2MP2A

Solution structure of sumo dimer in complex with sim2-3 from rnf4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
GTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Small ubiquitin-related modifier 3
publication title Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mp2A00
1WH3A 4MJSA 4NY0A 4DHJB 1V6EA 3RD2A 1E8XA 3L13A 3M63B 1I42A 4AP4C 4W9KA 5AZFA 3V62A 1V80A 4M8NA 3VUXA 4GSWA 4KZ0A 2PE9A 3GZNI 4MDKE 1S3SG 2BPSA 4IC7B 3Q3FA 3UQAA 1XT9B 4W9CA 4MSMB 4TUUA 3BINA 2EMSA 3VQIA 3H6NA 2M4NA 4DWFA 2FNJB 2KJRA 2O2VB 3ZKJC 3MJWA 2R2QA 3PHWB 3L17A 4WQOB 3V61A 4A20A 4HWIB 4EFOA 1KOTA 1AARA 2KWCA 1E90A 1QZEA 2V1YA 5AZGA 4BVUC 1WE7A 2O6VB 3JVZX 4KVGB 2KNBA 4AJYB 1HE8A 4F8CB 2D07B 1ZGUB 4JGHB 2KKCA 3IHPC 3NS8A 2FIFA 4KSLC 4MGYE 3A33B 3VHTC 3ZDTA 4WJQA 2Z59B 3PSEB 4MH0E 5DPSA 2KHWB 5CTRC 5E6NA 4F7ZA 3CF6E 2ZZPB 2IO1B 4FHJA 4I6LB 1FXTB 3V6EB 4GB9A 2LXCA 3IFWB 4JL9A 4LDTB 1NI2A 3IG3A 2MBEA 4BKSA 3KUCB 2ZNVB 2R2OA 5JZEB 2REXA 4TQ0A 3A9JB 4BBNC 5D94A 2MQJA 1GUAB 1WJ6A 1OQYA 2ZCBA 3NOBA 5DPTA 3RZWC 3ZLZA 1CMXB 4WJOA 5GMVA 4HVBA 3ZUNA 1WXAA 1KLVA 2DENB 1IP9A 2MBBB 4IM0A 4WWNA 2OJRA 4AJWA 4OVUA 4B6WA 3MHSD 3SU8X 1XQQA 1EO6A 4W9GA 3RULA 1G6JA 2HTHA 1WJ4A 2GBRA 4FJYA 2FCQA 2JWZA 1TZ1A 3A9KA 2GBKA 4GDKB 3ONSA 5J2RA 2MP2B 3K9PB 4AUQC 2ZNVC 4ZYNA 2N9EB 2FAZA 3H7SA 3DVNU 4GDKA 4IWPA 3ECIA 2MP2A 1C3TA 2MBOA 2DZIA 1WGYA 2KDIA 3QK0A 4A3OA 2I1JA 5KHOA 4PYUA 2DHZA 2CS4A 2GBJA 2Y5BB 1WI0A 1WX9A 3ML9A 5AZHA 5DPWA 1GG3A 3APDA 4W9HA 2LASA 1TBEA 2A5UA 3KYDD 3RYTA 2JUOA 2KMCA 2L0FA 3JYUA 3QHTA 2BWFA 4W9DA 5BO4B 1LFDA 4GIVA 1U4AA 2GBMA 3U30A 2KJ6A 2RR9A 3VDZA 4XZ4A 2AYOB 2BF8B 1F9JA 2DZMA 2MWSB 4GN1A 1EUVB 2YVCA 3QARA 2XEWA 1WYWB 2BGFA 3CSFA 1WGGA 4DHZB 5IAAC 2FIDA 2JVCA 4M8MA 1M94A 3KW5B 3RT3B 2KDFB 2CHXA 3UF8A 2IO2B 4K7WA 2V3SA 4DHJD 2KLCA 2KLGA 1X1MA 3DBSA 1Z5SB 1TTNA 2IO3B 2KX0A 2UYZB 3OLMD 4G11A 1A5RA 2D2QA 3APCA 4ANWA 2C9WB 1OEYA 3IVFA 3VAWA 3L10B 4GDLA 3ZNGC 2N1WA 1GNUA 3LJ3A 4HLEA 1WX8A 2NBVB 4EOYA 2LI5A 3PS6A 4K7SA 2ZVOA 3QA8A 3U7DA 3C0RB 3L54A 2UWQA 3MTNB 3ZTDA 3NZSA 1JRUA 3O65B 2KDBA 4MGKE 4ANVA 1WR1A 4EZKA 1K8RB 1YX5B 2L0TA 2O6VD 3N30A 2JT4B 2DYBA 3TCAA 2V4LA 3EECA 1ZKHA 1L7YA 5DCNA 3PTFC 4MJSB 1KM7A 4JQWC 1WF9A 3VUYA 4FADA 2CHZA 1V5TA 4FBJB 2N9PC 2DZJA 1P3QU 3PLUA 4TQ1A 3WAMA 2BYEA 4MSQB 2L76A 4ZDVA 2KMAA 4LDTD 2J0KA 5L83A 4FA6A 4JIOU 1S1QB 4GU2A 3TL5A 4IM2A 4CO7A 1E8YA 2WX1A 2ZPNA 2KZRA 2M17A 4DBGA 2C5LC 2LGDA 2G3QB 3M62B 2BKFA 3PHXB 1UGMA 4EUTA 5CX3A 2FCMA 2KWVB 3P2BA 2LGXA 4XC2A 4FHKA 4DK5A 2XBBC 4HXDA 1E8ZA 1YIWA 2RGFA 3X23A 3WALA 5HKHA 5LXHA 3W1YA 3R3MA 4JLCA 2WX0A 4DDGD 1SGHA 2D3GA 2LRWA 3A1QA 3TJPA 3VTUA 3WAOA 1C1YB 3H1UA 1J0GA 4E3CA 4BOZB 1D3ZA 1WX7A 4LJOB 4AOFA 2M1MA 3T8MA 3ZDMC 1Y8RC 2XK5B 1LQBA 1H4RA 2GOWA 4W9JA 2LJ5A 1UD7A 2J0JA 2JF5A 1J19A 2G4SA 1J8CA 1V81A 2XK5A 3K9OB 4NQLB 4MM3A 1OGWA 2IYDB 2CHWA 1GC6A 4GXBA 1R4NI 3PRZA 3VH3B 4HCNB 3A9KB 3UQBA 2MLBA 5CHFA 2MW5A 1XD3B 3QJZA 3BY4B 3QWZB 2LVQA 2D10A 3ZW3A 5JH5C 3PPAA 4MGIE 1I35A 2IZVB 2G45B 3PRMB 2KXJA 2AL6A 2MA9B 2IY0B 5DPRA 1EF1A 3UIPB 3W1SA 5AEKB 3HM6X 4IG7B 4ICUA 2HE7A 3ALBA 1RAXA 1ISNA 1YD8U 1WJUA 4G3XB 1H8CA 2Z0EB 2IY1B 3EFUA 2JRIB 2J0MA 1UH6A 4FN2A 3B08A 3SD5A 3W1SC 2K8BA 4HJKA 3PLVA 2AL3A 4ANUA 2NS5A 3D32A 2L3ZA 3KVFB 3WIMA 4GGQA 3HM3A 4X57B 2ZCCA 3QAQA 3SHQA 4NPNA 2KN5A 1RRBA 1WM2A 4F1SA 1UBIA 2IO0B 2BKRB 2KTRB 2DAJA 4PS3A 4TKNA 5CHVC 2C60A 3AULA 2G4DB 3ZNZB 3S2AA 2QHOA 4NJ7A 2JPHA 2LGYA 2N1VA 1UBQA 4NJ6A 5LLIA 3VXWA 2KTRA 1RFAA 1IYFA 2ZVNA 4XX5A 3NHEB 4ANXA 2NBWB 4BFRA 4HCPB 1WGRA 2NPTA 4LCDE 5D2MB 1P0RA 4GDLB 1IPGA 2NBUA 4WWOA 3PT2B 3RUIB 3EHVA 1R4MI 3CMMB 2FCSA 2LWPA 3X0WA 2M0XA 4PYZA 3HHMA 3DPDA 4M0WB 3AU5A 2EMTA 5E6OA 3RCZA 3UIOB 2WWZA 5C23A 3TBLD 4WJNA 2CKHB 4BKGA 4FLHA 2KFJA 5J18A 4ASWC 3JSVA 3ZTCA 2HJ8A 2N4FA 1Q0WB 3R7QA 2KFKB 3PGEA 4NAWB 2K39A 1KJTA 3ZRFA 4II3B 3CSTA 2LRUA 1WGDA 1WZ3A 1GC7A 1V86A 2KFKA 5FR6A 1PQSA 2KOXA 2DX5B 2EKEC 4NAWA 3ZNID 2JY6A 3HK0A 4BKSD 4URKA 1Q5WB 2KC1A 4HDOA 4BBNF 4WWPA 1LXDA 1YX6B 2JZZA 3L08A 1P9DU 4KIKA 4W9LA 4GOCA 2KC2A 4CYEA 1RLFA 2DZKA 3GOEA 2BYVE 4ICVA 1WY8A 2PPHA 4KDLB 1VD2A 5KHQA 4W9IA 1SE9A 4IW0A 2C7HA 3VTVA 2K6DB 1NBFC 2L8JA 2MX2A 2PE6B 1V9JA 2B3AA 3A1QB 4PS7A 4TV3A 2KK8A 3B1LX 3DCGA 3V60A 2CU1A 3LDZE 2LVPA 5L95C 2CR5A 3AXCA 3VH4B 2NVUI 2KO3A 5TR5A 1YQBA 2KX3A 3OJ3A 3A4RA 2MRPA 4E74A 2C7MB 2L7RA 2KTFA 4G0NB 4GMVA 1TGZB 3SDLC 4EZJA 2L00B 3R66C 2ZJDA 1VCBA 1WXSA 5CHWA 3WA0A 2K8HA 4B9KA 1E7VA 4LJPB 2A4ZA 2KANA 4IM3A 2ZPYA 4DHZE 2NCNA 2Z0DB 3L16A 2O2VA 3AU4A 4HPLB 2JXXA 2MBQA 3WAPA 2K1FA 4G50A 3Q3JA 1WR6E 2ASQA 3H7PB 3PVLA 5LXIB 2L05A 1GJZA 3QQ8B 2O6VA 2LZ6A 3DVGX 3NZUA 2C7NB 2NR2A 3DVGY 4KV2A 3H7PA 2M8SA 1BT0A 2BYFA 3I3TB 3L0WB 3VFKA 2FCNA 2AWTA 3R7RA 3N3KB 3KUDB 3ZVVA 3V6CB 2HD5B 1E7UA 2K8CA 2OOBB 2I1KA 2BWES 1ZW7A 2MSED 2N7DA 4WAAA 3VTWA 2AEHA 1SIFA 3A9JA 2KJHB 4HK2A 3OAWA 2DAFA 3QCAA 3VUWA 1WFYA 1EF5A 1NDDA 4ZRIA 3DOWA 4DDID 4AWJA 5IA7A 3TMPB 4W9EA 1WM3A 1WMHB 1WXMA 2LD9A 2MCNB 4KDIC 2IBIB 3PRPB 3QIJA 3PV1A 4N9F4 3DBRI 3DVNV 1YJ1A 4MEMA 1WMHA 3AI5A 5D6JB 2NPTB 1UELA 3HIZA 4HDQA 5J17A 3T9LA 3A4SC 2JRHA 4FJZA 4KSKC 4PS8A 2KVRA 3N32A 3PREA 2DYMA 3ZO5B 4MELA 5D7GA 4E71A 4J6IA 4IWQA 1Q1OA 5EDSA 2LXAA 1V2YA 1OTRB 3OJ4B 4I6NB 2JZ3B 2KWUB 3UGBB 5C1ZA 1WXVA 3DDCB 2PEAA 3H9DA 3NY5A 4WJPA 3APFA 1LM8B 3U8ZA 3EC8A 1WIAA 3UINB 3WANA 4K1RB 4BOSC 2KQSA 4EKUA 4B95A 3DBLI 4KZCA 1MG8A 3M95A 3DQVA 4W9FA 4FJVB 4I6PA 3ZIMA 3VVWB 2WYQA 5JHAA 3JW0X 3ML8A 3JSVB 2DYOA 2PJHA 1WJNA 1WGHA 3KH0A 4K81A 4RM9A 2K25A 2RD0A 3KUZA 2RSUA 3QX1A 3B0AA 4FULA 3RZFA 2VRRB 2KQ7A 2J7QB 1UZXB 2GBNA 2LVOA 4IUMB 1WRDB 4RMAA 4ZRJA 2N9XA 3ENEA 2K6QA 2GMIC 1V5OA 3TIXA 2FUHB 1OEYJ 4II2B 2D11A 1E5WA 4OVVA 2RPQA 1E8WA 2MBHA 2WDTB 3QC8B 4ZRKA 5E6PA 4K7UA 4YL8A 1Z2MA 3DBHI 4BKTA 5G55A 1L2NA 4KIKB 1V49A 3ZRCA 2W9NA 3KYCD 1T0YA 1P1AA 4IWOA 3ZNHB 4P7IA 4NNJB 5G2NA 3PZDA 4HPMB 4MGZE 3IBEA 4DXAB 4NQKE 4EZLA 2KDEB 1WZ0A 2ZEQA 5JHBA 1WE6A 2N7EA 1P98A 4EEWA 4RM8A 4A3PA 3M3JA 4CHKA 2LUEA 2KD0A 2YLMA
chains in the Genus database with same CATH superfamily
