2IDYA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
b'APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2idyA01
2IDYA 2GRIA 2M0AA
chains in the Genus database with same CATH superfamily
1TT5B 1YN3A 4GOCA 2QJLA 1OFFA 4DDGD 4FJZA 2GB1A 2BTEA 1S3SG 3S2AA 2KN5A 4KV2A 2C7MB 1ZPSA 4TQ1A 4PYUA 4AJWA 1SBBB 1J8CA 5FR3A 2KJHB 4A20A 2IGGA 3MC8A 1I4HA 1C3TA 5TSSA 5IN7A 3RULA 3Q8FA 1YMHE 1UWMA 3DHIC 2JT4B 3MJ5A 1XXGA 1L2NA 3DBLB 4RNAA 2GMIC 3X0WA 1WWTA 2NPTB 1TYGB 1UGMA 5DPRA 3IXSA 3PPAA 1DOXA 4IWQA 1WXVA 3MHSD 3RD2A 5EE3A 2JU6X 1XLOA 4DXFA 2PJHA 3ZW3A 2M8SA 3Q3MC 4HWIB 2BF8B 5E6NA 4N6EB 4GB9A 2OEDA 4MGKE 5C23A 1FIQA 3ECIA 1XLQA 2OJWA 3NJTA 3RMKC 2J7QB 1JWAD 1N63A 4KZ0A 1JWMD 1E7PB 3VUXA 1GJZA 3FKYA 2G1EA 3AB5A 3ONSA 3LB8C 4KKJA 4I6NB 1FEHA 4TSSA 1IP9A 1K52A 4WJPA 1YN5A 3ZNID 3OLMD 2BW2A 3PZDA 4DHZE 1V1OA 2JSVX 1J7AA 2LFIA 1Q0WB 1UGJA 3UIOB 3TL5A 3CSTA 2WXGA 1SIJA 3ML8A 2KQ7A 2CHZA 2MW5A 1UWXA 4GMVA 2KT7A 2D2QA 4FJVB 2Y5CA 3DBRI 2DX5B 3DBSA 1UUPA 4US9A 1WIAA 3AE9B 4H2AA 2IO0B 4WJQA 1WXQA 3AE5B 2FCSA 3N32A 2AX5A 3N1YC 4HCPB 2IDYA 5HFYA 4W9CA 2LEKA 3RPFC 2AL3A 4FN2A 4HROA 1SSNA 2BYVE 4MJSA 4HRSA 1VLBA 3RNEC 2BYFA 4JWSC 4R3DA 1OEYJ 2UYZB 1MPEA 2AQ3B 2L8JA 5MPOA 4UDUC 5G2NA 2ZPYA 3NY5A 2QCZA 1TS3A 4NAWB 4BKGA 2LUEA 1J7BA 3LDZE 3UINB 2HE7A 3AULA 3Q8BA 4OVZA 4JPSA 5EE9A 2K6DB 3ZJUA 1NI3A 2PKOA 1FXAA 3C0RB 1WYGA 3PRPB 4KDIC 4IDIA 2JRIB 1NENB 1N5XA 1DOIA 3X23A 4BBNF 1TY2A 3R7RA 4KZCA 2ZW0A 2OHFA 1N6ZA 1NBFC 4RGMA 2AYOB 3DVGX 2GBRA 2KOXA 3VR9B 2FUG1 1QOAA 2KTRB 2PE6B 1V5TA 4YT0B 2I2YA 1JALA 4B9KA 4ICUA 1K51A 3IG3A 3R8BA 5D94A 2LGDA 4DWFA 3ALBA 4EZKA 4GXBA 4M0WA 2DENB 1LXDA 4KVGB 5AUIA 4DXGA 2W3RA 4LTUA 3NVZA 4C4VB 4M00A 5AZFA 3A4SC 3APDA 2WXQA 3I3TB 1V9JA 4XGAB 1NI2A 4K3BA 3DVNV 2W3SA 3HRDD 4BBNC 2J4XA 2BKRB 3U4EG 1WE7A 4D2KA 1UH6A 4W9JA 3KVFB 1OTRB 2KLCA 2KHWB 2HDEA 4ZRIA 2JY6A 3Q6BA 5D3DA 3Q3FA 2GBMA 2M19A 3DBHI 4JIOU 5FR6A 1RLFA 2LASA 2V4IB 3DDCB 3HK0A 3RNBC 2X8XX 4YXDB 1TBEA 2O2VA 3QARA 3P1MA 2WP9B 1U4AA 1B9RA 4TMAB 3FILB 3W9CB 1K8RB 1WMHA 1JROA 1WXSA 2L3ZA 2GRIA 3R2IA 4WAFA 2LZ6A 2N9LA 4FLHA 4KKIA 2W54A 2NPTA 5JH5C 2CR5A 4KGRA 3UQAA 3H1UA 4OW0A 1YN4A 1RAXA 1C76A 3PV1A 3MFGA 1E8XA 3AECB 3MC9A 1TS4A 4NNJB 3OWEB 4OZCA 1GNUA 4TQ0A 1LGRA 4WIPA 1TKGA 2RDGA 2DZJA 2R61A 3WANA 3URYA 2N1VA 2V1YA 4XE0A 1UBQA 4N9F4 5E6OA 4RGNA 1C79A 1WRIA 4E71A 4KX6B 1ISNA 2YEPF 2DZIA 3L13A 4LNOA 1PUTA 4ZRQA 1P7FA 2HTME 4W9LA 2CU3A 1K53A 4HK2A 3DWMA 3AV8A 2FAZA 1ENFA 3AU5A 3H7SA 4EUTA 3VHTC 5EDSA 1XD3B 2DAFA 2KDMA 3BVMA 3L54A 4FBJB 1J7CA 3AEBB 3NVWA 4WQMA 2DWQA 2J0MA 4NJ7A 4IWOA 1FO4A 3P4SB 5HHDG 3ETRA 4REZA 1QQRA 2Z0DB 3AEDB 3SR6A 3EFCA 2GBKA 3AE7B 4N59A 4RM9A 2C9WB 4ZHPA 1WGHA 4AUQC 5DPWA 2ON8A 1V2YA 4ARIA 2AQ2B 3LXFA 4GDLB 3WCQA 4JLCA 2BKFA 1IUEA 2X38A 1ZXHA 4CHKA 1JWSD 2FIFA 3CMMB 5IO9A 3KYDD 5DCNA 4LDTD 3R2TA 2DAJA 2L52A 1QOBA 2MJEA 2ZEQA 3H6NA 1MG4A 4N58A 1WRDB 2QSDA 1YIWA 2WDVB 2A5UA 1F1HA 4MJSB 2XEWA 4P1BC 1QOGA 1T0YA 2CJOA 3RNGC 2K0PA 2NBUA 1FPYA 1VZ8A 4BOZB 3GE3C 2R2OA 1WGYA 2KC1A 1L5PA 2N7EA 3RZWC 2ACZB 1F2RC 2KTRA 2KZRA 1GB4A 1KLUD 3ZQ4A 3CSFA 3WAOA 5E6PA 2B3AA 3BIID 4XZ4A 2ASQA 2V0GA 2FE8A 2K8CA 1C4PA 3QIJA 1V80A 4W9HA 3BVGA 1LFDA 4OVUA 1LQBA 4IWPA 4ZOHC 2JUOA 3P42A 1D4BA 5BMGA 1B1ZA 3MJWA 3PO0A 2XK5A 4K3CA 1YD8U 2KK8A 3EUB2 4ANUA 2D3BA 5LNK1 2PLPA 1PGBA 5H8YE 2MX2A 1UD7A 4M01A 1R4MI 3PT2B 3GZNI 1ESFA 2MRPA 2KWVB 3BINA 3B9JA 1P0RA 4M0WB 2C60A 5C1ZA 3O65B 4P6VF 2H89B 2NTTA 3B2GA 3DBRB 5JHBA 2DNFA 1P98A 3TJPA 3H7PB 3AH7A 3NS8A 3Q3OC 3AXCA 4XWWA 1WJNA 3PZ7A 2JYTA 1HEZE 2FCNA 3TCAA 1HA5A 2KX0A 1TY0A 2UU7A 4YTNB 1I42A 2KKCA 1SXTA 2RDHA 3VXWA 3DCGA 2BS4B 3U30A 3BY4B 2DLBA 2BWES 4PT5A 2DYOA 5BYSA 3VVWB 3M62B 1C9FA 1M94A 2ONQA 2WGSA 4MELA 2IO2B 3NOBA 1J0GA 1R7SA 1ROEA 2GI9A 1TKEA 2PMVA 2O2VB 3HIZA 1ACCA 2KN4A 2MJDA 1KH0A 2I1JA 3V6EB 2MJ3A 2WU5B 2LVPA 4G3XB 3N1XC 1WMHB 3ZKJC 5LLIA 2LJ5A 1D3ZA 4EOYA 2KDBA 2WX1A 2YVCA 4AOFA 1RWSA 2DZKA 1XCTL 1C1YB 1KLVA 1VCBA 4WWOA 2WHIA 3KQ4A 5G5GA 3K9OB 4CYEA 1SE4A 2JVCA 1L7YA 2D5GA 1OQYA 1WX9A 5HKHA 2WXOA 1DGJA 1VRAB 2KDIA 4FHKA 3WIMA 3ABVB 1E7UA 3GE8C 1YQ3B 2PEAA 3P4QB 2BWFA 1YQBA 4BVUC 3A9JA 2MQJA 4CO7A 2KXJA 2KMAA 4ANXA 1NYRA 1T0SC 1HQRD 1LM8B 3W5UB 1E7VA 3RN9C 1Q1OA 3L08A 4DXAB 4JQWC 2IO1B 2MBOA 4II2B 2DBYA 1CQVA 1YJ1A 4B0MA 2IYDB 2KD0A 2JZZA 4BKSD 1TKYA 5FK9C 4XC2A 4HJKA 3TUOA 2REXA 3RNCC 3ZYYX 1ZE3D 4GDLA 2JF5A 3ENEA 3P2BA 2INDC 1FFVA 4W9FA 2WS3B 4HCNB 1WGGA 1I4GA 3R66C 4XDCA 2N0SB 2KWCA 4ZRJA 4B0EA 5CTRC 2NS5A 1WI0A 1E5WA 2D07B 1WXAA 2CU1A 1WR1A 3DBHB 2D3AA 3KYCD 2J42A 4BKSA 1XQQA 1MHXA 2JXTA 4EZJA 4GSWA 4KSLC 3FC4A 4L2YA 1SJHD 2K22A 2MH7A 3JSVA 1BT0A 1ZOYB 2DYMA 2D3CA 3A1QA 3PS6A 1CJEA 1XLNA 3RT3B 1XT9B 2KANA 2EKEC 2HJ1A 5IKCM 4YTPB 3NHEB 1MHHE 4S17A 4URKA 2BS2B 3ZDTA 2AL6A 3VDZA 3AE1B 2V9HA 2IJ0A 1WZ3A 1WM2A 4RH6A 4DHJB 3OG5A 2NBWB 4IM2A 1ZGUB 1M4VA 2LUMA 3A4RA 3IAM1 2JX5A 1WGRA 4LK0M 4PS3A 1GG3A 4BAXA 1QT9A 1ZP0B 5JXVA 4LCDE 3SEBA 