1QOFA

Ferredoxin mutation q70k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDKIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qofA00
1AWDA 2W55A 1NYRA 1VJKA 1RYJA 2Q5WD 1R7SA 4YT0B 2PVGC 1N62A 1F0ZA 2WDRB 3B9JA 1QOBA 3P4RB 4ZOHC 2W54A 1YJIA 1TJEA 2MJDA 2FBWB 3AMZA 3NVZA 1KRHA 1N63A 3AEEB 1J7AA 4FXCA 4YSYB 1DOYA 2Y5CA 5AUKA 3NVVA 3P1MA 4YTNB 3SR6A 1CJEA 5EE1A 4YSZB 2KAJA 2H88B 1RFKA 1N61A 2WQYB 4YSXB 1WRIA 2CJNA 1KF6B 2BS3B 3W9CB 3AEFB 2W3RA 4LTUA 1ZOYB 1JRPA 1FFVA 2K9XA 1FM0D 2WP9B 3SFEB 4C80A 1RWSA 1L5PA 1PUTA 3BIID 2WDVB 3AE9B 3FAHA 3AEGB 1QLBB 1N5XA 1JALA 1YQ3B 3AEBB 3HVZA 3WCQA 1L6UA 1WYGA 2M19A 3NS1A 1VDVA 2K22A 1QF6A 1DGJA 1XLOA 2CU3A 3DWMA 3W5UB 3ZYYX 2OHFA 3PO0A 2WDQB 2MH7A 1YQ4B 2W3SA 2N0SB 1A70A 3AEAB 1OQQA 1QOGA 1DOXA 5H92C 2CJOA 3HRDD 4YXDB 2MJEA 5EE3A 3L4PA 4KX6B 1I7HA 2JQRB 1L0VB 1V97A 3AH7A 3VR9B 3NVWA 5G5HA 1E9MA 1FO4A 5C3JB 1E7PB 2QIEB 3AEDB 1B9RA 1FXIA 2HTME 1J7BA 3AE6B 3DWGC 3P4QB 4C7ZA 1T3QA 1ZUD2 1QOFA 2WU5B 1ZP0B 2L83A 1JWBD 1FXAA 2JX5A 4JWUC 1WGKA 3NRZA 4USAA 3AE4B 1RM6C 2BT6A 1OFFA 4N58A 1IUEA 3SFDB 2MJ3A 4WWMA 1E10A 1TYGB 1WWTA 5C2TB 1V8CA 3VRAB 1N60A 5MPOA 2DBYA 2PIAA 4JX1C 1E0ZA 2PVOD 3AM9A 1GPXA 4P6VF 3AV8A 1KFYB 1TKYA 3ABVB 1PFDA 3AE1B 4IDIA 4ITKA 4YTPB 1E6EB 1JW9D 3B2FA 4ZHPA 2ACZB 2M56B 1SB3C 2BS4B 3NVYA 1QOAA 1JQ4A 2WU2B 3VRBB 1CZPA 1NI3A 1NVID 3VR8B 3AE2B 3P63A 1TKEA 1JWAD 3CWIA 3LB8C 2G1EA 2PKOA 3P4PB 3EUB2 1SIJA 2B76B 4ZHOA 4A9AA 3ETRA 1VLBA 4JWSC 3AE7B 1YJJA 4N6EB 1PDXA 1FMAD 1JROA 1L6VA 1NEKB 2H89B 2KMMA 3AE3B 1XLNA 3FC4A 5AUIA 2E3TA 1OQRA 3CIRB 1N5WA 2L52A 3HUIA 5EE9A 2DWQA 3AECB 1ROEA 2QJLA 1ZXIA 1DOIA 2BS2B 1SF0A 4HRSA 5EE0A 4YTMB 3AE8B 3B2GA 3AN1A 4WQMA 5G5GA 4US8A 1XLPA 1FRDA 1J7CA 1WXQA 1XO3A 3KWLA 3LXFA 1QT9A 1NYQA 3P4SB 1FFUA 1UWMA 1XLQA 5GXGB 4C7YA 3W5VB 2EKIA 2WLBA 3RPFC 1TKGA 2K5PA 3AB5A 3AE5B 1NENB 4HROA 4US9A 2WS3B 2LEKA 1GAQB 1FIQA 1AYFA 2AX5A 5H8YE 4N59A 1FRRA 1EWYC
chains in the Genus database with same CATH superfamily
3PRMB 2MJDA 3L0WB 4M0WA 1L0YB 4GB9A 4E71A 3TCAA 1J7AA 3RZFA 1MJDA 3B0AA 4HJGE 4BOZB 3BZDB 4KVGB 2LUEA 4AOFA 2BS3B 1SEBD 4XWWA 2BWFA 1YN4A 4P16A 1PUTA 4HJKA 4IM3A 4ZRQA 1QILA 3QARA 5AZGA 4PS3A 3I57A 1VDVA 2LGSA 4RNAA 2FCNA 2QSDA 1IBXB 4A8XC 1I42A 1XCTL 3L4PA 3IG3A 2JXXA 1WR6E 1B9RA 1FXIA 3K9OB 2M4NA 2MP2B 4P7IA 2HE7A 2QC8A 2KDMA 3N30A 5C2TB 2V3NA 1GPXA 5LXIB 2A4ZA 2I38A 4FADA 1WXMA 2O6VB 3WAPA 2RDBC 2OEDA 4JL9A 4DWFA 3ETRA 3HIZA 3QCAA 2BYFA 5D3IB 2KC1A 1FNVA 4GMVA 4NJCA 2WXLA 4XWTA 1SBBB 5HG2A 3BK2A 1XO3A 3KWLA 1G6JA 2HD5B 1K50A 2WLBA 2EELA 3EFUA 4HWIB 1YN3A 3SDLC 1WRDB 1WJUA 1WR1A 3VTVA 2L00B 1F0ZA 2WXIA 1V81A 3ECIA 3P4RB 1ET9A 5HHDG 1TJEA 2WXOA 4IG7B 3AMZA 2RPQA 3QK0A 1KTKA 2LWPA 3IXSA 2J7QB 5LXHA 1Z5SB 4KIKB 2ZCCA 4MJSA 3R7RA 5D3DA 2WP9B 1VRAB 1L6UA 5IKCM 2GBMA 2AL3A 5D6JB 1WX9A 3QJZA 5CHFA 2M0XA 3W5UB 2NBUA 4NY0A 3E9SA 4MGKE 4G11A 4DHJD 4FHKA 2CHXA 1VZ8A 2KTRB 2BF8B 2A5UA 5JH5C 5DPWA 2CHZA 1Q5WB 3Q8FA 2OJWA 4A55A 2KFJA 2PVOD 3AM9A 3ABVB 4ITKA 4LJPB 4R3DA 3K9PB 2R2OA 5C1ZA 4CYEA 2GBJA 2MSED 1JWAD 3CWIA 1UBIA 2WNMA 1HEZE 1HQRD 1J8CA 4A9AA 1VLBA 2E6XA 2I1KA 3VUWA 3HM6X 3T3OA 2D5GA 3ENEA 2DLBA 4NPNA 3B2GA 3APCA 3ONSA 2IY1B 1Q10A 2D3CA 2KOXA 3P4SB 4C7YA 1PQSA 2LEKA 3Q14C 1FEHA 2GOWA 2ZNVB 2FIFA 2PVGC 1TY2A 2WXNA 5JZEB 2C60A 5BMGA 1JWUD 3AU4A 2Y5CA 3SR6A 2Z59B 2KX0A 3B08A 2KAJA 1WJNA 3ZW3A 3AEFB 2ZVNA 2JYEA 4ZRKA 5I4DA 3DBHI 1JALA 4ZYNA 2J0KA 1KH0A 3N32A 4B9KA 2BYVE 2OHFA 1MHXA 2MBEA 3MC8A 4PYZA 2V4IB 1T6BX 2HJ1A 2MJEA 2R61A 1WGDA 2ZCBA 2ZPYA 3VVWB 3PZ7A 4BKGA 3Q6BA 1QOFA 1Z2MA 1FXAA 3O65B 1K8RB 3DBLI 4GDKA 4B95A 2KDIA 2V3SA 3UGBB 1RM6C 4RGOS 2PJHA 2I1JA 4GXBA 5J2RA 1TYGB 2W82A 3WANA 1SJED 2KVZA 3PREA 1SB3C 3NVYA 4WWPA 2GBKA 2WU2B 2G4SA 1P1AA 1I4RA 2J0JA 4YSXB 2BQQA 2TSSA 1VZ6A 3AE3B 5DCNA 4W9DA 4YTMB 1SF0A 2GLSA 3V3XA 4IWPA 2AWTA 5KHQA 2PPHA 2K8HA 2KHWB 2AX5A 1H4RA 1EWYC 2MWSB 2KNBA 2CKHB 1V5TA 2N9EB 4EZLA 1N62A 2QILA 1WGYA 4PS7A 3B9JA 4EKUA 4DXAB 4A90A 3QX1A 1WGGA 4B0MA 1P7EA 5JHBA 1RFKA 3Q8BA 1SE9A 4RGNA 2KXJA 4DXFA 4LCDE 3A1QB 4BZAA 4HLEA 4ZRJA 3WAMA 4OVVA 2CHWA 1SSNA 1UF0A 4J6IA 3APFA 3GB1A 1PGXA 3A9KB 4A3OA 2JRIB 1LXDA 4XE0A 3PRPB 3I5JC 4GSWA 2FCMA 4BKSA 4YXDB 4KX6B 5BYQA 2JZZA 1M4VA 2IO1B 2XNAC 1GNUA 3SHQA 1ENFA 4I6LB 1EU3A 4MEMA 2KDBA 3OWEB 3ZO5B 3T3NA 4USAA 2JZPA 1IUEA 1D4BA 3RCZA 2NTTA 1IPGA 4DDID 3URYA 3KLSX 1KLGD 4HDQA 4DDGD 4ZHPA 1UBQA 1Y56A 1E8YA 2Y5PA 1T0SC 3APDA 4BKSD 1E7UA 1CZPA 1V6EA 1V1PA 3AE2B 5L83A 4ZHOA 2B76B 3NS8A 4WURA 2O6VD 3ZJVA 1TGZB 1YX6B 4N6EB 1OQRA 1V1OA 3CMMB 5EE9A 3ML8A 2DZIA 1K51A 4WAFA 1KLUD 1J7CA 1EM7A 1WXQA 2G4DB 3MFGA 4KGSA 5J17A 1UWMA 3TSSA 1J0GA 1C4PA 4ANWA 1YMHE 4KSKC 1RYJA 3CSFA 2N9XA 2C9WB 2J0MA 4HXDA 4LNKA 1OEYJ 2KACA 4KGTA 2N7EA 4LLGM 2LVPA 3P1MA 2KWDA 1CJEA 1MPEA 2BWES 3I3TB 4TKNA 3KVFB 1L4ZB 2NR2A 2RPVA 3MC9A 2W3RA 1WM3A 4RFBA 1I4QA 1WE7A 3Q3JA 3R66C 2YVCA 2KLCA 1QF6A 3Q69A 5FK9C 4JGHB 3DWMA 3KW5B 1OQQA 1QOGA 3H7PB 3L10B 1QQRA 1I7HA 2NPTA 3ZVVA 4XGAB 2KQSA 4K81A 5G5HA 3JYUA 3PSEB 1WJ4A 2BPSA 2INDC 1FCCC 4F1SA 2V0GA 2WYQA 5DPRA 1S3SG 2DYBA 1SIFA 3I9V1 4OW0A 3ZNGC 1MFWA 5HFYA 2JZ3B 2BGFA 3NRZA 3C19A 1WX7A 3SFDB 4HDOA 4ANUA 5T8IA 1YQBA 3PZ8A 5G55A 1E0ZA 2KD0A 2FE8A 1JW9D 1BXTA 2BS4B 3RULA 3KYDD 4Q2JA 3VRBB 1YIWA 1WZ3A 3P4PB 3GE3C 1CQVA 2KMAA 2LJ5A 2K6QA 2MBOA 2RD0A 1HE8A 4NAWB 2PLPA 3W1YA 2QJLA 1ZXIA 3KH0A 2JYTA 3MP9A 2AL6A 1OTRB 4FLHA 4C56C 1MI0A 4DK5A 1UZXB 4MDKE 1FRRA 3VQIA 5AZHA 1WYWB 2KN5A 1GG3A 2G45B 2VH1A 2ASQA 1HZ6A 3TMPB 4GDLB 4REZA 4II2B 