3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
3AE8B 1JALA 2MJEA 3P1MA 1FIQA 1ZP0B 1TKEA 4ITKA 1DOXA 1ZOYB 3AEDB 3AEBB 4N6EB 1RM6C 4YSZB 1QOBA 4JWSC 4N59A 2KAJA 5G5GA 3SFEB 3AEEB 1ZXIA 3NVVA 1RFKA 1QOFA 1J7AA 3NVZA 5EE0A 5AUIA 1JROA 1R7SA 2HTME 2E3TA 2Y5CA 1L0VB 1FMAD 3HRDD 1H7XA 4HRSA 1CJEA 4YTMB 4WQMA 1CZPA 1H7WA 2QIEB 2WDVB 2EKIA 1GAQB 1PUTA 1RYJA 1V8CA 2BS3B 2K9XA 2W54A 1OQRA 1V97A 1TYGB 3AEFB 1JWBD 1GTHA 1DGJA 4YSXB 2BS4B 1FXAA 3AB5A 3B9JA 4HROA 1FFUA 1XLPA 1FXIA 1UWMA 1VLBA 1XLQA 2W3RA 3B2FA 1TKGA 2CU3A 3ZYYX 1DOYA 1N61A 1WGKA 3AE7B 3P4QB 4YT0B 2K5PA 1A70A 4C80A 3SFDB 1IUEA 1FO4A 1KF6B 2WDQB 2Q5WD 5MPOA 1QF6A 5C3JB 3LXFA 3AE1B 1RWSA 2WU5B 3AE2B 3P4SB 3P4PB 1PFDA 2K22A 2WU2B 2PVGC 3LB8C 4ZOHC 1NYQA 5H92C 3W5UB 4ZHOA 3AECB 3AE4B 3AEAB 1PDXA 1XLNA 1QOGA 1N5WA 1WYGA 4US9A 2WLBA 3AH7A 2DWQA 3AE5B 1J7CA 3ABVB 1L6VA 1N60A 3NVWA 3PO0A 1QT9A 1YQ4B 4A9AA 1VJKA 2BT6A 2MJDA 1WXQA 4US8A 1SF0A 1E10A 1FRDA 1XLOA 2DBYA 2L52A 3CIRB 3KWLA 1E7PB 2ACZB 3P63A 3AE9B 4YTNB 1L5PA 1WWTA 1JQ4A 1E6EB 1EWYC 3L4PA 5C2TB 1DOIA 3HVZA 3W9CB 1E0ZA 1QOAA 2WDRB 2MJ3A 2KMMA 2MH7A 3VR8B 1NI3A 2H89B 3WCQA 4C7ZA 1JW9D 3AM9A 4C7YA 2WQYB 4JX1C 5EE3A 4P6VF 2L83A 1L6UA 1WRIA 1KFYB 1E9MA 3VR9B 2B76B 3NRZA 3W5VB 1VDVA 4JWUC 1OFFA 1N62A 3DWGC 4USAA 3NS1A 1KRHA 1AYFA 1GPXA 1JRPA 3DWMA 1NEKB 2JX5A 2WP9B 1F0ZA 1N63A 3CWIA 5AUKA 1GT8A 4WWMA 3B2GA 3SR6A 4ZHPA 3FAHA 2JQRB 5EE1A 3AEGB 2G1EA 5GXGB 3AN1A 1YQ3B 1NENB 2PIAA 1J7BA 1YJIA 1FFVA 1ZUD2 2OHFA 4N58A 1SIJA 1XO3A 2M56B 5G5HA 5H8YE 3RPFC 3AE3B 3AMZA 1B9RA 3P4RB 1AWDA 1FRRA 2M19A 4LTUA 5EE9A 2FBWB 1T3QA 2QJLA 2WS3B 2AX5A 2CJOA 4IDIA 1I7HA 2N0SB 4FXCA 3ETRA 2H88B 1NYRA 2W55A 3HUIA 3CF4A 3BIID 3AV8A 1NVID 2PKOA 1GTEA 2BS2B 4YSYB 1TJEA 4KX6B 1FM0D 1TKYA 1YJJA 4YXDB 1JWAD 3EUB2 4YTPB 1SB3C 2LEKA 1QLBB 3AE6B 3VRBB 3VRAB 1OQQA 1N5XA 2CJNA 2W3SA 2PVOD 3FC4A 3NVYA 1ROEA
chains in the Genus database with same CATH superfamily
3ZXVA 5FR3A 1Q10A 4HVBA 1QOBA 3SEBA 2PE9A 3Q8AA 2K3UA 3HRDD 3Q8BA 4HRSA 4RH6A 1ZE3D 4LNNA 3V6EB 1OQRA 4WAAA 2ZPNA 4XWWA 1RFAA 3L0WB 5BYSA 4WH4A 3NZ3A 1WGKA 2KLCA 3OG5A 4ZRJA 5BO4B 3X23A 3H1UA 3UF8A 2PJHA 3V3XA 5D3DA 4DK5A 1YN5A 4TMAB 2JZPA 3W2DA 1I42A 3M62B 3P42A 4F7ZA 4L23A 2JY6A 2N7DA 3IT6B 2SEBD 1C79A 2MA9B 3EFCA 4O1NA 1V49A 1VD2A 3P63A 2KN5A 1TTNA 2INDC 3IFWB 2MBHA 2K25A 2H89B 5CHFA 5E6OA 4PYZA 2KACA 1OFFA 3NOBA 5CHWA 2Z59B 3I9V1 3DVGY 3DOWA 2WP9B 1E8YA 1S3SG 4MACA 4MDKE 3A1QB 4HCNB 3R3MA 2KTFA 1FFVA 2OHFA 2WXFA 1SIJA 3TCAA 3FILB 2D07B 4C4VA 1GB1A 2XEWA 1T0QC 4LK0M 3NUHB 1NYRA 3Q14C 1MJDA 4KIKA 4YXDB 5DPSA 2CJNA 2PVOD 1Y8RC 3BYYB 1ZOYB 2K0PA 3HIZA 2KQ7A 3PRMB 4IG7B 3WIMA 2PW9A 1KLVA 1RM6C 2KAJA 2GMIC 1A5RA 2BW2A 1PGBA 1LO5D 1TT5B 4YTMB 2PTLA 2YEPF 2B3AA 2MRPA 1YX5B 1GTHA 1YQBA 3NZSA 3B2FA 1EU4A 2CHWA 3BVZA 1UBQA 2L1AA 3SFDB 2KFKA 4J6IA 1FXTB 4IWOA 3HVDA 4FBJB 1JWUD 1PFDA 3M95A 3L13A 2KO3A 2FUHB 2BYVE 4DWFA 2DWQA 5TSSA 1L6VA 1N60A 1IPGA 1YQ4B 2LZ6A 2RPVA 1FRDA 2QSDA 2L52A 2KNBA 4JL9A 1I4GA 1L4DB 4WJPA 2DYBA 5DCNA 4XX5A 3DBSA 1RRBA 2L7RA 1UNSA 3DDCB 3UGBB 1SE2A 1L6UA 2LXCA 5DPRA 4LJPB 2YVCA 1L7YA 2FNJB 2ZNVC 2LGIA 5LLIA 2IPKD 2GBRA 3CWIA 2WX0A 3DBLB 1F77A 2E6XA 2LGXA 2QMTA 1MI0A 3URYA 4LTUA 4WURA 4RNAA 4F1SA 4GXBA 2WXIA 1GC6A 3MJ5A 1NVID 4EZLA 3BVMA 4ZRKA 2M4NA 5HI1A 3QK0A 2MP2A 2LGYA 2IBIB 4BBNF 3RUIB 3RNEC 4GB9A 2JPHA 2TSSA 2DYOA 2D11A 3PPAA 2D2QA 4MM3A 3N32A 2G3QB 2WXGA 1KTKA 3ONSA 2BGFA 2L00B 3M63B 4KSLC 1V5TA 2DZKA 4ANXA 1DGJA 3KW5B 5LNK1 4LJOB 4KIKB 5E6NA 1WZ3A 1V1OA 3ZGZA 4KVGB 5FR6A 2KDFB 4B0EA 4HDOA 2JU6X 1E8WA 3VXWA 2NTTA 1TZ1A 3ZJTA 3PREA 1NYQA 4ZHOA 4EZKA 1N5WA 1WYGA 2IGGA 3ZIMA 3NVWA 1VJKA 4WWNA 1ZW7A 3V61A 4CHKA 4FHJA 4WWOA 2N7JA 3L4PA 1SE9A 5C2TB 3RNAC 3KUZA 1HEZE 5EDSA 5EE3A 5CX3A 4GMVA 3U2SC 2JXXA 3LYYA 1YN4A 4USAA 4E3CA 1GPXA 1U4AA 1F0ZA 4DQOC 1C4PA 3SR6A 1ET9A 4ZHPA 5IKCM 2KDEB 3DVNU 4G50A 4K1RB 2JZ3B 4N58A 1ENFA 1STEA 4XDDA 3KUCB 3UI3A 4FXCA 2LD9A 1D4BA 2OOBB 3DHGC 2MBEA 2BS2B 1SE4A 4IDIA 4B95A 3U7ZA 1FNVA 1OTRB 3NVYA 3PSEB 2INPE 2XN9C 4HDQA 3KQ4A 1ZXHA 2Z0DB 1WR1A 1R7SA 1C78A 3UIPB 1SE3A 2JF5A 4LLGM 1TZOA 3RCZA 1C1YB 1FD6A 1S1QB 1RYJA 2BYTA 2OEDA 2IY0B 4GN1A 2CU1A 3RYTA 4XC2A 3KUDB 3Q3MC 3MHZA 2KX0A 1XLPA 1K8RB 3TSSA 1E7VA 1C4CA 1SIFA 3I57A 4FHKA 4J3OD 5DPTA 1WE7A 3RMKC 2MP2B 1RLFA 3LXFA 3JYUA 3TMPB 1WR6E 4NAWA 3AE4B 1QOGA 3VH4B 4MM3B 3ZNHB 2I1KA 2G9HD 4XWTA 3BK1A 1E90A 1SF0A 3CIRB 5BYRA 2V1YA 4JQWC 3TEYA 2N9EB 3H6NA 1Q5WB 2L76A 1WGRA 2CHZA 3PRPB 2PE6B 2DZJA 1NDDA 2LWPA 2MBOA 4HPLB 2GB1A 3VTVA 3APDA 2HDEA 4PYUA 1WM2A 3R7QA 4OZBA 2Y5PA 3R2TA 5AUKA 3DPDA 2BPSA 3U30A 2DZIA 2EMTA 1YJIA 5G5HA 4MH8A 3N1YC 2KZRA 1OQYA 2AWTA 2EMSA 4EUTA 2FCNA 5LXIB 3EUB2 3TJPA 5AEKB 3ZO5B 2GBJA 4GOCA 2MBBB 2W9NA 2AQ1B 2WXRA 1OGWA 3DHHC 4IM2A 5CHVC 3ZJVA 4G0NB 1ZXIA 1AARA 4W9GA 1JROA 4RGNA 1H7XA 1WM3A 3HHMA 4NJCA 4ARIA 1CMXB 2BS3B 1SGHA 1V97A 1ISNA 2V4IB 2NPTB 1L0YB 3E9SA 3I5JC 1BXTA 2WYQA 1MG8A 2HJ1A 3MP9A 2N9KA 4FLHA 1K53A 2I1JA 2MBQA 2Q5WD 5MPOA 4DDGD 1HXYD 4NAMA 5AZFA 2IO1B 4IM0A 3Q3NC 2FAZA 1QZEA 5L95C 1B1ZA 2D3CA 1E10A 1OEYJ 3LDZE 4DXFA 1JQ4A 2LUEA 1TS2A 2MW5A 3W9CB 4HKQA 1MVKA 1WXVA 2BWES 4RGMA 1NI3A 4MELA 3WCQA 3BWUD 1V5OA 3H7PA 1Q1OA 2MWSB 3JSVA 4ANVA 4A3OA 4NAWB 3SD5A 2BVCA 2JZZA 3OJ3A 3R2IA 1PGXA 3RD2A 3GZNI 2JQRB 2G1EA 1XO3A 4YWGG 1GTEA 3WAMA 1ZPSA 4US9A 5HG2A 1P98A 2IO0B 2ZNVB 1I4RA 3PV1A 4LDTB 2K6QA 4ITKA 4WJQA 4WIPA 3NZUA 1F52A 5TR5A 3U7DA 3A9JA 1RFKA 3VUYA 3RULA 4B6WA 1FMAD 3PZ8A 3E56A 1C9FA 1GAQB 2MSED 3AEFB 4IWQA 4P7IA 4OZAA 2IYDB 2JYTA 4A6QA 1SXTA 