1HEZE

Antibody-antigen complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibody
molecule keywords KAPPA LIGHT CHAIN OF IG
publication title Complex between Peptostreptococcus Magnus Protein L and a Human Antibody Reveals Structural Convergence in the Interaction Modes of Fab Binding Modes
pubmed doi rcsb
total genus 15
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hezE00
4GLSC 1QKZA 2IGGA 1K51A 2IGHA 1PGBA 5HHDG 1F2RI 1HZ5A 2ZW1A 2OEDA 2K0PA 4MACA 2RPVA 1MHXA 2GI9A 1XF5L 2I2YA 1MPEA 5BMHA 2PTLA 1FCLA 2EELA 2ONQA 3UI3A 1D4BA 5HFYA 4HJGE 1YNTE 2LGIA 2N7JA 2JWUA 2ON8A 2NMQA 4D2KA 3FILA 2KACA 1K50A 2N9LA 4KGSA 1YMHE 1KH0A 1ZXHA 1FD6A 3MP9A 2QMTA 5HI1A 1IGCA 1K53A 1MVKA 1HZ6A 2GB1A 2LHDA 1F2RC 2QSDA 2LHEA 4IOIE 2KQ4X 2JU6X 1XCTL 4IKGA 1HEZE 4KGTA 1FCCC 3FILB 1MI0A 1EM7A 2J53A 4HKZE 5JXVA 1IBXA 2I38A 2IGDA 2J52A 1GB4A 1PGAA 1IGDA 1C9FA 2PLPA 4OZCA 1MHHE 4OZBA 1JMLA 2KN4A 3GB1A 1P7FA 1P7EA 5HG2A 1PGXA 3V3XA 2KDMA 1K52A 1Q10A 1IBXB 5BMGA 2ZW0A 5BMIA 2RMMA 1UWXA 2LUMA 2PW9A 2KWDA 2JXTA 4OZAA 4WH4A 1GB1A 1XCQL 2JSVX 4KGRA 2N9KA 2JZPA
chains in the Genus database with same CATH superfamily
2FE8A 1PGBA 3TEZA 2RPVA 3TJPA 2GBRA 1BUIC 2KT7A 1QOAA 2FNJB 3NG0A 1YJIA 2AEHA 3AMZA 1PQSA 1C79A 2N1VA 3UI3A 1ET6A 5HKHA 1WFYA 4MH8A 4MSMB 3AE4B 2KVRA 2G4SA 4S0RA 1RWSA 4YTPB 2J0KA 3LB8C 4WQOB 2ZEQA 3FAHA 1LXDA 1F2RC 3TSSA 2NPTA 5TSSA 1DGJA 1ZUD2 3KVFB 4HPPA 5GXGB 3PREA 2QDFA 4WWOA 2M1MA 4FJZA 3Q3MC 5L83A 5G5GA 4JQWC 3Q6BA 3JSVB 3IAM1 4AJYB 3HVDA 2YLMA 3I9V1 2MSED 2JZ3B 2WHIA 1SJED 2N0SB 1N63A 4RM9A 1SE2A 3QIJA 2NTTA 1ZW7A 2WDRB 2KN4A 3Q3OC 1L0XB 1LM8B 3BWUD 2N7DA 5JHBA 1NI3A 3AE5B 3BY4B 5FK9C 4N58A 2L0FA 1K52A 1FO4A 2ZW0A 3ZUNA 4KX6B 2KDIA 3P4PB 2IPKD 1WGDA 4WH4A 1NENB 1E8WA 4HKQA 3DVGX 2MEKA 3GZNB 4PK1A 1SB3C 4HDQA 3ZRFA 3T8MA 1Z5SB 3U30A 1KRHA 2OEDA 2J7QB 1OQYA 1WX9A 1P98A 4DHZB 2EMSA 4OVZA 4KV2A 1XLOA 1Y8RC 2I2YA 1JWUD 3BYYB 1NBFC 2BB6A 3ZDTA 3MJ5A 4C80A 2DBYA 4E71A 4PYZA 3B1LX 1LFDA 2XEWA 2JT4B 2RSUA 4ZRJA 2FCSA 3Q2AC 3JSVA 5LXIB 2QMTA 4JIOU 2K5PA 2CHZA 2OHFA 1WI0A 2QSDA 1VZ8A 1WZ3A 1BT0A 4A8XC 1C1YB 2KWUB 1D5MC 1JW9D 2EKIA 3BVMA 2D11A 2MBQA 2MP2B 2M4NA 2WXJA 1P1AA 2RPQA 4O1NA 1XEEA 1F9JA 2LVOA 1TBEA 4GB9A 3MC9A 3ZVVA 2BYVE 4ZHOA 4M0WA 4OZCA 1K8RB 3JYUA 1EWYC 3UQAA 3N30A 1T0RC 4ZOHC 2E6XA 2W54A 2FAZA 3NS1A 2WDTB 4C56C 2KDMA 1NDDA 4A3PA 4HPLB 4KIKB 4KSKC 2CR5A 4NPNA 4JGHB 1L4ZB 5IN7A 4UDUC 2BWES 5C23A 3MTNB 4WAFA 2KN5A 1IUEA 2K25A 2G9HD 4ANXA 4XZ4A 3KUCB 1V5TA 1U4AA 1NEKB 4ZRIA 4A55A 2IJ0A 3I63C 3WAPA 3PZ8A 2FCNA 3MFGA 3PHXB 2K8BA 1WXMA 4RM8A 1YQ4B 3ZJTA 1OQQA 4K7WA 1H8CA 1TT5B 1YMHE 2MP2A 1I4XA 2DYBA 3EUB2 2GB1A 1L0YB 1UWMA 4GDLB 4P16A 4HEA1 2K8CA 5EE0A 4W9IA 4MM3B 2AL6A 3QC8B 2Z59B 2L7RA 2BT6A 3I57A 5FR6A 2GRIA 1QILA 2PEAA 3O65B 2NCNA 1SIJA 2LI5A 5AZHA 5JXVA 1YJJA 5FKAC 3WALA 3SHQA 1IGDA 3VUYA 4KIKA 4WJPA 4RF0A 1J19A 2N9EB 1STEA 4IUMB 2NBVB 2BYFA 2A5UA 3GB1A 2MHJA 1Y56A 4EZJA 5LLIA 2CU1A 1KLVA 4KZ0A 4LCDE 1TKYA 4RMAA 2RMMA 3TUOA 2LUMA 1UF0A 2KANA 4LJOB 1CQVA 1V86A 2MJEA 4EZKA 4RGMA 2WX1A 2L76A 2K8HA 5KHOA 1E5WA 4DDGD 1FNUA 5HHDG 4GGQA 1I4QA 1TS5A 2KLCA 1LGRA 2MBBB 2GBMA 3QWZB 3DBSA 1E8XA 2OOBB 3HIZA 1OFFA 1E10A 1JWMD 2WXNA 4ANVA 3L54A 4GDLA 1WYWB 4GIVA 3P2BA 1I42A 3AV8A 3OJ4B 2WXGA 2N7JA 2ON8A 4LLGM 1TZOA 3ZGZA 4AJWA 4B6WA 2KHWB 1E0ZA 2KACA 2N9LA 4K7UA 1CJEA 1HXYD 2C7HA 1YJ1A 3PZ7A 2A4ZA 3PV1A 4YT0B 5BYRA 3ZJVA 3N32A 2CS4A 1YD8U 2ZCBA 1Q5WB 2AYOB 2L32A 2ACZB 5G2NA 4RGNA 1QZEA 3AH7A 2AQ1B 3KLSX 4ICUA 4M01A 3ZIMA 4M00A 3VTUA 3QA8A 4RNAA 2ZVOA 2N9PC 3CSFA 3SD5A 1C4PA 2LRWA 4J3OD 1JMLA 4FULA 2LVQA 3SEBA 4FADA 5BYQA 1E9MA 3ONSA 4RGOS 2OJWA 2PKOA 2WXIA 1TKEA 2DZKA 2VZKB 4B9KA 2RDBC 2K6DB 2HJ1A 1P0RA 2INCC 1GC7A 1EO6A 4WQMA 1JWSD 2JZPA 1K51A 1FM0D 1YOVB 4W9LA 2K39A 4E3CA 1T0YA 2KMCA 3NJTA 1N6ZA 3Q8BA 1I35A 1QOGA 3A9KA 1JRPA 1XT9B 3U7ZA 2Z0DB 1JWBD 2INPE 2R2OA 1V80A 4BFRA 3AEFB 2WP9B 3VH4B 4BOSC 3RNGC 3PHWB 4IG7B 2DAFA 4W9KA 1MJDA 1WXVA 4KGSA 1AWDA 4BBNF 1SE3A 2BVCA 2C7NB 2C60A 2WU5B 4EKUA 1JQ4A 2XBBC 3M62B 3APFA 1E90A 3OLMD 3APCA 3ZW3A 4LNOA 5C2TB 3HM3A 4IWOA 1PDXA 3R7RA 2FUG1 2G4DB 1FCCC 2HTHA 1I7HA 4K3BA 1EM7A 3QJZA 1FFVA 3UINB 2DYMA 3UIPB 1YQ3B 1TZ1A 4K7SA 4GN1A 1P3QU 3V6EB 4DHZE 2PIAA 1VD2A 4RGTA 3AE3B 5D7GA 4JE3B 5HG2A 1WJNA 3NVYA 4DWFA 1IBXB 5BMGA 1P9DU 3KQ4A 4GSWA 1TS3A 4W9EA 3LYYA 1CK1A 1ROEA 3GP7A 5IP4D 2NPTB 3AEEB 3UF8A 3I3TB 4GXBA 1JRUA 1L6VA 3PT2B 1NYRA 3T3OA 3PVLA 4NY0A 2QILA 1GOZA 4KKJA 4G3XB 1T3QA 4BKTA 3AE8B 3P63A 4HK2A 2ZW1A 2BTEA 4FJYA 1V5OA 5IAAC 2BS2B 5DPTA 3QQ8B 3DWMA 3TEYA 1JALA 3N9YC 5AZFA 3R2IA 2RR9A 4YXDB 5D94A 1TS2A 2LGIA 5AUIA 5JZEB 1LO5D 3EC8A 1V1OA 2X38A 2DWQA 4GDKB 1WX7A 1K50A 2HDEA 2JYEA 2ZZPB 4LNKA 4AP4C 4WJOA 2ASQA 2CKHB 3RNCC 1MG8A 4TQ0A 4IW0A 4IC7B 4KSLC 2BPSA 1XCTL 3PRZA 2V0GA 3PO0A 2MBOA 4ASWC 1ZPSA 1SBBB 3RN9C 4FHKA 1HEZE 3SDLC 4HCPB 2FUHB 3AEGB 2NS5A 2J4XA 4AQ7A 1WXSA 3EFUA 3IFWB 1IBXA 3RMKC 1GPXA 1R4NI 3N1YC 5EE1A 3BIID 3L13A 1E7UA 3M63B 4JWUC 2LMCA 4MGKE 4G11A 3ZNZB 2C5LC 4ZRKA 1BXTA 2MW5A 4JLCA 4N6EB 3VDZA 3KYCD 1DOXA 1KLUD 1VJKA 2MRPA 3V60A 3K9PB 2D3AA 1UWXA 4IM0A 1J7CA 2J42A 2VZKD 3KW5B 3WAMA 4OZAA 4HRSA 1SIFA 3FC4A 4DBGA 3R2TA 1YN5A 2W3SA 2AX5A 