4A3OA

Crystal structure of the usp15 dusp-ubl monomer
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
217
structure length
211
Chain Sequence
AADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 15
publication title Structural Variability of the Ubiquitin Specific Protease Dusp-Ubl Double Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 64
structure length 211
sequence length 217
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2011-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4a3oA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4a3oA01
5D7GA 2ZCBA 2LI5A 4K81A 2MA9B 1GNUA 2BYEA 3ML9A 2XBBC 3Q3FA 1E7VA 4W9CA 2BYFA 3APFA 2DX5B 2ZVNA 2L0TA 2CS4A 5E6NA 3AU5A 3PPAA 2GBKA 1YIWA 3ZNGC 2IO3B 2D07B 2FCQA 2LXAA 2C7NB 4DHZE 2KDEB 5JHBA 2Z59B 3CSFA 4BBNC 5BO4B 3QQ8B 2KC1A 3UQAA 2QHOA 1C3TA 4BKGA 2WX1A 4FHJA 3I3TB 1PQSA 1P9DU 1WXMA 2EKEC 2N1VA 2ZZPB 4WWPA 4ICUA 5C1ZA 4LCDE 4G0NB 2FIDA 3N30A 3RYTA 3TIXA 3Q3JA 2MCNB 1UELA 2MBBB 1V5TA 1IP9A 2GOWA 2DYBA 2JZZA 3QARA 1E7UA 2KLCA 4HCPB 2LRWA 4AJYB 1V2YA 2XK5A 5DPRA 2RR9A 4DK5A 4EOYA 1NDDA 2DZJA 4XC2A 3RCZA 1V81A 3ZDTA 3CF6E 4II2B 1WMHB 2LGXA 3KYDD 1WM2A 1XT9B 2FIFA 3ZTDA 3ZRFA 4A3OA 5TR5A 2L05A 3TJPA 3WANA 1WR6E 2MP2A 2Y5BB 4EZJA 2K39A 1WE7A 2HJ8A 4RM9A 4ICVA 3JSVB 2NCNA 3LJ3A 5KHQA 1LXDA 2NBWB 2IO0B 3VTWA 3PHXB 3L13A 3QJZA 5KHOA 2M0XA 3ZO5B 2C60A 4M8MA 2Z0EB 2J0JA 4EKUA 5J18A 2OJRA 2MW5A 4NY0A 1IPGA 2FNJB 1MG8A 4GB9A 3RD2A 2K8HA 3VXWA 1WE6A 1WYWB 4J6IA 2KC2A 3UIPB 5C23A 4CO7A 2KTRA 3P2BA 4XX5A 2MQJA 4DXAB 3NHEB 3PLVA 4GN1A 4PYUA 1LFDA 3H9DA 3AU4A 4IM0A 1SE9A 2K6DB 2ASQA 4FLHA 1X1MA 1WM3A 3PREA 1YX5B 2K1FA 1TBEA 2GBRA 3T9LA 2R2OA 3ZLZA 2FCMA 4DHZB 1A5RA 3UF8A 3NY5A 1KLVA 1WZ0A 3A9KB 4OVVA 2L8JA 3A9JB 4FULA 5G55A 2IZVB 1W6VA 2LVQA 2M8SA 3H7PB 1YQBA 4MGZE 3L54A 2PE6B 3ZUNA 2M1MA 4G3XB 4HXDA 4IWPA 4KZCA 4KSLC 2AEHA 3H7SA 4EUTA 2RSUA 1Z5SB 4EZKA 3DVNU 3DBSA 3OJ4B 4GDKA 4NNJB 3X0WA 4LJOB 4BKSD 3OJ3A 1WIAA 5EDSA 2N7DA 3MJWA 3WAMA 3DQVA 2O6VD 3DBHI 2CHZA 3TMPB 1R4NI 1YJ1A 2D11A 1L2NA 2JRHA 3EECA 1EUVB 1VD2A 4FJYA 2WWZA 2BWES 3AULA 3W1SA 3TL5A 2REXA 3A33B 4KIKA 2PE9A 3HM3A 4MSMB 2YLMA 4M8NA 2KMCA 4B95A 3VUXA 1P0RA 3IG3A 4WWOA 2BYVE 2KFKA 3W1YA 2JT4B 2ZNVB 4FHKA 3W1SC 1KOTA 2IO1B 1I42A 2IBIB 4WJPA 4NQLB 1EF1A 2FAZA 2O2VB 5D6JB 3APCA 2FUHB 4NAWB 3PSEB 2G4DB 4WAAA 1WXVA 3IBEA 3V62A 4BKSA 1WJ6A 2NVUI 4BOSC 3H1UA 1WFYA 2JPHA 5LXIB 4A20A 3HM6X 1P1AA 2KLGA 2CHWA 2O6VA 3APDA 5DPWA 1E90A 4HK2A 4W9DA 3DVNV 1GUAB 3ZW3A 2KTFA 4HCNB 4WQOB 5CHFA 1UD7A 4EEWA 2C9WB 2L3ZA 5CHWA 4MJSB 3L10B 3L08A 3R66C 5AZGA 3ZRCA 1WX9A 2JXXA 2GBNA 3WA0A 2G4SA 1T0YA 4GDLB 4JGHB 4JLCA 3RUIB 2ZVOA 3NZSA 3R7QA 2DENB 2K25A 3KW5B 4LDTB 5J2RA 4I6LB 3KVFB 1WJNA 1QZEA 4TQ1A 4W9EA 3IFWB 2JUOA 4MSQB 4AUQC 5DCNA 3ZNID 3M3JA 3DVGY 4G11A 3K9PB 4IC7B 1D3ZA 4DHJD 2KXJA 3PRMB 4OVUA 3SDLC 3UINB 4HWIB 3VH3B 3PZDA 4W9KA 2MBHA 4W9GA 1EO6A 2LGDA 3RT3B 1NBFC 2KDBA 2M4NA 2JWZA 4HJKA 1KJTA 3ALBA 1OGWA 4ZRJA 2KQSA 2J7QB 3U30A 3ZVVA 2DZIA 2IY0B 3ZTCA 3AXCA 3GOEA 2IY1B 2KDIA 2MRPA 4ANXA 4WJNA 4GSWA 4K7WA 4W9HA 1XD3B 3H6NA 2D10A 3O65B 3KUZA 3VVWB 2BPSA 4K1RB 4W9JA 4CHKA 2V3SA 2KJRA 4W9LA 1E8YA 4BBNF 4DDGD 1M94A 3U8ZA 3NZUA 3PVLA 1I35A 1CMXB 2CHXA 1ZW7A 1WGYA 3UGBB 3WALA 4B6WA 1AARA 3GZNI 1ISNA 2KZRA 2WYQA 3A1QB 4BFRA 4W9IA 1J8CA 3PV1A 2HD5B 4A3PA 1XQQA 3PGEA 2KN5A 2GBJA 1E8XA 1L7YA 3IHPC 3S2AA 5JZEB 1LM8B 2ZEQA 3VAWA 4IW0A 2DYOA 2N4FA 4IWOA 3KH0A 1FXTB 4MGKE 5CTRC 2LZ6A 2FCNA 2NPTB 4E71A 3SHQA 1WX8A 2N7EA 3V60A 2DZMA 3UQBA 4X57B 1P3QU 3B1LX 4AP4C 2DAJA 2ZPYA 3QC8B 4WJQA 1LQBA 2G45B 3L0WB 2VRRB 1E8ZA 4GIVA 4BKTA 1GJZA 1WMHA 3DOWA 3PRZA 1JRUA 3VH4B 3M95A 3ZNHB 3ZNZB 1WX7A 2V4LA 3DCGA 5HKHA 3VQIA 3ML8A 4HDOA 4MDKE 3QA8A 2KO3A 3R3MA 1OEYJ 4YL8A 4URKA 2L00B 4KSKC 2J0MA 2V1YA 1UGMA 1UZXB 3JSVA 2RD0A 2Z0DB 1H4RA 2DZKA 2RGFA 4G50A 4JQWC 4W9FA 3SD5A 3VUWA 2C5LC 2MX2A 4FN2A 4I6PA 1C1YB 3A4SC 2L0FA 1WGDA 4EZLA 2B3AA 2PEAA 1V86A 3HIZA 1WRDB 2ZCCA 1WH3A 2K8BA 1WGHA 2W9NA 3VUYA 1Y8RC 2EMTA 4F8CB 1WXSA 2HE7A 3T8MA 3V6CB 1Q1OA 4TV3A 3WAPA 3ENEA 5L83A 2DAFA 4E74A 1V9JA 4FADA 2KDFB 4GXBA 5AZHA 1BT0A 1V5OA 2LGYA 4FJZA 1GC6A 1WR1A 5CX3A 3MHSD 3ONSA 3A9KA 2GBMA 3DDCB 2KD0A 3A9JA 4TKNA 3H7PA 3IVFA 1NI2A 4HPLB 2D2QA 4MGIE 5GMVA 2N1WA 2XEWA 3ZDMC 3QWZB 2I1KA 2IYDB 3MTNB 1UH6A 2JRIB 4XZ4A 2XK5B 3K9OB 2KOXA 3NS8A 1U4AA 4MH0E 4GGQA 3QX1A 2UYZB 2K6QA 1E5WA 1WY8A 4DWFA 2N9XA 4JL9A 2KANA 1VCBA 3LMNA 3SU8X 2KX0A 3QAQA 2NBUA 2MBQA 2MP2B 4ZRIA 4HVBA 1Z2MA 3JYUA 4WJOA 3CMMB 4AJWA 3VFKA 2FCSA 4ZYNA 1GC7A 2LD9A 1P98A 4KVGB 4ANWA 4DHJB 3ZIMA 1HE8A 4LDTD 3RZFA 1SIFA 2KWUB 2N9PC 2O2VA 4NAWA 3UIOB 3PS6A 2ZNVC 1ZKHA 4B9KA 2KTRB 2JY6A 4KDIC 1YX6B 3QK0A 2I1JA 1RRBA 4GOCA 1EF5A 3PLUA 4F1SA 2GMIC 4IM3A 4AOFA 3DPDA 1RAXA 3L17A 2MLBA 5D94A 3KYCD 2KJHB 4MJSA 4WWNA 4IM2A 4HLEA 4N9F4 4NJ7A 4MGYE 1E8WA 2CU1A 3OLMD 1WI0A 2JVCA 2KVRA 4LJPB 4FBJB 4FA6A 3LDZE 3C0RB 1J19A 1TZ1A 3B0AA 4GDLA 5CHVC 2OOBB 3PHWB 2A4ZA 4KZ0A 1R4MI 5L95C 1KM7A 2KJ6A 2LVOA 2UWQA 1Q0WB 2LUEA 4IG7B 2NR2A 4M0WB 4PS7A 4EFOA 5J17A 1ZGUB 4F7ZA 4KDLB 3JW0X 3TCAA 3QCAA 1WJUA 4GDKB 5JH5C 4FJVB 2HTHA 2MWSB 3HHMA 1V80A 3ECIA 5D2MB 5DPSA 4NQKE 2BWFA 3EC8A 2KWCA 2K8CA 1Q5WB 2D3GA 3N3KB 2CKHB 3V6EB 2KK8A 1SGHA 1WGGA 4ZRKA 2MBEA 3TBLD 1UBIA 2LXCA 4JIOU 2KKCA 2C7MB 4PYZA 5E6OA 2JZ3B 4BOZB 3DVGX 3PTFC 4DDID 1F9JA 3QIJA 2LJ5A 4HPMB 3KUDB 5E6PA 3RULA 1V49A 3AI5A 4KIKB 3BINA 4MM3A 4IUMB 5FR6A 5LLIA 2N9EB 2R2QA 3V61A 3X23A 2MBOA 1WGRA 2KNBA 1WXAA 1TGZB 3EHVA 2KFKB 2NBVB 2KWVB 3OAWA 2BGFA 4ASWC 2CR5A 3WAOA 2LVPA 1S1QB 1OQYA 1H8CA 3NOBA 2BKFA 5DPTA 4IWQA 2JF5A 2WX0A 4ANUA 2KFJA 2J0KA 1OEYA 4II3B 2G3QB 4GU2A 4PS3A 2L76A 2PPHA 3M62B 2C7HA 2O6VB 1K8RB 2M17A 3A1QA 3EFUA 3L16A 3N32A 4GMVA 3KUCB 3VDZA 2BKRB 4E3CA 1TTNA 4BVUC 1IYFA 2AL3A 3JVZX 2LASA 5JHAA 3ZKJC 5AEKB 3A4RA 3BY4B 4MELA 2A5UA 4ANVA 2WDTB 4K7SA 3D32A 4NPNA 1GG3A 3DBLI 4PS8A 1J0GA 2NPTA 4I6NB 4HDQA 3HK0A 5IAAC 2DYMA 2RPQA 3VTVA 2KMAA 2ZPNA 4CYEA 2KHWB 1OTRB 2DHZA 2AWTA 3WIMA 1WF9A 1YD8U 3R7RA 2EMSA 5G2NA 2PJHA 2AL6A 4AWJA 4NJ6A 2ZJDA 4TUUA 1UBQA 3M63B 2BF8B 4DBGA 1RFAA 1WJ4A 2KX3A 4TQ0A 3VTUA 2LWPA 1G6JA 3QHTA 4MEMA 2YVCA 1S3SG 2L7RA 4ZDVA 2LRUA 1WZ3A 2IO2B 3DBRI 4KV2A 2KQ7A 4RM8A 3VHTC 5LXHA 2MSED 1V6EA 4P7IA 2AYOB 2NS5A 3CSTA 3PRPB 4RMAA 3PT2B 5IA7A 1RLFA 3U7DA 4K7UA 5AZFA 3RZWC 3B08A
chains in the Genus database with same CATH superfamily
