1HEZE

Antibody-antigen complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex between Peptostreptococcus Magnus Protein L and a Human Antibody Reveals Structural Convergence in the Interaction Modes of Fab Binding Modes
pubmed doi rcsb
molecule tags Antibody
molecule keywords KAPPA LIGHT CHAIN OF IG
total genus 15
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hezE00
3UI3A 2LHEA 1ZXHA 2N7JA 4KGTA 1EM7A 2ONQA 4OZAA 3FILA 2RPVA 4OZCA 1QKZA 1KH0A 2N9LA 1MHHE 2KQ4X 2JSVX 5BMIA 1F2RI 3GB1A 1HZ5A 5HFYA 2NMQA 2KDMA 1MPEA 2ZW0A 1HZ6A 1GB4A 1PGAA 3V3XA 5HHDG 4D2KA 5HG2A 3MP9A 1IBXB 1Q10A 1JMLA 1P7FA 1YNTE 2I2YA 4MACA 2PTLA 1C9FA 1P7EA 1XCQL 2JXTA 2IGGA 4IOIE 1MI0A 1HEZE 2JWUA 1IBXA 2ON8A 1FCLA 1K50A 2QSDA 2RMMA 1MVKA 4GLSC 2LHDA 4KGSA 2KACA 1PGBA 1K53A 4HKZE 1IGDA 2N9KA 4KGRA 1K52A 2IGDA 2PLPA 1FD6A 1F2RC 1XF5L 2J52A 1GB1A 2J53A 5BMHA 2I38A 4HJGE 4OZBA 2OEDA 1YMHE 2KWDA 2K0PA 1UWXA 1K51A 1PGXA 2LUMA 3FILB 1XCTL 2KN4A 2LGIA 2EELA 2JZPA 1FCCC 1MHXA 5JXVA 2JU6X 1D4BA 4WH4A 2GB1A 5BMGA 2PW9A 1IGCA 2QMTA 2IGHA 4IKGA 2GI9A 5HI1A 2ZW1A
chains in the Genus database with same CATH superfamily
2HD5B 4ARIA 4BKTA 1OQRA 1LXDA 1TZ1A 3Q3OC 2RDBC 1KH0A 4A20A 2MBHA 4FADA 2JYTA 2MW5A 2K6QA 2NBUA 1JWBD 3M3JA 3V6EB 4ZDVA 3GB1A 3W5VB 5BYRA 1I4PA 2LEKA 2HJ8A 2W3SA 1GB4A 3V3XA 4BOSC 1FXAA 1JWAD 1TIFA 4K7SA 1L0YB 1WE7A 3QA8A 2GBRA 1QQRA 4BKGA 2JX5A 1PDXA 4IOIE 4MH0E 4DBGA 2J4XA 2KDBA 1HEZE 2N7EA 2MJEA 3C0RB 4HDQA 4NY0A 2WYQA 2ZNVC 4YXDB 3NVYA 1WGRA 4RGOS 1AN8A 1J7AA 3N32A 5D94A 4YSZB 4RGMA 4TMAB 4EKUA 3RN9C 4EOYA 4W9KA 3H1UA 1UNSA 3ENEA 2WWZA 5BYQA 1OGWA 2JRIB 1C79A 3UF8A 4PYZA 4GU2A 2AL6A 1XQQA 3NS1A 3ZKJC 2AQ1B 2QEJC 1DOXA 3DWGC 3HVDA 4M01A 1CQVA 5LLIA 2CJOA 3AE3B 1U4AA 4Q2JA 3OAWA 5AZHA 3M95A 5FR3A 2GB1A 2L76A 2AL3A 4ZOHC 4MT5A 3ZIMA 3SFDB 2KVZA 4W9FA 1NBFC 3FAHA 1E90A 1V5OA 2FUHB 2KX0A 4GDKA 1OQYA 3ETRA 3RNAC 4AQ7A 1WH3A 2WDVB 4YSYB 2CU3A 4BKSA 1VZ7A 3Q6BA 2N9LA 2MWSB 3IT6B 3AV8A 1SJED 4UDUC 2JY6A 1Z5SB 3L10B 1ZPSA 2OOBB 4IWOA 2LUEA 2FBWB 2IDYA 1HZ5A 3CSFA 4L1BA 4A3PA 4W9EA 2XK5A 3HUIA 4BFRA 1DGJA 2NCNA 1YIWA 3DHIC 1FXTB 3ZYYX 2LRUA 2KO3A 4JX1C 2MP2B 4K3CA 2BB6A 3P63A 3W1SA 4FJYA 1T6BX 1RFKA 3CMMB 3DVNV 1E0ZA 2JXTA 2J0MA 2WXLA 4EUTA 1MI0A 3BWUD 3ZLZA 3UQBA 1KM7A 2KANA 4RGNA 2BWES 2K25A 3B9JA 3X0WA 4DXAB 4I6NB 1FNWA 4IM2A 1SSNA 5JHBA 1EU3A 3OLMD 3PO0A 5BMHA 1WZ0A 2KWDA 4CO7A 1L6UA 4DXFA 1WXVA 1UUPA 1L5PA 3KYCD 3AM9A 2MCNB 4TKNA 2C9WB 2BYEA 2FCQA 1S3SG 4HWIB 1JROA 1FCCC 5E6JA 4ICUA 4WH4A 1E6EB 2XN9C 2O2VA 2KNBA 2O2VB 1P1AA 4KIKA 2LWPA 1DOYA 4OVVA 1WY8A 4A90A 1ZXHA 2MHJA 4WURA 2KDFB 1FRDA 2ONQA 3H7PA 3QC8B 5AUIA 2H88B 3V62A 2WDRB 4OZCA 1ZOYB 2A5UA 2MEKA 5L95C 5EE1A 4E74A 2KQ4X 2JXXA 2BBCA 1L2NA 2GBKA 1WR1A 3DVGX 1A5RA 1WM3A 2KWUB 2D5GA 3A1QA 3JVZX 4W9JA 1A70A 2QILA 1LQBA 3J9CA 4J3OD 3R3MA 2KC2A 2KKCA 4DHJB 3TCAA 1JW9D 1YNTE 4MACA 4TV3A 3DVGY 4ITKA 4G3XB 3H7SA 4KSKC 2JWUA 4YL8A 2W9NA 3Q3NC 4K3BA 5GXGB 1PGBA 4WJOA 3KQ4A 2WX0A 3RCZA 4US8A 3MJWA 1J7CA 2IGDA 4WJQA 2KT7A 3MHZA 3R2IA 1QT9A 2ICIA 2RDHA 1GUAB 2J53A 5CHWA 5FR6A 2IBIB 1R4NB 4BAXA 5J18A 5FKAC 1GPXA 2LUMA 4RFBA 2XEWA 2QHOA 3A4SC 1WXQA 3DBHI 3ZDMC 2KN5A 1FEHA 2OJWA 3MC0B 2XBBC 1T5XD 1ZDVA 2JU6X 4TSSA 5BMGA 4B0MA 2KFKA 2KJ6A 2GI9A 5HI1A 3BK1A 2ZPYA 2C7HA 3DBSA 1WX9A 2Y5PA 3PSEB 3U4EG 2K39A 1AW7A 1FNUA 1N62A 3ZNHB 2V3PA 4XDDA 2WXPA 4FBJB 2EMTA 3L16A 2DAFA 1TY2A 3MC9A 3PGEA 3AE2B 3U8ZA 3VTVA 4K81A 4YT0B 3QIJA 2BS3B 4RM9A 2QDFA 3AE8B 5BMIA 3CWIA 2KC1A 4JPSA 5I4DA 3P2BA 3QK0A 2GRIA 2DENB 5D3DA 3RFZB 3RT3B 2G45B 2B3AA 3ZUNA 4FHJA 4EZJA 1M94A 2IO0B 3X23A 4WJNA 1D5XC 3APCA 3A9KB 4LK0M 1GC7A 1UZXB 1K8RB 1H4RA 2PMVA 1NDDA 1LFDA 3B1LX 2KMAA 1I4GA 1L0XB 3RNGC 2I2YA 3B2FA 3L17A 1DOIA 3ZJVA 4K7UA 3H8HA 1WXSA 5FK9C 3AI5A 2KK8A 2WDQB 4IC7B 1EUVB 1FXIA 4M02A 4HCNB 1SF0A 1K53A 4HKZE 1WI0A 3RZFA 2LD9A 3NVVA 1VLBA 2D10A 4PS8A 2OEDA 1JRPA 4K7WA 1OEYJ 3Q8EA 2Q5WD 2O6VA 3QX1A 3B2GA 5AUKA 3BYYB 2EKEC 3LJ3A 2G3QB 1AARA 1D4BA 1YJJA 1D5MC 1T0SC 4XWTA 1JALA 4IM0A 4W9LA 3H6NA 5CX3A 2GOWA 1WRDB 2LVPA 1PUTA 1SJHD 1UBIA 1E8ZA 3FILA 3DPDA 4R3DA 3H9DA 2WHIA 4EZKA 2JSVX 4WAFA 1V1OA 3PZDA 1NEKB 4ZRPA 1FRRA 4ASWC 4HLEA 2H89B 2KDMA 1N5XA 1WFYA 2LXCA 4LNNA 1E10A 5G2NA 2AQ2B 3ZTDA 3LDZE 3ABVB 3IG3A 1KOTA 3U2SC 3VFKA 2M4NA 2DYOA 2DYMA 2NR2A 3A9JA 1ZGUB 2JPHA 1Q1OA 2VH1A 2LVOA 2LRWA 3URYA 3VRBB 3ALBA 3AULA 1CJEA 4HRSA 5AZFA 4YTMB 2JUOA 4W9HA 1XLNA 5E6OA 2KACA 4NAWA 2WLBA 3BVZA 4MGKE 2FNJB 3KUDB 2DWQA 2PE6B 4EFOA 1V1PA 2PKOA 3UIPB 4P6VF 2IO3B 4HJGE 1JWSD 3CF6E 1WGDA 4JWSC 4WWPA 3ZQ4A 1UH6A 2KTFA 1V86A 1WJ4A 4HROA 2PVOD 2PIAA 1LO5D 2NPTA 1I4XA 2BS2B 3WAPA 2L00B 1IP9A 4HK2A 2K8CA 3UINB 1ZE3D 2LJIA 2RGFA 1HTOA 3MJ5A 1TBEA 2D3GA 3NJTA 2ZW1A 1ZKHA 3NVWA 2KZRA 4IM3A 4HEA1 1P98A 3BY4B 2BPSA 4OZAA 2NVUI 1E9MA 1NYRA 3R2TA 4IUMB 3DDCB 4ZRJA 2I1KA 1BXTA 2NTSA 3GZNB 1UBQA 2Z8LA 4ANVA 2MSED 2NPTB 3ZTCA 5DPTA 2X8XX 2M19A 1TS5A 5C1ZA 3W9CB 3I9V1 1YX5B 4IW0A 4RNAA 1SE2A 1WXMA 3RPFC 5EE0A 2AEHA 4GGQA 1WYWB 4HPLB 5D7GA 2OHFA 3AEDB 2LASA 1N63A 4WJPA 4ZYNA 1IBXA 4MSMB 3SD5A 3PRMB 5L83A 4EEWA 2KVRA 4KGSA 3EC8A 2YEPB 2LXAA 1PFDA 3NOBA 5D6JB 4G11A 1FFUA 3ZVVA 2LVQA 1QOFA 3A4RA 2W55A 2YLMA 1GB1A 5H8YE 3Q3FA 