2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
1I7HA 5MPOA 1EWYC 4US9A 3SR6A 2BS4B 2WDVB 2CJNA 2K9XA 1GTHA 5GXGB 3VRBB 2PKOA 5EE0A 3AB5A 4JWUC 2BS3B 2K22A 2N0SB 2W3SA 3BIID 3NVYA 3AE3B 1RWSA 1XLQA 1ZXIA 1N62A 2MJDA 4LTUA 3AMZA 3AE9B 1N60A 1QOFA 1QF6A 1NYRA 1XLNA 1J7BA 2M56B 2WLBA 3LXFA 3ZYYX 1E10A 1JQ4A 3HVZA 3L4PA 1AWDA 1L0VB 2PVOD 1ZUD2 1ZOYB 1JALA 1N61A 1WYGA 1FRDA 3NVVA 2B76B 1B9RA 4FXCA 2CJOA 2EKIA 3RPFC 4HROA 1TKEA 3FC4A 1F0ZA 1FM0D 1VJKA 1SF0A 3DWGC 1VLBA 4ZHOA 1FMAD 1JW9D 4HRSA 1JWAD 2W55A 2WP9B 3AE6B 3AN1A 1NYQA 3ETRA 4WQMA 1YJJA 4N59A 2DWQA 4C80A 1GPXA 1FRRA 1YQ3B 3P63A 4IDIA 2OHFA 2HTME 1J7CA 1FFUA 1XO3A 1WRIA 2Y5CA 1JWBD 4JX1C 3AEBB 1E0ZA 4P6VF 2KMMA 3SFEB 2E3TA 3AE4B 3AEGB 5AUKA 4YXDB 1KFYB 3P4SB 1N63A 1OQRA 1SB3C 2AX5A 2W54A 1DOYA 1FFVA 3VR9B 1E9MA 1R7SA 1A70A 3HUIA 3AECB 3AEFB 3W5UB 1OQQA 1FIQA 3W5VB 1KRHA 1RFKA 4KX6B 3AH7A 3LB8C 1WGKA 3NRZA 1E7PB 2H89B 1IUEA 4YTMB 2W3RA 1H7WA 4YSYB 2L83A 3B2FA 1NVID 1H7XA 1XLPA 1V97A 4YT0B 3B9JA 1QOAA 1J7AA 1WWTA 4N6EB 3AE5B 2WU2B 3AE2B 5EE1A 5C3JB 5AUIA 1XLOA 4ZHPA 2BS2B 2WDQB 3AE7B 1DGJA 4WWMA 3AEDB 1TYGB 3P1MA 3AE8B 2Q5WD 1CJEA 3AM9A 4C7YA 3CF4A 3DWMA 1JRPA 1L6VA 1TKGA 2MJ3A 1FXAA 3NVZA 3VR8B 3AE1B 1L6UA 1DOXA 2PVGC 1T3QA 5EE3A 1KF6B 2M19A 4ITKA 3B2GA 3FAHA 1WXQA 1GAQB 2WS3B 5EE9A 3P4QB 2ACZB 1YJIA 3KWLA 2WU5B 4YTPB 3WCQA 1ROEA 2JX5A 3PO0A 4N58A 4YSZB 4US8A 1VDVA 3W9CB 3ABVB 1SIJA 2LEKA 2DBYA 5H8YE 1E6EB 2FBWB 2PIAA 1QLBB 1YQ4B 1AYFA 1DOIA 1TKYA 3HRDD 1ZP0B 2CU3A 3NS1A 3VRAB 1JROA 2WDRB 1UWMA 1N5XA 2MJEA 4USAA 1RYJA 1PFDA 1QOBA 5G5GA 1GT8A 5H92C 4JWSC 1NENB 1NEKB 1QT9A 2MH7A 4ZOHC 3P4PB 4YTNB 1CZPA 1NI3A 1L5PA 2QIEB 4A9AA 3P4RB 1RM6C 1TJEA 5G5HA 2WQYB 2K5PA 4C7ZA 1OFFA 1FXIA 1QOGA 3EUB2 3AEAB 3AV8A 2BT6A 3CIRB 2JQRB 2H88B 2L52A 3SFDB 1V8CA 2KAJA 3AEEB 1PDXA 5C2TB 2G1EA 1N5WA 1PUTA 3CWIA 4YSXB 2QJLA 1FO4A 3NVWA 1GTEA
chains in the Genus database with same CATH superfamily
2LASA 2K9XA 2INDC 3Q3OC 2O2VB 3PPAA 2IO1B 3T3OA 1YN5A 3NZUA 2DLBA 3UIOB 2KNBA 4BBNF 3L4PA 1AARA 4P1CC 5G2NA 1L4ZB 3ZJTA 2MEKA 3PHXB 3DWGC 2KDIA 3ZXVA 4HRSA 3AN1A 2WXHA 1MPEA 3P63A 4E3CA 2QC8A 5IAAC 2FCNA 1WE6A 5EDSA 4LDTB 3T8MA 3TJPA 4GGQA 3KYDD 1R4NI 1TZOA 3W5UB 2WXFA 2HDEA 2KDBA 1WIAA 3AE2B 1KOTA 5AZHA 1IGCA 2TSSA 1IYFA 2CR5A 1OEYJ 3U4EG 1ZXHA 2I1JA 4EZJA 5TSSA 4AJWA 2IO0B 3EFUA 3KW5B 2WXKA 1H8CA 2N4FA 2J0JA 3TEZA 1V6EA 2PPHA 3RNFC 1P0RA 1P3QU 3PSEB 4TQ1A 1PGXA 2KK8A 3RI7C 1AW7A 2QIEB 4WAFA 1LGRA 1QOGA 3URYA 3ZDMC 1KM7A 3CSTA 3J9CA 1N5WA 2KJ6A 2RDHA 2SAKA 2WXQA 2KDMA 4GIVA 4UDUC 3H7PA 4ANVA 2MBOA 2JZPA 5EE0A 2L0FA 1I4QA 4JWUC 4IM3A 3ZQ4A 3R8BA 3PGEA 2IZVB 1FPYA 1WX7A 1WZ3A 3Q2AC 1UBIA 3QJZA 4I6LB 4GXBA 2FUHB 2LRWA 3VTWA 3M95A 2C7HA 2DZKA 4FN2A 3PREA 2RD0A 2O6VB 1FMAD 4HDOA 1WXAA 2KWUB 2AQ2B 3OLMD 2NCNA 1V9JA 3PZDA 2BF8B 2EELA 2J0KA 2KN4A 3Q69A 4YXDB 5JZEB 2HE7A 1XCQL 1VR9A 1DOYA 4LCDE 3QK0A 1Q0WB 4TQ0A 5DPRA 4P16A 1FIQA 1KRHA 5BMHA 4WWPA 1SEBD 2DYMA 4AUQC 2IO2B 4IW0A 3B2FA 4HJKA 2WX1A 4KGRA 3QQ8B 4XWTA 3UGBB 5HHDG 3BVGA 1SE3A 2MWSB 2JZZA 1J0GA 1JRPA 2MJ3A 3NVZA 4A3PA 1WZ0A 2BWFA 2WS3B 3N20C 2K1FA 3DBRB 4US8A 2DBYA 1QLBB 3MHZA 2BYFA 3GZNI 4HEA1 2BQQA 2ZCCA 2LI5A 4LNKA 2GBNA 1ZDXA 3PRZA 3PS6A 1OEYA 2KQ7A 4KDLB 2KJRA 2CJNA 3KWVA 2MBQA 1S3SG 2LRUA 2BYVE 2VZKD 3QA8A 3AE3B 4RMAA 1MG4A 1QOFA 3N3KB 3EFCA 2O6VD 4A6QA 3ZYYX 2ZCBA 5TR5A 1E8WA 2DZJA 1WYGA 3MC9A 4FXCA 2LHDA 4LK0M 4L2YA 4HPMB 3U7DA 4A3OA 3W2DA 1NDDA 4TUUA 1YJJA 2PEAA 1E0ZA 2HJ1A 2KVZA 4REZA 4KGSA 1TY0A 1KFYB 2N9LA 2DAJA 3A4RA 2L00B 3U52E 4CQNA 1WMHB 1WGKA 4IM0A 4LNNA 2LHEA 3N9YC 3IBEA 3EC8A 3N30A 4W9KA 3DCGA 1WJUA 3GS2A 4ZHPA 2Y5PA 3N1YC 2RSUA 2X38A 4KGTA 2FIDA 2LVPA 2E6XA 3QARA 1FNVA 1P7EA 1SBBB 1WXQA 1YJIA 4C56C 1TIFA 4N58A 1Y8RC 3U8ZA 3PZ8A 4WAAA 1AYFA 3ZVVA 1RFAA 3WIMA 2INPE 1QT9A 2N1VA 1D5ZC 2Z8LA 3VHTC 1XF5L 4CYEA 1OFFA 5JHBA 4EE2A 1I4HA 4W9FA 2H88B 2PTLA 4IUMB 4DDGD 2K6QA 5MPOA 2J4XA 4HK2A 4CHKA 1TTNA 3ZKJC 3E56A 1LXDA 2LZ6A 2XNAC 2GOWA 3LXFA 4PYUA 3U7ZA 3GE8C 1P98A 2NPTA 3RPFC 3UIPB 2NBUA 3L54A 4NNJB 4GN1A 2DNFA 2JXXA 3IAS1 3M63B 4TSSA 4S17A 1GB4A 3VQIA 5AEKB 2E3TA 4IWOA 1SB3C 4J6IA 3VUWA 4R3DA 2BB6A 3AH7A 3LB8C 1XLPA 5AUIA 1C78A 1KLUD 3AEDB 1SSNA 4M0WA 3MP9A 4AWJA 4F1SA 1CJEA 1HZ5A 4OVZA 2L05A 3BVZA 3HM6X 2G4SA 5G55A 1WGHA 2YEPB 2WXLA 1C4AA 4NZLB 2M19A 5L95C 2WXIA 4MJSB 2C60A 3P4QB 1WGGA 2WU5B 2KT7A 3WANA 1MHHE 4JL9A 1D6EC 2GMIC 3BWUD 4KDIC 2CHXA 2LMCA 3I57A 1N5XA 4GDKB 3HHMA 4FHKA 3VH4B 1NENB 4WQOB 2Z59B 4OW0A 2L1AA 3KYCD 1CQVA 5AZGA 4WWNA 4M02A 3SFDB 2LWPA 2KLGA 3W1YA 1N6ZA 2BS4B 2WDVB 1XCTL 2J0MA 2FIFA 2JYEA 3A1QA 4F8CB 5FR6A 1YOVB 1B1ZA 4W9CA 4DHZE 4ZRIA 1YX6B 2RDGA 3Q8CA 1ZKHA 3GB1A 3Q14C 2CJOA 3N1XC 3H9DA 3ZUNA 1Q10A 1JW9D 1SJED 3DHGC 1J8CA 1WX8A 3WAOA 2C9WB 2KLCA 4B0EA 1F2RC 1WJ4A 3NJTA 3K9PB 1UWXA 3RYTA 2AYOB 3L17A 1TS5A 2AX5A 3HUIA 4MACA 1V1PA 3NRZA 4KKJA 2M1MA 1IUEA 4LNOA 1WMHA 2FCSA 3PVLA 2J7QB 4HVBA 5DPWA 3L16A 1QOAA 5FK9C 1C4CA 4NAMA 1TKGA 1MFWA 1JWUD 2HD5B 2LGSA 2N7DA 5LXHA 1C76A 1RLFA 2KWCA 1ZGUB 4E74A 3OG5A 3W9CB 1X1MA 3HRDD 1SJHD 3NS1A 1EF1A 4MEMA 3E9SA 4P7IA 1ET6A 2JU6X 2BYEA 3P4RB 4OVVA 2UYZB 4W9JA 5C2TB 1CMXB 1WYWB 2MRPA 3NOBA 3NVWA 2IJ0A 1EWYC 1KLVA 4MH8A 1HTQA 4GB9A 1GTHA 2VH1A 3GZNB 2RPVA 2KMCA 4NAWB 3AE9B 1V1PB 2X8XX 1YJ1A 5HKHA 4HJGE 3RCZA 1P9DU 3BZDB 1I42A 2QCZA 1FM0D 2BKFA 3DQVA 2JF5A 1I4RA 2ASQA 1JWAD 1I4GA 1GPXA 1WXVA 4C00A 3SU8X 3QWZB 3UI3A 1HE8A 1JWBD 1V49A 4EOYA 3WALA 3ECIA 3AEGB 3JVZX 3JSVA 3T3NA 4ICUA 1OQQA 3A4SC 4II2B 4C4VB 4XWWA 1H7XA 1JMLA 2G3QB 2LGIA 2KX0A 2BS2B 