2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
2G1EA 1N62A 4A9AA 3ABVB 1DOXA 1RFKA 1E10A 1L6VA 4US9A 3HUIA 1J7BA 1QOGA 1N60A 1T3QA 3AE1B 2DBYA 2N0SB 2K22A 3AE8B 1CJEA 1QOAA 5MPOA 3LB8C 1ZOYB 1F0ZA 1R7SA 1XLNA 4ITKA 1VJKA 3W5VB 5C2TB 1GTEA 4YTPB 1J7AA 1YQ4B 2M19A 1CZPA 1TYGB 1FM0D 1QT9A 4YSXB 4ZOHC 1NENB 1E7PB 1QOBA 1YJIA 3NVVA 3P1MA 2W3SA 2WQYB 3RPFC 1SF0A 3CF4A 5GXGB 1QF6A 1KF6B 1JALA 2L83A 3AM9A 2QIEB 1JW9D 2W55A 1WXQA 4WWMA 3CIRB 5AUKA 1JQ4A 4YSZB 4C7ZA 2JQRB 2BS3B 2AX5A 3CWIA 4N6EB 4US8A 1NYRA 2LEKA 4C7YA 1FO4A 2Q5WD 3P4PB 3AE3B 3AMZA 3VR8B 1NEKB 1YQ3B 2WLBA 1WYGA 1YJJA 1E0ZA 3AEAB 2W54A 1ROEA 2KAJA 1WGKA 3AE7B 3NVWA 1UWMA 3NRZA 3P4QB 3VRBB 2WP9B 4N58A 1FFUA 2QJLA 4FXCA 3SFEB 2OHFA 5H92C 3P63A 3L4PA 4LTUA 2WDQB 3AEGB 1EWYC 3BIID 1FRDA 4N59A 3AV8A 3FAHA 1N63A 1V8CA 2WDRB 3AE4B 3VR9B 2CJNA 2KMMA 3ZYYX 4YSYB 1L0VB 1AWDA 1L6UA 2M56B 4JWSC 5EE9A 1TKYA 1JWBD 4YT0B 2L52A 5EE3A 3SFDB 4YXDB 5C3JB 1DOIA 1QLBB 2E3TA 3WCQA 4P6VF 1N5WA 2CU3A 1XLQA 3NVYA 4YTMB 4JWUC 4ZHOA 4HRSA 1NI3A 1FIQA 2H89B 2B76B 2WU2B 1J7CA 1N61A 1PFDA 3FC4A 1KRHA 1A70A 3NS1A 3AECB 1GPXA 1AYFA 2JX5A 3AEDB 1E9MA 3PO0A 3B2FA 1WWTA 5EE0A 3AN1A 2WU5B 2BT6A 1QOFA 3HVZA 5H8YE 1IUEA 1XO3A 1PDXA 2EKIA 3ETRA 3NVZA 3VRAB 1I7HA 1SIJA 1ZUD2 1XLOA 2DWQA 3AEBB 3AE9B 3AEEB 3HRDD 2WS3B 1SB3C 1TJEA 1RWSA 1TKGA 1PUTA 1WRIA 1OQRA 1JROA 3AEFB 2CJOA 3AH7A 1E6EB 2PVGC 1H7XA 2PVOD 3DWGC 4KX6B 2ACZB 2BS4B 1JRPA 1FMAD 2MJ3A 1ZP0B 3AB5A 1N5XA 1TKEA 5G5GA 2PKOA 1VLBA 2MH7A 3AE6B 2K5PA 2PIAA 1FFVA 2Y5CA 4WQMA 1ZXIA 4USAA 5G5HA 4C80A 3LXFA 3AE5B 1FXAA 1V97A 2BS2B 2FBWB 4IDIA 1B9RA 1RYJA 2H88B 1L5PA 3W5UB 1GTHA 3P4RB 2HTME 2K9XA 4ZHPA 1JWAD 1FXIA 3DWMA 1FRRA 1OFFA 5AUIA 3SR6A 1KFYB 2WDVB 1GT8A 1RM6C 3EUB2 4HROA 1H7WA 1VDVA 2MJDA 2MJEA 3KWLA 1NVID 3AE2B 1NYQA 1DGJA 3W9CB 4YTNB 1OQQA 1GAQB 3B2GA 3P4SB 2W3RA 3B9JA 1XLPA 5EE1A 1DOYA 4JX1C
chains in the Genus database with same CATH superfamily
2UU7A 1L2NA 5CHVC 2IO3B 4US9A 3ZNZB 2J4XA 1GNUA 2VZKD 3EC8A 3OJ4B 5BO4B 1TYGB 1D5ZC 4GU2A 4OHJA 1RRBA 1WI0A 1WMHA 3P1MA 4WJNA 4WQOB 2L83A 4PK1A 2MBEA 3AU4A 2W55A 4TSSA 2LUEA 2BS3B 2MWSB 5TSSA 3AE3B 4KKIA 2ZPNA 3CSTA 1E0ZA 4J6IA 2CS4A 3Q8FA 4EKUA 3AXCA 2CKHB 2JRHA 3U8ZA 1I4XA 4N59A 2HD5B 4ZRQA 2RPVA 3ZYYX 5DPRA 3GE3C 1TKYA 2NTSA 2KN4A 2W82A 2K1FA 4XDCA 4WAAA 4P6VF 4GDLA 3DQVA 2BVCA 1PFDA 1J8CA 2EKEC 1KRHA 1A70A 1SEBD 1GPXA 3HM3A 1RLFA 1Q5WB 4MM3A 3RNCC 2DWQA 2X38A 2QEJC 4LJPB 4L2YA 1TS4A 1WRIA 3A4RA 2GBRA 2PE6B 2WXGA 2LFIA 2REXA 2GMIC 2ASQA 1VLBA 2VZKB 2LD9A 4GGQA 4C80A 3TL5A 3PTFC 3HM6X 2FBWB 4KGRA 4IDIA 1KLVA 1RYJA 5D7GA 4W9GA 2HTME 4ZHPA 5D6JB 2V0GA 1SBBB 1V1PA 1PGBA 2QMTA 3MHSD 2KJHB 3AE2B 3B2GA 1ET6A 1N62A 3IAM1 4HCPB 1RFKA 4W9CA 1J7BA 1QOGA 4ASWC 1WE6A 1ZOYB 2L76A 1R7SA 3UQBA 1WGHA 1YQBA 3APFA 2KXJA 4NAWB 1FM0D 1PQSA 3RT3B 2NTTA 3PREA 2AX5A 2KDFB 3E56A 2M8SA 4C4VA 1E7VA 4C4VB 2KMAA 3VFKA 3NVWA 2MHJA 1ZPSA 4OW0A 5C1ZA 1EWYC 4XZ4A 1FRDA 1V8CA 1C9FA 3WALA 2LZ6A 3WCQA 2K25A 3H7PB 2KX3A 2H89B 2B76B 2NBVB 1LXDA 2JSVX 3Q3JA 2LJIA 3U2SC 2L00B 3WANA 1P7FA 2FIFA 1SIJA 2WGSA 1FCLA 3DPDA 5KHOA 4WIPA 3Q3MC 3WAPA 3QA8A 4B9KA 4A6QA 3ZDTA 1SJHD 2RGFA 4FN2A 3BVMA 5FR6A 2LRUA 5JHAA 3A4SC 3T3NA 5G5HA 2J0KA 2BS2B 2MP2A 3QIJA 4LNNA 1IP9A 1B9RA 4D2KA 3VDZA 1FXIA 4W9IA 5IAAC 3R2IA 3SR6A 4AUQC 2KQSA 3EUB2 4FADA 3UQAA 3P2BA 1IYFA 1EF1A 3KH0A 2AQ2B 1HA5A 4K7SA 3H9DA 2K6QA 2M1MA 2ZW1A 3MTNB 3AE8B 3HVDA 2DX5B 1D6EC 1NENB 1YJIA 1MHXA 2WQYB 3RPFC 2WXNA 4ICVA 4MGIE 1QF6A 4F1SA 1L0XB 1EM7A 4YWGG 4GDKB 3PT2B 1FPYA 1VR9A 4GOCA 1VZ8A 2KWUB 3P4QB 4FJVB 4WWNA 1VRAB 4JPSA 3K9OB 2LGXA 1EWCA 3FILB 2KC2A 3GB1A 2WXFA 2KWVB 2L52A 3X23A 2LXCA 2KDBA 1TS3A 2N1WA 3V62A 3A9KA 1R4MI 3UF8A 5CX3A 5IA7A 2ZPYA 1WM3A 3MP9A 4ICUA 3NG0A 3IBEA 1WMHB 4LNOA 1WXMA 3Q8BA 4DQOC 2FCMA 3AEFB 2G45B 3L0WB 2GI9A 2PVGC 4LJOB 3B08A 3NZSA 1WFYA 2MJ3A 2DNFA 4PYUA 2G4DB 2GRIA 2BBCA 3AE5B 5C23A 1V97A 1CMXB 3Q3NC 2PTLA 5JZEB 4IW0A 1F9JA 1BUIC 2LHEA 4JLCA 2KTFA 3P4SB 1CQVA 3IAS1 2KVRA 5MPOA 3ABVB 4NY0A 1R4NI 3V3XA 4EEWA 3L17A 3NJTA 2K22A 1QOAA 3SU8X 4LNKA 2R2OA 2Y5BB 4DWFA 4JIOU 2LMCA 2CHWA 2NBWB 2CR5A 3JSVB 4RF0A 5DPTA 4US8A 2I1JA 5E6JA 1NEKB 2DLBA 4KGTA 1YOVB 3TSSA 5AZHA 2OHFA 2C7NB 1WX8A 1P98A 1I42A 1KJTA 4NJ6A 1N63A 1XCTL 3VR9B 3CF6E 4EZLA 3QARA 1ET9A 2KDMA 3V05A 4BKGA 1TS2A 2J53A 4DDID 5IOIA 2C7HA 1MJDA 1XLQA 1KH0A 1WZ0A 3FC4A 3VTUA 3IT6B 1AYFA 3PO0A 1WE7A 2MW5A 2BT6A 3KUZA 3ZQ4A 3HRDD 1LO5D 1EF5A 1JRUA 4HK2A 2KMCA 2R2QA 3H7PA 3OG5A 2JWZA 4HDOA 4AP4C 4EOYA 1KLGD 4USAA 2PEAA 2Y5CA 5DPSA 4F7ZA 1H4RA 3C0RB 1FRRA 2GB1A 2MRPA 3V6EB 2MJDA 3KWLA 4C56C 1E5WA 4YTNB 2AYOB 2IGGA 3J9CA 2JVCA 2GBKA 3B1LX 1ZDXA 4NQLB 1E8WA 2O2VB 2WXRA 2VH2A 1ZE3D 1GOZA 1LGRA 2ONQA 2K8BA 3A9JB 4WURA 4K7WA 1K8RB 1NDDA 1QOBA 3L54A 4RGNA 1UBQA 1BT0A 2C7MB 4ZYNA 4XYCA 5TR5A 5I4DA 2INCC 2KWDA 2N4FA 2M17A 3AEAB 2WYQA 2W9NA 4MJSA 5JH5C 3HHMA 3L4PA 1AN8A 5D94A 4MSMB 3VH4B 5IP4D 5JHBA 2AL6A 3R2TA 1P9DU 2KLGA 2WDRB 3AE4B 5LLIA 1DYQA 2ZCBA 4YT0B 2DZIA 4FJYA 2WNMA 1JCKB 1M94A 1XT9B 2Z0EB 2BKFA 2GOWA 4HKQA 4MSQB 3H7SA 2L0FA 3AEEB 4GXBA 3TJPA 3A1QB 4LDTB 2ON8A 3DWGC 2KN5A 4GB9A 3TUOA 2BYTA 1WF9A 2AQ3B 2KDIA 4RCOA 4GLSC 2BGFA 3T3OA 1FXAA 3A9JA 4IC7B 2H88B 4EFOA 3ZTDA 3DWMA 3GP7A 5GMVA 1VZ7A 1HTQA 1VDVA 4GIVA 1C4PA 2LRWA 2HJ8A 3I63C 1YNTE 2N9KA 2VH1A 1HEZE 1EU4A 2G1EA 4ZRKA 2R61A 3DBHI 3HUIA 3BVZA 3VUYA 2WDTB 3RNAC 4G11A 1J7AA 2KLCA 4NAWA 2YLMA 2LGSA 4AJYB 2ZVNA 1SF0A 2KQ4X 3MC9A 4RM8A 1KF6B 3AM9A 1MG4A 3QJZA 1WJ6A 1WIAA 4ANXA 2JYEA 3RZFA 4DXGA 1V5TA 2WP9B 4N58A 2WXQA 3L13A 