4A3OA

Crystal structure of the usp15 dusp-ubl monomer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
211
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3oA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3oA01
2IBIB 3ZDTA 1J0GA 3A33B 3NS8A 1WX9A 4E3CA 4B9KA 4ICUA 4EZLA 2O6VB 4K1RB 3DBRI 2KQ7A 3MJWA 2GBJA 1WM3A 1ZGUB 4IM0A 3L17A 4DHJD 1WXSA 1GUAB 2ZPNA 1EUVB 3AU5A 2NBWB 4A20A 3X0WA 1LM8B 3ML8A 3T8MA 5EDSA 2WYQA 2NPTB 4ANVA 1R4NI 5GMVA 5J2RA 1VCBA 3A9KB 3RUIB 2KX0A 1V2YA 3LDZE 3QK0A 2KC2A 4MGKE 4KIKA 2JZ3B 2YVCA 1G6JA 2JT4B 2JRIB 3HM6X 4EKUA 3R66C 3KYDD 4HWIB 2BPSA 4URKA 5C23A 1ZKHA 2ZEQA 5AZFA 3KUZA 1P98A 2G4SA 3ZIMA 1V80A 3A4RA 4LCDE 3DQVA 2K25A 1WIAA 3CF6E 3UIPB 5JHBA 4JQWC 1WM2A 2UYZB 4FBJB 3IVFA 3L0WB 4FJVB 1V9JA 4G11A 1X1MA 4KZ0A 2CHZA 2G3QB 2GBMA 3APCA 3HM3A 1OQYA 2BYVE 2DENB 2ASQA 1OGWA 2XEWA 4X57B 2FCSA 5CX3A 3OLMD 4BVUC 4KDLB 4PS3A 1Z5SB 1SIFA 1U4AA 3JSVB 3S2AA 1WF9A 3WAPA 1P3QU 1P9DU 3RD2A 2EMSA 5D94A 1BT0A 3L54A 3UIOB 4LDTB 2ZVOA 4DHZB 4MGYE 2D2QA 3PV1A 4II3B 2GBKA 1UBIA 1C3TA 3PRZA 4JGHB 4TV3A 2N4FA 4MH0E 4WQOB 5G2NA 1WH3A 3U8ZA 1YX5B 2J0JA 3PRPB 3WALA 1WMHB 2C9WB 2R2OA 5L95C 4XX5A 4ZDVA 1WJUA 2M0XA 2LRUA 2LUEA 5FR6A 5IAAC 2AYOB 2KQSA 2CU1A 3ZVVA 4MM3A 5J18A 5AZHA 4I6PA 4DXAB 3ZNID 3VHTC 3DCGA 1KOTA 4HCNB 4HDQA 2CHWA 3VAWA 4OVUA 3N32A 5LLIA 3WAMA 1K8RB 2KMAA 1HE8A 3PS6A 1LXDA 2UWQA 5CHWA 4W9GA 2L00B 3CMMB 2XBBC 4IM2A 3OAWA 2MQJA 1NDDA 4RM8A 2KNBA 2IO0B 4G0NB 3VQIA 4A3PA 4BKGA 1IP9A 2JF5A 3N3KB 4FADA 3JYUA 2ZJDA 3PHXB 4GDLB 2C7NB 4DK5A 2DX5B 2HD5B 3AU4A 4GB9A 1YD8U 2KFJA 2NPTA 2KK8A 2OOBB 1E7VA 2KHWB 2AL6A 2Y5BB 4A3OA 3QC8B 3A9KA 3VH3B 2FIFA 4ANUA 4EFOA 4M8NA 2LRWA 2WDTB 2MLBA 3HHMA 1EF5A 1TBEA 2WX1A 2FCMA 1V81A 2N9PC 3AULA 4CHKA 1XQQA 5L83A 2DYOA 1P0RA 2KTRB 4KV2A 4NPNA 4GMVA 4ZRKA 4ANXA 1H4RA 1E7UA 2NVUI 5AEKB 4ANWA 2DYMA 4KZCA 1UBQA 2KDBA 2V1YA 3PPAA 3ZTDA 1RFAA 3RZWC 3Q3JA 4BKSD 2FCNA 1KM7A 1EO6A 2PJHA 2BWFA 3QAQA 1WR6E 3RT3B 2JUOA 4TQ0A 3UINB 4FJYA 3QA8A 4NNJB 2O2VA 4W9HA 3A9JB 2JPHA 2KTFA 4GDKB 1E5WA 4F7ZA 3Q3FA 3A4SC 3VUXA 1J19A 2AEHA 2M8SA 2LVPA 2MBQA 4J6IA 1I35A 1VD2A 5G55A 4WJPA 3W1YA 5J17A 4M8MA 1UGMA 3DOWA 1XT9B 3DVNV 4XC2A 3VH4B 1RLFA 5AZGA 3OJ4B 2KFKA 4FULA 2K39A 1GC6A 2KJ6A 1Y8RC 4AOFA 4NAWB 3EHVA 4EUTA 2ZNVC 1WJ6A 3IHPC 3N30A 1V5OA 3W1SA 4HPMB 3DBHI 4DHJB 1SGHA 2MBOA 3ZUNA 3APDA 2LGDA 4MJSA 2NR2A 1WMHA 1UELA 4IWOA 3RULA 1E8XA 2GBNA 2NCNA 3ZKJC 4DHZE 3MTNB 1IYFA 2MBEA 3K9OB 2J0KA 2V3SA 4FN2A 4NJ6A 3SDLC 4HXDA 4TQ1A 5DPTA 4W9KA 4RM9A 3V61A 3JVZX 1WGRA 3QQ8B 2LGYA 3KUCB 2KC1A 3ECIA 4XZ4A 2A5UA 3H7PB 4WJNA 3RZFA 2N1WA 2LVQA 4P7IA 1IPGA 3ZRFA 2JY6A 5JHAA 3UF8A 4ICVA 2KWCA 3WAOA 1CMXB 2XK5B 3PGEA 4DWFA 1R4MI 2REXA 2MP2B 2RPQA 2D10A 4NQKE 3QARA 2D07B 3R7QA 2HTHA 5DPWA 4GDLA 4JL9A 3KW5B 3QCAA 5DPRA 4E74A 2D3GA 4HLEA 2LWPA 2KZRA 1PQSA 2L3ZA 4AJYB 4BBNF 4II2B 3NY5A 1UD7A 4EOYA 4I6NB 4JIOU 4IWQA 2GOWA 4IG7B 3ONSA 3ZTCA 1XD3B 2KX3A 2J7QB 2L05A 2MA9B 3B08A 2KN5A 3LJ3A 2KTRA 3R3MA 3L16A 2VRRB 3R7RA 3AXCA 1WGHA 2BKFA 3APFA 4GXBA 1NI2A 1WJ4A 5TR5A 2AL3A 1WRDB 2LJ5A 2JXXA 2MSED 4MSQB 3T9LA 2L0TA 2OJRA 4BFRA 1GJZA 3C0RB 2BKRB 4PYUA 2LXAA 4FJZA 3SHQA 4BBNC 2K8CA 2I1JA 2IY0B 3KUDB 5E6NA 2BYFA 4G50A 3PTFC 4WWNA 1F9JA 4KDIC 3VTVA 4B6WA 1Q0WB 2C5LC 1H8CA 2J0MA 4KSLC 3DBSA 2K6QA 4NY0A 3V6EB 3U30A 2RGFA 2KJHB 3ZW3A 4PYZA 3A9JA 2JZZA 4GDKA 4K81A 2G45B 2L7RA 2O6VA 2V4LA 2MCNB 2KMCA 5D7GA 1V86A 2A4ZA 1WGDA 2C60A 2DZKA 3UGBB 3L10B 1RRBA 3UQAA 1TGZB 1OEYA 2GBRA 4IM3A 3VDZA 2B3AA 2FCQA 4DDID 2IZVB 4NJ7A 3ZO5B 4HCPB 3LMNA 4KVGB 4B95A 3RYTA 4BOSC 2LASA 1V6EA 1E90A 2CR5A 2MBBB 2CKHB 3TIXA 3PT2B 2K8HA 3PZDA 4TUUA 2FUHB 5DPSA 3ENEA 2KVRA 4HVBA 2MW5A 2Z0EB 3M3JA 4W9LA 3IBEA 2JVCA 3L08A 2LVOA 4F8CB 3ZNHB 2KXJA 2NS5A 4AWJA 5BO4B 3V60A 3SD5A 4ZYNA 3A1QB 3GZNI 4GSWA 1S3SG 3HK0A 4ZRJA 4ASWC 4IUMB 4JLCA 2KDIA 4ZRIA 3MHSD 2WWZA 4HPLB 4OVVA 2ZZPB 2AWTA 1GC7A 1WZ0A 1WYWB 4HDOA 4W9EA 3JW0X 2FIDA 5KHOA 5E6OA 1OEYJ 3ZRCA 2ZNVB 2EMTA 2IYDB 4IW0A 3M63B 1L7YA 3K9PB 2BYEA 2FNJB 4E71A 2KKCA 2YLMA 2MP2A 3QHTA 5E6PA 1EF1A 3JSVA 4TKNA 3BINA 2M17A 4NQLB 1WE7A 1WGYA 4IWPA 3ZDMC 4MSMB 2JRHA 4PS8A 3WANA 4W9DA 4AUQC 2KJRA 1RAXA 1WJNA 2IO2B 2BGFA 4W9CA 3QX1A 4GIVA 1Q5WB 2CHXA 2KOXA 3IFWB 2Z59B 2HE7A 4W9JA 2C7MB 3PRMB 3EECA 2KDEB 4K7UA 4GGQA 3CSFA 4RMAA 2L0FA 2L8JA 3KVFB 4DBGA 2RD0A 3NOBA 3ML9A 3H9DA 3PLVA 4GOCA 4AP4C 3TBLD 2DHZA 4LJOB 4AJWA 3PHWB 4HJKA 1SE9A 4WWPA 3ZNGC 5CHVC 1A5RA 2GMIC 4MDKE 4MEMA 1WGGA 2KLGA 1M94A 2MX2A 1Z2MA 3H7SA 2ZVNA 3KYCD 4FHJA 4M0WB 3NZUA 1LQBA 2K8BA 2DYBA 2BWES 3PVLA 1UZXB 3V6CB 1QZEA 3I3TB 4HK2A 3TCAA 3M95A 3PREA 4MGZE 4FHKA 3DVNU 2M1MA 3QWZB 3RCZA 2PE9A 1J8CA 2JWZA 3GOEA 1YQBA 4LJPB 5LXIB 3VUYA 2HJ8A 3QJZA 5CTRC 3V62A 4EZJA 1LFDA 3PSEB 2O2VB 4IC7B 1T0YA 4FLHA 3TJPA 2N9XA 4LDTD 5C1ZA 1I42A 3TL5A 5LXHA 1V49A 2N7DA 2RSUA 3B1LX 1D3ZA 1W6VA 3EC8A 4EEWA 3B0AA 2KLCA 3DVGX 4N9F4 3PLUA 2PPHA 3ALBA 2EKEC 3A1QA 1NBFC 2KFKB 4FA6A 1YX6B 1GG3A 3KH0A 1E8WA 3OJ3A 3DDCB 3NZSA 3SU8X 1E8ZA 2DZIA 2K1FA 3EFUA 2I1KA 3M62B 4WAAA 3NHEB 2IY1B 5JH5C 1WX8A 2LXCA 2IO3B 2LZ6A 3L13A 3VXWA 3ZLZA 4KIKB 5CHFA 4MJSB 2PE6B 1WY8A 3P2BA 4BKSA 4KSKC 4W9IA 3H6NA 3VVWB 2PEAA 1MG8A 2KANA 2L76A 4F1SA 2C7HA 1FXTB 3DPDA 1UH6A 1YJ1A 5D2MB 1YIWA 1WI0A 3H1UA 3W1SC 1S1QB 5D6JB 1WFYA 2BF8B 4PS7A 5KHQA 1WXVA 1JRUA 4NAWA 2DAJA 4CYEA 2MRPA 5HKHA 1GNUA 1L2NA 1ZW7A 4GU2A 5JZEB 2DAFA 4BKTA 1ISNA 5DCNA 3BY4B 3U7DA 4MELA 1KJTA 2G4DB 2ZCBA 3VTUA 3D32A 1WZ3A 2KD0A 4W9FA 2R2QA 2KO3A 3TMPB 2DZJA 3VTWA 2N1VA 2MWSB 2NBVB 3IG3A 2KDFB 2DZMA 2WX0A 2NBUA 1E8YA 3HIZA 4BOZB 1WE6A 4DDGD 1WX7A 3H7PA 4WJOA 4MGIE 2ZPYA 1AARA 1TZ1A 1WXAA 1V5TA 4G3XB 4I6LB 3UQBA 3AI5A 2FAZA 2K6DB 4WWOA 3QIJA 1WR1A 1C1YB 3O65B 2KWVB 2LD9A 3VFKA 1Q1OA 2RR9A 3WIMA 4K7SA 2LGXA 2XK5A 3DBLI 3VUWA 4GN1A 4EZKA 3DVGY 3WA0A 2LI5A 1KLVA 4WJQA 5IA7A 4YL8A 1WXMA 2N9EB 2O6VD 2MBHA 2QHOA 2KWUB 2M4NA 2D11A 2Z0DB 3X23A 2CS4A 4K7WA 1OTRB 3CSTA 2ZCCA 3ZNZB 4CO7A 2W9NA 1P1AA 2N7EA 1TTNA 2IO1B
chains in the Genus database with same CATH superfamily
3A33B 4ICUA 4LNIA 4EZLA 3DBRI 2KQ7A 3SFDB 1LGRA 2GBJA 1ZGUB 3E56A 2L52A 4HJGE 1EUVB 5EDSA 2OJWA 2WYQA 1D5ZC 3OG5A 1SIJA 3O13A 1V2YA 4KIKA 4XYCA 3HM6X 4EKUA 4URKA 2PIAA 2ZEQA 5AZFA 3KUZA 3ZIMA 2G4SA 3NUHB 3NS1A 1V80A 1BUIC 1PUTA 3A4RA 2K25A 1WIAA 1YJIA 3CF6E 2QCZA 1IBXB 4JQWC 1R4MB 1WM2A 2UYZB 1X1MA 2BYVE 2GLSA 2JX5A 2ZW1A 4KDLB 2WXPA 1U4AA 3P4RB 1TZOA 1WF9A 3RD2A 1N6ZA 1XCTL 2E6XA 1QOFA 3L54A 4LDTB 4DHZB 1WGKA 2D2QA 1GPXA 2WDVB 4II3B 2GBKA 2JXTA 3PRZA 3DHHC 4TV3A 2J4XA 1ESFA 5G2NA 1YX5B 3WALA 1Q10A 4XX5A 2IJ0A 2BQQA 1JW9D 2CU1A 1L5PA 4I6PA 1FEHA 3P42A 1KOTA 1C78A 2KYWA 2K3UA 3RNCC 2WXMA 1HE8A 3LXFA 3PS6A 1VJKA 2UWQA 2XBBC 3Q2AC 1JROA 3T3NA 2JQRB 4DK5A 2DX5B 1YMHE 4GB9A 5BYQA 2KFJA 2OOBB 2DNFA 1E7VA 4QAYA 3A9KA 5G5HA 3VH3B 2PTLA 2Y3AA 2WDTB 1EF5A 3AULA 1XQQA 2DYOA 2VH1A 4YSXB 3AE9B 1TYGB 1UBQA 2KDBA 2V1YA 2MH7A 2JSVX 2IPKD 5AUIA 1I7HA 2D3CA 3RT3B 4TQ0A 2WQYB 3B2GA 2XNAC 4FJYA 1F77A 2KTFA 4GDKB 3Q3FA 3VUXA 2AEHA 2M8SA 4J6IA 1I35A 5G55A 4M8MA 2KFKA 1Y8RC 4NAWB 3EHVA 2LUMA 2ZNVC 3IHPC 1V5OA 1C76A 2WS3B 2MBOA 3ZUNA 