2IDYA

Nmr structure of the sars-cov non-structural protein nsp3a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
112
structure length
112
Chain Sequence
APIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNEKCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGEENFSSRMYCSFYPPDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords NSP3
publication title Nuclear magnetic resonance structure of the N-terminal domain of nonstructural protein 3 from the severe acute respiratory syndrome coronavirus.
pubmed doi rcsb
source organism Sars coronavirus
total genus 9
structure length 112
sequence length 112
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2006-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.350 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2idyA01
2IDYA 2GRIA 2M0AA
chains in the Genus database with same CATH superfamily
2M4NA 3WANA 4L2YA 2G1EA 2IZVB 4XGAB 4XWWA 1UZXB 1K52A 5FR6A 1V5TA 2N0SB 1ESFA 1UD7A 2BB6A 4ZRIA 2Z0EB 2R2OA 1AN8A 3RNCC 1N6ZA 1SSNA 4F1SA 2QJLA 4HLEA 3ZTCA 1E6EB 4W9EA 5EE3A 2NTSA 4MH8A 2JZPA 3MTNB 1STEA 2IPKD 3VH4B 1TYGB 4DXAB 4G0NB 1AW7A 4W9FA 5G5GA 4FXCA 4RGNA 2JYEA 2CHXA 1EM7A 3AN1A 3T8MA 4URKA 5FKAC 2FCSA 3ZVVA 2YVCA 4II3B 4L23A 3RZWC 3N3KB 2TSSA 1L2NA 4MGZE 1SXTA 1KLGD 2LUEA 1VLBA 4EOYA 3AB5A 3TEXA 3UGBB 3W2DA 1L4DB 3EFUA 1J7BA 1U4AA 5DPTA 1D5MC 4HJKA 3DWMA 4JWSC 4KZ0A 3X0WA 2L00B 3AE6B 1BUIC 2J0KA 3W1YA 3ZIMA 3HUIA 3PRZA 3BINA 3FC4A 3TMPB 4TKNA 2LGIA 4ZYNA 3QARA 1FEHA 1OQRA 3MJWA 2ZPYA 2KQ7A 4MJSA 1TS5A 4OHJA 5DPWA 3DOWA 4IOIE 2ZVNA 3RI7C 4AP4C 2KT7A 2X38A 2KWVB 2WWZA 2V9HA 4LTUA 2XK5B 2EKEC 2WS3B 1VDVA 2PKOA 1JQ4A 3DVGX 3WAPA 5L83A 2NBVB 2FUHB 4GOCA 3VAWA 4HKZE 3QWZB 2D3AA 3VUWA 3L0WB 3GZNB 1ACCA 2WXQA 3ZNZB 2KKCA 2RDBC 5IA7A 4AJYB 3EECA 4DBGA 4MM3A 2LUMA 3PREA 1CJEA 3ZRCA 3TEYA 2WLBA 3VRAB 4PS3A 5AUKA 4ANWA 2MBQA 4LNKA 3AECB 3PZ7A 4LK0M 1QOAA 2B76B 2W54A 1IBXA 3EHVA 3NVYA 2N9EB 4EEWA 3KW5B 2PLPA 3WAMA 1EF5A 2K3UA 2MHJA 3BWUD 2KFJA 1ENFA 1E90A 1WGRA 2KN5A 4IWPA 5CX3A 2KLGA 2NS5A 4MEMA 3L17A 1TKEA 1TKGA 3B9JA 1WXQA 1KRHA 4I6NB 1UELA 2KTRA 1UH6A 2VZKD 4MDKE 5LXIB 3CSTA 4IDIA 1XF5L 4NJCA 4P16A 5IO9A 4YSXB 4RGTA 3P4QB 3QHTA 3PO0A 3Q14C 3DCGA 3Q8AA 4WJNA 5CHVC 1CQVA 3VVWB 2IJ0A 3L16A 3KVFB 1L0VB 1HZ5A 1ZP0B 1T3QA 2BKFA 4DHZE 1ET9A 1MPEA 1IGDA 3PT2B 2VZKB 3GE3C 1WY8A 1JWAD 1ZUD2 2O6VA 1VD2A 3VH3B 2M56B 2BTEA 4MH0E 3AEEB 2KQ4X 4NPNA 3L4PA 2KXJA 3SFEB 2KZRA 3HRDD 3VTUA 3NOBA 3DBHI 1WR1A 3DVGY 3NVWA 1WGHA 4CYEA 3A4SC 1I4RA 4MSMB 2L8JA 4YTMB 4EZJA 5C1ZA 4MT5A 3JYUA 5EDSA 2WXLA 3TIXA 1PUTA 1YJIA 2LRWA 1GNUA 2LD9A 3T3OA 4JQWC 2YEPF 1J7AA 2C5LC 2H89B 1E8ZA 2JZ3B 4L1BA 3IXSA 3PVLA 2YLMA 1H4RA 3QAQA 1VR9A 3OJ3A 4DQOC 2LVQA 1RRBA 1FRRA 4RCOA 2RD0A 2MWSB 2Z8LA 1F9JA 2J52A 1FFUA 1SJHD 2GBRA 3Q3NC 3R66C 2A4ZA 3V6EB 4JL9A 1P98A 1KM7A 2NBWB 3WALA 1QILA 3WAOA 2DAFA 3R7QA 2NPTB 1AWDA 3I57A 1FRDA 1WZ0A 5JHAA 2V3NA 2FIDA 3SDLC 3ZKJC 3TBLD 3HK0A 2K8HA 3AU4A 2LRUA 3ZUNA 3NS1A 4ZYSA 1N62A 1V97A 2CR5A 3VTVA 3OWEB 3KWVA 1J8CA 2KDBA 1T5XD 2WNMA 5D3DA 5C23A 2O2VA 4M8MA 2PMVA 5JHBA 1WZ3A 2MLBA 5G2NA 4PYUA 1KH0A 2ICIA 2NCNA 5C2TB 1I4QA 2DZKA 1EU4A 4NQKE 1WF9A 4ZOHC 2L3ZA 4AOFA 1WJ6A 3ZJTA 2ZW0A 1Q5WB 3H6NA 2MP2A 1WYWB 2JU6X 2KOXA 3Q3MC 1YIWA 1XT9B 2QILA 3DBLI 4WJOA 3WIMA 3GS2A 1GB1A 1YX5B 2JZZA 1CMXB 5JZEB 2D2QA 3OG5A 4BKTA 4A20A 4M0WB 3I63C 2MSED 4R3DA 2UYZB 3DHIC 1N63A 4A9AA 1WSPA 4NJ7A 4RGOS 4O1NA 2KDMA 3ECIA 4KDIC 3A1QB 1MG8A 1L6VA 3AE2B 1D3ZA 1KLUD 4B0MA 2JRHA 4YSZB 2H88B 3D32A 2VH1A 4TSSA 4W9GA 1WJ4A 4RGMA 5E6OA 3DVNV 1IP9A 3TL5A 3ZRFA 2LEKA 2Q5WD 3BK2A 2DZMA 2N1WA 1WE7A 3M95A 1JCKB 1XEEA 1FCLA 4BFRA 3K9PB 1QOFA 4LJPB 4C7ZA 1AYFA 5FR3A 3TEZA 2J53A 1GPXA 5KHOA 5D7GA 1KLVA 2MBBB 4GMVA 2JX5A 4HK2A 4H2AA 3UINB 4HROA 4KGSA 1V6EA 4G50A 2WXGA 1M4VA 1NI3A 1ZOYB 4AJWA 1N5WA 2LGYA 3L10B 2LGDA 4RFBA 1I42A 3Q69A 1F77A 3W9CB 2JY6A 1E7VA 2OJWA 1P3QU 4JX1C 1BXTA 3M3JA 4IUMB 3BIID 2D11A 2ONQA 2PJHA 1SE3A 5AUIA 1R4MB 5DCNA 2OOBB 4FA6A 2KDEB 3SHQA 2JWZA 4GGQA 4KVGB 4RF0A 2LVPA 2W82A 4ANUA 4B0EA 2RPVA 1WIAA 2GBNA 1V1OA 4B6WA 2Z0DB 3H7PA 4JGHB 1K53A 5IP4D 4WWMA 3R3MA 3Q8BA 1E8YA 2INDC 2LASA 4QAYA 1E7UA 3PZ8A 5HKHA 1WFYA 3V05A 2AX5A 1QT9A 3DPDA 3L54A 4WH4A 1WRIA 4W9LA 1EWYC 1UBQA 1QOBA 3E9SA 2JPHA 2ZNVB 3N30A 5G55A 1UWXA 1WRDB 1XCTL 4ZHPA 1C9FA 1FFVA 2AQ3B 3GE8C 3ONSA 1TTNA 1WJNA 4WIPA 2QMTA 3NS8A 1WH3A 4AUQC 2KACA 1NENB 2WXRA 3B2GA 4OW0A 2K1FA 4E3CA 1FNVA 1I4XA 2C7MB 2EMTA 2AQ2B 3KLSX 2I1KA 2IGDA 3NZ3A 3JSVA 4K81A 4XZ4A 3APCA 5L95C 3LJ3A 2RR9A 1OQYA 1D4BA 2ZJDA 2J42A 4AS1A 1SIJA 3DBRB 1SE9A 4MJSB 4WQMA 3RUIB 2BWES 2PVGC 4WQOB 4HPMB 1IYFA 4BBNC 2MW5A 1DOYA 5JXVA 1R4NI 3MJ5A 1XLNA 4YSYB 4OVZA 2PTLA 4X57B 2A5UA 4BZAA 1V1PA 5HHDG 2V4IB 3SEBA 5D94A 3WA0A 2QSDA 2R2QA 1SEBD 3VUXA 4GDKA 1WI0A 4FJVB 2IBIB 1F2RI 2W9NA 1GAQB 3OAWA 4HCPB 1Y8RC 1RAXA 2ZCCA 4KKIA 3ZXRA 1C76A 2CHZA 4A8XC 3DBSA 2BB5A 3QCAA 4ZRJA 3QC8B 3TCAA 4C56C 5LXHA 2RGFA 4YTPB 1E10A 3I9V1 5DPRA 3AULA 3RULA 4DDGD 2FBWB 4IM0A 1P1AA 2G4DB 3ZNHB 4C7YA 1C77A 1FO4A 