2WP9B

Crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhb his207thr mutant
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
238
structure length
238
Chain Sequence
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVCGSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPYLLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYRFLIDSRDTETDSRLDGLSDAFSVFRCTSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINATE DEHYDROGENASE FLAVOPROTEIN SUBUNIT
publication title Perturbation of the quinone-binding site of complex II alters the electronic properties of the proximal [3Fe-4S] iron-sulfur cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 64
structure length 238
sequence length 238
chains with identical sequence F, J
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 2wp9B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2wp9B01
2CJOA 2Q5WD 1L6VA 3ZYYX 4YXDB 1ZP0B 4KX6B 3LXFA 3AE5B 4YTNB 1N61A 1FRRA 1PFDA 1DOXA 5EE1A 2K5PA 2KMMA 1FXAA 1GTHA 1QT9A 2B76B 3AE1B 3AECB 5C3JB 3ETRA 4ZHOA 2H88B 3P63A 4FXCA 3NVZA 2W3RA 1XLOA 5EE0A 1KFYB 4ITKA 1OQQA 4N6EB 2BT6A 3AB5A 1N5XA 2DWQA 4HRSA 3VR9B 1PDXA 1DOYA 1V8CA 1NYRA 1ZXIA 1E6EB 3AV8A 3AM9A 4US8A 1QF6A 1NEKB 4N58A 4YSXB 3AE3B 3FAHA 4HROA 1B9RA 1F0ZA 4WQMA 3SR6A 1AWDA 1WGKA 4JX1C 1RWSA 2PIAA 3NVWA 3LB8C 3NVYA 3AEGB 2CJNA 3P1MA 2FBWB 1JWAD 1FXIA 1NENB 2K22A 3AEEB 3P4PB 1L5PA 1TKYA 3CIRB 1TYGB 1WWTA 1FO4A 1SF0A 1NVID 3BIID 1FMAD 2WQYB 3CF4A 1H7XA 3AE8B 3AEBB 1RYJA 3P4QB 1YJJA 2QJLA 1KRHA 1FM0D 4YSZB 1CZPA 4WWMA 1E7PB 4USAA 1N5WA 2M56B 1ZUD2 2W54A 1GT8A 5EE3A 5AUIA 1SB3C 2ACZB 2WDQB 3AE4B 3SFEB 1E9MA 4LTUA 4N59A 3NVVA 1NI3A 2K9XA 2WP9B 5C2TB 1XLNA 2L52A 2MJEA 3VR8B 2LEKA 3EUB2 3HUIA 4A9AA 3AH7A 2MJ3A 1SIJA 1QOBA 3B2FA 2M19A 2PVGC 1AYFA 5G5HA 1TKEA 1L0VB 1JALA 1QOGA 1TJEA 3L4PA 1J7CA 2H89B 3AE9B 3HRDD 4C7YA 2WU5B 1JRPA 1N63A 1QOFA 1A70A 2MJDA 1RFKA 2EKIA 2BS2B 1ROEA 3DWMA 1GAQB 2HTME 3B2GA 3AMZA 4P6VF 5H8YE 1J7AA 3AEDB 5EE9A 1WRIA 1JQ4A 1YQ4B 1JWBD 1OFFA 1I7HA 3VRAB 3ABVB 4JWSC 3SFDB 1XLPA 2KAJA 2MH7A 1YQ3B 3FC4A 4IDIA 1NYQA 5AUKA 4YT0B 1GTEA 4YSYB 1L6UA 4YTMB 1VDVA 1VJKA 3AN1A 2AX5A 1XO3A 3P4SB 1RM6C 1WXQA 1XLQA 2OHFA 1UWMA 3CWIA 3DWGC 1JW9D 1H7WA 2WDRB 2E3TA 2PVOD 1KF6B 3AE2B 1OQRA 2W55A 4JWUC 1FRDA 4C7ZA 3HVZA 2QIEB 5G5GA 2G1EA 1N62A 3KWLA 3WCQA 2DBYA 1FFUA 3AE7B 3VRBB 2WLBA 3AE6B 1FFVA 1FIQA 5H92C 2WS3B 3W9CB 2N0SB 1DGJA 5MPOA 1E0ZA 1JROA 1J7BA 2W3SA 1GPXA 2WDVB 1CJEA 3P4RB 1E10A 2WU2B 2Y5CA 1DOIA 2CU3A 2JQRB 2JX5A 3RPFC 1EWYC 2PKOA 3NS1A 1TKGA 2BS4B 1VLBA 1T3QA 4C80A 1YJIA 5GXGB 1IUEA 4ZOHC 3AEAB 4YTPB 1N60A 2BS3B 1PUTA 1WYGA 2L83A 4US9A 4ZHPA 1QLBB 3W5VB 1QOAA 1V97A 3NRZA 3AEFB 1ZOYB 1R7SA 3B9JA 3PO0A 3W5UB
chains in the Genus database with same CATH superfamily
5BMGA 2N7EA 2L3ZA 2JYEA 1QT9A 2EMSA 2KC1A 4C4VA 3CSFA 2KQ7A 2M0AA 2VZKD 5CHFA 3MFGA 3UGBB 3IAS1 2GLSA 2M8SA 4WQMA 4HPLB 2GMIC 2JYTA 4RF1A 1JWAD 4NPNA 2K22A 4KGTA 2C9WB 4TSSA 3GOEA 2KLCA 1WXAA 3U2SC 2DYOA 3NY5A 2FIFA 4MACA 3KLSX 2KWCA 2M19A 3ZXVA 3H7SA 3VTWA 2WXMA 3Q8AA 2WU5B 3JSVB 2L1AA 3MHSD 3Q8BA 1WX9A 2DX5B 1UUPA 2IO3B 3SFDB 5DPRA 3BK1A 3BINA 2INPE 5J18A 2BKFA 1LXDA 1H7WA 4JE3B 4TUUA 3SDLC 1OQRA 1Q10A 3Q3JA 5JHAA 1MPEA 3A9JA 4DDID 1S1QB 4WWOA 5DCNA 2X8XX 2L0TA 2KTRA 2YVCA 1LQBA 1SE2A 2LRWA 5JH5C 1TY2A 4YL8A 3U30A 2NTTA 1YOVB 4AWJA 2KD0A 3DDCB 2GRIA 4EFOA 4IG7B 4YXDB 3N1YC 1ZP0B 1EWCA 2AEHA 3M63B 4M01A 2ICIA 3ZKJC 3VTUA 1MG8A 1F2RI 3AB5A 5IP4D 5GMVA 5D6JB 1F0ZA 1WXVA 4HROA 4FADA 1JMLA 2BTEA 1XCQL 2XNAC 3A33B 4JX1C 2WXKA 2D3GA 2FBWB 3AEEB 1TKYA 2BVCA 2D11A 3I63C 1H7XA 5BMHA 1ZW7A 2QHOA 2K6DB 4YSZB 4MGZE 1P9DU 2LJ5A 4N59A 5C2TB 1JWUD 3AH7A 1L4ZB 3BY4B 2KKCA 1QOBA 1E7UA 2JRIB 2WXGA 1IYFA 1YN5A 1AYFA 3JSVA 1C9FA 5G55A 1VRAB 3RUIB 2QDFA 1C3TA 2H89B 1UBIA 3KH0A 2KJRA 3DWMA 1IGCA 4P1CC 4HCNB 5JXVA 2MQJA 1L2NA 3PRPB 4KDLB 4LNIA 1E90A 3V6EB 1TTNA 3KQ4A 1CMXB 1M4VA 4H2AA 3TMPB 3X0WA 5IKCM 3ZTCA 3TEZA 1WI0A 4MH0E 1VZ6A 4AQ7A 5MPOA 3N1ZC 4M8NA 1D5XC 2PE9A 3ZJUA 2V3NA 1E7VA 3SEBA 1MFWA 3UQBA 4J3OD 4E74A 4JPSA 3EFUA 3BWUD 3ZRCA 1XD3B 1FD6A 1NDDA 2L76A 1LO5D 2BKRB 4I6PA 2B76B 3RULA 1L0YB 4KGRA 3VQIA 2LI5A 2GI9A 1EF1A 3VTVA 1SE4A 3W2DA 1FXTB 3DBHI 4N6EB 2BT6A 1N5XA 1E6EB 1NEKB 2G9HD 4WJQA 2K6QA 3VXWA 3APCA 3UF8A 3GE3C 3N32A 3V62A 5DPTA 1FEHA 3TJPA 4P1BC 1NVID 1VR9A 3A4SC 2PJHA 3DVGX 4MELA 1FNVA 3SFEB 1F2RC 1WYWB 4RGTA 2WP9B 1UWXA 2MBBB 1V1OA 1FNWA 1TKEA 3GZNB 3IFWB 1E5WA 5H8YE 2IO0B 3A4RA 1GC6A 2NTSA 2PLPA 2E6XA 2XBBC 2YEPF 3PREA 4YTMB 2J4XA 3C19A 3PSEB 4B95A 1JW9D 4C56C 2FCSA 2KMCA 4AP4C 2JT4B 3IVFA 3AE7B 5HFYA 2LD9A 2O6VD 1E0ZA 3L17A 2QILA 1WZ3A 1HA5A 4DXAB 1EWYC 4W9HA 1V1PB 4ZRQA 2LVPA 1UF0A 2ZW0A 2O2VB 2RPVA 2NR2A 4ANUA 3AU4A 4AOFA 4R3DA 2X38A 2KDIA 2HTHA 1TZ1A 2MBQA 2BWFA 5IAAC 2IPKD 4HKQA 5EE0A 1KFYB 2PEAA 1OQQA 3PZDA 3PV1A 2DWQA 2DZIA 2JRHA 3V6CB 3Q3FA 3DQVA 2FAZA 3PPAA 4TQ0A 4HWIB 2DNFA 3NVWA 1TS4A 2AL3A 3OJ3A 3E9SA 2KWDA 3MC9A 3TIXA 1XQQA 1BMLC 1YX5B 3CSTA 2JZZA 3O13A 1N5WA 4FJYA 4LCDE 5EE3A 1OTRB 2DZJA 5HKHA 2NMQA 3U52E 2W82A 4KZ0A 1SIJA 4B9KA 3RFZB 3FILB 3A1QA 2JU6X 2OJRA 2K25A 2FCMA 2FUG1 2MJDA 2R2QA 2WXPA 3AU5A 2RGFA 2EKIA 2BS2B 1WGHA 3UIPB 4CO7A 3ZIMA 2KFKB 1XLPA 1Y56A 1Z5SB 4YT0B 4KSKC 5CTRC 4JL9A 1RM6C 1WMHB 3C8YA 2KVRA 4P7IA 4JWUC 4P16A 2L8JA 2V1YA 3WCQA 2IYDB 3QAQA 2HDEA 4GB9A 2KN5A 4M8MA 1MJDA 1V1PA 4DBGA 2JX5A 2JQRB 2PKOA 3GZNI 2O2VA 4KIKB 5GXGB 1GNUA 1P1AA 1WF9A 4QAYA 1V97A 2BWES 2L7RA 4GLSC 1K50A 2KDBA 4A20A 4XX5A 1C4AA 3DVNV 5HG2A 3AECB 3L0WB 1C4PA 5TR5A 1S3SG 5IA7A 3FAHA 1WGKA 4DWFA 3L54A 1FPYA 2GBJA 2LRUA 2BB5A 3JVZX 2Z59B 4IOIE 4HJKA 3P4PB 4RGMA 3NS8A 4GXBA 