2IDYA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
molecule keywords NSP3
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2idyA01
2GRIA 2M0AA 2IDYA
chains in the Genus database with same CATH superfamily
1WXAA 2ZCBA 1S1QB 1LGRA 2ON8A 1XCQL 4C4VA 1VZ7A 1F52A 3P4SB 2LHDA 4HCNB 3NOBA 1QILA 2IBIB 2L0TA 1V81A 3ABVB 1ACCA 4N58A 4GMVA 1TKGA 3AMZA 5D7GA 3ZW3A 1V1PA 3V3XA 3Q3MC 2JSVX 2NS5A 1UNSA 3GP7A 1RLFA 2WXNA 3PSEB 1K50A 1LXDA 3PPAA 1XD3B 3R8BA 1XQQA 2DNFA 4O1NA 5HI1A 3IAS1 5IAAC 2L32A 3O65B 5E6JA 2PMVA 4W9KA 3IAM1 1Z2MA 5BMGA 3CSTA 4EE2A 3QX1A 5TSSA 3WANA 1V2YA 3RD2A 3KH0A 3AH7A 4K81A 1B1ZA 3RNAC 1UBIA 1C1YB 4BBNF 1TBEA 2K8HA 1VRAB 2V4IB 3R2TA 4EOYA 4JE3B 2KJHB 2MP2B 1GB1A 2LVQA 3AE3B 2PIAA 2GRIA 4A3OA 4M01A 4WWNA 3NRZA 1GAQB 2V0GA 4ARIA 2KZRA 5T8IA 3VTWA 2K39A 2ZW0A 2N7EA 3RZWC 2K5PA 2DZIA 4MM3A 4ANVA 4N9F4 4PYZA 2KX0A 1HTOA 2G45B 3U2SC 5FR3A 1SJED 4W9CA 1DGJA 3L10B 5L95C 4KKIA 3TSSA 3SDLC 2PVOD 2JT4B 2IPKD 1WXVA 2DYOA 2IGDA 3PV1A 2NTTA 3BK1A 5C3JB 2L0FA 2KFKA 3CWIA 5LXHA 3TEZA 4US9A 2KX3A 4RM9A 3BY4B 2X8XX 4DHZB 1SE4A 2HD5B 4NJ7A 4MGYE 2DYMA 4MGZE 4WAAA 4KX6B 2KDMA 2M19A 1HEZE 3RCZA 3K9OB 1L2NA 2INCC 4ZRPA 1FIQA 1WI0A 1WM3A 3MFGA 4M0WB 3APCA 2ZNVC 4YXDB 2JU6X 4HK2A 2MWSB 2OJWA 3Q8BA 2BYEA 3TBLD 2WNMA 2WXLA 1SBBB 3EA6A 4YTNB 2W3SA 3TEYA 1NVID 2IY0B 2Y5PA 1FXIA 2CKHB 4NQLB 1I4QA 2FAZA 4AS1A 1HA5A 3KWVA 2O6VB 1WGGA 2FUG1 5IA7A 1XLPA 1KRHA 3RNBC 3QC8B 1J7CA 2JZ3B 1FEHA 3A33B 2W54A 1LFDA 1T0SC 2RR9A 3KYCD 5TR5A 3APFA 1IBXA 2GB1A 3R3MA 3CIRB 3UIOB 2BYVE 4US8A 4FJZA 4M8NA 1IYFA 4DXGA 1WXQA 2K1FA 3BVGA 3DCGA 3VRBB 2RGFA 2BVCA 1PGAA 2N1WA 2V4LA 4BKTA 2DBYA 4EKUA 3AE9B 2Z0DB 5AZHA 1UWMA 3B2FA 2MLBA 3I57A 3AEAB 2LXAA 3EUB2 3T8MA 1K8RB 1EWYC 2G9HD 5CTRC 4A3PA 2IO2B 1FXTB 1L0VB 3OWEB 3BVZA 4M02A 1RYJA 1I4PA 4FN2A 1P7FA 4LCDE 1YN3A 3PGEA 3RZFA 1R4NI 5CHWA 2CJNA 2H88B 4USAA 4BKGA 4JX1C 4BKSD 5JZEB 3A4RA 2IO3B 1J19A 5LXIB 4LLGM 2KFKB 1G6JA 3AN1A 2NMQA 3HUIA 1E8ZA 3H8HA 3OJ4B 4W9DA 1UBQA 1WE7A 2EMSA 1MG8A 2JYEA 1WR1A 3AE6B 5KHQA 2V9HA 2V3SA 4ZOHC 1D6EC 1FM0D 3GZNI 1JWMD 5DPRA 2BS4B 5FK9C 4BBNC 1ZKHA 2BYFA 4AJWA 5BMHA 3NVWA 4B0EA 3W9CB 3N30A 1C76A 2PPHA 1UF0A 1V9JA 3ECIA 2MJDA 2IJ0A 2QHOA 3TUOA 3X0WA 2I2YA 3KUZA 2W3RA 4PT5A 1OEYA 1WWTA 3KQ4A 3C0RB 4AJYB 3IFWB 1WJ4A 1WY8A 3DHGC 4EUTA 3NG0A 1ZUD2 2EELA 1XLNA 1YN5A 3ZNHB 1WMHA 2MCNB 1T0QC 1L7YA 2KQ7A 4NZLB 4KGTA 4XDDA 2KDIA 5GXGB 1JW9D 5HFYA 1DOYA 1UELA 3QA8A 1OGWA 2KFJA 2WXFA 5EE0A 2LWPA 2IO1B 2VZKD 3L17A 4GB9A 3UQBA 2MJ3A 3N3KB 1JWAD 1L6UA 4HEA1 2BPSA 2KMCA 2W82A 4JWSC 1PQSA 3V62A 2KKCA 4DXFA 1EF5A 3QCAA 1VJKA 4FHKA 1N5XA 4KZ0A 4WH4A 3DWMA 2PVGC 1C4AA 1GC6A 1WXSA 1ZGUB 1TYGB 2KDEB 5EE9A 4P6VF 2KN4A 2L00B 1QOFA 3W5VB 5D94A 2XN9C 1AWDA 1KLUD 4S17A 1UH6A 4DDGD 2IGGA 5C2TB 4GSWA 3M3JA 2HJ8A 1E8XA 2OEDA 4XGAB 2X38A 3P4QB 4HKZE 1XXGA 2C7HA 1D4BA 2N9KA 4EFOA 4YT0B 4CYEA 3DBLB 2MBBB 1WX9A 1T3QA 3PRZA 3HK0A 2FIDA 1WRDB 3N9YC 2LUEA 2LUMA 2INPE 2LHEA 4A90A 1KFYB 4OVVA 1HXYD 4KGSA 4JLCA 2GBNA 5BO4B 4C56C 1I35A 2YEPF 3AE5B 3L0WB 1OQQA 2MP2A 3KUDB 1D5ZC 2MBHA 5DPTA 3OG5A 2M1MA 3N20C 1EO6A 2BS3B 2L52A 2GBJA 2G3QB 3UI3A 3H7PA 2CHXA 1YQBA 1I7HA 4IDIA 3L4PA 1WIAA 2LZ6A 3IT6B 4NAWA 1RRBA 4W9IA 4II2B 1WMHB 3ZTCA 3GE3C 4PK1A 2LXCA 2GMIC 3U7ZA 1C79A 3NZSA 2LJIA 3ZYYX 4G11A 4K7SA 4KIKB 1E5WA 2HTHA 1UWXA 4IUMB 2WYQA 1JRPA 3WIMA 2EKIA 3RNFC 1UZXB 2MH7A 3RN9C 2SAKA 3NVYA 4MJSB 2PLPA 2L3ZA 2JZPA 3JW0X 2BYTA 2KJRA 5IP4D 3VXWA 4TQ0A 2LGSA 2J52A 2FCMA 1R4NB 3L54A 3DQVA 4ZRIA 1ZDVA 3ZXVA 4LNNA 3S2AA 1ZP0B 1TS3A 2NPTB 3L13A 4BZAA 1AYFA 4A20A 1C78A 3TIXA 4XZ4A 1PUTA 4ACFA 4J3OD 2IYDB 2RDBC 2JXXA 4CHKA 3P42A 1BXTA 1SE9A 1MPEA 2KLCA 2NPTA 3RULA 1LQBA 2KC1A 4RGNA 3ZJUA 1TZOA 3AEFB 2MBEA 1FRDA 3TEWA 3J9CA 3PS6A 4IC7B 2AL3A 2ACZB 4YSZB 1F2RI 2IDYA 3EFUA 4KVGB 2IY1B 3L08A 5D3DA 3SEBA 4K7WA 3HHMA 4LNOA 1FFVA 1HTQA 1V49A 3B1LX 2WXPA 1SE2A 2WXMA 1E0ZA 1FCCC 2D3CA 3HRDD 3K9PB 2JRIB 1MG4A 4C00A 4MSQB 3ENEA 2ZZPB 3DBHI 4AQ7A 3PLUA 4TMAB 3H1UA 2KOXA 1ZDXA 4KZCA 3O13A 2KNBA 2L05A 2KACA 2OHFA 2JX5A 5G5HA 3B08A 2M8SA 3QK0A 4ZYNA 1QKZA 3P1MA 1GC7A 1Q0WB 3NJTA 1TY0A 2M17A 2XK5B 3DBRB 2MRPA 3C8YA 5DPSA 3VTUA 2QDFA 3ZJTA 5E6NA 2GBKA 1Y8RC 4MELA 5AZGA 2MSED 1FNUA 4F1SA 1L0XB 4H2AA 3P4RB 2KXJA 2DAJA 3IXSA 1JRUA 4DHJD 1VZ8A 3SFEB 3H7SA 4IWQA 1RM6C 2J4XA 4G0NB 3Q3OC 2ASQA 3FILB 2QMTA 3QQ8B 3N32A 5IN7A 2LGDA 1A70A 4JPSA 2GBRA 5J2RA 3LDZE 4XX5A 4WIPA 1V1PB 4PS8A 1QOGA 1N5WA 3N1YC 2BWES 1MVKA 5J18A 4RGMA 1I4XA 2JYTA 2FE8A 4AWJA 1HQRD 2WXIA 1J7AA 4FJYA 1MHHE 2V3NA 4A55A 1B9RA 2VZKB 3FILA 4HPMB 2CHZA 2N9XA 4ZRKA 3P63A 2WLBA 4DHZE 1NI3A 1WF9A 3MJ5A 2JPHA 1V1OA 4XE0A 1V5OA 2ZPYA 1VLBA 3WAOA 3N1XC 1YX5B 1GPXA 4MH8A 2D3BA 2WX1A 1TGZB 3AECB 3PZ7A 2LD9A 1KF6B 3Q3FA 4CO7A 2CR5A 1WX8A 1TS5A 1FNVA 2HTME 1R4MB 4GDKA 4W9HA 4W9EA 2LJ5A 3AI5A 4S0RA 2J53A 4WJNA 3A4SC 2KTFA 4TUUA 2D07B 3R7QA 3IHPC 1BMLC 1TS2A 4K3BA 2L83A 2KWCA 4LNKA 5G5GA 3AE7B 4RF0A 3ETRA 1CQVA 3GZNB 1F0ZA 4GN1A 