1IBXA

Nmr structure of dff40 and dff45 n-terminal domain complex
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
81
structure length
81
Chain Sequence
MLQKPKSVKLRALRSPRKFGVAGRSCQEVLRKGCLRFQLPERGSRLCLYEDGTELTEDYFPSVPDNAELVLLTLGQAWQGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of DFF40 and DFF45 N-terminal domain complex and mutual chaperone activity of DFF40 and DFF45.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords DNA FRAGMENTATION FACTOR 40
total genus 8
structure length 81
sequence length 81
ec nomenclature ec 3.-.-.-:
pdb deposition date 2001-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1ibxA00
2KDMA 1QKZA 2OEDA 2I2YA 1MVKA 1FCCC 4WH4A 5HI1A 1HZ6A 1YNTE 2I38A 5BMHA 1PGXA 2LGIA 2K0PA 2IGDA 1XF5L 4GLSC 3V3XA 4IOIE 1IBXA 2PLPA 2N9LA 2LHDA 3UI3A 2JXTA 3GB1A 2JWUA 5JXVA 1D4BA 2KACA 1IGDA 2IGHA 1K53A 1IBXB 3FILB 4HJGE 1HZ5A 5HG2A 1FCLA 2EELA 2QSDA 2KN4A 1GB4A 1MI0A 2N7JA 2GI9A 1K51A 1P7EA 1PGBA 1K52A 4OZAA 2PTLA 1EM7A 2JU6X 4IKGA 2ONQA 1YMHE 1MHHE 1Q10A 2NMQA 1K50A 1GB1A 2QMTA 2RPVA 3FILA 1ZXHA 3MP9A 1C9FA 1KH0A 1XCQL 5HHDG 5BMGA 5BMIA 1MHXA 1IGCA 1UWXA 4KGRA 2JZPA 1PGAA 4OZCA 2N9KA 2LHEA 2KWDA 2ZW1A 4KGTA 2PW9A 4D2KA 4MACA 1XCTL 4KGSA 1HEZE 2ZW0A 1F2RC 4HKZE 1FD6A 4OZBA 5HFYA 2J53A 1F2RI 2GB1A 1P7FA 2KQ4X 2IGGA 2J52A 1JMLA 2LUMA 2RMMA 2ON8A 2JSVX 1MPEA
chains in the Genus database with same CATH superfamily
4NJ6A 4DQOC 3LJ3A 1WX7A 1TY2A 2CHWA 2OJWA 2K3UA 1PQSA 2QIEB 2V0GA 3OAWA 1WYGA 2LXAA 4RMAA 4HXDA 2KANA 2SAKA 2INNE 4GLSC 1BT0A 2N9EB 1KLVA 4EZLA 5LLIA 2KLCA 4HROA 3NVVA 2JWZA 2PKOA 3A9KA 2V3PA 3W1YA 2EMTA 2JF5A 3NZUA 1LGRA 2WXJA 3MHSD 4MGIE 1CMXB 3AE4B 2N7JA 2WS3B 3ZQ4A 3KUDB 3AECB 1EM7A 2M0AA 2KC1A 4OW0A 2CU3A 3H1UA 2ZPYA 1V2YA 4WQOB 2KT7A 2GOWA 2KVZA 2QC8A 1OTRB 2KXJA 1WXSA 1WRIA 1FMAD 3APDA 1WR1A 3W1SA 1V97A 3TEXA 4GDLB 4PYZA 4FHKA 2N1VA 1SIFA 1I7HA 2LGSA 3V60A 2KDBA 2BYEA 1FNUA 2M4NA 1UZXB 1FXIA 3K9OB 4R3DA 5BYSA 1KRHA 4LNOA 1H8CA 1YQ4B 4RNAA 3AE6B 3PO0A 2IPKD 2ASQA 2BWFA 3ZTCA 1V1PB 1ZW7A 5G5GA 1R7SA 3MFGA 2RMMA 1FRRA 2HDEA 3CSFA 1WGRA 3JSVB 1UD7A 3QC8B 4S0RA 1L0XB 3U2SC 2J4XA 2IJ0A 3LXFA 2KMAA 3PRZA 1F77A 3TJPA 3AE3B 3V6CB 1VRAB 3DQVA 1KM7A 3HM3A 4LTUA 4US9A 1L0YB 2KDIA 2OHFA 4ZDVA 4XWWA 3VAWA 3UI3A 3E56A 1WGYA 4IG7B 1N60A 5DPSA 2KFJA 1RM6C 4C7ZA 4A3OA 2BBCA 4F1SA 4II2B 4K81A 2LGXA 2KTFA 3N3KB 2WXLA 1FIQA 2RR9A 2KC2A 4REZA 3AH7A 1CJEA 3RNGC 4N9F4 2IO2B 4O1NA 2ONQA 4BAXA 3MTNB 1WWTA 4JGHB 4WAAA 5AUKA 2LASA 2MCNB 4PT5A 2RPVA 4I6NB 3VUXA 3QK0A 4FHJA 4HEA1 3VRBB 1FO4A 4C4VA 1ZXHA 2GLSA 4BFRA 2L0FA 5D3DA 2MJEA 2GBKA 5BMIA 3EHVA 4M8MA 2XBBC 2A4ZA 3SDLC 2EMSA 3PLUA 4W9CA 3KWLA 4WWMA 3HM6X 5J2RA 3NVWA 2DLBA 5JHAA 1MFWA 3NZSA 1JCKB 2WU5B 3D32A 4WWNA 3NG0A 3KWVA 1C76A 3AI5A 2YEPF 3ALBA 1QOAA 2VH1A 1LM8B 4WJNA 5EE1A 1GAQB 5L95C 2JSVX 2AEHA 2KDMA 2QJLA 2OEDA 2HJ8A 3IBEA 4M0WB 2N0SB 3PZ8A 3RULA 2OJRA 2W55A 1Q5WB 4YTPB 3MHZA 1YNTE 1OQQA 1ROEA 2X38A 2K0PA 2PVGC 1IUEA 3RI7C 4BKGA 3DWGC 2KWVB 4G11A 3UQAA 1HTOA 2LI5A 3VFKA 4ACFA 3TBLD 3NHEB 4ITKA 4RH6A 4C4VB 2LRUA 2DZJA 2MSED 1WE6A 4HCPB 1B1ZA 4JX1C 4J3OD 2D3AA 1VZ6A 4M00A 3TSSA 1R4MI 4N58A 2IY0B 4RF1A 4IW0A 4IKGA 1WGKA 4IWQA 4YL8A 1GB1A 1EU4A 4LDTB 1P1AA 1QOFA 2ZCCA 3VH4B 2X8XX 3ZNGC 4KSLC 2BGFA 3AEAB 4MH0E 1OQRA 2JRHA 1DOYA 4KGRA 3U30A 2MH7A 4AJYB 4ZRPA 1J7AA 3I9V1 1OEYA 2HJ1A 2K1FA 5FR6A 4FJYA 4BKTA 2JUOA 2M17A 4HPLB 3NUHB 2RD0A 3ML9A 3DBRI 3Q8CA 2LUMA 4NJ7A 3CMMB 3ZNID 4EEWA 1F1HA 3VDZA 1SXTA 2DX5B 4CQNA 4HK2A 1TKYA 4WH4A 1IP9A 3FAHA 4IM0A 3WA0A 4KKJA 4ZHPA 5C23A 3WAMA 1I4GA 2C9WB 2KVRA 1WMHA 4LK0M 4ZRIA 2MQJA 3KW5B 3Q69A 3BYYB 4W9DA 2FUG1 2PJHA 3KYCD 2HTME 3RZFA 3VH3B 3DVNU 3N1YC 3IT4B 1D5XC 4WURA 2KHWB 2N1WA 4HCNB 1E10A 4FLHA 3KUCB 2KD0A 1WE7A 2VH2A 3VXWA 1SSNA 2KJRA 4MM3B 2LFIA 4K7WA 1I4PA 1WGDA 2DNFA 1E0ZA 3A9KB 3RT3B 1YJJA 4WJPA 2IDYA 3IAM1 4DDGD 1AW7A 1KH0A 2G9HD 1T0QC 3H8HA 1R4MB 4HVBA 1D5MC 1QT9A 2K39A 2MBHA 2XK5B 1QQRA 2KK8A 1ZGUB 4JLCA 1E5WA 3RYTA 3ZW3A 4D2KA 3PHXB 4RCOA 1VD2A 2WNMA 2FNJB 4TSSA 2MW5A 3DHIC 1UUPA 1WMHB 1TZOA 1UH6A 3BVZA 2KWCA 1F0ZA 1Q1OA 3H7PB 1JW9D 2YEPB 2H89B 3AE7B 4GDLA 4RM9A 4NY0A 4DXFA 4ANWA 2JY6A 2I2YA 1MVKA 2NTSA 2WGSA 3Q8BA 3ZIMA 5H92C 2R61A 1V49A 3UF8A 3V62A 2RGFA 2UWQA 2LRWA 3SHQA 3ZLZA 4EOYA 4ZRKA 2AYOB 3V3XA 3IHPC 2PPHA 1XO3A 1SEBD 1CK1A 4NQLB 4AP4C 1NYRA 1GJZA 4TMAB 5EE9A 3AM9A 4DK5A 3A33B 2PIAA 2GI9A 1K51A 2AL3A 2W9NA 3T3OA 1KLUD 1MHHE 1IYFA 4PS3A 3AE1B 4YWGG 3VUYA 4LNFA 3HVDA 2L00B 1TZ1A 3QJZA 1B9RA 4L2YA 1WJ4A 3M95A 2FIFA 1GNUA 1HA5A 2KO3A 3NVZA 3NOBA 1TKGA 3H7PA 5JH5C 1MHXA 1QOGA 4HDQA 4OVUA 1J8CA 3L4PA 2LVOA 3Q14C 1KOTA 2AQ1B 1C3TA 4OZCA 1EWYC 3R66C 1WXQA 4KGTA 1KJTA 2WXGA 4LCDE 2GBRA 4JQWC 1K8RB 1OGWA 2KOXA 4KGSA 3V61A 1LXDA 2LWPA 2WXFA 2FIDA 3ZTDA 3BWUD 4EZKA 2K5PA 2Y5BB 4GB9A 1ZUD2 1FXTB 4HRSA 4ASWC 1OEYJ 3B0AA 5EDSA 2E3TA 4DWFA 1JALA 3M3JA 3L17A 2DYMA 4YSZB 1YD8U 1MPEA 2J0KA 2FCMA 3Q3FA 2KX0A 3PGEA 1ESFA 1QILA 2AX5A 3AV8A 4HJKA 2V9HA 3UINB 1D6EC 3SFDB 1JWAD 1JROA 4WIPA 3PZDA 2NBUA 1V8CA 2V1YA 2KNBA 2O2VA 2NS5A 4KIKA 2Y3AA 2WLBA 1RAXA 3TIXA 4M02A 2H88B 2O6VD 2DZIA 3X0WA 1IBXB 1L4DB 1DGJA 2LMCA 4JL9A 5FKAC 3VQIA 1P3QU 1L6VA 4BKSD 4A90A 2W3RA 2DHZA 2WXNA 1N5WA 3CF6E 2MBEA 4XC2A 3BVGA 1MG8A 