1QOGA

Ferredoxin mutation s47a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qogA00
2DBYA 3LB8C 2CJNA 1NYRA 1ZP0B 5MPOA 2B76B 4YTPB 1JQ4A 4US9A 1SIJA 1V97A 3NVZA 2ACZB 1JRPA 1N62A 3AE9B 1WGKA 5EE9A 1ZUD2 1R7SA 1RM6C 2WS3B 2WU5B 3AE7B 3VRAB 3VR9B 1E7PB 4YSXB 1TKEA 2WDRB 4ITKA 3RPFC 5G5HA 3ZYYX 1ZXIA 3WCQA 1RFKA 1XLNA 2HTME 3DWGC 2WU2B 1TKGA 3VRBB 2FBWB 4IDIA 3P4RB 5AUKA 1OQRA 2L52A 1QOFA 3FAHA 1N61A 2KMMA 4KX6B 2JQRB 1WYGA 1KFYB 1N63A 1WXQA 2PIAA 3DWMA 4HROA 1TYGB 3W5VB 1DOXA 2L83A 1PDXA 1L6UA 3SFDB 2LEKA 2MJDA 3AE6B 1GAQB 3AE8B 3AEDB 5GXGB 5H8YE 3SFEB 2BS3B 3W9CB 2W3RA 5AUIA 1V8CA 1NYQA 1E6EB 2H88B 3AEAB 4P6VF 2W3SA 1B9RA 2K5PA 2QIEB 1XLOA 3ABVB 3CWIA 3P4QB 4JWUC 3LXFA 3AH7A 3VR8B 3P1MA 1CZPA 4JWSC 1YQ3B 2E3TA 1ZOYB 3EUB2 4FXCA 3AEGB 4ZOHC 1FXIA 1WRIA 2KAJA 1OFFA 2K9XA 2BT6A 1N60A 4WQMA 5C2TB 1JWAD 2Y5CA 4ZHPA 1L5PA 2Q5WD 2CU3A 1FIQA 2BS4B 2WQYB 1JWBD 3AE5B 1E10A 3L4PA 2MH7A 1YJJA 1QF6A 1FRRA 1SF0A 2PVOD 3B2FA 1QOBA 2M56B 3AE4B 1JW9D 2G1EA 3SR6A 5H92C 1PFDA 2WDVB 4YTMB 1QOGA 3AECB 3AMZA 4A9AA 1L6VA 1ROEA 1AYFA 1J7BA 1FXAA 1JROA 2W55A 3AE1B 3ETRA 1QT9A 2PKOA 1L0VB 1FM0D 1NVID 1WWTA 3HUIA 2K22A 4US8A 3AM9A 1DOYA 3P63A 3AB5A 3AEFB 1PUTA 3B9JA 1KF6B 3NVVA 4YT0B 3P4PB 3NVYA 1J7AA 2WP9B 5G5GA 1DOIA 1QLBB 1UWMA 1CJEA 4C7YA 3NRZA 1NENB 1VJKA 1YQ4B 5EE3A 3W5UB 4YXDB 5C3JB 3AEEB 1GPXA 4USAA 4YSZB 3AV8A 2H89B 5EE0A 3HVZA 2AX5A 3PO0A 1VDVA 1VLBA 1IUEA 1FO4A 1N5XA 4N6EB 1SB3C 2OHFA 1JALA 1DGJA 1N5WA 5EE1A 2CJOA 4HRSA 1A70A 1FFVA 1J7CA 1KRHA 1XLPA 2QJLA 3FC4A 1I7HA 4YSYB 4ZHOA 4JX1C 1YJIA 3KWLA 1FRDA 4LTUA 4YTNB 1TKYA 1EWYC 3NVWA 2WDQB 1TJEA 3AE2B 3AEBB 3B2GA 2PVGC 2W54A 4N59A 4WWMA 2MJ3A 3BIID 1E9MA 1AWDA 2MJEA 2DWQA 3P4SB 2M19A 3AN1A 3AE3B 3HRDD 3NS1A 1E0ZA 1FMAD 2N0SB 2JX5A 1XO3A 2BS2B 1RYJA 2EKIA 4C80A 1NI3A 4C7ZA 1NEKB 1FFUA 1RWSA 1QOAA 1XLQA 2WLBA 1F0ZA 4N58A 1OQQA 1T3QA 3CIRB
chains in the Genus database with same CATH superfamily
4YTPB 2BQQA 5C23A 3NVZA 3N32A 1N62A 1WXVA 4B0MA 2D3CA 5JXVA 3T3OA 1ZXIA 1AW7A 1WXSA 2IO2B 1TKGA 4RGMA 2ZNVB 3Q3MC 2M8SA 2J0JA 4G0NB 3VTUA 2PIAA 2WXRA 1CK1A 3ZRCA 3QX1A 2H88B 2KWVB 1B9RA 2FUHB 4XZ4A 4ZOHC 1WRIA 3ML9A 1OFFA 2BT6A 4MGYE 3QCAA 2WQYB 4L1BA 2KMCA 1WJUA 4BKGA 3OG5A 1LO5D 2I1KA 3HVDA 5EDSA 3UIOB 1WWTA 3K9OB 1WX8A 4WQOB 3O13A 5JH5C 5G5GA 5C3JB 2N9PC 2G4SA 4FHJA 1D5XC 1U4AA 1WZ3A 4HRSA 4JX1C 1FRDA 3RCZA 3U4EG 3TUOA 4OZAA 5CHVC 1WFYA 4EOYA 2L3ZA 3SDLC 3A4RA 1ET6A 1D3ZA 4RF1A 3DDCB 1EUVB 5D94A 1T3QA 3RNCC 1NYRA 4M01A 2NR2A 2BGFA 3DPDA 2D07B 2HDEA 1QQRA 3E9SA 4F1SA 1RFKA 1XLNA 2L05A 1FPYA 1UELA 2N9KA 2PJHA 2IDYA 1CQVA 2L52A 2ZZPB 3H6NA 4DHJB 1UNSA 1FEHA 4HPMB 4MGIE 3WAMA 1V8CA 1T0RC 3V60A 2L00B 3CWIA 1AARA 1WRDB 1E5WA 4LCDE 1C1YB 3GS2A 4RMAA 4PK1A 2KNBA 1SBBB 4NQKE 4ZHPA 3FILB 4FULA 3UQBA 3TEZA 4W9KA 3VUWA 4GIVA 1GUAB 2M4NA 4H2AA 3Q8EA 1NI2A 5H92C 3R8BA 3ONSA 4PYUA 3BINA 2DHZA 1IYFA 1SEBD 5BYRA 4GXBA 2LUEA 4UDUC 3ZDMC 2YLMA 1C9FA 2ICIA 1F77A 3AV8A 1HTOA 2K8BA 3PO0A 2KJRA 1VDVA 1FO4A 1N5XA 3M3JA 2LMCA 1UGJA 2BKFA 1I4XA 3VUXA 2W9NA 2PPHA 5CX3A 2M19A 4K7UA 4IUMB 1E0ZA 1XD3B 3L0WB 1XO3A 2V0GA 1UBIA 4KV2A 2KACA 4L23A 3AU5A 5BMGA 3RUIB 2LZ6A 4F7ZA 3U30A 1GC7A 3E56A 1RM6C 1VZ7A 2BWES 1YIWA 2QHOA 2LJIA 4WJQA 3FILA 4MH0E 4BZAA 5J2RA 5AUKA 3LJ3A 4D2KA 4FBJB 1D5ZC 5BMHA 2VZKD 4HWIB 2M0AA 1GNUA 1WMHB 2Y3AA 2L83A 3AE8B 2GBNA 3Q2AC 2W3SA 2MCNB 3H1UA 1TS4A 4M0WB 3A33B 2UWQA 3QA8A 2KJ6A 1CZPA 4GDKB 2KAJA 4P7IA 2K9XA 5HI1A 3Q3FA 2HJ1A 1L5PA 2JZPA 2CU3A 2KFKB 2MX2A 4NAWA 2MH7A 2MBHA 1TZOA 3EFCA 1FRRA 4HK2A 3ZW3A 2Y5PA 1WJNA 3CMMB 2KN4A 2J42A 2K0PA 4BAXA 4ANXA 4ACFA 2KWCA 4K3BA 3VFKA 2ZVOA 2WXPA 3OAWA 2LXAA 3AM9A 2L7RA 1WYWB 2V4LA 2H89B 4WJOA 1E7VA 1VZ6A 3I63C 3KWLA 3QQ8B 4KIKB 5IOIA 3PHXB 2WHIA 2GOWA 4ZYSA 3O65B 2N9XA 1Y56A 1WMHA 4C80A 1F0ZA 5I4DA 2KVRA 1Z2MA 1MFWA 2B76B 3NZUA 2V3PA 5IA7A 4GMVA 2M17A 3I57A 3ML8A 2AL6A 4GDKA 3PZDA 1F1HA 4MDKE 2HTME 3IT4B 2KDIA 4JIOU 2KFKA 1OTRB 1ZE3D 3MP9A 3D32A 2EMSA 1KLGD 2EELA 2WDTB 3ZKJC 1KFYB 1WXQA 2O6VB 5KHOA 3UF8A 2GLSA 1E90A 3VAWA 1UUPA 4W9JA 4G3XB 3R3MA 4TMAB 4URKA 1HA5A 1C79A 1EF1A 2KXJA 4WQMA 2Y5CA 3IBEA 2C7NB 3ZUNA 4TKNA 2AQ3B 1QOBA 3GOEA 1V2YA 4BFRA 1TS3A 4YL8A 2KX0A 2J53A 2KMAA 3WA0A 4KGTA 4IOIE 5G2NA 2N1VA 4K1RB 1K52A 4LNOA 1Y8RC 2WXQA 1L4DB 1Q0WB 1FCLA 1AN8A 2RDBC 4M00A 1C77A 5CHWA 4KSLC 3ZLZA 3R2TA 1WM2A 1I7HA 2NS5A 2NTTA 3Q8FA 3B2GA 3CSFA 2ASQA 2MJ3A 3A9JB 2MBQA 2DWQA 3VXWA 3LDZE 2NBWB 2BYVE 4MT5A 2N1WA 1YX5B 2C60A 3ENEA 3UQAA 1WM3A 4N58A 1RRBA 2D5GA 3PV1A 3W1SC 5C1ZA 4ITKA 2ZPYA 4KZCA 1MHXA 3BK1A 1IGDA 2D10A 3DOWA 1N61A 1N63A 3DWMA 3Q6BA 2CR5A 3DVNU 3MJ5A 4RF0A 5H8YE 1ZDXA 3N1XC 1JMLA 3RN9C 4NJCA 4A3OA 1I35A 4CQNA 3DBHB 3T8MA 3L16A 1LQBA 4IWOA 5C2TB 3L10B 3NG0A 1FIQA 1T0QC 2BYFA 2WX1A 2NCNA 2JSVX 4BVUC 4HKQA 2JXXA 3MJWA 3UIPB 4IG7B 1QILA 2MRPA 4FA6A 3A9JA 2ZW0A 2KTFA 2GBJA 4IM3A 3P4PB 3N30A 2LGDA 2KN5A 4RGOS 4YWGG 4C7YA 4ARIA 3KYDD 1VJKA 4CYEA 1I4RA 4YSZB 2G3QB 3H7PB 1IUEA 1SB3C 1WGGA 2PMVA 3KWVA 1KRHA 1V86A 2QJLA 3GE3C 3K9PB 4FJVB 4LLGM 1H8CA 1YJIA 1EWYC 3DHIC 4NJ6A 2PVGC 4BKTA 2BBCA 4HCNB 4GOCA 4NJ7A 2LRUA 2LVPA 3B1LX 3BK2A 4IWPA 4W9EA 1NDDA 2INDC 3U2SC 4LNNA 1V97A 3RNEC 1V1PB 4HDOA 1JWSD 3JYUA 2KQ4X 1WXAA 4GN1A 1S3SG 2A4ZA 1WF9A 2G4DB 4PS7A 2HJ8A 1SJHD 4WWNA 5BYSA 1VD2A 2XBBC 1TY0A 3RFZB 3PLVA 2BKRB 3SFEB 1GAQB 5GXGB 1OEYA 2QIEB 4W9LA 3LXFA 1YJ1A 4REZA 3IT6B 3VR8B 2YVCA 2V4IB 3NS8A 4KVGB 4LNFA 1ZOYB 3TBLD 1GC6A 1E8WA 2V1YA 2KDBA 3PREA 4TV3A 2IO0B 1PGXA 1UF0A 4K7WA 3PHWB 1FXAA 3DBHI 1T6BX 1HZ6A 