4YSXB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
total genus 68
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ysxB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ysxB01
3DWMA 3VR8B 3VR9B 1YJIA 2WS3B 2HTME 2MJDA 2WP9B 1N61A 2W3SA 3P4PB 1RFKA 1E10A 1SF0A 5EE0A 2Y5CA 2L83A 2L52A 2MJEA 2WLBA 2WU2B 1WXQA 1JQ4A 4YT0B 1B9RA 1N5WA 3P4SB 3LXFA 1CJEA 2WQYB 1FO4A 2BS2B 5H92C 3AE8B 4YXDB 5C3JB 2KMMA 1CZPA 5H8YE 5AUKA 2BS3B 3PO0A 1QF6A 1YQ4B 1FIQA 3AECB 1N5XA 1FRRA 1RWSA 1RYJA 1WRIA 1TKEA 2CJNA 4N6EB 1FXIA 1VDVA 2JX5A 1J7BA 5AUIA 1KRHA 1OQQA 3CF4A 3AB5A 4USAA 1FFVA 1JWBD 3LB8C 5EE3A 1L5PA 1QOGA 1ZP0B 3FAHA 1T3QA 1J7CA 1I7HA 4YTPB 4US8A 1TJEA 1ZUD2 2DBYA 3FC4A 3SFEB 4ZOHC 3P63A 3AEEB 3P1MA 1J7AA 2B76B 2WDRB 3P4QB 3AEFB 1FRDA 1OQRA 1UWMA 2KAJA 3HUIA 3NVVA 5MPOA 1EWYC 2CJOA 3AMZA 1NEKB 1AYFA 1TKGA 1QLBB 2MJ3A 4YSYB 1FFUA 1F0ZA 1NENB 3W5UB 1IUEA 1E6EB 2EKIA 3W9CB 1VLBA 3CWIA 1QT9A 2K22A 4ITKA 3AV8A 3HVZA 5GXGB 3AE2B 1N60A 1VJKA 4C80A 4ZHOA 1GTHA 3AEGB 3VRAB 2WDVB 1ZXIA 1NYQA 3BIID 5G5HA 4C7ZA 1TKYA 4US9A 3KWLA 3AE7B 2N0SB 1QOAA 1FM0D 3B2FA 4FXCA 2WU5B 1FMAD 3AEBB 2E3TA 3B9JA 1JWAD 2H89B 3W5VB 1DGJA 4HROA 3NRZA 1ZOYB 1JROA 2BT6A 1SB3C 1DOIA 2MH7A 3CIRB 3EUB2 2PVGC 1E7PB 4HRSA 1PUTA 3NVYA 1XLQA 4YSZB 2ACZB 2M19A 3AM9A 2LEKA 5C2TB 4A9AA 2PIAA 2W3RA 3AE9B 1QOFA 1E0ZA 1L0VB 1AWDA 2H88B 1WGKA 3WCQA 3AEDB 1GTEA 2AX5A 1N63A 1OFFA 2FBWB 2K5PA 1GT8A 3NS1A 1KFYB 3SFDB 1PFDA 1TYGB 1L6VA 1XLPA 3P4RB 4WWMA 3ZYYX 1H7XA 2QIEB 4KX6B 1N62A 4JWUC 1NYRA 4WQMA 1R7SA 4N58A 1JW9D 1QOBA 2OHFA 2Q5WD 1YJJA 2WDQB 1GAQB 1XLOA 3HRDD 1WWTA 4YTNB 1DOXA 2PVOD 3NVZA 3NVWA 1YQ3B 3AEAB 1XLNA 1V97A 5EE1A 4LTUA 2BS4B 1SIJA 1GPXA 3RPFC 1XO3A 4JWSC 1NI3A 3ETRA 1KF6B 2CU3A 3SR6A 2M56B 3ABVB 2QJLA 1L6UA 4ZHPA 4C7YA 2K9XA 4N59A 3AE6B 3AE5B 4YSXB 1PDXA 1RM6C 1V8CA 3DWGC 1E9MA 1H7WA 1WYGA 2JQRB 3AH7A 1DOYA 2PKOA 1A70A 1JALA 1NVID 2DWQA 1JRPA 2G1EA 3B2GA 3AE4B 4JX1C 5EE9A 3AE1B 2W55A 3L4PA 3AN1A 2W54A 3AE3B 1ROEA 4P6VF 1FXAA 4YTMB 5G5GA 3VRBB 4IDIA