1QILA 2NTTA 3AEGB 3PS6A 2MRPA 3EFCA 1I35A 2M0XA 2FAZA 3AECB 1TT5B 5C2TB 3AE9B 2W54A 2ZPNA 3CIRB 3WA0A 3IT4B 5DCNA 2DLBA 3AE1B 4QAYA 2C7NB 2J0KA 2FIDA 3WAOA 1C1YB 1SE9A 4WAAA 3TSSA 1L4DB 4AJWA 1EM7A 2ZZPB 1KRHA 1OTRB 1NI2A 4ZRKA 2R61A 4MH8A 3E56A 1I4HA 4DHJD 3JW0X 3OG5A 3GE8C 2HDEA 2MQJA 2VRRB 2FE8A 2VZKD 1D5ZC 3IAS1 4XE0A 1IYFA 2NMQA 2CJNA 1QZEA 4C00A 4ZHOA 1TY0A 4KDLB 3NZSA 5LXIB 1SBBB 3AH7A 3EA6A 1QOBA 3DQVA 3KW5B 3GOEA 2GBJA 4XC2A 3SEBA 2L3ZA 4M8NA 2N7DA 1S1QB 1WJNA 4ANXA 4NPNA 4C7YA 3HM6X 4JQWC 3LXFA 2J42A 3TEWA 4JGHB 1TGZB 3ZJTA 3APFA 1DYQA 5GMVA 2ASQA 4P1BC 4EZLA 3VDZA 2AQ3B 3DHHC 4GSWA 4BZAA 4DK5A 2WU2B 3PLUA 4W9GA 4DHZB 4W9CA 2DZMA 5E6NA 2WS3B 3KLSX 4A6QA 2WXFA 3DVNU 3OJ3A 3EECA 1YQ4B 2CHXA 4MGZE 1L0VB 3PHXB 2AYOB 2N0SB 1V6EA 2G1EA 4MM3A 5G5HA 4C56C 1F1HA 3Q3MC 2XNAC 4NJ7A 4BBNC 1V49A 1EWCA 2VH2A 1OFFA 4JIOU 1XLPA 4WQMA 3AMZA 3GP7A 1OEYA 3RI7C 3AEEB 3PHWB 2K8HA 4ZYSA 2GMIC 4MJSA 2KOXA 2PPHA 4RF0A 4RCOA 3R7QA 1RWSA 3ML9A 1N6ZA 3MFGA 1Q5WB 2WXMA 2CKHB 3ZNID 4OW0A 4FXCA 2V4LA 2HE7A 4A8XC 1Y8RC 4N6EB 2O6VB 3N3KB 4GDKB 4GDLB 4FLHA 3U7ZA 3Q14C 2INCC 3NZ3A 1H8CA 2QIEB 3CSTA 4I6PA 3ZNGC 3NY5A 4K1RB 1MJDA 1FFVA 1K52A 2CR5A 2QCZA 4IWPA 3RNFC 4US9A 1JQ4A 2I38A 2K8BA 3RULA 2L0TA 2LMCA 1ZW7A 4KVGB 3T3OA 1YD8U 3L13A 4KZ0A 1TZOA 1XO3A 2W3RA 1WM2A 2L1AA 3BYTB 1MFWA 2J0JA 4ZRIA 3RZWC 5DPSA 5JZEB 2PW9A 1UD7A 2QMTA 1V8CA 1HE8A 3VAWA 2K1FA 3PZ8A 3ZXRA 1WGKA 2N4FA 3TEZA 2MJ3A 2DZKA 2KLGA 2D07B 2JZ3B 3U52E 2LGSA 3DBRI 3HIZA 1T0YA 1TYGB 3ZGZA 5IO9A 1HTQA 1HQRD 3VR9B 3NHEB 1QOAA 2KHWB 3WCQA 3TJPA 2KMMA 5BYSA 4JWUC 4LCDE 1AYFA 4NAWB 3WAMA 1D3ZA 3QJZA 1VRAB 2LFIA 1BUIC 1Z2MA 4F8CB 3PVLA 2QJLA 4JE3B 1KFYB 3VVWB 1P9DU 5G55A 4D2KA 1J8CA 4LJOB 3AB5A 1JMLA 3A1QB 1WSPA 1RYJA 1TJEA 1GAQB 4RH6A 1C9FA 5D3IB 4BVUC 1E8YA 1P7EA 2UYZB 1JWMD 4ICVA 2BW2A 5DPWA 3LYYA 2BS4B 4NJCA 3A33B 3QHTA 1RFAA 2QC8A 3TL5A 4WIPA 3WALA 3RMKC 3JSVB 1E8XA 2WXRA 4MJSB 4WWNA 1V80A 4KX6B 3N1YC 2WXHA 2PLPA 4JL9A 4USAA 1UGJA 1YOVB 3ZXVA 4BOZB 1C76A 1PYWD 1QLBB 4MELA 2AWTA 2BGFA 3W2DA 1E5WA 2K0PA 2XK5B 3ZO5B 2C60A 4KSLC 2KN4A 4OVUA 3JSVA 3VTWA 2MH7A 3Q8AA 4H2AA 1KF6B 5H92C 1VD2A 1SB3C 5IA7A 1EWYC 5J17A 2CHZA 4GMVA 1EU4A 3KVFB 2D3BA 1LM8B 3DHGC 4A55A 4FJVB 1XLQA 2ZCBA 2ZNVB 1WX8A 2OJRA 2IY1B 1VZ6A 4M00A 4CQNA 4AOFA 2O6VD 3S2AA 4LDTD 1SXTA 2MJDA 3H7PB 5AZGA 3C19A 2FCMA 3P4SB 4XWWA 2N1WA 3RUIB 1T0QC 4KIKB 3VRAB 3SR6A 2KAJA 4GN1A 2IJ0A 3OJ4B 4N59A 3VUWA 2TSSA 4GDLA 3Q8BA 4LTUA 5D2MB 3MTNB 2BKFA 2KTRA 2D11A 2ZCCA 4NQKE 4NAMA 3AEAB 2HTME 3QAQA 2L7RA 1V2YA 1YQBA 2ON8A 3L54A 1K50A 4ANWA 1SE3A 1MVKA 1VDVA 4C7ZA 1L4ZB 1F9JA 3Q8CA 2FCSA 3VUXA 3VR8B 1GJZA 2INNE 2MBEA 2KYWA 1ESFA 1XF5L 1IUEA 1R7SA 4CYEA 1TS3A 1M4VA 4BBNF 1V81A 4G0NB 4FJZA 4OVZA 1FNVA 3TBLD 4EE2A 3UIOB 4NQLB 3TMPB 2BYFA 1P3QU 3W1YA 1QF6A 4AS1A 2X38A 3DWMA 3IVFA 4A9AA 3AN1A 1WYGA 3IHPC 3UI3A 2I1JA 4IWQA 1UWMA 5IAAC 2RPVA 1WMHB 1MG4A 1ZUD2 4P16A 1MHHE 2IY0B 1ET9A 3D32A 3BVMA 1F2RI 2DHZA 4B6WA 3IAM1 3NS8A 4FN2A 1QOGA 4TQ1A 2ZW0A 3DBLB 1NI3A 4II3B 1KLGD 5CHVC 4YWGG 2M17A 2WXOA 5HHDG 4E71A 1N60A 2YEPF 1WJ6A 4IDIA 3M62B 1RLFA 2IO2B 2NS5A 3Q2AC 2EMSA 1EF5A 3ZNZB 2Z59B 4KZCA 5EE9A 4MM3B 4YTPB 1R4MB 5EE3A 1F77A 1V5TA 4XYCA 3VQIA 2W82A 1JWUD 4GXBA 2KJRA 2GBMA 1E8WA 3GE3C 1IGDA 5KHQA 2LI5A 3KH0A 1FO4A 4W9IA 1FIQA 1FD6A 4HXDA 4XGAB 4LNKA 3HK0A 3I63C 3R8BA 3DBLI 2K3UA 2CHWA 3FC4A 3N20C 1JRUA 4REZA 1E7PB 1PGXA 5G5GA 3P4QB 3W5UB 1C4CA 3EUB2 4S17A 5E6PA 5C3JB 1YJIA 1CZPA 2JQRB 4LDTB 4J6IA 1FPYA 1TKYA 5LNK1 4B95A 3V60A 3K9PB 1FM0D 4M8MA 4B9KA 3NUHB 3AE5B 1STEA 2N7JA 4GB9A 2N1VA 3PV1A 1VR9A 2NBWB 2Z0EB 2ZJDA 1P0RA 2KMCA 3APDA 1GG3A 3NG0A 4LNIA 2V3NA 1TS2A 3AEFB 3LB8C 2BF8B 4HDOA 3FKYA 1PQSA 3BIID 1Q0WB 1HZ6A 4A3OA 3VH4B 1J0GA 1SGHA 5IKCM 5HG2A 4KKIA 3SU8X 2WNMA 4F1SA 1WGHA 4PK1A 3T8MA 1V97A 1L6VA 3A9JB 3KUCB 4HVBA 2INDC 2MP2A 4O1NA 5CHFA 2QSDA 2RSUA 1ZXIA 3UGBB 1CK1A 4WWMA 1ROEA 4ZRQA 4LNFA 2KWCA 3ZJUA 2WU5B 2BYTA 1F2RC 2Y5CA 3NZUA 3PZ7A 4AJYB 2IYDB 2DNFA 1TTNA 3RD2A 2KFKB 4OZBA 5JHAA 3W1SC 4MDKE 3U30A 4AWJA 2R2QA 1XCTL 3R7RA 1TKGA 4IG7B 4OHJA 2LGIA 2JZPA 3SFEB 5CTRC 3PPAA 1XEEA 3RNBC 4C4VA 3GZNI 3TUOA 2KFJA 4BKSD 3KWLA 3ECIA 1HXYD 4II2B 4HJKA 1NENB 2CU1A 1TKEA 3PRPB 2ACZB 4FHKA 2DBYA 3PRZA 3PLVA 2KTRB 2LHEA 4G50A 2PVGC 3T3NA 4KGTA 2PJHA 5T8IA 4YTNB 2V1YA 1KTKA 1I7HA 2V0GA 3RYTA 4N58A 1VZ8A 1V1PB 4DXGA 4FA6A 1T3QA 1RAXA 1C4AA 1VCBA 3EFUA 3N9YC 2VZKB 2EKIA 4LLGM 1JCKB 2LJ5A 4GIVA 2WGSA 2MA9B 2M8SA 2BQQA 2ZVNA 4E3CA 3V05A 1YN4A 3WANA 2L8JA 3EHVA 3TIXA 4KDIC 3MC8A 4W9DA 2AX5A 3I5JC 1XT9B 1TS4A 1KLUD 2DAJA 3TEXA 2V4IB 2PEAA 3JYUA 4I6LB 3P4PB 4AUQC 4WWOA 1GNUA 2BYVE 3L0WB 1XXGA 2MBOA 2G4SA 5HKHA 4CHKA 2J7QB 2RMMA 1C4PA 3BVGA 2LHDA 2BT6A 3SHQA 4DDID 1C77A 2KJHB 4TQ0A 2WXQA 2C7MB 2Z0DB 2J52A 3AEBB 1J19A 3AU4A 4P1CC 2BKRB 2HTHA 3KWVA 4LNOA 2EELA 4L23A 4DHZE 4RMAA 5JH5C 3ML8A 4XDCA 3VH3B 3QARA 1MHXA 2MX2A 2UU7A 3AE4B 3HVZA 4MSQB 1UELA 2LZ6A 1C78A 4HPPA 2KDEB 1I42A 1WIAA 1XLOA 1WGGA 4PS3A 3V6CB 2N9PC 1AWDA 3VHTC 2LGDA 3V61A 2V3SA 4KKJA 1N61A 3BZDB 2A4ZA 3SDLC 2WP9B 1RM6C 3N30A 3Q8FA 2BTEA 4AP4C 1WWTA 1YQ3B 2SEBD 3IFWB 2WXIA 1MG8A 1ZP0B 4KV2A 2K22A 1P7FA 4S0RA 2K9XA 3M63B 3AE7B 3GS2A 2WX1A 3DBHB 3U7DA 1XCQL 