2IDYA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
molecule tags Viral protein
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2idyA01
2GRIA 2IDYA 2M0AA
chains in the Genus database with same CATH superfamily
3M95A 4A3OA 2LXAA 2XNAC 3JSVA 1GG3A 4XYCA 4FJVB 2JQRB 2LMCA 3EFCA 2NPTB 4FHKA 4DHZE 2OJWA 5J18A 3AE7B 5HKHA 4MACA 1PGAA 4K7SA 1PYWD 1CQVA 1WJUA 4I6NB 3URYA 3K9PB 1GB4A 3A9KB 3QA8A 2J0JA 1YN5A 1J8CA 3WCQA 1LM8B 2W82A 1KF6B 1TT5B 3PRZA 2RGFA 2WQYB 1U4AA 1VCBA 1N60A 3ZRCA 4LCDE 2L7RA 4ASWC 2QHOA 4HJGE 3AE3B 4WIPA 2M19A 1SE2A 3R3MA 3OWEB 3V3XA 2MP2A 1YX5B 3UI3A 1WJ4A 4W9FA 3BIID 4A55A 1JROA 2X38A 2WDQB 4L1BA 4ARIA 2GLSA 4C80A 3Q6BA 3H7PA 4JGHB 4ZHOA 2R61A 3Q8AA 2FUG1 2GBRA 5FK9C 1CMXB 3PREA 5AZGA 3BINA 3UQAA 2J42A 3A1QA 1FCLA 2PLPA 3D32A 4XE0A 4RCOA 3PZ8A 4BKTA 3UGBB 1SE9A 2KJ6A 1P98A 5EE3A 2MBEA 2MEKA 3K9OB 1ZXHA 3IAM1 4ZRIA 4N59A 4W9CA 3PHXB 4NPNA 3CIRB 2K0PA 1T0QC 5TR5A 4IM2A 1E7VA 3RD2A 1NEKB 1XLQA 3PGEA 5BYRA 3VRBB 2JRIB 2L1AA 3B2FA 4GU2A 1PDXA 4RMAA 1OGWA 2HDEA 4I6LB 4KGRA 2H89B 1QOBA 4ITKA 3NHEB 2QILA 3FILB 3ZKJC 4A3PA 3ZRFA 4OZAA 2JX5A 1V81A 2MLBA 1F9JA 2KK8A 2ZCBA 1KLVA 3B1LX 3UIPB 4EEWA 2NPTA 4G0NB 4E74A 3ABVB 4JIOU 1XT9B 1TYGB 2X8XX 1Q5WB 3KW5B 4E3CA 3A33B 2G1EA 1D5ZC 3HIZA 1Q10A 1UZXB 1IPGA 2ZW1A 1UUPA 2SEBD 3BZDB 1Q1OA 3DVGY 3A9KA 1L6UA 5IO9A 4LK0M 1YQBA 1Z2MA 3T9LA 2L76A 2NVUI 4LNNA 5D3IB 2KFJA 1JCKB 2FAZA 1ET6A 1WGKA 1TY0A 3VH3B 2IDYA 5E6NA 4LNKA 5TSSA 5G5HA 1VJKA 1F2RC 2LI5A 4EUTA 4YSXB 2LRUA 3I63C 4W9LA 3V61A 1ENFA 2EELA 2N7DA 5C3JB 2KN5A 3AULA 3APDA 2MBHA 3MC0B 1SE4A 4YSYB 2BGFA 2I38A 5T8IA 3VAWA 4DDGD 2KNBA 2UWQA 4C7ZA 2MHJA 5LXIB 1OQQA 2WNMA 4KGSA 2DZKA 1V8CA 1WYWB 4P1CC 3DBSA 4NJ6A 2WXRA 1K52A 1QZEA 4DHZB 1Y8RC 1DOIA 3RZWC 4TQ0A 1FMAD 3OG5A 2N9XA 1ZE3D 1JW9D 2KOXA 4FA6A 1JMLA 2XK5A 4WJNA 3ZDMC 3N9YC 1UBQA 1ZPSA 4TV3A 2M0AA 2BB5A 1FXIA 4AJWA 3FILA 1HXYD 2D2QA 1WXSA 4DXAB 2WXMA 3R66C 2V3PA 1T6BX 2BYEA 1GB1A 3VTUA 1IYFA 2HJ8A 1SE3A 3EECA 1SJHD 2IY1B 3PV1A 2WXNA 1LQBA 1D5MC 2JXXA 1N63A 3AB5A 3TEXA 2N0SB 1K50A 4URKA 3EUB2 2KDMA 3ZIMA 3BK1A 1SF0A 1YQ4B 1P3QU 4FJYA 4ZRQA 4MGKE 3Q8FA 1NENB 1XEEA 1TS2A 2VZKD 4ZRKA 1I35A 4WURA 1FXAA 2WP9B 4ZOHC 2KXJA 2INDC 4KZCA 2KVRA 3RNEC 1L2NA 2KDIA 2YEPB 3QAQA 1CJEA 4K3CA 1PFDA 2BF8B 2DBYA 1VZ6A 2D10A 3HVDA 3PSEB 4TMAB 1RAXA 3RPFC 1YJJA 2BS3B 2DYMA 4EOYA 3UF8A 1WFYA 4ZRJA 2YVCA 4REZA 5CTRC 2MH7A 1FFUA 2KX3A 1PUTA 1C1YB 3ZJTA 2ZPNA 2M4NA 4F1SA 2PTLA 2XN9C 1P7FA 1G6JA 4HCNB 2ONQA 4KZ0A 5BO4B 1IBXA 4K7UA 5AEKB 1ZP0B 2VZKB 3L16A 2KHWB 1J7BA 3IHPC 3WAOA 1KOTA 1H8CA 2GOWA 1RWSA 3L54A 2PW9A 3P4PB 2BTEA 5E6OA 4N6EB 1R7SA 2GMIC 2OJRA 4AS1A 1CZPA 4A9AA 1FIQA 4DHJD 1QKZA 3TL5A 2HJ1A 1YNTE 3QWZB 1YN3A 2BBCA 3B0AA 5HHDG 1RYJA 1WXMA 4GDKB 4TUUA 4ANVA 3RT3B 3VUXA 1FNVA 2QJLA 3SR6A 1I4XA 2LVQA 1WGDA 2KDBA 5D7GA 2WXJA 1UWXA 2IGHA 5AUKA 1SEBD 3GZNI 1NYRA 4K3BA 1UELA 2FIDA 3AE5B 3N30A 3H9DA 3PZDA 2E6XA 1NI3A 4IWPA 2DAFA 1ZDXA 1BMLC 1V1OA 1EM7A 2WXGA 2SAKA 4HROA 1WMHB 4KIKB 3L13A 5JH5C 2WU5B 3DHGC 1ZDVA 4DHJB 4WWNA 3N3KB 2CHZA 4AWJA 2WDVB 4HPPA 3RNCC 4C7YA 4OZBA 1EWCA 1E7PB 2LGDA 5GXGB 3WALA 2XEWA 4KV2A 2Y5CA 2IBIB 3ZTCA 3GS2A 3SU8X 4A20A 1KM7A 4ANWA 3PTFC 2BQQA 2WDRB 3Q3JA 3AEEB 4PYUA 5IA7A 2AWTA 1ZOYB 3BVGA 4XDDA 3PZ7A 1WGRA 3KH0A 4C56C 3R8BA 3W5UB 4N58A 4FULA 2LGSA 3HRDD 2KQSA 4KKIA 1C4PA 2E3TA 2L0TA 1AYFA 2IO1B 2LD9A 3H6NA 1XXGA 1HTOA 2MW5A 4W9KA 3A4SC 1JQ4A 5L95C 1FO4A 3DBRB 2C9WB 2WDTB 4IW0A 1V6EA 4G3XB 1WZ3A 4RGNA 2IYDB 3Q69A 3NVVA 1N5WA 2PKOA 1T3QA 3AEAB 2NS5A 3RNFC 4ZRPA 4GOCA 2KFKB 2MX2A 2C7HA 3VQIA 2LFIA 2IZVB 1I42A 2HTHA 1B9RA 5D94A 1OQYA 1L7YA 3I9V1 4GDKA 1DGJA 2QC8A 2CR5A 3ENEA 4JE3B 1DYQA 3PVLA 3AECB 3HM6X 2KAJA 1JWBD 3W1YA 1AWDA 4XX5A 2NTTA 3GZNB 2KVZA 2H88B 3BVZA 4YSZB 2ACZB 5HFYA 2M0XA 2AL6A 4IC7B 2IO3B 4JWSC 2KANA 3A4RA 4KIKA 4NAWB 5J17A 4L23A 3JYUA 4TSSA 3IFWB 2N9EB 4IG7B 3NZSA 2KZRA 2NTSA 5AZHA 4YXDB 5AUIA 4NQLB 2KQ7A 2Y3AA 1FD6A 2INCC 1JRPA 2V0GA 3BYTB 1MPEA 3KUDB 5EE0A 5H8YE 4CYEA 1C4AA 4RM9A 1C3TA 2LGYA 5KHOA 1ZGUB 1WWTA 4MEMA 4P6VF 3AE8B 4RM8A 3AU4A 4WQMA 2INNE 1OTRB 1QOFA 4NNJB 1WGGA 3NG0A 2M1MA 1JRUA 2EKEC 1WXQA 2ON8A 2N9PC 2FCQA 1RFAA 2KKCA 1FNWA 1UH6A 3Q3OC 1JWSD 1WH3A 2AQ2B 1WGYA 1EF1A 1X1MA 2G4DB 4S17A 1YJIA 1F52A 1L4DB 3HUIA 5IAAC 1LO5D 2KFKA 1IP9A 2BT6A 1A70A 3V6CB 3E9SA 3PT2B 3B2GA 1WXVA 3AE2B 3ZJVA 4PK1A 1QF6A 4EE2A 1V5TA 2FIFA 2WWZA 1F2RI 1V1PA 2D3AA 5JHAA 3Q8BA 2KX0A 3ML9A 2JF5A 1N6ZA 5FR3A 3Q3MC 2KTFA 3VXWA 5LLIA 1BXTA 2J7QB 4MT5A 1TS3A 1SSNA 4YWGG 4WQOB 1BUIC 4BOSC 1K8RB 3PO0A 2KLCA 4K1RB 4L2YA 4DXGA 3U4EG 4II2B 1R4MB 2XK5B 2I2YA 3HK0A 4NAWA 5HI1A 4E71A 3AE1B 2YEPF 2JYEA 4P16A 3AH7A 3ZLZA 4DK5A 2J0MA 2CHWA 1D4BA 1WF9A 1WGHA 4WJPA 3PHWB 1GC7A 3ZYYX 2IGGA 2KC2A 4WAFA 1PQSA 4YTPB 4NJCA 1E0ZA 1WJ6A 2MRPA 2PPHA 3APFA 3PLVA 4AP4C 4EKUA 1B1ZA 3C8YA 1QQRA 4P1BC 2GI9A 4YL8A 4IWQA 4IKGA 2DWQA 2B76B 2ASQA 1ESFA 1TKEA 2ZNVC 3JVZX 4BBNC 2LEKA 4AUQC 2BWFA 2XBBC 3AEGB 2W9NA 2JSVX 