3AE2B

Crystal structure of porcine heart mitochondrial complex ii bound with 2-hydroxy-n-phenyl-benzamide
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with 2-Hydroxy-N-phenyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 64
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae2B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae2B01
3AE5B 2H89B 1JRPA 3AH7A 4YSZB 2BS4B 3B9JA 3ABVB 1XLOA 4JX1C 4WWMA 1TJEA 1QF6A 1TKYA 4ZHPA 3AEEB 1GAQB 1T3QA 2PVGC 1ZP0B 1KF6B 3AECB 1FFVA 1QOGA 3L4PA 2KAJA 1NI3A 2MJ3A 3SFDB 1FRRA 2WP9B 3VR9B 1YQ3B 3AEFB 2PVOD 3NVZA 4WQMA 4FXCA 3P63A 5EE3A 3VR8B 2BS2B 3P4QB 1FXIA 3AE4B 1H7XA 1NVID 1L0VB 2ACZB 3VRAB 1PDXA 2JX5A 4ZHOA 1JWAD 1E7PB 1TYGB 1V97A 1KRHA 3P4RB 3AEAB 1AWDA 2B76B 2AX5A 2CJNA 1E6EB 1GPXA 3PO0A 1FMAD 3W5VB 1WYGA 1E10A 5C2TB 2WQYB 3W5UB 2EKIA 4JWSC 3SR6A 3AE7B 5G5HA 1N61A 1JALA 1OFFA 1DOXA 4USAA 1FM0D 1SIJA 3LXFA 1SB3C 1QT9A 2G1EA 1RM6C 2DWQA 1PFDA 2QIEB 2QJLA 1JW9D 2M19A 4N59A 5C3JB 2WS3B 1QOFA 3NVWA 5EE9A 1DGJA 2M56B 5EE1A 4C80A 1DOYA 1OQQA 1WXQA 1YJIA 1ZXIA 1ZUD2 1OQRA 1JWBD 3KWLA 1KFYB 3AE1B 1H7WA 1RYJA 4ITKA 3ZYYX 1J7AA 4YTNB 4C7ZA 4YTPB 3AB5A 3AMZA 1SF0A 2E3TA 3AE6B 4N6EB 1L6UA 3WCQA 1JROA 1WGKA 2CU3A 1CZPA 3AN1A 5AUKA 3FAHA 3CIRB 3P4PB 1YQ4B 5EE0A 4YT0B 4IDIA 3AEDB 2W54A 5H92C 3FC4A 3AE9B 1EWYC 1L5PA 2CJOA 2BS3B 3AV8A 2W3SA 2WLBA 2N0SB 3HRDD 1FFUA 3HVZA 4N58A 5MPOA 1N5WA 1RWSA 3AEBB 3HUIA 3NRZA 4US9A 1WWTA 5H8YE 2BT6A 3AM9A 2Y5CA 3P1MA 3AE8B 1IUEA 1VLBA 1NYRA 1E9MA 1I7HA 1V8CA 2WDQB 1FXAA 1NENB 2DBYA 2HTME 2LEKA 2MJEA 3B2FA 3CF4A 2Q5WD 3DWGC 1F0ZA 5AUIA 1N5XA 3CWIA 4YSYB 4YTMB 3W9CB 2KMMA 1TKGA 2H88B 3DWMA 1QLBB 2K22A 1XO3A 1QOAA 1YJJA 4HROA 1XLQA 4US8A 3NVVA 1PUTA 2PIAA 2W55A 3VRBB 3BIID 5GXGB 4YSXB 1DOIA 1QOBA 1VJKA 1ROEA 1J7CA 2K9XA 1J7BA 1N62A 2OHFA 2WDVB 3B2GA 1GT8A 1L6VA 5G5GA 1FRDA 3RPFC 1GTHA 4KX6B 2L52A 4C7YA 3AE2B 1FIQA 4YXDB 1XLPA 4LTUA 3AE3B 1RFKA 4HRSA 2WDRB 2WU5B 4ZOHC 1ZOYB 3EUB2 1UWMA 2WU2B 3P4SB 1NYQA 1R7SA 2MJDA 1GTEA 3NS1A 1AYFA 3ETRA 1NEKB 2FBWB 1XLNA 1A70A 1JQ4A 2L83A 2PKOA 3LB8C 3SFEB 2W3RA 1N60A 2K5PA 4P6VF 2JQRB 4JWUC 3AEGB 1WRIA 4A9AA 1VDVA 1CJEA 1B9RA 1E0ZA 1N63A 2MH7A 1FO4A 3NVYA 1TKEA
chains in the Genus database with same CATH superfamily
1STEA 1WM3A 1XLOA 5HKHA 4WWMA 2KWCA 4KIKA 1K51A 1J8CA 3RMKC 2MBQA 1FFVA 2JRIB 2OJRA 2XK5A 2WXLA 4XDCA 4O1NA 4AJWA 2PE9A 2G9HD 1EUVB 4AP4C 5BYQA 4ZHOA 2G4DB 2K8BA 1E7PB 4K3BA 4B6WA 2KOXA 2BYTA 4L23A 1WZ0A 1D6EC 4LNIA 3W5UB 3ZTDA 4JQWC 4USAA 1P0RA 2G1EA 3SU8X 3EFCA 1DOYA 3MC9A 4BZAA 1VR9A 4LNKA 3N3KB 4FJZA 1LFDA 3WALA 2N7DA 3O65B 5IN7A 4N6EB 3U30A 2KC2A 3CIRB 3P42A 4YT0B 1ENFA 3R2TA 2D5GA 1EWYC 1ISNA 2CHZA 2XN9C 3PZ7A 1ET6A 2D3CA 3AEBB 2ZCBA 3DVNU 4M0WA 1GOZA 5DCNA 3WAOA 2MW5A 4HPPA 3ZLZA 3N32A 4DK5A 2L00B 2M4NA 3KUZA 4W9DA 1UZXB 4YSYB 4HPMB 4ANVA 3GZNB 4HROA 3PTFC 2R2QA 3DPDA 1HTQA 2JYTA 3ZO5B 1PGBA 2RSUA 1J7BA 3MP9A 1FRDA 2BYEA 1XLPA 3ZVVA 1RFKA 2NPTA 3VHTC 1JWSD 4HWIB 3R8BA 3BWUD 4LK0M 3JYUA 5D94A 3V62A 2FE8A 4A3PA 1NI2A 2LXCA 4P6VF 3U2SC 4A9AA 2BW2A 1WXVA 1LO5D 2BF8B 2N1VA 2QILA 4BBNC 3W1YA 2N4FA 3APDA 2CR5A 2LGDA 1TY2A 4ANUA 1QOGA 2JWZA 2J0KA 3IFWB 4I6PA 3L54A 1YQ3B 2BB5A 4FXCA 1FXIA 1H7XA 4TQ1A 1PDXA 1WXMA 1JMLA 2L05A 4MACA 4RF1A 1AWDA 2JPHA 1V81A 2CJNA 1V80A 2JZPA 5HG2A 1VZ8A 2INDC 2K8HA 1JRUA 3HK0A 3OAWA 4G0NB 4N59A 1UD7A 4LNFA 1WJNA 3ZRFA 4BAXA 4G3XB 3Q3MC 1OQRA 3MC0B 2JXTA 5HHDG 3CSFA 3EA6A 4NAWB 1WGKA 3V05A 2CU3A 1CZPA 3GP7A 1C4PA 3P4PB 3PT2B 3BVZA 2LVQA 2Y5PA 1RWSA 3HUIA 5E6NA 4PK1A 4TQ0A 2BT6A 3UF8A 4X57B 1SXTA 2LXAA 3CF4A 2DAJA 3DHHC 1DYQA 4GU2A 4B9KA 1WYWB 2KHWB 2KX0A 4ZYNA 1ET9A 2K22A 3C8YA 1WF9A 2LVPA 1SE3A 2K9XA 3R7RA 3A1QA 2WDVB 4DXAB 2D10A 2HE7A 4LNOA 2N7EA 4BFRA 3B0AA 4ZOHC 1ZOYB 2K0PA 2WU2B 1NYQA 1R7SA 2LUEA 2KDMA 1SSNA 3E9SA 3T9LA 3DCGA 2KTRB 5IO9A 3V6CB 4W9HA 3Q8AA 2PKOA 4WJQA 4KSLC 2W3RA 5L83A 1WRIA 1VDVA 3Q8FA 4RF0A 1BUIC 1Z5SB 3ML8A 2PMVA 5C1ZA 3ABVB 4ICVA 3ZNZB 2PVGC 3EC8A 4ZRIA 3WANA 3APFA 2OEDA 2I1KA 3H9DA 4IG7B 1OTRB 4ZRKA 2LD9A 4WWOA 1SIJA 3ENEA 1CK1A 1T0YA 1UF0A 3JW0X 3SDLC 1OQQA 2L0FA 1YJIA 1GNUA 4FBJB 2I1JA 3OLMD 3KH0A 2L7RA 3RN9C 2QHOA 4OZAA 3A9KA 3AMZA 2E3TA 3OJ3A 5AUKA 4NJ7A 1WJ6A 1WIAA 1WSPA 4WH4A 1IBXB 3I63C 3NUHB 1NBFC 1J19A 3L08A 2QCZA 2VZKB 4L2YA 2X8XX 3W2DA 2KT7A 2YEPF 3TEYA 2PLPA 3B2FA 3OWEB 2MQJA 4XYCA 1XO3A 4K7UA 3J9CA 2D3BA 4RGOS 1VJKA 1I4PA 3TMPB 4MT5A 2L52A 1V49A 2KDIA 2LMCA 2WDRB 2WU5B 3QAQA 1UWMA 3MJ5A 3ML9A 4LJPB 2WXJA 1HEZE 2J4XA 1A70A 2L83A 1UH6A 3RT3B 1E7VA 2WXQA 1TKEA 2RDHA 3K9PB 1VD2A 2N9LA 1ZE3D 2KLGA 1GAQB 2MWSB 2PTLA 2NTSA 1MG4A 2INPE 3M95A 4XDDA 2KKCA 4DBGA 2AEHA 2B76B 2C7NB 2DYMA 3NG0A 1Y56A 3DBHB 1GB4A 5IP4D 3N1ZC 2KNBA 1Q10A 1UGMA 2AQ3B 4GMVA 3HIZA 1E90A 5EE9A 5EE1A 5JXVA 2V4IB 4MM3A 2E6XA 2AL3A 3PRZA 2XNAC 3AE1B 4TV3A 2KWUB 4DHJD 3WCQA 1RRBA 3QJZA 4PS8A 4E74A 3IBEA 1M4VA 4DDID 1N5WA 1F77A 2J53A 3AM9A 3PHWB 1MVKA 1WGYA 1FXAA 3U7ZA 1L4DB 2HJ1A 4MGKE 1U4AA 4HVBA 4ZRJA 3APCA 3I3TB 3H7PB 2C60A 1QOBA 4Q2JA 2SEBD 5J18A 1QQRA 1ZKHA 4C4VB 2PW9A 4LLGM 4LTUA 2DYBA 4WJPA 4GSWA 3P4SB 1FXTB 2QMTA 1TY0A 3NS1A 3ETRA 3PPAA 1AYFA 1NEKB 3EGRA 4E71A 2V9HA 2LGYA 3M3JA 5CX3A 2BPSA 5D2MB 3ZNGC 1TZ1A 1B9RA 4BKGA 4XE0A 2FUG1 3Q69A 3DVGY 2KDFB 2LFIA 3TIXA 1QF6A 1TKYA 1WGDA 1ZP0B 1MHXA 2DYOA 2PVOD 2J52A 2AYOB 4KIKB 1XXGA 2ZCCA 4HJGE 1MPEA 2XK5B 2BGFA 3AEAB 3UGBB 2D3GA 1D5XC 3DBHI 3HM6X 3Q8EA 3EFUA 2KN4A 5C23A 3OJ4B 1R4MI 1PFDA 2QIEB 1WM2A 4R3DA 1WXQA 3N1YC 3ZDTA 2IGHA 2LHEA 2AQ2B 4FJYA 1SEBD 2KFJA 1VZ7A 3A9JA 2KANA 3IAM1 1JCKB 4IWPA 4F1SA 3Q3JA 3ZNID 2TSSA 3DHGC 4LCDE 