2ZVOA 4ZHOA 1TTNA 4S17A 4RGTA 3AEEB 4IC7B 2W82A 2D3CA 2C7MB 4XDCA 3A4RA 1AARA 1L4ZB 2BVCA 3GOEA 3KLSX 4A55A 5CTRC 3RCZA 3SR6A 3AU5A 5FK9C 5AEKB 1NEKB 4KDLB 1YQBA 3R7QA 2KWDA 2LVQA 1VZ7A 3DVGX 4HPMB 3NJTA 2IZVB 2REXA 3L13A 4MH8A 2UU7A 3ZJVA 1V5TA 4ARIA 3AMZA 1EU3A 4K3BA 5HFYA 1YOVB 2LVPA 2D3BA 3QA8A 2BS4B 1IPGA 1C1YB 4KDIC 2DZKA 3RZWC 3H6NA 1V81A 4DXGA 1SE3A 4ICVA 2MHJA 1F52A 3Q6BA 4XGAB 2LZ6A 4K1RB 4TKNA 3IAS1 2Q5WD 3ZDMC 1GC6A 3UGBB 4BOZB 3VVWB 3W5UB 4NAWB 3MJ5A 1WM2A 4JE3B 1N61A 2ZPNA 1M4VA 2BB5A 4WWPA 4GOCA 4AJWA 2PLPA 2ZJDA 3QQ8B 2HE7A 2WU2B 4GDKA 2WXMA 4WQMA 2I1JA 5C2TB 2JXXA 2DYBA 5HG2A 1E7VA 4RGMA 3R7RA 1STEA 2D2QA 4NQKE 5KHQA 4GMVA 3AEGB 1PGBA 5E6OA 2NBVB 2JU6X 3ML8A 4XE0A 5CHWA 4HDOA 2D10A 2K6QA 1PFDA 3N32A 3L54A 2WQYB 1G6JA 1L2NA 2EKIA 4AOFA 5EE0A 5HKHA 5TSSA 3PLVA 2A5UA 4CYEA 2XK5A 3QWZB 1KFYB 2MEKA 5JHBA 1YX6B 2PEAA 1C4PA 4GU2A 3AEDB 3GE8C 1S1QB 4A20A 3UIPB 1L6UA 3AE2B 4MACA 3ZJUA 2KLGA 4TQ0A 3BINA 5L83A 1H4RA 2J42A 2WXRA 3QAQA 1FEHA 4AUQC 2K9XA 1V80A 2L1AA 2LD9A 4DBGA 2KN5A 3AN1A 3TUOA 3LB8C 1VLBA 5G2NA 1WYWB 2KQ4X 3S2AA 1T0YA 2KFKB 3EGRA 4DHZE 1FPYA 2KQSA 4W9LA 1PYWD 2FAZA 3BK2A 3ZKJC 3QIJA 3B1LX 1FXAA 4ICUA 2PMVA 4CHKA 1WZ0A 5HI1A 3Q8AA 1MJDA 4YTNB 2TSSA 4ZOHC 2JZ3B 3RNCC 4K7SA 3P4SB 3U7DA 5BMHA 1CQVA 3AXCA 3U8ZA 2DZMA 2IGDA 1NVID 3ONSA 4UDUC 5DCNA 3DBRB 3QARA 1TS5A 3ECIA 5H8YE 4A3PA 2JWUA 4PS7A 2KACA 1IGDA 1EO6A 1E8ZA 2J0JA 1HZ5A 2N7DA 2B76B 2UYZB 2K8BA 4KZCA 1N6ZA 4W9IA 5EE3A 2KX3A 4X57B 2R2QA 1P7EA 3E9SA 4LNKA 1ENFA 1LFDA 2XNAC 3AE8B 3KQ4A 4MGZE 2D07B 3DCGA 2G4DB 3C8YA 4ANXA 4W9EA 1MG4A 3DHHC 4C00A 2M19A 4YXDB 2M8SA 5HHDG 5BMGA 2INPE 3WIMA 4GXBA 2K22A 2JZPA 3EFCA 5D6JB 4ARCA 2MBQA 2JQRB 4NZLB 2YVCA 1QF6A 2QHOA 4BKSA 3L08A 1XXGA 5AZHA 1UGMA 4NAMA 3VUWA 1FD6A 3DBLB 3OLMD 4XDDA 1V1PA 2M56B 3URYA 1P0RA 1D3ZA 4BBNF 3R2TA 3BY4B 3Q3MC 1RLFA 1WRDB 2C7NB 3AE5B 3O13A 1J7BA 3I63C 2DWQA 2OOBB 4NNJB 1I4QA 3KYDD 2K8HA 2WDRB 1P9DU 2I38A 1ZOYB 4B6WA 1UELA 4KIKB 1T5XD 4C80A 1XF5L 2NVUI 4GGQA 3JW0X 1KF6B 4DHZB 1GOZA 2DAFA 1IBXA 1ISNA 3SEBA 2JXTA 2BYVE 4G0NB 4HKQA 5DPRA 2MP2B 1JWUD 3HUIA 4WJQA 4BBNC 2WXOA 4MJSB 3DWMA 2G3QB 1FFVA 4K7UA 3I3TB 4EKUA 5GXGB 3NS1A 3ZXVA 2GRIA 4GSWA 2RDHA 1VR9A 1NDDA 2LEKA 1GB4A 2VRRB 1C77A 4YT0B 3EUB2 4G50A 2O2VB 4FJVB 2HTHA 1XLPA 1K50A 3DBSA 3ZO5B 4FA6A 1Q0WB 2G4SA 2DAJA 4RM8A 2N7EA 4FADA 4MDKE 3MP9A 1XCQL 1TY0A 2RPQA 1E6EB 2ZNVB 1VCBA 3H9DA 1YIWA 3AEFB 3EFUA 2DENB 2M0XA 1FM0D 4YTMB 2Z0DB 2LHEA 2PW9A 3RNBC 3GZNB 3WANA 2LGDA 2WXQA 4HKZE 2XEWA 2HD5B 3L16A 3DBHB 1U4AA 2FCSA 2XN9C 2LXCA 3B9JA 2V4LA 2I1KA 4M0WA 3BK1A 3EC8A 2EKEC 2ON8A 4RGNA 1QKZA 2ZNVC 2WWZA 4USAA 2ZVNA 4HPPA 3BVMA 2WHIA 5IAAC 1UGJA 3B2GA 1WXMA 1Y56A 3N20C 1GPXA 3VTWA 2BYFA 1FFUA 2DYOA 2JX5A 2JYEA 3RUIB 1ACCA 2J7QB 1AN8A 1YN3A 5AZGA 3FKYA 2LHDA 2BYTA 3ZNHB 3DHGC 3A9JA 2D5GA 2Y5CA 3HIZA 2RDGA 2IGHA 4KV2A 2GBJA 2GBNA 1EWCA 1LQBA 5T8IA 3Q2AC 3W9CB 1JWSD 2EELA 2FUHB 4AWJA 5E6JA 4MSMB 2LJ5A 5LXIB 2IY1B 4P16A 4XX5A 3VR9B 1M94A 1ZPSA 2QMTA 3ZGZA 3W5VB 4WJOA 5IN7A 1V9JA 3DOWA 1N63A 2WX0A 5G5HA 4MELA 2Y5PA 1UBQA 3AULA 2JT4B 2NCNA 3ABVB 2KZRA 2G45B 2MJDA 1JWBD 4B0EA 4H2AA 2N9KA 2ZW1A 2L8JA 2JVCA 5BYRA 1KTKA 3PPAA 1OFFA 4YSYB 5LXHA 2PE9A 4GIVA 4LNNA 1F2RC 3ENEA 4ZYNA 1XLOA 1XQQA 1L0VB 1I42A 1L5PA 2YLMA 3C0RB 4FXCA 2CHXA 3PV1A 3CSTA 3ZJTA 1RYJA 2QDFA 4II3B 1E8XA 5CHVC 4FBJB 2E6XA 3Q3JA 3B2FA 2WDTB 1A70A 4NPNA 4M01A 2ICIA 3AE9B 5J17A 3P4RB 3QX1A 3NVYA 4OVVA 3SFEB 1HTQA 1XEEA 2N4FA 3V6EB 1QLBB 1C4AA 4KZ0A 1WH3A 1RWSA 1Y8RC 1XLNA 2KJ6A 2LGIA 1WJUA 3N9YC 3Q8FA 5IOIA 3ZUNA 4W9FA 3HHMA 3OJ3A 3T9LA 3R3MA 5JXVA 3TEWA 3B08A 4FJZA 1SE9A 1J19A 3DBLI 5DPWA 1VZ8A 3GP7A 1WXAA 1Z5SB 3M62B 3OJ4B 4IWPA 1BMLC 4XZ4A 2BKRB 4JWSC 2V4IB 1FRDA 2KDFB 5FR3A 4IUMB 4W9KA 3PRMB 5BO4B 1VDVA 1JRPA 1EUVB 4P1BC 1ZKHA 4TUUA 4ANVA 2PE6B 3PTFC 3MC0B 1V86A 1WY8A 3PVLA 4L23A 1JQ4A 3O65B 1ZDXA 4W9JA 1WGGA 3P42A 2ZCBA 1I35A 4LDTD 1WGHA 5G55A 2J53A 1N62A 2MX2A 1FNVA 3VRAB 4MGYE 3TEZA 3EECA 3HK0A 4KX6B 2RSUA 4ZRJA 5BYQA 1WM3A 1OQYA 4JIOU 2Z59B 4JWUC 2L32A 2Z0EB 4K3CA 2V3NA 1E90A 1PGXA 1TKEA 2CHZA 3DVNV 3U4EG 3VTUA 1WX8A 2QCZA 3GS2A 1T0SC 1E7PB 4MJSA 4B95A 2NTTA 3N1ZC 4OHJA 1YQ3B 3PRPB 2GBMA 1CZPA 4I6LB 1WI0A 2AL6A 2M1MA 2MLBA 3VHTC 4BVUC 5IP4D 2ZZPB 4A8XC 1DOXA 1T3QA 4QAYA 1K52A 3QCAA 4OZAA 2PTLA 5DPTA 4PK1A 2C60A 1YMHE 2BW2A 1A5RA 1EF5A 2B3AA 2LJIA 3WALA 3PS6A 1NYQA 1YJIA 1YN4A 3ETRA 5CHFA 3R2IA 5LNK1 1SF0A 3J9CA 1NI2A 4HWIB 3L10B 5I4DA 2CU1A 4WWOA 1WJ6A 1FNWA 2R2OA 5GMVA 2KWUB 1ZDVA 2Z8LA 1PGAA 1WXVA 3C19A 3ZRFA 2BTEA 3N30A 3P4QB 1C4CA 1SJHD 3LYYA 1N5XA 2ACZB 4OZBA 3RNEC 3WAOA 4US8A 4ZRQA 2IGGA 2J52A 1JMLA 1GUAB 2KTRB 1WR6E 5IO9A 4I6PA 2BWES 5KHOA 4LJOB 1FCCC 2L7RA 3UQBA 3ZYYX 1TS4A 2ZEQA 2K8CA 4MEMA 2BF8B 3W2DA 1YN5A 3RPFC 4AS1A 3IFWB 3ZDTA 1XD3B 1PUTA 3IVFA 1ZP0B 2MRPA 2WYQA 3W1SC 1BXTA 4J6IA 4ANUA 3IT6B 5IA7A 2L76A 3PHWB 3R8BA 4KSKC 3WAPA 3P1MA 1D4BA 2C5LC 2O6VA 3LDZE 5IKCM 2SEBD 2IO3B 4XWTA 2KYWA 3IG3A 3P63A 1TIFA 2MBOA 1V1OA 1ZE3D 4EUTA 5D3IB 3NY5A 2AQ2B 3GZNI 1V6EA 4OVZA 2G1EA 2PVOD 1Q10A 3SU8X 2NMQA 3A9JB 4MM3A 1SJED 3HVZA 3BYTB 4B9KA 1DOIA 1SE2A 2WX1A 4ZYSA 4N59A 4LLGM 1I4RA 3DBHI 2NPTB 1X1MA 4EZJA 4FULA 3I5JC 5C1ZA 4KVGB 4IWOA 4E71A 1WSPA 3Q3OC 4KKIA 3RMKC 