1HEZE

Antibody-antigen complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
61
structure length
61
Chain Sequence
EVTIKVNLIFADGKIQTAEFKGTFEEATAEAYRYADLLAKVNGEYTADLEDGGNHMNIKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complex between Peptostreptococcus Magnus Protein L and a Human Antibody Reveals Structural Convergence in the Interaction Modes of Fab Binding Modes
pubmed doi rcsb
molecule tags Antibody
molecule keywords KAPPA LIGHT CHAIN OF IG
total genus 15
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 2000-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1hezE00
2QMTA 2ZW1A 1F2RC 1FCLA 2IGHA 1FCCC 5HI1A 1EM7A 1KH0A 1QKZA 5HFYA 3MP9A 2KACA 1PGBA 3FILA 1YMHE 1P7EA 2LHDA 1K53A 2JWUA 1GB1A 1C9FA 1XCQL 1PGXA 1HZ6A 4OZAA 1GB4A 4WH4A 4IKGA 2PLPA 4KGRA 1Q10A 1ZXHA 2N9LA 4HKZE 2JXTA 2LGIA 1K50A 2LUMA 3GB1A 1P7FA 5BMGA 1D4BA 2RMMA 1MHXA 1IGCA 1MPEA 1K52A 4D2KA 2I38A 2IGDA 1MI0A 2PTLA 2JSVX 1UWXA 2JU6X 1JMLA 1HEZE 1K51A 2OEDA 1FD6A 4IOIE 4OZBA 2N7JA 2GB1A 5BMIA 2ONQA 1YNTE 1IBXA 3FILB 2KWDA 5JXVA 1IBXB 2K0PA 2KN4A 4KGSA 3V3XA 4MACA 2KDMA 5HG2A 2J53A 2PW9A 1IGDA 2N9KA 1XCTL 3UI3A 2JZPA 2KQ4X 1MVKA 4OZCA 2QSDA 4KGTA 2ZW0A 1PGAA 2IGGA 1MHHE 5HHDG 2RPVA 1HZ5A 2GI9A 2ON8A 4HJGE 2I2YA 1F2RI 2NMQA 2LHEA 2EELA 1XF5L 4GLSC 5BMHA 2J52A
chains in the Genus database with same CATH superfamily
1J0GA 2BPSA 2VRRB 4C00A 2DAFA 4AOFA 1E10A 3OJ4B 2DZJA 4US8A 5HFYA 3O13A 4KIKA 2MEKA 2IO0B 4G0NB 1PGBA 4LNIA 2E6XA 4W9EA 3EGRA 4II3B 3U7ZA 3HVZA 1P1AA 4OVUA 1PGXA 4GDKA 4PT5A 3OG5A 4LJPB 5KHQA 1LQBA 4CHKA 2ASQA 4MT5A 2LJIA 1SE3A 2AEHA 3C0RB 3AE6B 4FN2A 3TJPA 4FXCA 2BYVE 2WXLA 4J3OD 2LJ5A 3A9JA 2D11A 3NS8A 4A3OA 1FIQA 2D3BA 4B6WA 3N1ZC 2CKHB 3IFWB 4K3CA 5C2TB 3K9OB 3Q8CA 2UU7A 1HQRD 3HRDD 2N7JA 1T3QA 2V3PA 5BMIA 2WXNA 3U7DA 1ZGUB 4RGTA 5H92C 3DVNV 2HD5B 1L7YA 5AUIA 3VDZA 3BK2A 3RZFA 2D2QA 3DBLI 2JWZA 2GBNA 4GDKB 3UINB 3U2SC 5FR6A 2GMIC 2N9KA 3PZ8A 4W9KA 2BWES 1TT5B 2DYOA 1F0ZA 4EZKA 2CR5A 2A4ZA 2G45B 3TEYA 2LXCA 1SBBB 4WWNA 4K3BA 3Q8BA 2BKRB 5BO4B 2EELA 2PKOA 2N1WA 5MPOA 1WGHA 3AN1A 2O2VB 5G5HA 4NAMA 1QOGA 3Q14C 1WGYA 3VUWA 1SGHA 3KW5B 3B1LX 4XWWA 1OGWA 3DBRB 3RNEC 2WXOA 1UF0A 3ZIMA 2DAJA 2X38A 4XE0A 2MHJA 2O6VA 1WX7A 2PE6B 2ZVNA 1SJHD 5E6PA 1LXDA 4KZCA 2G9HD 4G11A 2B76B 4P7IA 3VUYA 3RULA 3NVWA 1DGJA 3X0WA 3AEGB 2PLPA 3HVDA 3L17A 4FA6A 5AEKB 3DBSA 4K81A 4MGYE 1JWBD 1WXMA 4NJ7A 1TS5A 2QDFA 2YEPF 2JVCA 2N4FA 2L0TA 3QAQA 2W55A 5AZHA 2NTTA 2KFJA 5LXHA 1WXSA 3VRBB 3Q2AC 1VLBA 3W2DA 1VD2A 2ICIA 2MSED 1AARA 3KQ4A 3GS2A 3DWMA 5TR5A 1KM7A 4DHJB 4DHJD 1SB3C 1YQ3B 1HTQA 1F9JA 3OWEB 5D94A 1I4XA 3QA8A 3B9JA 1EWYC 3P63A 2KN4A 4LNOA 4B95A 5FR3A 3R7RA 2PW9A 1R4MI 4M00A 4RF0A 3B0AA 1JCKB 1XLOA 2INDC 2BS4B 2NBVB 1YQ4B 2K8BA 1MHHE 4ANWA 2L3ZA 1HZ5A 2L05A 4LNKA 3L13A 3N1XC 2BYFA 2RGFA 2I2YA 1HA5A 1KF6B 1E5WA 3KWLA 4N9F4 3Q8EA 2KFKA 3NVYA 5D6JB 1PUTA 2KKCA 3VAWA 4NJ6A 1FXAA 3VTUA 2QMTA 2QJLA 1MG4A 5JH5C 3Q3MC 4W9GA 4WWMA 2IGHA 4MM3B 4XWTA 5JZEB 1C1YB 1UD7A 4MELA 2GBJA 2N9PC 1QF6A 1V9JA 3GE8C 3MP9A 2CU3A 1LM8B 4ZYNA 4HPLB 3ZNID 4C80A 1P3QU 1FFVA 1VRAB 1GB1A 1V2YA 2Q5WD 1RWSA 3ZYYX 4C4VB 1GB4A 1WM2A 4DWFA 2N9LA 1PDXA 3TCAA 3GP7A 3RMKC 1I4RA 1TGZB 1P7FA 1TZOA 2INNE 1SE2A 1WGDA 5D3IB 3P4PB 4MGZE 2KVZA 4BFRA 1VJKA 2KC1A 2W3RA 4WJOA 4ZRKA 5IN7A 3V05A 2JSVX 3ZRFA 4DDID 2QHOA 3DVGX 1YJIA 2FBWB 1WM3A 1GJZA 4A3PA 1OQRA 2DYMA 3A4RA 5EE1A 4ICUA 4WQMA 1FNVA 3PS6A 1RLFA 3X23A 1RFKA 1WYGA 3FILB 4RFBA 1N63A 1UGMA 4GXBA 2L0FA 2LXAA 1ET9A 1SIJA 3LJ3A 1QT9A 4I6PA 1IPGA 1MVKA 1FNWA 2EKEC 1DYQA 1E7VA 2IGGA 3RFZB 2M8SA 1L4ZB 1WGKA 3NY5A 2PIAA 1N62A 1BUIC 2ON8A 1C4AA 1FO4A 1TTNA 2MH7A 3MC9A 2L8JA 2SEBD 5J18A 1ZUD2 3N32A 4HPPA 3BK1A 2WX0A 1F2RC 3WIMA 5EE9A 4JE3B 3IXSA 1PQSA 1XD3B 3APCA 2HTHA 5GMVA 4G3XB 4X57B 5LXIB 4E71A 2WU5B 3A1QA 2OJWA 3DBHI 2MCNB 4OZAA 1ZDVA 2JRHA 1S1QB 1UGJA 2LZ6A 1WX8A 1FEHA 4NAWB 3ZTCA 3MC8A 4EOYA 3TMPB 3KUZA 1L2NA 3WAOA 1VZ7A 4NQLB 1J8CA 4NJCA 4KZ0A 3QCAA 3P4QB 1XEEA 1JMLA 3UIPB 1YX6B 1NYRA 2MP2B 1NVID 1LFDA 1F77A 2N1VA 4TSSA 1CK1A 4M8NA 1OQYA 2ONQA 4HROA 4URKA 4O1NA 1YIWA 3ML8A 1B1ZA 4IWPA 4DHZE 3A4SC 4YXDB 2BVCA 4IG7B 3GOEA 2R2OA 4MACA 2MBHA 3EHVA 2KO3A 5LLIA 1IGDA 3A9KB 5JHBA 3T8MA 4KGTA 1WH3A 3KUCB 2CS4A 5IO9A 4IWOA 1E6EB 2IO2B 2LGDA 4W9HA 5J17A 2MJEA 3IAS1 5CHVC 1GNUA 4RH6A 2WXHA 3H9DA 2JRIB 3ZLZA 2G4SA 1JWAD 4R3DA 1GG3A 3JSVA 4W9FA 3L54A 1EUVB 1D5XC 3FC4A 1N60A 3QC8B 3PREA 2IO3B 3VTWA 3WANA 1D6EC 3AXCA 2DZIA 2ZZPB 5CHWA 1WJNA 4F1SA 1E90A 3WCQA 2V4LA 2KNBA 1Q10A 1ZXHA 2JXTA 3FKYA 5T8IA 3CMMB 3PLUA 3MTNB 3VRAB 1TS4A 4BKSD 2JXXA 4KSLC 1NDDA 2R61A 3Q3FA 4XZ4A 3ZUNA 2L1AA 1XLNA 3AEDB 1SF0A 2L7RA 4TV3A 2XK5B 3DCGA 3ETRA 3BYTB 1CMXB 5CX3A 2D3AA 4N58A 4YSXB 3B2GA 4CO7A 3MHSD 2IYDB 1YOVB 1WZ3A 3U8ZA 3RZWC 1AN8A 4MSMB 1ISNA 2RDGA 3WAMA 1P0RA 1L6UA 3CSFA 4K1RB 4ANXA 2MBBB 3PHXB 2JT4B 2NTSA 4ARIA 2EMTA 2LI5A 5KHOA 3L0WB 2KX0A 4XC2A 4IM0A 2JQRB 4XDDA 3M63B 3ZDMC 4UDUC 1FRDA 1WJUA 4BZAA 1TY0A 2O6VB 1T0QC 4FJVB 3Q3JA 1LGRA 2WDRB 3GZNB 4LNNA 2H89B 3NRZA 2KDBA 3C19A 1GC7A 3P2BA 3OLMD 2ZEQA 3T3NA 4PS3A 1YMHE 1FRRA 1K53A 1M4VA 2MW5A 1XCQL 1N6ZA 2BW2A 1WIAA 2BWFA 3TBLD 1UZXB 1TKYA 4WH4A 2KZRA 1NI2A 3R2IA 4IKGA 1WGRA 1ZOYB 2JF5A 1OQQA 2AQ2B 