3I63C

Peroxide bound toluene 4-monooxygenase
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
82
structure length
82
Chain Sequence
AFPVHAAFEKDFLVQLVVVDLNDSMDQVAEKVAYHCVNRRVAPREGVMRVRKHRSTELFPRDMTIAESGLNPTEVIDVVFEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene-4-monooxygenase system protein A
publication title Crystallographic and catalytic studies of the peroxide-shunt reaction in a diiron hydroxylase.
pubmed doi rcsb
source organism Pseudomonas mendocina
molecule tags Oxidoreductase
total genus 23
structure length 82
sequence length 82
ec nomenclature ec 1.14.13.236: Toluene 4-monooxygenase.
pdb deposition date 2009-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3i63C00
3RNGC 2INCC 3RNCC 2RDBC 3GE3C 3N1XC 3RNFC 3I5JC 3DHIC 2INDC 3N1YC 3RN9C 3RMKC 3RNBC 1T0RC 3I63C 3DHHC 3Q3OC 1T0SC 3Q3NC 3RNEC 3N1ZC 4P1BC 1T0QC 3RNAC 4P1CC 3Q14C 3Q3MC 3Q2AC 3RI7C 3N20C 3GE8C 3DHGC
chains in the Genus database with same CATH superfamily
2IO2B 4RCOA 1ACCA 1UZXB 1IBXA 2N4FA 3PREA 4AQ7A 2ZNVC 1ET9A 2KQ4X 4HWIB 4LNNA 5MPOA 1TKYA 4US8A 3Q69A 2C7HA 4IM2A 4CHKA 4LTUA 4WWNA 3NS1A 3A9JA 2AQ3B 1TY0A 2L0FA 4A6QA 2PVGC 2LGDA 3ETRA 1VJKA 4N58A 2EKIA 1WGKA 5HHDG 4A20A 3V6CB 2JSVX 2E3TA 1GNUA 3ZIMA 3A9JB 3PVLA 1F2RI 2Y5BB 2QILA 2JY6A 4NPNA 4TSSA 1LM8B 3VAWA 2X38A 3ABVB 1TIFA 4K7UA 2OHFA 4J6IA 3UQAA 2B3AA 4MH8A 1L2NA 2MJ3A 3AU5A 2AL6A 3RI7C 2LJIA 2LRWA 3GB1A 1MHHE 1WR1A 1DOXA 2XEWA 4AJYB 3A33B 4JLCA 5JHBA 3QAQA 1JW9D 4HEA1 2K9XA 2QIEB 5GXGB 4A8XC 5L83A 3WANA 3PHXB 5IP4D 1VR9A 1HTOA 2KQ7A 1WGGA 2A5UA 2KFJA 3C0RB 1I4HA 3K9OB 4B9KA 3ZRFA 3T3OA 4RF0A 1LO5D 2J0MA 2BWFA 1F77A 1V2YA 5J17A 4M8NA 5C3JB 3AXCA 1MHXA 3NVWA 4W9DA 4DXGA 3M63B 4E74A 3KQ4A 1C1YB 1V5OA 3GZNB 1J7BA 3RZFA 1RM6C 1QOFA 3H7PA 5CHWA 5IKCM 4KZ0A 1I4XA 1XLQA 5L95C 2KTRA 4JGHB 3UINB 1AW7A 1QZEA 3VR8B 5HKHA 1Q1OA 3MC8A 3ZXRA 2O2VA 2KWCA 1H4RA 2KTRB 3I3TB 2BGFA 5KHOA 4IWQA 3RNGC 2LUMA 1P1AA 2O2VB 4DDGD 2WU5B 4FJZA 3H1UA 4EFOA 1FNUA 4S0RA 1WM2A 3MJWA 3ZNHB 4P1CC 2JZPA 3H6NA 2FUG1 5FR6A 5BMHA 4HDOA 3VTUA 1FRDA 2N1VA 2GBJA 2RGFA 3VH3B 4UDUC 2QDFA 3D32A 2GBRA 4P1BC 1T0QC 1TYGB 5DPRA 4YL8A 1F2RC 1GG3A 1NBFC 3P4QB 4NY0A 4RF1A 1C4PA 2GLSA 1SF0A 2MJDA 3ML8A 4KV2A 4NZLB 3SEBA 4HK2A 2GOWA 4BKSD 2HDEA 1UD7A 4XZ4A 3W2DA 2C7NB 2V3NA 3RFZB 3CF6E 4JWSC 4P6VF 5LNK1 5AUKA 5D3IB 2H89B 2JU6X 1UWXA 1K51A 1GPXA 3QWZB 1QF6A 3Q8BA 3RPFC 3PRPB 3JW0X 1UF0A 3KUZA 1U4AA 3DBLB 4ZHOA 2VH1A 3N32A 2NCNA 4N6EB 2J42A 2MBEA 4ASWC 3RMKC 2LVPA 1YX5B 3RUIB 1XD3B 3AM9A 1RRBA 3SDLC 3IAM1 1M94A 3VRBB 1N6ZA 1HTQA 3VTWA 1FIQA 4EZKA 1NI3A 1ZGUB 2INCC 4PS3A 5I4DA 3BK2A 3L4PA 1E90A 2KDIA 2VZKB 2LI5A 3OAWA 3A4RA 5BYRA 3WIMA 2QEJC 2EMSA 4IM3A 2IO3B 3ZNZB 2W54A 1FO4A 1TBEA 1CQVA 2TSSA 5DPWA 2OOBB 2WXIA 2NTSA 2JWZA 3KH0A 4L23A 1KLVA 2LJ5A 1N5XA 4EEWA 1R4MB 3PLUA 3RNBC 3H8HA 2O6VD 2W3RA 3B2FA 4WJNA 3DBSA 3TCAA 1S3SG 3P4PB 4JWUC 1WMHA 4P7IA 1FM0D 2IJ0A 4I6LB 1UBQA 3VQIA 3X23A 2IGDA 2MRPA 1WMHB 2AQ2B 2MBHA 3DHHC 1FD6A 1HQRD 2L52A 1WGHA 3NVZA 1E8YA 2BT6A 1PYWD 2M1MA 1EF1A 4LJOB 3DHGC 1R7SA 2GB1A 3UI3A 2NMQA 2PLPA 3L13A 3M95A 1C4CA 2DNFA 4NNJB 1FXTB 1J7AA 3Q8AA 1XXGA 4WAAA 1R4NI 3PZDA 4YTMB 3DBRI 2JZZA 4K7SA 3DOWA 1MG8A 2I1KA 5E6JA 3EHVA 2B76B 4JQWC 1L6UA 2ZPYA 4B6WA 1WJ4A 1AARA 5EDSA 4BBNF 2ZW1A 2FUHB 3ZJTA 4II3B 5C23A 2J4XA 4C7ZA 1S1QB 1Q0WB 1D3ZA 4REZA 2UYZB 3HK0A 2K6QA 3GE8C 2BPSA 2OJRA 4WWMA 3O13A 2Q5WD 2JYEA 2MH7A 2L7RA 4MDKE 4WJQA 4YTPB 4HKZE 1WJNA 3DWGC 1TTNA 3Q3NC 4YSXB 4YXDB 1WGRA 4F7ZA 3WAPA 2BF8B 4K1RB 1OQRA 1SXTA 4KSLC 2Y3AA 5C2TB 3EUB2 4ANVA 2IBIB 3V62A 4RGNA 2IGHA 3DPDA 1V81A 1E8ZA 2LUEA 5EE9A 3A9KB 2W82A 3DWMA 4A3PA 3FILA 1FXAA 4WWOA 3ZDTA 3TIXA 3R7QA 3FILB 4MGKE 1MI0A 