1JRUA 1TJEA 4G3XB 3NRZA 1R4NB 3ZXRA 3NZ3A 1T0RC 2O6VB 4F7ZA 3ZVVA 4NAWA 5J18A 2MBBB 5AZFA 4C7YA 5D94A 2J0MA 1V5OA 2NR2A 1J7CA 3T8MA 3TL5A 1SB3C 3ZRCA 4F8CB 3Q8EA 4IOIE 1TS2A 3I57A 4GN1A 3GB1A 2L83A 2AWTA 3U7ZA 2KQ7A 2INDC 2L3ZA 2GMIC 3IXSA 1XLQA 2BB6A 2NBWB 2FE8A 3P2BA 1C78A 2QEJC 4LJPB 4EFOA 3X23A 4CO7A 1GG3A 3KUZA 1YJ1A 3K9PB 2INCC 1E8WA 1UNSA 1TYGB 1VJKA 4L1BA 1RFKA 2BT6A 4B0MA 3MC9A 4YSXB 3EA6A 4DDID 1P98A 1R4NI 2JRIB 2AQ3B 2BQQA 3GE3C 2WXHA 2IYDB 2VZKD 2CS4A 4TV3A 2MJ3A 1UWMA 3M63B 2JYTA 4WAFA 2BPSA 3NS8A 4PYUA 3MJWA 3FC4A 4W9GA 1ET9A 4Q2JA 1HEZE 4IM3A 3T3NA 1NENB 3KH0A 4FN2A 2KFKA 4DXAB 1DYQA 3SD5A 3AU4A 3DVGY 1AYFA 1TGZB 1EF1A 4E74A 2N9PC 4NJCA 4N6EB 2D11A 1I4HA 3Q3NC 3U52E 1PDXA 3H7SA 3PREA 3JSVA 3OWEB 1UF0A 2N9XA 1TS3A 1T6BX 4RF0A 2BS3B 5E6PA 3APCA 5C3JB 3BIID 3ZNZB 5D2MB 2N9LA 2KKCA 1QOBA 3VTVA 3OG5A 2WDVB 4W9HA 2BKFA 1K53A 3WCQA 5TR5A 2W54A 4HJGE 2BS2B 1NBFC 1FCLA 1D5ZC 2MWSB 2K25A 4DHJB 1XT9B 1WF9A 2KN4A 1Z2MA 1WIAA 2RDBC 4AQ7A 1HE8A 4RFBA 3RN9C 3CWIA 3UIOB 4PS8A 3A1QB 4JPSA 1L7YA 2KAJA 4MT5A 1TBEA 2FBWB 2VZKB 3FILA 4HLEA 3DPDA 2CR5A 1ZXIA 2WP9B 3AEBB 3MC8A 2JZZA 5AUIA 4RGOS 1IGCA 4MSQB 5D7GA 2L05A 1HQRD 1WJNA 2IO1B 1AWDA 4LNIA 3HRDD 3DDCB 3TMPB 2D3GA 3JYUA 1NI3A 2KMMA 1WX9A 2KTRA 1F2RI 4M8NA 2WXPA 1P7FA 1E9MA 1JWMD 2MA9B 4BZAA 4TQ1A 2IO0B 3JVZX 1HZ6A 1UBIA 1S3SG 4C56C 3A4SC 1TT5B 1GC7A 3L0WB 4EE2A 3RFZB 2KJHB 3TCAA 1ET6A 2MP2A 4MGKE 2WXIA 3PSEB 2LUEA 2LGYA 4P7IA 2WDQB 4IM2A 1BUIC 1E7UA 2IBIB 2JPHA 3A1QA 3VR8B 1YX5B 2QILA 5E6NA 3TEYA 1F9JA 3FILB 5JZEB 2K6DB 4DHJD 3QHTA 3BZDB 1SGHA 2L52A 2QSDA 3V05A 3APFA 4GDKB 2FCQA 2L0TA 4P1CC 1MI0A 2V3SA 1SIJA 1KLGD 1RRBA 1C79A 3CIRB 2FCNA 4P6VF 1WZ3A 1WFYA 2CJOA 3PZ7A 1SE4A 1SBBB 1I4XA 4A9AA 3RD2A 2KMCA 1HXYD 1C9FA 2NPTA 3AB5A 1QZEA 2CJNA 4A6QA 2C7HA 1UWXA 3RNAC 1J0GA 2W3SA 1LO5D 1XCTL 2CKHB 2ZW0A 3PT2B 2DBYA 3RNFC 1RFAA 2KDEB 3P4PB 2GB1A 5CX3A 3N1XC 2WXKA 4BOSC 4IDIA 5MPOA 4E3CA 4URKA 4XYCA 3KVFB 1E8YA
chains in the Genus database with same CATH topology
4DQOC 1TY2A 2I2YA 1MVKA 1FCCC 3AE5B 3O13A 3ZYYX 1TS4A 1J7BA 2NTSA 3Q8BA 2K3UA 2DWQA 1I4QA 2QIEB 5H92C 3W2DA 1YN5A 2WDRB 3RPFC 2R61A 2V0GA 4AS1A 1WYGA 2I38A 1PUTA 1ZOYB 1ZP0B 1T5XD 1BXTA 4C80A 1XF5L 2SAKA 2INNE 4GLSC 3V3XA 1KF6B 3IT6B 1XO3A 1GOZA 1IBXA 3R8BA 3SEBA 2JXTA 1SEBD 4HKQA 3HUIA 1JWUD 4HROA 3P1MA 1D4BA 3NVVA 1CK1A 2SEBD 2PKOA 2WXOA 3DWMA 4XWTA 1FFVA 1NYRA 2V3PA 3P63A 5GXGB 3NS1A 4TMAB 5EE9A 3AM9A 1V1OA 2GRIA 1ZE3D 2WXJA 5D3IB 2RDHA 1VR9A 2PIAA 2AQ2B 3AE4B 2LEKA 1GB4A 2GI9A 2N7JA 1K51A 2WS3B 3ZQ4A 1C77A 3AECB 4YT0B 4OVZA 1EM7A 2M0AA 3EUB2 4OW0A 2G1EA 2CU3A 2PVOD 3T3OA 1KLUD 1MHHE 1Q10A 2NMQA 1XLPA 1K50A 3AE1B 4YWGG 3HVDA 1B9RA 4L2YA 1SJED 3HVZA 3BYTB 1WRIA 1FMAD 1HA5A 3MP9A 3NVZA 1TKGA 1XCQL 1TY0A 3W1SA 1V97A 3TEXA 1DOIA 1SE2A 1E6EB 4GDLB 1MHXA 3AEFB 4ZYSA 4N59A 1QOGA 4LLGM 1I7HA 3L4PA 1I4RA 1FM0D 4YTMB 2AQ1B 4OZCA 1EWYC 2LHEA 1WXQA 4KGTA 2WXGA 2PW9A 1FNUA 4KGSA 2WXQA 4HKZE 1FXIA 2WXFA 4R3DA 5BYSA 1KRHA 3BWUD 2K5PA 1ZUD2 1YQ4B 4HRSA 4RNAA 3AE6B 3PO0A 1WSPA 2IPKD 4KKIA 2E3TA 1TJEA 1JALA 2XN9C 3NRZA 1V1PB 5G5GA 3B9JA 1R7SA 3MFGA 2RMMA 2DYMA 3NZ3A 4M0WA 3BK1A 4YSZB 2ON8A 1MPEA 1FRRA 2HDEA 4RGNA 1QKZA 3SFDB 4USAA 1L0XB 3U2SC 2J4XA 3BVMA 1ESFA 1QILA 4C7YA 2IJ0A 3LXFA 1UGJA 3B2GA 1Y56A 1F77A 1GPXA 3AE3B 1J7CA 2AX5A 1FFUA 1VRAB 2DYOA 2JX5A 3AV8A 2JYEA 1ACCA 1D6EC 1JWAD 1SB3C 4LTUA 1JROA 1L0YB 4US9A 4WIPA 1AN8A 2OHFA 1YN3A 1V8CA 3Q8EA 4IOIE 1TS2A 4XWWA 2LHDA 3I57A 3UI3A 3E56A 2BYTA 3GB1A 2L83A 2Y3AA 1N60A 2D5GA 1RM6C 2WLBA 2Y5CA 4C7ZA 2H88B 2RDGA 2IGHA 3U7ZA 1IBXB 3IXSA 1L4DB 2BBCA 1DGJA 1XLQA 2BB6A 1EWCA 2FE8A 2LMCA 5T8IA 3W9CB 1C78A 1JWSD 2EELA 2WXLA 2QEJC 5FKAC 1FIQA 3VQIA 4REZA 3AH7A 1CJEA 5E6JA 1L6VA 4A90A 2W3RA 2WXNA 1UNSA 1N5WA 1TYGB 1VJKA 4L1BA 3BVGA 2ONQA 4O1NA 1RFKA 2BT6A 4ZHOA 1WWTA 4B0MA 4P16A 3VR9B 5AUKA 4YSXB 3EA6A 4RGTA 4PT5A 3AEEB 1ZPSA 2QMTA 2W82A 2RPVA 3ZGZA 4XDCA 3W5VB 4HEA1 3VRBB 1L4ZB 2AQ3B 3KLSX 1N63A 5G5HA 1FO4A 4A55A 2WXHA 1ZXHA 2VZKD 2Y5PA 3SR6A 5FK9C 5D3DA 2MJEA 5BMIA 1NEKB 3ABVB 2MJDA 2MJ3A 3KWLA 1UWMA 4WWMA 1JWBD 4B0EA 4H2AA 2JYTA 2N9KA 3NVWA 4WAFA 2KWDA 2ZW1A 3FC4A 1VZ7A 5BYRA 1KTKA 2DLBA 1ET9A 4Q2JA 1HEZE 1OFFA 4YSYB 3T3NA 1F2RC 1NENB 1JCKB 4MH8A 3ZJVA 4ARIA 2WU5B 1DYQA 1XLOA 3AMZA 1EU3A 3KWVA 5HFYA 1L0VB 1C76A 1L5PA 2YEPF 1QOAA 4FXCA 2BS4B 1AYFA 5EE1A 1GAQB 3ZJTA 1RYJA 2JSVX 4NJCA 4N6EB 4DXGA 1SE3A 2E6XA 2KDMA 3B2FA 1A70A 2QJLA 2OEDA 1I4HA 2N0SB 3PZ8A 2ICIA 3IAS1 3U52E 2Q5WD 2W55A 1PDXA 3AE9B 3MHZA 3OWEB 4YTPB 1YNTE 3P4RB 3SFEB 3NVYA 1XEEA 3W5UB 4NAWB 1QLBB 1TS3A 1OQQA 1C4AA 1T6BX 3MJ5A 4JE3B 1ROEA 1RWSA 4RF0A 1N61A 1XLNA 2LGIA 1M4VA 2BB5A 2K0PA 2BS3B 2PVGC 2X38A 3N9YC 3Q8FA 5C3JB 3BIID 1IUEA 3DWGC 2N9LA 2PLPA 1QOBA 2WDVB 5JXVA 3TEWA 2WU2B 1K53A 3WCQA 2WXMA 4WQMA 2W54A 4HJGE 2BS2B 4ITKA 4RH6A 5C2TB 5HG2A 4RGMA 1FCLA 1D5ZC 1VZ8A 1B1ZA 1STEA 4JX1C 2KN4A 4J3OD 1VZ6A 3GP7A 3AEGB 1PGBA 3TSSA 4N58A 4RF1A 1BMLC 4AQ7A 4RFBA 2JU6X 4IKGA 4XE0A 1WGKA 3CWIA 1PFDA 4JWSC 2V4IB 1FRDA 1GB1A 2WQYB 5FR3A 4JPSA 1EU4A 2KAJA 4MT5A 2EKIA 2FBWB 2VZKB 1VDVA 1JRPA 1QOFA 5EE0A 3FILA 5TSSA 1ZXIA 2WP9B 3AEBB 5AUIA 4RGOS 3AEAB 1OQRA 1KFYB 1DOYA 2MEKA 1IGCA 4KGRA 3MC0B 2MH7A 1C4PA 4ZRPA 3AEDB 1J7AA 5D7GA 4L23A 