3I63C

Peroxide bound toluene 4-monooxygenase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 23
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i63C00
3DHHC 3DHIC 3Q2AC 3Q14C 1T0QC 2INCC 3RMKC 3I5JC 3GE3C 3I63C 2INDC 3N20C 3RNCC 4P1CC 3RNGC 3RI7C 2RDBC 1T0SC 3GE8C 3RNEC 3DHGC 3RNAC 3N1XC 3N1YC 3Q3NC 3RNBC 4P1BC 1T0RC 3RNFC 3Q3OC 3N1ZC 3Q3MC 3RN9C
chains in the Genus database with same CATH superfamily
5J17A 5TSSA 4ICVA 1N61A 1WM2A 1T6BX 1T0SC 2KANA 3DVGX 4HROA 2B76B 2QILA 4E71A 3K9PB 3CIRB 2D3GA 2N7EA 3PO0A 1OTRB 1N63A 4LK0M 3BVMA 2JWUA 1HTQA 2NPTA 1F2RC 1QKZA 2W55A 3ZRFA 4HPMB 2M1MA 1HZ6A 5DPWA 3PHWB 2MX2A 2L0TA 2MW5A 2M8SA 3OJ4B 5JHAA 3DBHI 2CHXA 2KAJA 3AM9A 2NBUA 2JPHA 3NVZA 4JWUC 2IO1B 2K1FA 3HRDD 1Z2MA 3L13A 4RF0A 3MC8A 4JE3B 1Q0WB 3NVWA 3MJWA 4B95A 4DBGA 2ZEQA 2JWZA 4YL8A 4RF1A 4HDOA 1E7UA 4KX6B 3ZGZA 2KTFA 3H7PA 1K8RB 3H1UA 4C4VB 1GJZA 1AARA 2PW9A 2Y3AA 3WANA 1E10A 3IHPC 1FRDA 3VTUA 4AOFA 1DGJA 1WXVA 2KK8A 1KJTA 2GI9A 2CU3A 4NJ6A 2PIAA 4KV2A 2MJDA 2KQ4X 1NENB 4LNNA 1WX9A 2JU6X 2TSSA 1WWTA 3Q8AA 4W9CA 1TGZB 3TIXA 2BQQA 3I5JC 5FR3A 5J18A 2KQSA 2BWFA 1MJDA 4USAA 3CSTA 3A9JA 3NJTA 4YT0B 1D3ZA 3AI5A 1JCKB 1ROEA 2L05A 1LXDA 3OAWA 2IYDB 4HKZE 1VD2A 5FK9C 4MH0E 4GN1A 4ZDVA 4LNOA 3X23A 3L54A 2WDQB 4ACFA 4OZAA 3UF8A 1L0YB 1UH6A 1QF6A 3ZJTA 4K3CA 1C77A 5BYRA 1V81A 1RLFA 3P4RB 4H2AA 1SF0A 3KVFB 1WSPA 2NMQA 1Q5WB 5HKHA 4F8CB 2N9XA 2WYQA 3T3OA 5AZGA 1TS3A 3DHHC 1PGXA 3UINB 4BAXA 1J7AA 2LD9A 4ANWA 1L0XB 4IKGA 2NBWB 2IY0B 3RI7C 2L32A 3NVVA 3RD2A 2W82A 2V3PA 2O6VA 1SIJA 2NS5A 2WXHA 5IP4D 3KUDB 2KN5A 3VVWB 2V1YA 4KGTA 3V62A 3AE6B 4A8XC 4KIKA 2KX3A 2KWUB 4OVVA 2ON8A 1XLPA 1AW7A 2K6QA 3A1QB 4I6NB 1H4RA 1HXYD 5L83A 3VDZA 2IO2B 3SU8X 3O13A 2I38A 1WR6E 3W5VB 1C79A 3I3TB 1L5PA 1JWSD 2SEBD 4DHZB 2YEPF 3ECIA 2KZRA 3DVGY 5KHOA 4BKTA 2WNMA 1TT5B 3AE2B 1K53A 2XNAC 3PTFC 1JALA 2L3ZA 3SHQA 3GZNB 3B08A 3DVNV 1FXAA 1V49A 1WM3A 4BOZB 1GB1A 1E8ZA 1GAQB 1KLUD 2PEAA 3VQIA 2FNJB 3ZYYX 1HQRD 1ET6A 4AWJA 1FNWA 2FCQA 1N6ZA 5EE9A 3A33B 4G11A 3W1SA 4YSXB 1TKGA 1KH0A 1UBQA 2ZVOA 1HZ5A 2IBIB 4IM2A 2FUG1 1Z5SB 1K51A 1HEZE 1VZ6A 2AYOB 2EKIA 3TEYA 4BKGA 3ALBA 4M8NA 3P4PB 3JW0X 2D5GA 2KOXA 5BMHA 1ESFA 2DNFA 4EOYA 1HE8A 3RYTA 3LJ3A 4OW0A 3DPDA 1SEBD 1B1ZA 2KMCA 2OJWA 2XBBC 3EC8A 2NVUI 2C7MB 4L2YA 2INCC 3NZ3A 1FIQA 5C23A 2Y5BB 4Q2JA 2WDTB 1V5OA 2L7RA 2JF5A 3VRAB 4BBNF 2BTEA 4OVZA 2EELA 3IFWB 4XDDA 2IO0B 3H7PB 2W3SA 1N5XA 4OZBA 4ITKA 2WU5B 3AE1B 4OHJA 3ZDTA 1M94A 1QOBA 3SFEB 1I4RA 4NAWB 2RD0A 1IP9A 2JRIB 1D4BA 2J0KA 1TY0A 2MBOA 3KWLA 3OG5A 5BYQA 3R2IA 4GU2A 4K1RB 2BW2A 3WIMA 2REXA 2KD0A 1HA5A 3PHXB 4EE2A 4HVBA 4IWQA 2KN4A 1ISNA 3W5UB 2K22A 2PKOA 3Q8BA 1GC6A 2DZJA 3ML8A 2PJHA 5GXGB 5JXVA 1PQSA 5AZFA 1KLGD 2E3TA 5HI1A 2WQYB 2K0PA 2O6VD 3OWEB 3QWZB 1IBXA 2CJNA 3VAWA 1SGHA 4US9A 1DOYA 3JSVA 2LGXA 3AEGB 1A70A 2J0JA 1N5WA 3PLVA 4HJKA 4PK1A 4WIPA 3EGRA 3V6EB 4S0RA 2MRPA 1BUIC 2NCNA 1V6EA 3UQAA 3PZDA 4B9KA 4FN2A 3VR8B 2GMIC 2KQ7A 4RM8A 1GG3A 1KM7A 3FC4A 4HPLB 3R66C 3H6NA 2O6VB 3M3JA 1FRRA 1XLQA 1TJEA 3JYUA 3X0WA 2G4DB 1Y8RC 4W9GA 2DAFA 3Q8CA 3SR6A 4E3CA 2VZKD 3BINA 1FCCC 1DYQA 1EWCA 3QK0A 1I7HA 2MBBB 4K7SA 4ZHOA 3GS2A 1E90A 3HK0A 3HVZA 3NY5A 4DDID 4UDUC 5C3JB 3LDZE 4RH6A 1C4PA 1P9DU 3AE5B 1SB3C 1UD7A 3TUOA 1F0ZA 1V1PB 3H9DA 1E7PB 4XE0A 4TKNA 3Q3MC 1TY2A 1C78A 4HLEA 2EMSA 1JQ4A 2LHEA 1NEKB 1K50A 1WXSA 2KTRA 1J7BA 2RDHA 3ZJUA 4GSWA 3P63A 2VZKB 3SFDB 4RGMA 4GB9A 4P7IA 5T8IA 2FE8A 4M0WA 2WXFA 3BVGA 2JVCA 3EFCA 2INPE 1TS4A 3VFKA 4URKA 4W9HA 3AE4B 1D5XC 3LXFA 1C9FA 4MSMB 3R8BA 2HE7A 2ZJDA 1NVID 2GBKA 3W1SC 3PPAA 1OEYA 2MJEA 5C1ZA 3A9KA 4LTUA 5DCNA 1FMAD 