3FC4A 3L10B 1JWMD 2W3SA 3HRDD 2PJHA 4A6QA 3DBSA 1E8ZA 3MFGA 1WE7A 2A4ZA 3R3MA 3ZNHB 1OEYJ 5BMIA 2C7HA 3IT4B 1F0ZA 3DWGC 1T0RC 2D3AA 3DBRB 3TL5A 4M0WB 2REXA 2B3AA 2NMQA 1YJJA 3VH3B 2W55A 2DAFA 5JZEB 2RGFA 2JY6A 3JVZX 1EM7A 3NJTA 3PRPB 4C7YA 4BOSC 2ZW1A 2KVRA 2KDBA 4L1BA 4CHKA 3LB8C 1MFWA 3JSVA 2NPTB 2K5PA 3H1UA 4HCPB 3NHEB 1E0ZA 4WAFA 4W9FA 1N63A 1I4XA 3RYTA 4I6LB 2MSED 4W9JA 4JX1C 3URYA 2M0AA 3QWZB 5AZHA 2KFKA 2K6DB 3KYDD 1FRRA 5DPRA 2MBBB 3A4RA 4ANXA 4DDGD 1NVID 4ZRQA 1XCTL 4GB9A 4P16A 1G6JA 1UBIA 4P1CC 1E6EB 5JH5C 1GPXA 1C4CA 1C77A 1V1PA 4P7IA 2KD0A 4TMAB 3TEWA 3L17A 4YL8A 3PLUA 2MBEA 1ZXIA 2WXKA 1K50A 1SJHD 1HA5A 4KDIC 4WURA 2NR2A 1WZ3A 4BBNF 3HVDA 4ITKA 2K25A 4YTPB 3U52E 3ZQ4A 1V6EA 4KZ0A 4BOZB 5HFYA 1YQ4B 4H2AA 3Q2AC 3AE9B 3VUXA 3AV8A 1KM7A 2ZVNA 4JIOU 5E6PA 1V1OA 4KZCA 2Z59B 2K8CA 1UBQA 4HKZE 3P1MA 3AE8B 2KQSA 1I7HA 1V8CA 3C19A 3RD2A 2O6VD 3DBRI 4JLCA 5AUIA 1E8YA 3DWMA 4JL9A 1HTOA 3IXSA 4ACFA 1L0YB 3RNBC 2PIAA 1EF5A 2GRIA 1N62A 1PYWD 2RR9A 2LRUA 2FAZA 5AEKB 4XGAB 2WX0A 3R7QA 1L0XB 3A1QB 2WXIA 3DDCB 1ZDVA 2O2VA 1YMHE 4GDKA 1H8CA 2CKHB 4RMAA 1FO4A 2L32A 1UNSA 2WHIA 4PS3A 1IP9A 3TEZA 3Q6BA 3PLVA 4BKSD 5DPTA 3IVFA 1YX6B 2IO1B 3I5JC 3AECB 3IAS1 1SIFA 1M94A 5G55A 2Y3AA 1NI3A 2GBNA 5EE3A 1Q0WB 2FNJB 2G3QB 3AE4B 4AWJA 1FD6A 4RFBA 5E6JA 3BZDB 1AW7A 2EKIA 2AQ1B 5BYSA 1FM0D 3HHMA 1TZOA 2YLMA 1SE2A 1F1HA 4KKIA 1FCCC 3AB5A 2N9PC 2W9NA 2GBMA 4IDIA 3KUDB 4XX5A 3A9KB 4HDQA 2D2QA 2ZNVB 3H7SA 1Q5WB 4LDTB 4MELA 2Z0EB 5DPWA 2MLBA 4YWGG 2MCNB 2ZJDA 3T3NA 3RNCC 2DZMA 1V9JA 1V2YA 2V3PA 3KVFB 2KN5A 2GOWA 5J17A 3T8MA 1DOIA 1D5MC 4HXDA 4M8NA 2XBBC 4E3CA 2IY1B 2RPQA 1GTHA 1L4ZB 2JYEA 4K81A 4KV2A 4HRSA 2GBKA 2IO3B 1MHHE 3KQ4A 4EZLA 4GOCA 4XZ4A 2BQQA 5JHAA 3RZWC 3UQBA 5BMHA 2PEAA 3GZNI 3NVYA 2OOBB 3AE5B 2H89B 1IYFA 3AH7A 3PS6A 3AEEB 3DOWA 3L4PA 3P4QB 4EFOA 3VRAB 1I4RA 2L0TA 1TYGB 2WXHA 1KRHA 3MHSD 5IAAC 2A5UA 2PPHA 3AE7B 4EE2A 3AU4A 2FCMA 3DVNV 3VDZA 4MH0E 2IGDA 3VXWA 1JW9D 1D4BA 1MJDA 1VZ6A 4S17A 1GC7A 1DGJA 1FEHA 3LJ3A 1H7WA 3ZJTA 4YTNB 3DHIC 3O13A 1J0GA 1WMHA 2KJHB 1L6UA 2LWPA 1C79A 4MM3B 2NS5A 2N7JA 4DWFA 3FAHA 4MSMB 3ZDMC 3AEDB 1L5PA 2V0GA 3N1XC 4NY0A 4J3OD 4KGRA 1WWTA 5H8YE 2L76A 3Q8BA 5AZFA 2WXMA 2WDQB 2DBYA 1NENB 3E56A 4C7ZA 2Q5WD 2ONQA 4IOIE 3TBLD 1T0SC 1F52A 4ZRPA 5GMVA 4JE3B 4G50A 1BMLC 5G2NA 5GXGB 4HJKA 4AUQC 1P1AA 4FJVB 4KX6B 2GI9A 2GBRA 4EEWA 5LNK1 1K53A 1T5XD 3NZSA 1JQ4A 4NZLB 3SFEB 3ZXRA 3MTNB 4K1RB 4BVUC 3HM3A 4MGYE 2GMIC 2IZVB 2JT4B 5E6OA 4NQKE 2BWES 5BMGA 2Y5BB 5AZGA 3NVZA 2MX2A 4OZCA 1C76A 2J0MA 2JRHA 2IO2B 1L0VB 3W1SC 1SBBB 2Z0DB 1FNVA 3SD5A 3V6EB 4B0EA 1FMAD 3T3OA 4ZYSA 3NZ3A 1TS3A 5FKAC 1UGJA 3Q3FA 1WRDB 1WGRA 2KMCA 3RFZB 1ACCA 3NVWA 1E8WA 4A90A 1ZUD2 3GB1A 1JWBD 1ESFA 1UUPA 4LNNA 1WY8A 1HZ6A 2J7QB 5LLIA 3Q14C 3A9JB 3H6NA 2M8SA 2WLBA 1LXDA 3V3XA 2I38A 5J2RA 2ZW0A 4KGTA 2Y5CA 2FCSA 4GDLA 1NYRA 2D11A 4MJSB 4S0RA 1S1QB 2LJ5A 2KMMA 3ZW3A 2DX5B 2NCNA 3RZFA 4OHJA 1CQVA 3NVVA 1WI0A 1ROEA 1HXYD 1AARA 2DLBA 1WE6A 1GG3A 4RH6A 4PYUA 4GN1A 2O6VA 1WXSA 1QZEA 2V3SA 3EUB2 5TSSA 2KXJA 1YQBA 1KLVA 1WXAA 4RGMA 3A33B 2EELA 1N60A 2MP2A 3PVLA 4WJOA 2G4SA 1L2NA 3VUYA 4HK2A 2BYFA 2KYWA 2BS4B 3JSVB 3WAPA 4RM9A 1TJEA 4EUTA 2BKFA 1I4HA 5I4DA 4W9IA 1WX9A 2LJIA 2MBOA 2ACZB 2KFKB 2WXGA 4MDKE 3P4RB 1GJZA 2JVCA 2K39A 4IM2A 4BKSA 1TS2A 2KJ6A 4JWSC 4M01A 4B95A 2IO0B 2JF5A 3VH4B 2YEPB 1I35A 1PQSA 2IGGA 1BXTA 1QOFA 1V1PB 2GB1A 4IKGA 4C80A 3ECIA 3RULA 1P9DU 2GLSA 3U4EG 4DXFA 5IOIA 3CF6E 2MRPA 2V4LA 4HLEA 3FKYA 4OW0A 2IJ0A 4DQOC 1ZXHA 1TS4A 1EU3A 1FFUA 4N58A 4ARIA 2UU7A 5MPOA 4DXGA 3NRZA 1C1YB 1UELA 4W9EA 2FCNA 2HD5B 3D32A 3PV1A 3NZUA 1VLBA 1EU4A 2I2YA 4ICUA 3CWIA 3W9CB 1QLBB 4RNAA 1QOAA 1SE9A 4URKA 1QKZA 4HKQA 1X1MA 3BIID 2EMTA 2XEWA 1J7CA 3EECA 3WAMA 4GGQA 4ANWA 4HEA1 4IC7B 4MJSA 2BYVE 4M8MA 2MJDA 3ONSA 2KQ7A 3Q8CA 4NNJB 3QARA 4I6NB 2WWZA 1PGAA 5CHFA 1N6ZA 2O2VB 4GDKB 4LDTD 3UQAA 4EZKA 4HPLB 4F8CB 4KKJA 2NVUI 2MJ3A 2L1AA 4WQMA 2DNFA 1MI0A 1FNUA 3UI3A 1YX5B 1C78A 1YD8U 1F2RC 1KLGD 2JSVX 3W5VB 1WYGA 3ZTCA 2FIDA 3U7DA 5KHQA 1YN3A 1RM6C 2DWQA 4W9LA 3QIJA 3R66C 2WYQA 2QDFA 1UWXA 1AN8A 5D7GA 1WX8A 2FUHB 4J6IA 2HTHA 2LGIA 2KWDA 3AN1A 4A3OA 4F7ZA 1GB1A 2BS3B 1KH0A 3K9OB 2QEJC 1EF1A 2CHXA 2IDYA 3FILB 4B0MA 4II3B 2INNE 2NBUA 1FNWA 3N20C 3IT6B 3LYYA 4XC2A 1NDDA 1FPYA 2H88B 1PGXA 3RUIB 1XLQA 3KUCB 3MJWA 2LGXA 1LQBA 1HE8A 1YNTE 2L8JA 5CTRC 4YSXB 2QC8A 2BTEA 3RCZA 3RNEC 1FIQA 2HJ8A 3RI7C 3AE3B 1C9FA 4A8XC 1XCQL 1R4NB 3NY5A 4TSSA 1WFYA 4XWWA 4W9CA 3VTUA 1YOVB 2CHWA 1P98A 2JQRB 3AEGB 1VCBA 4IWQA 1K52A 4IWOA 1V5OA 2V1YA 3V61A 4OVVA 4YSZB 2WXNA 2IBIB 5IKCM 4MGIE 4ZHPA 1A5RA 3KW5B 1KF6B 4HCNB 3BVMA 3AEFB 3PSEB 2BS2B 2WX1A 5D3IB 2KLCA 1Y8RC 2SAKA 5TR5A 5FK9C 2WXOA 3VTVA 2KZRA 1N61A 1JALA 3ALBA 1SB3C 3NOBA 2BKRB 2VZKD 2DHZA 3I57A 1V86A 2DZJA 1E5WA 3WIMA 2NBVB 3TUOA 1VRAB 3PRMB 1E7UA 3TJPA 3AE6B 4MH8A 3LDZE 1F2RI 2LVOA 4AOFA 3QHTA 4C00A 2EKEC 2NTTA 4OZBA 4PT5A 1WMHB 2JUOA 4IUMB 4GXBA 2ZNVC 2CU1A 3ZRCA 5D6JB 3X23A 1WX7A 5BYRA 4JGHB 2HTME 4AS1A 3QX1A 5FR3A 1SGHA 3PREA 1CMXB 1OGWA 1P3QU 2ZPNA 3FILA 2KC1A 1RFAA 4KDLB 1HZ5A 1Z2MA 2RD0A 2OHFA 3L0WB 1L6VA 4KSKC 1OEYA 2RPVA 2N9EB 1XT9B 4YXDB 3RNGC 1R4NI 5KHOA 3ZGZA 3I9V1 2FBWB 3CSTA 2JU6X 3UIOB 1IPGA 3SEBA 2WXPA 1TIFA 5LXHA 4UDUC 2K6QA 4M00A 4FADA 4FN2A 1SE4A 2FIFA 1T3QA 2AWTA 2KAJA 2R2OA 3R2IA 3P63A 3DVGX 2OJWA 4NPNA 1JWAD 4PS7A 4W9KA 2C7MB 1P7EA 3TCAA 2KACA 3PO0A 2WQYB 2WXFA 1OFFA 2YVCA 3ZJVA 3P2BA 3QQ8B 1D5ZC 1J7AA 3C0RB 1SF0A 1GUAB 2R61A 2DZIA 2N9KA 1KJTA 2K1FA 1Q1OA 2N0SB 4ASWC 2DENB 2KWVB 2MJEA 4FHJA 1C4AA 4JPSA 1LGRA 1TKGA 4NQLB 3M62B 