1QOGA

Ferredoxin mutation s47a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
b'ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN
molecule tags Electron transport
source organism Nostoc sp.
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qogA00
2H89B 1NEKB 1F0ZA 4HROA 4N6EB 1RYJA 1JALA 3FC4A 2DWQA 2L52A 2PIAA 4IDIA 3RPFC 1CZPA 3NVWA 3AB5A 5G5GA 1WXQA 1JWAD 1WWTA 3HVZA 1TKYA 3LXFA 1YJJA 1N63A 4YSZB 2BS2B 4N59A 1WRIA 1A70A 3P63A 1KRHA 3ABVB 1J7BA 3AEDB 4ZHOA 2PKOA 1T3QA 2BS3B 3AV8A 3VRAB 5MPOA 2K9XA 3AE1B 4HRSA 1SF0A 1JROA 1WGKA 4C7YA 1SIJA 1ROEA 3AH7A 1L6VA 1QOAA 4YTNB 1SB3C 3NVVA 4USAA 4YSXB 2QJLA 3NVZA 4C80A 2AX5A 4FXCA 1PFDA 3B2GA 3KWLA 3CIRB 1RFKA 3P4QB 2B76B 1KF6B 1YQ3B 2BT6A 1XLNA 4YTPB 1FIQA 1FFUA 1N60A 3VRBB 3AEGB 1FO4A 1FXIA 1V97A 1DGJA 2KAJA 2WDQB 1FMAD 5AUIA 2LEKA 2MJ3A 3W9CB 1DOYA 1FFVA 2E3TA 1QOFA 1N5XA 2W3SA 2Y5CA 3L4PA 2WP9B 4KX6B 4WQMA 5EE3A 2WS3B 1XLPA 2N0SB 4YT0B 5H92C 3WCQA 4C7ZA 5H8YE 1N5WA 3AE3B 1L0VB 1QOGA 1FXAA 2M56B 2K5PA 3AE7B 3DWGC 3LB8C 1N61A 1GAQB 1YJIA 1R7SA 3VR9B 4YTMB 1JQ4A 3AE9B 4JX1C 4P6VF 4YSYB 4N58A 1NI3A 2WDRB 3AEFB 3AEEB 3SFDB 3AE8B 3NRZA 1XLOA 1RWSA 3NS1A 1RM6C 3NVYA 1QLBB 1NYRA 2MH7A 3FAHA 3P4RB 5GXGB 1J7CA 1E10A 1ZXIA 1EWYC 3AMZA 1QOBA 5C3JB 1QF6A 5G5HA 3HUIA 2W54A 1E6EB 1I7HA 1KFYB 4ZOHC 1E0ZA 1WYGA 1OFFA 1L5PA 2OHFA 2Q5WD 1ZUD2 3DWMA 4ITKA 1ZOYB 2EKIA 5EE1A 3AE4B 1PUTA 3AEBB 1JW9D 1NVID 2M19A 1AYFA 2MJDA 1ZP0B 2K22A 2WLBA 1VDVA 3B2FA 3P4PB 4LTUA 1QT9A 2CU3A 2DBYA 1FM0D 2WQYB 1DOXA 1GPXA 1TKGA 2ACZB 1V8CA 3AE5B 1FRRA 1OQRA 3CWIA 4WWMA 4US9A 3W5UB 4ZHPA 2FBWB 4US8A 1VLBA 1B9RA 3SR6A 1J7AA 3B9JA 1IUEA 2JQRB 3VR8B 2PVOD 2HTME 3ETRA 1PDXA 3SFEB 1XO3A 3BIID 3AM9A 4JWSC 4A9AA 1UWMA 2CJOA 1XLQA 1E7PB 2JX5A 1JRPA 1CJEA 1N62A 5AUKA 2H88B 3W5VB 3AEAB 4YXDB 2KMMA 2W3RA 2CJNA 2MJEA 5EE9A 2QIEB 2WU5B 3AECB 5EE0A 5C2TB 3PO0A 1L6UA 1YQ4B 3P1MA 1E9MA 1OQQA 1TKEA 1AWDA 1NYQA 3AE2B 3ZYYX 4JWUC 1TYGB 3AN1A 2L83A 3P4SB 3AE6B 1TJEA 2W55A 3EUB2 1JWBD 1NENB 2BS4B 2G1EA 1DOIA 1VJKA 2PVGC 3HRDD 2WDVB 1FRDA 2WU2B
chains in the Genus database with same CATH superfamily
2REXA 3NHEB 2MLBA 5FK9C 2CS4A 3NZSA 3PZ8A 4MH0E 1Q0WB 3EFCA 3Q8EA 1EF5A 3UI3A 3RNEC 2UYZB 2KQSA 2LVPA 4ZHOA 3M95A 1AW7A 2QHOA 1SF0A 1QOAA 1P7EA 3KWLA 2HTHA 1I4RA 4EE2A 2KYWA 5CHWA 4YTPB 2KX0A 3VRBB 1FO4A 3AULA 4A55A 1UBIA 4MDKE 1K53A 1N5WA 1T0QC 2G4SA 4KZ0A 1SE4A 4BBNC 4JLCA 2O6VA 4BKTA 3KH0A 1M94A 1DYQA 3ZQ4A 3X23A 4HPPA 4HLEA 1NDDA 4RGOS 3Q8BA 2W82A 1RWSA 4PT5A 3T8MA 2KDFB 4WJPA 1I7HA 1L5PA 1WXVA 2R2OA 3IHPC 2KJRA 1Q10A 2RMMA 2RGFA 5HHDG 3Q8AA 2CU3A 2KXJA 2WQYB 2KLCA 2FUG1 3ZXRA 2IJ0A 1EM7A 4RH6A 3C8YA 1EF1A 4JWSC 1JCKB 4K7WA 1N62A 2WHIA 2QSDA 4GDKA 3X0WA 4G0NB 4II3B 4CHKA 3V3XA 3ZYYX 5GMVA 3PRZA 2RSUA 2LI5A 2BS4B 1DOIA 3PZDA 3SFDB 4KV2A 1V5OA 2LUMA 2Z0EB 2C7MB 1IP9A 2QCZA 3AB5A 3T9LA 3MJWA 4M8NA 2WXNA 3UINB 5LLIA 3TIXA 2MRPA 2AYOB 1L7YA 5MPOA 5L83A 2BB5A 1SB3C 3ZXVA 3M62B 3IVFA 3PVLA 4B95A 1LXDA 4KGSA 2D07B 2WXGA 1V9JA 1V5TA 1FMAD 2EKEC 3DDCB 1ISNA 2WXRA 2D3BA 2G9HD 5IKCM 1EU3A 4GXBA 3L13A 3WAPA 3S2AA 3AE3B 4IOIE 2J0KA 3BVMA 1HTQA 3V6CB 4YTMB 2PEAA 3OJ3A 1BT0A 4W9JA 1FCLA 1OEYJ 3V62A 2K3UA 1E10A 4MGKE 1QF6A 5C3JB 2LJIA 4EZLA 1GG3A 2UWQA 3T3NA 1ZUD2 3CSTA 3ZUNA 3V6EB 1F52A 2KK8A 1S3SG 1FRRA 1HEZE 4TSSA 2KANA 2JQRB 1WX9A 1PDXA 3V60A 2KNBA 1E7PB 4REZA 2WXKA 2BBCA 2MWSB 4EEWA 5JHBA 3ONSA 2K6QA 3AECB 3BYTB 3U4EG 1R4NI 4KDIC 4P16A 3L10B 3P4SB 3ZRFA 4JIOU 3KUZA 1WXAA 2NS5A 1F0ZA 4K81A 4MJSB 4N6EB 1H8CA 3DHGC 3FC4A 3R7RA 1WWTA 2BB6A 1FPYA 4RNAA 1T6BX 1WJNA 1TZ1A 4G3XB 1WE7A 1F1HA 2ZEQA 3ZJVA 2LVQA 2WDTB 3B08A 2LJ5A 1TS4A 1R4NB 4USAA 4PS7A 3RNGC 3EGRA 4A3PA 1YNTE 1D4BA 2M8SA 1T0YA 1YQ3B 2WNMA 3DBLB 5AZGA 1FFVA 3OJ4B 2Y5CA 3VH3B 5EE3A 4L2YA 4N9F4 1H4RA 3NY5A 4XX5A 4NZLB 4R3DA 4BKSA 2FNJB 1N61A 3VR9B 2N9EB 3RN9C 1D5ZC 3MC8A 3P4RB 1J7CA 1ZXIA 4PS8A 1C1YB 3RI7C 2GB1A 3QAQA 1XEEA 3JVZX 3U2SC 2KDMA 2GRIA 2LVOA 2DAJA 4XE0A 3VUWA 2LGIA 3W5UB 4ZHPA 3SR6A 3ETRA 1D3ZA 4A90A 4XZ4A 4K7UA 2W3RA 2CJNA 3Q3MC 1WGHA 2PW9A 2UU7A 2KFKB 1V86A 3PHXB 2MBHA 2D5GA 4XWWA 1KH0A 2L00B 3DPDA 5JH5C 3T3OA 2XK5B 3HVZA 2GBMA 2KQ7A 5HI1A 1YQBA 4N59A 4XWTA 5E6OA 2N9KA 1GUAB 1IPGA 2JZZA 2K39A 2PJHA 4LLGM 2KMCA 5E6JA 4RGMA 3R2IA 1C79A 4FHJA 4MJSA 3B2GA 1FIQA 4KZCA 3R66C 4CO7A 4TKNA 3N3KB 4ANWA 2ZZPB 3PZ7A 5DCNA 3BVGA 1SSNA 3KQ4A 4M02A 5IP4D 1GC6A 2MBEA 1FNWA 4C4VB 2WXFA 3I57A 1ET9A 3AE8B 1I4XA 4CQNA 3ZNHB 1QKZA 2IBIB 1KFYB 2JZ3B 2MCNB 1ZKHA 1NVID 4LJPB 1L0XB 2AQ2B 2V4IB 3NOBA 2KTFA 2R61A 1QILA 1GJZA 3A9JB 3UQAA 1UWMA 1B1ZA 3RNBC 1XCTL 4YXDB 3DBHB 4KGTA 2ZCBA 5AZHA 3TJPA 2Y5PA 2KHWB 2MW5A 4BZAA 2IGHA 1OQQA 2WGSA 4KIKA 1J0GA 4JWUC 1P1AA 3BK1A 4GDLA 4FBJB 4NQKE 4DHJB 4LK0M 2WU2B 4WWNA 1WIAA 3TEZA 1TT5B 2VZKB 4NQLB 4A3OA 4EKUA 4AP4C 4BKGA 4P1CC 4DQOC 2BS2B 4OZAA 2NMQA 3ZRCA 2BS3B 2NR2A 4P7IA 4PS3A 5JHAA 4FA6A 1I42A 2MBOA 3KYDD 2AL6A 2KMAA 2AX5A 5JZEB 4FXCA 3KLSX 1C4PA 1V1PB 3N9YC 3LDZE 1SEBD 2V9HA 1C76A 2ZPNA 3J9CA 4CYEA 5J2RA 1WSPA 4W9LA 2BWES 1XLPA 3TL5A 2K5PA 2KWCA 1FEHA 3DWGC 4YL8A 2GMIC 2NCNA 4AJWA 3NRZA 3NS1A 1NYRA 2MH7A 2V3PA 4GB9A 3LYYA 4ARCA 3FKYA 1EWYC 3MC9A 4HXDA 4J6IA 2LD9A 1OFFA 4RF1A 1TGZB 1E8ZA 3EC8A 1P0RA 1ZPSA 2D3CA 3NZUA 4XYCA 1D5MC 1T5XD 1FM0D 1WRDB 1CQVA 1EO6A 2DYBA 2FBWB 1WM2A 4I6PA 2M0AA 4DWFA 3PV1A 3BIID 2JX5A 3QWZB 4G11A 2KJHB 2FCQA 4E71A 3AEAB 4M01A 5I4DA 3C0RB 2L0TA 5C1ZA 2G3QB 2FCSA 1L2NA 3CSFA 2EMTA 4MT5A 2L76A 4ZRPA 2WXLA 4NAWA 1YMHE 2C9WB 1NENB 4C00A 4MELA 3E9SA 3WANA 3DQVA 1V1PA 4K3CA 4I6NB 2IZVB 3RT3B 