3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
3FC4A 3B2GA 5EE3A 3AE2B 2WU2B 3AMZA 3NRZA 2ACZB 4ITKA 3NVWA 1WWTA 1N5WA 1TKYA 1F0ZA 2CJNA 2G1EA 4US9A 2WDQB 1JRPA 1DOIA 3CWIA 1FFUA 5G5HA 1IUEA 3HVZA 2BS2B 2W3RA 3AE4B 1ZUD2 4P6VF 2PVGC 1XLPA 2EKIA 2W3SA 4ZHPA 2E3TA 3AN1A 2N0SB 1QOFA 2QJLA 3P4QB 1FRDA 1R7SA 2FBWB 4ZHOA 5C2TB 3AM9A 1KRHA 1ZOYB 1J7AA 3L4PA 3NS1A 1OFFA 4WQMA 1VJKA 5EE9A 4A9AA 1QT9A 4C7ZA 3SR6A 5EE1A 1CJEA 1FMAD 4N59A 1YQ4B 1KFYB 2K22A 1QOBA 4USAA 1GTHA 1FXIA 2MJDA 2H88B 3P63A 2KMMA 4YTPB 3CIRB 1T3QA 3B2FA 4JWUC 3AEGB 2PIAA 4YSZB 1TKGA 1UWMA 2BS4B 1QLBB 1N60A 1N62A 1VDVA 2MJ3A 1RM6C 4YXDB 2WP9B 3AE5B 1NVID 2OHFA 2HTME 2Y5CA 3HUIA 1B9RA 1QF6A 2WDRB 1RYJA 1CZPA 2WDVB 1EWYC 2CJOA 2L83A 4C7YA 1N63A 1ZP0B 3AEAB 2W55A 4JX1C 1SF0A 3HRDD 3PO0A 2KAJA 5AUKA 5H92C 3NVVA 2AX5A 1NI3A 2WQYB 1JALA 1I7HA 3AB5A 3VRAB 1NYQA 1L5PA 1OQQA 2Q5WD 1J7CA 1QOGA 5EE0A 3ZYYX 3AE9B 3AE8B 2BS3B 2K9XA 4HROA 5MPOA 3DWGC 1NYRA 1N61A 2H89B 1TJEA 1TKEA 2M19A 5AUIA 3W5UB 5GXGB 1DOYA 4YTMB 4YT0B 1L6VA 3ETRA 1XLNA 1XO3A 4C80A 4KX6B 1WYGA 1FRRA 1KF6B 3VR9B 1ROEA 3W5VB 1H7WA 3W9CB 1YJJA 3P4RB 1JWAD 1WGKA 4YTNB 4N6EB 1E7PB 3AE6B 3VRBB 1DGJA 1XLQA 3FAHA 4WWMA 3BIID 1RWSA 1PFDA 3LXFA 1FO4A 2M56B 2WS3B 3P4SB 3SFEB 1GPXA 1E10A 3SFDB 4IDIA 5C3JB 1JWBD 3NVYA 3AH7A 2MJEA 1E9MA 2B76B 1AWDA 1A70A 1FXAA 2WLBA 1E0ZA 1H7XA 2JX5A 2W54A 1QOAA 1GT8A 1L6UA 4YSXB 3AEDB 3AEEB 1VLBA 1WRIA 3ABVB 3CF4A 4YSYB 3VR8B 1PUTA 1FFVA 1E6EB 1XLOA 2QIEB 2WU5B 4FXCA 4LTUA 1SB3C 5G5GA 3AV8A 4US8A 1JQ4A 3AECB 1GAQB 3B9JA 1V8CA 4ZOHC 2PVOD 3RPFC 1L0VB 1AYFA 4JWSC 2K5PA 1FIQA 2DWQA 2PKOA 4N58A 2LEKA 1SIJA 1YQ3B 3P4PB 1N5XA 2DBYA 2L52A 3EUB2 2MH7A 5H8YE 2CU3A 1TYGB 1ZXIA 1GTEA 3KWLA 1JW9D 1V97A 1NENB 3AEFB 3AE7B 2JQRB 3NVZA 1J7BA 1OQRA 1PDXA 1RFKA 3LB8C 1WXQA 1YJIA 3AEBB 3DWMA 3WCQA 1DOXA 3AE3B 1FM0D 1JROA 3P1MA 3AE1B 1NEKB 2BT6A 4HRSA
chains in the Genus database with same CATH superfamily
3A1QB 4JIOU 1V49A 2N9XA 4S17A 3V60A 1YOVB 4P6VF 2WXRA 3QQ8B 3TJPA 2W3SA 2NR2A 4K7SA 2DLBA 2N9LA 1C77A 1FRDA 2FAZA 1WZ3A 3A9KB 4IOIE 1E8WA 2AQ3B 3QAQA 1ESFA 1YMHE 2FE8A 1UWMA 1N60A 4WJNA 3ZGZA 1QKZA 2GB1A 4ZYSA 3N3KB 1SEBD 2LXCA 3PLVA 3VQIA 5BMGA 5EE0A 1TBEA 2LWPA 3UI3A 3ZDTA 1C4PA 1NYRA 2M19A 3ECIA 4YT0B 3U7DA 1LO5D 2GLSA 3DVGY 4W9HA 4GDKB 2FIFA 1VR9A 1E8XA 4HJKA 3R3MA 3S2AA 2WS3B 2KTRB 3JVZX 3U2SC 1E5WA 1GPXA 3IFWB 5C3JB 3IBEA 4D2KA 2KN5A 3GE3C 3KYDD 4M8NA 2GBMA 1I42A 3RMKC 2E6XA 3Q3OC 4IM0A 4RM9A 5DPWA 4OZCA 4OVZA 2V4LA 1J19A 2D07B 3CF6E 4PT5A 2PPHA 4W9JA 3RT3B 2BBCA 4LNIA 4GMVA 4EE2A 2HTHA 1WXQA 1UBIA 1DOXA 3AE3B 3GZNI 4BBNC 2DNFA 4NJCA 5EE3A 2K8CA 4NNJB 1WWTA 3KYCD 3TSSA 2C5LC 2CJNA 2WDQB 1ET6A 1NDDA 3WALA 2R2QA 4PYZA 2ZVOA 2OJRA 3AN1A 4WWNA 4ICVA 2KANA 1L0XB 2MEKA 2MBOA 5E6OA 1CJEA 3HVDA 1TS4A 1V5OA 4BAXA 1QOBA 2LMCA 3GS2A 1J8CA 1WF9A 3B2FA 2QMTA 3AU4A 5CHFA 3AEGB 2PIAA 3FILB 4K3BA 4DHZB 2K6DB 2O6VB 4F7ZA 3R8BA 4BKTA 3ZYYX 2XK5A 4JLCA 4UDUC 1WX8A 2KX0A 3RCZA 3ETRA 4C80A 4W9LA 1PQSA 1E8YA 3TCAA 1NI2A 1PYWD 4P7IA 2BGFA 2KC2A 3U4EG 1DGJA 2TSSA 3PT2B 1BXTA 4TMAB 1AW7A 2M56B 2AEHA 2GMIC 2WXJA 3PRMB 4RF0A 1AARA 3ZXRA 1ET9A 2MJEA 1SE2A 3HM6X 1JCKB 3AEDB 3VUYA 2BQQA 3QWZB 5JXVA 1PGXA 1FFVA 5BYQA 4FXCA 2PVOD 2QHOA 5CX3A 1FIQA 5HI1A 2DBYA 4I6LB 2MBQA 2N4FA 1ZXIA 2I1JA 2WXMA 1JW9D 5DPRA 1WXSA 3HIZA 4P1CC 4ZYNA 1UBQA 4HRSA 1WRDB 2D3GA 1WZ0A 2PW9A 3NVWA 2MHJA 1JRPA 3VTUA 3KW5B 2YLMA 3KQ4A 2PVGC 4R3DA 1SSNA 5C2TB 3NS1A 4C7ZA 4HWIB 4XYCA 1YQ4B 1R4NB 4GIVA 2BPSA 4NAWB 3I57A 4GN1A 2V9HA 4GDLB 2N7EA 4MGKE 2J0MA 2OHFA 1F2RC 4BKSD 3DHIC 3AI5A 3R2IA 4F1SA 3NVVA 1AN8A 3A9JA 2WQYB 1I7HA 1VZ8A 2RD0A 2K1FA 4OHJA 2D10A 4AJWA 3PVLA 1WFYA 1HTOA 2ZNVC 2ZCBA 4J6IA 4M02A 2O2VA 2KC1A 1WYGA 3BVGA 4EZLA 1FEHA 1WXVA 1SJED 2INDC 5AZFA 3JSVB 4HKZE 1IBXB 1YJ1A 1WJUA 3V6EB 3ZO5B 4DXAB 3P4SB 5DPTA 2IJ0A 3JYUA 2KZRA 3QX1A 2K3UA 3A4SC 1F9JA 1V1OA 4IC7B 2KTRA 4WH4A 3AEEB 1K52A 1WRIA 2KKCA 4WIPA 2LVQA 3AV8A 1I4GA 1WX7A 3VHTC 3T8MA 3V62A 4L23A 4II2B 4WWPA 3ZNID 5AZGA 4L1BA 1BT0A 2I1KA 2LASA 2HDEA 2M17A 5G5HA 1ZKHA 4OVVA 3AU5A 2JU6X 1P3QU 4KKIA 2LUEA 3W2DA 4FHJA 3I5JC 2M1MA 3C19A 3RN9C 2PJHA 3L10B 3QIJA 4M0WA 2BF8B 3R2TA 2WDTB 3BK1A 3M95A 2L83A 1CZPA 2W55A 1UD7A 3TUOA 2J0JA 1JMLA 2L1AA 1L5PA 4AS1A 1T6BX 2IYDB 4AQ7A 4KV2A 3ZTCA 4DK5A 4OZBA 5AEKB 4P16A 5AUIA 2INNE 4MSQB 4YTMB 1CQVA 2ZNVB 2IO1B 4PYUA 2L00B 3MP9A 4XX5A 2D11A 1RAXA 1I4QA 1K51A 2KMCA 4LK0M 1GUAB 2KVZA 4NQLB 3ZIMA 1Q0WB 3NG0A 1M94A 2KD0A 3BZDB 1SE9A 1STEA 1WSPA 4EFOA 4YSYB 2KFKB 5IAAC 3EHVA 4US8A 5D94A 1JWMD 5IOIA 2JF5A 1V8CA 3RPFC 1AYFA 4RF1A 4IUMB 1TYGB 3I63C 3Q8BA 2JWUA 1I35A 1MVKA 1HZ6A 1OQRA 1XXGA 3H1UA 4K81A 4RGOS 2AL3A 4HDOA 2N9KA 3L16A 3MJWA 3TMPB 2KQ7A 4MH8A 1TKYA 2MBEA 3KUCB 1GB4A 4MM3B 2XN9C 3VH3B 1XLPA 3IAS1 3WAOA 2L0TA 3RNEC 2VH2A 3AM9A 2JY6A 1J7AA 2WXNA 1EF5A 2KLCA 1L4ZB 2MJDA 1E8ZA 4JE3B 3CIRB 1XEEA 2IDYA 3PLUA 4KDLB 3W1YA 3H7SA 3HM3A 3Q6BA 4LJOB 2DHZA 5AUKA 1SF0A 1GB1A 2KAJA 1SJHD 1F77A 2ZPYA 1JALA 3QC8B 2MW5A 3LJ3A 1SXTA 1E7VA 3AE8B 3RI7C 4EZKA 1MHHE 4WJQA 4REZA 5BO4B 3Q8FA 2BWFA 2YVCA 5D3DA 3KUDB 1H7WA 2N1WA 1YJJA 3MC9A 2JSVX 5G55A 1S3SG 1XLQA 1WMHB 1OEYA 2XBBC 3Q3FA 2LXAA 2KYWA 1WX9A 2NPTB 2GI9A 1IBXA 2D3AA 4MEMA 4BBNF 2NBVB 4IW0A 2Z0EB 2AQ1B 2HD5B 2ZW1A 5G5GA 2SAKA 4A90A 3U52E 2BB6A 1V9JA 3IXSA 3QA8A 4M01A 1H8CA 1GTEA 1HEZE 1C9FA 1FXTB 4G11A 2FCSA 3U30A 1YJIA 4O1NA 4KZ0A 4H2AA 3ZTDA 4EZJA 1C4CA 2MA9B 2WHIA 3APFA 1F0ZA 3BYYB 3CWIA 2W3RA 3APCA 3IVFA 2ZCCA 2E3TA 2W82A 1F1HA 3P4QB 3OWEB 1ZOYB 4BFRA 3ML8A 4A9AA 1TZOA 2IGHA 3Q14C 