1YN4A

Crystal structures of eap domains from staphylococcus aureus reveal an unexpected homology to bacterial superantigens
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
99
structure length
99
Chain Sequence
GKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of EAP Domains from Staphylococcus aureus Reveal an Unexpected Homology to Bacterial Superantigens.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Unknown function
molecule keywords EapH1
total genus 24
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2005-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1yn4A00
1SJED 4UDUC 4RGTA 4RH6A 2NTTA 2SEBD 1FNVA 4ZYSA 1T5XD 3BYTB 1D5ZC 1HA5A 1SEBD 4OHJA 1QILA 3O13A 1YN4A 3OWEB 3BVZA 1V1PA 1CQVA 4RCOA 1TS3A 4NZLB 3BYYB 3TSSA 4O1NA 3KLSX 3MC0B 1TY0A 1UUPA 2RDGA 1V1PB 4RGNA 1JWUD 2QEJC 1ET6A 4C56C 2XNAC 2AQ3B 1SE3A 1YN5A 2TSSA 2Z8LA 1AW7A 1I4XA 1D5XC 1KTKA 2J4XA 2QILA 1HQRD 2NTSA 1SE2A 1SXTA 1TS4A 1XXGA 3EA6A 2G9HD 1AN8A 1V1OA 2ICIA 1I4GA 1TS5A 1JWMD 5D3DA 1SE4A 1STEA 3SEBA 1ESFA 4RGOS 1I4HA 3URYA 1YN3A 1BXTA 5I4DA 1FNWA 1UNSA 3BZDB 3V05A 1ET9A 4RGMA 1TS2A 1M4VA 1ENFA 2R61A 1DYQA 3R2IA 5FK9C 1I4QA 1D6EC 1JCKB 1EU3A 1SJHD 1PYWD 1TY2A 2AQ2B 4RFBA 1FNUA 1B1ZA 1I4RA 1HXYD 2IPKD 3MFGA 1L0XB 1LO5D 1JWSD 3BVMA 4DXFA 1D5MC 2XN9C 1KLUD 3R2TA 1F77A 1GOZA 1CK1A 3R8BA 4TSSA 2RDHA 2IJ0A 2AQ1B 3W2DA 5FKAC 1EWCA 1L0YB 5D3IB 5TSSA 4DXGA 1SBBB 1I4PA 1KLGD 1EU4A 3GP7A 3BVGA
chains in the Genus database with same CATH superfamily
4BOSC 2KQ4X 4RH6A 3IG3A 5JHAA 2WDTB 4M0WB 2IO1B 1ZDVA 2PVOD 1J8CA 1JW9D 1H8CA 4P1CC 3TCAA 2MW5A 5JH5C 1SB3C 4JPSA 1WJUA 4YSYB 2KTRA 4LNKA 4KKIA 3GE8C 1SE2A 3NVZA 3Q69A 4IM0A 2W3SA 2M1MA 3K9OB 1YOVB 1V5TA 2V4IB 5TR5A 2D3CA 5D94A 2MJEA 2ZW1A 3Q3OC 3PZ7A 4HDOA 2ZCCA 4IWOA 2JRIB 4XDCA 5G5HA 1FCLA 1WXQA 3ZRCA 5E6PA 2N9KA 1TS2A 1WMHA 2L00B 4EEWA 4HDQA 2KX3A 3PLUA 3VTVA 2EMSA 3SU8X 2V3SA 2WS3B 3AH7A 1RFKA 2WXKA 1WM2A 2DYOA 2JZZA 2RDBC 3BK2A 1WIAA 3UIOB 1IBXA 4GMVA 4BKSA 2DENB 3BVMA 1F9JA 4Q2JA 2XN9C 1AARA 3A33B 4MGYE 2JF5A 3EGRA 2LVPA 2WX0A 4KZ0A 3TL5A 3WA0A 4FBJB 2UYZB 2Z59B 4TV3A 1EM7A 3FILA 4ZYSA 5L83A 1DOYA 1T5XD 4IWPA 1QILA 1YJIA 3A9JB 5LXIB 1TJEA 1T0QC 1HZ6A 2ON8A 2G45B 2I1JA 4WWPA 3ZNHB 2M0XA 4C7YA 4C4VB 5J17A 1UUPA 3L16A 1N60A 2YEPF 1QF6A 4C7ZA 2FIFA 3FAHA 4G11A 3SD5A 4YSXB 1I4XA 1D5XC 3DVNU 2KYWA 2RPQA 3LJ3A 4S17A 3UQBA 1C1YB 4ZRPA 1EF1A 1E8YA 4MEMA 2LVOA 4FLHA 1FMAD 4FHJA 1L7YA 2J0MA 2D3AA 3B08A 2I2YA 3RZFA 3Q3JA 1JWAD 5E6JA 3PREA 2GLSA 2EKEC 1WRIA 3U7DA 2L0TA 2IDYA 3IXSA 2ZZPB 2MBEA 2FE8A 3VTUA 2M17A 1BMLC 3PT2B 2WYQA 4PYZA 3VUYA 3MTNB 4RFBA 1UZXB 2NPTB 2K8BA 2CKHB 3LXFA 3HUIA 4WJNA 3VAWA 1GPXA 1WXAA 5GMVA 2HJ1A 3RPFC 3W5UB 1MVKA 5D2MB 2ONQA 2QMTA 1ZDXA 4ANUA 3I5JC 2Y5CA 2CU1A 2N1WA 5BO4B 1WF9A 3DCGA 3WAOA 1YJ1A 2V3PA 1JWBD 4DXGA 1R4NI 4AQ7A 4UDUC 4PS8A 1WFYA 2ZPNA 3RI7C 1CMXB 1L4ZB 2WNMA 3RYTA 4TQ1A 1HA5A 4EOYA 4DHJD 3A1QB 3QAQA 1CQVA 2JWUA 1TS3A 3RT3B 4HJKA 1V80A 3W1SC 3ZNZB 2KZRA 3UINB 4FN2A 4AUQC 2L7RA 1FO4A 3H1UA 5E6NA 2LGXA 2JT4B 3UI3A 1QOGA 1X1MA 1L0VB 1C4AA 2NBVB 5DPRA 2J0KA 1JWMD 4K7WA 1P9DU 3ZDMC 5EE3A 4FXCA 2GMIC 1GNUA 3S2AA 1FEHA 3AM9A 2KQ7A 2VZKB 2XBBC 4MJSB 2QSDA 4WQOB 4A20A 5I4DA 4KKJA 5HFYA 3O65B 1Q0WB 1ET9A 4MSQB 2K3UA 1V8CA 4HK2A 4WJOA 1T3QA 3Q2AC 2WXQA 2GBJA 4W9IA 3NG0A 1WR1A 4M01A 3ZXRA 1MI0A 1FCCC 2Y5PA 2BPSA 3VRBB 3DBRI 3P63A 1HXYD 1GB4A 4IUMB 3HVDA 3L13A 1ZUD2 3KWLA 3CMMB 2L3ZA 4OW0A 1WX8A 1V9JA 2DBYA 4P7IA 1V97A 1K8RB 4W9EA 2K1FA 1P98A 4IM2A 3RFZB 3AE3B 2L83A 4LDTB 2YEPB 2KWDA 4BKGA 1QOBA 3JVZX 4RGTA 2EELA 3PV1A 3TUOA 3WANA 3L0WB 3PVLA 4XWTA 3IFWB 3BWUD 3C19A 1ZKHA 3VHTC 2N7JA 3AULA 1HE8A 3BYYB 1GUAB 1XLPA 2NCNA 4CYEA 4LJPB 3UF8A 1QLBB 3DHHC 2XNAC 1V5OA 3WAPA 3QJZA 4L23A 4WQMA 3R3MA 3AEFB 3CSFA 1VR9A 1Q10A 4MM3A 1VZ7A 2VRRB 2LGSA 3RZWC 2RR9A 5DPSA 3RD2A 4B0EA 2PLPA 2WU5B 3ZO5B 2MX2A 4B9KA 1D4BA 3I63C 5IAAC 3MHZA 2ZCBA 4RF0A 1E8ZA 3DVGX 1E8XA 1FFUA 1MG8A 2KDFB 2QCZA 3TMPB 2KHWB 1L4DB 3ZNID 4K3BA 4FHKA 4YTPB 4N58A 2BTEA 4XDDA 4M8MA 4NJ7A 5BMGA 1XF5L 3AU4A 3HRDD 3TEYA 1B1ZA 1JROA 1C78A 3APFA 2REXA 4AWJA 3AU5A 4WWMA 3RNBC 2JZPA 3KH0A 2PMVA 4FULA 4A3OA 2JXTA 5KHQA 1L6UA 4W9KA 4NAWA 1OEYA 3WIMA 2NR2A 2OOBB 1MPEA 1ZXIA 4XC2A 3OG5A 3W2DA 2L52A 1P7EA 2MA9B 3A1QA 2JUOA 5TSSA 1SBBB 2KWVB 1F1HA 3QX1A 1P3QU 3QCAA 3V62A 4ZRJA 2JPHA 3SHQA 4OHJA 2YLMA 3B1LX 3U8ZA 1IUEA 4E74A 3NRZA 3ZQ4A 4NZLB 1KH0A 5IKCM 2AYOB 4ITKA 1M94A 2K22A 1TKEA 4RGNA 5C2TB 2WQYB 4C56C 4W9HA 3ZYYX 1SSNA 4JL9A 3CF6E 2Z8LA 1UD7A 3KUZA 2NPTA 4LDTD 1WJ6A 1Y56A 4K81A 2D2QA 3EA6A 2KFKA 4BOZB 4GIVA 3A9KB 1HTOA 1WE6A 1E8WA 1NBFC 4PYUA 1J7CA 3X0WA 1K52A 4EZJA 1IBXB 2C7NB 3HM6X 4GOCA 3U30A 1VRAB 2GBNA 4LNNA 4XWWA 2KT7A 3L10B 4YWGG 3C0RB 2DZKA 3R2IA 1FXAA 2L1AA 3UGBB 3VRAB 2KDIA 2ZVNA 4M8NA 4LK0M 3DOWA 4K7UA 2CHWA 4NY0A 1I4RA 4I6PA 3UQAA 2KLGA 2J0JA 4DDID 2GBMA 3AEGB 3H6NA 3VDZA 4MGKE 2M19A 3RCZA 1ZXHA 2DAFA 5CTRC 5EE9A 3NHEB 3ZW3A 2G3QB 2MEKA 1G6JA 2LUMA 3QQ8B 2FCSA 2L76A 3ALBA 2K0PA 4B6WA 1WX7A 1PGAA 2M0AA 3B0AA 3RNFC 3Q3NC 3ZIMA 2HE7A 3DBHB 1WJNA 3Q3MC 1D5ZC 2M56B 5EE1A 1N5XA 4DBGA 3ZTDA 3BVZA 3B2GA 1V1PA 1WXSA 3VUXA 1NEKB 1LFDA 2NVUI 1EO6A 4ZRKA 1QZEA 3KW5B 4BBNC 3KLSX 4M0WA 2DHZA 2FIDA 3MJWA 2FNJB 2KN5A 4HPPA 3HM3A 4HPLB 2PPHA 1XXGA 4A3PA 