1IBXA

Nmr structure of dff40 and dff45 n-terminal domain complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYFPSVPDNAELVLLTLGQAWQGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA FRAGMENTATION FACTOR 40
publication title Solution structure of DFF40 and DFF45 N-terminal domain complex and mutual chaperone activity of DFF40 and DFF45.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.-.-.-:
pdb deposition date 2001-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ibxA00
2PTLA 5JXVA 2LUMA 3FILB 1XCQL 2K0PA 5HG2A 2KN4A 4OZCA 2IGHA 1FCCC 1JMLA 1GB4A 3MP9A 2KDMA 2JZPA 2LHDA 1F2RI 1MVKA 5BMIA 1HEZE 1C9FA 2RPVA 2EELA 2ZW1A 1Q10A 2PLPA 1YNTE 1PGBA 1K53A 4HJGE 5BMGA 2RMMA 1FD6A 1HZ5A 2LHEA 1K51A 1PGAA 4KGSA 1QKZA 2ZW0A 2N7JA 1K50A 1IGDA 1PGXA 1GB1A 3V3XA 2N9LA 2OEDA 1MI0A 2LGIA 4WH4A 1XCTL 1FCLA 4KGTA 4OZAA 2J52A 1UWXA 2KWDA 1MHHE 2ON8A 4GLSC 2NMQA 2I38A 2I2YA 1P7EA 2JSVX 2KACA 4D2KA 2J53A 2IGGA 1IGCA 1YMHE 2JWUA 5HI1A 1EM7A 2QSDA 1ZXHA 5HHDG 2QMTA 1IBXA 4MACA 3UI3A 2N9KA 1HZ6A 3GB1A 3FILA 1K52A 2IGDA 2ONQA 4IOIE 2GI9A 1XF5L 2JXTA 2PW9A 4KGRA 5BMHA 1P7FA 1MHXA 2GB1A 1F2RC 4OZBA 1KH0A 1D4BA 2JU6X 1IBXB 1MPEA 4IKGA 4HKZE 2KQ4X 5HFYA
chains in the Genus database with same CATH superfamily
1FEHA 4PYZA 1MFWA 1WFYA 1XCQL 4FLHA 2KN4A 1FCCC 4GDLB 5IN7A 1YQ4B 4HDQA 1ENFA 3ZVVA 2WHIA 4BOSC 4TSSA 3JSVA 5JZEB 4FBJB 1XQQA 3AMZA 1WYGA 4L1BA 4HJGE 5BYRA 5BMGA 1AW7A 3AEEB 2BW2A 3VH3B 4OHJA 3A1QB 1HA5A 3AE8B 1WH3A 4ANVA 3QK0A 4WAFA 1P0RA 2W3RA 3NZSA 4EFOA 3IXSA 3GZNB 2NMQA 5G55A 1V97A 4B95A 5D3IB 1WJNA 2IBIB 2LZ6A 4DXGA 2J53A 3BY4B 3VTVA 5D94A 3ZJTA 3DBLI 1FXTB 4GDKA 5MPOA 1JW9D 3H7PB 4HCNB 1JRPA 4NPNA 1R4NI 4KSKC 3UI3A 2WQYB 1SIJA 3M95A 4URKA 1QLBB 4JWSC 4N6EB 4YSZB 1JALA 2PW9A 1WR1A 3V60A 2FUHB 4DWFA 2CHXA 1E8YA 3JYUA 5BMHA 3VRAB 2NTSA 3C0RB 2CKHB 1UH6A 3AI5A 2KFJA 1FRDA 2KFKA 5H92C 3TUOA 3W1SA 4A9AA 1IBXB 3ONSA 3HVZA 4HKZE 1ZW7A 3AE1B 1XLOA 3NHEB 3V61A 4OZCA 2MLBA 1IPGA 4BKSD 4G0NB 4OVVA 3BWUD 2N4FA 2KMCA 4YTMB 1V81A 3NOBA 3K9PB 4RGTA 4KVGB 2WXIA 2MP2B 2CU3A 3P4QB 2O6VD 4NNJB 1I4XA 4L2YA 1E7VA 4E74A 2ZW0A 2KK8A 1T0YA 2LJ5A 4WJQA 4W9DA 2FCQA 5LNK1 4AS1A 2DWQA 3H9DA 3JVZX 1YJ1A 2OEDA 2L8JA 2FIFA 1YN5A 4WJPA 2W82A 3W5VB 1WRIA 1MHHE 3R3MA 4FN2A 4ZDVA 3MHSD 2VZKB 1P7EA 3Q3JA 4MH8A 2WX1A 4BKSA 4HKQA 1S3SG 2KO3A 1V49A 3P42A 1ZXHA 5E6OA 2KXJA 3BVGA 4IC7B 2J42A 2KX0A 1VR9A 4US9A 3BIID 3LDZE 1U4AA 4J3OD 3AU4A 3VQIA 2RGFA 1TS2A 4KSLC 1C4AA 3ZNHB 3FAHA 4A20A 1HTQA 3U8ZA 2O6VA 2J0MA 1KTKA 2WXGA 3RULA 4B6WA 3Q3MC 2MBBB 3ZQ4A 3RCZA 3H1UA 4M01A 4JWUC 1I4PA 2N0SB 1NDDA 3IT6B 4NZLB 4HK2A 3VH4B 3MC0B 2MBQA 5AZHA 3U52E 5HKHA 1XT9B 4M0WB 1TKGA 1WMHA 3C8YA 1KOTA 1GC7A 3M3JA 5I4DA 2LHDA 3ZGZA 3J9CA 3AE3B 2QIEB 4IM0A 1WXQA 3SD5A 1R4MI 2KD0A 1WJUA 4DXAB 1PGAA 2K1FA 1Y8RC 3VAWA 3MFGA 4HJKA 1ACCA 4S0RA 5BYSA 2RPQA 1FMAD 3V05A 1S1QB 4B0EA 3UIPB 2HTME 3MHZA 1UWMA 2IY1B 3D32A 5GXGB 4DDGD 4OVZA 4NJ7A 1TS3A 2ON8A 1E8ZA 3RYTA 4I6NB 3RNGC 5J2RA 5AZGA 3RMKC 3DBLB 4EZKA 1A70A 3HRDD 3PSEB 3NS8A 1R4NB 4J6IA 3GS2A 4LDTD 4M02A 4JIOU 3MC9A 1WZ3A 2GOWA 1SSNA 1HZ6A 2RSUA 1IP9A 5JH5C 3HM6X 4H2AA 3TIXA 5E6PA 3PS6A 3B2GA 4YL8A 1XLPA 5H8YE 2FCSA 4YWGG 2DYOA 1XD3B 2AL6A 3ZIMA 2KNBA 4B9KA 2WXHA 4K3CA 2LWPA 1JWAD 1WGGA 2LJIA 1MPEA 1HQRD 2XNAC 3I5JC 5HFYA 3Q8EA 4XC2A 4IDIA 4WWNA 1TY0A 4ARCA 1I7HA 4GOCA 3PLUA 3CSTA 4MT5A 4ANXA 1HEZE 3A4RA 2AL3A 3QHTA 2A5UA 1WGDA 2FAZA 3H8HA 2N9EB 4W9FA 4ZRIA 2V3SA 2L83A 4TQ0A 5AZFA 5FKAC 3KUCB 3PT2B 1GB1A 4ZRKA 2JYTA 1F9JA 3NVZA 3AE6B 2OHFA 3NG0A 3KH0A 2C60A 3B0AA 4NQKE 3ZJUA 4HRSA 4N9F4 3IG3A 2I1JA 2ZCCA 1XEEA 3AXCA 3KWLA 4AJYB 1J7AA 3CSFA 2UU7A 2FBWB 2J0JA 1DOYA 3M63B 3FILA 5TSSA 4EKUA 2K8BA 2RDGA 2L52A 2PIAA 1EO6A 4KZCA 1PYWD 4JGHB 1L6UA 2GI9A 4R3DA 1VJKA 2JT4B 1KRHA 1LM8B 1KLVA 3T3OA 1WX9A 4MGIE 3AECB 2LRUA 2H88B 1R7SA 3C19A 2L00B 3GE8C 4REZA 3OJ3A 4FJZA 3PZ8A 5JXVA 3BINA 3VUWA 2JX5A 2WDRB 1I4HA 4PT5A 1JCKB 3U4EG 1YN3A 3MP9A 4ZHPA 4W9GA 1L4DB 1RFKA 5DPSA 2FUG1 2M4NA 5BMIA 3LXFA 2HDEA 1R4MB 4BOZB 4NJ6A 1Q10A 4LJPB 1WE6A 1YNTE 2D10A 2KN5A 1TZOA 2JRIB 1ZXIA 4DXFA 2KWVB 1QT9A 2CU1A 4NAWB 2IDYA 1K50A 4HPPA 1RLFA 3ZW3A 4C7YA 2KTRA 3IAM1 2X8XX 3CIRB 3TSSA 2ZVNA 3PRPB 2INPE 4LNNA 1M4VA 1GG3A 1GAQB 2V1YA 4KIKA 2X38A 2INDC 2IZVB 2YVCA 3ZTDA 1HTOA 1OQRA 1J8CA 3DHGC 2BYVE 2PMVA 2CJOA 3RN9C 2GBRA 2NCNA 4ACFA 2JF5A 1WXAA 4GU2A 2AQ1B 1GJZA 1VRAB 4WWMA 4IOIE 4E3CA 3T8MA 1D5XC 2MBEA 2N9XA 1IYFA 4P1CC 1STEA 2LUEA 3GP7A 3M62B 2AEHA 4MGYE 5JHBA 2BT6A 4GXBA 3W1SC 1P7FA 2H89B 2PVOD 4NJCA 2HE7A 4ICUA 3RPFC 2V0GA 1Z2MA 1VZ7A 4ZOHC 2TSSA 4GB9A 1C3TA 1YQBA 1NBFC 2AQ3B 1KJTA 2KQ4X 2PPHA 5IAAC 4USAA 2DYBA 3AH7A 1TT5B 3KYDD 1J7CA 1FIQA 1J0GA 4WJNA 4DQOC 1OQQA 2L05A 1UELA 1HE8A 4TKNA 3DDCB 4M00A 5L83A 3L08A 3TEZA 1WE7A 2B3AA 1F77A 2YEPB 3S2AA 1TY2A 3VTUA 2D07B 2KVRA 1N60A 2BWES 4TQ1A 1TS5A 2R61A 3U30A 1DOXA 4DHZE 2N9LA 2RR9A 4GMVA 1CJEA 4FHKA 3L13A 2IO2B 2N7EA 2N7DA 2IYDB 3P4SB 2QJLA 1CK1A 3B2FA 1VCBA 4XE0A 5L95C 3QC8B 4MM3A 2KACA 2GRIA 3I9V1 3PVLA 2NBVB 1ZP0B 2BTEA 3A33B 2BF8B 2BB6A 1E8WA 2BKRB 1I4RA 3EECA 3KWVA 5HHDG 1L4ZB 1ZUD2 1QILA 4HROA 1OGWA 2FIDA 2N9KA 4BAXA 4II2B 3I3TB 4ZRQA 1JQ4A 2KWUB 1WGYA 4XWTA 2GB1A 4RM9A 2KLGA 1TS4A 3Q8FA 