2KDFB 3B08A 2QC8A 4L2YA 2WXIA 1FPYA 3TEZA 3ZO5B 2JY6A 2BS3B 3SU8X 4LDTB 1YN3A 2N7DA 2IGDA 3EC8A 4DDGD 1C78A 2J0JA 2RSUA 1NYQA 2LGXA 1KTKA 5AUKA 2N9EB 1GOZA 4LJOB 1H8CA 2GBMA 3EECA 3SFEB 3PZDA 5E6OA 2INPE 1J7BA 4AJWA 3Q8AA 4GDLA 1T0RC 3DBHB 2JZZA 5L95C 3NJTA 3AH7A 3AECB 3EA6A 2KN5A 2KDMA 4AQ7A 3RNGC 3BY4B 2YVCA 2L83A 1R4NB 2NPTA 2UYZB 1G6JA 1P9DU 1V1OA 1JWMD 1V6EA 1S3SG 1C77A 2NCNA 2OHFA 2LWPA 3KUDB 3B2FA 4C4VA 4FJZA 5C3JB 2VZKB 2WXMA 1TS2A 4E3CA 2QILA 1WE7A 4GSWA 3NVVA 4Q2JA 3H1UA 4GMVA 3ZJTA 1IYFA 1UBQA 1ZDXA 1UNSA 2V3SA 1NEKB 1QKZA 1TS3A 3V6CB 3AEEB 2XN9C 3AE7B 4RF1A 3ZW3A 2KDIA 3IAM1 2CHWA 1XQQA 1R4NI 4DXFA 4I6LB 3BVGA 3SEBA 4REZA 5JHAA 2WDTB 2M0XA 2Y5CA 1JWUD 3TEXA 1D5MC 4KV2A 4S0RA 1FMAD 2BKFA 2I38A 2LGSA 3WA0A 4HVBA 4F8CB 1HEZE 2X8XX 1K51A 3APFA 1BMLC 4RNAA 4IOIE 3KH0A 4N59A 5DPTA 2OJRA 3L08A 3EFCA 2IZVB 4ICVA 4P6VF 1STEA 2DLBA 4PYZA 2MBEA 1Q1OA 2L52A 2KWCA 3AE2B 3P42A 1WE6A 2J53A 2ZCCA 3RPFC 1DOYA 1WXAA 1NBFC 1XO3A 2GLSA 3RT3B 2LRUA 2HJ1A 3E56A 2KWVB 4CQNA 2CHXA 1WXVA 3UQBA 3ZRCA 1PGAA 2WWZA 4PYUA 2WQYB 2RPQA 2BGFA 4BKTA 3AE1B 2J7QB 1QOFA 2ZPNA 2JYTA 2MBOA 4XDCA 3K9PB 1CZPA 2YEPB 1WY8A 4YSYB 3QIJA 2WNMA 1WZ0A 4EZLA 3VXWA 4HLEA 5IP4D 4OVVA 2JZ3B 3FILA 1FFUA 2E3TA 4ZRIA 4MH0E 3NZUA 1C9FA 4WWPA 1N61A 2C7MB 4W9IA 1I35A 1WRIA 3Q3NC 4DBGA 1L5PA 5J2RA 2XBBC 4HWIB 2Z0DB 3DQVA 2WXKA 1MPEA 1T0YA 4ITKA 4YTPB 3FAHA 1UH6A 3MFGA 1WRDB 4A90A 2M19A 1UWXA 4MSQB 2C5LC 2LVOA 2KMCA 4YSZB 3QJZA 2WXRA 3LXFA 1ACCA 1FM0D 2KAJA 2MJ3A 1V5OA 3PGEA 4HPMB 5FK9C 2REXA 1M94A 3PPAA 3WALA 3IBEA 3IHPC 1TBEA 1E7UA 4FLHA 3ZNHB 2AYOB 2M17A 4GDLB 1SSNA 1PFDA 2WXGA 4ZOHC 1T5XD 2K0PA 4KGSA 1WFYA 1C4PA 5HG2A 3PRMB 3H7PB 3GE3C 4WJNA 1XCTL 1J19A 1A70A 4OZCA 3JVZX 4QAYA 2QEJC 2RDBC 3NG0A 1E8WA 4WJPA 1V1PB 3MHZA 3AMZA 3ECIA 4DK5A 2RR9A 2KK8A 2LUEA 3W5UB 4ZYSA 3BINA 2K9XA 1HE8A 4BBNC 2C9WB 2EKIA 3DOWA 1EM7A 3BVMA 1KLVA 3Q6BA 4KIKB 1V80A 1L0VB 4BVUC 3ZNZB 1E8XA 5EDSA 4TQ1A 4PS7A 1BT0A 2D5GA 1TJEA 4RGMA 2LGIA 2AQ3B 2NR2A 1MHXA 3KWVA 1JRUA 3PZ7A 2ZVOA 2BF8B 1ENFA 1P98A 4TUUA 4GN1A 4HJKA 2WDQB 2PTLA 2DWQA 4A20A 4HKQA 1TKEA 2ZPYA 3VR8B 1WR6E 4DXGA 4NY0A 3L16A 1J7AA 1E8YA 4KKJA 1Y56A 4FHKA 5FKAC 3L4PA 1B9RA 2NBUA 1TIFA 3C8YA 1V5TA 2FE8A 2M56B 3HHMA 2N0SB 3DBLB 2W9NA 1XLQA 2TSSA 4YT0B 4ASWC 4DHZB 3ZJUA 1KOTA 2LFIA 3AB5A 4OW0A 1L6VA 3SDLC 4MDKE 2JPHA 1OFFA 1YX5B 2LMCA 3GZNI 1CQVA 2LHEA 3M3JA 2K8HA 3RI7C 2K6DB 2WGSA 2I1JA 5BMHA 3KVFB 3KLSX 1CJEA 4B0EA 4JX1C 3U4EG 4HCPB 3HUIA 4IM3A 1VDVA 1UBIA 3AEBB 1NENB 3DDCB 3LDZE 1E9MA 2MJDA 4A6QA 2YLMA 4IM2A 4DQOC 3AV8A 1ZW7A 3J9CA 3A9KA 2FCMA 1EF5A 2EMSA 2KJRA 4ZHOA 2DHZA 3A9JB 4B9KA 2RMMA 5DCNA 3RUIB 5BYQA 2B3AA 4IW0A 1VZ8A 2K25A 1TYGB 4A9AA 2KLCA 3HM6X 4HCNB 1V8CA 2QCZA 3ML9A 1UUPA 1QOBA 5BYRA 2ZCBA 3ALBA 5CHFA 4W9DA 4WWOA 3ZXVA 2FCNA 4W9CA 2D3GA 3DHGC 4CYEA 1C76A 4TQ0A 5C23A 4WJQA 1IBXB 4P16A 5DPSA 4KSKC 1SXTA 4M02A 1KRHA 2MBQA 2UWQA 2IDYA 4YWGG 2KVRA 1GUAB 4MEMA 5HHDG 2MP2A 1JW9D 4JWUC 5TSSA 5GXGB 1F2RI 2KTFA 2HDEA 2ZNVB 1YN5A 5IAAC 1XF5L 4IDIA 1V1PA 2LASA 1VCBA 4BBNF 2AL6A 4M0WA 3VVWB 1ZXIA 3ZNGC 1ZP0B 4W9JA 1RRBA 4XGAB 4K7SA 2KOXA 1KH0A 2CU1A 3CSTA 3VH4B 2IY0B 5AZGA 3AE9B 2VZKD 3KYCD 4EEWA 2KTRB 2HTME 3OAWA 4AJYB 3M62B 2DBYA 2G4DB 2C60A 4NAWA 1EU3A 1HZ6A 2QIEB 4JLCA 1BXTA 1VZ6A 2GRIA 1XT9B 1X1MA 4RCOA 5D7GA 2KQSA 4FHJA 2C7HA 2GOWA 3ZKJC 1D4BA 1IGCA 2WS3B 2IBIB 1T6BX 2BYTA 3PLVA 5EE3A 1N5XA 3M95A 1PYWD 3JW0X 3ONSA 4B0MA 2FCSA 2KXJA 4HDQA 4GB9A 1VR9A 4BKSA 4TKNA 3RNBC 1C79A 5I4DA 4XX5A 2Z0EB 4HEA1 3TIXA 2WX1A 3PSEB 4BOZB 4FULA 4M8MA 1JROA 3DBRI 3V62A 1NI3A 4ZRJA 3KYDD 3PT2B 3H8HA 3O65B 1XXGA 3P4RB 4MJSA 1WSPA 3UI3A 2CJNA 2DENB 2Y5BB 2LVPA 2Z8LA 4BKGA 4II2B 1L4DB 1I4HA 3Q8FA 2V3NA 1RYJA 1ZE3D 3N1YC 3H7SA 3NUHB 4HJGE 3R8BA 1QQRA 3RNAC 3W1SC 3HK0A 4WAAA 2MX2A 4L23A 2KX3A 3Q3OC 4GOCA 1HTOA 3N20C 3W9CB 4KKIA 2MRPA 5IOIA 2PVGC 3RNCC 2GBRA 5HI1A 2WYQA 3LB8C 4USAA 3AE5B 4RM9A 1HXYD 2BB6A 4OVZA 5D2MB 3QX1A 4LTUA 3NZ3A 2SAKA 2NS5A 1RM6C 2K22A 2N7EA 4IC7B 3BVZA 1F52A 3CF6E 4H2AA 4HKZE 4ANVA 2V1YA 3E9SA 5E6NA 2CJOA 3AM9A 3JYUA 5L83A 1FXIA 1TY2A 1K52A 3UGBB 3RCZA 3IG3A 1H4RA 2D3CA 1DOIA 3ZVVA 4L1BA 3IT6B 3H6NA 3U52E 1Q5WB 4NPNA 4FBJB 2K3UA 1JRPA 4JGHB 2AQ1B 1U4AA 2KJHB 3I63C 3DPDA 3VH3B 1YNTE 2V0GA 2VH2A 3P4SB 2CHZA 2KWDA 1N5WA 2KMMA 1RAXA 2KTRA 3AULA 3BWUD 2GBKA 2LD9A 4C7ZA 1GPXA 2NVUI 3NVZA 2K39A 1QLBB 2J42A 3PVLA 3UF8A 4MM3A 3RNFC 4J6IA 5DPRA 2KT7A 2IJ0A 2C7NB 3AE4B 2M4NA 3ZGZA 3I5JC 2JYEA 1DOXA 2WXQA 5G55A 4NQKE 1V49A 4AUQC 4JPSA 2V9HA 2BTEA 3ZDTA 4IWQA 2JUOA 2O2VA 2NMQA 2WDVB 3MC0B 3S2AA 2OOBB 4YTNB 4GLSC 1UELA 5HKHA 1KFYB 2L00B 3MJWA 4KDIC 4TMAB 1K8RB 4KVGB 4F7ZA 4FADA 2I1KA 3V60A 2M1MA 4RMAA 3TL5A 3VR9B 3EFUA 4M01A 1WJ4A 4P1CC 3A33B 3SR6A 5LNK1 1P7EA 2WP9B 3CIRB 3DWGC 3Q69A 1K50A 3U30A 2WXFA 4WIPA 1JQ4A 2ZJDA 2H88B 3TSSA 4I6NB 3R3MA 4EZJA 1Z5SB 2BB5A 2M0AA 3IVFA 3PTFC 1OEYJ 3VQIA 2OEDA 3NZSA 2K8CA 4OZBA 1GAQB 2KHWB 4GGQA 3VUXA 4K7WA 4YL8A 1RFAA 1IBXA 3RD2A 2BS2B 3AE8B 3A1QB 2WU2B 1Z2MA 2L76A 4N6EB 4ZHPA 2WXPA 1WJ6A 3AU4A 1ET6A 3PV1A 2W3SA 2W54A 2LRWA 1SEBD 3PHWB 1MG8A 1AWDA 4MH8A 2DZKA 4EE2A 4EFOA 2HJ8A 3WAPA 3T9LA 3OJ3A 2ZW1A 1SJED 3NHEB 2WHIA 3N9YC 4LCDE 2DNFA 2Y3AA 4DXAB 4G50A 2W82A 1SE4A 3AEFB 3L10B 2LHDA 2PJHA 