 3HUIA 2MBOA 4I6PA 1ROEA 2LHDA 2KD0A 5BMGA 5IN7A 3ZGZA 4NJCA 3R2TA 2Y3AA 2LGYA 3ZNID 2SEBD 2INPE 1JCKB 5D7GA 5CTRC 4ZRIA 4HLEA 1HE8A 3GB1A 1QLBB 3NOBA 2D11A 3A9KA 2IO1B 4IWQA 4DK5A 3B1LX 1NBFC 3AEGB 3N9YC 2RDGA 4LNFA 2BYTA 1WZ0A 1TS3A 5FKAC 4KSKC 1VJKA 1Q1OA 4FADA 3QCAA 4KSLC 1EF1A 4LDTB 3GZNB 2KANA 3H7PA 3UINB 3ZRCA 4RGTA 3UGBB 5J17A 1N62A 1SIFA 1SBBB 4LTUA 1D6EC 2Z0DB 2ZEQA 3NHEB 3DBLB 4BBNC 4XYCA 1NYRA 2OJRA 4DDID 2NR2A 2CJNA 2K9XA 2L0FA 3PPAA 3Q3FA 2KJ6A 3ZLZA 1F2RI 4M0WA 2EKIA 3N32A 4YTMB 3UI3A 4TV3A 3AEEB 2DAFA 1BMLC 2EMTA 4MGYE 3TIXA 1QKZA 1SGHA 1E6EB 3KUCB 4FHKA 4P16A 5D94A 1JWSD 2M8SA 2INNE 2WXKA 1YQ3B 3AE8B 3CF4A 1JWBD 4P6VF 2L05A 1E7VA 4W9GA 4F1SA 3M3JA 2KWVB 2L1AA 2KDFB 2BBCA 5HG2A 5IOIA 1TS4A 2KX3A 2IYDB 2W3SA 1C77A 1TKGA 2CJOA 4RM8A 4OHJA 2GBJA 1I4QA 5FR6A 1STEA 4W9IA 3R66C 2WXNA 3O65B 3ZNZB 4C7ZA 4HDQA 2HTHA 3SD5A 4K3BA 2O6VD 1JWAD 2D5GA 2NTTA 3PRPB 1D3ZA 3W9CB 2FNJB 2KVZA 3AXCA 2CR5A 4PYZA 1K50A 4Q2JA 2BKRB 2IGDA 3P42A 4W9KA 3Q3OC 3EGRA 2FCMA 4FXCA 1UD7A 2EELA 2JXTA 3LB8C 2V3SA 3N20C 3V62A 3ZTDA 4E3CA 1D4BA 2C5LC 4HPMB 2ZW0A 2BF8B 1FD6A 1OQRA 2WQYB 2L8JA 3EECA 4HROA 4O1NA 3ABVB 4I6LB 5CHVC 1A70A 2XK5B 1ET6A 3TL5A 2N0SB 2ZVNA 3B2GA 3TMPB 2WXLA 4L23A 4WWMA 3AE7B 1F52A 3FILA 5LXIB 1E7PB 2JUOA 3UQAA 3VUWA 1L6UA 2ASQA 2ZNVB 3EUB2 2KO3A 4EOYA 3ZQ4A 3T9LA 2K25A 2BPSA 2QCZA 1UBIA 4A9AA 4G11A 5L95C 2L52A 3DBSA 2CKHB 2LD9A 3A9KB 1UGMA 4ITKA 2RGFA 1GC6A 4TQ0A 1EWYC 4BOZB 3WANA 2MW5A 1RLFA 2RDHA 3MHSD 2LVOA 4X57B 5AZGA 4MM3A 4GDLB 3VR9B 2DZMA 3TEWA 1RM6C 3PREA 4CYEA 1N5XA 1E10A 2I1JA 2Z8LA 4M00A 1WF9A 2IGGA 2NVUI 2PEAA 5D2MB 3NS1A 2XN9C 2DWQA 2A5UA 3ZDTA 3AM9A 2V4IB 1EO6A 4AOFA 3AH7A 1T3QA 2J42A 4M0WB 1HZ5A 2KN5A 2ON8A 2D3AA 1K8RB 3CMMB 3AEFB
chains in the Genus database with same CATH topology
1CJEA 1FNUA 3HRDD 1HZ6A 3AECB 2W82A 4WQMA 1HQRD 1TKYA 1VLBA 3MC0B 3BVMA 1ZPSA 2L32A 5H8YE 3RFZB 3NUHB 2Y5PA 4OVZA 2AQ1B 5HFYA 2NTSA 1GAQB 3ETRA 1P7FA 3RPFC 2W3RA 3P63A 2BS2B 3NVVA 4XDDA 1AN8A 3VRBB 4MM3B 5C2TB 4WH4A 1TZOA 2WP9B 1MVKA 4YSYB 4DXGA 2J53A 2WLBA 3AE2B 1DGJA 1RWSA 2ICIA 5HI1A 3AEAB 1IUEA 5TSSA 1N5WA 1NI3A 3KLSX 1V1PA 5D3DA 2KDMA 1EWCA 3PZ7A 4MT5A 1FXIA 5E6JA 4A90A 2JSVX 1L0YB 1PDXA 2VZKB 1CK1A 4KGSA 2BB5A 5BYRA 1KF6B 1J7BA 1XEEA 1OFFA 3HVDA 2L83A 1C9FA 4XDCA 3P4QB 5HHDG 1PGAA 3KQ4A 2V3PA 5JXVA 2WNMA 1NENB 4OW0A 1V97A 3Q8BA 4KGTA 2JWUA 1MI0A 5BMHA 3BIID 1XCQL 4C7YA 1ZP0B 3Q8CA 1EU3A 2W55A 2PIAA 2E3TA 4JWSC 4CQNA 1QF6A 4JWUC 3KWVA 1E0ZA 1SJED 1JWMD 3V05A 1TKEA 2WXPA 4RNAA 3EA6A 1V1OA 4US9A 1BUIC 1YN3A 3P4SB 4XWTA 4C80A 5BYQA 4KKIA 1SE4A 1E9MA 3OWEB 2AQ2B 4N59A 1V8CA 3URYA 4RH6A 2JQRB 2FUG1 3TEYA 3MP9A 1I4RA 3NRZA 1FFVA 5LNK1 1N63A 3E9SA 2LMCA 1QILA 2JU6X 4OZCA 1L0VB 1IGCA 2BS4B 5T8IA 4EE2A 4XWWA 2BT6A 3VQIA 3AV8A 1SF0A 1IGDA 1JRPA 1YNTE 2QILA 1CZPA 1QQRA 3BZDB 1LO5D 2LEKA 1L4ZB 1C4AA 1K53A 3BVGA 3IXSA 2HTME 3Q8AA 1PGBA 2WXIA 1H7WA 4L1BA 1UWXA 3C8YA 4GDKB 4YWGG 1JW9D 2N9KA 1B9RA 2LJIA 3AE1B 1C76A 2GB1A 1C4CA 2MJEA 1QOGA 3MHZA 1KRHA 2DLBA 2FE8A 3GP7A 3NVZA 2PTLA 3TSSA 2X38A 3ZYYX 4MACA 5D3IB 1ESFA 3B9JA 1KLUD 3CWIA 1WRIA 1FMAD 4PT5A 3VRAB 1OQQA 1H7XA 1HEZE 1FNWA 3VR8B 1SXTA 3GS2A 5EE3A 1L4DB 4GLSC 1IBXA 1SEBD 2ZW1A 3U52E 3U7ZA 3Q8FA 4ZOHC 3SFEB 3FC4A 1WYGA 3MJ5A 2JX5A 4YT0B 1WSPA 1FIQA 1I7HA 1TS5A 4DQOC 1K51A 2WXHA 3H8HA 1XCTL 5I4DA 2FBWB 2WU5B 2OEDA 4US8A 5EE9A 1UNSA 4ZRQA 2I2YA 2WXRA 3W1SA 2MJ3A 1R7SA 1GB4A 1SSNA 4TSSA 3IAM1 2ACZB 1UUPA 2KWDA 2MJDA 1Q10A 4HEA1 4TQ1A 1C4PA 2N7JA 1SE3A 2WXMA 4HJGE 3AE4B 1JQ4A 2RPVA 1ZDXA 2WU2B 1MHXA 3AB5A 2WDVB 5C3JB 4RGNA 1NEKB 4JX1C 3HUIA 4TMAB 1UWMA 1TY0A 1YQ4B 1P7EA 3DWMA 2KQ4X 2BS3B 2V0GA 2JYEA 2JYTA 3AE9B 1J7CA 1ROEA 2LHDA 1F2RC 2IDYA 2QIEB 1B1ZA 3P4PB 4RF0A 5BMGA 1C79A 3ZGZA 4YXDB 4NJCA 3R2TA 2Y3AA 2WXOA 2KMMA 2SEBD 2INPE 1JCKB 3AE6B 5D7GA 1PUTA 1EU4A 1FFUA 1JALA 3GB1A 1QLBB 2PLPA 2PVOD 3B2FA 4IKGA 2J52A 3HVZA 3AEGB 1DOIA 2RDGA 3N9YC 3PZ8A 2WS3B 4MH8A 1VRAB 4NAMA 4A8XC 2BYTA 1DOYA 1TS3A 5FKAC 2YEPB 3R2IA 4YTNB 1GB1A 3O13A 1VJKA 5GXGB 1T6BX 4B0MA 1CQVA 2G9HD 1D5MC 3IT6B 3LYYA 1I4HA 4RCOA 3AEDB 1XLPA 2E6XA 3ZJVA 4RGTA 1N62A 1SBBB 2PW9A 