4HCPB 1N62A 2Y3AA 1I4HA 2MBQA 5IO9A 2O2VB 3RPFC 2K6QA 3FKYA 3IBEA 2KTRA 1WZ0A 3MHSD 1TJEA 4GDLA 4C7YA 3U7DA 1NI2A 3VVWB 1LO5D 3ZQ4A 3AE1B 4I6NB 2EKEC 3Q3JA 3ZKJC 3ZIMA 2Y5CA 2B3AA 2KT7A 4KIKA 2O2VA 2QJLA 2MQJA 4W9LA 4DXAB 1OFFA 1VZ6A 3Q14C 1F1HA 1JWUD 4OVUA 4GDKB 3UGBB 3Q8EA 2K6DB 1DOXA 2DYBA 4YSXB 1WJUA 1MJDA 3BINA 1FD6A 2N7DA 1JROA 1KTKA 2KQSA 3M63B 4YTPB 4W9JA 1KH0A 4HJGE 5EE1A 1SJHD 2KO3A 4HWIB 1WYGA 2L7RA 3RI7C 3SU8X 3W5UB 4F8CB 1R4MI 1STEA 4RMAA 1IPGA 3RMKC 3RFZB 2INDC 1KLGD 3DVNU 1HZ6A 4MT5A 3NS8A 4OVZA 2INNE 3DVGX 1FRRA 3HM6X 3V61A 1K51A 3NS1A 1YD8U 3APDA 3FAHA 3WALA 3Q69A 3Q3NC 3C19A 3B9JA 3H7PB 5CHVC 5MPOA 2HE7A 4PYUA 4WURA 4LJPB 1VCBA 2N7JA 1NDDA 1SEBD 3PRMB 1WFYA 1GB4A 2JRHA 2I1KA 4K1RB 2WU2B 3VDZA 1TIFA 3JVZX 3T3NA 2ZVNA 3L16A 4HPPA 1WGDA 2FIFA 1J0GA 5J17A 4UDUC 4DWFA 1P1AA 4ZHOA 4XYCA 1OTRB 2K8CA 3AM9A 3P4PB 4YWGG 4BVUC 3H6NA 1RWSA 1C77A 3NUHB 5GMVA 3E56A 1QF6A 1L6VA 4ANUA 2LEKA 3A9KA 2LI5A 1OQRA 4A6QA 1YQ4B 1H4RA 5LLIA 4BOSC 2J0MA 1P98A 2WDTB 4HVBA 1A5RA 1XF5L 5HKHA 3TJPA 4N59A 1ZE3D 2O6VA 1QQRA 4B0MA 3PO0A 1M4VA 2KMAA 4ZRQA 2D10A 3IVFA 1L0YB 4EZJA 1XCTL 2ZJDA 1YOVB 4BKSA 2N0SB 2N9EB 3NY5A 3MHZA 2LRWA 1P0RA 3R2IA 3T9LA 5BYSA 4JIOU 1I4RA 2DAFA 1SF0A 1XO3A 3PHXB 4LDTB 3AE4B 1L4DB 1NYRA 1QOBA 3VFKA 4ZRJA 1M94A 3PVLA 2M0AA 2E3TA 1D5MC 3EECA 1EUVB 1OQYA 2KK8A 3MJWA 4IG7B 2QSDA 4KGRA 1V80A 3AEGB 2RD0A 4R3DA 2FCNA 1JALA 4ZHPA 3DOWA 3EHVA 2WXHA 3ONSA 3MTNB 1PGXA 2N9PC 1UUPA 3ZRFA 5G55A 1P9DU 1F77A 1I42A 5CX3A 2KLGA 4WWMA 2NTSA 1F2RC 2WXGA 1AARA 1VR9A 3RNGC 2IGHA 4NPNA 2V3PA 2KD0A 4M8MA 3DBRI 1YX6B 3QARA 2JQRB 1SB3C 4A9AA 4LJOB 1D5XC 2BT6A 5C23A 2G1EA 3UIPB 3DBSA 1TKEA 2WX0A 3T3OA 4D2KA 2WP9B 2AQ2B 2ONQA 5D2MB 1WX7A 4EZLA 2ZW1A 4A8XC 1LM8B 1QZEA 2LMCA 4EEWA 5IOIA 1RAXA 2KMMA 2Z8LA 2QILA 3W1SA 3NVVA 2DZMA 2KDFB 5HHDG 4BAXA 2KTRB 4MGKE 3LYYA 2KJ6A 1WR6E 3EC8A 3R7RA 4RH6A 3PZ8A 1E9MA 1ET6A 3PTFC 1ZOYB 4GIVA 1WJ6A 2C9WB 4P7IA 1ZXHA 2C7MB 4ASWC 1X1MA 5JHAA 1IGDA 2NVUI 2QIEB 4DQOC 1P3QU 5KHOA 3WA0A 1NBFC 3MC9A 1S3SG 2BF8B 3PREA 5G2NA 2QCZA 2PW9A 2RPQA 1MFWA 3HVDA 3OLMD 1AN8A 4Q2JA 3AULA 4KDLB 3OJ3A 4RM8A 3RUIB 1YN4A 4C7ZA 3QWZB 2AQ3B 1OEYJ 4XC2A 1N6ZA 4FADA 4XDCA 2RDGA 1WH3A 4QAYA 2KANA 3U4EG 4GOCA 2HJ1A 1NEKB 3URYA 3ZRCA 1FXAA 2MX2A 1E7VA 2DZJA 5CHFA 1ET9A 1EU3A 4P1BC 5FKAC 3VTVA 2FNJB 2NBVB 2XNAC 3V05A 4MH0E 2Q5WD 1K52A 3TL5A 5D6JB 2JF5A 2OJRA 2JZZA 3QHTA 4FLHA 4N6EB 2ZEQA 2GBMA 2CHWA 1CZPA 1QT9A 3AE8B 3AEDB 1Y56A 2EMTA 4GDLB 1E90A 5AEKB 1C3TA 2L1AA 4MSMB 2LGIA 1QLBB 1GG3A 5AUKA 2E6XA 2QEJC 1WXMA 3DHHC 1E8YA 4NJCA 3V6CB 2RDHA 2ZNVB 4HPLB 2KN5A 3VH3B 4L1BA 4G50A 1N63A 1WRIA 2K8BA 2BS2B 4KSLC 4IM0A 4KSKC 1CK1A 2NR2A 2YVCA 2LRUA 1TY2A 3AV8A 4WQOB 1RFKA 3WAPA 1H8CA 4DBGA 1N60A 3UF8A 1YJ1A 1SIJA 2J7QB 2K3UA 3AU4A 2UWQA 1YJIA 2KVRA 4DDID 1IUEA 4FXCA 3KWLA 1WM2A 5L83A 2LVPA 4BOZB 3RT3B 1KJTA 1V97A 4AUQC 3W1YA 1WJNA 4GXBA 4WJOA 1UGMA 2IO0B 3SR6A 3DWGC 4ZDVA 4TKNA 2AQ1B 3QJZA 2PTLA 4L23A 2PKOA 2KYWA 4TSSA 2LVOA 2JY6A 2KAJA 2MW5A 2D11A 2CU1A 4K3CA 4OW0A 2PE6B 4ICUA 2DHZA 4KKJA 4DHJB 4WAFA 1HZ5A 1PYWD 3AEBB 1ESFA 3V60A 2WXKA 3OAWA 3RNEC 4LNFA 4OZBA 5BMIA 5AZFA 4WQMA 4IWOA 4PS3A 2JXTA 2HDEA 2FCQA 1WGYA 3LXFA 1ZXIA 4X57B 2BGFA 2JWUA 4IM3A 3A1QB 2D3AA 2PE9A 3B0AA 3W1SC 4E74A 2QC8A 1SIFA 2V1YA 1EU4A 2XEWA 5JH5C 4HXDA 4J6IA 2BB5A 4RCOA 1E10A 2MBOA 4NJ6A 3BIID 1T5XD 3A9JB 2G4SA 4KDIC 4LTUA 1E7PB 4YTMB 4NAWB 4LDTD 3GB1A 3KUCB 1P7EA 3ZDMC 5C1ZA 1V6EA 1AW7A 1YMHE 3Q8FA 1WGKA 4HDOA 5HG2A 1C4CA 3BYYB 3Q8CA 1J8CA 3M62B 2KQ4X 3ZGZA 3QIJA 2VH2A 4FHJA 3SD5A 4C80A 3W2DA 2LFIA 2H89B 1GNUA 5I4DA 3NZUA 5H92C 4ANXA 2R2QA 4F7ZA 1YNTE 4ANWA 4IWPA 2R61A 4IW0A 5D3IB 1NENB 4I6PA 2PEAA 2ZPNA 3N1ZC 1KLVA 1FO4A 1C4PA 3H9DA 3WAMA 2FUHB 3AEEB 3MC0B 2WDVB 4K7UA 2K0PA 2ZCCA 2B76B 2UU7A 3KLSX 4L2YA 4OZCA 2BTEA 1BT0A 3JYUA 3ALBA 2G4DB 3GS2A 1CMXB 1F9JA 1WGRA 3HIZA 4TV3A 2AEHA 3NZ3A 2MA9B 2WHIA 3BZDB 4C4VB 3VR8B 4ARCA 3UINB 4AP4C 2D3GA 1JWBD 1QOAA 4OHJA 3VQIA 1PFDA 1Q1OA 4BFRA 2W9NA 3Q8AA 2VRRB 3DPDA 4P16A 4MJSA 1V5TA 2AYOB 2J42A 2Z59B 3I3TB 3BVMA 1J7BA 3DVNV 3KYDD 4KV2A 3LB8C 4E71A 2I1JA 4URKA 2M56B 4MDKE 3ZTDA 1T0RC 2M0XA 3LJ3A 3DVGY 3R66C 3TCAA 3ZUNA 4AOFA 3X23A 1KM7A 2BKFA 1PGBA 3U8ZA 4HROA 5DPWA 4XWWA 2W55A 3DBHB 4WJQA 3MC8A 3NVZA 3ZNGC 1E8WA 2K25A 4ICVA 3VAWA 2KWDA 4NAMA 2PJHA 2IZVB 1XLQA 3AB5A 5JXVA 3RNCC 1KOTA 3Q2AC 1VD2A 1ENFA 4RNAA 1YQ3B 1L4ZB 1V86A 2WS3B 1EF1A 4M0WA 4HLEA 2NBWB 1UD7A 5EDSA 3A9JA 1WGHA 2C5LC 1DOIA 3CF6E 4GGQA 2YEPB 2YLMA 3GOEA 3FC4A 5AUIA 2WXJA 4HDQA 1D3ZA 3ZNZB 4DK5A 3ZDTA 2GI9A 2KDBA 3BWUD 3PT2B 2K9XA 3HM3A 2JVCA 1TZ1A 2CU3A 2D5GA 4FA6A 2WGSA 1HE8A 4TQ1A 3NHEB 2I38A 4HRSA 1C9FA 5BYRA 1E6EB 4LNIA 2DLBA 3ML9A 3SHQA 2VH1A 1PDXA 2A5UA 1SSNA 4E3CA 2WDQB 2GLSA 1ROEA 3VUXA 4OZAA 2CJOA 4RF1A 1SXTA 3VH4B 1JCKB 1TT5B 3JSVA 2DWQA 3SFDB 1YIWA 4WJPA 1NYQA 4ITKA 4JL9A 2KHWB 2BQQA 1SE3A 2DX5B 1GUAB 1XT9B 2J0JA 2REXA 1BUIC 1L5PA 1IP9A 2WXQA 2KC2A 2N9LA 3VUYA 4B6WA 1GOZA 4P1CC 