2K8CA 5IN7A 4WAAA 3A9KB 3P63A 3AV8A 4HDOA 3AE1B 3QARA 4YTNB 2MHJA 4KSKC 1TY0A 4FULA 1KLVA 2JYEA 1PFDA 1WGGA 1E8WA 1IYFA 3RYTA 3W9CB 3DHIC 3ZDMC 1N5XA 1J8CA 4GU2A 3N20C 4JL9A 3SDLC 2QMTA 1FXAA 4GDKB 2DYMA 2BW2A 4OZBA 2PLPA 1R4MI 4XDCA 1CK1A 4C56C 4LNKA 3BINA 1QLBB 1M4VA 3FAHA 4W9KA 3IFWB 1E0ZA 2LZ6A 2HJ8A 4GMVA 1K51A 4AOFA 3AE4B 1SJHD 2M19A 3OAWA 4LTUA 3VTWA 2AQ1B 1YN4A 1TY2A 2WXPA 3IT4B 4C4VA 1EWCA 2BF8B 2WXHA 4DBGA 1WR6E 2KMMA 4MGYE 4J3OD 3GE8C 3QX1A 3RMKC 3PO0A 5CHFA 4E74A 1HA5A 1WE6A 1NYQA 4AJYB 2N9LA 3RZWC 5BMHA 2GBNA 2LUEA 3A33B 3UGBB 3HVDA 4ZRQA 1STEA 3ZVVA 4IDIA 2L52A 3RPFC 4AS1A 1VD2A 2OOBB 2CR5A 1D6EC 3DHHC 1TKYA 1NBFC 1T3QA 5E6NA 4ANUA 1SIJA 4S17A 3NVVA 3KYCD 1E8YA 1LGRA 2IY0B 4LNOA 3CIRB 4JPSA 1RFKA 3ZJUA 4G50A 2NTSA 1UGMA 2GBJA 1WZ0A 2K1FA 2X8XX 1Y56A 2KFKA 2MJ3A 3TMPB 3TCAA 2G4DB 1JMLA 4NJ6A 3TEWA 1F2RI 1C4CA 3ZNID 1GAQB 1BXTA 5BMIA 2I2YA 4XDDA 1OQYA 2INPE 4DXAB 4IWOA 4NAMA 2MP2A 1AN8A 1SE3A 5HFYA 2KVZA 5KHOA 1PQSA 3GOEA 4LNNA 4M0WB 1TS5A 4GIVA 3H7PA 1JW9D 2DZMA 4TMAB 2I38A 3CWIA 1WYWB 3VTUA 1J7AA 2HTME 1XO3A 3AM9A 2JRIB 1YN5A 1ACCA 2FUHB 5CX3A 3N1XC 1RRBA 3APDA 4NJ7A 3Q8CA 3VH4B 2JZPA 2YEPB 3PT2B 1E9MA 3DBLI 4OW0A 4RGTA 5FR6A 2ONQA 1TJEA 2J0JA 1RFAA 2ICIA 4OHJA 2TSSA 2KKCA 4PYUA 3IBEA 4NAWB 2M4NA 3ZGZA 1IGDA 5AEKB 1XQQA 4FHKA 2QC8A 1UUPA 2L32A 1XLNA 4HCPB 1FXIA 5J17A 2WDQB 4W9DA 2LFIA 1E5WA 2M1MA 2OJWA 2WP9B 4KX6B 2MBBB 3KW5B 1QZEA 1L0VB 2ZVNA 3BK2A 4WQOB 5AZFA 4BBNF 1F77A 1PGXA 1R7SA 2DNFA 5LXIB 4JX1C 4YSYB 2D10A 2RPVA 4XC2A 5BYRA 2N1WA 3EECA 4DDID 3SEBA 2OHFA 1WXSA 4ANXA 3ENEA 1AYFA 2MA9B 4ZRJA 3P4PB 1XXGA 2YEPF 2NVUI 2ACZB 1FCCC 1S1QB 4IM2A 2N7JA 2GI9A 2K8HA 4MM3B 4A9AA 4NPNA 2J42A 4EZJA 3M63B 2BKFA 2J0MA 3W5VB 5KHQA 3JSVB 3DVGY 1AWDA 1C78A 3MP9A 3AE6B 3Q2AC 3DBSA 1FNUA 1HZ5A 1C3TA 2H89B 4WJQA 5TR5A 4MSQB 3UIPB 3GP7A 1WR1A 1UNSA 2PIAA 3APFA 1WXQA 2JWUA 2WX0A 1D5XC 4YSZB 2BYEA 1WMHB 2AL3A 1HZ6A 4A6QA 2VZKD 3W1YA 2K9XA 3PRPB 4C7YA 3PTFC 4BFRA 1ESFA 5IOIA 3RNAC 1K52A 4OVUA 4WAFA 4TUUA 4W9CA 2D2QA 3VVWB 2LASA 2MQJA 1I4PA 2KD0A 3P4QB 3PGEA 4MM3A 2KAJA 5AUIA 3GZNB 2FCNA 2E3TA 2PMVA 2ZNVC 2DX5B 3WCQA 3Q3FA 4F7ZA 2GBKA 3H7PB 1GOZA 3ZW3A 1I4HA 2KDEB 1JQ4A 1P3QU 2INNE 2INDC 5LNK1 1UD7A 2DENB 1N6ZA 1GB1A 4IWQA 3OLMD 1WY8A 2Z8LA 1I4GA 2I1KA 5G2NA 4DHZB 3KWVA 1SJED 1QOBA 1YD8U 2YLMA 1E90A 1TIFA 1LQBA 1FNVA 1MHXA 2WX1A 4HRSA 2LGXA 1ZP0B 2DBYA 2KLGA 3AE5B 1V8CA 4FN2A 1GB4A 3UF8A 4AWJA 4E3CA 2V3SA 2CHWA 3L16A 1GC7A 3SFEB 3ZLZA 2CJOA 4EOYA 1V49A 2DYOA 4JGHB 2KFJA 2L0FA 2KJ6A 2G45B 1WM3A 3CMMB 3N1YC 3U52E 5D94A 4GN1A 2O2VB 3GZNI 1IBXB 4GOCA 2PVGC 2WDVB 2MX2A 3APCA 2WYQA 1Y8RC 1FXTB 3O65B 4L23A 5G5GA 3ZJTA 4IM0A 1YN3A 2FCMA 2LMCA 4RM9A 3WIMA 3W1SA 1WX8A 1E7VA 4IG7B 1WGKA 1WZ3A 3AH7A 3CF6E 3KVFB 4FADA 4YSXB 1WI0A 3NVZA 1ZDXA 3QC8B 3R3MA 1MJDA 2GLSA 2JF5A 1QOFA 4RF0A 2BPSA 2Z59B 3B0AA 2DZJA 2CKHB 2K8BA 5FKAC 4GSWA 3LB8C 3U7ZA 4LDTD 5G55A 1K8RB 4YWGG 2N4FA 3AEEB 2HDEA 1I35A 2M17A 3QQ8B 2PTLA 3U30A 1MVKA 2JT4B 2V4LA 1Z5SB 1E6EB 4ZOHC 3W2DA 3QK0A 1ZOYB 4HKZE 1VCBA 2EKIA 3B2FA 4NY0A 3NUHB 3BY4B 3IT6B 4ANVA 4ZRIA 3SD5A 2KZRA 3L08A 3VR8B 3FILA 5IA7A 4ICUA 3OG5A 3I63C 3Q14C 2J7QB 3V61A 1SXTA 2WXOA 4S0RA 4W9FA 5C2TB 3N32A 1L6UA 2RDHA 2KN5A 1ZGUB 4KSLC 1TYGB 1JWUD 2LGYA 3A1QB 1MHHE 3B1LX 3VXWA 2ZCCA 3D32A 1VJKA 1NEKB 1WJUA 4OVVA 3BWUD 1HQRD 2KWVB 2DWQA 5L95C 1CZPA 1P9DU 2ZPYA 1YJJA 1N63A 2Y3AA 1E7UA 3W1SC 1UF0A 1YX6B 1JROA 5CHVC 2KDIA 3RUIB 4JE3B 2CHZA 2RDBC 1WX7A 1ET6A 2B76B 2K6DB 4MEMA 3PSEB 3AEGB 2JU6X 4PYZA 1FD6A 5BMGA 1A5RA 2N0SB 2KWDA 3I9V1 1SGHA 2D3AA 3ZDTA 1C77A 2OJRA 3AE9B 2J53A 1SBBB 2KC2A 4A8XC 4HCNB 2DZKA 4JQWC 2DLBA 2K0PA 2A5UA 3GE3C 1TBEA 1V81A 2MSED 5EE1A 2IGGA 3LJ3A 1PGBA 1EU4A 3QJZA 1TS3A 2KOXA 4ZYNA 1DOXA 1C9FA 2BYTA 1TKGA 4US9A 2IDYA 2VH1A 4FJYA 4BAXA 4KVGB 4MACA 1ZW7A 2N1VA 3HIZA 2JSVX 3MJ5A 2D3GA 1XLQA 1C4AA 3H7SA 1CJEA 3ZTCA 2KX3A 2KACA 4IC7B 2YVCA 1TKEA 2C7NB 5BYSA 2PPHA 3A9KA 3WAMA 2D11A 1EUVB 3DCGA 2PVOD 1FRDA 2A4ZA 2BWFA 4DDGD 3PPAA 3A4RA 5CTRC 1JWAD 3IXSA 1V6EA 2LGSA 3SU8X 4B6WA 4HEA1 3ABVB 1J7BA 3DBRB 2NBVB 2W9NA 3VDZA 2JVCA 1VRAB 3JSVA 4P1BC 2WXJA 3ZO5B 2BT6A 4D2KA 2J4XA 1N60A 4WWPA 3A9JA 1V97A 1DGJA 3A1QA 2ZJDA 2EELA 3BYYB 3QCAA 2SAKA 2BKRB 1X1MA 3I3TB 2HD5B 2FIFA 3RCZA 1YJIA 2KQ4X 1BUIC 3WALA 1NI3A 3AU4A 2K25A 5GXGB 1RM6C 1T0SC 4DK5A 3K9OB 2ASQA 1WYGA 2O6VB 3R2TA 4M0WA 4B0MA 3NG0A 2GBRA 3PS6A 3MC0B 4WURA 1OQRA 2MP2B 4HWIB 4KGRA 5E6PA 1IUEA 3N30A 1PGAA 3ZNGC 1SIFA 4B9KA 4EFOA 2IO3B 2LRUA 2ZVOA 1MG4A 1ZE3D 4BOSC 1CMXB 3Q3NC 3ZNZB 4LNIA 5EE9A 3JYUA 1YOVB 1VZ7A 2V3NA 2LXCA 1WH3A 3BZDB 3P42A 3R8BA 3PREA 4AUQC 4K1RB 1JWBD 2GOWA 2C7HA 1YX5B 3WA0A 2IYDB 3QA8A 2Z0DB 3OWEB 2LWPA 2IPKD 3RD2A 3TEYA 3K9PB 3PLUA 2JYTA 1KRHA 2NBUA 5BYQA 3GB1A 4KIKB 1GNUA 1ROEA 5HKHA 4C80A 4LDTB 1Q1OA 1UBQA 2NPTB 2CU1A 1WJ4A 1T0RC 3UQBA 3PRMB 1VZ6A 3Q6BA 5EDSA 1IBXA 2O2VA 3IG3A 1F9JA 3O13A 3HM6X 4C7ZA 2WS3B 4YT0B 4HVBA 2BYVE 1J19A 4RGNA 4W9GA 3RZFA 4HK2A 5D7GA 4ACFA 3KUCB 3AE7B 3P2BA 4WJOA 3ML8A 4ARIA 2IO2B 4RMAA 4MH8A 4AQ7A 3IAS1 4IUMB 5TSSA 4W9HA 3DBRI 3HUIA 2W54A 1HXYD 3ECIA 3H6NA 3HK0A 2BTEA 4TV3A 2V0GA 3AEBB 4K7SA 5DPWA 2FE8A 1VDVA 2OEDA 4FJVB 1B9RA 2KN4A 4US8A 3MHSD 3UIOB 4GGQA 2N7DA 2C60A 3QIJA 3ZTDA 1TS2A 4LCDE 2VH2A 4GLSC 1JRPA 3A4SC 5AUKA 2H88B 3L17A 1KM7A 2MJEA 2JPHA 5EE0A 1YQ4B 3P1MA 5HG2A 1JWMD 2I1JA 2QEJC 3AE2B 1SE2A 3HM3A 1V1OA 4B0EA 1AARA 4NNJB 2XK5A 3HRDD 4OZCA 2HJ1A 4LJOB 1HE8A 2C5LC 4LNFA 1UH6A 4WH4A 3RULA 1HTOA 1KTKA 4UDUC 2JXTA 4O1NA 3Q3OC 4X57B 5JXVA 4WIPA 3H1UA 2ON8A 2QJLA 