1YN4A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
b'GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EapH1
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn4A00
1SJED 4RFBA 1BXTA 3BVMA 2QEJC 1TY2A 1EU3A 1I4RA 1SEBD 3EA6A 2QILA 1JWMD 2IPKD 2RDGA 4RGOS 1V1OA 1F77A 3MC0B 3V05A 1TS2A 3MFGA 1LO5D 1I4XA 3BVZA 3TSSA 1TS4A 2XN9C 1SBBB 1B1ZA 1HXYD 2ICIA 1DYQA 3SEBA 1ESFA 1SE3A 2NTTA 1UNSA 4OHJA 1TS5A 4NZLB 1D6EC 1ENFA 1UUPA 1TY0A 1FNVA 2G9HD 4TSSA 1V1PB 1GOZA 1KLGD 3BYYB 1V1PA 1KLUD 4O1NA 2NTSA 1FNWA 2AQ2B 2IJ0A 1AN8A 4C56C 1SE2A 4ZYSA 3BYTB 2SEBD 4RGTA 1JCKB 1ET6A 1M4VA 3R2IA 1D5XC 1EU4A 1HA5A 3O13A 2Z8LA 1AW7A 5D3DA 2XNAC 5FK9C 4DXGA 1L0YB 2AQ1B 1I4QA 2R61A 1I4HA 1SE4A 3OWEB 3GP7A 4RGNA 4RGMA 5I4DA 3BZDB 1JWSD 1SXTA 4RCOA 1YN4A 5FKAC 1XXGA 3URYA 5D3IB 2RDHA 3BVGA 2TSSA 1FNUA 1TS3A 2AQ3B 1D5ZC 3R2TA 4RH6A 1PYWD 1ET9A 3W2DA 5TSSA 1CQVA 1YN5A 1I4PA 1YN3A 1T5XD 1QILA 4UDUC 1CK1A 1L0XB 1HQRD 1KTKA 1STEA 3R8BA 4DXFA 3KLSX 1SJHD 1JWUD 2J4XA 1I4GA 1EWCA 1D5MC
chains in the Genus database with same CATH superfamily
2L0TA 1TY2A 2B76B 3IAS1 1XEEA 1KM7A 3VDZA 1ZPSA 2V1YA 4KX6B 1L6UA 4WIPA 2LXAA 3IT6B 3W9CB 2BW2A 1N61A 1YJ1A 2CR5A 2KTFA 1UF0A 2MBOA 4GDLB 5DPTA 1IYFA 3PRPB 2CHXA 4LCDE 2KWVB 1YQ4B 1NYQA 2PLPA 3OAWA 2ZVNA 3WA0A 5HHDG 2O6VB 4RGTA 3JSVA 3ZW3A 1D5XC 1V5OA 2QSDA 1EF5A 1WZ0A 5EE9A 2WLBA 4XGAB 3I3TB 1T0SC 3VH3B 3NVWA 1I4QA 1L4DB 4WJOA 3H7PA 2IO3B 3ECIA 5KHQA 3ZRFA 2K22A 2AEHA 3VXWA 4TMAB 1UGJA 2HE7A 3P4PB 2W9NA 3ZJUA 3IVFA 3VQIA 2TSSA 5HKHA 1VLBA 4GN1A 3A1QA 1NENB 2WXLA 1FXAA 3Q3FA 3SFDB 1PUTA 2LHEA 3NVVA 2BYTA 4LNFA 1WX9A 3P2BA 1A70A 3SD5A 1FFVA 2W82A 5EE3A 2RPQA 2KMMA 4IWOA 2HTHA 3ENEA 3J9CA 4X57B 4AS1A 1XLOA 3NZUA 2RGFA 4RFBA 3TMPB 1EU3A 2K3UA 2KJ6A 4LNNA 4A90A 2NVUI 2K5PA 2L00B 2YVCA 1V81A 4NQKE 4ZDVA 2M17A 2WYQA 4W9KA 1I7HA 3U8ZA 2L1AA 1WE7A 3IHPC 4C00A 4NJ7A 3CMMB 2B3AA 4FULA 2LGXA 4HVBA 2LRWA 5C3JB 2FIDA 4RNAA 1JRPA 2KDFB 4MGKE 2AQ2B 4R3DA 3BK1A 3E9SA 1SE2A 1P9DU 1JMLA 3KVFB 2MW5A 2OJRA 4MJSB 3DBLB 4HLEA 2W3SA 3N20C 3PRMB 2WDTB 4M0WB 2UYZB 2FNJB 3PLVA 2ZW0A 3AULA 1Q10A 2JUOA 3GE8C 3Q69A 2J0KA 4EUTA 3TBLD 4KVGB 3PS6A 3S2AA 4BZAA 1QOFA 2ONQA 5D3IB 2RMMA 2N4FA 3UINB 1PGAA 3R66C 2KN4A 4N59A 1ET9A 3QJZA 2QIEB 2GBMA 4NJ6A 2BPSA 4EZKA 3NUHB 3AU5A 4TKNA 4W9DA 3VHTC 1L0XB 3L16A 4JWUC 2KAJA 3W1SA 2J4XA 4OVZA 4ACFA 4MH8A 4EKUA 1TZ1A 2FE8A 2JZZA 3I9V1 3QHTA 3AEFB 4FHJA 4MEMA 3EC8A 5BMHA 3E56A 2R2QA 1EUVB 1CJEA 2BVCA 4NQLB 3AE8B 4NAWA 1R4NB 2VZKB 2QC8A 1TKYA 4HK2A 1KF6B 1FRRA 4WQOB 4PT5A 3RNBC 1CZPA 2KN5A 2XEWA 5JZEB 1P0RA 1D6EC 1ROEA 4GDKB 4KSKC 5HFYA 1I42A 2FUHB 4MSQB 1TZOA 1WJ4A 4P7IA 3NS8A 3M63B 3JSVB 5D6JB 1C4PA 4KZ0A 4ZRJA 1PDXA 4IWPA 1M4VA 2DENB 1PGBA 1GAQB 1GUAB 3RULA 2PVGC 1PGXA 1MJDA 4KGRA 4G50A 1MFWA 3Q3JA 1LFDA 1QLBB 2KQSA 3C19A 3A1QB 4ZOHC 2JRIB 3ALBA 4LJPB 3RNCC 1C3TA 1VCBA 3NZ3A 2MP2A 1WXSA 2EKIA 3DBHB 3AMZA 3AECB 2BYEA 3CSFA 2V4IB 1WMHA 5TSSA 2HD5B 3U30A 1I4PA 2N0SB 1KTKA 1FXTB 4GGQA 2XK5B 3PRZA 1WGDA 4K7WA 1QOBA 3UI3A 3QQ8B 4NJCA 2I1JA 2CHZA 1R4MI 3ML8A 4XWWA 2WXOA 4US9A 2L3ZA 1KH0A 1D4BA 2R2OA 4HPMB 1WJ6A 4GMVA 1ZE3D 2M0AA 4HKQA 3SR6A 3OJ3A 1C4AA 1Q0WB 1WR1A 3K9PB 4ZRIA 2ZCCA 3L13A 3Q8BA 2CJOA 2KQ7A 5CX3A 1JWAD 4KDIC 4L2YA 1KOTA 1F1HA 3ZGZA 1UBQA 3V6CB 4DDGD 1XLNA 3DPDA 4LTUA 2NTSA 1FNWA 3VTUA 3HK0A 1F2RC 3L4PA 4RF1A 1ET6A 3Q6BA 1GPXA 2CS4A 4WURA 3A4RA 3N32A 5H92C 1E8WA 5DPSA 3N1ZC 2BT6A 4DXGA 4I6PA 4WJPA 3A9KA 2G4DB 3IFWB 1KJTA 2X8XX 3AE4B 5IN7A 3RN9C 4BOSC 1IBXA 2MBEA 4DWFA 5LXHA 4BOZB 4PS7A 3H1UA 4F8CB 3BIID 4ICVA 3VUYA 4B95A 5G2NA 3UF8A 1MG4A 1M94A 2K0PA 2N9KA 2RDHA 3W5UB 1J7CA 2GBJA 2AQ3B 2O6VA 3ZVVA 5DPRA 4WAFA 3ZJTA 2KDEB 4DHJB 1HZ6A 3MC9A 3W1SC 1JROA 4C4VA 1F0ZA 3PPAA 4PK1A 1UBIA 2MHJA 4FA6A 4ANWA 4AJWA 2KX0A 4M8MA 2FUG1 2PEAA 2LGDA 2A4ZA 2FCSA 2GMIC 1I4RA 4NAWB 4ZRQA 1JRUA 4XZ4A 3AEEB 3VVWB 3DHGC 5IP4D 1YMHE 2MX2A 2C7MB 2LVOA 2ICIA 3BY4B 4ITKA 4ZRPA 1F9JA 1PQSA 2JXTA 2WGSA 1E8YA 1L5PA 4YSZB 1NEKB 4HCPB 3I63C 3RI7C 1XLPA 5IO9A 2BYFA 2Q5WD 2BB5A 3U7ZA 3L0WB 2D3GA 2NMQA 4L23A 4WH4A 2WQYB 4K81A 3QC8B 2JZ3B 4GSWA 1G6JA 3DWGC 1WYWB 2MH7A 2KYWA 5CHWA 4Q2JA 2UWQA 3TEYA 5E6NA 3OLMD 4P1BC 3SDLC 3B2GA 1S3SG 4YTNB 5D3DA 3LJ3A 1VZ7A 2NBWB 1I35A 1E7UA 1KRHA 1VD2A 1OEYA 3IG3A 1E8XA 5I4DA 3P63A 1WJNA 1TKEA 1HTQA 3GE3C 3Q8CA 1V80A 1ZGUB 3KUDB 2MP2B 4JLCA 2DYMA 5BYQA 4A9AA 2RD0A 2NPTB 2WS3B 2CKHB 1V6EA 3IT4B 2K39A 3NY5A 4YTMB 1V8CA 1WMHB 3Q3MC 3KYDD 4MJSA 3IAM1 2QJLA 2K6DB 4FADA 3W2DA 1JQ4A 2C7NB 1LQBA 2HDEA 2KVZA 2M8SA 4AJYB 3BK2A 3AEAB 4M0WA 4B9KA 3VRAB 4UDUC 1OQQA 2W55A 3IXSA 1ZXHA 2V3SA 1WFYA 1Q1OA 2JYEA 3R3MA 4TV3A 4HPLB 2BF8B 3PREA 4XWTA 1HTOA 1SEBD 2RDGA 3H9DA 1TS2A 3LXFA 2PKOA 1GNUA 2KKCA 1YQ3B 4W9EA 1P98A 4D2KA 3ETRA 4GIVA 2IBIB 5J17A 2L83A 3PLUA 3WAPA 3DWMA 4RF0A 2DAFA 1FO4A 4JQWC 1B9RA 1UUPA 3DHIC 1KLGD 1XCTL 3PVLA 3HHMA 2JWUA 4II2B 4IDIA 4C56C 1L7YA 1H4RA 3ZRCA 1E5WA 5C23A 5J18A 1JCKB 2FIFA 1NVID 3A9KB 1IBXB 2IGGA 1UZXB 1C79A 2IO0B 2JT4B 1L0YB 3PZ7A 1SF0A 1IPGA 4GDKA 2G1EA 2LI5A 2LXCA 2WXNA 2M4NA 2BYVE 2FCMA 3IBEA 4HPPA 3QIJA 3TUOA 3BWUD 2BWES 4WAAA 4GOCA 2KZRA 3SHQA 1OQRA 2BGFA 3L08A 2HJ8A 2O6VD 3T9LA 1D5ZC 4FXCA 2AL3A 2KQ4X 3AEGB 4KV2A 3UQAA 2N9LA 4EFOA 2GBNA 2N9PC 