4A3OA

Crystal structure of the usp15 dusp-ubl monomer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
211
Chain Sequence
b'AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3oA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3oA01
3ML9A 3VTVA 4HWIB 2XK5B 5CTRC 2K39A 4GGQA 3TBLD 3ZDTA 1GJZA 1J8CA 2RPQA 4HDOA 4TQ1A 2EMSA 1WMHA 5G55A 3PGEA 2MBBB 2GBRA 4BKSA 1OEYA 2L00B 2ZNVC 4IW0A 4LDTB 4NAWA 4I6NB 3DBLI 5CX3A 1WE7A 2KQSA 2FAZA 3PLVA 2KTRB 3ML8A 3GZNI 1EUVB 3KUCB 5DPWA 2DENB 4IWPA 3ZNID 3TCAA 2KJ6A 4ZYNA 3W1YA 1KJTA 4BKGA 2KK8A 2MQJA 2WX1A 3NHEB 3N3KB 2KFKA 5CHVC 4NPNA 2KVRA 2L0FA 1WGDA 1V9JA 4E71A 4ICVA 4W9JA 4KSKC 3H7PB 1Z2MA 1WGRA 2PE9A 2K8BA 3QAQA 3SD5A 3WALA 1CMXB 3ZKJC 5DPRA 2DZMA 4BFRA 4MJSB 5L83A 2PPHA 3KVFB 1E7VA 1XQQA 3ZO5B 4KIKB 3PV1A 2N9EB 1TBEA 2V4LA 4GDLB 2JT4B 2DYBA 3ZVVA 4IM3A 2G3QB 3NZUA 2VRRB 2G4SA 4II3B 4EEWA 2A4ZA 2YVCA 2C9WB 2WX0A 4HK2A 3DBRI 2LGYA 4W9FA 2C7MB 3RT3B 3LMNA 2GBMA 2L76A 2K6DB 4GDKA 3AU4A 3UQAA 3EHVA 1RFAA 3VUXA 2LD9A 5DCNA 1E8ZA 2MP2B 1BT0A 3VUWA 1I42A 3M63B 2JRIB 3ZNZB 2FCNA 4OVVA 3PTFC 4FLHA 5AZFA 4ANUA 4HCNB 3OLMD 1WRDB 4A3OA 5E6PA 2JVCA 1IPGA 1SIFA 4GIVA 2HJ8A 4BKSD 4DWFA 1ZKHA 4GOCA 3NOBA 3DQVA 4GSWA 3L13A 4MM3A 3A4RA 2NVUI 4WWPA 5G2NA 4JGHB 1H8CA 1E8XA 3R7QA 2FCSA 1C3TA 4WWNA 2NPTA 4MH0E 4NQLB 4BBNC 2BWES 3VUYA 1WIAA 2BKRB 2KKCA 3IG3A 2LGDA 2K1FA 4BOZB 4TKNA 3VHTC 1W6VA 4PS8A 3DBHI 1UELA 2M17A 3QARA 3OAWA 4FBJB 2AL6A 4KDLB 2PEAA 1YJ1A 3EFUA 2RR9A 3H7SA 1P98A 4TUUA 4KSLC 4HDQA 1LM8B 2XK5A 4MEMA 1D3ZA 3B0AA 3ZTCA 2Z59B 2GBNA 1WYWB 3RULA 1WE6A 2BYEA 4CO7A 1JRUA 2KLGA 1TZ1A 1U4AA 2MBHA 1RAXA 2KDIA 2M8SA 3BY4B 3T9LA 1YIWA 2KWVB 2ASQA 1KOTA 3HK0A 1EF1A 1I35A 4IWOA 2KFJA 2KTRA 2K6QA 2NBWB 2RGFA 4ANXA 2BF8B 1E5WA 2CHZA 3WIMA 2KLCA 4ANWA 1WR1A 2L3ZA 5D94A 4FA6A 3CMMB 3L0WB 4GB9A 1E90A 2CR5A 2EKEC 4II2B 4K81A 4M8MA 4DHZE 1XD3B 4AUQC 3ECIA 4KZCA 4FHKA 4EZJA 2L8JA 4FN2A 3H7PA 2KHWB 3TIXA 4FADA 1P9DU 3QC8B 1WI0A 3QX1A 5JHBA 4MJSA 5CHWA 4CYEA 4BKTA 4DBGA 2I1JA 4IWQA 2MBEA 4A20A 4KIKA 2NS5A 4NY0A 3LJ3A 4EFOA 4GDLA 5KHOA 5J18A 2LVOA 3S2AA 4W9HA 5E6OA 3O65B 3AXCA 1L7YA 4MSMB 4W9EA 3ZDMC 4FJYA 2MA9B 1Q1OA 2DHZA 1A5RA 5IA7A 2FUHB 1NBFC 2NBVB 3QCAA 2CHXA 2CS4A 2KDEB 5FR6A 3DCGA 2JZ3B 3PSEB 4J6IA 4TQ0A 1P0RA 1YX5B 4IUMB 2LVPA 1RLFA 2M0XA 3ZW3A 2JXXA 2LXAA 3Q3FA 4WAAA 2JF5A 3IBEA 4RMAA 2LASA 5J17A 3VVWB 4RM8A 4JLCA 5D7GA 2D07B 5LLIA 4B95A 1XT9B 2JWZA 4LDTD 4K7UA 4PS3A 1V49A 1WZ0A 2V1YA 2L7RA 4LJOB 4NQKE 3U30A 1GG3A 1V6EA 1AARA 3VH4B 4GU2A 2LUEA 3L08A 5GMVA 4BBNF 4HVBA 1OTRB 2ZJDA 3ZTDA 2A5UA 5AZHA 2R2OA 3A33B 3RD2A 4A3PA 2DZIA 1P3QU 2J0JA 3L17A 3NS8A 1WXAA 3ZRFA 3PS6A 4MSQB 2W9NA 2C7HA 1Q5WB 3H1UA 2KJRA 3L16A 1OGWA 1HE8A 4TV3A 5D6JB 5C23A 3RZFA 4FHJA 3APCA 2DYOA 2WYQA 4MGZE 4FJVB 2KX3A 1WGHA 2RSUA 4I6LB 1ZW7A 4HJKA 3QWZB 4MELA 1Z5SB 3V60A 2JUOA 4EUTA 3APFA 3I3TB 2FCMA 3R7RA 3UIOB 2N9PC 2D11A 4ASWC 1V5OA 2OOBB 5JHAA 2LXCA 3QHTA 3KW5B 3K9OB 5C1ZA 3MHSD 3DBSA 4B6WA 1WX8A 4HLEA 5JZEB 3PHWB 3GOEA 3ALBA 3KUDB 5BO4B 3WAPA 2KD0A 4AJYB 1G6JA 2CU1A 1KLVA 1SGHA 4WJPA 3DVNU 3H6NA 1WM3A 2LGXA 4NNJB 3W1SA 1WH3A 1K8RB 2BPSA 4F8CB 2K8HA 2OJRA 4DXAB 4NJ7A 3HHMA 5IAAC 4MGYE 1GC6A 1WGYA 2N1VA 4F7ZA 2KDFB 4N9F4 4M8NA 4KDIC 5LXIB 2MWSB 4ICUA 4W9IA 4E3CA 2BYVE 1YX6B 3M62B 4IM0A 2Y5BB 3VXWA 3ZNHB 3X0WA 1WJ4A 4ZRJA 1WXMA 1WFYA 3L10B 4G11A 4B9KA 2IY0B 4IG7B 2MCNB 1V86A 3EC8A 2O6VB 3V61A 1V5TA 3PHXB 3PLUA 1UH6A 4AP4C 4NJ6A 1LQBA 4K1RB 4AWJA 3UINB 4ZRKA 2IO1B 5E6NA 3CF6E 1V80A 1R4NI 2N9XA 1ZGUB 2FCQA 4KZ0A 1EF5A 3DOWA 1J19A 3L54A 3QIJA 4DK5A 2JZZA 2KO3A 4ZDVA 3H9DA 3RZWC 1WF9A 3U7DA 4WQOB 4MGIE 2DZJA 2CHWA 2IY1B 2O2VB 2YLMA 1WJNA 1VD2A 2FIDA 4IC7B 5TR5A 3T8MA 2XBBC 4DHJD 2ZNVB 3PREA 2Z0EB 4PYUA 3ONSA 5AEKB 1Q0WB 5LXHA 1C1YB 2ZVNA 1M94A 2KWUB 3HM3A 2LI5A 3BINA 4P7IA 4F1SA 2N7EA 3JW0X 2LRWA 2G45B 4G0NB 4AOFA 2GOWA 3R3MA 2ZEQA 2KNBA 5DPTA 3V6CB 2GMIC 2N4FA 3DDCB 1NI2A 1H4RA 1UBQA 2QHOA 4GMVA 1L2NA 2MRPA 3A1QB 3DVGX 3PT2B 3UGBB 4BVUC 2GBKA 4HCPB 4EKUA 1UGMA 3KH0A 2MP2A 4X57B 1E8WA 2MBQA 3V6EB 3A4SC 2FIFA 2WWZA 2MLBA 3JSVB 3JYUA 4GXBA 3VH3B 3A9JB 4WJOA 4BOSC 2KC2A 2R2QA 3M3JA 3IVFA 2BGFA 3VDZA 3DVGY 4PYZA 1NDDA 2KC1A 3V62A 1TTNA 2I1KA 2MSED 4KV2A 3ZRCA 4K7SA 3W1SC 3UIPB 3LDZE 4ZRIA 2Z0DB 1WJ6A 2MX2A 3VTWA 2LWPA 4EZLA 4JL9A 2IO0B 3AU5A 2GBJA 2WDTB 2KXJA 3B08A 1F9JA 1V2YA 3PVLA 4LCDE 3VAWA 1Y8RC 3PPAA 1X1MA 2NBUA 2C5LC 4WWOA 3SDLC 4IM2A 1IP9A 1WGGA 3SHQA 3TL5A 4W9KA 2BYFA 2NR2A 2K8CA 1R4MI 2N1WA 1QZEA 2RD0A 2UWQA 2KMAA 2KJHB 2JY6A 4PS7A 1J0GA 4ANVA 4DDGD 4HPMB 2M1MA 3ENEA 3K9PB 1UBIA 2PE6B 3PZDA 4LJPB 3VFKA 2DAJA 2G4DB 2O6VA 3N30A 2AYOB 2ZCBA 3OJ4B 4I6PA 3TMPB 3UF8A 1WY8A 2HE7A 2ZCCA 4DHZB 2KANA 2BKFA 2PJHA 4XC2A 5EDSA 5JH5C 1T0YA 2HTHA 2LJ5A 5J2RA 3A9KB 1GC7A 2NCNA 3PRPB 2KOXA 4URKA 1WXVA 4W9LA 1WJUA 4WJNA 2ZPYA 2AL3A 2XEWA 5D2MB 1YQBA 2B3AA 3M95A 3MTNB 4GN1A 1WMHB 1UZXB 1EO6A 3AI5A 3JVZX 4CHKA 4NAWB 2O2VA 4W9CA 3P2BA 1YD8U 1S1QB 2AEHA 1V81A 3IFWB 2IYDB 2ZPNA 3VQIA 2KZRA 4FJZA 3UQBA 5HKHA 2UYZB 1P1AA 4YL8A 1WZ3A 2D2QA 1GUAB 2ZZPB 2KFKB 2CKHB 3CSFA 1MG8A 3KYDD 4DDID 3HM6X 4K7WA 2DZKA 2KDBA 2KX0A 1IYFA 1TGZB 3EECA 3R66C 3D32A 3IHPC 3QK0A 2IZVB 4MDKE 2V3SA 3ZUNA 3A1QA 3OJ3A 2LVQA 4JIOU 2ZVOA 2D3GA 5KHQA 1E7UA 1PQSA 3WAOA 2K25A 4RM9A 3JSVA 3KUZA 3TJPA 3A9JA 3KYCD 4G50A 3WA0A 4FULA 3ZNGC 4EZKA 3VTUA 1OEYJ 2JRHA 3CSTA 2O6VD 1SE9A 2KTFA 3DPDA 3N32A 2JPHA 3NY5A 2HD5B 3QQ8B 4GDKB 5AZGA 2N7DA 2IO3B 4JQWC 4XX5A 4XZ4A 4AJWA 2DYMA 2DAFA 4EOYA 2LRUA 2M4NA 2L05A 1UD7A 1GNUA 3APDA 1ISNA 3U8ZA 1WM2A 3ZIMA 3AULA 3RUIB 4W9GA 2KWCA 1WXSA 2EMTA 4HXDA 3NZSA 3QA8A 1FXTB 2FNJB 1WX9A 1OQYA 3C0RB 3MJWA 2BWFA 3SU8X 2IO2B 4E74A 4DHJB 3PRMB 5DPSA 2C7NB 2C60A 3HIZA 2KQ7A 3DVNV 4WJQA 4G3XB 3RYTA 4W9DA 3RCZA 5CHFA 2LZ6A 3B1LX 4KVGB 3X23A 3QJZA 1VCBA 1LFDA 1S3SG 2NPTB 2KN5A 1RRBA 2J7QB 2D10A 1LXDA 2J0MA 4HPLB 4M0WB 2IBIB 1WR6E 1WX7A 3Q3JA 5L95C 4MGKE 1KM7A 2MBOA 2REXA 2J0KA 3WAMA 1E8YA 3PRZA 2L0TA 2KMCA 3A9KA 3ZLZA 4OVUA 2AWTA 3WANA 2DX5B 2MW5A
chains in the Genus database with same CATH superfamily