2N9KA 2WXRA 1QKZA 4M8NA 2FIFA 1VZ7A 1EF5A 3DHGC 2WXMA 2KFJA 2INNE 4GDKA 3V05A 3L10B 3AI5A 2JYTA 4A20A 4MJSB 1VR9A 2WS3B 3B08A 5G5HA 1TIFA 2KJ6A 4M0WB 4YTNB 2CHWA 3ZNID 4EE2A 2UYZB 5EE3A 4MGYE 5DCNA 3A1QB 4XDCA 1N61A 2WYQA 4C00A 1UH6A 1ZKHA 2NR2A 2M17A 3DVGY 2RDHA 1HZ6A 4LK0M 2IY1B 1C77A 1X1MA 2KQ4X 1SJHD 1E7VA 2GOWA 2R2QA 3AE2B 3NHEB 1EWCA 3RUIB 4IKGA 4US8A 3PSEB 3MHSD 2ZPYA 3L4PA 4HXDA 3NVZA 2UWQA 4FN2A 1EUVB 1ACCA 4URKA 4QAYA 4ARCA 3OG5A 4HKZE 3KUZA 1D6EC 4A90A 2CHXA 3QAQA 2AL3A 3GE3C 3PS6A 5E6PA 2DZJA 1TJEA 1F0ZA 4ANWA 2YVCA 1C9FA 3EA6A 3URYA 5EDSA 1WX8A 3W5VB 1TGZB 3ALBA 1TY0A 2IO3B 1P7EA 2ZVNA 2WWZA 2ZNVB 4LTUA 3NZUA 3H1UA 5E6OA 4NNJB 2KK8A 1WSPA 4MJSA 4MDKE 5EE9A 4LNNA 1ET9A 2DAJA 4DK5A 3RNBC 1V9JA 2BKRB 3OJ3A 2JSVX 4KGRA 1WGRA 5I4DA 5E6JA 4OVVA 4I6LB 1QF6A 1QOFA 3A1QA 1HZ5A 1XD3B 1WH3A 2IY0B 3BZDB 2WXKA 5CX3A 2KTRB 4I6NB 3DPDA 2MJ3A 2LXCA 2MQJA 3DCGA 3H8HA 3Q14C 2W55A 3KYDD 2EKEC 4HJGE 4HVBA 1ENFA 2MBEA 4II3B 2KZRA 2KXJA 2JQRB 4MGIE 2H89B 5D6JB 4K3CA 3AB5A 3DBLB 2LHDA 5AZGA 4W9DA 1FEHA 4IOIE 4TMAB 1G6JA 1WGHA 1V97A 1WRIA 3W5UB 1J8CA 3RNEC 1FRRA 2D3BA 1WR1A 3JW0X 2DX5B 1I4HA 3Q8EA 4PS8A 1KFYB 2RGFA 2INDC 1GB4A 2M0AA 1V1PB 2C9WB 2ZJDA 4BZAA 1EF1A 4WJQA 5AUKA 1WZ0A 1MHHE 3TMPB 2JWZA 1YX5B 2ZNVC 1KJTA 1KTKA 2KJHB 1PGXA 2JRHA 2KAJA 4NZLB 1ZE3D 1L2NA 2RDGA 2KTRA 3ECIA 2M56B 2GLSA 3HVZA 4I6PA 4WURA 3NS8A 1OGWA 3H7PB 3PGEA 1QOBA 1D3ZA 1UGJA 4PYUA 1ZXIA 2JY6A 4ANUA 3N1XC 5D2MB 1HQRD 3H7SA 4GLSC 1SGHA 4XX5A 4G0NB 5KHQA 3RCZA 1FNVA 3V61A 1FXAA 3TCAA 4C7ZA 1WGGA 5H8YE 3NVVA 3ETRA 2KDBA 5JH5C 4HPMB 1MPEA 5BMHA 1F77A 1T5XD 1RLFA 4K81A 3PLUA 1FRDA 4ACFA 3HHMA 1D5ZC 1XO3A 1I4RA 1YN4A 4YL8A 2NBWB 4BAXA 2KMAA 2ZPNA 1KH0A 4WWPA 2O6VB 4WAAA 2KFKB 4DXFA 1WMHA 2JUOA 1V1PA 3T3NA 2KKCA 3AXCA 1XLNA 3IHPC 4N59A 4RFBA 4ARIA 5DPRA 4NJ6A 1XXGA 3KH0A 1L4DB 2J53A 4OVUA 4LJPB 3APDA 3WCQA 2BB5A 1YX6B 2J52A 3A9KB 3TEWA 2NBUA 5AEKB 3H7PA 3PRMB 2PVOD 3UGBB 1GG3A 3K9OB 4IM3A 3DDCB 1RFAA 3N1ZC 3Q8AA 3ZNGC 1UUPA 1P7FA 4L2YA 3PPAA 2PMVA 2LUEA 3B2FA 3V3XA 2BQQA 3QK0A 4TKNA 3WAOA 4W9HA 2HE7A 3P4RB 4ICVA 3Q8CA 3M95A 3AECB 4KDLB 1WJUA 2LZ6A 1C3TA 1N62A 2L1AA 4HCNB 3GS2A 3ZQ4A 2BYTA 4WWMA 3Q3FA 4BVUC 2MBHA 4CHKA 3RD2A 2O6VA 4P1CC 4B0MA 1WE6A 2KFKA 3J9CA 2WU2B 2Y3AA 4MGZE 2KMMA 2CJOA 3PLVA 5G55A 3W1YA 1RRBA 3GZNI 2DHZA 3NOBA 2DZMA 1B9RA 1ZDVA 1JCKB 1SF0A 1B1ZA 3Q69A 3ZO5B 1VLBA 1MG4A 4PT5A 2LEKA 1WR6E 4XYCA 1EU3A 3AULA 3KWLA 1JROA 1VDVA 4MEMA 3ZRCA 2K3UA 3EHVA 3N20C 4MELA 2KTFA 1E7PB 4MSQB 3JVZX 2MJDA 3RZWC 1LQBA 2WXFA 1WM2A 2REXA 2L3ZA 1I4PA 2L05A 2PLPA 3NZSA 2V3PA 4YSZB 1A70A 2QEJC 1AARA 3BK1A 2VH2A 5LNK1 5CTRC 2DLBA 3NZ3A 3AEDB 5BMIA 2L8JA 3VQIA 1PYWD 1J0GA 2FIDA 3A33B 2Z8LA 1WWTA 2JZZA 2PE6B 1TY2A 2K0PA 4XWTA 2NVUI 1IP9A 2WLBA 2G45B 1MHXA 4ITKA 4R3DA 4XE0A 4JPSA 4TUUA 4HDOA 2D3CA 1RAXA 2Q5WD 5IKCM 3H9DA 5HFYA 3R3MA 2K6QA 2NMQA 3R8BA 4D2KA 3P1MA 5C1ZA 1C4AA 2I1KA 3U4EG 4F8CB 2BWFA 1ZXHA 1SEBD 4CQNA 1WRDB 1GC6A 2CJNA 4ZHPA 4NAWA 2O6VD 4AWJA 2LHEA 1OTRB 4EOYA 4XDDA 2JU6X 5BO4B 3CF6E 3O13A 3DOWA 4FJVB 1GAQB 2PPHA 4ZYSA 3WA0A 1UBIA 4NAMA 2V3NA 4YSYB 4F7ZA 1T6BX 2IGDA 4C4VA 3DBRI 1PGAA 1V6EA 3BK2A 4YSXB 3ZXVA 4NJCA 2BBCA 1HTQA 5IA7A 2BKFA 2IO1B 3CWIA 3C8YA 4DDID 3P42A 3VRAB 3X23A 3VR8B 5TR5A 1XLQA 1QQRA 2KLGA 2D10A 4LDTB 5FR3A 1OEYA 3IVFA 5JHAA 1WGYA 1GB1A 3IBEA 2B3AA 1FMAD 2PE9A 4P7IA 4IDIA 2QC8A 1DOIA 5L95C 2BGFA 2PVGC 1YIWA 3B0AA 2KC2A 1XQQA 5DPWA 4WJNA 1R4MI 1IYFA 4WIPA 3QHTA 2GI9A 2IZVB 3RNFC 1FNWA 1OQRA 1CMXB 5CHVC 1VRAB 5D3DA 2BF8B 2UU7A 1KM7A 3W2DA 1RYJA 3PZDA 2EELA 3H6NA 2FCMA 4XGAB 2V1YA 3RPFC 3WANA 3B9JA 4W9FA 2QHOA 4TSSA 4KKIA 5IOIA 3MP9A 2H88B 2N9XA 1R7SA 1EU4A 1OEYJ 4CO7A 1GJZA 2V3SA 1ZGUB 4US9A 1UNSA 5LXHA 3AU4A 4JX1C 2PJHA 5D3IB 2W3RA 1QLBB 4H2AA 2LVPA 2HTME 2YEPB 2X8XX 1S1QB 1N60A 1WXQA 2Z0EB 4BBNC 1I4GA 1ISNA 3RI7C 3RNAC 1UZXB 1FFUA 2M0XA 4A9AA 5CHFA 2KOXA 4OZBA 3ABVB 1VCBA 3LXFA 3IAS1 2KDEB 3BVGA 1ZDXA 2SAKA 3AEBB 4FXCA 3DBHI 2DENB 5C3JB 2J0JA 2KWVB 3MJWA 3V62A 3GE8C 2JXTA 2VRRB 1WM3A 4EEWA 2RD0A 2Y5CA 4GU2A 3ZTCA 2WXPA 4N9F4 1HE8A 2K9XA 4K1RB 4W9CA 3RZFA 3U8ZA 2BS4B 3U7DA 2BW2A 3C0RB 4MACA 4FHJA 3WIMA 3VTVA 3RT3B 3SU8X 3U52E 3DWGC 3U2SC 4HJKA 1XF5L 4LNIA 1T0QC 1WJ6A 4B0EA 3BYTB 4NQKE 2TSSA 4BKSA 3BVZA 1FXTB 4AOFA 2JF5A 5IO9A 1FD6A 1TKGA 2M19A 2GMIC 1L0VB 2W9NA 2LRUA 4GOCA 2KVZA 4RF1A 1WF9A 3IG3A 1QT9A 2LJ5A 3VUWA 3ZDMC 4FBJB 3QX1A 1Q1OA 4EFOA 4IWQA 1E8YA 4GMVA 3MC8A 4F1SA 3L17A 3R66C 2DYOA 1C4CA 2LWPA 4W9GA 1MFWA 3VTWA 3TEXA 4KDIC 4JL9A 4B95A 4AS1A 4C7YA 1T0SC 4EUTA 2WDQB 5BYSA 2KO3A 2MLBA 1L6UA 4ZRQA 1V81A 3AE1B 3L16A 2JVCA 3IT4B 3Q8FA 1D5XC 1YQBA 4NJ7A 2MCNB 1WMHB 1DOYA 2D3GA 4LNFA 4S17A 3CIRB 2GBKA 1DYQA 4LDTD 3NUHB 1FPYA 2NTSA 2JX5A 2L00B 1BMLC 1F2RI 3ZXRA 1F52A 2D5GA 2KC1A 1V49A 2Y5BB 4Q2JA 3DBRB 3DHIC 3RFZB 3UQBA 5J2RA 1WGKA 3ZTDA 2PTLA 5J17A 3MHZA 2WXOA 4BKGA 2XK5B 5T8IA 2ONQA 1WYGA 1NVID 1D4BA 4ZYNA 1YNTE 2JWUA 4CYEA 3ZYYX 2V9HA 3L08A 4YTMB 1IPGA 4BOZB 3SR6A 5HI1A 2HJ8A 2XN9C 1R4NB 2V4IB 1UGMA 4A3OA 1KOTA 2IDYA 3PRPB 2JRIB 2D2QA 2V4LA 2N4FA 1C76A 3OWEB 1M4VA 1ESFA 4KGTA 4JWSC 4BKSD 3FILB 1R4MB 1MI0A 2JPHA 2EMTA 2KDFB 3A4RA 1N5WA 1ZP0B 2FCQA 2CU3A 3DQVA 2DZIA 2I38A 1AW7A 2WXHA 3BINA 4HWIB 