1JQ4A 1HQRD 3I9V1 1L6UA 1AWDA 3AE2B 1ZDXA 4MACA 3HRDD 3ZJUA 3P42A 4TQ0A 1NI3A 2J42A 2J53A 2WXRA 1FEHA 3NUHB 1N62A 2KMMA 2K9XA 2L1AA 1F2RI 1FNVA 2WXPA 3AN1A 3TUOA 3VRAB 3LB8C 3TEZA 1VLBA 1P7FA 2KQ4X 3Q8CA 3EGRA 2LUMA 1E9MA 1JWMD 4KX6B 1PYWD 3BK2A 1SXTA 5BYQA 4CQNA 4TQ1A 1FXAA 1TKYA 2PMVA 4WH4A 5HI1A 3Q8AA 3FAHA 1HZ6A 4JWUC 4YTNB 4C56C 2L32A 2TSSA 4ZOHC 2V3NA 4KKJA 4EE2A 3P4SB 5BMHA 1PGXA 4ZHPA 3RFZB 1CQVA 1TKEA 1I4GA 1ET6A 3U4EG 2WXIA 2IGDA 3GS2A 4LK0M 1E7PB 1NVID 4UDUC 2NTTA 2WDQB 1TS5A 1BUIC 5H8YE 3Q69A 3BYYB 2JWUA 2FUG1 4OHJA 3VR8B 2KACA 2QILA 1IGDA 2HTME 3TEYA 3FILB 1YQ3B 3IT4B 1D5XC 1HZ5A 1CZPA 2B76B 3BZDB 2L52A 2QSDA 3V05A 5EE3A 4GDKB 4WURA 4A8XC 1DOXA 1MI0A 1T3QA 1E10A 1P7EA 1SIJA 1K52A 4OZAA 3E9SA 2PTLA 1KLGD 1C79A 3CIRB 1YMHE 2BW2A 4P6VF 1SSNA 2LFIA 4MM3B 2LJIA 1ENFA 2XNAC 3AE8B 3KQ4A 1I4PA 1NYQA 1YJIA 1YN4A 2CJOA 3ETRA 3PZ7A 1SE4A 3R2IA 5LNK1 1SBBB 1I4XA 1SF0A 3C8YA 4A9AA 3J9CA 1E0ZA 1YJJA 2IDYA 2M19A 3IAM1 4YXDB 1AW7A 1HXYD 5I4DA 1C9FA 1KH0A 2G9HD 3AB5A 3H8HA 1FNWA 5HHDG 2CJNA 5BMGA 4A6QA 2INPE 1D5MC 1QT9A 1ZDVA 1UWXA 2K22A 2JZPA 2Z8LA 4ARCA 2JQRB 4NZLB 1PGAA 1QQRA 2W3SA 1QF6A 1LO5D 2BTEA 4D2KA 4RCOA 1XCTL 1XXGA 3P4QB 1C4CA 1SJHD 3LYYA 4NAMA 1N5XA 2ZW0A 1FD6A 2ACZB 4XDDA 2WNMA 1V1PA 4TSSA 2DBYA 4OZBA 2M56B 3URYA 3P4PB 1UUPA 4US8A 4ZRQA 2GB1A 2IGGA 2WXKA 1TZOA 2J52A 1JMLA 3BVZA 1F0ZA 3R2TA 1JW9D 2YEPB 2H89B 3AE7B 4IDIA 5MPOA 4DXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KDM A;  1QKZ A;  2OED A;  2I2Y A;  1MVK A;  1FCC C;  4WH4 A;  5HI1 A;  1HZ6 A;  1YNT E;  2I38 A;  5BMH A;  1PGX A;  2LGI A;  2K0P A;  2IGD A;  1XF5 L;  4GLS C;  3V3X A;  4IOI E;  1IBX A;  2PLP A;  2N9L A;  2LHD A;  3UI3 A;  2JXT A;  3GB1 A;  2JWU A;  5JXV A;  1D4B A;  2KAC A;  1IGD A;  2IGH A;  1K53 A;  1IBX B;  3FIL B;  4HJG E;  1HZ5 A;  5HG2 A;  1FCL A;  2EEL A;  2QSD A;  2KN4 A;  1GB4 A;  1MI0 A;  2N7J A;  2GI9 A;  1K51 A;  1P7E A;  1PGB A;  1K52 A;  4OZA A;  2PTL A;  1EM7 A;  2JU6 X;  4IKG A;  2ONQ A;  1YMH E;  1MHH E;  1Q10 A;  2NMQ A;  1K50 A;  1GB1 A;  2QMT A;  2RPV A;  3FIL A;  1ZXH A;  3MP9 A;  1C9F A;  1KH0 A;  1XCQ L;  5HHD G;  5BMG A;  5BMI A;  1MHX A;  1IGC A;  1UWX A;  4KGR A;  2JZP A;  1PGA A;  4OZC A;  2N9K A;  2LHE A;  2KWD A;  2ZW1 A;  4KGT A;  2PW9 A;  4D2K A;  4MAC A;  1XCT L;  4KGS A;  1HEZ E;  2ZW0 A;  1F2R C;  4HKZ E;  1FD6 A;  4OZB A;  5HFY A;  2J53 A;  1F2R I;  2GB1 A;  1P7F A;  2KQ4 X;  2IGG A;  2J52 A;  1JML A;  2LUM A;  2RMM A;  2ON8 A;  2JSV X;  1MPE A; 
#chains in the Genus database with same CATH topology
 4NJ6 A;  4DQO C;  3LJ3 A;  1WX7 A;  1TY2 A;  2CHW A;  2OJW A;  2K3U A;  1PQS A;  2QIE B;  2V0G A;  3OAW A;  1WYG A;  2LXA A;  4RMA A;  4HXD A;  2KAN A;  2SAK A;  2INN E;  4GLS C;  1BT0 A;  2N9E B;  1KLV A;  4EZL A;  5LLI A;  2KLC A;  4HRO A;  3NVV A;  2JWZ A;  2PKO A;  3A9K A;  2V3P A;  3W1Y A;  2EMT A;  2JF5 A;  3NZU A;  1LGR A;  2WXJ A;  3MHS D;  4MGI E;  1CMX B;  3AE4 B;  2N7J A;  2WS3 B;  3ZQ4 A;  3KUD B;  3AEC B;  1EM7 A;  2M0A A;  2KC1 A;  4OW0 A;  2CU3 A;  3H1U A;  2ZPY A;  1V2Y A;  4WQO B;  2KT7 A;  2GOW A;  2KVZ A;  2QC8 A;  1OTR B;  2KXJ A;  1WXS A;  1WRI A;  1FMA D;  3APD A;  1WR1 A;  3W1S A;  1V97 A;  3TEX A;  4GDL B;  4PYZ A;  4FHK A;  2N1V A;  1SIF A;  1I7H A;  2LGS A;  3V60 A;  2KDB A;  2BYE A;  1FNU A;  2M4N A;  1UZX B;  1FXI A;  3K9O B;  4R3D A;  5BYS A;  1KRH A;  4LNO A;  1H8C A;  1YQ4 B;  4RNA A;  3AE6 B;  3PO0 A;  2IPK D;  2ASQ A;  2BWF A;  3ZTC A;  1V1P B;  1ZW7 A;  5G5G A;  1R7S A;  3MFG A;  2RMM A;  1FRR A;  2HDE A;  3CSF A;  1WGR A;  3JSV B;  1UD7 A;  3QC8 B;  4S0R A;  1L0X B;  3U2S C;  2J4X A;  2IJ0 A;  3LXF A;  2KMA A;  3PRZ A;  1F77 A;  3TJP A;  3AE3 B;  3V6C B;  1VRA B;  3DQV A;  1KM7 A;  3HM3 A;  4LTU A;  4US9 A;  1L0Y B;  2KDI A;  2OHF A;  4ZDV A;  4XWW A;  3VAW A;  3UI3 A;  3E56 A;  1WGY A;  4IG7 B;  1N60 A;  5DPS A;  2KFJ A;  1RM6 C;  4C7Z A;  4A3O A;  2BBC A;  4F1S A;  4II2 B;  4K81 A;  2LGX A;  2KTF A;  3N3K B;  2WXL A;  1FIQ A;  2RR9 A;  2KC2 A;  4REZ A;  3AH7 A;  1CJE A;  3RNG C;  4N9F 4;  2IO2 B;  4O1N A;  2ONQ A;  4BAX A;  3MTN B;  1WWT A;  4JGH B;  4WAA A;  5AUK A;  2LAS A;  2MCN B;  4PT5 A;  2RPV A;  4I6N B;  3VUX A;  3QK0 A;  4FHJ A;  4HEA 1;  3VRB B;  1FO4 A;  4C4V A;  1ZXH A;  2GLS A;  4BFR A;  2L0F A;  5D3D A;  2MJE A;  2GBK A;  5BMI A;  3EHV A;  4M8M A;  2XBB C;  2A4Z A;  3SDL C;  2EMS A;  3PLU A;  4W9C A;  3KWL A;  4WWM A;  3HM6 X;  5J2R A;  3NVW A;  2DLB A;  5JHA A;  1MFW A;  3NZS A;  1JCK B;  2WU5 B;  3D32 A;  4WWN A;  3NG0 A;  3KWV A;  1C76 A;  3AI5 A;  2YEP F;  3ALB A;  1QOA A;  2VH1 A;  1LM8 B;  4WJN A;  5EE1 A;  1GAQ B;  5L95 C;  2JSV X;  2AEH A;  2KDM A;  2QJL A;  2OED A;  2HJ8 A;  3IBE A;  4M0W B;  2N0S B;  3PZ8 A;  3RUL A;  2OJR A;  2W55 A;  1Q5W B;  4YTP B;  3MHZ A;  1YNT E;  1OQQ A;  1ROE A;  2X38 A;  2K0P A;  2PVG C;  1IUE A;  3RI7 C;  4BKG A;  3DWG C;  2KWV B;  4G11 A;  3UQA A;  1HTO A;  2LI5 A;  3VFK A;  4ACF A;  3TBL D;  3NHE B;  4ITK A;  4RH6 A;  4C4V B;  2LRU A;  2DZJ A;  2MSE D;  1WE6 A;  4HCP B;  1B1Z A;  4JX1 C;  4J3O D;  2D3A A;  1VZ6 A;  4M00 A;  3TSS A;  1R4M I;  4N58 A;  2IY0 B;  4RF1 A;  4IW0 A;  4IKG A;  1WGK A;  4IWQ A;  4YL8 A;  1GB1 A;  1EU4 A;  4LDT B;  1P1A A;  1QOF A;  2ZCC A;  3VH4 B;  2X8X X;  3ZNG C;  4KSL C;  2BGF A;  3AEA B;  4MH0 E;  1OQR A;  2JRH A;  1DOY A;  4KGR A;  3U30 A;  2MH7 A;  4AJY B;  4ZRP A;  1J7A A;  3I9V 1;  1OEY A;  2HJ1 A;  2K1F A;  5FR6 A;  4FJY A;  4BKT A;  2JUO A;  2M17 A;  4HPL B;  3NUH B;  2RD0 A;  3ML9 A;  3DBR I;  3Q8C A;  2LUM A;  4NJ7 A;  3CMM B;  3ZNI D;  4EEW A;  1F1H A;  3VDZ A;  1SXT A;  2DX5 B;  4CQN A;  4HK2 A;  1TKY A;  4WH4 A;  1IP9 A;  3FAH A;  4IM0 A;  3WA0 A;  4KKJ A;  4ZHP A;  5C23 A;  3WAM A;  1I4G A;  2C9W B;  2KVR A;  1WMH A;  4LK0 M;  4ZRI A;  2MQJ A;  3KW5 B;  3Q69 A;  3BYY B;  4W9D A;  2FUG 1;  2PJH A;  3KYC D;  2HTM E;  3RZF A;  3VH3 B;  3DVN U;  3N1Y C;  3IT4 B;  1D5X C;  4WUR A;  2KHW B;  2N1W A;  4HCN B;  1E10 A;  4FLH A;  3KUC B;  2KD0 A;  1WE7 A;  2VH2 A;  3VXW A;  1SSN A;  2KJR A;  4MM3 B;  2LFI A;  4K7W A;  1I4P A;  1WGD A;  2DNF A;  1E0Z A;  3A9K B;  3RT3 B;  1YJJ A;  4WJP A;  2IDY A;  3IAM 1;  4DDG D;  1AW7 A;  1KH0 A;  2G9H D;  1T0Q C;  3H8H A;  1R4M B;  4HVB A;  1D5M C;  1QT9 A;  2K39 A;  2MBH A;  2XK5 B;  1QQR A;  2KK8 A;  1ZGU B;  4JLC A;  1E5W A;  3RYT A;  3ZW3 A;  4D2K A;  3PHX B;  4RCO A;  1VD2 A;  2WNM A;  2FNJ B;  4TSS A;  2MW5 A;  3DHI C;  1UUP A;  1WMH B;  1TZO A;  1UH6 A;  3BVZ A;  2KWC A;  1F0Z A;  1Q1O A;  3H7P B;  1JW9 D;  2YEP B;  2H89 B;  3AE7 B;  4GDL A;  4RM9 A;  4NY0 A;  4DXF A;  4ANW A;  2JY6 A;  2I2Y A;  1MVK A;  2NTS A;  2WGS A;  3Q8B A;  3ZIM A;  5H92 C;  2R61 A;  1V49 A;  3UF8 A;  3V62 A;  2RGF A;  2UWQ A;  2LRW A;  3SHQ A;  3ZLZ A;  4EOY A;  4ZRK A;  2AYO B;  3V3X A;  3IHP C;  2PPH A;  1XO3 A;  1SEB D;  1CK1 A;  4NQL B;  4AP4 C;  1NYR A;  1GJZ A;  4TMA B;  5EE9 A;  3AM9 A;  4DK5 A;  3A33 B;  2PIA A;  2GI9 A;  1K51 A;  2AL3 A;  2W9N A;  3T3O A;  1KLU D;  1MHH E;  1IYF A;  4PS3 A;  3AE1 B;  4YWG G;  3VUY A;  4LNF A;  3HVD A;  2L00 B;  1TZ1 A;  3QJZ A;  1B9R A;  4L2Y A;  1WJ4 A;  3M95 A;  2FIF A;  1GNU A;  1HA5 A;  2KO3 A;  3NVZ A;  3NOB A;  1TKG A;  3H7P A;  5JH5 C;  1MHX A;  1QOG A;  4HDQ A;  4OVU A;  1J8C A;  3L4P A;  2LVO A;  3Q14 C;  1KOT A;  2AQ1 B;  1C3T A;  4OZC A;  1EWY C;  3R66 C;  1WXQ A;  4KGT A;  1KJT A;  2WXG A;  4LCD E;  2GBR A;  4JQW C;  1K8R B;  1OGW A;  2KOX A;  4KGS A;  3V61 A;  1LXD A;  2LWP A;  2WXF A;  2FID A;  3ZTD A;  3BWU D;  4EZK A;  2K5P A;  2Y5B B;  4GB9 A;  1ZUD 2;  1FXT B;  4HRS A;  4ASW C;  1OEY J;  3B0A A;  5EDS A;  2E3T A;  4DWF A;  1JAL A;  3M3J A;  3L17 A;  2DYM A;  4YSZ B;  1YD8 U;  1MPE A;  2J0K A;  2FCM A;  3Q3F A;  2KX0 A;  3PGE A;  1ESF A;  1QIL A;  2AX5 A;  3AV8 A;  4HJK A;  2V9H A;  3UIN B;  1D6E C;  3SFD B;  1JWA D;  1JRO A;  4WIP A;  3PZD A;  2NBU A;  1V8C A;  2V1Y A;  2KNB A;  2O2V A;  2NS5 A;  4KIK A;  2Y3A A;  2WLB A;  1RAX A;  3TIX A;  4M02 A;  2H88 B;  2O6V D;  2DZI A;  3X0W A;  1IBX B;  1L4D B;  1DGJ A;  2LMC A;  4JL9 A;  5FKA C;  3VQI A;  1P3Q U;  1L6V A;  4BKS D;  4A90 A;  2W3R A;  2DHZ A;  2WXN A;  1N5W A;  3CF6 E;  2MBE A;  4XC2 A;  3BVG A;  1MG8 A;  2ZVO A;  4ZHO A;  1TTN A;  4S17 A;  4RGT A;  3AEE B;  4IC7 B;  2W82 A;  2D3C A;  2C7M B;  4XDC A;  3A4R A;  1AAR A;  1L4Z B;  2BVC A;  3GOE A;  3KLS X;  4A55 A;  5CTR C;  3RCZ A;  3SR6 A;  3AU5 A;  5FK9 C;  5AEK B;  1NEK B;  4KDL B;  1YQB A;  3R7Q A;  2KWD A;  2LVQ A;  1VZ7 A;  3DVG X;  4HPM B;  3NJT A;  2IZV B;  2REX A;  3L13 A;  4MH8 A;  2UU7 A;  3ZJV A;  1V5T A;  4ARI A;  3AMZ A;  1EU3 A;  4K3B A;  5HFY A;  1YOV B;  2LVP A;  2D3B A;  3QA8 A;  2BS4 B;  1IPG A;  1C1Y B;  4KDI C;  2DZK A;  3RZW C;  3H6N A;  1V81 A;  4DXG A;  1SE3 A;  4ICV A;  2MHJ A;  1F52 A;  3Q6B A;  4XGA B;  2LZ6 A;  4K1R B;  4TKN A;  3IAS 1;  2Q5W D;  3ZDM C;  1GC6 A;  3UGB B;  4BOZ B;  3VVW B;  3W5U B;  4NAW B;  3MJ5 A;  1WM2 A;  4JE3 B;  1N61 A;  2ZPN A;  1M4V A;  2BB5 A;  4WWP A;  4GOC A;  4AJW A;  2PLP A;  2ZJD A;  3QQ8 B;  2HE7 A;  2WU2 B;  4GDK A;  2WXM A;  4WQM A;  2I1J A;  5C2T B;  2JXX A;  2DYB A;  5HG2 A;  1E7V A;  4RGM A;  3R7R A;  1STE A;  2D2Q A;  4NQK E;  5KHQ A;  4GMV A;  3AEG B;  1PGB A;  5E6O A;  2NBV B;  2JU6 X;  3ML8 A;  4XE0 A;  5CHW A;  4HDO A;  2D10 A;  2K6Q A;  1PFD A;  3N32 A;  3L54 A;  2WQY B;  1G6J A;  1L2N A;  2EKI A;  4AOF A;  5EE0 A;  5HKH A;  5TSS A;  3PLV A;  2A5U A;  4CYE A;  2XK5 A;  3QWZ B;  1KFY B;  2MEK A;  5JHB A;  1YX6 B;  2PEA A;  1C4P A;  4GU2 A;  3AED B;  3GE8 C;  1S1Q B;  4A20 A;  3UIP B;  1L6U A;  3AE2 B;  4MAC A;  3ZJU A;  2KLG A;  4TQ0 A;  3BIN A;  5L83 A;  1H4R A;  2J42 A;  2WXR A;  3QAQ A;  1FEH A;  4AUQ C;  2K9X A;  1V80 A;  2L1A A;  2LD9 A;  4DBG A;  2KN5 A;  3AN1 A;  3TUO A;  3LB8 C;  1VLB A;  5G2N A;  1WYW B;  2KQ4 X;  3S2A A;  1T0Y A;  2KFK B;  3EGR A;  4DHZ E;  1FPY A;  2KQS A;  4W9L A;  1PYW D;  2FAZ A;  3BK2 A;  3ZKJ C;  3QIJ A;  3B1L X;  1FXA A;  4ICU A;  2PMV A;  4CHK A;  1WZ0 A;  5HI1 A;  3Q8A A;  1MJD A;  4YTN B;  2TSS A;  4ZOH C;  2JZ3 B;  3RNC C;  4K7S A;  3P4S B;  3U7D A;  5BMH A;  1CQV A;  3AXC A;  3U8Z A;  2DZM A;  2IGD A;  1NVI D;  3ONS A;  4UDU C;  5DCN A;  3DBR B;  3QAR A;  1TS5 A;  3ECI A;  5H8Y E;  4A3P A;  2JWU A;  4PS7 A;  2KAC A;  1IGD A;  1EO6 A;  1E8Z A;  2J0J A;  1HZ5 A;  2N7D A;  2B76 B;  