2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
2H88B 3PO0A 3W9CB 3W5UB 5H92C 1JQ4A 1JALA 3AECB 3P4QB 2OHFA 3NS1A 1SB3C 5MPOA 1KRHA 3DWGC 1DOXA 2CJNA 2W3SA 1AWDA 1CJEA 1E7PB 1QOBA 3AE5B 1NVID 3LB8C 4HRSA 2K22A 2MJ3A 3P4RB 1JWBD 1RWSA 1GAQB 2PKOA 4YSYB 1QOAA 2MH7A 2WDRB 4WWMA 1N61A 4US9A 2WS3B 3VRBB 4C7ZA 1WXQA 2K5PA 1FO4A 2WU2B 3HRDD 3LXFA 1J7BA 1NENB 1T3QA 3NVZA 4HROA 3AN1A 2WDQB 2BS2B 4USAA 2W55A 3ETRA 3AEAB 1NYQA 1PFDA 1R7SA 4WQMA 3ZYYX 1FIQA 1VDVA 1H7WA 3DWMA 3SFDB 1N60A 1GT8A 1IUEA 3P63A 4ZOHC 2H89B 2G1EA 2PIAA 5AUKA 1NI3A 1L6UA 3NVWA 3HVZA 3P4SB 2WU5B 5C3JB 1L5PA 1TJEA 1TYGB 3AEDB 3CF4A 1N63A 4C80A 3AE7B 3VR8B 1E6EB 3WCQA 2WP9B 1DOIA 2KMMA 3CWIA 1OQRA 4ITKA 3AE9B 1XO3A 2KAJA 3NRZA 1ZP0B 1E10A 1RFKA 1JW9D 1FM0D 1EWYC 5EE3A 1ZUD2 3KWLA 1RYJA 5EE1A 1SF0A 4N6EB 2QJLA 1V8CA 4N59A 3SFEB 1KF6B 1J7CA 2L83A 2WLBA 1I7HA 1FRRA 2JX5A 4JWSC 4YTNB 4P6VF 3AEFB 3RPFC 1XLPA 2DBYA 2JQRB 4JX1C 2K9XA 4US8A 1RM6C 1ZXIA 1FXAA 1XLNA 3AV8A 4ZHPA 1NEKB 1QF6A 1QT9A 1ROEA 1QLBB 1VJKA 1J7AA 5GXGB 3SR6A 1GPXA 2B76B 2BT6A 3ABVB 2Q5WD 3L4PA 4KX6B 3VRAB 1CZPA 3AEBB 2LEKA 2ACZB 1QOGA 3NVVA 1FRDA 1E9MA 5EE0A 2EKIA 5G5HA 1TKGA 1KFYB 1V97A 1YQ4B 1A70A 1YJJA 1XLQA 1XLOA 3P4PB 1L0VB 1UWMA 3BIID 1GTEA 4N58A 1L6VA 2QIEB 3AH7A 4YXDB 5AUIA 1FFVA 3EUB2 3FAHA 3AE4B 1TKYA 4YT0B 2BS4B 4IDIA 2L52A 3AM9A 3AEGB 1WWTA 4JWUC 3AE3B 1OFFA 1WYGA 1AYFA 1PUTA 1FMAD 2CJOA 2PVOD 3P1MA 4ZHOA 5H8YE 1JWAD 1F0ZA 1GTHA 5G5GA 2HTME 2W3RA 2CU3A 3B9JA 3AE8B 5EE9A 2FBWB 2WQYB 2BS3B 2MJEA 2W54A 3AB5A 2DWQA 1FFUA 2M19A 4YSXB 1TKEA 4C7YA 3CIRB 1JRPA 1E0ZA 3AE6B 5C2TB 3VR9B 1FXIA 2MJDA 4FXCA 4YTMB 1N62A 2M56B 3B2GA 4A9AA 1PDXA 2Y5CA 1JROA 2WDVB 3AEEB 1VLBA 2N0SB 2E3TA 1OQQA 4YSZB 1N5XA 1DGJA 1N5WA 2AX5A 1B9RA 1QOFA 1WRIA 4YTPB 2PVGC 3NVYA 3HUIA 3AMZA 1WGKA 1YJIA 3W5VB 1SIJA 1ZOYB 1DOYA 1NYRA 1YQ3B 1H7XA 3AE2B 3AE1B 3B2FA 4LTUA 3FC4A
chains in the Genus database with same CATH superfamily
2GBRA 4GN1A 2WWZA 3IBEA 4JGHB 4JL9A 5CHWA 1Q1OA 4HRSA 2GLSA 4H2AA 2JRIB 4US9A 2CHWA 1WXQA 5HHDG 3CF6E 3E9SA 2KZRA 4J3OD 1IGDA 3NZSA 1K53A 3RFZB 2BB5A 3RZWC 2ONQA 3A9JB 3H9DA 4IC7B 2L0TA 3RCZA 4GIVA 4M0WB 2LGXA 3DBLB 3U7ZA 1F77A 1OQRA 3BVGA 2KAJA 2JSVX 4EKUA 5G55A 3L0WB 1SF0A 3R7QA 2KNBA 2MRPA 2TSSA 2N1WA 3HHMA 3AEFB 2KX0A 4JLCA 1FXAA 1VJKA 3DVNU 3RN9C 1WSPA 4LNNA 3WALA 2XBBC 1OGWA 1OTRB 3PV1A 1FRDA 3W1YA 2HDEA 2KQ4X 3PTFC 4XDDA 4BOSC 3KYDD 3RT3B 3ZXVA 4YXDB 4IUMB 1GB4A 2EMTA 3A9KA 4UDUC 2FIFA 2M0XA 3KVFB 1FXTB 2KO3A 1PUTA 1XT9B 5H8YE 3NY5A 1E8YA 3ZNZB 2BB6A 3KW5B 4ARCA 2BF8B 4REZA 4WH4A 1WX9A 3NZ3A 4MJSA 3NS8A 2HJ1A 3B2GA 4YL8A 2IJ0A 1WFYA 3UGBB 3GS2A 2WXKA 1VCBA 1WR6E 2K22A 2V1YA 1WMHB 3U7DA 3ZQ4A 3HVDA 2KFJA 1NENB 4CQNA 1WZ3A 4XYCA 3CSFA 4GDKB 2BS2B 3PVLA 3AU4A 5G2NA 1I4RA 1VDVA 4G0NB 3EA6A 2G1EA 1K51A 1XEEA 1KOTA 1ZPSA 4K3CA 1L5PA 4DHZE 2C5LC 3T9LA 4B95A 3APCA 3C0RB 3RNFC 1NBFC 1D5XC 2RGFA 1RFKA 4X57B 2A5UA 1ZUD2 2RDGA 1V8CA 4G3XB 3UIOB 3L16A 3TJPA 2NTTA 4K7WA 4JX1C 4LNIA 4P16A 4C4VA 5BO4B 3D32A 5JHBA 1ZXHA 2ACZB 1R4MI 2EKIA 3IVFA 4DXAB 4A55A 4MSQB 2ZPNA 1V81A 3DBRI 3OAWA 3RNCC 1PGBA 2NTSA 3VTVA 1JWAD 4CO7A 3P2BA 2BKRB 2MBEA 2MBQA 2WYQA 2ZNVC 1MI0A 5FR3A 5AZHA 3EGRA 1E0ZA 1C4AA 4RM8A 4F1SA 5LXHA 2M8SA 1AARA 3BINA 2RMMA 1SE4A 4YTPB 4IWQA 2O6VD 2L05A 2LD9A 1HE8A 1FD6A 4HDOA 2OHFA 2XNAC 1AWDA 2WXNA 3DBLI 3TMPB 1SIFA 2PTLA 1JWBD 3H6NA 3TCAA 3ZJUA 4C7ZA 3HRDD 4PS8A 4II3B 4USAA 1S1QB 2JWZA 3FILA 4EZJA 1N60A 4HWIB 1KLGD 4L23A 3IHPC 1Z2MA 1P98A 1TT5B 3V60A 3AXCA 4GDKA 5DCNA 3UF8A 2B3AA 3B08A 1L4DB 1WH3A 4WJOA 1YJ1A 3VHTC 3DVGY 4RNAA 1YOVB 1J7CA 2PE9A 1SSNA 3V6CB 3DHGC 4FULA 1MVKA 2WXLA 1AN8A 2M1MA 2G9HD 1ZXIA 2WX0A 3A9JA 2AQ2B 4LDTB 4B0EA 3ABVB 2A4ZA 2LGYA 3AEBB 1I4HA 1X1MA 4ICVA 3ML8A 4W9EA 1M4VA 2FUG1 2KLGA 2BPSA 3ZLZA 4IW0A 5IAAC 1WYWB 1UELA 2MBBB 2UWQA 2WXQA 3BVZA 1WGRA 2HTME 1T0SC 2AEHA 2LI5A 4TKNA 3CIRB 4XWWA 5FR6A 2G4SA 2BWES 5BMIA 4KGRA 4ZRKA 1JROA 4YSZB 1IP9A 3VTWA 1ZOYB 2Y3AA 4ACFA 2AL3A 2KQ7A 1GC6A 1EWCA 3DWGC 1V1PB 2JU6X 2JUOA 3J9CA 2WXRA 2ON8A 1WJ4A 1E7VA 1R4NB 3IAS1 1QOAA 4ZRIA 1WJ6A 3A33B 4LLGM 3RNBC 3HK0A 4TUUA 2D3AA 2J42A 4E71A 4S0RA 3BZDB 1M94A 2H89B 2N4FA 1HQRD 1WRDB 3R2TA 5IOIA 2REXA 1BXTA 2NS5A 3TEYA 3DBRB 3HVZA 5IO9A 4DDGD 2IGGA 3ZDTA 4MM3B 4KSLC 3M95A 3PZ8A 1QQRA 3ZTDA 2KT7A 4MSMB 4MM3A 2WXIA 3DHIC 4HDQA 2J0JA 2JXXA 5BYQA 3KYCD 2K9XA 1NEKB 2L1AA 2WX1A 1R4MB 3FILB 3ZJVA 2N9LA 1MJDA 2IY1B 2ZZPB 3B0AA 2WXJA 2D5GA 1TKYA 4IDIA 3OJ3A 4JWUC 1ET9A 3VAWA 3UINB 1WIAA 2ZEQA 1TS3A 1I42A 2W9NA 3TBLD 1XD3B 2V4IB 5C2TB 2M56B 3A4RA 2WDVB 3KUCB 2FCSA 2Y5PA 1YJIA 3WAPA 3N3KB 4WWNA 1WY8A 3Q8EA 3B2FA 2DYOA 3VXWA 2JWUA 3AECB 2INPE 3LB8C 4JIOU 4F7ZA 2L0FA 1RWSA 4LNKA 2MH7A 4WWMA 5D7GA 4ANWA 1SE9A 3AN1A 1NYQA 1PFDA 2QHOA 3I3TB 3JW0X 4LK0M 2CHZA 5J2RA 2BKFA 1GB1A 4ZOHC 3ZNGC 4BFRA 1CMXB 1LQBA 4MACA 4R3DA 1EF5A 3PZ7A 2N1VA 5E6JA 1PQSA 4ASWC 4C00A 5D2MB 2FNJB 2IDYA 4KDIC 1WZ0A 3KWLA 2KWCA 3U52E 3GZNI 3APFA 1T0YA 1KLUD 2KDFB 1UF0A 2DZMA 2ZNVB 3PHXB 4FHKA 4IWOA 1E5WA 3RUIB 5GXGB 2Q5WD 4DDID 4RM9A 3Q69A 5FKAC 2ZCBA 2G3QB 3DVNV 1XQQA 2AYOB 3H8HA 4YT0B 3AE3B 2PVOD 1KJTA 2VH2A 4GLSC 4L2YA 5I4DA 4BZAA 4HJGE 2LUEA 2MJEA 3AB5A 1J19A 2DWQA 3N9YC 2PLPA 3AI5A 4NJ7A 4KKJA 4MDKE 3QQ8B 3P42A 4XZ4A 1V2YA 2CHXA 2L7RA 4DXGA 4NJ6A 1OQYA 4W9HA 2LMCA 1NDDA 1GC7A 1H4RA 1EUVB 1NVID 3N32A 1B1ZA 4K1RB 3WAOA 4OZCA 3A1QB 3U2SC 1T5XD 2PJHA 3V3XA 5KHQA 3QAQA 1VR9A 2YLMA 1GG3A 4XE0A 4LCDE 4II2B 1PGXA 2G4DB 2DZIA 2KN5A 3MJWA 5T8IA 1E6EB 2N9EB 3WCQA 4C56C 1L4ZB 4AWJA 3ZGZA 4N9F4 2Z0DB 2N9XA 4HKQA 3S2AA 