2RPQA 3A9KA 3B0AA 3PTFC 2KLCA 3NVZA 5C23A 4RF1A 3RNCC 2KX3A 3NRZA 1KLVA 1L7YA 2N9KA 2KQSA 1CMXB 2N9XA 1WX7A 2K6DB 4KGRA 3ZDTA 3BK2A 3L08A 1GC6A 2MBBB 2GBNA 1XD3B 4JLCA 1EF1A 4DDGD 1YMHE 2MBQA 1UWXA 1K51A 4MEMA 3ZRCA 3ZW3A 1WF9A 4XZ4A 2E6XA 4TUUA 1EO6A 2C5LC 3HM3A 2INPE 2RDGA 2ZEQA 3PREA 1WJUA 2JVCA 2E3TA 4F7ZA 5LXHA 1V9JA 1IGCA 3RNEC 1R4NI 2D3AA 2KD0A 2G4DB 3I3TB 4DWFA 2MLBA 2B76B 2L0FA 5J2RA 2JF5A 4PT5A 1YN5A 2D2QA 1ACCA 1C3TA 2JT4B 3I57A 2K5PA 4M0WB 1QKZA 3UQAA 3VTUA 1SEBD 1UF0A 3T9LA 3ZRFA 1WZ3A 3N1XC 2L05A 2JZZA 1MPEA 4B0EA 1I4RA 4N9F4 2M0AA 2WXNA 3E9SA 2SAKA 3ONSA 2IPKD 4MGIE 4MGYE 4YSXB 3MP9A 2LGYA 2WQYB 1IBXB 2PE9A 1WMHA 4ANUA 4P7IA 5TR5A 3DOWA 4PYUA 3QWZB 2IO1B 1FMAD 2NBVB 2D3CA 2IGGA 1Y56A 4FULA 2GLSA 3PT2B 2RD0A 4HPMB 1IPGA 2FIFA 1FCLA 4L2YA 3EGRA 3VUYA 2R2OA 4NZLB 1F52A 2KQ7A 1RRBA 2FUG1 1NYQA 2BWFA 2UWQA 3MHSD 1F0ZA 2WXJA 1OQQA 3P1MA 4ACFA 5EDSA 5IOIA 3TEYA 2V9HA 1WXAA 2HJ1A 2N9EB 3BINA 2CS4A 3VXWA 2G9HD 4M0WA 4NNJB 2M56B 2JYEA 2REXA 3O65B 4RM8A 3IBEA 1G6JA 1I4QA 1YJ1A 3P42A 3Q69A 4C4VB 2YVCA 1NVID 3QQ8B 2Y5BB 5JXVA 2DX5B 1E7VA 2IGHA 1SIFA 4ZHPA 3DBRB 2KXJA 4ARCA 4PS7A 2M1MA 2IZVB 1LGRA 4GOCA 3WIMA 2Y3AA 2RR9A 4C80A 1J7BA 4XX5A 5IN7A 1YX6B 3HRDD 5HFYA 1T0RC 2DZIA 5MPOA 2FCNA 4HKQA 3C8YA 3HHMA 5AEKB 2BB5A 2WDTB 5TSSA 1PGAA 1ET6A 3QCAA 3IXSA 2ZVOA 1Q10A 3B08A 4URKA 3OWEB 5DPRA 2PTLA 1BT0A 1YN3A 2JWZA 4RGTA 1WGYA 1SE4A 3L4PA 1B9RA 1ZDXA 2KWVB 4LJPB 1UGMA 3K9OB 2WXKA 1WE6A 4HCPB 1E7UA 3R66C 4GLSC 2DYBA 1WRIA 3AU5A 1N5WA 1ISNA 2L83A 1D6EC 2L52A 3AE6B 4X57B 5BO4B 1X1MA 1BMLC 1WR6E 2DZJA 2BVCA 2LGXA 4NJ6A 1R4MI 3KUZA 2L32A 3DCGA 1ENFA 1VJKA 2WXGA 3O13A 4DQOC 1B1ZA 3FILB 3KYDD 5KHOA 5IP4D 1GOZA 3Q3JA 3AXCA 1HA5A 2KDIA 3N1ZC 4WQOB 1SIJA 3P4RB 4IKGA 1KJTA 2JRHA
chains in the Genus database with same CATH topology
2DBYA 4ARIA 3PZ8A 1WGKA 2LHEA 3TEZA 1OQRA 2MJ3A 2PVGC 3T3NA 4KGTA 1PUTA 5T8IA 4YTNB 3U52E 1SJHD 3FILA 1TYGB 3ZGZA 1KH0A 4R3DA 1HQRD 1KTKA 1I7HA 3VR9B 2V0GA 1QOAA 4N58A 1VZ8A 1V1PB 2JYTA 4DXGA 3WCQA 1T3QA 2JSVX 4WAFA 1JWBD 1V1OA 1C4AA 3N9YC 1NEKB 2KMMA 5BYSA 2VZKB 2EKIA 4LLGM 4ZRPA 1JCKB 3GB1A 4JWUC 1FRRA 1AYFA 4NAWB 3W5VB 5BYRA 1I4PA 2H89B 2KDMA 1VRAB 2LFIA 1N5XA 2LEKA 1BUIC 3V05A 1YN4A 2QJLA 2W3SA 4JE3B 1GB4A 1KFYB 1E10A 3V3XA 2AQ2B 1FXAA 1JWAD 4D2KA 3ABVB 3AB5A 1JMLA 1L0YB 2AX5A 3U2SC 1TS4A 1KLUD 2DYOA 1WSPA 1RYJA 2DYMA 3TEXA 1TJEA 2V4IB 1GAQB 3P4PB 4RH6A 1QQRA 1C9FA 2JX5A 5D3IB 1P7EA 1PDXA 1JWMD 4IOIE 2BW2A 2J4XA 1HEZE 1XXGA 2MJEA 3URYA 3LYYA 3VRBB 2BS4B 4NJCA 1CJEA 4HRSA 2RMMA 4YTMB 1C4PA 3BVGA 2LHDA 2BT6A 4YXDB 4WIPA 1XLNA 2KACA 3NVYA 4RGOS 2WLBA 1C77A 1AN8A 1J7AA 3BVZA 4YSZB 2WXRA 4RGMA 4TMAB 4KX6B 2DWQA 4TQ0A 2WXQA 2PLPA 2WXHA 4USAA 1UNSA 1UGJA 1V1PA 2PKOA 2J52A 3AEBB 4P6VF 5BYQA 1C76A 1C79A 1PYWD 1QLBB 4HJGE 1JWSD 4JWSC 3W2DA 2K0PA 3NS1A 2AQ1B 3KWVA 3ZQ4A 2QEJC 1DOXA 2KN4A 3DWGC 2EELA 3HVDA 4L23A 4HROA 2PVOD 1CQVA 2MH7A 2PIAA 1LO5D 3Q8AA 2CJOA 3AE3B 1I4XA 4H2AA 4XDCA 4Q2JA 1KF6B 2BS2B 5H92C 1MHXA 1SB3C 1EWYC 5FR3A 3AE4B 2GB1A 1ZE3D 2LJIA 3MJ5A 3HVZA 4ZOHC 4MT5A 1EU4A 3SFDB 2ZW1A 3NVWA 3FAHA 4HEA1 1C78A 4A55A 3ETRA 1XLQA 4AQ7A 1XLOA 4OZAA 2WDVB 1E9MA 4YSYB 1NYRA 2CU3A 1AWDA 3R2TA 1VZ7A 2N9LA 1BXTA 3IT6B 2NTSA 3AV8A 1SJED 4UDUC 1VZ6A 4KKJA 1N61A 4CQNA 2Z8LA 1ZPSA 1SXTA 3BZDB 2MJDA 2FBWB 2WP9B 2IDYA 1RM6C 1HZ5A 3Q8FA 4L1BA 2BTEA 3P4SB 1WWTA 1YQ3B 4XWWA 2SEBD 2M19A 1TS5A 3HUIA 1DGJA 3SR6A 3VRAB 2WXIA 3W9CB 2KAJA 3I9V1 2IJ0A 4N59A 1SE2A 4RNAA 3RPFC 1ZP0B 5EE0A 4JX1C 3ZYYX 2BB6A 2TSSA 3P63A 3W1SA 2K22A 1P7FA 5D7GA 1T6BX 1RFKA 3Q8BA 4LTUA 2OHFA 2K9XA 3AEDB 3AE7B 3GS2A 4NAMA 1E0ZA 1N63A 1XCQL 2JXTA 3AEAB 2HTME 2WXLA 1MI0A 3BWUD 1IBXA 2ON8A 1K50A 1SE3A 1MVKA 3NVZA 4KGSA 4RF1A 4RGNA 3B9JA 1VDVA 4C7ZA 3NRZA 1L4ZB 2YEPB 3Q8CA 2N9KA 1PFDA 4KGRA 1FFUA 3VR8B 1FNWA 1SSNA 3BK2A 2INNE 1EU3A 1QOFA 3PO0A 1ESFA 1XF5L 2W55A 1IUEA 1R7SA 1TS3A 1GB1A 5H8YE 1M4VA 1QILA 5BMHA 2NTTA 3AEGB 1YMHE 2KWDA 1L6UA 1UWXA 1K51A 4OVZA 4DXFA 1UUPA 1FNVA 1L5PA 3AM9A 2E6XA 4EE2A 3AECB 5C2TB 3AE9B 2INPE 2W54A 2RDGA 1JROA 1FCCC 3CIRB 5E6JA 3IT4B 2E3TA 2DLBA 3AE1B 4WH4A 1E6EB 1QF6A 2XN9C 4AS1A 1IGCA 2X38A 3DWMA 4A9AA 3AN1A 1DOYA 1WYGA 3UI3A 4A90A 1ZXHA 2B76B 4PT5A 1YN5A 1L4DB 4WURA 3TSSA 1ACCA 1EM7A 1FRDA 2ONQA 5AUIA 1KRHA 1UWMA 2H88B 2RPVA 2WDRB 4OZCA 2R61A 3I57A 1ZOYB 2K5PA 4MH8A 1QKZA 3E56A 1I4HA 2MEKA 1ZUD2 4P16A 1MHHE 1SEBD 5EE1A 1ET9A 2HDEA 2KQ4X 2FE8A 2VZKD 3BVMA 2BBCA 1D5ZC 3IAS1 1F2RI 4XE0A 2NMQA 3IAM1 2CJNA 4ZHOA 1MPEA 4B0EA 1QOGA 1I4RA 4TQ1A 2ZW0A 2D5GA 1NI3A 1KLGD 2M0AA 2WXNA 1A70A 1TY0A 2QILA 3J9CA 4YWGG 4J3OD 2WXOA 5HHDG 3E9SA 2SAKA 2IPKD 1SBBB 3AH7A 3MP9A 4YSXB 2WQYB 1N60A 1IBXB 2YEPF 3EA6A 4IDIA 1QOBA 1JW9D 1YNTE 4MACA 1FMAD 3SEBA 4ITKA 5EE9A 2IGGA 1Y56A 4MM3B 4YTPB 2JWUA 5EE3A 4C7YA 1FCLA 4L2YA 1F77A 3EGRA 3LXFA 2J42A 4NZLB 3TEWA 3VQIA 2FUG1 2W82A 1JWUD 1NYQA 5GXGB 3ZJTA 1F0ZA 1PGBA 2WXJA 3KQ4A 1IGDA 1OQQA 1DYQA 4US8A 1J7CA 1FO4A 2IGDA 3P1MA 1FIQA 1FD6A 3MHZA 3TEYA 3R2IA 1QT9A 2ICIA 2AQ3B 2RDHA 2J53A 3R8BA 2G9HD 2K3UA 4M0WA 2M56B 2WU2B 3FC4A 2JYEA 5FKAC 1GPXA 1I4QA 4REZA 1E7PB 1PGXA 3P42A 2LUMA 4RFBA 5G5GA 3Q69A 3P4QB 3W5UB 2WS3B 1C4CA 3EUB2 5C3JB 3KLSX 1WXQA 1NVID 4A6QA 2WXFA 1YJIA 