1YN4A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords EapH1
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn4A00
1L0XB 1KLUD 1UNSA 1TS5A 2IPKD 1YN5A 4UDUC 1YN3A 2XNAC 1STEA 4C56C 1EU3A 1KTKA 1T5XD 1JWSD 4RGNA 2SEBD 1SJHD 4RH6A 1I4QA 1V1PA 1XXGA 2RDHA 1SBBB 1TY2A 3GP7A 1I4RA 3R2IA 2IJ0A 1F77A 2AQ1B 1SEBD 3W2DA 2NTTA 3BZDB 1ET6A 1DYQA 1FNVA 1TY0A 1FNUA 1SXTA 1I4GA 4RFBA 3EA6A 5FK9C 1AN8A 3O13A 1UUPA 4DXGA 1D6EC 1HQRD 2QILA 1V1PB 1ESFA 4OHJA 4TSSA 2ICIA 2XN9C 4RCOA 1SJED 1I4XA 2RDGA 4DXFA 1I4PA 2G9HD 2R61A 1EWCA 1PYWD 1SE2A 5D3DA 2AQ2B 1LO5D 3TSSA 4RGTA 1HA5A 1CK1A 1TS4A 3KLSX 1TS2A 1I4HA 1ET9A 3BVGA 2TSSA 1ENFA 3OWEB 1YN4A 1D5MC 3BYTB 2J4XA 4NZLB 1HXYD 1L0YB 1V1OA 2AQ3B 1AW7A 1M4VA 1GOZA 5I4DA 4RGMA 5FKAC 1SE3A 3MFGA 1D5ZC 1B1ZA 1JWUD 1FNWA 3SEBA 3BVZA 5TSSA 3V05A 4RGOS 2NTSA 1CQVA 3MC0B 1JWMD 5D3IB 2Z8LA 1D5XC 1JCKB 3R2TA 4O1NA 3R8BA 4ZYSA 1BXTA 3URYA 1SE4A 1KLGD 1TS3A 3BYYB 1EU4A 3BVMA 2QEJC 1QILA
chains in the Genus database with same CATH superfamily
3DBHI 2L76A 4C4VA 4LDTD 2N7JA 2C60A 3FKYA 1HTQA 3ZJVA 1C1YB 2KD0A 1WGYA 4HPMB 5D2MB 3AE7B 1TY2A 1MFWA 1FXTB 3GP7A 5AZHA 3CSTA 3DBHB 2ZNVB 4B9KA 2NS5A 2OEDA 1FNVA 4I6NB 3X23A 3A33B 2BWES 1Y56A 2ZZPB 1S1QB 2WDVB 1TKGA 2B76B 1GB1A 1UBQA 4E74A 1T0SC 3P1MA 3AE9B 4X57B 2M4NA 4K7WA 5C3JB 3ZO5B 2WDQB 1SB3C 1WGGA 1F2RC 1KFYB 3C8YA 3UQBA 4AOFA 3JYUA 1WXVA 2TSSA 2R2QA 2K5PA 4W9JA 3A4SC 4XDCA 5BMIA 3UIOB 4GDLA 3WANA 2JF5A 2AQ3B 4EFOA 1ZE3D 5TR5A 2ZCCA 2DNFA 3DBSA 1J8CA 2BQQA 3IT6B 4BKSA 3HHMA 1UWMA 4XX5A 4FHJA 1WY8A 4HKZE 2INDC 1JW9D 3NRZA 1NVID 3PREA 4NNJB 1YQ4B 1IUEA 3MTNB 1YX5B 2K6QA 3ZJTA 1EU4A 1PGBA 3APFA 1TKEA 1EF1A 1FM0D 2ZPNA 1LXDA 4NAWA 4IWOA 2ZW1A 1P98A 4ANUA 2DENB 4S17A 3E9SA 3EFCA 4B0MA 2WXPA 3ZGZA 3DPDA 5FR3A 4TQ1A 3RNGC 2BB6A 2WXIA 2IGDA 2I2YA 3Q3JA 2IJ0A 4JGHB 3B0AA 4DWFA 3W2DA 1ACCA 3VR8B 1M94A 2L05A 2DWQA 1PDXA 2RGFA 1HTOA 3TUOA 4NPNA 4MM3A 5E6NA 3W1SA 3JVZX 2RDBC 4WAFA 3WALA 2XK5B 3NZ3A 2JRHA 1SSNA 1K51A 1RFAA 3PTFC 2ICIA 1TJEA 4P1BC 4JE3B 3DWGC 4MGKE 1OEYA 2M0AA 3PVLA 3RCZA 2NCNA 2KX3A 2YVCA 1SE2A 2Y3AA 4MT5A 2R2OA 3IBEA 3L0WB 4HDQA 4GDKA 2KDFB 3EGRA 3BVGA 3VAWA 4A6QA 2WU5B 1V1OA 1FMAD 1MPEA 1B1ZA 4JQWC 3A9JA 2K8HA 4KSKC 3PS6A 2LASA 1C4CA 5TSSA 1WSPA 2VH1A 2KO3A 4FBJB 3DBRI 2NPTB 2PW9A 3MC0B 3SR6A 4Q2JA 2HTHA 1E8YA 3TBLD 5D7GA 1QKZA 3LB8C 1JWAD 1FRDA 3M95A 2V3PA 4ANVA 4GIVA 2LGSA 2V9HA 2PEAA 5AEKB 2LRWA 2J0MA 1WMHA 1L0XB 2MBBB 1LGRA 1BT0A 3VRAB 3DBRB 3NUHB 3AE5B 5CHVC 4IDIA 2INNE 4HK2A 1TBEA 3TEZA 4BKTA 3SD5A 2Z59B 2AWTA 2E3TA 2IY1B 4F7ZA 3R7QA 1DOIA 1GG3A 3VH3B 2KJRA 5GXGB 5LXHA 2WX0A 3B9JA 3ETRA 1JRUA 3IT4B 2GRIA 3EC8A 4EE2A 4KZCA 2LVQA 1QOBA 4EKUA 4RF1A 2L32A 1V6EA 1ROEA 3WCQA 3EA6A 2JVCA 3W5VB 2OJRA 1F1HA 1HQRD 2MEKA 1VZ8A 2G1EA 1RLFA 3P4QB 1GAQB 4KIKA 2J7QB 1PYWD 1V80A 1V9JA 5KHQA 4QAYA 1Z2MA 1K50A 5DPTA 2N9EB 1ET9A 3OWEB 4LNFA 4KX6B 4K1RB 3BYTB 2EKIA 4PYZA 2PJHA 2C7HA 4B0EA 2BYEA 3V61A 5I4DA 4RGMA 5H8YE 3TL5A 5D6JB 2VZKB 4LK0M 1QQRA 1V97A 5E6PA 4DHZE 1N62A 2Z0EB 3IXSA 1Q10A 2OJWA 3HUIA 4AQ7A 2D10A 1MVKA 2KMAA 1BXTA 1E8XA 3WA0A 3U7DA 2FCQA 4XWWA 2IGGA 2LGYA 3ZIMA 4DHJD 3LJ3A 4G11A 4DXAB 4A55A 1WX8A 3DVGY 4HCNB 3L13A 4M8MA 1JQ4A 4A8XC 4AJWA 5DPWA 3V60A 3DBLI 1KTKA 4IWPA 4RGNA 2L8JA 2UYZB 1WJUA 1TIFA 2K8BA 2REXA 2QIEB 1WWTA 1V5TA 1XCTL 2EMSA 1F77A 4MGYE 1EO6A 3V6EB 3R3MA 2FUHB 1NDDA 3QX1A 3UI3A 1I4GA 2CU3A 1IYFA 3HRDD 4DDGD 4KKIA 2D3CA 3NVYA 4FHKA 4W9KA 2WU2B 2IY0B 2R61A 2MJDA 4MGZE 1EWCA 2BS4B 2INPE 3Q8FA 5D3DA 1LO5D 2KJHB 2J42A 2IYDB 3AULA 3RZFA 1CK1A 1OGWA 4ZRIA 4PT5A 2QMTA 4TKNA 3RYTA 1L0YB 5JZEB 1FEHA 1WGDA 3DVGX 3KWLA 2ZEQA 4MH8A 1SE9A 2KWVB 3N1ZC 2DLBA 3QJZA 2BW2A 1A70A 3ML9A 3A4RA 4FADA 1XQQA 3IG3A 1P0RA 2O2VB 5J17A 1SIJA 1N61A 4M02A 1XD3B 1WIAA 2OOBB 2GBNA 2WXLA 2HD5B 1OEYJ 2LJ5A 3TCAA 1VR9A 4M0WA 2E6XA 4LCDE 1R7SA 1E90A 1VZ7A 2WHIA 3ZUNA 1YN5A 2DYOA 5C2TB 1DOXA 4EOYA 4IM3A 2GB1A 2HE7A 3N1XC 2XK5A 2FNJB 3SHQA 1UGJA 3Q8AA 1NI2A 3Q6BA 3AU5A 1WH3A 4OVVA 1Q5WB 1XO3A 2PTLA 2DYMA 2KQ7A 1XEEA 4WWMA 1VCBA 4J3OD 3K9OB 1SEBD 4K7UA 2CS4A 3A9JB 2WGSA 1V86A 3QQ8B 4LDTB 1IGCA 2ON8A 2KJ6A 2N9KA 1XLQA 1ZKHA 1ESFA 2CU1A 2N1VA 2ZJDA 4FJVB 5DPRA 2NPTA 3QC8B 4HPLB 4HCPB 5CHFA 4FXCA 1PFDA 1MHXA 1Y8RC 2BT6A 1WE7A 3I57A 4GLSC 4L2YA 1V8CA 1VZ6A 3AH7A 3KLSX 4HJGE 4YTMB 4K3CA 3L10B 1K8RB 5LNK1 4CO7A 1ISNA 4K81A 2D5GA 3C19A 1YIWA 1MHHE 3J9CA 2WXQA 1SF0A 1YQBA 1JMLA 1WR6E 4MSMB 3A9KB 3BVZA 1R4NB 3N30A 2DZKA 4GOCA 2KDBA 4WJPA 2N7DA 4BVUC 4ICUA 3NHEB 2FAZA 1WM2A 2MCNB 3RZWC 3K9PB 3URYA 3ZDTA 3AE1B 3QA8A 1C77A 3BYYB 3ABVB 2DYBA 1ENFA 2KWCA 3NG0A 3CF6E 2VRRB 4IM0A 4KGTA 3HK0A 4IC7B 4AP4C 4KSLC 1C4AA 2G4SA 3VUWA 4JIOU 4NQLB 2MHJA 2MW5A 1HE8A 2K0PA 4US9A 5EDSA 3CIRB 5G55A 5G2NA 3KH0A 4HLEA 4BFRA 1L5PA 2K9XA 2V3NA 1TTNA 2W3SA 2ZW0A 1N60A 4WWNA 2I1KA 2QC8A 3ZW3A 2KTRA 3NZSA 1D6EC 1FPYA 1TKYA 5AZGA 3L08A 2O6VD 2QILA 4TSSA 4RCOA 1SJED 4EZLA 1NYRA 1WGHA 5BMGA 3RT3B 2MBHA 2WDRB 4FLHA 4USAA 3VRBB 3I5JC 2AQ2B 1F0ZA 4ZRPA 1VRAB 2JT4B 3H7SA 2HJ1A 2GBRA 5HKHA 4WQOB 2KVRA 1YN4A 3Q69A 1U4AA 3QK0A 2KWUB 1FCCC 3LDZE 3H7PB 4FJZA 1WXSA 2AL3A 1DGJA 3TEXA 1QZEA 2KACA 2N1WA 3EHVA 3IAS1 1LFDA 2KZRA 5JHAA 1V5OA 2W9NA 2BTEA 2WXNA 1FIQA 3BINA 4MDKE 4OVZA 3SFEB 