1QOGA

Ferredoxin mutation s47a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qogA00
1N5WA 1SB3C 3NVVA 3NVWA 4N6EB 5AUIA 1T3QA 3AEEB 2W3SA 3AMZA 1FFVA 1QOAA 1RWSA 1FRRA 1TKGA 1VDVA 2PVGC 1DOXA 1FRDA 1L6UA 1FXIA 1J7CA 1QT9A 3AV8A 1SIJA 4N58A 3VR8B 1XO3A 2BS4B 1SF0A 2Y5CA 4ZHPA 4YSYB 4YT0B 4N59A 4KX6B 1NYRA 4US8A 5C2TB 4JX1C 3NVYA 2MJDA 1TYGB 1GAQB 1B9RA 1PFDA 2M19A 4FXCA 2CJOA 2LEKA 1JALA 3AEFB 1JRPA 2WQYB 3L4PA 4A9AA 4WWMA 1V97A 1OFFA 3AH7A 1J7AA 1XLNA 1FO4A 1DOYA 3SFEB 4HRSA 1JW9D 1WRIA 2N0SB 3AE8B 1F0ZA 3NS1A 1RM6C 1TKYA 2AX5A 1N62A 1CZPA 3RPFC 2DWQA 1WYGA 2JQRB 3AE4B 3FAHA 1ROEA 1QF6A 1FIQA 1QLBB 3AB5A 3P4PB 2H88B 2M56B 2MJEA 1KRHA 2W3RA 3LXFA 1L6VA 1RYJA 1JWAD 3AEDB 1EWYC 4WQMA 1WXQA 3W5VB 3LB8C 1QOBA 1ZOYB 2L52A 1QOFA 1KF6B 2BS3B 2PVOD 1L5PA 1YQ4B 4JWSC 1NEKB 2L83A 2EKIA 4YTNB 1NI3A 5EE0A 4C80A 1N61A 1FFUA 1OQRA 1YJJA 3AE2B 2WDVB 1FM0D 3VR9B 1WWTA 4ZOHC 2CJNA 3P1MA 2WU5B 1NVID 4C7YA 2G1EA 3NRZA 1CJEA 3W5UB 3P4QB 4C7ZA 1GPXA 2CU3A 1AYFA 1AWDA 1I7HA 1DGJA 2B76B 3FC4A 2K5PA 2E3TA 5C3JB 3B9JA 3AN1A 2KAJA 4HROA 5AUKA 5H8YE 3SFDB 2MJ3A 1FMAD 2ACZB 2WDRB 1DOIA 5GXGB 1R7SA 4ZHOA 1PDXA 4ITKA 3ZYYX 1YJIA 1XLOA 2HTME 3AE6B 3AE3B 3DWMA 3HRDD 5EE3A 3SR6A 3P4SB 4P6VF 2JX5A 2KMMA 3BIID 3KWLA 3VRAB 3AE9B 1E10A 2Q5WD 2WS3B 2WLBA 3ETRA 1ZP0B 5EE9A 2DBYA 1UWMA 5H92C 1E0ZA 2BT6A 1NENB 2QIEB 1RFKA 3HVZA 5G5GA 5EE1A 1L0VB 1XLQA 2PIAA 3EUB2 1E9MA 4YXDB 2W54A 1N63A 3AEAB 1A70A 2K22A 4YTMB 3NVZA 2WP9B 1JROA 2OHFA 2W55A 2PKOA 1J7BA 1JWBD 4YTPB 5MPOA 1PUTA 2FBWB 3AEGB 4USAA 3W9CB 4YSXB 1KFYB 3AM9A 1TKEA 4JWUC 1YQ3B 2K9XA 3WCQA 1N60A 1TJEA 1NYQA 1QOGA 3ABVB 3AE7B 3DWGC 5G5HA 2BS2B 3AECB 3CWIA 1E7PB 2QJLA 1WGKA 3VRBB 1V8CA 1N5XA 1OQQA 4LTUA 3AE5B 3CIRB 2WDQB 4IDIA 1XLPA 3HUIA 2WU2B 3AEBB 3B2GA 1ZXIA 2MH7A 4YSZB 1JQ4A 3P63A 2H89B 3AE1B 1E6EB 4US9A 1ZUD2 1IUEA 3B2FA 3P4RB 1FXAA 3PO0A 1VJKA 1VLBA
chains in the Genus database with same CATH superfamily
2KVZA 1SB3C 3EA6A 2NTSA 4OVZA 2JXXA 1RWSA 1FRRA 2IO0B 2XNAC 2Y5CA 4B9KA 1Z5SB 1GNUA 4IUMB 2WXLA 4FULA 3ZJUA 5BMIA 2M19A 4FLHA 1ET9A 3L17A 1ACCA 1XLNA 2IGGA 4C4VA 4WAAA 2LGDA 5KHOA 4AQ7A 1WYGA 3ZJTA 2I2YA 4MELA 3PV1A 1LGRA 3L54A 2L1AA 1G6JA 5AZFA 5AZHA 4BKSA 2MSED 2LGYA 2DZMA 3KW5B 5GMVA 2LJIA 3BYYB 3NHEB 4FHKA 3TJPA 5C3JB 3BK1A 3SFDB 3JVZX 4GDKB 2KWDA 5GXGB 5E6PA 3RNAC 3J9CA 4P6VF 3BK2A 3KWLA 1Z2MA 3VH4B 1YMHE 2QC8A 1E0ZA 3ZQ4A 1RFKA 4II2B 3KQ4A 1ESFA 5DPRA 3H8HA 3N3KB 3NY5A 2FBWB 1KFYB 4E3CA 2WXPA 2KD0A 4IOIE 3R3MA 1E7PB 3QX1A 4K7WA 3CIRB 5AEKB 3ZRFA 3ENEA 4RM8A 2JUOA 1KLVA 1IUEA 3ZVVA 2L7RA 4REZA 3UF8A 5CX3A 4NJCA 3W2DA 5D6JB 3R2IA 1J7CA 2W82A 5IAAC 1OGWA 1T0YA 4N59A 4KX6B 4EZLA 3WALA 1B9RA 4FXCA 2CJOA 3AI5A 1QKZA 3PS6A 4WWMA 3BWUD 1I4XA 1TKYA 2KDBA 2LRWA 1SXTA 2WDTB 3N9YC 3AB5A 2H88B 4W9DA 2ASQA 4GDLB 4TQ0A 2KXJA 1T5XD 1NEKB 2DHZA 1FM0D 1KOTA 4W9GA 2KYWA 4II3B 2B76B 2NPTA 3QARA 3T3NA 4A90A 3AN1A 4TQ1A 2HTHA 4ZRJA 4MGIE 4L23A 2WDRB 1TT5B 3RT3B 1EO6A 3TEXA 3RNBC 1RFAA 4YL8A 1L4ZB 2N1WA 2NR2A 3GZNI 3ZW3A 4YTMB 1X1MA 4O1NA 2AL3A 3VTVA 2RPQA 3L10B 2BYEA 4JWUC 4HEA1 2BPSA 1QOGA 3NG0A 2O6VA 3VRBB 4NQKE 2M4NA 2FUG1 1V2YA 1V1PA 3RMKC 2A4ZA 3AE5B 3H1UA 4MACA 2LVOA 4HWIB 2VZKD 4A20A 1MHXA 2H89B 3K9OB 1ZUD2 1FEHA 2NMQA 2V9HA 1VZ7A 1N6ZA 3AEEB 1UWXA 3SDLC 3O65B 4MSMB 2D11A 1UBIA 1FRDA 2C9WB 1UF0A 3L0WB 5BMGA 4IW0A 1NYRA 1E8XA 4J3OD 1WXAA 3DBLB 4P7IA 1VCBA 2K25A 1Q0WB 3Q14C 4XYCA 2WXFA 3ZLZA 2ONQA 1D3ZA 2N0SB 4WQOB 3AULA 4G0NB 3WANA 3NS1A 4NQLB 4OVVA 4I6NB 2PE6B 4NJ6A 3WA0A 4HPLB 2M56B 2FIFA 1WXQA 3I63C 5LLIA 1QOBA 1MPEA 4JWSC 1WWTA 3ZTDA 4AWJA 1WGYA 5JZEB 3VDZA 4OVUA 1T0QC 4DXAB 3RFZB 1BMLC 3ZYYX 1BXTA 1F9JA 3MC0B 5D2MB 2JX5A 4C4VB 1UELA 3UI3A 3HVDA 4JLCA 2MX2A 2INPE 2INNE 2W54A 1YJ1A 1A70A 3KUDB 2W55A 4WJQA 1OQYA 2ZNVC 4ZHOA 2NS5A 4PYUA 3DWGC 1D4BA 3PREA 4OW0A 3GB1A 4XC2A 4H2AA 4DBGA 3NOBA 3IAS1 3A9JB 2LXCA 4IDIA 5TR5A 1LXDA 3B2GA 4K7UA 2YEPB 4A55A 4RF1A 5D94A 2ON8A 4GGQA 2BYTA 3B0AA 3TEZA 2JT4B 1YN4A 4KSKC 1XT9B 1TS3A 3AV8A 4N58A 4B95A 5IN7A 3B08A 2KN5A 2OEDA 4YSYB 1I4RA 2JXTA 2RD0A 4GN1A 4ASWC 2BWES 2N7JA 5DPWA 4DHJD 3DHHC 1GC7A 1H4RA 2FCNA 4NJ7A 3VTWA 1JALA 2VH2A 3RNFC 3I57A 1OFFA 2KO3A 4MJSA 4FA6A 3I5JC 5LXIB 1F0ZA 4M01A 3CMMB 4K81A 4FBJB 3IAM1 1QF6A 4OHJA 1EF5A 2ZW0A 3NZ3A 2DENB 3QWZB 2XN9C 5LXHA 3B1LX 1V80A 3JW0X 3RYTA 2NBWB 2L52A 2AL6A 4GDKA 4Q2JA 4HKZE 3R8BA 3VR9B 3OAWA 2NCNA 2WU5B 1WJNA 4C7ZA 1AWDA 2K5PA 3V3XA 2ACZB 2KJHB 1EWCA 2ZPYA 4W9IA 2KMMA 3AE9B 1WMHA 1CK1A 5CTRC 1C78A 2PEAA 1KLUD 2UWQA 2NBVB 3KVFB 5H92C 3A4RA 2N9KA 2DZKA 2JZ3B 1JWBD 5BMHA 3C8YA 5HI1A 2KC2A 4DDGD 1JWUD 2KT7A 3A33B 3CWIA 3X0WA 5JH5C 3MTNB 2YLMA 3PLUA 4F1SA 3SD5A 2NPTB 3VH3B 3HUIA 1P7FA 3C19A 1VZ6A 4E74A 4IG7B 1WM3A 2MQJA 1T6BX 1J8CA 2XBBC 2W3SA 1FNVA 1OTRB 2EMTA 2JVCA 4WH4A 1WXSA 3ML9A 3S2AA 4KGRA 3RCZA 2OOBB 2BBCA 3QC8B 1GAQB 3AXCA 4NY0A 1IGCA 3AEFB 2O6VB 3Q3JA 3ONSA 3MC8A 2DWQA 2QMTA 2R2QA 2D3AA 2IY1B 2L76A 2MJEA 4M8MA 3VUYA 1EWYC 1XXGA 3Q8EA 1ZOYB 2L83A 3RNGC 2LUEA 4AJYB 2OJRA 4KKIA 5G55A 1WM2A 4LK0M 2L05A 3DBHB 1I7HA 2KJRA 2ZCBA 1HEZE 2E3TA 4JIOU 1CQVA 2GLSA 3UINB 2BVCA 4ARCA 2CS4A 4LNIA 1XF5L 4FJYA 3TCAA 1ZP0B 5IP4D 2KWUB 3GE8C 5DCNA 4ZRQA 4L2YA 4KDIC 1WI0A 1EU3A 4MGYE 2MWSB 1ZDXA 2QDFA 2K22A 1AARA 5LNK1 4PYZA 2PKOA 3MC9A 4EZJA 3Q8AA 3PZ8A 1YQ3B 2K9XA 4RGTA 2UYZB 4I6LB 4K3BA 4W9CA 2WYQA 4XDDA 3KYCD 1WFYA 2KKCA 1L7YA 3PLVA 4PS7A 4YSZB 4MDKE 1MG8A 1UGJA 1E6EB 1LQBA 4DK5A 1WE6A 1UZXB 1N5WA 5J2RA 3DBRB 1T3QA 3OJ4B 1TKGA 4BBNC 4ACFA 1E8ZA 1LO5D 3BVMA 3V6CB 1P98A 5BYRA 3VXWA 2LHDA 2M0XA 2C7HA 4IM0A 2CR5A 4OZCA 4MM3B 1ZKHA 2PE9A 2JYEA 1WXMA 1STEA 2AQ1B 3U8ZA 3KUCB 1C4PA 4HK2A 2AWTA 1L2NA 1B1ZA 4EEWA 3APFA 2CKHB 1ROEA 1T0SC 4X57B 3SEBA 2MW5A 2IO1B 3LXFA 2FIDA 2DX5B 1L4DB 4DXGA 4YTNB 1YQ4B 3U7ZA 1M4VA 2O2VA 4B0EA 1JCKB 4ZOHC 1RLFA 2G1EA 3W5UB 3L16A 3P4QB 1D6EC 3M95A 2CU3A 2ZVOA 4NAWA 2KAJA 5IA7A 4URKA 3KYDD 3N30A 2N4FA 2MBBB 2QSDA 1FCCC 1GC6A 1WJUA 1TIFA 4MJSB 1VD2A 1C4AA 2FE8A 2INCC 2WX1A 4TMAB 3U30A 2QIEB 1NENB 2CHZA 1FPYA 2I1KA 2WP9B 3A9JA 1JWSD 1I4PA 1JRUA 3NS8A 1QZEA 1TJEA 3QK0A 5G5HA 3MHZA 1VR9A 1PGXA 3M62B 4KVGB 4KZCA 3N1YC 3Q8FA 1KJTA 1C77A 5HFYA 4W9LA 1WJ6A 2LVPA 1WMHB 3FILA 1QOAA 1VDVA 3VUXA 1WZ0A 3IVFA 4BFRA 3RULA 2ZCCA 3HK0A 3RD2A 1UNSA 2DYBA 2MRPA 3DHIC 3MHSD 3ML8A 3PRPB 1ET6A 4UDUC 3H6NA 1EM7A 2HE7A 2PMVA 2JPHA 1J7AA 4XWWA 1SIFA 4BAXA 3AE4B 3FAHA 3PSEB 3PRMB 3VTUA 2W3RA 3KWVA 1JWAD 2LGXA 1L5PA 3ZDTA 3R7RA 1TTNA 2HD5B 1ISNA 3M3JA 3U4EG 3DVGY 4RNAA 1NDDA 2RDBC 2FUHB 2LHEA 3H7SA 5AUKA 4CQNA 3GZNB 3A4SC 3Q8CA 1YJIA 3N32A 3AE6B 3VRAB 4ZRPA 3UGBB 1E8WA 3ZNZB 1C9FA 1WSPA 2KACA 3QCAA 4RCOA 5BYQA 2Y5PA 4J6IA 4HCNB 1E5WA 2OHFA 1V86A 5DPSA 3DBSA 1E7VA 3ZNHB 1WYWB 3ZO5B 1TKEA 2FAZA 3Q3NC 4JL9A 3DHGC 3PGEA 1OEYJ 4LTUA 2ZNVB 1E8YA 4LDTD 3P63A 5EDSA 3P4RB 4US8A 1VLBA 2V3PA 2BF8B 4EUTA 5D7GA 3CSTA 2KDEB 4XWTA 1F2RI 2RGFA 2N9PC 2XK5A 5JHAA 2V3SA 4KSLC 5AZGA 4ANVA 3VUWA 3SFEB 3TSSA 1D5MC 3DVNU 3W1YA 2JQRB 1S3SG 1GJZA 3OLMD 2WGSA 3V05A 3EFUA 2KK8A 3AEDB 3MP9A 3GS2A 1WGHA 1KF6B 1V5TA 3EGRA 5EE0A 5FR6A 2G4SA 4K7SA 1GB1A 1MVKA 3BZDB 3NJTA 1CJEA 2IO3B 3ZXRA 4S17A 2LASA 4G11A 5E6OA 4KIKB 2KQSA 3U52E 2IBIB 1PDXA 4ITKA 3HRDD 4LJPB 3AU4A 2GBNA 4TUUA 2KWVB 2CHWA 3SU8X 5EE9A 1UWMA 2WXHA 1L0VB 2IYDB 1JWMD 4IC7B 4F8CB 3PPAA 4DDID 2X38A 1TS2A 5C1ZA 1I4HA 3AE7B 1NYQA 1KH0A 1QQRA 1P0RA 4PK1A 2KN4A 1V1OA 2O2VB 4W9KA 1E7UA 3RNEC 3BINA 1GUAB 1MI0A 2JYTA 3JSVA 4HJKA 1WH3A 2V4IB 4NAWB 2KTRA 2LMCA 2KQ7A 1F2RC 3ZKJC 2WXNA 4ZYNA 2K1FA 2DAJA 3NUHB 2RMMA 1LFDA 4MM3A 4NAMA 2FCSA 3QA8A 4L1BA 1V6EA 4BZAA 1QT9A 5L83A 3QAQA 4KV2A 3IBEA 4DHJB 3PT2B 1JMLA 4JE3B 3ALBA 2JRIB 4TKNA 1F52A 1V81A 2IPKD 4TSSA 4RGOS 3AH7A 2AYOB 1TS5A 4ARIA 4ANUA 4BOZB 4CYEA 2K6QA 4DXFA 1KTKA 5D3DA 2A5UA 4N9F4 2IY0B 3TEWA 2WXMA 1SJED 1K52A 4A8XC 2ZEQA 5KHQA 2KFKA 2Z59B 4XGAB 1PQSA 3FILB 1OQRA 1OEYA 4P16A 3LDZE 3BVGA 3H9DA 3FKYA 2J42A 5H8YE 5IKCM 4XDCA 4MGZE 1MG4A 1RAXA 4BKSD 4PS8A 5HG2A 3BIID 1WRDB 2Q5WD 1K51A 2K8HA 2NBUA 2YVCA 4NNJB 3VQIA 3Q3FA 1P7EA 3U7DA 1IYFA 3L08A 2REXA 1E9MA 1WGGA 1N63A 1XEEA 4B6WA 2DZIA 2WXOA 2KX0A 2QCZA 4TV3A 2K6DB 4A6QA 4BVUC 2FNJB 3AM9A 4ZRKA 1HXYD 4BKTA 3RN9C 1WE7A 1OQQA 3TL5A 3OWEB 1PYWD 2HJ1A 1I42A 3IFWB 3ZDMC 3I9V1 3ZJVA 5E6JA 1WIAA 2EKEC 3AMZA 1EF1A 2QILA 3NZSA 2GI9A 3VR8B 1SE9A 4IM2A 5HHDG 1UGMA 2MP2A 4ZHPA 2IGDA 5C2TB 3NVYA 4FADA 2MA9B 4HLEA 1PFDA 1TZOA 3TMPB 2W9NA 1GOZA 4NPNA 2WHIA 3Q6BA 1RM6C 2AX5A 1N62A 1NI2A 2XEWA 4F7ZA 1FIQA 5I4DA 3D32A 1LM8B 2JY6A 1KRHA 2G45B 1D5XC 2KX3A 3V6EB 4EZKA 2LUMA 3LB8C 2MEKA 3WAMA 2N1VA 4DHZB 3O13A 4LNFA 2BTEA 1DGJA 4ZYSA 3K9PB 3B9JA 2XK5B 2J4XA 2K39A 3GP7A 1AN8A 1YIWA 1P9DU 3UIOB 2WXRA 3EFCA 1VRAB 2DBYA 1C79A 2GB1A 2MHJA 4S0RA 3RNCC 3NVZA 2KLGA 1C3TA 2V0GA 1J7BA 4C56C 1PUTA 3T3OA 4ZRIA 1HZ5A 3ABVB 1ZPSA 3EECA 3IT6B 4P1BC 2JZPA 1FD6A 1N5XA 1Q1OA 4RM9A 1R4MI 2ZJDA 4I6PA 3T8MA 1TGZB 1HE8A 4G50A 3NVVA 3Q2AC 4K1RB 1FXIA 1GG3A 2C7MB 1J19A 2WXGA 4KGTA 2ZZPB 3PTFC 4LJOB 2M0AA 3LJ3A 2KOXA 3L4PA 2LEKA 2L3ZA 1JRPA 1WY8A 2L0FA 1FO4A 2MCNB 3CSFA 4LNKA 3KLSX 2LRUA 2LJ5A 2IJ0A 3JSVB 1GB4A 2KTRB 1WGDA 3APCA 1SSNA 4XE0A 3DBHI 2GBMA 4RGMA 2GRIA 4IKGA 1XD3B 4HKQA 3M63B 1ZE3D 3APDA 2WNMA 1XQQA 2Z8LA 4KIKA 4C80A 1YJJA 3VAWA 4HCPB 3WAPA 1NVID 5J17A 5G2NA 3FC4A 4CHKA 3T9LA 1T0RC 2L8JA 1WJ4A 1FMAD 3PHXB 4HDQA 1FNWA 3SR6A 5D3IB 2QEJC 2BYVE 2OJWA 3E56A 3ETRA 1M94A 1HZ6A 3P2BA 4BKGA 1EU4A 3VFKA 1R4NI 2V1YA 4MSQB 4M0WB 4PS3A 2KFKB 2J52A 3RZFA 4RFBA 3V61A 2VRRB 2BB5A 4ANWA 3DBRI 3DVGX 3ECIA 5BO4B 2EELA 1KM7A 2KDFB 1ZXIA 1JQ4A 1D5ZC 1QILA 1YD8U 4OZBA 2KTFA 1FXTB 1FXAA 2IGHA 1VJKA 1CMXB 3L13A 2WX0A 4ZDVA 2SEBD 1V5OA 2GBRA 2MBOA 3A1QA 2D3GA 4WJPA 4YT0B 4MT5A 2G3QB 2HDEA 4GB9A 4BBNF 5HKHA 4HPMB 3HM6X 2SAKA 1U4AA 1IBXB 1BUIC 5CHFA 4HRSA 2BKFA 1CZPA 1P3QU 2KFJA 2ICIA 2RDHA 5E6NA 2M1MA 4IWOA 1F77A 1Y8RC 1RYJA 4RH6A 1J0GA 4WQMA 4D2KA 2NTTA 2JU6X 1YN5A 4LCDE 1NI3A 2BW2A 4AS1A 1FFUA 4LNNA 3PHWB 2WDVB 3IXSA 2INDC 3UIPB 4C7YA 3WAOA 3TUOA 2MP2B 2GMIC 3BY4B 3MJWA 1IP9A 2KLCA 4FJZA 2Z0EB 1MJDA 1XLOA 2CU1A 2MBHA 3R2TA 5J18A 3U2SC 3N20C 1SE4A 2BT6A 5C23A 3HVZA 2PIAA 2D07B 4C00A 3EUB2 4EFOA 2KC1A 3IT4B 2RDGA 1MHHE 2KNBA 2LGIA 3ZTCA 4R3DA 4M02A 4LDTB 3P42A 4EE2A 4MEMA 1WX8A 2FCMA 2MH7A 1IPGA 4MH0E 3B2FA 2R2OA 4HDOA 3ZXVA 2J0KA 3NVWA 4N6EB 2WWZA 4MH8A 2PLPA 4JQWC 2GOWA 1SIJA 1SF0A 4LNOA 5JHBA 2N7EA 1AW7A 2VZKB 4K3CA 1F1HA 2GBKA 3DPDA 1TZ1A 4KDLB 4AP4C 1H8CA 2KMCA 3H7PA 2WXQA 3N1XC 1SEBD 1I4QA 1DOYA 1JW9D 3AE8B 1Q10A 5JXVA 4LLGM 4WURA 1E90A 1Y56A 3P4PB 2ZW1A 2PVOD 4RGNA 2EKIA 1YX5B 4A3OA 4HPPA 2DZJA 2DYMA 3DQVA 3GOEA 3LYYA 3PVLA 4HXDA 2LD9A 3W1SC 1ZGUB 2MJ3A 4B0MA 4W9HA 1SGHA 4WWNA 4HJGE 2JRHA 3QHTA 3P4SB 2J0JA 1RRBA 1BT0A 2WS3B 1UUPA 1VZ8A 2ZPNA 1YN3A 1UBQA 3A9KA 2J7QB 1TY2A 2KVRA 5IO9A 4GOCA 2KWCA 2MBQA 3IHPC 3JYUA 1JROA 2KHWB 2PPHA 5MPOA 2Y5BB 4USAA 2JWZA 2LZ6A 4OZAA 3BVZA 2BS2B 1SBBB 4BOSC 1V8CA 1XLPA 4GMVA 2L00B 2Z0DB 3ZIMA 2JSVX 2KANA 3PZ7A 2BGFA 3QIJA 1TS4A 2PVGC 3R66C 3HHMA 1L6UA 4M8NA 4CO7A 1XO3A 3MJ5A 1L0XB 4M00A 2CHXA 2K8CA 4W9JA 1PGBA 3RZWC 4JX1C 3ZUNA 2MJDA 