4LTUA 4NZLB 1D6EC 1N61A 4USAA 3SFDB 2H89B 3TEZA 1XLOA 2M0AA 3KWLA 4ARCA 2AX5A 1NYRA 4REZA 5EE0A 1GT8A 3U4EG 3Q8EA 4ARIA 1KH0A 2CJNA 2K9XA 2KAJA 3CIRB 4UDUC 2LGIA 1F2RI 1V1PB 4M0WA 2EKIA 4YTMB 4D2KA 1UGJA 4N6EB 3UI3A 2QEJC 3FAHA 3R8BA 3AEEB 2PKOA 1VR9A 5AUIA 4KX6B 2G1EA 1BMLC 1XLQA 5AUKA 2WXFA 3J9CA 1XXGA 1KLGD 1JWUD 1MHHE 2ONQA 1QKZA 1E6EB 4P16A 1JWSD 3IT4B 2INNE 1ZUD2 2Y5CA 2WXKA 1YQ3B 3AE8B 2K5PA 3CF4A 3T3NA 1JWBD 4P6VF 1L6VA 4B0EA 2RMMA 1M4VA 3BVZA 3I57A 2L1AA 5BMIA 2BBCA 1D5XC 5HG2A 1I4PA 3TEXA 5MPOA 1TS4A 1F0ZA 1PGXA 1YN4A 2GI9A 1BXTA 2PMVA 2QJLA 1F77A 1PFDA 2W3SA 1C77A 1TKGA 1XLNA 2CJOA 3W2DA 4OHJA 1FM0D 1TS2A 2IGHA 1SIJA 1XO3A 4YTPB 4JPSA 1QOBA 1I4QA 2HDEA 2N9LA 4WURA 2MH7A 1NYQA 1FCCC 3TUOA 1STEA 4RFBA 1TJEA 4A55A 1FO4A 2Q5WD 4LLGM 4OZAA 2WXNA 4JE3B 5EE1A 2JZPA 2DYMA 4LK0M 2LFIA 1FNVA 4C7ZA 4KKJA 2M19A 1VZ6A 2B76B 3PO0A 1K52A 1RYJA 1FCLA 1JWAD 2D5GA 2CU3A 1JROA 2NTTA 3W9CB 2NMQA 4R3DA 1FRRA 3Q69A 4ZYSA 2WXGA 1DOXA 1K50A 1MPEA 1DYQA 4Q2JA 2WXJA 2IGDA 3IAS1 3P42A 1ZDVA 4YSXB 2BB6A 4YSZB 3BYYB 3LXFA 2H88B 1FRDA 1QOAA 1WXQA 1ZE3D 1TY2A 3EGRA 4FXCA 3NZ3A 2JXTA 2EELA 2LHEA 3BK1A 1IBXB 1GPXA 1VZ7A 2KN4A 2OHFA 3LB8C 5G5GA 3P1MA 4HKQA 4A6QA 4AQ7A 3NVYA 1EM7A 2IPKD 4L2YA 2LUMA 4C56C 1L0XB 2WDQB 1D4BA 2K22A 3U2SC 1D5ZC 1ENFA 2W54A 1YJIA 2ZW0A 2YEPF 4ZHPA 3W5UB 1FD6A 1OQRA 3SR6A 2WQYB 2M56B 4DXFA 5FR3A 2PVGC 2K0PA 1SB3C 3ABVB 1GOZA 4HROA 4O1NA 3AEBB 1A70A 1Y56A 1ET6A 3T3OA 1AWDA 2N0SB 5FK9C 1KTKA 3B2GA 1JMLA 4WIPA 4RF1A 5H92C 4AS1A 1N60A 2WXLA 4L23A 4WWMA 2QMTA 3AE7B 1YN5A 1FXAA 3FILA 1E7PB 1ET9A 1I4XA 2V3NA 3E56A 3L4PA 1GTHA 1L6UA 2WDRB 1NVID 1VDVA 1ZXHA 3EUB2 1ACCA 1HA5A 1SJHD 3V3XA 2MEKA 1GTEA 4ZHOA 4J3OD 5BYSA 2QSDA 4RGOS 3DWGC 3ZQ4A 3ZJTA 3NVWA 1J7AA 4A9AA 3BYTB 3BK2A 4OZBA 1QOFA 2L52A 2IJ0A 2XNAC 4IDIA 3BWUD 4ITKA 1I4GA 4TQ0A 1EWYC 1QT9A 4RGMA 1HXYD 2WXQA 2RDHA 1T5XD 2DYOA 2BW2A 2GRIA 1WGKA 4XE0A 3W5VB 3AN1A 1ZOYB 4GDLB 4HKZE 3VR9B 1VZ8A 3TEWA 4IOIE 1RM6C 2VZKD 1WWTA 1KFYB 1N5XA 1ZXIA 1YMHE 2TSSA 1E10A 3ZJUA 3SEBA 4H2AA 1PYWD 1RFKA 2Z8LA 3P4RB 3FILB 3MFGA 2IGGA 3AE5B 2R61A 5G5HA 4ZRPA 2DBYA 1AYFA 2XN9C 3NS1A 2DWQA 3AE3B 1C78A 4NAWB 3AM9A 4KGRA 2V4IB 2I38A 2SAKA 1FEHA 1TYGB 3I9V1 1YJJA 1SE2A 1T3QA 2J42A 3AH7A 4HRSA 4WAFA 1HZ5A 2ON8A 1AW7A 2KACA 3AMZA 1XF5L 2AQ3B 3WCQA 2K3UA 4N58A 3AEFB 2J4XA 1L5PA 2BTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CJE A;  3AE1 B;  1N61 A;  3HRD D;  4USA A;  2WDQ B;  3AEC B;  3SFD B;  2K22 A;  2MJE A;  2H89 B;  1QOG A;  1XLO A;  2W54 A;  3KWL A;  4WQM A;  1YJI A;  2AX5 A;  4ZHP A;  1KRH A;  1NYR A;  1TKY A;  3NVZ A;  3W5U B;  1VLB A;  5EE0 A;  1GT8 A;  1OQR A;  3SR6 A;  2WQY B;  5H8Y E;  2M56 B;  2CJN A;  2K9X A;  3ZYY X;  2KAJ A;  3CIR B;  2PVG C;  3B9J A;  3CWI A;  1WRI A;  1FMA D;  3ABV B;  1SB3 C;  4HRO A;  1GAQ B;  3VRA B;  2EKI A;  3ETR A;  1OQQ A;  3RPF C;  1H7X A;  3AEB B;  4YTM B;  3VR8 B;  1A70 A;  2W3R A;  2BS2 B;  3P63 A;  5EE3 A;  4N6E B;  1AWD A;  3FAH A;  3NVV A;  2N0S B;  3AEE B;  3VRB B;  2PKO A;  3B2G A;  3SFE B;  3FC4 A;  5C2T B;  4KX6 B;  1WYG A;  4YT0 B;  2JX5 A;  4ZOH C;  2G1E A;  1FIQ A;  1I7H A;  1XLQ A;  5AUK A;  5H92 C;  1N60 A;  4WWM A;  2WP9 B;  2FBW B;  3AE7 B;  5AUI A;  4YSY B;  1E6E B;  1FXA A;  2WU5 B;  2WLB A;  4US8 A;  1E7P B;  5EE9 A;  3AE2 B;  1DGJ A;  1RWS A;  3AEA B;  1ZUD 2;  2Y5C A;  3L4P A;  1GTH A;  1YQ3 B;  2WDR B;  1IUE A;  1L6U A;  3AE8 B;  1N5W A;  1NI3 A;  1NVI D;  3CF4 A;  1R7S A;  1VDV A;  1JWB D;  2K5P A;  2MJ3 A;  1L6V A;  3EUB 2;  4P6V F;  1FXI A;  2ACZ B;  1GTE A;  2MJD A;  4ZHO A;  1PDX A;  3AE4 B;  1KF6 B;  1J7B A;  3DWG C;  1OFF A;  1JQ4 A;  2WU2 B;  2L83 A;  3AB5 A;  2WDV B;  5C3J B;  3NVW A;  5MPO A;  1NEK B;  3P4Q B;  1F0Z A;  1J7A A;  4JX1 C;  4A9A A;  3HUI A;  1NEN B;  1UWM A;  1V97 A;  1YQ4 B;  1QOF A;  2QJL A;  2L52 A;  3DWM A;  2BS3 B;  1PFD A;  2W3S A;  3BII D;  4C7Y A;  1ZP0 B;  1TKG A;  3AE9 B;  1J7C A;  1ROE A;  1XLN A;  2CJO A;  4IDI A;  2QIE B;  2W55 A;  1FM0 D;  3P4P B;  2E3T A;  2PIA A;  4JWS C;  4ITK A;  1QF6 A;  1SIJ A;  1XO3 A;  4YTP B;  1QOB A;  4JWU C;  4YXD