1HEZE

Antibody-antigen complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex between Peptostreptococcus Magnus Protein L and a Human Antibody Reveals Structural Convergence in the Interaction Modes of Fab Binding Modes
pubmed doi rcsb
molecule tags Antibody
molecule keywords KAPPA LIGHT CHAIN OF IG
total genus 15
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hezE00
4KGRA 2I38A 2KACA 2N7JA 1FCCC 1XF5L 2J52A 5HFYA 1IBXB 2KQ4X 2ZW0A 2OEDA 1YNTE 2J53A 5HHDG 1HZ6A 4HJGE 1FCLA 3FILB 5JXVA 5BMHA 1IBXA 1XCQL 1GB1A 1MVKA 4GLSC 1Q10A 4HKZE 2PLPA 1JMLA 2PTLA 1F2RI 2PW9A 3FILA 4OZBA 1K53A 5BMGA 2RMMA 2K0PA 2GI9A 5HI1A 4KGTA 3V3XA 1KH0A 2KWDA 4OZCA 1K50A 4MACA 2JZPA 4KGSA 1MI0A 2JSVX 1D4BA 1C9FA 1HEZE 1PGXA 1F2RC 1MPEA 1P7EA 2LHEA 3UI3A 2KN4A 2IGGA 1K52A 1IGDA 1P7FA 2IGHA 2NMQA 2I2YA 1ZXHA 2N9LA 1GB4A 2ONQA 4OZAA 4IOIE 1FD6A 2ZW1A 1PGBA 4D2KA 1HZ5A 2LGIA 1K51A 2KDMA 2JXTA 1PGAA 2N9KA 2LUMA 1YMHE 1MHHE 3MP9A 2IGDA 2QMTA 5BMIA 4WH4A 1UWXA 2ON8A 2RPVA 2JU6X 2LHDA 5HG2A 1EM7A 4IKGA 2GB1A 1MHXA 2EELA 3GB1A 1QKZA 1XCTL 2JWUA 2QSDA 1IGCA
chains in the Genus database with same CATH superfamily
2I38A 2KTFA 3TCAA 2WS3B 1ZGUB 2Y5BB 2I1KA 1WSPA 1UD7A 3C0RB 2RD0A 1V5TA 2CJNA 3VRAB 2C60A 2G9HD 3I3TB 1WGYA 2N9EB 4NJCA 4FJYA 2RPQA 2BB6A 3RD2A 4NZLB 1KFYB 3H8HA 1AYFA 3RZFA 3V3XA 1WH3A 3AEFB 2Y5CA 3UIPB 3JSVB 1I4QA 2V0GA 2LEKA 3U7ZA 3KUDB 1HEZE 2M4NA 4LLGM 4OW0A 3IVFA 1KLVA 1ZP0B 1FFUA 1WXQA 2KFKB 4B9KA 3Q69A 1X1MA 2KX0A 4EZLA 1KOTA 1HTOA 2PE9A 3WAMA 4US9A 2KJ6A 2WYQA 2ACZB 2LXAA 3PVLA 4HCPB 1WMHA 2WXLA 5CHFA 3CMMB 4DXFA 1YJIA 3P4QB 1QLBB 2KX3A 2H89B 2K6QA 1NYRA 2UWQA 3M95A 2V4IB 3ZO5B 2KTRA 3KUCB 4IWOA 1TZOA 2MHJA 4EFOA 1T0RC 2KJHB 3AMZA 3NS1A 1YOVB 3AH7A 1TGZB 2KK8A 4PK1A 2QJLA 3P1MA 1HE8A 4KGRA 3CF6E 3NOBA 2KLGA 3QHTA 3DBLB 2OEDA 1YNTE 1DGJA 4P6VF 3RNCC 5EDSA 2N1VA 3B2FA 4HVBA 1EWYC 5C2TB 1RRBA 1ZXIA 1LFDA 2Z0EB 4BBNF 4W9FA 1V86A 1EWCA 3ZYYX 3TUOA 1GAQB 4HWIB 4HRSA 4HEA1 2WDRB 1SE9A 2RMMA 1SEBD 1E5WA 2TSSA 4P1BC 2LVOA 4IM2A 2UYZB 2MBHA 4BKSA 5I4DA 2HE7A 3A33B 2AL3A 1VZ6A 4RMAA 1E90A 4JE3B 1ET9A 2R61A 3SDLC 2KDIA 2IJ0A 3DCGA 2V1YA 4HPPA 5HKHA 3ZNGC 5CHWA 2KT7A 4BBNC 3ZNZB 2LGYA 2M56B 2NR2A 4N59A 1F2RC 4HXDA 3AE7B 2LHEA 1F9JA 1E7VA 4EZJA 1WJUA 4M01A 1J0GA 1C76A 3OJ4B 1PDXA 2CJOA 1E6EB 4N6EB 3RFZB 4M0WB 4I6NB 2WXRA 4WAFA 3ENEA 4ZDVA 1YMHE 3MP9A 5BMIA 1WR1A 2D10A 3VR9B 2YEPF 1UWXA 3HUIA 1P98A 4OVVA 4TMAB 1OEYA 2A5UA 1KF6B 3GE3C 3DBHB 2WXMA 3HRDD 1WRIA 2JWUA 5GXGB 3RI7C 3UGBB 2K9XA 2KQ4X 2G1EA 4DWFA 2N7DA 2FAZA 2DZJA 4NPNA 4C7YA 2L05A 2FCNA 1UGMA 2IY1B 1IBXA 3KLSX 2K6DB 4B0MA 2W9NA 2LASA 5L83A 3ZJVA 3RNBC 4L23A 3AULA 1JMLA 2K22A 1F52A 2BWFA 2DNFA 3KW5B 2PEAA 2VH1A 1JW9D 1UELA 2AQ1B 1E7UA 2XEWA 1L0XB 2KWDA 1K50A 3H6NA 1ZPSA 5E6OA 1IYFA 1YIWA 5AEKB 3GZNB 1Y8RC 1F1HA 1E7PB 2KN4A 1V1OA 4LDTB 3PZ7A 1ZDVA 2KOXA 3BYYB 5AZFA 3SEBA 2QHOA 2LRUA 3PO0A 2XN9C 4GN1A 2BWES 2KWCA 2MJDA 1QT9A 4KX6B 1T0YA 3AE9B 4K3BA 3Q8FA 4LNOA 4D2KA 2MP2A 1XQQA 4W9EA 3QWZB 3R3MA 1JRUA 1GC6A 2BBCA 1GUAB 2BYTA 2G3QB 2YVCA 1XXGA 2QCZA 3ECIA 4FBJB 4GDKA 1GNUA 4M02A 2LI5A 2KQSA 3IXSA 2PJHA 3VDZA 5C3JB 2HJ8A 3AM9A 4KZ0A 1I4XA 4NJ7A 5G55A 5J2RA 2JWZA 1ZDXA 2OHFA 2M17A 4OHJA 4W9GA 1SIJA 1AN8A 2MH7A 2BS3B 3L10B 2GBKA 2LWPA 3VUYA 1BMLC 2KACA 3DVNV 1WYWB 2NPTB 1XEEA 4WWNA 2H88B 5FKAC 3PRMB 1WZ0A 1CMXB 3EUB2 3GZNI 3UF8A 4QAYA 3Q3MC 2NCNA 5FR6A 2KLCA 2KQ7A 4XGAB 1F77A 4PYZA 4ARIA 2RDGA 3QARA 3CSTA 3GE8C 1F2RI 2KC2A 1TS2A 3A9JB 1ACCA 3O13A 1J8CA 1IP9A 2KMCA 3X0WA 2J42A 3AE8B 2HD5B 4LNFA 3RNAC 2KANA 4ANXA 4DK5A 1WGDA 1L4DB 1MPEA 3QC8B 2O6VA 4N58A 1WM3A 2MCNB 2JF5A 1P7FA 1C4CA 3ABVB 2J0MA 3V05A 2BW2A 4AP4C 3EFUA 2CHZA 2W82A 4ZYNA 4JGHB 2M0XA 1HZ5A 4NAMA 1FXIA 1S1QB 4ZRJA 2JXTA 1E9MA 2BB5A 1UH6A 3WA0A 1IUEA 3NZUA 3ZDMC 1MHHE 1RYJA 3URYA 2IGDA 2QMTA 3GS2A 1TY0A 1QOAA 4FLHA 2AX5A 4W9KA 4LNIA 1R7SA 2QIEB 3TEZA 5EE3A 4A20A 3DHGC 3RNGC 1SGHA 4B0EA 3N1YC 1A70A 1I7HA 4K7WA 4AWJA 4YL8A 1WYGA 2REXA 4K81A 4C4VA 3T9LA 4PS8A 2K1FA 4E74A 2FCSA 4DDID 5AZHA 5JH5C 2J52A 1C77A 3NRZA 3AEEB 1YJ1A 1TS3A 3JW0X 3CSFA 1M94A 1T3QA 4F1SA 4LCDE 3RMKC 4ZYSA 3A9JA 2WDTB 2ZNVC 4GLSC 1L5PA 1E0ZA 4XYCA 3ZKJC 2L52A 4OZBA 2W3RA 3I63C 1QZEA 2KFJA 4C00A 1FFVA 1ISNA 1JROA 3VUXA 1TTNA 4LNKA 1WJNA 5DPWA 5BYRA 3L13A 2O6VB 5IP4D 4TV3A 1VJKA 4O1NA 3VTVA 3Q8EA 4XZ4A 2FE8A 2RDHA 2VH2A 2KC1A 2MBBB 3KWLA 5JHAA 2BPSA 3N3KB 4MT5A 1SXTA 4GDLB 3PZDA 3RNFC 3VAWA 2JXXA 4CHKA 1TS5A 2LGIA 3NVZA 2PIAA 3ZGZA 1KM7A 2MQJA 3W1SA 2WXFA 2WXPA 4K7SA 4A6QA 1TKGA 3AE2B 3AI5A 4XE0A 1C3TA 3ZVVA 2L0TA 2MX2A 3ZJUA 2ZEQA 3IAM1 4XC2A 2KDBA 1JQ4A 3HK0A 1VZ7A 4K3CA 2HDEA 2M1MA 3W1YA 3J9CA 2KKCA 2VZKB 2D11A 3WANA 1GOZA 4G0NB 3I9V1 2C7HA 1EF5A 1Q1OA 1XT9B 3C8YA 2D3GA 2G4SA 1KRHA 3TSSA 1VDVA 4TQ1A 2G4DB 2J7QB 4TUUA 1KJTA 1WE6A 3OWEB 2B3AA 1PQSA 4UDUC 5IAAC 3L4PA 1N60A 2WX1A 1WWTA 1K53A 3JSVA 2RGFA 4P1CC 4ZRPA 5LXHA 2K8CA 4MSMB 2DZKA 2PMVA 3ZNID 2HTHA 1KH0A 3AE4B 1DOYA 2JZPA 4W9LA 3HM3A 1HA5A 2WGSA 2NTTA 4TSSA 5DPSA 4RFBA 4EKUA 3H7SA 2W3SA 1RLFA 2N7EA 3H9DA 4GSWA 4EEWA 5EE0A 1EF1A 2M19A 2N9PC 1KLUD 2E3TA 1HTQA 1XO3A 1YN3A 2INCC 4ICVA 2D07B 4ANUA 4C56C 2QC8A 3DVGX 1FRDA 1ZW7A 4M8MA 3MJ5A 3DDCB 1C4AA 2IO3B 2JU6X 2FIDA 