3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
2K9XA 1V8CA 1YQ4B 3AECB 3HUIA 2CJNA 3SFEB 3P63A 1J7CA 1CJEA 1EWYC 4US8A 1VDVA 3AEEB 1E7PB 1VJKA 2ACZB 1IUEA 1NENB 1E6EB 1NYQA 2WDQB 1AYFA 3VRAB 1YQ3B 3W9CB 3AB5A 2PVOD 3P4RB 3AH7A 4LTUA 1L6UA 1WXQA 2WS3B 2KAJA 4C7YA 2QJLA 3AE6B 3ZYYX 2K5PA 4HROA 1PUTA 2CU3A 3W5UB 3AEDB 4JWUC 2DWQA 2H88B 3AE3B 1OQQA 1TJEA 1TKYA 2WLBA 4HRSA 2QIEB 1PFDA 1DGJA 1H7XA 3L4PA 4C7ZA 4YTPB 5C2TB 1PDXA 1JW9D 2AX5A 4P6VF 1SB3C 4YT0B 2G1EA 4ZHPA 1GT8A 4JWSC 4N6EB 5G5GA 3NVZA 3AE9B 4YTNB 2PVGC 2FBWB 2E3TA 4YXDB 5EE3A 1FFVA 1N62A 1NI3A 1JWBD 4N59A 1NEKB 1J7AA 1FXAA 2M19A 1FM0D 3PO0A 3LB8C 1ZOYB 2LEKA 2N0SB 4YSXB 2L52A 5EE0A 3NRZA 1ZUD2 1JROA 2EKIA 5EE9A 1XLPA 1JWAD 1T3QA 3P4QB 1SIJA 4ZHOA 1L6VA 1AWDA 2MJEA 4WQMA 3BIID 2PIAA 5GXGB 4YSZB 3W5VB 1QOFA 2JX5A 2WQYB 4KX6B 2W55A 1XO3A 1QOBA 3NS1A 3AEBB 3WCQA 2BS4B 3B2FA 1KF6B 5AUIA 1JRPA 3AEGB 1ROEA 1VLBA 3AEFB 3AN1A 3NVYA 1JQ4A 3AE7B 4C80A 4USAA 1CZPA 1GTHA 2WP9B 3AMZA 1FRRA 2Q5WD 3AE1B 2W3SA 1DOIA 1DOYA 2KMMA 1UWMA 1E9MA 1YJJA 1FO4A 3AE2B 1E0ZA 3SFDB 1XLNA 2W54A 1FIQA 1FMAD 2MJ3A 2WU2B 2K22A 3P1MA 2BT6A 1F0ZA 2MH7A 4A9AA 1SF0A 4ITKA 3VR9B 4WWMA 1I7HA 1N61A 1V97A 1ZP0B 5MPOA 3P4SB 1R7SA 3HRDD 2BS2B 3CIRB 1FXIA 3ETRA 1N5WA 2CJOA 5H92C 3VR8B 1GPXA 1GTEA 1RM6C 1TKEA 3AE5B 1QT9A 1JALA 3AE8B 2M56B 3LXFA 4IDIA 3ABVB 3DWMA 1QOAA 1QF6A 1KRHA 3VRBB 3DWGC 1NYRA 3EUB2 4YTMB 1DOXA 1TKGA 3AE4B 1H7WA 1RWSA 2DBYA 1E10A 1L5PA 1XLOA 2OHFA 3FAHA 1WGKA 3HVZA 3KWLA 5G5HA 2BS3B 3CF4A 1N60A 3FC4A 2B76B 4YSYB 2JQRB 5C3JB 4ZOHC 2WDRB 2HTME 3RPFC 1L0VB 1XLQA 1QOGA 3P4PB 3NVVA 3SR6A 3B2GA 1GAQB 2Y5CA 2L83A 1QLBB 1NVID 1OQRA 1RYJA 1ZXIA 4JX1C 1WRIA 3AV8A 3NVWA 5EE1A 1YJIA 2MJDA 1OFFA 1N63A 3B9JA 3AM9A 4N58A 5H8YE 2WDVB 1FRDA 2H89B 2WU5B 2PKOA 1KFYB 1WWTA 2W3RA 3CWIA 3AEAB 1FFUA 1N5XA 1TYGB 4FXCA 4US9A 5AUKA 1A70A 1B9RA 1WYGA 1RFKA 1J7BA
chains in the Genus database with same CATH superfamily
3JYUA 3SFEB 3V62A 4OHJA 3DDCB 4A20A 3ZNHB 1VR9A 3A33B 1BXTA 2KZRA 1L6UA 2MX2A 3DBHB 2ZEQA 5KHOA 2YEPB 4RNAA 1TTNA 3I5JC 1PFDA 1DGJA 2WYQA 2K3UA 2R61A 1PDXA 4P6VF 4ZHPA 4KGSA 1L2NA 1K52A 2LXCA 2CR5A 2KN4A 1FNVA 4LNKA 3V60A 2EKIA 5FK9C 1CK1A 2KFJA 1XT9B 4ZHOA 1N6ZA 5IP4D 4M8MA 4M8NA 5JHAA 1WI0A 2SAKA 2RD0A 2RSUA 4HEA1 3D32A 3TCAA 5D94A 1EU3A 1LXDA 1ROEA 4IM2A 3NZUA 4BFRA 2YVCA 1V86A 2UWQA 2CU1A 2KANA 2BWES 3JSVA 1IP9A 2KDMA 2RDBC 2GLSA 2AEHA 3CIRB 5BO4B 3NHEB 4ZYNA 2N4FA 1V80A 3PRZA 4HPPA 4IDIA 3VRBB 3TEZA 4FJVB 5HHDG 2ZJDA 4JIOU 2LVOA 4MELA 2Y3AA 2K25A 3QARA 1ZXIA 3DQVA 2HJ1A 3L16A 2BBCA 4EOYA 2INPE 2LMCA 2L3ZA 4DQOC 3ZKJC 3ZDTA 4NAMA 3TEXA 2K9XA 1V8CA 3U52E 3AECB 4US8A 1P9DU 4TQ1A 1Z5SB 3ZJTA 3AB5A 2CKHB 2QJLA 2WXRA 5CX3A 3W2DA 2DWQA 4BVUC 4KVGB 4K3BA 2WXQA 1OEYA 1WFYA 5HFYA 1ZXHA 1J0GA 4KV2A 2BPSA 3GB1A 3KUDB 2N1WA 2N0SB 4EFOA 2WXNA 3V6EB 1U4AA 2JZPA 2J53A 3ZQ4A 1VD2A 4K7SA 3UF8A 3BIID 2KXJA 3ONSA 4AJYB 1TS2A 1C76A 4ARIA 2IYDB 4MGYE 3B2FA 1C79A 5AZHA 4HJKA 5TR5A 3OG5A 2G45B 2NBWB 4EZLA 2Q5WD 1V6EA 2AL3A 2SEBD 1AN8A 2EELA 1RLFA 2UYZB 2MWSB 4AWJA 4PS8A 1FO4A 3PREA 4TQ0A 1FMAD 3P1MA 4GXBA 1F77A 1SF0A 1KOTA 3PSEB 1I7HA 1KM7A 4CHKA 3CF6E 3WIMA 2BS2B 1WGHA 2DX5B 1GPXA 4ASWC 3QIJA 3PPAA 1NYRA 3T3NA 4GGQA 2FAZA 4KGRA 2ONQA 2RMMA 2LGSA 1ZKHA 3U7DA 3QWZB 1SIFA 3MFGA 3VHTC 3P4PB 3IAM1 4ICUA 3A1QB 2KWDA 4M01A 1SE2A 3MC0B 3DVNV 2X38A 4EZJA 1XD3B 2KWUB 3IFWB 2XK5A 4ACFA 1F52A 2Y5BB 1R4NI 4F8CB 4WURA 3VH3B 1NYQA 2WDQB 4S0RA 4TUUA 1DYQA 2V4LA 3ZUNA 4XE0A 4RFBA 3IT4B 4XDCA 1TJEA 5IA7A 1D5XC 2I2YA 2GMIC 1EU4A 5E6JA 3M3JA 4MJSB 4JWSC 3A9JA 2DYMA 1HTQA 3DBRB 2MBEA 2ZCBA 2GBKA 4A6QA 5HG2A 1F9JA 2BYEA 3L13A 5JHBA 2V1YA 1JWAD 1T3QA 1TIFA 4NJCA 4NY0A 1QKZA 1T0RC 3EHVA 1TY0A 4WWNA 2R2OA 3LYYA 1C4PA 3A9KB 2UU7A 5FR6A 1V9JA 3AE1B 2I38A 1UWMA 2PTLA 1E9MA 3H6NA 2JU6X 3VUWA 3ECIA 4K7UA 2GB1A 2HD5B 3B1LX 3PT2B 3U2SC 2LJIA 5MPOA 1P98A 3VR8B 4W9FA 2BVCA 1WIAA 1UGJA 2MQJA 4IC7B 5D2MB 5IN7A 2LWPA 4FBJB 2KQSA 2ZNVC 3M63B 1H7WA 4AS1A 3HVZA 1V1OA 5C3JB 2IY1B 1FD6A 1D6EC 1ZGUB 1YN4A 2KX0A 1FRDA 1YN5A 3T8MA 5AUKA 1PGBA 2KDEB 4LNFA 2BTEA 2N7JA 1IGCA 4DHJD 3RT3B 3B08A 4W9GA 2VH2A 4M02A 4RGTA 1HZ6A 2FUG1 3AE6B 2K5PA 1SGHA 4GIVA 1C9FA 1KLGD 1M4VA 2KJRA 3L4PA 5AZFA 3QK0A 2NBUA 1WH3A 1E8ZA 3BYTB 1S3SG 1V2YA 2O2VB 3R66C 4NAWA 1M94A 1YNTE 2FBWB 4HKQA 1NEKB 4JL9A 1RRBA 1VZ6A 1C4CA 2L1AA 3JW0X 1JWSD 4RF0A 1I4PA 3ZJVA 1FNUA 3J9CA 4MH8A 4P16A 3RNAC 3WALA 2PIAA 3W5VB 1MHXA 3PRPB 2KVZA 2NTTA 2D2QA 3DOWA 3DVGX 3AN1A 2M17A 3H1UA 1R4MI 3SFDB 1XLNA 2BWFA 1IBXB 2K0PA 3Q3FA 3AULA 2J0MA 2L0TA 3ZNGC 2JXXA 1R7SA 2GOWA 2O6VB 3JVZX 2LD9A 3DBLB 2MW5A 3DWGC 4R3DA 4HPLB 3KWLA 1WX8A 4PS3A 4YSYB 1UGMA 2NS5A 2KACA 4XWWA 3SR6A 1C78A 2Y5CA 4DDGD 3AV8A 2LGDA 5EE1A 5EE0A 2O6VA 1RFKA 3QX1A 3HUIA 3P63A 4RM8A 4C4VA 1IUEA 1K53A 4DXFA 5LNK1 2MBBB 1TS3A 2BKRB 1AYFA 2WXHA 1IBXA 3KUZA 3IHPC 3GE3C 2N9KA 2IBIB 2LVPA 2KDBA 4HLEA 4GMVA 2VZKB 4KZ0A 2MBQA 1LFDA 2KHWB 4ZRIA 1WGYA 4WJPA 4YTPB 4RMAA 4RF1A 4YXDB 4WAFA 1J7AA 5AZGA 5HI1A 1GNUA 2KK8A 1XQQA 5L83A 1XLPA 5J18A 2INNE 4P1CC 3BY4B 4BAXA 1GB4A 4IUMB 1I4RA 1WJ4A 3NS1A 3AEBB 3DVGY 2RPQA 2DLBA 4IKGA 2JY6A 3M95A 4USAA 2WXOA 1V81A 2IO0B 3APCA 3KH0A 2KMMA 2MP2B 2K1FA 1E5WA 3AE2B 4GLSC 2BT6A 4EEWA 3PLVA 3ENEA 3VQIA 1L0XB 4KZCA 1WJNA 2N9PC 2KDFB 2KLCA 1FXIA 2AL6A 3N1XC 1WGDA 3AE8B 1QF6A 3DWMA 3U30A 1KH0A 4ANWA 3K9OB 3EUB2 1L5PA 2ZCCA 2DZKA 1WZ0A 3UIPB 4CQNA 5IOIA 2R2QA 3RUIB 4ZRKA 1UF0A 3PV1A 4L1BA 4DWFA 3FILB 1WRDB 1C77A 1UBQA 2ASQA 3Q8EA 3CWIA 5D6JB 2KTFA 1YQ4B 1J7CA 1SE3A 5KHQA 1BT0A 2DZMA 3HM6X 1VJKA 