4C4VB 3KYCD 4NNJB 3V3XA 4JIOU 5E6PA 5FR3A 2L7RA 3WIMA 4CO7A 1HQRD 4DXAB 2J53A 1EWYC 5AUIA 3RZFA 1SIFA 1EWCA 1JALA 4LK0M 1WY8A 4G3XB 1LXDA 1GC7A 3EUB2 3EA6A 4I6NB 3Q8EA 1DOYA 2HTME 3BINA 2DLBA 4TUUA 3T3NA 2D5GA 3TSSA 4NAMA 3RNFC 3I5JC 1KLVA 3SEBA 4BVUC 2WU2B 1MHXA 2YEPB 3VTWA 1IGCA 1TS5A 2PE9A 3KQ4A 2XK5A 2G9HD 5CHFA 1GOZA 4KKIA 2KTRB 4LDTB 2K8CA 1DGJA 1HZ5A 2MSED 2DZJA 4HJKA 2MCNB 1GJZA 4KZCA 3HUIA 4A3OA 4JGHB 2DAJA 3M62B 5EE0A 4ARCA 2SEBD 3DVGY 1XLQA 2ZEQA 1FRDA 1RAXA 4XDDA 2Z0DB 2Z8LA 3QCAA 4MGIE 4MGYE 5FK9C 1R7SA 2PE6B 4F1SA 1NBFC 3I57A 3ZQ4A 1K51A 5JHAA 3TCAA 4MACA 1WXAA 4ANVA 2XBBC 1UGMA 3N3KB 1NDDA 3BVGA 3V6EB 4MH0E 3VFKA 1S1QB 2WXPA 1L6VA 3U4EG 1L0VB 1CQVA 3RD2A 2V0GA 1YN3A 3AE9B 2KVRA 4HCNB 1J19A 1STEA 2X38A 3PZ8A 3RZWC 2IO1B 2M0XA 2V3PA 3X23A 1VZ8A 3B08A 5E6OA 3B1LX 2KHWB 3AH7A 3TEWA 3L54A 4FJZA 1E9MA 1EF1A 5D2MB 1P7FA 2IZVB 1FD6A 3APFA 1TS4A 2WXGA 1HXYD 2WXKA 2WXMA 3GOEA 3ONSA 2C9WB 2BB6A 4KDLB 4DBGA 4C7YA 1GB4A 1YJJA 1YOVB 2LASA 2NCNA 3MC8A 2RDBC 2IDYA 1C1YB 2OEDA 1XT9B 2GBKA 3A33B 3LYYA 3R2IA 2VZKD 1E0ZA 4BKSA 4WWMA 1MHHE 1R4MB 1ZW7A 3TIXA 2JQRB 3H7SA 4OZBA 4BBNF 1WGHA 3Q14C 2KLGA 4XC2A 3GP7A 2PIAA 2KWUB 3WALA 3APCA 2V4LA 4YWGG 1P7EA 3QARA 1T3QA 4ANUA 2QDFA 3DDCB 1RFAA 4HEA1 4E74A 4JE3B 1L4ZB 3MTNB 5FR6A 2N9EB 2DYOA 4E3CA 1ZDVA 4RH6A 3PZDA 1H8CA 3PTFC 4ANXA 1UWMA 2BS4B 1YN5A 4IM3A 4W9FA 4K7UA 1T5XD 1WGKA 3HM6X 2GI9A 1WYGA 1SE9A 4FJVB 4CHKA 1UH6A 3PT2B 4XDCA 2WX1A 3U2SC 2NPTA 5T8IA 2L8JA 4J3OD 3HIZA 3V05A 4BKTA 5LXIB 1WGYA 4OW0A 3GZNB 4M8NA 2XN9C 3VUWA 2LUMA 2QHOA 1SBBB 2SAKA 2IY1B 2V9HA 3GB1A 3QX1A 3JVZX 4M02A 3EFCA 4W9LA 3DBRI 1RM6C 1V2YA 3AE1B 1AWDA 2AL6A 2KXJA 3MJWA 1TBEA 1V1PA 3M95A 3ZNGC 4KGSA 2BS2B 3UIPB 4ZYSA 2LRUA 3N30A 1XQQA 2KK8A 3BYTB 5G55A 3FAHA 1ZXIA 3O13A 3PO0A 2MA9B 3N1YC 3ZO5B 2ZJDA 3EGRA 3MJ5A 3PHWB 4BFRA 1GG3A 1Z2MA 2WXFA 4WWNA 3TL5A 1OQYA 2Y5CA 1EO6A 1RYJA 2V3NA 4YT0B 2KC2A 1SSNA 2MJDA 5BYSA 1TS3A 3ML9A 1WWTA 1J0GA 3V60A 2JX5A 2HJ1A 3CSTA 3C0RB 3R7RA 2INPE 1BUIC 1WXMA 4PYUA 1RFKA 3N9YC 1QKZA 4F7ZA 4A6QA 1WGRA 2ON8A 1FIQA 2DWQA 2K25A 4HWIB 3LB8C 5JHBA 2KDIA 1JWUD 1C76A 3P42A 4OVUA 1PFDA 1FEHA 5L95C 3DBHI 2QEJC 2Z59B 2QILA 2MBHA 4DHJD 4P16A 4W9HA 3BVZA 4YL8A 3DQVA 2NTTA 2EMTA 4NZLB 4CQNA 1N5WA 5BMIA 3AE6B 3PSEB 3BYYB 4JWSC 2FAZA 4URKA 1QQRA 2DZKA 2ZNVC 1WE6A 3DBSA 2LVQA 3T3OA 3JYUA 2ZNVB 2MQJA 2WXQA 4GLSC 4BKSD 3AE5B 1AW7A 2XNAC 2WHIA 2CU3A 2AQ1B 4AWJA 2DNFA 4KIKA 2WDRB 1FCLA 1TTNA 3FKYA 1N60A 2GB1A 2WU5B 1FFUA 1YQBA 2GRIA 3NJTA 2KTRA 2E6XA 2PPHA 3P4RB 4BAXA 3L17A 2JF5A 2GLSA 3X0WA 1N62A 4LNOA 1D3ZA 3AE2B 1F2RI 1TKGA 2YLMA 5AZHA 2LHDA 1QT9A 2I38A 1WR6E 1C78A 5E6JA 4TQ0A 1Y8RC 3AM9A 1SJHD 4A20A 4YSYB 3Q2AC 1V5TA 1LGRA 4DDID 3ZYYX 2WXJA 2IPKD 1WXVA 1K50A 5G5HA 4NY0A 3QK0A 1MG8A 3VR8B 2WXIA 2IY0B 3D32A 4IM0A 4PS8A 3ZDTA 1DYQA 5CTRC 3AU4A 4K3CA 3LDZE 3ZDMC 4RM8A 2JU6X 3KWVA 1IGDA 5DCNA 1KFYB 1FNVA 1V1PB 4YTPB 3DVNU 1VDVA 2JSVX 3ZXVA 4YSXB 1QOAA 4G11A 1ZP0B 2J0JA 4IG7B 3NG0A 1CMXB 3FILB 1U4AA 1WH3A 2D3BA 2KLCA 3UQBA 1HA5A 1V86A 2Z0EB 4WWPA 3ZNZB 1VJKA 5HG2A 4IUMB 3V62A 1E7VA 3H8HA 1I4HA 1VRAB 2JVCA 4PS3A 4IKGA 1ZDXA 2WWZA 4HDOA 1LM8B 1E6EB 2MEKA 4HJGE 4RCOA 1C77A 1X1MA 3AB5A 1XXGA 4MM3A 4N9F4 1ACCA 3RT3B 2LEKA 1GB1A 2JWZA 3RPFC 3Q8AA 2J42A 4DQOC 3AN1A 4DHZB 5IA7A 2MBBB 4FHKA 1QF6A 2BQQA 2I2YA 4N58A 1OGWA 3TEXA 2INDC 4IC7B 3H6NA 4USAA 5C1ZA 1QILA 4A3PA 2WNMA 3TEZA 2KOXA 4CYEA 2K9XA 5JXVA 2K8HA 4E71A 1N6ZA 2KFKB 2OHFA 4YXDB 3BVMA 2G3QB 3N1XC 2A5UA 3ABVB 4K3BA 1OEYJ 1WF9A 2JYTA 2RSUA 3GS2A 1I4XA 5CHVC 1P1AA 2PMVA 2RR9A 1WRIA 2J0MA 2W3RA 5EE1A 2WDQB 3CWIA 1UNSA 5LLIA 2MRPA 3W1YA 1YJIA 4OZCA 2J7QB 4EZJA 1HE8A 3Q3NC 3A9JA 1N5XA 4KKJA 3OJ4B 3Q3OC 1C4CA 2O2VB 2IJ0A 1AN8A 1SGHA 1XCQL 2ZZPB 4S17A 5GXGB 5H8YE 3WAMA 4XE0A 5BMGA 3ZTDA 3DVGX 4LNKA 3KUCB 3RCZA 1ISNA 4KIKB 3EFUA 4MELA 2MJ3A 4B6WA 3ZLZA 4RGNA 3PHXB 3BZDB 2K8BA 4LDTD 3U52E 2JRHA 3L10B 2L05A 4LLGM 1WJUA 1SXTA 2N7DA 3HVZA 4M00A 3MHZA 5L83A 3P4SB 2KMAA 4FJYA 5LNK1 1J8CA 5G5GA 4OVVA 3KH0A 2ACZB 2C7HA 1FNUA 3FC4A 5AUKA 2AX5A 2PW9A 1FXIA 2JY6A 2KMCA 2WP9B 3QWZB 2JXXA 4A8XC 1EM7A 2INNE 3EECA 4N6EB 1FM0D 4MSMB 5TR5A 2MJEA 5HI1A 3AI5A 3HRDD 1YX5B 1V49A 2KJRA 4HROA 1D5MC 2FCNA 1Q5WB 1TT5B 4MT5A 2QMTA 4TQ1A 1T0YA 3NVYA 1V1OA 3MC0B 1ZUD2 3MFGA 4XX5A 4PYZA 3MHSD 3DHHC 5BYRA 2OOBB 1OFFA 3AV8A 3VH4B 4LNIA 2ASQA 1B1ZA 4WWOA 1SE3A 2KDBA 4JPSA 4OHJA 3U7DA 5IAAC 2KWDA 3UIOB 4RM9A 3NOBA 2L0FA 2KACA 3W5VB 1XF5L 2DYBA 3B9JA 1TJEA 3AE7B 5AZFA 3O65B 2RPVA 4AUQC 1SB3C 3AXCA 3RNAC 5BO4B 1YIWA 2FBWB 2KANA 4ZRKA 5J2RA 2EKEC 1YNTE 2VRRB 3TJPA 2L52A 1NI3A 4GXBA 2R61A 3PV1A 1NYRA 1P3QU 3SFEB 4C80A 3K9OB 3NHEB 4RGMA 2LGYA 4DK5A 4A55A 4MM3B 4ZHPA 1JW9D 2GBRA 3MP9A 4AP4C 1A5RA 3KW5B 2KDMA 1SIJA 4L1BA 3DBRB 1DOIA 2K6QA 1VR9A 1WIAA 2OJWA 3R2TA 2Y3AA 4ZYNA 1PYWD 3QAQA 4WJQA 4EE2A 2M19A 1MVKA 2ZCBA 2LVPA 4J6IA 1Z5SB 4FBJB 3CF6E 2D3AA 3M3JA 1J7BA 4C7ZA 2LJIA 3HVDA 3ZJVA 4NPNA 1RWSA 2GOWA 1BXTA 3DBLI 2BKFA 4IWQA 3ZIMA 2BBCA 1F77A 2LUEA 5EDSA 3Q8FA 2MBQA 1ZOYB 2KT7A 2D2QA 4WQMA 4P1CC 3VR9B 2FCQA 2CHWA 2N1VA 1OTRB 3AE3B 2NS5A 1WX7A 3H7PB 3A9JB 5MPOA 1TY0A 2LGSA 3NVZA 1E90A 2KC1A 5IOIA 4XYCA 2DHZA 1BT0A 5C2TB 2LZ6A 3P1MA 1T6BX 3UGBB 2LMCA 2H89B 4B0EA 4EOYA 2NBUA 