3R3MA 3LJ3A 3T9LA 2KTRB 1DGJA 1WR1A 3HK0A 3L13A 3V3XA 3DBHB 1WF9A 1FXTB 3AE1B 4M01A 4EZKA 2PVGC 4K7SA 3OAWA 3P2BA 2V3SA 3N32A 3ZRCA 1K50A 3U2SC 2W82A 1ZP0B 1UWMA 2UU7A 4EKUA 3L0WB 2KYWA 5G5GA 3SEBA 3V05A 2C7NB 3VTVA 2FAZA 5IKCM 4ZOHC 3P4PB 1CZPA 4HCNB 4LJOB 5JHAA 5G5HA 1Z2MA 2V3PA 5DPTA 3NZ3A 2JQRB 3R66C 1IP9A 1MG8A 1P1AA 1F52A 1PYWD 1FO4A 4Q2JA 3ZNHB 1LQBA 1E8YA 3AU5A 1SIFA 2YLMA 1XLQA 3DDCB 3KUDB 1QF6A 1YIWA 1YMHE 1EO6A 2D10A 1JCKB 4PS3A 2L7RA 2XBBC 2GBJA 3ZJUA 3Q3MC 3R2IA 2JWZA 3A9KB 2WDTB 3ALBA 2B76B 2JUOA 5I4DA 1SXTA 4GOCA 5JH5C 1KTKA 1ACCA 2YEPF 2MHJA 2KVRA 4DXAB 4ZHOA 1SE9A 2K8CA 2W55A 2WP9B 5E6NA 5LXIB 2DYOA 2R2OA 3AXCA 2WXJA 2YVCA 1J7CA 4BKSD 3BY4B 2IDYA 3S2AA 2KMMA 1XT9B 3NY5A 3P4SB 1YN4A 2M4NA 1ISNA 2RMMA 1KH0A 1MHXA 1K8RB 4LJPB 2AQ3B 3UINB 5J2RA 2LXAA 2KWVB 4IOIE 2LXCA 4N6EB 3AULA 3I63C 3IXSA 4EUTA 3AE7B 3Q3NC 3ML8A 2Q5WD 2FCQA 1ZDVA 4DQOC 1V86A 2CHWA 2IGHA 2D3BA 3VR8B 1WSPA 1DOXA 3N1ZC 4MSQB 4BOSC 4WURA 5IOIA 2G45B 3R7RA 3RNGC 4WIPA 3PO0A 4GDLB 2K39A 1IBXB 1ESFA 2LGDA 1VCBA 2PIAA 2WNMA 4II3B 1TKYA 1YQ4B 4FJZA 3VRAB 4DBGA 3WAMA 2MJEA 1ZW7A 1RYJA 3UF8A 2WHIA 1QQRA 1H4RA 3APCA 1MVKA 3KH0A 3P42A 5E6OA 3C0RB 2KACA 3AV8A 2JZ3B 2L52A 5JXVA 1V8CA 3DHIC 2D3AA 1PDXA 5D3DA 3KVFB 2WXGA 2DYBA 1TZ1A 2M0XA 3AB5A 1HQRD 2ZVNA 2L3ZA 3TEWA 4ARIA 2MJDA 3ZTCA 3RNAC 3IAM1 1N60A 3Q8BA 3O13A 1EU3A 4PS8A 2IY0B 2PVOD 3RNBC 1SE2A 2D07B 2LGXA 4MSMB 4YL8A 2CU1A 1SF0A 2BWES 1VRAB 2GLSA 4BZAA 2KC1A 4WJPA 3OWEB 2XK5A 4N59A 3UQAA 2GRIA 4K7WA 1XXGA 1WRDB 3WA0A 4LLGM 4K81A 4IKGA 4P6VF 3DVGX 4RFBA 3RT3B 5AUKA 2WXMA 3QC8B 3DBLI 3DBSA 4CO7A 1A70A 3RNEC 3VVWB 3K9OB 2LUEA 2KDFB 2H89B 4HLEA 4XDCA 1P7FA 1V97A 3M3JA 4IC7B 1T6BX 1J7AA 1WJNA 1WWTA 2WU2B 5C3JB 2ZPNA 2WDQB 2RGFA 3LYYA 2N7EA 4JLCA 3AM9A 2MBBB 4A8XC 1E8XA 1E7VA 1FXAA 2MA9B 2WXRA 5CHVC 5BMIA 5D6JB 4H2AA 2JVCA 4MGZE 4WJQA 1YD8U 5CHWA 3TIXA 3NS8A 1WE7A 4RF0A 2REXA 4EFOA 4MT5A 5IP4D 4B95A 1NI3A 2DZMA 4MDKE 2IGDA 4HXDA 2GB1A 4WWOA 1L2NA 4NQKE 2QMTA 1I7HA 4JPSA 5FR3A 2M8SA 3VRBB 2MX2A 1Q5WB 3CSFA 2RDBC 2K22A 4YWGG 1C4PA 4DXGA 4IWQA 1RWSA 2O6VA 4LTUA 2V1YA 2M56B 1J7BA 2WLBA 1JQ4A 3TL5A 3RD2A 4PS7A 1K51A 1ZOYB 2KWDA 4BFRA 3IT4B 2D3GA 2JY6A 2ZVOA 1VJKA 3Q8FA 2FCMA 2XEWA 1WR6E 3TEYA 4RGMA 4C80A 3VH3B 3MJWA 4JX1C 1T0RC 1RAXA 1GUAB 3VTUA 1E5WA 1MI0A 3MJ5A 2DHZA 1RFKA 2WX0A 2PE6B 1C77A 5EE1A 3QAQA 4B0MA 2C7MB 5E6PA 3VFKA 3MC0B 1A5RA 4MH0E 4GMVA 2MLBA 4G50A 3B2GA 2GI9A 4XGAB 1GAQB 2ONQA 1SE4A 3DPDA 5J17A 4DHJB 3BVMA 3X23A 4NY0A 1VZ7A 2ZNVB 1V5TA 3ZXRA 1NEKB 1YNTE 3IG3A 3ML9A 4A55A 4DK5A 3EUB2 2D11A 2ZZPB 1HEZE 1S1QB 1F9JA 2NBWB 5IN7A 1UH6A 4US9A 4MJSA 4ASWC 1D3ZA 1EF5A 4ZYSA 2AWTA 1LO5D 1BT0A 4E71A 1T0SC 1KJTA 1UBQA 1EWCA 1ZUD2 3KUCB 3NVVA 4ICVA 3PT2B 2EKIA 4XE0A 3KLSX 2N9XA 1TKEA 3AU4A 3WAPA 1E8ZA 1TY2A 3SHQA 2JPHA 2KD0A 3DOWA 1NYQA 3C8YA 4WQMA 4IDIA 2OHFA 2L8JA 2D2QA 4BKTA 3AEBB 2K0PA 2K8BA 3NZSA 4WJOA 3H6NA 4G0NB 1V81A 3DBHI 5BYRA 4K3BA 3AECB 3AEFB 1T0QC 1IBXA 3W5VB 2VZKB 4HKZE 4YSYB 2L83A 1PGBA 4J3OD 3A9JB 1GB1A 3V6CB 1WGRA 5LNK1 3DBLB 4WWMA 1TYGB 1STEA 4OHJA 1JWMD 2J52A 4C7YA 2MP2B 1L6VA 4NJ7A 3QIJA 1OQYA 2AL6A 3I9V1 4RGNA 1FNUA 3PRMB 1VDVA 2EKEC 2KTRA 1GC6A 2IYDB 2NR2A 1TT5B 2FNJB 3Q8EA 4FHJA 5C1ZA 1L5PA 3NUHB 4A90A 2K5PA 3BYTB 2KXJA 4XC2A 2W9NA 1I35A 1V5OA 1OGWA 4DXFA 1GTEA 3ENEA 2NPTB 2ZJDA 3B1LX 4LNFA 1WX9A 3BIID 4RM8A 1UZXB 4KZ0A 5IA7A 3TUOA 4HPLB 1E10A 2BB5A 3NHEB 1L0VB 1E7UA 1TS3A 1JALA 1N61A 2KFJA 1FRDA 2ZPYA 3PHWB 5BO4B 5E6JA 3FC4A 2N1WA 5D3IB 1L0XB 4L23A 1U4AA 3VXWA 1WM3A 3IT6B 3O65B 2BW2A 3UQBA 4RF1A 3PV1A 3OJ3A 4EZLA 2JRHA 1K53A 4RNAA 2JYTA 4MGYE 4LDTD 1ZPSA 3PLUA 2W3RA 4RGTA 4ZRQA 4M8NA 3APFA 1NVID 4MM3B 4GU2A 2L0TA 3A9KA 4ANUA 2VRRB 2NTTA 2WWZA 3QCAA 1C1YB 5CHFA 3H1UA 2IBIB 5BYQA 2Z0DB 3HM3A 2QILA 5FKAC 4DDID 3H7SA 4OZAA 1TBEA 2CS4A 4ARCA 3A33B 4IG7B 2KMAA 3RUIB 2OJRA 3PZ7A 3VUXA 4G11A 5CX3A 4C4VA 2KO3A 2MBEA 2DENB 5H92C 2K3UA 2AEHA 3ZNID 2PE9A 1RM6C 2J53A 2IY1B 2BGFA 5J18A 2PJHA 3QX1A 3R7QA 3ZIMA 1PUTA 3NG0A 5D2MB 2QDFA 2LUMA 3RZFA 4M8MA 4G3XB 2PKOA 3NVYA 4RM9A 1D5MC 1ZXIA 1LM8B 2BPSA 1T5XD 2R61A 2D5GA 3EECA 2BVCA 4B9KA 4NJ6A 4BKSA 2JT4B 3TSSA 5BMGA 3ZO5B 4ACFA 4KSLC 4W9IA 3C19A 1VLBA 1XD3B 3ZGZA 1J19A 3ZW3A 4W9GA 3DVNU 2D3CA 1YQ3B 1I4XA 1XO3A 3H8HA 4BKGA 2I1KA 1KLGD 1VZ6A 4M0WB 3AE4B 1IGDA 1L4DB 1WM2A 2KHWB 2W54A 2HJ8A 3RMKC 2LJIA 2WXPA 1ZE3D 2EMSA 3HIZA 4NAWA 5KHQA 1QKZA 1TGZB 4GSWA 3PTFC 4KIKA 4OVUA 3BINA 3TEXA 2MSED 4FJYA 4HDQA 4KKIA 3L10B 3DVGY 3ZTDA 2Y5BB 2V3NA 4MELA 1T3QA 1KF6B 4ITKA 1K52A 2WYQA 2KX3A 2V4IB 4JGHB 2B3AA 1E6EB 2FBWB 4KV2A 2WDRB 1R4NB 2R2QA 1M4VA 3GE3C 4BAXA 4K3CA 4A9AA 2NS5A 4HKQA 4ZDVA 2BBCA 4C7ZA 1UGMA 3AEAB 5AZFA 1BXTA 4FA6A 3BK2A 2V0GA 1WH3A 4JIOU 1WXMA 3AMZA 3RZWC 2KJHB 3HVZA 3DHHC 3EHVA 2MW5A 3V62A 2Z0EB 1UD7A 1YX5B 2JSVX 4RH6A 4ANXA 2INNE 3ETRA 1FRRA 3MTNB 4ZRJA 2KZRA 2Y5CA 3Q6BA 4S0RA 2M0AA 4MGIE 3SFEB 3I5JC 2L76A 1E9MA 2QSDA 1FEHA 4AP4C 2PLPA 3W1SA 1WXSA 2INCC 5GMVA 4YTMB 2BYTA 2KN5A 4RCOA 1G6JA 4PT5A 2XN9C 5DPSA 1GC7A 4BVUC 3W1SC 1Z5SB 2IGGA 2I2YA 1EU4A 4DHJD 2V4LA 1PQSA 3QHTA 1Y56A 3SDLC 5EE3A 1OTRB 3DVNV 1GG3A 3FKYA 2DAFA 3FAHA 4OZBA 3I3TB 3APDA 4YTPB 4TV3A 1ROEA 2N7JA 2NBVB 3SD5A 2LEKA 2QEJC 5H8YE 2V9HA 1RRBA 1GJZA 1JROA 2K8HA 2ZNVC 1C9FA 1V2YA 3Q8AA 3TBLD 3Q3FA 4M00A 1HXYD 2PMVA 4XDDA 1T0YA 1FXIA 2BT6A 3CIRB 3EA6A 2QJLA 3Q3JA 2BKRB 4AS1A 3SR6A 4WJNA 3V60A 3ZRFA 2N0SB 2W3SA 5CTRC 2SEBD 1WY8A 1NI2A 2CHZA 5C23A 2IPKD 1XLNA 3ZLZA 4GDKA 2C5LC 3LDZE 2LFIA 2BTEA 2KQ4X 4GLSC 1B9RA 2KC2A 1F77A 1F0ZA 1XQQA 1UF0A 4FJVB 2N9PC 1UGJA 