3I63C

Peroxide bound toluene 4-monooxygenase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
total genus 23
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i63C00
3RNCC 2INDC 3N1YC 3GE3C 1T0QC 3Q14C 3N20C 3I63C 3Q2AC 3Q3NC 3GE8C 3Q3OC 3RNGC 4P1BC 2INCC 3RNFC 2RDBC 1T0RC 3DHIC 3Q3MC 4P1CC 3RMKC 3DHHC 3RI7C 3RNBC 3RNAC 3RN9C 3RNEC 3N1XC 3DHGC 3I5JC 1T0SC 3N1ZC
chains in the Genus database with same CATH superfamily
1VLBA 4Q2JA 5C2TB 3VUXA 4DBGA 4WJQA 2J0KA 2KTRB 4W9KA 2BKFA 2PEAA 2JRHA 3BVZA 1K50A 3M3JA 4E3CA 1UH6A 4L23A 4GDKB 5IA7A 3PPAA 1QOGA 2VZKD 4P16A 1Z2MA 1TS5A 1WGGA 4XC2A 4CQNA 2CHWA 4AJWA 1H8CA 4MACA 1G6JA 4IM2A 4I6NB 2EKEC 1WJUA 2X38A 3Q8CA 1F52A 3DBHI 2BYEA 2CU1A 3RFZB 4CHKA 2EELA 2KK8A 2KWCA 3N9YC 1IBXA 5EE3A 3PHXB 4N59A 3Q8BA 2DX5B 3M63B 4BAXA 5MPOA 4XWTA 3URYA 2MP2A 2K5PA 2L05A 3DVNV 3TBLD 1MHHE 3DBLB 1UUPA 4FN2A 1ET6A 3ZNGC 3MFGA 1WJ6A 4ARIA 1Y8RC 1E9MA 2WDTB 4HKZE 1V5OA 2WDVB 1XCTL 2KMAA 2UYZB 1I35A 1DYQA 2N0SB 1TGZB 4WURA 4FA6A 1ZXIA 3RMKC 2AQ2B 4FLHA 1WF9A 3TJPA 1HXYD 1MHXA 4W9LA 2MX2A 4BBNC 2TSSA 3AH7A 2WQYB 4NZLB 2LRUA 4TQ1A 4IOIE 3P42A 5DPSA 3VAWA 4WWOA 2KAJA 1RFKA 3VQIA 1R4NI 3W1SA 1L7YA 1C77A 2O2VB 1E7PB 2G45B 1HQRD 2G4DB 4E71A 3DVNU 3C8YA 1R4NB 2R2OA 4JWSC 4CYEA 3RYTA 5AUIA 2N1WA 1GG3A 2K39A 2JRIB 2KX0A 2FBWB 3PSEB 3VFKA 1QLBB 1E8YA 2N4FA 4ZHPA 4HDQA 1YX6B 1FXIA 4N58A 1TBEA 1ZGUB 1WM2A 2JZZA 3JW0X 3QCAA 3TIXA 3ZDMC 4C4VB 5D94A 2YEPF 3AE2B 2GMIC 4MEMA 2Z59B 2J4XA 1EF1A 2PPHA 1FCCC 2PVOD 4HEA1 1M94A 2C7HA 3RULA 1L6UA 2EMSA 3WAPA 4RF0A 3CSTA 3AE8B 3A4RA 4M0WA 3AEEB 4RM8A 2JF5A 1FM0D 4ZRQA 3JSVA 1TZOA 2N9LA 2UU7A 3NJTA 1F9JA 3AI5A 3H7PA 5IAAC 1UBIA 3P2BA 3LJ3A 3LDZE 3IFWB 3ZW3A 2PTLA 4FJYA 4LDTB 1FIQA 1QT9A 2BS3B 4MGKE 1V1PA 1EO6A 3N1ZC 2LUEA 2LHDA 2GRIA 1J19A 1YN3A 2FIDA 2E3TA 5IN7A 1ZPSA 4MH8A 2G9HD 5C3JB 4NJ6A 3TL5A 5IP4D 3PV1A 1KLVA 4ANVA 1F0ZA 1FD6A 2DAJA 3AECB 4IW0A 3AE7B 4ITKA 4ZRJA 5T8IA 3R7RA 4OVZA 3MC0B 3WA0A 3Q2AC 4W9HA 3GZNB 4C56C 1EU4A 1UGMA 1CQVA 5I4DA 1BUIC 2ZEQA 1WIAA 3DHHC 5G5HA 3UINB 3H6NA 4G11A 1JRUA 4GGQA 3LB8C 2KC1A 2BVCA 2FCSA 1WYWB 3B9JA 5CHWA 2JU6X 4QAYA 3SFEB 1LM8B 2QEJC 3AEDB 3KH0A 2KACA 3U4EG 1FRRA 2KFKA 4G3XB 3L0WB 2WXLA 1JALA 3CMMB 3L16A 1N5XA 3KQ4A 2IGDA 1PUTA 1FFVA 1D5MC 4KKJA 5LNK1 1KJTA 5BYRA 3WALA 5AUKA 2MA9B 3RI7C 1L0XB 2WX1A 2IO0B 4AUQC 2KQ7A 3Q8FA 4MSQB 3AEBB 2D07B 2KVRA 2PVGC 4MGIE 3UGBB 3EHVA 1UELA 3I63C 1LQBA 1RAXA 3UF8A 1FMAD 4RFBA 2AWTA 1X1MA 4HXDA 4ZYSA 1WE6A 2MJ3A 1UBQA 4W9FA 4HPMB 3SR6A 1C79A 3RCZA 2L00B 4LNFA 4EZLA 5H8YE 4NAWB 1PFDA 2Y5CA 1PYWD 4GXBA 2JVCA 3CF6E 4DQOC 1MFWA 3A9KB 1ENFA 4FULA 4P6VF 1HA5A 3AE3B 2WXHA 2D10A 1K51A 3ETRA 2BS4B 4FADA 5C1ZA 2K25A 2K8HA 5JZEB 4KSKC 2IY1B 4LLGM 3V61A 2V3NA 1C78A 3Q8AA 4W9JA 3E9SA 1WR6E 4KGSA 1V9JA 4PT5A 1ZXHA 1I4GA 1EWCA 2KLGA 2D3BA 4REZA 4KIKB 4RCOA 2N9EB 2WXRA 1HTOA 1L4DB 1WWTA 1S3SG 1V80A 1EM7A 3E56A 3ZXRA 2ZCCA 3ZNHB 4B9KA 3MC9A 1YIWA 3ZUNA 2KJRA 2WXGA 1E8XA 3RN9C 3KLSX 1KLGD 2K3UA 2KHWB 4NAMA 3EA6A 1WGRA 3DWGC 4JLCA 1PGBA 2RR9A 2L32A 2WXFA 5E6NA 1R4MI 1SGHA 2C5LC 1KM7A 3JSVB 4S0RA 3X23A 1ZDXA 2KFJA 4L1BA 2HTHA 4HCNB 2AQ3B 4OW0A 2LEKA 4FJZA 3U2SC 3KVFB 4YWGG 3PRPB 4XYCA 1R4MB 5J2RA 1GB1A 2KQSA 1HTQA 5CTRC 3SU8X 1WGKA 1V1PB 2N7EA 5EE1A 2M8SA 4RH6A 1FNUA 3WAOA 2ON8A 2MJDA 1ZDVA 4IWQA 4XX5A 3AMZA 1P7EA 4PYZA 2KN5A 1WMHA 2MWSB 1WY8A 3PVLA 4XDDA 4M8MA 2KDFB 5G55A 2K8BA 4EFOA 2KXJA 4X57B 5AZGA 1V86A 2JT4B 3IXSA 2K6QA 3T3OA 2RD0A 1WXSA 3AE5B 2LVOA 1V1OA 3RNGC 2VH2A 3RUIB 2WXPA 1I4PA 3GB1A 2LZ6A 3LXFA 1MJDA 4MT5A 2KNBA 4HCPB 3DHGC 4G0NB 4ANUA 3AU5A 4TV3A 2L8JA 3W9CB 2BWFA 4CO7A 2VZKB 1N61A 4PK1A 1D3ZA 