2MP2A

Solution structure of sumo dimer in complex with sim2-3 from rnf4
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
82
structure length
82
Chain Sequence
GTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 3
publication title Structural insight into SUMO chain recognition and manipulation by the ubiquitin ligase RNF4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2014-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mp2A00
5G2NA 3L10B 1UBIA 2LVQA 3K9PB 4FA6A 3PREA 1LXDA 1RLFA 2LASA 1VD2A 2WX0A 4IUMB 4PYUA 3W1SC 4EZJA 2JRIB 3ML8A 2KDFB 4F1SA 3RT3B 1QZEA 5C1ZA 3L16A 2L76A 2O2VA 4CO7A 2RGFA 4EKUA 3M3JA 4FULA 2MSED 2MA9B 3WALA 2DZJA 5C23A 3DVNV 2JPHA 2LXCA 2JZZA 2YLMA 3X0WA 3GZNI 3RCZA 1VCBA 4KV2A 1XD3B 4HCPB 1E90A 2FCMA 4FJVB 1YD8U 2I1KA 2G4DB 4MJSA 3W1YA 1WY8A 1WXVA 4KVGB 1YX5B 4LDTD 4MM3A 3VQIA 4FHJA 4IG7B 5GMVA 4BKTA 3H7PA 2LWPA 3WA0A 3X23A 4BBNC 3EHVA 3DPDA 3H6NA 5AZGA 4CHKA 2UWQA 3PSEB 3C0RB 1GUAB 4GU2A 3B08A 2HJ8A 2MX2A 4WQOB 4M0WB 4ZRJA 3N30A 2KQ7A 3ZTDA 2XK5B 4EOYA 3DBLI 3ZO5B 1P1AA 2KX0A 2CU1A 1UH6A 2BGFA 3M63B 2KC2A 5AZHA 5JZEB 1TGZB 2I1JA 1C1YB 4MGIE 2W9NA 3ZW3A 4W9LA 2DZIA 4BOZB 3CSTA 3RYTA 4FJYA 3RZWC 2WX1A 1T0YA 2Z0EB 1EUVB 3T8MA 2KOXA 3DOWA 2JT4B 4KZ0A 4LDTB 4AWJA 3APCA 1OQYA 5J2RA 4KSLC 4X57B 2GBJA 5KHOA 1YIWA 3DBHI 2MCNB 5IA7A 3QA8A 4HWIB 3WANA 1WIAA 2R2OA 3V6CB 2V4LA 1WZ0A 2BKRB 4KSKC 1WXAA 1J19A 2YVCA 3RUIB 1WRDB 4PS3A 1X1MA 2J7QB 5E6PA 3KUDB 2AWTA 2N1VA 2L00B 4RM8A 5JHAA 2LJ5A 4PS7A 4IWQA 4DXAB 1J0GA 1WX9A 2DYMA 4FN2A 1EF5A 2J0JA 1ISNA 3R66C 3UIOB 2G4SA 4MELA 1YJ1A 3K9OB 2DHZA 1I42A 2KXJA 4WWOA 3DVGY 5D6JB 3ZNID 2KDIA 1J8CA 3L54A 2GOWA 5BO4B 2DYBA 2GBMA 5AZFA 3JW0X 3ECIA 3PRMB 4N9F4 2MWSB 3A1QB 1GNUA 1GC6A 1IYFA 1WM3A 2WDTB 1L7YA 5CX3A 4W9HA 2AYOB 2LGYA 3ALBA 3KUCB 2J0KA 3KYCD 2OJRA 1D3ZA 4W9KA 2XEWA 2JXXA 2O6VD 1V5TA 4GN1A 3TIXA 2IY0B 2DAJA 3P2BA 4NQKE 5EDSA 1V5OA 3ZUNA 4PS8A 4DK5A 3V62A 3DVNU 2L8JA 2DZMA 2PE6B 4I6LB 1MG8A 1TBEA 3VUXA 4MDKE 3ZRCA 1K8RB 2KN5A 2NS5A 4DHJD 2XK5A 1F9JA 4EUTA 2N9XA 2LZ6A 1M94A 2FCQA 1V9JA 2DENB 1NBFC 2ZPYA 1LQBA 3NY5A 4HPMB 4KIKB 1S3SG 5JH5C 2KMCA 5L95C 2LGXA 5CTRC 2CS4A 3QX1A 4URKA 3HIZA 1OTRB 2KX3A 2N7DA 1EO6A 2NBVB 2RPQA 2C7NB 2MW5A 1WI0A 3ZKJC 4EZLA 1WFYA 4A3OA 1WF9A 4NJ7A 4WJNA 2MBBB 4ICUA 5CHVC 4AJWA 2LGDA 1WJNA 3KYDD 4ZYNA 2QHOA 1A5RA 4E74A 2KMAA 4JIOU 3U7DA 2FUHB 4G0NB 1WJUA 2AL6A 1OGWA 2K8CA 3DDCB 1Q0WB 4F7ZA 2KFJA 1H8CA 3AXCA 5D7GA 4G3XB 4B95A 3IBEA 1C3TA 1R4MI 1PQSA 2NPTB 3A9KB 3HHMA 4M8NA 1YX6B 3A33B 3N32A 2ZJDA 4M8MA 4TQ0A 4DHJB 3ZNGC 3IFWB 3OJ4B 3WIMA 2KWVB 1WE7A 2CR5A 2NBUA 2C60A 2IO2B 2V1YA 3R7QA 2K1FA 1WH3A 2BYEA 3MHSD 4B9KA 1IP9A 3TL5A 2PJHA 1GG3A 2ZVOA 2DAFA 1G6JA 3UINB 1WGDA 2Z0DB 2IYDB 3ML9A 2BF8B 3VFKA 4KZCA 3ZIMA 4ZRIA 2LRWA 3UIPB 2K25A 4HJKA 4W9DA 4BKSD 2MBOA 3PHWB 5DPRA 4K1RB 5G55A 2D3GA 1LFDA 3PTFC 3VH3B 1KM7A 4K7UA 3PVLA 2IZVB 3A1QA 3D32A 3QARA 4BKGA 3L0WB 3ZDMC 3OLMD 3UQAA 4FBJB 1FXTB 2LRUA 3VHTC 3PGEA 3QC8B 3VUYA 4JGHB 2M0XA 4TV3A 4A3PA 3HK0A 1Z5SB 1V80A 1SIFA 2B3AA 4BOSC 2FNJB 4LJOB 4DHZB 1KOTA 3V61A 3JVZX 2KVRA 2MBHA 1WM2A 4GDKB 3UQBA 2L0TA 5D94A 4KIKA 2ZNVB 4GOCA 4I6NB 4XZ4A 4W9FA 3OJ3A 4RMAA 2KO3A 3AU4A 4XC2A 3QCAA 2ZNVC 5CHFA 4PYZA 4OVVA 2ZPNA 3CSFA 2J0MA 2HTHA 4IM0A 2PPHA 3S2AA 5DCNA 1Q1OA 2VRRB 4ANWA 1P9DU 4W9JA 3DBSA 3RD2A 1WR6E 3ZRFA 4W9CA 1P98A 1YQBA 3JSVB 1WJ4A 1ZW7A 1KLVA 2BYFA 4DWFA 3O65B 4ANUA 1GJZA 2KJHB 2LVOA 2KZRA 3N3KB 4J6IA 5E6OA 3Q3FA 1NDDA 3NHEB 3OAWA 1WXMA 1AARA 2CKHB 3QK0A 3A9KA 3A9JB 3H1UA 1WGGA 2ASQA 2K39A 3M95A 4BFRA 2IO0B 4MH0E 3ZVVA 2A4ZA 4NAWB 2EKEC 1E8ZA 2L0FA 3JYUA 4ZDVA 1WMHB 4MGKE 3APDA 4E71A 2NVUI 4LJPB 3PHXB 1UD7A 4GB9A 2KQSA 2BWES 2MQJA 3B1LX 4MGZE 1E5WA 1WZ3A 2K6QA 4NPNA 2BWFA 2KANA 2FCNA 3Q3JA 4ASWC 2A5UA 2ZZPB 2REXA 3KW5B 3PRZA 1P3QU 2KHWB 4TUUA 4W9GA 4EEWA 3ZLZA 4IM3A 4JL9A 2ZCCA 2EMSA 3VVWB 4W9IA 4HPLB 4WWPA 3LDZE 2L3ZA 3T9LA 5KHQA 1Q5WB 5DPSA 4HK2A 4AUQC 2KFKB 1OEYJ 1WXSA 3NZSA 3PZDA 4DDID 5JHBA 2BPSA 4B6WA 2N1WA 2C5LC 3EECA 1GC7A 2WWZA 1H4RA 2MRPA 2JVCA 4WWNA 5E6NA 3WAMA 2HD5B 1RAXA 2JY6A 2JRHA 1V6EA 1V81A 4BBNF 3MTNB 4GDKA 3A4RA 4OVUA 5IAAC 5HKHA 1RFAA 3ONSA 2GBRA 4F8CB 5L83A 3QWZB 1SGHA 2KWCA 4YL8A 3TJPA 3EC8A 2O6VB 3QQ8B 4GGQA 4FADA 2N9PC 3IVFA 4MGYE 1OEYA 1JRUA 2OOBB 3A4SC 3RULA 3VUWA 2Z59B 2ZVNA 4BKSA 2IO1B 3TBLD 1UELA 3AULA 1RRBA 2KJ6A 4MSQB 1WR1A 2N9EB 4A20A 4BVUC 2K8BA 1U4AA 3VTWA 4AJYB 3APFA 2JZ3B 3QJZA 4K7SA 3ZDTA 2C7HA 3IHPC 1P0RA 2PEAA 2G45B 2L05A 3GOEA 4NY0A 2C9WB 3SHQA 1LM8B 4E3CA 2LUEA 2MP2B 3JSVA 2KK8A 3L17A 4DHZE 2RSUA 1WGRA 4GDLB 1S1QB 2CHZA 4FHKA 3KUZA 1XQQA 2M1MA 4LCDE 4RM9A 3TCAA 1TTNA 1UZXB 3A9JA 3TMPB 3NZUA 5LLIA 2KJRA 2V3SA 3CF6E 3H7SA 1WJ6A 3R3MA 4MEMA 1EF1A 2MLBA 3SU8X 4NAWA 1HE8A 5J17A 2ZEQA 3V6EB 1IPGA 2LD9A 3VH4B 4HCNB 1WYWB 1WMHA 2FAZA 2G3QB 3ENEA 4WJPA 4HVBA 3PS6A 4WAAA 3R7RA 2XBBC 3DCGA 1V49A 4IWPA 3U30A 4CYEA 4EFOA 1ZGUB 5DPTA 4ANXA 4GMVA 4K7WA 3I3TB 3SD5A 5DPWA 1KJTA 3DVGX 2MBEA 1UGMA 2GMIC 3IG3A 4IWOA 4KDIC 3BY4B 4KDLB 4MSMB 3ZNHB 2BKFA 1WGHA 4K81A 1CMXB 3ZTCA 2KTRB 5J18A 2D10A 4IC7B 1V86A 2C7MB 4EZKA 3UF8A 1NI2A 3VTUA 2IBIB 4AOFA 1E7VA 2KFKA 4GSWA 4II3B 1XT9B 2FCSA 1E8YA 4FLHA 2NCNA 2GBNA 3U8ZA 4AP4C 2KDBA 2LXAA 3VDZA 3H9DA 2AL3A 3EFUA 3DBRI 5D2MB 4DDGD 3VAWA 2FIDA 4TKNA 5LXIB 3QIJA 2KLGA 3PLVA 4I6PA 2KTFA 2CHXA 3WAOA 4DBGA 1WX8A 1V2YA 2O2VB 2KNBA 4HXDA 4NJ6A 4P7IA 2GBKA 3BINA 2KDEB 2WYQA 4ANVA 3V60A 2RD0A 3B0AA 3HM3A 2NBWB 2O6VA 2D2QA 2Y5BB 3PT2B 2D07B 2CHWA 2D11A 3QHTA 4JLCA 3W1SA 2N7EA 2NPTA 1E7UA 4W9EA 4MJSB 2DZKA 2KKCA 3MJWA 4WJQA 3AU5A 3ZNZB 2R2QA 2UYZB 4GXBA 1WX7A 1I35A 2L7RA 3H7PB 2JUOA 3LJ3A 3L13A 2RR9A 3KVFB 1R4NI 2DYOA 4G50A 3NOBA 4NNJB 4IW0A 2MP2A 2K6DB 2KC1A 2BYVE 4FJZA 1WGYA 2NR2A 1Y8RC 4GDLA 5AEKB 3SDLC 1WE6A 5TR5A 2IY1B 5FR6A 3PRPB 4IM2A 2DX5B 1UBQA 2ZCBA 2MBQA 5CHWA 4ZRKA 1TZ1A 3WAPA 2K8HA 1E8XA 3NS8A 4JQWC 2JF5A 1SE9A 4GIVA 3QAQA 4XX5A 2HE7A 4WJOA 1E8WA 2LVPA 3VTVA 2EMTA 4HLEA 3PV1A 1L2NA 3PLUA 2N4FA 2KWUB 5LXHA 2KD0A 3PPAA 3UGBB 2PE9A 4G11A 3L08A 4ICVA 4HDQA 2M8SA 2AEHA 2M4NA 3VXWA 1ZKHA 4HDOA 3CMMB 2IO3B 1Z2MA 3KH0A 4II2B 2M17A 3HM6X 2KTRA 4NQLB 3AI5A 3RZFA 2KLCA 3M62B 2FIFA 2JWZA 4TQ1A 2LI5A 3DQVA 1BT0A
chains in the Genus database with same CATH superfamily