1L5PA 4K81A 4US9A 1E7VA 2C7NB 1DGJA 4RNAA 4ZHPA 3CSFA 3QQ8B 2IGGA 3RNBC 1C3TA 2WX1A 3AH7A 3I3TB 2WXPA 2EKEC 3Q14C 3Q3JA 3SEBA 2BT6A 1UGJA 3NUHB 1V5TA 2GOWA 2KLCA 1V2YA 1K51A 2D3CA 4N59A 1V81A 3O13A 3BYYB 3CF6E 4LLGM 1JW9D 5IOIA 4IOIE 2AQ1B 3KYDD 5FK9C 1WM2A 2K5PA 2L32A 3ZRFA 4A3OA 3RNEC 1KH0A 3WANA 4A6QA 1XCQL 2GLSA 1WE7A 2HJ8A 2KWDA 1N5WA 2NBWB 1XLQA 3PHXB 2INDC 2MW5A 4NY0A 2JYEA 2FNJB 2Y5PA 3RD2A 3VXWA 3UIPB 2KC2A 4A8XC 4WQMA 3PLVA 4J3OD 3MFGA 3AE1B 2ON8A 2ASQA 1T5XD 2FBWB 4OHJA 1X1MA 3B2GA 3T9LA 2R2OA 1N5XA 1VZ8A 3RMKC 2HDEA 3A9KB 2Q5WD 5G55A 4FULA 4D2KA 2M8SA 2M1MA 4IWPA 3DBSA 2VH1A 4LJOB 4ZYSA 5EDSA 2N7DA 1EU4A 3TEZA 2O6VD 1YJ1A 4OZCA 1VD2A 4HKQA 2HJ1A 2SEBD 4MSMB 2KMCA 2PIAA 1P0RA 5IKCM 3W1YA 2JT4B 2ZNVB 4ZRQA 1KOTA 2IBIB 4WJPA 4NQLB 4NAWB 4BKSA 2NVUI 3H1UA 4A20A 2NTTA 4ZOHC 5DPWA 4W9DA 3DVNV 2JX5A 3ZW3A 1UD7A 4EEWA 5CHWA 2WP9B 3L08A 3R66C 3WA0A 1T0YA 4JGHB 4CQNA 2L52A 2J53A 2DENB 3KW5B 4I6LB 1QZEA 4W9EA 2JUOA 4MSQB 4AUQC 3M3JA 4G11A 3AM9A 1D3ZA 4DHJD 4OVUA 5AUIA 3UINB 1MHHE 2QCZA 4W9KA 1NBFC 2BS2B 2KDBA 3ALBA 3Q3MC 1OGWA 1DOYA 2IY1B 3I5JC 4WJNA 2KMMA 3AE4B 2D10A 4CHKA 3MJ5A 1WYGA 3U8ZA 2GI9A 1I35A 5I4DA 5MPOA 1WGYA 2WYQA 4HJGE 1FNWA 4W9IA 1J8CA 2HD5B 1EM7A 2GBJA 3IHPC 3S2AA 4AQ7A 4IW0A 4IWOA 2B76B 1FXTB 2NPTB 3IT4B 4ITKA 1WX8A 5C2TB 2RDGA 1HEZE 4AP4C 2AX5A 2RPVA 2G45B 1ZUD2 2VRRB 4GIVA 4BKTA 1T0RC 3DOWA 2YEPF 1JRUA 3VH4B 1WX7A 2V4LA 3DCGA 3ABVB 2N7JA 3ML8A 1UUPA 2V1YA 1XLNA 2RD0A 2Z0DB 1KFYB 1H4RA 2RGFA 3SD5A 4W9FA 1DOXA 1FCCC 3A4SC 2PEAA 2KACA 2ZCCA 2W9NA 1YMHE 1TS3A 5FR3A 1D4BA 4F8CB 2M0AA 1WXSA 4M02A 3NRZA 4KX6B 2DAFA 1V9JA 2KDFB 1ROEA 4K3CA 5AZHA 1IGDA 1QOAA 3MHSD 3ONSA 1VZ7A 4TKNA 1FPYA 3ZQ4A 2XEWA 3AEAB 2FUG1 4JPSA 2I1KA 2INPE 4HPPA 2G9HD 3NG0A 1DYQA 3BWUD 3SR6A 4ARIA 2WXMA 4MH0E 5T8IA 3MHZA 1TS5A 1E5WA 1VCBA 1HQRD 1TKYA 2KX0A 2NBUA 4HVBA 3JYUA 1STEA 3DHIC 4AJWA 4ANWA 4NJCA 2N9PC 2O2VA 3P4RB 3UIOB 1ET6A 1YN5A 1ZKHA 4B9KA 4KDIC 1L0VB 1MPEA 3T3OA 4LK0M 1HA5A 4AOFA 3DPDA 3NZ3A 2MLBA 2JU6X 1HTOA 2KJHB 4MJSA 1MHXA 3DBRB 1C78A 4MGYE 3TEYA 2JVCA 4FA6A 1VJKA 1J19A 1KM7A 4PS7A 1UF0A 3EUB2 4RF0A 4F7ZA 3JW0X 1C4CA 3QCAA 5JH5C 3HHMA 1KLUD 3EC8A 2KWCA 4N6EB 4US8A 3TEXA 2MBEA 2KKCA 2JZ3B 3RNCC 4XE0A 3QIJA 2GRIA 3KUDB 5E6PA 1V49A 4KKIA 3X23A 2BGFA 1K50A 1NENB 1OQYA 1S1QB 1H8CA 4OW0A 2J4XA 2BKFA 1TS4A 2KFJA 2L76A 1BUIC 4C7ZA 2M17A 3N32A 3N20C 1FNVA 4E3CA 1TTNA 2LASA 5AEKB 1YQ4B 4NPNA 1FO4A 4PS8A 1FEHA 1ZDXA 5HHDG 2DYMA 2RPQA 3VTVA 3LB8C 2ZPNA 4CYEA 5E6JA 1WF9A 1YD8U 2EMSA 3GB1A 4NJ6A 3P63A 1F1HA 1UBQA 1WJ4A 2WDRB 2KX3A 2LWPA 2YVCA 1S3SG 4KV2A 5EE9A 2KQ7A 4JX1C 1T0SC 3BK1A 3CSTA 3PT2B 5IA7A 1PYWD 1AWDA 3PZDA 5D7GA 2ZCBA 4P1CC 3IXSA 2LI5A 2MA9B 2WXIA 2D3BA 2FE8A 2LJIA 3R2TA 4C4VA 2BYEA 3Q3FA 2EKIA 1NVID 4W9CA 2BYFA 2DX5B 2CS4A 2V3NA 2V0GA 3ZNGC 5D3IB 3NVVA 5JHBA 2KQ4X 2Z59B 2MJEA 5BO4B 2KC1A 3UQAA 3MC9A 4BKGA 4FHJA 2BVCA 2WU2B 4LCDE 4G0NB 2FIDA 5GXGB 3DBHB 3N30A 1R4NB 2MCNB 2DYBA 4OVZA 4AJYB 5DPRA 4EOYA 3P4PB 3NVZA 4GLSC 1OQQA 1LO5D 3ZTDA 2FIFA 5TR5A 2L05A 2MP2A 4EZJA 1ACCA 1YJJA 4RM9A 3FAHA 4ICVA 5KHQA 1PDXA 1TYGB 3VTWA 3QJZA 2M0XA 2C60A 4M8MA 1F0ZA 5J18A 2OJRA 4LNNA 1XO3A 3LXFA 3ZGZA 1WYWB 4J6IA 2KTRA 4DXAB 5IO9A 4GN1A 1I4RA 3KQ4A 4FLHA 1SE9A 2K6DB 1JWMD 1YX5B 1TBEA 1C4AA 1CJEA 2VH2A 4DHZB 1D6EC 3UF8A 1WZ0A 1XF5L 4C7YA 2L8JA 2LVQA 3TUOA 3L54A 2PE6B 4KZCA 4KSLC 1Z5SB 4EZKA 3EGRA 4BKSD 3N1ZC 3OJ3A 1WIAA 3CWIA 4YTNB 3DQVA 5EE3A 1L2NA 1JMLA 4FJYA 2BBCA 2IGDA 1IGCA 3AULA 4KIKA 1EWCA 2PE9A 2JZPA 3VUXA 3IG3A 2BYVE 3L4PA 4FHKA 3W1SC 1EF1A 2FAZA 2KN4A 2O2VB 3APCA 3PSEB 2J52A 4DXGA 4WAAA 4B0MA 4BOSC 1WJ6A 3E9SA 5CHFA 2C9WB 4MJSB 5AZGA 2LHDA 2W54A 3P42A 1QOBA 2JXXA 3TEWA 3C19A 2D3AA 3RUIB 2ZVOA 4LDTB 5J2RA 3KVFB 4TQ1A 3AE6B 3ZNID 3DVGY 2QJLA 2X38A 4HWIB 2LFIA 3IAS1 4HJKA 2KQSA 2J7QB 3U30A 2DZIA 4TSSA 3HVZA 3U7ZA 3AXCA 3ZTCA 2DBYA 2PTLA 4XWTA 4K7WA 1RFKA 3VVWB 4K1RB 4USAA 2V3SA 4C00A 4DDGD 3PVLA 2CHXA 3DHHC 3UGBB 4B6WA 4LNFA 3ZYYX 3PV1A 2OJWA 3PGEA 4RF1A 1E8XA 1L7YA 4RCOA 5JZEB 3KH0A 2W82A 1L6VA 2FCNA 4E71A 3SHQA 3BVMA 4X57B 2KYWA 3QC8B 1K53A 1SXTA 1E8ZA 5TSSA 1GJZA 1WMHA 3PRZA 2BB6A 3M95A 3ZNHB 3ZNZB 3HUIA 2V9HA 4LTUA 3VQIA 2JXTA 2M19A 2ZW1A 2KO3A 2CJNA 1FNUA 4A90A 3Q69A 2DZKA 4G50A 4HKZE 1I7HA 1FCLA 3TSSA 1C1YB 1WRDB 1WH3A 4C4VB 2K8BA 1WGHA 5EE1A 3RPFC 3VUYA 1R4MB 1YJIA 2LEKA 5JXVA 3AE5B 3MP9A 3PZ7A 3T8MA 1Q1OA 3V6CB 2KVZA 3IT6B 3HVDA 5HFYA 5L83A 4C56C 5D3DA 1VLBA 1BT0A 4FJZA 1GC6A 1WR1A 2MHJA 2KD0A 3H7PA 4P6VF 3U4EG 4HPLB 1Y56A 4P1BC 3MTNB 3RI7C 5BYRA 2YEPB 2CJOA 1U4AA 2UYZB 2K6QA 3W5VB 3LMNA 2INCC 1UWMA 2QC8A 2MP2B 4ZRIA 1JCKB 2PW9A 3CMMB 3Q8FA 1I4HA 3VFKA 2WU5B 3BIID 1GC7A 4KVGB 1RM6C 2PVGC 1HE8A 4LDTD 1SIFA 3H8HA 4RGMA 3PS6A 2ZNVC 4L1BA 2KTRB 2JY6A 1ZXIA 3QK0A 1RRBA 2I1JA 1EF5A 5IP4D 1SB3C 2GMIC 4IM3A 4REZA 1HZ5A 5D94A 3KYCD 4N9F4 1WI0A 3LDZE 5CHVC 3ZIMA 4LNKA 5J17A 2NR2A 3AEFB 4ZRPA 1SJED 2LGIA 3BZDB 2WLBA 1WJUA 3FC4A 4NQKE 4RGOS 2K8CA 3BK2A 3N3KB 4JE3B 4ZRKA 4MACA 3TBLD 4PYZA 4JIOU 3PTFC 3AE8B 4HPMB 3RULA 4KIKB 4MM3A 2N9EB 1E0ZA 3VRBB 3VR8B 1TGZB 3EHVA 2NBVB 3OAWA 3U52E 1C76A 4XGAB 1B1ZA 4ACFA 1ZP0B 5HG2A 3AE9B 3P1MA 2ZW0A 2WX0A 4ANUA 3ZJUA 1OEYA 2G3QB 4GU2A 1ZE3D 3M62B 3A1QA 3EFUA 4RFBA 3E56A 2BKRB 3SFDB 3A4RA 2A5UA 3NJTA 3BVZA 3NVWA 4K7SA 4ANVA 2JYTA 1GG3A 1J0GA 4HDQA 3HK0A 3PO0A 1C79A 4UDUC 3R7RA 5G2NA 2PJHA 2AL6A 2INNE 4AWJA 2ZJDA 3M63B 4DBGA 1G6JA 3AE3B 4MEMA 1D5XC 2IO2B 3DBRI 3VHTC 3J9CA 4AS1A 2W3RA 2AYOB 4ZHOA 2H89B 2NS5A 4RMAA 1RLFA 1I4GA 4JL9A 3B08A 3Q8CA 1QOFA 3ML9A 2XBBC 4HRSA 1GB1A 2ZVNA 1L0YB 4OZBA 5E6NA 3PPAA 2GBKA 1YIWA 3Q2AC 2IO3B 1FD6A 4DHZE 2LGSA 4BBNC 2QHOA 4BAXA 2WXNA 1PQSA 1P9DU 1WXMA 4ICUA 3N9YC 4YSXB 3RYTA 3TIXA 1UELA 4A55A 1IP9A 2JZZA 2WXQA 2G1EA 1E7UA 1JWAD 1QILA 1QF6A 1JQ4A 2DZJA 2KDMA 4XC2A 3RCZA 1PGXA 4II2B 1WMHB 1QT9A 2H88B 1MI0A 3U2SC 1AYFA 1XT9B 1QQRA 2Z8LA 1JROA 2K39A 2NMQA 3W9CB 3R2IA 3LJ3A 3L13A 3ZO5B 2AQ3B 2J0JA 5C3JB 2NTSA 4BZAA 4GB9A 2K8HA 5C23A 3P2BA 4XX5A 2MQJA 2E3TA 3NHEB 4M00A 1ZOYB 3H9DA 4M01A 4IM0A 3AMZA 2K1FA 3Q3NC 2GBRA 3RNGC 3ZLZA 1M4VA 2I38A 3KWLA 1A5RA 4H2AA 3NY5A 4OVVA 1SIJA 1FMAD 2WNMA 2WXOA 1W6VA 1T6BX 2MH7A 1YQBA 3H7PB 3T3NA 4HXDA 3I57A 2AEHA 2WXJA 4EUTA 2RSUA 3DVNU 2LUMA 3X0WA 1N60A 2BQQA 3WAMA 3TMPB 3DBHI 1R4NI 4PT5A 2D11A 2PMVA 2R61A 2JRHA 1EUVB 2BWES 3TL5A 2REXA 5BMHA 4XWWA 4B95A 3GZNB 3AEDB 1YNTE 2IO1B 1I42A 1PGBA 2W3SA 5D6JB 1VDVA 1J7CA 1WFYA 2JPHA 1LGRA 1SE2A 3HM6X 2WS3B 2KLGA 2CHWA 3APDA 1E90A 4HK2A 1GUAB 2W55A 4HCNB 4WQOB 2L3ZA 4YTMB 4LNOA 3ZJTA 3UI3A 2DLBA 1WX9A 1MJDA 2GBNA 3LYYA 1K52A 4L23A 1NI3A 3R7QA 3RFZB 3URYA 1WJNA 3AE7B 1F2RI 3IFWB 3IAM1 1ET9A 5DCNA 4IC7B 3PRMB 1L0XB 2WXFA 3SDLC 1WGKA 1MVKA 2Y3AA 2LGDA 3RT3B 2JQRB 4ZRJA 4MM3B 1A70A 1TJEA 4MH8A 2MRPA 4GSWA 2PKOA 3H6NA 2I2YA 3KUZA 2KAJA 4WWMA 1M94A 3NZUA 1CMXB 1ZW7A 1AARA 1I4PA 1SE4A 4BFRA 1ISNA 2KZRA 3A1QB 1SSNA 2HTME 2OHFA 4A3PA 1LM8B 2ZEQA 3VAWA 2DYOA 2N4FA 4MGKE 1SF0A 2LZ6A 2BS3B 3V60A 2N7EA 2DZMA 4QAYA 2V4IB 3SFEB 2ZPYA 1TY0A 2QEJC 4WJQA 1LQBA 3L0WB 2DNFA 1E7PB 1V8CA 5HKHA 4MDKE 3QA8A 1FIQA 5FKAC 4K3BA 4YL8A 2L00B 4KSKC 2J0MA 1FM0D 1UGMA 1UZXB 3JSVA 4RH6A 1N61A 3Q8EA 4FN2A 1TKEA 4I6PA 1WGDA 4EZLA 2B3AA 4ARCA 3HIZA 5G5HA 1Y8RC 2EMTA 1FXAA 1GPXA 1ZDVA 2HE7A 4WIPA 4GXBA 2WGSA 1V5OA 1T0QC 2LGYA 4WURA 1HXYD 3DDCB 3A9JA 1NI2A 1QLBB 4MGIE 4C80A 1JWSD 3FKYA 3ZDMC 3QWZB 1UH6A 4XZ4A 2WXHA 2WHIA 3K9OB 1TKGA 3NS8A 2OEDA 2IPKD 4XYCA 3BYTB 4GGQA 2RDHA 1WY8A 1KRHA 2N9XA 2WDVB 2KANA 3SU8X 5LNK1 4OZAA 1V1PA 3AEEB 5BMGA 3RN9C 4KGTA 1P98A 4DHJB 2KWUB 3DBLB 2CU3A 4GOCA 3N1YC 3PLUA 1CQVA 4F1SA 1E10A 1D5MC 1RAXA 3L17A 1BMLC 4IM2A 4HLEA 4JWUC 3B9JA 4NJ7A 2RDBC 3OLMD 5HI1A 4LJPB 4FBJB 3AEBB 3C0RB 4GDLA 3KLSX 2KT7A 2A4ZA 3PHWB 1R4MI 2ACZB 4Q2JA 2UWQA 2LUEA 4IG7B 4EFOA 1HTQA 4KDLB 4YT0B 4FJVB 1E6EB 1RYJA 2HTHA 2MWSB 5D2MB 1PGAA 1ZPSA 2BWFA 3RNAC 1Q5WB 1GAQB 4XDCA 4DXFA 2UU7A 1SGHA 1WGGA 3ZXRA 2LXCA 5E6OA 2C7MB 