2K8HA

Solution structure of sumo from trypanosoma brucei
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
102
structure length
102
Chain Sequence
MSNNGGEPSNNGGEGAEGTCKEETALVAVKVVNADGAEMFFRIKSRTALKKLIDTYCKKQGISRNSVRFLFDGTPIDETKTPEELGMEDDDVIDAMVEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Small ubiquitin protein
publication title Solution structure of SUMO from Trypanosoma brucei and its interaction with Ubc9
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 14
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2008-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2k8hA01
2KLGA 5HKHA 1GJZA 5E6OA 2KZRA 4BOZB 2REXA 2RPQA 2AEHA 3TL5A 1G6JA 4NPNA 2J0MA 1AARA 3PRMB 3RT3B 3DPDA 3UIOB 4IM2A 4B95A 3A4SC 2GBNA 4GU2A 1S3SG 1E8YA 1NDDA 2JXXA 4HXDA 2KDIA 4BVUC 3PV1A 1JRUA 4GB9A 3PVLA 1NBFC 5G2NA 2B3AA 4KIKB 2FCQA 2MRPA 1GC6A 4FJYA 3KYDD 4RMAA 2M8SA 3DBSA 3APDA 3MTNB 3NHEB 2JT4B 2N1WA 1P98A 4ICUA 2KWUB 4AP4C 1WX7A 2KTRA 3IFWB 2D11A 3PSEB 2KDFB 2AL3A 2C9WB 1ZGUB 1WX9A 2G3QB 4EKUA 2CHXA 5EDSA 3AU4A 3H7PA 4GIVA 1WM2A 4F7ZA 2DX5B 3RYTA 2DAJA 4LDTD 1VD2A 2L00B 3SD5A 1RAXA 4FA6A 2FUHB 3PT2B 3UF8A 2K6DB 2QHOA 2JVCA 2IO3B 3UINB 2BWES 4ZRIA 1EUVB 3M3JA 4NJ6A 1OEYJ 4YL8A 3QWZB 1V86A 4WJQA 4XX5A 1WMHA 4BKSA 4EZKA 4LCDE 4KZCA 5C23A 2LXAA 2J0JA 2FNJB 2NCNA 1WR1A 3ENEA 1E7VA 4WJNA 3PHWB 3JSVA 1WZ0A 3RUIB 2YLMA 4DHJB 3OLMD 2MQJA 4NNJB 4EZJA 3UQBA 1J8CA 1GG3A 2GBJA 3L0WB 1R4NI 3PPAA 5D94A 2MP2A 3TJPA 4DHJD 3VXWA 2IY0B 3T8MA 3L17A 3CSFA 1WIAA 3R66C 5CHWA 2KTRB 2NBUA 2KC1A 3QX1A 3X0WA 2VRRB 3ZIMA 2KFJA 4PS3A 3SU8X 3ZO5B 3VTUA 1UH6A 2KLCA 2D07B 2LJ5A 4G50A 4ZRKA 3H7PB 4DXAB 2IO1B 4A20A 4GN1A 3T9LA 2ZNVB 3H6NA 1WGRA 2G4SA 1R4MI 2M1MA 3DBRI 1SE9A 1TZ1A 3EECA 3L13A 3V62A 2O6VD 2DZKA 2RR9A 3DVGX 1C1YB 3APCA 1WM3A 2G45B 3IG3A 2LVPA 5AEKB 3Q3JA 3QCAA 1KLVA 1WMHB 3MHSD 1WY8A 2DHZA 3VH4B 2XK5A 1J19A 3ZDMC 1IP9A 4II2B 3O65B 3JSVB 1X1MA 3EC8A 3KVFB 3L08A 5E6PA 3EHVA 3ZDTA 4HDOA 4PS8A 5IAAC 5LXHA 2JRHA 2KKCA 4DDID 2D2QA 3NZUA 3QJZA 1K8RB 3RD2A 1OTRB 1P0RA 4WAAA 1L2NA 2ZJDA 2LVOA 1UELA 2Z59B 1EO6A 3JYUA 4GDKB 1YX6B 2RSUA 2HD5B 4HWIB 2V1YA 1KJTA 3LDZE 3V6EB 2DYMA 2MBBB 5E6NA 2FIFA 4NQLB 1TBEA 2IYDB 4ANWA 2DENB 2BGFA 2K8CA 1E90A 2LXCA 3CMMB 4MSQB 4URKA 2PJHA 1WXSA 4HPLB 5DPWA 2R2QA 4GSWA 1LM8B 4OVVA 4WWPA 1BT0A 4KDLB 4DHZE 2MW5A 1M94A 4IWOA 1UZXB 2FCSA 2L0FA 5JHAA 2CHWA 4KV2A 5DPSA 1WJUA 4IWQA 4BFRA 4N9F4 4E74A 4EFOA 1XT9B 4W9LA 4W9FA 3HM6X 4DBGA 2L0TA 2OJRA 4WJOA 1E8WA 1WH3A 4BBNF 3U8ZA 4BKTA 4EOYA 2IBIB 1YIWA 1OGWA 2CKHB 2JZ3B 2NPTA 1GC7A 4NY0A 1S1QB 3W1YA 2ZPYA 2FCMA 4RM8A 3UGBB 4FBJB 3PHXB 1WXMA 2N9XA 2WX0A 2Y5BB 3DCGA 2J7QB 3ZTDA 4G11A 4WJPA 3W1SC 2WDTB 4MJSB 4K7WA 2NVUI 1E8ZA 4MGKE 2DZIA 2J0KA 3U30A 2MBQA 2HE7A 2FCNA 4K7SA 4LJOB 2BYVE 3QHTA 2K6QA 1GNUA 3PREA 5TR5A 2MBHA 1YQBA 3C0RB 4G3XB 4M0WB 4MM3A 4TUUA 1KOTA 5D6JB 2KMAA 3NY5A 4W9JA 4XZ4A 4WQOB 4XC2A 3QC8B 1WR6E 4LDTB 1J0GA 1WJ4A 3ZLZA 1EF1A 4W9CA 3KYCD 5D7GA 3WA0A 2N9PC 2WX1A 4IG7B 2O6VA 2JUOA 3ZRCA 2EKEC 1MG8A 2NPTB 2BKFA 3WALA 2ASQA 4NAWA 2MBEA 2DYBA 1OQYA 1E5WA 2ZVOA 1WYWB 3P2BA 3VUYA 4BOSC 4HPMB 1HE8A 2JY6A 3R7RA 5JH5C 1FXTB 3ML8A 4J6IA 2K8BA 4W9GA 4NQKE 3K9PB 2KWCA 2LWPA 4MSMB 1UBIA 2FAZA 3M62B 2CR5A 1WGGA 3V6CB 3AU5A 3PLVA 3LJ3A 1V5TA 4KSLC 2KD0A 2O2VA 2MSED 5J18A 3L16A 3VTWA 3TIXA 1P1AA 4K81A 5BO4B 2FIDA 4MELA 1SIFA 4ASWC 2D10A 2LI5A 3DDCB 4BKGA 3QQ8B 2LZ6A 4IC7B 4GDKA 5CHVC 2KFKA 3NZSA 4JQWC 2IY1B 2D3GA 4PYUA 4FADA 2BYEA 2N1VA 2O6VB 4PYZA 3N32A 1OEYA 1QZEA 3QARA 3ONSA 5JHBA 2G4DB 4NAWB 4AUQC 1V2YA 3X23A 1GUAB 2PE9A 3VQIA 3UIPB 2UYZB 2NR2A 1ZW7A 1YX5B 3WAMA 3R7QA 3A1QA 2KK8A 3DBHI 5LLIA 4AJWA 2K25A 3WAPA 3ZTCA 4EUTA 3GZNI 2L3ZA 3V61A 3ZVVA 1WGHA 4GDLA 3L54A 4TV3A 3QIJA 3VH3B 1A5RA 2PEAA 2KVRA 2O2VB 3CF6E 5KHOA 3NS8A 2CS4A 3PTFC 2K1FA 2LRWA 2ZEQA 2I1JA 4HK2A 2MX2A 4W9HA 3A33B 3N30A 2KFKB 1ISNA 3DQVA 2KC2A 2EMTA 2KTFA 3KUDB 4KZ0A 4MJSA 3WIMA 5AZFA 2EMSA 4IUMB 1V5OA 3ZNZB 2K39A 4K7UA 4BBNC 1Z5SB 3B1LX 2LGYA 4G0NB 1E7UA 1WXVA 3GOEA 4CO7A 4LJPB 1TGZB 4E71A 2HJ8A 3Q3FA 3CSTA 4ANUA 4HJKA 1PQSA 1Y8RC 3A1QB 3VUWA 3VAWA 4I6LB 2LGDA 3VUXA 3IBEA 3PRPB 3DVNU 4HLEA 5LXIB 2LUEA 4GDLB 4MGYE 4OVUA 1WGDA 4P7IA 2JPHA 1V9JA 1LXDA 1WFYA 1ZKHA 2KHWB 2L8JA 2KJRA 2MWSB 2N7DA 1WF9A 4I6PA 4MGZE 3NOBA 4ICVA 3JW0X 3JVZX 1TTNA 4A3OA 2C7HA 2KDEB 4II3B 4KVGB 5J17A 3IHPC 3SHQA 3RCZA 2KJHB 3D32A 1XQQA 3ZRFA 1RRBA 5GMVA 2R2OA 2GBRA 2N9EB 2WWZA 3DVNV 3AULA 3APFA 2BF8B 4W9DA 3ZNID 4KDIC 3VDZA 1IYFA 1P9DU 4HCNB 1Q0WB 1T0YA 4WWOA 1V80A 2A5UA 2MCNB 2M4NA 3V60A 1EF5A 2KXJA 3EFUA 4EEWA 4EZLA 3DVGY 3SDLC 2CU1A 2DZJA 3QK0A 4FULA 4IWPA 3KUCB 3R3MA 2NS5A 3VHTC 1NI2A 4WWNA 1XD3B 1V6EA 2L7RA 3PGEA 3WAOA 2ZCCA 3PRZA 1KM7A 2I1KA 5AZGA 2LD9A 4GXBA 3TBLD 4DWFA 2W9NA 2BPSA 3N3KB 4KSKC 2L05A 2RD0A 5AZHA 3UQAA 2V3SA 2KWVB 1SGHA 2KX3A 2AL6A 2LVQA 2JF5A 3DBLI 3VFKA 3ZKJC 4B9KA 4TQ0A 2KO3A 4RM9A 2BYFA 3BINA 2AYOB 3ALBA 5C1ZA 3HIZA 2N7EA 4FHJA 2DYOA 3HM3A 4ZYNA 3A4RA 3ZNGC 3QA8A 4IM0A 4GOCA 2JZZA 3A9JA 4AWJA 1WRDB 1Q1OA 5CX3A 1D3ZA 4AJYB 3PLUA 2UWQA 4HCPB 4W9IA 2ZCBA 1P3QU 4JGHB 4TKNA 5DCNA 4ZDVA 1V81A 2YVCA 1I35A 3RZWC 1WX8A 2GOWA 4JIOU 2N4FA 4K1RB 3OJ4B 1WXAA 2AWTA 3PS6A 3PZDA 2HTHA 4MH0E 3TCAA 2LRUA 4F1SA 2K8HA 1I42A 4FN2A 2GMIC 5KHQA 2KQSA 3U7DA 3ECIA 4E3CA 3H7SA 3IVFA 1WZ3A 4DHZB 2IO2B 4HVBA 4B6WA 3ZUNA 3A9KA 1RFAA 2V4LA 5FR6A 4CHKA 3WANA 2JRIB 2GBKA 1E8XA 3W1SA 4F8CB 4FJZA 4M8MA 3M63B 4CYEA 3MJWA 2RGFA 4HDQA 5J2RA 2MA9B 4PS7A 2CHZA 1L7YA 3HHMA 1WE6A 4ANXA 1U4AA 3BY4B 3I3TB 5DPRA 3A9JB 2BWFA 2PE6B 4JL9A 2PPHA 3K9OB 3ZNHB 3M95A 5L83A 2NBVB 3VVWB 3ML9A 1Z2MA 4DK5A 4FHKA 3RULA 4ZRJA 1UBQA 2XBBC 3VTVA 2NBWB 2XEWA 2KJ6A 4MDKE 5CTRC 3TMPB 1VCBA 1RLFA 3QAQA 1WJ6A 3OAWA 2JWZA 5L95C 2L76A 3L10B 2M0XA 1F9JA 1UD7A 2ZVNA 3KH0A 4M8NA 4DDGD 4GMVA 1WJNA 2IZVB 4X57B 5IA7A 2ZZPB 3KW5B 4TQ1A 2KANA 4I6NB 2MBOA 2Z0DB 2C5LC 4IM3A 2C7NB 4W9KA 4BKSD 2WYQA 3B08A 2A4ZA 2KMCA 2BKRB 1IPGA 1YJ1A 4AOFA 2MLBA 5G55A 2DAFA 2MP2B 3A9KB 3AXCA 2KNBA 4W9EA 2ZNVC 1LFDA 2LGXA 4MEMA 5D2MB 5DPTA 2M17A 2ZPNA 2KQ7A 3B0AA 4MGIE 2IO0B 1Q5WB 2OOBB 1V49A 2KX0A 5CHFA 2LASA 4NJ7A 1WE7A 1WI0A 4KIKA 4ANVA 3ZW3A 1C3TA 4GGQA 2KOXA 2DZMA 4A3PA 1H8CA 3AI5A 1UGMA 3DOWA 1CMXB 4JLCA 1LQBA 4IW0A 5JZEB 3H1UA 3KUZA 3H9DA 4FJVB 1WGYA 3RZFA 2GBMA 3HK0A 3OJ3A 4FLHA 3S2AA 2C60A 2C7MB 2XK5B 2KN5A 1YD8U 2Z0EB 2KDBA 1H4RA
chains in the Genus database with same CATH superfamily
