1QOFA

Ferredoxin mutation q70k
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQSDQSFLDDDKIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qofA00
1VDVA 1FXIA 2K22A 1NVID 4YTPB 1TJEA 3ZYYX 1T3QA 2M56B 2N0SB 4YT0B 1FFVA 2Y5CA 1N5WA 1V8CA 1IUEA 1TKEA 1WWTA 1QLBB 3HVZA 4N6EB 1FM0D 2WU2B 2K5PA 3AV8A 1E6EB 4KX6B 2Q5WD 1QOFA 3NVZA 3HUIA 4YTNB 3VR8B 2AX5A 1NYQA 1L6VA 1FRDA 2HTME 1E7PB 1UWMA 1TKGA 2ACZB 2FBWB 3AE8B 3AE7B 3CWIA 3KWLA 5AUKA 1JW9D 2H89B 2M19A 3NVWA 4LTUA 1FMAD 4C7ZA 1KFYB 1J7BA 4USAA 1XO3A 1NYRA 3P4QB 1RFKA 5EE0A 1EWYC 4US8A 4FXCA 2KMMA 3AN1A 1L6UA 5H92C 3NRZA 5C3JB 1ZOYB 1NENB 5H8YE 4HROA 4HRSA 3P4PB 1QOGA 1OQRA 1FIQA 1E0ZA 1N62A 2MJ3A 2BS4B 1DGJA 1N63A 1JRPA 2E3TA 2W54A 4ZHOA 2PIAA 1YQ4B 4YTMB 2W3SA 3LB8C 2CJNA 3NS1A 5C2TB 4N59A 3ABVB 3AE4B 2BT6A 1ZP0B 1JROA 3AECB 2JX5A 4JWSC 3AE6B 1YQ3B 1FXAA 2DBYA 4ZHPA 1FRRA 2DWQA 1RYJA 1E9MA 1A70A 1SF0A 1QF6A 5GXGB 2B76B 4WQMA 3AE2B 1OFFA 2QIEB 1CZPA 1JWAD 2WDVB 1VJKA 3HRDD 3AE5B 1DOXA 4A9AA 1AWDA 3ETRA 4YSZB 1XLQA 1ZUD2 1TYGB 2CJOA 3L4PA 3SFDB 4P6VF 3RPFC 1OQQA 3SR6A 3AB5A 3P4SB 1F0ZA 1WYGA 2MJEA 3W9CB 3CIRB 4C80A 1DOIA 2WP9B 3NVYA 4ITKA 1PFDA 1PUTA 4US9A 2L83A 3FAHA 3EUB2 1N5XA 2WS3B 3W5UB 5MPOA 2KAJA 2BS2B 1NEKB 1CJEA 1I7HA 3AEDB 3NVVA 1WXQA 5EE3A 2K9XA 1R7SA 3W5VB 2L52A 3AM9A 1ROEA 2JQRB 3AEGB 2WU5B 3AEAB 2WQYB 1J7AA 1QOBA 1V97A 3B9JA 1QT9A 1SB3C 1E10A 3FC4A 1RWSA 2W3RA 1VLBA 2WLBA 3AH7A 1RM6C 2PVGC 1PDXA 3PO0A 3DWGC 1QOAA 1GAQB 5EE9A 4YSYB 4IDIA 1AYFA 5G5HA 3DWMA 3VRBB 2PKOA 3AE1B 3LXFA 5EE1A 1FO4A 1L5PA 1XLOA 4WWMA 4C7YA 4YXDB 2MJDA 3B2GA 1N60A 1JALA 1YJJA 4JX1C 4JWUC 4ZOHC 1J7CA 2OHFA 2EKIA 3VRAB 2PVOD 1SIJA 3B2FA 1DOYA 1KF6B 2W55A 3AE3B 2CU3A 2H88B 1B9RA 1WGKA 3P63A 2LEKA 3SFEB 2G1EA 3AMZA 3P1MA 1ZXIA 5AUIA 4N58A 2WDQB 2BS3B 1FFUA 2WDRB 3VR9B 3AEEB 1XLPA 1WRIA 1JWBD 3AEFB 1NI3A 2QJLA 1GPXA 1N61A 1L0VB 1JQ4A 1TKYA 3AE9B 1KRHA 1YJIA 3WCQA 3P4RB 1XLNA 2MH7A 3BIID 4YSXB 3AEBB 5G5GA
chains in the Genus database with same CATH superfamily
2K22A 1EWCA 1G6JA 1HXYD 3IXSA 1FM0D 3X0WA 4ZYSA 3VXWA 4WWNA 1QOFA 3PSEB 4BOZB 4XWTA 2HTME 1KM7A 3DVGX 1WR1A 2XBBC 3H8HA 2J0KA 1XO3A 2WXRA 5JHAA 2L1AA 4W9EA 5CHWA 1ZOYB 4K7SA 3URYA 1TTNA 3U7DA 1WXMA 2D10A 2MJ3A 2BS4B 1SIFA 2O6VA 3RULA 4ZHOA 4WURA 1WM3A 2IO3B 1HZ6A 2LASA 1VD2A 1F52A 4GMVA 2I2YA 2QILA 1FNWA 4HDQA 1WRDB 1A70A 2A4ZA 2OEDA 2KX0A 2KWCA 3AULA 4MH0E 3QHTA 1EF1A 1TYGB 1ET6A 4AS1A 1IP9A 4KZCA 3UIOB 4KSKC 1FCCC 2KOXA 2KAJA 2WXMA 1WX9A 3DPDA 3PZ7A 3RFZB 4P1BC 5J17A 1F77A 1H4RA 4PK1A 3PO0A 2BBCA 2WXQA 4IDIA 3PRMB 1HA5A 4MEMA 1XLOA 2MJDA 1SJHD 3PT2B 3KVFB 2LD9A 3V05A 3VRAB 4M8MA 4MM3B 4WJQA 2W55A 4XDDA 2RDHA 2KYWA 1ZXIA 1S3SG 3JSVA 4WIPA 1L0VB 1ZDVA 3P4RB 2KFKB 2R2OA 3PGEA 2PEAA 1WGYA 4ZRPA 2KANA 3ZYYX 2PMVA 1JWUD 2XK5B 1NI2A 1L6VA 5HG2A 4WH4A 2L8JA 2QC8A 2WGSA 1V6EA 2LUEA 4FADA 5H8YE 4ANVA 1JCKB 5C1ZA 3Q3NC 4IWOA 3EC8A 3VVWB 2LUMA 4YTMB 1V5OA 2BF8B 2NMQA 1GC7A 3RT3B 2Z59B 2IYDB 4KGTA 4PYUA 5GXGB 4HPMB 1V86A 1R4NB 1AN8A 2KMCA 5CHFA 1XF5L 2BB6A 1ZKHA 2MBHA 3SR6A 2MBOA 1XQQA 1CK1A 2MRPA 2WP9B 2BWFA 1PUTA 1TZ1A 1J0GA 2C5LC 2SAKA 1K53A 4GB9A 1CJEA 2L0FA 3TCAA 2KX3A 2JXTA 1GC6A 1QOBA 2JZ3B 4RGMA 2W3RA 2FCQA 2AQ3B 1PDXA 3VFKA 4BKSA 2LFIA 2INPE 2ZJDA 2M17A 2V0GA 1WGDA 1TY2A 2ON8A 2OJRA 2VH1A 2KDIA 3AMZA 4TV3A 2RGFA 4KDIC 2QMTA 3H6NA 1SEBD 3TBLD 1K8RB 3P42A 4O1NA 3UF8A 1PQSA 1C4PA 1NVID 1TJEA 3FKYA 4IM0A 4FJYA 1R4NI 1UWMA 2FCSA 4XWWA 2AEHA 3RUIB 2H89B 2Z0EB 4TQ1A 1Q10A 3M63B 3BYTB 4IC7B 2DZMA 3TMPB 1C78A 2KMMA 4XYCA 1L6UA 4FBJB 4YL8A 1UH6A 4HRSA 4ARIA 1WSPA 4F7ZA 3AU4A 1WM2A 4HVBA 2W54A 4ICVA 2JU6X 1Q0WB 3RNFC 3LB8C 4C4VA 3AE4B 3VUYA 1YQ3B 1ESFA 4PS7A 4W9KA 1ZUD2 5J18A 1F2RI 3J9CA 2G9HD 3AEDB 4FJZA 2WXIA 2KFJA 1X1MA 4WJOA 1E10A 5BO4B 1YX5B 3NJTA 4UDUC 2VH2A 2X8XX 2LVOA 3VRBB 2L3ZA 1FO4A 4C7YA 1N60A 4JWUC 3Q8FA 2DNFA 2N9LA 3KUDB 2GBJA 2WX1A 3SFEB 4W9FA 4A90A 4HXDA 4AJYB 5L95C 1NI3A 2IGDA 3OWEB 1LO5D 2NPTA 3Q3JA 1TS4A 4REZA 2GBNA 2REXA 2HE7A 3A1QA 1N5WA 1QLBB 3TJPA 3R66C 4BVUC 3HK0A 1Y56A 2KDEB 3CWIA 3PTFC 2M19A 3I57A 3IHPC 1HTQA 3R7QA 4ZYNA 3ZLZA 3AN1A 2L00B 2V4LA 2NTSA 4A3OA 2V3SA 3A33B 1H8CA 1QOGA 2BB5A 4OZBA 1C76A 1XXGA 1DGJA 3VTUA 4LDTD 3BY4B 2FUHB 1UGJA 2G3QB 3EFUA 1FXAA 3CF6E 4HCNB 3Q8EA 1JWSD 4A55A 2W9NA 4LNKA 1L4ZB 1EU4A 3ML8A 4N9F4 3HRDD 3PREA 2GMIC 3RPFC 2MJEA 2ZEQA 4W9LA 1N5XA 2KXJA 2BS2B 1NEKB 3NG0A 2VZKD 1WXQA 1HZ5A 1D5XC 2JY6A 2J52A 3A4SC 1F9JA 3DHHC 2Z0DB 4JL9A 3PV1A 4ZRQA 4NJ6A 3TEWA 3MP9A 3JW0X 2D3CA 1E5WA 3H1UA 4ZOHC 2PPHA 1KF6B 2CU3A 3L54A 2K8HA 1LXDA 2KD0A 1V1OA 4MGIE 1T0QC 1WRIA 4AJWA 3ZQ4A 2DYMA 2MBBB 3N20C 3ONSA 4OHJA 4KX6B 1FXIA 1ZDXA 3ZXVA 1WMHB 1IUEA 5AZGA 2RPQA 4R3DA 3APDA 1E6EB 1UELA 4WQOB 1GB4A 3PHXB 3Q14C 1F2RC 4F8CB 1VZ7A 1V1PA 4L23A 2LXCA 4M01A 1KLVA 5EE0A 2WWZA 1P3QU 1YD8U 2R2QA 2MX2A 2D3BA 4NAWA 1WGHA 3BVZA 3QA8A 4ASWC 1AARA 1JRPA 2GI9A 1GNUA 3H7SA 5C2TB 3QWZB 1JROA 4XE0A 3GE3C 5FR3A 1EF5A 2NR2A 1STEA 2V3NA 4FHJA 4M00A 2E6XA 4RM8A 3KH0A 4GDLA 1IPGA 3ML9A 3KLSX 1F0ZA 1C1YB 5BYRA 3AU5A 1D3ZA 2IDYA 4G11A 4DXAB 2KC1A 1B1ZA 3NVVA 2KQSA 4MACA 1ROEA 3QK0A 3R2IA 2WU5B 3AEAB 3OG5A 4NQKE 1LM8B 4GDKB 1RM6C 2JYEA 2PVGC 2V3PA 1MI0A 1RFAA 2J0MA 3GE8C 4KDLB 1AW7A 2K8CA 4WWMA 3ZTCA 4W9CA 3ZO5B 4KKJA 1UWXA 1UZXB 2IPKD 2IBIB 3A9KB 3UINB 2WDQB 4GN1A 2AYOB 4HPLB 1JWBD 1V5TA 2FAZA 1JQ4A 1EO6A 4LTUA 4YTPB 2KTFA 2M56B 4W9IA 3B08A 2MBEA 2LHEA 4BBNF 2WU2B 2K5PA 4RNAA 4L2YA 2O2VA 3NZ3A 2FE8A 1WX7A 2MP2B 1FMAD 5IKCM 4C7ZA 4USAA 3O65B 4B9KA 4MDKE 4PT5A 4EFOA 1JRUA 3UQAA 5C3JB 1XD3B 