3ZYYX 4OW0A 1N61A 5D6JB 3GE3C 1P7FA 3O65B 1T0YA 1XF5L 2RDHA 1FPYA 2N9PC 3S2AA 3AE1B 3P4PB 1G6JA 1GUAB 4KSKC 4ZOHC 2JVCA 3IBEA 4JE3B 3AI5A 5BMHA 3V05A 2IDYA 4W9LA 1QKZA 3AE5B 1WZ0A 4JIOU 2MJDA 1WXQA 3PLVA 4OHJA 2LVPA 2LGSA 1J0GA 1L0XB 4PT5A 3GS2A 1DOIA 2LASA 1WX7A 1C76A 3WANA 3B08A 4II3B 2KMMA 4W9DA 3C0RB 3DQVA 1T6BX 2KWCA 4ZRQA 3Q69A 2KFJA 3V6CB 2KDIA 3VR9B 2ZCCA 3B0AA 2O6VD 4AWJA 3VDZA 1TGZB 3QX1A 4IUMB 2REXA 3O13A 5E6JA 1T0RC 4A20A 2LJIA 5EE1A 4BOZB 2K6DB 3TUOA 2KANA 4F8CB 3DBRB 3HM6X 4BKTA 1P3QU 1T3QA 2QJLA 2W55A 2KVZA 4GLSC 1LM8B 4FADA 1TKYA 3BK2A 1QLBB 3VRBB 3H7PB 1D5XC 1D6EC 1P7EA 1JALA 3QHTA 4W9EA 3ZQ4A 1FIQA 1TKEA 2ON8A 1KLGD 1VZ6A 2BB6A 3JSVB 2KJRA 3NG0A 1J8CA 2VH1A 4YSZB 1VZ8A 3W1SA 4HXDA 2HTME 2Y5CA 1CK1A 2JRIB 2MEKA 3L16A 1CZPA 4G3XB 1EUVB 1I35A 3AXCA 1FNUA 4TKNA 3L08A 1ZDVA 4YSXB 3B9JA 2INNE 2BKFA 2WHIA 1WGHA 4I6PA 2KC1A 2FE8A 2FCMA 3UINB 4RMAA 2C7HA 4I6NB 1GOZA 5KHQA 1MHHE 5H92C 1ZGUB 2K22A 3LB8C 2ZEQA 3M3JA 3A9JB 5JHBA 4E74A 4PS8A 2BF8B 3RNCC 4MSQB 3NS8A 1XQQA 4HJKA 4L2YA 1HZ5A 5HKHA 1E0ZA 4G11A 2MHJA 4P1CC 4S17A 2KJHB 1V1PB 3AM9A 2WQYB 4JX1C 4ACFA 2FUG1 2WXKA 4JWUC 4TQ0A 3T3OA 3ALBA 2IY1B 3NS1A 1KRHA 1LGRA 1GB4A 4RFBA 4EE2A 2GBNA 2OJWA 3CSTA 2M8SA 2Z8LA 1HTQA 3U4EG 4CQNA 2J42A 2PEAA 3HM3A 2WXOA 1ZUD2 5H8YE 1GNUA 1WGGA 1Z5SB 2JT4B 3ETRA 3U52E 4NZLB 4AOFA 2DAJA 4HEA1 2PKOA 2CR5A 2N1VA 2M17A 4BKSA 4GU2A 3I3TB 4KGTA 3FC4A 3KLSX 3AE8B 2N4FA 2WXNA 3KWVA 3MJWA 3D32A 2V3SA 1YNTE 3AEEB 1SSNA 2HE7A 1TY0A 4TQ1A 2E3TA 4XE0A 1I4XA 5BMGA 3EHVA 2WDVB 1V8CA 1WI0A 3PZDA 3ZTCA 2KK8A 2NVUI 1FXAA 2W3RA 1XLQA 4REZA 2CU3A 4A8XC 1YMHE 1A70A 3R8BA 3EA6A 2AQ3B 1TS5A 2BQQA 1WXSA 5JZEB 3ZUNA 1H8CA 2DYMA 3KYDD 3ZRCA 4FULA 2BT6A 4UDUC 2Y5BB 4EFOA 2KC2A 2GBKA 1YD8U 5IA7A 1UELA 3HVZA 2WDRB 2RR9A 1IYFA 1GJZA 2EELA 4H2AA 4DBGA 4XZ4A 2L83A 1WRIA 2RPQA 1KJTA 2CKHB 4P16A 1N62A 2ICIA 3Q8CA 2C7MB 2JX5A 4RCOA 1LQBA 3CMMB 5GXGB 1YQ3B 3MHSD 4IWPA 2KMAA 1I4HA 3RPFC 2AX5A 5C1ZA 3AU5A 5IO9A 4MH0E 1ET6A 4K7SA 3BIID 4HK2A 2WXQA 3C8YA 1NI2A 2L8JA 3AE6B 2C7NB 2KHWB 2LVQA 1MHXA 2MJEA 2WXMA 4B9KA 1ZP0B 1PYWD 1R4MB 4R3DA 4LNKA 2ZVOA 3SFEB 1RAXA 1T5XD 2LRUA 3AULA 1J7AA 5IN7A 1WSPA 3N20C 1BMLC 4WWPA 2NPTA 2K8CA 4K3CA 1JWBD 2D3AA 4KDIC 1VLBA 4RF0A 2MCNB 4K7WA 4BOSC 3AE7B 3P4QB 3OLMD 3MC0B 2K1FA 2NTSA 2R2OA 2DHZA 2WU2B 4A90A 1SJED 2V3NA 1VRAB 1EU3A 4XDCA 3TEXA 4NJ7A 1P9DU 1J7CA 3TEWA 3PO0A 4A9AA 5CTRC 4AQ7A 1WJ6A 3DBHB 4IW0A 3PT2B 4RM9A 2MJ3A 2XK5A 3PLUA 4ANUA 1DYQA 4C7YA 1JW9D 2ZW0A 4M0WA 1KFYB 3GB1A 3ZVVA 3ECIA 3W5VB 2KDMA 4KGSA 4NY0A 2K8HA 3SU8X 3ZXRA 1JRPA 1P0RA 4BVUC 5JHAA 3Q8EA 2NBWB 1GT8A 3FAHA 3PGEA 2BYEA 1YJ1A 2GBMA 1B9RA 1D5ZC 2JSVX 5D7GA 1MPEA 2L0TA 4TUUA 4DXGA 2BTEA 2G4DB 1SB3C 2W3SA 3QARA 5G55A 3P1MA 1Y56A 2GI9A 3AEDB 3PS6A 3AEBB 1E7UA 2GLSA 1L0VB 3ZDTA 2LMCA 2O6VA 3WAOA 2J53A 2EKIA 3Q3OC 2BS4B 1JRUA 3QC8B 2MQJA 1IGDA 3APCA 4MGKE 2DX5B 3MC9A 4GGQA 4ZYSA 1HZ6A 3R7RA 4HJGE 2I2YA 4W9HA 1JMLA 1QF6A 2NBUA 2ZZPB 3P4SB 2ONQA 5HFYA 3W5UB 3ZKJC 1D3ZA 3Q3FA 3N9YC 2IO3B 5J17A 2LI5A 3EFUA 2JYEA 3V60A 4US8A 4XYCA 3Q8FA 1XLOA 4GIVA 1E7PB 2KD0A 1E6EB 2R61A 1UH6A 4FA6A 3WALA 4N9F4 2BYFA 2AYOB 2V4LA 1KLUD 1WF9A 1WRDB 1E9MA 4NPNA 3VUXA 1F1HA 1AYFA 3IVFA 1KM7A 3VUWA 2XBBC 4BFRA 2KYWA 5J18A 3K9PB 2MX2A 4ZRIA 1UBIA 2PIAA 1J7BA 3ML8A 3AMZA 4W9CA 4LNIA 2WS3B 2CJOA 5I4DA 1I7HA 1SEBD 2K39A 3TIXA 3ZJUA 3HUIA 1EWCA 4RM8A 2XK5B 1MG4A 4MSMB 1OQQA 2FIFA 2VZKB 1V6EA 4M0WB 2KWDA 5T8IA 2DAFA 3A4SC 5IP4D 1UUPA 3RZFA 5G5GA 4M8NA 1TS3A 4IKGA 2KWUB 4LNFA 2W82A 1TIFA 2VH2A 5D94A 3QIJA 1V9JA 3H7SA 4HROA 3VFKA 3T9LA 1JCKB 1F2RI 2IZVB 1C3TA 1FXIA 4MGIE 3ZTDA 1Q0WB 4B0MA 4Q2JA 4A55A 1HA5A 4OVUA 1IBXA 4DHJD 2NCNA 2PVGC 3DCGA 1E8XA 2IGHA 3QWZB 1L2NA 2MLBA 2RSUA 1V80A 3ABVB 2QHOA 1QT9A 2O6VB 2DBYA 3VHTC 1WMHA 1WWTA 1CQVA 1V1PA 1FEHA 2HTHA 2JWZA 3UQBA 2YLMA 1QQRA 3IHPC 2RDGA 3T3NA 1XCQL 3N3KB 2NS5A 1XCTL 4MGYE 3L10B 2ZPYA 1BT0A 1EO6A 4IC7B 2O2VA 2WXJA 1KH0A 1TBEA 2I38A 2Z0EB 5JXVA 3X0WA 3A9KA 3N1XC 2M56B 3IAM1 1AWDA 3OAWA 3ZNGC 2FBWB 4GDLA 4URKA 4LDTD 4KX6B 4HPMB 1E8ZA 4DDID 2V9HA 1Z2MA 4FN2A 1R4NB 2CS4A 2J52A 4DXAB 3MC8A 1I4QA 4D2KA 2KMCA 4JGHB 3UIOB 2N1WA 2J0MA 3IXSA 1CJEA 3GZNB 1EF1A 1H7WA 3Q3JA 2DZMA 3N30A 4OVVA 1PUTA 1WFYA 1WX8A 1TY2A 3AB5A 4HKZE 4HCPB 4OZCA 1E5WA 2KT7A 3K9OB 1M94A 3I63C 4IM3A 1IUEA 2JRHA 1HQRD 3H9DA 2WU5B 2L3ZA 1XLNA 1PDXA 3DBLI 4MGZE 3IT4B 3RT3B 2KXJA 1X1MA 4EEWA 2NMQA 4S0RA 1ZKHA 1N6ZA 4KGRA 4C00A 2AL3A 5GMVA 1ZDXA 4HWIB 1GC7A 3TBLD 2IJ0A 3VR8B 2X38A 1WY8A 2FIDA 2JUOA 3QA8A 2FCSA 2N7EA 1WGDA 1IP9A 2B76B 1IBXB 2AL6A 1AN8A 4W9FA 2JXTA 1N63A 3QQ8B 3IAS1 1LFDA 2UWQA 4KDLB 4L1BA 3NHEB 2G45B 2AQ2B 1WMHB 1FRRA 3QJZA 1TJEA 1H4RA 1JWAD 3A4RA 2L05A 3RFZB 3C19A 3ZNZB 3TL5A 3KVFB 2LRWA 4KKIA 2ZJDA 4JWSC 4N59A 2KLGA 3GOEA 1QILA 2PPHA 4LCDE 3SHQA 2O2VB 1YX6B 3PZ7A 2V3PA 2M1MA 3A9KB 2D3BA 2A5UA 4NQKE 1XD3B 2DLBA 4EOYA 2D10A 3JVZX 3GE8C 3HK0A 2XNAC 4GDLB 2V0GA 2RDBC 4KZ0A 2RD0A 1WGYA 4HLEA 1XXGA 2GOWA 2BKRB 2LHDA 4HPPA 5C3JB 2L32A 1RWSA 1XT9B 1T0SC 2BWFA 2LGDA 3APFA 1R4MI 4YL8A 1MFWA 3EC8A 4RGTA 1FCCC 1ESFA 3SDLC 2RGFA 1J19A 2R2QA 4AS1A 3KWLA 2ACZB 3RI7C 2VRRB 1EWYC 2IO2B 3RNBC 1LXDA 5IAAC 3P2BA 4K7UA 4BBNC 3PHWB 1WXAA 2BBCA 4P6VF 1VZ7A 2NR2A 3VVWB 1D5MC 4BKGA 3L17A 3DWGC 5D2MB 5FKAC 2L0FA 4W9KA 4WWMA 4FJYA 3BYTB 3AU4A 4PS7A 1XEEA 4FJZA 1UZXB 3DBHI 1WX9A 2N0SB 2KVRA 3ZW3A 3UQAA 2H88B 3AV8A 1C4AA 4C4VB 2LVOA 1FM0D 1VCBA 4ICUA 2KJ6A 4LNOA 1DOXA 4C56C 4EZJA 1HTOA 5BYQA 2G4SA 4TV3A 3NVVA 1EM7A 1QOFA 5AUIA 2HD5B 2PMVA 2KN4A 2FCQA 4DHZB 2J0JA 4WQMA 4FJVB 