3MHSD 2FUG1 1JWSD 4OZCA 3JYUA 1JRUA 3HVDA 4TKNA 4JE3B 2JRIB 4KIKB 1QZEA 4ZRKA 1TS2A 1N63A 4FULA 3IVFA 3VR9B 2QHOA 1R7SA 4KVGB 2JXTA 4GDLA 4KX6B 4FLHA 4D2KA 1HA5A 3KUZA 1H7WA 4HCPB 4YT0B 3MFGA 2ON8A 5HFYA 3VAWA 3P1MA 4O1NA 3DWMA 4JQWC 3B0AA 3MC8A 2M17A 1HZ6A 1ET9A 3PRPB 4LNIA 3CMMB 4A20A 2ACZB 2G9HD 2JX5A 1C79A 2HTHA 1QILA 4I6PA 3ONSA 3U30A 2LD9A 3FILB 4USAA 4MM3A 1PFDA 2L32A 3B08A 1GT8A 4JWSC 1M94A 2MH7A 3BK1A 2MCNB 3ZDTA 2OEDA 2XK5B 1L7YA 2FE8A 2ZW1A 1LFDA 3PLVA 2KAJA 3AEEB 2G1EA 2LJ5A 1HTOA 1SGHA 2AL3A 2A5UA 5GXGB 1C3TA 1UNSA 5KHOA 5DCNA 4W9EA 1N62A 3IFWB 2WXOA 1L0YB 1WI0A 2LVQA 1I4PA 1V80A 2MQJA 4FBJB 1Q1OA 1AWDA 4XZ4A 1D5XC 4RGOS 2RPQA 1EUVB 2J42A 4PK1A 4N9F4 3ZJVA 1ENFA 2PW9A 4F7ZA 4NJCA 1XEEA 1D4BA 3AE6B 3VUYA 2O2VA 2HTME 1YN3A 2G4DB 3ZNZB 1NBFC 4X57B 5T8IA 1WJ6A 3RFZB 1FFVA 2KKCA 1YQBA 2EMTA 1E7PB 2RR9A 1V1OA 2LVOA 2NMQA 4K1RB 1FNWA 2K6DB 4MGKE 1WFYA 3AE5B 3BYYB 3OJ4B 4IWPA 3CF6E 3DBRI 2DZIA 1CK1A 2N9EB 3CF4A 3VDZA 2IO3B 3R2TA 5IO9A 1L6UA 2KTFA 2NVUI 5D94A 2KFKA 3A9JA 2WGSA 4L1BA 5EE9A 1WGYA 5L83A 3D32A 4YSZB 1DYQA 3ABVB 4AQ7A 5HI1A 3JW0X 3JSVB 2OJWA 3IHPC 1DOIA 2MBHA 2Y3AA 4KSKC 4I6NB 2KQSA 2ZEQA 4KZCA 2GBRA 2KOXA 1UELA 2ICIA 1FCLA 2KFKB 3A1QB 2K25A 2MP2A 4B6WA 1GOZA 4AJYB 3CWIA 4YSXB 5HG2A 3RN9C 4HPPA 3M62B 4ANWA 3RULA 2BS3B 2LGYA 2DX5B 5D7GA 4DHZB 1UUPA 3L08A 1R4MB 1NYRA 4EEWA 2GBMA 4QAYA 2UWQA 1VZ8A 1EM7A 4URKA 1F2RI 3X0WA 3EGRA 2JWUA 1MJDA 4BOZB 3H7PB 2I38A 1AN8A 4HROA 3GP7A 5BYSA 4NPNA 1PGAA 4FADA 2DWQA 1FCCC 5LLIA 1BMLC 1FFUA 4NQLB 2KANA 1WRIA 4K7UA 3AI5A 4W9HA 2N9KA 3TMPB 4AOFA 1OQRA 2NTSA 1R4MI 2A4ZA 3V6EB 3B9JA 2GBKA 1IPGA 1XLOA 4ZYNA 1FD6A 1BUIC 1VD2A 3AE8B 2AQ1B 2OOBB 2WXNA 3GOEA 3KQ4A 4IM2A 4DWFA 1F1HA 2KDEB 4BBNC 2ZW0A 3V61A 2CKHB 3ZNGC 1E90A 1WGDA 3KWLA 4HWIB 4P1BC 4XYCA 3TCAA 3WCQA 4TMAB 3FILA 1SIJA 4XX5A 4PYZA 2CU3A 1TS4A 4W9LA 4WH4A 2VH2A 1QOBA 4W9DA 4YTNB 4ZRPA 1GNUA 3RNCC 1TJEA 2WQYB
chains in the Genus database with same CATH topology
2QMTA 1BXTA 1I7HA 2BS4B 2WDVB 1XCTL 2K9XA 4JPSA 5FR3A 3VRBB 3BK2A 2JYEA 2K22A 2V0GA 4YWGG 1C4PA 4DXGA 1RWSA 3T3OA 4LTUA 1YN5A 3AMZA 1B1ZA 2DLBA 2M56B 1J7BA 2WLBA 1JQ4A 1K51A 3HVZA 3L4PA 2RDGA 1ZOYB 2KWDA 1L4ZB 3ZJTA 3Q8CA 3GB1A 3IT4B 2CJOA 2MEKA 1VJKA 2JSVX 3DWGC 3Q8FA 4RH6A 1Q10A 1JW9D 4HRSA 1SJED 2INNE 3AN1A 3ETRA 2WXHA 3TEYA 1MPEA 4RGMA 4C80A 1FRRA 4B0EA 3P63A 2Y5CA 4JX1C 2M0AA 1F2RC 3SFEB 1UWXA 1TS5A 2AX5A 1MI0A 1E9MA 2QSDA 1TZOA 3HUIA 1FEHA 3W5UB 3MJ5A 2WXFA 4MACA 1V1PA 1RFKA 2PLPA 3NRZA 4KKJA 2HDEA 3W1SA 1IUEA 4YTMB 2BYTA 1C77A 4RCOA 1QOAA 4PT5A 5EE1A 2XN9C 3AE2B 5FK9C 1IGCA 4B0MA 2TSSA 1C4CA 4NAMA 3MC0B 2IGGA 2I2YA 1TKGA 1EU4A 3U4EG 1ZXHA 1JWUD 5TSSA 1Y56A 5EE3A 1C76A 3B2GA 2GI9A 3FAHA 1GAQB 2WXKA 4OZBA 2ONQA 3TEZA 4YTPB 1ROEA 1SE4A 2N7JA 3W9CB 2LEKA 2QEJC 5H8YE 3BVMA 3HRDD 1SJHD 4TQ1A 3NS1A 1JROA 1PGXA 3E9SA 1C9FA 1VZ7A 3Q8AA 1AW7A 1NEKB 1ET6A 1YNTE 2JU6X 2QIEB 4WAFA 3P4RB 1HXYD 2PMVA 4A55A 4XDDA 1FXIA 1QOGA 3EUB2 2BT6A 3CIRB 1HEZE 3URYA 3J9CA 5C2TB 1N5WA 3EA6A 2QJLA 2RDHA 2SAKA 3NVWA 2WXQA 2IJ0A 2KDMA 1EWYC 4UDUC 4US9A 4MH8A 3SR6A 4AS1A 1GTHA 2JZPA 5EE0A 1I4QA 4JWUC 3ZQ4A 2N0SB 2W3SA 4ZYSA 3R8BA 2RPVA 4NAWB 2SEBD 3AE9B 1LO5D 2IPKD 1V1PB 1XLNA 2LFIA 4HJGE 2BTEA 1EWCA 1ZUD2 2KQ4X 3BZDB 4GLSC 3NVVA 1B9RA 1F77A 2EKIA 4XE0A 3KLSX 1TKEA 1F0ZA 1FM0D 1I4RA 1UGJA 1FMAD 1TY2A 1JWAD 2FUG1 1I4GA 1GPXA 1NYQA 1JWSD 3C8YA 4WQMA 4IDIA 2OHFA 3UI3A 4OZCA 2AQ2B 1JWBD 3AEBB 3HVDA 4JE3B 2K0PA 2EELA 3AEGB 2KN4A 3Q69A 1TS2A 4YXDB 1N63A 5BYRA 1XCQL 1VR9A 1DOYA 3VR9B 4TQ0A 1R7SA 3T3NA 3AECB 3AEFB 1IBXA 1OQQA 2JXTA 1FIQA 4P16A 3W5VB 2VZKB 1KRHA 4KX6B 4HKZE 5BMHA 4D2KA 1HA5A 1SEBD 2DYMA 1H7WA 4YSYB 2L83A 3B2FA 4XWWA 4KGRA 1PGBA 1H7XA 4XWTA 4YT0B 3MFGA 4J3OD 1GB1A 1JMLA 2LGIA 2BS2B 5LNK1 5HHDG 2ON8A 5HFYA 1DGJA 3BVGA 4WWMA 1TYGB 3P1MA 1STEA 3V3XA 4O1NA 1SE3A 4OHJA 1JWMD 2J52A 3DWMA 4C7YA 1JRPA 1L6VA 2MJ3A 3NVZA 3AE1B 1HZ6A 2PVGC 3I9V1 1ET9A 4RGNA 1FNUA 2WS3B 2ACZB 2G9HD 2JX5A 1C79A 4US8A 1VDVA 1K50A 2DBYA 3U2SC 1QILA 2W82A 1QLBB 1ZP0B 3MHZA 1UWMA 4HEA1 3FILB 4USAA 1PFDA 2L32A 3Q8EA 5G5GA 3SEBA 1GT8A 4JWSC 3V05A 2MH7A 3BK1A 3P4PB 1CZPA 4ZOHC 1L5PA 1ZDXA 2OEDA 3NUHB 5G5HA 2K5PA 4A90A 2V3PA 2FE8A 2ZW1A 3NZ3A 2JQRB 3BYTB 2KAJA 3AEEB 2G1EA 1PYWD 1FO4A 4Q2JA 4DXFA 1GTEA 5GXGB 2CJNA 3KWVA 1UNSA 2VZKD 3BIID 3AE3B 1XLQA 1N62A 2WXOA 1QF6A 1QOFA 1L0YB 1YMHE 3TUOA 1JCKB 4A6QA 3ZYYX 2BB5A 1E10A 1I4PA 1AWDA 1L0VB 3ZJUA 3R2IA 1TS3A 1JALA 1N61A 1D5XC 1WYGA 4RGOS 1FRDA 2B76B 4FXCA 2J42A 2LHDA 4LK0M 1SXTA 5E6JA 5I4DA 3ZJVA 1KTKA 1ACCA 4L2YA 1ENFA 3FC4A 2PW9A 2YEPF 5D3IB 4NJCA 4ZHOA 1XEEA 1L0XB 3W2DA 4L23A 2W55A 1D4BA 2WP9B 3AE6B 2DYOA 1YJJA 3IT6B 2WXJA 2BW2A 2HTME 1J7CA 4RF1A 2IDYA 1YN3A 1E0ZA 2KMMA 4REZA 4KGSA 1TY0A 1KFYB 3P4SB 1YN4A 1K53A 2N9LA 5T8IA 3RFZB 1FFVA 4RNAA 2JYTA 3U52E 4CQNA 2RMMA 1KH0A 1ZPSA 1MHXA 1WGKA 1E7PB 2W3RA 4RGTA 4ZRQA 1V1OA 2LHEA 3N9YC 2NMQA 1FNWA 1NVID 2AQ3B 4MM3B 4IOIE 4N6EB 3AE5B 3BYYB 3IXSA 3GS2A 4ZHPA 3AE7B 2Y5PA 2X38A 4KGTA 2Q5WD 1CK1A 2NTTA 4DQOC 1ZDVA 3CF4A 2IGHA 2E6XA 3VR8B 3R2TA 1WSPA 1L6UA 5BYQA 1DOXA 1FNVA 1P7EA 4WURA 2QILA 5FKAC 1SBBB 1WXQA 4L1BA 5EE9A 1YJIA 4C56C 4OZAA 4WIPA 3PO0A 4GDLB 4N58A 4YSZB 4ARCA 1DYQA 3ABVB 1ESFA 1IBXB 4AQ7A 5HI1A 3PZ8A 2PIAA 2WNMA 1TKYA 1YQ4B 1AYFA 1DOIA 2Y3AA 3PZ7A 3VRAB 2MJEA 1RYJA 5H92C 1QQRA 2INPE 1QT9A 2K3UA 1MVKA 1D5ZC 2Z8LA 1FCLA 2ICIA 3P42A 1RM6C 2J53A 1XF5L 1OFFA 4EE2A 1I4HA 2KACA 3AV8A 2H88B 2L52A 5JXVA 1V8CA 1PDXA 1GOZA 2PTLA 5D3DA 1PUTA 3CWIA 4YSXB 5HG2A 2WXGA 2LUMA 5MPOA 2J4XA 2PKOA 3AB5A 