2XK5A 3L17A 1SXTA 4FJVB 3LYYA 2JT4B 2JPHA 4RF0A 3RZWC 2N7JA 2RDGA 4IKGA 4M0WB 2DYOA 2ZVNA 4MT5A 4E74A 3N3KB 3QAQA 2W3SA 5IO9A 1VCBA 4EKUA 3BVGA 3ZRFA 3DBHB 4QAYA 4LLGM 2WX0A 4WQMA 1OGWA 1E90A 2WXNA 1VR9A 5L83A 2C7HA 3ZKJC 5DPTA 5KHOA 3AB5A 4WJNA 3FILA 2INCC 1DOIA 2JSVX 5J2RA 1EU3A 4US9A 4RCOA 3V3XA 1FPYA 2LVPA 3ZNID 4GU2A 5CTRC 4RM9A 4HJGE 2ZCBA 5HKHA 1FXTB 1V2YA 4TMAB 3KYCD 5G5HA 3AE1B 4IW0A 1YX6B 4W9GA 1TZOA 2BW2A 2KWVB 1TBEA 3CSFA 3WALA 3N32A 2VRRB 1Y8RC 3T8MA 3RD2A 3N1ZC 2H88B 2IZVB 2JVCA 2LHDA 2K1FA 2KJHB 4URKA 3I3TB 4GIVA 3M95A 1JMLA 1N61A 1KRHA 1YJIA 1I4XA 2BYFA 4WAAA 2GRIA 4FHKA 3DBSA 3GB1A 1UUPA 3DBHI 4P1CC 2LJ5A 1IBXB 2ACZB 3AE8B 4LNNA 1WR6E 4ARCA 3RCZA 4ANUA 1D5MC 4EZLA 3RNGC 3PLVA 4OZCA 2KTRA 1VRAB 1FIQA 2NBUA 4DHJD 1R4MB 3M3JA 4W9JA 1MVKA 2GBMA 4DDGD 4MGYE 2FNJB 3JVZX 3KYDD 4XDCA 3C8YA 2XEWA 3IG3A 3AE2B 1GOZA 3VUWA 2LI5A 2N1VA 3Q8AA 1AWDA 1V9JA 1WY8A 4YSZB 1XLQA 3TL5A 3SFDB 3T3NA 1ZE3D 3WAMA 5AZHA 4ACFA 4K7WA 4NNJB 2DYBA 2WS3B 4BBNC 2JUOA 4W9DA 2CS4A 3B9JA 5D6JB 1SB3C 2ZNVC 1I4HA 5LLIA 3NUHB 2KLGA 4J6IA 4JPSA 4G0NB 3W1SA 1L0XB 3SDLC 2AQ2B 1IGDA 2LZ6A 3EGRA 1WJUA 1B9RA 1RAXA 1XCQL 4ZDVA 2KN5A 1R4MI 1XLPA 4KSLC 3IVFA 1BUIC 1WXVA 4MELA 1S1QB 2N4FA 3AE9B 4ZRKA 3ECIA 3BYYB 4DK5A 5G5GA 3O13A 2GLSA 1P7EA 1HEZE 2NS5A 2J7QB 2D3AA 2K6QA 1T0SC 1GG3A 1YMHE 2V4IB 3R3MA 4LDTB 3MHSD 4OW0A 5AUKA 2L76A 2DAFA 3V61A 2CHXA 2J53A 4X57B 2HD5B 2INNE 2RDBC 2LRUA 5BMHA 1K50A 3RNBC 3DHIC 2FCNA 4CQNA 4DHZB 2E3TA 4NY0A 5E6PA 1NDDA 1XEEA 2KC2A 2BT6A 4NAMA 2VZKB 4JQWC 3EECA 1OFFA 2WXOA 2QIEB 1P9DU 2J42A 2KACA 4K81A 1RRBA 1JWAD 3TEZA 2JWUA 1KOTA 2CJOA 3JSVB 2MA9B 1WI0A 5BMIA 4C80A 5TR5A 2KDMA 2EMSA 3QQ8B 3V6EB 3IT4B 5MPOA 5E6OA 3NHEB 3PVLA 1ZXHA 1E8XA 1R7SA 2L52A 2AL3A 3H9DA 2JQRB 2KWDA 3OLMD 4KVGB 1HE8A 5D2MB 1C4AA 2OJWA 2LJIA 1WGGA 2PJHA 2KQ4X 1JALA 1E7VA 1MHXA 2GOWA 3DQVA 1WE7A 2LVQA 5IP4D 4B0EA 2KZRA 2G1EA 1J8CA 5IOIA 3TUOA 3MFGA 4HK2A 3T3OA 2WDRB 3SHQA 3IBEA 3DHGC 2WXPA 1Q5WB 1YN3A 4YSXB 2V9HA 3VH3B 1FNVA 1CQVA 4ZHPA 3ZNZB 4H2AA 4CHKA 4LNIA 1GUAB 2DZJA 4GGQA 2UU7A 1WYWB 2BYTA 2AX5A 4M02A 3VTWA 4OZAA 1E7UA 4J3OD 4MGZE 1WMHA 5E6JA 1C4CA 1FD6A 2M8SA 5EDSA 2LGIA 4BKGA 2MBQA 1OQRA 2C9WB 1LGRA 2L05A 3VHTC 5JHBA 3TEYA 3HVDA 2AQ1B 1KLGD 2DBYA 2L32A 3VUXA 2O6VD 2FUG1 2WXGA 3MJ5A 3NS8A 4II3B 3OJ3A 1YQBA 4IWPA 4BAXA 4A9AA 5CX3A 3DBRB 2QHOA 2INDC 4KGSA 4ITKA 3TSSA 4JIOU 2FIFA 2BYEA 4XZ4A 4DWFA 3WIMA 3NZSA 2IO1B 4WWOA 1MG4A 5G2NA 2KHWB 1OTRB 2YEPB 4LCDE 3U30A 2D2QA 4MSMB 2OHFA 1Z2MA 2EKIA 3NZUA 4GDKA 2NTTA 1SE4A 2DZIA 2NCNA 1WXAA 3VH4B 5AUIA 1SE2A 2KT7A 2WXJA 4RGTA 4HPPA 1VDVA 4ANXA 3A9KA 3ZNGC 3EHVA 1TKEA 5JZEB 4B6WA 1FRDA 1YIWA 1JW9D 3NVWA 2EELA 4EOYA 1BT0A 3B0AA 1KFYB 5FR6A 4A3PA 1JWMD 3DBRI 1ET9A 3DDCB 2K6DB 3N9YC 3KQ4A 2HJ1A 4HROA 1IYFA 3KUZA 4II2B 1XCTL 2MP2A 4IWQA 3I9V1 1M4VA 2KKCA 2BGFA 4PS8A 4RGOS 3ABVB 3ZVVA 1ZP0B 3I5JC 2C7NB 3OJ4B 4IUMB 3ZJTA 1T0RC 2CKHB 1RYJA 3U2SC 2B76B 3PZ8A 4M0WA 1WXSA 4DBGA 3L13A 3APCA 1FEHA 1PGAA 4EEWA 3L16A 4ZRIA 4HKQA 1OQQA 3HIZA 2D3GA 2MHJA 3X23A 3PS6A 2ZW0A 1RLFA 1I7HA 1ZW7A 3A1QB 1YOVB 1MFWA 2K9XA 2J4XA 4E3CA 1HTOA 1YN4A 2ASQA 2ONQA 3VTVA 3S2AA 4K3CA 1RWSA 3H7PB 2BYVE 4TUUA 4LK0M 1WGRA 2KQ7A 5KHQA 2DAJA 4AQ7A 4XC2A 3R8BA 3ZW3A 1J7CA 2PVOD 3PRPB 2LGSA 2MW5A 3RNEC 1DOYA 3TEXA 4BKSD 1C79A 1WGKA 3QCAA 3IFWB 1EUVB 5D3IB 2BS3B 1GPXA 3WCQA 1Q1OA 4RF1A 1T3QA 2Y5CA 1WWTA 3ZXRA 4DHJB 4A20A 3KWVA 1CMXB 2Q5WD 2BQQA 1E7PB 3MHZA 5BYSA 4OVZA 3RYTA 3UQBA 2L7RA 1J7BA 1M94A 3P4QB 1EWYC 3W1SC 5D7GA 2DHZA 1GB1A 3NRZA 1K52A 4CO7A 3A9JB 4MM3A 1L4DB 5DCNA 3ENEA 2K8BA 3AI5A 1MJDA 4MJSB 1YQ4B 4DQOC 2XNAC 2L0TA 2WXHA 2KFKA 1E9MA 4M8NA 2BVCA 4DHZE 2C7MB 2IJ0A 3AE5B 2N9PC 1ZGUB 2XN9C 3Q3MC 4NJ7A 1V49A 4FLHA 4BOSC 1WYGA 4K3BA 4TSSA 3QC8B 3NVYA 4HJKA 2L83A 3FAHA 3W5UB 2NBWB 3ZJUA 2LRWA 2G45B 1V97A 2FCMA 3HM6X 3RMKC 1QT9A 5I4DA 2KK8A 3BVMA 4MGKE 5EE9A 1SSNA 1ENFA 2LGDA 4BZAA 1V1PB 3DVGY 2X38A 3LXFA 5EE1A 4RH6A 2Y3AA 3NY5A 4WJPA 4NAWB 4FA6A 1FCLA 1P7FA 5DPWA 3P63A 4NZLB 2MEKA 2TSSA 4KZ0A 1VZ6A 2MWSB 3PHWB 4HWIB 3P4PB 3BK2A 5BYQA 3Q2AC 2MCNB 1QZEA 2WYQA 2YVCA 2M4NA 3VR8B 4AP4C 1NYQA 1WJNA 1J19A 2KLCA 3I63C 5JH5C 4GDLB 3P2BA 1UNSA 4G50A 4US8A 1RFKA 2RPVA 2K0PA 4PYZA 3RNCC 1C3TA 3GS2A 4ICUA 4KKIA 1N6ZA 2JXXA 4JLCA 1E0ZA 1KLUD 4S17A 4S0RA 2PIAA 2J0JA 1BMLC 1V81A 4LJOB 1WE6A 1IGCA 3ZDMC 2C60A 2FIDA 2Y5PA 3GOEA 1E8YA 2QCZA 2CU1A 3GP7A 2UYZB 4KIKB 1SE9A 3L4PA 3WA0A 2ZPYA 2ICIA 5EE3A 1OEYA 1J7AA 2N9KA 1TS5A 2O2VB 5HI1A 1MPEA 1SJED 4TKNA 2GBRA 3AH7A 2JRIB 2JZPA 1FNUA 3DWMA 2PKOA 3QJZA 3E56A 2IGGA 4JX1C 4F1SA 2CHWA 4PS3A 2GBKA 3IT6B 3AE3B 1WX8A 2KJ6A 4Q2JA 2D5GA 3VDZA 3SEBA 1DYQA 1MHHE 4HKZE 4EZKA 2KO3A 2Y5BB 2QEJC 4LJPB 3HVZA 3L08A 3DVNU 2IO0B 4YTNB 3ZRCA 5LXHA 3HUIA 1HQRD 2HJ8A 1OQYA 3U8ZA 3FILB 2BKRB 2O6VB 2I1JA 1NYRA 3ZUNA 1T6BX 4FXCA 3N30A 1KJTA 5C23A 3L0WB 2PTLA 1N62A 1QILA 3SD5A 3WAPA 1C77A 2JWZA 2OOBB 4JGHB 4B95A 1FRRA 3U52E 1I4GA 1QF6A 1SBBB 2DLBA 2MLBA 5D94A 4IOIE 3MTNB 1DOXA 2AL6A 1C9FA 5FKAC 1I4QA 3HHMA 2IGHA 5G55A 3W9CB 4DXGA 3CSTA 2KDFB 2RSUA 1WZ0A 3Q3FA 1UD7A 3U7ZA 1ISNA 3RI7C 4HCPB 2PE9A 3AM9A 3Q8BA 1TY0A 2IY0B 2BPSA 2AWTA 1QOAA 3L10B 2K3UA 1L5PA 4YXDB 4DDID 3B2FA 3ZGZA 2KTRB 3V60A 2I1KA 2ZZPB 5AZFA 3QIJA 5GMVA 3PLUA 3AEFB 2QJLA 1WJ6A 3UI3A 4DXFA 3QARA 1XLNA 2WNMA 3BIID 3CMMB 3MC8A 4IM3A 3ZIMA 2BWES 2N0SB 1FFVA 1V8CA 2NBVB 3R2TA 5IA7A 1PGXA 1QKZA 5FK9C 3AV8A 5IAAC 3NVZA 4A6QA 4NPNA 2DX5B 1TKGA 2RD0A 2DENB 5T8IA 1MG8A 1I35A 1YJ1A 5H92C 2JZZA 3C19A 3K9PB 1NENB 3GZNB 4C00A 3K9OB 4L1BA 