4HCPB 4W9GA 3CMMB 3DBLI 3HK0A 3ENEA 4II3B 2WXRA 4M02A 4GDKB 5AUIA 5EDSA 3FILA 4MT5A 4C4VB 2JWUA 4O1NA 5T8IA 4GU2A 4OZCA 1HZ6A 1YNTE 3R2TA 2N9KA 4HPPA 2WDTB 2JUOA 2KFKA 2I1KA 3QC8B 1JCKB 1TY0A 2FIDA 1YD8U 1P0RA 1V49A 5AUKA 2N4FA 3MTNB 4YWGG 1A5RA 1KF6B 5DPWA 2CHXA 3L16A 5D2MB 1V80A 1FFUA 4ANWA 4EZJA 3PS6A 2KOXA 3PHXB 2LXCA 4N9F4 2BF8B 3QWZB 1SE9A 3I5JC 4RCOA 3I3TB 1GUAB 1E8YA 2KVZA 4ZYNA 5AZGA 3W5VB 3N1XC 5LXHA 2INDC 4FULA 1MHXA 2Y5PA 1ESFA 3WANA 3WALA 3R66C 4ANXA 2CKHB 4HVBA 3QJZA 3AE1B 2MSED 1WX7A 3ETRA 2H88B 4K1RB 2N7DA 3A9JB 3DHHC 2WXHA 4W9DA 1P98A 5JZEB 3VR9B 4BOSC 1YX6B 2K3UA 4S17A 2M4NA 2KT7A 1HTQA 2J7QB 2K8BA 2KYWA 2PIAA 4ICVA 1D5MC 1T0YA 4ACFA 1STEA 1LM8B 4GDKA 1SF0A 3Q8CA 2ZCCA 3EA6A 3ZW3A 4WWMA 1E7PB 3L13A 1HQRD 4MJSB 4MH8A 5J17A 2WGSA 2WWZA 2MJ3A 1WXSA 2AL6A 2NBWB 1WGRA 2KN4A 3W1YA 3CF6E 3U7ZA 4IUMB 2KC2A 3AEDB 1SJED 4HLEA 2QCZA 3SHQA 4BKSA 4YSYB 4WWPA 3K9OB 3KWVA 2OHFA 2PVOD 2W55A 1UGMA 2RDBC 2JPHA 5IOIA 1J0GA 3AE6B 3RYTA 1I4XA 1TZOA 3W1SA 2Y3AA 4C80A 2RSUA 3NG0A 2RDGA 1HXYD 3ZNGC 3ECIA 1R4MI 3AEFB 4XE0A 1WJ4A 3ONSA 4ZRKA 2QMTA 4MSQB 1WR1A 1ZXHA 3DBHB 4WH4A 5DPSA 1FXAA 2RPQA 1EU3A 3R8BA 4GSWA 1D4BA 3NVZA 4PYUA 2N9LA 3OG5A 1DOYA 3AV8A 1I4HA 5CHVC 4A6QA 3SR6A 1OEYJ 5BMIA 5FR6A 1H4RA 1ZE3D 2V4IB 1L4DB 4Q2JA 1AW7A 4HJGE 5TSSA 1SSNA 1HZ5A 2CJNA 3X23A 3RD2A 4GN1A 2ZJDA 1RRBA 2ZPYA 1NENB 3CIRB 2IGDA 2IDYA 4NZLB 4MJSA 3KYDD 4WJNA 2D07B 2HE7A 5IN7A 1YJJA 3SU8X 1T0QC 1SGHA 1CQVA 4XYCA 4FJVB 4KKIA 4ICUA 4DQOC 3DPDA 2KWVB 3B2FA 2KK8A 2ASQA 2LZ6A 2YLMA 2SEBD 2N9XA 3OAWA 1Q1OA 1UBQA 4FBJB 2GBKA 1JRPA 3TSSA 3AMZA 1GAQB 1V9JA 4PS8A 3R2IA 2WXQA 4FLHA 5LNK1 4L23A 4IDIA 2BQQA 3T8MA 4DHJB 1T0SC 4RFBA 2AX5A 2IGGA 2DZMA 5FK9C 4F1SA 1AN8A 2PPHA 3NUHB 4ARIA 3MC0B 3RT3B 1VZ7A 1D6EC 1LFDA 3IXSA 3NS1A 2VZKB 2ZW1A 1T6BX 2CHZA 4B6WA 1KOTA 3UIOB 4IW0A 4BFRA 1GJZA 1ZOYB 1R7SA 1WH3A 4KZCA 1L6VA 4RH6A 3BYTB 3AE5B 3V3XA 3VH4B 1GTHA 3QQ8B 5C3JB 1TT5B 3P63A 3WA0A 2BPSA 4L1BA 5D3DA 2W3RA 4W9JA 3R3MA 2G4SA 3NOBA 3AE3B 2KJHB 2L00B 4LNOA 4W9IA 1V86A 4AUQC 2G4DB 2LFIA 1JWSD 1PYWD 3ZO5B 1RYJA 3R7RA 2R61A 5KHQA 3SD5A 1BUIC 1GT8A 2BYVE 4OW0A 3UI3A 4K7WA 4TQ1A 5E6OA 5JHBA 2VRRB 4FHKA 4PK1A 3GS2A 1ENFA 1TS3A 1HE8A 2N9EB 1KLUD 1XT9B 2D10A 3OJ4B 2Y5BB 1OGWA 2IZVB 2KDEB 3Q2AC 5FKAC 1R4NB 1E8ZA 3B2GA 1J7AA 3W1SC 2MEKA 4MSMB 1WRIA 3Q6BA 1YQ3B 2N1WA 4LNFA 1KM7A 1NYQA 1SE3A 4EZKA 1L6UA 2ZPNA 4G50A 2LGYA 3KYCD 3KUCB 3EECA 4HDOA 2DBYA 3KVFB 3R7QA 1AARA 2JXTA 2DAFA 3MJ5A 3A1QB 4OVUA 1J8CA 2KFJA 1DOIA 1SXTA 1VLBA 4ANVA 3H8HA 1N60A 4LDTD 1PUTA 2B3AA 2KDMA 3JYUA 4CYEA 3NRZA 3PHWB 4ASWC 3M95A 2N7JA 3J9CA 1VD2A 2SAKA 2KMAA 4DHZB 3IBEA 1I4GA 2AQ1B 3EFCA 2OOBB 3KUZA 1D5ZC 4XDCA 1IBXA 2D2QA 2C7NB 4L2YA 2EMTA 1UGJA 4GIVA 1RLFA 1NI2A 4NQKE 2BYFA 1XEEA 1UNSA 3DBLB 4W9EA 1V81A 2ZZPB 3P1MA 2AWTA 2GOWA 1WWTA 1FO4A 2CR5A 2ZEQA 2JZ3B 2M1MA 1MHHE 1M94A 1FM0D 1E9MA 3BVMA 4DXGA 2MJEA 3VAWA 4A9AA 4KVGB 4DXFA 5G5HA 3KUDB 1QOGA 3AE9B 4WQOB 4C7YA 3B08A 3Q3MC 4P6VF 3T9LA 2RD0A 1JQ4A 3VUWA 3DOWA 3ABVB 5HHDG 4A8XC 4EOYA 3FC4A 3C0RB 2IY1B 3WAOA 3RMKC 1XLQA 2DZKA 4UDUC 4A3PA 3H7PA 3NJTA 5D3IB 3RNAC 2IY0B 1FFVA 3W9CB 2KX0A 4NQLB 2CHWA 1YQBA 2GBRA 2KDFB 1E10A 3RPFC 3APDA 3E56A 2BYTA 1YJIA 1YMHE 4YTPB 2MCNB 3QX1A 1QLBB 2AYOB 1R4NI 4XC2A 1UD7A 2W9NA 3DBRB 3PRZA 3PO0A 2NPTA 2UYZB 3ZYYX 3IAM1 2K39A 1N61A 2I1JA 2RR9A 2V4LA 3EGRA 2XK5A 3ML9A 3PTFC 4G3XB 4TMAB 2UWQA 1V8CA 2KACA 4N58A 1V5TA 1WR6E 1AWDA 4IWPA 1ZGUB 2J0JA 1UELA 2LGDA 1K8RB 3BIID 5I4DA 4LLGM 3CF4A 1BT0A 1ZKHA 3QCAA 4W9LA 3ZGZA 1KH0A 2MW5A 3ZDTA 1YJ1A 3AE4B 4NAWB 1XLNA 3HHMA 2G3QB 1L0VB 3Q8FA 4ZRPA 1FCLA 1I4QA 1J7CA 2O6VB 1QZEA 1N63A 2HJ1A 2VH1A 4K7SA 1WGGA 3ZNHB 2LVOA 1Z2MA 3UINB 2DHZA 3VRAB 1N6ZA 2MX2A 1G6JA 4B0EA 3RNBC 1ACCA 1VJKA 3RNGC 1XO3A 2WXLA 3CWIA 3DWGC 3AE2B 5BO4B 1EM7A 4RGNA 1I4RA 1E8WA 1P3QU 1XXGA 5J2RA 2IBIB 2K1FA 2QEJC 5G2NA 3V61A 2HD5B 3PLUA 2IGHA 1R4MB 1T0RC 2IO2B 2L0FA 4CQNA 5CX3A 2Z8LA 1IUEA 1WYGA 2WXFA 4E3CA 3L10B 2JXXA 2CJOA 1B1ZA 4ZDVA 3ZNZB 4YTNB 3NZ3A 3RN9C 1PGBA 4MEMA 2NS5A 1SEBD 3IT6B 2J52A 4ZRJA 2PE6B 3IG3A 3HM3A 1WY8A 1TGZB 1JRUA 4KSLC 1QF6A 2DAJA 4YSXB 2QC8A 4JGHB 1U4AA 4EKUA 2WXIA 1HEZE 4XZ4A 3NVYA 4K3BA 2JZPA 4BOZB 1UH6A 1ZDXA 2MP2B 3PZ8A 1FMAD 3DBRI 2WQYB 4NAWA 3AEBB 1WRDB 4WWNA 1SB3C 2ACZB 4G0NB 4MM3A 2N9PC 3WAPA 1ZDVA 2FCQA 2LHEA 2O6VA 4M0WB 2IJ0A 4XDDA 2M17A 1JALA 2WXJA 1JWMD 3PGEA 3Q14C 4FN2A 3BK2A 3H1UA 2I2YA 1OQYA 2XN9C 2MH7A 4DHJD 2LHDA 2KWUB 1GTEA 4MGYE 3P4SB 1KLVA 1WM2A 2ZNVC 1VCBA 2VH2A 3T3NA 2QIEB 5G5GA 3NZUA 2V3SA 4HPMB 1H8CA 3GB1A 1WGYA 4ARCA 3B0AA 1Q5WB 2WYQA 5H92C 5HI1A 2NBVB 3TEWA 4BBNC 3EC8A 4NJCA 2JVCA 2MA9B 4LNNA 1TKGA 4DDGD 3NZSA 2MWSB 1K53A 3TCAA 4ZOHC 5E6NA 3Q8EA 2J42A 1EU4A 1I4PA 4IM0A 2V9HA 3TEXA 4KDIC 1P7FA 1FRRA 2K5PA 4RGOS 1WE7A 3RNFC 3GE8C 2FNJB 3BZDB 4GDLA 2UU7A 4F8CB 2A4ZA 1WFYA 4HRSA 1EO6A 1QKZA 1NYRA 1ZXIA 5AZFA 4US8A 4OHJA 1F9JA 5D94A 1FCCC 1RWSA 3ZJTA 2MP2A 2D5GA 1VZ8A 2DYBA 2LJIA 4IWQA 4JLCA 4MDKE 1OEYA 2AQ2B 2LUMA 4TV3A 3AE8B 2LXAA 3VHTC 4BAXA 2KNBA 4MGIE 2M56B 1ZUD2 2BYEA 2KJ6A 1F52A 2LASA 2ZCBA 3BVZA 4LTUA 2JSVX 4M0WA 1V2YA 1Q0WB 3AULA 2LMCA 4GOCA 2PVGC 1GB1A 4WIPA 4HDQA 4JQWC 1C4CA 4LJPB 1KTKA 3D32A 5EE9A 1OFFA 2YEPB 2D3CA 4IM3A 5AEKB 1C1YB 2D3AA 5C1ZA 1WXQA 4WAAA 1ZPSA 2C7MB 1WJUA 4PT5A 2G1EA 1N62A 1KJTA 1ET9A 1F1HA 2WLBA 3MHZA 1FIQA 4NJ7A 1JROA 2TSSA 2K8CA 1CJEA 3TEYA 2AQ3B 3BVGA 2GB1A 4A55A 1P7EA 2BS4B 2J0MA 4AJYB 2KANA 2BW2A 3L08A 1C77A 3VVWB 4OZAA 2DLBA 3UQAA 3VUXA 1GB4A 3NHEB 5EE1A 4OVZA 2LGXA 4MGKE 4OVVA 4ZRIA 1WJ6A 2L05A 2HJ8A 1XCTL 2PTLA 2EKEC 3OLMD 1B9RA 2LWPA 3BYYB 4EUTA 1I42A 4A3OA 3LB8C 4WJOA 3JW0X 2ONQA 3ZNID 4I6NB 4II2B 