4YSXB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ysxB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ysxB01
1FMAD 1WYGA 2PKOA 3EUB2 1WRIA 2G1EA 5G5GA 3NS1A 3AE4B 2HTME 4YT0B 1L5PA 3AE5B 3AE3B 1FXIA 1RM6C 1TKEA 1UWMA 1GTEA 1WGKA 1YQ4B 1N63A 1WXQA 1YJJA 2JX5A 1JWAD 1QOGA 1QLBB 3P63A 1QF6A 4A9AA 3CWIA 2WU5B 3AM9A 3AECB 5G5HA 2BS4B 3AE2B 1ZOYB 3W5UB 3B9JA 2DWQA 2BS2B 2K5PA 5C3JB 1EWYC 3P4RB 1XLOA 4P6VF 5AUKA 1OQQA 1E0ZA 1QOFA 1DOYA 3HRDD 3AEEB 1JQ4A 3B2GA 4WQMA 2QJLA 1YJIA 4ZOHC 2M56B 4JWSC 1XO3A 1JALA 1H7WA 1J7AA 3P4QB 2JQRB 2MJDA 3ABVB 4USAA 5EE1A 5EE9A 5MPOA 2KAJA 1E10A 2EKIA 1FFUA 1FM0D 2PVGC 1NENB 3FAHA 1GTHA 3PO0A 4C7ZA 2MJ3A 4YTMB 2L52A 1JROA 1N5WA 2B76B 1DOXA 1YQ3B 1TYGB 3ZYYX 4ITKA 4WWMA 1A70A 1E6EB 1ZXIA 3BIID 4N6EB 1FRDA 2WDQB 3NVWA 4HRSA 2W3SA 2Y5CA 1FXAA 1NYRA 3AEFB 3W5VB 2BT6A 4YSZB 1FIQA 1TKGA 3L4PA 1XLPA 3AE6B 3VR8B 1GAQB 1N60A 2M19A 3RPFC 2MJEA 1FO4A 1DGJA 1TKYA 3P1MA 1QT9A 4FXCA 2PIAA 1SB3C 1PFDA 3W9CB 1V97A 2OHFA 2Q5WD 4LTUA 1JRPA 3HVZA 5GXGB 2CU3A 1E9MA 1XLQA 3DWMA 1SIJA 1VJKA 2QIEB 5C2TB 2WQYB 2K9XA 1L6VA 3CF4A 5AUIA 4C80A 1DOIA 1PDXA 3NVVA 4ZHOA 1E7PB 1NEKB 1XLNA 3AE8B 3NRZA 2WDVB 1WWTA 2H89B 1AWDA 1RYJA 2N0SB 3P4PB 1IUEA 2CJOA 1ZP0B 2H88B 4YTNB 4YSXB 2KMMA 4HROA 3KWLA 5EE0A 2W3RA 2K22A 2WDRB 2WLBA 3HUIA 4YSYB 1RWSA 3WCQA 3AB5A 3AE9B 2PVOD 1B9RA 3NVZA 1GPXA 1OQRA 2L83A 1VLBA 2LEKA 1CZPA 3SFDB 1FFVA 1ROEA 1KFYB 2W55A 1AYFA 4JWUC 3VRBB 3NVYA 3AE7B 1JW9D 1CJEA 1QOAA 3DWGC 1NI3A 5H92C 1V8CA 4US8A 1I7HA 2WU2B 4YTPB 1SF0A 1T3QA 3AEBB 3SFEB 1ZUD2 4US9A 3AEDB 1JWBD 4KX6B 1N62A 5EE3A 1L6UA 4N58A 1KF6B 3B2FA 1L0VB 3AE1B 3CIRB 3LXFA 3SR6A 3VR9B 1NVID 2AX5A 1FRRA 1TJEA 3VRAB 3FC4A 1KRHA 1N61A 4C7YA 1VDVA 2FBWB 4N59A 5H8YE 3AEAB 1F0ZA 1H7XA 1QOBA 1N5XA 2MH7A 3ETRA 1PUTA 2CJNA 3AV8A 2ACZB 3P4SB 2WS3B 1J7CA 1NYQA 3AN1A 4IDIA 4ZHPA 2W54A 1RFKA 3AMZA 1GT8A 4JX1C 1R7SA 1OFFA 3AH7A 3LB8C 2E3TA 2BS3B 2DBYA 4YXDB 1J7BA 2WP9B 3AEGB
chains in the Genus database with same CATH superfamily
1WYGA 3JSVA 1BMLC 2A4ZA 3PGEA 1GC6A 3GB1A 2JX5A 4FJZA 4W9KA 3ZGZA 5BO4B 3R3MA 4LK0M 4MSQB 2L7RA 2BS2B 4PS8A 1YJIA 1KTKA 2K25A 1ZKHA 2JQRB 2ASQA 2EKIA 3PO0A 1FEHA 2N1VA 1XF5L 2B76B 2GMIC 1YQ3B 3I5JC 4LNNA 4BOZB 1YD8U 3R7RA 2V0GA 1ESFA 2IBIB 2FIFA 1L4ZB 2QDFA 2BYTA 1YNTE 1HE8A 2KHWB 4RGNA 4ZRQA 4M8NA 2LHDA 4EOYA 4KGSA 4CQNA 2R2QA 4J6IA 1WY8A 1ROEA 4M0WB 1FNWA 1C3TA 1WM2A 3AE7B 3MJWA 1V8CA 3W1SC 4JLCA 5EE3A 4OHJA 2Y3AA 3K9PB 3CIRB 1HA5A 2D3BA 4DXGA 2BTEA 2AQ1B 2KYWA 2NVUI 4HDQA 2YVCA 2V4LA 4W9FA 4ICUA 2EMSA 1KLGD 3I57A 1UWXA 4JGHB 2Q5WD 1YX6B 2HDEA 4WH4A 5IAAC 2V9HA 2KAJA 5LXIB 1QF6A 5TR5A 4DQOC 3NHEB 2KQSA 5AUKA 2KC1A 3D32A 2J42A 1UGMA 1WXAA 4B9KA 4G11A 1RFAA 2FE8A 1K53A 3H7PB 1JROA 3ZYYX 1YJ1A 2NBUA 3NJTA 1C1YB 2PE6B 4IW0A 2RMMA 2RSUA 2NMQA 3BVZA 1C4AA 1GNUA 3Q8EA 2VH2A 2EMTA 1ZPSA 1PFDA 1WXVA 2XBBC 3HVZA 2Z59B 3A9JA 4RM8A 1JRUA 2WQYB 2L3ZA 4AJWA 3K9OB 2BVCA 3AI5A 2K6DB 1DOIA 1SJED 2KNBA 3M62B 2KLGA 4NJ7A 3NRZA 2UWQA 1ET6A 1TT5B 4K1RB 1WJ4A 3KWLA 2MBEA 5LNK1 3RN9C 4ACFA 1RWSA 2N1WA 4BKTA 1C4CA 3KUDB 1B9RA 1T0YA 1L4DB 4TMAB 1ISNA 1TZ1A 3KLSX 3DBRI 2GBNA 4YTPB 3H9DA 1MHXA 3NZUA 1IPGA 1L0VB 2M1MA 3PT2B 2KTRA 4M02A 1VDVA 2V1YA 1Q1OA 3HM3A 3ONSA 3AEAB 1N5XA 5LLIA 3Q8CA 2J7QB 2YEPF 3DBHI 3TEYA 1AN8A 2KX0A 4K7WA 1TY2A 1GB4A 2KD0A 3EUB2 5G5GA 4P1CC 3DVNV 4YT0B 4WWOA 4LNIA 2KT7A 1HTOA 1YQ4B 2K6QA 1JWAD 1KM7A 3ZJVA 4A9AA 4N9F4 2DAJA 2JY6A 3A33B 5T8IA 3WAMA 2DWQA 1SE2A 4MH8A 4PS7A 5FR3A 5KHOA 4B0MA 5MPOA 1SBBB 1EM7A 2M4NA 1VZ8A 5DPSA 3ZLZA 1PYWD 4KSLC 3VXWA 3CF6E 3T3OA 2W82A 3UIOB 2JUOA 5CTRC 1F9JA 2NS5A 4AUQC 4M01A 3MHZA 2WXJA 3ZUNA 2WGSA 2LHEA 4GDKA 5AUIA 1WR6E 2E6XA 4LLGM 2ZCBA 4NQKE 2WDVB 4XWTA 4ANUA 1IBXA 2KVRA 3ZRFA 2VRRB 4DHZB 4HJKA 1M4VA 2XEWA 2K8HA 2NPTA 3NVYA 2VH1A 2MSED 2L76A 3A9KB 1I42A 5JHAA 3SR6A 1E8ZA 4TKNA 1KRHA 3VUYA 1WZ0A 2ZZPB 2WX0A 1T0RC 4WURA 3AN1A 5HHDG 3UQAA 2FCNA 3AMZA 3U8ZA 4GMVA 4K7UA 3V62A 3UQBA 2D2QA 4XE0A 2L05A 2DNFA 2J0KA 5CHFA 3X0WA 3T8MA 1P7EA 1WXQA 3HM6X 2JVCA 2GBMA 2BF8B 2L0TA 3FILA 3R8BA 1UF0A 5C3JB 4GSWA 4XC2A 5J18A 4WIPA 3EFCA 4JWSC 4YL8A 1E10A 3TEWA 1NENB 3MC9A 2BYEA 4YTMB 3UF8A 2X8XX 1TGZB 5CHWA 2MP2B 2WDQB 2KWVB 1SSNA 2LD9A 1SEBD 1FXAA 4DK5A 1V5OA 4S0RA 3RFZB 1ET9A 4BBNC 2FCQA 3Q3FA 2QILA 1XLQA 4GXBA 2QIEB 3ZNID 2KACA 3CF4A 1J19A 2N0SB 4MM3A 2MBHA 1SJHD 1KH0A 4WQOB 4JE3B 3NVZA 4A90A 2IGHA 2MEKA 1AYFA 1TIFA 2KFKA 1Q10A 4ZRIA 1L6UA 2O6VA 4W9HA 2KANA 2AX5A 1WIAA 1TJEA 3DBLI 2WXMA 1D3ZA 1KLUD 5C23A 1QOBA 2CJNA 1NYQA 2WWZA 1OFFA 1J7BA 2BPSA 1EWCA 3ZJUA 2BQQA 4J3OD 3RCZA 1TKEA 1WMHA 4RF1A 2N9KA 2NR2A 2V4IB 3AM9A 4HPPA 3AECB 3IFWB 1YN3A 2KN4A 3ZQ4A 3PVLA 1A5RA 3W1SA 2WXHA 4HCNB 3H1UA 2KDMA 2JSVX 2W9NA 1PGAA 2JXTA 1BXTA 1FFUA 2R2OA 5DCNA 1UGJA 4K3BA 1N5WA 3M63B 3BWUD 3Q14C 4WWMA 4TSSA 4HRSA 2W3SA 2D10A 1P9DU 1L2NA 2AQ2B 3VR8B 2IDYA 2M19A 1U4AA 3N1XC 3P1MA 3R7QA 1WE6A 3IXSA 3VH4B 2LJIA 3DWMA 1K50A 3Q3JA 3PPAA 5IOIA 5G55A 4RMAA 3EECA 3HHMA 1WR1A 2A5UA 3QK0A 1V1PA 2OOBB 3U4EG 4A55A 2IYDB 1D5XC 3HUIA 1YOVB 1P0RA 2LGXA 1NDDA 3QX1A 3Q8AA 1IGDA 1ZXHA 2K39A 2K3UA 4P16A 1AW7A 2FCMA 2K8BA 2N7EA 2BBCA 1T5XD 4E3CA 1D5ZC 4LJOB 3VR9B 2V3SA 4XDCA 3PRPB 3FC4A 1CQVA 2AEHA 3MC0B 2JWUA 2HJ8A 4GDLA 2KJRA 5D3DA 4ZDVA 4IDIA 5AZGA 2DX5B 2G9HD 3KYDD 3SEBA 1R7SA 3AH7A 1EF5A 3RNGC 2KMAA 2DBYA 4JPSA 4NAMA 4IOIE 3AEGB 2WXKA 2FUG1 3QWZB 3L0WB 3AE3B 2AL6A 3A1QA 3ZNGC 1V5TA 1I4PA 2MX2A 2MQJA 3VUWA 1M94A 4AS1A 1UZXB 1WGDA 3DHIC 3P4QB 2ICIA 4R3DA 3N32A 3DQVA 1WGRA 4JIOU 2DHZA 1NYRA 2BT6A 4A6QA 2DZIA 2WX1A 2G45B 1I4GA 