4HCNB 2KMMA 4BBNF 3CSFA 3BY4B 1BMLC 4K3CA 2SEBD 2GOWA 1NI2A 3AE4B 2PPHA 1I35A 3VRBB 4PT5A 1TY0A 3A9KA 2WDQB 4KIKB 1WXAA 2V3PA 3HHMA 1JRPA 1FM0D 1EWCA 2WHIA 1TIFA 2DWQA 2BW2A 2MX2A 4IW0A 3RPFC 1NEKB 1V2YA 1WXSA 1KF6B 2AL6A 5HG2A 3NY5A 4JIOU 4YTNB 2ZZPB 2LI5A 5LLIA 1D5ZC 5TSSA 2KFKB 1F2RC 1ZE3D 2PVOD 2IO0B 3BYTB 1YD8U 2L32A 3W5VB 4GDLA 4CO7A 5J18A 4BKSD 4US8A 2KK8A 2L05A 1WYGA 2DYBA 4GXBA 1TS2A 3AXCA 1SE2A 3N1ZC 3HIZA 3VFKA 2CU1A 1YJ1A 2D3BA 2EKIA 2N4FA 3L13A 4P6VF 3V6CB 1DOIA 2MJ3A 4NNJB 2FCQA 3Q2AC 4IM2A 3ZJVA 1QQRA 4HKQA 4RM9A 4JLCA 2QCZA 4E74A 5KHQA 2OEDA 1XD3B 2N9KA 2XNAC 3NHEB 4MELA 2KVRA 1Q10A 3ZNID 3DWGC 1EUVB 1Q1OA 2WX0A 1QZEA 1RFAA 3KYDD 1DOXA 1GB4A 2K22A 3NVVA 2L76A 2DX5B 2QDFA 4NZLB 5I4DA 3P42A 4PYZA 2WDRB 1TS3A 2L83A 5EE9A 4ZRPA 3P2BA 4HDQA 3U30A 4NJ6A 1WM2A 1V86A 3SU8X 1N60A 4C4VB 4XC2A 1MVKA 1JWBD 3ENEA 3W1SC 2K8BA 2N9XA 2JYTA 3DQVA 1NYRA 4US9A 1S3SG 3T9LA 2RDHA 5TR5A 2J0JA 4MGYE 1C3TA 3ZTDA 1WXMA 2O2VB 2QHOA 3FILA 2Y5PA 4BVUC 1KJTA 1T6BX 4I6PA 3ALBA 1N5XA 5H92C 2K39A 3DDCB 1FXIA 4F7ZA 3Q6BA 1PYWD 2JQRB 4PK1A 4W9DA 1WMHB 1E8XA 4OZBA 2GMIC 3RNGC 1IUEA 2MBOA 2WXPA 1PGXA 2XK5A 2MP2B 3B2FA 2UWQA 2DENB 3QK0A 3U7DA 3URYA 1FNUA 2WXMA 3O13A 1GOZA 4CQNA 4OZCA 2KANA 2LGSA 4YL8A 4F8CB 1KTKA 3KH0A 1L0YB 4ICUA 3RN9C 2INNE 2AWTA 2SAKA 4IWQA 3IVFA 4I6LB 2CU3A 3GP7A 1TZOA 4FLHA 3MC0B 1UGJA 3LB8C 5C3JB 4AQ7A 4PS7A 4G3XB 2N7JA 1ET6A 1QF6A 2QIEB 2IGGA 2GBMA 4YWGG 1SF0A 3Q8CA 2BQQA 2FIFA 2W3SA 3P4RB 5BMIA 3IG3A 3W1SA 5BYRA 1TS4A 1EU3A 2JWUA 1FXTB 3AEAB 2WGSA 3AM9A 4FADA 2V1YA 1I4GA 2WU2B 3DBHB 2M19A 1FPYA 2HTME 1T0RC 2DZJA 1J19A 1L7YA 3V3XA 4JE3B 2NR2A 4GSWA 1TGZB 2ZVOA 4NAMA 2RDGA 4FJZA 2DAJA 1E8WA 1WX9A 3N32A 3UIOB 2WP9B 2KO3A 4EZLA 3ML8A 3CWIA 2M8SA 2MEKA 1YJJA 3AEFB 4NAWB 1ZKHA 1BT0A 1YQ4B 2GBJA 2LXCA 1K50A 2X8XX 1MFWA 1OQQA 3ZO5B 1YN5A 4REZA 2M17A 1V80A 2GB1A 3MC9A 3KWLA 1WJUA 1RYJA 2IGHA 1XCQL 1E7PB 1I7HA 3V61A 1DGJA 2L0FA 2KC1A 3WCQA 4A55A 4HRSA 4KGRA 1TBEA 1F52A 2ZW1A 1VCBA 2G45B 2LGXA 4C00A 3E56A 1UGMA 1FCCC 5AZHA 1P9DU 3A9JB 4PS8A 3C8YA 1VZ8A 3QX1A 2V3SA 4K7UA 2KAJA 3GB1A 3RCZA 3DHHC 4A90A 2IDYA 3C19A 5G5HA 4HEA1 4ZDVA 4M02A 5HFYA 1JWUD 1TY2A 3AE9B 2L7RA 3BYYB 2KDFB 4XDCA 4ANVA 5BYSA 1ZPSA 2KLCA 4ACFA 1LFDA 1IGCA 1NDDA 4FULA 5BMHA 5LNK1 5HI1A 1L6UA 1Y56A 2OJRA 3I3TB 3AEDB 1V8CA 3GOEA 4MSQB 4LNFA 1R4MI 2LWPA 2JF5A 1H8CA 2NPTA 2M1MA 5BO4B 4G11A 2HDEA 1OFFA 1T0SC 2BS4B 4NQLB 1V81A 4KSLC 4RF1A 1VRAB 3DBLB 3PRPB 5BMGA 2BYFA 4M00A 2GRIA 4E71A 1S1QB 2DNFA 5EE1A 3BZDB 1ZGUB 1YOVB 2EMSA 4P7IA 2MBHA 2K8CA 4FBJB 3BVZA 4N58A 1HEZE 2ZCBA 1SBBB 1A70A 5T8IA 3APFA 4DHZB 2MH7A 2AL3A 3HM6X 3LXFA 1RFKA 1MHHE 4IC7B 2ACZB 1UBIA 4HVBA 2KWDA 3N1XC 4XE0A 2HE7A 4LCDE 1MG4A 1F1HA 2KX3A 2M0XA 4KGTA 3ZDTA 2J0MA 4IM3A 1QOGA 3QA8A 3V62A 2WXNA 4WWOA 1E0ZA 4J3OD 2LJIA 3IAS1 1JWMD 1RWSA 1WR6E 3NG0A 4OVUA 1LQBA 3U2SC 2D07B 1HTQA 3CIRB 2IO3B 4M0WA 3TEWA 4TV3A 1SGHA 3U8ZA 2Y3AA 5GMVA 1YQ3B 1PQSA 3U4EG 3DHGC 5E6JA 1JW9D 4WAFA 2PEAA 3A1QA 5CTRC 2DHZA 3RNAC 4BOSC 3VXWA 1GG3A 4WAAA 5IAAC 1V9JA 2K25A 2IO2B 3BK1A 4TQ0A 3AE1B 2FE8A 1XO3A 1N61A 1WX7A 2NMQA 3PHXB 3A9KB 3UI3A 5JH5C 4W9JA 1R7SA 2R61A 3H7SA 3RNBC 2ZNVC 4BAXA 2BPSA 3RFZB 1Z5SB 1ZXHA 4II2B 2NTTA 4ITKA 4EUTA 1UWMA 2JXXA 1J0GA 3IBEA 3ZYYX 3FKYA 2NVUI 4S17A 2N9PC 2KDIA 2BF8B 1MJDA 3RYTA 2DYMA 4B95A 5MPOA 2D10A 1B9RA 1ROEA 1PGAA 3CF6E 2PIAA 1WE6A 1GC6A 2IY1B 2LJ5A 2G4SA 3I5JC 2FAZA 5FK9C 1SIFA 4MM3B 4K3BA 3ETRA 3PPAA 4KKJA 1UNSA 2KJRA 1VZ7A 4HDOA 5E6NA 1K51A 1IBXB 2D5GA 1FMAD 2CKHB 2N7DA 4HXDA 3A4RA 1T0YA 3RNEC 4XX5A 2C7NB 5IN7A 3KUZA 1FXAA 3MC8A 3Q8EA 5D3IB 2WXFA 2BYVE 1TJEA 2KTRB 3RT3B 2B3AA 1M94A 3S2AA 2DLBA 2N9LA 4KSKC 3P4PB 3IAM1 4LJOB 1WGGA 2K0PA 1OGWA 2O6VD 4J6IA 3UQBA 4FHKA 1R4NB 2FNJB 3M62B 4YT0B 3TSSA 1JMLA 1YX6B 3GZNI 1YN3A 1EF1A 2BGFA 4WJPA 2C9WB 3DVNU 3X23A 2HD5B 2I38A 1WXVA 3P1MA 3Q8FA 2J7QB 1P7FA 3H9DA 4GB9A 2PE9A 1L5PA 2J4XA 2O6VB 3RZFA 3VQIA 4TQ1A 3V60A 3MHSD 1OTRB 4P1CC 1Z2MA 2RPQA 4XYCA 4EZKA 1XLPA 3FILB 1G6JA 4ASWC 1C79A 2LHEA 4RM8A 1LXDA 2BT6A 4YXDB 4HWIB 3N1YC 4LNOA 5IKCM 4KDLB 4GLSC 2ASQA 1ISNA 1TZ1A 3B0AA 2NBUA 3L08A 1F0ZA 2JSVX 1K8RB 2LFIA 4IWOA 3UF8A 2KWUB 1XLQA 4MACA 4W9HA 4FN2A 3U7ZA 2K6DB 3APDA 3QQ8B 4ARIA 1PFDA 1SE4A 1JROA 3SFDB 1WGDA 4WWNA 3C0RB 3PS6A 3OJ4B 4EE2A 3JVZX 2K6QA 2WXOA 4A3PA 1HTOA 3EFCA 2ZEQA 4MGIE 1L4ZB 4ARCA 3ZQ4A 4DDID 4DXFA 1TT5B 3LYYA 3QJZA 2EELA 1XQQA 1QKZA 2WU5B 2I2YA 4A3OA 2C7HA 5GXGB 1GJZA 4N9F4 2GLSA 2BBCA 4LNIA 3R7RA 2MJDA 2YEPB 3Q3OC 3IT4B 1A5RA 4WJQA 2REXA 1XXGA 3P63A 3IT6B 1NVID 2WYQA 2WQYB 4C80A 2CJOA 4WURA 3TUOA 2I1JA 5D6JB 2KHWB 3ZLZA 4DK5A 4NY0A 1WM3A 1V5OA 2KYWA 4USAA 4RH6A 3SR6A 2LXAA 3LDZE 4KIKA 3PV1A 2KTFA 2N7EA 3VR8B 2JUOA 3PTFC 2WXJA 2Y5BB 3OLMD 4BKGA 1ZDXA 3VHTC 2FCMA 1OEYA 3NVZA 2WXIA 4W9KA 2Y5CA 1GUAB 2IYDB 4HPPA 2MJEA 3A33B 2WDTB 4FHJA 2V0GA 2GI9A 2KFKA 3ZGZA 3HVDA 3HM3A 4EKUA 4DHJD 3UIPB 2G3QB 1WWTA 1QLBB 3ZXVA 1RM6C 3KYCD 1D5XC 1IPGA 1I4PA 2RMMA 3ML9A 2AEHA 2CHWA 4DXGA 2BVCA 2L52A 2KNBA 1E9MA 3AEGB 4HPLB 5D2MB 3N9YC 3Q3FA 2QC8A 4DHJB 1XLOA 