1HEZE

Antibody-antigen complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
b'EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KAPPA LIGHT CHAIN OF IG
publication title Complex between Peptostreptococcus Magnus Protein L and a Human Antibody Reveals Structural Convergence in the Interaction Modes of Fab Binding Modes
pubmed doi rcsb
molecule tags Antibody
total genus 15
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hezE00
1MI0A 1ZXHA 4OZCA 2JXTA 1UWXA 1PGXA 2KN4A 1GB1A 5JXVA 2KQ4X 2EELA 2N7JA 5BMIA 2I2YA 1IGDA 1HEZE 4MACA 2RMMA 1GB4A 5HI1A 2JSVX 2PTLA 1XF5L 3MP9A 4KGSA 2J53A 5HHDG 1MHHE 2PLPA 1PGBA 2QMTA 2IGHA 2N9LA 1FCCC 4HKZE 3FILA 2LHEA 1YNTE 2I38A 4IOIE 1IBXB 3GB1A 1PGAA 1IGCA 1F2RC 1HZ5A 2LGIA 2ON8A 1P7FA 2PW9A 3V3XA 1YMHE 4KGTA 2J52A 2JWUA 4WH4A 1D4BA 2NMQA 3UI3A 2GI9A 2KACA 1FD6A 1XCTL 1F2RI 2K0PA 2JU6X 1K52A 1MHXA 1FCLA 1K51A 5BMGA 1XCQL 4OZAA 2N9KA 1EM7A 3FILB 1C9FA 4GLSC 5HG2A 1JMLA 2IGGA 1HZ6A 1MPEA 2LUMA 2GB1A 4IKGA 1KH0A 5BMHA 4D2KA 2IGDA 1K53A 2RPVA 2JZPA 2LHDA 4HJGE 2ZW1A 1K50A 4OZBA 2ONQA 2KDMA 2OEDA 5HFYA 1MVKA 1IBXA 1P7EA 2KWDA 1QKZA 2ZW0A 4KGRA 2QSDA 1Q10A
chains in the Genus database with same CATH superfamily
1WH3A 4WJPA 4LJOB 1J7CA 2CJOA 2KOXA 4M01A 1WXSA 1DOXA 3JYUA 1WFYA 4GMVA 5IOIA 5TR5A 1JCKB 5I4DA 2H88B 2PTLA 1XF5L 3DVGX 2TSSA 2L0TA 2LFIA 4LNIA 4LCDE 2BKFA 1J7AA 3ZDMC 3NZSA 1VZ8A 1GC6A 1PUTA 2QMTA 3V62A 1N61A 4P16A 2ACZB 4OVZA 3TEZA 5H92C 2SAKA 2KJHB 1I4XA 3ZTCA 1L6UA 3QC8B 4F8CB 2ON8A 1WYWB 4W9CA 4GN1A 4REZA 4FLHA 1UBQA 2V4LA 5T8IA 4DBGA 3UI3A 1YN5A 2QC8A 2BB5A 1WRDB 2LWPA 3CMMB 4M8MA 2AEHA 2KWCA 1I42A 2XBBC 3GS2A 3M63B 1DGJA 1TS4A 1WMHA 5IO9A 3QWZB 1CQVA 4KKJA 3DBRI 2JF5A 1EUVB 4KIKB 2W3SA 1E7PB 1E10A 2IYDB 4D2KA 3WAOA 3B2FA 3S2AA 2A4ZA 3KW5B 1D5XC 1PFDA 4RCOA 3AMZA 3TL5A 1ZPSA 4DHJB 2IPKD 2BBCA 4GDKB 4AS1A 2KQ7A 2LMCA 3KUCB 1CK1A 2KMMA 4E71A 4ITKA 3DWMA 5EE9A 2LGYA 2C60A 1SE4A 2Y3AA 2GLSA 1V9JA 2RMMA 5BYRA 2J0JA 2MJDA 2WDTB 4A9AA 5C1ZA 2LGXA 1E8XA 4NAWA 1ZXIA 4WIPA 2OOBB 1SE2A 2WXPA 1JWAD 1CJEA 1C79A 4FBJB 1YJ1A 3W9CB 1RYJA 1P0RA 2KFKA 5CTRC 4EEWA 2NMQA 3VRAB 4HK2A 1WGDA 3EECA 2KT7A 2O6VB 3NJTA 4A90A 3Q69A 1GNUA 1YQBA 2CHWA 1JWUD 2JU6X 2PKOA 3MHSD 5G55A 1WR6E 3QCAA 1WYGA 2N9KA 3DDCB 2KTFA 3FILB 2MBEA 1P98A 1PQSA 2IGGA 2LVOA 1V1PB 1DOIA 1NYQA 3R66C 4BVUC 1HXYD 3KH0A 1WGRA 1FIQA 3HIZA 4F1SA 2YEPB 5L95C 2BKRB 1YN4A 3IVFA 2BS3B 4HJGE 3KWLA 3PO0A 4JGHB 4FJYA 1QOFA 2C9WB 2XN9C 4NQKE 4MT5A 4XYCA 4MGIE 4EE2A 1Q0WB 4A3PA 4NAMA 4ICVA 1SJHD 4JLCA 5L83A 2MEKA 4TSSA 1TBEA 2PPHA 3BVGA 4WURA 5CHFA 4WWOA 2XEWA 1UGJA 4XWTA 2N0SB 4HJKA 1YN3A 3L0WB 4KGSA 2ZNVB 1KRHA 1V1OA 5FK9C 1I35A 3RYTA 3AEDB 4RGNA 4MJSB 4BOZB 1N60A 2MW5A 2NBVB 4G0NB 5DPSA 3VTWA 5EE0A 1EWCA 2ZPNA 3T9LA 1BMLC 1YNTE 3WA0A 1F77A 3U52E 4C7YA 2LGIA 4F7ZA 1TKEA 3PSEB 2BVCA 3DQVA 3DBLI 4LDTD 1IP9A 3DHHC 5CHWA 4TQ0A 2K0PA 2W9NA 3A4RA 1E7UA 2C7MB 1E6EB 2N1VA 4OZAA 3EA6A 3P2BA 2IJ0A 2KDFB 5C2TB 4DHZB 2MWSB 1V86A 2GB1A 2E6XA 2AQ1B 2NR2A 3RCZA 4FADA 3GZNB 3MJ5A 2IGDA 4Q2JA 1SBBB 1AN8A 1FNUA 3H7SA 2NTSA 3L10B 2KQSA 4WJNA 4NZLB 4S17A 3VVWB 1I4GA 2KDMA 3AE8B 5HFYA 2AWTA 1FXAA 5LLIA 4XX5A 3Q8BA 4ZRIA 3U30A 1LXDA 2FIFA 2Z59B 2LGDA 1XLNA 3UIPB 4AP4C 1P9DU 1WMHB 1DOYA 2BTEA 1RAXA 3N9YC 4IUMB 2ZCBA 4RGMA 1L0VB 4ZOHC 2CU3A 1K8RB 2REXA 3RMKC 3WAMA 2KK8A 3DBLB 1ZUD2 5D94A 4M02A 3PLVA 5CX3A 2EKEC 2L32A 4MDKE 3DCGA 2DWQA 5D2MB 1FFUA 3TJPA 3GE8C 2FIDA 4GU2A 3GB1A 4OW0A 3IT4B 1CMXB 1D3ZA 3EFUA 2BWFA 1OQYA 3VTVA 3JVZX 4MEMA 4GSWA 1FD6A 3SD5A 1XCTL 1F2RI 3NVVA 1WF9A 1TGZB 4W9DA 1V81A 1YD8U 3IAS1 1FCLA 4DWFA 1FRDA 4ZDVA 3NS1A 2HTHA 3LXFA 3V05A 5GMVA 1OQQA 2BGFA 1FO4A 3T8MA 2MBHA 2KXJA 1ZKHA 2IDYA 1KLGD 4ASWC 3WAPA 1BUIC 2KFKB 2K8CA 1NBFC 3E9SA 4MGZE 4N59A 5E6PA 1TYGB 3A33B 1XT9B 1L2NA 4N9F4 1TY0A 4E74A 2WXJA 2NS5A 4WWMA 1QF6A 5JXVA 2D2QA 2N7JA 3U4EG 3VUXA 3R2TA 4K81A 1QT9A 1WRIA 4MH0E 2LZ6A 4TKNA 2MHJA 1KLUD 4ANVA 2MP2B 1VCBA 3SEBA 1GAQB 3PRMB 1R7SA 2GBMA 5DPRA 3RUIB 4A20A 1FMAD 1PGBA 1WSPA 2K3UA 3AE4B 2XNAC 3TSSA 3NZUA 2MH7A 2FNJB 1C1YB 3EFCA 4W9HA 1NYRA 4M00A 2GOWA 5JH5C 2AQ2B 5AUIA 2W55A 3L13A 3PRPB 4W9IA 1A5RA 1SIFA 2L7RA 1LFDA 2Y5CA 2CS4A 4HEA1 1UZXB 3D32A 2L76A 3APFA 1Q5WB 1K52A 1ZDXA 2KWUB 4IW0A 1M4VA 3PV1A 2IBIB 3JSVA 1GUAB 3VUYA 1YQ4B 2OHFA 3BIID 4X57B 3ZVVA 1OGWA 1HZ6A 1P1AA 2L1AA 2GMIC 3HUIA 2DYMA 4K7UA 1QLBB 1KM7A 3P1MA 1TS5A 3N1ZC 2K8HA 2QJLA 3ZGZA 2FBWB 2Z8LA 2OEDA 1CZPA 1T5XD 2ZW0A 3CF6E 2DBYA 3DHGC 5G2NA 4GOCA 3PRZA 4AOFA 4LLGM 3ZW3A 5IA7A 4FA6A 1YX5B 1LQBA 4EZJA 3QA8A 3BY4B 2DZMA 5HI1A 4YTPB 1E0ZA 3H8HA 5LXHA 2KDIA 3I57A 1RFKA 3MP9A 1OEYJ 3IBEA 3H7PA 1J7BA 4IDIA 4FULA 2M0AA 4C80A 2N7EA 3IXSA 2WDQB 2INCC 3M3JA 4IC7B 3DHIC 4IM2A 2ZZPB 5IAAC 4WAFA 3A1QA 3UIOB 1DYQA 4KGTA 4RF0A 1D4BA 1OFFA 3EC8A 2KN5A 3AE2B 2M0XA 3N3KB 1YOVB 2WXLA 3KUZA 4WQMA 2R61A 1RFAA 2DX5B 3ALBA 4EZLA 3SFEB 4DXAB 4DK5A 2KC1A 3KYCD 4QAYA 3RNCC 1J8CA 3BYYB 3NRZA 1EF5A 2G1EA 4LDTB 3NOBA 3UF8A 3DVNV 2J0KA 2K8BA 1MPEA 4G50A 4CHKA 2WX1A 4BKSD 1UUPA 2D07B 1IUEA 2JY6A 2FUHB 1K50A 3Q6BA 2JYTA 5HKHA 2V3SA 4KGRA 1L0XB 3ENEA 1TZ1A 1ZXHA 3U7ZA 3M95A 4KZCA 4DHZE 4IWPA 3PT2B 4XGAB 3PTFC 4ZRJA 3I5JC 1EU3A 1A70A 4BOSC 3BK2A 2L00B 3PVLA 3AE1B 5EDSA 