3IHPC 4GDLB 4D2KA 4CQNA 2LZ6A 1PUTA 2ZEQA 4NJCA 5HI1A 1K8RB 3B2GA 2UYZB 3RPFC 1TT5B 3PZDA 4P1BC 1D3ZA 4AQ7A 3ZKJC 1XLNA 2O6VB 1SJED 4EOYA 1IGCA 4W9GA 3PZ8A 4EKUA 3MC8A 1CJEA 1JWUD 2NBWB 3AI5A 2MP2B 2KX3A 2LI5A 2KMAA 3M63B 5T8IA 4FLHA 1V5TA 3SFDB 2WP9B 3VR9B 3VQIA 3VR8B 4MEMA 4G11A 3GE3C 3TSSA 2JZZA 2BWFA 5BO4B 1S3SG 3SHQA 4KVGB 3DBLB 3KWVA 1TTNA 2KJRA 1EO6A 1QT9A 3B1LX 5EDSA 2QJLA 3Q3OC 1GC6A 2RDBC 1RLFA 4NAWA 5CHVC 4OVZA 4WJNA 4K7WA 2VH2A 5LXIB 1WH3A 4HDOA 3ZJUA 2LGSA 1JROA 4BKTA 3UIPB 2WDTB 3RNFC 5EE0A 5D3DA 5H92C 4K7SA 2WNMA 1T6BX 1KOTA 1E8XA 1YJ1A 4GLSC 1QILA 2Z8LA 1WJ4A 2W82A 1ZW7A 3RNAC 2BBCA 3OG5A 1ZPSA 2J42A 2LEKA 2ON8A 2ZVOA 2MHJA 2K3UA 3DQVA 4A20A 2MEKA 2BVCA 1WR1A 3VRBB 3UINB 3QA8A 3AU5A 3VAWA 3QCAA 3PGEA 1TS5A 2GBJA 2WGSA 2KTRA 2D07B 2INCC 3U8ZA 5G5GA 1HQRD 4NAMA 3GE8C 3S2AA 3WA0A 3MHZA 3CMMB 3KLSX 1GTEA 4PYZA 4WIPA 3N9YC 4JWUC 2C5LC 1OQYA 3VVWB 1YN4A 1JRPA 3B9JA 1H4RA 1FCLA 1R4MB 1WGGA 1RAXA 2LRWA 1IGDA 3V60A 2EMSA 4FHKA 5DPSA 3ZIMA 4CYEA 2JX5A 2IYDB 2JXXA 3H8HA 2AX5A 2ZPYA 1E10A 5C2TB 3DBLI 3SR6A 5G5HA 1DOXA 1ZGUB 3LXFA 4RGNA 2KVZA 2M19A 2WS3B 4ARCA 1TBEA 2L3ZA 3BY4B 4C56C 1KFYB 1YN5A 3ZYYX 4ZDVA 2QSDA 1T0QC 5IA7A 4WAAA 3Q3NC 1IBXA 3VTWA 3ZXVA 3ZUNA 4DHZE 4RM8A 3L13A 1YIWA 2W54A 2KTFA 2CJOA 2KK8A 2PE6B 2JWUA 4US9A 4TUUA 2J0JA 4MGZE 1WR6E 3BYYB 2ZZPB 2IY0B 1IUEA 1E9MA 3IG3A 1XD3B 4NJ6A 3BK2A 2RDGA 1EWCA 1BT0A 4US8A 3PHXB 2V3NA 3QC8B 4IW0A 4DHZB 4A55A 5FR6A 5L95C 1TGZB 2KO3A 2RMMA 4II2B 1MG8A 3NS8A 2MA9B 1I42A 1XEEA 2FCQA 4TKNA 3BINA 3X0WA 3AULA 4WQOB 2VH1A 3KWLA 4MSQB 1I4GA 3B08A 2VRRB 3BK1A 1XQQA 3BYTB 3GOEA 3W1SA 3BVGA 2UWQA 4K3CA 3TEXA 3GS2A 1KTKA 4FA6A 1V97A 4IM0A 4KGSA 2CS4A 4RGTA 1WJUA 4RCOA 2IPKD 4FULA 2LUMA 2M17A 2M0XA 5C3JB 1LM8B 2M56B 2KQ4X 4OVUA 3KYCD 1RYJA 1P7FA 1B1ZA 2KDEB 1ZDXA 3EHVA 2C9WB 3QK0A 2HDEA 3HVZA 1XF5L 4REZA 1I4QA 1WGHA 4CO7A 3AXCA 1L7YA 4M02A 2WXRA 3H7PA 1N5XA 5CHWA 4YTMB 2LHDA 2N9XA 2ICIA 4C4VA 4IM3A 2X38A 4AJYB 5JHBA 2ASQA 3N30A 4EZJA 1GT8A 4N9F4 3AE2B 4XWTA 4WWPA 4GIVA 2G45B 2JZ3B 2N1WA 1KLUD 3VFKA 3VUWA 2LASA 1C3TA 3L16A 4QAYA 2DZKA 2MBHA 2M1MA 4WWNA 4DHJB 4LJOB 1F9JA 2BB6A 2AL6A 3A4SC 2MH7A
chains in the Genus database with same CATH topology
1STEA 1XLOA 2LFIA 4WWMA 1QF6A 1TKYA 1SE4A 1K51A 5BMGA 1T3QA 1ZP0B 1FFVA 1MHXA 2KAJA 2DYOA 2WXLA 4XDCA 4O1NA 2PVOD 2J52A 3NVZA 2G9HD 3P63A 3R2IA 4OZCA 1C76A 1XXGA 5BYQA 1L0VB 4ZHOA 1SBBB 1JWAD 1E7PB 4HJGE 2BYTA 1FNVA 1MPEA 3AEAB 4L23A 1P7EA 4B0EA 1D6EC 1D5XC 2KACA 3PO0A 1FMAD 3T3OA 2WQYB 3NZ3A 3Q8EA 3W5UB 4ZYSA 2WXFA 1TS3A 5FKAC 1OFFA 1UGJA 2KN4A 4USAA 2G1EA 1PFDA 2QIEB 3ZJVA 3RFZB 1ACCA 3NVWA 1DOYA 1VR9A 4R3DA 1WXQA 4A90A 1ZUD2 2IGHA 3GB1A 1D5ZC 1JWBD 1ESFA 2AQ2B 2LHEA 1SEBD 1J7AA 1UUPA 1VZ7A 1SF0A 3IAM1 4N6EB 1JCKB 1HZ6A 2R61A 3CIRB 2TSSA 2N9KA 3P42A 4YT0B 1ENFA 3R2TA 2D5GA 3FC4A 1EWYC 2XN9C 1JWMD 2W3SA 3PZ7A 2WLBA 2N0SB 3HRDD 3V3XA 4A6QA 1ET6A 3AEBB 3MFGA 2I38A 4M0WA 1GOZA 2ZW0A 4KGTA 2Y5CA 1NYRA 5BMIA 2MJEA 3IT4B 1F0ZA 1C4AA 3DWGC 4YSYB 4JPSA 2KMMA 1TKGA 2NMQA 4GDLB 1YJJA 4HROA 4D2KA 4OHJA 4CQNA 1CQVA 3NVVA 1PUTA 2W55A 4NJCA 5HI1A 1ROEA 2JYTA 1HXYD 1PGBA 2DLBA 1EM7A 1J7BA 3B2GA 4RH6A 3MP9A 3RPFC 1FRDA 4C7YA 2ZW1A 1XLPA 1RFKA 3EUB2 4AQ7A 1JWSD 5TSSA 3R8BA 3BWUD 4L1BA 4RGMA 4LK0M 1XLNA 1SJED 2FE8A 3LB8C 2EELA 1N60A 1IGCA 2K5PA 4P6VF 3PZ8A 3U2SC 4A9AA 1CJEA 2BW2A 4WAFA 1E0ZA 1JWUD 1LO5D 1N63A 1I4XA 2QILA 2BS4B 3URYA 4JX1C 1TJEA 2M0AA 1I4HA 1TY2A 5I4DA 5T8IA 1QOGA 3SFDB 1FRRA 2WP9B 3VR9B 1YQ3B 2BB5A 4FXCA 3VQIA 3VR8B 2LJIA 1FXIA 1H7XA 1NVID 2ACZB 4TQ1A 1PDXA 4ZRQA 3TSSA 2WXGA 1XCTL 4P16A 1JMLA 4RF1A 4MACA 3P4RB 1AWDA 2CJNA 1E6EB 1GPXA 1C4CA 2JZPA 1TS2A 5HG2A 1C77A 4JWSC 1VZ8A 1V1PA 4TMAB 3KWVA 3TEWA 2YEPB 1QT9A 2IGGA 2QJLA 4N59A 1BXTA 1QOFA 1V1PB 2GB1A 4IKGA 4C80A 1ZXIA 2WXKA 1K50A 1SJHD 1HA5A 4OVZA 1OQRA 3MC0B 4WURA 3U4EG 2JXTA 4DXFA 3HVDA 5HHDG 4ITKA 3EA6A 4YTPB 3U52E 3ZJUA 3ZQ4A 1JROA 4NAWB 1WGKA 3V05A 2CU3A 1CZPA 3GP7A 1C4PA 5HFYA 3P4PB 1YQ4B 4H2AA 5EE0A 5D3DA 5H92C 3AE9B 3BVZA 4OW0A 2IJ0A 3AV8A 4DQOC 1ZXHA 2Y5PA 1TS4A 1EU3A 1T6BX 1FFUA 2WNMA 4N58A 4ARIA 5MPOA 1RWSA 1V1OA 4DXGA 3HUIA 4GLSC 3NRZA 1QILA 2Z8LA 4TQ0A 2W82A 2BT6A 2BBCA 4HKZE 3P1MA 3AE8B 1ZPSA 2J42A 1VLBA 1I7HA 1EU4A 1SXTA 1V8CA 2I2YA 2LEKA 2ON8A 3CF4A 5AUIA 1DYQA 3CWIA 3W9CB 2K3UA 3DWMA 1QLBB 4RNAA 1ET9A 2K22A 3IXSA 1QOAA 2MEKA 1L0YB 3C8YA 1QKZA 4HKQA 2PIAA 3VRBB 3BIID 1SE3A 1J7CA 2K9XA 2GRIA 1TS5A 1N62A 1PYWD 2WDVB 5G5GA 1HQRD 4NAMA 4HEA1 4ZOHC 3MHZA 1ZOYB 2K0PA 3KLSX 2WU2B 1L0XB 1NYQA 1R7SA 2KDMA 1SSNA 2MJDA 3E9SA 1GTEA 2WXIA 4WIPA 3Q8CA 3Q8AA 1ZDVA 2PKOA 2W3RA 1YMHE 3N9YC 4JWUC 1WRIA 1VDVA 3Q8FA 4RF0A 1BUIC 1FO4A 1PGAA 1YN4A 2PMVA 1JRPA 2L32A 1UNSA 3B9JA 3ABVB 4GDKB 3TEZA 1FCLA 2PVGC 3AECB 3IAS1 4KKJA 1IGDA 2MJ3A 1NI3A 2Y3AA 2L1AA 5EE3A 4WQMA 1MI0A 1FNUA 3UI3A 3AE4B 1FD6A 2JX5A 2OEDA 1C78A 3H8HA 4RFBA 5E6JA 1F2RC 2AX5A 1KLGD 2JSVX 3BZDB 1AW7A 1E10A 3W5VB 1WYGA 5C2TB 2EKIA 3SR6A 5G5HA 2AQ1B 5BYSA 1DOXA 1FM0D 1SIJA 1YN3A 3LXFA 1RM6C 2DWQA 1TZOA 1CK1A 2M19A 4RGNA 2WS3B 4ARCA 1SE2A 1UWXA 1OQQA 1YJIA 1AN8A 5D7GA 4KKIA 1FCCC 4C56C 1KFYB 1YN5A 4OZAA 3ZYYX 2QSDA 3AB5A 3AMZA 2E3TA 1IBXA 2LGIA 2KWDA 3AN1A 5AUKA 4IDIA 2W54A 1GB1A 2CJOA 2BS3B 1KH0A 1WSPA 2JWUA 2QEJC 4WH4A 1IBXB 3NUHB 2IDYA 3FILB 4B0MA 4US9A 2INNE 2VZKB 4L2YA 3BYYB 1FNWA 2YEPF 3W2DA 3TEYA 1IUEA 2PLPA 1E9MA 3IT6B 3LYYA 3B2FA 4YWGG 3OWEB 3BK2A 2RDGA 3T3NA 1EWCA 2H88B 1PGXA 2V3PA 1XO3A 1XLQA 3J9CA 4US8A 2V3NA 1YNTE 4RGOS 4YSXB 1DOIA 1D5MC 1VJKA 2BTEA 4A55A 1I4PA 4MT5A 1GTHA 1L4ZB 2L52A 2JYEA 1FIQA 2LMCA 3AE3B 1C9FA 4HRSA 4A8XC 