B;  2MH7 A;  1NYQ A;  1EWY C;  1E0Z A;  1QT9 A;  1TJE A;  1FO4 A;  1TKE A;  2Q5W D;  2KMM A;  3AE6 B;  4US9 A;  1PUT A;  1WGK A;  3W5V B;  3P4S B;  5EE1 A;  4C80 A;  3AN1 A;  1E9M A;  1ZOY B;  4N59 A;  1V8C A;  3VR9 B;  1FFU A;  2JQR B;  4C7Z A;  1JAL A;  2M19 A;  1QLB B;  1RM6 C;  1WWT A;  1KFY B;  2B76 B;  1FFV A;  2PVO D;  1RYJ A;  1N5X A;  1ZXI A;  3B2F A;  3NRZ A;  1JWA D;  3PO0 A;  1E10 A;  2CU3 A;  1JRO A;  3HVZ A;  1N63 A;  3W9C B;  1FRR A;  3AEG B;  1DOI A;  1L0V B;  1RFK A;  3P4R B;  2BS4 B;  2WS3 B;  3AE5 B;  2BT6 A;  1DOX A;  3AV8 A;  1SF0 A;  1DOY A;  1JRP A;  5G5H A;  2DBY A;  1AYF A;  3NS1 A;  4YTN B;  3AE3 B;  2DWQ A;  1CZP A;  3AM9 A;  1VJK A;  5GXG B;  2LEK A;  4YSX B;  2HTM E;  1TYG B;  4YSZ B;  1YJJ A;  3AH7 A;  1T3Q A;  3LXF A;  2H88 B;  1FRD A;  4HRS A;  1QOA A;  1H7W A;  1WXQ A;  3AMZ A;  4FXC A;  3AED B;  1XLP A;  3WCQ A;  1GPX A;  3LB8 C;  4N58 A;  2OHF A;  5G5G A;  3AEF B;  3P1M A;  1JW9 D;  1B9R A;  1L5P A;  3NVY A;  1N62 A;  4LTU A; 
#chains in the Genus database with same CATH topology
 1FNU A;  3PHW B;  2W82 A;  3DHH C;  2BVC A;  3A1Q A;  1VLB A;  2J0K A;  4OVZ A;  1TT5 B;  2MSE D;  3ETR A;  3RPF C;  4ACF A;  3QAQ A;  5KHO A;  2N7D A;  4IC7 B;  4WH4 A;  4BKT A;  4NPN A;  3NJT A;  4YSY B;  2J53 A;  3AE2 B;  1RWS A;  4LNN A;  1WY8 A;  5HI1 A;  4HPL B;  1NI3 A;  1H4R A;  1V1P A;  1TGZ B;  1L0Y B;  2VZK B;  2V9H A;  2KC2 A;  2MBE A;  1XEE A;  4ZRK A;  1R4N I;  2DZJ A;  5JXV A;  1NEN B;  3Q8B A;  5BMH A;  3BII D;  3GE3 C;  1GC7 A;  4FJY A;  4M8M A;  4W9D A;  4C7Y A;  1EU3 A;  2W55 A;  2D07 B;  2E3T A;  4JWS C;  4A3O A;  3KWV A;  4EZL A;  4A3P A;  4RNA A;  4IWO A;  3RZF A;  1WE6 A;  3HIZ A;  1L7Y A;  3P4S B;  4XWT A;  1SE4 A;  4NJ7 A;  2JF5 A;  4MH0 E;  2ZZP B;  3NRZ A;  1WH3 A;  3QWZ B;  2WX1 A;  1RFA A;  2LMC A;  2KJR A;  3KW5 B;  4XWW A;  1YX6 B;  1CZP A;  2KOX A;  1L4Z B;  1C4A A;  4P7I A;  3IXS A;  4EKU A;  1PGB A;  2NS5 A;  2M0X A;  3RYT A;  1UWX A;  4PYU A;  3VTW A;  3HHM A;  2N9E B;  5IAA C;  1C4C A;  2MJE A;  3KYD D;  3I63 C;  2DLB A;  2FE8 A;  1WRI A;  4E71 A;  1OQQ A;  1IBX A;  1FNW A;  2NPT A;  1NI2 A;  3U52 E;  5L83 A;  1FIQ A;  4GIV A;  2WU5 B;  2INC C;  2OED A;  3AU4 A;  1WGR A;  2FUH B;  4KIK B;  2WXR A;  3Q2A C;  4HCN B;  1GB4 A;  3R7Q A;  4JL9 A;  2ACZ B;  3UQB A;  2KWD A;  2MJD A;  3W1S C;  1MHX A;  2WDV B;  5C3J B;  4RGN A;  4JX1 C;  3DWM A;  2KQ4 X;  2VH2 A;  4WWO A;  2V0G A;  2JYT A;  1F2R C;  2IDY A;  1R4N B;  1WXA A;  3N30 A;  2MBH A;  5BO4 B;  2ZNV C;  3AE6 B;  1PUT A;  3RT3 B;  1JAL A;  2DHZ A;  1TTN A;  1Y8R C;  3B2F A;  2J52 A;  4BOS C;  3AUL A;  4XGA B;  3S2A A;  3M95 A;  4NAM A;  4FHJ A;  1VCB A;  3A1Q B;  1GB1 A;  1GUA B;  1Q0W B;  3O13 A;  2L76 A;  5GXG B;  3A33 B;  3T8M A;  4B0M A;  5TR5 A;  4CHK A;  2G9H D;  2IY0 B;  3Q6B A;  3IT6 B;  1I4H A;  2L0T A;  1MG8 A;  3ZJV A;  3PTF C;  5IKC M;  2PW9 A;  4NZL B;  1N61 A;  3VUX A;  4ARC A;  1IPG A;  4NAW A;  3VAW A;  3JSV A;  5EE0 A;  4AP4 C;  2KAJ A;  4UDU C;  3APD A;  2LGI A;  1V1P B;  2OOB B;  1UGJ A;  3L17 A;  4P1C C;  3QJZ A;  3R8B A;  2PKO A;  2G1E A;  5AUK A;  1V49 A;  4KDI C;  2KQS A;  2X8X X;  2K5P A;  3T3N A;  2QC8 A;  4G3X B;  2CHW A;  3I57 A;  3ONS A;  2PE6 B;  3ZVV A;  1EF5 A;  2O2V A;  1I4P A;  2K8H A;  4MJS A;  5MPO A;  1F0Z A;  5IP4 D;  1LGR A;  2BYV E;  2MP2 B;  1T0Y A;  1BXT A;  2QJL A;  1PFD A;  2QDF A;  1OEY J;  1KJT A;  1FCC C;  4ZYN A;  1TJE A;  4WJO A;  2LWP A;  3IG3 A;  2XK5 A;  4KZC A;  5EE1 A;  2RDB C;  1J8C A;  2PJH A;  3WAM A;  3PO0 A;  1K52 A;  1JRO A;  2LVP A;  3Q69 A;  4YL8 A;  1MPE A;  2JZZ A;  2NBU A;  3IAS 1;  2KNB A;  1ZDV A;  2I1K A;  3LXF A;  1FRD A;  2LGX A;  4IWP A;  3NZ3 A;  3BK1 A;  1IBX B;  2NPT B;  2Z59 B;  4RM9 A;  3HM6 X;  2GBR A;  2HE7 A;  2LAS A;  4L2Y A;  4C56 C;  4B95 A;  3U2S C;  5JH5 C;  1ENF A;  2W54 A;  1WJN A;  2YEP F;  4JGH B;  3U30 A;  3UF8 A;  1E90 A;  1ZGU B;  4GDL A;  1SB3 C;  1GOZ A;  3A4R A;  3RUL A;  4BAX A;  3T3O A;  1AWD A;  4FJZ A;  1TIF A;  4KZ0 A;  4WIP A;  1N60 A;  4LNK A;  2AWT A;  2QMT A;  1FXA A;  1WM3 