3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
3B2GA 1SIJA 1A70A 1V8CA 3AH7A 1YJIA 3NS1A 1ZOYB 3AE9B 4JX1C 1E10A 2BS3B 3SFDB 4C7YA 1YJJA 2H88B 2G1EA 1GT8A 3NVZA 5C2TB 2L52A 2W55A 3AE4B 1NEKB 1RYJA 1N5XA 1XLNA 2N0SB 2W3SA 5GXGB 4A9AA 1QOFA 2PVOD 3L4PA 4US9A 2WQYB 3ABVB 2WS3B 4YTMB 5EE1A 2KAJA 4ZHPA 4LTUA 1E0ZA 4C80A 3AEFB 4WQMA 2QIEB 5MPOA 1ZUD2 2MJ3A 3HVZA 3LB8C 1VLBA 3AMZA 2BT6A 1DOYA 1GPXA 3P4PB 2W54A 1TYGB 3HRDD 3W5VB 2WDVB 4JWSC 2EKIA 1E6EB 2Y5CA 4P6VF 1FO4A 1YQ3B 1L6UA 2CU3A 3CIRB 1E7PB 3B9JA 1JWBD 1IUEA 1KRHA 2MJDA 3AM9A 1R7SA 2MJEA 1N61A 1FIQA 1GTEA 3NRZA 5EE3A 1JRPA 3AEGB 1VJKA 3AV8A 3AE2B 3AE3B 1RWSA 3RPFC 1E9MA 3AEBB 1FFVA 3SFEB 1DOXA 1J7AA 1DOIA 1NYQA 1V97A 2BS2B 4YXDB 2L83A 2K5PA 2WLBA 1FXIA 3AECB 1N5WA 2WDQB 3AE6B 5H92C 4ITKA 3HUIA 1YQ4B 1PUTA 4USAA 3VR9B 2BS4B 2PIAA 3CWIA 1QT9A 3BIID 1QOGA 3P4RB 3P4SB 1GAQB 1NENB 3KWLA 4C7ZA 1QF6A 3P1MA 1SF0A 2DWQA 1N63A 1SB3C 1OFFA 1QOAA 3NVYA 1JQ4A 3FAHA 2K22A 3AE1B 1JW9D 5EE0A 1FRRA 1JWAD 3DWGC 4N59A 3W9CB 2ACZB 4YSZB 1JALA 2WU2B 1L5PA 1XO3A 3P63A 3WCQA 2PVGC 1ZXIA 1FMAD 1AYFA 3AB5A 1PFDA 2JQRB 2AX5A 2Q5WD 3AE7B 2DBYA 2JX5A 1KFYB 1GTHA 5AUIA 1NI3A 3VR8B 1OQQA 1XLOA 1WYGA 2OHFA 1WXQA 3AE8B 2WU5B 2K9XA 1XLPA 3AE5B 1TKGA 1TKYA 1TJEA 1QLBB 3ZYYX 2B76B 4YSYB 5C3JB 1N60A 4WWMA 2M56B 3AEAB 2FBWB 3PO0A 1RFKA 3DWMA 1WRIA 3LXFA 3AEDB 1FRDA 5AUKA 4JWUC 5H8YE 1FM0D 3B2FA 1H7WA 1B9RA 3W5UB 2M19A 1T3QA 1I7HA 4ZHOA 3VRAB 3AN1A 2KMMA 1H7XA 1N62A 1VDVA 4IDIA 4YTNB 4YTPB 4FXCA 1RM6C 4YSXB 1CJEA 3NVWA 4HRSA 3SR6A 3VRBB 1DGJA 3P4QB 2HTME 3ETRA 4YT0B 1KF6B 1AWDA 1JROA 2W3RA 2QJLA 5G5HA 1ROEA 1CZPA 2PKOA 1NYRA 1OQRA 1L6VA 1FXAA 4N58A 5G5GA 3AEEB 1TKEA 1NVID 4US8A 2E3TA 1J7CA 4KX6B 1XLQA 3FC4A 4ZOHC 4HROA 1ZP0B 1PDXA 1UWMA 3NVVA 2MH7A 1EWYC 1F0ZA 3CF4A 2WP9B 2CJOA 4N6EB 1QOBA 2H89B 2LEKA 2WDRB 3EUB2 1L0VB 5EE9A 1WWTA 1J7BA 1WGKA 1FFUA 2CJNA
chains in the Genus database with same CATH superfamily
3NS1A 2BS3B 1IBXA 1GT8A 1V81A 3C8YA 4HEA1 3LDZE 1N5XA 4ICVA 1I4RA 4US9A 3KUZA 5EE1A 1JWSD 3EFCA 4MGZE 5DCNA 1LXDA 1GC6A 5JHBA 4ZRJA 2VZKB 1YN5A 3HRDD 2DNFA 4WH4A 4HKZE 3CIRB 1MG4A 3TEWA 1SE2A 1D5XC 1L0XB 4A55A 5C23A 2D2QA 4N9F4 2L0FA 3ZTDA 1D5ZC 3QWZB 3HUIA 3N9YC 1WF9A 3VR9B 1FEHA 2KQ4X 3U30A 2WHIA 2V0GA 1QOAA 3Q3NC 3OG5A 1WXAA 2ZVOA 1HZ5A 1D6EC 1F2RC 2WXQA 4EE2A 2FUHB 2JX5A 2NBVB 2K9XA 3KYCD 3ML8A 3L0WB 3URYA 4HDQA 3RNEC 1T0RC 2LGIA 3Q2AC 3PRZA 1NI2A 4ZRIA 2J0KA 1STEA 3VH4B 2D3AA 5GMVA 4FBJB 2JZ3B 3TEZA 2RGFA 1UWMA 2MH7A 3FKYA 2N4FA 3TJPA 5EE9A 2MBHA 1FFUA 3PLUA 1ZOYB 1C3TA 1M94A 3AE4B 1HEZE 5IO9A 3L13A 3HVZA 1WX7A 3P4PB 3W5VB 2Y5CA 2BF8B 2BYEA 1E7PB 4EKUA 1N61A 1P7EA 4RMAA 1V1OA 1EM7A 2K8BA 1OTRB 1V80A 3L54A 1DOIA 2PJHA 3BWUD 3AECB 3OLMD 1JMLA 1WZ0A 1KLVA 1QF6A 3HHMA 5D3IB 1ET6A 3ZRFA 1QKZA 1UF0A 2K22A 1MHXA 4NAWB 5LXHA 3W9CB 2V3NA 4HPPA 1HZ6A 2MEKA 3IG3A 1IGDA 2Y3AA 2WX0A 2A5UA 2N1WA 3PHWB 2AQ3B 1V2YA 4NPNA 1F1HA 3U4EG 2D10A 5LLIA 3EHVA 2WXNA 5AZHA 1WXMA 2UU7A 4AJYB 2IJ0A 2LFIA 1RM6C 2W82A 3KQ4A 1JROA 2W3RA 2KJ6A 1E8WA 2GBNA 1FXAA 1HXYD 4IM2A 2R2QA 4FJYA 3VH3B 4ZOHC 2G4DB 3IT6B 1FCLA 1I4GA 2KJRA 1Z5SB 3K9OB 4IM3A 2IBIB 3Q8BA 3RD2A 5FK9C 2MBQA 1E10A 2DAJA 5C2TB 1WH3A 4L1BA 4DHZB 2KN5A 1XLNA 3Q6BA 4W9FA 4K3BA 2QMTA 1U4AA 4KIKA 2PLPA 3SD5A 3BYTB 2WXOA 3H1UA 1WJNA 4A20A 3MHZA 4G11A 5BYSA 1YMHE 3B9JA 2MJEA 1KM7A 3TBLD 4AUQC 3X23A 3QCAA 4GDLB 1MVKA 3VTWA 2KDBA 1FXIA 1WXSA 2I38A 2IO3B 1WGRA 1SE3A 4EZJA 2FE8A 3X0WA 1N63A 1KH0A 3SHQA 2UWQA 2N9LA 1JQ4A 2NCNA 5DPRA 1JRUA 3KW5B 4TSSA 4WJNA 2Q5WD 2JQRB 3M62B 1YX5B 2V9HA 1M4VA 2G9HD 1SJED 4W9EA 3NS8A 1R4NB 3PV1A 1TZOA 3Q8EA 2JYTA 4G50A 2D07B 3DQVA 3DVGX 2HJ8A 2KC2A 4BOZB 3HM3A 4S17A 4E3CA 3R7QA 4AP4C 3RUIB 4EFOA 1I42A 2NVUI 2ZNVB 1TKEA 1BUIC 1XQQA 1WGKA 1SIJA 1A70A 2PE9A 2NPTA 4XGAB 4ZRKA 1L4DB 2IPKD 5KHQA 2INPE 2O6VA 4LTUA 3KH0A 2WGSA 3QK0A 1VLBA 1TTNA 2W54A 1L6UA 2D11A 3NY5A 3A9JB 3Q69A 4K7UA 2D5GA 1HTQA 3ZDMC 2C7NB 3PT2B 3AE2B 1LM8B 3O65B 1SBBB 2BWFA 1MHHE 1NYQA 2L83A 3NG0A 4DK5A 1J0GA 5H92C 4ITKA 4TUUA 3UQBA 1LO5D 1KOTA 3CWIA 2KDFB 1V6EA 3APCA 4KKIA 4MSQB 4C7ZA 2BBCA 4IUMB 1MFWA 3DVGY 3FAHA 4LNIA 2N9EB 2JVCA 5IKCM 2KZRA 3PSEB 4MGYE 1KFYB 4MELA 4OVUA 3S2AA 2FCMA 4M01A 3B1LX 4W9LA 2BGFA 2K25A 4R3DA 3OAWA 1N60A 2WXRA 2M56B 4ICUA 3AI5A 4JIOU 3PO0A 3DWMA 1WRIA 1WGHA 3ALBA 1CK1A 3MJWA 3W5UB 1YD8U 4ZHOA 3DDCB 1VDVA 1YIWA 2PKOA 2ZW1A 4TV3A 4GN1A 1FNUA 1LQBA 4HROA 1RRBA 3N20C 4PT5A 1TS4A 3VFKA 2GOWA 4MGKE 1V5TA 2JUOA 3MJ5A 2LJIA 2EKEC 4J3OD 2CS4A 1I4QA 4P1BC 4PYUA 2KT7A 1YN4A 3Q8AA 5AEKB 1BXTA 1BMLC 2BT6A 5IN7A 1H4RA 2JYEA 4JWSC 4DQOC 3RZWC 3ZJTA 5G2NA 1KRHA 1JWUD 2ZJDA 2IGGA 1JRPA 3HM6X 3BYYB 3BY4B 3DBLI 4ACFA 2UYZB 2LUMA 4I6LB 2PIAA 3SEBA 1MPEA 3NZ3A 4MDKE 5DPSA 4GDKA 2KLGA 4CO7A 3VTUA 4MM3A 1T6BX 5IA7A 4X57B 4EUTA 3P63A 1ENFA 1WM3A 2J0MA 4WQOB 5FR3A 1L2NA 1T5XD 4F8CB 4OVVA 3TL5A 1WXQA 5C3JB 2MBOA 2FIDA 3TIXA 3VQIA 4K1RB 4MEMA 2R2OA 5FKAC 2M19A 3OJ4B 1WX9A 1BT0A 4II2B 4OZBA 1CJEA 3RNGC 2KWCA 3P4QB 2LGYA 5G5HA 2BTEA 1VZ7A 2IO1B 1WX8A 3R2TA 1E8YA 4FHKA 1E7VA 2V4IB 1QILA 1L0YB 3FC4A 5I4DA 1E8ZA 2KACA 2L05A 1MG8A 1YN3A 5DPWA 1WE6A 2IY0B 2L7RA 2KDMA 2V3SA 2LASA 4JX1C 2AWTA 1XT9B 2D3BA 4BKSA 1TS5A 3ZRCA 2NPTB 4A9AA 2ZPNA 4WURA 4RGOS 2FAZA 3NJTA 2FCSA 4LNOA 3QHTA 4DWFA 1UH6A 5AZFA 1DOYA 4TKNA 1GG3A 3UGBB 1P7FA 4K7WA 4JE3B 1WR1A 2YVCA 2MSED 3KYDD 4E71A 4BKTA 3PZ8A 3NRZA 2E6XA 3ZUNA 3ZXRA 4F7ZA 1ET9A 2N9KA 1GUAB 2YLMA 4IW0A 1QQRA 4P16A 3QAQA 2EELA 3RN9C 3SFEB 2NTSA 4GLSC 2J53A 3ZJVA 4WJPA 2WDQB 1YQ4B 1VD2A 2BS4B 4LNNA 2LXCA 3KWLA 1QOGA 