3I63C

Peroxide bound toluene 4-monooxygenase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
b'AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 23
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i63C00
3I63C 3RI7C 1T0QC 3N20C 3RNEC 3RNFC 1T0RC 3I5JC 3RNAC 4P1CC 3N1YC 2INDC 2RDBC 3DHHC 3Q3NC 3RMKC 3RNGC 3DHIC 3N1XC 3DHGC 3RN9C 3Q3MC 3GE3C 3GE8C 3N1ZC 1T0SC 3Q2AC 3Q14C 3RNCC 2INCC 3Q3OC 4P1BC 3RNBC
chains in the Genus database with same CATH superfamily
1V1PB 3R3MA 1VZ7A 4C7ZA 3ZRFA 1YQ4B 3VQIA 4FN2A 2AL3A 3EHVA 3AXCA 4GU2A 1E5WA 4PS8A 4MGZE 2KFJA 4EZJA 3BYTB 4W9FA 4K7UA 2WXNA 3DVGX 3Q3OC 4IKGA 1VZ6A 3ZYYX 2IO0B 1NEKB 1L0VB 2ZJDA 5AUIA 1X1MA 4II3B 4JQWC 5C3JB 2HTME 4DHJB 2L76A 2AQ2B 5D3IB 2KTRA 4TUUA 2BYEA 3K9OB 3DOWA 5FKAC 1SE9A 3ZIMA 4AS1A 4DDID 4WJOA 2KN5A 2WX0A 1YN4A 2JZPA 4AUQC 2N9PC 4BOSC 4PYUA 4EZLA 1TS3A 3OWEB 4MJSA 3WA0A 4KX6B 3RNFC 2KAJA 3O65B 1WYWB 1VLBA 4W9LA 3X0WA 4XYCA 4A6QA 3NS1A 3SFEB 4KKIA 4YWGG 1IP9A 3A1QB 1FIQA 1NBFC 1C9FA 4NZLB 3PLVA 2NMQA 4EZKA 1E10A 2PIAA 1C76A 4RGOS 4A20A 5FK9C 2BB6A 1PFDA 1I35A 4RGNA 4USAA 3AEAB 3ZJUA 1HZ5A 3SU8X 3VR9B 3DBLB 2QILA 2JF5A 5AEKB 1L6VA 3AE4B 1JWUD 2BF8B 4BFRA 3DCGA 2BYFA 1JWAD 1JWSD 2GMIC 2C5LC 4OW0A 4HDOA 4EFOA 3KWVA 1TS2A 2D3AA 4GSWA 2KWCA 2M56B 3OJ3A 3DHIC 1UNSA 4GDKA 3SFDB 2W54A 2GBRA 3AECB 2H88B 2LEKA 5TR5A 2D3CA 2QHOA 2JZ3B 5IA7A 1SE4A 1HA5A 1A70A 1KFYB 4R3DA 4GXBA 4HRSA 2VH1A 1HZ6A 1TZ1A 3AV8A 1BXTA 4G0NB 4WIPA 4WURA 1FCLA 2E6XA 2WXRA 5DCNA 1C4CA 3ZNID 2X8XX 2J0KA 2J42A 4M0WA 4C56C 2FCNA 3N30A 2KFKB 4MSMB 3MHZA 4IM2A 1MPEA 3ZNHB 4IWQA 3B0AA 5L95C 4FA6A 3LXFA 2C7NB 4HKZE 1GB1A 1WM3A 3VR8B 4W9HA 1WJUA 4BAXA 3FC4A 3LDZE 4BOZB 1FNUA 3C19A 4PK1A 2IZVB 2WDQB 5CX3A 1E0ZA 3RI7C 4GGQA 2BKRB 4N58A 2N9XA 3BVGA 4GDLA 2J0JA 3V60A 2OOBB 1Y56A 1SGHA 2FNJB 3SR6A 4QAYA 1NYRA 1TT5B 2LGDA 3H1UA 4XZ4A 5MPOA 1T0QC 2KDFB 2LUMA 1YQBA 1SF0A 4KZ0A 4ICUA 5D2MB 3L54A 1V8CA 3M62B 2JWZA 4MGYE 3GE3C 3KYDD 2WXPA 4S0RA 3U8ZA 2HD5B 2KC1A 3IT4B 3JSVA 3NY5A 4LDTB 3PT2B 4MT5A 1C77A 1F0ZA 4HVBA 5H8YE 2INPE 4AP4C 4WAFA 2GBMA 1XEEA 2QSDA 2DHZA 2BVCA 4LJOB 4LNOA 1UUPA 4K1RB 3Q3MC 1T5XD 1AARA 2R61A 1AW7A 3P42A 2NPTB 3EUB2 3AEEB 1UZXB 4P6VF 1UD7A 1ZGUB 1KLUD 2WNMA 4WH4A 4YTMB 1N5XA 2ZNVC 2E3TA 1WGKA 4ZHOA 4JE3B 2I38A 3JYUA 1FM0D 1E8YA 3W5VB 2XEWA 1RLFA 2ZZPB 1JWBD 2EKEC 3KVFB 1WMHB 2LGSA 1PGAA 3PSEB 1VR9A 1UELA 1ACCA 5HI1A 5DPTA 1UH6A 1TKGA 3HVZA 1HE8A 3JVZX 2NTTA 4RGTA 3H6NA 2KQ4X 1JQ4A 1CQVA 4KIKB 1N6ZA 3AEBB 1OQYA 1SXTA 1Q0WB 1WGDA 3LYYA 3NJTA 2MBBB 1HEZE 2BWFA 2DYOA 3AU5A 3PREA 1XQQA 1IPGA 4MACA 1XT9B 1L7YA 1K52A 3PV1A 3VUYA 4OVUA 1TGZB 2RGFA 3TEXA 2RD0A 3TUOA 2L05A 4C00A 5E6NA 5FR6A 2LVQA 4ARCA 1FFUA 1VJKA 4C80A 1WX9A 1P1AA 2BBCA 2IJ0A 3A1QA 5IO9A 2N9KA 4XDCA 5CHFA 2GLSA 1ZUD2 2IY0B 2I1JA 1C79A 4OZCA 1WXQA 2C7HA 1ROEA 3LB8C 1KM7A 3E56A 3BZDB 2G4SA 4WQMA 4N6EB 1IGDA 2G45B 2HJ8A 3Q6BA 1WFYA 2IDYA 2BS3B 1J19A 2L3ZA 3V6EB 5TSSA 4WWMA 2M8SA 2LHDA 4MM3A 1D6EC 3QA8A 4RM8A 2MCNB 1DOIA 3KW5B 2PE9A 3DHGC 2WU2B 2MP2A 4ZDVA 4C7YA 1R4NB 2BPSA 2BT6A 1ESFA 2QMTA 2WLBA 4BKTA 1WXMA 4FJVB 3WCQA 5CHWA 1FXTB 4PS7A 4ZRQA 1E9MA 1STEA 3HM3A 1B1ZA 1WRDB 4I6PA 5EE1A 3VVWB 2KO3A 1E6EB 2KDIA 1T3QA 3CF6E 3MC0B 5E6JA 2LHEA 5AZHA 2LVPA 3IAM1 4ANVA 3RFZB 3BVMA 5HG2A 2K8BA 2CU3A 2G1EA 2JY6A 3ZXVA 2JYTA 1TY0A 1FFVA 2J53A 3AMZA 2Z0EB 4PT5A 5DPSA 1OEYA 2IO2B 2NCNA 4YXDB 1LQBA 5BMGA 3ZTDA 1OTRB 1JW9D 2QIEB 3RMKC 2KTFA 2MBQA 2ASQA 2XN9C 4MGKE 1UGMA 2WS3B 2LGXA 4NAWB 2JSVX 1V49A 4DHZE 3RYTA 1N63A 3PLUA 3ZJVA 3H7PB 3GOEA 1UBQA 4ZRPA 2YVCA 2DLBA 4K3BA 2OJWA 2TSSA 2QJLA 4RFBA 3H9DA 3IVFA 5BYRA 5CTRC 2MA9B 2MHJA 2N1WA 