5DCNA 3VHTC 5JHBA 4YL8A 4IKGA 1ISNA 1EWCA 3HVZA 1EM7A 1WSPA 3EFCA 1JMLA 4II3B 2J0KA 4GLSC 2ZVOA 4B95A 1E7UA 1ZPSA 1JWSD 1T0YA 5H8YE 1ZW7A 4M00A 2KVZA 3DDCB 3IG3A 3ZNID 3AXCA 4PS7A 2MEKA 3RYTA 4RGOS 1MI0A 3MP9A 3QAQA 2DZKA 1XLOA 5EE3A 1FFUA 2KWUB 4RGTA 2MJEA 2AL6A 4YSYB 1JQ4A 3VUWA 1FNWA 3I5JC 3VRAB 4GU2A 2NCNA 2Z0EB 4IOIE 3VR9B 2NBUA 3M95A 3A9KB 4MGIE 1N61A 2M4NA 3D32A 2D2QA 1VDVA 2RPVA 1R7SA 2K22A 4NY0A 2A4ZA 3B2GA 4W9FA 3UQAA 2LGYA 3A1QA 1RFAA 2XBBC 2KWVB 3PLVA 4RFBA 2CS4A 3CMMB 2TSSA 2FCSA 3ZO5B 2RSUA 2LASA 1WE6A 1MHXA 3BK2A 4I6LB 3WCQA 3Q6BA 4W9GA 4IM2A 4MM3B 3JSVB 2RMMA 4JWUC 2BBCA 3ZVVA 5LNK1 4NNJB 3U30A 5IKCM 3ZJVA 1IGCA 2GOWA 1Q5WB 4LK0M 2BWFA 3ML8A 4ZYSA 4REZA 1I4GA 3ZLZA 3ZXRA 2DENB 1DYQA 2L76A 2R2OA 4JGHB 2N4FA 2UYZB 1FCLA 2L8JA 2ICIA 2LGXA 2WDRB 3DHIC 3IT4B 2JUOA 1V8CA 3AU5A 1GJZA 4WWPA 4MEMA 2BKRB 2O6VD 3I63C 2WXRA 1YJJA 4MACA 4XWTA 5BYQA 2N1VA 4CQNA 4G3XB 3U52E 3I9V1 1FMAD 3DBLI 3CSFA 4FBJB 5E6OA 1CJEA 1Q10A 3GE8C 2WXOA 3PRPB 3P2BA 2BW2A 4EZKA 5E6PA 2SEBD 4JQWC 3EGRA 2BB6A 3E9SA 2C60A 1WYWB 1WZ3A 2MHJA 2WQYB 4FJVB 1U4AA 4FULA 2WWZA 2C7NB 3KW5B 3KVFB 3AE2B 1TTNA 2XK5A 1FPYA 1TS4A 1XEEA 1Z5SB 2AX5A 1T6BX 4WWOA 2WU5B 3V6EB 4HKQA 2OOBB 1TKYA 2AWTA 2Y5BB 2FBWB 1IBXB 5FR6A 3TMPB 3TEXA 4B9KA 1SGHA 2JWZA 1K53A 3PHWB 3BYTB 4NQKE 4HJKA 1UGJA 3PZDA
chains in the Genus database with same CATH topology
4C56C 2K0PA 2YEPF 3AE5B 2B76B 2ON8A 1XCQL 1VZ7A 1OQQA 1OQRA 3P4SB 4A6QA 2LHDA 3KLSX 1YQ4B 4L2YA 1QILA 4OZCA 2BTEA 3ABVB 1ACCA 1D5ZC 1XF5L 4N58A 1TKGA 3AMZA 5D7GA 4N59A 1ZE3D 4B0MA 1QQRA 3PO0A 1M4VA 1V1PA 3GS2A 4ZRQA 3V3XA 1L0YB 2JSVX 1XCTL 2BS3B 3NZ3A 2N0SB 3BZDB 3VR8B 2L52A 1UNSA 3MHZA 4ARCA 3GP7A 2WXNA 3R2IA 3UI3A 1K50A 5BYSA 1JWBD 1QOAA 4OHJA 3VQIA 1PFDA 1I4RA 3R8BA 4IDIA 1I7HA 1SF0A 1XO3A 3L4PA 3AE4B 4O1NA 3IT6B 1L4DB 1NYRA 1QOBA 5HI1A 3IAS1 3Q8AA 2L32A 4P16A 5E6JA 2PMVA 2M0AA 2J42A 3U7ZA 3IAM1 2E3TA 1C79A 1D5MC 2LJIA 5BMGA 3BVMA 1J7BA 3ZYYX 4EE2A 5TSSA 3LB8C 1UWXA 2M56B 1JRPA 2QSDA 3AH7A 4KGRA 1B1ZA 3AEGB 2EKIA 1PGBA 4R3DA 1JALA 4ZHPA 4HROA 2MH7A 2SAKA 4XWWA 2W55A 3NVYA 2WXHA 2PLPA 1PGXA 2JZPA 2BYTA 3NVZA 1UUPA 1VRAB 4TQ0A 2V4IB 1F77A 2J52A 3R2TA 4WWMA 3MC0B 1ZDVA 4JE3B 2NTSA 1GB1A 1ZP0B 3AE3B 1TS3A 2PIAA 1F2RC 2WXGA 2KWDA 2GRIA 4NAMA 1AYFA 1VR9A 1C78A 3NRZA 2IGHA 1XLQA 3AB5A 1GAQB 1PUTA 5JXVA 4J3OD 2V0GA 4ARIA 5T8IA 2ZW0A 3P42A 2V3PA 2K5PA 1ENFA 1BXTA 4RNAA 2JQRB 1MPEA 1YQ3B 1L4ZB 2WS3B 4M0WA 1SB3C 4A9AA 4RGNA 3U2SC 5FR3A 1SJED 1D5XC 2BT6A 1DOIA 2G1EA 1DGJA 2YEPB 4KKIA 3ZJUA 1TKEA 3T3OA 1TZOA 3AEFB 3TSSA 1FRDA 2PVOD 4D2KA 3TEWA 2IPKD 3FC4A 5AUIA 3J9CA 2WXJA 2DYOA 2IGDA 2WP9B 2AQ2B 2ONQA 2NTTA 3BK1A 5C3JB 3CWIA 3TEZA 2ACZB 2ZW1A 4A8XC 4YSZB 4US9A 2GI9A 2LMCA 1SE4A 3BWUD 2K9XA 1F2RI 2DYMA 2IDYA 2D5GA 2CU3A 3SEBA 5D3DA 4KX6B 2KDMA 2M19A 2KMMA 2Z8LA 4TQ1A 1FFVA 1HEZE 2QILA 1SE2A 2WXMA 2I38A 2WXPA 3NVVA 4HRSA 3W1SA 4ZRPA 5BYRA 1FCCC 1C9FA 1E0ZA 5HHDG 3HRDD 1FIQA 1E6EB 3LYYA 2DLBA 3MFGA 1PDXA 4RH6A 3PZ8A 1E9MA 1ET6A 1ZOYB 1SSNA 4YXDB 2JU6X 2WDQB 4AQ7A 1ROEA 1ZXHA 3Q8BA 4OZAA 2CJOA 4RF1A 2WNMA 1SXTA 4TMAB 2WXLA 1SBBB 1IGDA 1JCKB 3EA6A 4YTNB 1ZDXA 2W3SA 3TEYA 3O13A 1NVID 2QIEB 4DQOC 2KACA 2Y5PA 1FXIA 2DWQA 2OHFA 2JX5A 3SFDB 5G5HA 1I4QA 4AS1A 1NYQA 4ITKA 1HA5A 1QKZA 3P1MA 2PW9A 1SE3A 3HVDA 3KWVA 1AN8A 1TY0A 2FUG1 4Q2JA 1XLPA 1KRHA 3C8YA 1BUIC 1L5PA 3ZJTA 2WXQA 1YN4A 2N9LA 4C7ZA 1J7CA 1FEHA 2AQ3B 2W54A 1FNUA 1GOZA 4XDCA 1L0XB 2RDGA 4H2AA 3P4RB 1IBXA 4IKGA 1EWCA 3HVZA 3U4EG 1EM7A 2GB1A 1WSPA 3CIRB 3URYA 1NEKB 4US8A 1JMLA 3IXSA 1VZ8A 1FXAA 3SFEB 4DXGA 1RM6C 1WXQA 2J4XA 4GLSC 1ET9A 1EU3A 1ZPSA 5FKAC 1JWSD 3BVGA 5H8YE 3VRBB 3FILB 2XNAC 2QMTA 3V05A 2Q5WD 1PGAA 1K52A 2MEKA 2DBYA 1A70A 4JPSA 3AE9B 4RGOS 1MI0A 1UWMA 3B2FA 3I57A 4N6EB 3MP9A 3AEAB 4WIPA 1V1PB 1QOGA 1XLOA 3EUB2 5EE3A 1CZPA 1FFUA 1QT9A 2MJEA 1N5WA 3AE8B 3AEDB 4RGTA 4YSYB 1EWYC 1Y56A 2G9HD 4GDLB 1MVKA 4RGMA 1FNWA 1I4XA 2JYTA 2FE8A 3VRAB 3VR9B 1L0VB 4IOIE 2L1AA 3OWEB 2LGIA 1QLBB 3BVZA 1HQRD 5AUKA 2WXIA 1J7AA 1N61A 2E6XA 2QEJC 1RYJA 1MHHE 2V3NA 4NJCA 4A55A 1B9RA 1I4PA 1VDVA 2RDHA 2VZKB 3FILA 1P7FA 1YN3A 2RPVA 4L1BA 1R7SA 1N63A 2K22A 3P63A 2WLBA 1WRIA 1NI3A 2BS2B 2CJNA 3MJ5A 3B2GA 1V1OA 4XE0A 1CK1A 2H88B 4USAA 4JX1C 1VLBA 1GPXA 1TY2A 3AV8A 4MH8A 1RFKA 4LLGM 3AECB 3PZ7A 4RFBA 3AN1A 1KF6B 1N60A 2NMQA 3HUIA 2TSSA 3H8HA 1TS5A 1FNVA 1SIJA 2HTME 2K3UA 4KGSA 1MHXA 2JYEA 3AE6B 3BK2A 2J53A 4ZOHC 1YJIA 1D6EC 3WCQA 1FM0D 1JWMD 2BS4B 5FK9C 4MM3B 1IUEA 1BMLC 1TS2A 4FXCA 2L83A 2RMMA 3KWLA 4JWUC 2BBCA 5G5GA 5BMHA 3NVWA 1V97A 4B0EA 5LNK1 3AE7B 4RF0A 3ETRA 3W9CB 1CQVA 1F0ZA 1N62A 3ZJVA 1C76A 1IGCA 2Y3AA 1I4HA 4LK0M 2MJDA 3SR6A 4ZYSA 3DWGC 3RPFC 2AQ1B 4REZA 2PTLA 1I4GA 2IJ0A 4L23A 1TJEA 3TUOA 2PKOA 1DYQA 4TSSA 2I2YA 4C7YA 2KAJA 2W3RA 4PT5A 1LO5D 3ZQ4A 3AE1B 1WWTA 1FCLA 3KQ4A 4OW0A 2Y5CA 2QJLA 4KKJA 2ICIA 4WAFA 2WDRB 1HZ5A 1OFFA 1PYWD 1VZ6A 3IT4B 1ZUD2 2EELA 1XLNA 1YN5A 3AEBB 1JWUD 1V8CA 4GDKB 3Q8EA 1ESFA 1DOXA 1JQ4A 2WXKA 