1QOGA

Ferredoxin mutation s47a
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
98
structure length
98
Chain Sequence
ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACATCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-function relationships in Anabaena ferredoxin: correlations between X-ray crystal structures, reduction potentials, and rate constants of electron transfer to ferredoxin:NADP+ reductase for site-specific ferredoxin mutants.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords FERREDOXIN
total genus 25
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1qogA00
1TKEA 3AE9B 1TKGA 3DWMA 4JWSC 1PDXA 3HRDD 1JROA 1GPXA 2K22A 3AE6B 1L6VA 4P6VF 1OQRA 2JQRB 1A70A 2W3SA 1N63A 3KWLA 4HRSA 2BS3B 4N6EB 2H88B 2ACZB 4ITKA 2MJ3A 4ZOHC 5C2TB 2QIEB 3AEFB 2KMMA 1FO4A 2W3RA 1R7SA 2MJDA 2K9XA 3B9JA 4YSZB 4LTUA 4FXCA 2PIAA 3P4QB 1CJEA 2WDVB 1E9MA 5H8YE 2BT6A 1FFUA 3NVVA 3SFDB 1DOIA 5C3JB 3HVZA 1KFYB 1FIQA 1E6EB 1DOYA 2B76B 1N60A 1QOAA 4YT0B 1DOXA 1N5WA 1YQ4B 3ETRA 4WQMA 1QOGA 4C80A 2CJNA 1VDVA 1JALA 3VRAB 1WYGA 2K5PA 3AH7A 5AUKA 5GXGB 3NVWA 1WRIA 4YTNB 3SR6A 3VR9B 1YJJA 1VLBA 1FFVA 1NYRA 5H92C 1QOFA 1VJKA 1XLNA 2DBYA 1F0ZA 3P4SB 3NRZA 1J7AA 2PVGC 3P4PB 1NI3A 3AEBB 5AUIA 2KAJA 1L6UA 1FM0D 3FAHA 1XLPA 4JX1C 3ZYYX 1EWYC 1FRDA 1FXIA 1XO3A 1YQ3B 3AE2B 5G5HA 5MPOA 3W5VB 1JWAD 1WXQA 1N62A 3NVZA 1V8CA 1ZP0B 3AE5B 1PFDA 1ROEA 2CJOA 2WU5B 3RPFC 3FC4A 4YTPB 1QT9A 3AE7B 2Q5WD 3VR8B 4YXDB 3AECB 1SB3C 4HROA 5EE3A 3AMZA 4N58A 2W54A 1B9RA 2WU2B 1N61A 1XLOA 2EKIA 1RWSA 1OFFA 1QLBB 4A9AA 1UWMA 1ZXIA 2N0SB 3BIID 3P1MA 2E3TA 3AEGB 2WLBA 1XLQA 1YJIA 2JX5A 2G1EA 3ABVB 3P63A 2W55A 1L5PA 1IUEA 3CIRB 1JW9D 4JWUC 4YTMB 3AEDB 1RFKA 1PUTA 5EE0A 3LXFA 4WWMA 2MJEA 4YSYB 1TYGB 1E7PB 3NVYA 1NVID 1AYFA 1NEKB 1SF0A 1TKYA 4IDIA 2QJLA 5G5GA 1AWDA 4C7ZA 1FXAA 2M56B 3AEEB 3AM9A 2FBWB 3SFEB 2DWQA 3AN1A 3EUB2 1WWTA 3NS1A 3B2GA 4YSXB 1CZPA 3AV8A 2L52A 3DWGC 1E0ZA 1QF6A 2OHFA 1TJEA 1ZUD2 1JQ4A 1DGJA 2CU3A 3HUIA 1J7BA 4US8A 3AE1B 1KRHA 1QOBA 2H89B 2WP9B 5EE1A 2HTME 2PVOD 4ZHPA 1I7HA 3AB5A 1SIJA 4ZHOA 3W5UB 3W9CB 1OQQA 3AE8B 3B2FA 2Y5CA 1V97A 2WQYB 1JRPA 3LB8C 3P4RB 1RM6C 2WS3B 3L4PA 2LEKA 1WGKA 4US9A 2MH7A 5EE9A 1T3QA 1NENB 3CWIA 2BS2B 2WDQB 4KX6B 1ZOYB 4N59A 1L0VB 3AEAB 2WDRB 1KF6B 2L83A 3AE4B 4C7YA 2AX5A 3VRBB 3WCQA 1N5XA 2PKOA 2M19A 3AE3B 1FRRA 1RYJA 4USAA 1GAQB 1J7CA 1E10A 1NYQA 2BS4B 1FMAD 3PO0A 1JWBD
chains in the Genus database with same CATH superfamily
4ZRQA 2INNE 3ZNZB 1BXTA 1ZDXA 1R4MB 1OGWA 5JHAA 2QSDA 3QJZA 3ZO5B 2WXPA 1N5WA 4E74A 3FILB 4UDUC 2NBVB 5GXGB 3RD2A 3IT6B 3PZ8A 2JT4B 2N7DA 1NI3A 3ZTCA 1EWYC 2C9WB 4DDGD 3DVNU 1H8CA 4YTPB 4WAFA 4HCPB 5CX3A 3I5JC 4HROA 4HXDA 4IC7B 4NAWB 4OW0A 5D2MB 2N7EA 3ZNHB 1GUAB 3VHTC 1Q10A 3ABVB 1SEBD 1Z2MA 3JVZX 3APFA 1JWSD 4MH0E 2V3PA 5EE0A 4RH6A 1NVID 1WFYA 3QCAA 4L2YA 3K9PB 1L0XB 4KIKA 3EUB2 3NS1A 2SEBD 3A9JB 3NUHB 1SBBB 1GOZA 2V3SA 1J7BA 3L54A 2NTSA 3AE1B 2L3ZA 3AB5A 2N4FA 3IAS1 2WGSA 2ZW1A 3LB8C 3IVFA 2KWVB 2IO2B 1MJDA 3CWIA 1FD6A 3AE4B 2GB1A 5FK9C 1PGAA 2LHDA 5BYRA 2Z0EB 2D5GA 4W9EA 1KJTA 1C4PA 3ZJTA 2KOXA 2W3SA 1C1YB 1WI0A 3URYA 3AEFB 2KK8A 2MJDA 4GB9A 4RF0A 2TSSA 3VTWA 2BT6A 1P3QU 2WXMA 2IY1B 2KNBA 2LGSA 1GNUA 3ZDTA 1TGZB 4FBJB 4C00A 2WX0A 3VDZA 1F0ZA 1IGDA 1UUPA 3KUZA 4II2B 1UBIA 2KHWB 2ZVOA 1C9FA 2J52A 3QK0A 5J18A 2PE9A 3VR8B 4HWIB 1JRUA 1UD7A 1VZ8A 1WZ0A 4N58A 3GP7A 3DVGY 1WGHA 1WXAA 4M00A 2KJ6A 2EELA 1SE9A 3HM3A 4JLCA 2RSUA 2KDMA 3BY4B 1AW7A 2KANA 2IGHA 4A3PA 1WY8A 2EMSA 3L17A 5BO4B 1F77A 4KKJA 2ASQA 1STEA 3DOWA 5AZGA 2GBMA 1BT0A 1UZXB 1WF9A 1CZPA 1A5RA 2LGIA 2L0TA 4MGYE 2FIFA 1QOBA 2KXJA 2KMAA 4CO7A 2BYTA 4KSKC 2KTRA 1YJ1A 1V97A 5LNK1 2BYFA 1WGRA 2BGFA 3EA6A 1KF6B 1WJUA 2MWSB 1FRRA 4P1CC 3K9OB 1D3ZA 2JUOA 2PEAA 1TKGA 4ZRJA 3PRPB 4LNFA 4CYEA 4GGQA 2KDEB 2MJ3A 4DHZE 1LXDA 3N1ZC 5HHDG 2ZNVB 3Q3OC 4BKSA 5E6OA 2G4SA 3WA0A 3NVVA 5C3JB 1HTQA 3CF6E 1DOYA 5FR6A 4C80A 1QOGA 4LJOB 1ZW7A 4TSSA 4XWWA 4MGZE 4KV2A 3H7SA 1I4RA 1Q0WB 3U52E 3IAM1 5TR5A 2IO3B 5AUIA 3VXWA 2KN5A 2ZZPB 4ZRKA 3AE5B 1R4NB 1ZPSA 2WU5B 1LQBA 4BOSC 3PS6A 1RWSA 4BZAA 2L7RA 3TL5A 2PTLA 4ACFA 2JZPA 5JHBA 3OG5A 2Y5PA 3AULA 2EKEC 3TIXA 3Q3FA 1H4RA 3MC0B 1RFKA 5DCNA 4EEWA 1WYWB 1SF0A 4ZRIA 4KKIA 3ZKJC 2OJRA 1WX7A 4ARIA 2KDFB 1T5XD 2VH1A 1TZOA 1ZUD2 2N9EB 4LNNA 3ZXVA 2H89B 2WP9B 3EECA 3MTNB 1WGKA 1P1AA 3C8YA 2CHWA 5KHQA 2KDIA 4TUUA 2LXCA 4Q2JA 1PGBA 2MW5A 1PDXA 5BYSA 3FKYA 4B95A 1V49A 3AE6B 3QC8B 4WH4A 4HJGE 3AU4A 2PW9A 2QIEB 4YSZB 3P4QB 1P7EA 3E56A 3ML8A 1UWXA 3QAQA 1FIQA 4RM8A 4AS1A 2M1MA 4XX5A 1F9JA 2HDEA 3Q3NC 3ALBA 1IYFA 1DOXA 3U7DA 3PZ7A 1Z5SB 1V5OA 4KZCA 5AUKA 4DXGA 2PLPA 3PV1A 2INPE 4LLGM 2G3QB 3VUYA 3NRZA 2NPTB 3NZUA 2L00B 3AEBB 2D10A 4AWJA 1XO3A 4MGIE 4XGAB 5FR3A 4B0MA 4GN1A 1WX9A 3JSVB 3ZQ4A 1B9RA 1TS5A 2N9PC 4WAAA 1OFFA 1QLBB 2MRPA 4TQ1A 2WXFA 2BKFA 2DHZA 5GMVA 2VZKB 3RNBC 1JMLA 4ASWC 3VUXA 3RUIB 4EZJA 1LO5D 1MG8A 4YTMB 2IDYA 1M4VA 3IFWB 3NVYA 4RF1A 1JWUD 1AWDA 2JZ3B 4WQOB 1HZ5A 5DPSA 1WM2A 4EZKA 3D32A 3KUDB 2CU3A 4RGTA 3ZDMC 2KJRA 4DK5A 4W9JA 2CHXA 2HTME 2G4DB 3JSVA 1HXYD 2J0JA 4IWQA 3BWUD 2WQYB 2LGDA 1T0SC 4KDLB 3VRBB 4IM2A 4XDDA 3KWVA 2C7MB 2RMMA 3R2IA 3WANA 2WXRA 4KZ0A 2JWUA 1FMAD 2I2YA 1RAXA 4OZBA 1R7SA 1E9MA 2CKHB 1I4XA 1DOIA 2DZIA 3VFKA 3TEZA 1YQ4B 1SIFA 2WX1A 2IBIB 2W82A 3BVMA 4ICUA 1MHHE 1UF0A 2WXKA 3R3MA 3B0AA 1EF5A 1KM7A 2ZNVC 3V62A 1FRDA 1YQ3B 3AE2B 1L4DB 2BW2A 3ZJUA 4HK2A 1YN5A 4NZLB 2MCNB 4BBNF 4HKQA 2EKIA 2J42A 4GSWA 1TS3A 1ACCA 1DYQA 1PQSA 3ZNID 2CU1A 1L2NA 3RCZA 2A4ZA 5BMGA 4TV3A 2WWZA 4WWMA 2MJEA 2PE6B 2JRHA 3UINB 