2K8HA

Solution structure of sumo from trypanosoma brucei
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
MSNNGGEPSNNGGEGAEGTCKEETALVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETKTPEELGMEDDDVIDAMVEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin protein
publication title Solution structure of SUMO from Trypanosoma brucei and its interaction with Ubc9
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Signaling protein
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k8hA01
3Q3FA 2LVQA 2AL3A 2ZCCA 3VTVA 4E3CA 2JRHA 4CO7A 2OOBB 1R4MI 2CHXA 3PRPB 3B08A 3CSTA 4GSWA 5LXHA 3T8MA 3H7PB 4RM8A 4EOYA 1LFDA 5E6NA 2KXJA 1BT0A 4BBNF 1A5RA 4HDOA 2KX3A 2NBUA 3RCZA 1CMXB 1SGHA 4DXAB 2LGYA 4KSKC 3ZLZA 1WF9A 5JHBA 3MJWA 2HJ8A 1I42A 2KQ7A 5JHAA 3CF6E 4HPMB 2DZMA 4BKSA 3DVNU 2NBWB 4OVUA 2GBMA 4JIOU 1WGYA 4PS8A 5AZGA 2KDFB 3DVGY 2GBJA 3A33B 1L7YA 1UH6A 4AWJA 3V6EB 4WWPA 4KDIC 2IO2B 1LQBA 3PGEA 4LJOB 4W9IA 4I6PA 1WMHA 4NJ6A 4GGQA 3ECIA 4NAWB 1WJ4A 1EO6A 1UBQA 2MBBB 2IO3B 2JPHA 2XK5A 3IHPC 2N7DA 4FADA 3PLUA 2L8JA 4KZCA 4FJYA 3KVFB 4DK5A 3L08A 1WGRA 2FAZA 4KSLC 4MJSB 1WXSA 3UGBB 2BWES 5G55A 2MWSB 4JGHB 3RULA 4M8MA 3EECA 2K25A 1WE7A 4FHKA 3UF8A 2WX0A 1NDDA 2C7HA 2O2VA 2JXXA 2FUHB 4MDKE 3V60A 1WRDB 1WGHA 1WZ0A 2ZJDA 4DHJB 2L76A 5EDSA 1XQQA 2MBHA 1YIWA 3KW5B 3H9DA 4EZJA 3H1UA 4W9FA 3Q3JA 1UD7A 3EFUA 4DBGA 1LXDA 2KMCA 3OLMD 4K81A 4G0NB 1WR1A 1WM2A 4BVUC 4KIKB 3IBEA 2DYMA 1YD8U 3ML9A 4HXDA 3GOEA 2KFKB 5HKHA 4WJQA 1WX8A 2MCNB 3R7QA 4XZ4A 3VUWA 1UBIA 5JZEB 3DPDA 3RZWC 1P98A 2J0KA 2N9PC 1Q0WB 3DCGA 4W9KA 4K7WA 2JUOA 2YLMA 2L05A 4IM0A 4EEWA 4K7UA 2IYDB 3OJ4B 3QCAA 4ZRKA 1Q1OA 2HE7A 4AJYB 2GBNA 2IO0B 3GZNI 3HHMA 4W9CA 1E8ZA 2DENB 3ZNGC 3A9KA 3L10B 4A3OA 3VQIA 2KTFA 3LJ3A 2CS4A 5D7GA 4HDQA 1NBFC 5AZHA 1WM3A 2FCSA 4HPLB 1OEYJ 2N4FA 2FIDA 3TL5A 1E5WA 1C1YB 4OVVA 2Z59B 3OAWA 1OTRB 2DZJA 3X23A 3ZDMC 4NY0A 4NNJB 3ZNHB 2V3SA 2O6VB 2BYVE 1IYFA 2G3QB 4GXBA 5BO4B 2J0MA 2K6DB 3ONSA 2NPTB 2KJRA 3TCAA 1OQYA 2G4SA 1R4NI 5IA7A 4KVGB 3JSVA 4WWNA 4GB9A 5C23A 1E8WA 4ANUA 1HE8A 2M0XA 1Z2MA 2LASA 3QK0A 3CSFA 2YVCA 2REXA 4IWQA 3DQVA 4JLCA 3QIJA 4FJZA 2M1MA 2NS5A 1EF5A 4JQWC 1E90A 2KWCA 4TV3A 3DBLI 2WDTB 4HCPB 1J0GA 3KYCD 2KDBA 3A9JA 4IWOA 4FBJB 1E8XA 2CHZA 2I1JA 3WA0A 4PYUA 2MLBA 4K7SA 2RGFA 3DOWA 5AZFA 3VDZA 2BWFA 3U8ZA 4HWIB 4DDID 5DCNA 2KO3A 4GDLB 2N1VA 1U4AA 2K8BA 4EUTA 2KFJA 4FN2A 2ZZPB 3EHVA 4MSMB 3VH3B 3P2BA 1LM8B 4W9HA 3H7PA 2MRPA 2JT4B 5LLIA 2LVOA 2IY1B 2MQJA 4RM9A 2WYQA 3PSEB 2ZNVC 5J18A 3QHTA 2NVUI 1RLFA 2N1WA 2PEAA 2KD0A 2DZIA 3NHEB 4RMAA 3MTNB 4BFRA 2KMAA 2IO1B 1IPGA 2K8CA 2EMSA 3WANA 1V6EA 3ZRFA 4IG7B 2R2QA 3HM6X 4HCNB 3IVFA 3SU8X 3M3JA 1L2NA 2JZ3B 1S3SG 4HJKA 2KQSA 5G2NA 2J0JA 3PPAA 2MBOA 3SD5A 3PRZA 4GMVA 4W9GA 4ASWC 2KC1A 3RYTA 1P0RA 2CR5A 2C7NB 3ZIMA 2GOWA 4HK2A 4IWPA 4WQOB 4NAWA 4M8NA 2FCMA 3VAWA 1GG3A 4FHJA 1G6JA 2DX5B 1TBEA 2MX2A 3PT2B 4K1RB 3TBLD 2CU1A 1M94A 2JWZA 2FNJB 1WE6A 2DHZA 3BINA 1VCBA 1JRUA 4TQ0A 4E71A 4MJSA 2V4LA 2JRIB 4GDKB 1WJUA 1AARA 4TKNA 3PLVA 4II3B 2LWPA 1XD3B 4AUQC 3NZUA 1YQBA 4LDTB 1EF1A 3DVNV 4DWFA 4DHJD 3VUYA 3T9LA 3O65B 3SHQA 3B1LX 3UIOB 2AL6A 2D2QA 2M8SA 2XEWA 3SDLC 4M0WB 3CMMB 4MSQB 2FCQA 5D6JB 2MBEA 5CHFA 3UINB 3JVZX 2KKCA 1GUAB 4W9JA 2MA9B 3V61A 4ANWA 1VD2A 4EFOA 3PRMB 2ZCBA 4FJVB 2K8HA 4MGZE 1NI2A 3WAPA 2KFKA 3H7SA 3QARA 4BOSC 1YX6B 3HM3A 2RD0A 3PHXB 1GJZA 5CX3A 4I6NB 3RT3B 4PS7A 3VUXA 2C60A 4EZLA 4MGYE 4AOFA 5IAAC 3R3MA 5J17A 2ASQA 3AXCA 3ZUNA 1MG8A 1WY8A 1WXVA 5L95C 4ZYNA 2ZPNA 3DDCB 1K8RB 2G45B 2KJHB 4MGKE 4WJPA 1SIFA 3DBHI 2KDIA 4DDGD 3KYDD 2WWZA 3ML8A 4GIVA 3VVWB 2AWTA 1WX7A 3V62A 3ZNID 3TMPB 2O6VD 1WXMA 3K9OB 3UQAA 2OJRA 1KJTA 2N7EA 2N9XA 2KTRA 2XBBC 1WJ6A 3JYUA 4PYZA 1WGDA 4BKGA 2NPTA 1OGWA 5DPTA 2WX1A 3DBSA 1E7UA 2AEHA 2LZ6A 4XC2A 3RUIB 3MHSD 2LD9A 4B6WA 4LCDE 3NOBA 1WIAA 1ZGUB 2C7MB 3ZRCA 3AI5A 3WAOA 1YJ1A 1P9DU 2ZEQA 1V80A 2KZRA 3DBRI 3X0WA 4FULA 4X57B 4AJWA 1J19A 3PS6A 1TZ1A 1E8YA 3LDZE 1UZXB 1WZ3A 2LVPA 4EZKA 4F1SA 3JSVB 4JL9A 4NJ7A 3VXWA 4HVBA 3HIZA 3QA8A 4MEMA 3A1QB 2VRRB 1GC6A 1V5TA 3DVGX 4YL8A 2BGFA 2LRUA 3R66C 4GDLA 2PE9A 2KNBA 4MELA 4N9F4 3KUZA 3L17A 3RZFA 3A4SC 2C9WB 2GMIC 2MP2B 2JF5A 1WX9A 3RD2A 2HD5B 3A9JB 2DAFA 3PTFC 2EMTA 3W1YA 5AEKB 4CHKA 4GN1A 2BF8B 3APCA 2B3AA 4DHZE 5L83A 3AU4A 4IW0A 3ZTDA 1P3QU 1RRBA 3OJ3A 2D07B 5D2MB 1F9JA 3A4RA 4B95A 5JH5C 2BYEA 2LUEA 1RFAA 2IBIB 4BBNC 2DYOA 3KUDB 4F8CB 4NQLB 4URKA 1J8CA 3ZO5B 2L0FA 1OEYA 5CTRC 2HTHA 4KV2A 5GMVA 2RPQA 4G11A 4GU2A 5C1ZA 1Q5WB 2GBKA 1PQSA 2R2OA 1E7VA 2J7QB 2KHWB 5D94A 3N32A 5DPWA 3AULA 2DAJA 2NR2A 3R7RA 3H6NA 5KHOA 3HK0A 5E6OA 4BKSD 4KZ0A 2L00B 4P7IA 2BKFA 2EKEC 2A5UA 1T0YA 5FR6A 4ANVA 4IUMB 5J2RA 2Y5BB 4CYEA 4ZRIA 2LGXA 1WMHB 2I1KA 3EC8A 3IFWB 3TIXA 3VFKA 2M4NA 3UIPB 3L13A 2C5LC 2L3ZA 2LXCA 2Z0EB 3L16A 3N3KB 2W9NA 4G3XB 4MM3A 3VTUA 3ZW3A 2XK5B 4W9EA 2KJ6A 2CKHB 4WJOA 1Y8RC 4F7ZA 4G50A 4DHZB 1KM7A 2D3GA 4GDKA 4II2B 1D3ZA 1EUVB 1UGMA 4LJPB 3U7DA 3ZDTA 4W9LA 1TTNA 3BY4B 1V81A 1H8CA 3K9PB 4LDTD 2UYZB 3VH4B 3WALA 4PS3A 1V49A 2KLCA 3B0AA 4W9DA 2PJHA 3L0WB 3ZKJC 3QWZB 3U30A 2PE6B 2LJ5A 3V6CB 4B9KA 2D11A 2NCNA 1GNUA 2ZPYA 3M62B 4BKTA 2GBRA 2K6QA 2O2VB 1UELA 1RAXA 3NZSA 4KIKA 3JW0X 3VTWA 2ZVOA 4MGIE 3IG3A 4ICUA 3VHTC 2K1FA 1TGZB 1H4RA 2CHWA 2UWQA 4IM2A 4A20A 2Z0DB 1X1MA 1KOTA 1V86A 1XT9B 1ZKHA 5KHQA 2KVRA 2V1YA 3ZVVA 1WJNA 2LRWA 2JZZA 3S2AA 2KC2A 2DZKA 1QZEA 1V2YA 3QJZA 3KUCB 2IY0B 3PVLA 2KX0A 2MBQA 1YX5B 5DPSA 3PREA 4NQKE 4FLHA 2MW5A 3PZDA 2DYBA 4ANXA 3WAMA 1GC7A 1V5OA 1I35A 2G4DB 3W1SA 2LI5A 1Z5SB 2D10A 3ALBA 2N9EB 3TJPA 2BPSA 2KOXA 4WWOA 1WYWB 4WJNA 3QQ8B 3WIMA 4A3PA 4IC7B 2O6VA 1FXTB 3L54A 2KK8A 3A9KB 3N30A 4EKUA 4HLEA 1V9JA 2LXAA 2NBVB 4KDLB 2A4ZA 5LXIB 2IZVB 2M17A 4ICVA 2L7RA 3D32A 5E6PA 1S1QB 3UQBA 3QX1A 4BOZB 2LGDA 2MSED 3NY5A 1IP9A 1WR6E 2RSUA 1SE9A 3I3TB 3C0RB 4E74A 2KWUB 3ENEA 1ZW7A 1WH3A 1C3TA 3M95A 4ZRJA 2RR9A 2ZNVB 4NPNA 3ZTCA 2KTRB 2KN5A 1ISNA 4AP4C 2BYFA 2FCNA 3QAQA 4J6IA 2FIFA 5CHVC 4I6LB 2K39A 1WI0A 4GOCA 4WAAA 1P1AA 3QC8B 5TR5A 1WGGA 2QHOA 3NS8A 4FA6A 4IM3A 1KLVA 2KWVB 5DPRA 3A1QA 1WXAA 4TUUA 3APDA 3AU5A 2ZVNA 4TQ1A 2L0TA 3APFA 4ZDVA 3M63B 4XX5A 3W1SC 4MH0E 2BKRB 3PHWB 1WFYA 3KH0A 2KANA 2JVCA 2JY6A 2MP2A 2PPHA 3PV1A 2AYOB 2KDEB 2KLGA 5CHWA 3ZNZB
chains in the Genus database with same CATH superfamily
