1IBXA

Nmr structure of dff40 and dff45 n-terminal domain complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYFPSVPDNAELVLLTLGQAWQGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords DNA FRAGMENTATION FACTOR 40
publication title Solution structure of DFF40 and DFF45 N-terminal domain complex and mutual chaperone activity of DFF40 and DFF45.
pubmed doi rcsb
source organism Homo sapiens
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.-.-.-:
pdb deposition date 2001-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ibxA00
2JWUA 1YNTE 4HKZE 1MVKA 5BMGA 2JU6X 3FILB 3GB1A 2ZW0A 2QMTA 2ON8A 2J52A 2KQ4X 4MACA 1F2RC 2I38A 2QSDA 4GLSC 1UWXA 1FCLA 2LHDA 4OZBA 1YMHE 3UI3A 3V3XA 4KGTA 2JXTA 2LHEA 2IGGA 2PLPA 4KGRA 2ZW1A 1EM7A 2JZPA 1HZ6A 2RMMA 2PW9A 1F2RI 2JSVX 1GB4A 1K50A 2KDMA 2N9LA 1K53A 5HHDG 1D4BA 5HFYA 4OZCA 2EELA 1MHHE 1MPEA 1MHXA 1IBXA 2LGIA 1XF5L 2KACA 4HJGE 1C9FA 1K51A 1HEZE 5JXVA 1K52A 2PTLA 5HG2A 5BMIA 5HI1A 1ZXHA 5BMHA 1Q10A 1FCCC 1PGAA 1IGDA 1KH0A 1XCTL 2ONQA 1IBXB 2I2YA 1JMLA 2KWDA 2J53A 2OEDA 1MI0A 4D2KA 1P7FA 2NMQA 4KGSA 4IOIE 1GB1A 2GI9A 2GB1A 1HZ5A 4OZAA 1FD6A 4WH4A 4IKGA 2LUMA 1QKZA 2N7JA 1XCQL 2KN4A 3FILA 2IGHA 1IGCA 1PGXA 3MP9A 2K0PA 2RPVA 1PGBA 2N9KA 1P7EA 2IGDA
chains in the Genus database with same CATH superfamily
3L10B 3W5VB 1L4ZB 2FE8A 2D5GA 3PVLA 1T3QA 2J0JA 1E8WA 3QCAA 1YOVB 3NVVA 2PPHA 4AP4C 1V49A 3V6CB 3M63B 3RNEC 2DBYA 5E6NA 4EKUA 1WGYA 4MACA 1V2YA 4I6LB 3QAQA 1J8CA 1TS5A 1I4XA 1V5OA 1RWSA 4B95A 1VZ8A 3UQBA 4EEWA 2Y5PA 1NENB 3I3TB 3AE8B 5G55A 1XLPA 2MRPA 4X57B 1EF1A 1TTNA 2LRWA 4R3DA 1SXTA 2JSVX 3ONSA 2V9HA 4XDCA 2KTRA 1D4BA 3MC0B 4C4VA 4DDGD 1WM2A 3SU8X 3MJ5A 2EELA 2AL3A 3I9V1 3AE7B 3M3JA 3H1UA 4IWPA 3VDZA 5JH5C 4W9IA 2BWFA 1LM8B 3Q8CA 1L6VA 3N20C 2LGSA 4H2AA 3CIRB 2M17A 2AEHA 2INCC 3TSSA 1J7CA 2NCNA 1CZPA 4BOSC 5G5HA 2YEPF 3KH0A 3DWMA 2QCZA 1UNSA 3U52E 2MW5A 3QA8A 3KVFB 1ESFA 3PT2B 5DPSA 1FNWA 1SIFA 5J18A 1Z5SB 2RPVA 1E6EB 1LO5D 1XLOA 1E7VA 3RUIB 1WX9A 4YWGG 2MWSB 2L0FA 3VTVA 2WXFA 4UDUC 1I7HA 1ENFA 2QMTA 3URYA 1ZXIA 3TEXA 1VRAB 4LCDE 1F2RC 2GBRA 1N5XA 4JIOU 2WQYB 4EUTA 2E3TA 3WA0A 1ZW7A 2AX5A 4OZBA 3T9LA 3Q3FA 1J0GA 4BKSD 2C7NB 3TL5A 3PS6A 2ZCBA 2KQSA 1WGKA 2WXMA 1I4HA 2JZPA 4M02A 3BVZA 2JQRB 4HVBA 4N6EB 2PE9A 1F52A 5D2MB 1K53A 4II2B 1E8XA 3DCGA 3BWUD 3JSVA 4ICUA 2C60A 3PRZA 1OQRA 1MPEA 4K1RB 1EUVB 4REZA 3RNBC 3QHTA 5E6JA 1WZ3A 4O1NA 2QJLA 4XWTA 1KTKA 5BMHA 2L7RA 4LNNA 3NY5A 4OHJA 1C78A 3HVDA 3DDCB 4C7YA 3R66C 2JYEA 1IBXB 2NBVB 4W9GA 2FUG1 2N9XA 3M95A 4HWIB 4OVUA 4LLGM 5JHAA 1MI0A 4FULA 1N63A 2JYTA 3ZVVA 1EF5A 3FC4A 1WRIA 4IM3A 2JF5A 3KW5B 1SE9A 1OEYA 3PHWB 5E6OA 3RNFC 3OAWA 2LGYA 1GG3A 4CYEA 5HKHA 1TIFA 4K7SA 5D3IB 4OZAA 1ZGUB 4G3XB 2KANA 1RYJA 3ZDMC 3IBEA 1QKZA 2ZNVB 3VUWA 3AEAB 4RMAA 2IJ0A 2TSSA 2M56B 3NS1A 4ZYSA 1ZDXA 2K0PA 2K22A 4KDLB 2LZ6A 2Z0EB 1M4VA 1YX5B 2FBWB 1V1PB 1JWBD 1L0XB 3VR8B 2MH7A 1Y56A 2WXGA 4Q2JA 2ZW0A 2FNJB 1OEYJ 2PKOA 3I63C 1XT9B 1AW7A 4ZRKA 1AN8A 1RLFA 2XK5A 1WX8A 1TZOA 1UWMA 1GNUA 1LQBA 3SDLC 3E9SA 4HLEA 2MP2A 3NUHB 5BYQA 2K8BA 4A9AA 4RM8A 4A8XC 3TIXA 1V6EA 4NAMA 1LGRA 1MHXA 5BYRA 3X23A 5AZGA 4TQ1A 4AJWA 2KTRB 2VH2A 3A33B 3M62B 4C4VB 1Q10A 3VFKA 1FCCC 2UU7A 2KZRA 4IC7B 3Q8BA 1XCTL 2O6VD 2FIDA 4FHKA 3U7DA 3AULA 2WXNA 4YSYB 4CQNA 2Q5WD 5CHVC 1TKGA 4DQOC 4MGZE 1FNVA 5C1ZA 1I4GA 2Z8LA 3SR6A 1SB3C 3BK2A 1T0YA 2PMVA 2D10A 2LD9A 2V4LA 3B1LX 2MBBB 2YVCA 4F7ZA 3FILA 3BZDB 3HRDD 3O13A 2Y5BB 1C77A 4NY0A 2LRUA 1U4AA 3T8MA 3GOEA 3UF8A 1SE2A 2O6VA 2K39A 1LFDA 1RFKA 3DBLI 3IVFA 1E10A 2CHWA 5J2RA 1RAXA 3LYYA 2ON8A 3DVNV 3W1SA 3ETRA 2I38A 1YD8U 2QSDA 3RN9C 4W9JA 2L83A 2J7QB 4A20A 4IUMB 1D5ZC 4W9KA 2MX2A 5C23A 4CHKA 2M4NA 2KJHB 3WALA 2WS3B 3NZSA 1L5PA 1S3SG 2REXA 5G5GA 1PFDA 2KDBA 4HK2A 3D32A 3KWVA 5HHDG 2D3GA 2AYOB 2KN5A 4HPLB 4GXBA 1V97A 3HUIA 2MLBA 3W1YA 4ANXA 1K52A 3U7ZA 2WDQB 1QLBB 3B2GA 1R4NI 1C1YB 3R2TA 1PGAA 3JSVB 2RD0A 4A3OA 4YT0B 4N9F4 4MSMB 2BVCA 4ZRPA 3RNAC 3PRMB 2LXAA 2AQ3B 4XWWA 4NPNA 5IN7A 3V6EB 3B0AA 4PT5A 1JWUD 2PVGC 1TS3A 3N30A 2Z59B 1GAQB 3RNCC 1TY2A 2OOBB 1KOTA 2BYFA 4MH0E 3EA6A 1NYQA 4M0WB 3WCQA 2MEKA 1N5WA 1TGZB 3KWLA 1RM6C 1XO3A 2WWZA 2WXRA 1VZ6A 1WWTA 1PQSA 1VCBA 1WJ6A 2RDBC 4DXFA 2ZNVC 5JZEB 3ZNID 1AYFA 1ZDVA 3DVNU 1P98A 2V3SA 2INPE 2NTTA 1SIJA 4US9A 3GB1A 4LNFA 2KQ4X 2L05A 2ZCCA 4XDDA 2BBCA 3GE8C 4DDID 2KMMA 2ZEQA 1ACCA 3UI3A 4RGOS 4LNKA 2PLPA 1I35A 3A4RA 2G4SA 2MBQA 3A1QA 2NR2A 2RR9A 2LMCA 4IM2A 4URKA 3LDZE 4K7UA 2G9HD 2AQ1B 1L2NA 2KDMA 2LJIA 2N0SB 4GGQA 4ANUA 2DYOA 2MJ3A 3VXWA 2HJ8A 3ZO5B 2KNBA 5TR5A 2OJWA 2LUEA 1WFYA 2GOWA 2M0AA 1KJTA 4P1CC 1D3ZA 2JX5A 2B3AA 3Q6BA 3PZDA 2A5UA 2WXIA 3Q69A 3ENEA 1F1HA 1JRPA 2KK8A 3IFWB 4LJOB 2KO3A 1QOBA 1V8CA 1GC6A 4KSKC 1SJED 3NZUA 1IP9A 3ABVB 2KFJA 4KZCA 3PSEB 4JX1C 1UH6A 2G1EA 4RGMA 2C7MB 3K9PB 2ZPYA 5FR3A 3WAOA 2ASQA 1NEKB 4BKTA 2V4IB 1MJDA 2WXKA 2PVOD 3QJZA 4IKGA 4TMAB 4FJZA 4GDKA 1UBIA 4DXAB 5LXIB 3NVWA 3L4PA 4FXCA 5AEKB 1GPXA 2PEAA 1I4RA 1NI3A 3KUCB 3L0WB 3PLVA 3RMKC 1V9JA 3VR9B 5IA7A 4HPPA 1I4PA 2L32A 5JHBA 5C2TB 3A4SC 4WJQA 1MVKA 1C4AA 1H8CA 3FILB 4EZLA 2C7HA 4C80A 2GBNA 4PS8A 1EU3A 2O6VB 3V3XA 3OG5A 3VH3B 3NRZA 1K8RB 3RCZA 3ZLZA 3UINB 1FXIA 1FMAD 2N1WA 3APDA 1PDXA 4ANVA 1WMHA 