3APCA 1LQBA 4IG7B 5G5GA 1RWSA 2L52A 3B2FA 2N9PC 4DXFA 3KQ4A 1T0QC 1YQ4B 2CS4A 2IGDA 3O65B 3UIPB 3NS1A 1WE6A 2MJ3A 2C60A 2PPHA 3TCAA 1G6JA 1MHXA 4IW0A 4C00A 3TL5A 3N1XC 4GDLB 1ACCA 4LNFA 3ZLZA 2LVPA 4FA6A 4US8A 3Q3OC 4EZLA 3BK1A 4P16A 1QZEA 1YQ3B 2DBYA 4A20A 4B0MA 3EECA 4IDIA 4MSQB 2EMTA 2GRIA 3PRMB 3GE8C 1ZP0B 2LJIA 1FXIA 4JWSC 2KJ6A 1B9RA 1CZPA 4B6WA 4NPNA 1IGCA 4IUMB 1SE3A 2WX0A 2KWVB 1YN5A 3MFGA 1WIAA 1M4VA 3BYTB 5IAAC 2EKEC 4N9F4 1PFDA 1P7EA 1RM6C 2M0XA 5D7GA 1E8WA 3VUXA 2QHOA 3OLMD 4ZYSA 1L0VB 3W1YA 2MWSB 2DLBA 3U8ZA 2V4IB 2BT6A 1J19A 4J3OD 4LNKA 2AX5A 3RN9C 2DWQA 3IAM1 3HHMA 1FPYA 4GDKA 2KVZA 3AECB 3AH7A 1XCTL 1WXAA 2KXJA 2QSDA 2RDGA 1YIWA 4JPSA 4XX5A 1P7FA 4KGRA 1TYGB 3BYYB 2AEHA 2BB6A 1QILA 1E9MA 3H8HA 2CR5A 3FKYA 2WLBA 1WGYA 2KJHB 1STEA 5EE0A 1EU4A 2NTSA 3MC0B 1TZOA 3L08A 1XT9B 4TQ0A 1X1MA 2KFKB 1P98A 1JMLA 2KDIA 1R4MB 4TQ1A 3R7QA 1WXMA 3E9SA 1AN8A 4TUUA 4ZRJA 3AEAB 1MVKA 4W9FA 5G5HA 1T3QA 1KTKA 4HWIB 3CSFA 1ZW7A 2BS4B 5D94A 1IGDA 5HHDG 4FULA 2INDC 2JX5A 2KDFB 1SIFA 1EWYC 2BKFA 2MBHA 3WCQA 2LMCA 3TJPA 1C1YB 4NAMA 2BGFA 2DZMA 3DBRB 3GZNI 1GNUA 4RMAA 4W9JA 1OEYJ 1ZDVA 1ZDXA 2OEDA 2DYOA 2MP2A 2LGDA 2ZW0A 3EUB2 2DYMA 2MEKA 2ONQA 3A4RA 1QOAA 3IBEA 2O2VA 1DOXA 2J4XA 3V05A 3QC8B 2Z8LA 1V1OA 4RGTA 2ASQA 1QT9A 5IKCM 1WYWB 4MELA 5LXIB 1YMHE 3B1LX 4KDIC 4RGOS 1RAXA 1WGGA 1ZUD2 1PDXA 5H92C 3VTWA 1ZKHA 3R3MA 3RT3B 4ANUA 4C80A 5DPRA 1WRDB 1PGAA 4FJYA 1NDDA 5HG2A 1YX6B 3S2AA 2BWES 4J6IA 2KNBA 2PTLA 2KLGA 3A9KB 2FCSA 1C3TA 1ZXHA 1FD6A 2ZNVC 2JYEA 3WAMA 4QAYA 2ZNVB 2I1KA 1XCQL 2QC8A 4M01A 2FCNA 2LXAA 2QCZA 1H8CA 3J9CA 4XZ4A 2BYTA 1JWUD 2MCNB 2Y5CA 3PREA 3N9YC 3AE8B 3HM3A 3IVFA 4C7ZA 2MBEA 4XYCA 2K3UA 2K9XA 3WAOA 4TMAB 1LO5D 4ZHPA 1MG4A 2XK5B 2JZPA 3KLSX 3C19A 2JZZA 3ONSA 4NZLB 4XGAB 3MHSD 2J52A 1BT0A 1ZGUB 1V97A 1RFAA 3VUYA 2GBNA 1E5WA 2WHIA 3U7DA 2N7JA 1F1HA 2WXJA 2L8JA 1UGMA 3QIJA 4MM3B 3W9CB 1L4DB 2WWZA 4BKSA 2YLMA 1SE2A 3N30A 5AZHA 1TIFA 2AQ3B 4HCPB 1WZ0A 5C2TB 4II2B 4WJNA 3Q3JA 2N9KA 1YJ1A 4JQWC 2W54A 4HXDA 1YJIA 3DHGC 4IWOA 4XC2A 2L83A 3N1YC 2DAJA 1WXQA 5CHVC 1SXTA 3BVZA 5JHBA 1SE4A 3AE9B 4OVUA 2D10A 5D3DA 4C7YA 1XXGA 3KYCD 4WURA 2K5PA 2NPTB 4KDLB 2IY1B 3QQ8B 5IA7A 3KUCB 5D2MB 2KDBA 2BVCA 2D3BA 3NS8A 1D6EC 2G9HD 4WH4A 4ICUA 2G45B 1YN4A 2K39A 1C4AA 2LHDA 4O1NA 2N0SB 4WWOA 2KDEB 3CWIA 1FNUA 3VTVA 2X8XX 1HTOA 2FAZA 3ZUNA 4YTNB 3ENEA 4AUQC 4BOSC 3QCAA 4PS3A 2UWQA 4JGHB 1FEHA 4A9AA 3ZIMA 2HTHA 2RR9A 3DWMA 4WJOA 4BVUC 3ML9A 2BYEA 3P1MA 3MJ5A 5BMIA 2JSVX 1WX8A 2ZCCA 1EUVB 3CMMB 5I4DA 1ZOYB 2WS3B 5DPTA 2BYVE 1Q1OA 1P0RA 2KHWB 1U4AA 3HVDA 4A90A 1NYRA 1KOTA 1WGRA 1BMLC 4PS8A 2K8CA 3KYDD 3QA8A 3IT4B 1YJJA 1SE9A 2D3AA 1J0GA 1YX5B 2KC2A 2V4LA 4IOIE 5IOIA 1UBIA 1TZ1A 1E0ZA 1QLBB 3A9JB 1UELA 2K6DB 3QARA 2J7QB 3AXCA 4DXGA 1S1QB 3EFUA 4RCOA 4C56C 4KSKC 2KACA 4NY0A 3MTNB 2KKCA 1WMHA 2ACZB 2LFIA 3IXSA 2O2VB 2KVRA 1WRIA 4E74A 2WDVB 2L76A 2G4SA 2D3CA 5HFYA 4HJGE 4KZCA 3AN1A 5TR5A 3AV8A 4W9EA 1XLNA 3BWUD 1J7CA 2KDMA 5D3IB 2KYWA 1KRHA 4FJVB 1GUAB 2WXLA 1N62A 2IGHA 4KGSA 1D5MC 2A5UA 2LZ6A 3OJ3A 2I1JA 2BBCA 4MGIE 1TS2A 2L1AA 1I42A 4K7WA 3T9LA 3L10B 2RGFA 1WI0A 2LWPA 5LLIA 2A4ZA 2JZ3B 5CHWA 1WGHA 1VLBA 2FIDA 3UIOB 1C4CA 2IDYA 2WXMA 4G0NB 1WJ4A 3P4SB 4KIKB 3TSSA 3PGEA 1SBBB 2LUMA 4C4VA 2YVCA 2AQ1B 5EDSA 3NVYA 1V80A 2D11A 2H89B 2J53A 3FAHA 2LRWA 2QMTA 1CMXB 1GOZA 1N60A 3NG0A 2J42A 3V60A 3PZ7A 3B0AA 3DBLB 4X57B 1EF5A 2GBMA 1L4ZB 3QAQA 1EM7A 2PVOD 1WFYA 4GGQA 1VCBA 3BK2A 2JXTA 1KF6B 2LI5A 2R61A 2V3NA 3VH3B 1NBFC 4A3PA 4G50A 4WWMA 1YNTE 1V86A 2DENB 3PVLA 4YXDB 1F2RI 4EEWA 5EE1A 4A55A 2BS2B 4CO7A 4PYUA 3ZW3A 1QOGA 1T0YA 3RZFA 1TS5A 1WY8A 2FIFA 