3N3KB 2XNAC 1KJTA 3I57A 2D10A 1QOAA 2AL3A 3ZTDA 1GC6A 2Z59B 3DHIC 4JIOU 3DHHC 1IP9A 2KMAA 5IKCM 3SD5A 2KFKB 4KGRA 3QWZB 2J0MA 1ESFA 1YN4A 2BQQA 4HRSA 1ROEA 2MA9B 3I3TB 3BIID 4XYCA 1QILA 5C1ZA 3DVGY 2D07B 1E0ZA 4KX6B 2LVQA 2BBCA 4ZRPA 2JU6X 3PO0A 4LK0M 3P1MA 1WF9A 1TKGA 3SHQA 3HM3A 4RM8A 2IO1B 5H8YE 3EUB2 1JALA 3R2TA 4P1BC 5CTRC 3PRZA 2INCC 2FUHB 1FNUA 1I4PA 2R2QA 2K5PA 5G2NA 2FIFA 3V3XA 1WX9A 2LGYA 5D3DA 5E6JA 2Y5PA 4LLGM 2JZPA 4JL9A 3T3OA 2XK5A 1D5ZC 3HIZA 3MJ5A 1WI0A 2KD0A 1QZEA 3RYTA 3SFDB 4PK1A 2VH1A 1UWMA 3PRPB 4BOSC 2FNJB 2J52A 2KLGA 2NBWB 4ACFA 4AWJA 4ZDVA 1I4GA 3W1SA 5IA7A 4WAFA 3AI5A 2MWSB 3QQ8B 4AS1A 1FCCC 4K7UA 3H7PA 5AZFA 3QHTA 4PS8A 1ZPSA 2O6VD 1KLGD 4WURA 4BAXA 1EO6A 3CWIA 1XLPA 2BT6A 2KDEB 3VTVA 1MJDA 4LNFA 4HXDA 1WYWB 4C7YA 2N9XA 1V81A 4HDOA 2V4IB 1F1HA 2FCQA 1E8ZA 3GB1A 1L0YB 3R66C 1SIFA 2DZMA 1WR1A 1I7HA 4D2KA 1C3TA 4NZLB 2FAZA 3QARA 4C56C 2K6QA 4YTMB 3TUOA 4S17A 3V61A 1T0SC 4MGIE 2KYWA 4A55A 1AYFA 1YJJA 1FD6A 1R7SA 2AWTA 1YQBA 1V97A 2KQ7A 2BYEA 2MLBA 4EKUA 2GB1A 3R7QA 1R4MB 1EF1A 3D32A 2NPTB 1D3ZA 3ENEA 4MJSB 3ZJVA 2PVOD 2PEAA 2G3QB 5BYSA 4ANUA 2ZNVC 2PE9A 2KQ4X 2KC2A 1EWCA 4JQWC 4KDLB 2RPVA 3RN9C 1E7PB 3QK0A 4JWSC 4E74A 1ZKHA 1OTRB 2MQJA 1OEYA 2HE7A 5DPWA 4ZRQA 3ZXRA 2WLBA 2WXJA 2K1FA 3JSVB 1Y8RC 4A8XC 3BYYB 3I9V1 1YJ1A 1L0XB 1WXQA 4RGNA 1FCLA 1WMHA 1TZ1A 2KACA 3ZQ4A 3URYA 3NOBA 1FXTB 4MGKE 2JWUA 3BZDB 3ABVB 1SE9A 1J7CA 2LEKA 2RD0A 4ARCA 3V6EB 1WWTA 1I42A 2LUMA 4OHJA 5BMGA 3NS1A 2A5UA 4W9LA 3UQAA 4HK2A 4FJYA 1MI0A 2KJ6A 3AE3B 1C4CA 2DYBA 1MFWA 2J0KA 3TEWA 2L32A 2IY1B 4US9A 4WQOB 1LO5D 1AW7A 4EUTA 3AEAB 1JWSD 2DX5B 2PMVA 3IT4B 3VFKA 2ACZB 1IUEA 2PPHA 2FUG1 4IUMB 1EU4A 2FIDA 1A5RA 2KANA 1I4QA 2JX5A 4NNJB 5JXVA 1YD8U 3UIOB 3APDA 1Q0WB 2RDHA 1KLUD 2G1EA 4GIVA 5G5GA 2KWUB 4RGOS 2QSDA 2ZW0A 4GU2A 1WGGA 2AX5A 4LDTD 3W1YA 3VHTC 4AP4C 3DVNU 2GI9A 1V86A 2IPKD 3N30A 3AU5A 4M0WB 2J4XA 1WMHB 3W5VB 5EE0A 2XEWA 3LYYA
chains in the Genus database with same CATH topology
4TMAB 2K9XA 1JWAD 2EKIA 4R3DA 1E10A 1EM7A 4US8A 5HFYA 3O13A 3VR9B 2MEKA 1D5XC 3BVMA 1PGBA 3FC4A 3SR6A 1N60A 5LNK1 2E6XA 3EGRA 3U7ZA 1P7EA 1D6EC 3HVZA 1L0VB 1PGXA 2WP9B 3CIRB 3DWGC 4PT5A 4TQ1A 3WCQA 2D5GA 1TJEA 3Q69A 1Q10A 1ZXHA 4RGMA 2JXTA 2LGIA 2AQ3B 5T8IA 1K50A 3VRAB 4MT5A 2LJIA 1SE3A 1MHXA 2WXFA 3KWVA 1TS4A 4WIPA 3PZ7A 1JQ4A 3AE6B 1ENFA 4FXCA 2H88B 2WDQB 2R61A 2PTLA 2DWQA 3TSSA 4HKQA 1TKEA 2L1AA 2WXLA 4J3OD 2BB5A 2M0AA 1XLNA 3AEDB 3VQIA 1SF0A 1FIQA 3VR8B 4DXGA 1J7AA 3BYTB 3ETRA 4KKJA 1Y56A 2OEDA 5FKAC 5C2TB 3Q8CA 3L4PA 4N58A 4YSXB 4OZBA 1B9RA 1GAQB 3B2GA 1HQRD 3HRDD 2N7JA 1T3QA 2V3PA 5BMIA 2WXNA 1IBXA 4RGTA 5H92C 5AUIA 1AN8A 3BK2A 3C8YA 2FE8A 2RDGA 2M56B 2N0SB 2BS2B 3AE8B 4GDKB 1L6UA 2WU2B 1XLQA 3U2SC 2TSSA 4YT0B 4N6EB 3ZJUA 4ZHPA 2N9KA 2WXPA 3PZ8A 2LFIA 1ET6A 3AB5A 2DYOA 1F0ZA 2W3SA 4OW0A 1L6VA 2W54A 1SEBD 2NTSA 4ARIA 1AWDA 3TEYA 4MH8A 1OFFA 1SBBB 2JQRB 2LMCA 3Q8BA 4XDDA 4EE2A 1CQVA 2LHEA 2EELA 2PKOA 5BMHA 4UDUC 5MPOA 5G5HA 1FRDA 3AN1A 4NAMA 3KLSX 1CJEA 1TY0A 1QOGA 2ZW1A 2WDRB 4B0EA 4JX1C 3U4EG 1SJED 2H89B 3NRZA 4XWWA 2WXOA 3HUIA 3N9YC 2X38A 4XE0A 2Y3AA 3T3NA 1YMHE 1VDVA 2W82A 1SE4A 3AEFB 1SJHD 2LHDA 1FRRA 1K53A 3AEBB 1M4VA 1NENB 2XNAC 1XCQL 3I57A 2BW2A 2G9HD 1QOAA 2B76B 1E9MA 2MJDA 3NVWA 4A6QA 1DGJA 1TKYA 4DQOC 3AEGB 4WH4A 3AV8A 4IKGA 3R2IA 2PLPA 3HVDA 4KGRA 1ZOYB 3J9CA 1OQQA 1ESFA 2AQ2B 1YN4A 4HRSA 4ZHOA 4L2YA 2WXIA 1ROEA 3TEZA 3BIID 1JWBD 2RMMA 1QILA 2BS3B 1TS5A 5BYQA 2YEPF 1YN3A 2IGDA 1VZ8A 1TYGB 1C78A 2W55A 1E0ZA 2NTTA 4A9AA 4KX6B 1NYQA 4ZRPA 2BBCA 2JU6X 3PO0A 1KTKA 3VRBB 5AUKA 1V8CA 4LK0M 1GOZA 1UUPA 3P1MA 1VLBA 3W2DA 1QOBA 1TKGA 2ICIA 5BYRA 3KQ4A 3SFEB 3GS2A 5H8YE 2INPE 1J7BA 3DWMA 3Q8AA 3EUB2 1JALA 3R2TA 1SB3C 1YQ3B 4RH6A 3OWEB 1C76A 4TQ0A 3AH7A 1FNUA 1I4XA 1I4PA 3AECB 3B9JA 1EWYC 2K5PA 3P63A 1IBXB 2KN4A 3EA6A 3V3XA 4P16A 2KDMA 4AQ7A 5D3DA 5E6JA 5FR3A 1SXTA 2Y5PA 1KRHA 2PW9A 2L83A 4RF0A 2IDYA 4YWGG 4LLGM 1JCKB 1V1OA 1XLOA 2JZPA 2BS4B 1JWMD 3T3OA 1YQ4B 1D5ZC 3MJ5A 1MHHE 5HHDG 1HZ5A 1C77A 2OHFA 1JW9D 4JWUC 5TSSA 5GXGB 2I2YA 1HA5A 1F2RI 1KF6B 3B2FA 3KWLA 2HDEA 3SFDB 1YN5A 3Q8EA 1XF5L 3NVYA 4IDIA 1V1PA 5C3JB 1UWMA 2VZKB 2WXMA 1TS2A 2QILA 2J52A 1PUTA 4M0WA 1FXAA 1ZXIA 2QMTA 1I4GA 2QJLA 3NVVA 3W1SA 4Q2JA 4WAFA 1ZP0B 3ZJTA 4WWMA 4AS1A 2IGHA 4MM3B 4XWTA 1FCCC 1ZDXA 1UNSA 1KH0A 1NEKB 1QKZA 1QF6A 1TS3A 1ZPSA 3AEEB 3MP9A 2CU3A 2XN9C 1KLGD 3AE7B 4RF1A 4WURA 3AE9B 2VZKD 3IAM1 2HTME 3CWIA 4C80A 1XLPA 1FFVA 2BT6A 1VRAB 1GB1A 2DBYA 2Q5WD 1EU3A 1HZ6A 1RWSA 2QIEB 3ZYYX 4DXFA 3BVGA 4C7YA 1GB4A 1BXTA 3SEBA 1VZ6A 2GRIA 2N9LA 4RCOA 2V4IB 4REZA 5D7GA 1PDXA 2Y5CA 3GP7A 1I4RA 1JWUD 3GB1A 3TEXA 1P7FA 1D4BA 2INNE 1L0YB 1D5MC 1SE2A 1TZOA 5D3IB 3P4PB 1IGCA 1I7HA 2WS3B 1VJKA 4D2KA 1FMAD 2W3RA 2I38A 1T6BX 4NZLB 2BYTA 5EE3A 4C56C 1N5XA 4YTMB 3V05A 2JSVX 1PYWD 3TUOA 4B0MA 1YJIA 2FBWB 1HEZE 1K51A 4A55A 1BMLC 1AYFA 1YJJA 1OQRA 1VR9A 2DYMA 1R7SA 1FD6A 1V97A 4RNAA 4IOIE 5EE1A 1C79A 4N59A 4WQMA 1FNVA 5I4DA 2GB1A 4HEA1 1RFKA 1WYGA 3FILB 4RFBA 1N63A 4P6VF 3ZJVA 1STEA 2DLBA 2PVOD 1JROA 2L52A 3AE2B 1NI3A 3P42A 1ET9A 1SIJA 3RPFC 2J53A 1DOYA 5BYSA 1QT9A 1XO3A 3H8HA 1XXGA 3P4RB 1WSPA 3UI3A 3E56A 2KQ4X 1MVKA 1FNWA 2CJNA 4CQNA 2Z8LA 1DYQA 1EWCA 1L4DB 1PGAA 1I4HA 