3APDA 4ZYNA 2BKFA 3N9YC 4H2AA 1H8CA 1WSPA 4I6PA 1MI0A 2QMTA 4NY0A 3JSVB 2PTLA 1V9JA 3NVVA 4OVZA 1TY0A 3IAM1 4DXAB 2H89B 1R4NI 1ZP0B 4YSXB 1C4PA 2K22A 2JPHA 2WDRB 3P2BA 1R4MI 4URKA 2IO0B 2IO1B 3H8HA 1VLBA 2DZMA 4KIKA 3PHXB 1JW9D 1QOAA 4MGYE 5AZFA 1I7HA 2L1AA 2YEPB 1IP9A 3AEDB 4KX6B 4ASWC 1UUPA 2JU6X 1UH6A 2MH7A 2LGYA 2L32A 2LVQA 2WS3B 4MJSA 2W54A 1WRDB 2BS3B 3L16A 4K81A 3IBEA 4F1SA 4NPNA 2JZPA 4MGZE 3NS1A 1UD7A 5D6JB 4DDID 1QLBB 1L7YA 4WWPA 3CWIA 1T0SC 1AARA 2HJ1A 2BS4B 1Q5WB 4KDIC 3KW5B 5CX3A 3U2SC 5C1ZA 2WNMA 4DHZE 1OQQA 1E0ZA 1QOFA 1L0YB 3VAWA 1I4RA 3TJPA 2PPHA 3H7SA 3R66C 1E8YA 3BY4B 1MG4A 2BYFA 4NZLB 4I6LB 1XLPA 2CHZA 4TV3A 4IM0A 2L8JA 1DGJA 3PRZA 1SXTA 3BK1A 1SB3C 2ZNVB 3L13A 2OHFA 2JF5A 4TUUA 1UNSA 4BKGA 4HLEA 2L00B 5BYRA 3FKYA 5HI1A 1V81A 4OZCA 1WX7A 2H88B 5HFYA 4HROA 1E90A 1OEYJ 2WXFA 2SAKA 1EUVB 5J17A 4G3XB 1BT0A 1HEZE 5H92C 3DWGC 2CS4A 3N30A 2KFJA 4LDTD 2MBBB 1YQBA 3B2FA 4FULA 2J0MA 4Q2JA 4EUTA 3GE3C 4B6WA 2WXNA 4KGTA 4MACA 3QCAA 1XCQL 3TEZA 3TL5A 2N7DA 1VCBA 4HJGE 2QHOA 3QA8A 4II2B 2QSDA 1WGYA 2R61A 1N63A 4XZ4A 2O2VA 1ENFA 2EKEC 2KMCA 5G5HA 3RNEC 3L08A 1WM3A 3RD2A 4ZRJA 4FLHA 2K0PA 3VHTC 1MJDA 4WQMA 2M56B 1JALA 3ALBA 4AOFA 5EE9A 2JRIB 3X23A 1FM0D 1G6JA 4MSMB 1CK1A 3BIID 2DYOA 1VR9A 2IO2B 4W9IA 2J4XA 2KTRB 3OJ3A 2G4DB 2LRWA 2J53A 2JXXA 3VDZA 5BYQA 3KQ4A 4K3CA 2N4FA 1LQBA 1JWMD 1QT9A 1I4HA 3ZDTA 2PEAA 3NZ3A 3Q3MC 3V6EB 2DZKA 2LUMA 4JL9A 5FKAC 2WXQA 1L6VA 4XWWA 4IWQA 3VTVA 5E6NA 3BVMA 2CJOA 3GZNB 1E5WA 4ZYSA 1P98A 1RLFA 3GE8C 1RRBA 1KJTA 4IC7B 3C8YA 2KQ4X 2MA9B 2Z8LA 2NTSA 4MT5A 5HKHA 3GS2A 2BKRB 1RAXA 1ZUD2 1SF0A 3I9V1 2LASA 4FJYA 1XEEA 2RDBC 2BWFA 3I63C 1FRRA 2JZZA 3DBSA 4BVUC 4JQWC 3RMKC 2N9LA 2I1KA 3RI7C 2MBOA 3P42A 1SE9A 1GUAB 4OZAA 4F7ZA 2LUEA 1UBIA 3PSEB 2UU7A 3SU8X 3M3JA 3VTWA 1WRIA 2KKCA 3AE4B 4GDKB 4IUMB 3MJ5A 2GBJA 1GTEA 3CSFA 2D11A 3L54A 4L2YA 1S1QB 2D3GA 4WJQA 2KVZA 4W9JA 3ZKJC 1EWYC 2MRPA 2KDIA 2C60A 3VQIA 4EZLA 5L83A 5GMVA 2C7HA 2NPTB 3B1LX 4LNKA 4DHJB 4GIVA 3OLMD 4PS3A 3V6CB 2CR5A 4PT5A 2LVPA 1TS2A 2FAZA 1E6EB 1D5MC 2I2YA 2IPKD 1HQRD 2KOXA 4GB9A 1UBQA 2M17A 2OJRA 3RT3B 2LVOA 3BK2A 3AE6B 1HZ5A 2ON8A 3MHSD 2PMVA 5AEKB 4HCPB 4HVBA 4HXDA 4A3PA 5GXGB 1XCTL 4AP4C 1WJ6A 1SE3A 4ZHOA 4HKZE 4C00A 1AWDA 5IO9A 2CKHB 2RR9A 2HD5B 3KH0A 4BKSD 2J0JA 4ZRPA 4YSYB 1OEYA 3AE9B 2PVOD 4CHKA 1C79A 1J0GA 2LEKA 1FFVA 2IY0B 3UGBB 4JWUC 2WU2B 1T3QA 1V49A 3AU5A 4GN1A 2DZJA 3ENEA 1ZGUB 4N59A 4DDGD 2PJHA 5IN7A 1J7CA 2NCNA 3RULA 3MC8A 2XK5A 2PKOA 5J2RA 3ZDMC 3UINB 1C77A 1LFDA 3ZNHB 4MH0E 5FR6A 3DHGC 4IM2A 3LDZE 4MM3B 4UDUC 2GRIA 1YIWA 1V6EA 1EU3A 3C0RB 4DWFA 4MGIE 3NUHB 1MVKA 2GBKA 2FUHB 3URYA 3ECIA 4GGQA 1I35A 2INCC 4KDLB 2L52A 4L1BA 2G4SA 1TYGB 3QHTA 1OGWA 1EF1A 1C9FA 2O6VB 4N6EB 4HEA1 3W5VB 3RUIB 5LXHA 4P7IA 4RFBA 2CHWA 4I6NB 2INDC 2I1JA 3QAQA 2PIAA 5JH5C 3Q8FA 4ANWA 1JRPA 3A4SC 3WIMA 1SIFA 3PREA 4EEWA 1PDXA 1E7PB 3V60A 4WJPA 4ARCA 4PYZA 3CSTA 1IGCA 3JVZX 3EFUA 5I4DA 1YX5B 3SFDB 1F1HA 3UIPB 2DENB 4C4VA 3ZXVA 1WGGA 1E8WA 1F2RI 4MELA 3AEBB 2RPVA 3ZRCA 4E74A 1D4BA 4KV2A 1NVID 1V80A 3RZWC 3VRAB 2C5LC 2ZEQA 4FN2A 5H8YE 1F0ZA 2ACZB 1WX9A 1WXMA 3Q6BA 3APFA 4TQ1A 2E3TA 4HDOA 3VTUA 4E71A 4II3B 4FADA 2G1EA 3Q2AC 4FBJB 3VFKA 2LFIA 2RD0A 4KKJA 3QIJA 4X57B 3AE2B 4OVVA 3DCGA 3B9JA 2K5PA 3DDCB 5DPWA 2DLBA 3QC8B 2PE9A 3AEEB 4KZCA 3B2GA 1E8XA 2XN9C 4NAWA 3M95A 1J7AA 2KN5A 3U7DA 2QEJC 2MWSB 3ZTDA 1GTHA 4EZJA 3OJ4B 3ZW3A 3NS8A 1V86A 5AZHA 1F2RC 1WF9A 4BFRA 3EA6A 3R2IA 2Y5CA 2MLBA 3L4PA 1GAQB 2KWCA 4GDLB 1MFWA 4O1NA 1LGRA 4KKIA 3RYTA 3W9CB 4GU2A 1XT9B 3EHVA 2WDTB 1Z5SB 3O65B 4XYCA 4DHJD 1Z2MA 3TBLD 3U30A 2K9XA 2IGDA 4DXFA 4C80A 1XLNA 1WWTA 5G2NA 3HIZA 2KMMA 1GB1A 2MHJA 1WI0A 4IKGA 4XDDA 2IY1B 2RDHA 1XXGA 1WX8A 5JZEB 2Z0EB 2W55A 4ARIA 2D07B 1CJEA 4N58A 2IO3B 3AE1B 1JWUD 3KYCD 1ZDXA 4GOCA 1Y8RC 3E9SA 4G50A 2CHXA 4C7YA 3E56A 1T6BX 3ETRA 3AV8A 3P4SB 4YWGG 4ZHPA 4JX1C 1BUIC 5D94A 2Z0DB 2Y5PA 1L5PA 4TQ0A 5BMGA 4C56C 1YJJA 4FA6A 2M0XA 2KC2A 1JWSD 1TZOA 3PZDA 1CMXB 3Q3OC 5BYSA 2X38A 1XLOA 3A4RA 4LJPB 3J9CA 3DBRB 4ZOHC 4M0WA 3TEXA 3TMPB 2L0FA 3EGRA 5JHBA 3ZJTA 4KIKB 5E6PA 4C7ZA 2PVGC 3RZFA 3IAS1 2KJHB 2B3AA 4WWNA 5EDSA 2BYVE 3GOEA 1UELA 4LNFA 2Y5BB 1Y56A 3NVWA 2IGGA 1EO6A 3OWEB 5D3IB 2GOWA 3NZSA 3VH3B 4A20A 4W9DA 1FIQA 2REXA 2QCZA 3DBHB 4KZ0A 4NNJB 2MJEA 1B1ZA 4IWPA 2KJ6A 4MJSB 4LTUA 3BYTB 3IT6B 2CU3A 1SIJA 3ZO5B 3BZDB 4M8MA 2GBRA 2O6VD 2JWZA 1YMHE 2JZ3B 3P4PB 4BKSA 3H6NA 4BOSC 2C7NB 4HWIB 4NQLB 1Q0WB 3AB5A 2INPE 3GP7A 4G0NB 2C7MB 1GG3A 2L83A 2V3PA 4IG7B 2N9EB 1C76A 2BW2A 1NI3A 3H7PA 3Q3NC 3KUCB 1JWBD 1P3QU 2K1FA 3PTFC 3PLVA 1QKZA 2SEBD 2AWTA 3WA0A 2LXAA 4WAFA 1FXTB 2ZVNA 4AJYB 1GT8A 2KK8A 2LZ6A 1KLVA 2KDEB 2PW9A 1VZ6A 4AWJA 3DVGX 2WXPA 3P63A 2WYQA 2V3NA 3IT4B 4EKUA 2ZPYA 3LJ3A 3DVGY 1ZOYB 1STEA 2INNE 3HRDD 3S2AA 5L95C 4USAA 3ABVB 3DHHC 3Q69A 1H4RA 2MJ3A 3A9JB 1MG8A 4IM3A 4ITKA 3TSSA 1A70A 1ZXIA 4OZBA 3WAPA 3HK0A 2GI9A 1V2YA 1S3SG 4PYUA 1LO5D 4S17A 1XQQA 2LRUA 1I4QA 1FPYA 2JYEA 3BYYB 4CO7A 1V97A 3UI3A 1E9MA 4RF0A 1WXSA 2HTHA 5C2TB 3ML8A 3ZTCA 2RPQA 3AE8B 1MPEA 2O2VB 4EFOA 2LMCA 4KGRA 4YTNB 2LI5A 4RGMA 2DAFA 2J52A 4LNOA 3QARA 1NI2A 3W2DA 2JYTA 5TSSA 3R2TA 3WANA 2VZKB 1CZPA 2D3AA 5HG2A 3AU4A 3PV1A 2JRHA 2D5GA 4US8A 2KLCA 1KF6B 1ZDVA 4RH6A 1T0QC 2MBQA 1SGHA 1E7VA 3DOWA 1VD2A 2AQ3B 2FNJB 2WXOA 2KTFA 1FNUA 4W9EA 5D7GA 4KSKC 3CMMB 1WZ3A 4RCOA 3N3KB 2KDFB 3LB8C 5JXVA 3Q8BA 1TS3A 2NTTA 4RNAA 2WXLA 4MEMA 2I38A 5DPTA 3AE5B 1QOGA 3RNBC 2ZW0A 5DPRA 2WU5B 2ZVOA 3PZ8A 3AXCA 3ZXRA 5CHVC 3W5UB 3P4RB 3T3NA 1HXYD 4XX5A 2MJDA 3MP9A 2LGSA 2GLSA 5IP4D 