2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
1XLOA 3B2GA 2H89B 1B9RA 4C80A 3AV8A 3WCQA 1N5WA 1GT8A 2WDVB 2QIEB 5C2TB 4US8A 3P1MA 4YTNB 1L6UA 3L4PA 3NS1A 1FIQA 2W3SA 1ROEA 1YJIA 3HVZA 3NVZA 4US9A 3ABVB 2M56B 5EE3A 5G5HA 2N0SB 4N6EB 1H7WA 1FFUA 1TKYA 4ITKA 1XLQA 1QLBB 3CWIA 4YTMB 3NVWA 4WQMA 1N63A 2W3RA 1YQ4B 1GTHA 3CF4A 1WWTA 1J7CA 1ZP0B 3AB5A 2BS3B 1I7HA 2B76B 1PDXA 1UWMA 1V97A 4P6VF 4ZOHC 3AM9A 2CU3A 1L5PA 3SR6A 1J7AA 1TKEA 5AUKA 1NENB 5H92C 4A9AA 3P4RB 1FRRA 1QOAA 3HRDD 3LXFA 2LEKA 4N59A 1YJJA 2WP9B 3DWGC 4JX1C 3VRBB 2K22A 3NRZA 2WU2B 2WDQB 1J7BA 1H7XA 4LTUA 2W54A 3AEAB 1FO4A 4YSZB 2L52A 1RYJA 3AE7B 1FM0D 3ZYYX 3DWMA 1QOFA 1ZXIA 1QOGA 2L83A 5AUIA 5EE9A 2KAJA 1GPXA 1JQ4A 1DGJA 1FFVA 3NVVA 5G5GA 1TJEA 1L0VB 1FRDA 2H88B 1CZPA 1NYQA 2G1EA 1RM6C 1N62A 3AEGB 2KMMA 4KX6B 4IDIA 1VDVA 5MPOA 1NI3A 3AE8B 3AE3B 3VR9B 2PVGC 1E9MA 4YSXB 3ETRA 3EUB2 4YT0B 1NVID 2CJOA 2EKIA 1N60A 2M19A 5EE1A 1XO3A 3AEFB 1FXAA 1L6VA 3AH7A 3AEDB 2QJLA 2AX5A 4YTPB 3RPFC 1DOXA 1RFKA 1E7PB 1CJEA 3KWLA 4ZHOA 1QF6A 1TKGA 3AMZA 1WYGA 2K5PA 1JWBD 1RWSA 1WGKA 4FXCA 3SFEB 3BIID 1QOBA 3AE4B 4HROA 3LB8C 2Q5WD 1R7SA 2K9XA 2E3TA 1TYGB 1XLNA 2MJDA 2JX5A 1GAQB 1WXQA 3AEBB 1AYFA 2Y5CA 1DOIA 2MJEA 2WS3B 3B2FA 3NVYA 5GXGB 2WDRB 2PKOA 1VJKA 2PIAA 2HTME 2FBWB 1F0ZA 4YXDB 1PFDA 3VR8B 4JWSC 1YQ3B 3AE9B 1JROA 3AE1B 1A70A 1NEKB 2MH7A 4JWUC 3AN1A 1DOYA 1VLBA 1SIJA 2MJ3A 1JW9D 2BS4B 1N61A 2BS2B 3P4SB 2WLBA 2WU5B 1OFFA 3P4QB 5C3JB 3W5VB 4C7ZA 1GTEA 1EWYC 1T3QA 1KFYB 2DWQA 3W5UB 1E10A 1JWAD 2BT6A 2DBYA 1ZOYB 1QT9A 2WQYB 1WRIA 1AWDA 3VRAB 2JQRB 1FXIA 3AE5B 3AE6B 1NYRA 1N5XA 1JALA 2CJNA 3FAHA 1JRPA 3P63A 5EE0A 1OQQA 5H8YE 4YSYB 3FC4A 4WWMA 2W55A 1PUTA 1IUEA 1SB3C 4N58A 4ZHPA 1XLPA 3AECB 1V8CA 1KRHA 1ZUD2 1OQRA 3B9JA 3W9CB 2ACZB 3P4PB 1E0ZA 1KF6B 1FMAD 2OHFA 3PO0A 3SFDB 1E6EB 3AEEB 2PVOD 4USAA 3AE2B 3CIRB 3HUIA 4HRSA 4C7YA 1SF0A
chains in the Genus database with same CATH superfamily
3CF6E 3PTFC 5DCNA 2H89B 2ZVOA 1V5TA 3N32A 2CR5A 3WALA 1XXGA 5D3DA 3A9KB 5DPTA 2K25A 2W82A 5CHVC 4AQ7A 1ZP0B 2B76B 3UQAA 2NCNA 4P6VF 3NUHB 1K8RB 1OGWA 4KGRA 4ZYSA 1FCLA 3P4RB 4N59A 2V3NA 4A90A 4AS1A 2DAJA 5BO4B 2WU2B 2PW9A 3KYCD 1UD7A 3FILA 4ANUA 2LGSA 2KANA 2OEDA 5EE9A 4XZ4A 3VUWA 1TT5B 1FRDA 1CZPA 1KH0A 4TMAB 4MSMB 3EHVA 3AE8B 1E9MA 5J17A 2GLSA 4P1CC 1IGCA 3NOBA 5EE1A 4EKUA 4M02A 3AEDB 4AJYB 4XWTA 2N7JA 3ZJVA 2HE7A 1WJNA 3P42A 5D94A 3RFZB 2L00B 1HEZE 2K5PA 2CHZA 2ZW0A 4KDIC 3V6EB 1WXQA 2ZCCA 4IKGA 3U4EG 2BKFA 1DOYA 2LGXA 3AN1A 3TCAA 4JIOU 4LDTD 2BS4B 4ICUA 1N61A 1GJZA 4ICVA 3VFKA 4W9LA 1JWAD 1QT9A 4FJYA 1QQRA 4NNJB 1GOZA 3U8ZA 3IAS1 5H8YE 2M8SA 4YSYB 2NPTB 2MSED 3KUDB 3QIJA 4W9DA 4A20A 1WY8A 2PEAA 3RMKC 2Z59B 2I2YA 3Q3MC 3ZUNA 3WCQA 3UINB 2AL3A 2XN9C 3NS1A 3MHZA 3ABVB 3OG5A 1NDDA 4YTMB 1Q1OA 4K1RB 3ZKJC 2INPE 3KQ4A 1I7HA 1V49A 4BVUC 2KZRA 2TSSA 2WP9B 3VRBB 2JU6X 2BYTA 2RPVA 4F8CB 4ANVA 2LUEA 3Q6BA 2JRIB 3ZO5B 2JVCA 1JQ4A 1DGJA 3ECIA 2K1FA 2V4LA 2KMMA 5BMGA 1GNUA 4W9FA 1E90A 3VH3B 1WXSA 1BUIC 2M0XA 3H7PB 1WR6E 4YWGG 3QCAA 1RFKA 3A1QB 5IA7A 1WYGA 1FNUA 3BIID 3Q3OC 2K9XA 4LNFA 1XLNA 3A9JB 4ZYNA 2MJEA 2WS3B 1MI0A 3R2TA 1R4NI 3RYTA 3AE1B 4II3B 4XDCA 2K0PA 3N9YC 2WXLA 3E56A 2BYEA 2O6VB 3JSVB 2KNBA 2WXRA 2NR2A 1N5XA 1UELA 1JRPA 2W55A 1PUTA 1IUEA 1JCKB 2JT4B 5L95C 4WWNA 2D3AA 2DZMA 3TSSA 4HRSA 4C7YA 1HQRD 1QZEA 1SF0A 3ZDTA 3M95A 1IBXA 4GDKA 4WJPA 1KJTA 2DNFA 1WFYA 2DHZA 1WXAA 2KWDA 1H7WA 4FJZA 4WJNA 3UIOB 4XX5A 1XT9B 1PDXA 4ZOHC 1HZ6A 3SEBA 2JYEA 2NTTA 3R7QA 2BB6A 2NMQA 2JWZA 2KN5A 3NRZA 4JLCA 4ZRIA 2WXFA 1FNVA 2LD9A 2D5GA 2V9HA 4URKA 2VH2A 2DZIA 1FFVA 1P7EA 3NVVA 1VR9A 2BGFA 2JYTA 4LNOA 2IGHA 2FCNA 3RI7C 3AEFB 3ML8A 2QJLA 3RNFC 3U30A 4GGQA 1BT0A 1E7PB 4ZHOA 4KGSA 4TSSA 1QF6A 1WI0A 5FR3A 4RGTA 2FE8A 5D6JB 1EU3A 3A4RA 3SU8X 1MFWA 2DYOA 2HDEA 4HCPB 2PKOA 4WQOB 2WWZA 3ZNGC 2M4NA 2VZKB 3N1YC 2BBCA 1KFYB 3BK2A 2IO0B 2LGYA 4RF1A 3VHTC 3A9KA 3T8MA 3AE5B 3U2SC 3DVGX 4F1SA 2LGIA 5CTRC 3WAOA 1GC6A 2RSUA 2Y5PA 2SEBD 2WXMA 2DZJA 1XLOA 4FA6A 3E9SA 2C7MB 4TKNA 4YTNB 2ASQA 2WXQA 2A4ZA 5G5HA 5T8IA 1E7UA 2CS4A 1F52A 1I4QA 1V86A 1HXYD 2CU3A 1RLFA 2BW2A 1NENB 4NJ7A 4P7IA 3LDZE 2ZPYA 3UGBB 3RNEC 3V3XA 4IOIE 1HTOA 1MVKA 4HJGE 3PT2B 3DPDA 4DHJB 2X8XX 2XK5A 4I6PA 1T0SC 4PT5A 3IT4B 4IM0A 4LNKA 4NZLB 3ZNHB 4YL8A 1WSPA 5E6JA 2AQ3B 2ZJDA 3AXCA 2KTFA 1WM3A 3VTVA 2C5LC 2BYVE 2GOWA 4LLGM 1ZDXA 2LVPA 1KM7A 3RPFC 4W9CA 4BZAA 1SJHD 4E74A 1WGGA 4C56C 4HDOA 4JL9A 3L16A 3H7SA 1Z2MA 3B0AA 3HHMA 1ESFA 4W9EA 4UDUC 3RZWC 1VCBA 2ZEQA 3UQBA 2KQSA 4Q2JA 2NPTA 1F0ZA 1TS4A 3VR8B 4NAWA 1WX7A 2FCSA 2DYBA 4L2YA 2LVQA 4M8NA 1F1HA 5EDSA 1SIJA 2QCZA 3HIZA 3HM6X 1I35A 3TIXA 2BPSA 1SBBB 1UGJA 4A3OA 2WQYB 3PHWB 3RNAC 1WXMA 1PGBA 4WIPA 2CHXA 5L83A 1KRHA 4MT5A 4L23A 5FKAC 2L8JA 1Q10A 1DYQA 1EUVB 3U52E 5I4DA 1MG4A 3IXSA 2R61A 3WAMA 3DVNV 3Q8CA 4ITKA 5FK9C 4DXGA 2RGFA 1YJ1A 1GTHA 3IT6B 3X23A 5AUKA 5JHBA 2BWFA 1QOAA 3RNBC 3D32A 2N9XA 4LNNA 3RNCC 2LJ5A 1E8YA 4LTUA 4L1BA 2G45B 3TL5A 1V6EA 3A1QA 2NTSA 1S3SG 1TY2A 4A6QA 3DOWA 3QARA 4O1NA 3OJ3A 3EFCA 2I38A 1Z5SB 3L13A 3AEGB 3A9JA 3OAWA 3PV1A 3BWUD 2BTEA 1NVID 2GBMA 2BB5A 4JPSA 2QEJC 4MELA 2LASA 2KJRA 4PS3A 3DHGC 4WAAA 4AP4C 2RMMA 4AWJA 5LXIB 1C9FA 3IAM1 3JSVA 2AEHA 4EZLA 2Y5CA 1R4NB 1DOIA 3PRPB 3M63B 4IC7B 3ZDMC 2D2QA 3HM3A 4M01A 4GMVA 4BOZB 4B0MA 3W5VB 4C7ZA 3W5UB 2ZNVC 2BT6A 3V6CB 2BQQA 3Q3NC 4E71A 2MHJA 3MP9A 3WANA 1T0RC 2KFKB 3B9JA 4MACA 2QSDA 4GLSC 5J18A 1D5MC 4HLEA 2ZZPB 4AJWA 1P3QU 2JRHA 1B9RA 4K7WA 1F2RI 4C80A 2LVOA 5D7GA 4US9A 3Q8EA 2N0SB 4EZJA 4LDTB 2KWCA 1E7VA 4KKJA 3TEZA 