4IWOA 3H9DA 1K8RB 4M00A 4USAA 3PS6A 2WGSA 3DHHC 1SIFA 2IZVB 1SE3A 3T9LA 4S0RA 1C79A 2Y5CA 1VD2A 3WAMA 1ZP0B 5H92C 3PO0A 2K0PA 4CHKA 2Y5PA 1TY2A 1OQQA 2LGSA 2FCMA 2MQJA 4NAMA 4HROA 1I4XA 1TJEA 3VTWA 3FKYA 5GMVA 4IWPA 2V0GA 1XLNA 1FRRA 2CHXA 4MJSB 1JWAD 3BK2A 4C56C 5E6PA 2KJ6A 4MDKE 2NS5A 2ZZPB 3SHQA 4W9KA 3BVZA 4ZRIA 3NHEB 2CU1A 3SFDB 3ZVVA 1WXAA 1YN5A 3NZ3A 3T3OA 3UF8A 2Z59B 3HK0A 1WGRA 2G3QB 4K3CA 2KDMA 4JQWC 2MP2A 2JZPA 3AECB 1Z5SB 3Q3JA 4C4VA 4WJPA 3V05A 4EKUA 1LGRA 2KWVB 4NJ7A 4AJYB 5DCNA 1LXDA 2MLBA 1I4PA 2JYTA 1J7BA 1PDXA 3LB8C 4I6PA 3EGRA 2BTEA 2WU2B 4ITKA 2LD9A 2V1YA 2NBWB 1FFUA 4XWWA 1IUEA 1LFDA 1ZUD2 3R66C 1ZDVA 3PREA 5LNK1 3IG3A 1FD6A 2LHDA 2IO2B 2AYOB 3PZDA 5EE9A 3ZQ4A 4TKNA 3PTFC 1NBFC 1V2YA 3GB1A 4FJZA 4DDID 1T3QA 3EA6A 1V81A 3GE8C 1TKGA 2MJ3A 1D3ZA 1H4RA 3AE5B 3PZ7A 1EWYC 2CJOA 1L2NA 3ZRCA 2QC8A 3VUXA 5EDSA 2KOXA 1J7CA 2K9XA 3ZNZB 3W5UB 4FN2A 2C7MB 2G9HD 3DBRB 5JHAA 3O13A 4URKA 2GRIA 2MRPA 1VRAB 4YL8A 4GGQA 1P9DU 2UYZB 4W9FA 4ARCA 1H7XA 1WIAA 4DHJD 1WGHA 2EKEC 1P98A 2LRWA 2A5UA 2K39A 1HQRD 2N9EB 4TQ1A 2M0XA 2DWQA 1ZPSA 2CU3A 3OJ4B 3KWVA 4B0EA 3B08A 2IBIB 2DZMA 4WURA 3WCQA 1TS3A 1WJ4A 4KIKA 3EFCA 4RGTA 1N5WA 4WQOB 2G1EA 4US9A 2JPHA 4WAFA 2M4NA 1YX6B 3AE4B 1UWXA 1WXMA 1L4DB 1WJ6A 5D6JB 5J17A 1Y56A 3J9CA 2G4SA 1CK1A 3Q3NC 5EE1A 3W1SA 1OQYA 3MC0B 4LCDE 4ZRKA 1KFYB 4OZAA 2KTFA 4YTPB 1GOZA 2JZ3B 2BVCA 3RFZB 2WX1A 3HUIA 1V6EA 3CMMB 1RYJA 4JX1C 3N20C 5BYSA 1T0RC 3VDZA 1I4RA 1NI3A 5CHWA 3A1QA 4FA6A 2Q5WD 2QSDA 4KSKC 1EM7A 3DWGC 4XDDA 1RFAA 2ON8A 1QQRA 1XT9B 2WXIA 4KX6B 4LJPB 4RH6A 3W5VB 1WGYA 1V1PB 3RNCC 2NTSA 3WIMA 3P4RB 3A9KA 2BYVE 3DVGX 2G45B 2BWES 5LXIB 2KLGA 1PFDA 3RNFC 3PHWB 1IGDA 2DZIA 2M8SA 3OJ3A 4IDIA 4BKGA 2JVCA 4MJSA 2K6QA 3AH7A 1RRBA 3UQBA 4KVGB 4ZRQA 1VCBA 1D4BA 3K9PB 2WXQA 2FCQA 2GBJA 2BB5A 1SB3C 3ENEA 1YIWA 4N9F4 2R61A 3Q2AC 3V6CB 2MSED 2ONQA 1N5XA 4GDKA 2BYTA 1WI0A 1Z2MA 1V97A 4XGAB 1NENB 5LLIA 1C4AA 2KXJA 4AWJA 1FM0D 3TEYA 4GXBA 2BYFA 3FC4A 2GBNA 3RNAC 2RDBC 3WANA 3ONSA 3HVZA 2BS2B 2RR9A 4NY0A 1UF0A 3ZJTA 2JYEA 2C7HA 3V3XA 2WXOA 2GBRA 4DHJB 4GU2A 4A6QA 1U4AA 3QJZA 1UELA 2CHWA 1GJZA 1FXIA 3UGBB 1K53A 1EUVB 4B0MA 5KHOA 4GSWA 3H7PB 3B0AA 2WDVB 4MGIE 1R4NI 1XD3B 3N30A 2QDFA 1YN4A 4KKJA 5IP4D 1XCTL 3NS8A 2C60A 1JWUD 1N61A 1MFWA 2CR5A 2KHWB 1N6ZA 4XWTA 4RGNA 4TSSA 1CMXB 4IWQA 3AULA 1EF1A 1KF6B 3RUIB 4ARIA 3VR9B 3VRBB 3H8HA 1C3TA 3UIPB 3BIID 2HE7A 3VVWB 4YWGG 3FILA 1B1ZA 1C76A 1T0SC 4I6NB 3T3NA 3NVYA 1D5ZC 3I3TB 4ZRJA 2O6VA 3ZNGC 1ENFA 2IPKD 3MHZA 2MWSB 3B1LX 1V86A 2DYBA 1PUTA 1TIFA 1FNVA 5BMHA 1HA5A 1SGHA 1V80A 3R7RA 1GAQB 4AUQC 4JWSC 1DYQA 2L7RA 2LEKA 3N1YC 2LGIA 1I4HA 3CSTA 4E3CA 3U8ZA 4II3B 4X57B 2NTTA 2KT7A 3Q8EA 4GB9A 1IPGA 1MHXA 3DWMA 4TV3A 4W9IA 2LHEA 2PLPA 3NRZA 1WE7A 4DDGD 2J7QB 1WY8A 2LJ5A 2RDGA 4HCNB 4IM3A 4G3XB 2FBWB 1HZ5A 3PGEA 3TEWA 3DVNV 1FMAD 2K22A 1TTNA 4ANVA 2WXPA 4B9KA 3QCAA 2LRUA 1VDVA 2PEAA 3ALBA 1RM6C 5TR5A 1GC7A 1QF6A 3AEAB 3U7ZA 2IGGA 3EFUA 3VRAB 2EELA 2WNMA 2JXXA 2WXLA 4FADA 3DVNU 3BY4B 1FCCC 1L7YA 2LVOA 2KJRA 1HE8A 3W1SC 3W9CB 1MG4A 4W9GA 4KZCA 4NAWA 2ZW0A 2KDFB 4OVUA 4IKGA 1EO6A 3WAPA 5L83A 3SFEB 4GDLA 3ZJUA 4B95A 1IYFA 4LDTD 4MT5A 4DXGA 2LGXA 4DQOC 1GNUA 2L0FA 2ZJDA 2KFJA 3NUHB 2WU5B 1OTRB 1WM3A 4JPSA 3VUWA 2UU7A 2MCNB 1L0VB 5C1ZA 2CKHB 2PKOA 1ZE3D 2VH1A 4CQNA 2VZKD 2J53A 3NVZA 3ZKJC 4A55A 3JSVA 4W9EA 4JL9A 4BOZB 1EWCA 2D5GA 1MI0A 1KTKA 4RNAA 2RDHA 1C78A 3I9V1 3RD2A 2XK5B 1DOIA 1KOTA 4C00A 1L0YB 4NJ6A 1WM2A 1YQBA 2KDBA 2QJLA 1R7SA 1YNTE 2Z0DB 2HJ8A 3L4PA 4E74A 2DYOA 3PZ8A 4A8XC 3IAM1 4HEA1 3RZFA 1BMLC 3L0WB 2KN4A 3M62B 1N62A 2PE6B 3RNGC 2WDRB 2BKFA 2Z8LA 3Q3MC 3AB5A 1MJDA 2JXTA 3TIXA 4FLHA 1S1QB 1QILA 5MPOA 1TKEA 2RPVA 1UGJA 2KVRA 2FNJB 4RM8A 3X0WA 3ZRFA 4HJGE 4NZLB 3PSEB 1WGKA 3DBLB 1Q10A 4N6EB 3AE6B 4HKQA 2MX2A 4EEWA 4L2YA 1T0QC 2KWUB 2RMMA 1SE4A 2NMQA 1X1MA 2WLBA 2WX0A 3A4RA 3LYYA 4LNFA 4WWOA 1QOAA 1VZ7A 1T0YA 2IO0B 5IA7A 1ISNA 5CHVC 2FUHB 3RNBC 3APDA 4ANXA 1E6EB 2QIEB 3C8YA 4ZOHC 1WR6E 3GZNB 4BOSC 3EUB2 2WXHA 5DPSA 2JQRB 1Q5WB 1RFKA 3AXCA 1KM7A 3IHPC 3A9JB 3DBHB 4HPPA 1YX5B 1IGCA 4LDTB 4A3PA 4BKSA 3P2BA 1BUIC 3C0RB 2CHZA 2RPQA 4QAYA 5FR6A 2NBUA 2O2VB 2KFKA 1QT9A 2R2OA 4AP4C 4TQ0A 1GTHA 2KWDA 3TL5A 2BYEA 2ASQA 2DX5B 5HFYA 2KMMA 2W9NA 1MPEA 4FJYA 1B9RA 2B3AA 3OAWA 2VZKB 5FR3A 1K50A 4IM2A 4JGHB 4LNNA 1NYQA 5BMIA 4NPNA 5HKHA 2NVUI 1QOGA 3M3JA 2DYMA 3DBLI 4MM3A 2N7DA 2JUOA 5JHBA 3VH4B 3ZDMC 1OGWA 1GG3A 3ZXVA 3MHSD 2ZEQA 4W9CA 2WYQA 3CSFA 1P7FA 4YTNB 1HTQA 2L8JA 2V3PA 1E7PB 1HXYD 2K8HA 2JRHA 2JT4B 3JW0X 2QCZA 1VZ6A 3E9SA 1A70A 4YSXB 2D3CA 1D5XC 1FNWA 3DQVA 3CF4A 5HHDG 3VR8B 2K25A 2V3NA 4BZAA 1XLOA 3PRPB 4LTUA 2N7JA 2PMVA 2WWZA 3SD5A 4PS3A 2I38A 4K7WA 2PE9A 2FUG1 1OEYJ 3ZUNA 2YEPB 1YQ3B 1WJNA 4K1RB 3DBHI 5H8YE 3AEFB 4M0WB 5IN7A 1PGBA 4HVBA 2J42A 1KH0A 1WMHA 5D2MB 4FJVB 5D7GA 1JWSD 3AE2B 3AMZA 3P42A 4G0NB 2NPTA 4GOCA 2N9PC 4GLSC 2BW2A 1PGAA 3NZSA 4MGZE 2N0SB 5KHQA 4HXDA 3VTVA 3MTNB 1KJTA 2RGFA 4ZDVA 1M4VA 2H88B 2KQ4X 3NZUA 3SEBA 2HJ1A 2IY1B 4HCPB 1NVID 2HTME 3OLMD 2LVPA 1E90A 3IT6B 4KGSA 4C7YA 1EU3A 4WAAA 2J0KA 5E6JA 4ICUA 4LNOA 5C23A 4G50A 3ML9A 2EMTA 3PHXB 2D3BA 1L6VA 3ZW3A 3WA0A 4K7UA 2C7NB 1SBBB 1J0GA 2MBHA 2MBBB 5IKCM 3UQAA 3SDLC 3TEXA 1KLVA 3QARA 2L3ZA 1FO4A 5L95C 1FPYA 3LDZE 4TUUA 2B76B 1UH6A 1WGDA 3DHGC 3NJTA 3DBRI 1P0RA 2KX3A 1T5XD 4EUTA 1VLBA 1UNSA 3DCGA 2DENB 4IG7B 1JQ4A 2N1VA 3OG5A 2CS4A 3Q8AA 4DBGA 3Q69A 4PK1A 3GP7A 2KDIA 3L17A 3BVMA 4HDQA 4BVUC 3N1XC 2UWQA 3A33B 2LI5A 5TSSA 3DPDA 1TT5B 3QHTA 1ZW7A 2V3SA 2BT6A 4ANUA 1UUPA 1R4MB 3K9OB 