4REZA 1SBBB 3QARA 3ZUNA 3ALBA 4BZAA 1SJHD 1L0XB 2MHJA 3PT2B 3P4QB 4USAA 2K0PA 3GP7A 3P42A 1MI0A 1SIFA 3AI5A 4HK2A 4TKNA 3EUB2 1IBXB 1WIAA 2CS4A 2RMMA 3L4PA 3HRDD 3H6NA 1L7YA 1A70A 3U7DA 4DK5A 2MBOA 3M3JA 4KV2A 4URKA 2KLGA 5KHOA 3VH3B 3MJWA 5E6JA 1JWBD 1WSPA 1FNUA 4W9FA 3URYA 2LGSA 3AN1A 3LJ3A 5C23A 2WDRB 1FRDA 1UZXB 3RNCC 3APFA 2DYMA 5FR3A 1GOZA 4FJZA 2N0SB 1DGJA 1RFAA 3HIZA 1J7BA 2C60A 2MBEA 3P4RB 2MLBA 3K9PB 2FE8A 1T3QA 4WAFA 2C5LC 4PS3A 3AEAB 2L83A 4ZHPA 3O65B 2G45B 2FCNA 3W5UB 2BGFA 5BYQA 2QSDA 5L95C 1KLGD 1DOXA 3RNEC 1YIWA 1C79A 3H7PB 2JF5A 3ZRFA 4EZLA 4K7UA 1PDXA 3DHGC 3DCGA 1PQSA 1TBEA 2D3BA 4PS7A 3VFKA 4FHJA 3MP9A 4IKGA 2KQ4X 4HXDA 1WJNA 3P2BA 3AEGB 1FXIA 2Z0DB 1L5PA 2ZNVB 2KQSA 2WHIA 2NPTB 1WGDA 1CK1A 3ML8A 1MVKA 3PVLA 3QA8A 1KRHA 4BKGA 2W54A 2WDQB 2XK5B 1WXMA 2MRPA 4W9CA 1Y8RC 3HUIA 1IP9A 1K51A 2RDHA 4HKZE 5D7GA 5L83A 1QOFA 1ROEA 2OJWA 3ZQ4A 4G11A 4JWSC 1J19A 1I7HA 2KXJA 2KAJA 2INCC 3ZJVA 2ON8A 1UWMA 3N3KB 3I57A 3HVZA 3TBLD 2V3PA 2NCNA 3H9DA 1GPXA 4LJOB 2V0GA 1QQRA 2Y5CA 3QK0A 1BXTA 2WX1A 3DBSA 3RZWC 3PLVA 2BS3B 2LUEA 1I35A 4AS1A 3KW5B 3HVDA 4M00A 4NNJB 4BKSD 2Q5WD 1IGDA 4KGSA 3LXFA 1D3ZA 1PFDA 2A5UA 5LLIA 2KMMA 3Q3OC 3A9KB 3VDZA 1PGAA 3ZLZA 4ZYSA 4XWWA 2M0XA 4FXCA 1DYQA 4C00A 3S2AA 4RM9A 4K3CA 4JIOU 3T3OA 1YN3A 1X1MA 1TS5A 2PMVA 2KTFA 3ZXRA 3U4EG 1QILA 4DHZE 3N9YC 3RZFA 5AZHA 4NAMA 3I9V1 3FKYA 4BVUC 1K52A 3U8ZA 4XGAB 1CZPA 3DVNU 3PRMB 3B1LX 1C76A 3TL5A 3VUYA 3WAMA 2K9XA 2L52A 2JY6A 2LEKA 5BYRA 4RNAA 4F7ZA 4B0MA 4WURA 3AXCA 3M62B 3RCZA 4PYZA 2HTME 4RMAA 2ZVOA 1YQ4B 4EE2A 4LDTB 2KO3A 2NVUI 4WJPA 3N30A 3IT4B 3MC8A 3OWEB 2E3TA 2L32A 4I6LB 1GG3A 4MM3B 3KWLA 3WIMA 3VRBB 1F77A 4GMVA 1WZ0A 4IC7B 2BBCA 2WDVB 1ET6A 4KKJA 2K8HA 1PGXA 2CU3A 1HTOA 4S0RA 1E8XA 4US9A 1ISNA 2Z0EB 2OEDA 4RF0A 3B9JA 3A9KA 4HEA1 1WE6A 4CHKA 1V6EA 3LYYA 3ZDMC 2DENB 4KX6B 4D2KA 4J6IA 4IM2A 2KZRA 1C78A 4ZHOA 4AJWA 5IO9A 1XLOA 3Q69A 4ITKA 4FA6A 1LGRA 3V60A 3AM9A 2KX3A 4BBNF 4X57B 2GBMA 3QIJA 1NBFC 1TIFA 3DHIC 2NBUA 4RM8A 2KHWB 4XWTA 1IPGA 1TYGB 4IWOA 3TUOA 2CU1A 2WNMA 4E71A 3N20C 3Q3NC 2QJLA 1WX8A 1WMHA 2INNE 1EF5A 2BB6A 3NVVA 3ZTDA 1NI3A 4GDLB 3VR8B 4OZBA 2ZVNA 1EUVB 2MBHA 4NJ6A 4BKTA 1TJEA 2EELA 2WX0A 1XF5L 2J53A 4KIKA 2J0KA 1RFKA 3PZ7A 4A90A 3V05A 1GC7A 4K81A 2WXOA 2XEWA 2C7HA 3RI7C 1YN4A 1VDVA 3QHTA 2N1VA 5LXIB 1T5XD 4EEWA 1TS2A 4C7ZA 2REXA 4GGQA 4LK0M 4NY0A 1MG4A 3EHVA 3LDZE 2WS3B 2LVQA 2JWZA 2R2OA 2LGIA 2WXNA 2W3SA 2WU2B 1RAXA 2IO1B 4LNKA 5CHWA 5BYSA 2PW9A 5E6PA 2GBNA 3HM6X 3DVGY 3IHPC 2KTRB 1WM3A 2FUHB 4W9KA 1QOAA 3ZVVA 2I38A 1V5OA
chains in the Genus database with same CATH topology
5BMGA 4OZAA 2SAKA 1C4AA 1I4GA 2DLBA 2AQ1B 1GB4A 2JYEA 5EE1A 4OVZA 1QT9A 5HG2A 3AECB 1D5ZC 1C4PA 2M0AA 2VZKD 4XDCA 1IBXA 3MFGA 1XCTL 2PTLA 3IAS1 4L2YA 3FAHA 1B9RA 4WQMA 1UGJA 3BYYB 1WGKA 1XEEA 1UNSA 3LB8C 2BB5A 2JYTA 3P1MA 2ONQA 4RF1A 1JWAD 4IOIE 2K22A 3P4PB 4RGMA 4KGTA 1WWTA 4REZA 4TSSA 1FO4A 1SBBB 1MHHE 1SJHD 1L0XB 3P4QB 2WXRA 1FM0D 4USAA 4GDKB 2K0PA 3GP7A 3P42A 5AUIA 1E9MA 1MI0A 3BVMA 3FILA 4MT5A 4DXGA 2JWUA 4O1NA 5T8IA 2MJEA 3U2SC 2DYOA 3EUB2 4A9AA 4MACA 3KLSX 1IBXB 2M19A 4OZCA 4DXFA 1HZ6A 5G5HA 1YNTE 3R2TA 1QOGA 2N9KA 2WXMA 2RMMA 3L4PA 3Q8AA 3AE9B 3HRDD 4C7YA 2WU5B 1A70A 2L1AA 4P6VF 3Q8BA 1JCKB 1TY0A 1UUPA 5E6JA 1JQ4A 1JWBD 1WSPA 3ABVB 3SFDB 1FNUA 5HHDG 4A8XC 3BK1A 3FC4A 3URYA 2INPE 5AUKA 3AN1A 1XLQA 4UDUC 4YWGG 1H7WA 2WDRB 4JE3B 1KF6B 1OQRA 1FRDA 5D3IB 1Q10A 1MPEA 2DYMA 5FR3A 1FFUA 1GOZA 1FFVA 3W9CB 2N0SB 1DGJA 1J7BA 3P4RB 1E10A 3RPFC 1SE2A 3E56A 2FE8A 2BYTA 1T3QA 4RCOA 1YJIA 4WAFA 1TY2A 1YMHE 3AEAB 4YTPB 2L83A 4ZHPA 1QLBB 3W5VB 2NTTA 3PO0A 3W5UB 2GRIA 3ZYYX 4YXDB 1ZP0B 5BYQA 2QSDA 1EWCA 3IAM1 1MHXA 2Y5PA 1KLGD 1ESFA 1N61A 1DOXA 1C79A 3EGRA 3AE1B 2ICIA 3ETRA 2H88B 1F2RI 4TMAB 2WXHA 3AB5A 3VR9B 1PDXA 1V8CA 2KACA 4N58A 1F0ZA 4HROA 2K3UA 1JMLA 2BTEA 1XCQL 1AWDA 2XNAC 3MP9A 4IKGA 4JX1C 2KQ4X 2WXKA 2PIAA 3AEGB 1D5MC 2FBWB 1FXIA 1STEA 3AEEB 1L5PA 1TKYA 1SF0A 3Q8CA 3BIID 5I4DA 4LLGM 3CF4A 1CK1A 1H7XA 3EA6A 1MVKA 5BMHA 1KRHA 3ZGZA 4YSZB 4WWMA 1E7PB 1KH0A 2W54A 1HQRD 2WDQB 3AE4B 4MH8A 4NAWB 4N59A 5C2TB 1XLNA 1JWUD 3HUIA 3AH7A 1L4ZB 2MJ3A 1QOBA 1K51A 2WXGA 1YN5A 1AYFA 1C9FA 1VRAB 2RDHA 1L0VB 3Q8FA 4ZRPA 1FCLA 1I4QA 1J7CA 2H89B 4HKZE 5D7GA 1QOFA 1N63A 2KN4A 1ROEA 3DWMA 1IGCA 3U7ZA 3ZQ4A 3AEDB 1SJED 4JWSC 1I7HA 3VRAB 5JXVA 2KAJA 4B0EA 1ACCA 4YSYB 3ZJVA 1VJKA 2ON8A 1XO3A 2WXLA 3KWVA 2OHFA 1UWMA 3CWIA 3DWGC 2PVOD 3KQ4A 3AE2B 2W55A 3I57A 1M4VA 4H2AA 3HVZA 1EM7A 4RGNA 1I4RA 1XXGA 3TEZA 3AE6B 1VZ6A 2QEJC 2V3PA 4AQ7A 5MPOA 1GPXA 1I4XA 1TZOA 1D5XC 1QQRA 2V0GA 2IGHA 2Y5CA 3W1SA 3ZJUA 2V3NA 1BXTA 3SEBA 2Y3AA 4CQNA 4C80A 2Z8LA 1IUEA 4J3OD 2RDGA 2BS3B 4JPSA 1WYGA 1HXYD 2WXFA 3AEFB 4AS1A 4XE0A 3HVDA 2CJOA 1IGDA 2Q5WD 3BWUD 1B1ZA 4KGSA 2QMTA 3LXFA 4YTNB 3NZ3A 1FD6A 1PFDA 1PGBA 1ZXHA 4WH4A 2KMMA 1LO5D 1FXAA 2B76B 1PGAA 1EU3A 3R8BA 1SEBD 3IT6B 4ZYSA 1L0YB 2J52A 4KGRA 4FXCA 3VQIA 4XWWA 1D4BA 2GI9A 3NVZA 1DYQA 1SE4A 3W2DA 4N6EB 2BT6A 1N5XA 2N9LA 1DOYA 3AV8A 1E6EB 1I4HA 1QF6A 1NEKB 4A6QA 4YSXB 2G9HD 3T3OA 3SR6A 5BMIA 1YN3A 1ZE3D 2V4IB 1L4DB 1TS5A 2PMVA 2WXIA 4Q2JA 1AW7A 3U4EG 1HEZE 1QILA 4HJGE 3NVYA 5TSSA 3N9YC 1SSNA 1HZ5A 2CJNA 1FEHA 2JZPA 1NENB 4NAMA 3I9V1 3CIRB 2IGDA 1NVID 2IDYA 1VR9A 1ZDXA 3PZ8A 1FMAD 1K52A 4NZLB 2WQYB 3AEBB 1YJJA 1CZPA 1FNVA 1C76A 1SB3C 2ACZB 3SFEB 1CQVA 1F2RC 4RGTA 2K9XA 2WP9B 2L52A 4KKIA 2LEKA 5BYRA 1UWXA 1ZDVA 1V1OA 2LHEA 4RNAA 4DQOC 1FNWA 3B2FA 1TKEA 2IJ0A 4XDDA 1JALA 2SEBD 1JWMD 2WXJA 4B0MA 4WURA 1JRPA 3TSSA 5H8YE 3AMZA 1GAQB 2HTME 3BK2A 2NTSA 3R2IA 2WXQA 2I2YA 2PLPA 2E6XA 5LNK1 1YQ4B 2XN9C 4EE2A 2MH7A 4L23A 4IDIA 2YEPF 2LHDA 1GTEA 