3DHHC 2N9XA 5HI1A 5JHAA 1J19A 1ISNA 3C19A 2LRWA 3ENEA 4IM0A 2NS5A 1PGXA 3DPDA 1V86A 1XO3A 2WU2B 4M0WB 4Q2JA 4PS3A 2D3GA 1TGZB 3H7SA 4K81A 3U2SC 5KHOA 4P1CC 1SSNA 4IG7B 3PGEA 2LGXA 2QDFA 3I3TB 4BZAA 1RFKA 5AUKA 5IAAC 2CU1A 4IKGA 4M00A 2KDEB 1T0QC 1SEBD 1WR6E 2QSDA 5CX3A 4FXCA 3SR6A 3VRBB 5J2RA 1PGBA 4N58A 3I57A 1WGYA 2KVZA 5J17A 3ZQ4A 4IWQA 3NVVA 3JSVB 1L0VB 1WWTA 4DXGA 2J0JA 3PHXB 1ZGUB 3B2GA 4M8MA 4DDGD 2KMAA 2H88B 1G6JA 1I35A 3V6CB 4IC7B 3P42A 1RYJA 2DZKA 4BBNF 4IWOA 1MJDA 3RNCC 2SEBD 3IAS1 5BMIA 3JYUA 3R3MA 1WJ6A 4PS8A 3UIOB 2QC8A 1IUEA 3RNAC 1PGAA 1FIQA 2JZZA 2JZPA 1YJ1A 4IOIE 2JWUA 2NTTA 4YXDB 1FD6A 1N5WA 2KQ7A 1PUTA 5G55A 2C60A 3M3JA 3TMPB 3BIID 5DPTA 3HVDA 1S1QB 1SB3C 3VUWA 1D4BA 3QA8A 1P0RA 4K3CA 2Z0EB 3QARA 1AYFA 1E7UA 1PFDA 1LGRA 2WWZA 4MJSA 4CYEA 2DBYA 3U7ZA 1ZDVA 4HKQA 1FXTB 4KZCA 3E56A 2CR5A 2LJ5A 4TQ0A 1XD3B 4JWUC 3B2FA 1H7WA 3VUYA 3BK1A 1I7HA 3VRAB 1P1AA 4BVUC 2ZW0A 1GC7A 2DLBA 4WAFA 4W9GA 2C5LC 1EWCA 3L17A 3BZDB 4NJCA 2WNMA 3R7RA 4US8A 5HHDG 2I1JA 4HCPB 3ZGZA 2LEKA 5IP4D 1XCTL 3LYYA 1CQVA 4C80A 1TY0A 3EECA 2CHZA 3ZO5B 3AE9B 4BOSC 3SFDB 3IBEA 2D3CA 4NAWA 2L52A 1NEKB 5FR6A 3U7DA 3QQ8B 3UINB 2C9WB 5LNK1 3MTNB 5D7GA 3AEFB 2M0AA 2M17A 4OZAA 2N9PC 4HJGE 2NMQA 3A4RA 3AU4A 3DHGC 3RNBC 5JXVA 1IPGA 2EKIA 4TMAB 2GMIC 2G4SA 4MM3B 2FCNA 3H6NA 1GTEA 3H8HA 3H7PB 4GMVA 3AV8A 3AE3B 4YWGG 1RWSA 4PK1A 2QILA 2L00B 4LLGM 2KN4A 2HD5B 2BYVE 2JSVX 2MWSB 4WAAA 2M4NA 3MFGA 1GAQB 1YOVB 3H7PA 1ZE3D 3A4SC 3BINA 2ASQA 3EA6A 3IT4B 4YSZB 4AS1A 3W2DA 4A8XC 3MP9A 4HVBA 3AE7B 2DZIA 2LUEA 2LHEA 2MRPA 3ZVVA 3A1QB 4I6NB 1VZ8A 3AE5B 3KUCB 1QLBB 3PRPB 2BW2A 3V60A 3LXFA 3PZ7A 3GS2A 3AN1A 1ZKHA 3APFA 1C9FA 3A33B 2I2YA 3UF8A 2N1VA 1KF6B 3EFUA 5BYQA 1K52A 1NYRA 3D32A 3R8BA 2E3TA 4XX5A 1ZP0B 3EC8A 4OVZA 2IY1B 2RDHA 2CJOA 1K8RB 4RM9A 1J7BA 4JLCA 4D2KA 3N3KB 1YJIA 1IYFA 4NNJB 4MT5A 3ONSA 2IGDA 2MA9B 4CQNA 2K8CA 4KZ0A 1UWXA 2PE6B 4NZLB 4G0NB 2KXJA 2WS3B 2NBWB 2FCQA 2HTHA 2KAJA 2NR2A 1E0ZA 1UGJA 3V62A 3N1ZC 5HG2A 2O2VA 4ZYSA 3AU5A 2KWUB 4LK0M 5AZGA 2MBBB 2K39A 3VDZA 1F9JA 4XYCA 2AYOB 1E9MA 3AEBB 4A3PA 1IP9A 1HQRD 2HDEA 2RDBC 4USAA 2KX0A 2LHDA 2K6DB 4ARIA 4FADA 5EDSA 2M1MA 3GZNI 4GSWA 3A9JA 2WXHA 4AJWA 2BKRB 3U8ZA 2EMTA 4WWPA 2DYBA 5CTRC 2IO0B 2N7JA 4WJOA 2K0PA 1EU4A 3TSSA 1XLPA 1Q5WB 4CHKA 2FBWB 2BPSA 1FRDA 1R4MI 2ZZPB 4DXFA 5CHFA 2DYMA 3ML9A 3NVWA 1DGJA 1C79A 4YT0B 1UBIA 2CHXA 2TSSA 2KMCA 2QJLA 3ZXVA 1SJHD 4BFRA 2WYQA 3APDA 1WY8A 5G5GA 3OJ3A 2X38A 3DBHB 5LXIB 2KNBA 2N7EA 1TT5B 1SXTA 1TIFA 1GJZA 2GRIA 4L23A 4TQ1A 1EUVB 3GP7A 4FA6A 4C7YA 1WFYA 3NVZA 2ICIA 4JQWC 4LJOB 4GOCA 1I4PA 2JF5A 3TEXA 3RZFA 2ZPYA 1KTKA 4A90A 3N30A 1GNUA 2ONQA 3Q3MC 2QIEB 4H2AA 2RDGA 2KTRA 3E9SA 1K51A 1WGGA 1NBFC 3NZSA 2LGDA 2L8JA 2LVQA 3ZNID 2QEJC 4ZDVA 4KV2A 4ANWA 1HTOA 1FFVA 3DHIC 4C4VB 2BS2B 1KLGD 3SU8X 2K5PA 1K53A 3R66C 5C1ZA 2RSUA 4URKA 1ZDXA 4G3XB 1D5MC 3N1XC 1UNSA 1OFFA 2L1AA 5EE0A 1FRRA 3PRMB 1XXGA 3L08A 3KVFB 4RF0A 2ZVNA 2QHOA 3MC9A 2NBUA 3I63C 2O6VB 1HA5A 4HPLB 4KVGB 1EO6A 2XK5B 2B76B 2KANA 1AN8A 3TUOA 2KK8A 3ZNHB 4GU2A 2M0XA 4J6IA 2BYTA 4FULA 3T3OA 1H7XA 2GBKA 1FPYA 1OGWA 1FNVA 1AWDA 2MLBA 2K3UA 2KHWB 1CZPA 4DHJB 4HK2A 1YNTE 2GBJA 1C4PA 2RPQA 3I9V1 4L2YA 1GB1A 1VRAB 2AQ2B 2JRHA 4HLEA 2WDRB 2IDYA 3IXSA 3BK2A 2MQJA 2KO3A 4HDOA 2OJWA 1JCKB 1UD7A 2G1EA 5J18A 3DBLB 5D3DA 2Y5BB 2M8SA 1J8CA 3VTVA 4RCOA 2OJRA 4K7SA 2WDVB 1E6EB 1ZW7A 4O1NA 1YQ3B 2QCZA 2WXKA 3IVFA 2IZVB 3CMMB 3AM9A 4GDKB 3ZLZA 3AEGB 1E90A 5CHVC 3N1YC 2MW5A 2KDIA 1Q0WB 1ZPSA 1V97A 1TY2A 1YQBA 2WLBA 4ANVA 4EOYA 1UGMA 4AOFA 2JRIB 4FJZA 1C76A 1JWMD 2W9NA 1NENB 1SE4A 2J4XA 1C77A 2MBEA 2AL3A 1XEEA 2I1KA 4N59A 4KGSA 2KWDA 1C78A 4XE0A 5T8IA 3HIZA 4KIKB 1WYGA 3RT3B 2WU5B 5E6JA 3PTFC 1KLUD 3V6EB 4M02A 1WJUA 4XDDA 1OQYA 1FM0D 2RD0A 4NJ6A 4F1SA 4BKGA 3GZNB 2KMMA 4MH8A 3UQAA 3CSFA 4OZCA 3BVGA 2IO2B 1P3QU 3V61A 4FHJA 2DX5B 4I6PA 2EMSA 2INNE 1NVID 1J7CA 2GBMA 1RAXA 3CF4A 4A6QA 4ZRPA 4N6EB 2R61A 2WXGA 1DYQA 2PW9A 2KFKA 1YX6B 3WANA 4OHJA 1GOZA 2L76A 2IYDB 3ZDTA 2RPVA 4HJKA 4ANXA 2W3SA 3L4PA 4RGMA 4W9HA 2XBBC 3QC8B 3PREA 3DBSA 4DHZE 4WQMA 1SIFA 4GXBA 4C00A 2LWPA 4P6VF 1FO4A 2MX2A 3WAOA 3N32A 1F77A 3B08A 4BAXA 3SDLC 2XEWA 1ESFA 1Y8RC 2IGHA 2G3QB 1V5OA 5HKHA 1J7AA 1B1ZA 3L10B 1Q1OA 2BKFA 4MJSB 2MCNB 4JGHB 1WYWB 1C4CA 3PVLA 4NY0A 3DBRI 2WXFA 2DWQA 3MC8A 1S3SG 2DZJA 3ZJUA 4LDTD 2PVGC 3OWEB 4NAMA 2WX1A 2VRRB 3PS6A 4FN2A 4XC2A 1P9DU 1OEYJ 2VH1A 3DCGA 1RFAA 2LVPA 3ZYYX 3RMKC 3V05A 4GGQA 4GIVA 4HXDA 1TBEA 3W1YA 3VAWA 2J7QB 1R4MB 2WXMA 2BB5A 2AEHA 1UZXB 1ROEA 2BYFA 4HWIB 3Q3OC 3U52E 1N6ZA 3T8MA 4KX6B 2LI5A 1T0SC 3DBHI 1PDXA 1TS3A 1F52A 3ZNZB 3FILA 4XWTA 2HTME 3CF6E 1KJTA 4RF1A 3GE8C 3HK0A 2JU6X 4RNAA 2JT4B 2RR9A 2WDTB 3VVWB 2DZMA 1QOFA 4M8NA 4EEWA 5D94A 1WMHA 1A5RA 1K50A 4MACA 4B6WA 1CMXB 3LB8C 3WA0A 3AMZA 3DVNV 1TYGB 3EGRA 2FUG1 2L3ZA 4ANUA 1ACCA 1MI0A 2ZNVC 4IWPA 3IFWB 2JXXA 2KWVB 4REZA 5JZEB 3DVNU 4NQLB 2ZCCA 2KTRB 1WSPA 3J9CA 3NZUA 4PYZA 2KTFA 3P4RB 4ZRQA 1WMHB 2PMVA 2INDC 3P1MA 2Y5PA 3WALA 4W9DA 4FLHA 2KC1A 2N7DA 2ACZB 1JALA 4UDUC 3A9KB 1FMAD 1C1YB 4AQ7A 2RMMA 2BQQA 3T3NA 1UELA 1TZ1A 3BVZA 1NI3A 3VR8B 3NHEB 4RGNA 4LCDE 1TKGA 1TKYA 3R2IA 4WWMA 3AEAB 2ZCBA 2BB6A 5H8YE 4QAYA 2OOBB 1I4HA 4RM8A 1WM2A 2V4LA 3IAM1 4DDID 4W9JA 5L95C 4HRSA 2LGSA 2KLCA 2V1YA 2CHWA 4DHJD 3ZNGC 1L6VA 4BBNC 1F0ZA 2REXA 2WP9B 3M63B 4C56C 3ZTCA 2BWES 3Q8FA 2KVRA 1UBQA 1E8XA 5BMGA 3ZKJC 2Z0DB 2BVCA 4FJVB 2W55A 2O6VD 1PQSA 3BVMA 2N0SB 2WXPA 1AW7A 2WQYB 4YTMB 3Q3JA 1GB4A 3NUHB 3PZDA 4ZHPA 4WJQA 5MPOA 3O13A 1GPXA 4MH0E 1C4AA 4C4VA 2B3AA 4B95A 