3L10B 1LXDA 4RNAA 1AYFA 1WRIA 5GXGB 2KDFB 3AEDB 4DXFA 2L76A 1D4BA 2MSED 3WALA 5C23A 5BMHA 1BUIC 3RCZA 1XD3B 5BYQA 2WNMA 4KVGB 2QEJC 4OVZA 4FHJA 1K50A 1BMLC 4BBNC 3EHVA 1I4RA 2LGIA 4JPSA 3H6NA 3PSEB 2BS4B 1GUAB 3B08A 2KQ7A 4EOYA 3ZO5B 1P1AA 2KX0A 2BGFA 3AMZA 1C1YB 1SB3C 3ZW3A 3NVZA 4FJYA 2WX1A 1TY0A 3T8MA 2KYWA 1F2RC 4AWJA 2GI9A 2LEKA 2FBWB 2D3BA 5J2RA 4X57B 3DBHI 3QA8A 3WANA 4RFBA 2V3PA 1TS2A 1JMLA 1HA5A 3KUDB 4RM8A 2LGSA 5JHAA 4IWQA 1WX9A 4FN2A 3U2SC 1WSPA 3R66C 4HKQA 4MELA 4MACA 2BS3B 3K9OB 2KXJA 5D6JB 2L83A 5IP4D 2KDIA 1J8CA 3L54A 2DYBA 5AZFA 3E9SA 3ECIA 4N9F4 4YT0B 1GC6A 1L7YA 4ZHPA 4W9HA 2J0KA 3KYCD 2OJRA 1V5TA 4GN1A 2VZKD 5EDSA 2DAJA 3P2BA 4PS8A 1C77A 4DK5A 3V62A 3MP9A 2L8JA 3AEEB 2PE6B 1TBEA 3ZRCA 2KN5A 1HXYD 2N9XA 1M94A 1D6EC 1V9JA 2RDHA 2ZPYA 3NY5A 2R61A 5HHDG 3Q8BA 1C9FA 1OTRB 2KX3A 2N7DA 1I4PA 2MJEA 4A3OA 4NJ7A 1HZ6A 2IPKD 3Q8EA 2KMAA 3NZ3A 4G0NB 1WJUA 2K9XA 3AEFB 1PYWD 1H8CA 3DBLB 1XLOA 2X8XX 1FXAA 3A9KB 4IDIA 4DHJB 1TS3A 1WE7A 2NBUA 2C60A 2DBYA 2H88B 2BYEA 2ZVOA 1CQVA 2DAFA 3UINB 2Z0DB 3VFKA 4ZRIA 1FRRA 4BKSD 4N6EB 5DPRA 4XGAB 1V1PB 4YSXB 1OQRA 3L0WB 3ZDMC 1DOYA 3PGEA 1TIFA 3VUYA 2KWDA 4JGHB 3TEZA 3BWUD 1V80A 1SIFA 1R4NB 4LJOB 2DNFA 4DHZB 2IGHA 3JVZX 2MBHA 1WM2A 4GDKB 3UQBA 4QAYA 5D94A 2ZNVB 4GOCA 1HZ5A 3AU4A 1KTKA 3CSFA 1QOFA 3Q6BA 5DCNA 1Q1OA 2BQQA 4ITKA 4W9JA 1WR6E 3JSVB 1XLNA 2BYFA 4DWFA 3N3KB 2KZRA 3MC9A 4J6IA 4US9A 4DXGA 3NHEB 1WXMA 1AARA 3QK0A 1JCKB 3A9KA 2INDC 1WGGA 4BFRA 3OWEB 1SF0A 3ZVVA 1E8ZA 3APDA 1FO4A 2KQSA 4MGZE 2A5UA 2ZZPB 1YN5A 4TUUA 2WS3B 1V1PA 1SBBB 2ZCCA 3VVWB 1GOZA 4W9IA 4WWPA 3LDZE 2L3ZA 3T9LA 1Q5WB 5JHBA 4HROA 1RM6C 3PZ7A 2N9LA 2N1WA 3EA6A 4KGRA 5E6NA 2JVCA 3GE8C 1RAXA 4WH4A 1MI0A 3PO0A 3AV8A 3AEGB 3MTNB 4GDKA 3ONSA 5L83A 3QWZB 1OEYA 2OOBB 2ZVNA 5C2TB 2IO1B 4MSQB 4BVUC 3SEBA 3QJZA 4JWSC 2PEAA 3LXFA 1FIQA 3SHQA 3JSVA 3L17A 2KK8A 2RSUA 1IUEA 1CK1A 2CHZA 3AE2B 1XQQA 1M4VA 3FILB 2QJLA 3TMPB 3NZUA 2JX5A 2V3SA 1ZUD2 5H8YE 3NJTA 1IPGA 4WQMA 1ET9A 2FAZA 1FNUA 2JYEA 2RDBC 1FFVA 4IWPA 3U30A 3PZ8A 1T0RC 4ANXA 3U4EG 3HVDA 4L1BA 5DPWA 3DVGX 4KDIC 1D5ZC 4KDLB 2IDYA 4K81A 4ZHOA 2KTRB 4LK0M 1NI2A 2IBIB 4AOFA 1TKGA 1R7SA 2KDBA 2LXAA 2Q5WD 3H9DA 4DDGD 3DBRI 1DYQA 1I4HA 2KTFA 3MJ5A 4DBGA 2O2VB 1LGRA 5HFYA 1TS4A 5H92C 3PT2B 2CJNA 4JLCA 3W1SA 1WGKA 1E7UA 3MJWA 4DQOC 3AE1B 2UYZB 1WX7A 1I35A 1TY2A 2ZW1A 4M02A 2FE8A 2RR9A 3BK2A 1R4NI 1SJHD 2BYVE 4FJZA 1WGYA 2NR2A 1Y8RC 2GB1A 2N9KA 5TR5A 4XWWA 1JALA 3MHZA 1UBQA 4ZRKA 3TEWA 4KGSA 2PKOA 3NS8A 1R4MB 3IAS1 3QAQA 4C7ZA 4WJOA 1E8WA 2LVPA 3VTVA 2EMTA 1L2NA 5JXVA 4G11A 2OJWA 3P42A 4YWGG 1UUPA 3HM6X 5EE3A 2NMQA 2KTRA 4NQLB 3RZFA 2WXQA 2FIFA 2JWZA 4G50A 3ZYYX 1UBIA 2LVQA 4XWTA 4FA6A 3PREA 2LASA 1VD2A 4PYUA 4EZJA 3ML8A 3RT3B 1QZEA 1SIJA 2O2VA 3M3JA 3J9CA 3AEAB 5AUIA 2YLMA 3N20C 2JZZA 2BTEA 2Y5CA 3GZNI 1GAQB 1VCBA 4FJVB 1YD8U 2I1KA 2G4DB 3AB5A 1YX5B 1C76A 3R8BA 1TKEA 1Y56A 5FK9C 2W54A 2HJ8A 4ZRJA 3N30A 2K3UA 3HUIA 2MHJA 2CU1A 1UH6A 4RGNA 1VRAB 4W9LA 3RZWC 2Z0EB 2Y3AA 3AE9B 2JT4B 3APCA 3LYYA 4KSLC 2ZW0A 4HWIB 1YOVB 1WIAA 2R2OA 3FAHA 5EE1A 2KQ4X 1WXAA 2PLPA 2LHDA 3RUIB 1EU4A 2VH1A 1WRDB 4PS3A 1X1MA 5E6PA 3T3OA 1EM7A 2N1VA 3P4PB 3AE5B 4LTUA 4PS7A 1UWXA 4DXAB 1J0GA 1L0YB 1EF5A 1YNTE 2J0JA 1ISNA 2G4SA 3ZJTA 4WWOA 3DVGY 3RNFC 5BO4B 3URYA 3CIRB 1K53A 1UGJA 2LGYA 3KUCB 2WHIA 1VZ8A 1QILA 1D3ZA 1E6EB 2IY0B 4NQKE 3ZUNA 1N6ZA 4I6LB 1MG8A 3VUXA 4DHJD 2NS5A 3BVZA 4EUTA 2LZ6A 4CQNA 5FKAC 5JH5C 3AE7B 1S3SG 5L95C 2LGXA 4URKA 1ZXHA 2RPQA 4JWUC 4EZLA 1KRHA 4YTMB 2ONQA 2MBBB 4ICUA 2LGDA 5BYRA 3KYDD 4ZYNA 1JRPA 2FUHB 3AE6B 1TYGB 2JU6X 1OGWA 3DDCB 4F7ZA 4WAFA 2KFJA 3P1MA 4G3XB 2HDEA 3IBEA 1R4MI 1SE3A 2NPTB 3B2GA 3HHMA 3BYYB 4M8NA 2ZJDA 2AX5A 1SSNA 4D2KA 3WIMA 2CR5A 2IO2B 2V1YA 2K1FA 1WH3A 3C8YA 1GPXA 3KQ4A 2IYDB 4C4VB 2LRWA 1QT9A 3PTFC 3VH3B 2G1EA 3PVLA 4HJGE 1D5XC 4YSZB 1E7PB 1MFWA 4FBJB 3VHTC 3QC8B 3HK0A 1Z5SB 4BOSC 1QQRA 4M01A 1T0QC 2KVRA 2Z8LA 4ZOHC 2W82A 1EWCA 4XZ4A 3DHHC 4IKGA 2KO3A 3QCAA 4YTPB 2ZNVC 5CHFA 4PYZA 3E56A 2QSDA 3W9CB 2WDRB 1JROA 1XXGA 4ANWA 1NEKB 3DBSA 1PGAA 3TEYA 1WJ4A 1J7BA 2OEDA 1TS5A 2KJHB 5E6OA 2I2YA 1ROEA 3NRZA 1FRDA 3H1UA 2BT6A 3C19A 4C56C 2IO0B 4MH0E 2UU7A 2EKEC 4M00A 2BS2B 4LJPB 3B1LX 1T6BX 1ET6A 4C4VA 2KANA 3Q3JA 4USAA 3KW5B 3B9JA 1JWAD 4EEWA 1GB1A 5MPOA 2EMSA 2AQ3B 5KHQA 5DPSA 4AUQC 2KFKB 4DDID 2WXGA 2WDVB 4B6WA 3AN1A 3ZXVA 1FD6A 2MRPA 4WWNA 1NYRA 2WXIA 1AWDA 3I63C 1SE4A 1I4GA 2JRHA 1V81A 3A4RA 5IAAC 1RFAA 4JX1C 4YL8A 4GGQA 3IVFA 3VUWA 4EE2A 1OFFA 1MVKA 4A20A 1LO5D 3AH7A 4RF1A 3GOEA 4NY0A 1OQQA 1LM8B 1PUTA 2MP2B 4GDLB 3KUZA 1DOXA 2M1MA 1TTNA 1WJ6A 2MLBA 3SU8X 2INNE 3V6EB 3FC4A 2EKIA 2LD9A 3R7RA 2XBBC 3DCGA 4CYEA 1RWSA 4OW0A 4ACFA 1ACCA 1ENFA 3IG3A 4IWOA 3BY4B 3ZNHB 2BKFA 2KDMA 1CMXB 4P16A 3ZTCA 2RDGA 4EZKA 2PVOD 1EU3A 3VTUA 1E7VA 2KFKA 3TSSA 2NCNA 2GBNA 3HVZA 4AP4C 2IGDA 2AL3A 3Q69A 4TKNA 5LXIB 2QC8A 3QIJA 4UDUC 1FCCC 4I6PA 2CHXA 3WAOA 1V2YA 4HXDA 4NJ6A 4P7IA 2GBKA 3BINA 1FXIA 2KDEB 2WYQA 4ANVA 3V60A 2N0SB 5BMGA 3HM3A 2NBWB 1GB4A 2Y5BB 2NTSA 2CHWA 4P1BC 2RMMA 4W9EA 2DZKA 2KKCA 4MM3B 3ZNZB 3H7PB 3L13A 3KVFB 3Q14C 4NNJB 2MP2A 2K6DB 5FR3A 4GDLA 3RFZB 1WE6A 2WU5B 1ESFA 2IY1B 2LHEA 3PRPB 3TEXA 2ZCBA 2MBQA 3EGRA 3IT4B 1TZ1A 3WAPA 4JQWC 4XYCA 1SE9A 4YXDB 1HQRD 2HE7A 2WXHA 2SAKA 1L6VA 4HLEA 2N4FA 2LMCA 3B2FA 3PPAA 3UGBB 4ICVA 2AEHA 3VXWA 1ZKHA 4LLGM 4HDOA 3KH0A 1Z2MA 5I4DA 2GLSA 3AI5A 2KLCA 2K22A 4RH6A 2LI5A 3DQVA 2DLBA 2JZPA 3N1ZC 3Q8FA 2WDQB 4XE0A 3K9PB 2ON8A 4IUMB 2WX0A 1QOBA 5C1ZA 2ACZB 3L16A 4CO7A 2MA9B 3VR9B 3GB1A 1NYQA 4K3BA 2PVGC 1WXVA 4MM3A 4O1NA 2MEKA 1C4PA 1UWMA 3H7PA 2LWPA 3WA0A 3X23A 3ZJUA 5AZGA 4CHKA 2UWQA 2MX2A 1CJEA 2GRIA 4M0WB 4ARCA 2WXLA 3ZTDA 4LNOA 2E6XA 3BVGA 3DBLI 1YN4A 3UI3A 2MJDA 1VJKA 3M63B 2KC2A 1MHXA 5C3JB 1NENB 1TGZB 3BIID 4MGIE 2DZIA 4BOZB 3CSTA 3RYTA 3KWVA 2WXRA 1T0YA 3SFDB 2KOXA 2QDFA 4KZ0A 1VR9A 4LDTB 2V4IB 1L0VB 1N5XA 1YIWA 2JXTA 1AW7A 2MCNB 5IA7A 3V6CB 2V4LA 2V9HA 1WZ0A 4KSKC 2YVCA 2N7JA 4OZAA 3V3XA 3GS2A 2TSSA 2LUMA 2L00B 5IO9A 2LJ5A 4A8XC 4A6QA 2YEPB 2V3NA 3RI7C 1KLGD 2CU3A 5HG2A 4LNIA 3NG0A 3U52E 4S17A 3FILA 3ZNID 1QLBB 2GOWA 2GBMA 3ZGZA 2MWSB 1CZPA 1GNUA 4N59A 1IYFA 1WM3A 2WDTB 2AYOB 3RNGC 4XDDA 2XEWA 2JXXA 2O6VD 3TIXA 2V0GA 1T5XD 2Y5PA 1V5OA 4K3CA 3W5UB 3DVNU 2BB6A 4M0WA 3I57A 2WXKA 4ZRQA 4LNKA 2KAJA 1F9JA 2FCQA 4KIKB 1LQBA 4KKIA 1KF6B 3QX1A 1QKZA 3HIZA 2NBVB 1EO6A 3ZKJC 4PK1A 1WFYA 1ZOYB 1WF9A 4WJNA 1IGCA 4AJWA 2QHOA 4E74A 1PFDA 2PMVA 1N60A 3U7DA 2K5PA 2INCC 2K8CA 1QF6A 1C3TA 3ZJVA 3AE8B 3BK1A 5LNK1 1PQSA 1YX6B 2WLBA 1Q10A 3A33B 4TQ0A 4M8MA 4HRSA 1UF0A 1XCQL 3IFWB 2KN4A 2KWVB 4RF0A 2XN9C 4ZYSA 3TL5A 1IP9A 2PJHA 1GG3A 1G6JA 2BF8B 1D5MC 3UIPB 2K25A 4W9DA 3PHWB 4K1RB 1LFDA 1FPYA 1KM7A 4WWMA 2IZVB 4A55A 4BKGA 1F77A 2W3RA 3OLMD 1P7FA 1NI3A 1SXTA 1ZDVA 2FNJB 3DWMA 1V8CA 1PGBA 3EUB2 4KIKA 1JWUD 4RMAA 2M19A 1V1OA 2ZPNA 2HTHA 4L2YA 3W5VB 4KX6B 2VRRB 3NUHB 1FM0D 3DWGC 3AE4B 4W9CA 1STEA 1KLVA 1ZW7A 3O65B 3P4QB 2LVOA 3SR6A 1NDDA 3Q3NC 2BW2A 1V97A 3OAWA 5IOIA 1N63A 3A9JB 3R2IA 3M95A 4RCOA 2A4ZA 2BB5A 4NAWB 2L0FA 1K51A 3JYUA 3SFEB 4ZDVA 1WMHB 3VR8B 4E71A 2M0AA 2NVUI 1UD7A 4GB9A 1E5WA 2K6QA 2BWFA 3GP7A 2WXNA 2J53A 4OHJA 5IKCM 4W9GA 1TT5B 2KACA 2WXJA 3ZLZA 4P6VF 4JL9A 4HPLB 1VDVA 1YN3A 1OEYJ 3NZSA 2LFIA 2BPSA 3BYTB 3EECA 1GC7A 2WWZA 2D5GA 3KWLA 1V6EA 2JYTA 4OVUA 4HEA1 2GBRA 1SGHA 4JE3B 3TJPA 3EC8A 2O6VB 3Q8CA 4FADA 1K52A 5T8IA 1JRUA 3RULA 1N62A 4RGMA 2FUG1 1UELA 1RRBA 2JWUA 1WR1A 2WXFA 2JQRB 2K8BA 2JZ3B 1HTQA 2C7HA 3IHPC 1P0RA 2G45B 2L05A 2NTTA 2WXPA 4E3CA 4RGOS 2LUEA 4DHZE 1WGRA 1S1QB 4FHKA 4RM9A 1UZXB 3A9JA 1DOIA 1L6UA 1N61A 2L32A 4NAWA 1HE8A 5J17A 2ZEQA 1C79A 2DWQA 3T3NA 4C00A 4HCNB 2I38A 1WMHA 2G3QB 3ENEA 2AQ1B 3PS6A 4WAAA 1V49A 1N5WA 2H89B 4EFOA 1ZGUB 5DPTA 3I3TB 3SD5A 1C4AA 1KJTA 4MSMB 1FMAD 4IC7B 2YEPF 3UF8A 1I7HA 1XT9B 2FCSA 1IGDA 2G9HD 3U7ZA 1ZXIA 3KLSX 4WIPA 1FNWA 5D2MB 3ZQ4A 2D3CA 3VAWA 5EE9A 2KLGA 3PLVA 4N58A 3CWIA 3BVMA 3Q2AC 1ZP0B 1WX8A 2KNBA 3NS1A 2JSVX 2RD0A 3B0AA 2O6VA 2D2QA 4YSYB 2D07B 1ZPSA 