4YTMB 2J4XA 4RFBA 2AX5A 2IGGA 3P4SB 3IT4B 5FK9C 3OWEB 1JW9D 2E3TA 2L32A 1AN8A 3NUHB 4C56C 3T3NA 2QIEB 5G5GA 4MM3B 3GB1A 4ARCA 3KWLA 4ARIA 3AE7B 3VRBB 5H92C 1F77A 3MC0B 5HI1A 1VZ7A 5HFYA 1E0ZA 2BBCA 2QILA 3TEWA 2WDVB 1ET6A 1HA5A 4KKJA 1D6EC 4NJCA 3IXSA 1PGXA 2CU3A 1EWYC 3NS1A 1TKGA 2VZKB 2ZW1A 1T6BX 1K53A 4ZOHC 1V1PB 4US9A 4ZRQA 3Q8EA 2J42A 1EU4A 2OEDA 2ZW0A 1I4PA 1ZOYB 1R7SA 4RF0A 2RPVA 3B9JA 3TEXA 4HEA1 1L6VA 3LYYA 4RH6A 4KX6B 3BYTB 4R3DA 3AE5B 2X38A 3V3XA 1P7FA 4D2KA 1FRRA 2K5PA 4RGOS 1GTHA 5C3JB 1C78A 4ZHOA 3P63A 3BZDB 2IPKD 4L1BA 5D3DA 2W3RA 1XLOA 3Q69A 5EE0A 1KFYB 4HKQA 4ITKA 1OQQA 4HRSA 2DWQA 1QKZA 1NYRA 1ZXIA 3AM9A 4US8A 3AE3B 4OHJA 1FCCC 4TQ0A 1RWSA 3ZJTA 3NVWA 1TS4A 2LFIA 1JWSD 4XWTA 3E9SA 2KWDA 1PYWD 1TYGB 1VZ8A 2D5GA 2LJIA 3TUOA 2AQ2B 2WNMA 1BMLC 2LUMA 3AE8B 1RYJA 2R61A 2QJLA 3O13A 1N5WA 2M56B 2INNE 1BUIC 1ZUD2 1GT8A 5EE3A 2NMQA 3BVZA 2BB6A 2JSVX 3NVVA 1NI3A 4LTUA 4M0WA 4OW0A 3UI3A 4TQ1A 4GDLB 3U52E 3VR8B 2W82A 2LMCA 4OZBA 1SIJA 3RFZB 3GS2A 2PVGC 3FILB 1ENFA 1TS3A 1GB1A 1KLUD 4WIPA 1TJEA 2EELA 2JU6X 1C4CA 2FUG1 1XF5L 2J53A 2MJDA 2WXPA 1RFKA 5FKAC 2EKIA 2BS2B 3PZ7A 3B2GA 4A90A 1J7AA 1KTKA 3V05A 2MEKA 5EE9A 1WRIA 1OFFA 2YEPB 1XLPA 1Y56A 1YQ3B 2WXOA 1NYQA 1SE3A 4YT0B 1L6UA 1YN4A 1VDVA 1RM6C 1WXQA 1ZPSA 3C8YA 1T5XD 4JWUC 4P16A 4PT5A 1TS2A 4C7ZA 2G1EA 1N62A 1ET9A 3WCQA 4LK0M 2DBYA 2WLBA 3MHZA 1FIQA 2WS3B 2HDEA 2JXTA 1JROA 2LGIA 2TSSA 2WXNA 3MJ5A 2W3SA 1CJEA 3TEYA 2AQ3B 2WU2B 1V1PA 3BVGA 2GB1A 4A55A 1DOIA 2JX5A 2JQRB 1P7EA 2PKOA 1SXTA 5BYSA 2PW9A 2BS4B 1VLBA 5GXGB 3H8HA 1N60A 1PUTA 2KDMA 1QOAA 1V97A 3NRZA 2BW2A 4GLSC 1C77A 2I38A 1K50A 2N7JA 3J9CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CJO A;  2Q5W D;  1L6V A;  3ZYY X;  4YXD B;  1ZP0 B;  4KX6 B;  3LXF A;  3AE5 B;  4YTN B;  1N61 A;  1FRR A;  1PFD A;  1DOX A;  5EE1 A;  2K5P A;  2KMM A;  1FXA A;  1GTH A;  1QT9 A;  2B76 B;  3AE1 B;  3AEC B;  5C3J B;  3ETR A;  4ZHO A;  2H88 B;  3P63 A;  4FXC A;  3NVZ A;  2W3R A;  1XLO A;  5EE0 A;  1KFY B;  4ITK A;  1OQQ A;  4N6E B;  2BT6 A;  3AB5 A;  1N5X A;  2DWQ A;  4HRS A;  3VR9 B;  1PDX A;  1DOY A;  1V8C A;  1NYR A;  1ZXI A;  1E6E B;  3AV8 A;  3AM9 A;  4US8 A;  1QF6 A;  1NEK B;  4N58 A;  4YSX B;  3AE3 B;  3FAH A;  4HRO A;  1B9R A;  1F0Z A;  4WQM A;  3SR6 A;  1AWD A;  1WGK A;  4JX1 C;  1RWS A;  2PIA A;  3NVW A;  3LB8 C;  3NVY A;  3AEG B;  2CJN A;  3P1M A;  2FBW B;  1JWA D;  1FXI A;  1NEN B;  2K22 A;  3AEE B;  3P4P B;  1L5P A;  1TKY A;  3CIR B;  1TYG B;  1WWT A;  1FO4 A;  1SF0 A;  1NVI D;  3BII D;  1FMA D;  2WQY B;  3CF4 A;  1H7X A;  3AE8 B;  3AEB B;  1RYJ A;  3P4Q B;  1YJJ A;  2QJL A;  1KRH A;  1FM0 D;  4YSZ B;  1CZP A;  4WWM A;  1E7P B;  4USA A;  1N5W A;  2M56 B;  1ZUD 2;  2W54 A;  1GT8 A;  5EE3 A;  5AUI A;  1SB3 C;  2ACZ B;  2WDQ B;  3AE4 B;  3SFE B;  1E9M A;  4LTU A;  4N59 A;  3NVV A;  1NI3 A;  2K9X A;  2WP9 B;  5C2T B;  1XLN A;  2L52 A;  2MJE A;  3VR8 B;  2LEK A;  3EUB 2;  3HUI A;  4A9A A;  3AH7 A;  2MJ3 A;  1SIJ A;  1QOB A;  3B2F A;  2M19 A;  2PVG C;  1AYF A;  5G5H A;  1TKE A;  1L0V B;  1JAL A;  1QOG A;  1TJE A;  3L4P A;  1J7C A;  2H89 B;  3AE9 B;  3HRD D;  4C7Y A;  2WU5 B;  1JRP A;  1N63 A;  1QOF A;  1A70 A;  2MJD A;  1RFK A;  2EKI A;  2BS2 B;  1ROE A;  3DWM A;  1GAQ B;  2HTM E;  3B2G A;  3AMZ A;  4P6V F;  5H8Y E;  1J7A A;  3AED B;  5EE9 A;  1WRI A;  1JQ4 A;  1YQ4 B;  1JWB D;  1OFF A;  1I7H A;  3VRA B;  3ABV B;  4JWS C;  3SFD B;  1XLP A;  2KAJ A;  2MH7 A;  1YQ3 B;  3FC4 A;  4IDI A;  1NYQ A;  5AUK A;  4YT0 B;  1GTE A;  4YSY B;  1L6U A;  4YTM B;  1VDV A;  1VJK A;  3AN1 A;  2AX5 A;  1XO3 A;  3P4S B;  1RM6 C;  1WXQ A;  1XLQ A;  2OHF A;  1UWM A;  3CWI A;  3DWG C;  1JW9 D;  1H7W A;  2WDR B;  2E3T A;  2PVO D;  1KF6 B;  3AE2 B;  1OQR A;  2W55 A;  4JWU C;  1FRD A;  4C7Z A;  3HVZ A;  2QIE B;  5G5G A;  2G1E A;  1N62 A;  3KWL A;  3WCQ A;  2DBY A;  1FFU A;  3AE7 B;  3VRB B;  2WLB A;  3AE6 B;  1FFV A;  1FIQ A;  5H92 C;  2WS3 B;  3W9C B;  2N0S B;  1DGJ A;  5MPO A;  1E0Z A;  1JRO A;  1J7B A;  2W3S A;  1GPX A;  2WDV B;  1CJE A;  3P4R B;  1E10 A;  2WU2 B;  2Y5C A;  1DOI A;  2CU3 A;  2JQR B;  2JX5 A;  3RPF C;  1EWY C;  2PKO A;  3NS1 A;  1TKG A;  2BS4 B;  1VLB A;  1T3Q A;  4C80 A;  1YJI A;  5GXG B;  1IUE A;  4ZOH C;  3AEA B;  4YTP B;  1N60 A;  2BS3 B;  1PUT A;  1WYG A;  2L83 A;  4US9 A;  4ZHP A;  1QLB B;  3W5V B;  1QOA A;  1V97 A;  3NRZ A;  3AEF B;  1ZOY B;  1R7S A;  3B9J A;  3PO0 A;  3W5U B; 
#chains in the Genus database with same CATH topology
 5BMG A;  2N7E A;  2L3Z A;  2JYE A;  1QT9 A;  2EMS A;  2KC1 A;  4C4V A;  3CSF A;  2KQ7 A;  2M0A A;  2VZK D;  5CHF A;  3MFG A;  3UGB B;  3IAS 1;  2GLS A;  2M8S A;  4WQM A;  4HPL B;  2GMI C;  2JYT A;  4RF1 A;  1JWA D;  4NPN A;  2K22 A;  4KGT A;  2C9W B;  4TSS A;  3GOE A;  2KLC A;  1WXA A;  3U2S C;  2DYO A;  3NY5 A;  2FIF A;  4MAC A;  3KLS X;  2KWC A;  2M19 A;  3ZXV A;  3H7S A;  3VTW A;  2WXM A;  3Q8A A;  2WU5 B;  3JSV B;  2L1A A;  3MHS D;  3Q8B A;  1WX9 A;  2DX5 B;  1UUP A;  2IO3 B;  3SFD B;  5DPR A;  3BK1 A;  3BIN A;  2INP E;  5J18 A;  2BKF A;  1LXD A;  1H7W A;  4JE3 B;  4TUU A;  3SDL C;  1OQR A;  1Q10 A;  3Q3J A;  5JHA A;  1MPE A;  3A9J A;  4DDI D;  1S1Q B;  4WWO A;  5DCN A;  2X8X X;  2L0T A;  2KTR A;  2YVC A;  1LQB A;  1SE2 A;  2LRW A;  5JH5 C;  1TY2 A;  4YL8 A;  3U30 A;  2NTT A;  1YOV B;  4AWJ A;  2KD0 A;  3DDC B;  2GRI A;  4EFO A;  4IG7 B;  4YXD B;  3N1Y C;  1ZP0 B;  1EWC A;  2AEH A;  3M63 B;  4M01 A;  2ICI A;  3ZKJ C;  3VTU A;  1MG8 A;  1F2R I;  3AB5 A;  5IP4 D;  5GMV A;  5D6J B;  1F0Z A;  1WXV A;  4HRO A;  4FAD A;  1JML A;  2BTE A;  1XCQ L;  2XNA C;  3A33 B;  