3ZTCA 4KZ0A 3GB1A 1IYFA 2AL3A 1WGDA 3KW5B 2MLBA 4AJYB 2WXPA 4FBJB 2V0GA 2CHZA 2M56B 2AWTA 2NR2A 2Z59B 2OOBB 1R4MI 1SSNA 3URYA 4TSSA 2FBWB 2LVQA 3C8YA 4AP4C 3ZO5B 1YOVB 5GMVA 3GP7A 4K81A 2JY6A 4MJSA 2B3AA 2RDBC 2WXOA 3DCGA 1MI0A 2K8BA 1JRPA 2ZPNA 3AEDB 1TTNA 1I4HA 5D6JB 3TBLD 1EF1A 1EO6A 2N1VA 2KWCA 3GE3C 4RM9A 1I4XA 3P2BA 1Y56A 3AU5A 1WX7A 3DBRI 3Q8FA 4TV3A 3DOWA 3VR9B 3HIZA 4OZCA 4XDCA 3Q8EA 2W9NA 4PT5A 2OJRA 3KWVA 2CKHB 3RPFC 2FUHB 4W9IA 2WXNA 5FKAC 1I4GA 4KKJA 2WDRB 2WGSA 3APDA 1FO4A 4WQOB 4N6EB 4YSYB 1UWMA 3DVNU 4N59A 2R2QA 1S3SG 3ZNID 1XD3B 3NUHB 3FILA 2LRUA 2GLSA 1MG8A 2WXKA 4F7ZA 2UU7A 1TKEA 3HM6X 3UGBB 1OQRA 4IM0A 1WGKA 2GBJA 3N32A 4WWNA 3AU4A 1WE7A 3APFA 4M02A 5BO4B 3A4SC 3RNEC 4FJZA 3HUIA 1WMHB 2KX0A 2LXCA 4DDGD 1IBXB 1LM8B 3RNGC 1L2NA 4K3BA 1LFDA 3B9JA 3JSVB 1XQQA 4W9LA 4EUTA 4N58A 3IAS1 1JW9D 1WJNA 1R4NB 3I9V1 3SD5A 1V2YA 1MHHE 5IN7A 5LXHA 1UUPA 3W2DA 4HEA1 3ZNZB 3NHEB 1VRAB 2V9HA 2XN9C 3M62B 4ZRPA 3U30A 3BZDB 5G55A 2HJ1A 2J0MA 4S17A 2N9LA 2BS3B 4NNJB 3L17A 1SJHD 1V8CA 4LNIA 2CJOA 3M95A 4JLCA 1L6VA 3TMPB 4EZJA 2GOWA 3Q14C 1NI3A 4EZKA 4M8MA 2PVGC 4NAWA 2K8HA 2G1EA 1WR1A 1UWXA 2WU2B 4M00A 3T3NA 1PGBA 2BYFA 2C5LC 3U2SC 1V5TA 4ZYNA 4DQOC 2G3QB 3AE3B 4GIVA 3U4EG 2IPKD 2HDEA 3P42A 1NI2A 4L23A 2D07B 4I6LB 2KTRB 1ZPSA 5H8YE 2LEKA 2VH2A 2PMVA 1QOFA 2RPVA 4ARIA 4ZRQA 1WH3A 3R2TA 4II3B 4M0WB 4PS7A 3AE7B 3PRZA 3VUWA 4KKIA 3N1ZC 4MH8A 2N7DA 1ET9A 4MEMA 3MHZA 2KMMA 4IWPA 3NOBA 2DYBA 3RNCC 2KFJA 2ZVNA 2QIEB 2IGGA 4DHJD 2N9EB 2W3RA 3VH4B 1LGRA 1F52A 4BFRA 2Z0DB 3RNFC 3ZTDA 3AEEB 2GB1A 4L1BA 4EFOA 4KSLC 1MPEA 1PUTA 1F9JA 1VZ8A 5BMGA 4MJSB 1P1AA 2AQ2B 3DBHB 4XWWA 1I4PA 2KC1A 2M19A 2Z0EB 2LGIA 5CTRC 4ARCA 3H7SA 3V61A 5AUKA 3DBSA 2VH1A 4DHJB 2NBVB 2IO3B 2KT7A 2MQJA 1VZ7A 3T8MA 3U7ZA 4HK2A 2M0AA 1PYWD 2M4NA 3GOEA 4ANVA 4CHKA 1F77A 4AS1A 3B2GA 1UNSA 1V1PA 3ZXVA 2LGYA 4EKUA 3VRBB 3AULA 1I4QA 1WJUA 2RPQA 2LASA 3BIID 3I63C 2ZZPB 3ZVVA 2VRRB 2MHJA 4FXCA 5AUIA 2LJ5A 2BB5A 1K52A 3E56A 2C7HA 4A6QA 1UGJA 3FILB 1NYQA 2HJ8A 4D2KA 2DZIA 1OQQA 4GDKB 3WALA 2GBRA 4AJWA 1MFWA 3R7RA 4FLHA 3LYYA 1VJKA 2INNE 3C0RB 4P1CC 3PZ8A 2KMAA 1WZ3A 3ETRA 4LJPB 4MT5A 3PLUA 3ZNHB 3PSEB 4DK5A 3DQVA 3PS6A 3IG3A 3ZRCA 3L16A 2L0FA 4DWFA 2ZW1A 1YD8U 2DZKA 2R2OA 1Q10A 5BYSA 5CHFA 2DX5B 3NZUA 4WJQA 1P3QU 1SJED 1YN3A 2CHWA 3AEFB 3PRPB 3ZQ4A 2N4FA 5L95C 4GXBA 2KO3A 3ABVB 4GDLA 3VHTC 1VDVA 1CJEA 4JIOU 5IO9A 1RRBA 3NRZA 1JROA 5FR6A 3EHVA 2KJRA 2WP9B 3MC9A 3DBLI 1ZE3D 2WX1A 1WYGA 3KH0A 4MGYE 4AQ7A 2KLCA 3ZKJC 1OFFA 3AMZA 4GOCA 3JVZX 2WXGA 3QHTA 4BZAA 4HKQA 4NJ7A 4LCDE 3M63B 4YWGG 2WXIA 3LB8C 2RMMA 3QJZA 3L0WB 1CK1A 2DHZA 1YQBA 4RGNA 1JWBD 1JWMD 5E6OA 2JYTA 2MP2B 2MH7A 1T5XD 4IC7B 3UI3A 3L4PA 4ZOHC 4YTPB 2H88B 3PV1A 1UZXB 4P1BC 3VXWA 2UYZB 2LVOA 2PE9A 1L6UA 4YTMB 2OHFA 2PE6B 5JH5C 3CF6E 1XLOA 2Q5WD 2L00B 4KVGB 1D5ZC 4YSZB 3ZNGC 1FNVA 4ZRKA 4NQKE 2ZPYA 4JL9A 1FM0D 4NQLB 5EE3A 1VR9A 2BPSA 2KFKA 1OGWA 4MGKE 3SEBA 2RSUA 3PT2B 4ASWC 3U52E 2N1WA 4MGZE 2ICIA 1WJ6A 4P6VF 3TEZA 4PYZA 4WWPA 3ZJVA 4CQNA 2Y5PA 3NZSA 3TEWA 4ZRIA 4BKSD 1J8CA 2CU1A 3RMKC 4W9DA 2E6XA 1JWAD 3P4QB 4DHZE 4GLSC 3N20C 4RFBA 4JX1C 3KUZA 3SDLC 2JQRB 4HPPA 1ENFA 1EU3A 4LDTD 2BF8B 1E6EB 3Q3NC 3RNBC 1JRUA 1FCLA 2FCMA 3MP9A 1KLVA 2BKRB 4K7UA 3RULA 4LJOB 1OQYA 4WJPA 3EA6A 1FFVA 1FXTB 2QDFA 4A3OA 4XWTA 4HRSA 4W9KA 2YEPB 4MDKE 5E6JA 1GPXA 1E7VA 3RCZA 3UQBA 2JUOA 3DHIC 3ZDMC 3Q2AC 4LDTB 2LGSA 4RNAA 1XO3A 5E6NA 1E8XA 1WF9A 5JZEB 5CX3A 3Q69A 2LUEA 4B0EA 1IPGA 4I6PA 2ZCBA 1KFYB 1BXTA 3BY4B 1C76A 2D2QA 1CQVA 4CYEA 3D32A 2IJ0A 4WAFA 1R4NI 2I2YA 4HDQA 1V9JA 2QEJC 1DOIA 3TEXA 1GC7A 1AYFA 2X38A 3IT6B 3DDCB 3AB5A 4FHJA 