1WH3A 1T3QA 1XCTL 1V6EA 2M19A 2WXRA 3L13A 5AZFA 1V80A 4M8NA 4GSWA 2PE9A 1K53A 2AQ2B 4IC7B 3VQIA 4A90A 2V0GA 2M4NA 1JMLA 4A20A 4PT5A 1E90A 1QZEA 1WE7A 3CIRB 4KVGB 1ZGUB 3TEXA 1D4BA 3OWEB 2KKCA 3NS8A 5DPSA 1I4RA 2WXHA 3CF6E 2ZZPB 4AQ7A 4I6LB 5HFYA 2OHFA 1PGAA 1HZ5A 3RPFC 3AM9A 4L1BA 2UU7A 3A9JB 2ZCBA 3ZLZA 1CMXB 4HKQA 4IM0A 3NG0A 3RULA 2HTHA 3BK1A 4FJYA 2GBRA 2GBKA 1PDXA 5J2RA 4AUQC 4ZYNA 2CJNA 4GDKA 2CJOA 1L4ZB 1WWTA 3QK0A 5KHOA 2DHZA 3HVZA 3APDA 4W9HA 2LASA 3KYDD 3RYTA 2JUOA 3QHTA 4W9DA 4LTUA 3VDZA 4XZ4A 1C4PA 2BF8B 1GB4A 4S17A 3P4QB 3QARA 2XEWA 2YEPF 2BGFA 3CSFA 1E6EB 1M94A 4A6QA 2CHXA 3GS2A 4EE2A 2IO2B 1TY2A 2PLPA 1FD6A 3DBSA 1Z5SB 4G11A 1L6UA 1JQ4A 4ANWA 1OEYA 2WXPA 1YQ3B 4GDLA 2N1WA 1GNUA 1TJEA 4HLEA 4A9AA 2LI5A 3U7DA 3C0RB 3L54A 3ZTDA 3NZSA 1JRUA 2KDBA 4ANVA 4M0WA 2O6VD 1ZKHA 4JQWC 3RI7C 4TQ1A 3PLUA 1P3QU 4HRSA 4RGMA 5EE0A 3RNGC 4JIOU 3TL5A 1TS5A 2KZRA 3NUHB 2C5LC 2G3QB 3M62B 1SE2A 4JPSA 3P2BA 4XC2A 1AN8A 4DK5A 4HXDA 3X23A 1L4DB 3WALA 5LXHA 3R3MA 3EUB2 1B1ZA 2D3AA 3TJPA 4LJOB 4AOFA 3CWIA 1Y8RC 2WXQA 4W9JA 2LJ5A 2JF5A 3EA6A 2AQ3B 1J8CA 1V81A 2XK5A 4NQLB 3RNEC 1WRIA 4YT0B 2CHWA 1GB1A 3PRZA 4HCNB 3A9KB 3UQBA 4WWMA 2MEKA 3ZW3A 2LVQA 1NENB 4MGIE 1I4QA 2IY0B 2SAKA 3W1SA 4IG7B 2HE7A 4XYCA 1YD8U 1WJUA 2JRIB 2J0MA 4FN2A 4L23A 2DWQA 3PLVA 1XF5L 1NI3A 3Q69A 3KVFB 3WIMA 2PW9A 3P4PB 4X57B 3QAQA 2KN5A 1IGCA 4F1SA 4RGNA 2C60A 3AN1A 3U4EG 3ZNZB 2JPHA 4GLSC 4NJ6A 1UGJA 3VXWA 2KTRA 3NVYA 4ANXA 4BFRA 1XEEA 1XLOA 2N9LA 1WGRA 2NPTA 3AB5A 4LCDE 4N6EB 5D2MB 2KWDA 1FEHA 5D3IB 1IPGA 1C4CA 2JYEA 5G5GA 1ENFA 1R4MI 3HUIA 2JXTA 2L83A 5IOIA 3NVVA 3X0WA 4PYZA 3HHMA 3RCZA 5E6OA 3TBLD 1SE4A 1TKYA 3LYYA 2N4FA 3PGEA 4MACA 4NAWB 1KJTA 4II3B 3CSTA 1WGDA 1RM6C 1V86A 1EWCA 4M01A 1PQSA 3IT6B 2KOXA 3AEFB 2WHIA 3HK0A 3MC0B 2W54A 4N59A 1MG4A 4GOCA 4CYEA 1RLFA 2IGGA 1WY8A 4KDLB 4K3CA 5KHQA 4RFBA 1E0ZA 4WQMA 4KKJA 1VJKA 2L8JA 2MX2A 2RPVA 3I57A 2CR5A 1IGDA 2KX3A 2QILA 1C77A 1ACCA 1FNWA 2C7MB 4E74A 2KTFA 1WXSA 5CHWA 2K8HA 4US8A 3Q8FA 1ESFA 2JU6X 1KLGD 4HPLB 3WAPA 4G50A 3Q3JA 3QQ8B 3MFGA 1SSNA 1FNVA 1OQQA 4KV2A 2M8SA 3IAS1 4RGTA 3E56A 3VFKA 3R7RA 3N3KB 3KUDB 3ZVVA 1E7UA 2K8CA 4USAA 4ZRQA 3ZXVA 1EU4A 4YTNB 3VTWA 3A9JA 4HK2A 2E6XA 3OAWA 1F2RC 1TS3A 2DAFA 3VUWA 4LNFA 1EF5A 1FXAA 1NDDA 4DDID 2FUG1 3TMPB 2DLBA 4TMAB 1C78A 2IBIB 3PV1A 3ZJTA 2GRIA 1JWMD 5AUIA 1T6BX 1UELA 5J17A 2L32A 3A4SC 1J7BA 2KAJA 2N7JA 4KSKC 3TSSA 2BB5A 2J52A 2QC8A 1L0YB 1Q1OA 2LXAA 3BYTB 3UGBB 4I6NB 3DDCB 2PEAA 3NY5A 3APFA 4HPPA 3UINB 1JCKB 2KQSA 4FJVB 4I6PA 5JHAA 3JW0X 2MJEA 3DBHB 3U7ZA 1WJNA 4RM9A 5IP4D 4A55A 3LB8C 4YSXB 3B0AA 3RZFA 2KQ7A 1UZXB 1WRDB 4FXCA 1PUTA 2GMIC 4II2B 1ROEA 2RPQA 4YL8A 1Z2MA 2WXLA 4BKTA 5G55A 3ZRCA 2RDBC 1T0YA 4XE0A 3B2GA 1NVID 3WCQA 3AMZA 3PZDA 4MGZE 4NQKE 3B2FA 2N7EA 4EEWA 3Q8BA 1K52A 3BZDB 2PVOD 4W9KA 2LEKA 3V3XA 1QF6A 1K51A 3ZJUA 1S3SG 1XT9B 4KGTA 4W9CA 4MSMB 3DWGC 4TUUA 3BINA 1ZE3D 1D5ZC 3H6NA 3AEDB 4DWFA 1FM0D 2FNJB 2KJRA 2O2VB 1SXTA 3MJWA 2R2QA 3PHWB 2KYWA 4EFOA 2KWCA 2V1YA 4BVUC 2WXNA 2D07B 4KSLC 2FIFA 3A33B 3ZDTA 2WXMA 5E6JA 3PSEB 4MH0E 5CTRC 5E6NA 4F7ZA 4XWTA 3V6EB 4JL9A 2WQYB 3IG3A 4XDDA 2K22A 4BKSA 2R2OA 3RNBC 2W82A 5D94A 1GUAB 4WJOA 1L5PA 1XLQA 2MHJA 1IP9A 2SEBD 4WWNA 4B6WA 2OJRA 3IXSA 3N9YC 3C19A 2INDC 3A9KA 3ONSA 2MP2B 3K9PB 4IWPA 5HG2A 2DZIA 1WGYA 1HTQA 2GBJA 1IBXB 1PGBA 2BB6A 1TBEA 1SIJA 2L0FA 5BO4B 4GIVA 1I4PA 1U4AA 4J3OD 2WDRB 2GBMA 2RR9A 2VH1A 3P1MA 1EUVB 1QILA 1WYWB 1WGGA 5IAAC 2FIDA 1WXQA 2JVCA 3KW5B 4M8MA 2PVGC 4DHJD 2KLGA 1TTNA 2LGSA 2IO3B 2UYZB 2I38A 2D2QA 3NJTA 3VAWA 1WX8A 1TZOA 4K7SA 1ZXHA 1V8CA 4MGKE 3AE3B 4EZKA 2L0TA 3IAM1 3Q8CA 3W5VB 4MJSB 1HQRD 1MVKA 2N9PC 2DZJA 2BS3B 2BYEA 1YJIA 4ZDVA 4LDTD 2J0KA 1DOXA 1VRAB 2E3TA 4WIPA 1I4HA 2ZPNA 4Q2JA 1UGMA 3HVDA 4JWSC 2ON8A 2QDFA 3P63A 5IO9A 1YIWA 5HKHA 4JLCA 1C79A 3I9V1 3VTUA 4E3CA 2LGIA 3V05A 1I7HA 2HJ1A 3ZYYX 2G4SA 2XN9C 3K9OB 2MJDA 4GXBA 3J9CA 2MLBA 4C7YA 2NMQA 3FILA 2D10A 1I35A 3PRMB 2KXJA 2AL6A 5DPRA 3UIPB 5AEKB 4MT5A 1RAXA 1ISNA 1H8CA 4JX1C 2IY1B 3EFUA 2D3BA 2WNMA 1TKEA 4HJKA 2AL3A 4NJCA 1BUIC 1P7FA 1F2RI 4KX6B 1WM2A 4P1CC 2BKRB 1ZXIA 4UDUC 4TKNA 5CHVC 1QLBB 2W3RA 3AULA 2QHOA 4NJ7A 4RGOS 4HROA 1IYFA 3Q6BA 1KH0A 2RMMA 1KFYB 1LO5D 4JWUC 1QOAA 1VDVA 3NS1A 1D5MC 1FPYA 2W3SA 2M0XA 3AV8A 2LHEA 3AU5A 2WWZA 5C23A 4FLHA 5LNK1 1BMLC 1FCLA 2HJ8A 1Q0WB 2FBWB 1MFWA 2LRUA 3AE9B 2KFKA 5FR6A 2DX5B 1ZUD2 1L0VB 3RNAC 2KC1A 3L4PA 1RWSA 2JZZA 1QOFA 3L08A 1P9DU 2BS4B 2K0PA 2BYVE 2ZW0A 2PPHA 2QMTA 3BVMA 1SE9A 3AE8B 2K5PA 1T0QC 3ZQ4A 2C7HA 2K6DB 1NBFC 2PE6B 3A1QB 1MI0A 3B1LX 1JWBD 1R4NB 3V60A 2CU1A 4LNOA 2LVPA 4YTMB 5L95C 2GLSA 5TR5A 1YQBA 3OJ3A 2MRPA 2X8XX 3SDLC 3FAHA 2OJWA 1VCBA 4B0EA 4JE3B 2HDEA 2KANA 1ET6A 5EE1A 1N60A 2O2VA 4ARCA 3PVLA 1VLBA 2L1AA 3NZUA 2NR2A 3PZ7A 1YJJA 4DQOC 3H7PA 1BT0A 2IGDA 1V1OA 1K50A 3L0WB 2FCNA 2AWTA 1FRDA 2WDQB 2KVZA 1MPEA 2I1KA 2BW2A 1MJDA 2BWES 3B9JA 2N7DA 3MHZA 2W55A 3QCAA 1FXIA 4XWWA 1BXTA 2ICIA 1WMHB 4XGAB 4OZBA 1TYGB 3DHIC 3PRPB 3N20C 5D6JB 4ARIA 3HIZA 5BYQA 4IKGA 3T9LA 4KGRA 4FJZA 2CU3A 4ZHPA 3N32A 3ZO5B 1AW7A 4IWQA 5EDSA 1OTRB 2BVCA 2JZ3B 2KWUB 2X38A 3VR8B 1WIAA 4K1RB 4BOSC 4D2KA 4B95A 3DBLI 1MG8A 4S0RA 4W9FA 3ML8A 3JSVB 2PJHA 3KUZA 1CQVA 1EWYC 2GBNA 1VZ6A 4IUMB 2V3NA 4RMAA 3ENEA 2K6QA 3TIXA 2BTEA 1E5WA 2NTSA 1YMHE 4YXDB 2WDTB 1N5WA 4KIKB 1V49A 4P1BC 2W9NA 4RNAA 3KYCD 1P1AA 4IWOA 3ZNHB 1SB3C 2H89B 4NNJB 2QEJC 5G2NA 4HPMB 4EZLA 2KDEB 5JHBA 1WE6A 3I63C 2BYTA 1J7AA 3Q3NC 1T5XD 3N1YC 4CHKA 3AE5B 4FULA 2KD0A 3VH3B 4MJSA 4NY0A 3RD2A 3M63B 1KTKA 5FKAC 4OW0A 3V62A 3AE6B 4BZAA 3T3OA 3H8HA 4KZ0A 3GZNI 1DGJA 2BPSA 3UQAA 3VRAB 1FFVA 4C80A 1TKGA 3V61A 4HWIB 1KOTA 2ZW1A 4AS1A 5AZGA 4ACFA 2O6VB 2KNBA 2LMCA 2JX5A 4KGSA 4F8CB 4RF0A 4JGHB 3IHPC 3RNCC 4H2AA 4WJQA 1ZPSA 2Z59B 2V4IB 4FHJA 2DNFA 3AECB 3IFWB 1TIFA 2MBEA 1ZOYB 2AX5A 2INNE 2MQJA 3DBRB 3NOBA 1OQYA 5DPTA 3RZWC 1HZ6A 1KLVA 1WXAA 3AH7A 2DENB 3AEGB 4AJWA 5EE9A 1N62A 2VZKD 1XQQA 4W9GA 1G6JA 1WJ4A 1TZ1A 3LXFA 4GDKB 3UI3A 1A70A 1UWXA 2N9EB 4LNKA 2FAZA 2JSVX 3H7SA 3DVNU 3ECIA 2MBOA 4L2YA 2L52A 1R7SA 4PYUA 3I5JC 1PFDA 2CS4A 2Y5BB 1WI0A 1EM7A 1YQ4B 2PTLA 2KT7A 3JYUA 2BWFA 2PIAA 1N5XA 2KJ6A 2AYOB 5BMHA 3Q14C 5H8YE 5TSSA 2BT6A 4DHZB 1SJED 3RT3B 4YWGG 1Y56A 3UF8A 3W2DA 3E9SA 1UNSA 4K7WA 2V3SA 3OLMD 3PO0A 1A5RA 2C9WB 1WYGA 3ZNGC 1N63A 2N0SB 2NBVB 2G9HD 3AE4B 3PS6A 5C2TB 2ZVOA 2UWQA 2IDYA 3O65B 3IT4B 1JWSD 1OQRA 1D6EC 3N30A 1T0RC 4WH4A 3EECA 5BMGA 4LK0M 3NVZA 1KM7A 3VUYA 2CHZA 1JRPA 1V5TA 1XXGA 4FBJB 3WAMA 3FKYA 2L76A 4OZCA 5MPOA 5L83A 1V1PB 4FA6A 1FIQA 1S1QB 1QT9A 3Q8AA 2WXGA 4IM2A 1E8YA 4DBGA 1PYWD 2M17A 1JWUD 2LGDA 3PHXB 4EUTA 2ACZB 4FHKA 2RGFA 2WX0A 1SGHA 2LRWA 3A1QA 3WAOA 2LJIA 4P6VF 1J0GA 4BOZB 1WX7A 5HHDG 2M1MA 2INCC 4QAYA 3ZDMC 1QOGA 5I4DA 2XK5B 1LQBA 1C9FA 1JW9D 2GOWA 1WGKA 1UD7A 2J0JA 3Q2AC 1RYJA 5T8IA 1OGWA 1R4NI 2MW5A 5JH5C 2H88B 2IZVB 2IJ0A 2MA9B 1EF1A 3HM6X 4LNNA 4ICUA 3ALBA 3RN9C 3URYA 4G3XB 4R3DA 2OEDA 1N6ZA 3O13A 3W1SC 2K8BA 4XDCA 4LLGM 1DYQA 3R2IA 1UWMA 4O1NA 2NS5A 4OHJA 4GGQA 3SHQA 4NPNA 5BMIA 1RRBA 1N61A 2KTRB 2QIEB 2DAJA 4PS3A 1R4MB 2G4DB 1F0ZA 5C3JB 3S2AA 5H92C 1SF0A 2LGYA 1UBQA 1NYQA 1RFAA 2ZVNA 5GXGB 1B9RA 4XX5A 3NHEB 2NBWB 4HCPB 1P0RA 2EELA 2Y3AA 4WWOA 2NBUA 1M4VA 2JYTA 3EHVA 3CMMB 2LWPA 4KKIA 3UIOB 2LHDA 2WU5B 4BKGA 3U52E 2D5GA 3JSVA 5JXVA 2J4XA 5HI1A 3GE8C 2K39A 1WZ3A 1GC7A 2JQRB 3ZXRA 4NAWA 2EKEC 3ZNID 4BKSD 4URKA 5G5HA 4HDOA 4LNIA 1SEBD 4WWPA 1LXDA 4KIKA 2WXJA 2K9XA 4ICVA 4W9IA 4PK1A 4RH6A 1EU3A 1I4XA 1E7PB 4C7ZA 2WLBA 1V9JA 2B3AA 4PS7A 2KK8A 3DCGA 2DBYA 3LDZE 2NVUI 2KO3A 1DOYA 1QKZA 4MH8A 2L7RA 4GMVA 4MM3B 1TGZB 4EZJA 3N1ZC 2QSDA 3R66C 5D3DA 4B9KA 1E7VA 1P7EA 2A4ZA 1CZPA 2NCNA 3L16A 3GP7A 3AU4A 2MBQA 2K1FA 2L05A 3C8YA 4ZRPA 2O6VA 2KACA 2V9HA 2WU2B 4US9A 2BBCA 1FFUA 1AYFA 4K3BA 2HD5B 2OOBB 3ZGZA 1ZW7A 2MSED 2VH2A 1JROA 2AEHA 1SIFA 2GB1A 2KQ4X 3AE1B 3BVZA 5AUKA 3BWUD 4ZRIA 4AWJA 1YN3A 3SR6A 4W9EA 1WM3A 2I2YA 1WXMA 2MCNB 3AEEB 3QIJA 4N9F4 3DBRI 3DVNV 1YJ1A 3AI5A 4HDQA 2JRHA 3PREA 4IDIA 2FE8A 1FO4A 3OJ4B 1CK1A 1WXVA 3H9DA 3U8ZA 1TY0A 3WANA 2Q5WD 2KMMA 4EKUA 4KZCA 3M95A 3ZIMA 2R61A 1L6VA 2DYOA 4K81A 1WGHA 1STEA 