1E7PB 1MG4A 2ON8A 2AEHA 1F2RI 5IO9A 1DGJA 4B95A 2V9HA 3A4SC 2W3RA 1E8YA 4HXDA 3N1ZC 1TKEA 5G2NA 4KIKB 1PFDA 3DBSA 3APDA 2JT4B 1WX7A 4KKJA 2D11A 1EU4A 3KQ4A 4LTUA 3SFEB 4EKUA 1WX9A 2G3QB 3V3XA 5EDSA 2QCZA 1V1PA 4F7ZA 2DX5B 2D5GA 2WS3B 1MHHE 3P1MA 2QHOA 3GZNB 4RF1A 4ZRIA 4IDIA 3PO0A 1J7BA 4NJ6A 3QWZB 1V86A 4XX5A 2INPE 1HQRD 1T0RC 4KZCA 2LXAA 2QIEB 2NCNA 1WR1A 2YLMA 5I4DA 4NNJB 3B2FA 2GBJA 2E6XA 3RNEC 4DHJD 3FILB 1QOGA 2NBUA 2L52A 1QLBB 2VRRB 2LGSA 2KFJA 3ZIMA 1QILA 2LFIA 2LJ5A 2D07B 1JCKB 4G50A 2K9XA 1D6EC 1ET9A 4DXAB 3T9LA 4MH8A 2MJ3A 1SE9A 1TZ1A 2VH1A 3OWEB 1SBBB 1QQRA 1FEHA 1WMHB 2XK5A 1J19A 1ROEA 3O65B 3JSVB 3KVFB 1B9RA 3EHVA 1SE3A 2D2QA 3QJZA 1K8RB 3RD2A 1P0RA 4Q2JA 1ZXHA 4P1BC 3P63A 2Z59B 1IGCA 4GDKB 2WXOA 1SB3C 2V1YA 3V6EB 2MBBB 1KF6B 2KVZA 4NQLB 2QJLA 1D5XC 3TEWA 4N58A 4MSQB 2R2QA 4GSWA 4DHZE 5JHAA 5DPSA 3KWVA 4IWQA 4EFOA 4ITKA 4NZLB 5G5GA 1E8WA 3U8ZA 2PKOA 2NPTA 4NY0A 1GC7A 3W1YA 2B76B 2R61A 3UGBB 4FBJB 3PHXB 1WXMA 2N9XA 3DCGA 4LNOA 1FCCC 4WJPA 3W1SC 2WDTB 4MJSB 2NVUI 1E8ZA 4MGKE 1MHXA 3U30A 3RMKC 1P7FA 3PREA 5TR5A 1C4CA 3NY5A 2Y3AA 1J0GA 2WX1A 4IG7B 5EE9A 1CJEA 2JUOA 1K53A 3ZRCA 2JU6X 4YXDB 3AECB 3Q3NC 3WALA 2ASQA 2MBEA 2ZVOA 1D4BA 5LNK1 1HE8A 3R7RA 1YJJA 5HHDG 1FXTB 3ZQ4A 4W9GA 4C56C 3NVVA 2LWPA 2GI9A 3M62B 1WGGA 3V6CB 5J18A 3BZDB 2KMMA 1TS3A 2M0AA 3GE8C 4ASWC 2AX5A 3BK2A 4FADA 2KFKA 4JQWC 3N20C 2N1VA 4PYZA 3N32A 4BAXA 1TIFA 4XYCA 4NAWB 4AUQC 1V2YA 3X23A 2WXJA 2BB6A 2NR2A 1ZW7A 1L4DB 3DBHI 1L6VA 3EGRA 3V61A 3ZVVA 3MC9A 2O2VB 3NS8A 3PTFC 2K1FA 1TYGB 3N1YC 4HK2A 2MX2A 4W9HA 3OG5A 1HA5A 3DQVA 3KUDB 2EMTA 3CWIA 4KGSA 1V1OA 1RWSA 4IUMB 1TKYA 1ENFA 3N1XC 4FXCA 2BS3B 2I38A 4QAYA 4WAFA 4G0NB 1E7UA 3GOEA 3TEXA 4E71A 2LHDA 2NTSA 1Y8RC 3VAWA 3NJTA 1ZDVA 1OFFA 4A8XC 2FUG1 4YSZB 2KHWB 5EE3A 2KJRA 1WF9A 4ICVA 1TTNA 1UWMA 5J17A 3IHPC 3RCZA 2JQRB 1XQQA 3ZNID 3VDZA 4IKGA 2VZKB 4WWOA 1V80A 1NYRA 2KXJA 3EFUA 1N5XA 2CU1A 3U4EG 3LYYA 1WRIA 1V6EA 1FXIA 3WAOA 3NVZA 2ZCCA 2I1KA 2W9NA 3N3KB 5HI1A 2L05A 4HRSA 2KWVB 3LXFA 4KKIA 4B9KA 2BW2A 4YSXB 4UDUC 2RDHA 3BINA 3ALBA 2MHJA 2QMTA 1N6ZA 2N7EA 3HRDD 3HM3A 4ZYNA 3DBRB 3ZNGC 3Q8EA 4ZOHC 4IM0A 2JZZA 4A9AA 5CX3A 3PLUA 4TKNA 3DBHB 4ZDVA 4JIOU 1E9MA 2HTHA 1UF0A 3TCAA 4YSYB 4FN2A 2KQSA 3H7SA 4XWWA 1YQ4B 1WGKA 3ZUNA 3WANA 1C76A 3W1SA 4M8MA 2LUMA 2N9LA 2RGFA 1I4XA 2WLBA 4ANXA 1L7YA 3HHMA 5DPRA 3DHGC 2NBVB 3VVWB 1Z2MA 3RULA 4ZRJA 1UBQA 3VTVA 2NBWB 2XEWA 2I2YA 2KJ6A 2PVOD 1V8CA 2EELA 1VCBA 3OAWA 5L95C 2M0XA 1UD7A 3Q8CA 2K22A 2ZZPB 3BWUD 3RN9C 1CZPA 1I4PA 2PMVA 2FE8A 3AN1A 4IM3A 2DBYA 2WYQA 2X38A 5G55A 1T0SC 4W9EA 3P4QB 4MEMA 2IO0B 1V49A 2WXPA 4NJ7A 4KIKA 4HEA1 4C4VA 1HXYD 1UGMA 3ZGZA 2SEBD 2OHFA 4S0RA 5JZEB 3H1UA 5EE0A 2N9KA 2GBMA 3S2AA 1JW9D 1QKZA 2WXNA 2REXA 2CJOA 4NPNA 2J0MA 1AARA 1J7AA 3PRMB 3RT3B 1T5XD 4P6VF 3UIOB 4N59A 1KTKA 4GU2A 1NDDA 3PV1A 1JRUA 1ESFA 1AYFA 3HUIA 2K0PA 3KYDD 1AW7A 3C19A 1RYJA 4A55A 1VDVA 3MTNB 3NHEB 2N1WA 3FILA 2BT6A 1ZDXA 2H88B 1QT9A 3RNCC 1UNSA 2CHXA 1A70A 3AU4A 2WXLA 1E6EB 3RYTA 1VD2A 2L00B 4L1BA 3UF8A 2IGGA 2JVCA 2IO3B 3UINB 4D2KA 3DWMA 4YL8A 1NYQA 4WJQA 1WMHA 4LCDE 5BYSA 3JSVA 3RUIB 1YNTE 2MQJA 4ZRPA 1J8CA 1GG3A 3L0WB 2MP2A 1ZXIA 3ZXRA 1PGAA 2MJEA 1F77A 1WIAA 1I7HA 4PS3A 1D5ZC 2KLCA 3RFZB 2INDC 1STEA 3EECA 3L13A 1R4MI 2KDMA 3KWLA 1CQVA 1ZPSA 1JWAD 4JX1C 2WGSA 3IG3A 1TY2A 2IPKD 3QCAA 2DHZA 3VH4B 3Q14C 1X1MA 5E6PA 4OW0A 5G5HA 2AQ1B 2KACA 4PS8A 3NZUA 1OTRB 4WAAA 1L2NA 2ZJDA 1UELA 1EWYC 1EO6A 3JYUA 4CQNA 2RSUA 1FNWA 4XE0A 2FIFA 1I4QA 2IYDB 2K8CA 2AQ3B 2LXCA 4URKA 2JYTA 1WXSA 1K52A 2PJHA 4OVVA 2RDGA 1FRDA 1UZXB 2CHWA 3Q8BA 4KV2A 4N9F4 4W9LA 3HM6X 2L0TA 2OJRA 4BBNF 4BKTA 4EOYA 2IBIB 2W55A 2WDVB 1FD6A 1S1QB 2FCMA 4YTPB 2J7QB 1QOBA 1VZ7A 4ZHOA 1F1HA 4B0MA 2DZIA 2J0KA 2MBQA 2HE7A 2JSVX 1TZOA 5FKAC 2K6QA 1GNUA 1N63A 4TUUA 2VZKD 4M0WB 5D6JB 2L32A 3NS1A 4XC2A 3QC8B 1EF1A 4W9CA 3KYCD 1QOFA 1BXTA 4C80A 1MG8A 3E56A 2BKFA 3EFCA 4NAWA 2LEKA 1WXQA 2DYBA 1E5WA 1WYWB 4B0EA 3VUYA 4HPMB 4GLSC 5JH5C 1R4MB 1IGDA 4NQKE 3K9PB 1FRRA 2RDBC 1VJKA 3LJ3A 1C78A 4KSLC 2O2VA 1C77A 1SIFA 3BVZA 3DDCB 4BKGA 3QQ8B 4ACFA 3FAHA 5BMIA 2BYEA 2O6VB 2BB5A 3C8YA 3ETRA 2OEDA 1SJHD 3WAMA 2KK8A 3ZTCA 4EUTA 2L3ZA 3QIJA 1B1ZA 1L0VB 5KHOA 3NZ3A 2ZEQA 2MEKA 1L0XB 2I1JA 2IGHA 3A33B 3N30A 2Y5PA 2INNE 2WXMA 2FBWB 4MACA 2WNMA 3EUB2 2K39A 1Z5SB 1WWTA 2QDFA 3VR8B 4CO7A 2GRIA 5D3DA 3CSTA 3T3OA 3AE5B 3A1QB 4KGTA 3VUXA 4HLEA 2LUEA 4GDLB 3ZJTA 1WGDA 2JPHA 1V9JA 1SEBD 1ZKHA 2N7DA 2MWSB 4M00A 2C7HA 3SHQA 2KJHB 1KRHA 2BYTA 3HVZA 1HTOA 3P4PB 4JPSA 3APFA 2BF8B 4W9DA 1T0YA 1EF5A 5FK9C 4JWSC 1XLQA 3QK0A 3VHTC 4WWNA 3GB1A 2L1AA 2LD9A 4GXBA 4OZCA 3TBLD 1C4PA 3PZ8A 4KSKC 3EA6A 2V3SA 1SGHA 2JXTA 1RFKA 3HIZA 5EE1A 3AMZA 1F52A 3A4RA 2YEPF 1ZUD2 3QA8A 4XWTA 3ZJUA 1HTQA 1YOVB 2UWQA 4HCPB 4AS1A 1P3QU 2QSDA 1K51A 5DCNA 1L6UA 1V81A 3BVGA 1JWUD 1WX8A 2GOWA 2WXIA 2W3SA 1FNUA 3OJ4B 1WXAA 3BYYB 3PZDA 2PIAA 4F1SA 2K8HA 3U7DA 4E3CA 1NEKB 2J42A 4DHZB 3R2IA 3R2TA 2V4LA 5FR6A 4CHKA 3P42A 2GBKA 4RH6A 3M63B 4CYEA 3MJWA 5J2RA 1N61A 2X8XX 1U4AA 3I3TB 3A9JB 2WXGA 1V1PB 3ZNHB 1TKGA 4DK5A 4FHKA 2JX5A 4MDKE 2WXKA 2N7JA 4XGAB 3TMPB 3RNBC 1WJ6A 2JWZA 3NG0A 1F9JA 3KH0A 1IBXA 4X57B 1WJNA 1TT5B 2BTEA 3Q6BA 1FO4A 4L2YA 3KW5B 1SSNA 3RPFC 2MBOA 4K3BA 2TSSA 2Z0DB 4W9KA 4BKSD 2KMCA 1JRPA 4LLGM 3AXCA 4P1CC 5D2MB 5JXVA 2DWQA 2ZPNA 2QILA 3AE4B 1Q5WB 2CU3A 4ANVA 3WCQA 1JMLA 4RGNA 4RGTA 4PK1A 3I63C 1H8CA 1XCTL 1XXGA 1Q10A 3KUZA 3H9DA 1WGYA 3RZFA 3OJ3A 4FLHA 2C7MB 2XK5B 2KN5A 2UU7A 2KLGA 5HKHA 1EU3A 2KZRA 1F2RC 2RPQA 1G6JA 1N5WA 1ZP0B 3DPDA 4IM2A 4C7ZA 2GBNA 1S3SG 2PLPA 2JXXA 4BVUC 2Z8LA 4GB9A 1NBFC 2MRPA 1GC6A 3AEAB 2E3TA 1PGXA 4DQOC 1P98A 2KWUB 4AP4C 1C9FA 3IFWB 2KDFB 3BIID 1ZGUB 3UI3A 4GIVA 4FA6A 1RAXA 3PT2B 2AQ2B 2K6DB 1FNVA 2K3UA 4BKSA 4EZKA 2J4XA 1PDXA 5C23A 2J0JA 2FNJB 1E7VA 4WJNA 2WU5B 4DHJB 4EZJA 1FFUA 3UQBA 4YWGG 2WHIA 1R4NI 5D94A 3TJPA 3VXWA 2IY0B 3T8MA 2D3AA 3CSFA 3R66C 5CHWA 2KTRB 3QX1A 2BBCA 1UH6A 4L23A 3N9YC 1FXAA 1OQRA 4ZRKA 3H7PB 3AM9A 4GN1A 3AE1B 2ZNVB 3NRZA 1WGRA 2G4SA 2M1MA 3J9CA 3V62A 1HEZE 2W82A 2O6VD 2DZKA 2HJ1A 2GLSA 3APCA 2G45B 2LVPA 3Q3JA 1KLVA 3MHSD 3ZDMC 4II2B 1N62A 2NTTA 4HDOA 3CIRB 4TSSA 5LXHA 2KKCA 4DDID 1TS2A 2ACZB 1NVID 1YX6B 2HD5B 4HWIB 1KJTA 1VLBA 4WH4A 2DYMA 2WXHA 5E6NA 5HG2A 2RMMA 1TS5A 2BGFA 1E90A 4HPLB 1GAQB 4M0WA 5BMGA 1LM8B 3BVMA 3AE8B 1BT0A 2LGIA 2MW5A 1M94A 1WJUA 4BFRA 4E74A 1XT9B 3AE6B 4LNFA 4DBGA 1WH3A 2HTME 1YIWA 2G9HD 2ZPYA 4YTNB 2Y5BB 2WP9B 3ZTDA 4G11A 1J7CA 4K7WA 2XN9C 2LMCA 2W54A 4LJOB 3QHTA 3Q69A 5H92C 2MBHA 4ZYSA 1ET6A 4W9JA 4US9A 4R3DA 1WR6E 4LDTB 1P7EA 1XEEA 1R4NB 3ZLZA 5D7GA 3WA0A 2N9PC 2O6VA 3NVYA 4O1NA 2EKEC 1WSPA 4BOSC 1YJIA 2JY6A 1DOXA 3ML8A 4OZAA 4J6IA 2K8BA 4MSMB 2FAZA 4ZRQA 5IKCM 2CR5A 3AU5A 3PLVA 1V5TA 3L16A 5H8YE 1BUIC 4MM3B 2FIDA 2D10A 2LI5A 3AEDB 2ONQA 4AQ7A 4IC7B 4GDKA 3NZSA 5JHBA 2G4DB 1T6BX 2JYEA 2BS2B 1GUAB 3VQIA 2UYZB 1YX5B 3A1QA 4AJWA 1LGRA 2K25A 3WAPA 1JWMD 3GZNI 1WGHA 4GDLA 4J3OD 3VH3B 1TY0A 2PEAA 2KVRA 4EE2A 3CF6E 2LRWA 5C3JB 3U7ZA 3TEYA 1ISNA 4KZ0A 2KTFA 4LNKA 4MJSA 3B1LX 1WXVA 4LJPB 1TGZB 2HJ8A 3Q3FA 4ANUA 2KQ4X 2LGDA 1KFYB 3PRPB 3NUHB 2QC8A 5LXIB 4MGYE 4OVUA 3SFDB 2KWDA 2L8JA 4US8A 3MJ5A 2VH2A 3NOBA 3JW0X 1KLGD 4A3OA 4II3B 2PTLA 4KVGB 3MC0B 3D32A 1UWXA 1RRBA 3VRAB 3PZ7A 5GMVA 2R2OA 2GBRA 2N9EB 2WWZA 1ZOYB 4KDIC 1P9DU 4HCNB 1TJEA 2MJDA 2LJIA 2OJWA 4RGOS 3SEBA 3DVGY 1AN8A 4IWPA 3KUCB 3Q3OC 2BS4B 2NS5A 1D5MC 1NI2A 1L4ZB 3NVWA 2L7RA 1E0ZA 3PRZA 5AZGA 3TSSA 3GS2A 2RD0A 5AZHA 3UQAA 4RFBA 4C4VB 3DBLI 2AL6A 2LVQA 2JF5A 1F0ZA 1HZ5A 4RM9A 3Q2AC 5C1ZA 4FHJA 2DYOA 3DHHC 3A9JA 1Y56A 4AWJA 3URYA 1D3ZA 4W9IA 2HDEA 2ZCBA 4JGHB 2KYWA 1N60A 2N4FA 3PS6A 4MH0E 2LRUA 1YMHE 4DXFA 1HZ6A 3T3NA 4OVZA 1WZ3A 4RF0A 4HVBA 4B6WA 2XNAC 1RFAA 2WU2B 3I57A 2JRIB 1E8XA 4F8CB 2MA9B 3MHZA 4PS7A 2CHZA 2N0SB 3RI7C 1MJDA 3K9OB 3KLSX 3M95A 4USAA 3ML9A 3AEEB 4H2AA 2DLBA 2XBBC 1LO5D 3QAQA 3TEZA 