2N7EA 1V9JA 2E3TA 1AARA 1EU4A 1QZEA 2DZIA 4II3B 1WSPA 4B0MA 2LWPA 3KUZA 3RYTA 1GC6A 2G45B 4HRSA 2D11A 2ZVOA 3OWEB 2KFJA 4HXDA 2H88B 1WM3A 2L76A 3ZXRA 3NS1A 1R4NI 3URYA 5DPWA 4JL9A 4US8A 2PJHA 2UU7A 2NBVB 3A4SC 3FILA 3VUXA 4P6VF 2YEPF 1AYFA 2MLBA 2LD9A 1MI0A 3RUIB 4AQ7A 2PVOD 1RRBA 2CU1A 4IM2A 5AZGA 4GU2A 1N63A 4FLHA 4DXFA 3B2FA 4QAYA 2INCC 4S0RA 2D07B 3WCQA 1SJED 4W9JA 2IGDA 2EMSA 3DCGA 1FCCC 1MPEA 3WANA 4RGOS 2BTEA 4DHZE 1LO5D 2I1KA 3NZSA 1UWXA 1NI2A 1F52A 1QOGA 2N1WA 1YD8U 1ESFA 3RNEC 4EEWA 1UELA 3VTVA 4MDKE 1ENFA 2KNBA 2M1MA 4FN2A 4M01A 1WI0A 2LFIA 3ZUNA 2KFKA 2WXRA 2G4SA 1VZ6A 1KLUD 1E8ZA 1T0RC 3V61A 4GDLA 3RMKC 2AYOB 4KGTA 2JPHA 3GZNI 2VH1A 3ZNID 2DX5B 2WX0A 2IO2B 1K8RB 5D94A 2IGHA 2K1FA 2W54A 1XD3B 1K52A 2LGIA 4HDQA 2C60A 4W9GA 1YN4A 5FKAC 4WJNA 1IP9A 2AWTA 3AEDB 4BKGA 2O2VA 1XO3A 3P4QB 4K7SA 1FMAD 2ZPYA 4W9IA 4ICUA 4ARIA 1HEZE 2ZW1A 1FPYA 3NRZA 2MWSB 2BS3B 2QCZA 4I6LB 1WGGA 1WXQA 4IW0A 3RFZB 3R8BA 1WM2A 5GMVA 3KLSX 5JH5C 1T0QC 1C9FA 2J52A 3PGEA 3SU8X 1JWMD 1BMLC 2DBYA 4ASWC 1IUEA 3AEBB 3EHVA 5AEKB 2M56B 3ZNHB 2KX3A 4MGZE 2N9XA 4ZHOA 3VRBB 3T8MA 1V97A 3DOWA 2BWFA 2KJHB 1L2NA 4GB9A 3VAWA 1DOXA 4K1RB 4TSSA 1UD7A 3QA8A 2CJNA 4EZLA 1RLFA 2DZMA 3WAOA 4O1NA 2JZPA 2IYDB 2BKRB 3HM3A 3OG5A 3ZKJC 2VH2A 1K53A 2Y5PA 2KWCA 3APDA 4IOIE 4RMAA 2WXHA 3ZTCA 3RNGC 3R7QA 2REXA 3DVNV 1E7PB 1SE4A 1YX6B 2NR2A 3CIRB 3C8YA 5KHOA 1JWSD 3KWLA 2C5LC 1TYGB 4LJOB 4H2AA 2KO3A 2Y5BB 4W9CA 1WRDB 5D7GA 1Y56A 2LJ5A 4HKZE 2KD0A 3JW0X 1WZ3A 1J7AA 1ZKHA 4REZA 2L32A 2PTLA 2ZPNA 2WDVB 1WX8A 2N7JA 4KSLC 1JWBD 2D10A 4G0NB 4AOFA 4BBNC 1TIFA 1TGZB 1CK1A 5IKCM 2D3CA 3B0AA 4JX1C 1E10A 4OZAA 1I4GA 2EELA
chains in the Genus database with same CATH topology
5T8IA 1TY2A 2B76B 4J3OD 1I4RA 2QMTA 4MT5A 3IAS1 1XEEA 3NVYA 4NAWB 1V1OA 4TQ1A 3MC0B 3V05A 4ZRQA 1ZUD2 3MFGA 1ZPSA 3AEEB 4KX6B 4OW0A 1L6UA 1YMHE 5BYRA 4WIPA 2XN9C 1OFFA 2LUMA 3AV8A 3IT6B 3W9CB 1SBBB 1B1ZA 2ICIA 4ITKA 4ZRPA 2BW2A 2JXTA 2SAKA 3GB1A 1SE3A 1L5PA 4YSZB 1NEKB 4JPSA 4OHJA 1N61A 2KWDA 1XLPA 1RM6C 3AE1B 1AWDA 2Q5WD 2BB5A 2KACA 3W5VB 3U7ZA 4GDLB 2NMQA 1XF5L 4L23A 2WQYB 4WH4A 1V1PA 3B9JA 3DWGC 1TJEA 2MH7A 3AE7B 4KGSA 1YQ4B 4Q2JA 1NYQA 2BS2B 2PLPA 4ZYSA 2RPVA 3TEYA 3BYTB 5HHDG 1SB3C 4RGTA 3FAHA 1D5XC 3B2GA 2FBWB 2QSDA 1ZXIA 3O13A 1YNTE 4YTNB 5EE9A 3PO0A 2WLBA 2L52A 5D3DA 1NI3A 1VZ7A 3NVWA 1I4QA 3EGRA 2R61A 1L4DB 3MJ5A 1NYRA 1KRHA 3SFEB 4C80A 4RGMA 2K22A 5I4DA 3P63A 4A55A 1TKEA 2WXFA 4TMAB 1UGJA 4MM3B 4ZHPA 3Q8CA 1JW9D 3P4PB 3MP9A 2Y5CA 1RYJA 3ZJUA 2V3NA 2DYMA 4YT0B 5BYQA 4A9AA 3VQIA 2WS3B 2TSSA 2KDMA 1SIJA 4L1BA 1VLBA 1DOIA 1SSNA 2MJDA 5BYSA 1TS3A 1NENB 1VR9A 2WXLA 1FXAA 1WWTA 3IT4B 4YTMB 3SFDB 1PUTA 1V8CA 2JX5A 2LHEA 3R2TA 3NVVA 2Y3AA 2BYTA 1PYWD 2INPE 1BUIC 3IAM1 1A70A 4EE2A 2QJLA 2M19A 1RFKA 1FFVA 2W82A 3N9YC 3W2DA 1JQ4A 1MVKA 1QKZA 2HDEA 5EE3A 2KMMA 3BK2A 3AEAB 4M0WA 4A6QA 3J9CA 1J7BA 4UDUC 3VRAB 2ON8A 1FIQA 1OQQA 2DWQA 2W55A 3IXSA 1XLOA 2LJIA 3LB8C 4C7ZA 4AS1A 3HVDA 1JWUD 1ZXHA 3ZJVA 1C76A 2JYEA 1RWSA 3P42A 1PFDA 1FEHA 4RFBA 1BXTA 2QEJC 1EU3A 2K3UA 4XWTA 1SEBD 2QILA 2RDGA 4A90A 2BBCA 2K5PA 1F77A 1TS2A 3LXFA 2PKOA 3Q8FA 4P16A 1YQ3B 1ZOYB 3BVZA 1I7HA 4D2KA 3ETRA 4WQMA 2L1AA 3VR9B 2NTTA 2L83A 3AE3B 3DWMA 4RF0A 1FO4A 4NZLB 4CQNA 1B9RA 1UUPA 5MPOA 1TY0A 1N5WA 5BMIA 3NVZA 3AE6B 1KLGD 3BYYB 4JWSC 1XCTL 5C2TB 5C3JB 3P1MA 1T6BX 1QQRA 4RNAA 1JRPA 2JWUA 2AQ2B 4R3DA 3BK1A 4IDIA 2LMCA 3E9SA 1SE2A 4C56C 2H89B 1JMLA 4B0EA 3T3OA 1JCKB 2E3TA 2WXQA 1EU4A 4GLSC 1NVID 1IBXB 2IGGA 1WSPA 3AE5B 4B0MA 1C79A 1AW7A 2XNAC 1L0YB 2CU3A 3PZ7A 2AQ1B 2W3SA 1SF0A 4HRSA 3OWEB 2WDRB 1FCLA 2G1EA 2ZW0A 2WXNA 1N60A 1Q10A 1FFUA 2GB1A 2GRIA 2H88B 2WU5B 3Q69A 2E6XA 3TUOA 3BWUD 3NS1A 3P4RB 3URYA 1QOFA 2ONQA 5D3IB 1OQRA 2RMMA 4US8A 1N62A 3AE2B 3FILA 1F2RI 1D5ZC 4P6VF 1PGAA 2KQ4X 2YEPF 4FXCA 3AEGB 2KN4A 1AYFA 1TKGA 2N9LA 4N59A 1ET9A 1MI0A 2QIEB 4AQ7A 2LHDA 1QT9A 2PVOD 3NUHB 2I38A 3V3XA 1C78A 5FR3A 5E6JA 4TQ0A 1L0XB 1HQRD 4JWUC 1N63A 2J53A 1EWYC 2KAJA 4DXFA 3AM9A 1SJHD 2J4XA 4OVZA 4YSYB 5AUIA 3W1SA 3B2FA 1EWCA 1JALA 4MH8A 4LK0M 3WCQA 1SJED 2IGDA 2FE8A 3EUB2 3ZYYX 2WXJA 3EA6A 3Q8EA 1DOYA 1FCCC 2HTME 1MPEA 2IPKD 3I9V1 4RGOS 2BTEA 2DLBA 3AEFB 1K50A 5G5HA 5BMHA 3E56A 3T3NA 1LO5D 2D5GA 1CJEA 3AE8B 3VR8B 1UWXA 1QOGA 2WXIA 3TSSA 4NAMA 2VZKB 1TKYA 1DYQA 3SEBA 1ESFA 1KF6B 1FRRA 2WU2B 4PT5A 1CZPA 1MHXA 2YEPB 1IGCA 1TS5A 2JU6X 1D6EC 1ROEA 1ENFA 3KWVA 4GDKB 1IGDA 3KQ4A 1KFYB 1FNVA 2G9HD 1V1PB 1GOZA 4YTPB 1VDVA 4KKIA 5HFYA 2LFIA 2JSVX 2WXRA 1DGJA 1HZ5A 1TZOA 1VZ6A 4YSXB 1KLUD 1QOAA 1ZP0B 3HUIA 5EE0A 4ARCA 4KGTA 3FILB 2SEBD 1C4PA 1XLQA 1PDXA 1M4VA 1FRDA 1PGBA 4XDDA 1HA5A 1GAQB 2Z8LA 1VJKA 5HG2A 2IGHA 5FK9C 1R7SA 2W54A 3H8HA 1I4HA 1K52A 2LGIA 1VRAB 2PVGC 1PGXA 4IKGA 4KGRA 1ZDXA 3I57A 3ZQ4A 1K51A 1E6EB 2MEKA 4HJGE 1QLBB 4RCOA 1C77A 1YN4A 4MACA 5FKAC 3AB5A 1XXGA 4ZOHC 3AEDB 1ACCA 2LEKA 3BVGA 1XO3A 3NZ3A 1GB1A 3P4QB 3RPFC 3Q8AA 2J42A 4DQOC 3AN1A 1FMAD 2EKIA 3AMZA 3AECB 4ARIA 1HEZE 1QF6A 2ZW1A 2V4IB 2WXPA 1L6VA 3U4EG 3NRZA 2I2YA 4N58A 1L0VB 5TSSA 2BS3B 1CQVA 3TEXA 2V0GA 1I4PA 1YN3A 3AE9B 4USAA 1QILA 2WNMA 2N0SB 1WXQA 1KTKA 3TEZA 1STEA 3R8BA 3RFZB 2X38A 3PZ8A 3KLSX 2K9XA 5JXVA 2V3PA 1VZ8A 1QOBA 1C9FA 3UI3A 2OHFA 4NJCA 2J52A 4YXDB 3BVMA 