2UYZB 2V3NA 2MRPA 4BBNC 4HK2A 2DX5B 2VRRB 1A5RA 4HLEA 5IN7A 3V61A 2K0PA 4IG7B 1UF0A 1I42A 3BY4B 3RUIB 3URYA 2L83A 3N32A 4XX5A 5D6JB 2CR5A 3B1LX 3VHTC 1I4QA 1M94A 3SD5A 2G9HD 3T3NA 1OFFA 4FXCA 1V5OA 1PQSA 5I4DA 1WGHA 1V1OA 1WRIA 3P63A 4HXDA 2NR2A 3UQAA 2BGFA 2YEPB 1GUAB 4RMAA 2INDC 3PGEA 2O2VA 4M8NA 1DYQA 1K8RB 2J0MA 3VH3B 1RWSA 2LWPA 2KWDA 2W82A 2IYDB 4IOIE 2D11A 1YN5A 1XF5L 2VZKB 1QQRA 3SEBA 3EA6A 3PVLA 1BMLC 2WQYB 3RNAC 1I4RA 1GNUA 2FUG1 4M01A 4L1BA 5FR3A 1XLNA 5JHBA 3SHQA 3AE7B 4REZA 3C0RB 1Q10A 2JUOA 4LTUA 1K51A 1YX5B 2DYMA 1IBXB 3RD2A 2WXQA 1GPXA 2D3BA 2R2QA 3TSSA 3M63B 2MX2A 5HFYA 2IGGA 3R7QA 3UI3A 3EFUA 4C4VA 3RT3B 3J9CA 1P7FA 3Q3FA 4DDGD 3ZNGC 2ZPYA 3BWUD 2I1KA 5E6OA 1WXAA 2RDGA 1WIAA 1J7CA 2XK5A 4LNNA 1FXIA 3DWMA 2DNFA 2MEKA 3DQVA 4A90A 1XO3A 3TMPB 4URKA 3A33B 5C1ZA 3KUZA 3ALBA 2AYOB 2INCC 2L1AA 1C3TA 2KXJA 2MW5A 4GB9A 1L2NA 2YLMA 1D5ZC 2M0AA 3FILB 3A9KB 1WXSA 1MFWA 1PDXA 2PE6B 1N62A 5EE3A 2MBOA 1AYFA 3NVWA 1CJEA 1LFDA 3QARA 1WI0A 5BMIA 1D5XC 2LJ5A 3RNCC 2BW2A 1M4VA 1WYGA 3IBEA 3VTUA 2IPKD 2Z0DB 4FJZA 4DWFA 1V86A 2B76B 2ONQA 4WJQA 3ZRCA 3NOBA 3TEWA 2C7MB 3IT6B 1HTQA 1WZ3A 3W1SA 4A55A 2M17A 1WGRA 4M00A 2RSUA 1S3SG 2JZZA 2KWUB 3Q8CA 2V4IB 4D2KA 3H8HA 1F52A 4XDDA 2ZNVB 3VDZA 1F2RC 3PRMB 4NQLB 1ET9A 3BVZA 3L13A 3R2IA 3W5UB 1JMLA 2JYEA 1YJIA 2D5GA 2CHZA 4ZYSA 2AQ3B 2V3PA 2WYQA 4LDTD 1YJ1A 4YTPB 2KWVB 2JQRB 1T6BX 3Q3JA 2YEPF 3VFKA 2GRIA 2QC8A 1AWDA 2N4FA 3H7SA 3ZGZA 2K9XA 1RM6C 1L6UA 4OHJA 4HJKA 5L83A 3Q8AA 4J3OD 1QOGA 2ZEQA 4NAWA 4FHKA 1YMHE 2AL6A 2KDBA 3ABVB 1L4ZB 5DPRA 2K8CA 3UIOB 1YN3A 4BKGA 4KSKC 2BQQA 2Y3AA 3RNBC 2LD9A 2JX5A 3V3XA 3WAPA 4JWSC 4N9F4 1GB4A 2KQSA 4NQKE 2KMAA 2BYVE 2PMVA 5JXVA 1V2YA 2QEJC 2KLGA 1D5MC 4YT0B 2D10A 2A5UA 2FE8A 3PZ7A 3A4RA 1IGCA 2WXOA 3CSTA 1F77A 3ZJTA 3VUXA 2ACZB 3DBHI 3L16A 1P9DU 3A9JA 3I9V1 2FCSA 4W9IA 1YNTE 4B6WA 2MQJA 2PJHA 2NVUI 4FULA 2V1YA 4LCDE 4IUMB 1CK1A 2GOWA 3R2TA 1TJEA 4GLSC 3GE8C 3OLMD 4JL9A 3KWLA 4RCOA 2DBYA 1SE2A 3TL5A 5J18A 2LMCA 4HKQA 1V1PA 1NENB 4TKNA 4F1SA 4BVUC 1H8CA 5G5GA 2CHXA 1FPYA 2AWTA 3ZVVA 1C1YB 2FIDA 2WHIA 2WXKA 2LVOA 4WAAA 1P0RA 2W3SA 3V6CB 1IBXA 5BO4B 1BUIC 4FADA 1V80A 2LJIA 1FEHA 3MTNB 2DYBA 4W9GA 3WANA 2JWUA 1I4PA 1QOAA 2WXFA 5C2TB 2GBNA 2HJ1A 3T3OA 1H4RA 2L8JA 2O6VB 2DZIA 2MSED 3OAWA 3C8YA 1WJ6A 3PRPB 4W9CA 4HCPB 2V4LA 1ISNA 1MHXA 1YQ3B 1VRAB 4WWNA 3DHHC 1F9JA 2LI5A 1N61A 4N59A 2DENB 2IGHA 3Q2AC 2PW9A 1WJNA 1NDDA 3D32A 3QCAA 3IHPC 4M8MA 4EKUA 1RFKA 2JVCA 2KVRA 2PKOA 2N1VA 4B95A 1OEYJ 1WSPA 3APCA 1J0GA 2PPHA 1YX6B 4OVZA 5KHQA 2AX5A 2KDEB 3KYCD 2B3AA 3ML8A 3VTWA 4MJSB 1DOXA 1OQRA 3P2BA 3ECIA 2N0SB 1EWYC 1UGJA 2BS2B 1L5PA 2JXTA 3OG5A 4LNFA 4MH0E 1GG3A 4G50A 1Y8RC 2K8HA 4ZYNA 2LFIA 4XGAB 3QAQA 3Q8EA 1L0YB 3TEYA 4ANWA 4RF1A 2LRWA 4XWWA 2LRUA 4YSZB 1K53A 1WGYA 3VAWA 2N7DA 2KJRA 1S1QB 3GZNI 1C4AA 1GAQB 2MJDA 3AM9A 4K81A 4H2AA 4B9KA 3CWIA 1NVID 3AEFB 4W9KA 2NS5A 4EUTA 4A3PA 3P4QB 1I4XA 4BKSD 3U2SC 1J7BA 2Y5BB 3APDA 4HCNB 2KFKA 3VH4B 4PS3A 5LXIB 4W9JA 3E9SA 3PZDA 1EF5A 4A8XC 3U7DA 3UF8A 4IM3A 3WALA 5D94A 4AJYB 1Z2MA 4MDKE 1XXGA 3RNEC 1AN8A 1UWMA 3MP9A 4ZOHC 3AU4A 1EU3A 4HDQA 3RZWC 2ZCBA 4KGRA 2KANA 3AE3B 2G3QB 4FJYA 3HHMA 1TBEA 3HIZA 3UQBA 1ZOYB 2XBBC 4M0WB 1WR6E 3PHWB 3N9YC 3PTFC 4ARIA 1E8WA 2VZKD 2K39A 1Z5SB 1QZEA 1P3QU 1RYJA 4NJ6A 5G5HA 2DZKA 4A3OA 3ZDTA 2A4ZA 2J4XA 3GS2A 4FLHA 4DQOC 2WP9B 2ICIA 1KH0A 4W9DA 1QILA 3L08A 3KLSX 2Z8LA 3U52E 4YSYB 2BYTA 4RM9A 4JX1C 3DPDA 4O1NA 1T0YA 4DXFA 4HROA 3RULA 2D07B 2WXMA 2IBIB 3EC8A 4LJPB 1TYGB 2ZVOA 2KJHB 4G11A 3WAOA 2ON8A 1N60A 3MJ5A 4CHKA 1MG8A 1WXVA 4WWPA 1R4MI 2NPTA 1XCQL 1LM8B 4MH8A 4FBJB 3HK0A 1WY8A 4J6IA 3R8BA 