3EFUA 1XD3B 2KJ6A 4WWOA 1FNVA 1GB4A 3T8MA 4KZ0A 5E6PA 4HJKA 2G9HD 1QKZA 3IHPC 4LDTD 2INNE 4XE0A 3RYTA 1E8YA 2J7QB 2ZEQA 4KVGB 1ISNA 1F52A 1MG8A 2LUMA 2QILA 4M02A 1E9MA 3APCA 4WH4A 4RH6A 1XO3A 3PRPB 2L0TA 1ZUD2 1N6ZA 3TEYA 1JROA 1RAXA 2CHXA 3W1SA 4J3OD 1Q0WB 4PS8A 3S2AA 2JZZA 2ZZPB 2TSSA 4TV3A 3QK0A 2K8CA 3AE6B 3Q8CA 4WQMA 3E9SA 2CU1A 4P16A 1J0GA 4A90A 3W1YA 3VXWA 2D5GA 3ZJTA 4OZAA 5DPWA 1XF5L 4NAMA 1KFYB 3KQ4A 2MJEA 3ZKJC 3ZDMC 3LYYA 3W9CB 1ZXHA 3N1XC 1GUAB 5EE1A 3ZUNA 1K50A 4JX1C 3R7QA 1N60A 1SE4A 4BKSA 4OVVA 2JZPA 2KX0A 4YL8A 1I4GA 2M4NA 2XEWA 3PS6A 3DVNV 2KC1A 5GXGB 3DVNU 5L83A 1WJUA 2WWZA 3ALBA 1WYWB 3X0WA 1LQBA 1FO4A 3P4PB 4NZLB 1UUPA 3ZXVA 3DHHC 5AZFA 3BK2A 4TQ1A 4NJ7A 4ZRIA 1V49A 1FFUA 4NJCA 4K7UA 1TGZB 1TY0A 4OVUA 2KKCA 2XNAC 2LVPA 2FCSA 1T6BX 4YXDB 1V86A 3BZDB 1V81A 3ML8A 3EGRA 2ZCCA 1ACCA 3N9YC 2A4ZA 3RNBC 2DYMA 3RMKC 1ZW7A 3VRAB 4E74A 4WJPA 3VH3B 1IBXA 2DYOA 3V60A 5BMHA 1YN3A 3HK0A 4R3DA 1UELA 2BPSA 2GBNA 2Y5PA 3AB5A 3VUWA 2PE9A 2LI5A 2NVUI 4NQKE 2WX0A 2LWPA 1YJ1A 4IWQA 1WR6E 1YN4A 3KUDB 2IYDB 2N7JA 1GTHA 1X1MA 5AUIA 1UD7A 1CK1A 1WXVA 2J0JA 1E8ZA 3U30A 2RR9A 5HHDG 1XXGA 1IPGA 5L95C 1Y56A 4GDLB 2FE8A 2JWUA 3HIZA 2IDYA 1XLNA 4IOIE 3TEXA 4RGMA 2NPTA 1SGHA 4EUTA 1I4PA 4YTPB 3RUIB 4MM3B 1TIFA 5D3IB 1NBFC 3UI3A 5LNK1 1I4RA 4PT5A 3KW5B 5HG2A 5LXHA 1C4AA 3OLMD 2KNBA 3TBLD 4C00A 1HZ5A 2HJ1A 2KAJA 4P1CC 3NHEB 4W9EA 3AULA 4KIKA 2GBMA 5G2NA 4LTUA 1WM2A 2JPHA 3SEBA 3DBLB 3WIMA 3ENEA 2DENB 2ZW0A 2QDFA 5CHFA 4TQ0A 1MPEA 1QILA 1K51A 3DVGX 3LDZE 1DOIA 3DCGA 2WU2B 5IKCM 2C60A 4BBNC 3NS1A 4RMAA 2IO1B 2LHDA 2WU5B 2BTEA 1KOTA 2N9XA 3VVWB 2FNJB 2Z8LA 4CQNA 4EZKA 4URKA 4II3B 1R4NB 1SE9A 4DHZE 2PVOD 2BS4B 3H1UA 1IGDA 3RNEC 4RF1A 4BVUC 4ANWA 2KYWA 1SIFA 3VHTC 2BQQA 2D3AA 3KYDD 4L23A 3Q8AA 3AU5A 2IGHA 2ZJDA 2M0XA 3FILA 2IPKD 1M4VA 2MEKA 4AQ7A 2W3RA 3B9JA 2JYTA 3SD5A 1TY2A 4ARIA 2KFJA 3PLVA 4RNAA 2WXLA 2BB5A 1FEHA 2PW9A 4L1BA 1VJKA 3W5VB 2LGYA 4ZYSA 4MELA 3GZNB 2WX1A 1TBEA 4MEMA 3CF4A 4FHKA 2KO3A 1OTRB 3M95A 3PSEB 4XC2A 2K8HA 2WLBA 2NCNA 2J0MA 2O2VA 2KTRB 4K81A 2FIDA 3VRBB 5G55A 1P7EA 3NY5A 3BVGA 2WDQB 3QX1A 3Q8EA 2IBIB 1JWUD 3L16A 4KKJA 1HTOA 5LXIB 1L4DB 4JWSC 2Z0DB 1JWSD 5AEKB 2FCQA 3PHWB 2MLBA 4IM0A 2N1VA 3PZDA 2D11A 1J7CA 4WAFA 4KIKB 2DHZA 1UGJA 4A3PA 3AEDB 3PGEA 1WH3A 1IUEA 3ETRA 1I7HA 3AEBB 1SB3C 1OQRA 2QC8A 2NMQA 4HVBA 2CJOA 3VQIA 1V9JA 3JYUA 1P3QU 4IG7B 4I6NB 2YEPB 3NZUA 3QWZB 4IM2A 3A9KB 3O65B 3BWUD 3PLUA 1OGWA 3TMPB 4MH8A 3P4RB 3R7RA 1OFFA 4FLHA 4JE3B 4BFRA 1UF0A 2KZRA 1NYQA 1FD6A 5BYSA 1ZKHA 4NNJB 1FNWA 1EU3A 3TCAA 2MA9B 2J52A 2KTRA 4HPMB 2XN9C 2JXTA 1XQQA 4AWJA 4DDGD 3ONSA 2BWFA 3NVVA 5E6OA 4KSKC 3IXSA 3V6CB 4MDKE 2KT7A 1C3TA 1XEEA 3OWEB 3N30A 2AL3A 3IG3A 2LGIA 2W54A 3IVFA 2M0AA 1WY8A 3APDA 3CSFA 4F8CB 3BK1A 1QQRA 3KUCB 4PS7A 2RMMA 3WAOA 1YX6B 2CJNA 1OEYA 4LK0M 4MGZE 1JWBD 1Z5SB 1SSNA 1VZ6A 2UYZB 1C77A 2LVOA 4YTMB 4ZHOA 3PZ8A 4WJQA 5DCNA 1YIWA 3LJ3A 4II2B 3B2FA 4W9LA 2RSUA 1Q1OA 3ZVVA 3NUHB 4M0WA 1RWSA 4HWIB 2DZJA 4I6LB 1EO6A 2RDGA 3NS8A 1HZ6A 1D4BA 1YD8U 2ACZB 1JRPA 1FMAD 1ZP0B 5G5GA 2K5PA 5FKAC 2FUHB 4X57B 3LXFA 5CHWA 4KSLC 3W5UB 3DBRB 4G0NB 2K6DB 4P7IA 1I4HA 1GT8A 4P1BC 2KFKA 4W9KA 3W1SC 3WAMA 1PYWD 4MH0E 3BYTB 3U7DA 1E90A 1D5MC 1HXYD 1ZDVA 2L32A 2E6XA 2WXJA 3PZ7A 1T3QA 4WJOA 1CJEA 2GBJA 2DZMA 3V61A 3Q69A 2NPTB 1L4ZB 2M19A 5IO9A 5HI1A 2QCZA 2JUOA 5EDSA 3A1QA 2QIEB 1C76A 1WXQA 4YSZB 3CWIA 2WXIA 4A20A 4HCNB 3EFCA 2RPQA 2Z59B 1YQ3B 2ZVOA 3AE7B 1UWMA 1I35A 1MI0A 3BY4B 3W2DA 2QJLA 4FXCA 4B6WA 5IN7A 1Q10A 3P63A 5H92C 4KZCA 1S1QB 1V1PB 3AEGB 2LGDA 4B0MA 3Q14C 3PRZA 5FK9C 1NI2A 3KYCD 2B3AA 3AI5A 2V3NA 1VCBA 3GS2A 2E3TA 5D3DA 1TZOA 2K0PA 2DAJA 3OJ3A 4BKSD 4GN1A 4MJSB 4MGYE 3AECB 2PLPA 2MBOA 1WWTA 2WXMA 4B0EA 2V3PA 3N1ZC 3UINB 2EKIA 3PPAA 3MC8A 1TZ1A 4FA6A 3QC8B 3N1YC 3KLSX 1E6EB 4ZDVA 2SEBD 2VRRB 4BOZB 2PKOA 3ZGZA 1GG3A 2BYEA 4S0RA 1FFVA 1I4QA 1L0YB 1F1HA 3I57A 2AQ1B 4XDDA 4M01A 3JW0X 2INDC 3M62B 2BB6A 3N3KB 2BYVE 4CO7A 4E71A 4MGKE 4JL9A 4ZRPA 1DOXA 1WJ4A 2N9LA 4TUUA 4PYZA 3AE1B 1F77A 4LCDE 3LB8C 1F0ZA 2WHIA 2IY0B 1P1AA 5C2TB 1GTEA 4UDUC 2IZVB 2KQ7A 1FNUA 1V1OA 1E7PB 1D3ZA 2JXXA 3NZ3A 1TTNA 4FJZA 5BMGA 1UNSA 1JALA 2C5LC 2N9EB 4CHKA 3CIRB 5AUKA 4DK5A 5J17A 1KM7A 3L08A 1Z2MA 3ZTCA 3VR8B 3K9PB 3RNGC 3MHZA 2I1KA 3BYYB 1GB1A 1UZXB 3H8HA 1MHHE 3B0AA 1WXAA 3SFEB 2AEHA 2RDHA 3EECA 2RD0A 3AV8A 3FAHA 2FUG1 1JMLA 2A5UA 1YX5B 3GZNI 4EZJA 1WX7A 4GDKA 5C3JB 1K52A 1HQRD 4GSWA 4KV2A 2CU3A 1SE2A 2C9WB 4JWUC 3TIXA 1AW7A 3GE8C 3ZXRA 1UH6A 5EE0A 3AN1A 5KHQA 2EELA 1YN5A 1TJEA 1WGRA 3JSVA 3T9LA 1QZEA 2KHWB 1TT5B 4KX6B 4W9HA 1WR1A 1N5XA 4W9DA 1S3SG 4O1NA 2N7DA 2IO2B 2FAZA 1R4MB 1A5RA 2V4IB 2WDVB 2D2QA 2MBHA 1H8CA 1V80A 2O6VB 3DBRI 1XLPA 4TMAB 3ZRFA 5J18A 2V1YA 1LM8B 1UWXA 4B95A 4BBNF 4DHZB 2PJHA 4XX5A 3JVZX 3RULA 1GC7A 5T8IA 4XGAB 2OJWA 4ITKA 3P42A 1L7YA 1MVKA 1T0QC 2DAFA 1CZPA 4HJGE 1QT9A 4ZOHC 4JGHB 1F2RI 4BOSC 4A55A 2IJ0A 1JQ4A 2JQRB 4K3CA 2Q5WD 1OQYA 3L10B 1UGMA 2AWTA 3I5JC 2IO0B 2BWES 3EHVA 3BIID 3QQ8B 3TEZA 2JF5A 2KFKB 2WXKA 3MC0B 5EE9A 4DXFA 2YVCA 1V2YA 4HRSA 4IKGA 1GC6A 2WXOA 1N61A 2MBQA 4PS3A 4M8MA 3KVFB 4RGTA 1TS5A 4RM9A 4XWWA 3N32A 1KTKA 3IFWB 3CMMB 4RFBA 3UIOB 2WS3B 1TKGA 3GOEA 2KDEB 3AH7A 3RCZA 2K39A 2NR2A 4LLGM 1ESFA 2EMTA 5D2MB 3TEWA 2V3SA 2DZKA 2MH7A 3OAWA 1WGDA 3VTWA 2IY1B 2JZ3B 1L5PA 2XK5A 3C8YA 3NOBA 4S17A 3RZWC 3ZW3A 2INPE 1RM6C 2L3ZA 4LNIA 4W9FA 1DGJA 5HFYA 3DBSA 1GAQB 2YEPF 4IM3A 3EA6A 3O13A 1GJZA 4ANVA 2N7EA 1L6VA 1C78A 2OJRA 4REZA 1WJNA 2ZNVB 4OZBA 2PPHA 3ZJVA 4K1RB 1T0YA 2W3SA 4HDQA 2QSDA 1JW9D 4HPLB 