2X8XX 3KYCD 2D3GA 4E71A 2WGSA 2J7QB 4I6LB 3N1ZC 5E6PA 1DOYA 4M00A 2K5PA 1WJ4A 2HJ8A 4IOIE 1FO4A 2KX3A 2WDQB 3Q2AC 1F2RC 3FKYA 4OVZA 1WH3A 3RNGC 2WXLA 2KFKB 3AECB 2Y3AA 5HHDG 3DHIC 2INCC 2WLBA 3RN9C 3GP7A 4ASWC 1FCLA 5D3IB 1YIWA 2D5GA 3ZNID 1UWXA 1OEYA 4ZDVA 2M0AA 1QOAA 2N9XA 4DHZE 2JWUA 2ZVNA 4JLCA 4TSSA 4C7ZA 2GRIA 3NRZA 1VDVA 4NNJB 3CSFA 2UYZB 4PK1A 1YOVB 2N9LA 4ZRPA 1K51A 1V2YA 3DVGX 2WDTB 3B2GA 2WNMA 1HE8A 4X57B 3MTNB 2DENB 5EE9A 3ML9A 5LXHA 5KHOA 4YSYB 3Q6BA 2LEKA 1N5XA 4GDKA 4NJ6A 1ROEA 3B1LX 1WJUA 5G2NA 4W9JA 4KZCA 2LJ5A 4AJYB 4WAFA 2K8BA 5EE0A 3NVZA 4AJWA 2UU7A 4MJSA 1WXMA 1TS4A 2KDBA 4AUQC 3OJ4B 1K52A 2CHXA 2C9WB 2W54A 4BZAA 4A3PA 4BKSD 1TYGB 1UWMA 3PRZA 2AEHA 1ACCA 2KQ4X 4C80A 1SBBB 1KF6B 4M01A 2J0KA 3WA0A 1M4VA 3BY4B 1UD7A 3AE2B 4ICVA 3PVLA 3AEAB 1FNWA 2ASQA 2C5LC 4MEMA 3AH7A 4NQLB 3PHXB 1EF5A 3ENEA 3EGRA 4KV2A 1L5PA 2LXAA 2KQSA 3A33B 3VTUA 1IGCA 3VH3B 4BAXA 3RNFC 2KTRA 3LJ3A 3QCAA 2IGDA 2LHEA 4K81A 1KOTA 3R66C 4EKUA 3CF6E 1WE6A 4WJOA 4CO7A 1L4ZB 2C60A 3BVGA 3W1YA 5L83A 4XGAB 3AEGB 5FK9C 1NENB 4KKJA 3P4RB 3W1SC 3TEZA 1UGMA 2KKCA 3CF4A 3VQIA 1YJJA 1BUIC 4YTPB 2KWVB 3VRAB 2QC8A 2RMMA 2M0XA 2YEPB 5AZHA 3IG3A 1NBFC 4GSWA 5DPWA 4N6EB 1WJNA 3DVNV 3J9CA 3JW0X 3MFGA 2QDFA 4DHJB 4RGOS 2QIEB 2WXPA 3V62A 4CYEA 2K9XA 3NY5A 2A4ZA 3QAQA 5JH5C 4QAYA 1FFUA 1TKGA 1V86A 3WAPA 4YT0B 3ZDMC 2LFIA 4GDKB 3EECA 4ARCA 4II2B 3RZWC 3T8MA 1GG3A 4MT5A 1AW7A 3ZLZA 4M8MA 2EKEC 4M02A 1R4NI 4MJSB 2SAKA 3OWEB 3KH0A 3DBRI 3ZRFA 3A1QA 3NJTA 4P1BC 2OJRA 1PQSA 4W9IA 3FILA 1P1AA 3AE9B 4YTNB 3L54A 2ZCBA 4WJNA 4ZYNA 2WXHA 1JWSD 1VR9A 4K3BA 2MH7A 1V81A 4PS3A 3H8HA 1C77A 4WQOB 2DNFA 1PGAA 2WX1A 1YN3A 5IOIA 2LUMA 2QCZA 3BINA 1SJHD 3DWMA 1WYWB 1NEKB 2PLPA 5C23A 2KOXA 3PTFC 2WWZA 1UGJA 5J2RA 3VAWA 4AP4C 2QEJC 3AN1A 1WIAA 1JWMD 2ZW1A 1K50A 5BMIA 4JPSA 3AE3B 1I4PA 1UF0A 2M19A 2J4XA 4ANWA 3BZDB 2VZKD 5AZGA 3VTWA 1F9JA 3U8ZA 4RF1A 2NBVB 2KTRB 2QILA 2BB5A
chains in the Genus database with same CATH topology
2MJEA 2WXMA 2AQ1B 2WXRA 1ZP0B 1PYWD 3ZJVA 4R3DA 5FR3A 1Q10A 4KKIA 1QOBA 4JWSC 4N59A 1ZXIA 3SFEB 1T5XD 3SEBA 1QILA 1J7AA 3PZ7A 3Q8AA 1JROA 2K3UA 1WSPA 1BMLC 4RGNA 2V3PA 3HRDD 3Q8BA 1H7XA 4HRSA 4RH6A 1ZE3D 2DLBA 4NJCA 4ARIA 2BS3B 1OQRA 1V97A 1JWBD 2XNAC 4GDLB 2V4IB 2V0GA 4XWWA 1VLBA 4RF0A 1L0YB 5BYSA 3E9SA 4WH4A 3NZ3A 1WGKA 3AE7B 3P4QB 1BXTA 1XXGA 3MP9A 2N9KA 2LHDA 1K53A 2Q5WD 3MC0B 3V3XA 5MPOA 5C3JB 2L32A 1RWSA 1HXYD 2NTSA 4NAMA 5D3DA 2WU2B 4A90A 1SJED 2V3NA 1YN5A 1VRAB 4TMAB 2JZPA 3W2DA 1EU3A 3P42A 4XDCA 4L23A 4RGTA 3TEXA 1FCCC 1B1ZA 1ESFA 3IT6B 1J7CA 3TEWA 3PO0A 4A9AA 2SEBD 1C79A 1E10A 4AQ7A 4AS1A 3KWLA 4O1NA 2ACZB 3P63A 4DXFA 1JQ4A 1TS2A 1EWYC 3W9CB 4HKQA 1MVKA 2MJ3A 4RGMA 1NI3A 1DYQA 2H89B 3WCQA 4C7YA 1JW9D 3BWUD 2ZW0A 2BBCA 4P6VF 1VZ7A 4M0WA 1KFYB 3GB1A 1D5MC 3W5VB 2KDMA 2KACA 4KGSA 1OFFA 3DWGC 5FKAC 3I9V1 1JRPA 4NAWB 2WP9B 3R2IA 3Q8EA 1PGXA 1GT8A 4WWMA 3FAHA 2JQRB 3BYTB 4MACA 2G1EA 1FFVA 1XEEA 2OHFA 2WXFA 1SIJA 1XO3A 1B9RA 3FILB 1D5ZC 1GB1A 2JSVX 5D7GA 2N0SB 4LK0M 1MPEA 2H88B 3NUHB 1NYRA 4DXGA 2BTEA 3AV8A 4YWGG 1GTEA 1C4AA 1FM0D 1ZPSA 4YXDB 4US9A 1SB3C 2W3SA 5HG2A 2CJNA 2PVOD 1I4RA 3P1MA 4ITKA 1Y56A 3BYYB 1DOXA 1ZOYB 2GI9A 2K0PA 3AEDB 4WIPA 3AEBB 4C56C 2PW9A 1RM6C 5BYQA 2KAJA 3NVVA 1EM7A 1RFKA 2BW2A 1QOFA 5AUIA 1PGBA 2PMVA 1L0VB 1FMAD 2KN4A 1LO5D 4YTMB 2PTLA 3PZ8A 3E56A 4WQMA 2LMCA 2YEPF 2J53A 2EKIA 1C9FA 1GAQB 3AEFB 1GTHA 2BS4B 4OZAA 3B2FA 2JYTA 4A6QA 1EU4A 1IGDA 1SXTA 3ZYYX 4OW0A 1DOYA 1N61A 3BVZA 2K5PA 2L1AA 1HZ6A 4ZYSA 1P7FA 4IOIE 3SFDB 1FO4A 2WDQB 1XF5L 4HJGE 1F2RC 2RDHA 2I2YA 3HVDA 1JMLA 1QF6A 1JWUD 3AE1B 4OVZA 3P4SB 1PFDA 3P4PB 2ONQA 4ZOHC 3W5UB 5HFYA 2WXLA 4JE3B 3AECB 5BMHA 3N9YC 3V05A 2Y3AA 5HHDG 2IDYA 1QKZA 2WLBA 2DWQA 3AE5B 5TSSA 1L6VA 1N60A 2JYEA 3GP7A 4US8A 1FCLA 1YQ4B 2RPVA 2MJDA 1WXQA 3Q8FA 5D3IB 4OHJA 1FRDA 1XLOA 2QSDA 2L52A 2D5GA 1E7PB 1UWXA 1L0XB 1E6EB 2R61A 4PT5A 3GS2A 1DOIA 1I4GA 1L4DB 2M0AA 1QOAA 1C76A 2JWUA 2KMMA 4TSSA 1T6BX 1UNSA 4C7ZA 4ZRQA 1KLUD 1SE2A 1L6UA 3Q69A 1E9MA 2GRIA 3VR9B 3NRZA 1VDVA 1AYFA 2N9LA 2LGIA 1K51A 4ZRPA 2IPKD 3O13A 3CWIA 5E6JA 3B2GA 2LJIA 5EE1A 2WNMA 1F77A 2E6XA 3TUOA 2PIAA 1J7BA 2QMTA 1MI0A 3URYA 3AMZA 4LTUA 5EE9A 4WURA 1T3QA 2QJLA 4RNAA 2WS3B 2CJOA 5I4DA 1I7HA 1SEBD 2WXIA 3ZJUA 3MJ5A 2W55A 1EWCA 3HUIA 4GLSC 1NVID 4YSYB 1TKYA 2LEKA 1QLBB 3BK2A 3VRBB 3BVMA 1OQQA 1N5XA 1D5XC 2VZKB 5HI1A 1ROEA 1D6EC 1P7EA 1JALA 2KWDA 3ZQ4A 1FIQA 1TKEA 2ON8A 1KLGD 1VZ6A 2BB6A 5T8IA 4YSZB 1UUPA 1VZ8A 2TSSA 5G5GA 3W1SA 2DYOA 4WAFA 5EE0A 3NVZA 2HTME 2Y5CA 1CK1A 1TS4A 1TS3A 4IKGA 2WXGA 1K52A 2MEKA 1KTKA 1CZPA 2W82A 1FNUA 2W54A 1TYGB 4HROA 1DGJA 4YSXB 1ZDVA 3B9JA 1JCKB 1F2RI 2INNE 5LNK1 1FXIA 1UWMA 2KQ4X 1ACCA 1V1OA 3ZGZA 4B0MA 4Q2JA 2FE8A 4C80A 4A55A 1SBBB 1HA5A 1KF6B 4B0EA 1IBXA 2JU6X 1GOZA 1M4VA 2NTTA 1MHHE 3AE2B 2PVGC 5H92C 3ZJTA 2K22A 3LB8C 1NYQA 4ZHOA 2IGHA 3AEAB 1FNWA 1N5WA 1WYGA 2IGGA 3AH7A 3ABVB 3NVWA 1QT9A 1VJKA 2DBYA 3EGRA 4L2YA 1HZ5A 1L5PA 1WWTA 1CQVA 2N7JA 3L4PA 5C2TB 1E0ZA 1V1PA 1FEHA 1QQRA 2RDGA 1HEZE 3T3NA 1IGCA 1XCQL 1V1PB 3AM9A 2WQYB 4JX1C 5EE3A 1XCTL 2FUG1 2IGDA 3U2SC 2WXKA 2LHEA 4JWUC 3LYYA 1YN4A 4TQ0A 4USAA 3T3OA 3NS1A 1KRHA 1GB4A 4RFBA 4EE2A 1GPXA 1L4ZB 1F0ZA 4DQOC 1C4PA 2Z8LA 3BVGA 3SR6A 1ET9A 3U4EG 4ZHPA 2WXJA 1KH0A 3AEGB 5FK9C 4CQNA 2J42A 2I38A 1NENB 5JXVA 2WXOA 1ENFA 1ZUD2 4N58A 5H8YE 4KKJA 2M56B 3IAM1 3P4RB 1AWDA 1STEA 2FBWB 4XDDA 3UI3A 4FXCA 3TEZA 3ETRA 1D4BA 3U52E 4NZLB 3CF4A 3VQIA 4HEA1 2PKOA 2BS2B 4KX6B 1YJJA 1BUIC 1SE4A 4YTPB 4IDIA 3VRAB 4KGTA 2RMMA 3FC4A 3U7ZA 1FNVA 3KLSX 