1HQRD 2KC2A 1YD8U 2LHEA 1TY0A 2QC8A 1WGDA 2MHJA 3AV8A 2LVQA 1QF6A 2JSVX 5IO9A 1DGJA 3R66C 3WAMA 2R2QA 3W9CB 2O2VA 1G6JA 3QX1A 2FAZA 2WDQB 2WXNA 3N9YC 1ET6A 4E71A 1F1HA 3P2BA 4OZCA 3RNGC 1EUVB 2FCMA 3V60A 3RI7C 4K81A 4WWPA 3AU5A 3H7PA 4PS7A 2DZKA 2H88B 3OJ3A 3CSFA 4ITKA 4NQLB 2KMMA 2K9XA 2C60A 1SSNA 1MVKA 4W9DA 3LJ3A 4LDTD 1T0YA 1JALA 2IPKD 2WXHA 4K3BA 2MP2B 2QHOA 3Q8EA 3ZNGC 3Q3MC 4HDQA 2KX3A 2O6VA 2BTEA 2MSED 4WJOA 3PTFC 2J0MA 5DPWA 1ET9A 3AI5A 2K6QA 2AWTA 2LVOA 5G55A 2K6DB 1SE4A 3Q3JA 1BUIC 1MHXA 2LRUA 4J6IA 1EM7A 4NAWA 4TMAB 3N1YC 2WNMA 3P63A 3U2SC 2MLBA 2JF5A 5C1ZA 4GLSC 2WXIA 4RM9A 3LXFA 4BFRA 2X38A 3PRZA 1TKYA 3ZJVA 1B1ZA 2AL6A 2PMVA 3Q14C 3Q8BA 4K7WA 1XCQL 3DWGC 3IT4B 3H1UA 3EFCA 5D94A 2ZEQA 1WJ6A 1OEYA 4RGMA 3A9KA 2HJ8A 1FNVA 4ZHOA 5J2RA 4DHJB 4RNAA 5E6JA 1SJHD 4W9KA 2SAKA 5L95C 4ARCA 1ZE3D 3DDCB 4WIPA 1C77A 1IGCA 1J7CA 3VAWA 3VUWA 1JWBD 1ZXHA 2KD0A 4MM3B 1LFDA 4PS8A 4P6VF 4W9FA 4HRSA 3ZXRA 4FA6A 2PPHA 5EDSA 4LTUA 1Y56A 1UBQA 1NI2A 1LM8B 3L16A 5D7GA 3U4EG 1I4PA 3HIZA 4YT0B 4XYCA 1VD2A 4MGKE 3RN9C 3T9LA 3TCAA 2LJ5A 2HD5B 1WRIA 2V9HA 3WAPA 2B3AA 3T3NA 4F8CB 2K0PA 2LD9A 5DPRA 1YN4A 4ZYNA 2O6VD 2N9LA 4LK0M 1V8CA 4YWGG 2CJOA 4IM0A 3QA8A 4NNJB 4PK1A 1WZ3A 4HVBA 3RNAC 3UQAA 1OQYA 1WMHB 4A9AA 1FNUA 1ZXIA 2LI5A 4HJKA 3DBHI 1R4MI 1WH3A 2WXGA 3L0WB 4WWNA 2LMCA 3EHVA 4GXBA 3P42A 1XF5L 3C19A 3PREA 4G50A 4MT5A 4XC2A 1TY2A 2CS4A 1NEKB 5AZFA 3SFEB 3NJTA 2FBWB 2DWQA 3AN1A 3MJ5A 3ZRCA 1MFWA 3B2GA 4DBGA 1XD3B 5IA7A 2JY6A 4US8A 2GBKA 1GC7A 4CQNA 3DPDA 3O65B 1RFAA 2AEHA 3IXSA 3TSSA 3W5UB 5L83A 1GPXA 1RM6C 4FHJA 2MBOA 1U4AA 1XCTL 5IKCM 1ZOYB 3DVGX 4RGOS 2AX5A 3Q6BA 1RYJA 3UI3A 2LVPA 4DQOC 3SD5A 2E6XA 4JQWC 3MP9A 4PYUA 1N63A 1D5XC 3A1QA 1K8RB 2KWCA 3N32A 3B9JA 4K7UA 4AUQC 2D2QA 3L08A 3N30A 3Q8FA 3SFDB 1T0RC 5LXHA 4HDOA 4IKGA 1GB1A 3DCGA 3A9KB 1N60A 3OJ4B 1QOAA 1VZ7A 3DBRI 5KHOA 3NVWA 2MBQA 3IG3A 4OZAA 1VLBA 4TQ0A 2DBYA 4NJCA 4O1NA 3ZUNA 5BMHA 1EU3A 4BOZB 1SJED 4DXAB 1ZDVA 5EE3A 2WU2B 4WJPA 3UF8A 1UWMA 4DWFA 3AEGB 2V4LA 2V4IB 4RGNA 4LJPB 2IGDA 4G11A 4WURA 1JW9D 4JWUC 3CSTA 2INDC 4REZA 4KIKB 4BAXA 3W1YA 4I6LB 1TS2A 3BVZA 4HEA1 1FXAA 2M56B 1NBFC 4YSXB 3W2DA 2PVOD 4GMVA 1SIJA 3H8HA 4J3OD 4D2KA 1WE7A 2MA9B 4C7YA 4ZRPA 2M19A 3H7PB 4DXFA 1I4QA 2O6VB 3JW0X 1V6EA 3KLSX 1EO6A 1TKEA 1YN3A 2JQRB 3KWLA 1QQRA 2ACZB 5C2TB 5IAAC 4PS3A 3BINA 3TJPA 2MX2A 1WSPA 2NCNA 2NBUA 3MHZA 1P7FA 1VDVA 1WYGA 3AH7A 4YTNB 4XWTA 5BYQA 1QILA 1QOFA 1LGRA 3CMMB 1FEHA 4JPSA 4LDTB 4L23A 5CHWA 2ZW0A 4ANWA 3ECIA 2C7NB 4L1BA 1PFDA 2AYOB 3RPFC 1E8WA 1SB3C 1XLOA 4AJYB 2D3BA 1TZ1A 2D11A 2DYMA 3BIID 1BMLC 2ZCCA 2LFIA 2FIDA 4HCNB 3ENEA 5J17A 2Z59B 3V05A 4BKTA 1V5TA 3PHXB 3CIRB 4GOCA 3RNCC 2KFKA 3AEDB 2XEWA 1K52A 2BYVE 2NR2A 1E7PB 2RR9A 2N1VA 4OVZA 4W9IA 3AEEB 1WR1A 2BVCA 4M01A 4QAYA 1J19A 3N20C 4GDKB 5T8IA 1E8ZA 3DBLB 1EU4A 4A55A 4KGRA 4US9A 1TBEA 1YX6B 3L10B 4N59A 2N7JA 1HZ6A 2WDRB 3PVLA 2W9NA 4USAA 4W9GA 3MJWA 4R3DA 4JWSC 3AE9B 3DWMA 3HRDD 4W9LA 4K1RB 4S0RA 1VZ6A 2YLMA 2GBJA 2BS3B 2MBEA 1SE2A 3RZFA 1M94A 2REXA 3RNEC 1KLVA 3SHQA 3EFUA 5JZEB 1ZGUB 3IBEA 2V1YA 2LGXA 2DZJA 3JYUA 5IP4D 1WXVA 2KTFA 4K3CA 4WQMA 3RZWC 3VRAB 2GLSA 2O2VB 3KVFB 4E3CA 1YJJA 4NAMA 3NG0A 2KC1A 4OHJA 1VJKA 3KH0A 1WJNA 2KAJA 3DHIC 3I57A 1I35A 2GBRA 3GS2A 2K1FA 5IN7A 2ICIA 1WXQA 3I9V1 4JL9A 5BMIA 4HLEA 3AE7B 2GMIC 1C4AA 1N61A 1WIAA 3VVWB 4NY0A 1WGGA 2N0SB 3P1MA 2KYWA 3DHGC 1E5WA 4MH8A 3ZRFA 2NVUI 2G1EA 4MSQB 2XNAC 2G9HD 1Q5WB 2GOWA 2L05A 1C79A 3O13A 2JXXA 3V61A 5HI1A 2IO0B 2FNJB 3ZW3A 4EE2A 2L52A 4BBNC 3SU8X 3HUIA 5LXIB 3UQBA 4HPMB 5EE1A 4MJSA 3ML9A 3B08A 2CHZA 3ONSA 3U8ZA 1L4ZB 3VTVA 4ANVA 2XK5B 3AE8B 2KWUB 2ZPYA 5TSSA 4KX6B 1XT9B 1E7VA 1N5XA 1HA5A 1IBXB 1HEZE 4ZDVA 1V1PB 2KQ7A 3GB1A 2BS4B 3PO0A 4BKGA 4GDLB 3VH3B 4OVVA 3B1LX 3R7QA 1VRAB 1OQRA 3U30A 3A33B 3BK2A 1HE8A 1WX8A 3UIOB 4A8XC 4FLHA 2PIAA 1I42A 1FFUA 1FXTB 3W1SC 2L76A 4AOFA 3EC8A 2B76B 2AQ3B 3PLUA 2BB5A 2K8HA 2V3NA 3ZGZA 3MHSD 4ICVA 3EGRA 4MDKE 3VR9B 4IWPA 4EOYA 5H92C 4G0NB 4I6NB 4IW0A 1P0RA 2LUEA 2KQSA 3QIJA 4FJYA 3DBSA 1WRDB 1XLPA 1AARA 5CHFA 3TUOA 3V6CB 5D3DA 3FC4A 2JZZA 1IP9A 4A20A 2NBWB 3PPAA 1TIFA 1MPEA 1PGXA 2J4XA 2KO3A 2VRRB 2I1KA 2KQ4X 2W55A 2V0GA 2K8BA 2VH2A 3APCA 1FPYA 2KKCA 4W9HA 1WXSA 3HHMA 1AYFA 4RFBA 4IDIA 2J7QB 3BYTB 2QJLA 1C76A 3Q69A 4LNKA 2BF8B 4EUTA 2KLGA 3TMPB 2Y5BB 1I4HA 2FCNA 3TEWA 4ZYSA 4EKUA 1OQQA 3FILA 4W9CA 2MH7A 5EE9A 1UELA 3TBLD 1NENB 3TEYA 2DNFA 4M0WB 5CTRC 1KOTA 1GAQB 4LNIA 2JRIB 5D6JB 1D5MC 1L0YB 4FJVB 1P9DU 3X0WA 1GB4A 2KN4A 4M0WA 2DYBA 2L1AA 4MM3A 4N9F4 2GI9A 4IOIE 2DLBA 4FHKA 2GBNA 5E6PA 2DAJA 2BWES 3RYTA 1CMXB 3WIMA 1KFYB 4NJ6A 4LNOA 2KZRA 1MI0A 2IJ0A 3RT3B 1WR6E 3I3TB 2OOBB 2UU7A 4NJ7A 2ONQA 3A1QB 3PSEB 2HE7A 3PLVA 3A4RA 4F7ZA 2FE8A 3ZYYX 1WXMA 2I1JA 1FNWA 2K8CA 2LWPA 4AJWA 3SEBA 1IBXA 4G3XB 2D3GA 2JXTA 2Q5WD 4GDKA 4YXDB 2QCZA 3AMZA 4IWOA 5HKHA 1YIWA 1WJ4A 2BB6A 2Y3AA 3BVGA 4PYZA 2WLBA 1XLQA 1MG4A 1XEEA 1TS4A 3WAOA 2RD0A 3KYCD 4LCDE 4YSYB 1ISNA 1TYGB 4XDCA 2D3CA 3I63C 3UGBB 5G5GA 2IO1B 2MBBB 2OJWA 1ESFA 1D5ZC 1TT5B 4PT5A 1F2RC 2KACA 3NS8A 2OHFA 1TJEA 2C7HA 1OEYJ 3TEXA 1UNSA 4TKNA 2M4NA 3MC8A 3R2TA 2HTHA 2MP2A 3KYDD 1YOVB 2RGFA 2R2OA 2WS3B 1E8XA 3M63B 4AQ7A 2L32A 4I6PA 4EFOA 4B0EA 4BKSD 1EF1A 2LRWA 3A4SC 2K39A 3N3KB 1JROA 3NOBA 2DYOA 1L6VA 3ZVVA 2XN9C 3ZTDA 4HKZE 1JCKB 1CJEA 5H8YE 4WJQA 2XK5A 2WXQA 4OVUA 2KTRB 2NMQA 1D4BA 1YQBA 4DHJD 1FFVA 4KVGB 1J7AA 2L0FA 2KVRA 4DHZB 1FXIA 5G5HA 1SXTA 2RDBC 5I4DA 4MSMB 4B6WA 3HK0A 2VZKD 4WJNA 1YNTE 2HJ1A 1QT9A 1C3TA 2M17A 5E6NA 2W54A 2KJHB 1C78A 2E3TA 1QZEA 3A9JA 3J9CA 2N9XA 2UWQA 5CHVC 1T6BX 