2UYZ B;  2K8B A;  4KZC A;  1N6Z A;  4W9I A;  5EE3 A;  2KX3 A;  4X57 B;  2R2Q A;  1P7E A;  3E9S A;  4LNK A;  1ENF A;  1LFD A;  2XNA C;  3AE8 B;  3KQ4 A;  4MGZ E;  2D07 B;  3DCG A;  2G4D B;  3C8Y A;  4ANX A;  4W9E A;  1MG4 A;  3DHH C;  4C00 A;  2M19 A;  4YXD B;  2M8S A;  5HHD G;  5BMG A;  2INP E;  3WIM A;  4GXB A;  2K22 A;  2JZP A;  3EFC A;  5D6J B;  4ARC A;  2MBQ A;  2JQR B;  4NZL B;  2YVC A;  1QF6 A;  2QHO A;  4BKS A;  3L08 A;  1XXG A;  5AZH A;  1UGM A;  4NAM A;  3VUW A;  1FD6 A;  3DBL B;  3OLM D;  4XDD A;  1V1P A;  2M56 B;  3URY A;  1P0R A;  1D3Z A;  4BBN F;  3R2T A;  3BY4 B;  3Q3M C;  1RLF A;  1WRD B;  2C7N B;  3AE5 B;  3O13 A;  1J7B A;  3I63 C;  2DWQ A;  2OOB B;  4NNJ B;  1I4Q A;  3KYD D;  2K8H A;  2WDR B;  1P9D U;  2I38 A;  1ZOY B;  4B6W A;  1UEL A;  4KIK B;  1T5X D;  4C80 A;  1XF5 L;  2NVU I;  4GGQ A;  3JW0 X;  1KF6 B;  4DHZ B;  1GOZ A;  2DAF A;  1IBX A;  1ISN A;  3SEB A;  2JXT A;  2BYV E;  4G0N B;  4HKQ A;  5DPR A;  2MP2 B;  1JWU D;  3HUI A;  4WJQ A;  4BBN C;  2WXO A;  4MJS B;  3DWM A;  2G3Q B;  1FFV A;  4K7U A;  3I3T B;  4EKU A;  5GXG B;  3NS1 A;  3ZXV A;  2GRI A;  4GSW A;  2RDH A;  1VR9 A;  1NDD A;  2LEK A;  1GB4 A;  2VRR B;  1C77 A;  4YT0 B;  3EUB 2;  4G50 A;  2O2V B;  4FJV B;  2HTH A;  1XLP A;  1K50 A;  3DBS A;  3ZO5 B;  4FA6 A;  1Q0W B;  2G4S A;  2DAJ A;  4RM8 A;  2N7E A;  4FAD A;  4MDK E;  3MP9 A;  1XCQ L;  1TY0 A;  2RPQ A;  1E6E B;  2ZNV B;  1VCB A;  3H9D A;  1YIW A;  3AEF B;  3EFU A;  2DEN B;  2M0X A;  1FM0 D;  4YTM B;  2Z0D B;  2LHE A;  2PW9 A;  3RNB C;  3GZN B;  3WAN A;  2LGD A;  2WXQ A;  4HKZ E;  2XEW A;  2HD5 B;  3L16 A;  3DBH B;  1U4A A;  2FCS A;  2XN9 C;  2LXC A;  3B9J A;  2V4L A;  2I1K A;  4M0W A;  3BK1 A;  3EC8 A;  2EKE C;  2ON8 A;  4RGN A;  1QKZ A;  2ZNV C;  2WWZ A;  4USA A;  2ZVN A;  4HPP A;  3BVM A;  2WHI A;  5IAA C;  1UGJ A;  3B2G A;  1WXM A;  1Y56 A;  3N20 C;  1GPX A;  3VTW A;  2BYF A;  1FFU A;  2DYO A;  2JX5 A;  2JYE A;  3RUI B;  1ACC A;  2J7Q B;  1AN8 A;  1YN3 A;  5AZG A;  3FKY A;  2LHD A;  2BYT A;  3ZNH B;  3DHG C;  3A9J A;  2D5G A;  2Y5C A;  3HIZ A;  2RDG A;  2IGH A;  4KV2 A;  2GBJ A;  2GBN A;  1EWC A;  1LQB A;  5T8I A;  3Q2A C;  3W9C B;  1JWS D;  2EEL A;  2FUH B;  4AWJ A;  5E6J A;  4MSM B;  2LJ5 A;  5LXI B;  2IY1 B;  4P16 A;  4XX5 A;  3VR9 B;  1M94 A;  1ZPS A;  2QMT A;  3ZGZ A;  3W5V B;  4WJO A;  5IN7 A;  1V9J A;  3DOW A;  1N63 A;  2WX0 A;  5G5H A;  4MEL A;  2Y5P A;  1UBQ A;  3AUL A;  2JT4 B;  2NCN A;  3ABV B;  2KZR A;  2G45 B;  2MJD A;  1JWB D;  4B0E A;  4H2A A;  2N9K A;  2ZW1 A;  2L8J A;  2JVC A;  5BYR A;  1KTK A;  3PPA A;  1OFF A;  4YSY B;  5LXH A;  2PE9 A;  4GIV A;  4LNN A;  1F2R C;  3ENE A;  4ZYN A;  1XLO A;  1XQQ A;  1L0V B;  1I42 A;  1L5P A;  2YLM A;  3C0R B;  4FXC A;  2CHX A;  3PV1 A;  3CST A;  3ZJT A;  1RYJ A;  2QDF A;  4II3 B;  1E8X A;  5CHV C;  4FBJ B;  2E6X A;  3Q3J A;  3B2F A;  2WDT B;  1A70 A;  4NPN A;  4M01 A;  2ICI A;  3AE9 B;  5J17 A;  3P4R B;  3QX1 A;  3NVY A;  4OVV A;  3SFE B;  1HTQ A;  1XEE A;  2N4F A;  3V6E B;  1QLB B;  1C4A A;  4KZ0 A;  1WH3 A;  1RWS A;  1Y8R C;  1XLN A;  2KJ6 A;  2LGI A;  1WJU A;  3N9Y C;  3Q8F A;  5IOI A;  3ZUN A;  4W9F A;  3HHM A;  3OJ3 A;  3T9L A;  3R3M A;  5JXV A;  3TEW A;  3B08 A;  4FJZ A;  1SE9 A;  1J19 A;  3DBL I;  5DPW A;  1VZ8 A;  3GP7 A;  1WXA A;  1Z5S B;  3M62 B;  3OJ4 B;  4IWP A;  1BML C;  4XZ4 A;  2BKR B;  4JWS C;  2V4I B;  1FRD A;  2KDF B;  5FR3 A;  4IUM B;  4W9K A;  3PRM B;  5BO4 B;  1VDV A;  1JRP A;  1EUV B;  4P1B C;  1ZKH A;  4TUU A;  4ANV A;  2PE6 B;  3PTF C;  3MC0 B;  1V86 A;  1WY8 A;  3PVL A;  4L23 A;  1JQ4 A;  3O65 B;  1ZDX A;  4W9J A;  1WGG A;  3P42 A;  2ZCB A;  1I35 A;  4LDT D;  1WGH A;  5G55 A;  2J53 A;  1N62 A;  2MX2 A;  1FNV A;  3VRA B;  4MGY E;  3TEZ A;  3EEC A;  3HK0 A;  4KX6 B;  2RSU A;  4ZRJ A;  5BYQ A;  1WM3 A;  1OQY A;  4JIO U;  2Z59 B;  4JWU C;  2L32 A;  2Z0E B;  4K3C A;  2V3N A;  1E90 A;  1PGX A;  1TKE A;  2CHZ A;  3DVN V;  3U4E G;  3VTU A;  1WX8 A;  2QCZ A;  3GS2 A;  1T0S C;  1E7P B;  4MJS A;  4B95 A;  2NTT A;  3N1Z C;  4OHJ A;  1YQ3 B;  3PRP B;  2GBM A;  1CZP A;  4I6L B;  1WI0 A;  2AL6 A;  2M1M A;  2MLB A;  3VHT C;  4BVU C;  5IP4 D;  2ZZP B;  4A8X C;  1DOX A;  1T3Q A;  4QAY A;  1K52 A;  3QCA A;  4OZA A;  2PTL A;  5DPT A;  4PK1 A;  2C60 A;  1YMH E;  2BW2 A;  1A5R A;  1EF5 A;  2B3A A;  2LJI A;  3WAL A;  3PS6 A;  1NYQ A;  1YJI A;  1YN4 A;  3ETR A;  5CHF A;  3R2I A;  5LNK 1;  1SF0 A;  3J9C A;  1NI2 A;  4HWI B;  3L10 B;  5I4D A;  2CU1 A;  4WWO A;  1WJ6 A;  1FNW A;  2R2O A;  5GMV A;  2KWU B;  1ZDV A;  2Z8L A;  1PGA A;  1WXV A;  3C19 A;  3ZRF A;  2BTE A;  3N30 A;  3P4Q B;  1C4C A;  1SJH D;  3LYY A;  1N5X A;  2ACZ B;  4OZB A;  3RNE C;  3WAO A;  4US8 A;  4ZRQ A;  2IGG A;  2J52 A;  1JML A;  1GUA B;  2KTR B;  1WR6 E;  5IO9 A;  4I6P A;  2BWE S;  5KHO A;  4LJO B;  1FCC C;  2L7R A;  3UQB A;  3ZYY X;  1TS4 A;  2ZEQ A;  2K8C A;  4MEM A;  2BF8 B;  3W2D A;  1YN5 A;  3RPF C;  4AS1 A;  3IFW B;  3ZDT A;  1XD3 B;  1PUT A;  3IVF A;  1ZP0 B;  2MRP A;  2WYQ A;  3W1S C;  1BXT A;  4J6I A;  4ANU A;  3IT6 B;  5IA7 A;  2L76 A;  3PHW B;  3R8B A;  4KSK C;  3WAP A;  3P1M A;  1D4B A;  2C5L C;  2O6V A;  3LDZ E;  5IKC M;  2SEB D;  2IO3 