1HQRD 2BS3B 3NVYA 5D7GA 3E56A 4ARIA 3TEWA 1UUPA 1D5MC 1ZXIA 2MJDA 3IAM1 1N60A 1T5XD 2R61A 2D5GA 1NYRA 3Q8BA 2XNAC 3LXFA 3O13A 1VZ8A 1EU3A 1EM7A 1F2RI 2PVOD 3U7ZA 3TSSA 3EGRA 2JWUA 5BMGA 1SE2A 2I38A 3RPFC 1AN8A 4HROA 1SF0A 3GP7A 1VLBA 5BYSA 3ZGZA 3IAS1 1VRAB 3OWEB 1PGAA 4N59A 2DWQA 1FCCC 1YQ3B 1I4XA 1BMLC 2GRIA 4TSSA 1FFUA 1XXGA 1GB4A 1XO3A 1WRIA 3H8HA 4LLGM 3VQIA 4IKGA 1KLGD 4P6VF 1VZ6A 4RFBA 2E3TA 3AE4B 1IGDA 1L4DB 5AUKA 2N9KA 1OQRA 1SB3C 2WXMA 2W54A 4R3DA 1A70A 2BB6A 2LJIA 3AH7A 2WXPA 1ZE3D 3LB8C 2NTSA 2H89B 4XDCA 1P7FA 1XLPA 1V97A 3B9JA 1T6BX 1J7AA 1WWTA 1QKZA 2WU2B 5C3JB 5AUIA 1XLOA 1FD6A 1C78A 1KLUD 2WDQB 1BUIC 3TEXA 3AEDB 3LYYA 1SSNA 4KKIA 3AE8B 4M0WA 3MP9A 2AQ1B 1CJEA 2WXNA 3AM9A 3KQ4A 1HZ5A 4OVZA 3BVZA 4A8XC 1FXAA 2V3NA 2WXRA 2YEPB 2WXLA 1T3QA 1C4AA 1KF6B 4NZLB 2M19A 4ITKA 1K52A 5BMIA 2WXIA 2ZW0A 4H2AA 2V4IB 3P4QB 3KWLA 2WU5B 3WCQA 4TMAB 3FILA 1SIJA 1MHHE 1D6EC 3BWUD 1E6EB 2FBWB 4RF0A 2CU3A 2LMCA 1TS4A 3I57A 2WDRB 1N5XA 4WH4A 4MT5A 4GDKB 1M4VA 1QOBA 1NENB 4YTNB 2L1AA 4OW0A 1NI3A 1CQVA 4ZRPA 4A9AA 4HKQA 1TJEA 2WQYB 2BBCA 4C7ZA 3AEAB 2IGDA 2GB1A 3SFDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7H A;  5MPO A;  1EWY C;  4US9 A;  3SR6 A;  2BS4 B;  2WDV B;  2CJN A;  2K9X A;  1GTH A;  5GXG B;  3VRB B;  2PKO A;  5EE0 A;  3AB5 A;  4JWU C;  2BS3 B;  2K22 A;  2N0S B;  2W3S A;  3BII D;  3NVY A;  3AE3 B;  1RWS A;  1XLQ A;  1ZXI A;  1N62 A;  2MJD A;  4LTU A;  3AMZ A;  3AE9 B;  1N60 A;  1QOF A;  1QF6 A;  1NYR A;  1XLN A;  1J7B A;  2M56 B;  2WLB A;  3LXF A;  3ZYY X;  1E10 A;  1JQ4 A;  3HVZ A;  3L4P A;  1AWD A;  1L0V B;  2PVO D;  1ZUD 2;  1ZOY B;  1JAL A;  1N61 A;  1WYG A;  1FRD A;  3NVV A;  2B76 B;  1B9R A;  4FXC A;  2CJO A;  2EKI A;  3RPF C;  4HRO A;  1TKE A;  3FC4 A;  1F0Z A;  1FM0 D;  1VJK A;  1SF0 A;  3DWG C;  1VLB A;  4ZHO A;  1FMA D;  1JW9 D;  4HRS A;  1JWA D;  2W55 A;  2WP9 B;  3AE6 B;  3AN1 A;  1NYQ A;  3ETR A;  4WQM A;  1YJJ A;  4N59 A;  2DWQ A;  4C80 A;  1GPX A;  1FRR A;  1YQ3 B;  3P63 A;  4IDI A;  2OHF A;  2HTM E;  1J7C A;  1FFU A;  1XO3 A;  1WRI A;  2Y5C A;  1JWB D;  4JX1 C;  3AEB B;  1E0Z A;  4P6V F;  2KMM A;  3SFE B;  2E3T A;  3AE4 B;  3AEG B;  5AUK A;  4YXD B;  1KFY B;  3P4S B;  1N63 A;  1OQR A;  1SB3 C;  2AX5 A;  2W54 A;  1DOY A;  1FFV A;  3VR9 B;  1E9M A;  1R7S A;  1A70 A;  3HUI A;  3AEC B;  3AEF B;  3W5U B;  1OQQ A;  1FIQ A;  3W5V B;  1KRH A;  1RFK A;  4KX6 B;  3AH7 A;  3LB8 C;  1WGK A;  3NRZ A;  1E7P B;  2H89 B;  1IUE A;  4YTM B;  2W3R A;  1H7W A;  4YSY B;  2L83 A;  3B2F A;  1NVI D;  1H7X A;  1XLP A;  1V97 A;  4YT0 B;  3B9J A;  1QOA A;  1J7A A;  1WWT A;  4N6E B;  3AE5 B;  2WU2 B;  3AE2 B;  5EE1 A;  5C3J B;  5AUI A;  1XLO A;  4ZHP A;  2BS2 B;  2WDQ B;  3AE7 B;  1DGJ A;  4WWM A;  3AED B;  1TYG B;  3P1M A;  3AE8 B;  2Q5W D;  1CJE A;  3AM9 A;  4C7Y A;  3CF4 A;  3DWM A;  1JRP A;  1L6V A;  1TKG A;  2MJ3 A;  1FXA A;  3NVZ A;  3VR8 B;  3AE1 B;  1L6U A;  1DOX A;  2PVG C;  1T3Q A;  5EE3 A;  1KF6 B;  2M19 A;  4ITK A;  3B2G A;  3FAH A;  1WXQ A;  1GAQ B;  2WS3 B;  5EE9 A;  3P4Q B;  2ACZ B;  1YJI A;  3KWL A;  2WU5 B;  4YTP B;  3WCQ A;  1ROE A;  2JX5 A;  3PO0 A;  4N58 A;  4YSZ B;  4US8 A;  1VDV A;  3W9C B;  3ABV B;  1SIJ A;  2LEK A;  2DBY A;  5H8Y E;  1E6E B;  2FBW B;  2PIA A;  1QLB B;  1YQ4 B;  1AYF A;  1DOI A;  1TKY A;  3HRD D;  1ZP0 B;  2CU3 A;  3NS1 A;  3VRA B;  1JRO A;  2WDR B;  1UWM A;  1N5X A;  2MJE A;  4USA A;  1RYJ A;  1PFD A;  1QOB A;  5G5G A;  1GT8 A;  5H92 C;  4JWS C;  1NEN B;  1NEK B;  1QT9 A;  2MH7 A;  4ZOH C;  3P4P B;  4YTN B;  1CZP A;  1NI3 A;  1L5P A;  2QIE B;  4A9A A;  3P4R B;  1RM6 C;  1TJE A;  5G5H A;  2WQY B;  2K5P A;  4C7Z A;  1OFF A;  1FXI A;  1QOG A;  3EUB 2;  3AEA B;  3AV8 A;  2BT6 A;  3CIR B;  2JQR B;  2H88 B;  2L52 A;  3SFD B;  1V8C A;  2KAJ A;  3AEE B;  1PDX A;  5C2T B;  2G1E A;  1N5W A;  1PUT A;  3CWI A;  4YSX B;  2QJL A;  1FO4 A;  3NVW A;  1GTE A; 
#chains in the Genus database with same CATH topology
 2LAS A;  2K9X A;  2IND C;  3Q3O C;  2O2V B;  3PPA A;  2IO1 B;  3T3O A;  1YN5 A;  3NZU A;  2DLB A;  3UIO B;  2KNB A;  4BBN F;  3L4P A;  1AAR A;  4P1C C;  5G2N A;  1L4Z B;  3ZJT A;  2MEK A;  3PHX B;  3DWG C;  2KDI A;  3ZXV A;  4HRS A;  3AN1 A;  2WXH A;  1MPE A;  3P63 A;  4E3C A;  2QC8 A;  5IAA C;  2FCN A;  1WE6 A;  5EDS A;  4LDT B;  3T8M A;  3TJP A;  4GGQ A;  3KYD D;  1R4N I;  1TZO A;  3W5U B;  2WXF A;  2HDE A;  2KDB A;  1WIA A;  3AE2 B;  1KOT A;  5AZH A;  1IGC A;  2TSS A;  1IYF A;  2CR5 A;  1OEY J;  3U4E G;  1ZXH A;  2I1J A;  4EZJ A;  5TSS A;  4AJW A;  2IO0 B;  3EFU A;  3KW5 B;  2WXK A;  1H8C A;  2N4F A;  2J0J A;  3TEZ A;  1V6E A;  2PPH A;  3RNF C;  1P0R A;  1P3Q U;  3PSE B;  4TQ1 A;  1PGX A;  2KK8 A;  3RI7 C;  1AW7 A;  2QIE B;  4WAF A;  1LGR A;  1QOG A;  3URY A;  3ZDM C;  1KM7 A;  3CST A;  3J9C A;  1N5W A;  2KJ6 A;  2RDH A;  2SAK A;  2WXQ A;  2KDM A;  4GIV A;  4UDU C;  3H7P A;  4ANV A;  2MBO A;  2JZP A;  5EE0 A;  2L0F A;  1I4Q A;  4JWU C;  4IM3 A;  3ZQ4 A;  3R8B A;  3PGE A;  2IZV B;  1FPY A;  1WX7 A;  1WZ3 A;  3Q2A C;  1UBI A;  3QJZ A;  4I6L B;  4GXB A;  2FUH B;  2LRW A;  3VTW A;  3M95 A;  2C7H A;  2DZK A;  4FN2 A;  3PRE A;  2RD0 A;  2O6V B;  1FMA D;  4HDO A;  1WXA A;  2KWU B;  2AQ2 B;  3OLM D;  2NCN A;  1V9J A;  3PZD A;  2BF8 B;  2EEL A;  2J0K A;  2KN4 A;  3Q69 A;  4YXD B;  5JZE B;  2HE7 A;  1XCQ L;  1VR9 A;  1DOY A;  4LCD E;  3QK0 A;  1Q0W B;  4TQ0 A;  5DPR A;  4P16 A;  1FIQ A;  1KRH A;  5BMH A;  4WWP A;  1SEB D;  2DYM A;  4AUQ C;  2IO2 B;  4IW0 A;  3B2F A;  