1P7FA 1QKZA 1WGGA 4OZAA 1NYQA 1OQQA 1E7PB 1L5PA 3ABVB 2ZNVC 2GBRA 3N20C 4RM9A 1UBQA 2MBHA 2WWZA 2KDEB 1YN3A 1B9RA 3C8YA 3OLMD 5CHFA 4XE0A 2KMCA 1UNSA 3BZDB 3I9V1 2GB1A 1JRUA 3CWIA 1JALA 2K6QA 1RRBA 1DYQA 1WXVA 4B95A 3B9JA 1EU3A 2LJ5A 2UU7A 3AEDB 1ZOYB 2Y5BB 1T0RC 3W5VB 3EUB2 4ZYNA 1J7BA 3DHGC 3SFDB 3MFGA 4I6LB 2LMCA 2WXRA 4P6VF 1KLVA 3HK0A 2KC1A 2LHDA 3IT6B 2I1KA 4JLCA 2KOXA 1AYFA 4MDKE 2WXHA 3ZTCA 2WXIA 2PTLA 5LNK1 3Q8AA 1OEYJ 2NMQA 3BINA 1KM7A 3DWGC 2BS4B 2INDC 1FXIA 2MSED 2QEJC 1Z5SB 2K5PA 1AW7A 1VCBA 3ZXVA 1V2YA 2J52A 4IWQA 4FJYA 4JQWC 1C76A 2B76B 1RYJA 1I35A 3Q6BA 1V81A 1ESFA 3NVVA 3TBLD 1BUIC 2MH7A 4DWFA 2K39A 4XX5A 1WM3A 2RD0A 5HI1A 1DOIA 4OZBA 1MG4A 1SJHD 2AQ2B 4HCNB 4A9AA 3ZNGC 3EECA 3VXWA 2WX1A 4WWNA 3K9PB 2LRWA 4ANWA 4B0MA 2IPKD 2R2QA 4KGSA 4E3CA 4RNAA 1KFYB 3A4RA 3V6EB 3AE4B 3P4QB 1N63A 3N1ZC 2RDHA 3W1SA 1YQBA 1Z2MA 2WXPA 1SE9A 3OAWA 2V1YA 4IW0A 2BGFA 1HZ5A 3X23A 5CX3A 2PE9A 5C3JB 3OJ3A 1PGXA 1YQ4B 3AE8B 3ECIA 1MFWA 1SEBD 3O13A 1YN4A 3OWEB 2AEHA 3Q8CA 4RM8A 4NPNA 1WJ4A 2IGDA 1IGCA 4ZRIA 1OFFA 1V1PB 2I38A 4N9F4 3UIPB 1WZ0A 3B2FA 3PZ8A 1YN5A 1AWDA 2RSUA 4NQKE 4KGTA 1WY8A 2NTSA 2Z0EB 1SXTA 1PDXA 4NJ6A 3CSTA 1RWSA 2ICIA 4IC7B 3AN1A 1LQBA 2JWZA 2DYMA 4L2YA 1XO3A 3DBRB 3QA8A 1WXMA 2OEDA 2CR5A 4TQ0A 4FJVB 2MBOA 2KXJA 4E71A 4WJPA 2HTME 2IBIB 1E6EB 4AJWA 4IDIA 1TTNA 2BW2A 2IO3B 4A6QA 2INNE 2FBWB 4DDGD 3KVFB 2V3NA 5FK9C 1I4QA 5GXGB 2MHJA 1SGHA 3U2SC 1WSPA 4BVUC 3WCQA 2LHEA 4N59A 2PIAA 4A90A 4MELA 1GC7A 3AE1B 3QHTA 4HRSA 5D6JB 3N9YC 1LO5D 1VZ8A 3MC8A 1D5MC 4IOIE 3VH3B 1KLUD 3R2TA 3U52E 1H4RA 1C4CA 3RNGC 4HWIB 2JXXA 2L05A 1A70A 1QOFA 4HVBA 1FRRA 4MM3B 3W9CB 2FCQA 3QC8B 5FR6A 3RNCC 2NTTA 1DGJA 3PSEB 2PE6B 4ZDVA 4DHJB 1RM6C 2ZEQA 2PVGC 3DHIC 2JYEA 2BYVE 4MH8A 2D07B 4G0NB 2N7EA 2D10A 3E9SA 3R7QA 4II2B 1J7AA 3AE6B 2WP9B 1XD3B 3A4SC 3ML8A 3EFCA 2DLBA 1U4AA 4ASWC 4W9JA 5IP4D 5BYQA 5E6OA 1V86A 2E6XA 1E7UA 1Y8RC 4HROA 1SE4A 1WYGA 2Y3AA 3PO0A 4L1BA 2KAJA 5BYRA 3AE7B 3W1YA 2INCC 2KWUB 3TEWA 4JIOU 5EDSA 2L8JA 3KUDB 3KUCB 1T6BX 2W3RA 4YTNB 3AEBB 3QK0A 1UF0A 2FCNA 1XCTL 2H88B 3PPAA 4LLGM 3WALA 1UH6A 4NNJB 4ICVA 1ISNA 2KACA 5EE0A 3Q14C 2IO2B 5AZFA 3L54A 3ONSA 1JWSD 2SAKA 2WXNA 2CS4A 2IY0B 1F77A 2C5LC 5LXHA 3J9CA 4J6IA 1OGWA 2KTFA 3BVGA 1F2RC 4ARIA 4NAWB 1XT9B 1SIJA 1XLOA 2Q5WD 3ZJVA 3BY4B 2PW9A 2G1EA 4WH4A 2HTHA 3V3XA 4YXDB 1P1AA 4MACA 2LEKA 4OVUA 1TT5B 1SIFA 4FADA 4OVZA 2Z0DB 4FA6A 4KDLB 2W54A 3L4PA 2DAJA 3RNAC 1E9MA 3P1MA 4BAXA 1ET6A 4KDIC 2H89B 3RMKC 2KMAA 5L95C 3BIID 2WXLA 4KVGB 1WE7A 2QILA 1NVID 1C3TA 5JHBA 2G4DB 3PRPB 3TEXA 4CHKA 2G9HD 4DXAB 2MP2B 4RF1A 4EKUA 3TEZA 3ZGZA 1GAQB 1F0ZA 2ZVOA 3TIXA 1P0RA 1WGDA 2MJ3A 1WMHB 3L08A 3KWVA 2LGIA 3IAS1 4IG7B 4RGOS 4XZ4A 4X57B 1YNTE 2BYTA 2WGSA 5BYSA 3SR6A 4W9CA 2XEWA 1N5WA 1ZW7A 4R3DA 1UGJA 1ROEA 1ENFA 3EHVA 4HCPB 2N9XA 2W9NA 3E56A 3V6CB 1UWMA 2JZ3B 1JCKB 1N62A 4GXBA 2KC2A 3Q3FA 2C60A 5DPTA 1J0GA 1XEEA 2HJ8A 2LVQA 2DZMA 3NS8A 2MQJA 2OJRA 3NS1A 4NQLB 5AUKA 3AE9B 2N9PC 3MHSD 3D32A 4DHZB 2C7MB 2BQQA 2BYFA 2DNFA 3VQIA 2AL6A 4II3B 1GJZA 1CK1A 1MHHE 1YX5B 1EWCA 1L0YB 3M62B 5IN7A 2BS3B 5IA7A 2WDQB 2O6VB 2GI9A 4QAYA 4G3XB 3H9DA 1WRDB 1FM0D 4ICUA 3MP9A 2K9XA 2VH1A 5HKHA 2KK8A 1ZE3D 3H7PB 5D7GA 1PQSA 2FUG1 3N1YC 3MC0B 2LD9A 5MPOA 3ZJTA 2KFJA 1HTQA 2PEAA 4LNIA 1FPYA 4GU2A 1LXDA 3GOEA 3ZKJC 3PHWB 2WXGA 2ZNVB 3JYUA 3SDLC 1ACCA 1E5WA 1TS5A 5LLIA 4S0RA 2GOWA 1PUTA 1TGZB 3MC9A 3SEBA 3V61A 1R4MB 5C1ZA 4KIKA 1S1QB 5G5GA 1FIQA 3Q8EA 3M63B 4NJCA 1VLBA 2IY1B 2RMMA 4ZRQA 1L6VA 5BMIA 3EC8A 3V05A 3NVYA 5J2RA 1M4VA 1GC6A 2BT6A 4ARCA 2KANA 3P2BA 4WIPA 4W9DA 1JQ4A 1HEZE 3ML9A 4KSKC 2LASA 1A5RA 4P1BC 1FNUA 4I6NB 3AB5A 1WZ3A 1WH3A 3T8MA 2BB6A 3JW0X 3M3JA 3U7ZA 2VH2A 4US9A 1KRHA 4J3OD 4A55A 1NI2A 4TSSA 2AX5A 3A9JA 3IBEA 4LTUA 3PRMB 3VTWA 4YL8A 1LM8B 2ACZB 3LB8C 4CQNA 1KLGD 2DWQA 4W9FA 2CHXA 1L2NA 1SJED 2MJDA 4HEA1 2JRHA 2RGFA 1RLFA 1T0YA 3WAMA 4USAA 4EZLA 4IM3A 1MJDA 1YX6B 2GRIA 2IYDB 4KZCA 3MJ5A 3H7PA 3KYDD 4DQOC 1E7VA 5DPWA 3VUWA 3RNEC 2BYEA 1C9FA 1GB1A 2BB5A 4MH0E 3ENEA 2O6VD 2E3TA 3PTFC 3ZDTA 4BZAA 4HKQA 1NYRA 3RULA 2LUEA 1KTKA 2J4XA 2KJ6A 2C7HA 2QHOA 3IVFA 4HKZE 4WAFA 2KO3A 2J53A 2QIEB 3QWZB 1F52A 1Q1OA 1R7SA 1V49A 4PS7A 2BS2B 2C9WB 2N0SB 5DCNA 1WYWB 2D3GA 3NZ3A 5AEKB 1C79A 2KX0A 1OTRB 1D3ZA 3JSVB 4F1SA 1JRPA 2KVRA 3FC4A 2L32A 3AV8A 4OVVA 1R4NB 1KOTA 1TZ1A 5HHDG 4ZHOA 2R61A 4EFOA 2D11A 2X38A 1TZOA 3CIRB 1IYFA 2WDRB 4GSWA 2XK5B 5AZHA 2WU2B 3HVZA 2BVCA 4DK5A 3P4SB 3VR9B 2A5UA 2O6VA 2MLBA 2B3AA 1KF6B 4M00A 5IOIA 2IJ0A 1YQ3B 3RUIB 5D3IB 2MBQA 1UWXA 4GDLB 3TJPA 4MJSA 2ZW0A 3LDZE 4WJQA 2O2VA 1N6ZA 1IP9A 1I7HA 2WDVB 4KGRA 4RCOA 4ANXA 1UBIA 1VJKA 2MP2A 4XYCA 2BWFA 2R2OA 4JWUC 2RDGA 3AI5A 2JSVX 2KDMA 2HD5B 1RAXA 1IGDA 2TSSA 4WURA 4WWOA 2WXJA 1NDDA 4GDLA 2RPVA 1DOXA 2QJLA 3NOBA 5T8IA 2JQRB 1I4GA 4K1RB 1EUVB 3T3NA 2LGYA 1N61A 2V9HA 2X8XX 2QC8A 2KVZA 1TKGA 1C4PA 1I4HA 3SFEB 2LWPA 3M95A 3DQVA 4MGZE 2M8SA 3T9LA 2LXCA 2IGGA 1JMLA 4PS3A 3HIZA 5G55A 4RMAA 4FJZA 1YIWA 3NJTA 5AUIA 3FKYA 3GE3C 2M4NA 3DWMA 3APDA 2PJHA 3U4EG 1VDVA 3PLVA 1UGMA 1V6EA 2D3BA 3NUHB 4H2AA 5CHVC 4YT0B 4BKTA 1E0ZA 4N6EB 1GOZA 2EMTA 1PFDA 3EFUA 3Q8FA 2O2VB 2FUHB 2KNBA 3R66C 1EU4A 3GP7A 4KX6B 4D2KA 2KN4A 2SEBD 1FNVA 1CJEA 3PGEA 1FRDA 2LXAA 5KHOA 3V60A 3LYYA 4WAAA 3VH4B 4TKNA 1MHXA 2KLCA 