2E6XA 3DVGX 5EE0A 2TSSA 3AI5A 5FR6A 4IUMB 5LLIA 2R2QA 3V61A 4EE2A 1L4ZB 4KGSA 2KWVB 4ASWC 2CR5A 3DHGC 3AN1A 3NOBA 1RWSA 4IWQA 2JF5A 3Q8AA 2PLPA 5H8YE 4N58A 4II3B 4PS3A 2WDQB 2PPHA 1K8RB 3VDZA 1AN8A 1IYFA 1V97A 2LHEA 2AL3A 3BY4B 3I9V1 2MJ3A 3D32A 1P7EA 5IAAC 3EA6A 2KMAA 1OTRB 2DHZA 1XXGA 1YN3A 2AWTA 3WIMA 2L83A 2BB5A 2BF8B 1FRDA 3VTUA 2N0SB 4ZDVA 2L7RA 1WZ3A 1KTKA 1WRIA 1XEEA 2MSED 1V6EA 1WSPA 1J7BA 1KF6B 3R8BA 1ENFA 2QDFA 1I4QA 3U7DA 5AZFA 1N63A 1GNUA 3APFA 2L0TA 3AU5A 3W2DA 2D07B 2FCQA 2LXAA 5IN7A 3RNFC 2KDEB 3AB5A 3DWMA 1GOZA 1JWBD 2K9XA 1Q10A 2N1VA 2N9LA 2ZZPB 3B2FA 4WWPA 1XLOA 5C1ZA 1R7SA 2VZKB 2MBBB 3QARA 4HCPB 2LRWA 1T3QA 2JWUA 2XK5A 4DK5A 2RR9A 1NDDA 3PZ8A 3AEGB 2WQYB 5AUKA 1BXTA 3ZDTA 3ZXVA 1WWTA 2LGXA 3DWGC 3V05A 2L1AA 1PUTA 1DOIA 3TJPA 1WR6E 2Y5BB 3EFCA 3I63C 3JSVB 2NCNA 4WH4A 1LXDA 2IO0B 5KHOA 3KWVA 2Z0EB 1EU3A 1SJHD 4R3DA 4EKUA 1IPGA 1MG8A 4CO7A 1WE6A 4A9AA 4PYUA 1LFDA 3AU4A 4YSYB 4P16A 2BTEA 3AE2B 3AECB 1WM3A 3PREA 1XCTL 2FCMA 1KLVA 3A9JB 2IZVB 3N1XC 4FXCA 1TT5B 4MGZE 3ZUNA 4G3XB 4M0WA 3H7SA 1IUEA 3OJ4B 3AV8A 4GDKA 4NNJB 2WXLA 1SE3A 1FRRA 3MJWA 2CHZA 3EECA 3GP7A 2IJ0A 1QOGA 2WWZA 2AQ2B 3BVGA 1V1PB 3W1SA 3A33B 3FILA 3HM3A 2YLMA 4M8NA 4WWOA 2KFKA 3C8YA 4YXDB 2BS4B 2MEKA 1CZPA 2XN9C 2FUHB 2G4DB 1WXVA 3IBEA 3V62A 5LXIB 4NZLB 4YWGG 1P1AA 2O6VA 2IDYA 2KTFA 1VRAB 1B9RA 1MFWA 3L10B 1UWXA 3ZRCA 4TMAB 1PFDA 2G4SA 1YN4A 4GDLB 1V1OA 4JLCA 3NZSA 2K25A 3HRDD 3W5UB 2N9KA 4RGTA 4NAMA 2BW2A 4IDIA 2LMCA 3K9PB 2KXJA 1TIFA 3VH3B 1IBXA 2MBHA 4W9GA 1YOVB 4HEA1 1EO6A 2M4NA 1OQRA 2JWZA 1KJTA 4O1NA 2VZKD 3ZVVA 2IY0B 3GE3C 2D5GA 3GOEA 2KDIA 1JWUD 4ANXA 2M56B 3Q3OC 4W9HA 1XD3B 3O65B 2BPSA 4W9JA 2KJRA 4W9LA 1E8YA 4BBNF 3MC8A 1AW7A 4HROA 5BYSA 3WALA 1C9FA 5BYQA 3GZNI 1XQQA 2KN5A 1JRPA 1FXIA 1F52A 5CTRC 1WXQA 2EELA 3GE8C 3UQBA 1P3QU 3B1LX 2DAJA 1TZOA 3ETRA 4KGRA 1P7FA 1XLPA 4HDOA 3R3MA 1OEYJ 4URKA 3VUWA 4JQWC 2K0PA 1VZ6A 2C5LC 2MX2A 1TY2A 2L0FA 1ZXHA 1SEBD 1V86A 1KLGD 4YTPB 4WAFA 2J42A 2JSVX 3OWEB 2WXKA 4TV3A 3WAPA 3ENEA 4E74A 4FADA 3GS2A 1E9MA 5CX3A 2QMTA 3A9KA 2GBMA 3IVFA 2D2QA 4RGNA 2SAKA 5GMVA 2N1WA 2V3PA 2IYDB 2JRIB 5G5GA 2XK5B 4IKGA 1I4XA 1GB4A 2KOXA 2ONQA 1N6ZA 3QX1A 4LNIA 1VR9A 4DWFA 5H92C 3QAQA 2MBQA 1Z2MA 4WJOA 1NYQA 1QKZA 2FCSA 1D5ZC 4ZYNA 2LD9A 3MC0B 4B0EA 4YSZB 3RZFA 4NAWA 4S0RA 1C4PA 1NEKB 1YX6B 2PVOD 2IGHA 2GB1A 1FFVA 1J7AA 3P4QB 2MJDA 4WWNA 3P4SB 2QSDA 1E8WA 2CU1A 2KVRA 1F77A 2DWQA 1TZ1A 2K3UA 3B0AA 3ZKJC 2OOBB 4KZ0A 5L95C 3VR9B 2KJ6A 2LVOA 4XDDA 1Q0WB 4M0WB 2Y5CA 1ZGUB 3ZJVA 3TCAA 3WCQA 3Q8BA 1OFFA 4GDKB 1V80A 3ECIA 1N62A 4KKJA 5DPSA 3VRAB 3Q6BA 2D3GA 1JALA 1NYRA 1TS2A 2CKHB 3V6EB 5BMIA 2KK8A 1L6UA 4PK1A 2XNAC 1UBIA 4BOZB 1C77A 4DDID 1F9JA 2LJ5A 3BINA 3NVYA 3FILB 2MBOA 1WGRA 2KNBA 1WXAA 2KFKB 3WAOA 2LVPA 1CK1A 3CIRB 4S17A 5DPTA 1UNSA 2ICIA 1YQ3B 2QIEB 2RMMA 2WXRA 2J0KA 2C7HA 2O6VB 4GMVA 3L16A 3KUCB 4BVUC 4JWSC 3JVZX 1EWYC 5JHAA 4MELA 2WDTB 2X8XX 3DBLI 2NPTA 4I6NB 1MG4A 2KHWB 2BYTA 4MT5A 1F2RC 1ESFA 2QILA 4TUUA 3V3XA 1RFAA 3NS1A 4TQ0A 3QHTA 3OG5A 2LRUA 4RM8A 5LXHA 4DQOC 4L2YA 1FFUA 1HZ6A 1IBXB 4P7IA 1L4DB 3PRPB 1SBBB 2K22A 2WXGA 4K7UA 3RZWC
chains in the Genus database with same CATH topology
5D7GA 2ZCBA 2LI5A 4K81A 2MA9B 1GNUA 2BYEA 3ML9A 2XBBC 3Q3FA 1E7VA 4W9CA 2BYFA 3APFA 2DX5B 2ZVNA 2L0TA 2CS4A 5E6NA 3AU5A 3PPAA 2GBKA 1YIWA 3ZNGC 2IO3B 2D07B 2FCQA 2LXAA 2C7NB 4DHZE 2KDEB 5JHBA 2Z59B 3CSFA 4BBNC 5BO4B 3QQ8B 2KC1A 3UQAA 2QHOA 1C3TA 4BKGA 2WX1A 4FHJA 3I3TB 1PQSA 1P9DU 1WXMA 2EKEC 2N1VA 2ZZPB 4WWPA 4ICUA 5C1ZA 4LCDE 4G0NB 2FIDA 3N30A 3RYTA 3TIXA 3Q3JA 2MCNB 1UELA 2MBBB 1V5TA 1IP9A 2GOWA 2DYBA 2JZZA 3QARA 1E7UA 2KLCA 4HCPB 2LRWA 4AJYB 1V2YA 2XK5A 5DPRA 2RR9A 4DK5A 4EOYA 1NDDA 2DZJA 4XC2A 3RCZA 1V81A 3ZDTA 3CF6E 4II2B 1WMHB 2LGXA 3KYDD 1WM2A 1XT9B 2FIFA 3ZTDA 3ZRFA 4A3OA 5TR5A 2L05A 3TJPA 3WANA 1WR6E 2MP2A 2Y5BB 4EZJA 2K39A 1WE7A 2HJ8A 4RM9A 4ICVA 3JSVB 2NCNA 3LJ3A 5KHQA 1LXDA 2NBWB 2IO0B 3VTWA 3PHXB 3L13A 3QJZA 5KHOA 2M0XA 3ZO5B 2C60A 4M8MA 2Z0EB 2J0JA 4EKUA 5J18A 2OJRA 2MW5A 4NY0A 1IPGA 2FNJB 1MG8A 4GB9A 3RD2A 2K8HA 3VXWA 1WE6A 1WYWB 4J6IA 2KC2A 3UIPB 5C23A 4CO7A 2KTRA 3P2BA 4XX5A 2MQJA 4DXAB 3NHEB 3PLVA 4GN1A 4PYUA 1LFDA 3H9DA 3AU4A 4IM0A 1SE9A 2K6DB 2ASQA 4FLHA 1X1MA 1WM3A 3PREA 1YX5B 2K1FA 1TBEA 2GBRA 3T9LA 2R2OA 3ZLZA 2FCMA 4DHZB 1A5RA 3UF8A 3NY5A 1KLVA 1WZ0A 3A9KB 4OVVA 2L8JA 3A9JB 4FULA 5G55A 2IZVB 1W6VA 2LVQA 2M8SA 3H7PB 1YQBA 4MGZE 3L54A 2PE6B 3ZUNA 2M1MA 4G3XB 4HXDA 4IWPA 4KZCA 4KSLC 2AEHA 3H7SA 4EUTA 2RSUA 1Z5SB 4EZKA 3DVNU 3DBSA 3OJ4B 4GDKA 4NNJB 3X0WA 4LJOB 4BKSD 3OJ3A 1WIAA 5EDSA 2N7DA 3MJWA 3WAMA 3DQVA 2O6VD 3DBHI 2CHZA 3TMPB 1R4NI 1YJ1A 2D11A 1L2NA 2JRHA 3EECA 1EUVB 1VD2A 4FJYA 2WWZA 2BWES 3AULA 3W1SA 3TL5A 2REXA 3A33B 4KIKA 2PE9A 3HM3A 4MSMB 2YLMA 4M8NA 2KMCA 4B95A 3VUXA 1P0RA 3IG3A 4WWOA 2BYVE 2KFKA 3W1YA 2JT4B 2ZNVB 4FHKA 3W1SC 1KOTA 2IO1B 1I42A 2IBIB 4WJPA 4NQLB 1EF1A 2FAZA 2O2VB 5D6JB 3APCA 2FUHB 4NAWB 3PSEB 2G4DB 4WAAA 1WXVA 3IBEA 3V62A 4BKSA 1WJ6A 2NVUI 4BOSC 3H1UA 1WFYA 2JPHA 5LXIB 4A20A 3HM6X 1P1AA 2KLGA 2CHWA 2O6VA 3APDA 5DPWA 1E90A 4HK2A 4W9DA 3DVNV 1GUAB 3ZW3A 2KTFA 4HCNB 4WQOB 5CHFA 1UD7A 4EEWA 2C9WB 2L3ZA 5CHWA 4MJSB 3L10B 3L08A 3R66C 5AZGA 3ZRCA 1WX9A 2JXXA 2GBNA 3WA0A 2G4SA 1T0YA 4GDLB 4JGHB 4JLCA 3RUIB 2ZVOA 3NZSA 3R7QA 2DENB 2K25A 3KW5B 4LDTB 5J2RA 4I6LB 3KVFB 1WJNA 1QZEA 4TQ1A 4W9EA 3IFWB 2JUOA 4MSQB 4AUQC 5DCNA 3ZNID 3M3JA 3DVGY 4G11A 3K9PB 4IC7B 1D3ZA 4DHJD 2KXJA 3PRMB 4OVUA 3SDLC 3UINB 4HWIB 3VH3B 3PZDA 4W9KA 2MBHA 4W9GA 1EO6A 2LGDA 3RT3B 1NBFC 2KDBA 2M4NA 2JWZA 4HJKA 1KJTA 3ALBA 1OGWA 4ZRJA 2KQSA 2J7QB 3U30A 3ZVVA 2DZIA 2IY0B 3ZTCA 3AXCA 3GOEA 2IY1B 2KDIA 2MRPA 4ANXA 4WJNA 4GSWA 4K7WA 4W9HA 1XD3B 3H6NA 2D10A 3O65B 3KUZA 3VVWB 2BPSA 4K1RB 4W9JA 4CHKA 2V3SA 2KJRA 4W9LA 1E8YA 4BBNF 4DDGD 1M94A 3U8ZA 3NZUA 3PVLA 1I35A 1CMXB 2CHXA 1ZW7A 1WGYA 3UGBB 3WALA 4B6WA 1AARA 3GZNI 1ISNA 2KZRA 2WYQA 3A1QB 4BFRA 4W9IA 1J8CA 3PV1A 2HD5B 4A3PA 1XQQA 3PGEA 2KN5A 2GBJA 1E8XA 1L7YA 3IHPC 3S2AA 5JZEB 1LM8B 2ZEQA 3VAWA 4IW0A 2DYOA 2N4FA 4IWOA 3KH0A 1FXTB 4MGKE 5CTRC 2LZ6A 2FCNA 2NPTB 4E71A 3SHQA 1WX8A 2N7EA 3V60A 2DZMA 3UQBA 4X57B 1P3QU 3B1LX 4AP4C 2DAJA 2ZPYA 3QC8B 4WJQA 1LQBA 2G45B 3L0WB 2VRRB 1E8ZA 4GIVA 4BKTA 1GJZA 1WMHA 3DOWA 3PRZA 1JRUA 3VH4B 3M95A 3ZNHB 3ZNZB 1WX7A 2V4LA 3DCGA 5HKHA 3VQIA 3ML8A 4HDOA 4MDKE 3QA8A 2KO3A 3R3MA 1OEYJ 4YL8A 4URKA 2L00B 4KSKC 2J0MA 2V1YA 1UGMA 1UZXB 3JSVA 2RD0A 2Z0DB 1H4RA 2DZKA 2RGFA 4G50A 4JQWC 4W9FA 3SD5A 3VUWA 2C5LC 2MX2A 4FN2A 4I6PA 1C1YB 3A4SC 2L0FA 1WGDA 4EZLA 2B3AA 2PEAA 1V86A 3HIZA 1WRDB 2ZCCA 1WH3A 2K8BA 1WGHA 2W9NA 3VUYA 1Y8RC 2EMTA 4F8CB 1WXSA 2HE7A 3T8MA 3V6CB 1Q1OA 4TV3A 3WAPA 3ENEA 5L83A 2DAFA 4E74A 1V9JA 4FADA 2KDFB 4GXBA 5AZHA 1BT0A 1V5OA 2LGYA 4FJZA 1GC6A 1WR1A 5CX3A 3MHSD 3ONSA 3A9KA 2GBMA 3DDCB 2KD0A 3A9JA 4TKNA 3H7PA 3IVFA 1NI2A 4HPLB 2D2QA 4MGIE 5GMVA 2N1WA 2XEWA 3ZDMC 3QWZB 2I1KA 2IYDB 3MTNB 1UH6A 2JRIB 4XZ4A 2XK5B 3K9OB 2KOXA 3NS8A 1U4AA 4MH0E 4GGQA 3QX1A 2UYZB 2K6QA 1E5WA 1WY8A 4DWFA 2N9XA 4JL9A 2KANA 1VCBA 3LMNA 3SU8X 2KX0A 3QAQA 2NBUA 2MBQA 2MP2B 4ZRIA 4HVBA 1Z2MA 3JYUA 4WJOA 3CMMB 4AJWA 3VFKA 2FCSA 4ZYNA 1GC7A 2LD9A 1P98A 