2K25A 2RD0A 1KRHA 2RSUA 3QX1A 3T3NA 4RF1A 1C76A 2VRRB 2LVOA 2IGHA 3Q8EA 2FUHB 1OEYJ 3RMKC 4OVVA 1CJEA 2MBHA 3QC8B 1OFFA 4ZRKA 1L2NA 4K7UA 3DBHI 3KWLA 1Q10A 4RCOA 1L0XB 4P7IA 3R8BA 3IBEA 1YOVB 1WZ0A 1VZ7A 2LUMA 2LUEA 2YLMA 2WXFA 4HKZE 4DHJB 1E8XA 3AEAB 1I42A 4AP4C 3KLSX 3VUXA 4MDKE 3TEZA 1XCQL 3NVWA 3Q3FA 3BYYB 1V1PA 2EMSA 3MC9A 2D3CA 1E9MA 3ZKJC 2RDHA 3VRBB 4WQOB 4C4VB 3L17A 2JWUA 3NZ3A 1AARA 3JVZX 1FMAD 3TUOA 4AJYB 1HE8A 4MGYE 3VHTC 1V97A 1WSPA 2XNAC 2KHWB 2M0AA 2Z8LA 2IO1B 1FXTB 4GB9A 2LXCA 4LDTB 1GOZA 1NI2A 3FC4A 5JZEB 3KUCB 2ZNVB 3U2SC 2REXA 4TQ0A 4BBNC 1WJ6A 2WDVB 5GMVA 4HVBA 1F52A 3ZUNA 2MBBB 3TEYA 4OVUA 1RFKA 3MHSD 3SU8X 1EO6A 3SEBA 1C4AA 2FCQA 2JWZA 2PKOA 2WP9B 2ZNVC 3BIID 2MP2A 1C3TA 3Q3MC 1KF6B 4HEA1 3VR9B 2KDIA 4A3OA 2I1JA 2AQ1B 1GAQB 1WX9A 3ML9A 5AZHA 5DPWA 1GG3A 3PZ8A 4TSSA 2A5UA 2KMCA 1IBXA 1LFDA 3U30A 1F9JA 2DZMA 2MWSB 4GN1A 2YVCA 2KDFB 2BS2B 1J7CA 1ZP0B 2KLCA 1X1MA 2KX0A 3APCA 3EGRA 3BK2A 3RFZB 3IVFA 3L10B 3P42A 3LJ3A 3AE2B 5EE3A 4EOYA 1FNUA 3QA8A 3Q3OC 3RNFC 1HEZE 3MTNB 4DXFA 1GPXA 3DHHC 1WR1A 1K8RB 1YX5B 3TCAA 2JT4B 2DYBA 2V4LA 3KQ4A 1E10A 5IKCM 1L7YA 5DCNA 3PTFC 3TEWA 3N1XC 3EFCA 1WF9A 3MJ5A 4FADA 3P4RB 4MSQB 2KMAA 2TSSA 2J53A 1XLPA 2JZPA 4GU2A 3DWMA 4CO7A 3HRDD 2WX1A 1UF0A 2BKFA 4REZA 5CX3A 1QOBA 2FCMA 2KWVB 2LGXA 2NTTA 4WAFA 4CQNA 2EKIA 2XBBC 1E8ZA 1AWDA 3ETRA 3W1YA 1JALA 2WGSA 4DDGD 2D3GA 1C1YB 3H1UA 3ZJVA 1D3ZA 1TS2A 3T8MA 1TS4A 2J42A 2INPE 1VR9A 1H4RA 2Y5PA 2G1EA 1J19A 2N9KA 1FRRA 3R2TA 4MM3A 3FILB 2IYDB 1GC6A 4P16A 4OZAA 5IN7A 1QQRA 4WURA 1YN4A 5CHFA 1XD3B 3QJZA 1UUPA 3BY4B 3QWZB 3PPAA 2G45B 1ZDXA 4C00A 2Z0EB 1UH6A 2LFIA 3B08A 3SD5A 4ITKA 3MP9A 4ANUA 2HTME 3D32A 2L3ZA 3HM3A 2PMVA 2ZCCA 1KLUD 1YNTE 1UBIA 2Y5CA 2IO0B 2N1VA 5LLIA 1ZDVA 3AEBB 3BVGA 4GDLB 3GE3C 3PT2B 3RUIB 3SFEB 2MH7A 3AE7B 2FCSA 3DPDA 4M0WB 4OVZA 2EMTA 4WJNA 3MC8A 2CKHB 1MHXA 2KFJA 5J18A 4ASWC 4NZLB 3P4SB 3ZTCA 3R7QA 2KFKB 3ZRFA 1PGXA 3SFDB 2JY6A 1MHHE 1HXYD 2YEPB 1Q5WB 4BBNF 1F77A 1YX6B 1HA5A 4W9LA 2KC2A 2DZKA 3GOEA 1NYRA 1VD2A 4IW0A 2IPKD 3ABVB 3VTVA 1NEKB 2WXOA 4TV3A 3AXCA 3VH4B 1IUEA 3A4RA 4M02A 1SBBB 1I4GA 4G0NB 2L00B 2ZJDA 3WA0A 1F1HA 4LJPB 1HTOA 4IM3A 4DHZE 2ZPYA 2Z0DB 2KN4A 2KDMA 2JXXA 4C4VA 4ZOHC 1WR6E 2WS3B 2ASQA 3H7PB 5LXIB 1GJZA 4BAXA 3W5UB 2LZ6A 3DVGX 2C7NB 5BYRA 1D5XC 1XO3A 3DVGY 1VZ8A 3OG5A 2BYFA 3I3TB 4NAMA 4ZHOA 1TT5B 1XLNA 4YTPB 4DXGA 3V6CB 2M56B 2B76B 4N58A 1YN5A 2BQQA 4WAAA 2GI9A 2KJHB 4ZYSA 1DOIA 1WFYA 3DOWA 2WXKA 5IA7A 2ONQA 2LD9A 4C56C 2MJ3A 4KDIC 3DBLB 4MEMA 1WMHA 2NPTB 4PS8A 2KVRA 2DYMA 2QCZA 4MELA 5D7GA 4E71A 4J6IA 1FCCC 1V2YA 4B0MA 5C1ZA 4WJPA 2WXIA 1LM8B 3EC8A 2QJLA 2VZKB 4HJGE 2RDGA 3DQVA 2K3UA 4A8XC 3VVWB 2WYQA 3KH0A 3KWVA 5FR3A 1ET9A 2V3PA 2J7QB 4ZRJA 2N9XA 5BYSA 1V5OA 2D11A 1E8WA 4IOIE 5E6PA 3GB1A 1SE3A 1SJHD 1JWAD 3DHGC 3GZNB 1T0SC 4YSYB 1LGRA 4DXAB 2ZEQA 4YSZB 1P98A 3NRZA 4M00A 3W9CB 4RM8A 4A3PA 5FK9C 3M3JA
chains in the Genus database with same CATH topology
1WH3A 4MJSA 4NY0A 4DHJB 1V6EA 3RD2A 1E8XA 3L13A 3M63B 1I42A 4AP4C 4W9KA 5AZFA 3V62A 1V80A 4M8NA 3VUXA 4GSWA 4KZ0A 2PE9A 3GZNI 4MDKE 1S3SG 2BPSA 4IC7B 3Q3FA 3UQAA 1XT9B 4W9CA 4MSMB 4TUUA 3BINA 2EMSA 3VQIA 3H6NA 2M4NA 4DWFA 2FNJB 2KJRA 2O2VB 3ZKJC 3MJWA 2R2QA 3PHWB 3L17A 4WQOB 3V61A 4A20A 4HWIB 4EFOA 1KOTA 1AARA 2KWCA 1E90A 1QZEA 2V1YA 5AZGA 4BVUC 1WE7A 2O6VB 3JVZX 4KVGB 2KNBA 4AJYB 1HE8A 4F8CB 2D07B 1ZGUB 4JGHB 2KKCA 3IHPC 3NS8A 2FIFA 4KSLC 4MGYE 3A33B 3VHTC 3ZDTA 4WJQA 2Z59B 3PSEB 4MH0E 5DPSA 2KHWB 5CTRC 5E6NA 4F7ZA 3CF6E 2ZZPB 2IO1B 4FHJA 4I6LB 1FXTB 3V6EB 4GB9A 2LXCA 3IFWB 4JL9A 4LDTB 1NI2A 3IG3A 2MBEA 4BKSA 3KUCB 2ZNVB 2R2OA 5JZEB 2REXA 4TQ0A 3A9JB 4BBNC 5D94A 2MQJA 1GUAB 1WJ6A 1OQYA 2ZCBA 3NOBA 5DPTA 3RZWC 3ZLZA 1CMXB 4WJOA 5GMVA 4HVBA 3ZUNA 1WXAA 1KLVA 2DENB 1IP9A 2MBBB 4IM0A 4WWNA 2OJRA 4AJWA 4OVUA 4B6WA 3MHSD 3SU8X 1XQQA 1EO6A 4W9GA 3RULA 1G6JA 2HTHA 1WJ4A 2GBRA 4FJYA 2FCQA 2JWZA 1TZ1A 3A9KA 2GBKA 4GDKB 3ONSA 5J2RA 2MP2B 3K9PB 4AUQC 2ZNVC 4ZYNA 2N9EB 2FAZA 3H7SA 3DVNU 4GDKA 4IWPA 3ECIA 2MP2A 1C3TA 2MBOA 2DZIA 1WGYA 2KDIA 3QK0A 4A3OA 2I1JA 5KHOA 4PYUA 2DHZA 2CS4A 2GBJA 2Y5BB 1WI0A 1WX9A 3ML9A 5AZHA 5DPWA 1GG3A 3APDA 4W9HA 2LASA 1TBEA 2A5UA 3KYDD 3RYTA 2JUOA 2KMCA 2L0FA 3JYUA 3QHTA 2BWFA 4W9DA 5BO4B 1LFDA 4GIVA 1U4AA 2GBMA 3U30A 2KJ6A 2RR9A 3VDZA 4XZ4A 2AYOB 2BF8B 1F9JA 2DZMA 2MWSB 4GN1A 1EUVB 2YVCA 3QARA 2XEWA 1WYWB 2BGFA 3CSFA 1WGGA 4DHZB 5IAAC 2FIDA 2JVCA 4M8MA 1M94A 3KW5B 3RT3B 2KDFB 2CHXA 3UF8A 2IO2B 4K7WA 2V3SA 4DHJD 2KLCA 2KLGA 1X1MA 3DBSA 1Z5SB 1TTNA 2IO3B 2KX0A 2UYZB 3OLMD 4G11A 1A5RA 2D2QA 3APCA 4ANWA 2C9WB 1OEYA 3IVFA 3VAWA 3L10B 4GDLA 3ZNGC 2N1WA 1GNUA 3LJ3A 4HLEA 1WX8A 2NBVB 4EOYA 2LI5A 3PS6A 4K7SA 2ZVOA 3QA8A 3U7DA 3C0RB 3L54A 2UWQA 3MTNB 3ZTDA 3NZSA 1JRUA 3O65B 2KDBA 4MGKE 4ANVA 1WR1A 4EZKA 1K8RB 1YX5B 2L0TA 2O6VD 3N30A 2JT4B 2DYBA 3TCAA 2V4LA 3EECA 1ZKHA 1L7YA 5DCNA 3PTFC 4MJSB 1KM7A 4JQWC 1WF9A 3VUYA 4FADA 2CHZA 1V5TA 4FBJB 2N9PC 2DZJA 1P3QU 3PLUA 4TQ1A 3WAMA 2BYEA 4MSQB 2L76A 4ZDVA 2KMAA 4LDTD 2J0KA 5L83A 4FA6A 4JIOU 1S1QB 4GU2A 3TL5A 4IM2A 4CO7A 1E8YA 2WX1A 2ZPNA 2KZRA 2M17A 4DBGA 2C5LC 2LGDA 2G3QB 3M62B 2BKFA 3PHXB 1UGMA 4EUTA 5CX3A 2FCMA 2KWVB 3P2BA 2LGXA 4XC2A 4FHKA 4DK5A 2XBBC 4HXDA 1E8ZA 1YIWA 2RGFA 3X23A 3WALA 5HKHA 5LXHA 3W1YA 3R3MA 4JLCA 2WX0A 4DDGD 1SGHA 2D3GA 2LRWA 3A1QA 3TJPA 3VTUA 3WAOA 1C1YB 3H1UA 1J0GA 4E3CA 4BOZB 1D3ZA 1WX7A 4LJOB 4AOFA 2M1MA 3T8MA 3ZDMC 1Y8RC 2XK5B 1LQBA 1H4RA 2GOWA 4W9JA 2LJ5A 1UD7A 2J0JA 2JF5A 1J19A 2G4SA 1J8CA 1V81A 2XK5A 3K9OB 4NQLB 4MM3A 1OGWA 2IYDB 2CHWA 1GC6A 4GXBA 1R4NI 3PRZA 3VH3B 4HCNB 3A9KB 3UQBA 2MLBA 5CHFA 2MW5A 1XD3B 3QJZA 3BY4B 3QWZB 2LVQA 2D10A 3ZW3A 5JH5C 3PPAA 4MGIE 1I35A 2IZVB 2G45B 3PRMB 2KXJA 2AL6A 2MA9B 2IY0B 5DPRA 1EF1A 3UIPB 3W1SA 5AEKB 3HM6X 4IG7B 4ICUA 2HE7A 3ALBA 1RAXA 1ISNA 1YD8U 1WJUA 4G3XB 1H8CA 2Z0EB 2IY1B 3EFUA 2JRIB 2J0MA 1UH6A 4FN2A 3B08A 3SD5A 3W1SC 2K8BA 4HJKA 3PLVA 2AL3A 4ANUA 2NS5A 3D32A 2L3ZA 3KVFB 3WIMA 4GGQA 3HM3A 4X57B 2ZCCA 3QAQA 3SHQA 4NPNA 2KN5A 1RRBA 1WM2A 4F1SA 1UBIA 2IO0B 2BKRB 2KTRB 2DAJA 4PS3A 4TKNA 5CHVC 2C60A 3AULA 2G4DB 3ZNZB 3S2AA 2QHOA 4NJ7A 2JPHA 2LGYA 2N1VA 1UBQA 4NJ6A 5LLIA 3VXWA 2KTRA 1RFAA 1IYFA 2ZVNA 4XX5A 3NHEB 4ANXA 2NBWB 4BFRA 4HCPB 1WGRA 2NPTA 4LCDE 5D2MB 1P0RA 4GDLB 1IPGA 2NBUA 4WWOA 3PT2B 3RUIB 3EHVA 1R4MI 3CMMB 2FCSA 2LWPA 3X0WA 2M0XA 4PYZA 3HHMA 3DPDA 4M0WB 3AU5A 2EMTA 5E6OA 3RCZA 3UIOB 2WWZA 5C23A 3TBLD 4WJNA 2CKHB 4BKGA 4FLHA 2KFJA 5J18A 4ASWC 3JSVA 3ZTCA 2HJ8A 2N4FA 1Q0WB 3R7QA 2KFKB 3PGEA 4NAWB 2K39A 1KJTA 3ZRFA 4II3B 3CSTA 2LRUA 1WGDA 1WZ3A 1GC7A 1V86A 2KFKA 5FR6A 1PQSA 2KOXA 2DX5B 2EKEC 4NAWA 3ZNID 2JY6A 3HK0A 4BKSD 4URKA 1Q5WB 2KC1A 4HDOA 4BBNF 4WWPA 1LXDA 1YX6B 2JZZA 3L08A 1P9DU 4KIKA 4W9LA 4GOCA 2KC2A 4CYEA 1RLFA 2DZKA 3GOEA 2BYVE 4ICVA 1WY8A 2PPHA 4KDLB 1VD2A 5KHQA 4W9IA 1SE9A 4IW0A 2C7HA 3VTVA 2K6DB 1NBFC 2L8JA 2MX2A 2PE6B 1V9JA 2B3AA 3A1QB 4PS7A 4TV3A 2KK8A 3B1LX 3DCGA 3V60A 2CU1A 3LDZE 2LVPA 5L95C 2CR5A 3AXCA 3VH4B 2NVUI 2KO3A 5TR5A 1YQBA 2KX3A 3OJ3A 3A4RA 2MRPA 4E74A 2C7MB 2L7RA 2KTFA 4G0NB 4GMVA 1TGZB 3SDLC 4EZJA 2L00B 3R66C 2ZJDA 1VCBA 