1YN4A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EapH1
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn4A00
1D5ZC 1AN8A 1I4HA 5FKAC 3V05A 1JWUD 3MFGA 3KLSX 2Z8LA 1L0YB 4RGOS 1HA5A 2QEJC 1TS4A 1PYWD 1EWCA 1L0XB 1EU4A 2IPKD 1D6EC 2R61A 1ET6A 2AQ3B 1SJED 4OHJA 4TSSA 5D3DA 4DXGA 3MC0B 1ET9A 2NTSA 1SEBD 1YN4A 5TSSA 3BVGA 1HXYD 1AW7A 1I4XA 2RDGA 1CQVA 1KLUD 3R8BA 5FK9C 1JWMD 2AQ2B 1FNWA 1M4VA 3BVZA 1I4GA 1I4PA 4ZYSA 4O1NA 4RGNA 3OWEB 1HQRD 4UDUC 1SE3A 1BXTA 1JCKB 2G9HD 1TS2A 1SXTA 1UUPA 4NZLB 1FNUA 3BYTB 3O13A 1FNVA 1YN5A 1D5MC 3SEBA 1V1OA 1TY2A 2J4XA 4RGTA 2XN9C 2RDHA 2XNAC 1SBBB 1D5XC 4RH6A 4RCOA 2SEBD 1KTKA 2TSSA 1I4RA 3URYA 3W2DA 1JWSD 1F77A 1I4QA 3GP7A 3EA6A 1ESFA 1STEA 1LO5D 5I4DA 2ICIA 3BVMA 2QILA 1B1ZA 1GOZA 1QILA 1XXGA 3BZDB 1SJHD 1ENFA 1V1PA 4DXFA 1TS3A 1DYQA 3R2IA 4C56C 4RFBA 1T5XD 1V1PB 1EU3A 1SE2A 3R2TA 1SE4A 1CK1A 1TY0A 2AQ1B 2NTTA 2IJ0A 1TS5A 5D3IB 4RGMA 1KLGD 1YN3A 3TSSA 3BYYB 1UNSA
chains in the Genus database with same CATH superfamily
1F1HA 1LQBA 1QKZA 2JRIB 3CWIA 3KLSX 4US9A 3I5JC 4J6IA 4HCNB 4A20A 3IAS1 1YJ1A 3RPFC 1LM8B 2L32A 3GS2A 3RCZA 4IG7B 3P4SB 2J0KA 1WIAA 5L95C 3N1XC 4XWTA 3RNCC 3TCAA 3ZRFA 4ICUA 2LVQA 5D94A 1WGHA 3NVZA 2KX3A 4C4VB 1FNWA 3H7PB 2JWUA 4TUUA 4M8MA 2G4SA 2LGYA 3L4PA 2NBUA 1FNUA 2WU2B 2LWPA 1TY2A 3ZNHB 1FD6A 2XN9C 3IT6B 2NMQA 3LXFA 1I4RA 2KYWA 3QK0A 4GB9A 1XQQA 1J19A 1E10A 2AL3A 1F77A 3AB5A 1F52A 1L7YA 4WWMA 2BT6A 4FJYA 2NR2A 1GOZA 4W9LA 4GMVA 2FBWB 2NBWB 1V1PA 2EKEC 2WXRA 4C7ZA 4P6VF 4RM8A 2KDMA 1TYGB 4JIOU 4K3BA 2KLCA 1OEYJ 4M8NA 3RN9C 1PGBA 3VUWA 4YT0B 2BTEA 1OQYA 1Y56A 1U4AA 1NEKB 2WQYB 3NG0A 2KWVB 3MFGA 1WZ0A 1N63A 4S17A 4ZOHC 4RF0A 4ANWA 2ZPNA 1C4AA 2JWZA 2W82A 4LTUA 1TS4A 1R4MB 1JRPA 3TJPA 1LXDA 2CJNA 2H88B 1EO6A 2K6DB 2R61A 3P1MA 2M56B 2BS3B 4RF1A 2N1VA 4CQNA 5H92C 4DHJB 1K53A 5TSSA 3IXSA 3W1SA 2RMMA 4DWFA 1R4NI 4YXDB 1F2RI 3AE9B 2WWZA 1E90A 3PZDA 3LB8C 2MJDA 1MHXA 3HHMA 1MJDA 2LGDA 2K0PA 3LJ3A 3PO0A 5IA7A 3SHQA 2WXHA 5AZFA 3A1QB 1J0GA 3TEXA 2E3TA 1SE9A 4TMAB 2L7RA 1N5WA 1ACCA 3CF6E 1WX8A 2WX1A 3KUDB 4JX1C 1WR6E 1WSPA 2XK5B 1V1OA 2RDBC 4XC2A 4PK1A 4NJ6A 3KYCD 3V6EB 1E5WA 2BS4B 4YSXB 2L8JA 3B08A 1JWSD 4GDLA 2W9NA 1OQQA 2UYZB 1ZXHA 3FKYA 3U4EG 3BINA 3AE4B 3DVGX 2ICIA 1DGJA 2N1WA 1L6UA 2BF8B 2KK8A 1ENFA 1XLOA 3KQ4A 2N9XA 4GIVA 1EU3A 2O6VD 4ZRIA 3V62A 1CK1A 2YEPF 4HK2A 2DZIA 1TIFA 1T6BX 2NPTB 2HTHA 2PPHA 4ZRQA 3Q14C 1X1MA 4ASWC 3AE2B 4EUTA 1WYGA 2BB6A 1N61A 3WA0A 2J0MA 2LJ5A 2NCNA 1WJ6A 3BWUD 3KVFB 4NQLB 3RI7C 1TBEA 2G1EA 3CSTA 3VQIA 3IBEA 4HEA1 2N9KA 1HZ6A 4FLHA 3DBRI 3AEAB 1CMXB 1SIJA 2JYEA 1V2YA 2WP9B 3AN1A 2KOXA 5TR5A 2WHIA 1CQVA 4L1BA 2LFIA 4GOCA 4KGSA 3R7RA 4ITKA 2LZ6A 5J17A 4K7UA 2WXQA 1WRIA 2V3NA 3BVZA 2GBJA 2N9LA 4NJ7A 4RMAA 3VTUA 1GC7A 5CHWA 1E0ZA 1VZ7A 1SSNA 2LEKA 1GB1A 3TEWA 4ARIA 1UBIA 1SBBB 3PTFC 4RH6A 3RULA 2ZCCA 2TSSA 1WFYA 4F8CB 1T0YA 3IVFA 3URYA 4TQ0A 2OJWA 3B2FA 3RNBC 4B0EA 2ZW1A 3WIMA 1V5OA 4QAYA 4AQ7A 3AE7B 3APDA 4P1BC 1PDXA 1L4DB 5GXGB 1JWBD 4A9AA 3N3KB 3L17A 1XD3B 4OZAA 2WLBA 1VCBA 5G5HA 4ZRKA 2O2VA 4KIKA 1YNTE 2BVCA 3I9V1 1P0RA 4WH4A 1D5ZC 1XF5L 3VRAB 3KH0A 3PRMB 3RFZB 4MSMB 1R7SA 1QQRA 2DZJA 2MBBB 4KKIA 3BK2A 1HA5A 4A55A 2QEJC 1PYWD 1N62A 2JPHA 3Q8CA 2WYQA 4DDID 2INDC 5D3DA 4A8XC 3VUYA 1GB4A 1Q1OA 3PV1A 1KF6B 3PS6A 3TEZA 3QJZA 2IDYA 2DBYA 2EELA 3T8MA 3I3TB 1L6VA 2C9WB 2INNE 2REXA 2L0FA 4ACFA 1I4GA 2L1AA 3PLUA 1HZ5A 1UH6A 4UDUC 2W54A 2G9HD 2O6VB 1UUPA 1QZEA 3EFUA 2KMAA 4HDQA 1SB3C 1JQ4A 3HVDA 4RNAA 2Z59B 1YJJA 4II2B 3AU4A 1ZDXA 3SFEB 3P63A 4JPSA 4KSKC 5E6NA 1I4QA 1XLPA 2K22A 2X38A 4NAWB 4E3CA 1Q0WB 1WJUA 3IFWB 3AU5A 4KZ0A 4XGAB 1NI3A 2J53A 2EMSA 1VLBA 1DYQA 3U30A 4XX5A 5JHAA 2ON8A 3GE3C 2ASQA 1BUIC 1E7VA 2KVZA 1TS5A 2JUOA 3AMZA 3L08A 4RGMA 1AWDA 2EKIA 4P1CC 3BK1A 4BVUC 2MRPA 4HCPB 2KAJA 4WJOA 4F7ZA 3MHZA 4IW0A 4P16A 4PS8A 5CHFA 2WXKA 1GNUA 3SU8X 1ZPSA 2PTLA 3AE8B 3HVZA 4TV3A 1WX9A 2ZZPB 4PS3A 5HI1A 2WDVB 4ANUA 3ZXVA 1E9MA 1JMLA 2LJIA 3E56A 1YN4A 1B9RA 3GZNI 1D3ZA 3ZVVA 3ABVB 3A9KA 2N9EB 2VZKD 4EZKA 2WGSA 3X23A 5DPTA 1WE6A 2KDBA 5E6JA 4HWIB 3VR9B 3DBRB 2AWTA 2I1JA 1FEHA 3NZ3A 4US8A 3AEFB 4GXBA 3IG3A 2OOBB 3PVLA 1L0VB 3PRZA 2Q5WD 1FNVA 1V5TA 4GLSC 1K51A 4A90A 1D5XC 1UWXA 3JVZX 2CHXA 3M62B 1J7CA 4FA6A 3WAPA 2LRWA 3ZJVA 2KWUB 2ZVOA 3EA6A 1STEA 2G3QB 3AEGB 1FPYA 2LMCA 4HROA 2LUMA 3LYYA 4MGZE 3ONSA 3T3NA 1XXGA 2AL6A 2D5GA 2W3RA 3VDZA 1MPEA 4ZHPA 3TBLD 2DYMA 3B0AA 2QMTA 1FFVA 3DQVA 3QX1A 3K9PB 2KMCA 3Q3FA 1QT9A 1KH0A 1SE2A 3OLMD 3KUZA 2QIEB 4NAMA 3AV8A 2W55A 5D3IB 2J7QB 2KDFB 1HTOA 2PVOD 3W1YA 2LD9A 2IBIB 4IWPA 3IAM1 3DHGC 3R7QA 3JW0X 2JZZA 2NS5A 2D3AA 2A4ZA 2NVUI 1WGRA 4FN2A 4AS1A 3C19A 2KN5A 5IP4D 1WMHA 2D11A 2DNFA 2FCMA 1ET9A 3AEEB 1SEBD 5GMVA 2IY1B 2V9HA 5HG2A 3Q8FA 1P9DU 1WXQA 1HEZE 2MWSB 3SD5A 2HTME 2RDGA 2XEWA 4WAAA 2RGFA 2YEPB 1HTQA 3B9JA 2QHOA 2N9PC 1FRRA 1H4RA 2BYVE 2PKOA 1M4VA 2BS2B 3MJWA 2D3CA 1FCLA 1V80A 4TKNA 1EM7A 4JL9A 1TS2A 3CIRB 2GBKA 4NZLB 1P7EA 3MC9A 3VAWA 3DVGY 5L83A 3BYTB 3V60A 4ANXA 2A5UA 4C00A 3DVNV 2J4XA 3Q8AA 4YTNB 3A33B 4L2YA 3M3JA 3QIJA 3VUXA 3DBHB 2IGHA 5AZGA 1V97A 2FCQA 2BPSA 3AEDB 2LUEA 2KTFA 3Q8EA 1XT9B 2KDIA 1VD2A 3MTNB 1RAXA 2K9XA 4FULA 2GB1A 4MM3A 1OEYA 5JXVA 3JSVA 5AUIA 1FXIA 2VRRB 