3AU5A 4OZBA 2KD0A 3PZ8A 4L2YA 5DCNA 4C7YA 4HROA 2MEKA 4MGIE 1L4DB 1MG4A 4A3OA 1WMHA 4HRSA 4KSKC 1JW9D 4UDUC 5G5GA 3TSSA 1JWBD 4N59A 1PYWD 3RD2A 4DHZB 4EZKA 1FM0D 4KSLC 1J8CA 3NRZA 3O13A 2ICIA 3L10B 4MJSA 2JX5A 5CHVC 2ZPNA 4DXGA 4AOFA 1D3ZA 4WJOA 3WCQA 4AQ7A 1WMHB 3KWVA 1KF6B 1R4NB 4HDQA 1C1YB 3AEFB 3AE7B 2MP2A 2DAJA 2D10A 2KTRB 2W3SA 4B0EA 2V3NA 2WU2B 2LHDA 3VTUA 2ZZPB 3H7PA 1WXMA 3RI7C 2L8JA 3AU4A 1NBFC 1F2RC 2PE6B 1Q0WB 1MG8A 3PGEA 1QOAA 4D2KA 2N9EB 1L7YA 1JQ4A 4KIKB 1SJHD 3A1QA 2NMQA 2FCQA 3FC4A 4F1SA 3RPFC 1GJZA 1L0VB 5IO9A 1TS5A 3FILA 1Q10A 2J4XA 4RCOA 2N9LA 1JRUA 3ZXVA 1RYJA 4RGNA 4A55A 1TT5B 2REXA 2X8XX 4GDKB 1OTRB 5IKCM 1UZXB 4FXCA 2RPVA 4WJQA 2JXTA 2WXKA 2DYBA 1CJEA 1VDVA 4EUTA 1HXYD 3PZ7A 3VRAB 4JPSA 4HPMB 2GBJA 4FJZA 4LTUA 1WXQA 3NJTA 1Y56A 4MM3A 4OVVA 5G55A 3Q8CA 4ZYSA 3ZDMC 5GMVA 5I4DA 1C3TA 1H7XA 3L08A 3VAWA 1IGDA 3RNEC 3NOBA 1NI2A 4NZLB 2JSVX 2WWZA 2PPHA 3GZNB 2FE8A 4YTNB 1N62A 2J52A 2VZKD 1FXAA 1GB1A 1WM2A 3N20C 4EKUA 1D5ZC 3EGRA 4NJ7A 5EE9A 1P1AA 1L0YB 2G9HD 2JZZA 2GRIA 4YSZB 3PTFC 2ZPYA 4OW0A 4G11A 4H2AA 3ZNZB 2FCSA 4LNOA 3UINB 3AEGB 1VLBA 2IDYA 4X57B 1EF1A 3NVYA 2CS4A 2JF5A 2QC8A 3RZFA 4YL8A 2LJ5A 1RFAA 2DYOA 4IG7B 4WWMA 3DPDA 2KO3A 2QEJC 3ZW3A 2EMSA 2HJ8A 1QT9A 4BKTA 2N9XA 4XWTA 1WXAA 2QDFA 2OOBB 2XBBC 2ZW1A 2JWZA 1NVID 3GS2A 2DZIA 4LJPB 4N58A 1WSPA 2WDVB 1X1MA 4B9KA 2CHXA 2N7DA 1A70A 1AARA 1MI0A 3RFZB 2AWTA 1YQBA 1VRAB 3W1SC 4ZRQA 1TZOA 2J0JA 3DVNU 2JZ3B 3HM3A 3I57A 1HTOA 3P4RB 1ACCA 4K7WA 4PYZA 5DPSA 3NG0A 1PUTA 5BMHA 1FXTB 2C9WB 3DBSA 1WYWB 4P1BC 1MVKA 2PE9A 4C7ZA 4BBNC 4XGAB 4REZA 2IJ0A 4YT0B 1I35A 1UNSA 3LDZE 1DOYA 1FFVA 1I4GA 4WAAA 2V9HA 4KIKA 3UQAA 1ESFA 1JROA 1HE8A 3V05A 1WE6A 3V61A 1WR6E 2O2VA 3RMKC 3VH4B 4AJWA 4XC2A 2K39A 4CYEA 4MACA 5CHFA 2RR9A 1XO3A 2DAFA 3MHSD 1WX7A 4CO7A 3BYYB 3IAS1 2QILA 1FRRA 4XDDA 1UBIA 1ET6A 4B6WA 2G3QB 3EFUA 2MJ3A 5HKHA 1F0ZA 2FIFA 4JGHB 2M4NA 1WXSA 3C19A 1V97A 2XN9C 3MTNB 3HRDD 5H92C 3S2AA 3AE5B 3ML9A 3SU8X 1BMLC 1SE9A 3AE4B 2BW2A 1WGKA 1SBBB 1STEA 4LNIA 1WR1A 3ZNID 3ZXRA 2L83A 4FHJA 1OQRA 4JX1C 1WRIA 3TUOA 2A5UA 1D5MC 4G50A 4WIPA 1T0YA 2MJDA 2PEAA 4W9IA 2W3RA 3AEAB 4NNJB 2WX0A 1E7UA 4YWGG 1WYGA 4GDLB 3W1SA 3NUHB 4LLGM 3TJPA 1E6EB 4B95A 1XEEA 2KQ7A 3DCGA 3H7PB 3W9CB 2WS3B 3ZYYX 1FPYA 1V5OA 2CU3A 4MGKE 1GOZA 4KDIC 1OQQA 4RM9A 4IWQA 2QIEB 3RZWC 1JMLA 2AX5A 3Q8AA 2LXAA 2G1EA 4MH0E 2KN5A 4LDTD 1LM8B 4N6EB 3NZSA 1KLUD 4MEMA 2MCNB 2D3CA 2L00B 3PO0A 5AEKB 2BB5A 1P3QU 1ZUD2 4QAYA 1OEYJ 1SIJA 3ZTCA 2M8SA 3TEWA 4JQWC 4MT5A 3PZDA 3U8ZA 4C56C 4GDKA 2MLBA 3B0AA 1WGRA 3Q8BA 3PS6A 3Q3NC 2WP9B 3AMZA 4AP4C 3GP7A 1EO6A 2FNJB 1R4MB 3PHXB 2L7RA 4M0WA 4GB9A 1V5TA 2LZ6A 3BVMA 4KKJA 2IGGA 3VR9B 3EA6A 2ZVNA 4OZAA 4GN1A 1L4ZB 1RAXA 2K6QA 3CSTA 1TKEA 1JALA 4PYUA 1I4HA 1YX5B 3KVFB 2LRWA 2PW9A 3BK2A 3Q3OC 4G0NB 2AQ2B 2BS3B 3PLUA 1K51A 4KDLB 2ZW0A 1QLBB 2C60A 1WY8A 1GUAB 2MBOA 1EWCA 3N9YC 1WXVA 2MA9B 2B3AA 2RDGA 3WANA 5H8YE 2H89B 4DBGA 3A9JB 2V0GA 4DK5A 2NCNA 4MGZE 2LUEA 1LO5D 1NENB 2KQ4X 4JE3B 2EMTA 2PVOD 4BOZB 4FA6A 3V3XA 1WJ6A 4IWPA 3AE3B 2CHZA 1ZPSA 4BZAA 1VZ8A 5TSSA 3QJZA 1FNWA 4IM3A 1SXTA 3AE9B 1H4RA 3ALBA 3VTVA 4N9F4 2IO2B 3CSFA 3EC8A 2GBMA 2VH1A 2KT7A 3DHIC 2NBVB 4TSSA 1I4QA 3Q3MC 2IGDA 4MSMB 1MFWA 2W55A 1D4BA 4S17A 2NVUI 4LK0M 2ZNVB 4J3OD 3O65B 4IW0A 1ET9A 1Q5WB 2MHJA 3U7ZA 1YJJA 2OJRA 3SHQA 4TV3A 2XEWA 1ZP0B 3PRMB 2WXGA 5FKAC 1GC6A 2D3GA 2N7EA 1GTEA 4KKIA 5LLIA 2J42A 1HEZE 1OQYA 1KRHA 4WJNA 2IO3B 1TKGA 2OHFA 5T8IA 1N60A 2CHWA 2JRIB 2WDRB 4NJ6A 2IO1B 1QOGA 2I1KA 3OAWA 3HIZA 2XNAC 2RGFA 3QC8B 1YJIA 3WAPA 2HE7A 2PKOA 4BOSC 4HXDA 2D5GA 1YX6B 1UELA 2LGXA 3WAOA 2DENB 3TMPB 2AQ3B 3JSVB 4NQKE 2ACZB 3QQ8B 3AH7A 2C7MB 2KAJA 4TMAB 3VFKA 3AEDB 2H88B 4ZRPA 3MC9A 1YN3A 4WH4A 3VVWB 1ZW7A 2V4IB 4A90A 1HA5A 1UUPA 3BVZA 3RNGC 2FUHB 3R7QA 2E3TA 4MSQB 3ZO5B 2LEKA 3OWEB 2L52A 4L23A 1XCQL 4W9DA 5C23A 1T5XD 2LGIA 4HDOA 5J17A 3UIOB 5DPRA 2BKFA 3E9SA 4AUQC 2JPHA 2K6DB 3Q14C 2K8HA 5BYRA 3KYDD 3P2BA 3ZJUA 4GOCA 4W9KA 1KLVA 1K8RB 2AQ1B 4A9AA 4E3CA 3KLSX 4BKGA 4XYCA 4LDTB 4E71A 3ETRA 1P0RA 2CJOA 5DPTA 2M56B 2OJWA 2K8CA 1XLOA 2KMCA 3ZRCA 3RCZA 2JQRB 1TBEA 3BINA 4M00A 3DHHC 3W1YA 1GC7A 1AW7A 3RN9C 1B1ZA 1FEHA 2HDEA 3APFA 1NDDA 2AYOB 4II3B 2LGYA 2Z0EB 2WU5B 4ICVA 3V6CB 1HZ5A 1SJED 3OLMD 2QHOA 1EWYC 2M0XA 3AEEB 4IWOA 2ON8A 3GOEA 4JWUC 4URKA 4RGOS 1ZE3D 4A8XC 1E8XA 4HK2A 2KYWA 4HCPB 3N32A 1SB3C 1V49A 1SE4A 3WA0A 2GBNA 2PVGC 2KC2A 4MM3B 2M19A 2A4ZA 3LB8C 2IY0B 2D3BA 3ZRFA 3ZIMA 3DBRI 1J19A 4F7ZA 2PJHA 3P4QB 1AWDA 3P42A 2C7HA 3QHTA 5GXGB 5G2NA 3SDLC 1CMXB 2LUMA 3BWUD 3ZLZA 2D11A 4BBNF 1XCTL 1H8CA 5AUIA 3APDA 2K8BA 2NPTA 5L95C 4XZ4A 2K22A 3M62B 1P7EA 1TS4A 1EUVB 3T9LA 1JWMD 4TKNA 4W9EA 2IGHA 3ABVB 5IAAC 1RWSA 2VRRB 3OJ4B 5J2RA 2JYEA 2NR2A 2KKCA 2KTRA 2MRPA 5CTRC 3MJWA 4M0WB 3VTWA 2ZVOA 3B9JA 3AM9A 4NQLB 1N5XA 1TZ1A 3BK1A 1B9RA 3A4RA 1E7PB 4IOIE 3R7RA 1YQ3B 4OVZA 3DHGC 4G3XB 3L54A 2YEPF 3E56A 3K9PB 1A5RA 1E8YA 3QAQA 4W9CA 4WWPA 2NTSA 2JUOA 3RNCC 5C2TB 3HHMA 4GSWA 2MBHA 3N1YC 1GT8A 3VDZA 2WXLA 5EE3A 3C8YA 3RULA 3UGBB 5LXIB 2BF8B 2BGFA 3IBEA 1LGRA 1EF5A 4LJOB 2LVQA 3MJ5A 3IG3A 3GE8C 4P7IA 3X0WA 2MJEA 4K1RB 1T0QC 2D3AA 1TY2A 1C4AA 2XK5B 2KX3A 1YD8U 3H7SA 1QOBA 1WM3A 3GZNI 4B0MA 1QZEA 5BYSA 1WGGA 2BYFA 4ANUA 4A3PA 4ANVA 3N30A 4BKSD 3KQ4A 2FCMA 2L0FA 1ENFA 4PT5A 4W9HA 2I1JA 3LJ3A 2W54A 2Z0DB 4Q2JA 2WXJA 4ITKA 3EECA 1K50A 3RNFC 3P4SB 2KJ6A 2KFKA 4HWIB 1ZDXA 1RM6C 1DOXA 1E10A 3PHWB 3I3TB 4HVBA 5D3IB 2DHZA 2B76B 3TEYA 3TIXA 1UH6A 3Q69A 4W9LA 1GAQB 2MSED 3UQBA 3IT6B 1WX9A 1E8WA 5BMIA 2WGSA 5LXHA 