2Y5BB 4TV3A 2D07B 4XDDA 3R66C 3BYYB 4F7ZA 5H92C 1MHHE 2RDBC 3X0WA 4ASWC 2KDEB 2OJRA 4NJCA 1CMXB 2RPQA 4MGKE 5G2NA 3QA8A 4A55A 3I57A 4EE2A 2OOBB 3L10B 2LJIA 1AN8A 5G5GA 4NQLB 3W2DA 1NYQA 3APFA 1STEA 2G4DB 1VDVA 2REXA 1PYWD 1WXVA 2KHWB 4GXBA 2PVGC 4KSKC 4MM3B 3KLSX 2EMTA 1N60A 2D3BA 4II2B 1ET6A 5CHWA 2B3AA 3ML9A 1XF5L 3SFEB 2KMAA 1V2YA 1GAQB 1C79A 1QILA 3RD2A 4CQNA 4G11A 1VLBA 1YX6B 3NZSA 1JW9D 2G3QB 3NS8A 4FBJB 2QMTA 2WLBA 4ZDVA 1Y56A 1E10A 2DWQA 1WF9A 4CYEA 1E5WA 2JZ3B 1WM2A 3TUOA 1NYRA 1JALA 3FAHA 1HA5A 1ZKHA 2Z8LA 1SB3C 5AZHA 3O13A 4ZHPA 2MLBA 4WJQA 3AEEB 2PVOD 3CIRB 2N7EA 4KIKB 2MQJA 2XNAC 3NVZA 3Q3FA 3DQVA 1V81A 1N63A 4MGYE 5DPWA 2WNMA 1YQ4B 3CF4A 2BS3B 2KTRA 4C00A 1IPGA 3SR6A 3I3TB 1C4PA 4RGNA 1YJJA 3A33B 2MA9B 1I4GA 1RAXA 1N6ZA 3NG0A 1J7BA 2LWPA 4RMAA 1L4ZB 1ZXIA 2L32A 3H1UA 1V1OA 3IBEA 1TJEA 3PRMB 3T3NA 2CHWA 3N1XC 3L0WB 4WURA 1VZ8A 1D6EC 4LJOB 4OZBA 1EWCA 1I4HA 3QJZA 2MWSB 3Q8FA 2KVZA 2AQ1B 3PLVA 2AQ2B 4EOYA 1FCCC 1WR1A 2PIAA 1F2RC 1ZE3D 2INNE 1RRBA 4HDQA 3BYTB 4NPNA 1MJDA 4FN2A 2NVUI 3B1LX 2ZVNA 1OTRB 1YNTE 3Q14C 3R2IA 1ZOYB 2D3CA 2KJ6A 1JWUD 5IOIA 2GBJA 5E6PA 1V5OA 1JMLA 1P98A 3EECA 2KK8A 1ISNA 4IG7B 3W9CB 4B6WA 1OQRA 1T5XD 2WXPA 1C76A 1UBQA 3L08A 1TZOA 3SFDB 3JVZX 4W9GA 4USAA 3R3MA 4IM3A 2X38A 4MJSB 1A5RA 4G3XB 2IYDB 3VXWA 2QIEB 1SXTA 3KWVA 1EU4A 2J4XA 3R8BA 5LXHA 1FNWA 4BFRA 1SJED 2AL6A 2JF5A 4E3CA 2IGGA 1J7CA 3VH4B 5TSSA 2WXNA 1E8ZA 3RUIB 1I42A 2AYOB 4S0RA 5CHFA 3HRDD 3DWGC 2IZVB 2K22A 3AU5A 1UBIA 2XEWA 3DBLI 3W1SC 1VZ7A 1WJ4A 4X57B 2W54A 3H8HA 1R4MI 5IKCM 2RDGA 2WDTB 5AUIA 2WXKA 2KAJA 2IO3B 5J2RA 4OZAA 1NI3A 2KYWA 4KZCA 3TEXA 4HKZE 4XC2A 4CO7A 3KYDD 2WHIA 1YN5A 5D3IB 2V1YA 4DXFA 3DBHI 3V61A 2KFKA 2MH7A 4AUQC 3SD5A 3WAPA 3TEYA 1P9DU 3P4SB 2BVCA 1Q5WB 1TZ1A 4LCDE 4GOCA 2QILA 2L05A 3I9V1 1LQBA 3EGRA 3P4PB 4C4VB 2GBRA 4XWWA 4NY0A 4BKSD 2N9LA 1YOVB 3MTNB 2AWTA 2IO2B 3ZLZA 2V3PA 2WDVB 1FIQA 1ROEA 1YJIA 1EF1A 3KH0A 4FLHA 4G0NB 2INCC 1YQBA 3NVWA 3IFWB 3MFGA 5TR5A 4DHZB 1UWMA 3C0RB 4HK2A 3RNGC 4N9F4 5IAAC 1FRRA 2OJWA 4HJKA 3BVZA 4MGIE 4GDLB 1V9JA 2SAKA 2WXIA 4KDLB 4MM3A 2M17A 2LXCA 3N30A 1KTKA 2PMVA 4DBGA 2WDQB 3Q8AA 1H7XA 2Y3AA 4K7UA 2KX3A 2L52A 1RYJA 3AE7B 4K3CA 3BY4B 2N1VA 2IPKD 2J42A 2N7DA 4IUMB 2GB1A 1KOTA 2MW5A 5KHOA 2FCMA 1C4AA 3MC9A 1I4XA 2MBEA 1LGRA 4P16A 4GIVA 3EUB2 2IGDA 1T0YA 1D5ZC 1FXAA 1L6VA 3AH7A 3NZUA 4GB9A 3MHSD 1D4BA 4AOFA 2KN4A 2C60A 4D2KA 1L0XB 5LLIA 3B2FA 5C1ZA 3RCZA 2PJHA 3ZJTA 1SE2A 3RULA 1J8CA 2O2VB 2FIFA 3DHIC 1OEYJ 3MJ5A 5BYQA 2QC8A 4GU2A 3IG3A 1L7YA 3IVFA 4OVVA 4KZ0A 1JRUA 4BKGA 4ANWA 2N9EB 2J53A 4MEMA 2LFIA 3PHXB 4RM8A 2V0GA 3PO0A 1L0YB 2WXJA 3AE2B 3HUIA 1C3TA 3H9DA 2WX0A 2Z0EB 1H4RA 4ZRPA 3AV8A 2BWES 4KV2A 5G55A 1AARA 4BBNF 3Q3JA 2LGDA 1FFUA 4WQMA 3PPAA 1WWTA 3VAWA 1UUPA 2W9NA 4K3BA 3GZNI 1J7AA 1TKEA 2L0TA 3GS2A 2LEKA 4KSLC 4W9HA 4TUUA 4ARIA 2HJ8A 3V05A 4WJOA 1WRDB 2G4SA 1WZ3A 3AU4A 3T3OA 4EEWA 1QOFA 4XYCA 3ZNID 1F9JA 3B08A 1C1YB 2YEPF 4KX6B 4DDGD 4ACFA 3VR9B 1XO3A 3ZXVA 3H7PA 3ONSA 3RN9C 1TBEA 1WGHA 3APCA 1TGZB 4FXCA 3PS6A 1SE3A 2LXAA 2Q5WD 2KOXA 3ALBA 3AEBB 1AYFA 1UZXB 5GXGB 2KLGA 4PYUA 2FBWB 2YLMA 3AULA 2EELA 4EZKA 2KT7A 2KQ7A 4IWOA 1YD8U 3ZTCA 4MJSA 2WU5B 4RFBA 1GG3A 1EWYC 4K81A 2UU7A 5JH5C 4OW0A 4M00A 1CK1A 3VRAB 2JQRB 3KUCB 5HFYA 1XEEA 2J0JA 4DHZE 2NBWB 2O6VA 5EE0A 2MP2B 4OZCA 4GSWA 1V8CA 1P1AA 4HCNB 1E0ZA 2L1AA 3KVFB 1LM8B 1Y8RC 1TS3A 3B2GA 2GBKA 1JWSD 2JUOA 3HVZA 3U7DA 3ZJUA 3URYA 3ZRCA 3QC8B 4RM9A 3OWEB 4BBNC 4CHKA 4OVUA 1PGXA 2CU1A 3Q69A 3LXFA 3DBLB 1X1MA 4JX1C 3RZFA 4IWPA 2M1MA 1R4MB 2UWQA 1PQSA 4WAFA 2WGSA 1YN3A 2YVCA 4PK1A 2KD0A 3DBRI 1GB1A 4XGAB 2MBBB 3DWMA 3I63C 2H88B 1V1PB 4M8MA 5MPOA 1MG8A 2LHEA 2KKCA 1ZDVA 4WH4A 2MRPA 1KLGD 1KLVA 4HPMB 2G9HD 3C19A 1CJEA 1WMHB 4NAMA 3QK0A 3QX1A 4ZRQA 2J0MA 1QOBA 2KFJA 3HK0A 2KLCA 3LB8C 4HROA 3DBHB 3A4SC 4JGHB 1T0QC 3NVYA 3M3JA 1SE9A 3S2AA 2ZPNA 3L54A 3AE9B 1WYWB 3QWZB 1T6BX 1WZ0A 2BS2B 2JXXA 1XD3B 2HJ1A 3WA0A 3KW5B 1IYFA 3AE6B 3P63A 2MX2A 2JSVX 2R2OA 4N58A 2DENB 1XLPA 1ZGUB 2LRWA 2MEKA 4TQ1A 3LJ3A 2IY1B 5C23A 2WXOA 1H8CA 3NJTA 1EO6A 1E6EB 4ARCA 1L4DB 3QHTA 4FHJA 4HWIB 1WX9A 4BAXA 2NBUA 4GDLA 4HPPA 3NY5A 2IO1B 3BVMA 3PGEA 3MC8A 1WGRA 3DHHC 3PZ7A 1FPYA 3PVLA 3UIPB 2W3RA 3OJ4B 2E6XA 3AB5A 1WGDA 1TY0A 3I5JC 1HE8A 4OHJA 3AM9A 4BKTA 2KDMA 2LI5A 1K52A 4LJPB 1WIAA 1BXTA 3U7ZA 1TTNA 1I4PA 1YIWA 2XK5B 3CSFA 4EUTA 4MGZE 2N1WA 5E6NA 3ENEA 2JZZA 5AZGA 3W1SA 2ZNVB 3DVGY 3ZTDA 2NS5A 1LO5D 1IGDA 1RM6C 1WE7A 3SHQA 3ETRA 4NJ6A 4PS8A 4ZRJA 2DX5B 1B1ZA 2HD5B 1VRAB 2O2VA 4HPLB 2MBOA 3NHEB 3L17A 1SIFA 3AMZA 4LNIA 1RWSA 3N1ZC 3P2BA 3AE4B 4JE3B 2QDFA 2K3UA 4NAWB 1CQVA 3RT3B 5BYSA 1YQ3B 2FIDA 1A70A 1G6JA 3R7RA 1WX8A 2IJ0A 4I6LB 3P4QB 5C3JB 1GTEA 2YEPB 5HHDG 1SGHA 1WJUA 1KLUD 2N9KA 1M94A 2C7HA 3VUYA 2ACZB 4QAYA 2FUHB 2KC2A 4DQOC 2LMCA 2KQ4X 1N5WA 3BINA 2INDC 3SDLC 1L6UA 2W3SA 3JYUA 5EE3A 1VZ6A 1HTQA 3PSEB 1HZ5A 5IN7A 4P1BC 3GZNB 4ANXA 2ONQA 2M0AA 3PREA 1L5PA 2LUMA 4A9AA 2GMIC 1J0GA 4MDKE 5IO9A 2BYFA 1XCTL 3TEWA 2J52A 2L83A 1QOGA 1GPXA 4ZRKA 4M0WB 1K50A 2J7QB 1K51A 1YMHE 1WH3A 2J0KA 3M62B 1U4AA 2KWVB 3V62A 2JPHA 4YSXB 4H2AA 1S1QB 1EF5A 3VUXA 2JZPA 3CMMB 1ENFA 3GP7A 4KKIA 4W9KA 1TYGB 2JX5A 2MP2A 2WDRB 3UF8A 2HTME 5GMVA 3DCGA 2C9WB 3DVNU 1JROA 2PE9A 1SE4A 1Q0WB 2MJ3A 2ICIA 3GE8C 2KDFB 5FR6A 4DK5A 1D3ZA 1LFDA 2CJNA 4WWMA 2PLPA 4W9JA 2DYMA 1MHXA 4B9KA 3NZ3A 2K8CA 3LYYA 4PYZA 4IM2A 3P1MA 2EKEC 3MJWA 3ZNZB 4NQKE 1UWXA 3VQIA 2K6QA 2N9PC 1V1PA 3TJPA 2N4FA 4LK0M 2LZ6A 3DBRB 1PGAA 2NBVB 1VD2A 3AEAB 2ON8A 1NI2A 2DAFA 3GB1A 1JWMD 3EC8A 1FM0D 3PZ8A 