1YNTE 4G3XB 4BKTA 2IO2B 2KWUB 5LXIB 2MQJA 3Q6BA 4N59A 3AECB 1E8ZA 2KVRA 4CYEA 1BXTA 4GXBA 3ZNHB 2DWQA 3IAS1 1EM7A 2M0AA 1K51A 2WHIA 3BWUD 2Z8LA 3P4SB 3DBLB 3C0RB 4D2KA 2BTEA 1PFDA 1L2NA 2SEBD 1I4RA 3ZDTA 1I4PA 2KDBA 3AEGB 1WZ3A 3FC4A 1D6EC 1VLBA 2MSED 3LJ3A 4IG7B 2D11A 1L7YA 4AWJA 4C56C 2CR5A 3B1LX 4YSYB 1KTKA 1V80A 3BZDB 1A5RA 3PRZA 2ZPNA 4I6LB 1LQBA 5DPSA 3APFA 5DPRA 1WH3A 3H7PA 3V62A 2B3AA 1XT9B 3GZNI 3QX1A 4E71A 2WXLA 1FFUA 3ALBA 3RN9C 2QSDA 1WF9A 3UIPB 1ZPSA 2HTHA 3W1YA 4ANWA 4FN2A 4HEA1 4XX5A 2WDTB 3D32A 3TIXA 3PZDA 4YT0B 2G4DB 3R7RA 2HDEA 4YWGG 2YLMA 2GB1A 5AEKB 3A4RA 4GSWA 3N1XC 2FBWB 3AE7B 3KWLA 4AUQC 4OVVA 1WFYA 3DBLI 4EUTA 3MJWA 5LNK1 4C4VB 4IM2A 2RR9A 3WAOA 2QDFA 4AOFA 2EMTA 1TS3A 3KUCB 3ZJVA 4NQLB 3NS1A 3MC9A 3PPAA 4EZJA 3SU8X 3V6CB 3A9JA 2JX5A 4JWSC 3AE6B 4WWPA 3RZFA 5HFYA 2KMAA 1P0RA 2N7EA 4MJSA 2NVUI 1GJZA 1OEYJ 1KH0A 2PLPA 4K7UA 2WDVB 1VJKA 2BKFA 3RNAC 2N7DA 4WAFA 1YN5A 1UBQA 5JXVA 4P6VF 2UWQA 2K25A 5TSSA 3CIRB 1Z5SB 3OAWA 3EUB2 1SGHA 1TT5B 3NOBA 4JE3B 3W5VB 4LNOA 3VAWA 2WQYB 3N1YC 2WLBA 3MC0B 4A8XC 3DVNV 3Q8CA 3DWGC 2YEPF 1GAQB 1P98A 1AYFA 1QQRA 1TGZB 4RFBA 3DCGA 2IY1B 2A5UA 4I6PA 4NJCA 3EFCA 1SIJA 2NPTB 2EKEC 3U4EG 1LFDA 2LEKA 2LMCA 3ZTDA 3P1MA 1D5ZC 4N58A 2D07B 1D4BA 1TIFA 1UGMA 5HHDG 3IAM1 2JF5A 1TKYA 2KN4A 2ZCCA 2LGXA 2MH7A 2JYTA 5CHVC 1E8WA 2I38A 5D3DA 2M1MA 3T9LA 1T0YA 3AXCA 4P16A 4K1RB 4N6EB 1ACCA 2DZKA 1VZ8A 2KNBA 3M62B 2N9EB 1NBFC 1T5XD 3E9SA 4GOCA 2ZNVB 1UBIA 3WANA 1P1AA 4EE2A 2M0XA 2N1WA 4W9HA 2PE6B 5IN7A 1U4AA 3BINA 3Q69A 3BK1A 4FULA 1WIAA 2G4SA 1N63A 2V1YA 1F1HA 2CJNA 3EA6A 4RMAA 5E6NA 2LXAA 2WXFA 1SF0A 4RGNA 4OVUA 1PGBA 3KW5B 1CZPA 4HLEA 1IBXA 4MSQB 3W2DA 3ETRA 3JYUA 4GLSC 4KGRA 4ZRJA 2K39A 2R61A 1L0YB 4P7IA 1PYWD 3UGBB 1SE3A 2PW9A 2N9XA 4BFRA 2LGYA 4KIKA 4KV2A 2ZW1A 3VQIA 3LDZE 1UF0A 5BMGA 2CHZA 4HDOA 3HM3A 4XGAB 2RMMA 2ZVOA 3B2GA 4TQ0A 1YJJA 4I6NB 4MH8A 1TS2A 4B0MA 2KJRA 2JRHA 3DOWA 2KVZA 2LWPA 1WJ4A 3AEEB 1I42A 2WXKA 2W82A 3Q3OC 4LNFA 3VR9B 3AEBB
chains in the Genus database with same CATH topology
2K22A 1FXIA 1FNVA 2QEJC 1ZDXA 1EWCA 1CQVA 4ZHPA 1HXYD 3IXSA 1IUEA 3HVZA 4H2AA 1FM0D 4ZYSA 4R3DA 1E6EB 4YTNB 1QOFA 3HUIA 1HQRD 2BYTA 2AX5A 1GB4A 4XWTA 2HTME 4OZAA 1F2RC 4J3OD 3H8HA 1VZ7A 3FILB 1V1PA 4L23A 5E6JA 1C4CA 1XO3A 1NYRA 5EE0A 2WXRA 1T6BX 4FXCA 2L1AA 1FD6A 1ZOYB 3BVZA 2LGIA 3URYA 1OQRA 2PTLA 1N62A 2MJ3A 2BS4B 1JRPA 4ZHOA 4WURA 2GI9A 1QILA 5C2TB 1HZ6A 1C77A 3TEYA 3HVDA 1JROA 4XE0A 2AQ1B 1KLGD 2DBYA 2L32A 2I2YA 2QILA 1FNWA 1FRRA 3U52E 5FR3A 1A70A 1I4GA 1QF6A 2OEDA 2FUG1 1SBBB 2DLBA 2WXGA 3MJ5A 1STEA 4IOIE 2V3NA 1DOXA 4A9AA 1C9FA 2E6XA 5FKAC 1TYGB 1I4QA 1ET6A 4AS1A 3KLSX 1F0ZA 2IGHA 4DXGA 3W9CB 4KGSA 5BYRA 4ITKA 3TSSA 1FCCC 2IDYA 2KAJA 2WXMA 3U7ZA 1B1ZA 3NVVA 3PZ7A 3RFZB 4MACA 3AM9A 1ROEA 3Q8BA 1F77A 3R2IA 2WU5B 3AEAB 1TY0A 4GDKB 1RM6C 2JYEA 2PVGC 2BBCA 2V3PA 1MI0A 2WXQA 3PO0A 1QOAA 4IDIA 1AW7A 2YEPB 1HA5A 2K3UA 1L5PA 1XLOA 4WWMA 4YXDB 2MJDA 1SJHD 4KKJA 2OHFA 3V05A 2EKIA 3VRAB 1UWXA 3B2FA 2NTTA 4MM3B 3ZGZA 2W55A 4XDDA 1SE4A 2IPKD 2RDHA 1ZXIA 1SE2A 5AUIA 2WDQB 4WIPA 1JWBD 3AEFB 2QJLA 2WXJA 1L0VB 1JQ4A 3UI3A 4DXFA 1ZDVA 3P4RB 4RGTA 1XLNA 2WNMA 3BIID 4LTUA 1VDVA 4YTPB 4ZRPA 3ZYYX 2M56B 2N0SB 1FFVA 1V8CA 2PMVA 3R2TA 1TKEA 1PGXA 1QKZA 5FK9C 2LHEA 2WU2B 2K5PA 3AV8A 4RNAA 4L2YA 3NVZA 1JWUD 4A6QA 3NZ3A 1L6VA 1FRDA 2FE8A 5HG2A 4WH4A 1TKGA 1JW9D 3NVWA 5T8IA 2EELA 1FMAD 4C7ZA 1KFYB 4USAA 1JWMD 4PT5A 1ET9A 5H92C 3N9YC 5C3JB 3KQ4A 1NENB 1SXTA 3LYYA 5H8YE 4HROA 4L1BA 1YNTE 4RF0A 1XCTL 1JCKB 2N7JA 2RDGA 4IKGA 3I9V1 2DYOA 2LUMA 4MT5A 1M4VA 4YTMB 2W3SA 2NMQA 4N59A 4RGOS 3ABVB 1ZP0B 3AECB 1BXTA 3ZJTA 4KGTA 2DWQA 1RYJA 3U2SC 3IAS1 3BVGA 5GXGB 2B76B 3PZ8A 4LLGM 1AN8A 1EM7A 2M0AA 4M0WA 1K51A 4WQMA 2WXNA 1VR9A 1FEHA 1XF5L 2BB6A 3BWUD 1PGAA 2Z8LA 4HKQA 1OQQA 3SR6A 3AB5A 3P4SB 3FILA 1DOIA 2JSVX 1CK1A 4D2KA 1EU3A 2WP9B 2BTEA 1PFDA 1PUTA 4US9A 2SEBD 2ZW0A 4RCOA 2SAKA 1I4RA 3V3XA 1I4PA 1K53A 1CJEA 1I7HA 2K9XA 2J4XA 3AEGB 1YN4A 2JXTA 1QOBA 2ONQA 4HJGE 3FC4A 1D6EC 1RWSA 1VLBA 2W3RA 4RGMA 2AQ3B 1PDXA 4LK0M 4TMAB 4C56C 4YSYB 1KTKA 3BZDB 2LFIA 5G5HA 2INPE 4AQ7A 3AE1B 3R8BA 1TZOA 2BW2A 1J7CA 2V0GA 1TY2A 2ON8A 2PVOD 1DOYA 3TEXA 1C79A 2H88B 1WGKA 2LHDA 3AMZA 2WXLA 5D3IB 2QMTA 2BS3B 1FFUA 1SEBD 3VR9B 1GPXA 1JMLA 2QSDA 1N61A 3WCQA 1KRHA 1YJIA 3P42A 1I4XA 1ZPSA 4O1NA 2GRIA 1C4PA 4HEA1 4RF1A 1NVID 1TJEA 1T3QA 4YT0B 2Y5CA 1WWTA 2HDEA 4YWGG 3GB1A 2GB1A 3KWVA 1UUPA 2Q5WD 1IBXB 1E7PB 3MHZA 5BYSA 1UWMA 4XWWA 2ACZB 2FBWB 3AE8B 3AE7B 3KWLA 4OVZA 2H89B 4ARCA 4TQ1A 1Q10A 3BYTB 1J7BA 1D5MC 3P4QB 1C78A 1EWYC 2KMMA 1L6UA 5D7GA 5LNK1 3NRZA 1GB1A 1K52A 4OZCA 1L4DB 4HRSA 4ARIA 1VRAB 1WSPA 1FIQA 1TS3A 2W54A 3ZJVA 1YQ4B 2JU6X 1MVKA 3LB8C 3NS1A 4DQOC 2XNAC 3AE4B 2WXHA 5HFYA 2JX5A 4JWSC 3AE6B 1YQ3B 4XDCA 1E9MA 3C8YA 3AE2B 1GOZA 1KH0A 2PLPA 1ESFA 2WDVB 1VJKA 3Q8AA 2IJ0A 3AE5B 1AWDA 2XN9C 4WAFA 4YSZB 1XLQA 1ZUD2 1YN5A 3SFDB 5JXVA 1F2RI 4P6VF 3T3NA 1ZE3D 1WYGA 5TSSA 3CIRB 4TSSA 3NVYA 2L83A 3FAHA 3EUB2 3W5UB 2WS3B 3J9CA 2G9HD 3ZJUA 4JE3B 3AEDB 2WXIA 3W5VB 2WQYB 1V97A 3B9JA 1QT9A 1SB3C 1E10A 5I4DA 1I4HA 2WLBA 3BVMA 3MC0B 4UDUC 4A8XC 3Q8CA 3DWGC 2YEPF 1GAQB 5EE9A 1SSNA 3NUHB 1ENFA 1AYFA 1QQRA 4RFBA 1V1PB 4JPSA 2X38A 3VRBB 3LXFA 5EE1A 4RH6A 1FO4A 4C7YA 2Y3AA 1N60A 3W1SA 1L0XB 4JWUC 4NJCA 3Q8FA 2AQ2B 1IGDA 3EGRA 2N9LA 1SIJA 4NAWB 1FCLA 1P7FA 3U4EG 1B9RA 3P63A 4NZLB 2LEKA 3SFEB 2LMCA 2MEKA 1XCQL 3P1MA 4A90A 2TSSA 1D5ZC 4N58A 1VZ6A 1XLPA 1D4BA 1NI3A 5HHDG 1BUIC 3IAM1 2IGDA 3OWEB 1TKYA 3AE9B 2KN4A 3P4PB 