2IGGA 3RFZB 3Q8FA 1L4ZB 2RPVA 1WGKA 2V3NA 2WQYB 1RYJA 1E7PB 1ZE3D 2PIAA 1N62A 1BUIC 2ON8A 4JWSC 1C4AA 3NUHB 3AE1B 4HJGE 3R8BA 1QQRA 1QOFA 1FO4A 4L23A 2JYTA 4XDCA 1CZPA 2MH7A 2YEPB 2SEBD 2WLBA 2WXJA 4ZRQA 1ZUD2 3BK1A 3W9CB 4A8XC 4KKIA 3BYYB 3I9V1 1F2RC 2PVGC 5EE9A 4JE3B 1L0XB 1WXQA 3IXSA 4RGNA 1FCLA 5HI1A 4YSYB 2WNMA 3LB8C 2KACA 4USAA 3AE5B 3ZQ4A 1HXYD 3URYA 3FILA 1FFUA 2E3TA 2BB6A 4OVZA 2JWUA 3BZDB 2WU5B 4LTUA 1C9FA 1N61A 3NZ3A 3ABVB 2SAKA 1J7CA 1RM6C 2K22A 4OZAA 3BVZA 2LEKA 1WRIA 1ZDVA 4H2AA 4ARCA 1WWTA 4HKZE 1L5PA 3E9SA 1UGJA 2CJOA 2LUMA 3AM9A 4OHJA 1FEHA 4NAWB 2WXKA 5BMGA 3NS1A 1FXIA 1MPEA 4ITKA 4YTPB 1TY2A 1K52A 3FAHA 3MFGA 1MI0A 3AE3B 1C4CA 4A90A 1VZ7A 1DOIA 2M19A 1UWXA 4L1BA 4NJCA 3TEWA 3IT6B 3P4QB 2L32A 3U52E 4YSZB 1XEEA 4US9A 1JMLA 2WXRA 1LO5D 1ACCA 3LXFA 1AW7A 1NYRA 1FM0D 3AEAB 2KAJA 2MJ3A 5FK9C 1JWSD 2K3UA 2PMVA 3IT4B 1JRPA 1NVID 1F77A 2ACZB 1IUEA 2AQ1B 4TSSA 2FUG1 1CK1A 1EU4A 2ONQA 4HROA 1YNTE 4O1NA 4GDLB 2V0GA 3P4SB 1B1ZA 2KWDA 1SSNA 1I4QA 1PFDA 1N5WA 2JX5A 2WXGA 4ZOHC 5JXVA 1T5XD 2KMMA 3BWUD 4YXDB 2K0PA 4KGSA 4C7ZA 1GPXA 3NVZA 4MACA 1C4PA 1QLBB 2J42A 5HG2A 2RDHA 1IGDA 1KLUD 2G1EA 5G5GA 1XCTL 2IJ0A 3AE4B 3ZGZA 1A70A 4OZCA 4RGOS 2QSDA 4KGTA 2ZW0A 2JYEA 1DOXA 2AX5A 2WXQA 2QEJC 4JPSA 2BTEA 2GI9A 1V1PB 3MHZA 3AMZA 1E6EB 2IPKD 2NMQA 2J4XA 2WDVB 3MC0B 3W5VB 2MJEA 5EE0A 3IAS1 4YTNB 4GLSC 3W5UB 3LYYA 1KFYB 4ZYSA 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QMT A;  2ZW1 A;  1F2R C;  1FCL A;  2IGH A;  1FCC C;  5HI1 A;  1EM7 A;  1KH0 A;  1QKZ A;  5HFY A;  3MP9 A;  2KAC A;  1PGB A;  3FIL A;  1YMH E;  1P7E A;  2LHD A;  1K53 A;  2JWU A;  1GB1 A;  1C9F A;  1XCQ L;  1PGX A;  1HZ6 A;  4OZA A;  1GB4 A;  4WH4 A;  4IKG A;  2PLP A;  4KGR A;  1Q10 A;  1ZXH A;  2N9L A;  4HKZ E;  2JXT A;  2LGI A;  1K50 A;  2LUM A;  3GB1 A;  1P7F A;  5BMG A;  1D4B A;  2RMM A;  1MHX A;  1IGC A;  1MPE A;  1K52 A;  4D2K A;  2I38 A;  2IGD A;  1MI0 A;  2PTL A;  2JSV X;  1UWX A;  2JU6 X;  1JML A;  1HEZ E;  1K51 A;  2OED A;  1FD6 A;  4IOI E;  4OZB A;  2N7J A;  2GB1 A;  5BMI A;  2ONQ A;  1YNT E;  1IBX A;  3FIL B;  2KWD A;  5JXV A;  1IBX B;  2K0P A;  2KN4 A;  4KGS A;  3V3X A;  4MAC A;  2KDM A;  5HG2 A;  2J53 A;  2PW9 A;  1IGD A;  2N9K A;  1XCT L;  3UI3 A;  2JZP A;  2KQ4 X;  1MVK A;  4OZC A;  2QSD A;  4KGT A;  2ZW0 A;  1PGA A;  2IGG A;  1MHH E;  5HHD G;  2RPV A;  1HZ5 A;  2GI9 A;  2ON8 A;  4HJG E;  2I2Y A;  1F2R I;  2NMQ A;  2LHE A;  2EEL A;  1XF5 L;  4GLS C;  5BMH A;  2J52 A; 
#chains in the Genus database with same CATH topology
 1J0G A;  2BPS A;  2VRR B;  4C00 A;  2DAF A;  4AOF A;  1E10 A;  3OJ4 B;  2DZJ A;  4US8 A;  5HFY A;  3O13 A;  4KIK A;  2MEK A;  2IO0 B;  4G0N B;  1PGB A;  4LNI A;  2E6X A;  4W9E A;  3EGR A;  4II3 B;  3U7Z A;  3HVZ A;  1P1A A;  4OVU A;  1PGX A;  4GDK A;  4PT5 A;  3OG5 A;  4LJP B;  5KHQ A;  1LQB A;  4CHK A;  2ASQ A;  4MT5 A;  2LJI A;  1SE3 A;  2AEH A;  3C0R B;  3AE6 B;  4FN2 A;  3TJP A;  4FXC A;  2BYV E;  2WXL A;  4J3O D;  2LJ5 A;  3A9J A;  2D11 A;  3NS8 A;  4A3O A;  1FIQ A;  2D3B A;  4B6W A;  3N1Z C;  2CKH B;  3IFW B;  4K3C A;  5C2T B;  3K9O B;  3Q8C A;  2UU7 A;  1HQR D;  3HRD D;  2N7J A;  1T3Q A;  2V3P A;  5BMI A;  2WXN A;  3U7D A;  1ZGU B;  4RGT A;  5H92 C;  3DVN V;  2HD5 B;  1L7Y A;  5AUI A;  3VDZ A;  3BK2 A;  3RZF A;  2D2Q A;  3DBL I;  2JWZ A;  2GBN A;  4GDK B;  3UIN B;  3U2S C;  5FR6 A;  2GMI C;  2N9K A;  3PZ8 A;  4W9K A;  2BWE S;  1TT5 B;  2DYO A;  1F0Z A;  4EZK A;  2CR5 A;  2A4Z A;  2G45 B;  3TEY A;  2LXC A;  1SBB B;  4WWN A;  4K3B A;  3Q8B A;  2BKR B;  5BO4 B;  2EEL A;  2PKO A;  2N1W A;  5MPO A;  1WGH A;  3AN1 A;  2O2V B;  5G5H A;  4NAM A;  1QOG A;  3Q14 C;  1WGY A;  3VUW A;  1SGH A;  3KW5 B;  3B1L X;  4XWW A;  1OGW A;  3DBR B;  3RNE C;  2WXO A;  1UF0 A;  3ZIM A;  2DAJ A;  2X38 A;  4XE0 A;  2MHJ A;  2O6V A;  1WX7 A;  2PE6 B;  2ZVN A;  1SJH D;  5E6P A;  1LXD A;  4KZC A;  2G9H D;  4G11 A;  2B76 B;  4P7I A;  3VUY A;  3RUL A;  3NVW A;  1DGJ A;  3X0W A;  3AEG B;  2PLP A;  3HVD A;  3L17 A;  4FA6 A;  5AEK B;  3DBS A;  4K81 A;  4MGY E;  1JWB D;  1WXM A;  4NJ7 A;  1TS5 A;  2QDF A;  2YEP F;  2JVC A;  2N4F A;  2L0T A;  3QAQ A;  2W55 A;  5AZH A;  2NTT A;  2KFJ A;  5LXH A;  1WXS A;  3VRB B;  3Q2A C;  1VLB A;  3W2D A;  1VD2 A;  2ICI A;  2MSE D;  1AAR A;  3KQ4 A;  3GS2 A;  3DWM A;  5TR5 A;  1KM7 A;  4DHJ B;  4DHJ D;  1SB3 C;  1YQ3 B;  1HTQ A;  1F9J A;  3OWE B;  5D94 A;  1I4X A;  3QA8 A;  3B9J A;  1EWY C;  3P63 A;  2KN4 A;  4LNO A;  4B95 A;  5FR3 A;  3R7R A;  2PW9 A;  1R4M I;  4M00 A;  4RF0 A;  3B0A A;  1JCK B;  1XLO A;  2IND C;  2BS4 B;  2NBV B;  1YQ4 B;  2K8B A;  1MHH E;  4ANW A;  2L3Z A;  1HZ5 A;  2L05 A;  4LNK A;  3L13 A;  3N1X C;  2BYF A;  2RGF A;  2I2Y A;  1HA5 A;  1KF6 B;  1E5W A;  3KWL A;  4N9F 4;  3Q8E A;  2KFK A;  3NVY A;  5D6J B;  1PUT A;  2KKC A;  3VAW A;  4NJ6 A;  1FXA A;  3VTU A;  2QMT A;  2QJL A;  1MG4 A;  5JH5 C;  3Q3M C;  4W9G A;  4WWM A;  2IGH A;  4MM3 B;  4XWT A;  5JZE B;  1C1Y B;  1UD7 A;  4MEL A;  2GBJ A;  2N9P C;  1QF6 A;  1V9J A;  3GE8 C;  3MP9 A;  2CU3 A;  1LM8 B;  4ZYN A;  4HPL B;  3ZNI D;  4C80 A;  1P3Q U;  1FFV A;  1VRA B;  1GB1 A;  1V2Y A;  2Q5W D;  1RWS A;  3ZYY X;  4C4V B;  1GB4 A;  1WM2 