4HJK A;  2WX1 A;  4KGR A;  3QQ8 B;  4XWT A;  3UGB B;  5HHD G;  3BVG A;  1SE3 A;  2MWS B;  2JZZ A;  1J0G A;  1JRP A;  2MJ3 A;  3NVZ A;  4A3P A;  1WZ0 A;  2BWF A;  2WS3 B;  3N20 C;  2K1F A;  3DBR B;  4US8 A;  2DBY A;  1QLB B;  3MHZ A;  2BYF A;  3GZN I;  4HEA 1;  2BQQ A;  2ZCC A;  2LI5 A;  4LNK A;  2GBN A;  1ZDX A;  3PRZ A;  3PS6 A;  1OEY A;  2KQ7 A;  4KDL B;  2KJR A;  2CJN A;  3KWV A;  2MBQ A;  1S3S G;  2LRU A;  2BYV E;  2VZK D;  3QA8 A;  3AE3 B;  4RMA A;  1MG4 A;  1QOF A;  3N3K B;  3EFC A;  2O6V D;  4A6Q A;  3ZYY X;  2ZCB A;  5TR5 A;  1E8W A;  2DZJ A;  1WYG A;  3MC9 A;  4FXC A;  2LHD A;  4LK0 M;  4L2Y A;  4HPM B;  3U7D A;  4A3O A;  3W2D A;  1NDD A;  4TUU A;  1YJJ A;  2PEA A;  1E0Z A;  2HJ1 A;  2KVZ A;  4REZ A;  4KGS A;  1TY0 A;  1KFY B;  2N9L A;  2DAJ A;  3A4R A;  2L00 B;  3U52 E;  4CQN A;  1WMH B;  1WGK A;  4IM0 A;  4LNN A;  2LHE A;  3N9Y C;  3IBE A;  3EC8 A;  3N30 A;  4W9K A;  3DCG A;  1WJU A;  3GS2 A;  4ZHP A;  2Y5P A;  3N1Y C;  2RSU A;  2X38 A;  4KGT A;  2FID A;  2LVP A;  2E6X A;  3QAR A;  1FNV A;  1P7E A;  1SBB B;  1WXQ A;  1YJI A;  4C56 C;  1TIF A;  4N58 A;  1Y8R C;  3U8Z A;  3PZ8 A;  4WAA A;  1AYF A;  3ZVV A;  1RFA A;  3WIM A;  2INP E;  1QT9 A;  2N1V A;  1D5Z C;  2Z8L A;  3VHT C;  1XF5 L;  4CYE A;  1OFF A;  5JHB A;  4EE2 A;  1I4H A;  4W9F A;  2H88 B;  2PTL A;  4IUM B;  4DDG D;  2K6Q A;  5MPO A;  2J4X A;  4HK2 A;  4CHK A;  1TTN A;  3ZKJ C;  3E56 A;  1LXD A;  2LZ6 A;  2XNA C;  2GOW A;  3LXF A;  4PYU A;  3U7Z A;  3GE8 C;  1P98 A;  2NPT A;  3RPF C;  3UIP B;  2NBU A;  3L54 A;  4NNJ B;  4GN1 A;  2DNF A;  2JXX A;  3IAS 1;  3M63 B;  4TSS A;  4S17 A;  1GB4 A;  3VQI A;  5AEK B;  2E3T A;  4IWO A;  1SB3 C;  4J6I A;  3VUW A;  4R3D A;  2BB6 A;  3AH7 A;  3LB8 C;  1XLP A;  5AUI A;  1C78 A;  1KLU D;  3AED B;  1SSN A;  4M0W A;  3MP9 A;  4AWJ A;  4F1S A;  1CJE A;  1HZ5 A;  4OVZ A;  2L05 A;  3BVZ A;  3HM6 X;  2G4S A;  5G55 A;  1WGH A;  2YEP B;  2WXL A;  1C4A A;  4NZL B;  2M19 A;  5L95 C;  2WXI A;  4MJS B;  2C60 A;  3P4Q B;  1WGG A;  2WU5 B;  2KT7 A;  3WAN A;  1MHH E;  4JL9 A;  1D6E C;  2GMI C;  3BWU D;  4KDI C;  2CHX A;  2LMC A;  3I57 A;  1N5X A;  4GDK B;  3HHM A;  4FHK A;  3VH4 B;  1NEN B;  4WQO B;  2Z59 B;  4OW0 A;  2L1A A;  3KYC D;  1CQV A;  5AZG A;  4WWN A;  4M02 A;  3SFD B;  2LWP A;  2KLG A;  3W1Y A;  1N6Z A;  2BS4 B;  2WDV B;  1XCT L;  2J0M A;  2FIF A;  2JYE A;  3A1Q A;  4F8C B;  5FR6 A;  1YOV B;  1B1Z A;  4W9C A;  4DHZ E;  4ZRI A;  1YX6 B;  2RDG A;  3Q8C A;  1ZKH A;  3GB1 A;  3Q14 C;  2CJO A;  3N1X C;  3H9D A;  3ZUN A;  1Q10 A;  1JW9 D;  1SJE D;  3DHG C;  1J8C A;  1WX8 A;  3WAO A;  2C9W B;  2KLC A;  4B0E A;  1F2R C;  1WJ4 A;  3NJT A;  3K9P B;  1UWX A;  3RYT A;  2AYO B;  3L17 A;  1TS5 A;  2AX5 A;  3HUI A;  4MAC A;  1V1P A;  3NRZ A;  4KKJ A;  2M1M A;  1IUE A;  4LNO A;  1WMH A;  2FCS A;  3PVL A;  2J7Q B;  4HVB A;  5DPW A;  3L16 A;  1QOA A;  5FK9 C;  1C4C A;  4NAM A;  1TKG A;  1MFW A;  1JWU D;  2HD5 B;  2LGS A;  2N7D A;  5LXH A;  1C76 A;  1RLF A;  2KWC A;  1ZGU B;  4E74 A;  3OG5 A;  3W9C B;  1X1M A;  3HRD D;  1SJH D;  3NS1 A;  1EF1 A;  4MEM A;  3E9S A;  4P7I A;  1ET6 A;  2JU6 X;  2BYE A;  3P4R B;  4OVV A;  2UYZ B;  4W9J A;  5C2T B;  1CMX B;  1WYW B;  2MRP A;  3NOB A;  3NVW A;  2IJ0 A;  1EWY C;  1KLV A;  4MH8 A;  1HTQ A;  4GB9 A;  1GTH A;  2VH1 A;  3GZN B;  2RPV A;  2KMC A;  4NAW B;  3AE9 B;  1V1P B;  2X8X X;  1YJ1 A;  5HKH A;  4HJG E;  3RCZ A;  1P9D U;  3BZD B;  1I42 A;  2QCZ A;  1FM0 D;  2BKF A;  3DQV A;  2JF5 A;  1I4R A;  2ASQ A;  1JWA D;  1I4G A;  1GPX A;  1WXV A;  4C00 A;  3SU8 X;  3QWZ B;  3UI3 A;  1HE8 A;  1JWB D;  1V49 A;  4EOY A;  3WAL A;  3ECI A;  3AEG B;  3JVZ X;  3JSV A;  3T3N A;  4ICU A;  1OQQ A;  3A4S C;  4II2 B;  4C4V B;  4XWW A;  1H7X A;  1JML A;  2G3Q B;  2LGI A;  2KX0 A;  2BS2 B;  3R3M A;  3LJ3 A;  3T9L A;  2KTR B;  1DGJ A;  1WR1 A;  3HK0 A;  3L13 A;  3V3X A;  3DBH B;  1WF9 A;  1FXT B;  3AE1 B;  4M01 A;  4EZK A;  2PVG C;  4K7S A;  3OAW A;  3P2B A;  2V3S A;  3N32 A;  3ZRC A;  1K50 A;  3U2S C;  2W82 A;  1ZP0 B;  1UWM A;  2UU7 A;  4EKU A;  3L0W B;  2KYW A;  5G5G A;  3SEB A;  3V05 A;  2C7N B;  3VTV A;  2FAZ A;  5IKC M;  4ZOH C;  3P4P B;  1CZP A;  4HCN B;  4LJO B;  5JHA A;  5G5H A;  1Z2M A;  2V3P A;  5DPT A;  3NZ3 A;  2JQR B;  3R66 C;  1IP9 A;  1MG8 A;  1P1A A;  1F52 A;  1PYW D;  1FO4 A;  4Q2J A;  3ZNH B;  1LQB A;  1E8Y A;  3AU5 A;  1SIF A;  2YLM A;  1XLQ A;  3DDC B;  3KUD B;  1QF6 A;  1YIW A;  1YMH E;  1EO6 A;  2D10 A;  1JCK B;  4PS3 A;  2L7R A;  2XBB C;  2GBJ A;  3ZJU A;  3Q3M C;  3R2I A;  2JWZ A;  3A9K B;  2WDT B;  3ALB A;  2B76 B;  2JUO A;  5I4D A;  1SXT A;  4GOC A;  5JH5 C;  1KTK A;  1ACC A;  2YEP F;  2MHJ A;  2KVR A;  4DXA B;  4ZHO A;  1SE9 A;  2K8C A;  2W55 A;  2WP9 B;  5E6N A;  5LXI B;  2DYO A;  2R2O A;  3AXC A;  2WXJ A;  2YVC A;  1J7C A;  4BKS D;  3BY4 B;  2IDY A;  3S2A A;  2KMM A;  1XT9 B;  3NY5 A;  3P4S B;  1YN4 A;  2M4N A;  1ISN A;  2RMM A;  1KH0 A;  1MHX A;  1K8R B;  4LJP B;  2AQ3 B;  3UIN B;  5J2R A;  2LXA A;  2KWV B;  4IOI E;  2LXC A;  4N6E B;  3AUL A;  3I63 C;  3IXS A;  4EUT A;  3AE7 B;  3Q3N C;  3ML8 A;  2Q5W D;  2FCQ A;  1ZDV A;  4DQO C;  1V86 A;  2CHW A;  2IGH A;  2D3B A;  3VR8 B;  1WSP A;  1DOX A;  3N1Z C;  4MSQ B;  4BOS C;  4WUR A;  5IOI A;  2G45 B;  3R7R A;  3RNG C;  4WIP A;  3PO0 A;  4GDL B;  2K39 A;  1IBX B;  1ESF A;  2LGD A;  1VCB A;  2PIA A;  2WNM A;  4II3 B;  1TKY A;  1YQ4 B;  4FJZ A;  3VRA B;  4DBG A;  3WAM A;  2MJE A;  1ZW7 A;  1RYJ A;  3UF8 A;  2WHI A;  1QQR