4DHJB 1VZ6A 5MPOA 4WWNA 1HTOA 3ZLZA 3LDZE 2KX3A 4FLHA 2IO2B 4KVGB 4L23A 2KX0A 2WXQA 1KF6B 3SFEB 4AUQC 3MC0B 2N1WA 2L52A 1M94A 5E6NA 2Y5PA 1Q10A 4EZLA 1RM6C 4FA6A 3AM9A 2D07B 2FBWB 4L1BA 2WGSA 2QIEB 1CZPA 2KQ7A 1WIAA 2G1EA 2XK5A 4MM3A 4MH0E 2IGHA 3EECA 1C78A 3ZKJC 4ZDVA 1FIQA 1Q0WB 3E9SA 3HUIA 3SFDB 2L83A 1GUAB 4DXAB 2BYEA 4IM2A 1SXTA 4IWPA 4YWGG 3VAWA 1Z2MA 3W1SA 1L7YA 1FCLA 3M3JA 3VH3B 4E74A 4XWWA 5H92C 1V8CA 3EFCA 3AE6B 1WE7A 2K1FA 2C7MB 1A5RA 3DBHB 5J18A 1J7AA 3FILA 4P6VF 1WJ4A 1UD7A 2KNBA 3W1SC 2SEBD 4ZRPA 3VVWB 1IGCA 3ML8A 1TYGB 3NVWA 2W82A 4TV3A 2R61A 3HK0A 3CMMB 3CSTA 1FXIA 1PFDA 2LFIA 2J0MA 2LJIA 1AYFA 3I5JC 4HLEA 1PUTA 3C19A 1AN8A 3AU5A 2VH1A 3S2AA 2LGYA 3QARA 2B76B 2IYDB 3AE7B 3L0WB 3N3KB 2M8SA 1WXAA 1H4RA 2O2VB 3LJ3A 4PS3A 1SE4A 2L0TA 3IT6B 4II2B 4RCOA 3V6CB 3PTFC 3Q3NC 1L5PA 1TTNA 3HM6X 1S3SG 3KWVA 1V2YA 3NRZA 3P4QB 1F1HA 3VR9B 2OJRA 4M8MA 3AN1A 4W9JA 3D32A 2IBIB 2QJLA 3ENEA 3VHTC 3T9LA 4TQ1A 2KWCA 1HA5A 4NAWB 3NY5A 4NQLB 4DXGA 1JWAD 4XC2A 1SE9A 3RULA 1E6EB 4X57B 3VXWA 1XCQL 2GBNA 2GBJA 2MX2A 3KUDB 3A4SC 2IGGA 2N7EA 2WX0A 1J7BA 1ZOYB 3FKYA 3AEAB 3R7QA 3VUXA 4OW0A 2QCZA 1YN3A 2KD0A 2WXLA 4USAA 4C4VB 1XLPA 3A9JB 2LASA 3AE9B 2WNMA 5GMVA 4DQOC 1SSNA 1RFKA 2IO0B 3E56A 1WY8A 4P1BC 2KQSA 2LD9A 3GOEA 3EGRA 3VFKA 3DVNU 2WQYB 2AQ2B 1K53A 1MVKA 2MA9B 4PS7A 2KYWA 3TL5A 2MH7A 3DHHC 4MT5A 2LGSA 1NYQA 2O2VA 3QCAA 2ICIA 2G3QB 5CHWA 4REZA 1N5XA 2LGDA 5DPSA 2MWSB 2I1JA 3ZNHB 3W9CB 3B2GA 3IXSA 1TS4A 2XNAC 2K22A 4KZCA 4G50A 1E8ZA 3DBLI 3OAWA 2LGXA 3DVNV 4A6QA 2E3TA 4RH6A 1NI2A 4M02A 3UIOB 3ML9A 4OHJA 4J6IA 4DHJD 2ZCCA 2AQ3B 2JXXA 3P4SB 2AWTA 2WDVB 1UELA 3X0WA 2LXAA 2HD5B 3RYTA 1KLGD 2PW9A 2KWDA 3TBLD 2BS3B 3TIXA 3HRDD 3A9JA 3ZJUA 1UBQA 3Q3JA 4HROA 3VRBB 2YEPF 2KJRA 1GNUA 2DNFA
chains in the Genus database with same CATH topology
4GLSC 2FE8A 1K51A 1PGBA 1FM0D 3TEZA 2BW2A 4MACA 2RPVA 1FNVA 1BUIC 1FXAA 4C7ZA 3U52E 3DWGC 1QOAA 5H8YE 3U2SC 3Q8BA 3NVVA 1YJIA 3ETRA 1XF5L 1QOGA 3AMZA 1JRPA 4B0EA 1MPEA 5BMHA 3U7ZA 3BYTB 1F77A 1T5XD 1C79A 1FRDA 1JWBD 2TSSA 2INPE 3UI3A 1ET6A 3AEFB 2WP9B 1D5ZC 1XO3A 4MH8A 3BVZA 3AE4B 1I4RA 1YN4A 1RWSA 4YTPB 4KGSA 1AWDA 1KH0A 3LB8C 1FD6A 1SE3A 2WU5B 1JQ4A 4DXFA 1TKGA 2M19A 3FAHA 1F2RC 1L0VB 1V1PA 3TSSA 5TSSA 1DGJA 1ZUD2 5C2TB 4RF1A 5GXGB 3T3NA 1PDXA 2FUG1 1XLNA 1QT9A 4N59A 1FCCC 4RFBA 4ARIA 5G5GA 1I7HA 1XXGA 1L4DB 1EM7A 2J53A 1FFVA 3IAM1 3HVDA 2DYMA 3I9V1 2BB5A 3WCQA 1SJED 2J52A 2N0SB 1N63A 3TEWA 1YQ3B 2DYOA 1C4CA 1SE2A 2NTTA 3TEXA 2PVOD 4AS1A 2WDRB 2PIAA 4RGTA 4C7YA 2WDQB 5BYSA 3Q8AA 2KN4A 1L0XB 1UUPA 3AE3B 1P7FA 3BWUD 1L6UA 4JE3B 5D7GA 4L2YA 1NI3A 4ZRQA 5HG2A 2PMVA 3AE5B 5FK9C 3AE1B 3B2FA 4N58A 3V3XA 3NVYA 1FO4A 1K52A 1IBXB 3IT4B 5BMGA 2ZW0A 3Q8FA 4KX6B 1D5XC 3P4RB 3KQ4A 3Q8CA 3P4PB 1TS3A 2IPKD 3LYYA 1DOYA 1CK1A 3AECB 1ROEA 3GP7A 3CIRB 4WH4A 3AEEB 1NENB 1DYQA 1L6VA 4HKQA 1NYRA 2MEKA 3T3OA 3NUHB 1N62A 1SB3C 2QILA 1GOZA 2L1AA 2NTSA 2JX5A 4KKJA 1T3QA 1BMLC 1F2RI 3AE8B 3P63A 1KRHA 2ZW1A 2D5GA 2OEDA 3GS2A 2BTEA 3ZQ4A 2BYTA 4WWMA 4OVZA 4Q2JA 3RFZB 2BS2B 4B0MA 1XLOA 3J9CA 1WGKA 2WU2B 2Y3AA 2I2YA 3DWMA 1JWUD 3BYYB 2PTLA 3TEYA 2BB6A 1JALA 3MHZA 2WXOA 2KMMA 2CJOA 3MJ5A 3N9YC 2ONQA 5T8IA 3R2IA 4C80A 4YXDB 1WYGA 1NVID 1D4BA 1TS2A 2DBYA 1YNTE 2LGIA 5AUIA 1B9RA 2JWUA 1ZDVA 1JCKB 1SF0A 1LO5D 1V1OA 2X38A 1B1ZA 2DWQA 4GDKB 3ZYYX 1K50A 2HDEA 3Q69A 2JYEA 1VLBA 4YTMB 3SR6A 4PT5A 2QMTA 5HI1A 2XN9C 4TQ0A 2K5PA 2V4IB 2OHFA 2LEKA 2IDYA 2QSDA 1VZ8A 1XCTL 1EU3A 2V0GA 3KWLA 1C76A 3PO0A 4A8XC 1ZPSA 1SBBB 1D5MC 3OWEB 1M4VA 1JW9D 1JROA 1ESFA 2EKIA 3BVMA 1HEZE 4KGTA 4JWSC 1VDVA 3FILB 1MI0A 2K3UA 3AEGB 2J4XA 4AQ7A 2WXJA 1E7PB 1N5WA 1ZP0B 2MJDA 4O1NA 2CU3A 1IBXA 1XEEA 2I38A 1AW7A 2WXFA 2WXHA 1GPXA 4ZHOA 4M0WA 1I4PA 5EE1A 3BIID 1VZ6A 2PLPA 4OZCA 5MPOA 2V3PA 4YSZB 1EWYC 4JWUC 4ZOHC 1A70A 2LMCA 2QEJC 3BK1A 4L23A 2WXQA 1BXTA 1KF6B 3SFEB 2E6XA 2W54A 5LNK1 3MC0B 3NS1A 4N6EB 2L52A 4C56C 2KDMA 2DLBA 2Y5PA 1Q10A 3NZ3A 1DOXA 1KLUD 1RM6C 1VJKA 3AEDB 5BMIA 1UWXA 3AM9A 3VQIA 2FBWB 4L1BA 1J7CA 1PYWD 2J42A 2VZKD 2QIEB 4OZAA 4HRSA 1CZPA 2Z8LA 3FC4A 1WWTA 3R2TA 1YN5A 2W3SA 1L4ZB 2AX5A 2N9KA 4UDUC 2G1EA 2WXRA 1QKZA 2IGHA 1VZ7A 4WAFA 2WXMA 1C78A 1TY2A 2INNE 2K0PA 4XWTA 1IUEA 3V05A 2WLBA 1FIQA 2G9HD 2JYTA 3E9SA 3HUIA 1MHXA 4ITKA 1VR9A 2WS3B 2L83A 3SFDB 4R3DA 5G5HA 4XE0A 1NEKB 4JPSA 1SXTA 4YTNB 4YWGG 4A55A 2IJ0A 3W1SA 3PZ8A 1FCLA 4EE2A 3MFGA 4XWWA 5EE3A 1V8CA 2Q5WD 5H92C 5HFYA 3AE6B 1YQ4B 3ZJTA 4XDCA 1OQQA 1J7AA 2NMQA 1N61A 3R8BA 4D2KA 3FILA 3P1MA 1C4AA 4P6VF 3U4EG 1YMHE 1ZXHA 1SEBD 2SEBD 4ZRPA 4CQNA 1I4XA 2CJNA 2RDHA 4ZHPA 3EUB2 1IGCA 1HZ6A 2GB1A 4LK0M 1TYGB 1C77A 1L0YB 1UWMA 2LHEA 2W82A 2KQ4X 1SJHD 3NVWA 4GDLB 2JU6X 4HEA1 3AE2B 4P16A 4XDDA 5EE0A 2R61A 1EWCA 3O13A 4MM3B 4IKGA 4US8A 1FXIA 1GAQB 1PFDA 2BT6A 2LFIA 4ZYSA 3L4PA 4NAMA 3I57A 3NVZA 2LJIA 1AYFA 2GRIA 2V3NA 4YSYB 1QILA 1PUTA 1ACCA 1T6BX 4ARCA 1AN8A 1SIJA 4HKZE 5JXVA 1D6EC 1YJJA 4A90A 5FKAC 2IGDA 2B76B 1PGAA 3AE7B 1IGDA 1TJEA 3BK2A 1F0ZA 1C9FA 4RF0A 4YSXB 3EA6A 3URYA 1SE4A 4NJCA 1STEA 3W5VB 3IT6B 2BBCA 4RCOA 1L5PA 1TY0A 3GB1A 3KWVA 1Y56A 3NRZA 1P7EA 3CWIA 3C8YA 3P4QB 3VR9B 3AN1A 2QJLA 3P42A 1TKYA 3VRAB 4LTUA 4TQ1A 1HA5A 2RMMA 3TUOA 4NAWB 2LUMA 3VR8B 4DXGA 