4HVBA 1UH6A 2TSSA 3ZNID 2LWPA 1C76A 2DNFA 2G4DB 2WQYB 4A9AA 1XCQL 2M8SA 1IGDA 3RPFC 2B3AA 3DBLI 4EOYA 3MFGA 2RPVA 1PGAA 2BWFA 1QOFA 3HM3A 1WX9A 2X8XX 3DOWA 1EUVB 3A1QB 2G9HD 2M17A 1R7SA 2KDIA 3KH0A 2HTME 3AE3B 5EE3A 3PZDA 2KJ6A 2JZZA 4WJOA 3AU5A 4M0WA 3URYA 3PRZA 2RSUA 2I38A 2WXJA 2PW9A 3R7QA 2L0TA 3DDCB 2IO2B 2HJ8A 4P1CC 4AOFA 2FCQA 5CHVC 3RI7C 2I1JA 4A3PA 3UQAA 4FHJA 4WJNA 2LI5A 3WCQA 2BKRB 1HA5A 1MFWA 4WWPA 2QJLA 4FN2A 1UD7A 2D5GA 4YWGG 4DWFA 1P1AA 4KKJA 2WU2B 3AEBB 5BYSA 3RUIB 1KLGD 3Q69A 1WX7A 2GBJA 1C4CA 5AUIA 2KDMA 2K8BA 2RR9A 1FFVA 2LVQA 2WXKA 1ZW7A 2BS4B 2N7DA 1XCTL 1IBXA 1A5RA 2QHOA 1WXVA 4GIVA 2D3CA 1HTOA 4IWPA 4GSWA 3GE3C 2J0MA 4DHZE 3W1SA 2AEHA 5FR3A 2N9EB 1WRIA 3EHVA 3IG3A 2Y3AA 2UU7A 3ZRCA 2AQ3B 2PTLA 1SJHD 1K8RB 1QLBB 1WR1A 1YNTE 5FKAC 1GPXA 1NBFC 2V3NA 2IZVB 5IOIA 4AJWA 3AE2B 2BYFA 4NZLB 4XX5A 2CJNA 3HIZA 3OG5A 3NRZA 1AYFA 2C5LC 3N1ZC 3WIMA 4G3XB 3VVWB 5FK9C 1ENFA 4IM3A 3V60A 3SHQA 4RMAA 3H7PB 3C0RB 2WLBA 3UQBA 4KGSA 2N9XA 1WZ3A 2LXAA 3Q3MC 5DPTA 4FJVB 1SE2A 1WGRA 4PT5A 4W9FA 3Q3OC 1DYQA 1XLQA 4WWOA 3TEYA 3AEAB 3EC8A 4YTPB 4MGKE 1FNUA 4YSXB 2D3BA 1R4MB 3AECB 4JGHB 2ZVNA 2K3UA 1WGKA 3Q8BA 1YOVB 4EKUA 2KZRA 3AE1B 4US9A 2KMAA 1K53A 2D2QA 1TBEA 4GDLA 3OJ3A 3PO0A 2DLBA 4ICVA 1HTQA 1V1PB 2JWUA 3ZNGC 4GXBA 1L0YB 4AUQC 2WXIA 3A9KB 2JF5A 2J53A 4E71A 3NZUA 2PJHA 1TYGB 1FCLA 1S1QB 2K0PA 4WAFA 1V97A 2C7NB 3ZGZA 2N9LA 4KZ0A 1WR6E 4IWQA 2O6VD 5CHWA 2AQ2B 2DYOA 2E6XA 4ANXA 2IDYA 2DAFA 2BQQA 4GLSC 5T8IA 3V62A 3DVNV 1L6VA 3E9SA 4QAYA 3X23A 4WIPA 2LFIA 4XZ4A 3W5VB 4GU2A 1ZXHA 2BS3B 4ICUA 1DOXA 1V49A 2C60A 1I4GA 1N61A 3P1MA 3VHTC 1ZDVA 1HQRD 3TIXA 2LGSA 3BYTB 3DCGA 3TBLD 4HROA 3CF6E 4RF0A 1DOIA 1Q5WB 3QQ8B 4JPSA 1V9JA 2NVUI 3DWMA 1R4NB 1E10A 3KUZA 3QJZA 1TY0A 1K50A 2BB6A 1YX6B 5G5GA 1I35A 3I3TB 2VH1A 2D10A 2MBEA 5EE1A 2YEPF 2R61A 4YXDB 2KQ4X 3AEGB 2EMSA 3W9CB 1SE3A 1N60A 2L32A 5TSSA 5L95C 2WDQB 1YQBA 1WF9A 4W9EA 2V4LA 1C1YB 4DQOC 2MLBA
chains in the Genus database with same CATH topology
1T6BX 1SB3C 3EA6A 3NVWA 2NTSA 4N6EB 2RMMA 4OVZA 2W3SA 1FNVA 4MH8A 2PLPA 4NAMA 1RWSA 1FRRA 4L1BA 4WH4A 1QT9A 1SIJA 2XNAC 1SF0A 2Y5CA 4KGRA 1AW7A 1JMLA 4JE3B 2WXLA 2BBCA 2VZKB 1GAQB 3ZJUA 5BMIA 2M19A 1IGCA 2IPKD 2WXQA 3AEFB 1SEBD 1ET9A 4TSSA 1I4QA 1ACCA 4RGOS 3AH7A 1XLNA 1TS5A 2IGGA 4ARIA 1DOYA 1JW9D 3AE8B 2DWQA 2QMTA 1Q10A 1WYGA 4DXFA 5JXVA 4LLGM 4AQ7A 3ZJTA 4WURA 2I2YA 1KTKA 5D3DA 1Y56A 3P4PB 2MJEA 3TEWA 1EWYC 1XXGA 2L1AA 1SJED 2WXMA 3Q8EA 1K52A 2ZW1A 4A8XC 1ZOYB 2PVOD 4RGNA 2L83A 2EKIA 3FILB 1OQRA 2LJIA 3BYYB 4KKIA 4LK0M 4P16A 2DYMA 3BVGA 3LYYA 5C3JB 1I7HA 1HEZE 2E3TA 2J42A 3BK1A 5H8YE 4XDCA 3SFDB 1CQVA 2MJ3A 4GDKB 2KWDA 4B0MA 4ARCA 5GXGB 1XF5L 4HJGE 3P4SB 3J9CA 4P6VF 5HG2A 3BK2A 3BIID 3KWLA 2Q5WD 1K51A 2WS3B 1YMHE 1UUPA 1VZ8A 1ZP0B 3VQIA 1YN3A 1E0ZA 1P7EA 3ZQ4A 4ZRQA 1RFKA 4L2YA 1TY2A 1EU3A 1ZDXA 1E9MA 1N63A 1XEEA 3KQ4A 1ESFA 2K22A 5LNK1 2WXOA 3H8HA 1JROA 2PKOA 3Q8AA 5MPOA 4A6QA 2FBWB 3PZ8A 4USAA 1KFYB 3AM9A 1YQ3B 2K9XA 4OZAA 4RGTA 3BVZA 2WXPA 2BS2B 1HXYD 1SBBB 1E7PB 4IOIE 1V8CA 4XDDA 1OQQA 3CIRB 1XLPA 3OWEB 4YSZB 1PYWD 1UGJA 1E6EB 1IUEA 3I9V1 3ZJVA 5E6JA 2JSVX 1N5WA 4REZA 3PZ7A 1T3QA 1TS4A 3AMZA 4NJCA 3W2DA 1TKGA 2PVGC 2QILA 3R2IA 2GI9A 1L6UA 1J7CA 2W82A 3VR8B 1XO3A 3MJ5A 1LO5D 1L0XB 3BVMA 5HHDG 4ZHPA 5BYRA 4N59A 4KX6B 1PGBA 2IGDA 5C2TB 2LHDA 4JX1C 3NVYA 2MJDA 4OZCA 4MM3B 2TSSA 1B9RA 1PFDA 1TZOA 1C76A 4FXCA 2JYEA 1GOZA 2CJOA 1STEA 2AQ1B 2WQYB 4A9AA 1QKZA 1C4PA 4WWMA 1XCQL 3BWUD 1I4XA 1IGDA 1B1ZA 1RM6C 1TKYA 2AX5A 1N62A 3RPFC 1ROEA 1SXTA 3MFGA 1FIQA 2RPVA 3N9YC 5I4DA 3AB5A 3SEBA 2H88B 1KRHA 1D5XC 3LXFA 1PGAA 4GDLB 2LUMA 4TQ0A 3LB8C 2MEKA 1L4DB 1QOFA 4DXGA 4YTNB 1T5XD 1YQ4B 1NEKB 3U7ZA 1M4VA 1FM0D 4B0EA 1JCKB 4ZOHC 3O13A 2G1EA 3W5UB 3P4QB 1D6EC 2G9HD 2CU3A 2BTEA 1DGJA 2B76B 3T3NA 4ZYSA 4A90A 3B9JA 3AN1A 4TQ1A 2KAJA 4L23A 2J4XA 2WDRB 1R7SA 2QSDA 3GP7A 2HTME 3AE3B 5EE3A 1FCCC 3TEXA 1AN8A 1L4ZB 1C4AA 4M0WA 2WXRA 3URYA 2FE8A 2I38A 2WXJA 1VRAB 2PW9A 4TMAB 2DBYA 2QIEB 1NENB 1C79A 2GB1A 4YTMB 3NVZA 2WP9B 2V0GA 4O1NA 1J7BA 1JWSD 1I4PA 4C56C 1PUTA 3T3OA 3WCQA 4JWUC 4HEA1 1HA5A 1HZ5A 1QOGA 1TJEA 1ZPSA 3ABVB 5G5HA 3MHZA 3IT6B 2QJLA 3VRBB 2FUG1 2JZPA 2D5GA 1FD6A 1N5XA 1V1PA 1VR9A 4YWGG 1PGXA 3AE5B 4MACA 4KKJA 2WU2B 3AEBB 5BYSA 1KLGD 2VZKD 1MHXA 2H89B 3Q8FA 3Q69A 5HFYA 1C77A 1ZUD2 1FEHA 1C4CA 3NVVA 2NMQA 1VZ7A 5AUIA 3AEEB 2KDMA 1UWXA 3FILA 1FFVA 1QOAA 1VDVA 1FRDA 1FXIA 2WXKA 2BS4B 1XCTL 1UNSA 1IBXA 5BMGA 1NYRA 4J3OD 2WXGA 4KGTA 1ET6A 4UDUC 2M0AA 1EM7A 2PMVA 2LEKA 3L4PA 1JRPA 3W1SA 2WXFA 1FO4A 1J7AA 2ONQA 5FR3A 1WRIA 2N0SB 3KLSX 3NS1A 2IJ0A 4XWWA 2Y3AA 3AE4B 3FAHA 1GB4A 2AQ3B 2PTLA 1SJHD 1QLBB 1SSNA 2M56B 2W3RA 3KWVA 4XE0A 1JWAD 1YNTE 4RGMA 5FKAC 2GRIA 4IKGA 1WXQA 4HKQA 1QOBA 1MPEA 1ZE3D 1GPXA 2V3NA 1L5PA 2WNMA 4JWSC 2Z8LA 4C80A 1YJJA 3AE2B 4NZLB 1WWTA 2CJNA 1NVID 3NRZA 3U4EG 1AYFA 3FC4A 4RNAA 2LHEA 5AUKA 4CQNA 5FK9C 1FMAD 3RFZB 1BMLC 1ENFA 3Q8CA 3ZYYX 1YJIA 1BXTA 1FNWA 3AE6B 3MC0B 3SR6A 5D3IB 2JX5A 2QEJC 3VRAB 4ZRPA 2WLBA 3E56A 3ETRA 4KGSA 1C9FA 1WSPA 3UI3A 2KACA 1HZ6A 3HVDA 1SE2A 4PT5A 4RCOA 5BYQA 1DYQA 1XLQA 2INPE 2Y5PA 1EU4A 2INNE 2W54A 3TEYA 3AEAB 1A70A 2OHFA 2W55A 4YTPB 1FNUA 4ZHOA 4YSXB 1TKEA 3DWGC 2J52A 3AECB 1D4BA 4RFBA 4OW0A 2K3UA 1WGKA 3GB1A 3Q8BA 2BB5A 4H2AA 3IAS1 4LTUA 2EELA 4IDIA 3B2GA 1ZXIA 1JQ4A 1D5ZC 3P63A 1QILA 3AE1B 4OZBA 4US9A 2YEPB 4A55A 1K53A 4RF1A 3P4RB 1FXAA 4US8A 2IGHA 1VJKA 2ON8A 2DLBA 1VLBA 3PO0A 1V1PB 2JWUA 2BYTA 3TEZA 2SEBD 2V3PA 1L0YB 1YN4A 4N58A 1TS3A 2WXIA 3AV8A 