1LO5D 2JYTA 2MH7A 3BYYB 5G5GA 3BK2A 3O13A 5BYQA 1P7EA 1TS4A 4REZA 1HEZE 2I38A 5D3DA 1N5WA 1QLBB 4P16A 4N6EB 1YMHE 3VR8B 2V4IB 1NYQA 1ACCA 1Y56A 3CWIA 1VZ8A 4OW0A 5AUKA 4GDLB 2M19A 3I57A 1T5XD 1UNSA 3E9SA 4US8A 1RFKA 3AN1A 2RPVA 2J53A 2NTSA 4EE2A 2K0PA 2INNE 5BMHA 3GS2A 1K50A 4KKIA 1QOGA 2BB5A 3Q69A 3BK1A 4OZBA 4CQNA 1C76A 1XXGA 1E0ZA 1KLUD 1DGJA 1N63A 2E3TA 2PIAA 2CJNA 1XEEA 1BMLC 3EA6A 2BT6A 1UGJA 1FXAA 4NAMA 2VZKB 3Q8EA 1JWSD 2WXFA 4A55A 1IGCA 1SF0A 4RGNA 1L4ZB 1PGBA 2Y5PA 1OFFA 2WXOA 2QIEB 1CZPA 1EU4A 2J42A 2KACA 1JWAD 3HRDD 1IBXA 3TEZA 3GP7A 3W2DA 3ETRA 4GLSC 2JWUA 2CJOA 3L4PA 4KGRA 3RPFC 5BMIA 2MJEA 4C80A 2KDMA 2R61A 1L0YB 1PYWD 3IT4B 1N5XA 2ICIA 5MPOA 1SE3A 1NEKB 2BS2B 2PW9A 1ZXHA 2VZKD 1WXQA 5EE3A 1R7SA 1HZ5A 1D5XC 2L52A 2JQRB 2KWDA 2J52A 2ZW1A 3VQIA 1J7AA 2N9KA 1TS5A 5HI1A 5BMGA 1MPEA 1SJED 3AH7A 1C4AA 2RMMA 4ZRQA 3TEWA 2JZPA 1FNUA 3DWMA 2LJIA 2PKOA 3MP9A 3E56A 3B2GA 2IGGA 4TQ0A 2KQ4X 1JALA 1YJJA 4JX1C 4ZOHC 4MH8A 1MHXA 1TS2A 4B0MA 3IT6B 1KF6B 3AE3B 2CU3A 4B0EA 4Q2JA 2G1EA 3TUOA 1V1OA 3MFGA 2D5GA 3SEBA 1DYQA 3T3OA 2WDRB 1MHHE 3AEEB 1WRIA 4HKZE 2WXKA 2W82A 2DYMA 3ZQ4A 2WXPA 1YN3A 4OHJA 4KX6B 4YSXB 3AEBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDV A;  1FXI A;  2K22 A;  1NVI D;  4YTP B;  1TJE A;  3ZYY X;  1T3Q A;  2M56 B;  2N0S B;  4YT0 B;  1FFV A;  2Y5C A;  1N5W A;  1V8C A;  1IUE A;  1TKE A;  1WWT A;  1QLB B;  3HVZ A;  4N6E B;  1FM0 D;  2WU2 B;  2K5P A;  3AV8 A;  1E6E B;  4KX6 B;  2Q5W D;  1QOF A;  3NVZ A;  3HUI A;  4YTN B;  3VR8 B;  2AX5 A;  1NYQ A;  1L6V A;  1FRD A;  2HTM E;  1E7P B;  1UWM A;  1TKG A;  2ACZ B;  2FBW B;  3AE8 B;  3AE7 B;  3CWI A;  3KWL A;  5AUK A;  1JW9 D;  2H89 B;  2M19 A;  3NVW A;  4LTU A;  1FMA D;  4C7Z A;  1KFY B;  1J7B A;  4USA A;  1XO3 A;  1NYR A;  3P4Q B;  1RFK A;  5EE0 A;  1EWY C;  4US8 A;  4FXC A;  2KMM A;  3AN1 A;  1L6U A;  5H92 C;  3NRZ A;  5C3J B;  1ZOY B;  1NEN B;  5H8Y E;  4HRO A;  4HRS A;  3P4P B;  1QOG A;  1OQR A;  1FIQ A;  1E0Z A;  1N62 A;  2MJ3 A;  2BS4 B;  1DGJ A;  1N63 A;  1JRP A;  2E3T A;  2W54 A;  4ZHO A;  2PIA A;  1YQ4 B;  4YTM B;  2W3S A;  3LB8 C;  2CJN A;  3NS1 A;  5C2T B;  4N59 A;  3ABV B;  3AE4 B;  2BT6 A;  1ZP0 B;  1JRO A;  3AEC B;  2JX5 A;  4JWS C;  3AE6 B;  1YQ3 B;  1FXA A;  2DBY A;  4ZHP A;  1FRR A;  2DWQ A;  1RYJ A;  1E9M A;  1A70 A;  1SF0 A;  1QF6 A;  5GXG B;  2B76 B;  4WQM A;  3AE2 B;  1OFF A;  2QIE B;  1CZP A;  1JWA D;  2WDV B;  1VJK A;  3HRD D;  3AE5 B;  1DOX A;  4A9A A;  1AWD A;  3ETR A;  4YSZ B;  1XLQ A;  1ZUD 2;  1TYG B;  2CJO A;  3L4P A;  3SFD B;  4P6V F;  3RPF C;  1OQQ A;  3SR6 A;  3AB5 A;  3P4S B;  1F0Z A;  1WYG A;  2MJE A;  3W9C B;  3CIR B;  4C80 A;  1DOI A;  2WP9 B;  3NVY A;  4ITK A;  1PFD A;  1PUT A;  4US9 A;  2L83 A;  3FAH A;  3EUB 2;  1N5X A;  2WS3 B;  3W5U B;  5MPO A;  2KAJ A;  2BS2 B;  1NEK B;  1CJE A;  1I7H A;  3AED B;  3NVV A;  1WXQ A;  5EE3 A;  2K9X A;  1R7S A;  3W5V B;  2L52 A;  3AM9 A;  1ROE A;  2JQR B;  3AEG B;  2WU5 B;  3AEA B;  2WQY B;  1J7A A;  1QOB A;  1V97 A;  3B9J A;  1QT9 A;  1SB3 C;  1E10 A;  3FC4 A;  1RWS A;  2W3R A;  1VLB A;  2WLB A;  3AH7 A;  1RM6 C;  2PVG C;  1PDX A;  3PO0 A;  3DWG C;  1QOA A;  1GAQ B;  5EE9 A;  4YSY B;  4IDI A;  1AYF A;  5G5H A;  3DWM A;  3VRB B;  2PKO A;  3AE1 B;  3LXF A;  5EE1 A;  1FO4 A;  1L5P A;  1XLO A;  4WWM A;  4C7Y A;  4YXD B;  2MJD A;  3B2G A;  1N60 A;  1JAL A;  1YJJ A;  4JX1 C;  4JWU C;  4ZOH C;  1J7C A;  2OHF A;  2EKI A;  3VRA B;  2PVO D;  1SIJ A;  3B2F A;  1DOY A;  1KF6 B;  2W55 A;  3AE3 B;  2CU3 A;  2H88 B;  1B9R A;  1WGK A;  3P63 A;  2LEK A;  3SFE B;  2G1E A;  3AMZ A;  3P1M A;  1ZXI A;  5AUI A;  4N58 A;  2WDQ B;  2BS3 B;  1FFU A;  2WDR B;  3VR9 B;  3AEE B;  1XLP A;  1WRI A;  1JWB D;  3AEF B;  1NI3 A;  2QJL A;  1GPX A;  1N61 A;  1L0V B;  1JQ4 A;  1TKY A;  3AE9 B;  1KRH A;  1YJI A;  3WCQ A;  3P4R B;  1XLN A;  2MH7 A;  3BII D;  4YSX B;  3AEB B;  5G5G A; 
#chains in the Genus database with same CATH topology
 2K22 A;  1EWC A;  1G6J A;  1HXY D;  3IXS A;  1FM0 D;  3X0W A;  4ZYS A;  3VXW A;  4WWN A;  1QOF A;  3PSE B;  4BOZ B;  4XWT A;  2HTM E;  1KM7 A;  3DVG X;  1WR1 A;  2XBB C;  3H8H A;  2J0K A;  1XO3 A;  2WXR A;  5JHA A;  2L1A A;  4W9E A;  5CHW A;  1ZOY B;  4K7S A;  3URY A;  1TTN A;  3U7D A;  1WXM A;  2D10 A;  2MJ3 A;  2BS4 B;  1SIF A;  2O6V A;  3RUL A;  4ZHO A;  4WUR A;  1WM3 A;  2IO3 B;  1HZ6 A;  2LAS A;  1VD2 A;  1F52 A;  4GMV A;  2I2Y A;  2QIL A;  1FNW A;  4HDQ A;  1WRD B;  1A70 A;  2A4Z A;  2OED A;  2KX0 A;  2KWC A;  3AUL A;  4MH0 E;  3QHT A;  1EF1 A;  1TYG B;  1ET6 A;  4AS1 A;  1IP9 A;  4KZC A;  3UIO B;  4KSK C;  1FCC C;  2KOX A;  2KAJ A;  2WXM A;  1WX9 A;  3DPD A;  3PZ7 A;  3RFZ B;  4P1B C;  5J17 A;  1F77 A;  1H4R A;  4PK1 A;  3PO0 A;  2BBC A;  2WXQ A;  4IDI A;  3PRM B;  1HA5 A;  4MEM A;  1XLO A;  2MJD A;  1SJH D;  3PT2 B;  3KVF B;  2LD9 A;  3V05 A;  3VRA B;  4M8M A;  4MM3 B;  4WJQ A;  2W55 A;  4XDD A;  2RDH A;  2KYW A;  1ZXI A;  1S3S G;  3JSV A;  4WIP A;  1L0V B;  1ZDV A;  3P4R B;  2KFK B;  2R2O A;  3PGE A;  2PEA A;  1WGY A;  4ZRP A;  2KAN A;  3ZYY X;  2PMV A;  1JWU D;  2XK5 B;  1NI2 A;  1L6V A;  5HG2 A;  4WH4 A;  2L8J A;  2QC8 A;  2WGS A;  1V6E A;  2LUE A;  4FAD A;  5H8Y E;  4ANV A;  1JCK B;  5C1Z A;  3Q3N C;  4IWO A;  3EC8 A;  3VVW B;  2LUM A;  4YTM B;  1V5O A;  2BF8 B;  2NMQ A;  1GC7 A;  3RT3 B;  2Z59 B;  2IYD B;  4KGT A;  4PYU A;  5GXG B;  4HPM B;  1V86 A;  1R4N B;  1AN8 A;  2KMC A;  5CHF A;  1XF5 L;  2BB6 A;  1ZKH A;  2MBH A;  3SR6 