1JWAD 1XLQA 1QQRA 1WSPA 5EE9A 5FR3A 1ET9A 1GB1A 1CQVA 1E6EB 1XCQL 2MJEA 1FMAD 4RGMA 4IDIA 2JSVX 4KGRA 5I4DA 1DOIA 5E6JA 1FNUA 2IGGA 2PVGC 5HHDG 1QF6A 1J7BA 1I4QA 1TS5A 1QOFA 1ZOYB 1HZ5A 3AEAB 4OW0A 3BZDB 4WIPA 2WXKA 1YN3A 2WXLA 4USAA 2MJ3A 2GI9A 1OFFA 1XLPA 1E10A 1FNWA 1JWMD 3AE9B 1OQRA 3H8HA 2WXNA 1VRAB 5D3DA 3W2DA 1RYJA 2W55A 2WNMA 2EELA 3AV8A 3RPFC 4HJGE 4DQOC 2WXGA 2N7JA 3B9JA 1SSNA 2ON8A 1RFKA 1ENFA 4LLGM 1TZOA 4TSSA 3ZGZA 4KKIA 3E56A 1E0ZA 2KACA 2N9LA 1CJEA 1HXYD 2JQRB 3MP9A 2H89B 2H88B 3PZ7A 3EGRA 2WQYB 2AQ2B 1K53A 1MVKA 1R7SA 1EU4A 3AB5A 2LHDA 4YT0B 5BYRA 2MH7A 4MT5A 1FEHA 3ZJVA 4IOIE 4US9A 4TMAB 1UNSA 1NYQA 4JX1C 1V97A 2ICIA 2L32A 4REZA 1N5XA 1WRIA 3W5UB 2ACZB 5D3IB 2W3RA 4RGNA 3W9CB 3AH7A 3B2GA 1FRRA 1QLBB 4H2AA 1I4HA 2AQ1B 3KLSX 3Q8EA 2HTME 1TS4A 3IXSA 2YEPB 2XNAC 1KFYB 2K22A 1GB4A 1WXQA 1N60A 2M0AA 1V1PB 1I4GA 5AUKA 4RNAA 4A6QA 2E3TA 4RH6A 1FFUA 4A9AA 1C4PA 1MHHE 4J3OD 4OZBA 1JMLA 4OHJA 3ABVB 3LXFA 3IAS1 3SEBA 2AQ3B 1E9MA 5BYQA 3BVGA 3P4SB 1ZDXA 2SAKA 2WDVB 1KTKA 3AEBB 4FXCA 1PGXA 4RGOS 2PKOA 2WXIA 5C3JB 2KAJA 1TKEA 4NZLB 2VZKB 1ZE3D 2RDGA 1KLGD 2M56B 2KWDA 2PW9A 3HVZA 2BS3B 2JXTA 4WURA 3HRDD 3ZJUA 1QOBA 4WQMA 1UGJA 2Y5CA 1ZXIA 1JWSD 2WXPA 4HROA 3VRBB 2YEPF 2K9XA 2JZPA 1HQRD 2BS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLS C;  1QKZ A;  2IGG A;  1K51 A;  2IGH A;  1PGB A;  5HHD G;  1F2R I;  1HZ5 A;  2ZW1 A;  2OED A;  2K0P A;  4MAC A;  2RPV A;  1MHX A;  2GI9 A;  1XF5 L;  2I2Y A;  1MPE A;  5BMH A;  2PTL A;  1FCL A;  2EEL A;  2ONQ A;  3UI3 A;  1D4B A;  5HFY A;  4HJG E;  1YNT E;  2LGI A;  2N7J A;  2JWU A;  2ON8 A;  2NMQ A;  4D2K A;  3FIL A;  2KAC A;  1K50 A;  2N9L A;  4KGS A;  1YMH E;  1KH0 A;  1ZXH A;  1FD6 A;  3MP9 A;  2QMT A;  5HI1 A;  1IGC A;  1K53 A;  1MVK A;  1HZ6 A;  2GB1 A;  2LHD A;  1F2R C;  2QSD A;  2LHE A;  4IOI E;  2KQ4 X;  2JU6 X;  1XCT L;  4IKG A;  1HEZ E;  4KGT A;  1FCC C;  3FIL B;  1MI0 A;  1EM7 A;  2J53 A;  4HKZ E;  5JXV A;  1IBX A;  2I38 A;  2IGD A;  2J52 A;  1GB4 A;  1PGA A;  1IGD A;  1C9F A;  2PLP A;  4OZC A;  1MHH E;  4OZB A;  1JML A;  2KN4 A;  3GB1 A;  1P7F A;  1P7E A;  5HG2 A;  1PGX A;  3V3X A;  2KDM A;  1K52 A;  1Q10 A;  1IBX B;  5BMG A;  2ZW0 A;  5BMI A;  2RMM A;  1UWX A;  2LUM A;  2PW9 A;  2KWD A;  2JXT A;  4OZA A;  4WH4 A;  1GB1 A;  1XCQ L;  2JSV X;  4KGR A;  2N9K A;  2JZP A; 
#chains in the Genus database with same CATH topology
 2FE8 A;  1PGB A;  3TEZ A;  2RPV A;  3TJP A;  2GBR A;  1BUI C;  2KT7 A;  1QOA A;  2FNJ B;  3NG0 A;  1YJI A;  2AEH A;  3AMZ A;  1PQS A;  1C79 A;  2N1V A;  3UI3 A;  1ET6 A;  5HKH A;  1WFY A;  4MH8 A;  4MSM B;  3AE4 B;  2KVR A;  2G4S A;  4S0R A;  1RWS A;  4YTP B;  2J0K A;  3LB8 C;  4WQO B;  2ZEQ A;  3FAH A;  1LXD A;  1F2R C;  3TSS A;  2NPT A;  5TSS A;  1DGJ A;  1ZUD 2;  3KVF B;  4HPP A;  5GXG B;  3PRE A;  2QDF A;  4WWO A;  2M1M A;  4FJZ A;  3Q3M C;  5L83 A;  5G5G A;  4JQW C;  3Q6B A;  3JSV B;  3IAM 1;  4AJY B;  3HVD A;  2YLM A;  3I9V 1;  2MSE D;  2JZ3 B;  2WHI A;  1SJE D;  2N0S B;  1N63 A;  4RM9 A;  1SE2 A;  3QIJ A;  2NTT A;  1ZW7 A;  2WDR B;  2KN4 A;  3Q3O C;  1L0X B;  1LM8 B;  3BWU D;  2N7D A;  5JHB A;  1NI3 A;  3AE5 B;  3BY4 B;  5FK9 C;  4N58 A;  2L0F A;  1K52 A;  1FO4 A;  2ZW0 A;  3ZUN A;  4KX6 B;  2KDI A;  3P4P B;  2IPK D;  1WGD A;  4WH4 A;  1NEN B;  1E8W A;  4HKQ A;  3DVG X;  2MEK A;  3GZN B;  4PK1 A;  1SB3 C;  4HDQ A;  3ZRF A;  3T8M A;  1Z5S B;  3U30 A;  1KRH A;  2OED A;  2J7Q B;  1OQY A;  1WX9 A;  1P98 A;  4DHZ B;  2EMS A;  4OVZ A;  4KV2 A;  1XLO A;  1Y8R C;  2I2Y A;  1JWU D;  3BYY B;  1NBF C;  2BB6 A;  3ZDT A;  3MJ5 A;  4C80 A;  2DBY A;  4E71 A;  4PYZ A;  3B1L X;  1LFD A;  2XEW A;  2JT4 B;  2RSU A;  4ZRJ A;  2FCS A;  3Q2A C;  3JSV A;  5LXI B;  2QMT A;  4JIO U;  2K5P A;  2CHZ A;  2OHF A;  1WI0 A;  2QSD A;  1VZ8 A;  1WZ3 A;  1BT0 A;  4A8X C;  1C1Y B;  2KWU B;  1D5M C;  1JW9 D;  2EKI A;  3BVM A;  2D11 A;  2MBQ A;  2MP2 B;  2M4N A;  2WXJ A;  1P1A A;  2RPQ A;  4O1N A;  1XEE A;  1F9J A;  2LVO A;  1TBE A;  4GB9 A;  3MC9 A;  3ZVV A;  2BYV E;  4ZHO A;  4M0W A;  4OZC A;  1K8R B;  3JYU A;  1EWY C;  3UQA A;  3N30 A;  1T0R C;  4ZOH C;  2E6X A;  2W54 A;  2FAZ A;  3NS1 A;  2WDT B;  4C56 C;  2KDM A;  1NDD A;  4A3P A;  4HPL B;  4KIK B;  4KSK C;  2CR5 A;  4NPN A;  4JGH B;  1L4Z B;  5IN7 A;  4UDU C;  2BWE S;  5C23 A;  3MTN B;  4WAF A;  2KN5 A;  1IUE A;  2K25 A;  2G9H D;  4ANX A;  4XZ4 A;  3KUC B;  1V5T A;  1U4A A;  1NEK B;  4ZRI A;  4A55 A;  2IJ0 A;  3I63 C;  3WAP A;  3PZ8 A;  2FCN A;  3MFG A;  3PHX B;  2K8B A;  1WXM A;  4RM8 A;  1YQ4 B;  3ZJT A;  1OQQ A;  4K7W A;  1H8C A;  1TT5 B;  1YMH E;  2MP2 A;  1I4X A;  2DYB A;  3EUB 2;  2GB1 A;  1L0Y B;  1UWM A;  4GDL B;  4P16 A;  4HEA 1;  2K8C A;  5EE0 A;  4W9I A;  4MM3 B;  2AL6 A;  3QC8 B;  2Z59 B;  2L7R A;  2BT6 A;  3I57 A;  5FR6 A;  2GRI A;  1QIL A;  2PEA A;  3O65 B;  2NCN A;  1SIJ A;  2LI5 A;  5AZH A;  5JXV A;  1YJJ A;  5FKA C;  3WAL A;  3SHQ A;  1IGD A;  3VUY A;  4KIK A;  4WJP A;  4RF0 A;  1J19 A;  2N9E B;  1STE A;  4IUM B;  2NBV B;  2BYF A;  2A5U A;  3GB1 A;  2MHJ A;  1Y56 A;  4EZJ A;  5LLI A;  2CU1 A;  1KLV A;  4KZ0 A;  4LCD E;  1TKY A;  4RMA A;  2RMM A;  3TUO A;  2LUM A;  