2FBWB 3EGRA 1FMAD 3N20C 1OQQA 5BYQA 4KKJA 1HXYD 1D3ZA 2DWQA 2BKFA 1E8ZA 4CO7A 2FUHB 3HUIA 3B08A 2W3RA 1SJHD 4WWOA 1JWMD 4KDIC 1WMHA 5IAAC 3VTVA 1V81A 5T8IA 4YSXB 2ZVNA 3IG3A 4DXGA 2UWQA 4PYZA 1IYFA 3BYYB 2IO1B 4BBNF 1YJJA 3W1SC 2MWSB 3RZFA 3ZTCA 4EOYA 1WWTA 2K22A 4KIKA 1EF1A 1ZDXA 3DBRB 5GMVA 3U4EG 1KOTA 1PGXA 4K7SA 2MBEA 3TBLD 2WXIA 1Q1OA 4UDUC 3BINA 1FO4A 3QK0A 2JRIB 2L7RA 4ANUA 3CIRB 1T0RC 2Y5PA 4TMAB 2OJRA 4JIOU 1TY2A 2PLPA 2L00B 4LNIA 3ZKJC 3DDCB 5IKCM 3L0WB 2M0XA 2OHFA 1NI3A 3MHSD 2ZPNA 1TZOA 1FRRA 3NVVA 1V5TA 1WF9A 2KOXA 2EMSA 1QLBB 1BT0A 1QOBA 3WAMA 3ZLZA 3IFWB 1ZXHA 4E74A 4TQ1A 3EECA 3GB1A 2RDBC 3UIPB 2ZCCA 2RPQA 1UWXA 4LLGM 4RNAA 3W1YA 1T0SC 2GI9A 4ANXA 2N9EB 2SAKA 3DBRI 1XLPA 3AE2B 4RF0A 4WJPA 1MI0A 1F2RI 3VRBB 2JPHA 3AULA 4ASWC 2KZRA 3KUCB 3AEDB 1EM7A 4IW0A 3ZUNA 4L2YA 5KHOA 2K3UA 4F7ZA 4IWOA 4ITKA 3ZNZB 1EO6A 4NY0A 3ZQ4A 4IC7B 3WIMA 2KJ6A 2KN4A 4P1CC 3W9CB 2DAJA 1VD2A 2M1MA 3DBSA 2CJOA 3LJ3A 2FCMA 2NBUA 1WM2A 2BB5A 3VRAB 3U7ZA 5H92C 5JZEB 4E71A 1R7SA 2WU5B 4KSLC 1SE3A 2N7EA 1KLGD 2PTLA 3NVZA 1PGBA 3HRDD 3B2GA 4F8CB 2OEDA 3S2AA 4MM3B 3B2FA 4OVVA 2REXA 1QKZA 3R7RA 1E90A 2PVGC 2BWES 1VZ8A 1U4AA 2MP2B 2WWZA 2EMTA 3RN9C 1V9JA 1LXDA 1GC6A 2DAFA 4IDIA 4NNJB 2EELA 1HQRD 3AE6B 4P16A 1I4GA 3AB5A 1EU4A 1WJ4A 3MJWA 3HVDA 3PZ8A 3ZDMC 2DZMA 3NZUA 2WXHA 3L17A 2PEAA 3DBHB 5LLIA 2QCZA 2KHWB 4Q2JA 2C60A 3AE5B 2WXJA 2L0FA 4HWIB 3U30A 3QX1A 1J8CA 4P1BC 2CJNA 1QT9A 4II2B 1K50A 2WX1A 2RR9A 3DBLI 3RPFC 4IWPA 2N9LA 3IXSA 3H7PA 5AUKA 2V9HA 4RGMA 1KLVA 2WDVB 3QHTA 4CQNA 1GC7A 1YD8U 4CYEA 1ET6A 5HHDG 1MG4A 4LNKA 1RAXA 3A4SC 3I3TB 4EEWA 1JRPA 1V6EA 3ZXRA 3NUHB 4KVGB 1RRBA 1UBIA 2M4NA 4JPSA 4BKSA 2K6DB 2KACA 5G2NA 4TV3A 4BZAA 4WJNA 1G6JA 3KH0A 3T8MA 1NYQA 4ZHPA 4XE0A 3L4PA 2INNE 2NTSA 2O6VD 3KUDB 2JT4B 1P98A 2RMMA 4ZRJA 3VXWA 5BYSA 3Q69A 3TIXA 2X38A 5GXGB 2UU7A 3JW0X 5EE0A 2EKIA 3N1XC 3DVGY 2W9NA 2AEHA 1WE7A 5CHVC 4B0EA 3R66C 3TCAA 2RDHA 2MJEA 4LK0M 2K6QA 2W55A 3FKYA 2GBJA 4AJWA 2L0TA 5C23A 1RFAA 3QIJA 4WQOB 3UINB 3ZW3A 2GBKA 3ZO5B 3PS6A 1FNVA 4ZRKA 2KT7A 1HTOA 1MJDA 2K1FA 1WE6A 1GJZA 3ML9A 2GB1A 1B9RA 2WXLA 2LASA 5J17A 3NHEB 4XC2A 4JLCA 2CS4A 4MELA 1E7UA 3Q8BA 2KYWA 2O2VB 4HPMB 4KV2A 3M95A 2IY1B 3UGBB 3OJ4B 3QC8B 4AWJA 3V05A 2KLCA 2LGIA 5HKHA 4P7IA 1E7VA 1EUVB 1ZPSA 1QOFA 2DZJA 2R2OA 1E8XA 1SEBD 5D7GA 4YL8A 4ICVA 4MSQB 3O13A 3N1YC 4YTNB 1JCKB 1ENFA 4NJ7A 1FCCC 2D3GA 3IAS1 2LXCA 4DBGA 2I2YA 1J7AA 3CMMB 4AQ7A 4HJGE 2KDMA 3AE1B 2IGDA 2KD0A 2M19A 2NBVB 1DGJA 1XCTL 2CHWA 2J7QB 1WX8A 3FILA 1SIFA 3A9KA 3GZNB 2HE7A 2ZW0A 2KTRB 2KMMA 1CZPA 3TEZA 2LUEA 1MVKA 3ENEA 1SSNA 1E7PB 2V3SA 3DVNU 1ZW7A 1WR1A 4OZBA 4C4VB 2KC2A 1SJED 5G55A 3Q14C 3DVNV 1WGGA 2AQ1B 2MBHA 2JXXA 2BTEA 4K7WA 2IO3B 2XK5B 4XWTA 4ZRIA 1XD3B 3MC8A 2KX3A 3Q3NC 4US8A 3NZSA 1SBBB 1ZP0B 2LXAA 1TTNA 3T9LA 1LGRA 4GIVA 4HPLB 1Q5WB 3MFGA 3AEGB 1VDVA 3I63C 5IOIA 1TKYA 4E3CA 1I4HA 1P7EA 1TIFA 1L4DB 3K9PB 5J2RA 3TJPA 2XNAC 2PVOD 2WGSA 2QDFA 4MGIE 1TS5A 4HPPA 3RNGC 4DK5A 1MHHE 4US9A 5LXHA 2RPVA 2FAZA 3BK2A 4AOFA 1C4PA 1YIWA 3PHXB 2V0GA 5EDSA 5E6PA 2MJ3A 2KNBA 2LZ6A 3PPAA 5AZGA 3M3JA 4JGHB 3MC9A 3KQ4A 2HDEA 3I57A 3P1MA 4A9AA 2N7JA 2J52A 2KQ7A 2KX0A 4K3CA 1JROA 1NI2A 3P4PB 4GDKB 1D4BA 2Q5WD 5JH5C 1FNWA 3RCZA 1EWCA 3NRZA 1PYWD 1ZE3D 4I6NB 2WDRB 1KTKA 4NAMA 1QF6A 1PUTA 3BIID 2ZW1A 4DHZB 3P4SB 3ETRA 2LGYA 1WX7A 3P4RB 2H89B 3DWGC 3EFCA 3GP7A 1I7HA 1C78A 3AE9B 1R4MB 3ONSA 3HM6X 3BK1A 5EE9A 3QJZA 5IP4D 2MH7A 3Q8FA 1VCBA 2KVZA 4M02A 1R4NI 2Y5CA 2KMCA 2Z59B 1XLQA 4TQ0A 1FXAA 1WH3A 1KJTA 4GOCA 2KK8A 2WXGA 4G3XB 4ACFA 1N5WA 2D2QA 3VUWA 2VH2A 3NVYA 4KGSA 3NS8A 2FIFA 4NJCA 5D3DA 3B9JA 2MLBA 4KZCA 5BMHA 