5E6OA 1WMHA 4MH8A 2MCNB 2V3SA 3H6NA 2IBIB 3Q2AC 1QKZA 2LRUA 3OLMD 1N62A 4RF0A 3O65B 3C8YA 1RFAA 3PZDA 3BZDB 1E8WA 1OEYA 5DPRA 3ZVVA 5JXVA 1WGYA 2O6VD 3DBSA 3N3KB 2I1JA 2DZKA 2IDYA 3FILB 3HVDA 3VTUA 2D10A 3BVGA 2KXJA 2K6DB 2D11A 2KDBA 1TKGA 4S17A 2I1KA 2CKHB 4B0EA 2E3TA 3EFUA 4I6NB 3J9CA 2L7RA 1PFDA 1M4VA 2GBNA 4JWUC 1NEKB 3VVWB 4R3DA 1YX5B 4A8XC 1MPEA 1XCQL 4HVBA 1IP9A 2DLBA 1OFFA 2QHOA 3APDA 2BF8B 1T3QA 2RDHA 2DBYA 3W1YA 4XE0A 1SEBD 1OQQA 3T9LA 2JWUA 2JXTA 5BMHA 2Z0DB 2OHFA 2KMCA 1UNSA 3VTWA 1GT8A 3EA6A 5C2TB 4US8A 4KIKA 3L4PA 2ZW1A 2ZCBA 4RNAA 2IY0B 1TKYA 1XLQA 1QLBB 2KTRB 2D3GA 4DDID 1V97A 1C4CA 2VRRB 1E8XA 1SSNA 2FCQA 2KC1A 3CSTA 1WE6A 1P7FA 4W9IA 2A5UA 2XBBC 5DPSA 1UF0A 3BK1A 3DDCB 4FULA 4KGTA 4YSZB 4IWQA 2FUG1 1UGMA 2K8HA 1C78A 3UI3A 4J6IA 3ZQ4A 2K8BA 4OVZA 1V80A 4HKQA 2G1EA 4HEA1 2VZKD 1ET9A 1ZW7A 5KHQA 1OQYA 3AE3B 4MH0E 4DWFA 4G50A 4YT0B 2CJOA 2HTHA 3ZW3A 5JZEB 2GI9A 5CX3A 2AX5A 4YTPB 3K9OB 1XQQA 5HKHA 3FKYA 1DOXA 1GC7A 3KWLA 1F77A 1JWBD 4FADA 1WGKA 4FHKA 1EM7A 4A3PA 4WWOA 3V60A 1R7SA 2MJDA 5IP4D 4JWSC 4HXDA 1TS5A 1WJ6A 1C77A 3VDZA 2V4IB 3KUZA 2KACA 2MBQA 4J3OD 2RR9A 5D2MB 1AWDA 1BMLC 2PTLA 2KO3A 5BMIA 3ZXRA 3ZGZA 3FC4A 4RGMA 1D5XC 1ZUD2 2WXHA 4RH6A 2KJHB 1FMAD 4DHJD 4K7SA 1TIFA 1GUAB 1J19A 2UYZB 2FAZA 2L76A 4BOSC 2M56B 4N6EB 4BKSA 3CWIA 2L3ZA 5BYRA 2VH1A 4M0WA 2KDIA 2R2QA 2KX0A 3IHPC 1TS2A 4IW0A 1I4RA 3WIMA 5JHAA 2GRIA 1IBXB 4GDKB 1K53A 1P0RA 3PLUA 4GN1A 1FXTB 1ACCA 4KVGB 3MC0B 1LXDA 3GE3C 3K9PB 3ZYYX 2L0FA 5AZFA 3AI5A 2WYQA 1L0VB 2LHDA 1UH6A 2FNJB 3Q8BA 4IDIA 3PRZA 4JQWC 2EKIA 2M19A 2PPHA 1ZXHA 4FJVB 4REZA 5AEKB 3GOEA 4EFOA 1AW7A 3JW0X 2PE6B 1YN4A 3ZIMA 5HG2A 3TMPB 2WX1A 4DXAB 1L2NA 2KWUB 1VJKA 1GB4A 4YXDB 4WWPA 2KVRA 3QQ8B 3TBLD 2MBHA 2JY6A 4RGOS 4MSQB 3QAQA 1WRIA 4RCOA 5HI1A 2BKRB 1FXIA 1FO4A 1ZPSA 3N20C 2EMSA 1NBFC 2RD0A 3AECB 1FEHA 2C7NB 4B95A 3ZRFA 1KF6B 2WXGA 5LNK1 4TQ0A 1FD6A 4C4VA 4PS7A 2K39A
chains in the Genus database with same CATH topology
5I4DA 2KQ4X 2H89B 1N5WA 2V3PA 2WDVB 3IXSA 2R61A 1L6UA 1XXGA 5D3DA 1FIQA 2W3SA 1ROEA 1YJIA 5EE3A 2W82A 3Q8CA 4ITKA 3NVWA 1VZ6A 5FK9C 4DXGA 1HZ5A 1GTHA 4AQ7A 1ZP0B 3MFGA 3IT6B 2ONQA 2B76B 1UWMA 2M0AA 4P6VF 3NUHB 1L5PA 4KGRA 5AUKA 2LUMA 4ZYSA 4A9AA 3P4RB 1FRRA 1QOAA 1FCLA 3BVZA 4GDLB 2SAKA 4N59A 2WXIA 2V3NA 4A90A 4AS1A 1KTKA 2WU2B 2PMVA 2WDQB 2PW9A 3Q8AA 3FILA 1H7XA 2Y3AA 4LTUA 4L1BA 2L52A 1RYJA 3AE7B 1XCTL 2NTSA 3TEWA 2J52A 2IPKD 2J42A 2L83A 1QOGA 1TY2A 2OEDA 5EE9A 4A6QA 2GB1A 1GPXA 4O1NA 1K50A 1K51A 2I38A 1FRDA 1CZPA 1YMHE 1KH0A 4TMAB 1C4AA 3AEGB 1I4XA 3BWUD 4P16A 3AE8B 2BTEA 1E9MA 4YSXB 3EUB2 2IGDA 1NVID 4H2AA 1IGCA 5EE1A 2BB5A 1D5ZC 1FXAA 1L6VA 3AH7A 4JPSA 2JZPA 3AEDB 2QEJC 1ENFA 2N7JA 4XWTA 3ZJVA 3GP7A 3P42A 3RFZB 1D4BA 1HEZE 2K5PA 2KN4A 2RMMA 4KKIA 1C9FA 3IAM1 4D2KA 1L0XB 1TYGB 2ZW0A 2JX5A 1WXQA 2Y5CA 1DOIA 3B2FA 2WDRB 2HTME 4IKGA 3U4EG 3ZJTA 1JROA 1SE2A 1DOYA 3AN1A 1SE4A 2MJ3A 2BS4B 1N61A 2ICIA 3MJ5A 5BYQA 4B0MA 3W5VB 4C7ZA 3W5UB 1JWAD 2BT6A 1QT9A 1QQRA 1GOZA 2CJNA 3IAS1 5H8YE 3MP9A 4YSYB 4WWMA 2J53A 2LFIA 3B9JA 4MACA 2QSDA 2V0GA 2PLPA 3PO0A 1L0YB 2DYMA 4GLSC 1D5MC 2WXJA 2I2YA 3AE2B 1MHXA 3HUIA 3NZ3A 1B9RA 3LYYA 4ZRPA 1F2RI 3AV8A 3WCQA 4C80A 2XN9C 3P1MA 3NS1A 5D7GA 4US9A 3MHZA 3ABVB 3Q8EA 2N0SB 1FFUA 4WQMA 4KKJA 4YTMB 3TEZA 1WWTA 2INPE 1UUPA 3KQ4A 1I7HA 4XDDA 1UWXA 3VQIA 1J7AA 1TKEA 3BYYB 1V1PA 5H92C 3GS2A 1MHHE 2LEKA 2TSSA 2WP9B 4LK0M 4ARIA 3VRBB 3V05A 2JU6X 2BYTA 2RPVA 1PGAA 4NJCA 3AEAB 2ON8A 4A55A 3GB1A 1JWMD 3T3OA 3I57A 1FM0D 3PZ8A 4EE2A 1QOFA 4MH8A 2LJIA 1AN8A 1JQ4A 1DGJA 5G5GA 3W2DA 1NYQA 1QKZA 1STEA 1N62A 4RF0A 2YEPF 5BMGA 2KMMA 4KX6B 3C8YA 1VDVA 3BZDB 1PYWD 3VR9B 2PVGC 4MM3B 1BUIC 3KLSX 5JXVA 1N60A 4YWGG 1XO3A 2IDYA 3FILB 3HVDA 3BVGA 1RFKA 1ET6A 1TKGA 1WYGA 1FNUA 4FXCA 1XF5L 3SFEB 3BIID 4B0EA 1SE3A 2Q5WD 2E3TA 2K9XA 1XLNA 1GAQB 1C79A 3AEBB 1AYFA 1QILA 2MJEA 2WS3B 5GXGB 3J9CA 1MI0A 2FBWB 1PFDA 2EELA 3R2TA 1M4VA 4CQNA 3AE1B 4JWUC 1NEKB 4XDCA 1VLBA 2K0PA 3N9YC 4R3DA 1JW9D 2WXLA 4A8XC 1MPEA 2QMTA 1XCQL 2WLBA 2WU5B 2DLBA 1OFFA 4RFBA 3E56A 1Y56A 1E10A 1EWYC 1T3QA 2DWQA 2RDHA 2DBYA 4OW0A 1SEBD 4XE0A 1CK1A 3TUOA 3VRAB 2JQRB 5HFYA 2WXRA 1XEEA 1NYRA 1N5XA 1JALA 3FAHA 1JRPA 1HA5A 5EE0A 1OQQA 2JWUA 2JXTA 4OZCA 2Z8LA 2W55A 1PUTA 1IUEA 1SB3C 3O13A 1JCKB 4ZHPA 1V8CA 1E0ZA 5BMHA 2OHFA 2L1AA 3AEEB 2PVOD 3TSSA 3CIRB 4HRSA 4C7YA 1UNSA 1HQRD 1SF0A 1TS3A 3B2GA 1JWSD 1IBXA 2XNAC 1GT8A 3EA6A 5C2TB 4US8A 3L4PA 3NVZA 2ZW1A 4RNAA 3HVZA 2KWDA 3ZJUA 3URYA 1H7WA 1TKYA 1XLQA 1QLBB 1N63A 2WNMA 1YQ4B 3CF4A 2BS3B 3OWEB 1PDXA 1V97A 1C4CA 4ZOHC 1HZ6A 3SEBA 2JYEA 3SR6A 1PGXA 2NTTA 2BB6A 1C4PA 2NMQA 1SSNA 3Q69A 3LXFA 1P7FA 4RGNA 1YJJA 4JX1C 3NRZA 3BK1A 2WXFA 4WAFA 1I4GA 1YN3A 1J7BA 1FNVA 4KGTA 4YSZB 1GB1A 2D5GA 2FUG1 3DWMA 1L4ZB 1C78A 1ZXIA 2L32A 3UI3A 1V1OA 3ZQ4A 1FFVA 1P7EA 3NVVA 4OVZA 1VR9A 1TJEA 4HKQA 2H88B 2G1EA 3T3NA 4HEA1 1V1PB 2JYTA 2VZKD 2IGHA 1ET9A 5MPOA 2LHEA 1ZDVA 4WH4A 3AE3B 4WURA 1KLGD 4YT0B 1VZ8A 2CJOA 1D6EC 3AEFB 2GI9A 4OZBA 2QJLA 1EWCA 1I4HA 2AX5A 4YTPB 2G9HD 1DOXA 1E7PB 1CJEA 3KWLA 4KGSA 4ZHOA 3Q8FA 1F77A 4TSSA 1QF6A 1JWBD 5FR3A 4NAMA 1WGKA 4RGTA 1EM7A 2FE8A 2AQ1B 4ZRQA 1QOBA 1EU3A 4HROA 3LB8C 1R7SA 2MJDA 2AQ2B 2DYOA 2HDEA 1FCCC 3NVYA 2PKOA 2PIAA 1F2RC 1ZE3D 4JWSC 2INNE 3AE9B 1TS5A 3BYTB 1C77A 1T6BX 2V4IB 2VZKB 2BS2B 2BBCA 2KACA 1KFYB 1YNTE 3R2IA 4J3OD 3BK2A 4RF1A 1ZOYB 1AWDA 1JWUD 1BMLC 2PTLA 3AE5B 3AE6B 3P63A 5BMIA 1JMLA 3ZGZA 2JSVX 3FC4A 3U2SC 4RGMA 1D5XC 4N58A 2LGIA 1XLPA 1ZUD2 3W9CB 2WXHA 1OQRA 1T5XD 4RH6A 2MEKA 2WXPA 4TQ1A 1FMAD 