3T3NA 2JRHA 3NUHB 3CSTA 3T8MA 4RM8A 2KXJA 2Y3AA 2LGYA 3ZLZA 1RM6C 5JHBA 1LGRA 5JHAA 3CF6E 1FRDA 3KWLA 4HPMB 4ARIA 3DVNU 4REZA 1K51A 2BVCA 4PS8A 1D5ZC 1UH6A 4YSXB 4LNIA 2AQ1B 1EWCA 1STEA 1EO6A 2IO3B 2HTME 2JPHA 3DBHB 4FADA 3I57A 2JWUA 4DK5A 5AUKA 3L08A 4MJSB 3UGBB 2KT7A 3N20C 2GB1A 2WXGA 2LGIA 4MDKE 2ZJDA 1XO3A 2L76A 1YMHE 1YIWA 4EZJA 2H88B 3Q3JA 3P4PB 2WXHA 3PO0A 2PW9A 3N1XC 1JWSD 4KIKB 3IBEA 2G9HD 4WJQA 2MCNB 4YWGG 3L4PA 3DPDA 4O1NA 3RZWC 2N9PC 4A90A 2FUG1 3QCAA 3R8BA 1QKZA 2GBNA 3FAHA 3HHMA 3L10B 1KF6B 2KTFA 1R4MB 1NBFC 2FCSA 1OEYJ 2FIDA 3TL5A 1E5WA 1C4CA 2DZJA 2WGSA 5BO4B 3ONSA 5HG2A 1B1ZA 1Q10A 2KJRA 2G4SA 3P4SB 5IA7A 5GXGB 3JSVA 2RDBC 3AB5A 1VJKA 2M0XA 1RYJA 1VLBA 1DOIA 2YVCA 1FXIA 3DQVA 2BS2B 3NJTA 4TSSA 4OHJA 2MLBA 4K7SA 3DOWA 2BWFA 4GDLB 2LUMA 2WNMA 2J52A 3EHVA 3VRBB 2MRPA 1ROEA 2MQJA 4RM9A 2WYQA 5IP4D 3HRDD 1XCQL 1CZPA 1K53A 2KMAA 2K8CA 3WANA 2ACZB 2OHFA 3AM9A 3HM6X 4HCNB 3SU8X 1L2NA 2JZ3B 4CQNA 4HJKA 5EE3A 3PPAA 4GMVA 4W9GA 3Q3NC 2UU7A 3ZIMA 1FEHA 1E7PB 1G6JA 1TY2A 2MX2A 2FNJB 1WE6A 3NVVA 1ZOYB 3BINA 4A6QA 3BK1A 3N1ZC 1HZ5A 4N58A 4TKNA 3PLVA 2LWPA 3TEZA 4AUQC 2PKOA 1EF1A 2LGSA 1F77A 1MPEA 2NTSA 3B1LX 4JWSC 1SBBB 1TYGB 2INDC 4MSQB 1R4NB 2FCQA 1KLUD 4YTMB 3PRMB 2ZCBA 1C4PA 1NI2A 2KFKA 3PHXB 4EZLA 4MGYE 4AOFA 5BMHA 5IAAC 1WY8A 5L95C 4ZYNA 3BYTB 4C00A 2BW2A 3FC4A 2G45B 2KJHB 4M02A 4XWWA 4ARCA 3DBHI 2QEJC 2RMMA 3TMPB 1SJED 4A55A 3K9OB 2XBBC 3JYUA 3AEAB 1WGDA 2Y5PA 4RNAA 3MHSD 2LD9A 4ZYSA 2OEDA 1V80A 2IJ0A 3DBRI 1N5XA 3MHZA 3RFZB 4EZKA 1YJJA 1SEBD 3VXWA 4HVBA 3P42A 3B2FA 4WIPA 4M00A 2PE9A 3HVZA 1SIJA 2KNBA 4N9F4 3L17A 1WX9A 3ZYYX 2DWQA 2R61A 3W1YA 1C4AA 2B3AA 3GB1A 1F9JA 3A4RA 4B95A 4RF0A 4NQLB 4LK0M 3ZQ4A 2WXLA 3NRZA 5CTRC 4KV2A 1YNTE 1QT9A 3AE8B 1E7VA 1FO4A 1SE2A 2NR2A 3MC8A 4KGRA 3RMKC 4YSZB 1UGJA 2BKFA 1YN5A 2A5UA 1T0YA 3Q8EA 1WMHB 2I1KA 4N6EB 2WU5B 3UIPB 3L13A 3L16A 2W9NA 3WCQA 1N63A 1CK1A 2XK5B 5IN7A 1Y8RC 4F7ZA 1BUIC 1IGDA 1TTNA 1FCCC 3BY4B 5TSSA 2W3SA 4PS3A 4RGNA 4W9DA 1IBXB 2PJHA 3L0WB 2D11A 2KDMA 2GBRA 3JW0X 4MH8A 4MGIE 1JWMD 3IG3A 3VHTC 2CHWA 4L1BA 2UWQA 1C77A 2W55A 2Z0DB 1X1MA 1TT5B 1XT9B 3AE1B 5C3JB 5KHQA 2DZKA 4BZAA 1PGBA 3QJZA 2M0AA 2KX0A 3PREA 4NQKE 4FLHA 2ZW0A 1ZXHA 4ANXA 5D3IB 1TIFA 3W1SA 1Z5SB 3ALBA 2N9EB 4QAYA 2DNFA 3ZXVA 3AE6B 4WJNA 3QQ8B 4IC7B 4GLSC 2JX5A 2O6VA 2KK8A 3A9KB 5FKAC 1T0SC 5E6PA 3UQBA 3DWMA 3RNFC 3RN9C 3W2DA 1WR6E 2RSUA 3U52E 5HHDG 1WH3A 4ZRJA 2IGDA 1GPXA 4NPNA 1PDXA 2MJDA 3NS1A 2BYFA 4LNNA 4I6LB 5H92C 1VR9A 3AEGB 3QC8B 1WGGA 5TR5A 1SF0A 4IM3A 4FA6A 1MG4A 2KWVB 4TUUA 3KLSX 3AU5A 2ZVNA 2N0SB 1SE4A 3W1SC 4XX5A 4MH0E 3PHWB 3Q8BA 2PPHA 2JY6A 1VZ7A 3Q3FA 2AL3A 4E3CA 2RDHA 2OOBB 3VR8B 4A9AA 4GSWA 3U2SC 3H7PB 1LFDA 4BBNF 4HDOA 2KX3A 2NBUA 3DHGC 1PUTA 4DXAB 2PIAA 4WAFA 2LFIA 1WSPA 2CU3A 2KQ7A 1I42A 1AYFA 1L4DB 2DZMA 3RNGC 4BKSA 4P16A 1B9RA 1ZDVA 4L2YA 4W9IA 4NJ6A 4GGQA 2BYTA 4NAWB 1MHXA 3TUOA 3Q8CA 1AWDA 3AE3B 1MVKA 2N7DA 4KZCA 5H8YE 1SJHD 2PMVA 1YOVB 4FJYA 2N9LA 2BS4B 3DHIC 1T5XD 4NZLB 5G55A 2MWSB 1WE7A 4FHKA 3AV8A 3UF8A 1I4XA 2E6XA 2L83A 5EDSA 1D4BA 1T3QA 1WM2A 4P6VF 4HXDA 1WX8A 1I4RA 5BYRA 1UBIA 3DCGA 2JUOA 2YLMA 4IM0A 4EEWA 4JE3B 1HTQA 3OJ4B 1QLBB 1Q1OA 2HE7A 4A3OA 3VQIA 2WDQB 5JXVA 5D7GA 4HDQA 1C78A 5AZHA 2QILA 3TEWA 3ZDMC 2Z59B 3CIRB 1OTRB 3X23A 4NY0A 3ZNHB 2KN4A 1BXTA 2BYVE 1IUEA 1IYFA 2BB5A 2KQ4X 3AECB 3AEDB 3GE3C 2HJ1A 1JROA 1NEKB 1OQYA 3TCAA 1K52A 1F2RI 4GB9A 1E8WA 3QK0A 4JLCA 4FJZA 1QOGA 2NS5A 2KWCA 3DBLI 4HCPB 3A9JA 3MP9A 5BYQA 4FBJB 2MH7A 2CHZA 2I1JA 3WA0A 4PYUA 3I5JC 5E6JA 2RGFA 3VDZA 3U8ZA 4XYCA 2N1VA 2K8BA 4J3OD 4JPSA 4EUTA 4FN2A 3VH3B 3ETRA 3P2BA 1LM8B 5EE0A 1TKEA 2VZKB 1FM0D 2IY1B 1JCKB 5J18A 1TY0A 2NVUI 4RMAA 3NHEB 3MTNB 1JMLA 3OWEB 1IPGA 4ZOHC 3FILB 2NTTA 1MHHE 3IVFA 5FK9C 2QJLA 4ZHOA 1MI0A 4ASWC 2KC1A 3RYTA 2CR5A 1C76A 3VAWA 2FCMA 2VH2A 2DX5B 4K1RB 1YQ3B 1M94A 2YEPB 4RH6A 3AE4B 2L52A 3GZNB 3IT6B 4TQ0A 3BK2A 2D3AA 4MJSA 1J7BA 2V4LA 4GDKB 4BAXA 1ZUD2 4OZBA 3O13A 1FFVA 1XD3B 4PK1A 4US9A 3NZUA 1YQBA 4LDTB 3DVNV 1OQRA 1HXYD 2XEWA 3AMZA 4MT5A 4P1CC 1FNVA 3V05A 1ZP0B 5D6JB 3UINB 1OQQA 4JWUC 2KKCA 1GUAB 1XLNA 4EFOA 4FJVB 2K8HA 2SAKA 5T8IA 3H7SA 2RD0A 1GJZA 3VUXA 4PS7A 2C60A 2XNAC 4IOIE 3ZUNA 3NVWA 2ZPNA 3Q8AA 4XDDA 1K8RB 5LNK1 2WWZA 3ZNID 1WXMA 3RI7C 1KJTA 3IXSA 5DPTA 2WX1A 3DBSA 2AEHA 4ZRQA 4XC2A 3TSSA 2C7MB 3WAOA 1JWBD 2K5PA 2XN9C 1P9DU 4C7YA 2I2YA 4K3BA 2LJIA 1J19A 3LDZE 1P7FA 3JSVB 4JL9A 3QA8A 2JU6X 1TJEA 1I4GA 4MEMA 1GC6A 3LYYA 3CWIA 4GDLA 3P1MA 4MELA 4R3DA 3A4SC 2GMIC 2HD5B 2DAFA 1QILA 1R7SA 2VZKD 4CHKA 4DHZE 1JWAD 4IW0A 3GS2A 3OJ3A 1PYWD 2D07B 1ZPSA 4BBNC 3KUDB 3UI3A 4LLGM 3ZO5B 1GB4A 4KGTA 1PGAA 4G11A 4LNOA 5C1ZA 2WHIA 2R2OA 2KHWB 3MFGA 5HI1A 2L00B 4NJCA 1MJDA 4PT5A 5FR6A 5AUIA 2LGXA 3BIID 3EC8A 3IFWB 4IKGA 4M01A 3VFKA 2QCZA 2C5LC 2LXCA 3VTUA 2MJEA 4WJOA 4G50A 4DHZB 3ZDTA 4W9LA 1QF6A 4LDTD 2UYZB 1V49A 2KLCA 3B0AA 1CQVA 2K9XA 4RGTA 3ZKJC 2PE6B 2LJ5A 3ZJUA 1L4ZB 1K50A 1GNUA 2ZPYA 2K6QA 2O2VB 4D2KA 3W5UB 2ZVOA 4ICUA 2K1FA 4B0EA 1YQ4B 3DHHC 1I7HA 1V86A 2WXPA 2SEBD 3ZVVA 2LRWA 3U4EG 2AQ2B 1JQ4A 1V2YA 2Y5CA 4HKZE 3KUCB 5DPSA 2WDVB 3WAMA 1GC7A 1ESFA 1V5OA 1XLQA 1I35A 1TKGA 4L23A 2LI5A 2PVOD 2D10A 3TJPA 4DQOC 2BPSA 1I4HA 2WS3B 1LO5D 4EKUA 4HLEA 2JSVX 1V9JA 2LXAA 4KDLB 2A4ZA 5LXIB 2IZVB 3D32A 4WQMA 1E6EB 1S1QB 2E3TA 3QX1A 3AH7A 1SSNA 3NY5A 1IP9A 2BB6A 2ZNVB 3ZTCA 2FCNA 5CHVC 3AE5B 2FBWB 4ACFA 2QIEB 2X38A 2QHOA 1FNWA 3NS8A 5DPRA 4OW0A 4FXCA 1KTKA 3APDA 3ABVB 4TQ1A 2L0TA 1UNSA 3M63B 2WP9B 3KH0A 3PV1A 4MACA 2KLGA 2KDEB 1AN8A 4OVZA 2JZPA 2LVQA 3SEBA 4CO7A 1R4MI 3EGRA 3PRPB 4EOYA 5E6NA 1A5RA 3RCZA 1CMXB 1SGHA 1WF9A 3MJWA 2HJ8A 1NI3A 2KAJA 2MJ3A 1PFDA 2NBWB 5AZGA 3DVGY 2GBJA 3A33B 1L7YA 4AWJA 1TS4A 1HTOA 1LQBA 4I6PA 1WMHA 2Z8LA 3MC9A 3ECIA 1WJ4A 2MBBB 2QC8A 2XK5A 3PLUA 5G5GA 2OJWA 3GP7A 5EE9A 3KVFB 1UWXA 1WGRA 2FAZA 4KSLC 1IBXA 4JGHB 3RULA 1T0RC 4M8MA 3EECA 2C7HA 2FUHB 1WGHA 1Y56A 4DHJB 2WDRB 4KKJA 2MBHA 3H9DA 4W9FA 1OFFA 1DGJA 1LXDA 2KMCA 3OLMD 4K81A 1GAQB 4S17A 4BVUC 1HEZE 3RNEC 1YD8U 3ML9A 2J42A 2KACA 5HKHA 1YN3A 2WXFA 3VUWA 5JZEB 1P98A 4W9KA 3I63C 3ZJVA 3E56A 4K7UA 2IYDB 4ZRKA 2AX5A 1E8ZA 4W9CA 3A9KA 2PVGC 1DOYA 1F2RC 4RFBA 4RGMA 1WM3A 4WURA 4TMAB 4OVVA 1C1YB 2JYTA 1YJIA 3IT4B 2V3SA 2O6VB 3FKYA 2J53A 3SFEB 2G3QB 1V1PB 2J0MA 2K6DB 1ET6A 2NPTB 1R4NI 1QOBA 4ANUA 1FFUA 5C23A 4KGSA 1HE8A 1TS5A 1Z2MA 2LASA 3CSFA 2REXA 1FXAA 3AEBB 1L0VB 2M1MA 3SFDB 4JQWC 4TV3A 1J0GA 1F1HA 2KDBA 4IWOA 4YTNB 1E8XA 1ZDXA 1QOAA 3Q69A 1NENB 1XEEA 4DDID 5DCNA 2KO3A 2KWDA 3VRAB 3H7PA 5LLIA 2EKIA 2LVOA 3PSEB 3R2TA 1SB3C 1RLFA 2N1WA 2RPVA 2PEAA 4BFRA 2IO1B 3ZGZA 2BS3B 2EMSA 1V6EA 4LNKA 3ZRFA 3M3JA 1FCLA 1ZE3D 4RF1A 2KQSA 1TKYA 1JW9D 1L0YB 3PRZA 2C7NB 3BVMA 4HK2A 4NAWA 1UUPA 4FHJA 2J4XA 2NMQA 3IAS1 1AW7A 4NAMA 4AS1A 4MM3B 1JRUA 1MFWA 4E71A 1WJUA 4C4VB 2RDGA 4II3B 4US8A 2WXNA 3P63A 4DHJD 3AEEB 1WGKA 3VUYA 3SHQA 3UIOB 2AL6A 2D2QA 2M8SA 4M0WB 3CMMB 3EA6A 2MBEA 5CHFA 2LMCA 3Q2AC 3JVZX 3BWUD 2MA9B 1VD2A 2D3CA 4K3CA 1L6VA 4MGZE 1KRHA 3WAPA 1J7AA 3T3OA 5CX3A 2JXTA 4USAA 2V0GA 2ASQA 3BVZA 3LXFA 3RPFC 3BYYB 3DDCB 1FNUA 3OG5A 1SIFA 3EFCA 2KDIA 3RNAC 3V62A 4A8XC 2O6VD 3UQAA 1YN4A 4PYZA 5G5HA 2KTRA 3Q6BA 1OGWA 1EU4A 3BVGA 2LZ6A 4B6WA 3V3XA 3B2GA 4RGOS 1ZGUB 2KVZA 3AI5A 1YJ1A 2ZEQA 2TSSA 2KZRA 3X0WA 4X57B 1T0QC 4AJWA 1TZ1A 1E8YA 3J9CA 1WZ3A 2LVPA 4C7ZA 3A1QB 2VRRB 2EELA 1V5TA 1HZ6A 1VRAB 3DVGX 4YL8A 2BGFA 2LRUA 3KUZA 3RZFA 1P7EA 2C9WB 2MP2B 3C8YA 3A9JB 4XE0A 5D3DA 2WXJA 2WXIA 4GN1A 5D2MB 5JH5C 2BYEA 3RNCC 3TEXA 2IBIB 3HUIA 4URKA 1J8CA 2L0FA 3W5VB 3FILA 2HTHA 5GMVA 2RPQA 4GU2A 5FR3A 3PZ7A 4UDUC 5MPOA 2J7QB 5DPWA 5E6OA 4BKSD 2INNE 2MEKA 2EKEC 3PZ8A 1UF0A 5J2RA 4ZRIA 1VZ8A 2WLBA 2ICIA 1KM7A 2D3GA 4GDKA 4II2B 1EUVB 1UGMA 4LJPB 3BZDB 1XLOA 3W9CB 1H8CA 2AQ3B 3VH4B 3WALA 1QOFA 4YXDB 1TZOA 4B9KA 3U30A 2NCNA 3NZ3A 1TS2A 3M62B 1UELA 1RAXA 1NYQA 3NZSA 4KIKA 1TGZB 1H4RA 4XWTA 3DBRB 3C19A 4YSYB 1ZKHA 1WJNA 3S2AA 2KC2A 2D5GA 2IY0B 2W54A 1D5XC 2MBQA 4C56C 3AE2B 