2D11A 3AECB 3QHTA 2N7EA 2NPTA 4MJSB 4WJQA 3N1XC 4GXBA 4IOIE 5AUKA 1TKYA 2JUOA 3LJ3A 1MHHE 2DYOA 2M56B 4IW0A 3I9V1 2KC1A 3AE3B 3SDLC 2QMTA 3I5JC 3VRBB 3AM9A 2K8HA 3LB8C 3OG5A 4GIVA 4AS1A 3V05A 4ZRPA 3PLUA 4KGTA 2KD0A 4P1CC 1J7AA 1J7CA 2VH2A 3L08A 2M4NA 3RPFC 1RYJA 1MJDA 3RN9C 5TSSA 1QOGA 3CMMB 4II2B 1JQ4A 1XEEA 1ZE3D 2M17A 4C80A 3M62B 4KKJA 2RPVA 2PIAA 1FFUA 5G2NA 3N9YC 2EELA 2J4XA 4NAMA 1RLFA 1VZ7A 3W1SC 1L0XB 2JRIB 4F1SA 1XF5L 4OZBA 2RGFA 4EKUA 4FULA 2QILA 2DZJA 1UNSA 3DVNV 2JPHA 2LXCA 4TSSA 3X0WA 4KV2A 4HCPB 3RNEC 1E90A 2FCMA 4MJSA 3W1YA 1WY8A 4LDTD 3VQIA 3TUOA 5BMIA 4IG7B 5GMVA 4BKTA 4YTNB 2KVZA 3DBRB 5G5HA 2PTLA 3DPDA 4HPPA 2MJ3A 3C0RB 4GU2A 3RMKC 4WQOB 1L4DB 1C4CA 4AQ7A 3WCQA 2XK5B 1XLPA 3Q3OC 5AZHA 5JZEB 2QIEB 2I1JA 3VRAB 1P7EA 2W9NA 1XO3A 4S0RA 1JW9D 1YQ3B 1EUVB 4A90A 3DOWA 1JWBD 2AQ2B 1OQYA 5KHOA 2GBJA 1I4QA 2BKRB 1J19A 4REZA 2CJOA 2J7QB 1VLBA 2AWTA 2LJIA 2DYMA 1BXTA 1KH0A 2J42A 3UIOB 1ZDXA 1B9RA 1YJ1A 2DHZA 1I42A 5HI1A 2OHFA 2BYTA 2L52A 1FNVA 3JW0X 3FKYA 3PRMB 3A1QB 5CX3A 3ALBA 2E3TA 4W9KA 3RNCC 2K0PA 5D3DA 2DZMA 3IXSA 4MDKE 1K8RB 4HKZE 3AEBB 2XK5A 2SEBD 3O13A 2QCZA 3GZNB 4J3OD 2DENB 1NBFC 4HPMB 2KMCA 1YJIA 5CTRC 2CS4A 3DHIC 2C7NB 2MH7A 1WI0A 2MW5A 1AN8A 3MC0B 4ARIA 5CHVC 2BBCA 1L4ZB 1WJNA 1A5RA 1MPEA 4JIOU 4B0MA 2AL6A 1Q0WB 4R3DA 4L23A 3AXCA 5D7GA 4Q2JA 4B95A 2VZKB 3MFGA 3N32A 1T0SC 3ZNGC 3OJ4B 1TZOA 4XDCA 3R7QA 1XLQA 3MHSD 4B9KA 1WGDA 3ML9A 4RGTA 3ZIMA 4KZCA 4MH8A 4HJKA 1QOAA 2MBOA 5EE0A 5G55A 2D3GA 4K7UA 3IAM1 3A1QA 3D32A 4BAXA 3QARA 2WQYB 3UQAA 1FXTB 2LRUA 2J52A 3R2TA 2M0XA 1HTOA 4TV3A 4A3PA 2ICIA 2B3AA 5BYSA 1VZ6A 1WYGA 3V61A 1KOTA 3RNBC 1F52A 2D3AA 2L0TA 4LNNA 4A9AA 4I6NB 4W9FA 3OJ3A 4XC2A 4OVVA 4B0EA 2J0MA 1WXQA 4IM0A 2PPHA 3S2AA 1FCLA 5G5GA 1XCTL 4LNFA 1P9DU 3RD2A 3ZRFA 1I4XA 1P98A 1YQBA 5D3IB 4ANUA 1GJZA 3Q3FA 2WP9B 2CKHB 3H8HA 3MC8A 3BZDB 3N1YC 2ASQA 2K39A 4NJCA 1F2RI 3RNAC 1PDXA 3Q8AA 4MGKE 1A70A 2IGGA 3HRDD 3PHXB 2BWES 2MQJA 1WZ3A 4NPNA 2FCNA 4ASWC 4WURA 1IBXB 2REXA 1TJEA 1P3QU 2KHWB 2W3SA 4IM3A 2HJ1A 2WU2B 1SEBD 3DHGC 4HK2A 1WXSA 2WXOA 3PZDA 2XNAC 2W55A 2C5LC 1DGJA 1H4RA 3WAMA 1WWTA 5E6JA 2HD5B 2JY6A 4BBNF 5HKHA 4F8CB 3GE3C 2KT7A 2KWCA 3QQ8B 1E10A 2N9PC 4MGYE 3A4SC 2Z59B 4BKSA 1HEZE 3TBLD 4BZAA 3AULA 2KJ6A 1YMHE 2N9EB 4AJYB 1U4AA 3VTWA 3APFA 4K7SA 3ZDTA 2C9WB 3EFCA 1RFKA 4FXCA 4LCDE 3TCAA 1PGXA 3DBHB 5LLIA 2KJRA 3CF6E 3H7SA 3R3MA 4MEMA 1EF1A 1B1ZA 3ABVB 3VH4B 1WYWB 4PT5A 4WJPA 1SE2A 4HVBA 3ZXRA 1F1HA 3Q3MC 4US8A 4GMVA 1IBXA 1L5PA 3NVWA 4K7WA 4MT5A 1KFYB 2MBEA 1UGMA 2GMIC 1JWSD 3ETRA 1T3QA 1WGHA 1JWMD 2INPE 2KMMA 5J18A 2D10A 1V86A 2C7MB 4H2AA 1FEHA 2B76B 4GSWA 2X38A 4II3B 2HTME 4FLHA 1E8YA 3U8ZA 4C7YA 3VDZA 1F0ZA 3EFUA 2FIDA 1C78A 4NZLB 2IJ0A 1EWYC 5IN7A 1NVID 1MG4A 4TMAB 3AU5A 2R2QA 2L1AA 2L7RA 3P4SB 3NOBA 5AEKB 5FR6A 1E9MA 4IM2A 2DX5B 5CHWA 1E8XA 1YQ4B 2PW9A 2WGSA 2JF5A 4XX5A 1YJJA 3PV1A 2KWUB 4OZCA 5LXHA 3IT6B 1E0ZA 1SJED 2PE9A 3L4PA 4HDQA 2M8SA 4GLSC 3NVYA 2IO3B 3W2DA 3NVVA 2BVCA 4TQ1A 2WXMA 3PRZA 3P63A 1KLUD 1BT0A 3P4RB
chains in the Genus database with same CATH topology
5G2NA 3L10B 1UBIA 2LVQA 3K9PB 4FA6A 3PREA 1LXDA 1RLFA 2LASA 1VD2A 2WX0A 4IUMB 4PYUA 3W1SC 4EZJA 2JRIB 3ML8A 2KDFB 4F1SA 3RT3B 1QZEA 5C1ZA 3L16A 2L76A 2O2VA 4CO7A 2RGFA 4EKUA 3M3JA 4FULA 2MSED 2MA9B 3WALA 2DZJA 5C23A 3DVNV 2JPHA 2LXCA 2JZZA 2YLMA 3X0WA 3GZNI 3RCZA 1VCBA 4KV2A 1XD3B 4HCPB 1E90A 2FCMA 4FJVB 1YD8U 2I1KA 2G4DB 4MJSA 3W1YA 1WY8A 1WXVA 4KVGB 1YX5B 4LDTD 4MM3A 3VQIA 4FHJA 4IG7B 5GMVA 4BKTA 3H7PA 2LWPA 3WA0A 3X23A 4BBNC 3EHVA 3DPDA 3H6NA 5AZGA 4CHKA 2UWQA 3PSEB 3C0RB 1GUAB 4GU2A 3B08A 2HJ8A 2MX2A 4WQOB 4M0WB 4ZRJA 3N30A 2KQ7A 3ZTDA 2XK5B 4EOYA 3DBLI 3ZO5B 1P1AA 2KX0A 2CU1A 1UH6A 2BGFA 3M63B 2KC2A 5AZHA 5JZEB 1TGZB 2I1JA 1C1YB 4MGIE 2W9NA 3ZW3A 4W9LA 2DZIA 4BOZB 3CSTA 3RYTA 4FJYA 3RZWC 2WX1A 1T0YA 2Z0EB 1EUVB 3T8MA 2KOXA 3DOWA 2JT4B 4KZ0A 4LDTB 4AWJA 3APCA 1OQYA 5J2RA 4KSLC 4X57B 2GBJA 5KHOA 1YIWA 3DBHI 2MCNB 5IA7A 3QA8A 4HWIB 3WANA 1WIAA 2R2OA 3V6CB 2V4LA 1WZ0A 2BKRB 4KSKC 1WXAA 1J19A 2YVCA 3RUIB 1WRDB 4PS3A 1X1MA 2J7QB 5E6PA 3KUDB 2AWTA 2N1VA 2L00B 4RM8A 5JHAA 2LJ5A 4PS7A 4IWQA 4DXAB 1J0GA 1WX9A 2DYMA 4FN2A 1EF5A 2J0JA 1ISNA 3R66C 3UIOB 2G4SA 4MELA 1YJ1A 3K9OB 2DHZA 1I42A 2KXJA 4WWOA 3DVGY 5D6JB 3ZNID 2KDIA 1J8CA 3L54A 2GOWA 5BO4B 2DYBA 2GBMA 5AZFA 3JW0X 3ECIA 3PRMB 4N9F4 2MWSB 3A1QB 1GNUA 1GC6A 1IYFA 1WM3A 2WDTB 1L7YA 5CX3A 4W9HA 2AYOB 2LGYA 3ALBA 3KUCB 2J0KA 3KYCD 2OJRA 1D3ZA 4W9KA 2XEWA 2JXXA 2O6VD 1V5TA 4GN1A 3TIXA 2IY0B 2DAJA 3P2BA 4NQKE 5EDSA 1V5OA 3ZUNA 4PS8A 4DK5A 3V62A 3DVNU 2L8JA 2DZMA 2PE6B 4I6LB 1MG8A 1TBEA 3VUXA 4MDKE 3ZRCA 1K8RB 2KN5A 2NS5A 4DHJD 2XK5A 1F9JA 4EUTA 2N9XA 2LZ6A 1M94A 2FCQA 1V9JA 2DENB 1NBFC 2ZPYA 1LQBA 3NY5A 4HPMB 4KIKB 1S3SG 5JH5C 2KMCA 5L95C 2LGXA 5CTRC 2CS4A 3QX1A 4URKA 3HIZA 1OTRB 2KX3A 2N7DA 1EO6A 2NBVB 2RPQA 2C7NB 2MW5A 1WI0A 3ZKJC 4EZLA 1WFYA 4A3OA 1WF9A 4NJ7A 4WJNA 2MBBB 4ICUA 5CHVC 4AJWA 2LGDA 1WJNA 3KYDD 4ZYNA 2QHOA 1A5RA 4E74A 2KMAA 4JIOU 3U7DA 2FUHB 4G0NB 1WJUA 2AL6A 1OGWA 2K8CA 3DDCB 1Q0WB 4F7ZA 2KFJA 1H8CA 3AXCA 5D7GA 4G3XB 4B95A 3IBEA 1C3TA 1R4MI 1PQSA 2NPTB 3A9KB 3HHMA 4M8NA 1YX6B 3A33B 3N32A 2ZJDA 4M8MA 4TQ0A 4DHJB 3ZNGC 3IFWB 3OJ4B 3WIMA 2KWVB 1WE7A 2CR5A 2NBUA 2C60A 2IO2B 2V1YA 3R7QA 2K1FA 1WH3A 2BYEA 3MHSD 4B9KA 1IP9A 3TL5A 2PJHA 1GG3A 2ZVOA 2DAFA 1G6JA 3UINB 1WGDA 2Z0DB 2IYDB 3ML9A 2BF8B 3VFKA 4KZCA 3ZIMA 4ZRIA 2LRWA 3UIPB 2K25A 4HJKA 4W9DA 4BKSD 2MBOA 3PHWB 5DPRA 4K1RB 5G55A 2D3GA 1LFDA 3PTFC 3VH3B 1KM7A 4K7UA 3PVLA 2IZVB 3A1QA 3D32A 3QARA 4BKGA 3L0WB 3ZDMC 3OLMD 3UQAA 4FBJB 1FXTB 2LRUA 3VHTC 3PGEA 3QC8B 3VUYA 4JGHB 2M0XA 4TV3A 4A3PA 3HK0A 1Z5SB 1V80A 1SIFA 2B3AA 4BOSC 2FNJB 4LJOB 4DHZB 1KOTA 3V61A 3JVZX 2KVRA 2MBHA 1WM2A 4GDKB 3UQBA 2L0TA 5D94A 4KIKA 2ZNVB 4GOCA 4I6NB 4XZ4A 4W9FA 3OJ3A 4RMAA 2KO3A 3AU4A 4XC2A 3QCAA 2ZNVC 5CHFA 4PYZA 4OVVA 2ZPNA 3CSFA 2J0MA 2HTHA 4IM0A 2PPHA 3S2AA 5DCNA 1Q1OA 2VRRB 4ANWA 1P9DU 4W9JA 3DBSA 3RD2A 1WR6E 3ZRFA 4W9CA 1P98A 1YQBA 3JSVB 1WJ4A 1ZW7A 1KLVA 2BYFA 4DWFA 3O65B 4ANUA 1GJZA 2KJHB 2LVOA 2KZRA 3N3KB 4J6IA 5E6OA 3Q3FA 1NDDA 3NHEB 3OAWA 1WXMA 1AARA 2CKHB 3QK0A 3A9KA 3A9JB 3H1UA 1WGGA 2ASQA 2K39A 3M95A 4BFRA 2IO0B 4MH0E 3ZVVA 2A4ZA 4NAWB 2EKEC 1E8ZA 2L0FA 3JYUA 4ZDVA 1WMHB 4MGKE 3APDA 4E71A 2NVUI 4LJPB 3PHXB 1UD7A 4GB9A 2KQSA 2BWES 2MQJA 3B1LX 4MGZE 1E5WA 1WZ3A 2K6QA 4NPNA 2BWFA 2KANA 2FCNA 3Q3JA 4ASWC 2A5UA 2ZZPB 2REXA 3KW5B 3PRZA 1P3QU 2KHWB 4TUUA 4W9GA 4EEWA 3ZLZA 4IM3A 4JL9A 2ZCCA 2EMSA 3VVWB 4W9IA 4HPLB 4WWPA 3LDZE 2L3ZA 3T9LA 5KHQA 1Q5WB 5DPSA 4HK2A 4AUQC 2KFKB 1OEYJ 1WXSA 3NZSA 3PZDA 4DDID 5JHBA 2BPSA 4B6WA 2N1WA 2C5LC 3EECA 1GC7A 2WWZA 1H4RA 2MRPA 2JVCA 4WWNA 5E6NA 3WAMA 2HD5B 1RAXA 2JY6A 2JRHA 1V6EA 1V81A 4BBNF 3MTNB 4GDKA 3A4RA 4OVUA 5IAAC 5HKHA 1RFAA 3ONSA 2GBRA 4F8CB 5L83A 3QWZB 1SGHA 2KWCA 4YL8A 3TJPA 3EC8A 2O6VB 3QQ8B 4GGQA 4FADA 2N9PC 3IVFA 4MGYE 1OEYA 1JRUA 2OOBB 3A4SC 3RULA 3VUWA 2Z59B 2ZVNA 4BKSA 2IO1B 3TBLD 1UELA 3AULA 1RRBA 2KJ6A 4MSQB 1WR1A 2N9EB 4A20A 4BVUC 2K8BA 1U4AA 3VTWA 4AJYB 3APFA 2JZ3B 3QJZA 4K7SA 3ZDTA 2C7HA 3IHPC 1P0RA 2PEAA 2G45B 2L05A 3GOEA 4NY0A 2C9WB 