3TSSA 4O1NA 1FXTB 3AEEB 5HG2A 1QT9A 5CHWA 3KQ4A 2OHFA 3RN9C 2WXOA 2J42A 2UWQA 2BKFA 2XK5A 1EF5A 1XQQA 2CJNA 1HQRD 1UELA 4YTMB 1TS4A 1AN8A 3H7SA 4A8XC 3AE5B 2ASQA 1VZ6A 2G4SA 2JYTA 4G50A 4GDKA 3FILB 3ETRA 1IPGA 4HXDA 3GB1A 2LFIA 2VZKD 1NENB 1BXTA 3H8HA 3Q8BA 1FNWA 4LCDE 2DYBA 3L17A 4RGMA 3ZRFA 4C00A 1WGHA 2N7DA 3AXCA 4BFRA 2JVCA 2V0GA 3PHXB 2DX5B 4EE2A 4F8CB 1D6EC 2KJRA 3DPDA 3IAM1 5JXVA 3AE2B 2LRUA 1XLQA 4JE3B 1PGBA 5AZGA 1L0XB 1QQRA 4CO7A 2N9LA 4C4VA 4DXFA 1BT0A 1TIFA 2AQ1B 2MWSB 4OZCA 4P16A 5FKAC 3AEAB 1Q5WB 2BWES 2WHIA 4NAMA 1ZP0B 5IO9A 4TMAB 4AOFA 1WI0A 3N1XC 5FR3A 4W9GA 2LJIA 4MGIE 1XCQL 2NBWB 2KFKB 1TYGB 1GG3A 1TY0A 2KWCA 2V4LA 4GLSC 1E90A 3VFKA 1YJJA 3R7RA 2NBUA 4LNFA 2AL3A 2W82A 3KYCD 1SE3A 1YMHE 2QDFA 4JGHB 1K51A 3JSVA 4AP4C 3VVWB 5JZEB 1FFVA 4EZKA 5D3DA 4KIKB 4KSLC 5C23A 3NVWA 2K6DB 2JU6X 3DVGY 1ZGUB 3A9KA 3BK1A 1T0SC 4YSZB 1J19A 1CZPA 4ZOHC 2N4FA 2MCNB 2JY6A 5BMHA 3ZJUA 4ZHPA 2KDBA 4PK1A 4URKA 3P42A 1YD8U 2K8HA 1NI3A 4EUTA 2WXMA 2NS5A 2BBCA 2L0FA 1PYWD 3IHPC 3QIJA 4GGQA 2KQSA 3ZLZA 1VD2A 3DBLI 3ZUNA 4M02A 5G2NA 3PZDA 4TUUA 4HLEA 2KD0A 4F7ZA 4K7SA 4LNOA 2IZVB 3VR8B 3HHMA 1OQYA 3DBLB 4KV2A 2FAZA 2BKRB 2KJHB 1WR6E 3OJ4B 4LJOB 1C77A 1SF0A 2AWTA 3R8BA 3APCA 1XLNA 1FD6A 2MRPA 4XGAB 2D5GA 2HDEA 1I4PA 1K50A 4GN1A 2CU3A 4BKSD 4GB9A 4GDKB 1WGYA 3BYTB 4MT5A 4JX1C 4BBNF 3T3OA 1WGRA 2K25A 2PKOA 2FCMA 3PS6A 2WLBA 3AECB 2K8CA 3DBSA 3NZUA 2IGHA 3QARA 2W55A 1KJTA 2JX5A 3N32A 4REZA 2OJWA 4MSMB 4IKGA 1JWUD 1K53A 4US8A 2J7QB 3I57A 4HPMB 2WXFA 1E10A 1S3SG 2AQ3B 2BF8B 4PT5A 3GZNI 2CJOA 2LZ6A 2N1VA 2KMMA 1V1OA 3P4RB 1WWTA 2LGDA 2A4ZA 3I3TB 3ZVVA 1QOAA 3DVNV 2MBBB 2DZJA 1WX9A 2GBKA 1STEA 3PRZA 4ACFA 3GZNB 2CHZA 5J18A 3URYA 1EWYC 2KKCA 1TBEA 5H8YE 1OQRA 3AMZA 3GS2A 2DZIA 2ZJDA 4K3CA 2EKIA 1WGKA 4C80A 3N3KB 1TY2A 3NZSA 3DDCB 2YVCA 3DBHI 1LGRA 1ZPSA 1I42A 2KTRB 4AJYB 2INPE 1R4MI 5H92C 3N30A 4W9LA 4DHZE 1TKYA 4HJGE 1RFAA 2LI5A 3NY5A 2N9EB 2IO0B 4AS1A 4JWSC 3P4PB 3IT4B 1F2RI 4ANVA 2ZPYA
chains in the Genus database with same CATH topology
1UWXA 4GDLB 3W9CB 2KQ4X 4RH6A 2NTTA 1DGJA 1RM6C 2ZW0A 2PVGC 4OHJA 2JYEA 1IUEA 4MH8A 1I7HA 1ZDVA 3NRZA 2PVOD 2WDVB 4KGRA 4RCOA 4NZLB 3ZQ4A 1JW9D 1KH0A 1VJKA 3E9SA 1J7AA 3AE6B 4ITKA 2WP9B 4JWUC 2K22A 2RDGA 1TKEA 4RGNA 5C2TB 2WQYB 2JSVX 4C56C 2KDMA 3ZYYX 2DLBA 1SB3C 1SSNA 4JPSA 1IGDA 2TSSA 2Z8LA 4WURA 4YSYB 2WXJA 2RPVA 4KKIA 5BYQA 1SE2A 1Y56A 1DOXA 2QJLA 3EA6A 3NVZA 3Q69A 5T8IA 2JQRB 1I4GA 2E6XA 2W3SA 4HROA 1SE4A 2V4IB 1WYGA 2Y3AA 3T3NA 3PO0A 1N61A 4L1BA 2KAJA 2MJEA 2ZW1A 1J7CA 5BYRA 1TKGA 3AE7B 1K52A 3PZ7A 1C4PA 1IBXB 1I4HA 3TEWA 3SFEB 1VRAB 1T6BX 2W3RA 4YTNB 4XDCA 5G5HA 1FCLA 3AEBB 4XWWA 1WXQA 2N9KA 4YWGG 2IGGA 1TS2A 1XCTL 2H88B 1JMLA 4LLGM 3R2IA 1FXAA 2L1AA 3VRAB 2KACA 5EE0A 4LK0M 5AUIA 2WS3B 3AH7A 1RFKA 1I4RA 2WXKA 3DWMA 2DYOA 3BK2A 3U4EG 3AEGB 1VDVA 1IBXA 2M19A 4H2AA 3NUHB 4YT0B 1ZXHA 1JWSD 2SAKA 3BVMA 2WXNA 4Q2JA 2XN9C 1E0ZA 4N6EB 1F77A 1GOZA 5EE9A 2MEKA 1PFDA 3EGRA 3Q8FA 2LUMA 3J9CA 2K0PA 1EU4A 3GP7A 1PGAA 2M0AA 3BVGA 1F2RC 4KX6B 4NAWB 4ARIA 1SIJA 1XLOA 2Q5WD 1EM7A 4D2KA 3ZJVA 3FILA 2KN4A 2PW9A 2SEBD 1FNVA 2G1EA 1CJEA 4ZYSA 1T5XD 1DOYA 1D5ZC 1FRDA 2M56B 4WH4A 3V3XA 5EE1A 1N5XA 4YXDB 1QILA 3BVZA 3B2GA 1V1PA 4MACA 1YJIA 2LEKA 1NEKB 1TJEA 3LYYA 1HZ6A 4OVZA 3TSSA 1MHXA 2ON8A 4O1NA 3KLSX 4C7YA 3AEEB 2W54A 3L4PA 1UUPA 5HG2A 1QT9A 1E9MA 3P1MA 1N60A 2YEPF 1ET6A 3KQ4A 2OHFA 2H89B 1QF6A 4M0WA 2WXOA 4C7ZA 2J42A 3BIID 3FAHA 2WXLA 4YSXB 1I4XA 2QILA 1D5XC 1NVID 2CJNA 1HQRD 4YTMB 3TEXA 1TS4A 1XXGA 2G9HD 1AN8A 4RF1A 4A8XC 1P7FA 3AE5B 4ZRPA 1QKZA 3TEZA 3ZGZA 1GAQB 1F0ZA 1FMAD 2MJ3A 3KWVA 1VZ6A 2LGIA 3IAS1 2I2YA 4OZAA 1NYQA 1OQQA 1E7PB 1L5PA 2JYTA 1JWAD 3ABVB 3ETRA 3FILB 5E6JA 4RGOS 3GB1A 1WRIA 2LFIA 2VZKD 1NENB 1YN3A 1YNTE 1B9RA 2BYTA 3C8YA 2IDYA 1BXTA 4XE0A 3H8HA 3Q8BA 3IXSA 3SR6A 1FNWA 5BYSA 1UNSA 3BZDB 3I9V1 2FE8A 1N5WA 2GB1A 4RGMA 4R3DA 3CWIA 1UGJA 1JALA 1ROEA 1BMLC 1ENFA 2V0GA 1DYQA 1A70A 3E56A 4EE2A 1UWMA 3B9JA 1D6EC 1JCKB 1EU3A 1N62A 4RFBA 3AEDB 1ZOYB 3IAM1 3W5VB 5JXVA 3AE2B 1XLQA 3EUB2 3LXFA 3HUIA 1J7BA 4JE3B 1XEEA 3SFDB 3MFGA 1GPXA 3RPFC 1PGBA 3W5UB 1L0XB 1MVKA 1QQRA 3NS1A 2LMCA 2ONQA 2WXRA 4P6VF 5AUKA 3AE9B 2QMTA 1ZDXA 2LHDA 3IT6B 2N9LA 2Y5CA 4DXFA 3VQIA 1CK1A 1MHHE 2AQ1B 4OZCA 4P16A 5FKAC 2V3PA 1EWCA 1AYFA 1L0YB 3AEAB 1JWBD 4DXGA 2WXHA 2BS3B 2WXIA 2WDQB 4AQ7A 4NAMA 1ZP0B 4UDUC 4TMAB 2PTLA 5LNK1 3Q8AA 2GI9A 5FR3A 1L4ZB 2WNMA 1FM0D 2NMQA 4TQ1A 1HA5A 3MP9A 2K9XA 2LJIA 1XCQL 1CQVA 2JWUA 1ZE3D 5D7GA 1TS3A 3DWGC 2FUG1 2BS4B 1TYGB 3MC0B 5MPOA 1TY0A 3ZJTA 1FXIA 4GLSC 2QEJC 1YJJA 1FO4A 2W82A 1SE3A 2K5PA 1YMHE 3UI3A 2WXGA 1AW7A 1QOGA 1K51A 1L0VB 1C4AA 2J52A 1ACCA 1FFVA 1C76A 1TS5A 2B76B 1JWMD 5D3DA 1RYJA 1PUTA 3NVWA 5EE3A 2JU6X 4FXCA 3SEBA 3BK1A 1FEHA 4YSZB 1CZPA 1ESFA 3AM9A 4ZOHC 2VZKB 2QSDA 3NVVA 5G5GA 1FIQA 3Q8EA 5BMHA 4NJCA 5I4DA 1VLBA 4KKJA 1BUIC 2MH7A 2RMMA 4ZRQA 3ZJUA 5HFYA 1L6VA 4ZHPA 5BMIA 3V05A 1ET9A 3NVYA 1M4VA 2K3UA 4ARCA 2BT6A 5HI1A 1V8CA 3P42A 4WIPA 1DOIA 1NI3A 1JQ4A 1T3QA 1HEZE 2WXMA 4OZBA 2BBCA 2WXQA 1SJHD 2AQ2B 1PYWD 4A9AA 1FNUA 1MI0A 1FCCC 2Y5PA 3VRBB 3AB5A 1HXYD 3P63A 4B0MA 1GB4A 3HVDA 2IPKD 4KGSA 1ZUD2 3KWLA 4RNAA 1KFYB 4OW0A 2BB6A 3VR8B 3AE4B 1N63A 2DBYA 3P4QB 3U7ZA 1C77A 1SF0A 1KRHA 4J3OD 4US9A 1V97A 3R8BA 4A55A 