4H2AA 5BYRA 2ZW0A 4GGQA 1WMHB 4KZCA 1RLFA 2VZKB 3BYYB 1AN8A 2L76A 1VR9A 2GBNA 2KHWB 3QAQA 2WXPA 4K3CA 2KJRA 2UU7A 2LASA 2B3AA 3C0RB 1L0XB 2ZEQA 1SIFA 3Q8BA 1F9JA 4OHJA 2JZPA 3QQ8B 3KYDD 2XBBC 1RWSA 3AEBB 2L83A 2ZJDA 4S0RA 1AW7A 1ZE3D 3P2BA 4HDOA 5JZEB 5FK9C 4A6QA 3NVWA 3ZYYX 3A9JA 3VVWB 4EZLA 4B95A 4MT5A 1IGCA 2JRHA 1BXTA 2MP2A 2QDFA 1SXTA 1V6EA 3U7DA 2KDEB 3RNAC 2K5PA 4P7IA 2M0AA 1CZPA 2Z0EB 2GBRA 3RNEC 5LNK1 3HM6X 2C5LC 2MBQA 4KX6B 1GC6A 2RDHA 3MHSD 4IM0A 1HE8A 1D4BA 3UINB 3M95A 2ACZB 4F1SA 2LGXA 5CX3A 5KHQA 2W3SA 2LI5A 4PYZA 4LNNA 1EF5A 4EKUA 3NJTA 2KJ6A 2M19A 3A4RA 2WXGA 1NBFC 2KFKA 1QOBA 3R2IA 1FM0D 1V1PB 1WR1A 2JT4B 4DBGA 4G0NB 2KWCA 5LXHA 3OJ4B 4I6LB 3ZDMC 1E8XA 2WXIA 2CR5A 3EC8A 3N9YC 2I2YA 3A4SC 2MX2A 3HRDD 1WGKA 5C1ZA 2Z8LA 3U52E 2C7NB 2RPQA 1EU4A 4XYCA 5KHOA 2PE9A 1ZUD2 2IPKD 4BBNC 3DWMA 3RMKC 2MJEA 1L2NA 3D32A 4WWPA 1GPXA 2ZCBA 3AM9A 2CU1A 3DBLI 3PZ8A 1WGDA 1ROEA 4C7YA 4IM2A 3P4QB 2K3UA 4HKQA 5G5GA 3NRZA 3RYTA 1QOAA 1WWTA 2FUG1 3AE1B 1A5RA 1WX7A 4W9HA 4IOIE 1UF0A 3ML9A 4O1NA 4IWQA 2KQSA 2QC8A 2MQJA 3Q6BA 1K8RB 4LNKA 4KKJA 3KW5B 4HVBA 3SEBA 3AXCA 2QSDA 2N7DA 2V4LA 5JH5C 2OJRA 4RGTA 3FILA 2WXJA 2SEBD 4IDIA 2SAKA 4X57B 4MELA 5IO9A 5EE9A 3C8YA 5EE3A 4MGKE 4XWWA 4FHJA 2VH1A 4GDLB 4IWOA 3BVMA 4MDKE 2V3SA 3H8HA 1RFKA 1WM2A 2JU6X 2H89B 3TMPB 3DOWA 1ZP0B 4EZJA 3N1YC 4OZCA 1YQBA 1BMLC 4BKSD 3T3OA 3ZJTA 4AUQC 1SE4A 2J0JA 2R2OA 2BYFA 2ZPYA 1DOYA 1YN3A 2IO2B 1BT0A 3N1ZC 2K8BA 2Y5BB 4N59A 2LHEA 4AWJA 1H8CA 1WF9A 1N60A 3HK0A 2BYEA 1DOIA 3DPDA 5J2RA 4BOSC 1WZ3A 2DYBA 1IBXA 1UD7A 3PHWB 4DHZB 4NY0A 3L54A 1WXVA 3ENEA 4HJGE 4K7WA 2KJHB 3I57A 4XE0A 1WGYA 1OGWA 2D2QA 4OVUA 2KX0A 3V3XA 5HFYA 3PRPB 2V3PA 2KC1A 2JXTA 3UF8A 4W9EA 4K7SA 1KLUD 2JVCA 1C1YB 1N6ZA 3AE3B 2K8HA 4W9CA 1JCKB 2K25A 1PUTA 4LJPB 3OJ3A 4ZRJA 1XLQA 4W9DA 3O13A 1KOTA 1D5MC 2K39A 3HIZA 2MBEA 4WJPA 4ZHOA 1T0SC 5BYSA 1IUEA 3ZNID 4PS7A 1NYRA 1Y8RC 3U7ZA 1ESFA 2LVOA 5EDSA 1UWMA 4OZBA 5LXIB 1R4NB 4LNOA 2KLGA 3FC4A 3O65B 1NI2A 3PREA 2WDQB 5C3JB 4M02A 1J7AA 2NTTA 2KO3A 2KD0A 2ONQA 2YVCA 3BIID 4AJWA 2GI9A 1PQSA 2JQRB 4BKGA 1XO3A 2O2VB 4KIKB 2UWQA 2LVPA 4WQMA 2CHZA 1FXTB 1C4CA 2PW9A 3BY4B 4MACA 2BQQA 2V1YA 1YQ3B 4WIPA 3NVVA 3Q69A 2V0GA 1S3SG 2BBCA 2J42A 3E9SA 4MH0E 3W1SC 1TJEA 1MG8A 4AOFA 3VHTC 1PGAA 3ETRA 1I42A 4YSYB 4YWGG 4FJZA 4MJSA 4W9IA 3ML8A 1ZXIA 4K81A 1JALA 5BO4B 1MI0A 4KGRA 3Q3NC 4YTPB 1ZDVA 2JYTA 1JROA 1IGDA 1YN5A 4HRSA 2KMMA 3SFDB 4MH8A 2KNBA 2PMVA 4E74A 2PIAA 2MHJA 3AECB 2L05A 4XDDA 2CU3A 2KVRA 2J52A 2MA9B 3ZRCA 2K8CA 3GP7A 4IKGA 1WJ4A 1C77A 2QILA 3ZTDA 4GDKA 1F0ZA 1WXMA 1MG4A 3V6CB 4ZRPA 1TKGA 1TY0A 2NBVB 2AQ1B 3PHXB 5CHVC 3EUB2 1E8ZA 3MC8A 4W9FA 5IN7A 3VH3B 1SF0A 2IY0B 2HDEA 3UGBB 5IAAC 1NYQA 3ZDTA 3NS1A 4ICVA 1KM7A 2MBHA 4XDCA 3EHVA 2MLBA 3B1LX 1ET6A 2AQ3B 4II3B 3NZSA 2DWQA 2D10A 3AH7A 4URKA 5MPOA 3RD2A 5BYQA 2RSUA 2BB5A 1UBQA 4I6PA 3IT4B 1TZOA 1V86A 1WE7A 1VZ8A 2DZKA 2X8XX 4M0WA 3VRBB 1LGRA 4W9KA 3A9KB 4B0MA 4MGYE 1KJTA 3H7PA 3Q3JA 1AYFA 1LFDA 4ZYSA 4RGNA 1XEEA 1HQRD 3EGRA 4IUMB 3VH4B 1KLVA 4NPNA 3SDLC 1I7HA 3WAOA 3EFCA 2PE6B 3CMMB 4HJKA 3QC8B 4RCOA 2K1FA 2Y5PA 2KXJA 4KVGB 1KTKA 4FXCA 4FADA 5BMHA 2WU5B 3K9OB 3HUIA 3ZO5B 3W2DA 1FCCC 1F2RC 1Z5SB 4DHZE 5BMIA 1C3TA 5HHDG 3KWVA 3RNFC 4CHKA 1QOFA 1LO5D 4OVVA 3UIPB 1V49A 1UGMA 4PYUA 3H9DA 3TIXA 3KWLA 3ZTCA 3DVNU 2MJ3A 1SJHD 4JWUC 3TL5A 4EOYA 4MSQB 3VTVA 2FUHB 1KRHA 1T5XD 1Q10A 3N20C 1E7PB 1J7BA 1RM6C 3VFKA 5D2MB 5HKHA 2WDTB 1E7UA 3H6NA 1UNSA 1TS3A 1FXAA 2MSED 3R66C 5H8YE 4N9F4 4GN1A 1NVID 4XZ4A 2KQ4X 4M0WB 2R2QA 4TQ1A 4LK0M 4ANVA 3MP9A 4M01A 3NOBA 1CJEA 2DLBA 2KZRA 1SJED 4DXAB 2I38A 2PJHA 2JF5A 3ECIA 2NTSA 1WI0A 5IKCM 1M94A 4Q2JA 4J3OD 3TEYA 2Y3AA 2BWES 2E6XA 3AI5A 3R8BA 3W9CB 2DYOA 3RUIB 3A1QA 3MJ5A 3DHHC 3UIOB 2L52A 4USAA 1QF6A 1I4PA 1FRDA 1EUVB 2MCNB 3R3MA 3P42A 4GSWA 3Q2AC 2XK5A 4R3DA 4LJOB 3AE5B 2LGIA 2JZ3B 3QWZB 4G50A 3Q3OC 1YIWA 2FIFA 3APCA 3QARA 3VXWA 3NZUA 4WWNA 1WM3A 4BKTA 3GZNB 1WXSA 5DPRA 3J9CA 1TZ1A 1DOXA 4CYEA 1B1ZA 1QILA 2FIDA 2INPE 1WXAA 2LGSA 2N7JA 1MHHE 2V4IB 4MM3B 5D7GA 2VH2A 4HXDA 3JSVB 3L10B 2G45B 3LDZE 4FHKA 2NPTA 1ZW7A 3TSSA 1P7FA 3ZQ4A 4BZAA 5DPWA 2D3GA 1I4HA 2K6QA 2FCNA 5FKAC 1JWUD 3V05A 4WJNA 3UQBA 1EWCA 1WJNA 2GBMA 5JHBA 1MVKA 5DPSA 3N32A 3ZJUA 3KUCB 5G2NA 2KQ7A 3ZW3A 1OQRA 4HPMB 4DXGA 3S2AA 1YJIA 4LNIA 1GAQB 1WYWB 3L0WB 3W5VB 2IGGA 5AEKB 3ZGZA 1TKEA 2OEDA 1J8CA 3DCGA 2FE8A 4W9JA 2PVGC 3B2GA 4NQKE 4FBJB 5D6JB 4EEWA 3ZKJC 2JX5A 3A9JB 3OWEB 2INCC 1SGHA 2DX5B 2BYTA 3IHPC 2LRUA 4LDTD 4BBNF 1UELA 2WX0A 2QJLA 2MP2B 1TKYA 3ZNZB 3ALBA 4KGTA 1GUAB 1E6EB 3HM3A 1P3QU 3OAWA 1V9JA 2MEKA 2DZMA 1MFWA 4WWOA 1EWYC 2M1MA 2IYDB 3GOEA 1XLNA 2RD0A 4ARCA 1C9FA 1WY8A 3N30A 4HPLB 5I4DA 2GMIC 3P4PB 2WXFA 4JLCA 2DENB 4DXFA 2C7HA 2WXMA 2N4FA 3RZFA 4C56C 2KFKB 1FO4A 3U2SC 2IJ0A 2Z0DB 2M17A 3DWGC 4L23A 1VZ6A 2CHWA 4A3PA 2LXAA 4WQOB 3T9LA 3H7SA 2WXNA 3PGEA 5EE1A 1ZKHA 5LLIA 1XCQL 4ZDVA 2AEHA 4G3XB 4REZA 2BWFA 2KFJA 3QCAA 2C7MB 1YQ4B 4N58A 1D6EC 1P1AA 1XCTL 3ZLZA 1C79A 2ZVNA 4W9GA 4TSSA 1E8YA 4OVZA 2L0TA 3M63B 1ZOYB 1FFUA 2HD5B 4CO7A 2LXCA 1YX6B 2KT7A 2BKFA 1C76A 1C78A 4G11A 4EFOA 3JYUA 4B6WA 3P4RB 2O6VA 4LNFA 2KN4A 1I35A 4OW0A 2IO1B 4WURA 1YMHE 4DQOC 5FR6A 3DDCB 1JRUA 4DDGD 2ZNVB 