4ARCA 2XBBC 2K3UA 1PGAA 3UIPB 4C7ZA 2D3BA 3IT4B 1NYRA 1RFAA 1WX9A 2N9PC 5BYQA 4DBGA 3ECIA 1WYGA 2JRIB 4IWPA 3R66C 3ML9A 4A3OA 3U7ZA 3VTVA 2SAKA 1WGGA 3Q6BA 4ZRJA 1L6UA 3DDCB 1J19A 2V9HA 4ACFA 2MCNB 4FULA 2MBBB 2KJRA 1N5WA 3UGBB 2BW2A 1NI3A 1WZ3A 1FIQA 2CHZA 3KWVA 3C19A 3HVZA 5H8YE 1EUVB 3ZNID 4LNFA 3AE9B 2ICIA 1PUTA 1YMHE 4FBJB 4DHJD 1SXTA 4W9JA 4GMVA 1LFDA 4BKTA 5HKHA 1ZXIA 1Y8RC 1ZGUB 4WWPA 3MJWA 3SDLC 5E6NA 4RGOS 1JWMD 3U52E 4E3CA 1STEA 2KOXA 4OVZA 2UWQA 2L1AA 2O6VD 4KDIC 1PGXA 1V5OA 1FCCC 4IWOA 1T5XD 1E10A 4MACA 4NPNA 1WGYA 1KLUD 2OEDA 2LASA 3DVGY 3Q2AC 1ENFA 4BZAA 4HKZE 2X8XX 2I38A 2XK5B 4OZCA 5FR3A 4AJWA 3M63B 2HE7A 3Q3FA 4M0WB 2D3CA 4WWMA 4N6EB 2LEKA 4Q2JA 2QHOA 3AMZA 5AZGA 3R3MA 3I9V1 3DHIC 1ROEA 2PMVA 3NRZA 1BXTA 2D3GA 4M00A 2JU6X 4CYEA 4DXAB 2JT4B 1G6JA 1B1ZA 2MX2A 2KACA 3PHXB 4XWTA 3ZIMA 2D07B 2BYFA 1AARA 4YSYB 1AWDA 1SJED 1E7UA 3VAWA 4DHJB 2G4SA 1VD2A 3SFDB 3ZJUA 3FKYA 2JX5A 2V4LA 1WSPA 2KK8A 1IGCA 3A33B 1XLOA 3MJ5A 2EMSA 1BMLC 1T0SC 1C4CA 2G3QB 2BF8B 1H7XA 2KWCA 2HTHA 3D32A 1C79A 1TKEA 3WA0A 3PV1A 2PIAA 3URYA 4HPPA 1OEYJ 2KANA 1V6EA 2K9XA 5BYRA 1JWAD 2KD0A 4HROA 1H7WA 5JXVA 3VUXA 2IGDA 2KVZA 2LVQA 2J42A 3QHTA 1OQQA 4G3XB 2GLSA 4EE2A 1DOYA 4A9AA 1FXTB 1C1YB 3BINA 2DBYA 2N0SB 4HXDA 3RNFC 2L8JA 4IUMB 3DBHB 1SE3A 2I2YA 2RDBC 1YQ4B 2WXPA 2LJ5A 4YSXB 3H6NA 4M8NA 4A8XC 1T0RC 5BMIA 4HEA1 2BKRB 4QAYA 2L05A 3ZO5B 4HLEA 4C7YA 1WXSA 4JQWC 1YJJA 4KGSA 1WGKA 2MP2B 1D5XC 4G50A 4H2AA 2D10A 2HDEA 2L7RA 2MSED 3QCAA 1IBXB 3DHGC 5CTRC 2KMMA 4ANUA 3M3JA 2M56B 1L0VB 2O6VA 3DBLI 3Q3OC 1U4AA 2FCNA 3RN9C 5EE3A 3R8BA 1WRDB 1QLBB 3NVYA 3I3TB 2JY6A 3ZNHB 4N9F4 4FHJA 3PRMB 2NBUA 5J2RA 3PVLA 3ZLZA 4KDLB 2OOBB 1QOFA 4I6PA 3RI7C 3NVZA 1PDXA 2DYBA 3SHQA 3U4EG 1F2RC 2NS5A 3RFZB 1P0RA 4MT5A 1K53A 1E8XA 1XCQL 3RD2A 2Y3AA 3N20C 2WXHA 4K3BA 4AS1A 2LXAA 3ZRCA 2ZNVC 4AOFA 1UBIA 3QAQA 3DOWA 1MFWA 3ZNGC 1HE8A 2MQJA 1NVID 3MFGA 4BAXA 4TKNA
chains in the Genus database with same CATH topology
1TY2A 4ARIA 1UWXA 4RNAA 4US9A 1ZDXA 2WXLA 2J4XA 2BB5A 2WXRA 2VZKD 1FEHA 1ZE3D 2PW9A 1GOZA 5T8IA 4ITKA 1VJKA 2ONQA 3P42A 4L1BA 3W5VB 4ZYSA 4WURA 1MVKA 4HJGE 1CZPA 1TYGB 1D5ZC 1QT9A 4OHJA 4ZOHC 1QOBA 3P1MA 1F2RI 3CF4A 4A55A 2IJ0A 2L83A 4RGNA 4TSSA 2W55A 1JQ4A 2JQRB 2BS3B 5I4DA 5TSSA 2KWDA 2Q5WD 3AE3B 4KKIA 2WLBA 1E0ZA 3AEAB 3Q8FA 3VRBB 1P7EA 3L4PA 1AN8A 3BVGA 2WDQB 3BIID 1I4XA 4N59A 3TEZA 3R2TA 4ZRQA 3Q8EA 2RPVA 2WDRB 3AE4B 3ZYYX 1JWUD 2WXKA 3MC0B 1DYQA 4KKJA 1L4DB 4JWSC 5EE9A 1TKYA 4DXFA 4YT0B 2NTSA 2KN4A 2W82A 4XDCA 1JWSD 4P6VF 3J9CA 2WNMA 4HRSA 1JCKB 4IKGA 2WXOA 1J7CA 1N61A 1PFDA 4WAFA 4RGTA 1TS5A 1KRHA 1UGJA 1A70A 1SEBD 1GPXA 3AEDB 4XWWA 4HKQA 1IUEA 1KTKA 3ETRA 4RFBA 1I7HA 2DWQA 2X38A 3AEBB 2QEJC 4L2YA 1TS4A 3AEEB 2WS3B 1SB3C 1TKGA 1WRIA 1OQRA 2NMQA 2CJOA 3AH7A 3VQIA 2WXGA 2LFIA 2ON8A 3DWGC 3TUOA 4LLGM 1ESFA 3TEWA 2BYTA 1VLBA 2VZKB 2YEPB 2AQ3B 2MH7A 4C80A 4GLSC 4RCOA 3BWUD 3T3OA 1FXAA 2FBWB 4KGRA 4IDIA 4MH8A 1RYJA 2H88B 1L5PA 5D7GA 3P4RB 2HTME 4ZHPA 3DWMA 2V0GA 3GP7A 3C8YA 1SBBB 1OFFA 1V1PA 1VZ7A 1PGBA 2INPE 1RM6C 2QMTA 4JE3B 1VDVA 3AE2B 1C4PA 1DGJA 1NYQA 5HFYA 1FD6A 5BYSA 1GAQB 2YEPF 3B2GA 3EA6A 3O13A 1ET6A 1YNTE 2N9KA 1HEZE 1EU4A 2G1EA 1N62A 1FNWA 1EU3A 3IAM1 2R61A 1RFKA 1L6VA 3HUIA 1C78A 1J7BA 1QOGA 3BVZA 2J52A 4REZA 1ZOYB 1R7SA 2XN9C 2JXTA 4OZBA 1J7AA 4NAWB 1FM0D 3ZJVA 3NVVA 2W3SA 3IXSA 1SF0A 2KQ4X 1KF6B 3AM9A 2NTTA 2QSDA 1JW9D 4ARCA 2K3UA 1PGAA 4C7ZA 2AX5A 3IT4B 1XEEA 3OWEB 1NYRA 3E56A 5BYQA 2JYEA 1WYGA 2LGIA 4DXGA 2W54A 3NVWA 2M0AA 2WP9B 4N58A 2WXQA 1ZPSA 4OW0A 3BK1A 3U7ZA 1FNVA 2SAKA 1EWYC 1GB4A 1QQRA 1FRDA 2RMMA 1V8CA 2CJNA 2G9HD 1QKZA 1L6UA 1C9FA 4LK0M 1JWBD 1SSNA 1VZ6A 1C77A 2INNE 4XE0A 3WCQA 1N5WA 4ZHOA 4YTMB 2BW2A 1NI3A 1FIQA 3KWVA 2H89B 2B76B 3PZ8A 2JSVX 2LUMA 2QILA 2LJIA 1E9MA 3B2FA 3U2SC 3HVZA 4WH4A 1P7FA 4RH6A 5H8YE 1XO3A 1SIJA 1ZUD2 3AE9B 3NUHB 1FCLA 2ICIA 4M0WA 3TEYA 1RWSA 4WIPA 1PUTA 1JROA 2RDGA 1HZ6A 4A6QA 1D4BA 1YMHE 3W1SA 4J3OD 1SJHD 2ACZB 1JRPA 1FMAD 2TSSA 1ZP0B 1SXTA 3BVMA 5G5GA 3AE6B 2K5PA 3Q8CA 4WQMA 5FKAC 1ZXIA 3E9SA 5G5HA 3T3NA 3LXFA 4P16A 2BS2B 4A90A 1B9RA 2D5GA 3W5UB 4RGOS 4D2KA 4OZAA 3ZJTA 1FXIA 1XF5L 1JWMD 3U52E 3R2IA 3SR6A 1STEA 4NAMA 4OVZA 1KFYB 1I4HA 1GT8A 3EUB2 3KQ4A 2MJEA 2L1AA 3LYYA 3W9CB 1ZXHA 1PYWD 3BYTB 5EE1A 1PGXA 1K50A 1D5MC 1FCCC 4JX1C 2AQ2B 1HA5A 1HXYD 1ZDVA 2L32A 1T5XD 2E6XA 1E10A 2WXJA 4MACA 3PZ7A 1KLUD 1N60A 1SE4A 1T3QA 2OEDA 2ZW1A 3AE8B 1CJEA 3HVDA 3Q69A 1ENFA 4HKZE 2I38A 1L4ZB 2JZPA 4OZCA 5FR3A 2M19A 1I4GA 1D6EC 1NENB 1YJIA 1MHXA 2WQYB 5HI1A 2WXNA 3RPFC 5GXGB 1QF6A 1L0XB 2QIEB 1C76A 1EM7A 4YWGG 1WXQA 4WWMA 4YSZB 3CWIA 2WXIA 4N6EB 4GDKB 2LEKA 4Q2JA 1FO4A 3P4PB 4NZLB 1UUPA 3AMZA 1YQ3B 3I9V1 1ROEA 3BK2A 4TQ1A 3AE7B 2PMVA 1VR9A 1UWMA 1VZ8A 1BXTA 3NRZA 3P4QB 1MI0A 3W2DA 1FFUA 1VRAB 2QJLA 4FXCA 2JU6X 4NJCA 1Q10A 3P63A 5H92C 4JPSA 1TY0A 1V1PB 3AEGB 4B0MA 1EWCA 3FILB 1B1ZA 5FK9C 2KACA 2XNAC 4XWTA 3GB1A 4YSYB 1AWDA 1SJED 2WXFA 1T6BX 2L52A 2V3NA 3GS2A 3SFDB 4YXDB 3BZDB 2E3TA 5D3DA 1TZOA 3ZJUA 2K0PA 3EGRA 1TS3A 1ACCA 3AECB 2PLPA 2JX5A 3N9YC 1WWTA 2WXMA 4B0EA 2V3PA 3MP9A 1WSPA 1IGCA 2DYMA 2EKIA 3VRAB 1XLOA 3MJ5A 1IBXA 2DYOA 3KLSX 1BMLC 3Q8BA 4DQOC 5BMHA 3AEFB 1C4CA 1E6EB 1YN3A 2GI9A 2PVGC 1H7XA 4R3DA 2SEBD 2MJ3A 1C79A 2Y5PA 3AB5A 1TKEA 2PKOA 3ZGZA 2PIAA 2GRIA 1FFVA 3URYA 1I4QA 2BBCA 1L0YB 3AE5B 1V97A 3I57A 1YN4A 2AQ1B 2N7JA 2PTLA 4XDDA 1GTHA 2K9XA 5BYRA 1JWAD 5AUIA 2BB6A 1CK1A 4HROA 1H7WA 5JXVA 2IGDA 1BUIC 2LHEA 2J42A 1OQQA 3P4SB 1CQVA 3IAS1 1DOYA 4EE2A 5HHDG 4ZRPA 4A9AA 5MPOA 3ABVB 1DOXA 