3SFDB 1K50A 3NUHB 5FR3A 4LDTD 1ZDXA 1XT9B 3DBHB 2ACZB 1NEKB 4BAXA 4E3CA 3QCAA 2WXHA 1YMHE 2BYVE 1KLUD 3APFA 4CO7A 4DQOC 4OVZA 1JQ4A 4LNFA 3ZKJC 4GOCA 4XC2A 2WU2B 4FN2A 4HJGE 3AECB 2PE6B 1P7EA 3ZO5B 1SGHA 1WR6E 2NVUI 3Q8CA 3P2BA 4M8MA 5AEKB 3APDA 3VTVA 2QC8A 4NQLB 4NJ6A 5HI1A 4DHJD 2W55A 3P4SB 3MHSD 1B1ZA 4MACA 2KVRA 2PKOA 4X57B 1JALA 2M17A 4XWWA 3R66C 1F9JA 4G3XB 4TUUA 4FBJB 2SEBD 1Q5WB 2R2QA 4GDKB 3TBLD 2L32A 1WXMA 5HG2A 3QK0A 2AYOB 2YLMA 2V1YA 2G3QB 3IT6B 1C77A 2Z0EB 3N20C 4R3DA 4ZYSA 4FHJA 2INNE 1ENFA 1LXDA 4MELA 3NS8A 3Q8FA 4ICVA 3PTFC 1T3QA 3U4EG 2HJ1A 1UUPA 2N7EA 1YN5A 4YTNB 5AZHA 3RULA 4RH6A 3N3KB 2OJWA 1V1OA 1AWDA 1V6EA 4GLSC 3ZVVA 4PS7A 4WJPA 1AN8A 1VCBA 3AEAB 4TQ1A 4KZCA 4ANXA 2Z59B 3ML9A 3KVFB 3N9YC 2C9WB 2SAKA 1SBBB 1WXAA 4GSWA 2DENB 4II2B 4RM8A 2WP9B 3TMPB 5FKAC 3O65B 1YIWA 1JRPA 1YD8U 4DXAB 1WI0A 1F52A 2KC1A 2WXFA 3L08A 2KVZA 2BKRB 3Q2AC 2WDVB 3U8ZA 1P7FA 4E71A 3NOBA 2ZCBA 1KFYB 4TQ0A 2KN4A 3RNCC 3DHIC 3RD2A 4HJKA 1VZ6A 2K0PA 1T0RC 3PLVA 1FEHA 2AX5A 1WJUA 1NDDA 1G6JA 4OVVA 1E7UA 1IBXB 2C7MB 2IZVB 3R8BA 1WF9A 1CK1A 3QX1A 1IGDA 2K6DB 2JRHA 3R2IA 4WAFA 4PS8A 4L1BA 1UGJA 3S2AA 2MWSB 3TEYA 1JWUD 3BZDB 4B0EA 1YJIA 3ALBA 1OQYA 1FMAD 4ZRQA 3MTNB 4KGSA 2FAZA 2IPKD 2MEKA 2KZRA 2WWZA 3HRDD 5D6JB 3PO0A 3DVNU 3ZDMC 1JMLA 3PRZA 3MC9A 3ONSA 4Q2JA 2RDHA 1L5PA 2MA9B 3P42A 4J3OD 3MFGA 4L2YA 3P4RB 2AL3A 5JXVA 4KGTA 2RPQA 2NTTA 2LMCA 3VVWB 2KN5A 3DVNV 2ZCCA 4DHZE 3ECIA 2G4SA 3NG0A 1CMXB 2ZVOA 3LB8C 1VD2A 1I42A 2C5LC 1XLPA 4B95A 2V4LA 1E7PB 3NVYA 4NAMA 1YQBA 3X0WA 5AZGA 4JX1C 3VFKA 4K7WA 5IAAC 4GMVA 1SIJA 2LXAA 2LGXA 4EE2A 1OTRB 3B08A 3PPAA 2ZJDA 1RYJA 2MX2A 1KRHA 2AWTA 2BS4B 4MGZE 2ZW0A 2KMMA 3AV8A 4ZRIA 1TS3A 4D2KA 1XF5L 4IC7B 2JQRB 4A3OA 2JX5A 4HKQA 2HTHA 4FLHA 2KFKA 3BVMA 2IYDB 2REXA 3NRZA 4ZOHC 3H7PB 1WM3A 2IGGA 1KTKA 4AS1A 2HTME 1E7VA 3FAHA 1PGAA 1DOIA 3HM6X 2K5PA 2FNJB 1C78A 1UNSA 4G11A 3ZXVA 1XO3A 1T0SC 2NR2A 4MT5A 3CSTA 1WX7A 4RGTA 2WGSA 3TEWA 2R2OA 2I1JA 1MJDA 3Q3MC 2L0TA 3U52E 1KH0A 2KACA 2BW2A 2FCMA 2EELA 3PZ7A 2M0AA 2EMTA 2WXPA 4W9LA 3NJTA 2DYBA 2LFIA 4US9A 2IDYA 2H88B 2R61A 4K3CA 2PE9A 1JWBD 1SIFA 5LLIA 4DXFA 5JHAA 1P9DU 1N62A 2LRUA 2UU7A 2K8CA 5KHQA 4FA6A 1N5WA 4EZLA 3W9CB 2DAJA 2M56B 4F1SA 1I35A 1NVID 2D3BA 1VRAB 2KAJA 3PHWB 2K3UA 4GDLA 2BVCA 4KVGB 4IWOA 1KOTA 3L17A 4GU2A 2VZKD 4A90A 4LJPB 1FPYA 1PDXA 2N9LA 3W5UB 1ZW7A 2NPTA 3IAS1 3KLSX 3V6EB 3VH4B 2JT4B 2JWUA 1TY2A 1PGBA 2INPE 1JRUA 3IBEA 3Q6BA 2K25A 1V86A 2NPTB 2MP2A 2Z8LA 3DVGY 1YX6B 3ZTCA 3QIJA 3IFWB 1WXSA 3MC0B 2DZIA 3AE8B 1WE6A 2LHEA 5BYSA 2MP2B 3CWIA 3EECA 5BMGA 2I2YA 2IO0B 3KWLA 2MSED 1TT5B 3TL5A 2JYTA 2V9HA 2PVOD 1C76A 5D7GA 4ZHPA 2QHOA 1L4DB 4C56C 4C80A 4MEMA 3EA6A 2ICIA 4JE3B 2RPVA 1LFDA 1WFYA 3VDZA 4W9HA 4ZRKA 3TEZA 5BO4B 4BKSA 1GAQB 1JWAD 4QAYA 2I38A 2LASA 1EWYC 2V3SA 2JUOA 1HEZE 1WSPA 2MLBA 2ZNVB 2DZJA 2MHJA 3OWEB 1EF5A 3AEGB 4M0WA 2KMCA 3Q3FA 5EE3A 5CHVC 3AEEB 4PT5A 1FCLA 4KIKA 3OJ4B 2M4NA 3GZNI 3K9PB 2KYWA 4M0WB 2KWUB 2LHDA 5IOIA 1UELA 3BYTB 5TSSA 2N9PC 3C19A 4XDCA 5E6OA 3IXSA 4KIKB 2BYFA 4C7YA 4RGOS 3LDZE 3ZLZA 2JVCA 1E5WA 4IDIA 1V49A 1QOAA 4LK0M 2PJHA 4DWFA 3RZWC 3V05A 1WE7A 1YN3A 3T3NA 1V97A 4KKJA 2KWDA 2RSUA 4FJVB 2G1EA 5D2MB 2WLBA 1C4AA 3ZW3A 1RFAA 2J0JA 2CR5A 3LXFA 5H8YE 3TEXA 2V0GA 4PYZA 5BYQA 4A55A 4I6NB 2KXJA 2KX0A 1YQ4B 3RYTA 5E6NA 3VUXA 2G4DB 2LGIA 3Q8EA 4PK1A 1N61A 1BT0A 4F8CB 2LD9A 3NVVA 4ICUA 5TR5A 2KWVB 3ZRCA 4BKGA 3UIPB 2O6VA 1KJTA 1NENB 4IWPA 2PW9A 2Z0DB 1VZ8A 3R7RA 4ANWA 1TS5A 1SSNA 2KLGA 1XEEA 5IO9A 1L0VB 2ONQA 2INDC 1JWSD 2JRIB 1SE9A 1YN4A 2YEPB 3MHZA 3N1ZC 1GJZA 1ZXIA 4C4VA 3Q14C 1WXVA 4NAWA 2N9XA 4EKUA 3QHTA 2A4ZA 3AEBB 2D5GA 4C4VB 2NS5A 1Z2MA 2PTLA 4YSYB 2QCZA 1XLNA 5G2NA 3VR9B 