1TTNA 1QT9A 4RGTA 1TS2A 4CHKA 3VVWB 2Z8LA 4OZBA 1S1QB 2AWTA 3NVYA 1LGRA 2R2OA 1NENB 3WAOA 3PZ7A 3GB1A 3HVZA 3JSVB 4W9IA 2DZIA 2V3SA 4WWOA 1GJZA 4EKUA 1V1PA 2FIDA 2R2QA 4TSSA 2RR9A 2KD0A 2K8CA 1E9MA 1AWDA 4DHZB 4ICUA 2JRHA 4IW0A 4KDIC 4DWFA 3Q69A 3N20C 1R4NB 3DHGC 2WYQA 4A6QA 1WH3A 2IY0B 2MQJA 2PLPA 3P2BA 3DQVA 1FFUA 2REXA 3EHVA 1VRAB 4DXGA 3C19A 3I9V1 4LJPB 5MPOA 2JZ3B 1I4PA 1P0RA 3H9DA 2RMMA 3QJZA 1PGAA 3WCQA 2WU2B 2ZEQA 2FBWB 2PE6B 3VTWA 3NOBA 2KMMA 1KH0A 2KYWA 2N4FA 1GB1A 2ZW1A 5G55A 3V6EB 4N9F4 3AEAB 4II2B 4KKJA 1OEYJ 3EUB2 4P1CC 2CHZA 2MWSB 3X0WA 1FXIA 1WIAA 2FAZA 3Q14C 3GP7A 2EKEC 3RT3B 4R3DA 1E10A 1YX6B 2DYBA 1YJJA 2L0TA 5HG2A 3JSVA 5T8IA 1SF0A 1K50A 2XNAC 1WJ6A 2I2YA 2SEBD 3EFUA 3N9YC 3KYCD 4B0EA 3M95A 1YOVB 2O2VB 1WR1A 2RPVA 1UWMA 2ZPNA 5GMVA 2B3AA 2NBUA 3C8YA 2LUMA 4JGHB 1I4HA 2LVQA 3T3NA 1P9DU 4S0RA 3AULA 2CJOA 1CMXB 2WXGA 3BVGA 2JY6A 3OWEB 2RGFA 3SHQA 4WJNA 1OQYA 3IXSA 2KC1A 3R7RA 1C4CA 2LWPA 2DZKA 1J19A 1LXDA 3DVGX 3J9CA 1SJED 3IVFA 1K51A 2LHDA 3R66C 3CIRB 2MEKA 3EC8A 4ZRJA 3L13A 4JQWC 4MACA 3AE7B 3VH3B 1R4NI 2LGYA 3APFA 2KO3A 1C76A 3VRBB 4ZRKA 3PRZA 2RD0A 2MLBA 2WX0A 2XEWA 2OOBB 3TSSA 1TYGB 3W5VB 3ZQ4A 2BS3B 4DQOC 4WIPA 4EUTA 4DBGA 2JXTA 2IGDA 1UBQA 1D5MC 4NNJB 1V5OA 4GSWA 2LHEA 2OEDA 1SE2A 1YNTE 4ZRQA 2MP2B 1QF6A 1V6EA 3TIXA 5CHFA 4HVBA 1TZ1A 4MGKE 4YTMB 1AYFA 3AE1B 2QEJC 4FJZA 3Q8CA 4C4VB 3R2IA 3HUIA 3JVZX 2NBVB 4W9HA 4MJSB 3X23A 3VQIA 1WI0A 4IM2A 2C7HA 1VLBA 4FJYA 1DGJA 1TY2A 3NZSA 4HKZE 1T0SC 2L32A 1E7UA 3OLMD 1SE3A 2JYEA 2NTSA 3PVLA 1HZ5A 5DPWA 5JHAA 4LDTB 1WGYA 4EFOA 2BW2A 2L1AA 2MJEA 1WJ4A 3BYYB 1JWUD 2N0SB 3U7ZA 3M63B 4BOSC 2K6DB 1WX7A 2JZZA 1RYJA 4HJGE 3W1SA 1UGMA 3NY5A 4C7ZA 3H7SA 2KZRA 4BKSA 4MSQB 1TT5B 3LB8C 1ZP0B 3N3KB 3PPAA 1KM7A 2KQSA 3AE9B 3ECIA 4ASWC 1QKZA 3ZYYX 2IO1B 2N9LA 4IDIA 3P4RB 1OQRA 5TSSA 5DPTA 4ANWA 1LFDA 1KLUD 4KX6B 1WYGA 4NY0A 3PS6A 3VUYA 3DCGA 2WXNA 2KKCA 2CU1A 1PQSA 4P6VF 2OJRA 4M0WA 3S2AA 5TR5A 2UYZB 3AH7A 3BZDB 3RULA 1MI0A 2KC2A 2E3TA 1P3QU 2DYOA 5JZEB 2ON8A 5E6PA 3APDA 4JE3B 3APCA 4TQ0A 1XF5L 1WR6E 3WALA 4DHJD 3SR6A 2WDVB 3AMZA 3ZDTA 3FKYA 4W9CA 3PGEA 3PRPB 2IY1B 4LJOB 1FM0D 4AJWA 4XWTA 4RFBA 4US8A 1TBEA 2Z0DB 4HEA1 2FCSA 1M94A 5FKAC 4IC7B 2KLGA 1WXMA 3NRZA 2AEHA 2RPQA 1EF5A 3PTFC 4MGZE 1F2RI 2FNJB 5D3DA 3L08A 5HFYA 2DZMA 3HM3A 1JALA 1BUIC 3NUHB 3QC8B 4IM0A 2J0KA 3MC0B 1P98A 1KTKA 3GZNB 4I6NB 4KIKA 3UGBB 4YTNB 2PEAA 2KTRB 3IAM1 3AE2B 3MHZA 4GGQA 2VH1A 4WWMA 2N7DA 3PSEB 2L76A 4HCPB 4KSKC 2Y5BB 2GBMA 3LYYA 1L0XB 4WH4A 2RSUA 5IAAC 4KZ0A 2WXJA 1UZXB 4DHZE 4KDLB 2G9HD 4K81A 1SIJA 4X57B 1WE6A 1R7SA 3RMKC 2WU5B 5D3IB 1IBXB 5G5HA 1FNUA 2SAKA 2JWUA 3GE8C 2BVCA 3IG3A 2V9HA 2JQRB 2O6VA 1VCBA 1G6JA 3N1ZC 2LEKA 3W9CB 4MM3B 4JLCA 1TGZB 3L54A 4BKSD 2W3RA 4BOZB 4DK5A 2K5PA 1XLOA 1E8YA 4OVUA 3P1MA 1RLFA 3RZWC 4FXCA 2WXHA 4EZKA 3ZVVA 4GLSC 2Q5WD 1ZDVA 2BS4B 4CO7A 3AE4B 1GB4A 1V81A 4DXFA 1ZW7A 4DDID 3A9KB 3NHEB 2KTRA 3ZJTA 3A4SC 2K22A 5AZGA 1F2RC 3V62A 3QIJA 3Q8BA 5BMIA 3NVVA 3IFWB 1WZ0A 4YT0B 5AZHA 4DDGD 5EE3A 2IJ0A 4M02A 2J7QB 2K8HA 2AX5A 1MHHE 2BWFA 3CF6E 2WXLA 1J7CA 1PGBA 4ZHOA 1IBXA 4LTUA 4KKIA 2AQ2B 2WDQB 1BMLC 1BT0A 4N59A 3QHTA 5LXHA 3HK0A 4XE0A 3P4SB 3TEWA 3MHSD 3NS1A 4M8MA 3ZTDA 4G11A 4K3CA 2BS2B 2KFJA 1NI3A 1F9JA 2CHWA 2WLBA 4E3CA 4MM3A 3GZNI 4NZLB 2DBYA 2KOXA 1MPEA 3Q3OC 2JWZA 3M62B 5HKHA 4HDQA 2ACZB 2K3UA 1WGKA 1TKEA 1HE8A 2KWDA 2N7JA 1X1MA 1QOFA 2LGXA 3FAHA 3HM6X 2XK5B 5AEKB 4HROA 4B9KA 3U7DA 4HJKA 3A9KA 1T5XD 3AE6B 1D6EC 2A5UA 1NYQA 1SE9A 2K6QA 1F52A 3BYTB 3EA6A 4OVZA 1SSNA 4AWJA 3RNFC 5FR6A 2C7MB 1N60A 1KJTA 5E6JA 3DBLB 2HTHA 1KOTA 3DBRB 3PLUA 2O6VD 2INPE 5J17A 3AECB 4JL9A 4HXDA 1BXTA 2ZJDA 1YMHE 1L0VB 3N1YC 5E6OA 3HHMA 3I5JC 2J52A 2NPTB 3B9JA 1J7AA 2WP9B 2YEPF 1YQ4B 3AI5A 1GPXA 5JHBA 3AEEB 3VDZA 3Q8AA 3ZTCA 2WXMA 4A90A 3H7PA 4WWPA 3EGRA 2X8XX 2IZVB 1YN5A 4RM9A 3NVWA 1P7EA 1FNWA 3RYTA 3QARA 2PW9A 4RNAA 4MH8A 3RD2A 1L2NA 5LLIA 3V6CB 2JX5A 2XK5A 4ANUA 2VZKB 1EO6A 1QOAA 3ZIMA 2N7EA 2QMTA 2JVCA 2AQ1B 3RI7C 4DXAB 2KVZA 5D6JB 1E7PB 1C4PA 2MSED 2BB6A 1SXTA 4MEMA 1OGWA 2BF8B 2FCMA 4ANVA 2QC8A 2Z0EB 2QCZA 3SFDB 2BB5A 4XC2A 2TSSA 3V05A 2J4XA 4WJPA 1WX9A 2JRIB 3B0AA 2NPTA 1B1ZA 2D3BA 3QWZB 2KANA 2WWZA 4P16A 1MG4A 3AE5B 3DHHC 3L4PA 4AJYB 1FXTB 3KW5B 4FLHA 4JPSA 2PVOD 3KUCB 1HTQA 2LFIA 2LXCA 4XDCA 1PFDA 1L6VA 1ROEA 2K25A 4W9FA 1UWXA 2MHJA 3I3TB 2DAJA 2GMIC 3AXCA 5IP4D 3P63A 3DBLI 3DBRI 1QLBB 1FNVA 2KWUB 2QILA 2WXOA 3C0RB 4M8NA 5DCNA 1L0YB 1ZGUB 1RFAA 3UINB 4A8XC 1C3TA 2GB1A 1N5WA 1FFVA 3MC9A 3FC4A 2XN9C 2WGSA 1TKYA 1ACCA 1TJEA 5D7GA 2DNFA 2VH2A 5KHQA 2IO3B 1UH6A 4MELA 1E8XA 1V9JA 3ZNGC 3AE3B 1ZPSA 4WAFA 4P1BC 4L2YA 1XLQA 3WANA 2CJNA 4GDLB 3TJPA 3BY4B 2LASA 2JF5A 1L4ZB 1JRPA 1IPGA 1LM8B 2WDRB 2JUOA 2ZVNA 1HEZE 3DWGC 2WXFA 4G50A 3CSTA 5IKCM 2JYTA 3BVMA 2LVOA 2IPKD 1XQQA 2EMTA 3VTVA 1Q1OA 4K7SA 1E6EB 3ZNID 3B08A 1HXYD 4C56C 3TEYA 3TCAA 1N6ZA 2C9WB 1MVKA 3VHTC 1WSPA 4QAYA 4A55A 1ZXHA 2KJHB 4NAWB 2FUG1 1SIFA 3RNAC 3TL5A 3V3XA 4F8CB 1MJDA 4ZDVA 1Q5WB 1C78A 1V49A 4RCOA 2JPHA 2W55A 2CS4A 1MG8A 2DENB 1YD8U 2W82A 4PT5A 1ET9A 3WAPA 3AEFB 2KK8A 2O2VA 1KF6B 1J0GA 1EM7A 1GG3A 1T0YA 3T9LA 4GDLA 3KH0A 2G45B 4N6EB 1L7YA 3SD5A 4AQ7A 2M1MA 2KLCA 4YSYB 1VZ8A 4ICVA 2OJWA 2CKHB 4C00A 3SU8X 5L83A 2ONQA 1IP9A 1JRUA 5AZFA 1VR9A 1P1AA 1FCCC 2ZNVC 2ZCBA 4HPLB 3ZO5B 3OJ4B 2QDFA 4FADA 1UD7A 2GI9A 1ZKHA 5EE9A 4RM8A 4YSXB 3VRAB 4LNIA 2D2QA 1NBFC 4EE2A 1C4AA 1P7FA 4I6LB 1V5TA 2KDFB 4B6WA 1JWMD 3Q3NC 4TUUA 2KQ7A 3TEXA 4WURA 3V61A 2BTEA 3KLSX 1L6UA 2MBOA 4RH6A 1I4QA 