2L3ZA 2C9WB 3IVFA 2O6VB 3AB5A 1YNTE 5DPRA 5BYSA 4AQ7A 2INNE 4EKUA 4WJPA 4O1NA 3R2IA 2J0MA 2KVZA 4MGYE 4OZBA 5E6JA 3ZQ4A 3C0RB 2AL6A 1LO5D 4EZJA 4DWFA 1PQSA 1SIJA 2FCNA 3APDA 3EUB2 1V5TA 4M00A 3MHSD 1WZ0A 2KDIA 4KGTA 2V4LA 4BKGA 1AWDA 3AXCA 4B95A 3KYDD 3A1QA 1J0GA 3ZRCA 2XEWA 5CHVC 4W9CA 3EC8A 5EE0A 5CX3A 2PIAA 4KX6B 1I7HA 5BYQA 1LGRA 4ASWC 1OFFA 2DHZA 2W9NA 2WHIA 5J17A 3V05A 5D3IB 1XXGA 4LTUA 3QAQA 4HLEA 5AZFA 3DCGA 2ICIA 4A6QA 1WXVA 1GAQB 1T0QC 1GPXA 2WDQB 1B9RA 2M56B 4PYUA 3GE8C 3V62A 4GIVA 2NCNA 2NMQA 1VCBA 1AN8A 3P63A 2JXXA 2C60A 4BVUC 4IUMB 2MCNB 1KF6B 3FILA 1J7BA 4YTNB 3DBLI 3TEWA 4YSYB 1ZOYB 2BF8B 2ZVOA 2FE8A 2QSDA 2YVCA 2D2QA 1Z5SB 4KKIA 1Y56A 1E6EB 2KJ6A 2WYQA 1SJHD 4WAAA 1N62A 2M0XA 3I57A 3FAHA 1YOVB 5CHFA 2I1JA 1SB3C 1QOFA 3VH3B 2BGFA 2D11A 4A9AA 1P0RA 1TY2A 4XE0A 3UIOB 2M19A 3CIRB 1JWBD 2MEKA 2WNMA 2JUOA 1WJ4A 2WWZA 1SE3A 4W9GA 1KH0A 4ANWA 1C4CA 3GE3C 2HJ1A 1WGHA 2MBEA 4UDUC 4DHZB 2J52A 4MGZE 3P4QB 5L95C 2ZPYA 1PDXA 2QCZA 4YTPB 3W5UB 3BY4B 1MI0A 1E90A 2MQJA 5G2NA 2BYFA 1V6EA 5H92C 2V0GA 1QOAA 5D7GA 3R3MA 5BMHA 1Q10A 1RLFA 1P9DU 3BYTB 4JQWC 2KQ4X 4DK5A 1OQQA 2N9PC 1F2RC 4HWIB 3IAS1 1LFDA 2CKHB 2KO3A 3AV8A 3N3KB 1NEKB 1L0VB 2GOWA 4BOZB 2C7MB 2JXTA 1BT0A 2ACZB 3UQAA 2LGXA 2MLBA 5LLIA 2Z0EB 4K7SA 4N6EB 2IZVB 1DOXA 4KZ0A 1I4QA 5HG2A 2N9XA 1UF0A 2MW5A 1SE9A 2K9XA 2LWPA 3EFCA 2WXJA 4K3CA 4JL9A 3FC4A 4NQKE 3DOWA 1MVKA 5E6OA 1C4AA 2QJLA 1E0ZA 2KLCA 1YQ4B 1EWYC 1V49A 3BZDB 1K52A 3N20C 3SHQA 1F2RI 1P3QU 2NPTA 1V81A 4OHJA 2GI9A 2WXOA 2SEBD 5JHAA 2REXA 2L0FA 3B2GA 4TMAB 2HE7A 2ONQA 2W54A 3U7ZA 2RSUA 2WU2B 4HVBA 1C9FA 1OEYA 2I1KA 1WRIA 1KLUD 1XQQA 2IPKD 3IHPC 2GBJA 4II2B 1T5XD 4RMAA 1P7FA 3NZUA 4WQOB 1J7CA 2B76B 2HJ8A 3QARA 1UNSA 5TR5A 3VTUA 3GZNI 1ACCA 3VUWA 2YEPB 3P4SB 1ET9A 2KWUB 1SSNA 3N30A 3SFDB 2WP9B 4IM0A 3N32A 3SEBA 4IM3A 3PT2B 3JYUA 3IG3A 1DOIA 1ZE3D 5FKAC 5TSSA 1L4ZB 2RDBC 2YLMA 2M0AA 4JGHB 2RDHA 4A3OA 2EMTA 3GOEA 3OWEB 1IYFA 4K7UA 4M8NA 4URKA 2Z8LA 2MBHA 2K6DB 1SJED 4A20A 4GMVA 1NI2A 2I2YA 2FUHB 4IWOA 5J18A 3MTNB 3OLMD 2JZPA 4YXDB 4OVUA 1CMXB 3IAM1 2IJ0A 4MELA 3ZNZB 1AW7A 4MDKE 2KC2A 3AE4B 1C76A 3P4RB 3W1SC 3BVMA 1P1AA 2KJHB 3RZFA 3TEZA 3ZNID 2Y5PA 1IBXB 3UI3A 2ZJDA 2R61A 1VZ7A 2LFIA 3UQBA 2MBBB 4XGAB 3PREA 2IGGA 2MP2B 2V9HA 4IDIA 4DXFA 3Q14C 3HIZA 2XBBC 5G5GA 2KT7A 2K8CA 2KX3A 1WRDB 2L0TA 1DOYA 1CK1A 1AARA 3ZJUA 2G3QB 1XD3B 5LXIB 1C1YB 4F8CB 2BW2A 5C23A 5D6JB 2LHEA 4TQ0A 1NYQA 2LUMA 2KTRA 3RD2A 1XCQL 3BYYB 2KANA 4GDKA 1OEYJ 1OTRB 2VH1A 2LMCA 1T0RC 2N9KA 2J7QB 3PRMB 1MG8A 1FNVA 1DGJA 2DLBA 2DYMA 1FCLA 2WXKA 5E6PA 2KKCA 3PZDA 1NYRA 5JXVA 2DENB 2NBVB 1RRBA 2EKIA 1V97A 2VRRB 2KWDA 3AULA 5DPTA 1JWSD 3NVYA 3ZJVA 4LNIA 5IKCM 4YT0B 2DWQA 2B3AA 2SAKA 3RNAC 2LXCA 2AL3A 1YD8U 2LGDA 4GB9A 1TTNA 3M95A 4J3OD 1CZPA 2GBRA 1JROA 2D3CA 4B6WA 1SE4A 4NQLB 3VTVA 1NENB 2BKRB 3QJZA 3ZDTA 3MP9A 3ECIA 3OJ3A 3SD5A 5FK9C 4IG7B 1WR1A 3VHTC 2JY6A 4DXGA 3QX1A 4MJSA 2J0JA 3RT3B 1JW9D 2FAZA 4TKNA 1PGAA 5DPWA 5KHQA 1KRHA 3VR9B 1TIFA 4LJOB 1SBBB 3VTWA 4EEWA 2NTSA 2WU5B 2AQ1B 2N7DA 2KDMA 1OQRA 2RPVA 1LXDA 2JPHA 1NVID 1XT9B 4WH4A 1JMLA 4ACFA 2NR2A 3BK1A 3QIJA 2DZKA 3Q6BA 1TZ1A 4M0WB 2BB6A 1PGXA 2NPTB 3O13A 3QHTA 2DZMA 4MM3A 3H7PB 4TSSA 1S1QB 3VXWA 4LJPB 1E8ZA 2J53A 1E8WA 2KZRA 3AEFB 4OVVA 1GUAB 2O2VA 3AEGB 4GSWA 2W55A 4DHJD 3DBRI 5IOIA 5GXGB 4M02A 1KFYB 2G1EA 2M17A 2KDEB 1B1ZA 1RYJA 2R2QA 3KUDB 3RPFC 1TKGA 2JZ3B 4J6IA 3DBRB 4BKSA 4HJKA 1EU3A 3ZTDA 4N9F4 4W9IA 4C00A 2L76A 2LJ5A 1I4RA 4FHJA 4HPLB 4NJCA 1FEHA 3B08A 3VVWB 4M01A 4US9A 1UWXA 1IGCA 1N6ZA 3N1XC 2OJRA 2IO3B 4FBJB 4WWMA 1JWUD 2IO2B 3AE9B 5HHDG 3I9V1 2ZNVC 2H89B 4K1RB 2LXAA 3NS8A 