1WE7A 3Q8CA 4FHKA 1FRRA 4ICUA 3VR8B 1V97A 3MHSD 1I42A 2PE6B 1J7AA 2KVRA 3NG0A 2K8BA 3HIZA 5J18A 4ANWA 1UUPA 3R7RA 2BVCA 1T5XD 4RH6A 1V6EA 2V3SA 2IO0B 1SE3A 1OQRA 3ZNHB 1FCLA 1YQBA 2CS4A 1P3QU 4B95A 4DXGA 3U4EG 1QQRA 2Y5PA 1Q10A 2Z8LA 2PVGC 1TJEA 5CHVC 5BMGA 1YQ4B 2L0FA 5G2NA 4AQ7A 1E8XA 4KKIA 2JZ3B 4ACFA 1V81A 2MJ3A 4RF0A 3IG3A 1L6UA 4HKQA 2ASQA 3ONSA 5IKCM 3UI3A 4M0WA 3PRZA 1IGDA 4MH8A 4IM0A 1QOGA 2LFIA 3ZXVA 3BVGA 4AUQC 4HJKA 1B9RA 2JUOA 2ICIA 1WY8A 1J7BA 1K51A 3GP7A 2QEJC 3P4RB 1RFAA 3U30A 1PGAA 2FIFA 3M3JA 3A4SC 2C7MB 1YD8U 3B9JA 1NI3A 4ITKA 2KMMA 1KLGD 1NBFC 2ZPNA 2J0JA 3OG5A 3V60A 4XDCA 1V2YA 4A90A 4P7IA 1I4HA 3MC0B 2L3ZA 4AOFA 4XX5A 3ZRCA 2WDVB 2G45B 4LDTD 4MM3B 3E9SA 3IT6B 2EELA 5BYSA 2BT6A 3JVZX 3A1QA 3EHVA 2FCQA 5JHBA 4BFRA 1NI2A 1EO6A 4GXBA 1YN4A 1TT5B 2QSDA 4GGQA 5LNK1 3ZTDA 4MGYE 5FR3A 2DWQA 2KAJA 5LLIA 4S17A 5E6PA 5EE9A 3Q6BA 2WXHA 1OTRB 2MBEA 1TIFA 1YQ3B 4H2AA 3M62B 3KVFB 3SR6A 1E8WA 1WF9A 2BYEA 1CJEA 3PLUA 1FEHA 1GG3A 3Q3JA 3PPAA 4L1BA 4USAA 1Q5WB 5LXIB 2JRIB 2NBWB 2BQQA 2KZRA 3DBRI 3VRBB 1F0ZA 3PSEB 1MI0A 3U8ZA 4I6LB 2KO3A 1AARA 2L8JA 1Q0WB 2V3NA 1SJHD 3AE1B 4LJOB 5D7GA 4RGTA 4HK2A 5H92C 2BKRB 4TKNA 4KVGB 3UIOB 2MA9B 2B76B 3SFEB 3SD5A 3KH0A 1T6BX 1B1ZA 1WJ4A 1FIQA 1D6EC 2HJ1A 2KWVB 4GB9A 2AWTA 3RYTA 3AE3B 2QDFA 2R2QA 1UBIA 1XLOA 3NZ3A 1V5OA 3ZXRA 4JIOU 2ZPYA 4ARCA 2EKEC 2GBMA 4IDIA 3R8BA 4WIPA 3FAHA 4GOCA 2NPTA 1MHXA 2YEPB 3T8MA 1UGJA 4R3DA 3B08A 1MG4A 5GMVA 2A4ZA 3BK1A 4RCOA 2N7JA 2KMAA 3BZDB 2WU2B 3QK0A 4L2YA 3RPFC 1JWUD 2ZCCA 1TBEA 4BOZB 1N5WA 3LB8C 5IN7A 4M00A 3RZWC 2Y3AA 3APDA 1N6ZA 5JXVA 1ZUD2 4XWWA 2NTSA 4AS1A 1TZ1A 5D3DA 2EMSA 1TS4A 2NS5A 1UWMA 1JWBD 2NBVB 3DVGY 1SF0A 1ZKHA 2C7NB 3R2TA 4JWSC 5J17A 3A9KA 1E8YA 3HHMA 1VCBA 4M8NA 1Y56A 2KJRA 4DHZE 4OZCA 4WWMA 4ZRKA 2XBBC 2IYDB 1C78A 4FULA 3L08A 1FXTB 4W9DA 3Q3NC 1YN5A 2BS4B 5D3IB 4PYUA 3P63A 1L4ZB 2DENB 3I57A 4ZHPA 3L16A 2PPHA 3AB5A 1FD6A 4YWGG 2O6VD 3KQ4A 2MWSB 3M63B 3MC8A 1C4PA 2LMCA 3BVMA 3IAS1 4X57B 4AJWA 1JALA 4F8CB 3BYTB 3SFDB 1L0VB 2N9KA 2LUMA 2ZZPB 1SE4A 1VRAB 3N30A 3OLMD 2L76A 4XDDA 2GBRA 3MHZA 1UBQA 2XNAC 4G11A 3P42A 5HG2A 2INPE 4W9HA 1ESFA 3RN9C 3I5JC 2JY6A 2LJIA 3KUZA 2Q5WD 3W9CB 3QA8A 4G50A 3UQBA 4JX1C 2FUG1 4REZA 3HVDA 4WQMA 3ML8A 3LJ3A 1R4MB 1GPXA 4NJ6A 1V8CA 4MJSB 1SIFA 2Z0DB 4US8A 1VD2A 3TBLD 3AU4A 2CHWA 2MBQA 2KN5A 2K5PA 3B2GA 3Q3FA 1GB1A 1STEA 2GRIA 3TEYA 5CX3A 1MVKA 2AQ2B 4OVUA 1NYQA 2MSED 2HTME 1OFFA 3DPDA 5HI1A 1D5MC 1TKEA 4LK0M 2INNE 1J7CA 1L6VA 4EUTA 3KYCD 3PV1A 3TL5A 3OAWA 3RNEC 1D4BA 5KHQA 2X38A 2GMIC 3NJTA 3ETRA 2N0SB 3Q14C 4IW0A 2AQ3B 1P7EA 4A3OA 1E10A 3TEXA 2IGGA 2BF8B 4NQLB 3V6EB 4J6IA 4KV2A 1ET6A 3D32A 3PHXB 2OJRA 1EU3A 2WXGA 1EU4A 4Q2JA 1U4AA 3R7QA 2WXQA 1R4NI 3ZDTA 3NVVA 4C80A 3HVZA 4IUMB 2AEHA 1DOXA 3K9PB 3V62A 2INDC 1RFKA 5DPTA 4A8XC 3EFCA 4NAWB 3VUWA 5IO9A 1EUVB 4YTPB 2GBJA 3H1UA 2EKIA 3VFKA 1HQRD 3QX1A 4KSKC 4IWQA 1AW7A 3Q3OC 5BYQA 4A55A 5BO4B 2WDQB 2MJEA 4MJSA 4DQOC 3IBEA 1P9DU 4II2B 3CWIA 1IBXB 2WQYB 2LGDA 3R66C 4PS3A 2NVUI 1MG8A 2D3BA 2WLBA 3BWUD 5C23A 1HZ6A 3VVWB 4HJGE 2FNJB 3O65B 3KWVA 4EE2A 3EC8A 2K8HA 2BYFA 1WIAA 3ZIMA 3IT4B 4LJPB 3BIID 1JRPA 1BT0A 3T3OA 1R4MI 3SHQA 1D5ZC 3AN1A 3UINB 2M0AA 5TR5A 3PRPB 2GI9A 3BVZA 1TYGB 4DDGD 3BINA 3IHPC 5KHOA 5D6JB 4GMVA 2DX5B 3C19A 2DYOA 4IG7B 2D5GA 2CU3A 4A3PA 1C9FA 2IO1B 3VH3B 3W5VB 1SB3C 1Z2MA 1K52A 2MRPA 4ZHOA 4HPMB 2PKOA 1WI0A 2NBUA 4ZRIA 2I2YA 2N9LA 3WAPA 3QAQA 1AWDA 1J19A 3NY5A 2FBWB 2AL6A 3HM6X 1HXYD 1FNWA 3MTNB 2BKFA 4YTMB 3U52E 4FADA 4MM3A 2K25A 5IOIA 3W1SC 1FO4A 2LHDA 3TIXA 4B6WA 2D2QA 2DYMA 4WJOA 1PYWD 1ZOYB 4WJQA 1JWSD 3SU8X 2JYEA 4NQKE 4K7UA 4W9JA 1WGHA 4FXCA 2L7RA 2WXIA 1RM6C 3QIJA 4HDQA 3N1XC 3B1LX 3H7PA 2GBNA 3ZQ4A 2IDYA 1WRDB 2JRHA 3V61A 2LXCA 3GOEA 4IWPA 2E6XA 1WXVA 2KHWB 1OGWA 3QJZA 4NNJB 2I1JA 2ZJDA 4DHJD 1SBBB 2XK5A 1JCKB 3W5UB 1FNUA 1L0YB 5G5HA 4FJVB 3TJPA 1NENB 2WX0A 4JWUC 1ZE3D 2CHXA 3P2BA 1WX8A 3VXWA 5AZGA 3QCAA 4HCNB 3AE6B 1N63A 4N9F4 3W2DA 4HPLB 3LXFA 3NHEB 4J3OD 3Q8BA 2ONQA 4IOIE 1DYQA 1RWSA 2JVCA 4EOYA 2KFKA 4WURA 2KDEB 1S3SG 2V9HA 2GOWA 1L2NA 1WGKA 2IBIB 2QILA 3NS8A 2RPVA 1LM8B 1A5RA 3A1QB 2JPHA 2ZCBA 4DXAB 2VZKD 4YSZB 1I4PA 1CK1A 4C4VB 4WJPA 2M8SA 4IKGA 3VQIA 1R4NB 2GB1A 1IPGA 3AEDB 3GB1A 2KTRB 2ZVOA 3DWGC 1QOBA 1UZXB 3AEBB 3DWMA 1IGCA 3DOWA 4P16A 1MJDA 1N5XA 1XF5L 3L0WB 2RDBC 3V6CB 2WXJA 4ASWC 2J53A 2BS2B 1D3ZA 1SE2A 3S2AA 2RR9A 1I35A 4YT0B 1CZPA 1XCQL 3N32A 1I4RA 5AUIA 4ZOHC 4CO7A 4BKSD 4HKZE 3ZRFA 1V49A 3KYDD 2K0PA 4MSQB 4W9CA 3UQAA 1WXSA 1XLNA 2KYWA 3WAOA 4GU2A 2BYVE 4JPSA 1N62A 2WXOA 2JSVX 2D3CA 3ZTCA 1QF6A 4MEMA 2IZVB 3TEWA 1KTKA 2JQRB 5DPRA 1OQQA 1T0QC 3P4SB 4C7ZA 5D2MB 3ML9A 2LRWA 4BZAA 1ZXHA 4OVZA 4BKGA 3L54A 4RNAA 1UNSA 4KSLC 1NDDA 3APCA 4MGZE 3NVWA 3N9YC 2V4LA 2AYOB 3PREA 3NZSA 1LXDA 2MBOA 1VLBA 1WJ6A 4WH4A 4WWOA 1NVID 2LVPA 4GIVA 4IM3A 1JWAD 4TQ0A 3ALBA 2K3UA 4RF1A 5EE1A 2WP9B 3WALA 4BKTA 1BXTA 1WGRA 1XLPA 2N1WA 4JL9A 3AECB 4PS7A 3ZLZA 1WXMA 2ZW0A 2L1AA 2PVOD 3JYUA 2JZZA 4HLEA 1LQBA 1H4RA 1WR6E 1JWMD 2KD0A 4RGMA 2WU5B 3K9OB 4CYEA 2KWUB 5E6NA 3A9KB 3P4PB 2YLMA 2WWZA 4BOSC 2ZNVB 4WWPA 4A9AA 3R2IA 2PLPA 1GJZA 1P0RA 1GC7A 2LZ6A 1PUTA 4MELA 2C9WB 1WM2A 2D3AA 2DAJA 3LYYA 2J4XA 4HROA 4FJZA 