A;  2V3N A;  3L4P A;  1GTH A;  4NJ6 A;  2N1V A;  2N7E A;  3VFK A;  3KYC D;  2N1W A;  5BYS A;  2QSD A;  4RGO S;  3DWG C;  4AUQ C;  2JVC A;  3NVW A;  1J7A A;  1KM7 A;  4B6W A;  4K7U A;  3BWU D;  1C1Y B;  1I4G A;  4IM3 A;  2BGF A;  4C4V A;  2WXQ A;  4K81 A;  2DYO A;  2GRI A;  4XE0 A;  4GMV A;  3AN1 A;  2DYB A;  4HKZ E;  4FN2 A;  3NZS A;  2ZJD A;  3N3K B;  4WAA A;  1VZ8 A;  3LJ3 A;  2MWS B;  3A9J A;  2TSS A;  3HM3 A;  4DDG D;  3SEB A;  2J7Q B;  4GOC A;  3QHT A;  4IW0 A;  4ZRP A;  4NAW B;  4WQO B;  3JSV B;  2I38 A;  1SE2 A;  4WAF A;  1P98 A;  3AMZ A;  3DVG Y;  1XF5 L;  4N58 A;  2V4L A;  2BTE A;  3PRM B;  3WAL A;  2KK8 A;  3PT2 B;  4LCD E;  5H8Y E;  3UIO B;  5IO9 A;  2AQ1 B;  5HFY A;  1V9J A;  2L00 B;  5AEK B;  1P7F A;  3N1Y C;  4HJK A;  3DDC B;  5C2T B;  1KLV A;  1TZO A;  2O2V B;  4MJS B;  2WLB A;  3V61 A;  2CHX A;  2ICI A;  3AEA B;  5E6O A;  5D3D A;  4ANX A;  4MT5 A;  1EWC A;  3PZ7 A;  3DHG C;  1WE7 A;  3ZKJ C;  1CK1 A;  3U8Z A;  2KDI A;  1WI0 A;  4RMA A;  2L83 A;  5HHD G;  3L10 B;  2V3P A;  2JWU A;  1XCQ L;  3PGE A;  1ZP0 B;  3JVZ X;  3Q8C A;  2PIA A;  5J2R A;  4CQN A;  1QF6 A;  2KTR B;  4JWU C;  3W1Y A;  1SJE D;  1JWM D;  3MC8 A;  1TKE A;  2NBW B;  1V1O A;  1BUI C;  5BYQ A;  3OWE B;  4NQK E;  2AQ2 B;  4MSM B;  2AL6 A;  2FUG 1;  3TEY A;  4F7Z A;  5LNK 1;  1N63 A;  4KIK A;  1WR6 E;  1QIL A;  4E74 A;  5T8I A;  4EE2 A;  2JY6 A;  1JRP A;  2KMC A;  2LGS A;  2RSU A;  3BZD B;  5G55 A;  1QZE A;  2HTM E;  3QK0 A;  5LLI A;  3KH0 A;  2GMI C;  2MCN B;  4BBN F;  1I35 A;  1WGH A;  2N9K A;  2LJI A;  3AE1 B;  3EC8 A;  2CU1 A;  2GB1 A;  2KYW A;  2D3G A;  1QOG A;  1YOV B;  1P1A A;  2KLC A;  4QAY A;  5AZH A;  2K6Q A;  2X38 A;  4NY0 A;  1IYF A;  5D3I B;  1ESF A;  1HEZ E;  3RMK C;  3VR8 B;  1L4D B;  4GLS C;  1J19 A;  2GLS A;  2KFK B;  3U7Z A;  3SFE B;  1WYG A;  3GOE A;  2JT4 B;  2KJH B;  3H8H A;  4BKS A;  3RZW C;  4LDT D;  3L16 A;  4W9E A;  1R7S A;  4TSS A;  1UUP A;  1AAR A;  2L7R A;  1Q10 A;  4HEA 1;  4TQ1 A;  1C4P A;  2N7J A;  3R3M A;  2C60 A;  1YQB A;  4HJG E;  4C4V B;  4EEW A;  2R2O A;  2WU2 B;  2KLG A;  1UH6 A;  4K3C A;  1UWM A;  1YQ4 B;  1P7E A;  4W9H A;  1XT9 B;  3AE9 B;  1J7C A;  2KTF A;  3RN9 C;  3A9J B;  3P4P B;  1C79 A;  4YXD B;  1UF0 A;  2UU7 A;  4FLH A;  2O6V A;  2WXO A;  2KMM A;  1FFU A;  3V60 A;  2PVO D;  5KHQ A;  4DWF A;  3VHT C;  1MG4 A;  2N4F A;  3IFW B;  1DOI A;  2WS3 B;  4MH8 A;  1DOY A;  3DVN U;  4TKN A;  4YTN B;  3PRZ A;  2MA9 B;  1X1M A;  1GNU A;  1CQV A;  3PLU A;  2MP2 A;  4PS3 A;  2E6X A;  4KV2 A;  4ZDV A;  1WFY A;  3PZD A;  2H89 B;  3KWL A;  1XLO A;  2M0A A;  4AWJ A;  2AX5 A;  4REZ A;  1BT0 A;  4PK1 A;  1ZW7 A;  1GT8 A;  1HTQ A;  3Q8E A;  4ARI A;  4D2K A;  4MEM A;  2QEJ C;  1HTO A;  1VR9 A;  1WRD B;  4WJN A;  4KX6 B;  1XLQ A;  2DEN B;  2DX5 B;  1XQQ A;  2ONQ A;  2FAZ A;  3B08 A;  3PHX B;  1P0R A;  3IT4 B;  4C00 A;  5J18 A;  2LUE A;  1M4V A;  3BVZ A;  3SHQ A;  3U7D A;  4M02 A;  1RRB A;  5BMI A;  3TJP A;  2DNF A;  1WJ6 A;  5CHW A;  1YN4 A;  2PMV A;  1F77 A;  2RD0 A;  3IVF A;  1XLN A;  3C0R B;  4EZJ A;  2IGH A;  3RNF C;  1XO3 A;  4GB9 A;  4YTP B;  4JPS A;  1TZ1 A;  2MH7 A;  1NYQ A;  5JZE B;  3QIJ A;  3TUO A;  1M94 A;  1FO4 A;  2Q5W D;  5JHA A;  1JRU A;  3AI5 A;  4JE3 B;  2JZP A;  4LK0 M;  4ANW A;  4CO7 A;  1LFD A;  3Q3N C;  3VH4 B;  1VZ6 A;  2B76 B;  1RYJ A;  1FCL A;  2Y5B B;  2NMQ A;  3RNB C;  3MJW A;  5DPW A;  3QA8 A;  1DOX A;  1DYQ A;  1A5R A;  2WXJ A;  4ICV A;  2UYZ B;  3DOW A;  4IG7 B;  2BB6 A;  3KUZ A;  4YSZ B;  4GXB A;  1ZE3 D;  1TY2 A;  2M1M A;  1WJU A;  4HKQ A;  2K6D B;  3P1M A;  4AQ7 A;  3NVY A;  2WDQ B;  1OQY A;  3M63 B;  1D5Z C;  1XD3 B;  2ZCC A;  2D2Q A;  5AZF A;  2KDE B;  4ICU A;  5CHF A;  4BZA A;  3ECI A;  3SR6 A;  2M56 B;  4OVU A;  3OG5 A;  4DXF A;  5FR3 A;  2IZV B;  5E6N A;  2K0P A;  4GN1 A;  4XZ4 A;  3Q3J A;  4GDK A;  1GG3 A;  1KTK A;  4GGQ A;  5H92 C;  2IND C;  2WHI A;  4DHJ D;  5DPS A;  1L2N A;  3ZXR A;  2W9N A;  1NVI D;  5C23 A;  1VDV A;  3K9P B;  1F1H A;  1T0R C;  3ALB A;  2N9X A;  3ZRF A;  1ACC A;  1HA5 A;  3V3X A;  3WA0 A;  2MEK A;  2DZK A;  1GTE A;  