1PYWD 3VTVA 3TBLD 1K51A 2JSVX 1E7PB 1TKEA 4XWWA 2MBBB 4BKSA 2L00B 4IW0A 1E0ZA 2MH7A 5HFYA 3ML8A 5DPWA 1MI0A 3W1YA 4BKGA 2MQJA 4KSKC 1WGRA 3O13A 3QAQA 3AH7A 4HROA 2MJDA 2PPHA 4KIKB 1D5MC 2N9EB 2V4LA 1R7SA 1AYFA 2G3QB 1XEEA 3CWIA 2SAKA 4II3B 1C4CA 2A4ZA 1HQRD 2C9WB 2WX0A 4HK2A 3DBRI 5HHDG 2AQ3B 3EHVA 1FMAD 3VUXA 1L6UA 1JCKB 1BT0A 4KX6B 2CU3A 3VUWA 3CIRB 3ZNZB 2FCNA 4LK0M 5IKCM 2EELA 2ACZB 3R2TA 4DWFA 3I5JC 4GOCA 3L13A 2NVUI 1UNSA 2J53A 4JGHB 3RFZB 1H8CA 1E8XA 4WWNA 1XO3A 2NPTA 4MH0E 4NQLB 1I4GA 2WXIA 3VHTC 3DBHI 1UELA 2PEAA 4IDIA 4KSLC 1YJJA 4C7YA 2VH1A 3DBLB 3B0AA 3T3NA 1WE6A 2QCZA 1KLGD 1TZ1A 1U4AA 3U7ZA 1I4QA 1CQVA 1PFDA 2RGFA 2BF8B 1V1PB 2J42A 3HVZA 4K3CA 3DHGC 3AE5B 2M56B 4AQ7A 1SF0A 4K81A 1FFVA 4M8MA 1XD3B 4FHKA 2IGDA 2L8JA 3H7PA 4FADA 1FM0D 2BB6A 4DBGA 4W9HA 3O65B 4MSMB 4FJYA 2MA9B 5IP4D 2K0PA 1A5RA 5IA7A 1ESFA 2CS4A 2KN4A 2WQYB 5BYSA 4JWUC 2PVOD 1A70A 1FIQA 1SE4A 1M4VA 4GLSC 3IT4B 2LXAA 3N9YC 4WAAA 2WXPA 3IBEA 2B76B 5C3JB 3VVWB 5J17A 4RM8A 5D7GA 5LLIA 1XT9B 1L0YB 4PS3A 1WZ0A 2L7RA 4NQKE 2L32A 1V6EA 1AARA 1I4XA 3A33B 1P3QU 3NS8A 2INCC 3Q69A 4HEA1 4MSQB 5BYQA 3H1UA 3L16A 5D6JB 1OGWA 5C23A 3RZFA 4FHJA 3APCA 2WYQA 3I57A 2RSUA 1FXAA 4A90A 3UIOB 1V5OA 3MJ5A 2BB5A 1T5XD 3DBSA 5JZEB 3KUDB 5BO4B 1C4AA 1OFFA 2MJ3A 2LGXA 4NNJB 3W1SA 1GB1A 3V05A 2OJRA 2K3UA 3HHMA 4MGYE 2AX5A 4F7ZA 5AUIA 4N9F4 4M8NA 2WDRB 3Q3OC 4ICUA 3NZ3A 3PZ8A 3M62B 2Y5BB 4OHJA 4RGTA 3X0WA 1WJ4A 1WFYA 3L10B 4G11A 2IY0B 3ZJVA 1V5TA 1UH6A 4AP4C 2IO1B 1QOAA 3BWUD 1FEHA 1ZGUB 2FCQA 1YQ4B 2PIAA 3QIJA 4DK5A 2KO3A 1IUEA 3H9DA 1WF9A 2WLBA 2DZJA 2O2VB 5TR5A 4IC7B 2Z0EB 4PYUA 2IPKD 2X38A 3FC4A 4HJGE 1C1YB 1XLOA 4XWTA 2KACA 2BVCA 3JW0X 2LRWA 3AN1A 4G0NB 2GOWA 3P4RB 2ZEQA 2KNBA 3R3MA 5DPTA 3W5UB 2I2YA 4GMVA 4TSSA 3AEGB 3PT2B 4BVUC 3MC9A 4EKUA 2FIFA 2WWZA 3JYUA 4GXBA 3A9JB 4WJOA 2KC2A 3AB5A 3IVFA 2QIEB 3MFGA 1N6ZA 3C8YA 1NDDA 2V4IB 4KV2A 3ZRCA 4K7SA 3LDZE 2V0GA 1WJ6A 3DHIC 3AU5A 4DQOC 3IAM1 1SE3A 1KRHA 1N5XA 1KFYB 1V2YA 3VAWA 2NBUA 3SDLC 3TEYA 3TL5A 3TEXA 1B9RA 2GB1A 1XCTL 2UWQA 2QC8A 2H88B 1J0GA 4ANVA 1GOZA 2KQ4X 2QILA 3K9PB 2DAJA 2G4DB 2O6VA 4I6PA 1JW9D 1PUTA 1XLPA 2BKFA 4XC2A 2QSDA 3PRPB 2NCNA 2Y5CA 1FRDA 4HPPA 4H2AA 1MJDA 4FXCA 4CQNA 3IFWB 2IYDB 1ZPSA 3BVMA 4RCOA 4KKJA 4L1BA 2UYZB 5MPOA 4YL8A 1WZ3A 2D2QA 3ABVB 4DDID 1UWMA 2DZKA 2IJ0A 3EECA 1GAQB 2IZVB 2V3SA 3KQ4A 4JIOU 3C19A 3WAOA 2K25A 1L6VA 3P1MA 1V8CA 3KUZA 2IGHA 1V97A 4M01A 3ZNGC 1ZUD2 1D6EC 1SE9A 2KTFA 5H92C 3R8BA 3U52E 4XX5A 2L05A 1WSPA 3APDA 3VRAB 1ZXIA 3AE7B 4QAYA 3AULA 3QA8A 1FXTB 2HDEA 1JWUD 1OQYA 4DHJB 2C7NB 2C60A 3HIZA 2DNFA 3RYTA 2R61A 2LZ6A 3B1LX 4KVGB 3QJZA 1LFDA 2NPTB 3Q3NC 1RRBA 2D10A 3N20C 1WX7A 2REXA 4US8A 2J0KA 3WAMA 2WXHA 1E8YA 2W82A 2J4XA 2KMCA 5TSSA 2AWTA 4DHZE 1WYGA 2INDC 1J8CA 2RPQA 4HDOA 1QQRA 4TQ1A 2KVZA 1WMHA 3Q8BA 2ON8A 1WE7A 2KQSA 4RGNA 3PLVA 1C4PA 2M0AA 2ICIA 4IWPA 1KJTA 3N3KB 1E9MA 3AEDB 4NPNA 1WGDA 4W9JA 1FD6A 2DLBA 3H7PB 1Z2MA 2PE9A 3SD5A 2DZMA 1T0SC 1XQQA 3AE9B 3ZO5B 3PV1A 5E6JA 2Y5PA 2DYBA 3ZVVA 2VRRB 2G4SA 5C2TB 2KWDA 2YVCA 1ZDXA 4W9FA 3NVVA 2C7MB 1Q10A 2GBMA 2YEPB 1RFAA 1TY0A 3RNGC 4OZAA 2LGSA 2NMQA 4MT5A 3OLMD 3KWLA 3B9JA 5E6PA 2JVCA 1IPGA 1SIFA 4GIVA 4BKSD 1C76A 3DQVA 2HTME 4GSWA 3A4RA 3VUYA 1WIAA 2BKRB 2KKCA 3BIID 3IG3A 2LGDA 4RFBA 1CK1A 1FCCC 3P4PB 3SFEB 3NUHB 4TKNA 4C00A 5FK9C 2PMVA 2M17A 3OAWA 2AL6A 2FBWB 2RDGA 1OQRA 3H7SA 1FNWA 4HDQA 1LM8B 2XK5A 1D3ZA 3ZTCA 2Z59B 3RULA 4D2KA 4US9A 4CO7A 2KLGA 1RAXA 2KDIA 2M8SA 2Q5WD 1R4MB 5EE0A 3HK0A 1I35A 4L23A 4RNAA 2KFJA 2KTRA 3URYA 1NENB 1E5WA 4J3OD 2CHZA 3WIMA 4ANWA 1WR1A 5D94A 4FA6A 3PZ7A 3L0WB 4GB9A 1E90A 4AUQC 4KZCA 4EZJA 5I4DA 4LNKA 3QC8B 1WI0A 4MJSA 4CYEA 3Q6BA 4EFOA 4GDLA 3ZYYX 3EUB2 3AEEB 4W9EA 5BMGA 3DWMA 2DHZA 2D3BA 2Y3AA 4N58A 1NEKB 3IXSA 1PGXA 1HTOA 3QCAA 2CHXA 1TS2A 2D3CA 5FR6A 4M02A 3BZDB 2JZ3B 3PSEB 4J6IA 3AE6B 1C78A 2LVPA 2M0XA 3ZW3A 3Q3FA 3B2FA 4WIPA 2KMMA 3MC0B 2D07B 4OZBA 4K7UA 4OW0A 3U30A 3ETRA 3P63A 1EU4A 2WXNA 1F2RC 1OTRB 2ZJDA 3ZTDA 1HXYD 2R2OA 4O1NA 2DZIA 2V3NA 1WXAA 3PS6A 4C7ZA 2C7HA 3IT6B 2KJRA 4TV3A 5FR3A 2WXKA 2DYOA 1CJEA 2MJEA 1I7HA 1WGHA 1ZW7A 4EUTA 3V60A 2XN9C 5BMIA 3APFA 4ASWC 5JHAA 2LXCA 1YN5A 3QHTA 4WWMA 1WWTA 3K9OB 3EGRA 1SB3C 5C1ZA 3MHSD 1GB4A 4B6WA 2WXOA 3PHWB 1QT9A 3GOEA 4WH4A 5HI1A 3WAPA 1G6JA 1JMLA 2QEJC 2V9HA 4OVUA 1JROA 1SGHA 2BS3B 4WJPA 4IOIE 2DWQA 2BPSA 4NJ7A 2WDQB 1K52A 3AEFB 2BQQA 4E3CA 1YX6B 3VXWA 2RDBC 4ZRJA 1WXMA 2JXTA 1VR9A 1V86A 3EC8A 2O6VB 3LYYA 1LQBA 1YQ3B 3ZJUA 3VR9B 4AWJA 2JYTA 1JWSD 5E6NA 3CF6E 1V80A 2JX5A 1EF5A 3DOWA 1L4DB 2WXQA 1WGKA 3HUIA 4LNFA 2CHWA 5D3DA 2ZNVB 1M94A 2KWUB 3HM3A 3BINA 4XDDA 2HJ1A 1DGJA 2N4FA 1H4RA 2MRPA 3DVGX 2NTSA 1KTKA 4HCPB 1P7FA 3MC8A 4X57B 1E8WA 4M00A 3BYYB 3TUOA 3VH3B 4BOSC 1D5ZC 5EE1A 2R2QA 3DVGY 2KC1A 2I1KA 3FAHA 3UIPB 4ZRIA 4YSXB 2Z0DB 4JL9A 2WDTB 4JPSA 4EE2A 4LCDE 2VZKB 3SFDB 4DXFA 1MVKA 3PPAA 4ZHPA 4WWOA 4IM2A 4W9KA 2K8CA 1PGAA 1R4MI 3UI3A 2RD0A 2KMAA 1SSNA 2JY6A 1VZ8A 1STEA 4HRSA 5T8IA 3PZDA 4LJPB 1DOIA 3VFKA 3OJ4B 3TMPB 2KANA 5EDSA 1T0YA 1GC7A 2KOXA 1F2RI 2AL3A 3M95A 2B3AA 4GN1A 1WMHB 4B0MA 1VJKA 3JVZX 4W9CA 1QILA 1V81A 2ZPNA 2ONQA 1C77A 1P1AA 3GE3C 2ZZPB 3N1YC 4AS1A 4K7WA 2KDBA 1L4ZB 2KX0A 3QK0A 4MDKE 3OJ3A 3VRBB 3TSSA 2D3GA 2OJWA 1UUPA 1E7UA 3I63C 3JSVA 3TJPA 3WA0A 1YMHE 4ZYSA 1OEYJ 2O6VD 4LNOA 3NY5A 3AE2B 5BYRA 2GI9A 2QJLA 1Y56A 4JQWC 4XZ4A 2DAFA 4PK1A 4YSYB 2WXRA 4RF0A 2JWUA 3U8ZA 3RUIB 4W9GA 1WXSA 2EMTA 1QLBB 3C0RB 2BWFA 1J7AA 4WJQA 4W9DA 3RCZA 3X23A 4XDCA 2KN5A 2J7QB 2PKOA 2IBIB 3Q3JA 1WXQA 1KM7A 4RGOS 2W55A 1JQ4A 4KGTA 3A9KA 1ET9A 3WANA 2DX5B 3ML9A 2RMMA 2XK5B 2K39A 4GGQA 2AQ2B 2MHJA 2EMSA 1I4PA 5G55A 3TEZA 3PGEA 4KKIA 3E56A 2GBRA 2LHDA 2KDMA 3DBLI 5G5HA 5FKAC 2KTRB 2IDYA 4HKZE 1QF6A 2DENB 3ZNID 4ZYNA 1FO4A 2WX1A 4B0EA 3ZJTA 2KFKA 2KVRA 2K22A 2L0FA 2VZKD 1TT5B 2WXJA 4ICVA 5EE9A 1I4HA 3WALA 1CMXB 1MHXA 5DPRA 3ZKJC 1R4NB 4MJSB 5L83A 4ARCA 3KVFB 1TBEA 4GDLB 4IM3A 3NZUA 4C80A 4NAMA 5D3IB 4EEWA 3AE3B 2LGYA 4ITKA 3LMNA 2K6DB 4GDKA 1RWSA 4ZOHC 2LD9A 5DCNA 1E8ZA 2MP2B 4XE0A 1I42A 3M63B 1C79A 3NJTA 3PTFC 4FLHA 4LTUA 4ANUA 4HCNB 1PDXA 1TZOA 2TSSA 3NOBA 4ZRQA 4MM3A 4WWPA 3R7QA 2FCSA 1NYQA 4M0WA 4N59A 4BOZB 3OG5A 4JE3B 5AUKA 2W54A 4KDLB 1YJ1A 3EFUA 2WXGA 4TUUA 4A9AA 1P7EA 1YNTE 2GBNA 4YTNB 1JRUA 2AQ1B 2MBHA 3AE4B 1UWXA 2KWVB 3SR6A 1KOTA 1EF1A 1AWDA 2LHEA 1SXTA 5EE3A 1TYGB 4LNNA 2KLCA 2CR5A 4YTMB 4II2B 3ECIA 1DYQA 3BK2A 2KHWB 3TIXA 3QX1A 3DBRB 5CHWA 4BKTA 1T0QC 4IWQA 1IBXB 3W2DA 4NY0A 1QOFA 3LJ3A 5KHOA 5J18A 1IGDA 3IAS1 2FUHB 1NBFC 2NBVB 3WCQA 1MFWA 4L2YA 1P0RA 4IUMB 3AV8A 1TY2A 1MG4A 2L1AA 1RLFA 2JXXA 3U2SC 3HRDD 2LASA 2WU2B 4JLCA 3E9SA 4B95A 2JWZA 2WXLA 3EFCA 1NI3A 5IO9A 3DBHB 2GLSA 3VH4B 3L08A 5GMVA 4BBNF 4HVBA 1TS5A 4A3PA 2L83A 2J0JA 3L17A 2M19A 3ZRFA 3AEAB 2W9NA 4YXDB 4BZAA 1N63A 3GE8C 2E3TA 4NZLB 2W3SA 4MGZE 4I6LB 4MELA 3QWZB 2JUOA 2FCMA 2N9PC 2OOBB 4ZRPA 2JU6X 3KW5B 4ACFA 1HA5A 1TKYA 1WX8A 2BS2B 1N61A 2X8XX 4AJYB 2CU1A 1ENFA 3DVNU 1WM3A 4RGMA 4F8CB 1SJHD 2OHFA 5IAAC 2N1VA 2KDFB 3P4QB 2MWSB 4W9IA 1V1OA 3I9V1 4Q2JA 3KLSX 3GZNB 4YSZB 3Q2AC 2PVGC 4LNIA 3V61A 3PLUA 3GP7A 2V3PA 1D5XC 4P1BC 3MHZA 1R4NI 2N9XA 4KZ0A 3ZQ4A 1HZ6A 3L54A 2JZZA 2LUMA 4WQOB 4MGIE 1ZDVA 4DHJD 3T8MA 2XBBC 3PREA 3ONSA 1C9FA 1T0RC 5LXHA 3RN9C 2Z8LA 2H89B 3PO0A 4PT5A 4P7IA 1I4RA 2LI5A 2ZW0A 4AOFA 3V6CB 3DDCB 1E6EB 3ZGZA 1NI2A 2JYEA 1FNVA 2RDHA 2BW2A 2MP2A 2MBQA 2D5GA 1JWAD 3JSVB 4RH6A 1FNUA 2N7JA 3GB1A 2BGFA 3VDZA 4PYZA 4YT0B 3V62A 4LLGM 2MSED 2W3RA 3W1SC 1L0XB 2MX2A 2WXMA 3N1ZC 4A8XC 2CJNA 2LJIA 4WAFA 3VTWA 4RF1A 2XNAC 2IO0B 2INNE 3PVLA 3RPFC 1X1MA 2C5LC 1IP9A 3SHQA 2BYFA 1LO5D 2WGSA 1YJIA 4HPMB 4S17A 2M1MA 2EKIA 3ENEA 1UBIA 2PE6B 3UF8A 3N30A 2AYOB 2ZCBA 1WY8A 2HE7A 2UU7A 5JH5C 2PJHA 2HTHA 3A9KB 4URKA 1JWMD 4W9LA 1WJUA 4WJNA 2ZPYA 5D2MB 1YQBA 3MTNB 2I38A 3DHHC 3AI5A 2KT7A 1D4BA 1YD8U 1S1QB 2AEHA 1IBXA 2KZRA 4FJZA 4JWSC 3NVWA 1FRRA 5HKHA 2RPVA 2VH2A 1GUAB 3Q8FA 2KFKB 2CKHB 1MG8A 3KYDD 1IYFA 4YWGG 1TGZB 3EA6A 3D32A 1FPYA 1QOBA 4JX1C 3A1QA 1SEBD 2ZVOA 3U4EG 1PQSA 3Q8CA 4RM9A 1E10A 4G50A 4EZKA 3VTUA 2JRHA 3CSTA 3DPDA 2BT6A 3N32A 4P1CC 3AM9A 3QQ8B 4GDKB 2QMTA 2LRUA 2M4NA 1GNUA 3NZSA 2FNJB 1WX9A 3MJWA 1KLUD 1IGCA 