3DWGC 1FRDA 4NZLB 3NJTA 3DVGX 2YLMA 3MC9A 2RDHA 3AM9A 4HLEA 4NAMA 4F8CB 4FBJB 2ZEQA 2Y5PA 1SXTA 4HK2A 2M17A 1WI0A 3EA6A 1S3SG 3BWUD 2O6VB 2WS3B 3ZGZA 2K22A 1V97A 4MSMB 4JPSA 4II3B 4WJOA 3QARA 3N1ZC 4J6IA 1FXTB 2WXKA 1Y56A 4FADA 1WE7A 1IBXB 1V2YA 1IUEA 2W54A 2NR2A 4CQNA 2DAJA 2K1FA 2LHDA 2K3UA 1EF5A 3GE8C 1IGDA 1J7CA 3ETRA 3SHQA 3SFEB 5D3DA 5MPOA 1P7EA 1XCQL 2AL3A 2KJRA 3ZXVA 3T3NA 1XCTL 1Q0WB 4WAAA 2RPQA 4ANXA 2WXLA 3DHIC 3AMZA 4RGTA 5GMVA 3AEBB 4MJSB 1YIWA 4HPMB 1KTKA 2L8JA 3M62B 1GJZA 2N9LA 5EE1A 3VR8B 2JT4B 1NBFC 3H8HA 1E10A 4DQOC 2C5LC 3WIMA 1TGZB 3CSTA 2DZIA 1R4NB 4JQWC 1MFWA 1TY2A 2AQ1B 2BYVE 1WZ0A 2GBNA 2DLBA 3AXCA 1WRIA 4XGAB 3PLUA 4US9A 2LGIA 2RMMA 1FEHA 2NBVB 4HKQA 2WHIA 3KUZA 1XQQA 1GNUA 4IM0A 2LUEA 2IO2B 1RFKA 1YN4A 1HA5A 2D5GA 3NVZA 2FCNA 2REXA 1A5RA 2K6QA 2KWCA 5FR6A 1QILA 4AJYB 2IJ0A 1TZOA 2V3SA 1C78A 2WYQA 1K51A 2MJEA 3NY5A 4K81A 4MGIE 4UDUC 3UINB 2JPHA 2GB1A 1ROEA 3NZUA 4GMVA 1V5OA 2MA9B 4EFOA 3DDCB 2L52A 2O6VA 3OJ3A 2KO3A 4TKNA 4PYZA 2KT7A 1GAQB 2WX0A 3IT6B 4ICVA 4MSQB 1L4ZB 3IVFA 3DBRI 2VH1A 4BKSA 2WXQA 3L0WB 2PE6B 5H92C 1WM2A 1MI0A 1PGBA 4M0WB 1WE6A 2WXFA 4WWMA 4JLCA 1WM3A 2N1VA 2LJ5A 1ZXIA 4LDTB 5IOIA 1KJTA 1ISNA 2ZPYA 1TJEA 2K8CA 2PVOD 1HTQA 4OHJA 5EE9A 4IUMB 1V86A 4FXCA 3DBLB 4MJSA 2JU6X 2D3BA 3RFZB 2WLBA 1UBIA 2CHXA 2N9KA 2ICIA 3NOBA 4C4VB 1T0RC 2INPE 1NI2A 3KLSX 4A90A 4IDIA 2J53A 1I4HA 1HZ6A 1TS4A 3VR9B 3FAHA 4M02A 2KMMA 3IT4B 1V80A 2KDEB 3QCAA 2N4FA 2BS2B 4LNOA 2ZVNA 3HHMA 4DBGA 3RYTA 1AW7A 1RLFA 1FFVA 1UWMA 2K9XA 2BPSA 4XWWA 3AE6B 3Q2AC 4PT5A 3ZTDA 1FCCC 2CJNA 1VZ8A 1XO3A 3U8ZA 1V9JA 2TSSA 4RH6A 4WJQA 1EUVB 2BW2A 1MG4A 3KQ4A 2CU1A 1XD3B 2K39A 5BMGA 2QCZA 2V3NA 4G50A 1LFDA 2Z0EB 2Z0DB 4YT0B 3VDZA 3MTNB 5CHFA 2GBKA 3QK0A 4JWUC 4Q2JA 2V4LA 3I57A 4MM3B 1C76A 2ZJDA 3J9CA 1L6VA 5DPWA 3DVNV 1GOZA 1JWMD 2KMAA 2BYFA 3ONSA 3RZFA 3P63A 4B95A 3PRMB 4ANUA 2AEHA 1EWYC 3SDLC 1C77A 3M63B 4GSWA 3CSFA 3P1MA 1VRAB 4M0WA 1TKGA 1TZ1A 1YOVB 4W9HA 2PMVA 1XLNA 2J0KA 2MBQA 4H2AA 3OLMD 4A6QA 4PS8A 1GPXA 3V05A 3H7SA 5G2NA 1I4QA 3RNAC 4ARCA 1I4PA 1MHXA 3Q3NC 1NDDA 4X57B 2WX1A 3VTVA 3ZXRA 5DPTA 4W9DA 1V1PB 2DNFA 3WAPA 3OJ4B 1WY8A 1RM6C 3DBHI 4C4VA 2ZW0A 2AYOB 2UU7A 4GLSC 4W9IA 3TBLD 1FM0D 1KLUD 3QX1A 1YJ1A 2I1JA 4BVUC 4B0EA 1C4CA 3BVMA 2LVOA 3NVYA 4FJZA 1R4MI 4C00A 1OFFA 2N7JA 4KDIC 3C0RB 1E5WA 3LYYA 1KLGD 2DZJA 1YMHE 3TMPB 3GB1A 2L83A 3R2TA 3WA0A 2PEAA 2DYOA 3T8MA 4A8XC 1UGJA 4B6WA 4AQ7A 4WH4A 3IAS1 1WR1A 2I1KA 1VLBA 1MG8A 1WX7A 2K25A 3AV8A 2MJ3A 1EU3A 3W5VB 2VH2A 1VDVA 1WXAA 3WANA 1D6EC 1J7AA 1SJED 4LNIA 5JHBA 3M3JA 1SIJA 1YX6B 4BBNF 3P4QB 1XLOA 4CHKA 2G9HD 1D5XC 4PS7A 3GP7A 3V60A 4FLHA 3U30A 2O2VA 3L10B 1LXDA 4D2KA 4B0MA 4WWOA 1ACCA 3I5JC 3NUHB 5JXVA 2K5PA 1WX9A 2A4ZA 4MM3A 2DENB 1GUAB 3LDZE 5LNK1 5E6PA 3RCZA 4MELA 3L4PA 4ZYSA 3B08A 3NS8A 1I4GA 4CO7A 2OHFA 2Z8LA 3HM3A 2NBUA 3S2AA 2MSED 3O13A 5LXHA 2FNJB 2RDBC 5G55A 2LXCA 2IGDA 3AN1A 5G5GA 3RUIB 1E8YA 4MH8A 1EO6A 3P42A 3ZUNA 2Y5BB 1UF0A 1FRRA 1L0XB 2LRWA 2MCNB 3MFGA 3UIOB 2GBMA 3NZ3A 1XLPA 1BT0A 4BZAA 1UGMA 1T0SC 2K6DB 2NCNA 2K8HA 1P9DU 4NY0A 3DBHB 4DXFA 2N1WA 4LTUA 3W1SC 2L0FA 4KKJA 1D3ZA 4KGTA 2PE9A 4US8A 5J2RA 3ZQ4A 2JWZA 2D3GA 3MJWA 2BVCA 3O65B 4HEA1 4USAA 2MJDA 1NYQA 1DOXA 4HKZE 1ZUD2 2LWPA 1HEZE 2QSDA 3N20C 3ZVVA 3TJPA 3NS1A 1F1HA 2D3CA 2KC1A 3SD5A 1R4NI 3JW0X 1OEYA 1SIFA 1HZ5A 2GBJA 4YTMB 5BYSA 5D6JB 1JALA 2DYBA 5CX3A 2LGXA 3X0WA 3DWMA 1K53A 4MGZE 1KH0A 5BMHA 3A9JB 3QJZA 3LB8C 4W9JA 4OVVA 3Q8CA 4NQKE 2O6VD 3QHTA 1SBBB 3VHTC 3ZW3A 3R7RA 2NBWB 2KYWA 1ZW7A 3EFUA 4M8MA 3IXSA 1RRBA 2J4XA 4OW0A 1E9MA 4IWOA 5HG2A 2OEDA 3TUOA 3DHHC 4BKSD 2BB6A 2K8BA 2RPVA 5FKAC 4HPLB 3AU5A 4MDKE 1F0ZA 4W9EA 5D2MB 1TTNA 1QOAA 4K7WA 5IKCM 1L0VB 4RF0A 5BMIA 4GN1A 2L32A 3TSSA 2VRRB 3VTWA 3Q14C 2RR9A 2JZ3B 3EC8A 1UD7A 3MHZA 2BWES 1STEA 2WXIA 4YTNB 1AARA 1WJNA 2BS4B 4RNAA 3X23A 1HQRD 4W9GA 2PIAA 4RGOS 3E56A 4GGQA 2RSUA 3OAWA 1PGXA 2PVGC 4XDCA 3N1YC 2PJHA 4HDQA 2R2QA 2ZNVB 2G4SA 2LJIA 4M01A 2MBBB 4M8NA 5JZEB 3CF6E 4GDLB 4TQ1A 3APCA 3GOEA 1ET9A 1F77A 1JWUD 4IM3A 2Z59B 1QLBB 3ALBA 5CHVC 1UNSA 1P0RA 3FKYA 3Q3FA 3DBLI 2G3QB 4HDOA 2L00B 4LJPB 4B9KA 3RI7C 3U7ZA 1J0GA 3SFDB 1OEYJ 1JWAD 3KWLA 2ZCCA 3ZNGC 3QQ8B 4WWPA 2FCMA 4OVZA 2G45B 3W1SA 5L83A 1E8ZA 2BKRB 3AEDB 1C9FA 3ZDTA 3BK2A 2GRIA 4HVBA 2RD0A 3A9JA 3SEBA 2KQ4X 5AZFA 3VH4B 3TEWA 3MP9A 1WR6E 1WX8A 2C60A 4KX6B 4F7ZA 3UQBA 4JL9A 2UYZB 5C2TB 2ZZPB 3IBEA 1E90A 1QOGA 1VR9A 2R2OA 4P7IA 3RNBC 2MWSB 1I7HA 3PRPB 2KWUB 2IPKD 3N32A 3AE9B 3TEZA 2JVCA 4GXBA 3AEFB 3KVFB 1WRDB 4S0RA 2KLGA 2ZVOA 4LDTD 4PS3A 1L0YB 5CHWA 2KD0A 4ZDVA 3VFKA 1WSPA 2WXHA 1DOYA 4RFBA 1TKYA 2V9HA 3PS6A 2HE7A 4G11A 5IN7A 1KFYB 3HVZA 2C7NB 1J19A 3ZJUA 2JZPA 2W3RA 4KVGB 4LNFA 3TCAA 5EDSA 5DPSA 2D07B 1MVKA 1OQRA 4OZCA 2JY6A 4KDLB 2V1YA 3ZO5B 2LVPA 2MQJA 3FC4A 2FCSA 1T5XD 3T3OA 1KRHA 2CU3A 2EMTA 1FNUA 4ZHPA 2BYTA 3KWVA 2Q5WD 3KYDD 4GB9A 3V6EB 4GDLA 2KTRB 3CMMB 3RULA 2JUOA 1N61A 1Z5SB 2KACA 1E8WA 2DZMA 3IG3A 4KSKC 1I4RA 2WXOA 