B;  4XWT A;  2KYW A;  3IG3 A;  3P63 A;  1TIF A;  2MBO A;  1V1O A;  1ZE3 D;  4EUT A;  5D3I B;  3NY5 A;  2AQ2 B;  3GZN I;  1V6E A;  4OVZ A;  2G1E A;  2PVO D;  1Q10 A;  3SU8 X;  2NMQ A;  3A9J B;  4MM3 A;  1SJE D;  3HVZ A;  3BYT B;  4B9K A;  1DOI A;  1SE2 A;  2WX1 A;  4ZYS A;  4N59 A;  4LLG M;  1I4R A;  3DBH I;  2NPT B;  1X1M A;  4EZJ A;  4FUL A;  3I5J C;  5C1Z A;  4KVG B;  4IWO A;  4E71 A;  1WSP A;  3Q3O C;  4KKI A;  3RMK C;  1JRU A;  1TJE A;  4G3X B;  3NRZ A;  1R4N B;  3ZXR A;  3NZ3 A;  1T0R C;  2O6V B;  4F7Z A;  3ZVV A;  4NAW A;  5J18 A;  2MBB B;  5AZF A;  4C7Y A;  5D94 A;  2J0M A;  1V5O A;  2NR2 A;  1J7C A;  3T8M A;  3TL5 A;  1SB3 C;  3ZRC A;  4F8C B;  3Q8E A;  4IOI E;  1TS2 A;  3I57 A;  4GN1 A;  3GB1 A;  2L83 A;  2AWT A;  3U7Z A;  2KQ7 A;  2IND C;  2L3Z A;  2GMI C;  3IXS A;  1XLQ A;  2BB6 A;  2NBW B;  2FE8 A;  3P2B A;  1C78 A;  2QEJ C;  4LJP B;  4EFO A;  3X23 A;  4CO7 A;  1GG3 A;  3KUZ A;  1YJ1 A;  3K9P B;  2INC C;  1E8W A;  1UNS A;  1TYG B;  1VJK A;  4L1B A;  1RFK A;  2BT6 A;  4B0M A;  3MC9 A;  4YSX B;  3EA6 A;  4DDI D;  1P98 A;  1R4N I;  2JRI B;  2AQ3 B;  2BQQ A;  3GE3 C;  2WXH A;  2IYD B;  2VZK D;  2CS4 A;  4TV3 A;  2MJ3 A;  1UWM A;  3M63 B;  2JYT A;  4WAF A;  2BPS A;  3NS8 A;  4PYU A;  3MJW A;  3FC4 A;  4W9G A;  1ET9 A;  4Q2J A;  1HEZ E;  4IM3 A;  3T3N A;  1NEN B;  3KH0 A;  4FN2 A;  2KFK A;  4DXA B;  1DYQ A;  3SD5 A;  3AU4 A;  3DVG Y;  1AYF A;  1TGZ B;  1EF1 A;  4E74 A;  2N9P C;  4NJC A;  4N6E B;  2D11 A;  1I4H A;  3Q3N C;  3U52 E;  1PDX A;  3H7S A;  3PRE A;  3JSV A;  3OWE B;  1UF0 A;  2N9X A;  1TS3 A;  1T6B X;  4RF0 A;  2BS3 B;  5E6P A;  3APC A;  5C3J B;  3BII D;  3ZNZ B;  5D2M B;  2N9L A;  2KKC A;  1QOB A;  3VTV A;  3OG5 A;  2WDV B;  4W9H A;  2BKF A;  1K53 A;  3WCQ A;  5TR5 A;  2W54 A;  4HJG E;  2BS2 B;  1NBF C;  1FCL A;  1D5Z C;  2MWS B;  2K25 A;  4DHJ B;  1XT9 B;  1WF9 A;  2KN4 A;  1Z2M A;  1WIA A;  2RDB C;  4AQ7 A;  1HE8 A;  4RFB A;  3RN9 C;  3CWI A;  3UIO B;  4PS8 A;  3A1Q B;  4JPS A;  1L7Y A;  2KAJ A;  4MT5 A;  1TBE A;  2FBW B;  2VZK B;  3FIL A;  4HLE A;  3DPD A;  2CR5 A;  1ZXI A;  2WP9 B;  3AEB B;  3MC8 A;  2JZZ A;  5AUI A;  4RGO S;  1IGC A;  4MSQ B;  5D7G A;  2L05 A;  1HQR D;  1WJN A;  2IO1 B;  1AWD A;  4LNI A;  3HRD D;  3DDC B;  3TMP B;  2D3G A;  3JYU A;  1NI3 A;  2KMM A;  1WX9 A;  2KTR A;  1F2R I;  4M8N A;  2WXP A;  1P7F A;  1E9M A;  1JWM D;  2MA9 B;  4BZA A;  4TQ1 A;  2IO0 B;  3JVZ X;  1HZ6 A;  1UBI A;  1S3S G;  4C56 C;  3A4S C;  1TT5 B;  1GC7 A;  3L0W B;  4EE2 A;  3RFZ B;  2KJH B;  3TCA A;  1ET6 A;  2MP2 A;  4MGK E;  2WXI A;  3PSE B;  2LUE A;  2LGY A;  4P7I A;  2WDQ B;  4IM2 A;  1BUI C;  1E7U A;  2IBI B;  2JPH A;  3A1Q A;  3VR8 B;  1YX5 B;  2QIL A;  5E6N A;  3TEY A;  1F9J A;  3FIL B;  5JZE B;  2K6D B;  4DHJ D;  3QHT A;  3BZD B;  1SGH A;  2L52 A;  2QSD A;  3V05 A;  3APF A;  4GDK B;  2FCQ A;  2L0T A;  4P1C C;  1MI0 A;  2V3S A;  1SIJ A;  1KLG D;  1RRB A;  1C79 A;  3CIR B;  2FCN A;  4P6V F;  1WZ3 A;  1WFY A;  2CJO A;  3PZ7 A;  1SE4 A;  1SBB B;  1I4X A;  4A9A A;  3RD2 A;  2KMC A;  1HXY D;  1C9F A;  2NPT A;  3AB5 A;  1QZE A;  2CJN A;  4A6Q A;  2C7H A;  1UWX A;  3RNA C;  1J0G A;  2W3S A;  1LO5 D;  1XCT L;  2CKH B;  2ZW0 A;  3PT2 B;  2DBY A;  3RNF C;  1RFA A;  2KDE B;  3P4P B;  2GB1 A;  5CX3 A;  3N1X C;  2WXK A;  4BOS C;  4IDI A;  5MPO A;  4E3C A;  4URK A;  4XYC A;  3KVF B;  1E8Y A; 
#chains in the Genus database with same CATH homology
 4DQO C;  1TY2 A;  2I2Y A;  1MVK A;  1FCC C;  3AE5 B;  3O13 A;  3ZYY X;  1TS4 A;  1J7B A;  2NTS A;  3Q8B A;  2K3U A;  2DWQ A;  1I4Q A;  2QIE B;  5H92 C;  3W2D A;  1YN5 A;  2WDR B;  3RPF C;  2R61 A;  2V0G A;  4AS1 A;  1WYG A;  2I38 A;  1PUT A;  1ZOY B;  1ZP0 B;  1T5X D;  1BXT A;  4C80 A;  1XF5 L;  2SAK A;  2INN E;  4GLS C;  3V3X A;  1KF6 B;  3IT6 B;  1XO3 A;  1GOZ A;  1IBX A;  3R8B A;  3SEB A;  2JXT A;  1SEB D;  4HKQ A;  3HUI A;  1JWU D;  4HRO A;  3P1M A;  1D4B A;  3NVV A;  1CK1 A;  2SEB D;  2PKO A;  2WXO A;  3DWM A;  4XWT A;  1FFV A;  1NYR A;  2V3P A;  3P63 A;  5GXG B;  3NS1 A;  4TMA B;  5EE9 A;  3AM9 A;  1V1O A;  2GRI A;  1ZE3 D;  2WXJ A;  5D3I B;  2RDH A;  1VR9 A;  2PIA A;  2AQ2 B;  3AE4 B;  2LEK A;  1GB4 A;  2GI9 A;  2N7J A;  1K51 A;  2WS3 B;  3ZQ4 A;  1C77 A;  3AEC B;  4YT0 B;  4OVZ A;  1EM7 A;  2M0A A;  3EUB 2;  4OW0 A;  2G1E A;  2CU3 A;  2PVO D;  3T3O A;  1KLU D;  1MHH E;  1Q10 A;  2NMQ A;  1XLP A;  1K50 A;  3AE1 B;  4YWG G;  3HVD A;  1B9R A;  4L2Y A;  1SJE D;  3HVZ A;  3BYT B;  1WRI A;  1FMA D;  1HA5 A;  3MP9 A;  3NVZ A;  1TKG A;  1XCQ L;  1TY0 A;  3W1S A;  1V97 A;  3TEX A;  1DOI A;  1SE2 A;  1E6E B;  4GDL B;  1MHX A;  3AEF B;  4ZYS A;  4N59 A;  1QOG A;  4LLG M;  1I7H A;  3L4P A;  1I4R A;  1FM0 D;  4YTM B;  2AQ1 B;  4OZC A;  1EWY C;  2LHE A;  1WXQ A;  4KGT A;  2WXG A;  2PW9 A;  1FNU A;  4KGS A;  2WXQ A;  4HKZ E;  1FXI A;  2WXF A;  4R3D A;  5BYS A;  1KRH A;  3BWU D;  2K5P A;  1ZUD 2;  1YQ4 B;  4HRS A;  4RNA A;  3AE6 B;  3PO0 A;  1WSP A;  2IPK D;  4KKI A;  2E3T A;  1TJE A;  1JAL A;  2XN9 C;  3NRZ A;  1V1P B;  5G5G A;  3B9J A;  1R7S A;  3MFG A;  2RMM A;  2DYM A;  3NZ3 A;  4M0W A;  3BK1 A;  4YSZ B;  2ON8 A;  1MPE A;  1FRR A;  2HDE A;  4RGN A;  1QKZ A;  3SFD B;  