4MGZ E;  4ZHO A;  4J3O D;  2MBB B;  2G3Q B;  1V5T A;  2O6V B;  2MX2 A;  2WYQ A;  3ZJT A;  4MDK E;  3H6N A;  4IUM B;  3A4S C;  2MBQ A;  4OZB A;  4DBG A;  2YLM A;  2IJ0 A;  1E8Y A;  2IBI B;  2IO3 B;  3GE8 C;  3FKY A;  1Z5S B;  2M4N A;  1U4A A;  4JIO U;  4B9K A;  1QT9 A;  3Q3M C;  4RGM A;  5E6P A;  3UIP B;  4OVV A;  2BW2 A;  3DBH I;  3W5V B;  2JXX A;  1ZOY B;  4HPP A;  4IOI E;  2VZK D;  3BY4 B;  1KFY B;  1YMH E;  3ZXV A;  3ZJU A;  4BKG A;  2FCS A;  1YD8 U;  1IP9 A;  4PS8 A;  3MFG A;  3P4R B;  4K7S A;  3AE5 B;  2KVR A;  2KQ7 A;  5G5H A;  1AYF A;  2XBB C;  3L13 A;  2FID A;  2NBV B;  4KGR A;  2SAK A;  2OJW A;  1TYG B;  3I9V 1;  1YJJ A;  5JHB A;  2G45 B;  1L5P A;  5EDS A;  1PQS A;  4JQW C;  2KTR A;  1HQR D;  3QC8 B;  4HCP B;  2NCN A;  3QQ8 B;  3BVM A;  2WGS A;  1ZPS A;  2L32 A;  1WXM A;  3NUH B;  2Y5P A;  2EKE C;  2KWU B;  2WX0 A;  2A4Z A;  2NTS A;  1GAQ B;  2BKF A;  3P63 A;  1UBQ A;  1E5W A;  4XDD A;  3VRB B;  1WGY A;  1EUV B;  4II3 B;  2WP9 B;  2B3A A;  4W9C A;  2KFJ A;  1MVK A;  1DGJ A;  3PS6 A;  1IUE A;  5TSS A;  1N5W A;  3KLS X;  2KDM A;  2JSV X;  1PDX A;  2PPH A;  1J0G A;  4KGS A;  2IO0 B;  5BYR A;  1J7B A;  2CS4 A;  1OFF A;  4F8C B;  2ZPN A;  1C9F A;  4WJP A;  4XDC A;  3CSF A;  3KQ4 A;  2WNM A;  1WX9 A;  1WXS A;  3QX1 A;  4OW0 A;  3VTU A;  2VH1 A;  3SU8 X;  1WZ3 A;  1E0Z A;  3WAP A;  2LZ6 A;  2WXP A;  1S1Q B;  2WWZ A;  2DAJ A;  2M17 A;  2KFK A;  4W9F A;  2KMA A;  1V8C A;  3URY A;  4RH6 A;  2JQR B;  1FFV A;  3DBH B;  4HWI B;  2JU6 X;  4K1R B;  2BT6 A;  3AV8 A;  4S0R A;  1SF0 A;  1YNT E;  2QIL A;  1Z2M A;  1QQR A;  3CF6 E;  3ML9 A;  2WXI A;  1H7W A;  4YWG G;  3C8Y A;  4GDK B;  3ZO5 B;  1JW9 D;  2IY1 B;  1C76 A;  3I3T B;  1H8C A;  3ZDM C;  1WX8 A;  3NVZ A;  3TSS A;  4W9L A;  4BKS D;  3ZYY X;  4MAC A;  1G6J A;  3B9J A;  1FMA D;  3VRA B;  1H7X A;  3GS2 A;  2GBN A;  1SEB D;  2ZW1 A;  3TCA A;  1WMH B;  1N6Z A;  3Q8F A;  3FC4 A;  3MJ5 A;  2JX5 A;  4YT0 B;  1NDD A;  1K51 A;  2WXH A;  4FUL A;  4ZRJ A;  2FBW B;  4US8 A;  2FCQ A;  1OEY A;  5DCN A;  5DPR A;  3N1X C;  2MJ3 A;  3OAW A;  1SE3 A;  2GOW A;  2WXM A;  3DCG A;  3AE4 B;  4ANV A;  4AJY B;  3NS8 A;  5G2N A;  2RPV A;  3PLV A;  1ZDX A;  1NEK B;  3VH3 B;  4TMA B;  1TY0 A;  3APC A;  2BS3 B;  2JYE A;  3H9D A;  3P2B A;  2D3B A;  4DHZ E;  2QIE B;  1B1Z A;  4RF0 A;  4IM0 A;  2ZCB A;  3RNA C;  1EU4 A;  3R7R A;  5CX3 A;  1YJ1 A;  2PLP A;  4IKG A;  3HVZ A;  2N9P C;  3PZ8 A;  1VRA B;  3OJ3 A;  3ML8 A;  4A8X C;  5HKH A;  1C3T A;  3APF A;  2XEW A;  2YEP B;  3R2I A;  1V6E A;  2KC1 A;  5C1Z A;  1T6B X;  1D5M C;  3X0W A;  3LYY A;  4RCO A;  3AED B;  1XLP A;  4W9J A;  2BWF A;  3PVL A;  3DPD A;  1E8Z A;  2HD5 B;  1WIA A;  4KVG B;  4USA A;  3KVF B;  3SFD B;  2G4D B;  3L54 A;  2RPQ A;  3TEZ A;  1FPY A;  3U4E G;  4II2 B;  1KH0 A;  3DVN V;  3CIR B;  3KUD B;  4N6E B;  3FAH A;  2MLB A;  4JLC A;  5AUI A;  2WXF A;  3J9C A;  1XXG A;  1KLG D;  1JWU D;  1MHH E;  1P3Q U;  2KZR A;  1Q5W B;  1ZUD 2;  3NZU A;  2Y5C A;  3RUI B;  2JPH A;  2C7M B;  1L6V A;  1WGG A;  2R2Q A;  4B0E A;  3RD2 A;  2RMM A;  2D10 A;  1WGD A;  2BYE A;  4LJP B;  1D5X C;  3TEX A;  3NG0 A;  1PGX A;  3CST A;  2GI9 A;  1V5O A;  1TBE A;  3H7P B;  4S17 A;  4I6N B;  3W2D A;  1WXV A;  1FM0 D;  1TS2 A;  3D32 A;  2ZVO A;  1SIJ A;  3WIM A;  2V1Y A;  4WUR A;  1QOB A;  2HDE A;  2N9L A;  3L08 A;  4RFB A;  4A55 A;  4EZK A;  4LLG M;  3IBE A;  4OZA A;  5DPT A;  2DYM A;  2LFI A;  1FNV A;  2K39 A;  4DHJ B;  4KKJ A;  2M19 A;  3RI7 C;  2L3Z A;  4HXD A;  1WM2 A;  1GJZ A;  2CU3 A;  1KOT A;  4BVU C;  4MSQ B;  3DBR I;  4EUT A;  2LXC A;  4R3D A;  3SDL C;  1FRR A;  4KDL B;  4ZYS A;  4MEL A;  4EFO A;  2WXG A;  4IM2 A;  1MFW A;  4NNJ B;  5IA7 A;  2K8C A;  2C7H A;  4BFR A;  4M8N A;  4XX5 A;  2K8B A;  2GBM A;  3VXW A;  5LXH A;  1F9J A;  3TBL D;  1LM8 B;  4YSX B;  2LVQ A;  3BYY B;  4ASW C;  5D6J B;  2H88 B;  1QOA A;  1WXQ A;  3MTN B;  2EMS A;  2MHJ A;  2LHE A;  4URK A;  1ISN A;  1VZ7 A;  2KN4 A;  2OHF A;  5G5G A;  1GPX A;  3RCZ A;  4A6Q A;  1EM7 A;  2IPK D;  4FA6 A;  1T0Q C;  2LUM A;  1L0X B;  2K22 A;  3C19 A;  1YJI A;  4ZHP