1EUVB 4TUUA 2FNJB 3Q6BA 2MSED 3Q14C 4EEWA 3N32A 3PZ7A 2AQ2B 2LVOA 4XWWA 4WJOA 1Y56A 3LB8C 1AARA 1MVKA 1YD8U 2GLSA 3WIMA 4YSYB 2BBCA 1GUAB 2K9XA 3RI7C 4GSWA 2XK5B 4GGQA 3AE9B 1K53A 2KC1A 2B76B 3MJWA 1FD6A 3AEDB 5CHFA 3VR9B 1BXTA 2Z8LA 2BS4B 1IUEA 2QCZA 1QOBA 3AE7B 1RWSA 3ZUNA 4WWOA 3KVFB 5C3JB 2W54A 2KWCA 2WXJA 3JSVB 1ZDXA 4MEMA 3R7RA 4LK0M 3PGEA 3U7ZA 4DK5A 3RZFA 3SDLC 5T8IA 3NUHB 3Q3FA 3SR6A 4P16A 1NENB 1TBEA 1I35A 2QSDA 3OG5A 3TCAA 3N9YC 5FR6A 1SE9A 3IAS1 4P6VF 2EKEC 4YTPB 3W2DA 4WQMA 3QAQA 4P7IA 2KMAA 1TZ1A 2WU2B 1YIWA 4C4VA 1VZ8A 1E7PB 3I63C 5AEKB 1FO4A 1OTRB 4AQ7A 3ZRCA 3Q8AA 3URYA 1FRRA 3V62A 3ZNID 2WXOA 4QAYA 1MHXA 2ZEQA 2BYFA 1F1HA 4GDKB 2DAJA 3VFKA 1KF6B 4ZHOA 1L5PA 1KH0A 2WDVB 2A4ZA 2KYWA 3FC4A 1QOGA 4LNIA 2MRPA 4W9HA 4G3XB 3ZLZA 4P1BC 4A3PA 1L0YB 3A9KA 2CJNA 3DHIC 1C1YB 3E56A 3AM9A 2JVCA 4XYCA 4DHJD 2W3SA 3ENEA 4PS7A 1SEBD 1WJ4A 2KFKB 4LNOA 4JLCA 1B9RA 4MSQB 1VD2A 2NS5A 3VDZA 3N1XC 4F7ZA 3W5UB 3QJZA 3IT4B 4YXDB 2GBKA 2FCMA 4A3OA 1G6JA 4WH4A 3ML9A 4K7WA 1UF0A 3P2BA 3ZRFA 3R7QA 2M0XA 3OWEB 2L7RA 3FKYA 1XXGA 3HHMA 1N6ZA 3APFA 3DOWA 2C7NB 3AEAB 3MC8A 2M17A 1VLBA 2DX5B 1KFYB 2CR5A 2O2VB 2FCNA 4G50A 1V1PB 1NVID 2ZZPB 2WS3B 2C7HA 3L17A 1RM6C 4MACA 2JXXA 2YEPF 2D3AA 1YOVB 1HXYD 3N1YC 1E0ZA 2PKOA 4FXCA 2C5LC 1TIFA 2JXTA 1V5OA 2Y5PA 4HCPB 5IA7A 1WF9A 2Z59B 2SAKA 5IP4D 3P4RB 3AU5A 2V4IB 4ICVA 2WWZA 2MA9B 1LGRA 1C77A 2MH7A 4IKGA 1WM3A 4HLEA 2O6VB 2J4XA 2PTLA 2LUMA 2K0PA 1WXMA 2SEBD 4X57B 1H4RA 5HG2A 2WGSA 1JMLA 3WAMA 1WGKA 2JZPA 3RNFC 3PRMB 4GN1A 3L4PA 1V2YA 3PTFC 1RYJA 3ZTCA 2BS3B 1SB3C 1C9FA 4RCOA 2L76A 2WXQA 2M19A 2PLPA 3ABVB 1PGBA 1OQYA 4KX6B 2K8CA 4K3BA 1LXDA 4EOYA 5GMVA 2BS2B 2CHWA 1HZ5A 4XDCA 1L7YA 5CHVC 1WMHB 1AWDA 4LTUA 3BVZA 1WX8A 1ZDVA 1QQRA 2LGXA 2G9HD 3HVDA 2KTFA 2WU5B 1WJ6A 2DZJA 1K8RB 2J52A 3QARA 1YX5B 3AEBB 1E8XA 4DHZB 2C9WB 2WX0A 3TMPB 1EF1A 2K5PA 3NZUA 1Q0WB 5J17A 4FA6A 1V1OA 2NBUA 2KVZA 3Q69A 1VZ6A 2BKFA 2MJ3A 3RNCC 1MJDA 3DPDA 3RFZB 1ESFA 4Q2JA 1LFDA 4US8A 2INCC 1E5WA 1UZXB 5C2TB 4NAWA 5EDSA 2DZMA 2VH1A 3RUIB 4C00A 5KHOA 4RMAA 3EFUA 1SE3A 1B1ZA 3ZDMC 4XZ4A 3SEBA 3ZNZB 1T5XD 2Z0DB 2KDFB 2M8SA 2LVPA 4PS3A 3SHQA 3SU8X 2ICIA 1I42A 3EGRA 1Q1OA 1K51A 3VUYA 4ZYSA 3BK2A 2VRRB 1FFUA 4XGAB 2J7QB 4MJSA 1F2RI 2L0FA 4O1NA 3NS1A 5DCNA 1GOZA 5JHAA 3NZ3A 2IO0B 2ZNVC 3ML8A 4CQNA 3LYYA 2JUOA 1BT0A 4WWPA 1SJED 2HJ8A 1CQVA 3KYCD 2Z0EB 3TEXA 1FXIA 3N3KB 3PRZA 1TJEA 4M8NA 2N7JA 3UIOB 5J18A 4KZ0A 1UBIA 2MHJA 2G1EA 4W9JA 4BBNC 1IGDA 1PGXA 3HUIA 3QIJA 1C4CA 3ZXRA 4WIPA 1MI0A 1T3QA 2OOBB 2AYOB 3UINB 1FCLA 4K1RB 4LDTB 3VRBB 4OZAA 2MJEA 1QOFA 3H7SA 5AUIA 2E3TA 2E6XA 4W9IA 2I38A 3UF8A 2NPTA 3UGBB 3NVYA 5G5GA 2ZVOA 1EM7A 3PREA 4B0MA 1VDVA 3U2SC 3ZXVA 5D6JB 2N1WA 3OAWA 3X23A 4DDID 4PYUA 3MTNB 4JE3B 2LGYA 4AUQC 3GB1A 3X0WA 2DZKA 1D5ZC 2OJRA 3AULA 4GDLA 4KDIC 4A55A 3N20C 4PS8A 4K7UA 1XO3A 3I57A 1ZPSA 4RGNA 3QX1A 2MJDA 1FNUA 3IBEA 1SE2A 4A90A 2PJHA 3QWZB 1NI3A 3PLVA 1FXAA 2GBJA 1UUPA 4F8CB 1D4BA 4EZJA 3AB5A 3FILB 3K9OB 2QILA 3A1QA 1PUTA 3AN1A 2UYZB 3ZYYX 2KZRA 4HDOA 3OJ4B 3U7DA 1ET9A 3W9CB 3VXWA 2EELA 5TR5A 1C78A 2AWTA 3MJ5A 3AEGB 2LHEA 4HVBA 1V86A 2EMTA 1E6EB 1E7UA 4F1SA 4OVUA 3DCGA 1SXTA 3RT3B 3H7PA 2DNFA 1XCTL 2MCNB 1E90A 1SJHD 3R2IA 1UWXA 2KWDA 4ITKA 2WXFA 2LASA 3WALA 5IOIA 1SF0A 3VR8B 2WXKA 1T6BX 2PEAA 4KKIA 1YMHE 4C56C 3L16A 4II3B 2RD0A 4TV3A 1ROEA 3RNEC 2PE9A 2L0TA 1DGJA 1N63A 1JWUD 2KJRA 3P1MA 1ISNA 1IBXA 3L10B 1OEYJ 1YJJA 2ASQA 3RNAC 2VZKD 2QC8A 2G4DB 4KIKB 4KDLB 2DBYA 2EKIA 2FE8A 3AV8A 1JROA 4LNKA 2Y3AA 3NRZA 2INNE 2LXCA 2KANA 3A9JB 2MBHA 2MP2A 2DENB 3EFCA 4CHKA 2JPHA 2C7MB 1H8CA 1WSPA 4AJWA 1SIFA 2KDBA 1NI2A 3AEFB 2QHOA 1ET6A 2DLBA 3IVFA 1ZGUB 1WM2A 3DBRI 2MWSB 2M1MA 2KMMA 1L6VA 2QDFA 2ZW1A 3APCA 4EE2A 1P1AA 2JY6A 2NTTA 2RMMA 5EE9A 4NQLB 3RZWC 3DVNV 4WURA 1TTNA 3AE5B 5IKCM 1T0RC 1F52A 5BYQA 1TKEA 1ZE3D 4ASWC 3CF6E 2LGIA 1SE4A 3NY5A 2L3ZA 3DHHC 4KGTA 3ZJVA 2MX2A 1ZKHA 3UQBA 4C7ZA 2JZ3B 2IO1B 2I2YA 1V5TA 2V9HA 4DBGA 1FM0D 1Q5WB 1WGHA 1P3QU 2ZNVB 5HI1A 1IGCA 2ACZB 1UGJA 2JQRB 3L0WB 4JPSA 2KT7A 3R8BA 3VUXA 4MGZE 4M0WA 1TGZB 2D11A 1F0ZA 1WWTA 2DYMA 2DZIA 4MSMB 3V6CB 2V3PA 4JX1C 4AOFA 1K52A 5BO4B 5AUKA 1L0VB 3T3NA 4XX5A 4RF0A 4MM3B 1D3ZA 3L54A 4BKGA 2RDHA 4KGRA 1AYFA 2XN9C 2GBMA 1C4PA 4FJYA 3KLSX 2NR2A 2ZPYA 1DOIA 4EZLA 1JWSD 2DHZA 4NAMA 4HWIB 2LEKA 1EU3A 1FFVA 4LJOB 1NYRA 3PPAA 2IGHA 3TEWA 4N58A 1J19A 2O2VA 1QF6A 1UGMA 4BVUC 4ANUA 1V1PA 4RM8A 5DPTA 1DYQA 4ANWA 2IY0B 2WXRA 4E71A 3DVGX 5C23A 2LI5A 3BYYB 3WAOA 1N62A 2WDQB 2KJHB 2W55A 3DBHI 2K6DB 2PVGC 3QA8A 3PHWB 3OLMD 4WQOB 5CHWA 1PQSA 3Q8BA 3APDA 3PO0A 1WZ0A 3WA0A 3TEYA 1V9JA 3O65B 2LGSA 2G45B 2RDBC 4BKTA 1JRUA 1KLUD 1V8CA 3N30A 3DBSA 2JSVX 4D2KA 2IGGA 3ZNGC 3PZDA 2ZCBA 4FULA 5G2NA 1UD7A 3Q3OC 2IO3B 4LNFA 2MQJA 2AX5A 3CMMB 2GBNA 3TL5A 4A8XC 5IO9A 3UQAA 1UBQA 4KV2A 3TJPA 4HPLB 2HJ1A 3IFWB 2WXMA 2KJ6A 2VH2A 1YQ3B 2I1KA 3W1YA 3DVNU 2BPSA 3EA6A 2L32A 4W9EA 3WCQA 2G4SA 1LO5D 3KQ4A 2EMSA 2N9PC 2KHWB 4LCDE 2WLBA 3Q2AC 2D2QA 4RF1A 4C4VB 4IG7B 3R2TA 3DBRB 2K8HA 1GB4A 2KQSA 3KW5B 3NVVA 5G5HA 5DPRA 1WR6E 4PK1A 4YT0B 2WDTB 4IWOA 2D3GA 4IM3A 2JWZA 1UNSA 2V4LA 3TBLD 3VTWA 2IJ0A 2L1AA 1SGHA 4L23A 3R66C 2KDEB 2R2QA 3BYTB 1RFAA 1CMXB 1KM7A 1YJIA 5C1ZA 4C80A 3EUB2 