2DHZA 1WE7A 2KQSA 1EU3A 5L83A 1JWBD 1WZ3A 1V1PB 2K1FA 5EE3A 1EF1A 1WXVA 2INCC 2KD0A 3AE6B 2O2VB 2ZEQA 4W9KA 3QJZA 4GDLA 3M95A 4W9CA 4KSKC 4RH6A 3MHSD 3P4SB 4WIPA 1SF0A 3VXWA 1HE8A 2GLSA 3NVYA 2XNAC 4B0MA 1LFDA 1JWAD 1L5PA 3WCQA 3V3XA 4RGTA 2AX5A 1WIAA 3GE3C 2PTLA 1WJ4A 5AUIA 2PEAA 1OQQA 2LD9A 2DAFA 5CHWA 4OW0A 1TJEA 1VR9A 2JXTA 3DBRB 4LJPB 1E5WA 1B9RA 1WRDB 5BO4B 1N62A 4MGIE 1L4ZB 4KKJA 2DENB 2A4ZA 4M0WA 3ECIA 3WAPA 1OQRA 3Q14C 3MC0B 4P7IA 2YEPB 2ON8A 4B0EA 2LRUA 1SE9A 2H89B 3A1QA 1EF5A 2CJNA 5E6OA 2GB1A 1V8CA 4XDCA 3AH7A 1I4XA 3H9DA 3Q8CA 1VZ6A 1PYWD 3B0AA 5GXGB 2PVOD 3ABVB 3TCAA 4WWOA 4LNFA 1F2RI 1Q10A 4DXAB 2KJHB 1TS2A 2PPHA 4EZKA 2CU3A 1L7YA 2V3PA 3DOWA 2MP2A 2C7HA 3RFZB 4W9IA 2WXIA 3RPFC 4EZLA 4MSMB 3KUDB 3RNFC 4AWJA 4RFBA 1WI0A 2JWZA 4NJ7A 2KX3A 2VZKD 1T0YA 1V9JA 2MP2B 2WXLA 2XK5A 1V1PA 3TEYA 3UI3A 3AE1B 1JW9D 2GBRA 3GOEA 5BYRA 2XN9C 2KFKB 3RI7C 1ZXIA 3LJ3A 2WXJA 2MHJA 3A9KA 3K9PB 3QIJA 2C7MB 4II3B 1XLOA 2K8HA 3AE8B 2CKHB 1UUPA 2G45B 4DBGA 3KWVA 3WIMA 1T3QA 3W1SA 1FNWA 3CSTA 4IDIA 3QX1A 1FCCC 4YSXB 2HE7A 5TSSA 3ETRA 4ZYNA 1VCBA 5BMHA 1R4NI 4XZ4A 2VH2A 1H8CA 2JPHA 3C0RB 1XLQA 2JY6A 1EWYC 4A3OA 3JW0X 3EUB2 2KFJA 3Q3FA 4KDLB 1OEYA 1ZXHA 5TR5A 4NQKE 1NDDA 1YJJA 3I5JC 1WGDA 2FIFA 4GB9A 4LDTB 2K6QA 1XCQL 1V49A 2J42A 3RULA 2X8XX 3ZW3A 1P98A 4JPSA 3WAMA 4LNKA 4ARCA 3KLSX 2LXAA 1ZUD2 2MJ3A 1AARA 3FILB 5D6JB 2AL6A 3P2BA 3RYTA 4B9KA 3L16A 5JH5C 1XF5L 4PS7A 4JL9A 2MJDA 1R7SA 2J52A 4HPMB 3VUXA 2KKCA 4KGRA 4BKSD 4S0RA 1VJKA 3NOBA 3T9LA 1QZEA 1DOXA 3PPAA 5E6NA 2LVOA 2YEPF 3IHPC 1QT9A 4E74A 5HFYA 3RCZA 1RLFA 2KYWA 2AQ1B 5E6PA 4KSLC 3DWGC 4XWWA 3AXCA 4WWNA 3AB5A 3ZIMA 1GTHA 2Z59B 2LZ6A 2OHFA 1D3ZA 5D2MB 2SAKA 3JSVA 2Z8LA 3W1SC 1X1MA 4YSYB 2KOXA 2OEDA 1Z2MA 4HCNB 2L0TA 3AEDB 1SGHA 2LMCA 1IBXB 5IOIA 4YTNB 4YTPB 3GB1A 2FNJB 3VHTC 3JVZX 3UIPB 2DYOA 2GI9A 3PLVA 4ASWC 3AEEB 1IGCA 2L32A 3AULA 4KGTA 1QOBA 4YL8A 1Y56A 2HJ1A 4KDIC
chains in the Genus database with same CATH topology
4RF1A 3NS1A 1YJIA 2JU6X 2BS3B 4MT5A 3MJ5A 1IBXA 2LJIA 1GT8A 4J3OD 4RNAA 3C8YA 2IGDA 4HEA1 4CQNA 1N5XA 1UWXA 1I4QA 1I4RA 1QOFA 4US9A 4NZLB 2WS3B 5EE1A 2KAJA 1JWSD 1K50A 4MACA 1E0ZA 1UGJA 1YN4A 3Q8AA 1BXTA 3LB8C 1BMLC 3AMZA 2BT6A 5HG2A 3EGRA 1TYGB 2VZKB 1YN5A 3HRDD 4WH4A 2JYEA 4JWSC 4ZYSA 2FUG1 4DQOC 4HKZE 4LK0M 3CIRB 3ZJTA 3TEWA 1SE2A 1D5XC 1KRHA 1JWUD 1ACCA 1L0XB 1MI0A 4A55A 2IGGA 1JRPA 4REZA 3BYYB 1E9MA 3AEBB 1HQRD 2LUMA 1D5ZC 2HDEA 3HUIA 3N9YC 4USAA 3VR9B 1WSPA 2PIAA 3J9CA 1FEHA 3SEBA 2KQ4X 1MPEA 3P4RB 3NZ3A 4ZRQA 2PMVA 2V0GA 2LHDA 3P1MA 4ARIA 2Y5PA 1QOAA 1T6BX 2WXHA 2ACZB 3P63A 1JALA 1HZ5A 4UDUC 1FMAD 1ENFA 4AQ7A 2RMMA 1D6EC 1F2RC 2WXQA 4EE2A 5FR3A 3T3NA 2N7JA 2JX5A 1T5XD 3BVZA 1NI3A 3VR8B 2K0PA 1EU4A 4RGNA 1WXQA 3TSSA 2K9XA 1XLPA 1TKGA 1TKYA 3R2IA 5C3JB 3URYA 3VQIA 4WWMA 3AEAB 2FBWB 2LGIA 2BB6A 5H8YE 1FRDA 1I4HA 5FKAC 2M19A 4OZBA 3IAM1 4DXFA 2DYMA 1CJEA 4HRSA 3NVWA 1DGJA 3P4QB 1C79A 1STEA 4YT0B 2TSSA 5G5HA 2BTEA 1VZ7A 2QJLA 1SJHD 3R2TA 2V4IB 1L6VA 1QILA 5G5GA 1L0YB 2X38A 3FC4A 5I4DA 3TEZA 1UWMA 1F0ZA 2MH7A 2WP9B 2KACA 1SXTA 5EE9A 1YN3A 4C56C 1FFUA 3Q8FA 2GRIA 4L23A 2KDMA 4TQ1A 3GP7A 1ZOYB 4JX1C 5BMGA 4C7YA 3NVZA 2ICIA 2W55A 1TS5A 3AE4B 3BVMA 1I4PA 2N0SB 4A9AA 2WXPA 3TEXA 1AW7A 1HEZE 4WURA 2WQYB 4RGOS 1KTKA 4YTMB 4A90A 1GB4A 3NUHB 4ZHPA 2ONQA 2QIEB 5MPOA 3HVZA 1DOYA 3O13A 4H2AA 2RDGA 1GPXA 1P7FA 3P4PB 1C4AA 3E9SA 3W5VB 1K51A 2Y5CA 4JE3B 1E7PB 1EU3A 1JWBD 1V1PB 1N61A 1P7EA 1V1OA 3PZ8A 3NRZA 1EM7A 2QEJC 2E6XA 5EE3A 1ET9A 2N9KA 1QQRA 4P16A 2EELA 1FFVA 3SFEB 2NTSA 1DOIA 2BS2B 2J53A 1KLGD 2K5PA 4GLSC 3ZJVA 3BWUD 3AECB 2WDQB 3AE6B 1K53A 1YQ4B 2BS4B 1JMLA 1ZDXA 4RH6A 1QOGA 3KWLA 3P4SB 4WIPA 5D3IB 1QF6A 5HI1A 1SF0A 1ET6A 1D5MC 1QKZA 1UNSA 1OFFA 2L1AA 3NVYA 2XNAC 4B0MA 2K22A 1MHXA 5EE0A 1FRRA 1JWAD 4NAWB 3W9CB 1PGXA 2V3NA 1XXGA 1XO3A 2WU2B 1L5PA 4Q2JA 3WCQA 1HZ6A 4RF0A 3V3XA 2MEKA 2AX5A 4RGTA 1IGDA 2Y3AA 3U2SC 2PTLA 5AUIA 1OQQA 1SSNA 2AQ3B 1HA5A 4OW0A 1TJEA 2B76B 1VR9A 2JXTA 3U4EG 1AN8A 3TUOA 1RFKA 5AUKA 2WXNA 4IKGA 2BYTA 1B9RA 3T3OA 1SEBD 2QSDA 1H7XA 1N62A 2IJ0A 2LFIA 1L4ZB 4FXCA 1RM6C 2W82A 3KQ4A 3SR6A 3VRBB 4KKJA 1FNVA 1AWDA 1JROA 2K3UA 2W3RA 4M0WA 1CZPA 1OQRA 1PGBA 1YNTE 1FXAA 1HXYD 4N58A 3MC0B 3I57A 1C4PA 3I9V1 4L2YA 1GB1A 1VRAB 2ON8A 2YEPB 3IT6B 4ZOHC 4B0EA 2AQ2B 1FCLA 3ZQ4A 3NVVA 2H89B 2WDRB 1I4GA 1L0VB 1WWTA 2IDYA 4DXGA 3Q8BA 2CJNA 5FK9C 2GB1A 3B2GA 3IXSA 1V8CA 3BK2A 4XDCA 3AH7A 1I4XA 1E10A 1JCKB 3Q8CA 2H88B 2G1EA 5C2TB 1VZ6A 1PYWD 4L1BA 3P42A 1RYJA 1XLNA 5D3DA 5GXGB 2PVOD 2QMTA 3ABVB 1F2RI 2PLPA 1Q10A 2SEBD 3IAS1 3BYTB 4RCOA 5BMIA 2WXOA 2WDVB 1E6EB 4O1NA 1TS2A 1YQ3B 2CU3A 2WXKA 3MHZA 5BYSA 1YMHE 3B9JA 1IUEA 1PGAA 3AM9A 2MJEA 2V3PA 1FIQA 4GDKB 3AEGB 3RFZB 2WXIA 3RPFC 4GDLB 2JZPA 1MVKA 4IOIE 1ZPSA 1V97A 1TY2A 2JWUA 2NTTA 4YXDB 2WLBA 1FXIA 1FD6A 1N5WA 2I38A 4RFBA 1PUTA 1SE3A 3BIID 1C76A 1JWMD 2VZKD 3HVDA 1NENB 1SE4A 2WXLA 2J4XA 2FE8A 1N63A 1KH0A 1SB3C 2N9LA 1C77A 1V1PA 1JQ4A 3TEYA 3UI3A 1D4BA 3AE1B 1JW9D 1XEEA 4N59A 4TSSA 4KGSA 2KWDA 5BYRA 2XN9C 1C78A 1ZXIA 1AYFA 4XE0A 1PFDA 2JQRB 2Q5WD 2WXJA 5T8IA 2DBYA 1M4VA 2G9HD 1SJED 3U7ZA 1TZOA 1XLOA 1WYGA 1ZDVA 3Q8EA 4HKQA 3AE8B 2WU5B 2JYTA 5E6JA 1UUPA 3E56A 1KLUD 4TQ0A 3KWVA 4XDDA 4JWUC 1FM0D 3B2FA 1H7WA 3BK1A 1T3QA 1I7HA 3VRAB 3W1SA 2KMMA 1FNWA 4MH8A 4IDIA 1FCCC 2ZW0A 4YSXB 4OZCA 2DLBA 4WAFA 5TSSA 3ETRA 3BVGA 5BMHA 1EWCA 3BZDB 4NJCA 2WNMA 1TKEA 2INNE 1NVID 4US8A 1BUIC 1J7CA 1XLQA 5HHDG 1EWYC 3CF4A 3ZGZA 4A6QA 4ZRPA 4N6EB 2LEKA 3EUB2 1XCTL 2R61A 2WXGA 3LYYA 1CQVA 1WGKA 1DYQA 4C80A 1TY0A 