3H1UA 2GRIA 2XK5A 1Y8RC 2H88B 5IA7A 2O2VA 1OQYA 1KF6B 2RDGA 1FFVA 1L7YA 2KTFA 2MEKA 3IFWB 2MCNB 3LJ3A 3Q8AA 3WCQA 2EMSA 4MM3A 2D07B 2KWUB 3TEYA 4GN1A 3PZDA 4BBNC 1R4NI 2MHJA 5IN7A 5AZFA 5EE3A 2D10A 1L0VB 3AH7A 2JRHA 3VR9B 1STEA 5C23A 5IOIA 2AQ3B 2J42A 2WU5B 3Q8CA 2JX5A 4WJQA 4MH8A 4CHKA 3PHXB 3A4SC 5EDSA 2BT6A 5MPOA 2K3UA 2ZVOA 2FCQA 2MW5A 4P6VF 5CX3A 1VR9A 3MTNB 2MLBA 1E6EB 3LYYA 1UGMA 2BBCA 4GLSC 3R2IA 2VZKB 3PT2B 2ZW0A 1LQBA 2DAFA 2XN9C 2YEPF 1NI3A 1WJ6A 1AW7A 1WMHB 1SIJA 4TMAB 3V60A 1F2RC 1L6VA 2KQ7A 2ON8A 3M3JA 1NEKB 2D3BA 3CIRB 3IT6B 2LI5A 2INCC 4K7UA 2DZKA 3CF6E 3AE8B 3WAOA 3QHTA 1RRBA 2L7RA 1XT9B 1MHHE 1QT9A 2KMCA 4FJZA 2KDFB 2WDRB 3NOBA 3IVFA 4QAYA 3UI3A 3VHTC 4CQNA 3DBHB 1TZ1A 5D2MB 1EUVB 2KX3A 3GP7A 2FIDA 4HK2A 4YSZB 3OG5A 2EKEC 3ZUNA 4W9IA 4IM0A 3M95A 3W9CB 4LTUA 2DYOA 3VFKA 3AEGB 3BY4B 4PYUA 3X23A 3PLUA 4LDTB 1WGRA 3S2AA 2J52A 3JSVB 2WHIA 4JE3B 3RMKC 2WXGA 2IO0B 3DVNV 4AJYB 1UNSA 4EZKA 3EFCA 2KDEB 4M00A 1ZUD2 2JSVX 1T0YA 4WIPA 2L0TA 4URKA 1QZEA 3AE4B 4NAMA 1SJHD 1TS2A 1JCKB 2GMIC 3BVZA 1L2NA 3VTWA 4P1BC 2SEBD 4LK0M 1M94A 2M56B 1UH6A 2JVCA 3DVGX 2BTEA 2KWVB 2DZMA 2QMTA 1PYWD 3QAQA 3TIXA 3OLMD 2L32A 5E6OA 1I4XA 3RUIB 4ANXA 3A9JA 2NVUI 1ZXHA 2LGDA 2KFKB 3L16A 3KUCB 4HRSA 2G9HD 3J9CA 1XLPA 1FFUA 4YWGG 4TV3A 1UWXA 1YJ1A 3RNFC 3V6CB 2RDHA 2KC2A 4BOSC 1D6EC 4N59A 1TZOA 1NI2A 1AWDA 4HVBA 3ZJTA 2Q5WD 1ZGUB 3RN9C 1QOBA 4RGTA 2GB1A 2MBHA 1SE3A 4MGYE 2YLMA 3AEEB 4OZBA 2PW9A 2M0AA 3GE8C 4YTNB 4OZCA 3H7PA 2C7NB 3U30A 1XEEA 4RH6A 1N61A 4D2KA 4EE2A 4FN2A 2B3AA 2K25A 4B0EA 3R7QA 4C4VB 1L5PA 3UIPB 2Z0DB 2GI9A 3GZNB 3H7SA 1ACCA 3X0WA 4MGZE 2GBRA 3VH4B 1LO5D 1VCBA 2AQ1B 4PT5A 3ZYYX 3EC8A 1YX5B 1WXAA 2AQ2B 2LHEA 3SU8X 3LDZE 1MG8A 1PGAA 3AXCA 1E9MA 1XD3B 4A3PA 3HVDA 2L83A 4HCPB 3OJ3A 1DYQA 4AUQC 2JUOA 4N58A 3RNCC 2LMCA 4NQLB 2ZZPB 3L13A 3AE1B 3P42A 2ACZB 3BYYB 1QOAA 2K1FA 1ISNA 4AS1A 3B1LX 4G0NB 3OJ4B 1NVID 1YN5A 2MX2A 1JWSD 2KJHB 2X8XX 2HJ8A 4JPSA 2E3TA 2AEHA 4NQKE 3KYCD 4M01A 1WFYA 1ROEA 4N9F4 2BS2B 1SE2A 2N7DA 3ZGZA 2I2YA 4LJOB 2L76A 3LXFA 5FR3A 3EECA 2KVRA 1T0RC 4DQOC 3WALA 2KANA 3A33B 2LGYA 1OGWA 1FD6A 1VJKA 1FXTB 4GGQA 4O1NA 4X57B 1J19A 2C7MB 5D7GA 1ZDVA 1ET6A 2FUG1 4LNIA 2RSUA 4TSSA 4RF1A 2JPHA 4A20A 4ARIA 2C5LC 4GOCA 1TBEA 2QHOA 2QDFA 2N9PC 1YQ3B 3HVZA 3ZKJC 2K22A 2ZNVC 2D2QA 2IJ0A 2MQJA 4H2AA 1YQ4B 1C9FA 1A70A 2M17A 2REXA 1IBXA 1EU4A 3BINA 2LD9A 4W9FA 1T3QA 3GS2A 3ZXRA 2L05A 4RMAA 2SAKA 2IGHA 2L1AA 4XDDA 1F52A 3ZNZB 1E7VA 4KZ0A 2MP2A 4PK1A 2N9LA 2BB5A 3KWVA 4RGMA 5FKAC 2DENB 3AV8A 1TKYA 4IDIA 4F7ZA 4IWOA 4W9JA 1GUAB 2O6VA 1FO4A 3H9DA 1E8XA 4BKTA 3C0RB 1WF9A 2ZPNA 1Q0WB 5AUIA 2KZRA 2L52A 3DBRB 1DOIA 2L8JA 3PS6A 1FNWA 1LFDA 1TKGA 3T9LA 1FCLA 4US9A 1UGJA 1NBFC 3Q8EA 3ZLZA 4YT0B 2QEJC 5JHAA 2W9NA 4DHJB 1N63A 3JSVA 2MA9B 1RLFA 5EE1A 2NBWB 1ESFA 2WX0A 2BB6A 4MJSB 3U4EG 4II3B 5G2NA 4KIKA 1JRPA 1FM0D 3N3KB 3T8MA 2DYMA 2UYZB 3RI7C 4BVUC 2CU3A 2Z0EB 2BYTA 2XBBC 3PO0A 2WDQB 1E8WA 1EF1A 2K0PA 4WWNA 4XC2A 4ZDVA 2WXHA 1WI0A 2BKFA 2Y3AA 4EUTA 3RYTA 4DBGA 5E6JA 1J7BA 4ICUA 3QQ8B 3DHGC 3ZQ4A 3VTUA 2KTRA 3UF8A 1WXVA 1P9DU 4NNJB 5E6NA 1TS3A 4FULA 1KFYB 4BBNF 3H6NA 3B2FA 4W9GA 2KK8A 3RNBC 4W9CA 1WXSA 1FPYA 4TUUA 3BVMA 1V86A 2M8SA 2WX1A 3TEXA 1T0QC 3QA8A 2H89B 3PTFC 1XLNA 3ALBA 1N5WA 3HK0A 1TT5B 3M63B 2BW2A 5IO9A 4PS8A 3VUXA 1PGBA 4FBJB 4TQ0A 2HTHA 1AYFA 1R7SA 3H8HA 2DZJA 2RGFA 1YJIA 2WGSA 5J18A 2X38A 2D3GA 4WJOA 3NVZA 5HKHA 1HXYD 1KRHA 1R4MI 3NJTA 2VRRB 4JLCA 3ZJUA 3L17A 3TEWA 2PMVA 3PV1A 2JY6A 4ZRPA 2BVCA 2LXCA 2NMQA 4HKQA 1N6ZA 4K7SA 1KLVA 2NTSA 1HTQA 3PLVA 1P3QU 2KO3A 4F8CB 1JMLA 4W9EA 1C79A 3VAWA 1A5RA 1L4DB 2CU1A 5CTRC 1UD7A 3NS1A 1EO6A 2WXMA 3BYTB 4KV2A 4S0RA 2LHDA 3PRZA 3AEDB 4LNNA 3P2BA 5HI1A 3AE6B 5FR6A 4GDKB 3KUDB 2N9KA 1OFFA 2VH2A 4WAAA 4WWMA 1N60A 4JX1C 3Q3OC 2V9HA 4IWQA 2PE9A 2IPKD 5DPSA 1P0RA 4OVUA 1TKEA 2IO2B 3C8YA 1B1ZA 4WJPA 2Z8LA 1PDXA 3N20C 1JROA 1AARA 2WWZA 1D5ZC 2J4XA 1GC6A 4FJYA 3Q2AC 1HTOA 2UWQA 3AN1A 4WQMA 4US8A 5AEKB 4W9HA 3HHMA 1NYQA 3NY5A 1TTNA 3ZDTA 1XCQL 2K5PA 2ZEQA 3AE5B 4HROA 4RM9A 4ASWC 1FIQA 3MC0B 1XF5L 1E8ZA 5LNK1 3V62A 3ZNID 3DCGA 2LRWA 2LUMA 4YSYB 4ZRIA 1DOYA 2YEPB 1ZDXA 3Q3MC 1WGHA 2LJIA 4IOIE 1MVKA 3ZNHB 4WH4A 2OJRA 3DHHC 3NZUA 3WA0A 2K8BA 2K9XA 4C80A 4KDLB 3A1QA 3FAHA 2WDVB 4W9LA 4L1BA 3AEBB 4HEA1 2PEAA 1I4GA 1YOVB 3IT4B 3A9KA 1JRUA 3VUYA 2LGIA 3VDZA 4I6NB 1DOXA 3A4RA 1V80A 1E7PB 4ACFA 1AN8A 2OOBB 2Y5BB 3DHIC 3DVGY 4K3BA 1KOTA 4JWUC 4WQOB 3CSTA 1FNUA 2PTLA 1WGKA 4MH0E 2IGGA 3PHWB 3SEBA 4EFOA 3Q3FA 2MJ3A 3DBLB 3DBSA 5DPTA 1ZW7A 3DOWA 4YTPB 1JWMD 4LNOA 1IGCA 3RNEC 3NZSA 1F2RI 2IYDB 3N1YC 1JQ4A 3KUZA 1V1PB 2MRPA 3VR8B 1UELA 3QWZB 3LB8C 4OHJA 2LGXA 3O13A 4IKGA 3EUB2 4NJ7A 1IP9A 3N1ZC 4MELA 1WE6A 1CK1A 4JWSC 3AE7B 2KN4A 4XDCA 3ZTCA 1FMAD 1IYFA 4MGIE 1SGHA 3W1SC 2WXQA 3FKYA 1C3TA 1V9JA 5IAAC 3BVGA 1GB4A 4WJNA 3L54A 1WSPA 4HPMB 2CS4A 2KLGA 5GXGB 2LVOA 1D5MC 1Q1OA 1BUIC 3I63C 1EF5A 2W55A 1NYRA 2M1MA 1TS5A 2KYWA 4JIOU 2ZJDA 4NZLB 2V1YA 3UIOB 4KZCA 4FXCA 3ZXVA 1TIFA 5AUKA 1C77A 5BYSA 4DXGA 1P98A 4IW0A 5LLIA 3D32A 3JVZX 1CMXB 4NJ6A 2G3QB 1ZOYB 1L0XB 2JWUA 3SFEB 1RWSA 3BIID 3DPDA 3MHZA 2C7HA 2UU7A 4K3CA 4WWOA 2NBVB 1V2YA 2MH7A 2W3SA 1E5WA 2NPTB 1C78A 3EA6A 1HA5A 1ZKHA 3MHSD 2KQ4X 2IO3B 2DAJA 4C7ZA 1H8CA 3P4QB 2DNFA 3ZRFA 2V3PA 1C4CA 3FILB 1GOZA 1KM7A 3BK1A 3IAS1 2MBBB 2HDEA 4GIVA 1YD8U 2J53A 4MT5A 4M8NA 1E10A 2NS5A 2DBYA 2PIAA 4A6QA 3RZWC 5IP4D 2KWCA 5E6PA 1LGRA 4XX5A 1YJJA 4FJVB 3EHVA 3FC4A 3HUIA 4KGRA 4E3CA 2DWQA 4NAWA 3PVLA 4IC7B 1FRDA 3JW0X 1D3ZA 4W9KA 1XLQA 