2BYEA 2PE6B 1UF0A 2FUG1 2HJ8A 1C1YB 4BKSA 4N59A 3EGRA 4IG7B 4GU2A 1YNTE 4RMAA 2KMCA 1C4CA 1LO5D 1SJED 4M8NA 4ZHOA 1YMHE 2VRRB 3MFGA 2VH2A 2G9HD 2IO1B 4D2KA 2QEJC 5CHWA 1FIQA 3ZNGC 3PLVA 3PHWB 3KQ4A 3PLUA 2XBBC 3ABVB 3O65B 2KN4A 3R8BA 2MA9B 2WXKA 4ZRQA 5DPSA 2UU7A 3ZW3A 1FD6A 4LLGM 3AEBB 4C4VA 2AYOB 1L0XB 2ZPNA 2KC2A 4K1RB 1V49A 1KOTA 3T3NA 4W9CA 4IKGA 4K7WA 3QIJA 2E3TA 3K9OB 1C4PA 4AWJA 1D6EC 3AE3B 1C4AA 3Q3JA 4LNNA 3RMKC 1OEYJ 1EO6A 4MGKE 5AZGA 1CK1A 2LVOA 3NJTA 5AEKB 3PRMB 2W55A 2INCC 1WMHA 2BKRB 3M63B 2JVCA 3UQAA 2OHFA 3H8HA 2JRIB 5H8YE 2N1VA 1X1MA 4JPSA 5IOIA 1LM8B 1ZXIA 2KX0A 4BOZB 3H7PB 2DZIA 2WDVB 1P7EA 2FCNA 3MHZA 1I4HA 1KFYB 2WX1A 3EC8A 1E5WA 3AMZA 3NZSA 2LMCA 1DYQA 1C78A 1JRUA 1HQRD 2KMAA 2Z59B 3CMMB 4ANXA 3SD5A 3AU5A 2ON8A 3EA6A 4OZAA 3VUYA 2HJ1A 1ZW7A 2KJHB 3IHPC 2DBYA 3AE5B 3B1LX 4GIVA 4CHKA 4KV2A 3KUDB 3BVMA 2D3CA 2KWCA 3TJPA 3JSVB 4N6EB 3VR9B 2V4LA 2PW9A 3ZJUA 5AZFA 1JALA 2RSUA 1AARA 1WX8A 4ZRKA 4UDUC 2IY0B 3P4SB 2XN9C 1VZ6A 2M0AA 3NZUA 2CJNA 1WGKA 3RD2A 4OVVA 3H1UA 2BWFA 4FJYA 4XWTA 1NYQA 2WXHA 4LDTD 4NAWA 2GBKA 1PGBA 3R2TA 1GC7A 1V1PB 4ICVA 2MRPA 4GDKB 3VDZA 1JWSD 1PDXA 2MBEA 4KX6B 1HE8A 4HJGE 1LGRA 4EFOA 3NUHB 1RLFA 4P1BC 4DWFA 1ZDVA 2KJ6A 3N20C 1CZPA 4LDTB 1YN4A 3DBRI 4XDDA 3R2IA 2K9XA 3AV8A 3RNFC 1B1ZA 1MHXA 2K5PA 1HA5A 3ZDMC 3A9JA 3AI5A 3IFWB 4B9KA 3MP9A 3VTWA 2XEWA 1TKYA 2LZ6A 2HTHA 3PGEA 2L0TA 4JWUC 5CHFA 1P0RA 4GN1A 2MCNB 1YQBA 5BYQA 2MQJA 3KUCB 3HVZA 3J9CA 1SB3C 2BYTA 2L1AA 1WGYA 2JXTA 4A6QA 1Q0WB 2INPE 3PSEB 4KZCA 2W3RA 4S0RA 3AE7B 3PZDA 3AE8B 1NBFC 5J2RA 1T0QC 3NRZA 1MI0A 3FAHA 1FNWA 3BVGA 3EUB2 1VJKA 2BS3B 5E6PA 4M01A 1HXYD 3JW0X 2D3GA 2KVZA 5EE0A 2E6XA 2KD0A 2KQSA 2LHDA 4W9IA 2JT4B 3B08A 4Q2JA 3U52E 2DYOA 1UUPA 4K7SA 4RNAA 5J17A 2CS4A 1J7CA 2C60A 4TUUA 4WWPA 4GDLB 2BS2B 2AQ1B 4TMAB 3AH7A 1HZ6A 3W5UB
chains in the Genus database with same CATH topology
1L4ZB 4L2YA 3ZQ4A 5BMIA 2G1EA 4ARCA 4DXFA 4C7ZA 3W1SA 3LYYA 5BYRA 4XWWA 1TS4A 1AYFA 2EELA 1EU3A 5FR3A 3TEZA 2JWUA 2J53A 3AEAB 1GPXA 1QKZA 2WU5B 1K52A 5D7GA 2I2YA 3AM9A 2JX5A 5GXGB 4H2AA 1I4GA 2N0SB 2WU2B 1ESFA 4HROA 2BB6A 2BBCA 2M19A 4KGSA 2MJDA 2YEPB 2HTME 1AN8A 3IT4B 2WXGA 1M4VA 1NI3A 1ZOYB 4JE3B 3V3XA 1N5WA 1SSNA 4NAMA 1XXGA 2QJLA 2RDGA 4RFBA 3P63A 3IT6B 1NVID 1E6EB 1F77A 3Q69A 2NTSA 5EE3A 4MH8A 2JZPA 2WQYB 3W9CB 4C80A 1STEA 2IPKD 4JX1C 1BXTA 1TYGB 2CJOA 2WP9B 1AW7A 4WURA 5G5GA 3TUOA 4FXCA 4RGNA 2JYEA 3CWIA 3BIID 1EM7A 2MEKA 2ONQA 3AN1A 1SE3A 1YJJA 3AEFB 4NAWB 5AUIA 5FKAC 4USAA 1YQ4B 4L23A 4RH6A 4RF0A 3SR6A 2W82A 1K50A 2TSSA 4B0EA 1OQQA 2RPVA 1SXTA 1YN5A 4REZA 1V1OA 3VR8B 1KLGD 1VLBA 2GB1A 3AB5A 3TEXA 1K53A 3KWLA 3W2DA 1RYJA 2IGHA 1L4DB 1XCQL 4WWMA 3Q8BA 1E7PB 2WXJA 1I7HA 3PZ8A 1DGJA 1J7BA 1ZDXA 3V05A 2AX5A 1QT9A 3WCQA 4A55A 4WH4A 1WRIA 4HRSA 1D5MC 4KGRA 3DWMA 1EWYC 3NVZA 4JWSC 1QOBA 3E9SA 2WXIA 2Y5CA 2ZW1A 3AE6B 2MJEA 3E56A 1BUIC 1UWXA 1XCTL 1FCCC 4ZHPA 1C9FA 2V0GA 2GI9A 1VZ8A 1FFVA 3C8YA 3HUIA 2KAJA 3GB1A 3ZGZA 3FC4A 2AQ3B 3HVDA 2LGIA 4A90A 2IDYA 5G5HA 1WWTA 1QLBB 4WIPA 2QMTA 1FEHA 1OQRA 4HEA1 1RM6C 5HFYA 1D5XC 1I4PA 2RMMA 2KACA 1JWUD 1TY2A 3AE9B 1NENB 2WXRA 1TS5A 4OHJA 3B2GA 4OW0A 3BYYB 4DXGA 2L52A 4XDCA 1E9MA 4IOIE 1FNVA 3AEGB 5BYSA 1I4XA 1ZPSA 2AQ2B 3KLSX 3N9YC 2X38A 2IGDA 1IGCA 3NZ3A 4LTUA 2WS3B 5BMHA 5LNK1 1VDVA 2PKOA 1L6UA 1Y56A 5HI1A 1JQ4A 1XLOA 1D4BA 2J42A 4AS1A 1SIJA 3AEDB 2FUG1 1V8CA 4HKZE 4WQMA 2PVGC 3EGRA 4N59A 1YNTE 1DOYA 1ACCA 2HDEA 1OFFA 5JXVA 2BS4B 2WXQA 1C4CA 1LO5D 1SJED 3MJ5A 4ZHOA 4RF1A 1YMHE 1XLNA 2LUMA 1CJEA 3MFGA 3TEYA 1VRAB 4YSYB 2G9HD 2WLBA 4OVZA 3VRAB 2PTLA 2QEJC 5AUKA 5BMGA 4D2KA 1FIQA 2GRIA 3AECB 3PZ7A 4LK0M 1QOAA 2B76B 3KQ4A 5EE1A 1V1PA 2W54A 3ABVB 5HHDG 2V4IB 1IBXA 3SEBA 3BZDB 2KN4A 3NVYA 3R8BA 2QSDA 1SEBD 2PLPA 2WXKA 4ZRQA 2K3UA 3W5UB 1F2RI 1GAQB 3BWUD 3BVZA 1ENFA 4N58A 1HEZE 1SBBB 1A70A 5T8IA 4KKIA 2MH7A 1TKEA 1TKGA 3B9JA 4LLGM 1WXQA 3LXFA 1FD6A 1KRHA 1RFKA 3AEBB 1C76A 4A8XC 1MHHE 1L0XB 2ACZB 2BB5A 4C56C 2VZKD 3T3NA 4YTPB 1E10A 2KWDA 3I9V1 4IDIA 4IKGA 1XF5L 4NJCA 4P16A 4XE0A 4YSXB 4RGTA 2E3TA 3P4QB 3PO0A 1C4PA 4KGTA 1D6EC 2FBWB 3AE3B 3Q8AA 1C4AA 1CQVA 2IJ0A 1QOGA 1L0VB 1HZ5A 4C7YA 2WXNA 1C77A 1FO4A 1ZP0B 1T3QA 2KMMA 1CK1A 1E0ZA 1ET9A 4J3OD 2LJIA 1BMLC 1MPEA 1IGDA 2W55A 3IAS1 2SEBD 1JWMD 1RWSA 2VZKB 1JWAD 3AE4B 1ZUD2 3VRBB 4PT5A 3U2SC 1TY0A 2OHFA 2WDQB 3H8HA 3CIRB 5H8YE 4JPSA 2M56B 4M0WA 2BTEA 2V3PA 3TEWA 1JRPA 1FM0D 1EWCA 3AEEB 2KQ4X 2Y3AA 1YQ3B 1ZXIA 3L4PA 3U4EG 5E6JA 1JW9D 4WAFA 2WDVB 1P7EA 3SFEB 3MHZA 1I4HA 1KFYB 2DWQA 2BW2A 3HRDD 3RPFC 3AMZA 1NEKB 2LMCA 1DYQA 1KF6B 5HG2A 3BK1A 4TQ0A 3NVWA 3AE1B 2FE8A 4YTNB 1C78A 1XO3A 1I4RA 1N61A 2NMQA 1HQRD 3UI3A 4YTMB 1R7SA 2R61A 1D5ZC 4MT5A 5TSSA 1F2RC 2WXLA 1PUTA 1YJIA 1ZE3D 3RFZB 2PVOD 3BYTB 1ZXHA 2L32A 3W5VB 3T3OA 2NTTA 4ITKA 2YEPF 1J7AA 2H89B 2ON8A 3EA6A 4L1BA 3IXSA 1UWMA 4US8A 4OZAA 1WYGA 3ZYYX 2DBYA 3AE5B 1TS2A 1VR9A 1SE2A 4DQOC 3BVMA 1FRRA 4RCOA 2Z8LA 2J52A 2EKIA 4P6VF 4N6EB 1FFUA 1SJHD 1DOIA 2MJ3A 3VR9B 2PW9A 3ZJVA 3ZJUA 1QQRA 4HKQA 1JALA 2DYMA 5MPOA 1QILA 1B9RA 1ROEA 