1SIJA 1A70A 1ZXHA 2PW9A 3AE9B 3SFDB 1YJJA 4OHJA 1GOZA 2L52A 2RPVA 1NEKB 2W3SA 1L4DB 1XCQL 3L4PA 2IPKD 4RGMA 2INPE 2J42A 4JPSA 5LNK1 4ARCA 4LTUA 3KLSX 5D7GA 3AEFB 2M0AA 2NMQA 4OZAA 4WQMA 4HJGE 1ZUD2 2MJ3A 3FILB 1VLBA 4D2KA 2W54A 5JXVA 2EKIA 4P6VF 1FO4A 4TMAB 1L6UA 1XF5L 3Q69A 1F77A 2D5GA 4MM3B 2MJDA 1R7SA 2J52A 1GTEA 1ESFA 3H8HA 4KGRA 2IGHA 1VJKA 3AV8A 3AE2B 3AE3B 4YWGG 1RWSA 1SBBB 2QILA 1MHHE 1DOXA 1J7AA 1B1ZA 1NYQA 2KN4A 2L83A 4LLGM 5H92C 4ITKA 2JSVX 1C4CA 2YEPF 1LO5D 3CWIA 1QT9A 4KKIA 3MFGA 4C7ZA 1GAQB 5HFYA 2BBCA 2WXFA 2DWQA 1ZE3D 3FAHA 2AQ1B 3DWGC 4XWWA 3ZJUA 3EA6A 3IT4B 4YSZB 4AS1A 3W2DA 2PVGC 3OWEB 4A8XC 3AB5A 3MP9A 3AE7B 4NAMA 1KFYB 2LHEA 1GTHA 2OHFA 1VZ8A 2SAKA 3AE5B 2Z8LA 3ZYYX 1QLBB 4R3DA 4YSYB 1N60A 2OEDA 2BW2A 2WXRA 2M56B 3PO0A 3DWMA 1WRIA 3LXFA 3AEDB 2LMCA 3V05A 1IBXB 3PZ7A 1CK1A 3W5UB 3GS2A 4ZHOA 3AN1A 1VDVA 2WXMA 1C9FA 4YTNB 4YTPB 2BB5A 2I2YA 3GB1A 1KF6B 1ROEA 2DYOA 2GI9A 2PKOA 2ZW1A 5BYQA 1K52A 1NYRA 3U52E 1FNUA 3AEEB 3R8BA 2E3TA 4KX6B 4HROA 1ZP0B 1PDXA 1IGCA 2L32A 4OVZA 1TS3A 2RDHA 4KGTA 2CJOA 1QOBA 4PT5A 1TS4A 3FILA 1J7BA 1Y56A 4XWTA 2HTME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B2G A;  1SIJ A;  1A70 A;  1V8C A;  3AH7 A;  1YJI A;  3NS1 A;  1ZOY B;  3AE9 B;  4JX1 C;  1E10 A;  2BS3 B;  3SFD B;  4C7Y A;  1YJJ A;  2H88 B;  2G1E A;  1GT8 A;  3NVZ A;  5C2T B;  2L52 A;  2W55 A;  3AE4 B;  1NEK B;  1RYJ A;  1N5X A;  1XLN A;  2N0S B;  2W3S A;  5GXG B;  4A9A A;  1QOF A;  2PVO D;  3L4P A;  4US9 A;  2WQY B;  3ABV B;  2WS3 B;  4YTM B;  5EE1 A;  2KAJ A;  4ZHP A;  4LTU A;  1E0Z A;  4C80 A;  3AEF B;  4WQM A;  2QIE B;  5MPO A;  1ZUD 2;  2MJ3 A;  3HVZ A;  3LB8 C;  1VLB A;  3AMZ A;  2BT6 A;  1DOY A;  1GPX A;  3P4P B;  2W54 A;  1TYG B;  3HRD D;  3W5V B;  2WDV B;  4JWS C;  2EKI A;  1E6E B;  2Y5C A;  4P6V F;  1FO4 A;  1YQ3 B;  1L6U A;  2CU3 A;  3CIR B;  1E7P B;  3B9J A;  1JWB D;  1IUE A;  1KRH A;  2MJD A;  3AM9 A;  1R7S A;  2MJE A;  1N61 A;  1FIQ A;  1GTE A;  3NRZ A;  5EE3 A;  1JRP A;  3AEG B;  1VJK A;  3AV8 A;  3AE2 B;  3AE3 B;  1RWS A;  3RPF C;  1E9M A;  3AEB B;  1FFV A;  3SFE B;  1DOX A;  1J7A A;  1DOI A;  1NYQ A;  1V97 A;  2BS2 B;  4YXD B;  2L83 A;  2K5P A;  2WLB A;  1FXI A;  3AEC B;  1N5W A;  2WDQ B;  3AE6 B;  5H92 C;  4ITK A;  3HUI A;  1YQ4 B;  1PUT A;  4USA A;  3VR9 B;  2BS4 B;  2PIA A;  3CWI A;  1QT9 A;  3BII D;  1QOG A;  3P4R B;  3P4S B;  1GAQ B;  1NEN B;  3KWL A;  4C7Z A;  1QF6 A;  3P1M A;  1SF0 A;  2DWQ A;  1N63 A;  1SB3 C;  1OFF A;  1QOA A;  3NVY A;  1JQ4 A;  3FAH A;  2K22 A;  3AE1 B;  1JW9 D;  5EE0 A;  1FRR A;  1JWA D;  3DWG C;  4N59 A;  3W9C B;  2ACZ B;  4YSZ B;  1JAL A;  2WU2 B;  1L5P A;  1XO3 A;  3P63 A;  3WCQ A;  2PVG C;  1ZXI A;  1FMA D;  1AYF A;  3AB5 A;  1PFD A;  2JQR B;  2AX5 A;  2Q5W D;  3AE7 B;  2DBY A;  2JX5 A;  1KFY B;  1GTH A;  5AUI A;  1NI3 A;  3VR8 B;  1OQQ A;  1XLO A;  1WYG A;  2OHF A;  1WXQ A;  3AE8 B;  2WU5 B;  2K9X A;  1XLP A;  3AE5 B;  1TKG A;  1TKY A;  1TJE A;  1QLB B;  3ZYY X;  2B76 B;  4YSY B;  5C3J B;  1N60 A;  4WWM A;  2M56 B;  3AEA B;  2FBW B;  3PO0 A;  1RFK A;  3DWM A;  1WRI A;  3LXF A;  3AED B;  1FRD A;  5AUK A;  4JWU C;  5H8Y E;  1FM0 D;  3B2F A;  1H7W A;  1B9R A;  3W5U B;  2M19 A;  1T3Q A;  1I7H A;  4ZHO A;  3VRA B;  3AN1 A;  2KMM A;  1H7X A;  1N62 A;  1VDV A;  4IDI A;  4YTN B;  4YTP B;  4FXC A;  1RM6 C;  4YSX B;  1CJE A;  3NVW A;  4HRS A;  3SR6 A;  3VRB B;  1DGJ A;  3P4Q B;  2HTM E;  3ETR A;  4YT0 B;  1KF6 B;  1AWD A;  1JRO A;  2W3R A;  2QJL A;  5G5H A;  1ROE A;  1CZP A;  2PKO A;  1NYR A;  1OQR A;  1L6V A;  1FXA A;  4N58 A;  5G5G A;  3AEE B;  1TKE A;  1NVI D;  4US8 A;  2E3T A;  1J7C A;  4KX6 B;  1XLQ A;  3FC4 A;  4ZOH C;  4HRO A;  1ZP0 B;  1PDX A;  1UWM A;  3NVV A;  2MH7 A;  1EWY C;  1F0Z A;  3CF4 A;  2WP9 B;  2CJO A;  4N6E B;  1QOB A;  2H89 B;  2LEK A;  2WDR B;  3EUB 2;  1L0V B;  5EE9 A;  1WWT A;  1J7B A;  1WGK A;  1FFU A;  2CJN A; 
#chains in the Genus database with same CATH topology
 3NS1 A;  2BS3 B;  1IBX A;  1GT8 A;  1V81 A;  3C8Y A;  4HEA 1;  3LDZ E;  1N5X A;  4ICV A;  1I4R A;  4US9 A;  3KUZ A;  5EE1 A;  1JWS D;  3EFC A;  4MGZ E;  5DCN A;  1LXD A;  1GC6 A;  5JHB A;  4ZRJ A;  2VZK B;  1YN5 A;  3HRD D;  2DNF A;  4WH4 A;  4HKZ E;  3CIR B;  1MG4 A;  3TEW A;  1SE2 A;  1D5X C;  1L0X B;  4A55 A;  5C23 A;  2D2Q A;  4N9F 4;  2L0F A;  3ZTD A;  1D5Z C;  3QWZ B;  3HUI A;  3N9Y C;  1WF9 A;  3VR9 B;  1FEH A;  2KQ4 X;  3U30 A;  2WHI A;  2V0G A;  1QOA A;  3Q3N C;  3OG5 A;  1WXA A;  2ZVO A;  1HZ5 A;  1D6E C;  1F2R C;  2WXQ A;  4EE2 A;  2FUH B;  2JX5 A;  2NBV B;  2K9X A;  3KYC D;  3ML8 A;  3L0W B;  3URY A;  4HDQ A;  3RNE C;  1T0R C;  2LGI A;  3Q2A C;  3PRZ A;  1NI2 A;  4ZRI A;  2J0K A;  1STE A;  3VH4 B;  2D3A A;  5GMV A;  4FBJ B;  2JZ3 B;  3TEZ A;  2RGF A;  1UWM A;  2MH7 A;  3FKY A;  2N4F A;  3TJP A;  5EE9 A;  2MBH A;  1FFU A;  3PLU A;  1ZOY B;  1C3T A;  1M94 A;  3AE4 B;  1HEZ E;  5IO9 A;  3L13 A;  3HVZ A;  1WX7 A;  3P4P B;  3W5V B;  2Y5C A;  2BF8 B;  2BYE A;  1E7P B;  4EKU A;  1N61 A;  1P7E A;  4RMA A;  1V1O A;  1EM7 A;  2K8B A;  1OTR B;  1V80 A;  3L54 A;  1DOI A;  2PJH A;  3BWU D;  3AEC B;  3OLM D;  1JML A;  1WZ0 A;  1KLV A;  1QF6 A;  3HHM A;  5D3I B;  1ET6 A;  3ZRF A;  1QKZ A;  1UF0 A;  2K22 A;  1MHX A;  4NAW B;  5LXH A;  3W9C B;  2V3N A;  4HPP A;  1HZ6 A;  2MEK A;  3IG3 A;  1IGD A;  2Y3A A;  2WX0 A;  2A5U A;  2N1W A;  3PHW B;  2AQ3 B;  1V2Y A;  4NPN A;  1F1H A;  3U4E G;  2D10 A;  5LLI A;  3EHV A;  2WXN A;  5AZH A;  1WXM A;  2UU7 A;  4AJY B;  2IJ0 A;  