3Q8FA 2LGDA 4MJSA 1E8XA 2GBNA 1IYFA 2BBCA 1BXTA 4NJ6A 4HXDA 3JVZX 4XWTA 3W2DA 4XZ4A 5BMIA 5JHAA 3UF8A 3SEBA 4HPPA 2RDHA 3WAOA 1L0VB 1XO3A 2LJIA 5DPWA 1C77A 5BYRA 4II2B 1UD7A 4I6NB 2GOWA 1XD3B 3AB5A 3LJ3A 1QT9A 3B08A 3V05A 3APFA 1ZUD2 4GXBA 1L0YB 1WJ4A 5TR5A 1HTQA 1WRDB 1N62A 1DOXA 3RPFC 2C5LC 3BWUD 4P1BC 4N58A 2LHDA 1CJEA 2MHJA 1E0ZA 2V4LA 1N61A 2ICIA 2A4ZA 2PVGC 4B0EA 1TGZB 2GBRA 2B3AA 2WU2B 2IZVB 4DDID 1ROEA 1MHHE 4BOSC 1IGCA 2LASA 1V6EA 2CR5A 3TIXA 3PT2B 4C7YA 1BMLC 1AWDA 3ENEA 2Y5PA 3L08A 2OEDA 4AWJA 5BO4B 3SD5A 3A1QB 1S3SG 3HK0A 3MJ5A 3MHSD 1PGAA 3GE8C 3OWEB 2ZNVB 2X38A 4IW0A 2FNJB 4E71A 1F1HA 4MSMB 2AQ2B 2JRHA 1VRAB 4W9DA 4AUQC 3R8BA 1RAXA 1WJNA 4MT5A 2IO2B 1F52A 4W9CA 4LNNA 2Z8LA 3FKYA 4CQNA 1JWBD 4GGQA 1R7SA 1TT5B 4GOCA 5CHVC 1A5RA 3RI7C 2FUG1 1Z2MA 2MX2A 4M0WB 2K8BA 3PVLA 1F2RC 4HROA 1QZEA 3TCAA 3RFZB 2I2YA 2M1MA 1WSPA 1ZXHA 2JWZA 3GOEA 5LXIB 4ZHOA 3QJZA 5CTRC 3V62A 4EZJA 5C1ZA 5HFYA 3TL5A 2RSUA 3AMZA 2KLCA 4N9F4 3PLUA 3ALBA 2KFKB 4FA6A 3SR6A 2KAJA 1GG3A 4KKIA 1E8WA 3DDCB 4FXCA 2QC8A 5JH5C 1WX8A 2LXCA 1MI0A 2KT7A 2LZ6A 4MJSB 4BKSA 4KSKC 3VVWB 4YTPB 1I4HA 1UH6A 1KLUD 1YIWA 1KH0A 1S1QB 2QJLA 2BF8B 4PS7A 4YT0B 1RYJA 1WXVA 1JRUA 5JXVA 4CYEA 5HKHA 4UDUC 4GU2A 5JZEB 1ISNA 4TMAB 5DCNA 4MELA 2ZCBA 2KO3A 1N5XA 1SE2A 1YNTE 1E8YA 1EU3A 1I4RA 1JWSD 1D5XC 3QIJA 1WR1A 1UF0A 2KWVB 4K7SA 3DBLI 3AEGB 4P1CC 2OHFA 5FR3A 2N9EB 2QHOA 1JWAD 3DWGC 2CS4A 1OTRB 1F0ZA 3P4SB 2PW9A 2N7EA 3LYYA 1UUPA 3ZDTA 3ZGZA 3NS8A 4E3CA 4K1RB 4IM0A 2KWDA 1GUAB 1J7AA 3AU5A 4K3CA 1LM8B 3T8MA 2NPTB 3Q3NC 1R4NI 4LTUA 5GMVA 5BMHA 1T3QA 3RUIB 2KC2A 4MGKE 2JRIB 1FMAD 1QOGA 3N1XC 3KYDD 4HWIB 1MVKA 1T0SC 3UIPB 1SXTA 2IGHA 3IVFA 4WURA 1K51A 4G11A 2JYTA 1I4XA 2CHZA 2G3QB 2GBMA 3APCA 4OZCA 1EWCA 2DENB 1PGBA 2L32A 3FILA 3OLMD 4BVUC 3RNFC 3AE1B 4YTNB 2ZW0A 4PK1A 2WXRA 2M56B 1XXGA 5I4DA 1FFUA 1P9DU 2EMSA 5D94A 2EKIA 2ZVOA 2MJEA 4MGYE 3MFGA 2KMMA 1C3TA 4ITKA 4M02A 4MH0E 2J0JA 1WMHB 2R2OA 5L95C 1SJED 2LUEA 2KQSA 2E3TA 5AZHA 2W3SA 4DXAB 4BAXA 5D3DA 3DCGA 4HCNB 2WXOA 3HUIA 3N32A 3WAMA 2AQ1B 3CMMB 4IM2A 4J3OD 1A70A 2WXGA 4RM8A 1IP9A 3VQIA 4BKGA 2JF5A 3KLSX 2MJ3A 3JYUA 4XE0A 2LHEA 2RPVA 3QC8B 2INDC 1WXQA 3RNGC 1FIQA 2FIFA 4EFOA 2LRWA 3HHMA 2MLBA 1K50A 4CHKA 1P0RA 2KTRB 2X8XX 3BVZA 4GMVA 4JX1C 4ANXA 1E7UA 2NVUI 1JQ4A 2CJOA 2KACA 3ZTDA 4BKSD 2PJHA 1QLBB 3BYTB 3UINB 2RDBC 1QF6A 4NNJB 2O2VA 3A9JB 2JPHA 1PGXA 1E5WA 4F7ZA 3A4SC 1J19A 2LVPA 1YQ4B 3I57A 1XCQL 1UGMA 3VH4B 3RMKC 4FULA 1GC6A 3BYYB 3N30A 2XN9C 1KFYB 1SGHA 2D5GA 2NR2A 4DHZE 4B0MA 1AW7A 1VZ6A 1YN3A 3SDLC 5DPTA 4W9KA 1T0RC 4EE2A 2A5UA 5E6JA 3PGEA 2REXA 4NQKE 2D07B 4GDLA 4JL9A 2D3GA 1DOIA 1PQSA 4A8XC 4IG7B 3ZTCA 2QSDA 2L05A 2VRRB 1WGHA 2YEPF 1D4BA 2MSED 3T9LA 4MSQB 3NJTA 3VRAB 1Y56A 2BKRB 3AN1A 4FJZA 4USAA 2I1JA 3KUDB 4G50A 3PTFC 4KDIC 4B6WA 1N63A 3FAHA 2RGFA 4PYZA 2LGIA 3N9YC 1WWTA 2O6VA 1V86A 1FCLA 4M01A 2C60A 3L10B 4A55A 3UQAA 2FCQA 2KQ4X 4NJ7A 3U52E 4B95A 3RYTA 3KWVA 2MBBB 3PZDA 1C4AA 5DPSA 2WU5B 2KVRA 3AEBB 4HVBA 3FILB 2TSSA 3IBEA 4F8CB 2LVOA 3ZNHB 4IKGA 2NS5A 1JALA 1LO5D 2HTME 3GZNI 4ZYNA 4C80A 4OZAA 4ZRJA 4ASWC 4YXDB 1I4PA 1QILA 2WWZA 3CIRB 1WZ0A 1WYWB 3NVYA 5KHOA 3ZRCA 2EMTA 2IYDB 3M63B 1L7YA 3K9PB 4IDIA 2KKCA 2YLMA 1TIFA 2MP2A 2BW2A 3BINA 2MJDA 2SAKA 1V1PB 1WGYA 4IWPA 1ZXIA 3DBRB 2BGFA 1L4DB 1K53A 1FM0D 2PMVA 2ON8A 2C7MB 2VZKD 4RMAA 2L0FA 3KVFB 4DBGA 3NOBA 1CZPA 3H9DA 3KQ4A 3PLVA 5H92C 4AP4C 3GP7A 2DHZA 4AJWA 3PHWB 3N1YC 3VRBB 1GB4A 3ZNGC 1JRPA 4MDKE 4MEMA 1WGGA 2L83A 4FHJA 4AS1A 3H7SA 3ZJTA 2K22A 2W54A 1UZXB 3V6CB 4HK2A 3PREA 4MGZE 4FHKA 4DQOC 2DWQA 3QWZB 2H88B 1YQBA 4LJPB 4XDCA 3E9SA 1LFDA 3U7ZA 2O2VB 4IC7B 4FLHA 3TJPA 3AV8A 1TKYA 3NZ3A 1MHXA 5LXHA 4EEWA 1DYQA 2EKEC 1E9MA 1YX6B 3L4PA 3NZSA 1E8ZA 2WDQB 4RH6A 2I1KA 3M62B 4WAAA 2IO3B 2WXHA 1FRDA 4KIKB 5CHFA 1MG8A 4F1SA 2LFIA 3DPDA 3H1UA 3H8HA 1YQ3B 5EE3A 2J53A 3Q8EA 5KHQA 1C79A 1ZW7A 1YN4A 4LNOA 4BKTA 3HVDA 4C4VA 3BY4B 1KJTA 4Q2JA 2G4DB 2BVCA 3VTUA 3BK1A 1I4GA 2KD0A 1L4ZB 3AEEB 3VTWA 1EU4A 2NBVB 3IG3A 4KGRA 4DDGD 3AE8B 3I5JC 1D6EC 3RNEC 3DHGC 4G3XB 1V5TA 3EUB2 4WWOA 5EE9A 1OQRA 3O65B 1Q1OA 2BS3B 2RR9A 1HEZE 2XK5A 3BIID 4NZLB 3ZJUA 2INNE 3Q3OC 2G9HD 2LI5A 1RFKA 4YL8A 1WXMA 2O6VD 2I38A 2KWUB 2Z0DB 4ZYSA 4CO7A 2W9NA 1P1AA 1TTNA 2IO1B 2IBIB 1J0GA 1WX9A 4MH8A 4B9KA 4AQ7A 2O6VB 3MJWA 1WM3A 4DHJD 1WXSA 1ENFA 3UI3A 2ZPNA 4A20A 5BYSA 5J2RA 3A9KB 2W55A 3PZ7A 1ZOYB 3TEZA 1G6JA 2JZ3B 2YVCA 2L1AA 1F2RI 1STEA 2Y5CA 1XEEA 3R66C 3Q69A 5C23A 3TEWA 1ZKHA 2INCC 1VLBA 3P4QB 1L6UA 3GE3C 4ZRQA 1RM6C 3B2FA 3DQVA 3CWIA 4ZOHC 2BB5A 4GLSC 3L0WB 4FJVB 4O1NA 4KZ0A 4S0RA 4RF1A 3HM3A 2ASQA 1OGWA 2XEWA 2FCSA 5CX3A 4K3BA 2WXFA 4KX6B 3S2AA 1P3QU 1YN5A 1BT0A 5FK9C 4XWWA 4NJCA 3PV1A 1UBIA 5TSSA 3DWMA 4JGHB 4C7ZA 1PYWD 2N4FA 4WQOB 4JWUC 3N20C 1FO4A 2LRUA 5IAAC 1HZ5A 2AYOB 3AEAB 4MM3A 5J18A 4R3DA 3VHTC 4A90A 5LLIA 2KVZA 3AE7B 3Q8AA 4W9GA 2L00B 1P7EA 2GRIA 3RNBC 3PO0A 2BS4B 1E6EB 2IO0B 4G0NB 4A3PA 4US9A 4FADA 4RF0A 1SE3A 3PHXB 3AU4A 1YD8U 2UU7A 2Y5BB 4JWSC 1QOAA 4A3OA 3Q8BA 3VR9B 4ANUA 2HJ1A 2WX1A 5L83A 1B9RA 4KV2A 4NPNA 4ZRKA 1SJHD 1H4RA 5AEKB 4ANWA 2DYMA 4KZCA 3PPAA 2DBYA 3Q14C 3RZWC 3Q3JA 2FCNA 1IBXA 1KM7A 1EO6A 2W82A 2SEBD 1WR6E 2WXJA 3QA8A 1FXAA 4W9HA 1KF6B 4C00A 1DGJA 2MBQA 4WJPA 3DBHB 3W1YA 5J17A 1JWMD 3DOWA 3V3XA 1XT9B 3DVNV 4XC2A 1N5WA 3ZJVA 2KJ6A 4AOFA 1WJ6A 3W1SA 4HPMB 3AE5B 2J42A 3APDA 4RCOA 4C4VB 3RULA 3ZKJC 1T0QC 2NCNA 3MTNB 2MBEA 3K9OB 2RMMA 2J0KA 3ZXVA 2V3SA 4TQ1A 4RM9A 3C8YA 1WGRA 1VZ7A 1HTOA 2KC1A 3ECIA 1FXIA 3RZFA 4P7IA 1IPGA 4ICVA 2BS2B 1CMXB 2XK5B 3J9CA 4DWFA 1R4MI 2WDRB 2ONQA 1JCKB 4TSSA 1TS5A 2RPQA 3QARA 3KW5B 4E74A 2KZRA 4JE3B 3NY5A 1V97A 4EOYA 4JIOU 4ZRPA 2KX3A 2J7QB 2MA9B 3R7RA 2N7JA 2BKFA 2AL3A 2LJ5A 2JXXA 2G1EA 2OJRA 4PYUA 3SHQA 4BBNC 2K8CA 2IY0B 1H8CA 1Q0WB 4RFBA 3DBSA 1FNUA 2K6QA 4NY0A 3V6EB 1P7FA 3U30A 2KJHB 3ZW3A 4GDKA 2G45B 2LEKA 4N59A 5D7GA 2WGSA 2WXKA 3UGBB 1RRBA 2N9KA 1OEYA 1K52A 2H89B 3TSSA 3ZO5B 4HCPB 1E90A 2CKHB 2PVOD 1FPYA 2K8HA 4TUUA 2FUHB 2MW5A 4W9LA 4KKJA 2JVCA 3IAM1 3LB8C 2KXJA 1IUEA 2RDGA 3FC4A 3ABVB 1XLNA 1UGJA 3V60A 4GSWA 1E10A 3DBLB 4JLCA 3W5UB 2QDFA 4IOIE 4ZRIA 3EGRA 4OVVA 4HDOA 1GC7A 3JW0X 2FIDA 4L2YA 5E6OA 1OEYJ 3ZYYX 1TS3A 3IT4B 2K5PA 5E6PA 3JSVA 1WE7A 1TJEA 2KJRA 4WQMA 4RNAA 3AEFB 3QX1A 1Q5WB 2KOXA 2CJNA 3I9V1 2HE7A 3MC9A 4W9JA 3NRZA 3PZ8A 4K7UA 1R4NB 3CSFA 3TEXA 2RD0A 5HHDG 1E7PB 3URYA 5FKAC 2NTTA 1SE9A 1VR9A 4WWPA 4REZA 1B1ZA 1TY0A 2KLGA 1M94A 3NZUA 2DYBA 4A6QA 3I3TB 2BT6A 5IP4D 3DVNU 4RGTA 3RCZA 3SFEB 2PE9A 3AECB 1J8CA 2V3PA 3VUYA 1QQRA 5LNK1 1T0YA 4LDTD 1I42A 1W6VA 3BK2A 3EC8A 3B0AA 3DVGX 2PPHA 3A1QA 1I4QA 1NBFC 1GOZA 2DZIA 3EFUA 5AUKA 3L13A 3ZLZA 2PE6B 1SF0A 1YOVB 3P2BA 4W9IA 3H6NA 2LMCA 2PEAA 2L76A 1WRIA 1SEBD 3R2TA 5D2MB 1YJ1A 1WI0A 5D6JB 1WFYA 5D3IB 1XLOA 4ARIA 3NVVA 3W5VB 2DAJA 1L2NA 4WWMA 2DAFA 1NENB 1SBBB 1HA5A 5G5GA 1TS4A 3GS2A 3D32A 4W9FA 2R2QA 2DZJA 2MWSB 4ARCA 2WX0A 2NBUA 1WE6A 1WX7A 3H7PA 4WJOA 4MGIE 3ZQ4A 3NVZA 1AARA 3UQBA 4I6LB 3AI5A 2K6DB 1UWMA 1FRRA 3Q3MC 4M0WA 1C1YB 3IT6B 3VFKA 2LD9A 1CK1A 3WIMA 1ZPSA 2LGXA 5C3JB 1PDXA 4GN1A 2B76B 4WJQA 1KTKA 4ZHPA 4RGMA 2D11A 