3AEDB 3U8ZA 3BWUD 2PTLA 2RDHA 3P4QB 1JCKB 2DX5B 2GRIA 5BYQA 4E74A 1YQ3B 3AEGB 4B95A 2WXIA 1JWAD 3AU4A 2INNE 4AUQC 1SGHA 2GBKA 2X38A 2MP2A 1TIFA 4PYZA 1XEEA 3KUDB 1K53A 2M56B 1JW9D 2G1EA 1QOGA 2DAFA 4A9AA 4WAAA 1WGHA 1JROA 3MFGA 3ETRA 2LJ5A 4C4VA 2INCC 4FHKA 1H4RA 1DOYA 3AB5A 4MJSA 1PYWD 2NMQA 4XYCA 1PUTA 2IGHA 3BVZA 1XCTL 1RAXA 3MTNB 4XGAB 1DOIA 2I38A 3W5UB 4YXDB 1EU4A 1K8RB 4OHJA 4USAA 2D11A 3ALBA 4AOFA 2KDMA 2RDGA 4EEWA 2D3AA 2WNMA 4MSMB 5EE1A 1YN4A 3NJTA 1ENFA 1WY8A 3KUZA 2WXKA 4E71A 4ARCA 3AEBB 2Z59B 5IN7A 1DYQA 3BIID 4OZCA 1KLVA 3HRDD 1M4VA 3PZ8A 1D4BA 3A1QB 3KVFB 1OQQA 2JT4B 2MBBB 3NZ3A 2LD9A 1ZUD2 1A5RA 4IKGA 4NAMA 2IGGA 4EZLA 4AS1A 4OVVA 1R4MB 3OJ3A 1HQRD 1PDXA 2MJDA 2C5LC 4II3B 3JW0X 2MW5A 4HPPA 2MA9B 4JWUC 3L17A 4W9DA 1V1OA 3H8HA 2BPSA 2HD5B 5L95C 4KGSA 1SE4A 2UU7A 1STEA 1Q10A 1FD6A 2BYTA 1I42A 3TMPB 3Q3JA 2K39A 2QSDA 1ISNA 2JU6X 2R61A 2K1FA 4BBNF 4IWQA 5LXIB 3PRMB 3UI3A 2E6XA 1QZEA 2D3GA 2IYDB 4NQLB 5DPRA 2M0XA 3HIZA 4ZRPA 3A1QA 2L0FA 2L8JA 1TS5A 2I1JA 3ZJUA 4J6IA 1XLPA 4NPNA 2ZCCA 3P42A 2YEPB 2KX3A 1J8CA 4LNKA 4FN2A 1FMAD 4HLEA 3U52E 1NEKB 4XWWA 1RWSA 1EU3A 4S17A 3QAQA 1JQ4A 2VRRB 4US9A 3W1YA 5LNK1 2CHXA 4I6PA 3SEBA 2WS3B 4OW0A 4GU2A 3VR9B 2LRWA 5DPSA 3RPFC 4RGNA 1XXGA 3VH4B 5E6NA 2KDEB 3IAS1 3MC8A 4LDTD 4XX5A 3ZJVA 1YN3A 4ZYNA 5FK9C 3ZXRA 3URYA 4W9GA 2FCQA 2PE9A 2LI5A 3RZFA 1DOXA 3ZXVA 3ZNZB 3EECA 2KHWB 1IGCA 5AUIA 1XCQL 3ABVB 2J0MA 2AYOB 2V3NA 2KT7A 1WE7A 2DYMA 2IBIB 4JWSC 3ZRFA 3KQ4A 1R4MI 2DZJA 4ZRIA 2N9EB 4A3PA 4AP4C 3RNBC 5CTRC 1JWBD 3QK0A 3ZGZA 2LGSA 4O1NA 3B2FA 2HE7A 4PS3A 2GBRA 1J7BA 2FIFA 2PKOA 1WGDA 1NVID 1ESFA 4BBNC 3DVNV 3IHPC 1E8ZA 3RNGC 1EWCA 4XDDA 3ZNHB 2FCNA 1GOZA 4EZJA 1CJEA 4GB9A 3PT2B 4PS8A 2BYEA 5D2MB 4J3OD 5EE0A 2FE8A 4TQ1A 1WGRA 2MBEA 2OHFA 5HHDG 1A70A 1I4GA 1Z5SB 2DLBA 5FR3A 4Q2JA 1YQBA 2AL3A 3DVGY 4A20A 1V80A 3DBSA 4KGRA 2W54A 5J18A 5BO4B 1XT9B 3AN1A 2LGIA 5IO9A 3WIMA 2NVUI 3R7QA 3W2DA 4LK0M 2EKIA
chains in the Genus database with same CATH topology
3LB8C 2CJNA 4GDLB 1ZP0B 4YTPB 2D5GA 1L4ZB 3NVZA 1JRPA 1N62A 3AE9B 4B0MA 2WDRB 5JXVA 4ITKA 1QKZA 3T3OA 3ZYYX 1HEZE 1ZXIA 1AW7A 1MHXA 3BK1A 1IGDA 3DWGC 1TKGA 2N9LA 2WXFA 4RGMA 4IDIA 3P4RB 1OQRA 5TSSA 1KLUD 4KX6B 1N61A 2JYTA 3BVMA 1WYGA 2PIAA 1N63A 2WXRA 3DWMA 2IPKD 1CK1A 3MJ5A 4RF0A 2WXNA 5H8YE 1ZDXA 2H88B 1E6EB 1JMLA 4P6VF 1B9RA 4M0WA 4NJCA 3BZDB 3AH7A 1HXYD 1MI0A 4CQNA 4C56C 2E3TA 4ZOHC 3TEYA 1WRIA 1OFFA 2DYOA 2BT6A 5C2TB 1MVKA 1WSPA 1FIQA 2WQYB 4L1BA 2ON8A 4A55A 1ZXHA 2JSVX 4NAWB 4JE3B 4TQ0A 2FUG1 1XF5L 4HKQA 3SR6A 3V3XA 1LO5D 2WDVB 1C78A 3AMZA 3HVDA 4RCOA 2W55A 1QILA 2W82A 4PT5A 1FM0D 1WWTA 4XWTA 2ZW0A 4RFBA 4US8A 1ET9A 4HEA1 3AEFB 3O13A 5FKAC 1KF6B 3P4PB 1EM7A 5G5GA 4RGOS 4YWGG 4C7YA 4ARIA 3NRZA 5C3JB 1VJKA 1I4RA 1F2RI 4YSZB 5D3DA 1D5XC 1IUEA 4N6EB 5HFYA 1SB3C 2PMVA 1JALA 1BUIC 3NUHB 4AQ7A 4HRSA 3KWVA 1KRHA 2QJLA 3MC0B 4LLGM 4YSYB 1KTKA 4JX1C 1YJIA 1FRDA 4YTNB 1EWYC 3U4EG 3TUOA 4OZAA 3IAM1 3MHZA 3AE2B 2PVGC 1VZ8A 4WWMA 2BBCA 2ONQA 1ET6A 3BK2A 3LYYA 4RF1A 1L0XB 4WH4A 1VR9A 2WXJA 1FCCC 1T3QA 3U2SC 1NYRA 2G9HD 1SIJA 1V97A 2GI9A 5EE9A 1R7SA 1V1PB 2WU5B 5D3IB 3VRAB 4YSXB 2HDEA 1IBXB 1QQRA 1JWSD 5G5HA 1FNUA 3E9SA 2KQ4X 1RFKA 1XLNA 2SAKA 4EE2A 2JWUA 1C4AA 1P7FA 2N9KA 2IDYA 1CQVA 2L52A 1JWMD 2JQRB 1UNSA 1FEHA 1SJHD 3TEXA 5BYSA 4WURA 1TY0A 3RFZB 2BTEA 3KLSX 1L6UA 2LEKA 4RH6A 1I4QA 1GAQB 3AEDB 4MM3B 5GXGB 3SFEB 3W9CB 2W3RA 1V8CA 2K5PA 2PTLA 2QIEB 1XLOA 3BWUD 3CWIA 2RDHA 3P4QB 3LXFA 4REZA 1JCKB 3IT6B 3P1MA 3VR8B 2V4IB 2GRIA 5BYQA 1YQ3B 3GS2A 1ZOYB 4FXCA 3AEGB 2WXHA 2WXIA 1SBBB 1JWAD 4GLSC 2INNE 4ZHPA 2Q5WD 1ZDVA 2BS4B 3FILB 2X38A 3TEZA 1XEEA 4H2AA 3Q8EA 1K53A 2M56B 3AE4B 1JW9D 1GB4A 2G1EA 4DXFA 5H92C 1PGXA 3R8BA 1QOGA 4A9AA 1FXAA 1JROA 3MFGA 3ETRA 1T6BX 1HZ6A 1SEBD 5BYRA 1QT9A 4RGTA 3ZJTA 1TS2A 4UDUC 2K22A 2Z8LA 4OZBA 1F2RC 1DOYA 3AB5A 3Q8BA 1PYWD 2NMQA 5BMIA 1PUTA 3NVVA 4YT0B 2IGHA 3BVZA 1XCTL 3NVYA 1C9FA 1DOIA 2I38A 2ICIA 1F77A 1EU4A 1NENB 5EE3A 3W5UB 2IJ0A 4OHJA 4YXDB 3PZ7A 4USAA 3AV8A 3GB1A 3HVZA 2AX5A 3PO0A 1VDVA 1MHHE 2KDMA 1FO4A 1N5XA 2RDGA 2WNMA 5EE1A 2LMCA 1YN4A 1UGJA 2WXLA 1J7CA 1PGBA 4ZHOA 1V1PA 1IBXA 1ENFA 1I4XA 4LTUA 2WXKA 4TSSA 4KKIA 2AQ2B 2WDQB 1BMLC 3AEBB 4ARCA 4N59A 1DYQA 4XE0A 3BIID 1E9MA 1AWDA 3P4SB 3TEWA 4OZCA 2M19A 3HRDD 3NS1A 3Q69A 1E0ZA 1XO3A 1M4VA 2V0GA 3PZ8A 2BS2B 4A6QA 2KACA 4L23A 1D4BA 1NI3A 2PLPA 1FFUA 5BMGA 2WLBA 1OQQA 4NZLB 2DBYA 1MPEA 1VRAB 3NZ3A 4DXGA 3I9V1 2ACZB 2K3UA 3E56A 1WGKA 5MPOA 1ZUD2 1RM6C 1VZ7A 4IKGA 1I4PA 1TKEA 4NAMA 2RMMA 2IGGA 1PGAA 3WCQA 2KWDA 2LJIA 2N7JA 4AS1A 2WU2B 3FILA 2FBWB 5AUKA 4D2KA 1QOFA 3FAHA 2KMMA 1D5ZC 1KH0A 4HROA 2VZKD 5BMHA 2M0AA 1GB1A 2ZW1A 1HQRD 2Y3AA 2L83A 1PDXA 1T5XD 2MJDA 3AE6B 3AE8B 1D6EC 3AEAB 1NYQA 4KKJA 2W3SA 1TS4A 4JWUC 3BYTB 3EA6A 4OVZA 1SSNA 1V1OA 1CZPA 3H8HA 3EUB2 1FXIA 4GDKB 2KAJA 4KGSA 2K9XA 3GP7A 5HI1A 1N60A 1SE4A 1L5PA 2JZPA 2CU3A 1STEA 4R3DA 5E6JA 1E10A 1Q10A 2MH7A 1YJJA 5HG2A 1TZOA 5T8IA 1FD6A 1FRRA 1SF0A 1K50A 2XNAC 2BYTA 2Y5PA 2INPE 2QSDA 2KN4A 2J42A 3AECB 2K0PA 2JU6X 2R61A 1BXTA 2I2YA 2SEBD 1YMHE 1L0VB 2WXPA 3UI3A 3N9YC 2E6XA 3AM9A 4B0EA 2J52A 3B9JA 2RPVA 1J7AA 2WP9B 1UWMA 2YEPF 1YQ4B 1GPXA 4ZRPA 3AEEB 3C8YA 3Q8AA 2WXMA 2LUMA 4A90A 2H89B 3EGRA 1YN5A 1I4HA 3T3NA 1VZ6A 1TS5A 3ZJUA 2CJOA 1XLPA 2WXGA 3BVGA 3KWLA 3P42A 3NVWA 3OWEB 1P7EA 2YEPB 1FNWA 3IXSA 4ZYSA 1C4CA 2PW9A 4RNAA 4MH8A 1FMAD 2JX5A 1Y56A 2VZKB 4C80A 3U52E 3J9CA 1SJED 1NEKB 4XWWA 1RWSA 1EU3A 1QOAA 1F0ZA 1K51A 2LHDA 3CIRB 5I4DA 2MEKA 2QMTA 2AQ1B 2B76B 