3AH7A 3TEWA 1JWMD 1BMLC 4XWWA 2DBYA 2WXOA 3ABVB 4US9A 1E9MA 2JYTA 1IUEA 1KH0A 3AEBB 1P7FA 2M56B 3GS2A 1FD6A 1I4XA 1D4BA 1TS4A 2PMVA 2WXGA 1ZE3D 1HXYD 1WRIA 2WXKA 4ZHOA 2M0AA 2WXMA 3VRBB 2W3RA 4HKQA 5EE1A 3SR6A 2WDQB 1V97A 3CWIA 1UNSA 1C4AA 2BB6A 3Q8BA 1DOXA 2CJOA 1YJIA 4TSSA 4OZCA 4C7YA 1JWAD 4L2YA 1GB4A 2CJNA 1YJJA 3ZGZA 1XLNA 4O1NA 1N5XA 2IDYA 4LTUA 2NTSA 2OEDA 1FNWA 4KKJA 1C4CA 2JZPA 2IJ0A 1AN8A 1F2RC 1K53A 1XCQL 3L4PA 2Y5PA 3LYYA 5GXGB 5H8YE 4XE0A 5BMGA 4IOIE 2WXHA 4RF1A 1ET6A 3R2IA 2VZKD 1GPXA 1E0ZA 4WURA 5H92C 4WWMA 1MHHE 4DXGA 2BT6A 1IBXA 2JQRB 3AE4B 4OZBA 1E7PB 1SE4A 2MJ3A 3CIRB 3GP7A 2PIAA 4RGNA 3C8YA 3BIID 3BZDB 4YWGG 1JWSD 3U52E 1P7EA 3KWLA 4LLGM 1T3QA 1SXTA 1TYGB 4HEA1 3HVZA 3MHZA 3P4SB 4H2AA 2K0PA 4JE3B 1L4ZB 2N9KA 2RDHA 5LNK1 5G5GA 2DYOA 5D7GA 1Y56A 1J7CA 2ACZB 3W5UB 1FNUA 2AQ3B 4HKZE 1ZDVA 3FC4A 2AX5A 4WAFA 2PW9A 5AUKA 1J7AA 3ZJTA 4RH6A 1FXIA 1HZ6A 2WP9B 4REZA 2L32A 2PTLA 4A8XC 2WDVB 1EM7A 2INNE 2N7JA 4N6EB 1FM0D 1UWMA 1JWBD 2BS4B 1YN5A 2MJEA 1JROA 1T5XD 5HI1A 1WGKA 3HRDD 1F0ZA 1CK1A 2GI9A 1WYGA 4JX1C 1E10A 4HROA 4OZAA 1I4GA 1D5MC 4XDCA 2FUG1 3U2SC 2EELA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJE D;  4RFB A;  1BXT A;  3BVM A;  2QEJ C;  1TY2 A;  1EU3 A;  1I4R A;  1SEB D;  3EA6 A;  2QIL A;  1JWM D;  2IPK D;  2RDG A;  4RGO S;  1V1O A;  1F77 A;  3MC0 B;  3V05 A;  1TS2 A;  3MFG A;  1LO5 D;  1I4X A;  3BVZ A;  3TSS A;  1TS4 A;  2XN9 C;  1SBB B;  1B1Z A;  1HXY D;  2ICI A;  1DYQ A;  3SEB A;  1ESF A;  1SE3 A;  2NTT A;  1UNS A;  4OHJ A;  1TS5 A;  4NZL B;  1D6E C;  1ENF A;  1UUP A;  1TY0 A;  1FNV A;  2G9H D;  4TSS A;  1V1P B;  1GOZ A;  1KLG D;  3BYY B;  1V1P A;  1KLU D;  4O1N A;  2NTS A;  1FNW A;  2AQ2 B;  2IJ0 A;  1AN8 A;  4C56 C;  1SE2 A;  4ZYS A;  3BYT B;  2SEB D;  4RGT A;  1JCK B;  1ET6 A;  1M4V A;  3R2I A;  1D5X C;  1EU4 A;  1HA5 A;  3O13 A;  2Z8L A;  1AW7 A;  5D3D A;  2XNA C;  5FK9 C;  4DXG A;  1L0Y B;  2AQ1 B;  1I4Q A;  2R61 A;  1I4H A;  1SE4 A;  3OWE B;  3GP7 A;  4RGN A;  4RGM A;  5I4D A;  3BZD B;  1JWS D;  1SXT A;  4RCO A;  1YN4 A;  5FKA C;  1XXG A;  3URY A;  5D3I B;  2RDH A;  3BVG A;  2TSS A;  1FNU A;  1TS3 A;  2AQ3 B;  1D5Z C;  3R2T A;  4RH6 A;  1PYW D;  1ET9 A;  3W2D A;  5TSS A;  1CQV A;  1YN5 A;  1I4P A;  1YN3 A;  1T5X D;  1QIL A;  4UDU C;  1CK1 A;  1L0X B;  1HQR D;  1KTK A;  1STE A;  3R8B A;  4DXF A;  3KLS X;  1SJH D;  1JWU D;  2J4X A;  1I4G A;  1EWC A;  1D5M C; 
#chains in the Genus database with same CATH topology
 2L0T A;  1TY2 A;  2B76 B;  3IAS 1;  1XEE A;  1KM7 A;  3VDZ A;  1ZPS A;  2V1Y A;  4KX6 B;  1L6U A;  4WIP A;  2LXA A;  3IT6 B;  3W9C B;  2BW2 A;  1N61 A;  1YJ1 A;  2CR5 A;  2KTF A;  1UF0 A;  2MBO A;  4GDL B;  5DPT A;  1IYF A;  3PRP B;  2CHX A;  4LCD E;  2KWV B;  1YQ4 B;  1NYQ A;  2PLP A;  3OAW A;  2ZVN A;  3WA0 A;  5HHD G;  2O6V B;  4RGT A;  3JSV A;  3ZW3 A;  1D5X C;  1V5O A;  2QSD A;  1EF5 A;  1WZ0 A;  5EE9 A;  2WLB A;  4XGA B;  3I3T B;  1T0S C;  3VH3 B;  3NVW A;  1I4Q A;  1L4D B;  4WJO A;  3H7P A;  2IO3 B;  3ECI A;  5KHQ A;  3ZRF A;  2K22 A;  2AEH A;  3VXW A;  4TMA B;  1UGJ A;  2HE7 A;  3P4P B;  2W9N A;  3ZJU A;  3IVF A;  3VQI A;  2TSS A;  5HKH A;  1VLB A;  4GN1 A;  3A1Q A;  1NEN B;  2WXL A;  1FXA A;  3Q3F A;  3SFD B;  1PUT A;  2LHE A;  3NVV A;  2BYT A;  4LNF A;  1WX9 A;  3P2B A;  1A70 A;  3SD5 A;  1FFV A;  2W82 A;  5EE3 A;  2RPQ A;  2KMM A;  4IWO A;  2HTH A;  3ENE A;  3J9C A;  4X57 B;  4AS1 A;  1XLO A;  3NZU A;  2RGF A;  4RFB A;  3TMP B;  1EU3 A;  2K3U A;  2KJ6 A;  4LNN A;  4A90 A;  2NVU I;  2K5P A;  2L00 B;  2YVC A;  1V81 A;  4NQK E;  4ZDV A;  2M17 A;  2WYQ A;  4W9K A;  1I7H A;  3U8Z A;  2L1A A;  1WE7 A;  3IHP C;  4C00 A;  4NJ7 A;  3CMM B;  2B3A A;  4FUL A;  2LGX A;  4HVB A;  2LRW A;  5C3J B;  2FID A;  4RNA A;  1JRP A;  2KDF B;  4MGK E;  2AQ2 B;  4R3D A;  3BK1 A;  3E9S A;  1SE2 A;  1P9D U;  1JML A;  3KVF B;  2MW5 A;  2OJR A;  4MJS B;  3DBL B;  4HLE A;  2W3S A;  3N20 C;  3PRM B;  2WDT B;  4M0W B;  2UYZ B;  2FNJ B;  3PLV A;  2ZW0 A;  3AUL A;  1Q10 A;  2JUO A;  3GE8 C;  3Q69 A;  2J0K A;  4EUT A;  3TBL D;  4KVG B;  3PS6 A;  3S2A A;  4BZA A;  1QOF A;  2ONQ A;  5D3I B;  2RMM A;  2N4F A;  3UIN B;  1PGA A;  3R66 C;  2KN4 A;  4N59 A;  1ET9 A;  3QJZ A;  2QIE B;  2GBM A;  4NJ6 A;  2BPS A;  4EZK A;  3NUH B;  3AU5 A;  4TKN A;  4W9D A;  3VHT C;  1L0X B;  3L16 A;  4JWU C;  2KAJ A;  3W1S A;  2J4X A;  4OVZ A;  4ACF A;  4MH8 A;  4EKU A;  1TZ1 A;  2FE8 A;  2JZZ A;  3I9V 1;  3QHT A;  3AEF B;  4FHJ A;  4MEM A;  3EC8 A;  5BMH A;  3E56 A;  2R2Q A;  1EUV B;  1CJE A;  2BVC A;  4NQL B;  3AE8 B;  4NAW A;  1R4N B;  2VZK B;  2QC8 A;  1TKY A;  4HK2 A;  1KF6 B;  1FRR A;  4WQO B;  4PT5 A;  3RNB C;  1CZP A;  2KN5 A;  2XEW A;  5JZE B;  1P0R A;  1D6E C;  1ROE A;  4GDK B;  4KSK C;  5HFY A;  1I42 A;  2FUH B;  4MSQ B;  1TZO A;  1WJ4 A;  4P7I A;  3NS8 A;  3M63 B;  3JSV B;  5D6J B;  1C4P A;  4KZ0 A;  4ZRJ A;  1PDX A;  4IWP A;  1M4V A;  2DEN B;  1PGB A;  1GAQ B;  1GUA B;  3RUL A;  2PVG C;  1PGX A;  1MJD A;  4KGR A;  4G50 A;  1MFW A;  3Q3J A;  1LFD A;  1QLB B;  2KQS A;  3C19 A;  3A1Q B;  4ZOH C;  2JRI B;  3ALB A;  4LJP B;  3RNC C;  1C3T A;  1VCB A;  3NZ3 A;  2MP2 A;  1WXS A;  2EKI A;  3DBH