1L7YA 2WXRA 2PLPA 3K9OB 3QX1A 5G2NA 1GB4A 1T0RC 2NTTA 2HD5B 2KWDA 2V3SA 2IZVB 3Q6BA 5DPSA 1AWDA 1XEEA 3WAPA 3AEBB 4WQMA 4REZA 3RFZB 4FADA 2MA9B 3N3KB 2XEWA 1XF5L 4FHKA 1TBEA 1UF0A 5MPOA 3WA0A 1R7SA 2SAKA 4F1SA 1RYJA 4GMVA 2HTME 4R3DA 5LNK1 4BBNC 3RZWC 4G3XB 3DWGC 2JRHA 5AEKB 3Q3FA 5KHQA 3A1QA 3RUIB 4HCNB 4WAAA 1E8YA 2XK5A 5E6PA 4LLGM 2M17A 3V3XA 2MBQA 3I57A 4MACA 3RNAC 2JXXA 5J2RA 2JT4B 1TKYA 1RFKA 4DXAB 2QJLA 3ZXRA 1IUEA 2C9WB 1ZXIA 4MM3A 4IM3A 3V6CB 2MSED 1QQRA 4NJCA 1A5RA 2C7NB 2AL6A 2WXQA 1I35A 1FFUA 2K25A 4ANXA
chains in the Genus database with same CATH topology
3DHHC 3DHIC 3Q2AC 3Q14C 1T0QC 2INCC 3RMKC 3I5JC 3GE3C 3I63C 2INDC 3N20C 3RNCC 4P1CC 3RNGC 3RI7C 2RDBC 1T0SC 3GE8C 3RNEC 3DHGC 3RNAC 3N1XC 3N1YC 3Q3NC 3RNBC 4P1BC 1T0RC 3RNFC 3Q3OC 3N1ZC 3Q3MC 3RN9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHH C;  3DHI C;  3Q2A C;  3Q14 C;  1T0Q C;  2INC C;  3RMK C;  3I5J C;  3GE3 C;  3I63 C;  2IND C;  3N20 C;  3RNC C;  4P1C C;  3RNG C;  3RI7 C;  2RDB C;  1T0S C;  3GE8 C;  3RNE C;  3DHG C;  3RNA C;  3N1X C;  3N1Y C;  3Q3N C;  3RNB C;  4P1B C;  1T0R C;  3RNF C;  3Q3O C;  3N1Z C;  3Q3M C;  3RN9 C; 
#chains in the Genus database with same CATH topology
 5J17 A;  5TSS A;  4ICV A;  1N61 A;  1WM2 A;  1T6B X;  1T0S C;  2KAN A;  3DVG X;  4HRO A;  2B76 B;  2QIL A;  4E71 A;  3K9P B;  3CIR B;  2D3G A;  2N7E A;  3PO0 A;  1OTR B;  1N63 A;  4LK0 M;  3BVM A;  2JWU A;  1HTQ A;  2NPT A;  1F2R C;  1QKZ A;  2W55 A;  3ZRF A;  4HPM B;  2M1M A;  1HZ6 A;  5DPW A;  3PHW B;  2MX2 A;  2L0T A;  2MW5 A;  2M8S A;  3OJ4 B;  5JHA A;  3DBH I;  2CHX A;  2KAJ A;  3AM9 A;  2NBU A;  2JPH A;  3NVZ A;  4JWU C;  2IO1 B;  2K1F A;  3HRD D;  1Z2M A;  3L13 A;  4RF0 A;  3MC8 A;  4JE3 B;  1Q0W B;  3NVW A;  3MJW A;  4B95 A;  4DBG A;  2ZEQ A;  2JWZ A;  4YL8 A;  4RF1 A;  4HDO A;  1E7U A;  4KX6 B;  3ZGZ A;  2KTF A;  3H7P A;  1K8R B;  3H1U A;  4C4V B;  1GJZ A;  1AAR A;  2PW9 A;  2Y3A A;  3WAN A;  1E10 A;  3IHP C;  1FRD A;  3VTU A;  4AOF A;  1DGJ A;  1WXV A;  2KK8 A;  1KJT A;  2GI9 A;  2CU3 A;  4NJ6 A;  2PIA A;  4KV2 A;  2MJD A;  2KQ4 X;  1NEN B;  4LNN A;  1WX9 A;  2JU6 X;  2TSS A;  1WWT A;  3Q8A A;  4W9C A;  1TGZ B;  3TIX A;  2BQQ A;  3I5J C;  5FR3 A;  5J18 A;  2KQS A;  2BWF A;  1MJD A;  4USA A;  3CST A;  3A9J A;  3NJT A;  4YT0 B;  1D3Z A;  3AI5 A;  1JCK B;  1ROE A;  2L05 A;  1LXD A;  3OAW A;  2IYD B;  4HKZ E;  1VD2 A;  5FK9 C;  4MH0 E;  4GN1 A;  4ZDV A;  4LNO A;  3X23 A;  3L54 A;  2WDQ B;  4ACF A;  4OZA A;  3UF8 A;  1L0Y B;  1UH6 A;  1QF6 A;  3ZJT A;  4K3C A;  1C77 A;  5BYR A;  1V81 A;  1RLF A;  3P4R B;  4H2A A;  1SF0 A;  3KVF B;  1WSP A;  2NMQ A;  1Q5W B;  5HKH A;  4F8C B;  2N9X A;  2WYQ A;  3T3O A;  5AZG A;  1TS3 A;  3DHH C;  1PGX A;  3UIN B;  4BAX A;  1J7A A;  2LD9 A;  4ANW A;  1L0X B;  4IKG A;  2NBW B;  2IY0 B;  3RI7 C;  2L32 A;  3NVV A;  3RD2 A;  2W82 A;  2V3P A;  2O6V A;  1SIJ A;  2NS5 A;  2WXH A;  5IP4 D;  3KUD B;  2KN5 A;  3VVW B;  2V1Y A;  4KGT A;  3V62 A;  3AE6 B;  4A8X C;  4KIK A;  2KX3 A;  2KWU B;  4OVV A;  2ON8 A;  1XLP A;  1AW7 A;  2K6Q A;  3A1Q B;  4I6N B;  1H4R A;  1HXY D;  5L83 A;  3VDZ A;  2IO2 B;  3SU8 X;  3O13 A;  2I38 A;  1WR6 E;  3W5V B;  1C79 A;  3I3T B;  1L5P A;  1JWS D;  2SEB D;  4DHZ B;  2YEP F;  3ECI A;  2KZR A;  3DVG Y;  5KHO A;  4BKT A;  2WNM A;  1TT5 B;  3AE2 B;  1K53 A;  2XNA C;  3PTF C;  1JAL A;  2L3Z A;  3SHQ A;  3GZN B;  3B08 A;  3DVN V;  1FXA A;  1V49 A;  1WM3 A;  4BOZ B;  1GB1 A;  1E8Z A;  1GAQ B;  1KLU D;  2PEA A;  3VQI A;  2FNJ B;  3ZYY X;  1HQR D;  1ET6 A;  4AWJ A;  1FNW A;  2FCQ A;  1N6Z A;  5EE9 A;  3A33 B;  4G11 