1E10A 3PZDA 4YTPB 2GLSA 3I9V1 3IAM1 1ENFA 3AE7B 1WYWB 3WIMA 3L54A 1SXTA 2JQRB 3AN1A 2NBVB 1WWTA 2M17A 4ICVA 1D5MC 1HA5A 3KWVA 4BOZB 1DOXA 4HKQA 3U7ZA 1SE9A 3I3TB 3ENEA 1C3TA 1SE3A 2RR9A 4XDCA 3Q8FA 4AP4C 2FIFA 1GOZA 1UWMA 4WWMA 3NVZA 1WI0A 3LB8C 4GOCA 3NG0A 1KLVA 1E9MA 2GI9A 4ZRPA 3H8HA 3APFA 3HVDA 2BKRB 2KANA 4ZHPA 1WRIA 1N60A 2WXKA 2ZCCA 3VTVA 1ET9A 2CHXA 3B08A 5LXHA 2V3PA 1BT0A 1KLGD 2INCC 3SR6A 4KSKC 1TS3A 2KMMA 5IKCM 4OVUA 2GBMA 4JIOU 1WGYA 2QSDA 2KDFB 2D3BA 1FD6A 3V6EB 2X8XX 4WWPA 4KDIC 2IO2B 3PGEA 4LJOB 2WXRA 1A70A 4DXGA 4P1BC 2HDEA 2M19A 1FIQA 2ON8A 1UBQA 3IHPC 2L8JA 3Q14C 4Q2JA 1KFYB 1M4VA 1WXSA 1JRPA 2BWES 1N61A 1F0ZA 2K25A 2WX0A 4OZAA 1NDDA 2O2VA 1GB1A 2JXXA 3V60A 1WRDB 1WZ0A 1ZXIA 2G1EA 1XQQA 3KW5B 3H1UA 4HRSA 1UD7A 3EFUA 4DBGA 4YT0B 2B76B 1FRRA 4G0NB 1WR1A 4HEA1 1C79A 2DYMA 1IGCA 3GOEA 2KFKB 1KH0A 4HJGE 3R7QA 4XZ4A 2J0KA 1Q0WB 3VR9B 1WXQA 4K7WA 2ZW1A 4KX6B 2L05A 4KKIA 4JX1C 3Q3MC 1XCTL 4AJYB 2IO0B 3GZNI 1RFKA 3ZNGC 2DENB 3LJ3A 2W82A 3MC0B 2CS4A 4AQ7A 4HPLB 2N4FA 3OAWA 2LEKA 1EM7A 4NNJB 1NYRA 4GXBA 2PLPA 5EE1A 4KVGB 4WWNA 2L1AA 4LNFA 4IWQA 3QIJA 1EF5A 1E90A 2WDTB 3KYCD 4ITKA 1JALA 5AZFA 4HWIB 1U4AA 2KFJA 2ZZPB 4MSMB 4W9HA 5HFYA 2JT4B 4C80A 2IPKD 1FMAD 3AEFB 2ZNVC 2WQYB 3QHTA 3RNBC 1JWUD 2KD0A 2DZIA 4RCOA 1CJEA 4IG7B 2R2QA 1S3SG 1I4PA 3TEYA 5G2NA 2J0JA 2MBOA 3SD5A 2BBCA 4B0MA 1P0RA 1V1OA 2GOWA 4WQOB 4IWPA 4M8NA 1GG3A 1TBEA 3PT2B 3TBLD 2CU1A 2JWZA 5C2TB 2DHZA 1VCBA 2IGHA 2BT6A 2JRIB 2BQQA 1AARA 4DXFA 1EU3A 4DWFA 3T9LA 3O65B 4LTUA 3SDLC 2V9HA 2YEPF 4W9JA 3V61A 4ANWA 3DBLB 2CJNA 3QARA 4BOSC 1YX6B 3HM3A 4I6NB 3RT3B 1VZ6A 1HQRD 2K0PA 3R3MA 5J17A 3AXCA 1MG8A 1WXVA 2MHJA 4MGKE 4WJPA 4DDGD 3AE9B 3KYDD 1T6BX 3ML8A 2QDFA 4GIVA 3VVWB 2AWTA 1WX7A 2INPE 3MJ5A 2OJRA 2N7EA 2N9XA 2DBYA 2M56B 1D6EC 1WJ6A 2N7JA 1V1PA 4WH4A 4BKGA 2NPTA 1FPYA 1E7UA 3RUIB 3B9JA 4LCDE 1WYGA 3NOBA 1WIAA 2GRIA 3ZRCA 2H89B 3P4QB 2WXOA 4FULA 1L5PA 3PS6A 1N5WA 1L0XB 1UZXB 4F1SA 1PGXA 1L6UA 4NJ7A 2KYWA 3HIZA 1EWYC 1V8CA 1J7CA 3E9SA 3R2IA 1XLPA 1XF5L 3R66C 3KQ4A 3RD2A 2JF5A 2N9KA 3P4RB 3PTFC 3ZJTA 2EMTA 5AEKB 5L83A 2BF8B 3APCA 3AU4A 3ZTDA 1P3QU 1RRBA 3Q3OC 2LUEA 1RFAA 2VH1A 2DYOA 4F8CB 2L32A 1C9FA 2QMTA 1OEYA 1Q5WB 2GBKA 1PQSA 5D94A 1BMLC 3N32A 3AULA 2DAJA 3R7RA 3H6NA 5KHOA 3HK0A 1V97A 4KZ0A 1E0ZA 4P7IA 2PTLA 2I38A 4ANVA 4IUMB 2Y5BB 4CYEA 2IDYA 3TIXA 2M4NA 4MM3A 4G3XB 2L3ZA 2WU2B 2Z0EB 1N62A 3GE8C 3N3KB 3ZW3A 4W9EA 3ZXRA 2KJ6A 2CKHB 3EUB2 1RWSA 2K3UA 1D3ZA 4C4VA 4OZCA 3U7DA 1V81A 3K9PB 4S0RA 4H2AA 5BMIA 1XXGA 3QWZB 3V6CB 1F52A 4M0WA 4BKTA 1DYQA 2LHEA 3N1YC 3VTWA 5BYSA 3N9YC 4N59A 4IM2A 4A20A 1KOTA 2KVRA 2V1YA 1N6ZA 2LHDA 2JZZA 1QZEA 4HPPA 3PVLA 2JYEA 1YX5B 2V3NA 5IOIA 2MW5A 2DYBA 1VDVA 2G4DB 2Q5WD 2KOXA 4WWOA 4A3PA 1FXTB 2WXQA 3N30A 2L7RA 2BTEA 2LGDA 2MSED 4HROA 3C0RB 4E74A 2KWUB 1ZW7A 3M95A 1ACCA 2DLBA 3URYA 2FE8A 2KTRB 2WXMA 2KN5A 1ISNA 4J6IA 3QAQA 2IGGA 1I4QA 2K39A 5IO9A 4XGAB 4WAAA 1P1AA 1NVID 2K22A 3A1QA 1WXAA 1QQRA 2W3RA 2CJOA 3DWGC 4ZDVA 4IDIA 2ONQA 4EE2A 1WFYA 2JVCA 2MP2A 2AYOB 5BMGA 5CHWA 5I4DA 3ZNZB 2V4IB 3NVYA
chains in the Genus database with same CATH topology
3Q3FA 2LVQA 2AL3A 2ZCCA 3VTVA 4E3CA 2JRHA 4CO7A 2OOBB 1R4MI 2CHXA 3PRPB 3B08A 3CSTA 4GSWA 5LXHA 3T8MA 3H7PB 4RM8A 4EOYA 1LFDA 5E6NA 2KXJA 1BT0A 4BBNF 1A5RA 4HDOA 2KX3A 2NBUA 3RCZA 1CMXB 1SGHA 4DXAB 2LGYA 4KSKC 3ZLZA 1WF9A 5JHBA 3MJWA 2HJ8A 1I42A 2KQ7A 5JHAA 3CF6E 4HPMB 2DZMA 4BKSA 3DVNU 2NBWB 4OVUA 2GBMA 4JIOU 1WGYA 4PS8A 5AZGA 2KDFB 3DVGY 2GBJA 3A33B 1L7YA 1UH6A 4AWJA 3V6EB 4WWPA 4KDIC 2IO2B 1LQBA 3PGEA 4LJOB 4W9IA 4I6PA 1WMHA 4NJ6A 4GGQA 3ECIA 4NAWB 1WJ4A 1EO6A 1UBQA 2MBBB 2IO3B 2JPHA 2XK5A 3IHPC 2N7DA 4FADA 3PLUA 2L8JA 4KZCA 4FJYA 3KVFB 4DK5A 3L08A 1WGRA 2FAZA 4KSLC 4MJSB 1WXSA 3UGBB 2BWES 5G55A 2MWSB 4JGHB 3RULA 4M8MA 3EECA 2K25A 1WE7A 4FHKA 3UF8A 2WX0A 1NDDA 2C7HA 2O2VA 2JXXA 2FUHB 4MDKE 3V60A 1WRDB 1WGHA 1WZ0A 2ZJDA 4DHJB 2L76A 5EDSA 1XQQA 2MBHA 1YIWA 3KW5B 3H9DA 4EZJA 3H1UA 4W9FA 3Q3JA 1UD7A 3EFUA 4DBGA 1LXDA 2KMCA 3OLMD 4K81A 4G0NB 1WR1A 1WM2A 4BVUC 4KIKB 3IBEA 2DYMA 1YD8U 3ML9A 4HXDA 3GOEA 2KFKB 5HKHA 4WJQA 1WX8A 2MCNB 3R7QA 4XZ4A 3VUWA 1UBIA 5JZEB 3DPDA 3RZWC 1P98A 2J0KA 2N9PC 1Q0WB 3DCGA 4W9KA 4K7WA 2JUOA 2YLMA 2L05A 4IM0A 4EEWA 4K7UA 2IYDB 3OJ4B 3QCAA 4ZRKA 1Q1OA 2HE7A 4AJYB 2GBNA 2IO0B 3GZNI 3HHMA 4W9CA 1E8ZA 2DENB 3ZNGC 3A9KA 3L10B 4A3OA 3VQIA 2KTFA 3LJ3A 2CS4A 5D7GA 4HDQA 1NBFC 5AZHA 1WM3A 2FCSA 4HPLB 1OEYJ 2N4FA 2FIDA 3TL5A 1E5WA 1C1YB 4OVVA 2Z59B 3OAWA 1OTRB 2DZJA 3X23A 3ZDMC 4NY0A 4NNJB 3ZNHB 2V3SA 2O6VB 2BYVE 1IYFA 2G3QB 4GXBA 5BO4B 2J0MA 2K6DB 3ONSA 2NPTB 2KJRA 3TCAA 1OQYA 2G4SA 1R4NI 5IA7A 4KVGB 3JSVA 4WWNA 4GB9A 5C23A 1E8WA 4ANUA 1HE8A 2M0XA 1Z2MA 2LASA 3QK0A 3CSFA 2YVCA 2REXA 4IWQA 3DQVA 4JLCA 3QIJA 4FJZA 2M1MA 2NS5A 1EF5A 4JQWC 1E90A 2KWCA 4TV3A 3DBLI 2WDTB 4HCPB 1J0GA 3KYCD 2KDBA 3A9JA 4IWOA 4FBJB 1E8XA 2CHZA 2I1JA 3WA0A 4PYUA 2MLBA 4K7SA 2RGFA 3DOWA 5AZFA 3VDZA 2BWFA 3U8ZA 4HWIB 4DDID 5DCNA 2KO3A 4GDLB 2N1VA 1U4AA 2K8BA 4EUTA 2KFJA 4FN2A 2ZZPB 3EHVA 4MSMB 3VH3B 3P2BA 1LM8B 4W9HA 3H7PA 2MRPA 2JT4B 5LLIA 2LVOA 2IY1B 2MQJA 4RM9A 2WYQA 3PSEB 2ZNVC 5J18A 3QHTA 2NVUI 1RLFA 2N1WA 2PEAA 2KD0A 2DZIA 3NHEB 4RMAA 3MTNB 4BFRA 2KMAA 2IO1B 1IPGA 2K8CA 2EMSA 3WANA 1V6EA 3ZRFA 4IG7B 2R2QA 3HM6X 4HCNB 3IVFA 3SU8X 3M3JA 1L2NA 2JZ3B 1S3SG 4HJKA 2KQSA 5G2NA 2J0JA 3PPAA 2MBOA 3SD5A 3PRZA 4GMVA 4W9GA 4ASWC 2KC1A 3RYTA 1P0RA 2CR5A 2C7NB 3ZIMA 2GOWA 4HK2A 4IWPA 4WQOB 4NAWA 4M8NA 2FCMA 3VAWA 1GG3A 4FHJA 1G6JA 2DX5B 1TBEA 2MX2A 3PT2B 4K1RB 3TBLD 2CU1A 1M94A 2JWZA 2FNJB 1WE6A 2DHZA 3BINA 1VCBA 1JRUA 4TQ0A 4E71A 4MJSA 2V4LA 2JRIB 4GDKB 1WJUA 1AARA 4TKNA 3PLVA 4II3B 2LWPA 1XD3B 4AUQC 3NZUA 1YQBA 4LDTB 1EF1A 3DVNV 4DWFA 4DHJD 3VUYA 3T9LA 3O65B 3SHQA 3B1LX 3UIOB 2AL6A 2D2QA 2M8SA 2XEWA 3SDLC 4M0WB 3CMMB 4MSQB 2FCQA 5D6JB 2MBEA 5CHFA 3UINB 3JVZX 2KKCA 1GUAB 4W9JA 2MA9B 3V61A 4ANWA 1VD2A 4EFOA 3PRMB 2ZCBA 4FJVB 2K8HA 4MGZE 1NI2A 3WAPA 2KFKA 3H7SA 3QARA 4BOSC 1YX6B 3HM3A 2RD0A 3PHXB 1GJZA 5CX3A 4I6NB 3RT3B 4PS7A 3VUXA 2C60A 4EZLA 4MGYE 4AOFA 5IAAC 3R3MA 5J17A 2ASQA 3AXCA 3ZUNA 1MG8A 1WY8A 1WXVA 5L95C 4ZYNA 2ZPNA 3DDCB 1K8RB 2G45B 2KJHB 4MGKE 4WJPA 1SIFA 3DBHI 2KDIA 4DDGD 3KYDD 2WWZA 3ML8A 4GIVA 3VVWB 2AWTA 1WX7A 3V62A 3ZNID 3TMPB 2O6VD 1WXMA 3K9OB 3UQAA 2OJRA 1KJTA 2N7EA 2N9XA 2KTRA 2XBBC 1WJ6A 3JYUA 4PYZA 1WGDA 4BKGA 2NPTA 1OGWA 5DPTA 2WX1A 3DBSA 1E7UA 2AEHA 2LZ6A 4XC2A 3RUIB 3MHSD 2LD9A 4B6WA 4LCDE 3NOBA 1WIAA 1ZGUB 2C7MB 3ZRCA 3AI5A 3WAOA 1YJ1A 1P9DU 2ZEQA 1V80A 2KZRA 3DBRI 3X0WA 4FULA 4X57B 4AJWA 1J19A 3PS6A 1TZ1A 1E8YA 3LDZE 1UZXB 1WZ3A 2LVPA 4EZKA 4F1SA 3JSVB 4JL9A 4NJ7A 3VXWA 4HVBA 3HIZA 3QA8A 4MEMA 3A1QB 2VRRB 1GC6A 1V5TA 3DVGX 4YL8A 2BGFA 2LRUA 3R66C 4GDLA 2PE9A 2KNBA 4MELA 4N9F4 3KUZA 3L17A 3RZFA 3A4SC 2C9WB 2GMIC 2MP2B 2JF5A 1WX9A 3RD2A 2HD5B 3A9JB 2DAFA 3PTFC 2EMTA 3W1YA 5AEKB 4CHKA 4GN1A 2BF8B 3APCA 2B3AA 4DHZE 5L83A 3AU4A 4IW0A 3ZTDA 1P3QU 1RRBA 3OJ3A 2D07B 5D2MB 1F9JA 3A4RA 4B95A 5JH5C 2BYEA 2LUEA 1RFAA 2IBIB 4BBNC 2DYOA 3KUDB 4F8CB 4NQLB 4URKA 1J8CA 3ZO5B 2L0FA 1OEYA 5CTRC 2HTHA 4KV2A 5GMVA 2RPQA 4G11A 4GU2A 5C1ZA 1Q5WB 2GBKA 1PQSA 2R2OA 