A;  1H4R A;  3APC A;  1MVK A;  3KH0 A;  3P42 A;  5E6O A;  3C0R B;  2KAC A;  3AV8 A;  2JZ3 B;  2L52 A;  5JXV A;  1V8C A;  3DHI C;  2D3A A;  1PDX A;  5D3D A;  3KVF B;  2WXG A;  2DYB A;  1TZ1 A;  2M0X A;  3AB5 A;  1HQR D;  2ZVN A;  2L3Z A;  3TEW A;  4ARI A;  2MJD A;  3ZTC A;  3RNA C;  3IAM 1;  1N60 A;  3Q8B A;  3O13 A;  1EU3 A;  4PS8 A;  2IY0 B;  2PVO D;  3RNB C;  1SE2 A;  2D07 B;  2LGX A;  4MSM B;  4YL8 A;  2CU1 A;  1SF0 A;  2BWE S;  1VRA B;  2GLS A;  4BZA A;  2KC1 A;  4WJP A;  3OWE B;  2XK5 A;  4N59 A;  3UQA A;  2GRI A;  4K7W A;  1XXG A;  1WRD B;  3WA0 A;  4LLG M;  4K81 A;  4IKG A;  4P6V F;  3DVG X;  4RFB A;  3RT3 B;  5AUK A;  2WXM A;  3QC8 B;  3DBL I;  3DBS A;  4CO7 A;  1A70 A;  3RNE C;  3VVW B;  3K9O B;  2LUE A;  2KDF B;  2H89 B;  4HLE A;  4XDC A;  1P7F A;  1V97 A;  3M3J A;  4IC7 B;  1T6B X;  1J7A A;  1WJN A;  1WWT A;  2WU2 B;  5C3J B;  2ZPN A;  2WDQ B;  2RGF A;  3LYY A;  2N7E A;  4JLC A;  3AM9 A;  2MBB B;  4A8X C;  1E8X A;  1E7V A;  1FXA A;  2MA9 B;  2WXR A;  5CHV C;  5BMI A;  5D6J B;  4H2A A;  2JVC A;  4MGZ E;  4WJQ A;  1YD8 U;  5CHW A;  3TIX A;  3NS8 A;  1WE7 A;  4RF0 A;  2REX A;  4EFO A;  4MT5 A;  5IP4 D;  4B95 A;  1NI3 A;  2DZM A;  4MDK E;  2IGD A;  4HXD A;  2GB1 A;  4WWO A;  1L2N A;  4NQK E;  2QMT A;  1I7H A;  4JPS A;  5FR3 A;  2M8S A;  3VRB B;  2MX2 A;  1Q5W B;  3CSF A;  2RDB C;  2K22 A;  4YWG G;  1C4P A;  4DXG A;  4IWQ A;  1RWS A;  2O6V A;  4LTU A;  2V1Y A;  2M56 B;  1J7B A;  2WLB A;  1JQ4 A;  3TL5 A;  3RD2 A;  4PS7 A;  1K51 A;  1ZOY B;  2KWD A;  4BFR A;  3IT4 B;  2D3G A;  2JY6 A;  2ZVO A;  1VJK A;  3Q8F A;  2FCM A;  2XEW A;  1WR6 E;  3TEY A;  4RGM A;  4C80 A;  3VH3 B;  3MJW A;  4JX1 C;  1T0R C;  1RAX A;  1GUA B;  3VTU A;  1E5W A;  1MI0 A;  3MJ5 A;  2DHZ A;  1RFK A;  2WX0 A;  2PE6 B;  1C77 A;  5EE1 A;  3QAQ A;  4B0M A;  2C7M B;  5E6P A;  3VFK A;  3MC0 B;  1A5R A;  4MH0 E;  4GMV A;  2MLB A;  4G50 A;  3B2G A;  2GI9 A;  4XGA B;  1GAQ B;  2ONQ A;  1SE4 A;  3DPD A;  5J17 A;  4DHJ B;  3BVM A;  3X23 A;  4NY0 A;  1VZ7 A;  2ZNV B;  1V5T A;  3ZXR A;  1NEK B;  1YNT E;  3IG3 A;  3ML9 A;  4A55 A;  4DK5 A;  3EUB 2;  2D11 A;  2ZZP B;  1HEZ E;  1S1Q B;  1F9J A;  2NBW B;  5IN7 A;  1UH6 A;  4US9 A;  4MJS A;  4ASW C;  1D3Z A;  1EF5 A;  4ZYS A;  2AWT A;  1LO5 D;  1BT0 A;  4E71 A;  1T0S C;  1KJT A;  1UBQ A;  1EWC A;  1ZUD 2;  3KUC B;  3NVV A;  4ICV A;  3PT2 B;  2EKI A;  4XE0 A;  3KLS X;  2N9X A;  1TKE A;  3AU4 A;  3WAP A;  1E8Z A;  1TY2 A;  3SHQ A;  2JPH A;  2KD0 A;  3DOW A;  1NYQ A;  3C8Y A;  4WQM A;  4IDI A;  2OHF A;  2L8J A;  2D2Q A;  4BKT A;  3AEB B;  2K0P A;  2K8B A;  3NZS A;  4WJO A;  3H6N A;  4G0N B;  1V81 A;  3DBH I;  5BYR A;  4K3B A;  3AEC B;  3AEF B;  1T0Q C;  1IBX A;  3W5V B;  2VZK B;  4HKZ E;  4YSY B;  2L83 A;  1PGB A;  4J3O D;  3A9J B;  1GB1 A;  3V6C B;  1WGR A;  5LNK 1;  3DBL B;  4WWM A;  1TYG B;  1STE A;  4OHJ A;  1JWM D;  2J52 A;  4C7Y A;  2MP2 B;  1L6V A;  4NJ7 A;  3QIJ A;  1OQY A;  2AL6 A;  3I9V 1;  4RGN A;  1FNU A;  3PRM B;  1VDV A;  2EKE C;  2KTR A;  1GC6 A;  2IYD B;  2NR2 A;  1TT5 B;  2FNJ B;  3Q8E A;  4FHJ A;  5C1Z A;  1L5P A;  3NUH B;  4A90 A;  2K5P A;  3BYT B;  2KXJ A;  4XC2 A;  2W9N A;  1I35 A;  1V5O A;  1OGW A;  4DXF A;  1GTE A;  3ENE A;  2NPT B;  2ZJD A;  3B1L X;  4LNF A;  1WX9 A;  3BII D;  4RM8 A;  1UZX B;  4KZ0 A;  5IA7 A;  3TUO A;  4HPL B;  1E10 A;  2BB5 A;  3NHE B;  1L0V B;  1E7U A;  1TS3 A;  1JAL A;  1N61 A;  2KFJ A;  1FRD A;  2ZPY A;  3PHW B;  5BO4 B;  5E6J A;  3FC4 A;  2N1W A;  5D3I B;  1L0X B;  4L23 A;  1U4A A;  3VXW A;  1WM3 A;  3IT6 B;  3O65 B;  2BW2 A;  3UQB A;  4RF1 A;  3PV1 A;  3OJ3 A;  4EZL A;  2JRH A;  1K53 A;  4RNA A;  2JYT A;  4MGY E;  4LDT D;  1ZPS A;  3PLU A;  2W3R A;  4RGT A;  4ZRQ A;  4M8N A;  3APF A;  1NVI D;  4MM3 B;  4GU2 A;  2L0T A;  3A9K A;  4ANU A;  2VRR B;  2NTT A;  2WWZ A;  3QCA A;  1C1Y B;  5CHF A;  3H1U A;  2IBI B;  5BYQ A;  2Z0D B;  3HM3 A;  2QIL A;  5FKA C;  4DDI D;  3H7S A;  4OZA A;  1TBE A;  2CS4 A;  4ARC A;  3A33 B;  4IG7 B;  2KMA A;  3RUI B;  2OJR A;  3PZ7 A;  3VUX A;  4G11 A;  5CX3 A;  4C4V A;  2KO3 A;  2MBE A;  2DEN B;  5H92 C;  2K3U A;  2AEH A;  3ZNI D;  2PE9 A;  1RM6 C;  2J53 A;  2IY1 B;  2BGF A;  5J18 A;  2PJH A;  3QX1 A;  3R7Q A;  3ZIM A;  1PUT A;  3NG0 A;  5D2M B;  2QDF A;  2LUM A;  3RZF A;  4M8M A;  4G3X B;  2PKO A;  3NVY A;  4RM9 A;  1D5M C;  1ZXI A;  1LM8 B;  2BPS A;  1T5X D;  2R61 A;  2D5G A;  3EEC A;  2BVC A;  4B9K A;  4NJ6 A;  4BKS A;  2JT4 B;  3TSS A;  5BMG A;  3ZO5 B;  4ACF A;  4KSL C;  4W9I A;  3C19 A;  1VLB A;  1XD3 B;  3ZGZ A;  1J19 A;  3ZW3 A;  4W9G A;  3DVN U;  2D3C A;  1YQ3 B;  1I4X A;  1XO3 A;  3H8H A;  4BKG A;  2I1K A;  1KLG D;  1VZ6 A;  4M0W B;  3AE4 B;  1IGD A;  1L4D B;  1WM2 A;  2KHW B;  2W54 A;  2HJ8 A;  3RMK C;  2LJI A;  2WXP A;  1ZE3 D;  2EMS A;  3HIZ A;  4NAW A;  5KHQ A;  1QKZ A;  1TGZ B;  4GSW A;  3PTF C;  4KIK A;  4OVU A;  3BIN A;  3TEX A;  2MSE D;  4FJY A;  4HDQ A;  4KKI A;  3L10 B;  3DVG Y;  3ZTD A;  2Y5B B;  2V3N A;  4MEL A;  1T3Q A;  1KF6 B;  4ITK A;  1K52 A;  2WYQ A;  2KX3 A;  2V4I B;  4JGH B;  2B3A A;  1E6E B;  2FBW B;  4KV2 A;  2WDR B;  1R4N B;  2R2Q A;  1M4V A;  3GE3 C;  4BAX A;  4K3C A;  4A9A A;  2NS5 A;  4HKQ A;  4ZDV A;  2BBC A;  4C7Z A;  1UGM A;  3AEA B;  5AZF A;  1BXT A;  4FA6 A;  3BK2 A;  2V0G A;  1WH3 A;  4JIO U;  1WXM A;  3AMZ A;  3RZW C;  2KJH B;  3HVZ A;  3DHH C;  3EHV A;  2MW5 A;  3V62 A;  2Z0E B;  1UD7 A;  1YX5 B;  2JSV X;  4RH6 A;  4ANX A;  2INN E;  3ETR A;  1FRR A;  3MTN B;  4ZRJ A;  2KZR