1WXSA 5CHWA 3WA0A 2K8HA 4B9KA 1E7VA 4LJPB 2A4ZA 2KANA 4IM3A 2ZPYA 4DHZE 2NCNA 2Z0DB 3L16A 2O2VA 3AU4A 4HPLB 2JXXA 2MBQA 3WAPA 2K1FA 4G50A 3Q3JA 1WR6E 2ASQA 3H7PB 3PVLA 5LXIB 2L05A 1GJZA 3QQ8B 2O6VA 2LZ6A 3DVGX 3NZUA 2C7NB 2NR2A 3DVGY 4KV2A 3H7PA 2M8SA 1BT0A 2BYFA 3I3TB 3L0WB 3VFKA 2FCNA 2AWTA 3R7RA 3N3KB 3KUDB 3ZVVA 3V6CB 2HD5B 1E7UA 2K8CA 2OOBB 2I1KA 2BWES 1ZW7A 2MSED 2N7DA 4WAAA 3VTWA 2AEHA 1SIFA 3A9JA 2KJHB 4HK2A 3OAWA 2DAFA 3QCAA 3VUWA 1WFYA 1EF5A 1NDDA 4ZRIA 3DOWA 4DDID 4AWJA 5IA7A 3TMPB 4W9EA 1WM3A 1WMHB 1WXMA 2LD9A 2MCNB 4KDIC 2IBIB 3PRPB 3QIJA 3PV1A 4N9F4 3DBRI 3DVNV 1YJ1A 4MEMA 1WMHA 3AI5A 5D6JB 2NPTB 1UELA 3HIZA 4HDQA 5J17A 3T9LA 3A4SC 2JRHA 4FJZA 4KSKC 4PS8A 2KVRA 3N32A 3PREA 2DYMA 3ZO5B 4MELA 5D7GA 4E71A 4J6IA 4IWQA 1Q1OA 5EDSA 2LXAA 1V2YA 1OTRB 3OJ4B 4I6NB 2JZ3B 2KWUB 3UGBB 5C1ZA 1WXVA 3DDCB 2PEAA 3H9DA 3NY5A 4WJPA 3APFA 1LM8B 3U8ZA 3EC8A 1WIAA 3UINB 3WANA 4K1RB 4BOSC 2KQSA 4EKUA 4B95A 3DBLI 4KZCA 1MG8A 3M95A 3DQVA 4W9FA 4FJVB 4I6PA 3ZIMA 3VVWB 2WYQA 5JHAA 3JW0X 3ML8A 3JSVB 2DYOA 2PJHA 1WJNA 1WGHA 3KH0A 4K81A 4RM9A 2K25A 2RD0A 3KUZA 2RSUA 3QX1A 3B0AA 4FULA 3RZFA 2VRRB 2KQ7A 2J7QB 1UZXB 2GBNA 2LVOA 4IUMB 1WRDB 4RMAA 4ZRJA 2N9XA 3ENEA 2K6QA 2GMIC 1V5OA 3TIXA 2FUHB 1OEYJ 4II2B 2D11A 1E5WA 4OVVA 2RPQA 1E8WA 2MBHA 2WDTB 3QC8B 4ZRKA 5E6PA 4K7UA 4YL8A 1Z2MA 3DBHI 4BKTA 5G55A 1L2NA 4KIKB 1V49A 3ZRCA 2W9NA 3KYCD 1T0YA 1P1AA 4IWOA 3ZNHB 4P7IA 4NNJB 5G2NA 3PZDA 4HPMB 4MGZE 3IBEA 4DXAB 4NQKE 4EZLA 2KDEB 1WZ0A 2ZEQA 5JHBA 1WE6A 2N7EA 1P98A 4EEWA 4RM8A 4A3PA 3M3JA 4CHKA 2LUEA 2KD0A 2YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WH3 A;  4MJS A;  4NY0 A;  4DHJ B;  1V6E A;  3RD2 A;  1E8X A;  3L13 A;  3M63 B;  1I42 A;  4AP4 C;  4W9K A;  5AZF A;  3V62 A;  1V80 A;  4M8N A;  3VUX A;  4GSW A;  4KZ0 A;  2PE9 A;  3GZN I;  4MDK E;  1S3S G;  2BPS A;  4IC7 B;  3Q3F A;  3UQA A;  1XT9 B;  4W9C A;  4MSM B;  4TUU A;  3BIN A;  2EMS A;  3VQI A;  3H6N A;  2M4N A;  4DWF A;  2FNJ B;  2KJR A;  2O2V B;  3ZKJ C;  3MJW A;  2R2Q A;  3PHW B;  3L17 A;  4WQO B;  3V61 A;  4A20 A;  4HWI B;  4EFO A;  1KOT A;  1AAR A;  2KWC A;  1E90 A;  1QZE A;  2V1Y A;  5AZG A;  4BVU C;  1WE7 A;  2O6V B;  3JVZ X;  4KVG B;  2KNB A;  4AJY B;  1HE8 A;  4F8C B;  2D07 B;  1ZGU B;  4JGH B;  2KKC A;  3IHP C;  3NS8 A;  2FIF A;  4KSL C;  4MGY E;  3A33 B;  3VHT C;  3ZDT A;  4WJQ A;  2Z59 B;  3PSE B;  4MH0 E;  5DPS A;  2KHW B;  5CTR C;  5E6N A;  4F7Z A;  3CF6 E;  2ZZP B;  2IO1 B;  4FHJ A;  4I6L B;  1FXT B;  3V6E B;  4GB9 A;  2LXC A;  3IFW B;  4JL9 A;  4LDT B;  1NI2 A;  3IG3 A;  2MBE A;  4BKS A;  3KUC B;  2ZNV B;  2R2O A;  5JZE B;  2REX A;  4TQ0 A;  3A9J B;  4BBN C;  5D94 A;  2MQJ A;  1GUA B;  1WJ6 A;  1OQY A;  2ZCB A;  3NOB A;  5DPT A;  3RZW C;  3ZLZ A;  1CMX B;  4WJO A;  5GMV A;  4HVB A;  3ZUN A;  1WXA A;  1KLV A;  2DEN B;  1IP9 A;  2MBB B;  4IM0 A;  4WWN A;  2OJR A;  4AJW A;  4OVU A;  4B6W A;  3MHS D;  3SU8 X;  1XQQ A;  1EO6 A;  4W9G A;  3RUL A;  1G6J A;  2HTH A;  1WJ4 A;  2GBR A;  4FJY A;  2FCQ A;  2JWZ A;  1TZ1 A;  3A9K A;  2GBK A;  4GDK B;  3ONS A;  5J2R A;  2MP2 B;  3K9P B;  4AUQ C;  2ZNV C;  4ZYN A;  2N9E B;  2FAZ A;  3H7S A;  3DVN U;  4GDK A;  4IWP A;  3ECI A;  2MP2 A;  1C3T A;  2MBO A;  2DZI A;  1WGY A;  2KDI A;  3QK0 A;  4A3O A;  2I1J A;  5KHO A;  4PYU A;  2DHZ A;  2CS4 A;  2GBJ A;  2Y5B B;  1WI0 A;  1WX9 A;  3ML9 A;  5AZH A;  5DPW A;  1GG3 A;  3APD A;  4W9H A;  2LAS A;  1TBE A;  2A5U A;  3KYD D;  3RYT A;  2JUO A;  2KMC A;  2L0F A;  3JYU A;  3QHT A;  2BWF A;  4W9D A;  5BO4 B;  1LFD A;  4GIV A;  1U4A A;  2GBM A;  3U30 A;  2KJ6 A;  2RR9 A;  3VDZ A;  4XZ4 A;  2AYO B;  2BF8 B;  1F9J A;  2DZM A;  2MWS B;  4GN1 A;  1EUV B;  2YVC A;  3QAR A;  2XEW A;  1WYW B;  2BGF A;  3CSF A;  1WGG A;  4DHZ B;  5IAA C;  2FID A;  2JVC A;  4M8M A;  1M94 A;  3KW5 B;  3RT3 B;  2KDF B;  2CHX A;  3UF8 A;  2IO2 B;  4K7W A;  2V3S A;  4DHJ D;  2KLC A;  2KLG A;  1X1M A;  3DBS A;  1Z5S B;  1TTN A;  2IO3 B;  2KX0 A;  2UYZ B;  3OLM D;  4G11 A;  1A5R A;  2D2Q A;  3APC A;  4ANW A;  2C9W B;  1OEY A;  3IVF A;  3VAW A;  3L10 B;  4GDL A;  3ZNG C;  2N1W A;  1GNU A;  3LJ3 A;  4HLE A;  1WX8 A;  2NBV B;  4EOY A;  2LI5 A;  3PS6 A;  4K7S A;  2ZVO A;  3QA8 A;  3U7D A;  3C0R B;  3L54 A;  2UWQ A;  3MTN B;  3ZTD A;  3NZS A;  1JRU A;  3O65 B;  2KDB A;  4MGK E;  4ANV A;  1WR1 A;  4EZK A;  1K8R B;  1YX5 B;  2L0T A;  2O6V D;  3N30 A;  2JT4 B;  2DYB A;  3TCA A;  2V4L A;  3EEC A;  1ZKH A;  1L7Y A;  5DCN A;  3PTF C;  4MJS B;  1KM7 A;  4JQW C;  1WF9 A;  3VUY A;  4FAD A;  2CHZ A;  1V5T A;  4FBJ B;  2N9P C;  2DZJ A;  1P3Q U;  3PLU A;  4TQ1 A;  3WAM A;  2BYE A;  4MSQ B;  2L76 A;  4ZDV A;  2KMA A;  4LDT D;  2J0K A;  5L83 A;  4FA6 A;  4JIO U;  1S1Q B;  4GU2 A;  3TL5 A;  4IM2 A;  4CO7 A;  1E8Y A;  2WX1 A;  2ZPN A;  2KZR A;  2M17 A;  4DBG A;  2C5L C;  2LGD A;  2G3Q B;  3M62 B;  2BKF A;  3PHX B;  1UGM A;  4EUT A;  5CX3 A;  2FCM A;  2KWV B;  3P2B A;  2LGX A;  4XC2 A;  4FHK A;  4DK5 A;  2XBB C;  4HXD A;  1E8Z A;  1YIW A;  2RGF A;  3X23 A;  3WAL A;  5HKH A;  5LXH A;  3W1Y A;  3R3M A;  4JLC A;  2WX0 A;  4DDG D;  1SGH A;  2D3G A;  2LRW A;  3A1Q A;  3TJP A;  3VTU A;  3WAO A;  1C1Y B;  3H1U A;  1J0G A;  4E3C A;  4BOZ B;  1D3Z A;  1WX7 A;  4LJO B;  4AOF A;  2M1M A;  3T8M A;  3ZDM C;  1Y8R C;  2XK5 B;  1LQB A;  1H4R A;  2GOW A;  4W9J A;  2LJ5 A;  1UD7 A;  2J0J A;  2JF5 A;  1J19 A;  2G4S A;  1J8C A;  1V81 A;  2XK5 A;  3K9O B;  4NQL B;  4MM3 A;  1OGW A;  2IYD B;  2CHW A;  1GC6 A;  4GXB A;  1R4N I;  3PRZ A;  3VH3 B;  4HCN B;  3A9K B;  3UQB A;  2MLB A;  5CHF A;  2MW5 A;  1XD3 B;  3QJZ A;  3BY4 B;  3QWZ B;  2LVQ A;  2D10 A;  3ZW3 A;  5JH5 C;  3PPA A;  4MGI E;  1I35 A;  2IZV B;  2G45 B;  3PRM B;  2KXJ A;  2AL6 A;  2MA9 B;  2IY0 B;  5DPR A;  1EF1 A;  3UIP B;  3W1S A;  5AEK B;  3HM6 X;  4IG7 B;  4ICU A;  2HE7 A;  3ALB A;  1RAX A;  1ISN A;  1YD8 U;  1WJU A;  4G3X B;  1H8C A;  2Z0E B;  2IY1 B;  3EFU A;  2JRI B;  2J0M A;  1UH6 A;  4FN2 A;  3B08 A;  3SD5 A;  3W1S C;  2K8B A;  4HJK A;  3PLV A;  2AL3 A;  4ANU A;  2NS5 A;  3D32 A;  2L3Z A;  3KVF B;  3WIM A;  4GGQ A;  3HM3 A;  4X57 B;  2ZCC A;  3QAQ A;  3SHQ A;  4NPN A;  2KN5 A;  1RRB A;  1WM2 A;  4F1S A;  1UBI A;  2IO0 B;  2BKR B;  2KTR B;  2DAJ A;  4PS3 A;  4TKN A;  5CHV C;  2C60 A;  3AUL A;  2G4D B;  3ZNZ B;  3S2A A;  2QHO A;  4NJ7 A;  2JPH A;  2LGY A;  2N1V A;  1UBQ A;  4NJ6 A;  5LLI A;  3VXW A;  2KTR A;  1RFA A;  1IYF A;  2ZVN A;  4XX5 A;  3NHE B;  4ANX A;  2NBW B;  4BFR A;  4HCP B;  1WGR A;  2NPT A;  4LCD E;  5D2M B;  1P0R A;  4GDL B;  1IPG A;  2NBU A;  4WWO A;  3PT2 B;  3RUI B;  3EHV A;  1R4M I;  3CMM B;  2FCS A;  2LWP A;  3X0W A;  2M0X A;  4PYZ A;  3HHM A;  3DPD A;  4M0W B;  3AU5 A;  2EMT A;  5E6O A;  3RCZ A;  3UIO B;  2WWZ A;  5C23 A;  3TBL D;  4WJN A;  2CKH B;  4BKG A;  4FLH A;  2KFJ A;  5J18 A;  4ASW C;  3JSV A;  3ZTC A;  2HJ8 A;  2N4F A;  1Q0W B;  3R7Q A;  2KFK B;  3PGE A;  4NAW B;  2K39 A;  1KJT A;  3ZRF A;  4II3 B;  3CST A;  2LRU A;  1WGD A;  1WZ3 A;  1GC7 A;  1V86 A;  2KFK A;  5FR6 A;  1PQS A;  2KOX A;  2DX5 B;  2EKE