3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
3AE5B 1GT8A 2L83A 1WWTA 1XLNA 3ABVB 3SFDB 2BS3B 3W9CB 4YSXB 1XLOA 1OFFA 2MJ3A 1FM0D 1JALA 4ZHPA 2WDVB 1TKYA 3BIID 1R7SA 3ZYYX 1F0ZA 1PFDA 1FMAD 3WCQA 3AN1A 1QOFA 3VR8B 2MJDA 3NVZA 1ZUD2 1KRHA 2EKIA 1GTEA 2BT6A 3LXFA 1IUEA 4FXCA 4JX1C 4JWUC 1V8CA 1N63A 1JQ4A 2W54A 1E9MA 5GXGB 1EWYC 2BS4B 2WDQB 1FIQA 2HTME 4YTNB 3P1MA 2BS2B 1QOGA 5EE3A 2WDRB 1WYGA 4C80A 3AEEB 1FXAA 3HUIA 4YXDB 2CJOA 2KMMA 1NVID 3VR9B 1E6EB 3AE6B 2JX5A 2K5PA 1N61A 1FXIA 2WU5B 3P4SB 2M19A 2WLBA 2CU3A 4YSYB 4HRSA 5EE9A 3W5VB 4N58A 2MH7A 4US9A 1CZPA 2PKOA 4WQMA 2DBYA 3B9JA 1GAQB 3AECB 5H92C 3AEBB 4C7ZA 3P4QB 1SB3C 4IDIA 3AMZA 3SFEB 3AE8B 4HROA 4N6EB 1QF6A 4JWSC 5H8YE 1E10A 1OQQA 1QLBB 2Q5WD 3ETRA 1VLBA 1GPXA 3NS1A 5G5HA 1JROA 2L52A 1DOIA 2QIEB 1N62A 3HVZA 1E7PB 2MJEA 4N59A 5EE0A 4ZOHC 1NYQA 5EE1A 2WQYB 1FRDA 1XLPA 1XO3A 2W55A 4USAA 1KF6B 1YQ4B 2B76B 3VRBB 2PIAA 1B9RA 2W3RA 5MPOA 1FO4A 5AUKA 1H7WA 2KAJA 1N5XA 3DWGC 1FFUA 1L6VA 3P4RB 1ZP0B 2WU2B 2OHFA 3P63A 2AX5A 1DOYA 3EUB2 1TKEA 3AEAB 4YSZB 1NI3A 1PUTA 1TKGA 2LEKA 1GTHA 3B2FA 3FAHA 2G1EA 1QT9A 1AYFA 1TYGB 1JWAD 3AEFB 1H7XA 3NVYA 1E0ZA 3CF4A 3PO0A 1J7AA 4ZHOA 3CIRB 1NENB 1RYJA 3LB8C 4YT0B 2DWQA 3P4PB 1YQ3B 1JWBD 1N5WA 1CJEA 3VRAB 1J7CA 2PVGC 4US8A 2H89B 3AE9B 1VJKA 1WRIA 3NVVA 1RFKA 3AE4B 1UWMA 5C3JB 3AM9A 3NVWA 1FRRA 5G5GA 3CWIA 2WS3B 3AEGB 4YTMB 1VDVA 2W3SA 4ITKA 3AE1B 1A70A 1ZOYB 1NYRA 1TJEA 3KWLA 3NRZA 1WXQA 1J7BA 1V97A 1JW9D 4KX6B 4C7YA 1PDXA 1YJJA 1N60A 2JQRB 1QOAA 3SR6A 1XLQA 2H88B 4P6VF 2FBWB 1I7HA 1NEKB 1QOBA 1OQRA 1ROEA 4LTUA 2ACZB 4YTPB 3B2GA 2M56B 3DWMA 1SIJA 1T3QA 2E3TA 3AE3B 3AH7A 1AWDA 2PVOD 1L5PA 3AE7B 1SF0A 1WGKA 2QJLA 4WWMA 1L6UA 2WP9B 1YJIA 3HRDD 3L4PA 2Y5CA 3AV8A 5C2TB 3RPFC 2K9XA 1DOXA 1JRPA 4A9AA 3AEDB 3AE2B 1DGJA 3W5UB 2N0SB 3AB5A 1FFVA 1KFYB 1RM6C 3FC4A 2CJNA 2K22A 5AUIA 1RWSA 1ZXIA 1L0VB
chains in the Genus database with same CATH superfamily
4OVUA 2V1YA 2K8CA 3Q2AC 4Q2JA 1JCKB 4I6NB 5BMGA 3BYYB 3NZSA 4NJ7A 3SEBA 2DENB 1LM8B 3MJWA 1GTEA 2VH1A 2WXHA 1AW7A 3DVNU 3A9KA 1T5XD 2KDIA 4P1BC 1YX5B 4N9F4 1YIWA 4M0WA 3IBEA 3ZXVA 1VR9A 1L0YB 1CK1A 2V3SA 4WJOA 2W9NA 2D2QA 2KDMA 2PJHA 1E8ZA 1I4PA 2KANA 1L4ZB 2Y3AA 1N62A 1C4CA 1WGDA 1M4VA 2BYEA 3C8YA 4GLSC 4P16A 2L1AA 4OVVA 2LUMA 1YMHE 3VUXA 3A4SC 2LGXA 2MRPA 3W2DA 1WY8A 1ZDVA 3MP9A 2RMMA 3V61A 1GNUA 4K3CA 1MVKA 3PO0A 5BO4B 1P7FA 2IO2B 3CIRB 1NENB 2HJ1A 2DWQA 4G11A 1E8XA 2E6XA 1RLFA 2BB6A 4B6WA 4A6QA 5JZEB 1J0GA 3NVVA 1D5MC 3KWLA 5HFYA 3UIOB 2AEHA 2GI9A 4XDDA 3JSVB 2IO1B 1I7HA 4YTPB 1ET9A 1GB4A 4EZLA 1P1AA 3WAOA 4NPNA 2ASQA 3A9JB 1DOXA 2ZVNA 4IW0A 3RYTA 4HVBA 2V4LA 4W9CA 3H9DA 2M8SA 2N7EA 2QSDA 1WMHB 3ABVB 2JXXA 1FCLA 1XLOA 4NZLB 5FR3A 5BYSA 3DPDA 2KJ6A 3V6EB 2PE9A 1L4DB 2N9EB 1E7VA 3DBRI 3PZ8A 3VHTC 1V81A 3U30A 2KX3A 3PVLA 4IUMB 2LD9A 1IBXA 1TIFA 4M02A 5EE9A 3Q3NC 2Z0DB 4ASWC 3AEBB 3KUDB 4FADA 4FJYA 4JPSA 1R4NI 1GPXA 1BXTA 3DVGY 3ENEA 1WH3A 3BINA 4OZBA 2L0FA 3X0WA 5FKAC 2PIAA 1ZKHA 5MPOA 5CHFA 3ZTCA 2QC8A 4A9AA 1V6EA 2FUHB 4W9FA 3UIPB 2L76A 1GTHA 3DVNV 3WAMA 2M17A 1E0ZA 1XQQA 3DBHB 2KKCA 4XX5A 3PPAA 4K3BA 3GOEA 4HCPB 4PT5A 3ZUNA 1P9DU 2IPKD 1PGBA 1VDVA 4YTMB 4ITKA 4W9KA 1HXYD 5AZGA 1V97A 1P0RA 2NBVB 4MELA 1KH0A 1XCQL 4IM3A 1HQRD 1BUIC 3SU8X 3U7DA 1MG4A 1C3TA 3CSTA 4W9IA 3QK0A 4ZRPA 2I38A 3H7PA 2BKFA 3M3JA 1I4RA 4KDLB 3RULA 2JZ3B 1TS4A 4LLGM 4ZYSA 2NS5A 2LWPA 3QA8A 3PLVA 3RNFC 3NOBA 4ZHPA 4DBGA 2D11A 1TS5A 2LMCA 2M4NA 1QOFA 3GP7A 3NVZA 1ZUD2 3LXFA 3UF8A 1C4AA 1V8CA 3IHPC 2HE7A 2K8BA 2EMTA 2OJWA 2D3AA 2KTRA 4ARCA 3VR9B 2K5PA 3L13A 3J9CA 4GDLA 3DDCB 4KZCA 4X57B 4WQMA 3TIXA 1GAQB 3L10B 4LNNA 4TV3A 3DCGA 3OAWA 1T0YA 2IBIB 2DAFA 2O6VB 3SD5A 4DK5A 2MJEA 2ZCBA 4WJQA 3RNGC 1WI0A 4N59A 3VTUA 3N30A 2M0XA 2FIDA 2WWZA 2AL3A 3QWZB 2I1KA 1RFAA 1UELA 4NAWB 1XEEA 4GMVA 2M0AA 3AEAB 1QILA 4BKTA 1KTKA 2GLSA 2IY0B 2BQQA 3KUCB 4HJKA 2IJ0A 1J7AA 1S3SG 1TTNA 2N1WA 1F77A 1PQSA 3AEGB 4A90A 2JPHA 2CR5A 4BFRA 1ZOYB 4NJ6A 1SXTA 5EDSA 1GC7A 1OQRA 2JYEA 2MP2B 4C00A 2EKEC 2C60A 3AE3B 3AH7A 3FILB 2OOBB 3HIZA 1YN5A 3RPFC 2JWUA 3TSSA 1UGJA 4YWGG 1GJZA 3HK0A 4HKQA 2LRWA 1ZE3D 2TSSA 3RFZB 1WWTA 3BK1A 4LDTB 2J0KA 2KX0A 4BBNF 2INCC 3FKYA 1H4RA 2KYWA 2K6QA 2AQ3B 1TT5B 2BKRB 3TCAA 4YXDB 1ZDXA 2ZPYA 4HLEA 3EHVA 4BZAA 2KMAA 4ZDVA 3BVGA 1HEZE 1CZPA 2BB5A 2CU1A 2QEJC 3BY4B 1VZ8A 1MG8A 5G2NA 4XWWA 1EU4A 2A4ZA 2KN4A 3TEXA 3ZDMC 1HA5A 5GMVA 1KOTA 5AZFA 2MQJA 2QCZA 4IKGA 3KYCD 2Z8LA 1V1PB 4EFOA 3P63A 1XF5L 4B95A 3OWEB 3N1XC 4YSZB 2LEKA 3RNAC 3LJ3A 3I5JC 1AYFA 2WXLA 3U7ZA 1WYWB 2KXJA 1MJDA 3KH0A 4W9GA 4BOSC 3P4PB 5L95C 3AE9B 2D3CA 3VH3B 5G5GA 1RFKA 4EZJA 3BZDB 1NYRA 2DYMA 3P2BA 1UBQA 2XBBC 4G3XB 4L1BA 2R61A 3IT6B 4TQ0A 1Z2MA 4OZCA 1XD3B 2L3ZA 3DBLB 4XGAB 1KM7A 2MSED 1SE4A 5C2TB 3LYYA 3ZO5B 2ZEQA 4ICVA 2Z59B 3AE2B 3VVWB 3MC9A 4BVUC 3AB5A 1XLNA 3SFDB 1WJUA 1I4HA 1ENFA 2WX1A 2NMQA 1GG3A 1JRUA 1QKZA 2W54A 1UNSA 2PPHA 4JL9A 1ZPSA 3HUIA 2CKHB 1LO5D 4JWUC 1LGRA 1N61A 2WU5B 2C9WB 2UYZB 4K7UA 2MH7A 4TSSA 5D7GA 1UWXA 1MFWA 2KNBA 3NZ3A 2MEKA 2GBRA 2N9KA 3AE8B 3L16A 5IO9A 1OQQA 1VLBA 2KD0A 3WAPA 3V62A 3ZVVA 5BMHA 4KSLC 1D6EC 3TMPB 1E8WA 2XN9C 4A8XC 1M94A 2LGYA 3UQBA 2MHJA 1I42A 1GC6A 3AU5A 2AX5A 4UDUC 3EUB2 3PLUA 4KV2A 4W9LA 3N1YC 3CSFA 4ANUA 1WXSA 2G45B 4JE3B 3PRZA 5DPSA 2N9LA 4OZAA 3LB8C 4FHJA 3TJPA 4AOFA 4E3CA 5LNK1 5DPWA 1CJEA 3EECA 3AM9A 1NBFC 4B9KA 1TZ1A 2W3SA 1JWMD 2WHIA 1WJNA 4M8NA 2NPTB 1WF9A 2NVUI 2KDEB 2KT7A 1YN4A 1UZXB 2LZ6A 2WXGA 2KACA 4MM3B 2KHWB 1KLUD 3RUIB 3AE7B 4KGSA 1BMLC 1LQBA 3MC8A 3ALBA 2R2OA 2KWDA 4WURA 