chains in the Genus database with same CATH superfamily
4ZDVA 3PZ8A 1TGZB 2L52A 2QMTA 1N5WA 3P4SB 1T6BX 2JT4B 1VD2A 1L0YB 4EOYA 2KDMA 3JSVB 4G0NB 1FXIA 1KLGD 1ET6A 5D94A 3ZXRA 5TSSA 1NBFC 1V5OA 2GB1A 4BBNF 1IGCA 2JUOA 1G6JA 4A90A 5IA7A 2KNBA 3BYTB 1XD3B 1PGAA 3VH4B 3AULA 2FCNA 4GOCA 2UWQA 1ZKHA 4JE3B 3EGRA 4RFBA 1GJZA 3M63B 3ZTCA 2O6VD 2IBIB 3VRAB 4ACFA 4C7ZA 4DHJB 2YVCA 3DPDA 2LVQA 1JROA 1DOIA 4D2KA 1E7PB 4F8CB 1IP9A 2RPQA 1WJUA 3A1QA 1GTEA 1C4AA 2JZPA 2MBHA 4QAYA 4NAWA 3P4RB 3E56A 2WDTB 2KDFB 3V3XA 1YJJA 3URYA 2RDBC 4A20A 3NVZA 2D3AA 2REXA 4AJWA 2CHZA 2BS4B 2N9KA 3X23A 3L16A 3ZTDA 5LNK1 1KF6B 1P9DU 2HJ1A 2M56B 3OLMD 1L6UA 3BK1A 5CHFA 2X38A 2BQQA 4XE0A 4MELA 2FE8A 2LRUA 2G1EA 4O1NA 4S0RA 3A1QB 3ENEA 1ET9A 2ZNVC 3I57A 2R2OA 4W9IA 3L13A 2JXXA 2BPSA 2R2QA 4II3B 3V6CB 4MJSA 3M62B 2JWZA 2SEBD 1E5WA 2BS2B 1GG3A 2E6XA 2BYEA 2CS4A 4FHJA 4OW0A 4M00A 1KRHA 4USAA 1XCQL 2JU6X 2OEDA 1X1MA 3FAHA 2KK8A 4AJYB 1J7CA 5JHBA 1TJEA 4AWJA 1CQVA 1V81A 3TEWA 4P1CC 1S1QB 3P63A 3H7PB 2D5GA 2K39A 4FJYA 3KLSX 1OEYJ 4DXFA 1L4DB 3GE3C 1EU4A 2EKIA 3C8YA 1QT9A 4ITKA 3AV8A 1WGRA 2CU1A 4G11A 4WWOA 2GBRA 2LD9A 3MJ5A 4BAXA 2KN4A 2XK5A 2MH7A 4IM3A 1XLQA 4B6WA 3RYTA 3ONSA 2V4LA 3AEDB 2MBEA 1SBBB 3NS1A 4OVUA 1F52A 1NYRA 3ZDTA 1GAQB 3MTNB 2KXJA 2GBKA 3RPFC 1HE8A 3AE5B 2RMMA 4DWFA 4E74A 2NTTA 2MRPA 2KQ7A 2QILA 1F9JA 4P6VF 4MH0E 2Y5BB 2A4ZA 2RD0A 1RAXA 3MC8A 3W2DA 5AZHA 3VUWA 2WU2B 1WXQA 4IG7B 1XXGA 2LUEA 4W9EA 3KYDD 1TZ1A 1VRAB 4LK0M 4XDDA 3WA0A 3Q3MC 1RRBA 5AUKA 1YNTE 3PO0A 3V6EB 1FIQA 4KZCA 4FN2A 2KWUB 4AUQC 2AQ1B 1LFDA 2FNJB 2HD5B 2J0MA 3AB5A 3SDLC 3JW0X 4MM3A 3A9KB 3O65B 4PYUA 