4C7ZA 3DOWA 4FA6A 4LJPB 3TMPB 4REZA 2KX0A 2EKEC 1I35A 1ZDXA 3B1LX 2IGHA 4WIPA 3UQAA 3DQVA 1C79A 2IPKD 2KT7A 2K3UA 3ENEA 2W3RA 4XYCA 4EUTA 4F8CB 1T5XD 1JWSD 3KUCB 4IOIE 4JL9A 2LGDA 4II2B 2GLSA 2GOWA 2IBIB 1KF6B 2MX2A 2WS3B 3RFZB 5E6OA 3MC8A 2J0JA 1JALA 2A4ZA 2RR9A 3BIID 2GBMA 3ZRFA 2JWUA 2K1FA 1XT9B 1YJIA 4KKJA 2LZ6A 4MJSB 1I7HA 1ZUD2 3CSFA 2QSDA 2WXKA 5HG2A 1IBXB 1ZGUB 4GMVA 2J52A 1UZXB 1GUAB 2XN9C 2FCNA 4KZ0A 3VFKA 1FD6A 4M0WB 5D94A 2O2VA 4AJYB 3TJPA 4M8NA 2WXHA 3MJWA 3EUB2 2KMCA 1CZPA 3NS8A 3GE3C 4HDOA 2NMQA 4KV2A 2QDFA 1D5MC 2B3AA 2LVOA 4OZBA 5L95C 4P7IA 4A3PA 3R66C 3AECB 4M00A 4WJNA 1JWUD 4GN1A 1G6JA 1P7EA 1QOFA 4PS3A 4S0RA 1XLOA 5JXVA 2N0SB 2LJIA 1H4RA 2JQRB 3MJ5A 5AUKA 1F2RI 2KDEB 4K7SA 4C00A 4P6VF 3RNFC 4MGIE 3PZ7A 1V49A 1XCQL 1QILA 4RMAA 2FIFA 3AV8A 1FO4A 3PRMB 2KQ4X 2WXMA 3L17A 2YLMA 3RUIB 2MRPA 5BYRA 3ZQ4A 1GPXA 1MG8A 3R2IA 5J18A 5L83A 3OAWA 1I42A 5KHOA 5G5GA 1DYQA 1J19A 5G5HA 3MHZA 2UWQA 5BYQA 3PV1A 3RNCC 4WJOA 5FK9C 4YTPB 4M01A 4MH0E 3VQIA 1SGHA 3I63C 3A9KA 1N5XA 1I4XA 1I4PA 5IKCM 2G9HD 2RD0A 1WRIA 3VDZA 3VXWA 1CMXB 4BZAA 2M56B 3ZVVA 2L00B 3DVNU 2KHWB 4HEA1 2PVOD 5BMHA 1I4HA 1JRPA 3ZDMC 4II3B 3I9V1 2FCMA 3DHHC 1M4VA 3AEAB 2KLCA 1E6EB 2DZIA 1FNWA 2WXFA 3GZNI 3V05A 4RGOS 4MEMA 1WE6A 2N9LA 2NTSA 4CYEA 5BO4B 2K25A 1D5XC 2ZPYA 2LUMA 1QT9A 4O1NA 1VJKA 1BUIC 2MP2A 4XGAB 1TGZB 3ZRCA 2D3AA 5H92C 4IG7B 3SDLC 1T3QA 2KTRB 2DZJA 3V62A 3V6CB 3GZNB 2PKOA 1TS5A 5CHWA 1QLBB 4K3BA 4NJ6A 5CX3A 1EU3A 4TUUA 3QAQA 3NS1A 2SEBD 4N59A 3MC9A 2LD9A 2ASQA 1I4RA 4G50A 3P2BA 1X1MA 1QOGA 3BZDB 2JZPA 4OZAA 1ET6A 2BS2B 3PSEB 1PUTA 3L16A 4RM9A 3C0RB 4ITKA 2K22A 3H7PA 5JH5C 3ML8A 5HHDG 1C76A 4PK1A 1YMHE 4LJOB 1J7BA 2ONQA 2JZ3B 2I1JA 2KC1A 2WXOA 3P63A 1TS4A 3W9CB 2GMIC 4A90A 3VR9B 4KGSA 2CKHB 1NEKB 3AE8B 2YEPB 1HEZE 3H8HA 5IO9A 1D3ZA 3B2GA 3Q3FA 4W9HA 2N9PC 1VLBA 3M63B 2DHZA 2BYFA 3RMKC 3B08A 3PT2B 1T0QC 5HFYA 4ZRJA 4IM2A 2Y5PA 1P3QU 3U2SC 1PQSA 2LMCA 4FULA 1CJEA 2X8XX 3ZKJC 1C3TA 1NYQA 2QEJC 2QCZA 2WLBA 3BK1A 1UNSA 1ZXHA 3AB5A 5E6JA 4UDUC 2WWZA 4W9FA 3P42A 3UF8A 2FCSA 2X38A 4MJSA 3ECIA 3U4EG 3Q8CA 1IBXA 2M1MA 3MHSD 3IHPC 1I4QA 2BB5A 2VZKD 4P1CC 3TIXA 4G3XB 2RDHA 1SBBB 5T8IA 2GBKA 1ZPSA 4BBNF 1KOTA 2K39A 2AQ1B 2NTTA 3KYDD 2WYQA 1HZ6A 4I6LB 1J7AA 1TY0A 2AX5A 3AEEB 4XC2A 2JZZA 3D32A 2KWDA 3S2AA 1WGKA 1E5WA 4RNAA 2N9XA 1B9RA 1H8CA 4RF0A 4DHZB 1WZ3A 4HJKA 4PS7A 4I6PA 3BWUD 4XE0A 1AYFA 3LXFA 2KVZA 3RPFC 2D11A 3OJ3A 1E10A 1UD7A 4HVBA 4ANWA 4MACA 4US8A 1FXAA 2IO0B 1E8ZA 2I38A 4L23A 4ZYNA 2DX5B 1TZ1A 4BKSD 2O6VB 1R4NI 4HXDA 2WNMA 2DAJA 2MQJA 1JWMD 1YQ3B 2Z8LA 3E56A 4A3OA 2KLGA 4JX1C 1KM7A 3R8BA 3ZXVA 2JX5A 3NY5A 2KDIA 4G0NB 2PPHA 2MLBA 1TS3A 4DDID 3L4PA 4P16A 2FIDA 3M3JA 4URKA 1UGMA 1FXIA 3U30A 1ZP0B 4MELA 2D07B 3APCA 2XNAC 5C23A 3KUZA 2BKFA 3T9LA 4WURA 2NBWB 4ARIA 1MI0A 3W1YA 4N58A 4LNIA 1N6ZA 2JUOA 3PZ8A 4BOSC 4WH4A 3WAMA 3ZLZA 5MPOA 3DVNV 3QCAA 3HM3A 4W9IA 3HIZA 2JY6A 3AE4B 2KFJA 3L54A 3GB1A 4RM8A 4DK5A 2MP2B 2LFIA 2JXXA 3VTVA 1V1PB 3NVWA 3ZTDA 4BKGA 2WXJA 5EE3A 4C7YA 5IAAC 1WR1A 3FC4A 1UELA 4RGTA 1WFYA 4FN2A 1VDVA 4D2KA 1OQQA 2NBVB 3QWZB 2PIAA 2M0XA 2RPQA 2FBWB 1JWBD 4A9AA 2H88B 3ZTCA 4IUMB 3ZNHB 1OQRA 2KTFA 3ONSA 1AW7A 3AEDB 5DCNA 4YXDB 3OJ4B 1SE3A 3PHWB 4YTNB 3RN9C 1WZ0A 1K52A 3KWVA 2WDTB 2J0KA 4BOZB 4E71A 3OLMD 3PLUA 4JPSA 1N5WA 2IZVB 1GC7A 5HI1A 2ACZB 4ZYSA 2L0FA 2C5LC 3AE6B 4YL8A 3H1UA 4EEWA 1LQBA 1WRDB 1PGAA 4NJCA 3APDA 4J6IA 2LI5A 2NVUI 3SFDB 1KLUD 3FILB 2QHOA 3PRPB 1YN3A 2W55A 4CQNA 3IVFA 3KYCD 1SIFA 1QF6A 2MJ3A 1F9JA 1UH6A 3NJTA 2N7EA 3PZDA 3WIMA 3RNBC 1YX6B 1L4DB 1WXMA 3PHXB 1WJNA 4NY0A 3U8ZA 1L7YA 4LNNA 3Q8BA 2ZVOA 3GS2A 4LNOA 2YEPF 2V4IB 2D3GA 3P4RB 1WF9A 2LGXA 3ZNGC 1E7UA 1WXAA 2CJOA 1E7VA 4HRSA 4YSZB 1L4ZB 3WAPA 1EUVB 2V3SA 4ZRQA 4LTUA 2KN5A 2JPHA 4F1SA 1TS2A 2DAFA 4YT0B 2M19A 1PGXA 2G45B 3VUXA 3DDCB 1GNUA 1EM7A 2G4DB 3KW5B 3RNEC 2BBCA 3PLVA 1GOZA 1T6BX 1YJ1A 2A5UA 1P1AA 3JW0X 4H2AA 1L0VB 1EF5A 4ZHOA 1WX9A 5AUIA 3GOEA 1CQVA 2PLPA 4DBGA 1FFVA 4PYUA 3AE2B 3Q3OC 1MJDA 2BYVE 5AZFA 2QJLA 3EECA 1YD8U 3NVVA 5FR6A 1R4MI 1KLGD 1T0RC 5JHBA 1WX7A 2C7MB 1EWYC 1IP9A 2IDYA 2MBQA 3SU8X 1RRBA 5IA7A 1Q0WB 2DZMA 4IWQA 4OW0A 3N20C 1YOVB 4AS1A 2KKCA 1STEA 4C56C 4ASWC 2L3ZA 1KLVA 1ZXIA 3IFWB 4RH6A 1XXGA 1R4MB 4GSWA 2LGIA 2SAKA 3UIPB 3W5UB 5IP4D 5GMVA 2CJNA 2LVPA 2C7NB 2W54A 1UBIA 4ZRKA 1RYJA 3KUDB 4A20A 4YWGG 3UGBB 1TYGB 2KDMA 1FNUA 5EE0A 4N9F4 4OVUA 2JYTA 2BPSA 2KFKB 3CWIA 1ZOYB 3DCGA 1QOAA 3ALBA 4KVGB 2C9WB 2O6VA 1YJJA 2PMVA 2LHEA 4HWIB 5CTRC 3I3TB 4YSXB 2D3BA 1RFKA 1UF0A 1WXQA 3AE3B 1K53A 2L1AA 2LHDA 4DHJB 2LEKA 1WI0A 2MSED 2V1YA 2Q5WD 2IO3B 3EFUA 3OG5A 3AMZA 3JSVB 2NBUA 1HXYD 3MFGA 2FUG1 1D5ZC 1FFUA 1FCLA 4ZOHC 3PRZA 4HKQA 1JROA 4W9DA 3KQ4A 1BMLC 3HM6X 2KYWA 2NR2A 3ZXRA 2LWPA 4GXBA 3O65B 3DWMA 2JYEA 4ZHPA 5BYSA 1J0GA 3A1QB 1KRHA 2GBJA 3RNAC 4B6WA 1XLPA 2L52A 4MSQB 1NI3A 4AWJA 2LRUA 4CHKA 5DPSA 2Y5CA 2HTME 3NOBA 1E9MA 3N1YC 1SJHD 4JWSC 1V1PA 4TV3A 2AL6A 2BGFA 4ZDVA 2WQYB 3KVFB 4ARCA 3AI5A 4BAXA 1E0ZA 5C1ZA 3HVZA 2BVCA 2PE9A 2KAJA 4L1BA 1GB4A 1RWSA 4C4VB 1SXTA 3QHTA 5IOIA 4YSYB 3U7ZA 1UUPA 3W1SC 4DXGA 4N6EB 3B2FA 3Q3MC 3HVDA 1NENB 4LNKA 5IN7A 3ZJUA 1OFFA 4OZCA 4DXFA 1C9FA 1WJ6A 3PGEA 3VTWA 3RULA 1OTRB 5J2RA 2J53A 1V81A 