3SHQA 1LM8B 4E3CA 2LUEA 2MP2B 3JSVA 2KK8A 3L17A 4DHZE 2RSUA 1WGRA 4GDLB 1S1QB 2CHZA 4FHKA 3KUZA 1XQQA 2M1MA 4LCDE 4RM9A 3TCAA 1TTNA 1UZXB 3A9JA 3TMPB 3NZUA 5LLIA 2KJRA 2V3SA 3CF6E 3H7SA 1WJ6A 3R3MA 4MEMA 1EF1A 2MLBA 3SU8X 4NAWA 1HE8A 5J17A 2ZEQA 3V6EB 1IPGA 2LD9A 3VH4B 4HCNB 1WYWB 1WMHA 2FAZA 2G3QB 3ENEA 4WJPA 4HVBA 3PS6A 4WAAA 3R7RA 2XBBC 3DCGA 1V49A 4IWPA 3U30A 4CYEA 4EFOA 1ZGUB 5DPTA 4ANXA 4GMVA 4K7WA 3I3TB 3SD5A 5DPWA 1KJTA 3DVGX 2MBEA 1UGMA 2GMIC 3IG3A 4IWOA 4KDIC 3BY4B 4KDLB 4MSMB 3ZNHB 2BKFA 1WGHA 4K81A 1CMXB 3ZTCA 2KTRB 5J18A 2D10A 4IC7B 1V86A 2C7MB 4EZKA 3UF8A 1NI2A 3VTUA 2IBIB 4AOFA 1E7VA 2KFKA 4GSWA 4II3B 1XT9B 2FCSA 1E8YA 4FLHA 2NCNA 2GBNA 3U8ZA 4AP4C 2KDBA 2LXAA 3VDZA 3H9DA 2AL3A 3EFUA 3DBRI 5D2MB 4DDGD 3VAWA 2FIDA 4TKNA 5LXIB 3QIJA 2KLGA 3PLVA 4I6PA 2KTFA 2CHXA 3WAOA 4DBGA 1WX8A 1V2YA 2O2VB 2KNBA 4HXDA 4NJ6A 4P7IA 2GBKA 3BINA 2KDEB 2WYQA 4ANVA 3V60A 2RD0A 3B0AA 3HM3A 2NBWB 2O6VA 2D2QA 2Y5BB 3PT2B 2D07B 2CHWA 2D11A 3QHTA 4JLCA 3W1SA 2N7EA 2NPTA 1E7UA 4W9EA 4MJSB 2DZKA 2KKCA 3MJWA 4WJQA 3AU5A 3ZNZB 2R2QA 2UYZB 4GXBA 1WX7A 1I35A 2L7RA 3H7PB 2JUOA 3LJ3A 3L13A 2RR9A 3KVFB 1R4NI 2DYOA 4G50A 3NOBA 4NNJB 4IW0A 2MP2A 2K6DB 2KC1A 2BYVE 4FJZA 1WGYA 2NR2A 1Y8RC 4GDLA 5AEKB 3SDLC 1WE6A 5TR5A 2IY1B 5FR6A 3PRPB 4IM2A 2DX5B 1UBQA 2ZCBA 2MBQA 5CHWA 4ZRKA 1TZ1A 3WAPA 2K8HA 1E8XA 3NS8A 4JQWC 2JF5A 1SE9A 4GIVA 3QAQA 4XX5A 2HE7A 4WJOA 1E8WA 2LVPA 3VTVA 2EMTA 4HLEA 3PV1A 1L2NA 3PLUA 2N4FA 2KWUB 5LXHA 2KD0A 3PPAA 3UGBB 2PE9A 4G11A 3L08A 4ICVA 4HDQA 2M8SA 2AEHA 2M4NA 3VXWA 1ZKHA 4HDOA 3CMMB 2IO3B 1Z2MA 3KH0A 4II2B 2M17A 3HM6X 2KTRA 4NQLB 3AI5A 3RZFA 2KLCA 3M62B 2FIFA 2JWZA 4TQ1A 2LI5A 3DQVA 1BT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2N A;  3L10 B;  1UBI A;  2LVQ A;  3K9P B;  4FA6 A;  3PRE A;  1LXD A;  1RLF A;  2LAS A;  1VD2 A;  2WX0 A;  4IUM B;  4PYU A;  3W1S C;  4EZJ A;  2JRI B;  3ML8 A;  2KDF B;  4F1S A;  3RT3 B;  1QZE A;  5C1Z A;  3L16 A;  2L76 A;  2O2V A;  4CO7 A;  2RGF A;  4EKU A;  3M3J A;  4FUL A;  2MSE D;  2MA9 B;  3WAL A;  2DZJ A;  5C23 A;  3DVN V;  2JPH A;  2LXC A;  2JZZ A;  2YLM A;  3X0W A;  3GZN I;  3RCZ A;  1VCB A;  4KV2 A;  1XD3 B;  4HCP B;  1E90 A;  2FCM A;  4FJV B;  1YD8 U;  2I1K A;  2G4D B;  4MJS A;  3W1Y A;  1WY8 A;  1WXV A;  4KVG B;  1YX5 B;  4LDT D;  4MM3 A;  3VQI A;  4FHJ A;  4IG7 B;  5GMV A;  4BKT A;  3H7P A;  2LWP A;  3WA0 A;  3X23 A;  4BBN C;  3EHV A;  3DPD A;  3H6N A;  5AZG A;  4CHK A;  2UWQ A;  3PSE B;  3C0R B;  1GUA B;  4GU2 A;  3B08 A;  2HJ8 A;  2MX2 A;  4WQO B;  4M0W B;  4ZRJ A;  3N30 A;  2KQ7 A;  3ZTD A;  2XK5 B;  4EOY A;  3DBL I;  3ZO5 B;  1P1A A;  2KX0 A;  2CU1 A;  1UH6 A;  2BGF A;  3M63 B;  2KC2 A;  5AZH A;  5JZE B;  1TGZ B;  2I1J A;  1C1Y B;  4MGI E;  2W9N A;  3ZW3 A;  4W9L A;  2DZI A;  4BOZ B;  3CST A;  3RYT A;  4FJY A;  3RZW C;  2WX1 A;  1T0Y A;  2Z0E B;  1EUV B;  3T8M A;  2KOX A;  3DOW A;  2JT4 B;  4KZ0 A;  4LDT B;  4AWJ A;  3APC A;  1OQY A;  5J2R A;  4KSL C;  4X57 B;  2GBJ A;  5KHO A;  1YIW A;  3DBH I;  2MCN B;  5IA7 A;  3QA8 A;  4HWI B;  3WAN A;  1WIA A;  2R2O A;  3V6C B;  2V4L A;  1WZ0 A;  2BKR B;  4KSK C;  1WXA A;  1J19 A;  2YVC A;  3RUI B;  1WRD B;  4PS3 A;  1X1M A;  2J7Q B;  5E6P A;  3KUD B;  2AWT A;  2N1V A;  2L00 B;  4RM8 A;  5JHA A;  2LJ5 A;  4PS7 A;  4IWQ A;  4DXA B;  1J0G A;  1WX9 A;  2DYM A;  4FN2 A;  1EF5 A;  2J0J A;  1ISN A;  3R66 C;  3UIO B;  2G4S A;  4MEL A;  1YJ1 A;  3K9O B;  2DHZ A;  1I42 A;  2KXJ A;  4WWO A;  3DVG Y;  5D6J B;  3ZNI D;  2KDI A;  1J8C A;  3L54 A;  2GOW A;  5BO4 B;  2DYB A;  2GBM A;  5AZF A;  3JW0 X;  3ECI A;  3PRM B;  4N9F 4;  2MWS B;  3A1Q B;  1GNU A;  1GC6 A;  1IYF A;  1WM3 A;  2WDT B;  1L7Y A;  5CX3 A;  4W9H A;  2AYO B;  2LGY A;  3ALB A;  3KUC B;  2J0K A;  3KYC D;  2OJR A;  1D3Z A;  4W9K A;  2XEW A;  2JXX A;  2O6V D;  1V5T A;  4GN1 A;  3TIX A;  2IY0 B;  2DAJ A;  3P2B A;  4NQK E;  5EDS A;  1V5O A;  3ZUN A;  4PS8 A;  4DK5 A;  3V62 A;  3DVN U;  2L8J A;  2DZM A;  2PE6 B;  4I6L B;  1MG8 A;  1TBE A;  3VUX A;  4MDK E;  3ZRC A;  1K8R B;  2KN5 A;  2NS5 A;  4DHJ D;  2XK5 A;  1F9J A;  4EUT A;  2N9X A;  2LZ6 A;  1M94 A;  2FCQ A;  1V9J A;  2DEN B;  1NBF C;  2ZPY A;  1LQB A;  3NY5 A;  4HPM B;  4KIK B;  1S3S G;  5JH5 C;  2KMC A;  5L95 C;  2LGX A;  5CTR C;  2CS4 A;  3QX1 A;  4URK A;  3HIZ A;  1OTR B;  2KX3 A;  2N7D A;  1EO6 A;  2NBV B;  2RPQ A;  2C7N B;  2MW5 A;  1WI0 A;  3ZKJ C;  4EZL A;  1WFY A;  4A3O A;  1WF9 A;  4NJ7 A;  4WJN A;  2MBB B;  4ICU A;  5CHV C;  4AJW A;  2LGD A;  1WJN A;  3KYD D;  4ZYN A;  2QHO A;  1A5R A;  4E74 A;  2KMA A;  4JIO U;  3U7D A;  2FUH B;  4G0N B;  1WJU A;  2AL6 A;  1OGW A;  2K8C A;  3DDC B;  1Q0W B;  4F7Z A;  2KFJ A;  1H8C A;  3AXC A;  5D7G A;  4G3X B;  4B95 A;  3IBE A;  1C3T A;  1R4M I;  1PQS A;  2NPT B;  3A9K B;  3HHM A;  4M8N A;  1YX6 B;  3A33 B;  3N32 A;  2ZJD A;  4M8M A;  4TQ0 A;  4DHJ B;  3ZNG C;  3IFW B;  3OJ4 B;  3WIM A;  2KWV B;  1WE7 A;  2CR5 A;  2NBU A;  2C60 A;  2IO2 B;  2V1Y A;  3R7Q A;  2K1F A;  1WH3 A;  2BYE A;  3MHS D;  4B9K A;  1IP9 A;  3TL5 A;  2PJH A;  1GG3 A;  2ZVO A;  2DAF A;  1G6J A;  3UIN B;  1WGD A;  2Z0D B;  2IYD B;  3ML9 A;  2BF8 B;  3VFK A;  4KZC A;  3ZIM A;  4ZRI A;  2LRW A;  3UIP B;  2K25 A;  4HJK A;  4W9D A;  4BKS D;  2MBO A;  3PHW B;  5DPR A;  4K1R B;  5G55 A;  2D3G A;  1LFD A;  3PTF C;  3VH3 B;  1KM7 A;  4K7U A;  3PVL A;  2IZV B;  3A1Q A;  3D32 A;  3QAR A;  4BKG A;  3L0W B;  3ZDM C;  3OLM D;  3UQA A;  4FBJ B;  1FXT B;  2LRU A;  3VHT C;  3PGE A;  3QC8 B;  3VUY A;  4JGH B;  2M0X A;  4TV3 A;  4A3P A;  3HK0 A;  1Z5S B;  1V80 A;  1SIF A;  2B3A A;  4BOS C;  2FNJ B;  4LJO B;  4DHZ B;  1KOT A;  3V61 A;  3JVZ X;  2KVR A;  2MBH A;  1WM2 A;  4GDK B;  3UQB A;  2L0T A;  5D94 A;  4KIK A;  2ZNV B;  4GOC A;  4I6N B;  4XZ4 A;  4W9F A;  3OJ3 A;  4RMA A;  2KO3 A;  3AU4 A;  4XC2 A;  3QCA A;  2ZNV C;  5CHF A;  4PYZ A;  4OVV A;  2ZPN A;  3CSF A;  2J0M A;  2HTH A;  4IM0 A;  2PPH A;  3S2A A;  5DCN A;  1Q1O A;  2VRR B;  4ANW A;  1P9D U;  4W9J A;  3DBS A;  3RD2 A;  1WR6 E;  3ZRF A;  4W9C A;  1P98 A;  1YQB A;  3JSV B;  1WJ4 A;  1ZW7 A;  1KLV A;  2BYF A;  4DWF A;  3O65 B;  4ANU A;  1GJZ A;  2KJH B;  2LVO A;  2KZR A;  3N3K B;  4J6I A;  5E6O A;  3Q3F A;  1NDD A;  3NHE B;  3OAW A;  1WXM A;  1AAR A;  2CKH B;  3QK0 A;  3A9K A;  3A9J B;  3H1U A;  1WGG A;  2ASQ A;  2K39 A;  3M95 A;  4BFR A;  2IO0 B;  4MH0 E;  3ZVV A;  2A4Z A;  4NAW B;  2EKE C;  1E8Z A;  2L0F A;  3JYU A;  4ZDV A;  1WMH B;  4MGK E;  3APD A;  4E71 A;  2NVU I;  4LJP B;  3PHX B;  1UD7 A;  4GB9 A;  2KQS A;  2BWE S;  2MQJ A;  3B1L X;  4MGZ E;  1E5W A;  1WZ3 A;  2K6Q A;  4NPN A;  2BWF A;  2KAN A;  2FCN A;  3Q3J A;  4ASW C;  2A5U A;  2ZZP B;  2REX A;  3KW5 B;  3PRZ A;  1P3Q U;  2KHW B;  4TUU A;  4W9G A;  4EEW A;  3ZLZ A;  4IM3 A;  4JL9 A;  2ZCC A;  2EMS A;  3VVW B;  4W9I A;  4HPL B;  4WWP A;  3LDZ E;  2L3Z A;  3T9L A;  5KHQ A;  1Q5W B;  5DPS A;  4HK2 A;  4AUQ C;  2KFK B;  1OEY J;  1WXS A;  3NZS A;  3PZD A;  4DDI D;  5JHB A;  2BPS A;  4B6W A;  2N1W A;  2C5L C;  3EEC A;  1GC7 A;  2WWZ A;  1H4R A;  2MRP A;  2JVC A;  4WWN A;  5E6N