1JQ4A 4US9A 5LNK1 2V3PA 3SEBA 4MACA 3AE7B 2WS3B 4OW0A 3I57A 3VR9B 1E7PB 1C4PA 3RPFC 2BB6A 1SXTA 4RGNA 1XXGA 2HTME 3IT4B 3IAS1 1ZE3D 1C76A 3MP9A 3VRBB 3ZJVA 1YN3A 1KLGD 5FK9C 2EELA 3URYA 1KFYB 1WXQA 3TSSA 1TYGB 3W5VB 1DOXA 3SFDB 2BB5A 3ZQ4A 1IGCA 2TSSA 2BS3B 3V05A 4DQOC 5AUIA 1XCQL 4WIPA 2J4XA 1UUPA 3ABVB 2V3NA 2JXTA 2IGDA 2DYMA 4TMAB 4JWSC 1D5MC 1B1ZA 1HA5A 3KQ4A 1C79A 2LHEA 4WQMA 4P16A 2Y5CA 3AE5B 2OEDA 1JWBD 1SE2A 3L4PA 1YNTE 4ZRQA 3ZGZA 2AQ3B 4JPSA 1QF6A 4O1NA 2PVOD 3B2FA 1QOBA 2LFIA 4XDCA 1PFDA 4YTMB 1L6VA 1ROEA 1TS3A 1AYFA 1J7BA 3AE1B 2QEJC 3Q8CA 2PKOA 1UWXA 1NVID 1ESFA 3R2IA 3HUIA 2J53A 3P63A 1EWCA 4KGTA 4IOIE 4XDDA 1GOZA 1QLBB 1K52A 1CJEA 1FNVA 2WXQA 3VQIA 1L4DB 2QILA 2WXOA 4J3OD 1FCLA 5EE0A 1AN8A 1L0YB 2FE8A 1C77A 1VLBA 4TQ1A 4A8XC 2OHFA 1DGJA 2GB1A 1N5WA 1TY2A 3R2TA 4HKZE 5HHDG 1A70A 1FFVA 1I4GA 3FC4A 1I7HA 2DLBA 2NTTA 2XN9C 2L32A 5FR3A 1TKYA 1SE3A 2JYEA 4Q2JA 2NTSA 1ACCA 1TJEA 3Q8FA 3B2GA 5D7GA 4KGRA 1HZ5A 2W54A 2MJ3A 2BW2A 2L1AA 2MJEA 2DWQA 3AN1A 3AE3B 1ZPSA 3BYYB 1JWUD 2LGIA 2N0SB 4WAFA 3U7ZA 4MT5A 3W2DA 4LK0M 1RYJA 2EKIA 4HJGE 3W1SA 4L2YA 4C7ZA 1XLQA 4N58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DBY A;  3LB8 C;  2CJN A;  1NYR A;  1ZP0 B;  5MPO A;  2B76 B;  4YTP B;  1JQ4 A;  4US9 A;  1SIJ A;  1V97 A;  3NVZ A;  2ACZ B;  1JRP A;  1N62 A;  3AE9 B;  1WGK A;  5EE9 A;  1ZUD 2;  1R7S A;  1RM6 C;  2WS3 B;  2WU5 B;  3AE7 B;  3VRA B;  3VR9 B;  1E7P B;  4YSX B;  1TKE A;  2WDR B;  4ITK A;  3RPF C;  5G5H A;  3ZYY X;  1ZXI A;  3WCQ A;  1RFK A;  1XLN A;  2HTM E;  3DWG C;  2WU2 B;  1TKG A;  3VRB B;  2FBW B;  4IDI A;  3P4R B;  5AUK A;  1OQR A;  2L52 A;  1QOF A;  3FAH A;  1N61 A;  2KMM A;  4KX6 B;  2JQR B;  1WYG A;  1KFY B;  1N63 A;  1WXQ A;  2PIA A;  3DWM A;  4HRO A;  1TYG B;  3W5V B;  1DOX A;  2L83 A;  1PDX A;  1L6U A;  3SFD B;  2LEK A;  2MJD A;  3AE6 B;  1GAQ B;  3AE8 B;  3AED B;  5GXG B;  5H8Y E;  3SFE B;  2BS3 B;  3W9C B;  2W3R A;  5AUI A;  1V8C A;  1NYQ A;  1E6E B;  2H88 B;  3AEA B;  4P6V F;  2W3S A;  1B9R A;  2K5P A;  2QIE B;  1XLO A;  3ABV B;  3CWI A;  3P4Q B;  4JWU C;  3LXF A;  3AH7 A;  3VR8 B;  3P1M A;  1CZP A;  4JWS C;  1YQ3 B;  2E3T A;  1ZOY B;  3EUB 2;  4FXC A;  3AEG B;  4ZOH C;  1FXI A;  1WRI A;  2KAJ A;  1OFF A;  2K9X A;  2BT6 A;  1N60 A;  4WQM A;  5C2T B;  1JWA D;  2Y5C A;  4ZHP A;  1L5P A;  2Q5W D;  2CU3 A;  1FIQ A;  2BS4 B;  2WQY B;  1JWB D;  3AE5 B;  1E10 A;  3L4P A;  2MH7 A;  1YJJ A;  1QF6 A;  1FRR A;  1SF0 A;  2PVO D;  3B2F A;  1QOB A;  2M56 B;  3AE4 B;  1JW9 D;  2G1E A;  3SR6 A;  5H92 C;  1PFD A;  2WDV B;  4YTM B;  1QOG A;  3AEC B;  3AMZ A;  4A9A A;  1L6V A;  1ROE A;  1AYF A;  1J7B A;  1FXA A;  1JRO A;  2W55 A;  3AE1 B;  3ETR A;  1QT9 A;  2PKO A;  1L0V B;  1FM0 D;  1NVI D;  1WWT A;  3HUI A;  2K22 A;  4US8 A;  3AM9 A;  1DOY A;  3P63 A;  3AB5 A;  3AEF B;  1PUT A;  3B9J A;  1KF6 B;  3NVV A;  4YT0 B;  3P4P B;  3NVY A;  1J7A A;  2WP9 B;  5G5G A;  1DOI A;  1QLB B;  1UWM A;  1CJE A;  4C7Y A;  3NRZ A;  1NEN B;  1VJK A;  1YQ4 B;  5EE3 A;  3W5U B;  4YXD B;  5C3J B;  3AEE B;  1GPX A;  4USA A;  4YSZ B;  3AV8 A;  2H89 B;  5EE0 A;  3HVZ A;  2AX5 A;  3PO0 A;  1VDV A;  1VLB A;  1IUE A;  1FO4 A;  1N5X A;  4N6E B;  1SB3 C;  2OHF A;  1JAL A;  1DGJ A;  1N5W A;  5EE1 A;  2CJO A;  4HRS A;  1A70 A;  1FFV A;  1J7C A;  1KRH A;  1XLP A;  2QJL A;  3FC4 A;  1I7H A;  4YSY B;  4ZHO A;  4JX1 C;  1YJI A;  3KWL A;  1FRD A;  4LTU A;  4YTN B;  1TKY A;  1EWY C;  3NVW A;  2WDQ B;  1TJE A;  3AE2 B;  3AEB B;  3B2G A;  2PVG C;  2W54 A;  4N59 A;  4WWM A;  2MJ3 A;  3BII D;  1E9M A;  1AWD A;  2MJE A;  2DWQ A;  3P4S B;  2M19 A;  3AN1 A;  3AE3 B;  3HRD D;  3NS1 A;  1E0Z A;  1FMA D;  2N0S B;  2JX5 A;  1XO3 A;  2BS2 B;  1RYJ A;  2EKI A;  4C80 A;  1NI3 A;  4C7Z A;  1NEK B;  1FFU A;  1RWS A;  1QOA A;  1XLQ A;  2WLB A;  1F0Z A;  4N58 A;  1OQQ A;  1T3Q A;  3CIR B; 
#chains in the Genus database with same CATH topology
 4YTP B;  2BQQ A;  5C23 A;  3NVZ A;  3N32 A;  1N62 A;  1WXV A;  4B0M A;  2D3C A;  5JXV A;  3T3O A;  1ZXI A;  1AW7 A;  1WXS A;  2IO2 B;  1TKG A;  4RGM A;  2ZNV B;  3Q3M C;  2M8S A;  2J0J A;  4G0N B;  3VTU A;  2PIA A;  2WXR A;  1CK1 A;  3ZRC A;  3QX1 A;  2H88 B;  2KWV B;  1B9R A;  2FUH B;  4XZ4 A;  4ZOH C;  1WRI A;  3ML9 A;  1OFF A;  2BT6 A;  4MGY E;  3QCA A;  2WQY B;  4L1B A;  2KMC A;  1WJU A;  4BKG A;  3OG5 A;  1LO5 D;  2I1K A;  3HVD A;  5EDS A;  3UIO B;  1WWT A;  3K9O B;  1WX8 A;  4WQO B;  3O13 A;  5JH5 C;  5G5G A;  5C3J B;  2N9P C;  2G4S A;  4FHJ A;  1D5X C;  1U4A A;  1WZ3 A;  4HRS A;  4JX1 C;  1FRD A;  3RCZ A;  3U4E G;  3TUO A;  4OZA A;  5CHV C;  1WFY A;  4EOY A;  2L3Z A;  3SDL C;  3A4R A;  1ET6 A;  1D3Z A;  4RF1 A;  3DDC B;  1EUV B;  5D94 A;  1T3Q A;  3RNC C;  1NYR A;  4M01 A;  2NR2 A;  2BGF A;  3DPD A;  2D07 B;  2HDE A;  1QQR A;  3E9S A;  4F1S A;  1RFK A;  1XLN A;  2L05 A;  1FPY A;  1UEL A;  2N9K A;  2PJH A;  2IDY A;  1CQV A;  2L52 A;  2ZZP B;  3H6N A;  4DHJ B;  1UNS A;  1FEH A;  4HPM B;  4MGI E;  3WAM A;  1V8C A;  1T0R C;  3V60 A;  2L00 B;  3CWI A;  1AAR A;  1WRD B;  1E5W A;  4LCD E;  1C1Y B;  3GS2 A;  4RMA A;  4PK1 A;  2KNB A;  1SBB B;  4NQK E;  4ZHP A;  3FIL B;  4FUL A;  3UQB A;  3TEZ A;  4W9K A;  3VUW A;  4GIV A;  1GUA B;  2M4N A;  4H2A A;  3Q8E A;  1NI2 A;  5H92 C;  3R8B A;  3ONS A;  4PYU A;  3BIN A;  2DHZ A;  1IYF A;  1SEB D;  5BYR A;  4GXB A;  2LUE A;  4UDU C;  3ZDM C;  2YLM A;  1C9F A;  2ICI A;  1F77 A;  3AV8 A;  1HTO A;  2K8B A;  3PO0 A;  2KJR A;  1VDV A;  