1WJUA 2QSDA 1VZ7A 3TBLD 1J7BA 4HJGE 2CJNA 1MHHE 2KOXA 5BYQA 2M0AA 3NY5A 1PGAA 4E74A 2PMVA 4J6IA 2D07B 3R2IA 3AI5A 4FADA 2LRUA 2OEDA 4PK1A 2WNMA 5C1ZA 5E6NA 3N3KB 3T3OA 4I6LB 2WXIA 3NVZA 1WF9A 1OGWA 4I6PA 2W82A 2L05A 2FCNA 3VUXA 4FULA 4YSXB 3A4SC 1P7FA 4PS7A 2DZJA 2O6VD 1L6VA 5E6PA 1QOFA 1I4XA 1HQRD 1Q1OA 1T0SC 4OZCA 1GG3A 2L76A 4KGTA 2BYTA 2KLGA 1E90A 3Q6BA 3IXSA 1SSNA 1E0ZA 1FIQA 5DPWA 2MH7A 4JLCA 2G4SA 1G6JA 2KNBA 2N1VA 2J7QB 3H9DA 3CMMB 1XF5L 2W9NA 3SD5A 1MJDA 2TSSA 4ZDVA 2KJHB 2QMTA 3KW5B 3KUCB 3L0WB 4RGMA 1PGXA 5JXVA 1KFYB 5CHWA 4US9A 4OVUA 3MP9A 1TYGB 1FCCC 3RNBC 1ISNA 1YOVB 3MHZA 2WXPA 2KFKB 2GBRA 1EM7A 4DHZE 3L17A 4C00A 2LFIA 3I9V1 5JH5C 2DNFA 3QCAA 1E7VA 4ZRJA 2LHEA 1Z2MA 3HK0A 3W5UB 2JRHA 3KYCD 1F1HA 1S1QB 1LQBA 4FJYA 2C5LC 1TKYA 2WLBA 3URYA 4NAWB 2C7NB 3C0RB 3MC8A 2LASA 3N1ZC 2QCZA 2M1MA 3PVLA 3R8BA 3BZDB 1JCKB 4WQMA 2J0KA 2KWVB 3BVGA 1IPGA 1CQVA 2YLMA 3VXWA 2V3PA 1UD7A 4C80A 2RDHA 1CZPA 1GTHA 5E6OA 1XXGA 2Y5PA 1DOIA 2JT4B 4II2B 1BUIC 2FIDA 1VCBA 3ZVVA 1KTKA 2GI9A 3Q8FA 1N5WA 4DDID 2L32A 1JWUD 3Q3JA 4K81A 4YTMB 2WDTB 5D3DA 3CF4A 2WXMA 2HTME 4ARCA 1IYFA 1XLQA 4WQOB 1WZ3A 3NVVA 2JWUA 1I42A 3VUYA 2KC1A 4O1NA 1OFFA 1V1PA 4DXAB 4I6NB 4FN2A 4K3CA 3A9KA 2PLPA 3IVFA 5D7GA 4LCDE 1QQRA 5EDSA 1TGZB 1FFUA 3X23A 1ZDVA 5BMGA 2BB6A 1Y8RC 1WE7A 5JZEB 3DBHI 3ML8A 1YMHE 3OJ3A 3FKYA 2INDC 4WWOA 4EE2A 4XX5A 3DBLI 2WXFA 3AXCA 1NI3A 3EFCA 3NS8A 2BYVE 2KDIA 1ZOYB 2INCC 4FHKA 2HTHA 4ANXA 2G4DB 3UI3A 1PQSA 4GU2A 3H8HA 2KVRA 3RYTA 1T6BX 2EKEC 2WQYB 4KX6B 3I63C 2KMAA 2BS4B 1JRPA 1V1PB 3R3MA 3U4EG 4IM0A 3TL5A 2BQQA 4W9JA 3QA8A 3R2TA 4MDKE 5FR3A 4HCNB 4NPNA 3WAMA 2V3SA 4FLHA 3ZGZA 1F2RI 1N61A 2NPTB 4GDLA 2Z59B 1YIWA 1SEBD 3HVDA 3LXFA 1YJ1A 2Z8LA 1MPEA 2JYTA 2WX1A 4BKSA 1KJTA 2IPKD 2IZVB 3ZTDA 1QILA 2DBYA 3FAHA 4LNNA 2LI5A 3NZ3A 2E6XA 5G5HA 1UWXA 4ZOHC 2WHIA 2JVCA 3B2GA 4RH6A 4C4VB 4DHJB 4HKZE 3NVWA 1FCLA 1N63A 1WWTA 3SEBA 2KWCA 3Q2AC
chains in the Genus database with same CATH topology
3W1SA 3HUIA 3P63A 3SFEB 4OHJA 3NUHB 1E7PB 4LLGM 1IUEA 1K53A 4DXFA 4IOIE 5LNK1 1E6EB 1TS3A 1VR9A 1AYFA 1XEEA 2WXHA 1YQ3B 1IBXA 1BXTA 4OVZA 3W9CB 1L6UA 2WS3B 2N9KA 3ZYYX 2YEPF 2CU3A 1GOZA 3E56A 2VZKB 2YEPB 4RNAA 1OQQA 2QIEB 1PFDA 1DGJA 2K3UA 2R61A 2NTSA 4YTPB 1JMLA 5C2TB 1PDXA 2AX5A 3Q8AA 4P6VF 2G1EA 4ZHPA 1GT8A 4KGSA 4N6EB 2WXLA 1KLUD 3C8YA 4RF1A 5EE3A 4YXDB 4WAFA 1J7AA 1K52A 3PO0A 2KN4A 1FNVA 2BB5A 5HI1A 1ZUD2 2EKIA 5FK9C 1CK1A 1XLPA 3MJ5A 1SIJA 4ZHOA 2MJEA 2INNE 1TY2A 1C4AA 3TEWA 1GB4A 2SAKA 4MT5A 1I4RA 1QOBA 3NS1A 4HEA1 3AEBB 4B0MA 4C56C 5BYSA 1EU3A 1ROEA 2DLBA 4IKGA 3Q8BA 4USAA 2WP9B 2WXOA 3AMZA 3GP7A 3KQ4A 1ENFA 4PT5A 4M0WA 2KMMA 3AE2B 2W54A 4GLSC 4Q2JA 3BVMA 4KKJA 2BT6A 2WXJA 2IGGA 4ITKA 2KDMA 3VR9B 3EA6A 1K50A 3VQIA 1L0XB 4OZAA 3P4SB 3CIRB 1FXIA 1L4ZB 1ZDXA 1RM6C 1TKEA 1JALA 3AE8B 1QF6A 4IDIA 3DWMA 1I4HA 1KH0A 3VRBB 3TEZA 3EUB2 2PW9A 1DOXA 3BK2A 1L5PA 5HHDG 1E10A 5D3IB 2AQ2B 2BS3B 2B76B 3TEYA 4CQNA 1K51A 3Q69A 2ZW0A 2Y3AA 1GAQB 4L1BA 1QLBB 3FILB 3IT6B 1ZXIA 1EWCA 3N9YC 5BMIA 1C77A 2BBCA 2RDGA 2INPE 2LMCA 3Q8EA 2QSDA 1VZ7A 5H8YE 2H89B 3CWIA 4DQOC 4NAMA 2V0GA 3TEXA 1J7BA 2K9XA 1V8CA 1YQ4B 3U52E 3AECB 4HJGE 2CJNA 1J7CA 1SE3A 1MHHE 4US8A 1LO5D 1VJKA 5BYQA 4OZBA 4TQ1A 1NENB 3ZJTA 2M0AA 2KQ4X 1PGAA 3PZ8A 4JE3B 2PMVA 3AB5A 2PVOD 4L2YA 3R2IA 4C7YA 2QJLA 2WXRA 4HROA 2MEKA 3V3XA 3W2DA 1L4DB 2DWQA 2OEDA 3AE3B 1ZPSA 4HRSA 1VZ8A 2WXQA 2WNMA 5HFYA 3T3OA 1JW9D 5TSSA 2WXIA 1FNWA 4UDUC 5G5GA 3TSSA 1SXTA 3NVZA 3AE9B 1ZXHA 2W82A 1JWBD 4N59A 3GB1A 1PYWD 1FM0D 2N0SB 2WXNA 4YSXB 3NRZA 2JZPA 3O13A 1P7FA 2J53A 3ZQ4A 1L6VA 4TSSA 1I4QA 2ICIA 3BIID 1QOFA 2IGDA 2JX5A 1I4XA 4DXGA 1TS2A 1C76A 2W55A 4ARIA 1D4BA 1HQRD 4AQ7A 3WCQA 3B2FA 3KWVA 4LK0M 1KF6B 1C79A 4OZCA 4J3OD 4KGTA 2BYTA 3AEFB 3AE7B 1ET9A 2Q5WD 3IXSA 2SEBD 1AN8A 2W3SA 1SSNA 2EELA 4B0EA 3U7ZA 1YJJA 1FO4A 1E0ZA 1FIQA 1FMAD 2V3NA 2WU2B 1F77A 2LHDA 3P1MA 4TQ0A 2MH7A 1SF0A 1I7HA 1ZP0B 1F2RC 2BS2B 2WXGA 5FKAC 1GPXA 1GTEA 4KKIA 2J42A 1HEZE 1QOAA 1KRHA 1NYRA 4D2KA 3T3NA 1TKGA 4KGRA 1JQ4A 2ONQA 2OHFA 5T8IA 1SJHD 2RMMA 1N60A 2NMQA 3FC4A 1XF5L 2WDRB 3RPFC 1L0VB 3MFGA 1QOGA 1TS5A 3FILA 3P4PB 1Q10A 2J4XA 3IAM1 4RCOA 2N9LA 2TSSA 2XNAC 1RYJA 2KWDA 2QMTA 4RGNA 4A55A 1YJIA 4RGMA 1PGXA 4GDKB 1SE2A 3MC0B 5JXVA 2X38A 2PKOA 1KFYB 4US9A 4FXCA 3MP9A 1TYGB 2RPVA 1FCCC 2D5GA 3MHZA 2JXTA 2WXKA 2WXPA 1EM7A 1CJEA 2AQ3B 1VDVA 4WURA 2ACZB 1NYQA 1HXYD 2WDQB 2LFIA 3PZ7A 3VRAB 3I9V1 4JPSA 3AH7A 1DYQA 4LTUA 1WXQA 2LHEA 2KAJA 4XE0A 1Y56A 4RFBA 4TMAB 3IT4B 3AEDB 3W5UB 3Q8CA 2H88B 4XDCA 4ZRPA 4ZYSA 1TJEA 1YN3A 1TKYA 2WLBA 5I4DA 3URYA 1D5XC 1H7XA 4WH4A 2I2YA 2V4IB 1IGDA 1EU4A 4NAWB 5E6JA 4A90A 1HA5A 1UUPA 3BVZA 4NZLB 2JSVX 4JWSC 2FE8A 4YTNB 2E3TA 2DYMA 1N62A 2J52A 2VZKD 1FXAA 1GB1A 2LEKA 4A6QA 5HG2A 3OWEB 2L52A 3R8BA 4L23A 1D5ZC 1XCQL 3EGRA 5EE9A 3BZDB 1T5XD 1L0YB 1JWAD 2LGIA 1JCKB 1T3QA 4NJCA 2G9HD 4WQMA 1QKZA 2GRIA 4YSZB 1TY0A 3BVGA 3E9SA 4OW0A 4H2AA 1CQVA 3LYYA 5BYRA 1C4PA 2V3PA 3AEGB 1VLBA 2IDYA 3NVYA 4C80A 2RDHA 1CZPA 1GTHA 3ZJUA 1XXGA 3AE1B 2Y5PA 1DOIA 2I38A 1UWMA 2PTLA 1E9MA 1BUIC 2AQ1B 2JU6X 4A9AA 2GB1A 3KLSX 2DYOA 3U2SC 4WWMA 2LJIA 1KTKA 2GI9A 5MPOA 3Q8FA 2QEJC 3ETRA 1N5WA 2CJOA 3VR8B 2L32A 1JWUD 1QT9A 2M56B 1UGJA 4XWTA 4YTMB 1H7WA 4AS1A 3HVZA 1XLOA 5D3DA 1V1OA 2ZW1A 3CF4A 2WXMA 2JQRB 5C3JB 2HTME 4ARCA 1XLQA 3NVVA 2JWUA 1NVID 1AW7A 4O1NA 1FD6A 1D6EC 1B1ZA 1YN4A 3GS2A 1FEHA 2HDEA 1OFFA 1V1PA 4N58A 1WSPA 2WDVB 1FRDA 2WU5B 1YN5A 2PLPA 5D7GA 5AUKA 1HZ5A 1SJED 1PGBA 1A70A 1QQRA 1MI0A 2BTEA 3RFZB 2N7JA 1FFUA 1IGCA 1EWYC 1VRAB 