1PGAA 2OEDA 4UDUC 2N9KA 3P4SB 2XNAC 1AWDA 3I57A 2PIAA 1VZ6A 2XN9C 1Q10A 1FRDA 2M0AA 3DWGC 2V3NA 5FK9C 4MM3B 2CJNA 1WGKA 3ETRA 4KKJA 1UNSA 4XWTA 1DOXA 1NYQA 2WXHA 2K22A 1GB4A 3NS1A 4ZYSA 1N62A 3NVVA 1VZ7A 1V97A 1PGBA 3R2TA 1K51A 4NZLB 1V1PB 5I4DA 1IBXB 3P42A 2D5GA 1FMAD 2WDRB 3OWEB 3KWVA 1TS3A 4GDKB 2L83A 5EE9A 4ZRPA 1T5XD 2WNMA 1JWSD 1PDXA 4KX6B 4HJGE 5D3DA 3NUHB 1FXAA 1ZDVA 2PMVA 1N60A 3Q8EA 2WXFA 5D3IB 1TJEA 1MVKA 1CZPA 1JWBD 1KH0A 2ICIA 2DLBA 2N9LA 3P4PB 5C2TB 1YN4A 3IAM1 1I4QA 4XDDA 3R2IA 2JYTA 2K0PA 2K9XA 3AV8A 1EU4A 1NYRA 1B1ZA 4US9A 1MHXA 2K5PA 4ZOHC 1HA5A 2RDHA 4YT0B 3TSSA 1JMLA 1YN3A 3MP9A 3ZJTA 2ZW0A 3FILA 2Y5PA 1TKYA 2JU6X 1T6BX 2I38A 2QILA 3P1MA 3Q8FA 1N5XA 5H92C 3GS2A 1GB1A 4JWUC 1FXIA 1P7FA 1PYWD 2JQRB 5BYQA 3HVZA 3J9CA 1L5PA 2J4XA 1SB3C 3VQIA 2BYTA 2L1AA 4OZBA 4TQ1A 2JXTA 1IUEA 4A6QA 2WXPA 4R3DA 1XLPA 1N63A 2INPE 1PGXA 3FILB 4A9AA 1C79A 2LHEA 1WSPA 3B2FA 4RGOS 4O1NA 2KDMA 2W3RA 2BT6A 3AE7B 4YXDB 3URYA 1FNUA 1L6VA 3AE8B 2WXMA 3AE2B 3O13A 1GOZA 4CQNA 1KLUD 4OZCA 4B0MA 4YSZB 3NRZA 4GLSC 1MI0A 3FAHA 1FNWA 3BVGA 2H88B 3EUB2 1VJKA 1KTKA 2BS3B 4TSSA 1F0ZA 1L0YB 2JSVX 1HXYD 4RGMA 2INNE 5EE0A 2SAKA 2LFIA 2E6XA 2CU3A 1XLQA 2LHDA 3GP7A 1TZOA 4MACA 3U7ZA 3MC0B 1UGJA 4Q2JA 3U52E 2LEKA 3LB8C 4ARIA 2DYOA 1UUPA 2Q5WD 3BK2A 1PFDA 5C3JB 1SE4A 4RNAA 1JROA 3SFDB 1J7CA 4AQ7A 1JCKB 4GDLB 2N7JA 1ET6A 1QF6A 1XEEA 1FCLA 2QIEB 4EE2A 2IGGA 2BS2B 4YWGG 2WXOA 1SF0A 2AQ1B 3Q8CA 4TMAB 2W3SA 3P4RB 3AH7A 1HZ6A 1QOFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDY A;  2GRI A;  2M0A A; 
#chains in the Genus database with same CATH topology
 2M4N A;  3WAN A;  4L2Y A;  2G1E A;  2IZV B;  4XGA B;  4XWW A;  1UZX B;  1K52 A;  5FR6 A;  1V5T A;  2N0S B;  1ESF A;  1UD7 A;  2BB6 A;  4ZRI A;  2Z0E B;  2R2O A;  1AN8 A;  3RNC C;  1N6Z A;  1SSN A;  4F1S A;  2QJL A;  4HLE A;  3ZTC A;  1E6E B;  4W9E A;  5EE3 A;  2NTS A;  4MH8 A;  2JZP A;  3MTN B;  1STE A;  2IPK D;  3VH4 B;  1TYG B;  4DXA B;  4G0N B;  1AW7 A;  4W9F A;  5G5G A;  4FXC A;  4RGN A;  2JYE A;  2CHX A;  1EM7 A;  3AN1 A;  3T8M A;  4URK A;  5FKA C;  2FCS A;  3ZVV A;  2YVC A;  4II3 B;  4L23 A;  3RZW C;  3N3K B;  2TSS A;  1L2N A;  4MGZ E;  1SXT A;  1KLG D;  2LUE A;  1VLB A;  4EOY A;  3AB5 A;  3TEX A;  3UGB B;  3W2D A;  1L4D B;  3EFU A;  1J7B A;  1U4A A;  5DPT A;  1D5M C;  4HJK A;  3DWM A;  4JWS C;  4KZ0 A;  3X0W A;  2L00 B;  3AE6 B;  1BUI C;  2J0K A;  3W1Y A;  3ZIM A;  3HUI A;  3PRZ A;  3BIN A;  3FC4 A;  3TMP B;  4TKN A;  2LGI A;  4ZYN A;  3QAR A;  1FEH A;  1OQR A;  3MJW A;  2ZPY A;  2KQ7 A;  4MJS A;  1TS5 A;  4OHJ A;  5DPW A;  3DOW A;  4IOI E;  2ZVN A;  3RI7 C;  4AP4 C;  2KT7 A;  2X38 A;  2KWV B;  2WWZ A;  2V9H A;  4LTU A;  2XK5 B;  2EKE C;  2WS3 B;  1VDV A;  2PKO A;  1JQ4 A;  3DVG X;  3WAP A;  5L83 A;  2NBV B;  2FUH B;  4GOC A;  3VAW A;  4HKZ E;  3QWZ B;  2D3A A;  3VUW A;  3L0W B;  3GZN B;  1ACC A;  2WXQ A;  3ZNZ B;  2KKC A;  2RDB C;  5IA7 A;  4AJY B;  3EEC A;  4DBG A;  4MM3 A;  2LUM A;  3PRE A;  1CJE A;  3ZRC A;  3TEY A;  2WLB A;  3VRA B;  4PS3 A;  5AUK A;  4ANW A;  2MBQ A;  4LNK A;  3AEC B;  3PZ7 A;  4LK0 M;  1QOA A;  2B76 B;  2W54 A;  1IBX A;  3EHV A;  3NVY A;  2N9E B;  4EEW A;  3KW5 B;  2PLP A;  3WAM A;  1EF5 A;  2K3U A;  2MHJ A;  3BWU D;  2KFJ A;  1ENF A;  1E90 A;  1WGR A;  2KN5 A;  4IWP A;  5CX3 A;  2KLG A;  2NS5 A;  4MEM A;  3L17 A;  1TKE A;  1TKG A;  3B9J A;  1WXQ A;  1KRH A;  4I6N B;  1UEL A;  2KTR A;  1UH6 A;  2VZK D;  4MDK E;  5LXI B;  3CST A;  4IDI A;  1XF5 L;  4NJC A;  4P16 A;  5IO9 A;  4YSX B;  4RGT A;  3P4Q B;  3QHT A;  3PO0 A;  3Q14 C;  3DCG A;  3Q8A A;  4WJN A;  5CHV C;  1CQV A;  3VVW B;  2IJ0 A;  3L16 A;  3KVF B;  1L0V B;  1HZ5 A;  1ZP0 B;  1T3Q A;  2BKF A;  4DHZ E;  1ET9 A;  1MPE A;  1IGD A;  3PT2 B;  2VZK B;  3GE3 C;  1WY8 A;  1JWA D;  1ZUD 2;  2O6V A;  1VD2 A;  3VH3 B;  2M56 B;  2BTE A;  4MH0 E;  3AEE B;  2KQ4 X;  4NPN A;  3L4P A;  2KXJ A;  3SFE B;  2KZR A;  3HRD D;  3VTU A;  3NOB A;  3DBH I;  1WR1 A;  3DVG Y;  3NVW A;  1WGH A;  4CYE A;  3A4S C;  1I4R A;  4MSM B;  2L8J A;  4YTM B;  4EZJ A;  5C1Z A;  4MT5 A;  3JYU A;  5EDS A;  2WXL A;  3TIX A;  1PUT A;  1YJI A;  2LRW A;  1GNU A;  2LD9 A;  3T3O A;  4JQW C;  2YEP F;  1J7A A;  2C5L C;  2H89 B;  1E8Z A;  2JZ3 B;  4L1B A;  3IXS A;  3PVL A;  2YLM A;  1H4R A;  3QAQ A;  1VR9 A;  3OJ3 A;  4DQO C;  2LVQ A;  1RRB A;  1FRR A;  4RCO A;  2RD0 A;  2MWS B;  2Z8L A;  1F9J A;  2J52 A;  1FFU A;  1SJH D;  2GBR A;  3Q3N C;  3R66 C;  2A4Z A;  3V6E B;  4JL9 A;  1P98 A;  1KM7 A;  2NBW B;  3WAL A;  1QIL A;  3WAO A;  2DAF A;  3R7Q A;  2NPT B;  1AWD A;  3I57 A;  1FRD A;  1WZ0 A;  5JHA A;  2V3N A;  2FID A;  3SDL C;  3ZKJ C;  3TBL D;  3HK0 A;  2K8H A;  3AU4 A;  2LRU A;  3ZUN A;  3NS1 A;  4ZYS A;  1N62 A;  1V97 A;  2CR5 A;  3VTV A;  3OWE B;  3KWV A;  1J8C A;  2KDB A;  1T5X D;  2WNM A;  5D3D A;  5C23 A;  2O2V A;  4M8M A;  2PMV A;  5JHB A;  1WZ3 A;  2MLB A;  5G2N A;  4PYU A;  1KH0 A;  2ICI A;  2NCN A;  5C2T B;  1I4Q A;  2DZK A;  1EU4 A;  4NQK E;  1WF9 A;  4ZOH