3NVYA 2YEPB 3AE8B 2WXNA 3KWVA 2INPE 2XN9C 4N6EB 1YNTE 2J52A 3KQ4A 3AEEB 1SSNA 1I4QA 1ZXHA 1TY0A 4D2KA 4TQ1A 1R7SA 3J9CA 1C78A 2E3TA 1SE3A 4LLGM 4XE0A 3MFGA 1I4XA 5BMGA 3IXSA 1CJEA 1TZOA 4RGOS 1H7WA 2QIEB 2WXPA 1FD6A 2WDVB 1PUTA 1RYJA 1V8CA 2K9XA 2BYTA 2OEDA 1TY2A 3AB5A 1FXAA 3MHZA 1FFUA 1XLPA 2W3RA 1XLQA 4HKZE 4REZA 1TKGA 2CU3A 3TSSA 1C4CA 4YT0B 1YMHE 3I57A 4J3OD 1A70A 4OZCA 2LFIA 4GDKB 4A8XC 3R8BA 4ARCA 1IUEA 3EA6A 2AQ3B 3LXFA 1HQRD 4MT5A 2WU5B 1AW7A 1TS5A 3AE4B 1XLNA 1PDXA 1QOGA 2SAKA 3IT4B 2DYMA 3OWEB 4MM3B 2G9HD 4XWTA 3BK1A 2BT6A 1SF0A 4UDUC 3CIRB 5BYRA 2NMQA 3FILA 3AE9B 4YTNB 4KGRA 3HVZA 2WXHA 1ZDXA 1JWSD 3TEYA 2WDRB 1VR9A 2EELA 2IJ0A 2MH7A 4H2AA 3VR8B 2X38A 3H8HA 1C77A 2L83A 1WRIA 1PGAA 2GB1A 2B76B 1YN3A 1IBXB 2HDEA 2LUMA 4P16A 1N62A 2ICIA 1AN8A 1SJHD 3DWMA 3Q8CA 1NEKB 2JXTA 2PLPA 2JX5A 4RCOA 1N63A 4OZBA 1UGJA 3IAS1 2Y5PA 3R2TA 5AUKA 4L1BA 5GXGB 2QEJC 3AN1A 1YQ3B 1JWMD 2ZW1A 1YJIA 5G5HA 2AQ2B 1I4HA 1K50A 4MH8A 3RPFC 5BMIA 4JPSA 3AE3B 1I4PA 1FRRA 2M19A 2J4XA 2AX5A 3BZDB 2VZKD 1ET6A 3BIID 2WXQA 3C8YA 1TJEA 4RF1A 1JWAD 3EUB2 3RFZB 3AE6B 2QILA 1MHXA 2BB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE8 B;  1JAL A;  2MJE A;  3P1M A;  1FIQ A;  1ZP0 B;  1TKE A;  4ITK A;  1DOX A;  1ZOY B;  3AED B;  3AEB B;  4N6E B;  1RM6 C;  4YSZ B;  1QOB A;  4JWS C;  4N59 A;  2KAJ A;  5G5G A;  3SFE B;  3AEE B;  1ZXI A;  3NVV A;  1RFK A;  1QOF A;  1J7A A;  3NVZ A;  5EE0 A;  5AUI A;  1JRO A;  1R7S A;  2HTM E;  2E3T A;  2Y5C A;  1L0V B;  1FMA D;  3HRD D;  1H7X A;  4HRS A;  1CJE A;  4YTM B;  4WQM A;  1CZP A;  1H7W A;  2QIE B;  2WDV B;  2EKI A;  1GAQ B;  1PUT A;  1RYJ A;  1V8C A;  2BS3 B;  2K9X A;  2W54 A;  1OQR A;  1V97 A;  1TYG B;  3AEF B;  1JWB D;  1GTH A;  1DGJ A;  4YSX B;  2BS4 B;  1FXA A;  3AB5 A;  3B9J A;  4HRO A;  1FFU A;  1XLP A;  1FXI A;  1UWM A;  1VLB A;  1XLQ A;  2W3R A;  3B2F A;  1TKG A;  2CU3 A;  3ZYY X;  1DOY A;  1N61 A;  1WGK A;  3AE7 B;  3P4Q B;  4YT0 B;  2K5P A;  1A70 A;  4C80 A;  3SFD B;  1IUE A;  1FO4 A;  1KF6 B;  2WDQ B;  2Q5W D;  5MPO A;  1QF6 A;  5C3J B;  3LXF A;  3AE1 B;  1RWS A;  2WU5 B;  3AE2 B;  3P4S B;  3P4P B;  1PFD A;  2K22 A;  2WU2 B;  2PVG C;  3LB8 C;  4ZOH C;  1NYQ A;  5H92 C;  3W5U B;  4ZHO A;  3AEC B;  3AE4 B;  3AEA B;  1PDX A;  1XLN A;  1QOG A;  1N5W A;  1WYG A;  4US9 A;  2WLB A;  3AH7 A;  2DWQ A;  3AE5 B;  1J7C A;  3ABV B;  1L6V A;  1N60 A;  3NVW A;  3PO0 A;  1QT9 A;  1YQ4 B;  4A9A A;  1VJK A;  2BT6 A;  2MJD A;  1WXQ A;  4US8 A;  1SF0 A;  1E10 A;  1FRD A;  1XLO A;  2DBY A;  2L52 A;  3CIR B;  3KWL A;  1E7P B;  2ACZ B;  3P63 A;  3AE9 B;  4YTN B;  1L5P A;  1WWT A;  1JQ4 A;  1E6E B;  1EWY C;  3L4P A;  5C2T B;  1DOI A;  3HVZ A;  3W9C B;  1E0Z A;  1QOA A;  2WDR B;  2MJ3 A;  2KMM A;  2MH7 A;  3VR8 B;  1NI3 A;  2H89 B;  3WCQ A;  4C7Z A;  1JW9 D;  3AM9 A;  4C7Y A;  2WQY B;  4JX1 C;  5EE3 A;  4P6V F;  2L83 A;  1L6U A;  1WRI A;  1KFY B;  1E9M A;  3VR9 B;  2B76 B;  3NRZ A;  3W5V B;  1VDV A;  4JWU C;  1OFF A;  1N62 A;  3DWG C;  4USA A;  3NS1 A;  1KRH A;  1AYF A;  1GPX A;  1JRP A;  3DWM A;  1NEK B;  2JX5 A;  2WP9 B;  1F0Z A;  1N63 A;  3CWI A;  5AUK A;  1GT8 A;  4WWM A;  3B2G A;  3SR6 A;  4ZHP A;  3FAH A;  2JQR B;  5EE1 A;  3AEG B;  2G1E A;  5GXG B;  3AN1 A;  1YQ3 B;  1NEN B;  2PIA A;  1J7B A;  1YJI A;  1FFV A;  1ZUD 2;  2OHF A;  4N58 A;  1SIJ A;  1XO3 A;  2M56 B;  5G5H A;  5H8Y E;  3RPF C;  3AE3 B;  3AMZ A;  1B9R A;  3P4R B;  1AWD A;  1FRR A;  2M19 A;  4LTU A;  5EE9 A;  2FBW B;  1T3Q A;  2QJL A;  2WS3 B;  2AX5 A;  2CJO A;  4IDI A;  1I7H A;  2N0S B;  4FXC A;  3ETR A;  2H88 B;  1NYR A;  2W55 A;  3HUI A;  3CF4 A;  3BII D;  3AV8 A;  1NVI D;  2PKO A;  1GTE A;  2BS2 B;  4YSY B;  1TJE A;  4KX6 B;  1FM0 D;  1TKY A;  1YJJ A;  4YXD B;  1JWA D;  3EUB 2;  4YTP B;  1SB3 C;  2LEK A;  1QLB B;  3AE6 B;  3VRB B;  3VRA B;  1OQQ A;  1N5X A;  2CJN A;  2W3S A;  2PVO D;  3FC4 A;  3NVY A;  1ROE A; 
#chains in the Genus database with same CATH topology
 3ZXV A;  5FR3 A;  1Q10 A;  4HVB A;  1QOB A;  3SEB A;  2PE9 A;  3Q8A A;  2K3U A;  3HRD D;  3Q8B A;  4HRS A;  4RH6 A;  1ZE3 D;  4LNN A;  3V6E B;  1OQR A;  4WAA A;  2ZPN A;  4XWW A;  1RFA A;  3L0W B;  5BYS A;  4WH4 A;  3NZ3 A;  1WGK A;  2KLC A;  3OG5 A;  4ZRJ A;  5BO4 B;  3X23 A;  3H1U A;  3UF8 A;  2PJH A;  3V3X A;  5D3D A;  4DK5 A;  1YN5 A;  4TMA B;  2JZP A;  3W2D A;  1I42 A;  3M62 B;  3P42 A;  4F7Z A;  4L23 A;  2JY6 A;  2N7D A;  3IT6 B;  2SEB D;  1C79 A;  2MA9 B;  3EFC A;  4O1N A;  1V49 A;  1VD2 A;  3P63 A;  2KN5 A;  1TTN A;  2IND C;  3IFW B;  2MBH A;  2K25 A;  2H89 B;  5CHF A;  5E6O A;  4PYZ A;  2KAC A;  1OFF A;  3NOB A;  5CHW A;  2Z59 B;  3I9V 1;  3DVG Y;  3DOW A;  2WP9 B;  1E8Y A;  1S3S G;  4MAC A;  4MDK E;  3A1Q B;  4HCN B;  3R3M A;  2KTF A;  1FFV A;  2OHF A;  2WXF A;  1SIJ A;  3TCA A;  3FIL B;  2D07 B;  4C4V A;  1GB1 A;  2XEW A;  1T0Q C;  4LK0 M;  3NUH B;  1NYR A;  3Q14 C;  1MJD A;  4KIK A;  4YXD B;  5DPS A;  2CJN A;  2PVO D;  1Y8R C;  3BYY B;  1ZOY B;  2K0P A;  3HIZ A;  2KQ7 A;  3PRM B;  4IG7 B;  3WIM A;  2PW9 A;  1KLV A;  1RM6 C;  2KAJ A;  2GMI C;  1A5R A;  2BW2 A;  1PGB A;  1LO5 D;  1TT5 B;  4YTM B;  2PTL A;  2YEP F;  2B3A A;  2MRP A;  1YX5 B;  1GTH A;  1YQB A;  3NZS A;  3B2F A;  1EU4 A;  2CHW A;  3BVZ A;  1UBQ A;  2L1A A;  3SFD B;  2KFK A;  4J6I A;  1FXT B;  4IWO A;  3HVD A;  4FBJ B;  1JWU D;  1PFD A;  3M95 A;  3L13 A;  2KO3 A;  2FUH B;  2BYV E;  4DWF A;  2DWQ A;  5TSS A;  1L6V A;  1N60 A;  1IPG A;  1YQ4 B;  2LZ6 A;  2RPV A;  1FRD A;  2QSD A;  2L52 A;  