1UF0 A;  2KAN A;  4LJO B;  1CQV A;  1V86 A;  2MJE A;  4EZK A;  4RGM A;  2WX1 A;  2L76 A;  2K8H A;  5KHO A;  1E5W A;  4DDG D;  1FNU A;  5HHD G;  4GGQ A;  1I4Q A;  1TS5 A;  2KLC A;  1LGR A;  2MBB B;  2GBM A;  3QWZ B;  3DBS A;  1E8X A;  2OOB B;  3HIZ A;  1OFF A;  1E10 A;  1JWM D;  2WXN A;  4ANV A;  3L54 A;  4GDL A;  1WYW B;  4GIV A;  3P2B A;  1I42 A;  3AV8 A;  3OJ4 B;  2WXG A;  2N7J A;  2ON8 A;  4LLG M;  1TZO A;  3ZGZ A;  4AJW A;  4B6W A;  2KHW B;  1E0Z A;  2KAC A;  2N9L A;  4K7U A;  1CJE A;  1HXY D;  2C7H A;  1YJ1 A;  3PZ7 A;  2A4Z A;  3PV1 A;  4YT0 B;  5BYR A;  3ZJV A;  3N32 A;  2CS4 A;  1YD8 U;  2ZCB A;  1Q5W B;  2AYO B;  2L32 A;  2ACZ B;  5G2N A;  4RGN A;  1QZE A;  3AH7 A;  2AQ1 B;  3KLS X;  4ICU A;  4M01 A;  3ZIM A;  4M00 A;  3VTU A;  3QA8 A;  4RNA A;  2ZVO A;  2N9P C;  3CSF A;  3SD5 A;  1C4P A;  2LRW A;  4J3O D;  1JML A;  4FUL A;  2LVQ A;  3SEB A;  4FAD A;  5BYQ A;  1E9M A;  3ONS A;  4RGO S;  2OJW A;  2PKO A;  2WXI A;  1TKE A;  2DZK A;  2VZK B;  4B9K A;  2RDB C;  2K6D B;  2HJ1 A;  1P0R A;  2INC C;  1GC7 A;  1EO6 A;  4WQM A;  1JWS D;  2JZP A;  1K51 A;  1FM0 D;  1YOV B;  4W9L A;  2K39 A;  4E3C A;  1T0Y A;  2KMC A;  3NJT A;  1N6Z A;  3Q8B A;  1I35 A;  1QOG A;  3A9K A;  1JRP A;  1XT9 B;  3U7Z A;  2Z0D B;  1JWB D;  2INP E;  2R2O A;  1V80 A;  4BFR A;  3AEF B;  2WP9 B;  3VH4 B;  4BOS C;  3RNG C;  3PHW B;  4IG7 B;  2DAF A;  4W9K A;  1MJD A;  1WXV A;  4KGS A;  1AWD A;  4BBN F;  1SE3 A;  2BVC A;  2C7N B;  2C60 A;  2WU5 B;  4EKU A;  1JQ4 A;  2XBB C;  3M62 B;  3APF A;  1E90 A;  3OLM D;  3APC A;  3ZW3 A;  4LNO A;  5C2T B;  3HM3 A;  4IWO A;  1PDX A;  3R7R A;  2FUG 1;  2G4D B;  1FCC C;  2HTH A;  1I7H A;  4K3B A;  1EM7 A;  3QJZ A;  1FFV A;  3UIN B;  2DYM A;  3UIP B;  1YQ3 B;  1TZ1 A;  4K7S A;  4GN1 A;  1P3Q U;  3V6E B;  4DHZ E;  2PIA A;  1VD2 A;  4RGT A;  3AE3 B;  5D7G A;  4JE3 B;  5HG2 A;  1WJN A;  3NVY A;  4DWF A;  1IBX B;  5BMG A;  1P9D U;  3KQ4 A;  4GSW A;  1TS3 A;  4W9E A;  3LYY A;  1CK1 A;  1ROE A;  3GP7 A;  5IP4 D;  2NPT B;  3AEE B;  3UF8 A;  3I3T B;  4GXB A;  1JRU A;  1L6V A;  3PT2 B;  1NYR A;  3T3O A;  3PVL A;  4NY0 A;  2QIL A;  1GOZ A;  4KKJ A;  4G3X B;  1T3Q A;  4BKT A;  3AE8 B;  3P63 A;  4HK2 A;  2ZW1 A;  2BTE A;  4FJY A;  1V5O A;  5IAA C;  2BS2 B;  5DPT A;  3QQ8 B;  3DWM A;  3TEY A;  1JAL A;  3N9Y C;  5AZF A;  3R2I A;  2RR9 A;  4YXD B;  5D94 A;  1TS2 A;  2LGI A;  5AUI A;  5JZE B;  1LO5 D;  3EC8 A;  1V1O A;  2X38 A;  2DWQ A;  4GDK B;  1WX7 A;  1K50 A;  2HDE A;  2JYE A;  2ZZP B;  4LNK A;  4AP4 C;  4WJO A;  2ASQ A;  2CKH B;  3RNC C;  1MG8 A;  4TQ0 A;  4IW0 A;  4IC7 B;  4KSL C;  2BPS A;  1XCT L;  3PRZ A;  2V0G A;  3PO0 A;  2MBO A;  4ASW C;  1ZPS A;  1SBB B;  3RN9 C;  4FHK A;  1HEZ E;  3SDL C;  4HCP B;  2FUH B;  3AEG B;  2NS5 A;  2J4X A;  4AQ7 A;  1WXS A;  3EFU A;  3IFW B;  1IBX A;  3RMK C;  1GPX A;  1R4N I;  3N1Y C;  5EE1 A;  3BII D;  3L13 A;  1E7U A;  3M63 B;  4JWU C;  2LMC A;  4MGK E;  4G11 A;  3ZNZ B;  2C5L C;  4ZRK A;  1BXT A;  2MW5 A;  4JLC A;  4N6E B;  3VDZ A;  3KYC D;  1DOX A;  1KLU D;  1VJK A;  2MRP A;  3V60 A;  3K9P B;  2D3A A;  1UWX A;  4IM0 A;  1J7C A;  2J42 A;  2VZK D;  3KW5 B;  3WAM A;  4OZA A;  4HRS A;  1SIF A;  3FC4 A;  4DBG A;  3R2T A;  1YN5 A;  2W3S A;  2AX5 A;  2N9K A;  2WXR A;  1QKZ A;  4M8N A;  2FIF A;  1VZ7 A;  1EF5 A;  3DHG C;  2WXM A;  2KFJ A;  2INN E;  4GDK A;  3V05 A;  3L10 B;  3AI5 A;  2JYT A;  4A20 A;  4MJS B;  1VR9 A;  2WS3 B;  3B08 A;  5G5H A;  1TIF A;  2KJ6 A;  4M0W B;  4YTN B;  2CHW A;  3ZNI D;  4EE2 A;  2UYZ B;  5EE3 A;  4MGY E;  5DCN A;  3A1Q B;  4XDC A;  1N61 A;  2WYQ A;  4C00 A;  1UH6 A;  1ZKH A;  2NR2 A;  2M17 A;  3DVG Y;  2RDH A;  1HZ6 A;  4LK0 M;  2IY1 B;  1C77 A;  1X1M A;  2KQ4 X;  1SJH D;  1E7V A;  2GOW A;  2R2Q A;  3AE2 B;  3NHE B;  1EWC A;  3RUI B;  4IKG A;  4US8 A;  3PSE B;  3MHS D;  2ZPY A;  3L4P A;  4HXD A;  3NVZ A;  2UWQ A;  4FN2 A;  1EUV B;  1ACC A;  4URK A;  4QAY A;  4ARC A;  3OG5 A;  4HKZ E;  3KUZ A;  1D6E C;  4A90 A;  2CHX A;  3QAQ A;  2AL3 A;  3GE3 C;  3PS6 A;  5E6P A;  2DZJ A;  1TJE A;  1F0Z A;  4ANW A;  2YVC A;  1C9F A;  3EA6 A;  3URY A;  5EDS A;  1WX8 A;  3W5V B;  1TGZ B;  3ALB A;  1TY0 A;  2IO3 B;  1P7E A;  2ZVN A;  2WWZ A;  2ZNV B;  4LTU A;  3NZU A;  3H1U A;  5E6O A;  4NNJ B;  2KK8 A;  1WSP A;  4MJS A;  4MDK E;  5EE9 A;  4LNN A;  1ET9 A;  2DAJ A;  4DK5 A;  3RNB C;  1V9J A;  2BKR B;  3OJ3 A;  2JSV X;  4KGR A;  1WGR A;  5I4D A;  5E6J A;  4OVV A;  4I6L B;  1QF6 A;  1QOF A;  3A1Q A;  1HZ5 A;  1XD3 B;  1WH3 A;  2IY0 B;  3BZD B;  2WXK A;  5CX3 A;  2KTR B;  4I6N B;  3DPD A;  2MJ3 A;  2LXC A;  2MQJ A;  3DCG A;  3H8H A;  3Q14 C;  2W55 A;  3KYD D;  2EKE C;  4HJG E;  4HVB A;  1ENF A;  2MBE A;  4II3 B;  2KZR A;  2KXJ A;  2JQR B;  4MGI E;  2H89 B;  5D6J B;  4K3C A;  3AB5 A;  3DBL B;  2LHD A;  5AZG A;  4W9D A;  1FEH A;  4IOI E;  4TMA B;  1G6J A;  1WGH A;  1V97 A;  1WRI A;  3W5U B;  1J8C A;  3RNE C;  1FRR A;  2D3B A;  1WR1 A;  3JW0 X;  2DX5 B;  1I4H A;  3Q8E A;  4PS8 A;  1KFY B;  2RGF A;  2IND C;  1GB4 A;  2M0A A;  1V1P B;  2C9W B;  2ZJD A;  4BZA A;  1EF1 A;  4WJQ A;  5AUK A;  1WZ0 A;  1MHH E;  3TMP B;  2JWZ A;  1YX5 B;  2ZNV C;  1KJT A;  1KTK