4KVGB 4ANWA 4DHJB 3ZIMA 1HE8A 4LDTD 3RZFA 1SIFA 2KWUB 2N9PC 2O2VA 4NAWA 3UIOB 3PS6A 2ZNVC 1ZKHA 4B9KA 2KTRB 2JY6A 4KDIC 1YX6B 3QK0A 2I1JA 1RRBA 4GOCA 1EF5A 3PLUA 4F1SA 2GMIC 4IM3A 4AOFA 3DPDA 1RAXA 3L17A 2MLBA 5D94A 3KYCD 2KJHB 4MJSA 4WWNA 4IM2A 4HLEA 4N9F4 4NJ7A 4MGYE 1E8WA 2CU1A 3OLMD 1WI0A 2JVCA 2KVRA 4LJPB 4FBJB 4FA6A 3LDZE 3C0RB 1J19A 1TZ1A 3B0AA 4GDLA 5CHVC 2OOBB 3PHWB 2A4ZA 4KZ0A 1R4MI 5L95C 1KM7A 2KJ6A 2LVOA 2UWQA 1Q0WB 2LUEA 4IG7B 2NR2A 4M0WB 4PS7A 4EFOA 5J17A 1ZGUB 4F7ZA 4KDLB 3JW0X 3TCAA 3QCAA 1WJUA 4GDKB 5JH5C 4FJVB 2HTHA 2MWSB 3HHMA 1V80A 3ECIA 5D2MB 5DPSA 4NQKE 2BWFA 3EC8A 2KWCA 2K8CA 1Q5WB 2D3GA 3N3KB 2CKHB 3V6EB 2KK8A 1SGHA 1WGGA 4ZRKA 2MBEA 3TBLD 1UBIA 2LXCA 4JIOU 2KKCA 2C7MB 4PYZA 5E6OA 2JZ3B 4BOZB 3DVGX 3PTFC 4DDID 1F9JA 3QIJA 2LJ5A 4HPMB 3KUDB 5E6PA 3RULA 1V49A 3AI5A 4KIKB 3BINA 4MM3A 4IUMB 5FR6A 5LLIA 2N9EB 2R2QA 3V61A 3X23A 2MBOA 1WGRA 2KNBA 1WXAA 1TGZB 3EHVA 2KFKB 2NBVB 2KWVB 3OAWA 2BGFA 4ASWC 2CR5A 3WAOA 2LVPA 1S1QB 1OQYA 1H8CA 3NOBA 2BKFA 5DPTA 4IWQA 2JF5A 2WX0A 4ANUA 2KFJA 2J0KA 1OEYA 4II3B 2G3QB 4GU2A 4PS3A 2L76A 2PPHA 3M62B 2C7HA 2O6VB 1K8RB 2M17A 3A1QA 3EFUA 3L16A 3N32A 4GMVA 3KUCB 3VDZA 2BKRB 4E3CA 1TTNA 4BVUC 1IYFA 2AL3A 3JVZX 2LASA 5JHAA 3ZKJC 5AEKB 3A4RA 3BY4B 4MELA 2A5UA 4ANVA 2WDTB 4K7SA 3D32A 4NPNA 1GG3A 3DBLI 4PS8A 1J0GA 2NPTA 4I6NB 4HDQA 3HK0A 5IAAC 2DYMA 2RPQA 3VTVA 2KMAA 2ZPNA 4CYEA 2KHWB 1OTRB 2DHZA 2AWTA 3WIMA 1WF9A 1YD8U 3R7RA 2EMSA 5G2NA 2PJHA 2AL6A 4AWJA 4NJ6A 2ZJDA 4TUUA 1UBQA 3M63B 2BF8B 4DBGA 1RFAA 1WJ4A 2KX3A 4TQ0A 3VTUA 2LWPA 1G6JA 3QHTA 4MEMA 2YVCA 1S3SG 2L7RA 4ZDVA 2LRUA 1WZ3A 2IO2B 3DBRI 4KV2A 2KQ7A 4RM8A 3VHTC 5LXHA 2MSED 1V6EA 4P7IA 2AYOB 2NS5A 3CSTA 3PRPB 4RMAA 3PT2B 5IA7A 1RLFA 3U7DA 4K7UA 5AZFA 3RZWC 3B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D7G A;  2ZCB A;  2LI5 A;  4K81 A;  2MA9 B;  1GNU A;  2BYE A;  3ML9 A;  2XBB C;  3Q3F A;  1E7V A;  4W9C A;  2BYF A;  3APF A;  2DX5 B;  2ZVN A;  2L0T A;  2CS4 A;  5E6N A;  3AU5 A;  3PPA A;  2GBK A;  1YIW A;  3ZNG C;  2IO3 B;  2D07 B;  2FCQ A;  2LXA A;  2C7N B;  4DHZ E;  2KDE B;  5JHB A;  2Z59 B;  3CSF A;  4BBN C;  5BO4 B;  3QQ8 B;  2KC1 A;  3UQA A;  2QHO A;  1C3T A;  4BKG A;  2WX1 A;  4FHJ A;  3I3T B;  1PQS A;  1P9D U;  1WXM A;  2EKE C;  2N1V A;  2ZZP B;  4WWP A;  4ICU A;  5C1Z A;  4LCD E;  4G0N B;  2FID A;  3N30 A;  3RYT A;  3TIX A;  3Q3J A;  2MCN B;  1UEL A;  2MBB B;  1V5T A;  1IP9 A;  2GOW A;  2DYB A;  2JZZ A;  3QAR A;  1E7U A;  2KLC A;  4HCP B;  2LRW A;  4AJY B;  1V2Y A;  2XK5 A;  5DPR A;  2RR9 A;  4DK5 A;  4EOY A;  1NDD A;  2DZJ A;  4XC2 A;  3RCZ A;  1V81 A;  3ZDT A;  3CF6 E;  4II2 B;  1WMH B;  2LGX A;  3KYD D;  1WM2 A;  1XT9 B;  2FIF A;  3ZTD A;  3ZRF A;  4A3O A;  5TR5 A;  2L05 A;  3TJP A;  3WAN A;  1WR6 E;  2MP2 A;  2Y5B B;  4EZJ A;  2K39 A;  1WE7 A;  2HJ8 A;  4RM9 A;  4ICV A;  3JSV B;  2NCN A;  3LJ3 A;  5KHQ A;  1LXD A;  2NBW B;  2IO0 B;  3VTW A;  3PHX B;  3L13 A;  3QJZ A;  5KHO A;  2M0X A;  3ZO5 B;  2C60 A;  4M8M A;  2Z0E B;  2J0J A;  4EKU A;  5J18 A;  2OJR A;  2MW5 A;  4NY0 A;  1IPG A;  2FNJ B;  1MG8 A;  4GB9 A;  3RD2 A;  2K8H A;  3VXW A;  1WE6 A;  1WYW B;  4J6I A;  2KC2 A;  3UIP B;  5C23 A;  4CO7 A;  2KTR A;  3P2B A;  4XX5 A;  2MQJ A;  4DXA B;  3NHE B;  3PLV A;  4GN1 A;  4PYU A;  1LFD A;  3H9D A;  3AU4 A;  4IM0 A;  1SE9 A;  2K6D B;  2ASQ A;  4FLH A;  1X1M A;  1WM3 A;  3PRE A;  1YX5 B;  2K1F A;  1TBE A;  2GBR A;  3T9L A;  2R2O A;  3ZLZ A;  2FCM A;  4DHZ B;  1A5R A;  3UF8 A;  3NY5 A;  1KLV A;  1WZ0 A;  3A9K B;  4OVV A;  2L8J A;  3A9J B;  4FUL A;  5G55 A;  2IZV B;  1W6V A;  2LVQ A;  2M8S A;  3H7P B;  1YQB A;  4MGZ E;  3L54 A;  2PE6 B;  3ZUN A;  2M1M A;  4G3X B;  4HXD A;  4IWP A;  4KZC A;  4KSL C;  2AEH A;  3H7S A;  4EUT A;  2RSU A;  1Z5S B;  4EZK A;  3DVN U;  3DBS A;  3OJ4 B;  4GDK A;  4NNJ B;  3X0W A;  4LJO B;  4BKS D;  3OJ3 A;  1WIA A;  5EDS A;  2N7D A;  3MJW A;  3WAM A;  3DQV A;  2O6V D;  3DBH I;  2CHZ A;  3TMP B;  1R4N I;  1YJ1 A;  2D11 A;  1L2N A;  2JRH A;  3EEC A;  1EUV B;  1VD2 A;  4FJY A;  2WWZ A;  2BWE S;  3AUL A;  3W1S A;  3TL5 A;  2REX A;  3A33 B;  4KIK A;  2PE9 A;  3HM3 A;  4MSM B;  2YLM A;  4M8N A;  2KMC A;  4B95 A;  3VUX A;  1P0R A;  3IG3 A;  4WWO A;  2BYV E;  2KFK A;  3W1Y A;  2JT4 B;  2ZNV B;  4FHK A;  3W1S C;  1KOT A;  2IO1 B;  1I42 A;  2IBI B;  4WJP A;  4NQL B;  1EF1 A;  2FAZ A;  2O2V B;  5D6J B;  3APC A;  2FUH B;  4NAW B;  3PSE B;  2G4D B;  4WAA A;  1WXV A;  3IBE A;  3V62 A;  4BKS A;  1WJ6 A;  2NVU I;  4BOS C;  3H1U A;  1WFY A;  2JPH A;  5LXI B;  4A20 A;  3HM6 X;  1P1A A;  2KLG A;  2CHW A;  2O6V A;  3APD A;  5DPW A;  1E90 A;  4HK2 A;  4W9D A;  3DVN V;  1GUA B;  3ZW3 A;  2KTF A;  4HCN B;  4WQO B;  5CHF A;  1UD7 A;  4EEW A;  2C9W B;  2L3Z A;  5CHW A;  4MJS B;  3L10 B;  3L08 A;  3R66 C;  5AZG A;  3ZRC A;  1WX9 A;  2JXX A;  2GBN A;  3WA0 A;  2G4S A;  1T0Y A;  4GDL B;  4JGH B;  4JLC A;  3RUI B;  2ZVO A;  3NZS A;  3R7Q A;  2DEN B;  2K25 A;  3KW5 B;  4LDT B;  5J2R A;  4I6L B;  3KVF B;  1WJN A;  1QZE A;  4TQ1 A;  4W9E A;  3IFW B;  2JUO A;  4MSQ B;  4AUQ C;  5DCN A;  3ZNI D;  3M3J A;  3DVG Y;  4G11 A;  3K9P B;  4IC7 B;  1D3Z A;  4DHJ D;  2KXJ A;  3PRM B;  4OVU A;  3SDL C;  3UIN B;  4HWI B;  3VH3 B;  3PZD A;  4W9K A;  2MBH A;  4W9G A;  1EO6 A;  2LGD A;  3RT3 B;  1NBF C;  2KDB A;  2M4N A;  2JWZ A;  4HJK A;  1KJT A;  3ALB A;  1OGW A;  4ZRJ A;  2KQS A;  2J7Q B;  3U30 A;  3ZVV A;  2DZI A;  2IY0 B;  3ZTC A;  3AXC A;  3GOE A;  2IY1 B;  2KDI A;  2MRP A;  4ANX A;  4WJN A;  4GSW A;  4K7W A;  4W9H A;  1XD3 B;  3H6N A;  2D10 A;  3O65 B;  3KUZ A;  3VVW B;  2BPS A;  4K1R B;  4W9J A;  4CHK A;  2V3S A;  2KJR A;  4W9L A;  1E8Y A;  4BBN F;  4DDG D;  1M94 A;  3U8Z A;  3NZU A;  3PVL A;  1I35 A;  1CMX B;  2CHX A;  1ZW7 A;  1WGY A;  3UGB B;  3WAL A;  4B6W A;  1AAR A;  3GZN I;  1ISN A;  2KZR A;  2WYQ A;  3A1Q B;  4BFR A;  4W9I A;  1J8C A;  3PV1 A;  2HD5 B;  4A3P A;  1XQQ A;  3PGE A;  2KN5 A;  2GBJ A;  1E8X A;  1L7Y A;  3IHP C;  3S2A A;  5JZE B;  1LM8 B;  2ZEQ A;  3VAW A;  4IW0 A;  2DYO A;  2N4F A;  4IWO A;  3KH0 A;  1FXT B;  4MGK E;  5CTR C;  2LZ6 A;  2FCN A;  2NPT B;  4E71 A;  3SHQ A;  1WX8 A;  2N7E A;  3V60 A;  2DZM A;  3UQB A;  4X57 B;  1P3Q U;  3B1L X;  4AP4 C;  2DAJ A;  2ZPY A;  3QC8 B;  4WJQ A;  1LQB A;  2G45 B;  3L0W B;  2VRR B;  1E8Z A;  4GIV A;  4BKT A;  1GJZ A;  1WMH A;  3DOW A;  3PRZ A;  1JRU A;  3VH4 B;  3M95 A;  3ZNH B;  3ZNZ B;  1WX7 A;  2V4L A;  3DCG A;  5HKH A;  3VQI A;  3ML8 A;  4HDO A;  4MDK E;  3QA8 A;  2KO3 A;  3R3M A;  1OEY J;  4YL8 A;  4URK A;  2L00 B;  4KSK C;  2J0M A;  2V1Y A;  1UGM A;  1UZX B;  3JSV A;  2RD0 A;  2Z0D B;  1H4R A;  2DZK A;  2RGF A;  4G50 A;  4JQW C;  4W9F A;  3SD5 A;  3VUW A;  2C5L C;  2MX2 A;  4FN2 A;  4I6P A;  1C1Y B;  3A4S C;  2L0F A;  1WGD A;  4EZL A;  2B3A A;  2PEA A;  1V86 A;  3HIZ A;  1WRD B;  2ZCC A;  1WH3 A;  2K8B A;  1WGH A;  2W9N A;  3VUY A;  1Y8R C;  2EMT A;  4F8C B;  1WXS A;  2HE7 A;  3T8M A;  3V6C B;  1Q1O A;  4TV3 A;  3WAP A;  3ENE A;  5L83 A;  2DAF A;  4E74 A;  1V9J A;  4FAD A;  2KDF B;  4GXB A;  5AZH A;  1BT0 A;  1V5O A;  2LGY A;  4FJZ A;  