3M62B 1WZ3A 4RFBA 1EM7A 1JWMD 1FFUA 1FRRA 2QJLA 3DBLI 4YT0B 1E8XA 1STEA 4W9JA 3RT3B 3WALA 3OJ3A 1WJ6A 4LLGM 1WIAA 2NBWB 2MCNB 2FCNA 5DPTA 2DLBA 3FKYA 2WXRA 1QKZA 2FIFA 3SHQA 3ZJVA 3L10B 4OHJA 3DCGA 2CHXA 1T0YA 1WYWB 2DAFA 3AEFB 1ESFA 2MJEA 4NQKE 3LYYA 4B0MA 1D6EC 2IO1B 1ZDVA 3MJ5A 2L00B 1EUVB 1WRDB 1Y8RC 2YEPF 4K81A 2DZKA 4KDIC 3P63A 1VLBA 2LXCA 2RD0A 2X8XX 2WXLA 1V5TA 3AE1B 2KDFB 4WWPA 2PPHA 3WCQA 3AE4B 2DYOA 4O1NA 1R4MI 2GI9A 3W1YA 3AU4A 3HIZA 2FCSA 3PGEA 2LWPA 3AE2B 5J2RA 2KX3A 3PV1A 4HRSA 2KJ6A 3GS2A 1GOZA 3Q3JA 2MBOA 3L0WB 1P98A 5T8IA 3ZGZA 1UBIA 3AE9B 4IG7B 1TS2A 1MPEA 4DHZB 2FCQA 1QOGA 1KLGD 3APCA 1DGJA 1WGYA 2WXJA 2WNMA 4XE0A 2Y5CA 3AI5A 4JIOU 4LNIA 2E6XA 3V3XA 3GOEA 1XLOA 4IKGA 2XK5A 2BWES 1H8CA 1KF6B 1BMLC 4TMAB 3FC4A 2XK5B 2GBKA 3AE3B 1EWCA 1ZXHA 1RAXA 3OLMD 3B1LX 3QQ8B 1L6VA 3GP7A 4N9F4 4EZJA 4GGQA 3BWUD 3HM3A 5FK9C 3T9LA 2WDTB 2MQJA 4XGAB 1WXQA 1M4VA 1IPGA 4RGMA 3WA0A 2XN9C 1WYGA 4TV3A 1DYQA 1SEBD 2FE8A 4W9IA 1OFFA 3CIRB 2M0XA 1WY8A 1RWSA 2CJNA 1A5RA 1OEYJ 1IGCA 3PRMB 3DVGX 2L83A 1I4QA 3UIOB 5AZFA 4GXBA 2QMTA 4ARIA 4K3BA 2KK8A 3IHPC 2YVCA 5AUIA 1E0ZA 2J0KA 2JPHA 3Q3OC 1XQQA 4BOZB 1HZ5A 2IY1B 2V4IB 2HD5B 3UQBA 2WDQB 1BXTA 2DWQA 4OW0A 1IUEA 2LEKA 2N9KA 4AJWA 4W9FA 1RLFA 3A4SC 1C9FA 1ISNA 4WURA 2CKHB 1GC7A 3AH7A 1ZKHA 4LNKA 4BOSC 1EU3A 1RFKA 2JF5A 4KGRA 4BBNC 4PYUA 2ZZPB 3N30A 3ZYYX 3DBHI 1I4PA 1XCQL 1NYQA 5JZEB 2M19A 1E10A 4NJ7A 3L54A 2EKEC 4JL9A 1QILA 1V9JA 1MVKA 2K22A 2CHWA 1QOBA 1YNTE 5BMIA 3EFUA 2ASQA 1WH3A 4FXCA 4W9CA 2L3ZA 2PMVA 4OZAA 1WRIA 3U2SC 3B0AA 4OVUA 1Q10A 2RDBC 2MBBB 4GB9A 4WQMA 2RDGA 3J9CA 1HXYD 1QT9A 4RMAA 1SE4A 1N60A 3ZTDA 4W9GA 3W1SC 1WX8A 3M3JA 3VRAB 1I4RA 2KJHB 3JYUA 4HCPB 4OZBA 2BS2B 2BYTA 1ET6A 1L7YA 2KMAA 2KJRA 3N1YC 5D94A 2WXQA 4ITKA 3U30A 4W9KA 3MP9A 3BVZA 3OG5A 4YWGG 5DCNA 1TJEA 3B2GA 2LVOA 2C60A 4AOFA 3AE6B 1F1HA 2KFKB 1K52A 3CMMB 1Y56A 1VDVA 1LQBA 1HZ6A 1CJEA 3SU8X 5J18A 2G45B 3BY4B 4GN1A 2KC2A 2J52A 4C00A 2NBUA 2N9EB 4ANUA 2CJOA 2ZPNA 4AWJA 1JROA 1C3TA 3IT4B 3VHTC 2KLCA 2K1FA 1V1PA 1ZE3D 1EO6A 1B9RA 3ENEA 4EUTA 2AEHA 3AMZA 1MFWA 3RNAC 4XWTA 4XDDA 2W9NA 3IVFA 1V1PB 2D3CA 4CYEA 2KDEB 2ON8A 4LCDE 3ZNID 1R4NB 2N1WA 3DBRB 2PEAA 3BIID 4FULA 2LGSA 3V60A 2K39A 3VUWA 1J19A 3C8YA 3EGRA 3L16A 1MG4A 5EE1A 1LGRA 1P0RA 4N59A 3E9SA 2MW5A 4GDLB 2DBYA 2JXXA 3EFCA 1SJHD 3QJZA 2DYMA 2QSDA 1FNWA 2BYEA 1TGZB 3AB5A 1Z5SB 1DOYA 4RM9A 2KO3A 4KDLB 4BFRA 3URYA 5CX3A 4AP4C 3CSFA 4GIVA 4IW0A 1D5XC 4G50A 1V8CA 5IA7A 2N7DA 3PT2B 1K8RB 2L76A 2L8JA 1VZ7A 4MM3A 3I57A 2HE7A 2K8HA 1I7HA 4MM3B 1OEYA 1OGWA 2KNBA 4WQOB 2FIDA 3KWVA 3TSSA 1E8WA 1V80A 2GMIC 3AEDB 4URKA 2BB6A 3AE5B 2BQQA 1TS4A 2WXOA 2Y5PA 4USAA 1CZPA 2M8SA 1GB4A 3U7ZA 3E56A 3HVDA 2D3AA 2XBBC 2KANA 1ZPSA 2LGYA 2KOXA 1GUAB 4HROA 3NZUA 1TKEA 2WHIA 4DK5A 2BTEA 4HPPA 1QQRA 5G55A 1FFVA 3PZ8A 3RNEC 2HJ8A 4HVBA 2GRIA 2WS3B 3HVZA 2KTFA 5LXIB 5E6PA 4A9AA 3GE3C 3ZQ4A 2J53A 1YQ3B 3NY5A 4G0NB 1P3QU 4HCNB 2DZMA 1NYRA 1ROEA 2D07B 2GBMA 1AYFA 5CTRC 3ZNGC 1E9MA 2CU1A 4HPLB 4CQNA 2WXMA 4S17A 1SB3C 3NZ3A 2V3PA 5DPSA 1YJJA 2FBWB 2DHZA 3KW5B 2D2QA 4ZYNA 3W1SA 2IY0B 1N63A 2WQYB 1IYFA 1ZUD2 4LNOA 1D5ZC 3BVGA 3VXWA 3ZJUA 3A1QA 4HPMB 2O6VB 1UWMA 1PFDA 3WAOA 1J0GA 2D11A 1SJED 1FCCC 4IM0A 4BVUC 2BS3B 2KKCA 2J7QB 2CU3A 3NHEB 3BINA 3A1QB 4IOIE 4W9EA 2LVQA 3P1MA 2WXKA 3JSVA 3R3MA 3BYYB 1QLBB 2KQSA 2AQ1B 3JSVB 4MJSA 4MH0E 4NAWB 2D3GA 1HE8A 2KDBA 2K8BA 1J7CA 1HA5A 3ZUNA 3DDCB 1L0XB 4MJSB 5GMVA 1XCTL 5D3DA 5G5HA 4M00A 4MGYE 4ZRJA 2RR9A 3KYCD 3U7DA 3AE7B 3B9JA 3N1XC 2LZ6A 4ZRPA 1YJ1A 4NJCA 3H9DA 1TZOA 1T5XD 3QC8B 4XX5A 4MSQB 1NI2A 1TZ1A 1YOVB 4FJYA 3A9KA 1PUTA 4ZDVA 1PGXA 3IG3A 3QA8A 3PS6A 1IP9A 4ACFA 3RN9C 1A70A 2D10A 1GB1A 2NBVB 2PIAA 1WWTA 