A;  4DWF A;  2N9L A;  1PDX A;  3TCA A;  3GP7 A;  3RMK C;  1I4R A;  1TGZ B;  1P7F A;  1TZO A;  2INN E;  1SE2 A;  1WGD A;  5D3I B;  3P4P B;  4MGZ E;  2KVZ A;  4BFR A;  1VJK A;  2KC1 A;  2W3R A;  4WJO A;  4ZRK A;  5IN7 A;  3V05 A;  2JSV X;  3ZRF A;  4DDI D;  2QHO A;  3DVG X;  1YJI A;  2FBW B;  1WM3 A;  1GJZ A;  4A3P A;  1OQR A;  2DYM A;  3A4R A;  5EE1 A;  4ICU A;  4WQM A;  1FNV A;  3PS6 A;  1RLF A;  3X23 A;  1RFK A;  1WYG A;  3FIL B;  4RFB A;  1N63 A;  1UGM A;  4GXB A;  2L0F A;  2LXA A;  1ET9 A;  1SIJ A;  3LJ3 A;  1QT9 A;  4I6P A;  1IPG A;  1MVK A;  1FNW A;  2EKE C;  1DYQ A;  1E7V A;  2IGG A;  3RFZ B;  2M8S A;  1L4Z B;  1WGK A;  3NY5 A;  2PIA A;  1N62 A;  1BUI C;  2ON8 A;  1C4A A;  1FO4 A;  1TTN A;  2MH7 A;  3MC9 A;  2L8J A;  2SEB D;  5J18 A;  1ZUD 2;  3N32 A;  4HPP A;  3BK1 A;  2WX0 A;  1F2R C;  3WIM A;  5EE9 A;  4JE3 B;  3IXS A;  1PQS A;  1XD3 B;  3APC A;  2HTH A;  5GMV A;  4G3X B;  4X57 B;  5LXI B;  4E71 A;  2WU5 B;  3A1Q A;  2OJW A;  3DBH I;  2MCN B;  4OZA A;  1ZDV A;  2JRH A;  1S1Q B;  1UGJ A;  2LZ6 A;  1WX8 A;  1FEH A;  4NAW B;  3ZTC A;  3MC8 A;  4EOY A;  3TMP B;  3KUZ A;  1L2N A;  3WAO A;  1VZ7 A;  4NQL B;  1J8C A;  4NJC A;  4KZ0 A;  3QCA A;  3P4Q B;  1XEE A;  1JML A;  3UIP B;  1YX6 B;  1NYR A;  2MP2 B;  1NVI D;  1LFD A;  1F77 A;  2N1V A;  4TSS A;  1CK1 A;  4M8N A;  1OQY A;  2ONQ A;  4HRO A;  4URK A;  4O1N A;  1YIW A;  3ML8 A;  1B1Z A;  4IWP A;  4DHZ E;  3A4S C;  4YXD B;  2BVC A;  4IG7 B;  3GOE A;  2R2O A;  4MAC A;  2MBH A;  3EHV A;  2KO3 A;  5LLI A;  1IGD A;  3A9K B;  5JHB A;  3T8M A;  4KGT A;  1WH3 A;  3KUC B;  2CS4 A;  5IO9 A;  4IWO A;  1E6E B;  2IO2 B;  2LGD A;  4W9H A;  5J17 A;  2MJE A;  3IAS 1;  5CHV C;  1GNU A;  4RH6 A;  2WXH A;  3H9D A;  2JRI B;  3ZLZ A;  2G4S A;  1JWA D;  4R3D A;  1GG3 A;  3JSV A;  4W9F A;  3L54 A;  1EUV B;  1D5X C;  3FC4 A;  1N60 A;  3QC8 B;  3PRE A;  2IO3 B;  3VTW A;  3WAN A;  1D6E C;  3AXC A;  2DZI A;  2ZZP B;  5CHW A;  1WJN A;  4F1S A;  1E90 A;  3WCQ A;  2V4L A;  2KNB A;  1Q10 A;  1ZXH A;  2JXT A;  3FKY A;  5T8I A;  3CMM B;  3PLU A;  3MTN B;  3VRA B;  1TS4 A;  4BKS D;  2JXX A;  4KSL C;  1NDD A;  2R61 A;  3Q3F A;  4XZ4 A;  3ZUN A;  2L1A A;  1XLN A;  3AED B;  1SF0 A;  2L7R A;  4TV3 A;  2XK5 B;  3DCG A;  3ETR A;  3BYT B;  1CMX B;  5CX3 A;  2D3A A;  4N58 A;  4YSX B;  3B2G A;  4CO7 A;  3MHS D;  2IYD B;  1YOV B;  1WZ3 A;  3U8Z A;  3RZW C;  1AN8 A;  4MSM B;  1ISN A;  2RDG A;  3WAM A;  1P0R A;  1L6U A;  3CSF A;  4K1R B;  4ANX A;  2MBB B;  3PHX B;  2JT4 B;  2NTS A;  4ARI A;  2EMT A;  2LI5 A;  5KHO A;  3L0W B;  2KX0 A;  4XC2 A;  4IM0 A;  2JQR B;  4XDD A;  3M63 B;  3ZDM C;  4UDU C;  1FRD A;  1WJU A;  4BZA A;  1TY0 A;  2O6V B;  1T0Q C;  4FJV B;  3Q3J A;  1LGR A;  2WDR B;  3GZN B;  4LNN A;  2H89 B;  3NRZ A;  2KDB A;  3C19 A;  1GC7 A;  3P2B A;  3OLM D;  2ZEQ A;  3T3N A;  4PS3 A;  1YMH E;  1FRR A;  1K53 A;  1M4V A;  2MW5 A;  1XCQ L;  1N6Z A;  2BW2 A;  1WIA A;  2BWF A;  3TBL D;  1UZX B;  1TKY A;  4WH4 A;  2KZR A;  1NI2 A;  3R2I A;  4IKG A;  1WGR A;  1ZOY B;  2JF5 A;  1OQQ A;  2AQ2 B;  2KDF B;  3B08 A;  2QC8 A;  4L2Y A;  2WXI A;  1FPY A;  3TEZ A;  3ZO5 B;  2JY6 A;  2BS3 B;  3SU8 X;  4LDT B;  1YN3 A;  2N7D A;  2IGD A;  3EC8 A;  4DDG D;  1C78 A;  2J0J A;  2RSU A;  1NYQ A;  2LGX A;  1KTK A;  5AUK A;  2N9E B;  1GOZ A;  4LJO B;  1H8C A;  2GBM A;  3EEC A;  3SFE B;  3PZD A;  5E6O A;  2INP E;  1J7B A;  4AJW A;  3Q8A A;  4GDL A;  1T0R C;  3DBH B;  2JZZ A;  5L95 C;  3NJT A;  3AH7 A;  3AEC B;  3EA6 A;  2KN5 A;  2KDM A;  4AQ7 A;  3RNG C;  3BY4 B;  2YVC A;  2L83 A;  1R4N B;  2NPT A;  2UYZ B;  1G6J A;  1P9D U;  1V1O A;  1JWM D;  1V6E A;  1S3S G;  1C77 A;  2NCN A;  2OHF A;  2LWP A;  3KUD B;  3B2F A;  4C4V A;  4FJZ A;  5C3J B;  2VZK B;  2WXM A;  1TS2 A;  4E3C A;  2QIL A;  1WE7 A;  4GSW A;  3NVV A;  4Q2J A;  3H1U A;  4GMV A;  3ZJT A;  1IYF A;  1UBQ A;  1ZDX A;  1UNS A;  2V3S A;  1NEK B;  1QKZ A;  1TS3 A;  3V6C B;  3AEE B;  2XN9 C;  3AE7 B;  4RF1 A;  3ZW3 A;  2KDI A;  3IAM 1;  2CHW A;  1XQQ A;  1R4N I;  4DXF A;  4I6L B;  3BVG A;  3SEB A;  4REZ A;  5JHA A;  2WDT B;  2M0X A;  2Y5C A;  1JWU D;  3TEX A;  1D5M C;  4KV2 A;  4S0R A;  1FMA D;  2BKF A;  2I38 A;  2LGS A;  3WA0 A;  4HVB A;  4F8C B;  1HEZ E;  2X8X X;  1K51 A;  3APF A;  1BML C;  4RNA A;  4IOI E;  3KH0 A;  4N59 A;  5DPT A;  2OJR A;  3L08 A;  3EFC A;  2IZV B;  4ICV A;  4P6V F;  1STE A;  2DLB A;  4PYZ A;  2MBE A;  1Q1O A;  2L52 A;  2KWC A;  3AE2 B;  3P42 A;  1WE6 A;  2J53 A;  2ZCC A;  3RPF C;  1DOY A;  1WXA A;  1NBF C;  1XO3 A;  2GLS A;  3RT3 B;  2LRU A;  2HJ1 A;  3E56 A;  2KWV B;  4CQN A;  2CHX A;  1WXV A;  3UQB A;  3ZRC A;  1PGA A;  2WWZ A;  4PYU A;  2WQY B;  2RPQ A;  2BGF A;  4BKT A;  3AE1 B;  2J7Q B;  1QOF A;  2ZPN A;  2JYT A;  2MBO A;  4XDC A;  3K9P B;  1CZP A;  2YEP B;  1WY8 A;  4YSY B;  3QIJ A;  2WNM A;  1WZ0 A;  4EZL A;  3VXW A;  4HLE A;  5IP4 D;  4OVV A;  2JZ3 B;  3FIL A;  1FFU A;  2E3T A;  4ZRI A;  4MH0 E;  3NZU A;  1C9F A;  4WWP A;  1N61 A;  2C7M B;  4W9I A;  1I35 A;  1WRI A;  3Q3N C;  4DBG A;  1L5P A;  5J2R A;  2XBB C;  4HWI B;  2Z0D B;  3DQV A;  2WXK A;  1MPE A;  1T0Y A;  4ITK A;  4YTP B;  3FAH A;  1UH6 A;  3MFG A;  1WRD B;  4A90 A;  2M19 