1XXGA 3V3XA 1Y56A 2N9LA 4GDLB 2FE8A 3AE1B 2DBYA 1F77A 2K22A 2N0SB 1QOAA 2JWUA 3LB8C 1F0ZA 2IDYA 1XLNA 4IOIE 3TEXA 1SE3A 4RGMA 5C2TB 1GTEA 2I2YA 1I4PA 4YTPB 1YQ4B 4MM3B 2WXPA 4UDUC 2LMCA 4YSXB 5D3IB 1FNUA 1V1OA 4A8XC 1E7PB 3NZ3A 5BMGA 1UNSA 5BMIA 3UI3A 1JALA 4HEA1 5LNK1 4RF0A 1I4RA 3CIRB 4PT5A 5AUKA 4US8A 4C7YA 5E6JA 5HG2A 3VR8B 1NEKB 1C4AA 1YJJA 1HZ5A 2DLBA 4KGTA 4KGSA 2KAJA 3MHZA 1WGKA 3TSSA 3BYYB 1GB1A 3H8HA 1MHHE 1D5XC 3SFEB 2OHFA 4LTUA 2RDHA 3SEBA 2ZW0A 4H2AA 2HDEA 3AV8A 1IBXB 3FAHA 1N63A 1JMLA 2FUG1 1XCTL 2KMMA 1MPEA 3VR9B 1QILA 4TQ0A 1K51A 1ET9A 2KDMA 3V05A 2M56B 1L0VB 1TS2A 2J53A 5EE3A 3R8BA 5C3JB 1DOIA 1QLBB 1HQRD 1K52A 2CU3A 1SE2A 1XLQA 1KH0A 3NVYA 4JWUC 2WU2B 1AW7A 3FC4A 3IT6B 3NS1A 1AYFA 3PO0A 5EE0A 2LHDA 2WU5B 2BT6A 1QOFA 3AN1A 3ZQ4A 2BTEA 3NVZA 1PDXA 2EELA 3U4EG 1F2RC 2Z8LA 1YN5A 4CQNA 3RFZB 3HRDD 1TJEA 1LO5D 2PVOD 4KX6B 2BS4B 1IGDA 1K53A 4MT5A 1XCQL 1N5XA 2Y3AA 4RF1A 2WXHA 1KLGD 4USAA 2Y5CA 4O1NA 4AS1A 4L23A 3Q8AA 2IGHA 1FRRA 3FILA 2V4IB 2IPKD 2GB1A 2WDVB 1M4VA 2MJDA 3KWLA 1NVID 2MEKA 4C56C 2IGGA 4YTNB 3MFGA 4AQ7A 2W3RA 3B9JA 1XLPA 4TMAB 2JYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G1E A;  1N62 A;  4A9A A;  3ABV B;  1DOX A;  1RFK A;  1E10 A;  1L6V A;  4US9 A;  3HUI A;  1J7B A;  1QOG A;  1N60 A;  1T3Q A;  3AE1 B;  2DBY A;  2N0S B;  2K22 A;  3AE8 B;  1CJE A;  1QOA A;  5MPO A;  3LB8 C;  1ZOY B;  1F0Z A;  1R7S A;  1XLN A;  4ITK A;  1VJK A;  3W5V B;  5C2T B;  1GTE A;  4YTP B;  1J7A A;  1YQ4 B;  2M19 A;  1CZP A;  1TYG B;  1FM0 D;  1QT9 A;  4YSX B;  4ZOH C;  1NEN B;  1E7P B;  1QOB A;  1YJI A;  3NVV A;  3P1M A;  2W3S A;  2WQY B;  3RPF C;  1SF0 A;  3CF4 A;  5GXG B;  1QF6 A;  1KF6 B;  1JAL A;  2L83 A;  3AM9 A;  2QIE B;  1JW9 D;  2W55 A;  1WXQ A;  4WWM A;  3CIR B;  5AUK A;  1JQ4 A;  4YSZ B;  4C7Z A;  2JQR B;  2BS3 B;  2AX5 A;  3CWI A;  4N6E B;  4US8 A;  1NYR A;  2LEK A;  4C7Y A;  1FO4 A;  2Q5W D;  3P4P B;  3AE3 B;  3AMZ A;  3VR8 B;  1NEK B;  1YQ3 B;  2WLB A;  1WYG A;  1YJJ A;  1E0Z A;  3AEA B;  2W54 A;  1ROE A;  2KAJ A;  1WGK A;  3AE7 B;  3NVW A;  1UWM A;  3NRZ A;  3P4Q B;  3VRB B;  2WP9 B;  4N58 A;  1FFU A;  2QJL A;  4FXC A;  3SFE B;  2OHF A;  5H92 C;  3P63 A;  3L4P A;  4LTU A;  2WDQ B;  3AEG B;  1EWY C;  3BII D;  1FRD A;  4N59 A;  3AV8 A;  3FAH A;  1N63 A;  1V8C A;  2WDR B;  3AE4 B;  3VR9 B;  2CJN A;  2KMM A;  3ZYY X;  4YSY B;  1L0V B;  1AWD A;  1L6U A;  2M56 B;  4JWS C;  5EE9 A;  1TKY A;  1JWB D;  4YT0 B;  2L52 A;  5EE3 A;  3SFD B;  4YXD B;  5C3J B;  1DOI A;  1QLB B;  2E3T A;  3WCQ A;  4P6V F;  1N5W A;  2CU3 A;  1XLQ A;  3NVY A;  4YTM B;  4JWU C;  4ZHO A;  4HRS A;  1NI3 A;  1FIQ A;  2H89 B;  2B76 B;  2WU2 B;  1J7C A;  1N61 A;  1PFD A;  3FC4 A;  1KRH A;  1A70 A;  3NS1 A;  3AEC B;  1GPX A;  1AYF A;  2JX5 A;  3AED B;  1E9M A;  3PO0 A;  3B2F A;  1WWT A;  5EE0 A;  3AN1 A;  2WU5 B;  2BT6 A;  1QOF A;  3HVZ A;  5H8Y E;  1IUE A;  1XO3 A;  1PDX A;  2EKI A;  3ETR A;  3NVZ A;  3VRA B;  1I7H A;  1SIJ A;  1ZUD 2;  1XLO A;  2DWQ A;  3AEB B;  3AE9 B;  3AEE B;  3HRD D;  2WS3 B;  1SB3 C;  1TJE A;  1RWS A;  1TKG A;  1PUT A;  1WRI A;  1OQR A;  1JRO A;  3AEF B;  2CJO A;  3AH7 A;  1E6E B;  2PVG C;  1H7X A;  2PVO D;  3DWG C;  4KX6 B;  2ACZ B;  2BS4 B;  1JRP A;  1FMA D;  2MJ3 A;  1ZP0 B;  3AB5 A;  1N5X A;  1TKE A;  5G5G A;  2PKO A;  1VLB A;  2MH7 A;  3AE6 B;  2K5P A;  2PIA A;  1FFV A;  2Y5C A;  4WQM A;  1ZXI A;  4USA A;  5G5H A;  4C80 A;  3LXF A;  3AE5 B;  1FXA A;  1V97 A;  2BS2 B;  2FBW B;  4IDI A;  1B9R A;  1RYJ A;  2H88 B;  1L5P A;  3W5U B;  1GTH A;  3P4R B;  2HTM E;  2K9X A;  4ZHP A;  1JWA D;  1FXI A;  3DWM A;  1FRR A;  1OFF A;  5AUI A;  3SR6 A;  1KFY B;  2WDV B;  1GT8 A;  1RM6 C;  3EUB 2;  4HRO A;  1H7W A;  1VDV A;  2MJD A;  2MJE A;  3KWL A;  1NVI D;  3AE2 B;  1NYQ A;  1DGJ A;  3W9C B;  4YTN B;  1OQQ A;  1GAQ B;  3B2G A;  3P4S B;  2W3R A;  3B9J A;  1XLP A;  5EE1 A;  1DOY A;  4JX1 C; 
#chains in the Genus database with same CATH topology
 2UU7 A;  1L2N A;  5CHV C;  2IO3 B;  4US9 A;  3ZNZ B;  2J4X A;  1GNU A;  2VZK D;  3EC8 A;  3OJ4 B;  5BO4 B;  1TYG B;  1D5Z C;  4GU2 A;  4OHJ A;  1RRB A;  1WI0 A;  1WMH A;  3P1M A;  4WJN A;  4WQO B;  2L83 A;  4PK1 A;  2MBE A;  3AU4 A;  2W55 A;  4TSS A;  2LUE A;  2BS3 B;  2MWS B;  5TSS A;  3AE3 B;  4KKI A;  2ZPN A;  3CST A;  1E0Z A;  4J6I A;  2CS4 A;  3Q8F A;  4EKU A;  3AXC A;  2CKH B;  2JRH A;  3U8Z A;  1I4X A;  4N59 A;  2HD5 B;  4ZRQ A;  2RPV A;  3ZYY X;  5DPR A;  3GE3 C;  1TKY A;  2NTS A;  2KN4 A;  2W82 A;  2K1F A;  4XDC A;  4WAA A;  4P6V F;  4GDL A;  3DQV A;  2BVC A;  1PFD A;  1J8C A;  2EKE C;  1KRH A;  1A70 A;  1SEB D;  1GPX A;  3HM3 A;  1RLF A;  1Q5W B;  4MM3 A;  3RNC C;  2DWQ A;  2X38 A;  2QEJ C;  4LJP B;  4L2Y A;  1TS4 A;  1WRI A;  3A4R A;  2GBR A;  2PE6 B;  2WXG A;  2LFI A;  2REX A;  2GMI C;  2ASQ A;  1VLB A;  2VZK B;  2LD9 A;  4GGQ A;  4C80 A;  3TL5 A;  3PTF C;  3HM6 X;  2FBW B;  4KGR A;  4IDI A;  1KLV A;  1RYJ A;  5D7G A;  4W9G A;  2HTM E;  4ZHP A;  5D6J B;  2V0G A;  1SBB B;  1V1P A;  1PGB A;  2QMT A;  3MHS D;  2KJH B;  3AE2 B;  3B2G A;  1ET6 A;  1N62 A;  3IAM 1;  4HCP B;  1RFK A;  4W9C A;  1J7B A;  1QOG A;  4ASW C;  1WE6 A;  1ZOY B;  2L76 A;  1R7S A;  3UQB A;  1WGH A;  1YQB A;  3APF A;  2KXJ A;  4NAW B;  1FM0 D;  1PQS A;  3RT3 B;  2NTT A;  3PRE A;  2AX5 A;  2KDF B;  3E56 A;  2M8S A;  4C4V A;  1E7V A;  4C4V B;  2KMA A;  3VFK A;  3NVW A;  2MHJ A;  1ZPS A;  4OW0 A;  5C1Z A;  1EWY C;  4XZ4 A;  1FRD A;  1V8C A;  1C9F A;  3WAL A;  2LZ6 A;  3WCQ A;  2K25 A;  