1T3QA 2PEAA 3APFA 4WAFA 2G4DB 2CKHB 4D2KA 2BKRB 3I63C 2FNJB 3W5UB 4BFRA 2YLMA 3FILB 3PPAA 3AE6B 3H1UA 3EECA 5AUKA 1FMAD 4GU2A 4NAWA 3WAMA 1JWAD 3CSFA 3UQAA 3OG5A 2KTRA 5E6PA 3PLVA 4DK5A 2IO3B 4I6NB 3FAHA 1GJZA 1T0RC 1VJKA 2KACA 2OHFA 4KDLB 2WXLA 2PLPA 3L13A 2DHZA 3VR8B 2FAZA 2JY6A 4JE3B 2DAJA 3ZUNA 2MH7A 1RFAA 2WNMA 1A70A 1ZGUB 2D3BA 2L00B 1YX5B 2RR9A 2RPVA 1L0YB 4RGOS 4LDTB 1QLBB 3WANA 1IBXB 1UZXB 4BKSA 5CTRC 5EE0A 2AYOB 3TUOA 4M00A 3MC0B 3DBHI 2WXOA 2HJ8A 4WJQA 2DAFA 2Y5CA 2N7EA 1RYJA 1S1QB 4BOZB 4K1RB 2BW2A 3NS8A 2BGFA 2JSVX 1HXYD 4BAXA 1I4XA 4AP4C 1IPGA 3VTWA 1TGZB 2KC2A 1JWMD 1YD8U 5T8IA 2AQ2B 5IOIA 1V81A 1Q5WB 2AX5A 2B76B 1K52A 1SE3A 3AULA 5G55A 2FCSA 4YTMB 2KWDA 4KDIC 4NNJB 2KTRB 2JXXA 3PT2B 3SR6A 4HKZE 4AJYB 1VRAB 1WGGA 1E8WA 2HE7A 5BMGA 3V61A 1C4PA 3DBLB 1P98A 1Z2MA 3RNGC 4FJVB 5DCNA 4KSLC 4A3OA 1NDDA 2CJOA 4RFBA 1K50A 3ZIMA 1OTRB 2GOWA 1QOGA 1IYFA 2HJ1A 2CS4A 2IO0B 3X0WA 4B9KA 2GRIA 1R4MI 5AZHA 3NUHB 4IC7B 4HLEA 3QA8A 3WALA 2MBOA 4HPPA 2LHDA 1JW9D 2IZVB 1ISNA 4EE2A 3UI3A 3QHTA 5C23A 1V8CA 1TT5B 1PFDA 1NENB 1G6JA 5FR3A 3GB1A 2EMTA 4IM3A 5J18A 2QCZA 2KKCA 2D07B 2L3ZA 3NHEB 4YSZB 4ZYNA 1L5PA 4MEMA 4LLGM 4LCDE 1WRDB 4YL8A 3U8ZA 3BVGA 4N6EB 4C80A 2N0SB 2KANA 3ZNGC 4MJSB 3DHIC 3NY5A 3RT3B 4JGHB 4JQWC 4JWSC 5E6OA 3PZ7A 2C60A 2WDRB 1FIQA 3DBSA 3L16A 1PGXA 4RM9A 2ZNVC 3ZXRA 4PT5A 1KFYB 1N5XA 2WS3B 2M4NA 1T0QC 3WCQA 2XNAC 2MW5A 1L4ZB 4MGIE 4C4VA 4DHJD 1WH3A 3Q3MC 1IP9A 2GLSA 1AARA 3PSEB 1RRBA 1EF1A 3RZWC 3GE8C 1UGJA 3BZDB 2I1KA 1VDVA 1GG3A 4GDKB 2M0XA 2IGDA 1TTNA 2M8SA 4NJCA 4E71A 3R2TA 1OFFA 1YOVB 3NVYA 1KLGD 5C2TB 4KV2A
chains in the Genus database with same CATH topology
4N59A 1I4HA 2LHEA 5FKAC 3V05A 1JWUD 2KAJA 1N60A 1QKZA 1DOIA 3CWIA 3KLSX 4US9A 3MHZA 4P16A 1IBXA 1EWCA 2WXKA 1ZPSA 3IAS1 1MVKA 2PTLA 3AE8B 3HVZA 4HJGE 3RPFC 3ZJUA 3I57A 4XE0A 5HI1A 2L32A 2WDVB 3GS2A 1OQRA 4DXGA 1YJIA 1E9MA 1GAQB 3V3XA 5HFYA 1JMLA 2V3PA 2LJIA 2JXTA 1YN4A 3E56A 3P4SB 1B9RA 3W5VB 2IGGA 4XWTA 3ZGZA 3ABVB 3ZQ4A 1TKEA 2OEDA 1KLUD 2FE8A 2VZKD 2PVGC 3B2GA 3NVZA 3AE3B 5E6JA 1FNWA 3VR9B 2JWUA 3NZ3A 1FEHA 4US8A 2JX5A 3AEFB 3OWEB 2BYTA 1JCKB 1PUTA 1L0VB 2Q5WD 2QJLA 1XLQA 1TKYA 3L4PA 2WU2B 1FNUA 3O13A 1FNVA 4KGTA 1D5MC 1E6EB 4GLSC 1TY2A 1K51A 2MEKA 4A90A 2XN9C 4ZHOA 1FD6A 1EWYC 1D5XC 5BYSA 1UWXA 1XLNA 3IT6B 4ARCA 2NMQA 3LXFA 1I4RA 1J7CA 1IUEA 1E10A 1C9FA 3ZJVA 1NYRA 1F77A 3AB5A 3U7ZA 3EA6A 1ESFA 1STEA 1UWMA 4OZBA 3AEGB 5I4DA 4WWMA 2LMCA 2BT6A 4HROA 2LUMA 1GOZA 3LYYA 3P4PB 2WXFA 3T3NA 1XXGA 2D5GA 2W3RA 4ZHPA 1MPEA 3FC4A 2FBWB 1V1PA 2WXRA 4DXFA 2DYMA 2WDQB 4C7ZA 4P6VF 2KDMA 2WXMA 4C56C 5C3JB 2QMTA 1FFVA 1TYGB 1QT9A 1KH0A 1SE2A 1FO4A 1J7AA 2NTTA 1PGBA 2QIEB 2IJ0A 4NAMA 4YT0B 2ONQA 3U2SC 2BTEA 3AV8A 2W55A 3BIID 5D3IB 2GI9A 2JQRB 1XO3A 2PVOD 1Y56A 3DWGC 1NEKB 4L23A 1VZ6A 2WQYB 3IAM1 3MFGA 4WQMA 1N63A 4ZOHC 4RF0A 2WXNA 5EE1A 1C4AA 1C4CA 2PW9A 2W82A 1XCQL 4LTUA 1TS4A 1JRPA 4MACA 4REZA 4AS1A 2CJNA 2H88B 1YQ4B 4N58A 1D6EC 1YQ3B 1XCTL 2R61A 4WIPA 1C79A 3P1MA 2M56B 2BS3B 3NVVA 4TSSA 3Q69A 4RF1A 2V0GA 4OVZA 2BBCA 1ET9A 3AEEB 4CQNA 5H92C 2J42A 1SEBD 3E9SA 1ZOYB 1FFUA 1K53A 1TJEA 5TSSA 3IXSA 3W1SA 2RMMA 5HG2A 3Q8FA 4YXDB 1F2RI 3AE9B 1PGAA 3ETRA 4YSYB 4YWGG 1WXQA 1HEZE 2HTME 2RDGA 3LB8C 2MJDA 1MHXA 2YEPB 1ZXIA 3B9JA 2K0PA 1JALA 3PO0A 1C76A 1FRRA 2WXHA 1C78A 1MI0A 2PKOA 4KGRA 1M4VA 2BS2B 3TEXA 2E3TA 1FCLA 3P4RB 4YTPB 1EM7A 2KN4A 4OW0A 1TS2A 4TMAB 1ZDVA 1N5WA 1ACCA 2JYTA 3CIRB 1YMHE 4WURA 1JROA 4NZLB 4DQOC 1P7EA 1IGDA 3BYTB 4JX1C 1YN5A 1WSPA 4HRSA 2KMMA 3SFDB 4MH8A 1V1OA 1T3QA 2J4XA 4WAFA 2PMVA 4D2KA 3Q8AA 4YTNB 4L2YA 2PIAA 3W5UB 3FILB 3AECB 3AE6B 2BS4B 4XDDA 4YSXB 2CU3A 2IGHA 2J52A 1JWSD 1V97A 5AUKA 3AEDB 1FMAD 1OQQA 3GP7A 3Q8EA 1ZXHA 4IKGA 3U4EG 3AE4B 1C77A 1JWAD 2ICIA 1DGJA 2QILA 1L6UA 2K9XA 2GB1A 1ENFA 1F0ZA 1XLOA 3KQ4A 5JXVA 4ZRPA 5AUIA 1FXIA 3FAHA 4H2AA 1EU3A 1TKGA 5BYRA 1TY0A 1CK1A 2AQ1B 2YEPF 1VJKA 2KACA 3EUB2 2OHFA 2ZW0A 2WXLA 2PLPA 1T6BX 3BYYB 2VZKB 3VR8B 4JE3B 1AN8A 1VR9A 1SF0A 2MH7A 4ZRQA 2WXPA 2WNMA 2HDEA 1A70A 1NYQA 3AE2B 1WYGA 2BB6A 1N61A 2RPVA 1L0YB 4RGOS 1QLBB 3NS1A 1L0XB 1IBXB 4XDCA 3BWUD 3Q8BA 2G1EA 3VQIA 1ET6A 2AQ3B 5EE0A 4OHJA 4HEA1 2N9KA 2DWQA 3AH7A 3TUOA 5MPOA 1HZ6A 3MC0B 5BYQA 2WXOA 2JZPA 2BB5A 2Y5CA 1RYJA 3AEAB 2BW2A 3IT4B 1SIJA 1RWSA 1TZOA 1VZ8A 2JYEA 2L83A 3AEBB 2JSVX 2WP9B 4M0WA 1HXYD 3AN1A 1AW7A 3VRBB 1I4XA 1ZE3D 1CQVA 4L1BA 2LFIA 4KGSA 4B0MA 5FK9C 4A6QA 1JWMD 3NVWA 4ITKA 1AYFA 5T8IA 3ZYYX 2AQ2B 2WXQA 1WRIA 2V3NA 3BVZA 4MT5A 4ZYSA 4RGNA 1XEEA 2AX5A 1IGCA 1HQRD 2B76B 2N9LA 1K52A 3EGRA 1SE3A 1BXTA 1SXTA 2K5PA 1E0ZA 4YTMB 1VZ7A 2KWDA 2M0AA 1CZPA 1SSNA 2LEKA 1GB1A 1I7HA 3TEWA 5LNK1 4ARIA 4KX6B 2RDHA 1SBBB 3SR6A 4RH6A 4RCOA 4HKZE 1D4BA 2Y5PA 1KTKA 2TSSA 4FXCA 5BMHA 2WU5B 1VRAB 2ACZB 3URYA 3HUIA 4TQ0A 5BMGA 1FCCC 3W2DA 1F2RC 2W3SA 1C4PA 3B2FA 5BMIA 5HHDG 3KWVA 1QOFA 1LO5D 4B0EA 2ZW1A 2M19A 3KWLA 4AQ7A 3AE7B 2MJ3A 1SJHD 2WXGA 1PDXA 1L4DB 4JWUC 5GXGB 1JWBD 4A9AA 2CJOA 1QOBA 3R2IA 1FM0D 4RFBA 1KRHA 1K50A 1Q10A 1T5XD 1V1PB 4OZAA 1QOGA 2WLBA 1E7PB 5G5HA 2GRIA 1J7BA 1YNTE 1RM6C 3NUHB 3I9V1 2WXIA 4WH4A 1UNSA 1D5ZC 1XF5L 1TS3A 1FXAA 1JW9D 2LHDA 3N9YC 3VRAB 2I2YA 5H8YE 3RFZB 1R7SA 3UI3A 4EE2A 1QQRA 3HRDD 1WGKA 1NVID 