3W5UB 3L10B 4M8NA 1M4VA 2IZVB 1T3QA 1DOYA 3IT6B 4TQ1A 4NAMA 4HKZE 2KANA 4I6NB 1MFWA 4PT5A 3AE3B 2JWUA 2M19A 2A4ZA 1YJ1A 4MT5A 1ZE3D 4AOFA 2MLBA 2DAFA 2MP2B 1I4RA 3A9KB 1RM6C 4JE3B 1LFDA 5IP4D 4IOIE 4MGIE 2OOBB 3IAM1 5CHFA 1FPYA 2LASA 1WE7A 1WI0A 3ZW3A 1C3TA 1XO3A 1UGJA 4A3PA 4OZBA 3AI5A 1QOAA 1VR9A 4LNNA 3ZYYX 1T0QC 3RNGC 3DBLB 2KDBA 1H4RA 1GJZA 2IDYA 1AWDA 5E6OA 4BOZB 1VZ6A 3B9JA 3TL5A 2M56B 4KGRA 4LNIA 3AV8A 3SR6A 2KDIA 3FKYA 3PVLA 5AUIA 1MI0A 1VZ8A 2B3AA 2FCQA 4FJYA 4RMAA 2M8SA 1IUEA 1XF5L 1EWCA 5IOIA 4WIPA 4ICUA 1GOZA 3TUOA 2KTRA 3PSEB 4HROA 4HJGE 2AL3A 2C9WB 1CK1A 3IAS1 3H7PA 1WM2A 3RNAC 3SD5A 2DAJA 4LDTD 2FUHB 5HFYA 4YTMB 4HKQA 2BWES 1EUVB 1FFVA 3M3JA 1OEYJ 3L4PA 5BYRA 1EM7A 3ENEA 3PHWB 1WZ0A 3OLMD 3V05A 4HPPA 3PPAA 4REZA 1KH0A 3L17A 1TS4A 3ABVB 3W2DA 2KC1A 3X0WA 2WQYB 3SU8X 3ZO5B 1XCQL 3VTUA 2ICIA 2IO1B 4A20A 2JZPA 3H6NA 3DBRI 5C2TB 2RR9A 3DVGX 1C1YB 1WM3A 1XLNA 5AEKB 5TSSA 4K3CA 4JWUC 1WY8A 2V0GA 1IP9A 1BMLC 3EC8A 3L08A 2INCC 3ZDTA 4BZAA 3BK1A 5IAAC 2SAKA 2JRHA 1FIQA 4M01A 5MPOA 1PUTA 2LVOA 2IGDA 1C4AA 1YN4A 2WDQB 3LDZE 3ZXVA 2ZW1A 1TBEA 4ANWA 1NENB 2DENB 1SXTA 3AE2B 3CMMB 2DNFA 3RNFC 5DPWA 2K5PA 1PGBA 4WWPA 4KDLB 2J52A 4IWOA 4ARCA 2FCSA 2L0FA 3MC8A 5BYQA 4OHJA 4A6QA 4W9FA 3W5VB 1K50A 4WJOA 1PYWD 2Y5CA 1OGWA 2CKHB 2JZ3B 2V3NA 2WXFA 4RM8A 3GE3C 2WX0A 3AEFB 2LHEA 4KX6B 1SJED 1NI3A 2FCNA 4K7SA 2BYVE 1VRAB 1YQBA 1SE4A 3C0RB 4G3XB 4MM3A 1KOTA 2KMAA 4DXGA 1QF6A 2EKIA 4XZ4A 4WQOB 2Q5WD 2BVCA 4C7YA 1WJ4A 3LB8C 1JALA 2WDRB 3GP7A 3R8BA 4TMAB 2NPTB 2KAJA 1OQYA 3P2BA 1GB4A 4XDCA 2KWCA 1UBIA 5E6JA 2G1EA 2KD0A 2MSED 3VTWA 3I5JC 3I9V1 1SE2A 1P1AA 4K81A 3TIXA 5T8IA 2D3CA 5BO4B 4MELA 2LZ6A 1XLPA 3H8HA 5CHVC 4PYUA 2IY1B 2D3GA 2IJ0A 4C00A 3IT4B 1OEYA 1QZEA 2ZW0A 3QARA 2V4IB 4RNAA 3ONSA 2PVGC 1MPEA 1E10A 2PE9A 1ACCA 3UIPB 1SF0A 4RGMA 3R7QA 5LLIA 3Q3MC 3L54A 4TV3A 1YN5A 1A5RA 3HVDA 2CS4A 3AEGB 3U2SC 1R7SA 2RPVA 4P16A 2GB1A 4A90A 1XLOA 3P4RB 4S17A 2KFKB 2KC2A 1I4HA 3WIMA 5AZFA 2EMSA 3ZNZB 1V5OA 4K7UA 4BBNC 2LGYA 1L5PA 3FC4A 4HJKA 2YEPB 1PQSA 2V3PA 3VUWA 5FR3A 4I6LB 3DHIC 3IBEA 3DVNU 4P7IA 2MH7A 1LXDA 1WFYA 4I6PA 4MGZE 4XDDA 3JVZX 1DOIA 2KDEB 1JROA 1JWBD 3AE7B 3VR9B 3ZRFA 1IBXB 1SIJA 3DVNV 3AULA 1I4GA 3ZJVA 1DYQA 1IYFA 1FMAD 1Q0WB 4LK0M 2A5UA 2MCNB 2M4NA 3V60A 4WQMA 4EEWA 4EZLA 3SDLC 2DZJA 4FULA 3R3MA 3IXSA 2D3BA 5BMHA 1XD3B 3PGEA 1KM7A 4DWFA 2BPSA 1FM0D 3W9CB 3Q8AA 2PW9A 4TQ0A 1L0YB 2KX3A 3ZKJC 3VFKA 2KO3A 2BYFA 2WXRA 2AYOB 1JWSD 1JQ4A 4ARIA 1YN3A 4GOCA 1WRDB 4WWMA 1Q1OA 4NJCA 4AJYB 2WXQA 2CJNA 2H89B 2YVCA 4M02A 3RZWC 1I35A 4RCOA 3O13A 2L83A 4K1RB 4N6EB 2AWTA 2QEJC 1I42A 2GMIC 2BQQA 5KHQA 3ECIA 3IVFA 2IO2B 1UUPA 1OQQA 3A9KA 3DWGC 4FJZA 5AUKA 4HDQA 5D3IB 3AEBB 1WE6A 3AB5A 3BY4B 2BWFA 2NMQA 2PE6B 4JL9A 2PPHA 3BYTB 3VRBB 5L83A 1C79A 5CTRC 1V97A 1RLFA 3B2GA 2L76A 4DDGD 2ZVNA 1MVKA 3U52E 4GMVA 5IA7A 4YT0B 1KLUD 2C5LC 2C7NB 4WURA 3B08A 2BKRB 1IPGA 1FCLA 3P4SB 3E9SA 2KT7A 2KNBA 2ZNVC 2KN4A 2LGXA 3AH7A 5DPTA 2M17A 2KQ7A 3B0AA 1WYGA 5GXGB 2KX0A 3MP9A 4GGQA 1GPXA 2KOXA 4ZHPA 2DZMA 3DOWA 1YQ3B 1CMXB 3MFGA 4JLCA 1LQBA 4IW0A 4FJVB 3AE9B 2J53A 3HK0A 5IN7A 1GB1A 2C60A 1YD8U 2Z0EB 3Q8FA
chains in the Genus database with same CATH topology
2KLGA 5HKHA 1GJZA 5E6OA 2KZRA 4BOZB 2REXA 2RPQA 2AEHA 3TL5A 1G6JA 4NPNA 2J0MA 1AARA 3PRMB 3RT3B 3DPDA 3UIOB 4IM2A 4B95A 3A4SC 2GBNA 4GU2A 1S3SG 1E8YA 1NDDA 2JXXA 4HXDA 2KDIA 4BVUC 3PV1A 1JRUA 4GB9A 3PVLA 1NBFC 5G2NA 2B3AA 4KIKB 2FCQA 2MRPA 1GC6A 4FJYA 3KYDD 4RMAA 2M8SA 3DBSA 3APDA 3MTNB 3NHEB 2JT4B 2N1WA 1P98A 4ICUA 2KWUB 4AP4C 1WX7A 2KTRA 3IFWB 2D11A 3PSEB 2KDFB 2AL3A 2C9WB 1ZGUB 1WX9A 2G3QB 4EKUA 2CHXA 5EDSA 3AU4A 3H7PA 4GIVA 1WM2A 4F7ZA 2DX5B 3RYTA 2DAJA 4LDTD 1VD2A 2L00B 3SD5A 1RAXA 4FA6A 2FUHB 3PT2B 3UF8A 2K6DB 2QHOA 2JVCA 2IO3B 3UINB 2BWES 4ZRIA 1EUVB 3M3JA 4NJ6A 1OEYJ 4YL8A 3QWZB 1V86A 4WJQA 4XX5A 1WMHA 4BKSA 4EZKA 4LCDE 4KZCA 5C23A 2LXAA 2J0JA 2FNJB 2NCNA 1WR1A 3ENEA 1E7VA 4WJNA 3PHWB 3JSVA 1WZ0A 3RUIB 2YLMA 4DHJB 3OLMD 2MQJA 4NNJB 4EZJA 3UQBA 1J8CA 1GG3A 2GBJA 3L0WB 1R4NI 3PPAA 5D94A 2MP2A 3TJPA 4DHJD 3VXWA 2IY0B 3T8MA 3L17A 3CSFA 1WIAA 3R66C 5CHWA 2KTRB 2NBUA 2KC1A 3QX1A 3X0WA 2VRRB 3ZIMA 2KFJA 4PS3A 3SU8X 3ZO5B 3VTUA 1UH6A 2KLCA 2D07B 2LJ5A 4G50A 4ZRKA 3H7PB 4DXAB 2IO1B 4A20A 4GN1A 3T9LA 2ZNVB 3H6NA 1WGRA 2G4SA 1R4MI 2M1MA 3DBRI 1SE9A 1TZ1A 3EECA 3L13A 3V62A 2O6VD 2DZKA 2RR9A 3DVGX 1C1YB 3APCA 1WM3A 2G45B 3IG3A 2LVPA 5AEKB 3Q3JA 3QCAA 1KLVA 1WMHB 3MHSD 1WY8A 2DHZA 3VH4B 2XK5A 1J19A 3ZDMC 1IP9A 4II2B 3O65B 3JSVB 1X1MA 3EC8A 3KVFB 3L08A 5E6PA 3EHVA 3ZDTA 4HDOA 4PS8A 5IAAC 5LXHA 2JRHA 2KKCA 4DDID 2D2QA 3NZUA 3QJZA 1K8RB 3RD2A 1OTRB 1P0RA 4WAAA 1L2NA 2ZJDA 2LVOA 1UELA 2Z59B 1EO6A 3JYUA 4GDKB 1YX6B 2RSUA 2HD5B 4HWIB 2V1YA 1KJTA 3LDZE 3V6EB 2DYMA 2MBBB 5E6NA 2FIFA 4NQLB 1TBEA 2IYDB 4ANWA 2DENB 2BGFA 2K8CA 1E90A 2LXCA 3CMMB 4MSQB 4URKA 2PJHA 1WXSA 4HPLB 5DPWA 2R2QA 4GSWA 1LM8B 4OVVA 4WWPA 1BT0A 4KDLB 4DHZE 2MW5A 1M94A 4IWOA 1UZXB 2FCSA 2L0FA 5JHAA 2CHWA 4KV2A 5DPSA 1WJUA 4IWQA 4BFRA 4N9F4 4E74A 4EFOA 1XT9B 4W9LA 4W9FA 3HM6X 4DBGA 2L0TA 2OJRA 4WJOA 1E8WA 1WH3A 4BBNF 3U8ZA 4BKTA 4EOYA 2IBIB 1YIWA 1OGWA 2CKHB 2JZ3B 2NPTA 1GC7A 4NY0A 1S1QB 3W1YA 2ZPYA 2FCMA 4RM8A 3UGBB 4FBJB 3PHXB 1WXMA 2N9XA 2WX0A 2Y5BB 3DCGA 2J7QB 3ZTDA 4G11A 4WJPA 3W1SC 2WDTB 4MJSB 4K7WA 2NVUI 1E8ZA 4MGKE 2DZIA 2J0KA 3U30A 2MBQA 2HE7A 2FCNA 4K7SA 4LJOB 2BYVE 3QHTA 2K6QA 1GNUA 3PREA 5TR5A 2MBHA 1YQBA 3C0RB 4G3XB 4M0WB 4MM3A 4TUUA 1KOTA 5D6JB 2KMAA 3NY5A 4W9JA 4XZ4A 4WQOB 4XC2A 3QC8B 1WR6E 4LDTB 1J0GA 1WJ4A 3ZLZA 1EF1A 4W9CA 3KYCD 5D7GA 3WA0A 2N9PC 2WX1A 4IG7B 2O6VA 2JUOA 3ZRCA 2EKEC 1MG8A 2NPTB 2BKFA 3WALA 2ASQA 4NAWA 2MBEA 2DYBA 1OQYA 1E5WA 2ZVOA 1WYWB 3P2BA 3VUYA 4BOSC 4HPMB 1HE8A 2JY6A 3R7RA 5JH5C 1FXTB 3ML8A 4J6IA 2K8BA 4W9GA 4NQKE 3K9PB 2KWCA 2LWPA 4MSMB 1UBIA 2FAZA 3M62B 2CR5A 1WGGA 3V6CB 3AU5A 3PLVA 3LJ3A 1V5TA 4KSLC 2KD0A 2O2VA 2MSED 5J18A 3L16A 3VTWA 3TIXA 1P1AA 4K81A 5BO4B 2FIDA 4MELA 1SIFA 4ASWC 2D10A 2LI5A 3DDCB 4BKGA 3QQ8B 2LZ6A 4IC7B 4GDKA 5CHVC 2KFKA 3NZSA 4JQWC 2IY1B 2D3GA 4PYUA 4FADA 2BYEA 2N1VA 2O6VB 4PYZA 3N32A 1OEYA 1QZEA 3QARA 3ONSA 5JHBA 2G4DB 4NAWB 4AUQC 1V2YA 3X23A 1GUAB 2PE9A 3VQIA 3UIPB 2UYZB 2NR2A 1ZW7A 1YX5B 3WAMA 3R7QA 3A1QA 2KK8A 3DBHI 5LLIA 4AJWA 2K25A 3WAPA 3ZTCA 4EUTA 3GZNI 2L3ZA 3V61A 3ZVVA 1WGHA 4GDLA 3L54A 4TV3A 3QIJA 3VH3B 1A5RA 2PEAA 2KVRA 2O2VB 3CF6E 5KHOA 3NS8A 2CS4A 3PTFC 2K1FA 2LRWA 2ZEQA 2I1JA 4HK2A 2MX2A 4W9HA 3A33B 3N30A 2KFKB 1ISNA 3DQVA 2KC2A 2EMTA 2KTFA 3KUDB 4KZ0A 4MJSA 3WIMA 5AZFA 2EMSA 4IUMB 1V5OA 3ZNZB 2K39A 4K7UA 4BBNC 1Z5SB 3B1LX 2LGYA 4G0NB 1E7UA 1WXVA 3GOEA 4CO7A 4LJPB 1TGZB 4E71A 2HJ8A 3Q3FA 3CSTA 4ANUA 4HJKA 1PQSA 1Y8RC 3A1QB 3VUWA 3VAWA 4I6LB 2LGDA 3VUXA 3IBEA 3PRPB 3DVNU 4HLEA 5LXIB 2LUEA 4GDLB 4MGYE 4OVUA 1WGDA 4P7IA 2JPHA 1V9JA 1LXDA 1WFYA 1ZKHA 2KHWB 2L8JA 2KJRA 2MWSB 2N7DA 1WF9A 4I6PA 4MGZE 3NOBA 4ICVA 3JW0X 3JVZX 1TTNA 4A3OA 2C7HA 2KDEB 4II3B 4KVGB 5J17A 3IHPC 3SHQA 3RCZA 2KJHB 3D32A 1XQQA 3ZRFA 1RRBA 5GMVA 2R2OA 2GBRA 2N9EB 2WWZA 3DVNV 3AULA 3APFA 2BF8B 4W9DA 3ZNID 4KDIC 3VDZA 1IYFA 1P9DU 4HCNB 1Q0WB 1T0YA 4WWOA 1V80A 2A5UA 2MCNB 2M4NA 3V60A 1EF5A 2KXJA 