4TSSA 2RDHA 1XLNA 2AX5A 3W1SA 1FD6A 2WXPA 3RFZB 3AE3B 4LTUA 2D5GA 2HDEA 2L83A 3LB8C 2ACZB 4CQNA 1I4PA 1KLGD 1HZ5A 2YEPB 2DWQA 1K50A 2KWDA 1QOBA 1SJED 2CU3A 2MJDA 4RGTA 4HEA1 5C3JB 2EELA 3TUOA 4GDKB 1PGXA 1YQ4B 3BYTB 4MT5A 4JX1C 3AE8B 4XWTA 3BWUD 3T3OA 1SEBD 3O13A 1YN4A 2PKOA 3OWEB 4USAA 2N7JA 3Q8CA 2WLBA 2GRIA 3AECB 3BYYB 1XLPA 2IGHA 3MJ5A 2IGDA 2W55A 1QLBB 2JX5A 1IGCA 4DQOC 1OFFA 4REZA 1V1PB 2I38A 4IKGA 1JWUD 1K53A 4US8A 1C9FA 1GB1A 2BB5A 3I57A 1E10A 2WXFA 2E3TA 2AQ3B 2XNAC 3B2FA 3PZ8A 4L23A 4WQMA 4HKQA 1NYRA 1YN5A 1AWDA 4PT5A 3AEFB 1KTKA 2J4XA 4KGTA 1VR9A 2NTSA 1Q10A 1SXTA 1PDXA 2CJOA 1VZ7A 2KMMA 1V1OA 1RWSA 3P4RB 1WWTA 4HKZE 2ICIA 4WAFA 1QOAA 2J53A 3AN1A 2QIEB 4B0EA 2PLPA 1STEA 1R7SA 2WU5B 2BS2B 2DYMA 4L2YA 2N0SB 1XO3A 3NZ3A 2OEDA 1C79A 4TQ0A 3URYA 1D4BA 1EWYC 2HTME 1JRPA 1E6EB 3FC4A 5H8YE 1OQRA 2L32A 3MHZA 4IDIA 3AV8A 3AMZA 2BW2A 4RF0A 4A6QA 2INNE 2FBWB 5HHDG 1FFUA 3GS2A 4ZHOA 2EKIA 1WGKA 2R61A 2V3NA 5FK9C 1L4DB 1I4QA 4C80A 5GXGB 2X38A 4YTPB 1TZOA 4N58A 2BTEA 1TY2A 3CIRB 1WSPA 4XDDA 3U2SC 5BMGA 1XF5L 3WCQA 2LHEA 2WDRB 3HRDD 3TEYA 1B1ZA 1JROA 1ZPSA 4N59A 1C78A 2PIAA 4A90A 2INPE 2WU2B 3HVZA 3AE1B 5H92C 4WWMA 4HRSA 2JZPA 3P4SB 2PMVA 3VR9B 2JXTA 3N9YC 1TKYA 1L6UA 4HJGE 1LO5D 1VZ8A 1KF6B 1D5MC 4IOIE 1KLUD 1MPEA 3R2TA 3U52E 1ZXIA 2IJ0A 1C4CA 4AS1A 4JWSC 1YQ3B 2L52A 3W2DA 1P7EA 3P4PB 3IT4B 5D3IB 5TSSA 1SBBB 1F2RI 1QOFA 1FRRA 4MM3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SJE D;  4UDU C;  4RGT A;  4RH6 A;  2NTT A;  2SEB D;  1FNV A;  4ZYS A;  1T5X D;  3BYT B;  1D5Z C;  1HA5 A;  1SEB D;  4OHJ A;  1QIL A;  3O13 A;  1YN4 A;  3OWE B;  3BVZ A;  1V1P A;  1CQV A;  4RCO A;  1TS3 A;  4NZL B;  3BYY B;  3TSS A;  4O1N A;  3KLS X;  3MC0 B;  1TY0 A;  1UUP A;  2RDG A;  1V1P B;  4RGN A;  1JWU D;  2QEJ C;  1ET6 A;  4C56 C;  2XNA C;  2AQ3 B;  1SE3 A;  1YN5 A;  2TSS A;  2Z8L A;  1AW7 A;  1I4X A;  1D5X C;  1KTK A;  2J4X A;  2QIL A;  1HQR D;  2NTS A;  1SE2 A;  1SXT A;  1TS4 A;  1XXG A;  3EA6 A;  2G9H D;  1AN8 A;  1V1O A;  2ICI A;  1I4G A;  1TS5 A;  1JWM D;  5D3D A;  1SE4 A;  1STE A;  3SEB A;  1ESF A;  4RGO S;  1I4H A;  3URY A;  1YN3 A;  1BXT A;  5I4D A;  1FNW A;  1UNS A;  3BZD B;  3V05 A;  1ET9 A;  4RGM A;  1TS2 A;  1M4V A;  1ENF A;  2R61 A;  1DYQ A;  3R2I A;  5FK9 C;  1I4Q A;  1D6E C;  1JCK B;  1EU3 A;  1SJH D;  1PYW D;  1TY2 A;  2AQ2 B;  4RFB A;  1FNU A;  1B1Z A;  1I4R A;  1HXY D;  2IPK D;  3MFG A;  1L0X B;  1LO5 D;  1JWS D;  3BVM A;  4DXF A;  1D5M C;  2XN9 C;  1KLU D;  3R2T A;  1F77 A;  1GOZ A;  1CK1 A;  3R8B A;  4TSS A;  2RDH A;  2IJ0 A;  2AQ1 B;  3W2D A;  5FKA C;  1EWC A;  1L0Y B;  5D3I B;  5TSS A;  4DXG A;  1SBB B;  1I4P A;  1KLG D;  1EU4 A;  3GP7 A;  3BVG A; 
#chains in the Genus database with same CATH topology
 4BOS C;  2KQ4 X;  4RH6 A;  3IG3 A;  5JHA A;  2WDT B;  4M0W B;  2IO1 B;  1ZDV A;  2PVO D;  1J8C A;  1JW9 D;  1H8C A;  4P1C C;  3TCA A;  2MW5 A;  5JH5 C;  1SB3 C;  4JPS A;  1WJU A;  4YSY B;  2KTR A;  4LNK A;  4KKI A;  3GE8 C;  1SE2 A;  3NVZ A;  3Q69 A;  4IM0 A;  2W3S A;  2M1M A;  3K9O B;  1YOV B;  1V5T A;  2V4I B;  5TR5 A;  2D3C A;  5D94 A;  2MJE A;  2ZW1 A;  3Q3O C;  3PZ7 A;  4HDO A;  2ZCC A;  4IWO A;  2JRI B;  4XDC A;  5G5H A;  1FCL A;  1WXQ A;  3ZRC A;  5E6P A;  2N9K A;  1TS2 A;  1WMH A;  2L00 B;  4EEW A;  4HDQ A;  2KX3 A;  3PLU A;  3VTV A;  2EMS A;  3SU8 X;  2V3S A;  2WS3 B;  3AH7 A;  1RFK A;  2WXK A;  1WM2 A;  2DYO A;  2JZZ A;  2RDB C;  3BK2 A;  1WIA A;  3UIO B;  1IBX A;  4GMV A;  4BKS A;  2DEN B;  3BVM A;  1F9J A;  4Q2J A;  2XN9 C;  1AAR A;  3A33 B;  4MGY E;  2JF5 A;  3EGR A;  2LVP A;  2WX0 A;  4KZ0 A;  3TL5 A;  3WA0 A;  4FBJ B;  2UYZ B;  2Z59 B;  4TV3 A;  1EM7 A;  3FIL A;  4ZYS A;  5L83 A;  1DOY A;  1T5X D;  4IWP A;  1QIL A;  1YJI A;  3A9J B;  5LXI B;  1TJE A;  1T0Q C;  1HZ6 A;  2ON8 A;  2G45 B;  2I1J A;  4WWP A;  3ZNH B;  2M0X A;  4C7Y A;  4C4V B;  5J17 A;  1UUP A;  3L16 A;  1N60 A;  2YEP F;  1QF6 A;  4C7Z A;  2FIF A;  3FAH A;  4G11 A;  3SD5 A;  4YSX B;  1I4X A;  1D5X C;  3DVN U;  2KYW A;  2RPQ A;  3LJ3 A;  4S17 A;  3UQB A;  1C1Y B;  4ZRP A;  1EF1 A;  1E8Y A;  4MEM A;  2LVO A;  4FLH A;  1FMA D;  4FHJ A;  1L7Y A;  2J0M A;  2D3A A;  3B08 A;  2I2Y A;  3RZF A;  3Q3J A;  1JWA D;  5E6J A;  3PRE A;  2GLS A;  2EKE C;  1WRI A;  3U7D A;  2L0T A;  2IDY A;  3IXS A;  2ZZP B;  2MBE A;  2FE8 A;  3VTU A;  2M17 A;  1BML C;  3PT2 B;  2WYQ A;  4PYZ A;  3VUY A;  3MTN B;  4RFB A;  1UZX B;  2NPT B;  2K8B A;  2CKH B;  3LXF A;  3HUI A;  4WJN A;  3VAW A;  1GPX A;  1WXA A;  5GMV A;  2HJ1 A;  3RPF C;  3W5U B;  1MVK A;  5D2M B;  2ONQ A;  2QMT A;  1ZDX A;  4ANU A;  3I5J C;  2Y5C A;  2CU1 A;  2N1W A;  5BO4 B;  1WF9 A;  3DCG A;  3WAO A;  1YJ1 A;  2V3P A;  1JWB D;  4DXG A;  1R4N I;  4AQ7 A;  4UDU C;  4PS8 A;  1WFY A;  2ZPN A;  3RI7 C;  1CMX B;  1L4Z B;  2WNM A;  3RYT A;  4TQ1 A;  1HA5 A;  4EOY A;  4DHJ D;  3A1Q B;  3QAQ A;  1CQV A;  2JWU A;  1TS3 A;  3RT3 B;  4HJK A;  1V80 A;  3W1S C;  3ZNZ B;  2KZR A;  3UIN B;  4FN2 A;  4AUQ C;  2L7R A;  1FO4 A;  3H1U A;  5E6N A;  2LGX A;  2JT4 B;  3UI3 A;  1QOG A;  1X1M A;  1L0V B;  1C4A A;  2NBV B;  5DPR A;  2J0K A;  1JWM D;  4K7W A;  1P9D U;  3ZDM C;  5EE3 A;  4FXC A;  2GMI C;  1GNU A;  3S2A A;  1FEH A;  3AM9 A;  2KQ7 A;  2VZK B;  