2K6QA 2BKFA 4EZKA 4JWSC 3SHQA 3WANA 3Q14C 2QILA 5D3DA 2KYWA 4EE2A 3C8YA 3S2AA 1WXMA 3T3NA 4ZHPA 3OLMD 3IAM1 3UIPB 1R7SA 2PIAA 1FPYA 1HEZE 1L4DB 1YQ4B 3ZNZB 1QZEA 3VUXA 1TZ1A 2BB5A 1HXYD 1HE8A 3EUB2 4A55A 2LWPA 3V62A 1FIQA 3MHZA 2DHZA 3ZW3A 2EMTA 4FBJB 2DZJA 2M8SA 4G11A 1WGDA 1F9JA 3ZUNA 3MHSD 2I2YA 4GSWA 2J53A 2KD0A 2G45B 1E7PB 4MGIE 4IM0A 4ACFA 4RGTA 4IOIE 4P16A 4L23A 3FKYA 3DHGC 2MSED 1CK1A 2V3PA 3EHVA 2VH1A 3EC8A 3KYDD 1TS2A 1N6ZA 3U4EG 1EU4A 1GOZA 3P4SB 1OTRB 2KDIA 2WXJA 3DBRI 1I4QA 2OJRA 3GZNB 2IYDB 2CHXA 3DBHI 1NDDA 4DK5A 4EOYA 3VRBB 2IO1B 3W9CB 1ZKHA 3AECB 1QOFA 1S1QB 2L3ZA 4NJ6A 3UGBB 3BYTB 2A4ZA 2JU6X 2K25A 3H9DA 3N1XC 3BYYB 1EWCA 2K8HA 3PRPB 3BVMA 1WGRA 1F77A 1WY8A 3ECIA 3J9CA 1WXQA 2JXTA 3T3OA 3WIMA 3N32A 2ZW1A 1T0QC 2VRRB 4WJPA 1P3QU 1QT9A 4WQMA 3W5UB 5HFYA 3P4RB 1C4CA 1MHHE 4WJOA 1IPGA 4BFRA 3ZYYX 4FJYA 3A1QB 2W82A 4WJNA 3QIJA 3BIID 1OGWA 1DOXA 2WGSA 1SJHD 3ZQ4A 1XLNA 3AEFB 4J3OD 3EECA 1ZP0B 2GRIA 3APCA 1WXVA 2KHWB 5BO4B 4F1SA 3TJPA 4HEA1 1N60A 2L52A 3LXFA 3OJ3A 1L0YB 4FADA 2FCMA 3AV8A 4IW0A 1IYFA 2XNAC 3SFDB 3SD5A 2INDC 3ALBA 1WJNA 4WAFA 1V86A 5I4DA 1KRHA 3L54A 3AMZA 3BVGA 4MT5A 1UF0A 1JRUA 2D11A 3P1MA 2HE7A 4ARCA 2XBBC 3L17A 2G3QB 2JT4B 2ACZB 3BK1A 3W2DA 4ASWC 3BY4B 4PYUA 4RF0A 1VDVA 4HDOA 4YTPB 2QHOA 2GMIC 4GB9A 4L1BA 4KV2A 2NPTB 3KQ4A 2BYEA 4JWUC 1SEBD 4DHJD 1DYQA 1HQRD 2BW2A 2WDTB 5D94A 4RGNA 1C4PA 4FA6A 1HTOA 1VZ7A 2NTSA 1P0RA 2INNE 2JWZA 1HZ6A 3VHTC 4P1BC 2RSUA 4NAWA 1N62A 4KX6B 2J42A 4AOFA 2DAJA 3PREA 1TKYA 1L6UA 2KX3A 5D7GA 3R7RA 1V80A 3DBHB 1KM7A 2L1AA 2ZVOA 4AQ7A 4YTMB 3ZIMA 2KACA 3AE3B 2KWVB 2LGDA 1WMHB 4CO7A 1CQVA 3H6NA 3B08A 3VTWA 3ZNHB 2X8XX 2MQJA 3ZXRA 3R7QA 2ONQA 3AE2B 3U30A 3ZJTA 2CHZA 2OEDA 4E3CA 1E7UA 4LK0M 2WX0A 1BUIC 2IBIB 4RF1A 1LXDA 4FHJA 4ICVA 3RPFC 2HTME 1WE6A 4WQOB 3IT4B 1YJ1A 3I57A 4AJYB 4WH4A 2WU2B 4XYCA 2KLCA 2D2QA 3AB5A 4MGYE 3WAPA 2CS4A 1A5RA 4NNJB 3Q8AA 4J6IA 2O2VA 1N61A 1PGBA 4W9HA 2NBWB 1KLUD 3Q3JA 2V3NA 4GDLA 1DOIA 1XEEA 3DBSA 5BMGA 1KLGD 5EDSA 3AEBB 1KLVA 4RH6A 3Q3MC 4ZHOA 2HJ1A 4K7WA 4XC2A 3CSTA 2LVPA 2CKHB 1PUTA 4GLSC 3IAS1 3CF6E 1VJKA 5DPWA 2Y3AA 2LHDA 1Z2MA 5T8IA 4C00A 1WGGA 4KGRA 3AEDB 2BKRB 4ARIA 3P42A 4AS1A 1A70A 3PV1A 2CR5A 2KWCA 1F2RI 1FRDA 3R8BA 4WURA 4RM9A 2BYVE 1WYGA 5LLIA 3RZWC 2JPHA 2H89B 1JWAD 4M8NA 4AUQC 1QQRA 4HJGE 1C9FA 2LXCA 4K3BA 4W9CA 3SEBA 2W55A 3PGEA 2KJRA 3NG0A 2MHJA 4B0MA 5FKAC 2LGXA 2M0XA 2QIEB 2R61A 2PJHA 2HDEA 2LVOA 1JROA 4D2KA 2KDFB 4PYZA 1AARA 1WJUA 1FM0D 2K8CA 5IP4D 4JE3B 2GB1A 4I6PA 2K9XA 1UBQA 1ISNA 3ZKJC 2L0TA 3RT3B 1D5XC 3L16A 2IGHA 1PGXA 2N9EB 2WXHA 1QOGA 2BS4B 2N9KA 3NHEB 2IY1B 4P6VF 3K9OB 2MBOA 3OJ4B 3OWEB 4PS3A 3VUYA 2FCNA 4XGAB 4LNOA 3EFUA 2JRHA 4XZ4A 4WWOA 1R4MI 1UGJA 1TKEA 3LB8C 3APFA 2AL6A 4BAXA 2WX1A 1FCLA 1V81A 4BVUC 3U8ZA 2NS5A 4A6QA 3ZGZA 3NS8A 4JPSA 5H8YE 1YN4A 1GB4A 4M00A 4KDIC 3JW0X 4OZCA 4W9EA 4KVGB 2JXXA 2FCSA 3MC8A 1K51A 4WIPA 4KIKA 1HTQA 4NAWB 3NVYA 3N3KB 2XK5B 1IUEA 2KKCA 3PPAA 4G0NB 4EZJA 1DOYA 1FFVA 2W54A 2EKIA 3DOWA 3DBLB 2L00B 1H4RA 2QC8A 2MP2B 1I42A 4DHJB 4HDQA 2GI9A 4AWJA 5KHOA 5IAAC 4TKNA 1BXTA 1YIWA 1UUPA 1JWSD 2G4DB 3AEEB 3HK0A 4DHZE 3QARA 4F8CB 2RGFA 4JLCA 1JW9D 2J0KA 4HCNB 3AU4A 4MM3A 1D6EC 4NJ7A 4FJVB 2DWQA 3Q3OC 1QOAA 2MBEA 3AE4B 5AUIA 4IDIA 2FIFA 3RNGC 1T0RC 1FO4A 2D3CA 2O2VB 2J52A 3VRAB 2DZIA 2D3BA 2CJNA 3C0RB 1R4NB 4GDLB 1TYGB 3QQ8B 2AQ2B 4XE0A 3DVGX 1ZE3D 2BPSA 3H8HA 4OVVA 4ZRJA 1B9RA 3HIZA 2IDYA 2BTEA 1CMXB 3N9YC 1GC7A 2FAZA 2V1YA 4BKGA 1EWYC 1GUAB 3QWZB 1ROEA 3V60A 1NYRA 1Q5WB 1UGMA 3L13A 1YQBA 4YTNB 3PO0A 1TBEA 4E71A 2KMCA 2KTFA 1E8YA 4WAAA 1YN3A 2KVRA 3UIOB 3DQVA 2E6XA 3ZJVA 4MDKE 1FNUA 2BS2B 3H7SA 3ZTDA 3V05A 2GBMA 1SF0A 2LI5A 3AM9A 1E8ZA 1KF6B 1ET6A 2KVZA 3KUZA 3NVZA 3RI7C 5D6JB 5AZFA 1HA5A 2QEJC 3R3MA 2BQQA 3Q3NC 1UZXB 1AWDA 3MFGA 1MG8A 1J19A 2WXLA 1L0VB 4FLHA 3MP9A 2R2OA 1C76A 4ZOHC 1YNTE 5BYSA 4S0RA 2K6DB 3CSFA 3FAHA 1FXAA 2LEKA 3IG3A 2H88B 3ZDTA 2M1MA 3KUDB 2WHIA 2KT7A 2Z0DB 2WP9B 3DVGY 5J17A 2FUHB 3AE5B 1YN5A 1E9MA 2GBJA 1ZUD2 2I1JA 1T6BX 1Y8RC 1E5WA 1RRBA 4HXDA 3CWIA 1XD3B 1TS4A 4WWPA 3DWGC 2DX5B 1DGJA 1EO6A 3NOBA 3WAMA 2CJOA 2V0GA 1YJJA 4BZAA 1Q0WB 1WIAA 4ZDVA 4IWOA 3VTUA 3ZXVA 3KYCD 4P7IA 2W3RA 4TUUA 5JXVA 1V1OA 3SFEB 5G2NA 2BB6A 2DENB 2NBUA 4KZ0A 3E56A 4DBGA 1WJ4A 2ICIA 2IO0B 2IPKD 2KWDA 5FR6A 4KIKB 2KJ6A 3MTNB 2BYTA 2BS3B 1JCKB 4L2YA 5AZHA 1NI2A 3VH4B 2LUMA 3AE9B 2KDEB 4N58A 1VLBA 3VQIA 3ZJUA 2EKEC 3NJTA 1J7BA 1ZOYB 2KFKA 3VAWA 2K5PA 1E90A 1BMLC 1V5TA 3B9JA 1WGHA 1P9DU 1UELA 1TT5B 2RDGA 4B6WA 3QK0A 1XXGA 3CMMB 1FFUA 4MM3B 1FEHA 2JUOA 2KLGA 1EM7A 2JVCA 1XQQA 2MJDA 2PW9A 4GDKB 1YJIA 4YSXB 2CU3A 2N7DA 4BKSA 2WXOA 1WRDB 2ZZPB 4M0WA 1WE7A 1ET9A 5E6PA 3AH7A 1SE3A 4C7ZA 2Y5CA 5CHFA 1WX7A 2GLSA 1ZPSA 2MA9B 3JYUA 4II3B 3DHHC 1T0SC 4JQWC 2RPQA 2PTLA 2KOXA 2HD5B 3HM3A 3P4PB 2KWUB 1JWMD 4TV3A 4HRSA 2DZMA 2WXQA 4ANWA 3DBRB 3IHPC 4RNAA 2I1KA 1QF6A 1WR1A 4I6NB 3R2IA 1C79A 3U2SC 3V61A 4US8A 3W1SC 3Q8FA 5EE3A 2N1VA 5EE9A 1STEA 3GP7A 3MJWA 1GJZA 2J4XA 4B9KA 2UYZB 3ZNGC 2UWQA 1WYWB 1JALA 3AEGB 4B0EA 5CHWA 1WXAA 4M01A 1MG4A 1MFWA 5LNK1 2D07B 4IG7B 2BT6A 2VZKD 4LDTD 5IKCM 4NQLB 1B1ZA 3KLSX 3RFZB 1J7AA 5GMVA 3AE1B 2N7EA 4MGKE 2DLBA 4LTUA 3RZFA 4A3PA 3JVZX 1XLQA 4GOCA 5CTRC 1UWXA 