3RNGC 2BYEA 4HPPA 1U4AA 4EEWA 3ML9A 1P7FA 2WS3B 3N9YC 1GAQB 4JQWC 3TJPA 2FUHB 1LM8B 4KSLC 4HKZE 1WX8A 2XEWA 3IHPC 2FAZA 3AI5A 1XXGA 2WXFA 2K8CA 4AP4C 2N1WA 4AWJA 3ZDMC 2XK5B 4GDLA 2IBIB 2O2VB 2L0FA 3E56A 2WXJA 1WRIA 1TY0A 1KJTA 1MG4A 1NDDA 2QCZA 3V05A 4MM3B 3U7ZA 2MBQA 1QLBB 1N5XA 3PGEA 4HCNB 4ANVA 1WYGA 2ONQA 3DQVA 4M0WB 5BMHA 3HM3A 3AEAB 4L23A 1GB1A 5H92C 1I35A 2RMMA 4AJWA 1V97A 2JWZA 1E90A 3N1XC 4KDIC 2QIEB 3R2TA 1QKZA 2D3AA 2HTME 4P1CC 4K1RB 1ZP0B 5JXVA 1K53A 1V5OA 2IGDA 1BMLC 3QC8B 5KHOA 3W1SA 1WWTA 1V8CA 3VRAB 3SD5A 1WM2A 3ZTDA 2WXPA 4J3OD 5GMVA 1PFDA 3IAM1 3GOEA 4UDUC 2KJ6A 2G1EA 4ZYSA 3M62B 1WMHA 2JT4B 4BAXA 3KQ4A 1XQQA 5EE0A 1F1HA 3NZ3A 3MJWA 2N7JA 2LASA 5CHVC 5D94A 1R4MB 2DHZA 2EKIA 3U7DA 1NENB 3TEZA 5H8YE 2WXKA 4KKIA 2D11A 1ZPSA 3V61A 2FCSA 2JU6X 1D5XC 2VZKD 3IBEA 2AYOB 2FBWB 2NCNA 4RM8A 4E74A 4FHJA 4S17A 3NVVA 4KKJA 3GZNI 2WQYB 2IZVB 1X1MA 2CJNA 2K6DB 1GC7A 2BKRB 1VD2A 3AE9B 2K39A 2ZW1A 4B6WA 3DVNU 2M19A 1DGJA 1XLOA 4XZ4A 3WIMA 2N4FA 3DDCB 4GU2A 2JQRB 1BT0A 1WIAA 5C3JB 3TUOA 4I6PA 5BO4B 3RT3B 1F77A 3DWGC 1R4NB 1RFAA 1JWBD 2RR9A 1F9JA 2R2QA 4G3XB 2CR5A 1I4HA 4ARCA 1IGDA 2DX5B 4IUMB 4MACA 2EMTA 3AU5A 4C00A 1WY8A 4LDTD 3MJ5A 3RFZB 3NHEB 3P63A 4LNFA 2PKOA 3W2DA 2LXAA 1C1YB 3A9JB 4K7WA 2INNE 2KMMA 2KJRA 4MSQB 2INPE 1WH3A 3AECB 2LVQA 3RD2A 1UUPA 5G5GA 2KFKA 4CO7A 3R8BA 3ZIMA 3W5VB 3U52E 3RPFC 3EGRA 5L95C 2LFIA 1K52A 1C4AA 4RCOA 3U8ZA 4OZAA 4DHZE 3U2SC 2IY0B 3L08A 1WZ0A 4ZOHC 2W54A 1ZE3D 5CHWA 3Q3NC 3VXWA 4OVZA 3R3MA 3NUHB 3PPAA 1HZ5A 1EWCA 2KT7A 1C76A 4FA6A 2ICIA 3VH3B 2JXTA 4M02A 4HPLB 3FILA 1GJZA 4C4VA 3UINB 4G50A 3TBLD 2FNJB 4EZJA 1OEYA 4RF0A 2N0SB 1S1QB 3OAWA 5BYRA 2CJOA 3HRDD 4DHZB 5BMIA 3NVWA 1SXTA 1SE4A 5TR5A 3UQAA 2LZ6A 2V4LA 4ICVA 2PE6B 4XYCA 2L3ZA 4L2YA 3ZRCA 2GBNA 2WDTB 4M8MA 2JF5A 1TS4A 2IDYA 4MSMB 1YNTE 3BWUD 1RAXA 4IM2A 4EOYA 4BFRA 1V49A 3AULA 5TSSA 1VZ7A 2WXRA 3DBRI 4YL8A 3UQBA 2LRUA 4TQ1A 3TL5A 1T5XD 3RNAC 3QIJA 1I4PA 3NG0A 3AB5A 4AQ7A 3V6EB 2N1VA 2KKCA
chains in the Genus database with same CATH topology
2W55A 1NYRA 1VJKA 1RYJA 1YMHE 1TS5A 4O1NA 4NZLB 2MJDA 4M0WA 1L0YB 2KACA 5D7GA 4KGTA 1J7AA 4FXCA 4LLGM 1ZDVA 1ET6A 2FUG1 5AUKA 1C77A 3P1MA 4HJGE 4TSSA 2KWDA 4RF1A 1CJEA 4DXGA 5BYSA 3BZDB 4ARIA 1MPEA 1L4ZB 2RPVA 2BS3B 2W3RA 1SEBD 1ZOYB 1L0XB 2JWUA 4RFBA 4XWWA 1I4QA 3SFEB 1RWSA 1YN4A 1PUTA 3BIID 4P16A 3MHZA 4ZRQA 1YQ3B 1QILA 3HVZA 3I57A 1QF6A 1VDVA 2K22A 3Q69A 2IJ0A 5FK9C 3DWMA 2MH7A 4H2AA 1YQ4B 2W3SA 4RNAA 2QSDA 1C9FA 1A70A 1IBXB 1OQQA 4A8XC 1QOGA 1C78A 1IBXA 1XCTL 1QQRA 1HA5A 1I7HA 3EA6A 3L4PA 1EU4A 5G5HA 2KQ4X 1B9RA 1FXIA 4C7ZA 3P4QB 2V0GA 1FCCC 1T3QA 3GS2A 2SAKA 2V3PA 3I9V1 1C4CA 2IGHA 4OW0A 3FILB 2L1AA 4XDDA 1GOZA 5HFYA 3NRZA 3BK1A 3IAS1 2HDEA 3SFDB 2J53A 4MT5A 2N9LA 2KDMA 1E10A 2BB5A 5T8IA 3KWVA 5C2TB 2DBYA 2PIAA 2V3NA 4RGMA 3PZ8A 1E0ZA 1GPXA 5FKAC 3AV8A 4IDIA 1TKYA 4A6QA 2FE8A 1JW9D 1BXTA 2I38A 2BS4B 4Q2JA 2OEDA 3VRBB 1FO4A 3P4PB 1CQVA 3ETRA 1YJJA 5D3IB 1FNVA 5AUIA 3FC4A 4NAWB 3HUIA 2L52A 2PLPA 2WXLA 2DWQA 4KGRA 4NJCA 2QJLA 1ZXIA 1DOIA 4XWTA 1SBBB 2JYTA 3MP9A 5HG2A 1FRDA 1FNWA 3BK2A 1XO3A 3KWLA 1K50A 1XLQA 2WLBA 1TKGA 4C56C 1FCLA 1MI0A 2EELA 4US9A 1UGJA 1P7FA 2WS3B 3N9YC 1GAQB 1YN3A 3Q8EA 1FRRA 3VQIA 4HKZE 4YT0B 2QEJC 1F0ZA 2WXIA 3P4RB 1ET9A 1HZ6A 5HHDG 1TJEA 2WXOA 1XXGA 3AMZA 2WXFA 1N63A 4GDLB 4REZA 2GRIA 5EE1A 1KTKA 1ESFA 3IXSA 3E56A 2H88B 2WXJA 2BB6A 3U4EG 1WRIA 1KF6B 1TY0A 2RDGA 1JRPA 1FFVA 1FM0D 2WP9B 5D3DA 3V05A 2MEKA 4MM3B 3U7ZA 1VRAB 2DYMA 1QLBB 1N5XA 3Q8AA 3WCQA 1L6UA 1WYGA 2ONQA 2CU3A 5BMHA 3TEYA 2BYTA 3W5UB 3PO0A 2WDQB 2K0PA 3AEAB 4L23A 1GB1A 5H92C 2RMMA 2WXHA 5EE3A 3E9SA 1L0VB 1V97A 3AH7A 3VR9B 1STEA 2Y3AA 2QIEB 3R2TA 1QKZA 5E6JA 2HTME 1J7BA 2AQ3B 1VZ8A 2J42A 2WU5B 3Q8CA 1ZP0B 2JX5A 4MH8A 5JXVA 3ZQ4A 1K53A 2IGDA 2BT6A 1BMLC 3Q8FA 1TS3A 3W1SA 4A55A 1WWTA 1V8CA 2K3UA 3VRAB 5MPOA 2PVOD 3AM9A 2WXPA 4J3OD 4P6VF 1VR9A 1KFYB 3ABVB 4ITKA 1PFDA 1E6EB 3IAM1 3B2FA 3LYYA 4R3DA 2BBCA 4GLSC 3R2IA 2VZKB 2ZW0A 2XN9C 2YEPF 3BVMA 1NI3A 4UDUC 1AW7A 1JWAD 3CWIA 2G1EA 1SIJA 4TMAB 4ZYSA 2WNMA 1HEZE 1HQRD 4A9AA 1VLBA 2E6XA 1F2RC 3TEXA 1L6VA 2ON8A 3T3OA 1NEKB 2H89B 2D5GA 1XLNA 3CIRB 1N5WA 3IT6B 3KQ4A 2DLBA 5EE0A 2BW2A 3AE8B 3B2GA 3NZ3A 2N7JA 1MHHE 1PGBA 1Q10A 1QT9A 3P4SB 4C7YA 2EKIA 4TQ0A 1NENB 3TEZA 2LEKA 1AYFA 5H8YE 2WXKA 4KKIA 1FEHA 1R7SA 1ZPSA 2PVGC 3H8HA 2WDRB 1TY2A 2WXNA 2JU6X 1D5XC 2VZKD 1YJIA 3UI3A 4CQNA 2X38A 2FBWB 3NVZA 1HXYD 1KRHA 5BMGA 1JWUD 3ZJUA 2Y5CA 3TEWA 3GP7A 2PMVA 3NVVA 3SR6A 4YSZB 2KAJA 4KKJA 4ZRPA 2WQYB 2NMQA 2CJNA 4HKQA 3W9CB 2NTSA 3AEFB 4LTUA 2DYOA 2JYEA 5I4DA 3AE9B 1JMLA 1C79A 2ZW1A 3AEGB 1JALA 1L4DB 2M19A 3NS1A 1KH0A 1DGJA 1XLOA 2WXMA 2J52A 2OHFA 1MHXA 4JE3B 2WXGA 3BYTB 2V4IB 1T6BX 2MJEA 2R61A 2JQRB 1UNSA 2LHDA 5C3JB 3TUOA 3AEDB 1F77A 5HI1A 3AE6B 3DWGC 3PZ7A 4GDKB 1ZUD2 1QOFA 2JSVX 4WIPA 1FXAA 1JWBD 3AE4B 2N9KA 1I4HA 1RM6C 4ARCA 4RGOS 1OFFA 4NAMA 1IGDA 1SJHD 1TS2A 1JCKB 3BVZA 4WWMA 4MACA 1TYGB 2W82A 1N60A 4JX1C 2SEBD 1SJED 4LK0M 2M56B 1SB3C 3NVYA 2BTEA 3MJ5A 3RFZB 2IPKD 2QMTA 1PYWD 2WU2B 1I4RA 4YSXB 3P63A 1TKEA 2PKOA 3C8YA 2L32A 3W2DA 1B1ZA 2TSSA 1I4XA 2Z8LA 1PDXA 1JROA 1VZ6A 2INNE 2KMMA 3AE3B 1D5ZC 2J4XA 2INPE 3AECB 1ZXHA 4YTMB 1SF0A 4HRSA 1UUPA 3V3XA 2G9HD 5G5GA 3AN1A 4WQMA 4US8A 3J9CA 1XLPA 1NYQA 3R8BA 1FFUA 1XCQL 4YWGG 3W5VB 3U52E 3RPFC 1UWXA 2K5PA 3AE5B 4HROA 2RDHA 3EGRA 2LFIA 1FIQA 1K52A 2AX5A 1C4AA 1XF5L 1D6EC 3MC0B 4N59A 4RCOA 1EWYC 4OZAA 1TZOA 1AWDA 3ZJTA 2Q5WD 1N62A 2QILA 3U2SC 5LNK1 3B9JA 1QOBA 4RGTA 4ZOHC 2GB1A 2W54A 