2M8SA 1F52A 1DOXA 3DBLB 4W9GA 4BAXA 3A9KA 2AL3A 4ZRKA 2HE7A 3ZNZB 3AEFB 1JMLA 1MHHE 3C19A 1TKGA 5D2MB 1IBXB 1WJUA 4BZAA 3VVWB 3RPFC 1FO4A 1GOZA 4FXCA 1WFYA 2LJ5A 2PLPA 2LGDA 3BINA 3OAWA 3EC8A 3ZVVA 1DYQA 2KWDA 1NEKB 2ZNVC 1FNVA 2RGFA 1RYJA 2ZW1A 1QILA 2KDBA 2IZVB 1D6EC 5EE0A 2W3RA 1K52A 1XD3B 4WJOA 4QAYA 3WALA 5KHQA 1KFYB 2MW5A 2ZJDA 2LGIA 4BBNF 3TCAA 4FHJA 1N62A 2WXIA 2MP2A 3LXFA 1SE4A 2OJWA 3TUOA 1V1OA 4K7SA 4GLSC 2FIDA 2MCNB 4ANVA 4B0EA 1N61A 4WJNA 1ZE3D 1YN5A 2YLMA 3FILB 4NJCA 1E7UA 3T9LA 2KQ7A 1FCLA 1TTNA 3DPDA 2WP9B 1ACCA 1H7XA 4HK2A 2HTME 5IA7A 1HTQA 1FXIA 1RM6C 3BVGA 4A3OA 2LXCA 2AYOB 3RNFC 3ZIMA 3SHQA 4P6VF 3GZNI 3ML9A 2JT4B 4DBGA 1DOYA 2QJLA 1XO3A 2KX3A 2XNAC 3IVFA 1LM8B 3IG3A 1EU4A 3FAHA 4F8CB 2G3QB 4W9CA 4W9LA 4OVUA 2KZRA 4AQ7A 2BGFA 3B0AA 4RGOS 3PLUA 4ICVA 5BMHA 2D3CA 1C78A 1TKYA 4IWOA 4HPLB 2RDGA 2CU1A 2WHIA 4EZKA 3WAOA 3LYYA 1VJKA 1FCCC 2KFKB 1IYFA 2XK5B 2ZCCA 1VZ7A 3IHPC 4FJVB 4CYEA 2TSSA 3NY5A 4B95A 1WYWB 4KVGB 1IUEA 1OQYA 1GJZA 3I3TB 2BB6A 1PGBA 2WLBA 4P1BC 3WCQA 3JYUA 2FCSA 1OQRA 2K8CA 3PHWB 1PQSA 3VRBB 4A8XC 2BWES 1K51A 3V3XA 4MDKE 5IKCM 3SDLC 2KO3A 3OG5A 4PK1A 1GC7A 1I4XA 1WMHB 3PRMB 2M0AA 3TIXA 2BB5A 3L17A 2KWUB 2QC8A 5BMIA 3APCA 3U52E 1PGXA 1RFKA 2VZKD 4ANXA 3QJZA 1FMAD 2GB1A 3DVNU 1QQRA 3VUXA 1R4NB 1UWMA 1WGKA 3KWVA 3NG0A 2N7JA 3MFGA 4RGTA 3PZ7A 4EE2A 5E6OA 1R4MB 3N20C 2NBVB 1OTRB 5E6JA 3KUZA 3L10B 2KXJA 1JQ4A 4L23A 3QQ8B 3JW0X 5EE1A 1H7WA 3HVDA 3O13A 5FK9C 1TS5A 4C4VB 1WE7A 4LDTB 2UYZB 3AULA 1FRDA 1TS4A 2WXRA 4YSZB 1ZW7A 3B08A 1NBFC 3W1YA 1V1PB 1N60A 1KOTA 4FHKA 1VRAB 2OEDA 1J8CA 3N1ZC 4OW0A 1P1AA 2WXGA 4HKQA 1N6ZA 1P7FA 1JCKB 4D2KA 4HPMB 3SD5A 2DYMA 2EELA 4WAAA 4NJ6A 1YN4A 4REZA 2LWPA 3RNAC 4XGAB 2N9PC 3RNCC 2ZPNA 2IJ0A 1GPXA 2NBWB 3U7ZA 4NAWB 1WGHA 4M00A 1HZ6A 1WJNA 4RM9A 3NOBA 2N9XA 2C9WB 4LCDE 1F77A 3V05A 4US9A 3SFEB 4MGKE 1WH3A 2ONQA 3A1QB 3N1YC 1X1MA 1FD6A 1QZEA 1L0XB 2FBWB 3KVFB 3V61A 1PUTA 3PS6A 1LXDA 1K8RB 1TBEA 3MTNB 2DYBA 4YXDB
chains in the Genus database with same CATH topology
1EWCA 1WYGA 1WRIA 1BMLC 3ZJUA 3AE4B 4GDKB 4J3OD 3GB1A 1TKEA 3MJ5A 4RF1A 1GTEA 1VZ6A 2JX5A 2PW9A 2N9KA 2V4IB 2WXPA 3P63A 3ZGZA 2V3NA 3AM9A 4L2YA 3IT4B 3AECB 4LK0M 1YN3A 1ZOYB 2KN4A 3ZQ4A 2BS2B 1EWYC 3W1SA 1STEA 2WXHA 2INNE 3HRDD 2KDMA 1YJIA 1KTKA 2JSVX 2JQRB 1PGAA 2JXTA 4USAA 3VQIA 3ABVB 1BXTA 2EKIA 1FFUA 3Q69A 3PO0A 1FEHA 2MJ3A 1UGJA 1XF5L 1N5WA 2B76B 4PT5A 1YQ3B 1TS2A 4ITKA 3TSSA 3BWUD 1A70A 1E6EB 1ZXIA 4WWMA 4OZBA 1D5MC 4TSSA 2GI9A 2I2YA 4HRSA 2IPKD 1HQRD 2W3SA 2V0GA 3BK2A 2AQ2B 3AE6B 3VR8B 2IDYA 1ESFA 1HZ5A 1LO5D 2M19A 2ON8A 1I4QA 3P1MA 2PMVA 2JYEA 1L4ZB 3BYYB 2BYTA 1V97A 5GXGB 3IXSA 3UI3A 1E9MA 1XCTL 2LJIA 3DWMA 4RF0A 1YNTE 5C2TB 4RGNA 4ZRQA 1K50A 1SE3A 4ZHOA 4HKZE 3AE8B 1MPEA 1AWDA 2LMCA 4KGRA 2LHDA 4YTNB 1V1PA 4KGSA 3U4EG 4A55A 4RGMA 4ZRPA 1D5XC 2J52A 4YSYB 3HUIA 3AE9B 4CQNA 2PVOD 3W2DA 2JYTA 5TSSA 3R2TA 2VZKB 3Q8AA 1C79A 2LEKA 1CZPA 1FFVA 1IGDA 1ROEA 1ZXHA 5HG2A 2K3UA 1FNWA 4P16A 4JWUC 3AE7B 1AW7A 1V8CA 2D5GA 2BBCA 1T5XD 2WU2B 1T3QA 4US8A 5EE3A 4OHJA 1D5ZC 2Y3AA 1KF6B 1ZDVA 3CIRB 3VR9B 1HA5A 4RH6A 4XDCA 4DXGA 2BTEA 3FC4A 1CQVA 2AQ1B 2AQ3B 2WXOA 4N59A 3MC0B 2JWUA 1FNUA 5D7GA 5D3DA 1J7CA 4IDIA 2G9HD 1KLGD 3I57A 4RCOA 3SEBA 1R7SA 3LB8C 3AH7A 1UWXA 3Q8BA 5JXVA 2DBYA 4JPSA 4NAMA 4IOIE 3AEGB 2Q5WD 2WXKA 1TS3A 2NTTA 2HDEA 2PKOA 4RNAA 4WH4A 2WXLA 2FUG1 2I38A 3AE5B 3AE3B 1C77A 2KAJA 1QOGA 2ZW0A 1QF6A 4DQOC 2WU5B 1I4PA 3PZ8A 4MM3B 4UDUC 3W5UB 2GRIA 4AS1A 3P4RB 1EU3A 5AUKA 3NUHB 1MVKA 2J42A 3T3NA 1HXYD 3URYA 3P4QB 2MJDA 3MP9A 2ICIA 4R3DA 2FE8A 1K53A 2L52A 1JROA 4L1BA 1DOXA 3ZYYX 1TYGB 1C9FA 4N6EB 2RMMA 4HEA1 3W5VB 1NYRA 3AEFB 1JMLA 2BT6A 4A6QA 1MHHE 1TKGA 4RFBA 1IBXB 1I4GA 2NMQA 3RPFC 3BVZA 1C4AA 1FO4A 1GOZA 3Q8EA 4FXCA 3N9YC 4H2AA 1ZPSA 2PIAA 1PFDA 3Q8FA 2PLPA 1WSPA 1JRPA 3HVZA 1MI0A 2QMTA 2WQYB 2PTLA 1DYQA 2KWDA 1DOIA 1PDXA 1SJED 3NVVA 1E7PB 1NEKB 4OVZA 3NRZA 1FNVA 1TY0A 3IAM1 1ET6A 2H89B 1RYJA 2ZW1A 1QILA 4ARCA 1ZP0B 4YSXB 1C4PA 1D6EC 1IGCA 3KWLA 2W3RA 5EE0A 1K52A 2K22A 2WDRB 5LNK1 1RWSA 1C4CA 1B9RA 5I4DA 1L4DB 3H8HA 1VLBA 4TMAB 3SFDB 1KFYB 3KLSX 1JW9D 2LGIA 1QOAA 1I7HA 4YTPB 1F2RI 2L1AA 2YEPB 3AEBB 1MHXA 2RPVA 3AEDB 1N62A 4KX6B 1D4BA 1L0VB 2WXIA 3LXFA 1SE4A 1UUPA 1NVID 3TUOA 1V1OA 4GLSC 3VRAB 4B0EA 1N61A 1VDVA 2JU6X 1ZE3D 1YN5A 3FILB 5H8YE 3AEAB 1F0ZA 1N5XA 2MH7A 3Q8CA 2ACZB 2L32A 2WS3B 4NJCA 2W54A 2YEPF 3TEYA 4TQ1A 1AN8A 2E3TA 2BS3B 1FCLA 1TY2A 2WP9B 1ACCA 1H7XA 1GB4A 3EUB2 5G5GA 2G1EA 2JZPA 3NS1A 2LFIA 2HTME 4YT0B 1FXIA 1RM6C 1YQ4B 1JWAD 3BVGA 1QLBB 3ZJVA 4A9AA 3CWIA 4KKJA 2BS4B 3AE2B 5T8IA 3U2SC 3B9JA 2DWQA 1SE2A 2WNMA 2K5PA 4P6VF 4MH8A 2DLBA 1OQQA 1E0ZA 1QOFA 1DOYA 3AEEB 5FR3A 3B2GA 4B0MA 2QJLA 2XN9C 1XO3A 1J7AA 1L0YB 2XNAC 1I4RA 1EM7A 1SBBB 5MPOA 2QEJC 1EU4A 3FAHA 1GTHA 1VZ8A 4AQ7A 1F2RC 1PYWD 4RGOS 3EA6A 3R2IA 2Y5CA 3T3OA 4NZLB 2W82A 3L4PA 5BMHA 1XLPA 1GAQB 1C78A 1DGJA 1TKYA 4GDLB 1SXTA 4O1NA 3BK1A 4KKIA 1SB3C 3W9CB 2RDGA 3MHZA 2OHFA 2WXJA 1UNSA 2LHEA 3LYYA 1VJKA 1FCCC 1VZ7A 2K9XA 2IGDA 4DXFA 5AUIA 4C80A 2TSSA 5BYRA 2E6XA 1XLNA 4LLGM 5HI1A 2WDVB 4XWTA 1WWTA 4OZCA 1IUEA 2H88B 1IBXA 2KMMA 5HFYA 4HROA 1GB1A 4IKGA 2WXFA 4XDDA 2BB6A 1PGBA 2WLBA 2RDHA 3WCQA 1XXGA 2SAKA 1M4VA 1OQRA 2W55A 4ARIA 1HEZE 3VRBB 3NVYA 5H92C 3DWGC 1CJEA 4A8XC 1K51A 3V3XA 4N58A 3B2FA 3AE1B 1JWUD 1I4XA 3SR6A 1ZDXA 4Q2JA 2M0AA 3E9SA 1KRHA 2BB5A 2WXNA 4C7YA 3E56A 4KGTA 4MACA 1T6BX 5BMIA 3ETRA 1XCQL 3AV8A 3P4SB 3U52E 3TEZA 4WURA 3AN1A 5HHDG 1PGXA 4YWGG 4ZHPA 1RFKA 3AMZA 2VZKD 4JX1C 1BUIC 4HJGE 4XE0A 1FMAD 2GB1A 2QSDA 