A;  1UWX A;  4MSQ B;  2C5L C;  2LVO A;  2KMC A;  4YSZ B;  3QJZ A;  2WXR A;  3LXF A;  1ACC A;  1FM0 D;  2KAJ A;  2MJ3 A;  1V5O A;  3PGE A;  4HPM B;  5FK9 C;  2REX A;  1M94 A;  3PPA A;  3WAL A;  3IBE A;  3IHP C;  1TBE A;  1E7U A;  4FLH A;  3ZNH B;  2AYO B;  2M17 A;  4GDL B;  1SSN A;  1PFD A;  2WXG A;  4ZOH C;  1T5X D;  2K0P A;  4KGS A;  1WFY A;  1C4P A;  5HG2 A;  3PRM B;  3H7P B;  3GE3 C;  4WJN A;  1XCT L;  1J19 A;  1A70 A;  4OZC A;  3JVZ X;  4QAY A;  2QEJ C;  2RDB C;  3NG0 A;  1E8W A;  4WJP A;  1V1P B;  3MHZ A;  3AMZ A;  3ECI A;  4DK5 A;  2RR9 A;  2KK8 A;  2LUE A;  3W5U B;  4ZYS A;  3BIN A;  2K9X A;  1HE8 A;  4BBN C;  2C9W B;  2EKI A;  3DOW A;  1EM7 A;  3BVM A;  1KLV A;  3Q6B A;  4KIK B;  1V80 A;  1L0V B;  4BVU C;  3ZNZ B;  1E8X A;  5EDS A;  4TQ1 A;  4PS7 A;  1BT0 A;  2D5G A;  1TJE A;  4RGM A;  2LGI A;  2AQ3 B;  2NR2 A;  1MHX A;  3KWV A;  1JRU A;  3PZ7 A;  2ZVO A;  2BF8 B;  1ENF A;  1P98 A;  4TUU A;  4GN1 A;  4HJK A;  2WDQ B;  2PTL A;  2DWQ A;  4A20 A;  4HKQ A;  1TKE A;  2ZPY A;  3VR8 B;  1WR6 E;  4DXG A;  4NY0 A;  3L16 A;  1J7A A;  1E8Y A;  4KKJ A;  1Y56 A;  4FHK A;  5FKA C;  3L4P A;  1B9R A;  2NBU A;  1TIF A;  3C8Y A;  1V5T A;  2FE8 A;  2M56 B;  3HHM A;  2N0S B;  3DBL B;  2W9N A;  1XLQ A;  2TSS A;  4YT0 B;  4ASW C;  4DHZ B;  3ZJU A;  1KOT A;  2LFI A;  3AB5 A;  4OW0 A;  1L6V A;  3SDL C;  4MDK E;  2JPH A;  1OFF A;  1YX5 B;  2LMC A;  3GZN I;  1CQV A;  2LHE A;  3M3J A;  2K8H A;  3RI7 C;  2K6D B;  2WGS A;  2I1J A;  5BMH A;  3KVF B;  3KLS X;  1CJE A;  4B0E A;  4JX1 C;  3U4E G;  4HCP B;  3HUI A;  4IM3 A;  1VDV A;  1UBI A;  3AEB B;  1NEN B;  3DDC B;  3LDZ E;  1E9M A;  2MJD A;  4A6Q A;  2YLM A;  4IM2 A;  4DQO C;  3AV8 A;  1ZW7 A;  3J9C A;  3A9K A;  2FCM A;  1EF5 A;  2EMS A;  2KJR A;  4ZHO A;  2DHZ A;  3A9J B;  4B9K A;  2RMM A;  5DCN A;  3RUI B;  5BYQ A;  2B3A A;  4IW0 A;  1VZ8 A;  2K25 A;  1TYG B;  4A9A A;  2KLC A;  3HM6 X;  4HCN B;  1V8C A;  2QCZ A;  3ML9 A;  1UUP A;  1QOB A;  5BYR A;  2ZCB A;  3ALB A;  5CHF A;  4W9D A;  4WWO A;  3ZXV A;  2FCN A;  4W9C A;  2D3G A;  3DHG C;  4CYE A;  1C76 A;  4TQ0 A;  5C23 A;  4WJQ A;  1IBX B;  4P16 A;  5DPS A;  4KSK C;  1SXT A;  4M02 A;  1KRH A;  2MBQ A;  2UWQ A;  2IDY A;  4YWG G;  2KVR A;  1GUA B;  4MEM A;  5HHD G;  2MP2 A;  1JW9 D;  4JWU C;  5TSS A;  5GXG B;  1F2R I;  2KTF A;  2HDE A;  2ZNV B;  1YN5 A;  5IAA C;  1XF5 L;  4IDI A;  1V1P A;  2LAS A;  1VCB A;  4BBN F;  2AL6 A;  4M0W A;  3VVW B;  1ZXI A;  3ZNG C;  1ZP0 B;  4W9J A;  1RRB A;  4XGA B;  4K7S A;  2KOX A;  1KH0 A;  2CU1 A;  3CST A;  3VH4 B;  2IY0 B;  5AZG A;  3AE9 B;  2VZK D;  3KYC D;  4EEW A;  2KTR B;  2HTM E;  3OAW A;  4AJY B;  3M62 B;  2DBY A;  2G4D B;  2C60 A;  4NAW A;  1EU3 A;  1HZ6 A;  2QIE B;  4JLC A;  1BXT A;  1VZ6 A;  2GRI A;  1XT9 B;  1X1M A;  4RCO A;  5D7G A;  2KQS A;  4FHJ A;  2C7H A;  2GOW A;  3ZKJ C;  1D4B A;  1IGC A;  2WS3 B;  2IBI B;  1T6B X;  2BYT A;  3PLV A;  5EE3 A;  1N5X A;  3M95 A;  1PYW D;  3JW0 X;  3ONS A;  4B0M A;  2FCS A;  2KXJ A;  4HDQ A;  4GB9 A;  1VR9 A;  4BKS A;  4TKN A;  3RNB C;  1C79 A;  5I4D A;  4XX5 A;  2Z0E B;  4HEA 1;  3TIX A;  2WX1 A;  3PSE B;  4BOZ B;  4FUL A;  4M8M A;  1JRO A;  3DBR I;  3V62 A;  1NI3 A;  4ZRJ A;  3KYD D;  3PT2 B;  3H8H A;  3O65 B;  1XXG A;  3P4R B;  4MJS A;  1WSP A;  3UI3 A;  2CJN A;  2DEN B;  2Y5B B;  2LVP A;  2Z8L A;  4BKG A;  4II2 B;  1L4D B;  1I4H A;  3Q8F A;  2V3N A;  1RYJ A;  1ZE3 D;  3N1Y C;  3H7S A;  3NUH B;  4HJG E;  3R8B A;  1QQR A;  3RNA C;  3W1S C;  3HK0 A;  4WAA A;  2MX2 A;  4L23 A;  2KX3 A;  3Q3O C;  4GOC A;  1HTO A;  3N20 C;  3W9C B;  4KKI A;  2MRP A;  5IOI A;  2PVG C;  3RNC C;  2GBR A;  5HI1 A;  2WYQ A;  3LB8 C;  4USA A;  3AE5 B;  4RM9 A;  1HXY D;  2BB6 A;  4OVZ A;  5D2M B;  3QX1 A;  4LTU A;  3NZ3 A;  2SAK A;  2NS5 A;  1RM6 C;  2K22 A;  2N7E A;  4IC7 B;  3BVZ A;  1F52 A;  3CF6 E;  4H2A A;  4HKZ E;  4ANV A;  2V1Y A;  3E9S A;  5E6N A;  2CJO A;  3AM9 A;  3JYU A;  5L83 A;  1FXI A;  1TY2 A;  1K52 A;  3UGB B;  3RCZ A;  3IG3 A;  1H4R A;  2D3C A;  1DOI A;  3ZVV A;  4L1B A;  3IT6 B;  3H6N A;  3U52 E;  1Q5W B;  4NPN A;  4FBJ B;  2K3U A;  1JRP A;  4JGH B;  2AQ1 B;  1U4A A;  2KJH B;  3I63 C;  3DPD A;  3VH3 B;  1YNT E;  2V0G A;  2VH2 A;  3P4S B;  2CHZ A;  2KWD A;  1N5W A;  2KMM A;  1RAX A;  2KTR A;  3AUL A;  3BWU D;  2GBK A;  2LD9 A;  4C7Z A;  1GPX A;  2NVU I;  3NVZ A;  2K39 A;  1QLB B;  2J42 A;  3PVL A;  3UF8 A;  4MM3 A;  3RNF C;  4J6I A;  5DPR A;  2KT7 A;  2IJ0 A;  2C7N B;  3AE4 B;  2M4N A;  3ZGZ A;  3I5J C;  2JYE A;  1DOX A;  2WXQ A;  5G55 A;  4NQK E;  1V49 A;  4AUQ C;  4JPS A;  2V9H A;  2BTE A;  3ZDT A;  4IWQ A;  2JUO A;  2O2V A;  2NMQ A;  2WDV B;  3MC0 B;  3S2A A;  2OOB B;  4YTN B;  4GLS C;  1UEL A;  5HKH A;  1KFY B;  2L00 B;  3MJW A;  4KDI C;  4TMA B;  1K8R B;  4KVG B;  4F7Z A;  4FAD A;  2I1K A;  3V60 A;  2M1M A;  4RMA A;  3TL5 A;  3VR9 B;  3EFU A;  4M01 A;  1WJ4 A;  4P1C C;  3A33 B;  3SR6 A;  5LNK 1;  1P7E A;  2WP9 B;  3CIR B;  3DWG C;  3Q69 A;  1K50 A;  3U30 A;  2WXF A;  4WIP A;  1JQ4 A;  2ZJD A;  2H88 B;  3TSS A;  4I6N B;  3R3M A;  4EZJ A;  1Z5S B;  2BB5 A;  2M0A A;  3IVF A;  3PTF C;  1OEY J;  3VQI A;  2OED A;  3NZS A;  2K8C A;  4OZB A;  1GAQ B;  