4TQ1A 3DBHI 3VQIA 3PHWB 4FJZA 1L4ZB 1SE9A 4K3BA 1IGCA 1F2RC 5DPSA 2N9PC 3U8ZA 3VFKA 2FIDA 2LEKA 2W3SA 4WQMA 3QHTA 2L1AA 1TZOA 1WGDA 2RD0A 2KDBA 2WXMA 2ZNVB 3ALBA 3TUOA 3C19A 3NS8A 2DHZA 2WXQA 3NJTA 4EZKA 4W9EA 2WXIA 4DHJD 3DVNV 2ZW1A 2DAFA 4N58A 3AEFB 1JWSD 2PE6B 3AXCA 2XEWA 3AMZA 3RFZB 4DXFA 1XD3B 2VRRB 4WJNA 5DPTA 4PK1A 4KKJA 4ITKA 3DVGX 1MPEA 1Q5WB 1WJ6A 2QDFA 1UWXA 4KDLB 2WLBA 2V1YA 5T8IA 2Y5BB 1ZDVA 3VAWA 1VLBA 2L8JA 3DVNU 1Z2MA 1KOTA 3ZKJC 3Q3JA 3ML9A 3VTVA 3AI5A 4M00A 4DHZE 4QAYA 4TQ0A 4MGIE 4NJCA 2KT7A 2L3ZA 2NBWB 4IM3A 2RR9A 4H2AA 1RLFA 4ASWC 4HPLB 3VUXA 2L83A 5IO9A 2IY1B 2JXXA 4BKSD 3Q69A 4MGZE 3AN1A 4F8CB 1RAXA 3MHZA 1RYJA 2XNAC 3NVWA 3TBLD 3RNFC 3VUYA 1WRIA 2AQ3B 1WMHA 1LFDA 2KWUB 1YIWA 1L6VA 2IGDA 2WWZA 4L1BA 1UELA 2LHDA 1V80A 1L0YB 4HDQA 3N1ZC 2E6XA 1P7FA 4EUTA 1DOYA 1E8XA 2XN9C 3L4PA 4MSMB 3R7QA 2X38A 1LM8B 2M56B 4RCOA 2EMSA 3I5JC 1U4AA 1V2YA 4P6VF 4URKA 4A20A 4IWPA 1OTRB 1XLOA 3NVYA 3AU5A 1KLGD 1R4MB 4M8MA 2JUOA 2KO3A 3DOWA 5G5HA 3DWMA 2HE7A 3MTNB 4Q2JA 4ZYSA 2KC1A 3EFUA 5C23A 3U7DA 1WGYA 1PUTA 3IAM1 3EA6A 2K22A 2L7RA 1QT9A 2LRWA 2L05A 3TSSA 4WWMA 1GPXA 5D2MB 1XT9B 3B9JA 3H9DA 4W9IA 5D6JB 2O6VD 2J52A 4HPMB 5BO4B 2ZW0A 2BGFA 2QIEB 1ZXHA 2BVCA 1VR9A 2KVRA 1NI2A 5LXHA 3VHTC 1OEYA 2M0XA 2MEKA 1ENFA 2AEHA 4II2B 2CHXA 2LXAA 5D3DA 2XBBC 4IKGA 1L4DB 2W55A 4HROA 2AWTA 2LHEA 2JRHA 1JALA 3E56A 1MFWA 1QQRA 4BVUC 3LXFA 2LGDA 3GS2A 2SEBD 4ZDVA 2IO1B 1A70A 3M3JA 1I4QA 3AEDB 3WAOA 1WF9A 4GDLB 2PE9A 2PKOA 1WFYA 3ZIMA 3VRAB 5J18A 3KUDB 2INCC 1G6JA 1LO5D 1KLUD 1XF5L 2JWZA 4OVZA 5FR3A 1P98A 3V05A 2JY6A 3MFGA 3URYA 3EHVA 1KF6B 4HJKA 1FFUA 4ZRKA 1WGRA 2N7EA 4KKIA 2DZIA 5H92C 4WWOA 5H8YE 1OGWA 2FAZA 2BYFA 2RPQA 1QOGA 2NTTA 2KTRA 3L54A 5IAAC 1YJ1A 1BMLC 2IO0B 3FILB 3NZ3A 2WDRB 1TTNA 1VZ8A 2BQQA 1JRUA 3Q8FA 4DXGA 2Q5WD 1WXMA 4XGAB 4RFBA 3H8HA 3L0WB 2KTRB 1PYWD 1KJTA 2MBQA 3RNCC 3HHMA 2MJDA 1UGJA 3BVZA 2QILA 5D3IB 4RM8A 1XCQL 4FLHA 3JW0X 1MI0A 5DPRA 4F1SA 2RDGA 1MG8A 2R2QA 1K50A 2WU5B 2NPTA 4ICVA 4BOZB 4HKQA 2N9XA 3SHQA 2B3AA 3PLVA 1UZXB 3EUB2 4I6LB 2G1EA 4IW0A 3TEXA 4HJGE
chains in the Genus database with same CATH topology
2H89B 5FK9C 3GP7A 3TEZA 2VZKB 1UNSA 2PIAA 3PZ8A 3OWEB 3Q8EA 1WXQA 2IPKD 2JWUA 3UI3A 1D5XC 3TEYA 4DQOC 4YSZB 2BS2B 1HZ6A 4OZAA 2JYTA 1KRHA 4ZHOA 2NMQA 1AW7A 4A6QA 2BS3B 2VZKD 5BYQA 2K9XA 1SF0A 3GB1A 4C7YA 1ROEA 1QOAA 1ESFA 1P7EA 4C80A 1K52A 2AX5A 4WAFA 4FXCA 3KWLA 3KLSX 1I4RA 1C4PA 1V1PB 4EE2A 1I4PA 3P4QB 1VZ6A 3N9YC 4YTPB 1IBXA 3VRBB 1SEBD 1FO4A 2KAJA 1C76A 5AUIA 3J9CA 4A55A 1WSPA 2E3TA 3O13A 2PMVA 4C7ZA 2WS3B 1XLPA 4YT0B 3WCQA 1K53A 1N5WA 4RGNA 1SE4A 5D7GA 1GOZA 2K5PA 1FEHA 3AE7B 3DWGC 1DYQA 1I4HA 4ARIA 1JQ4A 2INNE 5LNK1 4MH8A 4AQ7A 3IAS1 3ZQ4A 1GB1A 5TSSA 4RGOS 3NRZA 2W82A 2Z8LA 1I4GA 1RWSA 3NS1A 3Q8BA 4PT5A 1NYRA 2MH7A 2V3PA 3KWVA 3LYYA 4ARCA 1EWYC 1SJED 1QOBA 3HUIA 2W54A 1I7HA 1HXYD 1L5PA 1OFFA 4RF1A 1Q10A 2BTEA 1FNVA 1ZPSA 1MHXA 2V0GA 2RMMA 5HHDG 3AEBB 4HRSA 1D5MC 1ZP0B 2FE8A 1VDVA 1T5XD 3Q8AA 2CU3A 2DBYA 1FM0D 2WQYB 2FUG1 3AE5B 2OEDA 1CQVA 1V8CA 2IJ0A 1B9RA 1GB4A 2KN4A 2FBWB 4US8A 1EM7A 4RH6A 3C8YA 2M0AA 3SFEB 4JWSC 3BIID 1JCKB 1TS2A 2CJOA 2JX5A 2DYOA 4GLSC 1JRPA 1N62A 5AUKA 2H88B 3AEAB 5I4DA 2MJEA 2QSDA 5EE0A 4MT5A 1YQ4B 3P1MA 5HG2A 3V3XA 1JWMD 2QEJC 3AE2B 1SE2A 3ZYYX 3U52E 1V1OA 4B0EA 4ZRPA 2WXLA 1YMHE 1NENB 2BS4B 1IBXB 1DOIA 2PVGC 3HRDD 2WDVB 3E9SA 3SFDB 4OZCA 1V1PA 2LUMA 4L23A 3AB5A 5G5GA 3ZJTA 4WH4A 1YN3A 2WXNA 1KTKA 2LMCA 4UDUC 3P63A 3W1SA 3AV8A 5MPOA 3AE1B 1WGKA 2JXTA 4O1NA 2BB5A 5JXVA 3AH7A 4WIPA 4YTNB 1SB3C 2ON8A 4YSXB 2QJLA 3NVZA 1TY0A 4TQ1A 3VQIA 2JYEA 1PFDA 1ZDXA 1L4ZB 4KGSA 2WXGA 1IGCA 1F2RC 3W9CB 1FMAD 2LEKA 2WXRA 1QOFA 1N5XA 2G9HD 2W3SA 4WQMA 4RF0A 1EU3A 2L1AA 1TZOA 3AE3B 4IOIE 2QMTA 1FXAA 3BVMA 2WXMA 3TUOA 4GDKB 5FKAC 3LB8C 2WXQA 3U7ZA 2DYMA 4YTMB 2BW2A 2WXIA 4OZBA 2PLPA 2ZW1A 4YWGG 4N58A 4XDCA 1CK1A 3AEFB 3AEEB 2HDEA 4C56C 1FCLA 1JWSD 1QLBB 1M4VA 2K3UA 2PTLA 3FAHA 1E10A 1MVKA 3AMZA 1QF6A 5C3JB 3RFZB 2LJIA 4DXFA 1E6EB 4ZOHC 1E0ZA 3T3NA 4KKJA 3W2DA 1ZUD2 4ITKA 1MPEA 1ZOYB 4HKZE 2EKIA 1K51A 3AE4B 1SJHD 1UWXA 2M19A 3B2FA 2WLBA 4LTUA 3NUHB 3IT6B 5T8IA 1ZDVA 2AQ1B 1FRRA 1HEZE 1YN4A 1VLBA 4TSSA 1TY2A 2JQRB 3VR8B 3FILA 1PDXA 2WXPA 3IT4B 1E7PB 1EWCA 2WXHA 4REZA 4TQ0A 2WXKA 4NJCA 2BBCA 2KMMA 1SXTA 3AECB 4J3OD 2WXOA 3BYTB 5C2TB 3U4EG 3PO0A 4H2AA 4P16A 1L6UA 2RDHA 1HA5A 1NYQA 1TYGB 1JWUD 2L83A 3P4SB 2N9LA 1MHHE 5BMHA 1VJKA 3Q69A 3AN1A 1NEKB 3HVDA 4ZRQA 1F0ZA 3MHZA 1STEA 3BWUD 1RYJA 1HQRD 4N6EB 3FC4A 2DWQA 2L52A 2XNAC 4IDIA 3RPFC 1CZPA 3NVWA 4AS1A 1WWTA 2BB6A 1D6EC 1TKYA 1YJJA 1N63A 4RNAA 1T6BX 1WRIA 2Y3AA 2AQ3B 3ZJVA 1T3QA 1JROA 1SIJA 1TS4A 1L6VA 2IGDA 3NVVA 4USAA 4JE3B 3EGRA 4L1BA 2LHDA 1YNTE 1D4BA 1ET6A 3CIRB 1L0YB 4JPSA 1RFKA 3ZJUA 2B76B 2NTSA 1YQ3B 2WNMA 2E6XA 3AEGB 1P7FA 1Y56A 2MJ3A 2JU6X 1DOYA 1FFVA 2XN9C 5BMGA 1FD6A 2Y5CA 3L4PA 5EE3A 2N0SB 4L2YA 2X38A 1JMLA 2KWDA 3TEWA 1F2RI 3I9V1 2M56B 1C4CA 4NZLB 4R3DA 4RCOA 1N61A 1C77A 1GAQB 3VR9B 3AE9B 1BXTA 1SBBB 2J53A 5BMIA 4A8XC 2I2YA 4P6VF 4XDDA 2DLBA 1D5ZC 2INPE 2K0PA 1XLOA 4NAMA 3NVYA 1AN8A 1SE3A 1KLGD 3P4RB 5HFYA 1J7CA 1ZXIA 5G5HA 2GB1A 1XEEA 1TS5A 3DWMA 4Q2JA 4ZYSA 3U2SC 2KDMA 5EE1A 2GRIA 2IGGA 1PUTA 3IAM1 1PGBA 1JW9D 1EU4A 3EA6A 4TMAB 1TS3A 2K22A 2I38A 1QT9A 1DOXA 1C9FA 2BYTA 3TSSA 1TKGA 3CWIA 4WWMA 4XE0A 2LGIA 1GPXA 4US9A 3W5UB 4ZHPA 2IDYA 3SR6A 1J7AA 3B9JA 4MACA 3ETRA 2HTME 1XO3A 2JSVX 2J52A 3AM9A 3MJ5A 1YN5A 1ACCA 1XLQA 1C4AA 4A90A 1CJEA 2KACA 2W3RA 2ZW0A 2CJNA 2QIEB 1ZXHA 3Q8CA 2JZPA 2YEPB 2PW9A 1E9MA 4OW0A 