2CS4A 5BYQA 4NJ7A 3CWIA 3AI5A 4HXDA 1H4RA 2FUHB 3RNGC 4ACFA 1HE8A 1S1QB 3U2SC 2LZ6A 3BYYB 4BKGA 5KHQA 1FPYA 1L5PA 2JXTA 2DX5B 2M8SA 2L3ZA 2LHEA 2JRHA 1MJDA 4XZ4A 4BOZB 2HD5B 3R7QA 3BY4B 2AX5A 2KN4A 2HTME 3DQVA 4LLGM 2CJOA 3GE3C 3C19A 3P4RB 1V49A 4BAXA 4J3OD 1VD2A 3MHSD 4EZJA 4QAYA 2LUMA 4LJOB 2KWDA 3N1XC 3VVWB 1VZ7A 2RDGA 2KMCA 2EKIA 3EHVA 3Q8EA 1C79A 1GC6A 3DOWA 4M00A 3DVNU 2B3AA 3P2BA 1IGCA 5DPRA 2DHZA 2V4IB 4FN2A 4RGMA 2WXPA 4HRSA 2QDFA 4ICUA 3V62A 1M4VA 2FE8A 1N62A 3WAMA 2MBOA 1M94A 3JSVB 4FHJA 1MHHE 2N7EA 3AE4B 3U7DA 4EZKA 1ZKHA 5I4DA 4MH0E 2LASA 2O2VB 4JX1C 2IO0B 4KSLC 2W3SA 2J52A 3QIJA 4R3DA 1E8XA 4IOIE 4EZLA 1XF5L 2M56B 4GIVA 3ZNID 3L08A 3DCGA 2W55A 3W2DA 4I6PA 2CKHB 3LJ3A 1TIFA 2KTRA 2QMTA 3H1UA 1LGRA 1EU4A 1YQ3B 3EGRA 4DDID 3MC8A 3B9JA 2AQ3B 3NRZA 2BKFA 2QEJC 3VUWA 2OOBB 3R2IA 4HJKA 2MP2B 3PPAA 4HCPB 5DCNA 5IP4D 1AN8A 1NVID 2C7MB 2KDFB 4AOFA 3TEYA 3LXFA 2L05A 1TBEA 3ZNZB 4HWIB 3RMKC 2FBWB 3TIXA 3H7PB 3ML8A 4ZYNA 4XWTA 4OVUA 1P1AA 4BFRA 3KYCD 5C23A 4XC2A 2QIEB 5C1ZA 3A1QB 4N9F4 3ZNHB 2IY0B 2JYTA 2D11A 1T0YA 4DWFA 1CK1A 1WIAA 2NMQA 1TS5A 3ECIA 1N5XA 3QC8B 1YD8U 1E6EB 1QT9A 3DPDA 2JWUA 2EMSA 4RF1A 1E7UA 1SB3C 3U52E 2KJHB 3VRAB 3NVWA 3RN9C 3MJ5A 2JZZA 3KUCB 3P4SB 2WU2B 3W9CB 3VUYA 1SGHA 4MGYE 3I3TB 2A5UA 5E6JA 1WMHA 4O1NA 2WGSA 1WYGA 3L17A 2KWVB
chains in the Genus database with same CATH topology
1YN4A 3IXSA 1HA5A 2D5GA 2J4XA 3NVZA 4OW0A 2WDVB 2XNAC 2JQRB 1E9MA 2LMCA 4C7YA 4OZBA 1EWCA 5HG2A 2OEDA 1E7PB 3TUOA 5GXGB 2BB6A 2RPVA 5FKAC 3AE7B 1QILA 1F0ZA 2Y5CA 2IJ0A 1QOAA 4MACA 1PGAA 1L0VB 1PYWD 1TZOA 3GS2A 4RF0A 1C78A 1CQVA 1K51A 2MJEA 5BMIA 3URYA 4UDUC 2L32A 3TSSA 2GB1A 1GB4A 1YN5A 1ROEA 3WCQA 2W82A 1KF6B 2WDRB 3AEEB 2WQYB 3MHZA 1ZOYB 3BVGA 1N60A 4XDDA 2L52A 3PZ7A 1STEA 4C56C 2WXIA 4YTNB 3R8BA 3W5UB 4N58A 4HJGE 2BS4B 3AE3B 2M19A 1SE2A 4RNAA 4WIPA 3HRDD 1GAQB 4KKIA 1C4PA 2E3TA 3IT6B 1HQRD 3OWEB 3V3XA 2PIAA 1AYFA 3UI3A 1XXGA 1L4ZB 4RGOS 3E56A 1JQ4A 1PGXA 3BIID 1FO4A 2PVGC 4XDCA 2WXQA 4A55A 4RGNA 1JROA 2X38A 2WDQB 3Q69A 4L1BA 2LJIA 4ARIA 3NVVA 1N5WA 2PKOA 5H92C 1MI0A 1PGBA 4C80A 1T3QA 2WXFA 3AEAB 4WWMA 4ZHOA 2R61A 3Q8AA 2FUG1 1ZXIA 4ZRPA 4GDLB 5FK9C 4TQ1A 3VQIA 2LFIA 1ET9A 1F77A 1JWUD 1TJEA 2PVOD 1QLBB 1B9RA 2J42A 1FCLA 4OHJA 2PLPA 1UNSA 4XE0A 4RCOA 5EE9A 3I9V1 3PZ8A 4FXCA 1DGJA 2JU6X 5EE3A 3RFZB 2MEKA 4JE3B 1ZXHA 2WLBA 3IAM1 3U7ZA 1DYQA 2N9KA 2ICIA 4N59A 3SFDB 1JWAD 3AECB 3CIRB 2K0PA 1JWBD 2KAJA 1AWDA 2INPE 3KWLA 2NTTA 3KLSX 1XLQA 1NEKB 5BYRA 3VRBB 2L1AA 4A90A 2H88B 3B2FA 3BVZA 4IDIA 2J53A 4OVZA 4YSZB 1I4HA 2ACZB 5HFYA 1PDXA 3W1SA 1HZ6A 1TS4A 3VR9B 3AEDB 2HDEA 3FAHA 1C9FA 4JWSC 2KMMA 3IT4B 3BK2A 2GRIA 4KGRA 2H89B 1QOBA 4ITKA 4NAWB 3SEBA 2KQ4X 3TEWA 2BS2B 3MP9A 4L23A 2QILA 3FILB 4KX6B 4OZAA 2JX5A 4TSSA 5C2TB 1AW7A 1VR9A 1QOGA 1FFVA 1UWMA 2K9XA 4XWWA 3ABVB 3AE6B 4PT5A 1I7HA 1TYGB 2NTSA 1FCCC 4YXDB 2IPKD 2CJNA 3AE9B 5AUIA 3TEZA 2G1EA 1D5ZC 2Y3AA 1VZ8A 3AEFB 1XO3A 1FD6A 1JRPA 2TSSA 2V0GA 4RH6A 1Q10A 3BYTB 1L0YB 2ZW1A 1MPEA 1UUPA 2SEBD 5EE0A 5H8YE 2BW2A 3BZDB 1WSPA 2WXHA 3KQ4A 1DOYA 4RFBA 1L6UA 1C4AA 4LK0M 1TKYA 5BMGA 1KFYB 2V3NA 3HVZA 5D3IB 3ZJUA 1WWTA 1JCKB 2JZPA 1ET6A 4YT0B 1WGKA 1TY0A 2IDYA 4P6VF 2W3RA 3AE8B 4WQMA 5TSSA 2INNE 1MVKA 1OQRA 1QOFA 5G5HA 1VJKA 4JWUC 1F2RC 4OZCA 4Q2JA 3I57A 4MM3B 4YSXB 1C76A 3J9CA 1L6VA 1WXQA 2ON8A 3FC4A 1GOZA 1JWMD 1ENFA 2EELA 1T5XD 3P63A 3T3OA 5C3JB 1FNWA 1KRHA 2CU3A 1EWYC 1C77A 1JWSD 1FNUA 2AQ2B 4ZHPA 3P1MA 1VRAB 2BYTA 4M0WA 1TKGA 3KWVA 3MC0B 1SE4A 2Q5WD 2PMVA 4YSYB 1YJIA 2I38A 1L4DB 1XLNA 3HUIA 5T8IA 4H2AA 4A6QA 1LO5D 2BT6A 1GPXA 1A70A 3E9SA 3B2GA 1N61A 3AE2B 3ZJVA 4C7ZA 3V05A 2KACA 1QF6A 1I4QA 4EE2A 4ARCA 1OQQA 1I4PA 1MHXA 2WNMA 4KGSA 1F2RI 1V1PA 1V8CA 1I4RA 2WXOA 5BYQA 3Q8BA 1V1PB 3CWIA 5FR3A 2WXRA 1K52A 1RM6C 1DOIA 3U2SC 1BXTA 4MT5A 1TS3A 3BYYB 1SSNA 4TQ0A 4YWGG 2ZW0A 1FMAD 1BUIC 1L5PA 4GLSC 2JXTA 1FM0D 1ZE3D 1KLUD 2LHEA 1JW9D 3PO0A 4B0EA 1JMLA 1C4CA 3BVMA 4L2YA 4DXGA 3NVYA 3U4EG 3N9YC 1ZPSA 1OFFA 2I2YA 2N7JA 2M0AA 2BB5A 5HI1A 2AX5A 2KN4A 1FXIA 2HTME 3AE1B 3LYYA 3FILA 1HXYD 1KLGD 1YMHE 2YEPF 4LLGM 2CJOA 2JYEA 3GB1A 2L83A 3R2TA 4P16A 3AH7A 3P4RB 2WXMA 2DYOA 2V3PA 1T6BX 4A8XC 1UGJA 4J3OD 1D4BA 4AQ7A 4WH4A 3IAS1 2LUMA 2KWDA 1VLBA 3AV8A 1GB1A 2MJ3A 2IGGA 3ZYYX 1VZ7A 1EU3A 4WAFA 1SE3A 2RDGA 4YTPB 1SJHD 2EKIA 3W5VB 2WXNA 3Q8EA 4NJCA 1VDVA 1C79A 1D5MC 1N63A 1E0ZA 3AB5A 1D6EC 3TEXA 1J7AA 1SJED 1IGCA 2N0SB 1K50A 1SIJA 3EUB2 2KDMA 2V4IB 3P4QB 1XLOA 3BK1A 4RGMA 2WXPA 2G9HD 1SF0A 4HRSA 1B1ZA 1D5XC 1YQ4B 3C8YA 4ZRQA 3GP7A 1M4VA 2FE8A 1N62A 3Q8FA 1NENB 1QQRA 1XEEA 4D2KA 4B0MA 1MHHE 3AE4B 5I4DA 1TS2A 2GI9A 2VZKD 1ACCA 4WURA 1FXAA 3NUHB 4JX1C 5JXVA 4IKGA 2K5PA 2WP9B 2W3SA 2DWQA 2B76B 2J52A 1ESFA 1TKEA 4ZOHC 2LEKA 3AEGB 5LNK1 2JSVX 3DWGC 1FRDA 4R3DA 4NZLB 4IOIE 2YEPB 3L4PA 4ZYSA 1CJEA 1XF5L 1PFDA 2M56B 2RDHA 1I4GA 3AM9A 2DBYA 1VZ6A 2W55A 4NAMA 3W2DA 2OHFA 3HVDA 2Y5PA 2Z8LA 4TMAB 1SXTA 3RPFC 1YJJA 2BS3B 2DYMA 2QMTA 3EA6A 3O13A 