4JX1 C;  2WXK A;  2D3G A;  2FBW B;  3AEE B;  1TKY A;  2BVC A;  2D11 A;  3I63 C;  1H7X A;  5BMH A;  1ZW7 A;  2QHO A;  2K6D B;  4YSZ B;  4MGZ E;  1P9D U;  2LJ5 A;  4N59 A;  5C2T B;  1JWU D;  3AH7 A;  1L4Z B;  3BY4 B;  2KKC A;  1QOB A;  1E7U A;  2JRI B;  2WXG A;  1IYF A;  1YN5 A;  1AYF A;  3JSV A;  1C9F A;  5G55 A;  1VRA B;  3RUI B;  2QDF A;  1C3T A;  2H89 B;  1UBI A;  3KH0 A;  2KJR A;  3DWM A;  1IGC A;  4P1C C;  4HCN B;  5JXV A;  2MQJ A;  1L2N A;  3PRP B;  4KDL B;  4LNI A;  1E90 A;  3V6E B;  1TTN A;  3KQ4 A;  1CMX B;  1M4V A;  4H2A A;  3TMP B;  3X0W A;  5IKC M;  3ZTC A;  3TEZ A;  1WI0 A;  4MH0 E;  1VZ6 A;  4AQ7 A;  5MPO A;  3N1Z C;  4M8N A;  1D5X C;  2PE9 A;  3ZJU A;  2V3N A;  1E7V A;  3SEB A;  1MFW A;  3UQB A;  4J3O D;  4E74 A;  4JPS A;  3EFU A;  3BWU D;  3ZRC A;  1XD3 B;  1FD6 A;  1NDD A;  2L76 A;  1LO5 D;  2BKR B;  4I6P A;  2B76 B;  3RUL A;  1L0Y B;  4KGR A;  3VQI A;  2LI5 A;  2GI9 A;  1EF1 A;  3VTV A;  1SE4 A;  3W2D A;  1FXT B;  3DBH I;  4N6E B;  2BT6 A;  1N5X A;  1E6E B;  1NEK B;  2G9H D;  4WJQ A;  2K6Q A;  3VXW A;  3APC A;  3UF8 A;  3GE3 C;  3N32 A;  3V62 A;  5DPT A;  1FEH A;  3TJP A;  4P1B C;  1NVI D;  1VR9 A;  3A4S C;  2PJH A;  3DVG X;  4MEL A;  1FNV A;  3SFE B;  1F2R C;  1WYW B;  4RGT A;  2WP9 B;  1UWX A;  2MBB B;  1V1O A;  1FNW A;  1TKE A;  3GZN B;  3IFW B;  1E5W A;  5H8Y E;  2IO0 B;  3A4R A;  1GC6 A;  2NTS A;  2PLP A;  2E6X A;  2XBB C;  2YEP F;  3PRE A;  4YTM B;  2J4X A;  3C19 A;  3PSE B;  4B95 A;  1JW9 D;  4C56 C;  2FCS A;  2KMC A;  4AP4 C;  2JT4 B;  3IVF A;  3AE7 B;  5HFY A;  2LD9 A;  2O6V D;  1E0Z A;  3L17 A;  2QIL A;  1WZ3 A;  1HA5 A;  4DXA B;  1EWY C;  4W9H A;  1V1P B;  4ZRQ A;  2LVP A;  1UF0 A;  2ZW0 A;  2O2V B;  2RPV A;  2NR2 A;  4ANU A;  3AU4 A;  4AOF A;  4R3D A;  2X38 A;  2KDI A;  2HTH A;  1TZ1 A;  2MBQ A;  2BWF A;  5IAA C;  2IPK D;  4HKQ A;  5EE0 A;  1KFY B;  2PEA A;  1OQQ A;  3PZD A;  3PV1 A;  2DWQ A;  2DZI A;  2JRH A;  3V6C B;  3Q3F A;  3DQV A;  2FAZ A;  3PPA A;  4TQ0 A;  4HWI B;  2DNF A;  3NVW A;  1TS4 A;  2AL3 A;  3OJ3 A;  3E9S A;  2KWD A;  3MC9 A;  3TIX A;  1XQQ A;  1BML C;  1YX5 B;  3CST A;  2JZZ A;  3O13 A;  1N5W A;  4FJY A;  4LCD E;  5EE3 A;  1OTR B;  2DZJ A;  5HKH A;  2NMQ A;  3U52 E;  2W82 A;  4KZ0 A;  1SIJ A;  4B9K A;  3RFZ B;  3FIL B;  3A1Q A;  2JU6 X;  2OJR A;  2K25 A;  2FCM A;  2FUG 1;  2MJD A;  2R2Q A;  2WXP A;  3AU5 A;  2RGF A;  2EKI A;  2BS2 B;  1WGH A;  3UIP B;  4CO7 A;  3ZIM A;  2KFK B;  1XLP A;  1Y56 A;  1Z5S B;  4YT0 B;  4KSK C;  5CTR C;  4JL9 A;  1RM6 C;  1WMH B;  3C8Y A;  2KVR A;  4P7I A;  4JWU C;  4P16 A;  2L8J A;  2V1Y A;  3WCQ A;  2IYD B;  3QAQ A;  2HDE A;  4GB9 A;  2KN5 A;  4M8M A;  1MJD A;  1V1P A;  4DBG A;  2JX5 A;  2JQR B;  2PKO A;  3GZN I;  2O2V A;  4KIK B;  5GXG B;  1GNU A;  1P1A A;  1WF9 A;  4QAY A;  1V97 A;  2BWE S;  2L7R A;  4GLS C;  1K50 A;  2KDB A;  4A20 A;  4XX5 A;  1C4A A;  3DVN V;  5HG2 A;  3AEC B;  3L0W B;  1C4P A;  5TR5 A;  1S3S G;  5IA7 A;  3FAH A;  1WGK A;  4DWF A;  3L54 A;  1FPY A;  2GBJ A;  2LRU A;  2BB5 A;  3JVZ X;  2Z59 B;  4IOI E;  4HJK A;  3P4P B;  4RGM A;  3NS8 A;  4GXB A;  4HCP B;  4W9G A;  3CMM B;  3DBL I;  3HK0 A;  3ENE A;  4II3 B;  2WXR A;  4M02 A;  4GDK B;  5AUI A;  5EDS A;  3FIL A;  4MT5 A;  4C4V B;  2JWU A;  4O1N A;  5T8I A;  4GU2 A;  4OZC A;  1HZ6 A;  1YNT E;  3R2T A;  2N9K A;  4HPP A;  2WDT B;  2JUO A;  2KFK A;  2I1K A;  3QC8 B;  1JCK B;  1TY0 A;  2FID A;  1YD8 U;  1P0R A;  1V49 A;  5AUK A;  2N4F A;  3MTN B;  4YWG G;  1A5R A;  1KF6 B;  5DPW A;  2CHX A;  3L16 A;  5D2M B;  1V80 A;  1FFU A;  4ANW A;  4EZJ A;  3PS6 A;  2KOX A;  3PHX B;  2LXC A;  4N9F 4;  2BF8 B;  3QWZ B;  1SE9 A;  3I5J C;  4RCO A;  3I3T B;  1GUA B;  1E8Y A;  2KVZ A;  4ZYN A;  5AZG A;  3W5V B;  3N1X C;  5LXH A;  2IND C;  4FUL A;  1MHX A;  2Y5P A;  1ESF A;  3WAN A;  3WAL A;  3R66 C;  4ANX A;  2CKH B;  4HVB A;  3QJZ A;  3AE1 B;  2MSE D;  1WX7 A;  3ETR A;  2H88 B;  4K1R B;  2N7D A;  3A9J B;  3DHH C;  2WXH A;  4W9D A;  1P98 A;  5JZE B;  3VR9 B;  4BOS C;  1YX6 B;  2K3U A;  4S17 A;  2M4N A;  2KT7 A;  1HTQ A;  2J7Q B;  2K8B A;  2KYW A;  2PIA A;  4ICV A;  1D5M C;  1T0Y A;  4ACF A;  1STE A;  1LM8 B;  4GDK A;  1SF0 A;  3Q8C A;  2ZCC A;  3EA6 A;  3ZW3 A;  4WWM A;  1E7P B;  3L13 A;  1HQR D;  4MJS B;  4MH8 A;  5J17 A;  2WGS A;  2WWZ A;  2MJ3 A;  1WXS A;  2AL6 A;  2NBW B;  1WGR A;  2KN4 A;  3W1Y A;  3CF6 E;  3U7Z A;  4IUM B;  2KC2 A;  3AED B;  1SJE D;  4HLE A;  2QCZ A;  3SHQ A;  4BKS A;  4YSY B;  4WWP A;  3K9O B;  3KWV A;  2OHF A;  2PVO D;  2W55 A;  1UGM A;  2RDB C;  2JPH A;  5IOI A;  1J0G A;  3AE6 B;  3RYT A;  1I4X A;  1TZO A;  3W1S A;  2Y3A A;  4C80 A;  2RSU A;  3NG0 A;  2RDG A;  1HXY D;  3ZNG C;  3ECI A;  1R4M I;  3AEF B;  4XE0 A;  1WJ4 A;  3ONS A;  4ZRK A;  2QMT A;  4MSQ B;  1WR1 A;  1ZXH A;  3DBH B;  4WH4 A;  5DPS A;  1FXA A;  2RPQ A;  1EU3 A;  3R8B A;  4GSW A;  1D4B A;  3NVZ A;  4PYU A;  2N9L A;  3OG5 A;  1DOY A;  3AV8 A;  1I4H A;  5CHV C;  4A6Q A;  3SR6 A;  1OEY J;  5BMI A;  5FR6 A;  1H4R A;  1ZE3 D;  2V4I B;  1L4D B;  4Q2J A;  1AW7 A;  4HJG E;  5TSS A;  1SSN A;  1HZ5 A;  2CJN A;  3X23 A;  3RD2 A;  4GN1 A;  2ZJD A;  1RRB A;  2ZPY A;  1NEN B;  3CIR B;  2IGD A;  2IDY A;  4NZL B;  4MJS A;  3KYD D;  4WJN A;  2D07 B;  2HE7 A;  5IN7 A;  1YJJ A;  3SU8 X;  1T0Q C;  1SGH A;  1CQV A;  4XYC A;  4FJV B;  4KKI A;  4ICU A;  4DQO C;  3DPD A;  2KWV B;  3B2F A;  2KK8 A;  2ASQ A;  2LZ6 A;  2YLM A;  2SEB D;  2N9X A;  3OAW A;  1Q1O A;  1UBQ A;  4FBJ B;  2GBK A;  1JRP A;  3TSS A;  3AMZ A;  1GAQ B;  1V9J A;  4PS8 A;  3R2I A;  2WXQ A;  4FLH A;  5LNK 1;  4L23 A;  4IDI A;  2BQQ A;  