3EFUA 4EEWA 4EZLA 3DVGY 3SDLC 2CU1A 2DZJA 3QK0A 4FULA 4IWPA 3KUCB 3R3MA 2NS5A 3VHTC 1NI2A 4WWNA 1XD3B 1V6EA 2L7RA 3PGEA 3WAOA 2ZCCA 3PRZA 1KM7A 2I1KA 5AZGA 2LD9A 4GXBA 3TBLD 4DWFA 2W9NA 2BPSA 3N3KB 4KSKC 2L05A 2RD0A 5AZHA 3UQAA 2V3SA 2KWVB 1SGHA 2KX3A 2AL6A 2LVQA 2JF5A 3DBLI 3VFKA 3ZKJC 4B9KA 4TQ0A 2KO3A 4RM9A 2BYFA 3BINA 2AYOB 3ALBA 5C1ZA 3HIZA 2N7EA 4FHJA 2DYOA 3HM3A 4ZYNA 3A4RA 3ZNGC 3QA8A 4IM0A 4GOCA 2JZZA 3A9JA 4AWJA 1WRDB 1Q1OA 5CX3A 1D3ZA 4AJYB 3PLUA 2UWQA 4HCPB 4W9IA 2ZCBA 1P3QU 4JGHB 4TKNA 5DCNA 4ZDVA 1V81A 2YVCA 1I35A 3RZWC 1WX8A 2GOWA 4JIOU 2N4FA 4K1RB 3OJ4B 1WXAA 2AWTA 3PS6A 3PZDA 2HTHA 4MH0E 3TCAA 2LRUA 4F1SA 2K8HA 1I42A 4FN2A 2GMIC 5KHQA 2KQSA 3U7DA 3ECIA 4E3CA 3H7SA 3IVFA 1WZ3A 4DHZB 2IO2B 4HVBA 4B6WA 3ZUNA 3A9KA 1RFAA 2V4LA 5FR6A 4CHKA 3WANA 2JRIB 2GBKA 1E8XA 3W1SA 4F8CB 4FJZA 4M8MA 3M63B 4CYEA 3MJWA 2RGFA 4HDQA 5J2RA 2MA9B 4PS7A 2CHZA 1L7YA 3HHMA 1WE6A 4ANXA 1U4AA 3BY4B 3I3TB 5DPRA 3A9JB 2BWFA 2PE6B 4JL9A 2PPHA 3K9OB 3ZNHB 3M95A 5L83A 2NBVB 3VVWB 3ML9A 1Z2MA 4DK5A 4FHKA 3RULA 4ZRJA 1UBQA 2XBBC 3VTVA 2NBWB 2XEWA 2KJ6A 4MDKE 5CTRC 3TMPB 1VCBA 1RLFA 3QAQA 1WJ6A 3OAWA 2JWZA 5L95C 2L76A 3L10B 2M0XA 1F9JA 1UD7A 2ZVNA 3KH0A 4M8NA 4DDGD 4GMVA 1WJNA 2IZVB 4X57B 5IA7A 2ZZPB 3KW5B 4TQ1A 2KANA 4I6NB 2MBOA 2Z0DB 2C5LC 4IM3A 2C7NB 4W9KA 4BKSD 2WYQA 3B08A 2A4ZA 2KMCA 2BKRB 1IPGA 1YJ1A 4AOFA 2MLBA 5G55A 2DAFA 2MP2B 3A9KB 3AXCA 2KNBA 4W9EA 2ZNVC 1LFDA 2LGXA 4MEMA 5D2MB 5DPTA 2M17A 2ZPNA 2KQ7A 3B0AA 4MGIE 2IO0B 1Q5WB 2OOBB 1V49A 2KX0A 5CHFA 2LASA 4NJ7A 1WE7A 1WI0A 4KIKA 4ANVA 3ZW3A 1C3TA 4GGQA 2KOXA 2DZMA 4A3PA 1H8CA 3AI5A 1UGMA 3DOWA 1CMXB 4JLCA 1LQBA 4IW0A 5JZEB 3H1UA 3KUZA 3H9DA 4FJVB 1WGYA 3RZFA 2GBMA 3HK0A 3OJ3A 4FLHA 3S2AA 2C60A 2C7MB 2XK5B 2KN5A 1YD8U 2Z0EB 2KDBA 1H4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KLG A;  5HKH A;  1GJZ A;  5E6O A;  2KZR A;  4BOZ B;  2REX A;  2RPQ A;  2AEH A;  3TL5 A;  1G6J A;  4NPN A;  2J0M A;  1AAR A;  3PRM B;  3RT3 B;  3DPD A;  3UIO B;  4IM2 A;  4B95 A;  3A4S C;  2GBN A;  4GU2 A;  1S3S G;  1E8Y A;  1NDD A;  2JXX A;  4HXD A;  2KDI A;  4BVU C;  3PV1 A;  1JRU A;  4GB9 A;  3PVL A;  1NBF C;  5G2N A;  2B3A A;  4KIK B;  2FCQ A;  2MRP A;  1GC6 A;  4FJY A;  3KYD D;  4RMA A;  2M8S A;  3DBS A;  3APD A;  3MTN B;  3NHE B;  2JT4 B;  2N1W A;  1P98 A;  4ICU A;  2KWU B;  4AP4 C;  1WX7 A;  2KTR A;  3IFW B;  2D11 A;  3PSE B;  2KDF B;  2AL3 A;  2C9W B;  1ZGU B;  1WX9 A;  2G3Q B;  4EKU A;  2CHX A;  5EDS A;  3AU4 A;  3H7P A;  4GIV A;  1WM2 A;  4F7Z A;  2DX5 B;  3RYT A;  2DAJ A;  4LDT D;  1VD2 A;  2L00 B;  3SD5 A;  1RAX A;  4FA6 A;  2FUH B;  3PT2 B;  3UF8 A;  2K6D B;  2QHO A;  2JVC A;  2IO3 B;  3UIN B;  2BWE S;  4ZRI A;  1EUV B;  3M3J A;  4NJ6 A;  1OEY J;  4YL8 A;  3QWZ B;  1V86 A;  4WJQ A;  4XX5 A;  1WMH A;  4BKS A;  4EZK A;  4LCD E;  4KZC A;  5C23 A;  2LXA A;  2J0J A;  2FNJ B;  2NCN A;  1WR1 A;  3ENE A;  1E7V A;  4WJN A;  3PHW B;  3JSV A;  1WZ0 A;  3RUI B;  2YLM A;  4DHJ B;  3OLM D;  2MQJ A;  4NNJ B;  4EZJ A;  3UQB A;  1J8C A;  1GG3 A;  2GBJ A;  3L0W B;  1R4N I;  3PPA A;  5D94 A;  2MP2 A;  3TJP A;  4DHJ D;  3VXW A;  2IY0 B;  3T8M A;  3L17 A;  3CSF A;  1WIA A;  3R66 C;  5CHW A;  2KTR B;  2NBU A;  2KC1 A;  3QX1 A;  3X0W A;  2VRR B;  3ZIM A;  2KFJ A;  4PS3 A;  3SU8 X;  3ZO5 B;  3VTU A;  1UH6 A;  2KLC A;  2D07 B;  2LJ5 A;  4G50 A;  4ZRK A;  3H7P B;  4DXA B;  2IO1 B;  4A20 A;  4GN1 A;  3T9L A;  2ZNV B;  3H6N A;  1WGR A;  2G4S A;  1R4M I;  2M1M A;  3DBR I;  1SE9 A;  1TZ1 A;  3EEC A;  3L13 A;  3V62 A;  2O6V D;  2DZK A;  2RR9 A;  3DVG X;  1C1Y B;  3APC A;  1WM3 A;  2G45 B;  3IG3 A;  2LVP A;  5AEK B;  3Q3J A;  3QCA A;  1KLV A;  1WMH B;  3MHS D;  1WY8 A;  2DHZ A;  3VH4 B;  2XK5 A;  1J19 A;  3ZDM C;  1IP9 A;  4II2 B;  3O65 B;  3JSV B;  1X1M A;  3EC8 A;  3KVF B;  3L08 A;  5E6P A;  3EHV A;  3ZDT A;  4HDO A;  4PS8 A;  5IAA C;  5LXH A;  2JRH A;  2KKC A;  4DDI D;  2D2Q A;  3NZU A;  3QJZ A;  1K8R B;  3RD2 A;  1OTR B;  1P0R A;  4WAA A;  1L2N A;  2ZJD A;  2LVO A;  1UEL A;  2Z59 B;  1EO6 A;  3JYU A;  4GDK B;  1YX6 B;  2RSU A;  2HD5 B;  4HWI B;  2V1Y A;  1KJT A;  3LDZ E;  3V6E B;  2DYM A;  2MBB B;  5E6N A;  2FIF A;  4NQL B;  1TBE A;  2IYD B;  4ANW A;  2DEN B;  2BGF A;  2K8C A;  1E90 A;  2LXC A;  3CMM B;  4MSQ B;  4URK A;  2PJH A;  1WXS A;  4HPL B;  5DPW A;  2R2Q A;  4GSW A;  1LM8 B;  4OVV A;  4WWP A;  1BT0 A;  4KDL B;  4DHZ E;  2MW5 A;  1M94 A;  4IWO A;  1UZX B;  2FCS A;  2L0F A;  5JHA A;  2CHW A;  4KV2 A;  5DPS A;  1WJU A;  4IWQ A;  4BFR A;  4N9F 4;  4E74 A;  4EFO A;  1XT9 B;  4W9L A;  4W9F A;  3HM6 X;  4DBG A;  2L0T A;  2OJR A;  4WJO A;  1E8W A;  1WH3 A;  4BBN F;  3U8Z A;  4BKT A;  4EOY A;  2IBI B;  1YIW A;  1OGW A;  2CKH B;  2JZ3 B;  2NPT A;  1GC7 A;  4NY0 A;  1S1Q B;  3W1Y A;  2ZPY A;  2FCM A;  4RM8 A;  3UGB B;  4FBJ B;  3PHX B;  1WXM A;  2N9X A;  2WX0 A;  2Y5B B;  3DCG A;  2J7Q B;  3ZTD A;  4G11 A;  4WJP A;  3W1S C;  2WDT B;  4MJS B;  4K7W A;  2NVU I;  1E8Z A;  4MGK E;  2DZI A;  2J0K A;  3U30 A;  2MBQ A;  2HE7 A;  2FCN A;  4K7S A;  4LJO B;  2BYV E;  3QHT A;  2K6Q A;  1GNU A;  3PRE A;  5TR5 A;  2MBH A;  1YQB A;  3C0R B;  4G3X B;  4M0W B;  4MM3 A;  4TUU A;  1KOT A;  5D6J B;  2KMA A;  3NY5 A;  4W9J A;  4XZ4 A;  4WQO B;  4XC2 A;  3QC8 B;  1WR6 E;  4LDT B;  1J0G A;  1WJ4 A;  3ZLZ A;  1EF1 A;  4W9C A;  3KYC D;  5D7G A;  3WA0 A;  2N9P C;  2WX1 A;  4IG7 B;  2O6V A;  2JUO A;  3ZRC A;  2EKE C;  1MG8 A;  2NPT B;  2BKF A;  3WAL A;  2ASQ A;  4NAW A;  2MBE A;  2DYB A;  1OQY A;  1E5W A;  2ZVO A;  1WYW B;  3P2B A;  3VUY A;  4BOS C;  4HPM B;  1HE8 A;  2JY6 A;  3R7R A;  5JH5 C;  1FXT B;  3ML8 A;  4J6I A;  2K8B A;  4W9G A;  4NQK E;  3K9P B;  2KWC A;  2LWP A;  4MSM B;  1UBI A;  2FAZ A;  3M62 B;  2CR5 A;  1WGG A;  3V6C B;  3AU5 A;  3PLV A;  3LJ3 A;  1V5T A;  4KSL C;  2KD0 A;  2O2V A;  2MSE D;  5J18 A;  3L16 A;  3VTW A;  3TIX A;  1P1A A;  4K81 A;  5BO4 B;  2FID A;  4MEL A;  1SIF A;  4ASW C;  2D10 A;  2LI5 A;  3DDC B;  4BKG A;  3QQ8 B;  2LZ6 A;  4IC7 B;  4GDK A;  5CHV C;  2KFK A;  3NZS A;  4JQW C;  2IY1 B;  2D3G A;  4PYU A;  4FAD A;  2BYE A;  2N1V A;  2O6V B;  4PYZ A;  3N32 A;  1OEY A;  1QZE A;  3QAR A;  3ONS A;  5JHB A;  2G4D B;  4NAW B;  4AUQ C;  1V2Y A;  3X23 A;  1GUA B;  2PE9 A;  3VQI A;  3UIP B;  2UYZ B;  2NR2 A;  1ZW7 A;  1YX5 B;  3WAM A;  3R7Q A;  3A1Q A;  2KK8 A;  3DBH I;  5LLI A;  4AJW A;  2K25 A;  3WAP A;  3ZTC A;  4EUT A;  3GZN I;  2L3Z A;  3V61 A;  3ZVV A;  1WGH A;  4GDL A;  3L54 A;  4TV3 A;  3QIJ A;  3VH3 B;  1A5R A;  2PEA A;  2KVR A;  2O2V B;  3CF6 E;  5KHO A;  3NS8 A;  2CS4 A;  3PTF C;  2K1F A;  2LRW A;  2ZEQ A;  2I1J A;  4HK2 A;  2MX2 A;  4W9H A;  3A33 B;  3N30 A;  2KFK B;  1ISN A;  3DQV A;  2KC2 A;  2EMT A;  2KTF A;  3KUD B;  4KZ0 A;  4MJS A;  3WIM A;  5AZF A;  2EMS A;  4IUM B;  1V5O A;  3ZNZ B;  2K39 A;  4K7U A;  4BBN C;  1Z5S B;  3B1L X;  2LGY A;  4G0N B;  1E7U A;  1WXV A;  3GOE A;  4CO7 A;  4LJP B;  1TGZ B;  4E71 A;  2HJ8 A;  3Q3F A;  3CST A;  4ANU A;  4HJK A;  1PQS A;  1Y8R C;  3A1Q B;  3VUW A;  3VAW A;  4I6L B;  2LGD A;  3VUX A;  3IBE A;  3PRP B;  3DVN U;  4HLE A;  5LXI B;  2LUE