4NY0A 3A9KB 2YLMA 3VVWB 4K81A 3CWIA 1EF5A 2WYQA 1ZOYB 4GLSC 1PDXA 1D6EC 2Y5BB 2V3NA 3AE4B 3DWGC 3A4SC 1JWBD 2JWUA 4MDKE 1T0SC 1EWCA 1P98A 2BYTA 1CZPA 3QQ8B 1GPXA 1L0XB 4MH0E 2LVQA 3DWMA 2K22A 2KC2A 5EE1A 1GNUA 4ZYNA 1A5RA 2LMCA 4A6QA 3WANA 1AN8A 1XF5L 2JZZA 3ZO5B 5D2MB 3B08A 4RGOS 5E6JA 1RRBA 3NVWA 2K39A 1TKYA 1GC6A 3ALBA 1T0QC 4OW0A 1F2RC 2UWQA 3HK0A 4IM2A 5E6NA 1WI0A 3N1ZC 4FJVB 4ZRJA 4DHJB 1N5WA 5CX3A 1YX6B 3DQVA 2KDMA 4JL9A 3VHTC 5DPWA 1FNWA 4AWJA 1YN4A 5CTRC 3BZDB 4RGMA 1NEKB 4BBNF 3DBHB 3AE2B 2KOXA 1E10A 3SFDB 3Q3NC 4KKJA 3LJ3A 1XLQA 4KGSA 4I6LB 1QKZA 1X1MA 1WX7A 2KLCA 3NJTA 1BMLC 4ARIA 5FK9C 2K25A 1V80A 2KX3A 2JYEA 3V3XA 1M94A 1JWMD 1WXVA 1D5MC 2QEJC 4YSXB 2MBOA 4BFRA 1WYWB 5EE3A 3DVGY 3WAPA 4CO7A 4TMAB 3GZNI 3ZDTA 4ZRPA 1WY8A 2BVCA 4W9KA 5FR3A 2GMIC 4RNAA 2HTHA 4IW0A 5LXHA 2JRHA 1FNVA 2MW5A 2Q5WD 3KUZA 1J7BA 4BZAA 4WAAA 4FADA 4EUTA 4XDDA 2PE6B 1WGRA 4CYEA 1L2NA 4I6PA 3IHPC 4AP4C 1OFFA 1RAXA 1SBBB 1C76A 1MG4A 2NVUI 2BYEA 2LFIA 1N5XA 2LD9A 1WXSA 2BWFA 1E9MA 2BB5A 2HD5B 2KKCA 2LGDA 4HEA1 4MGKE 3P4PB 2G3QB 3QCAA 4OZBA 2LRWA 2WP9B 1P9DU 1OEYA 2JU6X 3KUDB 3B1LX 4K7SA 3BVMA 3PHXB 1N61A 3H6NA 1EWYC 3ZKJC 3ETRA 2DAFA 3E9SA 2BGFA 3GE3C 1TYGB 4FHJA 2RPVA 2CHZA 2WXPA 2XBBC 1BUIC 2IPKD 3GOEA 1QOAA 4M8MA 1MG8A 3ECIA 2OJWA 4RFBA 4MELA 2WNMA 2ZJDA 5EE0A 2D3CA 1EU4A 1LQBA 3EC8A 3T9LA 2K3UA 2XEWA 3HM3A 2BQQA 3A9JA 3O13A 3HIZA 4MJSB 4UDUC 2D3BA 4W9LA 4LLGM 4YTNB 2M56B 3JW0X 3RNBC 3EHVA 3P63A 2W9NA 2LXAA 4IUMB 3Q8CA 3V6EB 5D7GA 1C79A 2MEKA 2WXNA 5D3DA 2K6QA 2M0AA 2J0KA 3BK1A 3RD2A 2Y5CA 2KDIA 1WRDB 2QMTA 1I4GA 1Z5SB 2D5GA 4G11A 2R2OA 5KHQA 2KAJA 2N1VA 4N59A 2WXLA 2IGDA 4JQWC 1PFDA 1WIAA 2ONQA 4HPMB 1I4QA 2KQ7A 2NPTB 3PV1A 4IWQA 4GIVA 4HXDA 1FPYA 1V6EA 1NYQA 1QZEA 2CS4A 2XK5A 3B9JA 5LLIA 2KTRB 4IWPA 1XLNA 4S17A 2NBWB 4W9CA 2ZPNA 3SFEB 1KLGD 2REXA 5LXIB 4RH6A
chains in the Genus database with same CATH topology
2PTLA 5JXVA 1FFVA 1FEHA 2LUMA 1NYRA 1XCQL 2JX5A 2K0PA 2SEBD 5HG2A 2WDRB 1I4HA 4PT5A 2KN4A 2IGHA 3TEWA 1FCCC 1JCKB 1JMLA 1WGKA 1YN3A 4N58A 3U4EG 3MP9A 4GDLB 1QF6A 2JZPA 4ZHPA 1L4DB 1RFKA 1YQ4B 2FUG1 3L4PA 1V1PA 5BMIA 1ENFA 1RYJA 2BS3B 2HDEA 1DYQA 1SB3C 3LXFA 4RCOA 1C9FA 4TSSA 1Q10A 2WXQA 2M19A 2WXRA 2PLPA 1YNTE 3ABVB 1PGBA 3AMZA 1WYGA 4L1BA 1TZOA 3BYYB 4HJGE 1N62A 5BYRA 2WDQB 5BMGA 1AW7A 1ZXIA 4KX6B 3AEEB 4DXFA 2BS2B 2BW2A 1HZ5A 1QT9A 2W55A 4XDCA 2PVGC 1AWDA 4LTUA 4NAWB 3Q8BA 2IDYA 4OHJA 3PO0A 3BVZA 1K50A 1ZDVA 1QQRA 1HA5A 2G9HD 3AE8B 4C7YA 3HVDA 3IAM1 3CIRB 3TSSA 4WAFA 3TEYA 2W3RA 2WU5B 2INPE 2J52A 1M4VA 3IXSA 3AEBB 1GAQB 2X38A 1KLUD 1V8CA 2NMQA 1V97A 2K5PA 2JSVX 5D3IB 4D2KA 1OQRA 4DXGA 1V1OA 2J53A 2IGGA 2PMVA 2CJOA 3ZJTA 3Q69A 1VZ6A 2MJ3A 5MPOA 1JW9D 1JRPA 3RFZB 2AQ1B 2AX5A 1ESFA 4Q2JA 3UI3A 2WQYB 1SIJA 4US8A 5C2TB 4A8XC 1QLBB 1VRAB 4JWSC 4WWMA 4N6EB 4YSZB 1JALA 4IOIE 2PW9A 1D5XC 1SE3A 1B1ZA 1STEA 3SEBA 3GP7A 1T5XD 2BT6A 5BMHA 3VRAB 1P7FA 2H89B 2NTSA 2PVOD 2WXMA 4NJCA 3RPFC 2V0GA 1YQ3B 1VZ7A 4ZOHC 2TSSA 2ICIA 3EA6A 1FRDA 5H92C 2L32A 3TUOA 3W1SA 4A9AA 1IBXB 3WCQA 1LO5D 3HVZA 3EGRA 3KQ4A 2AQ3B 4HKZE 1K51A 2KQ4X 2WLBA 3AE1B 4ZYSA 4USAA 4RF1A 3AH7A 3BK2A 1XLOA 1J7CA 3R2TA 4OZCA 1FFUA 1FIQA 1GB4A 3NVVA 4DQOC 5G5HA 1OQQA 3BWUD 1F2RI 4YTMB 4YT0B 4O1NA 3NS1A 1GOZA 4RGTA 3NZ3A 1UNSA 2WXIA 4CQNA 2CU3A 3P4QB 3LYYA 3TEZA 2IJ0A 2L1AA 1SJED 1CQVA 1F77A 2YEPB 1I4XA 4L23A 1FXIA 3TEXA 4L2YA 1TJEA 2ZW0A 2N7JA 3BYTB 1TY2A 1N60A 2G1EA 1YJIA 5LNK1 4AS1A 1IGDA 4C80A 1PGXA 2DWQA 3EUB2 4TQ1A 1TS5A 2R61A 3HUIA 1DOXA 2N9LA 1C4CA 2OEDA 1CJEA 4WIPA 1MI0A 1T3QA 1YN5A 1FCLA 3VRBB 3CWIA 4OZAA 2MJEA 2W82A 1QOFA 1WRIA 3W5VB 1ZOYB 3P4SB 5AUIA 1MHHE 2QJLA 1CK1A 2E3TA 2E6XA 3B2FA 4GLSC 4XE0A 2I38A 1PDXA 2VZKB 1D6EC 1P7EA 2V3NA 2KACA 3AE4B 3DWGC 2GRIA 4MH8A 3NVYA 4HKQA 3I9V1 1JWBD 5G5GA 2JWUA 1EM7A 1ZP0B 2BTEA 1EWCA 3P42A 2BB6A 1ZXHA 4B0MA 2BYTA 1VDVA 3BVGA 1I4RA 1CZPA 2J42A 1VR9A 4US9A 3KWVA 1L0XB 5HHDG 3BIID 1L4ZB 1ZUD2 1GPXA 1QILA 3U2SC 4J3OD 3VQIA 3DWMA 1TS2A 4HROA 1C4AA 2K22A 2N9KA 4JE3B 5EE1A 3FAHA 3GB1A 1KTKA 2WXGA 2LMCA 4A6QA 1D5ZC 1AN8A 3ZQ4A 4A55A 1XF5L 1XO3A 3I57A 4JWUC 1I4PA 1ZPSA 4RGNA 2N0SB 4RGOS 5E6JA 2MJDA 1FNUA 3NVWA 1SE2A 3IT6B 4ZRQA 4A90A 4NZLB 1JQ4A 1TKYA 3MC0B 1NI3A 3U52E 4XWTA 2GB1A 4OW0A 1FXAA 3Q8FA 1TS4A 1F2RC 1TKGA 1UUPA 1D4BA 1N5WA 3C8YA 3AB5A 3PZ7A 3FILB 2QILA 2AQ2B 1PUTA 3AN1A 3ZYYX 4XWWA 5I4DA 1Y56A 2KDMA 3LB8C 2LHDA 3ZGZA 3J9CA 1FNWA 1ET9A 1MVKA 4YSYB 2BBCA 3W9CB 1YN4A 2K9XA 3AE3B 2EELA 2QIEB 3BZDB 4RGMA 1WXQA 1NEKB 3AE9B 1K53A 3AE2B 1C78A 2B76B 1E10A 3SFDB 3MJ5A 1FD6A 3AEDB 3AEGB 4KKJA 1XLQA 2LHEA 4KGSA 1PGAA 1QKZA 3VR9B 1E6EB 1BXTA 2Z8LA 2BS4B 1BMLC 4ARIA 5FK9C 1IUEA 1SXTA 3MFGA 1ACCA 1QOBA 3AE7B 5BYSA 2JYEA 3V3XA 1RWSA 1FMAD 3V05A 1JWMD 4B0EA 2HTME 3MHZA 1D5MC 1UWMA 1XCTL 5C3JB 1SJHD 2W54A 2QEJC 3R2IA 2WXJA 5GXGB 4YSXB 1UWXA 2KWDA 1ZDXA 4OVZA 4LK0M 5EE3A 1TS3A 4ITKA 2ON8A 2WXFA 3U7ZA 1SF0A 3VR8B 2WXKA 4TMAB 5T8IA 3NUHB 1T6BX 4ZRPA 3SR6A 4P16A 5FR3A 1NENB 4KKIA 1YMHE 4RNAA 4C56C 1A70A 2QSDA 1FNVA 2Q5WD 3HRDD 1J7BA 1ROEA 3N9YC 3IAS1 4XDDA 4P6VF 4YTPB 1DGJA 1N63A 1JWUD 3GS2A 3W2DA 3P1MA 4WQMA 1IBXA 1OFFA 1SBBB 1SSNA 1HZ6A 2WU2B 1VZ8A 1E7PB 1C76A 1YJJA 2VZKD 1FO4A 2DBYA 2EKIA 2FE8A 2LFIA 1N5XA 4H2AA 