2LFI A;  1RM6 C;  2W82 A;  3KQ4 A;  1JRO A;  2W3R A;  2KJ6 A;  1E8W A;  2GBN A;  1FXA A;  1HXY D;  4IM2 A;  2R2Q A;  4FJY A;  3VH3 B;  4ZOH C;  2G4D B;  3IT6 B;  1FCL A;  1I4G A;  2KJR A;  1Z5S B;  3K9O B;  4IM3 A;  2IBI B;  3Q8B A;  3RD2 A;  5FK9 C;  2MBQ A;  1E10 A;  2DAJ A;  5C2T B;  1WH3 A;  4L1B A;  4DHZ B;  2KN5 A;  1XLN A;  3Q6B A;  4W9F A;  4K3B A;  2QMT A;  1U4A A;  4KIK A;  2PLP A;  3SD5 A;  3BYT B;  2WXO A;  3H1U A;  1WJN A;  4A20 A;  3MHZ A;  4G11 A;  5BYS A;  1YMH E;  3B9J A;  2MJE A;  1KM7 A;  3TBL D;  4AUQ C;  3X23 A;  3QCA A;  4GDL B;  1MVK A;  3VTW A;  2KDB A;  1FXI A;  1WXS A;  2I38 A;  2IO3 B;  1WGR A;  1SE3 A;  4EZJ A;  2FE8 A;  3X0W A;  1N63 A;  1KH0 A;  3SHQ A;  2UWQ A;  2N9L A;  1JQ4 A;  2NCN A;  5DPR A;  1JRU A;  3KW5 B;  4TSS A;  4WJN A;  2Q5W D;  2JQR B;  3M62 B;  1YX5 B;  2V9H A;  1M4V A;  2G9H D;  1SJE D;  4W9E A;  3NS8 A;  1R4N B;  3PV1 A;  1TZO A;  3Q8E A;  2JYT A;  4G50 A;  2D07 B;  3DQV A;  3DVG X;  2HJ8 A;  2KC2 A;  4BOZ B;  3HM3 A;  4S17 A;  4E3C A;  3R7Q A;  4AP4 C;  3RUI B;  4EFO A;  1I42 A;  2NVU I;  2ZNV B;  1TKE A;  1BUI C;  1XQQ A;  1WGK A;  1SIJ A;  1A70 A;  2PE9 A;  2NPT A;  4XGA B;  4ZRK A;  1L4D B;  2IPK D;  5KHQ A;  2INP E;  2O6V A;  4LTU A;  3KH0 A;  2WGS A;  3QK0 A;  1VLB A;  1TTN A;  2W54 A;  1L6U A;  2D11 A;  3NY5 A;  3A9J B;  3Q69 A;  4K7U A;  2D5G A;  1HTQ A;  3ZDM C;  2C7N B;  3PT2 B;  3AE2 B;  1LM8 B;  3O65 B;  1SBB B;  2BWF A;  1MHH E;  1NYQ A;  2L83 A;  3NG0 A;  4DK5 A;  1J0G A;  5H92 C;  4ITK A;  4TUU A;  3UQB A;  1LO5 D;  1KOT A;  3CWI A;  2KDF B;  1V6E A;  3APC A;  4KKI A;  4MSQ B;  4C7Z A;  2BBC A;  4IUM B;  1MFW A;  3DVG Y;  3FAH A;  4LNI A;  2N9E B;  2JVC A;  5IKC M;  2KZR A;  3PSE B;  4MGY E;  1KFY B;  4MEL A;  4OVU A;  3S2A A;  2FCM A;  4M01 A;  3B1L X;  4W9L A;  2BGF A;  2K25 A;  4R3D A;  3OAW A;  1N60 A;  2WXR A;  2M56 B;  4ICU A;  3AI5 A;  4JIO U;  3PO0 A;  3DWM A;  1WRI A;  1WGH A;  3ALB A;  1CK1 A;  3MJW A;  3W5U B;  1YD8 U;  4ZHO A;  3DDC B;  1VDV A;  1YIW A;  2PKO A;  2ZW1 A;  4TV3 A;  4GN1 A;  1FNU A;  1LQB A;  4HRO A;  1RRB A;  3N20 C;  4PT5 A;  1TS4 A;  3VFK A;  2GOW A;  4MGK E;  1V5T A;  2JUO A;  3MJ5 A;  2LJI A;  2EKE C;  4J3O D;  2CS4 A;  1I4Q A;  4P1B C;  4PYU A;  2KT7 A;  1YN4 A;  3Q8A A;  5AEK B;  1BXT A;  1BML C;  2BT6 A;  5IN7 A;  1H4R A;  2JYE A;  4JWS C;  4DQO C;  3RZW C;  3ZJT A;  5G2N A;  1KRH A;  1JWU D;  2ZJD A;  2IGG A;  1JRP A;  3HM6 X;  3BYY B;  3BY4 B;  3DBL I;  4ACF A;  2UYZ B;  2LUM A;  4I6L B;  2PIA A;  3SEB A;  1MPE A;  3NZ3 A;  4MDK E;  5DPS A;  4GDK A;  2KLG A;  4CO7 A;  3VTU A;  4MM3 A;  1T6B X;  5IA7 A;  4X57 B;  4EUT A;  3P63 A;  1ENF A;  1WM3 A;  2J0M A;  4WQO B;  5FR3 A;  1L2N A;  1T5X D;  4F8C B;  4OVV A;  3TL5 A;  1WXQ A;  5C3J B;  2MBO A;  2FID A;  3TIX A;  3VQI A;  4K1R B;  4MEM A;  2R2O A;  5FKA C;  2M19 A;  3OJ4 B;  1WX9 A;  1BT0 A;  4II2 B;  4OZB A;  1CJE A;  3RNG C;  2KWC A;  3P4Q B;  2LGY A;  5G5H A;  2BTE A;  1VZ7 A;  2IO1 B;  1WX8 A;  3R2T A;  1E8Y A;  4FHK A;  1E7V A;  2V4I B;  1QIL A;  1L0Y B;  3FC4 A;  5I4D A;  1E8Z A;  2KAC A;  2L05 A;  1MG8 A;  1YN3 A;  5DPW A;  1WE6 A;  2IY0 B;  2L7R A;  2KDM A;  2V3S A;  2LAS A;  4JX1 C;  2AWT A;  1XT9 B;  2D3B A;  4BKS A;  1TS5 A;  3ZRC A;  2NPT B;  4A9A A;  2ZPN A;  4WUR A;  4RGO S;  2FAZ A;  3NJT A;  2FCS A;  4LNO A;  3QHT A;  4DWF A;  1UH6 A;  5AZF A;  1DOY A;  4TKN A;  1GG3 A;  3UGB B;  1P7F A;  4K7W A;  4JE3 B;  1WR1 A;  2YVC A;  2MSE D;  3KYD D;  4E71 A;  4BKT A;  3PZ8 A;  3NRZ A;  2E6X A;  3ZUN A;  3ZXR A;  4F7Z A;  1ET9 A;  2N9K A;  1GUA B;  2YLM A;  4IW0 A;  1QQR A;  4P16 A;  3QAQ A;  2EEL A;  3RN9 C;  3SFE B;  2NTS A;  4GLS C;  2J53 A;  3ZJV A;  4WJP A;  2WDQ B;  1YQ4 B;  1VD2 A;  2BS4 B;  4LNN A;  2LXC A;  3KWL A;  1QOG A;  3DHH C;  2N9X A;  5HI1 A;  5JHA A;  1J19 A;  1ISN A;  3C19 A;  2LRW A;  3ENE A;  4IM0 A;  2NS5 A;  1PGX A;  3DPD A;  1V86 A;  1XO3 A;  2WU2 B;  4M0W B;  4Q2J A;  4PS3 A;  2D3G A;  1TGZ B;  3H7S A;  4K81 A;  3U2S C;  5KHO A;  4P1C C;  1SSN A;  4IG7 B;  3PGE A;  2LGX A;  2QDF A;  3I3T B;  4BZA A;  1RFK A;  5AUK A;  5IAA C;  2CU1 A;  4IKG A;  4M00 A;  2KDE B;  1T0Q C;  1SEB D;  1WR6 E;  2QSD A;  5CX3 A;  4FXC A;  3SR6 A;  3VRB B;  5J2R A;  1PGB A;  4N58 A;  3I57 A;  1WGY A;  2KVZ A;  5J17 A;  3ZQ4 A;  4IWQ A;  3NVV A;  3JSV B;  1L0V B;  1WWT A;  4DXG A;  2J0J A;  3PHX B;  1ZGU B;  3B2G A;  4M8M A;  4DDG D;  2KMA A;  2H88 B;  1G6J A;  1I35 A;  3V6C B;  4IC7 B;  3P42 A;  1RYJ A;  2DZK A;  4BBN F;  4IWO A;  1MJD A;  3RNC C;  2SEB D;  3IAS 1;  5BMI A;  3JYU A;  3R3M A;  1WJ6 A;  4PS8 A;  3UIO B;  2QC8 A;  1IUE A;  3RNA C;  1PGA A;  1FIQ A;  2JZZ A;  2JZP A;  1YJ1 A;  4IOI E;  2JWU A;  2NTT A;  4YXD B;  1FD6 A;  1N5W A;  2KQ7 A;  1PUT A;  5G55 A;  2C60 A;  3M3J A;  3TMP B;  3BII D;  5DPT A;  3HVD A;  1S1Q B;  1SB3 C;  3VUW A;  1D4B A;  3QA8 A;  1P0R A;  4K3C A;  2Z0E B;  3QAR A;  1AYF A;  1E7U A;  1PFD A;  1LGR A;  2WWZ A;  4MJS A;  4CYE A;  2DBY A;  3U7Z A;  1ZDV A;  4HKQ A;  1FXT B;  4KZC A;  3E56 A;  2CR5 A;  2LJ5 A;  4TQ0 A;  1XD3 B;  4JWU C;  3B2F A;  1H7W A;  3VUY A;  3BK1 A;  1I7H A;  3VRA B;  1P1A A;  4BVU C;  2ZW0 A;  1GC7 A;  2DLB A;  4WAF A;  4W9G A;  2C5L C;  1EWC A;  3L17 A;  3BZD B;  4NJC A;  2WNM A;  3R7R A;  4US8 A;  5HHD G;  2I1J A;  4HCP B;  3ZGZ A;  2LEK A;  5IP4 D;  1XCT L;  3LYY A;  1CQV A;  4C80 A;  1TY0 A;  3EEC A;  2CHZ A;  3ZO5 B;  3AE9 B;  4BOS C;  3SFD B;  3IBE A;  2D3C A;  4NAW A;  2L52 