2WXNA 3HHMA 3PSEB 5JH5C 4YSZB 2WDRB 2WXGA 4M02A 1BUIC 4BKTA 4WH4A 4DBGA 4XYCA 1D4BA 2ZEQA 2OEDA 5LXHA 4HXDA 3KYDD 1SE2A 2WX1A 2WYQA 1FXIA 3HUIA 3TJPA 3TUOA 5H92C 3I63C 1F0ZA 1D5MC 1GC6A 4IUMB 4WJOA 3SD5A 2BBCA 5EE0A 2JXTA 2KT7A 3BK1A 2KHWB 3AULA 1I4GA 3UGBB 1WZ0A 2XNAC 1UGMA 1WX9A 3SR6A 4FADA 2N0SB 2DX5B 1C79A 1L4ZB 2W3SA 3WAMA 3NZSA 4FHKA 5CHFA 2UWQA 4HLEA 3T8MA 2BB5A 4WIPA 4M01A 5HFYA 4GDKA 3UF8A 4LDTB 3SFEB 4MSMB 2MBQA 1T6BX 3I5JC 3RCZA 1ZP0B 2L1AA 4H2AA 4BZAA 1WGDA 1KM7A 3V61A 3QARA 4AUQC 1X1MA 2BKFA 1TKGA 3EC8A 2G9HD 1J8CA 1E6EB 3W5VB 2ZVNA 4P16A 1K53A 4EOYA 4ARCA 3AN1A 4KSKC 3DQVA 1PQSA 2GBNA 1JCKB 5G5GA 1FNVA 1SE3A 2RMMA 3KUDB 2VRRB 3R2TA 4RNAA 3LJ3A 4JPSA 2JZ3B 4KKIA 2L05A 4DHJB 2CS4A 1ZOYB 2KDMA 1OQQA 4HDQA 4OZCA 3KUCB 5IN7A 4I6PA 4KX6B 3RNFC 1L0YB 2WX0A 3VUYA 3H7SA 3I9V1 2KD0A 2N7JA 4TKNA 4DDID 1UH6A 4MGIE 2VH2A 2CHZA 1EU4A 3JVZX 5C1ZA
chains in the Genus database with same CATH topology
3RNGC 2INCC 3RNCC 2RDBC 3GE3C 3N1XC 3RNFC 3I5JC 3DHIC 2INDC 3N1YC 3RN9C 3RMKC 3RNBC 1T0RC 3I63C 3DHHC 3Q3OC 1T0SC 3Q3NC 3RNEC 3N1ZC 4P1BC 1T0QC 3RNAC 4P1CC 3Q14C 3Q3MC 3Q2AC 3RI7C 3N20C 3GE8C 3DHGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RNG C;  2INC C;  3RNC C;  2RDB C;  3GE3 C;  3N1X C;  3RNF C;  3I5J C;  3DHI C;  2IND C;  3N1Y C;  3RN9 C;  3RMK C;  3RNB C;  1T0R C;  3I63 C;  3DHH C;  3Q3O C;  1T0S C;  3Q3N C;  3RNE C;  3N1Z C;  4P1B C;  1T0Q C;  3RNA C;  4P1C C;  3Q14 C;  3Q3M C;  3Q2A C;  3RI7 C;  3N20 C;  3GE8 C;  3DHG C; 
#chains in the Genus database with same CATH topology
 2IO2 B;  4RCO A;  1ACC A;  1UZX B;  1IBX A;  2N4F A;  3PRE A;  4AQ7 A;  2ZNV C;  1ET9 A;  2KQ4 X;  4HWI B;  4LNN A;  5MPO A;  1TKY A;  4US8 A;  3Q69 A;  2C7H A;  4IM2 A;  4CHK A;  4LTU A;  4WWN A;  3NS1 A;  3A9J A;  2AQ3 B;  1TY0 A;  2L0F A;  4A6Q A;  2PVG C;  2LGD A;  3ETR A;  1VJK A;  4N58 A;  2EKI A;  1WGK A;  5HHD G;  4A20 A;  3V6C B;  2JSV X;  2E3T A;  1GNU A;  3ZIM A;  3A9J B;  3PVL A;  1F2R I;  2Y5B B;  2QIL A;  2JY6 A;  4NPN A;  4TSS A;  1LM8 B;  3VAW A;  2X38 A;  3ABV B;  1TIF A;  4K7U A;  2OHF A;  4J6I A;  3UQA A;  2B3A A;  4MH8 A;  1L2N A;  2MJ3 A;  3AU5 A;  2AL6 A;  3RI7 C;  2LJI A;  2LRW A;  3GB1 A;  1MHH E;  1WR1 A;  1DOX A;  2XEW A;  4AJY B;  3A33 B;  4JLC A;  5JHB A;  3QAQ A;  1JW9 D;  4HEA 1;  2K9X A;  2QIE B;  5GXG B;  4A8X C;  5L83 A;  3WAN A;  3PHX B;  5IP4 D;  1VR9 A;  1HTO A;  2KQ7 A;  1WGG A;  2A5U A;  2KFJ A;  3C0R B;  1I4H A;  3K9O B;  4B9K A;  3ZRF A;  3T3O A;  4RF0 A;  1LO5 D;  2J0M A;  2BWF A;  1F77 A;  1V2Y A;  5J17 A;  4M8N A;  5C3J B;  3AXC A;  1MHX A;  3NVW A;  4W9D A;  4DXG A;  3M63 B;  4E74 A;  3KQ4 A;  1C1Y B;  1V5O A;  3GZN B;  1J7B A;  3RZF A;  1RM6 C;  1QOF A;  3H7P A;  5CHW A;  5IKC M;  4KZ0 A;  1I4X A;  1XLQ A;  5L95 C;  2KTR A;  4JGH B;  3UIN B;  1AW7 A;  1QZE A;  3VR8 B;  5HKH A;  1Q1O A;  3MC8 A;  3ZXR A;  2O2V A;  2KWC A;  1H4R A;  2KTR B;  3I3T B;  2BGF A;  5KHO A;  4IWQ A;  3RNG C;  2LUM A;  1P1A A;  2O2V B;  4DDG D;  2WU5 B;  4FJZ A;  3H1U A;  4EFO A;  1FNU A;  4S0R A;  1WM2 A;  3MJW A;  3ZNH B;  4P1C C;  2JZP A;  3H6N A;  2FUG 1;  5FR6 A;  5BMH A;  4HDO A;  3VTU A;  1FRD A;  2N1V A;  2GBJ A;  2RGF A;  3VH3 B;  4UDU C;  2QDF A;  3D32 A;  2GBR A;  4P1B C;  1T0Q C;  1TYG B;  5DPR A;  4YL8 A;  1F2R C;  1GG3 A;  1NBF C;  3P4Q B;  4NY0 A;  4RF1 A;  1C4P A;  2GLS A;  1SF0 A;  2MJD A;  3ML8 A;  4KV2 A;  4NZL B;  3SEB A;  4HK2 A;  2GOW A;  4BKS D;  2HDE A;  1UD7 A;  4XZ4 A;  3W2D A;  2C7N B;  2V3N A;  3RFZ B;  3CF6 E;  4JWS C;  4P6V F;  5LNK 1;  5AUK A;  5D3I B;  2H89 B;  2JU6 X;  1UWX A;  1K51 A;  1GPX A;  3QWZ B;  1QF6 A;  3Q8B A;  3RPF C;  3PRP B;  3JW0 