2Y5PA 1QQRA 1L5PA 1UWMA 1WGKA 4TQ0A 1P7EA 1WXQA 5BMGA 3KWVA 2R61A 1N63A 4C56C 1YJJA 2N7JA 3MFGA 4RGTA 1ENFA 3PZ7A 4EE2A 1JWSD 5G5HA 1TZOA 3FILA 3R8BA 5E6JA 5BYSA 5C3JB 2X38A 1XLOA 3J9CA 2K0PA 1JQ4A 4L23A 4WIPA 4WQMA 4ZOHC 2M56B 4JWSC 4M0WA 3TEXA 1JALA 1H7WA 3EGRA 3HVDA 5EE1A 3ZJTA 5EE9A 1E10A 3TEWA 3O13A 5FK9C 1TS5A 1FM0D 2PVGC 1NENB 4C7ZA 4YTMB 3IAS1 1CK1A 3BIID 2DYOA 1VR9A 1Y56A 1FRDA 2WDQB 1TS4A 2IGGA 3NVWA 1SSNA 2WXRA 3OWEB 5D3IB 1SEBD 1FXAA 2J4XA 4YSZB 1FIQA 1V1PB 2J53A 3RFZB 1N60A 1ET9A 2MJEA 1B1ZA 3KQ4A 5BYQA 1JWMD 1QT9A 1I4HA 1VRAB 2OEDA 3NZ3A 4LTUA 3BYTB 3IT6B 2CU3A 2QILA 1XLQA 1SIJA 2QIEB 4OW0A 2LUMA 2KACA 5FKAC 2WXGA 4HKQA 2WXQA 1L6VA 1P7FA 3CF4A 3BZDB 1JCKB 4D2KA 4XWWA 2DYMA 1YMHE 2EELA 2N0SB 3P4PB 3BVMA 2CJOA 1YN4A 1SJHD 4REZA 1KH0A 4ZYSA 3AB5A 2INPE 3C8YA 3GP7A 4JE3B 2IJ0A 3NVZA 1GPXA 3U7ZA 2IGHA 2MEKA 4A90A 2L83A 2V3PA 2KQ4X 2Z8LA 4NAWB 1HZ6A 1AYFA 1C76A 2NTSA 4MT5A 2BW2A 3GS2A 1NI3A 1Q10A 3V05A 1F77A 1ZUD2 1SF0A 4US9A 3SFEB 3I9V1 1JWBD 1L6UA 2ONQA 1XEEA 1QKZA 2AX5A 2SEBD 1FD6A 1FRRA 1TJEA 2WXMA 1KLUD 4WAFA 1L0XB 2FBWB 1QOBA 1PUTA 2CJNA 2N9LA 1NYQA 1GT8A 3P42A 4OZAA 1OFFA 4YXDB 1J7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMA D;  1WYG A;  2PKO A;  3EUB 2;  1WRI A;  2G1E A;  5G5G A;  3NS1 A;  3AE4 B;  2HTM E;  4YT0 B;  1L5P A;  3AE5 B;  3AE3 B;  1FXI A;  1RM6 C;  1TKE A;  1UWM A;  1GTE A;  1WGK A;  1YQ4 B;  1N63 A;  1WXQ A;  1YJJ A;  2JX5 A;  1JWA D;  1QOG A;  1QLB B;  3P63 A;  1QF6 A;  4A9A A;  3CWI A;  2WU5 B;  3AM9 A;  3AEC B;  5G5H A;  2BS4 B;  3AE2 B;  1ZOY B;  3W5U B;  3B9J A;  2DWQ A;  2BS2 B;  2K5P A;  5C3J B;  1EWY C;  3P4R B;  1XLO A;  4P6V F;  5AUK A;  1OQQ A;  1E0Z A;  1QOF A;  1DOY A;  3HRD D;  3AEE B;  1JQ4 A;  3B2G A;  4WQM A;  2QJL A;  1YJI A;  4ZOH C;  2M56 B;  4JWS C;  1XO3 A;  1JAL A;  1H7W A;  1J7A A;  3P4Q B;  2JQR B;  2MJD A;  3ABV B;  4USA A;  5EE1 A;  5EE9 A;  5MPO A;  2KAJ A;  1E10 A;  2EKI A;  1FFU A;  1FM0 D;  2PVG C;  1NEN B;  3FAH A;  1GTH A;  3PO0 A;  4C7Z A;  2MJ3 A;  4YTM B;  2L52 A;  1JRO A;  1N5W A;  2B76 B;  1DOX A;  1YQ3 B;  1TYG B;  3ZYY X;  4ITK A;  4WWM A;  1A70 A;  1E6E B;  1ZXI A;  3BII D;  4N6E B;  1FRD A;  2WDQ B;  3NVW A;  4HRS A;  2W3S A;  2Y5C A;  1FXA A;  1NYR A;  3AEF B;  3W5V B;  2BT6 A;  4YSZ B;  1FIQ A;  1TKG A;  3L4P A;  1XLP A;  3AE6 B;  3VR8 B;  1GAQ B;  1N60 A;  2M19 A;  3RPF C;  2MJE A;  1FO4 A;  1DGJ A;  1TKY A;  3P1M A;  1QT9 A;  4FXC A;  2PIA A;  1SB3 C;  1PFD A;  3W9C B;  1V97 A;  2OHF A;  2Q5W D;  4LTU A;  1JRP A;  3HVZ A;  5GXG B;  2CU3 A;  1E9M A;  1XLQ A;  3DWM A;  1SIJ A;  1VJK A;  2QIE B;  5C2T B;  2WQY B;  2K9X A;  1L6V A;  3CF4 A;  5AUI A;  4C80 A;  1DOI A;  1PDX A;  3NVV A;  4ZHO A;  1E7P B;  1NEK B;  1XLN A;  3AE8 B;  3NRZ A;  2WDV B;  1WWT A;  2H89 B;  1AWD A;  1RYJ A;  2N0S B;  3P4P B;  1IUE A;  2CJO A;  1ZP0 B;  2H88 B;  4YTN B;  4YSX B;  2KMM A;  4HRO A;  3KWL A;  5EE0 A;  2W3R A;  2K22 A;  2WDR B;  2WLB A;  3HUI A;  4YSY B;  1RWS A;  3WCQ A;  3AB5 A;  3AE9 B;  2PVO D;  1B9R A;  3NVZ A;  1GPX A;  1OQR A;  2L83 A;  1VLB A;  2LEK A;  1CZP A;  3SFD B;  1FFV A;  1ROE A;  1KFY B;  2W55 A;  1AYF A;  4JWU C;  3VRB B;  3NVY A;  3AE7 B;  1JW9 D;  1CJE A;  1QOA A;  3DWG C;  1NI3 A;  5H92 C;  1V8C A;  4US8 A;  1I7H A;  2WU2 B;  4YTP B;  1SF0 A;  1T3Q A;  3AEB B;  3SFE B;  1ZUD 2;  4US9 A;  3AED B;  1JWB D;  4KX6 B;  1N62 A;  5EE3 A;  1L6U A;  4N58 A;  1KF6 B;  3B2F A;  1L0V B;  3AE1 B;  3CIR B;  3LXF A;  3SR6 A;  3VR9 B;  1NVI D;  2AX5 A;  1FRR A;  1TJE A;  3VRA B;  3FC4 A;  1KRH A;  1N61 A;  4C7Y A;  1VDV A;  2FBW B;  4N59 A;  5H8Y E;  3AEA B;  1F0Z A;  1H7X A;  1QOB A;  1N5X A;  2MH7 A;  3ETR A;  1PUT A;  2CJN A;  3AV8 A;  2ACZ B;  3P4S B;  2WS3 B;  1J7C A;  1NYQ A;  3AN1 A;  4IDI A;  4ZHP A;  2W54 A;  1RFK A;  3AMZ A;  1GT8 A;  4JX1 C;  1R7S A;  1OFF A;  3AH7 A;  3LB8 C;  2E3T A;  2BS3 B;  2DBY A;  4YXD B;  1J7B A;  2WP9 B;  3AEG B; 
#chains in the Genus database with same CATH topology
 1WYG A;  3JSV A;  1BML C;  2A4Z A;  3PGE A;  1GC6 A;  3GB1 A;  2JX5 A;  4FJZ A;  4W9K A;  3ZGZ A;  5BO4 B;  3R3M A;  4LK0 M;  4MSQ B;  2L7R A;  2BS2 B;  4PS8 A;  1YJI A;  1KTK A;  2K25 A;  1ZKH A;  2JQR B;  2ASQ A;  2EKI A;  3PO0 A;  1FEH A;  2N1V A;  1XF5 L;  2B76 B;  2GMI C;  1YQ3 B;  3I5J C;  4LNN A;  4BOZ B;  1YD8 U;  3R7R A;  2V0G A;  1ESF A;  2IBI B;  2FIF A;  1L4Z B;  2QDF A;  2BYT A;  1YNT E;  1HE8 A;  2KHW B;  4RGN A;  4ZRQ A;  4M8N A;  2LHD A;  4EOY A;  4KGS A;  4CQN A;  2R2Q A;  4J6I A;  1WY8 A;  1ROE A;  4M0W B;  1FNW A;  1C3T A;  1WM2 A;  3AE7 B;  3MJW A;  1V8C A;  3W1S C;  4JLC A;  5EE3 A;  4OHJ A;  2Y3A A;  3K9P B;  3CIR B;  1HA5 A;  2D3B A;  4DXG A;  2BTE A;  2AQ1 B;  2KYW A;  2NVU I;  4HDQ A;  2YVC A;  2V4L A;  4W9F A;  4ICU A;  2EMS A;  1KLG D;  3I57 A;  1UWX A;  4JGH B;  2Q5W D;  1YX6 B;  2HDE A;  4WH4 A;  5IAA C;  2V9H A;  2KAJ A;  5LXI B;  1QF6 A;  5TR5 A;  4DQO C;  3NHE B;  2KQS A;  5AUK A;  2KC1 A;  3D32 A;  2J42 A;  1UGM A;  1WXA A;  4B9K A;  4G11 A;  1RFA A;  2FE8 A;  1K53 A;  3H7P B;  1JRO A;  3ZYY X;  1YJ1 A;  2NBU A;  3NJT A;  1C1Y B;  2PE6 B;  4IW0 A;  2RMM A;  2RSU A;  2NMQ A;  3BVZ A;  1C4A A;  1GNU A;  3Q8E A;  2VH2 A;  2EMT A;  1ZPS A;  1PFD A;  1WXV A;  2XBB C;  3HVZ A;  2Z59 B;  3A9J A;  4RM8 A;  1JRU A;  2WQY B;  2L3Z A;  4AJW A;  3K9O B;  2BVC A;  3AI5 A;  2K6D B;  1DOI A;  1SJE D;  2KNB A;  3M62 B;  2KLG A;  4NJ7 A;  3NRZ A;  2UWQ A;  1ET6 A;  1TT5 B;  4K1R B;  1WJ4 A;  3KWL A;  2MBE A;  