3ZNZB 1RM6C 3N3KB 4KGRA 1P9DU 2WXRA 3GE8C 2XEWA 3AEFB 5LXIB 2PVGC 1XF5L 4R3DA 3IAM1 4W9GA 3Q8EA 3FILA 5FKAC 3VHTC 3SEBA 1P7FA 4EZJA 3DHIC 4DQOC 4GGQA 2KK8A 1IGDA 3AN1A 4LLGM 3NVZA 1WJ4A 2AYOB 1L6UA 1WGRA 2MA9B 3T3OA 2KNBA 5EE9A 2M8SA 4HROA 2K6DB 1L6VA 4PS8A 3CMMB 1ZW7A 3BVMA 4ACFA 4JWUC 1A5RA 4GDLB 2MWSB 2L83A 2GI9A 4WWOA 2KXJA 3H9DA 1F52A 4AUQC 3DBLB 3R7RA 2L0TA 2BWFA 2BYTA 2BS3B 3WAOA 2ZVNA 2D2QA 3V3XA 1C4PA 2HJ8A 2AEHA 2EELA 4WJQA 3M62B 2RSUA 4RFBA 4NAWB 2ZCBA 1AN8A 2N4FA 3O13A 2MBEA 3T3NA 1AARA 2BF8B 1D4BA 3AU4A 2JU6X 1E8WA 1TZOA 2WXGA 2KN4A 2RDGA 3BK2A 2KMMA 3TEWA 4TQ0A 2KC2A 3TSSA 4W9LA 1GJZA 1ZDVA 3VVWB 2J4XA 3T8MA 3Q2AC 3RD2A 1OQYA 4MM3B 4XWTA 2VH2A 1AWDA 3P4SB 1VD2A 4NAMA 1KJTA 3QIJA 2RMMA 1N63A 1LM8B 2JWZA 3FAHA 3AEBB 2UU7A 5D3IB 2FE8A 1JCKB 1HZ5A 2KQSA 1IPGA 1J7CA 2EMTA 2G3QB 1WYWB 2KANA 2M17A 2MH7A 2OHFA 4GU2A 4NJ7A 4GDKB 1SE4A 1C78A 4HPPA 1WYGA 2W82A 2XBBC 3PO0A 4EZKA 2JSVX 2ZNVC 2IO2B 3ZYYX 2INCC 4NQKE 2LUEA 4XZ4A 2RPVA 3AM9A 4W9CA 2KFKA 4W9EA 2LXAA 4TMAB 3X0WA 4ICVA 2JRIB 3QARA 3Q14C 3AEGB 1FRRA 3VTUA 3AXCA 3Q3NC 1YNTE 2Y5BB 4E3CA 3PPAA 3UINB 1Q1OA 2L7RA 3P4PB 4KDIC 5EE1A 2CR5A 1WMHB 1UWXA 4FJYA 2DBYA 3JSVA 1KH0A 2BKRB 2Z0DB 1MG4A 3RI7C 4WWPA 4OHJA 3DHGC 3VH4B 5LLIA 1Z5SB 3NZUA 1S3SG 2JXTA 1DOYA 1E7PB 2LXCA 1WM3A 3MP9A 2CHWA 1HA5A 2V0GA 2V4LA 3H6NA 1TT5B 2WX1A 1NBFC 3BY4B 3A1QA 4NZLB 3LYYA 3N32A 3N9YC 2HDEA 4WQMA 2KOXA 4JLCA 4XDDA 2MJEA 1GC6A 4WAAA 3U52E 1RAXA 1T0YA 2CHXA 1XLNA 4KDLB 1L2NA 4IW0A 4KIKB 3R2TA 1V2YA 2H89B 4IKGA 4B95A 2K8CA 4C80A 3ZNID 4BBNC 3TEYA 2MBOA 2PE6B 2IO1B 4GB9A 4ANXA 3VUYA 2CHZA 2WP9B
chains in the Genus database with same CATH topology
1R7SA 1VZ7A 4OW0A 2PKOA 1TS5A 1YN5A 2DYOA 4AS1A 1QLBB 5C2TB 2N7JA 1DOXA 1STEA 4C56C 1EU3A 3NS1A 3ZJVA 2GB1A 1ZXIA 2SEBD 4N59A 1UGJA 1XXGA 3Q8AA 4RH6A 2LGIA 2SAKA 3W5UB 2CJNA 1XO3A 3AE7B 2W54A 2PTLA 2DYMA 1TY2A 3GP7A 1XEEA 1I4RA 1RYJA 4WWMA 4J3OD 1QOGA 1SEBD 3BZDB 2JZPA 4OZAA 4YWGG 1ET6A 2OEDA 1FNVA 2BS2B 1TYGB 2KDMA 1FNUA 5EE0A 1PUTA 1Y56A 2JYTA 2WDVB 1IGCA 3CWIA 4ITKA 1TKGA 2K22A 2ON8A 1ZOYB 2N9KA 1XLQA 2B76B 1QOAA 5HHDG 1GB1A 1C76A 1ESFA 1YMHE 1J7BA 3P1MA 3AE9B 1YJJA 2PMVA 2ONQA 2LHEA 5C3JB 4FXCA 4YSXB 1PFDA 2WDQB 1RFKA 1SB3C 1WXQA 3AE3B 1MHXA 1K53A 2BT6A 1F2RC 2WXOA 1KFYB 3I57A 4GLSC 4L2YA 3C8YA 2L1AA 2LHDA 1V8CA 1TS4A 1VZ6A 2LEKA 3AH7A 3KLSX 3P63A 4HJGE 4YTMB 3W9CB 2TSSA 2Q5WD 4A90A 5LNK1 3VR9B 4KGSA 3AMZA 2K5PA 1NEKB 3AE8B 2YEPB 1HEZE 2D5GA 4XDCA 5BMIA 1HXYD 3H8HA 1MHHE 2AQ3B 3J9CA 2WXQA 1SF0A 3MFGA 1JMLA 1ZE3D 3B2GA 2FUG1 1D5ZC 1FFUA 1FCLA 1VLBA 4ZOHC 3BVZA 4HKQA 3IT6B 1JROA 1UWMA 3KQ4A 1BMLC 5HFYA 4HKZE 1JW9D 3NRZA 2Y5PA 1NVID 3URYA 3U2SC 1YQ4B 3AE1B 2LMCA 1IUEA 1CJEA 1C77A 1NYQA 3BYYB 3DWMA 3ZJTA 1EU4A 3ABVB 2JYEA 2QEJC 4ZHPA 5BYSA 1PGBA 1ENFA 1TKEA 2WLBA 1KRHA 3BK1A 1UNSA 1ZXHA 3AB5A 5E6JA 1FM0D 4KGTA 1XLPA 2L52A 4UDUC 3P42A 1NI3A 2X38A 2ZW1A 2Y5CA 3U4EG 3Q8CA 1C4AA 2HTME 1IBXA 1E9MA 3E9SA 1SJHD 4JWSC 1I4QA 1V1PA 2BB5A 4B0MA 2VZKD 2WXPA 3ZGZA 5FR3A 4TQ1A 2BB6A 2RDHA 1SBBB 2WQYB 5T8IA 4ARCA 2WXIA 2K0PA 4US9A 3CIRB 2IGDA 1ZPSA 1E0ZA 2I2YA 2IJ0A 1L5PA 3HVZA 2K9XA 2V3NA 2W3SA 2AQ1B 3W2DA 1ACCA 2KAJA 2NTTA 4L1BA 1GB4A 1HZ6A 2ZW0A 1J7AA 1RWSA 1TY0A 2AX5A 3VR8B 3AEEB 1SXTA 2DWQA 1PDXA 4YSYB 1N60A 2KWDA 1WGKA 3TUOA 4RNAA 3U7ZA 1UUPA 4DXGA 1B9RA 3W1SA 1D6EC 4WAFA 4N6EB 3B2FA 4RF0A 1TKYA 3HVDA 1NENB 3NZ3A 2QILA 1SSNA 1K51A 4TSSA 2ICIA 1TJEA 3ZJUA 4JE3B 3DWGC 4RCOA 1SJED 1OFFA 1NYRA 2M0AA 4OZCA 5BMGA 4DXFA 2WDRB 1C9FA 3BWUD 4USAA 1SE2A 3VRBB 4XE0A 2AQ2B 2Y3AA 1F0ZA 1AYFA 2J53A 1VRAB 4ZRPA 4MT5A 1RM6C 3LXFA 3RPFC 4KGRA 3EGRA 3BVGA 2WXRA 1YN4A 3Q69A 3AEFB 1E10A 4A6QA 2PVGC 1FCCC 4MACA 2WU5B 1XF5L 4R3DA 3IAM1 4US8A 1FXAA 1V1OA 1FMAD 3Q8EA 2I38A 4L23A 1MPEA 3FILA 5FKAC 1DGJA 3TEXA 1B1ZA 3SEBA 1P7FA 1C4CA 5TSSA 2KACA 1WSPA 4DQOC 2WNMA 2PW9A 3MC0B 1JWMD 1YQ3B 2Z8LA 3E56A 3IAS1 1IGDA 4Q2JA 3AN1A 3SR6A 4LLGM 4JX1C 3NVZA 2BTEA 3R8BA 2WXNA 1L6UA 5D7GA 1QKZA 2JX5A 3LB8C 1JWAD 1FIQA 3T3OA 5EE9A 4HROA 1FRDA 4OVZA 3SFEB 4C7ZA 2V3PA 1TS3A 1L6VA 3L4PA 4REZA 4P16A 3BVMA 1ZDXA 4JWUC 2IGHA 4WIPA 1C79A 1FXIA 4GDLB 2L83A 1L0XB 1ZP0B 2IPKD 3VRAB 2GI9A 2K3UA 3NUHB 3AE5B 2XNAC 2W3RA 4IDIA 2INNE 3TEZA 1T5XD 1JWSD 4WURA 4IOIE 4ARIA 1MI0A 2E3TA 4N58A 1KF6B 3PZ8A 1DOIA 4WH4A 2BYTA 2WS3B 2BS3B 5GXGB 3V3XA 3RFZB 1JALA 3B9JA 5MPOA 1C4PA 3BIID 3ETRA 3IT4B 2EELA 2GRIA 2JWUA 3AE4B 4EE2A 1YJIA 1QOBA 3GB1A 4RF1A 4RFBA 2L32A 4KKJA 1ROEA 4NAWB 3WCQA 3EA6A 1AN8A 3O13A 1I7HA 1ZUD2 2QSDA 3T3NA 2WXKA 5HG2A 1D4BA 1IBXB 3W5VB 2LFIA 1HQRD 2MEKA 1V1PB 2JU6X 1TZOA 3NVWA 2J52A 2WXGA 2XN9C 2KN4A 1VZ8A 2RDGA 2G1EA 1FD6A 2WXJA 3BK2A 3P4QB 1GAQB 2KMMA 3TEWA 5EE3A 4TQ0A 1PYWD 4C7YA 3TSSA 3FC4A 4RGTA 2WXHA 1K50A 1VDVA 4D2KA 1OQQA 3EUB2 1ZDVA 1ET9A 1CZPA 2PIAA 3OWEB 2FBWB 1JWBD 2NMQA 4KX6B 4OZBA 1D5MC 4A9AA 3BYTB 2J4XA 2EKIA 2H88B 4B0EA 1OQRA 4MM3B 4XWTA 1AW7A 1AWDA 3AEDB 4YXDB 5I4DA 3P4SB 4NAMA 4RGMA 1SE3A 3AECB 5H8YE 4YTNB 1JWUD 2RMMA 2VZKB 1N63A 1K52A 3KWVA 4LK0M 1QQRA 1V97A 1P7EA 1QOFA 1N62A 3FAHA 3IXSA 1Q10A 1XLOA 3AEBB 3HUIA 5JXVA 2N0SB 4AQ7A 2LJIA 4JPSA 5D3IB 2FE8A 1JCKB 1HZ5A 1N5WA 1J7CA 5HI1A 2ACZB 2JQRB 3MJ5A 1MVKA 4ZYSA 5AUKA 1F2RI 2MH7A 2OHFA 3AE6B 1BXTA 