2KHW B;  4GGQ A;  3VUX A;  4K7W A;  4YL8 A;  1RFA A;  1IBX A;  3RD2 A;  2BS2 B;  3AE8 B;  3A1Q B;  2WU2 B;  1Z2M A;  2L76 A;  4N6E B;  4ZHP A;  2WXP A;  1WJ6 A;  3AU4 A;  1ET6 A;  3PV1 A;  2W3S A;  2W54 A;  2LRW A;  1SEB D;  3PHW B;  1MG8 A;  1AWD A;  4MH8 A;  2DZK A;  4EE2 A;  4EFO A;  2HJ8 A;  3WAP A;  3T9L A;  3OJ3 A;  2ZW1 A;  1SJE D;  3NHE B;  2WHI A;  3N9Y C;  4LCD E;  2DNF A;  2Y3A A;  4DXA B;  4G50 A;  2W82 A;  1SE4 A;  3AEF B;  3L10 B;  2LHD A;  2PJH A;  3N3K B;  2XNA C;  1KJT A;  3I57 A;  2D10 A;  1QOA A;  2AL3 A;  3ZTD A;  1GC6 A;  2Z59 B;  3DHI C;  4JIO U;  3DHH C;  1IP9 A;  2KMA A;  5IKC M;  3SD5 A;  2KFK B;  4KGR A;  3QWZ B;  2J0M A;  1ESF A;  1YN4 A;  2BQQ A;  4HRS A;  1ROE A;  2MA9 B;  3I3T B;  3BII D;  4XYC A;  1QIL A;  5C1Z A;  3DVG Y;  2D07 B;  1E0Z A;  4KX6 B;  2LVQ A;  2BBC A;  4ZRP A;  2JU6 X;  3PO0 A;  4LK0 M;  3P1M A;  1WF9 A;  1TKG A;  3SHQ A;  3HM3 A;  4RM8 A;  2IO1 B;  5H8Y E;  3EUB 2;  1JAL A;  3R2T A;  4P1B C;  5CTR C;  3PRZ A;  2INC C;  2FUH B;  1FNU A;  1I4P A;  2R2Q A;  2K5P A;  5G2N A;  2FIF A;  3V3X A;  1WX9 A;  2LGY A;  5D3D A;  5E6J A;  2Y5P A;  4LLG M;  2JZP A;  4JL9 A;  3T3O A;  2XK5 A;  1D5Z C;  3HIZ A;  3MJ5 A;  1WI0 A;  2KD0 A;  1QZE A;  3RYT A;  3SFD B;  4PK1 A;  2VH1 A;  1UWM A;  3PRP B;  4BOS C;  2FNJ B;  2J52 A;  2KLG A;  2NBW B;  4ACF A;  4AWJ A;  4ZDV A;  1I4G A;  3W1S A;  5IA7 A;  4WAF A;  3AI5 A;  2MWS B;  3QQ8 B;  4AS1 A;  1FCC C;  4K7U A;  3H7P A;  5AZF A;  3QHT A;  4PS8 A;  1ZPS A;  2O6V D;  1KLG D;  4WUR A;  4BAX A;  1EO6 A;  3CWI A;  1XLP A;  2BT6 A;  2KDE B;  3VTV A;  1MJD A;  4LNF A;  4HXD A;  1WYW B;  4C7Y A;  2N9X A;  1V81 A;  4HDO A;  2V4I B;  1F1H A;  2FCQ A;  1E8Z A;  3GB1 A;  1L0Y B;  3R66 C;  1SIF A;  2DZM A;  1WR1 A;  1I7H A;  4D2K A;  1C3T A;  4NZL B;  2FAZ A;  3QAR A;  4C56 C;  2K6Q A;  4YTM B;  3TUO A;  4S17 A;  3V61 A;  1T0S C;  4MGI E;  2KYW A;  4A55 A;  1AYF A;  1YJJ A;  1FD6 A;  1R7S A;  2AWT A;  1YQB A;  1V97 A;  2KQ7 A;  2BYE A;  2MLB A;  4EKU A;  2GB1 A;  3R7Q A;  1R4M B;  1EF1 A;  3D32 A;  2NPT B;  1D3Z A;  3ENE A;  4MJS B;  3ZJV A;  2PVO D;  2PEA A;  2G3Q B;  5BYS A;  4ANU A;  2ZNV C;  2PE9 A;  2KQ4 X;  2KC2 A;  1EWC A;  4JQW C;  4KDL B;  2RPV A;  3RN9 C;  1E7P B;  3QK0 A;  4JWS C;  4E74 A;  1ZKH A;  1OTR B;  2MQJ A;  1OEY A;  2HE7 A;  5DPW A;  4ZRQ A;  3ZXR A;  2WLB A;  2WXJ A;  2K1F A;  3JSV B;  1Y8R C;  4A8X C;  3BYY B;  3I9V 1;  1YJ1 A;  1L0X B;  1WXQ A;  4RGN A;  1FCL A;  1WMH A;  1TZ1 A;  2KAC A;  3ZQ4 A;  3URY A;  3NOB A;  1FXT B;  4MGK E;  2JWU A;  3BZD B;  3ABV B;  1SE9 A;  1J7C A;  2LEK A;  2RD0 A;  4ARC A;  3V6E B;  1WWT A;  1I42 A;  2LUM A;  4OHJ A;  5BMG A;  3NS1 A;  2A5U A;  4W9L A;  3UQA A;  4HK2 A;  4FJY A;  1MI0 A;  2KJ6 A;  3AE3 B;  1C4C A;  2DYB A;  1MFW A;  2J0K A;  3TEW A;  2L32 A;  2IY1 B;  4US9 A;  4WQO B;  1LO5 D;  1AW7 A;  4EUT A;  3AEA B;  1JWS D;  2DX5 B;  2PMV A;  3IT4 B;  3VFK A;  2ACZ B;  1IUE A;  2PPH A;  2FUG 1;  4IUM B;  1EU4 A;  2FID A;  1A5R A;  2KAN A;  1I4Q A;  2JX5 A;  4NNJ B;  5JXV A;  1YD8 U;  3UIO B;  3APD A;  1Q0W B;  2RDH A;  1KLU D;  2G1E A;  4GIV A;  5G5G A;  2KWU B;  4RGO S;  2QSD A;  2ZW0 A;  4GU2 A;  1WGG A;  2AX5 A;  4LDT D;  3W1Y A;  3VHT C;  4AP4 C;  3DVN U;  2GI9 A;  1V86 A;  2IPK D;  3N30 A;  3AU5 A;  4M0W B;  2J4X A;  1WMH B;  3W5V B;  5EE0 A;  2XEW A;  3LYY A; 
#chains in the Genus database with same CATH homology
 4TMA B;  2K9X A;  1JWA D;  2EKI A;  4R3D A;  1E10 A;  1EM7 A;  4US8 A;  5HFY A;  3O13 A;  3VR9 B;  2MEK A;  1D5X C;  3BVM A;  1PGB A;  3FC4 A;  3SR6 A;  1N60 A;  5LNK 1;  2E6X A;  3EGR A;  3U7Z A;  1P7E A;  1D6E C;  3HVZ A;  1L0V B;  1PGX A;  2WP9 B;  3CIR B;  3DWG C;  4PT5 A;  4TQ1 A;  3WCQ A;  2D5G A;  1TJE A;  3Q69 A;  1Q10 A;  1ZXH A;  4RGM A;  2JXT A;  2LGI A;  2AQ3 B;  5T8I A;  1K50 A;  3VRA B;  4MT5 A;  2LJI A;  1SE3 A;  1MHX A;  2WXF A;  3KWV A;  1TS4 A;  4WIP A;  3PZ7 A;  1JQ4 A;  3AE6 B;  1ENF A;  4FXC A;  2H88 B;  2WDQ B;  2R61 A;  2PTL A;  2DWQ A;  3TSS A;  4HKQ A;  1TKE A;  2L1A A;  2WXL A;  4J3O D;  2BB5 A;  2M0A A;  1XLN A;  3AED B;  3VQI A;  1SF0 A;  1FIQ A;  3VR8 B;  4DXG A;  1J7A A;  3BYT B;  3ETR A;  4KKJ A;  1Y56 A;  2OED A;  5FKA C;  5C2T B;  3Q8C A;  3L4P A;  4N58 A;  4YSX B;  4OZB A;  1B9R A;  1GAQ B;  3B2G A;  1HQR D;  3HRD D;  2N7J A;  1T3Q A;  2V3P A;  5BMI A;  2WXN A;  1IBX A;  4RGT A;  5H92 C;  5AUI A;  1AN8 A;  3BK2 A;  3C8Y A;  2FE8 A;  2RDG A;  2M56 B;  2N0S B;  2BS2 B;  3AE8 B;  4GDK B;  1L6U A;  2WU2 B;  1XLQ A;  3U2S C;  2TSS A;  4YT0 B;  4N6E B;  3ZJU A;  4ZHP A;  2N9K A;  2WXP A;  3PZ8 A;  2LFI A;  1ET6 A;  3AB5 A;  2DYO A;  1F0Z A;  2W3S A;  4OW0 A;  1L6V A;  2W54 A;  1SEB D;  2NTS A;  4ARI A;  1AWD A;  3TEY A;  4MH8 A;  1OFF A;  1SBB B;  2JQR B;  2LMC A;  3Q8B A;  4XDD A;  4EE2 A;  1CQV A;  2LHE A;  2EEL A;  2PKO A;  5BMH A;  4UDU C;  5MPO A;  5G5H A;  1FRD A;  3AN1 A;  4NAM A;  3KLS X;  1CJE A;  1TY0 A;  1QOG A;  2ZW1 A;  2WDR B;  4B0E A;  4JX1 C;  3U4E G;  1SJE D;  2H89 B;  3NRZ A;  4XWW A;  2WXO A;  3HUI A;  3N9Y C;  2X38 A;  4XE0 A;  2Y3A A;  3T3N A;  1YMH E;  1VDV A;  2W82 A;  1SE4 A;  3AEF B;  1SJH D;  2LHD A;  1FRR A;  