1FO4 A;  1N5X A;  3M3J A;  2LMC A;  1UGJ A;  2BKF A;  1I4X A;  3VUX A;  2W9N A;  2PPH A;  5CX3 A;  2M19 A;  4K7U A;  4IUM B;  1E0Z A;  1XD3 B;  3L0W B;  1XO3 A;  2V0G A;  1UBI A;  4KV2 A;  2KAC A;  4L23 A;  3AU5 A;  5BMG A;  3RUI B;  2LZ6 A;  4F7Z A;  3U30 A;  1GC7 A;  3E56 A;  1RM6 C;  1VZ7 A;  2BWE S;  1YIW A;  2QHO A;  2LJI A;  4WJQ A;  3FIL A;  4MH0 E;  4BZA A;  5J2R A;  5AUK A;  3LJ3 A;  4D2K A;  4FBJ B;  1D5Z C;  5BMH A;  2VZK D;  4HWI B;  2M0A A;  1GNU A;  1WMH B;  2Y3A A;  2L83 A;  3AE8 B;  2GBN A;  3Q2A C;  2W3S A;  2MCN B;  3H1U A;  1TS4 A;  4M0W B;  3A33 B;  2UWQ A;  3QA8 A;  2KJ6 A;  1CZP A;  4GDK B;  2KAJ A;  4P7I A;  2K9X A;  5HI1 A;  3Q3F A;  2HJ1 A;  1L5P A;  2JZP A;  2CU3 A;  2KFK B;  2MX2 A;  4NAW A;  2MH7 A;  2MBH A;  1TZO A;  3EFC A;  1FRR A;  4HK2 A;  3ZW3 A;  2Y5P A;  1WJN A;  3CMM B;  2KN4 A;  2J42 A;  2K0P A;  4BAX A;  4ANX A;  4ACF A;  2KWC A;  4K3B A;  3VFK A;  2ZVO A;  2WXP A;  3OAW A;  2LXA A;  3AM9 A;  2L7R A;  1WYW B;  2V4L A;  2H89 B;  4WJO A;  1E7V A;  1VZ6 A;  3I63 C;  3KWL A;  3QQ8 B;  4KIK B;  5IOI A;  3PHX B;  2WHI A;  2GOW A;  4ZYS A;  3O65 B;  2N9X A;  1Y56 A;  1WMH A;  4C80 A;  1F0Z A;  5I4D A;  2KVR A;  1Z2M A;  1MFW A;  2B76 B;  3NZU A;  2V3P A;  5IA7 A;  4GMV A;  2M17 A;  3I57 A;  3ML8 A;  2AL6 A;  4GDK A;  3PZD A;  1F1H A;  4MDK E;  2HTM E;  3IT4 B;  2KDI A;  4JIO U;  2KFK A;  1OTR B;  1ZE3 D;  3MP9 A;  3D32 A;  2EMS A;  1KLG D;  2EEL A;  2WDT B;  3ZKJ C;  1KFY B;  1WXQ A;  2O6V B;  5KHO A;  3UF8 A;  2GLS A;  1E90 A;  3VAW A;  1UUP A;  4W9J A;  4G3X B;  3R3M A;  4TMA B;  4URK A;  1HA5 A;  1C79 A;  1EF1 A;  2KXJ A;  4WQM A;  2Y5C A;  3IBE A;  2C7N B;  3ZUN A;  4TKN A;  2AQ3 B;  1QOB A;  3GOE A;  1V2Y A;  4BFR A;  1TS3 A;  4YL8 A;  2KX0 A;  2J53 A;  2KMA A;  3WA0 A;  4KGT A;  4IOI E;  5G2N A;  2N1V A;  4K1R B;  1K52 A;  4LNO A;  1Y8R C;  2WXQ A;  1L4D B;  1Q0W B;  1FCL A;  1AN8 A;  2RDB C;  4M00 A;  1C77 A;  5CHW A;  4KSL C;  3ZLZ A;  3R2T A;  1WM2 A;  1I7H A;  2NS5 A;  2NTT A;  3Q8F A;  3B2G A;  3CSF A;  2ASQ A;  2MJ3 A;  3A9J B;  2MBQ A;  2DWQ A;  3VXW A;  3LDZ E;  2NBW B;  2BYV E;  4MT5 A;  2N1W A;  1YX5 B;  2C60 A;  3ENE A;  3UQA A;  1WM3 A;  4N58 A;  1RRB A;  2D5G A;  3PV1 A;  3W1S C;  5C1Z A;  4ITK A;  2ZPY A;  4KZC A;  1MHX A;  3BK1 A;  1IGD A;  2D10 A;  3DOW A;  1N61 A;  1N63 A;  3DWM A;  3Q6B A;  2CR5 A;  3DVN U;  3MJ5 A;  4RF0 A;  5H8Y E;  1ZDX A;  3N1X C;  1JML A;  3RN9 C;  4NJC A;  4A3O A;  1I35 A;  4CQN A;  3DBH B;  3T8M A;  3L16 A;  1LQB A;  4IWO A;  5C2T B;  3L10 B;  3NG0 A;  1FIQ A;  1T0Q C;  2BYF A;  2WX1 A;  2NCN A;  2JSV X;  4BVU C;  4HKQ A;  2JXX A;  3MJW A;  3UIP B;  4IG7 B;  1QIL A;  2MRP A;  4FA6 A;  3A9J A;  2ZW0 A;  2KTF A;  2GBJ A;  4IM3 A;  3P4P B;  3N30 A;  2LGD A;  2KN5 A;  4RGO S;  4YWG G;  4C7Y A;  4ARI A;  3KYD D;  1VJK A;  4CYE A;  1I4R A;  4YSZ B;  2G3Q B;  3H7P B;  1IUE A;  1SB3 C;  1WGG A;  2PMV A;  3KWV A;  1KRH A;  1V86 A;  2QJL A;  3GE3 C;  3K9P B;  4FJV B;  4LLG M;  1H8C A;  1YJI A;  1EWY C;  3DHI C;  4NJ6 A;  2PVG C;  4BKT A;  2BBC A;  4HCN B;  4GOC A;  4NJ7 A;  2LRU A;  2LVP A;  3B1L X;  3BK2 A;  4IWP A;  4W9E A;  1NDD A;  2IND C;  3U2S C;  4LNN A;  1V97 A;  3RNE C;  1V1P B;  4HDO A;  1JWS D;  3JYU A;  2KQ4 X;  1WXA A;  4GN1 A;  1S3S G;  2A4Z A;  1WF9 A;  2G4D B;  4PS7 A;  2HJ8 A;  1SJH D;  4WWN A;  5BYS A;  1VD2 A;  2XBB C;  1TY0 A;  3RFZ B;  3PLV A;  2BKR B;  3SFE B;  1GAQ B;  5GXG B;  1OEY A;  2QIE B;  4W9L A;  3LXF A;  1YJ1 A;  4REZ A;  3IT6 B;  3VR8 B;  2YVC A;  2V4I B;  3NS8 A;  4KVG B;  4LNF A;  1ZOY B;  3TBL D;  1GC6 A;  1E8W A;  2V1Y A;  2KDB A;  3PRE A;  4TV3 A;  2IO0 B;  1PGX A;  1UF0 A;  4K7W A;  3PHW B;  1FXA A;  3DBH I;  1T6B X;  1HZ6 A;  1TTN A;  1QT9 A;  4RGT A;  1TS2 A;  4CHK A;  3VVW B;  2Z8L A;  4OZB A;  1S1Q B;  2AWT A;  3NVY A;  1LGR A;  2R2O A;  1NEN B;  3WAO A;  3PZ7 A;  3GB1 A;  3HVZ A;  3JSV B;  4W9I A;  2DZI A;  2V3S A;  4WWO A;  1GJZ A;  4EKU A;  1V1P A;  2FID A;  2R2Q A;  4TSS A;  2RR9 A;  2KD0 A;  2K8C A;  1E9M A;  1AWD A;  4DHZ B;  4ICU A;  2JRH A;  4IW0 A;  4KDI C;  4DWF A;  3Q69 A;  3N20 C;  1R4N B;  3DHG C;  2WYQ A;  4A6Q A;  1WH3 A;  2IY0 B;  2MQJ A;  2PLP A;  3P2B A;  3DQV A;  1FFU A;  2REX A;  3EHV A;  1VRA B;  4DXG A;  3C19 A;  3I9V 1;  4LJP B;  5MPO A;  2JZ3 B;  1I4P A;  1P0R A;  3H9D A;  2RMM A;  3QJZ A;  1PGA A;  3WCQ A;  2WU2 B;  2ZEQ A;  2FBW B;  2PE6 B;  3VTW A;  3NOB A;  2KMM A;  1KH0 A;  2KYW A;  2N4F A;  1GB1 A;  2ZW1 A;  5G55 A;  3V6E B;  4N9F 4;  3AEA B;  4II2 B;  4KKJ A;  1OEY J;  3EUB 2;  4P1C C;  2CHZ A;  2MWS B;  3X0W A;  1FXI A;  1WIA A;  2FAZ A;  3Q14 C;  3GP7 A;  2EKE C;  3RT3 B;  4R3D A;  1E10 A;  1YX6 B;  2DYB A;  1YJJ A;  2L0T A;  5HG2 A;  3JSV A;  5T8I A;  1SF0 A;  1K50 A;  2XNA C;  1WJ6 A;  2I2Y A;  2SEB D;  3EFU A;  3N9Y C;  3KYC D;  4B0E A;  3M95 A;  1YOV B;  2O2V B;  1WR1 A;  2RPV A;  1UWM A;  2ZPN A;  5GMV A;  2B3A A;  2NBU A;  3C8Y A;  2LUM A;  4JGH B;  1I4H A;  2LVQ A;  3T3N A;  1P9D U;  4S0R A;  3AUL A;  2CJO A;  1CMX B;  2WXG A;  3BVG A;  2JY6 A;  3OWE B;  2RGF A;  3SHQ A;  4WJN A;  1OQY A;  3IXS A;  2KC1 A;  3R7R A;  1C4C A;  2LWP A;  2DZK A;  1J19 A;  1LXD A;  3DVG X;  3J9C A;  1SJE D;  3IVF A;  1K51 A;  2LHD A;  3R66 C;  3CIR B;  2MEK A;  3EC8 A;  4ZRJ A;  3L13 A;  4JQW C;  4MAC A;  3AE7 B;  3VH3 B;  1R4N I;  2LGY A;  3APF A;  2KO3 A;  1C76 A;  3VRB B;  4ZRK A;  3PRZ A;  2RD0 A;  2MLB A;  2WX0 A;  2XEW A;  2OOB