4LK0M 4G50A 4LCDE 3RZWC 2BS2B 2JYEA 3PS6A 1V2YA 3PHWB 1YJ1A 2LGIA 1YJJA 3U52E 3W5VB 4KZCA 3WANA 2AEHA 3T8MA 5D2MB 2LJIA 3NS1A 3ZVVA 4B0MA 1YMHE 1IPGA 3PLUA 2V3SA 5FR6A 3P4PB 3RNCC 2RPQA 4F7ZA 3QQ8B 2KMCA 2KFKB 2JSVX 4JWUC 1QZEA 3IBEA 2X8XX 3HK0A 1ISNA 2IBIB 1N5WA 3B0AA 2UWQA 3T9LA 2JYTA 1NI3A 1YJIA 3V6EB 3MJ5A 2BTEA 4ZOHC 2GB1A 4US8A 3MHZA 3VH4B 4ANXA 2WS3B 3AU4A 4MH0E 2L1AA 2KYWA 1WH3A 4A55A 1UD7A 4PS8A 4RGNA 1SE2A 3R2TA 5KHOA 1YN5A 2HDEA 3Q3NC 4EOYA 2LGSA 2WXIA 4XWWA 3DPDA 1NDDA 4EZKA 4WIPA 2N1VA 2KD0A 1QKZA 2MHJA 3W2DA 3ZTCA 1T0YA 3DQVA 4YL8A 2ZNVB 2LD9A 1FRDA 4GN1A 5L83A 1FXTB 3ZJTA 3CSFA 1IUEA 1ESFA 4WWPA 3NRZA 4KSLC 4HKQA 1I4XA 2WX0A 1XLNA 1JWAD 3ML9A 4KDLB 1GJZA 2XNAC 4LNKA 1BXTA 4RNAA 3IT6B 1C4PA 3PO0A 2OJWA 3OJ4B 4DDID 2NBUA 2O6VD 1I42A 2L52A 3L54A 4DXAB 5HKHA 3AM9A 3HUIA 2OHFA 3W1YA 2W3SA 4HK2A 3DHIC 3NZSA 2IGHA 3O65B 4KDIC 1MPEA 2V1YA 3K9PB 5LXHA 2FNJB 2CS4A 3NUHB 2CJNA 3HRDD 4F1SA 5JHBA 1IP9A 1XLOA 4MSMB 4ZRIA 3R7QA 3A33B 3APFA 2L7RA 3DBHB 4AP4C 1A5RA 1WX8A 1IGDA 4KVGB 1BMLC 1VD2A 2ZVNA 4K7WA 4I6LB 2E6XA 2Q5WD 2MSED 3MJWA 2C7NB 1T0SC 2I38A 4DDGD 3V6CB 2INDC 4MJSB 2AYOB 2PE6B 3R66C 4B0EA 4EE2A 1Q1OA 1SXTA 3KW5B 3PLVA 3KWVA 1GB4A 2KWVB 2Y3AA 4BBNF 1C3TA 4NAWA 2XK5A 4HJGE 4HDOA 2GBMA 2BWES 2BPSA 2JQRB 4K3BA 3DDCB 4WJOA 1TT5B 1TS4A 3A9KA 1WX7A 3N1YC 4GLSC 3LYYA 3GS2A 3A9JA 4MM3B 2LGYA 4AWJA 2QDFA 4I6PA 1FFUA 1ZW7A 3EGRA 3QK0A 1TS3A 4IWPA 2GBKA 1WSPA 1P98A 2PW9A 3WIMA 4A8XC 2DBYA 2KOXA 4A90A 4BKTA 1K8RB 2M1MA 2BBCA 3ENEA 4AJYB 4RGTA 3CWIA 2JWZA 1WMHB 3DVGY 3Q3OC 4RGMA 4P1BC 2PLPA 4KIKA 3R8BA 1FPYA 4HROA 2Y5BB 4LNOA 2LI5A 1SIFA 1K53A 1QOBA 3C19A 4GOCA 4WJNA 3BK2A 1ROEA 4H2AA 2LASA 2DYBA 5EDSA 2MJEA 1HZ5A 2K0PA 2V3PA 2V4IB 3ZXVA 1OGWA 3ALBA 3H9DA 1N60A 2ZW0A 1YX5B 3A4SC 2GLSA 3NZ3A 2LRWA 1ZP0B 2CR5A 1TY0A 3WCQA 4HPPA 1HEZE 2ZPNA 3B2FA 5AEKB 2Z0DB 3I5JC 3BWUD 1Q5WB 2D3AA 2HD5B 3APCA 2ASQA 2K1FA 2QC8A 1D5XC 3NVVA 4C7ZA 4ICVA 1J7AA 4EUTA 3L13A 3Q8EA 3HHMA 3RNFC 2WDRB 5BMIA 1ZUD2 3K9OB 3FKYA 4JX1C 3HM6X 4FXCA 3PRZA 2WXMA 1E10A 3DVGX 1H4RA 4BKSD 3VUYA 2MBOA 2H88B 3A1QB 3JVZX 3ZGZA 1M4VA 4FJVB 2INCC 2PKOA 1A70A 1NBFC 3I3TB 2NBWB 1RFAA 1JCKB 1Q0WB 4OZCA 5BO4B 3AEAB 4IKGA 3KUCB 3KWLA 1EUVB 2WXNA 5HI1A 1TS2A 4NY0A 1L0YB 4W9DA 2CJOA 3VRAB 3NOBA 1KTKA 3HVDA 3H1UA 3TEYA 2NS5A 3J9CA 3EFUA 1WFYA 2CHXA 3ZO5B 2RDGA 4NPNA 2NTTA 1TJEA 4NJ7A 2BQQA 2QHOA 2O6VA 2KDBA 3PTFC 4JIOU 3VR8B 5BMGA 1CJEA 2BT6A 4XZ4A 3NVZA 1N63A 1L2NA 2ZZPB 1RWSA 2A5UA 4LDTD 1XO3A 3FILB 4RGOS 2IYDB 2FCQA 2BB5A 4JPSA 3ZLZA 4AOFA 2A4ZA 3ZIMA 1D6EC 1QF6A 1SEBD 3L17A 4WQMA 1KOTA 1YQBA 2RMMA 3NHEB 3EECA 1AYFA 3V60A 4GDLA 1ZKHA 1WGYA 2IY0B 5FR3A 2LVPA 4GU2A 2G4SA 3TCAA 2K22A 1JQ4A 1WM3A 1WX9A 2L83A 2MRPA 1F1HA 1WXQA 3T3NA 2D3GA 3QWZB 3KYCD 3H7SA 2WXQA 1TKEA 2PMVA 2DZIA 1T3QA 3GP7A 1V8CA 5JH5C 1WYGA 4TUUA 3VRBB 2DZJA 2W82A 2XN9C 4YSZB 4DHZE 3QC8B 4D2KA 4WAFA 1J8CA 1XLQA 3OG5A 4IC7B 3AN1A 5D3DA 2LVQA 1TYGB 4KGRA 2XK5B 1XF5L 3ML8A 2ZCBA 3IT4B 4RM9A 1WGDA 4WWNA 1WXMA 2WLBA 3L10B 3ZRFA 3UIPB 2KTFA 2AX5A 1WE7A 3NVWA 3A9JB 4DHJB 3SDLC 4YSXB 2KMMA 2QIEB 1OQYA 2MBQA 4A3PA 3S2AA 1FNWA 3AE6B 3PZ7A 3ZKJC 2ZW1A 2OOBB 5GMVA 2JWUA 4W9EA 3ONSA 1R7SA 2PJHA 3L4PA 3ZYYX 1D5ZC 3BVGA 2W3RA 1GNUA 1VR9A 1WI0A 3RNEC 1XLPA 1UWMA 2JX5A 3L08A 1E7VA 3QA8A 4BFRA 3Q3JA 1E7UA 1FXAA 2IO1B 2CU3A 2FIFA 3X0WA 2HTME 3DWMA 2BYVE 4LNNA 3HM3A 1QILA 4PS7A 2BYTA 4RF1A 1WXAA 1GC6A 1YQ3B 3DBSA 4YTMB 3TUOA 2PE9A 2DYOA 3B1LX 5DCNA 4USAA 3Q3MC 3MC8A 3Q69A 3PZ8A 4PS3A 1QQRA 1GOZA 4NNJB 1HZ6A 1UZXB 3HVZA 4C7YA 4K81A 4KV2A 3KUZA 1VZ6A 1F77A 4C80A 1L6VA 2DNFA 4ICUA 4S17A 2WGSA 3ABVB 1MG4A 1VZ8A 2FCMA 4C4VA 