A;  4GDL B;  4MGY E;  4OVU A;  1WGD A;  4P7I A;  2JPH A;  1V9J A;  1LXD A;  1WFY A;  1ZKH A;  2KHW B;  2L8J A;  2KJR A;  2MWS B;  2N7D A;  1WF9 A;  4I6P A;  4MGZ E;  3NOB A;  4ICV A;  3JW0 X;  3JVZ X;  1TTN A;  4A3O A;  2C7H A;  2KDE B;  4II3 B;  4KVG B;  5J17 A;  3IHP C;  3SHQ A;  3RCZ A;  2KJH B;  3D32 A;  1XQQ A;  3ZRF A;  1RRB A;  5GMV A;  2R2O A;  2GBR A;  2N9E B;  2WWZ A;  3DVN V;  3AUL A;  3APF A;  2BF8 B;  4W9D A;  3ZNI D;  4KDI C;  3VDZ A;  1IYF A;  1P9D U;  4HCN B;  1Q0W B;  1T0Y A;  4WWO A;  1V80 A;  2A5U A;  2MCN B;  2M4N A;  3V60 A;  1EF5 A;  2KXJ A;  3EFU A;  4EEW A;  4EZL A;  3DVG Y;  3SDL C;  2CU1 A;  2DZJ A;  3QK0 A;  4FUL A;  4IWP A;  3KUC B;  3R3M A;  2NS5 A;  3VHT C;  1NI2 A;  4WWN A;  1XD3 B;  1V6E A;  2L7R A;  3PGE A;  3WAO A;  2ZCC A;  3PRZ A;  1KM7 A;  2I1K A;  5AZG A;  2LD9 A;  4GXB A;  3TBL D;  4DWF A;  2W9N A;  2BPS A;  3N3K B;  4KSK C;  2L05 A;  2RD0 A;  5AZH A;  3UQA A;  2V3S A;  2KWV B;  1SGH A;  2KX3 A;  2AL6 A;  2LVQ A;  2JF5 A;  3DBL I;  3VFK A;  3ZKJ C;  4B9K A;  4TQ0 A;  2KO3 A;  4RM9 A;  2BYF A;  3BIN A;  2AYO B;  3ALB A;  5C1Z A;  3HIZ A;  2N7E A;  4FHJ A;  2DYO A;  3HM3 A;  4ZYN A;  3A4R A;  3ZNG C;  3QA8 A;  4IM0 A;  4GOC A;  2JZZ A;  3A9J A;  4AWJ A;  1WRD B;  1Q1O A;  5CX3 A;  1D3Z A;  4AJY B;  3PLU A;  2UWQ A;  4HCP B;  4W9I A;  2ZCB A;  1P3Q U;  4JGH B;  4TKN A;  5DCN A;  4ZDV A;  1V81 A;  2YVC A;  1I35 A;  3RZW C;  1WX8 A;  2GOW A;  4JIO U;  2N4F A;  4K1R B;  3OJ4 B;  1WXA A;  2AWT A;  3PS6 A;  3PZD A;  2HTH A;  4MH0 E;  3TCA A;  2LRU A;  4F1S A;  2K8H A;  1I42 A;  4FN2 A;  2GMI C;  5KHQ A;  2KQS A;  3U7D A;  3ECI A;  4E3C A;  3H7S A;  3IVF A;  1WZ3 A;  4DHZ B;  2IO2 B;  4HVB A;  4B6W A;  3ZUN A;  3A9K A;  1RFA A;  2V4L A;  5FR6 A;  4CHK A;  3WAN A;  2JRI B;  2GBK A;  1E8X A;  3W1S A;  4F8C B;  4FJZ A;  4M8M A;  3M63 B;  4CYE A;  3MJW A;  2RGF A;  4HDQ A;  5J2R A;  2MA9 B;  4PS7 A;  2CHZ A;  1L7Y A;  3HHM A;  1WE6 A;  4ANX A;  1U4A A;  3BY4 B;  3I3T B;  5DPR A;  3A9J B;  2BWF A;  2PE6 B;  4JL9 A;  2PPH A;  3K9O B;  3ZNH B;  3M95 A;  5L83 A;  2NBV B;  3VVW B;  3ML9 A;  1Z2M A;  4DK5 A;  4FHK A;  3RUL A;  4ZRJ A;  1UBQ A;  2XBB C;  3VTV A;  2NBW B;  2XEW A;  2KJ6 A;  4MDK E;  5CTR C;  3TMP B;  1VCB A;  1RLF A;  3QAQ A;  1WJ6 A;  3OAW A;  2JWZ A;  5L95 C;  2L76 A;  3L10 B;  2M0X A;  1F9J A;  1UD7 A;  2ZVN A;  3KH0 A;  4M8N A;  4DDG D;  4GMV A;  1WJN A;  2IZV B;  4X57 B;  5IA7 A;  2ZZP B;  3KW5 B;  4TQ1 A;  2KAN A;  4I6N B;  2MBO A;  2Z0D B;  2C5L C;  4IM3 A;  2C7N B;  4W9K A;  4BKS D;  2WYQ A;  3B08 A;  2A4Z A;  2KMC A;  2BKR B;  1IPG A;  1YJ1 A;  4AOF A;  2MLB A;  5G55 A;  2DAF A;  2MP2 B;  3A9K B;  3AXC A;  2KNB A;  4W9E A;  2ZNV C;  1LFD A;  2LGX A;  4MEM A;  5D2M B;  5DPT A;  2M17 A;  2ZPN A;  2KQ7 A;  3B0A A;  4MGI E;  2IO0 B;  1Q5W B;  2OOB B;  1V49 A;  2KX0 A;  5CHF A;  2LAS A;  4NJ7 A;  1WE7 A;  1WI0 A;  4KIK A;  4ANV A;  3ZW3 A;  1C3T A;  4GGQ A;  2KOX A;  2DZM A;  4A3P A;  1H8C A;  3AI5 A;  1UGM A;  3DOW A;  1CMX B;  4JLC A;  1LQB A;  4IW0 A;  5JZE B;  3H1U A;  3KUZ A;  3H9D A;  4FJV B;  1WGY A;  3RZF A;  2GBM A;  3HK0 A;  3OJ3 A;  4FLH A;  3S2A A;  2C60 A;  2C7M B;  2XK5 B;  2KN5 A;  1YD8 U;  2Z0E B;  2KDB A;  1H4R A; 
#chains in the Genus database with same CATH topology
 1E7P B;  1MG4 A;  2ON8 A;  2AEH A;  1F2R I;  5IO9 A;  1DGJ A;  4B95 A;  2V9H A;  3A4S C;  2W3R A;  1E8Y A;  4HXD A;  3N1Z C;  1TKE A;  5G2N A;  4KIK B;  1PFD A;  3DBS A;  3APD A;  2JT4 B;  1WX7 A;  4KKJ A;  2D11 A;  1EU4 A;  3KQ4 A;  4LTU A;  3SFE B;  4EKU A;  1WX9 A;  2G3Q B;  3V3X A;  5EDS A;  2QCZ A;  1V1P A;  4F7Z A;  2DX5 B;  2D5G A;  2WS3 B;  1MHH E;  3P1M A;  2QHO A;  3GZN B;  4RF1 A;  4ZRI A;  4IDI A;  3PO0 A;  1J7B A;  4NJ6 A;  3QWZ B;  1V86 A;  4XX5 A;  2INP E;  1HQR D;  1T0R C;  4KZC A;  2LXA A;  2QIE B;  2NCN A;  1WR1 A;  2YLM A;  5I4D A;  4NNJ B;  3B2F A;  2GBJ A;  2E6X A;  3RNE C;  4DHJ D;  3FIL B;  1QOG A;  2NBU A;  2L52 A;  1QLB B;  2VRR B;  2LGS A;  2KFJ A;  3ZIM A;  1QIL A;  2LFI A;  2LJ5 A;  2D07 B;  1JCK B;  4G50 A;  2K9X A;  1D6E C;  1ET9 A;  4DXA B;  3T9L A;  4MH8 A;  2MJ3 A;  1SE9 A;  1TZ1 A;  2VH1 A;  3OWE B;  1SBB B;  1QQR A;  1FEH A;  1WMH B;  2XK5 A;  1J19 A;  1ROE A;  3O65 B;  3JSV B;  3KVF B;  1B9R A;  3EHV A;  1SE3 A;  2D2Q A;  3QJZ A;  1K8R B;  3RD2 A;  1P0R A;  4Q2J A;  1ZXH A;  4P1B C;  3P63 A;  2Z59 B;  1IGC A;  4GDK B;  2WXO A;  1SB3 C;  2V1Y A;  3V6E B;  2MBB B;  1KF6 B;  2KVZ A;  4NQL B;  2QJL A;  1D5X C;  3TEW A;  4N58 A;  4MSQ B;  2R2Q A;  4GSW A;  4DHZ E;  5JHA A;  5DPS A;  3KWV A;  4IWQ A;  4EFO A;  4ITK A;  4NZL B;  5G5G A;  1E8W A;  3U8Z A;  2PKO A;  2NPT A;  4NY0 A;  1GC7 A;  3W1Y A;  2B76 B;  2R61 A;  3UGB B;  4FBJ B;  3PHX B;  1WXM A;  2N9X A;  3DCG A;  4LNO A;  1FCC C;  4WJP A;  3W1S C;  2WDT B;  4MJS B;  2NVU I;  1E8Z A;  4MGK E;  1MHX A;  3U30 A;  3RMK C;  1P7F A;  3PRE A;  5TR5 A;  1C4C A;  3NY5 A;  2Y3A A;  1J0G A;  2WX1 A;  4IG7 B;  5EE9 A;  1CJE A;  2JUO A;  1K53 A;  3ZRC A;  2JU6 X;  4YXD B;  3AEC B;  3Q3N C;  3WAL A;  2ASQ A;  2MBE A;  2ZVO A;  1D4B A;  5LNK 1;  1HE8 A;  3R7R A;  1YJJ A;  5HHD G;  1FXT B;  3ZQ4 A;  4W9G A;  4C56 C;  3NVV A;  2LWP A;  2GI9 A;  3M62 B;  1WGG A;  3V6C B;  5J18 A;  3BZD B;  2KMM A;  1TS3 A;  2M0A A;  3GE8 C;  4ASW C;  2AX5 A;  3BK2 A;  4FAD A;  2KFK A;  4JQW C;  3N20 C;  2N1V A;  4PYZ A;  3N32 A;  4BAX A;  1TIF A;  4XYC A;  4NAW B;  4AUQ C;  1V2Y A;  3X23 A;  2WXJ A;  2BB6 A;  2NR2 A;  1ZW7 A;  1L4D B;  3DBH I;  1L6V A;  3EGR A;  3V61 A;  3ZVV A;  3MC9 A;  2O2V B;  3NS8 A;  3PTF C;  2K1F A;  1TYG B;  3N1Y C;  4HK2 A;  2MX2 A;  4W9H A;  3OG5 A;  1HA5 A;  3DQV A;  3KUD B;  2EMT A;  3CWI A;  4KGS A;  1V1O A;  1RWS A;  4IUM B;  1TKY A;  1ENF A;  3N1X C;  4FXC A;  2BS3 B;  2I38 A;  4QAY A;  4WAF A;  4G0N B;  1E7U A;  3GOE A;  3TEX A;  4E71 A;  2LHD A;  2NTS A;  1Y8R C;  3VAW A;  3NJT A;  1ZDV A;  1OFF A;  4A8X C;  2FUG 1;  4YSZ B;  2KHW B;  5EE3 A;  2KJR A;  1WF9 A;  4ICV A;  1TTN A;  1UWM A;  5J17 A;  3IHP C;  3RCZ A;  2JQR B;  1XQQ A;  3ZNI D;  3VDZ A;  4IKG A;  2VZK B;  4WWO A;  1V80 A;  1NYR A;  2KXJ A;  3EFU A;  1N5X A;  2CU1 A;  3U4E G;  3LYY A;  1WRI A;  1V6E A;  1FXI A;  3WAO A;  3NVZ A;  2ZCC A;  2I1K A;  2W9N A;  3N3K B;  5HI1 A;  2L05 A;  4HRS A;  2KWV B;  3LXF A;  4KKI A;  4B9K A;  2BW2 A;  4YSX B;  4UDU C;  2RDH A;  3BIN A;  3ALB A;  2MHJ A;  2QMT A;  1N6Z A;  2N7E A;  3HRD D;  3HM3 A;  4ZYN A;  3DBR B;  3ZNG C;  3Q8E A;  4ZOH C;  4IM0 A;  2JZZ A;  4A9A A;  5CX3 A;  3PLU A;  4TKN A;  3DBH B;  4ZDV A;  4JIO U;  1E9M A;  2HTH A;  1UF0 A;  3TCA A;  4YSY B;  4FN2 A;  2KQS A;  3H7S A;  4XWW A;  1YQ4 B;  1WGK A;  3ZUN A;  3WAN A;  1C76 A;  3W1S A;  4M8M A;  2LUM A;  2N9L A;  2RGF A;  1I4X A;  2WLB A;  4ANX A;  1L7Y A;  3HHM A;  5DPR A;  3DHG C;  2NBV B;  3VVW B;  1Z2M A;  3RUL A;  4ZRJ A;  1UBQ A;  3VTV A;  2NBW B;  2XEW A;  2I2Y A;  2KJ6 A;  2PVO D;  1V8C A;  2EEL A;  1VCB A;  3OAW A;  5L95 C;  2M0X A;  1UD7 A;  3Q8C A;  2K22 A;  2ZZP B;  3BWU D;  3RN9 C;  1CZP A;  1I4P A;  2PMV