1GC6 A;  1WR1 A;  5CX3 A;  3MHS D;  3ONS A;  3A9K A;  2GBM A;  3DDC B;  2KD0 A;  3A9J A;  4TKN A;  3H7P A;  3IVF A;  1NI2 A;  4HPL B;  2D2Q A;  4MGI E;  5GMV A;  2N1W A;  2XEW A;  3ZDM C;  3QWZ B;  2I1K A;  2IYD B;  3MTN B;  1UH6 A;  2JRI B;  4XZ4 A;  2XK5 B;  3K9O B;  2KOX A;  3NS8 A;  1U4A A;  4MH0 E;  4GGQ A;  3QX1 A;  2UYZ B;  2K6Q A;  1E5W A;  1WY8 A;  4DWF A;  2N9X A;  4JL9 A;  2KAN A;  1VCB A;  3LMN A;  3SU8 X;  2KX0 A;  3QAQ A;  2NBU A;  2MBQ A;  2MP2 B;  4ZRI A;  4HVB A;  1Z2M A;  3JYU A;  4WJO A;  3CMM B;  4AJW A;  3VFK A;  2FCS A;  4ZYN A;  1GC7 A;  2LD9 A;  1P98 A;  4KVG B;  4ANW A;  4DHJ B;  3ZIM A;  1HE8 A;  4LDT D;  3RZF A;  1SIF A;  2KWU B;  2N9P C;  2O2V A;  4NAW A;  3UIO B;  3PS6 A;  2ZNV C;  1ZKH A;  4B9K A;  2KTR B;  2JY6 A;  4KDI C;  1YX6 B;  3QK0 A;  2I1J A;  1RRB A;  4GOC A;  1EF5 A;  3PLU A;  4F1S A;  2GMI C;  4IM3 A;  4AOF A;  3DPD A;  1RAX A;  3L17 A;  2MLB A;  5D94 A;  3KYC D;  2KJH B;  4MJS A;  4WWN A;  4IM2 A;  4HLE A;  4N9F 4;  4NJ7 A;  4MGY E;  1E8W A;  2CU1 A;  3OLM D;  1WI0 A;  2JVC A;  2KVR A;  4LJP B;  4FBJ B;  4FA6 A;  3LDZ E;  3C0R B;  1J19 A;  1TZ1 A;  3B0A A;  4GDL A;  5CHV C;  2OOB B;  3PHW B;  2A4Z A;  4KZ0 A;  1R4M I;  5L95 C;  1KM7 A;  2KJ6 A;  2LVO A;  2UWQ A;  1Q0W B;  2LUE A;  4IG7 B;  2NR2 A;  4M0W B;  4PS7 A;  4EFO A;  5J17 A;  1ZGU B;  4F7Z A;  4KDL B;  3JW0 X;  3TCA A;  3QCA A;  1WJU A;  4GDK B;  5JH5 C;  4FJV B;  2HTH A;  2MWS B;  3HHM A;  1V80 A;  3ECI A;  5D2M B;  5DPS A;  4NQK E;  2BWF A;  3EC8 A;  2KWC A;  2K8C A;  1Q5W B;  2D3G A;  3N3K B;  2CKH B;  3V6E B;  2KK8 A;  1SGH A;  1WGG A;  4ZRK A;  2MBE A;  3TBL D;  1UBI A;  2LXC A;  4JIO U;  2KKC A;  2C7M B;  4PYZ A;  5E6O A;  2JZ3 B;  4BOZ B;  3DVG X;  3PTF C;  4DDI D;  1F9J A;  3QIJ A;  2LJ5 A;  4HPM B;  3KUD B;  5E6P A;  3RUL A;  1V49 A;  3AI5 A;  4KIK B;  3BIN A;  4MM3 A;  4IUM B;  5FR6 A;  5LLI A;  2N9E B;  2R2Q A;  3V61 A;  3X23 A;  2MBO A;  1WGR A;  2KNB A;  1WXA A;  1TGZ B;  3EHV A;  2KFK B;  2NBV B;  2KWV B;  3OAW A;  2BGF A;  4ASW C;  2CR5 A;  3WAO A;  2LVP A;  1S1Q B;  1OQY A;  1H8C A;  3NOB A;  2BKF A;  5DPT A;  4IWQ A;  2JF5 A;  2WX0 A;  4ANU A;  2KFJ A;  2J0K A;  1OEY A;  4II3 B;  2G3Q B;  4GU2 A;  4PS3 A;  2L76 A;  2PPH A;  3M62 B;  2C7H A;  2O6V B;  1K8R B;  2M17 A;  3A1Q A;  3EFU A;  3L16 A;  3N32 A;  4GMV A;  3KUC B;  3VDZ A;  2BKR B;  4E3C A;  1TTN A;  4BVU C;  1IYF A;  2AL3 A;  3JVZ X;  2LAS A;  5JHA A;  3ZKJ C;  5AEK B;  3A4R A;  3BY4 B;  4MEL A;  2A5U A;  4ANV A;  2WDT B;  4K7S A;  3D32 A;  4NPN A;  1GG3 A;  3DBL I;  4PS8 A;  1J0G A;  2NPT A;  4I6N B;  4HDQ A;  3HK0 A;  5IAA C;  2DYM A;  2RPQ A;  3VTV A;  2KMA A;  2ZPN A;  4CYE A;  2KHW B;  1OTR B;  2DHZ A;  2AWT A;  3WIM A;  1WF9 A;  1YD8 U;  3R7R A;  2EMS A;  5G2N A;  2PJH A;  2AL6 A;  4AWJ A;  4NJ6 A;  2ZJD A;  4TUU A;  1UBQ A;  3M63 B;  2BF8 B;  4DBG A;  1RFA A;  1WJ4 A;  2KX3 A;  4TQ0 A;  3VTU A;  2LWP A;  1G6J A;  3QHT A;  4MEM A;  2YVC A;  1S3S G;  2L7R A;  4ZDV A;  2LRU A;  1WZ3 A;  2IO2 B;  3DBR I;  4KV2 A;  2KQ7 A;  4RM8 A;  3VHT C;  5LXH A;  2MSE D;  1V6E A;  4P7I A;  2AYO B;  2NS5 A;  3CST A;  3PRP B;  4RMA A;  3PT2 B;  5IA7 A;  1RLF A;  3U7D A;  4K7U A;  5AZF A;  3RZW C;  3B08 A; 
#chains in the Genus database with same CATH topology
 1L5P A;  4K81 A;  4US9 A;  1E7V A;  2C7N B;  1DGJ A;  4RNA A;  4ZHP A;  3CSF A;  3QQ8 B;  2IGG A;  3RNB C;  1C3T A;  2WX1 A;  3AH7 A;  3I3T B;  2WXP A;  2EKE C;  3Q14 C;  3Q3J A;  3SEB A;  2BT6 A;  1UGJ A;  3NUH B;  1V5T A;  2GOW A;  2KLC A;  1V2Y A;  1K51 A;  2D3C A;  4N59 A;  1V81 A;  3O13 A;  3BYY B;  3CF6 E;  4LLG M;  1JW9 D;  5IOI A;  4IOI E;  2AQ1 B;  3KYD D;  5FK9 C;  1WM2 A;  2K5P A;  2L32 A;  3ZRF A;  4A3O A;  3RNE C;  1KH0 A;  3WAN A;  4A6Q A;  1XCQ L;  2GLS A;  1WE7 A;  2HJ8 A;  2KWD A;  1N5W A;  2NBW B;  1XLQ A;  3PHX B;  2IND C;  2MW5 A;  4NY0 A;  2JYE A;  2FNJ B;  2Y5P A;  3RD2 A;  3VXW A;  3UIP B;  2KC2 A;  4A8X C;  4WQM A;  3PLV A;  4J3O D;  3MFG A;  3AE1 B;  2ON8 A;  2ASQ A;  1T5X D;  2FBW B;  4OHJ A;  1X1M A;  3B2G A;  3T9L A;  2R2O A;  1N5X A;  1VZ8 A;  3RMK C;  2HDE A;  3A9K B;  2Q5W D;  5G55 A;  4FUL A;  4D2K A;  2M8S A;  2M1M A;  4IWP A;  3DBS A;  2VH1 A;  4LJO B;  4ZYS A;  5EDS A;  2N7D A;  1EU4 A;  3TEZ A;  2O6V D;  1YJ1 A;  4OZC A;  1VD2 A;  4HKQ A;  2HJ1 A;  2SEB D;  4MSM B;  2KMC A;  2PIA A;  1P0R A;  5IKC M;  3W1Y A;  2JT4 B;  2ZNV B;  4ZRQ A;  1KOT A;  2IBI B;  4WJP A;  4NQL B;  4NAW B;  4BKS A;  2NVU I;  3H1U A;  4A20 A;  2NTT A;  4ZOH C;  5DPW A;  4W9D A;  3DVN V;  2JX5 A;  3ZW3 A;  1UD7 A;  4EEW A;  5CHW A;  2WP9 B;  3L08 A;  3R66 C;  3WA0 A;  1T0Y A;  4JGH B;  4CQN A;  2L52 A;  2J53 A;  2DEN B;  3KW5 B;  4I6L B;  1QZE A;  4W9E A;  2JUO A;  4MSQ B;  4AUQ C;  3M3J A;  4G11 A;  3AM9 A;  1D3Z A;  4DHJ D;  4OVU A;  5AUI A;  3UIN B;  1MHH E;  2QCZ A;  4W9K A;  1NBF C;  2BS2 B;  2KDB A;  3ALB A;  3Q3M C;  1OGW A;  1DOY A;  2IY1 B;  3I5J C;  4WJN A;  2KMM A;  3AE4 B;  2D10 A;  4CHK A;  3MJ5 A;  1WYG A;  3U8Z A;  2GI9 A;  1I35 A;  5I4D A;  5MPO A;  1WGY A;  2WYQ A;  4HJG E;  1FNW A;  4W9I A;  1J8C A;  2HD5 B;  1EM7 A;  2GBJ A;  3IHP C;  3S2A A;  4AQ7 A;  4IW0 A;  4IWO A;  2B76 B;  1FXT B;  2NPT B;  3IT4 B;  4ITK A;  1WX8 A;  5C2T B;  2RDG A;  1HEZ E;  4AP4 C;  2AX5 A;  2RPV A;  2G45 B;  1ZUD 2;  2VRR B;  4GIV A;  4BKT A;  1T0R C;  3DOW A;  2YEP F;  1JRU A;  3VH4 B;  1WX7 A;  2V4L A;  3DCG A;  3ABV B;  2N7J A;  3ML8 A;  1UUP A;  2V1Y A;  1XLN A;  2RD0 A;  2Z0D B;  1KFY B;  1H4R A;  2RGF A;  3SD5 A;  4W9F A;  1DOX A;  1FCC C;  3A4S C;  2PEA A;  2KAC A;  2ZCC A;  2W9N A;  1YMH E;  1TS3 A;  5FR3 A;  1D4B A;  4F8C B;  2M0A A;  1WXS A;  4M02 A;  3NRZ A;  4KX6 B;  2DAF A;  1V9J A;  2KDF B;  1ROE A;  4K3C A;  5AZH A;  1IGD A;  1QOA A;  3MHS D;  3ONS A;  1VZ7 A;  4TKN A;  1FPY A;  3ZQ4 A;  2XEW A;  3AEA B;  2FUG 1;  4JPS A;  2I1K A;  2INP E;  4HPP A;  2G9H D;  3NG0 A;  1DYQ A;  3BWU D;  3SR6 A;  4ARI A;  2WXM A;  4MH0 E;  5T8I A;  3MHZ A;  1TS5 A;  1E5W A;  1VCB A;  1HQR D;  1TKY A;  2KX0 A;  2NBU A;  4HVB A;  3JYU A;  1STE A;  3DHI C;  4AJW A;  4ANW A;  4NJC A;  2N9P C;  2O2V A;  3P4R B;  3UIO B;  1ET6 A;  1YN5 A;  1ZKH A;  4B9K A;  4KDI C;  1L0V B;  1MPE A;  3T3O A;  4LK0 M;  1HA5 A;  4AOF A;  3DPD A;  3NZ3 A;  2MLB A;  2JU6 X;  1HTO A;  2KJH B;  4MJS A;  1MHX A;  3DBR B;  1C78 A;  4MGY E;  3TEY A;  2JVC A;  4FA6 A;  1VJK A;  1J19 A;  1KM7 A;  4PS7 A;  1UF0 A;  3EUB 2;  4RF0 A;  4F7Z A;  3JW0 X;  1C4C A;  3QCA A;  5JH5 C;  3HHM A;  1KLU D;  3EC8 A;  2KWC A;  4N6E B;  4US8 A;  3TEX A;  2MBE A;  2KKC A;  2JZ3 B;  3RNC C;  4XE0 A;  3QIJ A;  2GRI A;  3KUD B;  5E6P A;  1V49 A;  4KKI A;  3X23 A;  2BGF A;  1K50 A;  1NEN B;  1OQY A;  1S1Q B;  1H8C A;  4OW0 A;  2J4X A;  2BKF A;  1TS4 A;  2KFJ A;  2L76 A;  1BUI C;  4C7Z A;  2M17 A;  3N32 A;  3N20 C;  1FNV A;  4E3C A;  1TTN A;  2LAS A;  5AEK B;  1YQ4 B;  4NPN A;  1FO4 A;  4PS8 A;  1FEH A;  1ZDX A;  5HHD G;  2DYM A;  2RPQ A;  3VTV A;  3LB8 C;  2ZPN A;  4CYE A;  5E6J A;  1WF9 A;  1YD8 U;  2EMS A;  3GB1 A;  4NJ6 A;  3P63 A;  