4YSXB 4NZLB 4OZBA 5BMIA 4WQMA 2WXRA 4KGTA 2JXTA 2HDEA 1YJJA 3LXFA 4MACA 1FD6A 1ZXIA 4XWTA 1JROA 5BYQA 4XDDA 4CQNA 1KTKA 5GXGB 2JWUA 4YTPB 1JW9D 5HFYA 1KH0A 3U52E 1DOYA 3I9V1 4HJGE 5EE1A 1SJHD 2WXFA 5EE0A 1FMAD 1WYGA 2VZKD 1EU4A 3W5UB 2MJ3A 1JWAD 1L6UA 4HEA1 1STEA 2BB5A 2W82A 1CJEA 4JWSC 4RCOA 1E10A 1Q10A 3BIID 3RFZB 1T5XD 2WXOA 4DXFA 1VJKA 4LTUA 1KLGD 1E7PB 1N5XA 1HZ6A 4WH4A 4YTMB 3DWMA 2PVGC 4MT5A 1C4AA 2BW2A 4OVZA 4NAWB 2INNE 1FRRA 2SEBD 3EGRA 3GB1A 1K51A 2BB6A 3NS1A 1TYGB 5EE9A 1P7EA 3E9SA 4P6VF 2KN4A 3FAHA 3Q69A 1AW7A 1QOFA 1YMHE 3B9JA 3Q8FA 3W5VB 5MPOA 1WGKA 2WQYB 4WURA 2XN9C 5HG2A 2N7JA 1C4CA 3BYYB 1AWDA 3Q8CA 1KLUD 1SEBD 2KQ4X 1GB4A 2IGGA 3ZGZA 2WU2B 5C2TB 2OEDA 4C80A 3T3NA 3W2DA 2LFIA 2X38A 3P4QB 4HKZE 1XXGA 3AE2B 2H89B 2N9KA 1D4BA 5I4DA 5H92C 4YT0B 1TS4A 1XEEA 2AX5A 1T6BX 1YNTE 2WU5B 4UDUC 4HKQA 2R61A 4ZHOA 1TKYA 1IBXB 1T3QA 2FBWB 5D3IB 1NENB 3AM9A 3P4PB 3TEXA 4YWGG 3N9YC 2LUMA 1RWSA 1FO4A 1C4PA 2INPE 2LHEA 4A90A 1K53A 1C77A 3NUHB 3BYTB 3E56A 1KFYB 1QF6A 1L6VA 3AEEB 1UGJA 2LEKA 1HXYD 2WDVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRI A;  2M0A A;  2IDY A; 
#chains in the Genus database with same CATH topology
 1WXA A;  2ZCB A;  1S1Q B;  1LGR A;  2ON8 A;  1XCQ L;  4C4V A;  1VZ7 A;  1F52 A;  3P4S B;  2LHD A;  4HCN B;  3NOB A;  1QIL A;  2IBI B;  2L0T A;  1V81 A;  3ABV B;  1ACC A;  4N58 A;  4GMV A;  1TKG A;  3AMZ A;  5D7G A;  3ZW3 A;  1V1P A;  3V3X A;  3Q3M C;  2JSV X;  2NS5 A;  1UNS A;  3GP7 A;  1RLF A;  2WXN A;  3PSE B;  1K50 A;  1LXD A;  3PPA A;  1XD3 B;  3R8B A;  1XQQ A;  2DNF A;  4O1N A;  5HI1 A;  3IAS 1;  5IAA C;  2L32 A;  3O65 B;  5E6J A;  2PMV A;  4W9K A;  3IAM 1;  1Z2M A;  5BMG A;  3CST A;  4EE2 A;  3QX1 A;  5TSS A;  3WAN A;  1V2Y A;  3RD2 A;  3KH0 A;  3AH7 A;  4K81 A;  1B1Z A;  3RNA C;  1UBI A;  1C1Y B;  4BBN F;  1TBE A;  2K8H A;  1VRA B;  2V4I B;  3R2T A;  4EOY A;  4JE3 B;  2KJH B;  2MP2 B;  1GB1 A;  2LVQ A;  3AE3 B;  2PIA A;  2GRI A;  4A3O A;  4M01 A;  4WWN A;  3NRZ A;  1GAQ B;  2V0G A;  4ARI A;  2KZR A;  5T8I A;  3VTW A;  2K39 A;  2ZW0 A;  2N7E A;  3RZW C;  2K5P A;  2DZI A;  4MM3 A;  4ANV A;  4N9F 4;  4PYZ A;  2KX0 A;  1HTO A;  2G45 B;  3U2S C;  5FR3 A;  1SJE D;  4W9C A;  1DGJ A;  3L10 B;  5L95 C;  4KKI A;  3TSS A;  3SDL C;  2PVO D;  2JT4 B;  2IPK D;  1WXV A;  2DYO A;  2IGD A;  3PV1 A;  2NTT A;  3BK1 A;  5C3J B;  2L0F A;  2KFK A;  3CWI A;  5LXH A;  3TEZ A;  4US9 A;  2KX3 A;  4RM9 A;  3BY4 B;  2X8X X;  4DHZ B;  1SE4 A;  2HD5 B;  4NJ7 A;  4MGY E;  2DYM A;  4MGZ E;  4WAA A;  4KX6 B;  2KDM A;  2M19 A;  1HEZ E;  3RCZ A;  3K9O B;  1L2N A;  2INC C;  4ZRP A;  1FIQ A;  1WI0 A;  1WM3 A;  3MFG A;  4M0W B;  3APC A;  2ZNV C;  4YXD B;  2JU6 X;  4HK2 A;  2MWS B;  2OJW A;  3Q8B A;  2BYE A;  3TBL D;  2WNM A;  2WXL A;  1SBB B;  3EA6 A;  4YTN B;  2W3S A;  3TEY A;  1NVI D;  2IY0 B;  2Y5P A;  1FXI A;  2CKH B;  4NQL B;  1I4Q A;  2FAZ A;  4AS1 A;  1HA5 A;  3KWV A;  2O6V B;  1WGG A;  2FUG 1;  5IA7 A;  1XLP A;  1KRH A;  3RNB C;  3QC8 B;  1J7C A;  2JZ3 B;  1FEH A;  3A33 B;  2W54 A;  1LFD A;  1T0S C;  2RR9 A;  3KYC D;  5TR5 A;  3APF A;  1IBX A;  2GB1 A;  3R3M A;  3CIR B;  3UIO B;  2BYV E;  4US8 A;  4FJZ A;  4M8N A;  1IYF A;  4DXG A;  1WXQ A;  2K1F A;  3BVG A;  3DCG A;  3VRB B;  2RGF A;  2BVC A;  1PGA A;  2N1W A;  2V4L A;  4BKT A;  2DBY A;  4EKU A;  3AE9 B;  2Z0D B;  5AZH A;  1UWM A;  3B2F A;  2MLB A;  3I57 A;  3AEA B;  2LXA A;  3EUB 2;  3T8M A;  1K8R B;  1EWY C;  2G9H D;  5CTR C;  4A3P A;  2IO2 B;  1FXT B;  1L0V B;  3OWE B;  3BVZ A;  4M02 A;  1RYJ A;  1I4P A;  4FN2 A;  1P7F A;  4LCD E;  1YN3 A;  3PGE A;  3RZF A;  1R4N I;  5CHW A;  2CJN A;  2H88 B;  4USA A;  4BKG A;  4JX1 C;  4BKS D;  5JZE B;  3A4R A;  2IO3 B;  1J19 A;  5LXI B;  4LLG M;  2KFK B;  1G6J A;  3AN1 A;  2NMQ A;  3HUI A;  1E8Z A;  3H8H A;  3OJ4 B;  4W9D A;  1UBQ A;  1WE7 A;  2EMS A;  1MG8 A;  2JYE A;  1WR1 A;  3AE6 B;  5KHQ A;  2V9H A;  2V3S A;  4ZOH C;  1D6E C;  1FM0 D;  3GZN I;  1JWM D;  5DPR A;  2BS4 B;  5FK9 C;  4BBN C;  1ZKH A;  2BYF A;  4AJW A;  5BMH A;  3NVW A;  4B0E A;  3W9C B;  3N30 A;  1C76 A;  2PPH A;  1UF0 A;  1V9J A;  3ECI A;  2MJD A;  2IJ0 A;  2QHO A;  3TUO A;  3X0W A;  2I2Y A;  3KUZ A;  2W3R A;  4PT5 A;  1OEY A;  1WWT A;  3KQ4 A;  3C0R B;  4AJY B;  3IFW B;  1WJ4 A;  1WY8 A;  3DHG C;  4EUT A;  3NG0 A;  1ZUD 2;  2EEL A;  1XLN A;  1YN5 A;  3ZNH B;  1WMH A;  2MCN B;  1T0Q C;  1L7Y A;  2KQ7 A;  4NZL B;  4KGT A;  4XDD A;  2KDI A;  5GXG B;  1JW9 D;  5HFY A;  1DOY A;  1UEL A;  3QA8 A;  1OGW A;  2KFJ A;  2WXF A;  5EE0 A;  2LWP A;  2IO1 B;  2VZK D;  3L17 A;  4GB9 A;  3UQB A;  2MJ3 A;  3N3K B;  1JWA D;  1L6U A;  4HEA 1;  2BPS A;  2KMC A;  2W82 A;  4JWS C;  1PQS A;  3V62 A;  2KKC A;  4DXF A;  1EF5 A;  3QCA A;  1VJK A;  4FHK A;  1N5X A;  4KZ0 A;  4WH4 A;  3DWM A;  2PVG C;  1C4A A;  1GC6 A;  1WXS A;  1ZGU B;  1TYG B;  2KDE B;  5EE9 A;  4P6V F;  2KN4 A;  2L00 B;  1QOF A;  3W5V B;  5D94 A;  