1XLQA 3Q8AA 4BAXA 3ZW3A 4KZCA 3WIMA 4W9IA 2MW5A 3PGEA 2RSUA 4RM9A 3PLVA 2KNBA 3E56A 3EECA 2WHIA 2C5LC 3Q2AC 4CQNA 1V1PA 2JYTA 2EMTA 3FC4A 5AUKA 1CQVA 2ZW1A 1H8CA 2LD9A 4URKA 1K8RB 4FHJA 4G3XB 2W54A 2O2VA 4ZRQA 3PS6A 1OQYA 2KDMA 1FM0D 3X23A 3NUHB 3MFGA 2V3PA 3PZ8A 3FKYA 4JQWC 1I4GA 2ON8A 2MP2B 2DZMA 4MDKE 3B0AA 3RCZA 4KIKB 1QILA 4YTNB 3DBHI 4E71A 5H8YE 5C1ZA 1N61A 1BUIC 1QKZA 3ZUNA 2L32A 3ZJTA 3AE5B 3MC9A 1WFYA 3LDZE 2R2OA 2DYBA 2DHZA 2MEKA 2DLBA 4KDLB 5FK9C 2DAFA 4PT5A 5JZEB 1NEKB 2K39A 2LVQA 4AJYB 4S0RA 5T8IA 3AEAB 5BMHA 1VR9A 2J0KA 3DHIC 1WX7A 4JLCA 3DBRB 3RT3B 1WGGA 4DBGA 4RM8A 2W55A 3U7DA 3A4RA 2PTLA 3MJWA 1SJED 3FILA 2CKHB 4K1RB 2X8XX 2KVZA 3AV8A 4KGTA 1C1YB 2DZIA 1LO5D 5IA7A 2WXKA 4HDOA 2N9XA 1YX5B 4KDIC 3N20C 4MACA 3IFWB 1FXAA 5L95C 3VTUA 1V1PB 3DQVA 3EGRA 1WX9A 3RULA 5TSSA 3OJ3A 3PTFC 5D94A 4MGKE 3T3NA 2IGHA 2O2VB 4WQOB 4MH0E 1XD3B 2NMQA 3TMPB 4F7ZA 1GB4A 4OZAA 4FN2A 2KXJA 2VRRB 4NAWA 1PGBA 3DBLI 2L00B 4KIKA 3EA6A 4E3CA 4YSXB 5DCNA 2KDFB 3AXCA 2GLSA 5E6JA 1QOFA 3AEGB 1P1AA 1EM7A 2IPKD 2SEBD 3CIRB 3DHHC 4GDKB 4WAAA 4IC7B 3VH4B 1Z5SB 2OOBB 1M4VA 5G5GA 1T0SC 1ENFA 3WCQA 1FCCC 5MPOA 4I6PA 4YXDB 3BK2A 5HFYA 4RGOS 3VTWA 2N4FA 2FCMA 1FPYA 1UF0A 3PT2B 2BTEA 1PFDA 5HHDG 3PHWB 2LGSA 2IO2B 3FILB 2XK5B 1VZ8A 1TY2A 3NVYA 4KKJA 1ROEA 4WJNA 1TKYA 1C79A 4RGNA 2LJ5A 4EZKA 2JX5A 2PW9A 1G6JA 1YJJA 2JT4B 2SAKA 2WNMA 4BVUC 2CU1A 1WXAA 2ZVNA 3DVNU 4XWTA 1RAXA 4KGSA 3APFA 1OEYJ 1PGXA 1FNVA 1V9JA 4DHZB 1V80A 4DHJB 2L83A 3BY4B 1WZ3A 2Z59B 2BGFA 1D5XC 1YX6B 4II3B 1DOIA 2DBYA 3QQ8B 2OJWA 4YSYB 1MFWA 1LGRA 4LTUA 3VHTC 4GDLA 1L7YA 3U2SC 4FA6A 3RUIB 3L17A 4NY0A 4LNNA 1WMHB 2LGXA 2UU7A 1SSNA 4ANVA 2FUHB 3DBSA 2IY0B 1E8ZA 2LUEA 2WXNA 2MLBA 1FMAD 3AU5A 3N1ZC 5CTRC 4MGIE 1XCTL 2CR5A 3H7PB
chains in the Genus database with same CATH topology
2I38A 4RCOA 4P16A 2N7JA 3BZDB 2WU2B 4L2YA 2WS3B 1N5XA 3RPFC 1XF5L 2J52A 1JWUD 1WSPA 1C77A 3NRZA 1N5WA 3LB8C 2WXJA 3AEEB 2J53A 1TS3A 2BS2B 2Y3AA 1SE2A 1T3QA 4YT0B 5JXVA 2CJNA 1CZPA 3VRAB 1XCQL 1I4RA 5AUIA 4ZOHC 2G9HD 4ZYSA 1ZUD2 4XWWA 2NTSA 4AS1A 5D3DA 4GLSC 1L5PA 4HKZE 1E0ZA 1TS4A 1UWMA 1JWBD 2L52A 4NJCA 2W3RA 4OZBA 2BB6A 1SF0A 1FFVA 3R2TA 1JROA 4JWSC 2K0PA 4NZLB 1KFYB 3H8HA 1AYFA 1XLNA 3V3XA 5BYRA 1Y56A 4JPSA 1N62A 4OZCA 4WWMA 3AEFB 2Y5CA 2WXOA 2JSVX 1C78A 1I4QA 2V0GA 2LEKA 3U7ZA 1VJKA 1QF6A 4O1NA 1HEZE 4LLGM 3Q8EA 3TEWA 4OW0A 1KTKA 2FE8A 2JQRB 2RDHA 1ZP0B 1FFUA 1OQQA 1WXQA 3Q69A 1YN5A 2BS4B 5D3IB 3P63A 1L4ZB 3KWLA 3P4SB 4MT5A 1SXTA 3I57A 4C7ZA 4GDLB 4ZHPA 1ZXHA 4US9A 3AB5A 4OVZA 1FD6A 4YWGG 4RNAA 1UNSA 2ACZB 1TS5A 3NVWA 3KQ4A 3N9YC 2WXLA 1C4PA 2LGIA 2LMCA 3BVMA 3IAS1 3NVZA 1JALA 2PIAA 3ZGZA 4DXFA 1YJIA 3BYTB 3P4QB 1L0VB 3SFDB 3W1SA 2N9KA 1QLBB 2LUMA 1VLBA 1SE4A 1VRAB 2WXFA 2WXPA 4WH4A 2H89B 4A6QA 1NYRA 1NVID 1TKGA 4XDDA 3MHZA 2V4IB 2XNAC 3AE2B 4XE0A 1TZOA 3P42A 3ZJUA 3IAM1 5HG2A 2INPE 3AMZA 1ESFA 3NS1A 1JWAD 2LJIA 4TQ0A 3AH7A 1JQ4A 1VZ7A 2HDEA 2K3UA 2QJLA 3P1MA 3J9CA 4RF1A 5EE1A 2WP9B 2Q5WD 2VZKB 3W9CB 4KGRA 1GOZA 4JX1C 2FUG1 4REZA 1BXTA 3HVDA 4WQMA 1XLPA 3AECB 3I9V1 2ZW0A 2L1AA 2PVOD 2OEDA 1YNTE 1DGJA 4P6VF 3C8YA 1GPXA 1V8CA 3B2FA 1JWMD 4US8A 1EWYC 4RGMA 1KRHA 3TSSA 5C2TB 2WU5B 1VDVA 4TQ1A 1ZXIA 2K5PA 3B2GA 1GB1A 1STEA 3P4PB 2GRIA 3ZYYX 1EWCA 1MVKA 3TEYA 3OWEB 2AQ2B 3TUOA 4A9AA 3R2IA 1GAQB 2PLPA 1NYQA 4UDUC 3L4PA 1N60A 4HEA1 4HRSA 1WWTA 1K53A 2TSSA 2WDRB 2RMMA 1SEBD 2HTME 1OFFA 1PUTA 4ZRPA 5HI1A 1D5MC 5I4DA 3LYYA 1TKEA 2J4XA 4HROA 4LK0M 2INNE 1XLQA 3Q8AA 1J7CA 1VZ6A 2PMVA 1L6VA 1KH0A 3AE4B 4JE3B 1DOYA 2JZPA 1ET9A 2R61A 2IJ0A 1D4BA 2X38A 1HA5A 2M56B 3ETRA 2N0SB 3E56A 4N59A 1F2RC 2NTTA 4TSSA 2AQ3B 1P7EA 2LHEA 3AE7B 4RFBA 1E10A 3TEXA 2IGGA 2W3SA 1ET6A 4CQNA 1V1PA 2JYTA 1C76A 3FC4A 5AUKA 1CQVA 1EU3A 1PDXA 2ZW1A 2CJOA 2WXGA 1EU4A 4Q2JA 1E6EB 4N6EB 3RFZB 2W54A 2WXQA 5EE0A 2M19A 4ZRQA 1KLUD 2KDMA 3NVVA 2WXRA 4WAFA 2E3TA 1FM0D 4C80A 3HVZA 3NUHB 1YMHE 1DOXA 1XO3A 3MFGA 2V3PA 3MP9A 5BMIA 3PZ8A 1RFKA 1YN3A 3VR9B 4A8XC 1I4GA 2YEPF 1UWXA 3HUIA 4NAWB 2ON8A 4C56C 1FRDA 4YTPB 4TMAB 3MJ5A 1C4AA 2JU6X 1KF6B 2EKIA 1QILA 4YTNB 1HQRD 5H8YE 2WXMA 3HRDD 3Q8CA 1FRRA 3VR8B 1AW7A 1V97A 1WRIA 5BYQA 1N61A 1BUIC 4A55A 1QKZA 1J7AA 2JWUA 2L32A 5GXGB 3ZJTA 2WDQB 3AE5B 2MJEA 4DQOC 1UUPA 2K9XA 3CWIA 1T5XD 1IBXB 2MEKA 2DLBA 2WQYB 4RH6A 2KQ4X 2G1EA 5FK9C 2WLBA 3BWUD 4PT5A 4C7YA 1HZ6A 1NEKB 4HJGE 1SE3A 1OQRA 4EE2A 3KWVA 1FCLA 5T8IA 3AEAB 5BMHA 1VR9A 1IBXA 3KLSX 4DXGA 3U4EG 4B0MA 3IT4B 3ZJVA 3BIID 1JRPA 1QQRA 2W55A 2Y5PA 1Q10A 4L23A 3T3OA 1JMLA 2PTLA 1SJED 2Z8LA 2PVGC 3FILA 1TJEA 2K22A 5BMGA 1D5ZC 1YQ4B 3AN1A 2M0AA 4AQ7A 2GI9A 3BVZA 1TYGB 3AV8A 1JW9D 4KGTA 1LO5D 2WXKA 2AQ1B 4KKIA 1L0XB 2KWDA 1K50A 4MACA 1ZPSA 2DYOA 2D5GA 2MJ3A 2CU3A 4RF0A 1FXAA 1L6UA 1C9FA 1V1PB 4HKQA 3EGRA 5TSSA 3UI3A 1E7PB 2KN4A 3W5VB 1V1OA 1SB3C 1K52A 4M0WA 3PZ7A 1ZDVA 3BYYB 1IGDA 4ZHOA 3T3NA 2IGHA 4MH8A 3SEBA 1QOGA 2PKOA 3PO0A 2LFIA 2XN9C 2NMQA 2I2YA 3BVGA 1GB4A 2N9LA 4OZAA 2MJDA 1AWDA 1QT9A 4KX6B 3AE9B 1B9RA 3Q8FA 1PGBA 2FBWB 2ICIA 4D2KA 1J7BA 1K51A 3GP7A 1HXYD 2QEJC 3P4RB 1FNWA 2BBCA 1PGAA 4YTMB 3EA6A 2BYTA 3B9JA 3U52E 4YSXB 1NI3A 1XXGA 2KMMA 4ITKA 1KLGD 3DWMA 3IXSA 4XDCA 5E6JA 4A90A 1I4HA 1QOFA 1FO4A 2LHDA 3MC0B 3AEGB 5C3JB 