A;  3W1S A;  4YSX B;  1TKG A;  1KH0 A;  1UBQ A;  2ZVO A;  1HZ5 A;  2IBI B;  4IM2 A;  2FUG 1;  1Z5S B;  1K51 A;  1HEZ E;  1VZ6 A;  2AYO B;  2EKI A;  3TEY A;  4BKG A;  3ALB A;  4M8N A;  3P4P B;  3JW0 X;  2D5G A;  2KOX A;  5BMH A;  1ESF A;  2DNF A;  4EOY A;  1HE8 A;  3RYT A;  3LJ3 A;  4OW0 A;  3DPD A;  1SEB D;  1B1Z A;  2KMC A;  2OJW A;  2XBB C;  3EC8 A;  2NVU I;  2C7M B;  4L2Y A;  2INC C;  3NZ3 A;  1FIQ A;  5C23 A;  2Y5B B;  4Q2J A;  2WDT B;  1V5O A;  2L7R A;  2JF5 A;  3VRA B;  4BBN F;  2BTE A;  4OVZ A;  2EEL A;  3IFW B;  4XDD A;  2IO0 B;  3H7P B;  2W3S A;  1N5X A;  4OZB A;  4ITK A;  2WU5 B;  3AE1 B;  4OHJ A;  3ZDT A;  1M94 A;  1QOB A;  3SFE B;  1I4R A;  4NAW B;  2RD0 A;  1IP9 A;  2JRI B;  1D4B A;  2J0K A;  1TY0 A;  2MBO A;  3KWL A;  3OG5 A;  5BYQ A;  3R2I A;  4GU2 A;  4K1R B;  2BW2 A;  3WIM A;  2REX A;  2KD0 A;  1HA5 A;  3PHX B;  4EE2 A;  4HVB A;  4IWQ A;  2KN4 A;  1ISN A;  3W5U B;  2K22 A;  2PKO A;  3Q8B A;  1GC6 A;  2DZJ A;  3ML8 A;  2PJH A;  5GXG B;  5JXV A;  1PQS A;  5AZF A;  1KLG D;  2E3T A;  5HI1 A;  2WQY B;  2K0P A;  2O6V D;  3OWE B;  3QWZ B;  1IBX A;  2CJN A;  3VAW A;  1SGH A;  4US9 A;  1DOY A;  3JSV A;  2LGX A;  3AEG B;  1A70 A;  2J0J A;  1N5W A;  3PLV A;  4HJK A;  4PK1 A;  4WIP A;  3EGR A;  3V6E B;  4S0R A;  2MRP A;  1BUI C;  2NCN A;  1V6E A;  3UQA A;  3PZD A;  4B9K A;  4FN2 A;  3VR8 B;  2GMI C;  2KQ7 A;  4RM8 A;  1GG3 A;  1KM7 A;  3FC4 A;  4HPL B;  3R66 C;  3H6N A;  2O6V B;  3M3J A;  1FRR A;  1XLQ A;  1TJE A;  3JYU A;  3X0W A;  2G4D B;  1Y8R C;  4W9G A;  2DAF A;  3Q8C A;  3SR6 A;  4E3C A;  2VZK D;  3BIN A;  1FCC C;  1DYQ A;  1EWC A;  3QK0 A;  1I7H A;  2MBB B;  4K7S A;  4ZHO A;  3GS2 A;  1E90 A;  3HK0 A;  3HVZ A;  3NY5 A;  4DDI D;  4UDU C;  5C3J B;  3LDZ E;  4RH6 A;  1C4P A;  1P9D U;  3AE5 B;  1SB3 C;  1UD7 A;  3TUO A;  1F0Z A;  1V1P B;  3H9D A;  1E7P B;  4XE0 A;  4TKN A;  3Q3M C;  1TY2 A;  1C78 A;  4HLE A;  2EMS A;  1JQ4 A;  2LHE A;  1NEK B;  1K50 A;  1WXS A;  2KTR A;  1J7B A;  2RDH A;  3ZJU A;  4GSW A;  3P63 A;  2VZK B;  3SFD B;  4RGM A;  4GB9 A;  4P7I A;  5T8I A;  2FE8 A;  4M0W A;  2WXF A;  3BVG A;  2JVC A;  3EFC A;  2INP E;  1TS4 A;  3VFK A;  4URK A;  4W9H A;  3AE4 B;  1D5X C;  3LXF A;  1C9F A;  4MSM B;  3R8B A;  2HE7 A;  2ZJD A;  1NVI D;  2GBK A;  3W1S C;  3PPA A;  1OEY A;  2MJE A;  5C1Z A;  3A9K A;  4LTU A;  5DCN A;  1FMA D;  3APC A;  1LQB A;  4IG7 B;  5G5G A;  1RWS A;  2L52 A;  3B2F A;  2N9P C;  4DXF A;  3KQ4 A;  1T0Q C;  1YQ4 B;  2CS4 A;  2IGD A;  3O65 B;  3UIP B;  3NS1 A;  1WE6 A;  2MJ3 A;  2C60 A;  2PPH A;  3TCA A;  1G6J A;  1MHX A;  4IW0 A;  4C00 A;  3TL5 A;  3N1X C;  4GDL B;  1ACC A;  4LNF A;  3ZLZ A;  2LVP A;  4FA6 A;  4US8 A;  3Q3O C;  4EZL A;  3BK1 A;  4P16 A;  1QZE A;  1YQ3 B;  2DBY A;  4A20 A;  4B0M A;  3EEC A;  4IDI A;  4MSQ B;  2EMT A;  2GRI A;  3PRM B;  3GE8 C;  1ZP0 B;  2LJI A;  1FXI A;  4JWS C;  2KJ6 A;  1B9R A;  1CZP A;  4B6W A;  4NPN A;  1IGC A;  4IUM B;  1SE3 A;  2WX0 A;  2KWV B;  1YN5 A;  3MFG A;  1WIA A;  1M4V A;  3BYT B;  5IAA C;  2EKE C;  4N9F 4;  1PFD A;  1P7E A;  1RM6 C;  2M0X A;  5D7G A;  1E8W A;  3VUX A;  2QHO A;  3OLM D;  4ZYS A;  1L0V B;  3W1Y A;  2MWS B;  2DLB A;  3U8Z A;  2V4I B;  2BT6 A;  1J19 A;  4J3O D;  4LNK A;  2AX5 A;  3RN9 C;  2DWQ A;  3IAM 1;  3HHM A;  1FPY A;  4GDK A;  2KVZ A;  3AEC B;  3AH7 A;  1XCT L;  1WXA A;  2KXJ A;  2QSD A;  2RDG A;  1YIW A;  4JPS A;  4XX5 A;  1P7F A;  4KGR A;  1TYG B;  3BYY B;  2AEH A;  2BB6 A;  1QIL A;  1E9M A;  3H8H A;  2CR5 A;  3FKY A;  2WLB A;  1WGY A;  2KJH B;  1STE A;  5EE0 A;  1EU4 A;  2NTS A;  3MC0 B;  1TZO A;  3L08 A;  