5E6NA 4B6WA 2L32A 1WR1A 4ZHPA 2DZJA 1LM8B 2LFIA 2OOBB 5G2NA 1OFFA 4MH0E 2V4IB 2JWZA 4N59A 3ZNHB 2AWTA 5J2RA 4EOYA 4JWUC 4YSZB 1QLBB 4F8CB 2AQ2B 4HLEA 3IT4B 3PPAA 5IO9A 2G4DB 3TEZA 1D5MC 1UGMA 1XO3A 1G6JA 2KNBA 1ROEA 3TBLD 2WXFA 1ZDXA 3Q8CA 4CYEA 1WH3A 1FNUA 1E10A 1JWBD 2M0AA 4Q2JA 3ZLZA 1JRUA 3O65B 1GT8A 5CTRC 4ZRPA 1LQBA 2J4XA 2OEDA 1V5TA 3ABVB 5BYRA 1Y8RC 4RFBA 4HPMB 2XNAC 3H6NA 2KDEB 3B9JA 3QK0A 2K5PA 2KO3A 2ZVNA 4N58A 2REXA 2L52A 1FCLA 1R4MI 2OJWA 2VRRB 3UIOB 2L76A 2I2YA 1JROA 4FULA 3P1MA 2Y3AA 3DBSA 1NEKB 2RSUA 2LJIA 3URYA 3UINB 3B2GA 2PTLA 4A3OA 2XEWA 1XCQL 2INCC 2C9WB 4W9DA 3L54A 2EKIA 1WYWB 1QOFA 3X23A 4XE0A 4ZHOA 1MG8A 2KWCA 2J52A 2A4ZA 3SR6A 1XF5L 3RULA 4HK2A 4ACFA 1E7UA 4KGRA 3PRZA 3P63A 1KLGD 3EC8A 4KGTA 2BS4B 5HG2A 4YXDB 2WP9B 1YN3A 2KACA 4M8MA 3VAWA 1ZXHA 2LUMA 3HRDD 2AX5A 2DAJA 1ZGUB 4DXFA 1P7EA 2KQSA 3NOBA 2MP2B 2ICIA 3D32A 2D2QA 2H89B 1TY0A 5GXGB 1DOYA 4KSLC 4C4VB 3KLSX 1WGGA 1EU4A 2YEPF 3RYTA 3VXWA 3NY5A 1C1YB 5T8IA 5I4DA 2JRIB 4WWMA 2Y5BB 4KDIC 3M63B 2KMAA 1RWSA 3LXFA 4MGYE 4HPLB 1UZXB 2DAFA 2LGYA 4MSMB 3L08A 4ASWC 2QILA 5JZEB 1FXAA 2KK8A 2W54A 2EMSA 1L6UA 1F2RI 1YD8U 3KVFB 5FKAC 3GOEA 4NQKE 4ANWA 5LXHA 4DWFA 1TS5A 1KLUD 1Q1OA 3P4PB 2MH7A 2IY0B 2IGDA 3AE7B 1V1PA 2ZPNA 2WXKA 4PS7A 2ACZB 1IP9A 1A5RA 1RLFA 4PS8A 1KRHA 1TZ1A 4MELA 4WQMA 1VJKA 3ZJVA 4OW0A 1TS2A 3EECA 2NCNA 4RGMA 5D3IB 2L05A 3SU8X 3KWLA 5FK9C 4FHKA 3MJ5A 1XQQA 4LNKA 3V61A 1N63A 1WE6A 4RMAA 2DZKA 3MC8A 4A20A 2KJHB 4P1BC 2WXGA 3AE9B 2BS3B 3HHMA 5JH5C 2X38A 4MACA 4FBJB 3N1ZC 1P1AA 2GOWA 3PV1A 3DOWA 1ACCA 4DHZE 2GBKA 1GC6A 3FAHA 3L13A 3MFGA 4RCOA 3BINA 2AL6A 4J3OD 2INPE 4XZ4A 1TGZB 4KIKB 2JZZA 2FCNA 1D6EC 2QEJC 1E9MA 4CO7A 1AWDA 3H7PA 1E0ZA 2JX5A 3DDCB 3RZWC 3VFKA 2LZ6A 5J18A 4AOFA 2K8BA 3KH0A 2BKRB 4LLGM 4E71A 2IO3B 2FIDA 1F52A 1SIJA 3R7QA 4WJOA 1QZEA 3KUZA 4XDCA 2O6VD 3N32A 3E56A 4XC2A 3BYTB 2SEBD 3AEBB 2X8XX 5AZHA 2LGDA 3N9YC 3AE1B 3BWUD
chains in the Genus database with same CATH topology
3FC4A 3AE2B 3AMZA 3P42A 4MH8A 1TKYA 1GB4A 4GLSC 4MM3B 2BW2A 2BS2B 1PGAA 2XN9C 3HVZA 4P6VF 2WXRA 1XLPA 3IAS1 2W3SA 3ZJTA 2JYEA 2DLBA 2N0SB 2N9LA 1C77A 1FRDA 3V3XA 2WXOA 3AM9A 1J7AA 2WXNA 4IOIE 4A6QA 2AQ3B 1FXIA 1L4ZB 1M4VA 2MJDA 1ESFA 1YMHE 2H88B 1K53A 2KQ4X 4JE3B 3CIRB 1XEEA 3SEBA 2FE8A 4B0MA 1UWMA 2IDYA 1N60A 1NVID 5D7GA 2HTME 3ZGZA 1QKZA 2GB1A 2WDVB 3IT6B 4KGSA 4C7YA 1EU3A 5AUKA 4ZYSA 1SF0A 1GB1A 1SEBD 2KAJA 1SJHD 1F77A 5E6JA 3VQIA 1JALA 5BMGA 5EE0A 1YN4A 4KKJA 1SXTA 3AE8B 3UI3A 1XCTL 1C4PA 1JWUD 1N61A 1NYRA 2M19A 1MHHE 4XWTA 4REZA 4RGNA 4YT0B 1L6VA 1LO5D 3Q8FA 4TSSA 4GDKB 1VR9A 5D3DA 1KF6B 4ARIA 1SBBB 3VR9B 1H7WA 3TEXA 1YJJA 2JSVX 3VRBB 1XLQA 3H8HA 3BIID 1FO4A 2WS3B 3U2SC 1GPXA 4YWGG 3FILA 1B1ZA 1C76A 3T3NA 5C3JB 3NVYA 1D5ZC 4D2KA 2GI9A 2B76B 1IBXA 1ENFA 2IPKD 3MHZA 1T5XD 1VLBA 2E6XA 2AQ1B 1UNSA 4OZCA 4OVZA 1PUTA 1FNVA 5BMHA 1HA5A 2ZW1A 5G5GA 1JQ4A 4PT5A 2SAKA 1GAQB 3Q8AA 3U52E 2BB6A 4JWSC 4A90A 3Q69A 3IXSA 1DYQA 3GP7A 2BBCA 2LEKA 2LGIA 1I4HA 1GTEA 1HEZE 3BVMA 4EE2A 1C9FA 2NTTA 3Q8EA 1WXQA 1YJIA 1MHXA 4O1NA 4H2AA 5TSSA 3DWMA 1DOXA 3AE3B 1C4CA 2LHEA 2BT6A 2PLPA 4NJCA 5EE3A 3NRZA 1UUPA 3TSSA 1WWTA 1F0ZA 2CJNA 3BYYB 2WDQB 3CWIA 1ET6A 2L32A 2RDGA 2W3RA 4ZHPA 2E3TA 3AN1A 2W82A 3P4QB 3OWEB 2FBWB 2LFIA 1L0XB 2MEKA 1ZOYB 1HZ5A 1OFFA 4A9AA 3TEWA 1TZOA 1CJEA 3HVDA 1FMAD 2IGHA 2V4IB 4N59A 1TS4A 2K22A 1QOBA 4USAA 2LMCA 3GS2A 2WXPA 1SE3A 3B2FA 2QMTA 4JWUC 3AEGB 2PIAA 4YSZB 3FILB 1QLBB 1VDVA 1RM6C 1C79A 2Y5CA 2AQ2B 1QF6A 1ZP0B 3AEAB 5H92C 3PO0A 3U7ZA 2IGGA 2K0PA 3R8BA 2Y5PA 3VRAB 1TY2A 2EELA 2WNMA 1OQQA 3IT4B 2WXLA 3ZYYX 4NAMA 4UDUC 4HROA 1FCCC 1I4XA 1TJEA 3TEZA 2V0GA 3ETRA 1D5MC 1XLNA 1XO3A 4C80A 1FRRA 1ROEA 2WXFA 1PYWD 3W9CB 1JWAD 3BK2A 1ZDXA 4C56C 3U4EG 1DGJA 2TSSA 2ZW0A 3BVZA 1BXTA 3Q8CA 4TMAB 1AW7A 2M56B 2WXJA 4IKGA 3ZJUA 3SFEB 1FNUA 1E10A 3SFDB 4RF0A 1JWBD 1YN5A 1ET9A 2M0AA 2MJEA 1SE2A 3NZ3A 4Q2JA 4MT5A 4DXGA 1JCKB 1GT8A 3T3OA 3AEDB 4ZRPA 4DQOC 2J4XA 2KDMA 2OEDA 3ABVB 5JXVA 5BYRA 4RFBA 1PGXA 1FFVA 3NUHB 5BYQA 2XNAC 2WU5B 4FXCA 2JZPA 4JPSA 3AECB 3B9JA 2PVOD 1L0VB 2K5PA 1FIQA 2PKOA 4N58A 5HI1A 1ZE3D 3V05A 2DBYA 2L52A 4CQNA 1ZXIA 2WXMA 1JW9D 2VZKD 1I4PA 2J53A 2JYTA 1FCLA 3NVZA 4A55A 1J7BA 1PDXA 3LB8C 1EWCA 2I2YA 2D5GA 1JROA 3P1MA 2Y3AA 3EGRA 1NEKB 2LJIA 4HRSA 3URYA 1MI0A 3B2GA 1KTKA 4RNAA 2WU2B 2PTLA 4ITKA 2BTEA 2RDHA 2PW9A 1C78A 3I9V1 3NVWA 1XCQL 1JRPA 1DOIA 4XWWA 1FFUA 1IUEA 1L0YB 1ZUD2 3KQ4A 2PVGC 2EKIA 4R3DA 1ZDVA 5LNK1 1QOFA 1SSNA 2QJLA 4XE0A 1R7SA 4ZHOA 1FD6A 2LHDA 5C2TB 1YNTE 3L4PA 3NS1A 5EE9A 4C7ZA 3ZQ4A 2J52A 2DYOA 3PZ8A 1XF5L 3SR6A 4A8XC 3IAM1 4HEA1 1YQ4B 3GB1A 4NAWB 1BMLC 4KGRA 2KN4A 3I57A 3P63A 1KLGD 1T3QA 3EA6A 4GDLB 4KGTA 1TKGA 2BS4B 2MJ3A 1N62A 2OHFA 5HG2A 1F2RC 4YXDB 2WP9B 3AE5B 1YN3A 2KACA 3PZ7A 2WDRB 1EWYC 2CJOA 3R2IA 1ZXHA 2Z8LA 2LUMA 3HRDD 3NVVA 1AN8A 2AX5A 2WQYB 1I7HA 3AB5A 4DXFA 1P7EA 1J7CA 1VZ8A 2JXTA 4OHJA 2K9XA 2ICIA 1QILA 5MPOA 2H89B 1TKEA 2RPVA 1TY0A 1UGJA 5GXGB 3W5UB 1DOYA 3KLSX 4HJGE 1WYGA 3BVGA 1EU4A 1FEHA 2YEPF 1SJED 4NZLB 5T8IA 2G9HD 1WGKA 1Q10A 5I4DA 3O13A 4HKZE 3AE6B 4N6EB 1IBXB 4WWMA 2GRIA 4HKQA 1RWSA 3LXFA 1VRAB 4L2YA 3P4SB 2RMMA 1SE4A 2IJ0A 2NMQA 2QILA 2K3UA 1FXAA 2WLBA 3LYYA 4ARCA 1H7XA 2W54A 1V1OA 1QOAA 1VZ7A 1L6UA 4WH4A 3AEEB 1F2RI 1K52A 1WRIA 5FKAC 1E6EB 2QIEB 4WIPA 3AV8A 1HQRD 1I4GA 3C8YA 4TQ1A 1TS5A 4ZOHC 1KLUD 2DWQA 1ZPSA 3P4PB 3EUB2 2MH7A 2CU3A 2WXHA 3KWVA 2IGDA 4B0EA 3AE7B 1V1PA 2JQRB 1RFKA 4L23A 4WURA 3WCQA 2WXKA 1TS3A 4L1BA 2ACZB 2HDEA 4RGTA 1N5WA 1IGCA 2G1EA 4US9A 5G5HA 4WAFA 1BUIC 3AE4B 