X;  1UF0 A;  3KUZ A;  1U4A A;  3DBL B;  4ZHO A;  2VH1 A;  3N32 A;  2NCN A;  4N6E B;  2J42 A;  2MBE A;  4ASW C;  3RMK C;  2LVP A;  1YX5 B;  3RUI B;  1XD3 B;  3AM9 A;  1RRB A;  3SDL C;  3IAM 1;  1M94 A;  3VRB B;  1N6Z A;  1HTQ A;  3VTW A;  1FIQ A;  4EZK A;  1NI3 A;  1ZGU B;  2INC C;  4PS3 A;  5I4D A;  3BK2 A;  3L4P A;  1E90 A;  2KDI A;  2VZK B;  2LI5 A;  3OAW A;  3A4R A;  5BYR A;  3WIM A;  2QEJ C;  2EMS A;  4IM3 A;  2IO3 B;  3ZNZ B;  2W54 A;  1FO4 A;  1TBE A;  1CQV A;  2TSS A;  5DPW A;  2OOB B;  2WXI A;  2NTS A;  2JWZ A;  3KH0 A;  4L23 A;  1KLV A;  2LJ5 A;  1N5X A;  4EEW A;  1R4M B;  3PLU A;  3RNB C;  3H8H A;  2O6V D;  2W3R A;  3B2F A;  4WJN A;  3DBS A;  3TCA A;  1S3S G;  3P4P B;  4JWU C;  1WMH A;  4P7I A;  1FM0 D;  2IJ0 A;  4I6L B;  1UBQ A;  3VQI A;  3X23 A;  2IGD A;  2MRP A;  1WMH B;  2AQ2 B;  2MBH A;  3DHH C;  1FD6 A;  1HQR D;  2L52 A;  1WGH A;  3NVZ A;  1E8Y A;  2BT6 A;  1PYW D;  2M1M A;  1EF1 A;  4LJO B;  3DHG C;  1R7S A;  2GB1 A;  3UI3 A;  2NMQ A;  2PLP A;  3L13 A;  3M95 A;  1C4C A;  2DNF A;  4NNJ B;  1FXT B;  1J7A A;  3Q8A A;  1XXG A;  4WAA A;  1R4N I;  3PZD A;  4YTM B;  3DBR I;  2JZZ A;  4K7S A;  3DOW A;  1MG8 A;  2I1K A;  5E6J A;  3EHV A;  2B76 B;  4JQW C;  1L6U A;  2ZPY A;  4B6W A;  1WJ4 A;  1AAR A;  5EDS A;  4BBN F;  2ZW1 A;  2FUH B;  3ZJT A;  4II3 B;  5C23 A;  2J4X A;  4C7Z A;  1S1Q B;  1Q0W B;  1D3Z A;  4REZ A;  2UYZ B;  3HK0 A;  2K6Q A;  3GE8 C;  2BPS A;  2OJR A;  4WWM A;  3O13 A;  2Q5W D;  2JYE A;  2MH7 A;  2L7R A;  4MDK E;  4WJQ A;  4YTP B;  4HKZ E;  1WJN A;  3DWG C;  1TTN A;  3Q3N C;  4YSX B;  4YXD B;  1WGR A;  4F7Z A;  3WAP A;  2BF8 B;  4K1R B;  1OQR A;  1SXT A;  4KSL C;  2Y3A A;  5C2T B;  3EUB 2;  4ANV A;  2IBI B;  3V62 A;  4RGN A;  2IGH A;  3DPD A;  1V81 A;  1E8Z A;  2LUE A;  5EE9 A;  3A9K B;  2W82 A;  3DWM A;  4A3P A;  3FIL A;  1FXA A;  4WWO A;  3ZDT A;  3TIX A;  3R7Q A;  3FIL B;  4MGK E;  1MI0 A;  3SFD B;  1K50 A;  3NUH B;  5FR3 A;  4LDT D;  1ZDX A;  1XT9 B;  3DBH B;  2ACZ B;  1NEK B;  4BAX A;  4E3C A;  3QCA A;  2WXH A;  1YMH E;  2BYV E;  1KLU D;  3APF A;  4CO7 A;  4DQO C;  4OVZ A;  1JQ4 A;  4LNF A;  3ZKJ C;  4GOC A;  4XC2 A;  2WU2 B;  4FN2 A;  4HJG E;  3AEC B;  2PE6 B;  1P7E A;  3ZO5 B;  1SGH A;  1WR6 E;  2NVU I;  3Q8C A;  3P2B A;  4M8M A;  5AEK B;  3APD A;  3VTV A;  2QC8 A;  4NQL B;  4NJ6 A;  5HI1 A;  4DHJ D;  2W55 A;  3P4S B;  3MHS D;  1B1Z A;  4MAC A;  2KVR A;  2PKO A;  4X57 B;  1JAL A;  2M17 A;  4XWW A;  3R66 C;  1F9J A;  4G3X B;  4TUU A;  4FBJ B;  2SEB D;  1Q5W B;  2R2Q A;  4GDK B;  3TBL D;  2L32 A;  1WXM A;  5HG2 A;  3QK0 A;  2AYO B;  2YLM A;  2V1Y A;  2G3Q B;  3IT6 B;  1C77 A;  2Z0E B;  3N20 C;  4R3D A;  4ZYS A;  4FHJ A;  2INN E;  1ENF A;  1LXD A;  4MEL A;  3NS8 A;  3Q8F A;  4ICV A;  3PTF C;  1T3Q A;  3U4E G;  2HJ1 A;  1UUP A;  2N7E A;  1YN5 A;  4YTN B;  5AZH A;  3RUL A;  4RH6 A;  3N3K B;  2OJW A;  1V1O A;  1AWD A;  1V6E A;  4GLS C;  3ZVV A;  4PS7 A;  4WJP A;  1AN8 A;  1VCB A;  3AEA B;  4TQ1 A;  4KZC A;  4ANX A;  2Z59 B;  3ML9 A;  3KVF B;  3N9Y C;  2C9W B;  2SAK A;  1SBB B;  1WXA A;  4GSW A;  2DEN B;  4II2 B;  4RM8 A;  2WP9 B;  3TMP B;  5FKA C;  3O65 B;  1YIW A;  1JRP A;  1YD8 U;  4DXA B;  1WI0 A;  1F52 A;  2KC1 A;  2WXF A;  3L08 A;  2KVZ A;  2BKR B;  3Q2A C;  2WDV B;  3U8Z A;  1P7F A;  4E71 A;  3NOB A;  2ZCB A;  1KFY B;  4TQ0 A;  2KN4 A;  3RNC C;  3DHI C;  3RD2 A;  4HJK A;  1VZ6 A;  2K0P A;  1T0R C;  3PLV A;  1FEH A;  2AX5 A;  1WJU A;  1NDD A;  1G6J A;  4OVV A;  1E7U A;  1IBX B;  2C7M B;  2IZV B;  3R8B A;  1WF9 A;  1CK1 A;  3QX1 A;  1IGD A;  2K6D B;  2JRH A;  3R2I A;  4WAF A;  4PS8 A;  4L1B A;  1UGJ A;  3S2A A;  2MWS B;  3TEY A;  1JWU D;  3BZD