3H7P B;  2KX3 A;  2H89 B;  2B76 B;  2NBV B;  1LXD A;  2JSV X;  3Q3J A;  2LJI A;  3U2S C;  2L00 B;  3WAN A;  1P7F A;  2FIF A;  1SIJ A;  2WGS A;  1FCL A;  3DPD A;  5KHO A;  4WIP A;  3Q3M C;  3WAP A;  3QA8 A;  4B9K A;  4A6Q A;  3ZDT A;  1SJH D;  2RGF A;  4FN2 A;  3BVM A;  5FR6 A;  2LRU A;  5JHA A;  3A4S C;  3T3N A;  5G5H A;  2J0K A;  2BS2 B;  2MP2 A;  3QIJ A;  4LNN A;  1IP9 A;  1B9R A;  4D2K A;  3VDZ A;  1FXI A;  4W9I A;  5IAA C;  3R2I A;  3SR6 A;  4AUQ C;  2KQS A;  3EUB 2;  4FAD A;  3UQA A;  3P2B A;  1IYF A;  1EF1 A;  3KH0 A;  2AQ2 B;  1HA5 A;  4K7S A;  3H9D A;  2K6Q A;  2M1M A;  2ZW1 A;  3MTN B;  3AE8 B;  3HVD A;  2DX5 B;  1D6E C;  1NEN B;  1YJI A;  1MHX A;  2WQY B;  3RPF C;  2WXN A;  4ICV A;  4MGI E;  1QF6 A;  4F1S A;  1L0X B;  1EM7 A;  4YWG G;  4GDK B;  3PT2 B;  1FPY A;  1VR9 A;  4GOC A;  1VZ8 A;  2KWU B;  3P4Q B;  4FJV B;  4WWN A;  1VRA B;  4JPS A;  3K9O B;  2LGX A;  1EWC A;  3FIL B;  2KC2 A;  3GB1 A;  2WXF A;  2KWV B;  2L52 A;  3X23 A;  2LXC A;  2KDB A;  1TS3 A;  2N1W A;  3V62 A;  3A9K A;  1R4M I;  3UF8 A;  5CX3 A;  5IA7 A;  2ZPY A;  1WM3 A;  3MP9 A;  4ICU A;  3NG0 A;  3IBE A;  1WMH B;  4LNO A;  1WXM A;  3Q8B A;  4DQO C;  2FCM A;  3AEF B;  2G45 B;  3L0W B;  2GI9 A;  2PVG C;  4LJO B;  3B08 A;  3NZS A;  1WFY A;  2MJ3 A;  2DNF A;  4PYU A;  2G4D B;  2GRI A;  2BBC A;  3AE5 B;  5C23 A;  1V97 A;  1CMX B;  3Q3N C;  2PTL A;  5JZE B;  4IW0 A;  1F9J A;  1BUI C;  2LHE A;  4JLC A;  2KTF A;  3P4S B;  1CQV A;  3IAS 1;  2KVR A;  5MPO A;  3ABV B;  4NY0 A;  1R4N I;  3V3X A;  4EEW A;  3L17 A;  3NJT A;  2K22 A;  1QOA A;  3SU8 X;  4LNK A;  2R2O A;  2Y5B B;  4DWF A;  4JIO U;  2LMC A;  2CHW A;  2NBW B;  2CR5 A;  3JSV B;  4RF0 A;  5DPT A;  4US8 A;  2I1J A;  5E6J A;  1NEK B;  2DLB A;  4KGT A;  1YOV B;  3TSS A;  5AZH A;  2OHF A;  2C7N B;  1WX8 A;  1P98 A;  1I42 A;  1KJT A;  4NJ6 A;  1N63 A;  1XCT L;  3VR9 B;  3CF6 E;  4EZL A;  3QAR A;  1ET9 A;  2KDM A;  3V05 A;  4BKG A;  1TS2 A;  2J53 A;  4DDI D;  5IOI A;  2C7H A;  1MJD A;  1XLQ A;  1KH0 A;  1WZ0 A;  3FC4 A;  3VTU A;  3IT6 B;  1AYF A;  3PO0 A;  1WE7 A;  2MW5 A;  2BT6 A;  3KUZ A;  3ZQ4 A;  3HRD D;  1LO5 D;  1EF5 A;  1JRU A;  4HK2 A;  2KMC A;  2R2Q A;  3H7P A;  3OG5 A;  2JWZ A;  4HDO A;  4AP4 C;  4EOY A;  1KLG D;  4USA A;  2PEA A;  2Y5C A;  5DPS A;  4F7Z A;  1H4R A;  3C0R B;  1FRR A;  2GB1 A;  2MRP A;  3V6E B;  2MJD A;  3KWL A;  4C56 C;  1E5W A;  4YTN B;  2AYO B;  2IGG A;  3J9C A;  2JVC A;  2GBK A;  3B1L X;  1ZDX A;  4NQL B;  1E8W A;  2O2V B;  2WXR A;  2VH2 A;  1ZE3 D;  1GOZ A;  1LGR A;  2ONQ A;  2K8B A;  3A9J B;  4WUR A;  4K7W A;  1K8R B;  1NDD A;  1QOB A;  3L54 A;  4RGN A;  1UBQ A;  1BT0 A;  2C7M B;  4ZYN A;  4XYC A;  5TR5 A;  5I4D A;  2INC C;  2KWD A;  2N4F A;  2M17 A;  3AEA B;  2WYQ A;  2W9N A;  4MJS A;  5JH5 C;  3HHM A;  3L4P A;  1AN8 A;  5D94 A;  4MSM B;  3VH4 B;  5IP4 D;  5JHB A;  2AL6 A;  3R2T A;  1P9D U;  2KLG A;  2WDR B;  3AE4 B;  5LLI A;  1DYQ A;  2ZCB A;  4YT0 B;  2DZI A;  4FJY A;  2WNM A;  1JCK B;  1M94 A;  1XT9 B;  2Z0E B;  2BKF A;  2GOW A;  4HKQ A;  4MSQ B;  3H7S A;  2L0F A;  3AEE B;  4GXB A;  3TJP A;  3A1Q B;  4LDT B;  2ON8 A;  3DWG C;  2KN5 A;  4GB9 A;  3TUO A;  2BYT A;  1WF9 A;  2AQ3 B;  2KDI A;  4RCO A;  4GLS C;  2BGF A;  3T3O A;  1FXA A;  3A9J A;  4IC7 B;  2H88 B;  4EFO A;  3ZTD A;  3DWM A;  3GP7 A;  5GMV A;  1VZ7 A;  1HTQ A;  1VDV A;  4GIV A;  1C4P A;  2LRW A;  2HJ8 A;  3I63 C;  1YNT E;  2N9K A;  2VH1 A;  1HEZ E;  1EU4 A;  2G1E A;  4ZRK A;  2R61 A;  3DBH I;  3HUI A;  3BVZ A;  3VUY A;  2WDT B;  3RNA C;  4G11 A;  1J7A A;  2KLC A;  4NAW A;  2YLM A;  2LGS A;  4AJY B;  2ZVN A;  1SF0 A;  2KQ4 X;  3MC9 A;  4RM8 A;  1KF6 B;  3AM9 A;  1MG4 A;  3QJZ A;  1WJ6 A;  1WIA A;  4ANX A;  2JYE A;  3RZF A;  4DXG A;  1V5T A;  2WP9 B;  4N58 A;  2WXQ A;  3L13 A;  3EFU A;  1XD3 B;  2KJ6 A;  4WWO A;  1FNV A;  1GB4 A;  3T8M A;  4KZ0 A;  5E6P A;  4HJK A;  2G9H D;  1QKZ A;  3IHP C;  4LDT D;  2INN E;  4XE0 A;  3RYT A;  1E8Y A;  2J7Q B;  2ZEQ A;  4KVG B;  1ISN A;  1F52 A;  1MG8 A;  2LUM A;  2QIL A;  4M02 A;  1E9M A;  3APC A;  4WH4 A;  4RH6 A;  1XO3 A;  3PRP B;  2L0T A;  1ZUD 2;  1N6Z A;  3TEY A;  1JRO A;  1RAX A;  2CHX A;  3W1S A;  4J3O D;  1Q0W B;  4PS8 A;  3S2A A;  2JZZ A;  2ZZP B;  2TSS A;  4TV3 A;  3QK0 A;  2K8C A;  3AE6 B;  3Q8C A;  4WQM A;  3E9S A;  2CU1 A;  4P16 A;  1J0G A;  4A90 A;  3W1Y A;  3VXW A;  2D5G A;  3ZJT A;  4OZA A;  5DPW A;  1XF5 L;  4NAM A;  1KFY B;  3KQ4 A;  2MJE A;  3ZKJ C;  3ZDM C;  3LYY A;  3W9C B;  1ZXH A;  3N1X C;  1GUA B;  5EE1 A;  3ZUN A;  1K50 A;  4JX1 C;  3R7Q A;  1N60 A;  1SE4 A;  4BKS A;  4OVV A;  2JZP A;  2KX0 A;  4YL8 A;  1I4G A;  2M4N A;  2XEW A;  3PS6 A;  3DVN V;  2KC1 A;  5GXG B;  3DVN U;  5L83 A;  1WJU A;  2WWZ A;  3ALB A;  1WYW B;  3X0W A;  1LQB A;  1FO4 A;  3P4P B;  4NZL B;  1UUP A;  3ZXV A;  3DHH C;  5AZF A;  3BK2 A;  4TQ1 A;  4NJ7 A;  4ZRI A;  1V49 A;  1FFU A;  4NJC A;  4K7U A;  1TGZ B;  1TY0 A;  4OVU A;  2KKC A;  2XNA C;  2LVP A;  2FCS A;  1T6B X;  4YXD B;  1V86 A;  3BZD B;  1V81 A;  3ML8 A;  3EGR A;  2ZCC A;  1ACC A;  3N9Y C;  2A4Z A;  3RNB C;  2DYM A;  3RMK C;  1ZW7 A;  3VRA B;  4E74 A;  4WJP A;  3VH3 B;  1IBX A;  2DYO A;  3V60 A;  5BMH A;  1YN3 A;  3HK0 A;  4R3D A;  1UEL A;  2BPS A;  2GBN A;  2Y5P A;  3AB5 A;  3VUW A;  2PE9 A;  2LI5 A;  2NVU I;  4NQK E;  2WX0 A;  2LWP A;  1YJ1 A;  4IWQ A;  1WR6 E;  1YN4 A;  3KUD B;  2IYD B;  2N7J A;  1GTH A;  1X1M A;  5AUI A;  1UD7 A;  1CK1 A;  1WXV A;  2J0J A;  1E8Z A;  3U30 A;  2RR9 A;  5HHD