3AEEB 1ZDVA 4ZRQA 5BMGA 1TZOA 2BB6A 4RGTA 2ON8A 3I57A 3P4RB 1ACCA 1HZ6A 2FUG1 3AE6B 2K5PA 1YMHE 1PUTA 5BMHA 1C9FA 4JWUC 1KLGD 1M4VA 4RGOS 1MVKA 3L4PA 1ZE3D 4C7ZA 4EE2A 4A8XC 4REZA 2IJ0A 1SB3C 3BYTB 4YT0B 2WXFA 1YNTE 1SE4A 1UNSA 1DOYA 2PVGC 2FBWB 1FFVA 1I4GA 1NI3A 4HKQA 1NEKB 4MM3B 2M19A 1VZ6A 3LB8C 1ZOYB 1C4CA 2L1AA 1JWSD 1ESFA 1JROA 4RF0A 3V05A 1I4PA 3UI3A 3ZJVA 1FNUA 3J9CA 4MH8A 3P4QB 3H8HA 4P16A 1AWDA 3P42A 1T6BX 2PIAA 5GXGB 3W5VB 1MHXA 2WQYB 4MACA 4KX6B 2LUMA 2NTTA 3BWUD 1XO3A 1XCTL 2BS4B 5AUIA 1JRPA 1V1PB 3AN1A 3U4EG 3BYYB 3IAS1 2QILA 1FRRA 4XDDA 1ET6A 3R2TA 5FR3A 3SFDB 1XLNA 1IBXB 2MJ3A 2K0PA 2K22A 1P7EA 1F0ZA 1TS4A 3ZGZA 1F2RI 1N61A 1V97A 2XN9C 3HRDD 1R7SA 1SEBD 3HVDA 5H92C 1JWMD 2IGHA 3LXFA 3AE5B 3ABVB 2Z8LA 1MPEA 2JYTA 2IPKD 3DWGC 1QILA 1BMLC 4R3DA 3AE4B 2DBYA 1RWSA 2BW2A 3FAHA 3KWLA 3NZ3A 1WGKA 1SBBB 2E6XA 1STEA 1UWXA 5G5HA 4YSYB 4ZOHC 2KACA 4XWWA 2JYEA 3SR6A 1C78A 3B2GA 2Y5CA 2L83A 1OQRA 4RH6A 4JX1C 1WRIA 3AV8A 4HKZE 3NVWA 3TUOA 1D5MC 5EE1A 1FCLA 4WIPA 2MJDA 1N63A 3B9JA 3AM9A 2W3RA 5EE0A 1WWTA 3AEAB 1N5XA 3SEBA 3BK1A 4YWGG 1B9RA 1WYGA 4GDLB 1RFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  1V8C A;  1YQ4 B;  3AEC B;  3HUI A;  2CJN A;  3SFE B;  3P63 A;  1J7C A;  1CJE A;  1EWY C;  4US8 A;  1VDV A;  3AEE B;  1E7P B;  1VJK A;  2ACZ B;  1IUE A;  1NEN B;  1E6E B;  1NYQ A;  2WDQ B;  1AYF A;  3VRA B;  1YQ3 B;  3W9C B;  3AB5 A;  2PVO D;  3P4R B;  3AH7 A;  4LTU A;  1L6U A;  1WXQ A;  2WS3 B;  2KAJ A;  4C7Y A;  2QJL A;  3AE6 B;  3ZYY X;  2K5P A;  4HRO A;  1PUT A;  2CU3 A;  3W5U B;  3AED B;  4JWU C;  2DWQ A;  2H88 B;  3AE3 B;  1OQQ A;  1TJE A;  1TKY A;  2WLB A;  4HRS A;  2QIE B;  1PFD A;  1DGJ A;  1H7X A;  3L4P A;  4C7Z A;  4YTP B;  5C2T B;  1PDX A;  1JW9 D;  2AX5 A;  4P6V F;  1SB3 C;  4YT0 B;  2G1E A;  4ZHP A;  1GT8 A;  4JWS C;  4N6E B;  5G5G A;  3NVZ A;  3AE9 B;  4YTN B;  2PVG C;  2FBW B;  2E3T A;  4YXD B;  5EE3 A;  1FFV A;  1N62 A;  1NI3 A;  1JWB D;  4N59 A;  1NEK B;  1J7A A;  1FXA A;  2M19 A;  1FM0 D;  3PO0 A;  3LB8 C;  1ZOY B;  2LEK A;  2N0S B;  4YSX B;  2L52 A;  5EE0 A;  3NRZ A;  1ZUD 2;  1JRO A;  2EKI A;  5EE9 A;  1XLP A;  1JWA D;  1T3Q A;  3P4Q B;  1SIJ A;  4ZHO A;  1L6V A;  1AWD A;  2MJE A;  4WQM A;  3BII D;  2PIA A;  5GXG B;  4YSZ B;  3W5V B;  1QOF A;  2JX5 A;  2WQY B;  4KX6 B;  2W55 A;  1XO3 A;  1QOB A;  3NS1 A;  3AEB B;  3WCQ A;  2BS4 B;  3B2F A;  1KF6 B;  5AUI A;  1JRP A;  3AEG B;  1ROE A;  1VLB A;  3AEF B;  3AN1 A;  3NVY A;  1JQ4 A;  3AE7 B;  4C80 A;  4USA A;  1CZP A;  1GTH A;  2WP9 B;  3AMZ A;  1FRR A;  2Q5W D;  3AE1 B;  2W3S A;  1DOI A;  1DOY A;  2KMM A;  1UWM A;  1E9M A;  1YJJ A;  1FO4 A;  3AE2 B;  1E0Z A;  3SFD B;  1XLN A;  2W54 A;  1FIQ A;  1FMA D;  2MJ3 A;  2WU2 B;  2K22 A;  3P1M A;  2BT6 A;  1F0Z A;  2MH7 A;  4A9A A;  1SF0 A;  4ITK A;  3VR9 B;  4WWM A;  1I7H A;  1N61 A;  1V97 A;  1ZP0 B;  5MPO A;  3P4S B;  1R7S A;  3HRD D;  2BS2 B;  3CIR B;  1FXI A;  3ETR A;  1N5W A;  2CJO A;  5H92 C;  3VR8 B;  1GPX A;  1GTE A;  1RM6 C;  1TKE A;  3AE5 B;  1QT9 A;  1JAL A;  3AE8 B;  2M56 B;  3LXF A;  4IDI A;  3ABV B;  3DWM A;  1QOA A;  1QF6 A;  1KRH A;  3VRB B;  3DWG C;  1NYR A;  3EUB 2;  4YTM B;  1DOX A;  1TKG A;  3AE4 B;  1H7W A;  1RWS A;  2DBY A;  1E10 A;  1L5P A;  1XLO A;  2OHF A;  3FAH A;  1WGK A;  3HVZ A;  3KWL A;  5G5H A;  2BS3 B;  3CF4 A;  1N60 A;  3FC4 A;  2B76 B;  4YSY B;  2JQR B;  5C3J B;  4ZOH C;  2WDR B;  2HTM E;  3RPF C;  1L0V B;  1XLQ A;  1QOG A;  3P4P B;  3NVV A;  3SR6 A;  3B2G A;  1GAQ B;  2Y5C A;  2L83 A;  1QLB B;  1NVI D;  1OQR A;  1RYJ A;  1ZXI A;  4JX1 C;  1WRI A;  3AV8 A;  3NVW A;  5EE1 A;  1YJI A;  2MJD A;  1OFF A;  1N63 A;  3B9J A;  3AM9 A;  4N58 A;  5H8Y E;  2WDV B;  1FRD A;  2H89 B;  2WU5 B;  2PKO A;  1KFY B;  1WWT A;  2W3R A;  3CWI A;  3AEA B;  1FFU A;  1N5X A;  1TYG B;  4FXC A;  4US9 A;  5AUK A;  1A70 A;  1B9R A;  1WYG A;  1RFK A;  1J7B A; 
#chains in the Genus database with same CATH topology
 3JYU A;  3SFE B;  3V62 A;  4OHJ A;  3DDC B;  4A20 A;  3ZNH B;  1VR9 A;  3A33 B;  1BXT A;  2KZR A;  1L6U A;  2MX2 A;  3DBH B;  2ZEQ A;  5KHO A;  2YEP B;  4RNA A;  1TTN A;  3I5J C;  1PFD A;  1DGJ A;  2WYQ A;  2K3U A;  2R61 A;  1PDX A;  4P6V F;  4ZHP A;  4KGS A;  1L2N A;  1K52 A;  2LXC A;  2CR5 A;  2KN4 A;  1FNV A;  4LNK A;  3V60 A;  2EKI A;  5FK9 C;  1CK1 A;  2KFJ A;  1XT9 B;  4ZHO A;  1N6Z A;  5IP4 D;  4M8M A;  4M8N A;  5JHA A;  1WI0 A;  2SAK A;  2RD0 A;  2RSU A;  4HEA 1;  3D32 A;  3TCA A;  5D94 A;  1EU3 A;  1LXD A;  1ROE A;  4IM2 A;  3NZU A;  4BFR A;  2YVC A;  1V86 A;  2UWQ A;  2CU1 A;  2KAN A;  2BWE S;  3JSV A;  1IP9 A;  2KDM A;  2RDB C;  2GLS A;  2AEH A;  3CIR B;  5BO4 B;  3NHE B;  4ZYN A;  2N4F A;  1V80 A;  3PRZ A;  4HPP A;  4IDI A;  3VRB B;  3TEZ A;  4FJV B;  5HHD G;  2ZJD A;  4JIO U;  2LVO A;  4MEL A;  2Y3A A;  2K25 A;  3QAR A;  1ZXI A;  3DQV A;  2HJ1 A;  3L16 A;  2BBC A;  4EOY A;  2INP E;  2LMC A;  2L3Z A;  4DQO C;  3ZKJ C;  3ZDT A;  4NAM A;  3TEX A;  2K9X A;  1V8C A;  3U52 E;  3AEC B;  4US8 A;  1P9D U;  4TQ1 A;  1Z5S B;  3ZJT A;  3AB5 A;  2CKH B;  2QJL A;  2WXR A;  5CX3 A;  3W2D A;  2DWQ A;  4BVU C;  4KVG B;  4K3B A;  2WXQ A;  1OEY A;  1WFY A;  5HFY A;  1ZXH A;  1J0G A;  4KV2 A;  2BPS A;  3GB1 A;  3KUD B;  2N1W A;  2N0S B;  4EFO A;  2WXN A;  3V6E B;  1U4A A;  2JZP A;  2J53 A;  3ZQ4 A;  1VD2 A;  4K7S A;  3UF8 A;  3BII D;  2KXJ A;  3ONS A;  4AJY B;  1TS2 A;  1C76 A;  4ARI A;  2IYD B;  4MGY E;  3B2F A;  1C79 A;  5AZH A;  4HJK A;  5TR5 A;  3OG5 A;  2G45 B;  