B;  4B0E A;  1YJI A;  3ALB A;  1OQY A;  1FMA D;  4ZRQ A;  3MTN B;  4KGS A;  2FAZ A;  2IPK D;  2MEK A;  2KZR A;  2WWZ A;  3HRD D;  5D6J B;  3PO0 A;  3DVN U;  3ZDM C;  1JML A;  3PRZ A;  3MC9 A;  3ONS A;  4Q2J A;  2RDH A;  1L5P A;  2MA9 B;  3P42 A;  4J3O D;  3MFG A;  4L2Y A;  3P4R B;  2AL3 A;  5JXV A;  4KGT A;  2RPQ A;  2NTT A;  2LMC A;  3VVW B;  2KN5 A;  3DVN V;  2ZCC A;  4DHZ E;  3ECI A;  2G4S A;  3NG0 A;  1CMX B;  2ZVO A;  3LB8 C;  1VD2 A;  1I42 A;  2C5L C;  1XLP A;  4B95 A;  2V4L A;  1E7P B;  3NVY A;  4NAM A;  1YQB A;  3X0W A;  5AZG A;  4JX1 C;  3VFK A;  4K7W A;  5IAA C;  4GMV A;  1SIJ A;  2LXA A;  2LGX A;  4EE2 A;  1OTR B;  3B08 A;  3PPA A;  2ZJD A;  1RYJ A;  2MX2 A;  1KRH A;  2AWT A;  2BS4 B;  4MGZ E;  2ZW0 A;  2KMM A;  3AV8 A;  4ZRI A;  1TS3 A;  4D2K A;  1XF5 L;  4IC7 B;  2JQR B;  4A3O A;  2JX5 A;  4HKQ A;  2HTH A;  4FLH A;  2KFK A;  3BVM A;  2IYD B;  2REX A;  3NRZ A;  4ZOH C;  3H7P B;  1WM3 A;  2IGG A;  1KTK A;  4AS1 A;  2HTM E;  1E7V A;  3FAH A;  1PGA A;  1DOI A;  3HM6 X;  2K5P A;  2FNJ B;  1C78 A;  1UNS A;  4G11 A;  3ZXV A;  1XO3 A;  1T0S C;  2NR2 A;  4MT5 A;  3CST A;  1WX7 A;  4RGT A;  2WGS A;  3TEW A;  2R2O A;  2I1J A;  1MJD A;  3Q3M C;  2L0T A;  3U52 E;  1KH0 A;  2KAC A;  2BW2 A;  2FCM A;  2EEL A;  3PZ7 A;  2M0A A;  2EMT A;  2WXP A;  4W9L A;  3NJT A;  2DYB A;  2LFI A;  4US9 A;  2IDY A;  2H88 B;  2R61 A;  4K3C A;  2PE9 A;  1JWB D;  1SIF A;  5LLI A;  4DXF A;  5JHA A;  1P9D U;  1N62 A;  2LRU A;  2UU7 A;  2K8C A;  5KHQ A;  4FA6 A;  1N5W A;  4EZL A;  3W9C B;  2DAJ A;  2M56 B;  4F1S A;  1I35 A;  1NVI D;  2D3B A;  1VRA B;  2KAJ A;  3PHW B;  2K3U A;  4GDL A;  2BVC A;  4KVG B;  4IWO A;  1KOT A;  3L17 A;  4GU2 A;  2VZK D;  4A90 A;  4LJP B;  1FPY A;  1PDX A;  2N9L A;  3W5U B;  1ZW7 A;  2NPT A;  3IAS 1;  3KLS X;  3V6E B;  3VH4 B;  2JT4 B;  2JWU A;  1TY2 A;  1PGB A;  2INP E;  1JRU A;  3IBE A;  3Q6B A;  2K25 A;  1V86 A;  2NPT B;  2MP2 A;  2Z8L A;  3DVG Y;  1YX6 B;  3ZTC A;  3QIJ A;  3IFW B;  1WXS A;  3MC0 B;  2DZI A;  3AE8 B;  1WE6 A;  2LHE A;  5BYS A;  2MP2 B;  3CWI A;  3EEC A;  5BMG A;  2I2Y A;  2IO0 B;  3KWL A;  2MSE D;  1TT5 B;  3TL5 A;  2JYT A;  2V9H A;  2PVO D;  1C76 A;  5D7G A;  4ZHP A;  2QHO A;  1L4D B;  4C56 C;  4C80 A;  4MEM A;  3EA6 A;  2ICI A;  4JE3 B;  2RPV A;  1LFD A;  1WFY A;  3VDZ A;  4W9H A;  4ZRK A;  3TEZ A;  5BO4 B;  4BKS A;  1GAQ B;  1JWA D;  4QAY A;  2I38 A;  2LAS A;  1EWY C;  2V3S A;  2JUO A;  1HEZ E;  1WSP A;  2MLB A;  2ZNV B;  2DZJ A;  2MHJ A;  3OWE B;  1EF5 A;  3AEG B;  4M0W A;  2KMC A;  3Q3F A;  5EE3 A;  5CHV C;  3AEE B;  4PT5 A;  1FCL A;  4KIK A;  3OJ4 B;  2M4N A;  3GZN I;  3K9P B;  2KYW A;  4M0W B;  2KWU B;  2LHD A;  5IOI A;  1UEL A;  3BYT B;  5TSS A;  2N9P C;  3C19 A;  4XDC A;  5E6O A;  3IXS A;  4KIK B;  2BYF A;  4C7Y A;  4RGO S;  3LDZ E;  3ZLZ A;  2JVC A;  1E5W A;  4IDI A;  1V49 A;  1QOA A;  4LK0 M;  2PJH A;  4DWF A;  3RZW C;  3V05 A;  1WE7 A;  1YN3 A;  3T3N A;  1V97 A;  4KKJ A;  2KWD A;  2RSU A;  4FJV B;  2G1E A;  5D2M B;  2WLB A;  1C4A A;  3ZW3 A;  1RFA A;  2J0J A;  2CR5 A;  3LXF A;  5H8Y E;  3TEX A;  2V0G A;  4PYZ A;  5BYQ A;  4A55 A;  4I6N B;  2KXJ A;  2KX0 A;  1YQ4 B;  3RYT A;  5E6N A;  3VUX A;  2G4D B;  2LGI A;  3Q8E A;  4PK1 A;  1N61 A;  1BT0 A;  4F8C B;  2LD9 A;  3NVV A;  4ICU A;  5TR5 A;  2KWV B;  3ZRC A;  4BKG A;  3UIP B;  2O6V A;  1KJT A;  1NEN B;  4IWP A;  2PW9 A;  2Z0D B;  1VZ8 A;  3R7R A;  4ANW A;  1TS5 A;  1SSN A;  2KLG A;  1XEE A;  5IO9 A;  1L0V B;  2ONQ A;  2IND C;  1JWS D;  2JRI B;  1SE9 A;  1YN4 A;  2YEP B;  3MHZ A;  3N1Z C;  1GJZ A;  1ZXI A;  4C4V A;  3Q14 C;  1WXV A;  4NAW A;  2N9X A;  4EKU A;  3QHT A;  2A4Z A;  3AEB B;  2D5G A;  