3I63C

Peroxide bound toluene 4-monooxygenase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
total genus 23
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i63C00
3DHIC 3I63C 3N1XC 4P1BC 3Q2AC 3Q3MC 3GE3C 3N20C 1T0QC 2RDBC 3RNGC 3RNFC 3RMKC 3RNBC 2INCC 2INDC 3Q3NC 3DHHC 1T0RC 3I5JC 3GE8C 3Q14C 4P1CC 3N1ZC 3DHGC 3RN9C 3N1YC 3RNEC 3RNCC 3Q3OC 3RNAC 1T0SC 3RI7C
chains in the Genus database with same CATH superfamily
3Q8CA 2KT7A 3Q3MC 1JWBD 1KJTA 3S2AA 1NVID 2BT6A 4E74A 2BGFA 3C19A 5G55A 4L23A 1G6JA 1VZ8A 4MGKE 2AEHA 3EGRA 1R4NB 4LNFA 2FE8A 3B2GA 3FKYA 1WXVA 2JXXA 1TTNA 2BB6A 3K9PB 1RRBA 4FADA 2CHXA 3ZNID 1FPYA 2MP2A 3AXCA 3V3XA 3VRBB 2N7DA 1I4QA 4KIKA 3TBLD 1F2RC 4B6WA 1FD6A 2JVCA 1CJEA 2FNJB 4XDCA 4FXCA 3VVWB 2LGIA 4CQNA 1T5XD 2H88B 3B1LX 3WANA 3EFCA 3BIID 3KH0A 3IHPC 4FHJA 1UUPA 3RPFC 2KN5A 1XXGA 1R4NI 5L83A 5J18A 3IAS1 4M0WB 1MHHE 4BZAA 4P1CC 1TZOA 4DHJB 4YSXB 1GB1A 1FXTB 2K6QA 4LNNA 4BOSC 4MDKE 3VHTC 2WDQB 1TIFA 1SIJA 1WXMA 1KF6B 1I7HA 1YN3A 5EE9A 2G3QB 2K1FA 2WYQA 4JPSA 1TKGA 1NENB 4YTNB 3AM9A 3OJ4B 1QOFA 3PS6A 1DGJA 2PIAA 4JGHB 4C00A 3AI5A 4ICUA 2XK5B 4HRSA 4P1BC 3BK1A 1SIFA 3DVGY 4W9EA 4II2B 3ZQ4A 1E9MA 1YQ3B 2LEKA 3DBRB 5JXVA 3I3TB 5DCNA 2NMQA 5D2MB 4ZRPA 4YTMB 3VAWA 3UIPB 1GUAB 4G0NB 4BKSD 3GP7A 1J7AA 4RNAA 3P4RB 2MH7A 1JWUD 3NJTA 2OOBB 4PT5A 1SSNA 2WGSA 4GB9A 5C23A 2QJLA 2CJOA 1F1HA 3DBRI 2PW9A 2J42A 1A5RA 3A33B 3AE1B 1UWMA 5FKAC 1L6VA 4M8MA 3RI7C 1YQBA 2LGYA 1GPXA 1E7PB 5BO4B 3PV1A 1AN8A 4ARIA 2ZW1A 1GAQB 3AE6B 3LDZE 5IA7A 5HG2A 1DOIA 3ZXRA 1HXYD 3GB1A 3Q8EA 3WAMA 2DAJA 2J52A 2KVRA 2NPTA 4PYZA 2DNFA 1YJ1A 3LJ3A 1H8CA 3BINA 1EU3A 5HHDG 1YNTE 3DHIC 1V5TA 5MPOA 1YOVB 4K7WA 4KGTA 1WX7A 4ANUA 2EMTA 4N9F4 1N63A 1VZ6A 2PKOA 3ZNZB 4LLGM 2ICIA 1JWAD 1WJ6A 1R4MB 1TKYA 4WJNA 2O6VD 3ZYYX 3RNAC 3L16A 4I6LB 4Q2JA 2MBHA 3PZ8A 1WRDB 4DHZE 3UF8A 2C60A 1V80A 1SEBD 3B08A 2EELA 3MTNB 2N0SB 1YIWA 2OHFA 4FJYA 3GZNI 1UD7A 1DOXA 3ZJUA 2KFJA 3RD2A 1QOGA 5GMVA 1K50A 3NOBA 2NBVB 2AQ1B 4KX6B 3ZUNA 1P9DU 4IM3A 1LGRA 1SXTA 2V3PA 1JRPA 3BY4B 3DWMA 3D32A 4ASWC 1AARA 2WDTB 3IXSA 3BYYB 3QQ8B 4KZ0A 3ZNGC 1S1QB 2RGFA 2KWDA 1C77A 2CR5A 5CTRC 3H1UA 4WAAA 2KNBA 1YD8U 1YN5A 1WJNA 2GB1A 1WM2A 3ENEA 1WSPA 2KANA 2BVCA 2KN4A 3RNGC 3RNFC 1Z2MA 2J4XA 4RMAA 2O2VB 1QLBB 2MSED 1MVKA 4YWGG 3NZSA 1WGDA 3ZKJC 1MHXA 4XE0A 1N5WA 3RYTA 3TEXA 2CJNA 4GN1A 3N1XC 2DAFA 3AE4B 1EF1A 1FM0D 5EE3A 5JZEB 3JYUA 4NQLB 4F1SA 2M0XA 2K25A 3U7DA 2MCNB 2SAKA 1JRUA 2WDRB 2D2QA 3B2FA 3P4QB 2MJ3A 2NS5A 3PGEA 2FCMA 3W9CB 3QK0A 1JCKB 1PDXA 2KYWA 1JALA 2DZIA 1KTKA 2C7HA 2MJDA 2D3AA 2MBQA 1E8XA 3DVGX 4IC7B 2JU6X 1UWXA 3OJ3A 1EUVB 1Y8RC 1TBEA 4B0EA 4HJKA 1QQRA 3HHMA 2JT4B 1ZDVA 2LD9A 2LUMA 2BBCA 1FNUA 1IPGA 1P7FA 2M4NA 1OTRB 2DZMA 1C4CA 3FAHA 3AE8B 2UWQA 2I38A 4XWWA 4WWPA 4ANWA 4G3XB 4MSMB 3NS8A 2J0MA 3QWZB 2O6VA 3AE9B 1V49A 2V4IB 3CSTA 4FN2A 2C9WB 3V6EB 2INCC 3HK0A 1WH3A 1I4GA 2CKHB 3P42A 2EMSA 3BWUD 1CMXB 5IKCM 1WZ0A 4KIKB 2KX3A 2ZNVB 5KHQA 4DHZB 2E6XA 2KTFA 2GI9A 3NG0A 3GZNB 3ZDMC 3MJ5A 2L76A 3PT2B 4RM9A 1P1AA 3VH4B 5AZFA 4M01A 2XBBC 4BBNC 2N1WA 2FCNA 1V5OA 2W54A 3T3NA 2KWCA 5HI1A 3KW5B 2HTME 3A9KB 3ZJTA 2RD0A 2R2QA 1B9RA 2ZCCA 2GBRA 2WXHA 2DZKA 2IJ0A 3I63C 4NPNA 1IGDA 4HDQA 4ZRQA 2GMIC 3GS2A 2CHZA 4HVBA 3AMZA 1XLQA 4ZYNA 3HM6X 1TS4A 2WP9B 2C7MB 4NQKE 2KFKB 4ZRJA 4GDLA 3A9KA 3BZDB 2WXRA 1EO6A 4OW0A 3BVZA 3RN9C 5BMHA 2K6DB 2KDFB 2VZKB 1FCLA 2IGDA 2ZVOA 4RGMA 2YVCA 2JYEA 3NVYA 4DXFA 2YEPF 4DBGA 1ET6A 2MWSB 2Z0DB 5D94A 2KX0A 2L1AA 3SR6A 2MX2A 4FA6A 4KSKC 3ZLZA 3HVZA 3N1YC 1M94A 2BWES 1GG3A 3RZWC 2DBYA 2LRWA 5JHBA 3RUIB 1JQ4A 1L0VB 3DOWA 2PMVA 1OQRA 1OEYJ 2JSVX 4PK1A 4KGSA 