2NBW B;  4EZL A;  2Q5W D;  1V6E A;  2AL3 A;  2SEB D;  1AN8 A;  2EEL A;  1RLF A;  2UYZ B;  2MWS B;  4AWJ A;  4PS8 A;  1FO4 A;  3PRE A;  4TQ0 A;  1FMA D;  3P1M A;  4GXB A;  1F77 A;  1SF0 A;  1KOT A;  3PSE B;  1I7H A;  1KM7 A;  4CHK A;  3CF6 E;  3WIM A;  2BS2 B;  1WGH A;  2DX5 B;  1GPX A;  4ASW C;  3QIJ A;  3PPA A;  1NYR A;  3T3N A;  4GGQ A;  2FAZ A;  4KGR A;  2ONQ A;  2RMM A;  2LGS A;  1ZKH A;  3U7D A;  3QWZ B;  1SIF A;  3MFG A;  3VHT C;  3P4P B;  3IAM 1;  4ICU A;  3A1Q B;  2KWD A;  4M01 A;  1SE2 A;  3MC0 B;  3DVN V;  2X38 A;  4EZJ A;  1XD3 B;  2KWU B;  3IFW B;  2XK5 A;  4ACF A;  1F52 A;  2Y5B B;  1R4N I;  4F8C B;  4WUR A;  3VH3 B;  1NYQ A;  2WDQ B;  4S0R A;  4TUU A;  1DYQ A;  2V4L A;  3ZUN A;  4XE0 A;  4RFB A;  3IT4 B;  4XDC A;  1TJE A;  5IA7 A;  1D5X C;  2I2Y A;  2GMI C;  1EU4 A;  5E6J A;  3M3J A;  4MJS B;  4JWS C;  3A9J A;  2DYM A;  1HTQ A;  3DBR B;  2MBE A;  2ZCB A;  2GBK A;  4A6Q A;  5HG2 A;  1F9J A;  2BYE A;  3L13 A;  5JHB A;  2V1Y A;  1JWA D;  1T3Q A;  1TIF A;  4NJC A;  4NY0 A;  1QKZ A;  1T0R C;  3EHV A;  1TY0 A;  4WWN A;  2R2O A;  3LYY A;  1C4P A;  3A9K B;  2UU7 A;  5FR6 A;  1V9J A;  3AE1 B;  2I38 A;  1UWM A;  2PTL A;  1E9M A;  3H6N A;  2JU6 X;  3VUW A;  3ECI A;  4K7U A;  2GB1 A;  2HD5 B;  3B1L X;  3PT2 B;  3U2S C;  2LJI A;  5MPO A;  1P98 A;  3VR8 B;  4W9F A;  2BVC A;  1WIA A;  1UGJ A;  2MQJ A;  4IC7 B;  5D2M B;  5IN7 A;  2LWP A;  4FBJ B;  2KQS A;  2ZNV C;  3M63 B;  1H7W A;  4AS1 A;  3HVZ A;  1V1O A;  5C3J B;  2IY1 B;  1FD6 A;  1D6E C;  1ZGU B;  1YN4 A;  2KX0 A;  1FRD A;  1YN5 A;  3T8M A;  5AUK A;  1PGB A;  2KDE B;  4LNF A;  2BTE A;  2N7J A;  1IGC A;  4DHJ D;  3RT3 B;  3B08 A;  4W9G A;  2VH2 A;  4M02 A;  4RGT A;  1HZ6 A;  2FUG 1;  3AE6 B;  2K5P A;  1SGH A;  4GIV A;  1C9F A;  1KLG D;  1M4V A;  2KJR A;  3L4P A;  5AZF A;  3QK0 A;  2NBU A;  1WH3 A;  1E8Z A;  3BYT B;  1S3S G;  1V2Y A;  2O2V B;  3R66 C;  4NAW A;  1M94 A;  1YNT E;  2FBW B;  4HKQ A;  1NEK B;  4JL9 A;  1RRB A;  1VZ6 A;  1C4C A;  2L1A A;  3JW0 X;  1JWS D;  4RF0 A;  1I4P A;  3ZJV A;  1FNU A;  3J9C A;  4MH8 A;  4P16 A;  3RNA C;  3WAL A;  2PIA A;  3W5V B;  1MHX A;  3PRP B;  2KVZ A;  2NTT A;  2D2Q A;  3DOW A;  3DVG X;  3AN1 A;  2M17 A;  3H1U A;  1R4M I;  3SFD B;  1XLN A;  2BWF A;  1IBX B;  2K0P A;  3Q3F A;  3AUL A;  2J0M A;  2L0T A;  3ZNG C;  2JXX A;  1R7S A;  2GOW A;  2O6V B;  3JVZ X;  2LD9 A;  3DBL B;  2MW5 A;  3DWG C;  4R3D A;  4HPL B;  3KWL A;  1WX8 A;  4PS3 A;  4YSY B;  1UGM A;  2NS5 A;  2KAC A;  4XWW A;  3SR6 A;  1C78 A;  2Y5C A;  4DDG D;  3AV8 A;  2LGD A;  5EE1 A;  5EE0 A;  2O6V A;  1RFK A;  3QX1 A;  3HUI A;  3P63 A;  4RM8 A;  4C4V A;  1IUE A;  1K53 A;  4DXF A;  5LNK 1;  2MBB B;  1TS3 A;  2BKR B;  1AYF A;  2WXH A;  1IBX A;  3KUZ A;  3IHP C;  3GE3 C;  2N9K A;  2IBI B;  2LVP A;  2KDB A;  4HLE A;  4GMV A;  2VZK B;  4KZ0 A;  2MBQ A;  1LFD A;  2KHW B;  4ZRI A;  1WGY A;  4WJP A;  4YTP B;  4RMA A;  4RF1 A;  4YXD B;  4WAF A;  1J7A A;  5AZG A;  5HI1 A;  1GNU A;  2KK8 A;  1XQQ A;  5L83 A;  1XLP A;  5J18 A;  2INN E;  4P1C C;  3BY4 B;  4BAX A;  1GB4 A;  4IUM B;  1I4R A;  1WJ4 A;  3NS1 A;  3AEB B;  3DVG Y;  2RPQ A;  2DLB A;  4IKG A;  2JY6 A;  3M95 A;  4USA A;  2WXO A;  1V81 A;  2IO0 B;  3APC A;  3KH0 A;  2KMM A;  2MP2 B;  2K1F A;  1E5W A;  3AE2 B;  4GLS C;  2BT6 A;  4EEW A;  3PLV A;  3ENE A;  3VQI A;  1L0X B;  4KZC A;  1WJN A;  2N9P C;  2KDF B;  2KLC A;  1FXI A;  2AL6 A;  3N1X C;  1WGD A;  3AE8 B;  1QF6 A;  3DWM A;  3U30 A;  1KH0 A;  4ANW A;  3K9O B;  3EUB 2;  1L5P A;  2ZCC A;  2DZK A;  1WZ0 A;  3UIP B;  4CQN A;  5IOI A;  2R2Q A;  3RUI B;  4ZRK A;  1UF0 A;  3PV1 A;  4L1B A;  4DWF A;  3FIL B;  1WRD B;  1C77 A;  1UBQ A;  2ASQ A;  3Q8E A;  3CWI A;  5D6J B;  2KTF A;  1YQ4 B;  1J7C A;  1SE3 A;  5KHQ A;  1BT0 A;  2DZM A;  3HM6 X;  1VJK A;  3AU5 A;  4OZB A;  2KD0 A;  3PZ8 A;  4L2Y A;  5DCN A;  4C7Y A;  4HRO A;  2MEK A;  4MGI E;  1L4D B;  1MG4 A;  4A3O A;  1WMH A;  4HRS A;  4KSK C;  1JW9 D;  4UDU C;  5G5G A;  3TSS A;  1JWB D;  4N59 A;  1PYW D;  3RD2 A;  4DHZ B;  4EZK A;  1FM0 D;  4KSL C;  1J8C A;  3NRZ A;  3O13 A;  2ICI A;  3L10 B;  4MJS A;  2JX5 A;  5CHV C;  2ZPN A;  4DXG A;  4AOF A;  1D3Z A;  4WJO A;  3WCQ A;  4AQ7 A;  1WMH B;  3KWV A;  1KF6 B;  1R4N B;  4HDQ A;  1C1Y B;  3AEF B;  3AE7 B;  2MP2 A;  2DAJ A;  2D10 A;  2KTR B;  2W3S A;  4B0E A;  2V3N A;  2WU2 B;  2LHD A;  3VTU A;  2ZZP B;  3H7P A;  1WXM A;  3RI7 C;  2L8J A;  3AU4 A;  1NBF C;  1F2R C;  2PE6 B;  1Q0W B;  1MG8 A;  3PGE A;  1QOA A;  4D2K A;  2N9E B;  1L7Y A;  1JQ4 A;  4KIK B;  1SJH D;  3A1Q A;  2NMQ A;  2FCQ A;  3FC4 A;  4F1S A;  3RPF C;  1GJZ A;  1L0V B;  5IO9 A;  1TS5 A;  3FIL A;  1Q10 A;  2J4X A;  4RCO A;  2N9L A;  1JRU A;  3ZXV A;  1RYJ A;  4RGN A;  4A55 A;  1TT5 B;  2REX A;  2X8X X;  4GDK B;  1OTR B;  5IKC M;  1UZX B;  4FXC A;  2RPV A;  4WJQ A;  2JXT A;  2WXK A;  2DYB A;  1CJE A;  1VDV A;  4EUT A;  1HXY D;  3PZ7 A;  3VRA B;  4JPS A;  4HPM B;  2GBJ A;  4FJZ A;  4LTU A;  1WXQ A;  3NJT A;  1Y56 A;  4MM3 A;  4OVV A;  5G55 A;  3Q8C A;  4ZYS A;  3ZDM C;  5GMV A;  5I4D A;  1C3T A;  1H7X A;  3L08 A;  3VAW A;  1IGD A;  3RNE C;  3NOB A;  1NI2 A;  4NZL B;  2JSV X;  2WWZ A;  2PPH A;  3GZN B;  2FE8 A;  4YTN B;  1N62 A;  2J52 A;  2VZK D;  1FXA A;  1GB1 A;  1WM2 A;  3N20 C;  4EKU A;  1D5Z C;  3EGR A;  4NJ7 A;  5EE9 A;  1P1A A;  1L0Y B;  2G9H D;  2JZZ A;  2GRI A;  4YSZ B;  3PTF C;  2ZPY A;  4OW0 A;  4G11 A;  4H2A A;  3ZNZ B;  2FCS A;  4LNO A;  3UIN B;  3AEG B;  1VLB A;  2IDY A;  4X57 B;  1EF1 A;  