1CZPA 1FEHA 1YQ4B 3MC0B 5JXVA 2JQRB 1T5XD 1ZDVA 2JU6X 1L0VB 1TKYA 4TSSA 5BMGA 2N0SB 4B0MA 2IGHA 2G1EA 5LNK1 1FM0D 2GI9A 5HI1A 3BK1A 3NUHB 5G5HA 3AE5B 4C56C 4ZHPA 2XNAC 2Y5PA 3U4EG 1STEA 1AW7A 2N7JA 4ARCA 1FNUA 1N62A 1VR9A 1EWCA 2V3PA 1OFFA 4XDDA 1XLPA 2WXPA 4WQMA 2Y3AA 3AMZA 3GP7A 4C80A 1TY2A 3AE2B 1J7BA 4YT0B 2BS3B 3AEEB 3AE8B 5BMIA 3CWIA 2V3NA 4JPSA 3HRDD 1TS2A 3AEFB 5I4DA 4ZYSA 3LB8C 2GRIA 5HFYA 5D3DA 3RFZB 5MPOA 4HKQA 3C8YA 2BB5A 3BIID 4RCOA 4RF0A 1HZ6A 1RWSA 5TSSA 1PGAA 1ET6A 3MFGA 3IXSA 5HG2A 1D5XC 2WXMA 4LK0M 1Q10A 4OW0A 2PMVA 4FXCA 3OWEB 4KKIA 1I4GA 1L0XB 4A8XC 2I2YA 2PTLA 3B2FA 4N6EB 1DOIA 2WNMA 3ZJVA 1YN3A 3H8HA 4GDKB 1V97A 1L6VA 4GDLB 4RGTA 1SE4A 5FK9C 3L4PA 1B9RA 1ZDXA 4O1NA 3U7ZA 2WDQB 3NZ3A 2QSDA 2WXKA 2QIEB 1FXIA 4GLSC 1ZXIA 1SF0A 1WRIA 1K53A 4HKZE 1N5WA 1FFVA 2L83A 1CK1A 1D6EC 1K52A 2L52A 3AE6B 4WWMA 1ROEA 4ZRQA 1BMLC 3ZJUA 2WU5B 2BYTA 1F2RC 2Y5CA 3NVVA 4US9A 1VLBA 3PZ7A 1JQ4A 2I38A 2L32A 4OZBA 2OEDA 2LMCA 1JRPA 1ENFA 1VJKA 2WXGA 3T3OA 3O13A 4DQOC 1B1ZA 3FILB 1XCTL 1TKGA 4OHJA 2LGIA 3Q8EA 2Q5WD 1TZOA 1XO3A 2JZPA 3SFEB 3B2GA 1GOZA 1XEEA 2W3RA 2L1AA 3TUOA 1HA5A 5AUKA 3BYTB 3BYYB 3KWLA 1D4BA 1YJJA 1SIJA 1HXYD 1D5MC 2PW9A 4XWTA 2QMTA 1V8CA 3P4RB 4IKGA 1JALA 1NENB 1TKEA 2ACZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UI3 A;  2LHE A;  1ZXH A;  2N7J A;  4KGT A;  1EM7 A;  2ONQ A;  4OZA A;  3FIL A;  2RPV A;  4OZC A;  1QKZ A;  1KH0 A;  2N9L A;  1MHH E;  2KQ4 X;  2JSV X;  5BMI A;  1F2R I;  3GB1 A;  1HZ5 A;  5HFY A;  2NMQ A;  2KDM A;  1MPE A;  2ZW0 A;  1HZ6 A;  1GB4 A;  1PGA A;  3V3X A;  5HHD G;  4D2K A;  5HG2 A;  3MP9 A;  1IBX B;  1Q10 A;  1JML A;  1P7F A;  1YNT E;  2I2Y A;  4MAC A;  2PTL A;  1C9F A;  1P7E A;  1XCQ L;  2JXT A;  2IGG A;  4IOI E;  1MI0 A;  1HEZ E;  2JWU A;  1IBX A;  2ON8 A;  1FCL A;  1K50 A;  2QSD A;  2RMM A;  1MVK A;  4GLS C;  2LHD A;  4KGS A;  2KAC A;  1PGB A;  1K53 A;  4HKZ E;  1IGD A;  2N9K A;  4KGR A;  1K52 A;  2IGD A;  2PLP A;  1FD6 A;  1F2R C;  1XF5 L;  2J52 A;  1GB1 A;  2J53 A;  5BMH A;  2I38 A;  4HJG E;  4OZB A;  2OED A;  1YMH E;  2KWD A;  2K0P A;  1UWX A;  1K51 A;  1PGX A;  2LUM A;  3FIL B;  1XCT L;  2KN4 A;  2LGI A;  2EEL A;  2JZP A;  1FCC C;  1MHX A;  5JXV A;  2JU6 X;  1D4B A;  4WH4 A;  2GB1 A;  5BMG A;  2PW9 A;  1IGC A;  2QMT A;  2IGH A;  4IKG A;  2GI9 A;  5HI1 A;  2ZW1 A; 
#chains in the Genus database with same CATH topology
 2HD5 B;  4ARI A;  4BKT A;  1OQR A;  1LXD A;  1TZ1 A;  3Q3O C;  2RDB C;  1KH0 A;  4A20 A;  2MBH A;  4FAD A;  2JYT A;  2MW5 A;  2K6Q A;  2NBU A;  1JWB D;  3M3J A;  3V6E B;  4ZDV A;  3GB1 A;  3W5V B;  5BYR A;  1I4P A;  2LEK A;  2HJ8 A;  2W3S A;  1GB4 A;  3V3X A;  4BOS C;  1FXA A;  1JWA D;  1TIF A;  4K7S A;  1L0Y B;  1WE7 A;  3QA8 A;  2GBR A;  1QQR A;  4BKG A;  2JX5 A;  1PDX A;  4IOI E;  4MH0 E;  4DBG A;  2J4X A;  2KDB A;  1HEZ E;  2N7E A;  2MJE A;  3C0R B;  4HDQ A;  4NY0 A;  2WYQ A;  2ZNV C;  4YXD B;  3NVY A;  1WGR A;  4RGO S;  1AN8 A;  1J7A A;  3N32 A;  5D94 A;  4YSZ B;  4RGM A;  4TMA B;  4EKU A;  3RN9 C;  4EOY A;  4W9K A;  3H1U A;  1UNS A;  3ENE A;  2WWZ A;  5BYQ A;  1OGW A;  2JRI B;  1C79 A;  3UF8 A;  4PYZ A;  4GU2 A;  2AL6 A;  1XQQ A;  3NS1 A;  3ZKJ C;  2AQ1 B;  2QEJ C;  1DOX A;  3DWG C;  3HVD A;  4M01 A;  1CQV A;  5LLI A;  2CJO A;  3AE3 B;  1U4A A;  4Q2J A;  3OAW A;  5AZH A;  3M95 A;  5FR3 A;  2GB1 A;  2L76 A;  2AL3 A;  4ZOH C;  4MT5 A;  3ZIM A;  3SFD B;  2KVZ A;  4W9F A;  1NBF C;  3FAH A;  1E90 A;  1V5O A;  2FUH B;  2KX0 A;  4GDK A;  1OQY A;  3ETR A;  3RNA C;  4AQ7 A;  1WH3 A;  2WDV B;  4YSY B;  2CU3 A;  4BKS A;  1VZ7 A;  3Q6B A;  2N9L A;  2MWS B;  3IT6 B;  3AV8 A;  1SJE D;  4UDU C;  2JY6 A;  1Z5S B;  3L10 B;  1ZPS A;  2OOB B;  4IWO A;  2LUE A;  2FBW B;  2IDY A;  1HZ5 A;  3CSF A;  4L1B A;  4A3P A;  4W9E A;  2XK5 A;  3HUI A;  4BFR A;  1DGJ A;  2NCN A;  1YIW A;  3DHI C;  1FXT B;  3ZYY X;  2LRU A;  2KO3 A;  4JX1 C;  2MP2 B;  4K3C A;  2BB6 A;  3P63 A;  3W1S A;  4FJY A;  1T6B X;  1RFK A;  3CMM B;  3DVN V;  1E0Z A;  2JXT A;  2J0M A;  2WXL A;  4EUT A;  1MI0 A;  3BWU D;  3ZLZ A;  3UQB A;  1KM7 A;  2KAN A;  4RGN A;  2BWE S;  2K25 A;  3B9J A;  3X0W A;  4DXA B;  4I6N B;  1FNW A;  4IM2 A;  1SSN A;  5JHB A;  1EU3 A;  3OLM D;  3PO0 A;  5BMH A;  1WZ0 A;  2KWD A;  4CO7 A;  1L6U A;  4DXF A;  1WXV A;  1UUP A;  1L5P A;  3KYC D;  3AM9 A;  2MCN B;  4TKN A;  2C9W B;  2BYE A;  2FCQ A;  1S3S G;  4HWI B;  1JRO A;  1FCC C;  5E6J A;  4ICU A;  4WH4 A;  1E6E B;  2XN9 C;  2O2V A;  2KNB A;  2O2V B;  1P1A A;  4KIK A;  2LWP A;  1DOY A;  4OVV A;  1WY8 A;  4A90 A;  1ZXH A;  2MHJ A;  4WUR A;  2KDF B;  1FRD A;  2ONQ A;  3H7P A;  3QC8 B;  5AUI A;  2H88 B;  3V62 A;  2WDR B;  4OZC A;  1ZOY B;  2A5U A;  2MEK A;  5L95 C;  5EE1 A;  4E74 A;  2KQ4 X;  2JXX A;  2BBC A;  1L2N A;  2GBK A;  1WR1 A;  3DVG X;  1A5R A;  1WM3 A;  2KWU B;  2D5G A;  3A1Q A;  3JVZ X;  4W9J A;  1A70 A;  2QIL A;  1LQB A;  3J9C A;  4J3O D;  3R3M A;  2KC2 A;  2KKC A;  4DHJ B;  3TCA A;  1JW9 D;  1YNT E;  4MAC A;  4TV3 A;  3DVG Y;  4ITK A;  4G3X B;  3H7S A;  4KSK C;  2JWU A;  4YL8 A;  2W9N A;  3Q3N C;  4K3B A;  5GXG B;  1PGB A;  4WJO A;  3KQ4 A;  2WX0 A;  3RCZ A;  4US8 A;  3MJW A;  1J7C