4KKIA 1V8CA 2Z8LA 2KQ4X 3BK2A 1HA5A 3U52E 4A55A 1PFDA 1NENB 2QEJC 1PYWD 4TQ1A 1EU4A 1N62A 4LK0M 3GB1A 5FR3A 3Q8CA 1ZUD2 2IPKD 3MP9A 1CJEA 2DLBA 3DWMA 4YSZB 2MJEA 1SJED 1L5PA 2I38A 5D3DA 4A8XC 1GPXA 3AM9A 4LLGM 2NTSA 1GB4A 3PZ8A 1ROEA 4C7YA 1KF6B 3TEZA 2IDYA 3P4QB 2K3UA 4HKQA 2DBYA 4Q2JA 5G5GA 3NRZA 2EELA 3BVGA 4N6EB 4J3OD 3TEYA 2Y3AA 4C80A 1QOAA 1WWTA 2E6XA 2FUG1 3AE1B 1L6VA 2N0SB 3R8BA 3W9CB 2INNE 2DYOA 3MJ5A 4IOIE 2L52A 1I4GA 4USAA 1QF6A 1I4PA 1FRDA 2L1AA 4O1NA 4JWSC 1HZ5A 3PZ7A 4UDUC 2W54A 2G9HD 2WDRB 3P42A 1FIQA 1UUPA 1PGXA 4KKJA 3SEBA 4PT5A 2QSDA 4R3DA 1KFYB 1N5XA 2WS3B 3AE5B 2LGIA 4RGTA 3WCQA 1SB3C 1JQ4A 2XNAC 3HVDA 3FILA 2WXJA 2SEBD 4IDIA 2SAKA 4RNAA 1YJJA 1L4ZB 1ZDXA 3SFEB 3P63A 4JPSA 5EE9A 1I4QA 3C8YA 1XLPA 5EE3A 4XWWA 2K22A 2X38A 4GDLB 3J9CA 4NAWB 1DOXA 3BVMA 1B1ZA 3H8HA 1UGJA 1QILA 1RFKA 2INPE 2JU6X 1NI3A 3BZDB 2J53A 2H89B 1ZP0B 1VDVA 4OZCA 4GDKB 1VLBA 1BMLC 1DYQA 2IGDA 2N7JA 1MHHE 2V4IB 4MM3B 5D7GA 4NJCA 3T3OA 3ZJTA 3R2TA 2ON8A 1BUIC 1SE4A 1OFFA 1TS5A 3AMZA 3NVYA 4RGMA 1DOYA 1KLGD 1YN3A 3TSSA 5C2TB 1AWDA 2EKIA 3BK1A 1P7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D5Z C;  1AN8 A;  1I4H A;  5FKA C;  3V05 A;  1JWU D;  3MFG A;  3KLS X;  2Z8L A;  1L0Y B;  4RGO S;  1HA5 A;  2QEJ C;  1TS4 A;  1PYW D;  1EWC A;  1L0X B;  1EU4 A;  2IPK D;  1D6E C;  2R61 A;  1ET6 A;  2AQ3 B;  1SJE D;  4OHJ A;  4TSS A;  5D3D A;  4DXG A;  3MC0 B;  1ET9 A;  2NTS A;  1SEB D;  1YN4 A;  5TSS A;  3BVG A;  1HXY D;  1AW7 A;  1I4X A;  2RDG A;  1CQV A;  1KLU D;  3R8B A;  5FK9 C;  1JWM D;  2AQ2 B;  1FNW A;  1M4V A;  3BVZ A;  1I4G A;  1I4P A;  4ZYS A;  4O1N A;  4RGN A;  3OWE B;  1HQR D;  4UDU C;  1SE3 A;  1BXT A;  1JCK B;  2G9H D;  1TS2 A;  1SXT A;  1UUP A;  4NZL B;  1FNU A;  3BYT B;  3O13 A;  1FNV A;  1YN5 A;  1D5M C;  3SEB A;  1V1O A;  1TY2 A;  2J4X A;  4RGT A;  2XN9 C;  2RDH A;  2XNA C;  1SBB B;  1D5X C;  4RH6 A;  4RCO A;  2SEB D;  1KTK A;  2TSS A;  1I4R A;  3URY A;  3W2D A;  1JWS D;  1F77 A;  1I4Q A;  3GP7 A;  3EA6 A;  1ESF A;  1STE A;  1LO5 D;  5I4D A;  2ICI A;  3BVM A;  2QIL A;  1B1Z A;  1GOZ A;  1QIL A;  1XXG A;  3BZD B;  1SJH D;  1ENF A;  1V1P A;  4DXF A;  1TS3 A;  1DYQ A;  3R2I A;  4C56 C;  4RFB A;  1T5X D;  1V1P B;  1EU3 A;  1SE2 A;  3R2T A;  1SE4 A;  1CK1 A;  1TY0 A;  2AQ1 B;  2NTT A;  2IJ0 A;  1TS5 A;  5D3I B;  4RGM A;  1KLG D;  1YN3 A;  3TSS A;  3BYY B;  1UNS A; 
#chains in the Genus database with same CATH topology
 1F1H A;  1LQB A;  1QKZ A;  2JRI B;  3CWI A;  3KLS X;  4US9 A;  3I5J C;  4J6I A;  4HCN B;  4A20 A;  3IAS 1;  1YJ1 A;  3RPF C;  1LM8 B;  2L32 A;  3GS2 A;  3RCZ A;  4IG7 B;  3P4S B;  2J0K A;  1WIA A;  5L95 C;  3N1X C;  4XWT A;  3RNC C;  3TCA A;  3ZRF A;  4ICU A;  2LVQ A;  5D94 A;  1WGH A;  3NVZ A;  2KX3 A;  4C4V B;  1FNW A;  3H7P B;  2JWU A;  4TUU A;  4M8M A;  2G4S A;  2LGY A;  3L4P A;  2NBU A;  1FNU A;  2WU2 B;  2LWP A;  1TY2 A;  3ZNH B;  1FD6 A;  2XN9 C;  3IT6 B;  2NMQ A;  3LXF A;  1I4R A;  2KYW A;  3QK0 A;  4GB9 A;  1XQQ A;  1J19 A;  1E10 A;  2AL3 A;  1F77 A;  3AB5 A;  1F52 A;  1L7Y A;  4WWM A;  2BT6 A;  4FJY A;  2NR2 A;  1GOZ A;  4W9L A;  4GMV A;  2FBW B;  2NBW B;  1V1P A;  2EKE C;  2WXR A;  4C7Z A;  4P6V F;  4RM8 A;  2KDM A;  1TYG B;  4JIO U;  4K3B A;  2KLC A;  1OEY J;  4M8N A;  3RN9 C;  1PGB A;  3VUW A;  4YT0 B;  2BTE A;  1OQY A;  1Y56 A;  1U4A A;  1NEK B;  2WQY B;  3NG0 A;  2KWV B;  3MFG A;  1WZ0 A;  1N63 A;  4S17 A;  4ZOH C;  4RF0 A;  4ANW A;  2ZPN A;  1C4A A;  2JWZ A;  2W82 A;  4LTU A;  1TS4 A;  1R4M B;  1JRP A;  3TJP A;  1LXD A;  2CJN A;  2H88 B;  1EO6 A;  2K6D B;  2R61 A;  3P1M A;  2M56 B;  2BS3 B;  4RF1 A;  2N1V A;  4CQN A;  5H92 C;  4DHJ B;  1K53 A;  5TSS A;  3IXS A;  3W1S A;  2RMM A;  4DWF A;  1R4N I;  4YXD B;  1F2R I;  3AE9 B;  2WWZ A;  1E90 A;  3PZD A;  3LB8 C;  2MJD A;  1MHX A;  3HHM A;  1MJD A;  2LGD A;  2K0P A;  3LJ3 A;  3PO0 A;  5IA7 A;  3SHQ A;  2WXH A;  5AZF A;  3A1Q B;  1J0G A;  3TEX A;  2E3T A;  1SE9 A;  4TMA B;  2L7R A;  1N5W A;  1ACC A;  3CF6 E;  1WX8 A;  2WX1 A;  3KUD B;  4JX1 C;  1WR6 E;  1WSP A;  2XK5 B;  1V1O A;  2RDB C;  4XC2 A;  4PK1 A;  4NJ6 A;  3KYC D;  3V6E B;  1E5W A;  2BS4 B;  4YSX B;  2L8J A;  3B08 A;  1JWS D;  4GDL A;  2W9N A;  1OQQ A;  2UYZ B;  1ZXH A;  3FKY A;  3U4E G;  3BIN A;  3AE4 B;  3DVG X;  2ICI A;  1DGJ A;  2N1W A;  1L6U A;  2BF8 B;  2KK8 A;  1ENF A;  1XLO A;  3KQ4 A;  2N9X A;  4GIV A;  1EU3 A;  2O6V D;  4ZRI A;  3V62 A;  1CK1 A;  2YEP F;  4HK2 A;  2DZI A;  1TIF A;  1T6B X;  2NPT B;  2HTH A;  2PPH A;  4ZRQ A;  3Q14 C;  1X1M A;  4ASW C;  3AE2 B;  4EUT A;  1WYG A;  2BB6 A;  1N61 A;  3WA0 A;  2J0M A;  2LJ5 A;  2NCN A;  1WJ6 A;  3BWU D;  3KVF B;  4NQL B;  3RI7 C;  1TBE A;  2G1E A;  3CST A;  3VQI A;  3IBE A;  4HEA 1;  2N9K A;  1HZ6 A;  4FLH A;  3DBR I;  3AEA B;  1CMX B;  1SIJ A;  2JYE A;  1V2Y A;  2WP9 B;  3AN1 A;  2KOX A;  5TR5 A;  2WHI A;  1CQV A;  4L1B A;  2LFI A;  4GOC A;  4KGS A;  3R7R A;  4ITK A;  2LZ6 A;  5J17 A;  4K7U A;  2WXQ A;  1WRI A;  2V3N A;  3BVZ A;  2GBJ A;  2N9L A;  4NJ7 A;  4RMA A;  3VTU A;  1GC7 A;  5CHW A;  1E0Z A;  1VZ7 A;  1SSN A;  2LEK A;  1GB1 A;  3TEW A;  4ARI A;  1UBI A;  1SBB B;  3PTF C;  4RH6 A;  3RUL A;  2ZCC