1XF5L 2KJHB 2MRPA 3IFWB 3C8YA 4GU2A 2A4ZA 1K8RB 4IOIE 1RAXA 3AEEB 3AECB 3R8BA 1D4BA 1UGMA 3DPDA 2N9KA 1C79A 2GBMA 3AEFB 4GLSC 3ZRFA 2LWPA 3J9CA 3WALA 2MBBB 1BT0A 4XX5A 4AS1A 4BFRA 3GOEA 1J19A 4IWQA 3QARA 2IO1B 2GBJA 3Q3FA 4W9IA 3R3MA 1FO4A 4RCOA 5FR6A 2RPQA 2BYEA 4ICVA 2V1YA 1WGGA 4LNKA 1L5PA 4RGTA 5CX3A 1ZKHA 4A6QA 4M8NA 2QILA 4MJSB 2NCNA 4ZYSA 2PVOD 2KOXA 1YX5B 2DZJA 1E8ZA 1WJUA 1XQQA 3QA8A 2JZ3B 4RGOS 2AL3A 1FRRA 2WXFA 4NY0A 1ZW7A 2IO2B 4ANXA 4A90A 2C7NB 3RNBC 4FULA 2G4DB 4RM8A 2MW5A 1WX8A 2DLBA 4ZHPA 3QAQA 3AULA 3C0RB 1WYWB 2O2VA 1QILA 1T0SC 2KWVB 4WWNA 3I57A 5E6NA 4WWOA 1ZXIA 3VUYA 1TY2A 1J7BA 4OVZA 3I5JC 3V6CB 1PFDA 2YLMA 1WM3A 3APFA 3QCAA 2IBIB 4OZCA 1WXSA 2OJRA 4MGZE 3AE7B 3X0WA 1D5XC 1SE2A 2V9HA 3DCGA 4USAA 2D10A 5AZHA 1LQBA 1E8WA 2IPKD 2K8CA 4HK2A 3ZXVA 1WJ4A 1NDDA 3AE5B 5D7GA 4K1RB 2ZCBA 2G1EA 1VDVA 5AUKA 4EE2A 4N59A 4RH6A 4DWFA 2HD5B 1SGHA 2K0PA 1ROEA 3H6NA 2WXKA 2WDVB 2XEWA 2CHWA 2LXCA 3WCQA 4BAXA 4P7IA 1Z5SB 4GIVA 1ACCA 2MA9B 3SU8X 2JY6A 4ACFA 1RFAA 3RFZB 2QCZA 3HUIA 4W9GA 2I1JA 2BKRB 3UGBB 2WXGA 2R61A 3TIXA 1HTQA 3HM3A 2L8JA 2K8HA 3MFGA 3VUXA 3CF6E 5LXIB 2Q5WD 2WNMA 3PRMB 1OGWA 1XCQL 4ZRIA 2W3SA 4MT5A 1JMLA 1C9FA 2Y5CA 4HPLB 2I2YA 4M0WA 5IOIA 2K5PA 3Q8FA 2G4SA 4OZAA 4C80A 2IYDB 2UYZB 1J7CA 3IT6B 3ZIMA 3TUOA 1ET9A 4XGAB 2KC1A 1STEA 5DPTA 1T6BX 4AQ7A 4P16A 1FNVA 2QEJC 3ZVVA 5G5GA 1JW9D 3AV8A 2K39A 4HWIB 4OZBA 5IO9A 1FXAA 3P1MA 4MH0E 5BYQA 1RLFA 2JRHA 2GBNA 2KACA 2WX1A 3PTFC 4NAWB 2VH1A 4IUMB 4B9KA 1TGZB 3A1QA 2V3SA 1E90A 2TSSA 3M63B 3W2DA 3KVFB 3A1QB 4KZCA 5C3JB 4WJOA 3E9SA 4OVVA 1AW7A 3Q3JA 2W55A 1V1OA 3Q8BA 5C2TB 1GOZA 4AJYB 1RFKA 2WU5B 3LYYA 1N61A 1H4RA 2K8BA 3Q69A 2KZRA 4BOZB 1TT5B 1FFUA 3IT4B 1HEZE 1V6EA 4UDUC 3PREA 3AE2B 3N20C 3QC8B 2V4LA 2MBEA 4A3PA 1WXQA 1VRAB 5J2RA 1XEEA 1B1ZA 3DHHC 2VZKD 4YL8A 2N9EB 2W82A 2KVZA 1QOBA 4HPPA 5FK9C 4BVUC 3VTWA 3IAM1 1N5XA 1TJEA 3N3KB 4ZDVA 1PGBA 2LGXA 2INPE 4S17A 1MG4A 3NVVA 2WXNA 1BUIC 2PLPA 3ZDTA 3EHVA 4IM0A 3M3JA 3N30A 4WJQA 3HRDD 2BYVE 1JROA 3RT3B 1SE9A 3AEGB 3QIJA 2JWZA 3KUDB 1UH6A 3X23A 2IO3B 1IUEA 4EFOA 2N9LA 4O1NA 1F2RI 1E10A 3AN1A 3I9V1 1E6EB 1QZEA 1C1YB 4YT0B 2W9NA 2ZZPB 3PO0A 1IP9A 1ESFA 4K3BA 4KV2A 1QF6A 2KMCA 2ONQA 2LJIA 1F9JA 2FIFA 1CQVA 2JPHA 4LTUA 3L54A 1WE7A 3OAWA 1BMLC 4PS3A 2L7RA 1VCBA 2VH2A 4REZA 4DXAB 1WI0A 1QT9A 3AU5A 4TQ1A 1FRDA 4LDTD 2NTSA 3ZGZA 2G45B 2BS2B 4BBNF 3UQBA 2LVOA 3Q2AC 3PHXB 1IBXB 4EKUA 3KQ4A 4HROA 3RMKC 2Y5BB 3JSVB 1K51A 4WURA 1SJHD 3ZTCA 4H2AA 2ASQA 1L4ZB 1ENFA 1UNSA 4A55A 2JWUA 3OG5A 4XWTA 4EZLA 4E3CA 3QJZA 4WWMA 2HJ1A 2WXIA 2QDFA 3WAPA 3M62B 1GJZA 2V3NA 3IG3A 2CS4A 3OWEB 3W5UB 4LK0M 2BW2A 4R3DA 2RR9A 3DQVA 2M8SA 2WXOA 4AJWA 1WY8A 1BXTA 1C78A 1I4PA 4MJSA 3A4RA 1ZXHA 4JWSC 2BS4B 2L0TA 1IGCA 2D07B 2M19A 1L4DB 2KAJA 2A5UA 4OHJA 4IWPA 2BQQA 1UGJA 1WR6E 5EE0A 2HE7A 3EUB2 4JE3B 4WH4A 4E71A 3CIRB 1FFVA 2PE9A 2JRIB 1WF9A 4BKSA 3R7RA 2J53A 2D11A 3E56A 1C76A 1NYQA 4C4VB 1WE6A 4C7YA 3JSVA 2KQ7A 1RM6C 2Y5PA 1E8YA 3K9OB 2KWUB 2KJ6A 5G2NA 2L3ZA 3LB8C 5JHAA 1TS5A 2WWZA 1AWDA 4GSWA 5HFYA 3AE3B 4II3B 1VR9A 2KMAA 2W3RA 1WR1A 5E6PA 3ML8A 3Q6BA 4MEMA 2M17A 4TMAB 3P63A 1ZGUB 4EZKA 1MFWA 4AOFA 4B95A 4N58A 1XCTL 5AUIA 2RDGA 2PPHA 4YTPB 5FR3A 2Z0EB 3U2SC 1J8CA 4A9AA 4BKTA 4GGQA 2BPSA 1KLUD 4A20A 4DDID 3SD5A 2SEBD 3URYA 3DVNU 1I35A 2LGSA 2WXLA 3W1SA 3KWLA 5IN7A 2ZW0A 4G11A 3SFDB 3R2IA 1T0RC 2D3BA 1VJKA 3MC0B 1YJJA 1WFYA 3VH3B 1PQSA 3NY5A 3WAOA 2KXJA 1QKZA 2DYBA 1XLPA 4GDLB 4XZ4A 5J17A 5EE1A 2LFIA 5LNK1 2BB5A 3KUZA 2Y3AA 3ZO5B 1L0YB 2J7QB 3MP9A 1C4AA 3OLMD 1OQYA 4XDDA 4KDLB 2LRUA 4MACA 4US8A 5DPRA 3N1ZC 2LHDA 1WGKA 1GC6A 1FNWA 4JX1C 4PS8A 2KQ4X 