A;  3WAM A;  2HD5 B;  1RAX A;  2JY6 A;  2JRH A;  1V6E A;  1V81 A;  4BBN F;  3MTN B;  4GDK A;  3A4R A;  4OVU A;  5IAA C;  5HKH A;  1RFA A;  3ONS A;  2GBR A;  4F8C B;  5L83 A;  3QWZ B;  1SGH A;  2KWC A;  4YL8 A;  3TJP A;  3EC8 A;  2O6V B;  3QQ8 B;  4GGQ A;  4FAD A;  2N9P C;  3IVF A;  4MGY E;  1OEY A;  1JRU A;  2OOB B;  3A4S C;  3RUL A;  3VUW A;  2Z59 B;  2ZVN A;  4BKS A;  2IO1 B;  3TBL D;  1UEL A;  3AUL A;  1RRB A;  2KJ6 A;  4MSQ B;  1WR1 A;  2N9E B;  4A20 A;  4BVU C;  2K8B A;  1U4A A;  3VTW A;  4AJY B;  3APF A;  2JZ3 B;  3QJZ A;  4K7S A;  3ZDT A;  2C7H A;  3IHP C;  1P0R A;  2PEA A;  2G45 B;  2L05 A;  3GOE A;  4NY0 A;  2C9W B;  3SHQ A;  1LM8 B;  4E3C A;  2LUE A;  2MP2 B;  3JSV A;  2KK8 A;  3L17 A;  4DHZ E;  2RSU A;  1WGR A;  4GDL B;  1S1Q B;  2CHZ A;  4FHK A;  3KUZ A;  1XQQ A;  2M1M A;  4LCD E;  4RM9 A;  3TCA A;  1TTN A;  1UZX B;  3A9J A;  3TMP B;  3NZU A;  5LLI A;  2KJR A;  2V3S A;  3CF6 E;  3H7S A;  1WJ6 A;  3R3M A;  4MEM A;  1EF1 A;  2MLB A;  3SU8 X;  4NAW A;  1HE8 A;  5J17 A;  2ZEQ A;  3V6E B;  1IPG A;  2LD9 A;  3VH4 B;  4HCN B;  1WYW B;  1WMH A;  2FAZ A;  2G3Q B;  3ENE A;  4WJP A;  4HVB A;  3PS6 A;  4WAA A;  3R7R A;  2XBB C;  3DCG A;  1V49 A;  4IWP A;  3U30 A;  4CYE A;  4EFO A;  1ZGU B;  5DPT A;  4ANX A;  4GMV A;  4K7W A;  3I3T B;  3SD5 A;  5DPW A;  1KJT A;  3DVG X;  2MBE A;  1UGM A;  2GMI C;  3IG3 A;  4IWO A;  4KDI C;  3BY4 B;  4KDL B;  4MSM B;  3ZNH B;  2BKF A;  1WGH A;  4K81 A;  1CMX B;  3ZTC A;  2KTR B;  5J18 A;  2D10 A;  4IC7 B;  1V86 A;  2C7M B;  4EZK A;  3UF8 A;  1NI2 A;  3VTU A;  2IBI B;  4AOF A;  1E7V A;  2KFK A;  4GSW A;  4II3 B;  1XT9 B;  2FCS A;  1E8Y A;  4FLH A;  2NCN A;  2GBN A;  3U8Z A;  4AP4 C;  2KDB A;  2LXA A;  3VDZ A;  3H9D A;  2AL3 A;  3EFU A;  3DBR I;  5D2M B;  4DDG D;  3VAW A;  2FID A;  4TKN A;  5LXI B;  3QIJ A;  2KLG A;  3PLV A;  4I6P A;  2KTF A;  2CHX A;  3WAO A;  4DBG A;  1WX8 A;  1V2Y A;  2O2V B;  2KNB A;  4HXD A;  4NJ6 A;  4P7I A;  2GBK A;  3BIN A;  2KDE B;  2WYQ A;  4ANV A;  3V60 A;  2RD0 A;  3B0A A;  3HM3 A;  2NBW B;  2O6V A;  2D2Q A;  2Y5B B;  3PT2 B;  2D07 B;  2CHW A;  2D11 A;  3QHT A;  4JLC A;  3W1S A;  2N7E A;  2NPT A;  1E7U A;  4W9E A;  4MJS B;  2DZK A;  2KKC A;  3MJW A;  4WJQ A;  3AU5 A;  3ZNZ B;  2R2Q A;  2UYZ B;  4GXB A;  1WX7 A;  1I35 A;  2L7R A;  3H7P B;  2JUO A;  3LJ3 A;  3L13 A;  2RR9 A;  3KVF B;  1R4N I;  2DYO A;  4G50 A;  3NOB A;  4NNJ B;  4IW0 A;  2MP2 A;  2K6D B;  2KC1 A;  2BYV E;  4FJZ A;  1WGY A;  2NR2 A;  1Y8R C;  4GDL A;  5AEK B;  3SDL C;  1WE6 A;  5TR5 A;  2IY1 B;  5FR6 A;  3PRP B;  4IM2 A;  2DX5 B;  1UBQ A;  2ZCB A;  2MBQ A;  5CHW A;  4ZRK A;  1TZ1 A;  3WAP A;  2K8H A;  1E8X A;  3NS8 A;  4JQW C;  2JF5 A;  1SE9 A;  4GIV A;  3QAQ A;  4XX5 A;  2HE7 A;  4WJO A;  1E8W A;  2LVP A;  3VTV A;  2EMT A;  4HLE A;  3PV1 A;  1L2N A;  3PLU A;  2N4F A;  2KWU B;  5LXH A;  2KD0 A;  3PPA A;  3UGB B;  2PE9 A;  4G11 A;  3L08 A;  4ICV A;  4HDQ A;  2M8S A;  2AEH A;  2M4N A;  3VXW A;  1ZKH A;  4HDO A;  3CMM B;  2IO3 B;  1Z2M A;  3KH0 A;  4II2 B;  2M17 A;  3HM6 X;  2KTR A;  4NQL B;  3AI5 A;  3RZF A;  2KLC A;  3M62 B;  2FIF A;  2JWZ A;  4TQ1 A;  2LI5 A;  3DQV A;  1BT0 A; 
#chains in the Genus database with same CATH topology
 3L10 B;  1LXD A;  4RNA A;  1AYF A;  1WRI A;  5GXG B;  2KDF B;  3AED B;  4DXF A;  2L76 A;  1D4B A;  2MSE D;  3WAL A;  5C23 A;  5BMH A;  1BUI C;  3RCZ A;  1XD3 B;  5BYQ A;  2WNM A;  4KVG B;  2QEJ C;  4OVZ A;  4FHJ A;  1K50 A;  1BML C;  4BBN C;  3EHV A;  1I4R A;  2LGI A;  4JPS A;  3H6N A;  3PSE B;  2BS4 B;  1GUA B;  3B08 A;  2KQ7 A;  4EOY A;  3ZO5 B;  1P1A A;  2KX0 A;  2BGF A;  3AMZ A;  1C1Y B;  1SB3 C;  3ZW3 A;  3NVZ A;  4FJY A;  2WX1 A;  1TY0 A;  3T8M A;  2KYW A;  1F2R C;  4AWJ A;  2GI9 A;  2LEK A;  2FBW B;  2D3B A;  5J2R A;  4X57 B;  3DBH I;  3QA8 A;  3WAN A;  4RFB A;  2V3P A;  1TS2 A;  1JML A;  1HA5 A;  3KUD B;  4RM8 A;  2LGS A;  5JHA A;  4IWQ A;  1WX9 A;  4FN2 A;  3U2S C;  1WSP A;  3R66 C;  4HKQ A;  4MEL A;  4MAC A;  2BS3 B;  3K9O B;  2KXJ A;  5D6J B;  2L83 A;  5IP4 D;  2KDI A;  1J8C A;  3L54 A;  2DYB A;  5AZF A;  3E9S A;  3ECI A;  4N9F 4;  4YT0 B;  1GC6 A;  1L7Y A;  4ZHP A;  4W9H A;  2J0K A;  3KYC D;  2OJR A;  1V5T A;  4GN1 A;  2VZK D;  5EDS A;  2DAJ A;  3P2B A;  4PS8 A;  1C77 A;  4DK5 A;  3V62 A;  3MP9 A;  2L8J A;  3AEE B;  2PE6 B;  1TBE A;  3ZRC A;  2KN5 A;  1HXY D;  2N9X A;  1M94 A;  1D6E C;  1V9J A;  2RDH A;  2ZPY A;  3NY5 A;  2R61 A;  5HHD G;  3Q8B A;  1C9F A;  1OTR B;  2KX3 A;  2N7D A;  1I4P A;  2MJE A;  4A3O A;  4NJ7 A;  1HZ6 A;  2IPK D;  3Q8E A;  2KMA A;  3NZ3 A;  4G0N B;  1WJU A;  2K9X A;  3AEF B;  1PYW D;  1H8C A;  3DBL B;  1XLO A;  2X8X X;  1FXA A;  3A9K B;  4IDI A;  4DHJ B;  1TS3 A;  1WE7 A;  2NBU A;  2C60 A;  2DBY A;  2H88 B;  2BYE A;  2ZVO A;  1CQV A;  2DAF A;  3UIN B;  2Z0D B;  3VFK A;  4ZRI A;  1FRR A;  4BKS D;  4N6E B;  5DPR A;  4XGA B;  1V1P B;  4YSX B;  1OQR A;  3L0W B;  3ZDM C;  1DOY A;  3PGE A;  1TIF A;  3VUY A;  2KWD A;  4JGH B;  3TEZ A;  3BWU D;  1V80 A;  1SIF A;  1R4N B;  4LJO B;  2DNF A;  4DHZ B;  2IGH A;  3JVZ X;  2MBH A;  1WM2 A;  4GDK B;  3UQB A;  4QAY A;  5D94 A;  2ZNV B;  4GOC A;  1HZ5 A;  3AU4 A;  1KTK A;  3CSF A;  1QOF A;  3Q6B A;  5DCN A;  1Q1O A;  2BQQ A;  4ITK A;  4W9J A;  1WR6 E;  3JSV B;  1XLN A;  2BYF A;  4DWF A;  3N3K B;  2KZR A;  3MC9 A;  4J6I A;  4US9 A;  4DXG A;  3NHE B;  1WXM A;  1AAR A;  3QK0 A;  1JCK B;  3A9K A;  2IND C;  1WGG A;  4BFR A;  3OWE B;  1SF0 A;  3ZVV A;  1E8Z A;  3APD A;  1FO4 A;  2KQS A;  4MGZ E;  2A5U A;  2ZZP B;  1YN5 A;  4TUU A;  2WS3 B;  1V1P A;  1SBB B;  2ZCC A;  3VVW B;  1GOZ A;  4W9I A;  4WWP A;  3LDZ E;  2L3Z A;  3T9L A;  1Q5W B;  5JHB A;  4HRO A;  1RM6 C;  3PZ7 A;  2N9L A;  2N1W A;  3EA6 A;  4KGR A;  5E6N A;  2JVC A;  3GE8 C;  1RAX A;  4WH4 A;  1MI0 A;  3PO0 A;  3AV8 A;  3AEG B;  3MTN B;  4GDK A;  3ONS A;  5L83 A;  3QWZ B;  1OEY A;  2OOB B;  2ZVN A;  5C2T B;  2IO1 B;  4MSQ B;  4BVU C;  3SEB A;  3QJZ A;  4JWS C;  2PEA A;  3LXF A;  1FIQ A;  3SHQ A;  3JSV A;  3L17 A;  2KK8 A;  2RSU A;  1IUE A;  1CK1 A;  2CHZ A;  3AE2 B;  1XQQ A;  1M4V A;  3FIL B;  2QJL A;  3TMP B;  3NZU A;  2JX5 A;  2V3S A;  1ZUD 2;  5H8Y E;  3NJT A;  1IPG A;  4WQM A;  1ET9 A;  2FAZ A;  1FNU A;  2JYE A;  2RDB C;  1FFV A;  4IWP A;  3U30 A;  3PZ8 A;  1T0R C;  4ANX A;  3U4E G;  3HVD A;  4L1B A;  5DPW A;  3DVG X;  4KDI C;  1D5Z C;  4KDL B;  2IDY A;  4K81 A;  4ZHO A;  2KTR B;  4LK0 M;  1NI2 A;  2IBI B;  4AOF A;  1TKG A;  1R7S A;  2KDB A;  2LXA A;  2Q5W D;  3H9D A;  4DDG D;  3DBR I;  1DYQ A;  1I4H A;  2KTF A;  3MJ5 A;  4DBG A;  2O2V B;  1LGR A;  5HFY A;  1TS4 A;  5H92 C;  3PT2 B;  2CJN A;  4JLC A;  3W1S A;  1WGK A;  1E7U A;  3MJW A;  4DQO C;  3AE1 B;  2UYZ B;  1WX7 A;  1I35 A;  1TY2 A;  2ZW1 A;  4M02 A;  2FE8 A;  2RR9 A;  3BK2 A;  1R4N I;  1SJH D;  2BYV E;  4FJZ A;  1WGY A;  2NR2 A;  1Y8R C;  2GB1 A;  2N9K A;  5TR5 A;  4XWW A;  1JAL A;  3MHZ A;  1UBQ A;  4ZRK A;  3TEW A;  4KGS A;  2PKO A;  3NS8 A;  1R4M B;  3IAS 1;  3QAQ A;  4C7Z A;  4WJO A;  1E8W A;  2LVP A;  3VTV A;  2EMT A;  1L2N A;  5JXV A;  