1ZE3D 1SE3A 4OVZA 3AEEB 3NUHB 2LUMA 4A90A 4YSYB 4OZBA 1HZ5A 1DOYA 1EWCA 2PW9A 1C76A 1ZDXA 2M0AA 2YEPB 4YTNB 4B0MA 1P7EA 2LJIA 4OZCA 2ICIA 4IOIE 1MVKA 1XEEA 4RH6A 1RFKA 1N61A 2JXTA 3Q8BA 4D2KA 4RGNA 4DXFA 4EE2A 4WH4A 2K9XA 4C80A 4B0EA 3FAHA 1L5PA 2WDVB 3FILA 2GI9A 4L1BA 1ACCA 3AEBB 1SSNA 4HEA1 3GB1A 1PGXA 1I4GA 1LO5D 3IT4B 2AQ1B 4PT5A 3ZYYX 4RF0A 4XE0A 2LGIA 2N0SB 1DOXA 5BYRA 2AQ2B 2LHEA 2CJOA 3HRDD 4YXDB 5BMIA 4KX6B 5BYQA 1PGAA 3NVWA 1SXTA 1SE4A 1E9MA 1E7PB 1AN8A 1M4VA 2XNAC 3HVDA 2L83A 1ENFA 4JWUC 1EU3A 1FNUA 1DYQA 2PTLA 3OWEB 3T3NA 1WGKA 4USAA 2IGGA 2JZPA 4L2YA 1IUEA 4N58A 3SEBA 1D4BA 2LMCA 2MJ3A 2NTTA 1TS4A 3URYA 2IDYA 3KLSX 1KLGD 4YTPB 3AE1B 1JWMD 1IGCA 3P42A 4ZHPA 2ACZB 1F2RI 1Y56A 1QOAA 1YNTE 3BYYB 1JQ4A 2Y5PA 3BWUD 4AS1A 1V1PB 1CZPA 1NVID 3VR8B 1V1PA 1YN5A 3AE2B 4OHJA 3LB8C 4ZHOA 5TSSA 3O13A 1JWSD 1VZ7A 2WXRA 2B76B 3EUB2 4IKGA 1CK1A 4WURA 3ZJVA 4JWSC 3AE7B 4N6EB 2KN4A 4XDCA 1FMAD 4TQ1A 4JPSA 2E3TA 1OQRA 1V1OA 5EE9A 1T5XD 1ROEA 2WXQA 2BS2B 1SE2A 1K51A 3ZGZA 3BVGA 4WAFA 1KLUD 2I2YA 1GB4A 1I4PA 1J7CA 1WXQA 1EM7A 1WSPA 3LXFA 3MFGA 4KGSA 5GXGB 5FR3A 1UWMA 3AB5A 3TSSA 1D5MC 4DQOC 1C4PA 4AQ7A 1BUIC 1FD6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  2W55 A;  1NYR A;  1VJK A;  1RYJ A;  2Q5W D;  1R7S A;  4YT0 B;  2PVG C;  1N62 A;  1F0Z A;  2WDR B;  3B9J A;  1QOB A;  3P4R B;  4ZOH C;  2W54 A;  1YJI A;  1TJE A;  2MJD A;  2FBW B;  3AMZ A;  3NVZ A;  1KRH A;  1N63 A;  3AEE B;  1J7A A;  4FXC A;  4YSY B;  1DOY A;  2Y5C A;  5AUK A;  3NVV A;  3P1M A;  4YTN B;  3SR6 A;  1CJE A;  5EE1 A;  4YSZ B;  2KAJ A;  2H88 B;  1RFK A;  1N61 A;  2WQY B;  4YSX B;  1WRI A;  2CJN A;  1KF6 B;  2BS3 B;  3W9C B;  3AEF B;  2W3R A;  4LTU A;  1ZOY B;  1JRP A;  1FFV A;  2K9X A;  1FM0 D;  2WP9 B;  3SFE B;  4C80 A;  1RWS A;  1L5P A;  1PUT A;  3BII D;  2WDV B;  3AE9 B;  3FAH A;  3AEG B;  1QLB B;  1N5X A;  1JAL A;  1YQ3 B;  3AEB B;  3HVZ A;  3WCQ A;  1L6U A;  1WYG A;  2M19 A;  3NS1 A;  1VDV A;  2K22 A;  1QF6 A;  1DGJ A;  1XLO A;  2CU3 A;  3DWM A;  3W5U B;  3ZYY X;  2OHF A;  3PO0 A;  2WDQ B;  2MH7 A;  1YQ4 B;  2W3S A;  2N0S B;  1A70 A;  3AEA B;  1OQQ A;  1QOG A;  1DOX A;  5H92 C;  2CJO A;  3HRD D;  4YXD B;  2MJE A;  5EE3 A;  3L4P A;  4KX6 B;  1I7H A;  2JQR B;  1L0V B;  1V97 A;  3AH7 A;  3VR9 B;  3NVW A;  5G5H A;  1E9M A;  1FO4 A;  5C3J B;  1E7P B;  2QIE B;  3AED B;  1B9R A;  1FXI A;  2HTM E;  1J7B A;  3AE6 B;  3DWG C;  3P4Q B;  4C7Z A;  1T3Q A;  1ZUD 2;  1QOF A;  2WU5 B;  1ZP0 B;  2L83 A;  1JWB D;  1FXA A;  2JX5 A;  4JWU C;  1WGK A;  3NRZ A;  4USA A;  3AE4 B;  1RM6 C;  2BT6 A;  1OFF A;  4N58 A;  1IUE A;  3SFD B;  2MJ3 A;  4WWM A;  1E10 A;  1TYG B;  1WWT A;  5C2T B;  1V8C A;  3VRA B;  1N60 A;  5MPO A;  2DBY A;  2PIA A;  4JX1 C;  1E0Z A;  2PVO D;  3AM9 A;  1GPX A;  4P6V F;  3AV8 A;  1KFY B;  1TKY A;  3ABV B;  1PFD A;  3AE1 B;  4IDI A;  4ITK A;  4YTP B;  1E6E B;  1JW9 D;  3B2F A;  4ZHP A;  2ACZ B;  2M56 B;  1SB3 C;  2BS4 B;  3NVY A;  1QOA A;  1JQ4 A;  2WU2 B;  3VRB B;  1CZP A;  1NI3 A;  1NVI D;  3VR8 B;  3AE2 B;  3P63 A;  1TKE A;  1JWA D;  3CWI A;  3LB8 C;  2G1E A;  2PKO A;  3P4P B;  3EUB 2;  1SIJ A;  2B76 B;  4ZHO A;  4A9A A;  3ETR A;  1VLB A;  4JWS C;  3AE7 B;  1YJJ A;  4N6E B;  1PDX A;  1FMA D;  1JRO A;  1L6V A;  1NEK B;  2H89 B;  2KMM A;  3AE3 B;  1XLN A;  3FC4 A;  5AUI A;  2E3T A;  1OQR A;  3CIR B;  1N5W A;  2L52 A;  3HUI A;  5EE9 A;  2DWQ A;  3AEC B;  1ROE A;  2QJL A;  1ZXI A;  1DOI A;  2BS2 B;  1SF0 A;  4HRS A;  5EE0 A;  4YTM B;  3AE8 B;  3B2G A;  3AN1 A;  4WQM A;  5G5G A;  4US8 A;  1XLP A;  1FRD A;  1J7C A;  1WXQ A;  1XO3 A;  3KWL A;  3LXF A;  1QT9 A;  1NYQ A;  3P4S B;  1FFU A;  1UWM A;  1XLQ A;  5GXG B;  4C7Y A;  3W5V B;  2EKI A;  2WLB A;  3RPF C;  1TKG A;  2K5P A;  3AB5 A;  3AE5 B;  1NEN B;  4HRO A;  4US9 A;  2WS3 B;  2LEK A;  1GAQ B;  1FIQ A;  1AYF A;  2AX5 A;  5H8Y E;  4N59 A;  1FRR A;  1EWY C; 
#chains in the Genus database with same CATH topology
 3PRM B;  2MJD A;  3L0W B;  4M0W A;  1L0Y B;  4GB9 A;  4E71 A;  3TCA A;  1J7A A;  3RZF A;  1MJD A;  3B0A A;  4HJG E;  4BOZ B;  3BZD B;  4KVG B;  2LUE A;  4AOF A;  2BS3 B;  1SEB D;  4XWW A;  2BWF A;  1YN4 A;  4P16 A;  1PUT A;  4HJK A;  4IM3 A;  4ZRQ A;  1QIL A;  3QAR A;  5AZG A;  4PS3 A;  3I57 A;  1VDV A;  2LGS A;  4RNA A;  2FCN A;  2QSD A;  1IBX B;  4A8X C;  1I42 A;  1XCT L;  3L4P A;  3IG3 A;  2JXX A;  1WR6 E;  1B9R A;  1FXI A;  3K9O B;  2M4N A;  2MP2 B;  4P7I A;  2HE7 A;  2QC8 A;  2KDM A;  3N30 A;  5C2T B;  2V3N A;  1GPX A;  5LXI B;  2A4Z A;  2I38 A;  4FAD A;  1WXM A;  2O6V B;  3WAP A;  2RDB C;  2OED A;  4JL9 A;  4DWF A;  3ETR A;  3HIZ A;  3QCA A;  2BYF A;  5D3I B;  2KC1 A;  1FNV A;  4GMV A;  4NJC A;  2WXL A;  4XWT A;  1SBB B;  5HG2 A;  3BK2 A;  1XO3 A;  3KWL A;  1G6J A;  2HD5 B;  1K50 A;  2WLB A;  2EEL A;  3EFU A;  4HWI B;  1YN3 A;  3SDL C;  1WRD B;  1WJU A;  1WR1 A;  3VTV A;  2L00 B;  1F0Z A;  2WXI A;  1V81 A;  3ECI A;  3P4R B;  1ET9 A;  5HHD G;  1TJE A;  2WXO A;  4IG7 B;  3AMZ A;  2RPQ A;  3QK0 A;  1KTK A;  2LWP A;  3IXS A;  2J7Q B;  5LXH A;  1Z5S B;  4KIK B;  2ZCC A;  4MJS A;  3R7R A;  5D3D A;  2WP9 B;  1VRA B;  1L6U A;  5IKC M;  2GBM A;  2AL3 A;  5D6J B;  1WX9 A;  3QJZ A;  5CHF A;  2M0X A;  3W5U B;  2NBU A;  4NY0 A;  3E9S A;  4MGK E;  4G11 A;  4DHJ D;  4FHK A;  2CHX A;  1VZ8 A;  2KTR B;  2BF8 B;  2A5U A;  5JH5 C;  5DPW A;  2CHZ A;  1Q5W B;  3Q8F A;  2OJW A;  4A55 A;  2KFJ A;  2PVO D;  3AM9 A;  3ABV B;  4ITK A;  4LJP B;  4R3D A;  3K9P B;  