2XK5B 1NI2A 2PEAA 3NY5A 3OJ4B 4CYEA 3KUZA 2ZCCA 1I4XA 4ZYNA 4CO7A 3BIID 1IYFA 2YVCA 1C9FA 1IUEA 3JYUA 1Q1OA 1WX8A 1E9MA 1EWYC 1WX7A 4YTNB 2KQ4X 1R4NB 1VCBA 3AE6B 5EE3A 4M8MA 1UGMA 3A9JA 4C80A 4GIVA 1QZEA 5LLIA 4IM2A 2DBYA 3AMZA 2YEPB 5HG2A 1YOVB 3PSEB 4CQNA 3H6NA 4LJPB 5J18A 1JROA 1WMHA 2Z0EB 3VAWA 1WR1A 1E5WA 4LNFA 4ZOHC 3VUYA 4B0EA 4W9EA 2KN5A 2DYBA 4EE2A 3BVZA 3R66C 1L6VA 5C23A 2LXAA 3AU4A 4DHJD 4IC7B 2R2QA 3B08A 2ONQA 2BF8B 3U2SC 3GZNI 4K7SA 5JHAA 3EFUA 2AQ1B 1WXMA 4IOIE 3ZKJC 2PVGC 3E9SA 4PS8A 5C3JB 1K53A 5IAAC 2LRUA 4JLCA 2L05A 4II2B 3L08A 3A1QB 3UI3A 1NEKB 4AJYB 3ZGZA 4MSQB 2V0GA 2NTTA 1AWDA 3M62B 3ZNGC 3ZNID 3TEZA 2K9XA 1TBEA 1Y8RC 3RCZA 3KQ4A 1WGHA 1V49A 1YN3A 4JX1C 1UD7A 2L83A 2FCQA 3APDA 3PV1A 2BYVE 1JALA 5D94A 3ZYYX 3DHHC 1LFDA 4ICUA 5HHDG 2VZKD 4S17A 4KIKA 3RT3B 1UBIA 1DYQA 2JX5A 4EZKA 1MPEA 4WAAA 1B1ZA 2OJRA 1FCCC 3H8HA 4MGIE 1QF6A 3ZRCA 4ZRIA 3K9PB 1QLBB 2WXMA 5G5HA 3ZJUA 2RDGA 5E6OA 3VUWA 4WH4A 2ZZPB 3OJ3A 4HPLB 1FO4A 1D5XC 4I6LB 3DWGC 1C76A 3IAM1 1PUTA 3FAHA 3T9LA 1TYGB 2RDBC 2FCNA 3SHQA 3NVYA 3CF4A 3A9KB 3L17A 2IDYA 1YQ3B 1WGGA 4EUTA 1UWMA 3NVWA 2O6VD 3MTNB 2L7RA 4NJCA 2DLBA 5KHQA 3NUHB 2DZIA 2LASA 5IKCM 1QOAA 1XLQA 4URKA 3R2TA 2WYQA 3IT4B 4NAWA 3AULA 1SF0A 2C7NB 4K7WA 4WWNA 3Q3OC 3IXSA 1CMXB 1TS2A 4AS1A 3ECIA 4LNOA 2BGFA 2D07B 4JGHB 2K22A 1L2NA 2NBUA 2G3QB 5D3DA 1C77A 3KLSX 4PK1A 3VXWA 2DZMA 1PFDA 3AN1A 2MJDA 3IVFA 4ACFA 2MP2A 2KJRA 4KKJA 1QOGA 2ZPNA 4RGTA 1E6EB 2WXJA 2RGFA 2BYFA 3DOWA 1F52A 3UINB 4A55A 4NAMA 5E6NA 1IPGA 4LJOB 2D10A 4IDIA 1TS3A 5TR5A 1SIFA 3ETRA 4W9JA 1TZOA 1TY0A 2QIEB 4OHJA 1E7PB 1FNVA 1VRAB 3PT2B 4LDTD 4GDKA 2J4XA 1D3ZA 1C79A 5DPRA 2K25A 3VQIA 2B76B 5FR6A 3ZXRA 2MBBB 2W82A 1UH6A 3P4RB 2WNMA 1DOYA 1SGHA 2MBOA 4WWPA 3TEYA 2JSVX 4A3PA 2KQ7A 2BPSA 5JXVA 1IBXB 4RH6A 2DYOA 2AQ2B 5BYQA 1J7CA 4US8A 1E7UA 4EKUA 1FRRA 3PHXB 2YLMA 2MA9B 3HM6X 5DCNA 2RSUA 3QHTA 4M01A 4KX6B 5AZHA 4HKZE 4ZHOA 4LK0M 4IWOA 4RF1A 2PW9A 1V1PA 1OQYA 1L5PA 2OEDA 3PZ7A 2O2VB 1FD6A 3HRDD 3AV8A 1JRPA 3D32A 4E71A 2NR2A 2IYDB 1SE3A 3ZJTA 2J53A 4MSMB 2WLBA 1VZ6A 3M63B 3Q69A 2WXQA 1ESFA 4J3OD 3W9CB 4DXGA 2MJ3A 2DNFA 4EOYA 2CHZA 1JQ4A 1N63A 3GE8C 1ISNA 2J0JA 2L8JA 2KOXA 3RNBC 2WDRB 4NQLB 1NVID 4HRSA 4HJGE 1R4MI 2BVCA 1VD2A 4ZRJA 5H92C 3H7PB 3V05A 4C7ZA 3P4QB 4FBJB 1KLGD 4HROA 4JWSC 2IY1B 2GB1A 4JQWC 2L52A 1EO6A 1K50A 1XCTL 2CHXA 4MGKE 3PHWB 2C7MB 1X1MA 2RPQA 3C0RB 3KWVA 1OEYJ 3KW5B 3AI5A 4HPMB 4C4VA 2G1EA 3PZDA 2PMVA 2AWTA 2KTRB 4F8CB 3QCAA 1G6JA 4DHZB 3LDZE 3Q3MC 1JWBD 1N5WA 1ACCA 2MLBA 3DVGX 1FPYA 3ZIMA 2V4IB 3TBLD 1TJEA 4MJSB 3C19A 3NRZA 1ZXHA 2Y5BB 1MI0A 4C7YA 4HXDA 3Q3JA 2ACZB 1EU3A 2M56B 2CHWA 3RN9C 1PYWD 3VTVA 2PVOD 2WP9B 3B1LX 3ZQ4A 1F1HA 2LJ5A 4XZ4A 4MGZE 4GOCA 1XXGA 2EMSA 3QJZA 4IM0A 2KWVB 5AUIA 2LUEA 2JYTA 5E6JA 3X23A 2NPTA 1K8RB 3BVMA 2ZNVB 4FHKA 4P1CC 1FMAD 2HDEA 1U4AA 2BWES 3N3KB 4W9HA 2BS4B 2WDQB 4PS3A 1WYGA 1V9JA 1V80A 4KKIA 3RD2A 2J42A 4WAFA 3P42A 4N58A 1NDDA 2JWZA 2ON8A 3BK2A 4KSKC 2FNJB 1L0XB 4R3DA 3EA6A 3VFKA 3ML9A 4HEA1 2FCMA 1XLPA 1OGWA 2DHZA 2KQSA 3GZNB 3JVZX 4FULA 4NQKE 2IO0B 2D5GA 2ZW0A 1V86A 2FUG1 1C1YB 2N1VA 3JW0X 5DPTA 2KFJA 4RCOA 3VH4B 1JWAD 2L32A 2KFKA 3MC0B 2RR9A 2AYOB 2KMCA 2N7DA 2JRHA 2MBQA 2KK8A 4XE0A 3AE4B 4ANVA 4TKNA 3RNCC 1WZ0A 3Q8EA 2KTFA 1JW9D 2WXIA 3MJ5A 4RNAA 3PRPB 4ZRKA 4LTUA 3K9OB 1I4QA 5BYRA 1T3QA 2BTEA 3ONSA 2UWQA 5E6PA 4WWMA 5LXIB 2LGDA 1D5ZC 4IWQA 5T8IA 2IGGA 1FNUA 1YJ1A 3V3XA 3W5UB 4XDCA 4MACA 2G9HD 1JWSD 3NG0A 2HTHA 1E90A 5D6JB 4G50A 3A1QA 2WX0A 3WCQA 5BMIA 4KDIC 1WJ4A 2DZJA 4YL8A 3EGRA 3AEEB 2A5UA 4DDGD 1WGRA 4BAXA 2KMMA 3BWUD 2V3NA 1P3QU 2MBEA 1GOZA 3Q8CA 2LVQA 2NCNA 3U8ZA 3JSVA 2QDFA 1WSPA 3T3NA 1Q5WB 3A33B 2WQYB 1XO3A 4ZRQA 4QAYA 1SEBD 1V5OA 3ZDTA 1ET6A 3WALA 5CX3A 3Q8AA 4BOZB 2WXRA 2GBMA 2SAKA 3R7RA 1HTQA 2C5LC 3V6CB 1WXAA 5TSSA 3H1UA 2ICIA 4GN1A 3UQAA 4XC2A 3PS6A 3NHEB 1VJKA 2QMTA 1T0RC 2G4DB 1K52A 3RMKC 2J0MA 4WWOA 5IN7A 1PGAA 3PRMB 4FA6A 4A20A 3N20C 2FAZA 2K6DB 4GU2A 2BWFA 4MGYE 3VDZA 1YJIA 2Y5CA 1JWUD 4AWJA 3AEDB 3CMMB 1UUPA 1DGJA 4WQOB 3FC4A 3CF6E 2CJNA 3QIJA 1XT9B 4RGNA 4TMAB 3QARA 4W9DA 1F2RI 1GT8A 3A4RA 3TUOA 4HDQA 4ARIA 2C7HA 1AARA 1STEA 1IP9A 2BT6A 5GXGB 3P1MA 1EF1A 2I1JA 2PE6B 4HCNB 2RDHA 1FXAA 1P7EA 4RMAA 2CU3A 3NJTA 1Z5SB 1TY2A 2YEPF 3Q8FA 1SE2A 3B9JA 1SB3C 1VZ7A 1WRDB 2DX5B 3QX1A 1HZ5A 3NZUA 4PYUA 4EEWA 3WA0A 2W55A 3TL5A 3Q14C 2N9PC 2W3RA 3O65B 2KAJA 4KZ0A 5D3IB 4REZA 2WU2B 3EFCA 3W1YA 3I63C 1C78A 2ZVOA 4AQ7A 4MDKE 3HVDA 4O1NA 2H89B 3Q3FA 1FEHA 3CWIA 1WJ6A 3KYDD 1Q10A 1WM2A 4DWFA 1WXQA 2INDC 2QILA 3RZFA 2K3UA 1RRBA 5C1ZA 2K0PA 4AP4C 2H88B 2FBWB 2NTSA 4KGRA 4TUUA 3DWMA 2KO3A 3M95A 4NY0A 1L6UA 5CTRC 4CHKA 1Y56A 4DHJB 2BBCA 2O6VA 5CHWA 3E56A 4M0WB 4WJPA 2MWSB 3QAQA 2JF5A 1TGZB 4C56C 1EUVB 1BT0A 3ZLZA 2MW5A 1KJTA 1FM0D 2LGSA 1TKYA 1R7SA 4IG7B 2K39A 3SDLC 1R4MB 1KRHA 4BKGA 3RI7C 1KLVA 2L00B 2HTME 2KC1A 2BS2B 2LI5A 2XEWA 2O2VA 3R7QA 4F7ZA 3P4SB 2QHOA 1IGDA 4WIPA 4US9A 2GBNA 2PKOA 3I57A 3HM3A 3W1SA 3SFEB 1WM3A 4RFBA 4OVZA 2Q5WD 1DOIA 3U52E 2JRIB 2FE8A 5FK9C 3ML8A 4M00A 2IGDA 4FJZA 1KF6B 3FILA 2IGHA 3VRBB 4NNJB 1WFYA 3R2IA 1H7WA 4DQOC 2VZKB 4S0RA 1V1OA 4FLHA 2HD5B 3V60A 1J19A 2JY6A 2BYTA 4KIKB 3NS8A 3H7SA 4GB9A 1YX6B 1OEYA 3IG3A 2SEBD 2KZRA 3EC8A 2RD0A 3R3MA 4G0NB 1IGCA 3KVFB 1FNWA 1PDXA 1EF5A 2JQRB 3SR6A 3MHSD 5CHVC 1QOBA 3B2GA 2VRRB 3B0AA 2KVRA 3DQVA 2QJLA 3WIMA 2EELA 3S2AA 3L4PA 2JUOA 5J2RA 3RZWC 5J17A 5IP4D 2N7JA 1KFYB 1RM6C 4II3B 2BW2A 3IAS1 1SJED 1ZGUB 2KDFB 3TEWA 2BS3B 3I9V1 4MJSA 3ZRFA 5AEKB 2WDVB 4BBNC 1YQBA 2GMIC 3VR8B 2JU6X 