A;  2TSS A;  1WFY A;  4F8C B;  1T0Y A;  3IVF A;  3URY A;  4TQ0 A;  2OJW A;  3B2F A;  3RNB C;  4B0E A;  2ZW1 A;  3WIM A;  1V5O A;  4QAY A;  4AQ7 A;  3AE7 B;  3APD A;  4P1B C;  1PDX A;  1L4D B;  5GXG B;  1JWB D;  4A9A A;  3N3K B;  3L17 A;  1XD3 B;  4OZA A;  2WLB A;  1VCB A;  5G5H A;  4ZRK A;  2O2V A;  4KIK A;  1YNT E;  2BVC A;  3I9V 1;  1P0R A;  4WH4 A;  1D5Z C;  1XF5 L;  3VRA B;  3KH0 A;  3PRM B;  3RFZ B;  4MSM B;  1R7S A;  1QQR A;  2DZJ A;  2MBB B;  4KKI A;  3BK2 A;  1HA5 A;  4A55 A;  2QEJ C;  1PYW D;  1N62 A;  2JPH A;  3Q8C A;  2WYQ A;  4DDI D;  2IND C;  5D3D A;  4A8X C;  3VUY A;  1GB4 A;  1Q1O A;  3PV1 A;  1KF6 B;  3PS6 A;  3TEZ A;  3QJZ A;  2IDY A;  2DBY A;  2EEL A;  3T8M A;  3I3T B;  1L6V A;  2C9W B;  2INN E;  2REX A;  2L0F A;  4ACF A;  1I4G A;  2L1A A;  3PLU A;  1HZ5 A;  1UH6 A;  4UDU C;  2W54 A;  2G9H D;  2O6V B;  1UUP A;  1QZE A;  3EFU A;  2KMA A;  4HDQ A;  1SB3 C;  1JQ4 A;  3HVD A;  4RNA A;  2Z59 B;  1YJJ A;  4II2 B;  3AU4 A;  1ZDX A;  3SFE B;  3P63 A;  4JPS A;  4KSK C;  5E6N A;  1I4Q A;  1XLP A;  2K22 A;  2X38 A;  4NAW B;  4E3C A;  1Q0W B;  1WJU A;  3IFW B;  3AU5 A;  4KZ0 A;  4XGA B;  1NI3 A;  2J53 A;  2EMS A;  1VLB A;  1DYQ A;  3U30 A;  4XX5 A;  5JHA A;  2ON8 A;  3GE3 C;  2ASQ A;  1BUI C;  1E7V A;  2KVZ A;  1TS5 A;  2JUO A;  3AMZ A;  3L08 A;  4RGM A;  1AWD A;  2EKI A;  4P1C C;  3BK1 A;  4BVU C;  2MRP A;  4HCP B;  2KAJ A;  4WJO A;  4F7Z A;  3MHZ A;  4IW0 A;  4P16 A;  4PS8 A;  5CHF A;  2WXK A;  1GNU A;  3SU8 X;  1ZPS A;  2PTL A;  3AE8 B;  3HVZ A;  4TV3 A;  1WX9 A;  2ZZP B;  4PS3 A;  5HI1 A;  2WDV B;  4ANU A;  3ZXV A;  1E9M A;  1JML A;  2LJI A;  3E56 A;  1YN4 A;  1B9R A;  3GZN I;  1D3Z A;  3ZVV A;  3ABV B;  3A9K A;  2N9E B;  2VZK D;  4EZK A;  2WGS A;  3X23 A;  5DPT A;  1WE6 A;  2KDB A;  5E6J A;  4HWI B;  3VR9 B;  3DBR B;  2AWT A;  2I1J A;  1FEH A;  3NZ3 A;  4US8 A;  3AEF B;  4GXB A;  3IG3 A;  2OOB B;  3PVL A;  1L0V B;  3PRZ A;  2Q5W D;  1FNV A;  1V5T A;  4GLS C;  1K51 A;  4A90 A;  1D5X C;  1UWX A;  3JVZ X;  2CHX A;  3M62 B;  1J7C A;  4FA6 A;  3WAP A;  2LRW A;  3ZJV A;  2KWU B;  2ZVO A;  3EA6 A;  1STE A;  2G3Q B;  3AEG B;  1FPY A;  2LMC A;  4HRO A;  2LUM A;  3LYY A;  4MGZ E;  3ONS A;  3T3N A;  1XXG A;  2AL6 A;  2D5G A;  2W3R A;  3VDZ A;  1MPE A;  4ZHP A;  3TBL D;  2DYM A;  3B0A A;  2QMT A;  1FFV A;  3DQV A;  3QX1 A;  3K9P B;  2KMC A;  3Q3F A;  1QT9 A;  1KH0 A;  1SE2 A;  3OLM D;  3KUZ A;  2QIE B;  4NAM A;  3AV8 A;  2W55 A;  5D3I B;  2J7Q B;  2KDF B;  1HTO A;  2PVO D;  3W1Y A;  2LD9 A;  2IBI B;  4IWP A;  3IAM 1;  3DHG C;  3R7Q A;  3JW0 X;  2JZZ A;  2NS5 A;  2D3A A;  2A4Z A;  2NVU I;  1WGR A;  4FN2 A;  4AS1 A;  3C19 A;  2KN5 A;  5IP4 D;  1WMH A;  2D11 A;  2DNF A;  2FCM A;  1ET9 A;  3AEE B;  1SEB D;  5GMV A;  2IY1 B;  2V9H A;  5HG2 A;  3Q8F A;  1P9D U;  1WXQ A;  1HEZ E;  2MWS B;  3SD5 A;  2HTM E;  2RDG A;  2XEW A;  4WAA A;  2RGF A;  2YEP B;  1HTQ A;  3B9J A;  2QHO A;  2N9P C;  1FRR A;  1H4R A;  2BYV E;  2PKO A;  1M4V A;  2BS2 B;  3MJW A;  2D3C A;  1FCL A;  1V80 A;  4TKN A;  1EM7 A;  4JL9 A;  1TS2 A;  3CIR B;  2GBK A;  4NZL B;  1P7E A;  3MC9 A;  3VAW A;  3DVG Y;  5L83 A;  3BYT B;  3V60 A;  4ANX A;  2A5U A;  4C00 A;  3DVN V;  2J4X A;  3Q8A A;  4YTN B;  3A33 B;  4L2Y A;  3M3J A;  3QIJ A;  3VUX A;  3DBH B;  2IGH A;  5AZG A;  1V97 A;  2FCQ A;  2BPS A;  3AED B;  2LUE A;  2KTF A;  3Q8E A;  1XT9 B;  2KDI A;  1VD2 A;  3MTN B;  1RAX A;  2K9X A;  4FUL A;  2GB1 A;  4MM3 A;  1OEY A;  5JXV A;  3JSV A;  5AUI A;  1FXI A;  2VRR B;  4H2A A;  5BYR A;  2ZW0 A;  4GGQ A;  1WMH B;  4KZC A;  1RLF A;  2VZK B;  3BYY B;  1AN8 A;  2L76 A;  1VR9 A;  2GBN A;  2KHW B;  3QAQ A;  2WXP A;  4K3C A;  2KJR A;  2UU7 A;  2LAS A;  2B3A A;  3C0R B;  1L0X B;  2ZEQ A;  1SIF A;  3Q8B A;  1F9J A;  4OHJ A;  2JZP A;  3QQ8 B;  3KYD D;  2XBB C;  1RWS A;  3AEB B;  2L83 A;  2ZJD A;  4S0R A;  1AW7 A;  1ZE3 D;  3P2B A;  4HDO A;  5JZE B;  5FK9 C;  4A6Q A;  3NVW A;  3ZYY X;  3A9J A;  3VVW B;  4EZL A;  4B95 A;  4MT5 A;  1IGC A;  2JRH A;  1BXT A;  2MP2 A;  2QDF A;  1SXT A;  1V6E A;  3U7D A;  2KDE B;  3RNA C;  2K5P A;  4P7I A;  2M0A A;  1CZP A;  2Z0E B;  2GBR A;  3RNE C;  5LNK 1;  3HM6 X;  2C5L C;  2MBQ A;  4KX6 B;  1GC6 A;  2RDH A;  3MHS D;  4IM0 A;  1HE8 A;  1D4B A;  3UIN B;  3M95 A;  2ACZ B;  4F1S A;  2LGX A;  5CX3 A;  5KHQ A;  2W3S A;  2LI5 A;  4PYZ A;  4LNN A;  1EF5 A;  4EKU A;  3NJT A;  2KJ6 A;  2M19 A;  3A4R A;  2WXG A;  1NBF C;  2KFK A;  1QOB A;  3R2I A;  1FM0 D;  1V1P B;  1WR1 A;  2JT4 B;  4DBG A;  4G0N B;  2KWC A;  5LXH A;  3OJ4 B;  4I6L B;  3ZDM C;  1E8X A;  2WXI A;  2CR5 A;  3EC8 A;  3N9Y C;  2I2Y A;  3A4S C;  2MX2 A;  3HRD D;  1WGK A;  5C1Z A;  2Z8L A;  3U52 E;  2C7N B;  2RPQ A;  1EU4 A;  4XYC A;  5KHO A;  2PE9 A;  1ZUD 2;  2IPK D;  4BBN C;  3DWM A;  3RMK C;  2MJE A;  1L2N A;  3D32 A;  4WWP A;  1GPX A;  2ZCB A;  3AM9 A;  2CU1 A;  3DBL I;  3PZ8 A;  1WGD A;  1ROE A;  4C7Y A;  4IM2 A;  3P4Q B;  2K3U A;  4HKQ A;  5G5G A;  3NRZ A;  3RYT A;  1QOA A;  1WWT A;  2FUG 1;  3AE1 B;  1A5R A;  1WX7 A;  4W9H A;  4IOI E;  1UF0 A;  3ML9 A;  4O1N A;  4IWQ A;  2KQS A;  2QC8 A;  2MQJ A;  3Q6B A;  1K8R B;  4LNK A;  4KKJ A;  3KW5 B;  4HVB A;  3SEB