3AH7A 2M56B 4KKJA 1A70A 1FIQA 3AEBB 2GLSA 3ABVB 4TV3A 3PSEB 2IGGA 2N1VA 1DOYA 2FAZA 1ZPSA 4AUQC 1Q5WB 2WS3B 3TL5A 2NR2A 3L08A 3TMPB 2XK5A 5CHFA 4TSSA 3TCAA 5JH5C 1KRHA 2YEPB 3DDCB 1U4AA 3ML9A 3RCZA 3JVZX 2R2OA 3V61A 1C4PA 3ONSA 4XC2A 1EU4A 2MBOA 2B76B 4NAWA 3PRZA 3MC9A 1YQ4B 4YSYB 1VLBA 4HCNB 4G50A 2L83A 3T8MA 1K53A 1L2NA 3SHQA 2X8XX 1L0XB 5DPWA 4K81A 1GB4A 1HZ5A 2KHWB 2K9XA 4MGYE 1MI0A 1WGYA 3R7QA 4FBJB 3U4EG 2GOWA 3P2BA 4IW0A 1IYFA 2O6VB 2OJWA 1WMHA 4EUTA 1LO5D 2UU7A 3FILB 4OVUA 4KVGB 4LCDE 3VR9B 2AX5A 4FHKA 4GOCA 4QAYA 1ISNA 3TEYA 5I4DA 2ON8A 3VFKA 4F7ZA 2GBKA 1WXAA 2LHEA 3A9JB 4IG7B 1FCCC 1E7VA 2JXTA 1P7EA 4P6VF 1HTOA 5KHOA 1ZUD2 2D3CA 2MEKA 3IVFA 2D3GA 4C7ZA 4CO7A 1LM8B 1E0ZA 4NNJB 2KC2A 1EWCA 1TY0A 2IDYA 4ZHOA 3ZRCA 3TSSA 1TZ1A 2KO3A 1KOTA 4WAFA 4A8XC 1ZOYB 3Q8AA 3VRAB 2KDMA 1WWTA 4MM3A 3L4PA 4W9CA 1D5ZC 2RDBC 1F52A 1P3QU 3DWGC 2FCSA 3VR8B 2C5LC 1S3SG 4YXDB 3GE8C 4KDIC 4ITKA 4LJOB 4WQMA 4HPMB 2CU1A 3LXFA 4K7SA 3CSFA 3H7PA 3MC8A 3O65B 3NZ3A 1M4VA 3H8HA 3KLSX 1V1PB 3R66C 5L95C 2PJHA 1ZE3D 2JQRB 4EEWA 1SJED 4GXBA 3U30A 1SE4A 2ZPYA 3N9YC 5CHWA 3EFUA 1KFYB 2LVPA 1MJDA 1X1MA 5BMIA 1PUTA 2BKFA 4D2KA 3ZJVA 5EDSA 2D5GA 1GNUA 2Z59B 3V60A 2PTLA 4MM3B 1I4XA 4WIPA 4DQOC 4J3OD 3ZNHB 3MHSD 1JWSD 2J0KA 2L52A 5IP4D 3PZDA 1D3ZA 3FC4A 4J6IA 4DXGA 1EWYC 3DVNV 4KKIA 2ZPNA 2Z8LA 3V62A 2FUG1 1N60A 1KH0A 1V86A 4IWOA 2KDIA 3MJWA 2IY1B 4RFBA 4B0MA 3NS1A 3GE3C 3H7PB 2IGHA 2WX0A 1XLNA 1SF0A 2OEDA 1WRIA 2LMCA 3L10B 2WHIA 5H92C 2IZVB 5BMGA 4MH8A 5D6JB 3ZW3A 2NPTB 3Q14C 3EECA 3P4PB 1HZ6A 3BK2A 2PE6B 1QOAA 2RMMA 2WXJA 3NZUA 3VTVA 1WIAA 3UINB 3ECIA 3SDLC 2KQSA 1WMHB 2IY0B 3ETRA 3W5VB 1SE3A 5D3DA 1PYWD 3EC8A 4HKQA 3R2TA 2BWFA 4HCPB 1NBFC 1JWMD 3V05A 2ZJDA 3SEBA 2KDBA 2ZVNA 1UZXB 2VRRB 3PLVA 2EKEC 4HKZE 1WZ3A 2MQJA 3M95A 3PRPB 1Y56A 2HJ8A 1E5WA 1PGXA 1WX9A 2KDEB 3AEDB 5E6OA 3UI3A 4URKA 1T0YA 2LJ5A 5GXGB 1V8CA 3KUCB 3KYCD 2WQYB 2KLCA 3QHTA 1OFFA 3A9JA 2N4FA 1V1PA 3QX1A 4NAMA 4RF0A 2PVGC 1PGAA 1TS2A 3N32A 1D6EC 1R7SA 2N9XA 1TS3A 2HTHA 1E7UA 4GMVA 4F8CB 1XLOA 2G9HD 2NBWB 4EOYA 2NVUI 5E6JA 2AWTA 2AL6A 4HJGE 2RPVA 3VQIA 1I4HA 4IDIA 2LI5A 3DBSA 4MELA 3KWVA 3ZTDA 2H89B 4WQOB 2QIEB 4TKNA 2JZPA 3L17A 4MGIE 1V97A 3U8ZA 3WA0A 2HDEA 2INDC 1GC7A 1HA5A 4NJ7A 4A3OA 4ARCA 4X57B 1XD3B 2WXQA 3U7ZA 4YSZB 4HLEA 2RSUA 2KFKA 3Q3OC 2KTRA 2LZ6A 5LLIA 2KK8A 1XT9B 1HQRD 1KM7A 1UF0A 2X38A 1NI3A 1T0QC 4FLHA 3AU4A 4EZJA 3BVGA 2N7EA 4JL9A 4LNOA 1N62A 3VTUA 1I42A 3DHGC 5CHVC 3BYTB 2ACZB 1Q1OA 1C3TA 4DHJD 1MG8A 2AYOB 3PVLA 2JYTA 2DENB 1FEHA 2MLBA 2LXAA 4MSQB 3UQAA 1UBQA 1T3QA 2MP2B 3DBHI 1YX6B 3U52E 5C1ZA 4ZRKA 4US9A 4M00A 4W9JA 1Q0WB 2JX5A 3A4SC 2DWQA 3CWIA 3L13A 1TYGB 2N7JA 2WXMA 1R4MI 2LASA 1P0RA 2KJRA 1V2YA 4BKGA 3PHWB 4L2YA 4N6EB 3P4SB 4HXDA 1N6ZA 3AEAB 1RYJA 2IO0B 3PPAA 2NBUA 2DYMA 3PZ7A 2MJEA 2INNE 1HE8A 1YMHE 4JWUC 5HKHA 1Q10A 3ALBA 4W9DA 4TQ0A 4LJPB 3TEWA 2L32A 4L1BA 2ZNVC 2KTRB 4CYEA 4C56C 3HIZA 2JUOA 3IBEA 4W9HA 1V9JA 3UIOB 4JLCA 2MHJA 1L6UA 2WXPA 2KMMA 3VXWA 1KLGD 5BYSA 2QSDA 1P98A 3W1SC 4GDKB 3WIMA 1FXIA 5BYRA 4LNIA 3NVZA 2K3UA 1SB3C 2EKIA 2FUHB 1LFDA 2LUEA 4W9KA 4K3CA 3AB5A 4JIOU 4PS7A 3W1YA 2RDHA 2XN9C 3EA6A 3CMMB 2FBWB 2WLBA 3RNEC 4AWJA 2REXA 2QC8A 5D3IB 3RULA 2JZZA 2KD0A 4W9LA 1WGHA 3DBHB 3HVDA 4IKGA 4TUUA 4M02A 4C4VA 2PEAA 4DK5A 4RF1A 4PYUA 1F77A 5DPSA 1OEYA 2N9PC 2XNAC 2V0GA 1CZPA 2FCQA 3RNCC 5AEKB 2CU3A 2LGDA 2B3AA 2JF5A 1D5MC 5H8YE 1F0ZA 4RGNA 3RZFA 3H9DA 3NVWA 2QMTA 1UELA 1CK1A 1J0GA 1XO3A 1TKEA 4CHKA 5AZGA 1K52A 1ZP0B 1WGRA 2I1KA 1ZDXA 3BVMA 3B0AA 1NYRA 4KSLC 4IM2A 3TEZA 4DDGD 2BS3B 2AQ3B 2BYFA 3T3OA 4NJCA 2QHOA 4NJ6A 4AP4C 5IAAC 4HDOA 2BF8B 2DHZA 