C;  4NAW A;  3ZNI D;  2JY6 A;  3HK0 A;  4BKS D;  4URK A;  1Q5W B;  2KC1 A;  4HDO A;  4BBN F;  4WWP A;  1LXD A;  1YX6 B;  2JZZ A;  3L08 A;  1P9D U;  4KIK A;  4W9L A;  4GOC A;  2KC2 A;  4CYE A;  1RLF A;  2DZK A;  3GOE A;  2BYV E;  4ICV A;  1WY8 A;  2PPH A;  4KDL B;  1VD2 A;  5KHQ A;  4W9I A;  1SE9 A;  4IW0 A;  2C7H A;  3VTV A;  2K6D B;  1NBF C;  2L8J A;  2MX2 A;  2PE6 B;  1V9J A;  2B3A A;  3A1Q B;  4PS7 A;  4TV3 A;  2KK8 A;  3B1L X;  3DCG A;  3V60 A;  2CU1 A;  3LDZ E;  2LVP A;  5L95 C;  2CR5 A;  3AXC A;  3VH4 B;  2NVU I;  2KO3 A;  5TR5 A;  1YQB A;  2KX3 A;  3OJ3 A;  3A4R A;  2MRP A;  4E74 A;  2C7M B;  2L7R A;  2KTF A;  4G0N B;  4GMV A;  1TGZ B;  3SDL C;  4EZJ A;  2L00 B;  3R66 C;  2ZJD A;  1VCB A;  1WXS A;  5CHW A;  3WA0 A;  2K8H A;  4B9K A;  1E7V A;  4LJP B;  2A4Z A;  2KAN A;  4IM3 A;  2ZPY A;  4DHZ E;  2NCN A;  2Z0D B;  3L16 A;  2O2V A;  3AU4 A;  4HPL B;  2JXX A;  2MBQ A;  3WAP A;  2K1F A;  4G50 A;  3Q3J A;  1WR6 E;  2ASQ A;  3H7P B;  3PVL A;  5LXI B;  2L05 A;  1GJZ A;  3QQ8 B;  2O6V A;  2LZ6 A;  3DVG X;  3NZU A;  2C7N B;  2NR2 A;  3DVG Y;  4KV2 A;  3H7P A;  2M8S A;  1BT0 A;  2BYF A;  3I3T B;  3L0W B;  3VFK A;  2FCN A;  2AWT A;  3R7R A;  3N3K B;  3KUD B;  3ZVV A;  3V6C B;  2HD5 B;  1E7U A;  2K8C A;  2OOB B;  2I1K A;  2BWE S;  1ZW7 A;  2MSE D;  2N7D A;  4WAA A;  3VTW A;  2AEH A;  1SIF A;  3A9J A;  2KJH B;  4HK2 A;  3OAW A;  2DAF A;  3QCA A;  3VUW A;  1WFY A;  1EF5 A;  1NDD A;  4ZRI A;  3DOW A;  4DDI D;  4AWJ A;  5IA7 A;  3TMP B;  4W9E A;  1WM3 A;  1WMH B;  1WXM A;  2LD9 A;  2MCN B;  4KDI C;  2IBI B;  3PRP B;  3QIJ A;  3PV1 A;  4N9F 4;  3DBR I;  3DVN V;  1YJ1 A;  4MEM A;  1WMH A;  3AI5 A;  5D6J B;  2NPT B;  1UEL A;  3HIZ A;  4HDQ A;  5J17 A;  3T9L A;  3A4S C;  2JRH A;  4FJZ A;  4KSK C;  4PS8 A;  2KVR A;  3N32 A;  3PRE A;  2DYM A;  3ZO5 B;  4MEL A;  5D7G A;  4E71 A;  4J6I A;  4IWQ A;  1Q1O A;  5EDS A;  2LXA A;  1V2Y A;  1OTR B;  3OJ4 B;  4I6N B;  2JZ3 B;  2KWU B;  3UGB B;  5C1Z A;  1WXV A;  3DDC B;  2PEA A;  3H9D A;  3NY5 A;  4WJP A;  3APF A;  1LM8 B;  3U8Z A;  3EC8 A;  1WIA A;  3UIN B;  3WAN A;  4K1R B;  4BOS C;  2KQS A;  4EKU A;  4B95 A;  3DBL I;  4KZC A;  1MG8 A;  3M95 A;  3DQV A;  4W9F A;  4FJV B;  4I6P A;  3ZIM A;  3VVW B;  2WYQ A;  5JHA A;  3JW0 X;  3ML8 A;  3JSV B;  2DYO A;  2PJH A;  1WJN A;  1WGH A;  3KH0 A;  4K81 A;  4RM9 A;  2K25 A;  2RD0 A;  3KUZ A;  2RSU A;  3QX1 A;  3B0A A;  4FUL A;  3RZF A;  2VRR B;  2KQ7 A;  2J7Q B;  1UZX B;  2GBN A;  2LVO A;  4IUM B;  1WRD B;  4RMA A;  4ZRJ A;  2N9X A;  3ENE A;  2K6Q A;  2GMI C;  1V5O A;  3TIX A;  2FUH B;  1OEY J;  4II2 B;  2D11 A;  1E5W A;  4OVV A;  2RPQ A;  1E8W A;  2MBH A;  2WDT B;  3QC8 B;  4ZRK A;  5E6P A;  4K7U A;  4YL8 A;  1Z2M A;  3DBH I;  4BKT A;  5G55 A;  1L2N A;  4KIK B;  1V49 A;  3ZRC A;  2W9N A;  3KYC D;  1T0Y A;  1P1A A;  4IWO A;  3ZNH B;  4P7I A;  4NNJ B;  5G2N A;  3PZD A;  4HPM B;  4MGZ E;  3IBE A;  4DXA B;  4NQK E;  4EZL A;  2KDE B;  1WZ0 A;  2ZEQ A;  5JHB A;  1WE6 A;  2N7E A;  1P98 A;  4EEW A;  4RM8 A;  4A3P A;  3M3J A;  4CHK A;  2LUE A;  2KD0 A;  2YLM A; 
#chains in the Genus database with same CATH topology
 1WH3 A;  1T3Q A;  1XCT L;  1V6E A;  2M19 A;  2WXR A;  3L13 A;  5AZF A;  1V80 A;  4M8N A;  4GSW A;  2PE9 A;  1K53 A;  2AQ2 B;  4IC7 B;  3VQI A;  4A90 A;  2V0G A;  2M4N A;  1JML A;  4A20 A;  4PT5 A;  1E90 A;  1QZE A;  1WE7 A;  3CIR B;  4KVG B;  1ZGU B;  3TEX A;  1D4B A;  3OWE B;  2KKC A;  3NS8 A;  5DPS A;  1I4R A;  2WXH A;  3CF6 E;  2ZZP B;  4AQ7 A;  4I6L B;  5HFY A;  2OHF A;  1PGA A;  1HZ5 A;  3RPF C;  3AM9 A;  4L1B A;  2UU7 A;  3A9J B;  2ZCB A;  3ZLZ A;  1CMX B;  4HKQ A;  4IM0 A;  3NG0 A;  3RUL A;  2HTH A;  3BK1 A;  4FJY A;  2GBR A;  2GBK A;  1PDX A;  5J2R A;  4AUQ C;  4ZYN A;  2CJN A;  4GDK A;  2CJO A;  1L4Z B;  1WWT A;  3QK0 A;  5KHO A;  2DHZ A;  3HVZ A;  3APD A;  4W9H A;  2LAS A;  3KYD D;  3RYT A;  2JUO A;  3QHT A;  4W9D A;  4LTU A;  3VDZ A;  4XZ4 A;  1C4P A;  2BF8 B;  1GB4 A;  4S17 A;  3P4Q B;  3QAR A;  2XEW A;  2YEP F;  2BGF A;  3CSF A;  1E6E B;  1M94 A;  4A6Q A;  2CHX A;  3GS2 A;  4EE2 A;  2IO2 B;  1TY2 A;  2PLP A;  1FD6 A;  3DBS A;  1Z5S B;  4G11 A;  1L6U A;  1JQ4 A;  4ANW A;  1OEY A;  2WXP A;  1YQ3 B;  4GDL A;  2N1W A;  1GNU A;  1TJE A;  4HLE A;  4A9A A;  2LI5 A;  3U7D A;  3C0R B;  3L54 A;  3ZTD A;  3NZS A;  1JRU A;  2KDB A;  4ANV A;  4M0W A;  2O6V D;  1ZKH A;  4JQW C;  3RI7 C;  4TQ1 A;  3PLU A;  1P3Q U;  4HRS A;  4RGM A;  5EE0 A;  3RNG C;  4JIO U;  3TL5 A;  1TS5 A;  2KZR A;  3NUH B;  2C5L C;  2G3Q B;  3M62 B;  1SE2 A;  4JPS A;  3P2B A;  4XC2 A;  1AN8 A;  4DK5 A;  4HXD A;  3X23 A;  1L4D B;  3WAL A;  5LXH A;  3R3M A;  3EUB 2;  1B1Z A;  2D3A A;  3TJP A;  4LJO B;  4AOF A;  3CWI A;  1Y8R C;  2WXQ A;  4W9J A;  2LJ5 A;  2JF5 A;  3EA6 A;  2AQ3 B;  1J8C A;  1V81 A;  2XK5 A;  4NQL B;  3RNE C;  1WRI A;  4YT0 B;  2CHW A;  1GB1 A;  3PRZ A;  4HCN B;  3A9K B;  3UQB A;  4WWM A;  2MEK A;  3ZW3 A;  2LVQ A;  1NEN B;  4MGI E;  1I4Q A;  2IY0 B;  2SAK A;  3W1S A;  4IG7 B;  2HE7 A;  4XYC A;  1YD8 U;  1WJU A;  2JRI B;  2J0M A;  4FN2 A;  4L23 A;  2DWQ A;  3PLV A;  1XF5 L;  1NI3 A;  3Q69 A;  3KVF B;  3WIM A;  2PW9 A;  3P4P B;  4X57 B;  3QAQ A;  2KN5 A;  1IGC A;  4F1S A;  4RGN A;  2C60 A;  3AN1 A;  3U4E G;  3ZNZ B;  2JPH A;  4GLS C;  4NJ6 A;  1UGJ A;  3VXW A;  2KTR A;  3NVY A;  4ANX A;  4BFR A;  1XEE A;  1XLO A;  2N9L A;  1WGR A;  2NPT A;  3AB5 A;  4LCD E;  4N6E B;  5D2M B;  2KWD A;  1FEH A;  5D3I B;  1IPG A;  1C4C A;  2JYE A;  5G5G A;  1ENF A;  1R4M I;  3HUI A;  2JXT A;  2L83 A;  5IOI A;  3NVV A;  3X0W A;  4PYZ A;  3HHM A;  3RCZ A;  5E6O A;  3TBL D;  1SE4 A;  1TKY A;  3LYY A;  2N4F A;  3PGE A;  4MAC A;  4NAW B;  1KJT A;  4II3 B;  3CST A;  1WGD A;  1RM6 C;  1V86 A;  1EWC A;  4M01 A;  1PQS A;  3IT6 B;  2KOX A;  3AEF B;  2WHI A;  3HK0 A;  3MC0 B;  2W54 A;  4N59 A;  1MG4 A;  4GOC A;  4CYE A;  1RLF A;  2IGG A;  1WY8 A;  4KDL B;  4K3C A;  5KHQ A;  4RFB A;  1E0Z A;  4WQM A;  4KKJ A;  1VJK A;  2L8J A;  2MX2 A;  2RPV A;  3I57 A;  2CR5 A;  1IGD A;  2KX3 A;  2QIL A;  1C77 A;  1ACC A;  1FNW A;  2C7M B;  4E74 A;  2KTF A;  1WXS A;  5CHW A;  2K8H A;  4US8 A;  3Q8F A;  1ESF A;  2JU6 X;  1KLG D;  4HPL B;  3WAP A;  4G50 A;  3Q3J A;  3QQ8 B;  3MFG A;  1SSN A;  1FNV A;  1OQQ A;  4KV2 A;  2M8S A;  3IAS 1;  4RGT A;  3E56 A;  3VFK A;  3R7R A;  3N3K B;  3KUD B;  3ZVV A;  1E7U A;  2K8C A;  4USA A;  4ZRQ A;  3ZXV A;  1EU4 A;  4YTN B;  3VTW A;  3A9J A;  4HK2 A;  2E6X A;  3OAW A;  1F2R C;  1TS3 A;  2DAF A;  3VUW A;  4LNF A;  1EF5 A;  1FXA A;  1NDD A;  4DDI D;  2FUG 1;  3TMP B;  2DLB A;  4TMA B;  1C78 A;  2IBI B;  3PV1 A;  3ZJT A;  2GRI A;  1JWM D;  5AUI A;  1T6B X;  1UEL A;  5J17 A;  2L32 A;  3A4S C;  1J7B A;  2KAJ A;  2N7J A;  4KSK C;  3TSS A;  2BB5 A;  2J52 A;  2QC8 A;  1L0Y B;  1Q1O A;  2LXA A;  3BYT B;  3UGB B;  4I6N B;  3DDC B;  2PEA A;  3NY5 A;  3APF A;  4HPP A;  3UIN B;  1JCK B;  2KQS A;  4FJV B;  4I6P A;  5JHA A;  3JW0 X;  2MJE A;  3DBH B;  3U7Z A;  1WJN A;  4RM9 A;  5IP4 D;  4A55 A;  3LB8 C;  4YSX B;  3B0A A;  3RZF