1C76A 2WXOA 2Y5PA 1TZOA 2SEBD 3SFDB 1E6EB 2WXMA 4ARCA 4USAA 1L4DB 2X38A 1XLOA 3E9SA 2QIEB 1SXTA 4YTNB 3KWVA 3BVMA 1EU4A 2J4XA 2WXQA 3R8BA 2M56B 5G5HA 4N6EB 5T8IA 3CWIA 1FNWA 3PZ7A 1SJED 2W3RA 2IGGA 2E6XA 1J7CA 3AB5A 5BYRA 1TY0A 5TSSA 1I4QA 4M0WA 2WXNA 1HXYD 4OHJA 3AM9A 2CU3A 2KDMA 1K52A 1BXTA 1TS2A 2BW2A 1NENB 3U7ZA 1I4RA 3HRDD 1I4PA 2GRIA 3V3XA 4IOIE 4GDKB 1K53A 3DWGC 1IBXB 2K22A 1MVKA 4HJGE 1VZ7A 2W54A 1ACCA 3H8HA 3MC0B 4PT5A 2RDGA 3IT4B 4NZLB 3ZYYX 5AUIA 2WXKA 3W1SA 1WSPA 2KAJA 5E6JA 2AQ3B 1LO5D 1L0VB 1IGDA 2LHDA 1RM6C 3Q8BA 4IDIA 4OZAA 1NI3A 3ETRA 2EKIA 4LLGM 2M19A 1B1ZA 1ZDXA 1ZXHA 4REZA 1VRAB 3RPFC 3TEXA 4HKZE 1AW7A 1SJHD 4C56C 3AMZA 1RWSA 1YN4A 5HG2A 1ESFA 1YN5A 3AE4B 4UDUC 5D3IB 4JE3B 4DXFA 2K3UA 4Q2JA 4NAWB 1F0ZA 1CQVA 1VJKA 1TS4A 1GB4A 4YXDB 3VR8B 5BYSA 1YQ3B 1A70A 2MH7A 4L2YA 3TEYA 1SIJA 2IJ0A 3P4SB 3P4QB 5C3JB 1GTEA 1SBBB 2YEPB 5HHDG 4RGOS 1UGJA 2WQYB 1WRIA 4RCOA 5HI1A 1KLUD 1FXIA 2QILA 1FO4A 1PGBA 2N9KA 4WIPA 1ZPSA 3I9V1 3AECB 1FEHA 1KRHA 3EGRA 2ACZB 3P4PB 1KF6B 2WXGA 4MT5A 5LNK1 4XWWA 4L23A 4DQOC 4TQ0A 5FKAC 1FD6A 2N9LA 1Q10A 1DYQA 2LMCA 3U52E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLO A;  3B2G A;  2H89 B;  1B9R A;  4C80 A;  3AV8 A;  3WCQ A;  1N5W A;  1GT8 A;  2WDV B;  2QIE B;  5C2T B;  4US8 A;  3P1M A;  4YTN B;  1L6U A;  3L4P A;  3NS1 A;  1FIQ A;  2W3S A;  1ROE A;  1YJI A;  3HVZ A;  3NVZ A;  4US9 A;  3ABV B;  2M56 B;  5EE3 A;  5G5H A;  2N0S B;  4N6E B;  1H7W A;  1FFU A;  1TKY A;  4ITK A;  1XLQ A;  1QLB B;  3CWI A;  4YTM B;  3NVW A;  4WQM A;  1N63 A;  2W3R A;  1YQ4 B;  1GTH A;  3CF4 A;  1WWT A;  1J7C A;  1ZP0 B;  3AB5 A;  2BS3 B;  1I7H A;  2B76 B;  1PDX A;  1UWM A;  1V97 A;  4P6V F;  4ZOH C;  3AM9 A;  2CU3 A;  1L5P A;  3SR6 A;  1J7A A;  1TKE A;  5AUK A;  1NEN B;  5H92 C;  4A9A A;  3P4R B;  1FRR A;  1QOA A;  3HRD D;  3LXF A;  2LEK A;  4N59 A;  1YJJ A;  2WP9 B;  3DWG C;  4JX1 C;  3VRB B;  2K22 A;  3NRZ A;  2WU2 B;  2WDQ B;  1J7B A;  1H7X A;  4LTU A;  2W54 A;  3AEA B;  1FO4 A;  4YSZ B;  2L52 A;  1RYJ A;  3AE7 B;  1FM0 D;  3ZYY X;  3DWM A;  1QOF A;  1ZXI A;  1QOG A;  2L83 A;  5AUI A;  5EE9 A;  2KAJ A;  1GPX A;  1JQ4 A;  1DGJ A;  1FFV A;  3NVV A;  5G5G A;  1TJE A;  1L0V B;  1FRD A;  2H88 B;  1CZP A;  1NYQ A;  2G1E A;  1RM6 C;  1N62 A;  3AEG B;  2KMM A;  4KX6 B;  4IDI A;  1VDV A;  5MPO A;  1NI3 A;  3AE8 B;  3AE3 B;  3VR9 B;  2PVG C;  1E9M A;  4YSX B;  3ETR A;  3EUB 2;  4YT0 B;  1NVI D;  2CJO A;  2EKI A;  1N60 A;  2M19 A;  5EE1 A;  1XO3 A;  3AEF B;  1FXA A;  1L6V A;  3AH7 A;  3AED B;  2QJL A;  2AX5 A;  4YTP B;  3RPF C;  1DOX A;  1RFK A;  1E7P B;  1CJE A;  3KWL A;  4ZHO A;  1QF6 A;  1TKG A;  3AMZ A;  1WYG A;  2K5P A;  1JWB D;  1RWS A;  1WGK A;  4FXC A;  3SFE B;  3BII D;  1QOB A;  3AE4 B;  4HRO A;  3LB8 C;  2Q5W D;  1R7S A;  2K9X A;  2E3T A;  1TYG B;  1XLN A;  2MJD A;  2JX5 A;  1GAQ B;  1WXQ A;  3AEB B;  1AYF A;  2Y5C A;  1DOI A;  2MJE A;  2WS3 B;  3B2F A;  3NVY A;  5GXG B;  2WDR B;  2PKO A;  1VJK A;  2PIA A;  2HTM E;  2FBW B;  1F0Z A;  4YXD B;  1PFD A;  3VR8 B;  4JWS C;  1YQ3 B;  3AE9 B;  1JRO A;  3AE1 B;  1A70 A;  1NEK B;  2MH7 A;  4JWU C;  3AN1 A;  1DOY A;  1VLB A;  1SIJ A;  2MJ3 A;  1JW9 D;  2BS4 B;  1N61 A;  2BS2 B;  3P4S B;  2WLB A;  2WU5 B;  1OFF A;  3P4Q B;  5C3J B;  3W5V B;  4C7Z A;  1GTE A;  1EWY C;  1T3Q A;  1KFY B;  2DWQ A;  3W5U B;  1E10 A;  1JWA D;  2BT6 A;  2DBY A;  1ZOY B;  1QT9 A;  2WQY B;  1WRI A;  1AWD A;  3VRA B;  2JQR B;  1FXI A;  3AE5 B;  3AE6 B;  1NYR A;  1N5X A;  1JAL A;  2CJN A;  3FAH A;  1JRP A;  3P63 A;  5EE0 A;  1OQQ A;  5H8Y E;  4YSY B;  3FC4 A;  4WWM A;  2W55 A;  1PUT A;  1IUE A;  1SB3 C;  4N58 A;  4ZHP A;  1XLP A;  3AEC B;  1V8C A;  1KRH A;  1ZUD 2;  1OQR A;  3B9J A;  3W9C B;  2ACZ B;  3P4P B;  1E0Z A;  1KF6 B;  1FMA D;  2OHF A;  3PO0 A;  3SFD B;  1E6E B;  3AEE B;  2PVO D;  4USA A;  3AE2 B;  3CIR B;  3HUI A;  4HRS A;  4C7Y A;  1SF0 A; 
#chains in the Genus database with same CATH topology
 3CF6 E;  3PTF C;  5DCN A;  2H89 B;  2ZVO A;  1V5T A;  3N32 A;  2CR5 A;  3WAL A;  1XXG A;  5D3D A;  3A9K B;  5DPT A;  2K25 A;  2W82 A;  5CHV C;  4AQ7 A;  1ZP0 B;  2B76 B;  3UQA A;  2NCN A;  4P6V F;  3NUH B;  1K8R B;  1OGW A;  4KGR A;  4ZYS A;  1FCL A;  3P4R B;  4N59 A;  2V3N A;  4A90 A;  4AS1 A;  2DAJ A;  5BO4 B;  2WU2 B;  2PW9 A;  3KYC D;  1UD7 A;  3FIL A;  4ANU A;  2LGS A;  2KAN A;  2OED A;  5EE9 A;  4XZ4 A;  3VUW A;  1TT5 B;  1FRD A;  1CZP A;  1KH0 A;  4TMA B;  4MSM B;  3EHV A;  3AE8 B;  1E9M A;  5J17 A;  2GLS A;  4P1C C;  1IGC A;  3NOB A;  5EE1 A;  4EKU A;  4M02 A;  3AED B;  4AJY B;  4XWT A;  2N7J A;  3ZJV A;  2HE7 A;  1WJN A;  3P42 A;  5D94 A;  3RFZ B;  2L00 B;  1HEZ E;  2K5P A;  2CHZ A;  2ZW0 A;  4KDI C;  3V6E B;  1WXQ A;  2ZCC A;  4IKG A;  3U4E G;  2BKF A;  1DOY A;  2LGX A;  3AN1 A;  3TCA A;  4JIO U;  4LDT D;  2BS4 B;  4ICU A;  1N61 A;  1GJZ A;  4ICV A;  3VFK A;  4W9L A;  1JWA D;  1QT9 A;  4FJY A;  1QQR A;  4NNJ B;  1GOZ A;  3U8Z A;  3IAS 1;  5H8Y E;  2M8S A;  4YSY B;  2NPT B;  2MSE D;  3KUD B;  3QIJ A;  4W9D A;  4A20 A;  1WY8 A;  2PEA A;  3RMK C;  2Z59 B;  2I2Y A;  3Q3M C;  3ZUN A;  3WCQ A;  3UIN B;  2AL3 A;  2XN9 C;  3NS1 A;  3MHZ A;  3ABV B;  3OG5 A;  1NDD A;  4YTM B;  1Q1O A;  4K1R B;  3ZKJ C;  2INP E;  3KQ4 A;  1I7H A;  1V49 A;  4BVU C;  2KZR A;  2TSS A;  2WP9 B;  3VRB B;  2JU6 X;  2BYT A;  2RPV A;  4F8C B;  4ANV A;  2LUE A;  3Q6B A;  2JRI B;  3ZO5 B;  2JVC A;  1JQ4 A;  1DGJ A;  3ECI A;  2K1F A;  2V4L A;  2KMM A;  5BMG A;  1GNU A;  4W9F A;  1E90 A;  