4G11 A;  2OJW A;  3P42 A;  4YWG G;  1UUP A;  3HM6 X;  5EE3 A;  2NMQ A;  2KTR A;  4NQL B;  3RZF A;  2WXQ A;  2FIF A;  2JWZ A;  4G50 A;  3ZYY X;  1UBI A;  2LVQ A;  4XWT A;  4FA6 A;  3PRE A;  2LAS A;  1VD2 A;  4PYU A;  4EZJ A;  3ML8 A;  3RT3 B;  1QZE A;  1SIJ A;  2O2V A;  3M3J A;  3J9C A;  3AEA B;  5AUI A;  2YLM A;  3N20 C;  2JZZ A;  2BTE A;  2Y5C A;  3GZN I;  1GAQ B;  1VCB A;  4FJV B;  1YD8 U;  2I1K A;  2G4D B;  3AB5 A;  1YX5 B;  1C76 A;  3R8B A;  1TKE A;  1Y56 A;  5FK9 C;  2W54 A;  2HJ8 A;  4ZRJ A;  3N30 A;  2K3U A;  3HUI A;  2MHJ A;  2CU1 A;  1UH6 A;  4RGN A;  1VRA B;  4W9L A;  3RZW C;  2Z0E B;  2Y3A A;  3AE9 B;  2JT4 B;  3APC A;  3LYY A;  4KSL C;  2ZW0 A;  4HWI B;  1YOV B;  1WIA A;  2R2O A;  3FAH A;  5EE1 A;  2KQ4 X;  1WXA A;  2PLP A;  2LHD A;  3RUI B;  1EU4 A;  2VH1 A;  1WRD B;  4PS3 A;  1X1M A;  5E6P A;  3T3O A;  1EM7 A;  2N1V A;  3P4P B;  3AE5 B;  4LTU A;  4PS7 A;  1UWX A;  4DXA B;  1J0G A;  1L0Y B;  1EF5 A;  1YNT E;  2J0J A;  1ISN A;  2G4S A;  3ZJT A;  4WWO A;  3DVG Y;  3RNF C;  5BO4 B;  3URY A;  3CIR B;  1K53 A;  1UGJ A;  2LGY A;  3KUC B;  2WHI A;  1VZ8 A;  1QIL A;  1D3Z A;  1E6E B;  2IY0 B;  4NQK E;  3ZUN A;  1N6Z A;  4I6L B;  1MG8 A;  3VUX A;  4DHJ D;  2NS5 A;  3BVZ A;  4EUT A;  2LZ6 A;  4CQN A;  5FKA C;  5JH5 C;  3AE7 B;  1S3S G;  5L95 C;  2LGX A;  4URK A;  1ZXH A;  2RPQ A;  4JWU C;  4EZL A;  1KRH A;  4YTM B;  2ONQ A;  2MBB B;  4ICU A;  2LGD A;  5BYR A;  3KYD D;  4ZYN A;  1JRP A;  2FUH B;  3AE6 B;  1TYG B;  2JU6 X;  1OGW A;  3DDC B;  4F7Z A;  4WAF A;  2KFJ A;  3P1M A;  4G3X B;  2HDE A;  3IBE A;  1R4M I;  1SE3 A;  2NPT B;  3B2G A;  3HHM A;  3BYY B;  4M8N A;  2ZJD A;  2AX5 A;  1SSN A;  4D2K A;  3WIM A;  2CR5 A;  2IO2 B;  2V1Y A;  2K1F A;  1WH3 A;  3C8Y A;  1GPX A;  3KQ4 A;  2IYD B;  4C4V B;  2LRW A;  1QT9 A;  3PTF C;  3VH3 B;  2G1E A;  3PVL A;  4HJG E;  1D5X C;  4YSZ B;  1E7P B;  1MFW A;  4FBJ B;  3VHT C;  3QC8 B;  3HK0 A;  1Z5S B;  4BOS C;  1QQR A;  4M01 A;  1T0Q C;  2KVR A;  2Z8L A;  4ZOH C;  2W82 A;  1EWC A;  4XZ4 A;  3DHH C;  4IKG A;  2KO3 A;  3QCA A;  4YTP B;  2ZNV C;  5CHF A;  4PYZ A;  3E56 A;  2QSD A;  3W9C B;  2WDR B;  1JRO A;  1XXG A;  4ANW A;  1NEK B;  3DBS A;  1PGA A;  3TEY A;  1WJ4 A;  1J7B A;  2OED A;  1TS5 A;  2KJH B;  5E6O A;  2I2Y A;  1ROE A;  3NRZ A;  1FRD A;  3H1U A;  2BT6 A;  3C19 A;  4C56 C;  2IO0 B;  4MH0 E;  2UU7 A;  2EKE C;  4M00 A;  2BS2 B;  4LJP B;  3B1L X;  1T6B X;  1ET6 A;  4C4V A;  2KAN A;  3Q3J A;  4USA A;  3KW5 B;  3B9J A;  1JWA D;  4EEW A;  1GB1 A;  5MPO A;  2EMS A;  2AQ3 B;  5KHQ A;  5DPS A;  4AUQ C;  2KFK B;  4DDI D;  2WXG A;  2WDV B;  4B6W A;  3AN1 A;  3ZXV A;  1FD6 A;  2MRP A;  4WWN A;  1NYR A;  2WXI A;  1AWD A;  3I63 C;  1SE4 A;  1I4G A;  2JRH A;  1V81 A;  3A4R A;  5IAA C;  1RFA A;  4JX1 C;  4YL8 A;  4GGQ A;  3IVF A;  3VUW A;  4EE2 A;  1OFF A;  1MVK A;  4A20 A;  1LO5 D;  3AH7 A;  4RF1 A;  3GOE A;  4NY0 A;  1OQQ A;  1LM8 B;  1PUT A;  2MP2 B;  4GDL B;  3KUZ A;  1DOX A;  2M1M A;  1TTN A;  1WJ6 A;  2MLB A;  3SU8 X;  2INN E;  3V6E B;  3FC4 A;  2EKI A;  2LD9 A;  3R7R A;  2XBB C;  3DCG A;  4CYE A;  1RWS A;  4OW0 A;  4ACF A;  1ACC A;  1ENF A;  3IG3 A;  4IWO A;  3BY4 B;  3ZNH B;  2BKF A;  2KDM A;  1CMX B;  4P16 A;  3ZTC A;  2RDG A;  4EZK A;  2PVO D;  1EU3 A;  3VTU A;  1E7V A;  2KFK A;  3TSS A;  2NCN A;  2GBN A;  3HVZ A;  4AP4 C;  2IGD A;  2AL3 A;  3Q69 A;  4TKN A;  5LXI B;  2QC8 A;  3QIJ A;  4UDU C;  1FCC C;  4I6P A;  2CHX A;  3WAO A;  1V2Y A;  4HXD A;  4NJ6 A;  4P7I A;  2GBK A;  3BIN A;  1FXI A;  2KDE B;  2WYQ A;  4ANV A;  3V60 A;  2N0S B;  5BMG A;  3HM3 A;  2NBW B;  1GB4 A;  2Y5B B;  2NTS A;  2CHW A;  4P1B C;  2RMM A;  4W9E A;  2DZK A;  2KKC A;  4MM3 B;  3ZNZ B;  3H7P B;  3L13 A;  3KVF B;  3Q14 C;  4NNJ B;  2MP2 A;  2K6D B;  5FR3 A;  4GDL A;  3RFZ B;  1WE6 A;  2WU5 B;  1ESF A;  2IY1 B;  2LHE A;  3PRP B;  3TEX A;  2ZCB A;  2MBQ A;  3EGR A;  3IT4 B;  1TZ1 A;  3WAP A;  4JQW C;  4XYC A;  1SE9 A;  4YXD B;  1HQR D;  2HE7 A;  2WXH A;  2SAK A;  1L6V A;  4HLE A;  2N4F A;  2LMC A;  3B2F A;  3PPA A;  3UGB B;  4ICV A;  2AEH A;  3VXW A;  1ZKH A;  4LLG M;  4HDO A;  3KH0 A;  1Z2M A;  5I4D A;  2GLS A;  3AI5 A;  2KLC A;  2K22 A;  4RH6 A;  2LI5 A;  3DQV A;  2DLB A;  2JZP A;  3N1Z C;  3Q8F A;  2WDQ B;  4XE0 A;  3K9P B;  2ON8 A;  4IUM B;  2WX0 A;  1QOB A;  5C1Z A;  2ACZ B;  3L16 A;  4CO7 A;  2MA9 B;  3VR9 B;  3GB1 A;  1NYQ A;  4K3B A;  2PVG C;  1WXV A;  4MM3 A;  4O1N A;  2MEK A;  1C4P A;  1UWM A;  3H7P A;  2LWP A;  3WA0 A;  3X23 A;  3ZJU A;  5AZG A;  4CHK A;  2UWQ A;  2MX2 A;  1CJE A;  2GRI A;  4M0W B;  4ARC A;  2WXL A;  3ZTD A;  4LNO A;  2E6X A;  3BVG A;  3DBL I;  1YN4 A;  3UI3 A;  2MJD A;  1VJK A;  3M63 B;  2KC2 A;  1MHX A;  5C3J B;  1NEN B;  1TGZ B;  3BII D;  4MGI E;  2DZI A;  4BOZ B;  3CST A;  3RYT A;  3KWV A;  2WXR A;  1T0Y A;  3SFD B;  2KOX A;  2QDF A;  4KZ0 A;  1VR9 A;  4LDT B;  2V4I B;  1L0V B;  1N5X A;  1YIW A;  2JXT A;  1AW7 A;  2MCN B;  5IA7 A;  3V6C B;  2V4L A;  2V9H A;  1WZ0 A;  4KSK C;  2YVC A;  2N7J A;  4OZA A;  3V3X A;  3GS2 A;  2TSS A;  2LUM A;  2L00 B;  5IO9 A;  2LJ5 A;  4A8X C;  4A6Q A;  2YEP B;  2V3N A;  3RI7 C;  1KLG D;  2CU3 A;  5HG2 A;  4LNI A;  3NG0 A;  3U52 E;  4S17 A;  3FIL A;  3ZNI D;  1QLB B;  2GOW A;  2GBM A;  3ZGZ A;  2MWS B;  1CZP A;  1GNU A;  4N59 A;  1IYF A;  1WM3 A;  2WDT B;  2AYO B;  3RNG C;  4XDD A;  2XEW A;  2JXX A;  2O6V D;  3TIX A;  2V0G A;  1T5X D;  2Y5P A;  1V5O A;  4K3C A;  3W5U B;  3DVN U;  2BB6 A;  4M0W A;  3I57 A;  2WXK A;  4ZRQ A;  4LNK A;  2KAJ A;  1F9J A;  2FCQ A;  4KIK B;  1LQB A;  4KKI A;  1KF6 B;  3QX1 A;  1QKZ A;  3HIZ A;  2NBV B;  1EO6 A;  3ZKJ C;  4PK1 A;  1WFY A;  1ZOY B;  1WF9 A;  4WJN A;  1IGC A;  4AJW A;  2QHO A;  4E74 A;  1PFD A;  2PMV A;  1N60 A;  3U7D A;  2K5P A;  2INC C;  2K8C A;  1QF6 A;  1C3T A;  3ZJV A;  3AE8 B;  3BK1 A;  5LNK 1;  1PQS A;  1YX6 B;  2WLB A;  1Q10 A;  3A33 B;  4TQ0 A;  4M8M A;  4HRS A;  1UF0 A;  1XCQ L;  3IFW B;  2KN4 A;  2KWV B;  4RF0 A;  2XN9 C;  4ZYS A;  3TL5 A;  1IP9 A;  2PJH A;  1GG3 A;  1G6J A;  2BF8 B;  1D5M C;  3UIP B;  2K25 A;  4W9D A;  3PHW B;  4K1R B;  1LFD A;  1FPY A;  1KM7 A;  4WWM A;  2IZV B;  4A55 A;  4BKG A;  1F77 A;  2W3R A;  3OLM D;  1P7F A;  1NI3 A;  1SXT A;  1ZDV A;  2FNJ B;  3DWM A;  1V8C A;  1PGB A;  3EUB 2;  4KIK A;  1JWU D;  4RMA A;  2M19 A;  1V1O A;  2ZPN A;  2HTH A;  4L2Y A;  3W5V B;  4KX6 B;  2VRR B;  3NUH B;  1FM0 D;  3DWG C;  3AE4 B;  4W9C A;  1STE A;  1KLV A;  1ZW7 A;  3O65 B;  3P4Q B;  2LVO A;  3SR6 A;  1NDD A;  3Q3N C;  2BW2 A;  1V97 A;  3OAW A;  5IOI A;  1N63 A;  3A9J B;  3R2I A;  3M95 A;  4RCO A;  2A4Z A;  2BB5 A;  4NAW B;  2L0F A;  1K51 A;  3JYU A;  3SFE B;  4ZDV A;  1WMH B;  3VR8 B;  4E71 A;  2M0A A;  2NVU I;  1UD7 A;  4GB9 A;  1E5W A;  2K6Q A;  2BWF A;  3GP7 A;  2WXN A;  2J53 A;  4OHJ A;  5IKC M;  4W9G A;  1TT5 B;  2KAC A;  2WXJ A;  3ZLZ A;  4P6V F;  4JL9 A;  4HPL B;  1VDV A;  1YN3 A;  1OEY J;  3NZS A;  2LFI A;  2BPS A;  3BYT B;  3EEC A;  1GC7 A;  2WWZ A;  2D5G A;  3KWL A;  1V6E A;  2JYT A;  4OVU A;  4HEA 1;  2GBR A;  1SGH A;  4JE3 B;  