2WDRB 2WU5B 1XCQL 1UWMA 3MJ5A 1MHHE 3KQ4A 2RMMA 4TSSA 2WXJA 4XWWA 1XEEA 1HEZE 2J4XA 1A70A 2L83A 2JQRB 5BMHA 3AEGB 3KWLA 1K52A 2WXQA 3NVYA 1TKEA 1I4GA 3AE5B 2RDHA 2H89B 3AH7A 4YSZB 2WXNA 2N9LA 3BK1A 1ZE3D 3BYTB 4ZHPA 3AEEB 1GAQB 3W1SA 1KF6B 2PTLA 3BVGA 3L4PA 2NTSA 2INPE 3BVMA 3AEFB 4XDDA 3TEXA 3P4QB 2BS2B 3GS2A 3VRAB 1I4RA 1KTKA 1V97A 1TYGB 2WXHA 4KGSA 1KRHA 5D3IB 2B76B 2DYMA 2SAKA 4RGTA 5FK9C 2WXOA 1Y56A 1GB4A 3AE7B 4RCOA 2IPKD 1N61A 1JALA 4EE2A 1Q10A 2LUMA 1SB3C 2IGDA 1JW9D 2AQ3B 1D4BA 5C3JB 1VZ6A 2VZKD 5EE9A 1DGJA 2M56B 1FEHA 2KQ4X 3I57A 5EE1A 5JXVA 2V4IB 3TUOA 1VRAB 2E6XA 2XNAC 3AE1B 1RYJA 1H7WA 3ZJTA 1P7FA 4YTNB 1B1ZA 3O13A 3AE6B 4MH8A 1L6UA 3WCQA 1C79A 4MM3B 1F2RI 2N7JA 3FAHA 1ZDXA 3AEDB 2NTTA 4OZBA 1L5PA 2V0GA 1M4VA 2HDEA 4PT5A 3HVZA 1XF5L 1N5WA 4J3OD 4KGRA 4REZA 1F77A 1I4QA 1WWTA 5H8YE 5BYRA 2J53A 3AM9A 1MVKA 3Q8BA 2WXMA 2HTME 4AS1A 2WDQB 1FXAA 1NENB 2DBYA 3E56A 3U7ZA 2WXRA 1L4DB 4C7ZA 2Q5WD 2ONQA 1N5XA 5FR3A 4YTMB 2LHDA 4IOIE 4ZRPA 2ICIA 4JE3B 3FILA 1BMLC 5GXGB 2X38A 1HZ5A 1QOBA 4Q2JA 2SEBD 2OHFA 1QQRA 1GT8A 1L6VA 2RPVA 4KX6B 2GI9A 3AE2B 2PW9A 4YXDB 4LLGM 4LTUA 4XWTA 5LNK1 3P4SB 2QMTA 1TY0A 3NS1A 3ZGZA 1AYFA 3EGRA 1NEKB 1K53A 2FBWB 1T5XD 3ETRA 3I9V1 1KLUD 1JQ4A 4NZLB 2JU6X 3SFEB 3SEBA 2WXPA 1B9RA 2BB6A 4XE0A 2MH7A 4UDUC 2FUG1 3Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE5 B;  2H89 B;  1JRP A;  3AH7 A;  4YSZ B;  2BS4 B;  3B9J A;  3ABV B;  1XLO A;  4JX1 C;  4WWM A;  1TJE A;  1QF6 A;  1TKY A;  4ZHP A;  3AEE B;  1GAQ B;  1T3Q A;  2PVG C;  1ZP0 B;  1KF6 B;  3AEC B;  1FFV A;  1QOG A;  3L4P A;  2KAJ A;  1NI3 A;  2MJ3 A;  3SFD B;  1FRR A;  2WP9 B;  3VR9 B;  1YQ3 B;  3AEF B;  2PVO D;  3NVZ A;  4WQM A;  4FXC A;  3P63 A;  5EE3 A;  3VR8 B;  2BS2 B;  3P4Q B;  1FXI A;  3AE4 B;  1H7X A;  1NVI D;  1L0V B;  2ACZ B;  3VRA B;  1PDX A;  2JX5 A;  4ZHO A;  1JWA D;  1E7P B;  1TYG B;  1V97 A;  1KRH A;  3P4R B;  3AEA B;  1AWD A;  2B76 B;  2AX5 A;  2CJN A;  1E6E B;  1GPX A;  3PO0 A;  1FMA D;  3W5V B;  1WYG A;  1E10 A;  5C2T B;  2WQY B;  3W5U B;  2EKI A;  4JWS C;  3SR6 A;  3AE7 B;  5G5H A;  1N61 A;  1JAL A;  1OFF A;  1DOX A;  4USA A;  1FM0 D;  1SIJ A;  3LXF A;  1SB3 C;  1QT9 A;  2G1E A;  1RM6 C;  2DWQ A;  1PFD A;  2QIE B;  2QJL A;  1JW9 D;  2M19 A;  4N59 A;  5C3J B;  2WS3 B;  1QOF A;  3NVW A;  5EE9 A;  1DGJ A;  2M56 B;  5EE1 A;  4C80 A;  1DOY A;  1OQQ A;  1WXQ A;  1YJI A;  1ZXI A;  1ZUD 2;  1OQR A;  1JWB D;  3KWL A;  1KFY B;  3AE1 B;  1H7W A;  1RYJ A;  4ITK A;  3ZYY X;  1J7A A;  4YTN B;  4C7Z A;  4YTP B;  3AB5 A;  3AMZ A;  1SF0 A;  2E3T A;  3AE6 B;  4N6E B;  1L6U A;  3WCQ A;  1JRO A;  1WGK A;  2CU3 A;  1CZP A;  3AN1 A;  5AUK A;  3FAH A;  3CIR B;  3P4P B;  1YQ4 B;  5EE0 A;  4YT0 B;  4IDI A;  3AED B;  2W54 A;  5H92 C;  3FC4 A;  3AE9 B;  1EWY C;  1L5P A;  2CJO A;  2BS3 B;  3AV8 A;  2W3S A;  2WLB A;  2N0S B;  3HRD D;  1FFU A;  3HVZ A;  4N58 A;  5MPO A;  1N5W A;  1RWS A;  3AEB B;  3HUI A;  3NRZ A;  4US9 A;  1WWT A;  5H8Y E;  2BT6 A;  3AM9 A;  2Y5C A;  3P1M A;  3AE8 B;  1IUE A;  1VLB A;  1NYR A;  1E9M A;  1I7H A;  1V8C A;  2WDQ B;  1FXA A;  1NEN B;  2DBY A;  2HTM E;  2LEK A;  2MJE A;  3B2F A;  3CF4 A;  2Q5W D;  3DWG C;  1F0Z A;  5AUI A;  1N5X A;  3CWI A;  4YSY B;  4YTM B;  3W9C B;  2KMM A;  1TKG A;  2H88 B;  3DWM A;  1QLB B;  2K22 A;  1XO3 A;  1QOA A;  1YJJ A;  4HRO A;  1XLQ A;  4US8 A;  3NVV A;  1PUT A;  2PIA A;  2W55 A;  3VRB B;  3BII D;  5GXG B;  4YSX B;  1DOI A;  1QOB A;  1VJK A;  1ROE A;  1J7C A;  2K9X A;  1J7B A;  1N62 A;  2OHF A;  2WDV B;  3B2G A;  1GT8 A;  1L6V A;  5G5G A;  1FRD A;  3RPF C;  1GTH A;  4KX6 B;  2L52 A;  4C7Y A;  3AE2 B;  1FIQ A;  4YXD B;  1XLP A;  4LTU A;  3AE3 B;  1RFK A;  4HRS A;  2WDR B;  2WU5 B;  4ZOH C;  1ZOY B;  3EUB 2;  1UWM A;  2WU2 B;  3P4S B;  1NYQ A;  1R7S A;  2MJD A;  1GTE A;  3NS1 A;  1AYF A;  3ETR A;  1NEK B;  2FBW B;  1XLN A;  1A70 A;  1JQ4 A;  2L83 A;  2PKO A;  3LB8 C;  3SFE B;  2W3R A;  1N60 A;  2K5P A;  4P6V F;  2JQR B;  4JWU C;  3AEG B;  1WRI A;  4A9A A;  1VDV A;  1CJE A;  1B9R A;  1E0Z A;  1N63 A;  2MH7 A;  1FO4 A;  3NVY A;  1TKE A; 
#chains in the Genus database with same CATH topology
 1STE A;  1WM3 A;  1XLO A;  5HKH A;  4WWM A;  2KWC A;  4KIK A;  1K51 A;  1J8C A;  3RMK C;  2MBQ A;  1FFV A;  2JRI B;  2OJR A;  2XK5 A;  2WXL A;  4XDC A;  4O1N A;  4AJW A;  2PE9 A;  2G9H D;  1EUV B;  4AP4 C;  5BYQ A;  4ZHO A;  2G4D B;  2K8B A;  1E7P B;  4K3B A;  4B6W A;  2KOX A;  2BYT A;  4L23 A;  1WZ0 A;  1D6E C;  4LNI A;  3W5U B;  3ZTD A;  4JQW C;  4USA A;  1P0R A;  2G1E A;  3SU8 X;  3EFC A;  1DOY A;  3MC9 A;  4BZA A;  1VR9 A;  4LNK A;  3N3K B;  4FJZ A;  1LFD A;  3WAL A;  2N7D A;  3O65 B;  5IN7 A;  4N6E B;  3U30 A;  2KC2 A;  3CIR B;  3P42 A;  4YT0 B;  1ENF A;  3R2T A;  2D5G A;  1EWY C;  1ISN A;  2CHZ A;  2XN9 C;  3PZ7 A;  1ET6 A;  2D3C A;  3AEB B;  2ZCB A;  3DVN U;  4M0W A;  1GOZ A;  5DCN A;  3WAO A;  2MW5 A;  4HPP A;  3ZLZ A;  3N32 A;  4DK5 A;  2L00 B;  2M4N A;  3KUZ A;  4W9D A;  1UZX B;  4YSY B;  4HPM B;  4ANV A;  3GZN B;  4HRO A;  3PTF C;  2R2Q A;  3DPD A;  1HTQ A;  2JYT A;  3ZO5 B;  1PGB A;  2RSU A;  1J7B A;  3MP9 A;  1FRD A;  2BYE A;  1XLP A;  3ZVV A;  1RFK A;  2NPT A;  3VHT C;  1JWS D;  4HWI B;  3R8B A;  3BWU D;  4LK0 M;  3JYU A;  5D94 A;  3V62 A;  2FE8 A;  4A3P A;  1NI2 A;  2LXC A;  4P6V F;  3U2S C;  4A9A A;  2BW2 A;  1WXV A;  1LO5 D;  2BF8 B;  2N1V A;  2QIL A;  4BBN C;  3W1Y A;  2N4F A;  3APD A;  2CR5 A;  2LGD A;  1TY2 A;  4ANU A;  1QOG A;  2JWZ A;  2J0K A;  3IFW B;  4I6P A;  3L54 A;  1YQ3 B;  2BB5 A;  