A;  2FE8 A;  3AN1 A;  4IM3 A;  2DBY A;  2WYQ A;  2X38 A;  5G55 A;  1T0S C;  4W9E A;  3P4Q B;  4MEM A;  2IO0 B;  1V49 A;  2WXP A;  4NJ7 A;  4KIK A;  4HEA 1;  4C4V A;  1HXY D;  1UGM A;  3ZGZ A;  2SEB D;  2OHF A;  4S0R A;  5JZE B;  3H1U A;  5EE0 A;  2N9K A;  2GBM A;  3S2A A;  1JW9 D;  1QKZ A;  2WXN A;  2REX A;  2CJO A;  4NPN A;  2J0M A;  1AAR A;  1J7A A;  3PRM B;  3RT3 B;  1T5X D;  4P6V F;  3UIO B;  4N59 A;  1KTK A;  4GU2 A;  1NDD A;  3PV1 A;  1JRU A;  1ESF A;  1AYF A;  3HUI A;  2K0P A;  3KYD D;  1AW7 A;  3C19 A;  1RYJ A;  4A55 A;  1VDV A;  3MTN B;  3NHE B;  2N1W A;  3FIL A;  2BT6 A;  1ZDX A;  2H88 B;  1QT9 A;  3RNC C;  1UNS A;  2CHX A;  1A70 A;  3AU4 A;  2WXL A;  1E6E B;  3RYT A;  1VD2 A;  2L00 B;  4L1B A;  3UF8 A;  2IGG A;  2JVC A;  2IO3 B;  3UIN B;  4D2K A;  3DWM A;  4YL8 A;  1NYQ A;  4WJQ A;  1WMH A;  4LCD E;  5BYS A;  3JSV A;  3RUI B;  1YNT E;  2MQJ A;  4ZRP A;  1J8C A;  1GG3 A;  3L0W B;  2MP2 A;  1ZXI A;  3ZXR A;  1PGA A;  2MJE A;  1F77 A;  1WIA A;  1I7H A;  4PS3 A;  1D5Z C;  2KLC A;  3RFZ B;  2IND C;  1STE A;  3EEC A;  3L13 A;  1R4M I;  2KDM A;  3KWL A;  1CQV A;  1ZPS A;  1JWA D;  4JX1 C;  2WGS A;  3IG3 A;  1TY2 A;  2IPK D;  3QCA A;  2DHZ A;  3VH4 B;  3Q14 C;  1X1M A;  5E6P A;  4OW0 A;  5G5H A;  2AQ1 B;  2KAC A;  4PS8 A;  3NZU A;  1OTR B;  4WAA A;  1L2N A;  2ZJD A;  1UEL A;  1EWY C;  1EO6 A;  3JYU A;  4CQN A;  2RSU A;  1FNW A;  4XE0 A;  2FIF A;  1I4Q A;  2IYD B;  2K8C A;  2AQ3 B;  2LXC A;  4URK A;  2JYT A;  1WXS A;  1K52 A;  2PJH A;  4OVV A;  2RDG A;  1FRD A;  1UZX B;  2CHW A;  3Q8B A;  4KV2 A;  4N9F 4;  4W9L A;  3HM6 X;  2L0T A;  2OJR A;  4BBN F;  4BKT A;  4EOY A;  2IBI B;  2W55 A;  2WDV B;  1FD6 A;  1S1Q B;  2FCM A;  4YTP B;  2J7Q B;  1QOB A;  1VZ7 A;  4ZHO A;  1F1H A;  4B0M A;  2DZI A;  2J0K A;  2MBQ A;  2HE7 A;  2JSV X;  1TZO A;  5FKA C;  2K6Q A;  1GNU A;  1N63 A;  4TUU A;  2VZK D;  4M0W B;  5D6J B;  2L32 A;  3NS1 A;  4XC2 A;  3QC8 B;  1EF1 A;  4W9C A;  3KYC D;  1QOF A;  1BXT A;  4C80 A;  1MG8 A;  3E56 A;  2BKF A;  3EFC A;  4NAW A;  2LEK A;  1WXQ A;  2DYB A;  1E5W A;  1WYW B;  4B0E A;  3VUY A;  4HPM B;  4GLS C;  5JH5 C;  1R4M B;  1IGD A;  4NQK E;  3K9P B;  1FRR A;  2RDB C;  1VJK A;  3LJ3 A;  1C78 A;  4KSL C;  2O2V A;  1C77 A;  1SIF A;  3BVZ A;  3DDC B;  4BKG A;  3QQ8 B;  4ACF A;  3FAH A;  5BMI A;  2BYE A;  2O6V B;  2BB5 A;  3C8Y A;  3ETR A;  2OED A;  1SJH D;  3WAM A;  2KK8 A;  3ZTC A;  4EUT A;  2L3Z A;  3QIJ A;  1B1Z A;  1L0V B;  5KHO A;  3NZ3 A;  2ZEQ A;  2MEK A;  1L0X B;  2I1J A;  2IGH A;  3A33 B;  3N30 A;  2Y5P A;  2INN E;  2WXM A;  2FBW B;  4MAC A;  2WNM A;  3EUB 2;  2K39 A;  1Z5S B;  1WWT A;  2QDF A;  3VR8 B;  4CO7 A;  2GRI A;  5D3D A;  3CST A;  3T3O A;  3AE5 B;  3A1Q B;  4KGT A;  3VUX A;  4HLE A;  2LUE A;  4GDL B;  3ZJT A;  1WGD A;  2JPH A;  1V9J A;  1SEB D;  1ZKH A;  2N7D A;  2MWS B;  4M00 A;  2C7H A;  3SHQ A;  2KJH B;  1KRH A;  2BYT A;  3HVZ A;  1HTO A;  3P4P B;  4JPS A;  3APF A;  2BF8 B;  4W9D A;  1T0Y A;  1EF5 A;  5FK9 C;  4JWS C;  1XLQ A;  3QK0 A;  3VHT C;  4WWN A;  3GB1 A;  2L1A A;  2LD9 A;  4GXB A;  4OZC A;  3TBL D;  1C4P A;  3PZ8 A;  4KSK C;  3EA6 A;  2V3S A;  1SGH A;  2JXT A;  1RFK A;  3HIZ A;  5EE1 A;  3AMZ A;  1F52 A;  3A4R A;  2YEP F;  1ZUD 2;  3QA8 A;  4XWT A;  3ZJU A;  1HTQ A;  1YOV B;  2UWQ A;  4HCP B;  4AS1 A;  1P3Q U;  2QSD A;  1K51 A;  5DCN A;  1L6U A;  1V81 A;  3BVG A;  1JWU D;  1WX8 A;  2GOW A;  2WXI A;  2W3S A;  1FNU A;  3OJ4 B;  1WXA A;  3BYY B;  3PZD A;  2PIA A;  4F1S A;  2K8H A;  3U7D A;  4E3C A;  1NEK B;  2J42 A;  4DHZ B;  3R2I A;  3R2T A;  2V4L A;  5FR6 A;  4CHK A;  3P42 A;  2GBK A;  4RH6 A;  3M63 B;  4CYE A;  3MJW A;  5J2R A;  1N61 A;  2X8X X;  1U4A A;  3I3T B;  3A9J B;  2WXG A;  1V1P B;  3ZNH B;  1TKG A;  4DK5 A;  4FHK A;  2JX5 A;  4MDK E;  2WXK A;  2N7J A;  4XGA B;  3TMP B;  3RNB C;  1WJ6 A;  2JWZ A;  3NG0 A;  1F9J A;  3KH0 A;  1IBX A;  4X57 B;  1WJN A;  1TT5 B;  2BTE A;  3Q6B A;  1FO4 A;  4L2Y A;  3KW5 B;  1SSN A;  3RPF C;  2MBO A;  4K3B A;  2TSS A;  2Z0D B;  4W9K A;  4BKS D;  2KMC A;  1JRP A;  4LLG M;  3AXC A;  4P1C C;  5D2M B;  5JXV A;  2DWQ A;  2ZPN A;  2QIL A;  3AE4 B;  1Q5W B;  2CU3 A;  4ANV A;  3WCQ A;  1JML A;  4RGN A;  4RGT A;  4PK1 A;  3I63 C;  1H8C A;  1XCT L;  1XXG A;  1Q10 A;  3KUZ A;  3H9D A;  1WGY A;  3RZF A;  3OJ3 A;  4FLH A;  2C7M B;  2XK5 B;  2KN5 A;  2UU7 A;  2KLG A;  5HKH A;  1EU3 A;  2KZR A;  1F2R C;  2RPQ A;  1G6J A;  1N5W A;  1ZP0 B;  3DPD A;  4IM2 A;  4C7Z A;  2GBN A;  1S3S G;  2PLP A;  2JXX A;  4BVU C;  2Z8L A;  4GB9 A;  1NBF C;  2MRP A;  1GC6 A;  3AEA B;  2E3T A;  1PGX A;  4DQO C;  1P98 A;  2KWU B;  4AP4 C;  1C9F A;  3IFW B;  2KDF B;  3BII D;  1ZGU B;  3UI3 A;  4GIV A;  4FA6 A;  1RAX A;  3PT2 B;  2AQ2 B;  2K6D B;  1FNV A;  2K3U A;  4BKS A;  4EZK A;  2J4X A;  1PDX A;  5C23 A;  2J0J A;  2FNJ B;  1E7V A;  4WJN A;  2WU5 B;  4DHJ B;  4EZJ A;  1FFU A;  3UQB A;  4YWG G;  2WHI A;  1R4N I;  5D94 A;  3TJP A;  3VXW A;  2IY0 B;  3T8M A;  2D3A A;  3CSF A;  3R66 C;  5CHW A;  2KTR B;  3QX1 A;  2BBC A;  1UH6 A;  4L23 A;  3N9Y C;  1FXA A;  1OQR A;  4ZRK A;  3H7P B;  3AM9 A;  4GN1 A;  3AE1 B;  2ZNV B;  3NRZ A;  1WGR A;  2G4S A;  2M1M A;  3J9C A;  3V62 A;  1HEZ E;  2W82 A;  2O6V D;  2DZK A;  2HJ1 A;  2GLS A;  3APC A;  2G45 B;  2LVP A;  3Q3J A;  1KLV A;  3MHS D;  3ZDM C;  4II2 B;  1N62 A;  2NTT A;  4HDO A;  3CIR B;  4TSS A;  5LXH A;  2KKC A;  4DDI D;  1TS2 A;  2ACZ B;  1NVI D;  1YX6 B;  2HD5 B;  4HWI B;  1KJT A;  1VLB A;  4WH4 A;  2DYM A;  2WXH A;  5E6N A;  5HG2 A;  2RMM A;  1TS5 A;  2BGF A;  1E90 A;  4HPL B;  1GAQ B;  4M0W A;  5BMG A;  1LM8 B;  3BVM A;  3AE8 B;  1BT0 A;  2LGI A;  2MW5 A;  1M94 A;  1WJU A;  4BFR A;  4E74 A;  1XT9 B;  3AE6 B;  4LNF A;  4DBG A;  1WH3 A;  2HTM E;  1YIW A;  2G9H D;  2ZPY A;  4YTN B;  2Y5B B;  2WP9 B;  3ZTD A;  4G11 A;  1J7C A;  4K7W A;  2XN9 C;  2LMC A;  2W54 A;  4LJO B;  3QHT A;  3Q69 A;  5H92 C;  2MBH A;  4ZYS A;  1ET6 A;  4W9J A;  4US9 A;  4R3D A;  1WR6 E;  4LDT B;  1P7E A;  1XEE A;  1R4N B;  3ZLZ A;  5D7G A;  3WA0 A;  2N9P C;  2O6V A;  3NVY A;  4O1N A;  2EKE C;  1WSP A;  4BOS C;  1YJI A;  2JY6 A;  1DOX A;  3ML8 A;  4OZA A;  4J6I A;  2K8B A;  4MSM B;  2FAZ A;  4ZRQ A;  5IKC M;  2CR5 A;  3AU5 A;  3PLV A;  1V5T A;  3L16 A;  5H8Y E;  1BUI C;  4MM3 B;  2FID A;  2D10 A;  2LI5 A;  3AED B;  2ONQ A;  4AQ7 A;  4IC7 B;  4GDK A;  3NZS A;  5JHB A;  2G4D B;  1T6B X;  2JYE A;  2BS2 B;  1GUA B;  3VQI A;  2UYZ B;  1YX5 B;  3A1Q A;  4AJW A;  1LGR A;  2K25 A;  3WAP A;  1JWM D;  3GZN I;  1WGH A;  4GDL A;  4J3O D;  3VH3 B;  1TY0 A;  2PEA A;  2KVR A;  4EE2 A;  3CF6 E;  2LRW A;  5C3J B;  3U7Z A;  3TEY A;  1ISN A;  4KZ0 A;  2KTF A;  4LNK A;  4MJS A;  3B1L X;  1WXV A;  4LJP B;  1TGZ B;  2HJ8 A;  3Q3F A;  4ANU A;  2KQ4 X;  2LGD A;  1KFY B;  3PRP B;  3NUH B;  2QC8 A;  5LXI B;  4MGY E;  4OVU A;  3SFD B;  2KWD A;  2L8J A;  4US8 A;  3MJ5 A;  2VH2 A;  3NOB A;  3JW0 X;  1KLG D;  4A3O A;  4II3 B;  2PTL A;  4KVG B;  3MC0 B;  3D32 A;  1UWX A;  1RRB A;  3VRA B;  3PZ7 A;  5GMV A;  2R2O A;  2GBR A;  2N9E B;  2WWZ A;  1ZOY B;  4KDI C;  1P9D U;  