A;  2IGD A;  4WJQ A;  2KT7 A;  3MHZ A;  3R2I A;  1QT9 A;  2ICI A;  2RDH A;  1GUA B;  2J53 A;  5CHW A;  5FR6 A;  2IBI B;  1R4N B;  4BAX A;  5J18 A;  5FKA C;  1GPX A;  2LUM A;  4RFB A;  2XEW A;  2QHO A;  3A4S C;  1WXQ A;  3DBH I;  3ZDM C;  2KN5 A;  1FEH A;  2OJW A;  3MC0 B;  2XBB C;  1T5X D;  1ZDV A;  2JU6 X;  4TSS A;  5BMG A;  4B0M A;  2KFK A;  2KJ6 A;  2GI9 A;  5HI1 A;  3BK1 A;  2ZPY A;  2C7H A;  3DBS A;  1WX9 A;  2Y5P A;  3PSE B;  3U4E G;  2K39 A;  1AW7 A;  1FNU A;  1N62 A;  3ZNH B;  2V3P A;  4XDD A;  2WXP A;  4FBJ B;  2EMT A;  3L16 A;  2DAF A;  1TY2 A;  3MC9 A;  3PGE A;  3AE2 B;  3U8Z A;  3VTV A;  4K81 A;  4YT0 B;  3QIJ A;  2BS3 B;  4RM9 A;  2QDF A;  3AE8 B;  5BMI A;  3CWI A;  2KC1 A;  4JPS A;  5I4D A;  3P2B A;  3QK0 A;  2GRI A;  2DEN B;  5D3D A;  3RFZ B;  3RT3 B;  2G45 B;  2B3A A;  3ZUN A;  4FHJ A;  4EZJ A;  1M94 A;  2IO0 B;  3X23 A;  4WJN A;  1D5X C;  3APC A;  3A9K B;  4LK0 M;  1GC7 A;  1UZX B;  1K8R B;  1H4R A;  2PMV A;  1NDD A;  1LFD A;  3B1L X;  2KMA A;  1I4G A;  1L0X B;  3RNG C;  2I2Y A;  3B2F A;  3L17 A;  1DOI A;  3ZJV A;  4K7U A;  3H8H A;  1WXS A;  5FK9 C;  3AI5 A;  2KK8 A;  2WDQ B;  4IC7 B;  1EUV B;  1FXI A;  4M02 A;  4HCN B;  1SF0 A;  1K53 A;  4HKZ E;  1WI0 A;  3RZF A;  2LD9 A;  3NVV A;  1VLB A;  2D10 A;  4PS8 A;  2OED A;  1JRP A;  4K7W A;  1OEY J;  3Q8E A;  2Q5W D;  2O6V A;  3QX1 A;  3B2G A;  5AUK A;  3BYY B;  2EKE C;  3LJ3 A;  2G3Q B;  1AAR A;  1D4B A;  1YJJ A;  1D5M C;  1T0S C;  4XWT A;  1JAL A;  4IM0 A;  4W9L A;  3H6N A;  5CX3 A;  2GOW A;  1WRD B;  2LVP A;  1PUT A;  1SJH D;  1UBI A;  1E8Z A;  3FIL A;  3DPD A;  4R3D A;  3H9D A;  2WHI A;  4EZK A;  2JSV X;  4WAF A;  1V1O A;  3PZD A;  1NEK B;  4ZRP A;  1FRR A;  4ASW C;  4HLE A;  2H89 B;  2KDM A;  1N5X A;  1WFY A;  2LXC A;  4LNN A;  1E10 A;  5G2N A;  2AQ2 B;  3ZTD A;  3LDZ E;  3ABV B;  3IG3 A;  1KOT A;  3U2S C;  3VFK A;  2M4N A;  2DYO A;  2DYM A;  2NR2 A;  3A9J A;  1ZGU B;  2JPH A;  1Q1O A;  2VH1 A;  2LVO A;  2LRW A;  3URY A;  3VRB B;  3ALB A;  3AUL A;  1CJE A;  4HRS A;  5AZF A;  4YTM B;  2JUO A;  4W9H A;  1XLN A;  5E6O A;  2KAC A;  4NAW A;  2WLB A;  3BVZ A;  4MGK E;  2FNJ B;  3KUD B;  2DWQ A;  2PE6 B;  4EFO A;  1V1P A;  2PKO A;  3UIP B;  4P6V F;  2IO3 B;  4HJG E;  1JWS D;  3CF6 E;  1WGD A;  4JWS C;  4WWP A;  3ZQ4 A;  1UH6 A;  2KTF A;  1V86 A;  1WJ4 A;  4HRO A;  2PVO D;  2PIA A;  1LO5 D;  2NPT A;  1I4X A;  2BS2 B;  3WAP A;  2L00 B;  1IP9 A;  4HK2 A;  2K8C A;  3UIN B;  1ZE3 D;  2LJI A;  2RGF A;  1HTO A;  3MJ5 A;  1TBE A;  2D3G A;  3NJT A;  2ZW1 A;  1ZKH A;  3NVW A;  2KZR A;  4IM3 A;  4HEA 1;  1P98 A;  3BY4 B;  2BPS A;  4OZA A;  2NVU I;  1E9M A;  1NYR A;  3R2T A;  4IUM B;  3DDC B;  4ZRJ A;  2I1K A;  1BXT A;  2NTS A;  3GZN B;  1UBQ A;  2Z8L A;  4ANV A;  2MSE D;  2NPT B;  3ZTC A;  5DPT A;  2X8X X;  2M19 A;  1TS5 A;  5C1Z A;  3W9C B;  3I9V 1;  1YX5 B;  4IW0 A;  4RNA A;  1SE2 A;  1WXM A;  3RPF C;  5EE0 A;  2AEH A;  4GGQ A;  1WYW B;  4HPL B;  5D7G A;  2OHF A;  3AED B;  2LAS A;  1N63 A;  4WJP A;  4ZYN A;  1IBX A;  4MSM B;  3SD5 A;  3PRM B;  5L83 A;  4EEW A;  2KVR A;  4KGS A;  3EC8 A;  2YEP B;  2LXA A;  1PFD A;  3NOB A;  5D6J B;  4G11 A;  1FFU A;  3ZVV A;  2LVQ A;  1QOF A;  3A4R A;  2W55 A;  2YLM A;  1GB1 A;  5H8Y E;  3Q3F A;  1QIL A;  2NTT A;  3AEG B;  3PS6 A;  2MRP A;  3EFC A;  1I35 A;  2M0X A;  2FAZ A;  3AEC B;  1TT5 B;  5C2T B;  3AE9 B;  2W54 A;  2ZPN A;  3CIR B;  3WA0 A;  3IT4 B;  5DCN A;  2DLB A;  3AE1 B;  4QAY A;  2C7N B;  2J0K A;  2FID A;  3WAO A;  1C1Y B;  1SE9 A;  4WAA A;  3TSS A;  1L4D B;  4AJW A;  1EM7 A;  2ZZP B;  1KRH A;  1OTR B;  1NI2 A;  4ZRK A;  2R61 A;  4MH8 A;  3E56 A;  1I4H A;  4DHJ D;  3JW0 X;  3OG5 A;  3GE8 C;  2HDE A;  2MQJ A;  2VRR B;  2FE8 A;  2VZK D;  1D5Z C;  3IAS 1;  4XE0 A;  1IYF A;  2NMQ A;  2CJN A;  1QZE A;  4C00 A;  4ZHO A;  1TY0 A;  4KDL B;  3NZS A;  5LXI B;  1SBB B;  3AH7 A;  3EA6 A;  1QOB A;  3DQV A;  3KW5 B;  3GOE A;  2GBJ A;  4XC2 A;  3SEB A;  2L3Z A;  4M8N A;  2N7D A;  1S1Q B;  1WJN A;  4ANX A;  4NPN A;  4C7Y A;  3HM6 X;  4JQW C;  3LXF A;  2J42 A;  3TEW A;  4JGH B;  1TGZ B;  3ZJT A;  3APF A;  1DYQ A;  5GMV A;  2ASQ A;  4P1B C;  4EZL A;  3VDZ A;  2AQ3 B;  3DHH C;  4GSW A;  4BZA A;  4DK5 A;  2WU2 B;  3PLU A;  4W9G A;  4DHZ B;  4W9C A;  2DZM A;  5E6N A;  2WS3 B;  3KLS X;  4A6Q A;  2WXF A;  3DVN U;  3OJ3 A;  3EEC A;  1YQ4 B;  2CHX A;  4MGZ E;  1L0V B;  3PHX B;  2AYO B;  2N0S B;  1V6E A;  2G1E A;  4MM3 A;  5G5H A;  4C56 C;  1F1H A;  3Q3M C;  2XNA C;  4NJ7 A;  4BBN C;  1V49 A;  1EWC A;  2VH2 A;  1OFF A;  4JIO U;  1XLP A;  4WQM A;  3AMZ A;  3GP7 A;  1OEY A;  3RI7 C;  3AEE B;  3PHW B;  2K8H A;  4ZYS A;  2GMI C;  4MJS A;  2KOX A;  2PPH A;  4RF0 A;  4RCO A;  3R7Q A;  1RWS A;  3ML9 A;  1N6Z A;  3MFG A;  1Q5W B;  2WXM A;  2CKH B;  3ZNI D;  4OW0 A;  4FXC A;  2V4L A;  2HE7 A;  4A8X C;  1Y8R C;  4N6E B;  2O6V B;  3N3K B;  4GDK B;  4GDL B;  4FLH A;  3U7Z A;  3Q14 C;  2INC C;  3NZ3 A;  1H8C A;  2QIE B;  3CST A;  4I6P A;  3ZNG C;  3NY5 A;  4K1R B;  1MJD A;  1FFV A;  1K52 A;  2CR5 A;  2QCZ A;  4IWP A;  3RNF C;  4US9 A;  1JQ4 A;  2I38 A;  2K8B A;  3RUL A;  2L0T A;  2LMC A;  1ZW7 A;  4KVG B;  3T3O A;  1YD8 