A;  1NEK B;  5FR6 A;  3U7D A;  3QQ8 B;  3UIN B;  2C9W B;  5LNK 1;  3MTN B;  5D7G A;  3AEF B;  2M0A A;  2M17 A;  4OZA A;  2N9P C;  4HJG E;  2NMQ A;  3A4R A;  3AU4 A;  3DHG C;  3RNB C;  5JXV A;  1IPG A;  2EKI A;  4TMA B;  2GMI C;  2G4S A;  4MM3 B;  2FCN A;  3H6N A;  1GTE A;  3H8H A;  3H7P B;  4GMV A;  3AV8 A;  3AE3 B;  4YWG G;  1RWS A;  4PK1 A;  2QIL A;  2L00 B;  4LLG M;  2KN4 A;  2HD5 B;  2BYV E;  2JSV X;  2MWS B;  4WAA A;  2M4N A;  3MFG A;  1GAQ B;  1YOV B;  3H7P A;  1ZE3 D;  3A4S C;  3BIN A;  2ASQ A;  3EA6 A;  3IT4 B;  4YSZ B;  4AS1 A;  3W2D A;  4A8X C;  3MP9 A;  4HVB A;  3AE7 B;  2DZI A;  2LUE A;  2LHE A;  2MRP A;  3ZVV A;  3A1Q B;  4I6N B;  1VZ8 A;  3AE5 B;  3KUC B;  1QLB B;  3PRP B;  2BW2 A;  3V60 A;  3LXF A;  3PZ7 A;  3GS2 A;  3AN1 A;  1ZKH A;  3APF A;  1C9F A;  3A33 B;  2I2Y A;  3UF8 A;  2N1V A;  1KF6 B;  3EFU A;  5BYQ A;  1K52 A;  1NYR A;  3D32 A;  3R8B A;  2E3T A;  4XX5 A;  1ZP0 B;  3EC8 A;  4OVZ A;  2IY1 B;  2RDH A;  2CJO A;  1K8R B;  4RM9 A;  1J7B A;  4JLC A;  4D2K A;  3N3K B;  1YJI A;  1IYF A;  4NNJ B;  4MT5 A;  3ONS A;  2IGD A;  2MA9 B;  4CQN A;  2K8C A;  4KZ0 A;  1UWX A;  2PE6 B;  4NZL B;  4G0N B;  2KXJ A;  2WS3 B;  2NBW B;  2FCQ A;  2HTH A;  2KAJ A;  2NR2 A;  1E0Z A;  1UGJ A;  3V62 A;  3N1Z C;  5HG2 A;  2O2V A;  4ZYS A;  3AU5 A;  2KWU B;  4LK0 M;  5AZG A;  2MBB B;  2K39 A;  3VDZ A;  1F9J A;  4XYC A;  2AYO B;  1E9M A;  3AEB B;  4A3P A;  1IP9 A;  1HQR D;  2HDE A;  2RDB C;  4USA A;  2KX0 A;  2LHD A;  2K6D B;  4ARI A;  4FAD A;  5EDS A;  2M1M A;  3GZN I;  4GSW A;  3A9J A;  2WXH A;  4AJW A;  2BKR B;  3U8Z A;  2EMT A;  4WWP A;  2DYB A;  5CTR C;  2IO0 B;  2N7J A;  4WJO A;  2K0P A;  1EU4 A;  3TSS A;  1XLP A;  1Q5W B;  4CHK A;  2FBW B;  2BPS A;  1FRD A;  1R4M I;  2ZZP B;  4DXF A;  5CHF A;  2DYM A;  3ML9 A;  3NVW A;  1DGJ A;  1C79 A;  4YT0 B;  1UBI A;  2CHX A;  2TSS A;  2KMC A;  2QJL A;  3ZXV A;  1SJH D;  4BFR A;  2WYQ A;  3APD A;  1WY8 A;  5G5G A;  3OJ3 A;  2X38 A;  3DBH B;  5LXI B;  2KNB A;  2N7E A;  1TT5 B;  1SXT A;  1TIF A;  1GJZ A;  2GRI A;  4L23 A;  4TQ1 A;  1EUV B;  3GP7 A;  4FA6 A;  4C7Y A;  1WFY A;  3NVZ A;  2ICI A;  4JQW C;  4LJO B;  4GOC A;  1I4P A;  2JF5 A;  3TEX A;  3RZF A;  2ZPY A;  1KTK A;  4A90 A;  3N30 A;  1GNU A;  2ONQ A;  3Q3M C;  2QIE B;  4H2A A;  2RDG A;  2KTR A;  3E9S A;  1K51 A;  1WGG A;  1NBF C;  3NZS A;  2LGD A;  2L8J A;  2LVQ A;  3ZNI D;  2QEJ C;  4ZDV A;  4KV2 A;  4ANW A;  1HTO A;  1FFV A;  3DHI C;  4C4V B;  2BS2 B;  1KLG D;  3SU8 X;  2K5P A;  1K53 A;  3R66 C;  5C1Z A;  2RSU A;  4URK A;  1ZDX A;  4G3X B;  1D5M C;  3N1X C;  1UNS A;  1OFF A;  2L1A A;  5EE0 A;  1FRR A;  3PRM B;  1XXG A;  3L08 A;  3KVF B;  4RF0 A;  2ZVN A;  2QHO A;  3MC9 A;  2NBU A;  3I63 C;  2O6V B;  1HA5 A;  4HPL B;  4KVG B;  1EO6 A;  2XK5 B;  2B76 B;  2KAN A;  1AN8 A;  3TUO A;  2KK8 A;  3ZNH B;  4GU2 A;  2M0X A;  4J6I A;  2BYT A;  4FUL A;  3T3O A;  1H7X A;  2GBK A;  1FPY A;  1OGW A;  1FNV A;  1AWD A;  2MLB A;  2K3U A;  2KHW B;  1CZP A;  4DHJ B;  4HK2 A;  1YNT E;  2GBJ A;  1C4P A;  2RPQ A;  3I9V 1;  4L2Y A;  1GB1 A;  1VRA B;  2AQ2 B;  2JRH A;  4HLE A;  2WDR B;  2IDY A;  3IXS A;  3BK2 A;  2MQJ A;  2KO3 A;  4HDO A;  2OJW A;  1JCK B;  1UD7 A;  2G1E A;  5J18 A;  3DBL B;  5D3D A;  2Y5B B;  2M8S A;  1J8C A;  3VTV A;  4RCO A;  2OJR A;  4K7S A;  2WDV B;  1E6E B;  1ZW7 A;  4O1N A;  1YQ3 B;  2QCZ A;  2WXK A;  3IVF A;  2IZV B;  3CMM B;  3AM9 A;  4GDK B;  3ZLZ A;  3AEG B;  1E90 A;  5CHV C;  3N1Y C;  2MW5 A;  2KDI A;  1Q0W B;  1ZPS A;  1V97 A;  1TY2 A;  1YQB A;  2WLB A;  4ANV A;  4EOY A;  1UGM A;  4AOF A;  2JRI B;  4FJZ A;  1C76 A;  1JWM D;  2W9N A;  1NEN B;  1SE4 A;  2J4X A;  1C77 A;  2MBE A;  2AL3 A;  1XEE A;  2I1K A;  4N59 A;  4KGS A;  2KWD A;  1C78 A;  4XE0 A;  5T8I A;  3HIZ A;  4KIK B;  1WYG A;  3RT3 B;  2WU5 B;  5E6J A;  3PTF C;  1KLU D;  3V6E B;  4M02 A;  1WJU A;  4XDD A;  1OQY A;  1FM0 D;  2RD0 A;  4NJ6 A;  4F1S A;  4BKG A;  3GZN B;  2KMM A;  4MH8 A;  3UQA A;  3CSF A;  4OZC A;  3BVG A;  2IO2 B;  1P3Q U;  3V61 A;  4FHJ A;  2DX5 B;  4I6P A;  2EMS A;  2INN E;  1NVI D;  1J7C A;  2GBM A;  1RAX A;  3CF4 A;  4A6Q A;  4ZRP A;  4N6E B;  2R61 A;  2WXG A;  1DYQ A;  2PW9 A;  2KFK A;  1YX6 B;  3WAN A;  4OHJ A;  1GOZ A;  2L76 A;  2IYD B;  3ZDT A;  2RPV A;  4HJK A;  4ANX A;  2W3S A;  3L4P A;  4RGM A;  4W9H A;  2XBB C;  3QC8 B;  3PRE A;  3DBS A;  4DHZ E;  4WQM A;  1SIF A;  4GXB A;  4C00 A;  2LWP A;  4P6V F;  1FO4 A;  2MX2 A;  3WAO A;  3N32 A;  1F77 A;  3B08 A;  4BAX A;  3SDL C;  2XEW A;  1ESF A;  1Y8R C;  2IGH A;  2G3Q B;  1V5O A;  5HKH A;  1J7A A;  1B1Z A;  3L10 B;  1Q1O A;  2BKF A;  4MJS B;  2MCN B;  4JGH B;  1WYW B;  1C4C A;  3PVL A;  4NY0 A;  3DBR I;  2WXF A;  2DWQ A;  3MC8 A;  1S3S G;  2DZJ A;  3ZJU A;  4LDT D;  2PVG C;  3OWE B;  4NAM A;  2WX1 A;  2VRR B;  3PS6 A;  4FN2 A;  4XC2 A;  1P9D U;  1OEY J;  2VH1 A;  3DCG A;  1RFA A;  2LVP A;  3ZYY X;  3RMK C;  3V05 A;  4GGQ A;  4GIV A;  4HXD A;  1TBE A;  3W1Y A;  3VAW A;  2J7Q B;  1R4M B;  2WXM A;  2BB5 A;  2AEH A;  1UZX B;  1ROE A;  2BYF A;  4HWI B;  3Q3O C;  3U52 E;  1N6Z A;  3T8M A;  4KX6 B;  2LI5 A;  1T0S C;  3DBH I;  1PDX A;  1TS3 A;  1F52 A;  3ZNZ B;  3FIL A;  4XWT A;  2HTM E;  3CF6 E;  1KJT A;  4RF1 A;  3GE8 C;  3HK0 A;  2JU6 X;  4RNA A;  2JT4 B;  2RR9 A;  2WDT B;  3VVW B;  2DZM A;  1QOF A;  4M8N A;  4EEW A;  5D94 A;  1WMH A;  1A5R A;  1K50 A;  4MAC A;  4B6W A;  1CMX B;  3LB8 C;  3WA0 A;  3AMZ A;  3DVN V;  1TYG B;  3EGR A;  2FUG 1;  2L3Z A;  4ANU A;  1ACC A;  1MI0 