2IO2B 3PRMB 5DPSA 4MM3B 3DVNV 4G3XB 1TS3A 5CHFA 4C56C 1VCBA 1S3SG 4HPLB 1LXDA 4M0WB 4N6EB 1WR6E 5GXGB 3NS1A 5L95C 3W5VB 4MGKE 2MBOA 2WS3B 1CZPA 3PRZA 2WNMA 3KWVA 3ZLZA 3BK1A 3ZDTA 4HWIB 5CTRC 1GJZA 1YN3A 3T3OA 4YTPB 1N60A 1K50A 1OEYA 2ZNVC 4LDTB 4NAWA 4I6NB 4WQMA 5CX3A 5IN7A 1QOGA 2FAZA 2FE8A 3GZNI 1EUVB 3KUCB 3W9CB 3FILA 3TCAA 2KJ6A 2KK8A 1L0VB 2G9HD 3NHEB 5CHVC 4C4VA 1V9JA 4E71A 2YEPF 2K8BA 1VLBA 1WRIA 4BFRA 2LMCA 1T3QA 1E7VA 3P4SB 1KH0A 4P6VF 2JT4B 2PTLA 5IOIA 1SIJA 1NYRA 2SEBD 3RT3B 1L5PA 2L76A 3UQAA 3AU4A 1EWYC 4KGRA 1XXGA 2JRIB 4OVVA 5AZFA 1JWBD 1WRDB 4A3OA 2WHIA 2HJ8A 1FFUA 1ZKHA 2MEKA 4DXGA 5G2NA 1FXIA 3RI7C 1C3TA 2QDFA 4BBNC 2BWES 1DOXA 2K1FA 4MACA 3OWEB 3Q8AA 1W6VA 5H8YE 3NVZA 1YN4A 4PS8A 3AE8B 3QARA 4FBJB 1UF0A 2RR9A 1P98A 3AE1B 3Q14C 4MEMA 2N9LA 4REZA 1BUIC 1PGBA 1WYWB 3NG0A 2BYEA 3MP9A 3T9LA 2PLPA 1HZ5A 2KYWA 3BY4B 1VRAB 1ZE3D 1YIWA 2ASQA 4A55A 4IWOA 4ANXA 2K6QA 2NBWB 2L3ZA 2WP9B 2FUG1 3CMMB 5LNK1 4USAA 2EKEC 4ZHOA 3RMKC 1XCQL 3BVGA 3NRZA 4FN2A 1HEZE 1P9DU 1RYJA 5JHBA 2I1JA 4A20A 2MBEA 4KIKA 1TS4A 2NS5A 4A6QA 2LVOA 3S2AA 5E6OA 3HVDA 3AXCA 1L7YA 2K9XA 3ZDMC 1Q1OA 2KDEB 4UDUC 2BYTA 3DCGA 3N1XC 4TQ0A 2LFIA 4K3BA 1YX5B 1QKZA 2E6XA 2JF5A 4RMAA 1XLNA 1EU3A 2KAJA 4LDTD 1V49A 2V1YA 4LJOB 2PW9A 1ROEA 1GG3A 1F52A 4GU2A 2LUEA 2A5UA 5AZHA 3RD2A 4WURA 1J7BA 2WU5B 1Q5WB 1HE8A 2JQRB 4FJVB 2KX3A 4HJKA 1Z5SB 3I3TB 3R7RA 2D11A 2CJOA 4S0RA 3RNBC 3B2GA 1N62A 1B1ZA 1V1PA 1XLQA 4HLEA 1MPEA 3ALBA 2KD0A 4HKQA 1KLVA 3H6NA 1SJED 1GPXA 1WH3A 1K8RB 2K8HA 4DXAB 2BTEA 1SE2A 1GC6A 1WGYA 3J9CA 4KDIC 5LXIB 3AECB 3GS2A 2BYVE 4IM0A 3ZNHB 1AN8A 1JRPA 1SBBB 3RNEC 1F1HA 4B9KA 1UGJA 4IG7B 2MCNB 2BBCA 3PHXB 2G1EA 4NJ6A 2INPE 4IKGA 4K1RB 3UINB 4ZRKA 1NVID 3RNAC 3Q8EA 1J19A 1VDVA 1T6BX 4ZDVA 1RFKA 3RZWC 3U7DA 2IY1B 2YLMA 1WJNA 1VD2A 2FIDA 5AEKB 1J7CA 1Q0WB 5HG2A 1TIFA 2ZVNA 1ZOYB 1LGRA 4F1SA 2N7EA 2G45B 1TJEA 2GMIC 1UBQA 2QHOA 1L2NA 1EWCA 3A1QB 2N9KA 3UGBB 1F0ZA 5G5GA 2GBKA 2J52A 3RNCC 1UGMA 2JZPA 3KH0A 3V6EB 3A4SC 2MLBA 3DWGC 3NVYA 3M3JA 4XYCA 3H8HA 1TTNA 2ZW1A 1ZXHA 1HTQA 1TKGA 2D3AA 2LWPA 3L4PA 4OVZA 4EZLA 1YOVB 2GBJA 3BVZA 1VZ7A 2OEDA 3SEBA 3TEWA 2KXJA 3B08A 1F9JA 1Y8RC 1FCLA 1WGGA 2N0SB 2NR2A 2N1WA 1QZEA 4TMAB 3VR8B 2KJHB 4PS7A 4DDGD 1VZ6A 2LEKA 1EM7A 3RNFC 2ZCCA 4DHZB 5J2RA 2LJ5A 3V3XA 1WXVA 2XEWA 1AW7A 1MHHE 3BYTB 1UZXB 1EO6A 1ACCA 1DOYA 3LXFA 4CHKA 4NAWB 3FKYA 2O2VA 3P2BA 3R2IA 4P16A 3VQIA 3UQBA 3FILB 4BAXA 2WDVB 4C4VB 1BMLC 4MH8A 3CSFA 3HM6X 2NTTA 3R66C 3AMZA 3Q3MC 3IHPC 3ZUNA 4ARIA 3ZXRA 2LVQA 1K53A 1KF6B 5KHQA 4R3DA 1RM6C 3A9JA 2BS4B 2IGGA 3KYCD 4FULA 4NJCA 2K5PA 3P42A 2JPHA 5AZGA 2HD5B 2N7DA 2IO3B 1OQQA 4AJWA 2DYMA 4OZCA 3AEBB 4EOYA 1UD7A 1JALA 3ZXVA 1ISNA 3ZIMA 1WM2A 2KWCA 4HXDA 2GRIA 3SU8X 4E74A 5BMHA 4XGAB 2L52A 1F77A 2KQ7A 2DBYA 1BXTA 2LGIA 4KGSA 2J0MA 2WXFA 5JXVA 3LB8C 1XF5L 1N5WA 2L0TA 1ZP0B 1ET6A 2MW5A
chains in the Genus database with same CATH topology
3ML9A 3VTVA 4HWIB 2XK5B 5CTRC 2K39A 4GGQA 3TBLD 3ZDTA 1GJZA 1J8CA 2RPQA 4HDOA 4TQ1A 2EMSA 1WMHA 5G55A 3PGEA 2MBBB 2GBRA 4BKSA 1OEYA 2L00B 2ZNVC 4IW0A 4LDTB 4NAWA 4I6NB 3DBLI 5CX3A 1WE7A 2KQSA 2FAZA 3PLVA 2KTRB 3ML8A 3GZNI 1EUVB 3KUCB 5DPWA 2DENB 4IWPA 3ZNID 3TCAA 2KJ6A 4ZYNA 3W1YA 1KJTA 4BKGA 2KK8A 2MQJA 2WX1A 3NHEB 3N3KB 2KFKA 5CHVC 4NPNA 2KVRA 2L0FA 1WGDA 1V9JA 4E71A 4ICVA 4W9JA 4KSKC 3H7PB 1Z2MA 1WGRA 2PE9A 2K8BA 3QAQA 3SD5A 3WALA 1CMXB 3ZKJC 5DPRA 2DZMA 4BFRA 4MJSB 5L83A 2PPHA 3KVFB 1E7VA 1XQQA 3ZO5B 4KIKB 3PV1A 2N9EB 1TBEA 2V4LA 4GDLB 2JT4B 2DYBA 3ZVVA 4IM3A 2G3QB 3NZUA 2VRRB 2G4SA 4II3B 4EEWA 2A4ZA 2YVCA 2C9WB 2WX0A 4HK2A 3DBRI 2LGYA 4W9FA 2C7MB 3RT3B 3LMNA 2GBMA 2L76A 2K6DB 4GDKA 3AU4A 3UQAA 3EHVA 1RFAA 3VUXA 2LD9A 5DCNA 1E8ZA 2MP2B 1BT0A 3VUWA 1I42A 3M63B 2JRIB 3ZNZB 2FCNA 4OVVA 3PTFC 4FLHA 5AZFA 4ANUA 4HCNB 3OLMD 1WRDB 4A3OA 5E6PA 2JVCA 1IPGA 1SIFA 4GIVA 2HJ8A 4BKSD 4DWFA 1ZKHA 4GOCA 3NOBA 3DQVA 4GSWA 3L13A 4MM3A 3A4RA 2NVUI 4WWPA 5G2NA 4JGHB 1H8CA 1E8XA 3R7QA 2FCSA 1C3TA 4WWNA 2NPTA 4MH0E 4NQLB 4BBNC 2BWES 3VUYA 1WIAA 2BKRB 2KKCA 3IG3A 2LGDA 2K1FA 4BOZB 4TKNA 3VHTC 1W6VA 4PS8A 3DBHI 1UELA 2M17A 3QARA 3OAWA 4FBJB 2AL6A 4KDLB 2PEAA 1YJ1A 3EFUA 2RR9A 3H7SA 1P98A 4TUUA 4KSLC 4HDQA 1LM8B 2XK5A 4MEMA 1D3ZA 3B0AA 3ZTCA 2Z59B 2GBNA 1WYWB 3RULA 1WE6A 2BYEA 4CO7A 1JRUA 2KLGA 1TZ1A 1U4AA 2MBHA 1RAXA 2KDIA 2M8SA 3BY4B 3T9LA 1YIWA 2KWVB 2ASQA 1KOTA 3HK0A 1EF1A 1I35A 4IWOA 2KFJA 2KTRA 2K6QA 2NBWB 2RGFA 4ANXA 2BF8B 1E5WA 2CHZA 3WIMA 2KLCA 4ANWA 1WR1A 2L3ZA 5D94A 4FA6A 3CMMB 3L0WB 4GB9A 1E90A 2CR5A 2EKEC 4II2B 4K81A 4M8MA 4DHZE 1XD3B 4AUQC 3ECIA 4KZCA 4FHKA 4EZJA 2L8JA 4FN2A 3H7PA 2KHWB 3TIXA 4FADA 1P9DU 3QC8B 1WI0A 3QX1A 5JHBA 4MJSA 5CHWA 4CYEA 4BKTA 4DBGA 2I1JA 4IWQA 2MBEA 4A20A 4KIKA 2NS5A 4NY0A 3LJ3A 4EFOA 4GDLA 5KHOA 5J18A 2LVOA 3S2AA 4W9HA 5E6OA 3O65B 3AXCA 1L7YA 4MSMB 4W9EA 3ZDMC 4FJYA 2MA9B 1Q1OA 2DHZA 1A5RA 5IA7A 2FUHB 1NBFC 2NBVB 3QCAA 2CHXA 2CS4A 2KDEB 5FR6A 3DCGA 2JZ3B 3PSEB 4J6IA 4TQ0A 1P0RA 1YX5B 4IUMB 2LVPA 1RLFA 2M0XA 3ZW3A 2JXXA 2LXAA 3Q3FA 4WAAA 2JF5A 3IBEA 4RMAA 2LASA 5J17A 3VVWB 4RM8A 4JLCA 5D7GA 2D07B 5LLIA 4B95A 1XT9B 2JWZA 4LDTD 4K7UA 4PS3A 1V49A 1WZ0A 2V1YA 2L7RA 4LJOB 4NQKE 3U30A 1GG3A 1V6EA 1AARA 3VH4B 4GU2A 2LUEA 3L08A 5GMVA 4BBNF 4HVBA 1OTRB 2ZJDA 3ZTDA 2A5UA 5AZHA 2R2OA 3A33B 3RD2A 4A3PA 2DZIA 1P3QU 2J0JA 3L17A 3NS8A 1WXAA 3ZRFA 3PS6A 4MSQB 2W9NA 2C7HA 1Q5WB 3H1UA 2KJRA 3L16A 1OGWA 1HE8A 4TV3A 5D6JB 5C23A 3RZFA 4FHJA 3APCA 2DYOA 2WYQA 4MGZE 4FJVB 2KX3A 1WGHA 2RSUA 4I6LB 1ZW7A 4HJKA 3QWZB 4MELA 1Z5SB 3V60A 2JUOA 4EUTA 3APFA 3I3TB 2FCMA 3R7RA 3UIOB 2N9PC 2D11A 4ASWC 1V5OA 2OOBB 5JHAA 2LXCA 3QHTA 3KW5B 3K9OB 5C1ZA 3MHSD 3DBSA 4B6WA 1WX8A 4HLEA 5JZEB 3PHWB 3GOEA 3ALBA 3KUDB 5BO4B 3WAPA 2KD0A 4AJYB 1G6JA 2CU1A 1KLVA 1SGHA 4WJPA 3DVNU 3H6NA 1WM3A 2LGXA 4NNJB 3W1SA 1WH3A 1K8RB 2BPSA 4F8CB 2K8HA 2OJRA 4DXAB 4NJ7A 3HHMA 5IAAC 4MGYE 1GC6A 1WGYA 2N1VA 4F7ZA 2KDFB 4N9F4 4M8NA 4KDIC 5LXIB 2MWSB 4ICUA 4W9IA 4E3CA 2BYVE 1YX6B 3M62B 4IM0A 2Y5BB 3VXWA 3ZNHB 3X0WA 1WJ4A 4ZRJA 1WXMA 1WFYA 3L10B 4G11A 4B9KA 2IY0B 4IG7B 2MCNB 1V86A 3EC8A 2O6VB 3V61A 1V5TA 3PHXB 3PLUA 1UH6A 4AP4C 4NJ6A 1LQBA 4K1RB 4AWJA 3UINB 4ZRKA 2IO1B 5E6NA 3CF6E 1V80A 1R4NI 2N9XA 1ZGUB 2FCQA 4KZ0A 1EF5A 3DOWA 1J19A 3L54A 3QIJA 4DK5A 2JZZA 2KO3A 4ZDVA 3H9DA 3RZWC 1WF9A 3U7DA 4WQOB 4MGIE 2DZJA 2CHWA 2IY1B 2O2VB 2YLMA 1WJNA 1VD2A 2FIDA 4IC7B 5TR5A 3T8MA 2XBBC 4DHJD 2ZNVB 3PREA 2Z0EB 4PYUA 3ONSA 5AEKB 1Q0WB 5LXHA 1C1YB 2ZVNA 1M94A 2KWUB 3HM3A 2LI5A 3BINA 4P7IA 4F1SA 2N7EA 3JW0X 2LRWA 2G45B 4G0NB 4AOFA 2GOWA 3R3MA 2ZEQA 2KNBA 5DPTA 3V6CB 2GMIC 2N4FA 3DDCB 1NI2A 1H4RA 1UBQA 2QHOA 4GMVA 1L2NA 2MRPA 3A1QB 3DVGX 3PT2B 3UGBB 4BVUC 2GBKA 4HCPB 4EKUA 1UGMA 3KH0A 2MP2A 4X57B 1E8WA 2MBQA 3V6EB 3A4SC 2FIFA 2WWZA 2MLBA 3JSVB 3JYUA 4GXBA 3VH3B 3A9JB 4WJOA 4BOSC 2KC2A 2R2QA 3M3JA 3IVFA 2BGFA 3VDZA 3DVGY 4PYZA 1NDDA 2KC1A 3V62A 1TTNA 2I1KA 2MSED 4KV2A 3ZRCA 4K7SA 3W1SC 3UIPB 3LDZE 4ZRIA 2Z0DB 1WJ6A 2MX2A 3VTWA 2LWPA 4EZLA 4JL9A 2IO0B 3AU5A 2GBJA 2WDTB 2KXJA 3B08A 1F9JA 1V2YA 3PVLA 4LCDE 3VAWA 1Y8RC 3PPAA 1X1MA 2NBUA 2C5LC 4WWOA 3SDLC 4IM2A 1IP9A 1WGGA 3SHQA 3TL5A 