1QOFA

Ferredoxin mutation q70k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDKIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qofA00
1XLQA 1KF6B 2L83A 1J7AA 1FFVA 3HUIA 3ZYYX 2WDRB 1UWMA 3VR8B 4LTUA 1PUTA 2OHFA 1E10A 1ROEA 1TKEA 4P6VF 1DOXA 1FMAD 3SR6A 3FC4A 1JW9D 1N5WA 2G1EA 3AEAB 3P63A 1DOYA 1E7PB 1FM0D 2MJ3A 1L5PA 1N60A 1SF0A 1ZUD2 4N6EB 4WQMA 4C80A 1FFUA 2W3SA 1ZP0B 2JX5A 3AE6B 5H92C 3P4PB 1QOBA 1RM6C 1RFKA 4YTPB 3P4RB 3ABVB 2WU2B 4KX6B 1NYQA 1J7BA 1JWAD 1VJKA 2DBYA 2PVOD 3AMZA 4HROA 3W9CB 1ZXIA 3BIID 3AECB 4YTMB 3W5UB 4USAA 5H8YE 3SFDB 3P4SB 3AE7B 3B2FA 1YJJA 3W5VB 4FXCA 1OQQA 3AN1A 1JRPA 4JX1C 1N63A 1NVID 1DGJA 2BS4B 3NVYA 4ITKA 2MJEA 1JQ4A 1AYFA 1QLBB 4YSXB 5MPOA 3NVWA 4C7YA 3NVZA 3LB8C 2QIEB 1PFDA 1V97A 2CU3A 2QJLA 3NS1A 2B76B 1FRRA 2ACZB 1NENB 1FXAA 2MJDA 1FO4A 2WDVB 1SIJA 1JALA 4C7ZA 3AE2B 2LEKA 2WQYB 2WS3B 1AWDA 4US8A 1L6VA 2HTME 3P4QB 3VRAB 1E9MA 2Q5WD 1QT9A 2DWQA 3NRZA 1FRDA 1TYGB 3AV8A 2W54A 1DOIA 3HRDD 4ZOHC 5EE9A 1F0ZA 1WRIA 1IUEA 4YT0B 3DWGC 2KMMA 2PKOA 3AEDB 5EE3A 4YXDB 1XLNA 1N61A 4YSZB 1YQ4B 1V8CA 3CWIA 4JWSC 1FXIA 1YQ3B 3B9JA 2KAJA 1JROA 1I7HA 1KRHA 1NI3A 2BT6A 2PVGC 3PO0A 2Y5CA 2W55A 4US9A 2CJOA 5G5GA 3AEFB 2BS3B 2N0SB 1KFYB 1A70A 2WDQB 3AEBB 5G5HA 3VR9B 1NYRA 2M56B 3AE5B 1XLOA 2L52A 4IDIA 4JWUC 4A9AA 2M19A 2FBWB 2WU5B 1OFFA 2JQRB 3AE1B 2BS2B 2H89B 5C3JB 1CJEA 1L6UA 3AE9B 2K9XA 5AUIA 1B9RA 1N5XA 2PIAA 2W3RA 3AE3B 3CIRB 4ZHPA 3KWLA 1TKYA 4YTNB 1RWSA 1WXQA 3AH7A 5AUKA 3RPFC 2WLBA 1EWYC 3NVVA 5C2TB 1E6EB 3B2GA 3FAHA 3LXFA 1L0VB 3AE8B 1WGKA 2WP9B 3AE4B 1J7CA 1QOFA 2E3TA 1FIQA 4YSYB 1CZPA 1RYJA 1WWTA 3HVZA 3L4PA 1TKGA 1N62A 5EE1A 3VRBB 3AB5A 1SB3C 2CJNA 3EUB2 4N58A 2K22A 3AEEB 5EE0A 3P1MA 1T3QA 1PDXA 1JWBD 1VLBA 1E0ZA 1NEKB 3AM9A 4N59A 5GXGB 4WWMA 1QOGA 3ETRA 1QF6A 2EKIA 2K5PA 1R7SA 1XLPA 1QOAA 1GAQB 3SFEB 1TJEA 2H88B 1XO3A 4ZHOA 1VDVA 1ZOYB 1YJIA 3AEGB 1GPXA 1WYGA 2AX5A 3DWMA 3WCQA 2MH7A 1OQRA 4HRSA
chains in the Genus database with same CATH superfamily
3TMPB 5IP4D 4IWQA 1FFVA 4ANUA 2FCNA 3VR8B 1E8WA 2BQQA 3LDZE 1QKZA 1HQRD 4N6EB 1YN4A 1TGZB 5H92C 4HDQA 3AI5A 2KN4A 3ABVB 2VH1A 4JPSA 5LLIA 3TCAA 2BYTA 3RD2A 4R3DA 3VXWA 3EFCA 2KJRA 3B2FA 2I1KA 4FXCA 4EZJA 4ANXA 2D3BA 1OTRB 3BZDB 4OVZA 1PFDA 2B76B 4NAWA 1P1AA 3RI7C 1KLUD 1JALA 4C7ZA 1P7FA 2CHWA 1AWDA 2DZJA 1FXTB 2WX1A 2RSUA 4GU2A 1FRDA 1E8XA 2J53A 4ZOHC 3UIOB 3DVGX 5D3DA 4YXDB 2KFKB 3WAPA 3HM6X 2JWUA 3PO0A 4FLHA 3ZUNA 2N9XA 4I6NB 3Q8EA 3AXCA 2ASQA 3HHMA 3NG0A 1SXTA 3IHPC 5KHOA 2KLGA 3MFGA 1K53A 4A20A 1OGWA 1Q5WB 4NPNA 4II2B 3KYCD 1N5XA 2ZCBA 5IO9A 4CYEA 2AL6A 1FEHA 2WYQA 2V3SA 2WXNA 3AE8B 3K9PB 2BKFA 5I4DA 4YSYB 3GZNI 3Q8CA 1TKGA 3IXSA 5EE0A 2KN5A 1H8CA 1F2RC 3UI3A 5HFYA 2JYTA 2A4ZA 5JH5C 2L8JA 5TSSA 1QOAA 4KKIA 2H88B 2M0AA 1GG3A 3PTFC 2DLBA 5E6OA 3A4RA 3A1QB 1E10A 3CSTA 3VUWA 3ZJTA 2G1EA 2KWDA 1DOYA 1GOZA 3L16A 4WQMA 2JYEA 2JX5A 1UELA 3KW5B 2YEPF 2JF5A 4KV2A 2KOXA 1WZ3A 2L32A 2CR5A 1JRUA 3T3NA 2XBBC 2WXLA 3N30A 1OQQA 3VTUA 1QLBB 2JVCA 1WGRA 4BKGA 1WM3A 4OW0A 4LCDE 3OG5A 1V97A 3Q14C 1L4ZB 4ZRPA 4AOFA 2Y3AA 3WALA 3Q3FA 2WS3B 1L6VA 1WF9A 2HTME 2KZRA 1IUEA 2FUG1 1WR1A 2KKCA 3B0AA 4MGYE 3RNCC 2KD0A 4MM3B 1E90A 2KTRB 3B9JA 3DQVA 1NI3A 3DCGA 4BKSA 1QQRA 1VCBA 3R2IA 3W1YA 2NVUI 3VH3B 4C4VA 4YTNB 2LUMA 3QQ8B 1CQVA 4GDKA 4GLSC 1L0VB 1K52A 3BVMA 3GZNB 1T0SC 1E8ZA 4FULA 1QOFA 3MJWA 1ZPSA 2E3TA 3H6NA 2BWES 2DENB 2HJ8A 3GE8C 2K6QA 2O2VB 1WX8A 4XDDA 2IO1B 3TEXA 4XE0A 4AWJA 4EZLA 5FK9C 2L76A 5HI1A 2D3CA 1YJIA 4HJKA 2JZ3B 4GN1A 1J7AA 2N7JA 2C7MB 1TKEA 3CMMB 2XN9C 2DAFA 3SR6A 1N60A 2REXA 4B9KA 4RF1A 5BYSA 1ET9A 3U30A 2QEJC 2MBHA 2PTLA 4DXAB 4MEMA 5IOIA 2LRUA 1WGHA 1YD8U 4DWFA 2WDTB 3NHEB 3AECB 2KO3A 5H8YE 2JXXA 3U4EG 3SU8X 3H8HA 4KVGB 1N63A 5G55A 1SJED 4EFOA 2O6VD 3RZWC 1IBXA 2ZJDA 3SHQA 2MJDA 2KK8A 2FE8A 4WH4A 3OLMD 2ZNVC 1Z2MA 3V6EB 2BKRB 1F0ZA 2KMCA 3DWGC 2N1WA 1PGAA 5J17A 3RT3B 2ZZPB 3T9LA 3A1QA 4HVBA 3MP9A 2GBKA 3RNGC 1MVKA 4W9EA 2PVGC 1I7HA 1HTOA 3VVWB 2M56B 1WXSA 3AE5B 1XLOA 4PYZA 4FJZA 2BS2B 1T0RC 5AUIA 4LJOB 4TQ1A 4WAAA 2WXPA 4C56C 4DQOC 2WXMA 3R7RA 1BT0A 1AN8A 4MT5A 4LNOA 1RYJA 3V62A 2XNAC 3A33B 3DBRB 2KQSA 4PS7A 3EUB2 4HKQA 3VQIA 2SAKA 4ANVA 1NEKB 2IDYA 4N59A 1KOTA 4WWMA 1R7SA 2XK5B 4JIOU 1TJEA 4LLGM 5HKHA 3WCQA 2KACA 1XLQA 1HXYD 3BK1A 2G4DB 2N1VA 1TS4A 1VZ7A 3RUIB 4MM3A 1DOXA 4WWPA 1P98A 4FJYA 2RMMA 2MJ3A 1FM0D 5DPWA 3Q8AA 1E8YA 1WX9A 1WR6E 1QOBA 1NYQA 1J7BA 1I4GA 3RNEC 3AMZA 3HIZA 3PRZA 3RNFC 1JMLA 1EU3A 1JRPA 4XDCA 2CHZA 3APCA 4NY0A 3B08A 4FHJA 3NVWA 1R4NI 2CU3A 3ZIMA 1ZXHA 1L2NA 1EWCA 4ZRJA 2LEKA 2WQYB 2O2VA 2RDHA 3WA0A 3DBSA 2W54A 1UZXB 1FPYA 1JWUD 3R8BA 4ARIA 5J18A 1N61A 3EC8A 2UU7A 3SDLC 2BT6A 2LJ5A 2ZW1A 2N0SB 1I4XA 2LHDA 2L52A 3Q8BA 3AE1B 3H1UA 5GMVA 3E56A 1TKYA 2DZMA 2ZPYA 1PGXA 1RFAA 1LGRA 3HVZA 1SB3C 2GBMA 2IGHA 1BXTA 1VLBA 2OEDA 4FADA 1E7UA 1QOGA 1SSNA 2D07B 2K8HA 2Z59B 4WIPA 2KNBA 1OEYA 1ZGUB 4FHKA 2KDIA 1F77A 4KGSA 1MJDA 1FMAD 3FC4A 4HK2A 3AE6B 1ZP0B 5HG2A 1RFKA 5FKAC 3BIID 1KLVA 2KLCA 4YTMB 3W5UB 4G0NB 3P4SB 2LMCA 1YJJA 3U7DA 1TS2A 1DYQA 2EMSA 1WI0A 1R4NB 4A8XC 2AQ3B 3NVYA 2KTFA 1V80A 2WXHA 3TBLD 3NS1A 2QJLA 2LRWA 1HEZE 4DDGD 1YMHE 4K81A 1SIJA 3KQ4A 3N20C 1WXMA 2N9EB 4RGMA 3QIJA 5TR5A 1DOIA 3I9V1 2INNE 5JHBA 2NCNA 2VZKD 2L00B 3L10B 2A5UA 4F1SA 1SIFA 1YN3A 2JPHA 1TS3A 3VR9B 3AEBB 4BBNC 3BINA 1R4MB 4LK0M 1GUAB 2M19A 1WJ6A 2JQRB 2ZPNA 5C3JB 4B0MA 1L6UA 5D3IB 1B9RA 4FN2A 1WXQA 3L54A 3ZQ4A 1WGKA 4RNAA 1HZ5A 3DVNV 5BO4B 3L13A 4M01A 5C23A 2K22A 4P1CC 2K5PA 3W1SA 2MP2B 2GB1A 3SFEB 1HA5A 