4GDKB 1SE4A 1C78A 1WYGA 4P6VF 2W82A 4XWWA 3PO0A 2IGGA 1PGAA 4NJCA 2JSVX 3PZ7A 3SFDB 1XCQL 1QILA 3ZYYX 3AV8A 1FO4A 1KLUD 3FILB 4A55A 2RPVA 3AM9A 1YN3A 1JQ4A 4A8XC 2W55A 4CQNA 4TMAB 2KQ4X 2WXMA 1KTKA 4RGNA 1QF6A 2MJ3A 3AEGB 5BYRA 1FRRA 3ZQ4A 1YNTE 1GPXA 2QIEB 3R2IA 1WWTA 1XCTL 3P4PB 1F77A 1L4DB 5EE1A 5G5GA 1DYQA 1UWXA 3UI3A 5G5HA 3MHZA 2DBYA 1I4GA 1KH0A 2CU3A 5BYQA 5FK9C 4YTPB 3VQIA 3HRDD 3Q8BA 3GS2A 2YEPF 4KKIA 1N5XA 2V4IB 3NVYA 3P4RB 4OHJA 2CJOA 1I4XA 2WU2B 4HRSA 1I4PA 4YSZB 2G9HD 2JXTA 1L4ZB 1DOYA 1WRIA 1E7PB 2R61A 2MJDA 2M56B 1EWCA 2BS4B 2INPE 3Q8FA 5D3DA 4ZRQA 1LO5D 3MP9A 4LTUA 4HEA1 2J42A 1HA5A 1CK1A 2V0GA 2PVOD 5BMHA 1TS2A 4YT0B 1I4HA 2M19A 1PGXA 1JRPA 1EM7A 4PT5A 3I9V1 2QMTA 4NZLB 1L0YB 3LYYA 1FEHA 2BBCA 1M4VA 1GOZA 1T6BX 3N9YC 3AEAB 2HDEA 3KWLA 4WQMA 1E6EB 2WXFA 1FNWA 4XDDA 4H2AA 2MJEA 4MH8A 1L0VB 2DLBA 3U52E 4RGOS 3V05A 2BW2A 4ZHOA 1A70A 2N9LA 2NTSA 1XLNA 5AUIA 1CQVA 2PLPA 1FFVA 1D5XC 3AE2B 2LUMA 1QT9A 3R2TA 1VJKA 4O1NA 1BUIC 1SIJA 2H89B 1N61A 4IKGA 2QJLA 4C80A 5H92C 3NVVA 2WXLA 1KLGD 3TEYA 1EWYC 1T3QA 1VR9A 2IDYA 4M0WA 2E6XA 2WP9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L0X B;  1KLU D;  1UNS A;  1TS5 A;  2IPK D;  1YN5 A;  4UDU C;  1YN3 A;  2XNA C;  1STE A;  4C56 C;  1EU3 A;  1KTK A;  1T5X D;  1JWS D;  4RGN A;  2SEB D;  1SJH D;  4RH6 A;  1I4Q A;  1V1P A;  1XXG A;  2RDH A;  1SBB B;  1TY2 A;  3GP7 A;  1I4R A;  3R2I A;  2IJ0 A;  1F77 A;  2AQ1 B;  1SEB D;  3W2D A;  2NTT A;  3BZD B;  1ET6 A;  1DYQ A;  1FNV A;  1TY0 A;  1FNU A;  1SXT A;  1I4G A;  4RFB A;  3EA6 A;  5FK9 C;  1AN8 A;  3O13 A;  1UUP A;  4DXG A;  1D6E C;  1HQR D;  2QIL A;  1V1P B;  1ESF A;  4OHJ A;  4TSS A;  2ICI A;  2XN9 C;  4RCO A;  1SJE D;  1I4X A;  2RDG A;  4DXF A;  1I4P A;  2G9H D;  2R61 A;  1EWC A;  1PYW D;  1SE2 A;  5D3D A;  2AQ2 B;  1LO5 D;  3TSS A;  4RGT A;  1HA5 A;  1CK1 A;  1TS4 A;  3KLS X;  1TS2 A;  1I4H A;  1ET9 A;  3BVG A;  2TSS A;  1ENF A;  3OWE B;  1YN4 A;  1D5M C;  3BYT B;  2J4X A;  4NZL B;  1HXY D;  1L0Y B;  1V1O A;  2AQ3 B;  1AW7 A;  1M4V A;  1GOZ A;  5I4D A;  4RGM A;  5FKA C;  1SE3 A;  3MFG A;  1D5Z C;  1B1Z A;  1JWU D;  1FNW A;  3SEB A;  3BVZ A;  5TSS A;  3V05 A;  4RGO S;  2NTS A;  1CQV A;  3MC0 B;  1JWM D;  5D3I B;  2Z8L A;  1D5X C;  1JCK B;  3R2T A;  4O1N A;  3R8B A;  4ZYS A;  1BXT A;  3URY A;  1SE4 A;  1KLG D;  1TS3 A;  3BYY B;  1EU4 A;  3BVM A;  2QEJ C;  1QIL A; 
#chains in the Genus database with same CATH topology
 3DBH I;  2L76 A;  4C4V A;  4LDT D;  2N7J A;  2C60 A;  3FKY A;  1HTQ A;  3ZJV A;  1C1Y B;  2KD0 A;  1WGY A;  4HPM B;  5D2M B;  3AE7 B;  1TY2 A;  1MFW A;  1FXT B;  3GP7 A;  5AZH A;  3CST A;  3DBH B;  2ZNV B;  4B9K A;  2NS5 A;  2OED A;  1FNV A;  4I6N B;  3X23 A;  3A33 B;  2BWE S;  1Y56 A;  2ZZP B;  1S1Q B;  2WDV B;  1TKG A;  2B76 B;  1GB1 A;  1UBQ A;  4E74 A;  1T0S C;  3P1M A;  3AE9 B;  4X57 B;  2M4N A;  4K7W A;  5C3J B;  3ZO5 B;  2WDQ B;  1SB3 C;  1WGG A;  1F2R C;  1KFY B;  3C8Y A;  3UQB A;  4AOF A;  3JYU A;  1WXV A;  2TSS A;  2R2Q A;  2K5P A;  4W9J A;  3A4S C;  4XDC A;  5BMI A;  3UIO B;  4GDL A;  3WAN A;  2JF5 A;  2AQ3 B;  4EFO A;  1ZE3 D;  5TR5 A;  2ZCC A;  2DNF A;  3DBS A;  1J8C A;  2BQQ A;  3IT6 B;  4BKS A;  3HHM A;  1UWM A;  4XX5 A;  4FHJ A;  1WY8 A;  4HKZ E;  2IND C;  1JW9 D;  3NRZ A;  1NVI D;  3PRE A;  4NNJ B;  1YQ4 B;  1IUE A;  3MTN B;  1YX5 B;  2K6Q A;  3ZJT A;  1EU4 A;  1PGB A;  3APF A;  1TKE A;  1EF1 A;  1FM0 D;  2ZPN A;  1LXD A;  4NAW A;  4IWO A;  2ZW1 A;  1P98 A;  4ANU A;  2DEN B;  4S17 A;  3E9S A;  3EFC A;  4B0M A;  2WXP A;  3ZGZ A;  3DPD A;  5FR3 A;  4TQ1 A;  3RNG C;  2BB6 A;  2WXI A;  2IGD A;  2I2Y A;  3Q3J A;  2IJ0 A;  4JGH B;  3B0A A;  4DWF A;  3W2D A;  1ACC A;  3VR8 B;  1M94 A;  2L05 A;  2DWQ A;  1PDX A;  2RGF A;  1HTO A;  3TUO A;  4NPN A;  4MM3 A;  5E6N A;  3W1S A;  3JVZ X;  2RDB C;  4WAF A;  3WAL A;  2XK5 B;  3NZ3 A;  2JRH A;  1SSN A;  1K51 A;  1RFA A;  3PTF C;  2ICI A;  1TJE A;  4P1B C;  4JE3 B;  3DWG C;  4MGK E;  1OEY A;  2M0A A;  3PVL A;  3RCZ A;  2NCN A;  2KX3 A;  2YVC A;  1SE2 A;  2Y3A A;  4MT5 A;  2R2O A;  3IBE A;  3L0W B;  4HDQ A;  4GDK A;  2KDF B;  3EGR A;  3BVG A;  3VAW A;  4A6Q A;  2WU5 B;  1V1O A;  1FMA D;  1MPE A;  1B1Z A;  4JQW C;  3A9J A;  2K8H A;  4KSK C;  3PS6 A;  2LAS A;  1C4C A;  5TSS A;  1WSP A;  2VH1 A;  2KO3 A;  4FBJ B;  3DBR I;  2NPT B;  2PW9 A;  3MC0 B;  3SR6 A;  4Q2J A;  2HTH A;  1E8Y A;  3TBL D;  5D7G A;  1QKZ A;  3LB8 C;  1JWA D;  1FRD A;  3M95 A;  2V3P A;  4ANV A;  4GIV A;  2LGS A;  2V9H A;  2PEA A;  5AEK B;  2LRW A;  2J0M A;  1WMH A;  1L0X B;  2MBB B;  1LGR A;  1BT0 A;  3VRA B;  3DBR B;  3NUH B;  3AE5 B;  5CHV C;  4IDI A;  2INN E;  4HK2 A;  1TBE A;  3TEZ A;  4BKT A;  3SD5 A;  2Z59 B;  2AWT A;  2E3T A;  2IY1 B;  4F7Z A;  3R7Q A;  1DOI A;  1GG3 A;  3VH3 B;  2KJR A;  5GXG B;  5LXH A;  2WX0 A;  3B9J A;  3ETR A;  1JRU A;  3IT4 B;  2GRI A;  3EC8 A;  4EE2 A;  4KZC A;  2LVQ A;  1QOB A;  4EKU A;  4RF1 A;  2L32 A;  1V6E A;  1ROE A;  3WCQ A;  3EA6 A;  2JVC A;  3W5V B;  2OJR A;  1F1H A;  1HQR D;  2MEK A;  1VZ8 A;  2G1E A;  1RLF A;  3P4Q B;  1GAQ B;  4KIK A;  2J7Q B;  1PYW D;  1V80 A;  1V9J A;  5KHQ A;  4QAY A;  1Z2M A;  1K50 A;  5DPT A;  2N9E