4US8A 3TSSA 4K81A 1L0YB 2QCZA 3L4PA 4K7UA 4NJCA 4ZYNA 1WGDA 2WXPA 1WE6A 1D5MC 1XLOA 4KVGB 3EFUA 4AUQC 2WXHA 2YEPF 2QIEB 3AE4B 1V9JA 2JZPA 2L52A 2JZZA 3WANA 1R4NI 2BBCA 3RI7C 1SXTA 2ZCCA 4I6PA 5G5GA 2WXMA 1SJED 1ZW7A 3DVGX 1C1YB 1LM8B 1FFUA 1J8CA 2C7HA 3AULA 2O2VA 2RDHA 2J52A 2LGIA 1VLBA 3L17A 1XF5L 1OQQA 2K25A 1N5WA 1WGKA 1YQ3B 3PZDA 4MGKE 2CJNA 4NZLB 3PPAA 3C8YA 1LGRA 4S17A 1WX7A 1IBXB 1EM7A 3APDA 4HROA 3N20C 4RGMA 3NJTA 3P63A 3SDLC 2HJ8A 3PHWB 2L3ZA 2INDC 4LJOB 2LGDA 1UBIA 3VR8B 3ZJTA 2OJWA 4ITKA 3AE9B 3ZXRA 3WA0A 3ZDMC 1KM7A 3DBSA 4TQ0A 1FM0D 4KV2A 2ZVOA 4FJVB 2KC1A 1ACCA 3QCAA 3QA8A 3H7PA 2ZVNA 4BBNC 4YTNB 2C9WB 3ZIMA 1WXMA 3RPFC 1FCCC 2L32A 2IO2B 1JWMD 2KDIA 3SR6A 4NAWB 3VRAB 3LJ3A 4GSWA 4KGTA 1A70A 1UGMA 2JF5A 4A8XC 1P7FA 4FBJB 2JT4B 4TV3A 3K9PB 3U8ZA 4QAYA 5AUIA 2QSDA 2BS4B 3SHQA 3AEGB 1TZ1A 3JSVB 1F9JA 1FEHA 1HXYD 1F0ZA 4NAMA 1GTHA 3EFCA 3AE8B 1N6ZA 2FBWB 4DXFA 4IM3A 2PEAA 4C7YA 1VZ8A 3AEEB 3ZKJC 3V62A 2RR9A 4PT5A 2C60A 3GE3C 2QEJC 3UIPB 3H7SA 4LTUA 2AQ3B 4IM0A 1ZDVA 2J0MA 2VZKD 1KRHA 1FCLA 1EU3A 2GBJA 2KVRA 3PREA 1HEZE 3V61A 3P4RB 1I4PA 1N61A 4HLEA 2WXOA 3PRZA 4OHJA 3H1UA 5AUKA 2DLBA 4MELA 4GGQA 2DX5B 3GOEA 1TY0A 5HFYA 1STEA 2AWTA 4ZYSA 1C4PA 2I2YA 4W9GA 2HE7A 1RYJA 3I5JC 1S3SG 3EC8A 3VTUA 5L95C 3ZNHB 2LVPA 3MHZA 3RYTA 4OZBA 3KLSX 4OVVA 1XLNA 2R2QA 4WJPA 1K8RB 2B76B 2BW2A 3DOWA 1QOGA 2J4XA 4WIPA 1E9MA 1V97A 1KFYB 2KK8A 1WF9A 2K3UA 2Y5BB 3MC0B 4G50A 1Q10A 5IA7A 4YWGG 4TMAB 2DYBA 2KMAA 2ZPYA 3LYYA 1AYFA 3MC8A 2CKHB 3P1MA 3VDZA 4HPPA 1OEYA 2NBUA 4A3PA 4BKTA 2NPTA 4EFOA 3HM6X 4FJZA 2G45B 5AZFA 3AE6B 2SEBD 4HEA1 2NCNA 4FA6A 2DNFA 1YN5A 3ZNID 1HZ6A 5TSSA 1ET6A 2KDBA 4HVBA 2IO1B 3KUZA 2RD0A 3PO0A 4M01A 3EECA 3L54A 4L1BA 1OEYJ 2CR5A 1DOXA 2N7DA 3JSVA 3Q14C 1UH6A 4WAAA 2IGHA 5TR5A 1YD8U 3VUXA 4MGZE 2WU2B 1T3QA 4I6NB 2RPQA 3PSEB 1FIQA 4WWPA 2WXGA 1GT8A 2LZ6A 4WQOB 1SGHA 5DPRA 2EKEC 4E74A 2NMQA 4LJPB 1F2RC 1TYGB 1GNUA 2R2OA 5DPTA 3RULA 3H7PB 4HXDA 3QWZB 2KACA 1E10A 2JY6A 2KFKA 4A3OA 2K8CA 1VZ7A 5D3DA 1C3TA 1KF6B 2INNE 2MBHA 4JQWC 4CHKA 3I63C 3E56A 2K39A 1XLPA 2DBYA 4KDLB 1JRUA 3BWUD 3R2IA 1CK1A 4ZDVA 1YQBA 4NPNA 1LO5D 3RMKC 1P7EA 3Q2AC 1FPYA 2K8BA 2FE8A 4DHJD 1TGZB 3FAHA 3NZUA 3M62B 1WXSA 2DAJA 3N1XC 5JHAA 1HTOA 3R8BA 1UD7A 1T6BX 3Q8AA 1UUPA 4EUTA 3ML9A 4YSXB 4P7IA 1C76A 2LRWA 2J53A 2MJDA 1N62A 1J0GA 2FUHB 1KLVA 2MBOA 1RAXA 1LXDA 2JPHA 2GRIA 4EOYA 1QKZA 3AMZA 4F8CB 5DPWA 3IT4B 1ESFA 4MGYE 1NYRA 2DZKA 3KUDB 4RMAA 1GOZA 3W9CB 4NAWA 2N9KA 4C4VB 1JQ4A 1KTKA 5CX3A 1JWSD 1SB3C 1QOBA 3X0WA 2Z0EB 3BYYB 4EZLA 3BK1A 1T0QC 4O1NA 4OW0A 1SBBB 5CTRC 4M02A 2KDEB 2VH1A 1D3ZA 1NI3A 3P4SB 5HG2A 3QIJA 1Y8RC 2CS4A 4E3CA 3Q3NC 3NRZA 1QILA 4BKGA 1F1HA 4N6EB 4NQKE 3W1SC 4G11A 3Q3FA 4PYZA 1MPEA 2AL6A 3DPDA 1MHHE 1F2RI 3RNAC 3T8MA 1QT9A 3V6EB 1GPXA 2KWVB 2IBIB 2XEWA 3JYUA 1EF1A 1V5TA 4OVZA 4GXBA 1MHXA 4NQLB 3N30A 1K50A 4KKIA 1JWUD 4A20A 2M4NA 1GTEA 1WJUA 4PS3A 1WMHA 3A1QA 3EUB2 4ZHOA 4HKZE 2C7NB 2WNMA 2CU3A 3B9JA 1Y56A 3DCGA 2M19A 2O6VB 2KD0A 3UQBA 1RFAA 3LDZE 3EHVA 1E8WA 4KGSA 1XCQL 2GMIC 4ZRQA 1QOFA 1WRIA 4DQOC 1FNVA 3NVYA 5LNK1 1WM2A 3IFWB 4B6WA 2KC2A 1H7XA 1H7WA 3X23A 3W5UB 1PGAA 2K6QA 1LFDA 1CJEA 5KHOA 4ICUA 2MJ3A 3CMMB 2R61A 2WXFA 2I38A 4D2KA 2FIDA 1TBEA 3NVZA 1GUAB 1YN4A 1F52A 4W9JA 4ANVA 2GB1A 1IUEA 3GP7A 2PIAA 4HPMB 3WIMA 2KTRA 2MCNB 1YIWA 4ANXA 3N1ZC 2D11A 1QZEA 3AEDB 3CF4A 4C80A 1Q0WB 2KMMA 1G6JA 2KFKB 3DBHI 1T0RC 2ZW0A 1TS2A 4MEMA 5EE1A 2KJRA 1AW7A 2EELA 2UYZB 1FRRA 3GB1A 1UGJA 3AV8A 4ZHPA 3BVMA 2BT6A 2L8JA 4KX6B 2NBWB 4BKSD 1UZXB 3Q3JA 2LEKA 1TKGA 1I4XA 2Z59B 1I35A 3SEBA 2D2QA 3P4PB 3MP9A 1UWMA 2GOWA 3BIID 1I4GA 2BYVE 3HIZA 3L10B 4KZ0A 2JXTA 1FNUA 4M8NA 3WAMA 2MWSB 2KJHB 3MHSD 4WJNA 2V9HA 5E6OA 2JVCA 1E7UA 2V3PA 1TS4A 3TEXA 3DBHB 4FJYA 4TQ1A 2BGFA 1NI2A 1SEBD 2K0PA 4KZCA 4NNJB 1RLFA 4W9LA 3UI3A 1N5XA 3HM3A 2W82A 1FNWA 2DYMA 3Q3MC 2PVGC 2KLCA 5FK9C 3W5VB 1SIJA 3Q3OC 3RNEC 1E8XA 2H88B 4BAXA 3I57A 2NPTB 4RGTA 2C7MB 4EE2A 1H8CA 2FAZA 3AE5B 3ZTCA 2LHEA 3Q8CA 2GBMA 2IZVB 1K52A 1E90A 2HTHA 1C4CA 3KWVA 1FO4A 4HCNB 3LXFA 1A5RA 2KVZA 1YX5B 1VRAB 3R7RA 2YEPB 2Z8LA 1IYFA 2WU5B 2QC8A 3IT6B 3SU8X 5J18A 2QILA 2N7JA 1L0XB 1XO3A 3RD2A 5C23A 4DHJB 1TS5A 1YNTE 3QK0A 3VUYA 1D4BA 3SFEB 2L83A 4JWSC 4W9CA 2KKCA 2JQRB 2BWFA 3DDCB 4FADA 1CZPA 3NVVA 2N7EA 3QARA 5LXIB 3UQAA 1Q5WB 4MH8A 3OLMD 2RDBC 2MX2A 3PLVA 4DBGA 1WGGA 4WWOA 2JYTA 2QMTA 1UWXA 5EE9A 2WQYB 2XK5B 2BYFA 1JMLA 2DZJA 2I1JA 2K6DB 1UBQA 2QDFA 1D6EC 3IXSA 3ZRCA 3HUIA 1V86A 1DOYA 1JCKB 4A6QA 1WX8A 3QC8B 2M0AA 3GE8C 1HZ5A 2E6XA 1V5OA 1WXVA 3R66C 3GZNB 5MPOA 1ZGUB 3QJZA 4P1BC 3U30A 1WJNA 1ZKHA 1SE2A 3VQIA 2WS3B 4URKA 4MT5A 4J6IA 2BQQA 2KTFA 4AP4C 2W55A 3NG0A 3O13A 4XDCA 3DWMA 1L2NA 2MSED 4LNOA 3RZFA 1L6UA 3NVWA 5IN7A 2ZW1A 1TJEA 1C78A 1N63A 3AE7B 2WP9B 1WI0A 2GBNA 5CHVC 1GJZA 1IBXA 3MTNB 2K8HA 2KN4A 4K3BA 3ALBA 3AU5A 1P3QU 2JX5A 2PE6B 5E6PA 1EU4A 3K9OB 1V1PA 5D3IB 1QF6A 1RM6C 2KTRB 1ROEA 1J7AA 3VVWB 3ZVVA 2D3CA 4OZAA 5E6NA 4TSSA 5D6JB 1P9DU 1WGYA 2M17A 3R3MA 3ZW3A 2V3NA 3QHTA 5BYSA 4AQ7A 5GMVA 1P1AA 1VZ6A 2LFIA 2KYWA 4RH6A 3TL5A 5HI1A 2KOXA 1FMAD 2CJOA 3ENEA 2N9PC 2WDTB 4ZRJA 4BOZB 4IM2A 2BS3B 2KJ6A 3DQVA 3VUWA 4BBNF 2D3GA 1FXIA 2INCC 2LXCA 4FXCA 3TIXA 1XCTL 2FCMA 1I4QA 1PDXA 5J17A 3L08A 1ISNA 2I1KA 2N0SB 3ZRFA 3VFKA 2AX5A 4FLHA 2O2VB 2X8XX 4AOFA 3M3JA 2OEDA 4ARIA 2O6VA 3NOBA 5JXVA 1BUIC 2EMSA 2VZKB 2MP2B 5CHFA 5H92C 1TIFA 2MHJA 3NS1A 2FCNA 5D94A 1IPGA 3KH0A 5LLIA 4W9FA 4BKSA 2NVUI 3NHEB 2PKOA 4YSYB 3PGEA 2WDRB 2HD5B 5EDSA 3ETRA 2LRUA 1R7SA 2KQSA 5L83A 2CU1A 4RGNA 4XGAB 2ASQA 