5LNK 1;  3RN9 C;  4ACF A;  1RWS A;  2N1W A;  4BKT A;  1C4C A;  3KUD B;  1B9R A;  1T0Y A;  1L4D B;  4TMA B;  1ISN A;  1TZ1 A;  3KLS X;  3DBR I;  2GBN A;  4YTP B;  3H9D A;  1MHX A;  3NZU A;  1IPG A;  1L0V B;  2M1M A;  3PT2 B;  2KTR A;  4M02 A;  1VDV A;  2V1Y A;  1Q1O A;  3HM3 A;  3ONS A;  3AEA B;  1N5X A;  5LLI A;  3Q8C A;  2J7Q B;  2YEP F;  3DBH I;  3TEY A;  1AN8 A;  2KX0 A;  4K7W A;  1TY2 A;  1GB4 A;  2KD0 A;  3EUB 2;  5G5G A;  4P1C C;  3DVN V;  4YT0 B;  4WWO A;  4LNI A;  2KT7 A;  1HTO A;  1YQ4 B;  2K6Q A;  1JWA D;  1KM7 A;  3ZJV A;  4A9A A;  4N9F 4;  2DAJ A;  2JY6 A;  3A33 B;  5T8I A;  3WAM A;  2DWQ A;  1SE2 A;  4MH8 A;  4PS7 A;  5FR3 A;  5KHO A;  4B0M A;  5MPO A;  1SBB B;  1EM7 A;  2M4N A;  1VZ8 A;  5DPS A;  3ZLZ A;  1PYW D;  4KSL C;  3VXW A;  3CF6 E;  3T3O A;  2W82 A;  3UIO B;  2JUO A;  5CTR C;  1F9J A;  2NS5 A;  4AUQ C;  4M01 A;  3MHZ A;  2WXJ A;  3ZUN A;  2WGS A;  2LHE A;  4GDK A;  5AUI A;  1WR6 E;  2E6X A;  4LLG M;  2ZCB A;  4NQK E;  2WDV B;  4XWT A;  4ANU A;  1IBX A;  2KVR A;  3ZRF A;  2VRR B;  4DHZ B;  4HJK A;  1M4V A;  2XEW A;  2K8H A;  2NPT A;  3NVY A;  2VH1 A;  2MSE D;  2L76 A;  3A9K B;  1I42 A;  5JHA A;  3SR6 A;  1E8Z A;  4TKN A;  1KRH A;  3VUY A;  1WZ0 A;  2ZZP B;  2WX0 A;  1T0R C;  4WUR A;  3AN1 A;  5HHD G;  3UQA A;  2FCN A;  3AMZ A;  3U8Z A;  4GMV A;  4K7U A;  3V62 A;  3UQB A;  2D2Q A;  4XE0 A;  2L05 A;  2DNF A;  2J0K A;  5CHF A;  3X0W A;  3T8M A;  1P7E A;  1WXQ A;  3HM6 X;  2JVC A;  2GBM A;  2BF8 B;  2L0T A;  3FIL A;  3R8B A;  1UF0 A;  5C3J B;  4GSW A;  4XC2 A;  5J18 A;  4WIP A;  3EFC A;  4JWS C;  4YL8 A;  1E10 A;  3TEW A;  1NEN B;  3MC9 A;  2BYE A;  4YTM B;  3UF8 A;  2X8X X;  1TGZ B;  5CHW A;  2MP2 B;  2WDQ B;  2KWV B;  1SSN A;  2LD9 A;  1SEB D;  1FXA A;  4DK5 A;  1V5O A;  4S0R A;  3RFZ B;  1ET9 A;  4BBN C;  2FCQ A;  3Q3F A;  2QIL A;  1XLQ A;  4GXB A;  2QIE B;  3ZNI D;  2KAC A;  3CF4 A;  1J19 A;  2N0S B;  4MM3 A;  2MBH A;  1SJH D;  1KH0 A;  4WQO B;  4JE3 B;  3NVZ A;  4A90 A;  2IGH A;  2MEK A;  1AYF A;  1TIF A;  2KFK A;  1Q10 A;  4ZRI A;  1L6U A;  2O6V A;  4W9H A;  2KAN A;  2AX5 A;  1WIA A;  1TJE A;  3DBL I;  2WXM A;  1D3Z A;  1KLU D;  5C23 A;  1QOB A;  2CJN A;  1NYQ A;  2WWZ A;  1OFF A;  1J7B A;  2BPS A;  1EWC A;  3ZJU A;  2BQQ A;  4J3O D;  3RCZ A;  1TKE A;  1WMH A;  4RF1 A;  2N9K A;  2NR2 A;  2V4I B;  3AM9 A;  4HPP A;  3AEC B;  3IFW B;  1YN3 A;  2KN4 A;  3ZQ4 A;  3PVL A;  1A5R A;  3W1S A;  2WXH A;  4HCN B;  3H1U A;  2KDM A;  2JSV X;  2W9N A;  1PGA A;  2JXT A;  1BXT A;  1FFU A;  2R2O A;  5DCN A;  1UGJ A;  4K3B A;  1N5W A;  3M63 B;  3BWU D;  3Q14 C;  4WWM A;  4TSS A;  4HRS A;  2W3S A;  2D10 A;  1P9D U;  1L2N A;  2AQ2 B;  3VR8 B;  2IDY A;  2M19 A;  1U4A A;  3N1X C;  3P1M A;  3R7Q A;  1WE6 A;  3IXS A;  3VH4 B;  2LJI A;  3DWM A;  1K50 A;  3Q3J A;  3PPA A;  5IOI A;  5G55 A;  4RMA A;  3EEC A;  3HHM A;  1WR1 A;  2A5U A;  3QK0 A;  1V1P A;  2OOB B;  3U4E G;  4A55 A;  2IYD B;  1D5X C;  3HUI A;  1YOV B;  1P0R A;  2LGX A;  1NDD A;  3QX1 A;  3Q8A A;  1IGD A;  1ZXH A;  2K39 A;  2K3U A;  4P16 A;  1AW7 A;  2FCM A;  2K8B A;  2N7E A;  2BBC A;  1T5X D;  4E3C A;  1D5Z C;  4LJO B;  3VR9 B;  2V3S A;  4XDC A;  3PRP B;  3FC4 A;  1CQV A;  2AEH A;  3MC0 B;  2JWU A;  2HJ8 A;  4GDL A;  2KJR A;  5D3D A;  4ZDV A;  4IDI A;  5AZG A;  2DX5 B;  2G9H D;  3KYD D;  3SEB A;  1R7S A;  3AH7 A;  1EF5 A;  3RNG C;  2KMA A;  2DBY A;  4JPS A;  4NAM A;  4IOI E;  3AEG B;  2WXK A;  2FUG 1;  3QWZ B;  3L0W B;  3AE3 B;  2AL6 A;  3A1Q A;  3ZNG C;  1V5T A;  1I4P A;  2MX2 A;  2MQJ A;  3VUW A;  1M94 A;  4AS1 A;  1UZX B;  1WGD A;  3DHI C;  3P4Q B;  2ICI A;  4R3D A;  3N32 A;  3DQV A;  1WGR A;  4JIO U;  2DHZ A;  1NYR A;  2BT6 A;  4A6Q A;  2DZI A;  2WX1 A;  2G45 B;  1I4G A;  3APD A;  4ZYN A;  2BKF A;  3N9Y C;  4H2A A;  1H8C A;  1WSP A;  4I6P A;  1MI0 A;  2QMT A;  4NY0 A;  3JSV B;  2PTL A;  1V9J A;  3NVV A;  4OVZ A;  1TY0 A;  3IAM 1;  4DXA B;  2H89 B;  1R4N I;  1ZP0 B;  4YSX B;  1C4P A;  2K22 A;  2JPH A;  2WDR B;  3P2B A;  1R4M I;  4URK A;  2IO0 B;  2IO1 B;  3H8H A;  1VLB A;  2DZM A;  4KIK A;  3PHX B;  1JW9 D;  1QOA A;  4MGY E;  5AZF A;  1I7H A;  2L1A A;  2YEP B;  1IP9 A;  3AED B;  4KX6 B;  4ASW C;  1UUP A;  2JU6 X;  1UH6 A;  2MH7 A;  2LGY A;  2L32 A;  2LVQ A;  2WS3 B;  4MJS A;  2W54 A;  1WRD B;  2BS3 B;  3L16 A;  4K81 A;  3IBE A;  4F1S A;  4NPN A;  2JZP A;  4MGZ E;  3NS1 A;  1UD7 A;  5D6J B;  4DDI D;  1QLB B;  1L7Y A;  4WWP A;  3CWI A;  1T0S C;  1AAR A;  2HJ1 A;  2BS4 B;  1Q5W B;  4KDI C;  3KW5 B;  5CX3 A;  3U2S C;  5C1Z A;  2WNM A;  4DHZ E;  1OQQ A;  1E0Z A;  1QOF A;  1L0Y B;  3VAW A;  1I4R A;  3TJP A;  2PPH A;  3H7S A;  3R66 C;  1E8Y A;  3BY4 B;  1MG4 A;  2BYF A;  4NZL B;  4I6L B;  1XLP A;  2CHZ A;  4TV3 A;  4IM0 A;  2L8J A;  1DGJ A;  3PRZ A;  1SXT A;  3BK1 A;  1SB3 C;  2ZNV B;  3L13 A;  2OHF A;  2JF5 A;  4TUU A;  1UNS A;  4BKG A;  4HLE A;  2L00 B;  5BYR A;  3FKY A;  5HI1 A;  1V81 A;  4OZC A;  1WX7 A;  2H88 B;  5HFY A;  4HRO A;  1E90 A;  1OEY J;  2WXF A;  2SAK A;  1EUV B;  5J17 A;  4G3X B;  1BT0 A;  1HEZ E;  5H92 C;  3DWG C;  2CS4 A;  3N30 A;  2KFJ A;  4LDT D;  2MBB B;  1YQB A;  3B2F A;  4FUL A;  2J0M A;  4Q2J A;  4EUT A;  3GE3 C;  4B6W A;  2WXN A;  4KGT A;  4MAC A;  3QCA A;  1XCQ L;  3TEZ A;  3TL5 A;  2N7D A;  1VCB A;  4HJG E;  2QHO A;  3QA8 A;  4II2 B;  2QSD A;  1WGY A;  2R61 A;  1N63 A;  4XZ4 A;  2O2V A;  1ENF A;  2EKE C;  2KMC A;  5G5H A;  3RNE C;  3L08 A;  1WM3 A;  3RD2 A;  4ZRJ A;  4FLH A;  2K0P A;  3VHT C;  1MJD A;  4WQM A;  2M56 B;  