3AM9A 2WDVB 1I4XA 1EM7A 2IPKD 2SEBD 4MM3B 3E9SA 3CIRB 3IT6B 2EELA 5BYSA 2BT6A 4GDKB 1ZDXA 2OHFA 2DYMA 4OHJA 1PYWD 1SIJA 1AN8A 2MH7A 2BS3B 1YN4A 1ZOYB 2QSDA 5LNK1 1BMLC 1JWSD 1M4VA 2JYEA 2KACA 5FR3A 2DWQA 2KAJA 5G5GA 1XEEA 1ENFA 5EE9A 1FCCC 3WCQA 2H88B 2WXHA 5FKAC 5MPOA 4YXDB 3BK2A 4FXCA 5HFYA 4RGOS 2WXIA 1RM6C 1YQ3B 4H2AA 3EUB2 2BTEA 3ZQ4A 1PFDA 5HHDG 3SR6A 2IDYA 3FILB 1CJEA 1FEHA 1VZ8A 2E6XA 1TY2A 1F77A 3NVYA 4KKJA 1ROEA 4ARIA 2RDGA 1TKYA 4L1BA 1C79A 4RGNA 4USAA 2JX5A 1F2RI 1SBBB 2PW9A 1YJJA 1JCKB 2SAKA 2WNMA 3W5UB 1TS2A 1FNUA 1ACCA 1L0YB 5G5HA 3O13A 3VRBB 1F0ZA 4XWTA 1NENB 4JWUC 2J42A 1ZE3D 4KGSA 3AE8B 1MI0A 2V3NA 1PGXA 1FNVA 1SJHD 1L4DB 1MPEA 3AE1B 5D7GA 3AE6B 4N58A 4RGTA 5H92C 2L83A 1N63A 1P7FA 3W2DA 1C4CA 2B76B 3ABVB 3LXFA 1D5XC 3V05A 3SFEB 2ONQA 1DYQA 1RWSA 2BW2A 3Q8BA 4IOIE 1T6BX 1DOIA 1B1ZA 2DBYA 4J3OD 1FIQA 1D6EC 2W82A 4YSYB 1HZ5A 4NAMA 1FXIA 3AE3B 4WURA 4LTUA 2JXTA 1E9MA 3U2SC 2BB5A 1WGKA 2QILA 1IUEA 1MHHE 1XLOA 1RYJA 3URYA 2IGDA 2QMTA 3GS2A 3NZ3A 1TY0A 1QOAA 2RPVA 2AX5A 1SSNA 1R7SA 2QIEB 4ARCA 2VZKD 4YSZB 1I4PA 1CK1A 4IDIA 3R8BA 4WIPA 3TEZA 5EE3A 2WXNA 4IKGA 3FAHA 3VQIA 2GB1A 1MHXA 1FMAD 4B0EA 2YEPB 3AEDB 3GB1A 1UGJA 1A70A 1I7HA 1XCTL 4R3DA 1WYGA 3DWGC 1QOBA 3AEBB 3BK1A 1IGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KGR A;  2I38 A;  2KAC A;  2N7J A;  1FCC C;  1XF5 L;  2J52 A;  5HFY A;  1IBX B;  2KQ4 X;  2ZW0 A;  2OED A;  1YNT E;  2J53 A;  5HHD G;  1HZ6 A;  4HJG E;  1FCL A;  3FIL B;  5JXV A;  5BMH A;  1IBX A;  1XCQ L;  1GB1 A;  1MVK A;  4GLS C;  1Q10 A;  4HKZ E;  2PLP A;  1JML A;  2PTL A;  1F2R I;  2PW9 A;  3FIL A;  4OZB A;  1K53 A;  5BMG A;  2RMM A;  2K0P A;  2GI9 A;  5HI1 A;  4KGT A;  3V3X A;  1KH0 A;  2KWD A;  4OZC A;  1K50 A;  4MAC A;  2JZP A;  4KGS A;  1MI0 A;  2JSV X;  1D4B A;  1C9F A;  1HEZ E;  1PGX A;  1F2R C;  1MPE A;  1P7E A;  2LHE A;  3UI3 A;  2KN4 A;  2IGG A;  1K52 A;  1IGD A;  1P7F A;  2IGH A;  2NMQ A;  2I2Y A;  1ZXH A;  2N9L A;  1GB4 A;  2ONQ A;  4OZA A;  4IOI E;  1FD6 A;  2ZW1 A;  1PGB A;  4D2K A;  1HZ5 A;  2LGI A;  1K51 A;  2KDM A;  2JXT A;  1PGA A;  2N9K A;  2LUM A;  1YMH E;  1MHH E;  3MP9 A;  2IGD A;  2QMT A;  5BMI A;  4WH4 A;  1UWX A;  2ON8 A;  2RPV A;  2JU6 X;  2LHD A;  5HG2 A;  1EM7 A;  4IKG A;  2GB1 A;  1MHX A;  2EEL A;  3GB1 A;  1QKZ A;  1XCT L;  2JWU A;  2QSD A;  1IGC A; 
#chains in the Genus database with same CATH topology
 2I38 A;  2KTF A;  3TCA A;  2WS3 B;  1ZGU B;  2Y5B B;  2I1K A;  1WSP A;  1UD7 A;  3C0R B;  2RD0 A;  1V5T A;  2CJN A;  3VRA B;  2C60 A;  2G9H D;  3I3T B;  1WGY A;  2N9E B;  4NJC A;  4FJY A;  2RPQ A;  2BB6 A;  3RD2 A;  4NZL B;  1KFY B;  3H8H A;  1AYF A;  3RZF A;  3V3X A;  1WH3 A;  3AEF B;  2Y5C A;  3UIP B;  3JSV B;  1I4Q A;  2V0G A;  2LEK A;  3U7Z A;  3KUD B;  1HEZ E;  2M4N A;  4LLG M;  4OW0 A;  3IVF A;  1KLV A;  1ZP0 B;  1FFU A;  1WXQ A;  2KFK B;  4B9K A;  3Q69 A;  1X1M A;  2KX0 A;  4EZL A;  1KOT A;  1HTO A;  2PE9 A;  3WAM A;  4US9 A;  2KJ6 A;  2WYQ A;  2ACZ B;  2LXA A;  3PVL A;  4HCP B;  1WMH A;  2WXL A;  5CHF A;  3CMM B;  4DXF A;  1YJI A;  3P4Q B;  1QLB B;  2KX3 A;  2H89 B;  2K6Q A;  1NYR A;  2UWQ A;  3M95 A;  2V4I B;  3ZO5 B;  2KTR A;  3KUC B;  4IWO A;  1TZO A;  2MHJ A;  4EFO A;  1T0R C;  2KJH B;  3AMZ A;  3NS1 A;  1YOV B;  3AH7 A;  1TGZ B;  2KK8 A;  4PK1 A;  2QJL A;  3P1M A;  1HE8 A;  4KGR A;  3CF6 E;  3NOB A;  2KLG A;  3QHT A;  3DBL B;  2OED A;  1YNT E;  1DGJ A;  4P6V F;  3RNC C;  5EDS A;  2N1V A;  3B2F A;  4HVB A;  1EWY C;  5C2T B;  1RRB A;  1ZXI A;  1LFD A;  2Z0E B;  4BBN F;  4W9F A;  1V86 A;  1EWC A;  3ZYY X;  3TUO A;  1GAQ B;  4HWI B;  4HRS A;  4HEA 1;  2WDR B;  1SE9 A;  2RMM A;  1SEB D;  1E5W A;  2TSS A;  4P1B C;  2LVO A;  4IM2 A;  2UYZ B;  2MBH A;  4BKS A;  5I4D A;  2HE7 A;  3A33 B;  2AL3 A;  1VZ6 A;  4RMA A;  1E90 A;  4JE3 B;  1ET9 A;  2R61 A;  3SDL C;  2KDI A;  2IJ0 A;  3DCG A;  2V1Y A;  4HPP A;  5HKH A;  3ZNG C;  5CHW A;  2KT7 A;  4BBN C;  3ZNZ B;  2LGY A;  2M56 B;  2NR2 A;  4N59 A;  1F2R C;  4HXD A;  3AE7 B;  2LHE A;  1F9J A;  1E7V A;  4EZJ A;  1WJU A;  4M01 A;  1J0G A;  1C76 A;  3OJ4 B;  1PDX A;  2CJO A;  1E6E B;  4N6E B;  3RFZ B;  4M0W B;  4I6N B;  2WXR A;  4WAF A;  3ENE A;  4ZDV A;  1YMH E;  3MP9 A;  5BMI A;  1WR1 A;  2D10 A;  3VR9 B;  2YEP F;  1UWX A;  3HUI A;  1P98 A;  4OVV A;  4TMA B;  1OEY A;  2A5U A;  1KF6 B;  3GE3 C;  3DBH B;  2WXM A;  3HRD D;  1WRI A;  2JWU A;  5GXG B;  3RI7 C;  3UGB B;  2K9X A;  2KQ4 X;  2G1E A;  4DWF A;  2N7D A;  2FAZ A;  2DZJ A;  4NPN A;  4C7Y A;  2L05 A;  2FCN A;  1UGM A;  2IY1 B;  1IBX A;  3KLS X;  2K6D B;  4B0M A;  2W9N A;  2LAS A;  5L83 A;  3ZJV A;  3RNB C;  4L23 A;  3AUL A;  1JML A;  2K22 A;  1F52 A;  2BWF A;  2DNF A;  3KW5 B;  2PEA A;  2VH1 A;  1JW9 D;  1UEL A;  2AQ1 B;  1E7U A;  2XEW A;  1L0X B;  2KWD A;  1K50 A;  3H6N A;  1ZPS A;  5E6O A;  1IYF A;  1YIW A;  5AEK B;  3GZN B;  1Y8R C;  1F1H A;  1E7P B;  2KN4 A;  1V1O A;  4LDT B;  3PZ7 A;  1ZDV A;  2KOX A;  3BYY B;  5AZF A;  3SEB A;  2QHO A;  2LRU A;  3PO0 A;  2XN9 C;  4GN1 A;  2BWE S;  2KWC A;  2MJD A;  1QT9 A;  4KX6 B;  1T0Y A;  3AE9 B;  4K3B A;  3Q8F A;  4LNO A;  4D2K A;  2MP2 A;  1XQQ A;  4W9E A;  3QWZ B;  3R3M