A;  2BYF A;  3W5U B;  4MGI E;  2AYO B;  2PVG C;  2LRU A;  4J6I A;  3AEB B;  1Y56 A;  1FXT B;  2KHW B;  5FK9 C;  1VD2 A;  1JML A;  1S3S G;  2BQQ A;  4NQL B;  4RF1 A;  4AS1 A;  3PSE B;  2UWQ A;  5GMV A;  4LNO A;  3EFC A;  2Z0E B;  1YN5 A;  1LQB A;  4N9F 4;  1E7U A;  1ET9 A;  1V86 A;  1I4X A;  3E56 A;  2K1F A;  2WDR B;  1UZX B;  1ZXH A;  1SJH D;  3RNC C;  3IHP C;  4GSW A;  1WX7 A;  1V81 A;  4WWP A;  2AL3 A;  2LRW A;  3BYT B;  4WWN A;  3BK2 A;  1ZKH A;  1QOF A;  2KX0 A;  2XNA C;  4LJO B;  4IDI A;  1OTR B;  1V2Y A;  4GU2 A;  1LXD A;  1HXY D;  3NY5 A;  2DZI A;  1T5X D;  1WGK A;  3LDZ E;  2HJ1 A;  2G4S A;  1R4M I;  1WWT A;  2KKC A;  2MRP A;  1ZXI A;  2FIF A;  2LJ5 A;  4H2A A;  1I42 A;  2JZ3 B;  1PYW D;  1RFK A;  2JWZ A;  2IO2 B;  3FIL B;  4LNI A;  2R61 A;  4A20 A;  4HVB A;  2DBY A;  4HK2 A;  2YVC A;  4K7W A;  4DXA B;  3AE3 B;  1C78 A;  3DBR B;  2PE9 A;  1FEH A;  4HRS A;  4M01 A;  1AW7 A;  2KAC A;  3ZNG C;  2AQ3 B;  3WCQ A;  2KXJ A;  1E8W A;  2K3U A;  2J4X A;  1CJE A;  3HRD D;  2MQJ A;  1HZ6 A;  3AEC B;  3DVG X;  4P1B C;  3H1U A;  4WQM A;  1TKY A;  3MC0 B;  3K9O B;  4G50 A;  3RFZ B;  2VRR B;  2RR9 A;  4PS7 A;  2BWE S;  2HJ8 A;  2W3R A;  2KT7 A;  2BS2 B;  1V80 A;  1WR1 A;  3NVV A;  1AN8 A;  1E8X A;  3OLM D;  4MM3 B;  3ZW3 A;  3HK0 A;  1SE9 A;  4DXG A;  3V6E B;  4G0N B;  4FBJ B;  3VUY A;  3BIN A;  3VDZ A;  3M62 B;  1CMX B;  1FXI A;  5E6J A;  4A90 A;  1T0S C;  2AEH A;  2BB5 A;  1KF6 B;  3WAO A;  3HVD A;  3P4Q B;  1PGA A;  1WJ4 A;  2FCN A;  3X23 A;  1V97 A;  3QAR A;  4KGT A;  1MI0 A;  4DHZ B;  1OGW A;  2LXA A;  3OJ4 B;  3V05 A;  2C7N B;  3PV1 A;  4AJW A;  3EA6 A;  4US9 A;  1WMH A;  1YN3 A;  4C80 A;  4KKI A;  1E9M A;  4N59 A;  2JRH A;  3ZIM A;  2J0M A;  3RNG C;  3VTV A;  3MP9 A;  1I4R A;  3H7S A;  2REX A;  3E9S A;  4XC2 A;  4OZC A;  1L0V B;  1IGC A;  3ENE A;  2BS4 B;  1R4M B;  4HDO A;  3VQI A;  1IGD A;  3N1Z C;  3ZNH B;  1UEL A;  3GZN I;  1LO5 D;  2LEK A;  1K53 A;  3BVG A;  3Q8A A;  1YIW A;  2GBK A;  3ZTC A;  4L1B A;  3DBL I;  4ANU A;  4TUU A;  3DQV A;  3EFU A;  3V6C B;  1B9R A;  1YX5 B;  2D3C A;  3AU5 A;  4FJV B;  3MHZ A;  2KDB A;  3JYU A;  1KRH A;  3GP7 A;  2PTL A;  2J0J A;  3JW0 X;  3VVW B;  1KLU D;  3CWI A;  3MC9 A;  4PT5 A;  2C9W B;  4WJQ A;  5EE3 A;  1SXT A;  2WDT B;  1MJD A;  4ZOH C;  3B0A A;  1WSP A;  1I7H A;  1TS5 A;  2LGD A;  4MGK E;  4DQO C;  3ZUN A;  1XCT L;  2ZPY A;  5I4D A;  2JRI B;  2CHZ A;  5EE9 A;  1UNS A;  4ZRQ A;  2I2Y A;  2LI5 A;  3W1S A;  1SSN A;  3IAM 1;  2KWC A;  1RAX A;  1P9D U;  1WYW B;  1JQ4 A;  3L0W B;  3I5J C;  3AB5 A;  3Q14 C;  3RNE C;  3EHV A;  2QHO A;  3DHI C;  3HUI A;  2MBO A;  4I6P A;  1ROE A;  2LHD A;  2KD0 A;  5BMG A;  5IN7 A;  3ZGZ A;  4NJC A;  3R2T A;  2Y3A A;  2LGY A;  3ZNI D;  2SEB D;  2INP E;  1JCK B;  5D7G A;  5CTR C;  4ZRI A;  4HLE A;  1HE8 A;  3GB1 A;  1QLB B;  3NOB A;  2D11 A;  3A9K A;  2IO1 B;  4IWQ A;  4DK5 A;  3B1L X;  1NBF C;  3AEG B;  3N9Y C;  2RDG A;  4LNF A;  2BYT A;  1WZ0 A;  1TS3 A;  5FKA C;  4KSK C;  1VJK A;  1Q1O A;  4FAD A;  3QCA A;  4KSL C;  1EF1 A;  4LDT B;  3GZN B;  2KAN A;  3H7P A;  3UIN B;  3ZRC A;  4RGT A;  3UGB B;  5J17 A;  1N62 A;  1SIF A;  1SBB B;  4LTU A;  1D6E C;  2Z0D B;  2ZEQ A;  3NHE B;  3DBL B;  4BBN C;  4XYC A;  1NYR A;  2OJR A;  4DDI D;  2NR2 A;  2CJN A;  2K9X A;  2L0F A;  3PPA A;  3Q3F A;  2KJ6 A;  3ZLZ A;  1F2R I;  4M0W A;  2EKI A;  3N32 A;  4YTM B;  3UI3 A;  4TV3 A;  3AEE B;  2DAF A;  1BML C;  2EMT A;  4MGY E;  3TIX A;  1QKZ A;  1SGH A;  1E6E B;  3KUC B;  4FHK A;  4P16 A;  5D94 A;  1JWS D;  2M8S A;  2INN E;  2WXK A;  1YQ3 B;  3AE8 B;  3CF4 A;  1JWB D;  4P6V F;  2L05 A;  1E7V A;  4W9G A;  4F1S A;  3M3J A;  2KWV B;  2L1A A;  2KDF B;  2BBC A;  5HG2 A;  5IOI A;  1TS4 A;  2KX3 A;  2IYD B;  2W3S A;  1C77 A;  1TKG A;  2CJO A;  4RM8 A;  4OHJ A;  2GBJ A;  1I4Q A;  5FR6 A;  1STE A;  4W9I A;  3R66 C;  2WXN A;  3O65 B;  3ZNZ B;  4C7Z A;  4HDQ A;  2HTH A;  3SD5 A;  4K3B A;  2O6V D;  1JWA D;  2D5G A;  2NTT A;  3PRP B;  1D3Z A;  3W9C B;  2FNJ B;  2KVZ A;  3AXC A;  2CR5 A;  4PYZ A;  1K50 A;  4Q2J A;  2BKR B;  2IGD A;  3P42 A;  