A;  2MBO A;  1XQQ A;  1CK1 A;  2MRP A;  2WP9 B;  2BWF A;  1PUT A;  1TZ1 A;  1J0G A;  2C5L C;  2SAK A;  1K53 A;  4GB9 A;  1CJE A;  2L0F A;  3TCA A;  2KX3 A;  2JXT A;  1GC6 A;  1QOB A;  2JZ3 B;  4RGM A;  2W3R A;  2FCQ A;  2AQ3 B;  1PDX A;  3VFK A;  4BKS A;  2LFI A;  2INP E;  2ZJD A;  2M17 A;  2V0G A;  1WGD A;  1TY2 A;  2ON8 A;  2OJR A;  2VH1 A;  2KDI A;  3AMZ A;  4TV3 A;  2RGF A;  4KDI C;  2QMT A;  3H6N A;  1SEB D;  3TBL D;  1K8R B;  3P42 A;  4O1N A;  3UF8 A;  1PQS A;  1C4P A;  1NVI D;  1TJE A;  3FKY A;  4IM0 A;  4FJY A;  1R4N I;  1UWM A;  2FCS A;  4XWW A;  2AEH A;  3RUI B;  2H89 B;  2Z0E B;  4TQ1 A;  1Q10 A;  3M63 B;  3BYT B;  4IC7 B;  2DZM A;  3TMP B;  1C78 A;  2KMM A;  4XYC A;  1L6U A;  4FBJ B;  4YL8 A;  1UH6 A;  4HRS A;  4ARI A;  1WSP A;  4F7Z A;  3AU4 A;  1WM2 A;  4HVB A;  2W54 A;  4ICV A;  2JU6 X;  1Q0W B;  3RNF C;  3LB8 C;  4C4V A;  3AE4 B;  3VUY A;  1YQ3 B;  1ESF A;  4PS7 A;  4W9K A;  1ZUD 2;  5J18 A;  1F2R I;  3J9C A;  2G9H D;  3AED B;  4FJZ A;  2WXI A;  2KFJ A;  1X1M A;  4WJO A;  1E10 A;  5BO4 B;  1YX5 B;  3NJT A;  4UDU C;  2VH2 A;  2X8X X;  2LVO A;  3VRB B;  2L3Z A;  1FO4 A;  4C7Y A;  1N60 A;  4JWU C;  3Q8F A;  2DNF A;  2N9L A;  3KUD B;  2GBJ A;  2WX1 A;  3SFE B;  4W9F A;  4A90 A;  4HXD A;  4AJY B;  5L95 C;  1NI3 A;  2IGD A;  3OWE B;  1LO5 D;  2NPT A;  3Q3J A;  1TS4 A;  4REZ A;  2GBN A;  2REX A;  2HE7 A;  3A1Q A;  1N5W A;  1QLB B;  3TJP A;  3R66 C;  4BVU C;  3HK0 A;  1Y56 A;  2KDE B;  3CWI A;  3PTF C;  2M19 A;  3I57 A;  3IHP C;  1HTQ A;  3R7Q A;  4ZYN A;  3ZLZ A;  3AN1 A;  2L00 B;  2V4L A;  2NTS A;  4A3O A;  2V3S A;  3A33 B;  1H8C A;  1QOG A;  2BB5 A;  4OZB A;  1C76 A;  1XXG A;  1DGJ A;  3VTU A;  4LDT D;  3BY4 B;  2FUH B;  1UGJ A;  2G3Q B;  3EFU A;  1FXA A;  3CF6 E;  4HCN B;  3Q8E A;  1JWS D;  4A55 A;  2W9N A;  4LNK A;  1L4Z B;  1EU4 A;  3ML8 A;  4N9F 4;  3HRD D;  3PRE A;  2GMI C;  3RPF C;  2MJE A;  2ZEQ A;  4W9L A;  1N5X A;  2KXJ A;  2BS2 B;  1NEK B;  3NG0 A;  2VZK D;  1WXQ A;  1HZ5 A;  1D5X C;  2JY6 A;  2J52 A;  3A4S C;  1F9J A;  3DHH C;  2Z0D B;  4JL9 A;  3PV1 A;  4ZRQ A;  4NJ6 A;  3TEW A;  3MP9 A;  3JW0 X;  2D3C A;  1E5W A;  3H1U A;  4ZOH C;  2PPH A;  1KF6 B;  2CU3 A;  3L54 A;  2K8H A;  1LXD A;  2KD0 A;  1V1O A;  4MGI E;  1T0Q C;  1WRI A;  4AJW A;  3ZQ4 A;  2DYM A;  2MBB B;  3N20 C;  3ONS A;  4OHJ A;  4KX6 B;  1FXI A;  1ZDX A;  3ZXV A;  1WMH B;  1IUE A;  5AZG A;  2RPQ A;  4R3D A;  3APD A;  1E6E B;  1UEL A;  4WQO B;  1GB4 A;  3PHX B;  3Q14 C;  1F2R C;  4F8C B;  1VZ7 A;  1V1P A;  4L23 A;  2LXC A;  4M01 A;  1KLV A;  5EE0 A;  2WWZ A;  1P3Q U;  1YD8 U;  2R2Q A;  2MX2 A;  2D3B A;  4NAW A;  1WGH A;  3BVZ A;  3QA8 A;  4ASW C;  1AAR A;  1JRP A;  2GI9 A;  1GNU A;  3H7S A;  5C2T B;  3QWZ B;  1JRO A;  4XE0 A;  3GE3 C;  5FR3 A;  1EF5 A;  2NR2 A;  1STE A;  2V3N A;  4FHJ A;  4M00 A;  2E6X A;  4RM8 A;  3KH0 A;  4GDL A;  1IPG A;  3ML9 A;  3KLS X;  1F0Z A;  1C1Y B;  5BYR A;  3AU5 A;  1D3Z A;  2IDY A;  4G11 A;  4DXA B;  2KC1 A;  1B1Z A;  3NVV A;  2KQS A;  4MAC A;  1ROE A;  3QK0 A;  3R2I A;  2WU5 B;  3AEA B;  3OG5 A;  4NQK E;  1LM8 B;  4GDK B;  1RM6 C;  2JYE A;  2PVG C;  2V3P A;  1MI0 A;  1RFA A;  2J0M A;  3GE8 C;  4KDL B;  1AW7 A;  2K8C A;  4WWM A;  3ZTC A;  4W9C A;  3ZO5 B;  4KKJ A;  1UWX A;  1UZX B;  2IPK D;  2IBI B;  3A9K B;  3UIN B;  2WDQ B;  4GN1 A;  2AYO B;  4HPL B;  1JWB D;  1V5T A;  2FAZ A;  1JQ4 A;  1EO6 A;  4LTU A;  4YTP B;  2KTF A;  2M56 B;  4W9I A;  3B08 A;  2MBE A;  2LHE A;  4BBN F;  2WU2 B;  2K5P A;  4RNA A;  4L2Y A;  2O2V A;  3NZ3 A;  2FE8 A;  1WX7 A;  2MP2 B;  1FMA D;  5IKC M;  4C7Z A;  4USA A;  3O65 B;  4B9K A;  4MDK E;  4PT5 A;  4EFO A;  1JRU A;  3UQA A;  5C3J B;  1XD3 B;  2XK5 A;  3L17 A;  1SXT A;  4FJV B;  3LYY A;  2JT4 B;  2JPH A;  4RF0 A;  3RZW C;  2N7J A;  2RDG A;  4IKG A;  4M0W B;  2DYO A;  2ZVN A;  4MT5 A;  4E74 A;  3N3K B;  3QAQ A;  2W3S A;  5IO9 A;  1VCB A;  4EKU A;  3BVG A;  3ZRF A;  3DBH B;  4QAY A;  4LLG M;  2WX0 A;  4WQM A;  1OGW A;  1E90 A;  2WXN A;  1VR9 A;  5L83 A;  2C7H A;  3ZKJ C;  5DPT A;  5KHO A;  3AB5 A;  4WJN A;  3FIL A;  2INC C;  1DOI A;  2JSV X;  5J2R A;  1EU3 A;  4US9 A;  4RCO A;  3V3X A;  1FPY A;  2LVP A;  3ZNI D;  4GU2 A;  5CTR C;  4RM9 A;  4HJG E;  2ZCB A;  5HKH A;  1FXT B;  1V2Y A;  4TMA B;  3KYC D;  5G5H A;  3AE1 B;  4IW0 A;  1YX6 B;  4W9G A;  1TZO A;  2BW2 A;  2KWV B;  1TBE A;  3CSF A;  3WAL A;  3N32 A;  2VRR B;  1Y8R C;  3T8M A;  3RD2 A;  3N1Z C;  2H88 B;  2IZV B;  2JVC A;  2LHD A;  2K1F A;  2KJH B;  4URK A;  3I3T B;  4GIV A;  3M95 A;  1JML A;  1N61 A;  1KRH A;  1YJI A;  1I4X A;  2BYF A;  4WAA A;  2GRI A;  4FHK A;  3DBS A;  3GB1 A;  1UUP A;  3DBH I;  4P1C C;  2LJ5 A;  1IBX B;  2ACZ B;  3AE8 B;  4LNN A;  1WR6 E;  4ARC A;  3RCZ A;  4ANU A;  1D5M C;  4EZL A;  3RNG C;  3PLV A;  4OZC A;  2KTR A;  1VRA B;  1FIQ A;  2NBU A;  4DHJ D;  1R4M B;  3M3J A;  4W9J A;  1MVK A;  2GBM A;  4DDG D;  4MGY E;  2FNJ B;  3JVZ X;  3KYD D;  4XDC A;  3C8Y A;  2XEW A;  3IG3 A;  3AE2 B;  1GOZ A;  3VUW A;  2LI5 A;  2N1V A;  3Q8A A;  1AWD A;  1V9J A;  1WY8 A;  4YSZ B;  1XLQ A;  3TL5 A;  3SFD B;  3T3N A;  1ZE3 D;  3WAM A;  5AZH A;  4ACF A;  4K7W A;  4NNJ B;  2DYB A;  2WS3 B;  4BBN C;  2JUO A;  4W9D A;  2CS4 A;  3B9J A;  5D6J B;  1SB3 C;  2ZNV C;  1I4H A;  5LLI A;  3NUH B;  2KLG A;  4J6I A;  4JPS A;  4G0N B;  3W1S A;  1L0X B;  3SDL C;  2AQ2 B;  1IGD A;  2LZ6 A;  3EGR A;  1WJU A;  1B9R A;  1RAX A;  1XCQ L;  4ZDV A;  2KN5 A;  1R4M I;  1XLP A;  4KSL C;  3IVF