2KLCA 4FXCA 1I4GA 5HKHA 2WXKA 1A5RA 1SBBB 3W1SC 2LVOA 3Q8BA 2JZPA 1OTRB 4AJWA 2CJOA 4LCDE 2JZZA 2ZW1A 1FXIA 2LGIA 4I6PA 1ZW7A 3W5VB 4RGOS 4GXBA 3L0WB 2FIFA 4TQ1A 3N9YC 2GBJA 2J52A 3L54A 4N6EB 4AUQC 5IOIA 1WZ3A 1E10A 4L23A 1WE7A 1NYQA 5EE1A 1V5TA 2PTLA 3OLMD 2GRIA 2XNAC 4HDOA 1HE8A 2J7QB 1FFUA 4RM8A 2WXFA 3DHGC 4D2KA 1NI3A 1Q0WB 2VH2A 1D4BA 1QT9A 3AEFB 2LHEA 4DXFA 1H7XA 2DAJA 4MT5A 3DBSA 1V2YA 4YT0B 2K1FA 2L0TA 4H2AA 3VRAB 1WXVA 1WRIA 2MX2A 2AL6A 1YD8U 2REXA 1A70A 1PGXA 3APCA 4JIOU 1J7BA 3DBHI 5G55A 4HK2A 3Q6BA 4A3OA 1T0SC 4GDKB 5D2MB 5JHBA 2E3TA 3AXCA 2DZKA 3DHIC 5JH5C 1WGKA 3R8BA 4GDLB 1QQRA 2UU7A 2ZJDA 3N32A 4MEMA 4KVGB 1FFVA 5KHOA 2FCSA 4PS7A 1RWSA 1ZXIA 1L0VB 4LNIA 3APFA 4RGMA 3URYA 4LNKA 2X38A 4OW0A 1AN8A 1CQVA 1J8CA 4K81A 3HHMA 4RM9A 2X8XX 2IZVB 2V3PA 4J6IA 2KJHB 3AECB 2ZNVC 2WXPA 4DHZE 3NS1A 4DXAB 2KWUB 4RF0A 2PLPA 2Y5PA 3HVZA 5EE0A 2M1MA 1HTOA 1H8CA 3ZTDA 1FRDA 4MM3A 4XYCA 1YQ4B 4DDID 1B9RA 3PTFC 5L83A 1SSNA 1ZP0B 3O13A 3BYTB 2N4FA 4MH0E 3U4EG 1TKGA 1I35A 1LXDA 2MBHA 1WX9A 1C4PA 1T0QC 2XK5A 2LVPA 5I4DA 3T8MA 2GOWA 1RYJA 2LHDA 3QC8B 2WS3B 2WXNA 2N9XA 3ZNZB 4ANXA 1EM7A 2RPVA 1K51A 3RNEC 1WE6A 1N60A 1YJJA 1ROEA 4FN2A 1SIJA 1F2RC 1GB1A 1P98A 4HPPA 1WR6E 3OG5A 4KGTA 3N1ZC 3MFGA 3GS2A 4B0MA 4C4VB 2N0SB 4PYZA 2D3BA 2LFIA 2INNE 1MHXA 2JVCA 3AE5B 4F1SA 4YSXB 1OFFA 2LXCA 1GUAB 4HWIB 3QQ8B 1E8YA 2JT4B 1F0ZA 2EKIA 2GBKA 4ANWA 3T3OA 5IA7A 3PREA 4MH8A 1FIQA 4E74A 4GSWA 3MHZA 4BKSA 2KLGA 1WGYA 2M19A 4BKSD 4YSYB 1S1QB 1MHHE 5LXHA 1SE9A 4L2YA 3WANA 2MCNB 5H8YE 1SJHD 2HJ8A 2KVZA 4FJVB 1N6ZA 1EWCA 2KDBA 2G4SA 1WIAA 4USAA 5HI1A 1F9JA 4WJNA 2I2YA 5AUKA 1N5XA 2OHFA 3ZW3A 2CS4A 4XWTA 2IO3B 1TKEA 3GB1A 3B2FA 2INPE 1YNTE 2V9HA 1JMLA 1L7YA 2D3GA 2NBWB 4IWPA 1T6BX 2WGSA 4GGQA 2KWCA 2KC2A 3ZNHB 3PGEA 2WDTB 1FXTB 3UGBB 1HZ6A 3AE1B 1UF0A 3ZJVA 2JXTA 4P7IA 3DBRB 2WXOA 2B3AA 4P6VF 2LJIA 3VTWA 3IFWB 1RAXA 4K1RB 3I3TB 3DBLI 2K8HA 2KFKB 3GE3C
chains in the Genus database with same CATH topology
1VZ6A 1XLNA 3Q69A 3SFDB 2WXQA 4Q2JA 1ESFA 1JCKB 1ENFA 1I4HA 2NMQA 4J3OD 3W9CB 2MJ3A 4DXGA 1FM0D 5BMGA 1TKYA 1R7SA 3BYYB 1QKZA 3SEBA 1KRHA 1GTEA 1JQ4A 1N63A 2WXHA 2W54A 1UNSA 2HTME 1AW7A 2BS2B 2WDRB 1ZPSA 3HUIA 1T5XD 1LO5D 1NVID 4JWUC 1N61A 2WU5B 3P4SB 4HRSA 4HJGE 1IGDA 2MH7A 4TSSA 4WIPA 4US9A 5D7GA 2PKOA 3I57A 1UWXA 4M0WA 5H92C 3V05A 4C7ZA 1VR9A 3P4QB 3W1SA 3NZ3A 1L0YB 2MEKA 3SFEB 3AE8B 1CK1A 1KLGD 2N9KA 4HROA 4JWSC 4OVZA 4RFBA 2GB1A 1OQQA 2KDMA 2Q5WD 1VLBA 1I4PA 2L52A 1DOIA 1L4ZB 2Y3AA 1N62A 1C4CA 1K50A 3U52E 1XCTL 2FE8A 1M4VA 3C8YA 5FK9C 5BMHA 4GLSC 2IGDA 1D6EC 4P16A 2L1AA 1KF6B 2XN9C 3FILA 2IGHA 2LUMA 3VRBB 1YMHE 4A8XC 3W2DA 3R2IA 1H7WA 2AX5A 4DQOC 1ZDVA 2VZKB 3KWVA 4UDUC 3EUB2 3MP9A 1V1OA 2RMMA 2G1EA 2BYTA 4JE3B 1MVKA 2N9LA 3PO0A 1P7FA 2PMVA 4OZAA 3CIRB 1NENB 3LB8C 2DWQA 5LNK1 2E6XA 1JWBD 1N5WA 1ACCA 1CJEA 2BB6A 4A6QA 2SEBD 3NVVA 2V4IB 3AM9A 1D5MC 2W3SA 1JWMD 3KWLA 1TJEA 3NRZA 1ZXHA 5HFYA 1IGCA 2GI9A 4XDDA 1MI0A 4C7YA 1FNWA 1PDXA 2JQRB 1YN4A 3SR6A 1I7HA 1QOBA 2ACZB 4YTPB 1EU3A 1ET9A 2M56B 3B2GA 2WXGA 1PYWD 2KACA 4MM3B 1GB4A 1KLUD 2PVOD 2QJLA 3AE7B 2WP9B 2EELA 3L4PA 3ZQ4A 4KGSA 1BMLC 1DOXA 1XXGA 2KWDA 2N7JA 1KFYB 1RM6C 4WURA 5AUIA 2BW2A 3IAS1 1SJED 2QSDA 3TEWA 2JYTA 5E6JA 3ABVB 2BS3B 3I9V1 1FCLA 1I4XA 1XLOA 4NZLB 3BVMA 5FR3A 2WDVB 3BIID 5BYSA 1FMAD 2HDEA 3VR8B 2JU6X 1L4DB 1I4GA 4FXCA 1C9FA 1IUEA 1E9MA 2WXKA 1EWYC 2BS4B 2WDQB 1SBBB 4YTNB 3PZ8A 2KQ4X 2JZPA 1WYGA 3Q8BA 2CJOA 3AE6B 5EE3A 4C80A 2ZW1A 1FXIA 4KKIA 1IBXA 2LGIA 5EE9A 2J42A 4WAFA 3W5VB 3P42A 4RGOS 4N58A 4TQ1A 2DBYA 3N9YC 3AEBB 2J52A 3AMZA 4JPSA 2YEPB 4N6EB 5HG2A 2ON8A 1E10A 4CQNA 1GPXA 1BXTA 3BK2A 4L23A 1JROA 1L0XB 4R3DA 4ZOHC 4B0EA 1NYQA 3EA6A 4OZBA 5EE1A 4HEA1 1XLPA 2PTLA 5FKAC 2GRIA 2PIAA 4EE2A 2XNAC 5MPOA 3BVZA 4A9AA 2D5GA 1FFUA 1L6VA 2WXFA 4D2KA 2ZW0A 2FUG1 1NI3A 1GTHA 1D4BA 1QT9A 4RCOA 1JWAD 2L32A 3AEFB 2LHEA 2ONQA 1H7XA 4DXFA 4MT5A 3MC0B 3U2SC 1E0ZA 4YT0B 2AQ1B 4IOIE 4XE0A 4PT5A 4H2AA 3VRAB 2PVGC 3E9SA 1WRIA 3AE4B 2IPKD 5C3JB 1K53A 1PGBA 1VDVA 4YTMB 4ITKA 1A70A 1HXYD 1PGXA 1J7BA 3Q8EA 1V97A 1JW9D 2WXIA 3MJ5A 4RNAA 3UI3A 1KH0A 1XCQL 4LTUA 1NEKB 1HQRD 1I4QA 3ZGZA 1BUIC 5BYRA 4GDKB 2V0GA 1T3QA 2NTTA 2BTEA 2E3TA 4ZRPA 1AWDA 4WWMA 1WGKA 2I38A 3R8BA 3TEZA 1I4RA 4GDLB 2K9XA 1D5ZC 5T8IA 2IGGA 1FNUA 1QQRA 1TS4A 3KQ4A 3V3XA 4LLGM 3W5UB 4XDCA 4ZYSA 1FFVA 1YN3A 4MACA 2G9HD 1JWSD 1RWSA 1ZXIA 4JX1C 1L0VB 4RGMA 3URYA 2L83A 2X38A 1JALA 4ZHPA 3ZYYX 1TS5A 2LMCA 4OW0A 3WCQA 1AN8A 3GP7A 1QOFA 5BMIA 3NVZA 1CQVA 1ZUD2 3LXFA 5HHDG 1C4AA 2VZKD 1V8CA 3EGRA 3AEEB 1DYQA 2KMMA 4ARCA 3VR9B 2JX5A 2K5PA 3BWUD 3J9CA 2V3NA 1MPEA 2V3PA 1B1ZA 4WQMA 1GAQB 3AECB 1FCCC 1GOZA 3H8HA 2WXPA 1QF6A 3Q8CA 1QLBB 3NS1A 2WXMA 5G5HA 4RF0A 2PLPA 2Y5PA 3HVZA 2MJEA 3ZJUA 1WSPA 2RDGA 4N59A 5EE0A 3T3NA 4WH4A 2WQYB 1FRDA 1XO3A 4ZRQA 1YQ4B 1B9RA 1FO4A 1SEBD 1D5XC 3DWGC 1SSNA 1ZP0B 1C76A 1XEEA 4NAWB 1ET6A 3O13A 3BYTB 2M0AA 3Q8AA 3AEAB 1QILA 1PUTA 1TKGA 3FAHA 1KTKA 3IAM1 3U4EG 1TYGB 1C4PA 2WXRA 2IJ0A 2SAKA 3NVYA 5I4DA 3CF4A 1J7AA 5TSSA 1RYJA 2LHDA 2ICIA 2IDYA 1YQ3B 1F77A 1VJKA 2QMTA 1UWMA 3NVWA 2WS3B 3AEGB 4A90A 1K52A 2WXNA 1ZOYB 4NJCA 2DLBA 1EM7A 2RPVA 3NUHB 1K51A 1SXTA 1YJJA 1N60A 1QOAA 1XLQA 1PGAA 1ROEA 1OQRA 3R2TA 2JYEA 3IT4B 1SIJA 1F2RC 1GB1A 3AE3B 3AH7A 3FILB 1SF0A 1YN5A 1YJIA 3IXSA 2Y5CA 4KGTA 3RPFC 2JWUA 1JWUD 3TSSA 3MFGA 3GS2A 1UGJA 3AEDB 1TS2A 4YWGG 4B0MA 1UUPA 1DGJA 4AS1A 2N0SB 4HKQA 3FC4A 2CJNA 2K22A 2LFIA 1ZE3D 2INNE 4RGNA 2TSSA 4TMAB 1MHXA 3RFZB 3AE5B 1F2RI 1GT8A 3TUOA 1WWTA 4ARIA 3BK1A 5D3DA 4YSXB 1OFFA 