5D7GA 4XWTA 2J53A 2OEDA 4YSYB 4YT0B 1I4RA 2JXTA 4MT5A 1F2RI 1TYGB 2N7JA 2HDEA 2SAKA 1FCLA 2K0PA 4WAFA 1JALA 1V97A 1BUIC 1OFFA 3I57A 3ZGZA 1IBXB 2N9LA 3SFEB 4HRSA 3TSSA 1D5MC 1F0ZA 1CZPA 2AQ2B 2JQRB 2DYOA 2E6XA 3IAM1 1QF6A 2IDYA 2ICIA 2RDHA 4OHJA 4GLSC 3V05A 5T8IA 1F77A 1L6VA 1RYJA 2ZW0A 3AEDB 3NZ3A 3E9SA 3MP9A 3GS2A 2XN9C 4RH6A 4WIPA 4WQMA 4D2KA 2LFIA 3W5VB 1ZXHA 2L52A 1KF6B 2JU6X 1YN5A 2BS3B 2NTTA 3EGRA 5EE0A 1DOXA 1NI3A 2BW2A 1I4GA 1N61A 4HKZE 4Q2JA 1FFUA 4AS1A 3R8BA 1GB1A 2WDVB 3IXSA 3VR9B 1MVKA 3BZDB 3P1MA 2WU5B 4C7YA 1ZDVA 1HQRD 1CJEA 4C7ZA 3TUOA 1AWDA 3BYTB 2K5PA 4HROA 3V3XA 4RF0A 2ACZB 3U52E 1DOIA 4JPSA 1PDXA 1EWCA 4ITKA 3HRDD 1XLOA 3DWMA 2KMMA 3AE9B 1E10A 1CK1A 1TY0A 1C78A 3R2TA 1KLUD 3U2SC 1K50A 2BB6A 5EE9A 1UWMA 5H92C 1SE4A 2BT6A 5G5GA 2WXHA 3HVZA 5EE1A 2YEPF 1L0VB 2PIAA 2R61A 3EUB2 2N9KA 4YXDB 2KQ4X 3IT4B 1JWMD 2RDGA 1JWBD 5BMHA 1MHHE 3AEGB 2X38A 1TS2A 3W9CB 3C8YA 1I4HA 5HI1A 1SE3A 1N60A 3AE7B 1NYQA 1JWUD 1KH0A 1QQRA 2L32A 2KN4A 1V1OA 3CWIA 2LGIA 5TSSA 4R3DA 1MI0A 2JYTA 3P42A 2WDQB 2V4IB 4NAWB 2LMCA 4EE2A 3HUIA 1P7FA 1F2RC 2MH7A 2WXNA 1VZ6A 3B2FA 4DQOC 3NUHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5W A;  1SB3 C;  3NVV A;  3NVW A;  4N6E B;  5AUI A;  1T3Q A;  3AEE B;  2W3S A;  3AMZ A;  1FFV A;  1QOA A;  1RWS A;  1FRR A;  1TKG A;  1VDV A;  2PVG C;  1DOX A;  1FRD A;  1L6U A;  1FXI A;  1J7C A;  1QT9 A;  3AV8 A;  1SIJ A;  4N58 A;  3VR8 B;  1XO3 A;  2BS4 B;  1SF0 A;  2Y5C A;  4ZHP A;  4YSY B;  4YT0 B;  4N59 A;  4KX6 B;  1NYR A;  4US8 A;  5C2T B;  4JX1 C;  3NVY A;  2MJD A;  1TYG B;  1GAQ B;  1B9R A;  1PFD A;  2M19 A;  4FXC A;  2CJO A;  2LEK A;  1JAL A;  3AEF B;  1JRP A;  2WQY B;  3L4P A;  4A9A A;  4WWM A;  1V97 A;  1OFF A;  3AH7 A;  1J7A A;  1XLN A;  1FO4 A;  1DOY A;  3SFE B;  4HRS A;  1JW9 D;  1WRI A;  2N0S B;  3AE8 B;  1F0Z A;  3NS1 A;  1RM6 C;  1TKY A;  2AX5 A;  1N62 A;  1CZP A;  3RPF C;  2DWQ A;  1WYG A;  2JQR B;  3AE4 B;  3FAH A;  1ROE A;  1QF6 A;  1FIQ A;  1QLB B;  3AB5 A;  3P4P B;  2H88 B;  2M56 B;  2MJE A;  1KRH A;  2W3R A;  3LXF A;  1L6V A;  1RYJ A;  1JWA D;  3AED B;  1EWY C;  4WQM A;  1WXQ A;  3W5V B;  3LB8 C;  1QOB A;  1ZOY B;  2L52 A;  1QOF A;  1KF6 B;  2BS3 B;  2PVO D;  1L5P A;  1YQ4 B;  4JWS C;  1NEK B;  2L83 A;  2EKI A;  4YTN B;  1NI3 A;  5EE0 A;  4C80 A;  1N61 A;  1FFU A;  1OQR A;  1YJJ A;  3AE2 B;  2WDV B;  1FM0 D;  3VR9 B;  1WWT A;  4ZOH C;  2CJN A;  3P1M A;  2WU5 B;  1NVI D;  4C7Y A;  2G1E A;  3NRZ A;  1CJE A;  3W5U B;  3P4Q B;  4C7Z A;  1GPX A;  2CU3 A;  1AYF A;  1AWD A;  1I7H A;  1DGJ A;  2B76 B;  3FC4 A;  2K5P A;  2E3T A;  5C3J B;  3B9J A;  3AN1 A;  2KAJ A;  4HRO A;  5AUK A;  5H8Y E;  3SFD B;  2MJ3 A;  1FMA D;  2ACZ B;  2WDR B;  1DOI A;  5GXG B;  1R7S A;  4ZHO A;  1PDX A;  4ITK A;  3ZYY X;  1YJI A;  1XLO A;  2HTM E;  3AE6 B;  3AE3 B;  3DWM A;  3HRD D;  5EE3 A;  3SR6 A;  3P4S B;  4P6V F;  2JX5 A;  2KMM A;  3BII D;  3KWL A;  3VRA B;  3AE9 B;  1E10 A;  2Q5W D;  2WS3 B;  2WLB A;  3ETR A;  1ZP0 B;  5EE9 A;  2DBY A;  1UWM A;  5H92 C;  1E0Z A;  2BT6 A;  1NEN B;  2QIE B;  1RFK A;  3HVZ A;  5G5G A;  5EE1 A;  1L0V B;  1XLQ A;  2PIA A;  3EUB 2;  1E9M A;  4YXD B;  2W54 A;  1N63 A;  3AEA B;  1A70 A;  2K22 A;  4YTM B;  3NVZ A;  2WP9 B;  1JRO A;  2OHF A;  2W55 A;  2PKO A;  1J7B A;  1JWB D;  4YTP B;  5MPO A;  1PUT A;  2FBW B;  3AEG B;  4USA A;  3W9C B;  4YSX B;  1KFY B;  3AM9 A;  1TKE A;  4JWU C;  1YQ3 B;  2K9X A;  3WCQ A;  1N60 A;  1TJE A;  1NYQ A;  1QOG A;  3ABV B;  3AE7 B;  3DWG C;  5G5H A;  2BS2 B;  3AEC B;  3CWI A;  1E7P B;  2QJL A;  1WGK A;  3VRB B;  1V8C A;  1N5X A;  1OQQ A;  4LTU A;  3AE5 B;  3CIR B;  2WDQ B;  4IDI A;  1XLP A;  3HUI A;  2WU2 B;  3AEB B;  3B2G A;  1ZXI A;  2MH7 A;  4YSZ B;  1JQ4 A;  3P63 A;  2H89 B;  3AE1 B;  1E6E B;  4US9 A;  1ZUD 2;  1IUE A;  3B2F A;  3P4R B;  1FXA A;  3PO0 A;  1VJK A;  1VLB A; 
#chains in the Genus database with same CATH topology
 2KVZ A;  1SB3 C;  3EA6 A;  2NTS A;  4OVZ A;  2JXX A;  1RWS A;  1FRR A;  2IO0 B;  2XNA C;  2Y5C A;  4B9K A;  1Z5S B;  1GNU A;  4IUM B;  2WXL A;  4FUL A;  3ZJU A;  5BMI A;  2M19 A;  4FLH A;  1ET9 A;  3L17 A;  1ACC A;  1XLN A;  2IGG A;  4C4V A;  4WAA A;  2LGD A;  5KHO A;  4AQ7 A;  1WYG A;  3ZJT A;  2I2Y A;  4MEL A;  3PV1 A;  1LGR A;  3L54 A;  2L1A A;  1G6J A;  5AZF A;  5AZH A;  4BKS A;  2MSE D;  2LGY A;  2DZM A;  3KW5 B;  5GMV A;  2LJI A;  3BYY B;  3NHE B;  4FHK A;  3TJP A;  5C3J B;  3BK1 A;  3SFD B;  3JVZ X;  4GDK B;  2KWD A;  5GXG B;  5E6P A;  3RNA C;  3J9C A;  4P6V F;  3BK2 A;  3KWL A;  1Z2M A;  3VH4 B;  1YMH E;  2QC8 A;  1E0Z A;  3ZQ4 A;  1RFK A;  4II2 B;  3KQ4 A;  1ESF A;  5DPR A;  3H8H A;  3N3K B;  3NY5 A;  2FBW B;  1KFY B;  4E3C A;  2WXP A;  2KD0 A;  4IOI E;  3R3M A;  1E7P B;  3QX1 A;  4K7W A;  3CIR B;  5AEK B;  3ZRF A;  3ENE A;  4RM8 A;  2JUO A;  1KLV A;  1IUE A;  3ZVV A;  2L7R A;  4REZ A;  3UF8 A;  5CX3 A;  4NJC A;  3W2D A;  5D6J B;  3R2I A;  1J7C A;  2W82 A;  5IAA C;  1OGW A;  1T0Y A;  4N59 A;  4KX6 B;  4EZL A;  3WAL A;  1B9R A;  4FXC A;  2CJO A;  3AI5 A;  1QKZ A;  3PS6 A;  4WWM A;  3BWU D;  1I4X A;  1TKY A;  2KDB A;  2LRW A;  1SXT A;  2WDT B;  3N9Y C;  3AB5 A;  2H88 B;  4W9D A;  2ASQ A;  4GDL B;  4TQ0 A;  2KXJ A;  1T5X D;  1NEK B;  2DHZ A;  1FM0 D;  1KOT A;  4W9G A;  2KYW A;  4II3 B;  2B76 B;  2NPT A;  3QAR A;  3T3N A;  4A90 A;  3AN1 A;  4TQ1 A;  2HTH A;  4ZRJ A;  4MGI E;  4L23 A;  2WDR B;  1TT5 B;  3RT3 B;  1EO6 A;  3TEX A;  3RNB C;  1RFA A;  4YL8 A;  1L4Z B;  