3X23A 3CSTA 3ZNZB 1FNVA 2FBWB 2ZCCA 2GI9A 5GXGB 1XLQA 4L1BA 1HXYD 3L17A 3Q6BA 2QMTA 2JWUA 2NBWB 4NAMA 3X0WA 3ML8A 3AE2B 4ANVA 2VZKB 1VCBA 3RN9C 2GB1A 3ZXRA 4YTMB 3MHZA 2KX0A 3LDZE 3QK0A 1N60A 2JT4B 4DXFA 2BTEA 2BPSA 4YSZB 3IXSA 4RGOS 4US8A 1P98A 1L6VA 2Q5WD 1ZDXA 4LCDE 5JHBA 4LNKA 2QIEB 4FBJB 1V9JA 1ZE3D 1OQYA 2J52A 4YWGG 2WLBA 4X57B 4MACA 3TEYA 2M0AA 4PS3A 1Z5SB 1SIFA 2WXIA 3JSVB 3WAPA 2D3BA 4KGTA 2M19A 4P6VF 3MC0B 3UIOB 3HRDD 1V8CA 1WH3A 3U8ZA 1NEKB 3PRPB 2C9WB 4ZDVA 1WJUA 2K9XA 2M0XA 5FR6A 3ZVVA 3ZNID 3Q8CA 4HDQA 3WCQA 2CHWA 1HQRD 3VAWA 4OVUA 1K8RB 2KMAA 2INPE 2VH2A 1LXDA 5CHWA 3OAWA 2MQJA 1NDDA 2WXNA 2KNBA 1XF5L 3N3KB 1ET9A 1T6BX 1FFVA 2ZJDA 4GDLB 2C7NB 2HD5B 2IGGA 1UNSA 2NPTA 2KK8A 2KHWB 2AL6A 1C9FA 4A9AA 4M8NA 3GZNB 3BVMA 1DOYA 2W3RA 1TBEA 2FCMA 1V81A 2N9PC 4ACFA 2BB6A 3I63C 1RFAA 1J7BA 4OW0A 2IDYA 1EM7A 5EE1A 2BWFA 2N9LA 3QAQA 2JUOA 1V1OA 1D5MC 2WXLA 4OHJA 3KWLA 1MG4A 1VD2A 4D2KA 1L0XB 1RLFA 5AZGA 3OJ4B 1KLGD 2K39A 5MPOA 2WXQA 4EUTA 3DBHI 4XDDA 4DHJB 3AM9A 1NYQA 2IGDA 4HEA1 3TUOA 3B9JA 1WMHA 1UELA 1SB3C 2WNMA 4IWOA 1FNWA 3C19A 3EA6A 4FN2A 1HZ6A 1XLPA 5C2TB 3V61A 3BZDB 2LGYA 3QQ8B 3KUCB 3IAS1 3H7PB 4WJNA 2N1WA 2LVQA 4N6EB 5BMGA 3ZRFA 2JY6A 3GB1A 2KWCA 2DLBA 3U4EG 3P63A 1NI3A 1TKGA 2MP2B 2WHIA 2D10A 1QOBA 3T3OA 3R7QA 2HTHA 3QCAA 5DPRA 4HLEA 2LWPA 2L3ZA 4AJYB 2K0PA 4BBNF 2V3NA 4IWQA 2CU3A 2NTSA 3ONSA 4L23A 2KN5A 2KTRA 3R3MA 3L16A 3AXCA 5H8YE 1NI2A 5IOIA 2YEPB 1TY2A 4LK0M 2L0TA 4BFRA 1GJZA 3C0RB 2LXAA 1ZP0B 1VDVA 5E6NA 2BYFA 4WWNA 1F9JA 3RNAC 3VTVA 2FE8A 1M4VA 3P4PB 2J0MA 4KSLC 3R2IA 1JMLA 4S17A 1T5XD 1WYGA 1C4PA 3NVWA 4LNFA 3A9JA 2JZZA 4K81A 2L7RA 4HKQA 2MCNB 2KMCA 1QKZA 1WGDA 3AH7A 4HRSA 2DZKA 3AE6B 4H2AA 4IM3A 3VDZA 3LMNA 4KVGB 1JWUD 2Z0EB 3M3JA 4JPSA 1RWSA 1ACCA 2QEJC 1OQQA 4PT5A 4IUMB 3ETRA 2KDIA 1MFWA 4HPLB 1GAQB 2ZZPB 2AWTA 4W9EA 1OFFA 2BYEA 1GB1A 5IKCM 3QHTA 1EF1A 4TKNA 1EWYC 2M17A 4NQLB 1ZDVA 2V4IB 3ZDMC 4PS8A 3WANA 5IN7A 3MP9A 3HVZA 4GIVA 1NVID 2CHXA 2HDEA 3IFWB 2Z59B 3PRMB 1NYRA 3EECA 2KDEB 3AE3B 2PKOA 2L8JA 2D3AA 1IGDA 3ML9A 3DHIC 3TBLD 4C56C 4LJOB 4HJKA 3BVGA 5T8IA 1MPEA 2KDMA 2GMIC 5HI1A 3KYCD 2ZVNA 2AQ3B 2V9HA 1LQBA 3N1ZC 2BWES 2LGSA 2KN4A 1VZ8A 1J7CA 3M95A 2NMQA 1SE4A 1KRHA 2HJ8A 4OZBA 3PSEB 1FD6A 2N0SB 2N9XA 1V49A 2N7DA 3B1LX 1D3ZA 4M00A 2JYEA 4RGNA 3KH0A 3OJ3A 4P16A 3AEDB 4BZAA 3SU8X 2K1FA 4HKZE 2WP9B 2BYTA 3NHEB 1SSNA 2IY1B 4WAFA 3VXWA 1WY8A 2JZPA 1MJDA 2KANA 1C4CA 2C7HA 2MEKA 2AX5A 1FXTB 4YSYB 2JU6X 4DXGA 3W1SC 1V1PA 4XGAB 3AE4B 4NAWA 1AYFA 2MRPA 1GNUA 2EELA 4OVZA 3VR8B 3P1MA 3U7DA 2QILA 5HG2A 1WZ3A 3TMPB 1CQVA 2ACZB 1AN8A 2V0GA 2N1VA 4WH4A 2KDFB 2DZMA 2R61A 3U2SC 3HIZA 3MC8A 1TKEA 1FCCC 4BOZB 1PFDA 2PLPA 2ZPYA 1ET6A 5IO9A 1TZ1A 1WXAA 4LLGM 1UWXA 2FAZA 3W9CB 1TS2A 3NG0A 4KGSA 3VUWA 4EZKA 4MM3B 3DVGY 3WA0A 4WIPA 1KLVA 5IA7A 3EFCA 2MBHA 2M4NA 5EE0A 4K7WA 1YJJA
chains in the Genus database with same CATH topology
2IBIB 3ZDTA 1J0GA 3A33B 3NS8A 1WX9A 4E3CA 4B9KA 4ICUA 4EZLA 2O6VB 4K1RB 3DBRI 2KQ7A 3MJWA 2GBJA 1WM3A 1ZGUB 4IM0A 3L17A 4DHJD 1WXSA 1GUAB 2ZPNA 1EUVB 3AU5A 2NBWB 4A20A 3X0WA 1LM8B 3ML8A 3T8MA 5EDSA 2WYQA 2NPTB 4ANVA 1R4NI 5GMVA 5J2RA 1VCBA 3A9KB 3RUIB 2KX0A 1V2YA 3LDZE 3QK0A 2KC2A 4MGKE 4KIKA 2JZ3B 2YVCA 1G6JA 2JT4B 2JRIB 3HM6X 4EKUA 3R66C 3KYDD 4HWIB 2BPSA 4URKA 5C23A 1ZKHA 2ZEQA 5AZFA 3KUZA 1P98A 2G4SA 3ZIMA 1V80A 3A4RA 4LCDE 3DQVA 2K25A 1WIAA 3CF6E 3UIPB 5JHBA 4JQWC 1WM2A 2UYZB 4FBJB 3IVFA 3L0WB 4FJVB 1V9JA 4G11A 1X1MA 4KZ0A 2CHZA 2G3QB 2GBMA 3APCA 3HM3A 1OQYA 2BYVE 2DENB 2ASQA 1OGWA 2XEWA 4X57B 2FCSA 5CX3A 3OLMD 4BVUC 4KDLB 4PS3A 1Z5SB 1SIFA 1U4AA 3JSVB 3S2AA 1WF9A 3WAPA 1P3QU 1P9DU 3RD2A 2EMSA 5D94A 1BT0A 3L54A 3UIOB 4LDTB 2ZVOA 4DHZB 4MGYE 2D2QA 3PV1A 4II3B 2GBKA 1UBIA 1C3TA 3PRZA 4JGHB 4TV3A 2N4FA 4MH0E 4WQOB 5G2NA 1WH3A 3U8ZA 1YX5B 2J0JA 3PRPB 3WALA 1WMHB 2C9WB 2R2OA 5L95C 4XX5A 4ZDVA 1WJUA 2M0XA 2LRUA 2LUEA 5FR6A 5IAAC 2AYOB 2KQSA 2CU1A 3ZVVA 4MM3A 5J18A 5AZHA 4I6PA 4DXAB 3ZNID 3VHTC 3DCGA 1KOTA 4HCNB 4HDQA 2CHWA 3VAWA 4OVUA 3N32A 5LLIA 3WAMA 1K8RB 2KMAA 1HE8A 3PS6A 1LXDA 2UWQA 5CHWA 4W9GA 2L00B 3CMMB 2XBBC 4IM2A 3OAWA 2MQJA 1NDDA 4RM8A 2KNBA 2IO0B 4G0NB 3VQIA 4A3PA 4BKGA 1IP9A 2JF5A 3N3KB 4FADA 3JYUA 2ZJDA 3PHXB 4GDLB 2C7NB 4DK5A 2DX5B 2HD5B 3AU4A 4GB9A 1YD8U 2KFJA 2NPTA 2KK8A 2OOBB 1E7VA 2KHWB 2AL6A 2Y5BB 4A3OA 3QC8B 3A9KA 3VH3B 2FIFA 4ANUA 4EFOA 4M8NA 2LRWA 2WDTB 2MLBA 3HHMA 1EF5A 1TBEA 2WX1A 2FCMA 1V81A 2N9PC 3AULA 4CHKA 1XQQA 5L83A 2DYOA 1P0RA 2KTRB 4KV2A 4NPNA 4GMVA 4ZRKA 4ANXA 1H4RA 1E7UA 2NVUI 5AEKB 4ANWA 2DYMA 4KZCA 1UBQA 2KDBA 2V1YA 3PPAA 3ZTDA 1RFAA 3RZWC 3Q3JA 4BKSD 2FCNA 1KM7A 1EO6A 2PJHA 2BWFA 3QAQA 1WR6E 3RT3B 2JUOA 4TQ0A 3UINB 4FJYA 3QA8A 4NNJB 2O2VA 4W9HA 3A9JB 2JPHA 2KTFA 4GDKB 1E5WA 4F7ZA 3Q3FA 3A4SC 3VUXA 1J19A 2AEHA 2M8SA 2LVPA 2MBQA 4J6IA 1I35A 1VD2A 5G55A 4WJPA 3W1YA 5J17A 4M8MA 1UGMA 3DOWA 1XT9B 3DVNV 4XC2A 3VH4B 1RLFA 5AZGA 3OJ4B 2KFKA 4FULA 2K39A 1GC6A 2KJ6A 1Y8RC 4AOFA 4NAWB 3EHVA 4EUTA 2ZNVC 1WJ6A 3IHPC 3N30A 1V5OA 3W1SA 4HPMB 3DBHI 4DHJB 1SGHA 2MBOA 3ZUNA 3APDA 2LGDA 4MJSA 2NR2A 1WMHA 1UELA 4IWOA 3RULA 1E8XA 2GBNA 2NCNA 3ZKJC 4DHZE 3MTNB 1IYFA 2MBEA 3K9OB 2J0KA 2V3SA 4FN2A 4NJ6A 3SDLC 4HXDA 4TQ1A 5DPTA 4W9KA 4RM9A 3V61A 3JVZX 1WGRA 3QQ8B 2LGYA 3KUCB 2KC1A 3ECIA 4XZ4A 2A5UA 3H7PB 4WJNA 3RZFA 2N1WA 2LVQA 4P7IA 1IPGA 3ZRFA 2JY6A 5JHAA 3UF8A 4ICVA 2KWCA 3WAOA 1CMXB 2XK5B 3PGEA 4DWFA 1R4MI 2REXA 2MP2B 2RPQA 2D10A 4NQKE 3QARA 2D07B 3R7QA 2HTHA 5DPWA 4GDLA 4JL9A 3KW5B 3QCAA 5DPRA 4E74A 2D3GA 4HLEA 2LWPA 2KZRA 1PQSA 2L3ZA 4AJYB 4BBNF 4II2B 3NY5A 1UD7A 4EOYA 4I6NB 4JIOU 4IWQA 2GOWA 4IG7B 3ONSA 3ZTCA 1XD3B 2KX3A 2J7QB 2L05A 2MA9B 3B08A 2KN5A 3LJ3A 2KTRA 3R3MA 3L16A 2VRRB 3R7RA 3AXCA 1WGHA 2BKFA 3APFA 4GXBA 1NI2A 1WJ4A 5TR5A 2AL3A 1WRDB 2LJ5A 2JXXA 2MSED 4MSQB 3T9LA 2L0TA 2OJRA 4BFRA 1GJZA 3C0RB 2BKRB 4PYUA 2LXAA 4FJZA 3SHQA 4BBNC 2K8CA 2I1JA 2IY0B 3KUDB 5E6NA 2BYFA 4G50A 3PTFC 4WWNA 1F9JA 4KDIC 3VTVA 4B6WA 1Q0WB 2C5LC 1H8CA 2J0MA 4KSLC 3DBSA 2K6QA 4NY0A 3V6EB 3U30A 2RGFA 2KJHB 3ZW3A 4PYZA 3A9JA 2JZZA 4GDKA 4K81A 2G45B 2L7RA 2O6VA 2V4LA 2MCNB 2KMCA 5D7GA 1V86A 2A4ZA 1WGDA 2C60A 2DZKA 3UGBB 3L10B 1RRBA 3UQAA 1TGZB 1OEYA 2GBRA 4IM3A 3VDZA 2B3AA 2FCQA 4DDID 2IZVB 4NJ7A 3ZO5B 4HCPB 3LMNA 4KVGB 4B95A 3RYTA 4BOSC 2LASA 1V6EA 1E90A 2CR5A 2MBBB 2CKHB 3TIXA 3PT2B 2K8HA 3PZDA 4TUUA 2FUHB 5DPSA 3ENEA 2KVRA 4HVBA 2MW5A 2Z0EB 3M3JA 4W9LA 3IBEA 2JVCA 3L08A 2LVOA 4F8CB 3ZNHB 2KXJA 2NS5A 4AWJA 5BO4B 3V60A 3SD5A 4ZYNA 3A1QB 3GZNI 4GSWA 1S3SG 3HK0A 4ZRJA 4ASWC 4IUMB 4JLCA 2KDIA 4ZRIA 3MHSD 2WWZA 4HPLB 4OVVA 2ZZPB 2AWTA 1GC7A 1WZ0A 1WYWB 4HDOA 4W9EA 3JW0X 2FIDA 5KHOA 5E6OA 1OEYJ 3ZRCA 2ZNVB 2EMTA 2IYDB 4IW0A 3M63B 1L7YA 3K9PB 2BYEA 2FNJB 4E71A 2KKCA 2YLMA 2MP2A 3QHTA 5E6PA 1EF1A 3JSVA 4TKNA 3BINA 2M17A 4NQLB 1WE7A 1WGYA 4IWPA 3ZDMC 4MSMB 2JRHA 4PS8A 3WANA 4W9DA 4AUQC 2KJRA 1RAXA 1WJNA 2IO2B 2BGFA 4W9CA 3QX1A 4GIVA 1Q5WB 2CHXA 2KOXA 3IFWB 2Z59B 2HE7A 4W9JA 2C7MB 3PRMB 3EECA 2KDEB 4K7UA 4GGQA 3CSFA 4RMAA 2L0FA 2L8JA 3KVFB 4DBGA 2RD0A 3NOBA 3ML9A 3H9DA 3PLVA 4GOCA 4AP4C 3TBLD 2DHZA 4LJOB 4AJWA 3PHWB 4HJKA 1SE9A 4WWPA 