2KN4A 3RNBC 3VDZA 1EF5A 1SF0A 1E5WA 2FUG1 2N7JA 4ZYNA 1FO4A 4R3DA 4FHKA 3PGEA 4ZHOA 1WZ3A 4JE3B 1WJNA 4P7IA 2QILA 3M62B 3P1MA 3U30A 3Q3FA 4ARCA 4OZAA 4HRSA 4AS1A 3BIID 3U7DA 4E74A 4XDCA 4L2YA 3BINA 3H8HA 2INPE 2QMTA 3OAWA 3NY5A 2CHZA 2MH7A 1VRAB 2M4NA 1RM6C 2D5GA 2DAFA 3AE1B 5EE9A 4BOSC 2IDYA 3TMPB 1U4AA 1D4BA 3D32A 1VDVA 1XEEA 2GBNA 2RGFA 4ZRPA 3U8ZA 3WAMA 3TSSA 1JWMD 2OEDA 3TEXA 4ZDVA 1GC7A 1I4HA 4II3B 4ZRKA 1STEA 1JRPA 4BZAA 1UGJA 1TKYA 1VJKA 5AZHA 3V3XA 3NG0A 2J42A 2NVUI 4P1CC 1HE8A 1L5PA 1YN4A 4GDLB 1T6BX 5HFYA 5IO9A
chains in the Genus database with same CATH topology
3RNCC 2INDC 3N1YC 3GE3C 1T0QC 3Q14C 3N20C 3I63C 3Q2AC 3Q3NC 3GE8C 3Q3OC 3RNGC 4P1BC 2INCC 3RNFC 2RDBC 1T0RC 3DHIC 3Q3MC 4P1CC 3RMKC 3DHHC 3RI7C 3RNBC 3RNAC 3RN9C 3RNEC 3N1XC 3DHGC 3I5JC 1T0SC 3N1ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNC C;  2IND C;  3N1Y C;  3GE3 C;  1T0Q C;  3Q14 C;  3N20 C;  3I63 C;  3Q2A C;  3Q3N C;  3GE8 C;  3Q3O C;  3RNG C;  4P1B C;  2INC C;  3RNF C;  2RDB C;  1T0R C;  3DHI C;  3Q3M C;  4P1C C;  3RMK C;  3DHH C;  3RI7 C;  3RNB C;  3RNA C;  3RN9 C;  3RNE C;  3N1X C;  3DHG C;  3I5J C;  1T0S C;  3N1Z C; 
#chains in the Genus database with same CATH topology
 1VLB A;  4Q2J A;  5C2T B;  3VUX A;  4DBG A;  4WJQ A;  2J0K A;  2KTR B;  4W9K A;  2BKF A;  2PEA A;  2JRH A;  3BVZ A;  1K50 A;  3M3J A;  4E3C A;  1UH6 A;  4L23 A;  4GDK B;  5IA7 A;  3PPA A;  1QOG A;  2VZK D;  4P16 A;  1Z2M A;  1TS5 A;  1WGG A;  4XC2 A;  4CQN A;  2CHW A;  4AJW A;  1H8C A;  4MAC A;  1G6J A;  4IM2 A;  4I6N B;  2EKE C;  1WJU A;  2X38 A;  3Q8C A;  1F52 A;  3DBH I;  2BYE A;  2CU1 A;  3RFZ B;  4CHK A;  2EEL A;  2KK8 A;  2KWC A;  3N9Y C;  1IBX A;  5EE3 A;  3PHX B;  4N59 A;  3Q8B A;  2DX5 B;  3M63 B;  4BAX A;  5MPO A;  4XWT A;  3URY A;  2MP2 A;  2K5P A;  2L05 A;  3DVN V;  3TBL D;  1MHH E;  3DBL B;  1UUP A;  4FN2 A;  1ET6 A;  3ZNG C;  3MFG A;  1WJ6 A;  4ARI A;  1Y8R C;  1E9M A;  2WDT B;  4HKZ E;  1V5O A;  2WDV B;  1XCT L;  2KMA A;  2UYZ B;  1I35 A;  1DYQ A;  2N0S B;  1TGZ B;  4WUR A;  4FA6 A;  1ZXI A;  3RMK C;  2AQ2 B;  4FLH A;  1WF9 A;  3TJP A;  1HXY D;  1MHX A;  4W9L A;  2MX2 A;  4BBN C;  2TSS A;  3AH7 A;  2WQY B;  4NZL B;  2LRU A;  4TQ1 A;  4IOI E;  3P42 A;  5DPS A;  3VAW A;  4WWO A;  2KAJ A;  1RFK A;  3VQI A;  1R4N I;  3W1S A;  1L7Y A;  1C77 A;  2O2V B;  1E7P B;  2G45 B;  1HQR D;  2G4D B;  4E71 A;  3DVN U;  3C8Y A;  1R4N B;  2R2O A;  4JWS C;  4CYE A;  3RYT A;  5AUI A;  2N1W A;  1GG3 A;  2K39 A;  2JRI B;  2KX0 A;  2FBW B;  3PSE B;  3VFK A;  1QLB B;  1E8Y A;  2N4F A;  4ZHP A;  4HDQ A;  1YX6 B;  1FXI A;  4N58 A;  1TBE A;  1ZGU B;  1WM2 A;  2JZZ A;  3JW0 X;  3QCA A;  3TIX A;  3ZDM C;  4C4V B;  5D94 A;  2YEP F;  3AE2 B;  2GMI C;  4MEM A;  2Z59 B;  2J4X A;  1EF1 A;  2PPH A;  1FCC C;  2PVO D;  4HEA 1;  1M94 A;  2C7H A;  3RUL A;  1L6U A;  2EMS A;  3WAP A;  4RF0 A;  3CST A;  3AE8 B;  3A4R A;  4M0W A;  3AEE B;  4RM8 A;  2JF5 A;  1FM0 D;  4ZRQ A;  3JSV A;  1TZO A;  2N9L A;  2UU7 A;  3NJT A;  1F9J A;  3AI5 A;  3H7P A;  5IAA C;  1UBI A;  3P2B A;  3LJ3 A;  3LDZ E;  3IFW B;  3ZW3 A;  2PTL A;  4FJY A;  4LDT B;  1FIQ A;  1QT9 A;  2BS3 B;  4MGK E;  1V1P A;  1EO6 A;  3N1Z C;  2LUE A;  2LHD A;  2GRI A;  1J19 A;  1YN3 A;  2FID A;  2E3T A;  5IN7 A;  1ZPS A;  4MH8 A;  2G9H D;  5C3J B;  4NJ6 A;  3TL5 A;  5IP4 D;  3PV1 A;  1KLV A;  4ANV A;  1F0Z A;  1FD6 A;  2DAJ A;  3AEC B;  4IW0 A;  3AE7 B;  4ITK A;  4ZRJ A;  5T8I A;  3R7R A;  4OVZ A;  3MC0 B;  3WA0 A;  3Q2A C;  4W9H A;  3GZN B;  4C56 C;  1EU4 A;  1UGM A;  1CQV A;  5I4D A;  1BUI C;  2ZEQ A;  1WIA A;  3DHH C;  5G5H