4FXC A;  1FXI A;  1H7X A;  4TQ1 A;  1PDX A;  1WXM A;  1JML A;  2L05 A;  4MAC A;  4RF1 A;  1AWD A;  2JPH A;  1V81 A;  2CJN A;  1V80 A;  2JZP A;  5HG2 A;  1VZ8 A;  2IND C;  2K8H A;  1JRU A;  3HK0 A;  3OAW A;  4G0N B;  4N59 A;  1UD7 A;  4LNF A;  1WJN A;  3ZRF A;  4BAX A;  4G3X B;  3Q3M C;  1OQR A;  3MC0 B;  2JXT A;  5HHD G;  3CSF A;  3EA6 A;  4NAW B;  1WGK A;  3V05 A;  2CU3 A;  1CZP A;  3GP7 A;  1C4P A;  3P4P B;  3PT2 B;  3BVZ A;  2LVQ A;  2Y5P A;  1RWS A;  3HUI A;  5E6N A;  4PK1 A;  4TQ0 A;  2BT6 A;  3UF8 A;  4X57 B;  1SXT A;  2LXA A;  3CF4 A;  2DAJ A;  3DHH C;  1DYQ A;  4GU2 A;  4B9K A;  1WYW B;  2KHW B;  2KX0 A;  4ZYN A;  1ET9 A;  2K22 A;  3C8Y A;  1WF9 A;  2LVP A;  1SE3 A;  2K9X A;  3R7R A;  3A1Q A;  2WDV B;  4DXA B;  2D10 A;  2HE7 A;  4LNO A;  2N7E A;  4BFR A;  3B0A A;  4ZOH C;  1ZOY B;  2K0P A;  2WU2 B;  1NYQ A;  1R7S A;  2LUE A;  2KDM A;  1SSN A;  3E9S A;  3T9L A;  3DCG A;  2KTR B;  5IO9 A;  3V6C B;  4W9H A;  3Q8A A;  2PKO A;  4WJQ A;  4KSL C;  2W3R A;  5L83 A;  1WRI A;  1VDV A;  3Q8F A;  4RF0 A;  1BUI C;  1Z5S B;  3ML8 A;  2PMV A;  5C1Z A;  3ABV B;  4ICV A;  3ZNZ B;  2PVG C;  3EC8 A;  4ZRI A;  3WAN A;  3APF A;  2OED A;  2I1K A;  3H9D A;  4IG7 B;  1OTR B;  4ZRK A;  2LD9 A;  4WWO A;  1SIJ A;  3ENE A;  1CK1 A;  1T0Y A;  1UF0 A;  3JW0 X;  3SDL C;  1OQQ A;  2L0F A;  1YJI A;  1GNU A;  4FBJ B;  2I1J A;  3OLM D;  3KH0 A;  2L7R A;  3RN9 C;  2QHO A;  4OZA A;  3A9K A;  3AMZ A;  2E3T A;  3OJ3 A;  5AUK A;  4NJ7 A;  1WJ6 A;  1WIA A;  1WSP A;  4WH4 A;  1IBX B;  3I63 C;  3NUH B;  1NBF C;  1J19 A;  3L08 A;  2QCZ A;  2VZK B;  4L2Y A;  2X8X X;  3W2D A;  2KT7 A;  2YEP F;  3TEY A;  2PLP A;  3B2F A;  3OWE B;  2MQJ A;  4XYC A;  1XO3 A;  4K7U A;  3J9C A;  2D3B A;  4RGO S;  1VJK A;  1I4P A;  3TMP B;  4MT5 A;  2L52 A;  1V49 A;  2KDI A;  2LMC A;  2WDR B;  2WU5 B;  3QAQ A;  1UWM A;  3MJ5 A;  3ML9 A;  4LJP B;  2WXJ A;  1HEZ E;  2J4X A;  1A70 A;  2L83 A;  1UH6 A;  3RT3 B;  1E7V A;  2WXQ A;  1TKE A;  2RDH A;  3K9P B;  1VD2 A;  2N9L A;  1ZE3 D;  2KLG A;  1GAQ B;  2MWS B;  2PTL A;  2NTS A;  1MG4 A;  2INP E;  3M95 A;  4XDD A;  2KKC A;  4DBG A;  2AEH A;  2B76 B;  2C7N B;  2DYM A;  3NG0 A;  1Y56 A;  3DBH B;  1GB4 A;  5IP4 D;  3N1Z C;  2KNB A;  1Q10 A;  1UGM A;  2AQ3 B;  4GMV A;  3HIZ A;  1E90 A;  5EE9 A;  5EE1 A;  5JXV A;  2V4I B;  4MM3 A;  2E6X A;  2AL3 A;  3PRZ A;  2XNA C;  3AE1 B;  4TV3 A;  2KWU B;  4DHJ D;  3WCQ A;  1RRB A;  3QJZ A;  4PS8 A;  4E74 A;  3IBE A;  1M4V A;  4DDI D;  1N5W A;  1F77 A;  2J53 A;  3AM9 A;  3PHW B;  1MVK A;  1WGY A;  1FXA A;  3U7Z A;  1L4D B;  2HJ1 A;  4MGK E;  1U4A A;  4HVB A;  4ZRJ A;  3APC A;  3I3T B;  3H7P B;  2C60 A;  1QOB A;  4Q2J A;  2SEB D;  5J18 A;  1QQR A;  1ZKH A;  4C4V B;  2PW9 A;  4LLG M;  4LTU A;  2DYB A;  4WJP A;  4GSW A;  3P4S B;  1FXT B;  2QMT A;  1TY0 A;  3NS1 A;  3ETR A;  3PPA A;  1AYF A;  1NEK B;  3EGR A;  4E71 A;  2V9H A;  2LGY A;  3M3J A;  5CX3 A;  2BPS A;  5D2M B;  3ZNG C;  1TZ1 A;  1B9R A;  4BKG A;  4XE0 A;  2FUG 1;  3Q69 A;  3DVG Y;  2KDF B;  2LFI A;  3TIX A;  1QF6 A;  1TKY A;  1WGD A;  1ZP0 B;  1MHX A;  2DYO A;  2PVO D;  2J52 A;  2AYO B;  4KIK B;  1XXG A;  2ZCC A;  4HJG E;  1MPE A;  2XK5 B;  2BGF A;  3AEA B;  3UGB B;  2D3G A;  1D5X C;  3DBH I;  3HM6 X;  3Q8E A;  3EFU A;  2KN4 A;  5C23 A;  3OJ4 B;  1R4M I;  1PFD A;  2QIE B;  1WM2 A;  4R3D A;  1WXQ A;  3N1Y C;  3ZDT A;  2IGH A;  2LHE A;  2AQ2 B;  4FJY A;  1SEB D;  2KFJ A;  1VZ7 A;  3A9J A;  2KAN A;  3IAM 1;  1JCK B;  4IWP A;  4F1S A;  3Q3J A;  3ZNI D;  2TSS A;  3DHG C;  4LCD E;  3FC4 A;  3L10 B;  1JWM D;  2W3S A;  3HRD D;  2PJH A;  4A6Q A;  3DBS A;  1E8Z A;  3MFG A;  1WE7 A;  2A4Z A;  3R3M A;  3ZNH B;  1OEY J;  5BMI A;  2C7H A;  3IT4 B;  1F0Z A;  3DWG C;  1T0R C;  2D3A A;  3DBR B;  3TL5 A;  4M0W B;  2REX A;  2B3A A;  2NMQ A;  1YJJ A;  3VH3 B;  2W55 A;  2DAF A;  5JZE B;  2RGF A;  2JY6 A;  3JVZ X;  1EM7 A;  3NJT A;  3PRP B;  4C7Y A;  4BOS C;  2ZW1 A;  2KVR A;  2KDB A;  4L1B A;  4CHK A;  3LB8 C;  1MFW A;  3JSV A;  2NPT B;  2K5P A;  3H1U A;  4HCP B;  3NHE B;  1E0Z A;  4WAF A;  4W9F A;  1N63 A;  1I4X A;  3RYT A;  4I6L B;  2MSE D;  4W9J A;  4JX1 C;  3URY A;  2M0A A;  3QWZ B;  5AZH A;  2KFK A;  2K6D B;  3KYD D;  1FRR A;  5DPR A;  2MBB B;  3A4R A;  4ANX A;  4DDG D;  1NVI D;  4ZRQ A;  1XCT L;  4GB9 A;  4P16 A;  1G6J A;  1UBI A;  4P1C C;  1E6E B;  5JH5 C;  1GPX A;  1C4C A;  1C77 A;  1V1P A;  4P7I A;  2KD0 A;  4TMA B;  3TEW A;  3L17 A;  4YL8 A;  3PLU A;  2MBE A;  1ZXI A;  2WXK A;  1K50 A;  1SJH D;  1HA5 A;  4KDI C;  4WUR A;  2NR2 A;  1WZ3 A;  4BBN F;  3HVD A;  4ITK A;  2K25 A;  4YTP B;  3U52 E;  3ZQ4 A;  1V6E A;  4KZ0 A;  4BOZ B;  5HFY A;  1YQ4 B;  4H2A A;  3Q2A C;  3AE9 B;  3VUX A;  3AV8 A;  1KM7 A;  2ZVN A;  4JIO U;  5E6P A;  1V1O A;  4KZC A;  2Z59 B;  2K8C A;  1UBQ A;  4HKZ E;  3P1M A;  3AE8 B;  2KQS A;  1I7H A;  1V8C A;  3C19 A;  3RD2 A;  2O6V D;  3DBR I;  4JLC A;  5AUI A;  1E8Y A;  3DWM A;  4JL9 A;  1HTO A;  3IXS A;  4ACF A;  1L0Y B;  3RNB C;  2PIA A;  1EF5 A;  2GRI A;  1N62 A;  1PYW D;  2RR9 A;  2LRU A;  2FAZ A;  5AEK B;  4XGA B;  2WX0 A;  3R7Q A;  1L0X B;  3A1Q B;  2WXI A;  3DDC B;  1ZDV A;  2O2V A;  1YMH E;  4GDK A;  1H8C A;  2CKH B;  4RMA A;  1FO4 A;  2L32 A;  1UNS A;  2WHI A;  4PS3 A;  1IP9 A;  3TEZ A;  3Q6B A;  3PLV A;  4BKS D;  5DPT A;  3IVF A;  1YX6 B;  2IO1 B;  3I5J C;  3AEC B;  3IAS 1;  1SIF A;  1M94 A;  5G55 A;  2Y3A A;  1NI3 A;  2GBN A;  5EE3 A;  1Q0W B;  2FNJ B;  2G3Q B;  3AE4 B;  4AWJ A;  1FD6 A;  4RFB A;  5E6J A;  3BZD B;  1AW7 A;  2EKI A;  2AQ1 B;  