2R2O A;  5C1Z A;  4CYE A;  2GBJ A;  2MSE D;  1JWA D;  3CWI A;  1UBI A;  2WNM A;  1HEZ E;  1HQR D;  1J8C A;  4A9A A;  1VLB A;  2E6X A;  2I1K A;  3VUW A;  3HM6 X;  3T3O A;  2D5G A;  3ENE A;  2DLB A;  4NPN A;  3B2G A;  3APC A;  3ONS A;  2IY1 B;  1Q10 A;  2D3C A;  2KOX A;  3P4S B;  4C7Y A;  1PQS A;  2LEK A;  3Q14 C;  1FEH A;  2GOW A;  2ZNV B;  2FIF A;  2PVG C;  1TY2 A;  2WXN A;  5JZE B;  2C60 A;  5BMG A;  1JWU D;  3AU4 A;  2Y5C A;  3SR6 A;  2Z59 B;  2KX0 A;  3B08 A;  2KAJ A;  1WJN A;  3ZW3 A;  3AEF B;  2ZVN A;  2JYE A;  4ZRK A;  5I4D A;  3DBH I;  1JAL A;  4ZYN A;  2J0K A;  1KH0 A;  3N32 A;  4B9K A;  2BYV E;  2OHF A;  1MHX A;  2MBE A;  3MC8 A;  4PYZ A;  2V4I B;  1T6B X;  2HJ1 A;  2MJE A;  2R61 A;  1WGD A;  2ZCB A;  2ZPY A;  3VVW B;  3PZ7 A;  4BKG A;  3Q6B A;  1QOF A;  1Z2M A;  1FXA A;  3O65 B;  1K8R B;  3DBL I;  4GDK A;  4B95 A;  2KDI A;  2V3S A;  3UGB B;  1RM6 C;  4RGO S;  2PJH A;  2I1J A;  4GXB A;  5J2R A;  1TYG B;  2W82 A;  3WAN A;  1SJE D;  2KVZ A;  3PRE A;  1SB3 C;  3NVY A;  4WWP A;  2GBK A;  2WU2 B;  2G4S A;  1P1A A;  1I4R A;  2J0J A;  4YSX B;  2BQQ A;  2TSS A;  1VZ6 A;  3AE3 B;  5DCN A;  4W9D A;  4YTM B;  1SF0 A;  2GLS A;  3V3X A;  4IWP A;  2AWT A;  5KHQ A;  2PPH A;  2K8H A;  2KHW B;  2AX5 A;  1H4R A;  1EWY C;  2MWS B;  2KNB A;  2CKH B;  1V5T A;  2N9E B;  4EZL A;  1N62 A;  2QIL A;  1WGY A;  4PS7 A;  3B9J A;  4EKU A;  4DXA B;  4A90 A;  3QX1 A;  1WGG A;  4B0M A;  1P7E A;  5JHB A;  1RFK A;  3Q8B A;  1SE9 A;  4RGN A;  2KXJ A;  4DXF A;  4LCD E;  3A1Q B;  4BZA A;  4HLE A;  4ZRJ A;  3WAM A;  4OVV A;  2CHW A;  1SSN A;  1UF0 A;  4J6I A;  3APF A;  3GB1 A;  1PGX A;  3A9K B;  4A3O A;  2JRI B;  1LXD A;  4XE0 A;  3PRP B;  3I5J C;  4GSW A;  2FCM A;  4BKS A;  4YXD B;  4KX6 B;  5BYQ A;  2JZZ A;  1M4V A;  2IO1 B;  2XNA C;  1GNU A;  3SHQ A;  1ENF A;  4I6L B;  1EU3 A;  4MEM A;  2KDB A;  3OWE B;  3ZO5 B;  3T3N A;  4USA A;  2JZP A;  1IUE A;  1D4B A;  3RCZ A;  2NTT A;  1IPG A;  4DDI D;  3URY A;  3KLS X;  1KLG D;  4HDQ A;  4DDG D;  4ZHP A;  1UBQ A;  1Y56 A;  1E8Y A;  2Y5P A;  1T0S C;  3APD A;  4BKS D;  1E7U A;  1CZP A;  1V6E A;  1V1P A;  3AE2 B;  5L83 A;  4ZHO A;  2B76 B;  3NS8 A;  4WUR A;  2O6V D;  3ZJV A;  1TGZ B;  1YX6 B;  4N6E B;  1OQR A;  1V1O A;  3CMM B;  5EE9 A;  3ML8 A;  2DZI A;  1K51 A;  4WAF A;  1KLU D;  1J7C A;  1EM7 A;  1WXQ A;  2G4D B;  3MFG A;  4KGS A;  5J17 A;  1UWM A;  3TSS A;  1J0G A;  1C4P A;  4ANW A;  1YMH E;  4KSK C;  1RYJ A;  3CSF A;  2N9X A;  2C9W B;  2J0M A;  4HXD A;  4LNK A;  1OEY J;  2KAC A;  4KGT A;  2N7E A;  4LLG M;  2LVP A;  3P1M A;  2KWD A;  1CJE A;  1MPE A;  2BWE S;  3I3T B;  4TKN A;  3KVF B;  1L4Z B;  2NR2 A;  2RPV A;  3MC9 A;  2W3R A;  1WM3 A;  4RFB A;  1I4Q A;  1WE7 A;  3Q3J A;  3R66 C;  2YVC A;  2KLC A;  1QF6 A;  3Q69 A;  5FK9 C;  4JGH B;  3DWM A;  3KW5 B;  1OQQ A;  1QOG A;  3H7P B;  3L10 B;  1QQR A;  1I7H A;  2NPT A;  3ZVV A;  4XGA B;  2KQS A;  4K81 A;  5G5H A;  3JYU A;  3PSE B;  1WJ4 A;  2BPS A;  2IND C;  1FCC C;  4F1S A;  2V0G A;  2WYQ A;  5DPR A;  1S3S G;  2DYB A;  1SIF A;  3I9V 1;  4OW0 A;  3ZNG C;  1MFW A;  5HFY A;  2JZ3 B;  2BGF A;  3NRZ A;  3C19 A;  1WX7 A;  3SFD B;  4HDO A;  4ANU A;  5T8I A;  1YQB A;  3PZ8 A;  5G55 A;  1E0Z A;  2KD0 A;  2FE8 A;  1JW9 D;  1BXT A;  2BS4 B;  3RUL A;  3KYD D;  4Q2J A;  3VRB B;  1YIW A;  1WZ3 A;  3P4P B;  3GE3 C;  1CQV A;  2KMA A;  2LJ5 A;  2K6Q A;  2MBO A;  2RD0 A;  1HE8 A;  4NAW B;  2PLP A;  3W1Y A;  2QJL A;  1ZXI A;  3KH0 A;  2JYT A;  3MP9 A;  2AL6 A;  1OTR B;  4FLH A;  4C56 C;  1MI0 A;  4DK5 A;  1UZX B;  4MDK E;  1FRR A;  3VQI A;  5AZH A;  1WYW B;  2KN5 A;  1GG3 A;  2G45 B;  2VH1 A;  2ASQ A;  1HZ6 A;  3TMP B;  4GDL B;  4REZ A;  4II2 B;  3H1U A;  2GRI A;  2XK5 A;  1Y8R C;  2H88 B;  5IA7 A;  2O2V A;  1OQY A;  1KF6 B;  2RDG A;  1FFV A;  1L7Y A;  2KTF A;  2MEK A;  3IFW B;  2MCN B;  3LJ3 A;  3Q8A A;  3WCQ A;  2EMS A;  4MM3 A;  2D07 B;  2KWU B;  3TEY A;  4GN1 A;  3PZD A;  4BBN C;  1R4N I;  2MHJ A;  5IN7 A;  5AZF A;  5EE3 A;  2D10 A;  1L0V B;  3AH7 A;  2JRH A;  3VR9 B;  1STE A;  5C23 A;  5IOI A;  2AQ3 B;  2J42 A;  2WU5 B;  3Q8C A;  2JX5 A;  4WJQ A;  4MH8 A;  4CHK A;  3PHX B;  3A4S C;  5EDS A;  2BT6 A;  5MPO A;  2K3U A;  2ZVO A;  2FCQ A;  2MW5 A;  4P6V F;  5CX3 A;  1VR9 A;  3MTN B;  2MLB A;  1E6E B;  3LYY A;  1UGM A;  2BBC A;  4GLS C;  3R2I A;  2VZK B;  3PT2 B;  2ZW0 A;  1LQB A;  2DAF A;  2XN9 C;  2YEP F;  1NI3 A;  1WJ6 A;  1AW7 A;  1WMH B;  1SIJ A;  4TMA B;  3V60 A;  1F2R C;  1L6V A;  2KQ7 A;  2ON8 A;  3M3J A;  1NEK B;  2D3B A;  3CIR B;  3IT6 B;  2LI5 A;  2INC C;  4K7U A;  2DZK A;  3CF6 E;  3AE8 B;  3WAO A;  3QHT A;  1RRB A;  2L7R A;  1XT9 B;  1MHH E;  1QT9 A;  2KMC A;  4FJZ A;  2KDF B;  2WDR B;  3NOB A;  3IVF A;  4QAY A;  3UI3 A;  3VHT C;  4CQN A;  3DBH B;  1TZ1 A;  5D2M B;  1EUV B;  2KX3 A;  3GP7 A;  2FID A;  4HK2 A;  4YSZ B;  3OG5 A;  2EKE C;  3ZUN A;  4W9I A;  4IM0 A;  3M95 A;  3W9C B;  4LTU A;  2DYO A;  3VFK A;  3AEG B;  3BY4 B;  4PYU A;  3X23 A;  3PLU A;  4LDT B;  1WGR A;  3S2A A;  2J52 A;  3JSV B;  2WHI A;  4JE3 B;  3RMK C;  2WXG A;  2IO0 B;  3DVN V;  4AJY B;  1UNS A;  4EZK A;  3EFC A;  2KDE B;  4M00 A;  1ZUD 2;  2JSV X;  1T0Y A;  4WIP A;  2L0T A;  4URK A;  1QZE A;  3AE4 B;  4NAM A;  1SJH D;  1TS2 A;  1JCK B;  2GMI C;  3BVZ A;  1L2N A;  3VTW A;  4P1B C;  2SEB D;  4LK0 M;  1M94 A;  2M56 B;  1UH6 A;  2JVC A;  3DVG X;  2BTE A;  2KWV B;  2DZM A;  2QMT A;  1PYW D;  3QAQ A;  3TIX A;  3OLM D;  2L32 A;  5E6O A;  1I4X A;  3RUI