4C4V B;  2NS5 A;  1Z2M A;  2PTL A;  4YSY B;  2QCZ A;  1XLN A;  5G2N A;  3VR9 B;  3M62 B;  1WZ3 A;  4RFB A;  1EM7 A;  1JWM D;  1FFU A;  1FRR A;  2QJL A;  3DBL I;  4YT0 B;  1E8X A;  1STE A;  4W9J A;  3RT3 B;  3WAL A;  3OJ3 A;  1WJ6 A;  4LLG M;  1WIA A;  2NBW B;  2MCN B;  2FCN A;  5DPT A;  2DLB A;  3FKY A;  2WXR A;  1QKZ A;  2FIF A;  3SHQ A;  3ZJV A;  3L10 B;  4OHJ A;  3DCG A;  2CHX A;  1T0Y A;  1WYW B;  2DAF A;  3AEF B;  1ESF A;  2MJE A;  4NQK E;  3LYY A;  4B0M A;  1D6E C;  2IO1 B;  1ZDV A;  3MJ5 A;  2L00 B;  1EUV B;  1WRD B;  1Y8R C;  2YEP F;  4K81 A;  2DZK A;  4KDI C;  3P63 A;  1VLB A;  2LXC A;  2RD0 A;  2X8X X;  2WXL A;  1V5T A;  3AE1 B;  2KDF B;  4WWP A;  2PPH A;  3WCQ A;  3AE4 B;  2DYO A;  4O1N A;  1R4M I;  2GI9 A;  3W1Y A;  3AU4 A;  3HIZ A;  2FCS A;  3PGE A;  2LWP A;  3AE2 B;  5J2R A;  2KX3 A;  3PV1 A;  4HRS A;  2KJ6 A;  3GS2 A;  1GOZ A;  3Q3J A;  2MBO A;  3L0W B;  1P98 A;  5T8I A;  3ZGZ A;  1UBI A;  3AE9 B;  4IG7 B;  1TS2 A;  1MPE A;  4DHZ B;  2FCQ A;  1QOG A;  1KLG D;  3APC A;  1DGJ A;  1WGY A;  2WXJ A;  2WNM A;  4XE0 A;  2Y5C A;  3AI5 A;  4JIO U;  4LNI A;  2E6X A;  3V3X A;  3GOE A;  1XLO A;  4IKG A;  2XK5 A;  2BWE S;  1H8C A;  1KF6 B;  1BML C;  4TMA B;  3FC4 A;  2XK5 B;  2GBK A;  3AE3 B;  1EWC A;  1ZXH A;  1RAX A;  3OLM D;  3B1L X;  3QQ8 B;  1L6V A;  3GP7 A;  4N9F 4;  4EZJ A;  4GGQ A;  3BWU D;  3HM3 A;  5FK9 C;  3T9L A;  2WDT B;  2MQJ A;  4XGA B;  1WXQ A;  1M4V A;  1IPG A;  4RGM A;  3WA0 A;  2XN9 C;  1WYG A;  4TV3 A;  1DYQ A;  1SEB D;  2FE8 A;  4W9I A;  1OFF A;  3CIR B;  2M0X A;  1WY8 A;  1RWS A;  2CJN A;  1A5R A;  1OEY J;  1IGC A;  3PRM B;  3DVG X;  2L83 A;  1I4Q A;  3UIO B;  5AZF A;  4GXB A;  2QMT A;  4ARI A;  4K3B A;  2KK8 A;  3IHP C;  2YVC A;  5AUI A;  1E0Z A;  2J0K A;  2JPH A;  3Q3O C;  1XQQ A;  4BOZ B;  1HZ5 A;  2IY1 B;  2V4I B;  2HD5 B;  3UQB A;  2WDQ B;  1BXT A;  2DWQ A;  4OW0 A;  1IUE A;  2LEK A;  2N9K A;  4AJW A;  4W9F A;  1RLF A;  3A4S C;  1C9F A;  1ISN A;  4WUR A;  2CKH B;  1GC7 A;  3AH7 A;  1ZKH A;  4LNK A;  4BOS C;  1EU3 A;  1RFK A;  2JF5 A;  4KGR A;  4BBN C;  4PYU A;  2ZZP B;  3N30 A;  3ZYY X;  3DBH I;  1I4P A;  1XCQ L;  1NYQ A;  5JZE B;  2M19 A;  1E10 A;  4NJ7 A;  3L54 A;  2EKE C;  4JL9 A;  1QIL A;  1V9J A;  1MVK A;  2K22 A;  2CHW A;  1QOB A;  1YNT E;  5BMI A;  3EFU A;  2ASQ A;  1WH3 A;  4FXC A;  4W9C A;  2L3Z A;  2PMV A;  4OZA A;  1WRI A;  3U2S C;  3B0A A;  4OVU A;  1Q10 A;  2RDB C;  2MBB B;  4GB9 A;  4WQM A;  2RDG A;  3J9C A;  1HXY D;  1QT9 A;  4RMA A;  1SE4 A;  1N60 A;  3ZTD A;  4W9G A;  3W1S C;  1WX8 A;  3M3J A;  3VRA B;  1I4R A;  2KJH B;  3JYU A;  4HCP B;  4OZB A;  2BS2 B;  2BYT A;  1ET6 A;  1L7Y A;  2KMA A;  2KJR A;  3N1Y C;  5D94 A;  2WXQ A;  4ITK A;  3U30 A;  4W9K A;  3MP9 A;  3BVZ A;  3OG5 A;  4YWG G;  5DCN A;  1TJE A;  3B2G A;  2LVO A;  2C60 A;  4AOF A;  3AE6 B;  1F1H A;  2KFK B;  1K52 A;  3CMM B;  1Y56 A;  1VDV A;  1LQB A;  1HZ6 A;  1CJE A;  3SU8 X;  5J18 A;  2G45 B;  3BY4 B;  4GN1 A;  2KC2 A;  2J52 A;  4C00 A;  2NBU A;  2N9E B;  4ANU A;  2CJO A;  2ZPN A;  4AWJ A;  1JRO A;  1C3T A;  3IT4 B;  3VHT C;  2KLC A;  2K1F A;  1V1P A;  1ZE3 D;  1EO6 A;  1B9R A;  3ENE A;  4EUT A;  2AEH A;  3AMZ A;  1MFW A;  3RNA C;  4XWT A;  4XDD A;  2W9N A;  3IVF A;  1V1P B;  2D3C A;  4CYE A;  2KDE B;  2ON8 A;  4LCD E;  3ZNI D;  1R4N B;  2N1W A;  3DBR B;  2PEA A;  3BII D;  4FUL A;  2LGS A;  3V60 A;  2K39 A;  3VUW A;  1J19 A;  3C8Y A;  3EGR A;  3L16 A;  1MG4 A;  5EE1 A;  1LGR A;  1P0R A;  4N59 A;  3E9S A;  2MW5 A;  4GDL B;  2DBY A;  2JXX A;  3EFC A;  1SJH D;  3QJZ A;  2DYM A;  2QSD A;  1FNW A;  2BYE A;  1TGZ B;  3AB5 A;  1Z5S B;  1DOY A;  4RM9 A;  2KO3 A;  4KDL B;  4BFR