4MJSA 5LXHA 1YMHE 4RFBA 3HHMA 4KGTA 2LHEA 2AWTA 2IGGA 3LJ3A 2EMSA 5IO9A 2CU1A 1YQ3B 4ZYNA 3AE6B 3P2BA 2FCQA 4OVZA 1G6JA 3H7PA 4EFOA 2N9LA 3ML8A 1TJEA 2L8JA 4DHZB 3ZRCA 2ZPNA 4YL8A 3I5JC 3P4QB 2J0MA 4W9FA 3TBLD 2HTHA 2LGIA 1P1AA 2KC2A 3TCAA 1VR9A 4NQKE 2WLBA 4MH8A 5DPRA 2LJ5A 3A9JA 5HI1A 1M94A 5FK9C 1FXTB 3EGRA 4M8MA 3N1YC 4ZRQA 2LFIA 4W9DA 2MJEA 5KHQA 3HM6X 4LNIA 1OFFA 5CX3A 4ITKA 4MSQB 2WDRB 4WWMA 2IY0B 1L7YA 2DZKA 4NZLB 3GE3C 1OQQA 4ZRIA 1WSPA 3A9KA 1GB1A 3IT6B 3TEZA 4BBNF 3Q2AC 2JZZA 3ML9A 1FD6A 4DWFA 2N7JA 3BINA 2M19A 3B2FA 2JRIB 5AUKA 2WXPA 5DCNA 4E74A 4JGHB 3DHIC 2IO2B 3HVZA 2JWUA 2DYMA 1WXSA 3PZ7A 2WDVB 2KQ7A 4HKZE 1CJEA 3PZ8A 5L83A 1SSNA 4USAA 1WR6E 2BF8B 2KX0A 4KKJA 4KSLC 5GXGB 2KMAA 2WYQA 3TEWA 2KFKB 1T5XD 5C3JB 3UQAA 1SGHA 2R2QA 1JQ4A 2RMMA 2SAKA 1NBFC 4S17A 1WF9A 2IO3B 3N1ZC 4FN2A 3TUOA 3DPDA 3P63A 2N4FA 4HROA 2JZ3B 3PLUA 4PK1A 3IXSA 4IWQA 4YSZB 3C19A 2LVQA 1XF5L 1D5MC 5HG2A 2SEBD 2D3AA 2W9NA 4G50A 1F0ZA 5BMIA 1WI0A 1ZXHA 3VVWB 1UD7A 2WU5B 2LASA 2KC1A 4LJPB 1KH0A 4TSSA 1KFYB 4A90A 3PHXB 3Q8EA 4HPMB 1WM3A 4TQ0A 2ZVNA 2MCNB 4MELA 3O65B 1P7FA 4RCOA 4GN1A 2YLMA 3AN1A 1QILA 5TSSA 1BT0A 1SE4A 3QC8B 2GBKA 2NVUI 2BWES 2WNMA 2X38A 2ZJDA 2W3SA 2KN4A 4K3CA 2MBHA 2IZVB 3TMPB 3RD2A 2KAJA 2XEWA 2DAFA 2IGDA 4BBNC 3AI5A 1VD2A 3EFCA 1YX6B 3RYTA 4HKQA 2XN9C 4KKIA 1WZ0A 1OQYA 4MEMA 2N9PC 1E0ZA 4WWNA 5IOIA 2B76B 4W9LA 2K3UA 1SBBB 4N59A 2K1FA 4OW0A 2DNFA 1K50A 3GZNI 5EE0A 4MJSB 5DPTA 4JL9A 4BOZB 4GMVA 1C3TA 3TEYA 1IBXA 4QAYA 3H7PB 2PE6B 2L76A 2KXJA 3L08A 1Q1OA 2VZKB 1RFAA 4LDTB 4PS7A 5L95C 1X1MA 2C5LC 2C9WB 4C56C 2JY6A 1IGDA 1PYWD 2BGFA 5EE1A 1WH3A 1JMLA 2NPTA 4NJCA 2OHFA 4XX5A 3X0WA 3ZTCA 2NMQA 3PTFC 3A9JB 1R4MB 3GS2A 4HCPB 4KGSA 4GIVA 3QX1A 2YEPB 1HZ5A 3ZRFA 1V1PA 2DYBA 3MC9A 4DXGA 1XCQL 1FRRA 2RDHA 2QDFA 3RULA 3AXCA 1IGCA 5H92C 4GU2A 3AU5A 3NZ3A 4YXDB 4K81A 3A9KB 5MPOA 1NVID 4HJKA 1P7EA 1TY0A
chains in the Genus database with same CATH topology
1J7BA 2V3NA 3W5VB 1DOIA 1XEEA 1L4ZB 5BMGA 1KLGD 1ZOYB 2FE8A 2D5GA 4DXFA 1AYFA 1ZDVA 3AEBB 1T3QA 2K5PA 4RH6A 2INPE 2NTTA 3NVVA 1BMLC 1SIJA 4ZHOA 3B9JA 4US9A 3GB1A 2DBYA 2KQ4X 2RDGA 4MACA 4XDDA 2BBCA 1PUTA 4GLSC 2KMMA 1XXGA 3IAS1 1VJKA 1ACCA 2Y3AA 1FFUA 2LHDA 1TS5A 1FEHA 1I4XA 4MM3B 3UI3A 4RGOS 1RWSA 5T8IA 1VZ8A 2PLPA 2Y5PA 1NENB 4KGRA 3AE8B 3AEDB 4ARIA 1EM7A 3P42A 4AS1A 1A70A 1XLPA 2LMCA 2MJDA 2PW9A 1F2RI 1SXTA 4R3DA 2JSVX 1FRDA 4GDKB 2G9HD 2AQ1B 2KDMA 2LJIA 4XDCA 4WURA 3R8BA 2N0SB 1YJIA 4YSXB 2CU3A 2DYOA 1D4BA 2MJ3A 1WYGA 2WXOA 3MC0B 3MJ5A 2EELA 4M0WA 1ET9A 3I9V1 3AE7B 3AH7A 1SE3A 2H89B 2M0AA 4C7ZA 1JWAD 2Y5CA 1ZPSA 1QQRA 4HJGE 2JX5A 1C9FA 2PTLA 2WXIA 3SEBA 2W55A 3Q69A 3P4PB 3Q8CA 1L6VA 1JWMD 1JRPA 4HRSA 4B0MA 2WXQA 1QOBA 5FKAC 1V8CA 2QIEB 4RNAA 2R61A 4H2AA 1SJED 3CIRB 3ABVB 2HDEA 1JROA 4D2KA 4JX1C 1QF6A 2G1EA 4RGMA 1FM0D 3TSSA 5FR3A 1J7CA 3R2IA 1C79A 3U2SC 4US8A 3Q8FA 1CZPA 5EE3A 5EE9A 1NEKB 4JE3B 1STEA 3GP7A 5G5HA 2V4IB 2WXKA 2GB1A 2YEPF 2J4XA 3DWMA 1UNSA 2PVOD 3U52E 4IKGA 1JALA 4TMAB 2K9XA 3AEGB 4B0EA 1ESFA 1D5XC 1FNWA 3NVWA 3L4PA 4FXCA 2IGHA 5LNK1 1PGXA 2BT6A 2VZKD 1GPXA 2WXHA 1B1ZA 1I4RA 1NI3A 2RPVA 1QOGA 2BS4B 3KLSX 3VR9B 1E6EB 1J7AA 1LO5D 2N9KA 3RFZB 1XLOA 3AE1B 4P6VF 1I4PA 2L32A 3OWEB 5C2TB 1MVKA 4YWGG 1C4AA 2DLBA 2WXFA 4UDUC 1I7HA 1ENFA 3FILB 4LTUA 1UGJA 1TKEA 3LB8C 2QMTA 4C80A 3URYA 1ZXIA 3TEXA 1VRAB 1XLQA 1F2RC 1N5XA 2WQYB 2E3TA 1UWXA 1FCLA 1EU3A 2AX5A 4OZBA 1YMHE 3V3XA 4A6QA 4RFBA 3NRZA 4KGTA 2LHEA 2IGGA 3ZGZA 1FXIA 1YQ3B 1FMAD 3AE6B 1WGKA 2WXMA 1I4HA 4JPSA 1PDXA 2JZPA 4OVZA 5H8YE 1YN4A 3BVZA 2JQRB 1GB4A 4N6EB 2N9LA 1TJEA 1K53A 4JWSC 2QILA 5D3DA 3BWUD 4EE2A 3C8YA 4OZCA 3P4QB 1OQRA 1MPEA 3T3NA 4ZHPA 3IAM1 2LGIA 4REZA 1R7SA 2PIAA 1K51A 1HEZE 1L4DB 1VR9A 4WIPA 2WLBA 4MH8A 4NAWB 1YQ4B 4O1NA 5E6JA 3NVYA 2QJLA 2BB5A 1HXYD 3EUB2 4XWTA 4A55A 5HI1A 5FK9C 1FIQA 1KTKA 3MHZA 5BMHA 3EGRA 4OHJA 1C78A 3HVDA 4C7YA 1IUEA 2JYEA 4ZRQA 1IBXB 2LFIA 2I2YA 2MJEA 2FUG1 2J53A 4LLGM 1DOYA 1FFVA 2W54A 1MI0A 1N63A 1E7PB 1OFFA 2EKIA 2JYTA 4ITKA 2WDRB 4WWMA 3FC4A 1WRIA 4NZLB 1OQQA 4RGTA 4IOIE 4P16A 4L23A 1WSPA 1GB1A 2GI9A 3IT6B 3TEZA 1CK1A 2V3PA 5D3IB 1BXTA 4OZAA 1FD6A 1UUPA 1RYJA 1JWSD 1QKZA 2N7JA 3AEAB 3AEEB 1TS2A 2M19A 3U4EG 1EU4A 3B2FA 2IJ0A 1GOZA 2WXPA 5AUKA 3P4SB 2TSSA 2M56B 3NS1A 4ZYSA 2WXJA 1ZDXA 2K0PA 2K22A 1JW9D 1M4VA 1I4QA 3HVZA 2FBWB 2JWUA 2DYMA 3PZ7A 1D6EC 2WDVB 3VRBB 3W9CB 1V1PB 1CJEA 4HKZE 1JWBD 2DWQA 3AECB 1L0XB 1QOFA 1QOAA 3PZ8A 3BYTB 3AE4B 2JU6X 3VR8B 2MH7A 5AUIA 1Y56A 4IDIA 3BYYB 1SSNA 2WXGA 4Q2JA 2ZW0A 4USAA 1FO4A 1EWCA 2J52A 2PKOA 3VRAB 1AW7A 1AN8A 3BVMA 2CJNA 1TZOA 1F77A 1UWMA 4KKJA 3J9CA 4GDLB 5GXGB 1TYGB 3TEWA 1WXQA 1T5XD 2JXTA 3T3OA 5C3JB 2AQ2B 3E9SA 4XE0A 2ZW1A 1ZE3D 3NUHB 3H8HA 5BYQA 1JQ4A 2RMMA 2SAKA 1B9RA 2IDYA 2BTEA 4A9AA 3TUOA 4A8XC 3N9YC 1QT9A 4WQMA 3W5UB 5HFYA 4NAMA 3P4RB 3P63A 1C4CA 1MHHE 4HROA 1EWYC 3IXSA 1MHXA 3ZYYX 4YSZB 2W82A 1XF5L 1ROEA 5BYRA 1NYRA 1D5MC 4YTNB 3PO0A 3BIID 4TQ1A 5HG2A 2SEBD 1DOXA 1F0ZA 5BMIA 1SJHD 1ZXHA 3ZQ4A 1YN3A 1XLNA 1Q10A 2WU5B 1FCCC 1KH0A 3AEFB 4J3OD 4TSSA 1KFYB 3Q8BA 1XCTL 4A90A 2E6XA 3Q8EA 3ZJVA 1ZP0B 2GRIA 1FNUA 2BS2B 2WXNA 4YSYB 4TQ0A 4CQNA 2Q5WD 4HEA1 3V05A 1N60A 1SF0A 1TKGA 2L52A 1P7FA 3LXFA 3AM9A 4RCOA 4DQOC 1KF6B 