1C77A 3KLSX 1F0ZA 1PFDA 3AN1A 2MJDA 1STEA 2EKIA 2BT6A 3T3OA 5GXGB 4MH8A 1FIQA 2AQ3B 3P1MA 4KKJA 1QOGA 2RDHA 1FXAA 4RGTA 4YXDB 3MHZA 1ZDXA 1P7EA 1E6EB 2WXJA 2M19A 2CU3A 4YSYB 4A55A 1MHHE 4NAMA 2YEPF 1TY2A 3BVGA 3Q8FA 1HEZE 1CZPA 2BB5A 4L2YA 1SE2A 3B9JA 1SB3C 2QEJC 4IDIA 1VZ7A 1VZ8A 1TS3A 5H8YE 4XWWA 1SJHD 3ETRA 1EU4A 1HZ5A 2KN4A 1TZOA 3TEXA 1TY0A 2QIEB 1EWCA 4OHJA 1E7PB 1HA5A 1FNVA 1VRAB 2W55A 4USAA 2J4XA 5HI1A 1C79A 3VQIA 2B76B 4IKGA 2Z8LA 2W3RA 2I2YA 5AUKA 2KAJA 1N5XA 2W82A 2OHFA 5D3IB 3P4RB 1V1PB 2WU2B 2WNMA 3P63A 1XF5L 4REZA 1DOYA 4XWTA 3OWEB 1TKEA 4YSZB 3B2FA 3GB1A 3TEYA 2LEKA 2INPE 1YNTE 1AYFA 2WXLA 2JSVX 1JMLA 3U7ZA 1C78A 1T6BX 5JXVA 1IBXB 4RH6A 2DYOA 4AQ7A 3P4PB 2AQ2B 5BYQA 3HVDA 1J7CA 4O1NA 4US8A 2H89B 3AE9B 5G5GA 1RFKA 1FEHA 1FRRA 3CWIA 1HZ6A 3AE1B 1Q10A 1NYRA 2DYMA 3BZDB 3ZJVA 1WXQA 4L1BA 2QILA 2JXTA 2R61A 3IT6B 4TQ0A 2K3UA 4KX6B 2WXOA 4HKZE 2K0PA 4OZCA 2H88B 4LK0M 2FBWB 2NTSA 4KGRA 4P6VF 4ZHOA 4RF1A 3DWMA 2LJIA 2PW9A 1V1PA 1L5PA 2OEDA 3PZ7A 1FD6A 1L6UA 1SE4A 3HRDD 1Y56A 3AV8A 5C2TB 1JRPA 2BBCA 3LYYA 3AE2B 3E56A 3AB5A 1SE3A 4C56C 3ZJTA 2J53A 2WLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  1GT8 A;  2L83 A;  1WWT A;  1XLN A;  3ABV B;  3SFD B;  2BS3 B;  3W9C B;  4YSX B;  1XLO A;  1OFF A;  2MJ3 A;  1FM0 D;  1JAL A;  4ZHP A;  2WDV B;  1TKY A;  3BII D;  1R7S A;  3ZYY X;  1F0Z A;  1PFD A;  1FMA D;  3WCQ A;  3AN1 A;  1QOF A;  3VR8 B;  2MJD A;  3NVZ A;  1ZUD 2;  1KRH A;  2EKI A;  1GTE A;  2BT6 A;  3LXF A;  1IUE A;  4FXC A;  4JX1 C;  4JWU C;  1V8C A;  1N63 A;  1JQ4 A;  2W54 A;  1E9M A;  5GXG B;  1EWY C;  2BS4 B;  2WDQ B;  1FIQ A;  2HTM E;  4YTN B;  3P1M A;  2BS2 B;  1QOG A;  5EE3 A;  2WDR B;  1WYG A;  4C80 A;  3AEE B;  1FXA A;  3HUI A;  4YXD B;  2CJO A;  2KMM A;  1NVI D;  3VR9 B;  1E6E B;  3AE6 B;  2JX5 A;  2K5P A;  1N61 A;  1FXI A;  2WU5 B;  3P4S B;  2M19 A;  2WLB A;  2CU3 A;  4YSY B;  4HRS A;  5EE9 A;  3W5V B;  4N58 A;  2MH7 A;  4US9 A;  1CZP A;  2PKO A;  4WQM A;  2DBY A;  3B9J A;  1GAQ B;  3AEC B;  5H92 C;  3AEB B;  4C7Z A;  3P4Q B;  1SB3 C;  4IDI A;  3AMZ A;  3SFE B;  3AE8 B;  4HRO A;  4N6E B;  1QF6 A;  4JWS C;  5H8Y E;  1E10 A;  1OQQ A;  1QLB B;  2Q5W D;  3ETR A;  1VLB A;  1GPX A;  3NS1 A;  5G5H A;  1JRO A;  2L52 A;  1DOI A;  2QIE B;  1N62 A;  3HVZ A;  1E7P B;  2MJE A;  4N59 A;  5EE0 A;  4ZOH C;  1NYQ A;  5EE1 A;  2WQY B;  1FRD A;  1XLP A;  1XO3 A;  2W55 A;  4USA A;  1KF6 B;  1YQ4 B;  2B76 B;  3VRB B;  2PIA A;  1B9R A;  2W3R A;  5MPO A;  1FO4 A;  5AUK A;  1H7W A;  2KAJ A;  1N5X A;  3DWG C;  1FFU A;  1L6V A;  3P4R B;  1ZP0 B;  2WU2 B;  2OHF A;  3P63 A;  2AX5 A;  1DOY A;  3EUB 2;  1TKE A;  3AEA B;  4YSZ B;  1NI3 A;  1PUT A;  1TKG A;  2LEK A;  1GTH A;  3B2F A;  3FAH A;  2G1E A;  1QT9 A;  1AYF A;  1TYG B;  1JWA D;  3AEF B;  1H7X A;  3NVY A;  1E0Z A;  3CF4 A;  3PO0 A;  1J7A A;  4ZHO A;  3CIR B;  1NEN B;  1RYJ A;  3LB8 C;  4YT0 B;  2DWQ A;  3P4P B;  1YQ3 B;  1JWB D;  1N5W A;  1CJE A;  3VRA B;  1J7C A;  2PVG C;  4US8 A;  2H89 B;  3AE9 B;  1VJK A;  1WRI A;  3NVV A;  1RFK A;  3AE4 B;  1UWM A;  5C3J B;  3AM9 A;  3NVW A;  1FRR A;  5G5G A;  3CWI A;  2WS3 B;  3AEG B;  4YTM B;  1VDV A;  2W3S A;  4ITK A;  3AE1 B;  1A70 A;  1ZOY B;  1NYR A;  1TJE A;  3KWL A;  3NRZ A;  1WXQ A;  1J7B A;  1V97 A;  1JW9 D;  4KX6 B;  4C7Y A;  1PDX A;  1YJJ A;  1N60 A;  2JQR B;  1QOA A;  3SR6 A;  1XLQ A;  2H88 B;  4P6V F;  2FBW B;  1I7H A;  1NEK B;  1QOB A;  1OQR A;  1ROE A;  4LTU A;  2ACZ B;  4YTP B;  3B2G A;  2M56 B;  3DWM A;  1SIJ A;  1T3Q A;  2E3T A;  3AE3 B;  3AH7 A;  1AWD A;  2PVO D;  1L5P A;  3AE7 B;  1SF0 A;  1WGK A;  2QJL A;  4WWM A;  1L6U A;  2WP9 B;  1YJI A;  3HRD D;  3L4P A;  2Y5C A;  3AV8 A;  5C2T B;  3RPF C;  2K9X A;  1DOX A;  1JRP A;  4A9A A;  3AED B;  3AE2 B;  1DGJ A;  3W5U B;  2N0S B;  3AB5 A;  1FFV A;  1KFY B;  1RM6 C;  3FC4 A;  2CJN A;  2K22 A;  5AUI A;  1RWS A;  1ZXI A;  1L0V B; 
#chains in the Genus database with same CATH topology
 4OVU A;  2V1Y A;  2K8C A;  3Q2A C;  4Q2J A;  1JCK B;  4I6N B;  5BMG A;  3BYY B;  3NZS A;  4NJ7 A;  3SEB A;  2DEN B;  1LM8 B;  3MJW A;  1GTE A;  2VH1 A;  2WXH A;  1AW7 A;  3DVN U;  3A9K A;  1T5X D;  2KDI A;  4P1B C;  1YX5 B;  4N9F 4;  1YIW A;  4M0W A;  3IBE A;  3ZXV A;  1VR9 A;  1L0Y B;  1CK1 A;  2V3S A;  4WJO A;  2W9N A;  2D2Q A;  2KDM A;  2PJH A;  1E8Z A;  1I4P A;  2KAN A;  1L4Z B;  2Y3A A;  1N62 A;  1C4C A;  1WGD A;  1M4V A;  2BYE A;  3C8Y A;  4GLS C;  4P16 A;  2L1A A;  4OVV A;  2LUM A;  1YMH E;  3VUX A;  3A4S C;  2LGX A;  2MRP A;  3W2D A;  1WY8 A;  1ZDV A;  3MP9 A;  2RMM A;  3V61 A;  1GNU A;  4K3C A;  1MVK A;  3PO0 A;  5BO4 B;  1P7F A;  2IO2 B;  3CIR B;  1NEN B;  2HJ1 A;  2DWQ A;  4G11 A;  1E8X A;  2E6X A;  1RLF A;  2BB6 A;  4B6W A;  4A6Q A;  5JZE B;  1J0G A;  3NVV A;  1D5M C;  3KWL A;  5HFY A;  3UIO B;  2AEH A;  2GI9 A;  4XDD A;  3JSV B;  2IO1 B;  1I7H A;  4YTP B;  1ET9 A;  1GB4 A;  4EZL A;  1P1A A;  3WAO A;  4NPN A;  2ASQ A;  3A9J B;  1DOX A;  2ZVN A;  4IW0 A;  3RYT A;  4HVB A;  2V4L A;  4W9C A;  3H9D A;  2M8S A;  2N7E A;  2QSD A;  1WMH B;  3ABV B;  2JXX A;  1FCL A;  1XLO A;  4NZL B;  5FR3 A;  5BYS A;  3DPD A;  2KJ6 A;  3V6E B;  2PE9 A;  1L4D B;  2N9E B;  1E7V A;  3DBR I;  3PZ8 A;  3VHT C;  1V81 A;  3U30 A;  2KX3 A;  3PVL A;  4IUM B;  2LD9 A;  1IBX A;  1TIF A;  4M02 A;  5EE9 A;  3Q3N C;  2Z0D B;  4ASW C;  3AEB B;  3KUD B;  4FAD A;  4FJY A;  4JPS A;  1R4N I;  1GPX A;  1BXT A;  3DVG Y;  3ENE A;  1WH3 A;  3BIN A;  4OZB A;  2L0F A;  3X0W A;  5FKA C;  2PIA A;  1ZKH A;  5MPO A;  5CHF A;  3ZTC A;  2QC8 A;  4A9A A;  1V6E A;  2FUH B;  4W9F A;  3UIP B;  2L76 A;  1GTH A;  3DVN V;  3WAM A;  2M17 A;  1E0Z A;  1XQQ A;  3DBH B;  2KKC A;  4XX5 A;  3PPA A;  4K3B A;  3GOE A;  4HCP B;  4PT5 A;  3ZUN A;  1P9D U;  2IPK D;  1PGB A;  1VDV A;  4YTM B;  4ITK A;  4W9K A;  1HXY D;  5AZG A;  1V97 A;  1P0R A;  2NBV B;  4MEL A;  1KH0 A;  1XCQ L;  4IM3 A;  1HQR D;  1BUI C;  3SU8 X;  3U7D A;  1MG4 A;  1C3T A;  3CST A;  4W9I A;  3QK0 A;  4ZRP A;  2I38 A;  3H7P A;  2BKF A;  3M3J A;  1I4R A;  4KDL B;  3RUL A;  2JZ3 B;  1TS4 A;  4LLG M;  4ZYS A;  2NS5 A;  2LWP A;  3QA8 A;  3PLV A;  3RNF C;  3NOB A;  4ZHP A;  4DBG A;  2D11 A;  1TS5 A;  2LMC A;  2M4N A;  1QOF A;  3GP7 A;  3NVZ A;  1ZUD 2;  3LXF A;  3UF8 A;  1C4A A;  1V8C A;  3IHP C;  2HE7 A;  2K8B A;  2EMT A;  2OJW A;  2D3A A;  2KTR A;  4ARC A;  3VR9 B;  2K5P A;  3L13 A;  3J9C A;  4GDL A;  3DDC B;  4KZC A;  4X57 B;  4WQM A;  3TIX A;  1GAQ B;  3L10 B;  4LNN A;  4TV3 A;  3DCG A;  3OAW A;  1T0Y A;  2IBI B;  2DAF A;  2O6V B;  3SD5 A;  4DK5 A;  2MJE A;  2ZCB A;  4WJQ A;  3RNG C;  1WI0 A;  4N59 A;  3VTU A;  3N30 A;  2M0X A;  2FID A;  2WWZ A;  2AL3 A;  3QWZ B;  2I1K A;  1RFA A;  1UEL A;  4NAW B;  1XEE A;  4GMV A;  2M0A A;  3AEA B;  1QIL A;  4BKT A;  1KTK A;  2GLS A;  2IY0 B;  2BQQ A;  3KUC B;  4HJK A;  2IJ0 A;  1J7A A;  1S3S G;  1TTN A;  2N1W A;  1F77 A;  1PQS A;  3AEG B;  4A90 A;  2JPH A;  2CR5 A;  4BFR A;  1ZOY B;  4NJ6 A;  1SXT A;  5EDS A;  1GC7 A;  1OQR A;  2JYE A;  2MP2 B;  4C00 A;  2EKE C;  2C60 A;  3AE3 B;  3AH7 A;  3FIL B;  2OOB B;  3HIZ A;  1YN5 A;  3RPF C;  2JWU A;  3TSS A;  1UGJ A;  4YWG G;  1GJZ A;  3HK0 A;  4HKQ A;  2LRW A;  1ZE3 D;  2TSS A;  3RFZ B;  1WWT A;  3BK1 A;  4LDT B;  2J0K A;  2KX0 A;  4BBN F;  2INC C;  3FKY A;  1H4R A;  2KYW A;  2K6Q A;  2AQ3 B;  1TT5 B;  2BKR B;  3TCA A;  4YXD B;  1ZDX A;  2ZPY A;  4HLE A;  3EHV A;  4BZA A;  2KMA A;  4ZDV A;  3BVG A;  1HEZ E;  1CZP A;  2BB5 A;  2CU1 A;  2QEJ C;  3BY4 B;  1VZ8 A;  1MG8 A;  5G2N A;  4XWW A;  1EU4 A;  2A4Z A;  2KN4 A;  3TEX A;  3ZDM C;  1HA5 A;  5GMV A;  1KOT A;  5AZF A;  2MQJ A;  2QCZ A;  4IKG A;  3KYC D;  2Z8L A;  1V1P B;  4EFO A;  3P63 A;  1XF5 L;  4B95 A;  3OWE B;  3N1X C;  4YSZ B;  2LEK A;  3RNA C;  3LJ3 A;  3I5J C;  1AYF A;  2WXL A;  3U7Z A;  1WYW B;  2KXJ A;  1MJD A;  3KH0 A;  4W9G A;  4BOS C;  3P4P B;  5L95 C;  3AE9 B;  2D3C A;  3VH3 B;  5G5G A;  1RFK A;  4EZJ A;  3BZD B;  1NYR A;  2DYM A;  3P2B A;  1UBQ A;  2XBB C;  4G3X B;  4L1B A;  2R61 A;  3IT6 B;  4TQ0 A;  1Z2M A;  4OZC A;  1XD3 B;  2L3Z A;  3DBL B;  4XGA B;  1KM7 A;  2MSE D;  1SE4 A;  5C2T B;  3LYY A;  3ZO5 B;  2ZEQ A;  4ICV A;  2Z59 B;  3AE2 B;  3VVW B;  3MC9 A;  4BVU C;  3AB5 A;  1XLN A;  3SFD B;  1WJU A;  1I4H A;  1ENF A;  2WX1 A;  2NMQ A;  1GG3 A;  1JRU A;  1QKZ A;  2W54 A;  1UNS A;  2PPH A;  4JL9 A;  1ZPS A;  3HUI A;  2CKH B;  1LO5 D;  4JWU C;  1LGR A;  1N61 A;  2WU5 B;  2C9W B;  2UYZ B;  4K7U A;  2MH7 A;  4TSS A;  5D7G A;  1UWX A;  1MFW A;  2KNB A;  3NZ3 A;  2MEK A;  2GBR A;  2N9K A;  3AE8 B;  3L16 A;  5IO9 A;  1OQQ A;  1VLB A;  2KD0 A;  3WAP A;  3V62 A;  3ZVV A;  5BMH A;  4KSL C;  1D6E C;  3TMP B;  1E8W A;  2XN9 C;  4A8X C;  1M94 A;  2LGY A;  3UQB A;  2MHJ A;  1I42 A;  1GC6 A;  3AU5 A;  2AX5 A;  4UDU C;  3EUB 2;  3PLU A;  4KV2 A;  4W9L A;  3N1Y C;  3CSF A;  4ANU A;  1WXS A;  2G45 B;  4JE3 B;  3PRZ A;  5DPS A;  2N9L A;  4OZA A;  3LB8 C;  4FHJ A;  3TJP A;  4AOF A;  4E3C A;  5LNK 1;  5DPW A;  1CJE A;  3EEC A;  3AM9 A;  1NBF C;  4B9K A;  1TZ1 A;  2W3S A;  1JWM D;  2WHI A;  1WJN A;  4M8N A;  2NPT B;  1WF9 A;  2NVU I;  2KDE B;  2KT7 A;  1YN4 A;  1UZX B;  2LZ6 A;  2WXG A;  2KAC A;  4MM3 B;  2KHW B;  1KLU D;  3RUI B;  3AE7 B;  4KGS A;  1BML C;  1LQB A;  3MC8 A;  3ALB A;  2R2O A;  2KWD A;  4WUR A;  2XK5 B;  1NI2 A;  2PEA A;  3NY5 A;  3OJ4 B;  4CYE A;  3KUZ A;  2ZCC A;  1I4X A;  4ZYN A;  4CO7 A;  3BII D;  1IYF A;  2YVC A;  1C9F A;  1IUE A;  3JYU A;  1Q1O A;  1WX8 A;  1E9M A;  1EWY C;  1WX7 A;  4YTN B;  2KQ4 X;  1R4N B;  1VCB A;  3AE6 B;  5EE3 A;  4M8M A;  1UGM A;  3A9J A;  4C80 A;  4GIV A;  1QZE A;  5LLI A;  4IM2 A;  2DBY A;  3AMZ A;  2YEP B;  5HG2 A;  1YOV B;  3PSE B;  4CQN A;  3H6N A;  4LJP B;  5J18 A;  1JRO A;  1WMH A;  2Z0E B;  3VAW A;  1WR1 A;  1E5W A;  4LNF A;  4ZOH C;  3VUY A;  4B0E A;  4W9E A;  2KN5 A;  2DYB A;  4EE2 A;  3BVZ A;  3R66 C;  1L6V A;  5C23 A;  2LXA A;  3AU4 A;  4DHJ D;  4IC7 B;  2R2Q A;  3B08 A;  2ONQ A;  2BF8 B;  3U2S C;  3GZN I;  4K7S A;  5JHA A;  3EFU A;  2AQ1 B;  1WXM A;  4IOI E;  3ZKJ C;  2PVG C;  3E9S A;  4PS8 A;  5C3J B;  1K53 A;  5IAA C;  2LRU A;  4JLC A;  2L05 A;  4II2 B;  3L08 A;  3A1Q B;  3UI3 A;  1NEK B;  4AJY B;  3ZGZ A;  4MSQ B;  2V0G A;  2NTT A;  1AWD A;  3M62 B;  3ZNG C;  3ZNI D;  3TEZ A;  2K9X A;  1TBE A;  1Y8R C;  3RCZ A;  3KQ4 A;  1WGH A;  1V49 A;  1YN3 A;  4JX1 C;  1UD7 A;  2L83 A;  2FCQ A;  3APD A;  3PV1 A;  2BYV E;  1JAL A;  5D94 A;  3ZYY X;  3DHH C;  1LFD A;  4ICU A;  5HHD G;  2VZK D;  4S17 A;  4KIK A;  3RT3 B;  1UBI A;  1DYQ A;  2JX5 A;  4EZK A;  1MPE A;  4WAA A;  1B1Z A;  2OJR A;  1FCC C;  3H8H A;  4MGI E;  1QF6 A;  3ZRC A;  4ZRI A;  3K9P B;  1QLB B;  2WXM A;  5G5H A;  3ZJU A;  2RDG A;  5E6O A;  3VUW A;  4WH4 A;  2ZZP B;  3OJ3 A;  4HPL B;  1FO4 A;  1D5X C;  4I6L B;  3DWG C;  1C76 A;  3IAM 1;  1PUT A;  3FAH A;  3T9L A;  1TYG B;  2RDB C;  2FCN A;  3SHQ A;  3NVY A;  3CF4 A;  3A9K B;  3L17 A;  2IDY A;  1YQ3 B;  1WGG A;  4EUT A;  1UWM A;  3NVW A;  2O6V D;  3MTN B;  