3PO0A 3L10B 3N3KB 4B0MA 1KF6B 3AI5A 4GDLB 2L32A 3V62A 2WDTB 4GN1A 2CU1A 3AN1A 1JRUA 2JU6X 1TKEA 1IUEA 3CSFA 1L0XB 2NBWB 1XLOA 4DXAB 1YOVB 1OGWA 2L52A 3AE8B 1V97A 1F1HA 2K5PA 4FHJA 2K25A 3W2DA 4IM0A 4KGTA 1LO5D 1ZXIA 1DOYA 4NPNA 2CKHB 2C9WB 3SDLC 4MEMA 4W9EA 1TS4A 1FD6A 2G4DB 4I6LB 3QQ8B 4DHJD 1SB3C 4HEA1 1GOZA 3I5JC 1CMXB 5DPWA 3NG0A 4X57B 1FRDA 5JHAA 2JRHA 4TSSA 3FAHA 4KDLB 3JSVB 3N1ZC 3A9JB 3X23A 1WZ0A 2HTHA 1ZKHA 4S17A 1SIJA 4OZAA 1JALA 4L23A 1ZDVA 4EE2A 3APFA 2SEBD 3NZ3A 3PRZA 1KRHA 2FCQA 4JWUC 2BS4B 3AH7A 3QWZB 5AZFA 2KKCA 5LNK1 4GMVA 4RH6A 2O6VA
chains in the Genus database with same CATH topology
3I63C 3RI7C 1T0QC 3N20C 3RNEC 3RNFC 1T0RC 3I5JC 3RNAC 4P1CC 3N1YC 2INDC 2RDBC 3DHHC 3Q3NC 3RMKC 3RNGC 3DHIC 3N1XC 3DHGC 3RN9C 3Q3MC 3GE3C 3GE8C 3N1ZC 1T0SC 3Q2AC 3Q14C 3RNCC 2INCC 3Q3OC 4P1BC 3RNBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I63 C;  3RI7 C;  1T0Q C;  3N20 C;  3RNE C;  3RNF C;  1T0R C;  3I5J C;  3RNA C;  4P1C C;  3N1Y C;  2IND C;  2RDB C;  3DHH C;  3Q3N C;  3RMK C;  3RNG C;  3DHI C;  3N1X C;  3DHG C;  3RN9 C;  3Q3M C;  3GE3 C;  3GE8 C;  3N1Z C;  1T0S C;  3Q2A C;  3Q14 C;  3RNC C;  2INC C;  3Q3O C;  4P1B C;  3RNB C; 
#chains in the Genus database with same CATH topology
 1V1P B;  3R3M A;  1VZ7 A;  4C7Z A;  3ZRF A;  1YQ4 B;  3VQI A;  4FN2 A;  2AL3 A;  3EHV A;  3AXC A;  4GU2 A;  1E5W A;  4PS8 A;  4MGZ E;  2KFJ A;  4EZJ A;  3BYT B;  4W9F A;  4K7U A;  2WXN A;  3DVG X;  3Q3O C;  4IKG A;  1VZ6 A;  3ZYY X;  2IO0 B;  1NEK B;  1L0V B;  2ZJD A;  5AUI A;  1X1M A;  4II3 B;  4JQW C;  5C3J B;  2HTM E;  4DHJ B;  2L76 A;  2AQ2 B;  5D3I B;  2KTR A;  4TUU A;  2BYE A;  3K9O B;  3DOW A;  5FKA C;  1SE9 A;  3ZIM A;  4AS1 A;  4DDI D;  4WJO A;  2KN5 A;  2WX0 A;  1YN4 A;  2JZP A;  4AUQ C;  2N9P C;  4BOS C;  4PYU A;  4EZL A;  1TS3 A;  3OWE B;  4MJS A;  3WA0 A;  4KX6 B;  3RNF C;  2KAJ A;  3O65 B;  1WYW B;  1VLB A;  4W9L A;  3X0W A;  4XYC A;  4A6Q A;  3NS1 A;  3SFE B;  4KKI A;  4YWG G;  1IP9 A;  3A1Q B;  1FIQ A;  1NBF C;  1C9F A;  4NZL B;  3PLV A;  2NMQ A;  4EZK A;  1E10 A;  2PIA A;  1C76 A;  4RGO S;  4A20 A;  5FK9 C;  2BB6 A;  1PFD A;  1I35 A;  4RGN A;  4USA A;  3AEA B;  3ZJU A;  1HZ5 A;  3SU8 X;  3VR9 B;  3DBL B;  2QIL A;  2JF5 A;  5AEK B;  1L6V A;  3AE4 B;  1JWU D;  2BF8 B;  4BFR A;  3DCG A;  2BYF A;  1JWA D;  1JWS D;  2GMI C;  2C5L C;  4OW0 A;  4HDO A;  4EFO A;  3KWV A;  1TS2 A;  2D3A A;  4GSW A;  2KWC A;  2M56 B;  3OJ3 A;  3DHI C;  1UNS A;  4GDK A;  3SFD B;  2W54 A;  2GBR A;  3AEC B;  2H88 B;  2LEK A;  5TR5 A;  2D3C A;  2QHO A;  2JZ3 B;  5IA7 A;  1SE4 A;  1HA5 A;  1A70 A;  1KFY B;  4R3D A;  4GXB A;  4HRS A;  2VH1 A;  1HZ6 A;  1TZ1 A;  3AV8 A;  1BXT A;  4G0N B;  4WIP A;  4WUR A;  1FCL A;  2E6X A;  2WXR A;  5DCN A;  1C4C A;  3ZNI D;  2X8X X;  2J0K A;  2J42 A;  4M0W A;  4C56 C;  2FCN A;  3N30 A;  2KFK B;  4MSM B;  3MHZ A;  4IM2 A;  1MPE A;  3ZNH B;  4IWQ A;  3B0A A;  5L95 C;  4FA6 A;  3LXF A;  2C7N B;  4HKZ E;  1GB1 A;  1WM3 A;  3VR8 B;  4W9H A;  1WJU A;  4BAX A;  3FC4 A;  3LDZ E;  4BOZ B;  1FNU A;  3C19 A;  4PK1 A;  2IZV B;  2WDQ B;  5CX3 A;  1E0Z A;  3RI7 C;  4GGQ A;  2BKR B;  4N58 A;  2N9X A;  3BVG A;  4GDL A;  2J0J A;  3V60 A;  2OOB B;  1Y56 A;  1SGH A;  2FNJ B;  3SR6 A;  4QAY A;  1NYR A;  1TT5 B;  2LGD A;  3H1U A;  4XZ4 A;  5MPO A;  1T0Q C;  2KDF B;  2LUM A;  1YQB A;  1SF0 A;  4KZ0 A;  4ICU A;  5D2M B;  3L54 A;  1V8C A;  3M62 B;  2JWZ A;  4MGY E;  3GE3 C;  3KYD D;  2WXP A;  4S0R A;  3U8Z A;  2HD5 B;  2KC1 A;  3IT4 B;  3JSV A;  3NY5 A;  4LDT B;  3PT2 B;  4MT5 A;  1C77 A;  1F0Z A;  4HVB A;  5H8Y E;  2INP E;  4AP4 C;  