A;  1JRU A;  1GC6 A;  2BBC A;  1GUA B;  2BYT A;  2G3Q B;  2YVC A;  1XXG A;  2QCZ A;  3ECI A;  4FBJ B;  4GDK A;  1GNU A;  4M02 A;  2LI5 A;  2KQS A;  3IXS A;  2PJH A;  3VDZ A;  5C3J B;  2HJ8 A;  3AM9 A;  4KZ0 A;  1I4X A;  4NJ7 A;  5G55 A;  5J2R A;  2JWZ A;  1ZDX A;  2OHF A;  2M17 A;  4OHJ A;  4W9G A;  1SIJ A;  1AN8 A;  2MH7 A;  2BS3 B;  3L10 B;  2GBK A;  2LWP A;  3VUY A;  1BML C;  2KAC A;  3DVN V;  1WYW B;  2NPT B;  1XEE A;  4WWN A;  2H88 B;  5FKA C;  3PRM B;  1WZ0 A;  1CMX B;  3EUB 2;  3GZN I;  3UF8 A;  4QAY A;  3Q3M C;  2NCN A;  5FR6 A;  2KLC A;  2KQ7 A;  4XGA B;  1F77 A;  4PYZ A;  4ARI A;  2RDG A;  3QAR A;  3CST A;  3GE8 C;  1F2R I;  2KC2 A;  1TS2 A;  3A9J B;  1ACC A;  3O13 A;  1J8C A;  1IP9 A;  2KMC A;  3X0W A;  2J42 A;  3AE8 B;  2HD5 B;  4LNF A;  3RNA C;  2KAN A;  4ANX A;  4DK5 A;  1WGD A;  1L4D B;  1MPE A;  3QC8 B;  2O6V A;  4N58 A;  1WM3 A;  2MCN B;  2JF5 A;  1P7F A;  1C4C A;  3ABV B;  2J0M A;  3V05 A;  2BW2 A;  4AP4 C;  3EFU A;  2CHZ A;  2W82 A;  4ZYN A;  4JGH B;  2M0X A;  1HZ5 A;  4NAM A;  1FXI A;  1S1Q B;  4ZRJ A;  2JXT A;  1E9M A;  2BB5 A;  1UH6 A;  3WA0 A;  1IUE A;  3NZU A;  3ZDM C;  1MHH E;  1RYJ A;  3URY A;  2IGD A;  2QMT A;  3GS2 A;  1TY0 A;  1QOA A;  4FLH A;  2AX5 A;  4W9K A;  4LNI A;  1R7S A;  2QIE B;  3TEZ A;  5EE3 A;  4A20 A;  3DHG C;  3RNG C;  1SGH A;  4B0E A;  3N1Y C;  1A70 A;  1I7H A;  4K7W A;  4AWJ A;  4YL8 A;  1WYG A;  2REX A;  4K81 A;  4C4V A;  3T9L A;  4PS8 A;  2K1F A;  4E74 A;  2FCS A;  4DDI D;  5AZH A;  5JH5 C;  2J52 A;  1C77 A;  3NRZ A;  3AEE B;  1YJ1 A;  1TS3 A;  3JW0 X;  3CSF A;  1M94 A;  1T3Q A;  4F1S A;  4LCD E;  3RMK C;  4ZYS A;  3A9J A;  2WDT B;  2ZNV C;  4GLS C;  1L5P A;  1E0Z A;  4XYC A;  3ZKJ C;  2L52 A;  4OZB A;  2W3R A;  3I63 C;  1QZE A;  2KFJ A;  4C00 A;  1FFV A;  1ISN A;  1JRO A;  3VUX A;  1TTN A;  4LNK A;  1WJN A;  5DPW A;  5BYR A;  3L13 A;  2O6V B;  5IP4 D;  4TV3 A;  1VJK A;  4O1N A;  3VTV A;  3Q8E A;  4XZ4 A;  2FE8 A;  2RDH A;  2VH2 A;  2KC1 A;  2MBB B;  3KWL A;  5JHA A;  2BPS A;  3N3K B;  4MT5 A;  1SXT A;  4GDL B;  3PZD A;  3RNF C;  3VAW A;  2JXX A;  4CHK A;  1TS5 A;  2LGI A;  3NVZ A;  2PIA A;  3ZGZ A;  1KM7 A;  2MQJ A;  3W1S A;  2WXF A;  2WXP A;  4K7S A;  4A6Q A;  1TKG A;  3AE2 B;  3AI5 A;  4XE0 A;  1C3T A;  3ZVV A;  2L0T A;  2MX2 A;  3ZJU A;  2ZEQ A;  3IAM 1;  4XC2 A;  2KDB A;  1JQ4 A;  3HK0 A;  1VZ7 A;  4K3C A;  2HDE A;  2M1M A;  3W1Y A;  3J9C A;  2KKC A;  2VZK B;  2D11 A;  3WAN A;  1GOZ A;  4G0N B;  3I9V 1;  2C7H A;  1EF5 A;  1Q1O A;  1XT9 B;  3C8Y A;  2D3G A;  2G4S A;  1KRH A;  3TSS A;  1VDV A;  4TQ1 A;  2G4D B;  2J7Q B;  4TUU A;  1KJT A;  1WE6 A;  3OWE B;  2B3A A;  1PQS A;  4UDU C;  5IAA C;  3L4P A;  1N60 A;  2WX1 A;  1WWT A;  1K53 A;  3JSV A;  2RGF A;  4P1C C;  4ZRP A;  5LXH A;  2K8C A;  4MSM B;  2DZK A;  2PMV A;  3ZNI D;  2HTH A;  1KH0 A;  3AE4 B;  1DOY A;  2JZP A;  4W9L A;  3HM3 A;  1HA5 A;  2WGS A;  2NTT A;  4TSS A;  5DPS A;  4RFB A;  4EKU A;  3H7S A;  2W3S A;  1RLF A;  2N7E A;  3H9D A;  4GSW A;  4EEW A;  5EE0 A;  1EF1 A;  2M19 A;  2N9P C;  1KLU D;  2E3T A;  1HTQ A;  1XO3 A;  1YN3 A;  2INC C;  4ICV A;  2D07 B;  4ANU A;  4C56 C;  2QC8 A;  3DVG X;  1FRD A;  1ZW7 A;  4M8M A;  3MJ5 A;  3DDC B;  1C4A A;  2IO3 B;  2JU6 X;  2FID A;  1WE7 A;  3Q8C A;  4FHK A;  1FRR A;  4ICU A;  3VR8 B;  1V97 A;  3MHS D;  1I42 A;  2PE6 B;  1J7A A;  2KVR A;  3NG0 A;  2K8B A;  3HIZ A;  5J18 A;  4ANW A;  1UUP A;  3R7R A;  2BVC A;  1T5X D;  4RH6 A;  1V6E A;  2V3S A;  2IO0 B;  1SE3 A;  1OQR A;  3ZNH B;  1FCL A;  1YQB A;  2CS4 A;  1P3Q U;  4B95 A;  4DXG A;  3U4E G;  1QQR A;  2Y5P A;  1Q10 A;  2Z8L A;  2PVG C;  1TJE A;  5CHV C;  5BMG A;  1YQ4 B;  2L0F A;  5G2N A;  4AQ7 A;  1E8X A;  4KKI A;  2JZ3 B;  4ACF A;  1V81 A;  2MJ3 A;  4RF0 A;  3IG3 A;  1L6U A;  4HKQ A;  2ASQ A;  3ONS A;  5IKC M;  3UI3 A;  4M0W A;  3PRZ A;  1IGD A;  4MH8 A;  4IM0 A;  1QOG A;  2LFI A;  3ZXV A;  3BVG A;  4AUQ C;  4HJK A;  1B9R A;  2JUO A;  2ICI A;  1WY8 A;  1J7B A;  1K51 A;  3GP7 A;  2QEJ C;  3P4R B;  1RFA A;  3U30 A;  1PGA A;  2FIF A;  3M3J A;  3A4S C;  2C7M B;  1YD8 U;  3B9J A;  1NI3 A;  4ITK A;  2KMM A;  1KLG D;  1NBF C;  2ZPN A;  2J0J A;  3OG5 A;  3V60 A;  4XDC A;  1V2Y A;  4A90 A;  4P7I A;  1I4H A;  3MC0 B;  2L3Z A;  4AOF A;  4XX5 A;  3ZRC A;  2WDV B;  2G45 B;  4LDT D;  4MM3 B;  3E9S A;  3IT6 B;  2EEL A;  5BYS A;  2BT6 A;  3JVZ X;  3A1Q A;  3EHV A;  2FCQ A;  5JHB A;  4BFR A;  1NI2 A;  1EO6 A;  4GXB A;  1YN4 A;  1TT5 B;  2QSD A;  4GGQ A;  5LNK 1;  3ZTD A;  4MGY E;  5FR3 A;  2DWQ A;  2KAJ A;  5LLI A;  4S17 A;  5E6P A;  5EE9 A;  3Q6B A;  2WXH A;  1OTR B;  2MBE A;  1TIF A;  1YQ3 B;  4H2A A;  3M62 B;  3KVF B;  3SR6 A;  1E8W A;  1WF9 A;  2BYE A;  1CJE A;  3PLU A;  1FEH A;  1GG3 A;  3Q3J A;  3PPA A;  4L1B A;  4USA A;  1Q5W B;  5LXI B;  2JRI B;  2NBW B;  2BQQ A;  2KZR A;  3DBR I;  3VRB B;  1F0Z A;  3PSE B;  1MI0 A;  3U8Z A;  4I6L B;  2KO3 A;  1AAR A;  2L8J A;  1Q0W B;  2V3N A;  1SJH D;  3AE1 B;  4LJO B;  5D7G A;  4RGT A;  4HK2 A;  5H92 C;  2BKR B;  4TKN A;  4KVG B;  3UIO B;  2MA9 B;  2B76 B;  3SFE B;  3SD5 A;  3KH0 A;  1T6B X;  1B1Z A;  1WJ4 A;  1FIQ A;  1D6E C;  2HJ1 A;  2KWV B;  4GB9 