5BYS A;  1FM0 D;  3HHM A;  1TZO A;  2YLM A;  1SE2 A;  1F1H A;  4KKI A;  1FCC C;  3AB5 A;  2N9P C;  2W9N A;  2GBM A;  4IDI A;  3KUD B;  4XX5 A;  3A9K B;  4HDQ A;  2D2Q A;  2ZNV B;  3H7S A;  1Q5W B;  4LDT B;  4MEL A;  2Z0E B;  5DPW A;  2MLB A;  4YWG G;  2MCN B;  2ZJD A;  3T3N A;  3RNC C;  2DZM A;  1V9J A;  1V2Y A;  2V3P A;  3KVF B;  2KN5 A;  2GOW A;  5J17 A;  3T8M A;  1DOI A;  1D5M C;  4HXD A;  4M8N A;  2XBB C;  4E3C A;  2IY1 B;  2RPQ A;  1GTH A;  1L4Z B;  2JYE A;  4K81 A;  4KV2 A;  4HRS A;  2GBK A;  2IO3 B;  1MHH E;  3KQ4 A;  4EZL A;  4GOC A;  4XZ4 A;  2BQQ A;  5JHA A;  3RZW C;  3UQB A;  5BMH A;  2PEA A;  3GZN I;  3NVY A;  2OOB B;  3AE5 B;  2H89 B;  1IYF A;  3AH7 A;  3PS6 A;  3AEE B;  3DOW A;  3L4P A;  3P4Q B;  4EFO A;  3VRA B;  1I4R A;  2L0T A;  1TYG B;  2WXH A;  1KRH A;  3MHS D;  5IAA C;  2A5U A;  2PPH A;  3AE7 B;  4EE2 A;  3AU4 A;  2FCM A;  3DVN V;  3VDZ A;  4MH0 E;  2IGD A;  3VXW A;  1JW9 D;  1D4B A;  1MJD A;  1VZ6 A;  4S17 A;  1GC7 A;  1DGJ A;  1FEH A;  3LJ3 A;  1H7W A;  3ZJT A;  4YTN B;  3DHI C;  3O13 A;  1J0G A;  1WMH A;  2KJH B;  1L6U A;  2LWP A;  1C79 A;  4MM3 B;  2NS5 A;  2N7J A;  4DWF A;  3FAH A;  4MSM B;  3ZDM C;  3AED B;  1L5P A;  2V0G A;  3N1X C;  4NY0 A;  4J3O D;  4KGR A;  1WWT A;  5H8Y E;  2L76 A;  3Q8B A;  5AZF A;  2WXM A;  2WDQ B;  2DBY A;  1NEN B;  3E56 A;  4C7Z A;  2Q5W D;  2ONQ A;  4IOI E;  3TBL D;  1T0S C;  1F52 A;  4ZRP A;  5GMV A;  4JE3 B;  4G50 A;  1BML C;  5G2N A;  5GXG B;  4HJK A;  4AUQ C;  1P1A A;  4FJV B;  4KX6 B;  2GI9 A;  2GBR A;  4EEW A;  5LNK 1;  1K53 A;  1T5X D;  3NZS A;  1JQ4 A;  4NZL B;  3SFE B;  3ZXR A;  3MTN B;  4K1R B;  4BVU C;  3HM3 A;  4MGY E;  2GMI C;  2IZV B;  2JT4 B;  5E6O A;  4NQK E;  2BWE S;  5BMG A;  2Y5B B;  5AZG A;  3NVZ A;  2MX2 A;  4OZC A;  1C76 A;  2J0M A;  2JRH A;  2IO2 B;  1L0V B;  3W1S C;  1SBB B;  2Z0D B;  1FNV A;  3SD5 A;  3V6E B;  4B0E A;  1FMA D;  3T3O A;  4ZYS A;  3NZ3 A;  1TS3 A;  5FKA C;  1UGJ A;  3Q3F A;  1WRD B;  1WGR A;  2KMC A;  3RFZ B;  1ACC A;  3NVW A;  1E8W A;  4A90 A;  1ZUD 2;  3GB1 A;  1JWB D;  1ESF A;  1UUP A;  4LNN A;  1WY8 A;  1HZ6 A;  2J7Q B;  5LLI A;  3Q14 C;  3A9J B;  3H6N A;  2M8S A;  2WLB A;  1LXD A;  3V3X A;  2I38 A;  5J2R A;  2ZW0 A;  4KGT A;  2Y5C A;  2FCS A;  4GDL A;  1NYR A;  2D11 A;  4MJS B;  4S0R A;  1S1Q B;  2LJ5 A;  2KMM A;  3ZW3 A;  2DX5 B;  2NCN A;  3RZF A;  4OHJ A;  1CQV A;  3NVV A;  1WI0 A;  1ROE A;  1HXY D;  1AAR A;  2DLB A;  1WE6 A;  1GG3 A;  4RH6 A;  4PYU A;  4GN1 A;  2O6V A;  1WXS A;  1QZE A;  2V3S A;  3EUB 2;  5TSS A;  2KXJ A;  1YQB A;  1KLV A;  1WXA A;  4RGM A;  3A33 B;  2EEL A;  1N60 A;  2MP2 A;  3PVL A;  4WJO A;  2G4S A;  1L2N A;  3VUY A;  4HK2 A;  2BYF A;  2KYW A;  2BS4 B;  3JSV B;  3WAP A;  4RM9 A;  1TJE A;  4EUT A;  2BKF A;  1I4H A;  5I4D A;  4W9I A;  1WX9 A;  2LJI A;  2MBO A;  2ACZ B;  2KFK B;  2WXG A;  4MDK E;  3P4R B;  1GJZ A;  2JVC A;  2K39 A;  4IM2 A;  4BKS A;  1TS2 A;  2KJ6 A;  4JWS C;  4M01 A;  4B95 A;  2IO0 B;  2JF5 A;  3VH4 B;  2YEP B;  1I35 A;  1PQS A;  2IGG A;  1BXT A;  1QOF A;  1V1P B;  2GB1 A;  4IKG A;  4C80 A;  3ECI A;  3RUL A;  1P9D U;  2GLS A;  3U4E G;  4DXF A;  5IOI A;  3CF6 E;  2MRP A;  2V4L A;  4HLE A;  3FKY A;  4OW0 A;  2IJ0 A;  4DQO C;  1ZXH A;  1TS4 A;  1EU3 A;  1FFU A;  4N58 A;  4ARI A;  2UU7 A;  5MPO A;  4DXG A;  3NRZ A;  1C1Y B;  1UEL A;  4W9E A;  2FCN A;  2HD5 B;  3D32 A;  3PV1 A;  3NZU A;  1VLB A;  1EU4 A;  2I2Y A;  4ICU A;  3CWI A;  3W9C B;  1QLB B;  4RNA A;  1QOA A;  1SE9 A;  4URK A;  1QKZ A;  4HKQ A;  1X1M A;  3BII D;  2EMT A;  2XEW A;  1J7C A;  3EEC A;  3WAM A;  4GGQ A;  4ANW A;  4HEA 1;  4IC7 B;  4MJS A;  2BYV E;  4M8M A;  2MJD A;  3ONS A;  2KQ7 A;  3Q8C A;  4NNJ B;  3QAR A;  4I6N B;  2WWZ A;  1PGA A;  5CHF A;  1N6Z A;  2O2V B;  4GDK B;  4LDT D;  3UQA A;  4EZK A;  4HPL B;  4F8C B;  4KKJ A;  2NVU I;  2MJ3 A;  2L1A A;  4WQM A;  2DNF A;  1MI0 A;  1FNU A;  3UI3 A;  1YX5 B;  1C78 A;  1YD8 U;  1F2R C;  1KLG D;  2JSV X;  3W5V B;  1WYG A;  3ZTC A;  2FID A;  3U7D A;  5KHQ A;  1YN3 A;  1RM6 C;  2DWQ A;  4W9L A;  3QIJ A;  3R66 C;  2WYQ A;  2QDF A;  1UWX A;  1AN8 A;  5D7G A;  1WX8 A;  2FUH B;  4J6I A;  2HTH A;  2LGI A;  2KWD A;  3AN1 A;  4A3O A;  4F7Z A;  1GB1 A;  2BS3 B;  1KH0 A;  3K9O B;  2QEJ C;  1EF1 A;  2CHX A;  2IDY A;  3FIL B;  4B0M A;  4II3 B;  2INN E;  2NBU A;  1FNW A;  3N20 C;  3IT6 B;  3LYY A;  4XC2 A;  1NDD A;  1FPY A;  2H88 B;  1PGX A;  3RUI B;  1XLQ A;  3KUC B;  3MJW A;  2LGX A;  1LQB A;  1HE8 A;  1YNT E;  2L8J A;  5CTR C;  4YSX B;  2QC8 A;  2BTE A;  3RCZ A;  3RNE C;  1FIQ A;  2HJ8 A;  3RI7 C;  3AE3 B;  1C9F A;  4A8X C;  1XCQ L;  1R4N B;  3NY5 A;  4TSS A;  1WFY A;  4XWW A;  4W9C A;  3VTU A;  1YOV B;  2CHW A;  1P98 A;  2JQR B;  3AEG B;  1VCB A;  4IWQ A;  1K52 A;  4IWO A;  1V5O A;  2V1Y A;  3V61 A;  4OVV A;  4YSZ B;  2WXN A;  2IBI B;  5IKC M;  4MGI E;  4ZHP A;  1A5R A;  3KW5 B;  1KF6 B;  4HCN B;  3BVM A;  3AEF B;  3PSE B;  2BS2 B;  2WX1 A;  5D3I B;  2KLC A;  1Y8R C;  2SAK A;  5TR5 A;  5FK9 C;  2WXO A;  3VTV A;  2KZR A;  1N61 A;  1JAL A;  3ALB A;  1SB3 C;  3NOB A;  2BKR B;  2VZK D;  2DHZ A;  3I57 A;  1V86 A;  2DZJ A;  1E5W A;  3WIM A;  2NBV B;  3TUO A;  1VRA B;  3PRM B;  1E7U A;  3TJP A;  3AE6 B;  4MH8 A;  3LDZ E;  1F2R I;  2LVO A;  4AOF A;  3QHT A;  4C00 A;  2EKE C;  2NTT A;  4OZB A;  4PT5 A;  1WMH B;  2JUO A;  4IUM B;  4GXB A;  2ZNV C;  2CU1 A;  3ZRC A;  5D6J B;  3X23 A;  1WX7 A;  5BYR A;  4JGH B;  2HTM E;  4AS1 A;  3QX1 A;  5FR3 A;  1SGH A;  3PRE A;  1CMX B;  1OGW A;  1P3Q U;  2ZPN A;  3FIL A;  