2N1W A;  2NR2 A;  3GZN I;  3ZW3 A;  4YTM B;  1X1M A;  4O1N A;  2AL3 A;  3VTV A;  2RPQ A;  3L10 B;  2BYE A;  4JWU C;  4HEA 1;  2BPS A;  1QOG A;  3NG0 A;  2O6V A;  3VRB B;  4NQK E;  2M4N A;  2FUG 1;  1V2Y A;  1V1P A;  3RMK C;  2A4Z A;  3AE5 B;  3H1U A;  4MAC A;  2LVO A;  4HWI B;  2VZK D;  4A20 A;  1MHX A;  2H89 B;  3K9O B;  1ZUD 2;  1FEH A;  2NMQ A;  2V9H A;  1VZ7 A;  1N6Z A;  3AEE B;  1UWX A;  3SDL C;  3O65 B;  4MSM B;  2D11 A;  1UBI A;  1FRD A;  2C9W B;  1UF0 A;  3L0W B;  5BMG A;  4IW0 A;  1NYR A;  1E8X A;  4J3O D;  1WXA A;  3DBL B;  4P7I A;  1VCB A;  2K25 A;  1Q0W B;  3Q14 C;  4XYC A;  2WXF A;  3ZLZ A;  2ONQ A;  1D3Z A;  2N0S B;  4WQO B;  3AUL A;  4G0N B;  3WAN A;  3NS1 A;  4NQL B;  4OVV A;  4I6N B;  2PE6 B;  4NJ6 A;  3WA0 A;  4HPL B;  2M56 B;  2FIF A;  1WXQ A;  3I63 C;  5LLI A;  1QOB A;  1MPE A;  4JWS C;  1WWT A;  3ZTD A;  4AWJ A;  1WGY A;  5JZE B;  3VDZ A;  4OVU A;  1T0Q C;  4DXA B;  3RFZ B;  1BML C;  3ZYY X;  1BXT A;  1F9J A;  3MC0 B;  5D2M B;  2JX5 A;  4C4V B;  1UEL A;  3UI3 A;  3HVD A;  4JLC A;  2MX2 A;  2INP E;  2INN E;  2W54 A;  1YJ1 A;  1A70 A;  3KUD B;  2W55 A;  4WJQ A;  1OQY A;  2ZNV C;  4ZHO A;  2NS5 A;  4PYU A;  3DWG C;  1D4B A;  3PRE A;  4OW0 A;  3GB1 A;  4XC2 A;  4H2A A;  4DBG A;  3NOB A;  3IAS 1;  3A9J B;  2LXC A;  4IDI A;  5TR5 A;  1LXD A;  3B2G A;  4K7U A;  2YEP B;  4A55 A;  4RF1 A;  5D94 A;  2ON8 A;  4GGQ A;  2BYT A;  3B0A A;  3TEZ A;  2JT4 B;  1YN4 A;  4KSK C;  1XT9 B;  1TS3 A;  3AV8 A;  4N58 A;  4B95 A;  5IN7 A;  3B08 A;  2KN5 A;  2OED A;  4YSY B;  1I4R A;  2JXT A;  2RD0 A;  4GN1 A;  4ASW C;  2BWE S;  2N7J A;  5DPW A;  4DHJ D;  3DHH C;  1GC7 A;  1H4R A;  2FCN A;  4NJ7 A;  3VTW A;  1JAL A;  2VH2 A;  3RNF C;  3I57 A;  1OFF A;  2KO3 A;  4MJS A;  4FA6 A;  3I5J C;  5LXI B;  1F0Z A;  4M01 A;  3CMM B;  4K81 A;  4FBJ B;  3IAM 1;  1QF6 A;  4OHJ A;  1EF5 A;  2ZW0 A;  3NZ3 A;  2DEN B;  3QWZ B;  2XN9 C;  5LXH A;  3B1L X;  1V80 A;  3JW0 X;  3RYT A;  2NBW B;  2L52 A;  2AL6 A;  4GDK A;  4Q2J A;  4HKZ E;  3R8B A;  3VR9 B;  3OAW A;  2NCN A;  2WU5 B;  1WJN A;  4C7Z A;  1AWD A;  2K5P A;  3V3X A;  2ACZ B;  2KJH B;  1EWC A;  2ZPY A;  4W9I A;  2KMM A;  3AE9 B;  1WMH A;  1CK1 A;  5CTR C;  1C78 A;  2PEA A;  1KLU D;  2UWQ A;  2NBV B;  3KVF B;  5H92 C;  3A4R A;  2N9K A;  2DZK A;  2JZ3 B;  1JWB D;  5BMH A;  3C8Y A;  5HI1 A;  2KC2 A;  4DDG D;  1JWU D;  2KT7 A;  3A33 B;  3CWI A;  3X0W A;  5JH5 C;  3MTN B;  2YLM A;  3PLU A;  4F1S A;  3SD5 A;  2NPT B;  3VH3 B;  3HUI A;  1P7F A;  3C19 A;  1VZ6 A;  4E74 A;  4IG7 B;  1WM3 A;  2MQJ A;  1T6B X;  1J8C A;  2XBB C;  2W3S A;  1FNV A;  1OTR B;  2EMT A;  2JVC A;  4WH4 A;  1WXS A;  3ML9 A;  3S2A A;  4KGR A;  3RCZ A;  2OOB B;  2BBC A;  3QC8 B;  1GAQ B;  3AXC A;  4NY0 A;  1IGC A;  3AEF B;  2O6V B;  3Q3J A;  3ONS A;  3MC8 A;  2DWQ A;  2QMT A;  2R2Q A;  2D3A A;  2IY1 B;  2L76 A;  2MJE A;  4M8M A;  3VUY A;  1EWY C;  1XXG A;  3Q8E A;  1ZOY B;  2L83 A;  3RNG C;  2LUE A;  4AJY B;  2OJR A;  4KKI A;  5G55 A;  1WM2 A;  4LK0 M;  2L05 A;  3DBH B;  1I7H A;  2KJR A;  2ZCB A;  1HEZ E;  2E3T A;  4JIO U;  1CQV A;  2GLS A;  3UIN B;  2BVC A;  4ARC A;  2CS4 A;  4LNI A;  1XF5 L;  4FJY A;  3TCA A;  1ZP0 B;  5IP4 D;  2KWU B;  3GE8 C;  5DCN A;  4ZRQ A;  4L2Y A;  4KDI C;  1WI0 A;  1EU3 A;  4MGY E;  2MWS B;  1ZDX A;  2QDF A;  2K22 A;  1AAR A;  5LNK 1;  4PYZ A;  2PKO A;  3MC9 A;  4EZJ A;  3Q8A A;  3PZ8 A;  1YQ3 B;  2K9X A;  4RGT A;  2UYZ B;  4I6L B;  4K3B A;  4W9C A;  2WYQ A;  4XDD A;  3KYC D;  1WFY A;  2KKC A;  1L7Y A;  3PLV A;  4PS7 A;  4YSZ B;  4MDK E;  1MG8 A;  1UGJ A;  1E6E B;  1LQB A;  4DK5 A;  1WE6 A;  1UZX B;  1N5W A;  5J2R A;  3DBR B;  1T3Q A;  3OJ4 B;  1TKG A;  4BBN C;  4ACF A;  1E8Z A;  1LO5 D;  3BVM A;  3V6C B;  1P98 A;  5BYR A;  3VXW A;  2LHD A;  2M0X A;  2C7H A;  4IM0 A;  2CR5 A;  4OZC A;  4MM3 B;  1ZKH A;  2PE9 A;  2JYE A;  1WXM A;  1STE A;  2AQ1 B;  3U8Z A;  3KUC B;  1C4P A;  4HK2 A;  2AWT A;  1L2N A;  1B1Z A;  4EEW A;  3APF A;  2CKH B;  1ROE A;  1T0S C;  4X57 B;  3SEB A;  2MW5 A;  2IO1 B;  3LXF A;  2FID A;  2DX5 B;  1L4D B;  4DXG A;  4YTN B;  1YQ4 B;  3U7Z A;  1M4V A;  2O2V A;  4B0E A;  1JCK B;  4ZOH C;  1RLF A;  2G1E A;  3W5U B;  3L16 A;  3P4Q B;  1D6E C;  3M95 A;  2CU3 A;  2ZVO A;  4NAW A;  2KAJ A;  5IA7 A;  4URK A;  3KYD D;  3N30 A;  2N4F A;  2MBB B;  2QSD A;  1FCC C;  1GC6 A;  1WJU A;  1TIF A;  4MJS B;  1VD2 A;  1C4A A;  2FE8 A;  2INC C;  2WX1 A;  4TMA B;  3U30 A;  2QIE B;  1NEN B;  2CHZ A;  1FPY A;  2I1K A;  2WP9 B;  3A9J A;  1JWS D;  1I4P A;  1JRU A;  3NS8 A;  1QZE A;  1TJE A;  3QK0 A;  5G5H A;  3MHZ A;  1VR9 A;  1PGX A;  3M62 B;  4KVG B;  4KZC A;  3N1Y C;  3Q8F A;  1KJT A;  1C77 A;  5HFY A;  4W9L A;  1WJ6 A;  2LVP A;  1WMH B;  3FIL A;  1QOA A;  1VDV A;  3VUX A;  1WZ0 A;  3IVF A;  4BFR A;  3RUL A;  2ZCC A;  3HK0 A;  3RD2 A;  1UNS A;  2DYB A;  2MRP A;  3DHI C;  3MHS D;  3ML8 A;  3PRP B;  1ET6 A;  4UDU C;  3H6N A;  1EM7 A;  2HE7 A;  2PMV A;  2JPH A;  1J7A A;  4XWW A;  1SIF A;  4BAX A;  3AE4 B;  3FAH A;  3PSE B;  3PRM B;  3VTU A;  2W3R A;  3KWV A;  1JWA D;  2LGX A;  1L5P A;  3ZDT A;  3R7R A;  1TTN A;  2HD5 B;  1ISN A;  3M3J A;  3U4E G;  3DVG Y;  4RNA A;  1NDD A;  2RDB C;  2FUH B;  2LHE A;  3H7S A;  5AUK A;  4CQN A;  3GZN B;  3A4S C;  3Q8C A;  1YJI A;  3N32 A;  3AE6 B;  3VRA B;  4ZRP A;  3UGB B;  1E8W A;  3ZNZ B;  1C9F A;  1WSP A;  2KAC A;  3QCA A;  4RCO A;  5BYQ A;  2Y5P A;  4J6I A;  4HCN B;  1E5W A;  2OHF A;  1V86 A;  5DPS A;  3DBS A;  1E7V