B;  1ET9 A;  3OWE B;  4LNF A;  4KX6 B;  4K1R B;  3BYT B;  2EKI A;  4PYZ A;  2PJH A;  2C7H A;  4B0E A;  2BYE A;  3V61 A;  5I4D A;  4RGM A;  5H8Y E;  3TL5 A;  5D6J B;  2VZK B;  4LK0 M;  1QQR A;  1V97 A;  5E6P A;  4DHZ E;  1N62 A;  2Z0E B;  3IXS A;  1Q10 A;  2OJW A;  3HUI A;  4AQ7 A;  2D10 A;  1MVK A;  2KMA A;  1BXT A;  1E8X A;  3WA0 A;  3U7D A;  2FCQ A;  4XWW A;  2IGG A;  2LGY A;  3ZIM A;  4DHJ D;  3LJ3 A;  4G11 A;  4DXA B;  4A55 A;  1WX8 A;  3DVG Y;  4HCN B;  3L13 A;  4M8M A;  1JQ4 A;  4A8X C;  4AJW A;  5DPW A;  3V60 A;  3DBL I;  1KTK A;  4IWP A;  4RGN A;  2L8J A;  2UYZ B;  1WJU A;  1TIF A;  2K8B A;  2REX A;  2QIE B;  1WWT A;  1V5T A;  1XCT L;  2EMS A;  1F77 A;  4MGY E;  1EO6 A;  3V6E B;  3R3M A;  2FUH B;  1NDD A;  3QX1 A;  3UI3 A;  1I4G A;  2CU3 A;  1IYF A;  3HRD D;  4DDG D;  4KKI A;  2D3C A;  3NVY A;  4FHK A;  4W9K A;  2WU2 B;  2IY0 B;  2R61 A;  2MJD A;  4MGZ E;  1EWC A;  2BS4 B;  2INP E;  3Q8F A;  5D3D A;  1LO5 D;  2KJH B;  2J42 A;  2IYD B;  3AUL A;  3RZF A;  1CK1 A;  1OGW A;  4ZRI A;  4PT5 A;  2QMT A;  4TKN A;  3RYT A;  1L0Y B;  5JZE B;  1FEH A;  1WGD A;  3DVG X;  3KWL A;  2ZEQ A;  4MH8 A;  1SE9 A;  2KWV B;  3N1Z C;  2DLB A;  3QJZ A;  2BW2 A;  1A70 A;  3ML9 A;  3A4R A;  4FAD A;  1XQQ A;  3IG3 A;  1P0R A;  2O2V B;  5J17 A;  1SIJ A;  1N61 A;  4M02 A;  1XD3 B;  1WIA A;  2OOB B;  2GBN A;  2WXL A;  2HD5 B;  1OEY J;  2LJ5 A;  3TCA A;  1VR9 A;  4M0W A;  2E6X A;  4LCD E;  1R7S A;  1E90 A;  1VZ7 A;  2WHI A;  3ZUN A;  1YN5 A;  2DYO A;  5C2T B;  1DOX A;  4EOY A;  4IM3 A;  2GB1 A;  2HE7 A;  3N1X C;  2XK5 A;  2FNJ B;  3SHQ A;  1UGJ A;  3Q8A A;  1NI2 A;  3Q6B A;  3AU5 A;  1WH3 A;  4OVV A;  1Q5W B;  1XO3 A;  2PTL A;  2DYM A;  2KQ7 A;  1XEE A;  4WWM A;  1VCB A;  4J3O D;  3K9O B;  1SEB D;  4K7U A;  2CS4 A;  3A9J B;  2WGS A;  1V86 A;  3QQ8 B;  4LDT B;  1IGC A;  2ON8 A;  2KJ6 A;  2N9K A;  1XLQ A;  1ZKH A;  1ESF A;  2CU1 A;  2N1V A;  2ZJD A;  4FJV B;  5DPR A;  2NPT A;  3QC8 B;  4HPL B;  4HCP B;  5CHF A;  4FXC A;  1PFD A;  1MHX A;  1Y8R C;  2BT6 A;  1WE7 A;  3I57 A;  4GLS C;  4L2Y A;  1V8C A;  1VZ6 A;  3AH7 A;  3KLS X;  4HJG E;  4YTM B;  4K3C A;  3L10 B;  1K8R B;  5LNK 1;  4CO7 A;  1ISN A;  4K81 A;  2D5G A;  3C19 A;  1YIW A;  1MHH E;  3J9C A;  2WXQ A;  1SF0 A;  1YQB A;  1JML A;  1WR6 E;  4MSM B;  3A9K B;  3BVZ A;  1R4N B;  3N30 A;  2DZK A;  4GOC A;  2KDB A;  4WJP A;  2N7D A;  4BVU C;  4ICU A;  3NHE B;  2FAZ A;  1WM2 A;  2MCN B;  3RZW C;  3K9P B;  3URY A;  3ZDT A;  3AE1 B;  3QA8 A;  1C77 A;  3BYY B;  3ABV B;  2DYB A;  1ENF A;  2KWC A;  3NG0 A;  3CF6 E;  2VRR B;  4IM0 A;  4KGT A;  3HK0 A;  4IC7 B;  4AP4 C;  4KSL C;  1C4A A;  2G4S A;  3VUW A;  4JIO U;  4NQL B;  2MHJ A;  2MW5 A;  1HE8 A;  2K0P A;  4US9 A;  5EDS A;  3CIR B;  5G55 A;  5G2N A;  3KH0 A;  4HLE A;  4BFR A;  1L5P A;  2K9X A;  2V3N A;  1TTN A;  2W3S A;  2ZW0 A;  1N60 A;  4WWN A;  2I1K A;  2QC8 A;  3ZW3 A;  2KTR A;  3NZS A;  1D6E C;  1FPY A;  1TKY A;  5AZG A;  3L08 A;  2O6V D;  2QIL A;  4TSS A;  4RCO A;  1SJE D;  4EZL A;  1NYR A;  1WGH A;  5BMG A;  3RT3 B;  2MBH A;  2WDR B;  4FLH A;  4USA A;  3VRB B;  3I5J C;  2AQ2 B;  1F0Z A;  4ZRP A;  1VRA B;  2JT4 B;  3H7S A;  2HJ1 A;  2GBR A;  5HKH A;  4WQO B;  2KVR A;  1YN4 A;  3Q69 A;  1U4A A;  3QK0 A;  2KWU B;  1FCC C;  3LDZ E;  3H7P B;  4FJZ A;  1WXS A;  2AL3 A;  1DGJ A;  3TEX A;  1QZE A;  2KAC A;  2N1W A;  3EHV A;  3IAS 1;  1LFD A;  2KZR A;  5JHA A;  1V5O A;  2W9N A;  2BTE A;  2WXN A;  1FIQ A;  3BIN A;  4MDK E;  4OVZ A;  3SFE B;  4C7Z A;  3DOW A;  4FA6 A;  4LJP B;  3TMP B;  4REZ A;  2KX0 A;  2EKE C;  1I35 A;  1ZDX A;  3B1L X;  2IGH A;  4WIP A;  3UQA A;  3DQV A;  1C79 A;  2IPK D;  2KT7 A;  2K3U A;  3ENE A;  2W3R A;  4XYC A;  4EUT A;  4F8C B;  1T5X D;  1JWS D;  3KUC B;  4IOI E;  4JL9 A;  2LGD A;  4II2 B;  2GLS A;  2GOW A;  2IBI B;  1KF6 B;  2MX2 A;  2WS3 B;  3RFZ B;  5E6O A;  3MC8 A;  2J0J A;  1JAL A;  2A4Z A;  2RR9 A;  3BII D;  2GBM A;  3ZRF A;  2JWU A;  2K1F A;  1XT9 B;  1YJI A;  4KKJ A;  2LZ6 A;  4MJS B;  1I7H A;  1ZUD 2;  3CSF A;  2QSD A;  2WXK A;  5HG2 A;  1IBX B;  1ZGU B;  4GMV A;  2J52 A;  1UZX B;  1GUA B;  2XN9 C;  2FCN A;  4KZ0 A;  3VFK A;  1FD6 A;  4M0W B;  5D94 A;  2O2V A;  4AJY B;  3TJP A;  4M8N A;  2WXH A;  3MJW A;  3EUB 2;  2KMC A;  1CZP A;  3NS8 A;  3GE3 C;  4HDO A;  2NMQ A;  4KV2 A;  2QDF A;  1D5M C;  2B3A A;  2LVO A;  4OZB A;  5L95 C;  4P7I A;  4A3P A;  3R66 C;  3AEC B;  4M00 A;  4WJN A;  1JWU D;  4GN1 A;  1G6J A;  1P7E A;  1QOF A;  4PS3 A;  4S0R A;  1XLO A;  5JXV A;  2N0S B;  2LJI A;  1H4R A;  2JQR B;  3MJ5 A;  5AUK A;  1F2R I;  2KDE B;  4K7S A;  4C00 A;  4P6V F;  3RNF C;  4MGI E;  3PZ7 A;  1V49 A;  1XCQ L;  1QIL A;  4RMA A;  2FIF A;  3AV8 A;  1FO4 A;  3PRM B;  2KQ4 X;  2WXM A;  3L17 A;  2YLM A;  3RUI B;  2MRP A;  5BYR A;  3ZQ4 A;  1GPX A;  1MG8 A;  3R2I A;  5J18 A;  5L83 A;  3OAW A;  1I42 A;  5KHO A;  5G5G A;  1DYQ A;  1J19 A;  5G5H A;  3MHZ A;  2UWQ A;  5BYQ A;  3PV1 A;  3RNC C;  4WJO A;  5FK9 C;  4YTP B;  4M01 A;  4MH0 E;  3VQI A;  1SGH A;  3I63 C;  3A9K A;  1N5X A;  1I4X A;  1I4P A;  5IKC M;  2G9H D;  2RD0 A;  1WRI A;  3VDZ A;  3VXW A;  1CMX B;  4BZA A;  2M56 B;  3ZVV A;  2L00 B;  3DVN