4REZA 2MH7A 1FFUA 3BWUD 2WS3B 1EU4A 1YQ3B 3EGRA 1PUTA 3ZGZA 3ZJTA 3B9JA 2K22A 5G5GA 2IGDA 3AN1A 2AQ3B 3NRZA 1V97A 2PTLA 2XN9C 1P7FA 2QEJC 2ONQA 3R2IA 4JPSA 4MH8A 3P42A 1IBXA 2WXKA 1ZP0B 1FRRA 1AN8A 1L0XB 1Y56A 1NVID 3MFGA 1IBXB 3TEYA 1IUEA 2VZKB 3LXFA 3NZ3A 2W54A 1XLPA 1J7BA 4CQNA 2LHDA 2K3UA 2FBWB 1RWSA 4XWTA 2PW9A 3P4PB 1IGDA 1J7CA 3ETRA 4DXFA 2BTEA 3SFEB 4LTUA 4N6EB 1R7SA 5D3DA 5MPOA 1P7EA 1XCQL 2QIEB 4KKJA 4AS1A 1CZPA 4A9AA 1FIQA 4KGTA 4US8A 1QKZA 3ZQ4A 1YNTE 3T3NA 1YN3A 1XCTL 2BBCA 2JYTA 5HHDG 1RYJA 2WXLA 3AMZA 4RGTA 4GDKB 3AEBB 1CK1A 4HEA1 4USAA 2MJDA 1KTKA 1NYQA 2NMQA 1DOXA 4HKZE 1FNVA 1TS5A 1N5XA 2QJLA 3SR6A 2N9LA 1I4XA 1ZUD2 5EE1A 1E6EB 1HEZE 1QT9A 2JWUA 3VR8B 5D7GA 2WXJA 1UWXA 4RF1A 2IGHA 1SB3C 2QSDA 3H8HA 3U52E 5AUKA 1E10A 3NS1A 1SEBD 4DQOC 1NYRA 3AE5B 3VRAB 1HZ5A 3NVWA 2E6XA 1TY2A 2AQ1B 4YTMB 1NI3A 5BYSA 3MJ5A 3P4SB 2DLBA 2WU2B 3W9CB 1WRIA 1ZDXA 1BMLC 1JALA 1V1OA 1EM7A 4US9A 5E6JA 2WXGA 2LGIA 2RMMA 2SAKA 4HROA 3DWMA 4O1NA 1FEHA 1K53A 1KH0A 5BMHA 3LB8C 4HKQA 3Q8CA 1SBBB 2WU5B 1WYGA 1ZDVA 1RFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRI A;  2IDY A;  2M0A A; 
#chains in the Genus database with same CATH topology
 3M95 A;  4A3O A;  2LXA A;  2XNA C;  3JSV A;  1GG3 A;  4XYC A;  4FJV B;  2JQR B;  2LMC A;  3EFC A;  2NPT B;  4FHK A;  4DHZ E;  2OJW A;  5J18 A;  3AE7 B;  5HKH A;  4MAC A;  1PGA A;  4K7S A;  1PYW D;  1CQV A;  1WJU A;  4I6N B;  3URY A;  3K9P B;  1GB4 A;  3A9K B;  3QA8 A;  2J0J A;  1YN5 A;  1J8C A;  3WCQ A;  1LM8 B;  2W82 A;  1KF6 B;  1TT5 B;  3PRZ A;  2RGF A;  2WQY B;  1U4A A;  1VCB A;  1N60 A;  3ZRC A;  4LCD E;  2L7R A;  4ASW C;  2QHO A;  4HJG E;  3AE3 B;  4WIP A;  2M19 A;  1SE2 A;  3R3M A;  3OWE B;  3V3X A;  2MP2 A;  1YX5 B;  3UI3 A;  1WJ4 A;  4W9F A;  3BII D;  4A55 A;  1JRO A;  2X38 A;  2WDQ B;  4L1B A;  4ARI A;  2GLS A;  4C80 A;  3Q6B A;  3H7P A;  4JGH B;  4ZHO A;  2R61 A;  3Q8A A;  2FUG 1;  2GBR A;  5FK9 C;  1CMX B;  3PRE A;  5AZG A;  3BIN A;  3UQA A;  2J42 A;  3A1Q A;  1FCL A;  2PLP A;  3D32 A;  4XE0 A;  4RCO A;  3PZ8 A;  4BKT A;  3UGB B;  1SE9 A;  2KJ6 A;  1P98 A;  5EE3 A;  2MBE A;  2MEK A;  3K9O B;  1ZXH A;  3IAM 1;  4ZRI A;  4N59 A;  4W9C A;  3PHX B;  4NPN A;  3CIR B;  2K0P A;  1T0Q C;  5TR5 A;  4IM2 A;  1E7V A;  3RD2 A;  1NEK B;  1XLQ A;  3PGE A;  5BYR A;  3VRB B;  2JRI B;  2L1A A;  3B2F A;  4GU2 A;  1PDX A;  4RMA A;  1OGW A;  2HDE A;  4I6L B;  4KGR A;  2H89 B;  1QOB A;  4ITK A;  3NHE B;  2QIL A;  3FIL B;  3ZKJ C;  4A3P A;  3ZRF A;  4OZA A;  2JX5 A;  1V81 A;  2MLB A;  1F9J A;  2KK8 A;  2ZCB A;  1KLV A;  3B1L X;  3UIP B;  4EEW A;  2NPT A;  4G0N B;  4E74 A;  3ABV B;  4JIO U;  1XT9 B;  1TYG B;  2X8X X;  1Q5W B;  3KW5 B;  4E3C A;  3A33 B;  2G1E A;  1D5Z C;  3HIZ A;  1Q10 A;  1UZX B;  1IPG A;  2ZW1 A;  1UUP A;  2SEB D;  3BZD B;  1Q1O A;  3DVG Y;  3A9K A;  1L6U A;  5IO9 A;  4LK0 M;  1YQB A;  1Z2M A;  3T9L A;  2L76 A;  2NVU I;  4LNN A;  5D3I B;  2KFJ A;  1JCK B;  2FAZ A;  1ET6 A;  1WGK A;  1TY0 A;  3VH3 B;  2IDY A;  5E6N A;  4LNK A;  5TSS A;  5G5H A;  1VJK A;  1F2R C;  2LI5 A;  4EUT A;  4YSX B;  2LRU A;  3I63 C;  4W9L A;  3V61 A;  1ENF A;  2EEL A;  2N7D A;  5C3J B;  2KN5 A;  3AUL A;  3APD A;  2MBH A;  3MC0 B;  1SE4 A;  4YSY B;  2BGF A;  2I38 A;  5T8I A;  3VAW A;  4DDG D;  2KNB A;  2UWQ A;  4C7Z A;  2MHJ A;  5LXI B;  1OQQ A;  2WNM A;  4KGS A;  2DZK A;  1V8C A;  1WYW B;  4P1C C;  3DBS A;  4NJ6 A;  2WXR A;  1K52 A;  1QZE A;  4DHZ B;  1Y8R C;  1DOI A;  3RZW C;  4TQ0 A;  1FMA D;  3OG5 A;  2N9X A;  1ZE3 D;  1JW9 D;  2KOX A;  4FA6 A;  1JML A;  2XK5 A;  4WJN A;  3ZDM C;  3N9Y C;  1UBQ A;  1ZPS A;  4TV3 A;  2M0A A;  2BB5 A;  1FXI A;  4AJW A;  3FIL A;  1HXY D;  2D2Q A;  1WXS A;  4DXA B;  2WXM A;  3R66 C;  2V3P A;  1T6B X;  2BYE A;  1GB1 A;  3VTU A;  1IYF A;  2HJ8 A;  1SE3 A;  3EEC A;  1SJH D;  2IY1 B;  3PV1 A;  2WXN A;  1LQB A;  1D5M C;  2JXX A;  1N63 A;  3AB5 A;  3TEX A;  2N0S B;  1K50 A;  4URK A;  3EUB 2;  2KDM A;  3ZIM A;  3BK1 A;  1SF0 A;  1YQ4 B;  1P3Q U;  4FJY A;  4ZRQ A;  4MGK E;  3Q8F A;  1NEN B;  1XEE A;  1TS2 A;  2VZK D;  4ZRK A;  1I35 A;  4WUR A;  1FXA A;  2WP9 B;  4ZOH C;  2KXJ A;  2IND C;  4KZC A;  2KVR A;  3RNE C;  1L2N A;  2KDI A;  2YEP B;  3QAQ A;  1CJE A;  4K3C A;  1PFD A;  2BF8 B;  2DBY A;  1VZ6 A;  2D10 A;  3HVD A;  3PSE B;  4TMA B;  1RAX A;  3RPF C;  1YJJ A;  2BS3 B;  2DYM A;  4EOY A;  3UF8 A;  1WFY A;  4ZRJ A;  2YVC A;  4REZ A;  5CTR C;  2MH7 A;  1FFU A;  2KX3 A;  1PUT A;  1C1Y B;  3ZJT A;  2ZPN A;  2M4N A;  4F1S A;  2PTL A;  2XN9 C;  1P7F A;  1G6J A;  4HCN B;  2ONQ A;  4KZ0 A;  5BO4 B;  1IBX A;  4K7U A;  5AEK B;  1ZP0 B;  2VZK B;  3L16 A;  2KHW B;  1J7B A;  3IHP C;  3WAO A;  1KOT A;  1H8C A;  2GOW A;  1RWS A;  3L54 A;  2PW9 A;  3P4P B;  2BTE A;  5E6O A;  4N6E B;  1R7S A;  2GMI C;  2OJR A;  4AS1 A;  1CZP A;  4A9A A;  1FIQ A;  4DHJ D;  1QKZ A;  3TL5 A;  2HJ1 A;  1YNT E;  3QWZ B;  1YN3 A;  2BBC A;  3B0A A;  5HHD