4W9KA 2BYFA 2NR2A 2K8CA 1R4MI 2N1WA 1QZEA 2RD0A 2UWQA 2KMAA 2KJHB 2JY6A 4PS7A 1J0GA 4ANVA 4DDGD 4HPMB 2M1MA 3ENEA 3K9PB 1UBIA 2PE6B 3PZDA 4LJPB 3VFKA 2DAJA 2G4DB 2O6VA 3N30A 2AYOB 2ZCBA 3OJ4B 4I6PA 3TMPB 3UF8A 1WY8A 2HE7A 2ZCCA 4DHZB 2KANA 2BKFA 2PJHA 4XC2A 5EDSA 5JH5C 1T0YA 2HTHA 2LJ5A 5J2RA 3A9KB 1GC7A 2NCNA 3PRPB 2KOXA 4URKA 1WXVA 4W9LA 1WJUA 4WJNA 2ZPYA 2AL3A 2XEWA 5D2MB 1YQBA 2B3AA 3M95A 3MTNB 4GN1A 1WMHB 1UZXB 1EO6A 3AI5A 3JVZX 4CHKA 4NAWB 2O2VA 4W9CA 3P2BA 1YD8U 1S1QB 2AEHA 1V81A 3IFWB 2IYDB 2ZPNA 3VQIA 2KZRA 4FJZA 3UQBA 5HKHA 2UYZB 1P1AA 4YL8A 1WZ3A 2D2QA 1GUAB 2ZZPB 2KFKB 2CKHB 3CSFA 1MG8A 3KYDD 4DDID 3HM6X 4K7WA 2DZKA 2KDBA 2KX0A 1IYFA 1TGZB 3EECA 3R66C 3D32A 3IHPC 3QK0A 2IZVB 4MDKE 2V3SA 3ZUNA 3A1QA 3OJ3A 2LVQA 4JIOU 2ZVOA 2D3GA 5KHQA 1E7UA 1PQSA 3WAOA 2K25A 4RM9A 3JSVA 3KUZA 3TJPA 3A9JA 3KYCD 4G50A 3WA0A 4FULA 3ZNGC 4EZKA 3VTUA 1OEYJ 2JRHA 3CSTA 2O6VD 1SE9A 2KTFA 3DPDA 3N32A 2JPHA 3NY5A 2HD5B 3QQ8B 4GDKB 5AZGA 2N7DA 2IO3B 4JQWC 4XX5A 4XZ4A 4AJWA 2DYMA 2DAFA 4EOYA 2LRUA 2M4NA 2L05A 1UD7A 1GNUA 3APDA 1ISNA 3U8ZA 1WM2A 3ZIMA 3AULA 3RUIB 4W9GA 2KWCA 1WXSA 2EMTA 4HXDA 3NZSA 3QA8A 1FXTB 2FNJB 1WX9A 1OQYA 3C0RB 3MJWA 2BWFA 3SU8X 2IO2B 4E74A 4DHJB 3PRMB 5DPSA 2C7NB 2C60A 3HIZA 2KQ7A 3DVNV 4WJQA 4G3XB 3RYTA 4W9DA 3RCZA 5CHFA 2LZ6A 3B1LX 4KVGB 3X23A 3QJZA 1VCBA 1LFDA 1S3SG 2NPTB 2KN5A 1RRBA 2J7QB 2D10A 1LXDA 2J0MA 4HPLB 4M0WB 2IBIB 1WR6E 1WX7A 3Q3JA 5L95C 4MGKE 1KM7A 2MBOA 2REXA 2J0KA 3WAMA 1E8YA 3PRZA 2L0TA 2KMCA 3A9KA 3ZLZA 4OVUA 2AWTA 3WANA 2DX5B 2MW5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML9 A;  3VTV A;  4HWI B;  2XK5 B;  5CTR C;  2K39 A;  4GGQ A;  3TBL D;  3ZDT A;  1GJZ A;  1J8C A;  2RPQ A;  4HDO A;  4TQ1 A;  2EMS A;  1WMH A;  5G55 A;  3PGE A;  2MBB B;  2GBR A;  4BKS A;  1OEY A;  2L00 B;  2ZNV C;  4IW0 A;  4LDT B;  4NAW A;  4I6N B;  3DBL I;  5CX3 A;  1WE7 A;  2KQS A;  2FAZ A;  3PLV A;  2KTR B;  3ML8 A;  3GZN I;  1EUV B;  3KUC B;  5DPW A;  2DEN B;  4IWP A;  3ZNI D;  3TCA A;  2KJ6 A;  4ZYN A;  3W1Y A;  1KJT A;  4BKG A;  2KK8 A;  2MQJ A;  2WX1 A;  3NHE B;  3N3K B;  2KFK A;  5CHV C;  4NPN A;  2KVR A;  2L0F A;  1WGD A;  1V9J A;  4E71 A;  4ICV A;  4W9J A;  4KSK C;  3H7P B;  1Z2M A;  1WGR A;  2PE9 A;  2K8B A;  3QAQ A;  3SD5 A;  3WAL A;  1CMX B;  3ZKJ C;  5DPR A;  2DZM A;  4BFR A;  4MJS B;  5L83 A;  2PPH A;  3KVF B;  1E7V A;  1XQQ A;  3ZO5 B;  4KIK B;  3PV1 A;  2N9E B;  1TBE A;  2V4L A;  4GDL B;  2JT4 B;  2DYB A;  3ZVV A;  4IM3 A;  2G3Q B;  3NZU A;  2VRR B;  2G4S A;  4II3 B;  4EEW A;  2A4Z A;  2YVC A;  2C9W B;  2WX0 A;  4HK2 A;  3DBR I;  2LGY A;  4W9F A;  2C7M B;  3RT3 B;  3LMN A;  2GBM A;  2L76 A;  2K6D B;  4GDK A;  3AU4 A;  3UQA A;  3EHV A;  1RFA A;  3VUX A;  2LD9 A;  5DCN A;  1E8Z A;  2MP2 B;  1BT0 A;  3VUW A;  1I42 A;  3M63 B;  2JRI B;  3ZNZ B;  2FCN A;  4OVV A;  3PTF C;  4FLH A;  5AZF A;  4ANU A;  4HCN B;  3OLM D;  1WRD B;  4A3O A;  5E6P A;  2JVC A;  1IPG A;  1SIF A;  4GIV A;  2HJ8 A;  4BKS D;  4DWF A;  1ZKH A;  4GOC A;  3NOB A;  3DQV A;  4GSW A;  3L13 A;  4MM3 A;  3A4R A;  2NVU I;  4WWP A;  5G2N A;  4JGH B;  1H8C A;  1E8X A;  3R7Q A;  2FCS A;  1C3T A;  4WWN A;  2NPT A;  4MH0 E;  4NQL B;  4BBN C;  2BWE S;  3VUY A;  1WIA A;  2BKR B;  2KKC A;  3IG3 A;  2LGD A;  2K1F A;  4BOZ B;  4TKN A;  3VHT C;  1W6V A;  4PS8 A;  3DBH I;  1UEL A;  2M17 A;  3QAR A;  3OAW A;  4FBJ B;  2AL6 A;  4KDL B;  2PEA A;  1YJ1 A;  3EFU A;  2RR9 A;  3H7S A;  1P98 A;  4TUU A;  4KSL C;  4HDQ A;  1LM8 B;  2XK5 A;  4MEM A;  1D3Z A;  3B0A A;  3ZTC A;  2Z59 B;  2GBN A;  1WYW B;  3RUL A;  1WE6 A;  2BYE A;  4CO7 A;  1JRU A;  2KLG A;  1TZ1 A;  1U4A A;  2MBH A;  1RAX A;  2KDI A;  2M8S A;  3BY4 B;  3T9L A;  1YIW A;  2KWV B;  2ASQ A;  1KOT A;  3HK0 A;  1EF1 A;  1I35 A;  4IWO A;  2KFJ A;  2KTR A;  2K6Q A;  2NBW B;  2RGF A;  4ANX A;  2BF8 B;  1E5W A;  2CHZ A;  3WIM A;  2KLC A;  4ANW A;  1WR1 A;  2L3Z A;  5D94 A;  4FA6 A;  3CMM B;  3L0W B;  4GB9 A;  1E90 A;  2CR5 A;  2EKE C;  4II2 B;  4K81 A;  4M8M A;  4DHZ E;  1XD3 B;  4AUQ C;  3ECI A;  4KZC A;  4FHK A;  4EZJ A;  2L8J A;  4FN2 A;  3H7P A;  2KHW B;  3TIX A;  4FAD A;  1P9D U;  3QC8 B;  1WI0 A;  3QX1 A;  5JHB A;  4MJS A;  5CHW A;  4CYE A;  4BKT A;  4DBG A;  2I1J A;  4IWQ A;  2MBE A;  4A20 A;  4KIK A;  2NS5 A;  4NY0 A;  3LJ3 A;  4EFO A;  4GDL A;  5KHO A;  5J18 A;  2LVO A;  3S2A A;  4W9H A;  5E6O A;  3O65 B;  3AXC A;  1L7Y A;  4MSM B;  4W9E A;  3ZDM C;  4FJY A;  2MA9 B;  1Q1O A;  2DHZ A;  1A5R A;  5IA7 A;  2FUH B;  1NBF C;  2NBV B;  3QCA A;  2CHX A;  2CS4 A;  2KDE B;  5FR6 A;  3DCG A;  2JZ3 B;  3PSE B;  4J6I A;  4TQ0 A;  1P0R A;  1YX5 B;  4IUM B;  2LVP A;  1RLF A;  2M0X A;  3ZW3 A;  2JXX A;  2LXA A;  3Q3F A;  4WAA A;  2JF5 A;  3IBE A;  4RMA A;  2LAS A;  5J17 A;  3VVW B;  4RM8 A;  4JLC A;  5D7G A;  2D07 B;  5LLI A;  4B95 A;  1XT9 B;  2JWZ A;  4LDT D;  4K7U A;  4PS3 A;  1V49 A;  1WZ0 A;  2V1Y A;  2L7R A;  4LJO B;  4NQK E;  3U30 A;  1GG3 A;  1V6E A;  1AAR A;  3VH4 B;  4GU2 A;  2LUE A;  3L08 A;  5GMV A;  4BBN F;  4HVB A;  1OTR B;  2ZJD A;  3ZTD A;  2A5U A;  5AZH A;  2R2O A;  3A33 B;  3RD2 A;  4A3P A;  2DZI A;  1P3Q U;  2J0J A;  3L17 A;  3NS8 A;  1WXA A;  3ZRF A;  3PS6 A;  4MSQ B;  2W9N A;  2C7H A;  1Q5W B;  3H1U A;  2KJR A;  3L16 A;  1OGW A;  1HE8 A;  4TV3 A;  5D6J B;  5C23 A;  3RZF A;  4FHJ A;  3APC A;  2DYO A;  2WYQ A;  4MGZ E;  4FJV B;  2KX3 A;  1WGH A;  2RSU A;  4I6L B;  1ZW7 A;  4HJK A;  3QWZ B;  4MEL A;  1Z5S B;  3V60 A;  2JUO A;  4EUT A;  3APF A;  3I3T B;  2FCM A;  3R7R A;  3UIO B;  2N9P C;  2D11 A;  4ASW C;  1V5O A;  2OOB B;  5JHA A;  2LXC A;  3QHT A;  3KW5 B;  3K9O B;  5C1Z A;  3MHS D;  3DBS A;  4B6W A;  1WX8 A;  4HLE A;  5JZE B;  3PHW B;  3GOE A;  3ALB A;  3KUD B;  5BO4 B;  3WAP A;  2KD0 A;  4AJY B;  1G6J A;  2CU1 A;  1KLV A;  1SGH A;  4WJP A;  3DVN U;  3H6N A;  1WM3 A;  2LGX A;  4NNJ B;  3W1S A;  1WH3 A;  1K8R B;  2BPS A;  4F8C B;  2K8H A;  2OJR A;  4DXA B;  4NJ7 A;  3HHM A;  5IAA C;  4MGY E;  1GC6 A;  1WGY A;  2N1V A;  4F7Z A;  2KDF B;  4N9F 4;  4M8N A;  4KDI C;  5LXI B;  2MWS B;  4ICU A;  4W9I A;  4E3C A;  2BYV E;  1YX6 B;  3M62 B;  4IM0 A;  2Y5B B;  3VXW A;  3ZNH B;  3X0W A;  1WJ4 A;  4ZRJ A;  1WXM A;  1WFY A;  3L10 B;  4G11 A;  4B9K A;  2IY0 B;  4IG7 B;  2MCN B;  1V86 A;  3EC8 A;  2O6V B;  3V61 A;  1V5T A;  3PHX B;  3PLU A;  1UH6 A;  4AP4 C;  4NJ6 A;  1LQB A;  4K1R B;  4AWJ A;  3UIN B;  4ZRK A;  2IO1 B;  5E6N A;  3CF6 E;  1V80 A;  1R4N I;  2N9X A;  1ZGU B;  2FCQ A;  4KZ0 A;  1EF5 A;  3DOW A;  1J19 A;  3L54 A;  3QIJ A;  4DK5 A;  2JZZ A;  2KO3 A;  4ZDV A;  3H9D A;  3RZW C;  1WF9 A;  3U7D A;  4WQO B;  4MGI E;  2DZJ A;  2CHW A;  2IY1 B;  2O2V B;  2YLM A;  1WJN A;  1VD2 A;  2FID A;  4IC7 B;  5TR5 A;  3T8M A;  2XBB C;  4DHJ D;  2ZNV B;  3PRE A;  2Z0E B;  4PYU A;  3ONS A;  5AEK B;  1Q0W B;  5LXH A;  1C1Y B;  2ZVN A;  1M94 A;  2KWU B;  3HM3 A;  2LI5 A;  3BIN A;  4P7I A;  4F1S A;  2N7E A;  3JW0 X;  2LRW A;  2G45 B;  4G0N B;  4AOF A;  2GOW A;  3R3M A;  2ZEQ A;  2KNB A;  5DPT A;  3V6C B;  2GMI C;  2N4F A;  3DDC B;  1NI2 A;  1H4R A;  