3VH3 B;  1WXS A;  1BUI C;  2M0X A;  3H7P B;  1WR6 E;  4YWG G;  3QCA A;  1RFK A;  3A1Q B;  5IA7 A;  1WYG A;  1FNU A;  3BII D;  3Q3O C;  2K9X A;  4LNF A;  1XLN A;  3A9J B;  4ZYN A;  2MJE A;  2WS3 B;  1MI0 A;  3R2T A;  1R4N I;  3RYT A;  3AE1 B;  4II3 B;  4XDC A;  2K0P A;  3N9Y C;  2WXL A;  3E56 A;  2BYE A;  2O6V B;  3JSV B;  2KNB A;  2WXR A;  2NR2 A;  1N5X A;  1UEL A;  1JRP A;  2W55 A;  1PUT A;  1IUE A;  1JCK B;  2JT4 B;  5L95 C;  4WWN A;  2D3A A;  2DZM A;  3TSS A;  4HRS A;  4C7Y A;  1HQR D;  1QZE A;  1SF0 A;  3ZDT A;  3M95 A;  1IBX A;  4GDK A;  4WJP A;  1KJT A;  2DNF A;  1WFY A;  2DHZ A;  1WXA A;  2KWD A;  1H7W A;  4FJZ A;  4WJN A;  3UIO B;  4XX5 A;  1XT9 B;  1PDX A;  4ZOH C;  1HZ6 A;  3SEB A;  2JYE A;  2NTT A;  3R7Q A;  2BB6 A;  2NMQ A;  2JWZ A;  2KN5 A;  3NRZ A;  4JLC A;  4ZRI A;  2WXF A;  1FNV A;  2LD9 A;  2D5G A;  2V9H A;  4URK A;  2VH2 A;  2DZI A;  1FFV A;  1P7E A;  3NVV A;  1VR9 A;  2BGF A;  2JYT A;  4LNO A;  2IGH A;  2FCN A;  3RI7 C;  3AEF B;  3ML8 A;  2QJL A;  3RNF C;  3U30 A;  4GGQ A;  1BT0 A;  1E7P B;  4ZHO A;  4KGS A;  4TSS A;  1QF6 A;  1WI0 A;  5FR3 A;  4RGT A;  2FE8 A;  5D6J B;  1EU3 A;  3A4R A;  3SU8 X;  1MFW A;  2DYO A;  2HDE A;  4HCP B;  2PKO A;  4WQO B;  2WWZ A;  3ZNG C;  2M4N A;  2VZK B;  3N1Y C;  2BBC A;  1KFY B;  3BK2 A;  2IO0 B;  2LGY A;  4RF1 A;  3VHT C;  3A9K A;  3T8M A;  3AE5 B;  3U2S C;  3DVG X;  4F1S A;  2LGI A;  5CTR C;  3WAO A;  1GC6 A;  2RSU A;  2Y5P A;  2SEB D;  2WXM A;  2DZJ A;  1XLO A;  4FA6 A;  3E9S A;  2C7M B;  4TKN A;  4YTN B;  2ASQ A;  2WXQ A;  2A4Z A;  5G5H A;  5T8I A;  1E7U A;  2CS4 A;  1F52 A;  1I4Q A;  1V86 A;  1HXY D;  2CU3 A;  1RLF A;  2BW2 A;  1NEN B;  4NJ7 A;  4P7I A;  3LDZ E;  2ZPY A;  3UGB B;  3RNE C;  3V3X A;  4IOI E;  1HTO A;  1MVK A;  4HJG E;  3PT2 B;  3DPD A;  4DHJ B;  2X8X X;  2XK5 A;  4I6P A;  1T0S C;  4PT5 A;  3IT4 B;  4IM0 A;  4LNK A;  4NZL B;  3ZNH B;  4YL8 A;  1WSP A;  5E6J A;  2AQ3 B;  2ZJD A;  3AXC A;  2KTF A;  1WM3 A;  3VTV A;  2C5L C;  2BYV E;  2GOW A;  4LLG M;  1ZDX A;  2LVP A;  1KM7 A;  3RPF C;  4W9C A;  4BZA A;  1SJH D;  4E74 A;  1WGG A;  4C56 C;  4HDO A;  4JL9 A;  3L16 A;  3H7S A;  1Z2M A;  3B0A A;  3HHM A;  1ESF A;  4W9E A;  4UDU C;  3RZW C;  1VCB A;  2ZEQ A;  3UQB A;  2KQS A;  4Q2J A;  2NPT A;  1F0Z A;  1TS4 A;  3VR8 B;  4NAW A;  1WX7 A;  2FCS A;  2DYB A;  4L2Y A;  2LVQ A;  4M8N A;  1F1H A;  5EDS A;  1SIJ A;  2QCZ A;  3HIZ A;  3HM6 X;  1I35 A;  3TIX A;  2BPS A;  1SBB B;  1UGJ A;  4A3O A;  2WQY B;  3PHW B;  3RNA C;  1WXM A;  1PGB A;  4WIP A;  2CHX A;  5L83 A;  1KRH A;  4MT5 A;  4L23 A;  5FKA C;  2L8J A;  1Q10 A;  1DYQ A;  1EUV B;  3U52 E;  5I4D A;  1MG4 A;  3IXS A;  2R61 A;  3WAM A;  3DVN V;  3Q8C A;  4ITK A;  5FK9 C;  4DXG A;  2RGF A;  1YJ1 A;  1GTH A;  3IT6 B;  3X23 A;  5AUK A;  5JHB A;  2BWF A;  1QOA A;  3RNB C;  3D32 A;  2N9X A;  4LNN A;  3RNC C;  2LJ5 A;  1E8Y A;  4LTU A;  4L1B A;  2G45 B;  3TL5 A;  1V6E A;  3A1Q A;  2NTS A;  1S3S G;  1TY2 A;  4A6Q A;  3DOW A;  3QAR A;  4O1N A;  3OJ3 A;  3EFC A;  2I38 A;  1Z5S B;  3L13 A;  3AEG B;  3A9J A;  3OAW A;  3PV1 A;  3BWU D;  2BTE A;  1NVI D;  2GBM A;  2BB5 A;  4JPS A;  2QEJ C;  4MEL A;  2LAS A;  2KJR A;  4PS3 A;  3DHG C;  4WAA A;  4AP4 C;  2RMM A;  4AWJ A;  5LXI B;  1C9F A;  3IAM 1;  3JSV A;  2AEH A;  4EZL A;  2Y5C A;  1R4N B;  1DOI A;  3PRP B;  3M63 B;  4IC7 B;  3ZDM C;  2D2Q A;  3HM3 A;  4M01 A;  4GMV A;  4BOZ B;  4B0M A;  3W5V B;  4C7Z A;  3W5U B;  2ZNV C;  2BT6 A;  3V6C B;  2BQQ A;  3Q3N C;  4E71 A;  2MHJ A;  3MP9 A;  3WAN A;  1T0R C;  2KFK B;  3B9J A;  4MAC A;  2QSD A;  4GLS C;  5J18 A;  1D5M C;  4HLE A;  2ZZP B;  4AJW A;  1P3Q U;  2JRH A;  1B9R A;  4K7W A;  1F2R I;  4C80 A;  2LVO A;  5D7G A;  4US9 A;  3Q8E A;  2N0S B;  4EZJ A;  4LDT B;  2KWC A;  1E7V A;  4KKJ A;  3TEZ A;  2Y5B B;  4TV3 A;  2D07 B;  4XDD A;  3R66 C;  3BYY B;  4F7Z A;  5H92 C;  1MHH E;  2RDB C;  3X0W A;  4ASW C;  2KDE B;  2OJR A;  4NJC A;  1CMX B;  2RPQ A;  4MGK E;  5G2N A;  3QA8 A;  4A55 A;  3I57 A;  4EE2 A;  2OOB B;  3L10 B;  2LJI A;  1AN8 A;  5G5G A;  4NQL B;  3W2D A;  1NYQ A;  3APF A;  1STE A;  2G4D B;  1VDV A;  2REX A;  1PYW D;  1WXV A;  2KHW B;  4GXB A;  2PVG C;  4KSK C;  4MM3 B;  3KLS X;  2EMT A;  1N60 A;  2D3B A;  4II2 B;  1ET6 A;  5CHW A;  2B3A A;  3ML9 A;  1XF5 L;  3SFE B;  2KMA A;  1V2Y A;  1GAQ B;  1C79 A;  1QIL A;  3RD2 A;  4CQN A;  4G11 A;  1VLB A;  1YX6 B;  3NZS A;  1JW9 D;  2G3Q B;  3NS8 A;  4FBJ B;  2QMT A;  2WLB A;  4ZDV A;  1Y56 A;  1E10 A;  2DWQ A;  1WF9 A;  4CYE A;  1E5W A;  2JZ3 B;  1WM2 A;  3TUO A;  1NYR A;  1JAL A;  3FAH A;  1HA5 A;  1ZKH A;  2Z8L A;  1SB3 C;  5AZH A;  3O13 A;  4ZHP A;  2MLB A;  4WJQ A;  3AEE B;  2PVO D;  3CIR B;  2N7E A;  4KIK B;  2MQJ A;  2XNA C;  3NVZ A;  3Q3F A;  3DQV A;  1V81 A;  1N63 A;  4MGY E;  5DPW A;  2WNM A;  1YQ4 B;  3CF4 A;  2BS3 B;  2KTR A;  4C00 A;  1IPG A;  3SR6 A;  3I3T B;  1C4P A;  4RGN A;  1YJJ A;  3A33 B;  2MA9 B;  1I4G A;  1RAX A;  1N6Z A;  3NG0 A;  1J7B A;  2LWP A;  4RMA A;  1L4Z B;  1ZXI A;  2L32 A;  3H1U A;  1V1O A;  3IBE A;  1TJE A;  3PRM B;  3T3N A;  2CHW A;  3N1X C;  3L0W B;  4WUR A;  1VZ8 A;  1D6E C;  4LJO B;  4OZB A;  1EWC A;  1I4H A;  3QJZ A;  2MWS B;  3Q8F A;  2KVZ A;  2AQ1 B;  3PLV A;  2AQ2 B;  4EOY A;  1FCC C;  1WR1 A;  2PIA A;  1F2R C;  1ZE3 D;  2INN E;  1RRB A;  4HDQ A;  3BYT B;  4NPN A;  1MJD A;  4FN2 A;  2NVU I;  3B1L X;  2ZVN A;  1OTR B;  1YNT E;  3Q14 C;  3R2I A;  1ZOY B;  2D3C A;  2KJ6 A;  1JWU D;  5IOI A;  2GBJ A;  5E6P A;  1V5O