4USA A;  1L0X B;  3U2S C;  2J4X A;  3BVM A;  1ESF A;  1QIL A;  4C7Y A;  2IJ0 A;  3LXF A;  1UGJ A;  3B2G A;  1Y56 A;  1F77 A;  1GPX A;  3AE3 B;  1J7C A;  2AX5 A;  1FFU A;  1VRA B;  2DYO A;  2JX5 A;  3AV8 A;  2JYE A;  1ACC A;  1D6E C;  1JWA D;  1SB3 C;  4LTU A;  1JRO A;  1L0Y B;  4US9 A;  4WIP A;  1AN8 A;  2OHF A;  1YN3 A;  1V8C A;  3Q8E A;  4IOI E;  1TS2 A;  4XWW A;  2LHD A;  3I57 A;  3UI3 A;  3E56 A;  2BYT A;  3GB1 A;  2L83 A;  2Y3A A;  1N60 A;  2D5G A;  1RM6 C;  2WLB A;  2Y5C A;  4C7Z A;  2H88 B;  2RDG A;  2IGH A;  3U7Z A;  1IBX B;  3IXS A;  1L4D B;  2BBC A;  1DGJ A;  1XLQ A;  2BB6 A;  1EWC A;  2FE8 A;  2LMC A;  5T8I A;  3W9C B;  1C78 A;  1JWS D;  2EEL A;  2WXL A;  2QEJ C;  5FKA C;  1FIQ A;  3VQI A;  4REZ A;  3AH7 A;  1CJE A;  5E6J A;  1L6V A;  4A90 A;  2W3R A;  2WXN A;  1UNS A;  1N5W A;  1TYG B;  1VJK A;  4L1B A;  3BVG A;  2ONQ A;  4O1N A;  1RFK A;  2BT6 A;  4ZHO A;  1WWT A;  4B0M A;  4P16 A;  3VR9 B;  5AUK A;  4YSX B;  3EA6 A;  4RGT A;  4PT5 A;  3AEE B;  1ZPS A;  2QMT A;  2W82 A;  2RPV A;  3ZGZ A;  4XDC A;  3W5V B;  4HEA 1;  3VRB B;  1L4Z B;  2AQ3 B;  3KLS X;  1N63 A;  5G5H A;  1FO4 A;  4A55 A;  2WXH A;  1ZXH A;  2VZK D;  2Y5P A;  3SR6 A;  5FK9 C;  5D3D A;  2MJE A;  5BMI A;  1NEK B;  3ABV B;  2MJD A;  2MJ3 A;  3KWL A;  1UWM A;  4WWM A;  1JWB D;  4B0E A;  4H2A A;  2JYT A;  2N9K A;  3NVW A;  4WAF A;  2KWD A;  2ZW1 A;  3FC4 A;  1VZ7 A;  5BYR A;  1KTK A;  2DLB A;  1ET9 A;  4Q2J A;  1HEZ E;  1OFF A;  4YSY B;  3T3N A;  1F2R C;  1NEN B;  1JCK B;  4MH8 A;  3ZJV A;  4ARI A;  2WU5 B;  1DYQ A;  1XLO A;  3AMZ A;  1EU3 A;  3KWV A;  5HFY A;  1L0V B;  1C76 A;  1L5P A;  2YEP F;  1QOA A;  4FXC A;  2BS4 B;  1AYF A;  5EE1 A;  1GAQ B;  3ZJT A;  1RYJ A;  2JSV X;  4NJC A;  4N6E B;  4DXG A;  1SE3 A;  2E6X A;  2KDM A;  3B2F A;  1A70 A;  2QJL A;  2OED A;  1I4H A;  2N0S B;  3PZ8 A;  2ICI A;  3IAS 1;  3U52 E;  2Q5W D;  2W55 A;  1PDX A;  3AE9 B;  3MHZ A;  3OWE B;  4YTP B;  1YNT E;  3P4R B;  3SFE B;  3NVY A;  1XEE A;  3W5U B;  4NAW B;  1QLB B;  1TS3 A;  1OQQ A;  1C4A A;  1T6B X;  3MJ5 A;  4JE3 B;  1ROE A;  1RWS A;  4RF0 A;  1N61 A;  1XLN A;  2LGI A;  1M4V A;  2BB5 A;  2K0P A;  2BS3 B;  2PVG C;  2X38 A;  3N9Y C;  3Q8F A;  5C3J B;  3BII D;  1IUE A;  3DWG C;  2N9L A;  2PLP A;  1QOB A;  2WDV B;  5JXV A;  3TEW A;  2WU2 B;  1K53 A;  3WCQ A;  2WXM A;  4WQM A;  2W54 A;  4HJG E;  2BS2 B;  4ITK A;  4RH6 A;  5C2T B;  5HG2 A;  4RGM A;  1FCL A;  1D5Z C;  1VZ8 A;  1B1Z A;  1STE A;  4JX1 C;  2KN4 A;  4J3O D;  1VZ6 A;  3GP7 A;  3AEG B;  1PGB A;  3TSS A;  4N58 A;  4RF1 A;  1BML C;  4AQ7 A;  4RFB A;  2JU6 X;  4IKG A;  4XE0 A;  1WGK A;  3CWI A;  1PFD A;  4JWS C;  2V4I B;  1FRD A;  1GB1 A;  2WQY B;  5FR3 A;  4JPS A;  1EU4 A;  2KAJ A;  4MT5 A;  2EKI A;  2FBW B;  2VZK B;  1VDV A;  1JRP A;  1QOF A;  5EE0 A;  3FIL A;  5TSS A;  1ZXI A;  2WP9 B;  3AEB B;  5AUI A;  4RGO S;  3AEA B;  1OQR A;  1KFY B;  1DOY A;  2MEK A;  1IGC A;  4KGR A;  3MC0 B;  2MH7 A;  1C4P A;  4ZRP A;  3AED B;  1J7A A;  5D7G A;  4L23 A;  1JQ4 A;  1HQR D;  3I9V 1;  1L6U A;  1AWD A;  3AE2 B;  1ZDX A;  4MAC A;  3HRD D;  3ZJU A;  3P42 A;  4TQ0 A;  1NI3 A;  2J42 A;  2J53 A;  2WXR A;  1FEH A;  3NUH B;  1N62 A;  2KMM A;  2K9X A;  2L1A A;  1F2R I;  1FNV A;  2WXP A;  3AN1 A;  3TUO A;  3VRA B;  3LB8 C;  3TEZ A;  1VLB A;  1P7F A;  2KQ4 X;  3Q8C A;  3EGR A;  2LUM A;  1E9M A;  1JWM D;  4KX6 B;  1PYW D;  3BK2 A;  1SXT A;  5BYQ A;  4CQN A;  4TQ1 A;  1FXA A;  1TKY A;  2PMV A;  4WH4 A;  5HI1 A;  3Q8A A;  3FAH A;  1HZ6 A;  4JWU C;  4YTN B;  4C56 C;  2L32 A;  2TSS A;  4ZOH C;  2V3N A;  4KKJ A;  4EE2 A;  3P4S B;  5BMH A;  1PGX A;  4ZHP A;  3RFZ B;  1CQV A;  1TKE A;  1I4G A;  1ET6 A;  3U4E G;  2WXI A;  2IGD A;  3GS2 A;  4LK0 M;  1E7P B;  1NVI D;  4UDU C;  2NTT A;  2WDQ B;  1TS5 A;  1BUI C;  5H8Y E;  3Q69 A;  3BYY B;  2JWU A;  2FUG 1;  4OHJ A;  3VR8 B;  2KAC A;  2QIL A;  1IGD A;  2HTM E;  3TEY A;  3FIL B;  1YQ3 B;  3IT4 B;  1D5X C;  1HZ5 A;  1CZP A;  2B76 B;  3BZD B;  2L52 A;  2QSD A;  3V05 A;  5EE3 A;  4GDK B;  4WUR A;  4A8X C;  1DOX A;  1MI0 A;  1T3Q A;  1E10 A;  1P7E A;  1SIJ A;  1K52 A;  4OZA A;  3E9S A;  2PTL A;  1KLG D;  1C79 A;  3CIR B;  1YMH E;  2BW2 A;  4P6V F;  1SSN A;  2LFI A;  4MM3 B;  2LJI A;  1ENF A;  2XNA C;  3AE8 B;  3KQ4 A;  1I4P A;  1NYQ A;  1YJI A;  1YN4 A;  2CJO A;  3ETR A;  3PZ7 A;  1SE4 A;  3R2I A;  5LNK 1;  1SBB B;  1I4X A;  1SF0 A;  3C8Y A;  4A9A A;  3J9C A;  1E0Z A;  1YJJ A;  2IDY A;  2M19 A;  3IAM 1;  4YXD B;  1AW7 A;  1HXY D;  5I4D A;  1C9F A;  1KH0 A;  2G9H D;  3AB5 A;  3H8H A;  1FNW A;  5HHD G;  2CJN A;  5BMG A;  4A6Q A;  2INP E;  1D5M C;  1QT9 A;  1ZDV A;  1UWX A;  2K22 A;  2JZP A;  2Z8L A;  4ARC A;  2JQR B;  4NZL B;  1PGA A;  1QQR A;  2W3S A;  1QF6 A;  1LO5 D;  2BTE A;  4D2K A;  4RCO A;  1XCT L;  1XXG A;  3P4Q B;  1C4C A;  1SJH D;  3LYY A;  4NAM A;  1N5X A;  2ZW0 A;  1FD6 A;  2ACZ B;  4XDD A;  2WNM A;  1V1P A;  4TSS A;  2DBY A;  4OZB A;  2M56 B;  3URY A;  3P4P B;  1UUP A;  4US8 A;  4ZRQ A;  2GB1 A;  2IGG A;  2WXK A;  1TZO A;  2J52 A;  1JML A;  3BVZ A;  1F0Z A;  3R2T A;  1JW9 D;  2YEP B;  2H89 B;  3AE7 B;  4IDI A;  5MPO A;  4DXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...