2N9XA 3P4PB 1V97A 2BWES 4A3OA 2LRWA 5IKCM 2KMAA 3N1YC 1N63A 2KZRA 1MHHE 4KSLC 4WQOB 4IWOA 2N9LA 1NVID 2X38A 2LASA 4WWNA 3SU8X 4IOIE 1WJ6A 2LRUA 4LNKA 3WCQA 1SJED 3P4RB 1Y8RC 1P7FA 3VHTC 4HWIB 1C78A 4WH4A 3RNBC 1VLBA 4FJVB 1UELA 3V60A 2C7HA 2X8XX 4PT5A 4MELA 4II2B 1I4QA 1VR9A 2QILA 4YSYB 2RSUA 3WANA 1Q1OA 4RMAA 3P42A 1SGHA 3ZLZA 2LGSA 3CSTA 1NI2A 5EE1A 3VAWA 3MC9A 1BT0A 3MFGA 2KVRA 4BKSA 5HG2A 4C4VB 1UF0A 2N9PC 2NBUA 1N5WA 3Q8EA 1ISNA 2GBKA 3VH4B 3DOWA 5EE3A 4DDID 3NVYA 1MJDA 2MX2A 3PZ7A 2INNE 4W9EA 2M19A 3IHPC 1PDXA 1ZDVA 2MJEA 2A5UA 3AU4A 1GB1A 2PIAA 4RGTA 4S0RA 3NHEB 2MA9B 1GB4A 4GIVA 4HKQA 3QJZA 2RDBC 2CU1A 3ZRFA 3KWVA 4TV3A 3ZNHB 3BYTB 1WGHA 4M0WB 2CKHB 1RWSA 1KJTA 3DWGC 2BF8B 1OQRA 1JWMD 3EUB2 2FCQA 3GZNI 3R3MA 4AWJA 1WI0A 3OLMD 2FE8A 2N9EB 4MH8A 2JZZA 3N1XC 4ARCA 4HROA 4ACFA 3A9JA 2EKIA 4MGKE 2KKCA 2BS2B 5FKAC 4TQ1A 4KZ0A 1RLFA 3H7PB 3RD2A 3W1YA 3ZIMA 2WYQA 1XEEA 1R4NI 4L2YA 3P4QB 1JMLA 1V6EA 4WAAA 5GXGB 1F0ZA 1C3TA 3A1QB 2MQJA 5KHOA 3Q3MC 2LJIA 3ZXVA 3A9KA 3R7RA 1K53A 5E6NA 3SDLC 1HTQA 1FXTB 2LXAA 4GXBA 3MTNB 2ZW1A 2RPQA 2K5PA 2JX5A 2INPE 4BBNC 1AWDA 5JHAA 1GG3A 1IPGA 4JL9A 3C8YA 2LVQA 3QAQA 3URYA 4AUQC 3DBSA 4JIOU 2L83A 4HDOA 2BPSA 3UQAA 3BINA 2QCZA 5JZEB 2KLCA 2BT6A 1IGDA 4I6LB 5LXIB 4K7WA 4B0MA 1GJZA 2G45B 2WXOA 4KV2A 1D5ZC 3ZJUA 4LNOA 3RT3B 5D6JB 4RM8A 2WP9B 1LGRA 1XXGA 2PLPA 1FCCC 3QX1A 4P1CC 2V9HA 2LHEA 1C77A 3HVDA 2AX5A 2WNMA 1J0GA 1X1MA 3B08A 4NY0A 4HPPA 4UDUC 1R4NB 2K6DB 4AJWA 1WM3A 3B1LX 1SEBD 2GRIA 3E56A 4ZYNA 2UWQA 1J19A 3Q3OC 4ZHPA 2MLBA 3B2GA 1QQRA 1F52A 1V80A 2NVUI 2WU2B 4US9A 1MHXA 2WX0A 5BMGA 3RZFA 4BBNF 4ZRPA 2MRPA 1WZ3A 3ZUNA 2WDVB 1JROA 2I1JA 4MSMB 1KFYB 4RF1A 2UYZB 2LD9A 4ZRQA 2DENB 4YXDB 1SSNA 1E5WA 2IY0B 3Q3FA 5MPOA 3VRBB 3Q3JA 4NAWB 2PVGC 2BYEA 1HQRD 3A4SC 3GE3C 1QKZA 4IG7B 2AYOB 1MI0A 2WQYB 3ZXRA 4H2AA 1IYFA 2JXTA 1ROEA 1FPYA 1I4PA 2KX3A 2M8SA 4LJPB 3TIXA 4KDIC 2EELA 4FXCA 1C4AA 2QHOA 4KIKA 1KLVA 3ZTDA 2KAJA 2UU7A 1WZ0A 3JW0X 4CO7A 2AL6A 1E90A 2MBQA 3DBHI 5G5GA 2DNFA 3AE7B 1MG4A 3BK1A 4RM9A 5BO4B 5HHDG 2KTRA 3HM6X 2PJHA 3VFKA 2KDEB 1TTNA 2DAFA 2WXRA 3ONSA 4HPMB 2ZCCA 1PGAA 1WX8A 2H89B 2K9XA 3AEFB 4A8XC 1HZ5A 2NCNA 3PLUA 4YSXB 4EOYA 1D5MC 4NJ6A 2V3PA 2G9HD 1WX9A 3VDZA 3DVNU 2KACA 2IO2B 1YJIA 3CWIA 1B9RA 3W5UB 3PZDA 1HA5A 5AEKB 2Q5WD 3HM3A 3TEWA 3TEXA 3NS8A 3U7DA 4DDGD 4TMAB 3LDZE 1TS2A 4XWWA 4MM3A 1RRBA 1T3QA 3TUOA 2WDRB 3L16A 3PREA 1T0RC 1N6ZA 1KH0A 3PS6A 2JPHA 2WXQA 1HTOA 2CHZA 1EU4A 3NY5A 3A9JB 4B95A 2DHZA 3IT6B 2ZJDA 2HDEA 1ESFA 3RN9C 3LB8C 3DBHB 3FKYA 2QDFA 1JQ4A 1ACCA 5BYQA 1L6VA 2JWZA 4O1NA 2O2VA 1UH6A 2G4DB 4OZCA 1YQ3B 1MG8A 1UWXA 4B6WA 4KVGB 3ZDTA 1JWBD 2JUOA 1FRRA 5BMIA 1WXVA 2ZVNA 3C19A 4MACA 1SE3A 5J17A 5G5HA 3WIMA 3ZNID 4B0EA 1JW9D 2MBBB 1B1ZA 1EO6A 2L05A 4PS8A 1Z5SB 3AN1A 3A9KB 2V1YA 1ZOYB 4HXDA 4N58A 1NENB 4YL8A 2VZKD 2LEKA 1WY8A 2L52A 2FAZA 2ZEQA 4NPNA 1WGKA 3LJ3A 1WJ4A 3ABVB 3Q3NC 3AE9B 1C4CA 3MC8A 5KHQA 4DXFA 4GDLA 2N1WA 3V61A 3ZYYX 3VTUA 5LNK1 4YWGG 4I6PA 1ET9A 2FCNA 3MC0B 4IM3A 3N20C 4MGYE 3L4PA 3VH3B 3PPAA 3QQ8B 3RI7C 4AJYB 3PHWB 1FM0D 2V3NA 3L08A 4YSZB 3RZWC 4N6EB 3HRDD 2MJ3A 4P6VF 4BKTA 2LUMA 4IKGA 2G4SA 1AYFA 1STEA 3AH7A 4BAXA 5C3JB 2D3CA 1WE6A 4W9GA 2J4XA 2CR5A 4HDQA 2DAJA 4ARIA 2LHDA 2C5LC 2NTTA 4K1RB 2WXKA 1GPXA 3Q8AA 1JALA 4HRSA 5IN7A 4NJCA 1S3SG 2ONQA 1LO5D 3CIRB 2I1KA 3TEYA 4XDDA 5J2RA 5H8YE 4CQNA 1WX7A 3H9DA 1WJNA 1Q10A 3AU5A 4J6IA 2BQQA 5BYSA 1JRUA 4W9JA 3SFDB 2RR9A 1TS3A 3ZNGC 4USAA 2MSED 2JVCA 3IG3A 4OVUA 1WGGA 2WXNA 3K9PB 1L4ZB 2JSVX 3KVFB 3AE5B 3AEEB 1UWMA 3VXWA 2B76B 5DCNA 2EMSA 2R2OA 2PMVA 1T6BX 3VR8B 1HE8A 4OHJA 3DPDA 3K9OB 2IZVB 2M17A 4FHKA 3X0WA 4KKIA 2DZIA 2KDBA 3HK0A 1F2RC 1XLQA 3QHTA 4L1BA 1UGMA 2PW9A 4A55A 1T0SC 3AEBB 4YT0B 2E3TA 1ET6A 1N5XA 3SR6A 2GI9A 4PS7A 4BZAA 2PE6B 1R4MI 1E8YA 1XD3B 2JYEA 1E9MA 2KNBA 3VQIA 3VUWA 1XLPA 2MBOA 2CHXA 2KTRB 2G3QB 1C9FA 1WJUA 5E6JA 2IO3B 4MSQB 2J42A 3PHXB 3NG0A 3AE3B 4FN2A 3I3TB 2K39A 2LI5A 1T0YA 4WJOA 1OEYA 2KC2A 4P1BC 5AUKA 3B9JA 2M56B 2N4FA 1WXQA 3OG5A 4JE3B 1V5OA 3APDA 1NEKB 1OTRB 2N7DA 2DYBA 5DPWA 2YLMA 2C7NB 1IBXA 1P7EA 1V2YA 4HVBA 2XK5A 2NBWB 3GP7A 3U2SC 1TY2A 1L5PA 1PGXA 2KN4A 3FC4A 2LVPA 4MM3B 1TIFA 4C7ZA 1KOTA 1E8ZA 2PE9A 3NVZA 1TKGA 3Q8CA 1WWTA 3DBRB 2KLGA 3TBLD 1GC7A 2HJ8A 3BVZA 3B0AA 3VR9B 1C76A 1SIJA 3QIJA 1R4MB 2WXFA 3R7QA 4C56C 1SF0A 4NJ7A 1I4RA 3JSVB 4HKZE 2Y5BB 2PEAA 2INDC 3P63A 4AQ7A 5AZHA 2BYVE 2KO3A 2I38A 3EHVA 4US8A 2D3BA 1ZP0B 2AL3A 4PYUA 3ZJTA 3OJ4B 2WGSA 2LXCA 2O2VB 1VZ6A 2WU5B 3V3XA 4LK0M 2JWUA 2CJNA 4RH6A 4EUTA 4RFBA 1G6JA 1AW7A 1LM8B 3AXCA 2ZVOA 2MP2A 4URKA 3RNEC 3W1SC 4K3BA 2W54A 4PS3A 1WXAA 4YTMB 5TSSA 1K51A 2WXMA 2V0GA 1WR1A 3T3OA 4BKGA 1EM7A 4C00A 4JPSA 1H8CA 3Q8FA 3EGRA 1FNVA 1YJJA 1ZW7A 5BMHA 4EKUA 2JRHA 4LNFA 2KD0A 4R3DA 3ZJVA 2RPVA 3O65B 2K1FA 2VRRB 2KVZA 4IWQA 4GDLB 3OJ3A 4FHJA 4YTNB 4E3CA 2K25A 3RFZB 3X23A 4JWUC 5FR3A 3N32A 1MVKA 3ECIA 2BYFA 3CSFA 3L54A 4RNAA 2WWZA 1NDDA 2D3GA 4XZ4A 2IY1B 2Z0DB 1M94A 2KQ4X 4P7IA 1FNWA 1XO3A 1QZEA 2VH1A 2D5GA 1YIWA 4XE0A 2B3AA 2KX0A 3AM9A 3Q14C 4JWSC 3TCAA 3W5VB 2FCSA 2FCMA 1QOBA 2ZPYA 1VJKA 1WXMA 2EMTA 1FEHA 2NPTA 3IFWB 2IGHA 2LJ5A 4ZRKA 4TUUA 4CYEA 3AE6B 2DZKA 3P4SB 2PVOD 1I7HA 5AZFA 4J3OD 2D11A 2KHWB 