A;  1JML A;  1P98 A;  3EEC A;  2KK8 A;  1ISN A;  4IG7 B;  3W9C B;  4B6W A;  1OQR A;  1T5X D;  2WXP A;  1C76 A;  1UBQ A;  3L08 A;  1TZO A;  3SFD B;  3JVZ X;  4W9G A;  4USA A;  3R3M A;  4IM3 A;  2X38 A;  4MJS B;  1A5R A;  4G3X B;  2IYD B;  3VXW A;  2QIE B;  1SXT A;  3KWV A;  1EU4 A;  2J4X A;  3R8B A;  5LXH A;  1FNW A;  4BFR A;  1SJE D;  2AL6 A;  2JF5 A;  4E3C A;  2IGG A;  1J7C A;  3VH4 B;  5TSS A;  2WXN A;  1E8Z A;  3RUI B;  1I42 A;  2AYO B;  4S0R A;  5CHF A;  3HRD D;  3DWG C;  2IZV B;  2K22 A;  3AU5 A;  1UBI A;  2XEW A;  3DBL I;  3W1S C;  1VZ7 A;  1WJ4 A;  4X57 B;  2W54 A;  3H8H A;  1R4M I;  5IKC M;  2RDG A;  2WDT B;  5AUI A;  2WXK A;  2KAJ A;  2IO3 B;  5J2R A;  4OZA A;  1NI3 A;  2KYW A;  4KZC A;  3TEX A;  4HKZ E;  4XC2 A;  4CO7 A;  3KYD D;  2WHI A;  1YN5 A;  5D3I B;  2V1Y A;  4DXF A;  3DBH I;  3V61 A;  2KFK A;  2MH7 A;  4AUQ C;  3SD5 A;  3WAP A;  3TEY A;  1P9D U;  3P4S B;  2BVC A;  1Q5W B;  1TZ1 A;  4LCD E;  4GOC A;  2QIL A;  2L05 A;  3I9V 1;  1LQB A;  3EGR A;  3P4P B;  4C4V B;  2GBR A;  4XWW A;  4NY0 A;  4BKS D;  2N9L A;  1YOV B;  3MTN B;  2AWT A;  2IO2 B;  3ZLZ A;  2V3P A;  2WDV B;  1FIQ A;  1ROE A;  1YJI A;  1EF1 A;  3KH0 A;  4FLH A;  4G0N B;  2INC C;  1YQB A;  3NVW A;  3IFW B;  3MFG A;  5TR5 A;  4DHZ B;  1UWM A;  3C0R B;  4HK2 A;  3RNG C;  4N9F 4;  5IAA C;  1FRR A;  2OJW A;  4HJK A;  3BVZ A;  4MGI E;  4GDL B;  1V9J A;  2SAK A;  2WXI A;  4KDL B;  4MM3 A;  2M17 A;  2LXC A;  3N30 A;  1KTK A;  2PMV A;  4DBG A;  2WDQ B;  3Q8A A;  1H7X A;  2Y3A A;  4K7U A;  2KX3 A;  2L52 A;  1RYJ A;  3AE7 B;  4K3C A;  3BY4 B;  2N1V A;  2IPK D;  2J42 A;  2N7D A;  4IUM B;  2GB1 A;  1KOT A;  2MW5 A;  5KHO A;  2FCM A;  1C4A A;  3MC9 A;  1I4X A;  2MBE A;  1LGR A;  4P16 A;  4GIV A;  3EUB 2;  2IGD A;  1T0Y A;  1D5Z C;  1FXA A;  1L6V A;  3AH7 A;  3NZU A;  4GB9 A;  3MHS D;  1D4B A;  4AOF A;  2KN4 A;  2C60 A;  4D2K A;  1L0X B;  5LLI A;  3B2F A;  5C1Z A;  3RCZ A;  2PJH A;  3ZJT A;  1SE2 A;  3RUL A;  1J8C A;  2O2V B;  2FIF A;  3DHI C;  1OEY J;  3MJ5 A;  5BYQ A;  2QC8 A;  4GU2 A;  3IG3 A;  1L7Y A;  3IVF A;  4OVV A;  4KZ0 A;  1JRU A;  4BKG A;  4ANW A;  2N9E B;  2J53 A;  4MEM A;  2LFI A;  3PHX B;  4RM8 A;  2V0G A;  3PO0 A;  1L0Y B;  2WXJ A;  3AE2 B;  3HUI A;  1C3T A;  3H9D A;  2WX0 A;  2Z0E B;  1H4R A;  4ZRP A;  3AV8 A;  2BWE S;  4KV2 A;  5G55 A;  1AAR A;  4BBN F;  3Q3J A;  2LGD A;  1FFU A;  4WQM A;  3PPA A;  1WWT A;  3VAW A;  1UUP A;  2W9N A;  4K3B A;  3GZN I;  1J7A A;  1TKE A;  2L0T A;  3GS2 A;  2LEK A;  4KSL C;  4W9H A;  4TUU A;  4ARI A;  2HJ8 A;  3V05 A;  4WJO A;  1WRD B;  2G4S A;  1WZ3 A;  3AU4 A;  3T3O A;  4EEW A;  1QOF A;  4XYC A;  3ZNI D;  1F9J A;  3B08 A;  1C1Y B;  2YEP F;  4KX6 B;  4DDG D;  4ACF A;  3VR9 B;  1XO3 A;  3ZXV A;  3H7P A;  3ONS A;  3RN9 C;  1TBE A;  1WGH A;  3APC A;  1TGZ B;  4FXC A;  3PS6 A;  1SE3 A;  2LXA A;  2Q5W D;  2KOX A;  3ALB A;  3AEB B;  1AYF A;  1UZX B;  5GXG B;  2KLG A;  4PYU A;  2FBW B;  2YLM A;  3AUL A;  2EEL A;  4EZK A;  2KT7 A;  2KQ7 A;  4IWO A;  1YD8 U;  3ZTC A;  4MJS A;  2WU5 B;  4RFB A;  1GG3 A;  1EWY C;  4K81 A;  2UU7 A;  5JH5 C;  4OW0 A;  4M00 A;  1CK1 A;  3VRA B;  2JQR B;  3KUC B;  5HFY A;  1XEE A;  2J0J A;  4DHZ E;  2NBW B;  2O6V A;  5EE0 A;  2MP2 B;  4OZC A;  4GSW A;  1V8C A;  1P1A A;  4HCN B;  1E0Z A;  2L1A A;  3KVF B;  1LM8 B;  1Y8R C;  1TS3 A;  3B2G A;  2GBK A;  1JWS D;  2JUO A;  3HVZ A;  3U7D A;  3ZJU A;  3URY A;  3ZRC A;  3QC8 B;  4RM9 A;  3OWE B;  4BBN C;  4CHK A;  4OVU A;  1PGX A;  2CU1 A;  3Q69 A;  3LXF A;  3DBL B;  1X1M A;  4JX1 C;  3RZF A;  4IWP A;  2M1M A;  1R4M B;  2UWQ A;  1PQS A;  4WAF A;  2WGS A;  1YN3 A;  2YVC A;  4PK1 A;  2KD0 A;  3DBR I;  1GB1 A;  4XGA B;  2MBB B;  3DWM A;  3I63 C;  2H88 B;  1V1P B;  4M8M A;  5MPO A;  1MG8 A;  2LHE A;  2KKC A;  1ZDV A;  4WH4 A;  2MRP A;  1KLG D;  1KLV A;  4HPM B;  2G9H D;  3C19 A;  1CJE A;  1WMH B;  4NAM A;  3QK0 A;  3QX1 A;  4ZRQ A;  2J0M A;  1QOB A;  2KFJ A;  3HK0 A;  2KLC A;  3LB8 C;  4HRO A;  3DBH B;  3A4S C;  4JGH B;  1T0Q C;  3NVY A;  3M3J A;  1SE9 A;  3S2A A;  2ZPN A;  3L54 A;  3AE9 B;  1WYW B;  3QWZ B;  1T6B X;  1WZ0 A;  2BS2 B;  2JXX A;  1XD3 B;  2HJ1 A;  3WA0 A;  3KW5 B;  1IYF A;  3AE6 B;  3P63 A;  2MX2 A;  2JSV X;  2R2O A;  4N58 A;  2DEN B;  1XLP A;  1ZGU B;  2LRW A;  2MEK A;  4TQ1 A;  3LJ3 A;  2IY1 B;  5C23 A;  2WXO A;  1H8C A;  3NJT A;  1EO6 A;  1E6E B;  4ARC A;  1L4D B;  3QHT A;  4FHJ A;  4HWI B;  1WX9 A;  4BAX A;  2NBU A;  4GDL A;  4HPP A;  3NY5 A;  2IO1 B;  3BVM A;  3PGE A;  3MC8 A;  1WGR A;  3DHH C;  3PZ7 A;  1FPY A;  3PVL A;  3UIP B;  2W3R A;  3OJ4 B;  2E6X A;  3AB5 A;  1WGD A;  1TY0 A;  3I5J C;  1HE8 A;  4OHJ A;  3AM9 A;  4BKT A;  2KDM A;  2LI5 A;  1K52 A;  4LJP B;  1WIA A;  1BXT A;  3U7Z A;  1TTN A;  1I4P A;  1YIW A;  2XK5 B;  3CSF A;  4EUT A;  4MGZ E;  2N1W A;  5E6N A;  3ENE A;  2JZZ A;  5AZG A;  3W1S A;  2ZNV B;  3DVG Y;  3ZTD A;  2NS5 A;  1LO5 D;  1IGD A;  1RM6 C;  1WE7 A;  3SHQ A;  3ETR A;  4NJ6 A;  4PS8 A;  4ZRJ A;  2DX5 B;  1B1Z A;  2HD5 B;  1VRA B;  2O2V A;  4HPL B;  2MBO A;  3NHE B;  3L17 A;  1SIF A;  3AMZ A;  4LNI A;  1RWS A;  3N1Z C;  3P2B A;  3AE4 B;  4JE3 B;  2QDF A;  2K3U A;  4NAW B;  1CQV A;  3RT3 B;  5BYS A;  1YQ3 B;  2FID A;  1A70 A;  1G6J A;  3R7R A;  1WX8 A;  2IJ0 A;  4I6L B;  3P4Q B;  5C3J B;  1GTE A;  2YEP B;  5HHD G;  1SGH A;  1WJU A;  1KLU D;  2N9K A;  1M94 A;  2C7H A;  3VUY A;  2ACZ B;  4QAY A;  2FUH B;  2KC2 A;  4DQO C;  2LMC A;  2KQ4 X;  1N5W A;  3BIN A;  2IND C;  3SDL C;  1L6U A;  2W3S