4KSKC 2K1FA 4ANUA 2DHZA 1SE3A 2LUMA 4DHZB 4GB9A 5EE3A 1EWYC 4IG7B 2QJLA 2IYDB 4XX5A 5BYRA 3PLUA 4N59A 4AJWA 2D10A 4A90A 1ENFA 4M0WA 3MFGA 1BT0A 4GU2A 2LJIA 4NY0A 1V1OA 3O65B 1U4AA 2NR2A 4JE3B 1V80A 5G5HA 5EE0A 4XC2A 1YJJA 1HTQA 2L00B 1L6VA 3AH7A 4RCOA 5HKHA 3W1SA 2LVOA 3AM9A 4MJSB 1WYGA 2X38A 3T3OA 2PW9A 2AQ1B 4AJYB 4EEWA 5AZGA 2KANA 1L7YA 1XXGA 4WAFA 4HCPB 5DPSA 1TY2A 2MP2A 2W54A 1TZOA 2D3BA 1TKEA 1Z5SB 1JRPA 3A9KB 2LGSA 3Q6BA 3ZO5B 4IOIE 1MG8A 3ONSA 4GOCA 2JZ3B 2WHIA 1YX6B 3DHHC 2MQJA 1YN3A 1WM3A 2LJ5A 3AE2B 3FC4A 2D07B 3V05A 2LASA 1DYQA 1TTNA 2LHDA 3I9V1 3P4QB 4BVUC 2W3SA 2IPKD 2PPHA 2IO0B 2IGDA 2J0KA 2OJRA 4B9KA 2J7QB 2K5PA 1J7BA 1C9FA 2BTEA 2WDQB 3BYTB 3AEAB 3RNGC 3Q8FA 4WQMA 2MA9B 3SFDB 1ZE3D 3W2DA 3TUOA 4FHJA 4CYEA 2VRRB 3CWIA 4OVUA 1JW9D 3IAM1 3T3NA 3KQ4A 4HJKA 3BK2A 3ZUNA 2FCQA 3M63B 1RRBA 1EO6A 2OOBB 3MC9A 2LXAA 2V3SA 2BVCA 4B0MA 1QLBB 2BYTA 1VD2A 3VH3B 3QX1A 1SJHD 4WJQA 3N1YC 1XLQA 2KX3A 1L0VB 2V0GA 3U4EG 4N58A 1WE7A 1FFVA 2PMVA 3OG5A 3TEZA 2KWUB 4I6LB 4IWPA 1V6EA 2W3RA 4KIKA 4RFBA 5C1ZA 5IKCM 2IO3B 3OWEB 4YTMB 4A9AA 1MG4A 2E3TA 3PRPB 2GBKA 4HPLB 3FKYA 4DK5A 2KDMA 2SAKA 1JALA 2KHWB 2ZJDA 4PK1A 5BMGA 1E7PB 4GDLA 2DENB 3Q8BA 2BYEA 1HA5A 1E8ZA 4IKGA 2DAFA 3CSTA 1GAQB 4FN2A 4LDTD 3VRBB 4W9IA 2MW5A 2KMCA 2L76A 3L13A 4Q2JA 3ZYYX 3MJ5A 2KXJA 4W9DA 2JRHA 2LWPA 1WR1A 5BMHA 1UNSA 4HK2A 5C3JB 3OJ4B 4WURA 2IY0B 3SD5A 1WGHA 1DOIA 2WGSA 2XN9C 1WXAA 1ZP0B 2ICIA 4RGOS 4EZKA 4MH0E 4ZRPA 3ECIA 3VH4B 2UU7A 4GMVA 1YMHE 4RF1A 4RF0A 5JZEB 1BMLC 1MFWA 2WLBA 1P0RA 3JVZX 1I7HA 4P6VF 4GDLB 4M00A 2NBVB 4PYUA 3C19A 1IGCA 3URYA 1C79A 4P1CC 1YQ4B 4DWFA 2YVCA 4XWTA 1C77A 3A4SC 4MGIE 4LNFA 5JH5C 1WWTA 5AEKB 1OFFA 1V49A 4W9KA 2MLBA 4M8MA 2XK5A 1D5ZC 2MEKA 4KIKB 4PS7A 4K7SA 3TEWA 3IG3A 5IP4D 3PRMB 1KH0A 3PT2B 3VR9B 1PYWD 3BY4B 2JYEA 2Y5CA 1ZDXA 2V4LA 2KWDA 2RSUA 1B9RA 1DGJA 3B1LX 2RPVA 2LVQA 2GI9A 3NUHB 3PS6A 4AS1A 4JPSA 3AE1B 1CQVA
chains in the Genus database with same CATH topology
3PO0A 2DYOA 2M0AA 1HZ5A 2E6XA 2JWUA 3AECB 4L1BA 2INPE 1DOXA 5MPOA 3LB8C 4HRSA 4H2AA 1RWSA 2IGHA 1SE2A 3VQIA 2MH7A 4WWMA 4US9A 5D7GA 2WS3B 1WXQA 4MT5A 2WU2B 5HHDG 1T3QA 3E9SA 3AN1A 4J3OD 2W55A 1IGDA 1K53A 1NYQA 1PFDA 3O13A 1FIQA 4LK0M 4XDCA 3DWMA 3RFZB 2WXGA 1GT8A 1GB1A 4ZOHC 2BB5A 1L6UA 3NVWA 4MACA 2ONQA 4R3DA 2NMQA 2ZW1A 1F2RC 1C78A 1TJEA 1N63A 1TYGB 3PZ7A 5E6JA 3AE7B 2WP9B 3U7ZA 1F77A 1OQRA 3BVGA 2KAJA 2JSVX 2KACA 2IDYA 1E10A 3KWLA 3U52E 1SF0A 1IBXA 2KN4A 1VZ7A 2TSSA 5D3DA 1KF6B 1KLUD 2INNE 2JX5A 1EU4A 3E56A 3AEFB 1V1PA 1XLPA 2DBYA 5D3IB 1QF6A 1RM6C 1FXAA 1ROEA 1VJKA 1J7AA 5GXGB 3BWUD 4OZAA 1WSPA 2Q5WD 3R2IA 1CK1A 4TSSA 3Q8EA 1FRDA 3Q69A 1LO5D 5FKAC 2HDEA 1P7EA 2KQ4X 4XDDA 2V3NA 5BYSA 4AQ7A 2FE8A 4YXDB 1VZ6A 3FAHA 2LFIA 3H8HA 1GB4A 4YT0B 4UDUC 4RH6A 3AE3B 5HI1A 1PUTA 1FMAD 2CJOA 2PVOD 4GLSC 4L2YA 5H8YE 5I4DA 3R8BA 2BB6A 1T6BX 4ARCA 4HJGE 2BS3B 2MJEA 3Q8AA 3AB5A 4REZA 1UUPA 2DWQA 4WH4A 3N9YC 2PLPA 3NZ3A 4YSXB 1FXIA 1C76A 2MJDA 2J53A 4FXCA 1N62A 1XCTL 3B2GA 1I4QA 1PDXA 4KKJA 2N0SB 2AX5A 2GRIA 3P42A 2IJ0A 1QKZA 3AMZA 4DXGA 3IT4B 1ESFA 2OEDA 4ARIA 2LMCA 1NYRA 3GS2A 5JXVA 2WXKA 1BUIC 1GOZA 2VZKB 3W9CB 2N9KA 5H92C 1JQ4A 1KTKA 3NS1A 1JWSD 1SB3C 1QOBA 1NVID 1B1ZA 2K22A 3BYYB 4OZCA 2PKOA 4YSYB 2WDRB 3BK1A 3ZQ4A 3HVDA 1NENB 4CQNA 4O1NA 3U2SC 1T5XD 3V3XA 4GDKB 2BS2B 3ETRA 1R7SA 4OW0A 1I4RA 1SBBB 1VDVA 1VR9A 3EA6A 4XE0A 4RGNA 2G1EA 1K51A 1PGXA 1NI3A 1XEEA 1ZPSA 3P4SB 1L5PA 5HG2A 5T8IA 1E6EB 3WCQA 1SE3A 4C56C 2LUMA 1L4ZB 1D5XC 3NRZA 1QILA 1RFKA 5EE3A 1EWYC 1ZUD2 2RDGA 3ZGZA 4N6EB 2QJLA 1V8CA 5BYRA 4N59A 4A90A 1MPEA 1ENFA 1MHHE 2NTTA 4M0WA 1F2RI 3MFGA 4JX1C 4HKQA 4US8A 3TSSA 1QT9A 4P16A 1GPXA 2LJIA 1L0YB 3L4PA 1V1OA 4NJCA 1ZXHA 4JE3B 2ACZB 4OVZA 1MHXA 5G5HA 5EE0A 2EKIA 1K50A 2WXPA 4KKIA 1D5MC 1YJJA 1XLOA 1JWUD 2WXHA 2YEPF 4A55A 1GTEA 1L6VA 2QIEB 3AH7A 4RCOA 3EUB2 3AE4B 3W1SA 2JZPA 2L52A 3AM9A 1WYGA 2X38A 3T3OA 2BBCA 1PGBA 1SXTA 4ZHOA 4HKZE 2NTSA 2PW9A 1JWAD 2AQ1B 5G5GA 2WNMA 1XXGA 2WXMA 2CU3A 3B9JA 1SJED 4WAFA 1TY2A 1Y56A 1MI0A 2W54A 5FR3A 2M19A 1FFUA 1TZOA 1TKEA 3EGRA 1JRPA 1E0ZA 2RDHA 1C4AA 2J52A 2LGIA 4IOIE 1VLBA 1XF5L 1OQQA 4KGSA 1XCQL 1SE4A 1N5WA 2RMMA 4ZRQA 1QOFA 1WRIA 4YTPB 4DQOC 1FNVA 3NVYA 1WGKA 5LNK1 1YN3A 1YQ3B 1H7XA 1H7WA 3AE2B 3FC4A 3W5UB 3V05A 1PGAA 1DYQA 2LHDA 1FD6A 3I9V1 3P4QB 2OHFA 2XNAC 2CJNA 2W3SA 4NZLB 2IPKD 1AWDA 1CJEA 2WXNA 2IGDA 2PTLA 2MJ3A 1JWBD 2R61A 3C8YA 3ZJUA 2WXFA 2I38A 1IBXB 4C7ZA 4D2KA 1EM7A 2K5PA 3HRDD 3NVZA 1J7BA 1YN4A 4HROA 1C9FA 2BTEA 2WDQB 4USAA 4RGMA 3BYTB 2GB1A 3AEAB 3FILA 3Q8FA 4WQMA 3SFDB 1N60A 1IUEA 3P63A 1ZE3D 3GP7A 2PIAA 3W2DA 3TUOA 1KLGD 4L23A 3AEDB 3CF4A 4C80A 3VR8B 2KMMA 3CWIA 3ZJTA 4ITKA 3AE9B 1JW9D 3IAM1 2ZW0A 3T3NA 4TQ0A 1FM0D 1TS2A 3KQ4A 5EE1A 3BK2A 1L4DB 1AW7A 2EELA 4RNAA 1ACCA 1J7CA 1FRRA 4YTNB 1SSNA 1MVKA 3RPFC 1FCCC 1UGJA 1AN8A 2L32A 2WXLA 3GB1A 2G9HD 1ZXIA 3AV8A 2AQ2B 4ZHPA 2BYTA 1JWMD 4B0MA 1QLBB 3SR6A 4NAWB 3BVMA 4B0EA 2BT6A 3ABVB 1SJHD 4KX6B 3VRAB 3AEBB 1I4HA 2LEKA 4KGTA 1TKGA 1I4XA 1A70A 1M4VA 3SEBA 4A8XC 1XLQA 1P7FA 3P4PB 3MP9A 1L0VB 1UWMA 3BIID 1I4GA 2V0GA 3U4EG 2FUG1 4N58A 5AUIA 1FFVA 2QSDA 2JXTA 1FNUA 2PMVA 2BS4B 3TEZA 3AEGB 2WXQA 2V3PA 1TS4A 3BVZA 1FEHA 1HXYD 3TEXA 4NAMA 1F0ZA 1GTHA 4TQ1A 2HTME 2W3RA 3AE8B 4RFBA 2FBWB 1SEBD 4DXFA 4C7YA 3CIRB 4XWWA 2K0PA 1VZ8A 3OWEB 4YTMB 4A9AA 4KGRA 5BMIA 1JROA 3AEEB 2E3TA 3UI3A 4YSZB 1N5XA 2W82A 1FNWA 2DYMA 2PVGC 5FK9C 3W5VB 1SIJA 4PT5A 1ZOYB 2Y3AA 2QEJC 4LTUA 2H88B 2AQ3B 3I57A 1ZDVA 2KDMA 2SAKA 1JALA 4RGTA 4EE2A 1EWCA 2VZKD 1KRHA 3DWGC 1V1PB 