U;  2KHW B;  4HEA 1;  2PVO D;  5BMH A;  1I4H A;  1JRP A;  3ZDM C;  4II3 B;  3I9V 1;  2FCM A;  3DHH C;  1M4V A;  3AEA B;  2KLC A;  1E6E B;  2DZI A;  1FNW A;  2WXF A;  3GZN I;  3V05 A;  4RGO S;  4MEM A;  1WE6 A;  2N9L A;  2NTS A;  4CYE A;  5BO4 B;  2K25 A;  1D5X C;  2ZPY A;  2LUM A;  1QT9 A;  4O1N A;  1VJK A;  1BUI C;  2MP2 A;  4XGA B;  1TGZ B;  3ZRC A;  2D3A A;  5H92 C;  4IG7 B;  3SDL C;  1T3Q A;  2KTR B;  2DZJ A;  3V62 A;  3V6C B;  3GZN B;  2PKO A;  1TS5 A;  5CHW A;  1QLB B;  4K3B A;  4NJ6 A;  5CX3 A;  1EU3 A;  4TUU A;  3QAQ A;  3NS1 A;  2SEB D;  4N59 A;  3MC9 A;  2LD9 A;  2ASQ A;  1I4R A;  4G50 A;  3P2B A;  1X1M A;  1QOG A;  3BZD B;  2JZP A;  4OZA A;  1ET6 A;  2BS2 B;  3PSE B;  1PUT A;  3L16 A;  4RM9 A;  3C0R B;  4ITK A;  2K22 A;  3H7P A;  5JH5 C;  3ML8 A;  5HHD G;  1C76 A;  4PK1 A;  1YMH E;  4LJO B;  1J7B A;  2ONQ A;  2JZ3 B;  2I1J A;  2KC1 A;  2WXO A;  3P63 A;  1TS4 A;  3W9C B;  2GMI C;  4A90 A;  3VR9 B;  4KGS A;  2CKH B;  1NEK B;  3AE8 B;  2YEP B;  1HEZ E;  3H8H A;  5IO9 A;  1D3Z A;  3B2G A;  3Q3F A;  4W9H A;  2N9P C;  1VLB A;  3M63 B;  2DHZ A;  2BYF A;  3RMK C;  3B08 A;  3PT2 B;  1T0Q C;  5HFY A;  4ZRJ A;  4IM2 A;  2Y5P A;  1P3Q U;  3U2S C;  1PQS A;  2LMC A;  4FUL A;  1CJE A;  2X8X X;  3ZKJ C;  1C3T A;  1NYQ A;  2QEJ C;  2QCZ A;  2WLB A;  3BK1 A;  1UNS A;  1ZXH A;  3AB5 A;  5E6J A;  4UDU C;  2WWZ A;  4W9F A;  3P42 A;  3UF8 A;  2FCS A;  2X38 A;  4MJS A;  3ECI A;  3U4E G;  3Q8C A;  1IBX A;  2M1M A;  3MHS D;  3IHP C;  1I4Q A;  2BB5 A;  2VZK D;  4P1C C;  3TIX A;  4G3X B;  2RDH A;  1SBB B;  5T8I A;  2GBK A;  1ZPS A;  4BBN F;  1KOT A;  2K39 A;  2AQ1 B;  2NTT A;  3KYD D;  2WYQ A;  1HZ6 A;  4I6L B;  1J7A A;  1TY0 A;  2AX5 A;  3AEE B;  4XC2 A;  2JZZ A;  3D32 A;  2KWD A;  3S2A A;  1WGK A;  1E5W A;  4RNA A;  2N9X A;  1B9R A;  1H8C A;  4RF0 A;  4DHZ B;  1WZ3 A;  4HJK A;  4PS7 A;  4I6P A;  3BWU D;  4XE0 A;  1AYF A;  3LXF A;  2KVZ A;  3RPF C;  2D11 A;  3OJ3 A;  1E10 A;  1UD7 A;  4HVB A;  4ANW A;  4MAC A;  4US8 A;  1FXA A;  2IO0 B;  1E8Z A;  2I38 A;  4L23 A;  4ZYN A;  2DX5 B;  1TZ1 A;  4BKS D;  2O6V B;  1R4N I;  4HXD A;  2WNM A;  2DAJ A;  2MQJ A;  1JWM D;  1YQ3 B;  2Z8L A;  3E56 A;  4A3O A;  2KLG A;  4JX1 C;  1KM7 A;  3R8B A;  3ZXV A;  2JX5 A;  3NY5 A;  2KDI A;  4G0N B;  2PPH A;  2MLB A;  1TS3 A;  4DDI D;  3L4P A;  4P16 A;  2FID A;  3M3J A;  4URK A;  1UGM A;  1FXI A;  3U30 A;  1ZP0 B;  4MEL A;  2D07 B;  3APC A;  2XNA C;  5C23 A;  3KUZ A;  2BKF A;  3T9L A;  4WUR A;  2NBW B;  4ARI A;  1MI0 A;  3W1Y A;  4N58 A;  4LNI A;  1N6Z A;  2JUO A;  3PZ8 A;  4BOS C;  4WH4 A;  3WAM A;  3ZLZ A;  5MPO A;  3DVN V;  3QCA A;  3HM3 A;  4W9I A;  3HIZ A;  2JY6 A;  3AE4 B;  2KFJ A;  3L54 A;  3GB1 A;  4RM8 A;  4DK5 A;  2MP2 B;  2LFI A;  2JXX A;  3VTV A;  1V1P B;  3NVW A;  3ZTD A;  4BKG A;  2WXJ A;  5EE3 A;  4C7Y A;  5IAA C;  1WR1 A;  3FC4 A;  1UEL A;  4RGT A;  1WFY A;  4FN2 A;  1VDV A;  4D2K A;  1OQQ A;  2NBV B;  3QWZ B;  2PIA A;  2M0X A;  2RPQ A;  2FBW B;  1JWB D;  4A9A A;  2H88 B;  3ZTC A;  4IUM B;  3ZNH B;  1OQR A;  2KTF A;  3ONS A;  1AW7 A;  3AED B;  5DCN A;  4YXD B;  3OJ4 B;  1SE3 A;  3PHW B;  4YTN B;  3RN9 C;  1WZ0 A;  1K52 A;  3KWV A;  2WDT B;  2J0K A;  4BOZ B;  4E71 A;  3OLM D;  3PLU A;  4JPS A;  1N5W A;  2IZV B;  1GC7 A;  5HI1 A;  2ACZ B;  4ZYS A;  2L0F A;  2C5L C;  3AE6 B;  4YL8 A;  3H1U A;  4EEW A;  1LQB A;  1WRD B;  1PGA A;  4NJC A;  3APD A;  4J6I A;  2LI5 A;  2NVU I;  3SFD B;  1KLU D;  3FIL B;  2QHO A;  3PRP B;  1YN3 A;  2W55 A;  4CQN A;  3IVF A;  3KYC D;  1SIF A;  1QF6 A;  2MJ3 A;  1F9J A;  1UH6 A;  3NJT A;  2N7E A;  3PZD A;  3WIM A;  3RNB C;  1YX6 B;  1L4D B;  1WXM A;  3PHX B;  1WJN A;  4NY0 A;  3U8Z A;  1L7Y A;  4LNN A;  3Q8B A;  2ZVO A;  3GS2 A;  4LNO A;  2YEP F;  2V4I B;  2D3G A;  3P4R B;  1WF9 A;  2LGX A;  3ZNG C;  1E7U A;  1WXA A;  2CJO A;  1E7V A;  4HRS A;  4YSZ B;  1L4Z B;  3WAP A;  1EUV B;  2V3S A;  4ZRQ A;  4LTU A;  2KN5 A;  2JPH A;  4F1S A;  1TS2 A;  2DAF A;  4YT0 B;  2M19 A;  1PGX A;  2G45 B;  3VUX A;  3DDC B;  1GNU A;  1EM7 A;  2G4D B;  3KW5 B;  3RNE C;  2BBC A;  3PLV A;  1GOZ A;  1T6B X;  1YJ1 A;  2A5U A;  1P1A A;  3JW0 X;  4H2A A;  1L0V B;  1EF5 A;  4ZHO A;  1WX9 A;  5AUI A;  3GOE A;  1CQV A;  2PLP A;  4DBG A;  1FFV A;  4PYU A;  3AE2 B;  3Q3O C;  1MJD A;  2BYV E;  5AZF A;  2QJL A;  3EEC A;  1YD8 U;  3NVV A;  5FR6 A;  1R4M I;  1KLG D;  1T0R C;  5JHB A;  1WX7 A;  2C7M B;  1EWY C;  1IP9 A;  2IDY A;  2MBQ A;  3SU8 X;  1RRB A;  5IA7 A;  1Q0W B;  2DZM A;  4IWQ A;  4OW0 A;  3N20 C;  1YOV B;  4AS1 A;  2KKC A;  1STE A;  4C56 C;  4ASW C;  2L3Z A;  1KLV A;  1ZXI A;  3IFW B;  4RH6 A;  1XXG A;  1R4M B;  4GSW A;  2LGI A;  2SAK A;  3UIP B;  3W5U B;  5IP4 D;  5GMV A;  2CJN A;  2LVP A;  2C7N B;  2W54 A;  1UBI A;  4ZRK A;  1RYJ A;  3KUD B;  4A20 A;  4YWG G;  3UGB B;  1TYG B;  2KDM A;  1FNU A;  5EE0 A;  4N9F 4;  4OVU A;  2JYT A;  2BPS A;  2KFK B;  3CWI A;  1ZOY B;  3DCG A;  1QOA A;  3ALB A;  4KVG B;  2C9W B;  2O6V A;  1YJJ A;  2PMV A;  2LHE A;  4HWI B;  5CTR C;  3I3T B;  4YSX B;  2D3B A;  1RFK A;  1UF0 A;  1WXQ A;  3AE3 B;  1K53 A;  2L1A A;  2LHD A;  4DHJ B;  2LEK A;  1WI0 A;  2MSE D;  2V1Y A;  2Q5W D;  2IO3 