2XN9 C;  1AWD A;  1KLU D;  4S17 A;  1UH6 A;  4DDG D;  2IGG A;  5C2T B;  4GSW A;  3M3J A;  2HJ8 A;  1E8X A;  2OED A;  4XGA B;  2X38 A;  3P4Q B;  4HKZ E;  1XXG A;  2C7H A;  1D4B A;  2N9K A;  4EFO A;  4YT0 B;  4CYE A;  3DBL B;  2MBB B;  1WX9 A;  1T3Q A;  3PRZ A;  3HK0 A;  2FID A;  1WRD B;  3N9Y C;  2LUE A;  2LUM A;  2INP E;  2LHE A;  4A90 A;  1KFY B;  4OVV A;  1HXY D;  4KGS A;  4JLC A;  2GBN A;  5BO4 B;  4C56 C;  1I35 A;  2YEP F;  3AE5 B;  3L0W B;  1OQQ A;  2MP2 A;  3KUD B;  1D5Z C;  2MBH A;  5DPT A;  3OG5 A;  2M1M A;  3N20 C;  1EO6 A;  2BS3 B;  2L52 A;  2GBJ A;  2G3Q B;  3UI3 A;  3H7P A;  2CHX A;  1YQB A;  1I7H A;  4IDI A;  3L4P A;  1WIA A;  2LZ6 A;  3IT6 B;  4NAW A;  1RRB A;  4W9I A;  4II2 B;  1WMH B;  3ZTC A;  3GE3 C;  4PK1 A;  2LXC A;  2GMI C;  3U7Z A;  1C79 A;  3NZS A;  2LJI A;  3ZYY X;  4G11 A;  4K7S A;  4KIK B;  1E5W A;  2HTH A;  1UWX A;  4IUM B;  2WYQ A;  1JRP A;  3WIM A;  2EKI A;  3RNF C;  1UZX B;  2MH7 A;  3RN9 C;  2SAK A;  3NVY A;  4MJS B;  2PLP A;  2L3Z A;  2JZP A;  3JW0 X;  2BYT A;  2KJR A;  5IP4 D;  3VXW A;  4TQ0 A;  2LGS A;  2J52 A;  2FCM A;  1R4N B;  3L54 A;  3DQV A;  4ZRI A;  1ZDV A;  3ZXV A;  4LNN A;  3S2A A;  1ZP0 B;  1TS3 A;  2NPT B;  3L13 A;  4BZA A;  1AYF A;  4A20 A;  1C78 A;  3TIX A;  4XZ4 A;  1PUT A;  4ACF A;  4J3O D;  2IYD B;  2RDB C;  2JXX A;  4CHK A;  3P42 A;  1BXT A;  1SE9 A;  1MPE A;  2KLC A;  2NPT A;  3RUL A;  1LQB A;  2KC1 A;  4RGN A;  3ZJU A;  1TZO A;  3AEF B;  2MBE A;  1FRD A;  3TEW A;  3J9C A;  3PS6 A;  4IC7 B;  2AL3 A;  2ACZ B;  4YSZ B;  1F2R I;  2IDY A;  3EFU A;  4KVG B;  2IY1 B;  3L08 A;  5D3D A;  3SEB A;  4K7W A;  3HHM A;  4LNO A;  1FFV A;  1HTQ A;  1V49 A;  3B1L X;  2WXP A;  1SE2 A;  2WXM A;  1E0Z A;  1FCC C;  2D3C A;  3HRD D;  3K9P B;  2JRI B;  1MG4 A;  4C00 A;  4MSQ B;  3ENE A;  2ZZP B;  3DBH I;  4AQ7 A;  3PLU A;  4TMA B;  3H1U A;  2KOX A;  1ZDX A;  4KZC A;  3O13 A;  2KNB A;  2L05 A;  2KAC A;  2OHF A;  2JX5 A;  5G5H A;  3B08 A;  2M8S A;  3QK0 A;  4ZYN A;  1QKZ A;  3P1M A;  1GC7 A;  1Q0W B;  3NJT A;  1TY0 A;  2M17 A;  2XK5 B;  3DBR B;  2MRP A;  3C8Y A;  5DPS A;  3VTU A;  2QDF A;  3ZJT A;  5E6N A;  2GBK A;  1Y8R C;  4MEL A;  5AZG A;  2MSE D;  1FNU A;  4F1S A;  1L0X B;  4H2A A;  3P4R B;  2KXJ A;  2DAJ A;  3IXS A;  1JRU A;  4DHJ D;  1VZ8 A;  3SFE B;  3H7S A;  4IWQ A;  1RM6 C;  2J4X A;  4G0N B;  3Q3O C;  2ASQ A;  3FIL B;  2QMT A;  3QQ8 B;  3N32 A;  5IN7 A;  2LGD A;  1A70 A;  4JPS A;  2GBR A;  5J2R A;  3LDZ E;  4XX5 A;  4WIP A;  1V1P B;  4PS8 A;  1QOG A;  1N5W A;  3N1Y C;  2BWE S;  1MVK A;  5J18 A;  4RGM A;  1I4X A;  2JYT A;  2FE8 A;  4AWJ A;  1HQR D;  2WXI A;  1J7A A;  4FJY A;  1MHH E;  2V3N A;  4A55 A;  1B9R A;  2VZK B;  3FIL A;  4HPM B;  2CHZ A;  2N9X A;  4ZRK A;  3P63 A;  2WLB A;  4DHZ E;  1NI3 A;  1WF9 A;  3MJ5 A;  2JPH A;  1V1O A;  4XE0 A;  1V5O A;  2ZPY A;  1VLB A;  3WAO A;  3N1X C;  1YX5 B;  1GPX A;  4MH8 A;  2D3B A;  2WX1 A;  1TGZ B;  3AEC B;  3PZ7 A;  2LD9 A;  1KF6 B;  3Q3F A;  4CO7 A;  2CR5 A;  1WX8 A;  1TS5 A;  1FNV A;  2HTM E;  1R4M B;  4GDK A;  4W9H A;  4W9E A;  2LJ5 A;  3AI5 A;  4S0R A;  2J53 A;  4WJN A;  3A4S C;  2KTF A;  4TUU A;  2D07 B;  3R7Q A;  3IHP C;  1BML C;  1TS2 A;  4K3B A;  2L83 A;  2KWC A;  4LNK A;  5G5G A;  3AE7 B;  4RF0 A;  3ETR A;  1CQV A;  3GZN B;  1F0Z A;  4GN1 A;  4HCP B;  1N62 A;  2Y3A A;  1I4H A;  2MBQ A;  5IO9 A;  2O2V B;  3RPF C;  2K6Q A;  3FKY A;  3IBE A;  2KTR A;  1WZ0 A;  3MHS D;  1TJE A;  4GDL A;  4C7Y A;  3U7D A;  1NI2 A;  3VVW B;  1LO5 D;  3ZQ4 A;  3AE1 B;  4I6N B;  2EKE C;  3Q3J A;  3ZKJ C;  3ZIM A;  2Y5C A;  2B3A A;  2KT7 A;  4KIK A;  2O2V A;  2QJL A;  2MQJ A;  4W9L A;  4DXA B;  1OFF A;  1VZ6 A;  3Q14 C;  1F1H A;  1JWU D;  4OVU A;  4GDK B;  3UGB B;  3Q8E A;  2K6D B;  1DOX A;  2DYB A;  4YSX B;  1WJU A;  1MJD A;  3BIN A;  1FD6 A;  2N7D A;  1JRO A;  1KTK A;  2KQS A;  3M63 B;  4YTP B;  4W9J A;  1KH0 A;  4HJG E;  5EE1 A;  1SJH D;  2KO3 A;  4HWI B;  1WYG A;  2L7R A;  3RI7 C;  3SU8 X;  3W5U B;  4F8C B;  1R4M I;  1STE A;  4RMA A;  1IPG A;  3RMK C;  3RFZ B;  2IND C;  1KLG D;  3DVN U;  1HZ6 A;  4MT5 A;  3NS8 A;  4OVZ A;  2INN E;  3DVG X;  1FRR A;  3HM6 X;  3V61 A;  1K51 A;  3NS1 A;  1YD8 U;  3APD A;  3FAH A;  3WAL A;  3Q69 A;  3Q3N C;  3C19 A;  3B9J A;  3H7P B;  5CHV C;  5MPO A;  2HE7 A;  4PYU A;  4WUR A;  4LJP B;  1VCB A;  2N7J A;  1NDD A;  1SEB D;  3PRM B;  1WFY A;  1GB4 A;  2JRH A;  2I1K A;  4K1R B;  2WU2 B;  3VDZ A;  1TIF A;  3JVZ X;  3T3N A;  2ZVN A;  3L16 A;  4HPP A;  1WGD A;  2FIF A;  1J0G A;  5J17 A;  4UDU C;  4DWF A;  1P1A A;  4ZHO A;  4XYC A;  1OTR B;  2K8C A;  3AM9 A;  3P4P B;  4YWG G;  4BVU C;  3H6N A;  1RWS A;  1C77 A;  3NUH B;  5GMV A;  3E56 A;  1QF6 A;  1L6V A;  4ANU A;  2LEK A;  3A9K A;  2LI5 A;  1OQR A;  4A6Q A;  1YQ4 B;  1H4R A;  5LLI A;  4BOS C;  2J0M A;  1P98 A;  2WDT B;  4HVB A;  1A5R A;  1XF5 L;  5HKH A;  3TJP A;  4N59 A;  1ZE3 D;  2O6V A;  1QQR A;  4B0M A;  