4WAF A;  2GBM A;  1XEE A;  2QSD A;  2DHZ A;  2BVC A;  4LJO B;  4LNO A;  1UUP A;  4K1R B;  3Q3M C;  1T5X D;  1AAR A;  2R61 A;  1AW7 A;  3P42 A;  2NPT B;  3EUB 2;  3AEE B;  1UZX B;  4P6V F;  1UD7 A;  1ZGU B;  1KLU D;  2WNM A;  4WH4 A;  4YTM B;  1N5X A;  2ZNV C;  2E3T A;  1WGK A;  4ZHO A;  4JE3 B;  2I38 A;  3JYU A;  1FM0 D;  1E8Y A;  3W5V B;  2XEW A;  1RLF A;  2ZZP B;  1JWB D;  2EKE C;  3KVF B;  1WMH B;  2LGS A;  1PGA A;  3PSE B;  1VR9 A;  1UEL A;  1ACC A;  5HI1 A;  5DPT A;  1UH6 A;  1TKG A;  3HVZ A;  1HE8 A;  3JVZ X;  2NTT A;  4RGT A;  3H6N A;  2KQ4 X;  1JQ4 A;  1CQV A;  4KIK B;  1N6Z A;  3AEB B;  1OQY A;  1SXT A;  1Q0W B;  1WGD A;  3LYY A;  3NJT A;  2MBB B;  1HEZ E;  2BWF A;  2DYO A;  3AU5 A;  3PRE A;  1XQQ A;  1IPG A;  4MAC A;  1XT9 B;  1L7Y A;  1K52 A;  3PV1 A;  3VUY A;  4OVU A;  1TGZ B;  2RGF A;  3TEX A;  2RD0 A;  3TUO A;  2L05 A;  4C00 A;  5E6N A;  5FR6 A;  2LVQ A;  4ARC A;  1FFU A;  1VJK A;  4C80 A;  1WX9 A;  1P1A A;  2BBC A;  2IJ0 A;  3A1Q A;  5IO9 A;  2N9K A;  4XDC A;  5CHF A;  2GLS A;  1ZUD 2;  2IY0 B;  2I1J A;  1C79 A;  4OZC A;  1WXQ A;  2C7H A;  1ROE A;  3LB8 C;  1KM7 A;  3E56 A;  3BZD B;  2G4S A;  4WQM A;  4N6E B;  1IGD A;  2G45 B;  2HJ8 A;  3Q6B A;  1WFY A;  2IDY A;  2BS3 B;  1J19 A;  2L3Z A;  3V6E B;  5TSS A;  4WWM A;  2M8S A;  2LHD A;  4MM3 A;  1D6E C;  3QA8 A;  4RM8 A;  2MCN B;  1DOI A;  3KW5 B;  2PE9 A;  3DHG C;  2WU2 B;  2MP2 A;  4ZDV A;  4C7Y A;  1R4N B;  2BPS A;  2BT6 A;  1ESF A;  2QMT A;  2WLB A;  4BKT A;  1WXM A;  4FJV B;  3WCQ A;  5CHW A;  1FXT B;  4PS7 A;  4ZRQ A;  1E9M A;  1STE A;  3HM3 A;  1B1Z A;  1WRD B;  4I6P A;  5EE1 A;  3VVW B;  2KO3 A;  1E6E B;  2KDI A;  1T3Q A;  3CF6 E;  3MC0 B;  5E6J A;  2LHE A;  5AZH A;  2LVP A;  3IAM 1;  4ANV A;  3RFZ B;  3BVM A;  5HG2 A;  2K8B A;  2CU3 A;  2G1E A;  2JY6 A;  3ZXV A;  2JYT A;  1TY0 A;  1FFV A;  2J53 A;  3AMZ A;  2Z0E B;  4PT5 A;  5DPS A;  1OEY A;  2IO2 B;  2NCN A;  4YXD B;  1LQB A;  5BMG A;  3ZTD A;  1OTR B;  1JW9 D;  2QIE B;  3RMK C;  2KTF A;  2MBQ A;  2ASQ A;  2XN9 C;  4MGK E;  1UGM A;  2WS3 B;  2LGX A;  4NAW B;  2JSV X;  1V49 A;  4DHZ E;  3RYT A;  1N63 A;  3PLU A;  3ZJV A;  3H7P B;  3GOE A;  1UBQ A;  4ZRP A;  2YVC A;  2DLB A;  4K3B A;  2OJW A;  2TSS A;  2QJL A;  4RFB A;  3H9D A;  3IVF A;  5BYR A;  5CTR C;  2MA9 B;  2MHJ A;  2N1W A;  2UYZ B;  2V3N A;  2MRP A;  4BBN C;  4HK2 A;  2DX5 B;  2VRR B;  1A5R A;  4HLE A;  5IN7 A;  3V61 A;  2K0P A;  4IG7 B;  1UF0 A;  1I42 A;  3BY4 B;  3RUI B;  3URY A;  2L83 A;  3N32 A;  4XX5 A;  5D6J B;  2CR5 A;  3B1L X;  3VHT C;  1I4Q A;  1M94 A;  3SD5 A;  2G9H D;  3T3N A;  1OFF A;  4FXC A;  1V5O A;  1PQS A;  5I4D A;  1WGH A;  1V1O A;  1WRI A;  3P63 A;  4HXD A;  2NR2 A;  3UQA A;  2BGF A;  2YEP B;  1GUA B;  4RMA A;  2IND C;  3PGE A;  2O2V A;  4M8N A;  1DYQ A;  1K8R B;  2J0M A;  3VH3 B;  1RWS A;  2LWP A;  2KWD A;  2W82 A;  2IYD B;  4IOI E;  2D11 A;  1YN5 A;  1XF5 L;  2VZK B;  1QQR A;  3SEB A;  3EA6 A;  3PVL A;  1BML C;  2WQY B;  3RNA C;  1I4R A;  1GNU A;  2FUG 1;  4M01 A;  4L1B A;  5FR3 A;  1XLN A;  5JHB A;  3SHQ A;  3AE7 B;  4REZ A;  3C0R B;  1Q10 A;  2JUO A;  4LTU A;  1K51 A;  1YX5 B;  2DYM A;  1IBX B;  3RD2 A;  2WXQ A;  1GPX A;  2D3B A;  2R2Q A;  3TSS A;  3M63 B;  2MX2 A;  5HFY A;  2IGG A;  3R7Q A;  3UI3 A;  3EFU A;  4C4V A;  3RT3 B;  3J9C A;  1P7F A;  3Q3F A;  4DDG D;  3ZNG C;  2ZPY A;  3BWU D;  2I1K A;  5E6O A;  1WXA A;  2RDG A;  1WIA A;  1J7C A;  2XK5 A;  4LNN A;  1FXI A;  3DWM A;  2DNF A;  2MEK A;  3DQV A;  4A90 A;  1XO3 A;  3TMP B;  4URK A;  3A33 B;  5C1Z A;  3KUZ A;  3ALB A;  2AYO B;  2INC C;  2L1A A;  1C3T A;  2KXJ A;  