2L7R A;  4NJC A;  2DLB A;  5KHQ A;  3NUH B;  2DZI A;  2LAS A;  5IKC M;  1QOA A;  1XLQ A;  4URK A;  3R2T A;  2WYQ A;  3IT4 B;  4NAW A;  3AUL A;  1SF0 A;  2C7N B;  4K7W A;  4WWN A;  3Q3O C;  3IXS A;  1CMX B;  1TS2 A;  4AS1 A;  3ECI A;  4LNO A;  2BGF A;  2D07 B;  4JGH B;  2K22 A;  1L2N A;  2NBU A;  2G3Q B;  5D3D A;  1C77 A;  3KLS X;  4PK1 A;  3VXW A;  2DZM A;  1PFD A;  3AN1 A;  2MJD A;  3IVF A;  4ACF A;  2MP2 A;  2KJR A;  4KKJ A;  1QOG A;  2ZPN A;  4RGT A;  1E6E B;  2WXJ A;  2RGF A;  2BYF A;  3DOW A;  1F52 A;  3UIN B;  4A55 A;  4NAM A;  5E6N A;  1IPG A;  4LJO B;  2D10 A;  4IDI A;  1TS3 A;  5TR5 A;  1SIF A;  3ETR A;  4W9J A;  1TZO A;  1TY0 A;  2QIE B;  4OHJ A;  1E7P B;  1FNV A;  1VRA B;  3PT2 B;  4LDT D;  4GDK A;  2J4X A;  1D3Z A;  1C79 A;  5DPR A;  2K25 A;  3VQI A;  2B76 B;  5FR6 A;  3ZXR A;  2MBB B;  2W82 A;  1UH6 A;  3P4R B;  2WNM A;  1DOY A;  1SGH A;  2MBO A;  4WWP A;  3TEY A;  2JSV X;  4A3P A;  2KQ7 A;  2BPS A;  5JXV A;  1IBX B;  4RH6 A;  2DYO A;  2AQ2 B;  5BYQ A;  1J7C A;  4US8 A;  1E7U A;  4EKU A;  1FRR A;  3PHX B;  2YLM A;  2MA9 B;  3HM6 X;  5DCN A;  2RSU A;  3QHT A;  4M01 A;  4KX6 B;  5AZH A;  4HKZ E;  4ZHO A;  4LK0 M;  4IWO A;  4RF1 A;  2PW9 A;  1V1P A;  1OQY A;  1L5P A;  2OED A;  3PZ7 A;  2O2V B;  1FD6 A;  3HRD D;  3AV8 A;  1JRP A;  3D32 A;  4E71 A;  2NR2 A;  2IYD B;  1SE3 A;  3ZJT A;  2J53 A;  4MSM B;  2WLB A;  1VZ6 A;  3M63 B;  3Q69 A;  2WXQ A;  1ESF A;  4J3O D;  3W9C B;  4DXG A;  2MJ3 A;  2DNF A;  4EOY A;  2CHZ A;  1JQ4 A;  1N63 A;  3GE8 C;  1ISN A;  2J0J A;  2L8J A;  2KOX A;  3RNB C;  2WDR B;  4NQL B;  1NVI D;  4HRS A;  4HJG E;  1R4M I;  2BVC A;  1VD2 A;  4ZRJ A;  5H92 C;  3H7P B;  3V05 A;  4C7Z A;  3P4Q B;  4FBJ B;  1KLG D;  4HRO A;  4JWS C;  2IY1 B;  2GB1 A;  4JQW C;  2L52 A;  1EO6 A;  1K50 A;  1XCT L;  2CHX A;  4MGK E;  3PHW B;  2C7M B;  1X1M A;  2RPQ A;  3C0R B;  3KWV A;  1OEY J;  3KW5 B;  3AI5 A;  4HPM B;  4C4V A;  2G1E A;  3PZD A;  2PMV A;  2AWT A;  2KTR B;  4F8C B;  3QCA A;  1G6J A;  4DHZ B;  3LDZ E;  3Q3M C;  1JWB D;  1N5W A;  1ACC A;  2MLB A;  3DVG X;  1FPY A;  3ZIM A;  2V4I B;  3TBL D;  1TJE A;  4MJS B;  3C19 A;  3NRZ A;  1ZXH A;  2Y5B B;  1MI0 A;  4C7Y A;  4HXD A;  3Q3J A;  2ACZ B;  1EU3 A;  2M56 B;  2CHW A;  3RN9 C;  1PYW D;  3VTV A;  2PVO D;  2WP9 B;  3B1L X;  3ZQ4 A;  1F1H A;  2LJ5 A;  4XZ4 A;  4MGZ E;  4GOC A;  1XXG A;  2EMS A;  3QJZ A;  4IM0 A;  2KWV B;  5AUI A;  2LUE A;  2JYT A;  5E6J A;  3X23 A;  2NPT A;  1K8R B;  3BVM A;  2ZNV B;  4FHK A;  4P1C C;  1FMA D;  2HDE A;  1U4A A;  2BWE S;  3N3K B;  4W9H A;  2BS4 B;  2WDQ B;  4PS3 A;  1WYG A;  1V9J A;  1V80 A;  4KKI A;  3RD2 A;  2J42 A;  4WAF A;  3P42 A;  4N58 A;  1NDD A;  2JWZ A;  2ON8 A;  3BK2 A;  4KSK C;  2FNJ B;  1L0X B;  4R3D A;  3EA6 A;  3VFK A;  3ML9 A;  4HEA 1;  2FCM A;  1XLP A;  1OGW A;  2DHZ A;  2KQS A;  3GZN B;  3JVZ X;  4FUL A;  4NQK E;  2IO0 B;  2D5G A;  2ZW0 A;  1V86 A;  2FUG 1;  1C1Y B;  2N1V A;  3JW0 X;  5DPT A;  2KFJ A;  4RCO A;  3VH4 B;  1JWA D;  2L32 A;  2KFK A;  3MC0 B;  2RR9 A;  2AYO B;  2KMC A;  2N7D A;  2JRH A;  2MBQ A;  2KK8 A;  4XE0 A;  3AE4 B;  4ANV A;  4TKN A;  3RNC C;  1WZ0 A;  3Q8E A;  2KTF A;  1JW9 D;  2WXI A;  3MJ5 A;  4RNA A;  3PRP B;  4ZRK A;  4LTU A;  3K9O B;  1I4Q A;  5BYR A;  1T3Q A;  2BTE A;  3ONS A;  2UWQ A;  5E6P A;  4WWM A;  5LXI B;  2LGD A;  1D5Z C;  4IWQ A;  5T8I A;  2IGG A;  1FNU A;  1YJ1 A;  3V3X A;  3W5U B;  4XDC A;  4MAC A;  2G9H D;  1JWS D;  3NG0 A;  2HTH A;  1E90 A;  5D6J B;  4G50 A;  3A1Q A;  2WX0 A;  3WCQ A;  5BMI A;  4KDI C;  1WJ4 A;  2DZJ A;  4YL8 A;  3EGR A;  3AEE B;  2A5U A;  4DDG D;  1WGR A;  4BAX A;  2KMM A;  3BWU D;  2V3N A;  1P3Q U;  2MBE A;  1GOZ A;  3Q8C A;  2LVQ A;  2NCN A;  3U8Z A;  3JSV A;  2QDF A;  1WSP A;  3T3N A;  1Q5W B;  3A33 B;  2WQY B;  1XO3 A;  4ZRQ A;  4QAY A;  1SEB D;  1V5O A;  3ZDT A;  1ET6 A;  3WAL A;  5CX3 A;  3Q8A A;  4BOZ B;  2WXR A;  2GBM A;  2SAK A;  3R7R A;  1HTQ A;  2C5L C;  3V6C B;  1WXA A;  5TSS A;  3H1U A;  2ICI A;  4GN1 A;  3UQA A;  4XC2 A;  3PS6 A;  3NHE B;  1VJK A;  2QMT A;  1T0R C;  2G4D B;  1K52 A;  3RMK C;  2J0M A;  4WWO A;  5IN7 A;  1PGA A;  3PRM B;  4FA6 A;  4A20 A;  3N20 C;  2FAZ A;  2K6D B;  4GU2 A;  2BWF A;  4MGY E;  3VDZ A;  1YJI A;  2Y5C A;  1JWU D;  4AWJ A;  3AED B;  3CMM B;  1UUP A;  1DGJ A;  4WQO B;  3FC4 A;  3CF6 E;  2CJN A;  3QIJ A;  1XT9 B;  4RGN A;  4TMA B;  3QAR A;  4W9D A;  1F2R I;  1GT8 A;  3A4R A;  3TUO A;  4HDQ A;  4ARI A;  2C7H A;  1AAR A;  1STE A;  1IP9 A;  2BT6 A;  5GXG B;  3P1M A;  1EF1 A;  2I1J A;  2PE6 B;  4HCN B;  2RDH A;  1FXA A;  1P7E A;  4RMA A;  2CU3 A;  3NJT A;  1Z5S B;  1TY2 A;  2YEP F;  3Q8F A;  1SE2 A;  3B9J A;  1SB3 C;  1VZ7 A;  1WRD B;  2DX5 B;  3QX1 A;  1HZ5 A;  3NZU A;  4PYU A;  4EEW A;  3WA0 A;  2W55 A;  3TL5 A;  3Q14 C;  2N9P C;  2W3R A;  3O65 B;  2KAJ A;  4KZ0 A;  5D3I B;  4REZ A;  2WU2 B;  3EFC A;  3W1Y A;  3I63 C;  1C78 A;  2ZVO A;  4AQ7 A;  4MDK E;  3HVD A;  4O1N A;  2H89 B;  3Q3F A;  1FEH A;  3CWI A;  1WJ6 A;  3KYD D;  1Q10 A;  1WM2 A;  4DWF A;  1WXQ A;  2IND C;  2QIL A;  3RZF A;  2K3U A;  1RRB A;  5C1Z A;  2K0P A;  4AP4 C;  2H88 B;  2FBW B;  2NTS A;  4KGR A;  4TUU A;  3DWM A;  2KO3 A;  3M95 A;  4NY0 A;  1L6U A;  5CTR C;  4CHK A;  1Y56 A;  4DHJ B;  2BBC A;  2O6V A;  5CHW A;  3E56 A;  4M0W B;  4WJP A;  2MWS B;  3QAQ A;  2JF5 A;  1TGZ B;  4C56 C;  1EUV B;  1BT0 A;  3ZLZ A;  2MW5 A;  1KJT A;  1FM0 D;  2LGS A;  1TKY A;  1R7S A;  4IG7 B;  2K39 A;  3SDL C;  1R4M B;  1KRH A;  4BKG A;  3RI7 