1UBQ A;  2QHO A;  4GMV A;  1L2N A;  2MRP A;  3A1Q B;  3DVG X;  3PT2 B;  3UGB B;  4BVU C;  2GBK A;  4HCP B;  4EKU A;  1UGM A;  3KH0 A;  2MP2 A;  4X57 B;  1E8W A;  2MBQ A;  3V6E B;  3A4S C;  2FIF A;  2WWZ A;  2MLB A;  3JSV B;  3JYU A;  4GXB A;  3VH3 B;  3A9J B;  4WJO A;  4BOS C;  2KC2 A;  2R2Q A;  3M3J A;  3IVF A;  2BGF A;  3VDZ A;  3DVG Y;  4PYZ A;  1NDD A;  2KC1 A;  3V62 A;  1TTN A;  2I1K A;  2MSE D;  4KV2 A;  3ZRC A;  4K7S A;  3W1S C;  3UIP B;  3LDZ E;  4ZRI A;  2Z0D B;  1WJ6 A;  2MX2 A;  3VTW A;  2LWP A;  4EZL A;  4JL9 A;  2IO0 B;  3AU5 A;  2GBJ A;  2WDT B;  2KXJ A;  3B08 A;  1F9J A;  1V2Y A;  3PVL A;  4LCD E;  3VAW A;  1Y8R C;  3PPA A;  1X1M A;  2NBU A;  2C5L C;  4WWO A;  3SDL C;  4IM2 A;  1IP9 A;  1WGG A;  3SHQ A;  3TL5 A;  4W9K A;  2BYF A;  2NR2 A;  2K8C A;  1R4M I;  2N1W A;  1QZE A;  2RD0 A;  2UWQ A;  2KMA A;  2KJH B;  2JY6 A;  4PS7 A;  1J0G A;  4ANV A;  4DDG D;  4HPM B;  2M1M A;  3ENE A;  3K9P B;  1UBI A;  2PE6 B;  3PZD A;  4LJP B;  3VFK A;  2DAJ A;  2G4D B;  2O6V A;  3N30 A;  2AYO B;  2ZCB A;  3OJ4 B;  4I6P A;  3TMP B;  3UF8 A;  1WY8 A;  2HE7 A;  2ZCC A;  4DHZ B;  2KAN A;  2BKF A;  2PJH A;  4XC2 A;  5EDS A;  5JH5 C;  1T0Y A;  2HTH A;  2LJ5 A;  5J2R A;  3A9K B;  1GC7 A;  2NCN A;  3PRP B;  2KOX A;  4URK A;  1WXV A;  4W9L A;  1WJU A;  4WJN A;  2ZPY A;  2AL3 A;  2XEW A;  5D2M B;  1YQB A;  2B3A A;  3M95 A;  3MTN B;  4GN1 A;  1WMH B;  1UZX B;  1EO6 A;  3AI5 A;  3JVZ X;  4CHK A;  4NAW B;  2O2V A;  4W9C A;  3P2B A;  1YD8 U;  1S1Q B;  2AEH A;  1V81 A;  3IFW B;  2IYD B;  2ZPN A;  3VQI A;  2KZR A;  4FJZ A;  3UQB A;  5HKH A;  2UYZ B;  1P1A A;  4YL8 A;  1WZ3 A;  2D2Q A;  1GUA B;  2ZZP B;  2KFK B;  2CKH B;  3CSF A;  1MG8 A;  3KYD D;  4DDI D;  3HM6 X;  4K7W A;  2DZK A;  2KDB A;  2KX0 A;  1IYF A;  1TGZ B;  3EEC A;  3R66 C;  3D32 A;  3IHP C;  3QK0 A;  2IZV B;  4MDK E;  2V3S A;  3ZUN A;  3A1Q A;  3OJ3 A;  2LVQ A;  4JIO U;  2ZVO A;  2D3G A;  5KHQ A;  1E7U A;  1PQS A;  3WAO A;  2K25 A;  4RM9 A;  3JSV A;  3KUZ A;  3TJP A;  3A9J A;  3KYC D;  4G50 A;  3WA0 A;  4FUL A;  3ZNG C;  4EZK A;  3VTU A;  1OEY J;  2JRH A;  3CST A;  2O6V D;  1SE9 A;  2KTF A;  3DPD A;  3N32 A;  2JPH A;  3NY5 A;  2HD5 B;  3QQ8 B;  4GDK B;  5AZG A;  2N7D A;  2IO3 B;  4JQW C;  4XX5 A;  4XZ4 A;  4AJW A;  2DYM A;  2DAF A;  4EOY A;  2LRU A;  2M4N A;  2L05 A;  1UD7 A;  1GNU A;  3APD A;  1ISN A;  3U8Z A;  1WM2 A;  3ZIM A;  3AUL A;  3RUI B;  4W9G A;  2KWC A;  1WXS A;  2EMT A;  4HXD A;  3NZS A;  3QA8 A;  1FXT B;  2FNJ B;  1WX9 A;  1OQY A;  3C0R B;  3MJW A;  2BWF A;  3SU8 X;  2IO2 B;  4E74 A;  4DHJ B;  3PRM B;  5DPS A;  2C7N B;  2C60 A;  3HIZ A;  2KQ7 A;  3DVN V;  4WJQ A;  4G3X B;  3RYT A;  4W9D A;  3RCZ A;  5CHF A;  2LZ6 A;  3B1L X;  4KVG B;  3X23 A;  3QJZ A;  1VCB A;  1LFD A;  1S3S G;  2NPT B;  2KN5 A;  1RRB A;  2J7Q B;  2D10 A;  1LXD A;  2J0M A;  4HPL B;  4M0W B;  2IBI B;  1WR6 E;  1WX7 A;  3Q3J A;  5L95 C;  4MGK E;  1KM7 A;  2MBO A;  2REX A;  2J0K A;  3WAM A;  1E8Y A;  3PRZ A;  2L0T A;  2KMC A;  3A9K A;  3ZLZ A;  4OVU A;  2AWT A;  3WAN A;  2DX5 B;  2MW5 A; 
#chains in the Genus database with same CATH topology
 1PYW D;  3VTV A;  3TBL D;  1K51 A;  2JSV X;  1E7P B;  1TKE A;  4XWW A;  2MBB B;  4BKS A;  2L00 B;  4IW0 A;  1E0Z A;  2MH7 A;  5HFY A;  3ML8 A;  5DPW A;  1MI0 A;  3W1Y A;  4BKG A;  2MQJ A;  4KSK C;  1WGR A;  3O13 A;  3QAQ A;  3AH7 A;  4HRO A;  2MJD A;  2PPH A;  4KIK B;  1D5M C;  2N9E B;  2V4L A;  1R7S A;  1AYF A;  2G3Q B;  1XEE A;  3CWI A;  2SAK A;  4II3 B;  1C4C A;  2A4Z A;  1HQR D;  2C9W B;  2WX0 A;  4HK2 A;  3DBR I;  5HHD G;  2AQ3 B;  3EHV A;  1FMA D;  3VUX A;  1L6U A;  1JCK B;  1BT0 A;  4KX6 B;  2CU3 A;  3VUW A;  3CIR B;  3ZNZ B;  2FCN A;  4LK0 M;  5IKC M;  2EEL A;  2ACZ B;  3R2T A;  4DWF A;  3I5J C;  4GOC A;  3L13 A;  2NVU I;  1UNS A;  2J53 A;  4JGH B;  3RFZ B;  1H8C A;  1E8X A;  4WWN A;  1XO3 A;  2NPT A;  4MH0 E;  4NQL B;  1I4G A;  2WXI A;  3VHT C;  3DBH I;  1UEL A;  2PEA A;  4IDI A;  4KSL C;  1YJJ A;  4C7Y A;  2VH1 A;  3DBL B;  3B0A A;  3T3N A;  1WE6 A;  2QCZ A;  1KLG D;  1TZ1 A;  1U4A A;  3U7Z A;  1I4Q A;  1CQV A;  1PFD A;  2RGF A;  2BF8 B;  1V1P B;  2J42 A;  3HVZ A;  4K3C A;  3DHG C;  3AE5 B;  2M56 B;  4AQ7 A;  1SF0 A;  4K81 A;  1FFV A;  4M8M A;  1XD3 B;  4FHK A;  2IGD A;  2L8J A;  3H7P A;  4FAD A;  1FM0 D;  2BB6 A;  4DBG A;  4W9H A;  3O65 B;  4MSM B;  4FJY A;  2MA9 B;  5IP4 D;  2K0P A;  1A5R A;  5IA7 A;  1ESF A;  2CS4 A;  2KN4 A;  2WQY B;  5BYS A;  4JWU C;  2PVO D;  1A70 A;  1FIQ A;  1SE4 A;  1M4V A;  4GLS C;  3IT4 B;  2LXA A;  3N9Y C;  4WAA A;  2WXP A;  3IBE A;  2B76 B;  5C3J B;  3VVW B;  5J17 A;  4RM8 A;  5D7G A;  5LLI A;  1XT9 B;  1L0Y B;  4PS3 A;  1WZ0 A;  2L7R A;  4NQK E;  2L32 A;  1V6E A;  1AAR A;  1I4X A;  3A33 B;  1P3Q U;  3NS8 A;  2INC C;  3Q69 A;  4HEA 1;  4MSQ B;  5BYQ A;  3H1U A;  3L16 A;  5D6J B;  1OGW A;  5C23 A;  3RZF A;  4FHJ A;  3APC A;  2WYQ A;  3I57 A;  2RSU A;  1FXA A;  4A90 A;  3UIO B;  1V5O A;  3MJ5 A;  2BB5 A;  1T5X D;  3DBS A;  5JZE B;  3KUD B;  5BO4 B;  1C4A A;  1OFF A;  2MJ3 A;  2LGX A;  4NNJ B;  3W1S A;  1GB1 A;  3V05 A;  2OJR A;  2K3U A;  3HHM A;  4MGY E;  2AX5 A;  4F7Z A;  5AUI A;  4N9F 4;  4M8N A;  2WDR B;  3Q3O C;  4ICU A;  3NZ3 A;  3PZ8 A;  3M62 B;  2Y5B B;  4OHJ A;  4RGT A;  3X0W A;  1WJ4 A;  1WFY A;  3L10 B;  4G11 A;  2IY0 B;  3ZJV A;  1V5T A;  1UH6 A;  4AP4 C;  2IO1 B;  1QOA A;  3BWU D;  1FEH A;  1ZGU B;  2FCQ A;  1YQ4 B;  2PIA A;  3QIJ A;  4DK5 A;  2KO3 A;  1IUE A;  3H9D A;  1WF9 A;  2WLB A;  2DZJ A;  2O2V B;  5TR5 A;  4IC7 B;  2Z0E B;  4PYU A;  2IPK D;  2X38 A;  3FC4 A;  4HJG E;  1C1Y B;  1XLO A;  4XWT A;  2KAC A;  2BVC A;  3JW0 X;  2LRW A;  3AN1 A;  4G0N B;  2GOW A;  3P4R B;  2ZEQ A;  2KNB A;  3R3M A;  5DPT A;  3W5U B;  2I2Y A;  4GMV A;  4TSS A;  3AEG B;  3PT2 B;  4BVU C;  3MC9 A;  4EKU A;  2FIF A;  2WWZ A;  3JYU A;  4GXB A;  3A9J B;  4WJO A;  2KC2 A;  3AB5 A;  3IVF A;  2QIE B;  3MFG A;  1N6Z A;  3C8Y A;  1NDD A;  2V4I B;  4KV2 A;  3ZRC A;  4K7S A;  3LDZ E;  2V0G A;  1WJ6 A;  3DHI C;  3AU5 A;  4DQO C;  3IAM 1;  1SE3 A;  1KRH A;  1N5X A;  1KFY B;  1V2Y A;  3VAW A;  2NBU A;  3SDL C;  3TEY A;  3TL5 A;  3TEX A;  1B9R A;  2GB1 A;  1XCT L;  2UWQ A;  2QC8 A;  2H88 B;  1J0G A;  4ANV A;  1GOZ A;  2KQ4 X;  2QIL A;  3K9P B;  2DAJ A;  2G4D B;  2O6V A;  4I6P A;  1JW9 D;  1PUT A;  1XLP A;  2BKF A;  4XC2 A;  2QSD A;  3PRP B;  2NCN A;  2Y5C A;  1FRD A;  4HPP A;  4H2A A;  1MJD A;  4FXC A;  4CQN A;  3IFW B;  2IYD B;  1ZPS A;  3BVM A;  4RCO A;  4KKJ A;  4L1B A;  2UYZ B;  5MPO A;  4YL8 A;  1WZ3 A;  2D2Q A;  3ABV B;  4DDI D;  1UWM A;  2DZK A;  2IJ0 A;  3EEC A;  1GAQ B;  2IZV B;  2V3S A;  3KQ4 A;  4JIO U;  3C19 A;  3WAO A;  2K25 A;  1L6V A;  3P1M A;  1V8C A;  3KUZ A;  2IGH A;  1V97 A;  4M01 A;  3ZNG C;  1ZUD 2;  1D6E C;  1SE9 A;  2KTF A;  5H92 C;  3R8B A;  3U52 E;  4XX5 A;  2L05 A;  1WSP A;  3APD A;  3VRA B;  1ZXI A;  3AE7 B;  4QAY A;  3AUL A;  3QA8 A;  1FXT B;  2HDE A;  1JWU D;  1OQY A;  4DHJ B;  2C7N B;  2C60 A;  3HIZ A;  2DNF A;  3RYT A;  2R61 A;  2LZ6 A;  3B1L X;  4KVG