2NBVB 1FNVA 4NJ6A 2MWSB 4ASWC 2LGYA 3RNBC 4LTUA 2BF8B 2MBEA 1ROEA 4II3B 2KC2A 2K8BA 2MLBA 3UQAA 3EA6A 1D5ZC 4NJ7A 1VD2A 3DHGC 5DCNA 3WAOA 5BMGA 2GI9A 2DBYA 4HLEA 4OVUA 4DXGA 3ML8A 4F8CB 4LNIA 4L23A 3Q8FA 4G3XB 1Q10A 4C7YA 1WM2A 4LNNA 3RMKC 4GMVA 1NENB 1WZ0A 2DYMA 1PGBA 4K7WA 4XWWA 1YN5A 1QT9A 2DWQA 3NRZA 4C4VB 3IG3A 3HRDD 5EE9A 3Q3MC 4MDKE 4GDKB 3DVGY 4GGQA 3HK0A 1K50A 3BVGA 2LGDA 3UIPB 3EGRA 1UBIA 4TKNA 2DNFA 1KJTA 3MTNB 1B1ZA 2WDQB 1KFYB 1A70A 2BB6A 2GBNA 4FJVB 4IDIA 4JWUC 3N3KB 3U52E 2Z0EB 5AUKA 4W9IA 3A9JA 2KWVB 2I1JA 4MSQB 4HXDA 2SEBD 3H7PA 4BOZB 4TQ0A 2KQ4X 1WXVA 2V0GA 2PW9A 1D3ZA 2GBJA 2AX5A 2DYOA 1SJHD 4MELA 2N4FA 1TTNA 4B6WA 3HM3A 2L1AA 2C5LC 2OHFA 3PVLA 1V86A 3P63A 1IBXB 4IM0A 2QC8A 3Q3JA 1E7PB 2DHZA 2MW5A 4NQKE 4O1NA 4FA6A 2IJ0A 3P4PB 4KIKB 4HWIB 2QHOA 1WXAA 1XXGA 2W82A 4IWOA 5D2MB 3M3JA 4N9F4 3QWZB 4LJPB 1V6EA 1C78A 4JX1C 4ITKA 2FCMA 3UQBA 1V5TA 3ZJUA 3IAS1 2J7QB 4LDTD 2KXJA 3R2TA 1TY0A 4DXFA 4JQWC 2MP2A 4TMAB 4YT0B 1C9FA 1WX7A 2KJ6A 2INDC 1OEYJ 1P9DU 4AJYB 3WANA 3APFA 4US9A 5G5GA 2Y5CA 2N9LA 3AEFB 1IGCA 5E6JA 2K3UA 3M63B 5G5HA 3J9CA 1GC7A 1OFFA 1TT5B 2IY1B 2PPHA 2JRIB 2WX0A 2LASA 2R2QA 3TEWA 3KWLA 3NVVA 2MA9B 5D7GA 1UWXA 1WE6A 1CMXB 5EE1A 1IP9A 3R66C 1GJZA 1J8CA 1WGYA 2D5GA 2CU1A 2MH7A 1OQRA 3HUIA 4AQ7A 2FCQA 4BFRA 4HEA1 3EHVA 4ZRQA 1YJ1A 1MHXA 2MQJA 3RCZA 4C80A 4OVVA 5CTRC 3DBRI 2FUHB 4B0EA 3BYYB 3WAMA 1JWAD 4A55A 3T3OA 4KSLC 2JSVX 3KWVA 2BTEA 3SFDB 1VR9A 2IO0B 2K39A 1VZ8A 1WFYA 4YL8A 1DGJA 2D3AA 2MJEA 3B1LX 4KSKC 1E5WA 3ZDMC 3PGEA 3AE2B 3MC9A 1YIWA 2PLPA 4E71A 2K25A 3OAWA 2LZ6A 2V4IB 4NJCA 2KX3A 3CWIA 1V8CA 1LM8B 2Y5BB 3DBHB 3MHZA 4ANWA 2FAZA 1U4AA 1EF1A 1WJ4A 3QK0A 4A9AA 3LJ3A 4J3OD 3IVFA 2JU6X 2M4NA 2MBOA 2ZVNA 4S17A 3R3MA 4M8MA 4KIKA 4RMAA 3ZNHB 2INPE 1TIFA 1ZKHA 1E6EB 3A9KA 3FAHA 4HPMB 3L17A 2PEAA 4WWNA 3U7ZA 3AB5A 5E6PA 2J0KA 2CS4A 2NPTB 3P1MA 5BYRA 1EO6A 2BB5A 4A3OA 4I6PA 4ICUA 1GC6A 3ETRA 1LQBA 2VH2A 1XLPA 3AEGB 1M94A 5LXIB 3PZ7A 3Q69A 2BW2A 2WXGA 2WGSA 1FD6A 4OHJA 1KF6B 4MJSA 4K3CA 2WDRB 5HHDG 1P7EA 4KZCA 2IO2B 3VH4B 4XGAB 3Q3NC 3AEAB 4M00A 2LVQA 3N32A 1I4RA 1L5PA 1SBBB 2B3AA 4W9DA 2O6VB 2X8XX 4KX6B 1PYWD 4LNFA 3EECA 2RD0A 4K1RB 1GNUA 1L0XB 1ZXIA 2IO3B 4IC7B 2KDBA 4BKTA 1FCLA 3ZJVA 1UF0A 2R61A 2RDBC 3VUYA 4OZCA 3PS6A 5J2RA 3K9OB 2DZIA 4PYUA 1RRBA 3UF8A 4NZLB 3MJ5A 3OJ3A 2G45B 1TYGB 3GP7A 2GMIC 5IA7A 3PLUA 1Q1OA 2V1YA 2M17A 4JGHB 1JROA 1E7VA 3AU4A 1TY2A 2DYBA 2YLMA 2I38A 2KX0A 2E6XA 3N1XC 3UINB 2LVPA 4C00A 1G6JA 2WU5B 4XYCA 1GB4A 2LGSA 5CHFA 1SE2A 2W3RA 1WY8A 3CIRB 1VZ6A 2LI5A 3RPFC 3UGBB 3N1YC 3CSFA 4GOCA 5C2TB 2OJWA 2LJIA 2WWZA 1HZ6A 3KLSX 1BMLC 3ZRFA 4OZBA 3Q2AC 1GB1A 4WJOA 1UNSA 4G50A 3ZO5B 3DHHC 4KDLB 1GAQB 2LGXA 1R4MI 1C1YB 1NI2A 2TSSA 1T5XD 3R7QA 4W9KA 2RPVA 3KYDD 3ONSA 3DBLI 4A6QA 3ALBA 4DHJD 1IGDA 1F2RI 4NAMA 2Z8LA 1ZUD2 4ICVA 1FFUA 2VRRB 4GB9A 4I6LB 4NQLB 1UH6A 2L05A 3P4RB 2WU2B 3V3XA 2G4SA 1J0GA 3RYTA 3IT6B 2J52A 3DPDA 2WXKA 3ZNZB 4EE2A 3W5VB 1RLFA 1XF5L 2JUOA 2JT4B 1JQ4A 1EU4A 4DHZE 2IGGA 2AEHA 4NNJB 2MHJA 1SE9A 2NPTA 1LO5D 2WXJA 4W9CA 3V05A 3P4QB 1F9JA 2BVCA 3URYA 3A9JB 3N1ZC 1TZOA 2PKOA 3PHXB 3TIXA 4YSZB 3ENEA 4IG7B 1V49A 3BWUD 3H7PB 2W55A 2CJOA 3IT4B 1ZE3D 2Z0DB 1NYRA 1Z5SB 2ZCCA 1NBFC 2GRIA 4JE3B 3RFZB 2O6VA 3AE9B 3AU5A 4RGOS 3AE3B 3NZUA 3TUOA 1VRAB 1TZ1A 4JLCA 1ISNA 4DBGA 1KH0A 4L1BA 3KH0A 1WRDB 2R2OA 4KDIC 3ZTCA 2QDFA 2DZKA 2LUEA 1ESFA 1E0ZA 1WE7A 2KC1A 4TUUA 2NMQA 1X1MA 1C79A 1M4VA 4MH8A 2IZVB 1WMHB 1WYGA 3DBLB 2CKHB 3NS8A 2J42A 4HRSA 4EUTA 1EUVB 4IM2A 1KTKA 3C19A 3JW0X 3ZYYX 3JVZX 2LXCA 5D94A 4RM9A 1YX5B 3LYYA 3I57A 1FNWA 2ICIA 2J0MA 3ECIA 2MEKA 1XT9B 1STEA 3W9CB 4BKSD 1T6BX 2HTHA 4AUQC 4TSSA 2N9PC 1LXDA 4GXBA 3SEBA 3GOEA 4WJPA 3NVZA 1MPEA 2VZKB 3VDZA 2K8CA 2IGDA 1XCTL 1F52A 2JWZA 1Y8RC 2EELA 1P0RA 3OJ4B 5BMHA 4HCPB 2AWTA 2N9KA 2C9WB 3QHTA 1XLNA 4JWSC 1IYFA 1C4PA 5L95C 1L4DB 5JHAA 3P2BA 3ZGZA 1V1PA 5JXVA 4BAXA 3H9DA 1NDDA 4PS3A 3VHTC 4ZHPA 1RWSA 4P7IA 2WLBA 3NOBA 3KVFB 2AQ1B 2WXQA 1D5MC 4CQNA 4A90A 2GLSA 1FIQA 1SEBD 1L7YA 1T3QA 1BUIC 2AL3A 2MSED 5GXGB 4KZ0A 3ZXVA 3SD5A 2G9HD 4HJGE 3MC0B 1ZOYB 4KGRA 2CHXA 3VAWA 2NTTA 3DDCB 3QJZA 1WGDA 1PUTA 1WSPA 4HCNB 1V9JA 1H4RA 4P6VF 2N7DA 2KWCA 1N5WA 4M0WB 3C0RB 3KUZA 3L08A 3OWEB 5DPSA 4PS8A 2MBQA 1IPGA 4DK5A 1XCQL 3M62B 3PZDA 1VJKA 2HD5B 2ON8A 3KUCB 1RAXA 5BYQA 4MSMB 3BK2A 3EFUA 1AYFA 4WQOB 4TV3A 4YSXB 5LXHA 2QIEB 4IW0A 2YVCA 1C77A 2NBUA 4RCOA 3I63C 1FO4A 3NZSA 2LD9A 4E3CA 3QA8A 5DPRA 1XD3B 2JY6A 3A9KB 1WMHA 4RH6A 2KMMA 4HDOA 2KHWB 2D3GA 1FXIA 1F1HA 3M95A 2ZNVB 1D4BA 1MFWA 4MGIE 2QMTA 4S0RA 2BS3B 4MACA 4Q2JA 1MHHE 4WWOA 3U2SC 2FBWB 1CK1A 2H89B 1CJEA 5AEKB 2RDGA 3X23A 2JXTA 2L0TA 3BYTB 3JSVA 3CF6E 4MJSB 1FCCC 3LXFA 4P16A 2WP9B 2KQ7A 4KGTA 3VRBB 3DBHI 3H7SA 4ZRKA 2EKIA 1QZEA 4ZDVA 1JWMD 1XO3A 1VDVA 2WXOA 3KUDB 2PJHA 4RFBA 1UGJA 3TJPA 3V60A 2GOWA 1K51A 3I3TB 1D6EC 2FCSA 4GSWA 3PREA 2K6DB 1SF0A 3MC8A 2M1MA 2GBRA 4YTPB 1WH3A 4LDTB 1YQBA 3DOWA 5EDSA 2WHIA 5JZEB 1P3QU 2QILA 2DX5B 2ZEQA 4GDLB 4IUMB 1EM7A 2HDEA 2KWUB 4JL9A 1PQSA 5G2NA 2KDEB 1NVID 4K7SA 3ZKJC 3PLVA 2PE6B 2ACZB 2BGFA 4P1BC 2WXFA 2YEPB 2LWPA 3TEZA 2I2YA 2ZVOA 4RM8A 1JWSD 3GS2A 1K8RB 2KJHB 3AEDB 2ONQA 2QSDA 1WGGA 4RGTA 2JRHA 4PK1A 4M0WA 4X57B 1I4HA 1YNTE 3NZ3A 3W2DA 3A4SC 2V3NA 1I35A 2K9XA 4K7UA 2IYDB 3T8MA 5IKCM 3IBEA 3B2GA 3JYUA 2KDFB 3NY5A 4RF0A 1SGHA 1AW7A 1XEEA 1J7CA 2KFKA 2J4XA 4YWGG 2RR9A 2XEWA 2LVOA 1WWTA 3L4PA 1N62A 1ET6A 4N58A 2FIFA 2V3PA 3NUHB 1JWBD 1TBEA 4EEWA 4HPLB 4KKJA 2X38A 1A5RA 1SE3A 4IKGA 5AZHA 3VFKA 4BOSC 1QILA 3DWMA 