1JWMD 3M62B 2WXOA 1K50A 2AQ1B 1PUTA 3RNFC 3H9DA 4ANXA 1J0GA 2ON8A 1D6EC 1V9JA 4C7ZA 2NPTA 2N1WA 3V6EB 2KMCA 2KFJA 1K51A 3T8MA 3RFZB 1I7HA 4GU2A 2BPSA 3NZSA 3KW5B 4P7IA 2Y5CA 3P4RB 3L4PA 1IPGA 3OLMD 3PRMB 3DBHB 3GZNB 2KLCA 3AEAB 2DX5B 4M8NA 1Y8RC 3RULA 2J53A 2LASA 3R7RA 1ZKHA 3L13A 2J0KA 4XZ4A 5IOIA 1V2YA 2L8JA 3M95A 3Q2AC 3PGEA 2M8SA 3NY5A 4HPLB 4IG7B 1FO4A 2NS5A 4JE3B 1GC6A 4IUMB 3HVZA 1S1QB 2QILA 1E6EB 1HTOA 2LJIA 1V1OA 3MC9A 5DPTA 1I4GA 1V86A 4NQKE 4GDLA 2M0AA 5AZHA 3SR6A 4URKA 1XXGA 1AN8A 1NYRA 2LXAA 1X1MA 4CHKA 4MELA 3P4SB 2JPHA 3P4PB 5MPOA 2WDTB 2X8XX 3NVZA 4M02A 1R4NI 1ROEA 5D3IB 2LZ6A 2KFKB 1GJZA 2Z8LA 3VQIA 1V80A 1FCLA 4MJSB 3AECB 2OEDA 4GIVA 1E7UA 1XQQA 5JXVA 3QQ8B 3VTUA 2GRIA 3QHTA 4IM3A 1ENFA 4KSLC 4KGSA 1YJIA 5JH5C 1IUEA 3AXCA 2YEPF 2QEJC 3BZDB 2R61A 3U7ZA 2IY0B 3RMKC 4A6QA 3ZIMA 3DBLI 3OAWA 1WWTA 3QWZB 3DVNV 4FJZA 1JQ4A 3NZ3A 4JIOU 2KT7A 4KDIC 4MEMA 1T3QA 2BS2B 1L0VB 3X23A 3GOEA 3DHHC 1E10A 3LDZE 1CK1A 1F52A 1YMHE 4RMAA 1A70A 2DZMA 4S17A 1S3SG 3BK1A 4N6EB 2MEKA 4B9KA 3KUCB 4F1SA 2PJHA 2W3RA 3LYYA 4FXCA 2WDVB 3WALA 1V1PA 1RLFA 1Q1OA 2FCSA 3ETRA 1VCBA 5G2NA 2CJNA 2JYEA 2QDFA 2JU6X 2K5PA 2A5UA 4FADA 2LGYA 3GZNI 3HM6X 2KWDA 3E9SA 1UH6A 3ZLZA 1XLNA 3PT2B 2YVCA 4C56C 3FAHA 1L6UA 1T0QC 2QMTA 3APDA 1L7YA 3DBRB 3T3OA 2KX0A 1K53A 1JWAD 3W5VB 1ZP0B 2KDBA 2RDHA 2MQJA 1J8CA 1TTNA 3DQVA 2Z0DB 2RPVA 2G45B 2YEPB 2ZCBA 2I38A 2BQQA 3R8BA 2DAFA 1PYWD 4FN2A 5C23A 1VR9A 4XE0A 5HG2A 1P98A 3OWEB 2INCC 2FCQA 1V81A 3C0RB 5HFYA 2BKRB 1KRHA 1SGHA 4ZHPA 2WXLA 4YL8A 2N9KA 3HVDA 1WMHA 4P1BC 2BYEA 3S2AA 1SE3A 5LLIA 3V3XA 2L83A 2IZVB 3WCQA 2JWZA 3AE3B 4MACA 3BYYB 1NYQA 3M3JA 1KLUD 2BBCA 1GG3A 2D07B 4WWOA 2WYQA 2K22A 2BWFA 3GE3C 4II3B 2JVCA 4ZOHC 3VH4B 2ZJDA 3MFGA 1N6ZA 3GE8C 2UYZB 2MBHA 1RRBA 2M0XA 2WHIA 5FKAC 1FCCC 1CQVA 2IGGA 4M8MA 1WM3A 1NDDA 2D3AA 2FUG1 2RPQA 4AP4C 4BVUC 1EWCA 3IHPC 1F2RI 4ANUA 2PVGC 3W1SA 3SDLC 4A90A 1FM0D 4JX1C 2K25A 3UIPB 2ZPNA 5AEKB 3H6NA 4A3OA 1N62A 4RCOA 1OTRB 2XBBC 1WE6A 3PHWB 2IYDB 4P16A 4X57B 3KQ4A 1KLGD 2LUMA 2RDGA 3NHEB 2KVZA 4K7SA 4DDID 2JX5A 2EMTA 1QKZA 3Q8CA 1L5PA 4C4VB 1KTKA 1UGMA 2NTTA 1UGJA 4HPPA 3AM9A 1WGYA 4JGHB 2WXJA 1YX5B 1E0ZA 3N1XC 2ZVNA 3Q8AA 4C4VA 2CR5A 2JYTA 2DENB 2AL3A 4H2AA 4NPNA 3PZDA 1E8YA 3B2FA 2AQ2B 1JRPA 2LEKA 1E90A 4EZLA 2K3UA 2PKOA 2FUHB 1C4CA 2C5LC 4FULA 3QARA 4KGTA 1KH0A
chains in the Genus database with same CATH topology
1TKEA 2INNE 1YN3A 4ZRQA 1BXTA 1JROA 2DYOA 2I2YA 1L6VA 1ZDXA 2JQRB 4OZBA 3KWLA 1QQRA 2ACZB 2XN9C 5C2TB 4HKZE 2QSDA 1R7SA 1JCKB 1CJEA 1E9MA 5H8YE 1I4XA 1DOIA 2WXPA 1WSPA 2WXQA 3TEZA 1N5WA 1YQ4B 3MHZA 1P7FA 1VDVA 3FILB 2W82A 2NMQA 1WYGA 3AH7A 3BVMA 4UDUC 5GXGB 4YTNB 4XWTA 1D4BA 5BYQA 1MHHE 1QILA 2WXKA 1FFVA 1QOFA 1FEHA 3IT6B 3PZ8A 4JPSA 1J7AA 1NI3A 4L23A 1EWYC 1FRDA 1FXIA 1YQ3B 3AE2B 5G5HA 1L4DB 1SXTA 2BW2A 2ZW0A 5I4DA 4L1BA 3ZJUA 1PFDA 2VZKD 4YTPB 3RPFC 1YNTE 1YN5A 1QT9A 4WAFA 4NZLB 4HROA 1SB3C 2W54A 4HKQA 4NAWB 1XLOA 2EKIA 4OW0A 2DYMA 2J42A 3BIID 1C78A 1BMLC 1TS3A 2E3TA 2LFIA 1ACCA 3J9CA 1DYQA 1Q10A 3ABVB 1SEBD 1T6BX 3V05A 1JWMD 3CIRB 2WXOA 5BMGA 1JWSD 1K50A 3AEDB 2V3PA 1K52A 2AQ1B 1PUTA 4RH6A 5EE0A 4WWMA 2MJEA 1E7PB 1NVID 1HQRD 4L2YA 4OVZA 2ON8A 1D6EC 1L0XB 4C7ZA 3AEEB 2LHEA 1TY0A 3EUB2 3NS1A 2SEBD 3AV8A 3NUHB 1K51A 2JSVX 1SBBB 1GOZA 1QF6A 1DGJA 1J7BA 2NTSA 3AE1B 3RFZB 4GDKB 1I7HA 3AB5A 5T8IA 3IAS1 2ZW1A 3W9CB 1EU4A 4A55A 4KGRA 2Y5CA 3LB8C 3P4RB 4US9A 3L4PA 3CWIA 2WDQB 4N59A 1FD6A 2N7JA 3AEAB 1HZ6A 2WDRB 2WXNA 3N9YC 1ET6A 2GB1A 3AE4B 5FK9C 1PGAA 4USAA 2J53A 2LHDA 5BYRA 4OZCA 2D5GA 4R3DA 4JWSC 3AE9B 3DWMA 1C4PA 3HRDD 3ZJTA 1VZ6A 2W3SA 2BS3B 2H88B 3URYA 1SE2A 4ITKA 3AEFB 2KMMA 1FO4A 2MJDA 2K9XA 4RF0A 1SSNA 2TSSA 1MVKA 2BT6A 4JE3B 3HVZA 2WXMA 2QILA 1E6EB 2LJIA 1V1OA 1I4GA 4WQMA 1JALA 3VRAB 2IPKD 2WXHA 2M0AA 5HG2A 3SR6A 3Q8EA 1YJJA 4NAMA 1XXGA 1AN8A 1NYRA 4OHJA 1VJKA 1F0ZA 3P4SB 1IGDA 3P4PB 1UUPA 2BTEA 2KAJA 3I57A 5MPOA 1ET9A 3GS2A 2ICIA 1WXQA 3I9V1 3NVZA 1C9FA 1ROEA 5D3IB 5BMIA 2J52A 2Z8LA 3VQIA 3AE7B 1FCLA 3VR8B 3AECB 1VZ8A 3GP7A 4N58A 1SE4A 2OEDA 1BUIC 1C4AA 1N61A 1MHXA 5JXVA 2N0SB 3P1MA 2EELA 1EM7A 2GRIA 1ENFA 4MH8A 4KGSA 4TMAB 1YJIA 2WNMA 2G1EA 3P63A 3U2SC 2KDMA 1IUEA 2XNAC 4GLSC 1AW7A 2YEPF 2G9HD 2IGHA 2WXIA 2QEJC 3BZDB 3LXFA 2X38A 2R61A 1C79A 3O13A 3U7ZA 4A6QA 1F77A 1TKYA 4KKJA 1STEA 3ZJVA 1B1ZA 3KLSX 5HI1A 1WWTA 2PMVA 3Q8BA 4EE2A 1CZPA 1XCQL 2L52A 3DWGC 3IT4B 2LGIA 1JQ4A 3HUIA 1QOBA 5EE1A 4RGMA 3NZ3A 2BYTA 1FNVA 4ZHOA 1L4ZB 3AE8B 1V97A 5LNK1 4RNAA 5E6JA 1SJHD 1T3QA 5TSSA 4KX6B 2BS2B 3EA6A 1L0VB 2SAKA 1KF6B 4ARCA 1N5XA 1ZE3D 1HA5A 1IBXB 1HEZE 1FRRA 1C77A 1IGCA 4WIPA 1V1PB 1E10A 1J7CA 3GB1A 2BS4B 3PO0A 1JWBD 1CK1A 1TKGA 1ZXHA 4GDLB 1YMHE 4MM3B 4P6VF 1VRAB 1OQRA 1A70A 3BK1A 4HRSA 4N6EB 2MEKA 2MJ3A 3BK2A 2W3RA 5HHDG 3LYYA 4LTUA 4A8XC 4FXCA 2PIAA 2WDVB 1Y56A 1V1PA 1FFUA 3NVVA 5C3JB 5D7GA 3U4EG 1DOYA 2B76B 1I4PA 2AQ3B 2BB5A 4YT0B 3ETRA 2V3NA 4C80A 1QOGA 3ZGZA 2CJNA 2JYEA 2JU6X 2K5PA 1WRIA 3EGRA 3VR9B 4TSSA 4XWWA 2KWDA 3E9SA 5H92C 3T3NA 1XLNA 1I4RA 3U52E 2K0PA 3IAM1 4C56C 5AUIA 1L6UA 3FAHA 2QMTA 3T3OA 1XLPA 1YN4A 3TUOA 1K53A 1JWAD 2N9LA 4LK0M 3W5VB 5D3DA 1V8CA 1ZP0B 3AE5B 1ZPSA 2WU5B 2CJOA 4YWGG 3FC4A 2RDHA 1RWSA 1MPEA 4A9AA 1FNUA 1ZXIA 2PTLA 2RPVA 2JZPA 1PGXA 2WXGA 2YEPB 2LMCA 2J4XA 3P42A 1XF5L 2Y5PA 2KQ4X 2W55A 2V0GA 2I38A 3R8BA 1PYWD 3MC0B 1RFKA 4MT5A 1TY2A 1AYFA 1VR9A 1NEKB 1SF0A 4IDIA 4KKIA 4RFBA 4XE0A 3BYTB 2QJLA 3OWEB 1C76A 3Q69A 3SFEB 2FBWB 2DWQA 3AN1A 3MJ5A 4ARIA 1T5XD 3B2GA 1TZOA 1ZUD2 1I4HA 4US8A 5HFYA 1KRHA 2H89B 2WP9B 4CQNA 4ZHPA 3TEWA 4ZYSA 2WXLA 3IXSA 