1UWXA 2JU6X 1L4DB 4KKIA 1Y56A 3W2DA 3J9CA 1KRHA 4WQMA 1VJKA 1QT9A 3ZJVA 1CK1A 4OW0A 1TS2A 5EE1A 3W1SA 3MC0B 1KFYB 4TQ0A 1GTHA 2KWDA 4OZAA 4RGMA 5D3IB 5HFYA 2KMMA 4YTPB 1GOZA 4M0WA 3KWLA 1MPEA 5FK9C 3RFZB 3R2TA 1B9RA 3HUIA 3BK1A 2VZKB 3MJ5A 2L83A 1RYJA 1CZPA 5FR3A 1K50A 1N63A 2W55A 4JX1C 5BYSA 1I4RA 3TUOA 1NI3A 1JMLA 1NYQA 2L1AA 5BMIA 1L5PA 4AS1A 2Q5WD 1QOGA 1T6BX 2QSDA 2WXGA 3AE9B 4AQ7A 2BS3B 2DYMA 1EM7A 3DWGC 4OZBA 4XDDA 2ON8A 4P16A 5AUIA 1QQRA 2INNE 4YTMB 2X38A 4MACA 1CQVA 2WXIA 4KX6B 1ACCA 4RH6A 3W5VB 1V1PB 1P7FA 2NTSA 3P4RB 3MP9A 4YTNB 2V3PA 1E7PB 1HXYD 3FAHA 4RCOA 3MFGA 4J3OD 2INPE 1PFDA 1I4QA 1K51A 1IGDA 4IDIA 4LK0M 1D6EC 2QEJC 1VZ6A 3AH7A 3E9SA 1E9MA 1AWDA 1A70A 1E0ZA 2JX5A 4ZRQA 4YSXB 3BZDB 1D4BA 1STEA 1WSPA 2WXQA 1D5XC 1FNWA 3CF4A 4YSYB 5HHDG 3VR8B 2V3NA 4LLGM 1XLOA 4US8A 2BB5A 4LTUA 1SB3C 2N7JA 1JWMD 2PMVA 2I38A 1V8CA 3RPFC 2FUG1 1AYFA 2R61A 4RF1A 2ONQA 2YEPB 1SIJA 1YQ3B 1N5XA 5H8YE 2BYTA 1TYGB 4XDCA 1V97A 1NENB 3AEFB 3Q8BA 2JWUA 3E56A 1MVKA 1HZ6A 3BYTB 1OQRA 1PGBA 2SEBD 3AEBB 1C4AA 1XXGA 2J42A 1KH0A 1FM0D 4RGOS 3TEYA 3N9YC 3AE1B 2N9KA 1JWSD 3BWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC4 A;  3B2G A;  5EE3 A;  3AE2 B;  2WU2 B;  3AMZ A;  3NRZ A;  2ACZ B;  4ITK A;  3NVW A;  1WWT A;  1N5W A;  1TKY A;  1F0Z A;  2CJN A;  2G1E A;  4US9 A;  2WDQ B;  1JRP A;  1DOI A;  3CWI A;  1FFU A;  5G5H A;  1IUE A;  3HVZ A;  2BS2 B;  2W3R A;  3AE4 B;  1ZUD 2;  4P6V F;  2PVG C;  1XLP A;  2EKI A;  2W3S A;  4ZHP A;  2E3T A;  3AN1 A;  2N0S B;  1QOF A;  2QJL A;  3P4Q B;  1FRD A;  1R7S A;  2FBW B;  4ZHO A;  5C2T B;  3AM9 A;  1KRH A;  1ZOY B;  1J7A A;  3L4P A;  3NS1 A;  1OFF A;  4WQM A;  1VJK A;  5EE9 A;  4A9A A;  1QT9 A;  4C7Z A;  3SR6 A;  5EE1 A;  1CJE A;  1FMA D;  4N59 A;  1YQ4 B;  1KFY B;  2K22 A;  1QOB A;  4USA A;  1GTH A;  1FXI A;  2MJD A;  2H88 B;  3P63 A;  2KMM A;  4YTP B;  3CIR B;  1T3Q A;  3B2F A;  4JWU C;  3AEG B;  2PIA A;  4YSZ B;  1TKG A;  1UWM A;  2BS4 B;  1QLB B;  1N60 A;  1N62 A;  1VDV A;  2MJ3 A;  1RM6 C;  4YXD B;  2WP9 B;  3AE5 B;  1NVI D;  2OHF A;  2HTM E;  2Y5C A;  3HUI A;  1B9R A;  1QF6 A;  2WDR B;  1RYJ A;  1CZP A;  2WDV B;  1EWY C;  2CJO A;  2L83 A;  4C7Y A;  1N63 A;  1ZP0 B;  3AEA B;  2W55 A;  4JX1 C;  1SF0 A;  3HRD D;  3PO0 A;  2KAJ A;  5AUK A;  5H92 C;  3NVV A;  2AX5 A;  1NI3 A;  2WQY B;  1JAL A;  1I7H A;  3AB5 A;  3VRA B;  1NYQ A;  1L5P A;  1OQQ A;  2Q5W D;  1J7C A;  1QOG A;  5EE0 A;  3ZYY X;  3AE9 B;  3AE8 B;  2BS3 B;  2K9X A;  4HRO A;  5MPO A;  3DWG C;  1NYR A;  1N61 A;  2H89 B;  1TJE A;  1TKE A;  2M19 A;  5AUI A;  3W5U B;  5GXG B;  1DOY A;  4YTM B;  4YT0 B;  1L6V A;  3ETR A;  1XLN A;  1XO3 A;  4C80 A;  4KX6 B;  1WYG A;  1FRR A;  1KF6 B;  3VR9 B;  1ROE A;  3W5V B;  1H7W A;  3W9C B;  1YJJ A;  3P4R B;  1JWA D;  1WGK A;  4YTN B;  4N6E B;  1E7P B;  3AE6 B;  3VRB B;  1DGJ A;  1XLQ A;  3FAH A;  4WWM A;  3BII D;  1RWS A;  1PFD A;  3LXF A;  1FO4 A;  2M56 B;  2WS3 B;  3P4S B;  3SFE B;  1GPX A;  1E10 A;  3SFD B;  4IDI A;  5C3J B;  1JWB D;  3NVY A;  3AH7 A;  2MJE A;  1E9M A;  2B76 B;  1AWD A;  1A70 A;  1FXA A;  2WLB A;  1E0Z A;  1H7X A;  2JX5 A;  2W54 A;  1QOA A;  1GT8 A;  1L6U A;  4YSX B;  3AED B;  3AEE B;  1VLB A;  1WRI A;  3ABV B;  3CF4 A;  4YSY B;  3VR8 B;  1PUT A;  1FFV A;  1E6E B;  1XLO A;  2QIE B;  2WU5 B;  4FXC A;  4LTU A;  1SB3 C;  5G5G A;  3AV8 A;  4US8 A;  1JQ4 A;  3AEC B;  1GAQ B;  3B9J A;  1V8C A;  4ZOH C;  2PVO D;  3RPF C;  1L0V B;  1AYF A;  4JWS C;  2K5P A;  1FIQ A;  2DWQ A;  2PKO A;  4N58 A;  2LEK A;  1SIJ A;  1YQ3 B;  3P4P B;  1N5X A;  2DBY A;  2L52 A;  3EUB 2;  2MH7 A;  5H8Y E;  2CU3 A;  1TYG B;  1ZXI A;  1GTE A;  3KWL A;  1JW9 D;  1V97 A;  1NEN B;  3AEF B;  3AE7 B;  2JQR B;  3NVZ A;  1J7B A;  1OQR A;  1PDX A;  1RFK A;  3LB8 C;  1WXQ A;  1YJI A;  3AEB B;  3DWM A;  3WCQ A;  1DOX A;  3AE3 B;  1FM0 D;  1JRO A;  3P1M A;  3AE1 B;  1NEK B;  2BT6 A;  4HRS A; 
#chains in the Genus database with same CATH topology
 3A1Q B;  4JIO U;  1V49 A;  2N9X A;  4S17 A;  3V60 A;  1YOV B;  4P6V F;  2WXR A;  3QQ8 B;  3TJP A;  2W3S A;  2NR2 A;  4K7S A;  2DLB A;  2N9L A;  1C77 A;  1FRD A;  2FAZ A;  1WZ3 A;  3A9K B;  4IOI E;  1E8W A;  2AQ3 B;  3QAQ A;  1ESF A;  1YMH E;  2FE8 A;  1UWM A;  1N60 A;  4WJN A;  3ZGZ A;  1QKZ A;  2GB1 A;  4ZYS A;  3N3K B;  1SEB D;  2LXC A;  3PLV A;  3VQI A;  5BMG A;  5EE0 A;  1TBE A;  2LWP A;  3UI3 A;  3ZDT A;  1C4P A;  1NYR A;  2M19 A;  3ECI A;  4YT0 B;  3U7D A;  1LO5 D;  2GLS A;  3DVG Y;  4W9H A;  4GDK B;  2FIF A;  1VR9 A;  1E8X A;  4HJK A;  3R3M A;  3S2A A;  2WS3 B;  2KTR B;  3JVZ X;  3U2S C;  1E5W A;  1GPX A;  3IFW B;  5C3J B;  3IBE A;  4D2K A;  2KN5 A;  3GE3 C;  3KYD D;  4M8N A;  2GBM A;  1I42 A;  3RMK C;  2E6X A;  3Q3O C;  4IM0 A;  4RM9 A;  5DPW A;  4OZC A;  4OVZ A;  2V4L A;  1J19 A;  2D07 B;  3CF6 E;  4PT5 A;  2PPH A;  4W9J A;  3RT3 B;  2BBC A;  4LNI A;  4GMV A;  4EE2 A;  2HTH A;  1WXQ A;  1UBI A;  1DOX A;  3AE3 B;  3GZN I;  4BBN C;  2DNF A;  4NJC A;  5EE3 A;  2K8C A;  4NNJ B;  1WWT A;  3KYC D;  3TSS A;  2C5L C;  2CJN A;  2WDQ B;  1ET6 A;  1NDD A;  3WAL A;  2R2Q A;  4PYZ A;  2ZVO A;  2OJR A;  3AN1 A;  4WWN A;  4ICV A;  2KAN A;  1L0X B;  2MEK A;  2MBO A;  5E6O A;  1CJE A;  3HVD A;  1TS4 A;  1V5O A;  4BAX A;  1QOB A;  2LMC A;  3GS2 A;  1J8C A;  1WF9 A;  3B2F A;  2QMT A;  3AU4 A;  5CHF A;  3AEG B;  2PIA A;  3FIL B;  4K3B A;  4DHZ B;  2K6D B;  2O6V B;  4F7Z A;  3R8B A;  4BKT A;  3ZYY X;  2XK5 A;  4JLC A;  4UDU C;  1WX8 A;  2KX0 A;  3RCZ A;  3ETR A;  4C80 A;  