C;  2L3Z A;  4AOF A;  1WJ6 A;  3ZJT A;  2ZW0 A;  1Q5W B;  3H6N A;  2MP2 A;  1WYW B;  2JU6 X;  2KOX A;  3Q3M C;  1YIW A;  1XT9 B;  2QIL A;  3DBL I;  4WJO A;  3WIM A;  3GS2 A;  1GB1 A;  1YX5 B;  2JZZ A;  1CMX B;  5JZE B;  2D2Q A;  3OG5 A;  4BKT A;  4A20 A;  4M0W B;  3I63 C;  2MSE D;  4R3D A;  2UYZ B;  3DHI C;  1N63 A;  4A9A A;  1WSP A;  4NJ7 A;  4RGO S;  4O1N A;  2KDM A;  3ECI A;  4KDI C;  3A1Q B;  1MG8 A;  1L6V A;  3AE2 B;  1D3Z A;  1KLU D;  4B0M A;  2JRH A;  4YSZ B;  2H88 B;  3D32 A;  2VH1 A;  4TSS A;  4W9G A;  1WJ4 A;  4RGM A;  5E6O A;  3DVN V;  1IP9 A;  3TL5 A;  3ZRF A;  2LEK A;  2Q5W D;  3BK2 A;  2DZM A;  2N1W A;  1WE7 A;  3M95 A;  1JCK B;  1XEE A;  1FCL A;  4BFR A;  3K9P B;  1QOF A;  4LJP B;  4C7Z A;  1AYF A;  5FR3 A;  3TEZ A;  2J53 A;  1GPX A;  5KHO A;  5D7G A;  1KLV A;  2MBB B;  4GMV A;  2JX5 A;  4HK2 A;  4H2A A;  3UIN B;  4HRO A;  4KGS A;  1V6E A;  4G50 A;  2WXG A;  1M4V A;  1NI3 A;  1ZOY B;  4AJW A;  1N5W A;  2LGY A;  3L10 B;  2LGD A;  4RFB A;  1I42 A;  3Q69 A;  1F77 A;  3W9C B;  2JY6 A;  1E7V A;  2OJW A;  1P3Q U;  4JX1 C;  1BXT A;  3M3J A;  4IUM B;  3BII D;  2D11 A;  2ONQ A;  2PJH A;  1SE3 A;  5AUI A;  1R4M B;  5DCN A;  2OOB B;  4FA6 A;  2KDE B;  3SHQ A;  2JWZ A;  4GGQ A;  4KVG B;  4RF0 A;  2LVP A;  2W82 A;  4ANU A;  4B0E A;  2RPV A;  1WIA A;  2GBN A;  1V1O A;  4B6W A;  2Z0D B;  3H7P A;  4JGH B;  1K53 A;  5IP4 D;  4WWM A;  3R3M A;  3Q8B A;  1E8Y A;  2IND C;  2LAS A;  4QAY A;  1E7U A;  3PZ8 A;  5HKH A;  1WFY A;  3V05 A;  2AX5 A;  1QT9 A;  3DPD A;  3L54 A;  4WH4 A;  1WRI A;  4W9L A;  1EWY C;  1UBQ A;  1QOB A;  3E9S A;  2JPH A;  2ZNV B;  3N30 A;  5G55 A;  1UWX A;  1WRD B;  1XCT L;  4ZHP A;  1C9F A;  1FFV A;  2AQ3 B;  3GE8 C;  3ONS A;  1TTN A;  1WJN A;  4WIP A;  2QMT A;  3NS8 A;  1WH3 A;  4AUQ C;  2KAC A;  1NEN B;  2WXR A;  3B2G A;  4OW0 A;  2K1F A;  4E3C A;  1FNV A;  1I4X A;  2C7M B;  2EMT A;  2AQ2 B;  3KLS X;  2I1K A;  2IGD A;  3NZ3 A;  3JSV A;  4K81 A;  4XZ4 A;  3APC A;  5L95 C;  3LJ3 A;  2RR9 A;  1OQY A;  1D4B A;  2ZJD A;  2J42 A;  4AS1 A;  1SIJ A;  3DBR B;  1SE9 A;  4MJS B;  4WQM A;  3RUI B;  2BWE S;  2PVG C;  4WQO B;  4HPM B;  1IYF A;  4BBN C;  2MW5 A;  1DOY A;  5JXV A;  1R4N I;  3MJ5 A;  1XLN A;  4YSY B;  4OVZ A;  2PTL A;  4X57 B;  2A5U A;  4BZA A;  1V1P A;  5HHD G;  2V4I B;  3SEB A;  5D94 A;  3WA0 A;  2QSD A;  2R2Q A;  1SEB D;  3VUX A;  4GDK A;  1WI0 A;  4FJV B;  2IBI B;  1F2R I;  2W9N A;  1GAQ B;  3OAW A;  4HCP B;  1Y8R C;  1RAX A;  2ZCC A;  4KKI A;  3ZXR A;  1C76 A;  2CHZ A;  4A8X C;  3DBS A;  2BB5 A;  3QCA A;  4ZRJ A;  3QC8 B;  3TCA A;  4C56 C;  5LXH A;  2RGF A;  4YTP B;  1E10 A;  3I9V 1;  5DPR A;  3AUL A;  3RUL A;  4DDG D;  2FBW B;  4IM0 A;  1P1A A;  2G4D B;  3ZNH B;  4C7Y A;  1C77 A;  1FO4 A;  4HCN B;  2KMM A;  4BBN F;  3CSF A;  3BY4 B;  1BML C;  4K3C A;  2SEB D;  2GOW A;  1NI2 A;  3AE4 B;  2PPH A;  1I35 A;  3VRB B;  4PT5 A;  1TY0 A;  3A9K A;  2WDQ B;  4KIK B;  1WXA A;  2V3P A;  3HHM A;  1JRP A;  1FM0 D;  1EWC A;  2WHI A;  1TIF A;  2DWQ A;  2BW2 A;  2MX2 A;  4IW0 A;  3RPF C;  1NEK B;  1V2Y A;  1WXS A;  1KF6 B;  2AL6 A;  5HG2 A;  3NY5 A;  4JIO U;  4YTN B;  2ZZP B;  2LI5 A;  5LLI A;  1D5Z C;  5TSS A;  2KFK B;  1F2R C;  1ZE3 D;  2PVO D;  2IO0 B;  3BYT B;  1YD8 U;  2L32 A;  3W5V B;  4GDL A;  4CO7 A;  5J18 A;  4BKS D;  4US8 A;  2KK8 A;  2L05 A;  1WYG A;  2DYB A;  4GXB A;  1TS2 A;  3AXC A;  1SE2 A;  3N1Z C;  3HIZ A;  3VFK A;  2CU1 A;  1YJ1 A;  2D3B A;  2EKI A;  2N4F A;  3L13 A;  4P6V F;  3V6C B;  1DOI A;  2MJ3 A;  4NNJ B;  2FCQ A;  3Q2A C;  4IM2 A;  3ZJV A;  1QQR A;  4HKQ A;  4RM9 A;  4JLC A;  2QCZ A;  4E74 A;  5KHQ A;  2OED A;  1XD3 B;  2N9K A;  2XNA C;  3NHE B;  4MEL A;  2KVR A;  1Q10 A;  3ZNI D;  3DWG C;  1EUV B;  1Q1O A;  2WX0 A;  1QZE A;  1RFA A;  3KYD D;  1DOX A;  1GB4 A;  2K22 A;  3NVV A;  2L76 A;  2DX5 B;  2QDF A;  4NZL B;  5I4D A;  3P42 A;  4PYZ A;  2WDR B;  1TS3 A;  2L83 A;  5EE9 A;  4ZRP A;  3P2B A;  4HDQ A;  3U30 A;  4NJ6 A;  1WM2 A;  1V86 A;  3SU8 X;  1N60 A;  4C4V B;  4XC2 A;  1MVK A;  1JWB D;  3ENE A;  3W1S C;  2K8B A;  2N9X A;  2JYT A;  3DQV A;  1NYR A;  4US9 A;  1S3S G;  3T9L A;  2RDH A;  5TR5 A;  2J0J A;  4MGY E;  1C3T A;  3ZTD A;  1WXM A;  2O2V B;  2QHO A;  3FIL A;  2Y5P A;  4BVU C;  1KJT A;  1T6B X;  4I6P A;  3ALB A;  1N5X A;  5H92 C;  2K39 A;  3DDC B;  1FXI A;  4F7Z A;  3Q6B A;  1PYW D;  2JQR B;  4PK1 A;  4W9D A;  1WMH B;  1E8X A;  4OZB A;  2GMI C;  3RNG C;  1IUE A;  2MBO A;  2WXP A;  1PGX A;  2XK5 A;  2MP2 B;  3B2F A;  2UWQ A;  2DEN B;  3QK0 A;  3U7D A;  3URY A;  1FNU A;  2WXM A;  3O13 A;  1GOZ A;  4CQN A;  4OZC A;  2KAN A;  2LGS A;  4YL8 A;  4F8C B;  1KTK A;  3KH0 A;  1L0Y B;  4ICU A;  3RN9 C;  2INN E;  2AWT A;  2SAK A;  4IWQ A;  3IVF A;  4I6L B;  2CU3 A;  3GP7 A;  1TZO A;  4FLH A;  3MC0 B;  1UGJ A;  3LB8 C;  5C3J B;  4AQ7 A;  4PS7 A;  4G3X B;  2N7J A;  1ET6 A;  1QF6 A;  2QIE B;  2IGG A;  2GBM A;  4YWG G;  1SF0 A;  3Q8C A;  2BQQ A;  2FIF A;  2W3S A;  3P4R B;  5BMI A;  3IG3 A;  3W1S A;  5BYR A;  