G;  1XXG A;  1IPG A;  5L95 C;  1Y56 A;  4GDL B;  2FE8 A;  2JWU A;  3HIZ A;  2IDY A;  1XLN A;  4IOI E;  3TEX A;  4RGM A;  2NPT A;  1SGH A;  4EUT A;  1I4P A;  4YTP B;  3RUI B;  4MM3 B;  1TIF A;  5D3I B;  1NBF C;  3UI3 A;  5LNK 1;  1I4R A;  4PT5 A;  3KW5 B;  5HG2 A;  5LXH A;  1C4A A;  3OLM D;  2KNB A;  3TBL D;  4C00 A;  1HZ5 A;  2HJ1 A;  2KAJ A;  4P1C C;  3NHE B;  4W9E A;  3AUL A;  4KIK A;  2GBM A;  5G2N A;  4LTU A;  1WM2 A;  2JPH A;  3SEB A;  3DBL B;  3WIM A;  3ENE A;  2DEN B;  2ZW0 A;  2QDF A;  5CHF A;  4TQ0 A;  1MPE A;  1QIL A;  1K51 A;  3DVG X;  3LDZ E;  1DOI A;  3DCG A;  2WU2 B;  5IKC M;  2C60 A;  4BBN C;  3NS1 A;  4RMA A;  2IO1 B;  2LHD A;  2WU5 B;  2BTE A;  1KOT A;  2N9X A;  3VVW B;  2FNJ B;  2Z8L A;  4CQN A;  4EZK A;  4URK A;  4II3 B;  1R4N B;  1SE9 A;  4DHZ E;  2PVO D;  2BS4 B;  3H1U A;  1IGD A;  3RNE C;  4RF1 A;  4BVU C;  4ANW A;  2KYW A;  1SIF A;  3VHT C;  2BQQ A;  2D3A A;  3KYD D;  4L23 A;  3Q8A A;  3AU5 A;  2IGH A;  2ZJD A;  2M0X A;  3FIL A;  2IPK D;  1M4V A;  2MEK A;  4AQ7 A;  2W3R A;  3B9J A;  2JYT A;  3SD5 A;  1TY2 A;  4ARI A;  2KFJ A;  3PLV A;  4RNA A;  2WXL A;  2BB5 A;  1FEH A;  2PW9 A;  4L1B A;  1VJK A;  3W5V B;  2LGY A;  4ZYS A;  4MEL A;  3GZN B;  2WX1 A;  1TBE A;  4MEM A;  3CF4 A;  4FHK A;  2KO3 A;  1OTR B;  3M95 A;  3PSE B;  4XC2 A;  2K8H A;  2WLB A;  2NCN A;  2J0M A;  2O2V A;  2KTR B;  4K81 A;  2FID A;  3VRB B;  5G55 A;  1P7E A;  3NY5 A;  3BVG A;  2WDQ B;  3QX1 A;  3Q8E A;  2IBI B;  1JWU D;  3L16 A;  4KKJ A;  1HTO A;  5LXI B;  1L4D B;  4JWS C;  2Z0D B;  1JWS D;  5AEK B;  2FCQ A;  3PHW B;  2MLB A;  4IM0 A;  2N1V A;  3PZD A;  2D11 A;  1J7C A;  4WAF A;  4KIK B;  2DHZ A;  1UGJ A;  4A3P A;  3AED B;  3PGE A;  1WH3 A;  1IUE A;  3ETR A;  1I7H A;  3AEB B;  1SB3 C;  1OQR A;  2QC8 A;  2NMQ A;  4HVB A;  2CJO A;  3VQI A;  1V9J A;  3JYU A;  1P3Q U;  4IG7 B;  4I6N B;  2YEP B;  3NZU A;  3QWZ B;  4IM2 A;  3A9K B;  3O65 B;  3BWU D;  3PLU A;  1OGW A;  3TMP B;  4MH8 A;  3P4R B;  3R7R A;  1OFF A;  4FLH A;  4JE3 B;  4BFR A;  1UF0 A;  2KZR A;  1NYQ A;  1FD6 A;  5BYS A;  1ZKH A;  4NNJ B;  1FNW A;  1EU3 A;  3TCA A;  2MA9 B;  2J52 A;  2KTR A;  4HPM B;  2XN9 C;  2JXT A;  1XQQ A;  4AWJ A;  4DDG D;  3ONS A;  2BWF A;  3NVV A;  5E6O A;  4KSK C;  3IXS A;  3V6C B;  4MDK E;  2KT7 A;  1C3T A;  1XEE A;  3OWE B;  3N30 A;  2AL3 A;  3IG3 A;  2LGI A;  2W54 A;  3IVF A;  2M0A A;  1WY8 A;  3APD A;  3CSF A;  4F8C B;  3BK1 A;  1QQR A;  3KUC B;  4PS7 A;  2RMM A;  3WAO A;  1YX6 B;  2CJN A;  1OEY A;  4LK0 M;  4MGZ E;  1JWB D;  1Z5S B;  1SSN A;  1VZ6 A;  2UYZ B;  1C77 A;  2LVO A;  4YTM B;  4ZHO A;  3PZ8 A;  4WJQ A;  5DCN A;  1YIW A;  3LJ3 A;  4II2 B;  3B2F A;  4W9L A;  2RSU A;  1Q1O A;  3ZVV A;  3NUH B;  4M0W A;  1RWS A;  4HWI B;  2DZJ A;  4I6L B;  1EO6 A;  2RDG A;  3NS8 A;  1HZ6 A;  1D4B A;  1YD8 U;  2ACZ B;  1JRP A;  1FMA D;  1ZP0 B;  5G5G A;  2K5P A;  5FKA C;  2FUH B;  4X57 B;  3LXF A;  5CHW A;  4KSL C;  3W5U B;  3DBR B;  4G0N B;  2K6D B;  4P7I A;  1I4H A;  1GT8 A;  4P1B C;  2KFK A;  4W9K A;  3W1S C;  3WAM A;  1PYW D;  4MH0 E;  3BYT B;  3U7D A;  1E90 A;  1D5M C;  1HXY D;  1ZDV A;  2L32 A;  2E6X A;  2WXJ A;  3PZ7 A;  1T3Q A;  4WJO A;  1CJE A;  2GBJ A;  2DZM A;  3V61 A;  3Q69 A;  2NPT B;  1L4Z B;  2M19 A;  5IO9 A;  5HI1 A;  2QCZ A;  2JUO A;  5EDS A;  3A1Q A;  2QIE B;  1C76 A;  1WXQ A;  4YSZ B;  3CWI A;  2WXI A;  4A20 A;  4HCN B;  3EFC A;  2RPQ A;  2Z59 B;  1YQ3 B;  2ZVO A;  3AE7 B;  1UWM A;  1I35 A;  1MI0 A;  3BY4 B;  3W2D A;  2QJL A;  4FXC A;  4B6W A;  5IN7 A;  1Q10 A;  3P63 A;  5H92 C;  4KZC A;  1S1Q B;  1V1P B;  3AEG B;  2LGD A;  4B0M A;  3Q14 C;  3PRZ A;  5FK9 C;  1NI2 A;  3KYC D;  2B3A A;  3AI5 A;  2V3N A;  1VCB A;  3GS2 A;  2E3T A;  5D3D A;  1TZO A;  2K0P A;  2DAJ A;  3OJ3 A;  4BKS D;  4GN1 A;  4MJS B;  4MGY E;  3AEC B;  2PLP A;  2MBO A;  1WWT A;  2WXM A;  4B0E A;  2V3P A;  3N1Z C;  3UIN B;  2EKI A;  3PPA A;  3MC8 A;  1TZ1 A;  4FA6 A;  3QC8 B;  3N1Y C;  3KLS X;  1E6E B;  4ZDV A;  2SEB D;  2VRR B;  4BOZ B;  2PKO A;  3ZGZ A;  1GG3 A;  2BYE A;  4S0R A;  1FFV A;  1I4Q A;  1L0Y B;  1F1H A;  3I57 A;  2AQ1 B;  4XDD A;  4M01 A;  3JW0 X;  2IND C;  3M62 B;  2BB6 A;  3N3K B;  2BYV E;  4CO7 A;  4E71 A;  4MGK E;  4JL9 A;  4ZRP A;  1DOX A;  1WJ4 A;  2N9L A;  4TUU A;  4PYZ A;  3AE1 B;  1F77 A;  4LCD E;  3LB8 C;  1F0Z A;  2WHI A;  2IY0 B;  1P1A A;  5C2T B;  1GTE A;  4UDU C;  2IZV B;  2KQ7 A;  1FNU A;  1V1O A;  1E7P B;  1D3Z A;  2JXX A;  3NZ3 A;  1TTN A;  4FJZ A;  5BMG A;  1UNS A;  1JAL A;  2C5L C;  2N9E B;  4CHK A;  3CIR B;  5AUK A;  4DK5 A;  5J17 A;  1KM7 A;  3L08 A;  1Z2M A;  3ZTC A;  3VR8 B;  3K9P B;  3RNG C;  3MHZ A;  2I1K A;  3BYY B;  1GB1 A;  1UZX B;  3H8H A;  1MHH E;  3B0A A;  1WXA A;  3SFE B;  2AEH A;  2RDH A;  3EEC A;  2RD0 A;  3AV8 A;  3FAH A;  2FUG 1;  1JML A;  2A5U A;  1YX5 B;  3GZN I;  4EZJ A;  1WX7 A;  4GDK A;  5C3J B;  1K52 A;  1HQR D;  4GSW A;  4KV2 A;  2CU3 A;  1SE2 A;  2C9W B;  4JWU C;  3TIX A;  1AW7 A;  3GE8 C;  3ZXR A;  1UH6 A;  5EE0 A;  3AN1 A;  5KHQ A;  2EEL A;  1YN5 A;  1TJE A;  1WGR A;  3JSV A;  3T9L A;  1QZE A;  2KHW B;  1TT5 B;  4KX6 B;  4W9H A;  1WR1 A;  1N5X A;  4W9D A;  1S3S G;  4O1N A;  2N7D A;  2IO2 B;  2FAZ A;  1R4M B;  1A5R A;  2V4I B;  2WDV B;  2D2Q A;  2MBH A;  1H8C A;  1V80 A;  2O6V B;  3DBR I;  1XLP A;  4TMA B;  3ZRF A;  5J18 A;  2V1Y A;  1LM8 B;  1UWX A;  4B95 A;  4BBN F;  4DHZ B;  2PJH A;  4XX5 A;  3JVZ X;  3RUL A;  1GC7 A;  5T8I A;  4XGA B;  2OJW A;  4ITK A;  3P42 A;  1L7Y A;  1MVK A;  1T0Q