2JU6X 3J9CA 1FCLA 5BMGA 1E7PB 3AE5B 1EU3A 2WXRA 3Q8BA 2LHEA 1HA5A 2ON8A 3Q8CA 4IKGA 1HEZE 1K52A 3P4RB 1I4PA 3IAS1 1GAQB 1QOAA 1C4CA 1N61A 3KWVA 3VRBB 1FO4A 4LLGM 2WXOA 3LXFA 2J42A 4OHJA 4Q2JA 3ZYYX 3BZDB 3MJ5A 1VRAB 2H89B 1HQRD 2YEPB 2Z8LA 3R2TA 5AUKA 2DLBA 5BMHA 1BXTA 3TEYA 1UNSA 3HVZA 2WU5B 5C3JB 3IT6B 4WURA 2QILA 2IGGA 1TY0A 1DOIA 4MM3B 5HFYA 2N7JA 1L0XB 1XO3A 1STEA 2XN9C 2ICIA 1ZP0B 4RGOS 4ZYSA 1C4PA 2I2YA 1TS5A 3PZ8A 1YNTE 1RYJA 4ZRPA 1YMHE 4RF1A 4RF0A 1QQRA 1BMLC 1D4BA 3SFEB 2L83A 2WLBA 3MHZA 1I7HA 4JWSC 2WXIA 4OZBA 4P6VF 4GDLB 2JQRB 5BYQA 3KLSX 2K9XA 1XLNA 1NEKB 1IGCA 2B76B 3URYA 2BW2A 1CZPA 2L1AA 3B2FA 1C79A 1QOGA 2J4XA 3NVVA 1E9MA 4WIPA 1V97A 1KFYB 3FILB 1YQ4B 3ZJVA 2N9LA 4XWTA 1C77A 4MH8A 2K3UA 3MC0B 2WXJA 2D5GA 1TKYA 1Q10A 4IDIA 4YWGG 4TMAB 1WWTA 4JWUC 1ET9A 1OFFA 3LYYA 1AYFA 3P1MA 2JYTA 1D5ZC 2MEKA 2QMTA 1UWXA 5EE9A 2WQYB 1TS3A 3TEWA 1JMLA 1KH0A 2V4IB 3AE6B 2SEBD 5C2TB 3VR9B 1PYWD 2M56B 1D6EC 3IXSA 2JYEA 4HEA1 2Y5CA 1ZDXA 2WDVB 1YN5A 2KWDA 1B9RA 1DGJA 1HZ6A 2RPVA 3HUIA 2Y5PA 1YJIA 5TSSA 1ET6A 2GI9A 3NUHB 4AS1A 1DOYA 4JPSA 3AE1B 1CQVA 1JCKB 4A6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H88 B;  3PO0 A;  3W9C B;  3W5U B;  5H92 C;  1JQ4 A;  1JAL A;  3AEC B;  3P4Q B;  2OHF A;  3NS1 A;  1SB3 C;  5MPO A;  1KRH A;  3DWG C;  1DOX A;  2CJN A;  2W3S A;  1AWD A;  1CJE A;  1E7P B;  1QOB A;  3AE5 B;  1NVI D;  3LB8 C;  4HRS A;  2K22 A;  2MJ3 A;  3P4R B;  1JWB D;  1RWS A;  1GAQ B;  2PKO A;  4YSY B;  1QOA A;  2MH7 A;  2WDR B;  4WWM A;  1N61 A;  4US9 A;  2WS3 B;  3VRB B;  4C7Z A;  1WXQ A;  2K5P A;  1FO4 A;  2WU2 B;  3HRD D;  3LXF A;  1J7B A;  1NEN B;  1T3Q A;  3NVZ A;  4HRO A;  3AN1 A;  2WDQ B;  2BS2 B;  4USA A;  2W55 A;  3ETR A;  3AEA B;  1NYQ A;  1PFD A;  1R7S A;  4WQM A;  3ZYY X;  1FIQ A;  1VDV A;  1H7W A;  3DWM A;  3SFD B;  1N60 A;  1GT8 A;  1IUE A;  3P63 A;  4ZOH C;  2H89 B;  2G1E A;  2PIA A;  5AUK A;  1NI3 A;  1L6U A;  3NVW A;  3HVZ A;  3P4S B;  2WU5 B;  5C3J B;  1L5P A;  1TJE A;  1TYG B;  3AED B;  3CF4 A;  1N63 A;  4C80 A;  3AE7 B;  3VR8 B;  1E6E B;  3WCQ A;  2WP9 B;  1DOI A;  2KMM A;  3CWI A;  1OQR A;  4ITK A;  3AE9 B;  1XO3 A;  2KAJ A;  3NRZ A;  1ZP0 B;  1E10 A;  1RFK A;  1JW9 D;  1FM0 D;  1EWY C;  5EE3 A;  1ZUD 2;  3KWL A;  1RYJ A;  5EE1 A;  1SF0 A;  4N6E B;  2QJL A;  1V8C A;  4N59 A;  3SFE B;  1KF6 B;  1J7C A;  2L83 A;  2WLB A;  1I7H A;  1FRR A;  2JX5 A;  4JWS C;  4YTN B;  4P6V F;  3AEF B;  3RPF C;  1XLP A;  2DBY A;  2JQR B;  4JX1 C;  2K9X A;  4US8 A;  1RM6 C;  1ZXI A;  1FXA A;  1XLN A;  3AV8 A;  4ZHP A;  1NEK B;  1QF6 A;  1QT9 A;  1ROE A;  1QLB B;  1VJK A;  1J7A A;  5GXG B;  3SR6 A;  1GPX A;  2B76 B;  2BT6 A;  3ABV B;  2Q5W D;  3L4P A;  4KX6 B;  3VRA B;  1CZP A;  3AEB B;  2LEK A;  2ACZ B;  1QOG A;  3NVV A;  1FRD A;  1E9M A;  5EE0 A;  2EKI A;  5G5H A;  1TKG A;  1KFY B;  1V97 A;  1YQ4 B;  1A70 A;  1YJJ A;  1XLQ A;  1XLO A;  3P4P B;  1L0V B;  1UWM A;  3BII D;  1GTE A;  4N58 A;  1L6V A;  2QIE B;  3AH7 A;  4YXD B;  5AUI A;  1FFV A;  3EUB 2;  3FAH A;  3AE4 B;  1TKY A;  4YT0 B;  2BS4 B;  4IDI A;  2L52 A;  3AM9 A;  3AEG B;  1WWT A;  4JWU C;  3AE3 B;  1OFF A;  1WYG A;  1AYF A;  1PUT A;  1FMA D;  2CJO A;  2PVO D;  3P1M A;  4ZHO A;  5H8Y E;  1JWA D;  1F0Z A;  1GTH A;  5G5G A;  2HTM E;  2W3R A;  2CU3 A;  3B9J A;  3AE8 B;  5EE9 A;  2FBW B;  2WQY B;  2BS3 B;  2MJE A;  2W54 A;  3AB5 A;  2DWQ A;  1FFU A;  2M19 A;  4YSX B;  1TKE A;  4C7Y A;  3CIR B;  1JRP A;  1E0Z A;  3AE6 B;  5C2T B;  3VR9 B;  1FXI A;  2MJD A;  4FXC A;  4YTM B;  1N62 A;  2M56 B;  3B2G A;  4A9A A;  1PDX A;  2Y5C A;  1JRO A;  2WDV B;  3AEE B;  1VLB A;  2N0S B;  2E3T A;  1OQQ A;  4YSZ B;  1N5X A;  1DGJ A;  1N5W A;  2AX5 A;  1B9R A;  1QOF A;  1WRI A;  4YTP B;  2PVG C;  3NVY A;  3HUI A;  3AMZ A;  1WGK A;  1YJI A;  3W5V B;  1SIJ A;  1ZOY B;  1DOY A;  1NYR A;  1YQ3 B;  1H7X A;  3AE2 B;  3AE1 B;  3B2F A;  4LTU A;  3FC4 A; 
#chains in the Genus database with same CATH topology
 2GBR A;  4GN1 A;  2WWZ A;  3IBE A;  4JGH B;  4JL9 A;  5CHW A;  1Q1O A;  4HRS A;  2GLS A;  4H2A A;  2JRI B;  4US9 A;  2CHW A;  1WXQ A;  5HHD G;  3CF6 E;  3E9S A;  2KZR A;  4J3O D;  1IGD A;  3NZS A;  1K53 A;  3RFZ B;  2BB5 A;  3RZW C;  2ONQ A;  3A9J B;  3H9D A;  4IC7 B;  2L0T A;  3RCZ A;  4GIV A;  4M0W B;  2LGX A;  3DBL B;  3U7Z A;  1F77 A;  1OQR A;  3BVG A;  2KAJ A;  2JSV X;  4EKU A;  5G55 A;  3L0W B;  1SF0 A;  3R7Q A;  2KNB A;  2MRP A;  2TSS A;  2N1W A;  3HHM A;  3AEF B;  2KX0 A;  4JLC A;  1FXA A;  1VJK A;  3DVN U;  3RN9 C;  1WSP A;  4LNN A;  3WAL A;  2XBB C;  1OGW A;  1OTR B;  3PV1 A;  1FRD A;  3W1Y A;  2HDE A;  2KQ4 X;  3PTF C;  4XDD A;  4BOS C;  3KYD D;  3RT3 B;  3ZXV A;  4YXD B;  4IUM B;  1GB4 A;  2EMT A;  3A9K A;  4UDU C;  2FIF A;  2M0X A;  3KVF B;  1FXT B;  2KO3 A;  1PUT A;  1XT9 B;  5H8Y E;  3NY5 A;  1E8Y A;  3ZNZ B;  2BB6 A;  3KW5 B;  4ARC A;  2BF8 B;  4REZ A;  4WH4 A;  1WX9 A;  3NZ3 A;  4MJS A;  3NS8 A;  2HJ1 A;  3B2G A;  4YL8 A;  2IJ0 A;  1WFY A;  3UGB B;  3GS2 A;  2WXK A;  1VCB A;  1WR6 E;  2K22 A;  2V1Y A;  1WMH B;  3U7D A;  3ZQ4 A;  3HVD A;  2KFJ A;  1NEN B;  4CQN A;  1WZ3 A;  4XYC A;  3CSF A;  4GDK B;  2BS2 B;  3PVL A;  3AU4 A;  5G2N A;  1I4R A;  1VDV A;  4G0N B;  3EA6 A;  2G1E A;  1K51 A;  1XEE A;  1KOT A;  1ZPS A;  4K3C A;  1L5P A;  4DHZ E;  2C5L C;  3T9L A;  4B95 A;  3APC A;  3C0R B;  3RNF C;  1NBF C;  1D5X C;  2RGF A;  1RFK A;  4X57 B;  2A5U A;  1ZUD 2;  2RDG A;  1V8C A;  4G3X B;  3UIO B;  3L16 A;  3TJP A;  2NTT A;  4K7W A;  4JX1 C;  4LNI A;  