A;  3ZNH B;  1WYW B;  3ZO5 B;  1TKE A;  2FAZ A;  3Q3N C;  4JL9 A;  3DHG C;  3PGE A;  1OEY J;  4LTU A;  2ZNV B;  1E8Y A;  4LDT D;  3P63 A;  5EDS A;  3P4R B;  4US8 A;  1VLB A;  2V3P A;  2BF8 B;  4EUT A;  5D7G A;  3CST A;  2KDE B;  4XWT A;  1F2R I;  2RGF A;  2N9P C;  2XK5 A;  5JHA A;  2V3S A;  4KSL C;  5AZG A;  4ANV A;  3VUW A;  3SFE B;  3TSS A;  1D5M C;  3DVN U;  3W1Y A;  2JQR B;  1S3S G;  1GJZ A;  3OLM D;  2WGS A;  3V05 A;  3EFU A;  2KK8 A;  3AED B;  3MP9 A;  3GS2 A;  1WGH A;  1KF6 B;  1V5T A;  3EGR A;  5EE0 A;  5FR6 A;  2G4S A;  4K7S A;  1GB1 A;  1MVK A;  3BZD B;  3NJT A;  1CJE A;  2IO3 B;  3ZXR A;  4S17 A;  2LAS A;  4G11 A;  5E6O A;  4KIK B;  2KQS A;  3U52 E;  2IBI B;  1PDX A;  4ITK A;  3HRD D;  4LJP B;  3AU4 A;  2GBN A;  4TUU A;  2KWV B;  2CHW A;  3SU8 X;  5EE9 A;  1UWM A;  2WXH A;  1L0V B;  2IYD B;  1JWM D;  4IC7 B;  4F8C B;  3PPA A;  4DDI D;  2X38 A;  1TS2 A;  5C1Z A;  1I4H A;  3AE7 B;  1NYQ A;  1KH0 A;  1QQR A;  1P0R A;  4PK1 A;  2KN4 A;  1V1O A;  2O2V B;  4W9K A;  1E7U A;  3RNE C;  3BIN A;  1GUA B;  1MI0 A;  2JYT A;  3JSV A;  4HJK A;  1WH3 A;  2V4I B;  4NAW B;  2KTR A;  2LMC A;  2KQ7 A;  1F2R C;  3ZKJ C;  2WXN A;  4ZYN A;  2K1F A;  2DAJ A;  3NUH B;  2RMM A;  1LFD A;  4MM3 A;  4NAM A;  2FCS A;  3QA8 A;  4L1B A;  1V6E A;  4BZA A;  1QT9 A;  5L83 A;  3QAQ A;  4KV2 A;  3IBE A;  4DHJ B;  3PT2 B;  1JML A;  4JE3 B;  3ALB A;  2JRI B;  4TKN A;  1F52 A;  1V81 A;  2IPK D;  4TSS A;  4RGO S;  3AH7 A;  2AYO B;  1TS5 A;  4ARI A;  4ANU A;  4BOZ B;  4CYE A;  2K6Q A;  4DXF A;  1KTK A;  5D3D A;  2A5U A;  4N9F 4;  2IY0 B;  3TEW A;  2WXM A;  1SJE D;  1K52 A;  4A8X C;  2ZEQ A;  5KHQ A;  2KFK A;  2Z59 B;  4XGA B;  1PQS A;  3FIL B;  1OQR A;  1OEY A;  4P16 A;  3LDZ E;  3BVG A;  3H9D A;  3FKY A;  2J42 A;  5H8Y E;  5IKC M;  4XDC A;  4MGZ E;  1MG4 A;  1RAX A;  4BKS D;  4PS8 A;  5HG2 A;  3BII D;  1WRD B;  2Q5W D;  1K51 A;  2K8H A;  2NBU A;  2YVC A;  4NNJ B;  3VQI A;  3Q3F A;  1P7E A;  3U7D A;  1IYF A;  3L08 A;  2REX A;  1E9M A;  1WGG A;  1N63 A;  1XEE A;  4B6W A;  2DZI A;  2WXO A;  2KX0 A;  2QCZ A;  4TV3 A;  2K6D B;  4A6Q A;  4BVU C;  2FNJ B;  3AM9 A;  4ZRK A;  1HXY D;  4BKT A;  3RN9 C;  1WE7 A;  1OQQ A;  3TL5 A;  3OWE B;  1PYW D;  2HJ1 A;  1I42 A;  3IFW B;  3ZDM C;  3I9V 1;  3ZJV A;  5E6J A;  1WIA A;  2EKE C;  3AMZ A;  1EF1 A;  2QIL A;  3NZS A;  2GI9 A;  3VR8 B;  1SE9 A;  4IM2 A;  5HHD G;  1UGM A;  2MP2 A;  4ZHP A;  2IGD A;  5C2T B;  3NVY A;  4FAD A;  2MA9 B;  4HLE A;  1PFD A;  1TZO A;  3TMP B;  2W9N A;  1GOZ A;  4NPN A;  2WHI A;  3Q6B A;  1RM6 C;  2AX5 A;  1N62 A;  1NI2 A;  2XEW A;  4F7Z A;  1FIQ A;  5I4D A;  3D32 A;  1LM8 B;  2JY6 A;  1KRH A;  2G45 B;  1D5X C;  2KX3 A;  3V6E B;  4EZK A;  2LUM A;  3LB8 C;  2MEK A;  3WAM A;  2N1V A;  4DHZ B;  3O13 A;  4LNF A;  2BTE A;  1DGJ A;  4ZYS A;  3K9P B;  3B9J A;  2XK5 B;  2J4X A;  2K39 A;  3GP7 A;  1AN8 A;  1YIW A;  1P9D U;  3UIO B;  2WXR A;  3EFC A;  1VRA B;  2DBY A;  1C79 A;  2GB1 A;  2MHJ A;  4S0R A;  3RNC C;  3NVZ A;  2KLG A;  1C3T A;  2V0G A;  1J7B A;  4C56 C;  1PUT A;  3T3O A;  4ZRI A;  1HZ5 A;  3ABV B;  1ZPS A;  3EEC A;  3IT6 B;  4P1B C;  2JZP A;  1FD6 A;  1N5X A;  1Q1O A;  4RM9 A;  1R4M I;  2ZJD A;  4I6P A;  3T8M A;  1TGZ B;  1HE8 A;  4G50 A;  3NVV A;  3Q2A C;  4K1R B;  1FXI A;  1GG3 A;  2C7M B;  1J19 A;  2WXG A;  4KGT A;  2ZZP B;  3PTF C;  4LJO B;  2M0A A;  3LJ3 A;  2KOX A;  3L4P A;  2LEK A;  2L3Z A;  1JRP A;  1WY8 A;  2L0F A;  1FO4 A;  2MCN B;  3CSF A;  4LNK A;  3KLS X;  2LRU A;  2LJ5 A;  2IJ0 A;  3JSV B;  1GB4 A;  2KTR B;  1WGD A;  3APC A;  1SSN A;  4XE0 A;  3DBH I;  2GBM A;  4RGM A;  2GRI A;  4IKG A;  1XD3 B;  4HKQ A;  3M63 B;  1ZE3 D;  3APD A;  2WNM A;  1XQQ A;  2Z8L A;  4KIK A;  4C80 A;  1YJJ A;  3VAW A;  4HCP B;  3WAP A;  1NVI D;  5J17 A;  5G2N A;  3FC4 A;  4CHK A;  3T9L A;  1T0R C;  2L8J A;  1WJ4 A;  1FMA D;  3PHX B;  4HDQ A;  1FNW A;  3SR6 A;  5D3I B;  2QEJ C;  2BYV E;  2OJW A;  3E56 A;  3ETR A;  1M94 A;  1HZ6 A;  3P2B A;  4BKG A;  1EU4 A;  3VFK A;  1R4N I;  2V1Y A;  4MSQ B;  4M0W B;  4PS3 A;  2KFK B;  2J52 A;  3RZF A;  4RFB A;  3V61 A;  2VRR B;  2BB5 A;  4ANW A;  3DBR I;  3DVG X;  3ECI A;  5BO4 B;  2EEL A;  1KM7 A;  2KDF B;  1ZXI A;  1JQ4 A;  1D5Z C;  1QIL A;  1YD8 U;  4OZB A;  2KTF A;  1FXT B;  1FXA A;  2IGH A;  1VJK A;  1CMX B;  3L13 A;  2WX0 A;  4ZDV A;  2SEB D;  1V5O A;  2GBR A;  2MBO A;  3A1Q A;  2D3G A;  4WJP A;  4YT0 B;  4MT5 A;  2G3Q B;  2HDE A;  4GB9 A;  4BBN F;  5HKH A;  4HPM B;  3HM6 X;  2SAK A;  1U4A A;  1IBX B;  1BUI C;  5CHF A;  4HRS A;  2BKF A;  1CZP A;  1P3Q U;  2KFJ A;  2ICI A;  2RDH A;  5E6N A;  2M1M A;  4IWO A;  1F77 A;  1Y8R C;  1RYJ A;  4RH6 A;  1J0G A;  4WQM A;  4D2K A;  2NTT A;  2JU6 X;  1YN5 A;  4LCD E;  1NI3 A;  2BW2 A;  4AS1 A;  1FFU A;  4LNN A;  3PHW B;  2WDV B;  3IXS A;  2IND C;  3UIP B;  4C7Y A;  3WAO A;  3TUO A;  2MP2 B;  2GMI C;  3BY4 B;  3MJW A;  1IP9 A;  2KLC A;  4FJZ A;  2Z0E B;  1MJD A;  1XLO A;  2CU1 A;  2MBH A;  3R2T A;  5J18 A;  3U2S C;  3N20 C;  1SE4 A;  2BT6 A;  5C23 A;  3HVZ A;  2PIA A;  2D07 B;  4C00 A;  3EUB 2;  4EFO A;  2KC1 A;  3IT4 B;  2RDG A;  1MHH E;  2KNB A;  2LGI A;  3ZTC A;  4R3D A;  4M02 A;  4LDT B;  3P42 A;  4EE2 A;  4MEM A;  1WX8 A;  2FCM A;  2MH7 A;  1IPG A;  4MH0 E;  3B2F A;  2R2O A;  4HDO A;  3ZXV A;  2J0K A;  3NVW A;  4N6E B;  2WWZ A;  4MH8 A;  2PLP A;  4JQW C;  2GOW A;  1SIJ A;  1SF0 A;  4LNO A;  5JHB A;  2N7E A;  1AW7 A;  2VZK B;  4K3C A;  1F1H A;  2GBK A;  3DPD A;  1TZ1 A;  4KDL B;  4AP4 C;  1H8C A;  2KMC A;  3H7P A;  2WXQ A;  3N1X C;  1SEB D;  1I4Q A;  1DOY A;  1JW9 D;  3AE8 B;  1Q10 A;  5JXV A;  4LLG M;  4WUR A;  1E90 A;  1Y56 A;  3P4P B;  2ZW1 A;  2PVO D;  4RGN A;  2EKI A;  1YX5 B;  4A3O A;  4HPP A;  2DZJ A;  2DYM A;  3DQV A;  3GOE A;  3LYY A;  3PVL A;  4HXD A;  2LD9 A;  3W1S C;  1ZGU B;  2MJ3 A;  4B0M A;  4W9H A;  1SGH A;  4WWN A;  4HJG E;  2JRH A;  3QHT A;  3P4S B;  2J0J A;  1RRB A;  1BT0 A;  2WS3 B;  1UUP A;  1VZ8 A;  2ZPN A;  1YN3 A;  1UBQ A;  3A9K A;  2J7Q B;  1TY2 A;  2KVR A;  5IO9 A;  4GOC A;  2KWC A;  2MBQ A;  3IHP C;  3JYU A;  1JRO A;  2KHW B;  2PPH A;  5MPO A;  2Y5B B;  4USA A;  2JWZ A;  2LZ6 A;  4OZA A;  3BVZ A;  2BS2 B;  1SBB B;  4BOS C;  1V8C A;  1XLP A;  4GMV A;  2L00 B;  2Z0D B;  3ZIM A;  2JSV X;  2KAN A;  3PZ7 A;  2BGF A;  3QIJ A;  1TS4 A;  2PVG C;  3R66 C;  3HHM A;  1L6U A;  4M8N A;  4CO7 A;  1XO3 A;  3MJ5 A;  1L0X B;  4M00 A;  2CHX A;  2K8C A;  4W9J A;  1PGB A;  3RZW C;  4JX1 C;  3ZUN A;  2MJD A;  4HVB A;  1UH6 A;  2TSS A;  3ZNI D;  2LWP A;  1C76 A;  2DNF A;  2G4D B;  2WQY B;  4A9A A;  1XCQ L;  2M8S A;  1IGD A;  3RPF C;  2B3A A;  3DBL I;  4EOY A;  3MFG A;  2RPV A;  1PGA A;  2BWF A;  1QOF A;  3HM3 A;  1WX9 A;  2X8X X;  3DOW A;  1EUV B;  3A1Q B;  2G9H D;  2M17 A;  1R7S A;  2KDI A;  3KH0 A;  2HTM E;  3AE3 B;  5EE3 A;  3PZD A;  2KJ6 A;  2JZZ A;  4WJO A;  3AU5 A;  4M0W A;  3URY A;  3PRZ A;  2RSU A;  2I38 A;  2WXJ A;  2PW9 A;  3R7Q A;  2L0T A;  3DDC B;  2IO2 B;  2HJ8 A;  4P1C C;  4AOF A;  2FCQ A;  5CHV C;  3RI7 C;  2I1J A;  4A3P A;  3UQA A;  4FHJ A;  4WJN A;  2LI5 A;  3WCQ A;  2BKR B;  1HA5 A;  1MFW A;  4WWP A;  2QJL A;  4FN2 A;  1UD7 A;  2D5G A;  4YWG G;  4DWF A;  1P1A A;  4KKJ A;  2WU2 B;  3AEB B;  5BYS A;  3RUI B;  1KLG D;  3Q69 A;  1WX7 A;  2GBJ A;  1C4C A;  5AUI A;  2KDM A;  2K8B A;  2RR9 A;  1FFV A;  2LVQ A;  2WXK A;  1ZW7 A;  2BS4 B;  2N7D A;  1XCT L;  1IBX A;  1A5R A;  2QHO A;  1WXV A;  4GIV A;  2D3C A;  1HTO A;  4IWP A;  4GSW A;  3GE3 C;  2J0M A;  4DHZ E;  3W1S A;  2AEH A;  5FR3 A;  2N9E B;  1WRI A;  3EHV A;  3IG3 A;  2Y3A A;  2UU7 A;  3ZRC A;  2AQ3 B;  2PTL A;  1SJH D;  1K8R B;  1QLB B;  1WR1 A;  1YNT E;  5FKA C;  1GPX A;  1NBF C;  2V3N A;  2IZV B;  5IOI A;  4AJW A;  3AE2 B;  2BYF A;  4NZL B;  4XX5 A;  2CJN A;  3HIZ A;  3OG5 A;  3NRZ A;  1AYF A;  2C5L C;  3N1Z C;  3WIM A;  4G3X B;  3VVW B;  5FK9 C;  1ENF A;  4IM3 A;  3V60 A;  3SHQ A;  4RMA A;  3H7P B;  3C0R B;  2WLB A;  3UQB A;  4KGS A;  2N9X A;  1WZ3 A;  2LXA A;  3Q3M C;  5DPT A;  4FJV B;  1SE2 A;  1WGR A;  4PT5 A;  4W9F A;  3Q3O C;  1DYQ A;  1XLQ A;  4WWO A;  3TEY A;  3AEA B;  3EC8 A;  4YTP B;  4MGK E;  1FNU A;  4YSX B;  2D3B A;  1R4M B;  3AEC B;  4JGH B;  2ZVN A;  2K3U A;  1WGK A;  3Q8B A;  1YOV B;  4EKU A;  2KZR A;  3AE1 B;  4US9 A;  2KMA A;  1K53 A;  2D2Q A;  1TBE A;  4GDL A;  3OJ3 A;  3PO0 A;  2DLB A;  4ICV A;  1HTQ A;  1V1P B;  2JWU A;  3ZNG C;  4GXB A;  1L0Y B;  4AUQ C;  2WXI A;  3A9K B;  2JF5 A;  2J53 A;  4E71 A;  3NZU A;  2PJH A;  1TYG B;  1FCL A;  1S1Q B;  2K0P A;  4WAF A;  1V97 A;  2C7N B;  3ZGZ A;  2N9L A;  4KZ0 A;  1WR6 E;  4IWQ A;  2O6V D;  5CHW A;  2AQ2 B;  2DYO A;  2E6X A;  4ANX A;  2IDY A;  2DAF A;  2BQQ A;  4GLS C;  5T8I A;  3V62 A;  3DVN V;  1L6V A;  3E9S A;  4QAY A;  3X23 A;  4WIP A;  2LFI A;  4XZ4 A;  3W5V B;  4GU2 A;  1ZXH A;  2BS3 B;  4ICU A;  1DOX A;  1V49 A;  2C60 A;  1I4G A;  1N61 A;  3P1M A;  3VHT C;  1ZDV A;  1HQR D;  3TIX A;  2LGS A;  3BYT B;  3DCG A;  3TBL D;  4HRO A;  3CF6 E;  4RF0 A;  1DOI A;  1Q5W B;  3QQ8 B;  4JPS A;  1V9J A;  2NVU I;  3DWM A;  1R4N B;  1E10 A;  3KUZ A;  3QJZ A;  1TY0 A;  1K50 A;  2BB6 A;  1YX6 B;  5G5G A;  1I35 A;  3I3T B;  2VH1 A;  2D10 A;  2MBE A;  5EE1 A;  2YEP F;  2R61 A;  4YXD B;  2KQ4 X;  3AEG B;  2EMS A;  3W9C B;  1SE3 A;  1N60 A;  2L32 A;  5TSS A;  5L95 C;  2WDQ B;  1YQB A;  1WF9 A;  4W9E A;  2V4L A;  1C1Y B;  4DQO C;  2MLB A; 
#chains in the Genus database with same CATH homology
 1T6B X;  1SB3 C;  3EA6 A;  3NVW A;  2NTS A;  4N6E B;  2RMM A;  4OVZ A;  2W3S A;  1FNV A;  4MH8 A;  2PLP A;  4NAM A;  1RWS A;  1FRR A;  4L1B A;  4WH4 A;  1QT9 A;  1SIJ A;  2XNA C;  1SF0 A;  2Y5C A;  4KGR A;  1AW7 A;  1JML A;  4JE3 B;  2WXL A;  2BBC A;  2VZK B;  1GAQ B;  3ZJU A;  5BMI A;  2M19 A;  1IGC A;  2IPK D;  2WXQ A;  3AEF B;  1SEB D;  1ET9 A;  4TSS A;  1I4Q A;  1ACC A;  4RGO S;  3AH7 A;  1XLN A;  1TS5 A;  2IGG A;  4ARI A;  1DOY A;  1JW9 D;  3AE8 B;  2DWQ A;  2QMT A;  1Q10 A;  1WYG A;  4DXF A;  5JXV A;  4LLG M;  4AQ7 A;  3ZJT A;  4WUR A;  2I2Y A;  1KTK A;  5D3D A;  1Y56 A;  3P4P B;  2MJE A;  3TEW A;  1EWY C;  1XXG A;  2L1A A;  1SJE D;  2WXM A;  3Q8E A;  1K52 A;  2ZW1 A;  4A8X C;  1ZOY B;  2PVO D;  4RGN A;  2L83 A;  2EKI A;  3FIL B;  1OQR A;  2LJI A;  3BYY B;  4KKI A;  4LK0 M;  4P16 A;  2DYM A;  3BVG A;  3LYY A;  5C3J B;  1I7H A;  1HEZ E;  2E3T A;  2J42 A;  3BK1 A;  5H8Y E;  4XDC A;  3SFD B;  1CQV A;  2MJ3 A;  4GDK B;  2KWD A;  4B0M A;  4ARC A;  5GXG B;  1XF5 L;  4HJG E;  3P4S B;  3J9C A;  4P6V F;  5HG2 A;  3BK2 A;  3BII D;  3KWL A;  2Q5W D;  1K51 A;  2WS3 B;  1YMH E;  1UUP A;  1VZ8 A;  1ZP0 B;  3VQI A;  1YN3 A;  1E0Z A;  1P7E A;  3ZQ4 A;  4ZRQ A;  1RFK A;  4L2Y A;  1TY2 A;  1EU3 A;  1ZDX A;  1E9M A;  1N63 A;  1XEE A;  3KQ4 A;  1ESF A;  2K22 A;  5LNK 1;  2WXO A;  3H8H A;  1JRO A;  2PKO A;  3Q8A A;  5MPO A;  4A6Q A;  2FBW B;  3PZ8 A;  4USA A;  1KFY B;  3AM9 A;  1YQ3 B;  2K9X A;  4OZA A;  4RGT A;  3BVZ A;  