4W9L A;  1PQS A;  1E8Y A;  3TCA A;  1NI2 A;  1PYW D;  4P7I A;  2BGF A;  2KC2 A;  3U4E G;  1DGJ A;  2TSS A;  3PT2 B;  1BXT A;  4TMA B;  1AW7 A;  2M56 B;  2AEH A;  2GMI C;  2WXJ A;  3PRM B;  4RF0 A;  1AAR A;  3ZXR A;  1ET9 A;  2MJE A;  1SE2 A;  3HM6 X;  1JCK B;  3AED B;  3VUY A;  2BQQ A;  3QWZ B;  5JXV A;  1PGX A;  1FFV A;  5BYQ A;  4FXC A;  2PVO D;  2QHO A;  5CX3 A;  1FIQ A;  5HI1 A;  2DBY A;  4I6L B;  2MBQ A;  2N4F A;  1ZXI A;  2I1J A;  2WXM A;  1JW9 D;  5DPR A;  1WXS A;  3HIZ A;  4P1C C;  4ZYN A;  1UBQ A;  4HRS A;  1WRD B;  2D3G A;  1WZ0 A;  2PW9 A;  3NVW A;  2MHJ A;  1JRP A;  3VTU A;  3KW5 B;  2YLM A;  3KQ4 A;  2PVG C;  4R3D A;  1SSN A;  5C2T B;  3NS1 A;  4C7Z A;  4HWI B;  4XYC A;  1YQ4 B;  1R4N B;  4GIV A;  2BPS A;  4NAW B;  3I57 A;  4GN1 A;  2V9H A;  4GDL B;  2N7E A;  4MGK E;  2J0M A;  2OHF A;  1F2R C;  4BKS D;  3DHI C;  3AI5 A;  3R2I A;  4F1S A;  3NVV A;  1AN8 A;  3A9J A;  2WQY B;  1I7H A;  1VZ8 A;  2RD0 A;  2K1F A;  4OHJ A;  2D10 A;  4AJW A;  3PVL A;  1WFY A;  1HTO A;  2ZNV C;  2ZCB A;  4J6I A;  4M02 A;  2O2V A;  2KC1 A;  1WYG A;  3BVG A;  4EZL A;  1FEH A;  1WXV A;  1SJE D;  2IND C;  5AZF A;  3JSV B;  4HKZ E;  1IBX B;  1YJ1 A;  1WJU A;  3V6E B;  3ZO5 B;  4DXA B;  3P4S B;  5DPT A;  2IJ0 A;  3JYU A;  2KZR A;  3QX1 A;  2K3U A;  3A4S C;  1F9J A;  1V1O A;  4IC7 B;  2KTR A;  4WH4 A;  3AEE B;  1K52 A;  1WRI A;  2KKC A;  4WIP A;  2LVQ A;  3AV8 A;  1I4G A;  1WX7 A;  3VHT C;  3T8M A;  3V62 A;  4L23 A;  4II2 B;  4WWP A;  3ZNI D;  5AZG A;  4L1B A;  1BT0 A;  2I1K A;  2LAS A;  2HDE A;  2M17 A;  5G5H A;  1ZKH A;  4OVV A;  3AU5 A;  2JU6 X;  1P3Q U;  4KKI A;  2LUE A;  3W2D A;  4FHJ A;  3I5J C;  2M1M A;  3C19 A;  3RN9 C;  2PJH A;  3L10 B;  3QIJ A;  4M0W A;  2BF8 B;  3R2T A;  2WDT B;  3BK1 A;  3M95 A;  2L83 A;  1CZP A;  2W55 A;  1UD7 A;  3TUO A;  2J0J A;  1JML A;  2L1A A;  1L5P A;  4AS1 A;  1T6B X;  2IYD B;  4AQ7 A;  4KV2 A;  3ZTC A;  4DK5 A;  4OZB A;  5AEK B;  4P16 A;  5AUI A;  2INN E;  4MSQ B;  4YTM B;  1CQV A;  2ZNV B;  2IO1 B;  4PYU A;  2L00 B;  3MP9 A;  4XX5 A;  2D11 A;  1RAX A;  1I4Q A;  1K51 A;  2KMC A;  4LK0 M;  1GUA B;  2KVZ A;  4NQL B;  3ZIM A;  1Q0W B;  3NG0 A;  1M94 A;  2KD0 A;  3BZD B;  1SE9 A;  1STE A;  1WSP A;  4EFO A;  4YSY B;  2KFK B;  5IAA C;  3EHV A;  4US8 A;  5D94 A;  1JWM D;  5IOI A;  2JF5 A;  1V8C A;  3RPF C;  1AYF A;  4RF1 A;  4IUM B;  1TYG B;  3I63 C;  3Q8B A;  2JWU A;  1I35 A;  1MVK A;  1HZ6 A;  1OQR A;  1XXG A;  3H1U A;  4K81 A;  4RGO S;  2AL3 A;  4HDO A;  2N9K A;  3L16 A;  3MJW A;  3TMP B;  2KQ7 A;  4MH8 A;  1TKY A;  2MBE A;  3KUC B;  1GB4 A;  4MM3 B;  2XN9 C;  3VH3 B;  1XLP A;  3IAS 1;  3WAO A;  2L0T A;  3RNE C;  2VH2 A;  3AM9 A;  2JY6 A;  1J7A A;  2WXN A;  1EF5 A;  2KLC A;  1L4Z B;  2MJD A;  1E8Z A;  4JE3 B;  3CIR B;  1XEE A;  2IDY A;  3PLU A;  4KDL B;  3W1Y A;  3H7S A;  3HM3 A;  3Q6B A;  4LJO B;  2DHZ A;  5AUK A;  1SF0 A;  1GB1 A;  2KAJ A;  1SJH D;  1F77 A;  2ZPY A;  1JAL A;  3QC8 B;  2MW5 A;  3LJ3 A;  1SXT A;  1E7V A;  3AE8 B;  3RI7 C;  4EZK A;  1MHH E;  4WJQ A;  4REZ A;  5BO4 B;  3Q8F A;  2BWF A;  2YVC A;  5D3D A;  3KUD B;  1H7W A;  2N1W A;  1YJJ A;  3MC9 A;  2JSV X;  5G55 A;  1S3S G;  1XLQ A;  1WMH B;  1OEY A;  2XBB C;  3Q3F A;  2LXA A;  2KYW A;  1WX9 A;  2NPT B;  2GI9 A;  1IBX A;  2D3A A;  4MEM A;  4BBN F;  2NBV B;  4IW0 A;  2Z0E B;  2AQ1 B;  2HD5 B;  2ZW1 A;  5G5G A;  2SAK A;  4A90 A;  3U52 E;  2BB6 A;  1V9J A;  3IXS A;  3QA8 A;  4M01 A;  1H8C A;  1GTE A;  1HEZ E;  1C9F A;  1FXT B;  4G11 A;  2FCS A;  3U30 A;  1YJI A;  4O1N A;  4KZ0 A;  4H2A A;  3ZTD A;  4EZJ A;  1C4C A;  2MA9 B;  2WHI A;  3APF A;  1F0Z A;  3BYY B;  3CWI A;  2W3R A;  3APC A;  3IVF A;  2ZCC A;  2E3T A;  2W82 A;  1F1H A;  3P4Q B;  3OWE B;  1ZOY B;  4BFR A;  3ML8 A;  4A9A A;  1TZO A;  2IGH A;  3Q14 C;  4IWO A;  3H9D A;  1K8R B;  4M00 A;  4USA A;  3PS6 A;  2WGS A;  3DHH C;  1SIF A;  2IZV B;  1SE3 A;  3T9L A;  4S0R A;  1C79 A;  2Y5C A;  1VD2 A;  3WAM A;  1ZP0 B;  5H92 C;  3PO0 A;  2K0P A;  4CHK A;  2Y5P A;  1TY2 A;  1OQQ A;  2LGS A;  2FCM A;  2MQJ A;  4NAM A;  4HRO A;  1I4X A;  1TJE A;  3VTW A;  3FKY A;  5GMV A;  4IWP A;  2V0G A;  1XLN A;  1FRR A;  2CHX A;  4MJS B;  1JWA D;  3BK2 A;  4C56 C;  5E6P A;  2KJ6 A;  4MDK E;  2NS5 A;  2ZZP B;  3SHQ A;  4W9K A;  3BVZ A;  4ZRI A;  3NHE B;  2CU1 A;  3SFD B;  3ZVV A;  1WXA A;  1YN5 A;  3NZ3 A;  3T3O A;  3UF8 A;  2Z59 B;  3HK0 A;  1WGR A;  2G3Q B;  4K3C A;  2KDM A;  4JQW C;  2MP2 A;  2JZP A;  3AEC B;  1Z5S B;  3Q3J A;  4C4V A;  4WJP A;  3V05 A;  4EKU A;  1LGR A;  2KWV B;  4NJ7 A;  4AJY B;  5DCN A;  1LXD A;  2MLB A;  1I4P A;  2JYT A;  1J7B A;  1PDX A;  3LB8 C;  4I6P A;  3EGR A;  2BTE A;  2WU2 B;  4ITK A;  2LD9 A;  2V1Y A;  2NBW B;  1FFU A;  4XWW A;  1IUE A;  1LFD A;  1ZUD 2;  3R66 C;  1ZDV A;  3PRE A;  5LNK 1;  3IG3 A;  1FD6 A;  2LHD A;  2IO2 B;  2AYO B;  3PZD A;  5EE9 A;  3ZQ4 A;  4TKN A;  3PTF C;  1NBF C;  1V2Y A;  3GB1 A;  4FJZ A;  4DDI D;  1T3Q A;  3EA6 A;  1V81 A;  3GE8 C;  1TKG A;  2MJ3 A;  1D3Z A;  1H4R A;  3AE5 B;  3PZ7 A;  1EWY C;  2CJO A;  1L2N A;  3ZRC A;  2QC8 A;  3VUX A;  5EDS A;  2KOX A;  1J7C A;  2K9X A;  3ZNZ B;  3W5U B;  4FN2 A;  2C7M B;  2G9H D;  3DBR B;  5JHA A;  3O13 A;  4URK A;  2GRI A;  2MRP A;  1VRA B;  4YL8 A;  4GGQ A;  1P9D U;  2UYZ B;  4W9F A;  4ARC A;  1H7X A;  1WIA A;  4DHJ D;  1WGH A;  2EKE C;  1P98 A;  2LRW A;  2A5U A;  2K39 A;  1HQR D;  2N9E B;  4TQ1 A;  2M0X A;  2DWQ A;  1ZPS A;  2CU3 A;  3OJ4 B;  3KWV A;  4B0E A;  3B08 A;  2IBI B;  2DZM