B;  4ANX A;  3A9J A;  2NVU I;  1ZXH A;  2LGD A;  2KFK B;  3L16 A;  3KUC B;  4HRS A;  2G9H D;  3J9C A;  1XLP A;  1FFU A;  4YWG G;  4TV3 A;  1UWX A;  1YJ1 A;  3RNF C;  3V6C B;  2RDH A;  2KC2 A;  4BOS C;  1D6E C;  4N59 A;  1TZO A;  1NI2 A;  1AWD A;  4HVB A;  3ZJT A;  2Q5W D;  1ZGU B;  3RN9 C;  1QOB A;  4RGT A;  2GB1 A;  2MBH A;  1SE3 A;  4MGY E;  2YLM A;  3AEE B;  4OZB A;  2PW9 A;  2M0A A;  3GE8 C;  4YTN B;  4OZC A;  3H7P A;  2C7N B;  3U30 A;  1XEE A;  4RH6 A;  1N61 A;  4D2K A;  4EE2 A;  4FN2 A;  2B3A A;  2K25 A;  4B0E A;  3R7Q A;  4C4V B;  1L5P A;  3UIP B;  2Z0D B;  2GI9 A;  3GZN B;  3H7S A;  1ACC A;  3X0W A;  4MGZ E;  2GBR A;  3VH4 B;  1LO5 D;  1VCB A;  2AQ1 B;  4PT5 A;  3ZYY X;  3EC8 A;  1YX5 B;  1WXA A;  2AQ2 B;  2LHE A;  3SU8 X;  3LDZ E;  1MG8 A;  1PGA A;  3AXC A;  1E9M A;  1XD3 B;  4A3P A;  3HVD A;  2L83 A;  4HCP B;  3OJ3 A;  1DYQ A;  4AUQ C;  2JUO A;  4N58 A;  3RNC C;  2LMC A;  4NQL B;  2ZZP B;  3L13 A;  3AE1 B;  3P42 A;  2ACZ B;  3BYY B;  1QOA A;  2K1F A;  1ISN A;  4AS1 A;  3B1L X;  4G0N B;  3OJ4 B;  1NVI D;  1YN5 A;  2MX2 A;  1JWS D;  2KJH B;  2X8X X;  2HJ8 A;  4JPS A;  2E3T A;  2AEH A;  4NQK E;  3KYC D;  4M01 A;  1WFY A;  1ROE A;  4N9F 4;  2BS2 B;  1SE2 A;  2N7D A;  3ZGZ A;  2I2Y A;  4LJO B;  2L76 A;  3LXF A;  5FR3 A;  3EEC A;  2KVR A;  1T0R C;  4DQO C;  3WAL A;  2KAN A;  3A33 B;  2LGY A;  1OGW A;  1FD6 A;  1VJK A;  1FXT B;  4GGQ A;  4O1N A;  4X57 B;  1J19 A;  2C7M B;  5D7G A;  1ZDV A;  1ET6 A;  2FUG 1;  4LNI A;  2RSU A;  4TSS A;  4RF1 A;  2JPH A;  4A20 A;  4ARI A;  2C5L C;  4GOC A;  1TBE A;  2QHO A;  2QDF A;  2N9P C;  1YQ3 B;  3HVZ A;  3ZKJ C;  2K22 A;  2ZNV C;  2D2Q A;  2IJ0 A;  2MQJ A;  4H2A A;  1YQ4 B;  1C9F A;  1A70 A;  2M17 A;  2REX A;  1IBX A;  1EU4 A;  3BIN A;  2LD9 A;  4W9F A;  1T3Q A;  3GS2 A;  3ZXR A;  2L05 A;  4RMA A;  2SAK A;  2IGH A;  2L1A A;  4XDD A;  1F52 A;  3ZNZ B;  1E7V A;  4KZ0 A;  2MP2 A;  4PK1 A;  2N9L A;  2BB5 A;  3KWV A;  4RGM A;  5FKA C;  2DEN B;  3AV8 A;  1TKY A;  4IDI A;  4F7Z A;  4IWO A;  4W9J A;  1GUA B;  2O6V A;  1FO4 A;  3H9D A;  1E8X A;  4BKT A;  3C0R B;  1WF9 A;  2ZPN A;  1Q0W B;  5AUI A;  2KZR A;  2L52 A;  3DBR B;  1DOI A;  2L8J A;  3PS6 A;  1FNW A;  1LFD A;  1TKG A;  3T9L A;  1FCL A;  4US9 A;  1UGJ A;  1NBF C;  3Q8E A;  3ZLZ A;  4YT0 B;  2QEJ C;  5JHA A;  2W9N A;  4DHJ B;  1N63 A;  3JSV A;  2MA9 B;  1RLF A;  5EE1 A;  2NBW B;  1ESF A;  2WX0 A;  2BB6 A;  4MJS B;  3U4E G;  4II3 B;  5G2N A;  4KIK A;  1JRP A;  1FM0 D;  3N3K B;  3T8M A;  2DYM A;  2UYZ B;  3RI7 C;  4BVU C;  2CU3 A;  2Z0E B;  2BYT A;  2XBB C;  3PO0 A;  2WDQ B;  1E8W A;  1EF1 A;  2K0P A;  4WWN A;  4XC2 A;  4ZDV A;  2WXH A;  1WI0 A;  2BKF A;  2Y3A A;  4EUT A;  3RYT A;  4DBG A;  5E6J A;  1J7B A;  4ICU A;  3QQ8 B;  3DHG C;  3ZQ4 A;  3VTU A;  2KTR A;  3UF8 A;  1WXV A;  1P9D U;  4NNJ B;  5E6N A;  1TS3 A;  4FUL A;  1KFY B;  4BBN F;  3H6N A;  3B2F A;  4W9G A;  2KK8 A;  3RNB C;  4W9C A;  1WXS A;  1FPY A;  4TUU A;  3BVM A;  1V86 A;  2M8S A;  2WX1 A;  3TEX A;  1T0Q C;  3QA8 A;  2H89 B;  3PTF C;  1XLN A;  3ALB A;  1N5W A;  3HK0 A;  1TT5 B;  3M63 B;  2BW2 A;  5IO9 A;  4PS8 A;  3VUX A;  1PGB A;  4FBJ B;  4TQ0 A;  2HTH A;  1AYF A;  1R7S A;  3H8H A;  2DZJ A;  2RGF A;  1YJI A;  2WGS A;  5J18 A;  2X38 A;  2D3G A;  4WJO A;  3NVZ A;  5HKH A;  1HXY D;  1KRH A;  1R4M I;  3NJT A;  2VRR B;  4JLC A;  3ZJU A;  3L17 A;  3TEW A;  2PMV A;  3PV1 A;  2JY6 A;  4ZRP A;  2BVC A;  2LXC A;  2NMQ A;  4HKQ A;  1N6Z A;  4K7S A;  1KLV A;  2NTS A;  1HTQ A;  3PLV A;  1P3Q U;  2KO3 A;  4F8C B;  1JML A;  4W9E A;  1C79 A;  3VAW A;  1A5R A;  1L4D B;  2CU1 A;  5CTR C;  1UD7 A;  3NS1 A;  1EO6 A;  2WXM A;  3BYT B;  4KV2 A;  4S0R A;  2LHD A;  3PRZ A;  3AED B;  4LNN A;  3P2B A;  5HI1 A;  3AE6 B;  5FR6 A;  4GDK B;  3KUD B;  2N9K A;  1OFF A;  2VH2 A;  4WAA A;  4WWM A;  1N60 A;  4JX1 C;  3Q3O C;  2V9H A;  4IWQ A;  2PE9 A;  2IPK D;  5DPS A;  1P0R A;  4OVU A;  1TKE A;  2IO2 B;  3C8Y A;  1B1Z A;  4WJP A;  2Z8L A;  1PDX A;  3N20 C;  1JRO A;  1AAR A;  2WWZ A;  1D5Z C;  2J4X A;  1GC6 A;  4FJY A;  3Q2A C;  1HTO A;  2UWQ A;  3AN1 A;  4WQM A;  4US8 A;  5AEK B;  4W9H A;  3HHM A;  1NYQ A;  3NY5 A;  1TTN A;  3ZDT A;  1XCQ L;  2K5P A;  2ZEQ A;  3AE5 B;  4HRO A;  4RM9 A;  4ASW C;  1FIQ A;  3MC0 B;  1XF5 L;  1E8Z A;  5LNK 1;  3V62 A;  3ZNI D;  3DCG A;  2LRW A;  2LUM A;  4YSY B;  4ZRI A;  1DOY A;  2YEP B;  1ZDX A;  3Q3M C;  1WGH A;  2LJI A;  4IOI E;  1MVK A;  3ZNH B;  4WH4 A;  2OJR A;  3DHH C;  3NZU A;  3WA0 A;  2K8B A;  2K9X A;  4C80 A;  4KDL B;  3A1Q A;  3FAH A;  2WDV B;  4W9L A;  4L1B A;  3AEB B;  4HEA 1;  2PEA A;  1I4G A;  1YOV B;  3IT4 B;  3A9K A;  1JRU A;  3VUY A;  2LGI A;  3VDZ A;  4I6N B;  1DOX A;  3A4R A;  1V80 A;  1E7P B;  4ACF A;  1AN8 A;  2OOB B;  2Y5B B;  3DHI C;  3DVG Y;  4K3B A;  1KOT A;  4JWU C;  4WQO B;  3CST A;  1FNU A;  2PTL A;  1WGK A;  4MH0 E;  2IGG A;  3PHW B;  3SEB A;  4EFO A;  3Q3F A;  2MJ3 A;  3DBL B;  3DBS A;  5DPT A;  1ZW7 A;  3DOW A;  4YTP B;  1JWM D;  4LNO A;  1IGC A;  3RNE C;  3NZS A;  1F2R I;  2IYD B;  3N1Y C;  1JQ4 A;  3KUZ A;  1V1P B;  2MRP A;  3VR8 B;  1UEL A;  3QWZ B;  3LB8 C;  4OHJ A;  2LGX A;  3O13 A;  4IKG A;  3EUB 2;  4NJ7 A;  1IP9 A;  3N1Z C;  4MEL A;  1WE6 A;  1CK1 A;  4JWS C;  3AE7 B;  2KN4 A;  4XDC A;  3ZTC A;  1FMA D;  1IYF A;  4MGI E;  1SGH A;  3W1S C;  2WXQ A;  3FKY A;  1C3T A;  1V9J A;  5IAA C;  3BVG A;  1GB4 A;  4WJN A;  3L54 A;  1WSP A;  4HPM B;  2CS4 A;  2KLG A;  5GXG B;  2LVO A;  1D5M