G;  1RYJ A;  1WXM A;  4GDK B;  4TUU A;  4ANV A;  3RT3 B;  3VUX A;  1FNV A;  2QJL A;  3SR6 A;  1I4X A;  2LVQ A;  1WGD A;  2KDB A;  5D7G A;  2WXJ A;  1UWX A;  2IGH A;  5AUK A;  1SEB D;  3GZN I;  1NYR A;  4K3B A;  1UEL A;  2FID A;  3AE5 B;  3N30 A;  3H9D A;  3PZD A;  2E6X A;  1NI3 A;  4IWP A;  2DAF A;  1ZDX A;  1BML C;  1V1O A;  1EM7 A;  2WXG A;  2SAK A;  4HRO A;  1WMH B;  4KIK B;  3L13 A;  5JH5 C;  2WU5 B;  3DHG C;  1ZDV A;  4DHJ B;  4WWN A;  3N3K B;  2CHZ A;  4AWJ A;  2WDV B;  4HPP A;  3RNC C;  4C7Y A;  4OZB A;  1EWC A;  1E7P B;  2LGD A;  5GXG B;  3WAL A;  2XEW A;  4KV2 A;  2Y5C A;  2IBI B;  3ZTC A;  3GS2 A;  3SU8 X;  4A20 A;  1KM7 A;  4ANW A;  3PTF C;  2BQQ A;  2WDR B;  3Q3J A;  3AEE B;  4PYU A;  5IA7 A;  2AWT A;  1ZOY B;  3BVG A;  4XDD A;  3PZ7 A;  1WGR A;  3KH0 A;  4C56 C;  3R8B A;  3W5U B;  4N58 A;  4FUL A;  2LGS A;  3HRD D;  2KQS A;  4KKI A;  1C4P A;  2E3T A;  2L0T A;  1AYF A;  2IO1 B;  2LD9 A;  3H6N A;  1XXG A;  1HTO A;  2MW5 A;  4W9K A;  3A4S C;  1JQ4 A;  5L95 C;  1FO4 A;  3DBR B;  2C9W B;  2WDT B;  4IW0 A;  1V6E A;  4G3X B;  1WZ3 A;  4RGN A;  2IYD B;  3Q69 A;  3NVV A;  1N5W A;  2PKO A;  1T3Q A;  3AEA B;  2NS5 A;  3RNF C;  4ZRP A;  4GOC A;  2KFK B;  2MX2 A;  2C7H A;  3VQI A;  2LFI A;  2IZV B;  1I42 A;  2HTH A;  1B9R A;  5D94 A;  1OQY A;  1L7Y A;  3I9V 1;  4GDK A;  1DGJ A;  2QC8 A;  2CR5 A;  3ENE A;  4JE3 B;  1DYQ A;  3PVL A;  3AEC B;  3HM6 X;  2KAJ A;  1JWB D;  3W1Y A;  1AWD A;  4XX5 A;  2NTT A;  3GZN B;  2KVZ A;  2H88 B;  3BVZ A;  4YSZ B;  2ACZ B;  5HFY A;  2M0X A;  2AL6 A;  4IC7 B;  2IO3 B;  4JWS C;  2KAN A;  3A4R A;  4KIK A;  4NAW B;  5J17 A;  4L23 A;  3JYU A;  4TSS A;  3IFW B;  2N9E B;  4IG7 B;  3NZS A;  2KZR A;  2NTS A;  5AZH A;  4YXD B;  5AUI A;  4NQL B;  2KQ7 A;  2Y3A A;  1FD6 A;  2INC C;  1JRP A;  2V0G A;  3BYT B;  1MPE A;  3KUD B;  5EE0 A;  5H8Y E;  4CYE A;  1C4A A;  4RM9 A;  1C3T A;  2LGY A;  5KHO A;  1ZGU B;  1WWT A;  4MEM A;  4P6V F;  3AE8 B;  4RM8 A;  3AU4 A;  4WQM A;  2INN E;  1OTR B;  1QOF A;  4NNJ B;  1WGG A;  3NG0 A;  2M1M A;  1JRU A;  2EKE C;  1WXQ A;  2ON8 A;  2N9P C;  2FCQ A;  1RFA A;  2KKC A;  1FNW A;  1UH6 A;  3Q3O C;  1JWS D;  1WH3 A;  2AQ2 B;  1WGY A;  1EF1 A;  1X1M A;  2G4D B;  4S17 A;  1YJI A;  1F52 A;  1L4D B;  3HUI A;  5IAA C;  1LO5 D;  2KFK A;  1IP9 A;  2BT6 A;  1A70 A;  3V6C B;  3E9S A;  3PT2 B;  3B2G A;  1WXV A;  3AE2 B;  3ZJV A;  4PK1 A;  1QF6 A;  4EE2 A;  1V5T A;  2FIF A;  2WWZ A;  1F2R I;  1V1P A;  2D3A A;  5JHA A;  3Q8B A;  2KX0 A;  3ML9 A;  2JF5 A;  1N6Z A;  5FR3 A;  3Q3M C;  2KTF A;  3VXW A;  5LLI A;  1BXT A;  2J7Q B;  4MT5 A;  1TS3 A;  1SSN A;  4YWG G;  4WQO B;  1BUI C;  4BOS C;  1K8R B;  3PO0 A;  2KLC A;  4K1R B;  4L2Y A;  4DXG A;  3U4E G;  4II2 B;  1R4M B;  2XK5 B;  2I2Y A;  3HK0 A;  4NAW A;  5HI1 A;  4E71 A;  3AE1 B;  2YEP F;  2JYE A;  4P16 A;  3AH7 A;  3ZLZ A;  4DK5 A;  2J0M A;  2CHW A;  1D4B A;  1WF9 A;  1WGH A;  4WJP A;  3PHW B;  1GC7 A;  3ZYY X;  2IGG A;  2KC2 A;  4WAF A;  1PQS A;  4YTP B;  4NJC A;  1E0Z A;  1WJ6 A;  2MRP A;  2PPH A;  3APF A;  3PLV A;  4AP4 C;  4EKU A;  1B1Z A;  3C8Y A;  1QQR A;  4P1B C;  2GI9 A;  4YL8 A;  4IWQ A;  4IKG A;  2DWQ A;  2B76 B;  2ASQ A;  1ESF A;  1TKE A;  2ZNV C;  3JVZ X;  4BBN C;  2LEK A;  4AUQ C;  2BWF A;  2XBB C;  3AEG B;  2W9N A;  2JSV X;  3DWG C;  1FRD A;  4NZL B;  3NJT A;  3DVG X;  2YLM A;  3MC9 A;  2RDH A;  3AM9 A;  4HLE A;  4NAM A;  4F8C B;  4FBJ B;  2ZEQ A;  2Y5P A;  1SXT A;  4HK2 A;  2M17 A;  1WI0 A;  3EA6 A;  1S3S G;  3BWU D;  2O6V B;  2WS3 B;  3ZGZ A;  2K22 A;  1V97 A;  4MSM B;  4JPS A;  4II3 B;  4WJO A;  3QAR A;  3N1Z C;  4J6I A;  1FXT B;  2WXK A;  1Y56 A;  4FAD A;  1WE7 A;  1IBX B;  1V2Y A;  1IUE A;  2W54 A;  2NR2 A;  4CQN A;  2DAJ A;  2K1F A;  2LHD A;  2K3U A;  1EF5 A;  3GE8 C;  1IGD A;  1J7C A;  3ETR A;  3SHQ A;  3SFE B;  5D3D A;  5MPO A;  1P7E A;  1XCQ L;  2AL3 A;  2KJR A;  3ZXV A;  3T3N A;  1XCT L;  1Q0W B;  4WAA A;  2RPQ A;  4ANX A;  2WXL A;  3DHI C;  3AMZ A;  4RGT A;  5GMV A;  3AEB B;  4MJS B;  1YIW A;  4HPM B;  1KTK A;  2L8J A;  3M62 B;  1GJZ A;  2N9L A;  5EE1 A;  3VR8 B;  2JT4 B;  1NBF C;  3H8H A;  1E10 A;  4DQO C;  2C5L C;  3WIM A;  1TGZ B;  3CST A;  2DZI A;  1R4N B;  4JQW C;  1MFW A;  1TY2 A;  2AQ1 B;  2BYV E;  1WZ0 A;  2GBN A;  2DLB A;  3AXC A;  1WRI A;  4XGA B;  3PLU A;  4US9 A;  2LGI A;  2RMM A;  1FEH A;  2NBV B;  4HKQ A;  2WHI A;  3KUZ A;  1XQQ A;  1GNU A;  4IM0 A;  2LUE A;  2IO2 B;  1RFK A;  1YN4 A;  1HA5 A;  2D5G A;  3NVZ A;  2FCN A;  2REX A;  1A5R A;  2K6Q A;  2KWC A;  5FR6 A;  1QIL A;  4AJY B;  2IJ0 A;  1TZO A;  2V3S A;  1C78 A;  2WYQ A;  1K51 A;  2MJE A;  3NY5 A;  4K81 A;  4MGI E;  4UDU C;  3UIN B;  2JPH A;  2GB1 A;  1ROE A;  3NZU A;  4GMV A;  1V5O A;  2MA9 B;  4EFO A;  3DDC B;  2L52 A;  2O6V A;  3OJ3 A;  2KO3 A;  4TKN A;  4PYZ A;  2KT7 A;  1GAQ B;  2WX0 A;  3IT6 B;  4ICV A;  4MSQ B;  1L4Z B;  3IVF A;  3DBR I;  2VH1 A;  4BKS A;  2WXQ A;  