3TSSA 3W5UB 1OQQA 2N9KA 3FILA 3HVDA 1GPXA 1RM6C 1WGKA 2MH7A 5EE9A 1SE3A 1NENB 1XCTL 1ZOYB 3C8YA 3V3XA 2L83A 4RGOS 3TEYA 2AX5A 3WCQA 3AE3B 4MACA 1RYJA 3BYYB 1GAQB 3UI3A 1NYQA 4Q2JA 1D5MC 1L0YB 1KLUD 1PGBA 2BBCA 1PDXA 5BYSA 1GB4A 4DQOC 2K22A 2E6XA 3AE6B 3MP9A 2KN4A 1N63A 1D5XC 4M0WA 4WH4A 4HJGE 2L1AA 2PW9A 4ZOHC 1FMAD 2QIEB 2GI9A 3B9JA 4IOIE 2DLBA 4YSZB 3P4QB 1P7EA 3E56A 3MFGA 1UWXA 3Q8FA 3SFDB 1KFYB 1FIQA 1GB1A 4IKGA 4AS1A 1N60A 2HDEA 1QOAA 5FKAC 1DOXA 1FCCC 3PZ7A 1CQVA 1VZ7A 2IGGA 1MI0A 2IJ0A 5AUKA 3NVWA 4DXGA 4OZAA 2FUG1 1VLBA 2PLPA 2ONQA 2INPE 4TQ0A 1EWCA 4LLGM 2DBYA 1F2RI 4NJCA 4O1NA 3NRZA 2PVGC 3W1SA 3AEBB 4A90A 1FM0D 5BMHA 2FE8A 4JX1C 3ZYYX 1XO3A 1EU3A 1SJED 1FNWA 1N62A 3SEBA 4RCOA 5FR3A 1IBXA 4B0MA 2JXTA 2Q5WD 1ZDVA 4P16A 3ZQ4A 4YXDB 5EE3A 3AMZA 1B9RA 2WU2B 1TS5A 3KQ4A 1OFFA 1QLBB 1UWMA 2BB6A 2Y3AA 3BVGA 1KLGD 2LUMA 2RDGA 3AEGB 4TQ1A 2WXFA 2V4IB 4RGNA 2WLBA 1XLQA 2JX5A 2VZKB 1JMLA 1QKZA 3Q8CA 1L5PA 1XEEA 1TS4A 1LO5D 2IGDA 4WURA 1KTKA 1JW9D 4JWUC 4YTMB 2NTTA 2IDYA 4YSYB 1M4VA 1TYGB 1UGJA 3NVYA 4REZA 4XDCA 4RF1A 1TS2A 3BVZA 1JWUD 1AWDA 4HEA1 5G5GA 1FXAA 2M56B 3AM9A 1ESFA 1D5ZC 4PT5A 1F2RC 2WXJA 1E0ZA 1HZ5A 2KACA 4YSXB 3Q8AA 2OHFA 1TJEA 2CU3A 4RGTA 3W2DA 2JYTA 3TEXA 1UNSA 2HTME 2PVOD 4H2AA 3R2TA 1HXYD 1SIJA 3H8HA 3B2FA 2AQ2B 3BWUD 2WQYB 4J3OD 1JRPA 4D2KA 2WS3B 2LEKA 4AQ7A 2K3UA 4C7YA 2L32A 3VRBB 4ZRPA 2PKOA 2M19A 4XDDA 3KWVA 4DXFA 2RMMA 1C4CA 3R2IA 1I4QA 4B0EA 4KGTA 2WXRA 1KH0A 2JWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKE A;  3AE9 B;  1TKG A;  3DWM A;  4JWS C;  1PDX A;  3HRD D;  1JRO A;  1GPX A;  2K22 A;  3AE6 B;  1L6V A;  4P6V F;  1OQR A;  2JQR B;  1A70 A;  2W3S A;  1N63 A;  3KWL A;  4HRS A;  2BS3 B;  4N6E B;  2H88 B;  2ACZ B;  4ITK A;  2MJ3 A;  4ZOH C;  5C2T B;  2QIE B;  3AEF B;  2KMM A;  1FO4 A;  2W3R A;  1R7S A;  2MJD A;  2K9X A;  3B9J A;  4YSZ B;  4LTU A;  4FXC A;  2PIA A;  3P4Q B;  1CJE A;  2WDV B;  1E9M A;  5H8Y E;  2BT6 A;  1FFU A;  3NVV A;  3SFD B;  1DOI A;  5C3J B;  3HVZ A;  1KFY B;  1FIQ A;  1E6E B;  1DOY A;  2B76 B;  1N60 A;  1QOA A;  4YT0 B;  1DOX A;  1N5W A;  1YQ4 B;  3ETR A;  4WQM A;  1QOG A;  4C80 A;  2CJN A;  1VDV A;  1JAL A;  3VRA B;  1WYG A;  2K5P A;  3AH7 A;  5AUK A;  5GXG B;  3NVW A;  1WRI A;  4YTN B;  3SR6 A;  3VR9 B;  1YJJ A;  1VLB A;  1FFV A;  1NYR A;  5H92 C;  1QOF A;  1VJK A;  1XLN A;  2DBY A;  1F0Z A;  3P4S B;  3NRZ A;  1J7A A;  2PVG C;  3P4P B;  1NI3 A;  3AEB B;  5AUI A;  2KAJ A;  1L6U A;  1FM0 D;  3FAH A;  1XLP A;  4JX1 C;  3ZYY X;  1EWY C;  1FRD A;  1FXI A;  1XO3 A;  1YQ3 B;  3AE2 B;  5G5H A;  5MPO A;  3W5V B;  1JWA D;  1WXQ A;  1N62 A;  3NVZ A;  1V8C A;  1ZP0 B;  3AE5 B;  1PFD A;  1ROE A;  2CJO A;  2WU5 B;  3RPF C;  3FC4 A;  4YTP B;  1QT9 A;  3AE7 B;  2Q5W D;  3VR8 B;  4YXD B;  3AEC B;  1SB3 C;  4HRO A;  5EE3 A;  3AMZ A;  4N58 A;  2W54 A;  1B9R A;  2WU2 B;  1N61 A;  1XLO A;  2EKI A;  1RWS A;  1OFF A;  1QLB B;  4A9A A;  1UWM A;  1ZXI A;  2N0S B;  3BII D;  3P1M A;  2E3T A;  3AEG B;  2WLB A;  1XLQ A;  1YJI A;  2JX5 A;  2G1E A;  3ABV B;  3P63 A;  2W55 A;  1L5P A;  1IUE A;  3CIR B;  1JW9 D;  4JWU C;  4YTM B;  3AED B;  1RFK A;  1PUT A;  5EE0 A;  3LXF A;  4WWM A;  2MJE A;  4YSY B;  1TYG B;  1E7P B;  3NVY A;  1NVI D;  1AYF A;  1NEK B;  1SF0 A;  1TKY A;  4IDI A;  2QJL A;  5G5G A;  1AWD A;  4C7Z A;  1FXA A;  2M56 B;  3AEE B;  3AM9 A;  2FBW B;  3SFE B;  2DWQ A;  3AN1 A;  3EUB 2;  1WWT A;  3NS1 A;  3B2G A;  4YSX B;  1CZP A;  3AV8 A;  2L52 A;  3DWG C;  1E0Z A;  1QF6 A;  2OHF A;  1TJE A;  1ZUD 2;  1JQ4 A;  1DGJ A;  2CU3 A;  3HUI A;  1J7B A;  4US8 A;  3AE1 B;  1KRH A;  1QOB A;  2H89 B;  2WP9 B;  5EE1 A;  2HTM E;  2PVO D;  4ZHP A;  1I7H A;  3AB5 A;  1SIJ A;  4ZHO A;  3W5U B;  3W9C B;  1OQQ A;  3AE8 B;  3B2F A;  2Y5C A;  1V97 A;  2WQY B;  1JRP A;  3LB8 C;  3P4R B;  1RM6 C;  2WS3 B;  3L4P A;  2LEK A;  1WGK A;  4US9 A;  2MH7 A;  5EE9 A;  1T3Q A;  1NEN B;  3CWI A;  2BS2 B;  2WDQ B;  4KX6 B;  1ZOY B;  4N59 A;  1L0V B;  3AEA B;  2WDR B;  1KF6 B;  2L83 A;  3AE4 B;  4C7Y A;  2AX5 A;  3VRB B;  3WCQ A;  1N5X A;  2PKO A;  2M19 A;  3AE3 B;  1FRR A;  1RYJ A;  4USA A;  1GAQ B;  1J7C A;  1E10 A;  1NYQ A;  2BS4 B;  1FMA D;  3PO0 A;  1JWB D; 
#chains in the Genus database with same CATH topology
 4ZRQ A;  2INN E;  3ZNZ B;  1BXT A;  1ZDX A;  1R4M B;  1OGW A;  5JHA A;  2QSD A;  3QJZ A;  3ZO5 B;  2WXP A;  1N5W A;  4E74 A;  3FIL B;  4UDU C;  2NBV B;  5GXG B;  3RD2 A;  3IT6 B;  3PZ8 A;  2JT4 B;  2N7D A;  1NI3 A;  3ZTC A;  1EWY C;  2C9W B;  4DDG D;  3DVN U;  1H8C A;  4YTP B;  4WAF A;  4HCP B;  5CX3 A;  3I5J C;  4HRO A;  4HXD A;  4IC7 B;  4NAW B;  4OW0 A;  5D2M B;  2N7E A;  3ZNH B;  1GUA B;  3VHT C;  1Q10 A;  3ABV B;  1SEB D;  1Z2M A;  3JVZ X;  3APF A;  1JWS D;  4MH0 E;  2V3P A;  5EE0 A;  4RH6 A;  1NVI D;  1WFY A;  3QCA A;  4L2Y A;  3K9P B;  1L0X B;  4KIK A;  3EUB 2;  3NS1 A;  2SEB D;  3A9J B;  3NUH B;  1SBB B;  1GOZ A;  2V3S A;  1J7B A;  3L54 A;  2NTS A;  3AE1 B;  2L3Z A;  3AB5 A;  2N4F A;  3IAS 1;  2WGS A;  2ZW1 A;  3LB8 C;  3IVF A;  2KWV B;  2IO2 B;  1MJD A;  3CWI A;  1FD6 A;  3AE4 B;  2GB1 A;  5FK9 C;  1PGA A;  2LHD A;  5BYR A;  2Z0E B;  2D5G A;  4W9E A;  1KJT A;  1C4P A;  3ZJT A;  2KOX A;  2W3S A;  1C1Y B;  1WI0 A;  3URY A;  3AEF B;  2KK8 A;  2MJD A;  4GB9 A;  4RF0 A;  2TSS A;  3VTW A;  2BT6 A;  1P3Q U;  2WXM A;  2IY1 B;  2KNB A;  2LGS A;  1GNU A;  3ZDT A;  1TGZ B;  4FBJ B;  4C00 A;  2WX0 A;  3VDZ A;  1F0Z A;  1IGD A;  1UUP A;  3KUZ A;  4II2 B;  1UBI A;  2KHW B;  2ZVO A;  1C9F A;  2J52 A;  3QK0 A;  5J18 A;  2PE9 