A;  2KJH B;  1PGX A;  2JRH A;  2KAJ A;  4NZL B;  1ZE3 D;  1L2N A;  2RDG A;  2KTR A;  3ECI A;  2M56 B;  2GLS A;  3HVZ A;  4I6P A;  4WUR A;  3NS8 A;  1OGW A;  3H7P B;  3PGE A;  1QOB A;  1D3Z A;  1UGJ A;  4PYU A;  1ZXI A;  2JY6 A;  4ANU A;  3N1X C;  5D2M B;  1HQR D;  3H7S A;  4GLS C;  1SGH A;  4XX5 A;  4G0N B;  5KHQ A;  3RCZ A;  1FNV A;  3V61 A;  1FXA A;  3TCA A;  4C7Z A;  1WGG A;  5H8Y E;  3NVV A;  3ETR A;  2KDB A;  5JH5 C;  4HPM B;  1MPE A;  5BMH A;  1F77 A;  1T5X D;  1RLF A;  4K81 A;  3PLU A;  1FRD A;  4ACF A;  3HHM A;  1D5Z C;  1XO3 A;  1I4R A;  1YN4 A;  4YL8 A;  2NBW B;  4BAX A;  2KMA A;  2ZPN A;  1KH0 A;  4WWP A;  2O6V B;  4WAA A;  2KFK B;  4DXF A;  1WMH A;  2JUO A;  1V1P A;  3T3N A;  2KKC A;  3AXC A;  1XLN A;  3IHP C;  4N59 A;  4RFB A;  4ARI A;  5DPR A;  4NJ6 A;  1XXG A;  3KH0 A;  1L4D B;  2J53 A;  4OVU A;  4LJP B;  3APD A;  3WCQ A;  2BB5 A;  1YX6 B;  2J52 A;  3A9K B;  3TEW A;  2NBU A;  5AEK B;  3H7P A;  3PRM B;  2PVO D;  3UGB B;  1GG3 A;  3K9O B;  4IM3 A;  3DDC B;  1RFA A;  3N1Z C;  3Q8A A;  3ZNG C;  1UUP A;  1P7F A;  4L2Y A;  3PPA A;  2PMV A;  2LUE A;  3B2F A;  3V3X A;  2BQQ A;  3QK0 A;  4TKN A;  3WAO A;  4W9H A;  2HE7 A;  3P4R B;  4ICV A;  3Q8C A;  3M95 A;  3AEC B;  4KDL B;  1WJU A;  2LZ6 A;  1C3T A;  1N62 A;  2L1A A;  4HCN B;  3GS2 A;  3ZQ4 A;  2BYT A;  4WWM A;  3Q3F A;  4BVU C;  2MBH A;  4CHK A;  3RD2 A;  2O6V A;  4P1C C;  4B0M A;  1WE6 A;  2KFK A;  3J9C A;  2WU2 B;  2Y3A A;  4MGZ E;  2KMM A;  2CJO A;  3PLV A;  5G55 A;  3W1Y A;  1RRB A;  3GZN I;  2DHZ A;  3NOB A;  2DZM A;  1B9R A;  1ZDV A;  1JCK B;  1SF0 A;  1B1Z A;  3Q69 A;  3ZO5 B;  1VLB A;  1MG4 A;  4PT5 A;  2LEK A;  1WR6 E;  4XYC A;  1EU3 A;  3AUL A;  3KWL A;  1JRO A;  1VDV A;  4MEM A;  3ZRC A;  2K3U A;  3EHV A;  3N20 C;  4MEL A;  2KTF A;  1E7P B;  4MSQ B;  3JVZ X;  2MJD A;  3RZW C;  1LQB A;  2WXF A;  1WM2 A;  2REX A;  2L3Z A;  1I4P A;  2L05 A;  2PLP A;  3NZS A;  2V3P A;  4YSZ B;  1A70 A;  2QEJ C;  1AAR A;  3BK1 A;  2VH2 A;  5LNK 1;  5CTR C;  2DLB A;  3NZ3 A;  3AED B;  5BMI A;  2L8J A;  3VQI A;  1PYW D;  1J0G A;  2FID A;  3A33 B;  2Z8L A;  1WWT A;  2JZZ A;  2PE6 B;  1TY2 A;  2K0P A;  4XWT A;  2NVU I;  1IP9 A;  2WLB A;  2G45 B;  1MHX A;  4ITK A;  4R3D A;  4XE0 A;  4JPS A;  4TUU A;  4HDO A;  2D3C A;  1RAX A;  2Q5W D;  5IKC M;  3H9D A;  5HFY A;  3R3M A;  2K6Q A;  2NMQ A;  3R8B A;  4D2K A;  3P1M A;  5C1Z A;  1C4A A;  2I1K A;  3U4E G;  4F8C B;  2BWF A;  1ZXH A;  1SEB D;  4CQN A;  1WRD B;  1GC6 A;  2CJN A;  4ZHP A;  4NAW A;  2O6V D;  4AWJ A;  2LHE A;  1OTR B;  4EOY A;  4XDD A;  2JU6 X;  5BO4 B;  3CF6 E;  3O13 A;  3DOW A;  4FJV B;  1GAQ B;  2PPH A;  4ZYS A;  3WA0 A;  1UBI A;  4NAM A;  2V3N A;  4YSY B;  4F7Z A;  1T6B X;  2IGD A;  4C4V A;  3DBR I;  1PGA A;  1V6E A;  3BK2 A;  4YSX B;  3ZXV A;  4NJC A;  2BBC A;  1HTQ A;  5IA7 A;  2BKF A;  2IO1 B;  3CWI A;  3C8Y A;  4DDI D;  3P42 A;  3VRA B;  3X23 A;  3VR8 B;  5TR5 A;  1XLQ A;  1QQR A;  2KLG A;  2D10 A;  4LDT B;  5FR3 A;  1OEY A;  3IVF A;  5JHA A;  1WGY A;  1GB1 A;  3IBE A;  2B3A A;  1FMA D;  2PE9 A;  4P7I A;  4IDI A;  2QC8 A;  1DOI A;  5L95 C;  2BGF A;  2PVG C;  1YIW A;  3B0A A;  2KC2 A;  1XQQ A;  5DPW A;  4WJN A;  1R4M I;  1IYF A;  4WIP A;  3QHT A;  2GI9 A;  2IZV B;  3RNF C;  1FNW A;  1OQR A;  1CMX B;  5CHV C;  1VRA B;  5D3D A;  2BF8 B;  2UU7 A;  1KM7 A;  3W2D A;  1RYJ A;  3PZD A;  2EEL A;  3H6N A;  2FCM A;  4XGA B;  2V1Y A;  3RPF C;  3WAN A;  3B9J A;  4W9F A;  2QHO A;  4TSS A;  4KKI A;  5IOI A;  3MP9 A;  2H88 B;  2N9X A;  1R7S A;  1EU4 A;  1OEY J;  4CO7 A;  1GJZ A;  2V3S A;  1ZGU B;  4US9 A;  1UNS A;  5LXH A;  3AU4 A;  4JX1 C;  2PJH A;  5D3I B;  2W3R A;  1QLB B;  4H2A A;  2LVP A;  2HTM E;  2YEP B;  2X8X X;  1S1Q B;  1N60 A;  1WXQ A;  2Z0E B;  4BBN C;  1I4G A;  1ISN A;  3RI7 C;  3RNA C;  1UZX B;  1FFU A;  2M0X A;  4A9A A;  5CHF A;  2KOX A;  4OZB A;  3ABV B;  1VCB A;  3LXF A;  3IAS 1;  2KDE B;  3BVG A;  1ZDX A;  2SAK A;  3AEB B;  4FXC A;  3DBH I;  2DEN B;  5C3J B;  2J0J A;  2KWV B;  3MJW A;  3V62 A;  3GE8 C;  2JXT A;  2VRR B;  1WM3 A;  4EEW A;  2RD0 A;  2Y5C A;  4GU2 A;  3ZTC A;  2WXP A;  4N9F 4;  1HE8 A;  2K9X A;  4K1R B;  4W9C A;  3RZF A;  3U8Z A;  2BS4 B;  3U7D A;  2BW2 A;  3C0R B;  4MAC A;  4FHJ A;  3WIM A;  3VTV A;  3RT3 B;  3SU8 X;  3U52 E;  3DWG C;  3U2S C;  4HJK A;  1XF5 L;  4LNI A;  1T0Q C;  1WJ6 A;  4B0E A;  3BYT B;  4NQK E;  2TSS A;  4BKS A;  3BVZ A;  1FXT B;  4AOF A;  2JF5 A;  5IO9 A;  1FD6 A;  1TKG A;  2M19 A;  2GMI C;  1L0V B;  2W9N A;  2LRU A;  4GOC A;  2KVZ A;  4RF1 A;  1WF9 A;  3IG3 A;  1QT9 A;  2LJ5 A;  3VUW A;  3ZDM C;  4FBJ B;  3QX1 A;  1Q1O A;  4EFO A;  4IWQ A;  1E8Y A;  4GMV A;  3MC8 A;  4F1S A;  3L17 A;  3R66 C;  2DYO A;  1C4C A;  2LWP A;  4W9G A;  1MFW A;  3VTW A;  3TEX A;  4KDI C;  4JL9 A;  4B95 A;  4AS1 A;  4C7Y A;  1T0S C;  4EUT A;  2WDQ B;  5BYS A;  2KO3 A;  2MLB A;  1L6U A;  4ZRQ A;  1V81 A;  3AE1 B;  3L16 A;  2JVC A;  3IT4 B;  3Q8F A;  1D5X C;  1YQB A;  4NJ7 A;  2MCN B;  1WMH B;  1DOY A;  2D3G A;  4LNF A;  4S17 A;  3CIR B;  2GBK A;  1DYQ A;  4LDT D;  3NUH B;  1FPY A;  2NTS A;  2JX5 A;  2L00 B;  1BML C;  1F2R I;  3ZXR A;  1F52 A;  2D5G A;  2KC1 