5AZFA 2EMTA 2KANA 3PRPB 3PV1A 2V9HA 3IFWB 4WURA 1WYWB 4EZKA 3AULA 3RNAC 3PSEB 4W9GA 3GB1A 2W3SA 3FILB 2NBWB 1UGMA 4M02A 4BBNF 1WJUA 4HROA 4ACFA 3PT2B 2L7RA 2MCNB 1ZDVA 1MG4A 1ZW7A 4XX5A 3S2AA 4RGNA 1T0YA 1YOVB 3P42A 2WXRA 2FIDA 1FRRA 3U8ZA 1XQQA 3X0WA 2NTSA 1ENFA 3GE3C 3C8YA 2WDVB 4W9HA 2JZZA 5FR3A 3QCAA 4URKA 1MI0A 2KT7A 3TL5A 3AV8A 2ZW0A 1SE4A 3QARA 1S3SG 2WNMA 4F7ZA 2D2QA 1Y56A 3D32A 3VTVA 5CHVC 2IBIB 1KM7A 2JZPA 4UDUC 2D10A 1C4CA 4A3PA 2KMAA 1YX6B 3AH7A 2V4LA 2LGIA 3ZRCA 2KVRA 3DVNU 4XWTA 5LNK1 4AJWA 1S1QB 4GDLA 3AE4B 2KTRA 1N6ZA 5BMIA 3V61A 1I42A 3ZNGC 2CJNA 5IN7A 3AEEB 4CHKA 4IWPA 1WIAA 3AM9A 5IAAC 4PT5A 3IAM1 3DHIC 4WAFA 1WJNA 4MGKE 2DAJA 1GPXA 4G11A 4IOIE 4US8A 1UWMA 3MHSD 2MRPA 4REZA 2NS5A 2FNJB 4W9LA 2MBBB 2AYOB 2IY0B 2BYEA 3BY4B 3O13A 2BYFA 2PMVA 2KFJA 4ZYSA 1EF5A 2HJ1A 4W9FA 1T0QC 2PVOD 2UYZB 3FKYA 4AP4C 4MGZE 4FBJB 3AE7B 2MX2A 1V5OA 2BS4B 5MPOA 2HE7A 5E6NA 1V1PB 2BBCA 4ZYNA 3WIMA 4EKUA 1E9MA 4HKZE 1UD7A 2C7HA 4XC2A 3QAQA 2EKEC 2PE9A 1WRIA 2IPKD 3Q3OC 1YQ3B 2LFIA 2K1FA 2KAJA 3RN9C 1KRHA 1FNUA 3ZVVA 4GIVA 3FILA 4OZAA 5CHWA 4WJNA 4D2KA 4HPPA 3HVDA 1AARA 3O65B 4B95A 2RPQA 3ZNID 3QX1A 3L0WB 1EWYC 2RGFA 1CZPA 4NAWB 2AQ2B 2M8SA 4DHJB 2N7EA 3N9YC 3PPAA 1PDXA 2C7NB 2UWQA 5C1ZA 5KHQA 3ZDTA 4WJQA 3ML9A 5DPTA 3APDA 3TEYA 4J6IA 2K0PA 3RULA 2L83A 5AZGA 4EOYA 3NJTA 3PHWB 1JCKB 2KVZA 1JW9D 3TSSA 3VUXA 2INCC 2D11A 2G3QB 1C3TA 1RM6C 2L0FA 4ZRIA 2XK5A 4K3BA 4MH0E 1L0YB 1J19A 1I4QA 2M0XA 4L2YA 4USAA 1I4PA 1UUPA 2OJRA 3AN1A 4QAYA 2Y5PA 1MG8A 4XZ4A 3LB8C 4M8NA 1D5XC 4LNKA 1FXAA 4ARCA 2BPSA 3RZFA 2NR2A 5L83A 3VRAB 4BZAA 4CO7A 3JSVB 2KYWA 3ZTDA 2KDMA 4E74A 1HE8A 5EE3A 3QC8B 1YQ4B 3W1SC 1V2YA 3E9SA 3Q6BA 4IM3A 3ZLZA 1ZDXA 5D6JB 5CX3A 1C4AA 2QCZA 1ACCA 2L3ZA 2LXAA 1TS5A 2C60A 3VTWA 3ZW3A 1Q0WB 1C76A 5T8IA 1UBQA 4AS1A 1KLGD 2PIAA 4W9JA 4H2AA 4BVUC 4DHZB 5FR6A 2J0JA 1OQYA 1LFDA 3PZ8A 2BWFA 2BYVE 1HTQA 3I5JC 2LHEA 2OOBB 1V1OA 2W9NA 1QF6A 3V6CB 2WXIA 3ZXRA 4ZHOA 3BVZA 1V81A 2Q5WD 4DDID 3PRMB
chains in the Genus database with same CATH topology
4OHJA 1KF6B 1FFVA 2WDRB 5HHDG 3VR8B 1P7EA 1F77A 4KGSA 1K51A 1FMAD 3FC4A 1D6EC 3AEAB 1QKZA 1I4RA 1L5PA 1HQRD 1SF0A 4N6EB 1YN4A 1SBBB 3AE6B 1ZP0B 5H92C 5HG2A 1RFKA 4YTPB 2KN4A 3ABVB 4JPSA 4KX6B 1PYWD 2QILA 5FKAC 2BYTA 1ZXIA 1L0XB 3BIID 4R3DA 1FD6A 4YTMB 3W5UB 4GDLB 1EM7A 3P4SB 2HDEA 2LMCA 1YJJA 3B2FA 4FXCA 1TS2A 1DYQA 4A8XC 2AQ3B 1NVID 3NVYA 3BZDB 1FCLA 2WXHA 3ZJVA 4OVZA 1PFDA 2QJLA 3NS1A 2B76B 2R61A 1HEZE 2ACZB 4OZCA 1YMHE 1KLUD 1SIJA 1JALA 3KQ4A 4C7ZA 1P7FA 2WXFA 1AWDA 2YEPB 4RGMA 4NZLB 3TEZA 3MJ5A 2I2YA 1FRDA 1TYGB 3GP7A 2J53A 1DOIA 1JWSD 2INNE 3I9V1 4ZOHC 3GS2A 5D3DA 3AEDB 4YXDB 2VZKD 2ONQA 2QSDA 4RGTA 1JROA 2JWUA 3PO0A 1TY2A 1YN3A 1TS3A 3Q8EA 3VR9B 3AEBB 4M0WA 1I4HA 1YNTE 2I38A 3NZ3A 4LK0M 1SXTA 2E6XA 2M19A 2WU5B 2JQRB 3W2DA 3MFGA 1K53A 5C3JB 4B0MA 1GB4A 1L6UA 2V3NA 5D3IB 2K9XA 1SE2A 1N5XA 2W3RA 3CIRB 1B9RA 1VZ6A 3RPFC 1WXQA 5C2TB 3B2GA 1FEHA 3ZQ4A 2LJIA 2WXNA 4RF0A 3AE8B 1HZ6A 1AW7A 1WGKA 1XEEA 3KLSX 4RNAA 1J7CA 1BMLC 1HZ5A 2J4XA 4YWGG 4OZBA 5I4DA 4YSYB 3Q8CA 1WWTA 3L4PA 1GB1A 1TKGA 1N62A 1ET6A 1UNSA 4N58A 2V3PA 2K22A 3IXSA 3NUHB 5EE0A 1JWBD 1F2RC 4KKJA 3UI3A 2X38A 5HFYA 2JYTA 1SE3A 2K5PA 4IKGA 3W1SA 5TSSA 2GB1A 1QOAA 1GAQB 4KKIA 3SFEB 2H88B 2M0AA 1HA5A 2TSSA 1QILA 3DWMA 1FNVA 1T5XD 2RPVA 2DLBA 4A6QA 4LTUA 4WURA 1IGDA 1E10A 1F2RI 1ROEA 4NAMA 2Z8LA 3ZJTA 2G1EA 2KWDA 1DOYA 3EA6A 1D5ZC 3GB1A 1GOZA 1ZUD2 4WQMA 1FFUA 2JYEA 2JX5A 2W3SA 3FILB 5BMGA 3P4RB 2YEPF 2GI9A 2WU2B 3V3XA 2DBYA 2L32A 4HROA 3IT6B 2J52A 3T3NA 2WXLA 2WXKA 1ZDVA 4EE2A 3W5VB 4DXGA 1XF5L 1OQQA 4RGNA 3P42A 4L23A 3Q8FA 1JQ4A 1QLBB 2WXRA 1Q10A 4OW0A 1EU4A 4C7YA 1V97A 1FRRA 1L4ZB 4ZRPA 2IGGA 1NENB 2NTSA 1ENFA 3C8YA 2WDVB 2Y3AA 1LO5D 5FR3A 2DYMA 2WXJA 1PGBA 2WS3B 4XWWA 3V05A 1L6VA 1MI0A 2HTME 3P4QB 1YN5A 1QT9A 2DWQA 3NRZA 3AV8A 2ZW0A 1SE4A 3HRDD 5EE9A 3URYA 4GDKB 1IUEA 2FUG1 2WNMA 1TZOA 2PKOA 1K50A 4MM3B 3BVGA 4YSZB 3B9JA 1NI3A 3BWUD 1Y56A 2W55A 3EGRA 2CJOA 3IT4B 1QQRA 1ZE3D 1B1ZA 2WDQB 1KFYB 1A70A 2BB6A 1NYRA 4IDIA 4JWUC 2JZPA 3R2IA 4UDUC 2GRIA 4JE3B 1C4CA 3RFZB 3U52E 3AE9B 4RGOS 3AE3B 3TUOA 4YTNB 5AUKA 2LUMA 3AH7A 1VRAB 2LGIA 1CQVA 1KH0A 5LNK1 4GLSC 4XWTA 4L1BA 1L0VB 1K52A 3BVMA 3AE4B 1QOFA 1ZPSA 2E3TA 5BMIA 2SEBD 2CJNA 1ESFA 3AEEB 4TQ0A 2KQ4X 1E0ZA 3AM9A 4XDDA 3TEXA 4PT5A 3IAM1 4XE0A 2V0GA 2NMQA 5FK9C 1C79A 2PW9A 4WAFA 1M4VA 5HI1A 1YJIA 4MH8A 1GPXA 1WYGA 2AX5A 2DYOA 2J42A 4HRSA 4IOIE 4US8A 1SJHD 1J7AA 1KTKA 3ZYYX 2N7JA 1UWMA 2L1AA 2OHFA 1TKEA 2XN9C 3SR6A 3P63A 1IBXB 1E7PB 4REZA 1N60A 3LYYA 4O1NA 3I57A 4RF1A 5BYSA 1ET9A 2IJ0A 1FNWA 3P4PB 2QEJC 2ICIA 2PTLA 3O13A 2PMVA 4ZYSA 2MEKA 2PVOD 1STEA 3W9CB 1XXGA 2W82A 3AECB 1T6BX 5H8YE 3U4EG 3AE7B 3H8HA 4TSSA 1C78A 4JX1C 1N63A 4ITKA 2BS4B 3SEBA 1SJED 5MPOA 3ZJUA 3NVZA 1MPEA 1IBXA 2VZKB 3IAS1 2IGDA 2MJDA 1V1PB 2BBCA 1XCTL 3R2TA 2FE8A 4WH4A 1TY0A 4DXFA 2EELA 1E9MA 4HKZE 5BMHA 1F0ZA 1WRIA 4TMAB 2N9KA 4YT0B 1C9FA 3DWGC 2IPKD 1PGAA 1XLNA 4JWSC 1C4PA 1YQ3B 2LFIA 3MP9A 1MVKA 2KAJA 2PVGC 1I7HA 1KRHA 4US9A 5G5GA 2Y5CA 2N9LA 3AEFB 1IGCA 5E6JA 2K3UA 1FNUA 5G5HA 1L4DB 2M56B 3AE5B 1XLOA 3ZGZA 1V1PA 3J9CA 5JXVA 3FILA 4OZAA 1OFFA 2BS2B 4D2KA 3HVDA 5AUIA 4TQ1A 3TEWA 4ZHPA 2WXPA 3KWLA 4C56C 1RWSA 2WLBA 1EWYC 3NVVA 5D7GA 2AQ1B 2WXQA 4DQOC 2WXMA 1D5MC 4CQNA 1AN8A 1UWXA 1FIQA 4A90A 4MT5A 1CZPA 1RYJA 4NAWB 2XNAC 2AQ2B 1SEBD 5EE1A 3EUB2 4HKQA 3N9YC 3VQIA 2SAKA 1T3QA 1BUIC 1PDXA 1NEKB 2IDYA 4N59A 5GXGB 4WWMA 1R7SA 2G9HD 1TJEA 4HJGE 4LLGM 3MC0B 1ZOYB 2D5GA 3WCQA 3TEYA 