1JAL A;  3ALB A;  4AOF A;  5EE9 A;  2JRI B;  3X23 A;  1FM0 D;  1G6J A;  4MSM B;  1CK1 A;  3BII D;  2DYO A;  1VR9 A;  2IO2 B;  4W9I A;  2J4X A;  2KTR B;  3OJ3 A;  2G4D B;  2LRW A;  2J53 A;  2JXX A;  3VDZ A;  5BYQ A;  3KQ4 A;  4K3C A;  2N4F A;  1LQB A;  1JWM D;  1QT9 A;  1I4H A;  3ZDT A;  2PEA A;  3NZ3 A;  3Q3M C;  3V6E B;  2DZK A;  2LUM A;  4JL9 A;  5FKA C;  2WXQ A;  1L6V A;  4XWW A;  4IWQ A;  3VTV A;  5E6N A;  3BVM A;  2CJO A;  3GZN B;  1E5W A;  4ZYS A;  1P98 A;  1RLF A;  3GE8 C;  1RRB A;  1KJT A;  4IC7 B;  3C8Y A;  2KQ4 X;  2MA9 B;  2Z8L A;  2NTS A;  4MT5 A;  5HKH A;  3GS2 A;  2BKR B;  1RAX A;  1ZUD 2;  1SF0 A;  3I9V 1;  2LAS A;  4FJY A;  1XEE A;  2RDB C;  2BWF A;  3I63 C;  1FRR A;  2JZZ A;  3DBS A;  4BVU C;  4JQW C;  3RMK C;  2N9L A;  2I1K A;  3RI7 C;  2MBO A;  3P42 A;  1SE9 A;  1GUA B;  4OZA A;  4F7Z A;  2LUE A;  1UBI A;  3PSE B;  2UU7 A;  3SU8 X;  3M3J A;  3VTW A;  1WRI A;  2KKC A;  3AE4 B;  4GDK B;  4IUM B;  3MJ5 A;  2GBJ A;  1GTE A;  3CSF A;  2D11 A;  3L54 A;  4L2Y A;  1S1Q B;  2D3G A;  4WJQ A;  2KVZ A;  4W9J A;  3ZKJ C;  1EWY C;  2MRP A;  2KDI A;  2C60 A;  3VQI A;  4EZL A;  5L83 A;  5GMV A;  2C7H A;  2NPT B;  3B1L X;  4LNK A;  4DHJ B;  4GIV A;  3OLM D;  4PS3 A;  3V6C B;  2CR5 A;  4PT5 A;  2LVP A;  1TS2 A;  2FAZ A;  1E6E B;  1D5M C;  2I2Y A;  2IPK D;  1HQR D;  2KOX A;  4GB9 A;  1UBQ A;  2M17 A;  2OJR A;  3RT3 B;  2LVO A;  3BK2 A;  3AE6 B;  1HZ5 A;  2ON8 A;  3MHS D;  2PMV A;  5AEK B;  4HCP B;  4HVB A;  4HXD A;  4A3P A;  5GXG B;  1XCT L;  4AP4 C;  1WJ6 A;  1SE3 A;  4ZHO A;  4HKZ E;  4C00 A;  1AWD A;  5IO9 A;  2CKH B;  2RR9 A;  2HD5 B;  3KH0 A;  4BKS D;  2J0J A;  4ZRP A;  4YSY B;  1OEY A;  3AE9 B;  2PVO D;  4CHK A;  1C79 A;  1J0G A;  2LEK A;  1FFV A;  2IY0 B;  3UGB B;  4JWU C;  2WU2 B;  1T3Q A;  1V49 A;  3AU5 A;  4GN1 A;  2DZJ A;  3ENE A;  1ZGU B;  4N59 A;  4DDG D;  2PJH A;  5IN7 A;  1J7C A;  2NCN A;  3RUL A;  3MC8 A;  2XK5 A;  2PKO A;  5J2R A;  3ZDM C;  3UIN B;  1C77 A;  1LFD A;  3ZNH B;  4MH0 E;  5FR6 A;  3DHG C;  4IM2 A;  3LDZ E;  4MM3 B;  4UDU C;  2GRI A;  1YIW A;  1V6E A;  1EU3 A;  3C0R B;  4DWF A;  4MGI E;  3NUH B;  1MVK A;  2GBK A;  2FUH B;  3URY A;  3ECI A;  4GGQ A;  1I35 A;  2INC C;  4KDL B;  2L52 A;  4L1B A;  2G4S A;  1TYG B;  3QHT A;  1OGW A;  1EF1 A;  1C9F A;  2O6V B;  4N6E B;  4HEA 1;  3W5V B;  3RUI B;  5LXH A;  4P7I A;  4RFB A;  2CHW A;  4I6N B;  2IND C;  2I1J A;  3QAQ A;  2PIA A;  5JH5 C;  3Q8F A;  4ANW A;  1JRP A;  3A4S C;  3WIM A;  1SIF A;  3PRE A;  4EEW A;  1PDX A;  1E7P B;  3V60 A;  4WJP A;  4ARC A;  4PYZ A;  3CST A;  1IGC A;  3JVZ X;  3EFU A;  5I4D A;  1YX5 B;  3SFD B;  1F1H A;  3UIP B;  2DEN B;  4C4V A;  3ZXV A;  1WGG A;  1E8W A;  1F2R I;  4MEL A;  3AEB B;  2RPV A;  3ZRC A;  4E74 A;  1D4B A;  4KV2 A;  1NVI D;  1V80 A;  3RZW C;  3VRA B;  2C5L C;  2ZEQ A;  4FN2 A;  5H8Y E;  1F0Z A;  2ACZ B;  1WX9 A;  1WXM A;  3Q6B A;  3APF A;  4TQ1 A;  2E3T A;  4HDO A;  3VTU A;  4E71 A;  4II3 B;  4FAD A;  2G1E A;  3Q2A C;  4FBJ B;  3VFK A;  2LFI A;  2RD0 A;  4KKJ A;  3QIJ A;  4X57 B;  3AE2 B;  4OVV A;  3DCG A;  3B9J A;  2K5P A;  3DDC B;  5DPW A;  2DLB A;  3QC8 B;  2PE9 A;  3AEE B;  4KZC A;  3B2G A;  1E8X A;  2XN9 C;  4NAW A;  3M95 A;  1J7A A;  2KN5 A;  3U7D A;  2QEJ C;  2MWS B;  3ZTD A;  1GTH A;  4EZJ A;  3OJ4 B;  3ZW3 A;  3NS8 A;  1V86 A;  5AZH A;  1F2R C;  1WF9 A;  4BFR A;  3EA6 A;  3R2I A;  2Y5C A;  2MLB A;  3L4P A;  1GAQ B;  2KWC A;  4GDL B;  1MFW A;  4O1N A;  1LGR A;  4KKI A;  3RYT A;  3W9C B;  4GU2 A;  1XT9 B;  3EHV A;  2WDT B;  1Z5S B;  3O65 B;  4XYC A;  4DHJ D;  1Z2M A;  3TBL D;  3U30 A;  2K9X A;  2IGD A;  4DXF A;  4C80 A;  1XLN A;  1WWT A;  5G2N A;  3HIZ A;  2KMM A;  1GB1 A;  2MHJ A;  1WI0 A;  4IKG A;  4XDD A;  2IY1 B;  2RDH A;  1XXG A;  1WX8 A;  5JZE B;  2Z0E B;  2W55 A;  4ARI A;  2D07 B;  1CJE A;  4N58 A;  2IO3 B;  3AE1 B;  1JWU D;  3KYC D;  1ZDX A;  4GOC A;  1Y8R C;  3E9S A;  4G50 A;  2CHX A;  4C7Y A;  3E56 A;  1T6B X;  3ETR A;  3AV8 A;  3P4S B;  4YWG G;  4ZHP A;  4JX1 C;  1BUI C;  5D94 A;  2Z0D B;  2Y5P A;  1L5P A;  4TQ0 A;  5BMG A;  4C56 C;  1YJJ A;  4FA6 A;  2M0X A;  2KC2 A;  1JWS D;  1TZO A;  3PZD A;  1CMX B;  3Q3O C;  5BYS A;  2X38 A;  1XLO A;  3A4R A;  4LJP B;  3J9C A;  3DBR B;  4ZOH C;  4M0W A;  3TEX A;  3TMP B;  2L0F A;  3EGR A;  5JHB A;  3ZJT A;  4KIK B;  5E6P A;  4C7Z A;  2PVG C;  3RZF A;  3IAS 1;  2KJH B;  2B3A A;  4WWN A;  5EDS A;  2BYV E;  3GOE A;  1UEL A;  4LNF A;  2Y5B B;  1Y56 A;  3NVW A;  2IGG A;  1EO6 A;  3OWE B;  5D3I B;  2GOW A;  3NZS A;  3VH3 B;  4A20 A;  4W9D A;  1FIQ A;  2REX A;  2QCZ A;  3DBH B;  4KZ0 A;  4NNJ B;  2MJE A;  1B1Z A;  4IWP A;  2KJ6 A;  4MJS B;  4LTU A;  3BYT B;  3IT6 B;  2CU3 A;  1SIJ A;  3ZO5 B;  3BZD B;  4M8M A;  2GBR A;  2O6V D;  2JWZ A;  1YMH E;  2JZ3 B;  3P4P B;  4BKS A;  3H6N A;  4BOS C;  2C7N B;  4HWI B;  4NQL B;  1Q0W B;  3AB5 A;  2INP E;  3GP7 A;  4G0N B;  2C7M B;  1GG3 A;  2L83 A;  2V3P A;  4IG7 B;  2N9E B;  1C76 A;  2BW2 A;  1NI3 A;  3H7P A;  3Q3N C;  3KUC B;  1JWB D;  1P3Q U;  2K1F A;  3PTF C;  3PLV A;  1QKZ A;  2SEB D;  2AWT A;  3WA0 A;  2LXA A;  4WAF A;  1FXT B;  2ZVN A;  4AJY B;  1GT8 A;  2KK8 A;  2LZ6 A;  1KLV A;  2KDE B;  2PW9 A;  1VZ6 A;  4AWJ A;  3DVG X;  2WXP A;  3P63 A;  2WYQ A;  2V3N A;  3IT4 B;  4EKU A;  2ZPY A;  3LJ3 A;  3DVG Y;  1ZOY B;  1STE A;  2INN E;  3HRD D;  3S2A A;  5L95 C;  4USA A;  3ABV B;  3DHH C;  3Q69 A;  1H4R A;  2MJ3 A;  3A9J B;  1MG8 A;  4IM3 A;  4ITK A;  3TSS A;  1A70 A;  1ZXI A;  4OZB A;  3WAP A;  3HK0 