A;  2KQ7 A;  1UZX B;  1WRD B;  4FXC A;  1PUT A;  2GMI C;  4II2 B;  1ROE A;  2RPQ A;  4YL8 A;  1Z2M A;  2WXL A;  4BKT A;  5G55 A;  3ZRC A;  2RDB C;  1T0Y A;  4XE0 A;  3B2G A;  1NVI D;  3WCQ A;  3AMZ A;  3PZD A;  4MGZ E;  4NQK E;  3B2F A;  2N7E A;  4EEW A;  3Q8B A;  1K52 A;  3BZD B;  2PVO D;  4W9K A;  2LEK A;  3V3X A;  1QF6 A;  1K51 A;  3ZJU A;  1S3S G;  1XT9 B;  4KGT A;  4W9C A;  4MSM B;  3DWG C;  4TUU A;  3BIN A;  1ZE3 D;  1D5Z C;  3H6N A;  3AED B;  4DWF A;  1FM0 D;  2FNJ B;  2KJR A;  2O2V B;  1SXT A;  3MJW A;  2R2Q A;  3PHW B;  2KYW A;  4EFO A;  2KWC A;  2V1Y A;  4BVU C;  2WXN A;  2D07 B;  4KSL C;  2FIF A;  3A33 B;  3ZDT A;  2WXM A;  5E6J A;  3PSE B;  4MH0 E;  5CTR C;  5E6N A;  4F7Z A;  4XWT A;  3V6E B;  4JL9 A;  2WQY B;  3IG3 A;  4XDD A;  2K22 A;  4BKS A;  2R2O A;  3RNB C;  2W82 A;  5D94 A;  1GUA B;  4WJO A;  1L5P A;  1XLQ A;  2MHJ A;  1IP9 A;  2SEB D;  4WWN A;  4B6W A;  2OJR A;  3IXS A;  3N9Y C;  3C19 A;  2IND C;  3A9K A;  3ONS A;  2MP2 B;  3K9P B;  4IWP A;  5HG2 A;  2DZI A;  1WGY A;  1HTQ A;  2GBJ A;  1IBX B;  1PGB A;  2BB6 A;  1TBE A;  1SIJ A;  2L0F A;  5BO4 B;  4GIV A;  1I4P A;  1U4A A;  4J3O D;  2WDR B;  2GBM A;  2RR9 A;  2VH1 A;  3P1M A;  1EUV B;  1QIL A;  1WYW B;  1WGG A;  5IAA C;  2FID A;  1WXQ A;  2JVC A;  3KW5 B;  4M8M A;  2PVG C;  4DHJ D;  2KLG A;  1TTN A;  2LGS A;  2IO3 B;  2UYZ B;  2I38 A;  2D2Q A;  3NJT A;  3VAW A;  1WX8 A;  1TZO A;  4K7S A;  1ZXH A;  1V8C A;  4MGK E;  3AE3 B;  4EZK A;  2L0T A;  3IAM 1;  3Q8C A;  3W5V B;  4MJS B;  1HQR D;  1MVK A;  2N9P C;  2DZJ A;  2BS3 B;  2BYE A;  1YJI A;  4ZDV A;  4LDT D;  2J0K A;  1DOX A;  1VRA B;  2E3T A;  4WIP A;  1I4H A;  2ZPN A;  4Q2J A;  1UGM A;  3HVD A;  4JWS C;  2ON8 A;  2QDF A;  3P63 A;  5IO9 A;  1YIW A;  5HKH A;  4JLC A;  1C79 A;  3I9V 1;  3VTU A;  4E3C A;  2LGI A;  3V05 A;  1I7H A;  2HJ1 A;  3ZYY X;  2G4S A;  2XN9 C;  3K9O B;  2MJD A;  4GXB A;  3J9C A;  2MLB A;  4C7Y A;  2NMQ A;  3FIL A;  2D10 A;  1I35 A;  3PRM B;  2KXJ A;  2AL6 A;  5DPR A;  3UIP B;  5AEK B;  4MT5 A;  1RAX A;  1ISN A;  1H8C A;  4JX1 C;  2IY1 B;  3EFU A;  2D3B A;  2WNM A;  1TKE A;  4HJK A;  2AL3 A;  4NJC A;  1BUI C;  1P7F A;  1F2R I;  4KX6 B;  1WM2 A;  4P1C C;  2BKR B;  1ZXI A;  4UDU C;  4TKN A;  5CHV C;  1QLB B;  2W3R A;  3AUL A;  2QHO A;  4NJ7 A;  4RGO S;  4HRO A;  1IYF A;  3Q6B A;  1KH0 A;  2RMM A;  1KFY B;  1LO5 D;  4JWU C;  1QOA A;  1VDV A;  3NS1 A;  1D5M C;  1FPY A;  2W3S A;  2M0X A;  3AV8 A;  2LHE A;  3AU5 A;  2WWZ A;  5C23 A;  4FLH A;  5LNK 1;  1BML C;  1FCL A;  2HJ8 A;  1Q0W B;  2FBW B;  1MFW A;  2LRU A;  3AE9 B;  2KFK A;  5FR6 A;  2DX5 B;  1ZUD 2;  1L0V B;  3RNA C;  2KC1 A;  3L4P A;  1RWS A;  2JZZ A;  1QOF A;  3L08 A;  1P9D U;  2BS4 B;  2K0P A;  2BYV E;  2ZW0 A;  2PPH A;  2QMT A;  3BVM A;  1SE9 A;  3AE8 B;  2K5P A;  1T0Q C;  3ZQ4 A;  2C7H A;  2K6D B;  1NBF C;  2PE6 B;  3A1Q B;  1MI0 A;  3B1L X;  1JWB D;  1R4N B;  3V60 A;  2CU1 A;  4LNO A;  2LVP A;  4YTM B;  5L95 C;  2GLS A;  5TR5 A;  1YQB A;  3OJ3 A;  2MRP A;  2X8X X;  3SDL C;  3FAH A;  2OJW A;  1VCB A;  4B0E A;  4JE3 B;  2HDE A;  2KAN A;  1ET6 A;  5EE1 A;  1N60 A;  2O2V A;  4ARC A;  3PVL A;  1VLB A;  2L1A A;  3NZU A;  2NR2 A;  3PZ7 A;  1YJJ A;  4DQO C;  3H7P A;  1BT0 A;  2IGD A;  1V1O A;  1K50 A;  3L0W B;  2FCN A;  2AWT A;  1FRD A;  2WDQ B;  2KVZ A;  1MPE A;  2I1K A;  2BW2 A;  1MJD A;  2BWE S;  3B9J A;  2N7D A;  3MHZ A;  2W55 A;  3QCA A;  1FXI A;  4XWW A;  1BXT A;  2ICI A;  1WMH B;  4XGA B;  4OZB A;  1TYG B;  3DHI C;  3PRP B;  3N20 C;  5D6J B;  4ARI A;  3HIZ A;  5BYQ A;  4IKG A;  3T9L A;  4KGR A;  4FJZ A;  2CU3 A;  4ZHP A;  3N32 A;  3ZO5 B;  1AW7 A;  4IWQ A;  5EDS A;  1OTR B;  2BVC A;  2JZ3 B;  2KWU B;  2X38 A;  3VR8 B;  1WIA A;  4K1R B;  4BOS C;  4D2K A;  4B95 A;  3DBL I;  1MG8 A;  4S0R A;  4W9F A;  3ML8 A;  3JSV B;  2PJH A;  3KUZ A;  1CQV A;  1EWY C;  2GBN A;  1VZ6 A;  4IUM B;  2V3N A;  4RMA A;  3ENE A;  2K6Q A;  3TIX A;  2BTE A;  1E5W A;  2NTS A;  1YMH E;  4YXD B;  2WDT B;  1N5W A;  4KIK B;  1V49 A;  4P1B C;  2W9N A;  4RNA A;  3KYC D;  1P1A A;  4IWO A;  3ZNH B;  1SB3 C;  2H89 B;  4NNJ B;  2QEJ C;  5G2N A;  4HPM B;  4EZL A;  2KDE B;  5JHB A;  1WE6 A;  3I63 C;  2BYT A;  1J7A A;  3Q3N C;  1T5X D;  3N1Y C;  4CHK A;  3AE5 B;  4FUL A;  2KD0 A;  3VH3 B;  4MJS A;  4NY0 A;  3RD2 A;  3M63 B;  1KTK A;  5FKA C;  4OW0 A;  3V62 A;  3AE6 B;  4BZA A;  3T3O A;  3H8H A;  4KZ0 A;  3GZN I;  1DGJ A;  2BPS A;  3UQA A;  3VRA B;  1FFV A;  4C80 A;  1TKG A;  3V61 A;  4HWI B;  1KOT A;  2ZW1 A;  4AS1 A;  5AZG A;  4ACF A;  2O6V B;  2KNB A;  2LMC A;  2JX5 A;  4KGS A;  4F8C B;  4RF0 A;  4JGH B;  3IHP C;  3RNC C;  4H2A A;  4WJQ A;  1ZPS A;  2Z59 B;  2V4I B;  4FHJ A;  2DNF A;  3AEC B;  3IFW B;  1TIF A;  2MBE A;  1ZOY B;  2AX5 A;  2INN E;  2MQJ A;  3DBR B;  3NOB A;  1OQY A;  5DPT A;  3RZW C;  1HZ6 A;  1KLV A;  1WXA A;  3AH7 A;  2DEN B;  3AEG B;  4AJW A;  5EE9 A;  1N62 A;  2VZK D;  1XQQ A;  4W9G A;  1G6J A;  1WJ4 A;  1TZ1 A;  3LXF A;  4GDK B;  3UI3 A;  1A70 A;  1UWX A;  2N9E B;  4LNK A;  2FAZ A;  2JSV X;  3H7S A;  3DVN U;  3ECI A;  2MBO A;  4L2Y A;  2L52 A;  1R7S A;  4PYU A;  3I5J C;  1PFD A;  2CS4 A;  2Y5B B;  1WI0 A;  1EM7 A;  1YQ4 B;  2PTL A;  2KT7 A;  3JYU A;  2BWF A;  2PIA A;  1N5X A;  2KJ6 A;  2AYO B;  5BMH A;  3Q14 C;  5H8Y E;  5TSS A;  2BT6 A;  4DHZ B;  1SJE D;  3RT3 B;  4YWG G;  1Y56 A;  3UF8 A;  3W2D A;  3E9S A;  1UNS A;  4K7W A;  2V3S A;  3OLM D;  3PO0 A;  1A5R A;  2C9W B;  1WYG A;  3ZNG C;  1N63 A;  2N0S B;  2NBV B;  2G9H D;  3AE4 B;  3PS6 A;  5C2T B;  2ZVO A;  2UWQ A;  2IDY A;  3O65 B;  3IT4 B;  1JWS D;  1OQR A;  1D6E C;  3N30 A;  1T0R C;  4WH4 A;  3EEC A;  5BMG A;  4LK0 M;  3NVZ A;  1KM7 A;  3VUY A;  2CHZ A;  1JRP A;  1V5T A;  1XXG A;  4FBJ B;  3WAM A;  3FKY A;  2L76 A;  4OZC A;  5MPO A;  5L83 A;  1V1P B;  4FA6 A;  1FIQ A;  1S1Q B;  1QT9 A;  3Q8A A;  2WXG A;  4IM2 A;  1E8Y A;  4DBG A;  1PYW D;  2M17 A;  1JWU D;  2LGD A;  3PHX B;  4EUT A;  2ACZ B;  4FHK A;  2RGF A;  2WX0 A;  1SGH A;  2LRW A;  3A1Q A;  3WAO A;  2LJI A;  4P6V F;  1J0G A;  4BOZ B;  1WX7 A;  5HHD G;  2M1M A;  2INC C;  4QAY A;  3ZDM C;  1QOG A;  5I4D A;  2XK5 B;  1LQB A;  1C9F A;  1JW9 D;  2GOW A;  1WGK A;  1UD7 A;  2J0J A;  3Q2A C;  1RYJ A;  5T8I A;  1OGW A;  1R4N I;  2MW5 A;  5JH5 C;  2H88 B;  2IZV B;  2IJ0 A;  2MA9 B;  1EF1 A;  3HM6 X;  4LNN A;  4ICU A;  3ALB A;  3RN9 C;  3URY A;  4G3X B;  4R3D A;  2OED A;  1N6Z A;  3O13 A;  3W1S C;  2K8B A;  4XDC A;  4LLG M;  1DYQ A;  3R2I A;  1UWM A;  4O1N A;  2NS5 A;  4OHJ A;  4GGQ A;  3SHQ A;  4NPN A;  5BMI A;  1RRB A;  1N61 A;  2KTR B;  2QIE B;  2DAJ A;  4PS3 A;  1R4M B;  2G4D B;  1F0Z A;  5C3J B;  3S2A A;  5H92 C;  1SF0 A;  2LGY A;  1UBQ A;  1NYQ A;  1RFA A;  2ZVN A;  5GXG B;  1B9R A;  4XX5 A;  3NHE B;  2NBW B;  4HCP B;  1P0R A;  2EEL A;  2Y3A A;  4WWO A;  2NBU A;  1M4V A;  2JYT A;  3EHV A;  3CMM B;  2LWP A;  4KKI A;  3UIO B;  2LHD A;  2WU5 B;  4BKG A;  3U52 E;  2D5G A;  3JSV A;  5JXV A;  2J4X A;  5HI1 A;  3GE8 C;  2K39 A;  1WZ3 A;  1GC7 A;  2JQR B;  3ZXR A;  4NAW A;  2EKE