4KGRA 2K0PA 2MH7A 1OQRA 2KACA 1XLQA 2L83A 1HXYD 2NTTA 3HUIA 4AQ7A 3BK1A 1JCKB 1PUTA 1WSPA 1TS4A 4P6VF 1VZ7A 1DOXA 4HEA1 4ZRQA 1JW9D 1N5WA 3TSSA 1MHXA 2MJ3A 1FM0D 2RMMA 3Q8AA 4C80A 3OWEB 1QOBA 1RM6C 4B0EA 3BYYB 1XCQL 1NYQA 1J7BA 1JWAD 1VJKA 1I4GA 2ON8A 4A55A 3AMZA 1L0YB 3T3OA 1I4QA 2JSVX 3KWVA 4L2YA 4USAA 3SFDB 1I4PA 1UUPA 1VR9A 1JMLA 2BTEA 1EU3A 5BYQA 3AN1A 1VZ8A 2Y5PA 1JRPA 4XDCA 3BK2A 1DGJA 2MJEA 1AYFA 4YSXB 3NVWA 3LB8C 2QIEB 2CU3A 1C77A 4RCOA 1D5XC 1ZXHA 1FXAA 4ARCA 1FO4A 1EWCA 3AE2B 2LEKA 2WQYB 2RDHA 3VRAB 2Q5WD 2PLPA 2KDMA 2W54A 1JWUD 4RH6A 2KMMA 3R8BA 2V4IB 4ARIA 5EE3A 4NJCA 1N61A 1YQ4B 1V8CA 3CWIA 1FXIA 3MHZA 3E9SA 2BT6A 1ZDXA 1D4BA 1C4AA 2QMTA 2ZW1A 2BS3B 2N0SB 4MACA 4Q2JA 1I4XA 1ACCA 2LHDA 1MHHE 1TS5A 2L52A 3Q8BA 4A9AA 3U2SC 2FBWB 5T8IA 1C76A 3AE1B 1CK1A 2H89B 1CJEA 2JU6X 4J3OD 2RDGA 4AS1A 1KLGD 2JXTA 2PIAA 3BYTB 3E56A 1TKYA 4H2AA 2INPE 1E6EB 3FAHA 1FCCC 3LXFA 4P16A 1PGXA 2WP9B 4KGTA 3U7ZA 3HVZA 3PZ8A 3VRBB 3AB5A 1SB3C 2IGHA 1BXTA 3P1MA 1VLBA 2OEDA 5BYRA 2BB5A 2LHEA 1QOGA 3ETRA 1SSNA 1V1OA 2EKIA 1QF6A 1XLPA 2WXIA 1JWMD 4WIPA 1XO3A 4ZHOA 1VDVA 3AEGB 2WXOA 3BVZA 3PZ7A 3Q69A 2BW2A 2WXGA 4RFBA 1UGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLQ A;  1KF6 B;  2L83 A;  1J7A A;  1FFV A;  3HUI A;  3ZYY X;  2WDR B;  1UWM A;  3VR8 B;  4LTU A;  1PUT A;  2OHF A;  1E10 A;  1ROE A;  1TKE A;  4P6V F;  1DOX A;  1FMA D;  3SR6 A;  3FC4 A;  1JW9 D;  1N5W A;  2G1E A;  3AEA B;  3P63 A;  1DOY A;  1E7P B;  1FM0 D;  2MJ3 A;  1L5P A;  1N60 A;  1SF0 A;  1ZUD 2;  4N6E B;  4WQM A;  4C80 A;  1FFU A;  2W3S A;  1ZP0 B;  2JX5 A;  3AE6 B;  5H92 C;  3P4P B;  1QOB A;  1RM6 C;  1RFK A;  4YTP B;  3P4R B;  3ABV B;  2WU2 B;  4KX6 B;  1NYQ A;  1J7B A;  1JWA D;  1VJK A;  2DBY A;  2PVO D;  3AMZ A;  4HRO A;  3W9C B;  1ZXI A;  3BII D;  3AEC B;  4YTM B;  3W5U B;  4USA A;  5H8Y E;  3SFD B;  3P4S B;  3AE7 B;  3B2F A;  1YJJ A;  3W5V B;  4FXC A;  1OQQ A;  3AN1 A;  1JRP A;  4JX1 C;  1N63 A;  1NVI D;  1DGJ A;  2BS4 B;  3NVY A;  4ITK A;  2MJE A;  1JQ4 A;  1AYF A;  1QLB B;  4YSX B;  5MPO A;  3NVW A;  4C7Y A;  3NVZ A;  3LB8 C;  2QIE B;  1PFD A;  1V97 A;  2CU3 A;  2QJL A;  3NS1 A;  2B76 B;  1FRR A;  2ACZ B;  1NEN B;  1FXA A;  2MJD A;  1FO4 A;  2WDV B;  1SIJ A;  1JAL A;  4C7Z A;  3AE2 B;  2LEK A;  2WQY B;  2WS3 B;  1AWD A;  4US8 A;  1L6V A;  2HTM E;  3P4Q B;  3VRA B;  1E9M A;  2Q5W D;  1QT9 A;  2DWQ A;  3NRZ A;  1FRD A;  1TYG B;  3AV8 A;  2W54 A;  1DOI A;  3HRD D;  4ZOH C;  5EE9 A;  1F0Z A;  1WRI A;  1IUE A;  4YT0 B;  3DWG C;  2KMM A;  2PKO A;  3AED B;  5EE3 A;  4YXD B;  1XLN A;  1N61 A;  4YSZ B;  1YQ4 B;  1V8C A;  3CWI A;  4JWS C;  1FXI A;  1YQ3 B;  3B9J A;  2KAJ A;  1JRO A;  1I7H A;  1KRH A;  1NI3 A;  2BT6 A;  2PVG C;  3PO0 A;  2Y5C A;  2W55 A;  4US9 A;  2CJO A;  5G5G A;  3AEF B;  2BS3 B;  2N0S B;  1KFY B;  1A70 A;  2WDQ B;  3AEB B;  5G5H A;  3VR9 B;  1NYR A;  2M56 B;  3AE5 B;  1XLO A;  2L52 A;  4IDI A;  4JWU C;  4A9A A;  2M19 A;  2FBW B;  2WU5 B;  1OFF A;  2JQR B;  3AE1 B;  2BS2 B;  2H89 B;  5C3J B;  1CJE A;  1L6U A;  3AE9 B;  2K9X A;  5AUI A;  1B9R A;  1N5X A;  2PIA A;  2W3R A;  3AE3 B;  3CIR B;  4ZHP A;  3KWL A;  1TKY A;  4YTN B;  1RWS A;  1WXQ A;  3AH7 A;  5AUK A;  3RPF C;  2WLB A;  1EWY C;  3NVV A;  5C2T B;  1E6E B;  3B2G A;  3FAH A;  3LXF A;  1L0V B;  3AE8 B;  1WGK A;  2WP9 B;  3AE4 B;  1J7C A;  1QOF A;  2E3T A;  1FIQ A;  4YSY B;  1CZP A;  1RYJ A;  1WWT A;  3HVZ A;  3L4P A;  1TKG A;  1N62 A;  5EE1 A;  3VRB B;  3AB5 A;  1SB3 C;  2CJN A;  3EUB 2;  4N58 A;  2K22 A;  3AEE B;  5EE0 A;  3P1M A;  1T3Q A;  1PDX A;  1JWB D;  1VLB A;  1E0Z A;  1NEK B;  3AM9 A;  4N59 A;  5GXG B;  4WWM A;  1QOG A;  3ETR A;  1QF6 A;  2EKI A;  2K5P A;  1R7S A;  1XLP A;  1QOA A;  1GAQ B;  3SFE B;  1TJE A;  2H88 B;  1XO3 A;  4ZHO A;  1VDV A;  1ZOY B;  1YJI A;  3AEG B;  1GPX A;  1WYG A;  2AX5 A;  3DWM A;  3WCQ A;  2MH7 A;  1OQR A;  4HRS A; 
#chains in the Genus database with same CATH topology
 3TMP B;  5IP4 D;  4IWQ A;  1FFV A;  4ANU A;  2FCN A;  3VR8 B;  1E8W A;  2BQQ A;  3LDZ E;  1QKZ A;  1HQR D;  4N6E B;  1YN4 A;  1TGZ B;  5H92 C;  4HDQ A;  3AI5 A;  2KN4 A;  3ABV B;  2VH1 A;  4JPS A;  5LLI A;  3TCA A;  2BYT A;  3RD2 A;  4R3D A;  3VXW A;  3EFC A;  2KJR A;  3B2F A;  2I1K A;  4FXC A;  4EZJ A;  4ANX A;  2D3B A;  1OTR B;  3BZD B;  4OVZ A;  1PFD A;  2B76 B;  4NAW A;  1P1A A;  3RI7 C;  1KLU D;  1JAL A;  4C7Z A;  1P7F A;  2CHW A;  1AWD A;  2DZJ A;  1FXT B;  2WX1 A;  2RSU A;  4GU2 A;  1FRD A;  1E8X A;  2J53 A;  4ZOH C;  3UIO B;  3DVG X;  5D3D A;  4YXD B;  2KFK B;  3WAP A;  3HM6 X;  2JWU A;  3PO0 A;  4FLH A;  3ZUN A;  2N9X A;  4I6N B;  3Q8E A;  3AXC A;  2ASQ A;  3HHM A;  3NG0 A;  1SXT A;  3IHP C;  5KHO A;  2KLG A;  3MFG A;  1K53 A;  4A20 A;  1OGW A;  1Q5W B;  4NPN A;  4II2 B;  3KYC D;  1N5X A;  2ZCB A;  5IO9 A;  4CYE A;  2AL6 A;  1FEH A;  2WYQ A;  2V3S A;  2WXN A;  3AE8 B;  3K9P B;  2BKF A;  5I4D A;  4YSY B;  3GZN I;  3Q8C A;  1TKG A;  3IXS A;  5EE0 A;  2KN5 A;  1H8C A;  1F2R C;  3UI3 A;  5HFY A;  2JYT A;  2A4Z A;  5JH5 C;  2L8J A;  5TSS A;  1QOA A;  4KKI A;  2H88 B;  2M0A A;  1GG3 A;  3PTF C;  2DLB A;  5E6O A;  3A4R A;  3A1Q B;  1E10 A;  3CST A;  3VUW A;  3ZJT A;  2G1E A;  2KWD A;  1DOY A;  1GOZ A;  3L16 A;  4WQM A;  2JYE A;  2JX5 A;  1UEL A;  3KW5 B;  2YEP F;  2JF5 A;  4KV2 A;  2KOX A;  1WZ3 A;  2L32 A;  2CR5 A;  1JRU A;  3T3N A;  2XBB C;  2WXL A;  3N30 A;  1OQQ A;  3VTU A;  1QLB B;  2JVC A;  1WGR A;  4BKG A;  1WM3 A;  4OW0 A;  4LCD E;  