A;  3JYU A;  5EE3 A;  1VZ6 A;  1HTQ A;  3PSE B;  1HZ5 A;  5IN7 A;  4P1B C;  3GZN B;  4ANX A;  2ONQ A;  2M0A A;  3PRE A;  1L5P A;  2LUM A;  4A9A A;  2GMI C;  1J0G A;  4MDK E;  5IO9 A;  2BYF A;  1XCT L;  3TEW A;  2J52 A;  2L83 A;  1QOG A;  1GPX A;  4ZRK A;  4M0W B;  1K50 A;  2J7Q B;  1K51 A;  1YMH E;  1WH3 A;  2J0K A;  3M62 B;  1U4A A;  2KWV B;  3V62 A;  2JPH A;  4YSX B;  4H2A A;  1S1Q B;  1EF5 A;  3VUX A;  2JZP A;  3CMM B;  1ENF A;  3GP7 A;  4KKI A;  4W9K A;  1TYG B;  2JX5 A;  2MP2 A;  2WDR B;  3UF8 A;  2HTM E;  5GMV A;  3DCG A;  2C9W B;  3DVN U;  1JRO A;  2PE9 A;  1SE4 A;  1Q0W B;  2MJ3 A;  2ICI A;  3GE8 C;  2KDF B;  5FR6 A;  4DK5 A;  1D3Z A;  1LFD A;  2CJN A;  4WWM A;  2PLP A;  4W9J A;  2DYM A;  1MHX A;  4B9K A;  3NZ3 A;  2K8C A;  3LYY A;  4PYZ A;  4IM2 A;  3P1M A;  2EKE C;  3MJW A;  3ZNZ B;  4NQK E;  1UWX A;  3VQI A;  2K6Q A;  2N9P C;  1V1P A;  3TJP A;  2N4F A;  4LK0 M;  2LZ6 A;  3DBR B;  1PGA A;  2NBV B;  1VD2 A;  3AEA B;  2ON8 A;  1NI2 A;  2DAF A;  3GB1 A;  1JWM D;  3EC8 A;  1FM0 D;  3PZ8 A;  5E6O A;  1WMH A;  4MH8 A;  2MCN B;  2V3S A;  3H6N A;  2IBI B;  3Q2A C;  1QKZ A;  2LRU A;  3OLM D;  1N62 A;  4RF0 A;  3O65 B;  3C8Y A;  1RFA A;  3PZD A;  3BZD B;  1E8W A;  1OEY A;  5DPR A;  3ZVV A;  5JXV A;  1WGY A;  2O6V D;  3DBS A;  3N3K B;  2I1J A;  2DZK A;  2IDY A;  3FIL B;  3HVD A;  3VTU A;  2D10 A;  3BVG A;  2KXJ A;  2K6D B;  2D11 A;  2KDB A;  1TKG A;  4S17 A;  2I1K A;  2CKH B;  4B0E A;  2E3T A;  3EFU A;  4I6N B;  3J9C A;  2L7R A;  1PFD A;  1M4V A;  2GBN A;  4JWU C;  1NEK B;  3VVW B;  4R3D A;  1YX5 B;  4A8X C;  1MPE A;  1XCQ L;  4HVB A;  1IP9 A;  2DLB A;  1OFF A;  2QHO A;  3APD A;  2BF8 B;  1T3Q A;  2RDH A;  2DBY A;  3W1Y A;  4XE0 A;  1SEB D;  1OQQ A;  3T9L A;  2JWU A;  2JXT A;  5BMH A;  2Z0D B;  2OHF A;  2KMC A;  1UNS A;  3VTW A;  1GT8 A;  3EA6 A;  5C2T B;  4US8 A;  4KIK A;  3L4P A;  2ZW1 A;  2ZCB A;  4RNA A;  2IY0 B;  1TKY A;  1XLQ A;  1QLB B;  2KTR B;  2D3G A;  4DDI D;  1V97 A;  1C4C A;  2VRR B;  1E8X A;  1SSN A;  2FCQ A;  2KC1 A;  3CST A;  1WE6 A;  1P7F A;  4W9I A;  2A5U A;  2XBB C;  5DPS A;  1UF0 A;  3BK1 A;  3DDC B;  4FUL A;  4KGT A;  4YSZ B;  4IWQ A;  2FUG 1;  1UGM A;  2K8H A;  1C78 A;  3UI3 A;  4J6I A;  3ZQ4 A;  2K8B A;  4OVZ A;  1V80 A;  4HKQ A;  2G1E A;  4HEA 1;  2VZK D;  1ET9 A;  1ZW7 A;  5KHQ A;  1OQY A;  3AE3 B;  4MH0 E;  4DWF A;  4G50 A;  4YT0 B;  2CJO A;  2HTH A;  3ZW3 A;  5JZE B;  2GI9 A;  5CX3 A;  2AX5 A;  4YTP B;  3K9O B;  1XQQ A;  5HKH A;  3FKY A;  1DOX A;  1GC7 A;  3KWL A;  1F77 A;  1JWB D;  4FAD A;  1WGK A;  4FHK A;  1EM7 A;  4A3P A;  4WWO A;  3V60 A;  1R7S A;  2MJD A;  5IP4 D;  4JWS C;  4HXD A;  1TS5 A;  1WJ6 A;  1C77 A;  3VDZ A;  2V4I B;  3KUZ A;  2KAC A;  2MBQ A;  4J3O D;  2RR9 A;  5D2M B;  1AWD A;  1BML C;  2PTL A;  2KO3 A;  5BMI A;  3ZXR A;  3ZGZ A;  3FC4 A;  4RGM A;  1D5X C;  1ZUD 2;  2WXH A;  4RH6 A;  2KJH B;  1FMA D;  4DHJ D;  4K7S A;  1TIF A;  1GUA B;  1J19 A;  2UYZ B;  2FAZ A;  2L76 A;  4BOS C;  2M56 B;  4N6E B;  4BKS A;  3CWI A;  2L3Z A;  5BYR A;  2VH1 A;  4M0W A;  2KDI A;  2R2Q A;  2KX0 A;  3IHP C;  1TS2 A;  4IW0 A;  1I4R A;  3WIM A;  5JHA A;  2GRI A;  1IBX B;  4GDK B;  1K53 A;  1P0R A;  3PLU A;  4GN1 A;  1FXT B;  1ACC A;  4KVG B;  3MC0 B;  1LXD A;  3GE3 C;  3K9P B;  3ZYY X;  2L0F A;  5AZF A;  3AI5 A;  2WYQ A;  1L0V B;  2LHD A;  1UH6 A;  2FNJ B;  3Q8B A;  4IDI A;  3PRZ A;  4JQW C;  2EKI A;  2M19 A;  2PPH A;  1ZXH A;  4FJV B;  4REZ A;  5AEK B;  3GOE A;  4EFO A;  1AW7 A;  3JW0 X;  2PE6 B;  1YN4 A;  3ZIM A;  5HG2 A;  3TMP B;  2WX1 A;  4DXA B;  1L2N A;  2KWU B;  1VJK A;  1GB4 A;  4YXD B;  4WWP A;  2KVR A;  3QQ8 B;  3TBL D;  2MBH A;  2JY6 A;  4RGO S;  4MSQ B;  3QAQ A;  1WRI A;  4RCO A;  5HI1 A;  2BKR B;  1FXI A;  1FO4 A;  1ZPS A;  3N20 C;  2EMS A;  1NBF C;  2RD0 A;  3AEC B;  1FEH A;  2C7N B;  4B95 A;  3ZRF A;  1KF6 B;  2WXG A;  5LNK 1;  4TQ0 A;  1FD6 A;  4C4V A;  4PS7 A;  2K39 A; 
#chains in the Genus database with same CATH homology
 5I4D A;  2KQ4 X;  2H89 B;  1N5W A;  2V3P A;  2WDV B;  3IXS A;  2R61 A;  1L6U A;  1XXG A;  5D3D A;  1FIQ A;  2W3S A;  1ROE A;  1YJI A;  5EE3 A;  2W82 A;  3Q8C A;  4ITK A;  3NVW A;  1VZ6 A;  5FK9 C;  4DXG A;  1HZ5 A;  1GTH A;  4AQ7 A;  1ZP0 B;  3MFG A;  3IT6 B;  2ONQ A;  2B76 B;  1UWM A;  2M0A A;  4P6V F;  3NUH B;  1L5P A;  4KGR A;  5AUK A;  2LUM A;  4ZYS A;  4A9A A;  3P4R B;  1FRR A;  1QOA A;  1FCL A;  3BVZ A;  4GDL B;  2SAK A;  4N59 A;  2WXI A;  2V3N A;  4A90 A;  4AS1 A;  1KTK A;  2WU2 B;  2PMV A;  2WDQ B;  2PW9 A;  3Q8A A;  3FIL A;  1H7X A;  2Y3A A;  4LTU A;  4L1B A;  2L52 A;  1RYJ A;  3AE7 B;  1XCT L;  2NTS A;  3TEW A;  2J52 A;  2IPK D;  2J42 A;  2L83 A;  1QOG A;  1TY2 A;  2OED A;  5EE9 A;  4A6Q A;  2GB1 A;  1GPX A;  4O1N A;  1K50 A;  1K51 A;  2I38 A;  1FRD A;  1CZP A;  1YMH E;  1KH0 A;  4TMA B;  1C4A A;  3AEG B;  1I4X A;  3BWU D;  4P16 A;  3AE8 B;  2BTE A;  1E9M A;  4YSX B;  3EUB 2;  2IGD A;  1NVI D;  4H2A A;  1IGC A;  5EE1 A;  2BB5 A;  1D5Z C;  1FXA A;  1L6V A;  3AH7 A;  4JPS A;  2JZP A;  3AED B;  2QEJ C;  1ENF A;  2N7J A;  4XWT A;  3ZJV A;  3GP7 A;  3P42 A;  3RFZ B;  1D4B A;  1HEZ E;  2K5P A;  2KN4 A;  2RMM A;  4KKI A;  1C9F A;  3IAM 1;  4D2K A;  1L0X B;  1TYG B;  2ZW0 A;  2JX5 A;  1WXQ A;  2Y5C A;  1DOI A;  3B2F A;  2WDR B;  2HTM E;  4IKG A;  3U4E G;  3ZJT A;  1JRO A;  1SE2 A;  1DOY A;  3AN1 A;  1SE4 A;  2MJ3 A;  2BS4 B;  1N61 A;  2ICI A;  3MJ5 A;  5BYQ A;  4B0M A;  3W5V B;  4C7Z A;  3W5U B;  1JWA D;  2BT6 A;  1QT9 A;  1QQR A;  