A;  3AXC A;  2QSD A;  2N7D A;  2V4L A;  5JH5 C;  2OJR A;  4RGT A;  3FIL A;  2WXJ A;  2SEB D;  4IDI A;  2SAK A;  4X57 B;  4MEL A;  5IO9 A;  5EE9 A;  3C8Y A;  5EE3 A;  4MGK E;  4XWW A;  4FHJ A;  2VH1 A;  4GDL B;  4IWO A;  3BVM A;  4MDK E;  2V3S A;  3H8H A;  1RFK A;  1WM2 A;  2JU6 X;  2H89 B;  3TMP B;  3DOW A;  1ZP0 B;  4EZJ A;  3N1Y C;  4OZC A;  1YQB A;  1BML C;  4BKS D;  3T3O A;  3ZJT A;  4AUQ C;  1SE4 A;  2J0J A;  2R2O A;  2BYF A;  2ZPY A;  1DOY A;  1YN3 A;  2IO2 B;  1BT0 A;  3N1Z C;  2K8B A;  2Y5B B;  4N59 A;  2LHE A;  4AWJ A;  1H8C A;  1WF9 A;  1N60 A;  3HK0 A;  2BYE A;  1DOI A;  3DPD A;  5J2R A;  4BOS C;  1WZ3 A;  2DYB A;  1IBX A;  1UD7 A;  3PHW B;  4DHZ B;  4NY0 A;  3L54 A;  1WXV A;  3ENE A;  4HJG E;  4K7W A;  2KJH B;  3I57 A;  4XE0 A;  1WGY A;  1OGW A;  2D2Q A;  4OVU A;  2KX0 A;  3V3X A;  5HFY A;  3PRP B;  2V3P A;  2KC1 A;  2JXT A;  3UF8 A;  4W9E A;  4K7S A;  1KLU D;  2JVC A;  1C1Y B;  1N6Z A;  3AE3 B;  2K8H A;  4W9C A;  1JCK B;  2K25 A;  1PUT A;  4LJP B;  3OJ3 A;  4ZRJ A;  1XLQ A;  4W9D A;  3O13 A;  1KOT A;  1D5M C;  2K39 A;  3HIZ A;  2MBE A;  4WJP A;  4ZHO A;  1T0S C;  5BYS A;  1IUE A;  3ZNI D;  4PS7 A;  1NYR A;  1Y8R C;  3U7Z A;  1ESF A;  2LVO A;  5EDS A;  1UWM A;  4OZB A;  5LXI B;  1R4N B;  4LNO A;  2KLG A;  3FC4 A;  3O65 B;  1NI2 A;  3PRE A;  2WDQ B;  5C3J B;  4M02 A;  1J7A A;  2NTT A;  2KO3 A;  2KD0 A;  2ONQ A;  2YVC A;  3BII D;  4AJW A;  2GI9 A;  1PQS A;  2JQR B;  4BKG A;  1XO3 A;  2O2V B;  4KIK B;  2UWQ A;  2LVP A;  4WQM A;  2CHZ A;  1FXT B;  1C4C A;  2PW9 A;  3BY4 B;  4MAC A;  2BQQ A;  2V1Y A;  1YQ3 B;  4WIP A;  3NVV A;  3Q69 A;  2V0G A;  1S3S G;  2BBC A;  2J42 A;  3E9S A;  4MH0 E;  3W1S C;  1TJE A;  1MG8 A;  4AOF A;  3VHT C;  1PGA A;  3ETR A;  1I42 A;  4YSY B;  4YWG G;  4FJZ A;  4MJS A;  4W9I A;  3ML8 A;  1ZXI A;  4K81 A;  1JAL A;  5BO4 B;  1MI0 A;  4KGR A;  3Q3N C;  4YTP B;  1ZDV A;  2JYT A;  1JRO A;  1IGD A;  1YN5 A;  4HRS A;  2KMM A;  3SFD B;  4MH8 A;  2KNB A;  2PMV A;  4E74 A;  2PIA A;  2MHJ A;  3AEC B;  2L05 A;  4XDD A;  2CU3 A;  2KVR A;  2J52 A;  2MA9 B;  3ZRC A;  2K8C A;  3GP7 A;  4IKG A;  1WJ4 A;  1C77 A;  2QIL A;  3ZTD A;  4GDK A;  1F0Z A;  1WXM A;  1MG4 A;  3V6C B;  4ZRP A;  1TKG A;  1TY0 A;  2NBV B;  2AQ1 B;  3PHX B;  5CHV C;  3EUB 2;  1E8Z A;  3MC8 A;  4W9F A;  5IN7 A;  3VH3 B;  1SF0 A;  2IY0 B;  2HDE A;  3UGB B;  5IAA C;  1NYQ A;  3ZDT A;  3NS1 A;  4ICV A;  1KM7 A;  2MBH A;  4XDC A;  3EHV A;  2MLB A;  3B1L X;  1ET6 A;  2AQ3 B;  4II3 B;  3NZS A;  2DWQ A;  2D10 A;  3AH7 A;  4URK A;  5MPO A;  3RD2 A;  5BYQ A;  2RSU A;  2BB5 A;  1UBQ A;  4I6P A;  3IT4 B;  1TZO A;  1V86 A;  1WE7 A;  1VZ8 A;  2DZK A;  2X8X X;  4M0W A;  3VRB B;  1LGR A;  4W9K A;  3A9K B;  4B0M A;  4MGY E;  1KJT A;  3H7P A;  3Q3J A;  1AYF A;  1LFD A;  4ZYS A;  4RGN A;  1XEE A;  1HQR D;  3EGR A;  4IUM B;  3VH4 B;  1KLV A;  4NPN A;  3SDL C;  1I7H A;  3WAO A;  3EFC A;  2PE6 B;  3CMM B;  4HJK A;  3QC8 B;  4RCO A;  2K1F A;  2Y5P A;  2KXJ A;  4KVG B;  1KTK A;  4FXC A;  4FAD A;  5BMH A;  2WU5 B;  3K9O B;  3HUI A;  3ZO5 B;  3W2D A;  1FCC C;  1F2R C;  1Z5S B;  4DHZ E;  5BMI A;  1C3T A;  5HHD G;  3KWV A;  3RNF C;  4CHK A;  1QOF A;  1LO5 D;  4OVV A;  3UIP B;  1V49 A;  1UGM A;  4PYU A;  3H9D A;  3TIX A;  3KWL A;  3ZTC A;  3DVN U;  2MJ3 A;  1SJH D;  4JWU C;  3TL5 A;  4EOY A;  4MSQ B;  3VTV A;  2FUH B;  1KRH A;  1T5X D;  1Q10 A;  3N20 C;  1E7P B;  1J7B A;  1RM6 C;  3VFK A;  5D2M B;  5HKH A;  2WDT B;  1E7U A;  3H6N A;  1UNS A;  1TS3 A;  1FXA A;  2MSE D;  3R66 C;  5H8Y E;  4N9F 4;  4GN1 A;  1NVI D;  4XZ4 A;  2KQ4 X;  4M0W B;  2R2Q A;  4TQ1 A;  4LK0 M;  4ANV A;  3MP9 A;  4M01 A;  3NOB A;  1CJE A;  2DLB A;  2KZR A;  1SJE D;  4DXA B;  2I38 A;  2PJH A;  2JF5 A;  3ECI A;  2NTS A;  1WI0 A;  5IKC M;  1M94 A;  4Q2J A;  4J3O D;  3TEY A;  2Y3A A;  2BWE S;  2E6X A;  3AI5 A;  3R8B A;  3W9C B;  2DYO A;  3RUI B;  3A1Q A;  3MJ5 A;  3DHH C;  3UIO B;  2L52 A;  4USA A;  1QF6 A;  1I4P A;  1FRD A;  1EUV B;  2MCN B;  3R3M A;  3P42 A;  4GSW A;  3Q2A C;  2XK5 A;  4R3D A;  4LJO B;  3AE5 B;  2LGI A;  2JZ3 B;  3QWZ B;  4G50 A;  3Q3O C;  1YIW A;  2FIF A;  3APC A;  3QAR A;  3VXW A;  3NZU A;  4WWN A;  1WM3 A;  4BKT A;  3GZN B;  1WXS A;  5DPR A;  3J9C A;  1TZ1 A;  1DOX A;  4CYE A;  1B1Z A;  1QIL A;  2FID A;  2INP E;  1WXA A;  2LGS A;  2N7J A;  1MHH E;  2V4I B;  4MM3 B;  5D7G A;  2VH2 A;  4HXD A;  3JSV B;  3L10 B;  2G45 B;  3LDZ E;  4FHK A;  2NPT A;  1ZW7 A;  3TSS A;  1P7F A;  3ZQ4 A;  4BZA A;  5DPW A;  2D3G A;  1I4H A;  2K6Q A;  2FCN A;  5FKA C;  1JWU D;  3V05 A;  4WJN A;  3UQB A;  1EWC A;  1WJN A;  2GBM A;  5JHB A;  1MVK A;  5DPS A;  3N32 A;  3ZJU A;  3KUC B;  5G2N A;  2KQ7 A;  3ZW3 A;  1OQR A;  4HPM B;  4DXG A;  3S2A A;  1YJI A;  4LNI A;  1GAQ B;  1WYW B;  3L0W B;  3W5V B;  2IGG A;  5AEK B;  3ZGZ A;  1TKE A;  2OED A;  1J8C A;  3DCG A;  2FE8 A;  4W9J A;  2PVG C;  3B2G A;  4NQK E;  4FBJ B;  5D6J B;  4EEW A;  3ZKJ C;  2JX5 A;  3A9J B;  3OWE B;  2INC C;  1SGH A;  2DX5 B;  2BYT A;  3IHP C;  2LRU A;  4LDT D;  4BBN F;  1UEL A;  2WX0 A;  2QJL A;  2MP2 B;  1TKY A;  3ZNZ B;  3ALB A;  4KGT A;  1GUA B;  1E6E B;  3HM3 A;  1P3Q U;  3OAW A;  1V9J A;  2MEK