3OG5 A;  1V97 A;  3Q14 C;  1L4Z B;  4ZRP A;  4AOF A;  2Y3A A;  3WAL A;  3Q3F A;  2WS3 B;  1L6V A;  1WF9 A;  2HTM E;  2KZR A;  1IUE A;  2FUG 1;  1WR1 A;  2KKC A;  3B0A A;  4MGY E;  3RNC C;  2KD0 A;  4MM3 B;  1E90 A;  2KTR B;  3B9J A;  3DQV A;  1NI3 A;  3DCG A;  4BKS A;  1QQR A;  1VCB A;  3R2I A;  3W1Y A;  2NVU I;  3VH3 B;  4C4V A;  4YTN B;  2LUM A;  3QQ8 B;  1CQV A;  4GDK A;  4GLS C;  1L0V B;  1K52 A;  3BVM A;  3GZN B;  1T0S C;  1E8Z A;  4FUL A;  1QOF A;  3MJW A;  1ZPS A;  2E3T A;  3H6N A;  2BWE S;  2DEN B;  2HJ8 A;  3GE8 C;  2K6Q A;  2O2V B;  1WX8 A;  4XDD A;  2IO1 B;  3TEX A;  4XE0 A;  4AWJ A;  4EZL A;  5FK9 C;  2L76 A;  5HI1 A;  2D3C A;  1YJI A;  4HJK A;  2JZ3 B;  4GN1 A;  1J7A A;  2N7J A;  2C7M B;  1TKE A;  3CMM B;  2XN9 C;  2DAF A;  3SR6 A;  1N60 A;  2REX A;  4B9K A;  4RF1 A;  5BYS A;  1ET9 A;  3U30 A;  2QEJ C;  2MBH A;  2PTL A;  4DXA B;  4MEM A;  5IOI A;  2LRU A;  1WGH A;  1YD8 U;  4DWF A;  2WDT B;  3NHE B;  3AEC B;  2KO3 A;  5H8Y E;  2JXX A;  3U4E G;  3SU8 X;  3H8H A;  4KVG B;  1N63 A;  5G55 A;  1SJE D;  4EFO A;  2O6V D;  3RZW C;  1IBX A;  2ZJD A;  3SHQ A;  2MJD A;  2KK8 A;  2FE8 A;  4WH4 A;  3OLM D;  2ZNV C;  1Z2M A;  3V6E B;  2BKR B;  1F0Z A;  2KMC A;  3DWG C;  2N1W A;  1PGA A;  5J17 A;  3RT3 B;  2ZZP B;  3T9L A;  3A1Q A;  4HVB A;  3MP9 A;  2GBK A;  3RNG C;  1MVK A;  4W9E A;  2PVG C;  1I7H A;  1HTO A;  3VVW B;  2M56 B;  1WXS A;  3AE5 B;  1XLO A;  4PYZ A;  4FJZ A;  2BS2 B;  1T0R C;  5AUI A;  4LJO B;  4TQ1 A;  4WAA A;  2WXP A;  4C56 C;  4DQO C;  2WXM A;  3R7R A;  1BT0 A;  1AN8 A;  4MT5 A;  4LNO A;  1RYJ A;  3V62 A;  2XNA C;  3A33 B;  3DBR B;  2KQS A;  4PS7 A;  3EUB 2;  4HKQ A;  3VQI A;  2SAK A;  4ANV A;  1NEK B;  2IDY A;  4N59 A;  1KOT A;  4WWM A;  1R7S A;  2XK5 B;  4JIO U;  1TJE A;  4LLG M;  5HKH A;  3WCQ A;  2KAC A;  1XLQ A;  1HXY D;  3BK1 A;  2G4D B;  2N1V A;  1TS4 A;  1VZ7 A;  3RUI B;  4MM3 A;  1DOX A;  4WWP A;  1P98 A;  4FJY A;  2RMM A;  2MJ3 A;  1FM0 D;  5DPW A;  3Q8A A;  1E8Y A;  1WX9 A;  1WR6 E;  1QOB A;  1NYQ A;  1J7B A;  1I4G A;  3RNE C;  3AMZ A;  3HIZ A;  3PRZ A;  3RNF C;  1JML A;  1EU3 A;  1JRP A;  4XDC A;  2CHZ A;  3APC A;  4NY0 A;  3B08 A;  4FHJ A;  3NVW A;  1R4N I;  2CU3 A;  3ZIM A;  1ZXH A;  1L2N A;  1EWC A;  4ZRJ A;  2LEK A;  2WQY B;  2O2V A;  2RDH A;  3WA0 A;  3DBS A;  2W54 A;  1UZX B;  1FPY A;  1JWU D;  3R8B A;  4ARI A;  5J18 A;  1N61 A;  3EC8 A;  2UU7 A;  3SDL C;  2BT6 A;  2LJ5 A;  2ZW1 A;  2N0S B;  1I4X A;  2LHD A;  2L52 A;  3Q8B A;  3AE1 B;  3H1U A;  5GMV A;  3E56 A;  1TKY A;  2DZM A;  2ZPY A;  1PGX A;  1RFA A;  1LGR A;  3HVZ A;  1SB3 C;  2GBM A;  2IGH A;  1BXT A;  1VLB A;  2OED A;  4FAD A;  1E7U A;  1QOG A;  1SSN A;  2D07 B;  2K8H A;  2Z59 B;  4WIP A;  2KNB A;  1OEY A;  1ZGU B;  4FHK A;  2KDI A;  1F77 A;  4KGS A;  1MJD A;  1FMA D;  3FC4 A;  4HK2 A;  3AE6 B;  1ZP0 B;  5HG2 A;  1RFK A;  5FKA C;  3BII D;  1KLV A;  2KLC A;  4YTM B;  3W5U B;  4G0N B;  3P4S B;  2LMC A;  1YJJ A;  3U7D A;  1TS2 A;  1DYQ A;  2EMS A;  1WI0 A;  1R4N B;  4A8X C;  2AQ3 B;  3NVY A;  2KTF A;  1V80 A;  2WXH A;  3TBL D;  3NS1 A;  2QJL A;  2LRW A;  1HEZ E;  4DDG D;  1YMH E;  4K81 A;  1SIJ A;  3KQ4 A;  3N20 C;  1WXM A;  2N9E B;  4RGM A;  3QIJ A;  5TR5 A;  1DOI A;  3I9V 1;  2INN E;  5JHB A;  2NCN A;  2VZK D;  2L00 B;  3L10 B;  2A5U A;  4F1S A;  1SIF A;  1YN3 A;  2JPH A;  1TS3 A;  3VR9 B;  3AEB B;  4BBN C;  3BIN A;  1R4M B;  4LK0 M;  1GUA B;  2M19 A;  1WJ6 A;  2JQR B;  2ZPN A;  5C3J B;  4B0M A;  1L6U A;  5D3I B;  1B9R A;  4FN2 A;  1WXQ A;  3L54 A;  3ZQ4 A;  1WGK A;  4RNA A;  1HZ5 A;  3DVN V;  5BO4 B;  3L13 A;  4M01 A;  5C23 A;  2K22 A;  4P1C C;  2K5P A;  3W1S A;  2MP2 B;  2GB1 A;  3SFE B;  1HA5 A;  2NBV B;  1FNV A;  4NJ6 A;  2MWS B;  4ASW C;  2LGY A;  3RNB C;  4LTU A;  2BF8 B;  2MBE A;  1ROE A;  4II3 B;  2KC2 A;  2K8B A;  2MLB A;  3UQA A;  3EA6 A;  1D5Z C;  4NJ7 A;  1VD2 A;  3DHG C;  5DCN A;  3WAO A;  5BMG A;  2GI9 A;  2DBY A;  4HLE A;  4OVU A;  4DXG A;  3ML8 A;  4F8C B;  4LNI A;  4L23 A;  3Q8F A;  4G3X B;  1Q10 A;  4C7Y A;  1WM2 A;  4LNN A;  3RMK C;  4GMV A;  1NEN B;  1WZ0 A;  2DYM A;  1PGB A;  4K7W A;  4XWW A;  1YN5 A;  1QT9 A;  2DWQ A;  3NRZ A;  4C4V B;  3IG3 A;  3HRD D;  5EE9 A;  3Q3M C;  4MDK E;  4GDK B;  3DVG Y;  4GGQ A;  3HK0 A;  1K50 A;  3BVG A;  2LGD A;  3UIP B;  3EGR A;  1UBI A;  4TKN A;  2DNF A;  1KJT A;  3MTN B;  1B1Z A;  2WDQ B;  1KFY B;  1A70 A;  2BB6 A;  2GBN A;  4FJV B;  4IDI A;  4JWU C;  3N3K B;  3U52 E;  2Z0E B;  5AUK A;  4W9I A;  3A9J A;  2KWV B;  2I1J A;  4MSQ B;  4HXD A;  2SEB D;  3H7P A;  4BOZ B;  4TQ0 A;  2KQ4 X;  1WXV A;  2V0G A;  2PW9 A;  1D3Z A;  2GBJ A;  2AX5 A;  2DYO A;  1SJH D;  4MEL A;  2N4F A;  1TTN A;  4B6W A;  3HM3 A;  2L1A A;  2C5L C;  2OHF A;  3PVL A;  1V86 A;  3P63 A;  1IBX B;  4IM0 A;  2QC8 A;  3Q3J A;  1E7P B;  2DHZ A;  2MW5 A;  4NQK E;  4O1N A;  4FA6 A;  2IJ0 A;  3P4P B;  4KIK B;  4HWI B;  2QHO A;  1WXA A;  1XXG A;  2W82 A;  4IWO A;  5D2M B;  3M3J A;  4N9F 4;  3QWZ B;  4LJP B;  1V6E A;  1C78 A;  4JX1 C;  4ITK A;  2FCM A;  3UQB A;  1V5T A;  3ZJU A;  3IAS 1;  2J7Q B;  4LDT D;  2KXJ A;  3R2T A;  1TY0 A;  4DXF A;  4JQW C;  2MP2 A;  4TMA B;  4YT0 B;  1C9F A;  1WX7 A;  2KJ6 A;  2IND C;  1OEY J;  1P9D U;  4AJY B;  3WAN A;  3APF A;  4US9 A;  5G5G A;  2Y5C A;  2N9L A;  3AEF B;  1IGC A;  5E6J A;  2K3U A;  3M63 B;  5G5H A;  3J9C A;  1GC7 A;  1OFF A;  1TT5 B;  2IY1 B;  2PPH A;  2JRI B;  2WX0 A;  2LAS A;  2R2Q A;  3TEW A;  3KWL A;  3NVV A;  2MA9 B;  