4AQ7A 3B2GA 3AV8A 1XLPA 1JROA 1E9MA 5H8YE 2BB5A 2Y3AA 3NRZA 3Q8AA 2INNE 3URYA 1FRRA 4YWGG 2DYOA 2WXOA 4HEA1 2WXHA 1MHXA 3P4PB 4GDKB 1KF6B 4OZBA 4ZHOA 1L5PA 2WP9B 1KH0A 2WDVB 2JU6X 1JWAD 1WSPA 2LJIA 1QOGA 1MPEA 3FC4A 1HQRD 2XNAC 3BVMA 5HFYA 1N61A 3Q8EA 4IDIA 1EWYC 1TY0A 3AEFB 4ARCA 1I7HA 1ET6A 3ETRA 2DLBA 1L0YB 3E9SA 2CJNA 1TYGB 2KMMA 4MT5A 1HEZE 1L6VA 2RPVA 3E56A 2ZW1A 2WXPA 3AM9A 1BUIC 2IPKD 4EE2A 3H8HA 2NTTA 2W3SA 2RMMA 5EE9A 1QOAA 1SEBD 2L83A 4TQ0A 4WURA 1B9RA 4RFBA 2WNMA 5EE0A 3AE5B 1EU4A 5FKAC 2K3UA 5BYQA 3W5UB 3O13A 1GB1A 1TKEA 3IT4B 4YXDB 4UDUC 1ZE3D 2JYTA 3NVZA 4LLGM 3AE6B 2LGIA 2OHFA 4WH4A 4YTNB 1SE4A 2M56B 4KGTA 3P63A 3ZJVA 3OWEB 3ZJUA 3Q8CA 4C7ZA 4HRSA 1XXGA 5D7GA 1C79A 2I2YA 1FM0D 2MEKA 2WXNA 5D3DA 2M0AA 5HI1A 1IGCA 2ACZB 1XEEA 3AEAB 1UGJA 3BK1A 2JQRB 3KWLA 1VLBA 4JPSA 1KFYB 3R8BA 1J7AA 4M0WA 2Y5CA 2FBWB 1V1PB 1F0ZA 1NVID 1I4GA 2QMTA 1WWTA 2DYMA 2WS3B 2D5GA 4MACA 1RM6C 1DOYA 2YEPF 3FILA 5TSSA 1HXYD 2KAJA 2V3PA 4JX1C 4N59A 1K52A 2IGDA 2RDGA 2WXLA 1E0ZA 1PFDA 2PKOA 2L52A 5AUKA 1L0VB 2ONQA 2PIAA 4FXCA 3T3NA 1PYWD 2GI9A 1I4QA 1L6UA 2JXTA 4R3DA 1VJKA 4MM3B 4RF0A 2Y5PA 1KRHA 3T3OA 2RDHA 3AECB 4KGRA 1AYFA 1NYQA 2XN9C 2SAKA 3B9JA 1C4PA 3P4RB 2H88B 3KLSX 1R7SA 1DOIA 1XLNA 1JWSD 2V4IB 4REZA 2MH7A 1C77A 3SFEB 4NAMA 1KLGD 4IKGA 3PZ8A 2LEKA 1EU3A 4RH6A 2J4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTL A;  5JXV A;  2LUM A;  3FIL B;  1XCQ L;  2K0P A;  5HG2 A;  2KN4 A;  4OZC A;  2IGH A;  1FCC C;  1JML A;  1GB4 A;  3MP9 A;  2KDM A;  2JZP A;  2LHD A;  1F2R I;  1MVK A;  5BMI A;  1HEZ E;  1C9F A;  2RPV A;  2EEL A;  2ZW1 A;  1Q10 A;  2PLP A;  1YNT E;  1PGB A;  1K53 A;  4HJG E;  5BMG A;  2RMM A;  1FD6 A;  1HZ5 A;  2LHE A;  1K51 A;  1PGA A;  4KGS A;  1QKZ A;  2ZW0 A;  2N7J A;  1K50 A;  1IGD A;  1PGX A;  1GB1 A;  3V3X A;  2N9L A;  2OED A;  1MI0 A;  2LGI A;  4WH4 A;  1XCT L;  1FCL A;  4KGT A;  4OZA A;  2J52 A;  1UWX A;  2KWD A;  1MHH E;  2ON8 A;  4GLS C;  2NMQ A;  2I38 A;  2I2Y A;  1P7E A;  2JSV X;  2KAC A;  4D2K A;  2J53 A;  2IGG A;  1IGC A;  1YMH E;  2JWU A;  5HI1 A;  1EM7 A;  2QSD A;  1ZXH A;  5HHD G;  2QMT A;  1IBX A;  4MAC A;  3UI3 A;  2N9K A;  1HZ6 A;  3GB1 A;  3FIL A;  1K52 A;  2IGD A;  2ONQ A;  4IOI E;  2GI9 A;  1XF5 L;  2JXT A;  2PW9 A;  4KGR A;  5BMH A;  1P7F A;  1MHX A;  2GB1 A;  1F2R C;  4OZB A;  1KH0 A;  1D4B A;  2JU6 X;  1IBX B;  1MPE A;  4IKG A;  4HKZ E;  2KQ4 X;  5HFY A; 
#chains in the Genus database with same CATH topology
 1FEH A;  4PYZ A;  1MFW A;  1WFY A;  1XCQ L;  4FLH A;  2KN4 A;  1FCC C;  4GDL B;  5IN7 A;  1YQ4 B;  4HDQ A;  1ENF A;  3ZVV A;  2WHI A;  4BOS C;  4TSS A;  3JSV A;  5JZE B;  4FBJ B;  1XQQ A;  3AMZ A;  1WYG A;  4L1B A;  4HJG E;  5BYR A;  5BMG A;  1AW7 A;  3AEE B;  2BW2 A;  3VH3 B;  4OHJ A;  3A1Q B;  1HA5 A;  3AE8 B;  1WH3 A;  4ANV A;  3QK0 A;  4WAF A;  1P0R A;  2W3R A;  3NZS A;  4EFO A;  3IXS A;  3GZN B;  2NMQ A;  5G55 A;  1V97 A;  4B95 A;  5D3I B;  1WJN A;  2IBI B;  2LZ6 A;  4DXG A;  2J53 A;  3BY4 B;  3VTV A;  5D94 A;  3ZJT A;  3DBL I;  1FXT B;  4GDK A;  5MPO A;  1JW9 D;  3H7P B;  4HCN B;  1JRP A;  4NPN A;  1R4N I;  4KSK C;  3UI3 A;  2WQY B;  1SIJ A;  3M95 A;  4URK A;  1QLB B;  4JWS C;  4N6E B;  4YSZ B;  1JAL A;  2PW9 A;  1WR1 A;  3V60 A;  2FUH B;  4DWF A;  2CHX A;  1E8Y A;  3JYU A;  5BMH A;  3VRA B;  2NTS A;  3C0R B;  2CKH B;  1UH6 A;  3AI5 A;  2KFJ A;  1FRD A;  2KFK A;  5H92 C;  3TUO A;  3W1S A;  4A9A A;  1IBX B;  3ONS A;  3HVZ A;  4HKZ E;  1ZW7 A;  3AE1 B;  1XLO A;  3NHE B;  3V61 A;  4OZC A;  2MLB A;  1IPG A;  4BKS D;  4G0N B;  4OVV A;  3BWU D;  2N4F A;  2KMC A;  4YTM B;  1V81 A;  3NOB A;  3K9P B;  4RGT A;  4KVG B;  2WXI A;  2MP2 B;  2CU3 A;  3P4Q B;  2O6V D;  4NNJ B;  1I4X A;  4L2Y A;  1E7V A;  4E74 A;  2ZW0 A;  2KK8 A;  1T0Y A;  2LJ5 A;  4WJQ A;  4W9D A;  2FCQ A;  5LNK 1;  4AS1 A;  2DWQ A;  3H9D A;  3JVZ X;  1YJ1 A;  2OED A;  2L8J A;  2FIF A;  1YN5 A;  4WJP A;  2W82 A;  3W5V B;  1WRI A;  1MHH E;  3R3M A;  4FN2 A;  4ZDV A;  3MHS D;  2VZK B;  1P7E A;  3Q3J A;  4MH8 A;  2WX1 A;  4BKS A;  4HKQ A;  1S3S G;  2KO3 A;  1V49 A;  3P42 A;  1ZXH A;  5E6O A;  2KXJ A;  3BVG A;  4IC7 B;  2J42 A;  2KX0 A;  1VR9 A;  4US9 A;  3BII D;  3LDZ E;  1U4A A;  4J3O D;  3AU4 A;  3VQI A;  2RGF A;  1TS2 A;  4KSL C;  1C4A A;  3ZNH B;  3FAH A;  4A20 A;  1HTQ A;  3U8Z A;  2O6V A;  2J0M A;  1KTK A;  2WXG A;  3RUL A;  4B6W A;  3Q3M C;  2MBB B;  3ZQ4 A;  3RCZ A;  3H1U A;  4M01 A;  4JWU C;  1I4P A;  2N0S B;  1NDD A;  3IT6 B;  4NZL B;  4HK2 A;  3VH4 B;  3MC0 B;  2MBQ A;  5AZH A;  3U52 E;  5HKH A;  1XT9 B;  4M0W B;  1TKG A;  1WMH A;  3C8Y A;  1KOT A;  1GC7 A;  3M3J A;  5I4D A;  2LHD A;  3ZGZ A;  3J9C A;  3AE3 B;  2QIE B;  4IM0 A;  1WXQ A;  3SD5 A;  1R4M I;  2KD0 A;  1WJU A;  4DXA B;  1PGA A;  2K1F A;  1Y8R C;  3VAW A;  3MFG A;  4HJK A;  1ACC A;  4S0R A;  5BYS A;  2RPQ A;  1FMA D;  3V05 A;  1S1Q B;  4B0E A;  3UIP B;  2HTM E;  3MHZ A;  1UWM A;  2IY1 B;  3D32 A;  5GXG B;  4DDG D;  4OVZ A;  4NJ7 A;  1TS3 A;  2ON8 A;  1E8Z A;  3RYT A;  4I6N B;  3RNG C;  5J2R A;  5AZG A;  3RMK C;  3DBL B;  4EZK A;  1A70 A;  3HRD D;  3PSE B;  3NS8 A;  1R4N B;  4J6I A;  3GS2 A;  4LDT D;  4M02 A;  4JIO U;  3MC9 A;  1WZ3 