A;  2Y5C A;  3Q6B A;  4S0R A;  2M0A A;  4MGI E;  3SFE B;  3I5J C;  2L76 A;  1E9M A;  2QSD A;  1FEH A;  4AP4 C;  2PLP A;  3W1S A;  1WXS A;  2INC C;  5GMV A;  4YTM B;  2BYT A;  2KN5 A;  4RCO A;  1G6J A;  4PT5 A;  2XN9 C;  5DPS A;  1GC7 A;  4BVU C;  3W1S C;  1Z5S B;  2IGG A;  2I2Y A;  1EU4 A;  4DHJ D;  2V4L A;  1PQS A;  3QHT A;  1Y56 A;  3SDL C;  5EE3 A;  1OTR B;  3DVN V;  1GG3 A;  3FKY A;  2DAF A;  3FAH A;  4OZB A;  3I3T B;  3APD A;  4YTP B;  4TV3 A;  1ROE A;  2N7J A;  2NBV B;  3SD5 A;  2LEK A;  2QEJ C;  5H8Y E;  2V9H A;  1RRB A;  1GJZ A;  1JRO A;  2K8H A;  2ZNV C;  1C9F A;  1V2Y A;  3Q8A A;  3TBL D;  3Q3F A;  4M00 A;  1HXY D;  2PMV A;  4XDD A;  1T0Y A;  1FXI A;  2BT6 A;  3CIR B;  3EA6 A;  2QJL A;  3Q3J A;  2BKR B;  4AS1 A;  3SR6 A;  4WJN A;  3V60 A;  3ZRF A;  2N0S B;  2W3S A;  5CTR C;  2SEB D;  1WY8 A;  1NI2 A;  2CHZ A;  5C23 A;  2IPK D;  1XLN A;  3ZLZ A;  4GDK A;  2C5L C;  3LDZ E;  2LFI A;  2BTE A;  2KQ4 X;  4GLS C;  1B9R A;  2KC2 A;  1F77 A;  1F0Z A;  1XQQ A;  1UF0 A;  4FJV B;  2N9P C;  1UGJ A;  3MHS D;  2FUG 1;  1JWS D;  4OZC A;  3JYU A;  1JRU A;  3HVD A;  4TKN A;  4JE3 B;  2JRI B;  4KIK B;  1QZE A;  4ZRK A;  1TS2 A;  1N63 A;  4FUL A;  3IVF A;  3VR9 B;  2QHO A;  1R7S A;  4KVG B;  2JXT A;  4GDL A;  4KX6 B;  4FLH A;  4D2K A;  1HA5 A;  3KUZ A;  1H7W A;  4HCP B;  4YT0 B;  3MFG A;  2ON8 A;  5HFY A;  3VAW A;  3P1M A;  4O1N A;  3DWM A;  4JQW C;  3B0A A;  3MC8 A;  2M17 A;  1HZ6 A;  1ET9 A;  3PRP B;  4LNI A;  3CMM B;  4A20 A;  2ACZ B;  2G9H D;  2JX5 A;  1C79 A;  2HTH A;  1QIL A;  4I6P A;  3ONS A;  3U30 A;  2LD9 A;  3FIL B;  4USA A;  4MM3 A;  1PFD A;  2L32 A;  3B08 A;  1GT8 A;  4JWS C;  1M94 A;  2MH7 A;  3BK1 A;  2MCN B;  3ZDT A;  2OED A;  2XK5 B;  1L7Y A;  2FE8 A;  2ZW1 A;  1LFD A;  3PLV A;  2KAJ A;  3AEE B;  2G1E A;  2LJ5 A;  1HTO A;  1SGH A;  2AL3 A;  2A5U A;  5GXG B;  1C3T A;  1UNS A;  5KHO A;  5DCN A;  4W9E A;  1N62 A;  3IFW B;  2WXO A;  1L0Y B;  1WI0 A;  2LVQ A;  1I4P A;  1V80 A;  2MQJ A;  4FBJ B;  1Q1O A;  1AWD A;  4XZ4 A;  1D5X C;  4RGO S;  2RPQ A;  1EUV B;  2J42 A;  4PK1 A;  4N9F 4;  3ZJV A;  1ENF A;  2PW9 A;  4F7Z A;  4NJC A;  1XEE A;  1D4B A;  3AE6 B;  3VUY A;  2O2V A;  2HTM E;  1YN3 A;  2G4D B;  3ZNZ B;  1NBF C;  4X57 B;  5T8I A;  1WJ6 A;  3RFZ B;  1FFV A;  2KKC A;  1YQB A;  2EMT A;  1E7P B;  2RR9 A;  1V1O A;  2LVO A;  2NMQ A;  4K1R B;  1FNW A;  2K6D B;  4MGK E;  1WFY A;  3AE5 B;  3BYY B;  3OJ4 B;  4IWP A;  3CF6 E;  3DBR I;  2DZI A;  1CK1 A;  2N9E B;  3CF4 A;  3VDZ A;  2IO3 B;  3R2T A;  5IO9 A;  1L6U A;  2KTF A;  2NVU I;  5D94 A;  2KFK A;  3A9J A;  2WGS A;  4L1B A;  5EE9 A;  1WGY A;  5L83 A;  3D32 A;  4YSZ B;  1DYQ A;  3ABV B;  4AQ7 A;  5HI1 A;  3JW0 X;  3JSV B;  2OJW A;  3IHP C;  1DOI A;  2MBH A;  2Y3A A;  4KSK C;  4I6N B;  2KQS A;  2ZEQ A;  4KZC A;  2GBR A;  2KOX A;  1UEL A;  2ICI A;  1FCL A;  2KFK B;  3A1Q B;  2K25 A;  2MP2 A;  4B6W A;  1GOZ A;  4AJY B;  3CWI A;  4YSX B;  5HG2 A;  3RN9 C;  4HPP A;  3M62 B;  4ANW A;  3RUL A;  2BS3 B;  2LGY A;  2DX5 B;  5D7G A;  4DHZ B;  1UUP A;  3L08 A;  1R4M B;  1NYR A;  4EEW A;  2GBM A;  4QAY A;  2UWQ A;  1VZ8 A;  1EM7 A;  4URK A;  1F2R I;  3X0W A;  3EGR A;  2JWU A;  1MJD A;  4BOZ B;  3H7P B;  2I38 A;  1AN8 A;  4HRO A;  3GP7 A;  5BYS A;  4NPN A;  1PGA A;  4FAD A;  2DWQ A;  1FCC C;  5LLI A;  1BML C;  1FFU A;  4NQL B;  2KAN A;  1WRI A;  4K7U A;  3AI5 A;  4W9H A;  2N9K A;  3TMP B;  4AOF A;  1OQR A;  2NTS A;  1R4M I;  2A4Z A;  3V6E B;  3B9J A;  2GBK A;  1IPG A;  1XLO A;  4ZYN A;  1FD6 A;  1BUI C;  1VD2 A;  3AE8 B;  2AQ1 B;  2OOB B;  2WXN A;  3GOE A;  3KQ4 A;  4IM2 A;  4DWF A;  1F1H A;  2KDE B;  4BBN C;  2ZW0 A;  3V61 A;  2CKH B;  3ZNG C;  1E90 A;  1WGD A;  3KWL A;  4HWI B;  4P1B C;  4XYC A;  3TCA A;  3WCQ A;  4TMA B;  3FIL A;  1SIJ A;  4XX5 A;  4PYZ A;  2CU3 A;  1TS4 A;  4W9L A;  4WH4 A;  2VH2 A;  1QOB A;  4W9D A;  4YTN B;  4ZRP A;  1GNU A;  3RNC C;  1TJE A;  2WQY B; 
#chains in the Genus database with same CATH homology
 2QMT A;  1BXT A;  1I7H A;  2BS4 B;  2WDV B;  1XCT L;  2K9X A;  4JPS A;  5FR3 A;  3VRB B;  3BK2 A;  2JYE A;  2K22 A;  2V0G A;  4YWG G;  1C4P A;  4DXG A;  1RWS A;  3T3O A;  4LTU A;  1YN5 A;  3AMZ A;  1B1Z A;  2DLB A;  2M56 B;  1J7B A;  2WLB A;  1JQ4 A;  1K51 A;  3HVZ A;  3L4P A;  2RDG A;  1ZOY B;  2KWD A;  1L4Z B;  3ZJT A;  3Q8C A;  3GB1 A;  3IT4 B;  2CJO A;  2MEK A;  1VJK A;  2JSV X;  3DWG C;  3Q8F A;  4RH6 A;  1Q10 A;  1JW9 D;  4HRS A;  1SJE D;  2INN E;  3AN1 A;  3ETR A;  2WXH A;  3TEY A;  1MPE A;  4RGM A;  4C80 A;  1FRR A;  4B0E A;  3P63 A;  2Y5C A;  4JX1 C;  2M0A A;  1F2R C;  3SFE B;  1UWX A;  1TS5 A;  2AX5 A;  1MI0 A;  1E9M A;  2QSD A;  1TZO A;  3HUI A;  1FEH A;  3W5U B;  3MJ5 A;  2WXF A;  4MAC A;  1V1P A;  1RFK A;  2PLP A;  3NRZ A;  4KKJ A;  2HDE A;  3W1S A;  1IUE A;  4YTM B;  2BYT A;  1C77 A;  4RCO A;  1QOA A;  4PT5 A;  5EE1 A;  2XN9 C;  3AE2 B;  5FK9 C;  1IGC A;  4B0M A;  2TSS A;  1C4C A;  4NAM A;  3MC0 B;  2IGG A;  2I2Y A;  1TKG A;  1EU4 A;  3U4E G;  1ZXH A;  1JWU D;  5TSS A;  1Y56 A;  5EE3 A;  1C76 A;  3B2G A;  2GI9 A;  3FAH A;  1GAQ B;  2WXK A;  4OZB A;  2ONQ A;  3TEZ A;  4YTP B;  1ROE A;  1SE4 A;  2N7J A;  3W9C B;  2LEK A;  2QEJ C;  5H8Y E;  3BVM A;  3HRD D;  1SJH D;  4TQ1 A;  3NS1 A;  1JRO A;  1PGX A;  3E9S A;  1C9F A;  1VZ7 A;  3Q8A A;  1AW7 A;  1NEK B;  1ET6 A;  1YNT E;  2JU6 X;  2QIE B;  4WAF A;  3P4R B;  1HXY D;  2PMV A;  4A55 A;  4XDD A;  1FXI A;  1QOG A;  3EUB 2;  2BT6 A;  3CIR B;  1HEZ E;  3URY A;  3J9C A;  5C2T B;  