B;  3AMZ A;  3AEC B;  2BYE A;  3CSF A;  2V4I B;  1WMH A;  5TSS A;  2HD5 B;  3U30 A;  1I4P A;  2N0S B;  1KTK A;  1FXT B;  4GGQ A;  2XK5 B;  3PRZ A;  1WGD A;  4K7W A;  1QOB A;  3UI3 A;  3QQ8 B;  4NJC A;  2I1J A;  2CHZ A;  1R4M I;  3ML8 A;  4XWW A;  2WXO A;  4US9 A;  2L3Z A;  1KH0 A;  1D4B A;  2R2O A;  4HPM B;  1WJ6 A;  4GMV A;  1ZE3 D;  2M0A A;  4HKQ A;  3SR6 A;  3OJ3 A;  1C4A A;  1Q0W B;  1WR1 A;  3K9P B;  4ZRI A;  2ZCC A;  3L13 A;  3Q8B A;  2CJO A;  2KQ7 A;  5CX3 A;  1JWA D;  4KDI C;  4L2Y A;  1KOT A;  1F1H A;  3ZGZ A;  1UBQ A;  3V6C B;  4DDG D;  1XLN A;  3DPD A;  4LTU A;  2NTS A;  1FNW A;  3VTU A;  3HK0 A;  1F2R C;  3L4P A;  4RF1 A;  1ET6 A;  3Q6B A;  1GPX A;  2CS4 A;  4WUR A;  3A4R A;  3N32 A;  5H92 C;  1E8W A;  5DPS A;  3N1Z C;  2BT6 A;  4DXG A;  4I6P A;  4WJP A;  3A9K A;  2G4D B;  3IFW B;  1KJT A;  2X8X X;  3AE4 B;  5IN7 A;  3RN9 C;  4BOS C;  1IBX A;  2MBE A;  4DWF A;  5LXH A;  4BOZ B;  4PS7 A;  3H1U A;  4F8C B;  3BII D;  4ICV A;  3VUY A;  4B95 A;  5G2N A;  3UF8 A;  1MG4 A;  1M94 A;  2K0P A;  2N9K A;  2RDH A;  3W5U B;  1J7C A;  2GBJ A;  2AQ3 B;  2O6V A;  3ZVV A;  5DPR A;  4WAF A;  3ZJT A;  2KDE B;  4DHJ B;  1HZ6 A;  3MC9 A;  3W1S C;  1JRO A;  4C4V A;  1F0Z A;  3PPA A;  4PK1 A;  1UBI A;  2MHJ A;  4FA6 A;  4ANW A;  4AJW A;  2KX0 A;  4M8M A;  2FUG 1;  2PEA A;  2LGD A;  2A4Z A;  2FCS A;  2GMI C;  1I4R A;  4NAW B;  4ZRQ A;  1JRU A;  4XZ4 A;  3AEE B;  3VVW B;  3DHG C;  5IP4 D;  1YMH E;  2MX2 A;  2C7M B;  2LVO A;  2ICI A;  3BY4 B;  4ITK A;  4ZRP A;  1F9J A;  1PQS A;  2JXT A;  2WGS A;  1E8Y A;  1L5P A;  4YSZ B;  1NEK B;  4HCP B;  3I63 C;  3RI7 C;  1XLP A;  5IO9 A;  2BYF A;  2Q5W D;  2BB5 A;  3U7Z A;  3L0W B;  2D3G A;  2NMQ A;  4L23 A;  4WH4 A;  2WQY B;  4K81 A;  3QC8 B;  2JZ3 B;  4GSW A;  1G6J A;  3DWG C;  1WYW B;  2MH7 A;  2KYW A;  5CHW A;  4Q2J A;  2UWQ A;  3TEY A;  5E6N A;  3OLM D;  4P1B C;  3SDL C;  3B2G A;  1S3S G;  4YTN B;  5D3D A;  3LJ3 A;  1VZ7 A;  2NBW B;  1I35 A;  1E7U A;  1KRH A;  1VD2 A;  1OEY A;  3IG3 A;  1E8X A;  5I4D A;  3P63 A;  1WJN A;  1TKE A;  1HTQ A;  3GE3 C;  3Q8C A;  1V80 A;  1ZGU B;  3KUD B;  2MP2 B;  4JLC A;  2DYM A;  5BYQ A;  4A9A A;  2RD0 A;  2NPT B;  2WS3 B;  2CKH B;  1V6E A;  3IT4 B;  2K39 A;  3NY5 A;  4YTM B;  1V8C A;  1WMH B;  3Q3M C;  3KYD D;  4MJS A;  3IAM 1;  2QJL A;  2K6D B;  4FAD A;  3W2D A;  1JQ4 A;  2C7N B;  1LQB A;  2HDE A;  2KVZ A;  2M8S A;  4AJY B;  3BK2 A;  3AEA B;  4M0W A;  4B9K A;  3VRA B;  4UDU C;  1OQQ A;  2W55 A;  3IXS A;  1ZXH A;  2V3S A;  1WFY A;  1Q1O A;  2JYE A;  3R3M A;  4TV3 A;  4HPL B;  2BF8 B;  3PRE A;  4XWT A;  1HTO A;  1SEB D;  2RDG A;  3H9D A;  1TS2 A;  3LXF A;  2PKO A;  1GNU A;  2KKC A;  1YQ3 B;  4W9E A;  1P98 A;  4D2K A;  3ETR A;  4GIV A;  2IBI B;  5J17 A;  2L83 A;  3PLU A;  3WAP A;  3DWM A;  4RF0 A;  2DAF A;  1FO4 A;  4JQW C;  1B9R A;  1UUP A;  3DHI C;  1KLG D;  1XCT L;  3PVL A;  3HHM A;  2JWU A;  4II2 B;  4IDI A;  4C56 C;  1L7Y A;  1H4R A;  3ZRC A;  1E5W A;  5C23 A;  5J18 A;  1JCK B;  2FIF A;  1NVI D;  3A9K B;  1IBX B;  2IGG A;  1UZX B;  1C79 A;  2IO0 B;  2JT4 B;  1L0Y B;  3PZ7 A;  1SF0 A;  1IPG A;  4GDK A;  2G1E A;  2LI5 A;  2LXC A;  2WXN A;  2M4N A;  2BYV E;  2FCM A;  3IBE A;  4HPP A;  3QIJ A;  3TUO A;  3BWU D;  2BWE S;  4WAA A;  4GOC A;  2KZR A;  3SHQ A;  1OQR A;  2BGF A;  3L08 A;  2HJ8 A;  2O6V D;  3T9L A;  1D5Z C;  4FXC A;  2AL3 A;  2KQ4 X;  3AEG B;  4KV2 A;  3UQA A;  2N9L A;  4EFO A;  2GBN A;  2N9P C;  4C4V B;  3KYC D;  4NNJ B;  3V3X A;  4JIO U;  5E6P A;  5FR3 A;  2L7R A;  3WIM A;  4CO7 A;  1HQR D;  4DXA B;  2J53 A;  1EWY C;  5AUI A;  3RZF A;  1SIF A;  1EWC A;  1JAL A;  4LK0 M;  1WY8 A;  4G3X B;  1LXD A;  1GC7 A;  3EUB 2;  3EA6 A;  4I6N B;  3Q8E A;  1DOY A;  2HTM E;  3BIN A;  2DLB A;  4TUU A;  3T3N A;  2D5G A;  3TSS A;  4NAM A;  3RNF C;  3I5J C;  1KLV A;  3SEB A;  4BVU C;  2WU2 B;  1MHX A;  2YEP B;  3VTW A;  1IGC A;  1TS5 A;  2PE9 A;  3KQ4 A;  2XK5 A;  2G9H D;  5CHF A;  1GOZ A;  4KKI A;  2KTR B;  4LDT B;  2K8C A;  1DGJ A;  1HZ5 A;  2MSE D;  2DZJ A;  4HJK A;  2MCN B;  1GJZ A;  4KZC A;  3HUI A;  4A3O A;  4JGH B;  2DAJ A;  3M62 B;  5EE0 A;  4ARC A;  2SEB D;  3DVG Y;  1XLQ A;  2ZEQ A;  1FRD A;  1RAX A;  4XDD A;  2Z0D B;  2Z8L A;  3QCA A;  4MGI E;  4MGY E;  5FK9 C;  1R7S A;  2PE6 B;  4F1S A;  1NBF C;  3I57 A;  3ZQ4 A;  1K51 A;  5JHA A;  3TCA A;  4MAC A;  1WXA A;  4ANV A;  2XBB C;  1UGM A;  3N3K B;  1NDD A;  3BVG A;  3V6E B;  4MH0 E;  3VFK A;  1S1Q B;  2WXP A;  1L6V A;  3U4E G;  1L0V B;  1CQV A;  3RD2 A;  2V0G A;  1YN3 A;  3AE9 B;  2KVR A;  4HCN B;  1J19 A;  1STE A;  2X38 A;  3PZ8 A;  3RZW C;  2IO1 B;  2M0X A;  2V3P A;  3X23 A;  1VZ8 A;  3B08 A;  5E6O A;  3B1L X;  2KHW B;  3AH7 A;  3TEW A;  3L54 A;  4FJZ A;  1E9M A;  1EF1 A;  5D2M B;  1P7F A;  2IZV B;  1FD6 A;  3APF A;  1TS4 A;  2WXG A;  1HXY D;  2WXK A;  2WXM A;  3GOE A;  3ONS A;  2C9W B;  2BB6 A;  4KDL B;  4DBG A;  4C7Y A;  1GB4 A;  1YJJ A;  1YOV B;  2LAS A;  2NCN A;  3MC8 A;  2RDB C;  2IDY A;  1C1Y B;  2OED A;  1XT9 B;  2GBK A;  3A33 B;  3LYY A;  3R2I A;  2VZK D;  1E0Z A;  4BKS A;  4WWM A;  1MHH E;  1R4M B;  1ZW7 A;  3TIX A;  2JQR B;  3H7S A;  4OZB A;  4BBN F;  1WGH A;  3Q14 C;  2KLG