3L0W B;  2PE6 B;  5H92 C;  1WM2 A;  1MI0 A;  1PGB A;  4M0W B;  1WE6 A;  2WXF A;  4WWM A;  4JLC A;  1WM3 A;  2N1V A;  2LJ5 A;  1ZXI A;  4LDT B;  5IOI A;  1KJT A;  1ISN A;  2ZPY A;  1TJE A;  2K8C A;  2PVO D;  1HTQ A;  4OHJ A;  5EE9 A;  4IUM B;  1V86 A;  4FXC A;  3DBL B;  4MJS A;  2JU6 X;  2D3B A;  3RFZ B;  2WLB A;  1UBI A;  2CHX A;  2N9K A;  2ICI A;  3NOB A;  4C4V B;  1T0R C;  2INP E;  1NI2 A;  3KLS X;  4A90 A;  4IDI A;  2J53 A;  1I4H A;  1HZ6 A;  1TS4 A;  3VR9 B;  3FAH A;  4M02 A;  2KMM A;  3IT4 B;  1V80 A;  2KDE B;  3QCA A;  2N4F A;  2BS2 B;  4LNO A;  2ZVN A;  3HHM A;  4DBG A;  3RYT A;  1AW7 A;  1RLF A;  1FFV A;  1UWM A;  2K9X A;  2BPS A;  4XWW A;  3AE6 B;  3Q2A C;  4PT5 A;  3ZTD A;  1FCC C;  2CJN A;  1VZ8 A;  1XO3 A;  3U8Z A;  1V9J A;  2TSS A;  4RH6 A;  4WJQ A;  1EUV B;  2BW2 A;  1MG4 A;  3KQ4 A;  2CU1 A;  1XD3 B;  2K39 A;  5BMG A;  2QCZ A;  2V3N A;  4G50 A;  1LFD A;  2Z0E B;  2Z0D B;  4YT0 B;  3VDZ A;  3MTN B;  5CHF A;  2GBK A;  3QK0 A;  4JWU C;  4Q2J A;  2V4L A;  3I57 A;  4MM3 B;  1C76 A;  2ZJD A;  3J9C A;  1L6V A;  5DPW A;  3DVN V;  1GOZ A;  1JWM D;  2KMA A;  2BYF A;  3ONS A;  3RZF A;  3P63 A;  4B95 A;  3PRM B;  4ANU A;  2AEH A;  1EWY C;  3SDL C;  1C77 A;  3M63 B;  4GSW A;  3CSF A;  3P1M A;  1VRA B;  4M0W A;  1TKG A;  1TZ1 A;  1YOV B;  4W9H A;  2PMV A;  1XLN A;  2J0K A;  2MBQ A;  4H2A A;  3OLM D;  4A6Q A;  4PS8 A;  1GPX A;  3V05 A;  3H7S A;  5G2N A;  1I4Q A;  3RNA C;  4ARC A;  1I4P A;  1MHX A;  3Q3N C;  1NDD A;  4X57 B;  2WX1 A;  3VTV A;  3ZXR A;  5DPT A;  4W9D A;  1V1P B;  2DNF A;  3WAP A;  3OJ4 B;  1WY8 A;  1RM6 C;  3DBH I;  4C4V A;  2ZW0 A;  2AYO B;  2UU7 A;  4GLS C;  4W9I A;  3TBL D;  1FM0 D;  1KLU D;  3QX1 A;  1YJ1 A;  2I1J A;  4BVU C;  4B0E A;  1C4C A;  3BVM A;  2LVO A;  3NVY A;  4FJZ A;  1R4M I;  4C00 A;  1OFF A;  2N7J A;  4KDI C;  3C0R B;  1E5W A;  3LYY A;  1KLG D;  2DZJ A;  1YMH E;  3TMP B;  3GB1 A;  2L83 A;  3R2T A;  3WA0 A;  2PEA A;  2DYO A;  3T8M A;  4A8X C;  1UGJ A;  4B6W A;  4AQ7 A;  4WH4 A;  3IAS 1;  1WR1 A;  2I1K A;  1VLB A;  1MG8 A;  1WX7 A;  2K25 A;  3AV8 A;  2MJ3 A;  1EU3 A;  3W5V B;  2VH2 A;  1VDV A;  1WXA A;  3WAN A;  1D6E C;  1J7A A;  1SJE D;  4LNI A;  5JHB A;  3M3J A;  1SIJ A;  1YX6 B;  4BBN F;  3P4Q B;  1XLO A;  4CHK A;  2G9H D;  1D5X C;  4PS7 A;  3GP7 A;  3V60 A;  4FLH A;  3U30 A;  2O2V A;  3L10 B;  1LXD A;  4D2K A;  4B0M A;  4WWO A;  1ACC A;  3I5J C;  3NUH B;  5JXV A;  2K5P A;  1WX9 A;  2A4Z A;  4MM3 A;  2DEN B;  1GUA B;  3LDZ E;  5LNK 1;  5E6P A;  3RCZ A;  4MEL A;  3L4P A;  4ZYS A;  3B08 A;  3NS8 A;  1I4G A;  4CO7 A;  2OHF A;  2Z8L A;  3HM3 A;  2NBU A;  3S2A A;  2MSE D;  3O13 A;  5LXH A;  2FNJ B;  2RDB C;  5G55 A;  2LXC A;  2IGD A;  3AN1 A;  5G5G A;  3RUI B;  1E8Y A;  4MH8 A;  1EO6 A;  3P42 A;  3ZUN A;  2Y5B B;  1UF0 A;  1FRR A;  1L0X B;  2LRW A;  2MCN B;  3MFG A;  3UIO B;  2GBM A;  3NZ3 A;  1XLP A;  1BT0 A;  4BZA A;  1UGM A;  1T0S C;  2K6D B;  2NCN A;  2K8H A;  1P9D U;  4NY0 A;  3DBH B;  4DXF A;  2N1W A;  4LTU A;  3W1S C;  2L0F A;  4KKJ A;  1D3Z A;  4KGT A;  2PE9 A;  4US8 A;  5J2R A;  3ZQ4 A;  2JWZ A;  2D3G A;  3MJW A;  2BVC A;  3O65 B;  4HEA 1;  4USA A;  2MJD A;  1NYQ A;  1DOX A;  4HKZ E;  1ZUD 2;  2LWP A;  1HEZ E;  2QSD A;  3N20 C;  3ZVV A;  3TJP A;  3NS1 A;  1F1H A;  2D3C A;  2KC1 A;  3SD5 A;  1R4N I;  3JW0 X;  1OEY A;  1SIF A;  1HZ5 A;  2GBJ A;  4YTM B;  5BYS A;  5D6J B;  1JAL A;  2DYB A;  5CX3 A;  2LGX A;  3X0W A;  3DWM A;  1K53 A;  4MGZ E;  1KH0 A;  5BMH A;  3A9J B;  3QJZ A;  3LB8 C;  4W9J A;  4OVV A;  3Q8C A;  4NQK E;  2O6V D;  3QHT A;  1SBB B;  3VHT C;  3ZW3 A;  3R7R A;  2NBW B;  2KYW A;  1ZW7 A;  3EFU A;  4M8M A;  3IXS A;  1RRB A;  2J4X A;  4OW0 A;  1E9M A;  4IWO A;  5HG2 A;  2OED A;  3TUO A;  3DHH C;  4BKS D;  2BB6 A;  2K8B A;  2RPV A;  5FKA C;  4HPL B;  3AU5 A;  4MDK E;  1F0Z A;  4W9E A;  5D2M B;  1TTN A;  1QOA A;  4K7W A;  5IKC M;  1L0V B;  4RF0 A;  5BMI A;  4GN1 A;  2L32 A;  3TSS A;  2VRR B;  3VTW A;  3Q14 C;  2RR9 A;  2JZ3 B;  3EC8 A;  1UD7 A;  3MHZ A;  2BWE S;  1STE A;  2WXI A;  4YTN B;  1AAR A;  1WJN A;  2BS4 B;  4RNA A;  3X23 A;  1HQR D;  4W9G A;  2PIA A;  4RGO S;  3E56 A;  4GGQ A;  2RSU A;  3OAW A;  1PGX A;  2PVG C;  4XDC A;  3N1Y C;  2PJH A;  4HDQ A;  2R2Q A;  2ZNV B;  2G4S A;  2LJI A;  4M01 A;  2MBB B;  4M8N A;  5JZE B;  3CF6 E;  4GDL B;  4TQ1 A;  3APC A;  3GOE A;  1ET9 A;  1F77 A;  1JWU D;  4IM3 A;  2Z59 B;  1QLB B;  3ALB A;  5CHV C;  1UNS A;  1P0R A;  3FKY A;  3Q3F A;  3DBL I;  2G3Q B;  4HDO A;  2L00 B;  4LJP B;  4B9K A;  3RI7 C;  3U7Z A;  1J0G A;  3SFD B;  1OEY J;  1JWA D;  3KWL A;  2ZCC A;  3ZNG C;  3QQ8 B;  4WWP A;  2FCM A;  4OVZ A;  2G45 B;  3W1S A;  5L83 A;  1E8Z A;  2BKR B;  3AED B;  1C9F A;  3ZDT A;  3BK2 A;  2GRI A;  4HVB A;  2RD0 A;  3A9J A;  3SEB A;  2KQ4 X;  5AZF A;  3VH4 B;  3TEW A;  3MP9 A;  1WR6 E;  1WX8 A;  2C60 A;  4KX6 B;  4F7Z A;  3UQB A;  4JL9 A;  2UYZ B;  5C2T B;  2ZZP B;  