B;  3EFU A;  3OG5 A;  3AMZ A;  3JSV B;  2NBU A;  1HXY D;  3MFG A;  2FUG 1;  1D5Z C;  1FFU A;  1FCL A;  4ZOH C;  3PRZ A;  4HKQ A;  1JRO A;  4W9D A;  3KQ4 A;  1BML C;  3HM6 X;  2KYW A;  2NR2 A;  3ZXR A;  2LWP A;  4GXB A;  3O65 B;  3DWM A;  2JYE A;  4ZHP A;  5BYS A;  1J0G A;  3A1Q B;  1KRH A;  2GBJ A;  3RNA C;  4B6W A;  1XLP A;  2L52 A;  4MSQ B;  1NI3 A;  4AWJ A;  2LRU A;  4CHK A;  5DPS A;  2Y5C A;  2HTM E;  3NOB A;  1E9M A;  3N1Y C;  1SJH D;  4JWS C;  1V1P A;  4TV3 A;  2AL6 A;  2BGF A;  4ZDV A;  2WQY B;  3KVF B;  4ARC A;  3AI5 A;  4BAX A;  1E0Z A;  5C1Z A;  3HVZ A;  2BVC A;  2PE9 A;  2KAJ A;  4L1B A;  1GB4 A;  1RWS A;  4C4V B;  1SXT A;  3QHT A;  5IOI A;  4YSY B;  3U7Z A;  1UUP A;  3W1S C;  4DXG A;  4N6E B;  3B2F A;  3Q3M C;  3HVD A;  1NEN B;  4LNK A;  5IN7 A;  3ZJU A;  1OFF A;  4OZC A;  4DXF A;  1C9F A;  1WJ6 A;  3PGE A;  3VTW A;  3RUL A;  1OTR B;  5J2R A;  2J53 A;  1V81 A;  3ZNZ B;  1RM6 C;  3N3K B;  4KGR A;  1P9D U;  2WXR A;  3GE8 C;  2XEW A;  3AEF B;  5LXI B;  2PVG C;  1XF5 L;  4R3D A;  3IAM 1;  4W9G A;  3Q8E A;  3FIL A;  5FKA C;  3VHT C;  3SEB A;  1P7F A;  4EZJ A;  3DHI C;  4DQO C;  4GGQ A;  2KK8 A;  1IGD A;  3AN1 A;  4LLG M;  3NVZ A;  1WJ4 A;  2AYO B;  1L6U A;  1WGR A;  2MA9 B;  3T3O A;  2KNB A;  5EE9 A;  2M8S A;  4HRO A;  2K6D B;  1L6V A;  4PS8 A;  3CMM B;  1ZW7 A;  3BVM A;  4ACF A;  4JWU C;  1A5R A;  4GDL B;  2MWS B;  2L83 A;  2GI9 A;  4WWO A;  2KXJ A;  3H9D A;  1F52 A;  4AUQ C;  3DBL B;  3R7R A;  2L0T A;  2BWF A;  2BYT A;  2BS3 B;  3WAO A;  2ZVN A;  2D2Q A;  3V3X A;  1C4P A;  2HJ8 A;  2AEH A;  2EEL A;  4WJQ A;  3M62 B;  2RSU A;  4RFB A;  4NAW B;  2ZCB A;  1AN8 A;  2N4F A;  3O13 A;  2MBE A;  3T3N A;  1AAR A;  2BF8 B;  1D4B A;  3AU4 A;  2JU6 X;  1E8W A;  1TZO A;  2WXG A;  2KN4 A;  2RDG A;  3BK2 A;  2KMM A;  3TEW A;  4TQ0 A;  2KC2 A;  3TSS A;  4W9L A;  1GJZ A;  1ZDV A;  3VVW B;  2J4X A;  3T8M A;  3Q2A C;  3RD2 A;  1OQY A;  4MM3 B;  4XWT A;  2VH2 A;  1AWD A;  3P4S B;  1VD2 A;  4NAM A;  1KJT A;  3QIJ A;  2RMM A;  1N63 A;  1LM8 B;  2JWZ A;  3FAH A;  3AEB B;  2UU7 A;  5D3I B;  2FE8 A;  1JCK B;  1HZ5 A;  2KQS A;  1IPG A;  1J7C A;  2EMT A;  2G3Q B;  1WYW B;  2KAN A;  2M17 A;  2MH7 A;  2OHF A;  4GU2 A;  4NJ7 A;  4GDK B;  1SE4 A;  1C78 A;  4HPP A;  1WYG A;  2W82 A;  2XBB C;  3PO0 A;  4EZK A;  2JSV X;  2ZNV C;  2IO2 B;  3ZYY X;  2INC C;  4NQK E;  2LUE A;  4XZ4 A;  2RPV A;  3AM9 A;  4W9C A;  2KFK A;  4W9E A;  2LXA A;  4TMA B;  3X0W A;  4ICV A;  2JRI B;  3QAR A;  3Q14 C;  3AEG B;  1FRR A;  3VTU A;  3AXC A;  3Q3N C;  1YNT E;  2Y5B B;  4E3C A;  3PPA A;  3UIN B;  1Q1O A;  2L7R A;  3P4P B;  4KDI C;  5EE1 A;  2CR5 A;  1WMH B;  1UWX A;  4FJY A;  2DBY A;  3JSV A;  1KH0 A;  2BKR B;  2Z0D B;  1MG4 A;  3RI7 C;  4WWP A;  4OHJ A;  3DHG C;  3VH4 B;  5LLI A;  1Z5S B;  3NZU A;  1S3S G;  2JXT A;  1DOY A;  1E7P B;  2LXC A;  1WM3 A;  3MP9 A;  2CHW A;  1HA5 A;  2V0G A;  2V4L A;  3H6N A;  1TT5 B;  2WX1 A;  1NBF C;  3BY4 B;  3A1Q A;  4NZL B;  3LYY A;  3N32 A;  3N9Y C;  2HDE A;  4WQM A;  2KOX A;  4JLC A;  4XDD A;  2MJE A;  1GC6 A;  4WAA A;  3U52 E;  1RAX A;  1T0Y A;  2CHX A;  1XLN A;  4KDL B;  1L2N A;  4IW0 A;  4KIK B;  3R2T A;  1V2Y A;  2H89 B;  4IKG A;  4B95 A;  2K8C A;  4C80 A;  3ZNI D;  4BBN C;  3TEY A;  2MBO A;  2PE6 B;  2IO1 B;  4GB9 A;  4ANX A;  3VUY A;  2CHZ A;  2WP9 B; 
#chains in the Genus database with same CATH homology
 1R7S A;  1VZ7 A;  4OW0 A;  2PKO A;  1TS5 A;  1YN5 A;  2DYO A;  4AS1 A;  1QLB B;  5C2T B;  2N7J A;  1DOX A;  1STE A;  4C56 C;  1EU3 A;  3NS1 A;  3ZJV A;  2GB1 A;  1ZXI A;  2SEB D;  4N59 A;  1UGJ A;  1XXG A;  3Q8A A;  4RH6 A;  2LGI A;  2SAK A;  3W5U B;  2CJN A;  1XO3 A;  3AE7 B;  2W54 A;  2PTL A;  2DYM A;  1TY2 A;  3GP7 A;  1XEE A;  1I4R A;  1RYJ A;  4WWM A;  4J3O D;  1QOG A;  1SEB D;  3BZD B;  2JZP A;  4OZA A;  4YWG G;  1ET6 A;  2OED A;  1FNV A;  2BS2 B;  1TYG B;  2KDM A;  1FNU A;  5EE0 A;  1PUT A;  1Y56 A;  2JYT A;  2WDV B;  1IGC A;  3CWI A;  4ITK A;  1TKG A;  2K22 A;  2ON8 A;  1ZOY B;  2N9K A;  1XLQ A;  2B76 B;  1QOA A;  5HHD G;  1GB1 A;  1C76 A;  1ESF A;  1YMH E;  1J7B A;  3P1M A;  3AE9 B;  1YJJ A;  2PMV A;  2ONQ A;  2LHE A;  5C3J B;  4FXC A;  4YSX B;  1PFD A;  2WDQ B;  1RFK A;  1SB3 C;  1WXQ A;  3AE3 B;  1MHX A;  1K53 A;  2BT6 A;  1F2R C;  2WXO A;  1KFY B;  3I57 A;  4GLS C;  4L2Y A;  3C8Y A;  2L1A A;  2LHD A;  1V8C A;  1TS4 A;  1VZ6 A;  2LEK A;  3AH7 A;  3KLS X;  3P63 A;  4HJG E;  4YTM B;  3W9C B;  2TSS A;  2Q5W D;  4A90 A;  5LNK 1;  3VR9 B;  4KGS A;  3AMZ A;  2K5P A;  1NEK B;  3AE8 B;  2YEP B;  1HEZ E;  2D5G A;  4XDC A;  5BMI A;  1HXY D;  3H8H A;  1MHH E;  2AQ3 B;  3J9C A;  2WXQ A;  1SF0 A;  3MFG A;  1JML A;  1ZE3 D;  3B2G A;  2FUG 1;  1D5Z C;  1FFU A;  1FCL A;  1VLB A;  4ZOH C;  3BVZ A;  4HKQ A;  3IT6 B;  1JRO A;  1UWM A;  3KQ4 A;  1BML C;  5HFY A;  4HKZ E;  1JW9 D;  3NRZ A;  2Y5P A;  1NVI D;  3URY A;  3U2S C;  1YQ4 B;  3AE1 B;  2LMC A;  1IUE A;  1CJE A;  1C77 A;  1NYQ A;  3BYY B;  3DWM A;  3ZJT A;  1EU4 A;  3ABV B;  2JYE A;  2QEJ C;  4ZHP A;  5BYS A;  1PGB A;  1ENF A;  1TKE A;  2WLB A;  1KRH A;  3BK1 A;  1UNS A;  1ZXH A;  3AB5 A;  5E6J A;  1FM0 D;  4KGT A;  1XLP A;  2L52 A;  4UDU