A;  3VR8 B;  4HWI B;  1JRU A;  1UD7 A;  1VZ8 A;  1WZ0 A;  4N58 A;  3GP7 A;  3DVG Y;  1WGH A;  1WXA A;  4M00 A;  2KJ6 A;  2EEL A;  1SE9 A;  3HM3 A;  4JLC A;  2RSU A;  2KDM A;  3BY4 B;  1AW7 A;  2KAN A;  2IGH A;  4A3P A;  1WY8 A;  2EMS A;  3L17 A;  5BO4 B;  1F77 A;  4KKJ A;  2ASQ A;  1STE A;  3DOW A;  5AZG A;  2GBM A;  1BT0 A;  1UZX B;  1WF9 A;  1CZP A;  1A5R A;  2LGI A;  2L0T A;  4MGY E;  2FIF A;  1QOB A;  2KXJ A;  2KMA A;  4CO7 A;  2BYT A;  4KSK C;  2KTR A;  1YJ1 A;  1V97 A;  5LNK 1;  2BYF A;  1WGR A;  2BGF A;  3EA6 A;  1KF6 B;  1WJU A;  2MWS B;  1FRR A;  4P1C C;  3K9O B;  1D3Z A;  2JUO A;  2PEA A;  1TKG A;  4ZRJ A;  3PRP B;  4LNF A;  4CYE A;  4GGQ A;  2KDE B;  2MJ3 A;  4DHZ E;  1LXD A;  3N1Z C;  5HHD G;  2ZNV B;  3Q3O C;  4BKS A;  5E6O A;  2G4S A;  3WA0 A;  3NVV A;  5C3J B;  1HTQ A;  3CF6 E;  1DOY A;  5FR6 A;  4C80 A;  1QOG A;  4LJO B;  1ZW7 A;  4TSS A;  4XWW A;  4MGZ E;  4KV2 A;  3H7S A;  1I4R A;  1Q0W B;  3U52 E;  3IAM 1;  5TR5 A;  2IO3 B;  5AUI A;  3VXW A;  2KN5 A;  2ZZP B;  4ZRK A;  3AE5 B;  1R4N B;  1ZPS A;  2WU5 B;  1LQB A;  4BOS C;  3PS6 A;  1RWS A;  4BZA A;  2L7R A;  3TL5 A;  2PTL A;  4ACF A;  2JZP A;  5JHB A;  3OG5 A;  2Y5P A;  3AUL A;  2EKE C;  3TIX A;  3Q3F A;  1H4R A;  3MC0 B;  1RFK A;  5DCN A;  4EEW A;  1WYW B;  1SF0 A;  4ZRI A;  4KKI A;  3ZKJ C;  2OJR A;  1WX7 A;  4ARI A;  2KDF B;  1T5X D;  2VH1 A;  1TZO A;  1ZUD 2;  2N9E B;  4LNN A;  3ZXV A;  2H89 B;  2WP9 B;  3EEC A;  3MTN B;  1WGK A;  1P1A A;  3C8Y A;  2CHW A;  5KHQ A;  2KDI A;  4TUU A;  2LXC A;  4Q2J A;  1PGB A;  2MW5 A;  1PDX A;  5BYS A;  3FKY A;  4B95 A;  1V49 A;  3AE6 B;  3QC8 B;  4WH4 A;  4HJG E;  3AU4 A;  2PW9 A;  2QIE B;  4YSZ B;  3P4Q B;  1P7E A;  3E56 A;  3ML8 A;  1UWX A;  3QAQ A;  1FIQ A;  4RM8 A;  4AS1 A;  2M1M A;  4XX5 A;  1F9J A;  2HDE A;  3Q3N C;  3ALB A;  1IYF A;  1DOX A;  3U7D A;  3PZ7 A;  1Z5S B;  1V5O A;  4KZC A;  5AUK A;  4DXG A;  2PLP A;  3PV1 A;  2INP E;  4LLG M;  2G3Q B;  3VUY A;  3NRZ A;  2NPT B;  3NZU A;  2L00 B;  3AEB B;  2D10 A;  4AWJ A;  1XO3 A;  4MGI E;  4XGA B;  5FR3 A;  4B0M A;  4GN1 A;  1WX9 A;  3JSV B;  3ZQ4 A;  1B9R A;  1TS5 A;  2N9P C;  4WAA A;  1OFF A;  1QLB B;  2MRP A;  4TQ1 A;  2WXF A;  2BKF A;  2DHZ A;  5GMV A;  2VZK B;  3RNB C;  1JML A;  4ASW C;  3VUX A;  3RUI B;  4EZJ A;  1LO5 D;  1MG8 A;  4YTM B;  2IDY A;  1M4V A;  3IFW B;  3NVY A;  4RF1 A;  1JWU D;  1AWD A;  2JZ3 B;  4WQO B;  1HZ5 A;  5DPS A;  1WM2 A;  4EZK A;  3D32 A;  3KUD B;  2CU3 A;  4RGT A;  3ZDM C;  2KJR A;  4DK5 A;  4W9J A;  2CHX A;  2HTM E;  2G4D B;  3JSV A;  1HXY D;  2J0J A;  4IWQ A;  3BWU D;  2WQY B;  2LGD A;  1T0S C;  4KDL B;  3VRB B;  4IM2 A;  4XDD A;  3KWV A;  2C7M B;  2RMM A;  3R2I A;  3WAN A;  2WXR A;  4KZ0 A;  2JWU A;  1FMA D;  2I2Y A;  1RAX A;  4OZB A;  1R7S A;  1E9M A;  2CKH B;  1I4X A;  1DOI A;  2DZI A;  3VFK A;  3TEZ A;  1YQ4 B;  1SIF A;  2WX1 A;  2IBI B;  2W82 A;  3BVM A;  4ICU A;  1MHH E;  1UF0 A;  2WXK A;  3R3M A;  3B0A A;  1EF5 A;  1KM7 A;  2ZNV C;  3V62 A;  1FRD A;  1YQ3 B;  3AE2 B;  1L4D B;  2BW2 A;  3ZJU A;  4HK2 A;  1YN5 A;  4NZL B;  2MCN B;  4BBN F;  4HKQ A;  2EKI A;  2J42 A;  4GSW A;  1TS3 A;  1ACC A;  1DYQ A;  1PQS A;  3ZNI D;  2CU1 A;  1L2N A;  3RCZ A;  2A4Z A;  5BMG A;  4TV3 A;  2WWZ A;  4WWM A;  2MJE A;  2PE6 B;  2JRH A;  3UIN B;  1HQR D;  2KC2 A;  1YD8 U;  2LHE A;  1TY0 A;  2QC8 A;  1WGD A;  2MHJ A;  3AV8 A;  2LVQ A;  1QF6 A;  2JSV X;  5IO9 A;  1DGJ A;  3R66 C;  3WAM A;  2R2Q A;  3W9C B;  2O2V A;  1G6J A;  3QX1 A;  2FAZ A;  2WDQ B;  2WXN A;  3N9Y C;  1ET6 A;  4E71 A;  1F1H A;  3P2B A;  4OZC A;  3RNG C;  1EUV B;  2FCM A;  3V60 A;  3RI7 C;  4K81 A;  4WWP A;  3AU5 A;  3H7P A;  4PS7 A;  2DZK A;  2H88 B;  3OJ3 A;  3CSF A;  4ITK A;  4NQL B;  2KMM A;  2K9X A;  2C60 A;  1SSN A;  1MVK A;  4W9D A;  3LJ3 A;  4LDT D;  1T0Y A;  1JAL A;  2IPK D;  2WXH A;  4K3B A;  2MP2 B;  2QHO A;  3Q8E A;  3ZNG C;  3Q3M C;  4HDQ A;  2KX3 A;  2O6V A;  2BTE A;  2MSE D;  4WJO A;  3PTF C;  2J0M A;  5DPW A;  1ET9 A;  3AI5 A;  2K6Q A;  2AWT A;  2LVO A;  5G55 A;  2K6D B;  1SE4 A;  3Q3J A;  1BUI C;  1MHX A;  2LRU A;  4J6I A;  1EM7 A;  4NAW A;  4TMA B;  3N1Y C;  2WNM A;  3P63 A;  3U2S C;  2MLB A;  2JF5 A;  5C1Z A;  4GLS C;  2WXI A;  4RM9 A;  3LXF A;  4BFR A;  2X38 A;  3PRZ A;  1TKY A;  3ZJV A;  1B1Z A;  2AL6 A;  2PMV A;  3Q14 C;  3Q8B A;  4K7W A;  1XCQ L;  3DWG C;  3IT4 B;  3H1U A;  3EFC A;  5D94 A;  2ZEQ A;  1WJ6 A;  1OEY A;  4RGM A;  3A9K A;  2HJ8 A;  1FNV A;  4ZHO A;  5J2R A;  4DHJ B;  4RNA A;  5E6J A;  1SJH D;  4W9K A;  2SAK A;  5L95 C;  4ARC A;  1ZE3 D;  3DDC B;  4WIP A;  1C77 A;  1IGC A;  1J7C A;  3VAW A;  3VUW A;  1JWB D;  1ZXH A;  2KD0 A;  4MM3 B;  1LFD A;  4PS8 A;  4P6V F;  4W9F A;  4HRS A;  3ZXR A;  4FA6 A;  2PPH A;  5EDS A;  4LTU A;  1Y56 A;  1UBQ A;  1NI2 A;  1LM8 B;  3L16 A;  5D7G A;  3U4E G;  1I4P A;  3HIZ A;  4YT0 B;  4XYC A;  1VD2 A;  4MGK E;  3RN9 C;  3T9L A;  3TCA A;  2LJ5 A;  2HD5 B;  1WRI A;  2V9H A;  3WAP A;  2B3A A;  3T3N A;  4F8C B;  2K0P A;  2LD9 A;  5DPR A;  1YN4 A;  4ZYN A;  2O6V D;  2N9L A;  4LK0 M;  1V8C A;  4YWG G;  2CJO A;  4IM0 A;  3QA8 A;  4NNJ B;  4PK1 A;  1WZ3 A;  4HVB A;  3RNA C;  3UQA A;  1OQY A;  1WMH B;  4A9A A;  1FNU A;  1ZXI A;  2LI5 A;  4HJK A;  3DBH I;  1R4M I;  1WH3 A;  2WXG A;  3L0W B;  4WWN A;  2LMC A;  3EHV A;  4GXB A;  3P42 A;  1XF5 L;  3C19 A;  3PRE A;  4G50 A;  4MT5 A;  4XC2 A;  1TY2 A;  2CS4 A;  1NEK B;  5AZF A;  3SFE B;  3NJT A;  2FBW B;  2DWQ A;  3AN1 A;  3MJ5 A;  3ZRC A;  1MFW A;  3B2G A;  4DBG A;  1XD3 B;  5IA7 A;  