1FNVA 1ET6A 1L0YB 3AN1A 3AV8A 1I4GA 1QILA 2XNAC 2Z8LA 3SR6A 3SFDB 5TSSA 1SB3C 1SE4A 3BK2A 3NVZA 2PMVA 4WAFA 1HA5A 2QEJC 2WNMA 2X38A 5I4DA 2W3SA 1KRHA 1AWDA 3AMZA 2KN4A 3MFGA 3FILA 3BZDB 3HRDD 2WXLA 3O13A 2KAJA 1C77A 1L0VB 3BVGA 3MP9A 4MT5A 1C76A 2IGDA 3P1MA 4ZOHC 1YNTE 1SE2A 5BYSA 4ARCA 2ACZB 3FAHA 3BK1A 1FXAA 3W2DA 2LEKA 1RFKA 4HKQA 4RF0A 1E10A 1VDVA 4YTPB 2H88B 4L1BA 2XN9C 3LYYA 4KKIA 2ON8A 3KQ4A 4JWUC 3W1SA 2WP9B 1SEBD 3ETRA 2I38A 1DYQA 1HQRD 2QSDA 2BW2A 1E0ZA 3AE5B 2L83A 1YN5A 1E9MA 4RGNA 1ZUD2 2B76B 1T6BX 1C4PA 1D5ZC 3CWIA 1VZ7A 1TS4A 3DWGC 2K3UA 1L5PA 1SBBB 2NTSA 2WS3B 1DGJA 2INNE 4N59A 1HZ6A 5G5GA 4OW0A 1PFDA 1N62A 1K50A 4KX6B 2CJOA 2J42A 5EE0A 3KWVA 1TKYA 5HHDG 1L6UA 5D7GA 2V0GA 1YJJA 1V97A 3HUIA 3TEYA 2L1AA 1IBXA 4AQ7A 4YTMB 2KACA 3AE3B 2W3RA 5JXVA 1K52A 1CQVA 1V1OA 2WDQB 3SFEB 1QLBB 2VZKB 3U7ZA 3B2GA 2BB6A 4C56C 3E56A 3R2TA 1PGAA 1IGDA 2ICIA 1PYWD 4YT0B 2ONQA 5EE1A 3AE2B 4ZRPA 2IPKD 1JMLA 2KWDA 3ZJTA 4NJCA 2OEDA 2OHFA 2AQ3B 4XWWA 2BYTA 2BS3B 2NMQA 4LK0M 1BUIC 4PT5A 1JWUD 2PVGC 1TS3A 3GS2A 4RF1A 1JCKB 4KGSA 3RPFC 2HTME 1GAQB 3IT4B 4L2YA 2YEPB 1HZ5A 1TY2A 3I57A 4WH4A 3EA6A 2WU2B 1V1PA 1NYQA 3WCQA 2LUMA 2MEKA 3AB5A 1N5WA 4DXGA 1XCQL 3Q8AA 1FRRA 2RDHA 3AE9B 3KWLA 1IGCA 1RM6C 1XO3A 4N58A 5H92C 1VLBA 4YXDB 3NZ3A 1N61A 3VQIA 3ZJUA 1PGBA 2WXRA 1VZ6A 1NVID 5MPOA 1WWTA 1P7EA 1TY0A 1KLUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JWU A;  1YNT E;  4HKZ E;  1MVK A;  5BMG A;  2JU6 X;  3FIL B;  3GB1 A;  2ZW0 A;  2QMT A;  2ON8 A;  2J52 A;  2KQ4 X;  4MAC A;  1F2R C;  2I38 A;  2QSD A;  4GLS C;  1UWX A;  1FCL A;  2LHD A;  4OZB A;  1YMH E;  3UI3 A;  3V3X A;  4KGT A;  2JXT A;  2LHE A;  2IGG A;  2PLP A;  4KGR A;  2ZW1 A;  1EM7 A;  2JZP A;  1HZ6 A;  2RMM A;  2PW9 A;  1F2R I;  2JSV X;  1GB4 A;  1K50 A;  2KDM A;  2N9L A;  1K53 A;  5HHD G;  1D4B A;  5HFY A;  4OZC A;  2EEL A;  1MHH E;  1MPE A;  1MHX A;  1IBX A;  2LGI A;  1XF5 L;  2KAC A;  4HJG E;  1C9F A;  1K51 A;  1HEZ E;  5JXV A;  1K52 A;  2PTL A;  5HG2 A;  5BMI A;  5HI1 A;  1ZXH A;  5BMH A;  1Q10 A;  1FCC C;  1PGA A;  1IGD A;  1KH0 A;  1XCT L;  2ONQ A;  1IBX B;  2I2Y A;  1JML A;  2KWD A;  2J53 A;  2OED A;  1MI0 A;  4D2K A;  1P7F A;  2NMQ A;  4KGS A;  4IOI E;  1GB1 A;  2GI9 A;  2GB1 A;  1HZ5 A;  4OZA A;  1FD6 A;  4WH4 A;  4IKG A;  2LUM A;  1QKZ A;  2N7J A;  1XCQ L;  2KN4 A;  3FIL A;  2IGH A;  1IGC A;  1PGX A;  3MP9 A;  2K0P A;  2RPV A;  1PGB A;  2N9K A;  1P7E A;  2IGD A; 
#chains in the Genus database with same CATH topology
 3L10 B;  3W5V B;  1L4Z B;  2FE8 A;  2D5G A;  3PVL A;  1T3Q A;  2J0J A;  1E8W A;  3QCA A;  1YOV B;  3NVV A;  2PPH A;  4AP4 C;  1V49 A;  3V6C B;  3M63 B;  3RNE C;  2DBY A;  5E6N A;  4EKU A;  1WGY A;  4MAC A;  1V2Y A;  4I6L B;  3QAQ A;  1J8C A;  1TS5 A;  1I4X A;  1V5O A;  1RWS A;  4B95 A;  1VZ8 A;  3UQB A;  4EEW A;  2Y5P A;  1NEN B;  3I3T B;  3AE8 B;  5G55 A;  1XLP A;  2MRP A;  4X57 B;  1EF1 A;  1TTN A;  2LRW A;  4R3D A;  1SXT A;  2JSV X;  3ONS A;  2V9H A;  4XDC A;  2KTR A;  1D4B A;  3MC0 B;  4C4V A;  4DDG D;  1WM2 A;  3SU8 X;  3MJ5 A;  2EEL A;  2AL3 A;  3I9V 1;  3AE7 B;  3M3J A;  3H1U A;  4IWP A;  3VDZ A;  5JH5 C;  4W9I A;  2BWF A;  1LM8 B;  3Q8C A;  1L6V A;  3N20 C;  2LGS A;  4H2A A;  3CIR B;  2M17 A;  2AEH A;  2INC C;  3TSS A;  1J7C A;  2NCN A;  1CZP A;  4BOS C;  5G5H A;  2YEP F;  3KH0 A;  3DWM A;  2QCZ A;  1UNS A;  3U52 E;  2MW5 A;  3QA8 A;  3KVF B;  1ESF A;  3PT2 B;  5DPS A;  1FNW A;  1SIF A;  5J18 A;  1Z5S B;  2RPV A;  1E6E B;  1LO5 D;  1XLO A;  1E7V A;  3RUI B;  1WX9 A;  4YWG G;  2MWS B;  2L0F A;  3VTV A;  2WXF A;  4UDU C;  1I7H A;  1ENF A;  2QMT A;  3URY A;  1ZXI A;  3TEX A;  1VRA B;  4LCD E;  1F2R C;  2GBR A;  1N5X A;  4JIO U;  2WQY B;  4EUT A;  2E3T A;  3WA0 A;  1ZW7 A;  2AX5 A;  4OZB A;  3T9L A;  3Q3F A;  1J0G A;  4BKS D;  2C7N B;  3TL5 A;  3PS6 A;  2ZCB A;  2KQS A;  1WGK A;  2WXM A;  1I4H A;  2JZP A;  4M02 A;  3BVZ A;  2JQR B;  4HVB A;  4N6E B;  2PE9 A;  1F52 A;  5D2M B;  1K53 A;  4II2 B;  1E8X A;  3DCG A;  3BWU D;  3JSV A;  4ICU A;  2C60 A;  3PRZ A;  1OQR A;  1MPE A;  4K1R B;  1EUV B;  4REZ A;  3RNB C;  3QHT A;  5E6J A;  1WZ3 A;  4O1N A;  2QJL A;  4XWT A;  1KTK A;  5BMH A;  2L7R A;  4LNN A;  3NY5 A;  4OHJ A;  1C78 A;  3HVD A;  3DDC B;  4C7Y A;  3R66 C;  2JYE A;  1IBX B;  2NBV B;  4W9G A;  2FUG 1;  2N9X A;  3M95 A;  4HWI B;  4OVU A;  4LLG M;  5JHA A;  1MI0 A;  4FUL A;  1N63 A;  2JYT A;  3ZVV A;  1EF5 A;  3FC4 A;  1WRI A;  4IM3 A;  2JF5 A;  3KW5 B;  1SE9 A;  1OEY A;  3PHW B;  5E6O A;  3RNF C;  3OAW A;  2LGY A;  1GG3 A;  4CYE A;  5HKH A;  1TIF A;  4K7S A;  5D3I B;  4OZA A;  1ZGU B;  4G3X B;  2KAN A;  1RYJ A;  3ZDM C;  3IBE A;  1QKZ A;  2ZNV B;  3VUW A;  3AEA B;  4RMA A;  2IJ0 A;  2TSS A;  2M56 B;  3NS1 A;  4ZYS A;  1ZDX A;  2K0P A;  2K22 A;  4KDL B;  2LZ6 A;  2Z0E B;  1M4V A;  1YX5 B;  2FBW B;  1V1P B;  1JWB D;  1L0X B;  3VR8 B;  2MH7 A;  1Y56 A;  2WXG A;  4Q2J A;  2ZW0 A;  2FNJ B;  1OEY J;  2PKO A;  3I63 C;  1XT9 B;  1AW7 A;  4ZRK A;  1AN8 A;  1RLF A;  2XK5 A;  1WX8 A;  1TZO A;  1UWM A;  1GNU A;  1LQB A;  3SDL C;  3E9S A;  4HLE A;  2MP2 A;  3NUH B;  5BYQ A;  2K8B A;  4A9A A;  4RM8 A;  4A8X C;  3TIX A;  1V6E A;  4NAM A;  1LGR