1TS4 A;  1EU3 A;  2JWU A;  1FXT B;  3AEA B;  2WGS A;  3AM9 A;  4FAD A;  2V1Y A;  1I4G A;  2WU2 B;  3DBH B;  2M19 A;  1FPY A;  2HTM E;  1T0R C;  2DZJ A;  1J19 A;  1L7Y A;  3V3X A;  4JE3 B;  2NR2 A;  4GSW A;  1TGZ B;  2ZVO A;  4NAM A;  2RDG A;  4FJZ A;  2DAJ A;  1E8W A;  1WX9 A;  3N32 A;  3UIO B;  2WP9 B;  2KO3 A;  4EZL A;  3ML8 A;  3CWI A;  2M8S A;  2MEK A;  1YJJ A;  3AEF B;  4NAW B;  1ZKH A;  1BT0 A;  1YQ4 B;  2GBJ A;  2LXC A;  1K50 A;  2X8X X;  1MFW A;  1OQQ A;  3ZO5 B;  1YN5 A;  4REZ A;  2M17 A;  1V80 A;  2GB1 A;  3MC9 A;  3KWL A;  1WJU A;  1RYJ A;  2IGH A;  1XCQ L;  1E7P B;  1I7H A;  3V61 A;  1DGJ A;  2L0F A;  2KC1 A;  3WCQ A;  4A55 A;  4HRS A;  4KGR A;  1TBE A;  1F52 A;  2ZW1 A;  1VCB A;  2G45 B;  2LGX A;  4C00 A;  3E56 A;  1UGM A;  1FCC C;  5AZH A;  1P9D U;  3A9J B;  4PS8 A;  3C8Y A;  1VZ8 A;  3QX1 A;  2V3S A;  4K7U A;  2KAJ A;  3GB1 A;  3RCZ A;  3DHH C;  4A90 A;  2IDY A;  3C19 A;  5G5H A;  4HEA 1;  4ZDV A;  4M02 A;  5HFY A;  1JWU D;  1TY2 A;  3AE9 B;  2L7R A;  3BYY B;  2KDF B;  4XDC A;  4ANV A;  5BYS A;  1ZPS A;  2KLC A;  4ACF A;  1LFD A;  1IGC A;  1NDD A;  4FUL A;  5BMH A;  5LNK 1;  5HI1 A;  1L6U A;  1Y56 A;  2OJR A;  3I3T B;  3AED B;  1V8C A;  3GOE A;  4MSQ B;  4LNF A;  1R4M I;  2LWP A;  2JF5 A;  1H8C A;  2NPT A;  2M1M A;  5BO4 B;  4G11 A;  2HDE A;  1OFF A;  1T0S C;  2BS4 B;  4NQL B;  1V81 A;  4KSL C;  4RF1 A;  1VRA B;  3DBL B;  3PRP B;  5BMG A;  2BYF A;  4M00 A;  2GRI A;  4E71 A;  1S1Q B;  2DNF A;  5EE1 A;  3BZD B;  1ZGU B;  1YOV B;  2EMS A;  4P7I A;  2MBH A;  2K8C A;  4FBJ B;  3BVZ A;  4N58 A;  1HEZ E;  2ZCB A;  1SBB B;  1A70 A;  5T8I A;  3APF A;  4DHZ B;  2MH7 A;  2AL3 A;  3HM6 X;  3LXF A;  1RFK A;  1MHH E;  4IC7 B;  2ACZ B;  1UBI A;  4HVB A;  2KWD A;  3N1X C;  4XE0 A;  2HE7 A;  4LCD E;  1MG4 A;  1F1H A;  2KX3 A;  2M0X A;  4KGT A;  3ZDT A;  2J0M A;  4IM3 A;  1QOG A;  3QA8 A;  3V62 A;  2WXN A;  4WWO A;  1E0Z A;  4J3O D;  2LJI A;  3IAS 1;  1JWM D;  1RWS A;  1WR6 E;  3NG0 A;  4OVU A;  1LQB A;  3U2S C;  2D07 B;  1HTQ A;  3CIR B;  2IO3 B;  4M0W A;  3TEW A;  4TV3 A;  1SGH A;  3U8Z A;  2Y3A A;  5GMV A;  1YQ3 B;  1PQS A;  3U4E G;  3DHG C;  5E6J A;  1JW9 D;  4WAF A;  2PEA A;  3A1Q A;  5CTR C;  2DHZ A;  3RNA C;  4BOS C;  3VXW A;  1GG3 A;  4WAA A;  5IAA C;  1V9J A;  2K25 A;  2IO2 B;  3BK1 A;  4TQ0 A;  3AE1 B;  2FE8 A;  1XO3 A;  1N61 A;  1WX7 A;  2NMQ A;  3PHX B;  3A9K B;  3UI3 A;  5JH5 C;  4W9J A;  1R7S A;  2R61 A;  3H7S A;  3RNB C;  2ZNV C;  4BAX A;  2BPS A;  3RFZ B;  1Z5S B;  1ZXH A;  4II2 B;  2NTT A;  4ITK A;  4EUT A;  1UWM A;  2JXX A;  1J0G A;  3IBE A;  3ZYY X;  3FKY A;  2NVU I;  4S17 A;  2N9P C;  2KDI A;  2BF8 B;  1MJD A;  3RYT A;  2DYM A;  4B95 A;  5MPO A;  2D10 A;  1B9R A;  1ROE A;  1PGA A;  3CF6 E;  2PIA A;  1WE6 A;  1GC6 A;  2IY1 B;  2LJ5 A;  2G4S A;  3I5J C;  2FAZ A;  5FK9 C;  1SIF A;  4MM3 B;  4K3B A;  3ETR A;  3PPA A;  4KKJ A;  1UNS A;  2KJR A;  1VZ7 A;  4HDO A;  5E6N A;  1K51 A;  1IBX B;  2D5G A;  1FMA D;  2CKH B;  2N7D A;  4HXD A;  3A4R A;  1T0Y A;  3RNE C;  4XX5 A;  2C7N B;  5IN7 A;  3KUZ A;  1FXA A;  3MC8 A;  3Q8E A;  5D3I B;  2WXF A;  2BYV E;  1TJE A;  2KTR B;  3RT3 B;  2B3A A;  1M94 A;  3S2A A;  2DLB A;  2N9L A;  4KSK C;  3P4P B;  3IAM 1;  4LJO B;  1WGG A;  2K0P A;  1OGW A;  2O6V D;  4J6I A;  3UQB A;  4FHK A;  1R4N B;  2FNJ B;  3M62 B;  4YT0 B;  3TSS A;  1JML A;  1YX6 B;  3GZN I;  1YN3 A;  1EF1 A;  2BGF A;  4WJP A;  2C9W B;  3DVN U;  3X23 A;  2HD5 B;  2I38 A;  1WXV A;  3P1M A;  3Q8F A;  2J7Q B;  1P7F A;  3H9D A;  4GB9 A;  2PE9 A;  1L5P A;  2J4X A;  2O6V B;  3RZF A;  3VQI A;  4TQ1 A;  3V60 A;  3MHS D;  1OTR B;  4P1C C;  1Z2M A;  2RPQ A;  4XYC A;  4EZK A;  1XLP A;  3FIL B;  1G6J A;  4ASW C;  1C79 A;  2LHE A;  4RM8 A;  1LXD A;  2BT6 A;  4YXD B;  4HWI B;  3N1Y C;  4LNO A;  5IKC M;  4KDL B;  4GLS C;  2ASQ A;  1ISN A;  1TZ1 A;  3B0A A;  2NBU A;  3L08 A;  1F0Z A;  2JSV X;  1K8R B;  2LFI A;  4IWO A;  3UF8 A;  2KWU B;  1XLQ A;  4MAC A;  4W9H A;  4FN2 A;  3U7Z A;  2K6D B;  3APD A;  3QQ8 B;  4ARI A;  1PFD A;  1SE4 A;  1JRO A;  3SFD B;  1WGD A;  4WWN A;  3C0R B;  3PS6 A;  3OJ4 B;  4EE2 A;  3JVZ X;  2K6Q A;  2WXO A;  4A3P A;  1HTO A;  3EFC A;  2ZEQ A;  4MGI E;  1L4Z B;  4ARC A;  3ZQ4 A;  4DDI D;  4DXF A;  1TT5 B;  3LYY A;  3QJZ A;  2EEL A;  1XQQ A;  1QKZ A;  2WU5 B;  2I2Y A;  4A3O A;  2C7H A;  5GXG B;  1GJZ A;  4N9F 4;  2GLS A;  2BBC A;  4LNI A;  3R7R A;  2MJD A;  2YEP B;  3Q3O C;  3IT4 B;  1A5R A;  4WJQ A;  2REX A;  1XXG A;  3P63 A;  3IT6 B;  1NVI D;  2WYQ A;  2WQY B;  4C80 A;  2CJO A;  4WUR A;  3TUO A;  2I1J A;  5D6J B;  2KHW B;  3ZLZ A;  4DK5 A;  4NY0 A;  1WM3 A;  1V5O A;  2KYW A;  4USA A;  4RH6 A;  3SR6 A;  2LXA A;  3LDZ E;  4KIK A;  3PV1 A;  2KTF A;  2N7E A;  3VR8 B;  2JUO A;  3PTF C;  2WXJ A;  2Y5B B;  3OLM D;  4BKG A;  1ZDX A;  3VHT C;  2FCM A;  1OEY A;  3NVZ A;  2WXI A;  4W9K A;  2Y5C A;  1GUA B;  2IYD B;  4HPP A;  2MJE A;  3A33 B;  2WDT B;  4FHJ A;  2V0G A;  2GI9 A;  2KFK A;  3ZGZ A;  3HVD A;  3HM3 A;  4EKU A;  