3PO0 A;  1M4V A;  2KMA A;  4ZRQ A;  2D10 A;  3IVF A;  1L0Y B;  4EZJ A;  1XCT L;  2ZJD A;  1YOV B;  4BKS A;  2N0S B;  2N9E B;  3NY5 A;  3MHZ A;  2LRW A;  1P0R A;  3R2I A;  3T9L A;  5BYS A;  4JIO U;  1I4R A;  2DAF A;  1SF0 A;  1XO3 A;  3PHX B;  4LDT B;  3AE4 B;  1L4D B;  1NYR A;  1QOB A;  3VFK A;  4ZRJ A;  1M94 A;  3PVL A;  2M0A A;  2E3T A;  1D5M C;  3EEC A;  1EUV B;  1OQY A;  2KK8 A;  3MJW A;  4IG7 B;  2QSD A;  4KGR A;  1V80 A;  3AEG B;  2RD0 A;  4R3D A;  2FCN A;  1JAL A;  4ZHP A;  3DOW A;  3EHV A;  2WXH A;  3ONS A;  3MTN B;  1PGX A;  2N9P C;  1UUP A;  3ZRF A;  5G55 A;  1P9D U;  1F77 A;  1I42 A;  5CX3 A;  2KLG A;  4WWM A;  2NTS A;  1F2R C;  2WXG A;  1AAR A;  1VR9 A;  3RNG C;  2IGH A;  4NPN A;  2V3P A;  2KD0 A;  4M8M A;  3DBR I;  1YX6 B;  3QAR A;  2JQR B;  1SB3 C;  4A9A A;  4LJO B;  1D5X C;  2BT6 A;  5C23 A;  2G1E A;  3UIP B;  3DBS A;  1TKE A;  2WX0 A;  3T3O A;  4D2K A;  2WP9 B;  2AQ2 B;  2ONQ A;  5D2M B;  1WX7 A;  4EZL A;  2ZW1 A;  4A8X C;  1LM8 B;  1QZE A;  2LMC A;  4EEW A;  5IOI A;  1RAX A;  2KMM A;  2Z8L A;  2QIL A;  3W1S A;  3NVV A;  2DZM A;  2KDF B;  5HHD G;  4BAX A;  2KTR B;  4MGK E;  3LYY A;  2KJ6 A;  1WR6 E;  3EC8 A;  3R7R A;  4RH6 A;  3PZ8 A;  1E9M A;  1ET6 A;  3PTF C;  1ZOY B;  4GIV A;  1WJ6 A;  2C9W B;  4P7I A;  1ZXH A;  2C7M B;  4ASW C;  1X1M A;  5JHA A;  1IGD A;  2NVU I;  2QIE B;  4DQO C;  1P3Q U;  5KHO A;  3WA0 A;  1NBF C;  3MC9 A;  1S3S G;  2BF8 B;  3PRE A;  5G2N A;  2QCZ A;  2PW9 A;  2RPQ A;  1MFW A;  3HVD A;  3OLM D;  1AN8 A;  4Q2J A;  3AUL A;  4KDL B;  3OJ3 A;  4RM8 A;  3RUI B;  1YN4 A;  4C7Z A;  3QWZ B;  2AQ3 B;  1OEY J;  4XC2 A;  1N6Z A;  4FAD A;  4XDC A;  2RDG A;  1WH3 A;  4QAY A;  2KAN A;  3U4E G;  4GOC A;  2HJ1 A;  1NEK B;  3URY A;  3ZRC A;  1FXA A;  2MX2 A;  1E7V A;  2DZJ A;  5CHF A;  1ET9 A;  1EU3 A;  4P1B C;  5FKA C;  3VTV A;  2FNJ B;  2NBV B;  2XNA C;  3V05 A;  4MH0 E;  2Q5W D;  1K52 A;  3TL5 A;  5D6J B;  2JF5 A;  2OJR A;  2JZZ A;  3QHT A;  4FLH A;  4N6E B;  2ZEQ A;  2GBM A;  2CHW A;  1CZP A;  1QT9 A;  3AE8 B;  3AED B;  1Y56 A;  2EMT A;  4GDL B;  1E90 A;  5AEK B;  1C3T A;  2L1A A;  4MSM B;  2LGI A;  1QLB B;  1GG3 A;  5AUK A;  2E6X A;  2QEJ C;  1WXM A;  3DHH C;  1E8Y A;  4NJC A;  3V6C B;  2RDH A;  2ZNV B;  4HPL B;  2KN5 A;  3VH3 B;  4L1B A;  4G50 A;  1N63 A;  1WRI A;  2K8B A;  2BS2 B;  4KSL C;  4IM0 A;  4KSK C;  1CK1 A;  2NR2 A;  2YVC A;  2LRU A;  1TY2 A;  3AV8 A;  4WQO B;  1RFK A;  3WAP A;  1H8C A;  4DBG A;  1N60 A;  3UF8 A;  1YJ1 A;  1SIJ A;  2J7Q B;  2K3U A;  3AU4 A;  2UWQ A;  1YJI A;  2KVR A;  4DDI D;  1IUE A;  4FXC A;  3KWL A;  1WM2 A;  5L83 A;  2LVP A;  4BOZ B;  3RT3 B;  1KJT A;  1V97 A;  4AUQ C;  3W1Y A;  1WJN A;  4GXB A;  4WJO A;  1UGM A;  2IO0 B;  3SR6 A;  3DWG C;  4ZDV A;  4TKN A;  2AQ1 B;  3QJZ A;  2PTL A;  4L23 A;  2PKO A;  2KYW A;  4TSS A;  2LVO A;  2JY6 A;  2KAJ A;  2MW5 A;  2D11 A;  2CU1 A;  4K3C A;  4OW0 A;  2PE6 B;  4ICU A;  2DHZ A;  4KKJ A;  4DHJ B;  4WAF A;  1HZ5 A;  1PYW D;  3AEB B;  1ESF A;  3V60 A;  2WXK A;  3OAW A;  3RNE C;  4LNF A;  4OZB A;  5BMI A;  5AZF A;  4WQM A;  4IWO A;  4PS3 A;  2JXT A;  2HDE A;  2FCQ A;  1WGY A;  3LXF A;  1ZXI A;  4X57 B;  2BGF A;  2JWU A;  4IM3 A;  3A1Q B;  2D3A A;  2PE9 A;  3B0A A;  3W1S C;  4E74 A;  2QC8 A;  1SIF A;  2V1Y A;  1EU4 A;  2XEW A;  5JH5 C;  4HXD A;  4J6I A;  2BB5 A;  4RCO A;  1E10 A;  2MBO A;  4NJ6 A;  3BII D;  1T5X D;  3A9J B;  2G4S A;  4KDI C;  4LTU A;  1E7P B;  4YTM B;  4NAW B;  4LDT D;  3GB1 A;  3KUC B;  1P7E A;  3ZDM C;  5C1Z A;  1V6E A;  1AW7 A;  1YMH E;  3Q8F A;  1WGK A;  4HDO A;  5HG2 A;  1C4C A;  3BYY B;  3Q8C A;  1J8C A;  3M62 B;  2KQ4 X;  3ZGZ A;  3QIJ A;  2VH2 A;  4FHJ A;  3SD5 A;  4C80 A;  3W2D A;  2LFI A;  2H89 B;  1GNU A;  5I4D A;  3NZU A;  5H92 C;  4ANX A;  2R2Q A;  4F7Z A;  1YNT E;  4ANW A;  4IWP A;  2R61 A;  4IW0 A;  5D3I B;  1NEN B;  4I6P A;  2PEA A;  2ZPN A;  3N1Z C;  1KLV A;  1FO4 A;  1C4P A;  3H9D A;  3WAM A;  2FUH B;  3AEE B;  3MC0 B;  2WDV B;  4K7U A;  2K0P A;  2ZCC A;  2B76 B;  2UU7 A;  3KLS X;  4L2Y A;  4OZC A;  2BTE A;  1BT0 A;  3JYU A;  3ALB A;  2G4D B;  3GS2 A;  1CMX B;  1F9J A;  1WGR A;  3HIZ A;  4TV3 A;  2AEH A;  3NZ3 A;  2MA9 B;  2WHI A;  3BZD B;  4C4V B;  3VR8 B;  4ARC A;  3UIN B;  4AP4 C;  2D3G A;  1JWB D;  1QOA A;  4OHJ A;  3VQI A;  1PFD A;  1Q1O A;  4BFR A;  2W9N A;  3Q8A A;  2VRR B;  3DPD A;  4P16 A;  4MJS A;  1V5T A;  2AYO B;  2J42 A;  2Z59 B;  3I3T B;  3BVM A;  1J7B A;  3DVN V;  3KYD D;  4KV2 A;  3LB8 C;  4E71 A;  2I1J A;  4URK A;  2M56 B;  4MDK E;  3ZTD A;  1T0R C;  2M0X A;  3LJ3 A;  3DVG Y;  3R66 C;  3TCA A;  3ZUN A;  4AOF A;  3X23 A;  1KM7 A;  2BKF A;  1PGB A;  3U8Z A;  4HRO A;  5DPW A;  4XWW A;  2W55 A;  3DBH B;  4WJQ A;  3MC8 A;  3NVZ A;  3ZNG C;  1E8W A;  2K25 A;  4ICV A;  3VAW A;  2KWD A;  4NAM A;  2PJH A;  2IZV B;  1XLQ A;  3AB5 A;  5JXV A;  3RNC C;  1KOT A;  3Q2A C;  1VD2 A;  1ENF A;  4RNA A;  1YQ3 B;  1L4Z B;  1V86 