2JY6 A;  4US8 A;  2GBK A;  1GC7 A;  4CQN A;  3DPD A;  3O65 B;  1RFA A;  2AEH A;  3IXS A;  3TSS A;  3W5U B;  5L83 A;  1GPX A;  1RM6 C;  4FHJ A;  2MBO A;  1U4A A;  1XCT L;  5IKC M;  1ZOY B;  3DVG X;  4RGO S;  2AX5 A;  3Q6B A;  1RYJ A;  3UI3 A;  2LVP A;  4DQO C;  3SD5 A;  2E6X A;  4JQW C;  3MP9 A;  4PYU A;  1N63 A;  1D5X C;  3A1Q A;  1K8R B;  2KWC A;  3N32 A;  3B9J A;  4K7U A;  4AUQ C;  2D2Q A;  3L08 A;  3N30 A;  3Q8F A;  3SFD B;  1T0R C;  5LXH A;  4HDO A;  4IKG A;  1GB1 A;  3DCG A;  3A9K B;  1N60 A;  3OJ4 B;  1QOA A;  1VZ7 A;  3DBR I;  5KHO A;  3NVW A;  2MBQ A;  3IG3 A;  4OZA A;  1VLB A;  4TQ0 A;  2DBY A;  4NJC A;  4O1N A;  3ZUN A;  5BMH A;  1EU3 A;  4BOZ B;  1SJE D;  4DXA B;  1ZDV A;  5EE3 A;  2WU2 B;  4WJP A;  3UF8 A;  1UWM A;  4DWF A;  3AEG B;  2V4L A;  2V4I B;  4RGN A;  4LJP B;  2IGD A;  4G11 A;  4WUR A;  1JW9 D;  4JWU C;  3CST A;  2IND C;  4REZ A;  4KIK B;  4BAX A;  3W1Y A;  4I6L B;  1TS2 A;  3BVZ A;  4HEA 1;  1FXA A;  2M56 B;  1NBF C;  4YSX B;  3W2D A;  2PVO D;  4GMV A;  1SIJ A;  3H8H A;  4J3O D;  4D2K A;  1WE7 A;  2MA9 B;  4C7Y A;  4ZRP A;  2M19 A;  3H7P B;  4DXF A;  1I4Q A;  2O6V B;  3JW0 X;  1V6E A;  3KLS X;  1EO6 A;  1TKE A;  1YN3 A;  2JQR B;  3KWL A;  1QQR A;  2ACZ B;  5C2T B;  5IAA C;  4PS3 A;  3BIN A;  3TJP A;  2MX2 A;  1WSP A;  2NCN A;  2NBU A;  3MHZ A;  1P7F A;  1VDV A;  1WYG A;  3AH7 A;  4YTN B;  4XWT A;  5BYQ A;  1QIL A;  1QOF A;  1LGR A;  3CMM B;  1FEH A;  4JPS A;  4LDT B;  4L23 A;  5CHW A;  2ZW0 A;  4ANW A;  3ECI A;  2C7N B;  4L1B A;  1PFD A;  2AYO B;  3RPF C;  1E8W A;  1SB3 C;  1XLO A;  4AJY B;  2D3B A;  1TZ1 A;  2D11 A;  2DYM A;  3BII D;  1BML C;  2ZCC A;  2LFI A;  2FID A;  4HCN B;  3ENE A;  5J17 A;  2Z59 B;  3V05 A;  4BKT A;  1V5T A;  3PHX B;  3CIR B;  4GOC A;  3RNC C;  2KFK A;  3AED B;  2XEW A;  1K52 A;  2BYV E;  2NR2 A;  1E7P B;  2RR9 A;  2N1V A;  4OVZ A;  4W9I A;  3AEE B;  1WR1 A;  2BVC A;  4M01 A;  4QAY A;  1J19 A;  3N20 C;  4GDK B;  5T8I A;  1E8Z A;  3DBL B;  1EU4 A;  4A55 A;  4KGR A;  4US9 A;  1TBE A;  1YX6 B;  3L10 B;  4N59 A;  2N7J A;  1HZ6 A;  2WDR B;  3PVL A;  2W9N A;  4USA A;  4W9G A;  3MJW A;  4R3D A;  4JWS C;  3AE9 B;  3DWM A;  3HRD D;  4W9L A;  4K1R B;  4S0R A;  1VZ6 A;  2YLM A;  2GBJ A;  2BS3 B;  2MBE A;  1SE2 A;  3RZF A;  1M94 A;  2REX A;  3RNE C;  1KLV A;  3SHQ A;  3EFU A;  5JZE B;  1ZGU B;  3IBE A;  2V1Y A;  2LGX A;  2DZJ A;  3JYU A;  5IP4 D;  1WXV A;  2KTF A;  4K3C A;  4WQM A;  3RZW C;  3VRA B;  2GLS A;  2O2V B;  3KVF B;  4E3C A;  1YJJ A;  4NAM A;  3NG0 A;  2KC1 A;  4OHJ A;  1VJK A;  3KH0 A;  1WJN A;  2KAJ A;  3DHI C;  3I57 A;  1I35 A;  2GBR A;  3GS2 A;  2K1F A;  5IN7 A;  2ICI A;  1WXQ A;  3I9V 1;  4JL9 A;  5BMI A;  4HLE A;  3AE7 B;  2GMI C;  1C4A A;  1N61 A;  1WIA A;  3VVW B;  4NY0 A;  1WGG A;  2N0S B;  3P1M A;  2KYW A;  3DHG C;  1E5W A;  4MH8 A;  3ZRF A;  2NVU I;  2G1E A;  4MSQ B;  2XNA C;  2G9H D;  1Q5W B;  2GOW A;  2L05 A;  1C79 A;  3O13 A;  2JXX A;  3V61 A;  5HI1 A;  2IO0 B;  2FNJ B;  3ZW3 A;  4EE2 A;  2L52 A;  4BBN C;  3SU8 X;  3HUI A;  5LXI B;  3UQB A;  4HPM B;  5EE1 A;  4MJS A;  3ML9 A;  3B08 A;  2CHZ A;  3ONS A;  3U8Z A;  1L4Z B;  3VTV A;  4ANV A;  2XK5 B;  3AE8 B;  2KWU B;  2ZPY A;  5TSS A;  4KX6 B;  1XT9 B;  1E7V A;  1N5X A;  1HA5 A;  1IBX B;  1HEZ E;  4ZDV A;  1V1P B;  2KQ7 A;  3GB1 A;  2BS4 B;  3PO0 A;  4BKG A;  4GDL B;  3VH3 B;  4OVV A;  3B1L X;  3R7Q A;  1VRA B;  1OQR A;  3U30 A;  3A33 B;  3BK2 A;  1HE8 A;  1WX8 A;  3UIO B;  4A8X C;  4FLH A;  2PIA A;  1I42 A;  1FFU A;  1FXT B;  3W1S C;  2L76 A;  4AOF A;  3EC8 A;  2B76 B;  2AQ3 B;  3PLU A;  2BB5 A;  2K8H A;  2V3N A;  3ZGZ A;  3MHS D;  4ICV A;  3EGR A;  4MDK E;  3VR9 B;  4IWP A;  4EOY A;  5H92 C;  4G0N B;  4I6N B;  4IW0 A;  1P0R A;  2LUE A;  2KQS A;  3QIJ A;  4FJY A;  3DBS A;  1WRD B;  1XLP A;  1AAR A;  5CHF A;  3TUO A;  3V6C B;  5D3D A;  3FC4 A;  2JZZ A;  1IP9 A;  4A20 A;  2NBW B;  3PPA A;  1TIF A;  1MPE A;  1PGX A;  2J4X A;  2KO3 A;  2VRR B;  2I1K A;  2KQ4 X;  2W55 A;  2V0G A;  2K8B A;  2VH2 A;  3APC A;  1FPY A;  2KKC A;  4W9H A;  1WXS A;  3HHM A;  1AYF A;  4RFB A;  4IDI A;  2J7Q B;  3BYT B;  2QJL A;  1C76 A;  3Q69 A;  4LNK A;  2BF8 B;  4EUT A;  2KLG A;  3TMP B;  2Y5B B;  1I4H A;  2FCN A;  3TEW A;  4ZYS A;  4EKU A;  1OQQ A;  3FIL A;  4W9C A;  2MH7 A;  5EE9 A;  1UEL A;  3TBL D;  1NEN B;  3TEY A;  2DNF A;  4M0W B;  5CTR C;  1KOT A;  1GAQ B;  4LNI A;  2JRI B;  5D6J B;  1D5M C;  1L0Y B;  4FJV B;  1P9D U;  3X0W A;  1GB4 A;  2KN4 A;  4M0W A;  2DYB A;  2L1A A;  4MM3 A;  4N9F 4;  2GI9 A;  4IOI E;  2DLB A;  4FHK A;  2GBN A;  5E6P A;  2DAJ A;  2BWE S;  3RYT A;  1CMX B;  3WIM A;  1KFY B;  4NJ6 A;  4LNO A;  2KZR A;  1MI0 A;  2IJ0 A;  3RT3 B;  1WR6 E;  3I3T B;  2OOB B;  2UU7 A;  4NJ7 A;  2ONQ A;  3A1Q B;  3PSE B;  2HE7 A;  3PLV A;  3A4R A;  4F7Z A;  2FE8 A;  3ZYY X;  1WXM A;  2I1J A;  1FNW A;  2K8C A;  2LWP A;  4AJW A;  3SEB A;  1IBX A;  4G3X B;  2D3G A;  2JXT A;  2Q5W D;  4GDK A;  4YXD B;  2QCZ A;  3AMZ A;  4IWO A;  5HKH A;  1YIW A;  1WJ4 A;  2BB6 A;  2Y3A A;  3BVG A;  4PYZ A;  2WLB A;  1XLQ A;  1MG4 A;  1XEE A;  1TS4 A;  3WAO A;  2RD0 A;  3KYC D;  4LCD E;  4YSY B;  1ISN A;  1TYG B;  4XDC A;  2D3C A;  3I63 C;  3UGB B;  5G5G A;  2IO1 B;  2MBB B;  2OJW A;  1ESF A;  1D5Z C;  1TT5 B;  4PT5 A;  1F2R C;  2KAC A;  3NS8 A;  2OHF A;  1TJE A;  2C7H A;  1OEY J;  3TEX A;  1UNS A;  4TKN A;  2M4N A;  3MC8 A;  3R2T A;  2HTH A;  2MP2 A;  3KYD D;  1YOV B;  2RGF A;  2R2O A;  2WS3 B;  1E8X A;  3M63 B;  4AQ7 A;  2L32 A;  4I6P A;  4EFO A;  4B0E A;  4BKS