1F1H A;  1UBQ A;  1WJ4 A;  2WDR B;  2KX3 A;  2LWP A;  2YVC A;  1S3S G;  4KV2 A;  5EE9 A;  2KQ7 A;  4JX1 C;  1T0S C;  3BK1 A;  3CST A;  3PT2 B;  5IA7 A;  1PYW D;  1AWD A;  3PZD A;  5D7G A;  2ZCB A;  4P1C C;  3IXS A;  2LI5 A;  2MA9 B;  2WXI A;  2D3B A;  2FE8 A;  2LJI A;  3R2T A;  4C4V A;  2BYE A;  3Q3F A;  2EKI A;  1NVI D;  4W9C A;  2BYF A;  2DX5 B;  2CS4 A;  2V3N A;  2V0G A;  3ZNG C;  5D3I B;  3NVV A;  5JHB A;  2KQ4 X;  2Z59 B;  2MJE A;  5BO4 B;  2KC1 A;  3UQA A;  3MC9 A;  4BKG A;  4FHJ A;  2BVC A;  2WU2 B;  4LCD E;  4G0N B;  2FID A;  5GXG B;  3DBH B;  3N30 A;  1R4N B;  2MCN B;  2DYB A;  4OVZ A;  4AJY B;  5DPR A;  4EOY A;  3P4P B;  3NVZ A;  4GLS C;  1OQQ A;  1LO5 D;  3ZTD A;  2FIF A;  5TR5 A;  2L05 A;  2MP2 A;  4EZJ A;  1ACC A;  1YJJ A;  4RM9 A;  3FAH A;  4ICV A;  5KHQ A;  1PDX A;  1TYG B;  3VTW A;  3QJZ A;  2M0X A;  2C60 A;  4M8M A;  1F0Z A;  5J18 A;  2OJR A;  4LNN A;  1XO3 A;  3LXF A;  3ZGZ A;  1WYW B;  4J6I A;  2KTR A;  4DXA B;  5IO9 A;  4GN1 A;  1I4R A;  3KQ4 A;  4FLH A;  1SE9 A;  2K6D B;  1JWM D;  1YX5 B;  1TBE A;  1C4A A;  1CJE A;  2VH2 A;  4DHZ B;  1D6E C;  3UF8 A;  1WZ0 A;  1XF5 L;  4C7Y A;  2L8J A;  2LVQ A;  3TUO A;  3L54 A;  2PE6 B;  4KZC A;  4KSL C;  1Z5S B;  4EZK A;  3EGR A;  4BKS D;  3N1Z C;  3OJ3 A;  1WIA A;  3CWI A;  4YTN B;  3DQV A;  5EE3 A;  1L2N A;  1JML A;  4FJY A;  2BBC A;  2IGD A;  1IGC A;  3AUL A;  4KIK A;  1EWC A;  2PE9 A;  2JZP A;  3VUX A;  3IG3 A;  2BYV E;  3L4P A;  4FHK A;  3W1S C;  1EF1 A;  2FAZ A;  2KN4 A;  2O2V B;  3APC A;  3PSE B;  2J52 A;  4DXG A;  4WAA A;  4B0M A;  4BOS C;  1WJ6 A;  3E9S A;  5CHF A;  2C9W B;  4MJS B;  5AZG A;  2LHD A;  2W54 A;  3P42 A;  1QOB A;  2JXX A;  3TEW A;  3C19 A;  2D3A A;  3RUI B;  2ZVO A;  4LDT B;  5J2R A;  3KVF B;  4TQ1 A;  3AE6 B;  3ZNI D;  3DVG Y;  2QJL A;  2X38 A;  4HWI B;  2LFI A;  3IAS 1;  4HJK A;  2KQS A;  2J7Q B;  3U30 A;  2DZI A;  4TSS A;  3HVZ A;  3U7Z A;  3AXC A;  3ZTC A;  2DBY A;  2PTL A;  4XWT A;  4K7W A;  1RFK A;  3VVW B;  4K1R B;  4USA A;  2V3S A;  4C00 A;  4DDG D;  3PVL A;  2CHX A;  3DHH C;  3UGB B;  4B6W A;  4LNF A;  3ZYY X;  3PV1 A;  2OJW A;  3PGE A;  4RF1 A;  1E8X A;  1L7Y A;  4RCO A;  5JZE B;  3KH0 A;  2W82 A;  1L6V A;  2FCN A;  4E71 A;  3SHQ A;  3BVM A;  4X57 B;  2KYW A;  3QC8 B;  1K53 A;  1SXT A;  1E8Z A;  5TSS A;  1GJZ A;  1WMH A;  3PRZ A;  2BB6 A;  3M95 A;  3ZNH B;  3ZNZ B;  3HUI A;  2V9H A;  4LTU A;  3VQI A;  2JXT A;  2M19 A;  2ZW1 A;  2KO3 A;  2CJN A;  1FNU A;  4A90 A;  3Q69 A;  2DZK A;  4G50 A;  4HKZ E;  1I7H A;  1FCL A;  3TSS A;  1C1Y B;  1WRD B;  1WH3 A;  4C4V B;  2K8B A;  1WGH A;  5EE1 A;  3RPF C;  3VUY A;  1R4M B;  1YJI A;  2LEK A;  5JXV A;  3AE5 B;  3MP9 A;  3PZ7 A;  3T8M A;  1Q1O A;  3V6C B;  2KVZ A;  3IT6 B;  3HVD A;  5HFY A;  5L83 A;  4C56 C;  5D3D A;  1VLB A;  1BT0 A;  4FJZ A;  1GC6 A;  1WR1 A;  2MHJ A;  2KD0 A;  3H7P A;  4P6V F;  3U4E G;  4HPL B;  1Y56 A;  4P1B C;  3MTN B;  3RI7 C;  5BYR A;  2YEP B;  2CJO A;  1U4A A;  2UYZ B;  2K6Q A;  3W5V B;  3LMN A;  2INC C;  1UWM A;  2QC8 A;  2MP2 B;  4ZRI A;  1JCK B;  2PW9 A;  3CMM B;  3Q8F A;  1I4H A;  3VFK A;  2WU5 B;  3BII D;  1GC7 A;  4KVG B;  1RM6 C;  2PVG C;  1HE8 A;  4LDT D;  1SIF A;  3H8H A;  4RGM A;  3PS6 A;  2ZNV C;  4L1B A;  2KTR B;  2JY6 A;  1ZXI A;  3QK0 A;  1RRB A;  2I1J A;  1EF5 A;  5IP4 D;  1SB3 C;  2GMI C;  4IM3 A;  4REZ A;  1HZ5 A;  5D94 A;  3KYC D;  4N9F 4;  1WI0 A;  3LDZ E;  5CHV C;  3ZIM A;  4LNK A;  5J17 A;  2NR2 A;  3AEF B;  4ZRP A;  1SJE D;  2LGI A;  3BZD B;  2WLB A;  1WJU A;  3FC4 A;  4NQK E;  4RGO S;  2K8C A;  3BK2 A;  3N3K B;  4JE3 B;  4ZRK A;  4MAC A;  3TBL D;  4PYZ A;  4JIO U;  3PTF C;  3AE8 B;  4HPM B;  3RUL A;  4KIK B;  4MM3 A;  2N9E B;  1E0Z A;  3VRB B;  3VR8 B;  1TGZ B;  3EHV A;  2NBV B;  3OAW A;  3U52 E;  1C76 A;  4XGA B;  1B1Z A;  4ACF A;  1ZP0 B;  5HG2 A;  3AE9 B;  3P1M A;  2ZW0 A;  2WX0 A;  4ANU A;  3ZJU A;  1OEY A;  2G3Q B;  4GU2 A;  1ZE3 D;  3M62 B;  3A1Q A;  3EFU A;  4RFB A;  3E56 A;  2BKR B;  3SFD B;  3A4R A;  2A5U A;  3NJT A;  3BVZ A;  3NVW A;  4K7S A;  4ANV A;  2JYT A;  1GG3 A;  1J0G A;  4HDQ A;  3HK0 A;  3PO0 A;  1C79 A;  4UDU C;  3R7R A;  5G2N A;  2PJH A;  2AL6 A;  2INN E;  4AWJ A;  2ZJD A;  3M63 B;  4DBG A;  1G6J A;  3AE3 B;  4MEM A;  1D5X C;  2IO2 B;  3DBR I;  3VHT C;  3J9C A;  4AS1 A;  2W3R A;  2AYO B;  4ZHO A;  2H89 B;  2NS5 A;  4RMA A;  1RLF A;  1I4G A;  4JL9 A;  3B08 A;  3Q8C A;  1QOF A;  3ML9 A;  2XBB C;  4HRS A;  1GB1 A;  2ZVN A;  1L0Y B;  4OZB A;  5E6N A;  3PPA A;  2GBK A;  1YIW A;  3Q2A C;  2IO3 B;  1FD6 A;  4DHZ E;  2LGS A;  4BBN C;  2QHO A;  4BAX A;  2WXN A;  1PQS A;  1P9D U;  1WXM A;  4ICU A;  3N9Y C;  4YSX B;  3RYT A;  3TIX A;  1UEL A;  4A55 A;  1IP9 A;  2JZZ A;  2WXQ A;  2G1E A;  1E7U A;  1JWA D;  1QIL A;  1QF6 A;  1JQ4 A;  2DZJ A;  2KDM A;  4XC2 A;  3RCZ A;  1PGX A;  4II2 B;  1WMH B;  1QT9 A;  2H88 B;  1MI0 A;  3U2S C;  1AYF A;  1XT9 B;  1QQR A;  2Z8L A;  1JRO A;  2K39 A;  2NMQ A;  3W9C B;  3R2I A;  3LJ3 A;  3L13 A;  3ZO5 B;  2AQ3 B;  2J0J A;  5C3J B;  2NTS A;  4BZA A;  4GB9 A;  2K8H A;  5C23 A;  3P2B A;  4XX5 A;  2MQJ A;  2E3T A;  3NHE B;  4M00 A;  1ZOY B;  3H9D A;  4M01 A;  4IM0 A;  3AMZ A;  2K1F A;  3Q3N C;  2GBR A;  3RNG C;  3ZLZ A;  1M4V A;  2I38 A;  3KWL A;  1A5R A;  4H2A A;  3NY5 A;  4OVV A;  1SIJ A;  1FMA D;  2WNM A;  2WXO A;  1W6V A;  1T6B X;  2MH7 A;  1YQB A;  3H7P B;  3T3N A;  4HXD A;  3I57 A;  2AEH A;  2WXJ A;  4EUT A;  2RSU A;  3DVN U;  2LUM A;  3X0W A;  1N60 A;  2BQQ A;  3WAM A;  3TMP B;  3DBH I;  1R4N I;  4PT5 A;  2D11 A;  2PMV A;  2R61 A;  2JRH A;  1EUV B;  2BWE S;  3TL5 A;  2REX A;  5BMH A;  4XWW A;  4B95 A;  3GZN B;  3AED B;  1YNT E;  2IO1 B;  1I42 A;  1PGB A;  2W3S A;  5D6J B;  1VDV A;  1J7C A;  1WFY A;  2JPH A;  1LGR A;  1SE2 A;  3HM6 X;  2WS3 B;  2KLG A;  2CHW A;  3APD A;  1E90 A;  4HK2 A;  1GUA B;  2W55 A;  4HCN B;  4WQO B;  2L3Z A;  4YTM B;  4LNO A;  3ZJT A;  3UI3 A;  2DLB A;  1WX9 A;  1MJD A;  2GBN A;  3LYY A;  1K52 A;  4L23 A;  1NI3 A;  3R7Q A;  3RFZ B;  3URY A;  1WJN A;  3AE7 B;  1F2R I;  3IFW B;  3IAM 1;  1ET9 A;  5DCN A;  4IC7 B;  3PRM B;  1L0X B;  2WXF A;  3SDL C;  1WGK A;  1MVK A;  2Y3A A;  2LGD A;  3RT3 B;  2JQR B;  4ZRJ A;  4MM3 B;  1A70 A;  1TJE A;  4MH8 A;  2MRP A;  4GSW A;  2PKO A;  3H6N A;  2I2Y A;  3KUZ A;  2KAJ A;  4WWM A;  1M94 A;  3NZU A;  1CMX B;  1ZW7 A;  1AAR A;  1I4P A;  1SE4 A;  4BFR A;  1ISN A;  2KZR A;  3A1Q B;  1SSN A;  2HTM E;  2OHF A;  4A3P A;  1LM8 B;  2ZEQ A;  3VAW A;  2DYO A;  2N4F A;  4MGK E;  1SF0 A;  2LZ6 A;  2BS3 B;  3V60 A;  2N7E A;  2DZM A;  4QAY A;  2V4I B;  3SFE B;  2ZPY A;  1TY0 A;  2QEJ C;  4WJQ A;  1LQB A;  3L0W B;  2DNF A;  1E7P B;  1V8C A;  5HKH A;  4MDK E;  3QA8 A;  1FIQ A;  5FKA C;  4K3B A;  4YL8 A;  2L00 B;  4KSK C;  2J0M A;  1FM0 D;  1UGM A;  1UZX B;  3JSV A;  4RH6 A;  1N61 A;  3Q8E A;  4FN2 A;  1TKE A;  4I6P A;  1WGD A;  4EZL A;  2B3A A;  4ARC A;  3HIZ A;  5G5H A;  1Y8R C;  2EMT A;  1FXA A;  1GPX A;  1ZDV A;  2HE7 A;  4WIP A;  4GXB A;  2WGS A;  1V5O A;  1T0Q C;  2LGY A;  4WUR A;  1HXY D;  3DDC B;  3A9J A;  1NI2 A;  1QLB B;  4MGI E;  