C;  3P42 A;  1NI3 A;  2X38 A;  2ZW1 A;  2Y5C A;  3U4E G;  3Q8C A;  1C4A A;  2HTM E;  1IBX A;  1E9M A;  3E9S A;  1SJH D;  4JWS C;  1I4Q A;  1V1P A;  2BB5 A;  4B0M A;  2VZK D;  2WXP A;  3ZGZ A;  5FR3 A;  4TQ1 A;  2BB6 A;  2RDH A;  1SBB B;  2WQY B;  5T8I A;  4ARC A;  2WXI A;  2K0P A;  4US9 A;  3CIR B;  2IGD A;  1ZPS A;  1E0Z A;  2I2Y A;  2IJ0 A;  1L5P A;  3HVZ A;  2K9X A;  2V3N A;  2W3S A;  2AQ1 B;  3W2D A;  1ACC A;  2KAJ A;  2NTT A;  4L1B A;  1GB4 A;  1HZ6 A;  2ZW0 A;  1J7A A;  1RWS A;  1TY0 A;  2AX5 A;  3VR8 B;  3AEE B;  1SXT A;  2DWQ A;  1PDX A;  4YSY B;  1N60 A;  2KWD A;  1WGK A;  3TUO A;  4RNA A;  3U7Z A;  1UUP A;  4DXG A;  1B9R A;  3W1S A;  1D6E C;  4WAF A;  4N6E B;  3B2F A;  4RF0 A;  1TKY A;  3HVD A;  1NEN B;  3NZ3 A;  2QIL A;  1SSN A;  1K51 A;  4TSS A;  2ICI A;  1TJE A;  3ZJU A;  4JE3 B;  3DWG C;  4RCO A;  1SJE D;  1OFF A;  1NYR A;  2M0A A;  4OZC A;  5BMG A;  4DXF A;  2WDR B;  1C9F A;  3BWU D;  4USA A;  1SE2 A;  3VRB B;  4XE0 A;  2AQ2 B;  2Y3A A;  1F0Z A;  1AYF A;  2J53 A;  1VRA B;  4ZRP A;  4MT5 A;  1RM6 C;  3LXF A;  3RPF C;  4KGR A;  3EGR A;  3BVG A;  2WXR A;  1YN4 A;  3Q69 A;  3AEF B;  1E10 A;  4A6Q A;  2PVG C;  1FCC C;  4MAC A;  2WU5 B;  1XF5 L;  4R3D A;  3IAM 1;  4US8 A;  1FXA A;  1V1O A;  1FMA D;  3Q8E A;  2I38 A;  4L23 A;  1MPE A;  3FIL A;  5FKA C;  1DGJ A;  3TEX A;  1B1Z A;  3SEB A;  1P7F A;  1C4C A;  5TSS A;  2KAC A;  1WSP A;  4DQO C;  2WNM A;  2PW9 A;  3MC0 B;  1JWM D;  1YQ3 B;  2Z8L A;  3E56 A;  3IAS 1;  1IGD A;  4Q2J A;  3AN1 A;  3SR6 A;  4LLG M;  4JX1 C;  3NVZ A;  2BTE A;  3R8B A;  2WXN A;  1L6U A;  5D7G A;  1QKZ A;  2JX5 A;  3LB8 C;  1JWA D;  1FIQ A;  3T3O A;  5EE9 A;  4HRO A;  1FRD A;  4OVZ A;  3SFE B;  4C7Z A;  2V3P A;  1TS3 A;  1L6V A;  3L4P A;  4REZ A;  4P16 A;  3BVM A;  1ZDX A;  4JWU C;  2IGH A;  4WIP A;  1C79 A;  1FXI A;  4GDL B;  2L83 A;  1L0X B;  1ZP0 B;  2IPK D;  3VRA B;  2GI9 A;  2K3U A;  3NUH B;  3AE5 B;  2XNA C;  2W3R A;  4IDI A;  2INN E;  3TEZ A;  1T5X D;  1JWS D;  4WUR A;  4IOI E;  4ARI A;  1MI0 A;  2E3T A;  4N58 A;  1KF6 B;  3PZ8 A;  1DOI A;  4WH4 A;  2BYT A;  2WS3 B;  2BS3 B;  5GXG B;  3V3X A;  3RFZ B;  1JAL A;  3B9J A;  5MPO A;  1C4P A;  3BII D;  3ETR A;  3IT4 B;  2EEL A;  2GRI A;  2JWU A;  3AE4 B;  4EE2 A;  1YJI A;  1QOB A;  3GB1 A;  4RF1 A;  4RFB A;  2L32 A;  4KKJ A;  1ROE A;  4NAW B;  3WCQ A;  3EA6 A;  1AN8 A;  3O13 A;  1I7H A;  1ZUD 2;  2QSD A;  3T3N A;  2WXK A;  5HG2 A;  1D4B A;  1IBX B;  3W5V B;  2LFI A;  1HQR D;  2MEK A;  1V1P B;  2JU6 X;  1TZO A;  3NVW A;  2J52 A;  2WXG A;  2XN9 C;  2KN4 A;  1VZ8 A;  2RDG A;  2G1E A;  1FD6 A;  2WXJ A;  3BK2 A;  3P4Q B;  1GAQ B;  2KMM A;  3TEW A;  5EE3 A;  4TQ0 A;  1PYW D;  4C7Y A;  3TSS A;  3FC4 A;  4RGT A;  2WXH A;  1K50 A;  1VDV A;  4D2K A;  1OQQ A;  3EUB 2;  1ZDV A;  1ET9 A;  1CZP A;  2PIA A;  3OWE B;  2FBW B;  1JWB D;  2NMQ A;  4KX6 B;  4OZB A;  1D5M C;  4A9A A;  3BYT B;  2J4X A;  2EKI A;  2H88 B;  4B0E A;  1OQR A;  4MM3 B;  4XWT A;  1AW7 A;  1AWD A;  3AED B;  4YXD B;  5I4D A;  3P4S B;  4NAM A;  4RGM A;  1SE3 A;  3AEC B;  5H8Y E;  4YTN B;  1JWU D;  2RMM A;  2VZK B;  1N63 A;  1K52 A;  3KWV A;  4LK0 M;  1QQR A;  1V97 A;  1P7E A;  1QOF A;  1N62 A;  3FAH A;  3IXS A;  1Q10 A;  1XLO A;  3AEB B;  3HUI A;  5JXV A;  2N0S B;  4AQ7 A;  2LJI A;  4JPS A;  5D3I B;  2FE8 A;  1JCK B;  1HZ5 A;  1N5W A;  1J7C A;  5HI1 A;  2ACZ B;  2JQR B;  3MJ5 A;  1MVK A;  4ZYS A;  5AUK A;  1F2R I;  2MH7 A;  2OHF A;  3AE6 B;  1BXT A;  4GDK B;  1SE4 A;  1C78 A;  1WYG A;  4P6V F;  2W82 A;  4XWW A;  3PO0 A;  2IGG A;  1PGA A;  4NJC A;  2JSV X;  3PZ7 A;  3SFD B;  1XCQ L;  1QIL A;  3ZYY X;  3AV8 A;  1FO4 A;  1KLU D;  3FIL B;  4A55 A;  2RPV A;  3AM9 A;  1YN3 A;  1JQ4 A;  4A8X C;  2W55 A;  4CQN A;  4TMA B;  2KQ4 X;  2WXM A;  1KTK A;  4RGN A;  1QF6 A;  2MJ3 A;  3AEG B;  5BYR A;  1FRR A;  3ZQ4 A;  1YNT E;  1GPX A;  2QIE B;  3R2I A;  1WWT A;  1XCT L;  3P4P B;  1F77 A;  1L4D B;  5EE1 A;  5G5G A;  1DYQ A;  1UWX A;  3UI3 A;  5G5H A;  3MHZ A;  2DBY A;  1I4G A;  1KH0 A;  2CU3 A;  5BYQ A;  5FK9 C;  4YTP B;  3VQI A;  3HRD D;  3Q8B A;  3GS2 A;  2YEP F;  4KKI A;  1N5X A;  2V4I B;  3NVY A;  3P4R B;  4OHJ A;  2CJO A;  1I4X A;  2WU2 B;  4HRS A;  1I4P A;  4YSZ B;  2G9H D;  2JXT A;  1L4Z B;  1DOY A;  1WRI A;  1E7P B;  2R61 A;  2MJD A;  2M56 B;  1EWC A;  2BS4 B;  2INP E;  3Q8F A;  5D3D A;  4ZRQ A;  1LO5 D;  3MP9 A;  4LTU A;  4HEA 1;  2J42 A;  1HA5 A;  1CK1 A;  2V0G A;  2PVO D;  5BMH A;  1TS2 A;  4YT0 B;  1I4H A;  2M19 A;  1PGX A;  1JRP A;  1EM7 A;  4PT5 A;  3I9V 1;  2QMT A;  4NZL B;  1L0Y B;  3LYY A;  1FEH A;  2BBC A;  1M4V A;  1GOZ A;  1T6B X;  3N9Y C;  3AEA B;  2HDE A;  3KWL A;  4WQM A;  1E6E B;  2WXF A;  1FNW A;  4XDD A;  4H2A A;  2MJE A;  4MH8 A;  1L0V B;  2DLB A;  3U52 E;  4RGO S;  3V05 A;  2BW2 A;  4ZHO A;  1A70 A;  2N9L A;  2NTS A;  1XLN A;  5AUI A;  1CQV A;  2PLP A;  1FFV A;  1D5X C;  3AE2 B;  2LUM A;  1QT9 A;  3R2T A;  1VJK A;  4O1N A;  1BUI C;  1SIJ A;  2H89 B;  1N61 A;  4IKG A;  2QJL A;  4C80 A;  5H92 C;  3NVV A;  2WXL A;  1KLG D;  3TEY A;  1EWY C;  1T3Q A;  1VR9 A;  2IDY A;  4M0W A;  2E6X A;  2WP9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...