D;  1EF1 A;  2LRW A;  3A4S C;  2K39 A;  3N3K B;  1JRO A;  3NOB A;  2DYO A;  1L6V A;  3ZVV A;  2XN9 C;  3ZTD A;  4HKZ E;  1JCK B;  1CJE A;  5H8Y E;  4WJQ A;  2XK5 A;  2WXQ A;  4OVU A;  2KTR B;  2NMQ A;  1D4B A;  1YQB A;  4DHJ D;  1FFV A;  4KVG B;  1J7A A;  2L0F A;  2KVR A;  4DHZ B;  1FXI A;  5G5H A;  1SXT A;  2RDB C;  5I4D A;  4MSM B;  4B6W A;  3HK0 A;  2VZK D;  4WJN A;  1YNT E;  2HJ1 A;  1QT9 A;  1C3T A;  2M17 A;  5E6N A;  2W54 A;  2KJH B;  1C78 A;  2E3T A;  1QZE A;  3A9J A;  3J9C A;  2N9X A;  2UWQ A;  5CHV C;  1T6B X;  1JWM D;  3M62 B;  2WXO A;  1K50 A;  2AQ1 B;  1PUT A;  3RNF C;  3H9D A;  4ANX A;  1J0G A;  2ON8 A;  1D6E C;  1V9J A;  4C7Z A;  2NPT A;  2N1W A;  3V6E B;  2KMC A;  2KFJ A;  1K51 A;  3T8M A;  3RFZ B;  1I7H A;  4GU2 A;  2BPS A;  3NZS A;  3KW5 B;  4P7I A;  2Y5C A;  3P4R B;  3L4P A;  1IPG A;  3OLM D;  3PRM B;  3DBH B;  3GZN B;  2KLC A;  3AEA B;  2DX5 B;  4M8N A;  1Y8R C;  3RUL A;  2J53 A;  2LAS A;  3R7R A;  1ZKH A;  3L13 A;  2J0K A;  4XZ4 A;  5IOI A;  1V2Y A;  2L8J A;  3M95 A;  3Q2A C;  3PGE A;  2M8S A;  3NY5 A;  4HPL B;  4IG7 B;  1FO4 A;  2NS5 A;  4JE3 B;  1GC6 A;  4IUM B;  3HVZ A;  1S1Q B;  2QIL A;  1E6E B;  1HTO A;  2LJI A;  1V1O A;  3MC9 A;  5DPT A;  1I4G A;  1V86 A;  4NQK E;  4GDL A;  2M0A A;  5AZH A;  3SR6 A;  4URK A;  1XXG A;  1AN8 A;  1NYR A;  2LXA A;  1X1M A;  4CHK A;  4MEL A;  3P4S B;  2JPH A;  3P4P B;  5MPO A;  2WDT B;  2X8X X;  3NVZ A;  4M02 A;  1R4N I;  1ROE A;  5D3I B;  2LZ6 A;  2KFK B;  1GJZ A;  2Z8L A;  3VQI A;  1V80 A;  1FCL A;  4MJS B;  3AEC B;  2OED A;  4GIV A;  1E7U A;  1XQQ A;  5JXV A;  3QQ8 B;  3VTU A;  2GRI A;  3QHT A;  4IM3 A;  1ENF A;  4KSL C;  4KGS A;  1YJI A;  5JH5 C;  1IUE A;  3AXC A;  2YEP F;  2QEJ C;  3BZD B;  2R61 A;  3U7Z A;  2IY0 B;  3RMK C;  4A6Q A;  3ZIM A;  3DBL I;  3OAW A;  1WWT A;  3QWZ B;  3DVN V;  4FJZ A;  1JQ4 A;  3NZ3 A;  4JIO U;  2KT7 A;  4KDI C;  4MEM A;  1T3Q A;  2BS2 B;  1L0V B;  3X23 A;  3GOE A;  3DHH C;  1E10 A;  3LDZ E;  1CK1 A;  1F52 A;  1YMH E;  4RMA A;  1A70 A;  2DZM A;  4S17 A;  1S3S G;  3BK1 A;  4N6E B;  2MEK A;  4B9K A;  3KUC B;  4F1S A;  2PJH A;  2W3R A;  3LYY A;  4FXC A;  2WDV B;  3WAL A;  1V1P A;  1RLF A;  1Q1O A;  2FCS A;  3ETR A;  1VCB A;  5G2N A;  2CJN A;  2JYE A;  2QDF A;  2JU6 X;  2K5P A;  2A5U A;  4FAD A;  2LGY A;  3GZN I;  3HM6 X;  2KWD A;  3E9S A;  1UH6 A;  3ZLZ A;  1XLN A;  3PT2 B;  2YVC A;  4C56 C;  3FAH A;  1L6U A;  1T0Q C;  2QMT A;  3APD A;  1L7Y A;  3DBR B;  3T3O A;  2KX0 A;  1K53 A;  1JWA D;  3W5V B;  1ZP0 B;  2KDB A;  2RDH A;  2MQJ A;  1J8C A;  1TTN A;  3DQV A;  2Z0D B;  2RPV A;  2G45 B;  2YEP B;  2ZCB A;  2I38 A;  2BQQ A;  3R8B A;  2DAF A;  1PYW D;  4FN2 A;  5C23 A;  1VR9 A;  4XE0 A;  5HG2 A;  1P98 A;  3OWE B;  2INC C;  2FCQ A;  1V81 A;  3C0R B;  5HFY A;  2BKR B;  1KRH A;  1SGH A;  4ZHP A;  2WXL A;  4YL8 A;  2N9K A;  3HVD A;  1WMH A;  4P1B C;  2BYE A;  3S2A A;  1SE3 A;  5LLI A;  3V3X A;  2L83 A;  2IZV B;  3WCQ A;  2JWZ A;  3AE3 B;  4MAC A;  3BYY B;  1NYQ A;  3M3J A;  1KLU D;  2BBC A;  1GG3 A;  2D07 B;  4WWO A;  2WYQ A;  2K22 A;  2BWF A;  3GE3 C;  4II3 B;  2JVC A;  4ZOH C;  3VH4 B;  2ZJD A;  3MFG A;  1N6Z A;  3GE8 C;  2UYZ B;  2MBH A;  1RRB A;  2M0X A;  2WHI A;  5FKA C;  1FCC C;  1CQV A;  2IGG A;  4M8M A;  1WM3 A;  1NDD A;  2D3A A;  2FUG 1;  2RPQ A;  4AP4 C;  4BVU C;  1EWC A;  3IHP C;  1F2R I;  4ANU A;  2PVG C;  3W1S A;  3SDL C;  4A90 A;  1FM0 D;  4JX1 C;  2K25 A;  3UIP B;  2ZPN A;  5AEK B;  3H6N A;  4A3O A;  1N62 A;  4RCO A;  1OTR B;  2XBB C;  1WE6 A;  3PHW B;  2IYD B;  4P16 A;  4X57 B;  3KQ4 A;  1KLG D;  2LUM A;  2RDG A;  3NHE B;  2KVZ A;  4K7S A;  4DDI D;  2JX5 A;  2EMT A;  1QKZ A;  3Q8C A;  1L5P A;  4C4V B;  1KTK A;  1UGM A;  2NTT A;  1UGJ A;  4HPP A;  3AM9 A;  1WGY A;  4JGH B;  2WXJ A;  1YX5 B;  1E0Z A;  3N1X C;  2ZVN A;  3Q8A A;  4C4V A;  2CR5 A;  2JYT A;  2DEN B;  2AL3 A;  4H2A A;  4NPN A;  3PZD A;  1E8Y A;  3B2F A;  2AQ2 B;  1JRP A;  2LEK A;  1E90 A;  4EZL A;  2K3U A;  2PKO A;  2FUH B;  1C4C A;  2C5L C;  4FUL A;  3QAR A;  4KGT A;  1KH0 A; 
#chains in the Genus database with same CATH homology
 1TKE A;  2INN E;  1YN3 A;  4ZRQ A;  1BXT A;  1JRO A;  2DYO A;  2I2Y A;  1L6V A;  1ZDX A;  2JQR B;  4OZB A;  3KWL A;  1QQR A;  2ACZ B;  2XN9 C;  5C2T B;  4HKZ E;  2QSD A;  1R7S A;  1JCK B;  1CJE A;  1E9M A;  5H8Y E;  1I4X A;  1DOI A;  2WXP A;  1WSP A;  2WXQ A;  3TEZ A;  1N5W A;  1YQ4 B;  3MHZ A;  1P7F A;  1VDV A;  3FIL B;  2W82 A;  2NMQ A;  1WYG A;  3AH7 A;  3BVM A;  4UDU C;  5GXG B;  4YTN B;  4XWT A;  1D4B A;  5BYQ A;  1MHH E;  1QIL A;  2WXK A;  1FFV A;  1QOF A;  1FEH A;  3IT6 B;  3PZ8 A;  4JPS A;  1J7A A;  1NI3 A;  4L23 A;  1EWY C;  1FRD A;  1FXI A;  1YQ3 B;  3AE2 B;  5G5H A;  1L4D B;  1SXT A;  2BW2 A;  2ZW0 A;  5I4D A;  4L1B A;  3ZJU A;  1PFD A;  2VZK D;  4YTP B;  3RPF C;  1YNT E;  1YN5 A;  1QT9 A;  4WAF A;  4NZL B;  4HRO A;  1SB3 C;  2W54 A;  4HKQ A;  4NAW B;  1XLO A;  2EKI A;  4OW0 A;  2DYM A;  2J42 A;  3BII D;  1C78 A;  1BML C;  1TS3 A;  2E3T A;  2LFI A;  1ACC A;  3J9C A;  1DYQ A;  1Q10 A;  3ABV B;  1SEB D;  1T6B X;  3V05 A;  1JWM D;  3CIR B;  2WXO A;  5BMG A;  1JWS D;  1K50 A;  3AED B;  2V3P A;  1K52 A;  2AQ1 B;  1PUT A;  4RH6 A;  5EE0 A;  4WWM A;  2MJE A;  1E7P B;  1NVI D;  1HQR D;  4L2Y A;  4OVZ A;  2ON8 A;  1D6E C;  1L0X B;  4C7Z A;  3AEE B;  2LHE A;  1TY0 A;  3EUB 2;  3NS1 A;  2SEB D;  3AV8 A;  3NUH B;  1K51 A;  2JSV X;  1SBB B;  1GOZ A;  1QF6 A;  1DGJ A;  1J7B A;  2NTS A;  3AE1 B;  3RFZ B;  4GDK B;  1I7H A;  3AB5 A;  5T8I A;  3IAS 1;  