1RWSA 3NRZA 3MHZA 1EF5A 2KLGA 2K22A 3APDA 2KKCA 1NI2A 1WYGA 2BYTA 3VUWA 4ANVA 3O13A 3KYDD 4I6PA 3FILA 4I6NB 1DYQA 4K7UA 2DX5B 4W9FA 3T9LA 1VD2A 1UBIA 3JW0X 5T8IA 1KLVA 4LDTB 1LXDA 3APCA 3NHEB 5TSSA 1VZ7A 1I4RA 3B9JA 5G5HA 2AQ2B 3SFEB 2NTTA 2ZEQA 3DBLI 5LXHA 4ZOHC 2M1MA 5TR5A 2FIDA 2E3TA 4S0RA 3NUHB 4KGRA 4GDKA 2LVQA 3TJPA 4WJPA 3H7SA 3VDZA 4FJZA 2GRIA 1FMAD 2L0FA 4XYCA 2M0AA 1YN4A 1NEKB 1V81A 1EM7A 1SBBB 4JQWC 2J0JA 2L05A 2BTEA 4HEA1 1IBXA 1AYFA 1YJIA 2L00B 1L7YA 3Q3NC 2DYOA 4NZLB 3L0WB 4FJVB 1MPEA 1OQQA 3PLUA 3DBLB 2WU2B
chains in the Genus database with same CATH topology
3DHIC 3I63C 3N1XC 4P1BC 3Q2AC 3Q3MC 3GE3C 3N20C 1T0QC 2RDBC 3RNGC 3RNFC 3RMKC 3RNBC 2INCC 2INDC 3Q3NC 3DHHC 1T0RC 3I5JC 3GE8C 3Q14C 4P1CC 3N1ZC 3DHGC 3RN9C 3N1YC 3RNEC 3RNCC 3Q3OC 3RNAC 1T0SC 3RI7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHI C;  3I63 C;  3N1X C;  4P1B C;  3Q2A C;  3Q3M C;  3GE3 C;  3N20 C;  1T0Q C;  2RDB C;  3RNG C;  3RNF C;  3RMK C;  3RNB C;  2INC C;  2IND C;  3Q3N C;  3DHH C;  1T0R C;  3I5J C;  3GE8 C;  3Q14 C;  4P1C C;  3N1Z C;  3DHG C;  3RN9 C;  3N1Y C;  3RNE C;  3RNC C;  3Q3O C;  3RNA C;  1T0S C;  3RI7 C; 
#chains in the Genus database with same CATH topology
 3Q8C A;  2KT7 A;  3Q3M C;  1JWB D;  1KJT A;  3S2A A;  1NVI D;  2BT6 A;  4E74 A;  2BGF A;  3C19 A;  5G55 A;  4L23 A;  1G6J A;  1VZ8 A;  4MGK E;  2AEH A;  3EGR A;  1R4N B;  4LNF A;  2FE8 A;  3B2G A;  3FKY A;  1WXV A;  2JXX A;  1TTN A;  2BB6 A;  3K9P B;  1RRB A;  4FAD A;  2CHX A;  3ZNI D;  1FPY A;  2MP2 A;  3AXC A;  3V3X A;  3VRB B;  2N7D A;  1I4Q A;  4KIK A;  3TBL D;  1F2R C;  4B6W A;  1FD6 A;  2JVC A;  1CJE A;  2FNJ B;  4XDC A;  4FXC A;  3VVW B;  2LGI A;  4CQN A;  1T5X D;  2H88 B;  3B1L X;  3WAN A;  3EFC A;  3BII D;  3KH0 A;  3IHP C;  4FHJ A;  1UUP A;  3RPF C;  2KN5 A;  1XXG A;  1R4N I;  5L83 A;  5J18 A;  3IAS 1;  4M0W B;  1MHH E;  4BZA A;  4P1C C;  1TZO A;  4DHJ B;  4YSX B;  1GB1 A;  1FXT B;  2K6Q A;  4LNN A;  4BOS C;  4MDK E;  3VHT C;  2WDQ B;  1TIF A;  1SIJ A;  1WXM A;  1KF6 B;  1I7H A;  1YN3 A;  5EE9 A;  2G3Q B;  2K1F A;  2WYQ A;  4JPS A;  1TKG A;  1NEN B;  4YTN B;  3AM9 A;  3OJ4 B;  1QOF A;  3PS6 A;  1DGJ A;  2PIA A;  4JGH B;  4C00 A;  3AI5 A;  4ICU A;  2XK5 B;  4HRS A;  4P1B C;  3BK1 A;  1SIF A;  3DVG Y;  4W9E A;  4II2 B;  3ZQ4 A;  1E9M A;  1YQ3 B;  2LEK A;  3DBR B;  5JXV A;  3I3T B;  5DCN A;  2NMQ A;  5D2M B;  4ZRP A;  4YTM B;  3VAW A;  3UIP B;  1GUA B;  4G0N B;  4BKS D;  3GP7 A;  1J7A A;  4RNA A;  3P4R B;  2MH7 A;  1JWU D;  3NJT A;  2OOB B;  4PT5 A;  1SSN A;  2WGS A;  4GB9 A;  5C23 A;  2QJL A;  2CJO A;  1F1H A;  3DBR I;  2PW9 A;  2J42 A;  1A5R A;  3A33 B;  3AE1 B;  1UWM A;  5FKA C;  1L6V A;  4M8M A;  3RI7 C;  1YQB A;  2LGY A;  1GPX A;  1E7P B;  5BO4 B;  3PV1 A;  1AN8 A;  4ARI A;  2ZW1 A;  1GAQ B;  3AE6 B;  3LDZ E;  5IA7 A;  5HG2 A;  1DOI A;  3ZXR A;  1HXY D;  3GB1 A;  3Q8E A;  3WAM A;  2DAJ A;  2J52 A;  2KVR A;  2NPT A;  4PYZ A;  2DNF A;  1YJ1 A;  3LJ3 A;  1H8C A;  3BIN A;  1EU3 A;  5HHD G;  1YNT E;  3DHI C;  1V5T A;  5MPO A;  1YOV B;  4K7W A;  4KGT A;  1WX7 A;  4ANU A;  2EMT A;  4N9F 4;  1N63 A;  1VZ6 A;  2PKO A;  3ZNZ B;  4LLG M;  2ICI A;  1JWA D;  1WJ6 A;  1R4M B;  1TKY A;  4WJN A;  2O6V D;  3ZYY X;  3RNA C;  3L16 A;  4I6L B;  4Q2J A;  2MBH A;  3PZ8 A;  1WRD B;  4DHZ E;  3UF8 A;  2C60 A;  1V80 A;  1SEB D;  3B08 A;  2EEL A;  3MTN B;  2N0S B;  1YIW A;  2OHF A;  4FJY A;  3GZN I;  1UD7 A;  1DOX A;  3ZJU A;  2KFJ A;  3RD2 A;  1QOG A;  5GMV A;  1K50 A;  3NOB A;  2NBV B;  2AQ1 B;  4KX6 B;  3ZUN A;  1P9D U;  4IM3 A;  1LGR A;  1SXT A;  2V3P A;  1JRP