3NVY A;  2CS4 A;  2JF5 A;  2QC8 A;  3RZF A;  4YL8 A;  2LJ5 A;  1RFA A;  2DYO A;  4IG7 B;  4WWM A;  3DPD A;  2KO3 A;  2QEJ C;  3ZW3 A;  2EMS A;  2HJ8 A;  1QT9 A;  4BKT A;  2N9X A;  4XWT A;  1WXA A;  2QDF A;  2OOB B;  2XBB C;  2ZW1 A;  2JWZ A;  1NVI D;  3GS2 A;  2DZI A;  4LJP B;  4N58 A;  1WSP A;  2WDV B;  1X1M A;  4B9K A;  2CHX A;  2N7D A;  1A70 A;  1AAR A;  1MI0 A;  3RFZ B;  2AWT A;  1YQB A;  1VRA B;  3W1S C;  4ZRQ A;  1TZO A;  2J0J A;  3DVN U;  2JZ3 B;  3HM3 A;  3I57 A;  1HTO A;  3P4R B;  1ACC A;  4K7W A;  4PYZ A;  5DPS A;  3NG0 A;  1PUT A;  5BMH A;  1FXT B;  2C9W B;  3DBS A;  1WYW B;  4P1B C;  1MVK A;  2PE9 A;  4C7Z A;  4BBN C;  4XGA B;  4REZ A;  2IJ0 A;  4YT0 B;  1I35 A;  1UNS A;  3LDZ E;  1DOY A;  1FFV A;  1I4G A;  4WAA A;  2V9H A;  4KIK A;  3UQA A;  1ESF A;  1JRO A;  1HE8 A;  3V05 A;  1WE6 A;  3V61 A;  1WR6 E;  2O2V A;  3RMK C;  3VH4 B;  4AJW A;  4XC2 A;  2K39 A;  4CYE A;  4MAC A;  5CHF A;  2RR9 A;  1XO3 A;  2DAF A;  3MHS D;  1WX7 A;  4CO7 A;  3BYY B;  3IAS 1;  2QIL A;  1FRR A;  4XDD A;  1UBI A;  1ET6 A;  4B6W A;  2G3Q B;  3EFU A;  2MJ3 A;  5HKH A;  1F0Z A;  2FIF A;  4JGH B;  2M4N A;  1WXS A;  3C19 A;  1V97 A;  2XN9 C;  3MTN B;  3HRD D;  5H92 C;  3S2A A;  3AE5 B;  3ML9 A;  3SU8 X;  1BML C;  1SE9 A;  3AE4 B;  2BW2 A;  1WGK A;  1SBB B;  1STE A;  4LNI A;  1WR1 A;  3ZNI D;  3ZXR A;  2L83 A;  4FHJ A;  1OQR A;  4JX1 C;  1WRI A;  3TUO A;  2A5U A;  1D5M C;  4G50 A;  4WIP A;  1T0Y A;  2MJD A;  2PEA A;  4W9I A;  2W3R A;  3AEA B;  4NNJ B;  2WX0 A;  1E7U A;  4YWG G;  1WYG A;  4GDL B;  3W1S A;  3NUH B;  4LLG M;  3TJP A;  1E6E B;  4B95 A;  1XEE A;  2KQ7 A;  3DCG A;  3H7P B;  3W9C B;  2WS3 B;  3ZYY X;  1FPY A;  1V5O A;  2CU3 A;  4MGK E;  1GOZ A;  4KDI C;  1OQQ A;  4RM9 A;  4IWQ A;  2QIE B;  3RZW C;  1JML A;  2AX5 A;  3Q8A A;  2LXA A;  2G1E A;  4MH0 E;  2KN5 A;  4LDT D;  1LM8 B;  4N6E B;  3NZS A;  1KLU D;  4MEM A;  2MCN B;  2D3C A;  2L00 B;  3PO0 A;  5AEK B;  2BB5 A;  1P3Q U;  1ZUD 2;  4QAY A;  1OEY J;  1SIJ A;  3ZTC A;  2M8S A;  3TEW A;  4JQW C;  4MT5 A;  3PZD A;  3U8Z A;  4C56 C;  4GDK A;  2MLB A;  3B0A A;  1WGR A;  3Q8B A;  3PS6 A;  3Q3N C;  2WP9 B;  3AMZ A;  4AP4 C;  3GP7 A;  1EO6 A;  2FNJ B;  1R4M B;  3PHX B;  2L7R A;  4M0W A;  4GB9 A;  1V5T A;  2LZ6 A;  3BVM A;  4KKJ A;  2IGG A;  3VR9 B;  3EA6 A;  2ZVN A;  4OZA A;  4GN1 A;  1L4Z B;  1RAX A;  2K6Q A;  3CST A;  1TKE A;  1JAL A;  4PYU A;  1I4H A;  1YX5 B;  3KVF B;  2LRW A;  2PW9 A;  3BK2 A;  3Q3O C;  4G0N B;  2AQ2 B;  2BS3 B;  3PLU A;  1K51 A;  4KDL B;  2ZW0 A;  1QLB B;  2C60 A;  1WY8 A;  1GUA B;  2MBO A;  1EWC A;  3N9Y C;  1WXV A;  2MA9 B;  2B3A A;  2RDG A;  3WAN A;  5H8Y E;  2H89 B;  4DBG A;  3A9J B;  2V0G A;  4DK5 A;  2NCN A;  4MGZ E;  2LUE A;  1LO5 D;  1NEN B;  2KQ4 X;  4JE3 B;  2EMT A;  2PVO D;  4BOZ B;  4FA6 A;  3V3X A;  1WJ6 A;  4IWP A;  3AE3 B;  2CHZ A;  1ZPS A;  4BZA A;  1VZ8 A;  5TSS A;  3QJZ A;  1FNW A;  4IM3 A;  1SXT A;  3AE9 B;  1H4R A;  3ALB A;  3VTV A;  4N9F 4;  2IO2 B;  3CSF A;  3EC8 A;  2GBM A;  2VH1 A;  2KT7 A;  3DHI C;  2NBV B;  4TSS A;  1I4Q A;  3Q3M C;  2IGD A;  4MSM B;  1MFW A;  2W55 A;  1D4B A;  4S17 A;  2NVU I;  4LK0 M;  2ZNV B;  4J3O D;  3O65 B;  4IW0 A;  1ET9 A;  1Q5W B;  2MHJ A;  3U7Z A;  1YJJ A;  2OJR A;  3SHQ A;  4TV3 A;  2XEW A;  1ZP0 B;  3PRM B;  2WXG A;  5FKA C;  1GC6 A;  2D3G A;  2N7E A;  1GTE A;  4KKI A;  5LLI A;  2J42 A;  1HEZ E;  1OQY A;  1KRH A;  4WJN A;  2IO3 B;  1TKG A;  2OHF A;  5T8I A;  1N60 A;  2CHW A;  2JRI B;  2WDR B;  4NJ6 A;  2IO1 B;  1QOG A;  2I1K A;  3OAW A;  3HIZ A;  2XNA C;  2RGF A;  3QC8 B;  1YJI A;  3WAP A;  2HE7 A;  2PKO A;  4BOS C;  4HXD A;  2D5G A;  1YX6 B;  1UEL A;  2LGX A;  3WAO A;  2DEN B;  3TMP B;  2AQ3 B;  3JSV B;  4NQK E;  2ACZ B;  3QQ8 B;  3AH7 A;  2C7M B;  2KAJ A;  4TMA B;  3VFK A;  3AED B;  2H88 B;  4ZRP A;  3MC9 A;  1YN3 A;  4WH4 A;  3VVW B;  1ZW7 A;  2V4I B;  4A90 A;  1HA5 A;  1UUP A;  3BVZ A;  3RNG C;  2FUH B;  3R7Q A;  2E3T A;  4MSQ B;  3ZO5 B;  2LEK A;  3OWE B;  2L52 A;  4L23 A;  1XCQ L;  4W9D A;  5C23 A;  1T5X D;  2LGI A;  4HDO A;  5J17 A;  3UIO B;  5DPR A;  2BKF A;  3E9S A;  4AUQ C;  2JPH A;  2K6D B;  3Q14 C;  2K8H A;  5BYR A;  3KYD D;  3P2B A;  3ZJU A;  4GOC A;  4W9K A;  1KLV A;  1K8R B;  2AQ1 B;  4A9A A;  4E3C A;  3KLS X;  4BKG A;  4XYC A;  4LDT B;  4E71 A;  3ETR A;  1P0R A;  2CJO A;  5DPT A;  2M56 B;  2OJW A;  2K8C A;  1XLO A;  2KMC A;  3ZRC A;  3RCZ A;  2JQR B;  1TBE A;  3BIN A;  4M00 A;  3DHH C;  3W1Y A;  1GC7 A;  1AW7 A;  3RN9 C;  1B1Z A;  1FEH A;  2HDE A;  3APF A;  1NDD A;  2AYO B;  4II3 B;  2LGY A;  2Z0E B;  2WU5 B;  4ICV A;  3V6C B;  1HZ5 A;  1SJE D;  3OLM D;  2QHO A;  1EWY C;  2M0X A;  3AEE B;  4IWO A;  2ON8 A;  3GOE A;  4JWU C;  4URK A;  4RGO S;  1ZE3 D;  4A8X C;  1E8X A;  4HK2 A;  2KYW A;  4HCP B;  3N32 A;  1SB3 C;  1V49 A;  1SE4 A;  3WA0 A;  2GBN A;  2PVG C;  2KC2 A;  4MM3 B;  2M19 A;  2A4Z A;  3LB8 C;  2IY0 B;  2D3B A;  3ZRF A;  3ZIM A;  3DBR I;  1J19 A;  4F7Z A;  2PJH A;  3P4Q B;  1AWD A;  3P42 A;  2C7H A;  3QHT A;  5GXG B;  5G2N A;  3SDL C;  1CMX B;  2LUM A;  3BWU D;  3ZLZ A;  2D11 A;  4BBN F;  1XCT L;  1H8C A;  5AUI A;  3APD A;  2K8B A;  2NPT A;  5L95 C;  4XZ4 A;  2K22 A;  3M62 B;  1P7E A;  1TS4 A;  1EUV B;  3T9L A;  1JWM D;  4TKN A;  4W9E A;  2IGH A;  3ABV B;  5IAA C;  1RWS A;  2VRR B;  3OJ4 B;  5J2R A;  2JYE A;  2NR2 A;  2KKC A;  2KTR A;  2MRP A;  5CTR C;  3MJW A;  4M0W B;  3VTW A;  2ZVO A;  3B9J A;  3AM9 A;  4NQL B;  1N5X A;  1TZ1 A;  3BK1 A;  1B9R A;  3A4R