4DHJ D;  3UIP B;  2G3Q B;  1WWT A;  1QLB B;  3ZXV A;  1RM6 C;  3KYC D;  1D5X C;  1IPG A;  1I4P A;  2RMM A;  3ML9 A;  2AEH A;  2CHW A;  4DXG A;  2BVC A;  2L52 A;  2KNB A;  1E9M A;  3AEG B;  4HPL B;  5D2M B;  3N9Y C;  3Q3F A;  2QC8 A;  4DHJ B;  1XLO A;  2BYE A;  2PE6 B;  1UF0 A;  2FUG 1;  2HJ8 A;  1C1Y B;  4BKS A;  4N59 A;  3EGR A;  4IG7 B;  4GU2 A;  1YNT E;  4RMA A;  2KMC A;  1C4C A;  1LO5 D;  1SJE D;  4M8N A;  4ZHO A;  1YMH E;  2VRR B;  3MFG A;  2VH2 A;  2G9H D;  2IO1 B;  4D2K A;  2QEJ C;  5CHW A;  1FIQ A;  3ZNG C;  3PLV A;  3PHW B;  3KQ4 A;  3PLU A;  2XBB C;  3ABV B;  3O65 B;  2KN4 A;  3R8B A;  2MA9 B;  2WXK A;  4ZRQ A;  5DPS A;  2UU7 A;  3ZW3 A;  1FD6 A;  4LLG M;  3AEB B;  4C4V A;  2AYO B;  1L0X B;  2ZPN A;  2KC2 A;  4K1R B;  1V49 A;  1KOT A;  3T3N A;  4W9C A;  4IKG A;  4K7W A;  3QIJ A;  2E3T A;  3K9O B;  1C4P A;  4AWJ A;  1D6E C;  3AE3 B;  1C4A A;  3Q3J A;  4LNN A;  3RMK C;  1OEY J;  1EO6 A;  4MGK E;  5AZG A;  1CK1 A;  2LVO A;  3NJT A;  5AEK B;  3PRM B;  2W55 A;  2INC C;  1WMH A;  2BKR B;  3M63 B;  2JVC A;  3UQA A;  2OHF A;  3H8H A;  2JRI B;  5H8Y E;  2N1V A;  1X1M A;  4JPS A;  5IOI A;  1LM8 B;  1ZXI A;  2KX0 A;  4BOZ B;  3H7P B;  2DZI A;  2WDV B;  1P7E A;  2FCN A;  3MHZ A;  1I4H A;  1KFY B;  2WX1 A;  3EC8 A;  1E5W A;  3AMZ A;  3NZS A;  2LMC A;  1DYQ A;  1C78 A;  1JRU A;  1HQR D;  2KMA A;  2Z59 B;  3CMM B;  4ANX A;  3SD5 A;  3AU5 A;  2ON8 A;  3EA6 A;  4OZA A;  3VUY A;  2HJ1 A;  1ZW7 A;  2KJH B;  3IHP C;  2DBY A;  3AE5 B;  3B1L X;  4GIV A;  4CHK A;  4KV2 A;  3KUD B;  3BVM A;  2D3C A;  2KWC A;  3TJP A;  3JSV B;  4N6E B;  3VR9 B;  2V4L A;  2PW9 A;  3ZJU A;  5AZF A;  1JAL A;  2RSU A;  1AAR A;  1WX8 A;  4ZRK A;  4UDU C;  2IY0 B;  3P4S B;  2XN9 C;  1VZ6 A;  2M0A A;  3NZU A;  2CJN A;  1WGK A;  3RD2 A;  4OVV A;  3H1U A;  2BWF A;  4FJY A;  4XWT A;  1NYQ A;  2WXH A;  4LDT D;  4NAW A;  2GBK A;  1PGB A;  3R2T A;  1GC7 A;  1V1P B;  4ICV A;  2MRP A;  4GDK B;  3VDZ A;  1JWS D;  1PDX A;  2MBE A;  4KX6 B;  1HE8 A;  4HJG E;  1LGR A;  4EFO A;  3NUH B;  1RLF A;  4P1B C;  4DWF A;  1ZDV A;  2KJ6 A;  3N20 C;  1CZP A;  4LDT B;  1YN4 A;  3DBR I;  4XDD A;  3R2I A;  2K9X A;  3AV8 A;  3RNF C;  1B1Z A;  1MHX A;  2K5P A;  1HA5 A;  3ZDM C;  3A9J A;  3AI5 A;  3IFW B;  4B9K A;  3MP9 A;  3VTW A;  2XEW A;  1TKY A;  2LZ6 A;  2HTH A;  3PGE A;  2L0T A;  4JWU C;  5CHF A;  1P0R A;  4GN1 A;  2MCN B;  1YQB A;  5BYQ A;  2MQJ A;  3KUC B;  3HVZ A;  3J9C A;  1SB3 C;  2BYT A;  2L1A A;  1WGY A;  2JXT A;  4A6Q A;  1Q0W B;  2INP E;  3PSE B;  4KZC A;  2W3R A;  4S0R A;  3AE7 B;  3PZD A;  3AE8 B;  1NBF C;  5J2R A;  1T0Q C;  3NRZ A;  1MI0 A;  3FAH A;  1FNW A;  3BVG A;  3EUB 2;  1VJK A;  2BS3 B;  5E6P A;  4M01 A;  1HXY D;  3JW0 X;  2D3G A;  2KVZ A;  5EE0 A;  2E6X A;  2KD0 A;  2KQS A;  2LHD A;  4W9I A;  2JT4 B;  3B08 A;  4Q2J A;  3U52 E;  2DYO A;  1UUP A;  4K7S A;  4RNA A;  5J17 A;  2CS4 A;  1J7C A;  2C60 A;  4TUU A;  4WWP A;  4GDL B;  2BS2 B;  2AQ1 B;  4TMA B;  3AH7 A;  1HZ6 A;  3W5U B; 
#chains in the Genus database with same CATH homology
 1L4Z B;  4L2Y A;  3ZQ4 A;  5BMI A;  2G1E A;  4ARC A;  4DXF A;  4C7Z A;  3W1S A;  3LYY A;  5BYR A;  4XWW A;  1TS4 A;  1AYF A;  2EEL A;  1EU3 A;  5FR3 A;  3TEZ A;  2JWU A;  2J53 A;  3AEA B;  1GPX A;  1QKZ A;  2WU5 B;  1K52 A;  5D7G A;  2I2Y A;  3AM9 A;  2JX5 A;  5GXG B;  4H2A A;  1I4G A;  2N0S B;  2WU2 B;  1ESF A;  4HRO A;  2BB6 A;  2BBC A;  2M19 A;  4KGS A;  2MJD A;  2YEP B;  2HTM E;  1AN8 A;  3IT4 B;  2WXG A;  1M4V A;  1NI3 A;  1ZOY B;  4JE3 B;  3V3X A;  1N5W A;  1SSN A;  4NAM A;  1XXG A;  2QJL A;  2RDG A;  4RFB A;  3P63 A;  3IT6 B;  1NVI D;  1E6E B;  1F77 A;  3Q69 A;  2NTS A;  5EE3 A;  4MH8 A;  2JZP A;  2WQY B;  3W9C B;  4C80 A;  1STE A;  2IPK D;  4JX1 C;  1BXT A;  1TYG B;  2CJO A;  2WP9 B;  1AW7 A;  4WUR A;  5G5G A;  3TUO A;  4FXC A;  4RGN A;  2JYE A;  3CWI A;  3BII D;  1EM7 A;  2MEK A;  2ONQ A;  3AN1 A;  1SE3 A;  1YJJ A;  3AEF B;  4NAW B;  5AUI A;  5FKA C;  4USA A;  1YQ4 B;  4L23 A;  4RH6 A;  4RF0 A;  3SR6 A;  2W82 A;  1K50 A;  2TSS A;  4B0E A;  1OQQ A;  2RPV A;  1SXT A;  1YN5 A;  4REZ A;  1V1O A;  3VR8 B;  1KLG D;  1VLB A;  2GB1 A;  3AB5 A;  3TEX A;  1K53 A;  3KWL A;  3W2D A;  1RYJ A;  2IGH A;  1L4D B;  1XCQ L;  4WWM A;  3Q8B A;  1E7P B;  2WXJ A;  1I7H A;  3PZ8 A;  1DGJ A;  1J7B A;  1ZDX A;  3V05 A;  2AX5 A;  1QT9 A;  3WCQ A;  4A55 A;  4WH4 A;  1WRI A;  4HRS A;  1D5M C;  4KGR A;  3DWM A;  1EWY C;  3NVZ A;  4JWS C;  1QOB A;  3E9S A;  2WXI A;  2Y5C A;  2ZW1 A;  3AE6 B;  2MJE A;  3E56 A;  1BUI C;  1UWX A;  1XCT L;  1FCC C;  4ZHP A;  1C9F A;  2V0G A;  2GI9 A;  1VZ8 A;  1FFV A;  3C8Y A;  3HUI A;  2KAJ A;  3GB1 A;  3ZGZ A;  3FC4 A;  2AQ3 B;  3HVD A;  2LGI A;  4A90 A;  2IDY A;  5G5H A;  1WWT A;  1QLB B;  4WIP A;  2QMT A;  1FEH A;  1OQR A;  4HEA 1;  1RM6 C;  5HFY A;  1D5X C;  1I4P A;  2RMM A;  2KAC A;  1JWU D;  1TY2 A;  3AE9 B;  1NEN B;  2WXR A;  1TS5 A;  4OHJ A;  3B2G A;  4OW0 A;  3BYY B;  4DXG A;  2L52 A;  4XDC A;  1E9M A;  4IOI E;  1FNV A;  3AEG