A;  3BY4 B;  3DWM A;  3D32 A;  4ASW C;  1AAR A;  2WDT B;  3IXS A;  3BYY B;  3QQ8 B;  4KZ0 A;  3ZNG C;  1S1Q B;  2RGF A;  2KWD A;  1C77 A;  2CR5 A;  5CTR C;  3H1U A;  4WAA A;  2KNB A;  1YD8 U;  1YN5 A;  1WJN A;  2GB1 A;  1WM2 A;  3ENE A;  1WSP A;  2KAN A;  2BVC A;  2KN4 A;  3RNG C;  3RNF C;  1Z2M A;  2J4X A;  4RMA A;  2O2V B;  1QLB B;  2MSE D;  1MVK A;  4YWG G;  3NZS A;  1WGD A;  3ZKJ C;  1MHX A;  4XE0 A;  1N5W A;  3RYT A;  3TEX A;  2CJN A;  4GN1 A;  3N1X C;  2DAF A;  3AE4 B;  1EF1 A;  1FM0 D;  5EE3 A;  5JZE B;  3JYU A;  4NQL B;  4F1S A;  2M0X A;  2K25 A;  3U7D A;  2MCN B;  2SAK A;  1JRU A;  2WDR B;  2D2Q A;  3B2F A;  3P4Q B;  2MJ3 A;  2NS5 A;  3PGE A;  2FCM A;  3W9C B;  3QK0 A;  1JCK B;  1PDX A;  2KYW A;  1JAL A;  2DZI A;  1KTK A;  2C7H A;  2MJD A;  2D3A A;  2MBQ A;  1E8X A;  3DVG X;  4IC7 B;  2JU6 X;  1UWX A;  3OJ3 A;  1EUV B;  1Y8R C;  1TBE A;  4B0E A;  4HJK A;  1QQR A;  3HHM A;  2JT4 B;  1ZDV A;  2LD9 A;  2LUM A;  2BBC A;  1FNU A;  1IPG A;  1P7F A;  2M4N A;  1OTR B;  2DZM A;  1C4C A;  3FAH A;  3AE8 B;  2UWQ A;  2I38 A;  4XWW A;  4WWP A;  4ANW A;  4G3X B;  4MSM B;  3NS8 A;  2J0M A;  3QWZ B;  2O6V A;  3AE9 B;  1V49 A;  2V4I B;  3CST A;  4FN2 A;  2C9W B;  3V6E B;  2INC C;  3HK0 A;  1WH3 A;  1I4G A;  2CKH B;  3P42 A;  2EMS A;  3BWU D;  1CMX B;  5IKC M;  1WZ0 A;  4KIK B;  2KX3 A;  2ZNV B;  5KHQ A;  4DHZ B;  2E6X A;  2KTF A;  2GI9 A;  3NG0 A;  3GZN B;  3ZDM C;  3MJ5 A;  2L76 A;  3PT2 B;  4RM9 A;  1P1A A;  3VH4 B;  5AZF A;  4M01 A;  2XBB C;  4BBN C;  2N1W A;  2FCN A;  1V5O A;  2W54 A;  3T3N A;  2KWC A;  5HI1 A;  3KW5 B;  2HTM E;  3A9K B;  3ZJT A;  2RD0 A;  2R2Q A;  1B9R A;  2ZCC A;  2GBR A;  2WXH A;  2DZK A;  2IJ0 A;  3I63 C;  4NPN A;  1IGD A;  4HDQ A;  4ZRQ A;  2GMI C;  3GS2 A;  2CHZ A;  4HVB A;  3AMZ A;  1XLQ A;  4ZYN A;  3HM6 X;  1TS4 A;  2WP9 B;  2C7M B;  4NQK E;  2KFK B;  4ZRJ A;  4GDL A;  3A9K A;  3BZD B;  2WXR A;  1EO6 A;  4OW0 A;  3BVZ A;  3RN9 C;  5BMH A;  2K6D B;  2KDF B;  2VZK B;  1FCL A;  2IGD A;  2ZVO A;  4RGM A;  2YVC A;  2JYE A;  3NVY A;  4DXF A;  2YEP F;  4DBG A;  1ET6 A;  2MWS B;  2Z0D B;  5D94 A;  2KX0 A;  2L1A A;  3SR6 A;  2MX2 A;  4FA6 A;  4KSK C;  3ZLZ A;  3HVZ A;  3N1Y C;  1M94 A;  2BWE S;  1GG3 A;  3RZW C;  2DBY A;  2LRW A;  5JHB A;  3RUI B;  1JQ4 A;  1L0V B;  3DOW A;  2PMV A;  1OQR A;  1OEY J;  2JSV X;  4PK1 A;  4KGS A;  1XF5 L;  2KJH B;  2MRP A;  3IFW B;  3C8Y A;  4GU2 A;  2A4Z A;  1K8R B;  4IOI E;  1RAX A;  3AEE B;  3AEC B;  3R8B A;  1D4B A;  1UGM A;  3DPD A;  2N9K A;  1C79 A;  2GBM A;  3AEF B;  4GLS C;  3ZRF A;  2LWP A;  3J9C A;  3WAL A;  2MBB B;  1BT0 A;  4XX5 A;  4AS1 A;  4BFR A;  3GOE A;  1J19 A;  4IWQ A;  3QAR A;  2IO1 B;  2GBJ A;  3Q3F A;  4W9I A;  3R3M A;  1FO4 A;  4RCO A;  5FR6 A;  2RPQ A;  2BYE A;  4ICV A;  2V1Y A;  1WGG A;  4LNK A;  1L5P A;  4RGT A;  5CX3 A;  1ZKH A;  4A6Q A;  4M8N A;  2QIL A;  4MJS B;  2NCN A;  4ZYS A;  2PVO D;  2KOX A;  1YX5 B;  2DZJ A;  1E8Z A;  1WJU A;  1XQQ A;  3QA8 A;  2JZ3 B;  4RGO S;  2AL3 A;  1FRR A;  2WXF A;  4NY0 A;  1ZW7 A;  2IO2 B;  4ANX A;  4A90 A;  2C7N B;  3RNB C;  4FUL A;  2G4D B;  4RM8 A;  2MW5 A;  1WX8 A;  2DLB A;  4ZHP A;  3QAQ A;  3AUL A;  3C0R B;  1WYW B;  2O2V A;  1QIL A;  1T0S C;  2KWV B;  4WWN A;  3I57 A;  5E6N A;  4WWO A;  1ZXI A;  3VUY A;  1TY2 A;  1J7B A;  4OVZ A;  3I5J C;  3V6C B;  1PFD A;  2YLM A;  1WM3 A;  3APF A;  3QCA A;  2IBI B;  4OZC A;  1WXS A;  2OJR A;  4MGZ E;  3AE7 B;  3X0W A;  1D5X C;  1SE2 A;  2V9H A;  3DCG A;  4USA A;  2D10 A;  5AZH A;  1LQB A;  1E8W A;  2IPK D;  2K8C A;  4HK2 A;  3ZXV A;  1WJ4 A;  1NDD A;  3AE5 B;  5D7G