4HCN B;  1TJE A;  2MJD A;  2LJI A;  2OJW A;  4RGO S;  3SEB A;  3DVG Y;  1AN8 A;  4IWP A;  3KUC B;  3Q3O C;  2BS4 B;  2NS5 A;  1D5M C;  1NI2 A;  1L4Z B;  3NVW A;  2L7R A;  1E0Z A;  3PRZ A;  5AZG A;  3TSS A;  3GS2 A;  2RD0 A;  5AZH A;  3UQA A;  4RFB A;  4C4V B;  3DBL I;  2AL6 A;  2LVQ A;  2JF5 A;  1F0Z A;  1HZ5 A;  4RM9 A;  3Q2A C;  5C1Z A;  4FHJ A;  2DYO A;  3DHH C;  3A9J A;  1Y56 A;  4AWJ A;  3URY A;  1D3Z A;  4W9I A;  2HDE A;  2ZCB A;  4JGH B;  2KYW A;  1N60 A;  2N4F A;  3PS6 A;  4MH0 E;  2LRU A;  1YMH E;  4DXF A;  1HZ6 A;  3T3N A;  4OVZ A;  1WZ3 A;  4RF0 A;  4HVB A;  4B6W A;  2XNA C;  1RFA A;  2WU2 B;  3I57 A;  2JRI B;  1E8X A;  4F8C B;  2MA9 B;  3MHZ A;  4PS7 A;  2CHZ A;  2N0S B;  3RI7 C;  1MJD A;  3K9O B;  3KLS X;  3M95 A;  4USA A;  3ML9 A;  3AEE B;  4H2A A;  2DLB A;  2XBB C;  1LO5 D;  3QAQ A;  3TEZ A;  3W5U B;  3L10 B;  4M8N A;  1M4V A;  2IZV B;  1T3Q A;  1DOY A;  3IT6 B;  4TQ1 A;  4NAM A;  4HKZ E;  2KAN A;  4I6N B;  1MFW A;  4PT5 A;  3AE3 B;  2JWU A;  2M19 A;  2A4Z A;  1YJ1 A;  4MT5 A;  1ZE3 D;  4AOF A;  2MLB A;  2DAF A;  2MP2 B;  1I4R A;  3A9K B;  1RM6 C;  4JE3 B;  1LFD A;  5IP4 D;  4IOI E;  4MGI E;  2OOB B;  3IAM 1;  5CHF A;  1FPY A;  2LAS A;  1WE7 A;  1WI0 A;  3ZW3 A;  1C3T A;  1XO3 A;  1UGJ A;  4A3P A;  4OZB A;  3AI5 A;  1QOA A;  1VR9 A;  4LNN A;  3ZYY X;  1T0Q C;  3RNG C;  3DBL B;  2KDB A;  1H4R A;  1GJZ A;  2IDY A;  1AWD A;  5E6O A;  4BOZ B;  1VZ6 A;  3B9J A;  3TL5 A;  2M56 B;  4KGR A;  4LNI A;  3AV8 A;  3SR6 A;  2KDI A;  3FKY A;  3PVL A;  5AUI A;  1MI0 A;  1VZ8 A;  2B3A A;  2FCQ A;  4FJY A;  4RMA A;  2M8S A;  1IUE A;  1XF5 L;  1EWC A;  5IOI A;  4WIP A;  4ICU A;  1GOZ A;  3TUO A;  2KTR A;  3PSE B;  4HRO A;  4HJG E;  2AL3 A;  2C9W B;  1CK1 A;  3IAS 1;  3H7P A;  1WM2 A;  3RNA C;  3SD5 A;  2DAJ A;  4LDT D;  2FUH B;  5HFY A;  4YTM B;  4HKQ A;  2BWE S;  1EUV B;  1FFV A;  3M3J A;  1OEY J;  3L4P A;  5BYR A;  1EM7 A;  3ENE A;  3PHW B;  1WZ0 A;  3OLM D;  3V05 A;  4HPP A;  3PPA A;  4REZ A;  1KH0 A;  3L17 A;  1TS4 A;  3ABV B;  3W2D A;  2KC1 A;  3X0W A;  2WQY B;  3SU8 X;  3ZO5 B;  1XCQ L;  3VTU A;  2ICI A;  2IO1 B;  4A20 A;  2JZP A;  3H6N A;  3DBR I;  5C2T B;  2RR9 A;  3DVG X;  1C1Y B;  1WM3 A;  1XLN A;  5AEK B;  5TSS A;  4K3C A;  4JWU C;  1WY8 A;  2V0G A;  1IP9 A;  1BML C;  3EC8 A;  3L08 A;  2INC C;  3ZDT A;  4BZA A;  3BK1 A;  5IAA C;  2SAK A;  2JRH A;  1FIQ A;  4M01 A;  5MPO A;  1PUT A;  2LVO A;  2IGD A;  1C4A A;  1YN4 A;  2WDQ B;  3LDZ E;  3ZXV A;  2ZW1 A;  1TBE A;  4ANW A;  1NEN B;  2DEN B;  1SXT A;  3AE2 B;  3CMM B;  2DNF A;  3RNF C;  5DPW A;  2K5P A;  1PGB A;  4WWP A;  4KDL B;  2J52 A;  4IWO A;  4ARC A;  2FCS A;  2L0F A;  3MC8 A;  5BYQ A;  4OHJ A;  4A6Q A;  4W9F A;  3W5V B;  1K50 A;  4WJO A;  1PYW D;  2Y5C A;  1OGW A;  2CKH B;  2JZ3 B;  2V3N A;  2WXF A;  4RM8 A;  3GE3 C;  2WX0 A;  3AEF B;  2LHE A;  4KX6 B;  1SJE D;  1NI3 A;  2FCN A;  4K7S A;  2BYV E;  1VRA B;  1YQB A;  1SE4 A;  3C0R B;  4G3X B;  4MM3 A;  1KOT A;  2KMA A;  4DXG A;  1QF6 A;  2EKI A;  4XZ4 A;  4WQO B;  2Q5W D;  2BVC A;  4C7Y A;  1WJ4 A;  3LB8 C;  1JAL A;  2WDR B;  3GP7 A;  3R8B A;  4TMA B;  2NPT B;  2KAJ A;  1OQY A;  3P2B A;  1GB4 A;  4XDC A;  2KWC A;  1UBI A;  5E6J A;  2G1E A;  2KD0 A;  2MSE D;  3VTW A;  3I5J C;  3I9V 1;  1SE2 A;  1P1A A;  4K81 A;  3TIX A;  5T8I A;  2D3C A;  5BO4 B;  4MEL A;  2LZ6 A;  1XLP A;  3H8H A;  5CHV C;  4PYU A;  2IY1 B;  2D3G A;  2IJ0 A;  4C00 A;  3IT4 B;  1OEY A;  1QZE A;  2ZW0 A;  3QAR A;  2V4I B;  4RNA A;  3ONS A;  2PVG C;  1MPE A;  1E10 A;  2PE9 A;  1ACC A;  3UIP B;  1SF0 A;  4RGM A;  3R7Q A;  5LLI A;  3Q3M C;  3L54 A;  4TV3 A;  1YN5 A;  1A5R A;  3HVD A;  2CS4 A;  3AEG B;  3U2S C;  1R7S A;  2RPV A;  4P16 A;  2GB1 A;  4A90 A;  1XLO A;  3P4R B;  4S17 A;  2KFK B;  2KC2 A;  1I4H A;  3WIM A;  5AZF A;  2EMS A;  3ZNZ B;  1V5O A;  4K7U A;  4BBN C;  2LGY A;  1L5P A;  3FC4 A;  4HJK A;  2YEP B;  1PQS A;  2V3P A;  3VUW A;  5FR3 A;  4I6L B;  3DHI C;  3IBE A;  3DVN U;  4P7I A;  2MH7 A;  1LXD A;  1WFY A;  4I6P A;  4MGZ E;  4XDD A;  3JVZ X;  1DOI A;  2KDE B;  1JRO A;  1JWB D;  3AE7 B;  3VR9 B;  3ZRF A;  1IBX B;  1SIJ A;  3DVN V;  3AUL A;  1I4G A;  3ZJV A;  1DYQ A;  1IYF A;  1FMA D;  1Q0W B;  4LK0 M;  2A5U A;  2MCN B;  2M4N A;  3V60 A;  4WQM A;  4EEW A;  4EZL A;  3SDL C;  2DZJ A;  4FUL A;  3R3M A;  3IXS A;  2D3B A;  5BMH A;  1XD3 B;  3PGE A;  1KM7 A;  4DWF A;  2BPS A;  1FM0 D;  3W9C B;  3Q8A A;  2PW9 A;  4TQ0 A;  1L0Y B;  2KX3 A;  3ZKJ C;  3VFK A;  2KO3 A;  2BYF A;  2WXR A;  2AYO B;  1JWS D;  1JQ4 A;  4ARI A;  1YN3 A;  4GOC A;  1WRD B;  4WWM A;  1Q1O A;  4NJC A;  4AJY B;  2WXQ A;  2CJN A;  2H89 B;  2YVC A;  4M02 A;  3RZW C;  1I35 A;  4RCO A;  3O13 A;  2L83 A;  4K1R B;  4N6E B;  2AWT A;  2QEJ C;  1I42 A;  2GMI C;  2BQQ A;  5KHQ A;  3ECI A;  3IVF A;  2IO2 B;  1UUP A;  1OQQ A;  3A9K A;  3DWG C;  4FJZ A;  5AUK A;  4HDQ A;  5D3I B;  3AEB B;  1WE6 A;  3AB5 A;  3BY4 B;  2BWF A;  2NMQ A;  2PE6 B;  4JL9 A;  2PPH A;  3BYT B;  3VRB B;  5L83 A;  1C79 A;  5CTR C;  1V97 A;  1RLF A;  3B2G A;  2L76 A;  4DDG D;  2ZVN A;  1MVK A;  3U52 E;  4GMV A;  5IA7 A;  4YT0 B;  1KLU D;  2C5L C;  2C7N B;  4WUR A;  3B08 A;  2BKR B;  1IPG A;  1FCL A;  3P4S B;  3E9S A;  2KT7 A;  2KNB A;  2ZNV C;  2KN4 A;  2LGX A;  3AH7 A;  5DPT A;  2M17 A;  2KQ7 A;  3B0A A;  1WYG A;  5GXG B;  2KX0 A;  3MP9 A;  4GGQ A;  1GPX A;  2KOX A;  4ZHP A;  2DZM A;  3DOW A;  1YQ3 B;  1CMX B;  3MFG A;  4JLC A;  1LQB A;  4IW0 A;  4FJV B;  3AE9 B;  2J53 A;  3HK0 A;  5IN7 A;  1GB1 A;  2C60 A;  1YD8 U;  2Z0E B;  3Q8F A; 
#chains in the Genus database with same CATH homology
 2KLG A;  5HKH A;  1GJZ A;  5E6O A;  2KZR A;  4BOZ B;  2REX A;  2RPQ A;  2AEH A;  3TL5 A;  1G6J A;  4NPN A;  2J0M A;  1AAR A;  3PRM B;  3RT3 B;  3DPD A;  3UIO B;  4IM2 A;  4B95 A;  3A4S C;  2GBN A;  4GU2 A;  1S3S G;  1E8Y A;  1NDD A;  2JXX A;  4HXD A;  2KDI A;  4BVU C;  3PV1 A;  1JRU A;  4GB9 A;  3PVL A;  1NBF C;  5G2N A;  2B3A A;  4KIK B;  2FCQ A;  2MRP A;  1GC6 A;  4FJY A;  3KYD D;  4RMA A;  2M8S A;  3DBS A;  3APD A;  3MTN B;  3NHE B;  2JT4 B;  2N1W A;  1P98 A;  4ICU A;  2KWU B;  4AP4 C;  1WX7 A;  2KTR A;  3IFW B;  2D11 A;  3PSE B;  2KDF B;  2AL3 A;  2C9W B;  1ZGU B;  1WX9 A;  2G3Q B;  4EKU A;  2CHX A;  5EDS A;  3AU4 A;  3H7P A;  4GIV A;  1WM2 A;  4F7Z A;  2DX5 B;  3RYT A;  2DAJ A;  4LDT D;  1VD2 A;  2L00 B;  3SD5 A;  1RAX A;  4FA6 A;  2FUH B;  3PT2 B;  3UF8 A;  2K6D B;  2QHO A;  2JVC A;  2IO3 B;  3UIN B;  2BWE S;  4ZRI A;  1EUV B;  3M3J A;  4NJ6 A;  1OEY J;  4YL8 A;  3QWZ B;  1V86 A;  4WJQ A;  4XX5 A;  1WMH A;  4BKS A;  4EZK A;  4LCD E;  4KZC A;  5C23 A;  2LXA A;  2J0J A;  2FNJ B;  2NCN A;  1WR1 A;  3ENE A;  1E7V A;  4WJN A;  3PHW B;  3JSV A;  1WZ0 A;  3RUI B;  2YLM A;  4DHJ B;  3OLM D;  2MQJ A;  4NNJ B;  4EZJ A;  3UQB A;  1J8C A;  1GG3 A;  2GBJ A;  3L0W B;  1R4N I;  3PPA A;  5D94 A;  2MP2 A;  3TJP A;  4DHJ D;  3VXW A;  2IY0 B;  3T8M A;  3L17 A;  3CSF A;  1WIA A;  3R66 C;  5CHW A;  2KTR B;  2NBU A;  2KC1 A;  3QX1 A;  3X0W A;  2VRR B;  3ZIM A;  2KFJ A;  4PS3 A;  3SU8 X;  3ZO5 B;  3VTU A;  1UH6 A;  