1XT9 B;  4TQ0 A;  1X1M A;  2KFK B;  1P98 A;  1JML A;  2KDI A;  1R4M B;  4TQ1 A;  3R7Q A;  1WXM A;  3E9S A;  1AN8 A;  4TUU A;  4ZRJ A;  3AEA B;  1MVK A;  4W9F A;  5G5H A;  1T3Q A;  1KTK A;  4HWI B;  3CSF A;  1ZW7 A;  2BS4 B;  5D94 A;  1IGD A;  5HHD G;  4FUL A;  2IND C;  2JX5 A;  2KDF B;  1SIF A;  1EWY C;  2BKF A;  2MBH A;  3WCQ A;  2LMC A;  3TJP A;  1C1Y B;  4NAM A;  2BGF A;  2DZM A;  3DBR B;  3GZN I;  1GNU A;  4RMA A;  4W9J A;  1OEY J;  1ZDV A;  1ZDX A;  2OED A;  2DYO A;  2MP2 A;  2LGD A;  2ZW0 A;  3EUB 2;  2DYM A;  2MEK A;  2ONQ A;  3A4R A;  1QOA A;  3IBE A;  2O2V A;  1DOX A;  2J4X A;  3V05 A;  3QC8 B;  2Z8L A;  1V1O A;  4RGT A;  2ASQ A;  1QT9 A;  5IKC M;  1WYW B;  4MEL A;  5LXI B;  1YMH E;  3B1L X;  4KDI C;  4RGO S;  1RAX A;  1WGG A;  1ZUD 2;  1PDX A;  5H92 C;  3VTW A;  1ZKH A;  3R3M A;  3RT3 B;  4ANU A;  4C80 A;  5DPR A;  1WRD B;  1PGA A;  4FJY A;  1NDD A;  5HG2 A;  1YX6 B;  3S2A A;  2BWE S;  4J6I A;  2KNB A;  2PTL A;  2KLG A;  3A9K B;  2FCS A;  1C3T A;  1ZXH A;  1FD6 A;  2ZNV C;  2JYE A;  3WAM A;  4QAY A;  2ZNV B;  2I1K A;  1XCQ L;  2QC8 A;  4M01 A;  2FCN A;  2LXA A;  2QCZ A;  1H8C A;  3J9C A;  4XZ4 A;  2BYT A;  1JWU D;  2MCN B;  2Y5C A;  3PRE A;  3N9Y C;  3AE8 B;  3HM3 A;  3IVF A;  4C7Z A;  2MBE A;  4XYC A;  2K3U A;  2K9X A;  3WAO A;  4TMA B;  1LO5 D;  4ZHP A;  1MG4 A;  2XK5 B;  2JZP A;  3KLS X;  3C19 A;  2JZZ A;  3ONS A;  4NZL B;  4XGA B;  3MHS D;  2J52 A;  1BT0 A;  1ZGU B;  1V97 A;  1RFA A;  3VUY A;  2GBN A;  1E5W A;  2WHI A;  3U7D A;  2N7J A;  1F1H A;  2WXJ A;  2L8J A;  1UGM A;  3QIJ A;  4MM3 B;  3W9C B;  1L4D B;  2WWZ A;  4BKS A;  2YLM A;  1SE2 A;  3N30 A;  5AZH A;  1TIF A;  2AQ3 B;  4HCP B;  1WZ0 A;  5C2T B;  4II2 B;  4WJN A;  3Q3J A;  2N9K A;  1YJ1 A;  4JQW C;  2W54 A;  4HXD A;  1YJI A;  3DHG C;  4IWO A;  4XC2 A;  2L83 A;  3N1Y C;  2DAJ A;  1WXQ A;  5CHV C;  1SXT A;  3BVZ A;  5JHB A;  1SE4 A;  3AE9 B;  4OVU A;  2D10 A;  5D3D A;  4C7Y A;  1XXG A;  3KYC D;  4WUR A;  2K5P A;  2NPT B;  4KDL B;  2IY1 B;  3QQ8 B;  5IA7 A;  3KUC B;  5D2M B;  2KDB A;  2BVC A;  2D3B A;  3NS8 A;  1D6E C;  2G9H D;  4WH4 A;  4ICU A;  2G45 B;  1YN4 A;  2K39 A;  1C4A A;  2LHD A;  4O1N A;  2N0S B;  4WWO A;  2KDE B;  3CWI A;  1FNU A;  3VTV A;  2X8X X;  1HTO A;  2FAZ A;  3ZUN A;  4YTN B;  3ENE A;  4AUQ C;  4BOS C;  3QCA A;  4PS3 A;  2UWQ A;  4JGH B;  1FEH A;  4A9A A;  3ZIM A;  2HTH A;  2RR9 A;  3DWM A;  4WJO A;  4BVU C;  3ML9 A;  2BYE A;  3P1M A;  3MJ5 A;  5BMI A;  2JSV X;  1WX8 A;  2ZCC A;  1EUV B;  3CMM B;  5I4D A;  1ZOY B;  2WS3 B;  5DPT A;  2BYV E;  1Q1O A;  1P0R A;  2KHW B;  1U4A A;  3HVD A;  4A90 A;  1NYR A;  1KOT A;  1WGR A;  1BML C;  4PS8 A;  2K8C A;  3KYD D;  3QA8 A;  3IT4 B;  1YJJ A;  1SE9 A;  2D3A A;  1J0G A;  1YX5 B;  2KC2 A;  2V4L A;  4IOI E;  5IOI A;  1UBI A;  1TZ1 A;  1E0Z A;  1QLB B;  3A9J B;  1UEL A;  2K6D B;  3QAR A;  2J7Q B;  3AXC A;  4DXG A;  1S1Q B;  3EFU A;  4RCO A;  4C56 C;  4KSK C;  2KAC A;  4NY0 A;  3MTN B;  2KKC A;  1WMH A;  2ACZ B;  2LFI A;  3IXS A;  2O2V B;  2KVR A;  1WRI A;  4E74 A;  2WDV B;  2L76 A;  2G4S A;  2D3C A;  5HFY A;  4HJG E;  4KZC A;  3AN1 A;  5TR5 A;  3AV8 A;  4W9E A;  1XLN A;  3BWU D;  1J7C A;  2KDM A;  5D3I B;  2KYW A;  1KRH A;  4FJV B;  1GUA B;  2WXL A;  1N62 A;  2IGH A;  4KGS A;  1D5M C;  2A5U A;  2LZ6 A;  3OJ3 A;  2I1J A;  2BBC A;  4MGI E;  1TS2 A;  2L1A A;  1I42 A;  4K7W A;  3T9L A;  3L10 B;  2RGF A;  1WI0 A;  2LWP A;  5LLI A;  2A4Z A;  2JZ3 B;  5CHW A;  1WGH A;  1VLB A;  2FID A;  3UIO B;  1C4C A;  2IDY A;  2WXM A;  4G0N B;  1WJ4 A;  3P4S B;  4KIK B;  3TSS A;  3PGE A;  1SBB B;  2LUM A;  