A;  2GOW A;  1SSN A;  1HZ6 A;  2RSU A;  1IP9 A;  5JH5 C;  3HM6 X;  4H2A A;  3TIX A;  5E6P A;  3PS6 A;  3B2G A;  4YL8 A;  1XLP A;  5H8Y E;  2FCS A;  4YWG G;  2DYO A;  1XD3 B;  2AL6 A;  3ZIM A;  2KNB A;  4B9K A;  2WXH A;  4K3C A;  2LWP A;  1JWA D;  1WGG A;  2LJI A;  1MPE A;  1HQR D;  2XNA C;  3I5J C;  5HFY A;  3Q8E A;  4XC2 A;  4IDI A;  4WWN A;  1TY0 A;  4ARC A;  1I7H A;  4GOC A;  3PLU A;  3CST A;  4MT5 A;  4ANX A;  1HEZ E;  3A4R A;  2AL3 A;  3QHT A;  2A5U A;  1WGD A;  2FAZ A;  3H8H A;  2N9E B;  4W9F A;  4ZRI A;  2V3S A;  2L83 A;  4TQ0 A;  5AZF A;  5FKA C;  3KUC B;  3PT2 B;  1GB1 A;  4ZRK A;  2JYT A;  1F9J A;  3NVZ A;  3AE6 B;  2OHF A;  3NG0 A;  3KH0 A;  2C60 A;  3B0A A;  4NQK E;  3ZJU A;  4HRS A;  4N9F 4;  3IG3 A;  2I1J A;  2ZCC A;  1XEE A;  3AXC A;  3KWL A;  4AJY B;  1J7A A;  3CSF A;  2UU7 A;  2FBW B;  2J0J A;  1DOY A;  3M63 B;  3FIL A;  5TSS A;  4EKU A;  2K8B A;  2RDG A;  2L52 A;  2PIA A;  1EO6 A;  4KZC A;  1PYW D;  4JGH B;  1L6U A;  2GI9 A;  4R3D A;  1VJK A;  2JT4 B;  1KRH A;  1LM8 B;  1KLV A;  3T3O A;  1WX9 A;  4MGI E;  3AEC B;  2LRU A;  2H88 B;  1R7S A;  3C19 A;  2L00 B;  3GE8 C;  4REZ A;  3OJ3 A;  4FJZ A;  3PZ8 A;  5JXV A;  3BIN A;  3VUW A;  2JX5 A;  2WDR B;  1I4H A;  4PT5 A;  1JCK B;  3U4E G;  1YN3 A;  3MP9 A;  4ZHP A;  4W9G A;  1L4D B;  1RFK A;  5DPS A;  2FUG 1;  2M4N A;  5BMI A;  3LXF A;  2HDE A;  1R4M B;  4BOZ B;  4NJ6 A;  1Q10 A;  4LJP B;  1WE6 A;  1YNT E;  2D10 A;  2KN5 A;  1TZO A;  2JRI B;  1ZXI A;  4DXF A;  2KWV B;  1QT9 A;  2CU1 A;  4NAW B;  2IDY A;  1K50 A;  4HPP A;  1RLF A;  3ZW3 A;  4C7Y A;  2KTR A;  3IAM 1;  2X8X X;  3CIR B;  3TSS A;  2ZVN A;  3PRP B;  2INP E;  4LNN A;  1M4V A;  1GG3 A;  1GAQ B;  2V1Y A;  4KIK A;  2X38 A;  2IND C;  2IZV B;  2YVC A;  3ZTD A;  1HTO A;  1OQR A;  1J8C A;  3DHG C;  2BYV E;  2PMV A;  2CJO A;  3RN9 C;  2GBR A;  2NCN A;  4ACF A;  2JF5 A;  1WXA A;  4GU2 A;  2AQ1 B;  1GJZ A;  1VRA B;  4WWM A;  4IOI E;  4E3C A;  3T8M A;  1D5X C;  2MBE A;  2N9X A;  1IYF A;  4P1C C;  1STE A;  2LUE A;  3GP7 A;  3M62 B;  2AEH A;  4MGY E;  5JHB A;  2BT6 A;  4GXB A;  3W1S C;  1P7F A;  2H89 B;  2PVO D;  4NJC A;  2HE7 A;  4ICU A;  3RPF C;  2V0G A;  1Z2M A;  1VZ7 A;  4ZOH C;  2TSS A;  4GB9 A;  1C3T A;  1YQB A;  1NBF C;  2AQ3 B;  1KJT A;  2KQ4 X;  2PPH A;  5IAA C;  4USA A;  2DYB A;  3AH7 A;  1TT5 B;  3KYD D;  1J7C A;  1FIQ A;  1J0G A;  4WJN A;  4DQO C;  1OQQ A;  2L05 A;  1UEL A;  1HE8 A;  4TKN A;  3DDC B;  4M00 A;  5L83 A;  3L08 A;  3TEZ A;  1WE7 A;  2B3A A;  1F77 A;  2YEP B;  3S2A A;  1TY2 A;  3VTU A;  2D07 B;  2KVR A;  1N60 A;  2BWE S;  4TQ1 A;  1TS5 A;  2R61 A;  3U30 A;  1DOX A;  4DHZ E;  2N9L A;  2RR9 A;  4GMV A;  1CJE A;  4FHK A;  3L13 A;  2IO2 B;  2N7E A;  2N7D A;  2IYD B;  3P4S B;  2QJL A;  1CK1 A;  3B2F A;  1VCB A;  4XE0 A;  5L95 C;  3QC8 B;  4MM3 A;  2KAC A;  2GRI A;  3I9V 1;  3PVL A;  2NBV B;  1ZP0 B;  2BTE A;  3A33 B;  2BF8 B;  2BB6 A;  1E8W A;  2BKR B;  1I4R A;  3EEC A;  3KWV A;  5HHD G;  1L4Z B;  1ZUD 2;  1QIL A;  4HRO A;  1OGW A;  2FID A;  2N9K A;  4BAX A;  4II2 B;  3I3T B;  4ZRQ A;  1JQ4 A;  2KWU B;  1WGY A;  4XWT A;  2GB1 A;  4RM9 A;  2KLG A;  1TS4 A;  3Q8F A;  1EUV B;  4TUU A;  2FNJ B;  3Q6B A;  2MSE D;  3Q14 C;  4EEW A;  3N32 A;  3PZ7 A;  2AQ2 B;  2LVO A;  4XWW A;  4WJO A;  1Y56 A;  3LB8 C;  1AAR A;  1MVK A;  1YD8 U;  2GLS A;  3WIM A;  4YSY B;  2BBC A;  1GUA B;  2K9X A;  3RI7 C;  4GSW A;  2XK5 B;  4GGQ A;  3AE9 B;  1K53 A;  2KC1 A;  2B76 B;  3MJW A;  1FD6 A;  3AED B;  5CHF A;  3VR9 B;  1BXT A;  2Z8L A;  2BS4 B;  1IUE A;  2QCZ A;  1QOB A;  3AE7 B;  1RWS A;  3ZUN A;  4WWO A;  3KVF B;  5C3J B;  2W54 A;  2KWC A;  2WXJ A;  3JSV B;  1ZDX A;  4MEM A;  3R7R A;  4LK0 M;  3PGE A;  3U7Z A;  4DK5 A;  3RZF A;  3SDL C;  5T8I A;  3NUH B;  3Q3F A;  3SR6 A;  4P16 A;  1NEN B;  1TBE A;  1I35 A;  2QSD A;  3OG5 A;  3TCA A;  3N9Y C;  5FR6 A;  1SE9 A;  3IAS 1;  4P6V F;  2EKE C;  4YTP B;  3W2D A;  4WQM A;  3QAQ A;  4P7I A;  2KMA A;  1TZ1 A;  2WU2 B;  1YIW A;  4C4V A;  1VZ8 A;  1E7P B;  3I63 C;  5AEK B;  1FO4 A;  1OTR B;  4AQ7 A;  3ZRC A;  3Q8A A;  3URY A;  1FRR A;  3V62 A;  3ZNI D;  2WXO A;  4QAY A;  1MHX A;  2ZEQ A;  2BYF A;  1F1H A;  4GDK B;  2DAJ A;  3VFK A;  1KF6 B;  4ZHO A;  1L5P A;  1KH0 A;  2WDV B;  2A4Z A;  2KYW A;  3FC4 A;  1QOG A;  4LNI A;  2MRP A;  4W9H A;  4G3X B;  3ZLZ A;  4P1B C;  4A3P A;  1L0Y B;  3A9K A;  2CJN A;  3DHI C;  1C1Y B;  3E56 A;  3AM9 A;  2JVC A;  4XYC A;  4DHJ D;  2W3S A;  3ENE A;  4PS7 A;  1SEB D;  1WJ4 A;  2KFK B;  4LNO A;  4JLC A;  1B9R A;  4MSQ B;  1VD2 A;  2NS5 A;  3VDZ A;  3N1X C;  4F7Z A;  3W5U B;  3QJZ A;  3IT4 B;  4YXD B;  2GBK A;  2FCM A;  4A3O A;  1G6J A;  4WH4 A;  3ML9 A;  4K7W A;  1UF0 A;  3P2B A;  3ZRF A;  3R7Q A;  2M0X A;  3OWE B;  2L7R A;  3FKY A;  1XXG A;  3HHM A;  1N6Z A;  3APF A;  3DOW A;  2C7N B;  3AEA B;  3MC8 A;  2M17 A;  1VLB A;  2DX5 B;  1KFY B;  2CR5 A;  2O2V B;  2FCN A;  4G50 A;  1V1P B;  1NVI D;  2ZZP B;  2WS3 B;  2C7H A;  3L17 A;  1RM6 C;  4MAC A;  2JXX A;  2YEP F;  2D3A A;  1YOV B;  1HXY D;  3N1Y C;  1E0Z A;  2PKO A;  4FXC A;  2C5L C;  1TIF A;  2JXT A;  1V5O A;  2Y5P A;  4HCP B;  5IA7 A;  1WF9 A;  2Z59 B;  2SAK A;  5IP4 D;  