2QIEB 3AECB 3H6NA 2V4IB 4W9KA 4KDLB 3U8ZA 3ZNZB 1Y56A 2OJRA 1EF1A 1L4DB 1QILA 4JX1C 4K3CA 4HCNB 5D3DA 1QOAA 3KQ4A 4DXGA 3RNGC 4PK1A 2ASQA 1L0YB 2DZJA 3AB5A 2KWVB 1PYWD 2VZKB 2L8JA 3NUHB 4JQWC 1U4AA 2K22A 1XCQL 4PYZA 4KSKC 1TJEA 2RDGA 5CHVC 3WALA 4DHJD 4M8NA 4GB9A 1VDVA 3ZO5B 1SXTA 2HJ1A 3TMPB 1FXIA 1TKYA 1BXTA 3HVZA 1AARA 4ICUA 4ANUA 4ANXA 2Y5PA 3W1SA 4LTUA 1UNSA 4EFOA 3HHMA 3ETRA 3OWEB 3UGBB 3AULA 1I4HA 4ZHOA 4G3XB 2GBNA 4KX6B 1ENFA 2WXIA 2GBRA 3ZKJC 4HLEA 2K6QA 3BWUD 1FFVA 2YVCA 3KLSX 3V6CB 2I2YA 1P3QU 1HEZE 2D3AA 1VZ7A 4WWPA 2JZ3B 3AEGB 2O6VD 1D6EC 2J53A 2OJWA 4HCPB 5JHBA 3MJWA 4L23A 2JRIB 1UBIA 1IBXB 4G11A 1IGCA 2KFJA 2HTME 3AI5A 4I6NB 2JT4B 2XK5B 1T0QC 3KUDB 4NNJB 1YMHE 2M4NA 1SE9A 3C0RB 2HD5B 1XLOA 1WGYA 2LUEA 1WM2A 3QK0A 3H1UA 3R2IA 3N30A 3FAHA 2ZNVC 2SEBD 4GDKA 1RM6C 1E8WA 3IAM1 3J9CA 2IO1B 4HPLB 5DPTA 3I9V1 5C23A 5IP4D 2FUG1 5J18A 2VH2A 2KANA 2BB6A 5D3IB 1V49A 2RDHA 4II3B 3GOEA 2JXXA 1ZGUB 1KF6B 4RGOS 3SHQA 2YEPF 3ZRCA 4W9LA 2KMCA 3NZ3A 1VRAB 2KWDA 2DYOA 3O13A 1H4RA 3PGEA 3Q2AC 3T3NA 1V5TA 2RD0A 2AQ3B 2KJRA 2Z0EB 3RPFC 4A6QA 3BVMA 4B9KA 3L17A 4NQLB 5AZGA 3NVWA 2WS3B 5FR6A 5E6OA 4C4VA 3RULA 1MFWA 2O6VA 2RGFA 3M62B 4K7SA 2GBJA 2J0MA 3MHZA 3ZQ4A 4WJQA 2W82A 4LNNA 2L3ZA 1V8CA 2HE7A 2M1MA 1TT5B 3RNFC 1YX6B 1E7VA 1C4PA 2JQRB 3APCA 3FILA 3OAWA 3R8BA 3UQBA 1S1QB 2BS4B 2WXHA 1V1PA 2KJ6A 4FJZA 2D10A 1WIAA 2MCNB 4ANWA 1GOZA 1JRPA 3AV8A 2J52A 2KYWA 2WHIA 2L0FA 3BZDB 4DQOC 2WXGA 3I63C 2BYTA 4W9FA 3DVGY 3ML8A 4M0WA 3AEAB 2ICIA 3QARA 4XC2A 1UD7A 1SB3C 3W2DA 3RNAC 4EZKA 4IM0A 3KYDD 5D7GA 1QOGA 2NPTB 1Z2MA 4BFRA 1N62A 1F1HA 4GLSC 4GGQA 1TZOA 1JWSD 2BW2A 2QEJC 1L7YA 2WLBA 4ZYSA 3ML9A 1EWYC 4XDCA 2DLBA 3V6EB 2IO0B 2W3RA 3UINB 2JZPA 1KTKA 1NI3A 1WE7A 4MJSA 2R2QA 1ZE3D 4OZBA 3PZ8A 1XQQA 4OVVA 3LYYA 1VD2A 2J7QB 2QSDA 1F9JA
chains in the Genus database with same CATH topology
1TY0A 3GP7A 2L83A 3U2SC 1J7CA 1TY2A 1L5PA 2WXJA 2CJOA 1PGXA 4WWMA 2KN4A 1QF6A 5JXVA 3FC4A 2N7JA 3U4EG 4MM3B 4C7ZA 3R2TA 1DOXA 1QT9A 2BT6A 1IGDA 1WRIA 4B0MA 1KLUD 3NVZA 1TKGA 2WXOA 1JCKB 3Q8CA 1WWTA 5I4DA 2H88B 2PTLA 3SEBA 1XF5L 2TSSA 1D5ZC 3ZJUA 2LFIA 1GAQB 3BVZA 1R7SA 1J7AA 3VR9B 1C76A 1SIJA 1FMAD 2WP9B 1VZ8A 2WXFA 1XXGA 1PGBA 1PUTA 1SF0A 2PLPA 2QMTA 1I4RA 1FCCC 4HKZE 4C56C 1WSPA 1N61A 2K3UA 2LHEA 3AE4B 1C77A 4P16A 2ACZB 3P63A 2XNAC 3TSSA 4AQ7A 3HVDA 4OVZA 3TEZA 2AX5A 2I38A 5H92C 4US8A 2MH7A 2SAKA 1ZP0B 1I4XA 3ZJTA 1L6UA 2WNMA 2ON8A 1VZ6A 2WU5B 1NYRA 3V3XA 4UDUC 4REZA 4LK0M 2JWUA 1SEBD 2GRIA 2CJNA 3E56A 4RH6A 4RFBA 5T8IA 2AQ2B 3UI3A 1AW7A 1YN5A 2W55A 5AUIA 4ZHPA 3B2GA 1QQRA 2BB5A 2Y5CA 4HEA1 2WU2B 4US9A 2W54A 1K52A 1MHXA 1ZDXA 4YTMB 1M4VA 5TSSA 1K51A 5BMGA 2WXMA 2V0GA 3GS2A 4ZRPA 1DGJA 2WDVB 3T3OA 1TS4A 1EM7A 1JROA 1YQ4B 2OHFA 4JPSA 3BIID 1CQVA 1KFYB 3Q8FA 3EGRA 4KKJA 1FNVA 1HZ6A 4RF1A 2W3SA 1E7PB 2L1AA 1E10A 3HUIA 2DYMA 1YJJA 4ZRQA 5BMHA 1QLBB 4D2KA 3P1MA 1TS5A 2QJLA 3B2FA 4YXDB 4R3DA 3ZJVA 1SSNA 2RPVA 3ZGZA 2FBWB 2Z8LA 1D5XC 5MPOA 1PFDA 4GDLB 3VRBB 4RCOA 3AMZA 4YTNB 4NAWB 3RFZB 2PVGC 2OEDA 1ZPSA 4JWUC 5FR3A 1CZPA 1HQRD 1MVKA 2IPKD 1QKZA 2BBCA 2ZW0A 4GDKB 4AS1A 1MI0A 2DBYA 2WQYB 2LMCA 4H2AA 4RNAA 2JXTA 1CK1A 2KMMA 1ROEA 1I4PA 4LLGM 2KQ4X 2EELA 4FXCA 1FNWA 1XO3A 1C4AA 4ITKA 3DWMA 5EE9A 1SE4A 2KAJA 2Y3AA 2RMMA 5BYRA 2D5GA 4XE0A 5HI1A 2MJDA 4JWSC 3AM9A 4A9AA 4YTPB 5G5GA 1E0ZA 3H8HA 3AE7B 3W5VB 3I57A 1RFKA 3MP9A 3BK1A 1QOBA 5HHDG 1VJKA 1J7BA 4IDIA 4C80A 2M0AA 1FEHA 3IXSA 1ZXIA 2IGHA 2WDQB 3AE6B 4WIPA 3P4SB 1SE2A 1I7HA 2PVOD 4J3OD 3AECB 2QIEB 2WXRA 2WXPA 1JWAD 1PGAA 2H89B 2K9XA 2V4IB 3AEFB 4A8XC 4WAFA 1CJEA 1HZ5A 1C79A 4YSXB 1Y56A 1D5MC 1DYQA 2V3PA 3W9CB 1L4DB 1QILA 4JX1C 1RYJA 4KGTA 4RF0A 2G9HD 1D4BA 5D3DA 1OFFA 2NMQA 1QOAA 3VRAB 3KQ4A 4DXGA 2KACA 1YJIA 4A90A 3AE2B 3Q69A 1L0YB 3AB5A 3CWIA 1B9RA 2WXLA 4WQMA 3W5UB 1PYWD 1HA5A 2R61A 2Q5WD 2VZKB 1JWUD 3TEWA 3NUHB 2JU6X 3SFEB 3TEXA 2PKOA 2K22A 1XCQL 1TJEA 2RDGA 1WYGA 2N9KA 3BYYB 4TMAB 3FILB 1TS2A 4XWWA 3NRZA 2IGGA 1T3QA 1VDVA 2G1EA 2WDRB 1SXTA 3TUOA 1V1PB 1MPEA 1FXIA 1DOIA 1NYQA 1BXTA 1TKYA 3HVZA 1KH0A 1HXYD 2WXQA 2Y5PA 1FIQA 3W1SA 2YEPB 1UUPA 1IUEA 1EU4A 1YN4A 4LTUA 2BS3B 1UNSA 4HJGE 3KWLA 3IT6B 2HDEA 1ESFA 1K50A 3ETRA 3OWEB 3LB8C 1I4HA 3PO0A 2JYTA 1QOFA 4ZHOA 2XN9C 1JQ4A 1ACCA 5BYQA 1L6VA 4MT5A 4KGRA 4O1NA 4EE2A 1L0XB 4KX6B 1ZXHA 4NAMA 3U7ZA 1ENFA 1YQ3B 2WXIA 4OZCA 1UWXA 1SJHD 2MEKA 3BWUD 4TSSA 1JWBD 1FFVA 1FRRA 5BMIA 3KLSX 2I2YA 3BVGA 4WURA 1EU3A 1HEZE 4MACA 1SE3A 1A70A 1UGJA 4XWTA 5G5HA 4B0EA 1JW9D 1VZ7A 2N0SB 1B1ZA 1YN3A 3BK2A 3AE1B 4KGSA 3AEGB 3P4PB 1KRHA 1V1OA 5FK9C 1D6EC 1V97A 2J53A 3AEDB 3AN1A 4RGNA 1ZOYB 1N63A 4N58A 1MHHE 1NENB 1N60A 2N9LA 2VZKD 2LEKA 5EE0A 4L23A 1EWCA 1NVID 2L52A 1BMLC 1YNTE 2X38A 1F77A 4IOIE 1IBXB 3WCQA 3U52E 1IGCA 4C7YA 2HTME 1SJED 1WGKA 3P4RB 2LGIA 1TKEA 1P7FA 3ABVB 1YMHE 1C78A 3AE9B 4WH4A 1VLBA 1C4CA 1XLOA 4PT5A 1I4QA 4DXFA 3R2IA 3ZYYX 5LNK1 4YWGG 1VR9A 2QILA 4TQ0A 3FAHA 4YSYB 1ET9A 3MC0B 2K0PA 2SEBD 3L4PA 3P42A 1RM6C 1E6EB 3IAM1 3J9CA 1FM0D 3I9V1 4OZAA 3EA6A 5EE1A 2IJ0A 2V3NA 2FUG1 5C2TB 4YSZB 3MFGA 4N6EB 3HRDD 5HG2A 2MJ3A 2BB6A 5D3IB 4P6VF 2LUMA 2GB1A 2E6XA 2AQ1B 4IKGA 1AYFA 1N5WA 3Q8EA 1STEA 2RDHA 3AH7A 5C3JB 3MJ5A 5EE3A 1KF6B 2IGDA 2J4XA 4Q2JA 4RGOS 