1TKEA 4RGTA 1VR9A 2MEKA 1ENFA 5BYSA 2ONQA 1TJEA 5D3DA 4IKGA 2PVOD 1L4DB 1FRDA 2W55A 2D5GA 2ICIA 4OHJA 4HROA 4XWWA 2TSSA 2LHEA 1JALA 3E56A 1KH0A 1JWAD 1QQRA 3IXSA 3T3OA 3HVZA 3LXFA 3GS2A 2SEBD 5HI1A 4N59A 4HEA1 1A70A 4XWTA 1I4QA 3ABVB 1J7BA 2N9KA 3AEDB 4GDLB 4NAWB 2PKOA 3VRAB 1LO5D 3ZGZA 1IGDA 1KLUD 1XF5L 4LLGM 5E6JA 4OVZA 5FR3A 4RGMA 3R2IA 3V05A 1UUPA 1C79A 3MFGA 3URYA 1VRAB 3B2GA 2WXJA 2L32A 1KF6B 2BT6A 4D2KA 1XLNA 1FIQA 1FFUA 1N60A 2J4XA 1FXIA 1V97A 1DGJA 2WDQB 2LFIA 2EELA 4KKIA 2WP9B 3BYYB 4KX6B 5H92C 3PZ7A 5H8YE 2SAKA 3BVGA 1L0VB 1QOGA 1SSNA 3KQ4A 3BK2A 2NTTA 1F77A 1PGXA 1YJIA 1R7SA 1BMLC 1FNWA 2KQ4X 1BUIC 4JX1C 2WXFA 3I57A 4YSYB 3FILB 1ET9A 3NZ3A 1NI3A 2WDRB 2RPVA 3AE8B 5BYRA 1I4XA 5GXGB 4CQNA 1RM6C 1QKZA 1VZ8A 3SEBA 3Q8FA 1KFYB 4DXGA 1WYGA 2OHFA 2Q5WD 4RFBA 3H8HA 3R2TA 1PYWD 4M0WA 4B0MA 1NVID 2MJDA 1AYFA 3P4PB 3MC0B 1XXGA 1L0XB 2YEPF 1UGJA 4WURA 2ACZB 3BVZA 1FCCC 2AQ2B 1OQRA 2QILA 2V4IB 5D3IB 1XCQL 4KGRA 2R61A 1IUEA 1QILA 2N7JA 1PGAA 2GI9A 1MI0A 4MM3B 4A9AA 1UWMA 2J42A 2RDGA 1ZE3D 3W5VB 1B1ZA 1XCTL 4YXDB 4KGTA 5EE9A 1K50A 2WU5B 2Y5PA 1VZ7A 2V3NA 4HKQA 3BZDB 2IGHA 1OQQA 1AWDA 4JWUC 3P42A 3R8BA 1C78A 3BK1A 3MP9A 3AE6B 3EUB2 1JWBD 1FNUA 2G1EA 3TEXA 1HZ5A 4HJGE 4LK0M 2WU2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H89 B;  1NEK B;  1F0Z A;  4HRO A;  4N6E B;  1RYJ A;  1JAL A;  3FC4 A;  2DWQ A;  2L52 A;  2PIA A;  4IDI A;  3RPF C;  1CZP A;  3NVW A;  3AB5 A;  5G5G A;  1WXQ A;  1JWA D;  1WWT A;  3HVZ A;  1TKY A;  3LXF A;  1YJJ A;  1N63 A;  4YSZ B;  2BS2 B;  4N59 A;  1WRI A;  1A70 A;  3P63 A;  1KRH A;  3ABV B;  1J7B A;  3AED B;  4ZHO A;  2PKO A;  1T3Q A;  2BS3 B;  3AV8 A;  3VRA B;  5MPO A;  2K9X A;  3AE1 B;  4HRS A;  1SF0 A;  1JRO A;  1WGK A;  4C7Y A;  1SIJ A;  1ROE A;  3AH7 A;  1L6V A;  1QOA A;  4YTN B;  1SB3 C;  3NVV A;  4USA A;  4YSX B;  2QJL A;  3NVZ A;  4C80 A;  2AX5 A;  4FXC A;  1PFD A;  3B2G A;  3KWL A;  3CIR B;  1RFK A;  3P4Q B;  2B76 B;  1KF6 B;  1YQ3 B;  2BT6 A;  1XLN A;  4YTP B;  1FIQ A;  1FFU A;  1N60 A;  3VRB B;  3AEG B;  1FO4 A;  1FXI A;  1V97 A;  1DGJ A;  2KAJ A;  2WDQ B;  1FMA D;  5AUI A;  2LEK A;  2MJ3 A;  3W9C B;  1DOY A;  1FFV A;  2E3T A;  1QOF A;  1N5X A;  2W3S A;  2Y5C A;  3L4P A;  2WP9 B;  4KX6 B;  4WQM A;  5EE3 A;  2WS3 B;  1XLP A;  2N0S B;  4YT0 B;  5H92 C;  3WCQ A;  4C7Z A;  5H8Y E;  1N5W A;  3AE3 B;  1L0V B;  1QOG A;  1FXA A;  2M56 B;  2K5P A;  3AE7 B;  3DWG C;  3LB8 C;  1N61 A;  1GAQ B;  1YJI A;  1R7S A;  3VR9 B;  4YTM B;  1JQ4 A;  3AE9 B;  4JX1 C;  4P6V F;  4YSY B;  4N58 A;  1NI3 A;  2WDR B;  3AEF B;  3AEE B;  3SFD B;  3AE8 B;  3NRZ A;  1XLO A;  1RWS A;  3NS1 A;  1RM6 C;  3NVY A;  1QLB B;  1NYR A;  2MH7 A;  3FAH A;  3P4R B;  5GXG B;  1J7C A;  1E10 A;  1ZXI A;  1EWY C;  3AMZ A;  1QOB A;  5C3J B;  1QF6 A;  5G5H A;  3HUI A;  2W54 A;  1E6E B;  1I7H A;  1KFY B;  4ZOH C;  1E0Z A;  1WYG A;  1OFF A;  1L5P A;  2OHF A;  2Q5W D;  1ZUD 2;  3DWM A;  4ITK A;  1ZOY B;  2EKI A;  5EE1 A;  3AE4 B;  1PUT A;  3AEB B;  1JW9 D;  1NVI D;  2M19 A;  1AYF A;  2MJD A;  1ZP0 B;  2K22 A;  2WLB A;  1VDV A;  3B2F A;  3P4P B;  4LTU A;  1QT9 A;  2CU3 A;  2DBY A;  1FM0 D;  2WQY B;  1DOX A;  1GPX A;  1TKG A;  2ACZ B;  1V8C A;  3AE5 B;  1FRR A;  1OQR A;  3CWI A;  4WWM A;  4US9 A;  3W5U B;  4ZHP A;  2FBW B;  4US8 A;  1VLB A;  1B9R A;  3SR6 A;  1J7A A;  3B9J A;  1IUE A;  2JQR B;  3VR8 B;  2PVO D;  2HTM E;  3ETR A;  1PDX A;  3SFE B;  1XO3 A;  3BII D;  3AM9 A;  4JWS C;  4A9A A;  1UWM A;  2CJO A;  1XLQ A;  1E7P B;  2JX5 A;  1JRP A;  1CJE A;  1N62 A;  5AUK A;  2H88 B;  3W5V B;  3AEA B;  4YXD B;  2KMM A;  2W3R A;  2CJN A;  2MJE A;  5EE9 A;  2QIE B;  2WU5 B;  3AEC B;  5EE0 A;  5C2T B;  3PO0 A;  1L6U A;  1YQ4 B;  3P1M A;  1E9M A;  1OQQ A;  1TKE A;  1AWD A;  1NYQ A;  3AE2 B;  3ZYY X;  4JWU C;  1TYG B;  3AN1 A;  2L83 A;  3P4S B;  3AE6 B;  1TJE A;  2W55 A;  3EUB 2;  1JWB D;  1NEN B;  2BS4 B;  2G1E A;  1DOI A;  1VJK A;  2PVG C;  3HRD D;  2WDV B;  1FRD A;  2WU2 B; 
#chains in the Genus database with same CATH topology
 2REX A;  3NHE B;  2MLB A;  5FK9 C;  2CS4 A;  3NZS A;  3PZ8 A;  4MH0 E;  1Q0W B;  3EFC A;  3Q8E A;  1EF5 A;  3UI3 A;  3RNE C;  2UYZ B;  2KQS A;  2LVP A;  4ZHO A;  3M95 A;  1AW7 A;  2QHO A;  1SF0 A;  1QOA A;  1P7E A;  3KWL A;  2HTH A;  1I4R A;  4EE2 A;  2KYW A;  5CHW A;  4YTP B;  2KX0 A;  3VRB B;  1FO4 A;  3AUL A;  4A55 A;  1UBI A;  4MDK E;  1K53 A;  1N5W A;  1T0Q C;  2G4S A;  4KZ0 A;  1SE4 A;  4BBN C;  4JLC A;  2O6V A;  4BKT A;  3KH0 A;  1M94 A;  1DYQ A;  3ZQ4 A;  3X23 A;  4HPP A;  4HLE A;  1NDD A;  4RGO S;  3Q8B A;  2W82 A;  1RWS A;  4PT5 A;  3T8M A;  2KDF B;  4WJP A;  1I7H A;  1L5P A;  1WXV A;  2R2O A;  3IHP C;  2KJR A;  1Q10 A;  2RMM A;  2RGF A;  5HHD G;  3Q8A A;  2CU3 A;  2KXJ A;  2WQY B;  2KLC A;  2FUG 1;  3ZXR A;  2IJ0 A;  1EM7 A;  4RH6 A;  3C8Y A;  1EF1 A;  4JWS C;  1JCK B;  4K7W A;  1N62 A;  2WHI A;  2QSD A;  4GDK A;  3X0W A;  4G0N B;  4II3 B;  4CHK A;  3V3X A;  3ZYY X;  5GMV A;  3PRZ A;  2RSU A;  2LI5 A;  2BS4 B;  1DOI A;  3PZD A;  3SFD B;  4KV2 A;  1V5O A;  2LUM A;  2Z0E B;  2C7M B;  1IP9 A;  2QCZ A;  3AB5 A;  3T9L A;  3MJW A;  4M8N A;  2WXN A;  3UIN B;  5LLI A;  3TIX A;  2MRP A;  2AYO B;  1L7Y A;  5MPO A;  5L83 A;  2BB5 A;  1SB3 C;  3ZXV A;  3M62 B;  3IVF A;  3PVL A;  4B95 A;  1LXD A;  4KGS A;  2D07 B;  2WXG A;  1V9J A;  1V5T A;  1FMA D;  2EKE C;  3DDC B;  1ISN A;  2WXR A;  2D3B A;  2G9H D;  5IKC M;  1EU3 A;  4GXB A;  3L13 A;  3WAP A;  3S2A A;  3AE3 B;  4IOI E;  2J0K A;  3BVM