A;  3UIN B;  3H6N A;  4G11 A;  1JRU A;  4GGQ A;  3LB8 C;  2KC1 A;  2BVC A;  2FCS A;  1WYW B;  3B9J A;  5CHW A;  2JU6 X;  4QAY A;  3SFE B;  1LM8 B;  2QEJ C;  3AED B;  3KH0 A;  2KAC A;  3U4E G;  1FRR A;  2KFK A;  4G3X B;  3L0W B;  2WXL A;  1JAL A;  3CMM B;  3L16 A;  1N5X A;  3KQ4 A;  2IGD A;  1PUT A;  1FFV A;  1D5M C;  4KKJ A;  5LNK 1;  1KJT A;  5BYR A;  3WAL A;  5AUK A;  2MA9 B;  3RI7 C;  1L0X B;  2WX1 A;  2IO0 B;  4AUQ C;  2KQ7 A;  3Q8F A;  4MSQ B;  3AEB B;  2D07 B;  2KVR A;  2PVG C;  4MGI E;  3UGB B;  3EHV A;  1UEL A;  3I63 C;  1LQB A;  1RAX A;  3UF8 A;  1FMA D;  4RFB A;  2AWT A;  1X1M A;  4HXD A;  4ZYS A;  1WE6 A;  2MJ3 A;  1UBQ A;  4W9F A;  4HPM B;  3SR6 A;  1C79 A;  3RCZ A;  2L00 B;  4LNF A;  4EZL A;  5H8Y E;  4NAW B;  1PFD A;  2Y5C A;  1PYW D;  4GXB A;  2JVC A;  3CF6 E;  4DQO C;  1MFW A;  3A9K B;  1ENF A;  4FUL A;  4P6V F;  1HA5 A;  3AE3 B;  2WXH A;  2D10 A;  1K51 A;  3ETR A;  2BS4 B;  4FAD A;  5C1Z A;  2K25 A;  2K8H A;  5JZE B;  4KSK C;  2IY1 B;  4LLG M;  3V61 A;  2V3N A;  1C78 A;  3Q8A A;  4W9J A;  3E9S A;  1WR6 E;  4KGS A;  1V9J A;  4PT5 A;  1ZXH A;  1I4G A;  1EWC A;  2KLG A;  2D3B A;  4REZ A;  4KIK B;  4RCO A;  2N9E B;  2WXR A;  1HTO A;  1L4D B;  1WWT A;  1S3S G;  1V80 A;  1EM7 A;  3E56 A;  3ZXR A;  2ZCC A;  3ZNH B;  4B9K A;  3MC9 A;  1YIW A;  3ZUN A;  2KJR A;  2WXG A;  1E8X A;  3RN9 C;  3KLS X;  1KLG D;  2K3U A;  2KHW B;  4NAM A;  3EA6 A;  1WGR A;  3DWG C;  4JLC A;  1PGB A;  2RR9 A;  2L32 A;  2WXF A;  5E6N A;  1R4M I;  1SGH A;  2C5L C;  1KM7 A;  3JSV B;  4S0R A;  3X23 A;  1ZDX A;  2KFJ A;  4L1B A;  2HTH A;  4HCN B;  2AQ3 B;  4OW0 A;  2LEK A;  4FJZ A;  3U2S C;  3KVF B;  4YWG G;  3PRP B;  4XYC A;  1R4M B;  5J2R A;  1GB1 A;  2KQS A;  1HTQ A;  5CTR C;  3SU8 X;  1WGK A;  1V1P B;  2N7E A;  5EE1 A;  2M8S A;  4RH6 A;  1FNU A;  3WAO A;  2ON8 A;  2MJD A;  1ZDV A;  4IWQ A;  4XX5 A;  3AMZ A;  1P7E A;  4PYZ A;  2KN5 A;  1WMH A;  2MWS B;  1WY8 A;  3PVL A;  4XDD A;  4M8M A;  2KDF B;  5G55 A;  2K8B A;  4EFO A;  2KXJ A;  4X57 B;  5AZG A;  1V86 A;  2JT4 B;  3IXS A;  2K6Q A;  3T3O A;  2RD0 A;  1WXS A;  3AE5 B;  2LVO A;  1V1O A;  3RNG C;  2VH2 A;  3RUI B;  2WXP A;  1I4P A;  3GB1 A;  2LZ6 A;  3LXF A;  1MJD A;  4MT5 A;  2KNB A;  4HCP B;  3DHG C;  4G0N B;  4ANU A;  3AU5 A;  4TV3 A;  2L8J A;  3W9C B;  2BWF A;  4CO7 A;  2VZK B;  1N61 A;  4PK1 A;  1D3Z A;  2L3Z A;  2C9W B;  3IVF A;  2O6V B;  3AB5 A;  1YNT E;  5DPR A;  5BYS A;  4AQ7 A;  2INN E;  4EKU A;  4WJP A;  4O1N A;  3R2I A;  2J0M A;  2KVZ A;  4MGY E;  4OZB A;  5E6J A;  3ZQ4 A;  3C0R B;  2AL6 A;  1LO5 D;  4EZJ A;  4DWF A;  1PQS A;  1SIJ A;  2FCN A;  3APD A;  3EUB 2;  1V5T A;  4M00 A;  3MHS D;  1WZ0 A;  2KDI A;  4KGT A;  2V4L A;  4BKG A;  1AWD A;  3AXC A;  4B95 A;  3KYD D;  3A1Q A;  1J0G A;  3ZRC A;  2XEW A;  5CHV C;  4W9C A;  3EC8 A;  5EE0 A;  5CX3 A;  2PIA A;  4KX6 B;  1I7H A;  5BYQ A;  1LGR A;  4ASW C;  1OFF A;  2DHZ A;  2W9N A;  2WHI A;  5J17 A;  3V05 A;  5D3I B;  1XXG A;  4LTU A;  3QAQ A;  4HLE A;  5AZF A;  3DCG A;  2ICI A;  4A6Q A;  1WXV A;  1GAQ B;  1T0Q C;  1GPX A;  2WDQ B;  1B9R A;  2M56 B;  4PYU A;  3GE8 C;  3V62 A;  4GIV A;  2NCN A;  2NMQ A;  1VCB A;  1AN8 A;  3P63 A;  2JXX A;  2C60 A;  4BVU C;  4IUM B;  2MCN B;  1KF6 B;  3FIL A;  1J7B A;  4YTN B;  3DBL I;  3TEW A;  4YSY B;  1ZOY B;  2BF8 B;  2ZVO A;  2FE8 A;  2QSD A;  2YVC A;  2D2Q A;  1Z5S B;  4KKI A;  1Y56 A;  1E6E B;  2KJ6 A;  2WYQ A;  1SJH D;  4WAA A;  1N62 A;  2M0X A;  3I57 A;  3FAH A;  1YOV B;  5CHF A;  2I1J A;  1SB3 C;  1QOF A;  3VH3 B;  2BGF A;  2D11 A;  4A9A A;  1P0R A;  1TY2 A;  4XE0 A;  3UIO B;  2M19 