4C4V A;  2YVC A;  2AQ1 B;  5EDS A;  3NVY A;  1V80 A;  2D11 A;  2H89 B;  2J53 A;  3FAH A;  2LRW A;  2QMT A;  1CMX B;  1GOZ A;  1N60 A;  3NG0 A;  2J42 A;  3V60 A;  3PZ7 A;  3B0A A;  3DBL B;  4X57 B;  1EF5 A;  2GBM A;  1L4Z B;  3QAQ A;  1EM7 A;  2PVO D;  1WFY A;  4GGQ A;  1VCB A;  3BK2 A;  2JXT A;  1KF6 B;  2LI5 A;  2R61 A;  2V3N A;  3VH3 B;  1NBF C;  4A3P A;  4G50 A;  4WWM A;  1YNT E;  1V86 A;  2DEN B;  3PVL A;  4YXD B;  1F2R I;  4EEW A;  5EE1 A;  4A55 A;  2BS2 B;  4CO7 A;  4PYU A;  3ZW3 A;  1QOG A;  1T0Y A;  3RZF A;  1TS5 A;  1WY8 A;  2FIF A;  3ZTC A;  4KZ0 A;  3GB1 A;  1IYF A;  2AL3 A;  1WGD A;  3KW5 B;  2MLB A;  4AJY B;  2WXP A;  4FBJ B;  2V0G A;  2CHZ A;  2M56 B;  2AWT A;  2NR2 A;  2Z59 B;  2OOB B;  1R4M I;  1SSN A;  3URY A;  4TSS A;  2FBW B;  2LVQ A;  3C8Y A;  4AP4 C;  3ZO5 B;  1YOV B;  5GMV A;  3GP7 A;  4K81 A;  2JY6 A;  4MJS A;  2B3A A;  2RDB C;  2WXO A;  3DCG A;  1MI0 A;  2K8B A;  1JRP A;  2ZPN A;  3AED B;  1TTN A;  1I4H A;  5D6J B;  3TBL D;  1EF1 A;  1EO6 A;  2N1V A;  2KWC A;  3GE3 C;  4RM9 A;  1I4X A;  3P2B A;  1Y56 A;  3AU5 A;  1WX7 A;  3DBR I;  3Q8F A;  4TV3 A;  3DOW A;  3VR9 B;  3HIZ A;  4OZC A;  4XDC A;  3Q8E A;  2W9N A;  4PT5 A;  2OJR A;  3KWV A;  2CKH B;  3RPF C;  2FUH B;  4W9I A;  2WXN A;  5FKA C;  1I4G A;  4KKJ A;  2WDR B;  2WGS A;  3APD A;  1FO4 A;  4WQO B;  4N6E B;  4YSY B;  1UWM A;  3DVN U;  4N59 A;  2R2Q A;  1S3S G;  3ZNI D;  1XD3 B;  3NUH B;  3FIL A;  2LRU A;  2GLS A;  1MG8 A;  2WXK A;  4F7Z A;  2UU7 A;  1TKE A;  3HM6 X;  3UGB B;  1OQR A;  4IM0 A;  1WGK A;  2GBJ A;  3N32 A;  4WWN A;  3AU4 A;  1WE7 A;  3APF A;  4M02 A;  5BO4 B;  3A4S C;  3RNE C;  4FJZ A;  3HUI A;  1WMH B;  2KX0 A;  2LXC A;  4DDG D;  1IBX B;  1LM8 B;  3RNG C;  1L2N A;  4K3B A;  1LFD A;  3B9J A;  3JSV B;  1XQQ A;  4W9L A;  4EUT A;  4N58 A;  3IAS 1;  1JW9 D;  1WJN A;  1R4N B;  3I9V 1;  3SD5 A;  1V2Y A;  1MHH E;  5IN7 A;  5LXH A;  1UUP A;  3W2D A;  4HEA 1;  3ZNZ B;  3NHE B;  1VRA B;  2V9H A;  2XN9 C;  3M62 B;  4ZRP A;  3U30 A;  3BZD B;  5G55 A;  2HJ1 A;  2J0M A;  4S17 A;  2N9L A;  2BS3 B;  4NNJ B;  3L17 A;  1SJH D;  1V8C A;  4LNI A;  2CJO A;  3M95 A;  4JLC A;  1L6V A;  3TMP B;  4EZJ A;  2GOW A;  3Q14 C;  1NI3 A;  4EZK A;  4M8M A;  2PVG C;  4NAW A;  2K8H A;  2G1E A;  1WR1 A;  1UWX A;  2WU2 B;  4M00 A;  3T3N A;  1PGB A;  2BYF A;  2C5L C;  3U2S C;  1V5T A;  4ZYN A;  4DQO C;  2G3Q B;  3AE3 B;  4GIV A;  3U4E G;  2IPK D;  2HDE A;  3P42 A;  1NI2 A;  4L23 A;  2D07 B;  4I6L B;  2KTR B;  1ZPS A;  5H8Y E;  2LEK A;  2VH2 A;  2PMV A;  1QOF A;  2RPV A;  4ARI A;  4ZRQ A;  1WH3 A;  3R2T A;  4II3 B;  4M0W B;  4PS7 A;  3AE7 B;  3PRZ A;  3VUW A;  4KKI A;  3N1Z C;  4MH8 A;  2N7D A;  1ET9 A;  4MEM A;  3MHZ A;  2KMM A;  4IWP A;  3NOB A;  2DYB A;  3RNC C;  2KFJ A;  2ZVN A;  2QIE B;  2IGG A;  4DHJ D;  2N9E B;  2W3R A;  3VH4 B;  1LGR A;  1F52 A;  4BFR A;  2Z0D B;  3RNF C;  3ZTD A;  3AEE B;  2GB1 A;  4L1B A;  4EFO A;  4KSL C;  1MPE A;  1PUT A;  1F9J A;  1VZ8 A;  5BMG A;  4MJS B;  1P1A A;  2AQ2 B;  3DBH B;  4XWW A;  1I4P A;  2KC1 A;  2M19 A;  2Z0E B;  2LGI A;  5CTR C;  4ARC A;  3H7S A;  3V61 A;  5AUK A;  3DBS A;  2VH1 A;  4DHJ B;  2NBV B;  2IO3 B;  2KT7 A;  2MQJ A;  1VZ7 A;  3T8M A;  3U7Z A;  4HK2 A;  2M0A A;  1PYW D;  2M4N A;  3GOE A;  4ANV A;  4CHK A;  1F77 A;  4AS1 A;  3B2G A;  1UNS A;  1V1P A;  3ZXV A;  2LGY A;  4EKU A;  3VRB B;  3AUL A;  1I4Q A;  1WJU A;  2RPQ A;  2LAS A;  3BII D;  3I63 C;  2ZZP B;  3ZVV A;  2VRR B;  2MHJ A;  4FXC A;  5AUI A;  2LJ5 A;  2BB5 A;  1K52 A;  3E56 A;  2C7H A;  4A6Q A;  1UGJ A;  3FIL B;  1NYQ A;  2HJ8 A;  4D2K A;  2DZI A;  