A;  4K1R B;  2ZCB A;  2G1E A;  1VDV A;  5AUK A;  4EE2 A;  4N59 A;  4RH6 A;  4DWF A;  2HD5 B;  1SGH A;  2K0P A;  1ROE A;  3H6N A;  2WXK A;  2WDV B;  2XEW A;  2CHW A;  2LXC A;  3WCQ A;  4BAX A;  4P7I A;  1Z5S B;  4GIV A;  1ACC A;  2MA9 B;  3SU8 X;  2JY6 A;  4ACF A;  1RFA A;  3RFZ B;  2QCZ A;  3HUI A;  4W9G A;  2I1J A;  2BKR B;  3UGB B;  2WXG A;  2R61 A;  3TIX A;  1HTQ A;  3HM3 A;  2L8J A;  2K8H A;  3MFG A;  3VUX A;  3CF6 E;  5LXI B;  2Q5W D;  2WNM A;  3PRM B;  1OGW A;  1XCQ L;  4ZRI A;  2W3S A;  4MT5 A;  1JML A;  1C9F A;  2Y5C A;  4HPL B;  2I2Y A;  4M0W A;  5IOI A;  2K5P A;  3Q8F A;  2G4S A;  4OZA A;  4C80 A;  2IYD B;  2UYZ B;  1J7C A;  3IT6 B;  3ZIM A;  3TUO A;  1ET9 A;  4XGA B;  2KC1 A;  1STE A;  5DPT A;  1T6B X;  4AQ7 A;  4P16 A;  1FNV A;  2QEJ C;  3ZVV A;  5G5G A;  1JW9 D;  3AV8 A;  2K39 A;  4HWI B;  4OZB A;  5IO9 A;  1FXA A;  3P1M A;  4MH0 E;  5BYQ A;  1RLF A;  2JRH A;  2GBN A;  2KAC A;  2WX1 A;  3PTF C;  4NAW B;  2VH1 A;  4IUM B;  4B9K A;  1TGZ B;  3A1Q A;  2V3S A;  1E90 A;  2TSS A;  3M63 B;  3W2D A;  3KVF B;  3A1Q B;  4KZC A;  5C3J B;  4WJO A;  3E9S A;  4OVV A;  1AW7 A;  3Q3J A;  2W55 A;  1V1O A;  3Q8B A;  5C2T B;  1GOZ A;  4AJY B;  1RFK A;  2WU5 B;  3LYY A;  1N61 A;  1H4R A;  2K8B A;  3Q69 A;  2KZR A;  4BOZ B;  1TT5 B;  1FFU A;  3IT4 B;  1HEZ E;  1V6E A;  4UDU C;  3PRE A;  3AE2 B;  3N20 C;  3QC8 B;  2V4L A;  2MBE A;  4A3P A;  1WXQ A;  1VRA B;  5J2R A;  1XEE A;  1B1Z A;  3DHH C;  2VZK D;  4YL8 A;  2N9E B;  2W82 A;  2KVZ A;  1QOB A;  4HPP A;  5FK9 C;  4BVU C;  3VTW A;  3IAM 1;  1N5X A;  1TJE A;  3N3K B;  4ZDV A;  1PGB A;  2LGX A;  2INP E;  4S17 A;  1MG4 A;  3NVV A;  2WXN A;  1BUI C;  2PLP A;  3ZDT A;  3EHV A;  4IM0 A;  3M3J A;  3N30 A;  4WJQ A;  3HRD D;  2BYV E;  1JRO A;  3RT3 B;  1SE9 A;  3AEG B;  3QIJ A;  2JWZ A;  3KUD B;  1UH6 A;  3X23 A;  2IO3 B;  1IUE A;  4EFO A;  2N9L A;  4O1N A;  1F2R I;  1E10 A;  3AN1 A;  3I9V 1;  1E6E B;  1QZE A;  1C1Y B;  4YT0 B;  2W9N A;  2ZZP B;  3PO0 A;  1IP9 A;  1ESF A;  4K3B A;  4KV2 A;  1QF6 A;  2KMC A;  2ONQ A;  2LJI A;  1F9J A;  2FIF A;  1CQV A;  2JPH A;  4LTU A;  3L54 A;  1WE7 A;  3OAW A;  1BML C;  4PS3 A;  2L7R A;  1VCB A;  2VH2 A;  4REZ A;  4DXA B;  1WI0 A;  1QT9 A;  3AU5 A;  4TQ1 A;  1FRD A;  4LDT D;  2NTS A;  3ZGZ A;  2G45 B;  2BS2 B;  4BBN F;  3UQB A;  2LVO A;  3Q2A C;  3PHX B;  1IBX B;  4EKU A;  3KQ4 A;  4HRO A;  3RMK C;  2Y5B B;  3JSV B;  1K51 A;  4WUR A;  1SJH D;  3ZTC A;  4H2A A;  2ASQ A;  1L4Z B;  1ENF A;  1UNS A;  4A55 A;  2JWU A;  3OG5 A;  4XWT A;  4EZL A;  4E3C A;  3QJZ A;  4WWM A;  2HJ1 A;  2WXI A;  2QDF A;  3WAP A;  3M62 B;  1GJZ A;  2V3N A;  3IG3 A;  2CS4 A;  3OWE B;  3W5U B;  4LK0 M;  2BW2 A;  4R3D A;  2RR9 A;  3DQV A;  2M8S A;  2WXO A;  4AJW A;  1WY8 A;  1BXT A;  1C78 A;  1I4P A;  4MJS A;  3A4R A;  1ZXH A;  4JWS C;  2BS4 B;  2L0T A;  1IGC A;  2D07 B;  2M19 A;  1L4D B;  2KAJ A;  2A5U A;  4OHJ A;  4IWP A;  2BQQ A;  1UGJ A;  1WR6 E;  5EE0 A;  2HE7 A;  3EUB 2;  4JE3 B;  4WH4 A;  4E71 A;  3CIR B;  1FFV A;  2PE9 A;  2JRI B;  1WF9 A;  4BKS A;  3R7R A;  2J53 A;  2D11 A;  3E56 A;  1C76 A;  1NYQ A;  4C4V B;  1WE6 A;  4C7Y A;  3JSV A;  2KQ7 A;  1RM6 C;  2Y5P A;  1E8Y A;  3K9O B;  2KWU B;  2KJ6 A;  5G2N A;  2L3Z A;  3LB8 C;  5JHA A;  1TS5 A;  2WWZ A;  1AWD A;  4GSW A;  5HFY A;  3AE3 B;  4II3 B;  1VR9 A;  2KMA A;  2W3R A;  1WR1 A;  5E6P A;  3ML8 A;  3Q6B A;  4MEM A;  2M17 A;  4TMA B;  3P63 A;  1ZGU B;  4EZK A;  1MFW A;  4AOF A;  4B95 A;  4N58 A;  1XCT L;  5AUI A;  2RDG A;  2PPH A;  4YTP B;  5FR3 A;  2Z0E B;  3U2S C;  1J8C A;  4A9A A;  4BKT A;  4GGQ A;  2BPS A;  1KLU