B;  3TSS A;  1TYG B;  3W5V B;  3ZQ4 A;  2BS3 B;  4DQO C;  4WIP A;  4EUT A;  4DBG A;  2JXT A;  2IGD A;  1UBQ A;  1D5M C;  4NNJ B;  1V5O A;  4GSW A;  2LHE A;  2OED A;  1SE2 A;  1YNT E;  4ZRQ A;  2MP2 B;  1QF6 A;  1V6E A;  3TIX A;  5CHF A;  4HVB A;  1TZ1 A;  4MGK E;  4YTM B;  1AYF A;  3AE1 B;  2QEJ C;  4FJZ A;  3Q8C A;  4C4V B;  3R2I A;  3HUI A;  3JVZ X;  2NBV B;  4W9H A;  4MJS B;  3X23 A;  3VQI A;  1WI0 A;  4IM2 A;  2C7H A;  1VLB A;  4FJY A;  1DGJ A;  1TY2 A;  3NZS A;  4HKZ E;  1T0S C;  2L32 A;  1E7U A;  3OLM D;  1SE3 A;  2JYE A;  2NTS A;  3PVL A;  1HZ5 A;  5DPW A;  5JHA A;  4LDT B;  1WGY A;  4EFO A;  2BW2 A;  2L1A A;  2MJE A;  1WJ4 A;  3BYY B;  1JWU D;  2N0S B;  3U7Z A;  3M63 B;  4BOS C;  2K6D B;  1WX7 A;  2JZZ A;  1RYJ A;  4HJG E;  3W1S A;  1UGM A;  3NY5 A;  4C7Z A;  3H7S A;  2KZR A;  4BKS A;  4MSQ B;  1TT5 B;  3LB8 C;  1ZP0 B;  3N3K B;  3PPA A;  1KM7 A;  2KQS A;  3AE9 B;  3ECI A;  4ASW C;  1QKZ A;  3ZYY X;  2IO1 B;  2N9L A;  4IDI A;  3P4R B;  1OQR A;  5TSS A;  5DPT A;  4ANW A;  1LFD A;  1KLU D;  4KX6 B;  1WYG A;  4NY0 A;  3PS6 A;  3VUY A;  3DCG A;  2WXN A;  2KKC A;  2CU1 A;  1PQS A;  4P6V F;  2OJR A;  4M0W A;  3S2A A;  5TR5 A;  2UYZ B;  3AH7 A;  3BZD B;  3RUL A;  1MI0 A;  2KC2 A;  2E3T A;  1P3Q U;  2DYO A;  5JZE B;  2ON8 A;  5E6P A;  3APD A;  4JE3 B;  3APC A;  4TQ0 A;  1XF5 L;  1WR6 E;  3WAL A;  4DHJ D;  3SR6 A;  2WDV B;  3AMZ A;  3ZDT A;  3FKY A;  4W9C A;  3PGE A;  3PRP B;  2IY1 B;  4LJO B;  1FM0 D;  4AJW A;  4XWT A;  4RFB A;  4US8 A;  1TBE A;  2Z0D B;  4HEA 1;  2FCS A;  1M94 A;  5FKA C;  4IC7 B;  2KLG A;  1WXM A;  3NRZ A;  2AEH A;  2RPQ A;  1EF5 A;  3PTF C;  4MGZ E;  1F2R I;  2FNJ B;  5D3D A;  3L08 A;  5HFY A;  2DZM A;  3HM3 A;  1JAL A;  1BUI C;  3NUH B;  3QC8 B;  4IM0 A;  2J0K A;  3MC0 B;  1P98 A;  1KTK A;  3GZN B;  4I6N B;  4KIK A;  3UGB B;  4YTN B;  2PEA A;  2KTR B;  3IAM 1;  3AE2 B;  3MHZ A;  4GGQ A;  2VH1 A;  4WWM A;  2N7D A;  3PSE B;  2L76 A;  4HCP B;  4KSK C;  2Y5B B;  2GBM A;  3LYY A;  1L0X B;  4WH4 A;  2RSU A;  5IAA C;  4KZ0 A;  2WXJ A;  1UZX B;  4DHZ E;  4KDL B;  2G9H D;  4K81 A;  1SIJ A;  4X57 B;  1WE6 A;  1R7S A;  3RMK C;  2WU5 B;  5D3I B;  1IBX B;  5G5H A;  1FNU A;  2SAK A;  2JWU A;  3GE8 C;  2BVC A;  3IG3 A;  2V9H A;  2JQR B;  2O6V A;  1VCB A;  1G6J A;  3N1Z C;  2LEK A;  3W9C B;  4MM3 B;  4JLC A;  1TGZ B;  3L54 A;  4BKS D;  2W3R A;  4BOZ B;  4DK5 A;  2K5P A;  1XLO A;  1E8Y A;  4OVU A;  3P1M A;  1RLF A;  3RZW C;  4FXC A;  2WXH A;  4EZK A;  3ZVV A;  4GLS C;  2Q5W D;  1ZDV A;  2BS4 B;  4CO7 A;  3AE4 B;  1GB4 A;  1V81 A;  4DXF A;  1ZW7 A;  4DDI D;  3A9K B;  3NHE B;  2KTR A;  3ZJT A;  3A4S C;  2K22 A;  5AZG A;  1F2R C;  3V62 A;  3QIJ A;  3Q8B A;  5BMI A;  3NVV A;  3IFW B;  1WZ0 A;  4YT0 B;  5AZH A;  4DDG D;  5EE3 A;  2IJ0 A;  4M02 A;  2J7Q B;  2K8H A;  2AX5 A;  1MHH E;  2BWF A;  3CF6 E;  2WXL A;  1J7C A;  1PGB A;  4ZHO A;  1IBX A;  4LTU A;  4KKI A;  2AQ2 B;  2WDQ B;  1BML C;  1BT0 A;  4N59 A;  3QHT A;  5LXH A;  3HK0 A;  4XE0 A;  3P4S B;  3TEW A;  3MHS D;  3NS1 A;  4M8M A;  3ZTD A;  4G11 A;  4K3C A;  2BS2 B;  2KFJ A;  1NI3 A;  1F9J A;  2CHW A;  2WLB A;  4E3C A;  4MM3 A;  3GZN I;  4NZL B;  2DBY A;  2KOX A;  1MPE A;  3Q3O C;  2JWZ A;  3M62 B;  5HKH A;  4HDQ A;  2ACZ B;  2K3U A;  1WGK A;  1TKE A;  1HE8 A;  2KWD A;  2N7J A;  1X1M A;  1QOF A;  2LGX A;  3FAH A;  3HM6 X;  2XK5 B;  5AEK B;  4HRO A;  4B9K A;  3U7D A;  4HJK A;  3A9K A;  1T5X D;  3AE6 B;  1D6E C;  2A5U A;  1NYQ A;  1SE9 A;  2K6Q A;  1F52 A;  3BYT B;  3EA6 A;  4OVZ A;  1SSN A;  4AWJ A;  3RNF C;  5FR6 A;  2C7M B;  1N60 A;  1KJT A;  5E6J A;  3DBL B;  2HTH A;  1KOT A;  3DBR B;  3PLU A;  2O6V D;  2INP E;  5J17 A;  3AEC B;  4JL9 A;  4HXD A;  1BXT A;  2ZJD A;  1YMH E;  1L0V B;  3N1Y C;  5E6O A;  3HHM A;  3I5J C;  2J52 A;  2NPT B;  3B9J A;  1J7A A;  2WP9 B;  2YEP F;  1YQ4 B;  3AI5 A;  1GPX A;  5JHB A;  3AEE B;  3VDZ A;  3Q8A A;  3ZTC A;  2WXM A;  4A90 A;  3H7P A;  4WWP A;  3EGR A;  2X8X X;  2IZV B;  1YN5 A;  4RM9 A;  3NVW A;  1P7E A;  1FNW A;  3RYT A;  3QAR A;  2PW9 A;  4RNA A;  4MH8 A;  3RD2 A;  1L2N A;  5LLI A;  3V6C B;  2JX5 A;  2XK5 A;  4ANU A;  2VZK B;  1EO6 A;  1QOA A;  3ZIM A;  2N7E A;  2QMT A;  2JVC A;  2AQ1 B;  3RI7 C;  4DXA B;  2KVZ A;  5D6J B;  1E7P B;  1C4P A;  2MSE D;  2BB6 A;  1SXT A;  4MEM A;  1OGW A;  2BF8 B;  2FCM A;  4ANV A;  2QC8 A;  2Z0E B;  2QCZ A;  3SFD B;  2BB5 A;  4XC2 A;  2TSS A;  3V05 A;  2J4X A;  4WJP A;  1WX9 A;  2JRI B;  3B0A A;  2NPT A;  1B1Z A;  2D3B A;  3QWZ B;  2KAN A;  2WWZ A;  4P16 A;  1MG4 A;  3AE5 B;  3DHH C;  3L4P A;  4AJY B;  1FXT B;  3KW5 B;  4FLH A;  4JPS A;  2PVO D;  3KUC B;  1HTQ A;  2LFI A;  2LXC A;  4XDC A;  1PFD A;  1L6V A;  1ROE A;  2K25 A;  4W9F A;  1UWX A;  2MHJ A;  3I3T B;  2DAJ A;  2GMI C;  3AXC A;  5IP4 D;  3P63 A;  3DBL I;  3DBR I;  1QLB B;  1FNV A;  2KWU B;  2QIL A;  2WXO A;  3C0R B;  4M8N A;  5DCN A;  1L0Y B;  1ZGU B;  1RFA A;  3UIN B;  4A8X C;  1C3T A;  2GB1 A;  1N5W A;  1FFV A;  3MC9 A;  3FC4 A;  2XN9 C;  2WGS A;  1TKY A;  1ACC A;  1TJE A;  5D7G A;  2DNF A;  2VH2 A;  5KHQ A;  2IO3 B;  1UH6 A;  4MEL A;  1E8X A;  1V9J A;  3ZNG C;  3AE3 B;  1ZPS A;  4WAF A;  4P1B C;  4L2Y A;  1XLQ A;  3WAN A;  2CJN A;  4GDL B;  3TJP A;  3BY4 B;  2LAS A;  2JF5 A;  1L4Z B;  1JRP A;  1IPG A;  1LM8 B;  2WDR B;  2JUO A;  2ZVN A;  1HEZ E;  3DWG C;  2WXF A;  4G50 A;  3CST A;  5IKC M;  2JYT A;  3BVM A;  2LVO A;  2IPK D;  1XQQ A;  2EMT A;  3VTV A;  1Q1O A;  4K7S A;  1E6E B;  