A;  1HTQ A;  3V6C B;  4YTM B;  2PEA A;  3OJ3 A;  1BT0 A;  4W9J A;  1FCL A;  1OEY J;  3V62 A;  2K3U A;  1E10 A;  4MGK E;  1QF6 A;  5C3J B;  2LJI A;  4EZL A;  1GG3 A;  2UWQ A;  3T3N A;  1ZUD 2;  3CST A;  3ZUN A;  3V6E B;  1F52 A;  2KK8 A;  1S3S G;  1FRR A;  1HEZ E;  4TSS A;  2KAN A;  2JQR B;  1WX9 A;  1PDX A;  3V60 A;  2KNB A;  1E7P B;  4REZ A;  2WXK A;  2BBC A;  2MWS B;  4EEW A;  5JHB A;  3ONS A;  2K6Q A;  3AEC B;  3BYT B;  3U4E G;  1R4N I;  4KDI C;  4P16 A;  3L10 B;  3P4S B;  3ZRF A;  4JIO U;  3KUZ A;  1WXA A;  2NS5 A;  1F0Z A;  4K81 A;  4MJS B;  4N6E B;  1H8C A;  3DHG C;  3FC4 A;  3R7R A;  1WWT A;  2BB6 A;  1FPY A;  4RNA A;  1T6B X;  1WJN A;  1TZ1 A;  4G3X B;  1WE7 A;  1F1H A;  2ZEQ A;  3ZJV A;  2LVQ A;  2WDT B;  3B08 A;  2LJ5 A;  1TS4 A;  1R4N B;  4USA A;  4PS7 A;  3RNG C;  3EGR A;  4A3P A;  1YNT E;  1D4B A;  2M8S A;  1T0Y A;  1YQ3 B;  2WNM A;  3DBL B;  5AZG A;  1FFV A;  3OJ4 B;  2Y5C A;  3VH3 B;  5EE3 A;  4L2Y A;  4N9F 4;  1H4R A;  3NY5 A;  4XX5 A;  4NZL B;  4R3D A;  4BKS A;  2FNJ B;  1N61 A;  3VR9 B;  2N9E B;  3RN9 C;  1D5Z C;  3MC8 A;  3P4R B;  1J7C A;  1ZXI A;  4PS8 A;  1C1Y B;  3RI7 C;  2GB1 A;  3QAQ A;  1XEE A;  3JVZ X;  3U2S C;  2KDM A;  2GRI A;  2LVO A;  2DAJ A;  4XE0 A;  3VUW A;  2LGI A;  3W5U B;  4ZHP A;  3SR6 A;  3ETR A;  1D3Z A;  4A90 A;  4XZ4 A;  4K7U A;  2W3R A;  2CJN A;  3Q3M C;  1WGH A;  2PW9 A;  2UU7 A;  2KFK B;  1V86 A;  3PHX B;  2MBH A;  2D5G A;  4XWW A;  1KH0 A;  2L00 B;  3DPD A;  5JH5 C;  3T3O A;  2XK5 B;  3HVZ A;  2GBM A;  2KQ7 A;  5HI1 A;  1YQB A;  4N59 A;  4XWT A;  5E6O A;  2N9K A;  1GUA B;  1IPG A;  2JZZ A;  2K39 A;  2PJH A;  4LLG M;  2KMC A;  5E6J A;  4RGM A;  3R2I A;  1C79 A;  4FHJ A;  4MJS A;  3B2G A;  1FIQ A;  4KZC A;  3R66 C;  4CO7 A;  4TKN A;  3N3K B;  4ANW A;  2ZZP B;  3PZ7 A;  5DCN A;  3BVG A;  1SSN A;  3KQ4 A;  4M02 A;  5IP4 D;  1GC6 A;  2MBE A;  1FNW A;  4C4V B;  2WXF A;  3I57 A;  1ET9 A;  3AE8 B;  1I4X A;  4CQN A;  3ZNH B;  1QKZ A;  2IBI B;  1KFY B;  2JZ3 B;  2MCN B;  1ZKH A;  1NVI D;  4LJP B;  1L0X B;  2AQ2 B;  2V4I B;  3NOB A;  2KTF A;  2R61 A;  1QIL A;  1GJZ A;  3A9J B;  3UQA A;  1UWM A;  1B1Z A;  3RNB C;  1XCT L;  4YXD B;  3DBH B;  4KGT A;  2ZCB A;  5AZH A;  3TJP A;  2Y5P A;  2KHW B;  2MW5 A;  4BZA A;  2IGH A;  1OQQ A;  2WGS A;  4KIK A;  1J0G A;  4JWU C;  1P1A A;  3BK1 A;  4GDL A;  4FBJ B;  4NQK E;  4DHJ B;  4LK0 M;  2WU2 B;  4WWN A;  1WIA A;  3TEZ A;  1TT5 B;  2VZK B;  4NQL B;  4A3O A;  4EKU A;  4AP4 C;  4BKG A;  4P1C C;  4DQO C;  2BS2 B;  4OZA A;  2NMQ A;  3ZRC A;  2BS3 B;  2NR2 A;  4P7I A;  4PS3 A;  5JHA A;  4FA6 A;  1I42 A;  2MBO A;  3KYD D;  2AL6 A;  2KMA A;  2AX5 A;  5JZE B;  4FXC A;  3KLS X;  1C4P A;  1V1P B;  3N9Y C;  3LDZ E;  1SEB D;  2V9H A;  1C76 A;  2ZPN A;  3J9C A;  4CYE A;  5J2R A;  1WSP A;  4W9L A;  2BWE S;  1XLP A;  3TL5 A;  2K5P A;  2KWC A;  1FEH A;  3DWG C;  4YL8 A;  2GMI C;  2NCN A;  4AJW A;  3NRZ A;  3NS1 A;  1NYR A;  2MH7 A;  2V3P A;  4GB9 A;  3LYY A;  4ARC A;  3FKY A;  1EWY C;  3MC9 A;  4HXD A;  4J6I A;  2LD9 A;  1OFF A;  4RF1 A;  1TGZ B;  1E8Z A;  3EC8 A;  1P0R A;  1ZPS A;  2D3C A;  3NZU A;  4XYC A;  1D5M C;  1T5X D;  1FM0 D;  1WRD B;  1CQV A;  1EO6 A;  2DYB A;  2FBW B;  1WM2 A;  4I6P A;  2M0A A;  4DWF A;  3PV1 A;  3BII D;  2JX5 A;  3QWZ B;  4G11 A;  2KJH B;  2FCQ A;  4E71 A;  3AEA B;  4M01 A;  5I4D A;  3C0R B;  2L0T A;  5C1Z A;  2G3Q B;  2FCS A;  1L2N A;  3CSF A;  2EMT A;  4MT5 A;  2L76 A;  4ZRP A;  2WXL A;  4NAW A;  1YMH E;  2C9W B;  1NEN B;  4C00 A;  4MEL A;  3E9S A;  3WAN A;  3DQV A;  1V1P A;  4K3C A;  4I6N B;  2IZV B;  3RT3 B;  2K8C A;  5IN7 A;  4WAA A;  3A9K B;  3P63 A;  3AV8 A;  4HDO A;  3AE1 B;  3QAR A;  4YTN B;  2MHJ A;  4KSK C;  1TY0 A;  4FUL A;  1KLV A;  2JYE A;  1PFD A;  1WGG A;  1E8W A;  1IYF A;  3RYT A;  3W9C B;  3DHI C;  3ZDM C;  1N5X A;  1J8C A;  4GU2 A;  3N20 C;  4JL9 A;  3SDL C;  2QMT A;  1FXA A;  4GDK B;  2DYM A;  2BW2 A;  4OZB A;  2PLP A;  1R4M I;  4XDC A;  1CK1 A;  4C56 C;  4LNK A;  3BIN A;  1QLB B;  1M4V A;  3FAH A;  4W9K A;  3IFW B;  1E0Z A;  2LZ6 A;  2HJ8 A;  4GMV A;  1K51 A;  4AOF A;  3AE4 B;  1SJH D;  2M19 A;  3OAW A;  4LTU A;  3VTW A;  2AQ1 B;  1YN4 A;  1TY2 A;  2WXP A;  3IT4 B;  4C4V A;  1EWC A;  2BF8 B;  2WXH A;  4DBG A;  1WR6 E;  2KMM A;  4MGY E;  4J3O D;  3GE8 C;  3QX1 A;  3RMK C;  3PO0 A;  5CHF A;  4E74 A;  1HA5 A;  1WE6 A;  1NYQ A;  4AJY B;  2N9L A;  3RZW C;  5BMH A;  2GBN A;  2LUE A;  3A33 B;  3UGB B;  3HVD A;  4ZRQ A;  1STE A;  3ZVV A;  4IDI A;  2L52 A;  3RPF C;  4AS1 A;  1VD2 A;  2OOB B;  2CR5 A;  1D6E C;  3DHH C;  1TKY A;  1NBF C;  1T3Q A;  5E6N A;  4ANU A;  1SIJ A;  4S17 A;  3NVV A;  3KYC D;  1E8Y A;  1LGR A;  2IY0 B;  4LNO A;  3CIR B;  4JPS A;  1RFK A;  3ZJU A;  4G50 A;  2NTS A;  1UGM A;  2GBJ A;  1WZ0 A;  2K1F A;  2X8X X;  1Y56 A;  2KFK A;  2MJ3 A;  3TMP B;  3TCA A;  2G4D B;  1JML A;  4NJ6 A;  3TEW A;  1F2R I;  1C4C A;  3ZNI D;  1GAQ B;  1BXT A;  5BMI A;  2I2Y A;  4XDD A;  1OQY A;  2INP E;  4DXA B;  4IWO A;  4NAM A;  2MP2 A;  1AN8 A;  1SE3 A;  5HFY A;  2KVZ A;  5KHO A;  1PQS A;  3GOE A;  4LNN A;  4M0W B;  1TS5 A;  4GIV A;  3H7P A;  1JW9 D;  2DZM A;  4TMA B;  2I38 A;  3CWI A;  1WYW B;  3VTU A;  1J7A A;  2HTM E;  1XO3 A;  3AM9 A;  2JRI B;  1YN5 A;  1ACC A;  2FUH B;  5CX3 A;  3N1X C;  1RRB A;  3APD A;  4NJ7 A;  3Q8C A;  3VH4 B;  2JZP A;  2YEP B;  3PT2 B;  1E9M A;  3DBL I;  4OW0 A;  4RGT A;  5FR6 A;  2ONQ A;  1TJE A;  2J0J A;  1RFA A;  2ICI A;  4OHJ A;  2TSS A;  2KKC A;  4PYU A;  