2WXP A;  2BS2 B;  1HXY D;  1SBB B;  1E7P B;  4IOI E;  1V8C A;  4XDD A;  1OQQ A;  3CIR B;  1XLP A;  3OWE B;  4YSZ B;  1PYW D;  1UGJ A;  1E6E B;  1IUE A;  3I9V 1;  3ZJV A;  5E6J A;  2JSV X;  1N5W A;  4REZ A;  3PZ7 A;  1T3Q A;  1TS4 A;  3AMZ A;  4NJC A;  3W2D A;  1TKG A;  2PVG C;  2QIL A;  3R2I A;  2GI9 A;  1L6U A;  1J7C A;  2W82 A;  3VR8 B;  1XO3 A;  3MJ5 A;  1LO5 D;  1L0X B;  3BVM A;  5HHD G;  4ZHP A;  5BYR A;  4N59 A;  4KX6 B;  1PGB A;  2IGD A;  5C2T B;  2LHD A;  4JX1 C;  3NVY A;  2MJD A;  4OZC A;  4MM3 B;  2TSS A;  1B9R A;  1PFD A;  1TZO A;  1C76 A;  4FXC A;  2JYE A;  1GOZ A;  2CJO A;  1STE A;  2AQ1 B;  2WQY B;  4A9A A;  1QKZ A;  1C4P A;  4WWM A;  1XCQ L;  3BWU D;  1I4X A;  1IGD A;  1B1Z A;  1RM6 C;  1TKY A;  2AX5 A;  1N62 A;  3RPF C;  1ROE A;  1SXT A;  3MFG A;  1FIQ A;  2RPV A;  3N9Y C;  5I4D A;  3AB5 A;  3SEB A;  2H88 B;  1KRH A;  1D5X C;  3LXF A;  1PGA A;  4GDL B;  2LUM A;  4TQ0 A;  3LB8 C;  2MEK A;  1L4D B;  1QOF A;  4DXG A;  4YTN B;  1T5X D;  1YQ4 B;  1NEK B;  3U7Z A;  1M4V A;  1FM0 D;  4B0E A;  1JCK B;  4ZOH C;  3O13 A;  2G1E A;  3W5U B;  3P4Q B;  1D6E C;  2G9H D;  2CU3 A;  2BTE A;  1DGJ A;  2B76 B;  3T3N A;  4ZYS A;  4A90 A;  3B9J A;  3AN1 A;  4TQ1 A;  2KAJ A;  4L23 A;  2J4X A;  2WDR B;  1R7S A;  2QSD A;  3GP7 A;  2HTM E;  3AE3 B;  5EE3 A;  1FCC C;  3TEX A;  1AN8 A;  1L4Z B;  1C4A A;  4M0W A;  2WXR A;  3URY A;  2FE8 A;  2I38 A;  2WXJ A;  1VRA B;  2PW9 A;  4TMA B;  2DBY A;  2QIE B;  1NEN B;  1C79 A;  2GB1 A;  4YTM B;  3NVZ A;  2WP9 B;  2V0G A;  4O1N A;  1J7B A;  1JWS D;  1I4P A;  4C56 C;  1PUT A;  3T3O A;  3WCQ A;  4JWU C;  4HEA 1;  1HA5 A;  1HZ5 A;  1QOG A;  1TJE A;  1ZPS A;  3ABV B;  5G5H A;  3MHZ A;  3IT6 B;  2QJL A;  3VRB B;  2FUG 1;  2JZP A;  2D5G A;  1FD6 A;  1N5X A;  1V1P A;  1VR9 A;  4YWG G;  1PGX A;  3AE5 B;  4MAC A;  4KKJ A;  2WU2 B;  3AEB B;  5BYS A;  1KLG D;  2VZK D;  1MHX A;  2H89 B;  3Q8F A;  3Q69 A;  5HFY A;  1C77 A;  1ZUD 2;  1FEH A;  1C4C A;  3NVV A;  2NMQ A;  1VZ7 A;  5AUI A;  3AEE B;  2KDM A;  1UWX A;  3FIL A;  1FFV A;  1QOA A;  1VDV A;  1FRD A;  1FXI A;  2WXK A;  2BS4 B;  1XCT L;  1UNS A;  1IBX A;  5BMG A;  1NYR A;  4J3O D;  2WXG A;  4KGT A;  1ET6 A;  4UDU C;  2M0A A;  1EM7 A;  2PMV A;  2LEK A;  3L4P A;  1JRP A;  3W1S A;  2WXF A;  1FO4 A;  1J7A A;  2ONQ A;  5FR3 A;  1WRI A;  2N0S B;  3KLS X;  3NS1 A;  2IJ0 A;  4XWW A;  2Y3A A;  3AE4 B;  3FAH A;  1GB4 A;  2AQ3 B;  2PTL A;  1SJH D;  1QLB B;  1SSN A;  2M56 B;  2W3R A;  3KWV A;  4XE0 A;  1JWA D;  1YNT E;  4RGM A;  5FKA C;  2GRI A;  4IKG A;  1WXQ A;  4HKQ A;  1QOB A;  1MPE A;  1ZE3 D;  1GPX A;  2V3N A;  1L5P A;  2WNM A;  4JWS C;  2Z8L A;  4C80 A;  1YJJ A;  3AE2 B;  4NZL B;  1WWT A;  2CJN A;  1NVI D;  3NRZ A;  3U4E G;  1AYF A;  3FC4 A;  4RNA A;  2LHE A;  5AUK A;  4CQN A;  5FK9 C;  1FMA D;  3RFZ B;  1BML C;  1ENF A;  3Q8C A;  3ZYY X;  1YJI A;  1BXT A;  1FNW A;  3AE6 B;  3MC0 B;  3SR6 A;  5D3I B;  2JX5 A;  2QEJ C;  3VRA B;  4ZRP A;  2WLB A;  3E56 A;  3ETR A;  4KGS A;  1C9F A;  1WSP A;  3UI3 A;  2KAC A;  1HZ6 A;  3HVD A;  1SE2 A;  4PT5 A;  4RCO A;  5BYQ A;  1DYQ A;  1XLQ A;  2INP E;  2Y5P A;  1EU4 A;  2INN E;  2W54 A;  3TEY A;  3AEA B;  1A70 A;  2OHF A;  2W55 A;  4YTP B;  1FNU A;  4ZHO A;  4YSX B;  1TKE A;  3DWG C;  2J52 A;  3AEC B;  1D4B A;  4RFB A;  4OW0 A;  2K3U A;  1WGK A;  3GB1 A;  3Q8B A;  2BB5 A;  4H2A A;  3IAS 1;  4LTU A;  2EEL A;  4IDI A;  3B2G A;  1ZXI A;  1JQ4 A;  1D5Z C;  3P63 A;  1QIL A;  3AE1 B;  4OZB A;  4US9 A;  2YEP B;  4A55 A;  1K53 A;  4RF1 A;  3P4R B;  1FXA A;  4US8 A;  2IGH A;  1VJK A;  2ON8 A;  2DLB A;  1VLB A;  3PO0 A;  1V1P B;  2JWU A;  2BYT A;  3TEZ A;  2SEB D;  2V3P A;  1L0Y B;  1YN4 A;  4N58 A;  1TS3 A;  2WXI A;  3AV8 A;  5D7G A;  4XWT A;  2J53 A;  2OED A;  4YSY B;  4YT0 B;  1I4R A;  2JXT A;  4MT5 A;  1F2R I;  1TYG B;  2N7J A;  2HDE A;  2SAK A;  1FCL A;  2K0P A;  4WAF A;  1JAL A;  1V97 A;  1BUI C;  1OFF A;  3I57 A;  3ZGZ A;  1IBX B;  2N9L A;  3SFE B;  4HRS A;  3TSS A;  1D5M C;  1F0Z A;  1CZP A;  2AQ2 B;  2JQR B;  2DYO A;  2E6X A;  3IAM 1;  1QF6 A;  2IDY A;  2ICI A;  2RDH A;  4OHJ A;  4GLS C;  3V05 A;  5T8I A;  1F77 A;  1L6V A;  1RYJ A;  2ZW0 A;  3AED B;  3NZ3 A;  3E9S A;  3MP9 A;  3GS2 A;  2XN9 C;  4RH6 A;  4WIP A;  4WQM A;  4D2K A;  2LFI A;  3W5V B;  1ZXH A;  2L52 A;  1KF6 B;  2JU6 X;  1YN5 A;  2BS3 B;  2NTT A;  3EGR A;  5EE0 A;  1DOX A;  1NI3 A;  2BW2 A;  1I4G A;  1N61 A;  4HKZ E;  4Q2J A;  1FFU A;  4AS1 A;  3R8B A;  1GB1 A;  2WDV B;  3IXS A;  3VR9 B;  1MVK A;  3BZD B;  3P1M A;  2WU5 B;  4C7Y A;  1ZDV A;  1HQR D;  1CJE A;  4C7Z A;  3TUO A;  1AWD A;  3BYT B;  2K5P A;  4HRO A;  3V3X A;  4RF0 A;  2ACZ B;  3U52 E;  1DOI A;  4JPS A;  1PDX A;  1EWC A;  4ITK A;  3HRD D;  1XLO A;  3DWM A;  2KMM A;  3AE9 B;  1E10 A;  1CK1 A;  1TY0 A;  1C78 A;  3R2T A;  1KLU D;  3U2S C;  1K50 A;  2BB6 A;  5EE9 A;  1UWM A;  5H92 C;  1SE4 A;  2BT6 A;  5G5G A;  2WXH A;  3HVZ A;  5EE1 A;  2YEP F;  1L0V B;  2PIA A;  2R61 A;  3EUB 2;  2N9K A;  4YXD B;  2KQ4 X;  3IT4 B;  1JWM D;  2RDG A;  1JWB D;  5BMH A;  1MHH E;  3AEG B;  2X38 A;  1TS2 A;  3W9C B;  3C8Y A;  1I4H A;  5HI1 A;  1SE3 A;  1N60 A;  3AE7 B;  1NYQ A;  1JWU D;  1KH0 A;  1QQR A;  2L32 A;  2KN4 A;  1V1O A;  3CWI A;  2LGI A;  5TSS A;  4R3D A;  1MI0 A;  2JYT A;  3P42 A;  2WDQ B;  2V4I B;  4NAW B;  2LMC A;  4EE2 A;  3HUI A;  1P7F A;  1F2R C;  2MH7 A;  2WXN A;  1VZ6 A;  3B2F A;  4DQO C;  3NUH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...