B;  5BYS A;  1I4X A;  1ZPS A;  2AQ2 B;  3KLS X;  3N9Y C;  2X38 A;  2IGD A;  1IGC A;  3NZ3 A;  4LTU A;  2WS3 B;  5BMH A;  5LNK 1;  1VDV A;  2PKO A;  1L6U A;  1Y56 A;  5HI1 A;  1JQ4 A;  1XLO A;  1D4B A;  2J42 A;  4AS1 A;  1SIJ A;  3AED B;  2FUG 1;  1V8C A;  4HKZ E;  4WQM A;  2PVG C;  3EGR A;  4N59 A;  1YNT E;  1DOY A;  1ACC A;  2HDE A;  1OFF A;  5JXV A;  2BS4 B;  2WXQ A;  1C4C A;  1LO5 D;  1SJE D;  3MJ5 A;  4ZHO A;  4RF1 A;  1YMH E;  1XLN A;  2LUM A;  1CJE A;  3MFG A;  3TEY A;  1VRA B;  4YSY B;  2G9H D;  2WLB A;  4OVZ A;  3VRA B;  2PTL A;  2QEJ C;  5AUK A;  5BMG A;  4D2K A;  1FIQ A;  2GRI A;  3AEC B;  3PZ7 A;  4LK0 M;  1QOA A;  2B76 B;  3KQ4 A;  5EE1 A;  1V1P A;  2W54 A;  3ABV B;  5HHD G;  2V4I B;  1IBX A;  3SEB A;  3BZD B;  2KN4 A;  3NVY A;  3R8B A;  2QSD A;  1SEB D;  2PLP A;  2WXK A;  4ZRQ A;  2K3U A;  3W5U B;  1F2R I;  1GAQ B;  3BWU D;  3BVZ A;  1ENF A;  4N58 A;  1HEZ E;  1SBB B;  1A70 A;  5T8I A;  4KKI A;  2MH7 A;  1TKE A;  1TKG A;  3B9J A;  4LLG M;  1WXQ A;  3LXF A;  1FD6 A;  1KRH A;  1RFK A;  3AEB B;  1C76 A;  4A8X C;  1MHH E;  1L0X B;  2ACZ B;  2BB5 A;  4C56 C;  2VZK D;  3T3N A;  4YTP B;  1E10 A;  2KWD A;  3I9V 1;  4IDI A;  4IKG A;  1XF5 L;  4NJC A;  4P16 A;  4XE0 A;  4YSX B;  4RGT A;  2E3T A;  3P4Q B;  3PO0 A;  1C4P A;  4KGT A;  1D6E C;  2FBW B;  3AE3 B;  3Q8A A;  1C4A A;  1CQV A;  2IJ0 A;  1QOG A;  1L0V B;  1HZ5 A;  4C7Y A;  2WXN A;  1C77 A;  1FO4 A;  1ZP0 B;  1T3Q A;  2KMM A;  1CK1 A;  1E0Z A;  1ET9 A;  4J3O D;  2LJI A;  1BML C;  1MPE A;  1IGD A;  2W55 A;  3IAS 1;  2SEB D;  1JWM D;  1RWS A;  2VZK B;  1JWA D;  3AE4 B;  1ZUD 2;  3VRB B;  4PT5 A;  3U2S C;  1TY0 A;  2OHF A;  2WDQ B;  3H8H A;  3CIR B;  5H8Y E;  4JPS A;  2M56 B;  4M0W A;  2BTE A;  2V3P A;  3TEW A;  1JRP A;  1FM0 D;  1EWC A;  3AEE B;  2KQ4 X;  2Y3A A;  1YQ3 B;  1ZXI A;  3L4P A;  3U4E G;  5E6J A;  1JW9 D;  4WAF A;  2WDV B;  1P7E A;  3SFE B;  3MHZ A;  1I4H A;  1KFY B;  2DWQ A;  2BW2 A;  3HRD D;  3RPF C;  3AMZ A;  1NEK B;  2LMC A;  1DYQ A;  1KF6 B;  5HG2 A;  3BK1 A;  4TQ0 A;  3NVW A;  3AE1 B;  2FE8 A;  4YTN B;  1C78 A;  1XO3 A;  1I4R A;  1N61 A;  2NMQ A;  1HQR D;  3UI3 A;  4YTM B;  1R7S A;  2R61 A;  1D5Z C;  4MT5 A;  5TSS A;  1F2R C;  2WXL A;  1PUT A;  1YJI A;  1ZE3 D;  3RFZ B;  2PVO D;  3BYT B;  1ZXH A;  2L32 A;  3W5V B;  3T3O A;  2NTT A;  4ITK A;  2YEP F;  1J7A A;  2H89 B;  2ON8 A;  3EA6 A;  4L1B A;  3IXS A;  1UWM A;  4US8 A;  4OZA A;  1WYG A;  3ZYY X;  2DBY A;  3AE5 B;  1TS2 A;  1VR9 A;  1SE2 A;  4DQO C;  3BVM A;  1FRR A;  4RCO A;  2Z8L A;  2J52 A;  2EKI A;  4P6V F;  4N6E B;  1FFU A;  1SJH D;  1DOI A;  2MJ3 A;  3VR9 B;  2PW9 A;  3ZJV A;  3ZJU A;  1QQR A;  4HKQ A;  1JAL A;  2DYM A;  5MPO A;  1QIL A;  1B9R A;  1ROE A;  1PGA A;  2OED A;  4UDU C;  2N9K A;  3P4S B;  2XNA C;  1AWD A;  3I57 A;  2PIA A;  1VZ6 A;  2XN9 C;  1Q10 A;  1FRD A;  2M0A A;  3DWG C;  2V3N A;  5FK9 C;  4MM3 B;  2CJN A;  1WGK A;  3ETR A;  4KKJ A;  1UNS A;  4XWT A;  1DOX A;  1NYQ A;  2WXH A;  2K22 A;  1GB4 A;  3NS1 A;  4ZYS A;  1N62 A;  3NVV A;  1VZ7 A;  1V97 A;  1PGB A;  3R2T A;  1K51 A;  4NZL B;  1V1P B;  5I4D A;  1IBX B;  3P42 A;  2D5G A;  1FMA D;  2WDR B;  3OWE B;  3KWV A;  1TS3 A;  4GDK B;  2L83 A;  5EE9 A;  4ZRP A;  1T5X D;  2WNM A;  1JWS D;  1PDX A;  4KX6 B;  4HJG E;  5D3D A;  3NUH B;  1FXA A;  1ZDV A;  2PMV A;  1N60 A;  3Q8E A;  2WXF A;  5D3I B;  1TJE A;  1MVK A;  1CZP A;  1JWB D;  1KH0 A;  2ICI A;  2DLB A;  2N9L A;  3P4P B;  5C2T B;  1YN4 A;  3IAM 1;  1I4Q A;  4XDD A;  3R2I A;  2JYT A;  2K0P A;  2K9X A;  3AV8 A;  1EU4 A;  1NYR A;  1B1Z A;  4US9 A;  1MHX A;  2K5P A;  4ZOH C;  1HA5 A;  2RDH A;  4YT0 B;  3TSS A;  1JML A;  1YN3 A;  3MP9 A;  3ZJT A;  2ZW0 A;  3FIL A;  2Y5P A;  1TKY A;  2JU6 X;  1T6B X;  2I38 A;  2QIL A;  3P1M A;  3Q8F A;  1N5X A;  5H92 C;  3GS2 A;  1GB1 A;  4JWU C;  1FXI A;  1P7F A;  1PYW D;  2JQR B;  5BYQ A;  3HVZ A;  3J9C A;  1L5P A;  2J4X A;  1SB3 C;  3VQI A;  2BYT A;  2L1A A;  4OZB A;  4TQ1 A;  2JXT A;  1IUE A;  4A6Q A;  2WXP A;  4R3D A;  1XLP A;  1N63 A;  2INP E;  1PGX A;  3FIL B;  4A9A A;  1C79 A;  2LHE A;  1WSP A;  3B2F A;  4RGO S;  4O1N A;  2KDM A;  2W3R A;  2BT6 A;  3AE7 B;  4YXD B;  3URY A;  1FNU A;  1L6V A;  3AE8 B;  2WXM A;  3AE2 B;  3O13 A;  1GOZ A;  4CQN A;  1KLU D;  4OZC A;  4B0M A;  4YSZ B;  3NRZ A;  4GLS C;  1MI0 A;  3FAH A;  1FNW A;  3BVG A;  2H88 B;  3EUB 2;  1VJK A;  1KTK A;  2BS3 B;  4TSS A;  1F0Z A;  1L0Y B;  2JSV X;  1HXY D;  4RGM A;  2INN E;  5EE0 A;  2SAK A;  2LFI A;  2E6X A;  2CU3 A;  1XLQ A;  2LHD A;  3GP7 A;  1TZO A;  4MAC A;  3U7Z A;  3MC0 B;  1UGJ A;  4Q2J A;  3U52 E;  2LEK A;  3LB8 C;  4ARI A;  2DYO A;  1UUP A;  2Q5W D;  3BK2 A;  1PFD A;  5C3J B;  1SE4 A;  4RNA A;  1JRO A;  3SFD B;  1J7C A;  4AQ7 A;  1JCK B;  4GDL B;  2N7J A;  1ET6 A;  1QF6 A;  1XEE A;  1FCL A;  2QIE B;  4EE2 A;  2IGG A;  2BS2 B;  4YWG G;  2WXO A;  1SF0 A;  2AQ1 B;  3Q8C A;  4TMA B;  2W3S A;  3P4R B;  3AH7 A;  1HZ6 A;  1QOF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...