3IBE A;  4NAW B;  2M4N A;  3ZGZ A;  1IGD A;  5AEK B;  1XQQ A;  4FHK A;  2QC8 A;  1UUP A;  2L32 A;  1XLN A;  4HCP B;  1FXI A;  5J17 A;  2WDQ B;  4W9D A;  2LFI A;  1E5W A;  2M1M A;  2OJW A;  2WP9 B;  4KX6 B;  2MBB B;  3KW5 B;  1QZE A;  1L0V B;  2ZVN A;  3BK2 A;  4WQO B;  5AZF A;  4BBN F;  1F77 A;  1PGX A;  1R7S A;  2DNF A;  5LXI B;  4JX1 C;  4YSY B;  2D10 A;  2RPV A;  4XC2 A;  5BYR A;  2N1W A;  3EEC A;  4DDI D;  3SEB A;  2OHF A;  1WXS A;  4ANX A;  3ENE A;  1AYF A;  2MA9 B;  4ZRJ A;  3P4P B;  1XXG A;  2YEP F;  2NVU I;  2ACZ B;  1FCC C;  1S1Q B;  4IM2 A;  2N7J A;  2GI9 A;  2K8H A;  4MM3 B;  4A9A A;  4NPN A;  2J42 A;  4EZJ A;  3M63 B;  2BKF A;  2J0M A;  3W5V B;  5KHQ A;  3JSV B;  3DVG Y;  1AWD A;  1C78 A;  3MP9 A;  3AE6 B;  3Q2A C;  3DBS A;  1FNU A;  1HZ5 A;  1C3T A;  2H89 B;  4WJQ A;  5TR5 A;  4MSQ B;  3UIP B;  3GP7 A;  1WR1 A;  1UNS A;  2PIA A;  3APF A;  1WXQ A;  2JWU A;  2WX0 A;  1D5X C;  4YSZ B;  2BYE A;  1WMH B;  2AL3 A;  1HZ6 A;  4A6Q A;  2VZK D;  3W1Y A;  2K9X A;  3PRP B;  4C7Y A;  3PTF C;  4BFR A;  1ESF A;  5IOI A;  3RNA C;  1K52 A;  4OVU A;  4WAF A;  4TUU A;  4W9C A;  2D2Q A;  3VVW B;  2LAS A;  2MQJ A;  1I4P A;  2KD0 A;  3P4Q B;  3PGE A;  4MM3 A;  2KAJ A;  5AUI A;  3GZN B;  2FCN A;  2E3T A;  2PMV A;  2ZNV C;  2DX5 B;  3WCQ A;  3Q3F A;  4F7Z A;  2GBK A;  3H7P B;  1GOZ A;  3ZW3 A;  1I4H A;  2KDE B;  1JQ4 A;  1P3Q U;  2INN E;  2IND C;  5LNK 1;  1UD7 A;  2DEN B;  1N6Z A;  1GB1 A;  4IWQ A;  3OLM D;  1WY8 A;  2Z8L A;  1I4G A;  2I1K A;  5G2N A;  4DHZ B;  3KWV A;  1SJE D;  1QOB A;  1YD8 U;  2YLM A;  1E90 A;  1TIF A;  1LQB A;  1FNV A;  1MHX A;  2WX1 A;  4HRS A;  2LGX A;  1ZP0 B;  2DBY A;  2KLG A;  3AE5 B;  1V8C A;  4FN2 A;  1GB4 A;  3UF8 A;  4AWJ A;  4E3C A;  2V3S A;  2CHW A;  3L16 A;  1GC7 A;  3SFE B;  3ZLZ A;  2CJO A;  4EOY A;  1V49 A;  2DYO A;  4JGH B;  2KFJ A;  2L0F A;  2KJ6 A;  2G45 B;  1WM3 A;  3CMM B;  3N1Y C;  3U52 E;  5D94 A;  4GN1 A;  2O2V B;  3GZN I;  1IBX B;  4GOC A;  2PVG C;  2WDV B;  2MX2 A;  3APC A;  2WYQ A;  1Y8R C;  1FXT B;  3O65 B;  4L23 A;  5G5G A;  3ZJT A;  4IM0 A;  1YN3 A;  2FCM A;  2LMC A;  4RM9 A;  3WIM A;  3W1S A;  1WX8 A;  1E7V A;  4IG7 B;  1WGK A;  1WZ3 A;  3AH7 A;  3CF6 E;  3KVF B;  4FAD A;  4YSX B;  1WI0 A;  3NVZ A;  1ZDX A;  3QC8 B;  3R3M A;  1MJD A;  2GLS A;  2JF5 A;  1QOF A;  4RF0 A;  2BPS A;  2Z59 B;  3B0A A;  2DZJ A;  2CKH B;  2K8B A;  5FKA C;  4GSW A;  3LB8 C;  3U7Z A;  4LDT D;  5G55 A;  1K8R B;  4YWG G;  2N4F A;  3AEE B;  2HDE A;  1I35 A;  2M17 A;  3QQ8 B;  2PTL A;  3U30 A;  1MVK A;  2JT4 B;  2V4L A;  1Z5S B;  1E6E B;  4ZOH C;  3W2D A;  3QK0 A;  1ZOY B;  4HKZ E;  1VCB A;  2EKI A;  3B2F A;  4NY0 A;  3NUH B;  3BY4 B;  3IT6 B;  4ANV A;  4ZRI A;  3SD5 A;  2KZR A;  3L08 A;  3VR8 B;  3FIL A;  5IA7 A;  4ICU A;  3OG5 A;  3I63 C;  3Q14 C;  2J7Q B;  3V61 A;  1SXT A;  2WXO A;  4S0R A;  4W9F A;  5C2T B;  3N32 A;  1L6U A;  2RDH A;  2KN5 A;  1ZGU B;  4KSL C;  1TYG B;  1JWU D;  2LGY A;  3A1Q B;  1MHH E;  3B1L X;  3VXW A;  2ZCC A;  3D32 A;  1VJK A;  1NEK B;  1WJU A;  4OVV A;  3BWU D;  1HQR D;  2KWV B;  2DWQ A;  5L95 C;  1CZP A;  1P9D U;  2ZPY A;  1YJJ A;  1N63 A;  2Y3A A;  1E7U A;  3W1S C;  1UF0 A;  1YX6 B;  1JRO A;  5CHV C;  2KDI A;  3RUI B;  4JE3 B;  2CHZ A;  2RDB C;  1WX7 A;  1ET6 A;  2B76 B;  2K6D B;  4MEM A;  3PSE B;  3AEG B;  2JU6 X;  4PYZ A;  1FD6 A;  5BMG A;  1A5R A;  2N0S B;  2KWD A;  3I9V 1;  1SGH A;  2D3A A;  3ZDT A;  1C77 A;  2OJR A;  3AE9 B;  2J53 A;  1SBB B;  2KC2 A;  4A8X C;  4HCN B;  2DZK A;  4JQW C;  2DLB A;  2K0P A;  2A5U A;  3GE3 C;  1TBE A;  1V81 A;  2MSE D;  5EE1 A;  2IGG A;  3LJ3 A;  1PGB A;  1EU4 A;  3QJZ A;  1TS3 A;  2KOX A;  4ZYN A;  1DOX A;  1C9F A;  2BYT A;  1TKG A;  4US9 A;  2IDY A;  2VH1 A;  4FJY A;  4BAX A;  4KVG B;  4MAC A;  1ZW7 A;  2N1V A;  3HIZ A;  2JSV X;  3MJ5 A;  2D3G A;  1XLQ A;  1C4A A;  3H7S A;  1CJE A;  3ZTC A;  2KX3 A;  2KAC A;  4IC7 B;  2YVC A;  1TKE A;  2C7N B;  5BYS A;  2PPH A;  3A9K A;  3WAM A;  2D11 A;  1EUV B;  3DCG A;  2PVO D;  1FRD A;  2A4Z A;  2BWF A;  4DDG D;  3PPA A;  3A4R A;  5CTR C;  1JWA D;  3IXS A;  1V6E A;  2LGS A;  3SU8 X;  4B6W A;  4HEA 1;  3ABV B;  1J7B A;  3DBR B;  2NBV B;  2W9N A;  3VDZ A;  2JVC A;  1VRA B;  3JSV A;  4P1B C;  2WXJ A;  3ZO5 B;  2BT6 A;  4D2K A;  2J4X A;  1N60 A;  4WWP A;  3A9J A;  1V97 A;  1DGJ A;  3A1Q A;  2ZJD A;  2EEL A;  3BYY B;  3QCA A;  2SAK A;  2BKR B;  1X1M A;  3I3T B;  2HD5 B;  2FIF A;  3RCZ A;  1YJI A;  2KQ4 X;  1BUI C;  3WAL A;  1NI3 A;  3AU4 A;  2K25 A;  5GXG B;  1RM6 C;  1T0S C;  4DK5 A;  3K9O B;  2ASQ A;  1WYG A;  2O6V B;  3R2T A;  4M0W A;  4B0M A;  3NG0 A;  2GBR A;  3PS6 A;  3MC0 B;  4WUR A;  1OQR A;  2MP2 B;  4HWI B;  4KGR A;  5E6P A;  1IUE A;  3N30 A;  1PGA A;  3ZNG C;  1SIF A;  4B9K A;  4EFO A;  2IO3 B;  2LRU A;  2ZVO A;  1MG4 A;  1ZE3 D;  4BOS C;  1CMX B;  3Q3N C;  3ZNZ B;  4LNI A;  5EE9 A;  3JYU A;  1YOV B;  1VZ7 A;  2V3N A;  2LXC A;  1WH3 A;  3BZD B;  3P42 A;  3R8B A;  3PRE A;  4AUQ C;  4K1R B;  1JWB D;  2GOW A;  2C7H A;  1YX5 B;  3WA0 A;  2IYD B;  3QA8 A;  2Z0D B;  3OWE B;  2LWP A;  2IPK D;  3RD2 A;  3TEY A;  3K9P B;  3PLU A;  2JYT A;  1KRH A;  2NBU A;  5BYQ A;  3GB1 A;  4KIK B;  1GNU A;  1ROE A;  5HKH A;  4C80 A;  4LDT B;  1Q1O A;  1UBQ A;  2NPT B;  2CU1 A;  1WJ4 A;  1T0R C;  3UQB A;  3PRM B;  1VZ6 A;  3Q6B A;  5EDS A;  1IBX A;  2O2V A;  3IG3 A;  1F9J A;  3O13 A;  3HM6 X;  4C7Z A;  2WS3 B;  4YT0 B;  4HVB A;  2BYV E;  1J19 A;  4RGN A;  4W9G A;  3RZF A;  4HK2 A;  5D7G A;  