3IBE A;  1E90 A;  1QOG A;  1VR9 A;  2R2O A;  4P7I A;  3RNB C;  2MWS B;  1I7H A;  3PRP B;  2KWU B;  2IPK D;  3N32 A;  3AE9 B;  3TEZ A;  2JVC A;  4GXB A;  3AEF B;  3KVF B;  1WRD B;  4S0R A;  2KLG A;  2ZVO A;  4LDT D;  4PS3 A;  1L0Y B;  5CHW A;  2KD0 A;  4ZDV A;  3VFK A;  1WSP A;  2WXH A;  1DOY A;  4RFB A;  1TKY A;  2V9H A;  3PS6 A;  2HE7 A;  4G11 A;  5IN7 A;  1KFY B;  3HVZ A;  2C7N B;  1J19 A;  3ZJU A;  2JZP A;  2W3R A;  4KVG B;  4LNF A;  3TCA A;  5EDS A;  5DPS A;  2D07 B;  1MVK A;  1OQR A;  4OZC A;  2JY6 A;  4KDL B;  2V1Y A;  3ZO5 B;  2LVP A;  2MQJ A;  3FC4 A;  2FCS A;  1T5X D;  3T3O A;  1KRH A;  2CU3 A;  2EMT A;  1FNU A;  4ZHP A;  2BYT A;  3KWV A;  2Q5W D;  3KYD D;  4GB9 A;  3V6E B;  4GDL A;  2KTR B;  3CMM B;  3RUL A;  2JUO A;  1N61 A;  1Z5S B;  2KAC A;  1E8W A;  2DZM A;  3IG3 A;  4KSK C;  1I4R A;  2WXO A;  2CS4 A;  5BYQ A;  4NJ7 A;  3CWI A;  3AI5 A;  4HXD A;  1H4R A;  2FUH B;  3RNG C;  4ACF A;  1HE8 A;  1S1Q B;  3U2S C;  2LZ6 A;  3BYY B;  4BKG A;  5KHQ A;  1FPY A;  1L5P A;  2JXT A;  2DX5 B;  2M8S A;  2L3Z A;  2LHE A;  2JRH A;  1MJD A;  4XZ4 A;  4BOZ B;  2HD5 B;  3R7Q A;  3BY4 B;  2AX5 A;  2KN4 A;  2HTM E;  3DQV A;  4LLG M;  2CJO A;  3GE3 C;  3C19 A;  3P4R B;  1V49 A;  4BAX A;  4J3O D;  1VD2 A;  3MHS D;  4EZJ A;  4QAY A;  2LUM A;  4LJO B;  2KWD A;  3N1X C;  3VVW B;  1VZ7 A;  2RDG A;  2KMC A;  2EKI A;  3EHV A;  3Q8E A;  1C79 A;  1GC6 A;  3DOW A;  4M00 A;  3DVN U;  2B3A A;  3P2B A;  1IGC A;  5DPR A;  2DHZ A;  2V4I B;  4FN2 A;  4RGM A;  2WXP A;  4HRS A;  2QDF A;  4ICU A;  3V62 A;  1M4V A;  2FE8 A;  1N62 A;  3WAM A;  2MBO A;  1M94 A;  3JSV B;  4FHJ A;  1MHH E;  2N7E A;  3AE4 B;  3U7D A;  4EZK A;  1ZKH A;  5I4D A;  4MH0 E;  2LAS A;  2O2V B;  4JX1 C;  2IO0 B;  4KSL C;  2W3S A;  2J52 A;  3QIJ A;  4R3D A;  1E8X A;  4IOI E;  4EZL A;  1XF5 L;  2M56 B;  4GIV A;  3ZNI D;  3L08 A;  3DCG A;  2W55 A;  3W2D A;  4I6P A;  2CKH B;  3LJ3 A;  1TIF A;  2KTR A;  2QMT A;  3H1U A;  1LGR A;  1EU4 A;  1YQ3 B;  3EGR A;  4DDI D;  3MC8 A;  3B9J A;  2AQ3 B;  3NRZ A;  2BKF A;  2QEJ C;  3VUW A;  2OOB B;  3R2I A;  4HJK A;  2MP2 B;  3PPA A;  4HCP B;  5DCN A;  5IP4 D;  1AN8 A;  1NVI D;  2C7M B;  2KDF B;  4AOF A;  3TEY A;  3LXF A;  2L05 A;  1TBE A;  3ZNZ B;  4HWI B;  3RMK C;  2FBW B;  3TIX A;  3H7P B;  3ML8 A;  4ZYN A;  4XWT A;  4OVU A;  1P1A A;  4BFR A;  3KYC D;  5C23 A;  4XC2 A;  2QIE B;  5C1Z A;  3A1Q B;  4N9F 4;  3ZNH B;  2IY0 B;  2JYT A;  2D11 A;  1T0Y A;  4DWF A;  1CK1 A;  1WIA A;  2NMQ A;  1TS5 A;  3ECI A;  1N5X A;  3QC8 B;  1YD8 U;  1E6E B;  1QT9 A;  3DPD A;  2JWU A;  2EMS A;  4RF1 A;  1E7U A;  1SB3 C;  3U52 E;  2KJH B;  3VRA B;  3NVW A;  3RN9 C;  3MJ5 A;  2JZZ A;  3KUC B;  3P4S B;  2WU2 B;  3W9C B;  3VUY A;  1SGH A;  4MGY E;  3I3T B;  2A5U A;  5E6J A;  1WMH A;  4O1N A;  2WGS A;  1WYG A;  3L17 A;  2KWV B; 
#chains in the Genus database with same CATH homology
 1YN4 A;  3IXS A;  1HA5 A;  2D5G A;  2J4X A;  3NVZ A;  4OW0 A;  2WDV B;  2XNA C;  2JQR B;  1E9M A;  2LMC A;  4C7Y A;  4OZB A;  1EWC A;  5HG2 A;  2OED A;  1E7P B;  3TUO A;  5GXG B;  2BB6 A;  2RPV A;  5FKA C;  3AE7 B;  1QIL A;  1F0Z A;  2Y5C A;  2IJ0 A;  1QOA A;  4MAC A;  1PGA A;  1L0V B;  1PYW D;  1TZO A;  3GS2 A;  4RF0 A;  1C78 A;  1CQV A;  1K51 A;  2MJE A;  5BMI A;  3URY A;  4UDU C;  2L32 A;  3TSS A;  2GB1 A;  1GB4 A;  1YN5 A;  1ROE A;  3WCQ A;  2W82 A;  1KF6 B;  2WDR B;  3AEE B;  2WQY B;  3MHZ A;  1ZOY B;  3BVG A;  1N60 A;  4XDD A;  2L52 A;  3PZ7 A;  1STE A;  4C56 C;  2WXI A;  4YTN B;  3R8B A;  3W5U B;  4N58 A;  4HJG E;  2BS4 B;  3AE3 B;  2M19 A;  1SE2 A;  4RNA A;  4WIP A;  3HRD D;  1GAQ B;  4KKI A;  1C4P A;  2E3T A;  3IT6 B;  1HQR D;  3OWE B;  3V3X A;  2PIA A;  1AYF A;  3UI3 A;  1XXG A;  1L4Z B;  4RGO S;  3E56 A;  1JQ4 A;  1PGX A;  3BII D;  1FO4 A;  2PVG C;  4XDC A;  2WXQ A;  4A55 A;  4RGN A;  1JRO A;  2X38 A;  2WDQ B;  3Q69 A;  4L1B A;  2LJI A;  4ARI A;  3NVV A;  1N5W A;  2PKO A;  5H92 C;  1MI0 A;  1PGB A;  4C80 A;  1T3Q A;  2WXF A;  3AEA B;  4WWM A;  4ZHO A;  2R61 A;  3Q8A A;  2FUG 1;  1ZXI A;  4ZRP A;  4GDL B;  5FK9 C;  4TQ1 A;  3VQI A;  2LFI A;  1ET9 A;  1F77 A;  1JWU D;  1TJE A;  2PVO D;  1QLB B;  1B9R A;  2J42 A;  1FCL A;  4OHJ A;  2PLP A;  1UNS A;  4XE0 A;  4RCO A;  5EE9 A;  3I9V 1;  3PZ8 A;  4FXC A;  1DGJ A;  2JU6 X;  5EE3 A;  3RFZ B;  2MEK A;  4JE3 B;  1ZXH A;  2WLB A;  3IAM 1;  3U7Z A;  1DYQ A;  2N9K A;  2ICI A;  4N59 A;  3SFD B;  1JWA D;  3AEC B;  3CIR B;  2K0P A;  1JWB D;  2KAJ A;  1AWD A;  2INP E;  3KWL A;  2NTT A;  3KLS X;  1XLQ A;  1NEK B;  5BYR A;  3VRB B;  2L1A A;  4A90 A;  2H88 B;  3B2F A;  3BVZ A;  4IDI A;  2J53 A;  4OVZ A;  4YSZ B;  1I4H A;  2ACZ B;  5HFY A;  1PDX A;  3W1S A;  1HZ6 A;  1TS4 A;  3VR9 B;  3AED B;  2HDE A;  3FAH A;  1C9F A;  4JWS C;  2KMM A;  3IT4 B;  3BK2 A;  2GRI A;  4KGR A;  2H89 B;  1QOB A;  4ITK A;  4NAW B;  3SEB A;  2KQ4 X;  3TEW A;  2BS2 B;  3MP9 A;  4L23 A;  2QIL A;  3FIL B;  4KX6 