1SBBB 1AN8A 1FNUA 4ARIA 2LHDA 2NTSA 2NTTA 2WXKA 2YEPF 1GPXA 3Q8AA 3NVYA 1JALA 4HRSA 4NZLB 4NJCA 1I4GA 2KDMA 2ONQA 3AE8B 3NZ3A 1VRAB 5HFYA 1LO5D 3CIRB 1FXAA 2KWDA 3PZ7A 2DYOA 2INNE 3Q8BA 3TEYA 3O13A 4XDDA 5H8YE 3T3NA 2AQ3B 2M19A 4CQNA 1Q10A 1XLNA 1PDXA 1ZDVA 3RPFC 2MJEA 5BYSA 4A6QA 3BVMA 3SFDB 1TS3A 1GB1A 3NVWA 1DOYA 2BTEA 2WS3B 2PIAA 3N9YC 4RGTA 4USAA 4RGMA 1L0VB 4ZOHC 1GB4A 2CU3A 2WXNA 4HKQA 1L4ZB 2JSVX 3KWVA 3AE5B 3AEEB 3BYTB 1UWMA 3MHZA 1ZUD2 3ZQ4A 2W82A 2B76B 2L32A 1V8CA 1RWSA 2PMVA 1T6BX 3DWGC 2DWQA 3VR8B 1FFUA 4OHJA 2JQRB 1C4PA 3FILA 1OQRA 3R8BA 4KKIA 1JWMD 3EUB2 2BS4B 2WXHA 1V1PA 4OW0A 3GB1A 3IT4B 1F2RC 1XLQA 4L1BA 2FE8A 4MH8A 2PW9A 4A55A 1GOZA 1JRPA 3AV8A 4ARCA 2J52A 4HROA 3AEBB 4YT0B 2E3TA 3BZDB 1ET6A 4DQOC 1N5XA 3SR6A 2WXGA 2GI9A 2BYTA 2EKIA 1FD6A 1XCTL 4M0WA 2BS2B 3AEAB 2ICIA 1F2RI 3NVVA 5FKAC 2JYEA 1SB3C 3W2DA 4TQ1A 3IAS1 1FCLA 1E9MA 5D7GA 1FRDA 3VQIA 3NS1A 1XLPA 1QOGA 3LXFA 3V05A 1C9FA 1N62A 1XEEA 1OQQA 4L2YA 3P4QB 4GLSC 1FO4A 1JMLA 1JWSD 1TZOA 2BW2A 2QEJC 5E6JA 2WLBA 2J42A 4ZYSA 5GXGB 1F0ZA 3AE3B 1EWYC 4XDCA 2IDYA 1KLGD 2DLBA 2LJIA 1BUIC 2W3RA 5AUKA 1K53A 3B9JA 2JZPA 1KTKA 1NI3A 2M56B 1WXQA 4JE3B 1ZE3D 2ZW1A 2K5PA 3E9SA 4OZBA 3PZ8A 2JX5A 4N59A 1NEKB 2INPE 1AWDA 1TYGB 3LYYA 1IBXA 1P7EA 3C8YA 3URYA 2QSDA 1T5XD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MI0 A;  1ZXH A;  4OZC A;  2JXT A;  1UWX A;  1PGX A;  2KN4 A;  1GB1 A;  5JXV A;  2KQ4 X;  2EEL A;  2N7J A;  5BMI A;  2I2Y A;  1IGD A;  1HEZ E;  4MAC A;  2RMM A;  1GB4 A;  5HI1 A;  2JSV X;  2PTL A;  1XF5 L;  3MP9 A;  4KGS A;  2J53 A;  5HHD G;  1MHH E;  2PLP A;  1PGB A;  2QMT A;  2IGH A;  2N9L A;  1FCC C;  4HKZ E;  3FIL A;  2LHE A;  1YNT E;  2I38 A;  4IOI E;  1IBX B;  3GB1 A;  1PGA A;  1IGC A;  1F2R C;  1HZ5 A;  2LGI A;  2ON8 A;  1P7F A;  2PW9 A;  3V3X A;  1YMH E;  4KGT A;  2J52 A;  2JWU A;  4WH4 A;  1D4B A;  2NMQ A;  3UI3 A;  2GI9 A;  2KAC A;  1FD6 A;  1XCT L;  1F2R I;  2K0P A;  2JU6 X;  1K52 A;  1MHX A;  1FCL A;  1K51 A;  5BMG A;  1XCQ L;  4OZA A;  2N9K A;  1EM7 A;  3FIL B;  1C9F A;  4GLS C;  5HG2 A;  1JML A;  2IGG A;  1HZ6 A;  1MPE A;  2LUM A;  2GB1 A;  4IKG A;  1KH0 A;  5BMH A;  4D2K A;  2IGD A;  1K53 A;  2RPV A;  2JZP A;  2LHD A;  4HJG E;  2ZW1 A;  1K50 A;  4OZB A;  2ONQ A;  2KDM A;  2OED A;  5HFY A;  1MVK A;  1IBX A;  1P7E A;  2KWD A;  1QKZ A;  2ZW0 A;  4KGR A;  2QSD A;  1Q10 A; 
#chains in the Genus database with same CATH topology
 1WH3 A;  4WJP A;  4LJO B;  1J7C A;  2CJO A;  2KOX A;  4M01 A;  1WXS A;  1DOX A;  3JYU A;  1WFY A;  4GMV A;  5IOI A;  5TR5 A;  1JCK B;  5I4D A;  2H88 B;  2PTL A;  1XF5 L;  3DVG X;  2TSS A;  2L0T A;  2LFI A;  4LNI A;  4LCD E;  2BKF A;  1J7A A;  3ZDM C;  3NZS A;  1VZ8 A;  1GC6 A;  1PUT A;  2QMT A;  3V62 A;  1N61 A;  4P16 A;  2ACZ B;  4OVZ A;  3TEZ A;  5H92 C;  2SAK A;  2KJH B;  1I4X A;  3ZTC A;  1L6U A;  3QC8 B;  4F8C B;  2ON8 A;  1WYW B;  4W9C A;  4GN1 A;  4REZ A;  4FLH A;  1UBQ A;  2V4L A;  5T8I A;  4DBG A;  3UI3 A;  1YN5 A;  2QC8 A;  2BB5 A;  1WRD B;  2LWP A;  3CMM B;  4M8M A;  2AEH A;  2KWC A;  1I42 A;  2XBB C;  3GS2 A;  3M63 B;  1DGJ A;  1TS4 A;  1WMH A;  5IO9 A;  3QWZ B;  1CQV A;  4KKJ A;  3DBR I;  2JF5 A;  1EUV B;  4KIK B;  2W3S A;  1E7P B;  1E10 A;  2IYD B;  4D2K A;  3WAO A;  3B2F A;  3S2A A;  2A4Z A;  3KW5 B;  1D5X C;  1PFD A;  4RCO A;  3AMZ A;  3TL5 A;  1ZPS A;  4DHJ B;  2IPK D;  2BBC A;  4GDK B;  4AS1 A;  2KQ7 A;  2LMC A;  3KUC B;  1CK1 A;  2KMM A;  4E71 A;  4ITK A;  3DWM A;  5EE9 A;  2LGY A;  2C60 A;  1SE4 A;  2Y3A A;  2GLS A;  1V9J A;  2RMM A;  5BYR A;  2J0J A;  2MJD A;  2WDT B;  4A9A A;  5C1Z A;  2LGX A;  1E8X A;  4NAW A;  1ZXI A;  4WIP A;  2OOB B;  1SE2 A;  2WXP A;  1JWA D;  1CJE A;  1C79 A;  4FBJ B;  1YJ1 A;  3W9C B;  1RYJ A;  1P0R A;  2KFK A;  5CTR C;  4EEW A;  2NMQ A;  3VRA B;  4HK2 A;  1WGD A;  3EEC A;  2KT7 A;  2O6V B;  3NJT A;  4A90 A;  3Q69 A;  1GNU A;  1YQB A;  2CHW A;  1JWU D;  2JU6 X;  2PKO A;  3MHS D;  5G55 A;  1WR6 E;  3QCA A;  1WYG A;  2N9K A;  3DDC B;  2KTF A;  3FIL B;  2MBE A;  1P98 A;  1PQS A;  2IGG A;  2LVO A;  1V1P B;  1DOI A;  1NYQ A;  3R66 C;  4BVU C;  1HXY D;  3KH0 A;  1WGR A;  1FIQ A;  3HIZ A;  4F1S A;  2YEP B;  5L95 C;  2BKR B;  1YN4 A;  3IVF A;  2BS3 B;  4HJG E;  3KWL A;  3PO0 A;  4JGH B;  4FJY A;  1QOF A;  2C9W B;  2XN9 C;  4NQK E;  4MT5 A;  4XYC A;  4MGI E;  4EE2 A;  1Q0W B;  4A3P A;  4NAM A;  4ICV A;  1SJH D;  4JLC A;  5L83 A;  2MEK A;  4TSS A;  1TBE A;  2PPH A;  3BVG A;  4WUR A;  5CHF A;  4WWO A;  2XEW A;  1UGJ A;  4XWT A;  2N0S B;  4HJK A;  1YN3 A;  3L0W B;  4KGS A;  2ZNV B;  1KRH A;  1V1O A;  5FK9 C;  1I35 A;  3RYT A;  3AED B;  4RGN A;  4MJS B;  4BOZ B;  1N60 A;  2MW5 A;  2NBV B;  4G0N B;  5DPS A;  3VTW A;  5EE0 A;  1EWC A;  2ZPN A;  3T9L A;  1BML C;  1YNT E;  3WA0 A;  1F77 A;  3U52 E;  4C7Y A;  2LGI A;  4F7Z A;  1TKE A;  3PSE B;  2BVC A;  3DQV A;  3DBL I;  4LDT D;  1IP9 A;  3DHH C;  5CHW A;  4TQ0 A;  2K0P A;  2W9N A;  3A4R A;  1E7U A;  2C7M B;  1E6E B;  2N1V A;  4OZA A;  3EA6 A;  3P2B A;  2IJ0 A;  2KDF B;  5C2T B;  4DHZ B;  2MWS B;  1V86 A;  2GB1 A;  2E6X A;  2AQ1 B;  2NR2 A;  3RCZ A;  4FAD A;  3GZN B;  3MJ5 A;  2IGD A;  4Q2J A;  1SBB B;  1AN8 A;  1FNU A;  3H7S A;  2NTS A;  3L10 B;  2KQS A;  4WJN A;  4NZL B;  4S17 A;  3VVW B;  1I4G A;  2KDM A;  3AE8 B;  5HFY A;  2AWT A;  1FXA A;  5LLI A;  4XX5 A;  3Q8B A;  4ZRI A;  3U30 A;  1LXD A;  2FIF A;  2Z59 B;  2LGD A;  1XLN A;  3UIP B;  4AP4 C;  1P9D U;  1WMH B;  1DOY A;  2BTE A;  1RAX A;  3N9Y C;  4IUM B;  2ZCB A;  4RGM A;  1L0V B;  4ZOH C;  2CU3 A;  1K8R B;  2REX A;  3RMK C;  3WAM A;  2KK8 A;  3DBL B;  1ZUD 2;  5D94 A;  4M02 A;  3PLV A;  5CX3 A;  2EKE C;  2L32 A;  4MDK E;  3DCG A;  2DWQ A;  5D2M B;  1FFU A;  3TJP A;  3GE8 C;  2FID A;  4GU2 A;  3GB1 A;  4OW0 A;  3IT4 B;  1CMX B;  1D3Z A;  3EFU A;  2BWF A;  1OQY A;  3VTV A;  3JVZ X;  4MEM A;  4GSW A;  1FD6 A;  3SD5 A;  1XCT L;  1F2R I;  3NVV A;  1WF9 A;  1TGZ B;  4W9D A;  1V81 A;  1YD8 U;  3IAS 1;  1FCL A;  4DWF A;  1FRD A;  4ZDV A;  3NS1 A;  2HTH A;  3LXF A;  3V05 A;  5GMV A;  1OQQ A;  2BGF A;  1FO4 A;  3T8M A;  2MBH A;  2KXJ A;  1ZKH A;  2IDY A;  1KLG D;  4ASW C;  3WAP A;  1BUI C;  2KFK B;  2K8C A;  1NBF C;  3E9S A;  4MGZ E;  4N59 A;  5E6P A;  1TYG B;  3A33 B;  1XT9 B;  1L2N A;  4N9F 4;  1TY0 A;  4E74 A;  2WXJ A;  2NS5 A;  4WWM A;  1QF6 A;  5JXV A;  2D2Q A;  2N7J A;  3U4E G;  3VUX A;  3R2T A;  4K81 A;  1QT9 A;  1WRI A;  4MH0 E;  2LZ6 A;  4TKN A;  2MHJ A;  1KLU D;  4ANV A;  2MP2 B;  1VCB A;  3SEB A;  1GAQ B;  3PRM B;  1R7S A;  2GBM A;  5DPR A;  3RUI B;  4A20 A;  1FMA D;  1PGB A;  1WSP A;  2K3U A;  3AE4 B;  2XNA C;  3TSS A;  3NZU A;  2MH7 A;  2FNJ B;  1C1Y B;  3EFC A;  4W9H A;  1NYR A;  4M00 A;  2GOW A;  5JH5 C;  2AQ2 B;  5AUI A;  2W55 A;  3L13 A;  3PRP B;  4W9I A;  1A5R A;  1SIF A;  2L7R A;  1LFD A;  2Y5C A;  2CS4 A;  4HEA 1;  1UZX B;  3D32 A;  2L76 A;  3APF A;  1Q5W B;  1K52 A;  1ZDX A;  2KWU B;  4IW0 A;  1M4V A;  3PV1 A;  2IBI B;  3JSV A;  1GUA B;  3VUY A;  1YQ4 B;  2OHF A;  3BII D;  4X57 B;  3ZVV A;  1OGW A;  1HZ6 A;  1P1A A;  2L1A A;  2GMI C;  3HUI A;  2DYM A;  4K7U A;  1QLB B;  1KM7 A;  3P1M A;  1TS5 A;  3N1Z C;  2K8H A;  2QJL A;  3ZGZ A;  2FBW B;  2Z8L A;  2OED A;  1CZP A;  1T5X D;  2ZW0 A;  3CF6 E;  2DBY A;  3DHG C;  5G2N A;  4GOC A;  3PRZ A;  4AOF A;  4LLG M;  3ZW3 A;  5IA7 A;  4FA6 A;  1YX5 B;  1LQB A;  4EZJ A;  3QA8 A;  3BY4 B;  2DZM A;  5HI1 A;  4YTP B;  1E0Z A;  3H8H A;  5LXH A;  2KDI A;  3I57 A;  1RFK A;  3MP9 A;  1OEY J;  3IBE A;  3H7P A;  1J7B A;  4IDI A;  4FUL A;  2M0A A;  4C80 A;  2N7E A;  3IXS A;  2WDQ B;  2INC C;  3M3J A;  4IC7 B;  3DHI C;  4IM2 A;  2ZZP B;  5IAA C;  4WAF A;  3A1Q A;  3UIO B;  1DYQ A;  4KGT A;  4RF0 A;  1D4B A;  1OFF A;  3EC8 A;  2KN5 A;  3AE2 B;  2M0X A;  3N3K B;  1YOV B;  2WXL A;  3KUZ A;  4WQM A;  2R61 A;  1RFA A;  2DX5 B;  3ALB A;  4EZL A;  3SFE B;  4DXA B;  4DK5 A;  2KC1 A;  3KYC D;  4QAY A;  3RNC C;  1J8C A;  3BYY B;  3NRZ A;  1EF5 A;  2G1E A;  4LDT B;  3NOB A;  3UF8 A;  3DVN V;  2J0K A;  2K8B A;  1MPE A;  4G50 A;  4CHK A;  2WX1 A;  4BKS D;  1UUP A;  2D07 B;  1IUE A;  2JY6 A;  2FUH B;  1K50 A;  3Q6B A;  2JYT A;  5HKH A;  2V3S A;  4KGR A;  1L0X B;  3ENE A;  1TZ1 A;  1ZXH A;  3U7Z A;  3M95 A;  4KZC A;  4DHZ E;  4IWP A;  3PT2 B;  4XGA B;  3PTF C;  4ZRJ A;  3I5J C;  1EU3 A;  1A70 A;  4BOS C;  3BK2 A;  2L00 B;  3PVL A;  3AE1 B;  5EDS A;  2N9X A;  3P4P B;  1V97 A;  2BWE S;  4A3O A;  2LRW A;  5IKC M;  2KMA A;  3N1Y C;  1N63 A;  2KZR A;  1MHH E;  4KSL C;  4WQO B;  4IWO A;  2N9L A;  1NVI D;  2X38 A;  2LAS A;  4WWN A;  3SU8 X;  4IOI E;  1WJ6 A;  2LRU A;  4LNK A;  3WCQ A;  1SJE D;  3P4R B;  1Y8R C;  1P7F A;  3VHT C;  4HWI B;  1C78 A;  4WH4 A;  3RNB C;  1VLB A;  4FJV B;  1UEL A;  3V60 A;  2C7H A;  2X8X X;  4PT5 A;  4MEL A;  4II2 B;  1I4Q A;  1VR9 A;  2QIL A;  4YSY B;  2RSU A;  3WAN A;  1Q1O A;  4RMA A;  3P42 A;  1SGH A;  3ZLZ A;  2LGS A;  3CST A;  1NI2 A;  5EE1 A;  3VAW A;  3MC9 A;  1BT0 A;  3MFG A;  2KVR A;  4BKS A;  5HG2 A;  4C4V B;  1UF0 A;  2N9P C;  2NBU A;  1N5W A;  3Q8E A;  1ISN A;  2GBK A;  3VH4 B;  3DOW A;  5EE3 A;  4DDI D;  3NVY A;  1MJD A;  2MX2 A;  3PZ7 A;  2INN E;  4W9E A;  2M19 A;  3IHP C;  1PDX A;  1ZDV A;  2MJE A;  2A5U A;  3AU4 A;  1GB1 A;  2PIA A;  4RGT A;  4S0R A;  3NHE B;  2MA9 B;  1GB4 A;  4GIV A;  4HKQ A;  3QJZ A;  2RDB C;  2CU1 A;  3ZRF A;  3KWV A;  4TV3 A;  3ZNH B;  3BYT B;  1WGH A;  4M0W B;  2CKH B;  1RWS A;  1KJT A;  3DWG C;  2BF8 B;  1OQR A;  1JWM D;  3EUB 2;  2FCQ A;  3GZN I;  3R3M A;  4AWJ A;  1WI0 A;  3OLM D;  2FE8 A;  2N9E B;  4MH8 A;  2JZZ A;  3N1X C;  4ARC A;  4HRO A;  4ACF A;  3A9J A;  2EKI A;  4MGK E;  2KKC A;  2BS2 B;  5FKA C;  4TQ1 A;  4KZ0 A;  1RLF A;  3H7P B;  3RD2 A;  3W1Y A;  3ZIM A;  2WYQ A;  1XEE A;  1R4N I;  4L2Y A;  3P4Q B;  1JML A;  1V6E A;  4WAA A;  5GXG B;  1F0Z A;  1C3T A;  3A1Q B;  2MQJ A;  5KHO A;  3Q3M C;  2LJI A;  3ZXV A;  3A9K A;  3R7R A;  1K53 A;  5E6N A;  3SDL C;  1HTQ A;  1FXT B;  2LXA A;  4GXB A;  3MTN B;  2ZW1 A;  2RPQ A;  2K5P A;  2JX5 A;  2INP E;  4BBN C;  1AWD A;  5JHA A;  1GG3 A;  1IPG A;  4JL9 A;  3C8Y A;  2LVQ A;  3QAQ A;  3URY A;  4AUQ C;  3DBS A;  4JIO U;  2L83 A;  4HDO A;  2BPS A;  3UQA A;  3BIN A;  2QCZ A;  5JZE B;  2KLC A;  2BT6 A;  1IGD A;  4I6L B;  5LXI B;  4K7W A;  4B0M A;  1GJZ A;  2G45 B;  2WXO A;  4KV2 A;  1D5Z C;  3ZJU A;  