A;  2ZNV C;  4IWP A;  3IFW B;  2JXX A;  2KWV B;  4REZ A;  5JZE B;  3DVN U;  4NQL B;  2ZCC A;  2KTR B;  1WSP A;  3J9C A;  3NZU A;  4PYZ A;  2KTF A;  3P4R B;  4ZRQ A;  1WMH B;  2PMV A;  2IND C;  3P1M A;  2Y5P A;  3WAL A;  4W9D A;  4FLH A;  2KC1 A;  2N7D A;  2ACZ B;  1JAL A;  4UDU C;  3A9K B;  1FMA D;  1C1Y B;  4AQ7 A;  2RMM A;  2BQQ A;  3T3N A;  1UEL A;  1TZ1 A;  3BVZ A;  1NI3 A;  3VR8 B;  3NHE B;  4RGN A;  4LCD E;  1TKG A;  1TKY A;  3R2I A;  4WWM A;  3AEA B;  2ZCB A;  2BB6 A;  5H8Y E;  4QAY A;  2OOB B;  1I4H A;  4RM8 A;  1WM2 A;  2V4L A;  3IAM 1;  4DDI D;  4W9J A;  5L95 C;  4HRS A;  2LGS A;  2KLC A;  2V1Y A;  2CHW A;  4DHJ D;  3ZNG C;  1L6V A;  4BBN C;  1F0Z A;  2REX A;  2WP9 B;  3M63 B;  4C56 C;  3ZTC A;  2BWE S;  3Q8F A;  2KVR A;  1UBQ A;  1E8X A;  5BMG A;  3ZKJ C;  2Z0D B;  2BVC A;  4FJV B;  2W55 A;  2O6V D;  1PQS A;  3BVM A;  2N0S B;  2WXP A;  1AW7 A;  2WQY B;  4YTM B;  3Q3J A;  1GB4 A;  3NUH B;  3PZD A;  4ZHP A;  4WJQ A;  5MPO A;  3O13 A;  1GPX A;  4MH0 E;  1C4A A;  4C4V A;  2B3A A;  4B95 A;  2DHZ A;  1WE7 A;  2KQS A;  1EU3 A;  5L83 A;  1JWB D;  1WZ3 A;  1V1P B;  2K1F A;  5EE3 A;  1EF1 A;  1WXV A;  2INC C;  2KD0 A;  3AE6 B;  2O2V B;  2ZEQ A;  4W9K A;  3QJZ A;  4GDL A;  3M95 A;  4W9C A;  4KSK C;  4RH6 A;  3MHS D;  3P4S B;  4WIP A;  1SF0 A;  3VXW A;  1HE8 A;  2GLS A;  3NVY A;  2XNA C;  4B0M A;  1LFD A;  1JWA D;  1L5P A;  3WCQ A;  3V3X A;  4RGT A;  2AX5 A;  1WIA A;  3GE3 C;  2PTL A;  1WJ4 A;  5AUI A;  2PEA A;  1OQQ A;  2LD9 A;  2DAF A;  5CHW A;  4OW0 A;  1TJE A;  1VR9 A;  2JXT A;  3DBR B;  4LJP B;  1E5W A;  1B9R A;  1WRD B;  5BO4 B;  1N62 A;  4MGI E;  1L4Z B;  4KKJ A;  2DEN B;  2A4Z A;  4M0W A;  3ECI A;  3WAP A;  1OQR A;  3Q14 C;  3MC0 B;  4P7I A;  2YEP B;  2ON8 A;  4B0E A;  2LRU A;  1SE9 A;  2H89 B;  3A1Q A;  1EF5 A;  2CJN A;  5E6O A;  2GB1 A;  1V8C A;  4XDC A;  3AH7 A;  1I4X A;  3H9D A;  3Q8C A;  1VZ6 A;  1PYW D;  3B0A A;  5GXG B;  2PVO D;  3ABV B;  3TCA A;  4WWO A;  4LNF A;  1F2R I;  1Q10 A;  4DXA B;  2KJH B;  1TS2 A;  2PPH A;  4EZK A;  2CU3 A;  1L7Y A;  2V3P A;  3DOW A;  2MP2 A;  2C7H A;  3RFZ B;  4W9I A;  2WXI A;  3RPF C;  4EZL A;  4MSM B;  3KUD B;  3RNF C;  4AWJ A;  4RFB A;  1WI0 A;  2JWZ A;  4NJ7 A;  2KX3 A;  2VZK D;  1T0Y A;  1V9J A;  2MP2 B;  2WXL A;  2XK5 A;  1V1P A;  3TEY A;  3UI3 A;  3AE1 B;  1JW9 D;  2GBR A;  3GOE A;  5BYR A;  2XN9 C;  2KFK B;  3RI7 C;  1ZXI A;  3LJ3 A;  2WXJ A;  2MHJ A;  3A9K A;  3K9P B;  3QIJ A;  2C7M B;  4II3 B;  1XLO A;  2K8H A;  3AE8 B;  2CKH B;  1UUP A;  2G45 B;  4DBG A;  3KWV A;  3WIM A;  1T3Q A;  3W1S A;  1FNW A;  3CST A;  4IDI A;  3QX1 A;  1FCC C;  4YSX B;  2HE7 A;  5TSS A;  3ETR A;  4ZYN A;  1VCB A;  5BMH A;  1R4N I;  4XZ4 A;  2VH2 A;  1H8C A;  2JPH A;  3C0R B;  1XLQ A;  2JY6 A;  1EWY C;  4A3O A;  3JW0 X;  3EUB 2;  2KFJ A;  3Q3F A;  4KDL B;  1OEY A;  1ZXH A;  5TR5 A;  4NQK E;  1NDD A;  1YJJ A;  3I5J C;  1WGD A;  2FIF A;  4GB9 A;  4LDT B;  2K6Q A;  1XCQ L;  1V49 A;  2J42 A;  3RUL A;  2X8X X;  3ZW3 A;  1P98 A;  4JPS A;  3WAM A;  4LNK A;  4ARC A;  3KLS X;  2LXA A;  1ZUD 2;  2MJ3 A;  1AAR A;  3FIL B;  5D6J B;  2AL6 A;  3P2B A;  3RYT A;  4B9K A;  3L16 A;  5JH5 C;  1XF5 L;  4PS7 A;  4JL9 A;  2MJD A;  1R7S A;  2J52 A;  4HPM B;  3VUX A;  2KKC A;  4KGR A;  4BKS D;  4S0R A;  1VJK A;  3NOB A;  3T9L A;  1QZE A;  1DOX A;  3PPA A;  5E6N A;  2LVO A;  2YEP F;  3IHP C;  1QT9 A;  4E74 A;  5HFY A;  3RCZ A;  1RLF A;  2KYW A;  2AQ1 B;  5E6P A;  4KSL C;  3DWG C;  4XWW A;  3AXC A;  4WWN A;  3AB5 A;  3ZIM A;  1GTH A;  2Z59 B;  2LZ6 A;  2OHF A;  1D3Z A;  5D2M B;  2SAK A;  3JSV A;  2Z8L A;  3W1S C;  1X1M A;  4YSY B;  2KOX A;  2OED A;  1Z2M A;  4HCN B;  2L0T A;  3AED B;  1SGH A;  2LMC A;  1IBX B;  5IOI A;  4YTN B;  4YTP B;  3GB1 A;  2FNJ B;  3VHT C;  3JVZ X;  3UIP B;  2DYO A;  2GI9 A;  3PLV A;  4ASW C;  3AEE B;  1IGC A;  2L32 A;  3AUL A;  4KGT A;  1QOB A;  4YL8 A;  1Y56 A;  2HJ1 A;  4KDI C; 
#chains in the Genus database with same CATH homology
 4RF1 A;  3NS1 A;  1YJI A;  2JU6 X;  2BS3 B;  4MT5 A;  3MJ5 A;  1IBX A;  2LJI A;  1GT8 A;  4J3O D;  4RNA A;  3C8Y A;  2IGD A;  4HEA 1;  4CQN A;  1N5X A;  1UWX A;  1I4Q A;  1I4R A;  1QOF A;  4US9 A;  4NZL B;  2WS3 B;  5EE1 A;  2KAJ A;  1JWS D;  1K50 A;  4MAC A;  1E0Z A;  1UGJ A;  1YN4 A;  3Q8A A;  1BXT A;  3LB8 C;  1BML C;  3AMZ A;  2BT6 A;  5HG2 A;  3EGR A;  1TYG B;  2VZK B;  1YN5 A;  3HRD D;  4WH4 A;  2JYE A;  4JWS C;  4ZYS A;  2FUG 1;  4DQO C;  4HKZ E;  4LK0 M;  3CIR B;  3ZJT A;  3TEW A;  1SE2 A;  1D5X C;  1KRH A;  1JWU D;  1ACC A;  1L0X B;  1MI0 A;  4A55 A;  2IGG A;  1JRP A;  4REZ A;  3BYY B;  1E9M A;  3AEB B;  1HQR D;  2LUM A;  1D5Z C;  2HDE A;  3HUI A;  3N9Y C;  4USA A;  3VR9 B;  1WSP A;  2PIA A;  3J9C A;  1FEH A;  3SEB A;  2KQ4 X;  1MPE A;  3P4R B;  3NZ3 A;  4ZRQ A;  2PMV A;  2V0G A;  2LHD A;  3P1M A;  4ARI A;  2Y5P A;  1QOA A;  1T6B X;  2WXH A;  2ACZ B;  3P63 A;  1JAL A;  1HZ5 A;  4UDU C;  1FMA D;  1ENF A;  4AQ7 A;  2RMM A;  1D6E C;  1F2R C;  2WXQ A;  4EE2 A;  5FR3 A;  3T3N A;  2N7J A;  2JX5 A;  1T5X D;  3BVZ A;  1NI3 A;  3VR8 B;  2K0P A;  1EU4 A;  4RGN A;  1WXQ A;  3TSS A;  2K9X A;  1XLP A;  1TKG A;  1TKY A;  3R2I A;  5C3J B;  3URY A;  3VQI A;  4WWM A;  3AEA B;  2FBW B;  2LGI A;  2BB6 A;  5H8Y E;  1FRD A;  1I4H A;  5FKA C;  2M19 A;  4OZB A;  3IAM 1;  4DXF A;  2DYM A;  1CJE A;  4HRS A;  3NVW A;  1DGJ A;  3P4Q B;  1C79 A;  1STE A;  4YT0 B;  2TSS A;  5G5H A;  2BTE A;  1VZ7 A;  2QJL A;  1SJH D;  3R2T A;  2V4I B;  1L6V A;  1QIL A;  