A;  1E7P B;  4IOI E;  3R7R A;  1YQ3 B;  4OVZ A;  3DHG C;  4G3X B;  3L54 A;  2YEP F;  3E56 A;  3K9P B;  1A5R A;  1E8Y A;  3QAQ A;  4W9C A;  4WWP A;  2NTS A;  2JUO A;  3RNC C;  5C2T B;  3HHM A;  4GSW A;  2MBH A;  3N1Y C;  1GT8 A;  3VDZ A;  2WXL A;  5EE3 A;  3C8Y A;  3RUL A;  3UGB B;  5LXI B;  2BF8 B;  2BGF A;  3IBE A;  1LGR A;  1EF5 A;  4LJO B;  2LVQ A;  3MJ5 A;  3IG3 A;  3GE8 C;  4P7I A;  3X0W A;  2MJE A;  4K1R B;  1T0Q C;  2D3A A;  1TY2 A;  1C4A A;  2XK5 B;  2KX3 A;  1YD8 U;  3H7S A;  1QOB A;  1WM3 A;  3GZN I;  4B0M A;  1QZE A;  5BYS A;  1WGG A;  2BYF A;  4ANU A;  4A3P A;  4ANV A;  3N30 A;  4BKS D;  3KQ4 A;  2FCM A;  2L0F A;  1ENF A;  4PT5 A;  4W9H A;  2I1J A;  3LJ3 A;  2W54 A;  2Z0D B;  4Q2J A;  2WXJ A;  4ITK A;  3EEC A;  1K50 A;  3RNF C;  3P4S B;  2KJ6 A;  2KFK A;  4HWI B;  1ZDX A;  1RM6 C;  1DOX A;  1E10 A;  3PHW B;  3I3T B;  4HVB A;  5D3I B;  2DHZ A;  2B76 B;  3TEY A;  3TIX A;  1UH6 A;  3Q69 A;  4W9L A;  1GAQ B;  2MSE D;  3UQB A;  3IT6 B;  1WX9 A;  1E8W A;  5BMI A;  2WGS A;  5LXH A;  1WJU A;  2QSD A;  1VZ7 A;  3TBL D;  1J7B A;  4HJG E;  2CJN A;  1MHH E;  2KOX A;  5BYQ A;  2M0A A;  3NY5 A;  1PGA A;  4E74 A;  2PMV A;  4J6I A;  2D07 B;  3R2I A;  3AI5 A;  4FAD A;  2LRU A;  2OED A;  4PK1 A;  2WNM A;  5C1Z A;  5E6N A;  3N3K B;  3T3O A;  4I6L B;  2WXI A;  3NVZ A;  1WF9 A;  1OGW A;  4I6P A;  2W82 A;  2L05 A;  2FCN A;  3VUX A;  4FUL A;  4YSX B;  3A4S C;  1P7F A;  4PS7 A;  2DZJ A;  2O6V D;  1L6V A;  5E6P A;  1QOF A;  1I4X A;  1HQR D;  1Q1O A;  1T0S C;  4OZC A;  1GG3 A;  2L76 A;  4KGT A;  2BYT A;  2KLG A;  1E90 A;  3Q6B A;  3IXS A;  1SSN A;  1E0Z A;  1FIQ A;  5DPW A;  2MH7 A;  4JLC A;  2G4S A;  1G6J A;  2KNB A;  2N1V A;  2J7Q B;  3H9D A;  3CMM B;  1XF5 L;  2W9N A;  3SD5 A;  1MJD A;  2TSS A;  4ZDV A;  2KJH B;  2QMT A;  3KW5 B;  3KUC B;  3L0W B;  4RGM A;  1PGX A;  5JXV A;  1KFY B;  5CHW A;  4US9 A;  4OVU A;  3MP9 A;  1TYG B;  1FCC C;  3RNB C;  1ISN A;  1YOV B;  3MHZ A;  2WXP A;  2KFK B;  2GBR A;  1EM7 A;  4DHZ E;  3L17 A;  4C00 A;  2LFI A;  3I9V 1;  5JH5 C;  2DNF A;  3QCA A;  1E7V A;  4ZRJ A;  2LHE A;  1Z2M A;  3HK0 A;  3W5U B;  2JRH A;  3KYC D;  1F1H A;  1S1Q B;  1LQB A;  4FJY A;  2C5L C;  1TKY A;  2WLB A;  3URY A;  4NAW B;  2C7N B;  3C0R B;  3MC8 A;  2LAS A;  3N1Z C;  2QCZ A;  2M1M A;  3PVL A;  3R8B A;  3BZD B;  1JCK B;  4WQM A;  2J0K A;  2KWV B;  3BVG A;  1IPG A;  1CQV A;  2YLM A;  3VXW A;  2V3P A;  1UD7 A;  4C80 A;  2RDH A;  1CZP A;  1GTH A;  5E6O A;  1XXG A;  2Y5P A;  1DOI A;  2JT4 B;  4II2 B;  1BUI C;  2FID A;  1VCB A;  3ZVV A;  1KTK A;  2GI9 A;  3Q8F A;  1N5W A;  4DDI D;  2L32 A;  1JWU D;  3Q3J A;  4K81 A;  4YTM B;  2WDT B;  5D3D A;  3CF4 A;  2WXM A;  2HTM E;  4ARC A;  1IYF A;  1XLQ A;  4WQO B;  1WZ3 A;  3NVV A;  2JWU A;  1I42 A;  3VUY A;  2KC1 A;  4O1N A;  1OFF A;  1V1P A;  4DXA B;  4I6N B;  4FN2 A;  4K3C A;  3A9K A;  2PLP A;  3IVF A;  5D7G A;  4LCD E;  1QQR A;  5EDS A;  1TGZ B;  1FFU A;  3X23 A;  1ZDV A;  5BMG A;  2BB6 A;  1Y8R C;  1WE7 A;  5JZE B;  3DBH I;  3ML8 A;  1YMH E;  3OJ3 A;  3FKY A;  2IND C;  4WWO A;  4EE2 A;  4XX5 A;  3DBL I;  2WXF A;  3AXC A;  1NI3 A;  3EFC A;  3NS8 A;  2BYV E;  2KDI A;  1ZOY B;  2INC C;  4FHK A;  2HTH A;  4ANX A;  2G4D B;  3UI3 A;  1PQS A;  4GU2 A;  3H8H A;  2KVR A;  3RYT A;  1T6B X;  2EKE C;  2WQY B;  4KX6 B;  3I63 C;  2KMA A;  2BS4 B;  1JRP A;  1V1P B;  3R3M A;  3U4E G;  4IM0 A;  3TL5 A;  2BQQ A;  4W9J A;  3QA8 A;  3R2T A;  4MDK E;  5FR3 A;  4HCN B;  4NPN A;  3WAM A;  2V3S A;  4FLH A;  3ZGZ A;  1F2R I;  1N61 A;  2NPT B;  4GDL A;  2Z59 B;  1YIW A;  1SEB D;  3HVD A;  3LXF A;  1YJ1 A;  2Z8L A;  1MPE A;  2JYT A;  2WX1 A;  4BKS A;  1KJT A;  2IPK D;  2IZV B;  3ZTD A;  1QIL A;  2DBY A;  3FAH A;  4LNN A;  2LI5 A;  3NZ3 A;  2E6X A;  5G5H A;  1UWX A;  4ZOH C;  2WHI A;  2JVC A;  3B2G A;  4RH6 A;  4C4V B;  4DHJ B;  4HKZ E;  3NVW A;  1FCL A;  1N63 A;  1WWT A;  3SEB A;  2KWC A;  3Q2A C; 
#chains in the Genus database with same CATH homology
 3W1S A;  3HUI A;  3P63 A;  3SFE B;  4OHJ A;  3NUH B;  1E7P B;  4LLG M;  1IUE A;  1K53 A;  4DXF A;  4IOI E;  5LNK 1;  1E6E B;  1TS3 A;  1VR9 A;  1AYF A;  1XEE A;  2WXH A;  1YQ3 B;  1IBX A;  1BXT A;  4OVZ A;  3W9C B;  1L6U A;  2WS3 B;  2N9K A;  3ZYY X;  2YEP F;  2CU3 A;  1GOZ A;  3E56 A;  2VZK B;  2YEP B;  4RNA A;  1OQQ A;  2QIE B;  1PFD A;  1DGJ A;  2K3U A;  2R61 A;  2NTS A;  4YTP B;  1JML A;  5C2T B;  1PDX A;  2AX5 A;  3Q8A A;  4P6V F;  2G1E A;  4ZHP A;  1GT8 A;  4KGS A;  4N6E B;  2WXL A;  1KLU D;  3C8Y A;  4RF1 A;  5EE3 A;  4YXD B;  4WAF A;  1J7A A;  1K52 A;  3PO0 A;  2KN4 A;  1FNV A;  2BB5 A;  5HI1 A;  1ZUD 2;  2EKI A;  5FK9 C;  1CK1 A;  1XLP A;  3MJ5 A;  1SIJ A;  4ZHO A;  2MJE A;  2INN E;  1TY2 A;  1C4A A;  3TEW A;  1GB4 A;  2SAK A;  4MT5 A;  1I4R A;  1QOB A;  3NS1 A;  4HEA 1;  3AEB B;  4B0M A;  4C56 C;  5BYS A;  1EU3 A;  1ROE A;  2DLB A;  4IKG A;  3Q8B A;  4USA A;  2WP9 B;  2WXO A;  3AMZ A;  3GP7 A;  3KQ4 A;  1ENF A;  4PT5 A;  4M0W A;  2KMM A;  3AE2 B;  2W54 A;  4GLS C;  4Q2J A;  3BVM A;  4KKJ A;  2BT6 A;  2WXJ A;  2IGG A;  4ITK A;  2KDM A;  3VR9 B;  3EA6 A;  1K50 A;  3VQI A;  1L0X B;  4OZA A;  3P4S B;  3CIR B;  1FXI A;  1L4Z B;  1ZDX A;  1RM6 C;  1TKE A;  1JAL A;  3AE8 B;  1QF6 A;  4IDI A;  3DWM A;  1I4H A;  1KH0 A;  3VRB B;  3TEZ A;  3EUB 2;  2PW9 A;  1DOX A;  3BK2 A;  1L5P A;  5HHD G;  1E10 A;  5D3I B;  2AQ2 B;  2BS3 B;  2B76 B;  3TEY A;  4CQN A;  1K51 A;  3Q69 A;  2ZW0 A;  2Y3A A;  1GAQ B;  4L1B A;  1QLB B;  3FIL B;  3IT6 B;  