2WU2B 1ET9A 2LD9A 1E8ZA 1QLBB 1E8WA 1IGCA 5C2TB 3UQBA 3DBLI 5HI1A 3N20C 3ZRFA 2FIDA 1JMLA 3WAPA 3BYYB 2H88B 4MM3A 4WH4A 2KDEB 2ZPNA 2LHEA 3NZSA 4LDTB 5D6JB 2JRHA 4A6QA 2UWQA 1FRDA 4RF1A 1AARA 1P9DU 3TEXA 3IFWB 3Q69A 1T0RC 2A4ZA 3B2FA 5EE0A 4A90A 3KWVA 4HKZE 1AYFA 1VDVA 3H7PA 2MWSB 2WXPA 3AE3B 3C8YA 3B08A 3QX1A 3W2DA 3ZLZA 1FCCC 1D5ZC 3APCA 3AN1A 2KX3A 1TIFA 3TBLD 1Z2MA 2XK5B 1NYQA 3RZFA 3DWGC 2J0JA 1RFAA 1IBXA 2YEPB 3Q2AC 2KJRA 2MHJA 1Q5WB 2E6XA 2HD5B 1YJIA 1NEKB 1E8YA 1EWCA 1N60A 3U52E 4BKTA 4USAA 1A70A 4G11A 4PK1A 4GLSC 3SFEB 1L6UA 4C7YA 3TEYA 3EA6A 1QOFA 3DVNU 3RYTA 2GBNA 4FJYA 4MGZE 2L00B 3KLSX 4KSKC 2WQYB 3HHMA 1WH3A 2NVUI 4P1CC 4K1RB 3Q3JA 5IP4D 2N9PC 3NVYA 1WFYA 4JGHB 1PQSA 3VRBB 2L0FA 3E56A 3VTWA 2JYEA 4WWNA 4KGTA 3A33B 1LO5D 4MACA 4WAAA 1F77A 3RNAC 3QJZA 1KFYB 2JZPA 1QKZA 3NVVA 4RGTA 4ICVA 2BVCA 1MG8A 2I38A 1V49A 3M63B 4A3PA 2MBHA 2PW9A 4NPNA 2QILA 1KRHA 2M0AA 3VTUA 4NZLB 1S1QB 3GP7A 4ACFA 3GB1A 5DPSA 1SF0A 1T5XD 3SD5A 4HLEA 1H8CA 1SE2A 1EM7A 3EC8A 4O1NA 3KUDB 5CHFA 1VZ7A 4JL9A 4KDLB 5D2MB 3PLVA 2JXXA 1E90A 4G0NB 3LJ3A 1SE9A 1HTQA 4M02A 5BO4B 3VQIA 1R4NI 2CJNA 4NY0A 2IGDA 3LYYA 3HVDA 1JRUA 3GZNB 2BS3B 3L17A 3P4PB 2C7HA 3A9JB 5CHWA 2ZW1A 1MJDA 4RM8A 4NAMA 3UF8A 1FFUA 2RPVA 4JX1C 3DQVA 3ZXVA 3EGRA 4DHJD 3RUIB 3ZJTA 2DYBA 5D7GA 3VFKA 3L10B 1MFWA 2WXHA 1GAQB 4WJNA 2QMTA 5E6JA 2QDFA 1VR9A 2RDBC 4C80A 3QWZB 2WXJA 2L76A 4HEA1 4BOSC 3BK1A 3Q8AA 3TMPB 4YSYB 1WE6A 2VH2A 2WDRB 2INCC 3P4RB 3SU8X 1WY8A 2ICIA 4A9AA 1SB3C 2N9KA 5CX3A 1VZ6A 3UI3A 4ASWC 3TIXA 2MBEA 5AZHA 3I5JC 1L0XB 2LGSA 1VD2A 3Q3NC 1MI0A 4MH8A 1SE3A 1I35A 3M3JA 2WLBA 3ZTDA 2AQ1B 3JSVB 3H9DA 3KWLA 3ML9A 3CF6E 1I7HA 3A1QB 3QK0A 3MTNB 3ZUNA 1EWYC 1BUIC 2K3UA 3I57A 1YOVB 4XYCA 3JYUA 3VR8B 1FM0D 1OEYA 2N7JA 1IYFA 2L0TA 1V86A 2KLGA 4J3OD 4HDQA 2Z0EB 3AE8B 4PS8A 1HZ5A 2PPHA 4EZLA 1P3QU 3A9KA 3PLUA 3I9V1 3ZVVA 4GIVA 2IZVB 2WDTB 1X1MA 4NJCA 1I4XA 1WYWB 2Y3AA 2PIAA 3M95A 5GXGB 1V97A 1I4QA 5AZGA 2WXRA 3BZDB 4ZDVA 3VRAB 2WXIA 4MM3B 1XLPA 1SGHA 3U2SC 1YQ4B 2INPE 2LVOA 1JCKB 3PHWB 3KH0A 2WXFA 3NG0A 2MCNB 1E10A 2CHWA 3AE2B 4WWPA 4FADA 5FKAC 3N3KB 3V05A 4II3B 2WXNA 1WR6E 4GDKA 4IM3A 2EELA 2LMCA 3IAS1 2RSUA 2WWZA 3EECA 1ET6A 1AWDA 5CHVC 1N5WA 2M17A 2HJ8A 2SAKA 3AEGB 4LJOB 2IPKD 1JQ4A 3V3XA 1WXMA 3QC8B 4RGOS 5TR5A 2LRWA 1AN8A 4DBGA 4W9GA 2GLSA 4OZBA 3Q14C 4M8MA 1HXYD 1TS5A 4AS1A 1XF5L 3ZNGC 5LXIB 1IBXB 1V8CA 4MGYE 2DZMA 1N61A 3PRZA 4K7SA 2TSSA 4GN1A 4PS7A 2NCNA 2EKIA 3NUHB 3UGBB 3SDLC 4RFBA 5L95C 1NVID 3R7QA 2O6VB 4GU2A 1D6EC 3NRZA 2K39A 3CIRB 1KLGD 1D5MC 3NS1A 2WX0A 2KACA 3AM9A 3ZTCA 2NBVB 1T6BX 1Z5SB 2Q5WD 5H92C 2EMTA 2K8BA 3DHGC 1GOZA 2WXKA 5J18A 1RFKA 4G50A 5HG2A 2KMMA 3PGEA 4AP4C 4HKQA 3RNFC 3T8MA 1C4CA 4NQKE 1TJEA 4I6LB 4DHZB 1XO3A 3V6CB 1QF6A 4YSXB 1E9MA 2L32A 3D32A 1BMLC 1OQQA 4L23A 4BZAA 3H8HA 4JE3B 2N4FA 1PGAA 3PHXB 4IUMB 2XNAC 1H4RA 4KGSA 2HTHA 1WGKA 2KAJA 1JWBD 3J9CA 2FCQA 3RFZB 3WALA 3U7DA 3L4PA 2WXLA 3RCZA 2W9NA 3K9PB 4QAYA 1T0QC 4F1SA 1GC6A 4KIKA 3MP9A 4FULA 5BYQA 2L1AA 3HUIA 2RR9A 1Y56A 1C77A 1N62A 1QILA 1FNWA 3OJ3A 2AEHA 3TSSA 4A8XC 3V62A 2KWDA 1FD6A 1AW7A 1FNVA 3EFUA 5KHOA 2ZNVB 3N30A 4LNIA 3ZNHB 1UZXB 2YLMA 4OVVA 2KMCA 3VH4B 1FRRA 2L7RA 4HVBA 2MBBB 2PVOD 1JWUD 2V4LA 1YJJA 1K50A 2M1MA 2J52A 1TTNA 3BWUD 2C5LC 4PYZA 3PTFC 1HTOA 3MC0B 3VTVA 3KUCB 2ZZPB 1OGWA 2FCMA 2LGXA 3W5VB 1DYQA 4ZHOA 1IPGA 2NR2A 1MVKA 2AWTA 3FAHA 3N1ZC 3QQ8B 1SEBD 3AMZA 2OJRA 4RCOA 5L83A 2ZVOA 2PTLA 2MEKA 1I4RA 1WX8A 2VZKB 1D5XC 2ZCCA 4YSZB 1WM3A 1FXIA 2LGIA 1CK1A 1F9JA 5C3JB 3AI5A 1PYWD 4MH0E 1YNTE 3PSEB 3IT4B 1G6JA 1ZDXA 3BYTB 2BQQA 3DVGY 1PGXA 3AEFB 3N9YC 2D11A 1WJUA 1L4ZB 2MP2A 1TGZB 2K1FA 3C19A 1E0ZA 4EE2A 4MDKE 3MHZA 4EKUA 3PZ8A 1C78A 4W9KA 1V1PA 4J6IA 2J0KA 3IVFA 2V3NA 4YWGG 5I4DA 1PDXA 2V3SA 1VJKA 3A9KB 2MA9B 3Q8EA 1WZ0A 2G3QB 1KJTA 2KYWA 2OOBB 4HXDA 4AQ7A 1YX6B 1PFDA 3RI7C 1SIFA 1ZKHA 1R4NB 2O6VD 2KQSA 2JPHA 3V60A 1FMAD 1SJED 2JWZA 4LJPB 3BK2A 1EF1A 2K5PA 4LLGM 2XBBC 5LXHA 4HPPA 2LXCA 2WXMA 3WAMA 2M0XA 2BGFA 1WJ6A 3O13A 1L0VB 1DOYA 3TEWA 3HVZA 3ZDMC 2LGYA 2ZCBA 2RD0A 1UELA 2INNE 1HZ6A 1L0YB 2NMQA 2KFKA 1EU4A 3DOWA 2WNMA 2K6QA 4FHJA 3ZIMA 4GDKB 1GC7A 2BT6A 1GPXA 2O6VA 2N1WA 2ZNVC 4US8A 4LNKA 1L4DB 2M4NA 3GOEA 5J17A 3JW0X 3L0WB 4MGIE 2JWUA 1P7EA 1V81A 1ZW7A 2LVQA 1GUAB 4ANVA 4P16A 4IG7B 2N9XA 3UIPB 2QC8A 2CHXA 3HM3A 3W1SC 1F0ZA 2ZVNA 3ZXRA 2RPQA 3EHVA 4ZRPA 2KWUB 3NZ3A 2QEJC 4MEMA 2G45B 5IA7A 4K7WA 5AEKB 3PVLA 2B76B 3TEZA 1C4AA 2L83A 2Y5BB 4ZYNA 5T8IA 3KW5B 4HPMB 1L6VA 4B6WA 3ZO5B 2BB6A 2MBQA 1XEEA 4OHJA 4P7IA 4ZRKA 2KNBA 2IY1B 4RMAA 5BYRA 4IC7B 4K81A 1E6EB 3T3NA 2LJIA 3ZNZB 4C56C 1XCQL 3QCAA 3IT6B 1NDDA 1WJ4A 4F8CB 3AE6B 1Y8RC 1RM6C 1HE8A 2BPSA 4S0RA 4ARCA 1YX5B 4DQOC 1TZOA 5G5HA 1ZUD2 1CMXB 4IM0A 2BYEA 3SHQA 2PVGC 2L05A 4LNFA 4RF0A 1STEA 1F52A 4W9IA 2JQRB 2EMSA 2Y5PA 2IBIB 1UF0A 5JHAA 1IGDA 2BBCA 3E9SA 5GMVA 2W82A 4WURA 2KQ4X 3I63C 4W9DA 4F7ZA 2DHZA 1V5OA 2K8HA 1BXTA 2BYTA 2G4DB 4HJGE 2D3GA 1R4MB 2IGHA 4YTMB 