2MW5 A;  4GB9 A;  1L2N A;  2YLM A;  1D5Z C;  2M0A A;  3FIL B;  3A9K B;  1WXS A;  1MFW A;  1PDX A;  2PE6 B;  1N62 A;  5EE3 A;  2MBO A;  1AYF A;  3NVW A;  1CJE A;  1LFD A;  3QAR A;  1WI0 A;  5BMI A;  1D5X C;  2LJ5 A;  3RNC C;  2BW2 A;  1M4V A;  1WYG A;  3IBE A;  3VTU A;  2IPK D;  2Z0D B;  4FJZ A;  4DWF A;  1V86 A;  2B76 B;  2ONQ A;  4WJQ A;  3ZRC A;  3NOB A;  3TEW A;  2C7M B;  3IT6 B;  1HTQ A;  1WZ3 A;  3W1S A;  4A55 A;  2M17 A;  1WGR A;  4M00 A;  2RSU A;  1S3S G;  2JZZ A;  2KWU B;  3Q8C A;  2V4I B;  4D2K A;  3H8H A;  1F52 A;  4XDD A;  2ZNV B;  3VDZ A;  1F2R C;  3PRM B;  4NQL B;  1ET9 A;  3BVZ A;  3L13 A;  3R2I A;  3W5U B;  1JML A;  2JYE A;  1YJI A;  2D5G A;  2CHZ A;  4ZYS A;  2AQ3 B;  2V3P A;  2WYQ A;  4LDT D;  1YJ1 A;  4YTP B;  2KWV B;  2JQR B;  1T6B X;  3Q3J A;  2YEP F;  3VFK A;  2GRI A;  2QC8 A;  1AWD A;  2N4F A;  3H7S A;  3ZGZ A;  2K9X A;  1RM6 C;  1L6U A;  4OHJ A;  4HJK A;  5L83 A;  3Q8A A;  4J3O D;  1QOG A;  2ZEQ A;  4NAW A;  4FHK A;  1YMH E;  2AL6 A;  2KDB A;  3ABV B;  1L4Z B;  5DPR A;  2K8C A;  3UIO B;  1YN3 A;  4BKG A;  4KSK C;  2BQQ A;  2Y3A A;  3RNB C;  2LD9 A;  2JX5 A;  3V3X A;  3WAP A;  4JWS C;  4N9F 4;  1GB4 A;  2KQS A;  4NQK E;  2KMA A;  2BYV E;  2PMV A;  5JXV A;  1V2Y A;  2QEJ C;  2KLG A;  1D5M C;  4YT0 B;  2D10 A;  2A5U A;  2FE8 A;  3PZ7 A;  3A4R A;  1IGC A;  2WXO A;  3CST A;  1F77 A;  3ZJT A;  3VUX A;  2ACZ B;  3DBH I;  3L16 A;  1P9D U;  3A9J A;  3I9V 1;  2FCS A;  4W9I A;  1YNT E;  4B6W A;  2MQJ A;  2PJH A;  2NVU I;  4FUL A;  2V1Y A;  4LCD E;  4IUM B;  1CK1 A;  2GOW A;  3R2T A;  1TJE A;  4GLS C;  3GE8 C;  3OLM D;  4JL9 A;  3KWL A;  4RCO A;  2DBY A;  1SE2 A;  3TL5 A;  5J18 A;  2LMC A;  4HKQ A;  1V1P A;  1NEN B;  4TKN A;  4F1S A;  4BVU C;  1H8C A;  5G5G A;  2CHX A;  1FPY A;  2AWT A;  3ZVV A;  1C1Y B;  2FID A;  2WHI A;  2WXK A;  2LVO A;  4WAA A;  1P0R A;  2W3S A;  3V6C B;  1IBX A;  5BO4 B;  1BUI C;  4FAD A;  1V80 A;  2LJI A;  1FEH A;  3MTN B;  2DYB A;  4W9G A;  3WAN A;  2JWU A;  1I4P A;  1QOA A;  2WXF A;  5C2T B;  2GBN A;  2HJ1 A;  3T3O A;  1H4R A;  2L8J A;  2O6V B;  2DZI A;  2MSE D;  3OAW A;  3C8Y A;  1WJ6 A;  3PRP B;  4W9C A;  4HCP B;  2V4L A;  1ISN A;  1MHX A;  1YQ3 B;  1VRA B;  4WWN A;  3DHH C;  1F9J A;  2LI5 A;  1N61 A;  4N59 A;  2DEN B;  2IGH A;  3Q2A C;  2PW9 A;  1WJN A;  1NDD A;  3D32 A;  3QCA A;  3IHP C;  4M8M A;  4EKU A;  1RFK A;  2JVC A;  2KVR A;  2PKO A;  2N1V A;  4B95 A;  1OEY J;  1WSP A;  3APC A;  1J0G A;  2PPH A;  1YX6 B;  4OVZ A;  5KHQ A;  2AX5 A;  2KDE B;  3KYC D;  2B3A A;  3ML8 A;  3VTW A;  4MJS B;  1DOX A;  1OQR A;  3P2B A;  3ECI A;  2N0S B;  1EWY C;  1UGJ A;  2BS2 B;  1L5P A;  2JXT A;  3OG5 A;  4LNF A;  4MH0 E;  1GG3 A;  4G50 A;  1Y8R C;  2K8H A;  4ZYN A;  2LFI A;  4XGA B;  3QAQ A;  3Q8E A;  1L0Y B;  3TEY A;  4ANW A;  4RF1 A;  2LRW A;  4XWW A;  2LRU A;  4YSZ B;  1K53 A;  1WGY A;  3VAW A;  2N7D A;  2KJR A;  1S1Q B;  3GZN I;  1C4A A;  1GAQ B;  2MJD A;  3AM9 A;  4K81 A;  4H2A A;  4B9K A;  3CWI A;  1NVI D;  3AEF B;  4W9K A;  2NS5 A;  4EUT A;  4A3P A;  3P4Q B;  1I4X A;  4BKS D;  3U2S C;  1J7B A;  2Y5B B;  3APD A;  4HCN B;  2KFK A;  3VH4 B;  4PS3 A;  5LXI B;  4W9J A;  3E9S A;  3PZD A;  1EF5 A;  4A8X C;  3U7D A;  3UF8 A;  4IM3 A;  3WAL A;  5D94 A;  4AJY B;  1Z2M A;  4MDK E;  1XXG A;  3RNE C;  1AN8 A;  1UWM A;  3MP9 A;  4ZOH C;  3AU4 A;  1EU3 A;  4HDQ A;  3RZW C;  2ZCB A;  4KGR A;  2KAN A;  3AE3 B;  2G3Q B;  4FJY A;  3HHM A;  1TBE A;  3HIZ A;  3UQB A;  1ZOY B;  2XBB C;  4M0W B;  1WR6 E;  3PHW B;  3N9Y C;  3PTF C;  4ARI A;  1E8W A;  2VZK D;  2K39 A;  1Z5S B;  1QZE A;  1P3Q U;  1RYJ A;  4NJ6 