3ZNGC 5CHVC 1A5RA 2GMIC 4MDKE 4MEMA 1WGGA 2KLGA 1M94A 2MX2A 1Z2MA 3H7SA 2ZVNA 3KYCD 4FHJA 4M0WB 3NZUA 1LQBA 2K8BA 2DYBA 2BWES 3PVLA 1UZXB 3V6CB 1QZEA 3I3TB 4HK2A 3TCAA 3M95A 3PREA 4MGZE 4FHKA 3DVNU 2M1MA 3QWZB 3RCZA 2PE9A 1J8CA 2JWZA 3GOEA 1YQBA 4LJPB 5LXIB 3VUYA 2HJ8A 3QJZA 5CTRC 3V62A 4EZJA 1LFDA 3PSEB 2O2VB 4IC7B 1T0YA 4FLHA 3TJPA 2N9XA 4LDTD 5C1ZA 1I42A 3TL5A 5LXHA 1V49A 2N7DA 2RSUA 3B1LX 1D3ZA 1W6VA 3EC8A 4EEWA 3B0AA 2KLCA 3DVGX 4N9F4 3PLUA 2PPHA 3ALBA 2EKEC 3A1QA 1NBFC 2KFKB 4FA6A 1YX6B 1GG3A 3KH0A 1E8WA 3OJ3A 3DDCB 3NZSA 3SU8X 1E8ZA 2DZIA 2K1FA 3EFUA 2I1KA 3M62B 4WAAA 3NHEB 2IY1B 5JH5C 1WX8A 2LXCA 2IO3B 2LZ6A 3L13A 3VXWA 3ZLZA 4KIKB 5CHFA 4MJSB 2PE6B 1WY8A 3P2BA 4BKSA 4KSKC 4W9IA 3H6NA 3VVWB 2PEAA 1MG8A 2KANA 2L76A 4F1SA 2C7HA 1FXTB 3DPDA 1UH6A 1YJ1A 5D2MB 1YIWA 1WI0A 3H1UA 3W1SC 1S1QB 5D6JB 1WFYA 2BF8B 4PS7A 5KHQA 1WXVA 1JRUA 4NAWA 2DAJA 4CYEA 2MRPA 5HKHA 1GNUA 1L2NA 1ZW7A 4GU2A 5JZEB 2DAFA 4BKTA 1ISNA 5DCNA 3BY4B 3U7DA 4MELA 1KJTA 2G4DB 2ZCBA 3VTUA 3D32A 1WZ3A 2KD0A 4W9FA 2R2QA 2KO3A 3TMPB 2DZJA 3VTWA 2N1VA 2MWSB 2NBVB 3IG3A 2KDFB 2DZMA 2WX0A 2NBUA 1E8YA 3HIZA 4BOZB 1WE6A 4DDGD 1WX7A 3H7PA 4WJOA 4MGIE 2ZPYA 1AARA 1TZ1A 1WXAA 1V5TA 4G3XB 4I6LB 3UQBA 3AI5A 2FAZA 2K6DB 4WWOA 3QIJA 1WR1A 1C1YB 3O65B 2KWVB 2LD9A 3VFKA 1Q1OA 2RR9A 3WIMA 4K7SA 2LGXA 2XK5A 3DBLI 3VUWA 4GN1A 4EZKA 3DVGY 3WA0A 2LI5A 1KLVA 4WJQA 5IA7A 4YL8A 1WXMA 2N9EB 2O6VD 2MBHA 2QHOA 2KWUB 2M4NA 2D11A 2Z0DB 3X23A 2CS4A 4K7WA 1OTRB 3CSTA 2ZCCA 3ZNZB 4CO7A 2W9NA 1P1AA 2N7EA 1TTNA 2IO1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBI B;  3ZDT A;  1J0G A;  3A33 B;  3NS8 A;  1WX9 A;  4E3C A;  4B9K A;  4ICU A;  4EZL A;  2O6V B;  4K1R B;  3DBR I;  2KQ7 A;  3MJW A;  2GBJ A;  1WM3 A;  1ZGU B;  4IM0 A;  3L17 A;  4DHJ D;  1WXS A;  1GUA B;  2ZPN A;  1EUV B;  3AU5 A;  2NBW B;  4A20 A;  3X0W A;  1LM8 B;  3ML8 A;  3T8M A;  5EDS A;  2WYQ A;  2NPT B;  4ANV A;  1R4N I;  5GMV A;  5J2R A;  1VCB A;  3A9K B;  3RUI B;  2KX0 A;  1V2Y A;  3LDZ E;  3QK0 A;  2KC2 A;  4MGK E;  4KIK A;  2JZ3 B;  2YVC A;  1G6J A;  2JT4 B;  2JRI B;  3HM6 X;  4EKU A;  3R66 C;  3KYD D;  4HWI B;  2BPS A;  4URK A;  5C23 A;  1ZKH A;  2ZEQ A;  5AZF A;  3KUZ A;  1P98 A;  2G4S A;  3ZIM A;  1V80 A;  3A4R A;  4LCD E;  3DQV A;  2K25 A;  1WIA A;  3CF6 E;  3UIP B;  5JHB A;  4JQW C;  1WM2 A;  2UYZ B;  4FBJ B;  3IVF A;  3L0W B;  4FJV B;  1V9J A;  4G11 A;  1X1M A;  4KZ0 A;  2CHZ A;  2G3Q B;  2GBM A;  3APC A;  3HM3 A;  1OQY A;  2BYV E;  2DEN B;  2ASQ A;  1OGW A;  2XEW A;  4X57 B;  2FCS A;  5CX3 A;  3OLM D;  4BVU C;  4KDL B;  4PS3 A;  1Z5S B;  1SIF A;  1U4A A;  3JSV B;  3S2A A;  1WF9 A;  3WAP A;  1P3Q U;  1P9D U;  3RD2 A;  2EMS A;  5D94 A;  1BT0 A;  3L54 A;  3UIO B;  4LDT B;  2ZVO A;  4DHZ B;  4MGY E;  2D2Q A;  3PV1 A;  4II3 B;  2GBK A;  1UBI A;  1C3T A;  3PRZ A;  4JGH B;  4TV3 A;  2N4F A;  4MH0 E;  4WQO B;  5G2N A;  1WH3 A;  3U8Z A;  1YX5 B;  2J0J A;  3PRP B;  3WAL A;  1WMH B;  2C9W B;  2R2O A;  5L95 C;  4XX5 A;  4ZDV A;  1WJU A;  2M0X A;  2LRU A;  2LUE A;  5FR6 A;  5IAA C;  2AYO B;  2KQS A;  2CU1 A;  3ZVV A;  4MM3 A;  5J18 A;  5AZH A;  4I6P A;  4DXA B;  3ZNI D;  3VHT C;  3DCG A;  1KOT A;  4HCN B;  4HDQ A;  2CHW A;  3VAW A;  4OVU A;  3N32 A;  5LLI A;  3WAM A;  1K8R B;  2KMA A;  1HE8 A;  3PS6 A;  1LXD A;  2UWQ A;  5CHW A;  4W9G A;  2L00 B;  3CMM B;  2XBB C;  4IM2 A;  3OAW A;  2MQJ A;  1NDD A;  4RM8 A;  2KNB A;  2IO0 B;  4G0N B;  3VQI A;  4A3P A;  4BKG A;  1IP9 A;  2JF5 A;  3N3K B;  4FAD A;  3JYU A;  2ZJD A;  3PHX B;  4GDL B;  2C7N B;  4DK5 A;  2DX5 B;  2HD5 B;  3AU4 A;  4GB9 A;  1YD8 U;  2KFJ A;  2NPT A;  2KK8 A;  2OOB B;  1E7V A;  2KHW B;  2AL6 A;  2Y5B B;  4A3O A;  3QC8 B;  3A9K A;  3VH3 B;  2FIF A;  4ANU A;  4EFO A;  4M8N A;  2LRW A;  2WDT B;  2MLB A;  3HHM A;  1EF5 A;  1TBE A;  2WX1 A;  2FCM A;  1V81 A;  2N9P C;  3AUL A;  4CHK A;  1XQQ A;  5L83 A;  2DYO A;  1P0R A;  2KTR B;  4KV2 A;  4NPN A;  4GMV A;  4ZRK A;  4ANX A;  1H4R A;  1E7U A;  2NVU I;  5AEK B;  4ANW A;  2DYM A;  4KZC A;  1UBQ A;  2KDB A;  2V1Y A;  3PPA A;  3ZTD A;  1RFA A;  3RZW C;  3Q3J A;  4BKS D;  2FCN A;  1KM7 A;  1EO6 A;  2PJH A;  2BWF A;  3QAQ A;  1WR6 E;  3RT3 B;  2JUO A;  4TQ0 A;  3UIN B;  4FJY A;  3QA8 A;  4NNJ B;  2O2V A;  4W9H A;  3A9J B;  2JPH A;  2KTF A;  4GDK B;  1E5W A;  4F7Z A;  3Q3F A;  3A4S C;  3VUX A;  1J19 A;  2AEH A;  2M8S A;  2LVP A;  2MBQ A;  4J6I A;  1I35 A;  1VD2 A;  5G55 A;  4WJP A;  3W1Y A;  5J17 A;  4M8M A;  1UGM A;  3DOW A;  1XT9 B;  3DVN V;  4XC2 A;  3VH4 B;  1RLF A;  5AZG A;  3OJ4 B;  2KFK A;  4FUL A;  2K39 A;  1GC6 A;  2KJ6 A;  1Y8R C;  4AOF A;  4NAW B;  3EHV A;  4EUT A;  2ZNV C;  1WJ6 A;  3IHP C;  3N30 A;  1V5O A;  3W1S A;  4HPM B;  3DBH I;  4DHJ B;  1SGH A;  2MBO A;  3ZUN A;  3APD A;  2LGD A;  4MJS A;  2NR2 A;  1WMH A;  1UEL A;  4IWO A;  3RUL A;  1E8X A;  2GBN A;  2NCN A;  3ZKJ C;  4DHZ E;  3MTN B;  1IYF A;  2MBE A;  3K9O B;  2J0K A;  2V3S A;  4FN2 A;  4NJ6 A;  3SDL C;  4HXD A;  4TQ1 A;  5DPT A;  4W9K A;  4RM9 A;  3V61 A;  3JVZ X;  1WGR A;  3QQ8 B;  2LGY A;  3KUC B;  2KC1 A;  3ECI A;  4XZ4 A;  2A5U A;  3H7P B;  4WJN A;  3RZF A;  2N1W A;  2LVQ A;  4P7I A;  1IPG A;  3ZRF A;  2JY6 A;  5JHA A;  3UF8 A;  4ICV A;  2KWC A;  3WAO A;  1CMX B;  2XK5 B;  3PGE A;  4DWF A;  1R4M I;  2REX A;  2MP2 B;  2RPQ A;  2D10 A;  4NQK E;  3QAR A;  2D07 B;  3R7Q A;  2HTH A;  5DPW A;  4GDL A;  4JL9 A;  3KW5 B;  3QCA A;  5DPR A;  4E74 A;  2D3G A;  4HLE A;  2LWP A;  2KZR A;  1PQS A;  2L3Z A;  4AJY B;  4BBN F;  4II2 B;  3NY5 A;  1UD7 A;  4EOY A;  4I6N B;  4JIO U;  4IWQ A;  2GOW A;  4IG7 B;  3ONS A;  3ZTC A;  1XD3 B;  2KX3 A;  2J7Q B;  2L05 A;  2MA9 B;  3B08 A;  2KN5 A;  3LJ3 A;  2KTR A;  3R3M A;  3L16 A;  2VRR B;  3R7R A;  3AXC A;  1WGH A;  2BKF A;  3APF A;  4GXB A;  1NI2 A;  1WJ4 A;  5TR5 A;  2AL3 A;  1WRD B;  2LJ5 A;  2JXX A;  2MSE D;  4MSQ B;  3T9L A;  2L0T A;  2OJR A;  4BFR A;  1GJZ A;  3C0R B;  2BKR B;  4PYU A;  2LXA A;  4FJZ A;  3SHQ A;  4BBN C;  2K8C A;  2I1J A;  2IY0 B;  3KUD B;  5E6N A;  2BYF A;  4G50 A;  3PTF C;  4WWN A;  1F9J A;  4KDI C;  3VTV A;  4B6W A;  1Q0W B;  2C5L C;  1H8C A;  2J0M A;  4KSL C;  3DBS A;  2K6Q A;  4NY0 A;  3V6E B;  3U30 A;  2RGF A;  2KJH B;  3ZW3 A;  4PYZ A;  3A9J A;  2JZZ A;  4GDK A;  4K81 A;  2G45 B;  2L7R A;  2O6V A;  2V4L A;  2MCN B;  2KMC A;  5D7G A;  1V86 A;  2A4Z A;  1WGD A;  2C60 A;  2DZK A;  3UGB B;  3L10 B;  1RRB A;  3UQA A;  1TGZ B;  1OEY A;  2GBR A;  4IM3 A;  3VDZ A;  2B3A A;  2FCQ A;  4DDI D;  2IZV B;  4NJ7 A;  3ZO5 B;  4HCP B;  3LMN A;  4KVG B;  4B95 A;  3RYT A;  4BOS C;  2LAS A;  1V6E A;  1E90 A;  2CR5 A;  2MBB B;  2CKH B;  3TIX A;  3PT2 B;  2K8H A;  3PZD A;  4TUU A;  2FUH B;  5DPS A;  3ENE A;  2KVR A;  4HVB A;  2MW5 A;  2Z0E B;  3M3J A;  4W9L A;  3IBE A;  2JVC A;  3L08 A;  2LVO A;  4F8C B;  3ZNH B;  2KXJ A;  2NS5 A;  4AWJ A;  5BO4 B;  3V60 A;  3SD5 A;  4ZYN A;  3A1Q B;  3GZN I;  4GSW A;  1S3S G;  3HK0 A;  4ZRJ A;  4ASW C;  4IUM B;  4JLC A;  2KDI A;  4ZRI A;  3MHS D;  2WWZ A;  4HPL B;  4OVV A;  2ZZP B;  2AWT A;  1GC7 A;  1WZ0 A;  