2G4SA 5D3IB 4ZYSA 1ZDVA 2PE9A 2RMMA 2GBJA 4K7UA 1J19A 1UNSA 5AUKA 1OQRA 3ZJVA 2LI5A 1EU3A 1EUVB 2V3PA 3B0AA 1WGDA 4XWTA 1TZ1A 1WX7A 5DPTA 1CZPA 2VZKD 4FXCA 1T3QA 2W55A 4KIKB 3HM6X 3QHTA 3PREA 3NZUA 2I1KA 2LWPA 4GGQA 3W1SA 1QZEA 3U7ZA 4NJ6A 2LXAA 2M56B 4HDOA 4XDDA 1JW9D 2KVRA 3JVZX 3AEEB 4WQOB 3ZGZA 2LRUA 3VAWA 1RRBA 3BVZA 3VUWA 4AJYB 2KTFA 4A55A 4EEWA 4ITKA 1ZXIA 3VH3B 3VUYA 3R3MA 2KDFB 1JRPA 1TS2A 2J53A 3ZRCA 4NAWA 4CQNA 3WA0A 3L16A 4XX5A 2QHOA 4I6PA 3W1YA 4LNNA 2IO3B 4B95A 2NTSA 3GS2A 3B1LX 2FUHB 4FA6A 4WJOA 3OAWA 3DPDA 4BFRA 2MSED 2CKHB 4NQLB 4L1BA 2KO3A 3T3OA 3SFDB 1F2RI 4C7ZA 3T9LA 1GB1A 2JZ3B 2KVZA 3AE4B 1KF6B 2IY0B 2Z59B 3OJ4B 2FNJB 4MSMB 3QAQA 5IOIA 5BMHA 4E74A 2KFJA 4M8NA 2KC2A 1KOTA 4X57B 4IOIE 3QA8A 4IW0A 4TKNA 1FCLA 3IHPC 5IAAC 4TV3A 3V61A 1P1AA 4AWJA 2MP2B 3CWIA 4JWUC 4C4VA 2K25A 1KTKA 1EO6A 2BB5A 5J2RA 1V1PB 2R2QA 2KJ6A 3AU4A 2SEBD 2G9HD 3APFA 4Q2JA 1EF5A 5JZEB 5KHQA 4OZAA 2WYQA 2K9XA 1A5RA 4DK5A 3PRMB 3U8ZA 1V6EA 4HPLB 2GOWA 3DHHC 4YL8A 4WWMA 1I4PA 4W9EA 2XN9C 1WSPA 4ANWA 1Q10A 3Q8CA 2WDQB 4TUUA 2RGFA 5EE1A 2D10A 2Z8LA 5G55A 2E3TA 2QIEB 1UBIA 3KUZA 3FILA 3IBEA 1WF9A 4A3OA 4DDID 5BMIA 2C7NB 4C00A 4MT5A 4EFOA 2VH1A 2CS4A 4IKGA 4MSQB 1KM7A 2KFKB 2LHDA 1FNUA 2N9EB 3AEAB 2ZJDA 2VRRB 3P63A 1RYJA 2FBWB 2MLBA 4E3CA 1FXTB 2N7DA
chains in the Genus database with same CATH topology
1YN3A 2L52A 1QOBA 1OFFA 2MJEA 2QJLA 2GB1A 2BTEA 4N58A 3W5VB 1DYQA 3NVYA 4ZHOA 2QSDA 2WDVB 1ZPSA 4TQ1A 3VRBB 1MVKA 3E56A 3FAHA 1SBBB 2JYEA 1SEBD 1QOGA 3AMZA 4RCOA 2CJOA 2K0PA 5FR3A 1VZ8A 2PTLA 2MEKA 1I4RA 2IGGA 4KGTA 1L5PA 1LO5D 1I4HA 4MACA 1F77A 1D5XC 2VZKB 5TSSA 4YSZB 1KFYB 1FXIA 2LGIA 3Q8FA 2JZPA 1YMHE 1UWMA 1QKZA 1CK1A 2ACZB 1F2RC 3NVVA 4RGTA 5C3JB 1GB4A 1PYWD 1KLUD 3MJ5A 1XXGA 1YNTE 3IT4B 1ZDXA 4RNAA 3ZQ4A 2I38A 3BYTB 1WWTA 2PW9A 1PGXA 3AEFB 3N9YC 2QILA 1KRHA 1TYGB 2M0AA 1L4ZB 3BIID 4NZLB 3GP7A 2V0GA 3IXSA 1E0ZA 4EE2A 1DOXA 3GB1A 1SF0A 1T5XD 3MHZA 5EE3A 2FE8A 3PZ8A 2JU6X 1C4PA 1XLOA 1C78A 4DXFA 1V1PA 2V3NA 4N6EB 1SE2A 1EM7A 4YWGG 5I4DA 4O1NA 2OEDA 1PDXA 3BVGA 4ZOHC 1VJKA 1FIQA 1VZ7A 3P42A 1XLQA 3Q8EA 1D4BA 5BMGA 1JWAD 1N63A 1B1ZA 1JWMD 1E7PB 4AQ7A 3PO0A 1PFDA 2G1EA 3EUB2 3AB5A 5LNK1 2PLPA 3LB8C 4KKJA 1PGBA 5H8YE 3VQIA 2CJNA 1FMAD 1FEHA 1SJED 2IGDA 3LYYA 3HVDA 4TSSA 1K52A 1YN5A 3BK2A 2K5PA 2BS3B 4LLGM 2BW2A 1ESFA 3P4PB 2ZW1A 1V1OA 2WXMA 2JSVX 1J7AA 2LFIA 4NAMA 3B9JA 1FFUA 2RPVA 4JX1C 1UGJA 3O13A 1L0VB 3EGRA 4P6VF 2H89B 1DOYA 3ZJTA 3TEWA 3HVZA 2NTTA 5D7GA 2WXGA 1SIJA 3B2GA 1UWXA 2WXHA 1GAQB 2Y5CA 2INNE 1HZ6A 1L0YB 2NMQA 2QMTA 3AH7A 5E6JA 1EU4A 1VR9A 1UUPA 4C80A 4US9A 2WXJA 2WNMA 3AE9B 4GDKB 4H2AA 2BT6A 4XWWA 1GPXA 1WXQA 3AE5B 3PZ7A 4HEA1 2AX5A 2JYTA 4US8A 3BK1A 1L4DB 1HEZE 3Q8AA 4YSYB 1HA5A 2IDYA 2WDRB 5HFYA 1TY0A 2LEKA 2JWUA 3P4RB 1P7EA 3RPFC 2ICIA 4A9AA 4HROA 1SB3C 4YTNB 1SSNA 2N9KA 4P16A 1SXTA 2RDHA 4HRSA 2BS4B 1VZ6A 2DLBA 3UI3A 1VLBA 4PT5A 2DYOA 4JWSC 5BYSA 4R3DA 1F0ZA 1C9FA 1L0XB 1MPEA 2AQ3B 4ZRPA 2ONQA 1MI0A 4MH8A 5MPOA 4UDUC 3NZ3A 1SE3A 2QEJC 1R7SA 2B76B 3TEZA 1C4AA 2L83A 1ROEA 5T8IA 2GI9A 1TKEA 1L6VA 2WLBA 2PMVA 1TS3A 1ACCA 2AQ1B 2KN4A 2MJDA 1KH0A 4NAWB 2BB6A 1XEEA 2MJ3A 2WU5B 3KWLA 1J7BA 4OHJA 1I7HA 3Q8BA 5BYRA 4OVZA 1EWYC 4JPSA 5EE9A 1E6EB 1BUIC 2K3UA 3I57A 3T3NA 3VR8B 1FM0D 2N7JA 1RWSA 3ZJUA 1NI3A 2LJIA 2PKOA 1FXAA 4J3OD 4C56C 1XCQL 3IT6B 1XCTL 1WYGA 3AE8B 1HZ5A 4IDIA 1NENB 1N5XA 3AE6B 1DOIA 3KQ4A 3I9V1 5G5GA 1RM6C 1TY2A 4ARCA 4DQOC 2ZW0A 1TZOA 2OHFA 1SE4A 5G5HA 1ZUD2 4NJCA 1I4XA 2D5GA 2Y3AA 4RGMA 2PIAA 2WXOA 1DGJA 1VRAB 3VR9B 2PVGC 2FUG1 1QOAA 5GXGB 4RF0A 1V97A 3ABVB 1STEA 1I4QA 2JQRB 4YT0B 2WXRA 2Y5PA 3BZDB 2I2YA 1JALA 1YQ3B 1IGDA 3P4QB 1K51A 2BBCA 3VRAB 3E9SA 2W82A 4WURA 2KQ4X 2WXIA 3R8BA 4MM3B 1XLPA 1BXTA 2BYTA 3U2SC 1YQ4B 2INPE 2IGHA 4HJGE 4M0WA 4YTMB 1JCKB 5D3IB 2WXFA 1E10A 1NYRA 1ZDVA 1HQRD 4ZYSA 3AE2B 2RMMA 5AUIA 3W5UB 2W3RA 4DXGA 1UNSA 4LTUA 5FKAC 5AUKA 1OQRA 3V05A 3NVZA 2DBYA 1CQVA 4B0MA 3ZJVA 2WXNA 1EU3A 2WXQA 2V3PA 2EELA 2LMCA 1TKYA 5FK9C 3TUOA 4XWTA 3IAS1 3ZYYX 1ET6A 1ZE3D 1AWDA 2W3SA 1N5WA 3HRDD 2SAKA 2J4XA 1CZPA 2VZKD 1FFVA 3AEGB 3U4EG 4FXCA 1T3QA 2WS3B 2W55A 2IPKD 4D2KA 1JQ4A 3V3XA 4RGOS 1I4GA 3W1SA 4XDCA 1AN8A 2N0SB 3U7ZA 4OZBA 4B0EA 1HXYD 1TS5A 2M56B 4AS1A 1XF5L 4XDDA 2HDEA 1JW9D 3AEEB 3ZGZA 5D3DA 2M19A 2J42A 1IBXB 1V8CA 3BVZA 2V4IB 1N61A 2TSSA 4A55A 1MHXA 4ITKA 1ZXIA 2EKIA 2JXTA 4YXDB 3NUHB 3FC4A 4L2YA 1JRPA 1TS2A 1SJHD 2K22A 2MH7A 3P1MA 2WP9B 2J53A 4RFBA 1NVID 4CQNA 1B9RA 4TMAB 3FILB 1ZOYB 2DYMA 3W9CB 1D6EC 3NRZA 1JROA 1CJEA 3CIRB 1XLNA 2GRIA 1KLGD 3R2IA 1D5MC 4WAFA 4YTPB 1MHHE 2N9LA 4KKIA 2W54A 2BS2B 3NS1A 2NTSA 3GS2A 4KGRA 2KACA 3AE1B 3AM9A 4OW0A 2IJ0A 1YN4A 1T6BX 4RH6A 1C76A 2Q5WD 5H92C 3MFGA 1GOZA 2WXKA 1M4VA 2LUMA 3IAM1 1RFKA 3AECB 2JX5A 4L1BA 1TS4A 4LK0M 3T3OA 5HG2A 2KMMA 3SFDB 1F2RI 4C7ZA 3OWEB 1GB1A 4OZCA 1QT9A 1ZP0B 5JXVA 3SEBA 4TQ0A 2WU2B 4HKQA 4WIPA 1C4CA 3AE4B 1ET9A 1TKGA 2RDGA 1KF6B 2R61A 1QLBB 1IGCA 1TJEA 5C2TB 5HI1A 