1K53 A;  3AEB B;  1M4V A;  1NEN B;  2XNA C;  1XCQ L;  3I57 A;  2BW2 A;  2G9H D;  1QOA A;  2B76 B;  1E9M A;  2MJD A;  3NVW A;  4A6Q A;  1DGJ A;  1TKY A;  4DQO C;  3AEG B;  4WH4 A;  3AV8 A;  4IKG A;  3R2I A;  2PLP A;  3HVD A;  4KGR A;  1ZOY B;  3J9C A;  1OQQ A;  1ESF A;  2AQ2 B;  1YN4 A;  4HRS A;  4ZHO A;  4L2Y A;  2WXI A;  1ROE A;  3TEZ A;  3BII D;  1JWB D;  2RMM A;  1QIL A;  2BS3 B;  1TS5 A;  5BYQ A;  2YEP F;  1YN3 A;  2IGD A;  1VZ8 A;  1TYG B;  1C78 A;  2W55 A;  1E0Z A;  2NTT A;  4A9A A;  4KX6 B;  1NYQ A;  4ZRP A;  2BBC A;  2JU6 X;  3PO0 A;  1KTK A;  3VRB B;  5AUK A;  1V8C A;  4LK0 M;  1GOZ A;  1UUP A;  3P1M A;  1VLB A;  3W2D A;  1QOB A;  1TKG A;  2ICI A;  5BYR A;  3KQ4 A;  3SFE B;  3GS2 A;  5H8Y E;  2INP E;  1J7B A;  3DWM A;  3Q8A A;  3EUB 2;  1JAL A;  3R2T A;  1SB3 C;  1YQ3 B;  4RH6 A;  3OWE B;  1C76 A;  4TQ0 A;  3AH7 A;  1FNU A;  1I4X A;  1I4P A;  3AEC B;  3B9J A;  1EWY C;  2K5P A;  3P63 A;  1IBX B;  2KN4 A;  3EA6 A;  3V3X A;  4P16 A;  2KDM A;  4AQ7 A;  5D3D A;  5E6J A;  5FR3 A;  1SXT A;  2Y5P A;  1KRH A;  2PW9 A;  2L83 A;  4RF0 A;  2IDY A;  4YWG G;  4LLG M;  1JCK B;  1V1O A;  1XLO A;  2JZP A;  2BS4 B;  1JWM D;  3T3O A;  1YQ4 B;  1D5Z C;  3MJ5 A;  1MHH E;  5HHD G;  1HZ5 A;  1C77 A;  2OHF A;  1JW9 D;  4JWU C;  5TSS A;  5GXG B;  2I2Y A;  1HA5 A;  1F2R I;  1KF6 B;  3B2F A;  3KWL A;  2HDE A;  3SFD B;  1YN5 A;  3Q8E A;  1XF5 L;  3NVY A;  4IDI A;  1V1P A;  5C3J B;  1UWM A;  2VZK B;  2WXM A;  1TS2 A;  2QIL A;  2J52 A;  1PUT A;  4M0W A;  1FXA A;  1ZXI A;  2QMT A;  1I4G A;  2QJL A;  3NVV A;  3W1S A;  4Q2J A;  4WAF A;  1ZP0 B;  3ZJT A;  4WWM A;  4AS1 A;  2IGH A;  4MM3 B;  4XWT A;  1FCC C;  1ZDX A;  1UNS A;  1KH0 A;  1NEK B;  1QKZ A;  1QF6 A;  1TS3 A;  1ZPS A;  3AEE B;  3MP9 A;  2CU3 A;  2XN9 C;  1KLG D;  3AE7 B;  4RF1 A;  4WUR A;  3AE9 B;  2VZK D;  3IAM 1;  2HTM E;  3CWI A;  4C80 A;  1XLP A;  1FFV A;  2BT6 A;  1VRA B;  1GB1 A;  2DBY A;  2Q5W D;  1EU3 A;  1HZ6 A;  1RWS A;  2QIE B;  3ZYY X;  4DXF A;  3BVG A;  4C7Y A;  1GB4 A;  1BXT A;  3SEB A;  1VZ6 A;  2GRI A;  2N9L A;  4RCO A;  2V4I B;  4REZ A;  5D7G A;  1PDX A;  2Y5C A;  3GP7 A;  1I4R A;  1JWU D;  3GB1 A;  3TEX A;  1P7F A;  1D4B A;  2INN E;  1L0Y B;  1D5M C;  1SE2 A;  1TZO A;  5D3I B;  3P4P B;  1IGC A;  1I7H A;  2WS3 B;  1VJK A;  4D2K A;  1FMA D;  2W3R A;  2I38 A;  1T6B X;  4NZL B;  2BYT A;  5EE3 A;  4C56 C;  1N5X A;  4YTM B;  3V05 A;  2JSV X;  1PYW D;  3TUO A;  4B0M A;  1YJI A;  2FBW B;  1HEZ E;  1K51 A;  4A55 A;  1BML C;  1AYF A;  1YJJ A;  1OQR A;  1VR9 A;  2DYM A;  1R7S A;  1FD6 A;  1V97 A;  4RNA A;  4IOI E;  5EE1 A;  1C79 A;  4N59 A;  4WQM A;  1FNV A;  5I4D A;  2GB1 A;  4HEA 1;  1RFK A;  1WYG A;  3FIL B;  4RFB A;  1N63 A;  4P6V F;  3ZJV A;  1STE A;  2DLB A;  2PVO D;  1JRO A;  2L52 A;  3AE2 B;  1NI3 A;  3P42 A;  1ET9 A;  1SIJ A;  3RPF C;  2J53 A;  1DOY A;  5BYS A;  1QT9 A;  1XO3 A;  3H8H A;  1XXG A;  3P4R B;  1WSP A;  3UI3 A;  3E56 A;  2KQ4 X;  1MVK A;  1FNW A;  2CJN A;  4CQN A;  2Z8L A;  1DYQ A;  1EWC A;  1L4D B;  1PGA A;  1I4H A;  2IGG A;  3RFZ B;  3Q8F A;  1L4Z B;  2RPV A;  1WGK A;  2V3N A;  2WQY B;  1RYJ A;  1E7P B;  1ZE3 D;  2PIA A;  1N62 A;  1BUI C;  2ON8 A;  4JWS C;  1C4A A;  3NUH B;  3AE1 B;  4HJG E;  3R8B A;  1QQR A;  1QOF A;  1FO4 A;  4L23 A;  2JYT A;  4XDC A;  1CZP A;  2MH7 A;  2YEP B;  2SEB D;  2WLB A;  2WXJ A;  4ZRQ A;  1ZUD 2;  3BK1 A;  3W9C B;  4A8X C;  4KKI A;  3BYY B;  3I9V 1;  1F2R C;  2PVG C;  5EE9 A;  4JE3 B;  1L0X B;  1WXQ A;  3IXS A;  4RGN A;  1FCL A;  5HI1 A;  4YSY B;  2WNM A;  3LB8 C;  2KAC A;  4USA A;  3AE5 B;  3ZQ4 A;  1HXY D;  3URY A;  3FIL A;  1FFU A;  2E3T A;  2BB6 A;  4OVZ A;  2JWU A;  3BZD B;  2WU5 B;  4LTU A;  1C9F A;  1N61 A;  3NZ3 A;  3ABV B;  2SAK A;  1J7C A;  1RM6 C;  2K22 A;  4OZA A;  3BVZ A;  2LEK A;  1WRI A;  1ZDV A;  4H2A A;  4ARC A;  1WWT A;  4HKZ E;  1L5P A;  3E9S A;  1UGJ A;  2CJO A;  2LUM A;  3AM9 A;  4OHJ A;  1FEH A;  4NAW B;  2WXK A;  5BMG A;  3NS1 A;  1FXI A;  1MPE A;  4ITK A;  4YTP B;  1TY2 A;  1K52 A;  3FAH A;  3MFG A;  1MI0 A;  3AE3 B;  1C4C A;  4A90 A;  1VZ7 A;  1DOI A;  2M19 A;  1UWX A;  4L1B A;  4NJC A;  3TEW A;  3IT6 B;  3P4Q B;  2L32 A;  3U52 E;  4YSZ B;  1XEE A;  4US9 A;  1JML A;  2WXR A;  1LO5 D;  1ACC A;  3LXF A;  1AW7 A;  1NYR A;  1FM0 D;  3AEA B;  2KAJ A;  2MJ3 A;  5FK9 C;  1JWS D;  2K3U A;  2PMV A;  3IT4 B;  1JRP A;  1NVI D;  1F77 A;  2ACZ B;  1IUE A;  2AQ1 B;  4TSS A;  2FUG 1;  1CK1 A;  1EU4 A;  2ONQ A;  4HRO A;  1YNT E;  4O1N A;  4GDL B;  2V0G A;  3P4S B;  1B1Z A;  2KWD A;  1SSN A;  1I4Q A;  1PFD A;  1N5W A;  2JX5 A;  2WXG A;  4ZOH C;  5JXV A;  1T5X D;  2KMM A;  3BWU D;  4YXD B;  2K0P A;  4KGS A;  4C7Z A;  1GPX A;  3NVZ A;  4MAC A;  1C4P A;  1QLB B;  2J42 A;  5HG2 A;  2RDH A;  1IGD A;  1KLU D;  2G1E A;  5G5G A;  1XCT L;  2IJ0 A;  3AE4 B;  3ZGZ A;  1A70 A;  4OZC A;  4RGO S;  2QSD A;  4KGT A;  2ZW0 A;  2JYE A;  1DOX A;  2AX5 A;  2WXQ A;  2QEJ C;  4JPS A;  2BTE A;  2GI9 A;  1V1P B;  3MHZ A;  3AMZ A;  1E6E B;  2IPK D;  2NMQ A;  2J4X A;  2WDV B;  3MC0 B;  3W5V B;  2MJE A;  5EE0 A;  3IAS 1;  4YTN B;  4GLS C;  3W5U B;  3LYY A;  1KFY B;  4ZYS A;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...