C;  1Q1O A;  1BUI C;  3I63 C;  1EF5 A;  2W55 A;  1NYR A;  2M1M A;  1TS5 A;  2KYW A;  4JIO U;  2ZJD A;  4NZL B;  2V1Y A;  3UIO B;  4KZC A;  4FXC A;  3ZXV A;  1TIF A;  5AUK A;  1C77 A;  5BYS A;  4DXG A;  1P98 A;  4IW0 A;  5LLI A;  3D32 A;  3JVZ X;  1CMX B;  4NJ6 A;  2G3Q B;  1ZOY B;  1L0X B;  2JWU A;  3SFE B;  1RWS A;  3BII D;  3DPD A;  3MHZ A;  2C7H A;  2UU7 A;  4K3C A;  4WWO A;  2NBV B;  1V2Y A;  2MH7 A;  2W3S A;  1E5W A;  2NPT B;  1C78 A;  3EA6 A;  1HA5 A;  1ZKH A;  3MHS D;  2KQ4 X;  2IO3 B;  2DAJ A;  4C7Z A;  1H8C A;  3P4Q B;  2DNF A;  3ZRF A;  2V3P A;  1C4C A;  3FIL B;  1GOZ A;  1KM7 A;  3BK1 A;  3IAS 1;  2MBB B;  2HDE A;  4GIV A;  1YD8 U;  2J53 A;  4MT5 A;  4M8N A;  1E10 A;  2NS5 A;  2DBY A;  2PIA A;  4A6Q A;  3RZW C;  5IP4 D;  2KWC A;  5E6P A;  1LGR A;  4XX5 A;  1YJJ A;  4FJV B;  3EHV A;  3FC4 A;  3HUI A;  4KGR A;  4E3C A;  2DWQ A;  4NAW A;  3PVL A;  4IC7 B;  1FRD A;  3JW0 X;  1D3Z A;  4W9K A;  1XLQ A;  3RNG C;  2BYE A;  4HPP A;  1U4A A;  4EEW A;  3ML9 A;  1P7F A;  2WS3 B;  3N9Y C;  1GAQ B;  4JQW C;  3TJP A;  2FUH B;  1LM8 B;  4KSL C;  4HKZ E;  1WX8 A;  2XEW A;  3IHP C;  2FAZ A;  3AI5 A;  1XXG A;  2WXF A;  2K8C A;  4AP4 C;  2N1W A;  4AWJ A;  3ZDM C;  2XK5 B;  4GDL A;  2IBI B;  2O2V B;  2L0F A;  3E56 A;  2WXJ A;  1WRI A;  1TY0 A;  1KJT A;  1MG4 A;  1NDD A;  2QCZ A;  3V05 A;  4MM3 B;  3U7Z A;  2MBQ A;  1QLB B;  1N5X A;  3PGE A;  4HCN B;  4ANV A;  1WYG A;  2ONQ A;  3DQV A;  4M0W B;  5BMH A;  3HM3 A;  3AEA B;  4L23 A;  1GB1 A;  5H92 C;  1I35 A;  2RMM A;  4AJW A;  1V97 A;  2JWZ A;  1E90 A;  3N1X C;  4KDI C;  2QIE B;  3R2T A;  1QKZ A;  2D3A A;  2HTM E;  4P1C C;  4K1R B;  1ZP0 B;  5JXV A;  1K53 A;  1V5O A;  2IGD A;  1BML C;  3QC8 B;  5KHO A;  3W1S A;  1WWT A;  1V8C A;  3VRA B;  3SD5 A;  1WM2 A;  3ZTD A;  2WXP A;  4J3O D;  5GMV A;  1PFD A;  3IAM 1;  3GOE A;  4UDU C;  2KJ6 A;  2G1E A;  4ZYS A;  3M62 B;  1WMH A;  2JT4 B;  4BAX A;  3KQ4 A;  1XQQ A;  5EE0 A;  1F1H A;  3NZ3 A;  3MJW A;  2N7J A;  2LAS A;  5CHV C;  5D94 A;  1R4M B;  2DHZ A;  2EKI A;  3U7D A;  1NEN B;  3TEZ A;  5H8Y E;  2WXK A;  4KKI A;  2D11 A;  1ZPS A;  3V61 A;  2FCS A;  2JU6 X;  1D5X C;  2VZK D;  3IBE A;  2AYO B;  2FBW B;  2NCN A;  4RM8 A;  4E74 A;  4FHJ A;  4S17 A;  3NVV A;  4KKJ A;  3GZN I;  2WQY B;  2IZV B;  1X1M A;  2CJN A;  2K6D B;  1GC7 A;  2BKR B;  1VD2 A;  3AE9 B;  2K39 A;  2ZW1 A;  4B6W A;  3DVN U;  2M19 A;  1DGJ A;  1XLO A;  4XZ4 A;  3WIM A;  2N4F A;  3DDC B;  4GU2 A;  2JQR B;  1BT0 A;  1WIA A;  5C3J B;  3TUO A;  4I6P A;  5BO4 B;  3RT3 B;  1F77 A;  3DWG C;  1R4N B;  1RFA A;  1JWB D;  2RR9 A;  1F9J A;  2R2Q A;  4G3X B;  2CR5 A;  1I4H A;  4ARC A;  1IGD A;  2DX5 B;  4IUM B;  4MAC A;  2EMT A;  3AU5 A;  4C00 A;  1WY8 A;  4LDT D;  3MJ5 A;  3RFZ B;  3NHE B;  3P63 A;  4LNF A;  2PKO A;  3W2D A;  2LXA A;  1C1Y B;  3A9J B;  4K7W A;  2INN E;  2KMM A;  2KJR A;  4MSQ B;  2INP E;  1WH3 A;  3AEC B;  2LVQ A;  3RD2 A;  1UUP A;  5G5G A;  2KFK A;  4CO7 A;  3R8B A;  3ZIM A;  3W5V B;  3U52 E;  3RPF C;  3EGR A;  5L95 C;  2LFI A;  1K52 A;  1C4A A;  4RCO A;  3U8Z A;  4OZA A;  4DHZ E;  3U2S C;  2IY0 B;  3L08 A;  1WZ0 A;  4ZOH C;  2W54 A;  1ZE3 D;  5CHW A;  3Q3N C;  3VXW A;  4OVZ A;  3R3M A;  3NUH B;  3PPA A;  1HZ5 A;  1EWC A;  2KT7 A;  1C76 A;  4FA6 A;  2ICI A;  3VH3 B;  2JXT A;  4M02 A;  4HPL B;  3FIL A;  1GJZ A;  4C4V A;  3UIN B;  4G50 A;  3TBL D;  2FNJ B;  4EZJ A;  1OEY A;  4RF0 A;  2N0S B;  1S1Q B;  3OAW A;  5BYR A;  2CJO A;  3HRD D;  4DHZ B;  5BMI A;  3NVW A;  1SXT A;  1SE4 A;  5TR5 A;  3UQA A;  2LZ6 A;  2V4L A;  4ICV A;  2PE6 B;  4XYC A;  2L3Z A;  4L2Y A;  3ZRC A;  2GBN A;  2WDT B;  4M8M A;  2JF5 A;  1TS4 A;  2IDY A;  4MSM B;  1YNT E;  3BWU D;  1RAX A;  4IM2 A;  4EOY A;  4BFR A;  1V49 A;  3AUL A;  5TSS A;  1VZ7 A;  2WXR A;  3DBR I;  4YL8 A;  3UQB A;  2LRU A;  4TQ1 A;  3TL5 A;  1T5X D;  3RNA C;  3QIJ A;  1I4P A;  3NG0 A;  3AB5 A;  4AQ7 A;  3V6E B;  2N1V A;  2KKC A; 
#chains in the Genus database with same CATH homology
 2W55 A;  1NYR A;  1VJK A;  1RYJ A;  1YMH E;  1TS5 A;  4O1N A;  4NZL B;  2MJD A;  4M0W A;  1L0Y B;  2KAC A;  5D7G A;  4KGT A;  1J7A A;  4FXC A;  4LLG M;  1ZDV A;  1ET6 A;  2FUG 1;  5AUK A;  1C77 A;  3P1M A;  4HJG E;  4TSS A;  2KWD A;  4RF1 A;  1CJE A;  4DXG A;  5BYS A;  3BZD B;  4ARI A;  1MPE A;  1L4Z B;  2RPV A;  2BS3 B;  2W3R A;  1SEB D;  1ZOY B;  1L0X B;  2JWU A;  4RFB A;  4XWW A;  1I4Q A;  3SFE B;  1RWS A;  1YN4 A;  1PUT A;  3BII D;  4P16 A;  3MHZ A;  4ZRQ A;  1YQ3 B;  1QIL A;  3HVZ A;  3I57 A;  1QF6 A;  1VDV A;  2K22 A;  3Q69 A;  2IJ0 A;  5FK9 C;  3DWM A;  2MH7 A;  4H2A A;  1YQ4 B;  2W3S A;  4RNA A;  2QSD A;  1C9F A;  1A70 A;  1IBX B;  1OQQ A;  4A8X C;  1QOG A;  1C78 A;  1IBX A;  1XCT L;  1QQR A;  1HA5 A;  1I7H A;  3EA6 A;  3L4P A;  1EU4 A;  5G5H A;  2KQ4 X;  1B9R A;  1FXI A;  4C7Z A;  3P4Q B;  2V0G A;  1FCC C;  1T3Q A;  3GS2 A;  2SAK A;  2V3P A;  3I9V 1;  1C4C A;  2IGH A;  4OW0 A;  3FIL B;  2L1A A;  4XDD A;  1GOZ A;  5HFY A;  3NRZ A;  3BK1 A;  3IAS 1;  2HDE A;  3SFD B;  2J53 A;  4MT5 A;  2N9L A;  2KDM A;  1E10 A;  2BB5 A;  5T8I A;  3KWV A;  5C2T B;  2DBY A;  2PIA A;  2V3N A;  4RGM A;  3PZ8 A;  1E0Z A;  1GPX A;  5FKA C;  3AV8 A;  4IDI A;  1TKY A;  4A6Q A;  2FE8 A;  1JW9 D;  1BXT A;  2I38 A;  2BS4 B;  4Q2J A;  2OED A;  3VRB B;  1FO4 A;  3P4P B;  1CQV A;  3ETR A;  1YJJ A;  5D3I B;  1FNV A;  5AUI A;  3FC4 A;  4NAW B;  3HUI A;  2L52 A;  2PLP A;  2WXL A;  2DWQ A;  4KGR A;  4NJC A;  2QJL A;  1ZXI A;  1DOI