3URYA 1XO3A 4XE0A 1JMLA 3BYYB 1QF6A 4YSXB 2H88B 5BMHA 1E9MA 4WH4A 4RGNA 1C79A 1WRIA 4KX6B 4IOIE 2L32A 2YEPF 2LHEA 1BMLC 1FCLA 4A6QA 1PUTA 1OQQA 4L23A 1FRDA 1P7FA 4ZRQA 4RF1A 2HTME 3H8HA 4JE3B 3TEXA 1PGAA 2CU3A 1K53A 2XNAC 3CWIA 3DWMA 3AV8A 4JWUC 3Q69A 4KGSA 1WGKA 1KTKA 2BB5A 2KAJA 1ENFA 1JWBD 3B2FA 3J9CA 3RFZB 5EE0A 4A90A 3KWVA 4HKZE 3L4PA 1AYFA 1VDVA 1V1PB 2KDMA 2WXLA 3BVMA 2SEBD 2G9HD 2WXPA 4Q2JA 1J7CA 3AEBB 3AE3B 3C8YA 3MP9A 4OZAA 5BYQA 2L1AA 3NVWA 2K9XA 4WQMA 2DWQA 3W2DA 1FO4A 1FCCC 1D5ZC 3P4SB 3HUIA 3AN1A 5HHDG 3ETRA 4REZA 1NYQA 3DWGC 1Y56A 4WWMA 1C77A 1I4PA 1N62A 1FNWA 1QILA 2XN9C 1IBXA 1QQRA 2YEPB 3AEDB 3SR6A 1WSPA 2E6XA 3TSSA 4A8XC 1Q10A 1YJIA 1NEKB 2KWDA 3Q8CA 2WDQB 1FD6A 1AW7A 1EWCA 1FNVA 1N60A 3AE7B 4N59A 5EE1A 2Z8LA 2E3TA 3U52E 2QIEB 4USAA 1A70A 4ZHPA 3FILA 4GLSC 5BMIA 1FRRA 1L6UA 3SFEB 4C7YA 3TEYA 2ON8A 4MT5A 3EA6A 4ARIA 2AQ2B 4IKGA 1QOFA 3LXFA 4GDLB 2LHDA 1FNUA 3WCQA 2PVOD 1JWUD 3AEAB 1YJJA 1K50A 2J52A 3P63A 1IUEA 1RYJA 2FBWB 2X38A 1ZXHA 1JWSD 3KLSX 3BWUD 2WQYB 3MC0B 3R2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDY A;  2GRI A;  2M0A A; 
#chains in the Genus database with same CATH topology
 1TT5 B;  1YN3 A;  4GOC A;  2QJL A;  1OFF A;  4DDG D;  4FJZ A;  2GB1 A;  2BTE A;  1S3S G;  3S2A A;  2KN5 A;  4KV2 A;  2C7M B;  1ZPS A;  4TQ1 A;  4PYU A;  4AJW A;  1SBB B;  1J8C A;  5FR3 A;  2KJH B;  4A20 A;  2IGG A;  3MC8 A;  1I4H A;  1C3T A;  5TSS A;  5IN7 A;  3RUL A;  3Q8F A;  1YMH E;  1UWM A;  3DHI C;  2JT4 B;  3MJ5 A;  1XXG A;  1L2N A;  3DBL B;  4RNA A;  2GMI C;  3X0W A;  1WWT A;  2NPT B;  1TYG B;  1UGM A;  5DPR A;  3IXS A;  3PPA A;  1DOX A;  4IWQ A;  1WXV A;  3MHS D;  3RD2 A;  5EE3 A;  2JU6 X;  1XLO A;  4DXF A;  2PJH A;  3ZW3 A;  2M8S A;  3Q3M C;  4HWI B;  2BF8 B;  5E6N A;  4N6E B;  4GB9 A;  2OED A;  4MGK E;  5C23 A;  1FIQ A;  3ECI A;  1XLQ A;  2OJW A;  3NJT A;  3RMK C;  2J7Q B;  1JWA D;  1N63 A;  4KZ0 A;  1JWM D;  1E7P B;  3VUX A;  1GJZ A;  3FKY A;  2G1E A;  3AB5 A;  3ONS A;  3LB8 C;  4KKJ A;  4I6N B;  1FEH A;  4TSS A;  1IP9 A;  1K52 A;  4WJP A;  1YN5 A;  3ZNI D;  3OLM D;  2BW2 A;  3PZD A;  4DHZ E;  1V1O A;  2JSV X;  1J7A A;  2LFI A;  1Q0W B;  1UGJ A;  3UIO B;  3TL5 A;  3CST A;  2WXG A;  1SIJ A;  3ML8 A;  2KQ7 A;  2CHZ A;  2MW5 A;  1UWX A;  4GMV A;  2KT7 A;  2D2Q A;  4FJV B;  2Y5C A;  3DBR I;  2DX5 B;  3DBS A;  1UUP A;  4US9 A;  1WIA A;  3AE9 B;  4H2A A;  2IO0 B;  4WJQ A;  1WXQ A;  3AE5 B;  2FCS A;  3N32 A;  2AX5 A;  3N1Y C;  4HCP B;  2IDY A;  5HFY A;  4W9C A;  2LEK A;  3RPF C;  2AL3 A;  4FN2 A;  4HRO A;  1SSN A;  2BYV E;  4MJS A;  4HRS A;  1VLB A;  3RNE C;  2BYF A;  4JWS C;  4R3D A;  1OEY J;  2UYZ B;  1MPE A;  2AQ3 B;  2L8J A;  5MPO A;  4UDU C;  5G2N A;  2ZPY A;  3NY5 A;  2QCZ A;  1TS3 A;  4NAW B;  4BKG A;  2LUE A;  1J7B A;  3LDZ E;  3UIN B;  2HE7 A;  3AUL A;  3Q8B A;  4OVZ A;  4JPS A;  5EE9 A;  2K6D B;  3ZJU A;  1NI3 A;  2PKO A;  1FXA A;  3C0R B;  1WYG A;  3PRP B;  4KDI C;  4IDI A;  2JRI B;  1NEN B;  1N5X A;  1DOI A;  3X23 A;  4BBN F;  1TY2 A;  3R7R A;  4KZC A;  2ZW0 A;  2OHF A;  1N6Z A;  1NBF C;  4RGM A;  2AYO B;  3DVG X;  2GBR A;  2KOX A;  3VR9 B;  2FUG 1;  1QOA A;  2KTR B;  2PE6 B;  1V5T A;  4YT0 B;  2I2Y A;  1JAL A;  4B9K A;  4ICU A;  1K51 A;  3IG3 A;  3R8B A;  5D94 A;  2LGD A;  4DWF A;  3ALB A;  4EZK A;  4GXB A;  4M0W A;  2DEN B;  1LXD A;  4KVG B;  5AUI A;  4DXG A;  2W3R A;  4LTU A;  3NVZ A;  4C4V B;  4M00 A;  5AZF A;  3A4S C;  3APD A;  2WXQ A;  3I3T B;  1V9J A;  4XGA B;  1NI2 A;  4K3B A;  3DVN V;  2W3S A;  3HRD D;  4BBN C;  2J4X A;  2BKR B;  3U4E G;  1WE7 A;  4D2K A;  1UH6 A;  4W9J A;  3KVF B;  1OTR B;  2KLC A;  2KHW B;  2HDE A;  4ZRI A;  2JY6 A;  3Q6B A;  5D3D A;  3Q3F A;  2GBM A;  2M19 A;  3DBH I;  4JIO U;  5FR6 A;  1RLF A;  2LAS A;  2V4I B;  3DDC B;  3HK0 A;  3RNB C;  2X8X X;  4YXD B;  1TBE A;  2O2V A;  3QAR A;  3P1M A;  2WP9 B;  1U4A A;  1B9R A;  4TMA B;  3FIL B;  3W9C B;  1K8R B;  1WMH A;  1JRO A;  1WXS A;  2L3Z A;  2GRI A;  3R2I A;  4WAF A;  2LZ6 A;  2N9L A;  4FLH A;  4KKI A;  2W54 A;  2NPT A;  5JH5 C;  2CR5 A;  4KGR A;  3UQA A;  3H1U A;  4OW0 A;  1YN4 A;  1RAX A;  1C76 A;  3PV1 A;  3MFG A;  1E8X A;  3AEC B;  3MC9 A;  1TS4 A;  4NNJ B;  3OWE B;  4OZC A;  1GNU A;  4TQ0 A;  1LGR A;  4WIP A;  1TKG A;  2RDG A;  2DZJ A;  2R61 A;  3WAN A;  3URY A;  2N1V A;  2V1Y A;  4XE0 A;  1UBQ A;  4N9F 4;  5E6O A;  4RGN A;  1C79 A;  1WRI A;  4E71 A;  4KX6 B;  1ISN A;  2YEP F;  2DZI A;  3L13 A;  4LNO A;  1PUT A;  4ZRQ A;  1P7F A;  2HTM E;  4W9L A;  2CU3 A;  1K53 A;  4HK2 A;  3DWM A;  3AV8 A;  2FAZ A;  1ENF A;  3AU5 A;  3H7S A;  4EUT A;  3VHT C;  5EDS A;  1XD3 B;  2DAF A;  2KDM A;  3BVM A;  3L54 A;  4FBJ B;  1J7C A;  3AEB B;  3NVW A;  4WQM A;  2DWQ A;  2J0M A;  4NJ7 A;  4IWO A;  1FO4 A;  3P4S B;  5HHD G;  3ETR A;  4REZ A;  1QQR A;  2Z0D B;  3AED B;  3SR6 A;  3EFC A;  2GBK A;  3AE7 B;  4N59 A;  4RM9 A;  2C9W B;  4ZHP A;  1WGH A;  4AUQ C;  5DPW A;  2ON8 A;  1V2Y A;  4ARI A;  2AQ2 B;  3LXF A;  4GDL B;  3WCQ A;  4JLC A;  2BKF A;  1IUE A;  2X38 A;  1ZXH A;  4CHK A;  1JWS D;  2FIF A;  3CMM B;  5IO9 A;  3KYD D;  5DCN A;  4LDT D;  3R2T A;  2DAJ A;  2L52 A;  1QOB A;  2MJE A;  2ZEQ A;  3H6N A;  1MG4 A;  4N58 A;  1WRD B;  2QSD A;  1YIW A;  2WDV B;  2A5U A;  1F1H A;  4MJS B;  2XEW A;  4P1B C;  1QOG A;  1T0Y A;  2CJO A;  3RNG C;  2K0P A;  2NBU A;  1FPY A;  1VZ8 A;  4BOZ B;  3GE3 C;  2R2O A;  1WGY A;  2KC1 A;  1L5P A;  2N7E A;  3RZW C;  2ACZ B;  1F2R C;  2KTR A;  2KZR A;  1GB4 A;  1KLU D;  3ZQ4 A;  3CSF A;  3WAO A;  5E6P A;  2B3A A;  3BII D;  4XZ4 A;  2ASQ A;  2V0G A;  2FE8 A;  2K8C A;  1C4P A;  3QIJ A;  1V80 A;  4W9H A;  3BVG A;  1LFD A;  4OVU A;  1LQB A;  4IWP A;  4ZOH C;  2JUO A;  3P42 A;  1D4B A;  5BMG A;  1B1Z A;  3MJW A;  3PO0 A;  2XK5 A;  4K3C A;  1YD8 U;  2KK8 A;  3EUB 2;  4ANU A;  2D3B A;  5LNK 1;  2PLP A;  1PGB A;  5H8Y E;  2MX2 A;  1UD7 A;  4M01 A;  1R4M I;  3PT2 B;  3GZN I;  1ESF A;  2MRP A;  2KWV B;  3BIN A;  3B9J A;  1P0R A;  4M0W B;  2C60 A;  5C1Z A;  3O65 B;  4P6V F;  2H89 B;  2NTT A;  3B2G A;  3DBR B;  5JHB A;  2DNF A;  1P98 A;  3TJP A;  3H7P B;  3AH7 A;  3NS8 A;  3Q3O C;  3AXC A;  4XWW A;  1WJN A;  3PZ7 A;  2JYT A;  1HEZ E;  2FCN A;  3TCA A;  1HA5 A;  2KX0 A;  1TY0 A;  2UU7 A;  4YTN B;  1I42 A;  2KKC A;  1SXT A;  2RDH A;  3VXW A;  3DCG A;  2BS4 B;  3U30 A;  3BY4 B;  2DLB A;  2BWE S;  4PT5 A;  2DYO A;  5BYS A;  3VVW B;  3M62 B;  1C9F A;  1M94 A;  2ONQ A;  2WGS A;  4MEL A;  2IO2 B;  3NOB A;  1J0G A;  1R7S A;  1ROE A;  2GI9 A;  1TKE A;  2PMV A;  2O2V B;  3HIZ A;  1ACC A;  2KN4 A;  2MJD A;  1KH0 A;  2I1J A;  3V6E B;  2MJ3 A;  2WU5 B;  2LVP A;  4G3X B;  3N1X C;  1WMH B;  3ZKJ C;  5LLI A;  2LJ5 A;  1D3Z A;  4EOY A;  2KDB A;  2WX1 A;  2YVC A;  4AOF A;  1RWS A;  2DZK A;  1XCT L;  1C1Y B;  1KLV A;  1VCB A;  4WWO A;  2WHI A;  3KQ4 A;  5G5G A;  3K9O B;  4CYE A;  1SE4 A;  2JVC A;  1L7Y A;  2D5G A;  1OQY A;  1WX9 A;  5HKH A;  2WXO A;  1DGJ A;  1VRA B;  2KDI A;  4FHK A;  3WIM A;  3ABV B;  1E7U A;  3GE8 C;  1YQ3 B;  2PEA A;  3P4Q B;  2BWF A;  1YQB A;  4BVU C;  3A9J A;  2MQJ A;  4CO7 A;  2KXJ A;  2KMA A;  4ANX A;  1NYR A;  1T0S C;  1HQR D;  1LM8 B;  3W5U B;  1E7V A;  3RN9 C;  1Q1O A;  3L08 A;  4DXA B;  4JQW C;  2IO1 B;  2MBO A;  4II2 B;  2DBY A;  1CQV A;  1YJ1 A;  4B0M A;  2IYD B;  2KD0 A;  2JZZ A;  4BKS D;  1TKY A;  5FK9 C;  4XC2 A;  4HJK A;  3TUO A;  2REX A;  3RNC C;  3ZYY X;  1ZE3 D;  4GDL A;  2JF5 A;  3ENE A;  3P2B A;  2IND C;  1FFV A;  4W9F A;  2WS3 B;  4HCN B;  1WGG A;  1I4G A;  3R66 C;  4XDC A;  2N0S B;  2KWC A;  4ZRJ A;  4B0E A;  5CTR C;  2NS5 A;  1WI0 A;  1E5W A;  2D07 B;  1WXA A;  2CU1 A;  1WR1 A;  3DBH B;  2D3A A;  3KYC D;  2J42 A;  4BKS A;  1XQQ A;  1MHX A;  2JXT A;  4EZJ A;  4GSW A;  4KSL C;  3FC4 A;  4L2Y A;  1SJH D;  2K22 A;  2MH7 A;  3JSV A;  1BT0 A;  1ZOY B;  2DYM A;  2D3C A;  3A1Q A;  3PS6 A;  1CJE A;  1XLN A;  3RT3 B;  1XT9 B;  2KAN A;  2EKE C;  2HJ1 A;  5IKC M;  4YTP B;  3NHE B;  1MHH E;  4S17 A;  4URK A;  2BS2 B;  3ZDT A;  2AL6 A;  3VDZ A;  3AE1 B;  2V9H A;  2IJ0 A;  1WZ3 A;  1WM2 A;  4RH6 A;  4DHJ B;  3OG5 A;  2NBW B;  4IM2 A;  1ZGU B;  1M4V A;  2LUM A;  3A4R A;  3IAM 1;  2JX5 A;  1WGR A;  4LK0 M;  4PS3 A;  1GG3 A;  4BAX A;  1QT9 A;  1ZP0 B;  5JXV A;  4LCD E;  3SEB A;  2WU2 B;  1ET9 A;  2LD9 A;  1E8Z A;  1QLB B;  1E8W A;  1IGC A;  5C2T B;  3UQB A;  3DBL I;  5HI1 A;  3N20 C;  3ZRF A;  2FID A;  1JML A;  3WAP A;  3BYY B;  2H88 B;  4MM3 A;  4WH4 A;  2KDE B;  2ZPN A;  2LHE A;  3NZS A;  4LDT B;  5D6J B;  2JRH A;  4A6Q A;  2UWQ A;  1FRD A;  4RF1 A;  1AAR A;  1P9D U;  3TEX A;  3IFW B;  3Q69 A;  1T0R C;  2A4Z A;  3B2F A;  5EE0 A;  4A90 A;  3KWV A;  4HKZ E;  1AYF A;  1VDV A;  3H7P A;  2MWS B;  2WXP A;  3AE3 B;  3C8Y A;  3B08 A;  3QX1 A;  3W2D A;  3ZLZ A;  1FCC C;  1D5Z C;  3APC A;  3AN1 A;  2KX3 A;  1TIF A;  3TBL D;  1Z2M A;  2XK5 B;  1NYQ A;  3RZF A;  3DWG C;  2J0J A;  1RFA A;  1IBX A;  2YEP B;  3Q2A C;  2KJR A;  2MHJ A;  1Q5W B;  2E6X A;  2HD5 B;  1YJI A;  1NEK B;  1E8Y A;  1EWC A;  1N60 A;  3U52 E;  4BKT A;  4USA A;  1A70 A;  4G11 A;  4PK1 A;  4GLS C;  3SFE B;  1L6U A;  4C7Y A;  3TEY A;  3EA6 A;  1QOF A;  3DVN U;  3RYT A;  2GBN A;  4FJY A;  4MGZ E;  2L00 B;  3KLS X;  4KSK C;  2WQY B;  3HHM A;  1WH3 A;  2NVU I;  4P1C C;  4K1R B;  3Q3J A;  5IP4 D;  2N9P C;  3NVY A;  1WFY A;  4JGH B;  1PQS A;  3VRB B;  2L0F A;  3E56 A;  3VTW A;  2JYE A;  4WWN A;  4KGT A;  3A33 B;  1LO5 D;  4MAC A;  4WAA A;  1F77 A;  3RNA C;  3QJZ A;  1KFY B;  2JZP A;  1QKZ A;  3NVV A;  4RGT A;  4ICV A;  2BVC A;  1MG8 A;  2I38 A;  1V49 A;  3M63 B;  4A3P A;  2MBH A;  2PW9 A;  4NPN A;  2QIL A;  1KRH A;  2M0A A;  3VTU A;  4NZL B;  1S1Q B;  3GP7 A;  4ACF A;  3GB1 A;  5DPS A;  1SF0 A;  1T5X D;  3SD5 A;  4HLE A;  1H8C A;  1SE2 A;  1EM7 A;  3EC8 A;  4O1N A;  3KUD B;  5CHF A;  1VZ7 A;  4JL9 A;  4KDL B;  5D2M B;  3PLV A;  