A;  2AWT A;  3RYT A;  3AE3 B;  2QDF A;  2R2Q A;  1UBI A;  1XLO A;  3NZ3 A;  1V5O A;  3ZXR A;  4JIO U;  2ZPY A;  4ARC A;  2EKE C;  2GBM A;  4IDI A;  3R8B A;  4WIP A;  3FAH A;  4GOC A;  2NPT A;  1MHX A;  2YEP B;  3T8M A;  1UGJ A;  4R3D A;  3B08 A;  1MG4 A;  5GMV A;  2A4Z A;  3BK1 A;  4RCO A;  2N7J A;  2KMA A;  3BZD B;  2WU2 B;  3QK0 A;  4L2Y A;  3RPF C;  1JWU D;  2ZCC A;  1TBE A;  4BOZ B;  1N5W A;  3LB8 C;  5IN7 A;  4M00 A;  3RZW C;  2Y3A A;  3APD A;  1N6Z A;  5JXV A;  1ZUD 2;  4XWW A;  2NTS A;  4AS1 A;  1TZ1 A;  5D3D A;  2EMS A;  1TS4 A;  2NS5 A;  1UWM A;  1JWB D;  2NBV B;  3DVG Y;  1SF0 A;  1ZKH A;  2C7N B;  3R2T A;  4JWS C;  5J17 A;  3A9K A;  1E8Y A;  3HHM A;  1VCB A;  4M8N A;  1Y56 A;  2KJR A;  4DHZ E;  4OZC A;  4WWM A;  4ZRK A;  2XBB C;  2IYD B;  1C78 A;  4FUL A;  3L08 A;  1FXT B;  4W9D A;  3Q3N C;  1YN5 A;  2BS4 B;  5D3I B;  4PYU A;  3P63 A;  1L4Z B;  2DEN B;  3I57 A;  4ZHP A;  3L16 A;  2PPH A;  3AB5 A;  1FD6 A;  4YWG G;  2O6V D;  3KQ4 A;  2MWS B;  3M63 B;  3MC8 A;  1C4P A;  2LMC A;  3BVM A;  3IAS 1;  4X57 B;  4AJW A;  1JAL A;  4F8C B;  3BYT B;  3SFD B;  1L0V B;  2N9K A;  2LUM A;  2ZZP B;  1SE4 A;  1VRA B;  3N30 A;  3OLM D;  2L76 A;  4XDD A;  2GBR A;  3MHZ A;  1UBQ A;  2XNA C;  4G11 A;  3P42 A;  5HG2 A;  2INP E;  4W9H A;  1ESF A;  3RN9 C;  3I5J C;  2JY6 A;  2LJI A;  3KUZ A;  2Q5W D;  3W9C B;  3QA8 A;  4G50 A;  3UQB A;  4JX1 C;  2FUG 1;  4REZ A;  3HVD A;  4WQM A;  3ML8 A;  3LJ3 A;  1R4M B;  1GPX A;  4NJ6 A;  1V8C A;  4MJS B;  1SIF A;  2Z0D B;  4US8 A;  1VD2 A;  3TBL D;  3AU4 A;  2CHW A;  2MBQ A;  2KN5 A;  2K5P A;  3B2G A;  3Q3F A;  1GB1 A;  1STE A;  2GRI A;  3TEY A;  5CX3 A;  1MVK A;  2AQ2 B;  4OVU A;  1NYQ A;  2MSE D;  2HTM E;  1OFF A;  3DPD A;  5HI1 A;  1D5M C;  1TKE A;  4LK0 M;  2INN E;  1J7C A;  1L6V A;  4EUT A;  3KYC D;  3PV1 A;  3TL5 A;  3OAW A;  3RNE C;  1D4B A;  5KHQ A;  2X38 A;  2GMI C;  3NJT A;  3ETR A;  2N0S B;  3Q14 C;  4IW0 A;  2AQ3 B;  1P7E A;  4A3O A;  1E10 A;  3TEX A;  2IGG A;  2BF8 B;  4NQL B;  3V6E B;  4J6I A;  4KV2 A;  1ET6 A;  3D32 A;  3PHX B;  2OJR A;  1EU3 A;  2WXG A;  1EU4 A;  4Q2J A;  1U4A A;  3R7Q A;  2WXQ A;  1R4N I;  3ZDT A;  3NVV A;  4C80 A;  3HVZ A;  4IUM B;  2AEH A;  1DOX A;  3K9P B;  3V62 A;  2IND C;  1RFK A;  5DPT A;  4A8X C;  3EFC A;  4NAW B;  3VUW A;  5IO9 A;  1EUV B;  4YTP B;  2GBJ A;  3H1U A;  2EKI A;  3VFK A;  1HQR D;  3QX1 A;  4KSK C;  4IWQ A;  1AW7 A;  3Q3O C;  5BYQ A;  4A55 A;  5BO4 B;  2WDQ B;  2MJE A;  4MJS A;  4DQO C;  3IBE A;  1P9D U;  4II2 B;  3CWI A;  1IBX B;  2WQY B;  2LGD A;  3R66 C;  4PS3 A;  2NVU I;  1MG8 A;  2D3B A;  2WLB A;  3BWU D;  5C23 A;  1HZ6 A;  3VVW B;  4HJG E;  2FNJ B;  3O65 B;  3KWV A;  4EE2 A;  3EC8 A;  2K8H A;  2BYF A;  1WIA A;  3ZIM A;  3IT4 B;  4LJP B;  3BII D;  1JRP A;  1BT0 A;  3T3O A;  1R4M I;  3SHQ A;  1D5Z C;  3AN1 A;  3UIN B;  2M0A A;  5TR5 A;  3PRP B;  2GI9 A;  3BVZ A;  1TYG B;  4DDG D;  3BIN A;  3IHP C;  5KHO A;  5D6J B;  4GMV A;  2DX5 B;  3C19 A;  2DYO A;  4IG7 B;  2D5G A;  2CU3 A;  4A3P A;  1C9F A;  2IO1 B;  3VH3 B;  3W5V B;  1SB3 C;  1Z2M A;  1K52 A;  2MRP A;  4ZHO A;  4HPM B;  2PKO A;  1WI0 A;  2NBU A;  4ZRI A;  2I2Y A;  2N9L A;  3WAP A;  3QAQ A;  1AWD A;  1J19 A;  3NY5 A;  2FBW B;  2AL6 A;  3HM6 X;  1HXY D;  1FNW A;  3MTN B;  2BKF A;  4YTM B;  3U52 E;  4FAD A;  4MM3 A;  2K25 A;  5IOI A;  3W1S C;  1FO4 A;  2LHD A;  3TIX A;  4B6W A;  2D2Q A;  2DYM A;  4WJO A;  1PYW D;  1ZOY B;  4WJQ A;  1JWS D;  3SU8 X;  2JYE A;  4NQK E;  4K7U A;  4W9J A;  1WGH A;  4FXC A;  2L7R A;  2WXI A;  1RM6 C;  3QIJ A;  4HDQ A;  3N1X C;  3B1L X;  3H7P A;  2GBN A;  3ZQ4 A;  2IDY A;  1WRD B;  2JRH A;  3V61 A;  2LXC A;  3GOE A;  4IWP A;  2E6X A;  1WXV A;  2KHW B;  1OGW A;  3QJZ A;  4NNJ B;  2I1J A;  2ZJD A;  4DHJ D;  1SBB B;  2XK5 A;  1JCK B;  3W5U B;  1FNU A;  1L0Y B;  5G5H A;  4FJV B;  3TJP A;  1NEN B;  2WX0 A;  4JWU C;  1ZE3 D;  2CHX A;  3P2B A;  1WX8 A;  3VXW A;  5AZG A;  3QCA A;  4HCN B;  3AE6 B;  1N63 A;  4N9F 4;  3W2D A;  4HPL B;  3LXF A;  3NHE B;  4J3O D;  3Q8B A;  2ONQ A;  4IOI E;  1DYQ A;  1RWS A;  2JVC A;  4EOY A;  2KFK A;  4WUR A;  2KDE B;  1S3S G;  2V9H A;  2GOW A;  1L2N A;  1WGK A;  2IBI B;  2QIL A;  3NS8 A;  2RPV A;  1LM8 B;  1A5R A;  3A1Q B;  2JPH A;  2ZCB A;  4DXA B;  2VZK D;  4YSZ B;  1I4P A;  1CK1 A;  4C4V B;  4WJP A;  2M8S A;  4IKG A;  3VQI A;  1R4N B;  2GB1 A;  1IPG A;  3AED B;  3GB1 A;  2KTR B;  2ZVO A;  3DWG C;  1QOB A;  1UZX B;  3AEB B;  3DWM A;  1IGC A;  3DOW A;  4P16 A;  1MJD A;  1N5X A;  1XF5 L;  3L0W B;  2RDB C;  3V6C B;  2WXJ A;  4ASW C;  2J53 A;  2BS2 B;  1D3Z A;  1SE2 A;  3S2A A;  2RR9 A;  1I35 A;  4YT0 B;  1CZP A;  1XCQ L;  3N32 A;  1I4R A;  5AUI A;  4ZOH C;  4CO7 A;  4BKS D;  4HKZ E;  3ZRF A;  1V49 A;  3KYD D;  2K0P A;  4MSQ B;  4W9C A;  3UQA A;  1WXS A;  1XLN A;  2KYW A;  3WAO A;  4GU2 A;  2BYV E;  4JPS A;  1N62 A;  2WXO A;  2JSV X;  2D3C A;  3ZTC A;  1QF6 A;  4MEM A;  2IZV B;  3TEW A;  1KTK A;  2JQR B;  5DPR A;  1OQQ A;  1T0Q C;  3P4S B;  4C7Z A;  5D2M B;  3ML9 A;  2LRW A;  4BZA A;  1ZXH A;  4OVZ A;  4BKG A;  3L54 A;  4RNA A;  1UNS A;  4KSL C;  1NDD A;  3APC A;  4MGZ E;  3NVW A;  3N9Y C;  2V4L