4P16 A;  4C4V A;  5BO4 B;  3D32 A;  5JHB A;  1ZXH A;  2ACZ B;  1R4M I;  2EKI A;  3IVF A;  4DXA B;  4A55 A;  4MSQ B;  2ZPN A;  1V81 A;  3DBR I;  3OAW A;  3RNC C;  1PGB A;  2NTS A;  3VTV A;  1JWA D;  4CO7 A;  3P2B A;  2BKR B;  2MBE A;  2MBQ A;  2WYQ A;  2ZNV C;  1MI0 A;  5FR3 A;  5AZH A;  3EGR A;  1E0Z A;  1C4A A;  4RM8 A;  4F1S A;  5LXH A;  2M8S A;  1AAR A;  3BIN A;  2RMM A;  1SE4 A;  4YTP B;  4IWQ A;  2O6V D;  2L05 A;  2LD9 A;  1HE8 A;  1FD6 A;  4HDO A;  2OHF A;  2XNA C;  1AWD A;  2WXN A;  3DBL I;  3TMP B;  1SIF A;  2PTL A;  1JWB D;  3H6N A;  3TCA A;  3ZJU A;  4C7Z A;  3HRD D;  4PS8 A;  4II3 B;  4USA A;  1S1Q B;  2JWZ A;  3FIL A;  4EZJ A;  1N60 A;  4HWI B;  1KLG D;  4L23 A;  3IHP C;  1Z2M A;  1P98 A;  1TT5 B;  3V60 A;  3AXC A;  4GDK A;  5DCN A;  3UF8 A;  2B3A A;  3B08 A;  1L4D B;  1WH3 A;  4WJO A;  1YJ1 A;  3VHT C;  3DVG Y;  4RNA A;  1YOV B;  1J7C A;  2PE9 A;  1SSN A;  3V6C B;  3DHG C;  4FUL A;  1MVK A;  2WXL A;  1AN8 A;  2M1M A;  2G9H D;  1ZXI A;  2WX0 A;  3A9J A;  2AQ2 B;  4LDT B;  4B0E A;  3ABV B;  2A4Z A;  2LGY A;  3AEB B;  1I4H A;  1X1M A;  4ICV A;  3ML8 A;  4W9E A;  1M4V A;  2FUG 1;  2KLG A;  2BPS A;  3ZLZ A;  4IW0 A;  5IAA C;  1WYW B;  1UEL A;  2MBB B;  2UWQ A;  2WXQ A;  3BVZ A;  1WGR A;  2HTM E;  1T0S C;  2AEH A;  2LI5 A;  4TKN A;  3CIR B;  4XWW A;  5FR6 A;  2G4S A;  2BWE S;  5BMI A;  4KGR A;  4ZRK A;  1JRO A;  4YSZ B;  1IP9 A;  3VTW A;  1ZOY B;  2Y3A A;  4ACF A;  2AL3 A;  2KQ7 A;  1GC6 A;  1EWC A;  3DWG C;  1V1P B;  2JU6 X;  2JUO A;  3J9C A;  2WXR A;  2ON8 A;  1WJ4 A;  1E7V A;  1R4N B;  3IAS 1;  1QOA A;  4ZRI A;  1WJ6 A;  3A33 B;  4LLG M;  3RNB C;  3HK0 A;  4TUU A;  2D3A A;  2J42 A;  4E71 A;  4S0R A;  3BZD B;  1M94 A;  2H89 B;  2N4F A;  1HQR D;  1WRD B;  3R2T A;  5IOI A;  2REX A;  1BXT A;  2NS5 A;  3TEY A;  3DBR B;  3HVZ A;  5IO9 A;  4DDG D;  2IGG A;  3ZDT A;  4MM3 B;  4KSL C;  3M95 A;  3PZ8 A;  1QQR A;  3ZTD A;  2KT7 A;  4MSM B;  4MM3 A;  2WXI A;  3DHI C;  4HDQ A;  2J0J A;  2JXX A;  5BYQ A;  3KYC D;  2K9X A;  1NEK B;  2L1A A;  2WX1 A;  1R4M B;  3FIL B;  3ZJV A;  2N9L A;  1MJD A;  2IY1 B;  2ZZP B;  3B0A A;  2WXJ A;  2D5G A;  1TKY A;  4IDI A;  3OJ3 A;  4JWU C;  1ET9 A;  3VAW A;  3UIN B;  1WIA A;  2ZEQ A;  1TS3 A;  1I42 A;  2W9N A;  3TBL D;  1XD3 B;  2V4I B;  5C2T B;  2M56 B;  3A4R A;  2WDV B;  3KUC B;  2FCS A;  2Y5P A;  1YJI A;  3WAP A;  3N3K B;  4WWN A;  1WY8 A;  3Q8E A;  3B2F A;  2DYO A;  3VXW A;  2JWU A;  3AEC B;  2INP E;  3LB8 C;  4JIO U;  4F7Z A;  2L0F A;  1RWS A;  4LNK A;  2MH7 A;  4WWM A;  5D7G A;  4ANW A;  1SE9 A;  3AN1 A;  1NYQ A;  1PFD A;  2QHO A;  3I3T B;  3JW0 X;  4LK0 M;  2CHZ A;  5J2R A;  2BKF A;  1GB1 A;  4ZOH C;  3ZNG C;  4BFR A;  1CMX B;  1LQB A;  4MAC A;  4R3D A;  1EF5 A;  3PZ7 A;  2N1V A;  5E6J A;  1PQS A;  4ASW C;  4C00 A;  5D2M B;  2FNJ B;  2IDY A;  4KDI C;  1WZ0 A;  3KWL A;  2KWC A;  3U52 E;  3GZN I;  3APF A;  1T0Y A;  1KLU D;  2KDF B;  1UF0 A;  2DZM A;  2ZNV B;  3PHX B;  4FHK A;  4IWO A;  1E5W A;  3RUI B;  5GXG B;  2Q5W D;  4DDI D;  4RM9 A;  3Q69 A;  5FKA C;  2ZCB A;  2G3Q B;  3DVN V;  1XQQ A;  2AYO B;  3H8H A;  4YT0 B;  3AE3 B;  2PVO D;  1KJT A;  2VH2 A;  4GLS C;  4L2Y A;  5I4D A;  4BZA A;  4HJG E;  2LUE A;  2MJE A;  3AB5 A;  1J19 A;  2DWQ A;  3N9Y C;  2PLP A;  3AI5 A;  4NJ7 A;  4KKJ A;  4MDK E;  3QQ8 B;  3P42 A;  4XZ4 A;  1V2Y A;  2CHX A;  2L7R A;  4DXG A;  4NJ6 A;  1OQY A;  4W9H A;  2LMC A;  1NDD A;  1GC7 A;  1H4R A;  1EUV B;  1NVI D;  3N32 A;  1B1Z A;  4K1R B;  3WAO A;  4OZC A;  3A1Q B;  3U2S C;  1T5X D;  2PJH A;  3V3X A;  5KHQ A;  3QAQ A;  1VR9 A;  2YLM A;  1GG3 A;  4XE0 A;  4LCD E;  4II2 B;  1PGX A;  2G4D B;  2DZI A;  2KN5 A;  3MJW A;  5T8I A;  1E6E B;  2N9E B;  3WCQ A;  4C56 C;  1L4Z B;  4AWJ A;  3ZGZ A;  4N9F 4;  2Z0D B;  2N9X A;  4HKQ A;  3S2A A;  4US8 A;  3TSS A;  4K81 A;  1L0Y B;  2QCZ A;  3L4P A;  4K7U A;  4NJC A;  4ZYN A;  1WGD A;  2WXP A;  1WE6 A;  1D5M C;  1XLO A;  4KVG B;  3EFU A;  4AUQ C;  2WXH A;  2YEP F;  2QIE B;  3AE4 B;  1V9J A;  2JZP A;  2L52 A;  2JZZ A;  3WAN A;  1R4N I;  2BBC A;  3RI7 C;  1SXT A;  2ZCC A;  4I6P A;  5G5G A;  2WXM A;  1SJE D;  1ZW7 A;  3DVG X;  1C1Y B;  1LM8 B;  1FFU A;  1J8C A;  2C7H A;  3AUL A;  2O2V A;  2RDH A;  2J52 A;  2LGI A;  1VLB A;  3L17 A;  1XF5 L;  1OQQ A;  2K25 A;  1N5W A;  1WGK A;  1YQ3 B;  3PZD A;  4MGK E;  2CJN A;  4NZL B;  3PPA A;  3C8Y A;  1LGR A;  4S17 A;  1WX7 A;  1IBX B;  1EM7 A;  3APD A;  4HRO A;  3N20 C;  4RGM A;  3NJT A;  3P63 A;  3SDL C;  2HJ8 A;  3PHW B;  2L3Z A;  2IND C;  4LJO B;  2LGD A;  1UBI A;  3VR8 B;  3ZJT A;  2OJW A;  4ITK A;  3AE9 B;  3ZXR A;  3WA0 A;  3ZDM C;  1KM7 A;  3DBS A;  4TQ0 A;  1FM0 D;  4KV2 A;  2ZVO A;  4FJV B;  2KC1 A;  1ACC A;  3QCA A;  3QA8 A;  3H7P A;  2ZVN A;  4BBN C;  4YTN B;  2C9W B;  3ZIM A;  1WXM A;  3RPF C;  1FCC C;  2L32 A;  2IO2 B;  1JWM D;  2KDI A;  3SR6 A;  4NAW B;  3VRA B;  3LJ3 A;  4GSW A;  4KGT A;  1A70 A;  1UGM A;  2JF5 A;  4A8X C;  1P7F A;  4FBJ B;  2JT4 B;  4TV3 A;  3K9P B;  3U8Z A;  4QAY A;  5AUI A;  2QSD A;  2BS4 B;  3SHQ A;  3AEG B;  1TZ1 A;  3JSV B;  1F9J A;  1FEH A;  1HXY D;  1F0Z A;  4NAM A;  1GTH A;  3EFC A;  3AE8 B;  1N6Z A;  2FBW B;  4DXF A;  4IM3 A;  2PEA A;  4C7Y A;  1VZ8 A;  3AEE B;  3ZKJ C;  3V62 A;  2RR9 A;  4PT5 A;  2C60 A;  3GE3 C;  2QEJ C;  3UIP B;  3H7S A;  4LTU A;  2AQ3 B;  4IM0 A;  1ZDV A;  2J0M A;  2VZK D;  1KRH A;  1FCL A;  1EU3 A;  2GBJ A;  2KVR A;  3PRE A;  1HEZ E;  3V61 A;  3P4R B;  1I4P A;  1N61 A;  4HLE A;  2WXO A;  3PRZ A;  4OHJ A;  3H1U A;  5AUK A;  2DLB A;  4MEL A;  4GGQ A;  2DX5 B;  3GOE A;  1TY0 A;  5HFY A;  1STE A;  2AWT A;  4ZYS A;  1C4P A;  2I2Y A;  4W9G A;  2HE7 A;  1RYJ A;  3I5J C;  1S3S G;  3EC8 A;  3VTU A;  5L95 C;  3ZNH B;  2LVP A;  3MHZ A;  3RYT A;  4OZB A;  3KLS X;  4OVV A;  1XLN A;  2R2Q A;  4WJP A;  1K8R B;  2B76 B;  2BW2 A;  3DOW A;  1QOG A;  2J4X A;  4WIP A;  1E9M A;  1V97 A;  1KFY B;  2KK8 A;  1WF9 A;  2K3U A;  2Y5B B;  3MC0 B;  4G50 A;  1Q10 A;  5IA7 A;  4YWG G;  4TMA B;  2DYB A;  2KMA A;  2ZPY A;  3LYY A;  1AYF A;  3MC8 A;  2CKH B;  3P1M A;  3VDZ A;  4HPP A;  1OEY A;  2NBU A;  4A3P A;  4BKT A;  2NPT A;  4EFO A;  3HM6 X;  4FJZ A;  2G45 B;  5AZF A;  3AE6 B;  2SEB D;  4HEA 1;  2NCN A;  4FA6 A;  2DNF A;  1YN5 A;  3ZNI D;  1HZ6 A;  5TSS A;  1ET6 A;  2KDB A;  4HVB A;  2IO1 B;  3KUZ A;  2RD0 A;  3PO0 A;  4M01 A;  3EEC A;  3L54 A;  4L1B A;  1OEY J;  2CR5 A;  1DOX A;  2N7D A;  3JSV A;  3Q14 C;  1UH6 A;  4WAA A;  2IGH A;  5TR5 A;  1YD8 U;  3VUX A;  4MGZ E;  2WU2 B;  1T3Q A;  4I6N B;  2RPQ A;  3PSE B;  1FIQ A;  4WWP A;  2WXG A;  1GT8 A;  2LZ6 A;  4WQO B;  1SGH A;  5DPR A;  2EKE C;  4E74 A;  2NMQ A;  4LJP B;  1F2R C;  1TYG B;  1GNU A;  2R2O A;  5DPT A;  3RUL A;  3H7P B;  4HXD A;  3QWZ B;  2KAC A;  1E10 A;  2JY6 A;  2KFK A;  4A3O A;  2K8C A;  1VZ7 A;  5D3D A;  1C3T A;  1KF6 B;  2INN E;  2MBH A;  4JQW C;  4CHK A;  3I63 C;  3E56 A;  2K39 A;  1XLP A;  2DBY A;  4KDL B;  1JRU A;  3BWU D;  3R2I A;  1CK1 A;  4ZDV A;  1YQB A;  4NPN A;  1LO5 D;  3RMK C;  1P7E A;  3Q2A C;  1FPY A;  2K8B A;  2FE8 A;  4DHJ D;  1TGZ B;  3FAH A;  3NZU A;  3M62 B;  1WXS A;  2DAJ A;  3N1X C;  5JHA A;  1HTO A;  3R8B A;  1UD7 A;  1T6B X;  3Q8A A;  1UUP A;  4EUT A;  3ML9 A;  4YSX B;  4P7I A;  1C76 A;  2LRW A;  2J53 A;  2MJD A;  1N62 A;  1J0G A;  2FUH B;  1KLV A;  2MBO A;  1RAX A;  1LXD A;  2JPH A;  2GRI A;  4EOY A;  1QKZ A;  3AMZ A;  4F8C B;  5DPW A;  3IT4 B;  1ESF A;  4MGY E;  1NYR A;  2DZK A;  3KUD B;  4RMA A;  1GOZ A;  3W9C B;  4NAW A;  2N9K A;  4C4V B;  1JQ4 A;  1KTK A;  5CX3 A;  1JWS D;  1SB3 C;  1QOB A;  3X0W A;  2Z0E B;  3BYY B;  4EZL A;  3BK1 A;  1T0Q C;  4O1N A;  4OW0 A;  1SBB B;  5CTR C;  4M02 A;  2KDE B;  2VH1 A;  1D3Z A;  1NI3 A;  3P4S B;  5HG2 A;  3QIJ A;  1Y8R C;  2CS4 A;  4E3C A;  3Q3N C;  3NRZ A;  1QIL A;  4BKG A;  1F1H A;  4N6E B;  4NQK E;  3W1S C;  4G11 A;  3Q3F A;  4PYZ A;  1MPE A;  2AL6 A;  3DPD A;  1MHH E;  1F2R I;  3RNA C;  3T8M A;  1QT9 A;  3V6E B;  1GPX A;  2KWV B;  2IBI B;  2XEW A;  3JYU A;  1EF1 A;  1V5T A;  4OVZ A;  4GXB A;  1MHX A;  4NQL B;  3N30 A;  1K50 A;  4KKI A;  1JWU D;  4A20 A;  2M4N A;  1GTE A;  1WJU A;  4PS3 A;  1WMH A;  3A1Q A;  3EUB 2;  4ZHO A;  4HKZ E;  2C7N B;  2WNM A;  2CU3 A;  3B9J A;  1Y56 A;  3DCG A;  2M19 A;  2O6V B;  2KD0 A;  3UQB A;  1RFA A;  3LDZ E;  3EHV A;  1E8W A;  4KGS A;  1XCQ L;  2GMI C;  4ZRQ A;  1QOF A;  1WRI A;  4DQO C;  1FNV A;  3NVY A;  5LNK 1;  1WM2 A;  3IFW B;  4B6W A;  2KC2 A;  1H7X A;  1H7W A;  3X23 A;  3W5U B;  1PGA A;  2K6Q A;  1LFD A;  1CJE A;  5KHO A;  4ICU A;  2MJ3 A;  3CMM B;  2R61 A;  2WXF A;  2I38 A;  4D2K A;  2FID A;  1TBE A;  3NVZ A;  1GUA B;  1YN4 A;  1F52 A;  4W9J A;  4ANV A;  2GB1 A;  1IUE A;  3GP7 A;  2PIA A;  4HPM B;  3WIM A;  2KTR A;  2MCN B;  1YIW A;  4ANX A;  3N1Z C;  2D11 A;  1QZE A;  3AED B;  3CF4 A;  4C80 A;  1Q0W B;  2KMM A;  1G6J A;  2KFK B;  3DBH I;  1T0R C;  2ZW0 A;  1TS2 A;  4MEM A;  5EE1 A;  2KJR A;  1AW7 A;  2EEL A;  2UYZ B;  1FRR A;  3GB1 A;  1UGJ A;  3AV8 A;  4ZHP A;  3BVM A;  2BT6 A;  2L8J A;  4KX6 B;  2NBW B;  4BKS D;  1UZX B;  3Q3J A;  2LEK A;  1TKG A;  1I4X A;  2Z59 B;  1I35 A;  3SEB A;  2D2Q A;  3P4P B;  3MP9 A;  1UWM A;  2GOW A;  3BII D;  1I4G A;  2BYV E;  3HIZ A;  3L10 B;  4KZ0 A;  2JXT A;  1FNU A;  4M8N A;  3WAM A;  2MWS B;  2KJH B;  3MHS D;  4WJN A;  2V9H A;  5E6O A;  2JVC A;  1E7U A;  2V3P A;  1TS4 A;  3TEX A;  3DBH B;  4FJY A;  4TQ1 A;  2BGF A;  1NI2 A;  1SEB D;  2K0P A;  4KZC A;  4NNJ B;  1RLF A;  4W9L A;  3UI3 A;  1N5X A;  3HM3 A;  2W82 A;  1FNW A;  2DYM A;  3Q3M C;  2PVG C;  2KLC A;  5FK9 C;  3W5V B;  1SIJ A;  3Q3O C;  3RNE C;  1E8X A;  2H88 B;  4BAX A;  3I57 A;  2NPT B;  4RGT A;  2C7M B;  4EE2 A;  1H8C A;  2FAZ A;  3AE5 B;  3ZTC A;  2LHE A;  3Q8C A;  2GBM A;  2IZV B;  1K52 A;  1E90 A;  2HTH A;  1C4C A;  3KWV A;  1FO4 A;  4HCN B;  3LXF A;  1A5R A;  2KVZ A;  1YX5 B;  1VRA B;  3R7R A;  2YEP B;  2Z8L A;  1IYF A;  2WU5 B;  2QC8 A;  3IT6 B;  3SU8 X;  5J18 A;  2QIL A;  2N7J A;  1L0X B;  1XO3 A;  3RD2 A;  5C23 A;  4DHJ B;  1TS5 A;  1YNT E;  3QK0 A;  3VUY A;  1D4B A;  3SFE B;  2L83 A;  4JWS C;  4W9C A;  2KKC A;  2JQR B;  2BWF A;  3DDC B;  4FAD A;  1CZP A;  3NVV A;  2N7E A;  3QAR A;  5LXI B;  3UQA A;  1Q5W B;  4MH8 A;  3OLM D;  2RDB C;  2MX2 A;  3PLV A;  4DBG A;  1WGG A;  4WWO A;  2JYT A;  2QMT A;  1UWX A;  5EE9 A;  2WQY B;  2XK5 B;  2BYF A;  1JML A;  2DZJ A;  2I1J A;  2K6D B;  1UBQ A;  2QDF A;  1D6E C;  3IXS A;  3ZRC A;  3HUI A;  1V86 A;  1DOY A;  1JCK B;  4A6Q A;  1WX8 A;  3QC8 B;  2M0A A;  3GE8 C;  1HZ5 A;  2E6X A;  1V5O A;  1WXV A;  3R66 C;  3GZN B;  5MPO A;  1ZGU B;  3QJZ A;  4P1B C;  3U30 A;  1WJN A;  1ZKH A;  1SE2 A;  3VQI A;  2WS3 B;  4URK A;  4MT5 A;  4J6I A;  2BQQ A;  2KTF A;  4AP4 C;  2W55 A;  3NG0 A;  3O13 A;  4XDC A;  3DWM A;  1L2N A;  2MSE D;  4LNO A;  3RZF A;  1L6U A;  3NVW A;  5IN7 A;  2ZW1 A;  1TJE A;  1C78 A;  1N63 A;  3AE7 B;  2WP9 B;  1WI0 A;  2GBN A;  5CHV C;  1GJZ A;  1IBX A;  3MTN B;  2K8H A;  2KN4 A;  4K3B A;  3ALB A;  3AU5 