5G5G A;  1L0Y B;  2X38 A;  3FC4 A;  5I4D A;  3TEZ A;  1UWM A;  1F0Z A;  2MH7 A;  2WP9 B;  2KAC A;  1SXT A;  5EE9 A;  1YN3 A;  4C56 C;  1FFU A;  3Q8F A;  2GRI A;  4L23 A;  2KDM A;  4TQ1 A;  3GP7 A;  1ZOY B;  4JX1 C;  5BMG A;  4C7Y A;  3NVZ A;  2ICI A;  2W55 A;  1TS5 A;  3AE4 B;  3BVM A;  1I4P A;  2N0S B;  4A9A A;  2WXP A;  3TEX A;  1AW7 A;  1HEZ E;  4WUR A;  2WQY B;  4RGO S;  1KTK A;  4YTM B;  4A90 A;  1GB4 A;  3NUH B;  4ZHP A;  2ONQ A;  2QIE B;  5MPO A;  3HVZ A;  1DOY A;  3O13 A;  4H2A A;  2RDG A;  1GPX A;  1P7F A;  3P4P B;  1C4A A;  3E9S A;  3W5V B;  1K51 A;  2Y5C A;  4JE3 B;  1E7P B;  1EU3 A;  1JWB D;  1V1P B;  1N61 A;  1P7E A;  1V1O A;  3PZ8 A;  3NRZ A;  1EM7 A;  2QEJ C;  2E6X A;  5EE3 A;  1ET9 A;  2N9K A;  1QQR A;  4P16 A;  2EEL A;  1FFV A;  3SFE B;  2NTS A;  1DOI A;  2BS2 B;  2J53 A;  1KLG D;  2K5P A;  4GLS C;  3ZJV A;  3BWU D;  3AEC B;  2WDQ B;  3AE6 B;  1K53 A;  1YQ4 B;  2BS4 B;  1JML A;  1ZDX A;  4RH6 A;  1QOG A;  3KWL A;  3P4S B;  4WIP A;  5D3I B;  1QF6 A;  5HI1 A;  1SF0 A;  1ET6 A;  1D5M C;  1QKZ A;  1UNS A;  1OFF A;  2L1A A;  3NVY A;  2XNA C;  4B0M A;  2K22 A;  1MHX A;  5EE0 A;  1FRR A;  1JWA D;  4NAW B;  3W9C B;  1PGX A;  2V3N A;  1XXG A;  1XO3 A;  2WU2 B;  1L5P A;  4Q2J A;  3WCQ A;  1HZ6 A;  4RF0 A;  3V3X A;  2MEK A;  2AX5 A;  4RGT A;  1IGD A;  2Y3A A;  3U2S C;  2PTL A;  5AUI A;  1OQQ A;  1SSN A;  2AQ3 B;  1HA5 A;  4OW0 A;  1TJE A;  2B76 B;  1VR9 A;  2JXT A;  3U4E G;  1AN8 A;  3TUO A;  1RFK A;  5AUK A;  2WXN A;  4IKG A;  2BYT A;  1B9R A;  3T3O A;  1SEB D;  2QSD A;  1H7X A;  1N62 A;  2IJ0 A;  2LFI A;  1L4Z B;  4FXC A;  1RM6 C;  2W82 A;  3KQ4 A;  3SR6 A;  3VRB B;  4KKJ A;  1FNV A;  1AWD A;  1JRO A;  2K3U A;  2W3R A;  4M0W A;  1CZP A;  1OQR A;  1PGB A;  1YNT E;  1FXA A;  1HXY D;  4N58 A;  3MC0 B;  3I57 A;  1C4P A;  3I9V 1;  4L2Y A;  1GB1 A;  1VRA B;  2ON8 A;  2YEP B;  3IT6 B;  4ZOH C;  4B0E A;  2AQ2 B;  1FCL A;  3ZQ4 A;  3NVV A;  2H89 B;  2WDR B;  1I4G A;  1L0V B;  1WWT A;  2IDY A;  4DXG A;  3Q8B A;  2CJN A;  5FK9 C;  2GB1 A;  3B2G A;  3IXS A;  1V8C A;  3BK2 A;  4XDC A;  3AH7 A;  1I4X A;  1E10 A;  1JCK B;  3Q8C A;  2H88 B;  2G1E A;  5C2T B;  1VZ6 A;  1PYW D;  4L1B A;  3P42 A;  1RYJ A;  1XLN A;  5D3D A;  5GXG B;  2PVO D;  2QMT A;  3ABV B;  1F2R I;  2PLP A;  1Q10 A;  2SEB D;  3IAS 1;  3BYT B;  4RCO A;  5BMI A;  2WXO A;  2WDV B;  1E6E B;  4O1N A;  1TS2 A;  1YQ3 B;  2CU3 A;  2WXK A;  3MHZ A;  5BYS A;  1YMH E;  3B9J A;  1IUE A;  1PGA A;  3AM9 A;  2MJE A;  2V3P A;  1FIQ A;  4GDK B;  3AEG B;  3RFZ B;  2WXI A;  3RPF C;  4GDL B;  2JZP A;  1MVK A;  4IOI E;  1ZPS A;  1V97 A;  1TY2 A;  2JWU A;  2NTT A;  4YXD B;  2WLB A;  1FXI A;  1FD6 A;  1N5W A;  2I38 A;  4RFB A;  1PUT A;  1SE3 A;  3BII D;  1C76 A;  1JWM D;  2VZK D;  3HVD A;  1NEN B;  1SE4 A;  2WXL A;  2J4X A;  2FE8 A;  1N63 A;  1KH0 A;  1SB3 C;  2N9L A;  1C77 A;  1V1P A;  1JQ4 A;  3TEY A;  3UI3 A;  1D4B A;  3AE1 B;  1JW9 D;  1XEE A;  4N59 A;  4TSS A;  4KGS A;  2KWD A;  5BYR A;  2XN9 C;  1C78 A;  1ZXI A;  1AYF A;  4XE0 A;  1PFD A;  2JQR B;  2Q5W D;  2WXJ A;  5T8I A;  2DBY A;  1M4V A;  2G9H D;  1SJE D;  3U7Z A;  1TZO A;  1XLO A;  1WYG A;  1ZDV A;  3Q8E A;  4HKQ A;  3AE8 B;  2WU5 B;  2JYT A;  5E6J A;  1UUP A;  3E56 A;  1KLU D;  4TQ0 A;  3KWV A;  4XDD A;  4JWU C;  1FM0 D;  3B2F A;  1H7W A;  3BK1 A;  1T3Q A;  1I7H A;  3VRA B;  3W1S A;  2KMM A;  1FNW A;  4MH8 A;  4IDI A;  1FCC C;  2ZW0 A;  4YSX B;  4OZC A;  2DLB A;  4WAF A;  5TSS A;  3ETR A;  3BVG A;  5BMH A;  1EWC A;  3BZD B;  4NJC A;  2WNM A;  1TKE A;  2INN E;  1NVI D;  4US8 A;  1BUI C;  1J7C A;  1XLQ A;  5HHD G;  1EWY C;  3CF4 A;  3ZGZ A;  4A6Q A;  4ZRP A;  4N6E B;  2LEK A;  3EUB 2;  1XCT L;  2R61 A;  2WXG A;  3LYY A;  1CQV A;  1WGK A;  1DYQ A;  4C80 A;  1TY0 A;  1SIJ A;  1A70 A;  1ZXH A;  2PW9 A;  3AE9 B;  3SFD B;  1YJJ A;  4OHJ A;  1GOZ A;  2L52 A;  2RPV A;  1NEK B;  2W3S A;  1L4D B;  1XCQ L;  3L4P A;  2IPK D;  4RGM A;  2INP E;  2J42 A;  4JPS A;  5LNK 1;  4ARC A;  4LTU A;  3KLS X;  5D7G A;  3AEF B;  2M0A A;  2NMQ A;  4OZA A;  4WQM A;  4HJG E;  1ZUD 2;  2MJ3 A;  3FIL B;  1VLB A;  4D2K A;  2W54 A;  5JXV A;  2EKI A;  4P6V F;  1FO4 A;  4TMA B;  1L6U A;  1XF5 L;  3Q69 A;  1F77 A;  2D5G A;  4MM3 B;  2MJD A;  1R7S A;  2J52 A;  1GTE A;  1ESF A;  3H8H A;  4KGR A;  2IGH A;  1VJK A;  3AV8 A;  3AE2 B;  3AE3 B;  4YWG G;  1RWS A;  1SBB B;  2QIL A;  1MHH E;  1DOX A;  1J7A A;  1B1Z A;  1NYQ A;  2KN4 A;  2L83 A;  4LLG M;  5H92 C;  4ITK A;  2JSV X;  1C4C A;  2YEP F;  1LO5 D;  3CWI A;  1QT9 A;  4KKI A;  3MFG A;  4C7Z A;  1GAQ B;  5HFY A;  2BBC A;  2WXF A;  2DWQ A;  1ZE3 D;  3FAH A;  2AQ1 B;  3DWG C;  4XWW A;  3ZJU A;  3EA6 A;  3IT4 B;  4YSZ B;  4AS1 A;  3W2D A;  2PVG C;  3OWE B;  4A8X C;  3AB5 A;  3MP9 A;  3AE7 B;  4NAM A;  1KFY B;  2LHE A;  1GTH A;  2OHF A;  1VZ8 A;  2SAK A;  3AE5 B;  2Z8L A;  3ZYY X;  1QLB B;  4R3D A;  4YSY B;  1N60 A;  2OED A;  2BW2 A;  2WXR A;  2M56 B;  3PO0 A;  3DWM A;  1WRI A;  3LXF A;  3AED B;  2LMC A;  3V05 A;  1IBX B;  3PZ7 A;  1CK1 A;  3W5U B;  3GS2 A;  4ZHO A;  3AN1 A;  1VDV A;  2WXM A;  1C9F A;  4YTN B;  4YTP B;  2BB5 A;  2I2Y A;  3GB1 A;  1KF6 B;  1ROE A;  2DYO A;  2GI9 A;  2PKO A;  2ZW1 A;  5BYQ A;  1K52 A;  1NYR A;  3U52 E;  1FNU A;  3AEE B;  3R8B A;  2E3T A;  4KX6 B;  4HRO A;  1ZP0 B;  1PDX A;  1IGC A;  2L32 A;  4OVZ A;  1TS3 A;  2RDH A;  4KGT A;  2CJO A;  1QOB A;  4PT5 A;  1TS4 A;  3FIL A;  1J7B A;  1Y56 A;  4XWT A;  2HTM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...