2KNB A;  4JL9 A;  1I4G A;  1L4D B;  4WJP A;  2DYB A;  5DCN A;  4XX5 A;  3DBS A;  1RRB A;  2L7R A;  1UNS A;  3DDC B;  3UGB B;  1SE2 A;  1L6U A;  2LXC A;  5DPR A;  4LJP B;  2YVC A;  1L7Y A;  2FNJ B;  2ZNV C;  2LGI A;  5LLI A;  2IPK D;  2GBR A;  3CWI A;  2WX0 A;  3DBL B;  1F77 A;  2E6X A;  2LGX A;  2QMT A;  1MI0 A;  3URY A;  4LTU A;  4WUR A;  4RNA A;  4F1S A;  4GXB A;  2WXI A;  1GC6 A;  3MJ5 A;  1NVI D;  4EZL A;  3BVM A;  4ZRK A;  2M4N A;  5HI1 A;  3QK0 A;  2MP2 A;  2LGY A;  2IBI B;  4BBN F;  3RUI B;  3RNE C;  4GB9 A;  2JPH A;  2TSS A;  2DYO A;  2D11 A;  3PPA A;  2D2Q A;  4MM3 A;  3N32 A;  2G3Q B;  2WXG A;  1KTK A;  3ONS A;  2BGF A;  2L00 B;  3M63 B;  4KSL C;  1V5T A;  2DZK A;  4ANX A;  1DGJ A;  3KW5 B;  5LNK 1;  4LJO B;  4KIK B;  5E6N A;  1WZ3 A;  1V1O A;  3ZGZ A;  4KVG B;  5FR6 A;  2KDF B;  4B0E A;  4HDO A;  2JU6 X;  1E8W A;  3VXW A;  2NTT A;  1TZ1 A;  3ZJT A;  3PRE A;  1NYQ A;  4ZHO A;  4EZK A;  1N5W A;  1WYG A;  2IGG A;  3ZIM A;  3NVW A;  1VJK A;  4WWN A;  1ZW7 A;  3V61 A;  4CHK A;  4FHJ A;  4WWO A;  2N7J A;  3L4P A;  1SE9 A;  5C2T B;  3RNA C;  3KUZ A;  1HEZ E;  5EDS A;  5EE3 A;  5CX3 A;  4GMV A;  3U2S C;  2JXX A;  3LYY A;  1YN4 A;  4USA A;  4E3C A;  1GPX A;  1U4A A;  1F0Z A;  4DQO C;  1C4P A;  3SR6 A;  1ET9 A;  4ZHP A;  5IKC M;  2KDE B;  3DVN U;  4G50 A;  4K1R B;  2JZ3 B;  4N58 A;  1ENF A;  1STE A;  4XDD A;  3KUC B;  3UI3 A;  4FXC A;  2LD9 A;  1D4B A;  2OOB B;  3DHG C;  2MBE A;  2BS2 B;  1SE4 A;  4IDI A;  4B95 A;  3U7Z A;  1FNV A;  1OTR B;  3NVY A;  3PSE B;  2INP E;  2XN9 C;  4HDQ A;  3KQ4 A;  1ZXH A;  2Z0D B;  1WR1 A;  1R7S A;  1C78 A;  3UIP B;  1SE3 A;  2JF5 A;  4LLG M;  1TZO A;  3RCZ A;  1C1Y B;  1FD6 A;  1S1Q B;  1RYJ A;  2BYT A;  2OED A;  2IY0 B;  4GN1 A;  2CU1 A;  3RYT A;  4XC2 A;  3KUD B;  3Q3M C;  3MHZ A;  2KX0 A;  1XLP A;  1K8R B;  3TSS A;  1E7V A;  1C4C A;  1SIF A;  3I57 A;  4FHK A;  4J3O D;  5DPT A;  1WE7 A;  3RMK C;  2MP2 B;  1RLF A;  3LXF A;  3JYU A;  3TMP B;  1WR6 E;  4NAW A;  3AE4 B;  1QOG A;  3VH4 B;  4MM3 B;  3ZNH B;  2I1K A;  2G9H D;  4XWT A;  3BK1 A;  1E90 A;  1SF0 A;  3CIR B;  5BYR A;  2V1Y A;  4JQW C;  3TEY A;  2N9E B;  3H6N A;  1Q5W B;  2L76 A;  1WGR A;  2CHZ A;  3PRP B;  2PE6 B;  2DZJ A;  1NDD A;  2LWP A;  2MBO A;  4HPL B;  2GB1 A;  3VTV A;  3APD A;  2HDE A;  4PYU A;  1WM2 A;  3R7Q A;  4OZB A;  2Y5P A;  3R2T A;  5AUK A;  3DPD A;  2BPS A;  3U30 A;  2DZI A;  2EMT A;  1YJI A;  5G5H A;  4MH8 A;  3N1Y C;  2KZR A;  1OQY A;  2AWT A;  2EMS A;  4EUT A;  2FCN A;  5LXI B;  3EUB 2;  3TJP A;  5AEK B;  3ZO5 B;  2GBJ A;  4GOC A;  2MBB B;  2W9N A;  2AQ1 B;  2WXR A;  1OGW A;  3DHH C;  4IM2 A;  5CHV C;  3ZJV A;  4G0N B;  1ZXI A;  1AAR A;  4W9G A;  1JRO A;  4RGN A;  1H7X A;  1WM3 A;  3HHM A;  4NJC A;  4ARI A;  1CMX B;  2BS3 B;  1SGH A;  1V97 A;  1ISN A;  2V4I B;  2NPT B;  1L0Y B;  3E9S A;  3I5J C;  1BXT A;  2WYQ A;  1MG8 A;  2HJ1 A;  3MP9 A;  2N9K A;  4FLH A;  1K53 A;  2I1J A;  2MBQ A;  2Q5W D;  5MPO A;  4DDG D;  1HXY D;  4NAM A;  5AZF A;  2IO1 B;  4IM0 A;  3Q3N C;  2FAZ A;  1QZE A;  5L95 C;  1B1Z A;  2D3C A;  1E10 A;  1OEY J;  3LDZ E;  4DXF A;  1JQ4 A;  2LUE A;  1TS2 A;  2MW5 A;  3W9C B;  4HKQ A;  1MVK A;  1WXV A;  2BWE S;  4RGM A;  1NI3 A;  4MEL A;  3WCQ A;  3BWU D;  1V5O A;  3H7P A;  1Q1O A;  2MWS B;  3JSV A;  4ANV A;  4A3O A;  4NAW B;  3SD5 A;  2BVC A;  2JZZ A;  3OJ3 A;  3R2I A;  1PGX A;  3RD2 A;  3GZN I;  2JQR B;  2G1E A;  1XO3 A;  4YWG G;  1GTE A;  3WAM A;  1ZPS A;  4US9 A;  5HG2 A;  1P98 A;  2IO0 B;  2ZNV B;  1I4R A;  3PV1 A;  4LDT B;  2K6Q A;  4ITK A;  4WJQ A;  4WIP A;  3NZU A;  1F52 A;  5TR5 A;  3U7D A;  3A9J A;  1RFK A;  3VUY A;  3RUL A;  4B6W A;  1FMA D;  3PZ8 A;  3E56 A;  1C9F A;  1GAQ B;  2MSE D;  3AEF B;  4IWQ A;  4P7I A;  4OZA A;  2IYD B;  2JYT A;  4A6Q A;  1SXT A;  3ZYY X;  4OW0 A;  1N61 A;  5D6J B;  3GE3 C;  1P7F A;  3O65 B;  1T0Y A;  1XF5 L;  2RDH A;  1FPY A;  2N9P C;  3S2A A;  3AE1 B;  3P4P B;  1G6J A;  1GUA B;  4KSK C;  4ZOH C;  2JVC A;  3IBE A;  4JE3 B;  3AI5 A;  5BMH A;  3V05 A;  2IDY A;  4W9L A;  1QKZ A;  3AE5 B;  1WZ0 A;  4JIO U;  2MJD A;  1WXQ A;  3PLV A;  4OHJ A;  2LVP A;  2LGS A;  1J0G A;  1L0X B;  4PT5 A;  3GS2 A;  1DOI A;  2LAS A;  1WX7 A;  1C76 A;  3WAN A;  3B08 A;  4II3 B;  2KMM A;  4W9D A;  3C0R B;  3DQV A;  1T6B X;  2KWC A;  4ZRQ A;  3Q69 A;  2KFJ A;  3V6C B;  2KDI A;  3VR9 B;  2ZCC A;  3B0A A;  2O6V D;  4AWJ A;  3VDZ A;  1TGZ B;  3QX1 A;  4IUM B;  2REX A;  3O13 A;  5E6J A;  1T0R C;  4A20 A;  2LJI A;  5EE1 A;  4BOZ B;  2K6D B;  3TUO A;  2KAN A;  4F8C B;  3DBR B;  3HM6 X;  4BKT A;  1P3Q U;  1T3Q A;  2QJL A;  2W55 A;  2KVZ A;  4GLS C;  1LM8 B;  4FAD A;  1TKY A;  3BK2 A;  1QLB B;  3VRB B;  3H7P B;  1D5X C;  1D6E C;  1P7E A;  1JAL A;  3QHT A;  4W9E A;  3ZQ4 A;  1FIQ A;  1TKE A;  2ON8 A;  1KLG D;  1VZ6 A;  2BB6 A;  3JSV B;  2KJR A;  3NG0 A;  1J8C A;  2VH1 A;  4YSZ B;  1VZ8 A;  3W1S A;  4HXD A;  2HTM E;  2Y5C A;  1CK1 A;  2JRI B;  2MEK A;  3L16 A;  1CZP A;  4G3X B;  1EUV B;  1I35 A;  3AXC A;  1FNU A;  4TKN A;  3L08 A;  1ZDV A;  4YSX B;  3B9J A;  2INN E;  2BKF A;  2WHI A;  1WGH A;  4I6P A;  2KC1 A;  2FE8 A;  2FCM A;  3UIN B;  4RMA A;  2C7H A;  4I6N B;  1GOZ A;  5KHQ A;  1MHH E;  5H92 C;  1ZGU B;  2K22 A;  3LB8 C;  2ZEQ A;  3M3J A;  3A9J B;  5JHB A;  4E74 A;  4PS8 A;  2BF8 B;  3RNC C;  4MSQ B;  3NS8 A;  1XQQ A;  4HJK A;  4L2Y A;  1HZ5 A;  5HKH A;  1E0Z A;  4G11 A;  2MHJ A;  4P1C C;  4S17 A;  2KJH B;  1V1P B;  3AM9 A;  2WQY B;  4JX1 C;  4ACF A;  2FUG 1;  2WXK