A;  4WUR A;  3WCQ A;  1TS3 A;  1WJ4 A;  4KIK A;  3EFC A;  4RGT A;  1N5W A;  4WQO B;  2G1E A;  4US9 A;  2JPH A;  4WAF A;  2M4N A;  1YX6 B;  3AE4 B;  1UWX A;  1WXM A;  1L4D B;  1WJ6 A;  5D6J B;  5J17 A;  1Y56 A;  3J9C A;  2G4S A;  1CK1 A;  3Q3N C;  5EE1 A;  3W1S A;  1OQY A;  3MC0 B;  4LCD E;  4ZRK A;  1KFY B;  4OZA A;  2KTF A;  4YTP B;  1GOZ A;  2JZ3 B;  2BVC A;  3RFZ B;  2WX1 A;  3HUI A;  1V6E A;  3CMM B;  1RYJ A;  4JX1 C;  3N20 C;  5BYS A;  1T0R C;  3VDZ A;  1I4R A;  1NI3 A;  5CHW A;  3A1Q A;  4FA6 A;  2Q5W D;  2QSD A;  4KSK C;  1EM7 A;  3DWG C;  4XDD A;  1RFA A;  2ON8 A;  1QQR A;  1XT9 B;  2WXI A;  4KX6 B;  4LJP B;  4RH6 A;  3W5V B;  1WGY A;  1V1P B;  3RNC C;  2NTS A;  3WIM A;  3P4R B;  3A9K A;  2BYV E;  3DVG X;  2G45 B;  2BWE S;  5LXI B;  2KLG A;  1PFD A;  3RNF C;  3PHW B;  1IGD A;  2DZI A;  2M8S A;  3OJ3 A;  4IDI A;  4BKG A;  2JVC A;  4MJS A;  2K6Q A;  3AH7 A;  1RRB A;  3UQB A;  4KVG B;  4ZRQ A;  1VCB A;  1D4B A;  3K9P B;  2WXQ A;  2FCQ A;  2GBJ A;  2BB5 A;  1SB3 C;  3ENE A;  1YIW A;  4N9F 4;  2R61 A;  3Q2A C;  3V6C B;  2MSE D;  2ONQ A;  1N5X A;  4GDK A;  2BYT A;  1WI0 A;  1Z2M A;  1V97 A;  4XGA B;  1NEN B;  5LLI A;  1C4A A;  2KXJ A;  4AWJ A;  1FM0 D;  3TEY A;  4GXB A;  2BYF A;  3FC4 A;  2GBN A;  3RNA C;  2RDB C;  3WAN A;  3ONS A;  3HVZ A;  2BS2 B;  2RR9 A;  4NY0 A;  1UF0 A;  3ZJT A;  2JYE A;  2C7H A;  3V3X A;  2WXO A;  2GBR A;  4DHJ B;  4GU2 A;  4A6Q A;  1U4A A;  3QJZ A;  1UEL A;  2CHW A;  1GJZ A;  1FXI A;  3UGB B;  1K53 A;  1EUV B;  4B0M A;  5KHO A;  4GSW A;  3H7P B;  3B0A A;  2WDV B;  4MGI E;  1R4N I;  1XD3 B;  3N30 A;  2QDF A;  1YN4 A;  4KKJ A;  5IP4 D;  1XCT L;  3NS8 A;  2C60 A;  1JWU D;  1N61 A;  1MFW A;  2CR5 A;  2KHW B;  1N6Z A;  4XWT A;  4RGN A;  4TSS A;  1CMX B;  4IWQ A;  3AUL A;  1EF1 A;  1KF6 B;  3RUI B;  4ARI A;  3VR9 B;  3VRB B;  3H8H A;  1C3T A;  3UIP B;  3BII D;  2HE7 A;  3VVW B;  4YWG G;  3FIL A;  1B1Z A;  1C76 A;  1T0S C;  4I6N B;  3T3N A;  3NVY A;  1D5Z C;  3I3T B;  4ZRJ A;  2O6V A;  3ZNG C;  1ENF A;  2IPK D;  3MHZ A;  2MWS B;  3B1L X;  1V86 A;  2DYB A;  1PUT A;  1TIF A;  1FNV A;  5BMH A;  1HA5 A;  1SGH A;  1V80 A;  3R7R A;  1GAQ B;  4AUQ C;  4JWS C;  1DYQ A;  2L7R A;  2LEK A;  3N1Y C;  2LGI A;  1I4H A;  3CST A;  4E3C A;  3U8Z A;  4II3 B;  4X57 B;  2NTT A;  2KT7 A;  3Q8E A;  4GB9 A;  1IPG A;  1MHX A;  3DWM A;  4TV3 A;  4W9I A;  2LHE A;  2PLP A;  3NRZ A;  1WE7 A;  4DDG D;  2J7Q B;  1WY8 A;  2LJ5 A;  2RDG A;  4HCN B;  4IM3 A;  4G3X B;  2FBW B;  1HZ5 A;  3PGE A;  3TEW A;  3DVN V;  1FMA D;  2K22 A;  1TTN A;  4ANV A;  2WXP A;  4B9K A;  3QCA A;  2LRU A;  1VDV A;  2PEA A;  3ALB A;  1RM6 C;  5TR5 A;  1GC7 A;  1QF6 A;  3AEA B;  3U7Z A;  2IGG A;  3EFU A;  3VRA B;  2EEL A;  2WNM A;  2JXX A;  2WXL A;  4FAD A;  3DVN U;  3BY4 B;  1FCC C;  1L7Y A;  2LVO A;  2KJR A;  1HE8 A;  3W1S C;  3W9C B;  1MG4 A;  4W9G A;  4KZC A;  4NAW A;  2ZW0 A;  2KDF B;  4OVU A;  4IKG A;  1EO6 A;  3WAP A;  5L83 A;  3SFE B;  4GDL A;  3ZJU A;  4B95 A;  1IYF A;  4LDT D;  4MT5 A;  4DXG A;  2LGX A;  4DQO C;  1GNU A;  2L0F A;  2ZJD A;  2KFJ A;  3NUH B;  2WU5 B;  1OTR B;  1WM3 A;  4JPS A;  3VUW A;  2UU7 A;  2MCN B;  1L0V B;  5C1Z A;  2CKH B;  2PKO A;  1ZE3 D;  2VH1 A;  4CQN A;  2VZK D;  2J53 A;  3NVZ A;  3ZKJ C;  4A55 A;  3JSV A;  4W9E A;  4JL9 A;  4BOZ B;  1EWC A;  2D5G A;  1MI0 A;  1KTK A;  4RNA A;  2RDH A;  1C78 A;  3I9V 1;  3RD2 A;  2XK5 B;  1DOI A;  1KOT A;  4C00 A;  1L0Y B;  4NJ6 A;  1WM2 A;  1YQB A;  2KDB A;  2QJL A;  1R7S A;  1YNT E;  2Z0D B;  2HJ8 A;  3L4P A;  4E74 A;  2DYO A;  3PZ8 A;  4A8X C;  3IAM 1;  4HEA 1;  3RZF A;  1BML C;  3L0W B;  2KN4 A;  3M62 B;  1N62 A;  2PE6 B;  3RNG C;  2WDR B;  2BKF A;  2Z8L A;  3Q3M C;  3AB5 A;  1MJD A;  2JXT A;  3TIX A;  4FLH A;  1S1Q B;  1QIL A;  5MPO A;  1TKE A;  2RPV A;  1UGJ A;  2KVR A;  2FNJ B;  4RM8 A;  3X0W A;  3ZRF A;  4HJG E;  4NZL B;  3PSE B;  1WGK A;  3DBL B;  1Q10 A;  4N6E B;  3AE6 B;  4HKQ A;  2MX2 A;  4EEW A;  4L2Y A;  1T0Q C;  2KWU B;  2RMM A;  1SE4 A;  2NMQ A;  1X1M A;  2WLB A;  2WX0 A;  3A4R A;  3LYY A;  4LNF A;  4WWO A;  1QOA A;  1VZ7 A;  1T0Y A;  2IO0 B;  5IA7 A;  1ISN A;  5CHV C;  2FUH B;  3RNB C;  3APD A;  4ANX A;  1E6E B;  2QIE B;  3C8Y A;  4ZOH C;  1WR6 E;  3GZN B;  4BOS C;  3EUB 2;  2WXH A;  5DPS A;  2JQR B;  1Q5W B;  1RFK A;  3AXC A;  1KM7 A;  3IHP C;  3A9J B;  3DBH B;  4HPP A;  1YX5 B;  1IGC A;  4LDT B;  4A3P A;  4BKS A;  3P2B A;  1BUI C;  3C0R B;  2CHZ A;  2RPQ A;  4QAY A;  5FR6 A;  2NBU A;  2O2V B;  2KFK A;  1QT9 A;  2R2O A;  4AP4 C;  4TQ0 A;  1GTH A;  2KWD A;  3TL5 A;  2BYE A;  2ASQ A;  2DX5 B;  5HFY A;  2KMM A;  2W9N A;  1MPE A;  4FJY A;  1B9R A;  2B3A A;  3OAW A;  2VZK B;  5FR3 A;  1K50 A;  4IM2 A;  4JGH B;  4LNN A;  1NYQ A;  5BMI A;  4NPN A;  5HKH A;  2NVU I;  1QOG A;  3M3J A;  2DYM A;  3DBL I;  4MM3 A;  2N7D A;  2JUO A;  5JHB A;  3VH4 B;  3ZDM C;  1OGW A;  1GG3 A;  3ZXV A;  3MHS D;  2ZEQ A;  4W9C A;  2WYQ A;  3CSF A;  1P7F A;  4YTN B;  1HTQ A;  2L8J A;  2V3P A;  1E7P B;  1HXY D;  2K8H A;  2JRH A;  2JT4 B;  3JW0 X;  2QCZ A;  1VZ6 A;  3E9S A;  1A70 A;  4YSX B;  2D3C A;  1D5X C;  1FNW A;  3DQV A;  3CF4 A;  5HHD G;  3VR8 B;  2K25 A;  2V3N A;  4BZA A;  1XLO A;  3PRP B;  4LTU A;  2N7J A;  2PMV A;  2WWZ A;  3SD5 A;  4PS3 A;  2I38 A;  4K7W A;  2PE9 A;  2FUG 1;  1OEY J;  3ZUN A;  2YEP B;  1YQ3 B;  1WJN A;  4K1R B;  3DBH I;  5H8Y E;  3AEF B;  4M0W B;  5IN7 A;  1PGB A;  4HVB A;  2J42 A;  1KH0 A;  1WMH A;  5D2M B;  4FJV B;  5D7G A;  1JWS D;  3AE2 B;  3AMZ A;  3P42 A;  4G0N B;  2NPT A;  4GOC A;  2N9P C;  4GLS C;  2BW2 A;  1PGA A;  3NZS A;  4MGZ E;  2N0S B;  5KHQ A;  4HXD A;  3VTV A;  3MTN B;  1KJT A;  2RGF A;  4ZDV A;  1M4V A;  2H88 B;  2KQ4 X;  3NZU A;  3SEB A;  2HJ1 A;  2IY1 B;  4HCP B;  1NVI D;  2HTM E;  3OLM D;  2LVP A;  1E90 A;  3IT6 B;  4KGS A;  4C7Y A;  1EU3 A;  4WAA A;  2J0K A;  5E6J A;  4ICU A;  4LNO A;  5C23 A;  4G50 A;  3ML9 A;  2EMT A;  3PHX B;  2D3B A;  1L6V A;  3ZW3 A;  3WA0 A;  4K7U A;  2C7N B;  1SBB B;  1J0G A;  2MBH A;  2MBB B;  5IKC M;  3UQA A;  3SDL C;  3TEX A;  1KLV A;  3QAR A;  2L3Z A;  1FO4 A;  5L95 C;  1FPY A;  3LDZ E;  4TUU A;  2B76 B;  1UH6 A;  1WGD A;  3DHG C;  3NJT A;  3DBR I;  1P0R A;  2KX3 A;  1T5X D;  4EUT A;  1VLB A;  1UNS A;  3DCG A;  2DEN B;  4IG7 B;  1JQ4 A;  2N1V A;  3OG5 A;  2CS4 A;  3Q8A A;  4DBG A;  3Q69 A;  4PK1 A;  3GP7 A;  2KDI A;  3L17 A;  3BVM A;  4HDQ A;  4BVU C;  3N1X C;  2UWQ A;  3A33 B;  2LI5 A;  5TSS A;  3DPD A;  1TT5 B;  3QHT A;  1ZW7 A;  2V3S A;  2BT6 A;  4ANU A;  1UUP A;  1R4M B;  3K9O B;  5E6N A;  4B6W A;  2L32 A;  1WR1 A;  4ZHP A;  2DZJ A;  1LM8 B;  2LFI A;  2OOB B;  5G2N A;  1OFF A;  4MH0 E;  2V4I B;  2JWZ A;  4N59 A;  3ZNH B;  2AWT A;  5J2R A;  4EOY A;  4JWU C;  4YSZ B;  1QLB B;  4F8C B;  2AQ2 B;  4HLE A;  3IT4 B;  3PPA A;  5IO9 A;  2G4D B;  3TEZ A;  1D5M C;  1UGM A;  1XO3 A;  1G6J A;  2KNB A;  1ROE A;  3TBL D;  2WXF A;  1ZDX A;  3Q8C A;  4CYE A;  1WH3 A;  1FNU A;  1E10 A;  1JWB D;  2M0A A;  4Q2J A;  3ZLZ A;  1JRU A;  3O65 B;  1GT8 A;  5CTR C;  4ZRP A;  1LQB A;  2J4X A;  2OED A;  1V5T A;  3ABV B;  5BYR A;  1Y8R C;  4RFB A;  4HPM B;  2XNA C;  3H6N A;  2KDE B;  3B9J A;  3QK0 A;  2K5P A;  2KO3 A;  2ZVN A;  4N58 A;  2REX A;  2L52 A;  1FCL A;  1R4M I;  2OJW A;  2VRR B;  3UIO B;  2L76 A;  2I2Y A;  1JRO A;  4FUL A;  3P1M A;  2Y3A A;  3DBS A;  1NEK B;  2RSU A;  2LJI A;  3URY A;  3UIN B;  3B2G A;  2PTL A;  4A3O A;  2XEW A;  1XCQ L;  2INC C;  2C9W B;  4W9D A;  3L54 A;  2EKI A;  1WYW B;  1QOF A;  3X23 A;  4XE0 A;  4ZHO A;  1MG8 A;  2KWC A;  2J52 A;  2A4Z A;  3SR6 A;  1XF5 L;  3RUL A;  4HK2 A;  4ACF A;  1E7U A;  4KGR A;  3PRZ A;  3P63 A;  1KLG D;  3EC8 A;  4KGT A;  2BS4 B;  5HG2 A;  4YXD B;  2WP9 B;  1YN3 A;  2KAC A;  4M8M A;  3VAW A;  1ZXH A;  2LUM A;  3HRD D;  2AX5 A;  2DAJ A;  1ZGU B;  4DXF A;  1P7E A;  2KQS A;  3NOB A;  2MP2 B;  2ICI A;  3D32 A;  2D2Q A;  2H89 B;  1TY0 A;  5GXG B;  1DOY A;  4KSL C;  4C4V B;  3KLS X;  1WGG A;  1EU4 A;  2YEP F;  3RYT A;  3VXW A;  3NY5 A;  1C1Y B;  5T8I A;  5I4D A;  2JRI B;  4WWM A;  2Y5B B;  4KDI C;  3M63 B;  2KMA A;  1RWS A;  3LXF A;  4MGY E;  4HPL B;  1UZX B;  2DAF A;  2LGY A;  4MSM B;  3L08 A;  4ASW C;  2QIL A;  5JZE B;  1FXA A;  2KK8 A;  2W54 A;  2EMS A;  1L6U A;  1F2R I;  1YD8 U;  3KVF B;  5FKA C;  3GOE A;  4NQK E;  4ANW A;  5LXH A;  4DWF A;  1TS5 A;  1KLU D;  1Q1O A;  3P4P B;  2MH7 A;  2IY0 B;  2IGD A;  3AE7 B;  1V1P A;  2ZPN A;  2WXK A;  4PS7 A;  2ACZ B;  1IP9 A;  1A5R A;  1RLF A;  4PS8 A;  1KRH A;  1TZ1 A;  4MEL A;  4WQM A;  1VJK A;  3ZJV A;  4OW0 A;  1TS2 A;  3EEC A;  2NCN A;  4RGM A;  5D3I B;  2L05 A;  3SU8 X;  3KWL A;  5FK9 C;  4FHK A;  3MJ5 A;  1XQQ A;  4LNK A;  3V61 A;  1N63 A;  1WE6 A;  4RMA A;  2DZK A;  3MC8 A;  4A20 A;  2KJH B;  4P1B C;  2WXG A;  3AE9 B;  2BS3 B;  3HHM A;  5JH5 C;  2X38 A;  4MAC A;  4FBJ B;  3N1Z C;  1P1A A;  2GOW A;  3PV1 A;  3DOW A;  1ACC A;  4DHZ E;  2GBK A;  1GC6 A;  3FAH A;  3L13 A;  3MFG A;  4RCO A;  3BIN A;  2AL6 A;  4J3O D;  2INP E;  4XZ4 A;  1TGZ B;  4KIK B;  2JZZ A;  2FCN A;  1D6E C;  2QEJ C;  1E9M A;  4CO7 A;  1AWD A;  3H7P A;  1E0Z A;  2JX5 A;  3DDC B;  3RZW C;  3VFK A;  2LZ6 A;  5J18 A;  4AOF A;  2K8B A;  3KH0 A;  2BKR B;  4LLG M;  4E71 A;  2IO3 B;  2FID A;  1F52 A;  1SIJ A;  3R7Q A;  4WJO A;  1QZE A;  3KUZ A;  4XDC A;  2O6V D;  3N32 A;  3E56 A;  4XC2 A;  3BYT B;  2SEB D;  3AEB B;  2X8X X;  5AZH A;  2LGD A;  3N9Y C;  3AE1 B;  3BWU D; 
#chains in the Genus database with same CATH homology
 3FC4 A;  3AE2 B;  3AMZ A;  3P42 A;  4MH8 A;  1TKY A;  1GB4 A;  4GLS C;  4MM3 B;  2BW2 A;  2BS2 B;  1PGA A;  2XN9 C;  3HVZ A;  4P6V F;  2WXR A;  1XLP A;  3IAS 1;  2W3S A;  3ZJT A;  2JYE A;  2DLB A;  2N0S B;  2N9L A;  1C77 A;  1FRD A;  3V3X A;  2WXO A;  3AM9 A;  1J7A A;  2WXN A;  4IOI E;  4A6Q A;  2AQ3 B;  1FXI A;  1L4Z B;  1M4V A;  2MJD A;  1ESF A;  1YMH E;  2H88 B;  1K53 A;  2KQ4 X;  4JE3 B;  3CIR B;  1XEE A;  3SEB A;  2FE8 A;  4B0M A;  1UWM A;  2IDY A;  1N60 A;  1NVI D;  5D7G A;  2HTM E;  3ZGZ A;  1QKZ A;  2GB1 A;  2WDV B;  3IT6 B;  4KGS A;  4C7Y A;  1EU3 A;  5AUK A;  4ZYS A;  1SF0 A;  1GB1 A;  1SEB D;  2KAJ A;  1SJH D;  1F77 A;  5E6J A;  3VQI A;  1JAL A;  5BMG A;  5EE0 A;  1YN4 A;  4KKJ A;  1SXT A;  3AE8 B;  3UI3 A;  1XCT L;  1C4P A;  1JWU D;  1N61 A;  1NYR A;  2M19 A;  1MHH E;  4XWT A;  4REZ A;  4RGN A;  4YT0 B;  1L6V A;  1LO5 D;  3Q8F A;  4TSS A;  4GDK B;  1VR9 A;  5D3D A;  1KF6 B;  4ARI A;  1SBB B;  3VR9 B;  1H7W A;  3TEX A;  1YJJ A;  2JSV X;  3VRB B;  1XLQ A;  3H8H A;  3BII D;  1FO4 A;  2WS3 B;  3U2S C;  1GPX A;  4YWG G;  3FIL A;  1B1Z A;  1C76 A;  3T3N A;  5C3J B;  3NVY A;  1D5Z C;  4D2K A;  2GI9 A;  2B76 B;  1IBX A;  1ENF A;  2IPK D;  3MHZ A;  1T5X D;  1VLB A;  2E6X A;  2AQ1 B;  1UNS A;  4OZC A;  4OVZ A;  1PUT A;  1FNV A;  5BMH A;  1HA5 A;  2ZW1 A;  5G5G A;  1JQ4 A;  4PT5 A;  2SAK A;  1GAQ B;  3Q8A A;  3U52 E;  2BB6 A;  4JWS C;  4A90 A;  3Q69 A;  3IXS A;  1DYQ A;  3GP7 A;  2BBC A;  2LEK A;  2LGI A;  1I4H A;  1GTE A;  1HEZ E;  