5D7G A;  1UWX A;  1WE6 A;  1CMX B;  5EE1 A;  1IP9 A;  3R66 C;  1GJZ A;  1J8C A;  1WGY A;  2D5G A;  2CU1 A;  2MH7 A;  1OQR A;  3HUI A;  4AQ7 A;  2FCQ A;  4BFR A;  4HEA 1;  3EHV A;  4ZRQ A;  1YJ1 A;  1MHX A;  2MQJ A;  3RCZ A;  4C80 A;  4OVV A;  5CTR C;  3DBR I;  2FUH B;  4B0E A;  3BYY B;  3WAM A;  1JWA D;  4A55 A;  3T3O A;  4KSL C;  2JSV X;  3KWV A;  2BTE A;  3SFD B;  1VR9 A;  2IO0 B;  2K39 A;  1VZ8 A;  1WFY A;  4YL8 A;  1DGJ A;  2D3A A;  2MJE A;  3B1L X;  4KSK C;  1E5W A;  3ZDM C;  3PGE A;  3AE2 B;  3MC9 A;  1YIW A;  2PLP A;  4E71 A;  2K25 A;  3OAW A;  2LZ6 A;  2V4I B;  4NJC A;  2KX3 A;  3CWI A;  1V8C A;  1LM8 B;  2Y5B B;  3DBH B;  3MHZ A;  4ANW A;  2FAZ A;  1U4A A;  1EF1 A;  1WJ4 A;  3QK0 A;  4A9A A;  3LJ3 A;  4J3O D;  3IVF A;  2JU6 X;  2M4N A;  2MBO A;  2ZVN A;  4S17 A;  3R3M A;  4M8M A;  4KIK A;  4RMA A;  3ZNH B;  2INP E;  1TIF A;  1ZKH A;  1E6E B;  3A9K A;  3FAH A;  4HPM B;  3L17 A;  2PEA A;  4WWN A;  3U7Z A;  3AB5 A;  5E6P A;  2J0K A;  2CS4 A;  2NPT B;  3P1M A;  5BYR A;  1EO6 A;  2BB5 A;  4A3O A;  4I6P A;  4ICU A;  1GC6 A;  3ETR A;  1LQB A;  2VH2 A;  1XLP A;  3AEG B;  1M94 A;  5LXI B;  3PZ7 A;  3Q69 A;  2BW2 A;  2WXG A;  2WGS A;  1FD6 A;  4OHJ A;  1KF6 B;  4MJS A;  4K3C A;  2WDR B;  5HHD G;  1P7E A;  4KZC A;  2IO2 B;  3VH4 B;  4XGA B;  3Q3N C;  3AEA B;  4M00 A;  2LVQ A;  3N32 A;  1I4R A;  1L5P A;  1SBB B;  2B3A A;  4W9D A;  2O6V B;  2X8X X;  4KX6 B;  1PYW D;  4LNF A;  3EEC A;  2RD0 A;  4K1R B;  1GNU A;  1L0X B;  1ZXI A;  2IO3 B;  4IC7 B;  2KDB A;  4BKT A;  1FCL A;  3ZJV A;  1UF0 A;  2R61 A;  2RDB C;  3VUY A;  4OZC A;  3PS6 A;  5J2R A;  3K9O B;  2DZI A;  4PYU A;  1RRB A;  3UF8 A;  4NZL B;  3MJ5 A;  3OJ3 A;  2G45 B;  1TYG B;  3GP7 A;  2GMI C;  5IA7 A;  3PLU A;  1Q1O A;  2V1Y A;  2M17 A;  4JGH B;  1JRO A;  1E7V A;  3AU4 A;  1TY2 A;  2DYB A;  2YLM A;  2I38 A;  2KX0 A;  2E6X A;  3N1X C;  3UIN B;  2LVP A;  4C00 A;  1G6J A;  2WU5 B;  4XYC A;  1GB4 A;  2LGS A;  5CHF A;  1SE2 A;  2W3R A;  1WY8 A;  3CIR B;  1VZ6 A;  2LI5 A;  3RPF C;  3UGB B;  3N1Y C;  3CSF A;  4GOC A;  5C2T B;  2OJW A;  2LJI A;  2WWZ A;  1HZ6 A;  3KLS X;  1BML C;  3ZRF A;  4OZB A;  3Q2A C;  1GB1 A;  4WJO A;  1UNS A;  4G50 A;  3ZO5 B;  3DHH C;  4KDL B;  1GAQ B;  2LGX A;  1R4M I;  1C1Y B;  1NI2 A;  2TSS A;  1T5X D;  3R7Q A;  4W9K A;  2RPV A;  3KYD D;  3ONS A;  3DBL I;  4A6Q A;  3ALB A;  4DHJ D;  1IGD A;  1F2R I;  4NAM A;  2Z8L A;  1ZUD 2;  4ICV A;  1FFU A;  2VRR B;  4GB9 A;  4I6L B;  4NQL B;  1UH6 A;  2L05 A;  3P4R B;  2WU2 B;  3V3X A;  2G4S A;  1J0G A;  3RYT A;  3IT6 B;  2J52 A;  3DPD A;  2WXK A;  3ZNZ B;  4EE2 A;  3W5V B;  1RLF A;  1XF5 L;  2JUO A;  2JT4 B;  1JQ4 A;  1EU4 A;  4DHZ E;  2IGG A;  2AEH A;  4NNJ B;  2MHJ A;  1SE9 A;  2NPT A;  1LO5 D;  2WXJ A;  4W9C A;  3V05 A;  3P4Q B;  1F9J A;  2BVC A;  3URY A;  3A9J B;  3N1Z C;  1TZO A;  2PKO A;  3PHX B;  3TIX A;  4YSZ B;  3ENE A;  4IG7 B;  1V49 A;  3BWU D;  3H7P B;  2W55 A;  2CJO A;  3IT4 B;  1ZE3 D;  2Z0D B;  1NYR A;  1Z5S B;  2ZCC A;  1NBF C;  2GRI A;  4JE3 B;  3RFZ B;  2O6V A;  3AE9 B;  3AU5 A;  4RGO S;  3AE3 B;  3NZU A;  3TUO A;  1VRA B;  1TZ1 A;  4JLC A;  1ISN A;  4DBG A;  1KH0 A;  4L1B A;  3KH0 A;  1WRD B;  2R2O A;  4KDI C;  3ZTC A;  2QDF A;  2DZK A;  2LUE A;  1ESF A;  1E0Z A;  1WE7 A;  2KC1 A;  4TUU A;  2NMQ A;  1X1M A;  1C79 A;  1M4V A;  4MH8 A;  2IZV B;  1WMH B;  1WYG A;  3DBL B;  2CKH B;  3NS8 A;  2J42 A;  4HRS A;  4EUT A;  1EUV B;  4IM2 A;  1KTK A;  3C19 A;  3JW0 X;  3ZYY X;  3JVZ X;  2LXC A;  5D94 A;  4RM9 A;  1YX5 B;  3LYY A;  3I57 A;  1FNW A;  2ICI A;  2J0M A;  3ECI A;  2MEK A;  1XT9 B;  1STE A;  3W9C B;  4BKS D;  1T6B X;  2HTH A;  4AUQ C;  4TSS A;  2N9P C;  1LXD A;  4GXB A;  3SEB A;  3GOE A;  4WJP A;  3NVZ A;  1MPE A;  2VZK B;  3VDZ A;  2K8C A;  2IGD A;  1XCT L;  1F52 A;  2JWZ A;  1Y8R C;  2EEL A;  1P0R A;  3OJ4 B;  5BMH A;  4HCP B;  2AWT A;  2N9K A;  2C9W B;  3QHT A;  1XLN A;  4JWS C;  1IYF A;  1C4P A;  5L95 C;  1L4D B;  5JHA A;  3P2B A;  3ZGZ A;  1V1P A;  5JXV A;  4BAX A;  3H9D A;  1NDD A;  4PS3 A;  3VHT C;  4ZHP A;  1RWS A;  4P7I A;  2WLB A;  3NOB A;  3KVF B;  2AQ1 B;  2WXQ A;  1D5M C;  4CQN A;  4A90 A;  2GLS A;  1FIQ A;  1SEB D;  1L7Y A;  1T3Q A;  1BUI C;  2AL3 A;  2MSE D;  5GXG B;  4KZ0 A;  3ZXV A;  3SD5 A;  2G9H D;  4HJG E;  3MC0 B;  1ZOY B;  4KGR A;  2CHX A;  3VAW A;  2NTT A;  3DDC B;  3QJZ A;  1WGD A;  1PUT A;  1WSP A;  4HCN B;  1V9J A;  1H4R A;  4P6V F;  2N7D A;  2KWC A;  1N5W A;  4M0W B;  3C0R B;  3KUZ A;  3L08 A;  3OWE B;  5DPS A;  4PS8 A;  2MBQ A;  1IPG A;  4DK5 A;  1XCQ L;  3M62 B;  3PZD A;  1VJK A;  2HD5 B;  2ON8 A;  3KUC B;  1RAX A;  5BYQ A;  4MSM B;  3BK2 A;  3EFU A;  1AYF A;  4WQO B;  4TV3 A;  4YSX B;  5LXH A;  2QIE B;  4IW0 A;  2YVC A;  1C77 A;  2NBU A;  4RCO A;  3I63 C;  1FO4 A;  3NZS A;  2LD9 A;  4E3C A;  3QA8 A;  5DPR A;  1XD3 B;  2JY6 A;  3A9K B;  1WMH A;  4RH6 A;  2KMM A;  4HDO A;  2KHW B;  2D3G A;  1FXI A;  1F1H A;  3M95 A;  2ZNV B;  1D4B A;  1MFW A;  4MGI E;  2QMT A;  4S0R A;  2BS3 B;  4MAC A;  4Q2J A;  1MHH E;  4WWO A;  3U2S C;  2FBW B;  1CK1 A;  2H89 B;  1CJE A;  5AEK B;  2RDG A;  3X23 A;  2JXT A;  2L0T A;  3BYT B;  3JSV A;  3CF6 E;  4MJS B;  1FCC C;  3LXF A;  4P16 A;  2WP9 B;  2KQ7 A;  4KGT A;  3VRB B;  3DBH I;  3H7S A;  4ZRK A;  2EKI A;  1QZE A;  4ZDV A;  1JWM D;  1XO3 A;  1VDV A;  2WXO A;  3KUD B;  2PJH A;  4RFB A;  1UGJ A;  3TJP A;  3V60 A;  2GOW A;  1K51 A;  3I3T B;  1D6E C;  2FCS A;  4GSW A;  3PRE A;  2K6D B;  