1WYW B;  4HDO A;  4W9E A;  3JW0 X;  2FID A;  5KHO A;  5E6O A;  1OEY J;  3ZRC A;  2ZNV B;  2EMT A;  2IYD B;  4IW0 A;  3M63 B;  1L7Y A;  3K9P B;  2BYE A;  2FNJ B;  4E71 A;  2KKC A;  2YLM A;  2MP2 A;  3QHT A;  5E6P A;  1EF1 A;  3JSV A;  4TKN A;  3BIN A;  2M17 A;  4NQL B;  1WE7 A;  1WGY A;  4IWP A;  3ZDM C;  4MSM B;  2JRH A;  4PS8 A;  3WAN A;  4W9D A;  4AUQ C;  2KJR A;  1RAX A;  1WJN A;  2IO2 B;  2BGF A;  4W9C A;  3QX1 A;  4GIV A;  1Q5W B;  2CHX A;  2KOX A;  3IFW B;  2Z59 B;  2HE7 A;  4W9J A;  2C7M B;  3PRM B;  3EEC A;  2KDE B;  4K7U A;  4GGQ A;  3CSF A;  4RMA A;  2L0F A;  2L8J A;  3KVF B;  4DBG A;  2RD0 A;  3NOB A;  3ML9 A;  3H9D A;  3PLV A;  4GOC A;  4AP4 C;  3TBL D;  2DHZ A;  4LJO B;  4AJW A;  3PHW B;  4HJK A;  1SE9 A;  4WWP A;  3ZNG C;  5CHV C;  1A5R A;  2GMI C;  4MDK E;  4MEM A;  1WGG A;  2KLG A;  1M94 A;  2MX2 A;  1Z2M A;  3H7S A;  2ZVN A;  3KYC D;  4FHJ A;  4M0W B;  3NZU A;  1LQB A;  2K8B A;  2DYB A;  2BWE S;  3PVL A;  1UZX B;  3V6C B;  1QZE A;  3I3T B;  4HK2 A;  3TCA A;  3M95 A;  3PRE A;  4MGZ E;  4FHK A;  3DVN U;  2M1M A;  3QWZ B;  3RCZ A;  2PE9 A;  1J8C A;  2JWZ A;  3GOE A;  1YQB A;  4LJP B;  5LXI B;  3VUY A;  2HJ8 A;  3QJZ A;  5CTR C;  3V62 A;  4EZJ A;  1LFD A;  3PSE B;  2O2V B;  4IC7 B;  1T0Y A;  4FLH A;  3TJP A;  2N9X A;  4LDT D;  5C1Z A;  1I42 A;  3TL5 A;  5LXH A;  1V49 A;  2N7D A;  2RSU A;  3B1L X;  1D3Z A;  1W6V A;  3EC8 A;  4EEW A;  3B0A A;  2KLC A;  3DVG X;  4N9F 4;  3PLU A;  2PPH A;  3ALB A;  2EKE C;  3A1Q A;  1NBF C;  2KFK B;  4FA6 A;  1YX6 B;  1GG3 A;  3KH0 A;  1E8W A;  3OJ3 A;  3DDC B;  3NZS A;  3SU8 X;  1E8Z A;  2DZI A;  2K1F A;  3EFU A;  2I1K A;  3M62 B;  4WAA A;  3NHE B;  2IY1 B;  5JH5 C;  1WX8 A;  2LXC A;  2IO3 B;  2LZ6 A;  3L13 A;  3VXW A;  3ZLZ A;  4KIK B;  5CHF A;  4MJS B;  2PE6 B;  1WY8 A;  3P2B A;  4BKS A;  4KSK C;  4W9I A;  3H6N A;  3VVW B;  2PEA A;  1MG8 A;  2KAN A;  2L76 A;  4F1S A;  2C7H A;  1FXT B;  3DPD A;  1UH6 A;  1YJ1 A;  5D2M B;  1YIW A;  1WI0 A;  3H1U A;  3W1S C;  1S1Q B;  5D6J B;  1WFY A;  2BF8 B;  4PS7 A;  5KHQ A;  1WXV A;  1JRU A;  4NAW A;  2DAJ A;  4CYE A;  2MRP A;  5HKH A;  1GNU A;  1L2N A;  1ZW7 A;  4GU2 A;  5JZE B;  2DAF A;  4BKT A;  1ISN A;  5DCN A;  3BY4 B;  3U7D A;  4MEL A;  1KJT A;  2G4D B;  2ZCB A;  3VTU A;  3D32 A;  1WZ3 A;  2KD0 A;  4W9F A;  2R2Q A;  2KO3 A;  3TMP B;  2DZJ A;  3VTW A;  2N1V A;  2MWS B;  2NBV B;  3IG3 A;  2KDF B;  2DZM A;  2WX0 A;  2NBU A;  1E8Y A;  3HIZ A;  4BOZ B;  1WE6 A;  4DDG D;  1WX7 A;  3H7P A;  4WJO A;  4MGI E;  2ZPY A;  1AAR A;  1TZ1 A;  1WXA A;  1V5T A;  4G3X B;  4I6L B;  3UQB A;  3AI5 A;  2FAZ A;  2K6D B;  4WWO A;  3QIJ A;  1WR1 A;  1C1Y B;  3O65 B;  2KWV B;  2LD9 A;  3VFK A;  1Q1O A;  2RR9 A;  3WIM A;  4K7S A;  2LGX A;  2XK5 A;  3DBL I;  3VUW A;  4GN1 A;  4EZK A;  3DVG Y;  3WA0 A;  2LI5 A;  1KLV A;  4WJQ A;  5IA7 A;  4YL8 A;  1WXM A;  2N9E B;  2O6V D;  2MBH A;  2QHO A;  2KWU B;  2M4N A;  2D11 A;  2Z0D B;  3X23 A;  2CS4 A;  4K7W A;  1OTR B;  3CST A;  2ZCC A;  3ZNZ B;  4CO7 A;  2W9N A;  1P1A A;  2N7E A;  1TTN A;  2IO1 B; 
#chains in the Genus database with same CATH topology
 3A33 B;  4ICU A;  4LNI A;  4EZL A;  3DBR I;  2KQ7 A;  3SFD B;  1LGR A;  2GBJ A;  1ZGU B;  3E56 A;  2L52 A;  4HJG E;  1EUV B;  5EDS A;  2OJW A;  2WYQ A;  1D5Z C;  3OG5 A;  1SIJ A;  3O13 A;  1V2Y A;  4KIK A;  4XYC A;  3HM6 X;  4EKU A;  4URK A;  2PIA A;  2ZEQ A;  5AZF A;  3KUZ A;  3ZIM A;  2G4S A;  3NUH B;  3NS1 A;  1V80 A;  1BUI C;  1PUT A;  3A4R A;  2K25 A;  1WIA A;  1YJI A;  3CF6 E;  2QCZ A;  1IBX B;  4JQW C;  1R4M B;  1WM2 A;  2UYZ B;  1X1M A;  2BYV E;  2GLS A;  2JX5 A;  2ZW1 A;  4KDL B;  2WXP A;  1U4A A;  3P4R B;  1TZO A;  1WF9 A;  3RD2 A;  1N6Z A;  1XCT L;  2E6X A;  1QOF A;  3L54 A;  4LDT B;  4DHZ B;  1WGK A;  2D2Q A;  1GPX A;  2WDV B;  4II3 B;  2GBK A;  2JXT A;  3PRZ A;  3DHH C;  4TV3 A;  2J4X A;  1ESF A;  5G2N A;  1YX5 B;  3WAL A;  1Q10 A;  4XX5 A;  2IJ0 A;  2BQQ A;  1JW9 D;  2CU1 A;  1L5P A;  4I6P A;  1FEH A;  3P42 A;  1KOT A;  1C78 A;  2KYW A;  2K3U A;  3RNC C;  2WXM A;  1HE8 A;  3LXF A;  3PS6 A;  1VJK A;  2UWQ A;  2XBB C;  3Q2A C;  1JRO A;  3T3N A;  2JQR B;  4DK5 A;  2DX5 B;  1YMH E;  4GB9 A;  5BYQ A;  2KFJ A;  2OOB B;  2DNF A;  1E7V A;  4QAY A;  3A9K A;  5G5H A;  3VH3 B;  2PTL A;  2Y3A A;  2WDT B;  1EF5 A;  3AUL A;  1XQQ A;  2DYO A;  2VH1 A;  4YSX B;  3AE9 B;  1TYG B;  1UBQ A;  2KDB A;  2V1Y A;  2MH7 A;  2JSV X;  2IPK D;  5AUI A;  1I7H A;  2D3C A;  3RT3 B;  4TQ0 A;  2WQY B;  3B2G A;  2XNA C;  4FJY A;  1F77 A;  2KTF A;  4GDK B;  3Q3F A;  3VUX A;  2AEH A;  2M8S A;  4J6I A;  1I35 A;  5G55 A;  4M8M A;  2KFK A;  1Y8R C;  4NAW B;  3EHV A;  2LUM A;  2ZNV C;  3IHP C;  1V5O A;  1C76 A;  2WS3 B;  2MBO A;  3ZUN A;  3Q8F A;  2LGD A;  4MJS A;  1E8X A;  2GBN A;  1IYF A;  2BBC A;  1BXT A;  4NJ6 A;  4HXD A;  3JVZ X;  4XWT A;  3W2D A;  4XZ4 A;  5BMI A;  5JHA A;  3UF8 A;  3SEB A;  4HPP A;  2RDH A;  3WAO A;  1L0V B;  1XO3 A;  2LJI A;  5DPW A;  1C77 A;  5BYR A;  4II2 B;  1UD7 A;  4I6N B;  2GOW A;  1XD3 B;  3AB5 A;  3LJ3 A;  1QT9 A;  3B08 A;  3V05 A;  3APF A;  1ZUD 2;  4GXB A;  1L0Y B;  1WJ4 A;  5TR5 A;  1HTQ A;  1WRD B;  1N62 A;  1DOX A;  3RPF C;  2C5L C;  3BWU D;  4P1B C;  4N58 A;  2LHD A;  1CJE A;  2MHJ A;  1E0Z A;  2V4L A;  1N61 A;  2ICI A;  2A4Z A;  2PVG C;  4B0E A;  1TGZ B;  2GBR A;  2B3A A;  2WU2 B;  2IZV B;  4DDI D;  1ROE A;  1MHH E;  4BOS C;  1IGC A;  2LAS A;  1V6E A;  2CR5 A;  3TIX A;  3PT2 B;  4C7Y A;  1BML C;  1AWD A;  3ENE A;  2Y5P A;  3L08 A;  2OED A;  4AWJ A;  5BO4 B;  3SD5 A;  3A1Q B;  1S3S G;  3HK0 A;  3MJ5 A;  3MHS D;  1PGA A;  3GE8 C;  3OWE B;  2ZNV B;  2X38 A;  4IW0 A;  2FNJ B;  4E71 A;  1F1H A;  4MSM B;  2AQ2 B;  2JRH A;  1VRA B;  4W9D A;  4AUQ C;  3R8B A;  1RAX A;  1WJN A;  4MT5 A;  2IO2 B;  1F52 A;  4W9C A;  4LNN A;  2Z8L A;  3FKY A;  4CQN A;  1JWB D;  4GGQ A;  1R7S A;  1TT5 B;  4GOC A;  5CHV C;  1A5R A;  3RI7 C;  2FUG 1;  1Z2M A;  2MX2 A;  4M0W B;  2K8B A;  3PVL A;  1F2R C;  4HRO A;  1QZE A;  3TCA A;  3RFZ B;  2I2Y A;  2M1M A;  1WSP A;  1ZXH A;  2JWZ A;  3GOE A;  5LXI B;  4ZHO A;  3QJZ A;  5CTR C;  3V62 A;  4EZJ A;  5C1Z A;  5HFY A;  3TL5 A;  2RSU A;  3AMZ A;  2KLC A;  4N9F 4;  3PLU A;  3ALB A;  2KFK B;  4FA6 A;  3SR6 A;  2KAJ A;  1GG3 A;  4KKI A;  1E8W A;  3DDC B;  4FXC A;  2QC8 A;  5JH5 C;  1WX8 A;  2LXC A;  1MI0 A;  2KT7 A;  2LZ6 A;  4MJS B;  4BKS A;  4KSK C;  3VVW B;  4YTP B;  1I4H A;  1UH6 A;  1KLU D;  1YIW A;  1KH0 A;  1S1Q B;  2QJL A;  2BF8 B;  4PS7 A;  4YT0 B;  1RYJ A;  1WXV A;  1JRU A;  5JXV A;  4CYE A;  5HKH A;  4UDU C;  4GU2 A;  5JZE B;  1ISN A;  4TMA B;  5DCN A;  4MEL A;  2ZCB A;  2KO3 A;  1N5X A;  1SE2 A;  1YNT E;  1E8Y A;  1EU3 A;  1I4R A;  1JWS D;  1D5X C;  3QIJ A;  1WR1 A;  1UF0 A;  2KWV B;  4K7S A;  3DBL I;  3AEG B;  4P1C C;  2OHF A;  5FR3 A;  2N9E B;  2QHO A;  1JWA D;  3DWG C;  2CS4 A;  1OTR B;  1F0Z A;  3P4S B;  2PW9 A;  2N7E A;  3LYY A;  1UUP A;  3ZDT A;  3ZGZ A;  3NS8 A;  4E3C A;  4K1R B;  4IM0 A;  2KWD A;  1GUA B;  1J7A A;  3AU5 A;  4K3C A;  1LM8 B;  3T8M A;  2NPT B;  3Q3N