1OQQ A;  4GDK B;  3WAL A;  2GBR A;  4AJW A;  1MFW A;  3R7R A;  4FLH A;  3LYY A;  1VJK A;  2INN E;  3C0R B;  4P1C C;  3PZ8 A;  2KMA A;  1WZ3 A;  3ETR A;  4LJP B;  4MT5 A;  3PLU A;  3ZNH B;  3PSE B;  4DK5 A;  3DQV A;  3PS6 A;  3IG3 A;  3ZRC A;  3L16 A;  2L0F A;  4DWF A;  2ZW1 A;  1YD8 U;  2DZK A;  2R2O A;  1Q10 A;  5BYS A;  5CHF A;  2DX5 B;  3NZU A;  4WJQ A;  1P3Q U;  1SJE D;  1YN3 A;  2CHW A;  3AEF B;  3PRP B;  3ZQ4 A;  2N4F A;  5L95 C;  4GXB A;  2KO3 A;  3ABV B;  4GDL A;  3VHT C;  1VDV A;  1CJE A;  4JIO U;  5IO9 A;  1RRB A;  3NRZ A;  1JRO A;  5FR6 A;  3EHV A;  2KJR A;  2WP9 B;  3MC9 A;  3DBL I;  1ZE3 D;  2WX1 A;  1WYG A;  3KH0 A;  4MGY E;  4AQ7 A;  2KLC A;  3ZKJ C;  1OFF A;  3AMZ A;  4GOC A;  3JVZ X;  2WXG A;  3QHT A;  4BZA A;  4HKQ A;  4NJ7 A;  4LCD E;  3M63 B;  4YWG G;  2WXI A;  3LB8 C;  2RMM A;  3QJZ A;  3L0W B;  1CK1 A;  2DHZ A;  1YQB A;  4RGN A;  1JWB D;  1JWM D;  5E6O A;  2JYT A;  2MP2 B;  2MH7 A;  1T5X D;  4IC7 B;  3UI3 A;  3L4P A;  4ZOH C;  4YTP B;  2H88 B;  3PV1 A;  1UZX B;  4P1B C;  3VXW A;  2UYZ B;  2LVO A;  2PE9 A;  1L6U A;  4YTM B;  2OHF A;  2PE6 B;  5JH5 C;  3CF6 E;  1XLO A;  2Q5W D;  2L00 B;  4KVG B;  1D5Z C;  4YSZ B;  3ZNG C;  1FNV A;  4ZRK A;  4NQK E;  2ZPY A;  4JL9 A;  1FM0 D;  4NQL B;  5EE3 A;  1VR9 A;  2BPS A;  2KFK A;  1OGW A;  4MGK E;  3SEB A;  2RSU A;  3PT2 B;  4ASW C;  3U52 E;  2N1W A;  4MGZ E;  2ICI A;  1WJ6 A;  4P6V F;  3TEZ A;  4PYZ A;  4WWP A;  3ZJV A;  4CQN A;  2Y5P A;  3NZS A;  3TEW A;  4ZRI A;  4BKS D;  1J8C A;  2CU1 A;  3RMK C;  4W9D A;  2E6X A;  1JWA D;  3P4Q B;  4DHZ E;  4GLS C;  3N20 C;  4RFB A;  4JX1 C;  3KUZ A;  3SDL C;  2JQR B;  4HPP A;  1ENF A;  1EU3 A;  4LDT D;  2BF8 B;  1E6E B;  3Q3N C;  3RNB C;  1JRU A;  1FCL A;  2FCM A;  3MP9 A;  1KLV A;  2BKR B;  4K7U A;  3RUL A;  4LJO B;  1OQY A;  4WJP A;  3EA6 A;  1FFV A;  1FXT B;  2QDF A;  4A3O A;  4XWT A;  4HRS A;  4W9K A;  2YEP B;  4MDK E;  5E6J A;  1GPX A;  1E7V A;  3RCZ A;  3UQB A;  2JUO A;  3DHI C;  3ZDM C;  3Q2A C;  4LDT B;  2LGS A;  4RNA A;  1XO3 A;  5E6N A;  1E8X A;  1WF9 A;  5JZE B;  5CX3 A;  3Q69 A;  2LUE A;  4B0E A;  1IPG A;  4I6P A;  2ZCB A;  1KFY B;  1BXT A;  3BY4 B;  1C76 A;  2D2Q A;  1CQV A;  4CYE A;  3D32 A;  2IJ0 A;  4WAF A;  1R4N I;  2I2Y A;  4HDQ A;  1V9J A;  2QEJ C;  1DOI A;  3TEX A;  1GC7 A;  1AYF A;  2X38 A;  3IT6 B;  3DDC B;  3AB5 A;  4FHJ A;  1L7Y A;  2WXR A;  2PLP A;  3K9O B;  3QX1 A;  5G2N A;  1GB4 A;  1T0R C;  2NTT A;  2HD5 B;  2KWD A;  2V3S A;  2IZV B;  3Q6B A;  5DPS A;  1AWD A;  1XEE A;  3WAP A;  3AEB B;  4WQM A;  4REZ A;  3RFZ B;  4FAD A;  2MA9 B;  3N3K B;  2XEW A;  1XF5 L;  4FHK A;  1TBE A;  1UF0 A;  5MPO A;  3WA0 A;  1R7S A;  2SAK A;  4F1S A;  1RYJ A;  4GMV A;  2HTM E;  4R3D A;  5LNK 1;  4BBN C;  3RZW C;  4G3X B;  3DWG C;  2JRH A;  5AEK B;  3Q3F A;  5KHQ A;  3A1Q A;  3RUI B;  4HCN B;  4WAA A;  1E8Y A;  2XK5 A;  5E6P A;  4LLG M;  2M17 A;  3V3X A;  2MBQ A;  3I57 A;  4MAC A;  3RNA C;  2JXX A;  5J2R A;  2JT4 B;  1TKY A;  1RFK A;  4DXA B;  2QJL A;  3ZXR A;  1IUE A;  2C9W B;  1ZXI A;  4MM3 A;  4IM3 A;  3V6C B;  2MSE D;  1QQR A;  4NJC A;  1A5R A;  2C7N B;  2AL6 A;  2WXQ A;  1I35 A;  1FFU A;  2K25 A;  4ANX A; 
#chains in the Genus database with same CATH homology
 3DHH C;  3DHI C;  3Q2A C;  3Q14 C;  1T0Q C;  2INC C;  3RMK C;  3I5J C;  3GE3 C;  3I63 C;  2IND C;  3N20 C;  3RNC C;  4P1C C;  3RNG C;  3RI7 C;  2RDB C;  1T0S C;  3GE8 C;  3RNE C;  3DHG C;  3RNA C;  3N1X C;  3N1Y C;  3Q3N C;  3RNB C;  4P1B C;  1T0R C;  3RNF C;  3Q3O C;  3N1Z C;  3Q3M C;  3RN9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...