A;  2GI9 A;  1V2Y A;  1S3S G;  4PYU A;  1LO5 D;  4S17 A;  1XQQ A;  2LRU A;  1I4Q A;  1FPY A;  2JYE A;  3BYY B;  4CO7 A;  1V97 A;  3UI3 A;  1E9M A;  4RF0 A;  1WXS A;  2HTH A;  5C2T B;  3ML8 A;  3ZTC A;  2RPQ A;  3AE8 B;  1MPE A;  2O2V B;  4EFO A;  2LMC A;  4KGR A;  4YTN B;  2LI5 A;  4RGM A;  2DAF A;  2J52 A;  4LNO A;  3QAR A;  1NI2 A;  3W2D A;  2JYT A;  5TSS A;  3R2T A;  3WAN A;  2VZK B;  1CZP A;  2D3A A;  5HG2 A;  3AU4 A;  3PV1 A;  2JRH A;  2D5G A;  4US8 A;  2KLC A;  1KF6 B;  1ZDV A;  4RH6 A;  1T0Q C;  2MBQ A;  1SGH A;  1E7V A;  3DOW A;  1VD2 A;  2AQ3 B;  2FNJ B;  2WXO A;  2KTF A;  1FNU A;  4W9E A;  5D7G A;  4KSK C;  3CMM B;  1WZ3 A;  4RCO A;  3N3K B;  2KDF B;  3LB8 C;  5JXV A;  3Q8B A;  1TS3 A;  2NTT A;  4RNA A;  2WXL A;  4MEM A;  2I38 A;  5DPT A;  3AE5 B;  1QOG A;  3RNB C;  2ZW0 A;  5DPR A;  2WU5 B;  2ZVO A;  3PZ8 A;  3AXC A;  3ZXR A;  5CHV C;  3W5U B;  3P4R B;  3T3N A;  1HXY D;  4XX5 A;  2MJD A;  3MP9 A;  2LGS A;  2GLS A;  5IP4 D;  2M8S A;  1F52 A;  1DOX A;  3DBL B;  4W9G A;  4BAX A;  3A9K A;  2AL3 A;  4ZRK A;  2HE7 A;  3ZNZ B;  3AEF B;  1JML A;  1MHH E;  3C19 A;  1TKG A;  5D2M B;  1IBX B;  1WJU A;  4BZA A;  3VVW B;  3RPF C;  1FO4 A;  1GOZ A;  4FXC A;  1WFY A;  2LJ5 A;  2PLP A;  2LGD A;  3BIN A;  3OAW A;  3EC8 A;  3ZVV A;  1DYQ A;  2KWD A;  1NEK B;  2ZNV C;  1FNV A;  2RGF A;  1RYJ A;  2ZW1 A;  1QIL A;  2KDB A;  2IZV B;  1D6E C;  5EE0 A;  2W3R A;  1K52 A;  1XD3 B;  4WJO A;  4QAY A;  3WAL A;  5KHQ A;  1KFY B;  2MW5 A;  2ZJD A;  2LGI A;  4BBN F;  3TCA A;  4FHJ A;  1N62 A;  2WXI A;  2MP2 A;  3LXF A;  1SE4 A;  2OJW A;  3TUO A;  1V1O A;  4K7S A;  4GLS C;  2FID A;  2MCN B;  4ANV A;  4B0E A;  1N61 A;  4WJN A;  1ZE3 D;  1YN5 A;  2YLM A;  3FIL B;  4NJC A;  1E7U A;  3T9L A;  2KQ7 A;  1FCL A;  1TTN A;  3DPD A;  2WP9 B;  1ACC A;  1H7X A;  4HK2 A;  2HTM E;  5IA7 A;  1HTQ A;  1FXI A;  1RM6 C;  3BVG A;  4A3O A;  2LXC A;  2AYO B;  3RNF C;  3ZIM A;  3SHQ A;  4P6V F;  3GZN I;  3ML9 A;  2JT4 B;  4DBG A;  1DOY A;  2QJL A;  1XO3 A;  2KX3 A;  2XNA C;  3IVF A;  1LM8 B;  3IG3 A;  1EU4 A;  3FAH A;  4F8C B;  2G3Q B;  4W9C A;  4W9L A;  4OVU A;  2KZR A;  4AQ7 A;  2BGF A;  3B0A A;  4RGO S;  3PLU A;  4ICV A;  5BMH A;  2D3C A;  1C78 A;  1TKY A;  4IWO A;  4HPL B;  2RDG A;  2CU1 A;  2WHI A;  4EZK A;  3WAO A;  3LYY A;  1VJK A;  1FCC C;  2KFK B;  1IYF A;  2XK5 B;  2ZCC A;  1VZ7 A;  3IHP C;  4FJV B;  4CYE A;  2TSS A;  3NY5 A;  4B95 A;  1WYW B;  4KVG B;  1IUE A;  1OQY A;  1GJZ A;  3I3T B;  2BB6 A;  1PGB A;  2WLB A;  4P1B C;  3WCQ A;  3JYU A;  2FCS A;  1OQR A;  2K8C A;  3PHW B;  1PQS A;  3VRB B;  4A8X C;  2BWE S;  1K51 A;  3V3X A;  4MDK E;  5IKC M;  3SDL C;  2KO3 A;  3OG5 A;  4PK1 A;  1GC7 A;  1I4X A;  1WMH B;  3PRM B;  2M0A A;  3TIX A;  2BB5 A;  3L17 A;  2KWU B;  2QC8 A;  5BMI A;  3APC A;  3U52 E;  1PGX A;  1RFK A;  2VZK D;  4ANX A;  3QJZ A;  1FMA D;  2GB1 A;  3DVN U;  1QQR A;  3VUX A;  1R4N B;  1UWM A;  1WGK A;  3KWV A;  3NG0 A;  2N7J A;  3MFG A;  4RGT A;  3PZ7 A;  4EE2 A;  5E6O A;  1R4M B;  3N20 C;  2NBV B;  1OTR B;  5E6J A;  3KUZ A;  3L10 B;  2KXJ A;  1JQ4 A;  4L23 A;  3QQ8 B;  3JW0 X;  5EE1 A;  1H7W A;  3HVD A;  3O13 A;  5FK9 C;  1TS5 A;  4C4V B;  1WE7 A;  4LDT B;  2UYZ B;  3AUL A;  1FRD A;  1TS4 A;  2WXR A;  4YSZ B;  1ZW7 A;  3B08 A;  1NBF C;  3W1Y A;  1V1P B;  1N60 A;  1KOT A;  4FHK A;  1VRA B;  2OED A;  1J8C A;  3N1Z C;  4OW0 A;  1P1A A;  2WXG A;  4HKQ A;  1N6Z A;  1P7F A;  1JCK B;  4D2K A;  4HPM B;  3SD5 A;  2DYM A;  2EEL A;  4WAA A;  4NJ6 A;  1YN4 A;  4REZ A;  2LWP A;  3RNA C;  4XGA B;  2N9P C;  3RNC C;  2ZPN A;  2IJ0 A;  1GPX A;  2NBW B;  3U7Z A;  4NAW B;  1WGH A;  4M00 A;  1HZ6 A;  1WJN A;  4RM9 A;  3NOB A;  2N9X A;  2C9W B;  4LCD E;  1F77 A;  3V05 A;  4US9 A;  3SFE B;  4MGK E;  1WH3 A;  2ONQ A;  3A1Q B;  3N1Y C;  1X1M A;  1FD6 A;  1QZE A;  1L0X B;  2FBW B;  3KVF B;  3V61 A;  1PUT A;  3PS6 A;  1LXD A;  1K8R B;  1TBE A;  3MTN B;  2DYB A;  4YXD B; 
#chains in the Genus database with same CATH homology
 1EWC A;  1WYG A;  1WRI A;  1BML C;  3ZJU A;  3AE4 B;  4GDK B;  4J3O D;  3GB1 A;  1TKE A;  3MJ5 A;  4RF1 A;  1GTE A;  1VZ6 A;  2JX5 A;  2PW9 A;  2N9K A;  2V4I B;  2WXP A;  3P63 A;  3ZGZ A;  2V3N A;  3AM9 A;  4L2Y A;  3IT4 B;  3AEC B;  4LK0 M;  1YN3 A;  1ZOY B;  2KN4 A;  3ZQ4 A;  2BS2 B;  1EWY C;  3W1S A;  1STE A;  2WXH A;  2INN E;  3HRD D;  2KDM A;  1YJI A;  1KTK A;  2JSV X;  2JQR B;  1PGA A;  2JXT A;  4USA A;  3VQI A;  3ABV B;  1BXT A;  2EKI A;  1FFU A;  3Q69 A;  3PO0 A;  1FEH A;  2MJ3 A;  1UGJ A;  1XF5 L;  1N5W A;  2B76 B;  4PT5 A;  1YQ3 B;  1TS2 A;  4ITK A;  3TSS A;  3BWU D;  1A70 A;  1E6E B;  1ZXI A;  4WWM A;  4OZB A;  1D5M C;  4TSS A;  2GI9 A;  2I2Y A;  4HRS A;  2IPK D;  1HQR D;  2W3S A;  2V0G A;  3BK2 A;  2AQ2 B;  3AE6 B;  3VR8 B;  2IDY A;  1ESF A;  1HZ5 A;  1LO5 D;  2M19 A;  2ON8 A;  1I4Q A;  3P1M A;  2PMV A;  2JYE A;  1L4Z B;  3BYY B;  2BYT A;  1V97 A;  5GXG B;  3IXS A;  3UI3 A;  1E9M A;  1XCT L;  2LJI A;  3DWM A;  4RF0 A;  1YNT E;  5C2T B;  4RGN A;  4ZRQ A;  1K50 A;  1SE3 A;  4ZHO A;  4HKZ E;  3AE8 B;  1MPE A;  1AWD A;  2LMC A;  4KGR A;  2LHD A;  4YTN B;  1V1P A;  4KGS A;  3U4E G;  4A55 A;  4RGM A;  4ZRP A;  1D5X C;  2J52 A;  4YSY B;  3HUI A;  3AE9 B;  4CQN A;  2PVO D;  3W2D A;  2JYT A;  5TSS A;  3R2T A;  2VZK B;  3Q8A A;  1C79 A;  2LEK A;  1CZP A;  1FFV A;  1IGD A;  1ROE A;  1ZXH A;  5HG2 A;  2K3U A;  1FNW A;  4P16 A;  4JWU C;  3AE7 B;  1AW7 A;  1V8C A;  2D5G A;  2BBC A;  1T5X D;  2WU2 B;  1T3Q A;  4US8 A;  5EE3 A;  