A;  5G5H A;  2DZK A;  4A3O A;  3ZDT A;  2A4Z A;  2J4X A;  3GS2 A;  4FLH A;  4DQO C;  2WP9 B;  2ICI A;  1KH0 A;  4W9D A;  1QIL A;  3L08 A;  3KLS X;  2Z8L A;  3U52 E;  4YSY B;  2BYT A;  4RM9 A;  4JX1 C;  3DPD A;  4O1N A;  1T0Y A;  4DXF A;  4HRO A;  3RUL A;  2D07 B;  2WXM A;  2IBI B;  3EC8 A;  4LJP B;  1TYG B;  2ZVO A;  2KJH B;  4G11 A;  3WAO A;  2ON8 A;  1N60 A;  3MJ5 A;  4CHK A;  1MG8 A;  1WXV A;  4WWP A;  1R4M I;  2NPT A;  1XCQ L;  1LM8 B;  4MH8 A;  4FBJ B;  3HK0 A;  1WY8 A;  4J6I A;  3R8B A;  2FBW B;  3EGR A;  1FMA D;  3N20 C;  1OQQ A;  5BYQ A;  4KKJ A;  1HXY D;  1D3Z A;  2DWQ A;  2BKF A;  1E8Z A;  4CO7 A;  2FUH B;  3HUI A;  3B08 A;  2W3R A;  1SJH D;  4WWO A;  1JWM D;  4KDI C;  1WMH A;  5IAA C;  3VTV A;  1V81 A;  5T8I A;  4YSX B;  2ZVN A;  3IG3 A;  4DXG A;  2UWQ A;  4PYZ A;  1IYF A;  3BYY B;  2IO1 B;  4BBN F;  1YJJ A;  3W1S C;  2MWS B;  3RZF A;  3ZTC A;  4EOY A;  1WWT A;  2K22 A;  4KIK A;  1EF1 A;  1ZDX A;  3DBR B;  5GMV A;  3U4E G;  1KOT A;  1PGX A;  4K7S A;  2MBE A;  3TBL D;  2WXI A;  1Q1O A;  4UDU C;  3BIN A;  1FO4 A;  3QK0 A;  2JRI B;  2L7R A;  4ANU A;  3CIR B;  1T0R C;  2Y5P A;  4TMA B;  2OJR A;  4JIO U;  1TY2 A;  2PLP A;  2L00 B;  4LNI A;  3ZKJ C;  3DDC B;  5IKC M;  3L0W B;  2M0X A;  2OHF A;  1NI3 A;  3MHS D;  2ZPN A;  1TZO A;  1FRR A;  3NVV A;  1V5T A;  1WF9 A;  2KOX A;  2EMS A;  1QLB B;  1BT0 A;  1QOB A;  3WAM A;  3ZLZ A;  3IFW B;  1ZXH A;  4E74 A;  4TQ1 A;  3EEC A;  3GB1 A;  2RDB C;  3UIP B;  2ZCC A;  2RPQ A;  1UWX A;  4LLG M;  4RNA A;  3W1Y A;  1T0S C;  2GI9 A;  4ANX A;  2N9E B;  2SAK A;  3DBR I;  1XLP A;  3AE2 B;  4RF0 A;  4WJP A;  1MI0 A;  1F2R I;  3VRB B;  2JPH A;  3AUL A;  4ASW C;  2KZR A;  3KUC B;  3AED B;  1EM7 A;  4IW0 A;  3ZUN A;  4L2Y A;  5KHO A;  2K3U A;  4F7Z A;  4IWO A;  4ITK A;  3ZNZ B;  1EO6 A;  4NY0 A;  3ZQ4 A;  4IC7 B;  3WIM A;  2KJ6 A;  2KN4 A;  4P1C C;  3W9C B;  2DAJ A;  1VD2 A;  2M1M A;  3DBS A;  2CJO A;  3LJ3 A;  2FCM A;  2NBU A;  1WM2 A;  2BB5 A;  3VRA B;  3U7Z A;  5H92 C;  5JZE B;  4E71 A;  1R7S A;  2WU5 B;  4KSL C;  1SE3 A;  2N7E A;  1KLG D;  2PTL A;  3NVZ A;  1PGB A;  3HRD D;  3B2G A;  4F8C B;  2OED A;  3S2A A;  4MM3 B;  3B2F A;  4OVV A;  2REX A;  1QKZ A;  3R7R A;  1E90 A;  2PVG C;  2BWE S;  1VZ8 A;  1U4A A;  2MP2 B;  2WWZ A;  2EMT A;  3RN9 C;  1V9J A;  1LXD A;  1GC6 A;  2DAF A;  4IDI A;  4NNJ B;  2EEL A;  1HQR D;  3AE6 B;  4P16 A;  1I4G A;  3AB5 A;  1EU4 A;  1WJ4 A;  3MJW A;  3HVD A;  3PZ8 A;  3ZDM C;  2DZM A;  3NZU A;  2WXH A;  3L17 A;  2PEA A;  3DBH B;  5LLI A;  2QCZ A;  2KHW B;  4Q2J A;  2C60 A;  3AE5 B;  2WXJ A;  2L0F A;  4HWI B;  3U30 A;  3QX1 A;  1J8C A;  4P1B C;  2CJN A;  1QT9 A;  4II2 B;  1K50 A;  2WX1 A;  2RR9 A;  3DBL I;  3RPF C;  4IWP A;  2N9L A;  3IXS A;  3H7P A;  5AUK A;  2V9H A;  4RGM A;  1KLV A;  2WDV B;  3QHT A;  4CQN A;  1GC7 A;  1YD8 U;  4CYE A;  1ET6 A;  5HHD G;  1MG4 A;  4LNK A;  1RAX A;  3A4S C;  3I3T B;  4EEW A;  1JRP A;  1V6E A;  3ZXR A;  3NUH B;  4KVG B;  1RRB A;  1UBI A;  2M4N A;  4JPS A;  4BKS A;  2K6D B;  2KAC A;  5G2N A;  4TV3 A;  4BZA A;  4WJN A;  1G6J A;  3KH0 A;  3T8M A;  1NYQ A;  4ZHP A;  4XE0 A;  3L4P A;  2INN E;  2NTS A;  2O6V D;  3KUD B;  2JT4 B;  1P98 A;  2RMM A;  4ZRJ A;  3VXW A;  5BYS A;  3Q69 A;  3TIX A;  2X38 A;  5GXG B;  2UU7 A;  3JW0 X;  5EE0 A;  2EKI A;  3N1X C;  3DVG Y;  2W9N A;  2AEH A;  1WE7 A;  5CHV C;  4B0E A;  3R66 C;  3TCA A;  2RDH A;  2MJE A;  4LK0 M;  2K6Q A;  2W55 A;  3FKY A;  2GBJ A;  4AJW A;  2L0T A;  5C23 A;  1RFA A;  3QIJ A;  4WQO B;  3UIN B;  3ZW3 A;  2GBK A;  3ZO5 B;  3PS6 A;  1FNV A;  4ZRK A;  2KT7 A;  1HTO A;  1MJD A;  