A;  1P3Q U;  2JX5 A;  2PE6 B;  5E6P A;  1EU4 A;  3K9O B;  1V1P A;  5D3I B;  1QF6 A;  1RM6 C;  2KTR B;  1ROE A;  1J7A A;  3VVW B;  3ZVV A;  2D3C A;  4OZA A;  5E6N A;  4TSS A;  5D6J B;  1P9D U;  1WGY A;  2M17 A;  3R3M A;  3ZW3 A;  2V3N A;  3QHT A;  5BYS A;  4AQ7 A;  5GMV A;  1P1A A;  1VZ6 A;  2LFI A;  2KYW A;  4RH6 A;  3TL5 A;  5HI1 A;  2KOX A;  1FMA D;  2CJO A;  3ENE A;  2N9P C;  2WDT B;  4ZRJ A;  4BOZ B;  4IM2 A;  2BS3 B;  2KJ6 A;  3DQV A;  3VUW A;  4BBN F;  2D3G A;  1FXI A;  2INC C;  2LXC A;  4FXC A;  3TIX A;  1XCT L;  2FCM A;  1I4Q A;  1PDX A;  5J17 A;  3L08 A;  1ISN A;  2I1K A;  2N0S B;  3ZRF A;  3VFK A;  2AX5 A;  4FLH A;  2O2V B;  2X8X X;  4AOF A;  3M3J A;  2OED A;  4ARI A;  2O6V A;  3NOB A;  5JXV A;  1BUI C;  2EMS A;  2VZK B;  2MP2 B;  5CHF A;  5H92 C;  1TIF A;  2MHJ A;  3NS1 A;  2FCN A;  5D94 A;  1IPG A;  3KH0 A;  5LLI A;  4W9F A;  4BKS A;  2NVU I;  3NHE B;  2PKO A;  4YSY B;  3PGE A;  2WDR B;  2HD5 B;  5EDS A;  3ETR A;  2LRU A;  1R7S A;  2KQS A;  5L83 A;  2CU1 A;  4RGN A;  4XGA B;  2ASQ A;  4KSK C;  2K1F A;  4ANU A;  2DHZ A;  1SE3 A;  2LUM A;  4DHZ B;  4GB9 A;  5EE3 A;  1EWY C;  4IG7 B;  2QJL A;  2IYD B;  4XX5 A;  5BYR A;  3PLU A;  4N59 A;  4AJW A;  2D10 A;  4A90 A;  1ENF A;  4M0W A;  3MFG A;  1BT0 A;  4GU2 A;  2LJI A;  4NY0 A;  1V1O A;  3O65 B;  1U4A A;  2NR2 A;  4JE3 B;  1V80 A;  5G5H A;  5EE0 A;  4XC2 A;  1YJJ A;  1HTQ A;  2L00 B;  1L6V A;  3AH7 A;  4RCO A;  5HKH A;  3W1S A;  2LVO A;  3AM9 A;  4MJS B;  1WYG A;  2X38 A;  3T3O A;  2PW9 A;  2AQ1 B;  4AJY B;  4EEW A;  5AZG A;  2KAN A;  1L7Y A;  1XXG A;  4WAF A;  4HCP B;  5DPS A;  1TY2 A;  2MP2 A;  2W54 A;  1TZO A;  2D3B A;  1TKE A;  1Z5S B;  1JRP A;  3A9K B;  2LGS A;  3Q6B A;  3ZO5 B;  4IOI E;  1MG8 A;  3ONS A;  4GOC A;  2JZ3 B;  2WHI A;  1YX6 B;  3DHH C;  2MQJ A;  1YN3 A;  1WM3 A;  2LJ5 A;  3AE2 B;  3FC4 A;  2D07 B;  3V05 A;  2LAS A;  1DYQ A;  1TTN A;  2LHD A;  3I9V 1;  3P4Q B;  4BVU C;  2W3S A;  2IPK D;  2PPH A;  2IO0 B;  2IGD A;  2J0K A;  2OJR A;  4B9K A;  2J7Q B;  2K5P A;  1J7B A;  1C9F A;  2BTE A;  2WDQ B;  3BYT B;  3AEA B;  3RNG C;  3Q8F A;  4WQM A;  2MA9 B;  3SFD B;  1ZE3 D;  3W2D A;  3TUO A;  4FHJ A;  4CYE A;  2VRR B;  3CWI A;  4OVU A;  1JW9 D;  3IAM 1;  3T3N A;  3KQ4 A;  4HJK A;  3BK2 A;  3ZUN A;  2FCQ A;  3M63 B;  1RRB A;  1EO6 A;  2OOB B;  3MC9 A;  2LXA A;  2V3S A;  2BVC A;  4B0M A;  1QLB B;  2BYT A;  1VD2 A;  3VH3 B;  3QX1 A;  1SJH D;  4WJQ A;  3N1Y C;  1XLQ A;  2KX3 A;  1L0V B;  2V0G A;  3U4E G;  4N58 A;  1WE7 A;  1FFV A;  2PMV A;  3OG5 A;  3TEZ A;  2KWU B;  4I6L B;  4IWP A;  1V6E A;  2W3R A;  4KIK A;  4RFB A;  5C1Z A;  5IKC M;  2IO3 B;  3OWE B;  4YTM B;  4A9A A;  1MG4 A;  2E3T A;  3PRP B;  2GBK A;  4HPL B;  3FKY A;  4DK5 A;  2KDM A;  2SAK A;  1JAL A;  2KHW B;  2ZJD A;  4PK1 A;  5BMG A;  1E7P B;  4GDL A;  2DEN B;  3Q8B A;  2BYE A;  1HA5 A;  1E8Z A;  4IKG A;  2DAF A;  3CST A;  1GAQ B;  4FN2 A;  4LDT D;  3VRB B;  4W9I A;  2MW5 A;  2KMC A;  2L76 A;  3L13 A;  4Q2J A;  3ZYY X;  3MJ5 A;  2KXJ A;  4W9D A;  2JRH A;  2LWP A;  1WR1 A;  5BMH A;  1UNS A;  4HK2 A;  5C3J B;  3OJ4 B;  4WUR A;  2IY0 B;  3SD5 A;  1WGH A;  1DOI A;  2WGS A;  2XN9 C;  1WXA A;  1ZP0 B;  2ICI A;  4RGO S;  4EZK A;  4MH0 E;  4ZRP A;  3ECI A;  3VH4 B;  2UU7 A;  4GMV A;  1YMH E;  4RF1 A;  4RF0 A;  5JZE B;  1BML C;  1MFW A;  2WLB A;  1P0R A;  3JVZ X;  1I7H A;  4P6V F;  4GDL B;  4M00 A;  2NBV B;  4PYU A;  3C19 A;  1IGC A;  3URY A;  1C79 A;  4P1C C;  1YQ4 B;  4DWF A;  2YVC A;  4XWT A;  1C77 A;  3A4S C;  4MGI E;  4LNF A;  5JH5 C;  1WWT A;  5AEK B;  1OFF A;  1V49 A;  4W9K A;  2MLB A;  4M8M A;  2XK5 A;  1D5Z C;  2MEK A;  4KIK B;  4PS7 A;  4K7S A;  3TEW A;  3IG3 A;  5IP4 D;  3PRM B;  1KH0 A;  3PT2 B;  3VR9 B;  1PYW D;  3BY4 B;  2JYE A;  2Y5C A;  1ZDX A;  2V4L A;  2KWD A;  2RSU A;  1B9R A;  1DGJ A;  3B1L X;  2RPV A;  2LVQ A;  2GI9 A;  3NUH B;  3PS6 A;  4AS1 A;  4JPS A;  3AE1 B;  1CQV A; 
#chains in the Genus database with same CATH homology
 3PO0 A;  2DYO A;  2M0A A;  1HZ5 A;  2E6X A;  2JWU A;  3AEC B;  4L1B A;  2INP E;  1DOX A;  5MPO A;  3LB8 C;  4HRS A;  4H2A A;  1RWS A;  2IGH A;  1SE2 A;  3VQI A;  2MH7 A;  4WWM A;  4US9 A;  5D7G A;  2WS3 B;  1WXQ A;  4MT5 A;  2WU2 B;  5HHD G;  1T3Q A;  3E9S A;  3AN1 A;  4J3O D;  2W55 A;  1IGD A;  1K53 A;  1NYQ A;  1PFD A;  3O13 A;  1FIQ A;  4LK0 M;  4XDC A;  3DWM A;  3RFZ B;  2WXG A;  1GT8 A;  1GB1 A;  4ZOH C;  2BB5 A;  1L6U A;  3NVW A;  4MAC A;  2ONQ A;  4R3D A;  2NMQ A;  2ZW1 A;  1F2R C;  1C78 A;  1TJE A;  1N63 A;  1TYG B;  3PZ7 A;  5E6J A;  3AE7 B;  2WP9 B;  3U7Z A;  1F77 A;  1OQR A;  3BVG A;  2KAJ A;  2JSV X;  2KAC A;  2IDY A;  1E10 A;  3KWL A;  3U52 E;  1SF0 A;  1IBX A;  2KN4 A;  1VZ7 A;  2TSS A;  5D3D A;  1KF6 B;  1KLU D;  2INN E;  2JX5 A;  1EU4 A;  3E56 A;  3AEF B;  1V1P A;  1XLP A;  2DBY A;  5D3I B;  1QF6 A;  1RM6 C;  1FXA A;  1ROE A;  1VJK A;  1J7A A;  5GXG B;  3BWU D;  4OZA A;  1WSP A;  2Q5W D;  3R2I A;  1CK1 A;  4TSS A;  3Q8E A;  1FRD A;  3Q69 A;  1LO5 D;  5FKA C;  2HDE A;  1P7E A;  2KQ4 X;  4XDD A;  2V3N A;  5BYS A;  4AQ7 A;  2FE8 A;  4YXD B;  1VZ6 A;  3FAH A;  2LFI A;  3H8H A;  1GB4 A;  4YT0 B;  4UDU C;  4RH6 A;  3AE3 B;  5HI1 A;  1PUT A;  1FMA D;  2CJO A;  2PVO D;  4GLS C;  4L2Y A;  5H8Y E;  5I4D A;  3R8B A;  2BB6 A;  1T6B X;  4ARC A;  4HJG E;  2BS3 B;  2MJE A;  3Q8A A;  3AB5 A;  4REZ A;  1UUP A;  2DWQ A;  4WH4 A;  3N9Y C;  2PLP A;  3NZ3 A;  4YSX B;  1FXI A;  1C76 A;  2MJD A;  2J53 A;  4FXC A;  1N62 A;  1XCT L;  3B2G A;  