1SF0 A;  3MC8 A;  2M1M A;  2GBR A;  4YTP B;  1WH3 A;  4LDT B;  1YQB A;  3DOW A;  5EDS A;  2WHI A;  5JZE B;  1P3Q U;  2QIL A;  2DX5 B;  2ZEQ A;  4GDL B;  4IUM B;  1EM7 A;  2HDE A;  2KWU B;  4JL9 A;  1PQS A;  5G2N A;  2KDE B;  1NVI D;  4K7S A;  3ZKJ C;  3PLV A;  2PE6 B;  2ACZ B;  2BGF A;  4P1B C;  2WXF A;  2YEP B;  2LWP A;  3TEZ A;  2I2Y A;  2ZVO A;  4RM8 A;  1JWS D;  3GS2 A;  1K8R B;  2KJH B;  3AED B;  2ONQ A;  2QSD A;  1WGG A;  4RGT A;  2JRH A;  4PK1 A;  4M0W A;  4X57 B;  1I4H A;  1YNT E;  3NZ3 A;  3W2D A;  3A4S C;  2V3N A;  1I35 A;  2K9X A;  4K7U A;  2IYD B;  3T8M A;  5IKC M;  3IBE A;  3B2G A;  3JYU A;  2KDF B;  3NY5 A;  4RF0 A;  1SGH A;  1AW7 A;  1XEE A;  1J7C A;  2KFK A;  2J4X A;  4YWG G;  2RR9 A;  2XEW A;  2LVO A;  1WWT A;  3L4P A;  1N62 A;  1ET6 A;  4N58 A;  2FIF A;  2V3P A;  3NUH B;  1JWB D;  1TBE A;  4EEW A;  4HPL B;  4KKJ A;  2X38 A;  1A5R A;  1SE3 A;  4IKG A;  5AZH A;  3VFK A;  4BOS C;  1QIL A;  3DWM A;  5AZF A;  2EMT A;  2KAN A;  3PRP B;  3PV1 A;  2V9H A;  3IFW B;  4WUR A;  1WYW B;  4EZK A;  3AUL A;  3RNA C;  3PSE B;  4W9G A;  3GB1 A;  2W3S A;  3FIL B;  2NBW B;  1UGM A;  4M02 A;  4BBN F;  1WJU A;  4HRO A;  4ACF A;  3PT2 B;  2L7R A;  2MCN B;  1ZDV A;  1MG4 A;  1ZW7 A;  4XX5 A;  3S2A A;  4RGN A;  1T0Y A;  1YOV B;  3P42 A;  2WXR A;  2FID A;  1FRR A;  3U8Z A;  1XQQ A;  3X0W A;  2NTS A;  1ENF A;  3GE3 C;  3C8Y A;  2WDV B;  4W9H A;  2JZZ A;  5FR3 A;  3QCA A;  4URK A;  1MI0 A;  2KT7 A;  3TL5 A;  3AV8 A;  2ZW0 A;  1SE4 A;  3QAR A;  1S3S G;  2WNM A;  4F7Z A;  2D2Q A;  1Y56 A;  3D32 A;  3VTV A;  5CHV C;  2IBI B;  1KM7 A;  2JZP A;  4UDU C;  2D10 A;  1C4C A;  4A3P A;  2KMA A;  1YX6 B;  3AH7 A;  2V4L A;  2LGI A;  3ZRC A;  2KVR A;  3DVN U;  4XWT A;  5LNK 1;  4AJW A;  1S1Q B;  4GDL A;  3AE4 B;  2KTR A;  1N6Z A;  5BMI A;  3V61 A;  1I42 A;  3ZNG C;  2CJN A;  5IN7 A;  3AEE B;  4CHK A;  4IWP A;  1WIA A;  3AM9 A;  5IAA C;  4PT5 A;  3IAM 1;  3DHI C;  4WAF A;  1WJN A;  4MGK E;  2DAJ A;  1GPX A;  4G11 A;  4IOI E;  4US8 A;  1UWM A;  3MHS D;  2MRP A;  4REZ A;  2NS5 A;  2FNJ B;  4W9L A;  2MBB B;  2AYO B;  2IY0 B;  2BYE A;  3BY4 B;  3O13 A;  2BYF A;  2PMV A;  2KFJ A;  4ZYS A;  1EF5 A;  2HJ1 A;  4W9F A;  1T0Q C;  2PVO D;  2UYZ B;  3FKY A;  4AP4 C;  4MGZ E;  4FBJ B;  3AE7 B;  2MX2 A;  1V5O A;  2BS4 B;  5MPO A;  2HE7 A;  5E6N A;  1V1P B;  2BBC A;  4ZYN A;  3WIM A;  4EKU A;  1E9M A;  4HKZ E;  1UD7 A;  2C7H A;  4XC2 A;  3QAQ A;  2EKE C;  2PE9 A;  1WRI A;  2IPK D;  3Q3O C;  1YQ3 B;  2LFI A;  2K1F A;  2KAJ A;  3RN9 C;  1KRH A;  1FNU A;  3ZVV A;  4GIV A;  3FIL A;  4OZA A;  5CHW A;  4WJN A;  4D2K A;  4HPP A;  3HVD A;  1AAR A;  3O65 B;  4B95 A;  2RPQ A;  3ZNI D;  3QX1 A;  3L0W B;  1EWY C;  2RGF A;  1CZP A;  4NAW B;  2AQ2 B;  2M8S A;  4DHJ B;  2N7E A;  3N9Y C;  3PPA A;  1PDX A;  2C7N B;  2UWQ A;  5C1Z A;  5KHQ A;  3ZDT A;  4WJQ A;  3ML9 A;  5DPT A;  3APD A;  3TEY A;  4J6I A;  2K0P A;  3RUL A;  2L83 A;  5AZG A;  4EOY A;  3NJT A;  3PHW B;  1JCK B;  2KVZ A;  1JW9 D;  3TSS A;  3VUX A;  2INC C;  2D11 A;  2G3Q B;  1C3T A;  1RM6 C;  2L0F A;  4ZRI A;  2XK5 A;  4K3B A;  4MH0 E;  1L0Y B;  1J19 A;  1I4Q A;  2M0X A;  4L2Y A;  4USA A;  1I4P A;  1UUP A;  2OJR A;  3AN1 A;  4QAY A;  2Y5P A;  1MG8 A;  4XZ4 A;  3LB8 C;  4M8N A;  1D5X C;  4LNK A;  1FXA A;  4ARC A;  2BPS A;  3RZF A;  2NR2 A;  5L83 A;  3VRA B;  4BZA A;  4CO7 A;  3JSV B;  2KYW A;  3ZTD A;  2KDM A;  4E74 A;  1HE8 A;  5EE3 A;  3QC8 B;  1YQ4 B;  3W1S C;  1V2Y A;  3E9S A;  3Q6B A;  4IM3 A;  3ZLZ A;  1ZDX A;  5D6J B;  5CX3 A;  1C4A A;  2QCZ A;  1ACC A;  2L3Z A;  2LXA A;  1TS5 A;  2C60 A;  3VTW A;  3ZW3 A;  1Q0W B;  1C76 A;  5T8I A;  1UBQ A;  4AS1 A;  1KLG D;  2PIA A;  4W9J A;  4H2A A;  4BVU C;  4DHZ B;  5FR6 A;  2J0J A;  1OQY A;  1LFD A;  3PZ8 A;  2BWF A;  2BYV E;  1HTQ A;  3I5J C;  2LHE A;  2OOB B;  1V1O A;  2W9N A;  1QF6 A;  3V6C B;  2WXI A;  3ZXR A;  4ZHO A;  3BVZ A;  1V81 A;  2Q5W D;  4DDI D;  3PRM B; 
#chains in the Genus database with same CATH homology
 4OHJ A;  1KF6 B;  1FFV A;  2WDR B;  5HHD G;  3VR8 B;  1P7E A;  1F77 A;  4KGS A;  1K51 A;  1FMA D;  3FC4 A;  1D6E C;  3AEA B;  1QKZ A;  1I4R A;  1L5P A;  1HQR D;  1SF0 A;  4N6E B;  1YN4 A;  1SBB B;  3AE6 B;  1ZP0 B;  5H92 C;  5HG2 A;  1RFK A;  4YTP B;  2KN4 A;  3ABV B;  4JPS A;  4KX6 B;  1PYW D;  2QIL A;  5FKA C;  2BYT A;  1ZXI A;  1L0X B;  3BII D;  4R3D A;  1FD6 A;  4YTM B;  3W5U B;  4GDL B;  1EM7 A;  3P4S B;  2HDE A;  2LMC A;  1YJJ A;  3B2F A;  4FXC A;  1TS2 A;  1DYQ A;  4A8X C;  2AQ3 B;  1NVI D;  3NVY A;  3BZD B;  1FCL A;  2WXH A;  3ZJV A;  4OVZ A;  1PFD A;  2QJL A;  3NS1 A;  2B76 B;  2R61 A;  1HEZ E;  2ACZ B;  4OZC A;  1YMH E;  1KLU D;  1SIJ A;  1JAL A;  3KQ4 A;  4C7Z A;  1P7F A;  2WXF A;  1AWD A;  2YEP B;  4RGM A;  4NZL B;  3TEZ A;  3MJ5 A;  2I2Y A;  1FRD A;  1TYG B;  3GP7 A;  2J53 A;  1DOI A;  1JWS D;  2INN E;  3I9V 1;  4ZOH C;  3GS2 A;  5D3D A;  3AED B;  4YXD B;  2VZK D;  2ONQ A;  2QSD A;  4RGT A;  1JRO A;  2JWU A;  3PO0 A;  1TY2 A;  1YN3 A;  1TS3 A;  3Q8E A;  3VR9 B;  3AEB B;  4M0W A;  1I4H A;  1YNT E;  2I38 A;  3NZ3 A;  4LK0 M;  1SXT A;  2E6X A;  2M19 A;  2WU5 B;  2JQR B;  3W2D A;  3MFG A;  1K53 A;  5C3J B;  4B0M A;  1GB4 A;  1L6U A;  2V3N A;  5D3I B;  2K9X A;  1SE2 A;  1N5X A;  2W3R A;  3CIR B;  1B9R A;  1VZ6 A;  3RPF C;  1WXQ A;  5C2T B;  3B2G A;  1FEH A;  3ZQ4 A;  2LJI A;  2WXN A;  4RF0 A;  3AE8 B;  1HZ6 A;  1AW7 A;  1WGK A;  1XEE A;  3KLS X;  4RNA A;  1J7C A;  1BML C;  1HZ5 A;  2J4X A;  4YWG