4W9K A;  3Q3O C;  3EGR A;  2FCM A;  4FXC A;  1UD7 A;  2EEL A;  2JXT A;  3LB8 C;  2V3S A;  3N20 C;  3V62 A;  3ZTD A;  4E3C A;  1D4B A;  2C5L C;  4HPM B;  2ZW0 A;  2BF8 B;  1FD6 A;  1OQR A;  2WQY B;  2L8J A;  3EEC A;  4HRO A;  4O1N A;  3ABV B;  4I6L B;  5CHV C;  1A70 A;  2XK5 B;  1ET6 A;  3TL5 A;  2N0S B;  2ZVN A;  3B2G A;  3TMP B;  2WXL A;  4L23 A;  4WWM A;  3AE7 B;  1F52 A;  3FIL A;  5LXI B;  1E7P B;  2JUO A;  3UQA A;  3VUW A;  1L6U A;  2ASQ A;  2ZNV B;  3EUB 2;  2KO3 A;  4EOY A;  3ZQ4 A;  3T9L A;  2K25 A;  2BPS A;  2QCZ A;  1UBI A;  4A9A A;  4G11 A;  5L95 C;  2L52 A;  3DBS A;  2CKH B;  2LD9 A;  3A9K B;  1UGM A;  4ITK A;  2RGF A;  1GC6 A;  4TQ0 A;  1EWY C;  4BOZ B;  3WAN A;  2MW5 A;  1RLF A;  2RDH A;  3MHS D;  2LVO A;  4X57 B;  5AZG A;  4MM3 A;  4GDL B;  3VR9 B;  2DZM A;  3TEW A;  1RM6 C;  3PRE A;  4CYE A;  1N5X A;  1E10 A;  2I1J A;  2Z8L A;  4M00 A;  1WF9 A;  2IGG A;  2NVU I;  2PEA A;  5D2M B;  3NS1 A;  2XN9 C;  2DWQ A;  2A5U A;  3ZDT A;  3AM9 A;  2V4I B;  1EO6 A;  4AOF A;  3AH7 A;  1T3Q A;  2J42 A;  4M0W B;  1HZ5 A;  2KN5 A;  2ON8 A;  2D3A A;  1K8R B;  3CMM B;  3AEF B; 
#chains in the Genus database with same CATH homology
 1CJE A;  1FNU A;  3HRD D;  1HZ6 A;  3AEC B;  2W82 A;  4WQM A;  1HQR D;  1TKY A;  1VLB A;  3MC0 B;  3BVM A;  1ZPS A;  2L32 A;  5H8Y E;  3RFZ B;  3NUH B;  2Y5P A;  4OVZ A;  2AQ1 B;  5HFY A;  2NTS A;  1GAQ B;  3ETR A;  1P7F A;  3RPF C;  2W3R A;  3P63 A;  2BS2 B;  3NVV A;  4XDD A;  1AN8 A;  3VRB B;  4MM3 B;  5C2T B;  4WH4 A;  1TZO A;  2WP9 B;  1MVK A;  4YSY B;  4DXG A;  2J53 A;  2WLB A;  3AE2 B;  1DGJ A;  1RWS A;  2ICI A;  5HI1 A;  3AEA B;  1IUE A;  5TSS A;  1N5W A;  1NI3 A;  3KLS X;  1V1P A;  5D3D A;  2KDM A;  1EWC A;  3PZ7 A;  4MT5 A;  1FXI A;  5E6J A;  4A90 A;  2JSV X;  1L0Y B;  1PDX A;  2VZK B;  1CK1 A;  4KGS A;  2BB5 A;  5BYR A;  1KF6 B;  1J7B A;  1XEE A;  1OFF A;  3HVD A;  2L83 A;  1C9F A;  4XDC A;  3P4Q B;  5HHD G;  1PGA A;  3KQ4 A;  2V3P A;  5JXV A;  2WNM A;  1NEN B;  4OW0 A;  1V97 A;  3Q8B A;  4KGT A;  2JWU A;  1MI0 A;  5BMH A;  3BII D;  1XCQ L;  4C7Y A;  1ZP0 B;  3Q8C A;  1EU3 A;  2W55 A;  2PIA A;  2E3T A;  4JWS C;  4CQN A;  1QF6 A;  4JWU C;  3KWV A;  1E0Z A;  1SJE D;  1JWM D;  3V05 A;  1TKE A;  2WXP A;  4RNA A;  3EA6 A;  1V1O A;  4US9 A;  1BUI C;  1YN3 A;  3P4S B;  4XWT A;  4C80 A;  5BYQ A;  4KKI A;  1SE4 A;  1E9M A;  3OWE B;  2AQ2 B;  4N59 A;  1V8C A;  3URY A;  4RH6 A;  2JQR B;  2FUG 1;  3TEY A;  3MP9 A;  1I4R A;  3NRZ A;  1FFV A;  5LNK 1;  1N63 A;  3E9S A;  2LMC A;  1QIL A;  2JU6 X;  4OZC A;  1L0V B;  1IGC A;  2BS4 B;  5T8I A;  4EE2 A;  4XWW A;  2BT6 A;  3VQI A;  3AV8 A;  1SF0 A;  1IGD A;  1JRP A;  1YNT E;  2QIL A;  1CZP A;  1QQR A;  3BZD B;  1LO5 D;  2LEK A;  1L4Z B;  1C4A A;  1K53 A;  3BVG A;  3IXS A;  2HTM E;  3Q8A A;  1PGB A;  2WXI A;  1H7W A;  4L1B A;  1UWX A;  3C8Y A;  4GDK B;  4YWG G;  1JW9 D;  2N9K A;  1B9R A;  2LJI A;  3AE1 B;  1C76 A;  2GB1 A;  1C4C A;  2MJE A;  1QOG A;  3MHZ A;  1KRH A;  2DLB A;  2FE8 A;  3GP7 A;  3NVZ A;  2PTL A;  3TSS A;  2X38 A;  3ZYY X;  4MAC A;  5D3I B;  1ESF A;  3B9J A;  1KLU D;  3CWI A;  1WRI A;  1FMA D;  4PT5 A;  3VRA B;  1OQQ A;  1H7X A;  1HEZ E;  1FNW A;  3VR8 B;  1SXT A;  3GS2 A;  5EE3 A;  1L4D B;  4GLS C;  1IBX A;  1SEB D;  2ZW1 A;  3U52 E;  3U7Z A;  3Q8F A;  4ZOH C;  3SFE B;  3FC4 A;  1WYG A;  3MJ5 A;  2JX5 A;  4YT0 B;  1WSP A;  1FIQ A;  1I7H A;  1TS5 A;  4DQO C;  1K51 A;  2WXH A;  3H8H A;  1XCT L;  5I4D A;  2FBW B;  2WU5 B;  2OED A;  4US8 A;  5EE9 A;  1UNS A;  4ZRQ A;  2I2Y A;  2WXR A;  3W1S A;  2MJ3 A;  1R7S A;  1GB4 A;  1SSN A;  4TSS A;  3IAM 1;  2ACZ B;  1UUP A;  2KWD A;  2MJD A;  1Q10 A;  4HEA 1;  4TQ1 A;  1C4P A;  2N7J A;  1SE3 A;  2WXM A;  4HJG E;  3AE4 B;  1JQ4 A;  2RPV A;  1ZDX A;  2WU2 B;  1MHX A;  3AB5 A;  2WDV B;  5C3J B;  4RGN A;  1NEK B;  4JX1 C;  3HUI A;  4TMA B;  1UWM A;  1TY0 A;  1YQ4 B;  1P7E A;  3DWM A;  2KQ4 X;  2BS3 B;  2V0G A;  2JYE A;  2JYT A;  3AE9 B;  1J7C A;  1ROE A;  2LHD A;  1F2R C;  2IDY A;  2QIE B;  1B1Z A;  3P4P B;  4RF0 A;  5BMG A;  1C79 A;  3ZGZ A;  4YXD B;  4NJC A;  