4LNO A;  3RT3 B;  5D6J B;  4RM8 A;  2WP9 B;  1LGR A;  1XXG A;  2PLP A;  1FCC C;  3QX1 A;  4P1C C;  2V9H A;  2LHE A;  1C77 A;  3HVD A;  2AX5 A;  2WNM A;  1J0G A;  1X1M A;  3B08 A;  4NY0 A;  4HPP A;  4UDU C;  1R4N B;  2K6D B;  4AJW A;  1WM3 A;  3B1L X;  1SEB D;  2GRI A;  3E56 A;  4ZYN A;  2UWQ A;  1J19 A;  3Q3O C;  4ZHP A;  2MLB A;  3B2G A;  1QQR A;  1F52 A;  1V80 A;  2NVU I;  2WU2 B;  4US9 A;  1MHX A;  2WX0 A;  5BMG A;  3RZF A;  4BBN F;  4ZRP A;  2MRP A;  1WZ3 A;  3ZUN A;  2WDV B;  1JRO A;  2I1J A;  4MSM B;  1KFY B;  4RF1 A;  2UYZ B;  2LD9 A;  4ZRQ A;  2DEN B;  4YXD B;  1SSN A;  1E5W A;  2IY0 B;  3Q3F A;  5MPO A;  3VRB B;  3Q3J A;  4NAW B;  2PVG C;  2BYE A;  1HQR D;  3A4S C;  3GE3 C;  1QKZ A;  4IG7 B;  2AYO B;  1MI0 A;  2WQY B;  3ZXR A;  4H2A A;  1IYF A;  2JXT A;  1ROE A;  1FPY A;  1I4P A;  2KX3 A;  2M8S A;  4LJP B;  3TIX A;  4KDI C;  2EEL A;  4FXC A;  1C4A A;  2QHO A;  4KIK A;  1KLV A;  3ZTD A;  2KAJ A;  2UU7 A;  1WZ0 A;  3JW0 X;  4CO7 A;  2AL6 A;  1E90 A;  2MBQ A;  3DBH I;  5G5G A;  2DNF A;  3AE7 B;  1MG4 A;  3BK1 A;  4RM9 A;  5BO4 B;  5HHD G;  2KTR A;  3HM6 X;  2PJH A;  3VFK A;  2KDE B;  1TTN A;  2DAF A;  2WXR A;  3ONS A;  4HPM B;  2ZCC A;  1PGA A;  1WX8 A;  2H89 B;  2K9X A;  3AEF B;  4A8X C;  1HZ5 A;  2NCN A;  3PLU A;  4YSX B;  4EOY A;  1D5M C;  4NJ6 A;  2V3P A;  2G9H D;  1WX9 A;  3VDZ A;  3DVN U;  2KAC A;  2IO2 B;  1YJI A;  3CWI A;  1B9R A;  3W5U B;  3PZD A;  1HA5 A;  5AEK B;  2Q5W D;  3HM3 A;  3TEW A;  3TEX A;  3NS8 A;  3U7D A;  4DDG D;  4TMA B;  3LDZ E;  1TS2 A;  4XWW A;  4MM3 A;  1RRB A;  1T3Q A;  3TUO A;  2WDR B;  3L16 A;  3PRE A;  1T0R C;  1N6Z A;  1KH0 A;  3PS6 A;  2JPH A;  2WXQ A;  1HTO A;  2CHZ A;  1EU4 A;  3NY5 A;  3A9J B;  4B95 A;  2DHZ A;  3IT6 B;  2ZJD A;  2HDE A;  1ESF A;  3RN9 C;  3LB8 C;  3DBH B;  3FKY A;  2QDF A;  1JQ4 A;  1ACC A;  5BYQ A;  1L6V A;  2JWZ A;  4O1N A;  2O2V A;  1UH6 A;  2G4D B;  4OZC A;  1YQ3 B;  1MG8 A;  1UWX A;  4B6W A;  4KVG B;  3ZDT A;  1JWB D;  2JUO A;  1FRR A;  5BMI A;  1WXV A;  2ZVN A;  3C19 A;  4MAC A;  1SE3 A;  5J17 A;  5G5H A;  3WIM A;  3ZNI D;  4B0E A;  1JW9 D;  2MBB B;  1B1Z A;  1EO6 A;  2L05 A;  4PS8 A;  1Z5S B;  3AN1 A;  3A9K B;  2V1Y A;  1ZOY B;  4HXD A;  4N58 A;  1NEN B;  4YL8 A;  2VZK D;  2LEK A;  1WY8 A;  2L52 A;  2FAZ A;  2ZEQ A;  4NPN A;  1WGK A;  3LJ3 A;  1WJ4 A;  3ABV B;  3Q3N C;  3AE9 B;  1C4C A;  3MC8 A;  5KHQ A;  4DXF A;  4GDL A;  2N1W A;  3V61 A;  3ZYY X;  3VTU A;  5LNK 1;  4YWG G;  4I6P A;  1ET9 A;  2FCN A;  3MC0 B;  4IM3 A;  3N20 C;  4MGY E;  3L4P A;  3VH3 B;  3PPA A;  3QQ8 B;  3RI7 C;  4AJY B;  3PHW B;  1FM0 D;  2V3N A;  3L08 A;  4YSZ B;  3RZW C;  4N6E B;  3HRD D;  2MJ3 A;  4P6V F;  4BKT A;  2LUM A;  4IKG A;  2G4S A;  1AYF A;  1STE A;  3AH7 A;  4BAX A;  5C3J B;  2D3C A;  1WE6 A;  4W9G A;  2J4X A;  2CR5 A;  4HDQ A;  2DAJ A;  4ARI A;  2LHD A;  2C5L C;  2NTT A;  4K1R B;  2WXK A;  1GPX A;  3Q8A A;  1JAL A;  4HRS A;  5IN7 A;  4NJC A;  1S3S G;  2ONQ A;  1LO5 D;  3CIR B;  2I1K A;  3TEY A;  4XDD A;  5J2R A;  5H8Y E;  4CQN A;  1WX7 A;  3H9D A;  1WJN A;  1Q10 A;  3AU5 A;  4J6I A;  2BQQ A;  5BYS A;  1JRU A;  4W9J A;  3SFD B;  2RR9 A;  1TS3 A;  3ZNG C;  4USA A;  2MSE D;  2JVC A;  3IG3 A;  4OVU A;  1WGG A;  2WXN A;  3K9P B;  1L4Z B;  2JSV X;  3KVF B;  3AE5 B;  3AEE B;  1UWM A;  3VXW A;  2B76 B;  5DCN A;  2EMS A;  2R2O A;  2PMV A;  1T6B X;  3VR8 B;  1HE8 A;  4OHJ A;  3DPD A;  3K9O B;  2IZV B;  2M17 A;  4FHK A;  3X0W A;  4KKI A;  2DZI A;  2KDB A;  3HK0 A;  1F2R C;  1XLQ A;  3QHT A;  4L1B A;  1UGM A;  2PW9 A;  4A55 A;  1T0S C;  3AEB B;  4YT0 B;  2E3T A;  1ET6 A;  1N5X A;  3SR6 A;  2GI9 A;  4PS7 A;  4BZA A;  2PE6 B;  1R4M I;  1E8Y A;  1XD3 B;  2JYE A;  1E9M A;  2KNB A;  3VQI A;  3VUW A;  1XLP A;  2MBO A;  2CHX A;  2KTR B;  2G3Q B;  1C9F A;  1WJU A;  5E6J A;  2IO3 B;  4MSQ B;  2J42 A;  3PHX B;  3NG0 A;  3AE3 B;  4FN2 A;  3I3T B;  2K39 A;  2LI5 A;  1T0Y A;  4WJO A;  1OEY A;  2KC2 A;  4P1B C;  5AUK A;  3B9J A;  2M56 B;  2N4F A;  1WXQ A;  3OG5 A;  4JE3 B;  1V5O A;  3APD A;  1NEK B;  1OTR B;  2N7D A;  2DYB A;  5DPW A;  2YLM A;  2C7N B;  1IBX A;  1P7E A;  1V2Y A;  4HVB A;  2XK5 A;  2NBW B;  3GP7 A;  3U2S C;  1TY2 A;  1L5P A;  1PGX A;  2KN4 A;  3FC4 A;  2LVP A;  4MM3 B;  1TIF A;  4C7Z A;  1KOT A;  1E8Z A;  2PE9 A;  3NVZ A;  1TKG A;  3Q8C A;  1WWT A;  3DBR B;  2KLG A;  3TBL D;  1GC7 A;  2HJ8 A;  3BVZ A;  3B0A A;  3VR9 B;  1C76 A;  1SIJ A;  3QIJ A;  1R4M B;  2WXF A;  3R7Q A;  4C56 C;  1SF0 A;  4NJ7 A;  1I4R A;  3JSV B;  4HKZ E;  2Y5B B;  2PEA A;  2IND C;  3P63 A;  4AQ7 A;  5AZH A;  2BYV E;  2KO3 A;  2I38 A;  3EHV A;  4US8 A;  2D3B A;  1ZP0 B;  2AL3 A;  4PYU A;  3ZJT A;  3OJ4 B;  2WGS A;  2LXC A;  2O2V B;  1VZ6 A;  2WU5 B;  3V3X A;  4LK0 M;  2JWU A;  2CJN A;  4RH6 A;  4EUT A;  4RFB A;  1G6J A;  1AW7 A;  1LM8 B;  3AXC A;  2ZVO A;  2MP2 A;  4URK A;  3RNE C;  3W1S C;  4K3B A;  2W54 A;  4PS3 A;  1WXA A;  4YTM B;  5TSS A;  1K51 A;  2WXM A;  2V0G A;  1WR1 A;  3T3O A;  4BKG A;  1EM7 A;  4C00 A;  4JPS A;  1H8C A;  3Q8F A;  3EGR A;  1FNV A;  1YJJ A;  1ZW7 A;  5BMH A;  4EKU A;  2JRH A;  4LNF A;  2KD0 A;  4R3D A;  3ZJV A;  2RPV A;  3O65 B;  2K1F A;  2VRR B;  