U;  3L13 A;  4KZ0 A;  1TZO A;  1XO3 A;  2W3R A;  1WM2 A;  2L1A A;  3BYT B;  1MFW A;  2J0J A;  4ZRI A;  3RZW C;  5DPS A;  5JZE B;  2PW9 A;  1UD7 A;  2QMT A;  1V8C A;  1HE8 A;  3VAW A;  2K1F A;  3PZ8 A;  3ZXR A;  1WGK A;  2N4F A;  3TEZ A;  2MJ3 A;  2DZK A;  2KLG A;  2D07 B;  2JZ3 B;  3U52 E;  2LGS A;  3DBR I;  3HIZ A;  1T0Y A;  1TYG B;  3ZGZ A;  5IO9 A;  1HTQ A;  1HQR D;  3VR9 B;  3NHE B;  1QOA A;  2KHW B;  3WCQ A;  3TJP A;  2KMM A;  5BYS A;  4JWU C;  4LCD E;  1AYF A;  4NAW B;  3WAM A;  1D3Z A;  3QJZ A;  1VRA B;  2LFI A;  1BUI C;  1Z2M A;  4F8C B;  3PVL A;  2QJL A;  4JE3 B;  1KFY B;  3VVW B;  1P9D U;  5G55 A;  4D2K A;  1J8C A;  4LJO B;  3AB5 A;  1JML A;  3A1Q B;  1WSP A;  1RYJ A;  1TJE A;  1GAQ B;  4RH6 A;  1C9F A;  5D3I B;  4BVU C;  1E8Y A;  1P7E A;  2UYZ B;  1JWM D;  4ICV A;  2BW2 A;  5DPW A;  3LYY A;  2BS4 B;  4NJC A;  3A33 B;  3QHT A;  1RFA A;  2QC8 A;  3TL5 A;  4WIP A;  3WAL A;  3RMK C;  3JSV B;  1E8X A;  2WXR A;  4MJS B;  4WWN A;  1V80 A;  4KX6 B;  3N1Y C;  2WXH A;  2PLP A;  4JL9 A;  4USA A;  1UGJ A;  1YOV B;  3ZXV A;  4BOZ B;  1C76 A;  1PYW D;  1QLB B;  4MEL A;  2AWT A;  2BGF A;  3W2D A;  1E5W A;  2K0P A;  2XK5 B;  3ZO5 B;  2C60 A;  4KSL C;  2KN4 A;  4OVU A;  3JSV A;  3VTW A;  2MH7 A;  3Q8A A;  4H2A A;  1KF6 B;  5H92 C;  1VD2 A;  1SB3 C;  5IA7 A;  1EWY C;  5J17 A;  2CHZ A;  4GMV A;  1EU4 A;  3KVF B;  2D3B A;  1LM8 B;  3DHG C;  4A55 A;  4FJV B;  1XLQ A;  2ZCB A;  2ZNV B;  1WX8 A;  2OJR A;  2IY1 B;  1VZ6 A;  4M00 A;  4CQN A;  4AOF A;  2O6V D;  3S2A A;  4LDT D;  1SXT A;  2MJD A;  3H7P B;  5AZG A;  3C19 A;  2FCM A;  3P4S B;  4XWW A;  2N1W A;  3RUI B;  1T0Q C;  4KIK B;  3VRA B;  3SR6 A;  2KAJ A;  4GN1 A;  2IJ0 A;  3OJ4 B;  4N59 A;  3VUW A;  2TSS A;  4GDL A;  3Q8B A;  4LTU A;  5D2M B;  3MTN B;  2BKF A;  2KTR A;  2D11 A;  2ZCC A;  4NQK E;  4NAM A;  3AEA B;  2HTM E;  3QAQ A;  2L7R A;  1V2Y A;  1YQB A;  2ON8 A;  3L54 A;  1K50 A;  4ANW A;  1SE3 A;  1MVK A;  1VDV A;  4C7Z A;  1L4Z B;  1F9J A;  3Q8C A;  2FCS A;  3VUX A;  3VR8 B;  1GJZ A;  2INN E;  2MBE A;  2KYW A;  1ESF A;  1XF5 L;  1IUE A;  1R7S A;  4CYE A;  1TS3 A;  1M4V A;  4BBN F;  1V81 A;  4G0N B;  4FJZ A;  4OVZ A;  1FNV A;  3TBL D;  4EE2 A;  3UIO B;  4NQL B;  3TMP B;  2BYF A;  1P3Q U;  3W1Y A;  1QF6 A;  4AS1 A;  2X38 A;  3DWM A;  3IVF A;  4A9A A;  3AN1 A;  1WYG A;  3IHP C;  3UI3 A;  2I1J A;  4IWQ A;  1UWM A;  5IAA C;  2RPV A;  1WMH B;  1MG4 A;  1ZUD 2;  4P16 A;  1MHH E;  2IY0 B;  1ET9 A;  3D32 A;  3BVM A;  1F2R I;  2DHZ A;  4B6W A;  3IAM 1;  3NS8 A;  4FN2 A;  1QOG A;  4TQ1 A;  2ZW0 A;  3DBL B;  1NI3 A;  4II3 B;  1KLG D;  5CHV C;  4YWG G;  2M17 A;  2WXO A;  5HHD G;  4E71 A;  1N60 A;  2YEP F;  1WJ6 A;  4IDI A;  3M62 B;  1RLF A;  2IO2 B;  2NS5 A;  3Q2A C;  2EMS A;  1EF5 A;  3ZNZ B;  2Z59 B;  4KZC A;  5EE9 A;  4MM3 B;  4YTP B;  1R4M B;  5EE3 A;  1F77 A;  1V5T A;  4XYC A;  3VQI A;  2W82 A;  1JWU D;  4GXB A;  2KJR A;  2GBM A;  1E8W A;  3GE3 C;  1IGD A;  5KHQ A;  2LI5 A;  3KH0 A;  1FO4 A;  4W9I A;  1FIQ A;  1FD6 A;  4HXD A;  4XGA B;  4LNK A;  3HK0 A;  3I63 C;  3R8B A;  3DBL I;  2K3U A;  2CHW A;  3FC4 A;  3N20 C;  1JRU A;  4REZ A;  1E7P B;  1PGX A;  5G5G A;  3P4Q B;  3W5U B;  1C4C A;  3EUB 2;  4S17 A;  5E6P A;  5C3J B;  1YJI A;  1CZP A;  2JQR B;  4LDT B;  4J6I A;  1FPY A;  1TKY A;  5LNK 1;  4B95 A;  3V60 A;  3K9P B;  1FM0 D;  4M8M A;  4B9K A;  3NUH B;  3AE5 B;  1STE A;  2N7J A;  4GB9 A;  2N1V A;  3PV1 A;  1VR9 A;  2NBW B;  2Z0E B;  2ZJD A;  1P0R A;  2KMC A;  3APD A;  1GG3 A;  3NG0 A;  4LNI A;  2V3N A;  1TS2 A;  3AEF B;  3LB8 C;  2BF8 B;  4HDO A;  3FKY A;  1PQS A;  3BII D;  1Q0W B;  1HZ6 A;  4A3O A;  3VH4 B;  1J0G A;  1SGH A;  5IKC M;  5HG2 A;  4KKI A;  3SU8 X;  2WNM A;  4F1S A;  1WGH A;  4PK1 A;  3T8M A;  1V97 A;  1L6V A;  3A9J B;  3KUC B;  4HVB A;  2IND C;  2MP2 A;  4O1N A;  5CHF A;  2QSD A;  2RSU A;  1ZXI A;  3UGB B;  1CK1 A;  4WWM A;  1ROE A;  4ZRQ A;  4LNF A;  2KWC A;  3ZJU A;  2WU5 B;  2BYT A;  1F2R C;  2Y5C A;  3NZU A;  3PZ7 A;  4AJY B;  2IYD B;  2DNF A;  1TTN A;  3RD2 A;  2KFK B;  4OZB A;  5JHA A;  3W1S C;  4MDK E;  3U30 A;  4AWJ A;  2R2Q A;  1XCT L;  3R7R A;  1TKG A;  4IG7 B;  4OHJ A;  2LGI A;  2JZP A;  3SFE B;  5CTR C;  3PPA A;  1XEE A;  3RNB C;  4C4V A;  3GZN I;  3TUO A;  2KFJ A;  4BKS D;  3KWL A;  3ECI A;  1HXY D;  4II2 B;  4HJK A;  1NEN B;  2CU1 A;  1TKE A;  3PRP B;  2ACZ B;  4FHK A;  2DBY A;  3PRZ A;  3PLV A;  2KTR B;  2LHE A;  4G50 A;  2PVG C;  3T3N A;  4KGT A;  2PJH A;  5T8I A;  4YTN B;  2V1Y A;  1KTK A;  1I7H A;  2V0G A;  3RYT A;  4N58 A;  1VZ8 A;  1V1P B;  4DXG A;  4FA6 A;  1T3Q A;  1RAX A;  1C4A A;  1VCB A;  3EFU A;  3N9Y C;  2VZK B;  2EKI A;  4LLG M;  1JCK B;  2LJ5 A;  4GIV A;  2WGS A;  2MA9 B;  2M8S A;  2BQQ A;  2ZVN A;  4E3C A;  3V05 A;  1YN4 A;  3WAN A;  2L8J A;  3EHV A;  3TIX A;  4KDI C;  3MC8 A;  4W9D A;  2AX5 A;  3I5J C;  1XT9 B;  1TS4 A;  1KLU D;  2DAJ A;  3TEX A;  2V4I B;  2PEA A;  3JYU A;  4I6L B;  3P4P B;  4AUQ C;  4WWO A;  1GNU A;  2BYV E;  3L0W B;  1XXG A;  2MBO A;  2G4S A;  5HKH A;  4CHK A;  2J7Q B;  2RMM A;  1C4P A;  3BVG A;  2LHD A;  2BT6 A;  3SHQ A;  4DDI D;  1C77 A;  2KJH B;  4TQ0 A;  2WXQ A;  2C7M