A;  2DZM A;  1MFW A;  4WWO A;  1EWY C;  2M1M A;  2IYD B;  3GOE A;  1XLN A;  2RD0 A;  4ARC A;  1C9F A;  1WY8 A;  3N30 A;  4HPL B;  5I4D A;  2GMI C;  3P4P B;  2WXF A;  4JLC A;  2DEN B;  4DXF A;  2C7H A;  2WXM A;  2N4F A;  3RZF A;  4C56 C;  2KFK B;  1FO4 A;  3U2S C;  2IJ0 A;  2Z0D B;  2M17 A;  3DWG C;  4L23 A;  1VZ6 A;  2CHW A;  4A3P A;  2LXA A;  4WQO B;  3T9L A;  3H7S A;  2WXN A;  3PGE A;  5EE1 A;  1ZKH A;  5LLI A;  1XCQ L;  4ZDV A;  2AEH A;  4G3X B;  4REZ A;  2BWF A;  2KFJ A;  3QCA A;  2C7M B;  1YQ4 B;  4N58 A;  1D6E C;  1P1A A;  1XCT L;  3ZLZ A;  1C79 A;  2ZVN A;  4W9G A;  4TSS A;  1E8Y A;  4OVZ A;  2L0T A;  3M63 B;  1ZOY B;  1FFU A;  2HD5 B;  4CO7 A;  2LXC A;  1YX6 B;  2KT7 A;  2BKF A;  1C76 A;  1C78 A;  4G11 A;  4EFO A;  3JYU A;  4B6W A;  3P4R B;  2O6V A;  4LNF A;  2KN4 A;  1I35 A;  4OW0 A;  2IO1 B;  4WUR A;  1YMH E;  4DQO C;  5FR6 A;  3DDC B;  1JRU A;  4DDG D;  2ZNV B;  1T3Q A;  2PEA A;  3APF A;  4WAF A;  2G4D B;  2CKH B;  4D2K A;  2BKR B;  3I63 C;  2FNJ B;  3W5U B;  4BFR A;  2YLM A;  3FIL B;  3PPA A;  3AE6 B;  3H1U A;  3EEC A;  5AUK A;  1FMA D;  4GU2 A;  4NAW A;  3WAM A;  1JWA D;  3CSF A;  3UQA A;  3OG5 A;  2KTR A;  5E6P A;  3PLV A;  4DK5 A;  2IO3 B;  4I6N B;  3FAH A;  1GJZ A;  1T0R C;  1VJK A;  2KAC A;  2OHF A;  4KDL B;  2WXL A;  2PLP A;  3L13 A;  2DHZ A;  3VR8 B;  2FAZ A;  2JY6 A;  4JE3 B;  2DAJ A;  3ZUN A;  2MH7 A;  1RFA A;  2WNM A;  1A70 A;  1ZGU B;  2D3B A;  2L00 B;  1YX5 B;  2RR9 A;  2RPV A;  1L0Y B;  4RGO S;  4LDT B;  1QLB B;  3WAN A;  1IBX B;  1UZX B;  4BKS A;  5CTR C;  5EE0 A;  2AYO B;  3TUO A;  4M00 A;  3MC0 B;  3DBH I;  2WXO A;  2HJ8 A;  4WJQ A;  2DAF A;  2Y5C A;  2N7E A;  1RYJ A;  1S1Q B;  4BOZ B;  4K1R B;  2BW2 A;  3NS8 A;  2BGF A;  2JSV X;  1HXY D;  4BAX A;  1I4X A;  4AP4 C;  1IPG A;  3VTW A;  1TGZ B;  2KC2 A;  1JWM D;  1YD8 U;  5T8I A;  2AQ2 B;  5IOI A;  1V81 A;  1Q5W B;  2AX5 A;  2B76 B;  1K52 A;  1SE3 A;  3AUL A;  5G55 A;  2FCS A;  4YTM B;  2KWD A;  4KDI C;  4NNJ B;  2KTR B;  2JXX A;  3PT2 B;  3SR6 A;  4HKZ E;  4AJY B;  1VRA B;  1WGG A;  1E8W A;  2HE7 A;  5BMG A;  3V61 A;  1C4P A;  3DBL B;  1P98 A;  1Z2M A;  3RNG C;  4FJV B;  5DCN A;  4KSL C;  4A3O A;  1NDD A;  2CJO A;  4RFB A;  1K50 A;  3ZIM A;  1OTR B;  2GOW A;  1QOG A;  1IYF A;  2HJ1 A;  2CS4 A;  2IO0 B;  3X0W A;  4B9K A;  2GRI A;  1R4M I;  5AZH A;  3NUH B;  4IC7 B;  4HLE A;  3QA8 A;  3WAL A;  2MBO A;  4HPP A;  2LHD A;  1JW9 D;  2IZV B;  1ISN A;  4EE2 A;  3UI3 A;  3QHT A;  5C23 A;  1V8C A;  1TT5 B;  1PFD A;  1NEN B;  1G6J A;  5FR3 A;  3GB1 A;  2EMT A;  4IM3 A;  5J18 A;  2QCZ A;  2KKC A;  2D07 B;  2L3Z A;  3NHE B;  4YSZ B;  4ZYN A;  1L5P A;  4MEM A;  4LLG M;  4LCD E;  1WRD B;  4YL8 A;  3U8Z A;  3BVG A;  4N6E B;  4C80 A;  2N0S B;  2KAN A;  3ZNG C;  4MJS B;  3DHI C;  3NY5 A;  3RT3 B;  4JGH B;  4JQW C;  4JWS C;  5E6O A;  3PZ7 A;  2C60 A;  2WDR B;  1FIQ A;  3DBS A;  3L16 A;  1PGX A;  4RM9 A;  2ZNV C;  3ZXR A;  4PT5 A;  1KFY B;  1N5X A;  2WS3 B;  2M4N A;  1T0Q C;  3WCQ A;  2XNA C;  2MW5 A;  1L4Z B;  4MGI E;  4C4V A;  4DHJ D;  1WH3 A;  3Q3M C;  1IP9 A;  2GLS A;  1AAR A;  3PSE B;  1RRB A;  1EF1 A;  3RZW C;  3GE8 C;  1UGJ A;  3BZD B;  2I1K A;  1VDV A;  1GG3 A;  4GDK B;  2M0X A;  2IGD A;  1TTN A;  2M8S A;  4NJC A;  4E71 A;  3R2T A;  1OFF A;  1YOV B;  3NVY A;  1KLG D;  5C2T B;  4KV2 A; 
#chains in the Genus database with same CATH homology
 4N59 A;  1I4H A;  2LHE A;  5FKA C;  3V05 A;  1JWU D;  2KAJ A;  1N60 A;  1QKZ A;  1DOI A;  3CWI A;  3KLS X;  4US9 A;  3MHZ A;  4P16 A;  1IBX A;  1EWC A;  2WXK A;  1ZPS A;  3IAS 1;  1MVK A;  2PTL A;  3AE8 B;  3HVZ A;  4HJG E;  3RPF C;  3ZJU A;  3I57 A;  4XE0 A;  5HI1 A;  2L32 A;  2WDV B;  3GS2 A;  1OQR A;  4DXG A;  1YJI A;  1E9M A;  1GAQ B;  3V3X A;  5HFY A;  1JML A;  2V3P A;  2LJI A;  2JXT A;  1YN4 A;  3E56 A;  3P4S B;  1B9R A;  3W5V B;  2IGG A;  4XWT A;  3ZGZ A;  3ABV B;  3ZQ4 A;  1TKE A;  2OED A;  1KLU D;  2FE8 A;  2VZK D;  2PVG C;  3B2G A;  3NVZ A;  3AE3 B;  5E6J A;  1FNW A;  3VR9 B;  2JWU A;  3NZ3 A;  1FEH A;  4US8 A;  2JX5 A;  3AEF B;  3OWE B;  2BYT A;  1JCK B;  1PUT A;  1L0V B;  2Q5W D;  2QJL A;  1XLQ A;  1TKY A;  3L4P A;  2WU2 B;  1FNU A;  3O13 A;  1FNV A;  4KGT A;  1D5M C;  1E6E B;  4GLS C;  1TY2 A;  1K51 A;  2MEK A;  4A90 A;  2XN9 C;  4ZHO A;  1FD6 A;  1EWY C;  1D5X C;  5BYS A;  1UWX A;  1XLN A;  3IT6 B;  4ARC A;  2NMQ A;  3LXF A;  1I4R A;  1J7C A;  1IUE A;  1E10 A;  1C9F A;  3ZJV A;  1NYR A;  1F77 A;  3AB5 A;  3U7Z A;  3EA6 A;  1ESF A;  1STE A;  1UWM A;  4OZB A;  3AEG B;  5I4D A;  4WWM A;  2LMC A;  2BT6 A;  4HRO A;  2LUM A;  1GOZ A;  3LYY A;  3P4P B;  2WXF A;  3T3N A;  1XXG A;  2D5G A;  2W3R A;  4ZHP A;  1MPE A;  3FC4 A;  2FBW B;  1V1P A;  2WXR A;  4DXF A;  2DYM A;  2WDQ B;  4C7Z A;  4P6V F;  2KDM A;  2WXM A;  4C56 C;  5C3J B;  2QMT A;  1FFV A;  1TYG B;  1QT9 A;  1KH0 A;  1SE2 A;  1FO4 A;  1J7A A;  2NTT A;  1PGB A;  2QIE B;  2IJ0 A;  4NAM A;  4YT0 B;  2ONQ A;  3U2S C;  2BTE A;  3AV8 A;  2W55 A;  3BII D;  5D3I B;  2GI9 A;  2JQR B;  1XO3 A;  2PVO D;  1Y56 A;  3DWG C;  1NEK B;  4L23 A;  1VZ6 A;  2WQY B;  3IAM 1;  3MFG A;  4WQM A;  1N63 A;  4ZOH C;  4RF0 A;  2WXN A;  5EE1 A;  1C4A