C;  1R4N I;  4LTU A;  5GMV A;  5BMH A;  1T3Q A;  3RUI B;  2KC2 A;  4MGK E;  2JRI B;  1FMA D;  1QOG A;  3N1X C;  3KYD D;  4HWI B;  1MVK A;  1T0S C;  3UIP B;  1SXT A;  2IGH A;  3IVF A;  4WUR A;  1K51 A;  4G11 A;  2JYT A;  1I4X A;  2CHZ A;  2G3Q B;  2GBM A;  3APC A;  4OZC A;  1EWC A;  2DEN B;  1PGB A;  2L32 A;  3FIL A;  3OLM D;  4BVU C;  3RNF C;  3AE1 B;  4YTN B;  2ZW0 A;  4PK1 A;  2WXR A;  2M56 B;  1XXG A;  5I4D A;  1FFU A;  1P9D U;  2EMS A;  5D94 A;  2EKI A;  2ZVO A;  2MJE A;  4MGY E;  3MFG A;  2KMM A;  1C3T A;  4ITK A;  4M02 A;  4MH0 E;  2J0J A;  1WMH B;  2R2O A;  5L95 C;  1SJE D;  2LUE A;  2KQS A;  2E3T A;  5AZH A;  2W3S A;  4DXA B;  4BAX A;  5D3D A;  3DCG A;  4HCN B;  2WXO A;  3HUI A;  3N32 A;  3WAM A;  2AQ1 B;  3CMM B;  4IM2 A;  4J3O D;  1A70 A;  2WXG A;  4RM8 A;  1IP9 A;  3VQI A;  4BKG A;  2JF5 A;  3KLS X;  2MJ3 A;  3JYU A;  4XE0 A;  2LHE A;  2RPV A;  3QC8 B;  2IND C;  1WXQ A;  3RNG C;  1FIQ A;  2FIF A;  4EFO A;  2LRW A;  3HHM A;  2MLB A;  1K50 A;  4CHK A;  1P0R A;  2KTR B;  2X8X X;  3BVZ A;  4GMV A;  4JX1 C;  4ANX A;  1E7U A;  2NVU I;  1JQ4 A;  2CJO A;  2KAC A;  3ZTD A;  4BKS D;  2PJH A;  1QLB B;  3BYT B;  3UIN B;  2RDB C;  1QF6 A;  4NNJ B;  2O2V A;  3A9J B;  2JPH A;  1PGX A;  1E5W A;  4F7Z A;  3A4S C;  1J19 A;  2LVP A;  1YQ4 B;  3I57 A;  1XCQ L;  1UGM A;  3VH4 B;  3RMK C;  4FUL A;  1GC6 A;  3BYY B;  3N30 A;  2XN9 C;  1KFY B;  1SGH A;  2D5G A;  2NR2 A;  4DHZ E;  4B0M A;  1AW7 A;  1VZ6 A;  1YN3 A;  3SDL C;  5DPT A;  4W9K A;  1T0R C;  4EE2 A;  2A5U A;  5E6J A;  3PGE A;  2REX A;  4NQK E;  2D07 B;  4GDL A;  4JL9 A;  2D3G A;  1DOI A;  1PQS A;  4A8X C;  4IG7 B;  3ZTC A;  2QSD A;  2L05 A;  2VRR B;  1WGH A;  2YEP F;  1D4B A;  2MSE D;  3T9L A;  4MSQ B;  3NJT A;  3VRA B;  1Y56 A;  2BKR B;  3AN1 A;  4FJZ A;  4USA A;  2I1J A;  3KUD B;  4G50 A;  3PTF C;  4KDI C;  4B6W A;  1N63 A;  3FAH A;  2RGF A;  4PYZ A;  2LGI A;  3N9Y C;  1WWT A;  2O6V A;  1V86 A;  1FCL A;  4M01 A;  2C60 A;  3L10 B;  4A55 A;  3UQA A;  2FCQ A;  2KQ4 X;  4NJ7 A;  3U52 E;  4B95 A;  3RYT A;  3KWV A;  2MBB B;  3PZD A;  1C4A A;  5DPS A;  2WU5 B;  2KVR A;  3AEB B;  4HVB A;  3FIL B;  2TSS A;  3IBE A;  4F8C B;  2LVO A;  3ZNH B;  4IKG A;  2NS5 A;  1JAL A;  1LO5 D;  2HTM E;  3GZN I;  4ZYN A;  4C80 A;  4OZA A;  4ZRJ A;  4ASW C;  4YXD B;  1I4P A;  1QIL A;  2WWZ A;  3CIR B;  1WZ0 A;  1WYW B;  3NVY A;  5KHO A;  3ZRC A;  2EMT A;  2IYD B;  3M63 B;  1L7Y A;  3K9P B;  4IDI A;  2KKC A;  2YLM A;  1TIF A;  2MP2 A;  2BW2 A;  3BIN A;  2MJD A;  2SAK A;  1V1P B;  1WGY A;  4IWP A;  1ZXI A;  3DBR B;  2BGF A;  1L4D B;  1K53 A;  1FM0 D;  2PMV A;  2ON8 A;  2C7M B;  2VZK D;  4RMA A;  2L0F A;  3KVF B;  4DBG A;  3NOB A;  1CZP A;  3H9D A;  3KQ4 A;  3PLV A;  5H92 C;  4AP4 C;  3GP7 A;  2DHZ A;  4AJW A;  3PHW B;  3N1Y C;  3VRB B;  1GB4 A;  3ZNG C;  1JRP A;  4MDK E;  4MEM A;  1WGG A;  2L83 A;  4FHJ A;  4AS1 A;  3H7S A;  3ZJT A;  2K22 A;  2W54 A;  1UZX B;  3V6C B;  4HK2 A;  3PRE A;  4MGZ E;  4FHK A;  4DQO C;  2DWQ A;  3QWZ B;  2H88 B;  1YQB A;  4LJP B;  4XDC A;  3E9S A;  1LFD A;  3U7Z A;  2O2V B;  4IC7 B;  4FLH A;  3TJP A;  3AV8 A;  1TKY A;  3NZ3 A;  1MHX A;  5LXH A;  4EEW A;  1DYQ A;  2EKE C;  1E9M A;  1YX6 B;  3L4P A;  3NZS A;  1E8Z A;  2WDQ B;  4RH6 A;  2I1K A;  3M62 B;  4WAA A;  2IO3 B;  2WXH A;  1FRD A;  4KIK B;  5CHF A;  1MG8 A;  4F1S A;  2LFI A;  3DPD A;  3H1U A;  3H8H A;  1YQ3 B;  5EE3 A;  2J53 A;  3Q8E A;  5KHQ A;  1C79 A;  1ZW7 A;  1YN4 A;  4LNO A;  4BKT A;  3HVD A;  4C4V A;  3BY4 B;  1KJT A;  4Q2J A;  2G4D B;  2BVC A;  3VTU A;  3BK1 A;  1I4G A;  2KD0 A;  1L4Z B;  3AEE B;  3VTW A;  1EU4 A;  2NBV B;  3IG3 A;  4KGR A;  4DDG D;  3AE8 B;  3I5J C;  1D6E C;  3RNE C;  3DHG C;  4G3X B;  1V5T A;  3EUB 2;  4WWO A;  5EE9 A;  1OQR A;  3O65 B;  1Q1O A;  2BS3 B;  2RR9 A;  1HEZ E;  2XK5 A;  3BII D;  4NZL B;  3ZJU A;  2INN E;  3Q3O C;  2G9H D;  2LI5 A;  1RFK A;  4YL8 A;  1WXM A;  2O6V D;  2I38 A;  2KWU B;  2Z0D B;  4ZYS A;  4CO7 A;  2W9N A;  1P1A A;  1TTN A;  2IO1 B;  2IBI B;  1J0G A;  1WX9 A;  4MH8 A;  4B9K A;  4AQ7 A;  2O6V B;  3MJW A;  1WM3 A;  4DHJ D;  1WXS A;  1ENF A;  3UI3 A;  2ZPN A;  4A20 A;  5BYS A;  5J2R A;  3A9K B;  2W55 A;  3PZ7 A;  1ZOY B;  3TEZ A;  1G6J A;  2JZ3 B;  2YVC A;  2L1A A;  1F2R I;  1STE A;  2Y5C A;  1XEE A;  3R66 C;  3Q69 A;  5C23 A;  3TEW A;  1ZKH A;  2INC C;  1VLB A;  3P4Q B;  1L6U A;  3GE3 C;  4ZRQ A;  1RM6 C;  3B2F A;  3DQV A;  3CWI A;  4ZOH C;  2BB5 A;  4GLS C;  3L0W B;  4FJV B;  4O1N A;  4KZ0 A;  4S0R A;  4RF1 A;  3HM3 A;  2ASQ A;  1OGW A;  2XEW A;  2FCS A;  5CX3 A;  4K3B A;  2WXF A;  4KX6 B;  3S2A A;  1P3Q U;  1YN5 A;  1BT0 A;  5FK9 C;  4XWW A;  4NJC A;  3PV1 A;  1UBI A;  5TSS A;  3DWM A;  4JGH B;  4C7Z A;  1PYW D;  2N4F A;  4WQO B;  4JWU C;  3N20 C;  1FO4 A;  2LRU A;  5IAA C;  1HZ5 A;  2AYO B;  3AEA B;  4MM3 A;  5J18 A;  4R3D A;  3VHT C;  4A90 A;  5LLI A;  2KVZ A;  3AE7 B;  3Q8A A;  4W9G A;  2L00 B;  1P7E A;  2GRI A;  3RNB C;  3PO0 A;  2BS4 B;  1E6E B;  2IO0 B;  4G0N B;  4A3P A;  4US9 A;  4FAD A;  4RF0 A;  1SE3 A;  3PHX B;  3AU4 A;  1YD8 U;  2UU7 A;  2Y5B B;  4JWS C;  1QOA A;  4A3O A;  3Q8B A;  3VR9 B;  4ANU A;  2HJ1 A;  2WX1 A;  5L83 A;  1B9R A;  4KV2 A;  4NPN A;  4ZRK A;  1SJH D;  1H4R A;  5AEK B;  4ANW A;  2DYM A;  4KZC A;  3PPA A;  2DBY A;  3Q14 C;  3RZW C;  3Q3J A;  2FCN A;  1IBX A;  1KM7 A;  1EO6 A;  2W82 A;  2SEB D;  1WR6 E;  2WXJ A;  3QA8 A;  1FXA A;  4W9H A;  1KF6 B;  4C00 A;  1DGJ A;  2MBQ A;  4WJP A;  3DBH B;  3W1Y A;  5J17 A;  1JWM D;  3DOW A;  3V3X A;  1XT9 B;  3DVN V;  4XC2 A;  1N5W A;  3ZJV A;  2KJ6 A;  4AOF A;  1WJ6 A;  3W1S A;  4HPM B;  3AE5 B;  2J42 A;  3APD A;  4RCO A;  4C4V B;  3RUL A;  3ZKJ C;  1T0Q C;  2NCN A;  3MTN B;  2MBE A;  3K9O B;  2RMM A;  2J0K A;  3ZXV A;  2V3S A;  4TQ1 A;  4RM9 A;  3C8Y A;  1WGR A;  1VZ7 A;  1HTO A;  2KC1 A;  3ECI A;  1FXI A;  3RZF A;  4P7I A;  1IPG A;  4ICV A;  2BS2 B;  1CMX B;  2XK5 B;  3J9C A;  4DWF A;  1R4M I;  2WDR B;  2ONQ A;  1JCK B;  4TSS A;  1TS5 A;  2RPQ A;  3QAR A;  3KW5 B;  4E74 A;  2KZR A;  4JE3 B;  3NY5 A;  1V97 A;  4EOY A;  4JIO U;  4ZRP A;  2KX3 A;  2J7Q B;  2MA9 B;  3R7R A;  2N7J A;  2BKF A;  2AL3 A;  2LJ5 A;  2JXX A;  2G1E A;  2OJR A;  4PYU A;  3SHQ A;  4BBN C;  2K8C A;  2IY0 B;  1H8C A;  1Q0W B;  4RFB A;  3DBS A;  1FNU A;  2K6Q A;  4NY0 A;  3V6E B;  1P7F A;  3U30 A;  2KJH B;  3ZW3 A;  4GDK A;  2G45 B;  2LEK A;  4N59 A;  5D7G A;  2WGS A;  2WXK A;  3UGB B;  1RRB A;  2N9K A;  1OEY A;  1K52 A;  2H89 B;  3TSS A;  3ZO5 B;  4HCP B;  1E90 A;  2CKH B;  2PVO D;  1FPY A;  2K8H A;  4TUU A;  2FUH B;  2MW5 A;  4W9L A;  4KKJ A;  2JVC A;  3IAM 1;  3LB8 C;  2KXJ A;  1IUE A;  2RDG A;  3FC4 A;  3ABV B;  1XLN A;  1UGJ A;  3V60 A;  4GSW A;  1E10 A;  3DBL B;  4JLC A;  3W5U B;  2QDF A;  4IOI E;  4ZRI A;  3EGR A;  4OVV A;  4HDO A;  1GC7 A;  3JW0 X;  2FID A;  4L2Y A;  5E6O A;  1OEY J;  3ZYY X;  1TS3 A;  3IT4 B;  2K5P A;  5E6P A;  3JSV A;  1WE7 A;  1TJE A;  2KJR A;  4WQM A;  4RNA A;  3AEF B;  3QX1 A;  1Q5W B;  2KOX A;  2CJN A;  3I9V 1;  2HE7 A;  3MC9 A;  4W9J A;  