2XBB C;  4MJS B;  2QSD A;  4WQO B;  4A20 A;  5I4D A;  4KKJ A;  5HFY A;  3O65 B;  1Q0W B;  1ET9 A;  4MSQ B;  2K3U A;  1V8C A;  4HK2 A;  4WJO A;  1T3Q A;  3Q2A C;  2WXQ A;  2GBJ A;  4W9I A;  3NG0 A;  1WR1 A;  4M01 A;  3ZXR A;  1MI0 A;  1FCC C;  2Y5P A;  2BPS A;  3VRB B;  3DBR I;  3P63 A;  1HXY D;  1GB4 A;  4IUM B;  3HVD A;  3L13 A;  1ZUD 2;  3KWL A;  3CMM B;  2L3Z A;  4OW0 A;  1WX8 A;  1V9J A;  2DBY A;  4P7I A;  1V97 A;  1K8R B;  4W9E A;  2K1F A;  1P98 A;  4IM2 A;  3RFZ B;  3AE3 B;  2L83 A;  4LDT B;  2YEP B;  2KWD A;  4BKG A;  1QOB A;  3JVZ X;  4RGT A;  2EEL A;  3PV1 A;  3TUO A;  3WAN A;  3L0W B;  3PVL A;  4XWT A;  3IFW B;  3BWU D;  3C19 A;  1ZKH A;  3VHT C;  2N7J A;  3AUL A;  1HE8 A;  3BYY B;  1GUA B;  1XLP A;  2NCN A;  4CYE A;  4LJP B;  3UF8 A;  1QLB B;  3DHH C;  2XNA C;  1V5O A;  3WAP A;  3QJZ A;  4L23 A;  4WQM A;  3R3M A;  3AEF B;  3CSF A;  1VR9 A;  1Q10 A;  4MM3 A;  1VZ7 A;  2VRR B;  2LGS A;  3RZW C;  2RR9 A;  5DPS A;  3RD2 A;  4B0E A;  2PLP A;  2WU5 B;  3ZO5 B;  2MX2 A;  4B9K A;  1D4B A;  3I63 C;  5IAA C;  3MHZ A;  2ZCB A;  4RF0 A;  1E8Z A;  3DVG X;  1E8X A;  1FFU A;  1MG8 A;  2KDF B;  2QCZ A;  3TMP B;  2KHW B;  1L4D B;  3ZNI D;  4K3B A;  4FHK A;  4YTP B;  4N58 A;  2BTE A;  4XDD A;  4M8M A;  4NJ7 A;  5BMG A;  1XF5 L;  3AU4 A;  3HRD D;  3TEY A;  1B1Z A;  1JRO A;  1C78 A;  3APF A;  2REX A;  4AWJ A;  3AU5 A;  4WWM A;  3RNB C;  2JZP A;  3KH0 A;  2PMV A;  4FUL A;  4A3O A;  2JXT A;  5KHQ A;  1L6U A;  4W9K A;  4NAW A;  1OEY A;  3WIM A;  2NR2 A;  2OOB B;  1MPE A;  1ZXI A;  4XC2 A;  3OG5 A;  3W2D A;  2L52 A;  1P7E A;  2MA9 B;  3A1Q A;  2JUO A;  5TSS A;  1SBB B;  2KWV B;  1F1H A;  3QX1 A;  1P3Q U;  3QCA A;  3V62 A;  4ZRJ A;  2JPH A;  3SHQ A;  4OHJ A;  2YLM A;  3B1L X;  3U8Z A;  1IUE A;  4E74 A;  3NRZ A;  3ZQ4 A;  4NZL B;  1KH0 A;  5IKC M;  2AYO B;  4ITK A;  1M94 A;  2K22 A;  1TKE A;  4RGN A;  5C2T B;  2WQY B;  4C56 C;  4W9H A;  3ZYY X;  1SSN A;  4JL9 A;  3CF6 E;  2Z8L A;  1UD7 A;  3KUZ A;  2NPT A;  4LDT D;  1WJ6 A;  1Y56 A;  4K81 A;  2D2Q A;  3EA6 A;  2KFK A;  4BOZ B;  4GIV A;  3A9K B;  1HTO A;  1WE6 A;  1E8W A;  1NBF C;  4PYU A;  1J7C A;  3X0W A;  1K52 A;  4EZJ A;  1IBX B;  2C7N B;  3HM6 X;  4GOC A;  3U30 A;  1VRA B;  2GBN A;  4LNN A;  4XWW A;  2KT7 A;  3L10 B;  4YWG G;  3C0R B;  2DZK A;  3R2I A;  1FXA A;  2L1A A;  3UGB B;  3VRA B;  2KDI A;  2ZVN A;  4M8N A;  4LK0 M;  3DOW A;  4K7U A;  2CHW A;  4NY0 A;  1I4R A;  4I6P A;  3UQA A;  2KLG A;  2J0J A;  4DDI D;  2GBM A;  3AEG B;  3H6N A;  3VDZ A;  4MGK E;  2M19 A;  3RCZ A;  1ZXH A;  2DAF A;  5CTR C;  5EE9 A;  3NHE B;  3ZW3 A;  2G3Q B;  2MEK A;  1G6J A;  2LUM A;  3QQ8 B;  2FCS A;  2L76 A;  3ALB A;  2K0P A;  4B6W A;  1WX7 A;  1PGA A;  2M0A A;  3B0A A;  3RNF C;  3Q3N C;  3ZIM A;  2HE7 A;  3DBH B;  1WJN A;  3Q3M C;  1D5Z C;  2M56 B;  5EE1 A;  1N5X A;  4DBG A;  3ZTD A;  3BVZ A;  3B2G A;  1V1P A;  1WXS A;  3VUX A;  1NEK B;  1LFD A;  2NVU I;  1EO6 A;  4ZRK A;  1QZE A;  3KW5 B;  4BBN C;  3KLS X;  4M0W A;  2DHZ A;  2FID A;  3MJW A;  2FNJ B;  2KN5 A;  4HPP A;  3HM3 A;  4HPL B;  2PPH A;  1XXG A;  4A3P A;  1P7F A;  1QKZ A;  1WGG A;  4OZA A;  1NYQ A;  1OQQ A;  1E7P B;  1L5P A;  3ABV B;  2ZNV C;  2GBR A;  3N20 C;  4RM9 A;  1UBQ A;  2MBH A;  2WWZ A;  2KDE B;  1YN3 A;  1B9R A;  3C8Y A;  3OLM D;  5CHF A;  4XE0 A;  2KMC A;  1UNS A;  3BZD B;  3I9V 1;  2GB1 A;  1JRU A;  3CWI A;  1JAL A;  2K6Q A;  1RRB A;  1DYQ A;  1WXV A;  4B95 A;  3B9J A;  1EU3 A;  2LJ5 A;  2UU7 A;  3AED B;  1ZOY B;  2Y5B B;  1T0R C;  3W5V B;  3EUB 2;  4ZYN A;  1J7B A;  3DHG C;  3SFD B;  3MFG A;  4I6L B;  2LMC A;  2WXR A;  4P6V F;  1KLV A;  3HK0 A;  2KC1 A;  2LHD A;  3IT6 B;  2I1K A;  4JLC A;  2KOX A;  1AYF A;  4MDK E;  2WXH A;  3ZTC A;  2WXI A;  2PTL A;  5LNK 1;  3Q8A A;  1OEY J;  2NMQ A;  3BIN A;  1KM7 A;  3DWG C;  2BS4 B;  2IND C;  1FXI A;  2MSE D;  2QEJ C;  1Z5S B;  2K5P A;  1AW7 A;  1VCB A;  3ZXV A;  1V2Y A;  2J52 A;  4IWQ A;  4FJY A;  4JQW C;  1C76 A;  2B76 B;  1RYJ A;  1I35 A;  3Q6B A;  1V81 A;  1ESF A;  3NVV A;  3TBL D;  1BUI C;  2MH7 A;  4DWF A;  2K39 A;  4XX5 A;  1WM3 A;  2RD0 A;  5HI1 A;  1DOI A;  4OZB A;  1MG4 A;  1SJH D;  2AQ2 B;  4HCN B;  4A9A A;  3ZNG C;  3EEC A;  3VXW A;  2WX1 A;  4WWN A;  3K9P B;  2LRW A;  4ANW A;  4B0M A;  2IPK D;  2R2Q A;  4KGS A;  4E3C A;  4RNA A;  1KFY B;  3A4R A;  3V6E B;  3AE4 B;  3P4Q B;  1N63 A;  3N1Z C;  2RDH A;  3W1S A;  1YQB A;  1Z2M A;  2WXP A;  1SE9 A;  3OAW A;  2V1Y A;  4IW0 A;  2BGF A;  1HZ5 A;  3X23 A;  5CX3 A;  2PE9 A;  5C3J B;  3OJ3 A;  1PGX A;  1YQ4 B;  3AE8 B;  3ECI A;  1MFW A;  1SEB D;  3O13 A;  1YN4 A;  3OWE B;  2AEH A;  3Q8C A;  4RM8 A;  4NPN A;  1WJ4 A;  2IGD A;  1IGC A;  4ZRI A;  1OFF A;  1V1P B;  2I38 A;  4N9F 4;  3UIP B;  1WZ0 A;  3B2F A;  3PZ8 A;  1YN5 A;  1AWD A;  2RSU A;  4NQK E;  4KGT A;  1WY8 A;  2NTS A;  2Z0E B;  1SXT A;  1PDX A;  4NJ6 A;  3CST A;  1RWS A;  2ICI A;  4IC7 B;  3AN1 A;  1LQB A;  2JWZ A;  2DYM A;  4L2Y A;  1XO3 A;  3DBR B;  3QA8 A;  1WXM A;  2OED A;  2CR5 A;  4TQ0 A;  4FJV B;  2MBO A;  2KXJ A;  4E71 A;  4WJP A;  2HTM E;  2IBI B;  1E6E B;  4AJW A;  4IDI A;  1TTN A;  2BW2 A;  2IO3 B;  4A6Q A;  2INN E;  2FBW B;  4DDG D;  3KVF B;  2V3N A;  5FK9 C;  1I4Q A;  5GXG B;  2MHJ A;  1SGH A;  