1I4Q A;  1PDX A;  4KKJ A;  2N0S B;  2AX5 A;  2GRI A;  3P42 A;  2IJ0 A;  1QKZ A;  3AMZ A;  4DXG A;  3IT4 B;  1ESF A;  2OED A;  4ARI A;  2LMC A;  1NYR A;  3GS2 A;  5JXV A;  2WXK A;  1BUI C;  1GOZ A;  2VZK B;  3W9C B;  2N9K A;  5H92 C;  1JQ4 A;  1KTK A;  3NS1 A;  1JWS D;  1SB3 C;  1QOB A;  1NVI D;  1B1Z A;  2K22 A;  3BYY B;  4OZC A;  2PKO A;  4YSY B;  2WDR B;  3BK1 A;  3ZQ4 A;  3HVD A;  1NEN B;  4CQN A;  4O1N A;  3U2S C;  1T5X D;  3V3X A;  4GDK B;  2BS2 B;  3ETR A;  1R7S A;  4OW0 A;  1I4R A;  1SBB B;  1VDV A;  1VR9 A;  3EA6 A;  4XE0 A;  4RGN A;  2G1E A;  1K51 A;  1PGX A;  1NI3 A;  1XEE A;  1ZPS A;  3P4S B;  1L5P A;  5HG2 A;  5T8I A;  1E6E B;  3WCQ A;  1SE3 A;  4C56 C;  2LUM A;  1L4Z B;  1D5X C;  3NRZ A;  1QIL A;  1RFK A;  5EE3 A;  1EWY C;  1ZUD 2;  2RDG A;  3ZGZ A;  4N6E B;  2QJL A;  1V8C A;  5BYR A;  4N59 A;  4A90 A;  1MPE A;  1ENF A;  1MHH E;  2NTT A;  4M0W A;  1F2R I;  3MFG A;  4JX1 C;  4HKQ A;  4US8 A;  3TSS A;  1QT9 A;  4P16 A;  1GPX A;  2LJI A;  1L0Y B;  3L4P A;  1V1O A;  4NJC A;  1ZXH A;  4JE3 B;  2ACZ B;  4OVZ A;  1MHX A;  5G5H A;  5EE0 A;  2EKI A;  1K50 A;  2WXP A;  4KKI A;  1D5M C;  1YJJ A;  1XLO A;  1JWU D;  2WXH A;  2YEP F;  4A55 A;  1GTE A;  1L6V A;  2QIE B;  3AH7 A;  4RCO A;  3EUB 2;  3AE4 B;  3W1S A;  2JZP A;  2L52 A;  3AM9 A;  1WYG A;  2X38 A;  3T3O A;  2BBC A;  1PGB A;  1SXT A;  4ZHO A;  4HKZ E;  2NTS A;  2PW9 A;  1JWA D;  2AQ1 B;  5G5G A;  2WNM A;  1XXG A;  2WXM A;  2CU3 A;  3B9J A;  1SJE D;  4WAF A;  1TY2 A;  1Y56 A;  1MI0 A;  2W54 A;  5FR3 A;  2M19 A;  1FFU A;  1TZO A;  1TKE A;  3EGR A;  1JRP A;  1E0Z A;  2RDH A;  1C4A A;  2J52 A;  2LGI A;  4IOI E;  1VLB A;  1XF5 L;  1OQQ A;  4KGS A;  1XCQ L;  1SE4 A;  1N5W A;  2RMM A;  4ZRQ A;  1QOF A;  1WRI A;  4YTP B;  4DQO C;  1FNV A;  3NVY A;  1WGK A;  5LNK 1;  1YN3 A;  1YQ3 B;  1H7X A;  1H7W A;  3AE2 B;  3FC4 A;  3W5U B;  3V05 A;  1PGA A;  1DYQ A;  2LHD A;  1FD6 A;  3I9V 1;  3P4Q B;  2OHF A;  2XNA C;  2CJN A;  2W3S A;  4NZL B;  2IPK D;  1AWD A;  1CJE A;  2WXN A;  2IGD A;  2PTL A;  2MJ3 A;  1JWB D;  2R61 A;  3C8Y A;  3ZJU A;  2WXF A;  2I38 A;  1IBX B;  4C7Z A;  4D2K A;  1EM7 A;  2K5P A;  3HRD D;  3NVZ A;  1J7B A;  1YN4 A;  4HRO A;  1C9F A;  2BTE A;  2WDQ B;  4USA A;  4RGM A;  3BYT B;  2GB1 A;  3AEA B;  3FIL A;  3Q8F A;  4WQM A;  3SFD B;  1N60 A;  1IUE A;  3P63 A;  1ZE3 D;  3GP7 A;  2PIA A;  3W2D A;  3TUO A;  1KLG D;  4L23 A;  3AED B;  3CF4 A;  4C80 A;  3VR8 B;  2KMM A;  3CWI A;  3ZJT A;  4ITK A;  3AE9 B;  1JW9 D;  3IAM 1;  2ZW0 A;  3T3N A;  4TQ0 A;  1FM0 D;  1TS2 A;  3KQ4 A;  5EE1 A;  3BK2 A;  1L4D B;  1AW7 A;  2EEL A;  4RNA A;  1ACC A;  1J7C A;  1FRR A;  4YTN B;  1SSN A;  1MVK A;  3RPF C;  1FCC C;  1UGJ A;  1AN8 A;  2L32 A;  2WXL A;  3GB1 A;  2G9H D;  1ZXI A;  3AV8 A;  2AQ2 B;  4ZHP A;  2BYT A;  1JWM D;  4B0M A;  1QLB B;  3SR6 A;  4NAW B;  3BVM A;  4B0E A;  2BT6 A;  3ABV B;  1SJH D;  4KX6 B;  3VRA B;  3AEB B;  1I4H A;  2LEK A;  4KGT A;  1TKG A;  1I4X A;  1A70 A;  1M4V A;  3SEB A;  4A8X C;  1XLQ A;  1P7F A;  3P4P B;  3MP9 A;  1L0V B;  1UWM A;  3BII D;  1I4G A;  2V0G A;  3U4E G;  2FUG 1;  4N58 A;  5AUI A;  1FFV A;  2QSD A;  2JXT A;  1FNU A;  2PMV A;  2BS4 B;  3TEZ A;  3AEG B;  2WXQ A;  2V3P A;  1TS4 A;  3BVZ A;  1FEH A;  1HXY D;  3TEX A;  4NAM A;  1F0Z A;  1GTH A;  4TQ1 A;  2HTM E;  2W3R A;  3AE8 B;  4RFB A;  2FBW B;  1SEB D;  4DXF A;  4C7Y A;  3CIR B;  4XWW A;  2K0P A;  1VZ8 A;  3OWE B;  4YTM B;  4A9A A;  4KGR A;  5BMI A;  1JRO A;  3AEE B;  2E3T A;  3UI3 A;  4YSZ B;  1N5X A;  2W82 A;  1FNW A;  2DYM A;  2PVG C;  5FK9 C;  3W5V B;  1SIJ A;  4PT5 A;  1ZOY B;  2Y3A A;  2QEJ C;  4LTU A;  2H88 B;  2AQ3 B;  3I57 A;  1ZDV A;  2KDM A;  2SAK A;  1JAL A;  4RGT A;  4EE2 A;  1EWC A;  2VZK D;  1KRH A;  3DWG C;  1V1P B;  2JU6 X;  3J9C A;  1FCL A;  5BMG A;  1E7P B;  3AE5 B;  1EU3 A;  2WXR A;  3Q8B A;  2LHE A;  1HA5 A;  2ON8 A;  3Q8C A;  4IKG A;  1HEZ E;  1K52 A;  3P4R B;  1I4P A;  3IAS 1;  1GAQ B;  1QOA A;  1C4C A;  1N61 A;  3KWV A;  3VRB B;  1FO4 A;  4LLG M;  2WXO A;  3LXF A;  2J42 A;  4OHJ A;  4Q2J A;  3ZYY X;  3BZD B;  3MJ5 A;  1VRA B;  2H89 B;  1HQR D;  2YEP B;  2Z8L A;  3R2T A;  5AUK A;  2DLB A;  5BMH A;  1BXT A;  3TEY A;  1UNS A;  3HVZ A;  2WU5 B;  5C3J B;  3IT6 B;  4WUR A;  2QIL A;  2IGG A;  1TY0 A;  1DOI A;  4MM3 B;  5HFY A;  2N7J A;  1L0X B;  1XO3 A;  1STE A;  2XN9 C;  2ICI A;  1ZP0 B;  4RGO S;  4ZYS A;  1C4P A;  2I2Y A;  1TS5 A;  3PZ8 A;  1YNT E;  1RYJ A;  4ZRP A;  1YMH E;  4RF1 A;  4RF0 A;  1QQR A;  1BML C;  1D4B A;  3SFE B;  2L83 A;  2WLB A;  3MHZ A;  1I7H A;  4JWS C;  2WXI A;  4OZB A;  4P6V F;  4GDL B;  2JQR B;  5BYQ A;  3KLS X;  2K9X A;  1XLN A;  1NEK B;  1IGC A;  2B76 B;  3URY A;  2BW2 A;  1CZP A;  2L1A A;  3B2F A;  1C79 A;  1QOG A;  2J4X A;  3NVV A;  1E9M A;  4WIP A;  1V97 A;  1KFY B;  3FIL B;  1YQ4 B;  3ZJV A;  2N9L A;  4XWT A;  1C77 A;  4MH8 A;  2K3U A;  3MC0 B;  2WXJ A;  2D5G A;  1TKY A;  1Q10 A;  4IDI A;  4YWG G;  4TMA B;  1WWT A;  4JWU C;  1ET9 A;  1OFF A;  3LYY A;  1AYF A;  3P1M A;  2JYT A;  1D5Z C;  2MEK A;  2QMT A;  1UWX A;  5EE9 A;  2WQY B;  1TS3 A;  3TEW A;  1JML A;  1KH0 A;  2V4I B;  3AE6 B;  2SEB D;  5C2T B;  3VR9 B;  1PYW D;  2M56 B;  1D6E C;  3IXS A;  2JYE A;  4HEA 1;  2Y5C A;  1ZDX A;  2WDV B;  1YN5 A;  2KWD A;  1B9R A;  1DGJ A;  1HZ6 A;  2RPV A;  3HUI A;  2Y5P A;  1YJI A;  5TSS A;  1ET6 A;  2GI9 A;  3NUH B;  4AS1 A;  1DOY A;  4JPS A;  3AE1 B;  1CQV A;  1JCK B;  4A6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...