A;  1MHX A;  5BYR A;  3X23 A;  5AZG A;  4TQ1 A;  4AJW A;  2KTR B;  2VH2 A;  3A33 B;  3M62 B;  4C4V B;  1Q10 A;  3VFK A;  1FCC C;  2UU7 A;  2KZR A;  4IC7 B;  3Q8B A;  1XCT L;  2O6V D;  2FID A;  4FHK A;  3U7D A;  3AUL A;  2WXN A;  4YSY B;  4CQN A;  2Q5W D;  5CHV C;  1TKG A;  4DQO C;  4MGZ E;  1FNV A;  5C1Z A;  1I4G A;  2Z8L A;  3SR6 A;  1SB3 C;  3BK2 A;  1T0Y A;  2PMV A;  2D10 A;  2LD9 A;  2V4L A;  3B1L X;  2MBB B;  2YVC A;  4F7Z A;  3FIL A;  3BZD B;  3HRD D;  3O13 A;  2Y5B B;  1C77 A;  4NY0 A;  2LRU A;  1U4A A;  3T8M A;  3GOE A;  3UF8 A;  1SE2 A;  2O6V A;  2K39 A;  1LFD A;  1RFK A;  3DBL I;  3IVF A;  1E10 A;  2CHW A;  5J2R A;  1RAX A;  3LYY A;  2ON8 A;  3DVN V;  3W1S A;  3ETR A;  2I38 A;  1YD8 U;  2QSD A;  3RN9 C;  4W9J A;  2L83 A;  2J7Q B;  4A20 A;  4IUM B;  1D5Z C;  4W9K A;  2MX2 A;  5C23 A;  4CHK A;  2M4N A;  2KJH B;  3WAL A;  2WS3 B;  3NZS A;  1L5P A;  1S3S G;  2REX A;  5G5G A;  1PFD A;  2KDB A;  4HK2 A;  3D32 A;  3KWV A;  5HHD G;  2D3G A;  2AYO B;  2KN5 A;  4HPL B;  4GXB A;  1V97 A;  3HUI A;  2MLB A;  3W1Y A;  4ANX A;  1K52 A;  3U7Z A;  2WDQ B;  1QLB B;  3B2G A;  1R4N I;  1C1Y B;  3R2T A;  1PGA A;  3JSV B;  2RD0 A;  4A3O A;  4YT0 B;  4N9F 4;  4MSM B;  2BVC A;  4ZRP A;  3RNA C;  3PRM B;  2LXA A;  2AQ3 B;  4XWW A;  4NPN A;  5IN7 A;  3V6E B;  3B0A A;  4PT5 A;  1JWU D;  2PVG C;  1TS3 A;  3N30 A;  2Z59 B;  1GAQ B;  3RNC C;  1TY2 A;  2OOB B;  1KOT A;  2BYF A;  4MH0 E;  3EA6 A;  1NYQ A;  4M0W B;  3WCQ A;  2MEK A;  1N5W A;  1TGZ B;  3KWL A;  1RM6 C;  1XO3 A;  2WWZ A;  2WXR A;  1VZ6 A;  1WWT A;  1PQS A;  1VCB A;  1WJ6 A;  2RDB C;  4DXF A;  2ZNV C;  5JZE B;  3ZNI D;  1AYF A;  1ZDV A;  3DVN U;  1P98 A;  2V3S A;  2INP E;  2NTT A;  1SIJ A;  4US9 A;  3GB1 A;  4LNF A;  2KQ4 X;  2L05 A;  2ZCC A;  4XDD A;  2BBC A;  3GE8 C;  4DDI D;  2KMM A;  2ZEQ A;  1ACC A;  3UI3 A;  4RGO S;  4LNK A;  2PLP A;  1I35 A;  3A4R A;  2G4S A;  2MBQ A;  3A1Q A;  2NR2 A;  2RR9 A;  2LMC A;  4IM2 A;  4URK A;  3LDZ E;  4K7U A;  2G9H D;  2AQ1 B;  1L2N A;  2KDM A;  2LJI A;  2N0S B;  4GGQ A;  4ANU A;  2DYO A;  2MJ3 A;  3VXW A;  2HJ8 A;  3ZO5 B;  2KNB A;  5TR5 A;  2OJW A;  2LUE A;  1WFY A;  2GOW A;  2M0A A;  1KJT A;  4P1C C;  1D3Z A;  2JX5 A;  2B3A A;  3Q6B A;  3PZD A;  2A5U A;  2WXI A;  3Q69 A;  3ENE A;  1F1H A;  1JRP A;  2KK8 A;  3IFW B;  4LJO B;  2KO3 A;  1QOB A;  1V8C A;  1GC6 A;  4KSK C;  1SJE D;  3NZU A;  1IP9 A;  3ABV B;  2KFJ A;  4KZC A;  3PSE B;  4JX1 C;  1UH6 A;  2G1E A;  4RGM A;  2C7M B;  3K9P B;  2ZPY A;  5FR3 A;  3WAO A;  2ASQ A;  1NEK B;  4BKT A;  2V4I B;  1MJD A;  2WXK A;  2PVO D;  3QJZ A;  4IKG A;  4TMA B;  4FJZ A;  4GDK A;  1UBI A;  4DXA B;  5LXI B;  3NVW A;  3L4P A;  4FXC A;  5AEK B;  1GPX A;  2PEA A;  1I4R A;  1NI3 A;  3KUC B;  3L0W B;  3PLV A;  3RMK C;  1V9J A;  3VR9 B;  5IA7 A;  4HPP A;  1I4P A;  2L32 A;  5JHB A;  5C2T B;  3A4S C;  4WJQ A;  1MVK A;  1C4A A;  1H8C A;  3FIL B;  4EZL A;  2C7H A;  4C80 A;  2GBN A;  4PS8 A;  1EU3 A;  2O6V B;  3V3X A;  3OG5 A;  3VH3 B;  3NRZ A;  1K8R B;  3RCZ A;  3ZLZ A;  3UIN B;  1FXI A;  1FMA D;  2N1W A;  3APD A;  1PDX A;  4ANV A;  1WMH A;  2K6Q A;  2BKF A;  4EZK A;  4JWS C;  3SHQ A;  3WAN A;  3Q14 C;  2QIL A;  5D3D A;  2KYW A;  4EE2 A;  3C8Y A;  3S2A A;  1WXM A;  3T3N A;  4ZHP A;  3OLM D;  3IAM 1;  3UIP B;  1R7S A;  2PIA A;  1FPY A;  1HEZ E;  1L4D B;  1YQ4 B;  3ZNZ B;  1QZE A;  3VUX A;  1TZ1 A;  2BB5 A;  1HXY D;  1HE8 A;  3EUB 2;  4A55 A;  2LWP A;  3V62 A;  1FIQ A;  3MHZ A;  2DHZ A;  3ZW3 A;  2EMT A;  4FBJ B;  2DZJ A;  2M8S A;  4G11 A;  1WGD A;  1F9J A;  3ZUN A;  3MHS D;  2I2Y A;  4GSW A;  2J53 A;  2KD0 A;  2G45 B;  1E7P B;  4MGI E;  4IM0 A;  4ACF A;  4RGT A;  4IOI E;  4P16 A;  4L23 A;  3FKY A;  3DHG C;  2MSE D;  1CK1 A;  2V3P A;  3EHV A;  2VH1 A;  3EC8 A;  3KYD D;  1TS2 A;  1N6Z A;  3U4E G;  1EU4 A;  1GOZ A;  3P4S B;  1OTR B;  2KDI A;  2WXJ A;  3DBR I;  1I4Q A;  2OJR A;  3GZN B;  2IYD B;  2CHX A;  3DBH I;  1NDD A;  4DK5 A;  4EOY A;  3VRB B;  2IO1 B;  3W9C B;  1ZKH A;  3AEC B;  1QOF A;  1S1Q B;  2L3Z A;  4NJ6 A;  3UGB B;  3BYT B;  2A4Z A;  2JU6 X;  2K25 A;  3H9D A;  3N1X C;  3BYY B;  1EWC A;  2K8H A;  3PRP B;  3BVM A;  1WGR A;  1F77 A;  1WY8 A;  3ECI A;  3J9C A;  1WXQ A;  2JXT A;  3T3O A;  3WIM A;  3N32 A;  2ZW1 A;  1T0Q C;  2VRR B;  4WJP A;  1P3Q U;  1QT9 A;  4WQM A;  3W5U B;  5HFY A;  3P4R B;  1C4C A;  1MHH E;  4WJO A;  1IPG A;  4BFR A;  3ZYY X;  4FJY A;  3A1Q B;  2W82 A;  4WJN A;  3QIJ A;  3BII D;  1OGW A;  1DOX A;  2WGS A;  1SJH D;  3ZQ4 A;  1XLN A;  3AEF B;  4J3O D;  3EEC A;  1ZP0 B;  2GRI A;  3APC A;  1WXV A;  2KHW B;  5BO4 B;  4F1S A;  3TJP A;  4HEA 1;  1N60 A;  2L52 A;  3LXF A;  3OJ3 A;  1L0Y B;  4FAD A;  2FCM A;  3AV8 A;  4IW0 A;  1IYF A;  2XNA C;  3SFD B;  3SD5 A;  2IND C;  3ALB A;  1WJN A;  4WAF A;  1V86 A;  5I4D A;  1KRH A;  3L54 A;  3AMZ A;  3BVG A;  4MT5 A;  1UF0 A;  1JRU A;  2D11 A;  3P1M A;  2HE7 A;  4ARC A;  2XBB C;  3L17 A;  2G3Q B;  2JT4 B;  2ACZ B;  3BK1 A;  3W2D A;  4ASW C;  3BY4 B;  4PYU A;  4RF0 A;  1VDV A;  4HDO A;  4YTP B;  2QHO A;  2GMI C;  4GB9 A;  4L1B A;  4KV2 A;  2NPT B;  3KQ4 A;  2BYE A;  4JWU C;  1SEB D;  4DHJ D;  1DYQ A;  1HQR D;  2BW2 A;  2WDT B;  5D94 