3U2S C;  1WSP A;  4BVU C;  3WCQ A;  2LHE A;  4N59 A;  2PIA A;  4A90 A;  4MEL A;  1GC7 A;  3AE1 B;  3QHT A;  4HRS A;  5D6J B;  3N9Y C;  1LO5 D;  1VZ8 A;  3MC8 A;  1D5M C;  4IOI E;  3VH3 B;  1KLU D;  3R2T A;  3U52 E;  1H4R A;  1C4C A;  3RNG C;  4HWI B;  2JXX A;  2L05 A;  1A70 A;  1QOF A;  4HVB A;  1FRR A;  4MM3 B;  3W9C B;  2FCQ A;  3QC8 B;  5FR6 A;  3RNC C;  2NTT A;  1DGJ A;  3PSE B;  2PE6 B;  4ZDV A;  4DHJ B;  1RM6 C;  2ZEQ A;  2PVG C;  3DHI C;  2JYE A;  2BYV E;  4MH8 A;  2D07 B;  4G0N B;  2N7E A;  2D10 A;  3E9S A;  3R7Q A;  4II2 B;  1J7A A;  3AE6 B;  2WP9 B;  1XD3 B;  3A4S C;  3ML8 A;  3EFC A;  2DLB A;  1U4A A;  4ASW C;  4W9J A;  5IP4 D;  5BYQ A;  5E6O A;  1V86 A;  2E6X A;  1E7U A;  1Y8R C;  4HRO A;  1SE4 A;  1WYG A;  2Y3A A;  3PO0 A;  4L1B A;  2KAJ A;  5BYR A;  3AE7 B;  3W1Y A;  2INC C;  2KWU B;  3TEW A;  4JIO U;  5EDS A;  2L8J A;  3KUD B;  3KUC B;  1T6B X;  2W3R A;  4YTN B;  3AEB B;  3QK0 A;  1UF0 A;  2FCN A;  1XCT L;  2H88 B;  3PPA A;  4LLG M;  3WAL A;  1UH6 A;  4NNJ B;  4ICV A;  1ISN A;  2KAC A;  5EE0 A;  3Q14 C;  2IO2 B;  5AZF A;  3L54 A;  3ONS A;  1JWS D;  2SAK A;  2WXN A;  2CS4 A;  2IY0 B;  1F77 A;  2C5L C;  5LXH A;  3J9C A;  4J6I A;  1OGW A;  2KTF A;  3BVG A;  1F2R C;  4ARI A;  4NAW B;  1XT9 B;  1SIJ A;  1XLO A;  2Q5W D;  3ZJV A;  3BY4 B;  2PW9 A;  2G1E A;  4WH4 A;  2HTH A;  3V3X A;  4YXD B;  1P1A A;  4MAC A;  2LEK A;  4OVU A;  1TT5 B;  1SIF A;  4FAD A;  4OVZ A;  2Z0D B;  4FA6 A;  4KDL B;  2W54 A;  3L4P A;  2DAJ A;  3RNA C;  1E9M A;  3P1M A;  4BAX A;  1ET6 A;  4KDI C;  2H89 B;  3RMK C;  2KMA A;  5L95 C;  3BII D;  2WXL A;  4KVG B;  1WE7 A;  2QIL A;  1NVI D;  1C3T A;  5JHB A;  2G4D B;  3PRP B;  3TEX A;  4CHK A;  2G9H D;  4DXA B;  2MP2 B;  4RF1 A;  4EKU A;  3TEZ A;  3ZGZ A;  1GAQ B;  1F0Z A;  2ZVO A;  3TIX A;  1P0R A;  1WGD A;  2MJ3 A;  1WMH B;  3L08 A;  3KWV A;  2LGI A;  3IAS 1;  4IG7 B;  4RGO S;  4XZ4 A;  4X57 B;  1YNT E;  2BYT A;  2WGS A;  5BYS A;  3SR6 A;  4W9C A;  2XEW A;  1N5W A;  1ZW7 A;  4R3D A;  1UGJ A;  1ROE A;  1ENF A;  3EHV A;  4HCP B;  2N9X A;  2W9N A;  3E56 A;  3V6C B;  1UWM A;  2JZ3 B;  1JCK B;  1N62 A;  4GXB A;  2KC2 A;  3Q3F A;  2C60 A;  5DPT A;  1J0G A;  1XEE A;  2HJ8 A;  2LVQ A;  2DZM A;  3NS8 A;  2MQJ A;  2OJR A;  3NS1 A;  4NQL B;  5AUK A;  3AE9 B;  2N9P C;  3MHS D;  3D32 A;  4DHZ B;  2C7M B;  2BQQ A;  2BYF A;  2DNF A;  3VQI A;  2AL6 A;  4II3 B;  1GJZ A;  1CK1 A;  1MHH E;  1YX5 B;  1EWC A;  1L0Y B;  3M62 B;  5IN7 A;  2BS3 B;  5IA7 A;  2WDQ B;  2O6V B;  2GI9 A;  4QAY A;  4G3X B;  3H9D A;  1WRD B;  1FM0 D;  4ICU A;  3MP9 A;  2K9X A;  2VH1 A;  5HKH A;  2KK8 A;  1ZE3 D;  3H7P B;  5D7G A;  1PQS A;  2FUG 1;  3N1Y C;  3MC0 B;  2LD9 A;  5MPO A;  3ZJT A;  2KFJ A;  1HTQ A;  2PEA A;  4LNI A;  1FPY A;  4GU2 A;  1LXD A;  3GOE A;  3ZKJ C;  3PHW B;  2WXG A;  2ZNV B;  3JYU A;  3SDL C;  1ACC A;  1E5W A;  1TS5 A;  5LLI A;  4S0R A;  2GOW A;  1PUT A;  1TGZ B;  3MC9 A;  3SEB A;  3V61 A;  1R4M B;  5C1Z A;  4KIK A;  1S1Q B;  5G5G A;  1FIQ A;  3Q8E A;  3M63 B;  4NJC A;  1VLB A;  2IY1 B;  2RMM A;  4ZRQ A;  1L6V A;  5BMI A;  3EC8 A;  3V05 A;  3NVY A;  5J2R A;  1M4V A;  1GC6 A;  2BT6 A;  4ARC A;  2KAN A;  3P2B A;  4WIP A;  4W9D A;  1JQ4 A;  1HEZ E;  3ML9 A;  4KSK C;  2LAS A;  1A5R A;  4P1B C;  1FNU A;  4I6N B;  3AB5 A;  1WZ3 A;  1WH3 A;  3T8M A;  2BB6 A;  3JW0 X;  3M3J A;  3U7Z A;  2VH2 A;  4US9 A;  1KRH A;  4J3O D;  4A55 A;  1NI2 A;  4TSS A;  2AX5 A;  3A9J A;  3IBE A;  4LTU A;  3PRM B;  3VTW A;  4YL8 A;  1LM8 B;  2ACZ B;  3LB8 C;  4CQN A;  1KLG D;  2DWQ A;  4W9F A;  2CHX A;  1L2N A;  1SJE D;  2MJD A;  4HEA 1;  2JRH A;  2RGF A;  1RLF A;  1T0Y A;  3WAM A;  4USA A;  4EZL A;  4IM3 A;  1MJD A;  1YX6 B;  2GRI A;  2IYD B;  4KZC A;  3MJ5 A;  3H7P A;  3KYD D;  4DQO C;  1E7V A;  5DPW A;  3VUW A;  3RNE C;  2BYE A;  1C9F A;  1GB1 A;  2BB5 A;  4MH0 E;  3ENE A;  2O6V D;  2E3T A;  3PTF C;  3ZDT A;  4BZA A;  4HKQ A;  1NYR A;  3RUL A;  2LUE A;  1KTK A;  2J4X A;  2KJ6 A;  2C7H A;  2QHO A;  3IVF A;  4HKZ E;  4WAF A;  2KO3 A;  2J53 A;  2QIE B;  3QWZ B;  1F52 A;  1Q1O A;  1R7S A;  1V49 A;  4PS7 A;  2BS2 B;  2C9W B;  2N0S B;  5DCN A;  1WYW B;  2D3G A;  3NZ3 A;  5AEK B;  1C79 A;  2KX0 A;  1OTR B;  1D3Z A;  3JSV B;  4F1S A;  1JRP A;  2KVR A;  3FC4 A;  2L32 A;  3AV8 A;  4OVV A;  1R4N B;  1KOT A;  1TZ1 A;  5HHD G;  4ZHO A;  2R61 A;  4EFO A;  2D11 A;  2X38 A;  1TZO A;  3CIR B;  1IYF A;  2WDR B;  4GSW A;  2XK5 B;  5AZH A;  2WU2 B;  3HVZ A;  2BVC A;  4DK5 A;  3P4S B;  3VR9 B;  2A5U A;  2O6V A;  2MLB A;  2B3A A;  1KF6 B;  4M00 A;  5IOI A;  2IJ0 A;  1YQ3 B;  3RUI B;  5D3I B;  2MBQ A;  1UWX A;  4GDL B;  3TJP A;  4MJS A;  2ZW0 A;  3LDZ E;  4WJQ A;  2O2V A;  1N6Z A;  1IP9 A;  1I7H A;  2WDV B;  4KGR A;  4RCO A;  4ANX A;  1UBI A;  1VJK A;  2MP2 A;  4XYC A;  2BWF A;  2R2O A;  4JWU C;  2RDG A;  3AI5 A;  2JSV X;  2KDM A;  2HD5 B;  1RAX A;  1IGD A;  2TSS A;  4WUR A;  4WWO A;  2WXJ A;  1NDD A;  4GDL A;  2RPV A;  1DOX A;  2QJL A;  3NOB A;  5T8I A;  2JQR B;  1I4G A;  4K1R B;  1EUV B;  3T3N A;  2LGY A;  1N61 A;  2V9H A;  2X8X X;  2QC8 A;  2KVZ A;  1TKG A;  1C4P A;  1I4H A;  3SFE B;  2LWP A;  3M95 A;  3DQV A;  4MGZ E;  2M8S A;  3T9L A;  2LXC A;  2IGG A;  1JML A;  4PS3 A;  3HIZ A;  5G55 