A;  1BUI C;  1WXV A;  4MEL A;  1S1Q B;  2N4F A;  3AE9 B;  4ZRK A;  3ECI A;  3BYY B;  4DK5 A;  5G5G A;  3O13 A;  2GLS A;  1P7E A;  1HEZ E;  2NS5 A;  2J7Q B;  2D3A A;  2K6Q A;  1T0S C;  1GG3 A;  1YMH E;  2V4I B;  3R3M A;  4LDT B;  3MHS D;  4OW0 A;  5AUK A;  2L76 A;  2DAF A;  3V61 A;  2CHX A;  2J53 A;  4X57 B;  2HD5 B;  2INN E;  2RDB C;  2LRU A;  5BMH A;  1K50 A;  3RNB C;  3DHI C;  2FCN A;  4CQN A;  4DHZ B;  2E3T A;  4NY0 A;  5E6P A;  1NDD A;  1XEE A;  2KC2 A;  2BT6 A;  4NAM A;  2VZK B;  4JQW C;  3EEC A;  1OFF A;  2WXO A;  2QIE B;  1P9D U;  2J42 A;  2KAC A;  4K81 A;  1RRB A;  1JWA D;  3TEZ A;  2JWU A;  1KOT A;  2CJO A;  3JSV B;  2MA9 B;  1WI0 A;  5BMI A;  4C80 A;  5TR5 A;  2KDM A;  2EMS A;  3QQ8 B;  3V6E B;  3IT4 B;  5MPO A;  5E6O A;  3NHE B;  3PVL A;  1ZXH A;  1E8X A;  1R7S A;  2L52 A;  2AL3 A;  3H9D A;  2JQR B;  2KWD A;  3OLM D;  4KVG B;  1HE8 A;  5D2M B;  1C4A A;  2OJW A;  2LJI A;  1WGG A;  2PJH A;  2KQ4 X;  1JAL A;  1E7V A;  1MHX A;  2GOW A;  3DQV A;  1WE7 A;  2LVQ A;  5IP4 D;  4B0E A;  2KZR A;  2G1E A;  1J8C A;  5IOI A;  3TUO A;  3MFG A;  4HK2 A;  3T3O A;  2WDR B;  3SHQ A;  3IBE A;  3DHG C;  2WXP A;  1Q5W B;  1YN3 A;  4YSX B;  2V9H A;  3VH3 B;  1FNV A;  1CQV A;  4ZHP A;  3ZNZ B;  4H2A A;  4CHK A;  4LNI A;  1GUA B;  2DZJ A;  4GGQ A;  2UU7 A;  1WYW B;  2BYT A;  2AX5 A;  4M02 A;  3VTW A;  4OZA A;  1E7U A;  4J3O D;  4MGZ E;  1WMH A;  5E6J A;  1C4C A;  1FD6 A;  2M8S A;  5EDS A;  2LGI A;  4BKG A;  2MBQ A;  1OQR A;  2C9W B;  1LGR A;  2L05 A;  3VHT C;  5JHB A;  3TEY A;  3HVD A;  2AQ1 B;  1KLG D;  2DBY A;  2L32 A;  3VUX A;  2O6V D;  2FUG 1;  2WXG A;  3MJ5 A;  3NS8 A;  4II3 B;  3OJ3 A;  1YQB A;  4IWP A;  4BAX A;  4A9A A;  5CX3 A;  3DBR B;  2QHO A;  2IND C;  4KGS A;  4ITK A;  3TSS A;  4JIO U;  2FIF A;  2BYE A;  4XZ4 A;  4DWF A;  3WIM A;  3NZS A;  2IO1 B;  4WWO A;  1MG4 A;  5G2N A;  2KHW B;  1OTR B;  2YEP B;  4LCD E;  3U30 A;  2D2Q A;  4MSM B;  2OHF A;  1Z2M A;  2EKI A;  3NZU A;  4GDK A;  2NTT A;  1SE4 A;  2DZI A;  2NCN A;  1WXA A;  3VH4 B;  5AUI A;  1SE2 A;  2KT7 A;  2WXJ A;  4RGT A;  4HPP A;  1VDV A;  4ANX A;  3A9K A;  3ZNG C;  3EHV A;  1TKE A;  5JZE B;  4B6W A;  1FRD A;  1YIW A;  1JW9 D;  3NVW A;  2EEL A;  4EOY A;  1BT0 A;  3B0A A;  1KFY B;  5FR6 A;  4A3P A;  1JWM D;  3DBR I;  1ET9 A;  3DDC B;  2K6D B;  3N9Y C;  3KQ4 A;  2HJ1 A;  4HRO A;  1IYF A;  3KUZ A;  4II2 B;  1XCT L;  2MP2 A;  4IWQ A;  3I9V 1;  1M4V A;  2KKC A;  2BGF A;  4PS8 A;  4RGO S;  3ABV B;  3ZVV A;  1ZP0 B;  3I5J C;  2C7N B;  3OJ4 B;  4IUM B;  3ZJT A;  1T0R C;  2CKH B;  1RYJ A;  3U2S C;  2B76 B;  3PZ8 A;  4M0W A;  1WXS A;  4DBG A;  3L13 A;  3APC A;  1FEH A;  1PGA A;  4EEW A;  3L16 A;  4ZRI A;  4HKQ A;  1OQQ A;  3HIZ A;  2D3G A;  2MHJ A;  3X23 A;  3PS6 A;  2ZW0 A;  1RLF A;  1I7H A;  1ZW7 A;  3A1Q B;  1YOV B;  1MFW A;  2K9X A;  2J4X A;  4E3C A;  1HTO A;  1YN4 A;  2ASQ A;  2ONQ A;  3VTV A;  3S2A A;  4K3C A;  1RWS A;  3H7P B;  2BYV E;  4TUU A;  4LK0 M;  1WGR A;  2KQ7 A;  5KHQ A;  2DAJ A;  4AQ7 A;  4XC2 A;  3R8B A;  3ZW3 A;  1J7C A;  2PVO D;  3PRP B;  2LGS A;  2MW5 A;  3RNE C;  1DOY A;  3TEX A;  4BKS D;  1C79 A;  1WGK A;  3QCA A;  3IFW B;  1EUV B;  5D3I B;  2BS3 B;  1GPX A;  3WCQ A;  1Q1O A;  4RF1 A;  1T3Q A;  2Y5C A;  1WWT A;  3ZXR A;  4DHJ B;  4A20 A;  3KWV A;  1CMX B;  2Q5W D;  2BQQ A;  1E7P B;  3MHZ A;  5BYS A;  4OVZ A;  3RYT A;  3UQB A;  2L7R A;  1J7B A;  1M94 A;  3P4Q B;  1EWY C;  3W1S C;  5D7G A;  2DHZ A;  1GB1 A;  3NRZ A;  1K52 A;  4CO7 A;  3A9J B;  4MM3 A;  1L4D B;  5DCN A;  3ENE A;  2K8B A;  3AI5 A;  1MJD A;  4MJS B;  1YQ4 B;  4DQO C;  2XNA C;  2L0T A;  2WXH A;  2KFK A;  1E9M A;  4M8N A;  2BVC A;  4DHZ E;  2C7M B;  2IJ0 A;  3AE5 B;  2N9P C;  1ZGU B;  2XN9 C;  3Q3M C;  4NJ7 A;  1V49 A;  4FLH A;  4BOS C;  1WYG A;  4K3B A;  4TSS A;  3QC8 B;  3NVY A;  4HJK A;  2L83 A;  3FAH A;  3W5U B;  2NBW B;  3ZJU A;  2LRW A;  2G45 B;  1V97 A;  2FCM A;  3HM6 X;  3RMK C;  1QT9 A;  5I4D A;  2KK8 A;  3BVM A;  4MGK E;  5EE9 A;  1SSN A;  1ENF A;  2LGD A;  4BZA A;  1V1P B;  3DVG Y;  2X38 A;  3LXF A;  5EE1 A;  4RH6 A;  2Y3A A;  3NY5 A;  4WJP A;  4NAW B;  4FA6 A;  1FCL A;  1P7F A;  5DPW A;  3P63 A;  4NZL B;  2MEK A;  2TSS A;  4KZ0 A;  1VZ6 A;  2MWS B;  3PHW B;  4HWI B;  3P4P B;  3BK2 A;  5BYQ A;  3Q2A C;  2MCN B;  1QZE A;  2WYQ A;  2YVC A;  2M4N A;  3VR8 B;  4AP4 C;  1NYQ A;  1WJN A;  1J19 A;  2KLC A;  3I63 C;  5JH5 C;  4GDL B;  3P2B A;  1UNS A;  4G50 A;  4US8 A;  1RFK A;  2RPV A;  2K0P A;  4PYZ A;  3RNC C;  1C3T A;  3GS2 A;  4ICU A;  4KKI A;  1N6Z A;  2JXX A;  4JLC A;  1E0Z A;  1KLU D;  4S17 A;  4S0R A;  2PIA A;  2J0J A;  1BML C;  1V81 A;  4LJO B;  1WE6 A;  1IGC A;  3ZDM C;  2C60 A;  2FID A;  2Y5P A;  3GOE A;  1E8Y A;  2QCZ A;  2CU1 A;  3GP7 A;  2UYZ B;  4KIK B;  1SE9 A;  3L4P A;  3WA0 A;  2ZPY A;  2ICI A;  5EE3 A;  1OEY A;  1J7A A;  2N9K A;  1TS5 A;  2O2V B;  5HI1 A;  1MPE A;  1SJE D;  4TKN A;  2GBR A;  3AH7 A;  2JRI B;  2JZP A;  1FNU A;  3DWM A;  2PKO A;  3QJZ A;  3E56 A;  2IGG A;  4JX1 C;  4F1S A;  2CHW A;  4PS3 A;  2GBK A;  3IT6 B;  3AE3 B;  1WX8 A;  2KJ6 A;  4Q2J A;  2D5G A;  3VDZ A;  3SEB A;  1DYQ A;  1MHH E;  4HKZ E;  4EZK A;  2KO3 A;  2Y5B B;  2QEJ C;  4LJP B;  3HVZ A;  3L08 A;  3DVN U;  2IO0 B;  4YTN B;  3ZRC A;  5LXH A;  3HUI A;  1HQR D;  2HJ8 A;  1OQY A;  3U8Z A;  3FIL B;  2BKR B;  2O6V B;  2I1J A;  1NYR A;  3ZUN A;  1T6B X;  4FXC A;  3N30 A;  1KJT A;  5C23 A;  3L0W B;  2PTL A;  1N62 A;  1QIL A;  3SD5 A;  3WAP A;  1C77 A;  