A;  4XC2 A;  3GP7 A;  2PIA A;  2KWU B;  3WAL A;  3APC A;  2V4L A;  4YWG G;  1P7E A;  3QAR A;  1T3Q A;  4ANU A;  2QDF A;  3DDC B;  1RFA A;  4HEA 1;  4E74 A;  4JE3 B;  1L4Z B;  3MTN B;  5FR6 A;  2N9E B;  2DYO A;  4E3C A;  1ZDV A;  4RH6 A;  3PZD A;  1H8C A;  3PTF C;  4ANX A;  1UWM A;  2BS4 B;  1YN5 A;  4IM3 A;  4W9F A;  4K7U A;  1T5X D;  1WGK A;  3HM6 X;  2GI9 A;  1WYG A;  1SE9 A;  4FJV B;  4CHK A;  1UH6 A;  3PT2 B;  4XDC A;  2WX1 A;  3U2S C;  2NPT A;  5T8I A;  2L8J A;  4J3O D;  3HIZ A;  3V05 A;  4BKT A;  5LXI B;  1WGY A;  4OW0 A;  3GZN B;  4M8N A;  2XN9 C;  3VUW A;  2LUM A;  2QHO A;  1SBB B;  2SAK A;  2IY1 B;  2V9H A;  3GB1 A;  3QX1 A;  3JVZ X;  4M02 A;  3EFC A;  4W9L A;  3DBR I;  1RM6 C;  1V2Y A;  3AE1 B;  1AWD A;  2AL6 A;  2KXJ A;  3MJW A;  1TBE A;  1V1P A;  3M95 A;  3ZNG C;  4KGS A;  2BS2 B;  3UIP B;  4ZYS A;  2LRU A;  3N30 A;  1XQQ A;  2KK8 A;  3BYT B;  5G55 A;  3FAH A;  1ZXI A;  3O13 A;  3PO0 A;  2MA9 B;  3N1Y C;  3ZO5 B;  2ZJD A;  3EGR A;  3MJ5 A;  3PHW B;  4BFR A;  1GG3 A;  1Z2M A;  2WXF A;  4WWN A;  3TL5 A;  1OQY A;  2Y5C A;  1EO6 A;  1RYJ A;  2V3N A;  4YT0 B;  2KC2 A;  1SSN A;  2MJD A;  5BYS A;  1TS3 A;  3ML9 A;  1WWT A;  1J0G A;  3V60 A;  2JX5 A;  2HJ1 A;  3CST A;  3C0R B;  3R7R A;  2INP E;  1BUI C;  1WXM A;  4PYU A;  1RFK A;  3N9Y C;  1QKZ A;  4F7Z A;  4A6Q A;  1WGR A;  2ON8 A;  1FIQ A;  2DWQ A;  2K25 A;  4HWI B;  3LB8 C;  5JHB A;  2KDI A;  1JWU D;  1C76 A;  3P42 A;  4OVU A;  1PFD A;  1FEH A;  5L95 C;  3DBH I;  2QEJ C;  2Z59 B;  2QIL A;  2MBH A;  4DHJ D;  4P16 A;  4W9H A;  3BVZ A;  4YL8 A;  3DQV A;  2NTT A;  2EMT A;  4NZL B;  4CQN A;  1N5W A;  5BMI A;  3AE6 B;  3PSE B;  3BYY B;  4JWS C;  2FAZ A;  4URK A;  1QQR A;  2DZK A;  2ZNV C;  1WE6 A;  3DBS A;  2LVQ A;  3T3O A;  3JYU A;  2ZNV B;  2MQJ A;  2WXQ A;  4GLS C;  4BKS D;  3AE5 B;  1AW7 A;  2XNA C;  2WHI A;  2CU3 A;  2AQ1 B;  4AWJ A;  2DNF A;  4KIK A;  2WDR B;  1FCL A;  1TTN A;  3FKY A;  1N60 A;  2GB1 A;  2WU5 B;  1FFU A;  1YQB A;  2GRI A;  3NJT A;  2KTR A;  2E6X A;  2PPH A;  3P4R B;  4BAX A;  3L17 A;  2JF5 A;  2GLS A;  3X0W A;  1N62 A;  4LNO A;  1D3Z A;  3AE2 B;  1F2R I;  1TKG A;  2YLM A;  5AZH A;  2LHD A;  1QT9 A;  2I38 A;  1WR6 E;  1C78 A;  5E6J A;  4TQ0 A;  1Y8R C;  3AM9 A;  1SJH D;  4A20 A;  4YSY B;  3Q2A C;  1V5T A;  1LGR A;  4DDI D;  3ZYY X;  2WXJ A;  2IPK D;  1WXV A;  1K50 A;  5G5H A;  4NY0 A;  3QK0 A;  1MG8 A;  3VR8 B;  2WXI A;  2IY0 B;  3D32 A;  4IM0 A;  4PS8 A;  3ZDT A;  1DYQ A;  5CTR C;  3AU4 A;  4K3C A;  3LDZ E;  3ZDM C;  4RM8 A;  2JU6 X;  3KWV A;  1IGD A;  5DCN A;  1KFY B;  1FNV A;  1V1P B;  4YTP B;  3DVN U;  1VDV A;  2JSV X;  3ZXV A;  4YSX B;  1QOA A;  4G11 A;  1ZP0 B;  2J0J A;  4IG7 B;  3NG0 A;  1CMX B;  3FIL B;  1U4A A;  1WH3 A;  2D3B A;  2KLC A;  3UQB A;  1HA5 A;  1V86 A;  2Z0E B;  4WWP A;  3ZNZ B;  1VJK A;  5HG2 A;  4IUM B;  3V62 A;  1E7V A;  3H8H A;  1I4H A;  1VRA B;  2JVC A;  4PS3 A;  4IKG A;  1ZDX A;  2WWZ A;  4HDO A;  1LM8 B;  1E6E B;  2MEK A;  4HJG E;  4RCO A;  1C77 A;  1X1M A;  3AB5 A;  1XXG A;  4MM3 A;  4N9F 4;  1ACC A;  3RT3 B;  2LEK A;  1GB1 A;  2JWZ A;  3RPF C;  3Q8A A;  2J42 A;  4DQO C;  3AN1 A;  4DHZ B;  5IA7 A;  2MBB B;  4FHK A;  1QF6 A;  2BQQ A;  2I2Y A;  4N58 A;  1OGW A;  3TEX A;  2IND C;  4IC7 B;  3H6N A;  4USA A;  5C1Z A;  1QIL A;  4A3P A;  2WNM A;  3TEZ A;  2KOX A;  4CYE A;  2K9X A;  5JXV A;  2K8H A;  4E71 A;  1N6Z A;  2KFK B;  2OHF A;  4YXD B;  3BVM A;  2G3Q B;  3N1X C;  2A5U A;  3ABV B;  4K3B A;  1OEY J;  1WF9 A;  2JYT A;  2RSU A;  3GS2 A;  1I4X A;  5CHV C;  1P1A A;  2PMV A;  2RR9 A;  1WRI A;  2J0M A;  2W3R A;  5EE1 A;  2WDQ B;  3CWI A;  1UNS A;  5LLI A;  2MRP A;  3W1Y A;  1YJI A;  4OZC A;  2J7Q B;  4EZJ A;  1HE8 A;  3Q3N C;  3A9J A;  1N5X A;  4KKJ A;  3OJ4 B;  3Q3O C;  1C4C A;  2O2V B;  2IJ0 A;  1AN8 A;  1SGH A;  1XCQ L;  2ZZP B;  4S17 A;  5GXG B;  5H8Y E;  3WAM A;  4XE0 A;  5BMG A;  3ZTD A;  3DVG X;  4LNK A;  3KUC B;  3RCZ A;  1ISN A;  4KIK B;  3EFU A;  4MEL A;  2MJ3 A;  4B6W A;  3ZLZ A;  4RGN A;  3PHX B;  3BZD B;  2K8B A;  4LDT D;  3U52 E;  2JRH A;  3L10 B;  2L05 A;  4LLG M;  1WJU A;  1SXT A;  2N7D A;  3HVZ A;  4M00 A;  3MHZ A;  5L83 A;  3P4S B;  2KMA A;  4FJY A;  5LNK 1;  1J8C A;  5G5G A;  4OVV A;  3KH0 A;  2ACZ B;  2C7H A;  1FNU A;  3FC4 A;  5AUK A;  2AX5 A;  2PW9 A;  1FXI A;  2JY6 A;  2KMC A;  2WP9 B;  3QWZ B;  2JXX A;  4A8X C;  1EM7 A;  2INN E;  3EEC A;  4N6E B;  1FM0 D;  4MSM B;  5TR5 A;  2MJE A;  5HI1 A;  3AI5 A;  3HRD D;  1YX5 B;  1V49 A;  2KJR A;  4HRO A;  1D5M C;  2FCN A;  1Q5W B;  1TT5 B;  4MT5 A;  2QMT A;  4TQ1 A;  1T0Y A;  3NVY A;  1V1O A;  3MC0 B;  1ZUD 2;  3MFG A;  4XX5 A;  4PYZ A;  3MHS D;  3DHH C;  5BYR A;  2OOB B;  1OFF A;  3AV8 A;  3VH4 B;  4LNI A;  2ASQ A;  1B1Z A;  4WWO A;  1SE3 A;  2KDB A;  4JPS A;  4OHJ A;  3U7D A;  5IAA C;  2KWD A;  3UIO B;  4RM9 A;  3NOB A;  2L0F A;  2KAC A;  3W5V B;  1XF5 L;  2DYB A;  3B9J A;  1TJE A;  3AE7 B;  5AZF A;  3O65 B;  2RPV A;  4AUQ C;  1SB3 C;  3AXC A;  3RNA C;  5BO4 B;  1YIW A;  2FBW B;  2KAN A;  4ZRK A;  5J2R A;  2EKE C;  1YNT E;  2VRR B;  3TJP A;  2L52 A;  1NI3 A;  4GXB A;  2R61 A;  3PV1 A;  1NYR A;  1P3Q U;  3SFE B;  4C80 A;  3K9O B;  