A;  4JWU C;  4TQ0 A;  3T3O A;  3ALB A;  2IY1 B;  3NS1 A;  1KRH A;  1LGR A;  1GB4 A;  4RFB A;  4EE2 A;  2GBN A;  2OJW A;  3CST A;  2M8S A;  2Z8L A;  1HTQ A;  3U4E G;  4CQN A;  2J42 A;  2PEA A;  3HM3 A;  2WXO A;  1ZUD 2;  5H8Y E;  1GNU A;  1WGG A;  1Z5S B;  2JT4 B;  3ETR A;  3U52 E;  4NZL B;  4AOF A;  2DAJ A;  4HEA 1;  2PKO A;  2CR5 A;  2N1V A;  2M17 A;  4BKS A;  4GU2 A;  3I3T B;  4KGT A;  3FC4 A;  3KLS X;  3AE8 B;  2N4F A;  2WXN A;  3KWV A;  3MJW A;  3D32 A;  2V3S A;  1YNT E;  3AEE B;  1SSN A;  2HE7 A;  1TY0 A;  4TQ1 A;  2E3T A;  4XE0 A;  1I4X A;  5BMG A;  3EHV A;  2WDV B;  1V8C A;  1WI0 A;  3PZD A;  3ZTC A;  2KK8 A;  2NVU I;  1FXA A;  2W3R A;  1XLQ A;  4REZ A;  2CU3 A;  4A8X C;  1YMH E;  1A70 A;  3R8B A;  3EA6 A;  2AQ3 B;  1TS5 A;  2BQQ A;  1WXS A;  5JZE B;  3ZUN A;  1H8C A;  2DYM A;  3KYD D;  3ZRC A;  4FUL A;  2BT6 A;  4UDU C;  2Y5B B;  4EFO A;  2KC2 A;  2GBK A;  1YD8 U;  5IA7 A;  1UEL A;  3HVZ A;  2WDR B;  2RR9 A;  1IYF A;  1GJZ A;  2EEL A;  4H2A A;  4DBG A;  4XZ4 A;  2L83 A;  1WRI A;  2RPQ A;  1KJT A;  2CKH B;  4P16 A;  1N62 A;  2ICI A;  3Q8C A;  2C7M B;  2JX5 A;  4RCO A;  1LQB A;  3CMM B;  5GXG B;  1YQ3 B;  3MHS D;  4IWP A;  2KMA A;  1I4H A;  3RPF C;  2AX5 A;  5C1Z A;  3AU5 A;  5IO9 A;  4MH0 E;  1ET6 A;  4K7S A;  3BII D;  4HK2 A;  2WXQ A;  3C8Y A;  1NI2 A;  2L8J A;  3AE6 B;  2C7N B;  2KHW B;  2LVQ A;  1MHX A;  2MJE A;  2WXM A;  4B9K A;  1ZP0 B;  1PYW D;  1R4M B;  4R3D A;  4LNK A;  2ZVO A;  3SFE B;  1RAX A;  1T5X D;  2LRU A;  3AUL A;  1J7A A;  5IN7 A;  1WSP A;  3N20 C;  1BML C;  4WWP A;  2NPT A;  2K8C A;  4K3C A;  1JWB D;  2D3A A;  4KDI C;  1VLB A;  4RF0 A;  2MCN B;  4K7W A;  4BOS C;  3AE7 B;  3P4Q B;  3OLM D;  3MC0 B;  2K1F A;  2NTS A;  2R2O A;  2DHZ A;  2WU2 B;  4A90 A;  1SJE D;  2V3N A;  1VRA B;  1EU3 A;  4XDC A;  3TEX A;  4NJ7 A;  1P9D U;  1J7C A;  3TEW A;  3PO0 A;  4A9A A;  5CTR C;  4AQ7 A;  1WJ6 A;  3DBH B;  4IW0 A;  3PT2 B;  4RM9 A;  2MJ3 A;  2XK5 A;  3PLU A;  4ANU A;  1DYQ A;  4C7Y A;  1JW9 D;  2ZW0 A;  4M0W A;  1KFY B;  3GB1 A;  3ZVV A;  3ECI A;  3W5V B;  2KDM A;  4KGS A;  4NY0 A;  2K8H A;  3SU8 X;  3ZXR A;  1JRP A;  1P0R A;  4BVU C;  5JHA A;  3Q8E A;  2NBW B;  1GT8 A;  3FAH A;  3PGE A;  2BYE A;  1YJ1 A;  2GBM A;  1B9R A;  1D5Z C;  2JSV X;  5D7G A;  1MPE A;  2L0T A;  4TUU A;  4DXG A;  2BTE A;  2G4D B;  1SB3 C;  2W3S A;  3QAR A;  5G55 A;  3P1M A;  1Y56 A;  2GI9 A;  3AED B;  3PS6 A;  3AEB B;  1E7U A;  2GLS A;  1L0V B;  3ZDT A;  2LMC A;  2O6V A;  3WAO A;  2J53 A;  2EKI A;  3Q3O C;  2BS4 B;  1JRU A;  3QC8 B;  2MQJ A;  1IGD A;  3APC A;  4MGK E;  2DX5 B;  3MC9 A;  4GGQ A;  4ZYS A;  1HZ6 A;  3R7R A;  4HJG E;  2I2Y A;  4W9H A;  1JML A;  1QF6 A;  2NBU A;  2ZZP B;  3P4S B;  2ONQ A;  5HFY A;  3W5U B;  3ZKJ C;  1D3Z A;  3Q3F A;  3N9Y C;  2IO3 B;  5J17 A;  2LI5 A;  3EFU A;  2JYE A;  3V60 A;  4US8 A;  4XYC A;  3Q8F A;  1XLO A;  4GIV A;  1E7P B;  2KD0 A;  1E6E B;  2R61 A;  1UH6 A;  4FA6 A;  3WAL A;  4N9F 4;  2BYF A;  2AYO B;  2V4L A;  1KLU D;  1WF9 A;  1WRD B;  1E9M A;  4NPN A;  3VUX A;  1F1H A;  1AYF A;  3IVF A;  1KM7 A;  3VUW A;  2XBB C;  4BFR A;  2KYW A;  5J18 A;  3K9P B;  2MX2 A;  4ZRI A;  1UBI A;  2PIA A;  1J7B A;  3ML8 A;  3AMZ A;  4W9C A;  4LNI A;  2WS3 B;  2CJO A;  5I4D A;  1I7H A;  1SEB D;  2K39 A;  3TIX A;  3ZJU A;  3HUI A;  1EWC A;  4RM8 A;  2XK5 B;  1MG4 A;  4MSM B;  1OQQ A;  2FIF A;  2VZK B;  1V6E A;  4M0W B;  2KWD A;  5T8I A;  2DAF A;  3A4S C;  5IP4 D;  1UUP A;  3RZF A;  5G5G A;  4M8N A;  1TS3 A;  4IKG A;  2KWU B;  4LNF A;  2W82 A;  1TIF A;  2VH2 A;  5D94 A;  3QIJ A;  1V9J A;  3H7S A;  4HRO A;  3VFK A;  3T9L A;  1JCK B;  1F2R I;  2IZV B;  1C3T A;  1FXI A;  4MGI E;  3ZTD A;  1Q0W B;  4B0M A;  4Q2J A;  4A55 A;  1HA5 A;  4OVU A;  1IBX A;  4DHJ D;  2NCN A;  2PVG C;  3DCG A;  1E8X A;  2IGH A;  3QWZ B;  1L2N A;  2MLB A;  2RSU A;  1V80 A;  3ABV B;  2QHO A;  1QT9 A;  2O6V B;  2DBY A;  3VHT C;  1WMH A;  1WWT A;  1CQV A;  1V1P A;  1FEH A;  2HTH A;  2JWZ A;  3UQB A;  2YLM A;  1QQR A;  3IHP C;  2RDG A;  3T3N A;  1XCQ L;  3N3K B;  2NS5 A;  1XCT L;  4MGY E;  3L10 B;  2ZPY A;  1BT0 A;  1EO6 A;  4IC7 B;  2O2V A;  2WXJ A;  1KH0 A;  1TBE A;  2I38 A;  2Z0E B;  5JXV A;  3X0W A;  3A9K A;  3N1X C;  2M56 B;  3IAM 1;  1AWD A;  3OAW A;  3ZNG C;  2FBW B;  4GDL A;  4URK A;  4LDT D;  4KX6 B;  4HPM B;  1E8Z A;  4DDI D;  2V9H A;  1Z2M A;  4FN2 A;  1R4N B;  2CS4 A;  2J52 A;  4DXA B;  3MC8 A;  1I4Q A;  4D2K A;  2KMC A;  4JGH B;  3UIO B;  2N1W A;  2J0M A;  3IXS A;  1CJE A;  3GZN B;  1EF1 A;  1H7W A;  3Q3J A;  2DZM A;  3N30 A;  4OVV A;  1PUT A;  1WFY A;  1WX8 A;  1TY2 A;  3AB5 A;  4HKZ E;  4HCP B;  4OZC A;  1E5W A;  2KT7 A;  3K9O B;  1M94 A;  3I63 C;  4IM3 A;  1IUE A;  2JRH A;  1HQR D;  3H9D A;  2WU5 B;  2L3Z A;  1XLN A;  1PDX A;  3DBL I;  4MGZ E;  3IT4 B;  3RT3 B;  2KXJ A;  1X1M A;  4EEW A;  2NMQ A;  4S0R A;  1ZKH A;  1N6Z A;  4KGR A;  4C00 A;  2AL3 A;  5GMV A;  1ZDX A;  4HWI B;  1GC7 A;  3TBL D;  2IJ0 A;  3VR8 B;  2X38 A;  1WY8 A;  2FID A;  2JUO A;  3QA8 A;  2FCS A;  2N7E A;  1WGD A;  1IP9 A;  2B76 B;  1IBX B;  2AL6 A;  1AN8 A;  4W9F A;  2JXT A;  1N63 A;  3QQ8 B;  3IAS 1;  1LFD A;  2UWQ A;  4KDL B;  4L1B A;  3NHE B;  2G45 B;  2AQ2 B;  1WMH B;  1FRR A;  3QJZ A;  1TJE A;  1H4R A;  1JWA D;  3A4R A;  2L05 A;  3RFZ B;  3C19 A;  3ZNZ B;  3TL5 A;  3KVF B;  2LRW A;  4KKI A;  2ZJD A;  4JWS C;  4N59 A;  2KLG A;  3GOE A;  1QIL A;  2PPH A;  4LCD E;  3SHQ A;  2O2V B;  1YX6 B;  3PZ7 A;  2V3P A;  2M1M A;  3A9K B;  2D3B A;  2A5U