A;  1V49 A;  2Y5B B;  4Q2J A;  3DBR B;  3DHI C;  3RFZ B;  3UQB A;  5J2R A;  1WGK A;  3ZTD A;  2PTL A;  5J17 A;  3MHZ A;  2WXO A;  4BKG A;  2XK5 B;  5T8I A;  2ONQ A;  1WYG A;  1NVI D;  1D4B A;  4ZYN A;  1YNT E;  2JWU A;  4CYE A;  3ZYY X;  2V9H A;  3L08 A;  4YTM B;  1IPG A;  4BOZ B;  3SR6 A;  5HI1 A;  2HJ8 A;  2XN9 C;  1R4N B;  2V4I B;  1UGM A;  4A3O A;  1KOT A;  2IDY A;  3PRP B;  2JRI B;  2D2Q A;  2V4L A;  2N4F A;  1C76 A;  3OWE B;  1M4V A;  1ESF A;  4KGT A;  4JWS C;  4BKS D;  3FIL B;  1R4M B;  1MI0 A;  2JPH A;  2EMT A;  2KDF B;  3A4R A;  1N5W A;  1ZP0 B;  2FCQ A;  2CU3 A;  3DQV A;  2DZI A;  2I38 A;  1AW7 A;  2WXH A;  3BIN A;  4HWI B;  4DHJ B;  1VZ6 A;  5MPO A;  4WWN A;  1HTO A;  3ZLZ A;  3LDZ E;  2KX3 A;  4FLH A;  2IO2 B;  4KVG B;  4L23 A;  2KX0 A;  2WXQ A;  1KF6 B;  3SFE B;  4AUQ C;  3MC0 B;  2N1W A;  2L52 A;  1M94 A;  5E6N A;  2Y5P A;  1Q10 A;  4EZL A;  1RM6 C;  4FA6 A;  3AM9 A;  2D07 B;  2FBW B;  4L1B A;  2WGS A;  2QIE B;  1CZP A;  2KQ7 A;  1WIA A;  2G1E A;  2XK5 A;  4MM3 A;  4MH0 E;  2IGH A;  3EEC A;  1C78 A;  3ZKJ C;  4ZDV A;  1FIQ A;  1Q0W B;  3E9S A;  3HUI A;  3SFD B;  2L83 A;  1GUA B;  4DXA B;  2BYE A;  4IM2 A;  1SXT A;  4IWP A;  4YWG G;  3VAW A;  1Z2M A;  3W1S A;  1L7Y A;  1FCL A;  3M3J A;  3VH3 B;  4E74 A;  4XWW A;  5H92 C;  1V8C A;  3EFC A;  3AE6 B;  1WE7 A;  2K1F A;  2C7M B;  1A5R A;  3DBH B;  5J18 A;  1J7A A;  3FIL A;  4P6V F;  1WJ4 A;  1UD7 A;  2KNB A;  3W1S C;  2SEB D;  4ZRP A;  3VVW B;  1IGC A;  3ML8 A;  1TYG B;  3NVW A;  2W82 A;  4TV3 A;  2R61 A;  3HK0 A;  3CMM B;  3CST A;  1FXI A;  1PFD A;  2LFI A;  2J0M A;  2LJI A;  1AYF A;  3I5J C;  4HLE A;  1PUT A;  3C19 A;  1AN8 A;  3AU5 A;  2VH1 A;  3S2A A;  2LGY A;  3QAR A;  2B76 B;  2IYD B;  3AE7 B;  3L0W B;  3N3K B;  2M8S A;  1WXA A;  1H4R A;  2O2V B;  3LJ3 A;  4PS3 A;  1SE4 A;  2L0T A;  3IT6 B;  4II2 B;  4RCO A;  3V6C B;  3PTF C;  3Q3N C;  1L5P A;  1TTN A;  3HM6 X;  1S3S G;  3KWV A;  1V2Y A;  3NRZ A;  3P4Q B;  1F1H A;  3VR9 B;  2OJR A;  4M8M A;  3AN1 A;  4W9J A;  3D32 A;  2IBI B;  2QJL A;  3ENE A;  3VHT C;  3T9L A;  4TQ1 A;  2KWC A;  1HA5 A;  4NAW B;  3NY5 A;  4NQL B;  4DXG A;  1JWA D;  4XC2 A;  1SE9 A;  3RUL A;  1E6E B;  4X57 B;  3VXW A;  1XCQ L;  2GBN A;  2GBJ A;  2MX2 A;  3KUD B;  3A4S C;  2IGG A;  2N7E A;  2WX0 A;  1J7B A;  1ZOY B;  3FKY A;  3AEA B;  3R7Q A;  3VUX A;  4OW0 A;  2QCZ A;  1YN3 A;  2KD0 A;  2WXL A;  4USA A;  4C4V B;  1XLP A;  3A9J B;  2LAS A;  3AE9 B;  2WNM A;  5GMV A;  4DQO C;  1SSN A;  1RFK A;  2IO0 B;  3E56 A;  1WY8 A;  4P1B C;  2KQS A;  2LD9 A;  3GOE A;  3EGR A;  3VFK A;  3DVN U;  2WQY B;  2AQ2 B;  1K53 A;  1MVK A;  2MA9 B;  4PS7 A;  2KYW A;  3TL5 A;  2MH7 A;  3DHH C;  4MT5 A;  2LGS A;  1NYQ A;  2O2V A;  3QCA A;  2ICI A;  2G3Q B;  5CHW A;  4REZ A;  1N5X A;  2LGD A;  5DPS A;  2MWS B;  2I1J A;  3ZNH B;  3W9C B;  3B2G A;  3IXS A;  1TS4 A;  2XNA C;  2K22 A;  4KZC A;  4G50 A;  1E8Z A;  3DBL I;  3OAW A;  2LGX A;  3DVN V;  4A6Q A;  2E3T A;  4RH6 A;  1NI2 A;  4M02 A;  3UIO B;  3ML9 A;  4OHJ A;  4J6I A;  4DHJ D;  2ZCC A;  2AQ3 B;  2JXX A;  3P4S B;  2AWT A;  2WDV B;  1UEL A;  3X0W A;  2LXA A;  2HD5 B;  3RYT A;  1KLG D;  2PW9 A;  2KWD A;  3TBL D;  2BS3 B;  3TIX A;  3HRD D;  3A9J A;  3ZJU A;  1UBQ A;  3Q3J A;  4HRO A;  3VRB B;  2YEP F;  2KJR A;  1GNU A;  2DNF A; 
#chains in the Genus database with same CATH homology
 4GLS C;  2FE8 A;  1K51 A;  1PGB A;  1FM0 D;  3TEZ A;  2BW2 A;  4MAC A;  2RPV A;  1FNV A;  1BUI C;  1FXA A;  4C7Z A;  3U52 E;  3DWG C;  1QOA A;  5H8Y E;  3U2S C;  3Q8B A;  3NVV A;  1YJI A;  3ETR A;  1XF5 L;  1QOG A;  3AMZ A;  1JRP A;  4B0E A;  1MPE A;  5BMH A;  3U7Z A;  3BYT B;  1F77 A;  1T5X D;  1C79 A;  1FRD A;  1JWB D;  2TSS A;  2INP E;  3UI3 A;  1ET6 A;  3AEF B;  2WP9 B;  1D5Z C;  1XO3 A;  4MH8 A;  3BVZ A;  3AE4 B;  1I4R A;  1YN4 A;  1RWS A;  4YTP B;  4KGS A;  1AWD A;  1KH0 A;  3LB8 C;  1FD6 A;  1SE3 A;  2WU5 B;  1JQ4 A;  4DXF A;  1TKG A;  2M19 A;  3FAH A;  1F2R C;  1L0V B;  1V1P A;  3TSS A;  5TSS A;  1DGJ A;  1ZUD 2;  5C2T B;  4RF1 A;  5GXG B;  3T3N A;  1PDX A;  2FUG 1;  1XLN A;  1QT9 A;  4N59 A;  1FCC C;  4RFB A;  4ARI A;  5G5G A;  1I7H A;  1XXG A;  1L4D B;  1EM7 A;  2J53 A;  1FFV A;  3IAM 1;  3HVD A;  2DYM A;  3I9V 1;  2BB5 A;  3WCQ A;  1SJE D;  2J52 A;  2N0S B;  1N63 A;  3TEW A;  1YQ3 B;  2DYO A;  1C4C A;  1SE2 A;  2NTT A;  3TEX A;  2PVO D;  4AS1 A;  2WDR B;  2PIA A;  4RGT A;  4C7Y A;  2WDQ B;  5BYS A;  3Q8A A;  2KN4 A;  1L0X B;  1UUP A;  3AE3 B;  1P7F A;  3BWU D;  1L6U A;  4JE3 B;  5D7G A;  4L2Y A;  1NI3 A;  4ZRQ A;  5HG2 A;  2PMV A;  3AE5 B;  5FK9 C;  3AE1 B;  3B2F A;  4N58 A;  3V3X A;  3NVY A;  1FO4 A;  1K52 A;  1IBX B;  3IT4 B;  5BMG A;  2ZW0 A;  3Q8F A;  4KX6 B;  1D5X C;  3P4R B;  3KQ4 A;  3Q8C A;  3P4P B;  1TS3 A;  2IPK D;  3LYY A;  1DOY A;  1CK1 A;  3AEC B;  1ROE A;  3GP7 A;  3CIR B;  4WH4 A;  3AEE B;  1NEN B;  1DYQ A;  1L6V A;  4HKQ A;  1NYR A;  2MEK A;  3T3O A;  3NUH B;  1N62 A;  1SB3 C;  2QIL A;  1GOZ A;  2L1A A;  2NTS A;  2JX5 A;  4KKJ A;  1T3Q A;  1BML C;  1F2R I;  3AE8 B;  3P63 A;  1KRH A;  2ZW1 A;  2D5G A;  2OED A;  3GS2 A;  2BTE A;  3ZQ4 A;  2BYT A;  4WWM A;  4OVZ A;  4Q2J