3TJP A;  3EC8 A;  2O6V B;  3Q8C A;  4FAD A;  1K52 A;  5T8I A;  1JRU A;  3RUL A;  1N62 A;  4RGM A;  2FUG 1;  1UEL A;  1RRB A;  2JWU A;  1WR1 A;  2WXF A;  2JQR B;  2K8B A;  2JZ3 B;  1HTQ A;  2C7H A;  3IHP C;  1P0R A;  2G45 B;  2L05 A;  2NTT A;  2WXP A;  4E3C A;  4RGO S;  2LUE A;  4DHZ E;  1WGR A;  1S1Q B;  4FHK A;  4RM9 A;  1UZX B;  3A9J A;  1DOI A;  1L6U A;  1N61 A;  2L32 A;  4NAW A;  1HE8 A;  5J17 A;  2ZEQ A;  1C79 A;  2DWQ A;  3T3N A;  4C00 A;  4HCN B;  2I38 A;  1WMH A;  2G3Q B;  3ENE A;  2AQ1 B;  3PS6 A;  4WAA A;  1V49 A;  1N5W A;  2H89 B;  4EFO A;  1ZGU B;  5DPT A;  3I3T B;  3SD5 A;  1C4A A;  1KJT A;  4MSM B;  1FMA D;  4IC7 B;  2YEP F;  3UF8 A;  1I7H A;  1XT9 B;  2FCS A;  1IGD A;  2G9H D;  3U7Z A;  1ZXI A;  3KLS X;  4WIP A;  1FNW A;  5D2M B;  3ZQ4 A;  2D3C A;  3VAW A;  5EE9 A;  2KLG A;  3PLV A;  4N58 A;  3CWI A;  3BVM A;  3Q2A C;  1ZP0 B;  1WX8 A;  2KNB A;  3NS1 A;  2JSV X;  2RD0 A;  3B0A A;  2O6V A;  2D2Q A;  4YSY B;  2D07 B;  1ZPS A;  2D11 A;  3AEC B;  3QHT A;  2N7E A;  2NPT A;  4MJS B;  4WJQ A;  3N1X C;  4GXB A;  4IOI E;  5AUK A;  1TKY A;  2JUO A;  3LJ3 A;  1MHH E;  2DYO A;  2M56 B;  4IW0 A;  3I9V 1;  2KC1 A;  3AE3 B;  3SDL C;  2QMT A;  3I5J C;  3VRB B;  3AM9 A;  2K8H A;  3LB8 C;  3OG5 A;  4GIV A;  4AS1 A;  3V05 A;  4ZRP A;  3PLU A;  4KGT A;  2KD0 A;  4P1C C;  1J7A A;  1J7C A;  2VH2 A;  3L08 A;  2M4N A;  3RPF C;  1RYJ A;  1MJD A;  3RN9 C;  5TSS A;  1QOG A;  3CMM B;  4II2 B;  1JQ4 A;  1XEE A;  1ZE3 D;  2M17 A;  4C80 A;  3M62 B;  4KKJ A;  2RPV A;  2PIA A;  1FFU A;  5G2N A;  3N9Y C;  2EEL A;  2J4X A;  4NAM A;  1RLF A;  1VZ7 A;  3W1S C;  1L0X B;  2JRI B;  4F1S A;  1XF5 L;  4OZB A;  2RGF A;  4EKU A;  4FUL A;  2QIL A;  2DZJ A;  1UNS A;  3DVN V;  2JPH A;  2LXC A;  4TSS A;  3X0W A;  4KV2 A;  4HCP B;  3RNE C;  1E90 A;  2FCM A;  4MJS A;  3W1Y A;  1WY8 A;  4LDT D;  3VQI A;  3TUO A;  5BMI A;  4IG7 B;  5GMV A;  4BKT A;  4YTN B;  2KVZ A;  3DBR B;  5G5H A;  2PTL A;  3DPD A;  4HPP A;  2MJ3 A;  3C0R B;  4GU2 A;  3RMK C;  4WQO B;  1L4D B;  1C4C A;  4AQ7 A;  3WCQ A;  2XK5 B;  1XLP A;  3Q3O C;  5AZH A;  5JZE B;  2QIE B;  2I1J A;  3VRA B;  1P7E A;  2W9N A;  1XO3 A;  4S0R A;  1JW9 D;  1YQ3 B;  1EUV B;  4A90 A;  3DOW A;  1JWB D;  2AQ2 B;  1OQY A;  5KHO A;  2GBJ A;  1I4Q A;  2BKR B;  1J19 A;  4REZ A;  2CJO A;  2J7Q B;  1VLB A;  2AWT A;  2LJI A;  2DYM A;  1BXT A;  1KH0 A;  2J42 A;  3UIO B;  1ZDX A;  1B9R A;  1YJ1 A;  2DHZ A;  1I42 A;  5HI1 A;  2OHF A;  2BYT A;  2L52 A;  1FNV A;  3JW0 X;  3FKY A;  3PRM B;  3A1Q B;  5CX3 A;  3ALB A;  2E3T A;  4W9K A;  3RNC C;  2K0P A;  5D3D A;  2DZM A;  3IXS A;  4MDK E;  1K8R B;  4HKZ E;  3AEB B;  2XK5 A;  2SEB D;  3O13 A;  2QCZ A;  3GZN B;  4J3O D;  2DEN B;  1NBF C;  4HPM B;  2KMC A;  1YJI A;  5CTR C;  2CS4 A;  3DHI C;  2C7N B;  2MH7 A;  1WI0 A;  2MW5 A;  1AN8 A;  3MC0 B;  4ARI A;  5CHV C;  2BBC A;  1L4Z B;  1WJN A;  1A5R A;  1MPE A;  4JIO U;  4B0M A;  2AL6 A;  1Q0W B;  4R3D A;  4L23 A;  3AXC A;  5D7G A;  4Q2J A;  4B95 A;  2VZK B;  3MFG A;  3N32 A;  1T0S C;  3ZNG C;  3OJ4 B;  1TZO A;  4XDC A;  3R7Q A;  1XLQ A;  3MHS D;  4B9K A;  1WGD A;  3ML9 A;  4RGT A;  3ZIM A;  4KZC A;  4MH8 A;  4HJK A;  1QOA A;  2MBO A;  5EE0 A;  5G55 A;  2D3G A;  4K7U A;  3IAM 1;  3A1Q A;  3D32 A;  4BAX A;  3QAR A;  2WQY B;  3UQA A;  1FXT B;  2LRU A;  2J52 A;  3R2T A;  2M0X A;  1HTO A;  4TV3 A;  4A3P A;  2ICI A;  2B3A A;  5BYS A;  1VZ6 A;  1WYG A;  3V61 A;  1KOT A;  3RNB C;  1F52 A;  2D3A A;  2L0T A;  4LNN A;  4A9A A;  4I6N B;  4W9F A;  3OJ3 A;  4XC2 A;  4OVV A;  4B0E A;  2J0M A;  1WXQ A;  4IM0 A;  2PPH A;  3S2A A;  1FCL A;  5G5G A;  1XCT L;  4LNF A;  1P9D U;  3RD2 A;  3ZRF A;  1I4X A;  1P98 A;  1YQB A;  5D3I B;  4ANU A;  1GJZ A;  3Q3F A;  2WP9 B;  2CKH B;  3H8H A;  3MC8 A;  3BZD B;  3N1Y C;  2ASQ A;  2K39 A;  4NJC A;  1F2R I;  3RNA C;  1PDX A;  3Q8A A;  4MGK E;  1A70 A;  2IGG A;  3HRD D;  3PHX B;  2BWE S;  2MQJ A;  1WZ3 A;  4NPN A;  2FCN A;  4ASW C;  4WUR A;  1IBX B;  2REX A;  1TJE A;  1P3Q U;  2KHW B;  2W3S A;  4IM3 A;  2HJ1 A;  2WU2 B;  1SEB D;  3DHG C;  4HK2 A;  1WXS A;  2WXO A;  3PZD A;  2XNA C;  2W55 A;  2C5L C;  1DGJ A;  1H4R A;  3WAM A;  1WWT A;  5E6J A;  2HD5 B;  2JY6 A;  4BBN F;  5HKH A;  4F8C B;  3GE3 C;  2KT7 A;  2KWC A;  3QQ8 B;  1E10 A;  2N9P C;  4MGY E;  3A4S C;  2Z59 B;  4BKS A;  1HEZ E;  3TBL D;  4BZA A;  3AUL A;  2KJ6 A;  1YMH E;  2N9E B;  4AJY B;  1U4A A;  3VTW A;  3APF A;  4K7S A;  3ZDT A;  2C9W B;  3EFC A;  1RFK A;  4FXC A;  4LCD E;  3TCA A;  1PGX A;  3DBH B;  5LLI A;  2KJR A;  3CF6 E;  3H7S A;  3R3M A;  4MEM A;  1EF1 A;  1B1Z A;  3ABV B;  3VH4 B;  1WYW B;  4PT5 A;  4WJP A;  1SE2 A;  4HVB A;  3ZXR A;  1F1H A;  3Q3M C;  4US8 A;  4GMV A;  1IBX A;  1L5P A;  3NVW A;  4K7W A;  4MT5 A;  1KFY B;  2MBE A;  1UGM A;  2GMI C;  1JWS D;  3ETR A;  1T3Q A;  1WGH A;  1JWM D;  2INP E;  2KMM A;  5J18 A;  2D10 A;  1V86 A;  2C7M B;  4H2A A;  1FEH A;  2B76 B;  4GSW A;  2X38 A;  4II3 B;  2HTM E;  4FLH A;  1E8Y A;  3U8Z A;  4C7Y A;  3VDZ A;  1F0Z A;  3EFU A;  2FID A;  1C78 A;  4NZL B;  2IJ0 A;  1EWY C;  5IN7 A;  1NVI D;  1MG4 A;  4TMA B;  3AU5 A;  2R2Q A;  2L1A A;  2L7R A;  3P4S B;  3NOB A;  5AEK B;  5FR6 A;  1E9M A;  4IM2 A;  2DX5 B;  5CHW A;  1E8X A;  1YQ4 B;  2PW9 A;  2WGS A;  2JF5 A;  4XX5 A;  1YJJ A;  3PV1 A;  2KWU B;  4OZC A;  5LXH A;  3IT6 B;  1E0Z A;  1SJE D;  2PE9 A;  3L4P A;  4HDQ A;  2M8S A;  4GLS C;  3NVY A;  2IO3 B;  3W2D A;  3NVV A;  2BVC A;  4TQ1 A;  2WXM A;  3PRZ A;  3P63 A;  1KLU D;  1BT0 A;  3P4R B; 
#chains in the Genus database with same CATH homology
 5G2N A;  3L10 B;  1UBI A;  2LVQ A;  3K9P B;  4FA6 A;  3PRE A;  1LXD A;  1RLF A;  2LAS A;  1VD2 A;  2WX0 A;  4IUM B;  4PYU A;  3W1S C;  4EZJ A;  2JRI B;  3ML8 A;  2KDF B;  4F1S A;  3RT3 B;  1QZE A;  5C1Z A;  3L16 A;  2L76 A;  2O2V A;  4CO7 A;  2RGF A;  4EKU A;  3M3J A;  4FUL A;  2MSE D;  2MA9 B;  3WAL A;  2DZJ A;  5C23 A;  3DVN V;  2JPH A;  2LXC A;  2JZZ A;  2YLM A;  3X0W A;  3GZN I;  3RCZ A;  1VCB A;  4KV2 A;  1XD3 B;  4HCP B;  1E90 A;  2FCM A;  4FJV B;  1YD8 U;  2I1K A;  2G4D B;  4MJS A;  3W1Y A;  1WY8 A;  1WXV A;  4KVG B;  1YX5 B;  4LDT D;  4MM3 A;  3VQI A;  4FHJ A;  4IG7 B;  5GMV A;  4BKT A;  3H7P A;  2LWP A;  3WA0 A;  3X23 A;  4BBN C;  3EHV A;  3DPD A;  3H6N A;  5AZG A;  4CHK A;  2UWQ A;  3PSE B;  3C0R B;  1GUA B;  4GU2 A;  3B08 A;  2HJ8 A;  2MX2 A;  4WQO B;  4M0W B;  4ZRJ A;  3N30 A;  2KQ7 A;  3ZTD A;  2XK5 B;  4EOY A;  3DBL I;  3ZO5 B;  1P1A A;  2KX0 A;  2CU1 A;  1UH6 A;  2BGF A;  3M63 B;  2KC2 A;  5AZH A;  5JZE B;  1TGZ B;  2I1J A;  1C1Y B;  4MGI E;  2W9N A;  3ZW3 A;  4W9L A;  2DZI A;  4BOZ B;  3CST A;  3RYT A;  4FJY A;  3RZW C;  2WX1 A;  1T0Y A;  2Z0E B;  1EUV B;  3T8M A;  2KOX A;  3DOW A;  2JT4 B;  4KZ0 A;  4LDT B;  4AWJ A;  3APC A;  1OQY A;  5J2R A;  4KSL C;  4X57 B;  2GBJ A;  5KHO A;  1YIW A;  3DBH I;  2MCN B;  5IA7 A;  3QA8 A;  4HWI B;  3WAN A;  1WIA A;  2R2O A;  3V6C B;  2V4L A;  1WZ0 A;  2BKR B;  4KSK C;  1WXA A;  1J19 A;  2YVC A;  3RUI B;  1WRD B;  4PS3 A;  1X1M A;  2J7Q B;  5E6P A;  3KUD B;  2AWT A;  2N1V