A;  4XWT A;  1SBB B;  2JYT A;  3MP9 A;  5HG2 A;  1FRD A;  1FNW A;  3BK2 A;  1XO3 A;  3KWL A;  1K50 A;  1XLQ A;  2WLB A;  1TKG A;  4C56 C;  1FCL A;  1MI0 A;  2EEL A;  4US9 A;  1UGJ A;  1P7F A;  2WS3 B;  3N9Y C;  1GAQ B;  1YN3 A;  3Q8E A;  1FRR A;  3VQI A;  4HKZ E;  4YT0 B;  2QEJ C;  1F0Z A;  2WXI A;  3P4R B;  1ET9 A;  1HZ6 A;  5HHD G;  1TJE A;  2WXO A;  1XXG A;  3AMZ A;  2WXF A;  1N63 A;  4GDL B;  4REZ A;  2GRI A;  5EE1 A;  1KTK A;  1ESF A;  3IXS A;  3E56 A;  2H88 B;  2WXJ A;  2BB6 A;  3U4E G;  1WRI A;  1KF6 B;  1TY0 A;  2RDG A;  1JRP A;  1FFV A;  1FM0 D;  2WP9 B;  5D3D A;  3V05 A;  2MEK A;  4MM3 B;  3U7Z A;  1VRA B;  2DYM A;  1QLB B;  1N5X A;  3Q8A A;  3WCQ A;  1L6U A;  1WYG A;  2ONQ A;  2CU3 A;  5BMH A;  3TEY A;  2BYT A;  3W5U B;  3PO0 A;  2WDQ B;  2K0P A;  3AEA B;  4L23 A;  1GB1 A;  5H92 C;  2RMM A;  2WXH A;  5EE3 A;  3E9S A;  1L0V B;  1V97 A;  3AH7 A;  3VR9 B;  1STE A;  2Y3A A;  2QIE B;  3R2T A;  1QKZ A;  5E6J A;  2HTM E;  1J7B A;  2AQ3 B;  1VZ8 A;  2J42 A;  2WU5 B;  3Q8C A;  1ZP0 B;  2JX5 A;  4MH8 A;  5JXV A;  3ZQ4 A;  1K53 A;  2IGD A;  2BT6 A;  1BML C;  3Q8F A;  1TS3 A;  3W1S A;  4A55 A;  1WWT A;  1V8C A;  2K3U A;  3VRA B;  5MPO A;  2PVO D;  3AM9 A;  2WXP A;  4J3O D;  4P6V F;  1VR9 A;  1KFY B;  3ABV B;  4ITK A;  1PFD A;  1E6E B;  3IAM 1;  3B2F A;  3LYY A;  4R3D A;  2BBC A;  4GLS C;  3R2I A;  2VZK B;  2ZW0 A;  2XN9 C;  2YEP F;  3BVM A;  1NI3 A;  4UDU C;  1AW7 A;  1JWA D;  3CWI A;  2G1E A;  1SIJ A;  4TMA B;  4ZYS A;  2WNM A;  1HEZ E;  1HQR D;  4A9A A;  1VLB A;  2E6X A;  1F2R C;  3TEX A;  1L6V A;  2ON8 A;  3T3O A;  1NEK B;  2H89 B;  2D5G A;  1XLN A;  3CIR B;  1N5W A;  3IT6 B;  3KQ4 A;  2DLB A;  5EE0 A;  2BW2 A;  3AE8 B;  3B2G A;  3NZ3 A;  2N7J A;  1MHH E;  1PGB A;  1Q10 A;  1QT9 A;  3P4S B;  4C7Y A;  2EKI A;  4TQ0 A;  1NEN B;  3TEZ A;  2LEK A;  1AYF A;  5H8Y E;  2WXK A;  4KKI A;  1FEH A;  1R7S A;  1ZPS A;  2PVG C;  3H8H A;  2WDR B;  1TY2 A;  2WXN A;  2JU6 X;  1D5X C;  2VZK D;  1YJI A;  3UI3 A;  4CQN A;  2X38 A;  2FBW B;  3NVZ A;  1HXY D;  1KRH A;  5BMG A;  1JWU D;  3ZJU A;  2Y5C A;  3TEW A;  3GP7 A;  2PMV A;  3NVV A;  3SR6 A;  4YSZ B;  2KAJ A;  4KKJ A;  4ZRP A;  2WQY B;  2NMQ A;  2CJN A;  4HKQ A;  3W9C B;  2NTS A;  3AEF B;  4LTU A;  2DYO A;  2JYE A;  5I4D A;  3AE9 B;  1JML A;  1C79 A;  2ZW1 A;  3AEG B;  1JAL A;  1L4D B;  2M19 A;  3NS1 A;  1KH0 A;  1DGJ A;  1XLO A;  2WXM A;  2J52 A;  2OHF A;  1MHX A;  4JE3 B;  2WXG A;  3BYT B;  2V4I B;  1T6B X;  2MJE A;  2R61 A;  2JQR B;  1UNS A;  2LHD A;  5C3J B;  3TUO A;  3AED B;  1F77 A;  5HI1 A;  3AE6 B;  3DWG C;  3PZ7 A;  4GDK B;  1ZUD 2;  1QOF A;  2JSV X;  4WIP A;  1FXA A;  1JWB D;  3AE4 B;  2N9K A;  1I4H A;  1RM6 C;  4ARC A;  4RGO S;  1OFF A;  4NAM A;  1IGD A;  1SJH D;  1TS2 A;  1JCK B;  3BVZ A;  4WWM A;  4MAC A;  1TYG B;  2W82 A;  1N60 A;  4JX1 C;  2SEB D;  1SJE D;  4LK0 M;  2M56 B;  1SB3 C;  3NVY A;  2BTE A;  3MJ5 A;  3RFZ B;  2IPK D;  2QMT A;  1PYW D;  2WU2 B;  1I4R A;  4YSX B;  3P63 A;  1TKE A;  2PKO A;  3C8Y A;  2L32 A;  3W2D A;  1B1Z A;  2TSS A;  1I4X A;  2Z8L A;  1PDX A;  1JRO A;  1VZ6 A;  2INN E;  2KMM A;  3AE3 B;  1D5Z C;  2J4X A;  2INP E;  3AEC B;  1ZXH A;  4YTM B;  1SF0 A;  4HRS A;  1UUP A;  3V3X A;  2G9H D;  5G5G A;  3AN1 A;  4WQM A;  4US8 A;  3J9C A;  1XLP A;  1NYQ A;  3R8B A;  1FFU A;  1XCQ L;  4YWG G;  3W5V B;  3U52 E;  3RPF C;  1UWX A;  2K5P A;  3AE5 B;  4HRO A;  2RDH A;  3EGR A;  2LFI A;  1FIQ A;  1K52 A;  2AX5 A;  1C4A A;  1XF5 L;  1D6E C;  3MC0 B;  4N59 A;  4RCO A;  1EWY C;  4OZA A;  1TZO A;  1AWD A;  3ZJT A;  2Q5W D;  1N62 A;  2QIL A;  3U2S C;  5LNK 1;  3B9J A;  1QOB A;  4RGT A;  4ZOH C;  2GB1 A;  2W54 A;  1ZE3 D;  1SE3 A;  4OVZ A;  3AEE B;  3NUH B;  2LUM A;  4A90 A;  4YSY B;  4OZB A;  1HZ5 A;  1DOY A;  1EWC A;  2PW9 A;  1C76 A;  1ZDX A;  2M0A A;  2YEP B;  4YTN B;  4B0M A;  1P7E A;  2LJI A;  4OZC A;  2ICI A;  4IOI E;  1MVK A;  1XEE A;  4RH6 A;  1RFK A;  1N61 A;  2JXT A;  3Q8B A;  4D2K A;  4RGN A;  4DXF A;  4EE2 A;  4WH4 A;  2K9X A;  4C80 A;  4B0E A;  3FAH A;  1L5P A;  2WDV B;  3FIL A;  2GI9 A;  4L1B A;  1ACC A;  3AEB B;  1SSN A;  4HEA 1;  3GB1 A;  1PGX A;  1I4G A;  1LO5 D;  3IT4 B;  2AQ1 B;  4PT5 A;  3ZYY X;  4RF0 A;  4XE0 A;  2LGI A;  2N0S B;  1DOX A;  5BYR A;  2AQ2 B;  2LHE A;  2CJO A;  3HRD D;  4YXD B;  5BMI A;  4KX6 B;  5BYQ A;  1PGA A;  3NVW A;  1SXT A;  1SE4 A;  1E9M A;  1E7P B;  1AN8 A;  1M4V A;  2XNA C;  3HVD A;  2L83 A;  1ENF A;  4JWU C;  1EU3 A;  1FNU A;  1DYQ A;  2PTL A;  3OWE B;  3T3N A;  1WGK A;  4USA A;  2IGG A;  2JZP A;  4L2Y A;  1IUE A;  4N58 A;  3SEB A;  1D4B A;  2LMC A;  2MJ3 A;  2NTT A;  1TS4 A;  3URY A;  2IDY A;  3KLS X;  1KLG D;  4YTP B;  3AE1 B;  1JWM D;  1IGC A;  3P42 A;  4ZHP A;  2ACZ B;  1F2R I;  1Y56 A;  1QOA A;  1YNT E;  3BYY B;  1JQ4 A;  2Y5P A;  3BWU D;  4AS1 A;  1V1P B;  1CZP A;  1NVI D;  3VR8 B;  1V1P A;  1YN5 A;  3AE2 B;  4OHJ A;  3LB8 C;  4ZHO A;  5TSS A;  3O13 A;  1JWS D;  1VZ7 A;  2WXR A;  2B76 B;  3EUB 2;  4IKG A;  1CK1 A;  4WUR A;  3ZJV A;  4JWS C;  3AE7 B;  4N6E B;  2KN4 A;  4XDC A;  1FMA D;  4TQ1 A;  4JPS A;  2E3T A;  1OQR A;  1V1O A;  5EE9 A;  1T5X D;  1ROE A;  2WXQ A;  2BS2 B;  1SE2 A;  1K51 A;  3ZGZ A;  3BVG A;  4WAF A;  1KLU D;  2I2Y A;  1GB4 A;  1I4P A;  1J7C A;  1WXQ A;  1EM7 A;  1WSP A;  3LXF A;  3MFG A;  4KGS A;  5GXG B;  5FR3 A;  1UWM A;  3AB5 A;  3TSS A;  1D5M C;  4DQO C;  1C4P A;  4AQ7 A;  1BUI C;  1FD6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...