A;  3RFZ B;  2BS2 B;  4B0M A;  1XLO A;  3J9C A;  1WGK A;  2WU2 B;  2Y3A A;  2I2Y A;  3DWM A;  1JWU D;  3BYY B;  2PTL A;  3TEY A;  2BB6 A;  1JAL A;  3MHZ A;  2WXO A;  2KMM A;  2CJO A;  3MJ5 A;  3N9Y C;  2ONQ A;  5T8I A;  3R2I A;  4C80 A;  4YXD B;  1WYG A;  1NVI D;  1D4B A;  1TS2 A;  2DBY A;  1YNT E;  2LGI A;  5AUI A;  1B9R A;  2JWU A;  1ZDV A;  1JCK B;  1SF0 A;  1LO5 D;  1V1O A;  2X38 A;  1B1Z A;  2DWQ A;  4GDK B;  3ZYY X;  1K50 A;  2HDE A;  3Q69 A;  2JYE A;  1VLB A;  4YTM B;  3SR6 A;  4PT5 A;  2QMT A;  5HI1 A;  2XN9 C;  4TQ0 A;  2K5P A;  2V4I B;  2OHF A;  2LEK A;  2IDY A;  2QSD A;  1VZ8 A;  1XCT L;  1EU3 A;  2V0G A;  3KWL A;  1C76 A;  3PO0 A;  4A8X C;  1ZPS A;  1SBB B;  1D5M C;  3OWE B;  1M4V A;  1JW9 D;  1JRO A;  1ESF A;  2EKI A;  3BVM A;  1HEZ E;  4KGT A;  4JWS C;  1VDV A;  3FIL B;  1MI0 A;  2K3U A;  3AEG B;  2J4X A;  4AQ7 A;  2WXJ A;  1E7P B;  1N5W A;  1ZP0 B;  2MJD A;  4O1N A;  2CU3 A;  1IBX A;  1XEE A;  2I38 A;  1AW7 A;  2WXF A;  2WXH A;  1GPX A;  4ZHO A;  4M0W A;  1I4P A;  5EE1 A;  3BII D;  1VZ6 A;  2PLP A;  4OZC A;  5MPO A;  2V3P A;  4YSZ B;  1EWY C;  4JWU C;  4ZOH C;  1A70 A;  2LMC A;  2QEJ C;  3BK1 A;  4L23 A;  2WXQ A;  1BXT A;  1KF6 B;  3SFE B;  2E6X A;  2W54 A;  5LNK 1;  3MC0 B;  3NS1 A;  4N6E B;  2L52 A;  4C56 C;  2KDM A;  2DLB A;  2Y5P A;  1Q10 A;  3NZ3 A;  1DOX A;  1KLU D;  1RM6 C;  1VJK A;  3AED B;  5BMI A;  1UWX A;  3AM9 A;  3VQI A;  2FBW B;  4L1B A;  1J7C A;  1PYW D;  2J42 A;  2VZK D;  2QIE B;  4OZA A;  4HRS A;  1CZP A;  2Z8L A;  3FC4 A;  1WWT A;  3R2T A;  1YN5 A;  2W3S A;  1L4Z B;  2AX5 A;  2N9K A;  4UDU C;  2G1E A;  2WXR A;  1QKZ A;  2IGH A;  1VZ7 A;  4WAF A;  2WXM A;  1C78 A;  1TY2 A;  2INN E;  2K0P A;  4XWT A;  1IUE A;  3V05 A;  2WLB A;  1FIQ A;  2G9H D;  2JYT A;  3E9S A;  3HUI A;  1MHX A;  4ITK A;  1VR9 A;  2WS3 B;  2L83 A;  3SFD B;  4R3D A;  5G5H A;  4XE0 A;  1NEK B;  4JPS A;  1SXT A;  4YTN B;  4YWG G;  4A55 A;  2IJ0 A;  3W1S A;  3PZ8 A;  1FCL A;  4EE2 A;  3MFG A;  4XWW A;  5EE3 A;  1V8C A;  2Q5W D;  5H92 C;  5HFY A;  3AE6 B;  1YQ4 B;  3ZJT A;  4XDC A;  1OQQ A;  1J7A A;  2NMQ A;  1N61 A;  3R8B A;  4D2K A;  3FIL A;  3P1M A;  1C4A A;  4P6V F;  3U4E G;  1YMH E;  1ZXH A;  1SEB D;  2SEB D;  4ZRP A;  4CQN A;  1I4X A;  2CJN A;  2RDH A;  4ZHP A;  3EUB 2;  1IGC A;  1HZ6 A;  2GB1 A;  4LK0 M;  1TYG B;  1C77 A;  1L0Y B;  1UWM A;  2LHE A;  2W82 A;  2KQ4 X;  1SJH D;  3NVW A;  4GDL B;  2JU6 X;  4HEA 1;  3AE2 B;  4P16 A;  4XDD A;  5EE0 A;  2R61 A;  1EWC A;  3O13 A;  4MM3 B;  4IKG A;  4US8 A;  1FXI A;  1GAQ B;  1PFD A;  2BT6 A;  2LFI A;  4ZYS A;  3L4P A;  4NAM A;  3I57 A;  3NVZ A;  2LJI A;  1AYF A;  2GRI A;  2V3N A;  4YSY B;  1QIL A;  1PUT A;  1ACC A;  1T6B X;  4ARC A;  1AN8 A;  1SIJ A;  4HKZ E;  5JXV A;  1D6E C;  1YJJ A;  4A90 A;  5FKA C;  2IGD A;  2B76 B;  1PGA A;  3AE7 B;  1IGD A;  1TJE A;  3BK2 A;  1F0Z A;  1C9F A;  4RF0 A;  4YSX B;  3EA6 A;  3URY A;  1SE4 A;  4NJC A;  1STE A;  3W5V B;  3IT6 B;  2BBC A;  4RCO A;  1L5P A;  1TY0 A;  3GB1 A;  3KWV A;  1Y56 A;  3NRZ A;  1P7E A;  3CWI A;  3C8Y A;  3P4Q B;  3VR9 B;  3AN1 A;  2QJL A;  3P42 A;  1TKY A;  3VRA B;  4LTU A;  4TQ1 A;  1HA5 A;  2RMM A;  3TUO A;  4NAW B;  2LUM A;  3VR8 B;  4DXG A;  1JWA D;  1XLQ A;  1QQR A;  1WSP A;  5EE9 A;  5FR3 A;  1ET9 A;  1GB1 A;  1CQV A;  1E6E B;  1XCQ L;  2MJE A;  1FMA D;  4RGM A;  4IDI A;  2JSV X;  4KGR A;  5I4D A;  1DOI A;  5E6J A;  1FNU A;  2IGG A;  2PVG C;  5HHD G;  1QF6 A;  1J7B A;  1I4Q A;  1TS5 A;  1QOF A;  1ZOY B;  1HZ5 A;  3AEA B;  4OW0 A;  3BZD B;  4WIP A;  2WXK A;  1YN3 A;  2WXL A;  4USA A;  2MJ3 A;  2GI9 A;  1OFF A;  1XLP A;  1E10 A;  1FNW A;  1JWM D;  3AE9 B;  1OQR A;  3H8H A;  2WXN A;  1VRA B;  5D3D A;  3W2D A;  1RYJ A;  2W55 A;  2WNM A;  2EEL A;  3AV8 A;  3RPF C;  4HJG E;  4DQO C;  2WXG A;  2N7J A;  3B9J A;  1SSN A;  2ON8 A;  1RFK A;  1ENF A;  4LLG M;  1TZO A;  4TSS A;  3ZGZ A;  4KKI A;  3E56 A;  1E0Z A;  2KAC A;  2N9L A;  1CJE A;  1HXY D;  2JQR B;  3MP9 A;  2H89 B;  2H88 B;  3PZ7 A;  3EGR A;  2WQY B;  2AQ2 B;  1K53 A;  1MVK A;  1R7S A;  1EU4 A;  3AB5 A;  2LHD A;  4YT0 B;  5BYR A;  2MH7 A;  4MT5 A;  1FEH A;  3ZJV A;  4IOI E;  4US9 A;  4TMA B;  1UNS A;  1NYQ A;  4JX1 C;  1V97 A;  2ICI A;  2L32 A;  4REZ A;  1N5X A;  1WRI A;  3W5U B;  2ACZ B;  5D3I B;  2W3R A;  4RGN A;  3W9C B;  3AH7 A;  3B2G A;  1FRR A;  1QLB B;  4H2A A;  1I4H A;  2AQ1 B;  3KLS X;  3Q8E A;  2HTM E;  1TS4 A;  3IXS A;  2YEP B;  2XNA C;  1KFY B;  2K22 A;  1GB4 A;  1WXQ A;  1N60 A;  2M0A A;  1V1P B;  1I4G A;  5AUK A;  4RNA A;  4A6Q A;  2E3T A;  4RH6 A;  1FFU A;  4A9A A;  1C4P A;  1MHH E;  4J3O D;  4OZB A;  1JML A;  4OHJ A;  3ABV B;  3LXF A;  3IAS 1;  3SEB A;  2AQ3 B;  1E9M A;  5BYQ A;  3BVG A;  3P4S B;  1ZDX A;  2SAK A;  2WDV B;  1KTK A;  3AEB B;  4FXC A;  1PGX A;  4RGO S;  2PKO A;  2WXI A;  5C3J B;  2KAJ A;  1TKE A;  4NZL B;  2VZK B;  1ZE3 D;  2RDG A;  1KLG D;  2M56 B;  2KWD A;  2PW9 A;  3HVZ A;  2BS3 B;  2JXT A;  4WUR A;  3HRD D;  3ZJU A;  1QOB A;  4WQM A;  1UGJ A;  2Y5C A;  1ZXI A;  1JWS D;  2WXP A;  4HRO A;  3VRB B;  2YEP F;  2K9X A;  2JZP A;  1HQR D;  2BS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...