B;  2Z0D B;  2J52 A;  3AEB B;  1J19 A;  3AU4 A;  4P1C C;  2BKR B;  2HTH A;  3KWV A;  4LNO A;  2EEL A;  4L23 A;  4DHZ E;  4RMA A;  5JH5 C;  3ML8 A;  4XDC A;  3VH3 B;  3QAR A;  1MHX A;  2MX2 A;  2UU7 A;  3AE4 B;  3HVZ A;  4MSQ B;  1UEL A;  2LZ6 A;  1C78 A;  4HPP A;  2KDE B;  1I42 A;  1WIA A;  1XLO A;  1WGG A;  4PS3 A;  3V6C B;  2N9P C;  1AWD A;  3VHT C;  2LGD A;  3V61 A;  2V3S A;  4KKJ A;  1N61 A;  3BZD B;  2A4Z A;  3SDL C;  2WP9 B;  1RM6 C;  3N30 A;  3Q8F A;  2BTE A;  4AP4 C;  1WWT A;  1YQ3 B;  2SEB D;  3IFW B;  2WXI A;  1MG8 A;  1ZP0 B;  4KV2 A;  2K22 A;  1P7F A;  4S0R A;  2K9X A;  3M63 B;  3AE7 B;  3GS2 A;  2WX1 A;  3DBH B;  3U7D A;  1XCQ L;  2RPQ A;  3A9K A;  3B0A A;  3PTF C;  2KLC A;  3NVZ A;  5C23 A;  4RF1 A;  3RNC C;  2KX3 A;  3NRZ A;  1KLV A;  1L7Y A;  2N9K A;  2KQS A;  1CMX B;  2N9X A;  1WX7 A;  2K6D B;  4KGR A;  3ZDT A;  3BK2 A;  3L08 A;  1GC6 A;  2MBB B;  2GBN A;  1XD3 B;  4JLC A;  1EF1 A;  4DDG D;  1YMH E;  2MBQ A;  1UWX A;  1K51 A;  4MEM A;  3ZRC A;  3ZW3 A;  1WF9 A;  4XZ4 A;  2E6X A;  4TUU A;  1EO6 A;  2C5L C;  3HM3 A;  2INP E;  2RDG A;  2ZEQ A;  3PRE A;  1WJU A;  2JVC A;  2E3T A;  4F7Z A;  5LXH A;  1V9J A;  1IGC A;  3RNE C;  1R4N I;  2D3A A;  2KD0 A;  2G4D B;  3I3T B;  4DWF A;  2MLB A;  2B76 B;  2L0F A;  5J2R A;  2JF5 A;  4PT5 A;  1YN5 A;  2D2Q A;  1ACC A;  1C3T A;  2JT4 B;  3I57 A;  2K5P A;  4M0W B;  1QKZ A;  3UQA A;  3VTU A;  1SEB D;  1UF0 A;  3T9L A;  3ZRF A;  1WZ3 A;  3N1X C;  2L05 A;  2JZZ A;  1MPE A;  4B0E A;  1I4R A;  4N9F 4;  2M0A A;  2WXN A;  3E9S A;  2SAK A;  3ONS A;  2IPK D;  4MGI E;  4MGY E;  4YSX B;  3MP9 A;  2LGY A;  2WQY B;  1IBX B;  2PE9 A;  1WMH A;  4ANU A;  4P7I A;  5TR5 A;  3DOW A;  4PYU A;  3QWZ B;  2IO1 B;  1FMA D;  2NBV B;  2D3C A;  2IGG A;  1Y56 A;  4FUL A;  2GLS A;  3PT2 B;  2RD0 A;  4HPM B;  1IPG A;  2FIF A;  1FCL A;  4L2Y A;  3EGR A;  3VUY A;  2R2O A;  4NZL B;  1F52 A;  2KQ7 A;  1RRB A;  2FUG 1;  1NYQ A;  2BWF A;  2UWQ A;  3MHS D;  1F0Z A;  2WXJ A;  1OQQ A;  3P1M A;  4ACF A;  5EDS A;  5IOI A;  3TEY A;  2V9H A;  1WXA A;  2HJ1 A;  2N9E B;  3BIN A;  2CS4 A;  3VXW A;  2G9H D;  4M0W A;  4NNJ B;  2M56 B;  2JYE A;  2REX A;  3O65 B;  4RM8 A;  3IBE A;  1G6J A;  1I4Q A;  1YJ1 A;  3P42 A;  3Q69 A;  4C4V B;  2YVC A;  1NVI D;  3QQ8 B;  2Y5B B;  5JXV A;  2DX5 B;  1E7V A;  2IGH A;  1SIF A;  4ZHP A;  3DBR B;  2KXJ A;  4ARC A;  4PS7 A;  2M1M A;  2IZV B;  1LGR A;  4GOC A;  3WIM A;  2Y3A A;  2RR9 A;  4C80 A;  1J7B A;  4XX5 A;  5IN7 A;  1YX6 B;  3HRD D;  5HFY A;  1T0R C;  2DZI A;  5MPO A;  2FCN A;  4HKQ A;  3C8Y A;  3HHM A;  5AEK B;  2BB5 A;  2WDT B;  5TSS A;  1PGA A;  1ET6 A;  3QCA A;  3IXS A;  2ZVO A;  1Q10 A;  3B08 A;  4URK A;  3OWE B;  5DPR A;  2PTL A;  1BT0 A;  1YN3 A;  2JWZ A;  4RGT A;  1WGY A;  1SE4 A;  3L4P A;  1B9R A;  1ZDX A;  2KWV B;  4LJP B;  1UGM A;  3K9O B;  2WXK A;  1WE6 A;  4HCP B;  1E7U A;  3R66 C;  4GLS C;  2DYB A;  1WRI A;  3AU5 A;  1N5W A;  1ISN A;  2L83 A;  1D6E C;  2L52 A;  3AE6 B;  4X57 B;  5BO4 B;  1X1M A;  1BML C;  1WR6 E;  2DZJ A;  2BVC A;  2LGX A;  4NJ6 A;  1R4M I;  3KUZ A;  2L32 A;  3DCG A;  1ENF A;  1VJK A;  2WXG A;  3O13 A;  4DQO C;  1B1Z A;  3FIL B;  3KYD D;  5KHO A;  5IP4 D;  1GOZ A;  3Q3J A;  3AXC A;  1HA5 A;  2KDI A;  3N1Z C;  4WQO B;  1SIJ A;  3P4R B;  4IKG A;  1KJT A;  2JRH A; 
#chains in the Genus database with same CATH homology
 2DBY A;  4ARI A;  3PZ8 A;  1WGK A;  2LHE A;  3TEZ A;  1OQR A;  2MJ3 A;  2PVG C;  3T3N A;  4KGT A;  1PUT A;  5T8I A;  4YTN B;  3U52 E;  1SJH D;  3FIL A;  1TYG B;  3ZGZ A;  1KH0 A;  4R3D A;  1HQR D;  1KTK A;  1I7H A;  3VR9 B;  2V0G A;  1QOA A;  4N58 A;  1VZ8 A;  1V1P B;  2JYT A;  4DXG A;  3WCQ A;  1T3Q A;  2JSV X;  4WAF A;  1JWB D;  1V1O A;  1C4A A;  3N9Y C;  1NEK B;  2KMM A;  5BYS A;  2VZK B;  2EKI A;  4LLG M;  4ZRP A;  1JCK B;  3GB1 A;  4JWU C;  1FRR A;  1AYF A;  4NAW B;  3W5V B;  5BYR A;  1I4P A;  2H89 B;  2KDM A;  1VRA B;  2LFI A;  1N5X A;  2LEK A;  1BUI C;  3V05 A;  1YN4 A;  2QJL A;  2W3S A;  4JE3 B;  1GB4 A;  1KFY B;  1E10 A;  3V3X A;  2AQ2 B;  1FXA A;  1JWA D;  4D2K A;  3ABV B;  3AB5 A;  1JML A;  1L0Y B;  2AX5 A;  3U2S C;  1TS4 A;  1KLU D;  2DYO A;  1WSP A;  1RYJ A;  2DYM A;  3TEX A;  1TJE A;  2V4I B;  1GAQ B;  3P4P B;  4RH6 A;  1QQR A;  1C9F A;  2JX5 A;  5D3I B;  1P7E A;  1PDX A;  1JWM D;  4IOI E;  2BW2 A;  2J4X A;  1HEZ E;  1XXG A;  2MJE A;  3URY A;  3LYY A;  3VRB B;  2BS4 B;  4NJC A;  1CJE A;  4HRS A;  2RMM A;  4YTM B;  1C4P A;  3BVG A;  2LHD A;  2BT6 A;  4YXD B;  4WIP A;  1XLN A;  2KAC A;  3NVY A;  4RGO S;  2WLB A;  1C77 A;  1AN8 A;  1J7A A;  3BVZ A;  4YSZ B;  2WXR A;  4RGM A;  4TMA B;  4KX6 B;  2DWQ A;  4TQ0 A;  2WXQ A;  2PLP A;  2WXH A;  4USA A;  1UNS A;  1UGJ A;  1V1P A;  2PKO A;  2J52 A;  3AEB B;  4P6V F;  5BYQ A;  1C76 A;  1C79 A;  1PYW D;  1QLB B;  4HJG E;  1JWS D;  4JWS C;  3W2D A;  2K0P A;  3NS1 A;  2AQ1 B;  3KWV A;  3ZQ4 A;  2QEJ C;  1DOX A;  2KN4 A;  3DWG C;  2EEL A;  3HVD A;  4L23 A;  4HRO A;  2PVO D;  1CQV A;  2MH7 A;  2PIA A;  1LO5 D;  3Q8A A;  2CJO A;  3AE3 B;  1I4X A;  4H2A A;  4XDC A;  4Q2J A;  1KF6 B;  2BS2 B;  5H92 C;  1MHX A;  1SB3 C;  1EWY C;  5FR3 A;  3AE4 B;  2GB1 