4C80 A;  1JWS D;  3FKY A;  3ZDM C;  3QWZ B;  1UH6 A;  4XZ4 A;  2WXH A;  2WHI A;  3K9O B;  1TKG A;  3NS8 A;  2OED A;  2IPK D;  4XYC A;  3BYT B;  4GGQ A;  2RDH A;  1WY8 A;  1KRH A;  2N9X A;  2WDV B;  2KAN A;  3SU8 X;  5LNK 1;  4OZA A;  1V1P A;  3AEE B;  5BMG A;  3RN9 C;  4KGT A;  1P98 A;  4DHJ B;  2KWU B;  3DBL B;  2CU3 A;  4GOC A;  3N1Y C;  3PLU A;  1CQV A;  4F1S A;  1E10 A;  1D5M C;  1RAX A;  3L17 A;  1BML C;  4IM2 A;  4HLE A;  4JWU C;  3B9J A;  4NJ7 A;  2RDB C;  3OLM D;  5HI1 A;  4LJP B;  4FBJ B;  3AEB B;  3C0R B;  4GDL A;  3KLS X;  2KT7 A;  2A4Z A;  3PHW B;  1R4M I;  2ACZ B;  4Q2J A;  2UWQ A;  2LUE A;  4IG7 B;  4EFO A;  1HTQ A;  4KDL B;  4YT0 B;  4FJV B;  1E6E B;  1RYJ A;  2HTH A;  2MWS B;  5D2M B;  1PGA A;  1ZPS A;  2BWF A;  3RNA C;  1Q5W B;  1GAQ B;  4XDC A;  4DXF A;  2UU7 A;  1SGH A;  1WGG A;  3ZXR A;  2LXC A;  5E6O A;  2C7M B;  2E6X A;  3DVG X;  5EE0 A;  2TSS A;  3AI5 A;  5FR6 A;  4IUM B;  5LLI A;  2R2Q A;  3V61 A;  4EE2 A;  1L4Z B;  4KGS A;  2KWV B;  4ASW C;  2CR5 A;  3DHG C;  3AN1 A;  3NOB A;  1RWS A;  4IWQ A;  2JF5 A;  3Q8A A;  2PLP A;  5H8Y E;  4N58 A;  4II3 B;  4PS3 A;  2WDQ B;  2PPH A;  1K8R B;  3VDZ A;  1AN8 A;  1IYF A;  1V97 A;  2LHE A;  2AL3 A;  3BY4 B;  3I9V 1;  2MJ3 A;  3D32 A;  1P7E A;  5IAA C;  3EA6 A;  2KMA A;  1OTR B;  2DHZ A;  1XXG A;  1YN3 A;  2AWT A;  3WIM A;  2L83 A;  2BB5 A;  2BF8 B;  1FRD A;  3VTU A;  2N0S B;  4ZDV A;  2L7R A;  1WZ3 A;  1KTK A;  1WRI A;  1XEE A;  2MSE D;  1V6E A;  1WSP A;  1J7B A;  1KF6 B;  3R8B A;  1ENF A;  2QDF A;  1I4Q A;  3U7D A;  5AZF A;  1N63 A;  1GNU A;  3APF A;  2L0T A;  3AU5 A;  3W2D A;  2D07 B;  2FCQ A;  2LXA A;  5IN7 A;  3RNF C;  2KDE B;  3AB5 A;  3DWM A;  1GOZ A;  1JWB D;  2K9X A;  1Q10 A;  2N1V A;  2N9L A;  2ZZP B;  3B2F A;  4WWP A;  1XLO A;  5C1Z A;  1R7S A;  2VZK B;  2MBB B;  3QAR A;  4HCP B;  2LRW A;  1T3Q A;  2JWU A;  2XK5 A;  4DK5 A;  2RR9 A;  1NDD A;  3PZ8 A;  3AEG B;  2WQY B;  5AUK A;  1BXT A;  3ZDT A;  3ZXV A;  1WWT A;  2LGX A;  3DWG C;  3V05 A;  2L1A A;  1PUT A;  1DOI A;  3TJP A;  1WR6 E;  2Y5B B;  3EFC A;  3I63 C;  3JSV B;  2NCN A;  4WH4 A;  1LXD A;  2IO0 B;  5KHO A;  3KWV A;  2Z0E B;  1EU3 A;  1SJH D;  4R3D A;  4EKU A;  1IPG A;  1MG8 A;  4CO7 A;  1WE6 A;  4A9A A;  4PYU A;  1LFD A;  3AU4 A;  4YSY B;  4P16 A;  2BTE A;  3AE2 B;  3AEC B;  1WM3 A;  3PRE A;  1XCT L;  2FCM A;  1KLV A;  3A9J B;  2IZV B;  3N1X C;  4FXC A;  1TT5 B;  4MGZ E;  3ZUN A;  4G3X B;  4M0W A;  3H7S A;  1IUE A;  3OJ4 B;  3AV8 A;  4GDK A;  4NNJ B;  2WXL A;  1SE3 A;  1FRR A;  3MJW A;  2CHZ A;  3EEC A;  3GP7 A;  2IJ0 A;  1QOG A;  2WWZ A;  2AQ2 B;  3BVG A;  1V1P B;  3W1S A;  3A33 B;  3FIL A;  3HM3 A;  2YLM A;  4M8N A;  4WWO A;  2KFK A;  3C8Y A;  4YXD B;  2BS4 B;  2MEK A;  1CZP A;  2XN9 C;  2FUH B;  2G4D B;  1WXV A;  3IBE A;  3V62 A;  5LXI B;  4NZL B;  4YWG G;  1P1A A;  2O6V A;  2IDY A;  2KTF A;  1VRA B;  1B9R A;  1MFW A;  3L10 B;  1UWX A;  3ZRC A;  4TMA B;  1PFD A;  2G4S A;  1YN4 A;  4GDL B;  1V1O A;  4JLC A;  3NZS A;  2K25 A;  3HRD D;  3W5U B;  2N9K A;  4RGT A;  4NAM A;  2BW2 A;  4IDI A;  2LMC A;  3K9P B;  2KXJ A;  1TIF A;  3VH3 B;  1IBX A;  2MBH A;  4W9G A;  1YOV B;  4HEA 1;  1EO6 A;  2M4N A;  1OQR A;  2JWZ A;  1KJT A;  4O1N A;  2VZK D;  3ZVV A;  2IY0 B;  3GE3 C;  2D5G A;  3GOE A;  2KDI A;  1JWU D;  4ANX A;  2M56 B;  3Q3O C;  4W9H A;  1XD3 B;  3O65 B;  2BPS A;  4W9J A;  2KJR A;  4W9L A;  1E8Y A;  4BBN F;  3MC8 A;  1AW7 A;  4HRO A;  5BYS A;  3WAL A;  1C9F A;  5BYQ A;  3GZN I;  1XQQ A;  2KN5 A;  1JRP A;  1FXI A;  1F52 A;  5CTR C;  1WXQ A;  2EEL A;  3GE8 C;  3UQB A;  1P3Q U;  3B1L X;  2DAJ A;  1TZO A;  3ETR A;  4KGR A;  1P7F A;  1XLP A;  4HDO A;  3R3M A;  1OEY J;  4URK A;  3VUW A;  4JQW C;  2K0P A;  1VZ6 A;  2C5L C;  2MX2 A;  1TY2 A;  2L0F A;  1ZXH A;  1SEB D;  1V86 A;  1KLG D;  4YTP B;  4WAF A;  2J42 A;  2JSV X;  3OWE B;  2WXK A;  4TV3 A;  3WAP A;  3ENE A;  4E74 A;  4FAD A;  3GS2 A;  1E9M A;  5CX3 A;  2QMT A;  3A9K A;  2GBM A;  3IVF A;  2D2Q A;  4RGN A;  2SAK A;  5GMV A;  2N1W A;  2V3P A;  2IYD B;  2JRI B;  5G5G A;  2XK5 B;  4IKG A;  1I4X A;  1GB4 A;  2KOX A;  2ONQ A;  1N6Z A;  3QX1 A;  4LNI A;  1VR9 A;  4DWF A;  5H92 C;  3QAQ A;  2MBQ A;  1Z2M A;  4WJO A;  1NYQ A;  1QKZ A;  2FCS A;  1D5Z C;  4ZYN A;  2LD9 A;  3MC0 B;  4B0E A;  4YSZ B;  3RZF A;  4NAW A;  4S0R A;  1C4P A;  1NEK B;  1YX6 B;  2PVO D;  2IGH A;  2GB1 A;  1FFV A;  1J7A A;  3P4Q B;  2MJD A;  4WWN A;  3P4S B;  2QSD A;  1E8W A;  2CU1 A;  2KVR A;  1F77 A;  2DWQ A;  1TZ1 A;  2K3U A;  3B0A A;  3ZKJ C;  2OOB B;  4KZ0 A;  5L95 C;  3VR9 B;  2KJ6 A;  2LVO A;  4XDD A;  1Q0W B;  4M0W B;  2Y5C A;  1ZGU B;  3ZJV A;  3TCA A;  3WCQ A;  3Q8B A;  1OFF A;  4GDK B;  1V80 A;  3ECI A;  1N62 A;  4KKJ A;  5DPS A;  3VRA B;  3Q6B A;  2D3G A;  1JAL A;  1NYR A;  1TS2 A;  2CKH B;  3V6E B;  5BMI A;  2KK8 A;  1L6U A;  4PK1 A;  2XNA C;  1UBI A;  4BOZ B;  1C77 A;  4DDI D;  1F9J A;  2LJ5 A;  3BIN A;  3NVY A;  3FIL B;  2MBO A;  1WGR A;  2KNB A;  1WXA A;  2KFK B;  3WAO A;  2LVP A;  1CK1 A;  3CIR B;  4S17 A;  5DPT A;  1UNS A;  2ICI A;  1YQ3 B;  2QIE B;  2RMM A;  2WXR A;  2J0K A;  2C7H A;  2O6V B;  4GMV A;  3L16 A;  3KUC B;  4BVU C;  4JWS C;  3JVZ X;  1EWY C;  5JHA A;  4MEL A;  2WDT B;  2X8X X;  3DBL I;  2NPT A;  4I6N B;  1MG4 A;  2KHW B;  2BYT A;  4MT5 A;  1F2R C;  1ESF A;  2QIL A;  4TUU A;  3V3X A;  1RFA A;  3NS1 A;  4TQ0 A;  3QHT A;  3OG5 A;  2LRU A;  4RM8 A;  5LXH A;  4DQO C;  4L2Y A;  1FFU A;  1HZ6 A;  1IBX B;  4P7I A;  1L4D B;  3PRP B;  1SBB B;  2K22 A;  2WXG A;  4K7U A;  3RZW C; 
#chains in the Genus database with same CATH homology
 5D7G A;  2ZCB A;  2LI5 A;  4K81 A;  2MA9 B;  1GNU A;  2BYE A;  3ML9 A;  2XBB C;  3Q3F A;  1E7V A;  4W9C A;  2BYF A;  3APF A;  2DX5 B;  2ZVN A;  2L0T A;  2CS4 A;  5E6N A;  3AU5 A;  3PPA A;  2GBK A;  1YIW A;  3ZNG C;  2IO3 B;  2D07 B;  2FCQ A;  2LXA A;  2C7N B;  4DHZ E;  2KDE B;  5JHB A;  2Z59 B;  3CSF A;  4BBN C;  5BO4 B;  3QQ8 B;  2KC1 A;  3UQA A;  2QHO A;  1C3T A;  4BKG A;  2WX1 A;  4FHJ A;  3I3T B;  1PQS A;  1P9D U;  1WXM A;  2EKE C;  2N1V A;  2ZZP B;  4WWP A;  4ICU A;  5C1Z A;  4LCD E;  4G0N B;  2FID A;  3N30 A;  3RYT A;  3TIX A;  3Q3J A;  2MCN B;  1UEL A;  2MBB B;  1V5T A;  1IP9 A;  2GOW A;  2DYB A;  2JZZ A;  3QAR A;  1E7U A;  2KLC A;  4HCP B;  2LRW A;  4AJY B;  1V2Y A;  2XK5 A;  5DPR A;  2RR9 A;  4DK5 A;  4EOY A;  1NDD A;  2DZJ A;  4XC2 A;  3RCZ A;  1V81 A;  3ZDT A;  3CF6 E;  4II2 B;  1WMH B;  2LGX A;  3KYD D;  1WM2 A;  1XT9 B;  2FIF A;  3ZTD A;  3ZRF A;  4A3O A;  5TR5 A;  2L05 A;  3TJP A;  3WAN A;  1WR6 E;  2MP2 A;  2Y5B B;  4EZJ A;  2K39 A;  1WE7 A;  2HJ8 A;  4RM9 A;  4ICV A;  3JSV B;  2NCN A;  3LJ3 A;  5KHQ A;  1LXD A;  2NBW B;  2IO0 B;  3VTW A;  3PHX B;  3L13 A;  3QJZ A;  5KHO A;  2M0X A;  3ZO5 B;  2C60 A;  4M8M A;  2Z0E B;  2J0J A;  4EKU A;  5J18 A;  2OJR A;  2MW5 A;  4NY0 A;  1IPG A;  2FNJ B;  1MG8 A;  4GB9 A;  3RD2 A;  2K8H A;  3VXW A;  1WE6 A;  1WYW B;  4J6I A;  2KC2 A;  3UIP B;  5C23 A;  4CO7 A;  2KTR A;  3P2B A;  4XX5 A;  2MQJ A;  4DXA B;  3NHE B;  3PLV A;  4GN1 A;  4PYU A;  1LFD A;  3H9D A;  