2KVZ A;  4IWQ A;  4GDL B;  3OJ3 A;  4FHJ A;  4YTN B;  4E3C A;  2K25 A;  3RFZ B;  3X23 A;  4JWU C;  5FR3 A;  3N32 A;  1MVK A;  3ECI A;  2BYF A;  3CSF A;  3L54 A;  4RNA A;  2WWZ A;  1NDD A;  2D3G A;  4XZ4 A;  2IY1 B;  2Z0D B;  1M94 A;  2KQ4 X;  4P7I A;  1FNW A;  1XO3 A;  1QZE A;  2VH1 A;  2D5G A;  1YIW A;  4XE0 A;  2B3A A;  2KX0 A;  3AM9 A;  3Q14 C;  4JWS C;  3TCA A;  3W5V B;  2FCS A;  2FCM A;  1QOB A;  2ZPY A;  1VJK A;  1WXM A;  2EMT A;  1FEH A;  2NPT A;  3IFW B;  2IGH A;  2LJ5 A;  4ZRK A;  4TUU A;  4CYE A;  3AE6 B;  2DZK A;  3P4S B;  2PVO D;  1I7H A;  5AZF A;  4J3O D;  2D11 A;  2KHW B;  2QIE B;  3AEC B;  3H6N A;  2V4I B;  4W9K A;  4KDL B;  3U8Z A;  3ZNZ B;  1Y56 A;  2OJR A;  1EF1 A;  1L4D B;  1QIL A;  4JX1 C;  4K3C A;  4HCN B;  5D3D A;  1QOA A;  3KQ4 A;  4DXG A;  3RNG C;  4PK1 A;  2ASQ A;  1L0Y B;  2DZJ A;  3AB5 A;  2KWV B;  1PYW D;  2VZK B;  2L8J A;  3NUH B;  4JQW C;  1U4A A;  2K22 A;  1XCQ L;  4PYZ A;  4KSK C;  1TJE A;  2RDG A;  5CHV C;  3WAL A;  4DHJ D;  4M8N A;  4GB9 A;  1VDV A;  3ZO5 B;  1SXT A;  2HJ1 A;  3TMP B;  1FXI A;  1TKY A;  1BXT A;  3HVZ A;  1AAR A;  4ICU A;  4ANU A;  4ANX A;  2Y5P A;  3W1S A;  4LTU A;  1UNS A;  4EFO A;  3HHM A;  3ETR A;  3OWE B;  3UGB B;  3AUL A;  1I4H A;  4ZHO A;  4G3X B;  2GBN A;  4KX6 B;  1ENF A;  2WXI A;  2GBR A;  3ZKJ C;  4HLE A;  2K6Q A;  3BWU D;  1FFV A;  2YVC A;  3KLS X;  3V6C B;  2I2Y A;  1P3Q U;  1HEZ E;  2D3A A;  1VZ7 A;  4WWP A;  2JZ3 B;  3AEG B;  2O6V D;  1D6E C;  2J53 A;  2OJW A;  4HCP B;  5JHB A;  3MJW A;  4L23 A;  2JRI B;  1UBI A;  1IBX B;  4G11 A;  1IGC A;  2KFJ A;  2HTM E;  3AI5 A;  4I6N B;  2JT4 B;  2XK5 B;  1T0Q C;  3KUD B;  4NNJ B;  1YMH E;  2M4N A;  1SE9 A;  3C0R B;  2HD5 B;  1XLO A;  1WGY A;  2LUE A;  1WM2 A;  3QK0 A;  3H1U A;  3R2I A;  3N30 A;  3FAH A;  2ZNV C;  2SEB D;  4GDK A;  1RM6 C;  1E8W A;  3IAM 1;  3J9C A;  2IO1 B;  4HPL B;  5DPT A;  3I9V 1;  5C23 A;  5IP4 D;  2FUG 1;  5J18 A;  2VH2 A;  2KAN A;  2BB6 A;  5D3I B;  1V49 A;  2RDH A;  4II3 B;  3GOE A;  2JXX A;  1ZGU B;  1KF6 B;  4RGO S;  3SHQ A;  2YEP F;  3ZRC A;  4W9L A;  2KMC A;  3NZ3 A;  1VRA B;  2KWD A;  2DYO A;  3O13 A;  1H4R A;  3PGE A;  3Q2A C;  3T3N A;  1V5T A;  2RD0 A;  2AQ3 B;  2KJR A;  2Z0E B;  3RPF C;  4A6Q A;  3BVM A;  4B9K A;  3L17 A;  4NQL B;  5AZG A;  3NVW A;  2WS3 B;  5FR6 A;  5E6O A;  4C4V A;  3RUL A;  1MFW A;  2O6V A;  2RGF A;  3M62 B;  4K7S A;  2GBJ A;  2J0M A;  3MHZ A;  3ZQ4 A;  4WJQ A;  2W82 A;  4LNN A;  2L3Z A;  1V8C A;  2HE7 A;  2M1M A;  1TT5 B;  3RNF C;  1YX6 B;  1E7V A;  1C4P A;  2JQR B;  3APC A;  3FIL A;  3OAW A;  3R8B A;  3UQB A;  1S1Q B;  2BS4 B;  2WXH A;  1V1P A;  2KJ6 A;  4FJZ A;  2D10 A;  1WIA A;  2MCN B;  4ANW A;  1GOZ A;  1JRP A;  3AV8 A;  2J52 A;  2KYW A;  2WHI A;  2L0F A;  3BZD B;  4DQO C;  2WXG A;  3I63 C;  2BYT A;  4W9F A;  3DVG Y;  3ML8 A;  4M0W A;  3AEA B;  2ICI A;  3QAR A;  4XC2 A;  1UD7 A;  1SB3 C;  3W2D A;  3RNA C;  4EZK A;  4IM0 A;  3KYD D;  5D7G A;  1QOG A;  2NPT B;  1Z2M A;  4BFR A;  1N62 A;  1F1H A;  4GLS C;  4GGQ A;  1TZO A;  1JWS D;  2BW2 A;  2QEJ C;  1L7Y A;  2WLB A;  4ZYS A;  3ML9 A;  1EWY C;  4XDC A;  2DLB A;  3V6E B;  2IO0 B;  2W3R A;  3UIN B;  2JZP A;  1KTK A;  1NI3 A;  1WE7 A;  4MJS A;  2R2Q A;  1ZE3 D;  4OZB A;  3PZ8 A;  1XQQ A;  4OVV A;  3LYY A;  1VD2 A;  2J7Q B;  2QSD A;  1F9J A; 
#chains in the Genus database with same CATH homology
 1TY0 A;  3GP7 A;  2L83 A;  3U2S C;  1J7C A;  1TY2 A;  1L5P A;  2WXJ A;  2CJO A;  1PGX A;  4WWM A;  2KN4 A;  1QF6 A;  5JXV A;  3FC4 A;  2N7J A;  3U4E G;  4MM3 B;  4C7Z A;  3R2T A;  1DOX A;  1QT9 A;  2BT6 A;  1IGD A;  1WRI A;  4B0M A;  1KLU D;  3NVZ A;  1TKG A;  2WXO A;  1JCK B;  3Q8C A;  1WWT A;  5I4D A;  2H88 B;  2PTL A;  3SEB A;  1XF5 L;  2TSS A;  1D5Z C;  3ZJU A;  2LFI A;  1GAQ B;  3BVZ A;  1R7S A;  1J7A A;  3VR9 B;  1C76 A;  1SIJ A;  1FMA D;  2WP9 B;  1VZ8 A;  2WXF A;  1XXG A;  1PGB A;  1PUT A;  1SF0 A;  2PLP A;  2QMT A;  1I4R A;  1FCC C;  4HKZ E;  4C56 C;  1WSP A;  1N61 A;  2K3U A;  2LHE A;  3AE4 B;  1C77 A;  4P16 A;  2ACZ B;  3P63 A;  2XNA C;  3TSS A;  4AQ7 A;  3HVD A;  4OVZ A;  3TEZ A;  2AX5 A;  2I38 A;  5H92 C;  4US8 A;  2MH7 A;  2SAK A;  1ZP0 B;  1I4X A;  3ZJT A;  1L6U A;  2WNM A;  2ON8 A;  1VZ6 A;  2WU5 B;  1NYR A;  3V3X A;  4UDU C;  4REZ A;  4LK0 M;  2JWU A;  1SEB D;  2GRI A;  2CJN A;  3E56 A;  4RH6 A;  4RFB A;  5T8I A;  2AQ2 B;  3UI3 A;  1AW7 A;  1YN5 A;  2W55 A;  5AUI A;  4ZHP A;  3B2G A;  1QQR A;  2BB5 A;  2Y5C A;  4HEA 1;  2WU2 B;  4US9 A;  2W54 A;  1K52 A;  1MHX A;  1ZDX A;  4YTM B;  1M4V A;  5TSS A;  1K51 A;  5BMG A;  2WXM A;  2V0G A;  3GS2 A;  4ZRP A;  1DGJ A;  2WDV B;  3T3O A;  1TS4 A;  1EM7 A;  1JRO A;  1YQ4 B;  2OHF A;  4JPS A;  3BII D;  1CQV A;  1KFY B;  3Q8F A;  3EGR A;  4KKJ A;  1FNV A;  1HZ6 A;  4RF1 A;  2W3S A;  1E7P B;  2L1A A;  1E10 A;  3HUI A;  2DYM A;  1YJJ A;  4ZRQ A;  5BMH A;  1QLB B;  4D2K A;  3P1M A;  1TS5 A;  2QJL A;  3B2F A;  4YXD B;  4R3D A;  3ZJV A;  1SSN A;  2RPV A;  3ZGZ A;  2FBW B;  2Z8L A;  1D5X C;  5MPO A;  1PFD A;  4GDL B;  3VRB B;  4RCO A;  3AMZ A;  4YTN B;  4NAW B;  3RFZ B;  2PVG C;  2OED A;  1ZPS A;  4JWU C;  5FR3 A;  1CZP A;  1HQR D;  1MVK A;  