1ZXI A;  1EWC A;  3N9Y C;  5BMI A;  1C77 A;  2BBC A;  2RDG A;  2INP E;  2LMC A;  3Q8E A;  2QSD A;  1VZ7 A;  5H8Y E;  2H89 B;  3CWI A;  4DQO C;  4NAM A;  2V0G A;  3TEX A;  1J7B A;  2K9X A;  1V8C A;  1YQ4 B;  3U52 E;  3AEC B;  4HJG E;  2CJN A;  1J7C A;  1SE3 A;  1MHH E;  4US8 A;  1LO5 D;  1VJK A;  5BYQ A;  4OZB A;  4TQ1 A;  1NEN B;  3ZJT A;  2M0A A;  2KQ4 X;  1PGA A;  3PZ8 A;  4JE3 B;  2PMV A;  3AB5 A;  2PVO D;  4L2Y A;  3R2I A;  4C7Y A;  2QJL A;  2WXR A;  4HRO A;  2MEK A;  3V3X A;  3W2D A;  1L4D B;  2DWQ A;  2OED A;  3AE3 B;  1ZPS A;  4HRS A;  1VZ8 A;  2WXQ A;  2WNM A;  5HFY A;  3T3O A;  1JW9 D;  5TSS A;  2WXI A;  1FNW A;  4UDU C;  5G5G A;  3TSS A;  1SXT A;  3NVZ A;  3AE9 B;  1ZXH A;  2W82 A;  1JWB D;  4N59 A;  3GB1 A;  1PYW D;  1FM0 D;  2N0S B;  2WXN A;  4YSX B;  3NRZ A;  2JZP A;  3O13 A;  1P7F A;  2J53 A;  3ZQ4 A;  1L6V A;  4TSS A;  1I4Q A;  2ICI A;  3BII D;  1QOF A;  2IGD A;  2JX5 A;  1I4X A;  4DXG A;  1TS2 A;  1C76 A;  2W55 A;  4ARI A;  1D4B A;  1HQR D;  4AQ7 A;  3WCQ A;  3B2F A;  3KWV A;  4LK0 M;  1KF6 B;  1C79 A;  4OZC A;  4J3O D;  4KGT A;  2BYT A;  3AEF B;  3AE7 B;  1ET9 A;  2Q5W D;  3IXS A;  2SEB D;  1AN8 A;  2W3S A;  1SSN A;  2EEL A;  4B0E A;  3U7Z A;  1YJJ A;  1FO4 A;  1E0Z A;  1FIQ A;  1FMA D;  2V3N A;  2WU2 B;  1F77 A;  2LHD A;  3P1M A;  4TQ0 A;  2MH7 A;  1SF0 A;  1I7H A;  1ZP0 B;  1F2R C;  2BS2 B;  2WXG A;  5FKA C;  1GPX A;  1GTE A;  4KKI A;  2J42 A;  1HEZ E;  1QOA A;  1KRH A;  1NYR A;  4D2K A;  3T3N A;  1TKG A;  4KGR A;  1JQ4 A;  2ONQ A;  2OHF A;  5T8I A;  1SJH D;  2RMM A;  1N60 A;  2NMQ A;  3FC4 A;  1XF5 L;  2WDR B;  3RPF C;  1L0V B;  3MFG A;  1QOG A;  1TS5 A;  3FIL A;  3P4P B;  1Q10 A;  2J4X A;  3IAM 1;  4RCO A;  2N9L A;  2TSS A;  2XNA C;  1RYJ A;  2KWD A;  2QMT A;  4RGN A;  4A55 A;  1YJI A;  4RGM A;  1PGX A;  4GDK B;  1SE2 A;  3MC0 B;  5JXV A;  2X38 A;  2PKO A;  1KFY B;  4US9 A;  4FXC A;  3MP9 A;  1TYG B;  2RPV A;  1FCC C;  2D5G A;  3MHZ A;  2JXT A;  2WXK A;  2WXP A;  1EM7 A;  1CJE A;  2AQ3 B;  1VDV A;  4WUR A;  2ACZ B;  1NYQ A;  1HXY D;  2WDQ B;  2LFI A;  3PZ7 A;  3VRA B;  3I9V 1;  4JPS A;  3AH7 A;  1DYQ A;  4LTU A;  1WXQ A;  2LHE A;  2KAJ A;  4XE0 A;  1Y56 A;  4RFB A;  4TMA B;  3IT4 B;  3AED B;  3W5U B;  3Q8C A;  2H88 B;  4XDC A;  4ZRP A;  4ZYS A;  1TJE A;  1YN3 A;  1TKY A;  2WLB A;  5I4D A;  3URY A;  1D5X C;  1H7X A;  4WH4 A;  2I2Y A;  2V4I B;  1IGD A;  1EU4 A;  4NAW B;  5E6J A;  4A90 A;  1HA5 A;  1UUP A;  3BVZ A;  4NZL B;  2JSV X;  4JWS C;  2FE8 A;  4YTN B;  2E3T A;  2DYM A;  1N62 A;  2J52 A;  2VZK D;  1FXA A;  1GB1 A;  2LEK A;  4A6Q A;  5HG2 A;  3OWE B;  2L52 A;  3R8B A;  4L23 A;  1D5Z C;  1XCQ L;  3EGR A;  5EE9 A;  3BZD B;  1T5X D;  1L0Y B;  1JWA D;  2LGI A;  1JCK B;  1T3Q A;  4NJC A;  2G9H D;  4WQM A;  1QKZ A;  2GRI A;  4YSZ B;  1TY0 A;  3BVG A;  3E9S A;  4OW0 A;  4H2A A;  1CQV A;  3LYY A;  5BYR A;  1C4P A;  2V3P A;  3AEG B;  1VLB A;  2IDY A;  3NVY A;  4C80 A;  2RDH A;  1CZP A;  1GTH A;  3ZJU A;  1XXG A;  3AE1 B;  2Y5P A;  1DOI A;  2I38 A;  1UWM A;  2PTL A;  1E9M A;  1BUI C;  2AQ1 B;  2JU6 X;  4A9A A;  2GB1 A;  3KLS X;  2DYO A;  3U2S C;  4WWM A;  2LJI A;  1KTK A;  2GI9 A;  5MPO A;  3Q8F A;  2QEJ C;  3ETR A;  1N5W A;  2CJO A;  3VR8 B;  2L32 A;  1JWU D;  1QT9 A;  2M56 B;  1UGJ A;  4XWT A;  4YTM B;  1H7W A;  4AS1 A;  3HVZ A;  1XLO A;  5D3D A;  1V1O A;  2ZW1 A;  3CF4 A;  2WXM A;  2JQR B;  5C3J B;  2HTM E;  4ARC A;  1XLQ A;  3NVV A;  2JWU A;  1NVI D;  1AW7 A;  4O1N A;  1FD6 A;  1D6E C;  1B1Z A;  1YN4 A;  3GS2 A;  1FEH A;  2HDE A;  1OFF A;  1V1P A;  4N58 A;  1WSP A;  2WDV B;  1FRD A;  2WU5 B;  1YN5 A;  2PLP A;  5D7G A;  5AUK A;  1HZ5 A;  1SJE D;  1PGB A;  1A70 A;  1QQR A;  1MI0 A;  2BTE A;  3RFZ B;  2N7J A;  1FFU A;  1IGC A;  1EWY C;  1VRA B;  3AEE B;  1ZDV A;  4ZRQ A;  5BMG A;  1TZO A;  2BB6 A;  4RGT A;  2ON8 A;  3I57 A;  3P4R B;  1ACC A;  1HZ6 A;  2FUG 1;  3AE6 B;  2K5P A;  1YMH E;  1PUT A;  5BMH A;  1C9F A;  4JWU C;  1KLG D;  1M4V A;  4RGO S;  1MVK A;  3L4P A;  1ZE3 D;  4C7Z A;  4EE2 A;  4A8X C;  4REZ A;  2IJ0 A;  1SB3 C;  3BYT B;  4YT0 B;  2WXF A;  1YNT E;  1SE4 A;  1UNS A;  1DOY A;  2PVG C;  2FBW B;  1FFV A;  1I4G A;  1NI3 A;  4HKQ A;  1NEK B;  4MM3 B;  2M19 A;  1VZ6 A;  3LB8 C;  1ZOY B;  1C4C A;  2L1A A;  1JWS D;  1ESF A;  1JRO A;  4RF0 A;  3V05 A;  1I4P A;  3UI3 A;  3ZJV A;  1FNU A;  3J9C A;  4MH8 A;  3P4Q B;  3H8H A;  4P16 A;  1AWD A;  3P42 A;  1T6B X;  2PIA A;  5GXG B;  3W5V B;  1MHX A;  2WQY B;  4MAC A;  4KX6 B;  2LUM A;  2NTT A;  3BWU D;  1XO3 A;  1XCT L;  2BS4 B;  5AUI A;  1JRP A;  1V1P B;  3AN1 A;  3U4E G;  3BYY B;  3IAS 1;  2QIL A;  1FRR A;  4XDD A;  1ET6 A;  3R2T A;  5FR3 A;  3SFD B;  1XLN A;  1IBX B;  2MJ3 A;  2K0P A;  2K22 A;  1P7E A;  1F0Z A;  1TS4 A;  3ZGZ A;  1F2R I;  1N61 A;  1V97 A;  2XN9 C;  3HRD D;  1R7S A;  1SEB D;  3HVD A;  5H92 C;  1JWM D;  2IGH A;  3LXF A;  3AE5 B;  3ABV B;  2Z8L A;  1MPE A;  2JYT A;  2IPK D;  3DWG C;  1QIL A;  1BML C;  4R3D A;  3AE4 B;  2DBY A;  1RWS A;  2BW2 A;  3FAH A;  3KWL A;  3NZ3 A;  1WGK A;  1SBB B;  2E6X A;  1STE A;  1UWX A;  5G5H A;  4YSY B;  4ZOH C;  2KAC A;  4XWW A;  2JYE A;  3SR6 A;  1C78 A;  3B2G A;  2Y5C A;  2L83 A;  1OQR A;  4RH6 A;  4JX1 C;  1WRI A;  3AV8 A;  4HKZ E;  3NVW A;  3TUO A;  1D5M C;  5EE1 A;  1FCL A;  4WIP A;  2MJD A;  1N63 A;  3B9J A;  3AM9 A;  2W3R A;  5EE0 A;  1WWT A;  3AEA B;  1N5X A;  3SEB A;  3BK1 A;  4YWG G;  1B9R A;  1WYG A;  4GDL B;  1RFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...