1E7VA 2J7QB 2KHWB 5D94A 3N32A 5DPWA 3AULA 2DAJA 2NR2A 3R7RA 3H6NA 5KHOA 3HK0A 5E6OA 4BKSD 4KZ0A 2L00B 4P7IA 2BKFA 2EKEC 2A5UA 1T0YA 5FR6A 4ANVA 4IUMB 5J2RA 2Y5BB 4CYEA 4ZRIA 2LGXA 1WMHB 2I1KA 3EC8A 3IFWB 3TIXA 3VFKA 2M4NA 3UIPB 3L13A 2C5LC 2L3ZA 2LXCA 2Z0EB 3L16A 3N3KB 2W9NA 4G3XB 4MM3A 3VTUA 3ZW3A 2XK5B 4W9EA 2KJ6A 2CKHB 4WJOA 1Y8RC 4F7ZA 4G50A 4DHZB 1KM7A 2D3GA 4GDKA 4II2B 1D3ZA 1EUVB 1UGMA 4LJPB 3U7DA 3ZDTA 4W9LA 1TTNA 3BY4B 1V81A 1H8CA 3K9PB 4LDTD 2UYZB 3VH4B 3WALA 4PS3A 1V49A 2KLCA 3B0AA 4W9DA 2PJHA 3L0WB 3ZKJC 3QWZB 3U30A 2PE6B 2LJ5A 3V6CB 4B9KA 2D11A 2NCNA 1GNUA 2ZPYA 3M62B 4BKTA 2GBRA 2K6QA 2O2VB 1UELA 1RAXA 3NZSA 4KIKA 3JW0X 3VTWA 2ZVOA 4MGIE 3IG3A 4ICUA 3VHTC 2K1FA 1TGZB 1H4RA 2CHWA 2UWQA 4IM2A 4A20A 2Z0DB 1X1MA 1KOTA 1V86A 1XT9B 1ZKHA 5KHQA 2KVRA 2V1YA 3ZVVA 1WJNA 2LRWA 2JZZA 3S2AA 2KC2A 2DZKA 1QZEA 1V2YA 3QJZA 3KUCB 2IY0B 3PVLA 2KX0A 2MBQA 1YX5B 5DPSA 3PREA 4NQKE 4FLHA 2MW5A 3PZDA 2DYBA 4ANXA 3WAMA 1GC7A 1V5OA 1I35A 2G4DB 3W1SA 2LI5A 1Z5SB 2D10A 3ALBA 2N9EB 3TJPA 2BPSA 2KOXA 4WWOA 1WYWB 4WJNA 3QQ8B 3WIMA 4A3PA 4IC7B 2O6VA 1FXTB 3L54A 2KK8A 3A9KB 3N30A 4EKUA 4HLEA 1V9JA 2LXAA 2NBVB 4KDLB 2A4ZA 5LXIB 2IZVB 2M17A 4ICVA 2L7RA 3D32A 5E6PA 1S1QB 3UQBA 3QX1A 4BOZB 2LGDA 2MSED 3NY5A 1IP9A 1WR6E 2RSUA 1SE9A 3I3TB 3C0RB 4E74A 2KWUB 3ENEA 1ZW7A 1WH3A 1C3TA 3M95A 4ZRJA 2RR9A 2ZNVB 4NPNA 3ZTCA 2KTRB 2KN5A 1ISNA 4AP4C 2BYFA 2FCNA 3QAQA 4J6IA 2FIFA 5CHVC 4I6LB 2K39A 1WI0A 4GOCA 4WAAA 1P1AA 3QC8B 5TR5A 1WGGA 2QHOA 3NS8A 4FA6A 4IM3A 1KLVA 2KWVB 5DPRA 3A1QA 1WXAA 4TUUA 3APDA 3AU5A 2ZVNA 4TQ1A 2L0TA 3APFA 4ZDVA 3M63B 4XX5A 3W1SC 4MH0E 2BKRB 3PHWB 1WFYA 3KH0A 2KANA 2JVCA 2JY6A 2MP2A 2PPHA 3PV1A 2AYOB 2KDEB 2KLGA 5CHWA 3ZNZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q3F A;  2LVQ A;  2AL3 A;  2ZCC A;  3VTV A;  4E3C A;  2JRH A;  4CO7 A;  2OOB B;  1R4M I;  2CHX A;  3PRP B;  3B08 A;  3CST A;  4GSW A;  5LXH A;  3T8M A;  3H7P B;  4RM8 A;  4EOY A;  1LFD A;  5E6N A;  2KXJ A;  1BT0 A;  4BBN F;  1A5R A;  4HDO A;  2KX3 A;  2NBU A;  3RCZ A;  1CMX B;  1SGH A;  4DXA B;  2LGY A;  4KSK C;  3ZLZ A;  1WF9 A;  5JHB A;  3MJW A;  2HJ8 A;  1I42 A;  2KQ7 A;  5JHA A;  3CF6 E;  4HPM B;  2DZM A;  4BKS A;  3DVN U;  2NBW B;  4OVU A;  2GBM A;  4JIO U;  1WGY A;  4PS8 A;  5AZG A;  2KDF B;  3DVG Y;  2GBJ A;  3A33 B;  1L7Y A;  1UH6 A;  4AWJ A;  3V6E B;  4WWP A;  4KDI C;  2IO2 B;  1LQB A;  3PGE A;  4LJO B;  4W9I A;  4I6P A;  1WMH A;  4NJ6 A;  4GGQ A;  3ECI A;  4NAW B;  1WJ4 A;  1EO6 A;  1UBQ A;  2MBB B;  2IO3 B;  2JPH A;  2XK5 A;  3IHP C;  2N7D A;  4FAD A;  3PLU A;  2L8J A;  4KZC A;  4FJY A;  3KVF B;  4DK5 A;  3L08 A;  1WGR A;  2FAZ A;  4KSL C;  4MJS B;  1WXS A;  3UGB B;  2BWE S;  5G55 A;  2MWS B;  4JGH B;  3RUL A;  4M8M A;  3EEC A;  2K25 A;  1WE7 A;  4FHK A;  3UF8 A;  2WX0 A;  1NDD A;  2C7H A;  2O2V A;  2JXX A;  2FUH B;  4MDK E;  3V60 A;  1WRD B;  1WGH A;  1WZ0 A;  2ZJD A;  4DHJ B;  2L76 A;  5EDS A;  1XQQ A;  2MBH A;  1YIW A;  3KW5 B;  3H9D A;  4EZJ A;  3H1U A;  4W9F A;  3Q3J A;  1UD7 A;  3EFU A;  4DBG A;  1LXD A;  2KMC A;  3OLM D;  4K81 A;  4G0N B;  1WR1 A;  1WM2 A;  4BVU C;  4KIK B;  3IBE A;  2DYM A;  1YD8 U;  3ML9 A;  4HXD A;  3GOE A;  2KFK B;  5HKH A;  4WJQ A;  1WX8 A;  2MCN B;  3R7Q A;  4XZ4 A;  3VUW A;  1UBI A;  5JZE B;  3DPD A;  3RZW C;  1P98 A;  2J0K A;  2N9P C;  1Q0W B;  3DCG A;  4W9K A;  4K7W A;  2JUO A;  2YLM A;  2L05 A;  4IM0 A;  4EEW A;  4K7U A;  2IYD B;  3OJ4 B;  3QCA A;  4ZRK A;  1Q1O A;  2HE7 A;  4AJY B;  2GBN A;  2IO0 B;  3GZN I;  3HHM A;  4W9C A;  1E8Z A;  2DEN B;  3ZNG C;  3A9K A;  3L10 B;  4A3O A;  3VQI A;  2KTF A;  3LJ3 A;  2CS4 A;  5D7G A;  4HDQ A;  1NBF C;  5AZH A;  1WM3 A;  2FCS A;  4HPL B;  1OEY J;  2N4F A;  2FID A;  3TL5 A;  1E5W A;  1C1Y B;  4OVV A;  2Z59 B;  3OAW A;  1OTR B;  2DZJ A;  3X23 A;  3ZDM C;  4NY0 A;  4NNJ B;  3ZNH B;  2V3S A;  2O6V B;  2BYV E;  1IYF A;  2G3Q B;  4GXB A;  5BO4 B;  2J0M A;  2K6D B;  3ONS A;  2NPT B;  2KJR A;  3TCA A;  1OQY A;  2G4S A;  1R4N I;  5IA7 A;  4KVG B;  3JSV A;  4WWN A;  4GB9 A;  5C23 A;  1E8W A;  4ANU A;  1HE8 A;  2M0X A;  1Z2M A;  2LAS A;  3QK0 A;  3CSF A;  2YVC A;  2REX A;  4IWQ A;  3DQV A;  4JLC A;  3QIJ A;  4FJZ A;  2M1M A;  2NS5 A;  1EF5 A;  4JQW C;  1E90 A;  2KWC A;  4TV3 A;  3DBL I;  2WDT B;  4HCP B;  1J0G A;  3KYC D;  2KDB A;  3A9J A;  4IWO A;  4FBJ B;  1E8X A;  2CHZ A;  2I1J A;  3WA0 A;  4PYU A;  2MLB A;  4K7S A;  2RGF A;  3DOW A;  5AZF A;  3VDZ A;  2BWF A;  3U8Z A;  4HWI B;  4DDI D;  5DCN A;  2KO3 A;  4GDL B;  2N1V A;  1U4A A;  2K8B A;  4EUT A;  2KFJ A;  4FN2 A;  2ZZP B;  3EHV A;  4MSM B;  3VH3 B;  3P2B A;  1LM8 B;  4W9H A;  3H7P A;  2MRP A;  2JT4 B;  5LLI A;  2LVO A;  2IY1 B;  2MQJ A;  4RM9 A;  2WYQ A;  3PSE B;  2ZNV C;  5J18 A;  3QHT A;  2NVU I;  1RLF A;  2N1W A;  2PEA A;  2KD0 A;  2DZI A;  3NHE B;  4RMA A;  3MTN B;  4BFR A;  2KMA A;  2IO1 B;  1IPG A;  2K8C A;  2EMS A;  3WAN A;  1V6E A;  3ZRF A;  4IG7 B;  2R2Q A;  3HM6 X;  4HCN B;  3IVF A;  3SU8 X;  3M3J A;  1L2N A;  2JZ3 B;  1S3S G;  4HJK A;  2KQS A;  5G2N A;  2J0J A;  3PPA A;  2MBO A;  3SD5 A;  3PRZ A;  4GMV A;  4W9G A;  4ASW C;  2KC1 A;  3RYT A;  1P0R A;  2CR5 A;  2C7N B;  3ZIM A;  2GOW A;  4HK2 A;  4IWP A;  4WQO B;  4NAW A;  4M8N A;  2FCM A;  3VAW A;  1GG3 A;  4FHJ A;  1G6J A;  2DX5 B;  1TBE A;  2MX2 A;  3PT2 B;  4K1R B;  3TBL D;  2CU1 A;  1M94 A;  2JWZ A;  2FNJ B;  1WE6 A;  2DHZ A;  3BIN A;  1VCB A;  1JRU A;  4TQ0 A;  4E71 A;  4MJS A;  2V4L A;  2JRI B;  4GDK B;  1WJU A;  1AAR A;  4TKN A;  3PLV A;  4II3 B;  2LWP A;  1XD3 B;  4AUQ C;  3NZU A;  1YQB A;  4LDT B;  1EF1 A;  3DVN V;  4DWF A;  4DHJ D;  3VUY A;  3T9L A;  3O65 B;  3SHQ A;  3B1L X;  3UIO B;  2AL6 A;  2D2Q A;  2M8S A;  2XEW A;  3SDL C;  4M0W B;  3CMM B;  4MSQ B;  2FCQ A;  5D6J B;  2MBE A;  5CHF A;  3UIN B;  3JVZ X;  2KKC A;  1GUA B;  4W9J A;  2MA9 B;  3V61 A;  4ANW A;  1VD2 A;  4EFO A;  3PRM B;  2ZCB A;  4FJV B;  2K8H A;  4MGZ E;  1NI2 A;  3WAP A;  2KFK A;  3H7S A;  3QAR A;  4BOS C;  1YX6 B;  3HM3 A;  2RD0 A;  3PHX B;  1GJZ A;  5CX3 A;  4I6N B;  3RT3 B;  4PS7 A;  3VUX A;  2C60 A;  4EZL A;  4MGY E;  4AOF A;  5IAA C;  3R3M A;  5J17 A;  2ASQ A;  3AXC A;  3ZUN A;  1MG8 A;  1WY8 A;  1WXV A;  5L95 C;  4ZYN A;  2ZPN A;  3DDC B;  1K8R B;  2G45 B;  2KJH B;  4MGK E;  4WJP A;  1SIF A;  3DBH I;  2KDI A;  4DDG D;  3KYD D;  2WWZ A;  3ML8 A;  4GIV A;  3VVW B;  2AWT A;  1WX7 A;  3V62 A;  3ZNI D;  3TMP B;  2O6V D;  1WXM A;  3K9O B;  3UQA A;  2OJR A;  1KJT A;  2N7E A;  2N9X A;  2KTR A;  2XBB C;  1WJ6 A;  3JYU A;  4PYZ A;  1WGD A;  4BKG A;  2NPT A;  1OGW A;  5DPT A;  2WX1 A;  3DBS A;  1E7U A;  2AEH A;  2LZ6 A;  4XC2 A;  3RUI B;  3MHS D;  2LD9 A;  4B6W A;  4LCD E;  3NOB A;  1WIA A;  1ZGU B;  2C7M B;  3ZRC A;  3AI5 A;  3WAO A;  1YJ1 A;  1P9D U;  2ZEQ A;  1V80 A;  2KZR A;  3DBR I;  3X0W A;  4FUL A;  4X57 B;  4AJW A;  1J19 A;  3PS6 A;  1TZ1 A;  1E8Y A;  3LDZ E;  1UZX B;  1WZ3 A;  2LVP A;  4EZK A;  4F1S A;  3JSV B;  4JL9 A;  4NJ7 A;  3VXW A;  4HVB A;  3HIZ A;  3QA8 A;  4MEM A;  3A1Q B;  2VRR B;  1GC6 A;  1V5T A;  3DVG X;  4YL8 A;  2BGF A;  2LRU