3NRZ A;  3PZ8 A;  4K7U A;  1R4N B;  3CSF A;  3TEX A;  2RD0 A;  5HHD G;  1E7P B;  3URY A;  5FKA C;  2NTT A;  1SE9 A;  1VR9 A;  4WWP A;  4REZ A;  1B1Z A;  1TY0 A;  2KLG A;  1M94 A;  3NZU A;  2DYB A;  4A6Q A;  3I3T B;  2BT6 A;  5IP4 D;  3DVN U;  4RGT A;  3RCZ A;  3SFE B;  2PE9 A;  3AEC B;  1J8C A;  2V3P A;  3VUY A;  1QQR A;  5LNK 1;  1T0Y A;  4LDT D;  1I42 A;  1W6V A;  3BK2 A;  3EC8 A;  3B0A A;  3DVG X;  2PPH A;  3A1Q A;  1I4Q A;  1NBF C;  1GOZ A;  2DZI A;  3EFU A;  5AUK A;  3L13 A;  3ZLZ A;  2PE6 B;  1SF0 A;  1YOV B;  3P2B A;  4W9I A;  3H6N A;  2LMC A;  2PEA A;  2L76 A;  1WRI A;  1SEB D;  3R2T A;  5D2M B;  1YJ1 A;  1WI0 A;  5D6J B;  1WFY A;  5D3I B;  1XLO A;  4ARI A;  3NVV A;  3W5V B;  2DAJ A;  1L2N A;  4WWM A;  2DAF A;  1NEN B;  1SBB B;  1HA5 A;  5G5G A;  1TS4 A;  3GS2 A;  3D32 A;  4W9F A;  2R2Q A;  2DZJ A;  2MWS B;  4ARC A;  2WX0 A;  2NBU A;  1WE6 A;  1WX7 A;  3H7P A;  4WJO A;  4MGI E;  3ZQ4 A;  3NVZ A;  1AAR A;  3UQB A;  4I6L B;  3AI5 A;  2K6D B;  1UWM A;  1FRR A;  3Q3M C;  4M0W A;  1C1Y B;  3IT6 B;  3VFK A;  2LD9 A;  1CK1 A;  3WIM A;  1ZPS A;  2LGX A;  5C3J B;  1PDX A;  4GN1 A;  2B76 B;  4WJQ A;  1KTK A;  4ZHP A;  4RGM A;  2D11 A;  3X23 A;  3CST A;  3ZNZ B;  1FNV A;  2FBW B;  2ZCC A;  2GI9 A;  5GXG B;  1XLQ A;  4L1B A;  1HXY D;  3L17 A;  3Q6B A;  2QMT A;  2JWU A;  2NBW B;  4NAM A;  3X0W A;  3ML8 A;  3AE2 B;  4ANV A;  2VZK B;  1VCB A;  3RN9 C;  2GB1 A;  3ZXR A;  4YTM B;  3MHZ A;  2KX0 A;  3LDZ E;  3QK0 A;  1N60 A;  2JT4 B;  4DXF A;  2BTE A;  2BPS A;  4YSZ B;  3IXS A;  4RGO S;  4US8 A;  1P98 A;  1L6V A;  2Q5W D;  1ZDX A;  4LCD E;  5JHB A;  4LNK A;  2QIE B;  4FBJ B;  1V9J A;  1ZE3 D;  1OQY A;  2J52 A;  4YWG G;  2WLB A;  4X57 B;  4MAC A;  3TEY A;  2M0A A;  4PS3 A;  1Z5S B;  1SIF A;  2WXI A;  3JSV B;  3WAP A;  2D3B A;  4KGT A;  2M19 A;  4P6V F;  3MC0 B;  3UIO B;  3HRD D;  1V8C A;  1WH3 A;  3U8Z A;  1NEK B;  3PRP B;  2C9W B;  4ZDV A;  1WJU A;  2K9X A;  2M0X A;  5FR6 A;  3ZVV A;  3ZNI D;  3Q8C A;  4HDQ A;  3WCQ A;  2CHW A;  1HQR D;  3VAW A;  4OVU A;  1K8R B;  2KMA A;  2INP E;  2VH2 A;  1LXD A;  5CHW A;  3OAW A;  2MQJ A;  1NDD A;  2WXN A;  2KNB A;  1XF5 L;  3N3K B;  1ET9 A;  1T6B X;  1FFV A;  2ZJD A;  4GDL B;  2C7N B;  2HD5 B;  2IGG A;  1UNS A;  2NPT A;  2KK8 A;  2KHW B;  2AL6 A;  1C9F A;  4A9A A;  4M8N A;  3GZN B;  3BVM A;  1DOY A;  2W3R A;  1TBE A;  2FCM A;  1V81 A;  2N9P C;  4ACF A;  2BB6 A;  3I63 C;  1RFA A;  1J7B A;  4OW0 A;  2IDY A;  1EM7 A;  5EE1 A;  2BWF A;  2N9L A;  3QAQ A;  2JUO A;  1V1O A;  1D5M C;  2WXL A;  4OHJ A;  3KWL A;  1MG4 A;  1VD2 A;  4D2K A;  1L0X B;  1RLF A;  5AZG A;  3OJ4 B;  1KLG D;  2K39 A;  5MPO A;  2WXQ A;  4EUT A;  3DBH I;  4XDD A;  4DHJ B;  3AM9 A;  1NYQ A;  2IGD A;  4HEA 1;  3TUO A;  3B9J A;  1WMH A;  1UEL A;  1SB3 C;  2WNM A;  4IWO A;  1FNW A;  3C19 A;  3EA6 A;  4FN2 A;  1HZ6 A;  1XLP A;  5C2T B;  3V61 A;  3BZD B;  2LGY A;  3QQ8 B;  3KUC B;  3IAS 1;  3H7P B;  4WJN A;  2N1W A;  2LVQ A;  4N6E B;  5BMG A;  3ZRF A;  2JY6 A;  3GB1 A;  2KWC A;  2DLB A;  3U4E G;  3P63 A;  1NI3 A;  1TKG A;  2MP2 B;  2WHI A;  2D10 A;  1QOB A;  3T3O A;  3R7Q A;  2HTH A;  3QCA A;  5DPR A;  4HLE A;  2LWP A;  2L3Z A;  4AJY B;  2K0P A;  4BBN F;  2V3N A;  4IWQ A;  2CU3 A;  2NTS A;  3ONS A;  4L23 A;  2KN5 A;  2KTR A;  3R3M A;  3L16 A;  3AXC A;  5H8Y E;  1NI2 A;  5IOI A;  2YEP B;  1TY2 A;  4LK0 M;  2L0T A;  4BFR A;  1GJZ A;  3C0R B;  2LXA A;  1ZP0 B;  1VDV A;  5E6N A;  2BYF A;  4WWN A;  1F9J A;  3RNA C;  3VTV A;  2FE8 A;  1M4V A;  3P4P B;  2J0M A;  4KSL C;  3R2I A;  1JML A;  4S17 A;  1T5X D;  1WYG A;  1C4P A;  3NVW A;  4LNF A;  3A9J A;  2JZZ A;  4K81 A;  2L7R A;  4HKQ A;  2MCN B;  2KMC A;  1QKZ A;  1WGD A;  3AH7 A;  4HRS A;  2DZK A;  3AE6 B;  4H2A A;  4IM3 A;  3VDZ A;  3LMN A;  4KVG B;  1JWU D;  2Z0E B;  3M3J A;  4JPS A;  1RWS A;  1ACC A;  2QEJ C;  1OQQ A;  4PT5 A;  4IUM B;  3ETR A;  2KDI A;  1MFW A;  4HPL B;  1GAQ B;  2ZZP B;  2AWT A;  4W9E A;  1OFF A;  2BYE A;  1GB1 A;  5IKC M;  3QHT A;  1EF1 A;  4TKN A;  1EWY C;  2M17 A;  4NQL B;  1ZDV A;  2V4I B;  3ZDM C;  4PS8 A;  3WAN A;  5IN7 A;  3MP9 A;  3HVZ A;  4GIV A;  1NVI D;  2CHX A;  2HDE A;  3IFW B;  2Z59 B;  3PRM B;  1NYR A;  3EEC A;  2KDE B;  3AE3 B;  2PKO A;  2L8J A;  2D3A A;  1IGD A;  3ML9 A;  3DHI C;  3TBL D;  4C56 C;  4LJO B;  4HJK A;  3BVG A;  5T8I A;  1MPE A;  2KDM A;  2GMI C;  5HI1 A;  3KYC D;  2ZVN A;  2AQ3 B;  2V9H A;  1LQB A;  3N1Z C;  2BWE S;  2LGS A;  2KN4 A;  1VZ8 A;  1J7C A;  3M95 A;  2NMQ A;  1SE4 A;  1KRH A;  2HJ8 A;  4OZB A;  3PSE B;  1FD6 A;  2N0S B;  2N9X A;  1V49 A;  2N7D A;  3B1L X;  1D3Z A;  4M00 A;  2JYE A;  4RGN A;  3KH0 A;  3OJ3 A;  4P16 A;  3AED B;  4BZA A;  3SU8 X;  2K1F A;  4HKZ E;  2WP9 B;  2BYT A;  3NHE B;  1SSN A;  2IY1 B;  4WAF A;  3VXW A;  1WY8 A;  2JZP A;  1MJD A;  2KAN A;  1C4C A;  2C7H A;  2MEK A;  2AX5 A;  1FXT B;  4YSY B;  2JU6 X;  4DXG A;  3W1S C;  1V1P A;  4XGA B;  3AE4 B;  4NAW A;  1AYF A;  2MRP A;  1GNU A;  2EEL A;  4OVZ A;  3VR8 B;  3P1M A;  3U7D A;  2QIL A;  5HG2 A;  1WZ3 A;  3TMP B;  1CQV A;  2ACZ B;  1AN8 A;  2V0G A;  2N1V A;  4WH4 A;  2KDF B;  2DZM A;  2R61 A;  3U2S C;  3HIZ A;  3MC8 A;  1TKE A;  1FCC C;  4BOZ B;  1PFD A;  2PLP A;  2ZPY A;  1ET6 A;  5IO9 A;  1TZ1 A;  1WXA A;  4LLG M;  1UWX A;  2FAZ A;  3W9C B;  1TS2 A;  3NG0 A;  4KGS A;  3VUW A;  4EZK A;  4MM3 B;  3DVG Y;  3WA0 A;  4WIP A;  1KLV A;  5IA7 A;  3EFC A;  2MBH A;  2M4N A;  5EE0 A;  4K7W A;  1YJJ A; 
#chains in the Genus database with same CATH homology
 2IBI B;  3ZDT A;  1J0G A;  3A33 B;  3NS8 A;  1WX9 A;  4E3C A;  4B9K A;  4ICU A;  4EZL A;  2O6V B;  4K1R B;  3DBR I;  2KQ7 A;  3MJW A;  2GBJ A;  1WM3 A;  1ZGU B;  4IM0 A;  3L17 A;  4DHJ D;  1WXS A;  1GUA B;  2ZPN A;  1EUV B;  3AU5 A;  2NBW B;  4A20 A;  3X0W A;  1LM8 B;  3ML8 A;  3T8M A;  5EDS A;  2WYQ A;  2NPT B;  4ANV A;  1R4N I;  5GMV A;  5J2R A;  1VCB A;  3A9K B;  3RUI B;  2KX0 A;  1V2Y A;  3LDZ E;  3QK0 A;  2KC2 A;  4MGK E;  4KIK A;  2JZ3 B;  2YVC A;  1G6J A;  2JT4 B;  2JRI B;  3HM6 X;  4EKU A;  3R66 C;  3KYD D;  4HWI B;  2BPS A;  4URK A;  5C23 A;  1ZKH A;  2ZEQ A;  5AZF A;  3KUZ A;  1P98 A;  2G4S A;  3ZIM A;  1V80 A;  3A4R A;  4LCD E;  3DQV A;  2K25 A;  1WIA A;  3CF6 E;  3UIP B;  5JHB A;  4JQW C;  1WM2 A;  2UYZ B;  4FBJ B;  3IVF A;  3L0W B;  4FJV B;  1V9J A;  4G11 A;  1X1M A;  4KZ0 A;  2CHZ A;  2G3Q B;  2GBM A;  3APC A;  3HM3 A;  1OQY A;  2BYV E;  2DEN B;  2ASQ A;  1OGW A;  2XEW A;  4X57 B;  2FCS A;  5CX3 A;  3OLM D;  4BVU C;  4KDL B;  4PS3 A;  1Z5S B;  1SIF A;  1U4A A;  3JSV B;  3S2A A;  1WF9 A;  3WAP A;  1P3Q U;  1P9D U;  3RD2 A;  2EMS A;  5D94 A;  1BT0 A;  3L54 A;  3UIO B;  4LDT B;  2ZVO A;  4DHZ B;  4MGY E;  2D2Q A;  3PV1 A;  4II3 B;  2GBK A;  1UBI A;  1C3T A;  3PRZ A;  4JGH B;  4TV3 A;  2N4F A;  4MH0 E;  4WQO B;  5G2N A;  1WH3 A;  3U8Z A;  1YX5 B;  2J0J A;  3PRP B;  3WAL A;  1WMH B;  2C9W B;  2R2O A;  5L95 C;  4XX5 A;  4ZDV A;  1WJU A;  2M0X A;  2LRU A;  2LUE A;  5FR6 A;  5IAA C;  2AYO B;  2KQS A;  2CU1 A;  3ZVV A;  4MM3 A;  5J18 A;  5AZH A;  