C;  2DAF A;  1CZP A;  4HJG E;  1QT9 A;  4ZOH C;  4JGH B;  1F2R I;  4BOS C;  4A55 A;  2IJ0 A;  1JQ4 A;  2JQR B;  4K3C A;  2Q5W D;  1OQY A;  3L10 B;  1UGM A;  2AWT A;  3I5J C;  2IO0 B;  2BWE S;  3EHV A;  3BII D;  3QQ8 B;  3TEZ A;  2JF5 A;  2KFK B;  2WXK A;  3MC0 B;  5EE9 A;  4DXF A;  2YVC A;  1V2Y A;  4HRS A;  4IKG A;  1GC6 A;  2WXO A;  1N61 A;  2MBQ A;  4PS3 A;  4M8M A;  3KVF B;  4RGT A;  1TS5 A;  4RM9 A;  4XWW A;  3N32 A;  1KTK A;  3IFW B;  3CMM B;  4RFB A;  3UIO B;  2WS3 B;  1TKG A;  3GOE A;  2KDE B;  3AH7 A;  3RCZ A;  2K39 A;  2NR2 A;  4LLG M;  1ESF A;  2EMT A;  5D2M B;  3TEW A;  2V3S A;  2DZK A;  2MH7 A;  3OAW A;  1WGD A;  3VTW A;  2IY1 B;  2JZ3 B;  1L5P A;  2XK5 A;  3C8Y A;  3NOB A;  4S17 A;  3RZW C;  3ZW3 A;  2INP E;  1RM6 C;  2L3Z A;  4LNI A;  4W9F A;  1DGJ A;  5HFY A;  3DBS A;  1GAQ B;  2YEP F;  4IM3 A;  3EA6 A;  3O13 A;  1GJZ A;  4ANV A;  2N7E A;  1L6V A;  1C78 A;  2OJR A;  4REZ A;  1WJN A;  2ZNV B;  4OZB A;  2PPH A;  3ZJV A;  4K1R B;  1T0Y A;  2W3S A;  4HDQ A;  2QSD A;  1JW9 D;  4HPL B;  4ARC A;  2XBB C;  2K3U A;  1PGA A;  3UIP B;  4C7Z A;  2D3B A;  3IT4 B;  1NYR A;  1RFA A;  1WX9 A;  2N9P C;  5BYQ A;  4DBG A;  3ECI A;  1WYG A;  2JRI B;  4IWP A;  3R66 C;  3ML9 A;  4A3O A;  3U7Z A;  3VTV A;  2SAK A;  1WGG A;  3Q6B A;  4ZRJ A;  1L6U A;  3DDC B;  1J19 A;  2V9H A;  4ACF A;  2MCN B;  4FUL A;  2MBB B;  2KJR A;  1N5W A;  3UGB B;  2BW2 A;  1NI3 A;  1WZ3 A;  1FIQ A;  2CHZ A;  3KWV A;  3C19 A;  3HVZ A;  5H8Y E;  1EUV B;  3ZNI D;  4LNF A;  3AE9 B;  2ICI A;  1PUT A;  1YMH E;  4FBJ B;  4DHJ D;  1SXT A;  4W9J A;  4GMV A;  1LFD A;  4BKT A;  5HKH A;  1ZXI A;  1Y8R C;  1ZGU B;  4WWP A;  3MJW A;  3SDL C;  5E6N A;  4RGO S;  1JWM D;  3U52 E;  4E3C A;  1STE A;  2KOX A;  4OVZ A;  2UWQ A;  2L1A A;  2O6V D;  4KDI C;  1PGX A;  1V5O A;  1FCC C;  4IWO A;  1T5X D;  1E10 A;  4MAC A;  4NPN A;  1WGY A;  1KLU D;  2OED A;  2LAS A;  3DVG Y;  3Q2A C;  1ENF A;  4BZA A;  4HKZ E;  2X8X X;  2I38 A;  2XK5 B;  4OZC A;  5FR3 A;  4AJW A;  3M63 B;  2HE7 A;  3Q3F A;  4M0W B;  2D3C A;  4WWM A;  4N6E B;  2LEK A;  4Q2J A;  2QHO A;  3AMZ A;  5AZG A;  3R3M A;  3I9V 1;  3DHI C;  1ROE A;  2PMV A;  3NRZ A;  1BXT A;  2D3G A;  4M00 A;  2JU6 X;  4CYE A;  4DXA B;  2JT4 B;  1G6J A;  1B1Z A;  2MX2 A;  2KAC A;  3PHX B;  4XWT A;  3ZIM A;  2D07 B;  2BYF A;  1AAR A;  4YSY B;  1AWD A;  1SJE D;  1E7U A;  3VAW A;  4DHJ B;  2G4S A;  1VD2 A;  3SFD B;  3ZJU A;  3FKY A;  2JX5 A;  2V4L A;  1WSP A;  2KK8 A;  1IGC A;  3A33 B;  1XLO A;  3MJ5 A;  2EMS A;  1BML C;  1T0S C;  1C4C A;  2G3Q B;  2BF8 B;  1H7X A;  2KWC A;  2HTH A;  3D32 A;  1C79 A;  1TKE A;  3WA0 A;  3PV1 A;  2PIA A;  3URY A;  4HPP A;  1OEY J;  2KAN A;  1V6E A;  2K9X A;  5BYR A;  1JWA D;  2KD0 A;  4HRO A;  1H7W A;  5JXV A;  3VUX A;  2IGD A;  2KVZ A;  2LVQ A;  2J42 A;  3QHT A;  1OQQ A;  4G3X B;  2GLS A;  4EE2 A;  1DOY A;  4A9A A;  1FXT B;  1C1Y B;  3BIN A;  2DBY A;  2N0S B;  4HXD A;  3RNF C;  2L8J A;  4IUM B;  3DBH B;  1SE3 A;  2I2Y A;  2RDB C;  1YQ4 B;  2WXP A;  2LJ5 A;  4YSX B;  3H6N A;  4M8N A;  4A8X C;  1T0R C;  5BMI A;  4HEA 1;  2BKR B;  4QAY A;  2L05 A;  3ZO5 B;  4HLE A;  4C7Y A;  1WXS A;  4JQW C;  1YJJ A;  4KGS A;  1WGK A;  2MP2 B;  1D5X C;  4G50 A;  4H2A A;  2D10 A;  2HDE A;  2L7R A;  2MSE D;  3QCA A;  1IBX B;  3DHG C;  5CTR C;  2KMM A;  4ANU A;  3M3J A;  2M56 B;  1L0V B;  2O6V A;  3DBL I;  3Q3O C;  1U4A A;  2FCN A;  3RN9 C;  5EE3 A;  3R8B A;  1WRD B;  1QLB B;  3NVY A;  3I3T B;  2JY6 A;  3ZNH B;  4N9F 4;  4FHJ A;  3PRM B;  2NBU A;  5J2R A;  3PVL A;  3ZLZ A;  4KDL B;  2OOB B;  1QOF A;  4I6P A;  3RI7 C;  3NVZ A;  1PDX A;  2DYB A;  3SHQ A;  3U4E G;  1F2R C;  2NS5 A;  3RFZ B;  1P0R A;  4MT5 A;  1K53 A;  1E8X A;  1XCQ L;  3RD2 A;  2Y3A A;  3N20 C;  2WXH A;  4K3B A;  4AS1 A;  2LXA A;  3ZRC A;  2ZNV C;  4AOF A;  1UBI A;  3QAQ A;  3DOW A;  1MFW A;  3ZNG C;  1HE8 A;  2MQJ A;  1NVI D;  3MFG A;  4BAX A;  4TKN A; 
#chains in the Genus database with same CATH homology
 1TY2 A;  4ARI A;  1UWX A;  4RNA A;  4US9 A;  1ZDX A;  2WXL A;  2J4X A;  2BB5 A;  2WXR A;  2VZK D;  1FEH A;  1ZE3 D;  2PW9 A;  1GOZ A;  5T8I A;  4ITK A;  1VJK A;  2ONQ A;  3P42 A;  4L1B A;  3W5V B;  4ZYS A;  4WUR A;  1MVK A;  4HJG E;  1CZP A;  1TYG B;  1D5Z C;  1QT9 A;  4OHJ A;  4ZOH C;  1QOB A;  3P1M A;  1F2R I;  3CF4 A;  4A55 A;  2IJ0 A;  2L83 A;  4RGN A;  4TSS A;  2W55 A;  1JQ4 A;  2JQR B;  2BS3 B;  5I4D A;  5TSS A;  2KWD A;  2Q5W D;  3AE3 B;  4KKI A;  2WLB A;  1E0Z A;  3AEA B;  3Q8F A;  3VRB B;  1P7E A;  3L4P A;  1AN8 A;  3BVG A;  2WDQ B;  3BII D;  1I4X A;  4N59 A;  3TEZ A;  3R2T A;  4ZRQ A;  3Q8E A;  2RPV A;  2WDR B;  3AE4 B;  3ZYY X;  1JWU D;  2WXK A;  3MC0 B;  1DYQ A;  4KKJ A;  1L4D B;  4JWS C;  5EE9 A;  1TKY A;  4DXF A;  4YT0 B;  2NTS A;  2KN4 A;  2W82 A;  4XDC A;  1JWS D;  4P6V F;  3J9C A;  2WNM A;  4HRS A;  1JCK B;  4IKG A;  2WXO A;  1J7C A;  1N61 A;  1PFD A;  4WAF A;  4RGT A;  1TS5 A;  1KRH A;  1UGJ A;  1A70 A;  1SEB D;  1GPX A;  3AED B;  4XWW A;  4HKQ A;  1IUE A;  1KTK A;  3ETR A;  4RFB A;  1I7H A;  2DWQ A;  2X38 A;  3AEB B;  2QEJ C;  4L2Y A;  1TS4 A;  3AEE B;  2WS3 B;  1SB3 C;  1TKG A;  1WRI A;  1OQR A;  2NMQ A;  2CJO A;  3AH7 A;  3VQI A;  2WXG A;  2LFI A;  2ON8 A;  3DWG C;  3TUO A;  4LLG M;  1ESF A;  3TEW A;  2BYT A;  1VLB A;  2VZK B;  2YEP B;  2AQ3 B;  2MH7 A;  4C80 A;  4GLS C;  4RCO A;  3BWU D;  3T3O A;  1FXA A;  2FBW B;  4KGR A;  4IDI A;  4MH8 A;  1RYJ A;  2H88 B;  1L5P A;  5D7G A;  3P4R B;  2HTM E;  4ZHP A;  3DWM A;  