2JWZ A;  2OOB B;  4JGH B;  4B95 A;  1FRR A;  3U52 E;  1I4G A;  1QF6 A;  1SBB B;  2DLB A;  2MLB A;  5D94 A;  4IOI E;  3MTN B;  1DOX A;  2AL6 A;  1C9F A;  5FKA C;  1I4Q A;  3HHM A;  2IGH A;  5G55 A;  3W9C B;  4DXG A;  3CST A;  2KDF B;  2RSU A;  1WZ0 A;  3Q3F A;  1UD7 A;  3U7Z A;  1ISN A;  3RI7 C;  4HCP B;  2PE9 A;  3AM9 A;  3Q8B A;  1TY0 A;  2IY0 B;  2BPS A;  2AWT A;  1QOA A;  3L10 B;  2K3U A;  1L5P A;  4YXD B;  4DDI D;  3B2F A;  3ZGZ A;  2KTR B;  3V60 A;  2I1K A;  2ZZP B;  5AZF A;  3QIJ A;  5GMV A;  3PLU A;  3AEF B;  2QJL A;  1WJ6 A;  3UI3 A;  4DXF A;  3QAR A;  1XLN A;  2WNM A;  3BII D;  3CMM B;  3MC8 A;  4IM3 A;  3ZIM A;  2BWE S;  2N0S B;  1FFV A;  1V8C A;  2NBV B;  3R2T A;  5IA7 A;  1PGX A;  1QKZ A;  5FK9 C;  3AV8 A;  5IAA C;  3NVZ A;  4A6Q A;  4NPN A;  2DX5 B;  1TKG A;  2RD0 A;  2DEN B;  5T8I A;  1MG8 A;  1I35 A;  1YJ1 A;  5H92 C;  2JZZ A;  3C19 A;  3K9P B;  1NEN B;  3GZN B;  4C00 A;  3K9O B;  4L1B A;  1YNT E;  4G3X B;  4BKT A;  2IO2 B;  2KWU B;  5LXI B;  2MQJ A;  3Q6B A;  4N59 A;  3AEC B;  1E8Z A;  2KVR A;  4CYE A;  1BXT A;  4GXB A;  3ZNH B;  2DWQ A;  3IAS 1;  1EM7 A;  2M0A A;  1K51 A;  2WHI A;  3BWU D;  2Z8L A;  3P4S B;  3DBL B;  3C0R B;  4D2K A;  2BTE A;  1PFD A;  1L2N A;  2SEB D;  1I4R A;  3ZDT A;  1I4P A;  2KDB A;  3AEG B;  1WZ3 A;  3FC4 A;  1D6E C;  1VLB A;  2MSE D;  3LJ3 A;  4IG7 B;  2D11 A;  1L7Y A;  4AWJ A;  4C56 C;  2CR5 A;  3B1L X;  4YSY B;  1KTK A;  1V80 A;  3BZD B;  1A5R A;  3PRZ A;  2ZPN A;  4I6L B;  1LQB A;  5DPS A;  3APF A;  5DPR A;  1WH3 A;  3H7P A;  3V62 A;  2B3A A;  1XT9 B;  3GZN I;  3QX1 A;  4E71 A;  2WXL A;  1FFU A;  3ALB A;  3RN9 C;  2QSD A;  1WF9 A;  3UIP B;  1ZPS A;  2HTH A;  3W1Y A;  4ANW A;  4FN2 A;  4HEA 1;  4XX5 A;  2WDT B;  3D32 A;  3TIX A;  3PZD A;  4YT0 B;  2G4D B;  3R7R A;  2HDE A;  4YWG G;  2YLM A;  2GB1 A;  5AEK B;  3A4R A;  4GSW A;  3N1X C;  2FBW B;  3AE7 B;  3KWL A;  4AUQ C;  4OVV A;  1WFY A;  3DBL I;  4EUT A;  3MJW A;  5LNK 1;  4C4V B;  4IM2 A;  2RR9 A;  3WAO A;  2QDF A;  4AOF A;  2EMT A;  1TS3 A;  3KUC B;  3ZJV A;  4NQL B;  3NS1 A;  3MC9 A;  3PPA A;  4EZJ A;  3SU8 X;  3V6C B;  3A9J A;  2JX5 A;  4JWS C;  3AE6 B;  4WWP A;  3RZF A;  5HFY A;  2KMA A;  1P0R A;  2N7E A;  4MJS A;  2NVU I;  1GJZ A;  1OEY J;  1KH0 A;  2PLP A;  4K7U A;  2WDV B;  1VJK A;  2BKF A;  3RNA C;  2N7D A;  4WAF A;  1YN5 A;  1UBQ A;  5JXV A;  4P6V F;  2UWQ A;  2K25 A;  5TSS A;  3CIR B;  1Z5S B;  3OAW A;  3EUB 2;  1SGH A;  1TT5 B;  3NOB A;  4JE3 B;  3W5V B;  4LNO A;  3VAW A;  2WQY B;  3N1Y C;  2WLB A;  3MC0 B;  4A8X C;  3DVN V;  3Q8C A;  3DWG C;  2YEP F;  1GAQ B;  1P98 A;  1AYF A;  1QQR A;  1TGZ B;  4RFB A;  3DCG A;  2IY1 B;  2A5U A;  4I6P A;  4NJC A;  3EFC A;  1SIJ A;  2NPT B;  2EKE C;  3U4E G;  1LFD A;  2LEK A;  2LMC A;  3ZTD A;  3P1M A;  1D5Z C;  4N58 A;  2D07 B;  1D4B A;  1TIF A;  1UGM A;  5HHD G;  3IAM 1;  2JF5 A;  1TKY A;  2KN4 A;  2ZCC A;  2LGX A;  2MH7 A;  2JYT A;  5CHV C;  1E8W A;  2I38 A;  5D3D A;  2M1M A;  3T9L A;  1T0Y A;  3AXC A;  4P16 A;  4K1R B;  4N6E B;  1ACC A;  2DZK A;  1VZ8 A;  2KNB A;  3M62 B;  2N9E B;  1NBF C;  1T5X D;  3E9S A;  4GOC A;  2ZNV B;  1UBI A;  3WAN A;  1P1A A;  4EE2 A;  2M0X A;  2N1W A;  4W9H A;  2PE6 B;  5IN7 A;  1U4A A;  3BIN A;  3Q69 A;  3BK1 A;  4FUL A;  1WIA A;  2G4S A;  1N63 A;  2V1Y A;  1F1H A;  2CJN A;  3EA6 A;  4RMA A;  5E6N A;  2LXA A;  2WXF A;  1SF0 A;  4RGN A;  4OVU A;  1PGB A;  3KW5 B;  1CZP A;  4HLE A;  1IBX A;  4MSQ B;  3W2D A;  3ETR A;  3JYU A;  4GLS C;  4KGR A;  4ZRJ A;  2K39 A;  2R61 A;  1L0Y B;  4P7I A;  1PYW D;  3UGB B;  1SE3 A;  2PW9 A;  2N9X A;  4BFR A;  2LGY A;  4KIK A;  4KV2 A;  2ZW1 A;  3VQI A;  3LDZ E;  1UF0 A;  5BMG A;  2CHZ A;  4HDO A;  3HM3 A;  4XGA B;  2RMM A;  2ZVO A;  3B2G A;  4TQ0 A;  1YJJ A;  4I6N B;  4MH8 A;  1TS2 A;  4B0M A;  2KJR A;  2JRH A;  3DOW A;  2KVZ A;  2LWP A;  1WJ4 A;  3AEE B;  1I42 A;  2WXK A;  2W82 A;  3Q3O C;  4LNF A;  3VR9 B;  3AEB B; 
#chains in the Genus database with same CATH homology
 2K22 A;  1FXI A;  1FNV A;  2QEJ C;  1ZDX A;  1EWC A;  1CQV A;  4ZHP A;  1HXY D;  3IXS A;  1IUE A;  3HVZ A;  4H2A A;  1FM0 D;  4ZYS A;  4R3D A;  1E6E B;  4YTN B;  1QOF A;  3HUI A;  1HQR D;  2BYT A;  2AX5 A;  1GB4 A;  4XWT A;  2HTM E;  4OZA A;  1F2R C;  4J3O D;  3H8H A;  1VZ7 A;  3FIL B;  1V1P A;  4L23 A;  5E6J A;  1C4C A;  1XO3 A;  1NYR A;  5EE0 A;  2WXR A;  1T6B X;  4FXC A;  2L1A A;  1FD6 A;  1ZOY B;  3BVZ A;  2LGI A;  3URY A;  1OQR A;  2PTL A;  1N62 A;  2MJ3 A;  2BS4 B;  1JRP A;  4ZHO A;  4WUR A;  2GI9 A;  1QIL A;  5C2T B;  1HZ6 A;  1C77 A;  3TEY A;  3HVD A;  1JRO A;  4XE0 A;  2AQ1 B;  1KLG D;  2DBY A;  2L32 A;  2I2Y A;  2QIL A;  1FNW A;  1FRR A;  3U52 E;  5FR3 A;  1A70 A;  1I4G A;  1QF6 A;  2OED A;  2FUG 1;  1SBB B;  2DLB A;  2WXG A;  3MJ5 A;  1STE A;  4IOI E;  2V3N A;  1DOX A;  4A9A A;  1C9F A;  2E6X A;  5FKA C;  1TYG B;  1I4Q A;  1ET6 A;  4AS1 A;  3KLS X;  1F0Z A;  2IGH A;  4DXG A;  3W9C B;  4KGS A;  5BYR A;  4ITK A;  3TSS A;  1FCC C;  2IDY A;  2KAJ A;  2WXM A;  3U7Z A;  1B1Z A;  3NVV A;  3PZ7 A;  3RFZ B;  4MAC A;  3AM9 A;  1ROE A;  3Q8B A;  1F77 A;  3R2I A;  2WU5 B;  3AEA B;  1TY0 A;  4GDK B;  1RM6 C;  2JYE A;  2PVG C;  2BBC A;  2V3P A;  1MI0 A;  2WXQ A;  3PO0 A;  1QOA A;  4IDI A;  1AW7 A;  2YEP B;  1HA5 A;  2K3U A;  1L5P A;  1XLO A;  4WWM A;  4YXD B;  2MJD A;  1SJH D;  4KKJ A;  2OHF A;  3V05 A;  2EKI A;  3VRA B;  1UWX A;  3B2F A;  2NTT A;  4MM3 B;  3ZGZ A;  2W55 A;  4XDD A;  1SE4 A;  2IPK D;  2RDH