2JXX A;  1E90 A;  4G0N B;  3LJ3 A;  1SE9 A;  1HTQ A;  4M02 A;  5BO4 B;  3VQI A;  1R4N I;  2CJN A;  4NY0 A;  2IGD A;  3LYY A;  3HVD A;  1JRU A;  3GZN B;  2BS3 B;  3L17 A;  3P4P B;  2C7H A;  3A9J B;  5CHW A;  2ZW1 A;  1MJD A;  4RM8 A;  4NAM A;  3UF8 A;  1FFU A;  2RPV A;  4JX1 C;  3DQV A;  3ZXV A;  3EGR A;  4DHJ D;  3RUI B;  3ZJT A;  2DYB A;  5D7G A;  3VFK A;  3L10 B;  1MFW A;  2WXH A;  1GAQ B;  4WJN A;  2QMT A;  5E6J A;  2QDF A;  1VR9 A;  2RDB C;  4C80 A;  3QWZ B;  2WXJ A;  2L76 A;  4HEA 1;  4BOS C;  3BK1 A;  3Q8A A;  3TMP B;  4YSY B;  1WE6 A;  2VH2 A;  2WDR B;  2INC C;  3P4R B;  3SU8 X;  1WY8 A;  2ICI A;  4A9A A;  1SB3 C;  2N9K A;  5CX3 A;  1VZ6 A;  3UI3 A;  4ASW C;  3TIX A;  2MBE A;  5AZH A;  3I5J C;  1L0X B;  2LGS A;  1VD2 A;  3Q3N C;  1MI0 A;  4MH8 A;  1SE3 A;  1I35 A;  3M3J A;  2WLB A;  3ZTD A;  2AQ1 B;  3JSV B;  3H9D A;  3KWL A;  3ML9 A;  3CF6 E;  1I7H A;  3A1Q B;  3QK0 A;  3MTN B;  3ZUN A;  1EWY C;  1BUI C;  2K3U A;  3I57 A;  1YOV B;  4XYC A;  3JYU A;  3VR8 B;  1FM0 D;  1OEY A;  2N7J A;  1IYF A;  2L0T A;  1V86 A;  2KLG A;  4J3O D;  4HDQ A;  2Z0E B;  3AE8 B;  4PS8 A;  1HZ5 A;  2PPH A;  4EZL A;  1P3Q U;  3A9K A;  3PLU A;  3I9V 1;  3ZVV A;  4GIV A;  2IZV B;  2WDT B;  1X1M A;  4NJC A;  1I4X A;  1WYW B;  2Y3A A;  2PIA A;  3M95 A;  5GXG B;  1V97 A;  1I4Q A;  5AZG A;  2WXR A;  3BZD B;  4ZDV A;  3VRA B;  2WXI A;  4MM3 B;  1XLP A;  1SGH A;  3U2S C;  1YQ4 B;  2INP E;  2LVO A;  1JCK B;  3PHW B;  3KH0 A;  2WXF A;  3NG0 A;  2MCN B;  1E10 A;  2CHW A;  3AE2 B;  4WWP A;  4FAD A;  5FKA C;  3N3K B;  3V05 A;  4II3 B;  2WXN A;  1WR6 E;  4GDK A;  4IM3 A;  2EEL A;  2LMC A;  3IAS 1;  2RSU A;  2WWZ A;  3EEC A;  1ET6 A;  1AWD A;  5CHV C;  1N5W A;  2M17 A;  2HJ8 A;  2SAK A;  3AEG B;  4LJO B;  2IPK D;  1JQ4 A;  3V3X A;  1WXM A;  3QC8 B;  4RGO S;  5TR5 A;  2LRW A;  1AN8 A;  4DBG A;  4W9G A;  2GLS A;  4OZB A;  3Q14 C;  4M8M A;  1HXY D;  1TS5 A;  4AS1 A;  1XF5 L;  3ZNG C;  5LXI B;  1IBX B;  1V8C A;  4MGY E;  2DZM A;  1N61 A;  3PRZ A;  4K7S A;  2TSS A;  4GN1 A;  4PS7 A;  2NCN A;  2EKI A;  3NUH B;  3UGB B;  3SDL C;  4RFB A;  5L95 C;  1NVI D;  3R7Q A;  2O6V B;  4GU2 A;  1D6E C;  3NRZ A;  2K39 A;  3CIR B;  1KLG D;  1D5M C;  3NS1 A;  2WX0 A;  2KAC A;  3AM9 A;  3ZTC A;  2NBV B;  1T6B X;  1Z5S B;  2Q5W D;  5H92 C;  2EMT A;  2K8B A;  3DHG C;  1GOZ A;  2WXK A;  5J18 A;  1RFK A;  4G50 A;  5HG2 A;  2KMM A;  3PGE A;  4AP4 C;  4HKQ A;  3RNF C;  3T8M A;  1C4C A;  4NQK E;  1TJE A;  4I6L B;  4DHZ B;  1XO3 A;  3V6C B;  1QF6 A;  4YSX B;  1E9M A;  2L32 A;  3D32 A;  1BML C;  1OQQ A;  4L23 A;  4BZA A;  3H8H A;  4JE3 B;  2N4F A;  1PGA A;  3PHX B;  4IUM B;  2XNA C;  1H4R A;  4KGS A;  2HTH A;  1WGK A;  2KAJ A;  1JWB D;  3J9C A;  2FCQ A;  3RFZ B;  3WAL A;  3U7D A;  3L4P A;  2WXL A;  3RCZ A;  2W9N A;  3K9P B;  4QAY A;  1T0Q C;  4F1S A;  1GC6 A;  4KIK A;  3MP9 A;  4FUL A;  5BYQ A;  2L1A A;  3HUI A;  2RR9 A;  1Y56 A;  1C77 A;  1N62 A;  1QIL A;  1FNW A;  3OJ3 A;  2AEH A;  3TSS A;  4A8X C;  3V62 A;  2KWD A;  1FD6 A;  1AW7 A;  1FNV A;  3EFU A;  5KHO A;  2ZNV B;  3N30 A;  4LNI A;  3ZNH B;  1UZX B;  2YLM A;  4OVV A;  2KMC A;  3VH4 B;  1FRR A;  2L7R A;  4HVB A;  2MBB B;  2PVO D;  1JWU D;  2V4L A;  1YJJ A;  1K50 A;  2M1M A;  2J52 A;  1TTN A;  3BWU D;  2C5L C;  4PYZ A;  3PTF C;  1HTO A;  3MC0 B;  3VTV A;  3KUC B;  2ZZP B;  1OGW A;  2FCM A;  2LGX A;  3W5V B;  1DYQ A;  4ZHO A;  1IPG A;  2NR2 A;  1MVK A;  2AWT A;  3FAH A;  3N1Z C;  3QQ8 B;  1SEB D;  3AMZ A;  2OJR A;  4RCO A;  5L83 A;  2ZVO A;  2PTL A;  2MEK A;  1I4R A;  1WX8 A;  2VZK B;  1D5X C;  2ZCC A;  4YSZ B;  1WM3 A;  1FXI A;  2LGI A;  1CK1 A;  1F9J A;  5C3J B;  3AI5 A;  1PYW D;  4MH0 E;  1YNT E;  3PSE B;  3IT4 B;  1G6J A;  1ZDX A;  3BYT B;  2BQQ A;  3DVG Y;  1PGX A;  3AEF B;  3N9Y C;  2D11 A;  1WJU A;  1L4Z B;  2MP2 A;  1TGZ B;  2K1F A;  3C19 A;  1E0Z A;  4EE2 A;  4MDK E;  3MHZ A;  4EKU A;  3PZ8 A;  1C78 A;  4W9K A;  1V1P A;  4J6I A;  2J0K A;  3IVF A;  2V3N A;  4YWG G;  5I4D A;  1PDX A;  2V3S A;  1VJK A;  3A9K B;  2MA9 B;  3Q8E A;  1WZ0 A;  2G3Q B;  1KJT A;  2KYW A;  2OOB B;  4HXD A;  4AQ7 A;  1YX6 B;  1PFD A;  3RI7 C;  1SIF A;  1ZKH A;  1R4N B;  2O6V D;  2KQS A;  2JPH A;  3V60 A;  1FMA D;  1SJE D;  2JWZ A;  4LJP B;  3BK2 A;  1EF1 A;  2K5P A;  4LLG M;  2XBB C;  5LXH A;  4HPP A;  2LXC A;  2WXM A;  3WAM A;  2M0X A;  2BGF A;  1WJ6 A;  3O13 A;  1L0V B;  1DOY A;  3TEW A;  3HVZ A;  3ZDM C;  2LGY A;  2ZCB A;  2RD0 A;  1UEL A;  2INN E;  1HZ6 A;  1L0Y B;  2NMQ A;  2KFK A;  1EU4 A;  3DOW A;  2WNM A;  2K6Q A;  4FHJ A;  3ZIM A;  4GDK B;  1GC7 A;  2BT6 A;  1GPX A;  2O6V A;  2N1W A;  2ZNV C;  4US8 A;  4LNK A;  1L4D B;  2M4N A;  3GOE A;  5J17 A;  3JW0 X;  3L0W B;  4MGI E;  2JWU A;  1P7E A;  1V81 A;  1ZW7 A;  2LVQ A;  1GUA B;  4ANV A;  4P16 A;  4IG7 B;  2N9X A;  3UIP B;  2QC8 A;  2CHX A;  3HM3 A;  3W1S C;  1F0Z A;  2ZVN A;  3ZXR A;  2RPQ A;  3EHV A;  4ZRP A;  2KWU B;  