B;  3QJZ A;  1LFD A;  2NPT B;  3Q3N C;  1RRB A;  2D10 A;  3N20 C;  1WX7 A;  2REX A;  4US8 A;  2J0K A;  3WAM A;  2WXH A;  1E8Y A;  2W82 A;  2J4X A;  2KMC A;  5TSS A;  2AWT A;  4DHZ E;  1WYG A;  2IND C;  1J8C A;  2RPQ A;  4HDO A;  1QQR A;  4TQ1 A;  2KVZ A;  1WMH A;  3Q8B A;  2ON8 A;  1WE7 A;  2KQS A;  4RGN A;  3PLV A;  1C4P A;  2M0A A;  2ICI A;  4IWP A;  1KJT A;  3N3K B;  1E9M A;  3AED B;  4NPN A;  1WGD A;  4W9J A;  1FD6 A;  2DLB A;  3H7P B;  1Z2M A;  2PE9 A;  3SD5 A;  2DZM A;  1T0S C;  1XQQ A;  3AE9 B;  3ZO5 B;  3PV1 A;  5E6J A;  2Y5P A;  2DYB A;  3ZVV A;  2VRR B;  2G4S A;  5C2T B;  2KWD A;  2YVC A;  1ZDX A;  4W9F A;  3NVV A;  2C7M B;  1Q10 A;  2GBM A;  2YEP B;  1RFA A;  1TY0 A;  3RNG C;  4OZA A;  2LGS A;  2NMQ A;  4MT5 A;  3OLM D;  3KWL A;  3B9J A;  5E6P A;  2JVC A;  1IPG A;  1SIF A;  4GIV A;  4BKS D;  1C76 A;  3DQV A;  2HTM E;  4GSW A;  3A4R A;  3VUY A;  1WIA A;  2BKR B;  2KKC A;  3BII D;  3IG3 A;  2LGD A;  4RFB A;  1CK1 A;  1FCC C;  3P4P B;  3SFE B;  3NUH B;  4TKN A;  4C00 A;  5FK9 C;  2PMV A;  2M17 A;  3OAW A;  2AL6 A;  2FBW B;  2RDG A;  1OQR A;  3H7S A;  1FNW A;  4HDQ A;  1LM8 B;  2XK5 A;  1D3Z A;  3ZTC A;  2Z59 B;  3RUL A;  4D2K A;  4US9 A;  4CO7 A;  2KLG A;  1RAX A;  2KDI A;  2M8S A;  2Q5W D;  1R4M B;  5EE0 A;  3HK0 A;  1I35 A;  4L23 A;  4RNA A;  2KFJ A;  2KTR A;  3URY A;  1NEN B;  1E5W A;  4J3O D;  2CHZ A;  3WIM A;  4ANW A;  1WR1 A;  5D94 A;  4FA6 A;  3PZ7 A;  3L0W B;  4GB9 A;  1E90 A;  4AUQ C;  4KZC A;  4EZJ A;  5I4D A;  4LNK A;  3QC8 B;  1WI0 A;  4MJS A;  4CYE A;  3Q6B A;  4EFO A;  4GDL A;  3ZYY X;  3EUB 2;  3AEE B;  4W9E A;  5BMG A;  3DWM A;  2DHZ A;  2D3B A;  2Y3A A;  4N58 A;  1NEK B;  3IXS A;  1PGX A;  1HTO A;  3QCA A;  2CHX A;  1TS2 A;  2D3C A;  5FR6 A;  4M02 A;  3BZD B;  2JZ3 B;  3PSE B;  4J6I A;  3AE6 B;  1C78 A;  2LVP A;  2M0X A;  3ZW3 A;  3Q3F A;  3B2F A;  4WIP A;  2KMM A;  3MC0 B;  2D07 B;  4OZB A;  4K7U A;  4OW0 A;  3U30 A;  3ETR A;  3P63 A;  1EU4 A;  2WXN A;  1F2R C;  1OTR B;  2ZJD A;  3ZTD A;  1HXY D;  2R2O A;  4O1N A;  2DZI A;  2V3N A;  1WXA A;  3PS6 A;  4C7Z A;  2C7H A;  3IT6 B;  2KJR A;  4TV3 A;  5FR3 A;  2WXK A;  2DYO A;  1CJE A;  2MJE A;  1I7H A;  1WGH A;  1ZW7 A;  4EUT A;  3V60 A;  2XN9 C;  5BMI A;  3APF A;  4ASW C;  5JHA A;  2LXC A;  1YN5 A;  3QHT A;  4WWM A;  1WWT A;  3K9O B;  3EGR A;  1SB3 C;  5C1Z A;  3MHS D;  1GB4 A;  4B6W A;  2WXO A;  3PHW B;  1QT9 A;  3GOE A;  4WH4 A;  5HI1 A;  3WAP A;  1G6J A;  1JML A;  2QEJ C;  2V9H A;  4OVU A;  1JRO A;  1SGH A;  2BS3 B;  4WJP A;  4IOI E;  2DWQ A;  2BPS A;  4NJ7 A;  2WDQ B;  1K52 A;  3AEF B;  2BQQ A;  4E3C A;  1YX6 B;  3VXW A;  2RDB C;  4ZRJ A;  1WXM A;  2JXT A;  1VR9 A;  1V86 A;  3EC8 A;  2O6V B;  3LYY A;  1LQB A;  1YQ3 B;  3ZJU A;  3VR9 B;  4AWJ A;  2JYT A;  1JWS D;  5E6N A;  3CF6 E;  1V80 A;  2JX5 A;  1EF5 A;  3DOW A;  1L4D B;  2WXQ A;  1WGK A;  3HUI A;  4LNF A;  2CHW A;  5D3D A;  2ZNV B;  1M94 A;  2KWU B;  3HM3 A;  3BIN A;  4XDD A;  2HJ1 A;  1DGJ A;  2N4F A;  1H4R A;  2MRP A;  3DVG X;  2NTS A;  1KTK A;  4HCP B;  1P7F A;  3MC8 A;  4X57 B;  1E8W A;  4M00 A;  3BYY B;  3TUO A;  3VH3 B;  4BOS C;  1D5Z C;  5EE1 A;  2R2Q A;  3DVG Y;  2KC1 A;  2I1K A;  3FAH A;  3UIP B;  4ZRI A;  4YSX B;  2Z0D B;  4JL9 A;  2WDT B;  4JPS A;  4EE2 A;  4LCD E;  2VZK B;  3SFD B;  4DXF A;  1MVK A;  3PPA A;  4ZHP A;  4WWO A;  4IM2 A;  4W9K A;  2K8C A;  1PGA A;  1R4M I;  3UI3 A;  2RD0 A;  2KMA A;  1SSN A;  2JY6 A;  1VZ8 A;  1STE A;  4HRS A;  5T8I A;  3PZD A;  4LJP B;  1DOI A;  3VFK A;  3OJ4 B;  3TMP B;  2KAN A;  5EDS A;  1T0Y A;  1GC7 A;  2KOX A;  1F2R I;  2AL3 A;  3M95 A;  2B3A A;  4GN1 A;  1WMH B;  4B0M A;  1VJK A;  3JVZ X;  4W9C A;  1QIL A;  1V81 A;  2ZPN A;  2ONQ A;  1C77 A;  1P1A A;  3GE3 C;  2ZZP B;  3N1Y C;  4AS1 A;  4K7W A;  2KDB A;  1L4Z B;  2KX0 A;  3QK0 A;  4MDK E;  3OJ3 A;  3VRB B;  3TSS A;  2D3G A;  2OJW A;  1UUP A;  1E7U A;  3I63 C;  3JSV A;  3TJP A;  3WA0 A;  1YMH E;  4ZYS A;  1OEY J;  2O6V D;  4LNO A;  3NY5 A;  3AE2 B;  5BYR A;  2GI9 A;  2QJL A;  1Y56 A;  4JQW C;  4XZ4 A;  2DAF A;  4PK1 A;  4YSY B;  2WXR A;  4RF0 A;  2JWU A;  3U8Z A;  3RUI B;  4W9G A;  1WXS A;  2EMT A;  1QLB B;  3C0R B;  2BWF A;  1J7A A;  4WJQ A;  4W9D A;  3RCZ A;  3X23 A;  4XDC A;  2KN5 A;  2J7Q B;  2PKO A;  2IBI B;  3Q3J A;  1WXQ A;  1KM7 A;  4RGO S;  2W55 A;  1JQ4 A;  4KGT A;  3A9K A;  1ET9 A;  3WAN A;  2DX5 B;  3ML9 A;  2RMM A;  2XK5 B;  2K39 A;  4GGQ A;  2AQ2 B;  2MHJ A;  2EMS A;  1I4P A;  5G55 A;  3TEZ A;  3PGE A;  4KKI A;  3E56 A;  2GBR A;  2LHD A;  2KDM A;  3DBL I;  5G5H A;  5FKA C;  2KTR B;  2IDY A;  4HKZ E;  1QF6 A;  2DEN B;  3ZNI D;  4ZYN A;  1FO4 A;  2WX1 A;  4B0E A;  3ZJT A;  2KFK A;  2KVR A;  2K22 A;  2L0F A;  2VZK D;  1TT5 B;  2WXJ A;  4ICV A;  5EE9 A;  1I4H A;  3WAL A;  1CMX B;  1MHX A;  5DPR A;  3ZKJ C;  1R4N B;  4MJS B;  5L83 A;  4ARC A;  3KVF B;  1TBE A;  4GDL B;  4IM3 A;  3NZU A;  4C80 A;  4NAM A;  5D3I B;  4EEW A;  3AE3 B;  2LGY A;  4ITK A;  3LMN A;  2K6D B;  4GDK A;  1RWS A;  4ZOH C;  2LD9 A;  5DCN A;  1E8Z A;  2MP2 B;  4XE0 A;  1I42 A;  3M63 B;  1C79 A;  3NJT A;  3PTF C;  4FLH A;  4LTU A;  4ANU A;  4HCN B;  1PDX A;  1TZO A;  2TSS A;  3NOB A;  4ZRQ A;  4MM3 A;  4WWP A;  3R7Q A;  2FCS A;  1NYQ A;  4M0W A;  4N59 A;  4BOZ B;  3OG5 A;  4JE3 B;  5AUK A;  2W54 A;  4KDL B;  1YJ1 A;  3EFU A;  2WXG A;  4TUU A;  4A9A A;  1P7E A;  1YNT E;  2GBN A;  4YTN B;  1JRU A;  2AQ1 B;  2MBH A;  3AE4 B;  1UWX A;  2KWV B;  3SR6 A;  1KOT A;  1EF1 A;  1AWD A;  2LHE A;  1SXT A;  5EE3 A;  1TYG B;  4LNN A;  2KLC A;  2CR5 A;  4YTM B;  4II2 B;  3ECI A;  1DYQ A;  3BK2 A;  2KHW B;  3TIX A;  3QX1 A;  3DBR B;  5CHW A;  4BKT A;  1T0Q C;  4IWQ A;  1IBX B;  3W2D A;  4NY0 A;  1QOF A;  3LJ3 A;  5KHO A;  5J18 A;  1IGD A;  3IAS 1;  2FUH B;  1NBF C;  2NBV B;  3WCQ A;  1MFW A;  4L2Y A;  1P0R A;  4IUM B;  3AV8 A;  1TY2 A;  1MG4 A;  2L1A A;  1RLF A;  2JXX A;  3U2S C;  3HRD D;  2LAS A;  2WU2 B;  4JLC A;  3E9S A;  4B95 A;  2JWZ A;  2WXL A;  3EFC A;  1NI3 A;  5IO9 A;  3DBH B;  2GLS A;  3VH4 B;  3L08 A;  5GMV A;  4BBN F;  4HVB A;  1TS5 A;  4A3P A;  2L83 A;  2J0J A;  3L17 A;  2M19 A;  3ZRF A;  3AEA B;  2W9N A;  4YXD B;  4BZA A;  1N63 A;  3GE8 C;  2E3T A;  4NZL B;  2W3S A;  4MGZ E;  4I6L B;  4MEL A;  3QWZ B;  2JUO A;  2FCM A;  2N9P C;  2OOB B;  4ZRP A;  2JU6 X;  3KW5 B;  4ACF A;  1HA5 A;  1TKY A;  1WX8 A;  2BS2 B;  1N61 A;  2X8X X;  4AJY B;  2CU1 A;  1ENF A;  3DVN U;  1WM3 A;  4RGM A;  4F8C B;  1SJH D;  2OHF A;  5IAA C;  2N1V A;  2KDF B;  3P4Q B;  2MWS B;  4W9I A;  1V1O A;  3I9V 1;  4Q2J A;  3KLS X;  3GZN B;  4YSZ B;  3Q2A C;  2PVG C;  4LNI A;  3V61 A;  3PLU A;  3GP7 A;  2V3P A;  1D5X C;  4P1B C;  3MHZ A;  1R4N I;  2N9X A;  4KZ0 A;  3ZQ4 A;  1HZ6 A;  3L54 A;  2JZZ A;  2LUM A;  4WQO B;  4MGI E;  1ZDV A;  4DHJ D;  3T8M A;  2XBB C;  3PRE A;  3ONS A;  1C9F A;  1T0R C;  5LXH A;  3RN9 C;  2Z8L A;  2H89 B;  3PO0 A;  4PT5 A;  4P7I A;  1I4R A;  2LI5 A;  2ZW0 A;  4AOF A;  3V6C B;  3DDC B;  1E6E B;  3ZGZ A;  1NI2 A;  2JYE A;  1FNV A;  2RDH A;  2BW2 A;  2MP2 A;  2MBQ A;  2D5G