A;  3R66 C;  4GDL A;  2PE9 A;  2KNB A;  4MEL A;  4N9F 4;  3KUZ A;  3L17 A;  3RZF A;  3A4S C;  2C9W B;  2GMI C;  2MP2 B;  2JF5 A;  1WX9 A;  3RD2 A;  2HD5 B;  3A9J B;  2DAF A;  3PTF C;  2EMT A;  3W1Y A;  5AEK B;  4CHK A;  4GN1 A;  2BF8 B;  3APC A;  2B3A A;  4DHZ E;  5L83 A;  3AU4 A;  4IW0 A;  3ZTD A;  1P3Q U;  1RRB A;  3OJ3 A;  2D07 B;  5D2M B;  1F9J A;  3A4R A;  4B95 A;  5JH5 C;  2BYE A;  2LUE A;  1RFA A;  2IBI B;  4BBN C;  2DYO A;  3KUD B;  4F8C B;  4NQL B;  4URK A;  1J8C A;  3ZO5 B;  2L0F A;  1OEY A;  5CTR C;  2HTH A;  4KV2 A;  5GMV A;  2RPQ A;  4G11 A;  4GU2 A;  5C1Z A;  1Q5W B;  2GBK A;  1PQS A;  2R2O A;  1E7V A;  2J7Q B;  2KHW B;  5D94 A;  3N32 A;  5DPW A;  3AUL A;  2DAJ A;  2NR2 A;  3R7R A;  3H6N A;  5KHO A;  3HK0 A;  5E6O A;  4BKS D;  4KZ0 A;  2L00 B;  4P7I A;  2BKF A;  2EKE C;  2A5U A;  1T0Y A;  5FR6 A;  4ANV A;  4IUM B;  5J2R A;  2Y5B B;  4CYE A;  4ZRI A;  2LGX A;  1WMH B;  2I1K A;  3EC8 A;  3IFW B;  3TIX A;  3VFK A;  2M4N A;  3UIP B;  3L13 A;  2C5L C;  2L3Z A;  2LXC A;  2Z0E B;  3L16 A;  3N3K B;  2W9N A;  4G3X B;  4MM3 A;  3VTU A;  3ZW3 A;  2XK5 B;  4W9E A;  2KJ6 A;  2CKH B;  4WJO A;  1Y8R C;  4F7Z A;  4G50 A;  4DHZ B;  1KM7 A;  2D3G A;  4GDK A;  4II2 B;  1D3Z A;  1EUV B;  1UGM A;  4LJP B;  3U7D A;  3ZDT A;  4W9L A;  1TTN A;  3BY4 B;  1V81 A;  1H8C A;  3K9P B;  4LDT D;  2UYZ B;  3VH4 B;  3WAL A;  4PS3 A;  1V49 A;  2KLC A;  3B0A A;  4W9D A;  2PJH A;  3L0W B;  3ZKJ C;  3QWZ B;  3U30 A;  2PE6 B;  2LJ5 A;  3V6C B;  4B9K A;  2D11 A;  2NCN A;  1GNU A;  2ZPY A;  3M62 B;  4BKT A;  2GBR A;  2K6Q A;  2O2V B;  1UEL A;  1RAX A;  3NZS A;  4KIK A;  3JW0 X;  3VTW A;  2ZVO A;  4MGI E;  3IG3 A;  4ICU A;  3VHT C;  2K1F A;  1TGZ B;  1H4R A;  2CHW A;  2UWQ A;  4IM2 A;  4A20 A;  2Z0D B;  1X1M A;  1KOT A;  1V86 A;  1XT9 B;  1ZKH A;  5KHQ A;  2KVR A;  2V1Y A;  3ZVV A;  1WJN A;  2LRW A;  2JZZ A;  3S2A A;  2KC2 A;  2DZK A;  1QZE A;  1V2Y A;  3QJZ A;  3KUC B;  2IY0 B;  3PVL A;  2KX0 A;  2MBQ A;  1YX5 B;  5DPS A;  3PRE A;  4NQK E;  4FLH A;  2MW5 A;  3PZD A;  2DYB A;  4ANX A;  3WAM A;  1GC7 A;  1V5O A;  1I35 A;  2G4D B;  3W1S A;  2LI5 A;  1Z5S B;  2D10 A;  3ALB A;  2N9E B;  3TJP A;  2BPS A;  2KOX A;  4WWO A;  1WYW B;  4WJN A;  3QQ8 B;  3WIM A;  4A3P A;  4IC7 B;  2O6V A;  1FXT B;  3L54 A;  2KK8 A;  3A9K B;  3N30 A;  4EKU A;  4HLE A;  1V9J A;  2LXA A;  2NBV B;  4KDL B;  2A4Z A;  5LXI B;  2IZV B;  2M17 A;  4ICV A;  2L7R A;  3D32 A;  5E6P A;  1S1Q B;  3UQB A;  3QX1 A;  4BOZ B;  2LGD A;  2MSE D;  3NY5 A;  1IP9 A;  1WR6 E;  2RSU A;  1SE9 A;  3I3T B;  3C0R B;  4E74 A;  2KWU B;  3ENE A;  1ZW7 A;  1WH3 A;  1C3T A;  3M95 A;  4ZRJ A;  2RR9 A;  2ZNV B;  4NPN A;  3ZTC A;  2KTR B;  2KN5 A;  1ISN A;  4AP4 C;  2BYF A;  2FCN A;  3QAQ A;  4J6I A;  2FIF A;  5CHV C;  4I6L B;  2K39 A;  1WI0 A;  4GOC A;  4WAA A;  1P1A A;  3QC8 B;  5TR5 A;  1WGG A;  2QHO A;  3NS8 A;  4FA6 A;  4IM3 A;  1KLV A;  2KWV B;  5DPR A;  3A1Q A;  1WXA A;  4TUU A;  3APD A;  3AU5 A;  2ZVN A;  4TQ1 A;  2L0T A;  3APF A;  4ZDV A;  3M63 B;  4XX5 A;  3W1S C;  4MH0 E;  2BKR B;  3PHW B;  1WFY A;  3KH0 A;  2KAN A;  2JVC A;  2JY6 A;  2MP2 A;  2PPH A;  3PV1 A;  2AYO B;  2KDE B;  2KLG A;  5CHW A;  3ZNZ B; 
#chains in the Genus database with same CATH topology
 3T3N A;  2JRH A;  3NUH B;  3CST A;  3T8M A;  4RM8 A;  2KXJ A;  2Y3A A;  2LGY A;  3ZLZ A;  1RM6 C;  5JHB A;  1LGR A;  5JHA A;  3CF6 E;  1FRD A;  3KWL A;  4HPM B;  4ARI A;  3DVN U;  4REZ A;  1K51 A;  2BVC A;  4PS8 A;  1D5Z C;  1UH6 A;  4YSX B;  4LNI A;  2AQ1 B;  1EWC A;  1STE A;  1EO6 A;  2IO3 B;  2HTM E;  2JPH A;  3DBH B;  4FAD A;  3I57 A;  2JWU A;  4DK5 A;  5AUK A;  3L08 A;  4MJS B;  3UGB B;  2KT7 A;  3N20 C;  2GB1 A;  2WXG A;  2LGI A;  4MDK E;  2ZJD A;  1XO3 A;  2L76 A;  1YMH E;  1YIW A;  4EZJ A;  2H88 B;  3Q3J A;  3P4P B;  2WXH A;  3PO0 A;  2PW9 A;  3N1X C;  1JWS D;  4KIK B;  3IBE A;  2G9H D;  4WJQ A;  2MCN B;  4YWG G;  3L4P A;  3DPD A;  4O1N A;  3RZW C;  2N9P C;  4A90 A;  2FUG 1;  3QCA A;  3R8B A;  1QKZ A;  2GBN A;  3FAH A;  3HHM A;  3L10 B;  1KF6 B;  2KTF A;  1R4M B;  1NBF C;  2FCS A;  1OEY J;  2FID A;  3TL5 A;  1E5W A;  1C4C A;  2DZJ A;  2WGS A;  5BO4 B;  3ONS A;  5HG2 A;  1B1Z A;  1Q10 A;  2KJR A;  2G4S A;  3P4S B;  5IA7 A;  5GXG B;  3JSV A;  2RDB C;  3AB5 A;  1VJK A;  2M0X A;  1RYJ A;  1VLB A;  1DOI A;  2YVC A;  1FXI A;  3DQV A;  2BS2 B;  3NJT A;  4TSS A;  4OHJ A;  2MLB A;  4K7S A;  3DOW A;  2BWF A;  4GDL B;  2LUM A;  2WNM A;  2J52 A;  3EHV A;  3VRB B;  2MRP A;  1ROE A;  2MQJ A;  4RM9 A;  2WYQ A;  5IP4 D;  3HRD D;  1XCQ L;  1CZP A;  1K53 A;  2KMA A;  2K8C A;  3WAN A;  2ACZ B;  2OHF A;  3AM9 A;  3HM6 X;  4HCN B;  3SU8 X;  1L2N A;  2JZ3 B;  4CQN A;  4HJK A;  5EE3 A;  3PPA A;  4GMV A;  4W9G A;  3Q3N C;  2UU7 A;  3ZIM A;  1FEH A;  1E7P B;  1G6J A;  1TY2 A;  2MX2 A;  2FNJ B;  1WE6 A;  3NVV A;  1ZOY B;  3BIN A;  4A6Q A;  3BK1 A;  3N1Z C;  1HZ5 A;  4N58 A;  4TKN A;  3PLV A;  2LWP A;  3TEZ A;  4AUQ C;  2PKO A;  1EF1 A;  2LGS A;  1F77 A;  1MPE A;  2NTS A;  3B1L X;  4JWS C;  1SBB B;  1TYG B;  2IND C;  4MSQ B;  1R4N B;  2FCQ A;  1KLU D;  4YTM B;  3PRM B;  2ZCB A;  1C4P A;  1NI2 A;  2KFK A;  3PHX B;  4EZL A;  4MGY E;  4AOF A;  5BMH A;  5IAA C;  1WY8 A;  5L95 C;  4ZYN A;  3BYT B;  4C00 A;  2BW2 A;  3FC4 A;  2G45 B;  2KJH B;  4M02 A;  4XWW A;  4ARC A;  3DBH I;  2QEJ C;  2RMM A;  3TMP B;  1SJE D;  4A55 A;  3K9O B;  2XBB C;  3JYU A;  3AEA B;  1WGD A;  2Y5P A;  4RNA A;  3MHS D;  2LD9 A;  4ZYS A;  2OED A;  1V80 A;  2IJ0 A;  3DBR I;  1N5X A;  3MHZ A;  3RFZ B;  4EZK A;  1YJJ A;  1SEB D;  3VXW A;  4HVB A;  3P42 A;  3B2F A;  4WIP A;  4M00 A;  2PE9 A;  3HVZ A;  1SIJ A;  2KNB A;  4N9F 4;  3L17 A;  1WX9 A;  3ZYY X;  2DWQ A;  2R61 A;  3W1Y A;  1C4A A;  2B3A A;  3GB1 A;  1F9J A;  3A4R A;  4B95 A;  4RF0 A;  4NQL B;  4LK0 M;  3ZQ4 A;  2WXL A;  3NRZ A;  5CTR C;  4KV2 A;  1YNT E;  1QT9 A;  3AE8 B;  1E7V A;  1FO4 A;  1SE2 A;  2NR2 A;  3MC8 A;  4KGR A;  3RMK C;  4YSZ B;  1UGJ A;  2BKF A;  1YN5 A;  2A5U A;  1T0Y A;  3Q8E A;  1WMH B;  2I1K A;  4N6E B;  2WU5 B;  3UIP B;  3L13 A;  3L16 A;  2W9N A;  3WCQ A;  1N63 A;  1CK1 A;  2XK5 B;  5IN7 A;  1Y8R C;  4F7Z A;  1BUI C;  1IGD A;  1TTN A;  1FCC C;  3BY4 B;  5TSS A;  2W3S A;  4PS3 A;  4RGN A;  4W9D A;  1IBX B;  2PJH A;  3L0W B;  2D11 A;  2KDM A;  2GBR A;  3JW0 X;  4MH8 A;  4MGI E;  1JWM D;  3IG3 A;  3VHT C;  2CHW A;  4L1B A;  2UWQ A;  1C77 A;  2W55 A;  2Z0D B;  1X1M A;  1TT5 B;  1XT9 B;  3AE1 B;  5C3J B;  5KHQ A;  2DZK A;  4BZA A;  1PGB A;  3QJZ A;  2M0A A;  2KX0 A;  3PRE A;  4NQK E;  4FLH A;  2ZW0 A;  1ZXH A;  4ANX A;  5D3I B;  1TIF A;  3W1S A;  1Z5S B;  3ALB A;  2N9E B;  4QAY A;  2DNF A;  3ZXV A;  3AE6 B;  4WJN A;  3QQ8 B;  4IC7 B;  4GLS C;  2JX5 A;  2O6V A;  2KK8 A;  3A9K B;  5FKA C;  1T0S C;  5E6P A;  3UQB A;  3DWM A;  3RNF C;  3RN9 C;  3W2D A;  1WR6 E;  2RSU A;  3U52 E;  5HHD G;  1WH3 A;  4ZRJ A;  2IGD A;  1GPX A;  4NPN A;  1PDX A;  2MJD A;  3NS1 A;  2BYF A;  4LNN A;  4I6L B;  5H92 C;  1VR9 A;  3AEG B;  3QC8 B;  1WGG A;  5TR5 A;  1SF0 A;  4IM3 A;  4FA6 A;  1MG4 A;  2KWV B;  4TUU