3NZ3 A;  2QEJ C;  4MEM A;  2G45 B;  5IA7 A;  4K7W A;  5AEK B;  3PVL A;  2B76 B;  3TEZ A;  1C4A A;  2L83 A;  2Y5B B;  4ZYN A;  5T8I A;  3KW5 B;  4HPM B;  1L6V A;  4B6W A;  3ZO5 B;  2BB6 A;  2MBQ A;  1XEE A;  4OHJ A;  4P7I A;  4ZRK A;  2KNB A;  2IY1 B;  4RMA A;  5BYR A;  4IC7 B;  4K81 A;  1E6E B;  3T3N A;  2LJI A;  3ZNZ B;  4C56 C;  1XCQ L;  3QCA A;  3IT6 B;  1NDD A;  1WJ4 A;  4F8C B;  3AE6 B;  1Y8R C;  1RM6 C;  1HE8 A;  2BPS A;  4S0R A;  4ARC A;  1YX5 B;  4DQO C;  1TZO A;  5G5H A;  1ZUD 2;  1CMX B;  4IM0 A;  2BYE A;  3SHQ A;  2PVG C;  2L05 A;  4LNF A;  4RF0 A;  1STE A;  1F52 A;  4W9I A;  2JQR B;  2EMS A;  2Y5P A;  2IBI B;  1UF0 A;  5JHA A;  1IGD A;  2BBC A;  3E9S A;  5GMV A;  2W82 A;  4WUR A;  2KQ4 X;  3I63 C;  4W9D A;  4F7Z A;  2DHZ A;  1V5O A;  2K8H A;  1BXT A;  2BYT A;  2G4D B;  4HJG E;  2D3G A;  1R4M B;  2IGH A;  4YTM B;  2G4S A;  5D3I B;  4ZYS A;  1ZDV A;  2PE9 A;  2RMM A;  2GBJ A;  4K7U A;  1J19 A;  1UNS A;  5AUK A;  1OQR A;  3ZJV A;  2LI5 A;  1EU3 A;  1EUV B;  2V3P A;  3B0A A;  1WGD A;  4XWT A;  1TZ1 A;  1WX7 A;  5DPT A;  1CZP A;  2VZK D;  4FXC A;  1T3Q A;  2W55 A;  4KIK B;  3HM6 X;  3QHT A;  3PRE A;  3NZU A;  2I1K A;  2LWP A;  4GGQ A;  3W1S A;  1QZE A;  3U7Z A;  4NJ6 A;  2LXA A;  2M56 B;  4HDO A;  4XDD A;  1JW9 D;  2KVR A;  3JVZ X;  3AEE B;  4WQO B;  3ZGZ A;  2LRU A;  3VAW A;  1RRB A;  3BVZ A;  3VUW A;  4AJY B;  2KTF A;  4A55 A;  4EEW A;  4ITK A;  1ZXI A;  3VH3 B;  3VUY A;  3R3M A;  2KDF B;  1JRP A;  1TS2 A;  2J53 A;  3ZRC A;  4NAW A;  4CQN A;  3WA0 A;  3L16 A;  4XX5 A;  2QHO A;  4I6P A;  3W1Y A;  4LNN A;  2IO3 B;  4B95 A;  2NTS A;  3GS2 A;  3B1L X;  2FUH B;  4FA6 A;  4WJO A;  3OAW A;  3DPD A;  4BFR A;  2MSE D;  2CKH B;  4NQL B;  4L1B A;  2KO3 A;  3T3O A;  3SFD B;  1F2R I;  4C7Z A;  3T9L A;  1GB1 A;  2JZ3 B;  2KVZ A;  3AE4 B;  1KF6 B;  2IY0 B;  2Z59 B;  3OJ4 B;  2FNJ B;  4MSM B;  3QAQ A;  5IOI A;  5BMH A;  4E74 A;  2KFJ A;  4M8N A;  2KC2 A;  1KOT A;  4X57 B;  4IOI E;  3QA8 A;  4IW0 A;  4TKN A;  1FCL A;  3IHP C;  5IAA C;  4TV3 A;  3V61 A;  1P1A A;  4AWJ A;  2MP2 B;  3CWI A;  4JWU C;  4C4V A;  2K25 A;  1KTK A;  1EO6 A;  2BB5 A;  5J2R A;  1V1P B;  2R2Q A;  2KJ6 A;  3AU4 A;  2SEB D;  2G9H D;  3APF A;  4Q2J A;  1EF5 A;  5JZE B;  5KHQ A;  4OZA A;  2WYQ A;  2K9X A;  1A5R A;  4DK5 A;  3PRM B;  3U8Z A;  1V6E A;  4HPL B;  2GOW A;  3DHH C;  4YL8 A;  4WWM A;  1I4P A;  4W9E A;  2XN9 C;  1WSP A;  4ANW A;  1Q10 A;  3Q8C A;  2WDQ B;  4TUU A;  2RGF A;  5EE1 A;  2D10 A;  2Z8L A;  5G55 A;  2E3T A;  2QIE B;  1UBI A;  3KUZ A;  3FIL A;  3IBE A;  1WF9 A;  4A3O A;  4DDI D;  5BMI A;  2C7N B;  4C00 A;  4MT5 A;  4EFO A;  2VH1 A;  2CS4 A;  4IKG A;  4MSQ B;  1KM7 A;  2KFK B;  2LHD A;  1FNU A;  2N9E B;  3AEA B;  2ZJD A;  2VRR B;  3P63 A;  1RYJ A;  2FBW B;  2MLB A;  4E3C A;  1FXT B;  2N7D A; 
#chains in the Genus database with same CATH homology
 1YN3 A;  2L52 A;  1QOB A;  1OFF A;  2MJE A;  2QJL A;  2GB1 A;  2BTE A;  4N58 A;  3W5V B;  1DYQ A;  3NVY A;  4ZHO A;  2QSD A;  2WDV B;  1ZPS A;  4TQ1 A;  3VRB B;  1MVK A;  3E56 A;  3FAH A;  1SBB B;  2JYE A;  1SEB D;  1QOG A;  3AMZ A;  4RCO A;  2CJO A;  2K0P A;  5FR3 A;  1VZ8 A;  2PTL A;  2MEK A;  1I4R A;  2IGG A;  4KGT A;  1L5P A;  1LO5 D;  1I4H A;  4MAC A;  1F77 A;  1D5X C;  2VZK B;  5TSS A;  4YSZ B;  1KFY B;  1FXI A;  2LGI A;  3Q8F A;  2JZP A;  1YMH E;  1UWM A;  1QKZ A;  1CK1 A;  2ACZ B;  1F2R C;  3NVV A;  4RGT A;  5C3J B;  1GB4 A;  1PYW D;  1KLU D;  3MJ5 A;  1XXG A;  1YNT E;  3IT4 B;  1ZDX A;  4RNA A;  3ZQ4 A;  2I38 A;  3BYT B;  1WWT A;  2PW9 A;  1PGX A;  3AEF B;  3N9Y C;  2QIL A;  1KRH A;  1TYG B;  2M0A A;  1L4Z B;  3BII D;  4NZL B;  3GP7 A;  2V0G A;  3IXS A;  1E0Z A;  4EE2 A;  1DOX A;  3GB1 A;  1SF0 A;  1T5X D;  3MHZ A;  5EE3 A;  2FE8 A;  3PZ8 A;  2JU6 X;  1C4P A;  1XLO A;  1C78 A;  4DXF A;  1V1P A;  2V3N A;  4N6E B;  1SE2 A;  1EM7 A;  4YWG G;  5I4D A;  4O1N A;  2OED A;  1PDX A;  3BVG A;  4ZOH C;  1VJK A;  1FIQ A;  1VZ7 A;  3P42 A;  1XLQ A;  3Q8E A;  1D4B A;  5BMG A;  1JWA D;  1N63 A;  1B1Z A;  1JWM D;  1E7P B;  4AQ7 A;  3PO0 A;  1PFD A;  2G1E A;  3EUB 2;  3AB5 A;  5LNK 1;  2PLP A;  3LB8 C;  4KKJ A;  1PGB A;  5H8Y E;  3VQI A;  2CJN A;  1FMA D;  1FEH A;  1SJE D;  2IGD A;  3LYY A;  3HVD A;  4TSS A;  1K52 A;  1YN5 A;  3BK2 A;  2K5P A;  2BS3 B;  4LLG M;  2BW2 A;  1ESF A;  3P4P B;  2ZW1 A;  1V1O A;  2WXM A;  2JSV X;  1J7A A;  2LFI A;  4NAM A;  3B9J A;  1FFU A;  2RPV A;  4JX1 C;  1UGJ A;  3O13 A;  1L0V B;  3EGR A;  4P6V F;  2H89 B;  1DOY A;  3ZJT A;  3TEW A;  3HVZ A;  2NTT A;  5D7G A;  2WXG A;  1SIJ A;  3B2G A;  1UWX A;  2WXH A;  1GAQ B;  2Y5C A;  2INN E;  1HZ6 A;  1L0Y B;  2NMQ A;  2QMT A;  3AH7 A;  5E6J A;  1EU4 A;  1VR9 A;  1UUP A;  4C80 A;  4US9 A;  2WXJ A;  2WNM A;  3AE9 B;  4GDK B;  4H2A A;  2BT6 A;  4XWW A;  1GPX A;  1WXQ A;  3AE5 B;  3PZ7 A;  4HEA 1;  2AX5 A;  2JYT A;  4US8 A;  3BK1 A;  1L4D B;  1HEZ E;  3Q8A A;  4YSY