2KLC A;  2D07 B;  2LJ5 A;  4G50 A;  4ZRK A;  3H7P B;  4DXA B;  2IO1 B;  4A20 A;  4GN1 A;  3T9L A;  2ZNV B;  3H6N A;  1WGR A;  2G4S A;  1R4M I;  2M1M A;  3DBR I;  1SE9 A;  1TZ1 A;  3EEC A;  3L13 A;  3V62 A;  2O6V D;  2DZK A;  2RR9 A;  3DVG X;  1C1Y B;  3APC A;  1WM3 A;  2G45 B;  3IG3 A;  2LVP A;  5AEK B;  3Q3J A;  3QCA A;  1KLV A;  1WMH B;  3MHS D;  1WY8 A;  2DHZ A;  3VH4 B;  2XK5 A;  1J19 A;  3ZDM C;  1IP9 A;  4II2 B;  3O65 B;  3JSV B;  1X1M A;  3EC8 A;  3KVF B;  3L08 A;  5E6P A;  3EHV A;  3ZDT A;  4HDO A;  4PS8 A;  5IAA C;  5LXH A;  2JRH A;  2KKC A;  4DDI D;  2D2Q A;  3NZU A;  3QJZ A;  1K8R B;  3RD2 A;  1OTR B;  1P0R A;  4WAA A;  1L2N A;  2ZJD A;  2LVO A;  1UEL A;  2Z59 B;  1EO6 A;  3JYU A;  4GDK B;  1YX6 B;  2RSU A;  2HD5 B;  4HWI B;  2V1Y A;  1KJT A;  3LDZ E;  3V6E B;  2DYM A;  2MBB B;  5E6N A;  2FIF A;  4NQL B;  1TBE A;  2IYD B;  4ANW A;  2DEN B;  2BGF A;  2K8C A;  1E90 A;  2LXC A;  3CMM B;  4MSQ B;  4URK A;  2PJH A;  1WXS A;  4HPL B;  5DPW A;  2R2Q A;  4GSW A;  1LM8 B;  4OVV A;  4WWP A;  1BT0 A;  4KDL B;  4DHZ E;  2MW5 A;  1M94 A;  4IWO A;  1UZX B;  2FCS A;  2L0F A;  5JHA A;  2CHW A;  4KV2 A;  5DPS A;  1WJU A;  4IWQ A;  4BFR A;  4N9F 4;  4E74 A;  4EFO A;  1XT9 B;  4W9L A;  4W9F A;  3HM6 X;  4DBG A;  2L0T A;  2OJR A;  4WJO A;  1E8W A;  1WH3 A;  4BBN F;  3U8Z A;  4BKT A;  4EOY A;  2IBI B;  1YIW A;  1OGW A;  2CKH B;  2JZ3 B;  2NPT A;  1GC7 A;  4NY0 A;  1S1Q B;  3W1Y A;  2ZPY A;  2FCM A;  4RM8 A;  3UGB B;  4FBJ B;  3PHX B;  1WXM A;  2N9X A;  2WX0 A;  2Y5B B;  3DCG A;  2J7Q B;  3ZTD A;  4G11 A;  4WJP A;  3W1S C;  2WDT B;  4MJS B;  4K7W A;  2NVU I;  1E8Z A;  4MGK E;  2DZI A;  2J0K A;  3U30 A;  2MBQ A;  2HE7 A;  2FCN A;  4K7S A;  4LJO B;  2BYV E;  3QHT A;  2K6Q A;  1GNU A;  3PRE A;  5TR5 A;  2MBH A;  1YQB A;  3C0R B;  4G3X B;  4M0W B;  4MM3 A;  4TUU A;  1KOT A;  5D6J B;  2KMA A;  3NY5 A;  4W9J A;  4XZ4 A;  4WQO B;  4XC2 A;  3QC8 B;  1WR6 E;  4LDT B;  1J0G A;  1WJ4 A;  3ZLZ A;  1EF1 A;  4W9C A;  3KYC D;  5D7G A;  3WA0 A;  2N9P C;  2WX1 A;  4IG7 B;  2O6V A;  2JUO A;  3ZRC A;  2EKE C;  1MG8 A;  2NPT B;  2BKF A;  3WAL A;  2ASQ A;  4NAW A;  2MBE A;  2DYB A;  1OQY A;  1E5W A;  2ZVO A;  1WYW B;  3P2B A;  3VUY A;  4BOS C;  4HPM B;  1HE8 A;  2JY6 A;  3R7R A;  5JH5 C;  1FXT B;  3ML8 A;  4J6I A;  2K8B A;  4W9G A;  4NQK E;  3K9P B;  2KWC A;  2LWP A;  4MSM B;  1UBI A;  2FAZ A;  3M62 B;  2CR5 A;  1WGG A;  3V6C B;  3AU5 A;  3PLV A;  3LJ3 A;  1V5T A;  4KSL C;  2KD0 A;  2O2V A;  2MSE D;  5J18 A;  3L16 A;  3VTW A;  3TIX A;  1P1A A;  4K81 A;  5BO4 B;  2FID A;  4MEL A;  1SIF A;  4ASW C;  2D10 A;  2LI5 A;  3DDC B;  4BKG A;  3QQ8 B;  2LZ6 A;  4IC7 B;  4GDK A;  5CHV C;  2KFK A;  3NZS A;  4JQW C;  2IY1 B;  2D3G A;  4PYU A;  4FAD A;  2BYE A;  2N1V A;  2O6V B;  4PYZ A;  3N32 A;  1OEY A;  1QZE A;  3QAR A;  3ONS A;  5JHB A;  2G4D B;  4NAW B;  4AUQ C;  1V2Y A;  3X23 A;  1GUA B;  2PE9 A;  3VQI A;  3UIP B;  2UYZ B;  2NR2 A;  1ZW7 A;  1YX5 B;  3WAM A;  3R7Q A;  3A1Q A;  2KK8 A;  3DBH I;  5LLI A;  4AJW A;  2K25 A;  3WAP A;  3ZTC A;  4EUT A;  3GZN I;  2L3Z A;  3V61 A;  3ZVV A;  1WGH A;  4GDL A;  3L54 A;  4TV3 A;  3QIJ A;  3VH3 B;  1A5R A;  2PEA A;  2KVR A;  2O2V B;  3CF6 E;  5KHO A;  3NS8 A;  2CS4 A;  3PTF C;  2K1F A;  2LRW A;  2ZEQ A;  2I1J A;  4HK2 A;  2MX2 A;  4W9H A;  3A33 B;  3N30 A;  2KFK B;  1ISN A;  3DQV A;  2KC2 A;  2EMT A;  2KTF A;  3KUD B;  4KZ0 A;  4MJS A;  3WIM A;  5AZF A;  2EMS A;  4IUM B;  1V5O A;  3ZNZ B;  2K39 A;  4K7U A;  4BBN C;  1Z5S B;  3B1L X;  2LGY A;  4G0N B;  1E7U A;  1WXV A;  3GOE A;  4CO7 A;  4LJP B;  1TGZ B;  4E71 A;  2HJ8 A;  3Q3F A;  3CST A;  4ANU A;  4HJK A;  1PQS A;  1Y8R C;  3A1Q B;  3VUW A;  3VAW A;  4I6L B;  2LGD A;  3VUX A;  3IBE A;  3PRP B;  3DVN U;  4HLE A;  5LXI B;  2LUE A;  4GDL B;  4MGY E;  4OVU A;  1WGD A;  4P7I A;  2JPH A;  1V9J A;  1LXD A;  1WFY A;  1ZKH A;  2KHW B;  2L8J A;  2KJR A;  2MWS B;  2N7D A;  1WF9 A;  4I6P A;  4MGZ E;  3NOB A;  4ICV A;  3JW0 X;  3JVZ X;  1TTN A;  4A3O A;  2C7H A;  2KDE B;  4II3 B;  4KVG B;  5J17 A;  3IHP C;  3SHQ A;  3RCZ A;  2KJH B;  3D32 A;  1XQQ A;  3ZRF A;  1RRB A;  5GMV A;  2R2O A;  2GBR A;  2N9E B;  2WWZ A;  3DVN V;  3AUL A;  3APF A;  2BF8 B;  4W9D A;  3ZNI D;  4KDI C;  3VDZ A;  1IYF A;  1P9D U;  4HCN B;  1Q0W B;  1T0Y A;  4WWO A;  1V80 A;  2A5U A;  2MCN B;  2M4N A;  3V60 A;  1EF5 A;  2KXJ A;  3EFU A;  4EEW A;  4EZL A;  3DVG Y;  3SDL C;  2CU1 A;  2DZJ A;  3QK0 A;  4FUL A;  4IWP A;  3KUC B;  3R3M A;  2NS5 A;  3VHT C;  1NI2 A;  4WWN A;  1XD3 B;  1V6E A;  2L7R A;  3PGE A;  3WAO A;  2ZCC A;  3PRZ A;  1KM7 A;  2I1K A;  5AZG A;  2LD9 A;  4GXB A;  3TBL D;  4DWF A;  2W9N A;  2BPS A;  3N3K B;  4KSK C;  2L05 A;  2RD0 A;  5AZH A;  3UQA A;  2V3S A;  2KWV B;  1SGH A;  2KX3 A;  2AL6 A;  2LVQ A;  2JF5 A;  3DBL I;  3VFK A;  3ZKJ C;  4B9K A;  4TQ0 A;  2KO3 A;  4RM9 A;  2BYF A;  3BIN A;  2AYO B;  3ALB A;  5C1Z A;  3HIZ A;  2N7E A;  4FHJ A;  2DYO A;  3HM3 A;  4ZYN A;  3A4R A;  3ZNG C;  3QA8 A;  4IM0 A;  4GOC A;  2JZZ A;  3A9J A;  4AWJ A;  1WRD B;  1Q1O A;  5CX3 A;  1D3Z A;  4AJY B;  3PLU A;  2UWQ A;  4HCP B;  4W9I A;  2ZCB A;  1P3Q U;  4JGH B;  4TKN A;  5DCN A;  4ZDV A;  1V81 A;  2YVC A;  1I35 A;  3RZW C;  1WX8 A;  2GOW A;  4JIO U;  2N4F A;  4K1R B;  3OJ4 B;  1WXA A;  2AWT A;  3PS6 A;  3PZD A;  2HTH A;  4MH0 E;  3TCA A;  2LRU A;  4F1S A;  2K8H A;  1I42 A;  4FN2 A;  2GMI C;  5KHQ A;  2KQS A;  3U7D A;  3ECI A;  4E3C A;  3H7S A;  3IVF A;  1WZ3 A;  4DHZ B;  2IO2 B;  4HVB A;  4B6W A;  3ZUN A;  3A9K A;  1RFA A;  2V4L A;  5FR6 A;  4CHK A;  3WAN A;  2JRI B;  2GBK A;  1E8X A;  3W1S A;  4F8C B;  4FJZ A;  4M8M A;  3M63 B;  4CYE A;  3MJW A;  2RGF A;  4HDQ A;  5J2R A;  2MA9 B;  4PS7 A;  2CHZ A;  1L7Y A;  3HHM A;  1WE6 A;  4ANX A;  1U4A A;  3BY4 B;  3I3T B;  5DPR A;  3A9J B;  2BWF A;  2PE6 B;  4JL9 A;  2PPH A;  3K9O B;  3ZNH B;  3M95 A;  5L83 A;  2NBV B;  3VVW B;  3ML9 A;  1Z2M A;  4DK5 A;  4FHK A;  3RUL A;  4ZRJ A;  1UBQ A;  2XBB C;  3VTV A;  2NBW B;  2XEW A;  2KJ6 A;  4MDK E;  5CTR C;  3TMP B;  1VCB A;  1RLF A;  3QAQ A;  1WJ6 A;  3OAW A;  2JWZ A;  5L95 C;  2L76 A;  3L10 B;  2M0X A;  1F9J A;  1UD7 A;  2ZVN A;  3KH0 A;  4M8N A;  4DDG D;  4GMV A;  1WJN A;  2IZV B;  4X57 B;  5IA7 A;  2ZZP B;  3KW5 B;  4TQ1 A;  2KAN A;  4I6N B;  2MBO A;  2Z0D B;  2C5L C;  4IM3 A;  2C7N B;  4W9K A;  4BKS D;  2WYQ A;  3B08 A;  2A4Z A;  2KMC A;  2BKR B;  1IPG A;  1YJ1 A;  4AOF A;  2MLB A;  5G55 A;  2DAF A;  2MP2 B;  3A9K B;  3AXC A;  2KNB A;  4W9E A;  2ZNV C;  1LFD A;  2LGX A;  4MEM A;  5D2M B;  5DPT A;  2M17 A;  2ZPN A;  2KQ7 A;  3B0A A;  4MGI E;  2IO0 B;  1Q5W B;  2OOB B;  1V49 A;  2KX0 A;  5CHF A;  2LAS A;  4NJ7 A;  1WE7 A;  1WI0 A;  4KIK A;  4ANV A;  3ZW3 A;  1C3T A;  4GGQ A;  2KOX A;  2DZM A;  4A3P A;  1H8C A;  3AI5 A;  1UGM A;  3DOW A;  1CMX B;  4JLC A;  1LQB A;  4IW0 A;  5JZE B;  3H1U A;  3KUZ A;  3H9D A;  4FJV B;  1WGY A;  3RZF A;  2GBM A;  3HK0 A;  3OJ3 A;  4FLH A;  3S2A A;  2C60 A;  2C7M B;  2XK5 B;  2KN5 A;  1YD8 U;  2Z0E B;  2KDB A;  1H4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...