A;  2WS3 B;  1EF1 A;  4M0W A;  4HLE A;  2NBW B;  1UD7 A;  5EDS A;  3A9J A;  1WGH A;  2C5L C;  1DOI A;  3CF6 E;  4GGQ A;  2YEP B;  2YLM A;  3GOE A;  3FC4 A;  5AUI A;  2WXJ A;  4HDQ A;  1D3Z A;  3ZNZ B;  4DK5 A;  3ZDT A;  2GI9 A;  2KDB A;  3BWU D;  3PT2 B;  2K9X A;  3HM3 A;  2JVC A;  1TZ1 A;  2CU3 A;  2D5G A;  4FA6 A;  2WGS A;  1HE8 A;  4TQ1 A;  3NHE B;  2I38 A;  4HRS A;  1C9F A;  5BYR A;  1E6E B;  4LNI A;  2DLB A;  3ML9 A;  3SHQ A;  2VH1 A;  1PDX A;  2A5U A;  1SSN A;  4E3C A;  2WDQ B;  2GLS A;  1ROE A;  3VUX A;  4OZA A;  2CJO A;  4RF1 A;  1SXT A;  3VH4 B;  1JCK B;  1TT5 B;  3JSV A;  2DWQ A;  3SFD B;  1YIW A;  4WJP A;  1NYQ A;  4ITK A;  4JL9 A;  2KHW B;  2BQQ A;  1SE3 A;  2DX5 B;  1GUA B;  1XT9 B;  2J0J A;  2REX A;  1BUI C;  1L5P A;  1IP9 A;  2WXQ A;  2KC2 A;  2N9L A;  3VUY A;  4B6W A;  1GOZ A;  4P1C C;  5DCN A;  3VHT C;  5JHB A;  4YL8 A;  4IKG A;  1ISN A;  1EWC A;  3HVZ A;  1EM7 A;  1WSP A;  3EFC A;  1JML A;  4II3 B;  2J0K A;  4GLS C;  2ZVO A;  4B95 A;  1E7U A;  1ZPS A;  1JWS D;  1T0Y A;  5H8Y E;  1ZW7 A;  4M00 A;  2KVZ A;  3DDC B;  3IG3 A;  3ZNI D;  3AXC A;  4PS7 A;  2MEK A;  3RYT A;  4RGO S;  1MI0 A;  3MP9 A;  3QAQ A;  2DZK A;  1XLO A;  5EE3 A;  1FFU A;  2KWU B;  4RGT A;  2MJE A;  2AL6 A;  4YSY B;  1JQ4 A;  3VUW A;  1FNW A;  3I5J C;  3VRA B;  4GU2 A;  2NCN A;  2Z0E B;  4IOI E;  3VR9 B;  2NBU A;  3M95 A;  3A9K B;  4MGI E;  1N61 A;  2M4N A;  3D32 A;  2D2Q A;  1VDV A;  2RPV A;  1R7S A;  2K22 A;  4NY0 A;  2A4Z A;  3B2G A;  4W9F A;  3UQA A;  2LGY A;  3A1Q A;  1RFA A;  2XBB C;  2KWV B;  3PLV A;  4RFB A;  2CS4 A;  3CMM B;  2TSS A;  2FCS A;  3ZO5 B;  2RSU A;  2LAS A;  1WE6 A;  1MHX A;  3BK2 A;  4I6L B;  3WCQ A;  3Q6B A;  4W9G A;  4IM2 A;  4MM3 B;  3JSV B;  2RMM A;  4JWU C;  2BBC A;  3ZVV A;  5LNK 1;  4NNJ B;  3U30 A;  5IKC M;  3ZJV A;  1IGC A;  2GOW A;  1Q5W B;  4LK0 M;  2BWF A;  3ML8 A;  4ZYS A;  4REZ A;  1I4G A;  3ZLZ A;  3ZXR A;  2DEN B;  1DYQ A;  2L76 A;  2R2O A;  4JGH B;  2N4F A;  2UYZ B;  1FCL A;  2L8J A;  2ICI A;  2LGX A;  2WDR B;  3DHI C;  3IT4 B;  2JUO A;  1V8C A;  3AU5 A;  1GJZ A;  4WWP A;  4MEM A;  2BKR B;  2O6V D;  3I63 C;  2WXR A;  1YJJ A;  4MAC A;  4XWT A;  5BYQ A;  2N1V A;  4CQN A;  4G3X B;  3U52 E;  3I9V 1;  1FMA D;  3DBL I;  3CSF A;  4FBJ B;  5E6O A;  1CJE A;  1Q10 A;  3GE8 C;  2WXO A;  3PRP B;  3P2B A;  2BW2 A;  4EZK A;  5E6P A;  2SEB D;  4JQW C;  3EGR A;  2BB6 A;  3E9S A;  2C60 A;  1WYW B;  1WZ3 A;  2MHJ A;  2WQY B;  4FJV B;  1U4A A;  4FUL A;  2WWZ A;  2C7N B;  3KW5 B;  3KVF B;  3AE2 B;  1TTN A;  2XK5 A;  1FPY A;  1TS4 A;  1XEE A;  1Z5S B;  2AX5 A;  1T6B X;  4WWO A;  2WU5 B;  3V6E B;  4HKQ A;  2OOB B;  1TKY A;  2AWT A;  2Y5B B;  2FBW B;  1IBX B;  5FR6 A;  3TMP B;  3TEX A;  4B9K A;  1SGH A;  2JWZ A;  1K53 A;  3PHW B;  3BYT B;  4NQK E;  4HJK A;  1UGJ A;  3PZD A; 
#chains in the Genus database with same CATH homology
 4C56 C;  2K0P A;  2YEP F;  3AE5 B;  2B76 B;  2ON8 A;  1XCQ L;  1VZ7 A;  1OQQ A;  1OQR A;  3P4S B;  4A6Q A;  2LHD A;  3KLS X;  1YQ4 B;  4L2Y A;  1QIL A;  4OZC A;  2BTE A;  3ABV B;  1ACC A;  1D5Z C;  1XF5 L;  4N58 A;  1TKG A;  3AMZ A;  5D7G A;  4N59 A;  1ZE3 D;  4B0M A;  1QQR A;  3PO0 A;  1M4V A;  1V1P A;  3GS2 A;  4ZRQ A;  3V3X A;  1L0Y B;  2JSV X;  1XCT L;  2BS3 B;  3NZ3 A;  2N0S B;  3BZD B;  3VR8 B;  2L52 A;  1UNS A;  3MHZ A;  4ARC A;  3GP7 A;  2WXN A;  3R2I A;  3UI3 A;  1K50 A;  5BYS A;  1JWB D;  1QOA A;  4OHJ A;  3VQI A;  1PFD A;  1I4R A;  3R8B A;  4IDI A;  1I7H A;  1SF0 A;  1XO3 A;  3L4P A;  3AE4 B;  4O1N A;  3IT6 B;  1L4D B;  1NYR A;  1QOB A;  5HI1 A;  3IAS 1;  3Q8A A;  2L32 A;  4P16 A;  5E6J A;  2PMV A;  2M0A A;  2J42 A;  3U7Z A;  3IAM 1;  2E3T A;  1C79 A;  1D5M C;  2LJI A;  5BMG A;  3BVM A;  1J7B A;  3ZYY X;  4EE2 A;  5TSS A;  3LB8 C;  1UWX A;  2M56 B;  1JRP A;  2QSD A;  3AH7 A;  4KGR A;  1B1Z A;  3AEG B;  2EKI A;  1PGB A;  4R3D A;  1JAL A;  4ZHP A;  4HRO A;  2MH7 A;  2SAK A;  4XWW A;  2W55 A;  3NVY A;  2WXH A;  2PLP A;  1PGX A;  2JZP A;  2BYT A;  3NVZ A;  1UUP A;  1VRA B;  4TQ0 A;  2V4I B;  1F77 A;  2J52 A;  3R2T A;  4WWM A;  3MC0 B;  1ZDV A;  4JE3 B;  2NTS A;  1GB1 A;  1ZP0 B;  3AE3 B;  1TS3 A;  2PIA A;  1F2R C;  2WXG A;  2KWD A;  2GRI A;  4NAM A;  1AYF A;  1VR9 A;  1C78 A;  3NRZ A;  2IGH A;  1XLQ A;  3AB5 A;  1GAQ B;  1PUT A;  5JXV A;  4J3O D;  2V0G A;  4ARI A;  5T8I A;  2ZW0 A;  3P42 A;  2V3P A;  2K5P A;  1ENF A;  1BXT A;  4RNA A;  2JQR B;  1MPE A;  1YQ3 B;  1L4Z B;  2WS3 B;  4M0W A;  1SB3 C;  4A9A A;  4RGN A;  3U2S C;  5FR3 A;  1SJE D;  1D5X C;  2BT6 A;  1DOI A;  2G1E A;  1DGJ A;  2YEP B;  4KKI A;  3ZJU A;  1TKE A;  3T3O A;  1TZO A;  3AEF B;  3TSS A;  1FRD A;  2PVO D;  4D2K A;  3TEW A;  2IPK D;  3FC4 A;  5AUI A;  3J9C A;  2WXJ A;  2DYO A;  2IGD A;  2WP9 B;  2AQ2 B;  2ONQ A;  2NTT A;  3BK1 A;  5C3J B;  3CWI A;  3TEZ A;  2ACZ B;  2ZW1 A;  4A8X C;  4YSZ B;  4US9 A;  2GI9 A;  2LMC A;  1SE4 A;  3BWU D;  2K9X A;  1F2R