3P4R B;  3AU5 A;  2V4I B;  4ICV A;  2WWZ A;  2MA9 B;  1LGR A;  1C77 A;  2MH7 A;  4IKG A;  1WM3 A;  4HLE A;  2O6V B;  2J4X A;  2PTL A;  2LUM A;  2K0P A;  1WXM A;  2SEB D;  4X57 B;  1H4R A;  5HG2 A;  2WGS A;  1JML A;  3WAM A;  1WGK A;  2JZP A;  3RNF C;  3PRM B;  4GN1 A;  3L4P A;  1V2Y A;  3PTF C;  1RYJ A;  3ZTC A;  2BS3 B;  1SB3 C;  1C9F A;  4RCO A;  2L76 A;  2WXQ A;  2M19 A;  2PLP A;  3ABV B;  1PGB A;  1OQY A;  4KX6 B;  2K8C A;  4K3B A;  1LXD A;  4EOY A;  5GMV A;  2BS2 B;  2CHW A;  1HZ5 A;  4XDC A;  1L7Y A;  5CHV C;  1WMH B;  1AWD A;  4LTU A;  3BVZ A;  1WX8 A;  1ZDV A;  1QQR A;  2LGX A;  2G9H D;  3HVD A;  2KTF A;  2WU5 B;  1WJ6 A;  2DZJ A;  1K8R B;  2J52 A;  3QAR A;  1YX5 B;  3AEB B;  1E8X A;  4DHZ B;  2C9W B;  2WX0 A;  3TMP B;  1EF1 A;  2K5P A;  3NZU A;  1Q0W B;  5J17 A;  4FA6 A;  1V1O A;  2NBU A;  2KVZ A;  3Q69 A;  1VZ6 A;  2BKF A;  2MJ3 A;  3RNC C;  1MJD A;  3DPD A;  3RFZ B;  1ESF A;  4Q2J A;  1LFD A;  4US8 A;  2INC C;  1E5W A;  1UZX B;  5C2T B;  4NAW A;  5EDS A;  2DZM A;  2VH1 A;  3RUI B;  4C00 A;  5KHO A;  4RMA A;  3EFU A;  1SE3 A;  1B1Z A;  3ZDM C;  4XZ4 A;  3SEB A;  3ZNZ B;  1T5X D;  2Z0D B;  2KDF B;  2M8S A;  2LVP A;  4PS3 A;  3SHQ A;  3SU8 X;  2ICI A;  1I42 A;  3EGR A;  1Q1O A;  1K51 A;  3VUY A;  4ZYS A;  3BK2 A;  2VRR B;  1FFU A;  4XGA B;  2J7Q B;  4MJS A;  1F2R I;  2L0F A;  4O1N A;  3NS1 A;  5DCN A;  1GOZ A;  5JHA A;  3NZ3 A;  2IO0 B;  2ZNV C;  3ML8 A;  4CQN A;  3LYY A;  2JUO A;  1BT0 A;  4WWP A;  1SJE D;  2HJ8 A;  1CQV A;  3KYC D;  2Z0E B;  3TEX A;  1FXI A;  3N3K B;  3PRZ A;  1TJE A;  4M8N A;  2N7J A;  3UIO B;  5J18 A;  4KZ0 A;  1UBI A;  2MHJ A;  2G1E A;  4W9J A;  4BBN C;  1IGD A;  1PGX A;  3HUI A;  3QIJ A;  1C4C A;  3ZXR A;  4WIP A;  1MI0 A;  1T3Q A;  2OOB B;  2AYO B;  3UIN B;  1FCL A;  4K1R B;  4LDT B;  3VRB B;  4OZA A;  2MJE A;  1QOF A;  3H7S A;  5AUI A;  2E3T A;  2E6X A;  4W9I A;  2I38 A;  3UF8 A;  2NPT A;  3UGB B;  3NVY A;  5G5G A;  2ZVO A;  1EM7 A;  3PRE A;  4B0M A;  1VDV A;  3U2S C;  3ZXV A;  5D6J B;  2N1W A;  3OAW A;  3X23 A;  4DDI D;  4PYU A;  3MTN B;  4JE3 B;  2LGY A;  4AUQ C;  3GB1 A;  3X0W A;  2DZK A;  1D5Z C;  2OJR A;  3AUL A;  4GDL A;  4KDI C;  4A55 A;  3N20 C;  4PS8 A;  4K7U A;  1XO3 A;  3I57 A;  1ZPS A;  4RGN A;  3QX1 A;  2MJD A;  1FNU A;  3IBE A;  1SE2 A;  4A90 A;  2PJH A;  3QWZ B;  1NI3 A;  3PLV A;  1FXA A;  2GBJ A;  1UUP A;  4F8C B;  1D4B A;  4EZJ A;  3AB5 A;  3FIL B;  3K9O B;  2QIL A;  3A1Q A;  1PUT A;  3AN1 A;  2UYZ B;  3ZYY X;  2KZR A;  4HDO A;  3OJ4 B;  3U7D A;  1ET9 A;  3W9C B;  3VXW A;  2EEL A;  5TR5 A;  1C78 A;  2AWT A;  3MJ5 A;  3AEG B;  2LHE A;  4HVB A;  1V86 A;  2EMT A;  1E6E B;  1E7U A;  4F1S A;  4OVU A;  3DCG A;  1SXT A;  3RT3 B;  3H7P A;  2DNF A;  1XCT L;  2MCN B;  1E90 A;  1SJH D;  3R2I A;  1UWX A;  2KWD A;  4ITK A;  2WXF A;  2LAS A;  3WAL A;  5IOI A;  1SF0 A;  3VR8 B;  2WXK A;  1T6B X;  2PEA A;  4KKI A;  1YMH E;  4C56 C;  3L16 A;  4II3 B;  2RD0 A;  4TV3 A;  1ROE A;  3RNE C;  2PE9 A;  2L0T A;  1DGJ A;  1N63 A;  1JWU D;  2KJR A;  3P1M A;  1ISN A;  1IBX A;  3L10 B;  1OEY J;  1YJJ A;  2ASQ A;  3RNA C;  2VZK D;  2QC8 A;  2G4D B;  4KIK B;  4KDL B;  2DBY A;  2EKI A;  2FE8 A;  3AV8 A;  1JRO A;  4LNK A;  2Y3A A;  3NRZ A;  2INN E;  2LXC A;  2KAN A;  3A9J B;  2MBH A;  2MP2 A;  2DEN B;  3EFC A;  4CHK A;  2JPH A;  2C7M B;  1H8C A;  1WSP A;  4AJW A;  1SIF A;  2KDB A;  1NI2 A;  3AEF B;  2QHO A;  1ET6 A;  2DLB A;  3IVF A;  1ZGU B;  1WM2 A;  3DBR I;  2MWS B;  2M1M A;  2KMM A;  1L6V A;  2QDF A;  2ZW1 A;  3APC A;  4EE2 A;  1P1A A;  2JY6 A;  2NTT A;  2RMM A;  5EE9 A;  4NQL B;  3RZW C;  3DVN V;  4WUR A;  1TTN A;  3AE5 B;  5IKC M;  1T0R C;  1F52 A;  5BYQ A;  1TKE A;  1ZE3 D;  4ASW C;  3CF6 E;  2LGI A;  1SE4 A;  3NY5 A;  2L3Z A;  3DHH C;  4KGT A;  3ZJV A;  2MX2 A;  1ZKH A;  3UQB A;  4C7Z A;  2JZ3 B;  2IO1 B;  2I2Y A;  1V5T A;  2V9H A;  4DBG A;  1FM0 D;  1Q5W B;  1WGH A;  1P3Q U;  2ZNV B;  5HI1 A;  1IGC A;  2ACZ B;  1UGJ A;  2JQR B;  3L0W B;  4JPS A;  2KT7 A;  3R8B A;  3VUX A;  4MGZ E;  4M0W A;  1TGZ B;  2D11 A;  1F0Z A;  1WWT A;  2DYM A;  2DZI A;  4MSM B;  3V6C B;  2V3P A;  4JX1 C;  4AOF A;  1K52 A;  5BO4 B;  5AUK A;  1L0V B;  3T3N A;  4XX5 A;  4RF0 A;  4MM3 B;  1D3Z A;  3L54 A;  4BKG A;  2RDH A;  4KGR A;  1AYF A;  2XN9 C;  2GBM A;  1C4P A;  4FJY A;  3KLS X;  2NR2 A;  2ZPY A;  1DOI A;  4EZL A;  1JWS D;  2DHZ A;  4NAM A;  4HWI B;  2LEK A;  1EU3 A;  1FFV A;  4LJO B;  1NYR A;  3PPA A;  2IGH A;  3TEW A;  4N58 A;  1J19 A;  2O2V A;  1QF6 A;  1UGM A;  4BVU C;  4ANU A;  1V1P A;  4RM8 A;  5DPT A;  1DYQ A;  4ANW A;  2IY0 B;  2WXR A;  4E71 A;  3DVG X;  5C23 A;  2LI5 A;  3BYY B;  3WAO A;  1N62 A;  2WDQ B;  2KJH B;  2W55 A;  3DBH I;  2K6D B;  2PVG C;  3QA8 A;  3PHW B;  3OLM D;  4WQO B;  5CHW A;  1PQS A;  3Q8B A;  3APD A;  3PO0 A;  1WZ0 A;  3WA0 A;  3TEY A;  1V9J A;  3O65 B;  2LGS A;  2G45 B;  2RDB C;  4BKT A;  1JRU A;  1KLU D;  1V8C A;  3N30 A;  3DBS A;  2JSV X;  4D2K A;  2IGG A;  3ZNG C;  3PZD A;  2ZCB A;  4FUL A;  5G2N A;  1UD7 A;  3Q3O C;  2IO3 B;  4LNF A;  2MQJ A;  2AX5 A;  3CMM B;  2GBN A;  3TL5 A;  4A8X C;  5IO9 A;  3UQA A;  1UBQ A;  4KV2 A;  3TJP A;  4HPL B;  2HJ1 A;  3IFW