A;  4RGN A;  1C4P A;  4FA6 A;  1HTO A;  1VZ7 A;  2NTS A;  1P0R A;  2INN E;  2JWZ A;  1HZ6 A;  3VHT C;  4P1B C;  2RSU A;  4NAW A;  1N62 A;  4KX6 B;  2J42 A;  4AOF A;  2DAJ A;  3PRE A;  1TKY A;  1L6U A;  2KX3 A;  5D7G A;  3R7R A;  1V80 A;  3DBH B;  1KM7 A;  2L1A A;  2ZVO A;  4AQ7 A;  4YTM B;  3ZIM A;  2KAC A;  3AE3 B;  2KWV B;  2LGD A;  1WMH B;  4CO7 A;  1CQV A;  3H6N A;  3B08 A;  3VTW A;  3ZNH B;  2X8X X;  2MQJ A;  3ZXR A;  3R7Q A;  2ONQ A;  3AE2 B;  3U30 A;  3ZJT A;  2CHZ A;  2OED A;  4E3C A;  1E7U A;  4LK0 M;  2WX0 A;  1BUI C;  2IBI B;  4RF1 A;  1LXD A;  4FHJ A;  4ICV A;  3RPF C;  2HTM E;  1WE6 A;  4WQO B;  3IT4 B;  1YJ1 A;  3I57 A;  4AJY B;  4WH4 A;  2WU2 B;  4XYC A;  2KLC A;  2D2Q A;  3AB5 A;  4MGY E;  3WAP A;  2CS4 A;  1A5R A;  4NNJ B;  3Q8A A;  4J6I A;  2O2V A;  1N61 A;  1PGB A;  4W9H A;  2NBW B;  1KLU D;  3Q3J A;  2V3N A;  4GDL A;  1DOI A;  1XEE A;  3DBS A;  5BMG A;  1KLG D;  5EDS A;  3AEB B;  1KLV A;  4RH6 A;  3Q3M C;  4ZHO A;  2HJ1 A;  4K7W A;  4XC2 A;  3CST A;  2LVP A;  2CKH B;  1PUT A;  4GLS C;  3IAS 1;  3CF6 E;  1VJK A;  5DPW A;  2Y3A A;  2LHD A;  1Z2M A;  5T8I A;  4C00 A;  1WGG A;  4KGR A;  3AED B;  2BKR B;  4ARI A;  3P42 A;  4AS1 A;  1A70 A;  3PV1 A;  2CR5 A;  2KWC A;  1F2R I;  1FRD A;  3R8B A;  4WUR A;  4RM9 A;  2BYV E;  1WYG A;  5LLI A;  3RZW C;  2JPH A;  2H89 B;  1JWA D;  4M8N A;  4AUQ C;  1QQR A;  4HJG E;  1C9F A;  2LXC A;  4K3B A;  4W9C A;  3SEB A;  2W55 A;  3PGE A;  2KJR A;  3NG0 A;  2MHJ A;  4B0M A;  5FKA C;  2LGX A;  2M0X A;  2QIE B;  2R61 A;  2PJH A;  2HDE A;  2LVO A;  1JRO A;  4D2K A;  2KDF B;  4PYZ A;  1AAR A;  1WJU A;  1FM0 D;  2K8C A;  5IP4 D;  4JE3 B;  2GB1 A;  4I6P A;  2K9X A;  1UBQ A;  1ISN A;  3ZKJ C;  2L0T A;  3RT3 B;  1D5X C;  3L16 A;  2IGH A;  1PGX A;  2N9E B;  2WXH A;  1QOG A;  2BS4 B;  2N9K A;  3NHE B;  2IY1 B;  4P6V F;  3K9O B;  2MBO A;  3OJ4 B;  3OWE B;  4PS3 A;  3VUY A;  2FCN A;  4XGA B;  4LNO A;  3EFU A;  2JRH A;  4XZ4 A;  4WWO A;  1R4M I;  1UGJ A;  1TKE A;  3LB8 C;  3APF A;  2AL6 A;  4BAX A;  2WX1 A;  1FCL A;  1V81 A;  4BVU C;  3U8Z A;  2NS5 A;  4A6Q A;  3ZGZ A;  3NS8 A;  4JPS A;  5H8Y E;  1YN4 A;  1GB4 A;  4M00 A;  4KDI C;  3JW0 X;  4OZC A;  4W9E A;  4KVG B;  2JXX A;  2FCS A;  3MC8 A;  1K51 A;  4WIP A;  4KIK A;  1HTQ A;  4NAW B;  3NVY A;  3N3K B;  2XK5 B;  1IUE A;  2KKC A;  3PPA A;  4G0N B;  4EZJ A;  1DOY A;  1FFV A;  2W54 A;  2EKI A;  3DOW A;  3DBL B;  2L00 B;  1H4R A;  2QC8 A;  2MP2 B;  1I42 A;  4DHJ B;  4HDQ A;  2GI9 A;  4AWJ A;  5KHO A;  5IAA C;  4TKN A;  1BXT A;  1YIW A;  1UUP A;  1JWS D;  2G4D B;  3AEE B;  3HK0 A;  4DHZ E;  3QAR A;  4F8C B;  2RGF A;  4JLC A;  1JW9 D;  2J0K A;  4HCN B;  3AU4 A;  4MM3 A;  1D6E C;  4NJ7 A;  4FJV B;  2DWQ A;  3Q3O C;  1QOA A;  2MBE A;  3AE4 B;  5AUI A;  4IDI A;  2FIF A;  3RNG C;  1T0R C;  1FO4 A;  2D3C A;  2O2V B;  2J52 A;  3VRA B;  2DZI A;  2D3B A;  2CJN A;  3C0R B;  1R4N B;  4GDL B;  1TYG B;  3QQ8 B;  2AQ2 B;  4XE0 A;  3DVG X;  1ZE3 D;  2BPS A;  3H8H A;  4OVV A;  4ZRJ A;  1B9R A;  3HIZ A;  2IDY A;  2BTE A;  1CMX B;  3N9Y C;  1GC7 A;  2FAZ A;  2V1Y A;  4BKG A;  1EWY C;  1GUA B;  3QWZ B;  1ROE A;  3V60 A;  1NYR A;  1Q5W B;  1UGM A;  3L13 A;  1YQB A;  4YTN B;  3PO0 A;  1TBE A;  4E71 A;  2KMC A;  2KTF A;  1E8Y A;  4WAA A;  1YN3 A;  2KVR A;  3UIO B;  3DQV A;  2E6X A;  3ZJV A;  4MDK E;  1FNU A;  2BS2 B;  3H7S A;  3ZTD A;  3V05 A;  2GBM A;  1SF0 A;  2LI5 A;  3AM9 A;  1E8Z A;  1KF6 B;  1ET6 A;  2KVZ A;  3KUZ A;  3NVZ A;  3RI7 C;  5D6J B;  5AZF A;  1HA5 A;  2QEJ C;  3R3M A;  2BQQ A;  3Q3N C;  1UZX B;  1AWD A;  3MFG A;  1MG8 A;  1J19 A;  2WXL A;  1L0V B;  4FLH A;  3MP9 A;  2R2O A;  1C76 A;  4ZOH C;  1YNT E;  5BYS A;  4S0R A;  2K6D B;  3CSF A;  3FAH A;  1FXA A;  2LEK A;  3IG3 A;  2H88 B;  3ZDT A;  2M1M A;  3KUD B;  2WHI A;  2KT7 A;  2Z0D B;  2WP9 B;  3DVG Y;  5J17 A;  2FUH B;  3AE5 B;  1YN5 A;  1E9M A;  2GBJ A;  1ZUD 2;  2I1J A;  1T6B X;  1Y8R C;  1E5W A;  1RRB A;  4HXD A;  3CWI A;  1XD3 B;  1TS4 A;  4WWP A;  3DWG C;  2DX5 B;  1DGJ A;  1EO6 A;  3NOB A;  3WAM A;  2CJO A;  2V0G A;  1YJJ A;  4BZA A;  1Q0W B;  1WIA A;  4ZDV A;  4IWO A;  3VTU A;  3ZXV A;  3KYC D;  4P7I A;  2W3R A;  4TUU A;  5JXV A;  1V1O A;  3SFE B;  5G2N A;  2BB6 A;  2DEN B;  2NBU A;  4KZ0 A;  3E56 A;  4DBG A;  1WJ4 A;  2ICI A;  2IO0 B;  2IPK D;  2KWD A;  5FR6 A;  4KIK B;  2KJ6 A;  3MTN B;  2BYT A;  2BS3 B;  1JCK B;  4L2Y A;  5AZH A;  1NI2 A;  3VH4 B;  2LUM A;  3AE9 B;  2KDE B;  4N58 A;  1VLB A;  3VQI A;  3ZJU A;  2EKE C;  3NJT A;  1J7B A;  1ZOY B;  2KFK A;  3VAW A;  2K5P A;  1E90 A;  1BML C;  1V5T A;  3B9J A;  1WGH A;  1P9D U;  1UEL A;  1TT5 B;  2RDG A;  4B6W A;  3QK0 A;  1XXG A;  3CMM B;  1FFU A;  4MM3 B;  1FEH A;  2JUO A;  2KLG A;  1EM7 A;  2JVC A;  1XQQ A;  2MJD A;  2PW9 A;  4GDK B;  1YJI A;  4YSX B;  2CU3 A;  2N7D A;  4BKS A;  2WXO A;  1WRD B;  2ZZP B;  4M0W A;  1WE7 A;  1ET9 A;  5E6P A;  3AH7 A;  1SE3 A;  4C7Z A;  2Y5C A;  5CHF A;  1WX7 A;  2GLS A;  1ZPS A;  2MA9 B;  3JYU A;  4II3 B;  3DHH C;  1T0S C;  4JQW C;  2RPQ A;  2PTL A;  2KOX A;  2HD5 B;  3HM3 A;  3P4P B;  2KWU B;  1JWM D;  4TV3 A;  4HRS A;  2DZM A;  2WXQ A;  4ANW A;  3DBR B;  3IHP C;  4RNA A;  2I1K A;  