3ZNI D;  3B08 A;  1HXY D;  4C56 C;  3TEY A;  3TCA A;  1N6Z A;  2C9W B;  1MVK A;  3VHT C;  1WSP A;  4QAY A;  4A55 A;  1ZXH A;  2KJH B;  4NAW B;  2FUG 1;  1SIF A;  3RNA C;  3TL5 A;  3V3X A;  4F8C B;  1MJD A;  4ZDV A;  1Q5W B;  1C78 A;  1V49 A;  4RCO A;  2JPH A;  2W55 A;  2CS4 A;  1MG8 A;  2DEN B;  1YD8 U;  2W82 A;  4PT5 A;  1ET9 A;  3WAP A;  3AEF B;  2KK8 A;  2O2V A;  1KF6 B;  1J0G A;  1EM7 A;  1GG3 A;  1T0Y A;  3T9L A;  4GDL A;  3KH0 A;  2G45 B;  4N6E B;  1L7Y A;  3SD5 A;  4AQ7 A;  2M1M A;  2KLC A;  4YSY B;  1VZ8 A;  4ICV A;  2OJW A;  2CKH B;  4C00 A;  3SU8 X;  5L83 A;  2ONQ A;  1IP9 A;  1JRU A;  5AZF A;  1VR9 A;  1P1A A;  1FCC C;  2ZNV C;  2ZCB A;  4HPL B;  3ZO5 B;  3OJ4 B;  2QDF A;  4FAD A;  1UD7 A;  2GI9 A;  1ZKH A;  5EE9 A;  4RM8 A;  4YSX B;  3VRA B;  4LNI A;  2D2Q A;  1NBF C;  4EE2 A;  1C4A A;  1P7F A;  4I6L B;  1V5T A;  2KDF B;  4B6W A;  1JWM D;  3Q3N C;  4TUU A;  2KQ7 A;  3TEX A;  4WUR A;  3V61 A;  2BTE A;  3KLS X;  1L6U A;  2MBO A;  4RH6 A;  1I4Q A;  3AED B;  3U8Z A;  3BWU D;  2PTL A;  2RDH A;  3P4Q B;  1JCK B;  2DX5 B;  2GRI A;  5BYQ A;  4E74 A;  1YQ3 B;  3AEG B;  4B95 A;  2WXI A;  1JWA D;  3AU4 A;  2INN E;  4AUQ C;  1SGH A;  2GBK A;  2X38 A;  2MP2 A;  1TIF A;  4PYZ A;  1XEE A;  3KUD B;  1K53 A;  2M56 B;  1JW9 D;  2G1E A;  1QOG A;  2DAF A;  4A9A A;  4WAA A;  1WGH A;  1JRO A;  3MFG A;  3ETR A;  2LJ5 A;  4C4V A;  2INC C;  4FHK A;  1H4R A;  1DOY A;  3AB5 A;  4MJS A;  1PYW D;  2NMQ A;  4XYC A;  1PUT A;  2IGH A;  3BVZ A;  1XCT L;  1RAX A;  3MTN B;  4XGA B;  1DOI A;  2I38 A;  3W5U B;  4YXD B;  1EU4 A;  1K8R B;  4OHJ A;  4USA A;  2D11 A;  3ALB A;  4AOF A;  2KDM A;  2RDG A;  4EEW A;  2D3A A;  2WNM A;  4MSM B;  5EE1 A;  1YN4 A;  3NJT A;  1ENF A;  1WY8 A;  3KUZ A;  2WXK A;  4E71 A;  4ARC A;  3AEB B;  2Z59 B;  5IN7 A;  1DYQ A;  3BII D;  4OZC A;  1KLV A;  3HRD D;  1M4V A;  3PZ8 A;  1D4B A;  3A1Q B;  3KVF B;  1OQQ A;  2JT4 B;  2MBB B;  3NZ3 A;  2LD9 A;  1ZUD 2;  1A5R A;  4IKG A;  4NAM A;  2IGG A;  4EZL A;  4AS1 A;  4OVV A;  1R4M B;  3OJ3 A;  1HQR D;  1PDX A;  2MJD A;  2C5L C;  4II3 B;  3JW0 X;  2MW5 A;  4HPP A;  2MA9 B;  4JWU C;  3L17 A;  4W9D A;  1V1O A;  3H8H A;  2BPS A;  2HD5 B;  5L95 C;  4KGS A;  1SE4 A;  2UU7 A;  1STE A;  1Q10 A;  1FD6 A;  2BYT A;  1I42 A;  3TMP B;  3Q3J A;  2K39 A;  2QSD A;  1ISN A;  2JU6 X;  2R61 A;  2K1F A;  4BBN F;  4IWQ A;  5LXI B;  3PRM B;  3UI3 A;  2E6X A;  1QZE A;  2D3G A;  2IYD B;  4NQL B;  5DPR A;  2M0X A;  3HIZ A;  4ZRP A;  3A1Q A;  2L0F A;  2L8J A;  1TS5 A;  2I1J A;  3ZJU A;  4J6I A;  1XLP A;  4NPN A;  2ZCC A;  3P42 A;  2YEP B;  2KX3 A;  1J8C A;  4LNK A;  4FN2 A;  1FMA D;  4HLE A;  3U52 E;  1NEK B;  4XWW A;  1RWS A;  1EU3 A;  4S17 A;  3QAQ A;  1JQ4 A;  2VRR B;  4US9 A;  3W1Y A;  5LNK 1;  2CHX A;  4I6P A;  3SEB A;  2WS3 B;  4OW0 A;  4GU2 A;  3VR9 B;  2LRW A;  5DPS A;  3RPF C;  4RGN A;  1XXG A;  3VH4 B;  5E6N A;  2KDE B;  3IAS 1;  3MC8 A;  4LDT D;  4XX5 A;  3ZJV A;  1YN3 A;  4ZYN A;  5FK9 C;  3ZXR A;  3URY A;  4W9G A;  2FCQ A;  2PE9 A;  2LI5 A;  3RZF A;  1DOX A;  3ZXV A;  3ZNZ B;  3EEC A;  2KHW B;  1IGC A;  5AUI A;  1XCQ L;  3ABV B;  2J0M A;  2AYO B;  2V3N A;  2KT7 A;  1WE7 A;  2DYM A;  2IBI B;  4JWS C;  3ZRF A;  3KQ4 A;  1R4M I;  2DZJ A;  4ZRI A;  2N9E B;  4A3P A;  4AP4 C;  3RNB C;  5CTR C;  1JWB D;  3QK0 A;  3ZGZ A;  2LGS A;  4O1N A;  3B2F A;  2HE7 A;  4PS3 A;  2GBR A;  1J7B A;  2FIF A;  2PKO A;  1WGD A;  1NVI D;  1ESF A;  4BBN C;  3DVN V;  3IHP C;  1E8Z A;  3RNG C;  1EWC A;  4XDD A;  3ZNH B;  2FCN A;  1GOZ A;  4EZJ A;  1CJE A;  4GB9 A;  3PT2 B;  4PS8 A;  2BYE A;  5D2M B;  4J3O D;  5EE0 A;  2FE8 A;  4TQ1 A;  1WGR A;  2MBE A;  2OHF A;  5HHD G;  1A70 A;  1I4G A;  1Z5S B;  2DLB A;  5FR3 A;  4Q2J A;  1YQB A;  2AL3 A;  3DVG Y;  4A20 A;  1V80 A;  3DBS A;  4KGR A;  2W54 A;  5J18 A;  5BO4 B;  1XT9 B;  3AN1 A;  2LGI A;  5IO9 A;  3WIM A;  2NVU I;  3R7Q A;  3W2D A;  4LK0 M;  2EKI A; 
#chains in the Genus database with same CATH homology
 3LB8 C;  2CJN A;  4GDL B;  1ZP0 B;  4YTP B;  2D5G A;  1L4Z B;  3NVZ A;  1JRP A;  1N62 A;  3AE9 B;  4B0M A;  2WDR B;  5JXV A;  4ITK A;  1QKZ A;  3T3O A;  3ZYY X;  1HEZ E;  1ZXI A;  1AW7 A;  1MHX A;  3BK1 A;  1IGD A;  3DWG C;  1TKG A;  2N9L A;  2WXF A;  4RGM A;  4IDI A;  3P4R B;  1OQR A;  5TSS A;  1KLU D;  4KX6 B;  1N61 A;  2JYT A;  3BVM A;  1WYG A;  2PIA A;  1N63 A;  2WXR A;  3DWM A;  2IPK D;  1CK1 A;  3MJ5 A;  4RF0 A;  2WXN A;  5H8Y E;  1ZDX A;  2H88 B;  1E6E B;  1JML A;  4P6V F;  1B9R A;  4M0W A;  4NJC A;  3BZD B;  3AH7 A;  1HXY D;  1MI0 A;  4CQN A;  4C56 C;  2E3T A;  4ZOH C;  3TEY A;  1WRI A;  1OFF A;  2DYO A;  2BT6 A;  5C2T B;  1MVK A;  1WSP A;  1FIQ A;  2WQY B;  4L1B A;  2ON8 A;  4A55 A;  1ZXH A;  2JSV X;  4NAW B;  4JE3 B;  4TQ0 A;  2FUG 1;  1XF5 L;  4HKQ A;  3SR6 A;  3V3X A;  1LO5 D;  2WDV B;  1C78 A;  3AMZ A;  3HVD A;  4RCO A;  2W55 A;  1QIL A;  2W82 A;  4PT5 A;  1FM0 D;  1WWT A;  4XWT A;  2ZW0 A;  4RFB A;  4US8 A;  1ET9 A;  4HEA 1;  3AEF B;  3O13 A;  5FKA C;  1KF6 B;  3P4P B;  1EM7 A;  5G5G A;  4RGO S;  4YWG G;  4C7Y A;  4ARI A;  3NRZ A;  5C3J B;  1VJK A;  1I4R A;  1F2R I;  4YSZ B;  5D3D A;  1D5X C;  1IUE A;  4N6E B;  5HFY A;  1SB3 C;  2PMV A;  1JAL A;  1BUI C;  3NUH B;  4AQ7 A;  4HRS A;  3KWV A;  1KRH A;  2QJL A;  3MC0 B;  4LLG M;  4YSY B;  1KTK A;  4JX1 C;  1YJI A;  1FRD A;  4YTN B;  1EWY C;  3U4E G;  3TUO A;  4OZA A;  3IAM 1;  3MHZ A;  3AE2 B;  2PVG C;  1VZ8 A;  4WWM A;  2BBC A;  2ONQ A;  1ET6 A;  