2IPK D;  1QKZ A;  2BBC A;  2ZW0 A;  4GDK B;  4AS1 A;  1MI0 A;  2DBY A;  2WQY B;  2LMC A;  4H2A A;  4RNA A;  2JXT A;  1CK1 A;  2KMM A;  1ROE A;  1I4P A;  4LLG M;  2KQ4 X;  2EEL A;  4FXC A;  1FNW A;  1XO3 A;  1C4A A;  4ITK A;  3DWM A;  5EE9 A;  1SE4 A;  2KAJ A;  2Y3A A;  2RMM A;  5BYR A;  2D5G A;  4XE0 A;  5HI1 A;  2MJD A;  4JWS C;  3AM9 A;  4A9A A;  4YTP B;  5G5G A;  1E0Z A;  3H8H A;  3AE7 B;  3W5V B;  3I57 A;  1RFK A;  3MP9 A;  3BK1 A;  1QOB A;  5HHD G;  1VJK A;  1J7B A;  4IDI A;  4C80 A;  2M0A A;  1FEH A;  3IXS A;  1ZXI A;  2IGH A;  2WDQ B;  3AE6 B;  4WIP A;  3P4S B;  1SE2 A;  1I7H A;  2PVO D;  4J3O D;  3AEC B;  2QIE B;  2WXR A;  2WXP A;  1JWA D;  1PGA A;  2H89 B;  2K9X A;  2V4I B;  3AEF B;  4A8X C;  4WAF A;  1CJE A;  1HZ5 A;  1C79 A;  4YSX B;  1Y56 A;  1D5M C;  1DYQ A;  2V3P A;  3W9C B;  1L4D B;  1QIL A;  4JX1 C;  1RYJ A;  4KGT A;  4RF0 A;  2G9H D;  1D4B A;  5D3D A;  1OFF A;  2NMQ A;  1QOA A;  3VRA B;  3KQ4 A;  4DXG A;  2KAC A;  1YJI A;  4A90 A;  3AE2 B;  3Q69 A;  1L0Y B;  3AB5 A;  3CWI A;  1B9R A;  2WXL A;  4WQM A;  3W5U B;  1PYW D;  1HA5 A;  2R61 A;  2Q5W D;  2VZK B;  1JWU D;  3TEW A;  3NUH B;  2JU6 X;  3SFE B;  3TEX A;  2PKO A;  2K22 A;  1XCQ L;  1TJE A;  2RDG A;  1WYG A;  2N9K A;  3BYY B;  4TMA B;  3FIL B;  1TS2 A;  4XWW A;  3NRZ A;  2IGG A;  1T3Q A;  1VDV A;  2G1E A;  2WDR B;  1SXT A;  3TUO A;  1V1P B;  1MPE A;  1FXI A;  1DOI A;  1NYQ A;  1BXT A;  1TKY A;  3HVZ A;  1KH0 A;  1HXY D;  2WXQ A;  2Y5P A;  1FIQ A;  3W1S A;  2YEP B;  1UUP A;  1IUE A;  1EU4 A;  1YN4 A;  4LTU A;  2BS3 B;  1UNS A;  4HJG E;  3KWL A;  3IT6 B;  2HDE A;  1ESF A;  1K50 A;  3ETR A;  3OWE B;  3LB8 C;  1I4H A;  3PO0 A;  2JYT A;  1QOF A;  4ZHO A;  2XN9 C;  1JQ4 A;  1ACC A;  5BYQ A;  1L6V A;  4MT5 A;  4KGR A;  4O1N A;  4EE2 A;  1L0X B;  4KX6 B;  1ZXH A;  4NAM A;  3U7Z A;  1ENF A;  1YQ3 B;  2WXI A;  4OZC A;  1UWX A;  1SJH D;  2MEK A;  3BWU D;  4TSS A;  1JWB D;  1FFV A;  1FRR A;  5BMI A;  3KLS X;  2I2Y A;  3BVG A;  4WUR A;  1EU3 A;  1HEZ E;  4MAC A;  1SE3 A;  1A70 A;  1UGJ A;  4XWT A;  5G5H A;  4B0E A;  1JW9 D;  1VZ7 A;  2N0S B;  1B1Z A;  1YN3 A;  3BK2 A;  3AE1 B;  4KGS A;  3AEG B;  3P4P B;  1KRH A;  1V1O A;  5FK9 C;  1D6E C;  1V97 A;  2J53 A;  3AED B;  3AN1 A;  4RGN A;  1ZOY B;  1N63 A;  4N58 A;  1MHH E;  1NEN B;  1N60 A;  2N9L A;  2VZK D;  2LEK A;  5EE0 A;  4L23 A;  1EWC A;  1NVI D;  2L52 A;  1BML C;  1YNT E;  2X38 A;  1F77 A;  4IOI E;  1IBX B;  3WCQ A;  3U52 E;  1IGC A;  4C7Y A;  2HTM E;  1SJE D;  1WGK A;  3P4R B;  2LGI A;  1TKE A;  1P7F A;  3ABV B;  1YMH E;  1C78 A;  3AE9 B;  4WH4 A;  1VLB A;  1C4C A;  1XLO A;  4PT5 A;  1I4Q A;  4DXF A;  3R2I A;  3ZYY X;  5LNK 1;  4YWG G;  1VR9 A;  2QIL A;  4TQ0 A;  3FAH A;  4YSY B;  1ET9 A;  3MC0 B;  2K0P A;  2SEB D;  3L4P A;  3P42 A;  1RM6 C;  1E6E B;  3IAM 1;  3J9C A;  1FM0 D;  3I9V 1;  4OZA A;  3EA6 A;  5EE1 A;  2IJ0 A;  2V3N A;  2FUG 1;  5C2T B;  4YSZ B;  3MFG A;  4N6E B;  3HRD D;  5HG2 A;  2MJ3 A;  2BB6 A;  5D3I B;  4P6V F;  2LUM A;  2GB1 A;  2E6X A;  2AQ1 B;  4IKG A;  1AYF A;  1N5W A;  3Q8E A;  1STE A;  2RDH A;  3AH7 A;  5C3J B;  3MJ5 A;  5EE3 A;  1KF6 B;  2IGD A;  2J4X A;  4Q2J A;  4RGO S;  1SBB B;  1AN8 A;  1FNU A;  4ARI A;  2LHD A;  2NTS A;  2NTT A;  2WXK A;  2YEP F;  1GPX A;  3Q8A A;  3NVY A;  1JAL A;  4HRS A;  4NZL B;  4NJC A;  1I4G A;  2KDM A;  2ONQ A;  3AE8 B;  3NZ3 A;  1VRA B;  5HFY A;  1LO5 D;  3CIR B;  1FXA A;  2KWD A;  3PZ7 A;  2DYO A;  2INN E;  3Q8B A;  3TEY A;  3O13 A;  4XDD A;  5H8Y E;  3T3N A;  2AQ3 B;  2M19 A;  4CQN A;  1Q10 A;  1XLN A;  1PDX A;  1ZDV A;  3RPF C;  2MJE A;  5BYS A;  4A6Q A;  3BVM A;  3SFD B;  1TS3 A;  1GB1 A;  3NVW A;  1DOY A;  2BTE A;  2WS3 B;  2PIA A;  3N9Y C;  4RGT A;  4USA A;  4RGM A;  1L0V B;  4ZOH C;  1GB4 A;  2CU3 A;  2WXN A;  4HKQ A;  1L4Z B;  2JSV X;  3KWV A;  3AE5 B;  3AEE B;  3BYT B;  1UWM A;  3MHZ A;  1ZUD 2;  3ZQ4 A;  2W82 A;  2B76 B;  2L32 A;  1V8C A;  1RWS A;  2PMV A;  1T6B X;  3DWG C;  2DWQ A;  3VR8 B;  1FFU A;  4OHJ A;  2JQR B;  1C4P A;  3FIL A;  1OQR A;  3R8B A;  4KKI A;  1JWM D;  3EUB 2;  2BS4 B;  2WXH A;  1V1P A;  4OW0 A;  3GB1 A;  3IT4 B;  1F2R C;  1XLQ A;  4L1B A;  2FE8 A;  4MH8 A;  2PW9 A;  4A55 A;  1GOZ A;  1JRP A;  3AV8 A;  4ARC A;  2J52 A;  4HRO A;  3AEB B;  4YT0 B;  2E3T A;  3BZD B;  1ET6 A;  4DQO C;  1N5X A;  3SR6 A;  2WXG A;  2GI9 A;  2BYT A;  2EKI A;  1FD6 A;  1XCT L;  4M0W A;  2BS2 B;  3AEA B;  2ICI A;  1F2R I;  3NVV A;  5FKA C;  2JYE A;  1SB3 C;  3W2D A;  4TQ1 A;  3IAS 1;  1FCL A;  1E9M A;  5D7G A;  1FRD A;  3VQI A;  3NS1 A;  1XLP A;  1QOG A;  3LXF A;  3V05 A;  1C9F A;  1N62 A;  1XEE A;  1OQQ A;  4L2Y A;  3P4Q B;  4GLS C;  1FO4 A;  1JML A;  1JWS D;  1TZO A;  2BW2 A;  2QEJ C;  5E6J A;  2WLB A;  2J42 A;  4ZYS A;  5GXG B;  1F0Z A;  3AE3 B;  1EWY C;  4XDC A;  2IDY A;  1KLG D;  2DLB A;  2LJI A;  1BUI C;  2W3R A;  5AUK A;  1K53 A;  3B9J A;  2JZP A;  1KTK A;  1NI3 A;  2M56 B;  1WXQ A;  4JE3 B;  1ZE3 D;  2ZW1 A;  2K5P A;  3E9S A;  4OZB A;  3PZ8 A;  2JX5 A;  4N59 A;  1NEK B;  2INP E;  1AWD A;  1TYG B;  3LYY A;  1IBX A;  1P7E A;  3C8Y A;  3URY A;  2QSD A;  1T5X D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...