2KC1 A;  1RFA A;  4KDL B;  1HZ5 A;  1Z2M A;  2RD0 A;  2OHF A;  3L0W B;  1L6V A;  4KSK C;  1OEY A;  2RPV A;  2N9E B;  1XT9 B;  4YXD B;  3RNG C;  1R4N I;  5KHO A;  3ZGZ A;  3I9V 1;  2FBW B;  3CST A;  2JU6 X;  3UIO B;  1IPG A;  3SEB A;  2WXP A;  1TIF A;  5LXH A;  4UDU C;  2K6Q A;  4M00 A;  4FAD A;  4FN2 A;  1SE4 A;  2FIF A;  1T3Q A;  2AWT A;  2KAJ A;  2R2O A;  3R2I A;  3P63 A;  3DVG X;  2OJW A;  4NPN A;  1JWA D;  4PS7 A;  4W9K A;  2C7M B;  1P7E A;  3TCA A;  2KAC A;  3PO0 A;  2WQY B;  2WXF A;  1OFF A;  2YVC A;  3ZJV A;  3P2B A;  3QQ8 B;  1D5Z C;  1J7A A;  3C0R B;  1SF0 A;  1GUA B;  2R61 A;  2DZI A;  2N9K A;  1KJT A;  2K1F A;  1Q1O A;  2N0S B;  4ASW C;  2DEN B;  2KWV B;  2MJE A;  4FHJ A;  1C4A A;  4JPS A;  1LGR A;  1TKG A;  4NQL B;  3M62 B;  3IHP C;  4GDL B;  4D2K A;  4CQN A;  2LZ6 A;  1PUT A;  2ZEQ A;  4NJC A;  5HI1 A;  1K8R B;  3B2G A;  2UYZ B;  3RPF C;  1TT5 B;  3PZD A;  4P1B C;  1D3Z A;  4AQ7 A;  3ZKJ C;  1XLN A;  2O6V B;  1SJE D;  4EOY A;  1IGC A;  4W9G A;  3PZ8 A;  4EKU A;  3MC8 A;  1CJE A;  1JWU D;  2NBW B;  3AI5 A;  2MP2 B;  2KX3 A;  2LI5 A;  2KMA A;  3M63 B;  5T8I A;  4FLH A;  1V5T A;  3SFD B;  2WP9 B;  3VR9 B;  3VQI A;  3VR8 B;  4MEM A;  4G11 A;  3GE3 C;  3TSS A;  2JZZ A;  2BWF A;  5BO4 B;  1S3S G;  3SHQ A;  4KVG B;  3DBL B;  3KWV A;  1TTN A;  2KJR A;  1EO6 A;  1QT9 A;  3B1L X;  5EDS A;  2QJL A;  3Q3O C;  1GC6 A;  2RDB C;  1RLF A;  4NAW A;  5CHV C;  4OVZ A;  4WJN A;  4K7W A;  2VH2 A;  5LXI B;  1WH3 A;  4HDO A;  3ZJU A;  2LGS A;  1JRO A;  4BKT A;  3UIP B;  2WDT B;  3RNF C;  5EE0 A;  5D3D A;  5H92 C;  4K7S A;  2WNM A;  1T6B X;  1KOT A;  1E8X A;  1YJ1 A;  4GLS C;  1QIL A;  2Z8L A;  1WJ4 A;  2W82 A;  1ZW7 A;  3RNA C;  2BBC A;  3OG5 A;  1ZPS A;  2J42 A;  2LEK A;  2ON8 A;  2ZVO A;  2MHJ A;  2K3U A;  3DQV A;  4A20 A;  2MEK A;  2BVC A;  1WR1 A;  3VRB B;  3UIN B;  3QA8 A;  3AU5 A;  3VAW A;  3QCA A;  3PGE A;  1TS5 A;  2GBJ A;  2WGS A;  2KTR A;  2D07 B;  2INC C;  3U8Z A;  5G5G A;  1HQR D;  4NAM A;  3GE8 C;  3S2A A;  3WA0 A;  3MHZ A;  3CMM B;  3KLS X;  1GTE A;  4PYZ A;  4WIP A;  3N9Y C;  4JWU C;  2C5L C;  1OQY A;  3VVW B;  1YN4 A;  1JRP A;  3B9J A;  1H4R A;  1FCL A;  1R4M B;  1WGG A;  1RAX A;  2LRW A;  1IGD A;  3V60 A;  2EMS A;  4FHK A;  5DPS A;  3ZIM A;  4CYE A;  2JX5 A;  2IYD B;  2JXX A;  3H8H A;  2AX5 A;  2ZPY A;  1E10 A;  5C2T B;  3DBL I;  3SR6 A;  5G5H A;  1DOX A;  1ZGU B;  3LXF A;  4RGN A;  2KVZ A;  2M19 A;  2WS3 B;  4ARC A;  1TBE A;  2L3Z A;  3BY4 B;  4C56 C;  1KFY B;  1YN5 A;  3ZYY X;  4ZDV A;  2QSD A;  1T0Q C;  5IA7 A;  4WAA A;  3Q3N C;  1IBX A;  3VTW A;  3ZXV A;  3ZUN A;  4DHZ E;  4RM8 A;  3L13 A;  1YIW A;  2W54 A;  2KTF A;  2CJO A;  2KK8 A;  2PE6 B;  2JWU A;  4US9 A;  4TUU A;  2J0J A;  4MGZ E;  1WR6 E;  3BYY B;  2ZZP B;  2IY0 B;  1IUE A;  1E9M A;  3IG3 A;  1XD3 B;  4NJ6 A;  3BK2 A;  2RDG A;  1EWC A;  1BT0 A;  4US8 A;  3PHX B;  2V3N A;  3QC8 B;  4IW0 A;  4DHZ B;  4A55 A;  5FR6 A;  5L95 C;  1TGZ B;  2KO3 A;  2RMM A;  4II2 B;  1MG8 A;  3NS8 A;  2MA9 B;  1I42 A;  1XEE A;  2FCQ A;  4TKN A;  3BIN A;  3X0W A;  3AUL A;  4WQO B;  2VH1 A;  3KWL A;  4MSQ B;  1I4G A;  3B08 A;  2VRR B;  3BK1 A;  1XQQ A;  3BYT B;  3GOE A;  3W1S A;  3BVG A;  2UWQ A;  4K3C A;  3TEX A;  3GS2 A;  1KTK A;  4FA6 A;  1V97 A;  4IM0 A;  4KGS A;  2CS4 A;  4RGT A;  1WJU A;  4RCO A;  2IPK D;  4FUL A;  2LUM A;  2M17 A;  2M0X A;  5C3J B;  1LM8 B;  2M56 B;  2KQ4 X;  4OVU A;  3KYC D;  1RYJ A;  1P7F A;  1B1Z A;  2KDE B;  1ZDX A;  3EHV A;  2C9W B;  3QK0 A;  2HDE A;  3HVZ A;  1XF5 L;  4REZ A;  1I4Q A;  1WGH A;  4CO7 A;  3AXC A;  1L7Y A;  4M02 A;  2WXR A;  3H7P A;  1N5X A;  5CHW A;  4YTM B;  2LHD A;  2N9X A;  2ICI A;  4C4V A;  4IM3 A;  2X38 A;  4AJY B;  5JHB A;  2ASQ A;  3N30 A;  4EZJ A;  1GT8 A;  4N9F 4;  3AE2 B;  4XWT A;  4WWP A;  4GIV A;  2G45 B;  2JZ3 B;  2N1W A;  1KLU D;  3VFK A;  3VUW A;  2LAS A;  1C3T A;  3L16 A;  4QAY A;  2DZK A;  2MBH A;  2M1M A;  4WWN A;  4DHJ B;  4LJO B;  1F9J A;  2BB6 A;  2AL6 A;  3A4S C;  2MH7 A; 
#chains in the Genus database with same CATH homology
 1STE A;  1XLO A;  2LFI A;  4WWM A;  1QF6 A;  1TKY A;  1SE4 A;  1K51 A;  5BMG A;  1T3Q A;  1ZP0 B;  1FFV A;  1MHX A;  2KAJ A;  2DYO A;  2WXL A;  4XDC A;  4O1N A;  2PVO D;  2J52 A;  3NVZ A;  2G9H D;  3P63 A;  3R2I A;  4OZC A;  1C76 A;  1XXG A;  5BYQ A;  1L0V B;  4ZHO A;  1SBB B;  1JWA D;  1E7P B;  4HJG E;  2BYT A;  1FNV A;  1MPE A;  3AEA B;  4L23 A;  1P7E A;  4B0E A;  1D6E C;  1D5X C;  2KAC A;  3PO0 A;  1FMA D;  3T3O A;  2WQY B;  3NZ3 A;  3Q8E A;  3W5U B;  4ZYS A;  2WXF A;  1TS3 A;  5FKA C;  1OFF A;  1UGJ A;  2KN4 A;  4USA A;  2G1E A;  1PFD A;  2QIE B;  3ZJV A;  3RFZ B;  1ACC A;  3NVW A;  1DOY A;  1VR9 A;  4R3D A;  1WXQ A;  4A90 A;  1ZUD 2;  2IGH A;  3GB1 A;  1D5Z C;  1JWB D;  1ESF A;  2AQ2 B;  2LHE A;  1SEB D;  1J7A A;  1UUP A;  1VZ7 A;  1SF0 A;  3IAM 1;  4N6E B;  1JCK B;  1HZ6 A;  2R61 A;  3CIR B;  2TSS A;  2N9K A;  3P42 A;  4YT0 B;  1ENF A;  3R2T A;  2D5G A;  3FC4 A;  1EWY C;  2XN9 C;  1JWM D;  2W3S A;  3PZ7 A;  2WLB A;  2N0S B;  3HRD D;  3V3X A;  4A6Q A;  1ET6 A;  3AEB B;  3MFG A;  2I38 A;  4M0W A;  1GOZ A;  2ZW0 A;  4KGT A;  2Y5C A;  1NYR A;  5BMI A;  2MJE A;  3IT4 B;  1F0Z A;  1C4A A;  3DWG C;  4YSY B;  4JPS A;  2KMM A;  1TKG A;  2NMQ A;  4GDL B;  1YJJ A;  4HRO A;  4D2K A;  4OHJ A;  4CQN A;  1CQV A;  3NVV A;  1PUT A;  2W55 A;  4NJC A;  5HI1 A;  1ROE A;  2JYT A;  1HXY D;  1PGB A;  2DLB A;  1EM7 A;  1J7B A;  3B2G A;  4RH6 A;  3MP9 A;  3RPF C;  1FRD A;  4C7Y A;  2ZW1 A;  1XLP A;  1RFK A;  3EUB 