4OHJ A;  1D5Z C;  2Y3A A;  1KF6 B;  1ZDV A;  3CIR B;  3VR9 B;  1HA5 A;  4RH6 A;  4XDC A;  4DXG A;  2BTE A;  3FC4 A;  1CQV A;  2AQ1 B;  2AQ3 B;  2WXO A;  4N59 A;  3MC0 B;  2JWU A;  1FNU A;  5D7G A;  5D3D A;  1J7C A;  4IDI A;  2G9H D;  1KLG D;  3I57 A;  4RCO A;  3SEB A;  1R7S A;  3LB8 C;  3AH7 A;  1UWX A;  3Q8B A;  5JXV A;  2DBY A;  4JPS A;  4NAM A;  4IOI E;  3AEG B;  2Q5W D;  2WXK A;  1TS3 A;  2NTT A;  2HDE A;  2PKO A;  4RNA A;  4WH4 A;  2WXL A;  2FUG 1;  2I38 A;  3AE5 B;  3AE3 B;  1C77 A;  2KAJ A;  1QOG A;  2ZW0 A;  1QF6 A;  4DQO C;  2WU5 B;  1I4P A;  3PZ8 A;  4MM3 B;  4UDU C;  3W5U B;  2GRI A;  4AS1 A;  3P4R B;  1EU3 A;  5AUK A;  3NUH B;  1MVK A;  2J42 A;  3T3N A;  1HXY D;  3URY A;  3P4Q B;  2MJD A;  3MP9 A;  2ICI A;  4R3D A;  2FE8 A;  1K53 A;  2L52 A;  1JRO A;  4L1B A;  1DOX A;  3ZYY X;  1TYG B;  1C9F A;  4N6E B;  2RMM A;  4HEA 1;  3W5V B;  1NYR A;  3AEF B;  1JML A;  2BT6 A;  4A6Q A;  1MHH E;  1TKG A;  4RFB A;  1IBX B;  1I4G A;  2NMQ A;  3RPF C;  3BVZ A;  1C4A A;  1FO4 A;  1GOZ A;  3Q8E A;  4FXC A;  3N9Y C;  4H2A A;  1ZPS A;  2PIA A;  1PFD A;  3Q8F A;  2PLP A;  1WSP A;  1JRP A;  3HVZ A;  1MI0 A;  2QMT A;  2WQY B;  2PTL A;  1DYQ A;  2KWD A;  1DOI A;  1PDX A;  1SJE D;  3NVV A;  1E7P B;  1NEK B;  4OVZ A;  3NRZ A;  1FNV A;  1TY0 A;  3IAM 1;  1ET6 A;  2H89 B;  1RYJ A;  2ZW1 A;  1QIL A;  4ARC A;  1ZP0 B;  4YSX B;  1C4P A;  1D6E C;  1IGC A;  3KWL A;  2W3R A;  5EE0 A;  1K52 A;  2K22 A;  2WDR B;  5LNK 1;  1RWS A;  1C4C A;  1B9R A;  5I4D A;  1L4D B;  3H8H A;  1VLB A;  4TMA B;  3SFD B;  1KFY B;  3KLS X;  1JW9 D;  2LGI A;  1QOA A;  1I7H A;  4YTP B;  1F2R I;  2L1A A;  2YEP B;  3AEB B;  1MHX A;  2RPV A;  3AED B;  1N62 A;  4KX6 B;  1D4B A;  1L0V B;  2WXI A;  3LXF A;  1SE4 A;  1UUP A;  1NVI D;  3TUO A;  1V1O A;  4GLS C;  3VRA B;  4B0E A;  1N61 A;  1VDV A;  2JU6 X;  1ZE3 D;  1YN5 A;  3FIL B;  5H8Y E;  3AEA B;  1F0Z A;  1N5X A;  2MH7 A;  3Q8C A;  2ACZ B;  2L32 A;  2WS3 B;  4NJC A;  2W54 A;  2YEP F;  3TEY A;  4TQ1 A;  1AN8 A;  2E3T A;  2BS3 B;  1FCL A;  1TY2 A;  2WP9 B;  1ACC A;  1H7X A;  1GB4 A;  3EUB 2;  5G5G A;  2G1E A;  2JZP A;  3NS1 A;  2LFI A;  2HTM E;  4YT0 B;  1FXI A;  1RM6 C;  1YQ4 B;  1JWA D;  3BVG A;  1QLB B;  3ZJV A;  4A9A A;  3CWI A;  4KKJ A;  2BS4 B;  3AE2 B;  5T8I A;  3U2S C;  3B9J A;  2DWQ A;  1SE2 A;  2WNM A;  2K5P A;  4P6V F;  4MH8 A;  2DLB A;  1OQQ A;  1E0Z A;  1QOF A;  1DOY A;  3AEE B;  5FR3 A;  3B2G A;  4B0M A;  2QJL A;  2XN9 C;  1XO3 A;  1J7A A;  1L0Y B;  2XNA C;  1I4R A;  1EM7 A;  1SBB B;  5MPO A;  2QEJ C;  1EU4 A;  3FAH A;  1GTH A;  1VZ8 A;  4AQ7 A;  1F2R C;  1PYW D;  4RGO S;  3EA6 A;  3R2I A;  2Y5C A;  3T3O A;  4NZL B;  2W82 A;  3L4P A;  5BMH A;  1XLP A;  1GAQ B;  1C78 A;  1DGJ A;  1TKY A;  4GDL B;  1SXT A;  4O1N A;  3BK1 A;  4KKI A;  1SB3 C;  3W9C B;  2RDG A;  3MHZ A;  2OHF A;  2WXJ A;  1UNS A;  2LHE A;  3LYY A;  1VJK A;  1FCC C;  1VZ7 A;  2K9X A;  2IGD A;  4DXF A;  5AUI A;  4C80 A;  2TSS A;  5BYR A;  2E6X A;  1XLN A;  4LLG M;  5HI1 A;  2WDV B;  4XWT A;  1WWT A;  4OZC A;  1IUE A;  2H88 B;  1IBX A;  2KMM A;  5HFY A;  4HRO A;  1GB1 A;  4IKG A;  2WXF A;  4XDD A;  2BB6 A;  1PGB A;  2WLB A;  2RDH A;  3WCQ A;  1XXG A;  2SAK A;  1M4V A;  1OQR A;  2W55 A;  4ARI A;  1HEZ E;  3VRB B;  3NVY A;  5H92 C;  3DWG C;  1CJE A;  4A8X C;  1K51 A;  3V3X A;  4N58 A;  3B2F A;  3AE1 B;  1JWU D;  1I4X A;  3SR6 A;  1ZDX A;  4Q2J A;  2M0A A;  3E9S A;  1KRH A;  2BB5 A;  2WXN A;  4C7Y A;  3E56 A;  4KGT A;  4MAC A;  1T6B X;  5BMI A;  3ETR A;  1XCQ L;  3AV8 A;  3P4S B;  3U52 E;  3TEZ A;  4WUR A;  3AN1 A;  5HHD G;  1PGX A;  4YWG G;  4ZHP A;  1RFK A;  3AMZ A;  2VZK D;  4JX1 C;  1BUI C;  4HJG E;  4XE0 A;  1FMA D;  2GB1 A;  2QSD A;  2Y5P A;  1QQR A;  1L5P A;  1UWM A;  1WGK A;  4TQ0 A;  1P7E A;  1WXQ A;  5BMG A;  3KWV A;  2R61 A;  1N63 A;  4C56 C;  1YJJ A;  2N7J A;  3MFG A;  4RGT A;  1ENF A;  3PZ7 A;  4EE2 A;  1JWS D;  5G5H A;  1TZO A;  3FIL A;  3R8B A;  5E6J A;  5BYS A;  5C3J B;  2X38 A;  1XLO A;  3J9C A;  2K0P A;  1JQ4 A;  4L23 A;  4WIP A;  4WQM A;  4ZOH C;  2M56 B;  4JWS C;  4M0W A;  3TEX A;  1JAL A;  1H7W A;  3EGR A;  3HVD A;  5EE1 A;  3ZJT A;  5EE9 A;  1E10 A;  3TEW A;  3O13 A;  5FK9 C;  1TS5 A;  1FM0 D;  2PVG C;  1NEN B;  4C7Z A;  4YTM B;  3IAS 1;  1CK1 A;  3BII D;  2DYO A;  1VR9 A;  1Y56 A;  1FRD A;  2WDQ B;  1TS4 A;  2IGG A;  3NVW A;  1SSN A;  2WXR A;  3OWE B;  5D3I B;  1SEB D;  1FXA A;  2J4X A;  4YSZ B;  1FIQ A;  1V1P B;  2J53 A;  3RFZ B;  1N60 A;  1ET9 A;  2MJE A;  1B1Z A;  3KQ4 A;  5BYQ A;  1JWM D;  1QT9 A;  1I4H A;  1VRA B;  2OED A;  3NZ3 A;  4LTU A;  3BYT B;  3IT6 B;  2CU3 A;  2QIL A;  1XLQ A;  1SIJ A;  2QIE B;  4OW0 A;  2LUM A;  2KAC A;  5FKA C;  2WXG A;  4HKQ A;  2WXQ A;  1L6V A;  1P7F A;  3CF4 A;  3BZD B;  1JCK B;  4D2K A;  4XWW A;  2DYM A;  1YMH E;  2EEL A;  2N0S B;  3P4P B;  3BVM A;  2CJO A;  1YN4 A;  1SJH D;  4REZ A;  1KH0 A;  4ZYS A;  3AB5 A;  2INP E;  3C8Y A;  3GP7 A;  4JE3 B;  2IJ0 A;  3NVZ A;  1GPX A;  3U7Z A;  2IGH A;  2MEK A;  4A90 A;  2L83 A;  2V3P A;  2KQ4 X;  2Z8L A;  4NAW B;  1HZ6 A;  1AYF A;  1C76 A;  2NTS A;  4MT5 A;  2BW2 A;  3GS2 A;  1NI3 A;  1Q10 A;  3V05 A;  1F77 A;  1ZUD 2;  1SF0 A;  4US9 A;  3SFE B;  3I9V 1;  1JWB D;  1L6U A;  2ONQ A;  1XEE A;  1QKZ A;  2AX5 A;  2SEB D;  1FD6 A;  1FRR A;  1TJE A;  2WXM A;  1KLU D;  4WAF A;  1L0X B;  2FBW B;  1QOB A;  1PUT A;  2CJN A;  2N9L A;  1NYQ A;  1GT8 A;  3P42 A;  4OZA A;  1OFF A;  4YXD B;  1J7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...