A;  1C4C A;  2PW9 A;  2W82 A;  1XCQ L;  4LTU A;  1TS4 A;  1JRP A;  4MAC A;  4REZ A;  4AS1 A;  2CJN A;  2H88 B;  1YQ4 B;  4N58 A;  1D6E C;  1YQ3 B;  1XCT L;  2R61 A;  4WIP A;  1C79 A;  3P1M A;  2M56 B;  2BS3 B;  3NVV A;  4TSS A;  3Q69 A;  4RF1 A;  2V0G A;  4OVZ A;  2BBC A;  1ET9 A;  3AEE B;  4CQN A;  5H92 C;  2J42 A;  1SEB D;  3E9S A;  1ZOY B;  1FFU A;  1K53 A;  1TJE A;  5TSS A;  3IXS A;  3W1S A;  2RMM A;  5HG2 A;  3Q8F A;  4YXD B;  1F2R I;  3AE9 B;  1PGA A;  3ETR A;  4YSY B;  4YWG G;  1WXQ A;  1HEZ E;  2HTM E;  2RDG A;  3LB8 C;  2MJD A;  1MHX A;  2YEP B;  1ZXI A;  3B9J A;  2K0P A;  1JAL A;  3PO0 A;  1C76 A;  1FRR A;  2WXH A;  1C78 A;  1MI0 A;  2PKO A;  4KGR A;  1M4V A;  2BS2 B;  3TEX A;  2E3T A;  1FCL A;  3P4R B;  4YTP B;  1EM7 A;  2KN4 A;  4OW0 A;  1TS2 A;  4TMA B;  1ZDV A;  1N5W A;  1ACC A;  2JYT A;  3CIR B;  1YMH E;  4WUR A;  1JRO A;  4NZL B;  4DQO C;  1P7E A;  1IGD A;  3BYT B;  4JX1 C;  1YN5 A;  1WSP A;  4HRS A;  2KMM A;  3SFD B;  4MH8 A;  1V1O A;  1T3Q A;  2J4X A;  4WAF A;  2PMV A;  4D2K A;  3Q8A A;  4YTN B;  4L2Y A;  2PIA A;  3W5U B;  3FIL B;  3AEC B;  3AE6 B;  2BS4 B;  4XDD A;  4YSX B;  2CU3 A;  2IGH A;  2J52 A;  1JWS D;  1V97 A;  5AUK A;  3AED B;  1FMA D;  1OQQ A;  3GP7 A;  3Q8E A;  1ZXH A;  4IKG A;  3U4E G;  3AE4 B;  1C77 A;  1JWA D;  2ICI A;  1DGJ A;  2QIL A;  1L6U A;  2K9X A;  2GB1 A;  1ENF A;  1F0Z A;  1XLO A;  3KQ4 A;  5JXV A;  4ZRP A;  5AUI A;  1FXI A;  3FAH A;  4H2A A;  1EU3 A;  1TKG A;  5BYR A;  1TY0 A;  1CK1 A;  2AQ1 B;  2YEP F;  1VJK A;  2KAC A;  3EUB 2;  2OHF A;  2ZW0 A;  2WXL A;  2PLP A;  1T6B X;  3BYY B;  2VZK B;  3VR8 B;  4JE3 B;  1AN8 A;  1VR9 A;  1SF0 A;  2MH7 A;  4ZRQ A;  2WXP A;  2WNM A;  2HDE A;  1A70 A;  1NYQ A;  3AE2 B;  1WYG A;  2BB6 A;  1N61 A;  2RPV A;  1L0Y B;  4RGO S;  1QLB B;  3NS1 A;  1L0X B;  1IBX B;  4XDC A;  3BWU D;  3Q8B A;  2G1E A;  3VQI A;  1ET6 A;  2AQ3 B;  5EE0 A;  4OHJ A;  4HEA 1;  2N9K A;  2DWQ A;  3AH7 A;  3TUO A;  5MPO A;  1HZ6 A;  3MC0 B;  5BYQ A;  2WXO A;  2JZP A;  2BB5 A;  2Y5C A;  1RYJ A;  3AEA B;  2BW2 A;  3IT4 B;  1SIJ A;  1RWS A;  1TZO A;  1VZ8 A;  2JYE A;  2L83 A;  3AEB B;  2JSV X;  2WP9 B;  4M0W A;  1HXY D;  3AN1 A;  1AW7 A;  3VRB B;  1I4X A;  1ZE3 D;  1CQV A;  4L1B A;  2LFI A;  4KGS A;  4B0M A;  5FK9 C;  4A6Q A;  1JWM D;  3NVW A;  4ITK A;  1AYF A;  5T8I A;  3ZYY X;  2AQ2 B;  2WXQ A;  1WRI A;  2V3N A;  3BVZ A;  4MT5 A;  4ZYS A;  4RGN A;  1XEE A;  2AX5 A;  1IGC A;  1HQR D;  2B76 B;  2N9L A;  1K52 A;  3EGR A;  1SE3 A;  1BXT A;  1SXT A;  2K5P A;  1E0Z A;  4YTM B;  1VZ7 A;  2KWD A;  2M0A A;  1CZP A;  1SSN A;  2LEK A;  1GB1 A;  1I7H A;  3TEW A;  5LNK 1;  4ARI A;  4KX6 B;  2RDH A;  1SBB B;  3SR6 A;  4RH6 A;  4RCO A;  4HKZ E;  1D4B A;  2Y5P A;  1KTK A;  2TSS A;  4FXC A;  5BMH A;  2WU5 B;  1VRA B;  2ACZ B;  3URY A;  3HUI A;  4TQ0 A;  5BMG A;  1FCC C;  3W2D A;  1F2R C;  2W3S A;  1C4P A;  3B2F A;  5BMI A;  5HHD G;  3KWV A;  1QOF A;  1LO5 D;  4B0E A;  2ZW1 A;  2M19 A;  3KWL A;  4AQ7 A;  3AE7 B;  2MJ3 A;  1SJH D;  2WXG A;  1PDX A;  1L4D B;  4JWU C;  5GXG B;  1JWB D;  4A9A A;  2CJO A;  1QOB A;  3R2I A;  1FM0 D;  4RFB A;  1KRH A;  1K50 A;  1Q10 A;  1T5X D;  1V1P B;  4OZA A;  1QOG A;  2WLB A;  1E7P B;  5G5H A;  2GRI A;  1J7B A;  1YNT E;  1RM6 C;  3NUH B;  3I9V 1;  2WXI A;  4WH4 A;  1UNS A;  1D5Z C;  1XF5 L;  1TS3 A;  1FXA A;  1JW9 D;  2LHD A;  3N9Y C;  3VRA B;  2I2Y A;  5H8Y E;  3RFZ B;  1R7S A;  3UI3 A;  4EE2 A;  1QQR A;  3HRD D;  1WGK A;  1NVI D;  4KKI A;  1V8C A;  2Z8L A;  2KQ4 X;  3BK2 A;  1HA5 A;  3U52 E;  4A55 A;  1PFD A;  1NEN B;  2QEJ C;  1PYW D;  4TQ1 A;  1EU4 A;  1N62 A;  4LK0 M;  3GB1 A;  5FR3 A;  3Q8C A;  1ZUD 2;  2IPK D;  3MP9 A;  1CJE A;  2DLB A;  3DWM A;  4YSZ B;  2MJE A;  1SJE D;  1L5P A;  2I38 A;  5D3D A;  4A8X C;  1GPX A;  3AM9 A;  4LLG M;  2NTS A;  1GB4 A;  3PZ8 A;  1ROE A;  4C7Y A;  1KF6 B;  3TEZ A;  2IDY A;  3P4Q B;  2K3U A;  4HKQ A;  2DBY A;  4Q2J A;  5G5G A;  3NRZ A;  2EEL A;  3BVG A;  4N6E B;  4J3O D;  3TEY A;  2Y3A A;  4C80 A;  1QOA A;  1WWT A;  2E6X A;  2FUG 1;  3AE1 B;  1L6V A;  2N0S B;  3R8B A;  3W9C B;  2INN E;  2DYO A;  3MJ5 A;  4IOI E;  2L52 A;  1I4G A;  4USA A;  1QF6 A;  1I4P A;  1FRD A;  2L1A A;  4O1N A;  4JWS C;  1HZ5 A;  3PZ7 A;  4UDU C;  2W54 A;  2G9H D;  2WDR B;  3P42 A;  1FIQ A;  1UUP A;  1PGX A;  4KKJ A;  3SEB A;  4PT5 A;  2QSD A;  4R3D A;  1KFY B;  1N5X A;  2WS3 B;  3AE5 B;  2LGI A;  4RGT A;  3WCQ A;  1SB3 C;  1JQ4 A;  2XNA C;  3HVD A;  3FIL A;  2WXJ A;  2SEB D;  4IDI A;  2SAK A;  4RNA A;  1YJJ A;  1L4Z B;  1ZDX A;  3SFE B;  3P63 A;  4JPS A;  5EE9 A;  1I4Q A;  3C8Y A;  1XLP A;  5EE3 A;  4XWW A;  2K22 A;  2X38 A;  4GDL B;  3J9C A;  4NAW B;  1DOX A;  3BVM A;  1B1Z A;  3H8H A;  1UGJ A;  1QIL A;  1RFK A;  2INP E;  2JU6 X;  1NI3 A;  3BZD B;  2J53 A;  2H89 B;  1ZP0 B;  1VDV A;  4OZC A;  4GDK B;  1VLB A;  1BML C;  1DYQ A;  2IGD A;  2N7J A;  1MHH E;  2V4I B;  4MM3 B;  5D7G A;  4NJC A;  3T3O A;  3ZJT A;  3R2T A;  2ON8 A;  1BUI C;  1SE4 A;  1OFF A;  1TS5 A;  3AMZ A;  3NVY A;  4RGM A;  1DOY A;  1KLG D;  1YN3 A;  3TSS A;  5C2T B;  1AWD A;  2EKI A;  3BK1 A;  1P7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...