A;  4RMA A;  4FJZ A;  1YIW A;  3NJT A;  5AUI A;  3FKY A;  3GE3 C;  2M4N A;  3DWM A;  3APD A;  2PJH A;  3U4E G;  1VDV A;  3PLV A;  1UGM A;  1V6E A;  2D3B A;  3NUH B;  4H2A A;  5CHV C;  4YT0 B;  4BKT A;  1E0Z A;  4N6E B;  1GOZ A;  2EMT A;  1PFD A;  3EFU A;  3Q8F A;  2O2V B;  2FUH B;  2KNB A;  3R66 C;  1EU4 A;  3GP7 A;  4KX6 B;  4D2K A;  2KN4 A;  2SEB D;  1FNV A;  1CJE A;  3PGE A;  1FRD A;  2LXA A;  5KHO A;  3V60 A;  3LYY A;  4WAA A;  3VH4 B;  4TKN A;  1MHX A;  2KLC A;  3TSS A;  4O1N A;  1FXT B;  3AEE B;  5HG2 A;  1QT9 A;  5CHW A;  3KQ4 A;  2OHF A;  3RN9 C;  2WXO A;  2J42 A;  2UWQ A;  2BKF A;  2XK5 A;  1EF5 A;  1XQQ A;  2CJN A;  1HQR D;  1UEL A;  4YTM B;  1TS4 A;  1AN8 A;  3H7S A;  4A8X C;  3AE5 B;  2ASQ A;  1VZ6 A;  2G4S A;  2JYT A;  4G50 A;  4GDK A;  3FIL B;  3ETR A;  1IPG A;  4HXD A;  3GB1 A;  2LFI A;  2VZK D;  1NEN B;  1BXT A;  3H8H A;  3Q8B A;  1FNW A;  4LCD E;  2DYB A;  3L17 A;  4RGM A;  3ZRF A;  4C00 A;  1WGH A;  2N7D A;  3AXC A;  4BFR A;  2JVC A;  2V0G A;  3PHX B;  2DX5 B;  4EE2 A;  4F8C B;  1D6E C;  2KJR A;  3DPD A;  3IAM 1;  5JXV A;  3AE2 B;  2LRU A;  1XLQ A;  4JE3 B;  1PGB A;  5AZG A;  1L0X B;  1QQR A;  4CO7 A;  2N9L A;  4C4V A;  4DXF A;  1BT0 A;  1TIF A;  2AQ1 B;  2MWS B;  4OZC A;  4P16 A;  5FKA C;  3AEA B;  1Q5W B;  2BWE S;  2WHI A;  4NAM A;  1ZP0 B;  5IO9 A;  4TMA B;  4AOF A;  1WI0 A;  3N1X C;  5FR3 A;  4W9G A;  2LJI A;  4MGI E;  1XCQ L;  2NBW B;  2KFK B;  1TYG B;  1GG3 A;  1TY0 A;  2KWC A;  2V4L A;  4GLS C;  1E90 A;  3VFK A;  1YJJ A;  3R7R A;  2NBU A;  4LNF A;  2AL3 A;  2W82 A;  3KYC D;  1SE3 A;  1YMH E;  2QDF A;  4JGH B;  1K51 A;  3JSV A;  4AP4 C;  3VVW B;  5JZE B;  1FFV A;  4EZK A;  5D3D A;  4KIK B;  4KSL C;  5C23 A;  3NVW A;  2K6D B;  2JU6 X;  3DVG Y;  1ZGU B;  3A9K A;  3BK1 A;  1T0S C;  4YSZ B;  1J19 A;  1CZP A;  4ZOH C;  2N4F A;  2MCN B;  2JY6 A;  5BMH A;  3ZJU A;  4ZHP A;  2KDB A;  4PK1 A;  4URK A;  3P42 A;  1YD8 U;  2K8H A;  1NI3 A;  4EUT A;  2WXM A;  2NS5 A;  2BBC A;  2L0F A;  1PYW D;  3IHP C;  3QIJ A;  4GGQ A;  2KQS A;  3ZLZ A;  1VD2 A;  3DBL I;  3ZUN A;  4M02 A;  5G2N A;  3PZD A;  4TUU A;  4HLE A;  2KD0 A;  4F7Z A;  4K7S A;  4LNO A;  2IZV B;  3VR8 B;  3HHM A;  1OQY A;  3DBL B;  4KV2 A;  2FAZ A;  2BKR B;  2KJH B;  1WR6 E;  3OJ4 B;  4LJO B;  1C77 A;  1SF0 A;  2AWT A;  3R8B A;  3APC A;  1XLN A;  1FD6 A;  2MRP A;  4XGA B;  2D5G A;  2HDE A;  1I4P A;  1K50 A;  4GN1 A;  2CU3 A;  4BKS D;  4GB9 A;  4GDK B;  1WGY A;  3BYT B;  4MT5 A;  4JX1 C;  4BBN F;  3T3O A;  1WGR A;  2K25 A;  2PKO A;  2FCM A;  3PS6 A;  2WLB A;  3AEC B;  2K8C A;  3DBS A;  3NZU A;  2IGH A;  3QAR A;  2W55 A;  1KJT A;  2JX5 A;  3N32 A;  4REZ A;  2OJW A;  4MSM B;  4IKG A;  1JWU D;  1K53 A;  4US8 A;  2J7Q B;  3I57 A;  4HPM B;  2WXF A;  1E10 A;  1S3S G;  2AQ3 B;  2BF8 B;  4PT5 A;  3GZN I;  2CJO A;  2LZ6 A;  2N1V A;  2KMM A;  1V1O A;  3P4R B;  1WWT A;  2LGD A;  2A4Z A;  3I3T B;  3ZVV A;  1QOA A;  3DVN V;  2MBB B;  2DZJ A;  1WX9 A;  2GBK A;  1STE A;  3PRZ A;  4ACF A;  3GZN B;  2CHZ A;  5J18 A;  3URY A;  1EWY C;  2KKC A;  1TBE A;  5H8Y E;  1OQR A;  3AMZ A;  3GS2 A;  2DZI A;  2ZJD A;  4K3C A;  2EKI A;  1WGK A;  4C80 A;  3N3K B;  1TY2 A;  3NZS A;  3DDC B;  2YVC A;  3DBH I;  1LGR A;  1ZPS A;  1I42 A;  2KTR B;  4AJY B;  2INP E;  1R4M I;  5H92 C;  3N30 A;  4W9L A;  4DHZ E;  1TKY A;  4HJG E;  1RFA A;  2LI5 A;  3NY5 A;  2N9E B;  2IO0 B;  4AS1 A;  4JWS C;  3P4P B;  3IT4 B;  1F2R I;  4ANV A;  2ZPY A; 
#chains in the Genus database with same CATH homology
 1UWX A;  4GDL B;  3W9C B;  2KQ4 X;  4RH6 A;  2NTT A;  1DGJ A;  1RM6 C;  2ZW0 A;  2PVG C;  4OHJ A;  2JYE A;  1IUE A;  4MH8 A;  1I7H A;  1ZDV A;  3NRZ A;  2PVO D;  2WDV B;  4KGR A;  4RCO A;  4NZL B;  3ZQ4 A;  1JW9 D;  1KH0 A;  1VJK A;  3E9S A;  1J7A A;  3AE6 B;  4ITK A;  2WP9 B;  4JWU C;  2K22 A;  2RDG A;  1TKE A;  4RGN A;  5C2T B;  2WQY B;  2JSV X;  4C56 C;  2KDM A;  3ZYY X;  2DLB A;  1SB3 C;  1SSN A;  4JPS A;  1IGD A;  2TSS A;  2Z8L A;  4WUR A;  4YSY B;  2WXJ A;  2RPV A;  4KKI A;  5BYQ A;  1SE2 A;  1Y56 A;  1DOX A;  2QJL A;  3EA6 A;  3NVZ A;  3Q69 A;  5T8I A;  2JQR B;  1I4G A;  2E6X A;  2W3S A;  4HRO A;  1SE4 A;  2V4I B;  1WYG A;  2Y3A A;  3T3N A;  3PO0 A;  1N61 A;  4L1B A;  2KAJ A;  2MJE A;  2ZW1 A;  1J7C A;  5BYR A;  1TKG A;  3AE7 B;  1K52 A;  3PZ7 A;  1C4P A;  1IBX B;  1I4H A;  3TEW A;  3SFE B;  1VRA B;  1T6B X;  2W3R A;  4YTN B;  4XDC A;  5G5H A;  1FCL A;  3AEB B;  4XWW A;  1WXQ A;  2N9K A;  4YWG G;  2IGG A;  1TS2 A;  1XCT L;  2H88 B;  1JML A;  4LLG M;  3R2I A;  1FXA A;  2L1A A;  3VRA B;  2KAC A;  5EE0 A;  4LK0 M;  5AUI A;  2WS3 B;  3AH7 A;  1RFK A;  1I4R A;  2WXK A;  3DWM A;  2DYO A;  3BK2 A;  3U4E G;  3AEG B;  1VDV A;  1IBX A;  2M19 A;  4H2A A;  3NUH B;  4YT0 B;  1ZXH A;  1JWS D;  2SAK A;  3BVM A;  2WXN A;  4Q2J A;  2XN9 C;  1E0Z A;  4N6E B;  1F77 A;  1GOZ A;  5EE9 A;  2MEK A;  1PFD A;  3EGR A;  3Q8F A;  2LUM A;  3J9C A;  2K0P A;  1EU4 A;  3GP7 A;  1PGA A;  2M0A A;  3BVG A;  1F2R C;  4KX6 B;  4NAW B;  4ARI A;  1SIJ A;  1XLO A;  2Q5W D;  1EM7 A;  4D2K A;  3ZJV A;  3FIL A;  2KN4 A;  2PW9 A;  2SEB D;  1FNV A;  2G1E A;  1CJE A;  4ZYS A;  1T5X D;  1DOY A;  1D5Z C;  1FRD A;  2M56 B;  4WH4 A;  3V3X A;  5EE1 A;  1N5X A;  4YXD B;  