C;  1KLV A;  2L00 B;  2HTM E;  2KC1 A;  2BS2 B;  2LI5 A;  2XEW A;  2O2V A;  3R7Q A;  4F7Z A;  3P4S B;  2QHO A;  1IGD A;  4WIP A;  4US9 A;  2GBN A;  2PKO A;  3I57 A;  3HM3 A;  3W1S A;  3SFE B;  1WM3 A;  4RFB A;  4OVZ A;  2Q5W D;  1DOI A;  3U52 E;  2JRI B;  2FE8 A;  5FK9 C;  3ML8 A;  4M00 A;  2IGD A;  4FJZ A;  1KF6 B;  3FIL A;  2IGH A;  3VRB B;  4NNJ B;  1WFY A;  3R2I A;  1H7W A;  4DQO C;  2VZK B;  4S0R A;  1V1O A;  4FLH A;  2HD5 B;  3V60 A;  1J19 A;  2JY6 A;  2BYT A;  4KIK B;  3NS8 A;  3H7S A;  4GB9 A;  1YX6 B;  1OEY A;  3IG3 A;  2SEB D;  2KZR A;  3EC8 A;  2RD0 A;  3R3M A;  4G0N B;  1IGC A;  3KVF B;  1FNW A;  1PDX A;  1EF5 A;  2JQR B;  3SR6 A;  3MHS D;  5CHV C;  1QOB A;  3B2G A;  2VRR B;  3B0A A;  2KVR A;  3DQV A;  2QJL A;  3WIM A;  2EEL A;  3S2A A;  3L4P A;  2JUO A;  5J2R A;  3RZW C;  5J17 A;  5IP4 D;  2N7J A;  1KFY B;  1RM6 C;  4II3 B;  2BW2 A;  3IAS 1;  1SJE D;  1ZGU B;  2KDF B;  3TEW A;  2BS3 B;  3I9V 1;  4MJS A;  3ZRF A;  5AEK B;  2WDV B;  4BBN C;  1YQB A;  2GMI C;  3VR8 B;  2JU6 X;  2KLC A;  4FXC A;  1I4G A;  5HKH A;  2WXK A;  1A5R A;  1SBB B;  3W1S C;  2LVO A;  3Q8B A;  2JZP A;  1OTR B;  4AJW A;  2CJO A;  4LCD E;  2JZZ A;  2ZW1 A;  1FXI A;  2LGI A;  4I6P A;  1ZW7 A;  3W5V B;  4RGO S;  4GXB A;  3L0W B;  2FIF A;  4TQ1 A;  3N9Y C;  2GBJ A;  2J52 A;  3L54 A;  4N6E B;  4AUQ C;  5IOI A;  1WZ3 A;  1E10 A;  4L23 A;  1WE7 A;  1NYQ A;  5EE1 A;  1V5T A;  2PTL A;  3OLM D;  2GRI A;  2XNA C;  4HDO A;  1HE8 A;  2J7Q B;  1FFU A;  4RM8 A;  2WXF A;  3DHG C;  4D2K A;  1NI3 A;  1Q0W B;  2VH2 A;  1D4B A;  1QT9 A;  3AEF B;  2LHE A;  4DXF A;  1H7X A;  2DAJ A;  4MT5 A;  3DBS A;  1V2Y A;  4YT0 B;  2K1F A;  2L0T A;  4H2A A;  3VRA B;  1WXV A;  1WRI A;  2MX2 A;  2AL6 A;  1YD8 U;  2REX A;  1A70 A;  1PGX A;  3APC A;  4JIO U;  1J7B A;  3DBH I;  5G55 A;  4HK2 A;  3Q6B A;  4A3O A;  1T0S C;  4GDK B;  5D2M B;  5JHB A;  2E3T A;  3AXC A;  2DZK A;  3DHI C;  5JH5 C;  1WGK A;  3R8B A;  4GDL B;  1QQR A;  2UU7 A;  2ZJD A;  3N32 A;  4MEM A;  4KVG B;  1FFV A;  5KHO A;  2FCS A;  4PS7 A;  1RWS A;  1ZXI A;  1L0V B;  4LNI A;  3APF A;  4RGM A;  3URY A;  4LNK A;  2X38 A;  4OW0 A;  1AN8 A;  1CQV A;  1J8C A;  4K81 A;  3HHM A;  4RM9 A;  2X8X X;  2IZV B;  2V3P A;  4J6I A;  2KJH B;  3AEC B;  2ZNV C;  2WXP A;  4DHZ E;  3NS1 A;  4DXA B;  2KWU B;  4RF0 A;  2PLP A;  2Y5P A;  3HVZ A;  5EE0 A;  2M1M A;  1HTO A;  1H8C A;  3ZTD A;  1FRD A;  4MM3 A;  4XYC A;  1YQ4 B;  4DDI D;  1B9R A;  3PTF C;  5L83 A;  1SSN A;  1ZP0 B;  3O13 A;  3BYT B;  2N4F A;  4MH0 E;  3U4E G;  1TKG A;  1I35 A;  1LXD A;  2MBH A;  1WX9 A;  1C4P A;  1T0Q C;  2XK5 A;  2LVP A;  5I4D A;  3T8M A;  2GOW A;  1RYJ A;  2LHD A;  3QC8 B;  2WS3 B;  2WXN A;  2N9X A;  3ZNZ B;  4ANX A;  1EM7 A;  2RPV A;  1K51 A;  3RNE C;  1WE6 A;  1N60 A;  1YJJ A;  1ROE A;  4FN2 A;  1SIJ A;  1F2R C;  1GB1 A;  1P98 A;  4HPP A;  1WR6 E;  3OG5 A;  4KGT A;  3N1Z C;  3MFG A;  3GS2 A;  4B0M A;  4C4V B;  2N0S B;  4PYZ A;  2D3B A;  2LFI A;  2INN E;  1MHX A;  2JVC A;  3AE5 B;  4F1S A;  4YSX B;  1OFF A;  2LXC A;  1GUA B;  4HWI B;  3QQ8 B;  1E8Y A;  2JT4 B;  1F0Z A;  2EKI A;  2GBK A;  4ANW A;  3T3O A;  5IA7 A;  3PRE A;  4MH8 A;  1FIQ A;  4E74 A;  4GSW A;  3MHZ A;  4BKS A;  2KLG A;  1WGY A;  2M19 A;  4BKS D;  4YSY B;  1S1Q B;  1MHH E;  5LXH A;  1SE9 A;  4L2Y A;  3WAN A;  2MCN B;  5H8Y E;  1SJH D;  2HJ8 A;  2KVZ A;  4FJV B;  1N6Z A;  1EWC A;  2KDB A;  2G4S A;  1WIA A;  4USA A;  5HI1 A;  1F9J A;  4WJN A;  2I2Y A;  5AUK A;  1N5X A;  2OHF A;  3ZW3 A;  2CS4 A;  4XWT A;  2IO3 B;  1TKE A;  3GB1 A;  3B2F A;  2INP E;  1YNT E;  2V9H A;  1JML A;  1L7Y A;  2D3G A;  2NBW B;  4IWP A;  1T6B X;  2WGS A;  4GGQ A;  2KWC A;  2KC2 A;  3ZNH B;  3PGE A;  2WDT B;  1FXT B;  3UGB B;  1HZ6 A;  3AE1 B;  1UF0 A;  3ZJV A;  2JXT A;  4P7I A;  3DBR B;  2WXO A;  2B3A A;  4P6V F;  2LJI A;  3VTW A;  3IFW B;  1RAX A;  4K1R B;  3I3T B;  3DBL I;  2K8H A;  2KFK B;  3GE3 C; 
#chains in the Genus database with same CATH homology
 1VZ6 A;  1XLN A;  3Q69 A;  3SFD B;  2WXQ A;  4Q2J A;  1ESF A;  1JCK B;  1ENF A;  1I4H A;  2NMQ A;  4J3O D;  3W9C B;  2MJ3 A;  4DXG A;  1FM0 D;  5BMG A;  1TKY A;  1R7S A;  3BYY B;  1QKZ A;  3SEB A;  1KRH A;  1GTE A;  1JQ4 A;  1N63 A;  2WXH A;  2W54 A;  1UNS A;  2HTM E;  1AW7 A;  2BS2 B;  2WDR B;  1ZPS A;  3HUI A;  1T5X D;  1LO5 D;  1NVI D;  4JWU C;  1N61 A;  2WU5 B;  3P4S B;  4HRS A;  4HJG E;  1IGD A;  2MH7 A;  4TSS A;  4WIP A;  4US9 A;  5D7G A;  2PKO A;  3I57 A;  1UWX A;  4M0W A;  5H92 C;  3V05 A;  4C7Z A;  1VR9 A;  3P4Q B;  3W1S A;  3NZ3 A;  1L0Y B;  2MEK A;  3SFE B;  3AE8 B;  1CK1 A;  1KLG D;  2N9K A;  4HRO A;  4JWS C;  4OVZ A;  4RFB A;  2GB1 A;  1OQQ A;  2KDM A;  2Q5W D;  1VLB A;  1I4P A;  2L52 A;  1DOI A;  1L4Z B;  2Y3A A;  1N62 A;  1C4C A;  1K50 A;  3U52 E;  1XCT L;  2FE8 A;  1M4V A;  3C8Y A;  5FK9 C;  5BMH A;  4GLS C;  2IGD A;  1D6E C;  4P16 A;  2L1A A;  1KF6 B;  2XN9 C;  3FIL A;  2IGH A;  2LUM A;  3VRB B;  1YMH E;  4A8X C;  3W2D A;  3R2I A;  1H7W A;  2AX5 A;  4DQO C;  1ZDV A;  2VZK B;  3KWV A;  4UDU C;  3EUB 2;  3MP9 A;  1V1O A;  2RMM A;  2G1E A;  2BYT A;  4JE3 B;  1MVK A;  2N9L A;  3PO0 A;  1P7F A;  2PMV A;  4OZA A;  3CIR B;  1NEN B;  3LB8 C;  2DWQ A;  5LNK 1;  2E6X A;  1JWB D;  1N5W A;  1ACC A;  1CJE A;  2BB6 A;  4A6Q A;  2SEB D;  3NVV A;  2V4I B;  3AM9 A;  1D5M C;  2W3S A;  1JWM D;  3KWL A;  1TJE A;  3NRZ A;  1ZXH A;  5HFY A;  1IGC A;  2GI9 A;  4XDD A;  1MI0 A;  4C7Y A;  1FNW A;  1PDX A;  2JQR B;  1YN4 A;  3SR6 A;  1I7H A;  