A;  2L00 B;  4RM8 A;  5JHA A;  2LJ5 A;  4PS7 A;  4IWQ A;  4DXA B;  1J0G A;  1WX9 A;  2DYM A;  4FN2 A;  1EF5 A;  2J0J A;  1ISN A;  3R66 C;  3UIO B;  2G4S A;  4MEL A;  1YJ1 A;  3K9O B;  2DHZ A;  1I42 A;  2KXJ A;  4WWO A;  3DVG Y;  5D6J B;  3ZNI D;  2KDI A;  1J8C A;  3L54 A;  2GOW A;  5BO4 B;  2DYB A;  2GBM A;  5AZF A;  3JW0 X;  3ECI A;  3PRM B;  4N9F 4;  2MWS B;  3A1Q B;  1GNU A;  1GC6 A;  1IYF A;  1WM3 A;  2WDT B;  1L7Y A;  5CX3 A;  4W9H A;  2AYO B;  2LGY A;  3ALB A;  3KUC B;  2J0K A;  3KYC D;  2OJR A;  1D3Z A;  4W9K A;  2XEW A;  2JXX A;  2O6V D;  1V5T A;  4GN1 A;  3TIX A;  2IY0 B;  2DAJ A;  3P2B A;  4NQK E;  5EDS A;  1V5O A;  3ZUN A;  4PS8 A;  4DK5 A;  3V62 A;  3DVN U;  2L8J A;  2DZM A;  2PE6 B;  4I6L B;  1MG8 A;  1TBE A;  3VUX A;  4MDK E;  3ZRC A;  1K8R B;  2KN5 A;  2NS5 A;  4DHJ D;  2XK5 A;  1F9J A;  4EUT A;  2N9X A;  2LZ6 A;  1M94 A;  2FCQ A;  1V9J A;  2DEN B;  1NBF C;  2ZPY A;  1LQB A;  3NY5 A;  4HPM B;  4KIK B;  1S3S G;  5JH5 C;  2KMC A;  5L95 C;  2LGX A;  5CTR C;  2CS4 A;  3QX1 A;  4URK A;  3HIZ A;  1OTR B;  2KX3 A;  2N7D A;  1EO6 A;  2NBV B;  2RPQ A;  2C7N B;  2MW5 A;  1WI0 A;  3ZKJ C;  4EZL A;  1WFY A;  4A3O A;  1WF9 A;  4NJ7 A;  4WJN A;  2MBB B;  4ICU A;  5CHV C;  4AJW A;  2LGD A;  1WJN A;  3KYD D;  4ZYN A;  2QHO A;  1A5R A;  4E74 A;  2KMA A;  4JIO U;  3U7D A;  2FUH B;  4G0N B;  1WJU A;  2AL6 A;  1OGW A;  2K8C A;  3DDC B;  1Q0W B;  4F7Z A;  2KFJ A;  1H8C A;  3AXC A;  5D7G A;  4G3X B;  4B95 A;  3IBE A;  1C3T A;  1R4M I;  1PQS A;  2NPT B;  3A9K B;  3HHM A;  4M8N A;  1YX6 B;  3A33 B;  3N32 A;  2ZJD A;  4M8M A;  4TQ0 A;  4DHJ B;  3ZNG C;  3IFW B;  3OJ4 B;  3WIM A;  2KWV B;  1WE7 A;  2CR5 A;  2NBU A;  2C60 A;  2IO2 B;  2V1Y A;  3R7Q A;  2K1F A;  1WH3 A;  2BYE A;  3MHS D;  4B9K A;  1IP9 A;  3TL5 A;  2PJH A;  1GG3 A;  2ZVO A;  2DAF A;  1G6J A;  3UIN B;  1WGD A;  2Z0D B;  2IYD B;  3ML9 A;  2BF8 B;  3VFK A;  4KZC A;  3ZIM A;  4ZRI A;  2LRW A;  3UIP B;  2K25 A;  4HJK A;  4W9D A;  4BKS D;  2MBO A;  3PHW B;  5DPR A;  4K1R B;  5G55 A;  2D3G A;  1LFD A;  3PTF C;  3VH3 B;  1KM7 A;  4K7U A;  3PVL A;  2IZV B;  3A1Q A;  3D32 A;  3QAR A;  4BKG A;  3L0W B;  3ZDM C;  3OLM D;  3UQA A;  4FBJ B;  1FXT B;  2LRU A;  3VHT C;  3PGE A;  3QC8 B;  3VUY A;  4JGH B;  2M0X A;  4TV3 A;  4A3P A;  3HK0 A;  1Z5S B;  1V80 A;  1SIF A;  2B3A A;  4BOS C;  2FNJ B;  4LJO B;  4DHZ B;  1KOT A;  3V61 A;  3JVZ X;  2KVR A;  2MBH A;  1WM2 A;  4GDK B;  3UQB A;  2L0T A;  5D94 A;  4KIK A;  2ZNV B;  4GOC A;  4I6N B;  4XZ4 A;  4W9F A;  3OJ3 A;  4RMA A;  2KO3 A;  3AU4 A;  4XC2 A;  3QCA A;  2ZNV C;  5CHF A;  4PYZ A;  4OVV A;  2ZPN A;  3CSF A;  2J0M A;  2HTH A;  4IM0 A;  2PPH A;  3S2A A;  5DCN A;  1Q1O A;  2VRR B;  4ANW A;  1P9D U;  4W9J A;  3DBS A;  3RD2 A;  1WR6 E;  3ZRF A;  4W9C A;  1P98 A;  1YQB A;  3JSV B;  1WJ4 A;  1ZW7 A;  1KLV A;  2BYF A;  4DWF A;  3O65 B;  4ANU A;  1GJZ A;  2KJH B;  2LVO A;  2KZR A;  3N3K B;  4J6I A;  5E6O A;  3Q3F A;  1NDD A;  3NHE B;  3OAW A;  1WXM A;  1AAR A;  2CKH B;  3QK0 A;  3A9K A;  3A9J B;  3H1U A;  1WGG A;  2ASQ A;  2K39 A;  3M95 A;  4BFR A;  2IO0 B;  4MH0 E;  3ZVV A;  2A4Z A;  4NAW B;  2EKE C;  1E8Z A;  2L0F A;  3JYU A;  4ZDV A;  1WMH B;  4MGK E;  3APD A;  4E71 A;  2NVU I;  4LJP B;  3PHX B;  1UD7 A;  4GB9 A;  2KQS A;  2BWE S;  2MQJ A;  3B1L X;  4MGZ E;  1E5W A;  1WZ3 A;  2K6Q A;  4NPN A;  2BWF A;  2KAN A;  2FCN A;  3Q3J A;  4ASW C;  2A5U A;  2ZZP B;  2REX A;  3KW5 B;  3PRZ A;  1P3Q U;  2KHW B;  4TUU A;  4W9G A;  4EEW A;  3ZLZ A;  4IM3 A;  4JL9 A;  2ZCC A;  2EMS A;  3VVW B;  4W9I A;  4HPL B;  4WWP A;  3LDZ E;  2L3Z A;  3T9L A;  5KHQ A;  1Q5W B;  5DPS A;  4HK2 A;  4AUQ C;  2KFK B;  1OEY J;  1WXS A;  3NZS A;  3PZD A;  4DDI D;  5JHB A;  2BPS A;  4B6W A;  2N1W A;  2C5L C;  3EEC A;  1GC7 A;  2WWZ A;  1H4R A;  2MRP A;  2JVC A;  4WWN A;  5E6N A;  3WAM A;  2HD5 B;  1RAX A;  2JY6 A;  2JRH A;  1V6E A;  1V81 A;  4BBN F;  3MTN B;  4GDK A;  3A4R A;  4OVU A;  5IAA C;  5HKH A;  1RFA A;  3ONS A;  2GBR A;  4F8C B;  5L83 A;  3QWZ B;  1SGH A;  2KWC A;  4YL8 A;  3TJP A;  3EC8 A;  2O6V B;  3QQ8 B;  4GGQ A;  4FAD A;  2N9P C;  3IVF A;  4MGY E;  1OEY A;  1JRU A;  2OOB B;  3A4S C;  3RUL A;  3VUW A;  2Z59 B;  2ZVN A;  4BKS A;  2IO1 B;  3TBL D;  1UEL A;  3AUL A;  1RRB A;  2KJ6 A;  4MSQ B;  1WR1 A;  2N9E B;  4A20 A;  4BVU C;  2K8B A;  1U4A A;  3VTW A;  4AJY B;  3APF A;  2JZ3 B;  3QJZ A;  4K7S A;  3ZDT A;  2C7H A;  3IHP C;  1P0R A;  2PEA A;  2G45 B;  2L05 A;  3GOE A;  4NY0 A;  2C9W B;  3SHQ A;  1LM8 B;  4E3C A;  2LUE A;  2MP2 B;  3JSV A;  2KK8 A;  3L17 A;  4DHZ E;  2RSU A;  1WGR A;  4GDL B;  1S1Q B;  2CHZ A;  4FHK A;  3KUZ A;  1XQQ A;  2M1M A;  4LCD E;  4RM9 A;  3TCA A;  1TTN A;  1UZX B;  3A9J A;  3TMP B;  3NZU A;  5LLI A;  2KJR A;  2V3S A;  3CF6 E;  3H7S A;  1WJ6 A;  3R3M A;  4MEM A;  1EF1 A;  2MLB A;  3SU8 X;  4NAW A;  1HE8 A;  5J17 A;  2ZEQ A;  3V6E B;  1IPG A;  2LD9 A;  3VH4 B;  4HCN B;  1WYW B;  1WMH A;  2FAZ A;  2G3Q B;  3ENE A;  4WJP A;  4HVB A;  3PS6 A;  4WAA A;  3R7R A;  2XBB C;  3DCG A;  1V49 A;  4IWP A;  3U30 A;  4CYE A;  4EFO A;  1ZGU B;  5DPT A;  4ANX A;  4GMV A;  4K7W A;  3I3T B;  3SD5 A;  5DPW A;  1KJT A;  3DVG X;  2MBE A;  1UGM A;  2GMI C;  3IG3 A;  4IWO A;  4KDI C;  3BY4 B;  4KDL B;  4MSM B;  3ZNH B;  2BKF A;  1WGH A;  4K81 A;  1CMX B;  3ZTC A;  2KTR B;  5J18 A;  2D10 A;  4IC7 B;  1V86 A;  2C7M B;  4EZK A;  3UF8 A;  1NI2 A;  3VTU A;  2IBI B;  4AOF A;  1E7V A;  2KFK A;  4GSW A;  4II3 B;  1XT9 B;  2FCS A;  1E8Y A;  4FLH A;  2NCN A;  2GBN A;  3U8Z A;  4AP4 C;  2KDB A;  2LXA A;  3VDZ A;  3H9D A;  2AL3 A;  3EFU A;  3DBR I;  5D2M B;  4DDG D;  3VAW A;  2FID A;  4TKN A;  5LXI B;  3QIJ A;  2KLG A;  3PLV A;  4I6P A;  2KTF A;  2CHX A;  3WAO A;  4DBG A;  1WX8 A;  1V2Y A;  2O2V B;  2KNB A;  4HXD A;  4NJ6 A;  4P7I A;  2GBK A;  3BIN A;  2KDE B;  2WYQ A;  4ANV A;  3V60 A;  2RD0 A;  3B0A A;  3HM3 A;  2NBW B;  2O6V A;  2D2Q A;  2Y5B B;  3PT2 B;  2D07 B;  2CHW A;  2D11 A;  3QHT A;  4JLC A;  3W1S A;  2N7E A;  2NPT A;  1E7U A;  4W9E A;  4MJS B;  2DZK A;  2KKC A;  3MJW A;  4WJQ A;  3AU5 A;  3ZNZ B;  2R2Q A;  2UYZ B;  4GXB A;  1WX7 A;  1I35 A;  2L7R A;  3H7P B;  2JUO A;  3LJ3 A;  3L13 A;  2RR9 A;  3KVF B;  1R4N I;  2DYO A;  4G50 A;  3NOB A;  4NNJ B;  4IW0 A;  2MP2 A;  2K6D B;  2KC1 A;  2BYV E;  4FJZ A;  1WGY A;  2NR2 A;  1Y8R C;  4GDL A;  5AEK B;  3SDL C;  1WE6 A;  5TR5 A;  2IY1 B;  5FR6 A;  3PRP B;  4IM2 A;  2DX5 B;  1UBQ A;  2ZCB A;  2MBQ A;  5CHW A;  4ZRK A;  1TZ1 A;  3WAP A;  2K8H A;  1E8X A;  3NS8 A;  4JQW C;  2JF5 A;  1SE9 A;  4GIV A;  3QAQ A;  4XX5 A;  2HE7 A;  4WJO A;  1E8W A;  2LVP A;  3VTV A;  2EMT A;  4HLE A;  3PV1 A;  1L2N A;  3PLU A;  2N4F A;  2KWU B;  5LXH A;  2KD0 A;  3PPA A;  3UGB B;  2PE9 A;  4G11 A;  3L08 A;  4ICV A;  4HDQ A;  2M8S A;  2AEH A;  2M4N A;  3VXW A;  1ZKH A;  4HDO A;  3CMM B;  2IO3 B;  1Z2M A;  3KH0 A;  4II2 B;  2M17 A;  3HM6 X;  2KTR A;  4NQL B;  3AI5 A;  3RZF A;  2KLC A;  3M62 B;  2FIF A;  2JWZ A;  4TQ1 A;  2LI5 A;  3DQV A;  1BT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...