3NHE B;  4RGM A;  2LGY A;  4DK5 A;  4A55 A;  4MM3 B;  4ZHP A;  1JW9 D;  2GBR A;  3MP9 A;  4AP4 C;  1A5R A;  3KW5 B;  2KDM A;  1SIJ A;  4L1B A;  3DBR B;  1DOI A;  2K6Q A;  1VR9 A;  1WIA A;  2OJW A;  3R2T A;  2Y3A A;  4ZYN A;  1PYW D;  3QAQ A;  4WJQ A;  4EE2 A;  2M19 A;  1MVK A;  2ZCB A;  2LVP A;  4J6I A;  1Z5S B;  4FBJ B;  3CF6 E;  2D3A A;  3M3J A;  1J7B A;  4C7Z A;  2LJI A;  3HVD A;  3ZJV A;  4NPN A;  1RWS A;  2GOW A;  1BXT A;  3DBL I;  2BKF A;  4IWQ A;  3ZIM A;  2BBC A;  1F77 A;  2LUE A;  5EDS A;  3Q8F A;  2MBQ A;  1ZOY B;  2KT7 A;  2D2Q A;  4WQM A;  4P1C C;  3VR9 B;  2FCQ A;  2CHW A;  2N1V A;  1OTR B;  3AE3 B;  2NS5 A;  1WX7 A;  3H7P B;  3A9J B;  5MPO A;  1TY0 A;  2LGS A;  3NVZ A;  1E90 A;  2KC1 A;  5IOI A;  4XYC A;  2DHZ A;  1BT0 A;  5C2T B;  2LZ6 A;  3P1M A;  1T6B X;  3UGB B;  2LMC A;  2H89 B;  4B0E A;  4EOY A;  2NBU A;  2N7E A;  1V9J A;  2E3T A;  1AAR A;  1EU4 A;  1QZE A;  2DZI A;  4II3 B;  1WSP A;  4B0M A;  2LWP A;  3KUZ A;  3RYT A;  1GC6 A;  2G45 B;  4HRS A;  2D11 A;  2ZVO A;  3OWE B;  2KFJ A;  4HXD A;  2H88 B;  1WM3 A;  2L76 A;  3ZXR A;  3NS1 A;  1R4N I;  3URY A;  5DPW A;  4JL9 A;  4US8 A;  2PJH A;  2UU7 A;  2NBV B;  3A4S C;  3FIL A;  3VUX A;  4P6V F;  2YEP F;  1AYF A;  2MLB A;  2LD9 A;  1MI0 A;  3RUI B;  4AQ7 A;  2PVO D;  1RRB A;  2CU1 A;  4IM2 A;  5AZG A;  4GU2 A;  1N63 A;  4FLH A;  4DXF A;  3B2F A;  4QAY A;  2INC C;  4S0R A;  2D07 B;  3WCQ A;  1SJE D;  4W9J A;  2IGD A;  2EMS A;  3DCG A;  1FCC C;  1MPE A;  3WAN A;  4RGO S;  2BTE A;  4DHZ E;  1LO5 D;  2I1K A;  3NZS A;  1UWX A;  1NI2 A;  1F52 A;  1QOG A;  2N1W A;  1YD8 U;  1ESF A;  3RNE C;  4EEW A;  1UEL A;  3VTV A;  4MDK E;  1ENF A;  2KNB A;  2M1M A;  4FN2 A;  4M01 A;  1WI0 A;  2LFI A;  3ZUN A;  2KFK A;  2WXR A;  2G4S A;  1VZ6 A;  1KLU D;  1E8Z A;  1T0R C;  3V61 A;  4GDL A;  3RMK C;  2AYO B;  4KGT A;  2JPH A;  3GZN I;  2VH1 A;  3ZNI D;  2DX5 B;  2WX0 A;  2IO2 B;  1K8R B;  5D94 A;  2IGH A;  2K1F A;  2W54 A;  1XD3 B;  1K52 A;  2LGI A;  4HDQ A;  2C60 A;  4W9G A;  1YN4 A;  5FKA C;  4WJN A;  1IP9 A;  2AWT A;  3AED B;  4BKG A;  2O2V A;  1XO3 A;  3P4Q B;  4K7S A;  1FMA D;  2ZPY A;  4W9I A;  4ICU A;  4ARI A;  1HEZ E;  2ZW1 A;  1FPY A;  3NRZ A;  2MWS B;  2BS3 B;  2QCZ A;  4I6L B;  1WGG A;  1WXQ A;  4IW0 A;  3RFZ B;  3R8B A;  1WM2 A;  5GMV A;  3KLS X;  5JH5 C;  1T0Q C;  1C9F A;  2J52 A;  3PGE A;  3SU8 X;  1JWM D;  1BML C;  2DBY A;  4ASW C;  1IUE A;  3AEB B;  3EHV A;  5AEK B;  2M56 B;  3ZNH B;  2KX3 A;  4MGZ E;  2N9X A;  4ZHO A;  3VRB B;  3T8M A;  1V97 A;  3DOW A;  2BWF A;  2KJH B;  1L2N A;  4GB9 A;  3VAW A;  1DOX A;  4K1R B;  4TSS A;  1UD7 A;  3QA8 A;  2CJN A;  4EZL A;  1RLF A;  2DZM A;  3WAO A;  4O1N A;  2JZP A;  2IYD B;  2BKR B;  3HM3 A;  3OG5 A;  3ZKJ C;  2VH2 A;  1K53 A;  2Y5P A;  2KWC A;  3APD A;  4IOI E;  4RMA A;  2WXH A;  3ZTC A;  3RNG C;  3R7Q A;  2REX A;  3DVN V;  1E7P B;  1SE4 A;  1YX6 B;  2NR2 A;  3CIR B;  3C8Y A;  5KHO A;  1JWS D;  3KWL A;  2C5L C;  1TYG B;  4LJO B;  4H2A A;  2KO3 A;  2Y5B B;  4W9C A;  1WRD B;  5D7G A;  1Y56 A;  2LJ5 A;  4HKZ E;  2KD0 A;  3JW0 X;  1WZ3 A;  1J7A A;  1ZKH A;  4REZ A;  2L32 A;  2PTL A;  2ZPN A;  2WDV B;  1WX8 A;  2N7J A;  4KSL C;  1JWB D;  2D10 A;  4G0N B;  4AOF A;  4BBN C;  1TIF A;  1TGZ B;  1CK1 A;  5IKC M;  2D3C A;  3B0A A;  4JX1 C;  1E10 A;  4OZA A;  1I4G A;  2EEL A; 
#chains in the Genus database with same CATH homology
 5T8I A;  1TY2 A;  2B76 B;  4J3O D;  1I4R A;  2QMT A;  4MT5 A;  3IAS 1;  1XEE A;  3NVY A;  4NAW B;  1V1O A;  4TQ1 A;  3MC0 B;  3V05 A;  4ZRQ A;  1ZUD 2;  3MFG A;  1ZPS A;  3AEE B;  4KX6 B;  4OW0 A;  1L6U A;  1YMH E;  5BYR A;  4WIP A;  2XN9 C;  1OFF A;  2LUM A;  3AV8 A;  3IT6 B;  3W9C B;  1SBB B;  1B1Z A;  2ICI A;  4ITK A;  4ZRP A;  2BW2 A;  2JXT A;  2SAK A;  3GB1 A;  1SE3 A;  1L5P A;  4YSZ B;  1NEK B;  4JPS A;  4OHJ A;  1N61 A;  2KWD A;  1XLP A;  1RM6 C;  3AE1 B;  1AWD A;  2Q5W D;  2BB5 A;  2KAC A;  3W5V B;  3U7Z A;  4GDL B;  2NMQ A;  1XF5 L;  4L23 A;  2WQY B;  4WH4 A;  1V1P A;  3B9J A;  3DWG C;  1TJE A;  2MH7 A;  3AE7 B;  4KGS A;  1YQ4 B;  4Q2J A;  1NYQ A;  2BS2 B;  2PLP A;  4ZYS A;  2RPV A;  3TEY A;  3BYT B;  5HHD G;  1SB3 C;  4RGT A;  3FAH A;  1D5X C;  3B2G A;  2FBW B;  2QSD A;  1ZXI A;  3O13 A;  1YNT E;  4YTN B;  5EE9 A;  3PO0 A;  2WLB A;  2L52 A;  5D3D A;  1NI3 A;  1VZ7 A;  3NVW A;  1I4Q A;  3EGR A;  2R61 A;  1L4D B;  3MJ5 A;  1NYR A;  1KRH A;  3SFE B;  4C80 A;  4RGM A;  2K22 A;  5I4D A;  3P63 A;  4A55 A;  1TKE A;  2WXF A;  4TMA B;  1UGJ A;  4MM3 B;  4ZHP A;  3Q8C A;  1JW9 D;  3P4P B;  3MP9 A;  2Y5C A;  1RYJ A;  3ZJU A;  2V3N A;  2DYM A;  4YT0 B;  5BYQ A;  4A9A A;  3VQI A;  2WS3 B;  2TSS A;  2KDM A;  1SIJ A;  4L1B A;  1VLB A;  1DOI A;  1SSN A;  2MJD A;  5BYS A;  1TS3 A;  1NEN B;  1VR9 A;  2WXL A;  1FXA A;  1WWT A;  3IT4 B;  4YTM B;  3SFD B;  1PUT A;  1V8C A;  2JX5 A;  2LHE A;  3R2T A;  3NVV A;  2Y3A A;  2BYT A;  1PYW D;  2INP E;  1BUI C;  3IAM 1;  1A70 A;  4EE2 A;  2QJL A;  2M19 A;  1RFK A;  1FFV A;  2W82 A;  3N9Y C;  3W2D A;  1JQ4 A;  1MVK A;  1QKZ A;  2HDE A;  5EE3 A;  2KMM A;  3BK2 A;  3AEA B;  4M0W A;  4A6Q A;  3J9C A;  1J7B A;  4UDU C;  3VRA B;  2ON8 A;  1FIQ A;  1OQQ A;  