A;  1ZXI A;  1SE2 A;  5AUI A;  2WDQ B;  4WIP A;  1JWB D;  3AEF B;  2QJL A;  2WXJ A;  1L0V B;  1JQ4 A;  3UI3 A;  4DXF A;  1ZDV A;  3P4R B;  4RGT A;  1XLN A;  2WNM A;  3BII D;  4LTU A;  1VDV A;  4YTP B;  4ZRP A;  3ZYY X;  2M56 B;  2N0S B;  1FFV A;  1V8C A;  2PMV A;  3R2T A;  1TKE A;  1PGX A;  1QKZ A;  5FK9 C;  2LHE A;  2WU2 B;  2K5P A;  3AV8 A;  4RNA A;  4L2Y A;  3NVZ A;  1JWU D;  4A6Q A;  3NZ3 A;  1L6V A;  1FRD A;  2FE8 A;  5HG2 A;  4WH4 A;  1TKG A;  1JW9 D;  3NVW A;  5T8I A;  2EEL A;  1FMA D;  4C7Z A;  1KFY B;  4USA A;  1JWM D;  4PT5 A;  1ET9 A;  5H92 C;  3N9Y C;  5C3J B;  3KQ4 A;  1NEN B;  1SXT A;  3LYY A;  5H8Y E;  4HRO A;  4L1B A;  1YNT E;  4RF0 A;  1XCT L;  1JCK B;  2N7J A;  2RDG A;  4IKG A;  3I9V 1;  2DYO A;  2LUM A;  4MT5 A;  1M4V A;  4YTM B;  2W3S A;  2NMQ A;  4N59 A;  4RGO S;  3ABV B;  1ZP0 B;  3AEC B;  1BXT A;  3ZJT A;  4KGT A;  2DWQ A;  1RYJ A;  3U2S C;  3IAS 1;  3BVG A;  5GXG B;  2B76 B;  3PZ8 A;  4LLG M;  1AN8 A;  1EM7 A;  2M0A A;  4M0W A;  1K51 A;  4WQM A;  2WXN A;  1VR9 A;  1FEH A;  1XF5 L;  2BB6 A;  3BWU D;  1PGA A;  2Z8L A;  4HKQ A;  1OQQ A;  3SR6 A;  3AB5 A;  3P4S B;  3FIL A;  1DOI A;  2JSV X;  1CK1 A;  4D2K A;  1EU3 A;  2WP9 B;  2BTE A;  1PFD A;  1PUT A;  4US9 A;  2SEB D;  2ZW0 A;  4RCO A;  2SAK A;  1I4R A;  3V3X A;  1I4P A;  1K53 A;  1CJE A;  1I7H A;  2K9X A;  2J4X A;  3AEG B;  1YN4 A;  2JXT A;  1QOB A;  2ONQ A;  4HJG E;  3FC4 A;  1D6E C;  1RWS A;  1VLB A;  2W3R A;  4RGM A;  2AQ3 B;  1PDX A;  4LK0 M;  4TMA B;  4C56 C;  4YSY B;  1KTK A;  3BZD B;  2LFI A;  5G5H A;  2INP E;  4AQ7 A;  3AE1 B;  3R8B A;  1TZO A;  2BW2 A;  1J7C A;  2V0G A;  1TY2 A;  2ON8 A;  2PVO D;  1DOY A;  3TEX A;  1C79 A;  2H88 B;  1WGK A;  2LHD A;  3AMZ A;  2WXL A;  5D3I B;  2QMT A;  2BS3 B;  1FFU A;  1SEB D;  3VR9 B;  1GPX A;  1JML A;  2QSD A;  1N61 A;  3WCQ A;  1KRH A;  1YJI A;  3P42 A;  1I4X A;  1ZPS A;  4O1N A;  2GRI A;  1C4P A;  4HEA 1;  4RF1 A;  1NVI D;  1TJE A;  1T3Q A;  4YT0 B;  2Y5C A;  1WWT A;  2HDE A;  4YWG G;  3GB1 A;  2GB1 A;  3KWV A;  1UUP A;  2Q5W D;  1IBX B;  1E7P B;  3MHZ A;  5BYS A;  1UWM A;  4XWW A;  2ACZ B;  2FBW B;  3AE8 B;  3AE7 B;  3KWL A;  4OVZ A;  2H89 B;  4ARC A;  4TQ1 A;  1Q10 A;  3BYT B;  1J7B A;  1D5M C;  3P4Q B;  1C78 A;  1EWY C;  2KMM A;  1L6U A;  5D7G A;  5LNK 1;  3NRZ A;  1GB1 A;  1K52 A;  4OZC A;  1L4D B;  4HRS A;  4ARI A;  1VRA B;  1WSP A;  1FIQ A;  1TS3 A;  2W54 A;  3ZJV A;  1YQ4 B;  2JU6 X;  1MVK A;  3LB8 C;  3NS1 A;  4DQO C;  2XNA C;  3AE4 B;  2WXH A;  5HFY A;  2JX5 A;  4JWS C;  3AE6 B;  1YQ3 B;  4XDC A;  1E9M A;  3C8Y A;  3AE2 B;  1GOZ A;  1KH0 A;  2PLP A;  1ESF A;  2WDV B;  1VJK A;  3Q8A A;  2IJ0 A;  3AE5 B;  1AWD A;  2XN9 C;  4WAF A;  4YSZ B;  1XLQ A;  1ZUD 2;  1YN5 A;  3SFD B;  5JXV A;  1F2R I;  4P6V F;  3T3N A;  1ZE3 D;  1WYG A;  5TSS A;  3CIR B;  4TSS A;  3NVY A;  2L83 A;  3FAH A;  3EUB 2;  3W5U B;  2WS3 B;  3J9C A;  2G9H D;  3ZJU A;  4JE3 B;  3AED B;  2WXI A;  3W5V B;  2WQY B;  1V97 A;  3B9J A;  1QT9 A;  1SB3 C;  1E10 A;  5I4D A;  1I4H A;  2WLB A;  3BVM A;  3MC0 B;  4UDU C;  4A8X C;  3Q8C A;  3DWG C;  2YEP F;  1GAQ B;  5EE9 A;  1SSN A;  3NUH B;  1ENF A;  1AYF A;  1QQR A;  4RFB A;  1V1P B;  4JPS A;  2X38 A;  3VRB B;  3LXF A;  5EE1 A;  4RH6 A;  1FO4 A;  4C7Y A;  2Y3A A;  1N60 A;  3W1S A;  1L0X B;  4JWU C;  4NJC A;  3Q8F A;  2AQ2 B;  1IGD A;  3EGR A;  2N9L A;  1SIJ A;  4NAW B;  1FCL A;  1P7F A;  3U4E G;  1B9R A;  3P63 A;  4NZL B;  2LEK A;  3SFE B;  2LMC A;  2MEK A;  1XCQ L;  3P1M A;  4A90 A;  2TSS A;  1D5Z C;  4N58 A;  1VZ6 A;  1XLP A;  1D4B A;  1NI3 A;  5HHD G;  1BUI C;  3IAM 1;  2IGD A;  3OWE B;  1TKY A;  3AE9 B;  2KN4 A;  3P4P B;  1LO5 D;  2JYT A;  2MH7 A;  3BYY B;  5G5G A;  3BK2 A;  3O13 A;  5BYQ A;  1P7E A;  1TS4 A;  4REZ A;  1HEZ E;  2I38 A;  5D3D A;  1N5W A;  1QLB B;  4P16 A;  4N6E B;  1YMH E;  3VR8 B;  2V4I B;  1NYQ A;  1ACC A;  1Y56 A;  3CWI A;  1VZ8 A;  4OW0 A;  5AUK A;  4GDL B;  2M19 A;  3I57 A;  1T5X D;  1UNS A;  3E9S A;  4US8 A;  1RFK A;  3AN1 A;  2RPV A;  2J53 A;  2NTS A;  4EE2 A;  2K0P A;  2INN E;  5BMH A;  3GS2 A;  1K50 A;  4KKI A;  1QOG A;  2BB5 A;  3Q69 A;  3BK1 A;  4OZB A;  4CQN A;  1C76 A;  1XXG A;  1E0Z A;  1KLU D;  1DGJ A;  1N63 A;  2E3T A;  2PIA A;  2CJN A;  1XEE A;  1BML C;  3EA6 A;  2BT6 A;  1UGJ A;  1FXA A;  4NAM A;  2VZK B;  3Q8E A;  1JWS D;  2WXF A;  4A55 A;  1IGC A;  1SF0 A;  4RGN A;  1L4Z B;  1PGB A;  2Y5P A;  1OFF A;  2WXO A;  2QIE B;  1CZP A;  1EU4 A;  2J42 A;  2KAC A;  1JWA D;  3HRD D;  1IBX A;  3TEZ A;  3GP7 A;  3W2D A;  3ETR A;  4GLS C;  2JWU A;  2CJO A;  3L4P A;  4KGR A;  3RPF C;  5BMI A;  2MJE A;  4C80 A;  2KDM A;  2R61 A;  1L0Y B;  1PYW D;  3IT4 B;  1N5X A;  2ICI A;  5MPO A;  1SE3 A;  1NEK B;  2BS2 B;  2PW9 A;  1ZXH A;  2VZK D;  1WXQ A;  5EE3 A;  1R7S A;  1HZ5 A;  1D5X C;  2L52 A;  2JQR B;  2KWD A;  2J52 A;  2ZW1 A;  3VQI A;  1J7A A;  2N9K A;  1TS5 A;  5HI1 A;  5BMG A;  1MPE A;  1SJE D;  3AH7 A;  1C4A A;  2RMM A;  4ZRQ A;  3TEW A;  2JZP A;  1FNU A;  3DWM A;  2LJI A;  2PKO A;  3MP9 A;  3E56 A;  3B2G A;  2IGG A;  4TQ0 A;  2KQ4 X;  1JAL A;  1YJJ A;  4JX1 C;  4ZOH C;  4MH8 A;  1MHX A;  1TS2 A;  4B0M A;  3IT6 B;  1KF6 B;  3AE3 B;  2CU3 A;  4B0E A;  4Q2J A;  2G1E A;  3TUO A;  1V1O A;  3MFG A;  2D5G A;  3SEB A;  1DYQ A;  3T3O A;  2WDR B;  1MHH E;  3AEE B;  1WRI A;  4HKZ E;  2WXK A;  2W82 A;  2DYM A;  3ZQ4 A;  2WXP A;  1YN3 A;  4OHJ A;  4KX6 B;  4YSX B;  3AEB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...