3BVM A;  4EE2 A;  1C9F A;  2NTT A;  3Q8E A;  1WXQ A;  1YJI A;  1MHX A;  4O1N A;  4H2A A;  5TSS A;  3DWM A;  1DOX A;  3AE3 B;  1C4C A;  2LHE A;  2BT6 A;  2PLP A;  4NJC A;  5EE3 A;  3NRZ A;  1UUP A;  3TSS A;  1WWT A;  1F0Z A;  2CJN A;  3BYY B;  2WDQ B;  3CWI A;  1ET6 A;  2L32 A;  2RDG A;  2W3R A;  4ZHP A;  2E3T A;  3AN1 A;  2W82 A;  3P4Q B;  3OWE B;  2FBW B;  2LFI A;  1L0X B;  2MEK A;  1ZOY B;  1HZ5 A;  1OFF A;  4A9A A;  3TEW A;  1TZO A;  1CJE A;  3HVD A;  1FMA D;  2IGH A;  2V4I B;  4N59 A;  1TS4 A;  2K22 A;  1QOB A;  4USA A;  2LMC A;  3GS2 A;  2WXP A;  1SE3 A;  3B2F A;  2QMT A;  4JWU C;  3AEG B;  2PIA A;  4YSZ B;  3FIL B;  1QLB B;  1VDV A;  1RM6 C;  1C79 A;  2Y5C A;  2AQ2 B;  1QF6 A;  1ZP0 B;  3AEA B;  5H92 C;  3PO0 A;  3U7Z A;  2IGG A;  2K0P A;  3R8B A;  2Y5P A;  3VRA B;  1TY2 A;  2EEL A;  2WNM A;  1OQQ A;  3IT4 B;  2WXL A;  3ZYY X;  4NAM A;  4UDU C;  4HRO A;  1FCC C;  1I4X A;  1TJE A;  3TEZ A;  2V0G A;  3ETR A;  1D5M C;  1XLN A;  1XO3 A;  4C80 A;  1FRR A;  1ROE A;  2WXF A;  1PYW D;  3W9C B;  1JWA D;  3BK2 A;  1ZDX A;  4C56 C;  3U4E G;  1DGJ A;  2TSS A;  2ZW0 A;  3BVZ A;  1BXT A;  3Q8C A;  4TMA B;  1AW7 A;  2M56 B;  2WXJ A;  4IKG A;  3ZJU A;  3SFE B;  1FNU A;  1E10 A;  3SFD B;  4RF0 A;  1JWB D;  1YN5 A;  1ET9 A;  2M0A A;  2MJE A;  1SE2 A;  3NZ3 A;  4Q2J A;  4MT5 A;  4DXG A;  1JCK B;  1GT8 A;  3T3O A;  3AED B;  4ZRP A;  4DQO C;  2J4X A;  2KDM A;  2OED A;  3ABV B;  5JXV A;  5BYR A;  4RFB A;  1PGX A;  1FFV A;  3NUH B;  5BYQ A;  2XNA C;  2WU5 B;  4FXC A;  2JZP A;  4JPS A;  3AEC B;  3B9J A;  2PVO D;  1L0V B;  2K5P A;  1FIQ A;  2PKO A;  4N58 A;  5HI1 A;  1ZE3 D;  3V05 A;  2DBY A;  2L52 A;  4CQN A;  1ZXI A;  2WXM A;  1JW9 D;  2VZK D;  1I4P A;  2J53 A;  2JYT A;  1FCL A;  3NVZ A;  4A55 A;  1J7B A;  1PDX A;  3LB8 C;  1EWC A;  2I2Y A;  2D5G A;  1JRO A;  3P1M A;  2Y3A A;  3EGR A;  1NEK B;  2LJI A;  4HRS A;  3URY A;  1MI0 A;  3B2G A;  1KTK A;  4RNA A;  2WU2 B;  2PTL A;  4ITK A;  2BTE A;  2RDH A;  2PW9 A;  1C78 A;  3I9V 1;  3NVW A;  1XCQ L;  1JRP A;  1DOI A;  4XWW A;  1FFU A;  1IUE A;  1L0Y B;  1ZUD 2;  3KQ4 A;  2PVG C;  2EKI A;  4R3D A;  1ZDV A;  5LNK 1;  1QOF A;  1SSN A;  2QJL A;  4XE0 A;  1R7S A;  4ZHO A;  1FD6 A;  2LHD A;  5C2T B;  1YNT E;  3L4P A;  3NS1 A;  5EE9 A;  4C7Z A;  3ZQ4 A;  2J52 A;  2DYO A;  3PZ8 A;  1XF5 L;  3SR6 A;  4A8X C;  3IAM 1;  4HEA 1;  1YQ4 B;  3GB1 A;  4NAW B;  1BML C;  4KGR A;  2KN4 A;  3I57 A;  3P63 A;  1KLG D;  1T3Q A;  3EA6 A;  4GDL B;  4KGT A;  1TKG A;  2BS4 B;  2MJ3 A;  1N62 A;  2OHF A;  5HG2 A;  1F2R C;  4YXD B;  2WP9 B;  3AE5 B;  1YN3 A;  2KAC A;  3PZ7 A;  2WDR B;  1EWY C;  2CJO A;  3R2I A;  1ZXH A;  2Z8L A;  2LUM A;  3HRD D;  3NVV A;  1AN8 A;  2AX5 A;  2WQY B;  1I7H A;  3AB5 A;  4DXF A;  1P7E A;  1J7C A;  1VZ8 A;  2JXT A;  4OHJ A;  2K9X A;  2ICI A;  1QIL A;  5MPO A;  2H89 B;  1TKE A;  2RPV A;  1TY0 A;  1UGJ A;  5GXG B;  3W5U B;  1DOY A;  3KLS X;  4HJG E;  1WYG A;  3BVG A;  1EU4 A;  1FEH A;  2YEP F;  1SJE D;  4NZL B;  5T8I A;  2G9H D;  1WGK A;  1Q10 A;  5I4D A;  3O13 A;  4HKZ E;  3AE6 B;  4N6E B;  1IBX B;  4WWM A;  2GRI A;  4HKQ A;  1RWS A;  3LXF A;  1VRA B;  4L2Y A;  3P4S B;  2RMM A;  1SE4 A;  2IJ0 A;  2NMQ A;  2QIL A;  2K3U A;  1FXA A;  2WLB A;  3LYY A;  4ARC A;  1H7X A;  2W54 A;  1V1O A;  1QOA A;  1VZ7 A;  1L6U A;  4WH4 A;  3AEE B;  1F2R I;  1K52 A;  1WRI A;  5FKA C;  1E6E B;  2QIE B;  4WIP A;  3AV8 A;  1HQR D;  1I4G A;  3C8Y A;  4TQ1 A;  1TS5 A;  4ZOH C;  1KLU D;  2DWQ A;  1ZPS A;  3P4P B;  3EUB 2;  2MH7 A;  2CU3 A;  2WXH A;  3KWV A;  2IGD A;  4B0E A;  3AE7 B;  1V1P A;  2JQR B;  1RFK A;  4L23 A;  4WUR A;  3WCQ A;  2WXK A;  1TS3 A;  4L1B A;  2ACZ B;  2HDE A;  4RGT A;  1N5W A;  1IGC A;  2G1E A;  4US9 A;  5G5H A;  4WAF A;  1BUI C;  3AE4 B;  1UWX A;  2JU6 X;  1L4D B;  4KKI A;  1Y56 A;  3W2D A;  3J9C A;  1KRH A;  4WQM A;  1VJK A;  1QT9 A;  3ZJV A;  1CK1 A;  4OW0 A;  1TS2 A;  5EE1 A;  3W1S A;  3MC0 B;  1KFY B;  4TQ0 A;  1GTH A;  2KWD A;  4OZA A;  4RGM A;  5D3I B;  5HFY A;  2KMM A;  4YTP B;  1GOZ A;  4M0W A;  3KWL A;  1MPE A;  5FK9 C;  3RFZ B;  3R2T A;  1B9R A;  3HUI A;  3BK1 A;  2VZK B;  3MJ5 A;  2L83 A;  1RYJ A;  1CZP A;  5FR3 A;  1K50 A;  1N63 A;  2W55 A;  4JX1 C;  5BYS A;  1I4R A;  3TUO A;  1NI3 A;  1JML A;  1NYQ A;  2L1A A;  5BMI A;  1L5P A;  4AS1 A;  2Q5W D;  1QOG A;  1T6B X;  2QSD A;  2WXG A;  3AE9 B;  4AQ7 A;  2BS3 B;  2DYM A;  1EM7 A;  3DWG C;  4OZB A;  4XDD A;  2ON8 A;  4P16 A;  5AUI A;  1QQR A;  2INN E;  4YTM B;  2X38 A;  4MAC A;  1CQV A;  2WXI A;  4KX6 B;  1ACC A;  4RH6 A;  3W5V B;  1V1P B;  1P7F A;  2NTS A;  3P4R B;  3MP9 A;  4YTN B;  2V3P A;  1E7P B;  1HXY D;  3FAH A;  4RCO A;  3MFG A;  4J3O D;  2INP E;  1PFD A;  1I4Q A;  1K51 A;  1IGD A;  4IDI A;  4LK0 M;  1D6E C;  2QEJ C;  1VZ6 A;  3AH7 A;  3E9S A;  1E9M A;  1AWD A;  1A70 A;  1E0Z A;  2JX5 A;  4ZRQ A;  4YSX B;  3BZD B;  1D4B A;  1STE A;  1WSP A;  2WXQ A;  1D5X C;  1FNW A;  3CF4 A;  4YSY B;  5HHD G;  3VR8 B;  2V3N A;  4LLG M;  1XLO A;  4US8 A;  2BB5 A;  4LTU A;  1SB3 C;  2N7J A;  1JWM D;  2PMV A;  2I38 A;  1V8C A;  3RPF C;  2FUG 1;  1AYF A;  2R61 A;  4RF1 A;  2ONQ A;  2YEP B;  1SIJ A;  1YQ3 B;  1N5X A;  5H8Y E;  2BYT A;  1TYG B;  4XDC A;  1V97 A;  1NEN B;  3AEF B;  3Q8B A;  2JWU A;  3E56 A;  1MVK A;  1HZ6 A;  3BYT B;  1OQR A;  1PGB A;  2SEB D;  3AEB B;  1C4A A;  1XXG A;  2J42 A;  1KH0 A;  1FM0 D;  4RGO S;  3TEY A;  3N9Y C;  3AE1 B;  2N9K A;  1JWS D;  3BWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...