A;  3CIR B;  1JWB D;  2MEK A;  2WNM A;  2JUO A;  1WJ4 A;  2WWZ A;  1SE3 A;  4W9G A;  1KH0 A;  4ANW A;  1C4C A;  3GE3 C;  2HJ1 A;  1WGH A;  2MBE A;  4UDU C;  4DHZ B;  2J52 A;  4MGZ E;  3P4Q B;  5L95 C;  2ZPY A;  1PDX A;  2QCZ A;  4YTP B;  3W5U B;  3BY4 B;  1MI0 A;  1E90 A;  2MQJ A;  5G2N A;  2BYF A;  1V6E A;  5H92 C;  2V0G A;  1QOA A;  5D7G A;  3R3M A;  5BMH A;  1Q10 A;  1RLF A;  1P9D U;  3BYT B;  4JQW C;  2KQ4 X;  4DK5 A;  1OQQ A;  2N9P C;  1F2R C;  4HWI B;  3IAS 1;  1LFD A;  2CKH B;  2KO3 A;  3AV8 A;  3N3K B;  1NEK B;  1L0V B;  2GOW A;  4BOZ B;  2C7M B;  2JXT A;  1BT0 A;  2ACZ B;  3UQA A;  2LGX A;  2MLB A;  5LLI A;  2Z0E B;  4K7S A;  4N6E B;  2IZV B;  1DOX A;  4KZ0 A;  1I4Q A;  5HG2 A;  2N9X A;  1UF0 A;  2MW5 A;  1SE9 A;  2K9X A;  2LWP A;  3EFC A;  2WXJ A;  4K3C A;  4JL9 A;  3FC4 A;  4NQK E;  3DOW A;  1MVK A;  5E6O A;  1C4A A;  2QJL A;  1E0Z A;  2KLC A;  1YQ4 B;  1EWY C;  1V49 A;  3BZD B;  1K52 A;  3N20 C;  3SHQ A;  1F2R I;  1P3Q U;  2NPT A;  1V81 A;  4OHJ A;  2GI9 A;  2WXO A;  2SEB D;  5JHA A;  2REX A;  2L0F A;  3B2G A;  4TMA B;  2HE7 A;  2ONQ A;  2W54 A;  3U7Z A;  2RSU A;  2WU2 B;  4HVB A;  1C9F A;  1OEY A;  2I1K A;  1WRI A;  1KLU D;  1XQQ A;  2IPK D;  3IHP C;  2GBJ A;  4II2 B;  1T5X D;  4RMA A;  1P7F A;  3NZU A;  4WQO B;  1J7C A;  2B76 B;  2HJ8 A;  3QAR A;  1UNS A;  5TR5 A;  3VTU A;  3GZN I;  1ACC A;  3VUW A;  2YEP B;  3P4S B;  1ET9 A;  2KWU B;  1SSN A;  3N30 A;  3SFD B;  2WP9 B;  4IM0 A;  3N32 A;  3SEB A;  4IM3 A;  3PT2 B;  3JYU A;  3IG3 A;  1DOI A;  1ZE3 D;  5FKA C;  5TSS A;  1L4Z B;  2RDB C;  2YLM A;  2M0A A;  4JGH B;  2RDH A;  4A3O A;  2EMT A;  3GOE A;  3OWE B;  1IYF A;  4K7U A;  4M8N A;  4URK A;  2Z8L A;  2MBH A;  2K6D B;  1SJE D;  4A20 A;  4GMV A;  1NI2 A;  2I2Y A;  2FUH B;  4IWO A;  5J18 A;  3MTN B;  3OLM D;  2JZP A;  4YXD B;  4OVU A;  1CMX B;  3IAM 1;  2IJ0 A;  4MEL A;  3ZNZ B;  1AW7 A;  4MDK E;  2KC2 A;  3AE4 B;  1C76 A;  3P4R B;  3W1S C;  3BVM A;  1P1A A;  2KJH B;  3RZF A;  3TEZ A;  3ZNI D;  2Y5P A;  1IBX B;  3UI3 A;  2ZJD A;  2R61 A;  1VZ7 A;  2LFI A;  3UQB A;  2MBB B;  4XGA B;  3PRE A;  2IGG A;  2MP2 B;  2V9H A;  4IDI A;  4DXF A;  3Q14 C;  3HIZ A;  2XBB C;  5G5G A;  2KT7 A;  2K8C A;  2KX3 A;  1WRD B;  2L0T A;  1DOY A;  1CK1 A;  1AAR A;  3ZJU A;  2G3Q B;  1XD3 B;  5LXI B;  1C1Y B;  4F8C B;  2BW2 A;  5C23 A;  5D6J B;  2LHE A;  4TQ0 A;  1NYQ A;  2LUM A;  2KTR A;  3RD2 A;  1XCQ L;  3BYY B;  2KAN A;  4GDK A;  1OEY J;  1OTR B;  2VH1 A;  2LMC A;  1T0R C;  2N9K A;  2J7Q B;  3PRM B;  1MG8 A;  1FNV A;  1DGJ A;  2DLB A;  2DYM A;  1FCL A;  2WXK A;  5E6P A;  2KKC A;  3PZD A;  1NYR A;  5JXV A;  2DEN B;  2NBV B;  1RRB A;  2EKI A;  1V97 A;  2VRR B;  2KWD A;  3AUL A;  5DPT A;  1JWS D;  3NVY A;  3ZJV A;  4LNI A;  5IKC M;  4YT0 B;  2DWQ A;  2B3A A;  2SAK A;  3RNA C;  2LXC A;  2AL3 A;  1YD8 U;  2LGD A;  4GB9 A;  1TTN A;  3M95 A;  4J3O D;  1CZP A;  2GBR A;  1JRO A;  2D3C A;  4B6W A;  1SE4 A;  4NQL B;  3VTV A;  1NEN B;  2BKR B;  3QJZ A;  3ZDT A;  3MP9 A;  3ECI A;  3OJ3 A;  3SD5 A;  5FK9 C;  4IG7 B;  1WR1 A;  3VHT C;  2JY6 A;  4DXG A;  3QX1 A;  4MJS A;  2J0J A;  3RT3 B;  1JW9 D;  2FAZ A;  4TKN A;  1PGA A;  5DPW A;  5KHQ A;  1KRH A;  3VR9 B;  1TIF A;  4LJO B;  1SBB B;  3VTW A;  4EEW A;  2NTS A;  2WU5 B;  2AQ1 B;  2N7D A;  2KDM A;  1OQR A;  2RPV A;  1LXD A;  2JPH A;  1NVI D;  1XT9 B;  4WH4 A;  1JML A;  4ACF A;  2NR2 A;  3BK1 A;  3QIJ A;  2DZK A;  3Q6B A;  1TZ1 A;  4M0W B;  2BB6 A;  1PGX A;  2NPT B;  3O13 A;  3QHT A;  2DZM A;  4MM3 A;  3H7P B;  4TSS A;  1S1Q B;  3VXW A;  4LJP B;  1E8Z A;  2J53 A;  1E8W A;  2KZR A;  3AEF