A;  3URY A;  5CX3 A;  4AP4 C;  3CSF A;  4GIV A;  4IW0 A;  1D5X C;  4G50 A;  1V8C A;  5IA7 A;  2N7D A;  3PT2 B;  1K8R B;  2L76 A;  2L8J A;  1VZ7 A;  4MM3 A;  3I57 A;  2HE7 A;  2K8H A;  1I7H A;  4MM3 B;  1OEY A;  1OGW A;  2KNB A;  4WQO B;  2FID A;  3KWV A;  3TSS A;  1E8W A;  1V80 A;  2GMI C;  3AED B;  4URK A;  2BB6 A;  3AE5 B;  2BQQ A;  1TS4 A;  2WXO A;  2Y5P A;  4USA A;  1CZP A;  2M8S A;  1GB4 A;  3U7Z A;  3E56 A;  3HVD A;  2D3A A;  2XBB C;  2KAN A;  1ZPS A;  2LGY A;  2KOX A;  1GUA B;  4HRO A;  3NZU A;  1TKE A;  2WHI A;  4DK5 A;  2BTE A;  4HPP A;  1QQR A;  5G55 A;  1FFV A;  3PZ8 A;  3RNE C;  2HJ8 A;  4HVB A;  2GRI A;  2WS3 B;  3HVZ A;  2KTF A;  5LXI B;  5E6P A;  4A9A A;  3GE3 C;  3ZQ4 A;  2J53 A;  1YQ3 B;  3NY5 A;  4G0N B;  1P3Q U;  4HCN B;  2DZM A;  1NYR A;  1ROE A;  2D07 B;  2GBM A;  1AYF A;  5CTR C;  3ZNG C;  1E9M A;  2CU1 A;  4HPL B;  4CQN A;  2WXM A;  4S17 A;  1SB3 C;  3NZ3 A;  2V3P A;  5DPS A;  1YJJ A;  2FBW B;  2DHZ A;  3KW5 B;  2D2Q A;  4ZYN A;  3W1S A;  2IY0 B;  1N63 A;  2WQY B;  1IYF A;  1ZUD 2;  4LNO A;  1D5Z C;  3BVG A;  3VXW A;  3ZJU A;  3A1Q A;  4HPM B;  2O6V B;  1UWM A;  1PFD A;  3WAO A;  1J0G A;  2D11 A;  1SJE D;  1FCC C;  4IM0 A;  4BVU C;  2BS3 B;  2KKC A;  2J7Q B;  2CU3 A;  3NHE B;  3BIN A;  3A1Q B;  4IOI E;  4W9E A;  2LVQ A;  3P1M A;  2WXK A;  3JSV A;  3R3M A;  3BYY B;  1QLB B;  2KQS A;  2AQ1 B;  3JSV B;  4MJS A;  4MH0 E;  4NAW B;  2D3G A;  1HE8 A;  2KDB A;  2K8B A;  1J7C A;  1HA5 A;  3ZUN A;  3DDC B;  1L0X B;  4MJS B;  5GMV A;  1XCT L;  5D3D A;  5G5H A;  4M00 A;  4MGY E;  4ZRJ A;  2RR9 A;  3KYC D;  3U7D A;  3AE7 B;  3B9J A;  3N1X C;  2LZ6 A;  4ZRP A;  1YJ1 A;  4NJC A;  3H9D A;  1TZO A;  1T5X D;  3QC8 B;  4XX5 A;  4MSQ B;  1NI2 A;  1TZ1 A;  1YOV B;  4FJY A;  3A9K A;  1PUT A;  4ZDV A;  1PGX A;  3IG3 A;  3QA8 A;  3PS6 A;  1IP9 A;  4ACF A;  3RN9 C;  1A70 A;  2D10 A;  1GB1 A;  2NBV B;  2PIA A;  1WWT A;  2WXN A;  3HHM A;  3PSE B;  5JH5 C;  4YSZ B;  2WDR B;  2WXG A;  4M02 A;  1BUI C;  4BKT A;  4WH4 A;  4DBG A;  4XYC A;  1D4B A;  2ZEQ A;  2OED A;  5LXH A;  4HXD A;  3KYD D;  1SE2 A;  2WX1 A;  2WYQ A;  1FXI A;  3HUI A;  3TJP A;  3TUO A;  5H92 C;  3I63 C;  1F0Z A;  1D5M C;  1GC6 A;  4IUM B;  4WJO A;  3SD5 A;  2BBC A;  5EE0 A;  2JXT A;  2KT7 A;  3BK1 A;  2KHW B;  3AUL A;  1I4G A;  3UGB B;  1WZ0 A;  2XNA C;  1UGM A;  1WX9 A;  3SR6 A;  4FAD A;  2N0S B;  2DX5 B;  1C79 A;  1L4Z B;  2W3S A;  3WAM A;  3NZS A;  4FHK A;  5CHF A;  2UWQ A;  4HLE A;  3T8M A;  2BB5 A;  4WIP A;  4M01 A;  5HFY A;  4GDK A;  3UF8 A;  4LDT B;  3SFE B;  4MSM B;  2MBQ A;  1T6B X;  3I5J C;  3RCZ A;  1ZP0 B;  2L1A A;  4H2A A;  4BZA A;  1WGD A;  1KM7 A;  3V61 A;  3QAR A;  4AUQ C;  1X1M A;  2BKF A;  1TKG A;  3EC8 A;  2G9H D;  1J8C A;  1E6E B;  3W5V B;  2ZVN A;  4P16 A;  1K53 A;  4EOY A;  4ARC A;  3AN1 A;  4KSK C;  3DQV A;  1PQS A;  2GBN A;  1JCK B;  5G5G A;  1FNV A;  1SE3 A;  2RMM A;  3KUD B;  2VRR B;  3R2T A;  4RNA A;  3LJ3 A;  4JPS A;  2JZ3 B;  4KKI A;  2L05 A;  4DHJ B;  2CS4 A;  1ZOY B;  2KDM A;  1OQQ A;  4HDQ A;  4OZC A;  3KUC B;  5IN7 A;  4I6P A;  4KX6 B;  3RNF C;  1L0Y B;  2WX0 A;  3VUY A;  3H7S A;  3I9V 1;  2KD0 A;  2N7J A;  4TKN A;  4DDI D;  1UH6 A;  4MGI E;  2VH2 A;  2CHZ A;  1EU4 A;  3JVZ X;  5C1Z A; 
#chains in the Genus database with same CATH homology
 3RNG C;  2INC C;  3RNC C;  2RDB C;  3GE3 C;  3N1X C;  3RNF C;  3I5J C;  3DHI C;  2IND C;  3N1Y C;  3RN9 C;  3RMK C;  3RNB C;  1T0R C;  3I63 C;  3DHH C;  3Q3O C;  1T0S C;  3Q3N C;  3RNE C;  3N1Z C;  4P1B C;  1T0Q C;  3RNA C;  4P1C C;  3Q14 C;  3Q3M C;  3Q2A C;  3RI7 C;  3N20 C;  3GE8 C;  3DHG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...