B;  4OZA A;  2JX5 A;  4TSS A;  5C2T B;  1AW7 A;  1VR9 A;  1QOG A;  1FFV A;  1UWM A;  2K9X A;  4XWW A;  3ABV B;  3AE6 B;  4PT5 A;  1I7H A;  1TYG B;  2NTS A;  1FCC C;  4YXD B;  2IPK D;  2CJN A;  3AE9 B;  5AUI A;  3TEZ A;  2G1E A;  1D5Z C;  2Y3A A;  1VZ8 A;  3AEF B;  1XO3 A;  1FD6 A;  1JRP A;  2TSS A;  2V0G A;  4RH6 A;  1Q10 A;  3BYT B;  1L0Y B;  2ZW1 A;  1MPE A;  1UUP A;  2SEB D;  5EE0 A;  5H8Y E;  2BW2 A;  3BZD B;  1WSP A;  2WXH A;  3KQ4 A;  1DOY A;  4RFB A;  1L6U A;  1C4A A;  4LK0 M;  1TKY A;  5BMG A;  1KFY B;  2V3N A;  3HVZ A;  5D3I B;  3ZJU A;  1WWT A;  1JCK B;  2JZP A;  1ET6 A;  4YT0 B;  1WGK A;  1TY0 A;  2IDY A;  4P6V F;  2W3R A;  3AE8 B;  4WQM A;  5TSS A;  2INN E;  1MVK A;  1OQR A;  1QOF A;  5G5H A;  1VJK A;  4JWU C;  1F2R C;  4OZC A;  4Q2J A;  3I57 A;  4MM3 B;  4YSX B;  1C76 A;  3J9C A;  1L6V A;  1WXQ A;  2ON8 A;  3FC4 A;  1GOZ A;  1JWM D;  1ENF A;  2EEL A;  1T5X D;  3P63 A;  3T3O A;  5C3J B;  1FNW A;  1KRH A;  2CU3 A;  1EWY C;  1C77 A;  1JWS D;  1FNU A;  2AQ2 B;  4ZHP A;  3P1M A;  1VRA B;  2BYT A;  4M0W A;  1TKG A;  3KWV A;  3MC0 B;  1SE4 A;  2Q5W D;  2PMV A;  4YSY B;  1YJI A;  2I38 A;  1L4D B;  1XLN A;  3HUI A;  5T8I A;  4H2A A;  4A6Q A;  1LO5 D;  2BT6 A;  1GPX A;  1A70 A;  3E9S A;  3B2G A;  1N61 A;  3AE2 B;  3ZJV A;  4C7Z A;  3V05 A;  2KAC A;  1QF6 A;  1I4Q A;  4EE2 A;  4ARC A;  1OQQ A;  1I4P A;  1MHX A;  2WNM A;  4KGS A;  1F2R I;  1V1P A;  1V8C A;  1I4R A;  2WXO A;  5BYQ A;  3Q8B A;  1V1P B;  3CWI A;  5FR3 A;  2WXR A;  1K52 A;  1RM6 C;  1DOI A;  3U2S C;  1BXT A;  4MT5 A;  1TS3 A;  3BYY B;  1SSN A;  4TQ0 A;  4YWG G;  2ZW0 A;  1FMA D;  1BUI C;  1L5P A;  4GLS C;  2JXT A;  1FM0 D;  1ZE3 D;  1KLU D;  2LHE A;  1JW9 D;  3PO0 A;  4B0E A;  1JML A;  1C4C A;  3BVM A;  4L2Y A;  4DXG A;  3NVY A;  3U4E G;  3N9Y C;  1ZPS A;  1OFF A;  2I2Y A;  2N7J A;  2M0A A;  2BB5 A;  5HI1 A;  2AX5 A;  2KN4 A;  1FXI A;  2HTM E;  3AE1 B;  3LYY A;  3FIL A;  1HXY D;  1KLG D;  1YMH E;  2YEP F;  4LLG M;  2CJO A;  2JYE A;  3GB1 A;  2L83 A;  3R2T A;  4P16 A;  3AH7 A;  3P4R B;  2WXM A;  2DYO A;  2V3P A;  1T6B X;  4A8X C;  1UGJ A;  4J3O D;  1D4B A;  4AQ7 A;  4WH4 A;  3IAS 1;  2LUM A;  2KWD A;  1VLB A;  3AV8 A;  1GB1 A;  2MJ3 A;  2IGG A;  3ZYY X;  1VZ7 A;  1EU3 A;  4WAF A;  1SE3 A;  2RDG A;  4YTP B;  1SJH D;  2EKI A;  3W5V B;  2WXN A;  3Q8E A;  4NJC A;  1VDV A;  1C79 A;  1D5M C;  1N63 A;  1E0Z A;  3AB5 A;  1D6E C;  3TEX A;  1J7A A;  1SJE D;  1IGC A;  2N0S B;  1K50 A;  1SIJ A;  3EUB 2;  2KDM A;  2V4I B;  3P4Q B;  1XLO A;  3BK1 A;  4RGM A;  2WXP A;  2G9H D;  1SF0 A;  4HRS A;  1B1Z A;  1D5X C;  1YQ4 B;  3C8Y A;  4ZRQ A;  3GP7 A;  1M4V A;  2FE8 A;  1N62 A;  3Q8F A;  1NEN B;  1QQR A;  1XEE A;  4D2K A;  4B0M A;  1MHH E;  3AE4 B;  5I4D A;  1TS2 A;  2GI9 A;  2VZK D;  1ACC A;  4WUR A;  1FXA A;  3NUH B;  4JX1 C;  5JXV A;  4IKG A;  2K5P A;  2WP9 B;  2W3S A;  2DWQ A;  2B76 B;  2J52 A;  1ESF A;  1TKE A;  4ZOH C;  2LEK A;  3AEG B;  5LNK 1;  2JSV X;  3DWG C;  1FRD A;  4R3D A;  4NZL B;  4IOI E;  2YEP B;  3L4P A;  4ZYS A;  1CJE A;  1XF5 L;  1PFD A;  2M56 B;  2RDH A;  1I4G A;  3AM9 A;  2DBY A;  1VZ6 A;  2W55 A;  4NAM A;  3W2D A;  2OHF A;  3HVD A;  2Y5P A;  2Z8L A;  4TMA B;  1SXT A;  3RPF C;  1YJJ A;  2BS3 B;  2DYM A;  2QMT A;  3EA6 A;  3O13 A;  4REZ A;  2MH7 A;  1FFU A;  3BWU D;  2WS3 B;  1EU4 A;  1YQ3 B;  3EGR A;  1PUT A;  3ZGZ A;  3ZJT A;  3B9J A;  2K22 A;  5G5G A;  2IGD A;  3AN1 A;  2AQ3 B;  3NRZ A;  1V97 A;  2PTL A;  2XN9 C;  1P7F A;  2QEJ C;  2ONQ A;  3R2I A;  4JPS A;  4MH8 A;  3P42 A;  1IBX A;  2WXK A;  1ZP0 B;  1FRR A;  1AN8 A;  1L0X B;  1Y56 A;  1NVI D;  3MFG A;  1IBX B;  3TEY A;  1IUE A;  2VZK B;  3LXF A;  3NZ3 A;  2W54 A;  1XLP A;  1J7B A;  4CQN A;  2LHD A;  2K3U A;  2FBW B;  1RWS A;  4XWT A;  2PW9 A;  3P4P B;  1IGD A;  1J7C A;  3ETR A;  4DXF A;  2BTE A;  3SFE B;  4LTU A;  4N6E B;  1R7S A;  5D3D A;  5MPO A;  1P7E A;  1XCQ L;  2QIE B;  4KKJ A;  4AS1 A;  1CZP A;  4A9A A;  1FIQ A;  4KGT A;  4US8 A;  1QKZ A;  3ZQ4 A;  1YNT E;  3T3N A;  1YN3 A;  1XCT L;  2BBC A;  2JYT A;  5HHD G;  1RYJ A;  2WXL A;  3AMZ A;  4RGT A;  4GDK B;  3AEB B;  1CK1 A;  4HEA 1;  4USA A;  2MJD A;  1KTK A;  1NYQ A;  2NMQ A;  1DOX A;  4HKZ E;  1FNV A;  1TS5 A;  1N5X A;  2QJL A;  3SR6 A;  2N9L A;  1I4X A;  1ZUD 2;  5EE1 A;  1E6E B;  1HEZ E;  1QT9 A;  2JWU A;  3VR8 B;  5D7G A;  2WXJ A;  1UWX A;  4RF1 A;  2IGH A;  1SB3 C;  2QSD A;  3H8H A;  3U52 E;  5AUK A;  1E10 A;  3NS1 A;  1SEB D;  4DQO C;  1NYR A;  3AE5 B;  3VRA B;  1HZ5 A;  3NVW A;  2E6X A;  1TY2 A;  2AQ1 B;  4YTM B;  1NI3 A;  5BYS A;  3MJ5 A;  3P4S B;  2DLB A;  2WU2 B;  3W9C B;  1WRI A;  1ZDX A;  1BML C;  1JAL A;  1V1O A;  1EM7 A;  4US9 A;  5E6J A;  2WXG A;  2LGI A;  2RMM A;  2SAK A;  4HRO A;  3DWM A;  4O1N A;  1FEH A;  1K53 A;  1KH0 A;  5BMH A;  3LB8 C;  4HKQ A;  3Q8C A;  1SBB B;  2WU5 B;  1WYG A;  1ZDV A;  1RFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...