1QIL A;  3BVZ A;  3B2G A;  1V1P A;  4MAC A;  1YJI A;  2LEK A;  1NEK B;  1TJE A;  3LYY A;  1HZ6 A;  4OVZ A;  3TSS A;  1MHX A;  2ON8 A;  4O1N A;  3KLS X;  4C7Y A;  3AEE B;  2W54 A;  3L4P A;  1UUP A;  5HG2 A;  1QT9 A;  1E9M A;  3P1M A;  1N60 A;  2YEP F;  1ET6 A;  3KQ4 A;  2OHF A;  2H89 B;  1QF6 A;  4M0W A;  2WXO A;  4C7Z A;  2J42 A;  3BII D;  3FAH A;  2WXL A;  4YSX B;  1I4X A;  2QIL A;  1D5X C;  1NVI D;  2CJN A;  1HQR D;  4YTM B;  3TEX A;  1TS4 A;  1XXG A;  2G9H D;  1AN8 A;  4RF1 A;  4A8X C;  1P7F A;  3AE5 B;  4ZRP A;  1QKZ A;  3TEZ A;  3ZGZ A;  1GAQ B;  1F0Z A;  1FMA D;  2MJ3 A;  3KWV A;  1VZ6 A;  2LGI A;  3IAS 1;  2I2Y A;  4OZA A;  1NYQ A;  1OQQ A;  1E7P B;  1L5P A;  2JYT A;  1JWA D;  3ABV B;  3ETR A;  3FIL B;  5E6J A;  4RGO S;  3GB1 A;  1WRI A;  2LFI A;  2VZK D;  1NEN B;  1YN3 A;  1YNT E;  1B9R A;  2BYT A;  3C8Y A;  2IDY A;  1BXT A;  4XE0 A;  3H8H A;  3Q8B A;  3IXS A;  3SR6 A;  1FNW A;  5BYS A;  1UNS A;  3BZD B;  3I9V 1;  2FE8 A;  1N5W A;  2GB1 A;  4RGM A;  4R3D A;  3CWI A;  1UGJ A;  1JAL A;  1ROE A;  1BML C;  1ENF A;  2V0G A;  1DYQ A;  1A70 A;  3E56 A;  4EE2 A;  1UWM A;  3B9J A;  1D6E C;  1JCK B;  1EU3 A;  1N62 A;  4RFB A;  3AED B;  1ZOY B;  3IAM 1;  3W5V B;  5JXV A;  3AE2 B;  1XLQ A;  3EUB 2;  3LXF A;  3HUI A;  1J7B A;  4JE3 B;  1XEE A;  3SFD B;  3MFG A;  1GPX A;  3RPF C;  1PGB A;  3W5U B;  1L0X B;  1MVK A;  1QQR A;  3NS1 A;  2LMC A;  2ONQ A;  2WXR A;  4P6V F;  5AUK A;  3AE9 B;  2QMT A;  1ZDX A;  2LHD A;  3IT6 B;  2N9L A;  2Y5C A;  4DXF A;  3VQI A;  1CK1 A;  1MHH E;  2AQ1 B;  4OZC A;  4P16 A;  5FKA C;  2V3P A;  1EWC A;  1AYF A;  1L0Y B;  3AEA B;  1JWB D;  4DXG A;  2WXH A;  2BS3 B;  2WXI A;  2WDQ B;  4AQ7 A;  4NAM A;  1ZP0 B;  4UDU C;  4TMA B;  2PTL A;  5LNK 1;  3Q8A A;  2GI9 A;  5FR3 A;  1L4Z B;  2WNM A;  1FM0 D;  2NMQ A;  4TQ1 A;  1HA5 A;  3MP9 A;  2K9X A;  2LJI A;  1XCQ L;  1CQV A;  2JWU A;  1ZE3 D;  5D7G A;  1TS3 A;  3DWG C;  2FUG 1;  2BS4 B;  1TYG B;  3MC0 B;  5MPO A;  1TY0 A;  3ZJT A;  1FXI A;  4GLS C;  2QEJ C;  1YJJ A;  1FO4 A;  2W82 A;  1SE3 A;  2K5P A;  1YMH E;  3UI3 A;  2WXG A;  1AW7 A;  1QOG A;  1K51 A;  1L0V B;  1C4A A;  2J52 A;  1ACC A;  1FFV A;  1C76 A;  1TS5 A;  2B76 B;  1JWM D;  5D3D A;  1RYJ A;  1PUT A;  3NVW A;  5EE3 A;  2JU6 X;  4FXC A;  3SEB A;  3BK1 A;  1FEH A;  4YSZ B;  1CZP A;  1ESF A;  3AM9 A;  4ZOH C;  2VZK B;  2QSD A;  3NVV A;  5G5G A;  1FIQ A;  3Q8E A;  5BMH A;  4NJC A;  5I4D A;  1VLB A;  4KKJ A;  1BUI C;  2MH7 A;  2RMM A;  4ZRQ A;  3ZJU A;  5HFY A;  1L6V A;  4ZHP A;  5BMI A;  3V05 A;  1ET9 A;  3NVY A;  1M4V A;  2K3U A;  4ARC A;  2BT6 A;  5HI1 A;  1V8C A;  3P42 A;  4WIP A;  1DOI A;  1NI3 A;  1JQ4 A;  1T3Q A;  1HEZ E;  2WXM A;  4OZB A;  2BBC A;  2WXQ A;  1SJH D;  2AQ2 B;  1PYW D;  4A9A A;  1FNU A;  1MI0 A;  1FCC C;  2Y5P A;  3VRB B;  3AB5 A;  1HXY D;  3P63 A;  4B0M A;  1GB4 A;  3HVD A;  2IPK D;  4KGS A;  1ZUD 2;  3KWL A;  4RNA A;  1KFY B;  4OW0 A;  2BB6 A;  3VR8 B;  3AE4 B;  1N63 A;  2DBY A;  3P4Q B;  3U7Z A;  1C77 A;  1SF0 A;  1KRH A;  4J3O D;  4US9 A;  1V97 A;  3R8B A;  4A55 A;  4TSS A;  2RDH A;  1XLN A;  2AX5 A;  3W1S A;  1FD6 A;  2WXP A;  3RFZ B;  3AE3 B;  4LTU A;  2D5G A;  2HDE A;  2L83 A;  3LB8 C;  2ACZ B;  4CQN A;  1I4P A;  1KLG D;  1HZ5 A;  2YEP B;  2DWQ A;  1K50 A;  2KWD A;  1QOB A;  1SJE D;  2CU3 A;  2MJD A;  4RGT A;  4HEA 1;  5C3J B;  2EEL A;  3TUO A;  4GDK B;  1PGX A;  1YQ4 B;  3BYT B;  4MT5 A;  4JX1 C;  3AE8 B;  4XWT A;  3BWU D;  3T3O A;  1SEB D;  3O13 A;  1YN4 A;  2PKO A;  3OWE B;  4USA A;  2N7J A;  3Q8C A;  2WLB A;  2GRI A;  3AEC B;  3BYY B;  1XLP A;  2IGH A;  3MJ5 A;  2IGD A;  2W55 A;  1QLB B;  2JX5 A;  1IGC A;  4DQO C;  1OFF A;  4REZ A;  1V1P B;  2I38 A;  4IKG A;  1JWU D;  1K53 A;  4US8 A;  1C9F A;  1GB1 A;  2BB5 A;  3I57 A;  1E10 A;  2WXF A;  2E3T A;  2AQ3 B;  2XNA C;  3B2F A;  3PZ8 A;  4L23 A;  4WQM A;  4HKQ A;  1NYR A;  1YN5 A;  1AWD A;  4PT5 A;  3AEF B;  1KTK A;  2J4X A;  4KGT A;  1VR9 A;  2NTS A;  1Q10 A;  1SXT A;  1PDX A;  2CJO A;  1VZ7 A;  2KMM A;  1V1O A;  1RWS A;  3P4R B;  1WWT A;  4HKZ E;  2ICI A;  4WAF A;  1QOA A;  2J53 A;  3AN1 A;  2QIE B;  4B0E A;  2PLP A;  1STE A;  1R7S A;  2WU5 B;  2BS2 B;  2DYM A;  4L2Y A;  2N0S B;  1XO3 A;  3NZ3 A;  2OED A;  1C79 A;  4TQ0 A;  3URY A;  1D4B A;  1EWY C;  2HTM E;  1JRP A;  1E6E B;  3FC4 A;  5H8Y E;  1OQR A;  2L32 A;  3MHZ A;  4IDI A;  3AV8 A;  3AMZ A;  2BW2 A;  4RF0 A;  4A6Q A;  2INN E;  2FBW B;  5HHD G;  1FFU A;  3GS2 A;  4ZHO A;  2EKI A;  1WGK A;  2R61 A;  2V3N A;  5FK9 C;  1L4D B;  1I4Q A;  4C80 A;  5GXG B;  2X38 A;  4YTP B;  1TZO A;  4N58 A;  2BTE A;  1TY2 A;  3CIR B;  1WSP A;  4XDD A;  3U2S C;  5BMG A;  1XF5 L;  3WCQ A;  2LHE A;  2WDR B;  3HRD D;  3TEY A;  1B1Z A;  1JRO A;  1ZPS A;  4N59 A;  1C78 A;  2PIA A;  4A90 A;  2INP E;  2WU2 B;  3HVZ A;  3AE1 B;  5H92 C;  4WWM A;  4HRS A;  2JZP A;  3P4S B;  2PMV A;  3VR9 B;  2JXT A;  3N9Y C;  1TKY A;  1L6U A;  4HJG E;  1LO5 D;  1VZ8 A;  1KF6 B;  1D5M C;  4IOI E;  1KLU D;  1MPE A;  3R2T A;  3U52 E;  1ZXI A;  2IJ0 A;  1C4C A;  4AS1 A;  4JWS C;  1YQ3 B;  2L52 A;  3W2D A;  1P7E A;  3P4P B;  3IT4 B;  5D3I B;  5TSS A;  1SBB B;  1F2R I;  1QOF A;  1FRR A;  4MM3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...