3T8M A;  4DHJ B;  1T0S C;  4RFB A;  2AX5 A;  2IGG A;  2DZM A;  5FK9 C;  4F1S A;  1AN8 A;  2PPH A;  3NUH B;  4ARI A;  3MC0 B;  3RT3 B;  1VZ7 A;  1D6E C;  1LFD A;  3IXS A;  3NS1 A;  2VZK B;  2ZW1 A;  1T6B X;  2CHZ A;  4B6W A;  1KOT A;  3UIO B;  4IW0 A;  4BFR A;  1GJZ A;  1ZOY B;  1R7S A;  1WH3 A;  4KZC A;  1L6V A;  4RH6 A;  3BYT B;  3AE5 B;  3V3X A;  3VH4 B;  1GTH A;  3QQ8 B;  5C3J B;  1TT5 B;  3P63 A;  3WA0 A;  2BPS A;  4L1B A;  5D3D A;  2W3R A;  4W9J A;  3R3M A;  2G4S A;  3NOB A;  3AE3 B;  2KJH B;  2L00 B;  4LNO A;  4W9I A;  1V86 A;  4AUQ C;  2G4D B;  2LFI A;  1JWS D;  1PYW D;  3ZO5 B;  1RYJ A;  3R7R A;  2R61 A;  5KHQ A;  3SD5 A;  1BUI C;  1GT8 A;  2BYV E;  4OW0 A;  3UI3 A;  4K7W A;  4TQ1 A;  5E6O A;  5JHB A;  2VRR B;  4FHK A;  4PK1 A;  3GS2 A;  1ENF A;  1TS3 A;  1HE8 A;  2N9E B;  1KLU D;  1XT9 B;  2D10 A;  3OJ4 B;  2Y5B B;  1OGW A;  2IZV B;  2KDE B;  3Q2A C;  5FKA C;  1R4N B;  1E8Z A;  3B2G A;  1J7A A;  3W1S C;  2MEK A;  4MSM B;  1WRI A;  3Q6B A;  1YQ3 B;  2N1W A;  4LNF A;  1KM7 A;  1NYQ A;  1SE3 A;  4EZK A;  1L6U A;  2ZPN A;  4G50 A;  2LGY A;  3KYC D;  3KUC B;  3EEC A;  4HDO A;  2DBY A;  3KVF B;  3R7Q A;  1AAR A;  2JXT A;  2DAF A;  3MJ5 A;  3A1Q B;  4OVU A;  1J8C A;  2KFJ A;  1DOI A;  1SXT A;  1VLB A;  4ANV A;  3H8H A;  1N60 A;  4LDT D;  1PUT A;  2B3A A;  2KDM A;  3JYU A;  4CYE A;  3NRZ A;  3PHW B;  4ASW C;  3M95 A;  2N7J A;  3J9C A;  1VD2 A;  2SAK A;  2KMA A;  4DHZ B;  3IBE A;  1I4G A;  2AQ1 B;  3EFC A;  2OOB B;  3KUZ A;  1D5Z C;  4XDC A;  1IBX A;  2D2Q A;  2C7N B;  4L2Y A;  2EMT A;  1UGJ A;  4GIV A;  1RLF A;  1NI2 A;  4NQK E;  2BYF A;  1XEE A;  1UNS A;  3DBL B;  4W9E A;  1V81 A;  2ZZP B;  3P1M A;  2AWT A;  2GOW A;  1WWT A;  1FO4 A;  2CR5 A;  2ZEQ A;  2JZ3 B;  2M1M A;  1MHH E;  1M94 A;  1FM0 D;  1E9M A;  3BVM A;  4DXG A;  2MJE A;  3VAW A;  4A9A A;  4KVG B;  4DXF A;  5G5H A;  3KUD B;  1QOG A;  3AE9 B;  4WQO B;  4C7Y A;  3B08 A;  3Q3M C;  4P6V F;  3T9L A;  2RD0 A;  1JQ4 A;  3VUW A;  3DOW A;  3ABV B;  5HHD G;  4A8X C;  4EOY A;  3FC4 A;  3C0R B;  2IY1 B;  3WAO A;  3RMK C;  1XLQ A;  2DZK A;  4UDU C;  4A3P A;  3H7P A;  3NJT A;  5D3I B;  3RNA C;  2IY0 B;  1FFV A;  3W9C B;  2KX0 A;  4NQL B;  2CHW A;  1YQB A;  2GBR A;  2KDF B;  1E10 A;  3RPF C;  3APD A;  3E56 A;  2BYT A;  1YJI A;  1YMH E;  4YTP B;  2MCN B;  3QX1 A;  1QLB B;  2AYO B;  1R4N I;  4XC2 A;  1UD7 A;  2W9N A;  3DBR B;  3PRZ A;  3PO0 A;  2NPT A;  2UYZ B;  3ZYY X;  3IAM 1;  2K39 A;  1N61 A;  2I1J A;  2RR9 A;  2V4L A;  3EGR A;  2XK5 A;  3ML9 A;  3PTF C;  4G3X B;  4TMA B;  2UWQ A;  1V8C A;  2KAC A;  4N58 A;  1V5T A;  1WR6 E;  1AWD A;  4IWP A;  1ZGU B;  2J0J A;  1UEL A;  2LGD A;  1K8R B;  3BII D;  5I4D A;  4LLG M;  3CF4 A;  1BT0 A;  1ZKH A;  3QCA A;  4W9L A;  3ZGZ A;  1KH0 A;  2MW5 A;  3ZDT A;  1YJ1 A;  3AE4 B;  4NAW B;  1XLN A;  3HHM A;  2G3Q B;  1L0V B;  3Q8F A;  4ZRP A;  1FCL A;  1I4Q A;  1J7C A;  2O6V B;  1QZE A;  1N63 A;  2HJ1 A;  2VH1 A;  4K7S A;  1WGG A;  3ZNH B;  2LVO A;  1Z2M A;  3UIN B;  2DHZ A;  3VRA B;  1N6Z A;  2MX2 A;  1G6J A;  4B0E A;  3RNB C;  1ACC A;  1VJK A;  3RNG C;  1XO3 A;  2WXL A;  3CWI A;  3DWG C;  3AE2 B;  5BO4 B;  1EM7 A;  4RGN A;  1I4R A;  1E8W A;  1P3Q U;  1XXG A;  5J2R A;  2IBI B;  2K1F A;  2QEJ C;  5G2N A;  3V61 A;  2HD5 B;  3PLU A;  2IGH A;  1R4M B;  1T0R C;  2IO2 B;  2L0F A;  4CQN A;  5CX3 A;  2Z8L A;  1IUE A;  1WYG A;  2WXF A;  4E3C A;  3L10 B;  2JXX A;  2CJO A;  1B1Z A;  4ZDV A;  3ZNZ B;  4YTN B;  3NZ3 A;  3RN9 C;  1PGB A;  4MEM A;  2NS5 A;  1SEB D;  3IT6 B;  2J52 A;  4ZRJ A;  2PE6 B;  3IG3 A;  3HM3 A;  1WY8 A;  1TGZ B;  1JRU A;  4KSL C;  1QF6 A;  2DAJ A;  4YSX B;  2QC8 A;  4JGH B;  1U4A A;  4EKU A;  2WXI A;  1HEZ E;  4XZ4 A;  3NVY A;  4K3B A;  2JZP A;  4BOZ B;  1UH6 A;  1ZDX A;  2MP2 B;  3PZ8 A;  1FMA D;  3DBR I;  2WQY B;  4NAW A;  3AEB B;  1WRD B;  4WWN A;  1SB3 C;  2ACZ B;  4G0N B;  4MM3 A;  2N9P C;  3WAP A;  1ZDV A;  2FCQ A;  2LHE A;  2O6V A;  4M0W B;  2IJ0 A;  4XDD A;  2M17 A;  1JAL A;  2WXJ A;  1JWM D;  3PGE A;  3Q14 C;  4FN2 A;  3BK2 A;  3H1U A;  2I2Y A;  1OQY A;  2XN9 C;  2MH7 A;  4DHJ D;  2LHD A;  2KWU B;  1GTE A;  4MGY E;  3P4S B;  1KLV A;  1WM2 A;  2ZNV C;  1VCB A;  2VH2 A;  3T3N A;  2QIE B;  5G5G A;  3NZU A;  2V3S A;  4HPM B;  1H8C A;  3GB1 A;  1WGY A;  4ARC A;  3B0A A;  1Q5W B;  2WYQ A;  5H92 C;  5HI1 A;  2NBV B;  3TEW A;  4BBN C;  3EC8 A;  4NJC A;  2JVC A;  2MA9 B;  4LNN A;  1TKG A;  4DDG D;  3NZS A;  2MWS B;  1K53 A;  3TCA A;  4ZOH C;  5E6N A;  3Q8E A;  2J42 A;  1EU4 A;  1I4P A;  4IM0 A;  2V9H A;  3TEX A;  4KDI C;  1P7F A;  1FRR A;  2K5P A;  4RGO S;  1WE7 A;  3RNF C;  3GE8 C;  2FNJ B;  3BZD B;  4GDL A;  2UU7 A;  4F8C B;  2A4Z A;  1WFY A;  4HRS A;  1EO6 A;  1QKZ A;  1NYR A;  1ZXI A;  5AZF A;  4US8 A;  4OHJ A;  1F9J A;  5D94 A;  1FCC C;  1RWS A;  3ZJT A;  2MP2 A;  2D5G A;  1VZ8 A;  2DYB A;  2LJI A;  4IWQ A;  4JLC A;  4MDK E;  1OEY A;  2AQ2 B;  2LUM A;  4TV3 A;  3AE8 B;  2LXA A;  3VHT C;  4BAX A;  2KNB A;  4MGI E;  2M56 B;  1ZUD 2;  2BYE A;  2KJ6 A;  1F52 A;  2LAS A;  2ZCB A;  3BVZ A;  4LTU A;  2JSV X;  4M0W A;  1V2Y A;  1Q0W B;  3AUL A;  2LMC A;  4GOC A;  2PVG C;  1GB1 A;  4WIP A;  4HDQ A;  4JQW C;  1C4C A;  4LJP B;  1KTK A;  3D32 A;  5EE9 A;  1OFF A;  2YEP B;  2D3C A;  4IM3 A;  5AEK B;  1C1Y B;  2D3A A;  5C1Z A;  1WXQ A;  4WAA A;  1ZPS A;  2C7M B;  1WJU A;  4PT5 A;  2G1E A;  1N62 A;  1KJT A;  1ET9 A;  1F1H A;  2WLB A;  3MHZ A;  1FIQ A;  4NJ7 A;  1JRO A;  2TSS A;  2K8C A;  1CJE A;  3TEY A;  2AQ3 B;  3BVG A;  2GB1 A;  4A55 A;  1P7E A;  2BS4 B;  2J0M A;  4AJY B;  2KAN A;  2BW2 A;  3L08 A;  1C77 A;  