2V0G A;  3GP7 A;  3C8Y A;  1SBB B;  1OFF A;  1V1P A;  1VZ7 A;  1PGB A;  2INP E;  1RM6 C;  2QMT A;  4JE3 B;  1VDV A;  3AE2 B;  1C4P A;  1DGJ A;  1NYQ A;  5HFY A;  1FD6 A;  5BYS A;  1GAQ B;  2YEP F;  3B2G A;  3EA6 A;  3O13 A;  1ET6 A;  1YNT E;  2N9K A;  1HEZ E;  1EU4 A;  2G1E A;  1N62 A;  1FNW A;  1EU3 A;  3IAM 1;  2R61 A;  1RFK A;  1L6V A;  3HUI A;  1C78 A;  1J7B A;  1QOG A;  3BVZ A;  2J52 A;  4REZ A;  1ZOY B;  1R7S A;  2XN9 C;  2JXT A;  4OZB A;  1J7A A;  4NAW B;  1FM0 D;  3ZJV A;  3NVV A;  2W3S A;  3IXS A;  1SF0 A;  2KQ4 X;  1KF6 B;  3AM9 A;  2NTT A;  2QSD A;  1JW9 D;  4ARC A;  2K3U A;  1PGA A;  4C7Z A;  2AX5 A;  3IT4 B;  1XEE A;  3OWE B;  1NYR A;  3E56 A;  5BYQ A;  2JYE A;  1WYG A;  2LGI A;  4DXG A;  2W54 A;  3NVW A;  2M0A A;  2WP9 B;  4N58 A;  2WXQ A;  1ZPS A;  4OW0 A;  3BK1 A;  3U7Z A;  1FNV A;  2SAK A;  1EWY C;  1GB4 A;  1QQR A;  1FRD A;  2RMM A;  1V8C A;  2CJN A;  2G9H D;  1QKZ A;  1L6U A;  1C9F A;  4LK0 M;  1JWB D;  1SSN A;  1VZ6 A;  1C77 A;  2INN E;  4XE0 A;  3WCQ A;  1N5W A;  4ZHO A;  4YTM B;  2BW2 A;  1NI3 A;  1FIQ A;  3KWV A;  2H89 B;  2B76 B;  3PZ8 A;  2JSV X;  2LUM A;  2QIL A;  2LJI A;  1E9M A;  3B2F A;  3U2S C;  3HVZ A;  4WH4 A;  1P7F A;  4RH6 A;  5H8Y E;  1XO3 A;  1SIJ A;  1ZUD 2;  3AE9 B;  3NUH B;  1FCL A;  2ICI A;  4M0W A;  3TEY A;  1RWS A;  4WIP A;  1PUT A;  1JRO A;  2RDG A;  1HZ6 A;  4A6Q A;  1D4B A;  1YMH E;  3W1S A;  4J3O D;  1SJH D;  2ACZ B;  1JRP A;  1FMA D;  2TSS A;  1ZP0 B;  1SXT A;  3BVM A;  5G5G A;  3AE6 B;  2K5P A;  3Q8C A;  4WQM A;  5FKA C;  1ZXI A;  3E9S A;  5G5H A;  3T3N A;  3LXF A;  4P16 A;  2BS2 B;  4A90 A;  1B9R A;  2D5G A;  3W5U B;  4RGO S;  4D2K A;  4OZA A;  3ZJT A;  1FXI A;  1XF5 L;  1JWM D;  3U52 E;  3R2I A;  3SR6 A;  1STE A;  4NAM A;  4OVZ A;  1KFY B;  1I4H A;  1GT8 A;  3EUB 2;  3KQ4 A;  2MJE A;  2L1A A;  3LYY A;  3W9C B;  1ZXH A;  1PYW D;  3BYT B;  5EE1 A;  1PGX A;  1K50 A;  1D5M C;  1FCC C;  4JX1 C;  2AQ2 B;  1HA5 A;  1HXY D;  1ZDV A;  2L32 A;  1T5X D;  2E6X A;  1E10 A;  2WXJ A;  4MAC A;  3PZ7 A;  1KLU D;  1N60 A;  1SE4 A;  1T3Q A;  2OED A;  2ZW1 A;  3AE8 B;  1CJE A;  3HVD A;  3Q69 A;  1ENF A;  4HKZ E;  2I38 A;  1L4Z B;  2JZP A;  4OZC A;  5FR3 A;  2M19 A;  1I4G A;  1D6E C;  1NEN B;  1YJI A;  1MHX A;  2WQY B;  5HI1 A;  2WXN A;  3RPF C;  5GXG B;  1QF6 A;  1L0X B;  2QIE B;  1C76 A;  1EM7 A;  4YWG G;  1WXQ A;  4WWM A;  4YSZ B;  3CWI A;  2WXI A;  4N6E B;  4GDK B;  2LEK A;  4Q2J A;  1FO4 A;  3P4P B;  4NZL B;  1UUP A;  3AMZ A;  1YQ3 B;  3I9V 1;  1ROE A;  3BK2 A;  4TQ1 A;  3AE7 B;  2PMV A;  1VR9 A;  1UWM A;  1VZ8 A;  1BXT A;  3NRZ A;  3P4Q B;  1MI0 A;  3W2D A;  1FFU A;  1VRA B;  2QJL A;  4FXC A;  2JU6 X;  4NJC A;  1Q10 A;  3P63 A;  5H92 C;  4JPS A;  1TY0 A;  1V1P B;  3AEG B;  4B0M A;  1EWC A;  3FIL B;  1B1Z A;  5FK9 C;  2KAC A;  2XNA C;  4XWT A;  3GB1 A;  4YSY B;  1AWD A;  1SJE D;  2WXF A;  1T6B X;  2L52 A;  2V3N A;  3GS2 A;  3SFD B;  4YXD B;  3BZD B;  2E3T A;  5D3D A;  1TZO A;  3ZJU A;  2K0P A;  3EGR A;  1TS3 A;  1ACC A;  3AEC B;  2PLP A;  2JX5 A;  3N9Y C;  1WWT A;  2WXM A;  4B0E A;  2V3P A;  3MP9 A;  1WSP A;  1IGC A;  2DYM A;  2EKI A;  3VRA B;  1XLO A;  3MJ5 A;  1IBX A;  2DYO A;  3KLS X;  1BML C;  3Q8B A;  4DQO C;  5BMH A;  3AEF B;  1C4C A;  1E6E B;  1YN3 A;  2GI9 A;  2PVG C;  1H7X A;  4R3D A;  2SEB D;  2MJ3 A;  1C79 A;  2Y5P A;  3AB5 A;  1TKE A;  2PKO A;  3ZGZ A;  2PIA A;  2GRI A;  1FFV A;  3URY A;  1I4Q A;  2BBC A;  1L0Y B;  3AE5 B;  1V97 A;  3I57 A;  1YN4 A;  2AQ1 B;  2N7J A;  2PTL A;  4XDD A;  1GTH A;  2K9X A;  5BYR A;  1JWA D;  5AUI A;  2BB6 A;  1CK1 A;  4HRO A;  1H7W A;  5JXV A;  2IGD A;  1BUI C;  2LHE A;  2J42 A;  1OQQ A;  3P4S B;  1CQV A;  3IAS 1;  1DOY A;  4EE2 A;  5HHD G;  4ZRP A;  4A9A A;  5MPO A;  3ABV B;  1DOX A;  1XXG A;  3V3X A;  1Y56 A;  2N9L A;  4GDL B;  2FE8 A;  3AE1 B;  2DBY A;  1F77 A;  2K22 A;  2N0S B;  1QOA A;  2JWU A;  3LB8 C;  1F0Z A;  2IDY A;  1XLN A;  4IOI E;  3TEX A;  1SE3 A;  4RGM A;  5C2T B;  1GTE A;  2I2Y A;  1I4P A;  4YTP B;  1YQ4 B;  4MM3 B;  2WXP A;  4UDU C;  2LMC A;  4YSX B;  5D3I B;  1FNU A;  1V1O A;  4A8X C;  1E7P B;  3NZ3 A;  5BMG A;  1UNS A;  5BMI A;  3UI3 A;  1JAL A;  4HEA 1;  5LNK 1;  4RF0 A;  1I4R A;  3CIR B;  4PT5 A;  5AUK A;  4US8 A;  4C7Y A;  5E6J A;  5HG2 A;  3VR8 B;  1NEK B;  1C4A A;  1YJJ A;  1HZ5 A;  2DLB A;  4KGT A;  4KGS A;  2KAJ A;  3MHZ A;  1WGK A;  3TSS A;  3BYY B;  1GB1 A;  3H8H A;  1MHH E;  1D5X C;  3SFE B;  2OHF A;  4LTU A;  2RDH A;  3SEB A;  2ZW0 A;  4H2A A;  2HDE A;  3AV8 A;  1IBX B;  3FAH A;  1N63 A;  1JML A;  2FUG 1;  1XCT L;  2KMM A;  1MPE A;  3VR9 B;  1QIL A;  4TQ0 A;  1K51 A;  1ET9 A;  2KDM A;  3V05 A;  2M56 B;  1L0V B;  1TS2 A;  2J53 A;  5EE3 A;  3R8B A;  5C3J B;  1DOI A;  1QLB B;  1HQR D;  1K52 A;  2CU3 A;  1SE2 A;  1XLQ A;  1KH0 A;  3NVY A;  4JWU C;  2WU2 B;  1AW7 A;  3FC4 A;  3IT6 B;  3NS1 A;  1AYF A;  3PO0 A;  5EE0 A;  2LHD A;  2WU5 B;  2BT6 A;  1QOF A;  3AN1 A;  3ZQ4 A;  2BTE A;  3NVZ A;  1PDX A;  2EEL A;  3U4E G;  1F2R C;  2Z8L A;  1YN5 A;  4CQN A;  3RFZ B;  3HRD D;  1TJE A;  1LO5 D;  2PVO D;  4KX6 B;  2BS4 B;  1IGD A;  1K53 A;  4MT5 A;  1XCQ L;  1N5X A;  2Y3A A;  4RF1 A;  2WXH A;  1KLG D;  4USA A;  2Y5C A;  4O1N A;  4AS1 A;  4L23 A;  3Q8A A;  2IGH A;  1FRR A;  3FIL A;  2V4I B;  2IPK D;  2GB1 A;  2WDV B;  1M4V A;  2MJD A;  3KWL A;  1NVI D;  2MEK A;  4C56 C;  2IGG A;  4YTN B;  3MFG A;  4AQ7 A;  2W3R A;  3B9J A;  1XLP A;  4TMA B;  2JYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...