2K1F A;  1WE6 A;  1GJZ A;  3ML9 A;  2GB1 A;  1B9R A;  2WXL A;  2LAS A;  5J17 A;  3NHE B;  4XC2 A;  4JLC A;  2CS4 A;  4MEL A;  1E7U A;  3Q8B A;  2KYW A;  2O2V B;  4HPM B;  4KV2 A;  3M95 A;  2IY1 B;  3UGB B;  3OJ4 B;  3QC8 B;  4AWJ A;  3V05 A;  2KLC A;  2LGI A;  5HKH A;  4P7I A;  1E7V A;  1EUV B;  1ZPS A;  1QOF A;  2DZJ A;  2R2O A;  1E8X A;  1SEB D;  5D7G A;  4YL8 A;  4ICV A;  4MSQ B;  3O13 A;  3N1Y C;  4YTN B;  1JCK B;  1ENF A;  4NJ7 A;  1FCC C;  2D3G A;  3IAS 1;  2LXC A;  4DBG A;  2I2Y A;  1J7A A;  3CMM B;  4AQ7 A;  4HJG E;  2KDM A;  3AE1 B;  2IGD A;  2KD0 A;  2M19 A;  2NBV B;  1DGJ A;  1XCT L;  2CHW A;  2J7Q B;  1WX8 A;  3FIL A;  1SIF A;  3A9K A;  3GZN B;  2HE7 A;  2ZW0 A;  2KTR B;  2KMM A;  1CZP A;  3TEZ A;  2LUE A;  1MVK A;  3ENE A;  1SSN A;  1E7P B;  2V3S A;  3DVN U;  1ZW7 A;  1WR1 A;  4OZB A;  4C4V B;  2KC2 A;  1SJE D;  5G55 A;  3Q14 C;  3DVN V;  1WGG A;  2AQ1 B;  2MBH A;  2JXX A;  2BTE A;  4K7W A;  2IO3 B;  2XK5 B;  4XWT A;  4ZRI A;  1XD3 B;  3MC8 A;  2KX3 A;  3Q3N C;  4US8 A;  3NZS A;  1SBB B;  1ZP0 B;  2LXA A;  1TTN A;  3T9L A;  1LGR A;  4GIV A;  4HPL B;  1Q5W B;  3MFG A;  3AEG B;  1VDV A;  3I63 C;  5IOI A;  1TKY A;  4E3C A;  1I4H A;  1P7E A;  1TIF A;  1L4D B;  3K9P B;  5J2R A;  3TJP A;  2XNA C;  2PVO D;  2WGS A;  2QDF A;  4MGI E;  1TS5 A;  4HPP A;  3RNG C;  4DK5 A;  1MHH E;  4US9 A;  5LXH A;  2RPV A;  2FAZ A;  3BK2 A;  4AOF A;  1C4P A;  1YIW A;  3PHX B;  2V0G A;  5EDS A;  5E6P A;  2MJ3 A;  2KNB A;  2LZ6 A;  3PPA A;  5AZG A;  3M3J A;  4JGH B;  3MC9 A;  3KQ4 A;  2HDE A;  3I57 A;  3P1M A;  4A9A A;  2N7J A;  2J52 A;  2KQ7 A;  2KX0 A;  4K3C A;  1JRO A;  1NI2 A;  3P4P B;  4GDK B;  1D4B A;  2Q5W D;  5JH5 C;  1FNW A;  3RCZ A;  1EWC A;  3NRZ A;  1PYW D;  1ZE3 D;  4I6N B;  2WDR B;  1KTK A;  4NAM A;  1QF6 A;  1PUT A;  3BII D;  2ZW1 A;  4DHZ B;  3P4S B;  3ETR A;  2LGY A;  1WX7 A;  3P4R B;  2H89 B;  3DWG C;  3EFC A;  3GP7 A;  1I7H A;  1C78 A;  3AE9 B;  1R4M B;  3ONS A;  3HM6 X;  3BK1 A;  5EE9 A;  3QJZ A;  5IP4 D;  2MH7 A;  3Q8F A;  1VCB A;  2KVZ A;  4M02 A;  1R4N I;  2Y5C A;  2KMC A;  2Z59 B;  1XLQ A;  4TQ0 A;  1FXA A;  1WH3 A;  1KJT A;  4GOC A;  2KK8 A;  2WXG A;  4G3X B;  4ACF A;  1N5W A;  2D2Q A;  3VUW A;  2VH2 A;  3NVY A;  4KGS A;  3NS8 A;  2FIF A;  4NJC A;  5D3D A;  3B9J A;  2MLB A;  4KZC A;  5BMH A;  3PO0 A;  3L10 B;  3N3K B;  4B0M A;  1KF6 B;  3AI5 A;  4GDL B;  2L32 A;  3V62 A;  2WDT B;  4GN1 A;  2CU1 A;  3AN1 A;  1JRU A;  2JU6 X;  1TKE A;  1IUE A;  3CSF A;  1L0X B;  2NBW B;  1XLO A;  4DXA B;  1YOV B;  1OGW A;  2L52 A;  3AE8 B;  1V97 A;  1F1H A;  2K5P A;  4FHJ A;  2K25 A;  3W2D A;  4IM0 A;  4KGT A;  1LO5 D;  1ZXI A;  1DOY A;  4NPN A;  2CKH B;  2C9W B;  3SDL C;  4MEM A;  4W9E A;  1TS4 A;  1FD6 A;  2G4D B;  4I6L B;  3QQ8 B;  4DHJ D;  1SB3 C;  4HEA 1;  1GOZ A;  3I5J C;  1CMX B;  5DPW A;  3NG0 A;  4X57 B;  1FRD A;  5JHA A;  2JRH A;  4TSS A;  3FAH A;  4KDL B;  3JSV B;  3N1Z C;  3A9J B;  3X23 A;  1WZ0 A;  2HTH A;  1ZKH A;  4S17 A;  1SIJ A;  4OZA A;  1JAL A;  4L23 A;  1ZDV A;  4EE2 A;  3APF A;  2SEB D;  3NZ3 A;  3PRZ A;  1KRH A;  2FCQ A;  4JWU C;  2BS4 B;  3AH7 A;  3QWZ B;  5AZF A;  2KKC A;  5LNK 1;  4GMV A;  4RH6 A;  2O6V A; 
#chains in the Genus database with same CATH homology
 3I63 C;  3RI7 C;  1T0Q C;  3N20 C;  3RNE C;  3RNF C;  1T0R C;  3I5J C;  3RNA C;  4P1C C;  3N1Y C;  2IND C;  2RDB C;  3DHH C;  3Q3N C;  3RMK C;  3RNG C;  3DHI C;  3N1X C;  3DHG C;  3RN9 C;  3Q3M C;  3GE3 C;  3GE8 C;  3N1Z C;  1T0S C;  3Q2A C;  3Q14 C;  3RNC C;  2INC C;  3Q3O C;  4P1B C;  3RNB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...