3AU4 A;  4IM0 A;  1SE9 A;  2K6D B;  2ASQ A;  4FLH A;  1X1M A;  1WM3 A;  3PRE A;  1YX5 B;  2K1F A;  1TBE A;  2GBR A;  3T9L A;  2R2O A;  3ZLZ A;  2FCM A;  4DHZ B;  1A5R A;  3UF8 A;  3NY5 A;  1KLV A;  1WZ0 A;  3A9K B;  4OVV A;  2L8J A;  3A9J B;  4FUL A;  5G55 A;  2IZV B;  1W6V A;  2LVQ A;  2M8S A;  3H7P B;  1YQB A;  4MGZ E;  3L54 A;  2PE6 B;  3ZUN A;  2M1M A;  4G3X B;  4HXD A;  4IWP A;  4KZC A;  4KSL C;  2AEH A;  3H7S A;  4EUT A;  2RSU A;  1Z5S B;  4EZK A;  3DVN U;  3DBS A;  3OJ4 B;  4GDK A;  4NNJ B;  3X0W A;  4LJO B;  4BKS D;  3OJ3 A;  1WIA A;  5EDS A;  2N7D A;  3MJW A;  3WAM A;  3DQV A;  2O6V D;  3DBH I;  2CHZ A;  3TMP B;  1R4N I;  1YJ1 A;  2D11 A;  1L2N A;  2JRH A;  3EEC A;  1EUV B;  1VD2 A;  4FJY A;  2WWZ A;  2BWE S;  3AUL A;  3W1S A;  3TL5 A;  2REX A;  3A33 B;  4KIK A;  2PE9 A;  3HM3 A;  4MSM B;  2YLM A;  4M8N A;  2KMC A;  4B95 A;  3VUX A;  1P0R A;  3IG3 A;  4WWO A;  2BYV E;  2KFK A;  3W1Y A;  2JT4 B;  2ZNV B;  4FHK A;  3W1S C;  1KOT A;  2IO1 B;  1I42 A;  2IBI B;  4WJP A;  4NQL B;  1EF1 A;  2FAZ A;  2O2V B;  5D6J B;  3APC A;  2FUH B;  4NAW B;  3PSE B;  2G4D B;  4WAA A;  1WXV A;  3IBE A;  3V62 A;  4BKS A;  1WJ6 A;  2NVU I;  4BOS C;  3H1U A;  1WFY A;  2JPH A;  5LXI B;  4A20 A;  3HM6 X;  1P1A A;  2KLG A;  2CHW A;  2O6V A;  3APD A;  5DPW A;  1E90 A;  4HK2 A;  4W9D A;  3DVN V;  1GUA B;  3ZW3 A;  2KTF A;  4HCN B;  4WQO B;  5CHF A;  1UD7 A;  4EEW A;  2C9W B;  2L3Z A;  5CHW A;  4MJS B;  3L10 B;  3L08 A;  3R66 C;  5AZG A;  3ZRC A;  1WX9 A;  2JXX A;  2GBN A;  3WA0 A;  2G4S A;  1T0Y A;  4GDL B;  4JGH B;  4JLC A;  3RUI B;  2ZVO A;  3NZS A;  3R7Q A;  2DEN B;  2K25 A;  3KW5 B;  4LDT B;  5J2R A;  4I6L B;  3KVF B;  1WJN A;  1QZE A;  4TQ1 A;  4W9E A;  3IFW B;  2JUO A;  4MSQ B;  4AUQ C;  5DCN A;  3ZNI D;  3M3J A;  3DVG Y;  4G11 A;  3K9P B;  4IC7 B;  1D3Z A;  4DHJ D;  2KXJ A;  3PRM B;  4OVU A;  3SDL C;  3UIN B;  4HWI B;  3VH3 B;  3PZD A;  4W9K A;  2MBH A;  4W9G A;  1EO6 A;  2LGD A;  3RT3 B;  1NBF C;  2KDB A;  2M4N A;  2JWZ A;  4HJK A;  1KJT A;  3ALB A;  1OGW A;  4ZRJ A;  2KQS A;  2J7Q B;  3U30 A;  3ZVV A;  2DZI A;  2IY0 B;  3ZTC A;  3AXC A;  3GOE A;  2IY1 B;  2KDI A;  2MRP A;  4ANX A;  4WJN A;  4GSW A;  4K7W A;  4W9H A;  1XD3 B;  3H6N A;  2D10 A;  3O65 B;  3KUZ A;  3VVW B;  2BPS A;  4K1R B;  4W9J A;  4CHK A;  2V3S A;  2KJR A;  4W9L A;  1E8Y A;  4BBN F;  4DDG D;  1M94 A;  3U8Z A;  3NZU A;  3PVL A;  1I35 A;  1CMX B;  2CHX A;  1ZW7 A;  1WGY A;  3UGB B;  3WAL A;  4B6W A;  1AAR A;  3GZN I;  1ISN A;  2KZR A;  2WYQ A;  3A1Q B;  4BFR A;  4W9I A;  1J8C A;  3PV1 A;  2HD5 B;  4A3P A;  1XQQ A;  3PGE A;  2KN5 A;  2GBJ A;  1E8X A;  1L7Y A;  3IHP C;  3S2A A;  5JZE B;  1LM8 B;  2ZEQ A;  3VAW A;  4IW0 A;  2DYO A;  2N4F A;  4IWO A;  3KH0 A;  1FXT B;  4MGK E;  5CTR C;  2LZ6 A;  2FCN A;  2NPT B;  4E71 A;  3SHQ A;  1WX8 A;  2N7E A;  3V60 A;  2DZM A;  3UQB A;  4X57 B;  1P3Q U;  3B1L X;  4AP4 C;  2DAJ A;  2ZPY A;  3QC8 B;  4WJQ A;  1LQB A;  2G45 B;  3L0W B;  2VRR B;  1E8Z A;  4GIV A;  4BKT A;  1GJZ A;  1WMH A;  3DOW A;  3PRZ A;  1JRU A;  3VH4 B;  3M95 A;  3ZNH B;  3ZNZ B;  1WX7 A;  2V4L A;  3DCG A;  5HKH A;  3VQI A;  3ML8 A;  4HDO A;  4MDK E;  3QA8 A;  2KO3 A;  3R3M A;  1OEY J;  4YL8 A;  4URK A;  2L00 B;  4KSK C;  2J0M A;  2V1Y A;  1UGM A;  1UZX B;  3JSV A;  2RD0 A;  2Z0D B;  1H4R A;  2DZK A;  2RGF A;  4G50 A;  4JQW C;  4W9F A;  3SD5 A;  3VUW A;  2C5L C;  2MX2 A;  4FN2 A;  4I6P A;  1C1Y B;  3A4S C;  2L0F A;  1WGD A;  4EZL A;  2B3A A;  2PEA A;  1V86 A;  3HIZ A;  1WRD B;  2ZCC A;  1WH3 A;  2K8B A;  1WGH A;  2W9N A;  3VUY A;  1Y8R C;  2EMT A;  4F8C B;  1WXS A;  2HE7 A;  3T8M A;  3V6C B;  1Q1O A;  4TV3 A;  3WAP A;  3ENE A;  5L83 A;  2DAF A;  4E74 A;  1V9J A;  4FAD A;  2KDF B;  4GXB A;  5AZH A;  1BT0 A;  1V5O A;  2LGY A;  4FJZ A;  1GC6 A;  1WR1 A;  5CX3 A;  3MHS D;  3ONS A;  3A9K A;  2GBM A;  3DDC B;  2KD0 A;  3A9J A;  4TKN A;  3H7P A;  3IVF A;  1NI2 A;  4HPL B;  2D2Q A;  4MGI E;  5GMV A;  2N1W A;  2XEW A;  3ZDM C;  3QWZ B;  2I1K A;  2IYD B;  3MTN B;  1UH6 A;  2JRI B;  4XZ4 A;  2XK5 B;  3K9O B;  2KOX A;  3NS8 A;  1U4A A;  4MH0 E;  4GGQ A;  3QX1 A;  2UYZ B;  2K6Q A;  1E5W A;  1WY8 A;  4DWF A;  2N9X A;  4JL9 A;  2KAN A;  1VCB A;  3LMN A;  3SU8 X;  2KX0 A;  3QAQ A;  2NBU A;  2MBQ A;  2MP2 B;  4ZRI A;  4HVB A;  1Z2M A;  3JYU A;  4WJO A;  3CMM B;  4AJW A;  3VFK A;  2FCS A;  4ZYN A;  1GC7 A;  2LD9 A;  1P98 A;  4KVG B;  4ANW A;  4DHJ B;  3ZIM A;  1HE8 A;  4LDT D;  3RZF A;  1SIF A;  2KWU B;  2N9P C;  2O2V A;  4NAW A;  3UIO B;  3PS6 A;  2ZNV C;  1ZKH A;  4B9K A;  2KTR B;  2JY6 A;  4KDI C;  1YX6 B;  3QK0 A;  2I1J A;  1RRB A;  4GOC A;  1EF5 A;  3PLU A;  4F1S A;  2GMI C;  4IM3 A;  4AOF A;  3DPD A;  1RAX A;  3L17 A;  2MLB A;  5D94 A;  3KYC D;  2KJH B;  4MJS A;  4WWN A;  4IM2 A;  4HLE A;  4N9F 4;  4NJ7 A;  4MGY E;  1E8W A;  2CU1 A;  3OLM D;  1WI0 A;  2JVC A;  2KVR A;  4LJP B;  4FBJ B;  4FA6 A;  3LDZ E;  3C0R B;  1J19 A;  1TZ1 A;  3B0A A;  4GDL A;  5CHV C;  2OOB B;  3PHW B;  2A4Z A;  4KZ0 A;  1R4M I;  5L95 C;  1KM7 A;  2KJ6 A;  2LVO A;  2UWQ A;  1Q0W B;  2LUE A;  4IG7 B;  2NR2 A;  4M0W B;  4PS7 A;  4EFO A;  5J17 A;  1ZGU B;  4F7Z A;  4KDL B;  3JW0 X;  3TCA A;  3QCA A;  1WJU A;  4GDK B;  5JH5 C;  4FJV B;  2HTH A;  2MWS B;  3HHM A;  1V80 A;  3ECI A;  5D2M B;  5DPS A;  4NQK E;  2BWF A;  3EC8 A;  2KWC A;  2K8C A;  1Q5W B;  2D3G A;  3N3K B;  2CKH B;  3V6E B;  2KK8 A;  1SGH A;  1WGG A;  4ZRK A;  2MBE A;  3TBL D;  1UBI A;  2LXC A;  4JIO U;  2KKC A;  2C7M B;  4PYZ A;  5E6O A;  2JZ3 B;  4BOZ B;  3DVG X;  3PTF C;  4DDI D;  1F9J A;  3QIJ A;  2LJ5 A;  4HPM B;  3KUD B;  5E6P A;  3RUL A;  1V49 A;  3AI5 A;  4KIK B;  3BIN A;  4MM3 A;  4IUM B;  5FR6 A;  5LLI A;  2N9E B;  2R2Q A;  3V61 A;  3X23 A;  2MBO A;  1WGR A;  2KNB A;  1WXA A;  1TGZ B;  3EHV A;  2KFK B;  2NBV B;  2KWV B;  3OAW A;  2BGF A;  4ASW C;  2CR5 A;  3WAO A;  2LVP A;  1S1Q B;  1OQY A;  1H8C A;  3NOB A;  2BKF A;  5DPT A;  4IWQ A;  2JF5 A;  2WX0 A;  4ANU A;  2KFJ A;  2J0K A;  1OEY A;  4II3 B;  2G3Q B;  4GU2 A;  4PS3 A;  2L76 A;  2PPH A;  3M62 B;  2C7H A;  2O6V B;  1K8R B;  2M17 A;  3A1Q A;  3EFU A;  3L16 A;  3N32 A;  4GMV A;  3KUC B;  3VDZ A;  2BKR B;  4E3C A;  1TTN A;  4BVU C;  1IYF A;  2AL3 A;  3JVZ X;  2LAS A;  5JHA A;  3ZKJ C;  5AEK B;  3A4R A;  3BY4 B;  4MEL A;  2A5U A;  4ANV A;  2WDT B;  4K7S A;  3D32 A;  4NPN A;  1GG3 A;  3DBL I;  4PS8 A;  1J0G A;  2NPT A;  4I6N B;  4HDQ A;  3HK0 A;  5IAA C;  2DYM A;  2RPQ A;  3VTV A;  2KMA A;  2ZPN A;  4CYE A;  2KHW B;  1OTR B;  2DHZ A;  2AWT A;  3WIM A;  1WF9 A;  1YD8 U;  3R7R A;  2EMS A;  5G2N A;  2PJH A;  2AL6 A;  4AWJ A;  4NJ6 A;  2ZJD A;  4TUU A;  1UBQ A;  3M63 B;  2BF8 B;  4DBG A;  1RFA A;  1WJ4 A;  2KX3 A;  4TQ0 A;  3VTU A;  2LWP A;  1G6J A;  3QHT A;  4MEM A;  2YVC A;  1S3S G;  2L7R A;  4ZDV A;  2LRU A;  1WZ3 A;  2IO2 B;  3DBR I;  4KV2 A;  2KQ7 A;  4RM8 A;  3VHT C;  5LXH A;  2MSE D;  1V6E A;  4P7I A;  2AYO B;  2NS5 A;  3CST A;  3PRP B;  4RMA A;  3PT2 B;  5IA7 A;  1RLF A;  3U7D A;  4K7U A;  5AZF A;  3RZW C;  3B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...