2;  4AQ7 A;  1JWS D;  5TSS A;  3R8B A;  3BWU D;  4L1B A;  4RGM A;  4LK0 M;  1XLN A;  1SJE D;  2FE8 A;  3LB8 C;  2EEL A;  1N60 A;  1IGC A;  2K5P A;  4P6V F;  3PZ8 A;  3U2S C;  4A9A A;  1CJE A;  2BW2 A;  4WAF A;  1E0Z A;  1JWU D;  1LO5 D;  1N63 A;  1I4X A;  2QIL A;  2BS4 B;  3URY A;  4JX1 C;  1TJE A;  2M0A A;  1I4H A;  1TY2 A;  5I4D A;  5T8I A;  1QOG A;  3SFD B;  1FRR A;  2WP9 B;  3VR9 B;  1YQ3 B;  2BB5 A;  4FXC A;  3VQI A;  3VR8 B;  2LJI A;  1FXI A;  1H7X A;  1NVI D;  2ACZ B;  4TQ1 A;  1PDX A;  4ZRQ A;  3TSS A;  2WXG A;  1XCT L;  4P16 A;  1JML A;  4RF1 A;  4MAC A;  3P4R B;  1AWD A;  2CJN A;  1E6E B;  1GPX A;  1C4C A;  2JZP A;  1TS2 A;  5HG2 A;  1C77 A;  4JWS C;  1VZ8 A;  1V1P A;  4TMA B;  3KWV A;  3TEW A;  2YEP B;  1QT9 A;  2IGG A;  2QJL A;  4N59 A;  1BXT A;  1QOF A;  1V1P B;  2GB1 A;  4IKG A;  4C80 A;  1ZXI A;  2WXK A;  1K50 A;  1SJH D;  1HA5 A;  4OVZ A;  1OQR A;  3MC0 B;  4WUR A;  3U4E G;  2JXT A;  4DXF A;  3HVD A;  5HHD G;  4ITK A;  3EA6 A;  4YTP B;  3U52 E;  3ZJU A;  3ZQ4 A;  1JRO A;  4NAW B;  1WGK A;  3V05 A;  2CU3 A;  1CZP A;  3GP7 A;  1C4P A;  5HFY A;  3P4P B;  1YQ4 B;  4H2A A;  5EE0 A;  5D3D A;  5H92 C;  3AE9 B;  3BVZ A;  4OW0 A;  2IJ0 A;  3AV8 A;  4DQO C;  1ZXH A;  2Y5P A;  1TS4 A;  1EU3 A;  1T6B X;  1FFU A;  2WNM A;  4N58 A;  4ARI A;  5MPO A;  1RWS A;  1V1O A;  4DXG A;  3HUI A;  4GLS C;  3NRZ A;  1QIL A;  2Z8L A;  4TQ0 A;  2W82 A;  2BT6 A;  2BBC A;  4HKZ E;  3P1M A;  3AE8 B;  1ZPS A;  2J42 A;  1VLB A;  1I7H A;  1EU4 A;  1SXT A;  1V8C A;  2I2Y A;  2LEK A;  2ON8 A;  3CF4 A;  5AUI A;  1DYQ A;  3CWI A;  3W9C B;  2K3U A;  3DWM A;  1QLB B;  4RNA A;  1ET9 A;  2K22 A;  3IXS A;  1QOA A;  2MEK A;  1L0Y B;  3C8Y A;  1QKZ A;  4HKQ A;  2PIA A;  3VRB B;  3BII D;  1SE3 A;  1J7C A;  2K9X A;  2GRI A;  1TS5 A;  1N62 A;  1PYW D;  2WDV B;  5G5G A;  1HQR D;  4NAM A;  4HEA 1;  4ZOH C;  3MHZ A;  1ZOY B;  2K0P A;  3KLS X;  2WU2 B;  1L0X B;  1NYQ A;  1R7S A;  2KDM A;  1SSN A;  2MJD A;  3E9S A;  1GTE A;  2WXI A;  4WIP A;  3Q8C A;  3Q8A A;  1ZDV A;  2PKO A;  2W3R A;  1YMH E;  3N9Y C;  4JWU C;  1WRI A;  1VDV A;  3Q8F A;  4RF0 A;  1BUI C;  1FO4 A;  1PGA A;  1YN4 A;  2PMV A;  1JRP A;  2L32 A;  1UNS A;  3B9J A;  3ABV B;  4GDK B;  3TEZ A;  1FCL A;  2PVG C;  3AEC B;  3IAS 1;  4KKJ A;  1IGD A;  2MJ3 A;  1NI3 A;  2Y3A A;  2L1A A;  5EE3 A;  4WQM A;  1MI0 A;  1FNU A;  3UI3 A;  3AE4 B;  1FD6 A;  2JX5 A;  2OED A;  1C78 A;  3H8H A;  4RFB A;  5E6J A;  1F2R C;  2AX5 A;  1KLG D;  2JSV X;  3BZD B;  1AW7 A;  1E10 A;  3W5V B;  1WYG A;  5C2T B;  2EKI A;  3SR6 A;  5G5H A;  2AQ1 B;  5BYS A;  1DOX A;  1FM0 D;  1SIJ A;  1YN3 A;  3LXF A;  1RM6 C;  2DWQ A;  1TZO A;  1CK1 A;  2M19 A;  4RGN A;  2WS3 B;  4ARC A;  1SE2 A;  1UWX A;  1OQQ A;  1YJI A;  1AN8 A;  5D7G A;  4KKI A;  1FCC C;  4C56 C;  1KFY B;  1YN5 A;  4OZA A;  3ZYY X;  2QSD A;  3AB5 A;  3AMZ A;  2E3T A;  1IBX A;  2LGI A;  2KWD A;  3AN1 A;  5AUK A;  4IDI A;  2W54 A;  1GB1 A;  2CJO A;  2BS3 B;  1KH0 A;  1WSP A;  2JWU A;  2QEJ C;  4WH4 A;  1IBX B;  3NUH B;  2IDY A;  3FIL B;  4B0M A;  4US9 A;  2INN E;  2VZK B;  4L2Y A;  3BYY B;  1FNW A;  2YEP F;  3W2D A;  3TEY A;  1IUE A;  2PLP A;  1E9M A;  3IT6 B;  3LYY A;  3B2F A;  4YWG G;  3OWE B;  3BK2 A;  2RDG A;  3T3N A;  1EWC A;  2H88 B;  1PGX A;  2V3P A;  1XO3 A;  1XLQ A;  3J9C A;  4US8 A;  2V3N A;  1YNT E;  4RGO S;  4YSX B;  1DOI A;  1D5M C;  1VJK A;  2BTE A;  4A55 A;  1I4P A;  4MT5 A;  1GTH A;  1L4Z B;  2L52 A;  2JYE A;  1FIQ A;  2LMC A;  3AE3 B;  1C9F A;  4HRS A;  4A8X C;  2WDR B;  2WU5 B;  1XCQ L;  1UWM A;  3MJ5 A;  1MHH E;  3KQ4 A;  2RMM A;  4TSS A;  2WXJ A;  4XWW A;  1XEE A;  1HEZ E;  2J4X A;  1A70 A;  2L83 A;  2JQR B;  5BMH A;  3AEG B;  3KWL A;  1K52 A;  2WXQ A;  3NVY A;  1TKE A;  1I4G A;  3AE5 B;  2RDH A;  2H89 B;  3AH7 A;  4YSZ B;  2WXN A;  2N9L A;  3BK1 A;  1ZE3 D;  3BYT B;  4ZHP A;  3AEE B;  1GAQ B;  3W1S A;  1KF6 B;  2PTL A;  3BVG A;  3L4P A;  2NTS A;  2INP E;  3BVM A;  3AEF B;  4XDD A;  3TEX A;  3P4Q B;  2BS2 B;  3GS2 A;  3VRA B;  1I4R A;  1KTK A;  1V97 A;  1TYG B;  2WXH A;  4KGS A;  1KRH A;  5D3I B;  2B76 B;  2DYM A;  2SAK A;  4RGT A;  5FK9 C;  2WXO A;  1Y56 A;  1GB4 A;  3AE7 B;  4RCO A;  2IPK D;  1N61 A;  1JAL A;  4EE2 A;  1Q10 A;  2LUM A;  1SB3 C;  2IGD A;  1JW9 D;  2AQ3 B;  1D4B A;  5C3J B;  1VZ6 A;  2VZK D;  5EE9 A;  1DGJ A;  2M56 B;  1FEH A;  2KQ4 X;  3I57 A;  5EE1 A;  5JXV A;  2V4I B;  3TUO A;  1VRA B;  2E6X A;  2XNA C;  3AE1 B;  1RYJ A;  1H7W A;  3ZJT A;  1P7F A;  4YTN B;  1B1Z A;  3O13 A;  3AE6 B;  4MH8 A;  1L6U A;  3WCQ A;  1C79 A;  4MM3 B;  1F2R I;  2N7J A;  3FAH A;  1ZDX A;  3AED B;  2NTT A;  4OZB A;  1L5P A;  2V0G A;  1M4V A;  2HDE A;  4PT5 A;  3HVZ A;  1XF5 L;  1N5W A;  4J3O D;  4KGR A;  4REZ A;  1F77 A;  1I4Q A;  1WWT A;  5H8Y E;  5BYR A;  2J53 A;  3AM9 A;  1MVK A;  3Q8B A;  2WXM A;  2HTM E;  4AS1 A;  2WDQ B;  1FXA A;  1NEN B;  2DBY A;  3E56 A;  3U7Z A;  2WXR A;  1L4D B;  4C7Z A;  2Q5W D;  2ONQ A;  1N5X A;  5FR3 A;  4YTM B;  2LHD A;  4IOI E;  4ZRP A;  2ICI A;  4JE3 B;  3FIL A;  1BML C;  5GXG B;  2X38 A;  1HZ5 A;  1QOB A;  4Q2J A;  2SEB D;  2OHF A;  1QQR A;  1GT8 A;  1L6V A;  2RPV A;  4KX6 B;  2GI9 A;  3AE2 B;  2PW9 A;  4YXD B;  4LLG M;  4LTU A;  4XWT A;  5LNK 1;  3P4S B;  2QMT A;  1TY0 A;  3NS1 A;  3ZGZ A;  1AYF A;  3EGR A;  1NEK B;  1K53 A;  2FBW B;  1T5X D;  3ETR A;  3I9V 1;  1KLU D;  1JQ4 A;  4NZL B;  2JU6 X;  3SFE B;  3SEB A;  2WXP A;  1B9R A;  2BB6 A;  4XE0 A;  2MH7 A;  4UDU C;  2FUG 1;  3Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...