3BK2 A;  3LYY A;  4RF1 A;  1L0X B;  4WH4 A;  1VR9 A;  2WXJ A;  1FCC C;  1T3Q A;  3U2S C;  1NYR A;  2G9H D;  1SIJ A;  1V97 A;  2GI9 A;  5EE9 A;  1R7S A;  1V1P B;  2WU5 B;  5D3I B;  3VRA B;  4YSX B;  2HDE A;  1IBX B;  1QQR A;  1JWS D;  5G5H A;  1FNU A;  3E9S A;  2KQ4 X;  1RFK A;  1XLN A;  2SAK A;  4EE2 A;  2JWU A;  1C4A A;  1P7F A;  2N9K A;  2IDY A;  1CQV A;  2L52 A;  1JWM D;  2JQR B;  1UNS A;  1FEH A;  1SJH D;  3TEX A;  5BYS A;  4WUR A;  1TY0 A;  3RFZ B;  2BTE A;  3KLS X;  1L6U A;  2LEK A;  4RH6 A;  1I4Q A;  1GAQ B;  3AED B;  4MM3 B;  5GXG B;  3SFE B;  3W9C B;  2W3R A;  1V8C A;  2K5P A;  2PTL A;  2QIE B;  1XLO A;  3BWU D;  3CWI A;  2RDH A;  3P4Q B;  3LXF A;  4REZ A;  1JCK B;  3IT6 B;  3P1M A;  3VR8 B;  2V4I B;  2GRI A;  5BYQ A;  1YQ3 B;  3GS2 A;  1ZOY B;  4FXC A;  3AEG B;  2WXH A;  2WXI A;  1SBB B;  1JWA D;  4GLS C;  2INN E;  4ZHP A;  2Q5W D;  1ZDV A;  2BS4 B;  3FIL B;  2X38 A;  3TEZ A;  1XEE A;  4H2A A;  3Q8E A;  1K53 A;  2M56 B;  3AE4 B;  1JW9 D;  1GB4 A;  2G1E A;  4DXF A;  5H92 C;  1PGX A;  3R8B A;  1QOG A;  4A9A A;  1FXA A;  1JRO A;  3MFG A;  3ETR A;  1T6B X;  1HZ6 A;  1SEB D;  5BYR A;  1QT9 A;  4RGT A;  3ZJT A;  1TS2 A;  4UDU C;  2K22 A;  2Z8L A;  4OZB A;  1F2R C;  1DOY A;  3AB5 A;  3Q8B A;  1PYW D;  2NMQ A;  5BMI A;  1PUT A;  3NVV A;  4YT0 B;  2IGH A;  3BVZ A;  1XCT L;  3NVY A;  1C9F A;  1DOI A;  2I38 A;  2ICI A;  1F77 A;  1EU4 A;  1NEN B;  5EE3 A;  3W5U B;  2IJ0 A;  4OHJ A;  4YXD B;  3PZ7 A;  4USA A;  3AV8 A;  3GB1 A;  3HVZ A;  2AX5 A;  3PO0 A;  1VDV A;  1MHH E;  2KDM A;  1FO4 A;  1N5X A;  2RDG A;  2WNM A;  5EE1 A;  2LMC A;  1YN4 A;  1UGJ A;  2WXL A;  1J7C A;  1PGB A;  4ZHO A;  1V1P A;  1IBX A;  1ENF A;  1I4X A;  4LTU A;  2WXK A;  4TSS A;  4KKI A;  2AQ2 B;  2WDQ B;  1BML C;  3AEB B;  4ARC A;  4N59 A;  1DYQ A;  4XE0 A;  3BII D;  1E9M A;  1AWD A;  3P4S B;  3TEW A;  4OZC A;  2M19 A;  3HRD D;  3NS1 A;  3Q69 A;  1E0Z A;  1XO3 A;  1M4V A;  2V0G A;  3PZ8 A;  2BS2 B;  4A6Q A;  2KAC A;  4L23 A;  1D4B A;  1NI3 A;  2PLP A;  1FFU A;  5BMG A;  2WLB A;  1OQQ A;  4NZL B;  2DBY A;  1MPE A;  1VRA B;  3NZ3 A;  4DXG A;  3I9V 1;  2ACZ B;  2K3U A;  3E56 A;  1WGK A;  5MPO A;  1ZUD 2;  1RM6 C;  1VZ7 A;  4IKG A;  1I4P A;  1TKE A;  4NAM A;  2RMM A;  2IGG A;  1PGA A;  3WCQ A;  2KWD A;  2LJI A;  2N7J A;  4AS1 A;  2WU2 B;  3FIL A;  2FBW B;  5AUK A;  4D2K A;  1QOF A;  3FAH A;  2KMM A;  1D5Z C;  1KH0 A;  4HRO A;  2VZK D;  5BMH A;  2M0A A;  1GB1 A;  2ZW1 A;  1HQR D;  2Y3A A;  2L83 A;  1PDX A;  1T5X D;  2MJD A;  3AE6 B;  3AE8 B;  1D6E C;  3AEA B;  1NYQ A;  4KKJ A;  2W3S A;  1TS4 A;  4JWU C;  3BYT B;  3EA6 A;  4OVZ A;  1SSN A;  1V1O A;  1CZP A;  3H8H A;  3EUB 2;  1FXI A;  4GDK B;  2KAJ A;  4KGS A;  2K9X A;  3GP7 A;  5HI1 A;  1N60 A;  1SE4 A;  1L5P A;  2JZP A;  2CU3 A;  1STE A;  4R3D A;  5E6J A;  1E10 A;  1Q10 A;  2MH7 A;  1YJJ A;  5HG2 A;  1TZO A;  5T8I A;  1FD6 A;  1FRR A;  1SF0 A;  1K50 A;  2XNA C;  2BYT A;  2Y5P A;  2INP E;  2QSD A;  2KN4 A;  2J42 A;  3AEC B;  2K0P A;  2JU6 X;  2R61 A;  1BXT A;  2I2Y A;  2SEB D;  1YMH E;  1L0V B;  2WXP A;  3UI3 A;  3N9Y C;  2E6X A;  3AM9 A;  4B0E A;  2J52 A;  3B9J A;  2RPV A;  1J7A A;  2WP9 B;  1UWM A;  2YEP F;  1YQ4 B;  1GPX A;  4ZRP A;  3AEE B;  3C8Y A;  3Q8A A;  2WXM A;  2LUM A;  4A90 A;  2H89 B;  3EGR A;  1YN5 A;  1I4H A;  3T3N A;  1VZ6 A;  1TS5 A;  3ZJU A;  2CJO A;  1XLP A;  2WXG A;  3BVG A;  3KWL A;  3P42 A;  3NVW A;  3OWE B;  1P7E A;  2YEP B;  1FNW A;  3IXS A;  4ZYS A;  1C4C A;  2PW9 A;  4RNA A;  4MH8 A;  1FMA D;  2JX5 A;  1Y56 A;  2VZK B;  4C80 A;  3U52 E;  3J9C A;  1SJE D;  1NEK B;  4XWW A;  1RWS A;  1EU3 A;  1QOA A;  1F0Z A;  1K51 A;  2LHD A;  3CIR B;  5I4D A;  2MEK A;  2QMT A;  2AQ1 B;  2B76 B;  1JQ4 A;  4US9 A;  5LNK 1;  2V3P A;  3SEB A;  4MAC A;  3AE7 B;  2WS3 B;  4OW0 A;  3I57 A;  3VR9 B;  1E7P B;  1C4P A;  3RPF C;  2BB6 A;  1SXT A;  4RGN A;  1XXG A;  2HTM E;  3IT4 B;  3IAS 1;  1ZE3 D;  1C76 A;  3MP9 A;  3VRB B;  3ZJV A;  1YN3 A;  1KLG D;  5FK9 C;  2EEL A;  3URY A;  1KFY B;  1WXQ A;  3TSS A;  1TYG B;  3W5V B;  1DOX A;  3SFD B;  2BB5 A;  3ZQ4 A;  1IGC A;  2TSS A;  2BS3 B;  3V05 A;  4DQO C;  5AUI A;  1XCQ L;  4WIP A;  2J4X A;  1UUP A;  3ABV B;  2V3N A;  2JXT A;  2IGD A;  2DYM A;  4TMA B;  4JWS C;  1D5M C;  1B1Z A;  1HA5 A;  3KQ4 A;  1C79 A;  2LHE A;  4WQM A;  4P16 A;  2Y5C A;  3AE5 B;  2OED A;  1JWB D;  1SE2 A;  3L4P A;  1YNT E;  4ZRQ A;  3ZGZ A;  2AQ3 B;  4JPS A;  1QF6 A;  4O1N A;  2PVO D;  3B2F A;  1QOB A;  2LFI A;  4XDC A;  1PFD A;  4YTM B;  1L6V A;  1ROE A;  1TS3 A;  1AYF A;  1J7B A;  3AE1 B;  2QEJ C;  3Q8C A;  2PKO A;  1UWX A;  1NVI D;  1ESF A;  3R2I A;  3HUI A;  2J53 A;  3P63 A;  1EWC A;  4KGT A;  4IOI E;  4XDD A;  1GOZ A;  1QLB B;  1K52 A;  1CJE A;  1FNV A;  2WXQ A;  3VQI A;  1L4D B;  2QIL A;  2WXO A;  4J3O D;  1FCL A;  5EE0 A;  1AN8 A;  1L0Y B;  2FE8 A;  1C77 A;  1VLB A;  4TQ1 A;  4A8X C;  2OHF A;  1DGJ A;  2GB1 A;  1N5W A;  1TY2 A;  3R2T A;  4HKZ E;  5HHD G;  1A70 A;  1FFV A;  1I4G A;  3FC4 A;  1I7H A;  2DLB A;  2NTT A;  2XN9 C;  2L32 A;  5FR3 A;  1TKY A;  1SE3 A;  2JYE A;  4Q2J A;  2NTS A;  1ACC A;  1TJE A;  3Q8F A;  3B2G A;  5D7G A;  4KGR A;  1HZ5 A;  2W54 A;  2MJ3 A;  2BW2 A;  2L1A A;  2MJE A;  2DWQ A;  3AN1 A;  3AE3 B;  1ZPS A;  3BYY B;  1JWU D;  2LGI A;  2N0S B;  4WAF A;  3U7Z A;  4MT5 A;  3W2D A;  4LK0 M;  1RYJ A;  2EKI A;  4HJG E;  3W1S A;  4L2Y A;  4C7Z A;  1XLQ A;  4N58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...