1GOZ A;  2CJN A;  3IAS 1;  5H8Y E;  3MP9 A;  4YSY B;  4WWM A;  2J53 A;  2LFI A;  3B9J A;  4MAC A;  2QSD A;  2V0G A;  2PLP A;  3PO0 A;  1L0Y B;  2DYM A;  4GLS C;  1D5M C;  2WXJ A;  2I2Y A;  3AE2 B;  1MHX A;  3HUI A;  3NZ3 A;  1B9R A;  3LYY A;  4ZRP A;  1F2R I;  3AV8 A;  3WCQ A;  4C80 A;  2XN9 C;  3P1M A;  3NS1 A;  5D7G A;  4US9 A;  3MHZ A;  3ABV B;  3Q8E A;  2N0S B;  1FFU A;  4WQM A;  4KKJ A;  4YTM B;  3TEZ A;  1WWT A;  2INP E;  1UUP A;  3KQ4 A;  1I7H A;  4XDD A;  1UWX A;  3VQI A;  1J7A A;  1TKE A;  3BYY B;  1V1P A;  5H92 C;  3GS2 A;  1MHH E;  2LEK A;  2TSS A;  2WP9 B;  4LK0 M;  4ARI A;  3VRB B;  3V05 A;  2JU6 X;  2BYT A;  2RPV A;  1PGA A;  4NJC A;  3AEA B;  2ON8 A;  4A55 A;  3GB1 A;  1JWM D;  3T3O A;  3I57 A;  1FM0 D;  3PZ8 A;  4EE2 A;  1QOF A;  4MH8 A;  2LJI A;  1AN8 A;  1JQ4 A;  1DGJ A;  5G5G A;  3W2D A;  1NYQ A;  1QKZ A;  1STE A;  1N62 A;  4RF0 A;  2YEP F;  5BMG A;  2KMM A;  4KX6 B;  3C8Y A;  1VDV A;  3BZD B;  1PYW D;  3VR9 B;  2PVG C;  4MM3 B;  1BUI C;  3KLS X;  5JXV A;  1N60 A;  4YWG G;  1XO3 A;  2IDY A;  3FIL B;  3HVD A;  3BVG A;  1RFK A;  1ET6 A;  1TKG A;  1WYG A;  1FNU A;  4FXC A;  1XF5 L;  3SFE B;  3BII D;  4B0E A;  1SE3 A;  2Q5W D;  2E3T A;  2K9X A;  1XLN A;  1GAQ B;  1C79 A;  3AEB B;  1AYF A;  1QIL A;  2MJE A;  2WS3 B;  5GXG B;  3J9C A;  1MI0 A;  2FBW B;  1PFD A;  2EEL A;  3R2T A;  1M4V A;  4CQN A;  3AE1 B;  4JWU C;  1NEK B;  4XDC A;  1VLB A;  2K0P A;  3N9Y C;  4R3D A;  1JW9 D;  2WXL A;  4A8X C;  1MPE A;  2QMT A;  1XCQ L;  2WLB A;  2WU5 B;  2DLB A;  1OFF A;  4RFB A;  3E56 A;  1Y56 A;  1E10 A;  1EWY C;  1T3Q A;  2DWQ A;  2RDH A;  2DBY A;  4OW0 A;  1SEB D;  4XE0 A;  1CK1 A;  3TUO A;  3VRA B;  2JQR B;  5HFY A;  2WXR A;  1XEE A;  1NYR A;  1N5X A;  1JAL A;  3FAH A;  1JRP A;  1HA5 A;  5EE0 A;  1OQQ A;  2JWU A;  2JXT A;  4OZC A;  2Z8L A;  2W55 A;  1PUT A;  1IUE A;  1SB3 C;  3O13 A;  1JCK B;  4ZHP A;  1V8C A;  1E0Z A;  5BMH A;  2OHF A;  2L1A A;  3AEE B;  2PVO D;  3TSS A;  3CIR B;  4HRS A;  4C7Y A;  1UNS A;  1HQR D;  1SF0 A;  1TS3 A;  3B2G A;  1JWS D;  1IBX A;  2XNA C;  1GT8 A;  3EA6 A;  5C2T B;  4US8 A;  3L4P A;  3NVZ A;  2ZW1 A;  4RNA A;  3HVZ A;  2KWD A;  3ZJU A;  3URY A;  1H7W A;  1TKY A;  1XLQ A;  1QLB B;  1N63 A;  2WNM A;  1YQ4 B;  3CF4 A;  2BS3 B;  3OWE B;  1PDX A;  1V97 A;  1C4C A;  4ZOH C;  1HZ6 A;  3SEB A;  2JYE A;  3SR6 A;  1PGX A;  2NTT A;  2BB6 A;  1C4P A;  2NMQ A;  1SSN A;  3Q69 A;  3LXF A;  1P7F A;  4RGN A;  1YJJ A;  4JX1 C;  3NRZ A;  3BK1 A;  2WXF A;  4WAF A;  1I4G A;  1YN3 A;  1J7B A;  1FNV A;  4KGT A;  4YSZ B;  1GB1 A;  2D5G A;  2FUG 1;  3DWM A;  1L4Z B;  1C78 A;  1ZXI A;  2L32 A;  3UI3 A;  1V1O A;  3ZQ4 A;  1FFV A;  1P7E A;  3NVV A;  4OVZ A;  1VR9 A;  1TJE A;  4HKQ A;  2H88 B;  2G1E A;  3T3N A;  4HEA 1;  1V1P B;  2JYT A;  2VZK D;  2IGH A;  1ET9 A;  5MPO A;  2LHE A;  1ZDV A;  4WH4 A;  3AE3 B;  4WUR A;  1KLG D;  4YT0 B;  1VZ8 A;  2CJO A;  1D6E C;  3AEF B;  2GI9 A;  4OZB A;  2QJL A;  1EWC A;  1I4H A;  2AX5 A;  4YTP B;  2G9H D;  1DOX A;  1E7P B;  1CJE A;  3KWL A;  4KGS A;  4ZHO A;  3Q8F A;  1F77 A;  4TSS A;  1QF6 A;  1JWB D;  5FR3 A;  4NAM A;  1WGK A;  4RGT A;  1EM7 A;  2FE8 A;  2AQ1 B;  4ZRQ A;  1QOB A;  1EU3 A;  4HRO A;  3LB8 C;  1R7S A;  2MJD A;  2AQ2 B;  2DYO A;  2HDE A;  1FCC C;  3NVY A;  2PKO A;  2PIA A;  1F2R C;  1ZE3 D;  4JWS C;  2INN E;  3AE9 B;  1TS5 A;  3BYT B;  1C77 A;  1T6B X;  2V4I B;  2VZK B;  2BS2 B;  2BBC A;  2KAC A;  1KFY B;  1YNT E;  3R2I A;  4J3O D;  3BK2 A;  4RF1 A;  1ZOY B;  1AWD A;  1JWU D;  1BML C;  2PTL A;  3AE5 B;  3AE6 B;  3P63 A;  5BMI A;  1JML A;  3ZGZ A;  2JSV X;  3FC4 A;  3U2S C;  4RGM A;  1D5X C;  4N58 A;  2LGI A;  1XLP A;  1ZUD 2;  3W9C B;  2WXH A;  1OQR A;  1T5X D;  4RH6 A;  2MEK A;  2WXP A;  4TQ1 A;  1FMA D;  1C76 A;  2WXO A;  2Y5P A;  1TZO A;  2SEB D;  3SFD B;  1E6E B;  2WXM A;  4ARC A;  4USA A;  1L4D B;  2X38 A;  1XLO A;  3E9S A;  2QIE B;  1SXT A;  4YTN B;  3KWV A;  3BVM A;  1EU4 A;  2J4X A;  2WXQ A;  3R8B A;  2M56 B;  5G5H A;  4N6E B;  5T8I A;  3CWI A;  1FNW A;  3PZ7 A;  1SJE D;  2W3R A;  2IGG A;  2E6X A;  1J7C A;  3AB5 A;  5BYR A;  1TY0 A;  5TSS A;  1I4Q A;  4M0W A;  2WXN A;  1HXY D;  4OHJ A;  3AM9 A;  2CU3 A;  2KDM A;  1K52 A;  1BXT A;  1TS2 A;  2BW2 A;  1NEN B;  3U7Z A;  1I4R A;  3HRD D;  1I4P A;  2GRI A;  3V3X A;  4IOI E;  4GDK B;  1K53 A;  3DWG C;  1IBX B;  2K22 A;  1MVK A;  4HJG E;  1VZ7 A;  2W54 A;  1ACC A;  3H8H A;  3MC0 B;  4PT5 A;  2RDG A;  3IT4 B;  4NZL B;  3ZYY X;  5AUI A;  2WXK A;  3W1S A;  1WSP A;  2KAJ A;  5E6J A;  2AQ3 B;  1LO5 D;  1L0V B;  1IGD A;  2LHD A;  1RM6 C;  3Q8B A;  4IDI A;  4OZA A;  1NI3 A;  3ETR A;  2EKI A;  4LLG M;  2M19 A;  1B1Z A;  1ZDX A;  1ZXH A;  4REZ A;  1VRA B;  3RPF C;  3TEX A;  4HKZ E;  1AW7 A;  1SJH D;  4C56 C;  3AMZ A;  1RWS A;  1YN4 A;  5HG2 A;  1ESF A;  1YN5 A;  3AE4 B;  4UDU C;  5D3I B;  4JE3 B;  4DXF A;  2K3U A;  4Q2J A;  4NAW B;  1F0Z A;  1CQV A;  1VJK A;  1TS4 A;  1GB4 A;  4YXD B;  3VR8 B;  5BYS A;  1YQ3 B;  1A70 A;  2MH7 A;  4L2Y A;  3TEY A;  1SIJ A;  2IJ0 A;  3P4S B;  3P4Q B;  5C3J B;  1GTE A;  1SBB B;  2YEP B;  5HHD G;  4RGO S;  1UGJ A;  2WQY B;  1WRI A;  4RCO A;  5HI1 A;  1KLU D;  1FXI A;  2QIL A;  1FO4 A;  1PGB A;  2N9K A;  4WIP A;  1ZPS A;  3I9V 1;  3AEC B;  1FEH A;  1KRH A;  3EGR A;  2ACZ B;  3P4P B;  1KF6 B;  2WXG A;  4MT5 A;  5LNK 1;  4XWW A;  4L23 A;  4DQO C;  4TQ0 A;  5FKA C;  1FD6 A;  2N9L A;  1Q10 A;  1DYQ A;  2LMC A;  3U52 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...