1N5W A;  3EA6 A;  2QJL A;  2RDH A;  2SAK A;  3NVW A;  2WXQ A;  2IJ0 A;  2KDM A;  1EWY C;  4UDU C;  4US9 A;  4MH8 A;  3SR6 A;  4AS1 A;  1GTH A;  2JZP A;  5EE0 A;  1I4Q A;  4JWU C;  3ZQ4 A;  2N0S B;  2W3S A;  4ZYS A;  3R8B A;  2RPV A;  4NAW B;  2SEB D;  3AE9 B;  1LO5 D;  2IPK D;  1V1P B;  1XLN A;  2LFI A;  4HJG E;  2BTE A;  1EWC A;  1ZUD 2;  2KQ4 X;  3BZD B;  4GLS C;  3NVV A;  1B9R A;  1F77 A;  2EKI A;  4XE0 A;  3KLS X;  1TKE A;  1F0Z A;  1FM0 D;  1I4R A;  1UGJ A;  1FMA D;  1TY2 A;  1JWA D;  2FUG 1;  1I4G A;  1GPX A;  1NYQ A;  1JWS D;  3C8Y A;  4WQM A;  4IDI A;  2OHF A;  3UI3 A;  4OZC A;  2AQ2 B;  1JWB D;  3AEB B;  3HVD A;  4JE3 B;  2K0P A;  2EEL A;  3AEG B;  2KN4 A;  3Q69 A;  1TS2 A;  4YXD B;  1N63 A;  5BYR A;  1XCQ L;  1VR9 A;  1DOY A;  3VR9 B;  4TQ0 A;  1R7S A;  3T3N A;  3AEC B;  3AEF B;  1IBX A;  1OQQ A;  2JXT A;  1FIQ A;  4P16 A;  3W5V B;  2VZK B;  1KRH A;  4KX6 B;  4HKZ E;  5BMH A;  4D2K A;  1HA5 A;  1SEB D;  2DYM A;  1H7W A;  4YSY B;  2L83 A;  3B2F A;  4XWW A;  4KGR A;  1PGB A;  1H7X A;  4XWT A;  4YT0 B;  3MFG A;  4J3O D;  1GB1 A;  1JML A;  2LGI A;  2BS2 B;  5LNK 1;  5HHD G;  2ON8 A;  5HFY A;  1DGJ A;  3BVG A;  4WWM A;  1TYG B;  3P1M A;  1STE A;  3V3X A;  4O1N A;  1SE3 A;  4OHJ A;  1JWM D;  2J52 A;  3DWM A;  4C7Y A;  1JRP A;  1L6V A;  2MJ3 A;  3NVZ A;  3AE1 B;  1HZ6 A;  2PVG C;  3I9V 1;  1ET9 A;  4RGN A;  1FNU A;  2WS3 B;  2ACZ B;  2G9H D;  2JX5 A;  1C79 A;  4US8 A;  1VDV A;  1K50 A;  2DBY A;  3U2S C;  1QIL A;  2W82 A;  1QLB B;  1ZP0 B;  3MHZ A;  1UWM A;  4HEA 1;  3FIL B;  4USA A;  1PFD A;  2L32 A;  3Q8E A;  5G5G A;  3SEB A;  1GT8 A;  4JWS C;  3V05 A;  2MH7 A;  3BK1 A;  3P4P B;  1CZP A;  4ZOH C;  1L5P A;  1ZDX A;  2OED A;  3NUH B;  5G5H A;  2K5P A;  4A90 A;  2V3P A;  2FE8 A;  2ZW1 A;  3NZ3 A;  2JQR B;  3BYT B;  2KAJ A;  3AEE B;  2G1E A;  1PYW D;  1FO4 A;  4Q2J A;  4DXF A;  1GTE A;  5GXG B;  2CJN A;  3KWV A;  1UNS A;  2VZK D;  3BII D;  3AE3 B;  1XLQ A;  1N62 A;  2WXO A;  1QF6 A;  1QOF A;  1L0Y B;  1YMH E;  3TUO A;  1JCK B;  4A6Q A;  3ZYY X;  2BB5 A;  1E10 A;  1I4P A;  1AWD A;  1L0V B;  3ZJU A;  3R2I A;  1TS3 A;  1JAL A;  1N61 A;  1D5X C;  1WYG A;  4RGO S;  1FRD A;  2B76 B;  4FXC A;  2J42 A;  2LHD A;  4LK0 M;  1SXT A;  5E6J A;  5I4D A;  3ZJV A;  1KTK A;  1ACC A;  4L2Y A;  1ENF A;  3FC4 A;  2PW9 A;  2YEP F;  5D3I B;  4NJC A;  4ZHO A;  1XEE A;  1L0X B;  3W2D A;  4L23 A;  2W55 A;  1D4B A;  2WP9 B;  3AE6 B;  2DYO A;  1YJJ A;  3IT6 B;  2WXJ A;  2BW2 A;  2HTM E;  1J7C A;  4RF1 A;  2IDY A;  1YN3 A;  1E0Z A;  2KMM A;  4REZ A;  4KGS A;  1TY0 A;  1KFY B;  3P4S B;  1YN4 A;  1K53 A;  2N9L A;  5T8I A;  3RFZ B;  1FFV A;  4RNA A;  2JYT A;  3U52 E;  4CQN A;  2RMM A;  1KH0 A;  1ZPS A;  1MHX A;  1WGK A;  1E7P B;  2W3R A;  4RGT A;  4ZRQ A;  1V1O A;  2LHE A;  3N9Y C;  2NMQ A;  1FNW A;  1NVI D;  2AQ3 B;  4MM3 B;  4IOI E;  4N6E B;  3AE5 B;  3BYY B;  3IXS A;  3GS2 A;  4ZHP A;  3AE7 B;  2Y5P A;  2X38 A;  4KGT A;  2Q5W D;  1CK1 A;  2NTT A;  4DQO C;  1ZDV A;  3CF4 A;  2IGH A;  2E6X A;  3VR8 B;  3R2T A;  1WSP A;  1L6U A;  5BYQ A;  1DOX A;  1FNV A;  1P7E A;  4WUR A;  2QIL A;  5FKA C;  1SBB B;  1WXQ A;  4L1B A;  5EE9 A;  1YJI A;  4C56 C;  4OZA A;  4WIP A;  3PO0 A;  4GDL B;  4N58 A;  4YSZ B;  4ARC A;  1DYQ A;  3ABV B;  1ESF A;  1IBX B;  4AQ7 A;  5HI1 A;  3PZ8 A;  2PIA A;  2WNM A;  1TKY A;  1YQ4 B;  1AYF A;  1DOI A;  2Y3A A;  3PZ7 A;  3VRA B;  2MJE A;  1RYJ A;  5H92 C;  1QQR A;  2INP E;  1QT9 A;  2K3U A;  1MVK A;  1D5Z C;  2Z8L A;  1FCL A;  2ICI A;  3P42 A;  1RM6 C;  2J53 A;  1XF5 L;  1OFF A;  4EE2 A;  1I4H A;  2KAC A;  3AV8 A;  2H88 B;  2L52 A;  5JXV A;  1V8C A;  1PDX A;  1GOZ A;  2PTL A;  5D3D A;  1PUT A;  3CWI A;  4YSX B;  5HG2 A;  2WXG A;  2LUM A;  5MPO A;  2J4X A;  2PKO A;  3AB5 A;  1HQR D;  2BS3 B;  3NVY A;  5D7G A;  3E56 A;  4ARI A;  3TEW A;  1UUP A;  1D5M C;  1ZXI A;  2MJD A;  3IAM 1;  1N60 A;  1T5X D;  2R61 A;  2D5G A;  1NYR A;  3Q8B A;  2XNA C;  3LXF A;  3O13 A;  1VZ8 A;  1EU3 A;  1EM7 A;  1F2R I;  2PVO D;  3U7Z A;  3TSS A;  3EGR A;  2JWU A;  5BMG A;  1SE2 A;  2I38 A;  3RPF C;  1AN8 A;  4HRO A;  1SF0 A;  3GP7 A;  1VLB A;  5BYS A;  3ZGZ A;  3IAS 1;  1VRA B;  3OWE B;  1PGA A;  4N59 A;  2DWQ A;  1FCC C;  1YQ3 B;  1I4X A;  1BML C;  2GRI A;  4TSS A;  1FFU A;  1XXG A;  1GB4 A;  1XO3 A;  1WRI A;  3H8H A;  4LLG M;  3VQI A;  4IKG A;  1KLG D;  4P6V F;  1VZ6 A;  4RFB A;  2E3T A;  3AE4 B;  1IGD A;  1L4D B;  5AUK A;  2N9K A;  1OQR A;  1SB3 C;  2WXM A;  2W54 A;  4R3D A;  1A70 A;  2BB6 A;  2LJI A;  3AH7 A;  2WXP A;  1ZE3 D;  3LB8 C;  2NTS A;  2H89 B;  4XDC A;  1P7F A;  1XLP A;  1V97 A;  3B9J A;  1T6B X;  1J7A A;  1WWT A;  1QKZ A;  2WU2 B;  5C3J B;  5AUI A;  1XLO A;  1FD6 A;  1C78 A;  1KLU D;  2WDQ B;  1BUI C;  3TEX A;  3AED B;  3LYY A;  1SSN A;  4KKI A;  3AE8 B;  4M0W A;  3MP9 A;  2AQ1 B;  1CJE A;  2WXN A;  3AM9 A;  3KQ4 A;  1HZ5 A;  4OVZ A;  3BVZ A;  4A8X C;  1FXA A;  2V3N A;  2WXR A;  2YEP B;  2WXL A;  1T3Q A;  1C4A A;  1KF6 B;  4NZL B;  2M19 A;  4ITK A;  1K52 A;  5BMI A;  2WXI A;  2ZW0 A;  4H2A A;  2V4I B;  3P4Q B;  3KWL A;  2WU5 B;  3WCQ A;  4TMA B;  3FIL A;  1SIJ A;  1MHH E;  1D6E C;  3BWU D;  1E6E B;  2FBW B;  4RF0 A;  2CU3 A;  2LMC A;  1TS4 A;  3I57 A;  2WDR B;  1N5X A;  4WH4 A;  4MT5 A;  4GDK B;  1M4V A;  1QOB A;  1NEN B;  4YTN B;  2L1A A;  4OW0 A;  1NI3 A;  1CQV A;  4ZRP A;  4A9A A;  4HKQ A;  1TJE A;  2WQY B;  2BBC A;  4C7Z A;  3AEA B;  2IGD A;  2GB1 A;  3SFD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...