D;  4A20 A;  4DDI D;  3SD5 A;  2SEB D;  3URY A;  3DVN U;  1I35 A;  2LGS A;  2WXL A;  3W1S A;  3KWL A;  5IN7 A;  2ZW0 A;  4G11 A;  3SFD B;  3R2I A;  1T0R C;  2D3B A;  1VJK A;  3MC0 B;  1YJJ A;  1WFY A;  3VH3 B;  1PQS A;  3NY5 A;  3WAO A;  2KXJ A;  1QKZ A;  2DYB A;  1XLP A;  4GDL B;  4XZ4 A;  5J17 A;  5EE1 A;  2LFI A;  5LNK 1;  2BB5 A;  3KUZ A;  2Y3A A;  3ZO5 B;  1L0Y B;  2J7Q B;  3MP9 A;  1C4A A;  3OLM D;  1OQY A;  4XDD A;  4KDL B;  2LRU A;  4MAC A;  4US8 A;  5DPR A;  3N1Z C;  2LHD A;  1WGK A;  1GC6 A;  1FNW A;  4JX1 C;  4PS8 A;  2KQ4 X;  3AH7 A;  2M56 B;  4KKJ A;  1A70 A;  1FIQ A;  3AEB B;  2GLS A;  3ABV B;  4TV3 A;  3PSE B;  2IGG A;  2N1V A;  1DOY A;  2FAZ A;  1ZPS A;  4AUQ C;  1Q5W B;  2WS3 B;  3TL5 A;  2NR2 A;  3L08 A;  3TMP B;  2XK5 A;  5CHF A;  4TSS A;  3TCA A;  5JH5 C;  1KRH A;  2YEP B;  3DDC B;  1U4A A;  3ML9 A;  3RCZ A;  3JVZ X;  2R2O A;  3V61 A;  1C4P A;  3ONS A;  4XC2 A;  1EU4 A;  2MBO A;  2B76 B;  4NAW A;  3PRZ A;  3MC9 A;  1YQ4 B;  4YSY B;  1VLB A;  4HCN B;  4G50 A;  2L83 A;  3T8M A;  1K53 A;  1L2N A;  3SHQ A;  2X8X X;  1L0X B;  5DPW A;  4K81 A;  1GB4 A;  1HZ5 A;  2KHW B;  2K9X A;  4MGY E;  1MI0 A;  1WGY A;  3R7Q A;  4FBJ B;  3U4E G;  2GOW A;  3P2B A;  4IW0 A;  1IYF A;  2O6V B;  2OJW A;  1WMH A;  4EUT A;  1LO5 D;  2UU7 A;  3FIL B;  4OVU A;  4KVG B;  4LCD E;  3VR9 B;  2AX5 A;  4FHK A;  4GOC A;  4QAY A;  1ISN A;  3TEY A;  5I4D A;  2ON8 A;  3VFK A;  4F7Z A;  2GBK A;  1WXA A;  2LHE A;  3A9J B;  4IG7 B;  1FCC C;  1E7V A;  2JXT A;  1P7E A;  4P6V F;  1HTO A;  5KHO A;  1ZUD 2;  2D3C A;  2MEK A;  3IVF A;  2D3G A;  4C7Z A;  4CO7 A;  1LM8 B;  1E0Z A;  4NNJ B;  2KC2 A;  1EWC A;  1TY0 A;  2IDY A;  4ZHO A;  3ZRC A;  3TSS A;  1TZ1 A;  2KO3 A;  1KOT A;  4WAF A;  4A8X C;  1ZOY B;  3Q8A A;  3VRA B;  2KDM A;  1WWT A;  4MM3 A;  3L4P A;  4W9C A;  1D5Z C;  2RDB C;  1F52 A;  1P3Q U;  3DWG C;  2FCS A;  3VR8 B;  2C5L C;  1S3S G;  4YXD B;  3GE8 C;  4KDI C;  4ITK A;  4LJO B;  4WQM A;  4HPM B;  2CU1 A;  3LXF A;  4K7S A;  3CSF A;  3H7P A;  3MC8 A;  3O65 B;  3NZ3 A;  1M4V A;  3H8H A;  3KLS X;  1V1P B;  3R66 C;  5L95 C;  2PJH A;  1ZE3 D;  2JQR B;  4EEW A;  1SJE D;  4GXB A;  3U30 A;  1SE4 A;  2ZPY A;  3N9Y C;  5CHW A;  3EFU A;  1KFY B;  2LVP A;  1MJD A;  1X1M A;  5BMI A;  1PUT A;  2BKF A;  4D2K A;  3ZJV A;  5EDS A;  2D5G A;  1GNU A;  2Z59 B;  3V60 A;  2PTL A;  4MM3 B;  1I4X A;  4WIP A;  4DQO C;  4J3O D;  3ZNH B;  3MHS D;  1JWS D;  2J0K A;  2L52 A;  5IP4 D;  3PZD A;  1D3Z A;  3FC4 A;  4J6I A;  4DXG A;  1EWY C;  3DVN V;  4KKI A;  2ZPN A;  2Z8L A;  3V62 A;  2FUG 1;  1N60 A;  1KH0 A;  1V86 A;  4IWO A;  2KDI A;  3MJW A;  2IY1 B;  4RFB A;  4B0M A;  3NS1 A;  3GE3 C;  3H7P B;  2IGH A;  2WX0 A;  1XLN A;  1SF0 A;  2OED A;  1WRI A;  2LMC A;  3L10 B;  2WHI A;  5H92 C;  2IZV B;  5BMG A;  4MH8 A;  5D6J B;  3ZW3 A;  2NPT B;  3Q14 C;  3EEC A;  3P4P B;  1HZ6 A;  3BK2 A;  2PE6 B;  1QOA A;  2RMM A;  2WXJ A;  3NZU A;  3VTV A;  1WIA A;  3UIN B;  3ECI A;  3SDL C;  2KQS A;  1WMH B;  2IY0 B;  3ETR A;  3W5V B;  1SE3 A;  5D3D A;  1PYW D;  3EC8 A;  4HKQ A;  3R2T A;  2BWF A;  4HCP B;  1NBF C;  1JWM D;  3V05 A;  2ZJD A;  3SEB A;  2KDB A;  2ZVN A;  1UZX B;  2VRR B;  3PLV A;  2EKE C;  4HKZ E;  1WZ3 A;  2MQJ A;  3M95 A;  3PRP B;  1Y56 A;  2HJ8 A;  1E5W A;  1PGX A;  1WX9 A;  2KDE B;  3AED B;  5E6O A;  3UI3 A;  4URK A;  1T0Y A;  2LJ5 A;  5GXG B;  1V8C A;  3KUC B;  3KYC D;  2WQY B;  2KLC A;  3QHT A;  1OFF A;  3A9J A;  2N4F A;  1V1P A;  3QX1 A;  4NAM A;  4RF0 A;  2PVG C;  1PGA A;  1TS2 A;  3N32 A;  1D6E C;  1R7S A;  2N9X A;  1TS3 A;  2HTH A;  1E7U A;  4GMV A;  4F8C