3VVW B;  4OZA A;  2DLB A;  3UQA A;  3VUX A;  1GB4 A;  3NHE B;  5EE1 A;  4OVZ A;  2LGX A;  4MGK E;  4OVV A;  4ZRI A;  1WJ6 A;  2L05 A;  2HJ8 A;  1XCT L;  2PTL A;  2EKE C;  3OLM D;  1B9R A;  2LWP A;  3BYY B;  4EUT A;  1I42 A;  4A3O A;  3LB8 C;  4WJO A;  3JW0 X;  2ONQ A;  3ZNI D;  4I6N B;  4II2 B;  4REZ A;  1SBB B;  3QAR A;  3ZUN A;  3ALB A;  4BZA A;  1SJH D;  1L0X B;  2MHJ A;  3PT2 B;  3P4Q B;  4USA A;  2K0P A;  3GP7 A;  3P42 A;  1MI0 A;  1SIF A;  3AI5 A;  4HK2 A;  4TKN A;  3EUB 2;  1IBX B;  1WIA A;  2CS4 A;  2RMM A;  3L4P A;  3HRD D;  3H6N A;  1L7Y A;  1A70 A;  3U7D A;  4DK5 A;  2MBO A;  3M3J A;  4KV2 A;  4URK A;  2KLG A;  5KHO A;  3VH3 B;  3MJW A;  5E6J A;  1JWB D;  1WSP A;  1FNU A;  4W9F A;  3URY A;  2LGS A;  3AN1 A;  3LJ3 A;  5C23 A;  2WDR B;  1FRD A;  1UZX B;  3RNC C;  3APF A;  2DYM A;  5FR3 A;  1GOZ A;  4FJZ A;  2N0S B;  1DGJ A;  1RFA A;  3HIZ A;  1J7B A;  2C60 A;  2MBE A;  3P4R B;  2MLB A;  3K9P B;  2FE8 A;  1T3Q A;  4WAF A;  2C5L C;  4PS3 A;  3AEA B;  2L83 A;  4ZHP A;  3O65 B;  2G45 B;  2FCN A;  3W5U B;  2BGF A;  5BYQ A;  2QSD A;  5L95 C;  1KLG D;  1DOX A;  3RNE C;  1YIW A;  1C79 A;  3H7P B;  2JF5 A;  3ZRF A;  4EZL A;  4K7U A;  1PDX A;  3DHG C;  3DCG A;  1PQS A;  1TBE A;  2D3B A;  4PS7 A;  3VFK A;  4FHJ A;  3MP9 A;  4IKG A;  2KQ4 X;  4HXD A;  1WJN A;  3P2B A;  3AEG B;  1FXI A;  2Z0D B;  1L5P A;  2ZNV B;  2KQS A;  2WHI A;  2NPT B;  1WGD A;  1CK1 A;  3ML8 A;  1MVK A;  3PVL A;  3QA8 A;  1KRH A;  4BKG A;  2W54 A;  2WDQ B;  2XK5 B;  1WXM A;  2MRP A;  4W9C A;  1Y8R C;  3HUI A;  1IP9 A;  1K51 A;  2RDH A;  4HKZ E;  5D7G A;  5L83 A;  1QOF A;  1ROE A;  2OJW A;  3ZQ4 A;  4G11 A;  4JWS C;  1J19 A;  1I7H A;  2KXJ A;  2KAJ A;  2INC C;  3ZJV A;  2ON8 A;  1UWM A;  3N3K B;  3I57 A;  3HVZ A;  3TBL D;  2V3P A;  2NCN A;  3H9D A;  1GPX A;  4LJO B;  2V0G A;  1QQR A;  2Y5C A;  3QK0 A;  1BXT A;  2WX1 A;  3DBS A;  3RZW C;  3PLV A;  2BS3 B;  2LUE A;  1I35 A;  4AS1 A;  3KW5 B;  3HVD A;  4M00 A;  4NNJ B;  4BKS D;  2Q5W D;  1IGD A;  4KGS A;  3LXF A;  1D3Z A;  1PFD A;  2A5U A;  5LLI A;  2KMM A;  3Q3O C;  3A9K B;  3VDZ A;  1PGA A;  3ZLZ A;  4ZYS A;  4XWW A;  2M0X A;  4FXC A;  1DYQ A;  4C00 A;  3S2A A;  4RM9 A;  4K3C A;  4JIO U;  3T3O A;  1YN3 A;  1X1M A;  1TS5 A;  2PMV A;  2KTF A;  3ZXR A;  3U4E G;  1QIL A;  4DHZ E;  3N9Y C;  3RZF A;  5AZH A;  4NAM A;  3I9V 1;  3FKY A;  4BVU C;  1K52 A;  3U8Z A;  4XGA B;  1CZP A;  3DVN U;  3PRM B;  3B1L X;  1C76 A;  3TL5 A;  3VUY A;  3WAM A;  2K9X A;  2L52 A;  2JY6 A;  2LEK A;  5BYR A;  4RNA A;  4F7Z A;  4B0M A;  4WUR A;  3AXC A;  3M62 B;  3RCZ A;  4PYZ A;  2HTM E;  4RMA A;  2ZVO A;  1YQ4 B;  4EE2 A;  4LDT B;  2KO3 A;  2NVU I;  4WJP A;  3N30 A;  3IT4 B;  3MC8 A;  3OWE B;  2E3T A;  2L32 A;  4I6L B;  1GG3 A;  4MM3 B;  3KWL A;  3WIM A;  3VRB B;  1F77 A;  4GMV A;  1WZ0 A;  4IC7 B;  2BBC A;  2WDV B;  1ET6 A;  4KKJ A;  2K8H A;  1PGX A;  2CU3 A;  1HTO A;  4S0R A;  1E8X A;  4US9 A;  1ISN A;  2Z0E B;  2OED A;  4RF0 A;  3B9J A;  3A9K A;  4HEA 1;  1WE6 A;  4CHK A;  1V6E A;  3LYY A;  3ZDM C;  2DEN B;  4KX6 B;  4D2K A;  4J6I A;  4IM2 A;  2KZR A;  1C78 A;  4ZHO A;  4AJW A;  5IO9 A;  1XLO A;  3Q69 A;  4ITK A;  4FA6 A;  1LGR A;  3V60 A;  3AM9 A;  2KX3 A;  4BBN F;  4X57 B;  2GBM A;  3QIJ A;  1NBF C;  1TIF A;  3DHI C;  2NBU A;  4RM8 A;  2KHW B;  4XWT A;  1IPG A;  1TYG B;  4IWO A;  3TUO A;  2CU1 A;  2WNM A;  4E71 A;  3N20 C;  3Q3N C;  2QJL A;  1WX8 A;  1WMH A;  2INN E;  1EF5 A;  2BB6 A;  3NVV A;  3ZTD A;  1NI3 A;  4GDL B;  3VR8 B;  4OZB A;  2ZVN A;  1EUV B;  2MBH A;  4NJ6 A;  4BKT A;  1TJE A;  2EEL A;  2WX0 A;  1XF5 L;  2J53 A;  4KIK A;  2J0K A;  1RFK A;  3PZ7 A;  4A90 A;  3V05 A;  1GC7 A;  4K81 A;  2WXO A;  2XEW A;  2C7H A;  3RI7 C;  1YN4 A;  1VDV A;  3QHT A;  2N1V A;  5LXI B;  1T5X D;  4EEW A;  1TS2 A;  4C7Z A;  2REX A;  4GGQ A;  4LK0 M;  4NY0 A;  1MG4 A;  3EHV A;  3LDZ E;  2WS3 B;  2LVQ A;  2JWZ A;  2R2O A;  2LGI A;  2WXN A;  2W3S A;  2WU2 B;  1RAX A;  2IO1 B;  4LNK A;  5CHW A;  5BYS A;  2PW9 A;  5E6P A;  2GBN A;  3HM6 X;  3DVG Y;  3IHP C;  2KTR B;  1WM3 A;  2FUH B;  4W9K A;  1QOA A;  3ZVV A;  2I38 A;  1V5O A; 
#chains in the Genus database with same CATH homology
 5BMG A;  4OZA A;  2SAK A;  1C4A A;  1I4G A;  2DLB A;  2AQ1 B;  1GB4 A;  2JYE A;  5EE1 A;  4OVZ A;  1QT9 A;  5HG2 A;  3AEC B;  1D5Z C;  1C4P A;  2M0A A;  2VZK D;  4XDC A;  1IBX A;  3MFG A;  1XCT L;  2PTL A;  3IAS 1;  4L2Y A;  3FAH A;  1B9R A;  4WQM A;  1UGJ A;  3BYY B;  1WGK A;  1XEE A;  1UNS A;  3LB8 C;  2BB5 A;  2JYT A;  3P1M A;  2ONQ A;  4RF1 A;  1JWA D;  4IOI E;  2K22 A;  3P4P B;  4RGM A;  4KGT A;  1WWT A;  4REZ A;  4TSS A;  1FO4 A;  1SBB B;  1MHH E;  1SJH D;  1L0X B;  3P4Q B;  2WXR A;  1FM0 D;  4USA A;  4GDK B;  2K0P A;  3GP7 A;  3P42 A;  5AUI A;  1E9M A;  1MI0 A;  3BVM A;  3FIL A;  4MT5 A;  4DXG A;  2JWU A;  4O1N A;  5T8I A;  2MJE A;  3U2S C;  2DYO A;  3EUB 2;  4A9A A;  4MAC A;  3KLS X;  1IBX B;  2M19 A;  4OZC A;  4DXF A;  1HZ6 A;  5G5H A;  1YNT E;  3R2T A;  1QOG A;  2N9K A;  2WXM A;  2RMM A;  3L4P A;  3Q8A A;  3AE9 B;  3HRD D;  4C7Y A;  2WU5 B;  1A70 A;  2L1A A;  4P6V F;  3Q8B A;  1JCK B;  1TY0 A;  1UUP A;  5E6J A;  1JQ4 A;  1JWB D;  1WSP A;  3ABV B;  3SFD B;  1FNU A;  5HHD G;  4A8X C;  3BK1 A;  3FC4 A;  3URY A;  2INP E;  5AUK A;  3AN1 A;  1XLQ A;  4UDU C;  4YWG G;  1H7W A;  2WDR B;  4JE3 B;  1KF6 B;  1OQR A;  1FRD A;  5D3I B;  1Q10 A;  1MPE A;  2DYM A;  5FR3 A;  1FFU A;  1GOZ A;  1FFV A;  3W9C B;  2N0S B;  1DGJ A;  1J7B A;  3P4R B;  1E10 A;  3RPF C;  1SE2 A;  3E56 A;  2FE8 A;  2BYT A;  1T3Q A;  4RCO A;  1YJI A;  4WAF A;  1TY2 