4ACF A;  3KUC B;  3AE7 B;  3P2B A;  4WJO A;  3ML8 A;  4ARI A;  2IO2 B;  4RMA A;  4MH8 A;  4AQ7 A;  3IAS 1;  4IUM B;  5TSS A;  4W9H A;  3DBR I;  3HUI A;  2W54 A;  1HXY D;  3ECI A;  3H6N A;  3HK0 A;  2BTE A;  4TV3 A;  2V0G A;  3AEB B;  4K7S A;  5DPW A;  2FE8 A;  1VDV A;  2OED A;  4FJV B;  1B9R A;  2KN4 A;  4US8 A;  3MHS D;  3UIO B;  4GGQ A;  2N7D A;  2C60 A;  3QIJ A;  3ZTD A;  1TS2 A;  4LCD E;  2VH2 A;  4GLS C;  1JRP A;  3A4S C;  5AUK A;  2H88 B;  3L17 A;  1KM7 A;  2MJE A;  2JPH A;  5EE0 A;  1YQ4 B;  3P1M A;  5HG2 A;  1JWM D;  2I1J A;  2QEJ C;  3AE2 B;  1SE2 A;  3HM3 A;  1V1O A;  4B0E A;  1AAR A;  4NNJ B;  2XK5 A;  3HRD D;  4OZC A;  2HJ1 A;  4LJO B;  1HE8 A;  2C5L C;  4LNF A;  1UH6 A;  4WH4 A;  3RUL A;  1HTO A;  1KTK A;  4UDU C;  2JXT A;  4O1N A;  3Q3O C;  4X57 B;  5JXV A;  4WIP A;  3H1U A;  2ON8 A;  2QJL A;  4TQ1 A;  3DBH I;  3VQI A;  3PHW B;  4FJZ A;  1L4Z B;  1SE9 A;  4K3B A;  1IGC A;  1F2R C;  5DPS A;  2N9P C;  3U8Z A;  3VFK A;  2FID A;  2LEK A;  2W3S A;  4WQM A;  3QHT A;  2L1A A;  1TZO A;  1WGD A;  2RD0 A;  2KDB A;  2WXM A;  2ZNV B;  3ALB A;  3TUO A;  3C19 A;  3NS8 A;  2DHZ A;  2WXQ A;  3NJT A;  4EZK A;  4W9E A;  2WXI A;  4DHJ D;  3DVN V;  2ZW1 A;  2DAF A;  4N58 A;  3AEF B;  1JWS D;  2PE6 B;  3AXC A;  2XEW A;  3AMZ A;  3RFZ B;  4DXF A;  1XD3 B;  2VRR B;  4WJN A;  5DPT A;  4PK1 A;  4KKJ A;  4ITK A;  3DVG X;  1MPE A;  1Q5W B;  1WJ6 A;  2QDF A;  1UWX A;  4KDL B;  2WLB A;  2V1Y A;  5T8I A;  2Y5B B;  1ZDV A;  3VAW A;  1VLB A;  2L8J A;  3DVN U;  1Z2M A;  1KOT A;  3ZKJ C;  3Q3J A;  3ML9 A;  3VTV A;  3AI5 A;  4M00 A;  4DHZ E;  4QAY A;  4TQ0 A;  4MGI E;  4NJC A;  2KT7 A;  2L3Z A;  2NBW B;  4IM3 A;  2RR9 A;  4H2A A;  1RLF A;  4ASW C;  4HPL B;  3VUX A;  2L83 A;  5IO9 A;  2IY1 B;  2JXX A;  4BKS D;  3Q69 A;  4MGZ E;  3AN1 A;  4F8C B;  1RAX A;  3MHZ A;  1RYJ A;  2XNA C;  3NVW A;  3TBL D;  3RNF C;  3VUY A;  1WRI A;  2AQ3 B;  1WMH A;  1LFD A;  2KWU B;  1YIW A;  1L6V A;  2IGD A;  2WWZ A;  4L1B A;  1UEL A;  2LHD A;  1V80 A;  1L0Y B;  4HDQ A;  3N1Z C;  2E6X A;  1P7F A;  4EUT A;  1DOY A;  1E8X A;  2XN9 C;  3L4P A;  4MSM B;  3R7Q A;  2X38 A;  1LM8 B;  2M56 B;  4RCO A;  2EMS A;  3I5J C;  1U4A A;  1V2Y A;  4P6V F;  4URK A;  4A20 A;  4IWP A;  1OTR B;  1XLO A;  3NVY A;  3AU5 A;  1KLG D;  1R4M B;  4M8M A;  2JUO A;  2KO3 A;  3DOW A;  5G5H A;  3DWM A;  2HE7 A;  3MTN B;  4Q2J A;  4ZYS A;  2KC1 A;  3EFU A;  5C23 A;  3U7D A;  1WGY A;  1PUT A;  3IAM 1;  3EA6 A;  2K22 A;  2L7R A;  1QT9 A;  2LRW A;  2L05 A;  3TSS A;  4WWM A;  1GPX A;  5D2M B;  1XT9 B;  3B9J A;  3H9D A;  4W9I A;  5D6J B;  2O6V D;  2J52 A;  4HPM B;  5BO4 B;  2ZW0 A;  2BGF A;  2QIE B;  1ZXH A;  2BVC A;  1VR9 A;  2KVR A;  1NI2 A;  5LXH A;  3VHT C;  1OEY A;  2M0X A;  2MEK A;  1ENF A;  2AEH A;  4II2 B;  2CHX A;  2LXA A;  5D3D A;  2XBB C;  4IKG A;  1L4D B;  2W55 A;  4HRO A;  2AWT A;  2LHE A;  2JRH A;  1JAL A;  3E56 A;  1MFW A;  1QQR A;  4BVU C;  3LXF A;  2LGD A;  3GS2 A;  2SEB D;  4ZDV A;  2IO1 B;  1A70 A;  3M3J A;  1I4Q A;  3AED B;  3WAO A;  1WF9 A;  4GDL B;  2PE9 A;  2PKO A;  1WFY A;  3ZIM A;  3VRA B;  5J18 A;  3KUD B;  2INC C;  1G6J A;  1LO5 D;  1KLU D;  1XF5 L;  2JWZ A;  4OVZ A;  5FR3 A;  1P98 A;  3V05 A;  2JY6 A;  3MFG A;  3URY A;  3EHV A;  1KF6 B;  4HJK A;  1FFU A;  4ZRK A;  1WGR A;  2N7E A;  4KKI A;  2DZI A;  5H92 C;  4WWO A;  5H8Y E;  1OGW A;  2FAZ A;  2BYF A;  2RPQ A;  1QOG A;  2NTT A;  2KTR A;  3L54 A;  5IAA C;  1YJ1 A;  1BML C;  2IO0 B;  3FIL B;  3NZ3 A;  2WDR B;  1TTN A;  1VZ8 A;  2BQQ A;  1JRU A;  3Q8F A;  4DXG A;  2Q5W D;  1WXM A;  4XGA B;  4RFB A;  3H8H A;  3L0W B;  2KTR B;  1PYW D;  1KJT A;  2MBQ A;  3RNC C;  3HHM A;  2MJD A;  1UGJ A;  3BVZ A;  2QIL A;  5D3I B;  4RM8 A;  1XCQ L;  4FLH A;  3JW0 X;  1MI0 A;  5DPR A;  4F1S A;  2RDG A;  1MG8 A;  2R2Q A;  1K50 A;  2WU5 B;  2NPT A;  4ICV A;  4BOZ B;  4HKQ A;  2N9X A;  3SHQ A;  2B3A A;  3PLV A;  1UZX B;  3EUB 2;  4I6L B;  2G1E A;  4IW0 A;  3TEX A;  4HJG E; 
#chains in the Genus database with same CATH homology
 2H89 B;  5FK9 C;  3GP7 A;  3TEZ A;  2VZK B;  1UNS A;  2PIA A;  3PZ8 A;  3OWE B;  3Q8E A;  1WXQ A;  2IPK D;  2JWU A;  3UI3 A;  1D5X C;  3TEY A;  4DQO C;  4YSZ B;  2BS2 B;  1HZ6 A;  4OZA A;  2JYT A;  1KRH A;  4ZHO A;  2NMQ A;  1AW7 A;  4A6Q A;  2BS3 B;  2VZK D;  5BYQ A;  2K9X A;  1SF0 A;  3GB1 A;  4C7Y A;  1ROE A;  1QOA A;  1ESF A;  1P7E A;  4C80 A;  1K52 A;  2AX5 A;  4WAF A;  4FXC A;  3KWL A;  3KLS X;  1I4R A;  1C4P A;  1V1P B;  4EE2 A;  1I4P A;  3P4Q B;  1VZ6 A;  3N9Y C;  4YTP B;  1IBX A;  3VRB B;  1SEB D;  1FO4 A;  2KAJ A;  1C76 A;  5AUI A;  3J9C A;  4A55 A;  1WSP A;  2E3T A;  3O13 A;  2PMV A;  4C7Z A;  2WS3 B;  1XLP A;  4YT0 B;  3WCQ A;  1K53 A;  1N5W A;  4RGN A;  1SE4 A;  5D7G A;  1GOZ A;  2K5P A;  1FEH A;  3AE7 B;  3DWG C;  1DYQ A;  1I4H A;  4ARI A;  1JQ4 A;  2INN E;  5LNK 1;  4MH8 A;  4AQ7 A;  3IAS 1;  3ZQ4 A;  1GB1 A;  5TSS A;  4RGO S;  3NRZ A;  2W82 A;  2Z8L A;  1I4G A;  1RWS A;  3NS1 A;  3Q8B A;  4PT5 A;  1NYR A;  2MH7 A;  2V3P A;  3KWV A;  3LYY A;  4ARC A;  1EWY C;  1SJE D;  1QOB A;  3HUI A;  2W54 A;  1I7H A;  1HXY D;  1L5P A;  1OFF A;  4RF1 A;  1Q10 A;  2BTE A;  1FNV A;  1ZPS A;  1MHX A;  2V0G A;  2RMM A;  5HHD G;  3AEB B;  4HRS A;  1D5M C;  1ZP0 B;  2FE8 A;  1VDV A;  1T5X D;  3Q8A A;  2CU3 A;  2DBY A;  1FM0 D;  2WQY B;  2FUG 1;  3AE5 B;  2OED A;  1CQV A;  1V8C A;  2IJ0 A;  1B9R A;  1GB4 A;  2KN4 A;  2FBW B;  4US8 A;  1EM7 A;  4RH6 A;  3C8Y A;  2M0A A;  3SFE B;  4JWS C;  3BII D;  