2DWQ A;  2W55 A;  3IXS A;  1XLO A;  2LJI A;  3LB8 C;  4C7Z A;  4AS1 A;  3HVD A;  1JWU D;  1ZXH A;  3ZJV A;  1C76 A;  2JYE A;  1RWS A;  3P42 A;  1PFD A;  1FEH A;  4RFB A;  1BXT A;  2QEJ C;  1EU3 A;  2K3U A;  4XWT A;  1SEB D;  2QIL A;  2RDG A;  4A90 A;  2BBC A;  2K5P A;  1F77 A;  1TS2 A;  3LXF A;  2PKO A;  3Q8F A;  4P16 A;  1YQ3 B;  1ZOY B;  3BVZ A;  1I7H A;  4D2K A;  3ETR A;  4WQM A;  2L1A A;  3VR9 B;  2NTT A;  2L83 A;  3AE3 B;  3DWM A;  4RF0 A;  1FO4 A;  4NZL B;  4CQN A;  1B9R A;  1UUP A;  5MPO A;  1TY0 A;  1N5W A;  5BMI A;  3NVZ A;  3AE6 B;  1KLG D;  3BYY B;  4JWS C;  1XCT L;  5C2T B;  5C3J B;  3P1M A;  1T6B X;  1QQR A;  4RNA A;  1JRP A;  2JWU A;  2AQ2 B;  4R3D A;  3BK1 A;  4IDI A;  2LMC A;  3E9S A;  1SE2 A;  4C56 C;  2H89 B;  1JML A;  4B0E A;  3T3O A;  1JCK B;  2E3T A;  2WXQ A;  1EU4 A;  4GLS C;  1NVI D;  1IBX B;  2IGG A;  1WSP A;  3AE5 B;  4B0M A;  1C79 A;  1AW7 A;  2XNA C;  1L0Y B;  2CU3 A;  3PZ7 A;  2AQ1 B;  2W3S A;  1SF0 A;  4HRS A;  3OWE B;  2WDR B;  1FCL A;  2G1E A;  2ZW0 A;  2WXN A;  1N60 A;  1Q10 A;  1FFU A;  2GB1 A;  2GRI A;  2H88 B;  2WU5 B;  3Q69 A;  2E6X A;  3TUO A;  3BWU D;  3NS1 A;  3P4R B;  3URY A;  1QOF A;  2ONQ A;  5D3I B;  1OQR A;  2RMM A;  4US8 A;  1N62 A;  3AE2 B;  3FIL A;  1F2R I;  1D5Z C;  4P6V F;  1PGA A;  2KQ4 X;  2YEP F;  4FXC A;  3AEG B;  2KN4 A;  1AYF A;  1TKG A;  2N9L A;  4N59 A;  1ET9 A;  1MI0 A;  2QIE B;  4AQ7 A;  2LHD A;  1QT9 A;  2PVO D;  3NUH B;  2I38 A;  3V3X A;  1C78 A;  5FR3 A;  5E6J A;  4TQ0 A;  1L0X B;  1HQR D;  4JWU C;  1N63 A;  2J53 A;  1EWY C;  2KAJ A;  4DXF A;  3AM9 A;  1SJH D;  2J4X A;  4OVZ A;  4YSY B;  5AUI A;  3W1S A;  3B2F A;  1EWC A;  1JAL A;  4MH8 A;  4LK0 M;  3WCQ A;  1SJE D;  2IGD A;  2FE8 A;  3EUB 2;  3ZYY X;  2WXJ A;  3EA6 A;  3Q8E A;  1DOY A;  1FCC C;  2HTM E;  1MPE A;  2IPK D;  3I9V 1;  4RGO S;  2BTE A;  2DLB A;  3AEF B;  1K50 A;  5G5H A;  5BMH A;  3E56 A;  3T3N A;  1LO5 D;  2D5G A;  1CJE A;  3AE8 B;  3VR8 B;  1UWX A;  1QOG A;  2WXI A;  3TSS A;  4NAM A;  2VZK B;  1TKY A;  1DYQ A;  3SEB A;  1ESF A;  1KF6 B;  1FRR A;  2WU2 B;  4PT5 A;  1CZP A;  1MHX A;  2YEP B;  1IGC A;  1TS5 A;  2JU6 X;  1D6E C;  1ROE A;  1ENF A;  3KWV A;  4GDK B;  1IGD A;  3KQ4 A;  1KFY B;  1FNV A;  2G9H D;  1V1P B;  1GOZ A;  4YTP B;  1VDV A;  4KKI A;  5HFY A;  2LFI A;  2JSV X;  2WXR A;  1DGJ A;  1HZ5 A;  1TZO A;  1VZ6 A;  4YSX B;  1KLU D;  1QOA A;  1ZP0 B;  3HUI A;  5EE0 A;  4ARC A;  4KGT A;  3FIL B;  2SEB D;  1C4P A;  1XLQ A;  1PDX A;  1M4V A;  1FRD A;  1PGB A;  4XDD A;  1HA5 A;  1GAQ B;  2Z8L A;  1VJK A;  5HG2 A;  2IGH A;  5FK9 C;  1R7S A;  2W54 A;  3H8H A;  1I4H A;  1K52 A;  2LGI A;  1VRA B;  2PVG C;  1PGX A;  4IKG A;  4KGR A;  1ZDX A;  3I57 A;  3ZQ4 A;  1K51 A;  1E6E B;  2MEK A;  4HJG E;  1QLB B;  4RCO A;  1C77 A;  1YN4 A;  4MAC A;  5FKA C;  3AB5 A;  1XXG A;  4ZOH C;  3AED B;  1ACC A;  2LEK A;  3BVG A;  1XO3 A;  3NZ3 A;  1GB1 A;  3P4Q B;  3RPF C;  3Q8A A;  2J42 A;  4DQO C;  3AN1 A;  1FMA D;  2EKI A;  3AMZ A;  3AEC B;  4ARI A;  1HEZ E;  1QF6 A;  2ZW1 A;  2V4I B;  2WXP A;  1L6V A;  3U4E G;  3NRZ A;  2I2Y A;  4N58 A;  1L0V B;  5TSS A;  2BS3 B;  1CQV A;  3TEX A;  2V0G A;  1I4P A;  1YN3 A;  3AE9 B;  4USA A;  1QIL A;  2WNM A;  2N0S B;  1WXQ A;  1KTK A;  3TEZ A;  1STE A;  3R8B A;  3RFZ B;  2X38 A;  3PZ8 A;  3KLS X;  2K9X A;  5JXV A;  2V3P A;  1VZ8 A;  1QOB A;  1C9F A;  3UI3 A;  2OHF A;  4NJC A;  2J52 A;  4YXD B;  3BVM A;  3AH7 A;  3TEW A;  1JWM D;  1BML C;  4XWW A;  2DBY A;  2WXO A;  3ABV B;  4US9 A;  1E9M A;  2JYT A;  1IUE A;  1KH0 A;  3AEB B;  1P7F A;  2M56 B;  3GS2 A;  1FD6 A;  1I4X A;  1D4B A;  1TS4 A;  2PMV A;  2WXG A;  1ZE3 D;  1HXY D;  1WRI A;  2WXK A;  4ZHO A;  2M0A A;  2WXM A;  3VRB B;  2W3R A;  4HKQ A;  5EE1 A;  3SR6 A;  2WDQ B;  1V97 A;  3CWI A;  1UNS A;  1C4A A;  2BB6 A;  3Q8B A;  1DOX A;  2CJO A;  1YJI A;  4TSS A;  4OZC A;  4C7Y A;  1JWA D;  4L2Y A;  1GB4 A;  2CJN A;  1YJJ A;  3ZGZ A;  1XLN A;  4O1N A;  1N5X A;  2IDY A;  4LTU A;  2NTS A;  2OED A;  1FNW A;  4KKJ A;  1C4C A;  2JZP A;  2IJ0 A;  1AN8 A;  1F2R C;  1K53 A;  1XCQ L;  3L4P A;  2Y5P A;  3LYY A;  5GXG B;  5H8Y E;  4XE0 A;  5BMG A;  4IOI E;  2WXH A;  4RF1 A;  1ET6 A;  3R2I A;  2VZK D;  1GPX A;  1E0Z A;  4WUR A;  5H92 C;  4WWM A;  1MHH E;  4DXG A;  2BT6 A;  1IBX A;  2JQR B;  3AE4 B;  4OZB A;  1E7P B;  1SE4 A;  2MJ3 A;  3CIR B;  3GP7 A;  2PIA A;  4RGN A;  3C8Y A;  3BII D;  3BZD B;  4YWG G;  1JWS D;  3U52 E;  1P7E A;  3KWL A;  4LLG M;  1T3Q A;  1SXT A;  1TYG B;  4HEA 1;  3HVZ A;  3MHZ A;  3P4S B;  4H2A A;  2K0P A;  4JE3 B;  1L4Z B;  2N9K A;  2RDH A;  5LNK 1;  5G5G A;  2DYO A;  5D7G A;  1Y56 A;  1J7C A;  2ACZ B;  3W5U B;  1FNU A;  2AQ3 B;  4HKZ E;  1ZDV A;  3FC4 A;  2AX5 A;  4WAF A;  2PW9 A;  5AUK A;  1J7A A;  3ZJT A;  4RH6 A;  1FXI A;  1HZ6 A;  2WP9 B;  4REZ A;  2L32 A;  2PTL A;  4A8X C;  2WDV B;  1EM7 A;  2INN E;  2N7J A;  4N6E B;  1FM0 D;  1UWM A;  1JWB D;  2BS4 B;  1YN5 A;  2MJE A;  1JRO A;  1T5X D;  5HI1 A;  1WGK A;  3HRD D;  1F0Z A;  1CK1 A;  2GI9 A;  1WYG A;  4JX1 C;  1E10 A;  4HRO A;  4OZA A;  1I4G A;  1D5M C;  4XDC A;  2FUG 1;  3U2S C;  2EEL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...