G;  4OZB A;  5I4D A;  4YSY B;  3Q8C A;  1WWT A;  3L4P A;  1GB1 A;  1TKG A;  1N62 A;  1ET6 A;  1UNS A;  4N58 A;  2V3P A;  2K22 A;  3IXS A;  3NUH B;  5EE0 A;  1JWB D;  1F2R C;  4KKJ A;  3UI3 A;  2X38 A;  5HFY A;  2JYT A;  1SE3 A;  2K5P A;  4IKG A;  3W1S A;  5TSS A;  2GB1 A;  1QOA A;  1GAQ B;  4KKI A;  3SFE B;  2H88 B;  2M0A A;  1HA5 A;  2TSS A;  1QIL A;  3DWM A;  1FNV A;  1T5X D;  2RPV A;  2DLB A;  4A6Q A;  4LTU A;  4WUR A;  1IGD A;  1E10 A;  1F2R I;  1ROE A;  4NAM A;  2Z8L A;  3ZJT A;  2G1E A;  2KWD A;  1DOY A;  3EA6 A;  1D5Z C;  3GB1 A;  1GOZ A;  1ZUD 2;  4WQM A;  1FFU A;  2JYE A;  2JX5 A;  2W3S A;  3FIL B;  5BMG A;  3P4R B;  2YEP F;  2GI9 A;  2WU2 B;  3V3X A;  2DBY A;  2L32 A;  4HRO A;  3IT6 B;  2J52 A;  3T3N A;  2WXL A;  2WXK A;  1ZDV A;  4EE2 A;  3W5V B;  4DXG A;  1XF5 L;  1OQQ A;  4RGN A;  3P42 A;  4L23 A;  3Q8F A;  1JQ4 A;  1QLB B;  2WXR A;  1Q10 A;  4OW0 A;  1EU4 A;  4C7Y A;  1V97 A;  1FRR A;  1L4Z B;  4ZRP A;  2IGG A;  1NEN B;  2NTS A;  1ENF A;  3C8Y A;  2WDV B;  2Y3A A;  1LO5 D;  5FR3 A;  2DYM A;  2WXJ A;  1PGB A;  2WS3 B;  4XWW A;  3V05 A;  1L6V A;  1MI0 A;  2HTM E;  3P4Q B;  1YN5 A;  1QT9 A;  2DWQ A;  3NRZ A;  3AV8 A;  2ZW0 A;  1SE4 A;  3HRD D;  5EE9 A;  3URY A;  4GDK B;  1IUE A;  2FUG 1;  2WNM A;  1TZO A;  2PKO A;  1K50 A;  4MM3 B;  3BVG A;  4YSZ B;  3B9J A;  1NI3 A;  3BWU D;  1Y56 A;  2W55 A;  3EGR A;  2CJO A;  3IT4 B;  1QQR A;  1ZE3 D;  1B1Z A;  2WDQ B;  1KFY B;  1A70 A;  2BB6 A;  1NYR A;  4IDI A;  4JWU C;  2JZP A;  3R2I A;  4UDU C;  2GRI A;  4JE3 B;  1C4C A;  3RFZ B;  3U52 E;  3AE9 B;  4RGO S;  3AE3 B;  3TUO A;  4YTN B;  5AUK A;  2LUM A;  3AH7 A;  1VRA B;  2LGI A;  1CQV A;  1KH0 A;  5LNK 1;  4GLS C;  4XWT A;  4L1B A;  1L0V B;  1K52 A;  3BVM A;  3AE4 B;  1QOF A;  1ZPS A;  2E3T A;  5BMI A;  2SEB D;  2CJN A;  1ESF A;  3AEE B;  4TQ0 A;  2KQ4 X;  1E0Z A;  3AM9 A;  4XDD A;  3TEX A;  4PT5 A;  3IAM 1;  4XE0 A;  2V0G A;  2NMQ A;  5FK9 C;  1C79 A;  2PW9 A;  4WAF A;  1M4V A;  5HI1 A;  1YJI A;  4MH8 A;  1GPX A;  1WYG A;  2AX5 A;  2DYO A;  2J42 A;  4HRS A;  4IOI E;  4US8 A;  1SJH D;  1J7A A;  1KTK A;  3ZYY X;  2N7J A;  1UWM A;  2L1A A;  2OHF A;  1TKE A;  2XN9 C;  3SR6 A;  3P63 A;  1IBX B;  1E7P B;  4REZ A;  1N60 A;  3LYY A;  4O1N A;  3I57 A;  4RF1 A;  5BYS A;  1ET9 A;  2IJ0 A;  1FNW A;  3P4P B;  2QEJ C;  2ICI A;  2PTL A;  3O13 A;  2PMV A;  4ZYS A;  2MEK A;  2PVO D;  1STE A;  3W9C B;  1XXG A;  2W82 A;  3AEC B;  1T6B X;  5H8Y E;  3U4E G;  3AE7 B;  3H8H A;  4TSS A;  1C78 A;  4JX1 C;  1N63 A;  4ITK A;  2BS4 B;  3SEB A;  1SJE D;  5MPO A;  3ZJU A;  3NVZ A;  1MPE A;  1IBX A;  2VZK B;  3IAS 1;  2IGD A;  2MJD A;  1V1P B;  2BBC A;  1XCT L;  3R2T A;  2FE8 A;  4WH4 A;  1TY0 A;  4DXF A;  2EEL A;  1E9M A;  4HKZ E;  5BMH A;  1F0Z A;  1WRI A;  4TMA B;  2N9K A;  4YT0 B;  1C9F A;  3DWG C;  2IPK D;  1PGA A;  1XLN A;  4JWS C;  1C4P A;  1YQ3 B;  2LFI A;  3MP9 A;  1MVK A;  2KAJ A;  2PVG C;  1I7H A;  1KRH A;  4US9 A;  5G5G A;  2Y5C A;  2N9L A;  3AEF B;  1IGC A;  5E6J A;  2K3U A;  1FNU A;  5G5H A;  1L4D B;  2M56 B;  3AE5 B;  1XLO A;  3ZGZ A;  1V1P A;  3J9C A;  5JXV A;  3FIL A;  4OZA A;  1OFF A;  2BS2 B;  4D2K A;  3HVD A;  5AUI A;  4TQ1 A;  3TEW A;  4ZHP A;  2WXP A;  3KWL A;  4C56 C;  1RWS A;  2WLB A;  1EWY C;  3NVV A;  5D7G A;  2AQ1 B;  2WXQ A;  4DQO C;  2WXM A;  1D5M C;  4CQN A;  1AN8 A;  1UWX A;  1FIQ A;  4A90 A;  4MT5 A;  1CZP A;  1RYJ A;  4NAW B;  2XNA C;  2AQ2 B;  1SEB D;  5EE1 A;  3EUB 2;  4HKQ A;  3N9Y C;  3VQI A;  2SAK A;  1T3Q A;  1BUI C;  1PDX A;  1NEK B;  2IDY A;  4N59 A;  5GXG B;  4WWM A;  1R7S A;  2G9H D;  1TJE A;  4HJG E;  4LLG M;  3MC0 B;  1ZOY B;  2D5G A;  3WCQ A;  3TEY A;  4KGR A;  2K0P A;  2MH7 A;  1OQR A;  2KAC A;  1XLQ A;  2L83 A;  1HXY D;  2NTT A;  3HUI A;  4AQ7 A;  3BK1 A;  1JCK B;  1PUT A;  1WSP A;  1TS4 A;  4P6V F;  1VZ7 A;  1DOX A;  4HEA 1;  4ZRQ A;  1JW9 D;  1N5W A;  3TSS A;  1MHX A;  2MJ3 A;  1FM0 D;  2RMM A;  3Q8A A;  4C80 A;  3OWE B;  1QOB A;  1RM6 C;  4B0E A;  3BYY B;  1XCQ L;  1NYQ A;  1J7B A;  1JWA D;  1VJK A;  1I4G A;  2ON8 A;  4A55 A;  3AMZ A;  1L0Y B;  3T3O A;  1I4Q A;  2JSV X;  3KWV A;  4L2Y A;  4USA A;  3SFD B;  1I4P A;  1UUP A;  1VR9 A;  1JML A;  2BTE A;  1EU3 A;  5BYQ A;  3AN1 A;  1VZ8 A;  2Y5P A;  1JRP A;  4XDC A;  3BK2 A;  1DGJ A;  2MJE A;  1AYF A;  4YSX B;  3NVW A;  3LB8 C;  2QIE B;  2CU3 A;  1C77 A;  4RCO A;  1D5X C;  1ZXH A;  1FXA A;  4ARC A;  1FO4 A;  1EWC A;  3AE2 B;  2LEK A;  2WQY B;  2RDH A;  3VRA B;  2Q5W D;  2PLP A;  2KDM A;  2W54 A;  1JWU D;  4RH6 A;  2KMM A;  3R8B A;  2V4I B;  4ARI A;  5EE3 A;  4NJC A;  1N61 A;  1YQ4 B;  1V8C A;  3CWI A;  1FXI A;  3MHZ A;  3E9S A;  2BT6 A;  1ZDX A;  1D4B A;  1C4A A;  2QMT A;  2ZW1 A;  2BS3 B;  2N0S B;  4MAC A;  4Q2J A;  1I4X A;  1ACC A;  2LHD A;  1MHH E;  1TS5 A;  2L52 A;  3Q8B A;  4A9A A;  3U2S C;  2FBW B;  5T8I A;  1C76 A;  3AE1 B;  1CK1 A;  2H89 B;  1CJE A;  2JU6 X;  4J3O D;  2RDG A;  4AS1 A;  1KLG D;  2JXT A;  2PIA A;  3BYT B;  3E56 A;  1TKY A;  4H2A A;  2INP E;  1E6E B;  3FAH A;  1FCC C;  3LXF A;  4P16 A;  1PGX A;  2WP9 B;  4KGT A;  3U7Z A;  3HVZ A;  3PZ8 A;  3VRB B;  3AB5 A;  1SB3 C;  2IGH A;  1BXT A;  3P1M A;  1VLB A;  2OED A;  5BYR A;  2BB5 A;  2LHE A;  1QOG A;  3ETR A;  1SSN A;  1V1O A;  2EKI A;  1QF6 A;  1XLP A;  2WXI A;  1JWM D;  4WIP A;  1XO3 A;  4ZHO A;  1VDV A;  3AEG B;  2WXO A;  3BVZ A;  3PZ7 A;  3Q69 A;  2BW2 A;  2WXG A;  4RFB A;  1UGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...