1QF6 A;  1WR1 A;  4I6N B;  3R2I A;  1C79 A;  3U2S C;  3V61 A;  4US8 A;  3W1S C;  3Q8F A;  5EE3 A;  2N1V A;  5EE9 A;  1STE A;  3GP7 A;  3MJW A;  1GJZ A;  2J4X A;  4B9K A;  2UYZ B;  3ZNG C;  2UWQ A;  1WYW B;  1JAL A;  3AEG B;  4B0E A;  5CHW A;  1WXA A;  4M01 A;  1MG4 A;  1MFW A;  5LNK 1;  2D07 B;  4IG7 B;  2BT6 A;  2VZK D;  4LDT D;  5IKC M;  4NQL B;  1B1Z A;  3KLS X;  3RFZ B;  1J7A A;  5GMV A;  3AE1 B;  2N7E A;  4MGK E;  2DLB A;  4LTU A;  3RZF A;  4A3P A;  3JVZ X;  1XLQ A;  4GOC A;  5CTR C;  1UWX A;  4MJS A;  5LXH A;  1YMH E;  4RFB A;  3HHM A;  4KGT A;  2LHE A;  2AWT A;  2IGG A;  3LJ3 A;  2EMS A;  5IO9 A;  2CU1 A;  1YQ3 B;  4ZYN A;  3AE6 B;  3P2B A;  2FCQ A;  4OVZ A;  1G6J A;  3H7P A;  4EFO A;  2N9L A;  3ML8 A;  1TJE A;  2L8J A;  4DHZ B;  3ZRC A;  2ZPN A;  4YL8 A;  3I5J C;  3P4Q B;  2J0M A;  4W9F A;  3TBL D;  2HTH A;  2LGI A;  1P1A A;  2KC2 A;  3TCA A;  1VR9 A;  4NQK E;  2WLB A;  4MH8 A;  5DPR A;  2LJ5 A;  3A9J A;  5HI1 A;  1M94 A;  5FK9 C;  1FXT B;  3EGR A;  4M8M A;  3N1Y C;  4ZRQ A;  2LFI A;  4W9D A;  2MJE A;  5KHQ A;  3HM6 X;  4LNI A;  1OFF A;  5CX3 A;  4ITK A;  4MSQ B;  2WDR B;  4WWM A;  2IY0 B;  1L7Y A;  2DZK A;  4NZL B;  3GE3 C;  1OQQ A;  4ZRI A;  1WSP A;  3A9K A;  1GB1 A;  3IT6 B;  3TEZ A;  4BBN F;  3Q2A C;  2JZZ A;  3ML9 A;  1FD6 A;  4DWF A;  2N7J A;  3BIN A;  2M19 A;  3B2F A;  2JRI B;  5AUK A;  2WXP A;  5DCN A;  4E74 A;  4JGH B;  3DHI C;  2IO2 B;  3HVZ A;  2JWU A;  2DYM A;  1WXS A;  3PZ7 A;  2WDV B;  2KQ7 A;  4HKZ E;  1CJE A;  3PZ8 A;  5L83 A;  1SSN A;  4USA A;  1WR6 E;  2BF8 B;  2KX0 A;  4KKJ A;  4KSL C;  5GXG B;  2KMA A;  2WYQ A;  3TEW A;  2KFK B;  1T5X D;  5C3J B;  3UQA A;  1SGH A;  2R2Q A;  1JQ4 A;  2RMM A;  2SAK A;  1NBF C;  4S17 A;  1WF9 A;  2IO3 B;  3N1Z C;  4FN2 A;  3TUO A;  3DPD A;  3P63 A;  2N4F A;  4HRO A;  2JZ3 B;  3PLU A;  4PK1 A;  3IXS A;  4IWQ A;  4YSZ B;  3C19 A;  2LVQ A;  1XF5 L;  1D5M C;  5HG2 A;  2SEB D;  2D3A A;  2W9N A;  4G50 A;  1F0Z A;  5BMI A;  1WI0 A;  1ZXH A;  3VVW B;  1UD7 A;  2WU5 B;  2LAS A;  2KC1 A;  4LJP B;  1KH0 A;  4TSS A;  1KFY B;  4A90 A;  3PHX B;  3Q8E A;  4HPM B;  1WM3 A;  4TQ0 A;  2ZVN A;  2MCN B;  4MEL A;  3O65 B;  1P7F A;  4RCO A;  4GN1 A;  2YLM A;  3AN1 A;  1QIL A;  5TSS A;  1BT0 A;  1SE4 A;  3QC8 B;  2GBK A;  2NVU I;  2BWE S;  2WNM A;  2X38 A;  2ZJD A;  2W3S A;  2KN4 A;  4K3C A;  2MBH A;  2IZV B;  3TMP B;  3RD2 A;  2KAJ A;  2XEW A;  2DAF A;  2IGD A;  4BBN C;  3AI5 A;  1VD2 A;  3EFC A;  1YX6 B;  3RYT A;  4HKQ A;  2XN9 C;  4KKI A;  1WZ0 A;  1OQY A;  4MEM A;  2N9P C;  1E0Z A;  4WWN A;  5IOI A;  2B76 B;  4W9L A;  2K3U A;  1SBB B;  4N59 A;  2K1F A;  4OW0 A;  2DNF A;  1K50 A;  3GZN I;  5EE0 A;  4MJS B;  5DPT A;  4JL9 A;  4BOZ B;  4GMV A;  1C3T A;  3TEY A;  1IBX A;  4QAY A;  3H7P B;  2PE6 B;  2L76 A;  2KXJ A;  3L08 A;  1Q1O A;  2VZK B;  1RFA A;  4LDT B;  4PS7 A;  5L95 C;  1X1M A;  2C5L C;  2C9W B;  4C56 C;  2JY6 A;  1IGD A;  1PYW D;  2BGF A;  5EE1 A;  1WH3 A;  1JML A;  2NPT A;  4NJC A;  2OHF A;  4XX5 A;  3X0W A;  3ZTC A;  2NMQ A;  3PTF C;  3A9J B;  1R4M B;  3GS2 A;  4HCP B;  4KGS A;  4GIV A;  3QX1 A;  2YEP B;  1HZ5 A;  3ZRF A;  1V1P A;  2DYB A;  3MC9 A;  4DXG A;  1XCQ L;  1FRR A;  2RDH A;  2QDF A;  3RUL A;  3AXC A;  1IGC A;  5H92 C;  4GU2 A;  3AU5 A;  3NZ3 A;  4YXD B;  4K81 A;  3A9K B;  5MPO A;  1NVI D;  4HJK A;  1P7E A;  1TY0 A; 
#chains in the Genus database with same CATH homology
 1J7B A;  2V3N A;  3W5V B;  1DOI A;  1XEE A;  1L4Z B;  5BMG A;  1KLG D;  1ZOY B;  2FE8 A;  2D5G A;  4DXF A;  1AYF A;  1ZDV A;  3AEB B;  1T3Q A;  2K5P A;  4RH6 A;  2INP E;  2NTT A;  3NVV A;  1BML C;  1SIJ A;  4ZHO A;  3B9J A;  4US9 A;  3GB1 A;  2DBY A;  2KQ4 X;  2RDG A;  4MAC A;  4XDD A;  2BBC A;  1PUT A;  4GLS C;  2KMM A;  1XXG A;  3IAS 1;  1VJK A;  1ACC A;  2Y3A A;  1FFU A;  2LHD A;  1TS5 A;  1FEH A;  1I4X A;  4MM3 B;  3UI3 A;  4RGO S;  1RWS A;  5T8I A;  1VZ8 A;  2PLP A;  2Y5P A;  1NEN B;  4KGR A;  3AE8 B;  3AED B;  4ARI A;  1EM7 A;  3P42 A;  4AS1 A;  1A70 A;  1XLP A;  2LMC A;  2MJD A;  2PW9 A;  1F2R I;  1SXT A;  4R3D A;  2JSV X;  1FRD A;  4GDK B;  2G9H D;  2AQ1 B;  2KDM A;  2LJI A;  4XDC A;  4WUR A;  3R8B A;  2N0S B;  1YJI A;  4YSX B;  2CU3 A;  2DYO A;  1D4B A;  2MJ3 A;  1WYG A;  2WXO A;  3MC0 B;  3MJ5 A;  2EEL A;  4M0W A;  1ET9 A;  3I9V 1;  3AE7 B;  3AH7 A;  1SE3 A;  2H89 B;  2M0A A;  4C7Z A;  1JWA D;  2Y5C A;  1ZPS A;  1QQR A;  4HJG E;  2JX5 A;  1C9F A;  2PTL A;  2WXI A;  3SEB A;  2W55 A;  3Q69 A;  3P4P B;  3Q8C A;  1L6V A;  1JWM D;  1JRP A;  4HRS A;  4B0M A;  2WXQ A;  1QOB A;  5FKA C;  1V8C A;  2QIE B;  4RNA A;  2R61 A;  4H2A A;  1SJE D;  3CIR B;  3ABV B;  2HDE A;  1JRO A;  4D2K A;  4JX1 C;  1QF6 A;  2G1E A;  4RGM A;  1FM0 D;  3TSS A;  5FR3 A;  1J7C A;  3R2I A;  1C79 A;  3U2S C;  4US8 A;  3Q8F A;  1CZP A;  5EE3 A;  5EE9 A;  1NEK B;  4JE3 B;  1STE A;  3GP7 A;  5G5H A;  2V4I B;  2WXK A;  2GB1 A;  2YEP F;  2J4X A;  3DWM A;  1UNS A;  2PVO D;  3U52 E;  4IKG A;  1JAL A;  4TMA B;  2K9X A;  3AEG B;  4B0E A;  1ESF A;  1D5X C;  1FNW A;  3NVW A;  3L4P A;  4FXC A;  2IGH A;  5LNK 1;  1PGX A;  2BT6 A;  2VZK D;  1GPX A;  2WXH A;  1B1Z A;  1I4R A;  1NI3 A;  2RPV A;  1QOG A;  2BS4 B;  3KLS