A;  4NQK E;  1XD3 B;  2DLB A;  4EOY A;  2D10 A;  3JVZ X;  3GE8 C;  3HK0 A;  2XNA C;  4GDL B;  2V0G A;  2RDB C;  4KZ0 A;  2RD0 A;  1WGY A;  4HLE A;  1XXG A;  2GOW A;  2BKR B;  2LHD A;  4HPP A;  5C3J B;  2L32 A;  1RWS A;  1XT9 B;  1T0S C;  2BWF A;  2LGD A;  3APF A;  1R4M I;  4YL8 A;  1MFW A;  3EC8 A;  4RGT A;  1FCC C;  1ESF A;  3SDL C;  2RGF A;  1J19 A;  2R2Q A;  4AS1 A;  3KWL A;  2ACZ B;  3RI7 C;  2VRR B;  1EWY C;  2IO2 B;  3RNB C;  1LXD A;  5IAA C;  3P2B A;  4K7U A;  4BBN C;  3PHW B;  1WXA A;  2BBC A;  4P6V F;  1VZ7 A;  2NR2 A;  3VVW B;  1D5M C;  4BKG A;  3L17 A;  3DWG C;  5D2M B;  5FKA C;  2L0F A;  4W9K A;  4WWM A;  4FJY A;  3BYT B;  3AU4 A;  4PS7 A;  1XEE A;  4FJZ A;  1UZX B;  3DBH I;  1WX9 A;  2N0S B;  2KVR A;  3ZW3 A;  3UQA A;  2H88 B;  3AV8 A;  1C4A A;  4C4V B;  2LVO A;  1FM0 D;  1VCB A;  4ICU A;  2KJ6 A;  4LNO A;  1DOX A;  4C56 C;  4EZJ A;  1HTO A;  5BYQ A;  2G4S A;  4TV3 A;  3NVV A;  1EM7 A;  1QOF A;  5AUI A;  2HD5 B;  2PMV A;  2KN4 A;  2FCQ A;  4DHZ B;  2J0J A;  4WQM A;  4FJV B;  2X8X X;  3KYC D;  2D3G A;  4E71 A;  2WGS A;  2J7Q B;  4I6L B;  3N1Z C;  5E6P A;  1DOY A;  4M00 A;  2K5P A;  1WJ4 A;  2HJ8 A;  4IOI E;  1FO4 A;  2KX3 A;  2WDQ B;  3Q2A C;  1F2R C;  3FKY A;  4OVZ A;  1WH3 A;  3RNG C;  2WXL A;  2KFK B;  3AEC B;  2Y3A A;  5HHD G;  3DHI C;  2INC C;  2WLB A;  3RN9 C;  3GP7 A;  4ASW C;  1FCL A;  5D3I B;  1YIW A;  2D5G A;  3ZNI D;  1UWX A;  1OEY A;  4ZDV A;  2M0A A;  1QOA A;  2N9X A;  4DHZ E;  2JWU A;  2ZVN A;  4JLC A;  4TSS A;  4C7Z A;  2GRI A;  3NRZ A;  1VDV A;  4NNJ B;  3CSF A;  2UYZ B;  4PK1 A;  1YOV B;  2N9L A;  4ZRP A;  1K51 A;  1V2Y A;  3DVG X;  2WDT B;  3B2G A;  2WNM A;  1HE8 A;  4X57 B;  3MTN B;  2DEN B;  5EE9 A;  3ML9 A;  5LXH A;  5KHO A;  4YSY B;  3Q6B A;  2LEK A;  1N5X A;  4GDK A;  4NJ6 A;  1ROE A;  3B1L X;  1WJU A;  5G2N A;  4W9J A;  4KZC A;  2LJ5 A;  4AJY B;  4WAF A;  2K8B A;  5EE0 A;  3NVZ A;  4AJW A;  2UU7 A;  4MJS A;  1WXM A;  1TS4 A;  2KDB A;  4AUQ C;  3OJ4 B;  1K52 A;  2CHX A;  2C9W B;  2W54 A;  4BZA A;  4A3P A;  4BKS D;  1TYG B;  1UWM A;  3PRZ A;  2AEH A;  1ACC A;  2KQ4 X;  4C80 A;  1SBB B;  1KF6 B;  4M01 A;  2J0K A;  3WA0 A;  1M4V A;  3BY4 B;  1UD7 A;  3AE2 B;  4ICV A;  3PVL A;  3AEA B;  1FNW A;  2ASQ A;  2C5L C;  4MEM A;  3AH7 A;  4NQL B;  3PHX B;  1EF5 A;  3ENE A;  3EGR A;  4KV2 A;  1L5P A;  2LXA A;  2KQS A;  3A33 B;  3VTU A;  1IGC A;  3VH3 B;  4BAX A;  3RNF C;  2KTR A;  3LJ3 A;  3QCA A;  2IGD A;  2LHE A;  4K81 A;  1KOT A;  3R66 C;  4EKU A;  3CF6 E;  1WE6 A;  4WJO A;  4CO7 A;  1L4Z B;  2C60 A;  3BVG A;  3W1Y A;  5L83 A;  4XGA B;  3AEG B;  5FK9 C;  1NEN B;  4KKJ A;  3P4R B;  3W1S C;  3TEZ A;  1UGM A;  2KKC A;  3CF4 A;  3VQI A;  1YJJ A;  1BUI C;  4YTP B;  2KWV B;  3VRA B;  2QC8 A;  2RMM A;  2M0X A;  2YEP B;  5AZH A;  3IG3 A;  1NBF C;  4GSW A;  5DPW A;  4N6E B;  1WJN A;  3DVN V;  3J9C A;  3JW0 X;  3MFG A;  2QDF A;  4DHJ B;  4RGO S;  2QIE B;  2WXP A;  3V62 A;  4CYE A;  2K9X A;  3NY5 A;  2A4Z A;  3QAQ A;  5JH5 C;  4QAY A;  1FFU A;  1TKG A;  1V86 A;  3WAP A;  4YT0 B;  3ZDM C;  2LFI A;  4GDK B;  3EEC A;  4ARC A;  4II2 B;  3RZW C;  3T8M A;  1GG3 A;  4MT5 A;  1AW7 A;  3ZLZ A;  4M8M A;  2EKE C;  4M02 A;  1R4N I;  4MJS B;  2SAK A;  3OWE B;  3KH0 A;  3DBR I;  3ZRF A;  3A1Q A;  3NJT A;  4P1B C;  2OJR A;  1PQS A;  4W9I A;  3FIL A;  1P1A A;  3AE9 B;  4YTN B;  3L54 A;  2ZCB A;  4WJN A;  4ZYN A;  2WXH A;  1JWS D;  1VR9 A;  4K3B A;  2MH7 A;  1V81 A;  4PS3 A;  3H8H A;  1C77 A;  4WQO B;  2DNF A;  1PGA A;  2WX1 A;  1YN3 A;  5IOI A;  2LUM A;  2QCZ A;  3BIN A;  1SJH D;  3DWM A;  1WYW B;  1NEK B;  2PLP A;  5C23 A;  2KOX A;  3PTF C;  2WWZ A;  1UGJ A;  5J2R A;  3VAW A;  4AP4 C;  2QEJ C;  3AN1 A;  1WIA A;  1JWM D;  2ZW1 A;  1K50 A;  5BMI A;  4JPS A;  3AE3 B;  1I4P A;  1UF0 A;  2M19 A;  2J4X A;  4ANW A;  3BZD B;  2VZK D;  5AZG A;  3VTW A;  1F9J A;  3U8Z A;  4RF1 A;  2NBV B;  2KTR B;  2QIL A;  2BB5 A; 
#chains in the Genus database with same CATH homology
 2MJE A;  2WXM A;  2AQ1 B;  2WXR A;  1ZP0 B;  1PYW D;  3ZJV A;  4R3D A;  5FR3 A;  1Q10 A;  4KKI A;  1QOB A;  4JWS C;  4N59 A;  1ZXI A;  3SFE B;  1T5X D;  3SEB A;  1QIL A;  1J7A A;  3PZ7 A;  3Q8A A;  1JRO A;  2K3U A;  1WSP A;  1BML C;  4RGN A;  2V3P A;  3HRD D;  3Q8B A;  1H7X A;  4HRS A;  4RH6 A;  1ZE3 D;  2DLB A;  4NJC A;  4ARI A;  2BS3 B;  1OQR A;  1V97 A;  1JWB D;  2XNA C;  4GDL B;  2V4I B;  2V0G A;  4XWW A;  1VLB A;  4RF0 A;  1L0Y B;  5BYS A;  3E9S A;  4WH4 A;  3NZ3 A;  1WGK A;  3AE7 B;  3P4Q B;  1BXT A;  1XXG A;  3MP9 A;  2N9K A;  2LHD A;  1K53 A;  2Q5W D;  3MC0 B;  3V3X A;  5MPO A;  5C3J B;  2L32 A;  1RWS A;  1HXY D;  2NTS A;  4NAM A;  5D3D A;  2WU2 B;  4A90 A;  1SJE D;  2V3N A;  1YN5 A;  1VRA B;  4TMA B;  2JZP A;  3W2D A;  1EU3 A;  3P42 A;  4XDC A;  4L23 A;  4RGT A;  3TEX A;  1FCC C;  1B1Z A;  1ESF A;  3IT6 B;  1J7C A;  3TEW A;  3PO0 A;  4A9A A;  2SEB D;  1C79 A;  1E10 A;  4AQ7 A;  4AS1 A;  3KWL A;  4O1N A;  2ACZ B;  3P63 A;  4DXF A;  1JQ4 A;  1TS2 A;  1EWY C;  3W9C B;  4HKQ A;  1MVK A;  2MJ3 A;  4RGM A;  1NI3 A;  1DYQ A;  2H89 B;  3WCQ A;  4C7Y A;  1JW9 D;  3BWU D;  2ZW0 A;  2BBC A;  4P6V F;  1VZ7 A;  4M0W A;  1KFY B;  3GB1 A;  1D5M C;  3W5V B;  2KDM A;  2KAC A;  4KGS A;  1OFF A;  3DWG C;  5FKA C;  3I9V 1;  1JRP A;  4NAW B;  2WP9 B;  3R2I A;  3Q8E A;  1PGX A;  1GT8 A;  4WWM A;  3FAH A;  2JQR B;  3BYT B;  4MAC A;  2G1E A;  1FFV A;  1XEE A;  2OHF A;  2WXF A;  1SIJ A;  1XO3 A;  1B9R A;  3FIL B;  1D5Z C;  1GB1 A;  2JSV X;  5D7G A;  