B;  4OVV A;  1GUA B;  2O2V A;  3AEG B;  4GSW A;  2W55 A;  4DHJ D;  3DBR I;  5IOI A;  5GXG B;  4M02 A;  1KFY B;  2G1E A;  2M17 A;  2KDE B;  1B1Z A;  1RYJ A;  2R2Q A;  3KUD B;  3RPF C;  1TKG A;  2JZ3 B;  4J6I A;  3DBR B;  4BKS A;  4HJK A;  1EU3 A;  3ZTD A;  4N9F 4;  4W9I A;  4C00 A;  2L76 A;  2LJ5 A;  1I4R A;  4FHJ A;  4HPL B;  4NJC A;  1FEH A;  3B08 A;  3VVW B;  4M01 A;  4US9 A;  1UWX A;  1IGC A;  1N6Z A;  3N1X C;  2OJR A;  2IO3 B;  4FBJ B;  4WWM A;  1JWU D;  2IO2 B;  3AE9 B;  5HHD G;  3I9V 1;  2ZNV C;  2H89 B;  4K1R B;  2LXA A;  3NS8 A;  4LK0 M;  4G50 A;  4LCD E;  3RZW C;  2BS2 B;  2JYE A;  3PS6 A;  1V2Y A;  3PHW B;  1YJ1 A;  2LGI A;  1YJJ A;  3U52 E;  3W5V B;  4KZC A;  3WAN A;  2AEH A;  3T8M A;  5D2M B;  2LJI A;  3NS1 A;  3ZVV A;  4B0M A;  1YMH E;  1IPG A;  3PLU A;  2V3S A;  5FR6 A;  3P4P B;  3RNC C;  2RPQ A;  4F7Z A;  3QQ8 B;  2KMC A;  2KFK B;  2JSV X;  4JWU C;  1QZE A;  3IBE A;  2X8X X;  3HK0 A;  1ISN A;  2IBI B;  1N5W A;  3B0A A;  2UWQ A;  3T9L A;  2JYT A;  1NI3 A;  1YJI A;  3V6E B;  3MJ5 A;  2BTE A;  4ZOH C;  2GB1 A;  4US8 A;  3MHZ A;  3VH4 B;  4ANX A;  2WS3 B;  3AU4 A;  4MH0 E;  2L1A A;  2KYW A;  1WH3 A;  4A55 A;  1UD7 A;  4PS8 A;  4RGN A;  1SE2 A;  3R2T A;  5KHO A;  1YN5 A;  2HDE A;  3Q3N C;  4EOY A;  2LGS A;  2WXI A;  4XWW A;  3DPD A;  1NDD A;  4EZK A;  4WIP A;  2N1V A;  2KD0 A;  1QKZ A;  2MHJ A;  3W2D A;  3ZTC A;  1T0Y A;  3DQV A;  4YL8 A;  2ZNV B;  2LD9 A;  1FRD A;  4GN1 A;  5L83 A;  1FXT B;  3ZJT A;  3CSF A;  1IUE A;  1ESF A;  4WWP A;  3NRZ A;  4KSL C;  4HKQ A;  1I4X A;  2WX0 A;  1XLN A;  1JWA D;  3ML9 A;  4KDL B;  1GJZ A;  2XNA C;  4LNK A;  1BXT A;  4RNA A;  3IT6 B;  1C4P A;  3PO0 A;  2OJW A;  3OJ4 B;  4DDI D;  2NBU A;  2O6V D;  1I42 A;  2L52 A;  3L54 A;  4DXA B;  5HKH A;  3AM9 A;  3HUI A;  2OHF A;  3W1Y A;  2W3S A;  4HK2 A;  3DHI C;  3NZS A;  2IGH A;  3O65 B;  4KDI C;  1MPE A;  2V1Y A;  3K9P B;  5LXH A;  2FNJ B;  2CS4 A;  3NUH B;  2CJN A;  3HRD D;  4F1S A;  5JHB A;  1IP9 A;  1XLO A;  4MSM B;  4ZRI A;  3R7Q A;  3A33 B;  3APF A;  2L7R A;  3DBH B;  4AP4 C;  1A5R A;  1WX8 A;  1IGD A;  4KVG B;  1BML C;  1VD2 A;  2ZVN A;  4K7W A;  4I6L B;  2E6X A;  2Q5W D;  2MSE D;  3MJW A;  2C7N B;  1T0S C;  2I38 A;  4DDG D;  3V6C B;  2IND C;  4MJS B;  2AYO B;  2PE6 B;  3R66 C;  4B0E A;  4EE2 A;  1Q1O A;  1SXT A;  3KW5 B;  3PLV A;  3KWV A;  1GB4 A;  2KWV B;  2Y3A A;  4BBN F;  1C3T A;  4NAW A;  2XK5 A;  4HJG E;  4HDO A;  2GBM A;  2BWE S;  2BPS A;  2JQR B;  4K3B A;  3DDC B;  4WJO A;  1TT5 B;  1TS4 A;  3A9K A;  1WX7 A;  3N1Y C;  4GLS C;  3LYY A;  3GS2 A;  3A9J A;  4MM3 B;  2LGY A;  4AWJ A;  2QDF A;  4I6P A;  1FFU A;  1ZW7 A;  3EGR A;  3QK0 A;  1TS3 A;  4IWP A;  2GBK A;  1WSP A;  1P98 A;  2PW9 A;  3WIM A;  4A8X C;  2DBY A;  2KOX A;  4A90 A;  4BKT A;  1K8R B;  2M1M A;  2BBC A;  3ENE A;  4AJY B;  4RGT A;  3CWI A;  2JWZ A;  1WMH B;  3DVG Y;  3Q3O C;  4RGM A;  4P1B C;  2PLP A;  4KIK A;  3R8B A;  1FPY A;  4HRO A;  2Y5B B;  4LNO A;  2LI5 A;  1SIF A;  1K53 A;  1QOB A;  3C19 A;  4GOC A;  4WJN A;  3BK2 A;  1ROE A;  4H2A A;  2LAS A;  2DYB A;  5EDS A;  2MJE A;  1HZ5 A;  2K0P A;  2V3P A;  2V4I B;  3ZXV A;  1OGW A;  3ALB A;  3H9D A;  1N60 A;  2ZW0 A;  1YX5 B;  3A4S C;  2GLS A;  3NZ3 A;  2LRW A;  1ZP0 B;  2CR5 A;  1TY0 A;  3WCQ A;  4HPP A;  1HEZ E;  2ZPN A;  3B2F A;  5AEK B;  2Z0D B;  3I5J C;  3BWU D;  1Q5W B;  2D3A A;  2HD5 B;  3APC A;  2ASQ A;  2K1F A;  2QC8 A;  1D5X C;  3NVV A;  4C7Z A;  4ICV A;  1J7A A;  4EUT A;  3L13 A;  3Q8E A;  3HHM A;  3RNF C;  2WDR B;  5BMI A;  1ZUD 2;  3K9O B;  3FKY A;  4JX1 C;  3HM6 X;  4FXC A;  3PRZ A;  2WXM