C;  3ZNI D;  4BKS D;  4URK A;  5G5H A;  4HDO A;  4LNI A;  1SEB D;  4WWP A;  1LXD A;  4KIK A;  2WXJ A;  2K9X A;  4ICV A;  4W9I A;  4PK1 A;  4RH6 A;  1EU3 A;  1I4X A;  1E7P B;  4C7Z A;  2WLB A;  1V9J A;  2B3A A;  4PS7 A;  2KK8 A;  3DCG A;  2DBY A;  3LDZ E;  2NVU I;  2KO3 A;  1DOY A;  1QKZ A;  4MH8 A;  2L7R A;  4GMV A;  4MM3 B;  1TGZ B;  4EZJ A;  3N1Z C;  2QSD A;  3R66 C;  5D3D A;  4B9K A;  1E7V A;  1P7E A;  2A4Z A;  1CZP A;  2NCN A;  3L16 A;  3GP7 A;  3AU4 A;  2MBQ A;  2K1F A;  2L05 A;  3C8Y A;  4ZRP A;  2O6V A;  2KAC A;  2V9H A;  2WU2 B;  4US9 A;  2BBC A;  1FFU A;  1AYF A;  4K3B A;  2HD5 B;  2OOB B;  3ZGZ A;  1ZW7 A;  2MSE D;  2VH2 A;  1JRO A;  2AEH A;  1SIF A;  2GB1 A;  2KQ4 X;  3AE1 B;  3BVZ A;  5AUK A;  3BWU D;  4ZRI A;  4AWJ A;  1YN3 A;  3SR6 A;  4W9E A;  1WM3 A;  2I2Y A;  1WXM A;  2MCN B;  3AEE B;  3QIJ A;  4N9F 4;  3DBR I;  3DVN V;  1YJ1 A;  3AI5 A;  4HDQ A;  2JRH A;  3PRE A;  4IDI A;  2FE8 A;  1FO4 A;  3OJ4 B;  1CK1 A;  1WXV A;  3H9D A;  3U8Z A;  1TY0 A;  3WAN A;  2Q5W D;  2KMM A;  4EKU A;  4KZC A;  3M95 A;  3ZIM A;  2R61 A;  1L6V A;  2DYO A;  4K81 A;  1WGH A;  1STE A;  2K25 A;  2RD0 A;  1KRH A;  2RSU A;  3QX1 A;  3T3N A;  4RF1 A;  1C76 A;  2VRR B;  2LVO A;  2IGH A;  3Q8E A;  2FUH B;  1OEY J;  3RMK C;  4OVV A;  1CJE A;  2MBH A;  3QC8 B;  1OFF A;  4ZRK A;  1L2N A;  4K7U A;  3DBH I;  3KWL A;  1Q10 A;  4RCO A;  1L0X B;  4P7I A;  3R8B A;  3IBE A;  1YOV B;  1WZ0 A;  1VZ7 A;  2LUM A;  2LUE A;  2YLM A;  2WXF A;  4HKZ E;  4DHJ B;  1E8X A;  3AEA B;  1I42 A;  4AP4 C;  3KLS X;  3VUX A;  4MDK E;  3TEZ A;  1XCQ L;  3NVW A;  3Q3F A;  3BYY B;  1V1P A;  2EMS A;  3MC9 A;  2D3C A;  1E9M A;  3ZKJ C;  2RDH A;  3VRB B;  4WQO B;  4C4V B;  3L17 A;  2JWU A;  3NZ3 A;  1AAR A;  3JVZ X;  1FMA D;  3TUO A;  4AJY B;  1HE8 A;  4MGY E;  3VHT C;  1V97 A;  1WSP A;  2XNA C;  2KHW B;  2M0A A;  2Z8L A;  2IO1 B;  1FXT B;  4GB9 A;  2LXC A;  4LDT B;  1GOZ A;  1NI2 A;  3FC4 A;  5JZE B;  3KUC B;  2ZNV B;  3U2S C;  2REX A;  4TQ0 A;  4BBN C;  1WJ6 A;  2WDV B;  5GMV A;  4HVB A;  1F52 A;  3ZUN A;  2MBB B;  3TEY A;  4OVU A;  1RFK A;  3MHS D;  3SU8 X;  1EO6 A;  3SEB A;  1C4A A;  2FCQ A;  2JWZ A;  2PKO A;  2WP9 B;  2ZNV C;  3BII D;  2MP2 A;  1C3T A;  3Q3M C;  1KF6 B;  4HEA 1;  3VR9 B;  2KDI A;  4A3O A;  2I1J A;  2AQ1 B;  1GAQ B;  1WX9 A;  3ML9 A;  5AZH A;  5DPW A;  1GG3 A;  3PZ8 A;  4TSS A;  2A5U A;  2KMC A;  1IBX A;  1LFD A;  3U30 A;  1F9J A;  2DZM A;  2MWS B;  4GN1 A;  2YVC A;  2KDF B;  2BS2 B;  1J7C A;  1ZP0 B;  2KLC A;  1X1M A;  2KX0 A;  3APC A;  3EGR A;  3BK2 A;  3RFZ B;  3IVF A;  3L10 B;  3P42 A;  3LJ3 A;  3AE2 B;  5EE3 A;  4EOY A;  1FNU A;  3QA8 A;  3Q3O C;  3RNF C;  1HEZ E;  3MTN B;  4DXF A;  1GPX A;  3DHH C;  1WR1 A;  1K8R B;  1YX5 B;  3TCA A;  2JT4 B;  2DYB A;  2V4L A;  3KQ4 A;  1E10 A;  5IKC M;  1L7Y A;  5DCN A;  3PTF C;  3TEW A;  3N1X C;  3EFC A;  1WF9 A;  3MJ5 A;  4FAD A;  3P4R B;  4MSQ B;  2KMA A;  2TSS A;  2J53 A;  1XLP A;  2JZP A;  4GU2 A;  3DWM A;  4CO7 A;  3HRD D;  2WX1 A;  1UF0 A;  2BKF A;  4REZ A;  5CX3 A;  1QOB A;  2FCM A;  2KWV B;  2LGX A;  2NTT A;  4WAF A;  4CQN A;  2EKI A;  2XBB C;  1E8Z A;  1AWD A;  3ETR A;  3W1Y A;  1JAL A;  2WGS A;  4DDG D;  2D3G A;  1C1Y B;  3H1U A;  3ZJV A;  1D3Z A;  1TS2 A;  3T8M A;  1TS4 A;  2J42 A;  2INP E;  1VR9 A;  1H4R A;  2Y5P A;  2G1E A;  1J19 A;  2N9K A;  1FRR A;  3R2T A;  4MM3 A;  3FIL B;  2IYD B;  1GC6 A;  4P16 A;  4OZA A;  5IN7 A;  1QQR A;  4WUR A;  1YN4 A;  5CHF A;  1XD3 B;  3QJZ A;  1UUP A;  3BY4 B;  3QWZ B;  3PPA A;  2G45 B;  1ZDX A;  4C00 A;  2Z0E B;  1UH6 A;  2LFI A;  3B08 A;  3SD5 A;  4ITK A;  3MP9 A;  4ANU A;  2HTM E;  3D32 A;  2L3Z A;  3HM3 A;  2PMV A;  2ZCC A;  1KLU D;  1YNT E;  1UBI A;  2Y5C A;  2IO0 B;  2N1V A;  5LLI A;  1ZDV A;  3AEB B;  3BVG A;  4GDL B;  3GE3 C;  3PT2 B;  3RUI B;  3SFE B;  2MH7 A;  3AE7 B;  2FCS A;  3DPD A;  4M0W B;  4OVZ A;  2EMT A;  4WJN A;  3MC8 A;  2CKH B;  1MHX A;  2KFJ A;  5J18 A;  4ASW C;  4NZL B;  3P4S B;  3ZTC A;  3R7Q A;  2KFK B;  3ZRF A;  1PGX A;  3SFD B;  2JY6 A;  1MHH E;  1HXY D;  2YEP B;  1Q5W B;  4BBN F;  1F77 A;  1YX6 B;  1HA5 A;  4W9L A;  2KC2 A;  2DZK A;  3GOE A;  1NYR A;  1VD2 A;  4IW0 A;  2IPK D;  3ABV B;  3VTV A;  1NEK B;  2WXO A;  4TV3 A;  3AXC A;  3VH4 B;  1IUE A;  3A4R A;  4M02 A;  1SBB B;  1I4G A;  4G0N B;  2L00 B;  2ZJD A;  3WA0 A;  1F1H A;  4LJP B;  1HTO A;  4IM3 A;  4DHZ E;  2ZPY A;  2Z0D B;  2KN4 A;  2KDM A;  2JXX A;  4C4V A;  4ZOH C;  1WR6 E;  2WS3 B;  2ASQ A;  3H7P B;  5LXI B;  1GJZ A;  4BAX A;  3W5U B;  2LZ6 A;  3DVG X;  2C7N B;  5BYR A;  1D5X C;  1XO3 A;  3DVG Y;  1VZ8 A;  3OG5 A;  2BYF A;  3I3T B;  4NAM A;  4ZHO A;  1TT5 B;  1XLN A;  4YTP B;  4DXG A;  3V6C B;  2M56 B;  2B76 B;  4N58 A;  1YN5 A;  2BQQ A;  4WAA A;  2GI9 A;  2KJH B;  4ZYS A;  1DOI A;  1WFY A;  3DOW A;  2WXK A;  5IA7 A;  2ONQ A;  2LD9 A;  4C56 C;  2MJ3 A;  4KDI C;  3DBL B;  4MEM A;  1WMH A;  2NPT B;  4PS8 A;  2KVR A;  2DYM A;  2QCZ A;  4MEL A;  5D7G A;  4E71 A;  4J6I A;  1FCC C;  1V2Y A;  4B0M A;  5C1Z A;  4WJP A;  2WXI A;  1LM8 B;  3EC8 A;  2QJL A;  2VZK B;  4HJG E;  2RDG A;  3DQV A;  2K3U A;  4A8X C;  3VVW B;  2WYQ A;  3KH0 A;  3KWV A;  5FR3 A;  1ET9 A;  2V3P A;  2J7Q B;  4ZRJ A;  2N9X A;  5BYS A;  1V5O A;  2D11 A;  1E8W A;  4IOI E;  5E6P A;  3GB1 A;  1SE3 A;  1SJH D;  1JWA D;  3DHG C;  3GZN B;  1T0S C;  4YSY B;  1LGR A;  4DXA B;  2ZEQ A;  4YSZ B;  1P98 A;  3NRZ A;  4M00 A;  3W9C B;  4RM8 A;  4A3P A;  5FK9 C;  3M3J A; 
#chains in the Genus database with same CATH homology
 1WH3 A;  4MJS A;  4NY0 A;  4DHJ B;  1V6E A;  3RD2 A;  1E8X A;  3L13 A;  3M63 B;  1I42 A;  4AP4 C;  4W9K A;  5AZF A;  3V62 A;  1V80 A;  4M8N A;  3VUX A;  4GSW A;  4KZ0 A;  2PE9 A;  3GZN I;  4MDK E;  1S3S G;  2BPS A;  4IC7 B;  3Q3F A;  3UQA A;  1XT9 B;  4W9C A;  4MSM B;  4TUU A;  3BIN A;  2EMS A;  3VQI A;  3H6N A;  2M4N A;  4DWF A;  2FNJ B;  2KJR A;  2O2V B;  3ZKJ C;  3MJW A;  2R2Q A;  3PHW B;  3L17 A;  4WQO B;  3V61 A;  4A20 A;  4HWI B;  4EFO A;  1KOT A;  1AAR A;  2KWC A;  1E90 A;  1QZE A;  2V1Y A;  5AZG A;  4BVU C;  1WE7 A;  2O6V B;  3JVZ X;  4KVG B;  2KNB A;  4AJY B;  1HE8 A;  4F8C B;  2D07 B;  1ZGU B;  4JGH B;  2KKC A;  3IHP C;  3NS8 A;  2FIF A;  4KSL C;  4MGY E;  3A33 B;  3VHT C;  3ZDT A;  4WJQ A;  2Z59 B;  3PSE B;  4MH0 E;  5DPS A;  2KHW B;  5CTR C;  5E6N A;  4F7Z A;  3CF6 E;  2ZZP B;  2IO1 B;  4FHJ A;  4I6L B;  1FXT B;  3V6E B;  4GB9 A;  2LXC A;  3IFW B;  4JL9 A;  4LDT B;  1NI2 A;  3IG3 A;  2MBE A;  4BKS A;  3KUC B;  2ZNV B;  2R2O A;  5JZE B;  2REX A;  4TQ0 A;  3A9J B;  4BBN C;  5D94 A;  2MQJ A;  1GUA B;  1WJ6 A;  1OQY A;  2ZCB A;  3NOB A;  5DPT A;  3RZW C;  3ZLZ A;  1CMX B;  4WJO A;  5GMV A;  4HVB A;  3ZUN A;  1WXA A;  1KLV A;  2DEN B;  1IP9 A;  2MBB B;  4IM0 A;  4WWN A;  2OJR A;  4AJW A;  4OVU A;  4B6W A;  3MHS D;  3SU8 X;  1XQQ A;  1EO6 A;  4W9G A;  3RUL A;  1G6J A;  2HTH A;  1WJ4 A;  2GBR A;  4FJY A;  2FCQ A;  2JWZ A;  1TZ1 A;  3A9K A;  2GBK A;  4GDK B;  3ONS A;  5J2R A;  2MP2 B;  3K9P B;  4AUQ C;  2ZNV C;  4ZYN A;  2N9E B;  2FAZ A;  3H7S A;  3DVN U;  4GDK A;  4IWP A;  3ECI A;  2MP2 A;  1C3T A;  2MBO A;  2DZI A;  1WGY A;  2KDI A;  3QK0 A;  4A3O A;  2I1J A;  5KHO A;  4PYU A;  2DHZ A;  2CS4 A;  2GBJ A;  2Y5B B;  1WI0 A;  1WX9 A;  3ML9 A;  5AZH A;  5DPW A;  1GG3 A;  3APD A;  4W9H A;  2LAS A;  1TBE A;  2A5U A;  3KYD D;  3RYT A;  2JUO A;  2KMC A;  2L0F A;  3JYU A;  3QHT A;  2BWF A;  4W9D A;  5BO4 B;  1LFD A;  4GIV A;  1U4A A;  2GBM A;  3U30 A;  2KJ6 A;  2RR9 A;  3VDZ A;  4XZ4 A;  2AYO B;  2BF8 B;  1F9J A;  2DZM A;  2MWS B;  4GN1 A;  1EUV B;  2YVC A;  3QAR A;  2XEW A;  1WYW B;  2BGF A;  3CSF A;  1WGG A;  4DHZ B;  5IAA C;  2FID A;  2JVC A;  4M8M A;  1M94 A;  3KW5 B;  3RT3 B;  2KDF B;  2CHX A;  3UF8 A;  2IO2 B;  4K7W A;  2V3S A;  4DHJ D;  2KLC A;  2KLG A;  1X1M A;  3DBS A;  1Z5S B;  1TTN A;  2IO3 B;  2KX0 A;  2UYZ B;  3OLM D;  4G11 A;  1A5R A;  2D2Q A;  3APC A;  4ANW A;  2C9W B;  1OEY A;  3IVF A;  3VAW A;  3L10 B;  4GDL A;  3ZNG C;  2N1W A;  1GNU A;  3LJ3 A;  4HLE A;  1WX8 A;  2NBV B;  4EOY A;  2LI5 A;  3PS6 A;  4K7S A;  2ZVO A;  3QA8 A;  3U7D A;  3C0R B;  3L54 A;  2UWQ A;  3MTN B;  3ZTD A;  3NZS A;  1JRU A;  3O65 B;  2KDB A;  4MGK E;  4ANV A;  1WR1 A;  4EZK A;  1K8R B;  1YX5 B;  2L0T A;  2O6V D;  3N30 A;  2JT4 B;  2DYB A;  3TCA A;  2V4L A;  3EEC A;  1ZKH A;  1L7Y A;  5DCN A;  3PTF C;  4MJS B;  1KM7 A;  4JQW C;  1WF9 A;  3VUY A;  4FAD A;  2CHZ A;  1V5T A;  4FBJ B;  2N9P C;  2DZJ A;  1P3Q U;  3PLU A;  4TQ1 A;  3WAM A;  2BYE A;  4MSQ B;  2L76 A;  4ZDV A;  2KMA A;  4LDT D;  2J0K A;  5L83 A;  4FA6 A;  4JIO U;  1S1Q B;  4GU2 A;  3TL5 A;  4IM2 A;  4CO7 A;  1E8Y A;  2WX1 A;  2ZPN A;  2KZR A;  2M17 A;  4DBG A;  2C5L C;  2LGD A;  2G3Q B;  3M62 B;  2BKF A;  3PHX B;  1UGM A;  4EUT A;  5CX3 A;  2FCM A;  2KWV B;  3P2B A;  2LGX A;  4XC2 A;  4FHK A;  4DK5 A;  2XBB C;  4HXD A;  1E8Z A;  1YIW A;  2RGF A;  3X23 A;  3WAL A;  5HKH A;  5LXH A;  3W1Y A;  3R3M A;  4JLC A;  2WX0 A;  4DDG D;  1SGH A;  2D3G A;  2LRW A;  3A1Q A;  3TJP A;  3VTU A;  3WAO A;  1C1Y B;  3H1U A;  1J0G A;  4E3C A;  4BOZ B;  1D3Z A;  1WX7 A;  4LJO B;  4AOF A;  2M1M A;  3T8M A;  3ZDM C;  1Y8R C;  2XK5 B;  1LQB A;  1H4R A;  2GOW A;  4W9J A;  2LJ5 A;  1UD7 A;  2J0J A;  2JF5 A;  1J19 A;  2G4S A;  1J8C A;  1V81 A;  2XK5 A;  3K9O B;  4NQL B;  4MM3 A;  1OGW A;  2IYD B;  2CHW A;  1GC6 A;  4GXB A;  1R4N I;  3PRZ A;  3VH3 B;  4HCN B;  3A9K B;  3UQB A;  2MLB A;  5CHF A;  2MW5 A;  1XD3 B;  3QJZ A;  3BY4 B;  3QWZ B;  2LVQ A;  2D10 A;  3ZW3 A;  5JH5 C;  3PPA A;  4MGI E;  1I35 A;  2IZV B;  2G45 B;  3PRM B;  2KXJ A;  2AL6 A;  2MA9 B;  2IY0 B;  5DPR A;  1EF1 A;  3UIP B;  3W1S A;  5AEK B;  3HM6 X;  4IG7 B;  4ICU A;  2HE7 A;  3ALB A;  1RAX A;  1ISN A;  1YD8 U;  1WJU A;  4G3X B;  1H8C A;  2Z0E B;  2IY1 B;  3EFU A;  2JRI B;  2J0M A;  1UH6 A;  4FN2 A;  3B08 A;  3SD5 A;  3W1S C;  2K8B A;  4HJK A;  3PLV A;  2AL3 A;  4ANU A;  2NS5 A;  3D32 A;  2L3Z A;  3KVF B;  3WIM A;  4GGQ A;  3HM3 A;  4X57 B;  2ZCC A;  3QAQ A;  3SHQ A;  4NPN A;  2KN5 A;  1RRB A;  1WM2 A;  4F1S A;  1UBI A;  2IO0 B;  2BKR B;  2KTR B;  2DAJ A;  4PS3 A;  4TKN A;  5CHV C;  2C60 A;  3AUL A;  2G4D B;  3ZNZ B;  3S2A A;  2QHO A;  4NJ7 A;  2JPH A;  2LGY A;  2N1V A;  1UBQ A;  4NJ6 A;  5LLI A;  3VXW A;  2KTR A;  1RFA A;  1IYF A;  2ZVN A;  4XX5 A;  3NHE B;  4ANX A;  2NBW B;  4BFR A;  4HCP B;  1WGR A;  2NPT A;  4LCD E;  5D2M B;  1P0R A;  4GDL B;  1IPG A;  2NBU A;  4WWO A;  3PT2 B;  3RUI B;  3EHV A;  1R4M I;  3CMM B;  2FCS A;  2LWP A;  3X0W A;  2M0X A;  4PYZ A;  3HHM A;  3DPD A;  4M0W B;  3AU5 A;  2EMT A;  5E6O A;  3RCZ A;  3UIO B;  2WWZ A;  5C23 A;  3TBL D;  4WJN A;  2CKH B;  4BKG A;  4FLH A;  2KFJ A;  5J18 A;  4ASW C;  3JSV A;  3ZTC A;  2HJ8 A;  2N4F A;  1Q0W B;  3R7Q A;  2KFK B;  3PGE A;  4NAW B;  2K39 A;  1KJT A;  3ZRF A;  4II3 B;  3CST A;  2LRU A;  1WGD A;  1WZ3 A;  1GC7 A;  1V86 A;  2KFK A;  5FR6 A;  1PQS A;  2KOX A;  2DX5 B;  2EKE C;  4NAW A;  3ZNI D;  2JY6 A;  3HK0 A;  4BKS D;  4URK A;  1Q5W B;  2KC1 A;  4HDO A;  4BBN F;  4WWP A;  1LXD A;  1YX6 B;  2JZZ A;  3L08 A;  1P9D U;  4KIK A;  4W9L A;  4GOC A;  2KC2 A;  4CYE A;  1RLF A;  2DZK A;  3GOE A;  2BYV E;  4ICV A;  1WY8 A;  2PPH A;  4KDL B;  1VD2 A;  5KHQ A;  4W9I A;  1SE9 A;  4IW0 A;  2C7H A;  3VTV A;  2K6D B;  1NBF C;  2L8J A;  2MX2 A;  2PE6 B;  1V9J A;  2B3A A;  3A1Q B;  4PS7 A;  4TV3 A;  2KK8 A;  3B1L X;  3DCG A;  3V60 A;  2CU1 A;  3LDZ E;  2LVP A;  5L95 C;  2CR5 A;  3AXC A;  3VH4 B;  2NVU I;  2KO3 A;  5TR5 A;  1YQB A;  2KX3 A;  3OJ3 A;  3A4R A;  2MRP A;  4E74 A;  2C7M B;  2L7R A;  2KTF A;  4G0N B;  4GMV A;  1TGZ B;  3SDL C;  4EZJ A;  2L00 B;  3R66 C;  2ZJD A;  1VCB A;  1WXS A;  5CHW A;  3WA0 A;  2K8H A;  4B9K A;  1E7V A;  4LJP B;  2A4Z A;  2KAN A;  4IM3 A;  2ZPY A;  4DHZ E;  2NCN A;  2Z0D B;  3L16 A;  2O2V A;  3AU4 A;  4HPL B;  2JXX A;  2MBQ A;  3WAP A;  2K1F A;  4G50 A;  3Q3J A;  1WR6 E;  2ASQ A;  3H7P B;  3PVL A;  5LXI B;  2L05 A;  1GJZ A;  3QQ8 B;  2O6V A;  2LZ6 A;  3DVG X;  3NZU A;  2C7N B;  2NR2 A;  3DVG Y;  4KV2 A;  3H7P A;  2M8S A;  1BT0 A;  2BYF A;  3I3T B;  3L0W B;  3VFK A;  2FCN A;  2AWT A;  3R7R A;  3N3K B;  3KUD B;  3ZVV A;  3V6C B;  2HD5 B;  1E7U A;  2K8C A;  2OOB B;  2I1K A;  2BWE S;  1ZW7 A;  2MSE D;  2N7D A;  4WAA A;  3VTW A;  2AEH A;  1SIF A;  3A9J A;  2KJH B;  4HK2 A;  3OAW A;  2DAF A;  3QCA A;  3VUW A;  1WFY A;  1EF5 A;  1NDD A;  4ZRI A;  3DOW A;  4DDI D;  4AWJ A;  5IA7 A;  3TMP B;  4W9E A;  1WM3 A;  1WMH B;  1WXM A;  2LD9 A;  2MCN B;  4KDI C;  2IBI B;  3PRP B;  3QIJ A;  3PV1 A;  4N9F 4;  3DBR I;  3DVN V;  1YJ1 A;  4MEM A;  1WMH A;  3AI5 A;  5D6J B;  2NPT B;  1UEL A;  3HIZ A;  4HDQ A;  5J17 A;  3T9L A;  3A4S C;  2JRH A;  4FJZ A;  4KSK C;  4PS8 A;  2KVR A;  3N32 A;  3PRE A;  2DYM A;  3ZO5 B;  4MEL A;  5D7G A;  4E71 A;  4J6I A;  4IWQ A;  1Q1O A;  5EDS A;  2LXA A;  1V2Y A;  1OTR B;  3OJ4 B;  4I6N B;  2JZ3 B;  2KWU B;  3UGB B;  5C1Z A;  1WXV A;  3DDC B;  2PEA A;  3H9D A;  3NY5 A;  4WJP A;  3APF A;  1LM8 B;  3U8Z A;  3EC8 A;  1WIA A;  3UIN B;  3WAN A;  4K1R B;  4BOS C;  2KQS A;  4EKU A;  4B95 A;  3DBL I;  4KZC A;  1MG8 A;  3M95 A;  3DQV A;  4W9F A;  4FJV B;  4I6P A;  3ZIM A;  3VVW B;  2WYQ A;  5JHA A;  3JW0 X;  3ML8 A;  3JSV B;  2DYO A;  2PJH A;  1WJN A;  1WGH A;  3KH0 A;  4K81 A;  4RM9 A;  2K25 A;  2RD0 A;  3KUZ A;  2RSU A;  3QX1 A;  3B0A A;  4FUL A;  3RZF A;  2VRR B;  2KQ7 A;  2J7Q B;  1UZX B;  2GBN A;  2LVO A;  4IUM B;  1WRD B;  4RMA A;  4ZRJ A;  2N9X A;  3ENE A;  2K6Q A;  2GMI C;  1V5O A;  3TIX A;  2FUH B;  1OEY J;  4II2 B;  2D11 A;  1E5W A;  4OVV A;  2RPQ A;  1E8W A;  2MBH A;  2WDT B;  3QC8 B;  4ZRK A;  5E6P A;  4K7U A;  4YL8 A;  1Z2M A;  3DBH I;  4BKT A;  5G55 A;  1L2N A;  4KIK B;  1V49 A;  3ZRC A;  2W9N A;  3KYC D;  1T0Y A;  1P1A A;  4IWO A;  3ZNH B;  4P7I A;  4NNJ B;  5G2N A;  3PZD A;  4HPM B;  4MGZ E;  3IBE A;  4DXA B;  4NQK E;  4EZL A;  2KDE B;  1WZ0 A;  2ZEQ A;  5JHB A;  1WE6 A;  2N7E A;  1P98 A;  4EEW A;  4RM8 A;  4A3P A;  3M3J A;  4CHK A;  2LUE A;  2KD0 A;  2YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...