1JCK B;  1TS2 A;  2CJO A;  2JX5 A;  2DYO A;  4GLS C;  1JRP A;  1N62 A;  5AUK A;  2H88 B;  3AEA B;  5I4D A;  2MJE A;  2QSD A;  5EE0 A;  4MT5 A;  1YQ4 B;  3P1M A;  5HG2 A;  3V3X A;  1JWM D;  2QEJ C;  3AE2 B;  1SE2 A;  3ZYY X;  3U52 E;  1V1O A;  4B0E A;  4ZRP A;  2WXL A;  1YMH E;  1NEN B;  2BS4 B;  1IBX B;  1DOI A;  2PVG C;  3HRD D;  2WDV B;  3E9S A;  3SFD B;  4OZC A;  1V1P A;  2LUM A;  4L23 A;  3AB5 A;  5G5G A;  3ZJT A;  4WH4 A;  1YN3 A;  2WXN A;  1KTK A;  2LMC A;  4UDU C;  3P63 A;  3W1S A;  3AV8 A;  5MPO A;  3AE1 B;  1WGK A;  2JXT A;  4O1N A;  2BB5 A;  5JXV A;  3AH7 A;  4WIP A;  4YTN B;  1SB3 C;  2ON8 A;  4YSX B;  2QJL A;  3NVZ A;  1TY0 A;  4TQ1 A;  3VQI A;  2JYE A;  1PFD A;  1ZDX A;  1L4Z B;  4KGS A;  2WXG A;  1IGC A;  1F2R C;  3W9C B;  1FMA D;  2LEK A;  2WXR A;  1QOF A;  1N5X A;  2G9H D;  2W3S A;  4WQM A;  4RF0 A;  1EU3 A;  2L1A A;  1TZO A;  3AE3 B;  4IOI E;  2QMT A;  1FXA A;  3BVM A;  2WXM A;  3TUO A;  4GDK B;  5FKA C;  3LB8 C;  2WXQ A;  3U7Z A;  2DYM A;  4YTM B;  2BW2 A;  2WXI A;  4OZB A;  2PLP A;  2ZW1 A;  4YWG G;  4N58 A;  4XDC A;  1CK1 A;  3AEF B;  3AEE B;  2HDE A;  4C56 C;  1FCL A;  1JWS D;  1QLB B;  1M4V A;  2K3U A;  2PTL A;  3FAH A;  1E10 A;  1MVK A;  3AMZ A;  1QF6 A;  5C3J B;  3RFZ B;  2LJI A;  4DXF A;  1E6E B;  4ZOH C;  1E0Z A;  3T3N A;  4KKJ A;  3W2D A;  1ZUD 2;  4ITK A;  1MPE A;  1ZOY B;  4HKZ E;  2EKI A;  1K51 A;  3AE4 B;  1SJH D;  1UWX A;  2M19 A;  3B2F A;  2WLB A;  4LTU A;  3NUH B;  3IT6 B;  5T8I A;  1ZDV A;  2AQ1 B;  1FRR A;  1HEZ E;  1YN4 A;  1VLB A;  4TSS A;  1TY2 A;  2JQR B;  3VR8 B;  3FIL A;  1PDX A;  2WXP A;  3IT4 B;  1E7P B;  1EWC A;  2WXH A;  4REZ A;  4TQ0 A;  2WXK A;  4NJC A;  2BBC A;  2KMM A;  1SXT A;  3AEC B;  4J3O D;  2WXO A;  3BYT B;  5C2T B;  3U4E G;  3PO0 A;  4H2A A;  4P16 A;  1L6U A;  2RDH A;  1HA5 A;  1NYQ A;  1TYG B;  1JWU D;  2L83 A;  3P4S B;  2N9L A;  1MHH E;  5BMH A;  1VJK A;  3Q69 A;  3AN1 A;  1NEK B;  3HVD A;  4ZRQ A;  1F0Z A;  3MHZ A;  1STE A;  3BWU D;  1RYJ A;  1HQR D;  4N6E B;  3FC4 A;  2DWQ A;  2L52 A;  2XNA C;  4IDI A;  3RPF C;  1CZP A;  3NVW A;  4AS1 A;  1WWT A;  2BB6 A;  1D6E C;  1TKY A;  1YJJ A;  1N63 A;  4RNA A;  1T6B X;  1WRI A;  2Y3A A;  2AQ3 B;  3ZJV A;  1T3Q A;  1JRO A;  1SIJ A;  1TS4 A;  1L6V A;  2IGD A;  3NVV A;  4USA A;  4JE3 B;  3EGR A;  4L1B A;  2LHD A;  1YNT E;  1D4B A;  1ET6 A;  3CIR B;  1L0Y B;  4JPS A;  1RFK A;  3ZJU A;  2B76 B;  2NTS A;  1YQ3 B;  2WNM A;  2E6X A;  3AEG B;  1P7F A;  1Y56 A;  2MJ3 A;  2JU6 X;  1DOY A;  1FFV A;  2XN9 C;  5BMG A;  1FD6 A;  2Y5C A;  3L4P A;  5EE3 A;  2N0S B;  4L2Y A;  2X38 A;  1JML A;  2KWD A;  3TEW A;  1F2R I;  3I9V 1;  2M56 B;  1C4C A;  4NZL B;  4R3D A;  4RCO A;  1N61 A;  1C77 A;  1GAQ B;  3VR9 B;  3AE9 B;  1BXT A;  1SBB B;  2J53 A;  5BMI A;  4A8X C;  2I2Y A;  4P6V F;  4XDD A;  2DLB A;  1D5Z C;  2INP E;  2K0P A;  1XLO A;  4NAM A;  3NVY A;  1AN8 A;  1SE3 A;  1KLG D;  3P4R B;  5HFY A;  1J7C A;  1ZXI A;  5G5H A;  2GB1 A;  1XEE A;  1TS5 A;  3DWM A;  4Q2J A;  4ZYS A;  3U2S C;  2KDM A;  5EE1 A;  2GRI A;  2IGG A;  1PUT A;  3IAM 1;  1PGB A;  1JW9 D;  1EU4 A;  3EA6 A;  4TMA B;  1TS3 A;  2K22 A;  2I38 A;  1QT9 A;  1DOX A;  1C9F A;  2BYT A;  3TSS A;  1TKG A;  3CWI A;  4WWM A;  4XE0 A;  2LGI A;  1GPX A;  4US9 A;  3W5U B;  4ZHP A;  2IDY A;  3SR6 A;  1J7A A;  3B9J A;  4MAC A;  3ETR A;  2HTM E;  1XO3 A;  2JSV X;  2J52 A;  3AM9 A;  3MJ5 A;  1YN5 A;  1ACC A;  1XLQ A;  1C4A A;  4A90 A;  1CJE A;  2KAC A;  2W3R A;  2ZW0 A;  2CJN A;  2QIE B;  1ZXH A;  3Q8C A;  2JZP A;  2YEP B;  2PW9 A;  1E9M A;  4OW0 A;  1TKE A;  4RGT A;  1VR9 A;  2MEK A;  1ENF A;  5BYS A;  2ONQ A;  1TJE A;  5D3D A;  4IKG A;  2PVO D;  1L4D B;  1FRD A;  2W55 A;  2D5G A;  2ICI A;  4OHJ A;  4HRO A;  4XWW A;  2TSS A;  2LHE A;  1JAL A;  3E56 A;  1KH0 A;  1JWA D;  1QQR A;  3IXS A;  3T3O A;  3HVZ A;  3LXF A;  3GS2 A;  2SEB D;  5HI1 A;  4N59 A;  4HEA 1;  1A70 A;  4XWT A;  1I4Q A;  3ABV B;  1J7B A;  2N9K A;  3AED B;  4GDL B;  4NAW B;  2PKO A;  3VRA B;  1LO5 D;  3ZGZ A;  1IGD A;  1KLU D;  1XF5 L;  4LLG M;  5E6J A;  4OVZ A;  5FR3 A;  4RGM A;  3R2I A;  3V05 A;  1UUP A;  1C79 A;  3MFG A;  3URY A;  1VRA B;  3B2G A;  2WXJ A;  2L32 A;  1KF6 B;  2BT6 A;  4D2K A;  1XLN A;  1FIQ A;  1FFU A;  1N60 A;  2J4X A;  1FXI A;  1V97 A;  1DGJ A;  2WDQ B;  2LFI A;  2EEL A;  4KKI A;  2WP9 B;  3BYY B;  4KX6 B;  5H92 C;  3PZ7 A;  5H8Y E;  2SAK A;  3BVG A;  1L0V B;  1QOG A;  1SSN A;  3KQ4 A;  3BK2 A;  2NTT A;  1F77 A;  1PGX A;  1YJI A;  1R7S A;  1BML C;  1FNW A;  2KQ4 X;  1BUI C;  4JX1 C;  2WXF A;  3I57 A;  4YSY B;  3FIL B;  1ET9 A;  3NZ3 A;  1NI3 A;  2WDR B;  2RPV A;  3AE8 B;  5BYR A;  1I4X A;  5GXG B;  4CQN A;  1RM6 C;  1QKZ A;  1VZ8 A;  3SEB A;  3Q8F A;  1KFY B;  4DXG A;  1WYG A;  2OHF A;  2Q5W D;  4RFB A;  3H8H A;  3R2T A;  1PYW D;  4M0W A;  4B0M A;  1NVI D;  2MJD A;  1AYF A;  3P4P B;  3MC0 B;  1XXG A;  1L0X B;  2YEP F;  1UGJ A;  4WUR A;  2ACZ B;  3BVZ A;  1FCC C;  2AQ2 B;  1OQR A;  2QIL A;  2V4I B;  5D3I B;  1XCQ L;  4KGR A;  2R61 A;  1IUE A;  1QIL A;  2N7J A;  1PGA A;  2GI9 A;  1MI0 A;  4MM3 B;  4A9A A;  1UWM A;  2J42 A;  2RDG A;  1ZE3 D;  3W5V B;  1B1Z A;  1XCT L;  4YXD B;  4KGT A;  5EE9 A;  1K50 A;  2WU5 B;  2Y5P A;  1VZ7 A;  2V3N A;  4HKQ A;  3BZD B;  2IGH A;  1OQQ A;  1AWD A;  4JWU C;  3P42 A;  3R8B A;  1C78 A;  3BK1 A;  3MP9 A;  3AE6 B;  3EUB 2;  1JWB D;  1FNU A;  2G1E A;  3TEX A;  1HZ5 A;  4HJG E;  4LK0 M;  2WU2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...