A;  1E10 A;  3DVG X;  1H4R A;  4BKS D;  3VUY A;  2MBO A;  2H88 B;  3A1Q B;  3JVZ X;  3ZGZ A;  1M4V A;  4FJV B;  2INC C;  2PKO A;  1A70 A;  1NBF C;  3I3T B;  2NBW B;  1RFA A;  1JCK B;  1Q0W B;  4OZC A;  5BO4 B;  3AEA B;  4IKG A;  3KUC B;  3KWL A;  1EUV B;  2WXN A;  5HI1 A;  1TS2 A;  4NY0 A;  1L0Y B;  4W9D A;  2CJO A;  3VRA B;  3NOB A;  1KTK A;  3HVD A;  3H1U A;  3TEY A;  2NS5 A;  3J9C A;  3EFU A;  1WFY A;  2CHX A;  3ZO5 B;  2RDG A;  4NPN A;  2NTT A;  1TJE A;  4NJ7 A;  2BQQ A;  2QHO A;  2O6V A;  2KDB A;  3PTF C;  4JIO U;  3VR8 B;  5BMG A;  1CJE A;  2BT6 A;  4XZ4 A;  3NVZ A;  1N63 A;  1L2N A;  2ZZP B;  1RWS A;  2A5U A;  4LDT D;  1XO3 A;  3FIL B;  4RGO S;  2IYD B;  2FCQ A;  2BB5 A;  4JPS A;  3ZLZ A;  4AOF A;  2A4Z A;  3ZIM A;  1D6E C;  1QF6 A;  1SEB D;  3L17 A;  4WQM A;  1KOT A;  1YQB A;  2RMM A;  3NHE B;  3EEC A;  1AYF A;  3V60 A;  4GDL A;  1ZKH A;  1WGY A;  2IY0 B;  5FR3 A;  2LVP A;  4GU2 A;  2G4S A;  3TCA A;  2K22 A;  1JQ4 A;  1WM3 A;  1WX9 A;  2L83 A;  2MRP A;  1F1H A;  1WXQ A;  3T3N A;  2D3G A;  3QWZ B;  3KYC D;  3H7S A;  2WXQ A;  1TKE A;  2PMV A;  2DZI A;  1T3Q A;  3GP7 A;  1V8C A;  5JH5 C;  1WYG A;  4TUU A;  3VRB B;  2DZJ A;  2W82 A;  2XN9 C;  4YSZ B;  4DHZ E;  3QC8 B;  4D2K A;  4WAF A;  1J8C A;  1XLQ A;  3OG5 A;  4IC7 B;  3AN1 A;  5D3D A;  2LVQ A;  1TYG B;  4KGR A;  2XK5 B;  1XF5 L;  3ML8 A;  2ZCB A;  3IT4 B;  4RM9 A;  1WGD A;  4WWN A;  1WXM A;  2WLB A;  3L10 B;  3ZRF A;  3UIP B;  2KTF A;  2AX5 A;  1WE7 A;  3NVW A;  3A9J B;  4DHJ B;  3SDL C;  4YSX B;  2KMM A;  2QIE B;  1OQY A;  2MBQ A;  4A3P A;  3S2A A;  1FNW A;  3AE6 B;  3PZ7 A;  3ZKJ C;  2ZW1 A;  2OOB B;  5GMV A;  2JWU A;  4W9E A;  3ONS A;  1R7S A;  2PJH A;  3L4P A;  3ZYY X;  1D5Z C;  3BVG A;  2W3R A;  1GNU A;  1VR9 A;  1WI0 A;  3RNE C;  1XLP A;  1UWM A;  2JX5 A;  3L08 A;  1E7V A;  3QA8 A;  4BFR A;  3Q3J A;  1E7U A;  1FXA A;  2IO1 B;  2CU3 A;  2FIF A;  3X0W A;  2HTM E;  3DWM A;  2BYV E;  4LNN A;  3HM3 A;  1QIL A;  4PS7 A;  2BYT A;  4RF1 A;  1WXA A;  1GC6 A;  1YQ3 B;  3DBS A;  4YTM B;  3TUO A;  2PE9 A;  2DYO A;  3B1L X;  5DCN A;  4USA A;  3Q3M C;  3MC8 A;  3Q69 A;  3PZ8 A;  4PS3 A;  1QQR A;  1GOZ A;  4NNJ B;  1HZ6 A;  1UZX B;  3HVZ A;  4C7Y A;  4K81 A;  4KV2 A;  3KUZ A;  1VZ6 A;  1F77 A;  4C80 A;  1L6V A;  2DNF A;  4ICU A;  4S17 A;  2WGS A;  3ABV B;  1MG4 A;  1VZ8 A;  2FCM A;  4C4V A;  2KN4 A;  3RNB C;  3VDZ A;  1EF5 A;  1SF0 A;  1E5W A;  2FUG 1;  2N7J A;  4ZYN A;  1FO4 A;  4R3D A;  4FHK A;  3PGE A;  4ZHO A;  1WZ3 A;  4JE3 B;  1WJN A;  4P7I A;  2QIL A;  3M62 B;  3P1M A;  3U30 A;  3Q3F A;  4ARC A;  4OZA A;  4HRS A;  4AS1 A;  3BII D;  3U7D A;  4E74 A;  4XDC A;  4L2Y A;  3BIN A;  3H8H A;  2INP E;  2QMT A;  3OAW A;  3NY5 A;  2CHZ A;  2MH7 A;  1VRA B;  2M4N A;  1RM6 C;  2D5G A;  2DAF A;  3AE1 B;  5EE9 A;  4BOS C;  2IDY A;  3TMP B;  1U4A A;  1D4B A;  3D32 A;  1VDV A;  1XEE A;  2GBN A;  2RGF A;  4ZRP A;  3U8Z A;  3WAM A;  3TSS A;  1JWM D;  2OED A;  3TEX A;  4ZDV A;  1GC7 A;  1I4H A;  4II3 B;  4ZRK A;  1STE A;  1JRP A;  4BZA A;  1UGJ A;  1TKY A;  1VJK A;  5AZH A;  3V3X A;  3NG0 A;  2J42 A;  2NVU I;  4P1C C;  1HE8 A;  1L5P A;  1YN4 A;  4GDL B;  1T6B X;  5HFY A;  5IO9 A; 
#chains in the Genus database with same CATH homology
 3RNC C;  2IND C;  3N1Y C;  3GE3 C;  1T0Q C;  3Q14 C;  3N20 C;  3I63 C;  3Q2A C;  3Q3N C;  3GE8 C;  3Q3O C;  3RNG C;  4P1B C;  2INC C;  3RNF C;  2RDB C;  1T0R C;  3DHI C;  3Q3M C;  4P1C C;  3RMK C;  3DHH C;  3RI7 C;  3RNB C;  3RNA C;  3RN9 C;  3RNE C;  3N1X C;  3DHG C;  3I5J C;  1T0S C;  3N1Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...