A;  1JWA D;  3JSV B;  4RH6 A;  1FNU A;  2N7J A;  3GB1 A;  2BGF A;  3VDZ A;  4PYZ A;  4YT0 B;  3V62 A;  4LLG M;  2MSE D;  2W3R A;  3W1S C;  1L0X B;  2MX2 A;  2WXM A;  3N1Z C;  4A8X C;  2CJN A;  2LJI A;  4WAF A;  3VTW A;  4RF1 A;  2XNA C;  2IO0 B;  2INN E;  3PVL A;  3RPF C;  1X1M A;  2C5L C;  1IP9 A;  3SHQ A;  2BYF A;  1LO5 D;  2WGS A;  1YJI A;  4HPM B;  4S17 A;  2M1M A;  2EKI A;  3ENE A;  1UBI A;  2PE6 B;  3UF8 A;  3N30 A;  2AYO B;  2ZCB A;  1WY8 A;  2HE7 A;  2UU7 A;  5JH5 C;  2PJH A;  2HTH A;  3A9K B;  4URK A;  1JWM D;  4W9L A;  1WJU A;  4WJN A;  2ZPY A;  5D2M B;  1YQB A;  3MTN B;  2I38 A;  3DHH C;  3AI5 A;  2KT7 A;  1D4B A;  1YD8 U;  1S1Q B;  2AEH A;  1IBX A;  2KZR A;  4FJZ A;  4JWS C;  3NVW A;  1FRR A;  5HKH A;  2RPV A;  2VH2 A;  1GUA B;  3Q8F A;  2KFK B;  2CKH B;  1MG8 A;  3KYD D;  1IYF A;  4YWG G;  1TGZ B;  3EA6 A;  3D32 A;  1FPY A;  1QOB A;  4JX1 C;  3A1Q A;  1SEB D;  2ZVO A;  3U4E G;  1PQS A;  3Q8C A;  4RM9 A;  1E10 A;  4G50 A;  4EZK A;  3VTU A;  2JRH A;  3CST A;  3DPD A;  2BT6 A;  3N32 A;  4P1C C;  3AM9 A;  3QQ8 B;  4GDK B;  2QMT A;  2LRU A;  2M4N A;  1GNU A;  3NZS A;  2FNJ B;  1WX9 A;  3MJW A;  1KLU D;  1IGC A;  2IO2 B;  3PRM B;  5DPS A;  4MM3 B;  3DVN V;  4G3X B;  1TS3 A;  5CHF A;  4C56 C;  1VCB A;  1S3S G;  4HPL B;  1LXD A;  4M0W B;  4N6E B;  1WR6 E;  5GXG B;  3NS1 A;  5L95 C;  3W5V B;  4MGK E;  2MBO A;  2WS3 B;  1CZP A;  3PRZ A;  2WNM A;  3KWV A;  3ZLZ A;  3BK1 A;  3ZDT A;  4HWI B;  5CTR C;  1GJZ A;  1YN3 A;  3T3O A;  4YTP B;  1N60 A;  1K50 A;  1OEY A;  2ZNV C;  4LDT B;  4NAW A;  4I6N B;  4WQM A;  5CX3 A;  5IN7 A;  1QOG A;  2FAZ A;  2FE8 A;  3GZN I;  1EUV B;  3KUC B;  3W9C B;  3FIL A;  3TCA A;  2KJ6 A;  2KK8 A;  1L0V B;  2G9H D;  3NHE B;  5CHV C;  4C4V A;  1V9J A;  4E71 A;  2YEP F;  2K8B A;  1VLB A;  1WRI A;  4BFR A;  2LMC A;  1T3Q A;  1E7V A;  3P4S B;  1KH0 A;  4P6V F;  2JT4 B;  2PTL A;  5IOI A;  1SIJ A;  1NYR A;  2SEB D;  3RT3 B;  1L5P A;  2L76 A;  3UQA A;  3AU4 A;  1EWY C;  4KGR A;  1XXG A;  2JRI B;  4OVV A;  5AZF A;  1JWB D;  1WRD B;  4A3O A;  2WHI A;  2HJ8 A;  1FFU A;  1ZKH A;  2MEK A;  4DXG A;  5G2N A;  1FXI A;  3RI7 C;  1C3T A;  2QDF A;  4BBN C;  2BWE S;  1DOX A;  2K1F A;  4MAC A;  3OWE B;  3Q8A A;  1W6V A;  5H8Y E;  3NVZ A;  1YN4 A;  4PS8 A;  3AE8 B;  3QAR A;  4FBJ B;  1UF0 A;  2RR9 A;  1P98 A;  3AE1 B;  3Q14 C;  4MEM A;  2N9L A;  4REZ A;  1BUI C;  1PGB A;  1WYW B;  3NG0 A;  2BYE A;  3MP9 A;  3T9L A;  2PLP A;  1HZ5 A;  2KYW A;  3BY4 B;  1VRA B;  1ZE3 D;  1YIW A;  2ASQ A;  4A55 A;  4IWO A;  4ANX A;  2K6Q A;  2NBW B;  2L3Z A;  2WP9 B;  2FUG 1;  3CMM B;  5LNK 1;  4USA A;  2EKE C;  4ZHO A;  3RMK C;  1XCQ L;  3BVG A;  3NRZ A;  4FN2 A;  1HEZ E;  1P9D U;  1RYJ A;  5JHB A;  2I1J A;  4A20 A;  2MBE A;  4KIK A;  1TS4 A;  2NS5 A;  4A6Q A;  2LVO A;  3S2A A;  5E6O A;  3HVD A;  3AXC A;  1L7Y A;  2K9X A;  3ZDM C;  1Q1O A;  2KDE B;  4UDU C;  2BYT A;  3DCG A;  3N1X C;  4TQ0 A;  2LFI A;  4K3B A;  1YX5 B;  1QKZ A;  2E6X A;  2JF5 A;  4RMA A;  1XLN A;  1EU3 A;  2KAJ A;  4LDT D;  1V49 A;  2V1Y A;  4LJO B;  2PW9 A;  1ROE A;  1GG3 A;  1F52 A;  4GU2 A;  2LUE A;  2A5U A;  5AZH A;  3RD2 A;  4WUR A;  1J7B A;  2WU5 B;  1Q5W B;  1HE8 A;  2JQR B;  4FJV B;  2KX3 A;  4HJK A;  1Z5S B;  3I3T B;  3R7R A;  2D11 A;  2CJO A;  4S0R A;  3RNB C;  3B2G A;  1N62 A;  1B1Z A;  1V1P A;  1XLQ A;  4HLE A;  1MPE A;  3ALB A;  2KD0 A;  4HKQ A;  1KLV A;  3H6N A;  1SJE D;  1GPX A;  1WH3 A;  1K8R B;  2K8H A;  4DXA B;  2BTE A;  1SE2 A;  1GC6 A;  1WGY A;  3J9C A;  4KDI C;  5LXI B;  3AEC B;  3GS2 A;  2BYV E;  4IM0 A;  3ZNH B;  1AN8 A;  1JRP A;  1SBB B;  3RNE C;  1F1H A;  4B9K A;  1UGJ A;  4IG7 B;  2MCN B;  2BBC A;  3PHX B;  2G1E A;  4NJ6 A;  2INP E;  4IKG A;  4K1R B;  3UIN B;  4ZRK A;  1NVI D;  3RNA C;  3Q8E A;  1J19 A;  1VDV A;  1T6B X;  4ZDV A;  1RFK A;  3RZW C;  3U7D A;  2IY1 B;  2YLM A;  1WJN A;  1VD2 A;  2FID A;  5AEK B;  1J7C A;  1Q0W B;  5HG2 A;  1TIF A;  2ZVN A;  1ZOY B;  1LGR A;  4F1S A;  2N7E A;  2G45 B;  1TJE A;  2GMI C;  1UBQ A;  2QHO A;  1L2N A;  1EWC A;  3A1Q B;  2N9K A;  3UGB B;  1F0Z A;  5G5G A;  2GBK A;  2J52 A;  3RNC C;  1UGM A;  2JZP A;  3KH0 A;  3V6E B;  3A4S C;  2MLB A;  3DWG C;  3NVY A;  3M3J A;  4XYC A;  3H8H A;  1TTN A;  2ZW1 A;  1ZXH A;  1HTQ A;  1TKG A;  2D3A A;  2LWP A;  3L4P A;  4OVZ A;  4EZL A;  1YOV B;  2GBJ A;  3BVZ A;  1VZ7 A;  2OED A;  3SEB A;  3TEW A;  2KXJ A;  3B08 A;  1F9J A;  1Y8R C;  1FCL A;  1WGG A;  2N0S B;  2NR2 A;  2N1W A;  1QZE A;  4TMA B;  3VR8 B;  2KJH B;  4PS7 A;  4DDG D;  1VZ6 A;  2LEK A;  1EM7 A;  3RNF C;  2ZCC A;  4DHZ B;  5J2R A;  2LJ5 A;  3V3X A;  1WXV A;  2XEW A;  1AW7 A;  1MHH E;  3BYT B;  1UZX B;  1EO6 A;  1ACC A;  1DOY A;  3LXF A;  4CHK A;  4NAW B;  3FKY A;  2O2V A;  3P2B A;  3R2I A;  4P16 A;  3VQI A;  3UQB A;  3FIL B;  4BAX A;  2WDV B;  4C4V B;  1BML C;  4MH8 A;  3CSF A;  3HM6 X;  2NTT A;  3R66 C;  3AMZ A;  3Q3M C;  3IHP C;  3ZUN A;  4ARI A;  3ZXR A;  2LVQ A;  1K53 A;  1KF6 B;  5KHQ A;  4R3D A;  1RM6 C;  3A9J A;  2BS4 B;  2IGG A;  3KYC D;  4FUL A;  4NJC A;  2K5P A;  3P42 A;  2JPH A;  5AZG A;  2HD5 B;  2N7D A;  2IO3 B;  1OQQ A;  4AJW A;  2DYM A;  4OZC A;  3AEB B;  4EOY A;  1UD7 A;  1JAL A;  3ZXV A;  1ISN A;  3ZIM A;  1WM2 A;  2KWC A;  4HXD A;  2GRI A;  3SU8 X;  4E74 A;  5BMH A;  4XGA B;  2L52 A;  1F77 A;  2KQ7 A;  2DBY A;  1BXT A;  2LGI A;  4KGS A;  2J0M A;  2WXF A;  5JXV A;  3LB8 C;  1XF5 L;  1N5W A;  2L0T A;  1ZP0 B;  1ET6 A;  2MW5 A; 
#chains in the Genus database with same CATH homology
 3ML9 A;  3VTV A;  4HWI B;  2XK5 B;  5CTR C;  2K39 A;  4GGQ A;  3TBL D;  3ZDT A;  1GJZ A;  1J8C A;  2RPQ A;  4HDO A;  4TQ1 A;  2EMS A;  1WMH A;  5G55 A;  3PGE A;  2MBB B;  2GBR A;  4BKS A;  1OEY A;  2L00 B;  2ZNV C;  4IW0 A;  4LDT B;  4NAW A;  4I6N B;  3DBL I;  5CX3 A;  1WE7 A;  2KQS A;  2FAZ A;  3PLV A;  2KTR B;  3ML8 A;  3GZN I;  1EUV B;  3KUC B;  5DPW A;  2DEN B;  4IWP A;  3ZNI D;  3TCA A;  2KJ6 A;  4ZYN A;  3W1Y A;  1KJT A;  4BKG A;  2KK8 A;  2MQJ A;  2WX1 A;  3NHE B;  3N3K B;  2KFK A;  5CHV C;  4NPN A;  2KVR A;  2L0F A;  1WGD A;  1V9J A;  4E71 A;  4ICV A;  4W9J A;  4KSK C;  3H7P B;  1Z2M A;  1WGR A;  2PE9 A;  2K8B A;  3QAQ A;  3SD5 A;  3WAL A;  1CMX B;  3ZKJ C;  5DPR A;  2DZM A;  4BFR A;  4MJS B;  5L83 A;  2PPH A;  3KVF B;  1E7V A;  1XQQ A;  3ZO5 B;  4KIK B;  3PV1 A;  2N9E B;  1TBE A;  2V4L A;  4GDL B;  2JT4 B;  2DYB A;  3ZVV A;  4IM3 A;  2G3Q B;  3NZU A;  2VRR B;  2G4S A;  4II3 B;  4EEW A;  2A4Z A;  2YVC A;  2C9W B;  2WX0 A;  4HK2 A;  3DBR I;  2LGY A;  4W9F A;  2C7M B;  3RT3 B;  3LMN A;  2GBM A;  2L76 A;  2K6D B;  4GDK A;  3AU4 A;  3UQA A;  3EHV A;  1RFA A;  3VUX A;  2LD9 A;  5DCN A;  1E8Z A;  2MP2 B;  1BT0 A;  3VUW A;  1I42 A;  3M63 B;  2JRI B;  3ZNZ B;  2FCN A;  4OVV A;  3PTF C;  4FLH A;  5AZF A;  4ANU A;  4HCN B;  3OLM D;  1WRD B;  4A3O A;  5E6P A;  2JVC A;  1IPG A;  1SIF A;  4GIV A;  2HJ8 A;  4BKS D;  4DWF A;  1ZKH A;  4GOC A;  3NOB A;  3DQV A;  4GSW A;  3L13 A;  4MM3 A;  3A4R A;  2NVU I;  4WWP A;  5G2N A;  4JGH B;  1H8C A;  1E8X A;  3R7Q A;  