B;  2WXM A;  2KJ6 A;  2VH2 A;  1YQ3 B;  2I1K A;  3W1Y A;  3DVN U;  2BPS A;  3EA6 A;  2L32 A;  4W9E A;  3WCQ A;  2G4S A;  1LO5 D;  3KQ4 A;  2EMS A;  2N9P C;  2KHW B;  4LCD E;  2WLB A;  3Q2A C;  2D2Q A;  4RF1 A;  4C4V B;  4IG7 B;  3R2T A;  3DBR B;  2K8H A;  1GB4 A;  2KQS A;  3KW5 B;  3NVV A;  5G5H A;  5DPR A;  1WR6 E;  4PK1 A;  4YT0 B;  2WDT B;  4IWO A;  2D3G A;  4IM3 A;  2JWZ A;  1UNS A;  2V4L A;  3TBL D;  3VTW A;  2IJ0 A;  2L1A A;  1SGH A;  4L23 A;  3R66 C;  2KDE B;  2R2Q A;  3BYT B;  1RFA A;  1CMX B;  1KM7 A;  1YJI A;  5C1Z A;  4C80 A;  3EUB 2;  4NY0 A;  3A9K B;  2YLM A;  3VVW B;  4K81 A;  3CWI A;  1EF5 A;  2WYQ A;  1ZOY B;  4GLS C;  1PDX A;  1D6E C;  2Y5B B;  2V3N A;  3AE4 B;  3DWG C;  3A4S C;  1JWB D;  2JWU A;  4MDK E;  1T0S C;  1EWC A;  1P98 A;  2BYT A;  1CZP A;  3QQ8 B;  1GPX A;  1L0X B;  4MH0 E;  2LVQ A;  3DWM A;  2K22 A;  2KC2 A;  5EE1 A;  1GNU A;  4ZYN A;  1A5R A;  2LMC A;  4A6Q A;  3WAN A;  1AN8 A;  1XF5 L;  2JZZ A;  3ZO5 B;  5D2M B;  3B08 A;  4RGO S;  5E6J A;  1RRB A;  3NVW A;  2K39 A;  1TKY A;  1GC6 A;  3ALB A;  1T0Q C;  4OW0 A;  1F2R C;  2UWQ A;  3HK0 A;  4IM2 A;  5E6N A;  1WI0 A;  3N1Z C;  4FJV B;  4ZRJ A;  4DHJ B;  1N5W A;  5CX3 A;  1YX6 B;  3DQV A;  2KDM A;  4JL9 A;  3VHT C;  5DPW A;  1FNW A;  4AWJ A;  1YN4 A;  5CTR C;  3BZD B;  4RGM A;  1NEK B;  4BBN F;  3DBH B;  3AE2 B;  2KOX A;  1E10 A;  3SFD B;  3Q3N C;  4KKJ A;  3LJ3 A;  1XLQ A;  4KGS A;  4I6L B;  1QKZ A;  1X1M A;  1WX7 A;  2KLC A;  3NJT A;  1BML C;  4ARI A;  5FK9 C;  2K25 A;  1V80 A;  2KX3 A;  2JYE A;  3V3X A;  1M94 A;  1JWM D;  1WXV A;  1D5M C;  2QEJ C;  4YSX B;  2MBO A;  4BFR A;  1WYW B;  5EE3 A;  3DVG Y;  3WAP A;  4CO7 A;  4TMA B;  3GZN I;  3ZDT A;  4ZRP A;  1WY8 A;  2BVC A;  4W9K A;  5FR3 A;  2GMI C;  4RNA A;  2HTH A;  4IW0 A;  5LXH A;  2JRH A;  1FNV A;  2MW5 A;  2Q5W D;  3KUZ A;  1J7B A;  4BZA A;  4WAA A;  4FAD A;  4EUT A;  4XDD A;  2PE6 B;  1WGR A;  4CYE A;  1L2N A;  4I6P A;  3IHP C;  4AP4 C;  1OFF A;  1RAX A;  1SBB B;  1C76 A;  1MG4 A;  2NVU I;  2BYE A;  2LFI A;  1N5X A;  2LD9 A;  1WXS A;  2BWF A;  1E9M A;  2BB5 A;  2HD5 B;  2KKC A;  2LGD A;  4HEA 1;  4MGK E;  3P4P B;  2G3Q B;  3QCA A;  4OZB A;  2LRW A;  2WP9 B;  1P9D U;  1OEY A;  2JU6 X;  3KUD B;  3B1L X;  4K7S A;  3BVM A;  3PHX B;  1N61 A;  3H6N A;  1EWY C;  3ZKJ C;  3ETR A;  2DAF A;  3E9S A;  2BGF A;  3GE3 C;  1TYG B;  4FHJ A;  2RPV A;  2CHZ A;  2WXP A;  2XBB C;  1BUI C;  2IPK D;  3GOE A;  1QOA A;  4M8M A;  1MG8 A;  3ECI A;  2OJW A;  4RFB A;  4MEL A;  2WNM A;  2ZJD A;  5EE0 A;  2D3C A;  1EU4 A;  1LQB A;  3EC8 A;  3T9L A;  2K3U A;  2XEW A;  3HM3 A;  2BQQ A;  3A9J A;  3O13 A;  3HIZ A;  4MJS B;  4UDU C;  2D3B A;  4W9L A;  4LLG M;  4YTN B;  2M56 B;  3JW0 X;  3RNB C;  3EHV A;  3P63 A;  2W9N A;  2LXA A;  4IUM B;  3Q8C A;  3V6E B;  5D7G A;  1C79 A;  2MEK A;  2WXN A;  5D3D A;  2K6Q A;  2M0A A;  2J0K A;  3BK1 A;  3RD2 A;  2Y5C A;  2KDI A;  1WRD B;  2QMT A;  1I4G A;  1Z5S B;  2D5G A;  4G11 A;  2R2O A;  5KHQ A;  2KAJ A;  2N1V A;  4N59 A;  2WXL A;  2IGD A;  4JQW C;  1PFD A;  1WIA A;  2ONQ A;  4HPM B;  1I4Q A;  2KQ7 A;  2NPT B;  3PV1 A;  4IWQ A;  4GIV A;  4HXD A;  1FPY A;  1V6E A;  1NYQ A;  1QZE A;  2CS4 A;  2XK5 A;  3B9J A;  5LLI A;  2KTR B;  4IWP A;  1XLN A;  4S17 A;  2NBW B;  4W9C A;  2ZPN A;  3SFE B;  1KLG D;  2REX A;  5LXI B;  4RH6 A; 
#chains in the Genus database with same CATH homology
 2PTL A;  5JXV A;  1FFV A;  1FEH A;  2LUM A;  1NYR A;  1XCQ L;  2JX5 A;  2K0P A;  2SEB D;  5HG2 A;  2WDR B;  1I4H A;  4PT5 A;  2KN4 A;  2IGH A;  3TEW A;  1FCC C;  1JCK B;  1JML A;  1WGK A;  1YN3 A;  4N58 A;  3U4E G;  3MP9 A;  4GDL B;  1QF6 A;  2JZP A;  4ZHP A;  1L4D B;  1RFK A;  1YQ4 B;  2FUG 1;  3L4P A;  1V1P A;  5BMI A;  1ENF A;  1RYJ A;  2BS3 B;  2HDE A;  1DYQ A;  1SB3 C;  3LXF A;  4RCO A;  1C9F A;  4TSS A;  1Q10 A;  2WXQ A;  2M19 A;  2WXR A;  2PLP A;  1YNT E;  3ABV B;  1PGB A;  3AMZ A;  1WYG A;  4L1B A;  1TZO A;  3BYY B;  4HJG E;  1N62 A;  5BYR A;  2WDQ B;  5BMG A;  1AW7 A;  1ZXI A;  4KX6 B;  3AEE B;  4DXF A;  2BS2 B;  2BW2 A;  1HZ5 A;  1QT9 A;  2W55 A;  4XDC A;  2PVG C;  1AWD A;  4LTU A;  4NAW B;  3Q8B A;  2IDY A;  4OHJ A;  3PO0 A;  3BVZ A;  1K50 A;  1ZDV A;  1QQR A;  1HA5 A;  2G9H D;  3AE8 B;  4C7Y A;  3HVD A;  3IAM 1;  3CIR B;  3TSS A;  4WAF A;  3TEY A;  2W3R A;  2WU5 B;  2INP E;  2J52 A;  1M4V A;  3IXS A;  3AEB B;  1GAQ B;  2X38 A;  1KLU D;  1V8C A;  2NMQ A;  1V97 A;  2K5P A;  2JSV X;  5D3I B;  4D2K A;  1OQR A;  4DXG A;  1V1O A;  2J53 A;  2IGG A;  2PMV A;  2CJO A;  3ZJT A;  3Q69 A;  1VZ6 A;  2MJ3 A;  5MPO A;  1JW9 D;  1JRP A;  3RFZ B;  2AQ1 B;  2AX5 A;  1ESF A;  4Q2J A;  3UI3 A;  2WQY B;  1SIJ A;  4US8 A;  5C2T B;  4A8X C;  1QLB B;  1VRA B;  4JWS C;  4WWM A;  4N6E B;  4YSZ B;  1JAL A;  4IOI E;  2PW9 A;  1D5X C;  1SE3 A;  1B1Z A;  1STE A;  3SEB A;  3GP7 A;  1T5X D;  2BT6 A;  5BMH A;  3VRA B;  1P7F A;  2H89 B;  2NTS A;  2PVO D;  2WXM A;  4NJC A;  3RPF C;  2V0G A;  1YQ3 B;  1VZ7 A;  4ZOH C;  2TSS A;  2ICI A;  3EA6 A;  1FRD A;  5H92 C;  2L32 A;  3TUO A;  3W1S A;  4A9A A;  1IBX B;  3WCQ A;  1LO5 D;  3HVZ A;  3EGR A;  3KQ4 A;  2AQ3 B;  4HKZ E;  1K51 A;  2KQ4 X;  2WLB A;  3AE1 B;  