A;  2AYO B;  3PRE A;  3NZS A;  1LXD A;  2MBO A;  1VLB A;  1WJ6 A;  4WH4 A;  4WWO A;  1NVI D;  2LVP A;  4GIV A;  4IM3 A;  1JWA D;  4TQ0 A;  3ALB A;  2K3U A;  4RF1 A;  5EE1 A;  2WP9 B;  3WAL A;  4BKT A;  1BXT A;  1WGR A;  1XLP A;  2N1W A;  4JL9 A;  3AEC B;  4PS7 A;  3ZLZ A;  1WXM A;  2ZW0 A;  2L1A A;  2PVO D;  3JYU A;  2JZZ A;  4HLE A;  1LQB A;  1H4R A;  1WR6 E;  1JWM D;  2KD0 A;  4RGM A;  2WU5 B;  3K9O B;  4CYE A;  2KWU B;  5E6N A;  3A9K B;  3P4P B;  2YLM A;  2WWZ A;  4BOS C;  2ZNV B;  4WWP A;  4A9A A;  3R2I A;  2PLP A;  1GJZ A;  1P0R A;  1GC7 A;  2LZ6 A;  1PUT A;  4MEL A;  2C9W B;  1WM2 A;  2D3A A;  2DAJ A;  3LYY A;  2J4X A;  4HRO A;  4FJZ A;  1XLQ A;  3Q8A A;  4BAX A;  3ZW3 A;  4KZC A;  3WIM A;  4W9I A;  2MW5 A;  3PGE A;  2RSU A;  4RM9 A;  3PLV A;  2KNB A;  3E56 A;  3EEC A;  2WHI A;  2C5L C;  3Q2A C;  4CQN A;  1V1P A;  2JYT A;  2EMT A;  3FC4 A;  5AUK A;  1CQV A;  2ZW1 A;  1H8C A;  2LD9 A;  4URK A;  1K8R B;  4FHJ A;  4G3X B;  2W54 A;  2O2V A;  4ZRQ A;  3PS6 A;  1OQY A;  2KDM A;  1FM0 D;  3X23 A;  3NUH B;  3MFG A;  2V3P A;  3PZ8 A;  3FKY A;  4JQW C;  1I4G A;  2ON8 A;  2MP2 B;  2DZM A;  4MDK E;  3B0A A;  3RCZ A;  4KIK B;  1QIL A;  4YTN B;  3DBH I;  4E71 A;  5H8Y E;  5C1Z A;  1N61 A;  1BUI C;  1QKZ A;  3ZUN A;  2L32 A;  3ZJT A;  3AE5 B;  3MC9 A;  1WFY A;  3LDZ E;  2R2O A;  2DYB A;  2DHZ A;  2MEK A;  2DLB A;  4KDL B;  5FK9 C;  2DAF A;  4PT5 A;  5JZE B;  1NEK B;  2K39 A;  2LVQ A;  4AJY B;  4S0R A;  5T8I A;  3AEA B;  5BMH A;  1VR9 A;  2J0K A;  3DHI C;  1WX7 A;  4JLC A;  3DBR B;  3RT3 B;  1WGG A;  4DBG A;  4RM8 A;  2W55 A;  3U7D A;  3A4R A;  2PTL A;  3MJW A;  1SJE D;  3FIL A;  2CKH B;  4K1R B;  2X8X X;  2KVZ A;  3AV8 A;  4KGT A;  1C1Y B;  2DZI A;  1LO5 D;  5IA7 A;  2WXK A;  4HDO A;  2N9X A;  1YX5 B;  4KDI C;  3N20 C;  4MAC A;  3IFW B;  1FXA A;  5L95 C;  3VTU A;  1V1P B;  3DQV A;  3EGR A;  1WX9 A;  3RUL A;  5TSS A;  3OJ3 A;  3PTF C;  5D94 A;  4MGK E;  3T3N A;  2IGH A;  2O2V B;  4WQO B;  4MH0 E;  1XD3 B;  2NMQ A;  3TMP B;  4F7Z A;  1GB4 A;  4OZA A;  4FN2 A;  2KXJ A;  2VRR B;  4NAW A;  1PGB A;  3DBL I;  2L00 B;  4KIK A;  3EA6 A;  4E3C A;  4YSX B;  5DCN A;  2KDF B;  3AXC A;  2GLS A;  5E6J A;  1QOF A;  3AEG B;  1P1A A;  1EM7 A;  2IPK D;  2SEB D;  3CIR B;  3DHH C;  4GDK B;  4WAA A;  4IC7 B;  3VH4 B;  1Z5S B;  2OOB B;  1M4V A;  5G5G A;  1T0S C;  1ENF A;  3WCQ A;  1FCC C;  5MPO A;  4I6P A;  4YXD B;  3BK2 A;  5HFY A;  4RGO S;  3VTW A;  2N4F A;  2FCM A;  1FPY A;  1UF0 A;  3PT2 B;  2BTE A;  1PFD A;  5HHD G;  3PHW B;  2LGS A;  2IO2 B;  3FIL B;  2XK5 B;  1VZ8 A;  1TY2 A;  3NVY A;  4KKJ A;  1ROE A;  4WJN A;  1TKY A;  1C79 A;  4RGN A;  2LJ5 A;  4EZK A;  2JX5 A;  2PW9 A;  1G6J A;  1YJJ A;  2JT4 B;  2SAK A;  2WNM A;  4BVU C;  2CU1 A;  1WXA A;  2ZVN A;  3DVN U;  4XWT A;  1RAX A;  4KGS A;  3APF A;  1OEY J;  1PGX A;  1FNV A;  1V9J A;  4DHZ B;  1V80 A;  4DHJ B;  2L83 A;  3BY4 B;  1WZ3 A;  2Z59 B;  2BGF A;  1D5X C;  1YX6 B;  4II3 B;  1DOI A;  2DBY A;  3QQ8 B;  2OJW A;  4YSY B;  1MFW A;  1LGR A;  4LTU A;  3VHT C;  4GDL A;  1L7Y A;  3U2S C;  4FA6 A;  3RUI B;  3L17 A;  4NY0 A;  4LNN A;  1WMH B;  2LGX A;  2UU7 A;  1SSN A;  4ANV A;  2FUH B;  3DBS A;  2IY0 B;  1E8Z A;  2LUE A;  2WXN A;  2MLB A;  1FMA D;  3AU5 A;  3N1Z C;  5CTR C;  4MGI E;  1XCT L;  2CR5 A;  3H7P B; 
#chains in the Genus database with same CATH homology
 2I38 A;  4RCO A;  4P16 A;  2N7J A;  3BZD B;  2WU2 B;  4L2Y A;  2WS3 B;  1N5X A;  3RPF C;  1XF5 L;  2J52 A;  1JWU D;  1WSP A;  1C77 A;  3NRZ A;  1N5W A;  3LB8 C;  2WXJ A;  3AEE B;  2J53 A;  1TS3 A;  2BS2 B;  2Y3A A;  1SE2 A;  1T3Q A;  4YT0 B;  5JXV A;  2CJN A;  1CZP A;  3VRA B;  1XCQ L;  1I4R A;  5AUI A;  4ZOH C;  2G9H D;  4ZYS A;  1ZUD 2;  4XWW A;  2NTS A;  4AS1 A;  5D3D A;  4GLS C;  1L5P A;  4HKZ E;  1E0Z A;  1TS4 A;  1UWM A;  1JWB D;  2L52 A;  4NJC A;  2W3R A;  4OZB A;  2BB6 A;  1SF0 A;  1FFV A;  3R2T A;  1JRO A;  4JWS C;  2K0P A;  4NZL B;  1KFY B;  3H8H A;  1AYF A;  1XLN A;  3V3X A;  5BYR A;  1Y56 A;  4JPS A;  1N62 A;  4OZC A;  4WWM A;  3AEF B;  2Y5C A;  2WXO A;  2JSV X;  1C78 A;  1I4Q A;  2V0G A;  2LEK A;  3U7Z A;  1VJK A;  1QF6 A;  4O1N A;  1HEZ E;  4LLG M;  3Q8E A;  3TEW A;  4OW0 A;  1KTK A;  2FE8 A;  2JQR B;  2RDH A;  1ZP0 B;  1FFU A;  1OQQ A;  1WXQ A;  3Q69 A;  1YN5 A;  2BS4 B;  5D3I B;  3P63 A;  1L4Z B;  3KWL A;  3P4S B;  4MT5 A;  1SXT A;  3I57 A;  4C7Z A;  4GDL B;  4ZHP A;  1ZXH A;  4US9 A;  3AB5 A;  4OVZ A;  1FD6 A;  4YWG G;  4RNA A;  1UNS A;  2ACZ B;  1TS5 A;  3NVW A;  3KQ4 A;  3N9Y C;  2WXL A;  1C4P A;  2LGI A;  2LMC A;  3BVM A;  3IAS 1;  3NVZ A;  1JAL A;  2PIA A;  3ZGZ A;  4DXF A;  1YJI A;  3BYT B;  3P4Q B;  1L0V B;  3SFD B;  3W1S A;  2N9K A;  1QLB B;  2LUM A;  1VLB A;  1SE4 A;  1VRA B;  2WXF A;  2WXP A;  4WH4 A;  2H89 B;  4A6Q A;  1NYR A;  1NVI D;  1TKG A;  4XDD A;  3MHZ A;  2V4I B;  2XNA C;  3AE2 B;  4XE0 A;  1TZO A;  3P42 A;  3ZJU A;  3IAM 1;  5HG2 A;  2INP E;  3AMZ A;  1ESF A;  3NS1 A;  1JWA D;  2LJI A;  4TQ0 A;  3AH7 A;  1JQ4 A;  1VZ7 A;  2HDE A;  2K3U A;  2QJL A;  3P1M A;  3J9C A;  4RF1 A;  5EE1 A;  2WP9 B;  2Q5W D;  2VZK B;  3W9C B;  4KGR A;  1GOZ A;  4JX1 C;  2FUG 1;  4REZ A;  1BXT A;  3HVD A;  4WQM A;  1XLP A;  3AEC B;  3I9V 1;  2ZW0 A;  2L1A A;  2PVO D;  2OED A;  1YNT E;  1DGJ A;  4P6V F;  3C8Y A;  1GPX A;  1V8C A;  3B2F A;  1JWM D;  4US8 A;  1EWY C;  4RGM A;  1KRH A;  3TSS A;  5C2T B;  2WU5 B;  1VDV A;  4TQ1 A;  1ZXI A;  2K5P A;  3B2G A;  1GB1 A;  1STE A;  3P4P B;  2GRI A;  3ZYY X;  1EWC A;  1MVK A;  3TEY A;  3OWE B;  2AQ2 B;  3TUO A;  4A9A A;  3R2I A;  1GAQ B;  2PLP A;  1NYQ A;  4UDU C;  3L4P A;  1N60 A;  4HEA 1;  4HRS A;  1WWT A;  1K53 A;  2TSS A;  2WDR B;  2RMM A;  1SEB D;  2HTM E;  1OFF A;  1PUT A;  4ZRP A;  5HI1 A;  1D5M C;  5I4D A;  3LYY A;  1TKE A;  2J4X A;  4HRO A;  4LK0 M;  2INN E;  1XLQ A;  3Q8A A;  1J7C A;  1VZ6 A;  2PMV A;  1L6V A;  1KH0 A;  3AE4 B;  4JE3 B;  1DOY A;  2JZP A;  1ET9 A;  2R61 A;  2IJ0 A;  1D4B A;  2X38 A;  1HA5 A;  2M56 B;  3ETR A;  2N0S B;  3E56 A;  4N59 A;  1F2R C;  2NTT A;  4TSS A;  2AQ3 B;  1P7E A;  2LHE A;  3AE7 B;  4RFB A;  1E10 A;  3TEX A;  2IGG A;  2W3S A;  1ET6 A;  4CQN A;  1V1P A;  2JYT A;  1C76 A;  3FC4 A;  5AUK A;  1CQV A;  1EU3 A;  1PDX A;  2ZW1 A;  2CJO A;  2WXG A;  1EU4 A;  4Q2J A;  1E6E B;  4N6E B;  3RFZ B;  2W54 A;  2WXQ A;  5EE0 A;  2M19 A;  4ZRQ A;  1KLU D;  2KDM A;  3NVV A;  2WXR A;  4WAF A;  2E3T A;  1FM0 D;  4C80 A;  3HVZ A;  3NUH B;  1YMH E;  1DOX A;  1XO3 A;  3MFG A;  2V3P A;  3MP9 A;  5BMI A;  3PZ8 A;  1RFK A;  1YN3 A;  3VR9 B;  4A8X C;  1I4G A;  2YEP F;  1UWX A;  3HUI A;  4NAW B;  2ON8 A;  4C56 C;  1FRD A;  4YTP B;  4TMA B;  3MJ5 A;  1C4A A;  2JU6 X;  1KF6 B;  2EKI A;  1QIL A;  4YTN B;  1HQR D;  5H8Y E;  2WXM A;  3HRD D;  3Q8C A;  1FRR A;  3VR8 B;  1AW7 A;  1V97 A;  1WRI A;  5BYQ A;  1N61 A;  1BUI C;  4A55 A;  1QKZ A;  1J7A A;  2JWU A;  2L32 A;  5GXG B;  3ZJT A;  2WDQ B;  3AE5 B;  2MJE A;  4DQO C;  1UUP A;  2K9X A;  3CWI A;  1T5X D;  1IBX B;  2MEK A;  2DLB A;  2WQY B;  4RH6 A;  2KQ4 X;  2G1E A;  5FK9 C;  2WLB A;  3BWU D;  4PT5 A;  4C7Y A;  1HZ6 A;  1NEK B;  4HJG E;  1SE3 A;  1OQR A;  4EE2 A;  3KWV A;  1FCL A;  5T8I A;  3AEA B;  5BMH A;  1VR9 A;  1IBX A;  3KLS X;  4DXG A;  3U4E G;  4B0M A;  3IT4 B;  3ZJV A;  3BII D;  1JRP A;  1QQR A;  2W55 A;  2Y5P A;  1Q10 A;  4L23 A;  3T3O A;  1JML A;  2PTL A;  1SJE D;  2Z8L A;  2PVG C;  3FIL A;  1TJE A;  2K22 A;  5BMG A;  1D5Z C;  1YQ4 B;  3AN1 A;  2M0A A;  4AQ7 A;  2GI9 A;  3BVZ A;  1TYG B;  3AV8 A;  1JW9 D;  4KGT A;  1LO5 D;  2WXK A;  2AQ1 B;  4KKI A;  1L0X B;  2KWD A;  1K50 A;  4MAC A;  1ZPS A;  2DYO A;  2D5G A;  2MJ3 A;  2CU3 A;  4RF0 A;  1FXA A;  1L6U A;  1C9F A;  1V1P B;  4HKQ A;  3EGR A;  5TSS A;  3UI3 A;  1E7P B;  2KN4 A;  3W5V B;  1V1O A;  1SB3 C;  1K52 A;  4M0W A;  3PZ7 A;  1ZDV A;  3BYY B;  1IGD A;  4ZHO A;  3T3N A;  2IGH A;  4MH8 A;  3SEB A;  1QOG A;  2PKO A;  3PO0 A;  2LFI A;  2XN9 C;  2NMQ A;  2I2Y A;  3BVG A;  1GB4 A;  2N9L A;  4OZA A;  2MJD A;  1AWD A;  1QT9 A;  4KX6 B;  3AE9 B;  1B9R A;  3Q8F A;  1PGB A;  2FBW B;  2ICI A;  4D2K A;  1J7B A;  1K51 A;  3GP7 A;  1HXY D;  2QEJ C;  3P4R B;  1FNW A;  2BBC A;  1PGA A;  4YTM B;  3EA6 A;  2BYT A;  3B9J A;  3U52 E;  4YSX B;  1NI3 A;  1XXG A;  2KMM A;  4ITK A;  1KLG D;  3DWM A;  3IXS A;  4XDC A;  5E6J A;  4A90 A;  1I4H A;  1QOF A;  1FO4 A;  2LHD A;  3MC0 B;  3AEG B;  5C3J B;  3AM9 A;  2WDV B;  1I4X A;  1EM7 A;  2IPK D;  2SEB D;  4MM3 B;  3E9S A;  3CIR B;  3IT6 B;  2EEL A;  5BYS A;  2BT6 A;  4GDK B;  1ZDX A;  2OHF A;  2DYM A;  4OHJ A;  1PYW D;  1SIJ A;  1AN8 A;  2MH7 A;  2BS3 B;  1YN4 A;  1ZOY B;  2QSD A;  5LNK 1;  1BML C;  1JWS D;  1M4V A;  2JYE A;  2KAC A;  5FR3 A;  2DWQ A;  2KAJ A;  5G5G A;  1XEE A;  1ENF A;  5EE9 A;  1FCC C;  3WCQ A;  2H88 B;  2WXH A;  5FKA C;  5MPO A;  4YXD B;  3BK2 A;  4FXC A;  5HFY A;  4RGO S;  2WXI A;  1RM6 C;  1YQ3 B;  4H2A A;  3EUB 2;  2BTE A;  3ZQ4 A;  1PFD A;  5HHD G;  3SR6 A;  2IDY A;  3FIL B;  1CJE A;  1FEH A;  1VZ8 A;  2E6X A;  1TY2 A;  1F77 A;  3NVY A;  4KKJ A;  1ROE A;  4ARI A;  2RDG A;  1TKY A;  4L1B A;  1C79 A;  4RGN A;  4USA A;  2JX5 A;  1F2R I;  1SBB B;  2PW9 A;  1YJJ A;  1JCK B;  2SAK A;  2WNM A;  3W5U B;  1TS2 A;  1FNU A;  1ACC A;  1L0Y B;  5G5H A;  3O13 A;  3VRB B;  1F0Z A;  4XWT A;  1NEN B;  4JWU C;  2J42 A;  1ZE3 D;  4KGS A;  3AE8 B;  1MI0 A;  2V3N A;  1PGX A;  1FNV A;  1SJH D;  1L4D B;  1MPE A;  3AE1 B;  5D7G A;  3AE6 B;  4N58 A;  4RGT A;  5H92 C;  2L83 A;  1N63 A;  1P7F A;  3W2D A;  1C4C A;  2B76 B;  3ABV B;  3LXF A;  1D5X C;  3V05 A;  3SFE B;  2ONQ A;  1DYQ A;  1RWS A;  2BW2 A;  3Q8B A;  4IOI E;  1T6B X;  1DOI A;  1B1Z A;  2DBY A;  4J3O D;  1FIQ A;  1D6E C;  2W82 A;  4YSY B;  1HZ5 A;  4NAM A;  1FXI A;  3AE3 B;  4WUR A;  4LTU A;  2JXT A;  1E9M A;  3U2S C;  2BB5 A;  1WGK A;  2QIL A;  1IUE A;  1MHH E;  1XLO A;  1RYJ A;  3URY A;  2IGD A;  2QMT A;  3GS2 A;  3NZ3 A;  1TY0 A;  1QOA A;  2RPV A;  2AX5 A;  1SSN A;  1R7S A;  2QIE B;  4ARC A;  2VZK D;  4YSZ B;  1I4P A;  1CK1 A;  4IDI A;  3R8B A;  4WIP A;  3TEZ A;  5EE3 A;  2WXN A;  4IKG A;  3FAH A;  3VQI A;  2GB1 A;  1MHX A;  1FMA D;  4B0E A;  2YEP B;  3AED B;  3GB1 A;  1UGJ A;  1A70 A;  1I7H A;  1XCT L;  4R3D A;  1WYG A;  3DWG C;  1QOB A;  3AEB B;  3BK1 A;  1IGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...