3R2T A;  2Y3A A;  2WXO A;  2KMM A;  2SEB D;  2INP E;  1JCK B;  3AE6 B;  5D7G A;  1PUT A;  1EU4 A;  1FFU A;  1JAL A;  3GB1 A;  1QLB B;  2PLP A;  2PVO D;  3B2F A;  4IKG A;  2J52 A;  3HVZ A;  3AEG B;  1DOI A;  2RDG A;  3N9Y C;  3PZ8 A;  2WS3 B;  4MH8 A;  1VRA B;  4NAM A;  4A8X C;  2BYT A;  1DOY A;  1TS3 A;  5FKA C;  2YEP B;  3R2I A;  4YTN B;  1GB1 A;  3O13 A;  1VJK A;  5GXG B;  1T6B X;  4B0M A;  1CQV A;  2G9H D;  1D5M C;  3IT6 B;  3LYY A;  1I4H A;  4RCO A;  3AED B;  1XLP A;  2E6X A;  3ZJV A;  4RGT A;  1N62 A;  1SBB B;  2PW9 A;  4LTU A;  4NZL B;  1D6E C;  1N61 A;  4USA A;  3SFD B;  2H89 B;  3TEZ A;  1XLO A;  2M0A A;  3KWL A;  4ARC A;  2AX5 A;  1NYR A;  4REZ A;  5EE0 A;  1GT8 A;  3U4E G;  3Q8E A;  4ARI A;  1KH0 A;  2CJN A;  2K9X A;  2KAJ A;  3CIR B;  4UDU C;  2LGI A;  1F2R I;  1V1P B;  4M0W A;  2EKI A;  4YTM B;  4D2K A;  1UGJ A;  4N6E B;  3UI3 A;  2QEJ C;  3FAH A;  3R8B A;  3AEE B;  2PKO A;  1VR9 A;  5AUI A;  4KX6 B;  2G1E A;  1BML C;  1XLQ A;  5AUK A;  2WXF A;  3J9C A;  1XXG A;  1KLG D;  1JWU D;  1MHH E;  2ONQ A;  1QKZ A;  1E6E B;  4P16 A;  1JWS D;  3IT4 B;  2INN E;  1ZUD 2;  2Y5C A;  2WXK A;  1YQ3 B;  3AE8 B;  2K5P A;  3CF4 A;  3T3N A;  1JWB D;  4P6V F;  1L6V A;  4B0E A;  2RMM A;  1M4V A;  3BVZ A;  3I57 A;  2L1A A;  5BMI A;  2BBC A;  1D5X C;  5HG2 A;  1I4P A;  3TEX A;  5MPO A;  1TS4 A;  1F0Z A;  1PGX A;  1YN4 A;  2GI9 A;  1BXT A;  2PMV A;  2QJL A;  1F77 A;  1PFD A;  2W3S A;  1C77 A;  1TKG A;  1XLN A;  2CJO A;  3W2D A;  4OHJ A;  1FM0 D;  1TS2 A;  2IGH A;  1SIJ A;  1XO3 A;  4YTP B;  4JPS A;  1QOB A;  1I4Q A;  2HDE A;  2N9L A;  4WUR A;  2MH7 A;  1NYQ A;  1FCC C;  3TUO A;  1STE A;  4RFB A;  1TJE A;  4A55 A;  1FO4 A;  2Q5W D;  4LLG M;  4OZA A;  2WXN A;  4JE3 B;  5EE1 A;  2JZP A;  2DYM A;  4LK0 M;  2LFI A;  1FNV A;  4C7Z A;  4KKJ A;  2M19 A;  1VZ6 A;  2B76 B;  3PO0 A;  1K52 A;  1RYJ A;  1FCL A;  1JWA D;  2D5G A;  2CU3 A;  1JRO A;  2NTT A;  3W9C B;  2NMQ A;  4R3D A;  1FRR A;  3Q69 A;  4ZYS A;  2WXG A;  1DOX A;  1K50 A;  1MPE A;  1DYQ A;  4Q2J A;  2WXJ A;  2IGD A;  3IAS 1;  3P42 A;  1ZDV A;  4YSX B;  2BB6 A;  4YSZ B;  3BYY B;  3LXF A;  2H88 B;  1FRD A;  1QOA A;  1WXQ A;  1ZE3 D;  1TY2 A;  3EGR A;  4FXC A;  3NZ3 A;  2JXT A;  2EEL A;  2LHE A;  3BK1 A;  1IBX B;  1GPX A;  1VZ7 A;  2KN4 A;  2OHF A;  3LB8 C;  5G5G A;  3P1M A;  4HKQ A;  4A6Q A;  4AQ7 A;  3NVY A;  1EM7 A;  2IPK D;  4L2Y A;  2LUM A;  4C56 C;  1L0X B;  2WDQ B;  1D4B A;  2K22 A;  3U2S C;  1D5Z C;  1ENF A;  2W54 A;  1YJI A;  2ZW0 A;  2YEP F;  4ZHP A;  3W5U B;  1FD6 A;  1OQR A;  3SR6 A;  2WQY B;  2M56 B;  4DXF A;  5FR3 A;  2PVG C;  2K0P A;  1SB3 C;  3ABV B;  1GOZ A;  4HRO A;  4O1N A;  3AEB B;  1A70 A;  1Y56 A;  1ET6 A;  3T3O A;  1AWD A;  2N0S B;  5FK9 C;  1KTK A;  3B2G A;  1JML A;  4WIP A;  4RF1 A;  5H92 C;  4AS1 A;  1N60 A;  2WXL A;  4L23 A;  4WWM A;  2QMT A;  3AE7 B;  1YN5 A;  1FXA A;  3FIL A;  1E7P B;  1ET9 A;  1I4X A;  2V3N A;  3E56 A;  3L4P A;  1GTH A;  1L6U A;  2WDR B;  1NVI D;  1VDV A;  1ZXH A;  3EUB 2;  1ACC A;  1HA5 A;  1SJH D;  3V3X A;  2MEK A;  1GTE A;  4ZHO A;  4J3O D;  5BYS A;  2QSD A;  4RGO S;  3DWG C;  3ZQ4 A;  3ZJT A;  3NVW A;  1J7A A;  4A9A A;  3BYT B;  3BK2 A;  4OZB A;  1QOF A;  2L52 A;  2IJ0 A;  2XNA C;  4IDI A;  3BWU D;  4ITK A;  1I4G A;  4TQ0 A;  1EWY C;  1QT9 A;  4RGM A;  1HXY D;  2WXQ A;  2RDH A;  1T5X D;  2DYO A;  2BW2 A;  2GRI A;  1WGK A;  4XE0 A;  3W5V B;  3AN1 A;  1ZOY B;  4GDL B;  4HKZ E;  3VR9 B;  1VZ8 A;  3TEW A;  4IOI E;  1RM6 C;  2VZK D;  1WWT A;  1KFY B;  1N5X A;  1ZXI A;  1YMH E;  2TSS A;  1E10 A;  3ZJU A;  3SEB A;  4H2A A;  1PYW D;  1RFK A;  2Z8L A;  3P4R B;  3FIL B;  3MFG A;  2IGG A;  3AE5 B;  2R61 A;  5G5H A;  4ZRP A;  2DBY A;  1AYF A;  2XN9 C;  3NS1 A;  2DWQ A;  3AE3 B;  1C78 A;  4NAW B;  3AM9 A;  4KGR A;  2V4I B;  2I38 A;  2SAK A;  1FEH A;  1TYG B;  3I9V 1;  1YJJ A;  1SE2 A;  1T3Q A;  2J42 A;  3AH7 A;  4HRS A;  4WAF A;  1HZ5 A;  2ON8 A;  1AW7 A;  2KAC A;  3AMZ A;  1XF5 L;  2AQ3 B;  3WCQ A;  2K3U A;  4N58 A;  3AEF B;  2J4X A;  1L5P A;  2BTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...