2FCS A;  1C3T A;  4WWN A;  2NPT A;  4MH0 E;  4NQL B;  4BBN C;  2BWE S;  3VUY A;  1WIA A;  2BKR B;  2KKC A;  3IG3 A;  2LGD A;  2K1F A;  4BOZ B;  4TKN A;  3VHT C;  1W6V A;  4PS8 A;  3DBH I;  1UEL A;  2M17 A;  3QAR A;  3OAW A;  4FBJ B;  2AL6 A;  4KDL B;  2PEA A;  1YJ1 A;  3EFU A;  2RR9 A;  3H7S A;  1P98 A;  4TUU A;  4KSL C;  4HDQ A;  1LM8 B;  2XK5 A;  4MEM A;  1D3Z A;  3B0A A;  3ZTC A;  2Z59 B;  2GBN A;  1WYW B;  3RUL A;  1WE6 A;  2BYE A;  4CO7 A;  1JRU A;  2KLG A;  1TZ1 A;  1U4A A;  2MBH A;  1RAX A;  2KDI A;  2M8S A;  3BY4 B;  3T9L A;  1YIW A;  2KWV B;  2ASQ A;  1KOT A;  3HK0 A;  1EF1 A;  1I35 A;  4IWO A;  2KFJ A;  2KTR A;  2K6Q A;  2NBW B;  2RGF A;  4ANX A;  2BF8 B;  1E5W A;  2CHZ A;  3WIM A;  2KLC A;  4ANW A;  1WR1 A;  2L3Z A;  5D94 A;  4FA6 A;  3CMM B;  3L0W B;  4GB9 A;  1E90 A;  2CR5 A;  2EKE C;  4II2 B;  4K81 A;  4M8M A;  4DHZ E;  1XD3 B;  4AUQ C;  3ECI A;  4KZC A;  4FHK A;  4EZJ A;  2L8J A;  4FN2 A;  3H7P A;  2KHW B;  3TIX A;  4FAD A;  1P9D U;  3QC8 B;  1WI0 A;  3QX1 A;  5JHB A;  4MJS A;  5CHW A;  4CYE A;  4BKT A;  4DBG A;  2I1J A;  4IWQ A;  2MBE A;  4A20 A;  4KIK A;  2NS5 A;  4NY0 A;  3LJ3 A;  4EFO A;  4GDL A;  5KHO A;  5J18 A;  2LVO A;  3S2A A;  4W9H A;  5E6O A;  3O65 B;  3AXC A;  1L7Y A;  4MSM B;  4W9E A;  3ZDM C;  4FJY A;  2MA9 B;  1Q1O A;  2DHZ A;  1A5R A;  5IA7 A;  2FUH B;  1NBF C;  2NBV B;  3QCA A;  2CHX A;  2CS4 A;  2KDE B;  5FR6 A;  3DCG A;  2JZ3 B;  3PSE B;  4J6I A;  4TQ0 A;  1P0R A;  1YX5 B;  4IUM B;  2LVP A;  1RLF A;  2M0X A;  3ZW3 A;  2JXX A;  2LXA A;  3Q3F A;  4WAA A;  2JF5 A;  3IBE A;  4RMA A;  2LAS A;  5J17 A;  3VVW B;  4RM8 A;  4JLC A;  5D7G A;  2D07 B;  5LLI A;  4B95 A;  1XT9 B;  2JWZ A;  4LDT D;  4K7U A;  4PS3 A;  1V49 A;  1WZ0 A;  2V1Y A;  2L7R A;  4LJO B;  4NQK E;  3U30 A;  1GG3 A;  1V6E A;  1AAR A;  3VH4 B;  4GU2 A;  2LUE A;  3L08 A;  5GMV A;  4BBN F;  4HVB A;  1OTR B;  2ZJD A;  3ZTD A;  2A5U A;  5AZH A;  2R2O A;  3A33 B;  3RD2 A;  4A3P A;  2DZI A;  1P3Q U;  2J0J A;  3L17 A;  3NS8 A;  1WXA A;  3ZRF A;  3PS6 A;  4MSQ B;  2W9N A;  2C7H A;  1Q5W B;  3H1U A;  2KJR A;  3L16 A;  1OGW A;  1HE8 A;  4TV3 A;  5D6J B;  5C23 A;  3RZF A;  4FHJ A;  3APC A;  2DYO A;  2WYQ A;  4MGZ E;  4FJV B;  2KX3 A;  1WGH A;  2RSU A;  4I6L B;  1ZW7 A;  4HJK A;  3QWZ B;  4MEL A;  1Z5S B;  3V60 A;  2JUO A;  4EUT A;  3APF A;  3I3T B;  2FCM A;  3R7R A;  3UIO B;  2N9P C;  2D11 A;  4ASW C;  1V5O A;  2OOB B;  5JHA A;  2LXC A;  3QHT A;  3KW5 B;  3K9O B;  5C1Z A;  3MHS D;  3DBS A;  4B6W A;  1WX8 A;  4HLE A;  5JZE B;  3PHW B;  3GOE A;  3ALB A;  3KUD B;  5BO4 B;  3WAP A;  2KD0 A;  4AJY B;  1G6J A;  2CU1 A;  1KLV A;  1SGH A;  4WJP A;  3DVN U;  3H6N A;  1WM3 A;  2LGX A;  4NNJ B;  3W1S A;  1WH3 A;  1K8R B;  2BPS A;  4F8C B;  2K8H A;  2OJR A;  4DXA B;  4NJ7 A;  3HHM A;  5IAA C;  4MGY E;  1GC6 A;  1WGY A;  2N1V A;  4F7Z A;  2KDF B;  4N9F 4;  4M8N A;  4KDI C;  5LXI B;  2MWS B;  4ICU A;  4W9I A;  4E3C A;  2BYV E;  1YX6 B;  3M62 B;  4IM0 A;  2Y5B B;  3VXW A;  3ZNH B;  3X0W A;  1WJ4 A;  4ZRJ A;  1WXM A;  1WFY A;  3L10 B;  4G11 A;  4B9K A;  2IY0 B;  4IG7 B;  2MCN B;  1V86 A;  3EC8 A;  2O6V B;  3V61 A;  1V5T A;  3PHX B;  3PLU A;  1UH6 A;  4AP4 C;  4NJ6 A;  1LQB A;  4K1R B;  4AWJ A;  3UIN B;  4ZRK A;  2IO1 B;  5E6N A;  3CF6 E;  1V80 A;  1R4N I;  2N9X A;  1ZGU B;  2FCQ A;  4KZ0 A;  1EF5 A;  3DOW A;  1J19 A;  3L54 A;  3QIJ A;  4DK5 A;  2JZZ A;  2KO3 A;  4ZDV A;  3H9D A;  3RZW C;  1WF9 A;  3U7D A;  4WQO B;  4MGI E;  2DZJ A;  2CHW A;  2IY1 B;  2O2V B;  2YLM A;  1WJN A;  1VD2 A;  2FID A;  4IC7 B;  5TR5 A;  3T8M A;  2XBB C;  4DHJ D;  2ZNV B;  3PRE A;  2Z0E B;  4PYU A;  3ONS A;  5AEK B;  1Q0W B;  5LXH A;  1C1Y B;  2ZVN A;  1M94 A;  2KWU B;  3HM3 A;  2LI5 A;  3BIN A;  4P7I A;  4F1S A;  2N7E A;  3JW0 X;  2LRW A;  2G45 B;  4G0N B;  4AOF A;  2GOW A;  3R3M A;  2ZEQ A;  2KNB A;  5DPT A;  3V6C B;  2GMI C;  2N4F A;  3DDC B;  1NI2 A;  1H4R A;  1UBQ A;  2QHO A;  4GMV A;  1L2N A;  2MRP A;  3A1Q B;  3DVG X;  3PT2 B;  3UGB B;  4BVU C;  2GBK A;  4HCP B;  4EKU A;  1UGM A;  3KH0 A;  2MP2 A;  4X57 B;  1E8W A;  2MBQ A;  3V6E B;  3A4S C;  2FIF A;  2WWZ A;  2MLB A;  3JSV B;  3JYU A;  4GXB A;  3VH3 B;  3A9J B;  4WJO A;  4BOS C;  2KC2 A;  2R2Q A;  3M3J A;  3IVF A;  2BGF A;  3VDZ A;  3DVG Y;  4PYZ A;  1NDD A;  2KC1 A;  3V62 A;  1TTN A;  2I1K A;  2MSE D;  4KV2 A;  3ZRC A;  4K7S A;  3W1S C;  3UIP B;  3LDZ E;  4ZRI A;  2Z0D B;  1WJ6 A;  2MX2 A;  3VTW A;  2LWP A;  4EZL A;  4JL9 A;  2IO0 B;  3AU5 A;  2GBJ A;  2WDT B;  2KXJ A;  3B08 A;  1F9J A;  1V2Y A;  3PVL A;  4LCD E;  3VAW A;  1Y8R C;  3PPA A;  1X1M A;  2NBU A;  2C5L C;  4WWO A;  3SDL C;  4IM2 A;  1IP9 A;  1WGG A;  3SHQ A;  3TL5 A;  4W9K A;  2BYF A;  2NR2 A;  2K8C A;  1R4M I;  2N1W A;  1QZE A;  2RD0 A;  2UWQ A;  2KMA A;  2KJH B;  2JY6 A;  4PS7 A;  1J0G A;  4ANV A;  4DDG D;  4HPM B;  2M1M A;  3ENE A;  3K9P B;  1UBI A;  2PE6 B;  3PZD A;  4LJP B;  3VFK A;  2DAJ A;  2G4D B;  2O6V A;  3N30 A;  2AYO B;  2ZCB A;  3OJ4 B;  4I6P A;  3TMP B;  3UF8 A;  1WY8 A;  2HE7 A;  2ZCC A;  4DHZ B;  2KAN A;  2BKF A;  2PJH A;  4XC2 A;  5EDS A;  5JH5 C;  1T0Y A;  2HTH A;  2LJ5 A;  5J2R A;  3A9K B;  1GC7 A;  2NCN A;  3PRP B;  2KOX A;  4URK A;  1WXV A;  4W9L A;  1WJU A;  4WJN A;  2ZPY A;  2AL3 A;  2XEW A;  5D2M B;  1YQB A;  2B3A A;  3M95 A;  3MTN B;  4GN1 A;  1WMH B;  1UZX B;  1EO6 A;  3AI5 A;  3JVZ X;  4CHK A;  4NAW B;  2O2V A;  4W9C A;  3P2B A;  1YD8 U;  1S1Q B;  2AEH A;  1V81 A;  3IFW B;  2IYD B;  2ZPN A;  3VQI A;  2KZR A;  4FJZ A;  3UQB A;  5HKH A;  2UYZ B;  1P1A A;  4YL8 A;  1WZ3 A;  2D2Q A;  1GUA B;  2ZZP B;  2KFK B;  2CKH B;  3CSF A;  1MG8 A;  3KYD D;  4DDI D;  3HM6 X;  4K7W A;  2DZK A;  2KDB A;  2KX0 A;  1IYF A;  1TGZ B;  3EEC A;  3R66 C;  3D32 A;  3IHP C;  3QK0 A;  2IZV B;  4MDK E;  2V3S A;  3ZUN A;  3A1Q A;  3OJ3 A;  2LVQ A;  4JIO U;  2ZVO A;  2D3G A;  5KHQ A;  1E7U A;  1PQS A;  3WAO A;  2K25 A;  4RM9 A;  3JSV A;  3KUZ A;  3TJP A;  3A9J A;  3KYC D;  4G50 A;  3WA0 A;  4FUL A;  3ZNG C;  4EZK A;  3VTU A;  1OEY J;  2JRH A;  3CST A;  2O6V D;  1SE9 A;  2KTF A;  3DPD A;  3N32 A;  2JPH A;  3NY5 A;  2HD5 B;  3QQ8 B;  4GDK B;  5AZG A;  2N7D A;  2IO3 B;  4JQW C;  4XX5 A;  4XZ4 A;  4AJW A;  2DYM A;  2DAF A;  4EOY A;  2LRU A;  2M4N A;  2L05 A;  1UD7 A;  1GNU A;  3APD A;  1ISN A;  3U8Z A;  1WM2 A;  3ZIM A;  3AUL A;  3RUI B;  4W9G A;  2KWC A;  1WXS A;  2EMT A;  4HXD A;  3NZS A;  3QA8 A;  1FXT B;  2FNJ B;  1WX9 A;  1OQY A;  3C0R B;  3MJW A;  2BWF A;  3SU8 X;  2IO2 B;  4E74 A;  4DHJ B;  3PRM B;  5DPS A;  2C7N B;  2C60 A;  3HIZ A;  2KQ7 A;  3DVN V;  4WJQ A;  4G3X B;  3RYT A;  4W9D A;  3RCZ A;  5CHF A;  2LZ6 A;  3B1L X;  4KVG B;  3X23 A;  3QJZ A;  1VCB A;  1LFD A;  1S3S G;  2NPT B;  2KN5 A;  1RRB A;  2J7Q B;  2D10 A;  1LXD A;  2J0M A;  4HPL B;  4M0W B;  2IBI B;  1WR6 E;  1WX7 A;  3Q3J A;  5L95 C;  4MGK E;  1KM7 A;  2MBO A;  2REX A;  2J0K A;  3WAM A;  1E8Y A;  3PRZ A;  2L0T A;  2KMC A;  3A9K A;  3ZLZ A;  4OVU A;  2AWT A;  3WAN A;  2DX5 B;  2MW5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...