1QOB A;  2ACZ B;  4YTP B;  1EU3 A;  1ET9 A;  2M56 B;  3B2G A;  2WXG A;  1PYW D;  2KAC A;  4MM3 B;  1GB4 A;  1KLU D;  2PVO D;  2QJL A;  3AE7 B;  2WP9 B;  2EEL A;  3L4P A;  3ZQ4 A;  4KGS A;  1BML C;  1DOX A;  1XXG A;  2KWD A;  2N7J A;  1KFY B;  1RM6 C;  4WUR A;  5AUI A;  2BW2 A;  3IAS 1;  1SJE D;  2QSD A;  3TEW A;  2JYT A;  5E6J A;  3ABV B;  2BS3 B;  3I9V 1;  1FCL A;  1I4X A;  1XLO A;  4NZL B;  3BVM A;  5FR3 A;  2WDV B;  3BII D;  5BYS A;  1FMA D;  2HDE A;  3VR8 B;  2JU6 X;  1L4D B;  1I4G A;  4FXC A;  1C9F A;  1IUE A;  1E9M A;  2WXK A;  1EWY C;  2BS4 B;  2WDQ B;  1SBB B;  4YTN B;  3PZ8 A;  2KQ4 X;  2JZP A;  1WYG A;  3Q8B A;  2CJO A;  3AE6 B;  5EE3 A;  4C80 A;  2ZW1 A;  1FXI A;  4KKI A;  1IBX A;  2LGI A;  5EE9 A;  2J42 A;  4WAF A;  3W5V B;  3P42 A;  4RGO S;  4N58 A;  4TQ1 A;  2DBY A;  3N9Y C;  3AEB B;  2J52 A;  3AMZ A;  4JPS A;  2YEP B;  4N6E B;  5HG2 A;  2ON8 A;  1E10 A;  4CQN A;  1GPX A;  1BXT A;  3BK2 A;  4L23 A;  1JRO A;  1L0X B;  4R3D A;  4ZOH C;  4B0E A;  1NYQ A;  3EA6 A;  4OZB A;  5EE1 A;  4HEA 1;  1XLP A;  2PTL A;  5FKA C;  2GRI A;  2PIA A;  4EE2 A;  2XNA C;  5MPO A;  3BVZ A;  4A9A A;  2D5G A;  1FFU A;  1L6V A;  2WXF A;  4D2K A;  2ZW0 A;  2FUG 1;  1NI3 A;  1GTH A;  1D4B A;  1QT9 A;  4RCO A;  1JWA D;  2L32 A;  3AEF B;  2LHE A;  2ONQ A;  1H7X A;  4DXF A;  4MT5 A;  3MC0 B;  3U2S C;  1E0Z A;  4YT0 B;  2AQ1 B;  4IOI E;  4XE0 A;  4PT5 A;  4H2A A;  3VRA B;  2PVG C;  3E9S A;  1WRI A;  3AE4 B;  2IPK D;  5C3J B;  1K53 A;  1PGB A;  1VDV A;  4YTM B;  4ITK A;  1A70 A;  1HXY D;  1PGX A;  1J7B A;  3Q8E A;  1V97 A;  1JW9 D;  2WXI A;  3MJ5 A;  4RNA A;  3UI3 A;  1KH0 A;  1XCQ L;  4LTU A;  1NEK B;  1HQR D;  1I4Q A;  3ZGZ A;  1BUI C;  5BYR A;  4GDK B;  2V0G A;  1T3Q A;  2NTT A;  2BTE A;  2E3T A;  4ZRP A;  1AWD A;  4WWM A;  1WGK A;  2I38 A;  3R8B A;  3TEZ A;  1I4R A;  4GDL B;  2K9X A;  1D5Z C;  5T8I A;  2IGG A;  1FNU A;  1QQR A;  1TS4 A;  3KQ4 A;  3V3X A;  4LLG M;  3W5U B;  4XDC A;  4ZYS A;  1FFV A;  1YN3 A;  4MAC A;  2G9H D;  1JWS D;  1RWS A;  1ZXI A;  4JX1 C;  1L0V B;  4RGM A;  3URY A;  2L83 A;  2X38 A;  1JAL A;  4ZHP A;  3ZYY X;  1TS5 A;  2LMC A;  4OW0 A;  3WCQ A;  1AN8 A;  3GP7 A;  1QOF A;  5BMI A;  3NVZ A;  1CQV A;  1ZUD 2;  3LXF A;  5HHD G;  1C4A A;  2VZK D;  1V8C A;  3EGR A;  3AEE B;  1DYQ A;  2KMM A;  4ARC A;  3VR9 B;  2JX5 A;  2K5P A;  3BWU D;  3J9C A;  2V3N A;  1MPE A;  2V3P A;  1B1Z A;  4WQM A;  1GAQ B;  3AEC B;  1FCC C;  1GOZ A;  3H8H A;  2WXP A;  1QF6 A;  3Q8C A;  1QLB B;  3NS1 A;  2WXM A;  5G5H A;  4RF0 A;  2PLP A;  2Y5P A;  3HVZ A;  2MJE A;  3ZJU A;  1WSP A;  2RDG A;  4N59 A;  5EE0 A;  3T3N A;  4WH4 A;  2WQY B;  1FRD A;  1XO3 A;  4ZRQ A;  1YQ4 B;  1B9R A;  1FO4 A;  1SEB D;  1D5X C;  3DWG C;  1SSN A;  1ZP0 B;  1C76 A;  1XEE A;  4NAW B;  1ET6 A;  3O13 A;  3BYT B;  2M0A A;  3Q8A A;  3AEA B;  1QIL A;  1PUT A;  1TKG A;  3FAH A;  1KTK A;  3IAM 1;  3U4E G;  1TYG B;  1C4P A;  2WXR A;  2IJ0 A;  2SAK A;  3NVY A;  5I4D A;  3CF4 A;  1J7A A;  5TSS A;  1RYJ A;  2LHD A;  2ICI A;  2IDY A;  1YQ3 B;  1F77 A;  1VJK A;  2QMT A;  1UWM A;  3NVW A;  2WS3 B;  3AEG B;  4A90 A;  1K52 A;  2WXN A;  1ZOY B;  4NJC A;  2DLB A;  1EM7 A;  2RPV A;  3NUH B;  1K51 A;  1SXT A;  1YJJ A;  1N60 A;  1QOA A;  1XLQ A;  1PGA A;  1ROE A;  1OQR A;  3R2T A;  2JYE A;  3IT4 B;  1SIJ A;  1F2R C;  1GB1 A;  3AE3 B;  3AH7 A;  3FIL B;  1SF0 A;  1YN5 A;  1YJI A;  3IXS A;  2Y5C A;  4KGT A;  3RPF C;  2JWU A;  1JWU D;  3TSS A;  3MFG A;  3GS2 A;  1UGJ A;  3AED B;  1TS2 A;  4YWG G;  4B0M A;  1UUP A;  1DGJ A;  4AS1 A;  2N0S B;  4HKQ A;  3FC4 A;  2CJN A;  2K22 A;  2LFI A;  1ZE3 D;  2INN E;  4RGN A;  2TSS A;  4TMA B;  1MHX A;  3RFZ B;  3AE5 B;  1F2R I;  1GT8 A;  3TUO A;  1WWT A;  4ARI A;  3BK1 A;  5D3D A;  4YSX B;  1OFF A;  1C77 A;  3KLS X;  1F0Z A;  1PFD A;  3AN1 A;  2MJD A;  1STE A;  2EKI A;  2BT6 A;  3T3O A;  5GXG B;  4MH8 A;  1FIQ A;  2AQ3 B;  3P1M A;  4KKJ A;  1QOG A;  2RDH A;  1FXA A;  4RGT A;  4YXD B;  3MHZ A;  1ZDX A;  1P7E A;  1E6E B;  2WXJ A;  2M19 A;  2CU3 A;  4YSY B;  4A55 A;  1MHH E;  4NAM A;  2YEP F;  1TY2 A;  3BVG A;  3Q8F A;  1HEZ E;  1CZP A;  2BB5 A;  4L2Y A;  1SE2 A;  3B9J A;  1SB3 C;  2QEJ C;  4IDI A;  1VZ7 A;  1VZ8 A;  1TS3 A;  5H8Y E;  4XWW A;  1SJH D;  3ETR A;  1EU4 A;  1HZ5 A;  2KN4 A;  1TZO A;  3TEX A;  1TY0 A;  2QIE B;  1EWC A;  4OHJ A;  1E7P B;  1HA5 A;  1FNV A;  1VRA B;  2W55 A;  4USA A;  2J4X A;  5HI1 A;  1C79 A;  3VQI A;  2B76 B;  4IKG A;  2Z8L A;  2W3R A;  2I2Y A;  5AUK A;  2KAJ A;  1N5X A;  2W82 A;  2OHF A;  5D3I B;  3P4R B;  1V1P B;  2WU2 B;  2WNM A;  3P63 A;  1XF5 L;  4REZ A;  1DOY A;  4XWT A;  3OWE B;  1TKE A;  4YSZ B;  3B2F A;  3GB1 A;  3TEY A;  2LEK A;  2INP E;  1YNT E;  1AYF A;  2WXL A;  2JSV X;  1JML A;  3U7Z A;  1C78 A;  1T6B X;  5JXV A;  1IBX B;  4RH6 A;  2DYO A;  4AQ7 A;  3P4P B;  2AQ2 B;  5BYQ A;  3HVD A;  1J7C A;  4O1N A;  4US8 A;  2H89 B;  3AE9 B;  5G5G A;  1RFK A;  1FEH A;  1FRR A;  3CWI A;  1HZ6 A;  3AE1 B;  1Q10 A;  1NYR A;  2DYM A;  3BZD B;  3ZJV A;  1WXQ A;  4L1B A;  2QIL A;  2JXT A;  2R61 A;  3IT6 B;  4TQ0 A;  2K3U A;  4KX6 B;  2WXO A;  4HKZ E;  2K0P A;  4OZC A;  2H88 B;  4LK0 M;  2FBW B;  2NTS A;  4KGR A;  4P6V F;  4ZHO A;  4RF1 A;  3DWM A;  2LJI A;  2PW9 A;  1V1P A;  1L5P A;  2OED A;  3PZ7 A;  1FD6 A;  1L6U A;  1SE4 A;  3HRD D;  1Y56 A;  3AV8 A;  5C2T B;  1JRP A;  2BBC A;  3LYY A;  3AE2 B;  3E56 A;  3AB5 A;  1SE3 A;  4C56 C;  3ZJT A;  2J53 A;  2WLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...