A;  1YMH E;  3AEA B;  4YTP B;  2L83 A;  4ZHP A;  1QLB B;  3W5V B;  2NTT A;  3PO0 A;  3W5U B;  2GRI A;  3ZYY X;  4YXD B;  1ZP0 B;  5BYQ A;  2QSD A;  1EWC A;  3IAM 1;  1MHX A;  2Y5P A;  1KLG D;  1ESF A;  1N61 A;  1DOX A;  1C79 A;  3EGR A;  3AE1 B;  2ICI A;  3ETR A;  2H88 B;  1F2R I;  4TMA B;  2WXH A;  3AB5 A;  3VR9 B;  1PDX A;  1V8C A;  2KAC A;  4N58 A;  1F0Z A;  4HRO A;  2K3U A;  1JML A;  2BTE A;  1XCQ L;  1AWD A;  2XNA C;  3MP9 A;  4IKG A;  4JX1 C;  2KQ4 X;  2WXK A;  2PIA A;  3AEG B;  1D5M C;  2FBW B;  1FXI A;  1STE A;  3AEE B;  1L5P A;  1TKY A;  1SF0 A;  3Q8C A;  3BII D;  5I4D A;  4LLG M;  3CF4 A;  1CK1 A;  1H7X A;  3EA6 A;  1MVK A;  5BMH A;  1KRH A;  3ZGZ A;  4YSZ B;  4WWM A;  1E7P B;  1KH0 A;  2W54 A;  1HQR D;  2WDQ B;  3AE4 B;  4MH8 A;  4NAW B;  4N59 A;  5C2T B;  1XLN A;  1JWU D;  3HUI A;  3AH7 A;  1L4Z B;  2MJ3 A;  1QOB A;  1K51 A;  2WXG A;  1YN5 A;  1AYF A;  1C9F A;  1VRA B;  2RDH A;  1L0V B;  3Q8F A;  4ZRP A;  1FCL A;  1I4Q A;  1J7C A;  2H89 B;  4HKZ E;  5D7G A;  1QOF A;  1N63 A;  2KN4 A;  1ROE A;  3DWM A;  1IGC A;  3U7Z A;  3ZQ4 A;  3AED B;  1SJE D;  4JWS C;  1I7H A;  3VRA B;  5JXV A;  2KAJ A;  4B0E A;  1ACC A;  4YSY B;  3ZJV A;  1VJK A;  2ON8 A;  1XO3 A;  2WXL A;  3KWV A;  2OHF A;  1UWM A;  3CWI A;  3DWG C;  2PVO D;  3KQ4 A;  3AE2 B;  2W55 A;  3I57 A;  1M4V A;  4H2A A;  3HVZ A;  1EM7 A;  4RGN A;  1I4R A;  1XXG A;  3TEZ A;  3AE6 B;  1VZ6 A;  2QEJ C;  2V3P A;  4AQ7 A;  5MPO A;  1GPX A;  1I4X A;  1TZO A;  1D5X C;  1QQR A;  2V0G A;  2IGH A;  2Y5C A;  3W1S A;  3ZJU A;  2V3N A;  1BXT A;  3SEB A;  2Y3A A;  4CQN A;  4C80 A;  2Z8L A;  1IUE A;  4J3O D;  2RDG A;  2BS3 B;  4JPS A;  1WYG A;  1HXY D;  2WXF A;  3AEF B;  4AS1 A;  4XE0 A;  3HVD A;  2CJO A;  1IGD A;  2Q5W D;  3BWU D;  1B1Z A;  4KGS A;  2QMT A;  3LXF A;  4YTN B;  3NZ3 A;  1FD6 A;  1PFD A;  1PGB A;  1ZXH A;  4WH4 A;  2KMM A;  1LO5 D;  1FXA A;  2B76 B;  1PGA A;  1EU3 A;  3R8B A;  1SEB D;  3IT6 B;  4ZYS A;  1L0Y B;  2J52 A;  4KGR A;  4FXC A;  3VQI A;  4XWW A;  1D4B A;  2GI9 A;  3NVZ A;  1DYQ A;  1SE4 A;  3W2D A;  4N6E B;  2BT6 A;  1N5X A;  2N9L A;  1DOY A;  3AV8 A;  1E6E B;  1I4H A;  1QF6 A;  1NEK B;  4A6Q A;  4YSX B;  2G9H D;  3T3O A;  3SR6 A;  5BMI A;  1YN3 A;  1ZE3 D;  2V4I B;  1L4D B;  1TS5 A;  2PMV A;  2WXI A;  4Q2J A;  1AW7 A;  3U4E G;  1HEZ E;  1QIL A;  4HJG E;  3NVY A;  5TSS A;  3N9Y C;  1SSN A;  1HZ5 A;  2CJN A;  1FEH A;  2JZP A;  1NEN B;  4NAM A;  3I9V 1;  3CIR B;  2IGD A;  1NVI D;  2IDY A;  1VR9 A;  1ZDX A;  3PZ8 A;  1FMA D;  1K52 A;  4NZL B;  2WQY B;  3AEB B;  1YJJ A;  1CZP A;  1FNV A;  1C76 A;  1SB3 C;  2ACZ B;  3SFE B;  1CQV A;  1F2R C;  4RGT A;  2K9X A;  2WP9 B;  2L52 A;  4KKI A;  2LEK A;  5BYR A;  1UWX A;  1ZDV A;  1V1O A;  2LHE A;  4RNA A;  4DQO C;  1FNW A;  3B2F A;  1TKE A;  2IJ0 A;  4XDD A;  1JAL A;  2SEB D;  1JWM D;  2WXJ A;  4B0M A;  4WUR A;  1JRP A;  3TSS A;  5H8Y E;  3AMZ A;  1GAQ B;  2HTM E;  3BK2 A;  2NTS A;  3R2I A;  2WXQ A;  2I2Y A;  2PLP A;  2E6X A;  5LNK 1;  1YQ4 B;  2XN9 C;  4EE2 A;  2MH7 A;  4L23 A;  4IDI A;  2YEP F;  2LHD A;  1GTE A;  4YTM B;  2J4X A;  4RFB A;  2AX5 A;  2IGG A;  3P4S B;  3IT4 B;  5FK9 C;  3OWE B;  1JW9 D;  2E3T A;  2L32 A;  1AN8 A;  3NUH B;  4C56 C;  3T3N A;  2QIE B;  5G5G A;  4MM3 B;  3GB1 A;  4ARC A;  3KWL A;  4ARI A;  3AE7 B;  3VRB B;  5H92 C;  1F77 A;  3MC0 B;  5HI1 A;  1VZ7 A;  5HFY A;  1E0Z A;  2BBC A;  2QIL A;  3TEW A;  2WDV B;  1ET6 A;  1HA5 A;  4KKJ A;  1D6E C;  4NJC A;  3IXS A;  1PGX A;  2CU3 A;  1EWY C;  3NS1 A;  1TKG A;  2VZK B;  2ZW1 A;  1T6B X;  1K53 A;  4ZOH C;  1V1P B;  4US9 A;  4ZRQ A;  3Q8E A;  2J42 A;  1EU4 A;  2OED A;  2ZW0 A;  1I4P A;  1ZOY B;  1R7S A;  4RF0 A;  2RPV A;  3B9J A;  3TEX A;  4HEA 1;  1L6V A;  3LYY A;  4RH6 A;  4KX6 B;  3BYT B;  4R3D A;  3AE5 B;  2X38 A;  3V3X A;  1P7F A;  4D2K A;  1FRR A;  2K5P A;  4RGO S;  1GTH A;  5C3J B;  1C78 A;  4ZHO A;  3P63 A;  3BZD B;  2IPK D;  4L1B A;  5D3D A;  2W3R A;  1XLO A;  3Q69 A;  5EE0 A;  1KFY B;  4HKQ A;  4ITK A;  1OQQ A;  4HRS A;  2DWQ A;  1QKZ A;  1NYR A;  1ZXI A;  3AM9 A;  4US8 A;  3AE3 B;  4OHJ A;  1FCC C;  4TQ0 A;  1RWS A;  3ZJT A;  3NVW A;  1TS4 A;  2LFI A;  1JWS D;  4XWT A;  3E9S A;  2KWD A;  1PYW D;  1TYG B;  1VZ8 A;  2D5G A;  2LJI A;  3TUO A;  2AQ2 B;  2WNM A;  1BML C;  2LUM A;  3AE8 B;  1RYJ A;  2R61 A;  2QJL A;  3O13 A;  1N5W A;  2M56 B;  2INN E;  1BUI C;  1ZUD 2;  1GT8 A;  5EE3 A;  2NMQ A;  3BVZ A;  2BB6 A;  2JSV X;  3NVV A;  1NI3 A;  4LTU A;  4M0W A;  4OW0 A;  3UI3 A;  4TQ1 A;  4GDL B;  3U52 E;  3VR8 B;  2W82 A;  2LMC A;  4OZB A;  1SIJ A;  3RFZ B;  3GS2 A;  2PVG C;  3FIL B;  1ENF A;  1TS3 A;  1GB1 A;  1KLU D;  4WIP A;  1TJE A;  2EEL A;  2JU6 X;  1C4C A;  2FUG 1;  1XF5 L;  2J53 A;  2MJD A;  2WXP A;  1RFK A;  5FKA C;  2EKI A;  2BS2 B;  3PZ7 A;  3B2G A;  4A90 A;  1J7A A;  1KTK A;  3V05 A;  2MEK A;  5EE9 A;  1WRI A;  1OFF A;  2YEP B;  1XLP A;  1Y56 A;  1YQ3 B;  2WXO A;  1NYQ A;  1SE3 A;  4YT0 B;  1L6U A;  1YN4 A;  1VDV A;  1RM6 C;  1WXQ A;  1ZPS A;  3C8Y A;  1T5X D;  4JWU C;  4P16 A;  4PT5 A;  1TS2 A;  4C7Z A;  2G1E A;  1N62 A;  1ET9 A;  3WCQ A;  4LK0 M;  2DBY A;  2WLB A;  3MHZ A;  1FIQ A;  2WS3 B;  2HDE A;  2JXT A;  1JRO A;  2LGI A;  2TSS A;  2WXN A;  3MJ5 A;  2W3S A;  1CJE A;  3TEY A;  2AQ3 B;  2WU2 B;  1V1P A;  3BVG A;  2GB1 A;  4A55 A;  1DOI A;  2JX5 A;  2JQR B;  1P7E A;  2PKO A;  1SXT A;  5BYS A;  2PW9 A;  2BS4 B;  1VLB A;  5GXG B;  3H8H A;  1N60 A;  1PUT A;  2KDM A;  1QOA A;  1V97 A;  3NRZ A;  2BW2 A;  4GLS C;  1C77 A;  2I38 A;  1K50 A;  2N7J A;  3J9C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...