X;  3VR9 B;  1E6E B;  1J7A A;  1LO5 D;  2N9K A;  3RFZ B;  1XLO A;  3AE1 B;  4P6V F;  1I4P A;  2L32 A;  3OWE B;  5C2T B;  1MVK A;  4YWG G;  1C4A A;  2DLB A;  2WXF A;  4UDU C;  1I7H A;  1ENF A;  3FIL B;  4LTU A;  1UGJ A;  1TKE A;  3LB8 C;  2QMT A;  4C80 A;  3URY A;  1ZXI A;  3TEX A;  1VRA B;  1XLQ A;  1F2R C;  1N5X A;  2WQY B;  2E3T A;  1UWX A;  1FCL A;  1EU3 A;  2AX5 A;  4OZB A;  1YMH E;  3V3X A;  4A6Q A;  4RFB A;  3NRZ A;  4KGT A;  2LHE A;  2IGG A;  3ZGZ A;  1FXI A;  1YQ3 B;  1FMA D;  3AE6 B;  1WGK A;  2WXM A;  1I4H A;  4JPS A;  1PDX A;  2JZP A;  4OVZ A;  5H8Y E;  1YN4 A;  3BVZ A;  2JQR B;  1GB4 A;  4N6E B;  2N9L A;  1TJE A;  1K53 A;  4JWS C;  2QIL A;  5D3D A;  3BWU D;  4EE2 A;  3C8Y A;  4OZC A;  3P4Q B;  1OQR A;  1MPE A;  3T3N A;  4ZHP A;  3IAM 1;  2LGI A;  4REZ A;  1R7S A;  2PIA A;  1K51 A;  1HEZ E;  1L4D B;  1VR9 A;  4WIP A;  2WLB A;  4MH8 A;  4NAW B;  1YQ4 B;  4O1N A;  5E6J A;  3NVY A;  2QJL A;  2BB5 A;  1HXY D;  3EUB 2;  4XWT A;  4A55 A;  5HI1 A;  5FK9 C;  1FIQ A;  1KTK A;  3MHZ A;  5BMH A;  3EGR A;  4OHJ A;  1C78 A;  3HVD A;  4C7Y A;  1IUE A;  2JYE A;  4ZRQ A;  1IBX B;  2LFI A;  2I2Y A;  2MJE A;  2FUG 1;  2J53 A;  4LLG M;  1DOY A;  1FFV A;  2W54 A;  1MI0 A;  1N63 A;  1E7P B;  1OFF A;  2EKI A;  2JYT A;  4ITK A;  2WDR B;  4WWM A;  3FC4 A;  1WRI A;  4NZL B;  1OQQ A;  4RGT A;  4IOI E;  4P16 A;  4L23 A;  1WSP A;  1GB1 A;  2GI9 A;  3IT6 B;  3TEZ A;  1CK1 A;  2V3P A;  5D3I B;  1BXT A;  4OZA A;  1FD6 A;  1UUP A;  1RYJ A;  1JWS D;  1QKZ A;  2N7J A;  3AEA B;  3AEE B;  1TS2 A;  2M19 A;  3U4E G;  1EU4 A;  3B2F A;  2IJ0 A;  1GOZ A;  2WXP A;  5AUK A;  3P4S B;  2TSS A;  2M56 B;  3NS1 A;  4ZYS A;  2WXJ A;  1ZDX A;  2K0P A;  2K22 A;  1JW9 D;  1M4V A;  1I4Q A;  3HVZ A;  2FBW B;  2JWU A;  2DYM A;  3PZ7 A;  1D6E C;  2WDV B;  3VRB B;  3W9C B;  1V1P B;  1CJE A;  4HKZ E;  1JWB D;  2DWQ A;  3AEC B;  1L0X B;  1QOF A;  1QOA A;  3PZ8 A;  3BYT B;  3AE4 B;  2JU6 X;  3VR8 B;  2MH7 A;  5AUI A;  1Y56 A;  4IDI A;  3BYY B;  1SSN A;  2WXG A;  4Q2J A;  2ZW0 A;  4USA A;  1FO4 A;  1EWC A;  2J52 A;  2PKO A;  3VRA B;  1AW7 A;  1AN8 A;  3BVM A;  2CJN A;  1TZO A;  1F77 A;  1UWM A;  4KKJ A;  3J9C A;  4GDL B;  5GXG B;  1TYG B;  3TEW A;  1WXQ A;  1T5X D;  2JXT A;  3T3O A;  5C3J B;  2AQ2 B;  3E9S A;  4XE0 A;  2ZW1 A;  1ZE3 D;  3NUH B;  3H8H A;  5BYQ A;  1JQ4 A;  2RMM A;  2SAK A;  1B9R A;  2IDY A;  2BTE A;  4A9A A;  3TUO A;  4A8X C;  3N9Y C;  1QT9 A;  4WQM A;  3W5U B;  5HFY A;  4NAM A;  3P4R B;  3P63 A;  1C4C A;  1MHH E;  4HRO A;  1EWY C;  3IXS A;  1MHX A;  3ZYY X;  4YSZ B;  2W82 A;  1XF5 L;  1ROE A;  5BYR A;  1NYR A;  1D5M C;  4YTN B;  3PO0 A;  3BII D;  4TQ1 A;  5HG2 A;  2SEB D;  1DOX A;  1F0Z A;  5BMI A;  1SJH D;  1ZXH A;  3ZQ4 A;  1YN3 A;  1XLN A;  1Q10 A;  2WU5 B;  1FCC C;  1KH0 A;  3AEF B;  4J3O D;  4TSS A;  1KFY B;  3Q8B A;  1XCT L;  4A90 A;  2E6X A;  3Q8E A;  3ZJV A;  1ZP0 B;  2GRI A;  1FNU A;  2BS2 B;  2WXN A;  4YSY B;  4TQ0 A;  4CQN A;  2Q5W D;  4HEA 1;  3V05 A;  1N60 A;  1SF0 A;  1TKG A;  2L52 A;  1P7F A;  3LXF A;  3AM9 A;  4RCO A;  4DQO C;  1KF6 B;  1FNV A;  1ET6 A;  1L0Y B;  3AN1 A;  3AV8 A;  1I4G A;  1QIL A;  2XNA C;  2Z8L A;  3SR6 A;  3SFD B;  5TSS A;  1SB3 C;  1SE4 A;  3BK2 A;  3NVZ A;  2PMV A;  4WAF A;  1HA5 A;  2QEJ C;  2WNM A;  2X38 A;  5I4D A;  2W3S A;  1KRH A;  1AWD A;  3AMZ A;  2KN4 A;  3MFG A;  3FIL A;  3BZD B;  3HRD D;  2WXL A;  3O13 A;  2KAJ A;  1C77 A;  1L0V B;  3BVG A;  3MP9 A;  4MT5 A;  1C76 A;  2IGD A;  3P1M A;  4ZOH C;  1YNT E;  1SE2 A;  5BYS A;  4ARC A;  2ACZ B;  3FAH A;  3BK1 A;  1FXA A;  3W2D A;  2LEK A;  1RFK A;  4HKQ A;  4RF0 A;  1E10 A;  1VDV A;  4YTP B;  2H88 B;  4L1B A;  2XN9 C;  3LYY A;  4KKI A;  2ON8 A;  3KQ4 A;  4JWU C;  3W1S A;  2WP9 B;  1SEB D;  3ETR A;  2I38 A;  1DYQ A;  1HQR D;  2QSD A;  2BW2 A;  1E0Z A;  3AE5 B;  2L83 A;  1YN5 A;  1E9M A;  4RGN A;  1ZUD 2;  2B76 B;  1T6B X;  1C4P A;  1D5Z C;  3CWI A;  1VZ7 A;  1TS4 A;  3DWG C;  2K3U A;  1L5P A;  1SBB B;  2NTS A;  2WS3 B;  1DGJ A;  2INN E;  4N59 A;  1HZ6 A;  5G5G A;  4OW0 A;  1PFD A;  1N62 A;  1K50 A;  4KX6 B;  2CJO A;  2J42 A;  5EE0 A;  3KWV A;  1TKY A;  5HHD G;  1L6U A;  5D7G A;  2V0G A;  1YJJ A;  1V97 A;  3HUI A;  3TEY A;  2L1A A;  1IBX A;  4AQ7 A;  4YTM B;  2KAC A;  3AE3 B;  2W3R A;  5JXV A;  1K52 A;  1CQV A;  1V1O A;  2WDQ B;  3SFE B;  1QLB B;  2VZK B;  3U7Z A;  3B2G A;  2BB6 A;  4C56 C;  3E56 A;  3R2T A;  1PGA A;  1IGD A;  2ICI A;  1PYW D;  4YT0 B;  2ONQ A;  5EE1 A;  3AE2 B;  4ZRP A;  2IPK D;  1JML A;  2KWD A;  3ZJT A;  4NJC A;  2OED A;  2OHF A;  2AQ3 B;  4XWW A;  2BYT A;  2BS3 B;  2NMQ A;  4LK0 M;  1BUI C;  4PT5 A;  1JWU D;  2PVG C;  1TS3 A;  3GS2 A;  4RF1 A;  1JCK B;  4KGS A;  3RPF C;  2HTM E;  1GAQ B;  3IT4 B;  4L2Y A;  2YEP B;  1HZ5 A;  1TY2 A;  3I57 A;  4WH4 A;  3EA6 A;  2WU2 B;  1V1P A;  1NYQ A;  3WCQ A;  2LUM A;  2MEK A;  3AB5 A;  1N5W A;  4DXG A;  1XCQ L;  3Q8A A;  1FRR A;  2RDH A;  3AE9 B;  3KWL A;  1IGC A;  1RM6 C;  1XO3 A;  4N58 A;  5H92 C;  1VLB A;  4YXD B;  3NZ3 A;  1N61 A;  3VQI A;  3ZJU A;  1PGB A;  2WXR A;  1VZ6 A;  1NVI D;  5MPO A;  1WWT A;  1P7E A;  1TY0 A;  1KLU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...