A;  1ZE3 D;  2LJI A;  3MJ5 A;  3HVZ A;  4ZOH C;  4MT5 A;  1EU4 A;  3SFD B;  2ZW1 A;  3NVW A;  3FAH A;  4HEA 1;  1C78 A;  4A55 A;  3ETR A;  1XLQ A;  4AQ7 A;  1XLO A;  4OZA A;  2WDV B;  1E9M A;  4YSY B;  1NYR A;  2CU3 A;  1AWD A;  3R2T A;  1VZ7 A;  2N9L A;  1BXT A;  3IT6 B;  2NTS A;  3AV8 A;  1SJE D;  4UDU C;  1VZ6 A;  4KKJ A;  1N61 A;  4CQN A;  2Z8L A;  1ZPS A;  1SXT A;  3BZD B;  2MJD A;  2FBW B;  2WP9 B;  2IDY A;  1RM6 C;  1HZ5 A;  3Q8F A;  4L1B A;  2BTE A;  3P4S B;  1WWT A;  1YQ3 B;  4XWW A;  2SEB D;  2M19 A;  1TS5 A;  3HUI A;  1DGJ A;  3SR6 A;  3VRA B;  2WXI A;  3W9C B;  2KAJ A;  3I9V 1;  2IJ0 A;  4N59 A;  1SE2 A;  4RNA A;  3RPF C;  1ZP0 B;  5EE0 A;  4JX1 C;  3ZYY X;  2BB6 A;  2TSS A;  3P63 A;  3W1S A;  2K22 A;  1P7F A;  5D7G A;  1T6B X;  1RFK A;  3Q8B A;  4LTU A;  2OHF A;  2K9X A;  3AED B;  3AE7 B;  3GS2 A;  4NAM A;  1E0Z A;  1N63 A;  1XCQ L;  2JXT A;  3AEA B;  2HTM E;  2WXL A;  1MI0 A;  3BWU D;  1IBX A;  2ON8 A;  1K50 A;  1SE3 A;  1MVK A;  3NVZ A;  4KGS A;  4RF1 A;  4RGN A;  3B9J A;  1VDV A;  4C7Z A;  3NRZ A;  1L4Z B;  2YEP B;  3Q8C A;  2N9K A;  1PFD A;  4KGR A;  1FFU A;  3VR8 B;  1FNW A;  1SSN A;  3BK2 A;  2INN E;  1EU3 A;  1QOF A;  3PO0 A;  1ESF A;  1XF5 L;  2W55 A;  1IUE A;  1R7S A;  1TS3 A;  1GB1 A;  5H8Y E;  1M4V A;  1QIL A;  5BMH A;  2NTT A;  3AEG B;  1YMH E;  2KWD A;  1L6U A;  1UWX A;  1K51 A;  4OVZ A;  4DXF A;  1UUP A;  1FNV A;  1L5P A;  3AM9 A;  2E6X A;  4EE2 A;  3AEC B;  5C2T B;  3AE9 B;  2INP E;  2W54 A;  2RDG A;  1JRO A;  1FCC C;  3CIR B;  5E6J A;  3IT4 B;  2E3T A;  2DLB A;  3AE1 B;  4WH4 A;  1E6E B;  1QF6 A;  2XN9 C;  4AS1 A;  1IGC A;  2X38 A;  3DWM A;  4A9A A;  3AN1 A;  1DOY A;  1WYG A;  3UI3 A;  4A90 A;  1ZXH A;  2B76 B;  4PT5 A;  1YN5 A;  1L4D B;  4WUR A;  3TSS A;  1ACC A;  1EM7 A;  1FRD A;  2ONQ A;  5AUI A;  1KRH A;  1UWM A;  2H88 B;  2RPV A;  2WDR B;  4OZC A;  2R61 A;  3I57 A;  1ZOY B;  2K5P A;  4MH8 A;  1QKZ A;  3E56 A;  1I4H A;  2MEK A;  1ZUD 2;  4P16 A;  1MHH E;  1SEB D;  5EE1 A;  1ET9 A;  2HDE A;  2KQ4 X;  2FE8 A;  2VZK D;  3BVM A;  2BBC A;  1D5Z C;  3IAS 1;  1F2R I;  4XE0 A;  2NMQ A;  3IAM 1;  2CJN A;  4ZHO A;  1MPE A;  4B0E A;  1QOG A;  1I4R A;  4TQ1 A;  2ZW0 A;  2D5G A;  1NI3 A;  1KLG D;  2M0A A;  2WXN A;  1A70 A;  1TY0 A;  2QIL A;  3J9C A;  4YWG G;  4J3O D;  2WXO A;  5HHD G;  3E9S A;  2SAK A;  2IPK D;  1SBB B;  3AH7 A;  3MP9 A;  4YSX B;  2WQY B;  1N60 A;  1IBX B;  2YEP F;  3EA6 A;  4IDI A;  1QOB A;  1JW9 D;  1YNT E;  4MAC A;  1FMA D;  3SEB A;  4ITK A;  5EE9 A;  2IGG A;  1Y56 A;  4MM3 B;  4YTP B;  2JWU A;  5EE3 A;  4C7Y A;  1FCL A;  4L2Y A;  1F77 A;  3EGR A;  3LXF A;  2J42 A;  4NZL B;  3TEW A;  3VQI A;  2FUG 1;  2W82 A;  1JWU D;  1NYQ A;  5GXG B;  3ZJT A;  1F0Z A;  1PGB A;  2WXJ A;  3KQ4 A;  1IGD A;  1OQQ A;  1DYQ A;  4US8 A;  1J7C A;  1FO4 A;  2IGD A;  3P1M A;  1FIQ A;  1FD6 A;  3MHZ A;  3TEY A;  3R2I A;  1QT9 A;  2ICI A;  2AQ3 B;  2RDH A;  2J53 A;  3R8B A;  2G9H D;  2K3U A;  4M0W A;  2M56 B;  2WU2 B;  3FC4 A;  2JYE A;  5FKA C;  1GPX A;  1I4Q A;  4REZ A;  1E7P B;  1PGX A;  3P42 A;  2LUM A;  4RFB A;  5G5G A;  3Q69 A;  3P4Q B;  3W5U B;  2WS3 B;  1C4C A;  3EUB 2;  5C3J B;  3KLS X;  1WXQ A;  1NVI D;  4A6Q A;  2WXF A;  1YJI A;  1CZP A;  1FEH A;  1YQ4 B;  3MC0 B;  5JXV A;  2JQR B;  1T5X D;  1ZDV A;  2JU6 X;  1L0V B;  1TKY A;  4TSS A;  5BMG A;  2N0S B;  4B0M A;  2IGH A;  2G1E A;  5LNK 1;  1FM0 D;  2GI9 A;  5HI1 A;  3BK1 A;  3NUH B;  5G5H A;  3AE5 B;  4C56 C;  4ZHP A;  2XNA C;  2Y5P A;  3U4E G;  1STE A;  1AW7 A;  2N7J A;  4ARC A;  1FNU A;  1N62 A;  1VR9 A;  1EWC A;  2V3P A;  1OFF A;  4XDD A;  1XLP A;  2WXP A;  4WQM A;  2Y3A A;  3AMZ A;  3GP7 A;  4C80 A;  1TY2 A;  3AE2 B;  1J7B A;  4YT0 B;  2BS3 B;  3AEE B;  3AE8 B;  5BMI A;  3CWI A;  2V3N A;  4JPS A;  3HRD D;  1TS2 A;  3AEF B;  5I4D A;  4ZYS A;  3LB8 C;  2GRI A;  5HFY A;  5D3D A;  3RFZ B;  5MPO A;  4HKQ A;  3C8Y A;  2BB5 A;  3BII D;  4RCO A;  4RF0 A;  1HZ6 A;  1RWS A;  5TSS A;  1PGA A;  1ET6 A;  3MFG A;  3IXS A;  5HG2 A;  1D5X C;  2WXM A;  4LK0 M;  1Q10 A;  4OW0 A;  2PMV A;  4FXC A;  3OWE B;  4KKI A;  1I4G A;  1L0X B;  4A8X C;  2I2Y A;  2PTL A;  3B2F A;  4N6E B;  1DOI A;  2WNM A;  3ZJV A;  1YN3 A;  3H8H A;  4GDK B;  1V97 A;  1L6V A;  4GDL B;  4RGT A;  1SE4 A;  5FK9 C;  3L4P A;  1B9R A;  1ZDX A;  4O1N A;  3U7Z A;  2WDQ B;  3NZ3 A;  2QSD A;  2WXK A;  2QIE B;  1FXI A;  4GLS C;  1ZXI A;  1SF0 A;  1WRI A;  1K53 A;  4HKZ E;  1N5W A;  1FFV A;  2L83 A;  1CK1 A;  1D6E C;  1K52 A;  2L52 A;  3AE6 B;  4WWM A;  1ROE A;  4ZRQ A;  1BML C;  3ZJU A;  2WU5 B;  2BYT A;  1F2R C;  2Y5C A;  3NVV A;  4US9 A;  1VLB A;  3PZ7 A;  1JQ4 A;  2I38 A;  2L32 A;  4OZB A;  2OED A;  2LMC A;  1JRP A;  1ENF A;  1VJK A;  2WXG A;  3T3O A;  3O13 A;  4DQO C;  1B1Z A;  3FIL B;  1XCT L;  1TKG A;  4OHJ A;  2LGI A;  3Q8E A;  2Q5W D;  1TZO A;  1XO3 A;  2JZP A;  3SFE B;  3B2G A;  1GOZ A;  1XEE A;  2W3R A;  2L1A A;  3TUO A;  1HA5 A;  5AUK A;  3BYT B;  3BYY B;  3KWL A;  1D4B A;  1YJJ A;  1SIJ A;  1HXY D;  1D5M C;  2PW9 A;  4XWT A;  2QMT A;  1V8C A;  3P4R B;  4IKG A;  1JAL A;  1NEN B;  1TKE A;  2ACZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...