A;  3KLS X;  3AU5 A;  2ZVN A;  2N0S B;  1SE4 A;  3W1S C;  4XX5 A;  4MH0 E;  3PHW B;  3Q8B A;  2PPH A;  2JY6 A;  1VZ7 A;  3Q3F A;  2AL3 A;  4E3C A;  2RDH A;  2OOB B;  3VR8 B;  4A9A A;  4GSW A;  3U2S C;  3H7P B;  1LFD A;  4BBN F;  4HDO A;  2KX3 A;  2NBU A;  3DHG C;  1PUT A;  4DXA B;  2PIA A;  4WAF A;  2LFI A;  1WSP A;  2CU3 A;  2KQ7 A;  1I42 A;  1AYF A;  1L4D B;  2DZM A;  3RNG C;  4BKS A;  4P16 A;  1B9R A;  1ZDV A;  4L2Y A;  4W9I A;  4NJ6 A;  4GGQ A;  2BYT A;  4NAW B;  1MHX A;  3TUO A;  3Q8C A;  1AWD A;  3AE3 B;  1MVK A;  2N7D A;  4KZC A;  5H8Y E;  1SJH D;  2PMV A;  1YOV B;  4FJY A;  2N9L A;  2BS4 B;  3DHI C;  1T5X D;  4NZL B;  5G55 A;  2MWS B;  1WE7 A;  4FHK A;  3AV8 A;  3UF8 A;  1I4X A;  2E6X A;  2L83 A;  5EDS A;  1D4B A;  1T3Q A;  1WM2 A;  4P6V F;  4HXD A;  1WX8 A;  1I4R A;  5BYR A;  1UBI A;  3DCG A;  2JUO A;  2YLM A;  4IM0 A;  4EEW A;  4JE3 B;  1HTQ A;  3OJ4 B;  1QLB B;  1Q1O A;  2HE7 A;  4A3O A;  3VQI A;  2WDQ B;  5JXV A;  5D7G A;  4HDQ A;  1C78 A;  5AZH A;  2QIL A;  3TEW A;  3ZDM C;  2Z59 B;  3CIR B;  1OTR B;  3X23 A;  4NY0 A;  3ZNH B;  2KN4 A;  1BXT A;  2BYV E;  1IUE A;  1IYF A;  2BB5 A;  2KQ4 X;  3AEC B;  3AED B;  3GE3 C;  2HJ1 A;  1JRO A;  1NEK B;  1OQY A;  3TCA A;  1K52 A;  1F2R I;  4GB9 A;  1E8W A;  3QK0 A;  4JLC A;  4FJZ A;  1QOG A;  2NS5 A;  2KWC A;  3DBL I;  4HCP B;  3A9J A;  3MP9 A;  5BYQ A;  4FBJ B;  2MH7 A;  2CHZ A;  2I1J A;  3WA0 A;  4PYU A;  3I5J C;  5E6J A;  2RGF A;  3VDZ A;  3U8Z A;  4XYC A;  2N1V A;  2K8B A;  4J3O D;  4JPS A;  4EUT A;  4FN2 A;  3VH3 B;  3ETR A;  3P2B A;  1LM8 B;  5EE0 A;  1TKE A;  2VZK B;  1FM0 D;  2IY1 B;  1JCK B;  5J18 A;  1TY0 A;  2NVU I;  4RMA A;  3NHE B;  3MTN B;  1JML A;  3OWE B;  1IPG A;  4ZOH C;  3FIL B;  2NTT A;  1MHH E;  3IVF A;  5FK9 C;  2QJL A;  4ZHO A;  1MI0 A;  4ASW C;  2KC1 A;  3RYT A;  2CR5 A;  1C76 A;  3VAW A;  2FCM A;  2VH2 A;  2DX5 B;  4K1R B;  1YQ3 B;  1M94 A;  2YEP B;  4RH6 A;  3AE4 B;  2L52 A;  3GZN B;  3IT6 B;  4TQ0 A;  3BK2 A;  2D3A A;  4MJS A;  1J7B A;  2V4L A;  4GDK B;  4BAX A;  1ZUD 2;  4OZB A;  3O13 A;  1FFV A;  1XD3 B;  4PK1 A;  4US9 A;  3NZU A;  1YQB A;  4LDT B;  3DVN V;  1OQR A;  1HXY D;  2XEW A;  3AMZ A;  4MT5 A;  4P1C C;  1FNV A;  3V05 A;  1ZP0 B;  5D6J B;  3UIN B;  1OQQ A;  4JWU C;  2KKC A;  1GUA B;  1XLN A;  4EFO A;  4FJV B;  2K8H A;  2SAK A;  5T8I A;  3H7S A;  2RD0 A;  1GJZ A;  3VUX A;  4PS7 A;  2C60 A;  2XNA C;  4IOI E;  3ZUN A;  3NVW A;  2ZPN A;  3Q8A A;  4XDD A;  1K8R B;  5LNK 1;  2WWZ A;  3ZNI D;  1WXM A;  3RI7 C;  1KJT A;  3IXS A;  5DPT A;  2WX1 A;  3DBS A;  2AEH A;  4ZRQ A;  4XC2 A;  3TSS A;  2C7M B;  3WAO A;  1JWB D;  2K5P A;  2XN9 C;  1P9D U;  4C7Y A;  2I2Y A;  4K3B A;  2LJI A;  1J19 A;  3LDZ E;  1P7F A;  3JSV B;  4JL9 A;  3QA8 A;  2JU6 X;  1TJE A;  1I4G A;  4MEM A;  1GC6 A;  3LYY A;  3CWI A;  4GDL A;  3P1M A;  4MEL A;  4R3D A;  3A4S C;  2GMI C;  2HD5 B;  2DAF A;  1QIL A;  1R7S A;  2VZK D;  4CHK A;  4DHZ E;  1JWA D;  4IW0 A;  3GS2 A;  3OJ3 A;  1PYW D;  2D07 B;  1ZPS A;  4BBN C;  3KUD B;  3UI3 A;  4LLG M;  3ZO5 B;  1GB4 A;  4KGT A;  1PGA A;  4G11 A;  4LNO A;  5C1Z A;  2WHI A;  2R2O A;  2KHW B;  3MFG A;  5HI1 A;  2L00 B;  4NJC A;  1MJD A;  4PT5 A;  5FR6 A;  5AUI A;  2LGX A;  3BII D;  3EC8 A;  3IFW B;  4IKG A;  4M01 A;  3VFK A;  2QCZ A;  2C5L C;  2LXC A;  3VTU A;  2MJE A;  4WJO A;  4G50 A;  4DHZ B;  3ZDT A;  4W9L A;  1QF6 A;  4LDT D;  2UYZ B;  1V49 A;  2KLC A;  3B0A A;  1CQV A;  2K9X A;  4RGT A;  3ZKJ C;  2PE6 B;  2LJ5 A;  3ZJU A;  1L4Z B;  1K50 A;  1GNU A;  2ZPY A;  2K6Q A;  2O2V B;  4D2K A;  3W5U B;  2ZVO A;  4ICU A;  2K1F A;  4B0E A;  1YQ4 B;  3DHH C;  1I7H A;  1V86 A;  2WXP A;  2SEB D;  3ZVV A;  2LRW A;  3U4E G;  2AQ2 B;  1JQ4 A;  1V2Y A;  2Y5C A;  4HKZ E;  3KUC B;  5DPS A;  2WDV B;  3WAM A;  1GC7 A;  1ESF A;  1V5O A;  1XLQ A;  1I35 A;  1TKG A;  4L23 A;  2LI5 A;  2PVO D;  2D10 A;  3TJP A;  4DQO C;  2BPS A;  1I4H A;  2WS3 B;  1LO5 D;  4EKU A;  4HLE A;  2JSV X;  1V9J A;  2LXA A;  4KDL B;  2A4Z A;  5LXI B;  2IZV B;  3D32 A;  4WQM A;  1E6E B;  1S1Q B;  2E3T A;  3QX1 A;  3AH7 A;  1SSN A;  3NY5 A;  1IP9 A;  2BB6 A;  2ZNV B;  3ZTC A;  2FCN A;  5CHV C;  3AE5 B;  2FBW B;  4ACF A;  2QIE B;  2X38 A;  2QHO A;  1FNW A;  3NS8 A;  5DPR A;  4OW0 A;  4FXC A;  1KTK A;  3APD A;  3ABV B;  4TQ1 A;  2L0T A;  1UNS A;  3M63 B;  2WP9 B;  3KH0 A;  3PV1 A;  4MAC A;  2KLG A;  2KDE B;  1AN8 A;  4OVZ A;  2JZP A;  2LVQ A;  3SEB A;  4CO7 A;  1R4M I;  3EGR A;  3PRP B;  4EOY A;  5E6N A;  1A5R A;  3RCZ A;  1CMX B;  1SGH A;  1WF9 A;  3MJW A;  2HJ8 A;  1NI3 A;  2KAJ A;  2MJ3 A;  1PFD A;  2NBW B;  5AZG A;  3DVG Y;  2GBJ A;  3A33 B;  1L7Y A;  4AWJ A;  1TS4 A;  1HTO A;  1LQB A;  4I6P A;  1WMH A;  2Z8L A;  3MC9 A;  3ECI A;  1WJ4 A;  2MBB B;  2QC8 A;  2XK5 A;  3PLU A;  5G5G A;  2OJW A;  3GP7 A;  5EE9 A;  3KVF B;  1UWX A;  1WGR A;  2FAZ A;  4KSL C;  1IBX A;  4JGH B;  3RUL A;  1T0R C;  4M8M A;  3EEC A;  2C7H A;  2FUH B;  1WGH A;  1Y56 A;  4DHJ B;  2WDR B;  4KKJ A;  2MBH A;  3H9D A;  4W9F A;  1OFF A;  1DGJ A;  1LXD A;  2KMC A;  3OLM D;  4K81 A;  1GAQ B;  4S17 A;  4BVU C;  1HEZ E;  3RNE C;  1YD8 U;  3ML9 A;  2J42 A;  2KAC A;  5HKH A;  1YN3 A;  2WXF A;  3VUW A;  5JZE B;  1P98 A;  4W9K A;  3I63 C;  3ZJV A;  3E56 A;  4K7U A;  2IYD B;  4ZRK A;  2AX5 A;  1E8Z A;  4W9C A;  3A9K A;  2PVG C;  1DOY A;  1F2R C;  4RFB A;  4RGM A;  1WM3 A;  4WUR A;  4TMA B;  4OVV A;  1C1Y B;  2JYT A;  1YJI A;  3IT4 B;  2V3S A;  2O6V B;  3FKY A;  2J53 A;  3SFE B;  2G3Q B;  1V1P B;  2J0M A;  2K6D B;  1ET6 A;  2NPT B;  1R4N I;  1QOB A;  4ANU A;  1FFU A;  5C23 A;  4KGS A;  1HE8 A;  1TS5 A;  1Z2M A;  2LAS A;  3CSF A;  2REX A;  1FXA A;  3AEB B;  1L0V B;  2M1M A;  3SFD B;  4JQW C;  4TV3 A;  1J0G A;  1F1H A;  2KDB A;  4IWO A;  4YTN B;  1E8X A;  1ZDX A;  1QOA A;  3Q69 A;  1NEN B;  1XEE A;  4DDI D;  5DCN A;  2KO3 A;  2KWD A;  3VRA B;  3H7P A;  5LLI A;  2EKI A;  2LVO A;  3PSE B;  3R2T A;  1SB3 C;  1RLF A;  2N1W A;  2RPV A;  2PEA A;  4BFR A;  2IO1 B;  3ZGZ A;  2BS3 B;  2EMS A;  1V6E A;  4LNK A;  3ZRF A;  3M3J A;  1FCL A;  1ZE3 D;  4RF1 A;  2KQS A;  1TKY A;  1JW9 D;  1L0Y B;  3PRZ A;  2C7N B;  3BVM A;  4HK2 A;  4NAW A;  1UUP A;  4FHJ A;  2J4X A;  2NMQ A;  3IAS 1;  1AW7 A;  4NAM A;  4AS1 A;  4MM3 B;  1JRU A;  1MFW A;  4E71 A;  1WJU A;  4C4V B;  2RDG A;  4II3 B;  4US8 A;  2WXN A;  3P63 A;  4DHJ D;  3AEE B;  1WGK A;  3VUY A;  3SHQ A;  3UIO B;  2AL6 A;  2D2Q A;  2M8S A;  4M0W B;  3CMM B;  3EA6 A;  2MBE A;  5CHF A;  2LMC A;  3Q2A C;  3JVZ X;  3BWU D;  2MA9 B;  1VD2 A;  2D3C A;  4K3C A;  1L6V A;  4MGZ E;  1KRH A;  3WAP A;  1J7A A;  3T3O A;  5CX3 A;  2JXT A;  4USA A;  2V0G A;  2ASQ A;  3BVZ A;  3LXF A;  3RPF C;  3BYY B;  3DDC B;  1FNU A;  3OG5 A;  1SIF A;  3EFC A;  2KDI A;  3RNA C;  3V62 A;  4A8X C;  2O6V D;  3UQA A;  1YN4 A;  4PYZ A;  5G5H A;  2KTR A;  3Q6B A;  1OGW A;  1EU4 A;  3BVG A;  2LZ6 A;  4B6W A;  3V3X A;  3B2G A;  4RGO S;  1ZGU B;  2KVZ A;  3AI5 A;  1YJ1 A;  2ZEQ A;  2TSS A;  2KZR A;  3X0W A;  4X57 B;  1T0Q C;  4AJW A;  1TZ1 A;  1E8Y A;  3J9C A;  1WZ3 A;  2LVP A;  4C7Z A;  3A1Q