I;  2DYM A;  2IDY A;  2D5G A;  2CU3 A;  3SEB A;  5D3D A;  4KX6 B;  2KDM A;  2M19 A;  2KMM A;  2Z8L A;  4TQ1 A;  1FFV A;  1HEZ E;  2QIL A;  1SE2 A;  2WXM A;  2I38 A;  2WXP A;  3NVV A;  4HRS A;  3W1S A;  4ZRP A;  5BYR A;  1FCC C;  1C9F A;  1E0Z A;  5HHD G;  3HRD D;  1FIQ A;  1E6E B;  3LYY A;  2DLB A;  3MFG A;  1PDX A;  4RH6 A;  3PZ8 A;  1E9M A;  1ET6 A;  1ZOY B;  1SSN A;  4YXD B;  2JU6 X;  2WDQ B;  4AQ7 A;  1ROE A;  1ZXH A;  3Q8B A;  4OZA A;  2CJO A;  4RF1 A;  2WNM A;  1SXT A;  4TMA B;  2WXL A;  1SBB B;  1IGD A;  1JCK B;  3EA6 A;  4YTN B;  1ZDX A;  2W3S A;  3TEY A;  3O13 A;  1NVI D;  2QIE B;  4DQO C;  2KAC A;  2Y5P A;  1FXI A;  2DWQ A;  2OHF A;  2JX5 A;  3SFD B;  5G5H A;  1I4Q A;  4AS1 A;  1NYQ A;  4ITK A;  1HA5 A;  1QKZ A;  3P1M A;  2PW9 A;  1SE3 A;  3HVD A;  3KWV A;  1AN8 A;  1TY0 A;  2FUG 1;  4Q2J A;  1XLP A;  1KRH A;  3C8Y A;  1BUI C;  1L5P A;  3ZJT A;  2WXQ A;  1YN4 A;  2N9L A;  4C7Z A;  1J7C A;  1FEH A;  2AQ3 B;  2W54 A;  1FNU A;  1GOZ A;  4XDC A;  1L0X B;  2RDG A;  4H2A A;  3P4R B;  1IBX A;  4IKG A;  1EWC A;  3HVZ A;  3U4E G;  1EM7 A;  2GB1 A;  1WSP A;  3CIR B;  3URY A;  1NEK B;  4US8 A;  1JML A;  3IXS A;  1VZ8 A;  1FXA A;  3SFE B;  4DXG A;  1RM6 C;  1WXQ A;  2J4X A;  4GLS C;  1ET9 A;  1EU3 A;  1ZPS A;  5FKA C;  1JWS D;  3BVG A;  5H8Y E;  3VRB B;  3FIL B;  2XNA C;  2QMT A;  3V05 A;  2Q5W D;  1PGA A;  1K52 A;  2MEK A;  2DBY A;  1A70 A;  4JPS A;  3AE9 B;  4RGO S;  1MI0 A;  1UWM A;  3B2F A;  3I57 A;  4N6E B;  3MP9 A;  3AEA B;  4WIP A;  1V1P B;  1QOG A;  1XLO A;  3EUB 2;  5EE3 A;  1CZP A;  1FFU A;  1QT9 A;  2MJE A;  1N5W A;  3AE8 B;  3AED B;  4RGT A;  4YSY B;  1EWY C;  1Y56 A;  2G9H D;  4GDL B;  1MVK A;  4RGM A;  1FNW A;  1I4X A;  2JYT A;  2FE8 A;  3VRA B;  3VR9 B;  1L0V B;  4IOI E;  2L1A A;  3OWE B;  2LGI A;  1QLB B;  3BVZ A;  1HQR D;  5AUK A;  2WXI A;  1J7A A;  1N61 A;  2E6X A;  2QEJ C;  1RYJ A;  1MHH E;  2V3N A;  4NJC A;  4A55 A;  1B9R A;  1I4P A;  1VDV A;  2RDH A;  2VZK B;  3FIL A;  1P7F A;  1YN3 A;  2RPV A;  4L1B A;  1R7S A;  1N63 A;  2K22 A;  3P63 A;  2WLB A;  1WRI A;  1NI3 A;  2BS2 B;  2CJN A;  3MJ5 A;  3B2G A;  1V1O A;  4XE0 A;  1CK1 A;  2H88 B;  4USA A;  4JX1 C;  1VLB A;  1GPX A;  1TY2 A;  3AV8 A;  4MH8 A;  1RFK A;  4LLG M;  3AEC B;  3PZ7 A;  4RFB A;  3AN1 A;  1KF6 B;  1N60 A;  2NMQ A;  3HUI A;  2TSS A;  3H8H A;  1TS5 A;  1FNV A;  1SIJ A;  2HTM E;  2K3U A;  4KGS A;  1MHX A;  2JYE A;  3AE6 B;  3BK2 A;  2J53 A;  4ZOH C;  1YJI A;  1D6E C;  3WCQ A;  1FM0 D;  1JWM D;  2BS4 B;  5FK9 C;  4MM3 B;  1IUE A;  1BML C;  1TS2 A;  4FXC A;  2L83 A;  2RMM A;  3KWL A;  4JWU C;  2BBC A;  5G5G A;  5BMH A;  3NVW A;  1V97 A;  4B0E A;  5LNK 1;  3AE7 B;  4RF0 A;  3ETR A;  3W9C B;  1CQV A;  1F0Z A;  1N62 A;  3ZJV A;  1C76 A;  1IGC A;  2Y3A A;  1I4H A;  4LK0 M;  2MJD A;  3SR6 A;  4ZYS A;  3DWG C;  3RPF C;  2AQ1 B;  4REZ A;  2PTL A;  1I4G A;  2IJ0 A;  4L23 A;  1TJE A;  3TUO A;  2PKO A;  1DYQ A;  4TSS A;  2I2Y A;  4C7Y A;  2KAJ A;  2W3R A;  4PT5 A;  1LO5 D;  3ZQ4 A;  3AE1 B;  1WWT A;  1FCL A;  3KQ4 A;  4OW0 A;  2Y5C A;  2QJL A;  4KKJ A;  2ICI A;  4WAF A;  2WDR B;  1HZ5 A;  1OFF A;  1PYW D;  1VZ6 A;  3IT4 B;  1ZUD 2;  2EEL A;  1XLN A;  1YN5 A;  3AEB B;  1JWU D;  1V8C A;  4GDK B;  3Q8E A;  1ESF A;  1DOX A;  1JQ4 A;  2WXK A;  4YSX B;  4NZL B;  4OZB A;  5BMI A;  4WQM A;  2WXR A;  4KGT A;  2JXT A;  2HDE A;  1YJJ A;  3LXF A;  4MAC A;  1FD6 A;  1ZXI A;  4XWT A;  1JRO A;  5BYQ A;  4XDD A;  4CQN A;  1KTK A;  5GXG B;  2JWU A;  4YTP B;  1JW9 D;  5HFY A;  1KH0 A;  3U52 E;  1DOY A;  3I9V 1;  4HJG E;  5EE1 A;  1SJH D;  2WXF A;  5EE0 A;  1FMA D;  1WYG A;  2VZK D;  1EU4 A;  3W5U B;  2MJ3 A;  1JWA D;  1L6U A;  4HEA 1;  1STE A;  2BB5 A;  2W82 A;  1CJE A;  4JWS C;  4RCO A;  1E10 A;  1Q10 A;  3BII D;  3RFZ B;  1T5X D;  2WXO A;  4DXF A;  1VJK A;  4LTU A;  1KLG D;  1E7P B;  1N5X A;  1HZ6 A;  4WH4 A;  4YTM B;  3DWM A;  2PVG C;  4MT5 A;  1C4A A;  2BW2 A;  4OVZ A;  4NAW B;  2INN E;  1FRR A;  2SEB D;  3EGR A;  3GB1 A;  1K51 A;  2BB6 A;  3NS1 A;  1TYG B;  5EE9 A;  1P7E A;  3E9S A;  4P6V F;  2KN4 A;  3FAH A;  3Q69 A;  1AW7 A;  1QOF A;  1YMH E;  3B9J A;  3Q8F A;  3W5V B;  5MPO A;  1WGK A;  2WQY B;  4WUR A;  2XN9 C;  5HG2 A;  2N7J A;  1C4C A;  3BYY B;  1AWD A;  3Q8C A;  1KLU D;  1SEB D;  2KQ4 X;  1GB4 A;  2IGG A;  3ZGZ A;  2WU2 B;  5C2T B;  2OED A;  4C80 A;  3T3N A;  3W2D A;  2LFI A;  2X38 A;  3P4Q B;  4HKZ E;  1XXG A;  3AE2 B;  2H89 B;  2N9K A;  1D4B A;  5I4D A;  5H92 C;  4YT0 B;  1TS4 A;  1XEE A;  2AX5 A;  1T6B X;  1YNT E;  2WU5 B;  4UDU C;  4HKQ A;  2R61 A;  4ZHO A;  1TKY A;  1IBX B;  1T3Q A;  2FBW B;  5D3I B;  1NEN B;  3AM9 A;  3P4P B;  3TEX A;  4YWG G;  3N9Y C;  2LUM A;  1RWS A;  1FO4 A;  1C4P A;  2INP E;  2LHE A;  4A90 A;  1K53 A;  1C77 A;  3NUH B;  3BYT B;  3E56 A;  1KFY B;  1QF6 A;  1L6V A;  3AEE B;  1UGJ A;  2LEK A;  1HXY D;  2WDV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...