4I6P A;  4DXA B;  3ZNI D;  3VHT C;  3DCG A;  1KOT A;  4HCN B;  4HDQ A;  2CHW A;  3VAW A;  4OVU A;  3N32 A;  5LLI A;  3WAM A;  1K8R B;  2KMA A;  1HE8 A;  3PS6 A;  1LXD A;  2UWQ A;  5CHW A;  4W9G A;  2L00 B;  3CMM B;  2XBB C;  4IM2 A;  3OAW A;  2MQJ A;  1NDD A;  4RM8 A;  2KNB A;  2IO0 B;  4G0N B;  3VQI A;  4A3P A;  4BKG A;  1IP9 A;  2JF5 A;  3N3K B;  4FAD A;  3JYU A;  2ZJD A;  3PHX B;  4GDL B;  2C7N B;  4DK5 A;  2DX5 B;  2HD5 B;  3AU4 A;  4GB9 A;  1YD8 U;  2KFJ A;  2NPT A;  2KK8 A;  2OOB B;  1E7V A;  2KHW B;  2AL6 A;  2Y5B B;  4A3O A;  3QC8 B;  3A9K A;  3VH3 B;  2FIF A;  4ANU A;  4EFO A;  4M8N A;  2LRW A;  2WDT B;  2MLB A;  3HHM A;  1EF5 A;  1TBE A;  2WX1 A;  2FCM A;  1V81 A;  2N9P C;  3AUL A;  4CHK A;  1XQQ A;  5L83 A;  2DYO A;  1P0R A;  2KTR B;  4KV2 A;  4NPN A;  4GMV A;  4ZRK A;  4ANX A;  1H4R A;  1E7U A;  2NVU I;  5AEK B;  4ANW A;  2DYM A;  4KZC A;  1UBQ A;  2KDB A;  2V1Y A;  3PPA A;  3ZTD A;  1RFA A;  3RZW C;  3Q3J A;  4BKS D;  2FCN A;  1KM7 A;  1EO6 A;  2PJH A;  2BWF A;  3QAQ A;  1WR6 E;  3RT3 B;  2JUO A;  4TQ0 A;  3UIN B;  4FJY A;  3QA8 A;  4NNJ B;  2O2V A;  4W9H A;  3A9J B;  2JPH A;  2KTF A;  4GDK B;  1E5W A;  4F7Z A;  3Q3F A;  3A4S C;  3VUX A;  1J19 A;  2AEH A;  2M8S A;  2LVP A;  2MBQ A;  4J6I A;  1I35 A;  1VD2 A;  5G55 A;  4WJP A;  3W1Y A;  5J17 A;  4M8M A;  1UGM A;  3DOW A;  1XT9 B;  3DVN V;  4XC2 A;  3VH4 B;  1RLF A;  5AZG A;  3OJ4 B;  2KFK A;  4FUL A;  2K39 A;  1GC6 A;  2KJ6 A;  1Y8R C;  4AOF A;  4NAW B;  3EHV A;  4EUT A;  2ZNV C;  1WJ6 A;  3IHP C;  3N30 A;  1V5O A;  3W1S A;  4HPM B;  3DBH I;  4DHJ B;  1SGH A;  2MBO A;  3ZUN A;  3APD A;  2LGD A;  4MJS A;  2NR2 A;  1WMH A;  1UEL A;  4IWO A;  3RUL A;  1E8X A;  2GBN A;  2NCN A;  3ZKJ C;  4DHZ E;  3MTN B;  1IYF A;  2MBE A;  3K9O B;  2J0K A;  2V3S A;  4FN2 A;  4NJ6 A;  3SDL C;  4HXD A;  4TQ1 A;  5DPT A;  4W9K A;  4RM9 A;  3V61 A;  3JVZ X;  1WGR A;  3QQ8 B;  2LGY A;  3KUC B;  2KC1 A;  3ECI A;  4XZ4 A;  2A5U A;  3H7P B;  4WJN A;  3RZF A;  2N1W A;  2LVQ A;  4P7I A;  1IPG A;  3ZRF A;  2JY6 A;  5JHA A;  3UF8 A;  4ICV A;  2KWC A;  3WAO A;  1CMX B;  2XK5 B;  3PGE A;  4DWF A;  1R4M I;  2REX A;  2MP2 B;  2RPQ A;  2D10 A;  4NQK E;  3QAR A;  2D07 B;  3R7Q A;  2HTH A;  5DPW A;  4GDL A;  4JL9 A;  3KW5 B;  3QCA A;  5DPR A;  4E74 A;  2D3G A;  4HLE A;  2LWP A;  2KZR A;  1PQS A;  2L3Z A;  4AJY B;  4BBN F;  4II2 B;  3NY5 A;  1UD7 A;  4EOY A;  4I6N B;  4JIO U;  4IWQ A;  2GOW A;  4IG7 B;  3ONS A;  3ZTC A;  1XD3 B;  2KX3 A;  2J7Q B;  2L05 A;  2MA9 B;  3B08 A;  2KN5 A;  3LJ3 A;  2KTR A;  3R3M A;  3L16 A;  2VRR B;  3R7R A;  3AXC A;  1WGH A;  2BKF A;  3APF A;  4GXB A;  1NI2 A;  1WJ4 A;  5TR5 A;  2AL3 A;  1WRD B;  2LJ5 A;  2JXX A;  2MSE D;  4MSQ B;  3T9L A;  2L0T A;  2OJR A;  4BFR A;  1GJZ A;  3C0R B;  2BKR B;  4PYU A;  2LXA A;  4FJZ A;  3SHQ A;  4BBN C;  2K8C A;  2I1J A;  2IY0 B;  3KUD B;  5E6N A;  2BYF A;  4G50 A;  3PTF C;  4WWN A;  1F9J A;  4KDI C;  3VTV A;  4B6W A;  1Q0W B;  2C5L C;  1H8C A;  2J0M A;  4KSL C;  3DBS A;  2K6Q A;  4NY0 A;  3V6E B;  3U30 A;  2RGF A;  2KJH B;  3ZW3 A;  4PYZ A;  3A9J A;  2JZZ A;  4GDK A;  4K81 A;  2G45 B;  2L7R A;  2O6V A;  2V4L A;  2MCN B;  2KMC A;  5D7G A;  1V86 A;  2A4Z A;  1WGD A;  2C60 A;  2DZK A;  3UGB B;  3L10 B;  1RRB A;  3UQA A;  1TGZ B;  1OEY A;  2GBR A;  4IM3 A;  3VDZ A;  2B3A A;  2FCQ A;  4DDI D;  2IZV B;  4NJ7 A;  3ZO5 B;  4HCP B;  3LMN A;  4KVG B;  4B95 A;  3RYT A;  4BOS C;  2LAS A;  1V6E A;  1E90 A;  2CR5 A;  2MBB B;  2CKH B;  3TIX A;  3PT2 B;  2K8H A;  3PZD A;  4TUU A;  2FUH B;  5DPS A;  3ENE A;  2KVR A;  4HVB A;  2MW5 A;  2Z0E B;  3M3J A;  4W9L A;  3IBE A;  2JVC A;  3L08 A;  2LVO A;  4F8C B;  3ZNH B;  2KXJ A;  2NS5 A;  4AWJ A;  5BO4 B;  3V60 A;  3SD5 A;  4ZYN A;  3A1Q B;  3GZN I;  4GSW A;  1S3S G;  3HK0 A;  4ZRJ A;  4ASW C;  4IUM B;  4JLC A;  2KDI A;  4ZRI A;  3MHS D;  2WWZ A;  4HPL B;  4OVV A;  2ZZP B;  2AWT A;  1GC7 A;  1WZ0 A;  1WYW B;  4HDO A;  4W9E A;  3JW0 X;  2FID A;  5KHO A;  5E6O A;  1OEY J;  3ZRC A;  2ZNV B;  2EMT A;  2IYD B;  4IW0 A;  3M63 B;  1L7Y A;  3K9P B;  2BYE A;  2FNJ B;  4E71 A;  2KKC A;  2YLM A;  2MP2 A;  3QHT A;  5E6P A;  1EF1 A;  3JSV A;  4TKN A;  3BIN A;  2M17 A;  4NQL B;  1WE7 A;  1WGY A;  4IWP A;  3ZDM C;  4MSM B;  2JRH A;  4PS8 A;  3WAN A;  4W9D A;  4AUQ C;  2KJR A;  1RAX A;  1WJN A;  2IO2 B;  2BGF A;  4W9C A;  3QX1 A;  4GIV A;  1Q5W B;  2CHX A;  2KOX A;  3IFW B;  2Z59 B;  2HE7 A;  4W9J A;  2C7M B;  3PRM B;  3EEC A;  2KDE B;  4K7U A;  4GGQ A;  3CSF A;  4RMA A;  2L0F A;  2L8J A;  3KVF B;  4DBG A;  2RD0 A;  3NOB A;  3ML9 A;  3H9D A;  3PLV A;  4GOC A;  4AP4 C;  3TBL D;  2DHZ A;  4LJO B;  4AJW A;  3PHW B;  4HJK A;  1SE9 A;  4WWP A;  3ZNG C;  5CHV C;  1A5R A;  2GMI C;  4MDK E;  4MEM A;  1WGG A;  2KLG A;  1M94 A;  2MX2 A;  1Z2M A;  3H7S A;  2ZVN A;  3KYC D;  4FHJ A;  4M0W B;  3NZU A;  1LQB A;  2K8B A;  2DYB A;  2BWE S;  3PVL A;  1UZX B;  3V6C B;  1QZE A;  3I3T B;  4HK2 A;  3TCA A;  3M95 A;  3PRE A;  4MGZ E;  4FHK A;  3DVN U;  2M1M A;  3QWZ B;  3RCZ A;  2PE9 A;  1J8C A;  2JWZ A;  3GOE A;  1YQB A;  4LJP B;  5LXI B;  3VUY A;  2HJ8 A;  3QJZ A;  5CTR C;  3V62 A;  4EZJ A;  1LFD A;  3PSE B;  2O2V B;  4IC7 B;  1T0Y A;  4FLH A;  3TJP A;  2N9X A;  4LDT D;  5C1Z A;  1I42 A;  3TL5 A;  5LXH A;  1V49 A;  2N7D A;  2RSU A;  3B1L X;  1D3Z A;  1W6V A;  3EC8 A;  4EEW A;  3B0A A;  2KLC A;  3DVG X;  4N9F 4;  3PLU A;  2PPH A;  3ALB A;  2EKE C;  3A1Q A;  1NBF C;  2KFK B;  4FA6 A;  1YX6 B;  1GG3 A;  3KH0 A;  1E8W A;  3OJ3 A;  3DDC B;  3NZS A;  3SU8 X;  1E8Z A;  2DZI A;  2K1F A;  3EFU A;  2I1K A;  3M62 B;  4WAA A;  3NHE B;  2IY1 B;  5JH5 C;  1WX8 A;  2LXC A;  2IO3 B;  2LZ6 A;  3L13 A;  3VXW A;  3ZLZ A;  4KIK B;  5CHF A;  4MJS B;  2PE6 B;  1WY8 A;  3P2B A;  4BKS A;  4KSK C;  4W9I A;  3H6N A;  3VVW B;  2PEA A;  1MG8 A;  2KAN A;  2L76 A;  4F1S A;  2C7H A;  1FXT B;  3DPD A;  1UH6 A;  1YJ1 A;  5D2M B;  1YIW A;  1WI0 A;  3H1U A;  3W1S C;  1S1Q B;  5D6J B;  1WFY A;  2BF8 B;  4PS7 A;  5KHQ A;  1WXV A;  1JRU A;  4NAW A;  2DAJ A;  4CYE A;  2MRP A;  5HKH A;  1GNU A;  1L2N A;  1ZW7 A;  4GU2 A;  5JZE B;  2DAF A;  4BKT A;  1ISN A;  5DCN A;  3BY4 B;  3U7D A;  4MEL A;  1KJT A;  2G4D B;  2ZCB A;  3VTU A;  3D32 A;  1WZ3 A;  2KD0 A;  4W9F A;  2R2Q A;  2KO3 A;  3TMP B;  2DZJ A;  3VTW A;  2N1V A;  2MWS B;  2NBV B;  3IG3 A;  2KDF B;  2DZM A;  2WX0 A;  2NBU A;  1E8Y A;  3HIZ A;  4BOZ B;  1WE6 A;  4DDG D;  1WX7 A;  3H7P A;  4WJO A;  4MGI E;  2ZPY A;  1AAR A;  1TZ1 A;  1WXA A;  1V5T A;  4G3X B;  4I6L B;  3UQB A;  3AI5 A;  2FAZ A;  2K6D B;  4WWO A;  3QIJ A;  1WR1 A;  1C1Y B;  3O65 B;  2KWV B;  2LD9 A;  3VFK A;  1Q1O A;  2RR9 A;  3WIM A;  4K7S A;  2LGX A;  2XK5 A;  3DBL I;  3VUW A;  4GN1 A;  4EZK A;  3DVG Y;  3WA0 A;  2LI5 A;  1KLV A;  4WJQ A;  5IA7 A;  4YL8 A;  1WXM A;  2N9E B;  2O6V D;  2MBH A;  2QHO A;  2KWU B;  2M4N A;  2D11 A;  2Z0D B;  3X23 A;  2CS4 A;  4K7W A;  1OTR B;  3CST A;  2ZCC A;  3ZNZ B;  4CO7 A;  2W9N A;  1P1A A;  2N7E A;  1TTN A;  2IO1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...