2N0S B;  4LK0 M;  1MPE A;  2H88 B;  3NUH B;  1NYR A;  4DXG A;  2BTE A;  3AV8 A;  4YWG G;  1GTE A;  1C4A A;  1FM0 D;  1ZPS A;  4YXD B;  4US9 A;  1SB3 C;  2W3S A;  5HG2 A;  2CJN A;  2PVO D;  1I4R A;  3P1M A;  4ITK A;  1Y56 A;  3BYY B;  1DOX A;  1ZOY B;  2GI9 A;  2K0P A;  3AED B;  4WIP A;  3AEB B;  4C56 C;  2PW9 A;  1RM6 C;  5BYQ A;  2KAJ A;  3NVV A;  1EM7 A;  1RFK A;  2BW2 A;  1QOF A;  5AUI A;  1PGB A;  2PMV A;  1L0V B;  1FMA D;  2KN4 A;  1LO5 D;  4YTM B;  2PTL A;  3PZ8 A;  3E56 A;  4WQM A;  2LMC A;  2YEP F;  2J53 A;  2EKI A;  1C9F A;  1GAQ B;  3AEF B;  1GTH A;  2BS4 B;  4OZA A;  3B2F A;  2JYT A;  4A6Q A;  1EU4 A;  1IGD A;  1SXT A;  3ZYY X;  4OW0 A;  1DOY A;  1N61 A;  3BVZ A;  2K5P A;  2L1A A;  1HZ6 A;  4ZYS A;  1P7F A;  4IOI E;  3SFD B;  1FO4 A;  2WDQ B;  1XF5 L;  4HJG E;  1F2R C;  2RDH A;  2I2Y A;  3HVD A;  1JML A;  1QF6 A;  1JWU D;  3AE1 B;  4OVZ A;  3P4S B;  1PFD A;  3P4P B;  2ONQ A;  4ZOH C;  3W5U B;  5HFY A;  2WXL A;  4JE3 B;  3AEC B;  5BMH A;  3N9Y C;  3V05 A;  2Y3A A;  5HHD G;  2IDY A;  1QKZ A;  2WLB A;  2DWQ A;  3AE5 B;  5TSS A;  1L6V A;  1N60 A;  2JYE A;  3GP7 A;  4US8 A;  1FCL A;  1YQ4 B;  2RPV A;  2MJD A;  1WXQ A;  3Q8F A;  5D3I B;  4OHJ A;  1FRD A;  1XLO A;  2QSD A;  2L52 A;  2D5G A;  1E7P B;  1UWX A;  1L0X B;  1E6E B;  2R61 A;  4PT5 A;  3GS2 A;  1DOI A;  1I4G A;  1L4D B;  2M0A A;  1QOA A;  1C76 A;  2JWU A;  2KMM A;  4TSS A;  1T6B X;  1UNS A;  4C7Z A;  4ZRQ A;  1KLU D;  1SE2 A;  1L6U A;  3Q69 A;  1E9M A;  2GRI A;  3VR9 B;  3NRZ A;  1VDV A;  1AYF A;  2N9L A;  2LGI A;  1K51 A;  4ZRP A;  2IPK D;  3O13 A;  3CWI A;  5E6J A;  3B2G A;  2LJI A;  5EE1 A;  2WNM A;  1F77 A;  2E6X A;  3TUO A;  2PIA A;  1J7B A;  2QMT A;  1MI0 A;  3URY A;  3AMZ A;  4LTU A;  5EE9 A;  4WUR A;  1T3Q A;  2QJL A;  4RNA A;  2WS3 B;  2CJO A;  5I4D A;  1I7H A;  1SEB D;  2WXI A;  3ZJU A;  3MJ5 A;  2W55 A;  1EWC A;  3HUI A;  4GLS C;  1NVI D;  4YSY B;  1TKY A;  2LEK A;  1QLB B;  3BK2 A;  3VRB B;  3BVM A;  1OQQ A;  1N5X A;  1D5X C;  2VZK B;  5HI1 A;  1ROE A;  1D6E C;  1P7E A;  1JAL A;  2KWD A;  3ZQ4 A;  1FIQ A;  1TKE A;  2ON8 A;  1KLG D;  1VZ6 A;  2BB6 A;  5T8I A;  4YSZ B;  1UUP A;  1VZ8 A;  2TSS A;  5G5G A;  3W1S A;  2DYO A;  4WAF A;  5EE0 A;  3NVZ A;  2HTM E;  2Y5C A;  1CK1 A;  1TS4 A;  1TS3 A;  4IKG A;  2WXG A;  1K52 A;  2MEK A;  1KTK A;  1CZP A;  2W82 A;  1FNU A;  2W54 A;  1TYG B;  4HRO A;  1DGJ A;  4YSX B;  1ZDV A;  3B9J A;  1JCK B;  1F2R I;  2INN E;  5LNK 1;  1FXI A;  1UWM A;  2KQ4 X;  1ACC A;  1V1O A;  3ZGZ A;  4B0M A;  4Q2J A;  2FE8 A;  4C80 A;  4A55 A;  1SBB B;  1HA5 A;  1KF6 B;  4B0E A;  1IBX A;  2JU6 X;  1GOZ A;  1M4V A;  2NTT A;  1MHH E;  3AE2 B;  2PVG C;  5H92 C;  3ZJT A;  2K22 A;  3LB8 C;  1NYQ A;  4ZHO A;  2IGH A;  3AEA B;  1FNW A;  1N5W A;  1WYG A;  2IGG A;  3AH7 A;  3ABV B;  3NVW A;  1QT9 A;  1VJK A;  2DBY A;  3EGR A;  4L2Y A;  1HZ5 A;  1L5P A;  1WWT A;  1CQV A;  2N7J A;  3L4P A;  5C2T B;  1E0Z A;  1V1P A;  1FEH A;  1QQR A;  2RDG A;  1HEZ E;  3T3N A;  1IGC A;  1XCQ L;  1V1P B;  3AM9 A;  2WQY B;  4JX1 C;  5EE3 A;  1XCT L;  2FUG 1;  2IGD A;  3U2S C;  2WXK A;  2LHE A;  4JWU C;  3LYY A;  1YN4 A;  4TQ0 A;  4USA A;  3T3O A;  3NS1 A;  1KRH A;  1GB4 A;  4RFB A;  4EE2 A;  1GPX A;  1L4Z B;  1F0Z A;  4DQO C;  1C4P A;  2Z8L A;  3BVG A;  3SR6 A;  1ET9 A;  3U4E G;  4ZHP A;  2WXJ A;  1KH0 A;  3AEG B;  5FK9 C;  4CQN A;  2J42 A;  2I38 A;  1NEN B;  5JXV A;  2WXO A;  1ENF A;  1ZUD 2;  4N58 A;  5H8Y E;  4KKJ A;  2M56 B;  3IAM 1;  3P4R B;  1AWD A;  1STE A;  2FBW B;  4XDD A;  3UI3 A;  4FXC A;  3TEZ A;  3ETR A;  1D4B A;  3U52 E;  4NZL B;  3CF4 A;  3VQI A;  4HEA 1;  2PKO A;  2BS2 B;  4KX6 B;  1YJJ A;  1BUI C;  1SE4 A;  4YTP B;  4IDI A;  3VRA B;  4KGT A;  2RMM A;  3FC4 A;  3U7Z A;  1FNV A;  3KLS X;  3NVY A;  2YEP B;  3AE8 B;  2WXN A;  3KWV A;  2INP E;  2XN9 C;  4N6E B;  1YNT E;  2J52 A;  3KQ4 A;  3AEE B;  1SSN A;  1I4Q A;  1ZXH A;  1TY0 A;  4D2K A;  4TQ1 A;  1R7S A;  3J9C A;  1C78 A;  2E3T A;  1SE3 A;  4LLG M;  4XE0 A;  3MFG A;  1I4X A;  5BMG A;  3IXS A;  1CJE A;  1TZO A;  4RGO S;  1H7W A;  2QIE B;  2WXP A;  1FD6 A;  2WDV B;  1PUT A;  1RYJ A;  1V8C A;  2K9X A;  2BYT A;  2OED A;  1TY2 A;  3AB5 A;  1FXA A;  3MHZ A;  1FFU A;  1XLP A;  2W3R A;  1XLQ A;  4HKZ E;  4REZ A;  1TKG A;  2CU3 A;  3TSS A;  1C4C A;  4YT0 B;  1YMH E;  3I57 A;  4J3O D;  1A70 A;  4OZC A;  2LFI A;  4GDK B;  4A8X C;  3R8B A;  4ARC A;  1IUE A;  3EA6 A;  2AQ3 B;  3LXF A;  1HQR D;  4MT5 A;  2WU5 B;  1AW7 A;  1TS5 A;  3AE4 B;  1XLN A;  1PDX A;  1QOG A;  2SAK A;  3IT4 B;  2DYM A;  3OWE B;  4MM3 B;  2G9H D;  4XWT A;  3BK1 A;  2BT6 A;  1SF0 A;  4UDU C;  3CIR B;  5BYR A;  2NMQ A;  3FIL A;  3AE9 B;  4YTN B;  4KGR A;  3HVZ A;  2WXH A;  1ZDX A;  1JWS D;  3TEY A;  2WDR B;  1VR9 A;  2EEL A;  2IJ0 A;  2MH7 A;  4H2A A;  3VR8 B;  2X38 A;  3H8H A;  1C77 A;  2L83 A;  1WRI A;  1PGA A;  2GB1 A;  2B76 B;  1YN3 A;  1IBX B;  2HDE A;  2LUM A;  4P16 A;  1N62 A;  2ICI A;  1AN8 A;  1SJH D;  3DWM A;  3Q8C A;  1NEK B;  2JXT A;  2PLP A;  2JX5 A;  4RCO A;  1N63 A;  4OZB A;  1UGJ A;  3IAS 1;  2Y5P A;  3R2T A;  5AUK A;  4L1B A;  5GXG B;  2QEJ C;  3AN1 A;  1YQ3 B;  1JWM D;  2ZW1 A;  1YJI A;  5G5H A;  2AQ2 B;  1I4H A;  1K50 A;  4MH8 A;  3RPF C;  5BMI A;  4JPS A;  3AE3 B;  1I4P A;  1FRR A;  2M19 A;  2J4X A;  2AX5 A;  3BZD B;  2VZK D;  1ET6 A;  3BII D;  2WXQ A;  3C8Y A;  1TJE A;  4RF1 A;  1JWA D;  3EUB 2;  3RFZ B;  3AE6 B;  2QIL A;  1MHX A;  2BB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...