B;  2VRR B;  2EEL A;  1V5T A;  1HZ6 A;  1VRA B;  3DVG X;  4YL8 A;  2BGF A;  2LRU A;  3KUZ A;  3RZF A;  1P7E A;  2C9W B;  2MP2 B;  3C8Y A;  3A9J B;  4XE0 A;  5D3D A;  2WXJ A;  2WXI A;  4GN1 A;  5D2M B;  5JH5 C;  2BYE A;  3RNC C;  3TEX A;  2IBI B;  3HUI A;  4URK A;  1J8C A;  2L0F A;  3W5V B;  3FIL A;  2HTH A;  5GMV A;  2RPQ A;  4GU2 A;  5FR3 A;  3PZ7 A;  4UDU C;  5MPO A;  2J7Q B;  5DPW A;  5E6O A;  4BKS D;  2INN E;  2MEK A;  2EKE C;  3PZ8 A;  1UF0 A;  5J2R A;  4ZRI A;  1VZ8 A;  2WLB A;  2ICI A;  1KM7 A;  2D3G A;  4GDK A;  4II2 B;  1EUV B;  1UGM A;  4LJP B;  3BZD B;  1XLO A;  3W9C B;  1H8C A;  2AQ3 B;  3VH4 B;  3WAL A;  1QOF A;  4YXD B;  1TZO A;  4B9K A;  3U30 A;  2NCN A;  3NZ3 A;  1TS2 A;  3M62 B;  1UEL A;  1RAX A;  1NYQ A;  3NZS A;  4KIK A;  1TGZ B;  1H4R A;  4XWT A;  3DBR B;  3C19 A;  4YSY B;  1ZKH A;  1WJN A;  3S2A A;  2KC2 A;  2D5G A;  2IY0 B;  2W54 A;  1D5X C;  2MBQ A;  4C56 C;  3AE2 B;  1E10 A;  3PZD A;  4YTP B;  2GLS A;  3I9V 1;  3IAM 1;  1ENF A;  3AE7 B;  1WYW B;  3WIM A;  3L54 A;  1SXT A;  2JQR B;  3AN1 A;  2NBV B;  1WWT A;  2M17 A;  4ICV A;  1D5M C;  1HA5 A;  3KWV A;  4BOZ B;  1DOX A;  4HKQ A;  3U7Z A;  1SE9 A;  3I3T B;  3ENE A;  1C3T A;  1SE3 A;  2RR9 A;  4XDC A;  3Q8F A;  4AP4 C;  2FIF A;  1GOZ A;  1UWM A;  4WWM A;  3NVZ A;  1WI0 A;  3LB8 C;  4GOC A;  3NG0 A;  1KLV A;  1E9M A;  2GI9 A;  4ZRP A;  3H8H A;  3APF A;  3HVD A;  2BKR B;  2KAN A;  4ZHP A;  1WRI A;  1N60 A;  2WXK A;  2ZCC A;  3VTV A;  1ET9 A;  2CHX A;  3B08 A;  5LXH A;  2V3P A;  1BT0 A;  1KLG D;  2INC C;  3SR6 A;  4KSK C;  1TS3 A;  2KMM A;  5IKC M;  4OVU A;  2GBM A;  4JIO U;  1WGY A;  2QSD A;  2KDF B;  2D3B A;  1FD6 A;  3V6E B;  2X8X X;  4WWP A;  4KDI C;  2IO2 B;  3PGE A;  4LJO B;  2WXR A;  1A70 A;  4DXG A;  4P1B C;  2HDE A;  2M19 A;  1FIQ A;  2ON8 A;  1UBQ A;  3IHP C;  2L8J A;  3Q14 C;  4Q2J A;  1KFY B;  1M4V A;  1WXS A;  1JRP A;  2BWE S;  1N61 A;  1F0Z A;  2K25 A;  2WX0 A;  4OZA A;  1NDD A;  2O2V A;  1GB1 A;  2JXX A;  3V60 A;  1WRD B;  1WZ0 A;  1ZXI A;  2G1E A;  1XQQ A;  3KW5 B;  3H1U A;  4HRS A;  1UD7 A;  3EFU A;  4DBG A;  4YT0 B;  2B76 B;  1FRR A;  4G0N B;  1WR1 A;  4HEA 1;  1C79 A;  2DYM A;  1IGC A;  3GOE A;  2KFK B;  1KH0 A;  4HJG E;  3R7Q A;  4XZ4 A;  2J0K A;  1Q0W B;  3VR9 B;  1WXQ A;  4K7W A;  2ZW1 A;  4KX6 B;  2L05 A;  4KKI A;  4JX1 C;  3Q3M C;  1XCT L;  4AJY B;  2IO0 B;  3GZN I;  1RFK A;  3ZNG C;  2DEN B;  3LJ3 A;  2W82 A;  3MC0 B;  2CS4 A;  4AQ7 A;  4HPL B;  2N4F A;  3OAW A;  2LEK A;  1EM7 A;  4NNJ B;  1NYR A;  4GXB A;  2PLP A;  5EE1 A;  4KVG B;  4WWN A;  2L1A A;  4LNF A;  4IWQ A;  3QIJ A;  1EF5 A;  1E90 A;  2WDT B;  3KYC D;  4ITK A;  1JAL A;  5AZF A;  4HWI B;  1U4A A;  2KFJ A;  2ZZP B;  4MSM B;  4W9H A;  5HFY A;  2JT4 B;  4C80 A;  2IPK D;  1FMA D;  3AEF B;  2ZNV C;  2WQY B;  3QHT A;  3RNB C;  1JWU D;  2KD0 A;  2DZI A;  4RCO A;  1CJE A;  4IG7 B;  2R2Q A;  1S3S G;  1I4P A;  3TEY A;  5G2N A;  2J0J A;  2MBO A;  3SD5 A;  2BBC A;  4B0M A;  1P0R A;  1V1O A;  2GOW A;  4WQO B;  4IWP A;  4M8N A;  1GG3 A;  1TBE A;  3PT2 B;  3TBL D;  2CU1 A;  2JWZ A;  5C2T B;  2DHZ A;  1VCB A;  2IGH A;  2BT6 A;  2JRI B;  2BQQ A;  1AAR A;  4DXF A;  1EU3 A;  4DWF A;  3T9L A;  3O65 B;  4LTU A;  3SDL C;  2V9H A;  2YEP F;  4W9J A;  3V61 A;  4ANW A;  3DBL B;  2CJN A;  3QAR A;  4BOS C;  1YX6 B;  3HM3 A;  4I6N B;  3RT3 B;  1VZ6 A;  1HQR D;  2K0P A;  3R3M A;  5J17 A;  3AXC A;  1MG8 A;  1WXV A;  2MHJ A;  4MGK E;  4WJP A;  4DDG D;  3AE9 B;  3KYD D;  1T6B X;  3ML8 A;  2QDF A;  4GIV A;  3VVW B;  2AWT A;  1WX7 A;  2INP E;  3MJ5 A;  2OJR A;  2N7E A;  2N9X A;  2DBY A;  2M56 B;  1D6E C;  1WJ6 A;  2N7J A;  1V1P A;  4WH4 A;  4BKG A;  2NPT A;  1FPY A;  1E7U A;  3RUI B;  3B9J A;  4LCD E;  1WYG A;  3NOB A;  1WIA A;  2GRI A;  3ZRC A;  2H89 B;  3P4Q B;  2WXO A;  4FUL A;  1L5P A;  3PS6 A;  1N5W A;  1L0X B;  1UZX B;  4F1S A;  1PGX A;  1L6U A;  4NJ7 A;  2KYW A;  3HIZ A;  1EWY C;  1V8C A;  1J7C A;  3E9S A;  3R2I A;  1XLP A;  1XF5 L;  3R66 C;  3KQ4 A;  3RD2 A;  2JF5 A;  2N9K A;  3P4R B;  3PTF C;  3ZJT A;  2EMT A;  5AEK B;  5L83 A;  2BF8 B;  3APC A;  3AU4 A;  3ZTD A;  1P3Q U;  1RRB A;  3Q3O C;  2LUE A;  1RFA A;  2VH1 A;  2DYO A;  4F8C B;  2L32 A;  1C9F A;  2QMT A;  1OEY A;  1Q5W B;  2GBK A;  1PQS A;  5D94 A;  1BML C;  3N32 A;  3AUL A;  2DAJ A;  3R7R A;  3H6N A;  5KHO A;  3HK0 A;  1V97 A;  4KZ0 A;  1E0Z A;  4P7I A;  2PTL A;  2I38 A;  4ANV A;  4IUM B;  2Y5B B;  4CYE A;  2IDY A;  3TIX A;  2M4N A;  4MM3 A;  4G3X B;  2L3Z A;  2WU2 B;  2Z0E B;  1N62 A;  3GE8 C;  3N3K B;  3ZW3 A;  4W9E A;  3ZXR A;  2KJ6 A;  2CKH B;  3EUB 2;  1RWS A;  2K3U A;  1D3Z A;  4C4V A;  4OZC A;  3U7D A;  1V81 A;  3K9P B;  4S0R A;  4H2A A;  5BMI A;  1XXG A;  3QWZ B;  3V6C B;  1F52 A;  4M0W A;  4BKT A;  1DYQ A;  2LHE A;  3N1Y C;  3VTW A;  5BYS A;  3N9Y C;  4N59 A;  4IM2 A;  4A20 A;  1KOT A;  2KVR A;  2V1Y A;  1N6Z A;  2LHD A;  2JZZ A;  1QZE A;  4HPP A;  3PVL A;  2JYE A;  1YX5 B;  2V3N A;  5IOI A;  2MW5 A;  2DYB A;  1VDV A;  2G4D B;  2Q5W D;  2KOX A;  4WWO A;  4A3P A;  1FXT B;  2WXQ A;  3N30 A;  2L7R A;  2BTE A;  2LGD A;  2MSE D;  4HRO A;  3C0R B;  4E74 A;  2KWU B;  1ZW7 A;  3M95 A;  1ACC A;  2DLB A;  3URY A;  2FE8 A;  2KTR B;  2WXM A;  2KN5 A;  1ISN A;  4J6I A;  3QAQ A;  2IGG A;  1I4Q A;  2K39 A;  5IO9 A;  4XGA B;  4WAA A;  1P1A A;  1NVI D;  2K22 A;  3A1Q A;  1WXA A;  1QQR A;  2W3R A;  2CJO A;  3DWG C;  4ZDV A;  4IDI A;  2ONQ A;  4EE2 A;  1WFY A;  2JVC A;  2MP2 A;  2AYO B;  5BMG A;  5CHW A;  5I4D A;  3ZNZ B;  2V4I B;  3NVY A; 
#chains in the Genus database with same CATH homology
 3Q3F A;  2LVQ A;  2AL3 A;  2ZCC A;  3VTV A;  4E3C A;  2JRH A;  4CO7 A;  2OOB B;  1R4M I;  2CHX A;  3PRP B;  3B08 A;  3CST A;  4GSW A;  5LXH A;  3T8M A;  3H7P B;  4RM8 A;  4EOY A;  1LFD A;  5E6N A;  2KXJ A;  1BT0 A;  4BBN F;  1A5R A;  4HDO A;  2KX3 A;  2NBU A;  3RCZ A;  1CMX B;  1SGH A;  4DXA B;  2LGY A;  4KSK C;  3ZLZ A;  1WF9 A;  5JHB A;  3MJW A;  2HJ8 A;  1I42 A;  2KQ7 A;  5JHA A;  3CF6 E;  4HPM B;  2DZM A;  4BKS A;  3DVN U;  2NBW B;  4OVU A;  2GBM A;  4JIO U;  1WGY A;  4PS8 A;  5AZG A;  2KDF B;  3DVG Y;  2GBJ A;  3A33 B;  1L7Y A;  1UH6 A;  4AWJ A;  3V6E B;  4WWP A;  4KDI C;  2IO2 B;  1LQB A;  3PGE A;  4LJO B;  4W9I A;  4I6P A;  1WMH A;  4NJ6 A;  4GGQ A;  3ECI A;  4NAW B;  1WJ4 A;  1EO6 A;  1UBQ A;  2MBB B;  2IO3 B;  2JPH A;  2XK5 A;  3IHP C;  2N7D A;  4FAD A;  3PLU A;  2L8J A;  4KZC A;  4FJY A;  3KVF B;  4DK5 A;  3L08 A;  1WGR A;  2FAZ A;  4KSL C;  4MJS B;  1WXS A;  3UGB B;  2BWE S;  5G55 A;  2MWS B;  4JGH B;  3RUL A;  4M8M A;  3EEC A;  2K25 A;  1WE7 A;  4FHK A;  3UF8 A;  2WX0 A;  1NDD A;  2C7H A;  2O2V A;  2JXX A;  2FUH B;  4MDK E;  3V60 A;  1WRD B;  1WGH A;  1WZ0 A;  2ZJD A;  4DHJ B;  2L76 A;  5EDS A;  1XQQ A;  2MBH A;  1YIW A;  3KW5 B;  3H9D A;  4EZJ A;  3H1U A;  4W9F A;  3Q3J A;  1UD7 A;  3EFU A;  4DBG A;  1LXD A;  2KMC A;  3OLM D;  4K81 A;  4G0N B;  1WR1 A;  1WM2 A;  4BVU C;  4KIK B;  3IBE A;  2DYM A;  1YD8 U;  3ML9 A;  4HXD A;  3GOE A;  2KFK B;  5HKH A;  4WJQ A;  1WX8 A;  2MCN B;  3R7Q A;  4XZ4 A;  3VUW