B;  1XLO A;  2G9H D;  2NBW B;  4EOY A;  2NVU I;  5E6J A;  2AWT A;  2AL6 A;  4HJG E;  2RPV A;  3VQI A;  1I4H A;  4IDI A;  2LI5 A;  3DBS A;  4MEL A;  3KWV A;  3ZTD A;  2H89 B;  4WQO B;  2QIE B;  4TKN A;  2JZP A;  3L17 A;  4MGI E;  1V97 A;  3U8Z A;  3WA0 A;  2HDE A;  2IND C;  1GC7 A;  1HA5 A;  4NJ7 A;  4A3O A;  4ARC A;  4X57 B;  1XD3 B;  2WXQ A;  3U7Z A;  4YSZ B;  4HLE A;  2RSU A;  2KFK A;  3Q3O C;  2KTR A;  2LZ6 A;  5LLI A;  2KK8 A;  1XT9 B;  1HQR D;  1KM7 A;  1UF0 A;  2X38 A;  1NI3 A;  1T0Q C;  4FLH A;  3AU4 A;  4EZJ A;  3BVG A;  2N7E A;  4JL9 A;  4LNO A;  1N62 A;  3VTU A;  1I42 A;  3DHG C;  5CHV C;  3BYT B;  2ACZ B;  1Q1O A;  1C3T A;  4DHJ D;  1MG8 A;  2AYO B;  3PVL A;  2JYT A;  2DEN B;  1FEH A;  2MLB A;  2LXA A;  4MSQ B;  3UQA A;  1UBQ A;  1T3Q A;  2MP2 B;  3DBH I;  1YX6 B;  3U52 E;  5C1Z A;  4ZRK A;  4US9 A;  4M00 A;  4W9J A;  1Q0W B;  2JX5 A;  3A4S C;  2DWQ A;  3CWI A;  3L13 A;  1TYG B;  2N7J A;  2WXM A;  1R4M I;  2LAS A;  1P0R A;  2KJR A;  1V2Y A;  4BKG A;  3PHW B;  4L2Y A;  4N6E B;  3P4S B;  4HXD A;  1N6Z A;  3AEA B;  1RYJ A;  2IO0 B;  3PPA A;  2NBU A;  2DYM A;  3PZ7 A;  2MJE A;  2INN E;  1HE8 A;  1YMH E;  4JWU C;  5HKH A;  1Q10 A;  3ALB A;  4W9D A;  4TQ0 A;  4LJP B;  3TEW A;  2L32 A;  4L1B A;  2ZNV C;  2KTR B;  4CYE A;  4C56 C;  3HIZ A;  2JUO A;  3IBE A;  4W9H A;  1V9J A;  3UIO B;  4JLC A;  2MHJ A;  1L6U A;  2WXP A;  2KMM A;  3VXW A;  1KLG D;  5BYS A;  2QSD A;  1P98 A;  3W1S C;  4GDK B;  3WIM A;  1FXI A;  5BYR A;  4LNI A;  3NVZ A;  2K3U A;  1SB3 C;  2EKI A;  2FUH B;  1LFD A;  2LUE A;  4W9K A;  4K3C A;  3AB5 A;  4JIO U;  4PS7 A;  3W1Y A;  2RDH A;  2XN9 C;  3EA6 A;  3CMM B;  2FBW B;  2WLB A;  3RNE C;  4AWJ A;  2REX A;  2QC8 A;  5D3I B;  3RUL A;  2JZZ A;  2KD0 A;  4W9L A;  1WGH A;  3DBH B;  3HVD A;  4IKG A;  4TUU A;  4M02 A;  4C4V A;  2PEA A;  4DK5 A;  4RF1 A;  4PYU A;  1F77 A;  5DPS A;  1OEY A;  2N9P C;  2XNA C;  2V0G A;  1CZP A;  2FCQ A;  3RNC C;  5AEK B;  2CU3 A;  2LGD A;  2B3A A;  2JF5 A;  1D5M C;  5H8Y E;  1F0Z A;  4RGN A;  3RZF A;  3H9D A;  3NVW A;  2QMT A;  1UEL A;  1CK1 A;  1J0G A;  1XO3 A;  1TKE A;  4CHK A;  5AZG A;  1K52 A;  1ZP0 B;  1WGR A;  2I1K A;  1ZDX A;  3BVM A;  3B0A A;  1NYR A;  4KSL C;  4IM2 A;  3TEZ A;  4DDG D;  2BS3 B;  2AQ3 B;  2BYF A;  3T3O A;  4NJC A;  2QHO A;  4NJ6 A;  4AP4 C;  5IAA C;  4HDO A;  2BF8 B;  2DHZ A;  1RWS A;  3NRZ A;  3MHZ A;  1EF5 A;  2KLG A;  2K22 A;  3APD A;  2KKC A;  1NI2 A;  1WYG A;  2BYT A;  3VUW A;  4ANV A;  3O13 A;  3KYD D;  4I6P A;  3FIL A;  4I6N B;  1DYQ A;  4K7U A;  2DX5 B;  4W9F A;  3T9L A;  1VD2 A;  1UBI A;  3JW0 X;  5T8I A;  1KLV A;  4LDT B;  1LXD A;  3APC A;  3NHE B;  5TSS A;  1VZ7 A;  1I4R A;  3B9J A;  5G5H A;  2AQ2 B;  3SFE B;  2NTT A;  2ZEQ A;  3DBL I;  5LXH A;  4ZOH C;  2M1M A;  5TR5 A;  2FID A;  2E3T A;  4S0R A;  3NUH B;  4KGR A;  4GDK A;  2LVQ A;  3TJP A;  4WJP A;  3H7S A;  3VDZ A;  4FJZ A;  2GRI A;  1FMA D;  2L0F A;  4XYC A;  2M0A A;  1YN4 A;  1NEK B;  1V81 A;  1EM7 A;  1SBB B;  4JQW C;  2J0J A;  2L05 A;  2BTE A;  4HEA 1;  1IBX A;  1AYF A;  1YJI A;  2L00 B;  1L7Y A;  3Q3N C;  2DYO A;  4NZL B;  3L0W B;  4FJV B;  1MPE A;  1OQQ A;  3PLU A;  3DBL B;  2WU2 B; 
#chains in the Genus database with same CATH homology
 3DHI C;  3I63 C;  3N1X C;  4P1B C;  3Q2A C;  3Q3M C;  3GE3 C;  3N20 C;  1T0Q C;  2RDB C;  3RNG C;  3RNF C;  3RMK C;  3RNB C;  2INC C;  2IND C;  3Q3N C;  3DHH C;  1T0R C;  3I5J C;  3GE8 C;  3Q14 C;  4P1C C;  3N1Z C;  3DHG C;  3RN9 C;  3N1Y C;  3RNE C;  3RNC C;  3Q3O C;  3RNA C;  1T0S C;  3RI7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...