2ZW1 A;  3W9C B;  1EU4 A;  4A55 A;  4KGR A;  2Y5C A;  3LB8 C;  3P4R B;  4US9 A;  3L4P A;  3CWI A;  2WDQ B;  4N59 A;  1FD6 A;  2N7J A;  3AEA B;  1HZ6 A;  2WDR B;  2WXN A;  3N9Y C;  1ET6 A;  2GB1 A;  3AE4 B;  5FK9 C;  1PGA A;  4USA A;  2J53 A;  2LHD A;  5BYR A;  4OZC A;  2D5G A;  4R3D A;  4JWS C;  3AE9 B;  3DWM A;  1C4P A;  3HRD D;  3ZJT A;  1VZ6 A;  2W3S A;  2BS3 B;  2H88 B;  3URY A;  1SE2 A;  4ITK A;  3AEF B;  2KMM A;  1FO4 A;  2MJD A;  2K9X A;  4RF0 A;  1SSN A;  2TSS A;  1MVK A;  2BT6 A;  4JE3 B;  3HVZ A;  2WXM A;  2QIL A;  1E6E B;  2LJI A;  1V1O A;  1I4G A;  4WQM A;  1JAL A;  3VRA B;  2IPK D;  2WXH A;  2M0A A;  5HG2 A;  3SR6 A;  3Q8E A;  1YJJ A;  4NAM A;  1XXG A;  1AN8 A;  1NYR A;  4OHJ A;  1VJK A;  1F0Z A;  3P4S B;  1IGD A;  3P4P B;  1UUP A;  2BTE A;  2KAJ A;  3I57 A;  5MPO A;  1ET9 A;  3GS2 A;  2ICI A;  1WXQ A;  3I9V 1;  3NVZ A;  1C9F A;  1ROE A;  5D3I B;  5BMI A;  2J52 A;  2Z8L A;  3VQI A;  3AE7 B;  1FCL A;  3VR8 B;  3AEC B;  1VZ8 A;  3GP7 A;  4N58 A;  1SE4 A;  2OED A;  1BUI C;  1C4A A;  1N61 A;  1MHX A;  5JXV A;  2N0S B;  3P1M A;  2EEL A;  1EM7 A;  2GRI A;  1ENF A;  4MH8 A;  4KGS A;  4TMA B;  1YJI A;  2WNM A;  2G1E A;  3P63 A;  3U2S C;  2KDM A;  1IUE A;  2XNA C;  4GLS C;  1AW7 A;  2YEP F;  2G9H D;  2IGH A;  2WXI A;  2QEJ C;  3BZD B;  3LXF A;  2X38 A;  2R61 A;  1C79 A;  3O13 A;  3U7Z A;  4A6Q A;  1F77 A;  1TKY A;  4KKJ A;  1STE A;  3ZJV A;  1B1Z A;  3KLS X;  5HI1 A;  1WWT A;  2PMV A;  3Q8B A;  4EE2 A;  1CZP A;  1XCQ L;  2L52 A;  3DWG C;  3IT4 B;  2LGI A;  1JQ4 A;  3HUI A;  1QOB A;  5EE1 A;  4RGM A;  3NZ3 A;  2BYT A;  1FNV A;  4ZHO A;  1L4Z B;  3AE8 B;  1V97 A;  5LNK 1;  4RNA A;  5E6J A;  1SJH D;  1T3Q A;  5TSS A;  4KX6 B;  2BS2 B;  3EA6 A;  1L0V B;  2SAK A;  1KF6 B;  4ARC A;  1N5X A;  1ZE3 D;  1HA5 A;  1IBX B;  1HEZ E;  1FRR A;  1C77 A;  1IGC A;  4WIP A;  1V1P B;  1E10 A;  1J7C A;  3GB1 A;  2BS4 B;  3PO0 A;  1JWB D;  1CK1 A;  1TKG A;  1ZXH A;  4GDL B;  1YMH E;  4MM3 B;  4P6V F;  1VRA B;  1OQR A;  1A70 A;  3BK1 A;  4HRS A;  4N6E B;  2MEK A;  2MJ3 A;  3BK2 A;  2W3R A;  5HHD G;  3LYY A;  4LTU A;  4A8X C;  4FXC A;  2PIA A;  2WDV B;  1Y56 A;  1V1P A;  1FFU A;  3NVV A;  5C3J B;  5D7G A;  3U4E G;  1DOY A;  2B76 B;  1I4P A;  2AQ3 B;  2BB5 A;  4YT0 B;  3ETR A;  2V3N A;  4C80 A;  1QOG A;  3ZGZ A;  2CJN A;  2JYE A;  2JU6 X;  2K5P A;  1WRI A;  3EGR A;  3VR9 B;  4TSS A;  4XWW A;  2KWD A;  3E9S A;  5H92 C;  3T3N A;  1XLN A;  1I4R A;  3U52 E;  2K0P A;  3IAM 1;  4C56 C;  5AUI A;  1L6U A;  3FAH A;  2QMT A;  3T3O A;  1XLP A;  1YN4 A;  3TUO A;  1K53 A;  1JWA D;  2N9L A;  4LK0 M;  3W5V B;  5D3D A;  1V8C A;  1ZP0 B;  3AE5 B;  1ZPS A;  2WU5 B;  2CJO A;  4YWG G;  3FC4 A;  2RDH A;  1RWS A;  1MPE A;  4A9A A;  1FNU A;  1ZXI A;  2PTL A;  2RPV A;  2JZP A;  1PGX A;  2WXG A;  2YEP B;  2LMC A;  2J4X A;  3P42 A;  1XF5 L;  2Y5P A;  2KQ4 X;  2W55 A;  2V0G A;  2I38 A;  3R8B A;  1PYW D;  3MC0 B;  1RFK A;  4MT5 A;  1TY2 A;  1AYF A;  1VR9 A;  1NEK B;  1SF0 A;  4IDI A;  4KKI A;  4RFB A;  4XE0 A;  3BYT B;  2QJL A;  3OWE B;  1C76 A;  3Q69 A;  3SFE B;  2FBW B;  2DWQ A;  3AN1 A;  3MJ5 A;  4ARI A;  1T5X D;  3B2G A;  1TZO A;  1ZUD 2;  1I4H A;  4US8 A;  5HFY A;  1KRH A;  2H89 B;  2WP9 B;  4CQN A;  4ZHP A;  3TEW A;  4ZYS A;  2WXL A;  3IXS A;  3TSS A;  3W5U B;  1OQQ A;  2N9K A;  3FIL A;  3HVD A;  1GPX A;  1RM6 C;  1WGK A;  2MH7 A;  5EE9 A;  1SE3 A;  1NEN B;  1XCT L;  1ZOY B;  3C8Y A;  3V3X A;  2L83 A;  4RGO S;  3TEY A;  2AX5 A;  3WCQ A;  3AE3 B;  4MAC A;  1RYJ A;  3BYY B;  1GAQ B;  3UI3 A;  1NYQ A;  4Q2J A;  1D5M C;  1L0Y B;  1KLU D;  1PGB A;  2BBC A;  1PDX A;  5BYS A;  1GB4 A;  4DQO C;  2K22 A;  2E6X A;  3AE6 B;  3MP9 A;  2KN4 A;  1N63 A;  1D5X C;  4M0W A;  4WH4 A;  4HJG E;  2L1A A;  2PW9 A;  4ZOH C;  1FMA D;  2QIE B;  2GI9 A;  3B9J A;  4IOI E;  2DLB A;  4YSZ B;  3P4Q B;  1P7E A;  3E56 A;  3MFG A;  1UWX A;  3Q8F A;  3SFD B;  1KFY B;  1FIQ A;  1GB1 A;  4IKG A;  4AS1 A;  1N60 A;  2HDE A;  1QOA A;  5FKA C;  1DOX A;  1FCC C;  3PZ7 A;  1CQV A;  1VZ7 A;  2IGG A;  1MI0 A;  2IJ0 A;  5AUK A;  3NVW A;  4DXG A;  4OZA A;  2FUG 1;  1VLB A;  2PLP A;  2ONQ A;  2INP E;  4TQ0 A;  1EWC A;  4LLG M;  2DBY A;  1F2R I;  4NJC A;  4O1N A;  3NRZ A;  2PVG C;  3W1S A;  3AEB B;  4A90 A;  1FM0 D;  5BMH A;  2FE8 A;  4JX1 C;  3ZYY X;  1XO3 A;  1EU3 A;  1SJE D;  1FNW A;  1N62 A;  3SEB A;  4RCO A;  5FR3 A;  1IBX A;  4B0M A;  2JXT A;  2Q5W D;  1ZDV A;  4P16 A;  3ZQ4 A;  4YXD B;  5EE3 A;  3AMZ A;  1B9R A;  2WU2 B;  1TS5 A;  3KQ4 A;  1OFF A;  1QLB B;  1UWM A;  2BB6 A;  2Y3A A;  3BVG A;  1KLG D;  2LUM A;  2RDG A;  3AEG B;  4TQ1 A;  2WXF A;  2V4I B;  4RGN A;  2WLB A;  1XLQ A;  2JX5 A;  2VZK B;  1JML A;  1QKZ A;  3Q8C A;  1L5P A;  1XEE A;  1TS4 A;  1LO5 D;  2IGD A;  4WUR A;  1KTK A;  1JW9 D;  4JWU C;  4YTM B;  2NTT A;  2IDY A;  4YSY B;  1M4V A;  1TYG B;  1UGJ A;  3NVY A;  4REZ A;  4XDC A;  4RF1 A;  1TS2 A;  3BVZ A;  1JWU D;  1AWD A;  4HEA 1;  5G5G A;  1FXA A;  2M56 B;  3AM9 A;  1ESF A;  1D5Z C;  4PT5 A;  1F2R C;  2WXJ A;  1E0Z A;  1HZ5 A;  2KAC A;  4YSX B;  3Q8A A;  2OHF A;  1TJE A;  2CU3 A;  4RGT A;  3W2D A;  2JYT A;  3TEX A;  1UNS A;  2HTM E;  2PVO D;  4H2A A;  3R2T A;  1HXY D;  1SIJ A;  3H8H A;  3B2F A;  2AQ2 B;  3BWU D;  2WQY B;  4J3O D;  1JRP A;  4D2K A;  2WS3 B;  2LEK A;  4AQ7 A;  2K3U A;  4C7Y A;  2L32 A;  3VRB B;  4ZRP A;  2PKO A;  2M19 A;  4XDD A;  3KWV A;  4DXF A;  2RMM A;  1C4C A;  3R2I A;  1I4Q A;  4B0E A;  4KGT A;  2WXR A;  1KH0 A;  2JWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...