A;  1UBI A;  5JZE B;  3DPD A;  3RZW C;  1P98 A;  2J0K A;  2N9P C;  1Q0W B;  3DCG A;  4W9K A;  4K7W A;  2JUO A;  2YLM A;  2L05 A;  4IM0 A;  4EEW A;  4K7U A;  2IYD B;  3OJ4 B;  3QCA A;  4ZRK A;  1Q1O A;  2HE7 A;  4AJY B;  2GBN A;  2IO0 B;  3GZN I;  3HHM A;  4W9C A;  1E8Z A;  2DEN B;  3ZNG C;  3A9K A;  3L10 B;  4A3O A;  3VQI A;  2KTF A;  3LJ3 A;  2CS4 A;  5D7G A;  4HDQ A;  1NBF C;  5AZH A;  1WM3 A;  2FCS A;  4HPL B;  1OEY J;  2N4F A;  2FID A;  3TL5 A;  1E5W A;  1C1Y B;  4OVV A;  2Z59 B;  3OAW A;  1OTR B;  2DZJ A;  3X23 A;  3ZDM C;  4NY0 A;  4NNJ B;  3ZNH B;  2V3S A;  2O6V B;  2BYV E;  1IYF A;  2G3Q B;  4GXB A;  5BO4 B;  2J0M A;  2K6D B;  3ONS A;  2NPT B;  2KJR A;  3TCA A;  1OQY A;  2G4S A;  1R4N I;  5IA7 A;  4KVG B;  3JSV A;  4WWN A;  4GB9 A;  5C23 A;  1E8W A;  4ANU A;  1HE8 A;  2M0X A;  1Z2M A;  2LAS A;  3QK0 A;  3CSF A;  2YVC A;  2REX A;  4IWQ A;  3DQV A;  4JLC A;  3QIJ A;  4FJZ A;  2M1M A;  2NS5 A;  1EF5 A;  4JQW C;  1E90 A;  2KWC A;  4TV3 A;  3DBL I;  2WDT B;  4HCP B;  1J0G A;  3KYC D;  2KDB A;  3A9J A;  4IWO A;  4FBJ B;  1E8X A;  2CHZ A;  2I1J A;  3WA0 A;  4PYU A;  2MLB A;  4K7S A;  2RGF A;  3DOW A;  5AZF A;  3VDZ A;  2BWF A;  3U8Z A;  4HWI B;  4DDI D;  5DCN A;  2KO3 A;  4GDL B;  2N1V A;  1U4A A;  2K8B A;  4EUT A;  2KFJ A;  4FN2 A;  2ZZP B;  3EHV A;  4MSM B;  3VH3 B;  3P2B A;  1LM8 B;  4W9H A;  3H7P A;  2MRP A;  2JT4 B;  5LLI A;  2LVO A;  2IY1 B;  2MQJ A;  4RM9 A;  2WYQ A;  3PSE B;  2ZNV C;  5J18 A;  3QHT A;  2NVU I;  1RLF A;  2N1W A;  2PEA A;  2KD0 A;  2DZI A;  3NHE B;  4RMA A;  3MTN B;  4BFR A;  2KMA A;  2IO1 B;  1IPG A;  2K8C A;  2EMS A;  3WAN A;  1V6E A;  3ZRF A;  4IG7 B;  2R2Q A;  3HM6 X;  4HCN B;  3IVF A;  3SU8 X;  3M3J A;  1L2N A;  2JZ3 B;  1S3S G;  4HJK A;  2KQS A;  5G2N A;  2J0J A;  3PPA A;  2MBO A;  3SD5 A;  3PRZ A;  4GMV A;  4W9G A;  4ASW C;  2KC1 A;  3RYT A;  1P0R A;  2CR5 A;  2C7N B;  3ZIM A;  2GOW A;  4HK2 A;  4IWP A;  4WQO B;  4NAW A;  4M8N A;  2FCM A;  3VAW A;  1GG3 A;  4FHJ A;  1G6J A;  2DX5 B;  1TBE A;  2MX2 A;  3PT2 B;  4K1R B;  3TBL D;  2CU1 A;  1M94 A;  2JWZ A;  2FNJ B;  1WE6 A;  2DHZ A;  3BIN A;  1VCB A;  1JRU A;  4TQ0 A;  4E71 A;  4MJS A;  2V4L A;  2JRI B;  4GDK B;  1WJU A;  1AAR A;  4TKN A;  3PLV A;  4II3 B;  2LWP A;  1XD3 B;  4AUQ C;  3NZU A;  1YQB A;  4LDT B;  1EF1 A;  3DVN V;  4DWF A;  4DHJ D;  3VUY A;  3T9L A;  3O65 B;  3SHQ A;  3B1L X;  3UIO B;  2AL6 A;  2D2Q A;  2M8S A;  2XEW A;  3SDL C;  4M0W B;  3CMM B;  4MSQ B;  2FCQ A;  5D6J B;  2MBE A;  5CHF A;  3UIN B;  3JVZ X;  2KKC A;  1GUA B;  4W9J A;  2MA9 B;  3V61 A;  4ANW A;  1VD2 A;  4EFO A;  3PRM B;  2ZCB A;  4FJV B;  2K8H A;  4MGZ E;  1NI2 A;  3WAP A;  2KFK A;  3H7S A;  3QAR A;  4BOS C;  1YX6 B;  3HM3 A;  2RD0 A;  3PHX B;  1GJZ A;  5CX3 A;  4I6N B;  3RT3 B;  4PS7 A;  3VUX A;  2C60 A;  4EZL A;  4MGY E;  4AOF A;  5IAA C;  3R3M A;  5J17 A;  2ASQ A;  3AXC A;  3ZUN A;  1MG8 A;  1WY8 A;  1WXV A;  5L95 C;  4ZYN A;  2ZPN A;  3DDC B;  1K8R B;  2G45 B;  2KJH B;  4MGK E;  4WJP A;  1SIF A;  3DBH I;  2KDI A;  4DDG D;  3KYD D;  2WWZ A;  3ML8 A;  4GIV A;  3VVW B;  2AWT A;  1WX7 A;  3V62 A;  3ZNI D;  3TMP B;  2O6V D;  1WXM A;  3K9O B;  3UQA A;  2OJR A;  1KJT A;  2N7E A;  2N9X A;  2KTR A;  2XBB C;  1WJ6 A;  3JYU A;  4PYZ A;  1WGD A;  4BKG A;  2NPT A;  1OGW A;  5DPT A;  2WX1 A;  3DBS A;  1E7U A;  2AEH A;  2LZ6 A;  4XC2 A;  3RUI B;  3MHS D;  2LD9 A;  4B6W A;  4LCD E;  3NOB A;  1WIA A;  1ZGU B;  2C7M B;  3ZRC A;  3AI5 A;  3WAO A;  1YJ1 A;  1P9D U;  2ZEQ A;  1V80 A;  2KZR A;  3DBR I;  3X0W A;  4FUL A;  4X57 B;  4AJW A;  1J19 A;  3PS6 A;  1TZ1 A;  1E8Y A;  3LDZ E;  1UZX B;  1WZ3 A;  2LVP A;  4EZK A;  4F1S A;  3JSV B;  4JL9 A;  4NJ7 A;  3VXW A;  4HVB A;  3HIZ A;  3QA8 A;  4MEM A;  3A1Q B;  2VRR B;  1GC6 A;  1V5T A;  3DVG X;  4YL8 A;  2BGF A;  2LRU A;  3R66 C;  4GDL A;  2PE9 A;  2KNB A;  4MEL A;  4N9F 4;  3KUZ A;  3L17 A;  3RZF A;  3A4S C;  2C9W B;  2GMI C;  2MP2 B;  2JF5 A;  1WX9 A;  3RD2 A;  2HD5 B;  3A9J B;  2DAF A;  3PTF C;  2EMT A;  3W1Y A;  5AEK B;  4CHK A;  4GN1 A;  2BF8 B;  3APC A;  2B3A A;  4DHZ E;  5L83 A;  3AU4 A;  4IW0 A;  3ZTD A;  1P3Q U;  1RRB A;  3OJ3 A;  2D07 B;  5D2M B;  1F9J A;  3A4R A;  4B95 A;  5JH5 C;  2BYE A;  2LUE A;  1RFA A;  2IBI B;  4BBN C;  2DYO A;  3KUD B;  4F8C B;  4NQL B;  4URK A;  1J8C A;  3ZO5 B;  2L0F A;  1OEY A;  5CTR C;  2HTH A;  4KV2 A;  5GMV A;  2RPQ A;  4G11 A;  4GU2 A;  5C1Z A;  1Q5W B;  2GBK A;  1PQS A;  2R2O A;  1E7V A;  2J7Q B;  2KHW B;  5D94 A;  3N32 A;  5DPW A;  3AUL A;  2DAJ A;  2NR2 A;  3R7R A;  3H6N A;  5KHO A;  3HK0 A;  5E6O A;  4BKS D;  4KZ0 A;  2L00 B;  4P7I A;  2BKF A;  2EKE C;  2A5U A;  1T0Y A;  5FR6 A;  4ANV A;  4IUM B;  5J2R A;  2Y5B B;  4CYE A;  4ZRI A;  2LGX A;  1WMH B;  2I1K A;  3EC8 A;  3IFW B;  3TIX A;  3VFK A;  2M4N A;  3UIP B;  3L13 A;  2C5L C;  2L3Z A;  2LXC A;  2Z0E B;  3L16 A;  3N3K B;  2W9N A;  4G3X B;  4MM3 A;  3VTU A;  3ZW3 A;  2XK5 B;  4W9E A;  2KJ6 A;  2CKH B;  4WJO A;  1Y8R C;  4F7Z A;  4G50 A;  4DHZ B;  1KM7 A;  2D3G A;  4GDK A;  4II2 B;  1D3Z A;  1EUV B;  1UGM A;  4LJP B;  3U7D A;  3ZDT A;  4W9L A;  1TTN A;  3BY4 B;  1V81 A;  1H8C A;  3K9P B;  4LDT D;  2UYZ B;  3VH4 B;  3WAL A;  4PS3 A;  1V49 A;  2KLC A;  3B0A A;  4W9D A;  2PJH A;  3L0W B;  3ZKJ C;  3QWZ B;  3U30 A;  2PE6 B;  2LJ5 A;  3V6C B;  4B9K A;  2D11 A;  2NCN A;  1GNU A;  2ZPY A;  3M62 B;  4BKT A;  2GBR A;  2K6Q A;  2O2V B;  1UEL A;  1RAX A;  3NZS A;  4KIK A;  3JW0 X;  3VTW A;  2ZVO A;  4MGI E;  3IG3 A;  4ICU A;  3VHT C;  2K1F A;  1TGZ B;  1H4R A;  2CHW A;  2UWQ A;  4IM2 A;  4A20 A;  2Z0D B;  1X1M A;  1KOT A;  1V86 A;  1XT9 B;  1ZKH A;  5KHQ A;  2KVR A;  2V1Y A;  3ZVV A;  1WJN A;  2LRW A;  2JZZ A;  3S2A A;  2KC2 A;  2DZK A;  1QZE A;  1V2Y A;  3QJZ A;  3KUC B;  2IY0 B;  3PVL A;  2KX0 A;  2MBQ A;  1YX5 B;  5DPS A;  3PRE A;  4NQK E;  4FLH A;  2MW5 A;  3PZD A;  2DYB A;  4ANX A;  3WAM A;  1GC7 A;  1V5O A;  1I35 A;  2G4D B;  3W1S A;  2LI5 A;  1Z5S B;  2D10 A;  3ALB A;  2N9E B;  3TJP A;  2BPS A;  2KOX A;  4WWO A;  1WYW B;  4WJN A;  3QQ8 B;  3WIM A;  4A3P A;  4IC7 B;  2O6V A;  1FXT B;  3L54 A;  2KK8 A;  3A9K B;  3N30 A;  4EKU A;  4HLE A;  1V9J A;  2LXA A;  2NBV B;  4KDL B;  2A4Z A;  5LXI B;  2IZV B;  2M17 A;  4ICV A;  2L7R A;  3D32 A;  5E6P A;  1S1Q B;  3UQB A;  3QX1 A;  4BOZ B;  2LGD A;  2MSE D;  3NY5 A;  1IP9 A;  1WR6 E;  2RSU A;  1SE9 A;  3I3T B;  3C0R B;  4E74 A;  2KWU B;  3ENE A;  1ZW7 A;  1WH3 A;  1C3T A;  3M95 A;  4ZRJ A;  2RR9 A;  2ZNV B;  4NPN A;  3ZTC A;  2KTR B;  2KN5 A;  1ISN A;  4AP4 C;  2BYF A;  2FCN A;  3QAQ A;  4J6I A;  2FIF A;  5CHV C;  4I6L B;  2K39 A;  1WI0 A;  4GOC A;  4WAA A;  1P1A A;  3QC8 B;  5TR5 A;  1WGG A;  2QHO A;  3NS8 A;  4FA6 A;  4IM3 A;  1KLV A;  2KWV B;  5DPR A;  3A1Q A;  1WXA A;  4TUU A;  3APD A;  3AU5 A;  2ZVN A;  4TQ1 A;  2L0T A;  3APF A;  4ZDV A;  3M63 B;  4XX5 A;  3W1S C;  4MH0 E;  2BKR B;  3PHW B;  1WFY A;  3KH0 A;  2KAN A;  2JVC A;  2JY6 A;  2MP2 A;  2PPH A;  3PV1 A;  2AYO B;  2KDE B;  2KLG A;  5CHW A;  3ZNZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...