B;  1HA5 A;  2IDY A;  2WDR B;  5HFY A;  1TY0 A;  2LEK A;  2JWU A;  3P4R B;  1P7E A;  3RPF C;  2ICI A;  4A9A A;  4HRO A;  1SB3 C;  4YTN B;  1SSN A;  2N9K A;  4P16 A;  1SXT A;  2RDH A;  4HRS A;  2BS4 B;  1VZ6 A;  2DLB A;  3UI3 A;  1VLB A;  4PT5 A;  2DYO A;  4JWS C;  5BYS A;  4R3D A;  1F0Z A;  1C9F A;  1L0X B;  1MPE A;  2AQ3 B;  4ZRP A;  2ONQ A;  1MI0 A;  4MH8 A;  5MPO A;  4UDU C;  3NZ3 A;  1SE3 A;  2QEJ C;  1R7S A;  2B76 B;  3TEZ A;  1C4A A;  2L83 A;  1ROE A;  5T8I A;  2GI9 A;  1TKE A;  1L6V A;  2WLB A;  2PMV A;  1TS3 A;  1ACC A;  2AQ1 B;  2KN4 A;  2MJD A;  1KH0 A;  4NAW B;  2BB6 A;  1XEE A;  2MJ3 A;  2WU5 B;  3KWL A;  1J7B A;  4OHJ A;  1I7H A;  3Q8B A;  5BYR A;  4OVZ A;  1EWY C;  4JPS A;  5EE9 A;  1E6E B;  1BUI C;  2K3U A;  3I57 A;  3T3N A;  3VR8 B;  1FM0 D;  2N7J A;  1RWS A;  3ZJU A;  1NI3 A;  2LJI A;  2PKO A;  1FXA A;  4J3O D;  4C56 C;  1XCQ L;  3IT6 B;  1XCT L;  1WYG A;  3AE8 B;  1HZ5 A;  4IDI A;  1NEN B;  1N5X A;  3AE6 B;  1DOI A;  3KQ4 A;  3I9V 1;  5G5G A;  1RM6 C;  1TY2 A;  4ARC A;  4DQO C;  2ZW0 A;  1TZO A;  2OHF A;  1SE4 A;  5G5H A;  1ZUD 2;  4NJC A;  1I4X A;  2D5G A;  2Y3A A;  4RGM A;  2PIA A;  2WXO A;  1DGJ A;  1VRA B;  3VR9 B;  2PVG C;  2FUG 1;  1QOA A;  5GXG B;  4RF0 A;  1V97 A;  3ABV B;  1STE A;  1I4Q A;  2JQR B;  4YT0 B;  2WXR A;  2Y5P A;  3BZD B;  2I2Y A;  1JAL A;  1YQ3 B;  1IGD A;  3P4Q B;  1K51 A;  2BBC A;  3VRA B;  3E9S A;  2W82 A;  4WUR A;  2KQ4 X;  2WXI A;  3R8B A;  4MM3 B;  1XLP A;  1BXT A;  2BYT A;  3U2S C;  1YQ4 B;  2INP E;  2IGH A;  4HJG E;  4M0W A;  4YTM B;  1JCK B;  5D3I B;  2WXF A;  1E10 A;  1NYR A;  1ZDV A;  1HQR D;  4ZYS A;  3AE2 B;  2RMM A;  5AUI A;  3W5U B;  2W3R A;  4DXG A;  1UNS A;  4LTU A;  5FKA C;  5AUK A;  1OQR A;  3V05 A;  3NVZ A;  2DBY A;  1CQV A;  4B0M A;  3ZJV A;  2WXN A;  1EU3 A;  2WXQ A;  2V3P A;  2EEL A;  2LMC A;  1TKY A;  5FK9 C;  3TUO A;  4XWT A;  3IAS 1;  3ZYY X;  1ET6 A;  1ZE3 D;  1AWD A;  2W3S A;  1N5W A;  3HRD D;  2SAK A;  2J4X A;  1CZP A;  2VZK D;  1FFV A;  3AEG B;  3U4E G;  4FXC A;  1T3Q A;  2WS3 B;  2W55 A;  2IPK D;  4D2K A;  1JQ4 A;  3V3X A;  4RGO S;  1I4G A;  3W1S A;  4XDC A;  1AN8 A;  2N0S B;  3U7Z A;  4OZB A;  4B0E A;  1HXY D;  1TS5 A;  2M56 B;  4AS1 A;  1XF5 L;  4XDD A;  2HDE A;  1JW9 D;  3AEE B;  3ZGZ A;  5D3D A;  2M19 A;  2J42 A;  1IBX B;  1V8C A;  3BVZ A;  2V4I B;  1N61 A;  2TSS A;  4A55 A;  1MHX A;  4ITK A;  1ZXI A;  2EKI A;  2JXT A;  4YXD B;  3NUH B;  3FC4 A;  4L2Y A;  1JRP A;  1TS2 A;  1SJH D;  2K22 A;  2MH7 A;  3P1M A;  2WP9 B;  2J53 A;  4RFB A;  1NVI D;  4CQN A;  1B9R A;  4TMA B;  3FIL B;  1ZOY B;  2DYM A;  3W9C B;  1D6E C;  3NRZ A;  1JRO A;  1CJE A;  3CIR B;  1XLN A;  2GRI A;  1KLG D;  3R2I A;  1D5M C;  4WAF A;  4YTP B;  1MHH E;  2N9L A;  4KKI A;  2W54 A;  2BS2 B;  3NS1 A;  2NTS A;  3GS2 A;  4KGR A;  2KAC A;  3AE1 B;  3AM9 A;  4OW0 A;  2IJ0 A;  1YN4 A;  1T6B X;  4RH6 A;  1C76 A;  2Q5W D;  5H92 C;  3MFG A;  1GOZ A;  2WXK A;  1M4V A;  2LUM A;  3IAM 1;  1RFK A;  3AEC B;  2JX5 A;  4L1B A;  1TS4 A;  4LK0 M;  3T3O A;  5HG2 A;  2KMM A;  3SFD B;  1F2R I;  4C7Z A;  3OWE B;  1GB1 A;  4OZC A;  1QT9 A;  1ZP0 B;  5JXV A;  3SEB A;  4TQ0 A;  2WU2 B;  4HKQ A;  4WIP A;  1C4C A;  3AE4 B;  1ET9 A;  1TKG A;  2RDG A;  1KF6 B;  2R61 A;  1QLB B;  1IGC A;  1TJE A;  5C2T B;  5HI1 A;  3URY A;  1XO3 A;  4XE0 A;  1JML A;  3BYY B;  1QF6 A;  4YSX B;  2H88 B;  5BMH A;  1E9M A;  4WH4 A;  4RGN A;  1C79 A;  1WRI A;  4KX6 B;  4IOI E;  2L32 A;  2YEP F;  2LHE A;  1BML C;  1FCL A;  4A6Q A;  1PUT A;  1OQQ A;  4L23 A;  1FRD A;  1P7F A;  4ZRQ A;  4RF1 A;  2HTM E;  3H8H A;  4JE3 B;  3TEX A;  1PGA A;  2CU3 A;  1K53 A;  2XNA C;  3CWI A;  3DWM A;  3AV8 A;  4JWU C;  3Q69 A;  4KGS A;  1WGK A;  1KTK A;  2BB5 A;  2KAJ A;  1ENF A;  1JWB D;  3B2F A;  3J9C A;  3RFZ B;  5EE0 A;  4A90 A;  3KWV A;  4HKZ E;  3L4P A;  1AYF A;  1VDV A;  1V1P B;  2KDM A;  2WXL A;  3BVM A;  2SEB D;  2G9H D;  2WXP A;  4Q2J A;  1J7C A;  3AEB B;  3AE3 B;  3C8Y A;  3MP9 A;  4OZA A;  5BYQ A;  2L1A A;  3NVW A;  2K9X A;  4WQM A;  2DWQ A;  3W2D A;  1FO4 A;  1FCC C;  1D5Z C;  3P4S B;  3HUI A;  3AN1 A;  5HHD G;  3ETR A;  4REZ A;  1NYQ A;  3DWG C;  1Y56 A;  4WWM A;  1C77 A;  1I4P A;  1N62 A;  1FNW A;  1QIL A;  2XN9 C;  1IBX A;  1QQR A;  2YEP B;  3AED B;  3SR6 A;  1WSP A;  2E6X A;  3TSS A;  4A8X C;  1Q10 A;  1YJI A;  1NEK B;  2KWD A;  3Q8C A;  2WDQ B;  1FD6 A;  1AW7 A;  1EWC A;  1FNV A;  1N60 A;  3AE7 B;  4N59 A;  5EE1 A;  2Z8L A;  2E3T A;  3U52 E;  2QIE B;  4USA A;  1A70 A;  4ZHP A;  3FIL A;  4GLS C;  5BMI A;  1FRR A;  1L6U A;  3SFE B;  4C7Y A;  3TEY A;  2ON8 A;  4MT5 A;  3EA6 A;  4ARI A;  2AQ2 B;  4IKG A;  1QOF A;  3LXF A;  4GDL B;  2LHD A;  1FNU A;  3WCQ A;  2PVO D;  1JWU D;  3AEA B;  1YJJ A;  1K50 A;  2J52 A;  3P63 A;  1IUE A;  1RYJ A;  2FBW B;  2X38 A;  1ZXH A;  1JWS D;  3KLS X;  3BWU D;  2WQY B;  3MC0 B;  3R2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...