4ZYS A;  4USA A;  4RF1 A;  3AH7 A;  3BK2 A;  1XLO A;  1J7C A;  3R2T A;  4OZC A;  1FFU A;  1FIQ A;  1GB4 A;  3NVV A;  4DQO C;  5G5H A;  1OQQ A;  3BWU D;  1F2R I;  4YTM B;  4YT0 B;  4O1N A;  3NS1 A;  1GOZ A;  4RGT A;  3NZ3 A;  1UNS A;  2WXI A;  4CQN A;  2CU3 A;  3P4Q B;  3LYY A;  3TEZ A;  2IJ0 A;  2L1A A;  1SJE D;  1CQV A;  1F77 A;  2YEP B;  1I4X A;  4L23 A;  1FXI A;  3TEX A;  4L2Y A;  1TJE A;  2ZW0 A;  2N7J A;  3BYT B;  1TY2 A;  1N60 A;  2G1E A;  1YJI A;  5LNK 1;  4AS1 A;  1IGD A;  4C80 A;  1PGX A;  2DWQ A;  3EUB 2;  4TQ1 A;  1TS5 A;  2R61 A;  3HUI A;  1DOX A;  2N9L A;  1C4C A;  2OED A;  1CJE A;  4WIP A;  1MI0 A;  1T3Q A;  1YN5 A;  1FCL A;  3VRB B;  3CWI A;  4OZA A;  2MJE A;  2W82 A;  1QOF A;  1WRI A;  3W5V B;  1ZOY B;  3P4S B;  5AUI A;  1MHH E;  2QJL A;  1CK1 A;  2E3T A;  2E6X A;  3B2F A;  4GLS C;  4XE0 A;  2I38 A;  1PDX A;  2VZK B;  1D6E C;  1P7E A;  2V3N A;  2KAC A;  3AE4 B;  3DWG C;  2GRI A;  4MH8 A;  3NVY A;  4HKQ A;  3I9V 1;  1JWB D;  5G5G A;  2JWU A;  1EM7 A;  1ZP0 B;  2BTE A;  1EWC A;  3P42 A;  2BB6 A;  1ZXH A;  4B0M A;  2BYT A;  1VDV A;  3BVG A;  1I4R A;  1CZP A;  2J42 A;  1VR9 A;  4US9 A;  3KWV A;  1L0X B;  5HHD G;  3BII D;  1L4Z B;  1ZUD 2;  1GPX A;  1QIL A;  3U2S C;  4J3O D;  3VQI A;  3DWM A;  1TS2 A;  4HRO A;  1C4A A;  2K22 A;  2N9K A;  4JE3 B;  5EE1 A;  3FAH A;  3GB1 A;  1KTK A;  2WXG A;  2LMC A;  4A6Q A;  1D5Z C;  1AN8 A;  3ZQ4 A;  4A55 A;  1XF5 L;  1XO3 A;  3I57 A;  4JWU C;  1I4P A;  1ZPS A;  4RGN A;  2N0S B;  4RGO S;  5E6J A;  2MJD A;  1FNU A;  3NVW A;  1SE2 A;  3IT6 B;  4ZRQ A;  4A90 A;  4NZL B;  1JQ4 A;  1TKY A;  3MC0 B;  1NI3 A;  3U52 E;  4XWT A;  2GB1 A;  4OW0 A;  1FXA A;  3Q8F A;  1TS4 A;  1F2R C;  1TKG A;  1UUP A;  1D4B A;  1N5W A;  3C8Y A;  3AB5 A;  3PZ7 A;  3FIL B;  2QIL A;  2AQ2 B;  1PUT A;  3AN1 A;  3ZYY X;  4XWW A;  5I4D A;  1Y56 A;  2KDM A;  3LB8 C;  2LHD A;  3ZGZ A;  3J9C A;  1FNW A;  1ET9 A;  1MVK A;  4YSY B;  2BBC A;  3W9C B;  1YN4 A;  2K9X A;  3AE3 B;  2EEL A;  2QIE B;  3BZD B;  4RGM A;  1WXQ A;  1NEK B;  3AE9 B;  1K53 A;  3AE2 B;  1C78 A;  2B76 B;  1E10 A;  3SFD B;  3MJ5 A;  1FD6 A;  3AED B;  3AEG B;  4KKJ A;  1XLQ A;  2LHE A;  4KGS A;  1PGA A;  1QKZ A;  3VR9 B;  1E6E B;  1BXT A;  2Z8L A;  2BS4 B;  1BML C;  4ARI A;  5FK9 C;  1IUE A;  1SXT A;  3MFG A;  1ACC A;  1QOB A;  3AE7 B;  5BYS A;  2JYE A;  3V3X A;  1RWS A;  1FMA D;  3V05 A;  1JWM D;  4B0E A;  2HTM E;  3MHZ A;  1D5M C;  1UWM A;  1XCT L;  5C3J B;  1SJH D;  2W54 A;  2QEJ C;  3R2I A;  2WXJ A;  5GXG B;  4YSX B;  1UWX A;  2KWD A;  1ZDX A;  4OVZ A;  4LK0 M;  5EE3 A;  1TS3 A;  4ITK A;  2ON8 A;  2WXF A;  3U7Z A;  1SF0 A;  3VR8 B;  2WXK A;  4TMA B;  5T8I A;  3NUH B;  1T6B X;  4ZRP A;  3SR6 A;  4P16 A;  5FR3 A;  1NEN B;  4KKI A;  1YMH E;  4RNA A;  4C56 C;  1A70 A;  2QSD A;  1FNV A;  2Q5W D;  3HRD D;  1J7B A;  1ROE A;  3N9Y C;  3IAS 1;  4XDD A;  4P6V F;  4YTP B;  1DGJ A;  1N63 A;  1JWU D;  3GS2 A;  3W2D A;  3P1M A;  4WQM A;  1IBX A;  1OFF A;  1SBB B;  1SSN A;  1HZ6 A;  2WU2 B;  1VZ8 A;  1E7P B;  1C76 A;  1YJJ A;  2VZK D;  1FO4 A;  2DBY A;  2EKI A;  2FE8 A;  2LFI A;  1N5X A;  4H2A A;  4AQ7 A;  3B2G A;  3AV8 A;  1XLP A;  1JRO A;  1E9M A;  5H8Y E;  2BB5 A;  2Y3A A;  3NRZ A;  3Q8A A;  2INN E;  3URY A;  1FRR A;  4YWG G;  2DYO A;  2WXO A;  4HEA 1;  2WXH A;  1MHX A;  3P4P B;  4GDK B;  1KF6 B;  4OZB A;  4ZHO A;  1L5P A;  2WP9 B;  1KH0 A;  2WDV B;  2JU6 X;  1JWA D;  1WSP A;  2LJI A;  1QOG A;  1MPE A;  3FC4 A;  1HQR D;  2XNA C;  3BVM A;  5HFY A;  1N61 A;  3Q8E A;  4IDI A;  1EWY C;  1TY0 A;  3AEF B;  4ARC A;  1I7H A;  1ET6 A;  3ETR A;  2DLB A;  1L0Y B;  3E9S A;  2CJN A;  1TYG B;  2KMM A;  4MT5 A;  1HEZ E;  1L6V A;  2RPV A;  3E56 A;  2ZW1 A;  2WXP A;  3AM9 A;  1BUI C;  2IPK D;  4EE2 A;  3H8H A;  2NTT A;  2W3S A;  2RMM A;  5EE9 A;  1QOA A;  1SEB D;  2L83 A;  4TQ0 A;  4WUR A;  1B9R A;  4RFB A;  2WNM A;  5EE0 A;  3AE5 B;  1EU4 A;  5FKA C;  2K3U A;  5BYQ A;  3W5U B;  3O13 A;  1GB1 A;  1TKE A;  3IT4 B;  4YXD B;  4UDU C;  1ZE3 D;  2JYT A;  3NVZ A;  4LLG M;  3AE6 B;  2LGI A;  2OHF A;  4WH4 A;  4YTN B;  1SE4 A;  2M56 B;  4KGT A;  3P63 A;  3ZJV A;  3OWE B;  3ZJU A;  3Q8C A;  4C7Z A;  4HRS A;  1XXG A;  5D7G A;  1C79 A;  2I2Y A;  1FM0 D;  2MEK A;  2WXN A;  5D3D A;  2M0A A;  5HI1 A;  1IGC A;  2ACZ B;  1XEE A;  3AEA B;  1UGJ A;  3BK1 A;  2JQR B;  3KWL A;  1VLB A;  4JPS A;  1KFY B;  3R8B A;  1J7A A;  4M0W A;  2Y5C A;  2FBW B;  1V1P B;  1F0Z A;  1NVI D;  1I4G A;  2QMT A;  1WWT A;  2DYM A;  2WS3 B;  2D5G A;  4MAC A;  1RM6 C;  1DOY A;  2YEP F;  3FIL A;  5TSS A;  1HXY D;  2KAJ A;  2V3P A;  4JX1 C;  4N59 A;  1K52 A;  2IGD A;  2RDG A;  2WXL A;  1E0Z A;  1PFD A;  2PKO A;  2L52 A;  5AUK A;  1L0V B;  2ONQ A;  2PIA A;  4FXC A;  3T3N A;  1PYW D;  2GI9 A;  1I4Q A;  1L6U A;  2JXT A;  4R3D A;  1VJK A;  4MM3 B;  4RF0 A;  2Y5P A;  1KRH A;  3T3O A;  2RDH A;  3AEC B;  4KGR A;  1AYF A;  1NYQ A;  2XN9 C;  2SAK A;  3B9J A;  1C4P A;  3P4R B;  2H88 B;  3KLS X;  1R7S A;  1DOI A;  1XLN A;  1JWS D;  2V4I B;  4REZ A;  2MH7 A;  1C77 A;  3SFE B;  4NAM A;  1KLG D;  4IKG A;  3PZ8 A;  2LEK A;  1EU3 A;  4RH6 A;  2J4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...