2LXAA 2B76B 2NCNA 4HJKA 3W1SC 2G45B 2WGSA 2B3AA 3CMMB 3RNCC 2LVPA 3QC8B 2PEAA 2XK5B 3QA8A 2JYEA 1YJ1A 1QOAA 4XWTA 2FUG1 2KLGA 5IO9A 3NRZA 4MGIE 4NQLB 2UU7A 4G3XB 2G4DB 4BVUC 2PTLA 2RPVA 1L6VA 2MX2A 1QOBA 2DX5B 4ZYNA 1MHHE 2KDEB 1DOXA 3L17A 1XLOA 5CHVC 2BGFA 1EF5A 3RCZA 3SR6A 2INPE 5DPSA 3DWGC 3TJPA 2WX0A 1A70A 2K3UA 2KLCA 3DCGA 4JL9A 4DDID 2KYWA 3V62A 4FBJB 3ZRCA 3LDZE 5HI1A 2MJDA 3UINB 1IBXB 4EE2A 1RLFA 3ZW3A 2GOWA 1D3ZA 4KSLC 2KFJA 3R8BA 4DXAB 1FO4A 3SEBA 3BZDB 4MGYE 1TY2A 1K52A 3VUYA 2KKCA 2M4NA 3ZRFA 2BWES 4IOIE 3A9KA 1FCCC 3Q8CA 2LFIA 2KANA 5D3DA 4US8A 2IGGA 1C3TA 1TS4A 1L4ZB 2HTHA 2LUMA 2FCSA 4NAMA 2ZPYA 4KGTA 3TMPB 1OEYA 4LLGM 2DLBA 2N9EB 4TMAB 3WAMA 1TS2A 4C80A 1N60A 4ZHOA 2ZW1A 4DXGA 2N0SB 2E3TA 4E3CA 5FR3A 3PT2B 2GMIC 1DGJA 3W1SA 2AQ2B 3Q3NC 1VZ7A 4BKSD 3KUZA 4MGZE 1I4RA 1P0RA 4OZAA 1K8RB 2KMAA 3BYYB 4BFRA 2JXTA 4NZLB 1OFFA 1AARA 1V1OA 1XLPA 2I1JA 4DHJD 1H7XA 2QIEB 3OAWA 1WJNA 1EF1A 2O6VB 1YIWA 4REZA 3KUDB 3U7ZA 4YTNB 2J7QB 2MEKA 4W9GA 2KOXA 2VH1A 1J19A 1STEA 4L23A 4BOSC 1M94A 5JH5C 1WGGA 2N7JA 3H6NA 3QX1A 3N3KB 4G50A 2W55A 1ROEA 1FXAA 2WXHA 1V6EA 3DWMA 2IDYA 2J53A 1WRDB 2CR5A 1GC6A 3IVFA 3TEXA 1FCLA 2G3QB 3DHIC 2L83A 3H9DA 1B9RA 2AYOB 4L2YA 3PZ7A 2L3ZA 4M02A 3K9OB 2N9LA 1WX9A 3DBHI 1IYFA 1RWSA 4XC2A 1J7BA 5FR6A 4OZBA 3QAQA 3DVNV 2HJ8A 3E9SA 1ZUD2 3R2IA 3FC4A 3SFEB 2OJWA 3HM3A 1UWMA 1EWCA 3AMZA 1NEKB 3BINA 2Y3AA 1NENB 1HEZE 3A4RA 1IUEA 4DQOC 4CO7A 1FNWA 3WIMA 2V3NA 3PV1A 2DZIA 2LI5A 2N4FA 4ZRJA 1I4QA 1GB1A 4MDKE 2K8HA 4WJQA 3TUOA 2YEPF 4EZLA 2JF5A 2GBMA 1E0ZA 1L0VB 3SHQA 3WCQA 1ZDVA 3EC8A 2AX5A 2BWFA 2O6VA 4C00A 5AEKB 4KZ0A 3T3NA 4P16A 1R4MI 1WGYA 3U30A 4HK2A 3RZFA 2PVOD 4TV3A 3N20C 4AS1A 1TTNA 5EE1A 5FKAC 3ETRA 3WAOA 2QJLA 2LVOA 4HPMB 1PDXA 1RM6C 2KJHB 1E9MA 1AN8A 3ZVVA 3L4PA 3AN1A 3ZIMA 2UYZB 1GNUA 2KACA 4TUUA 1GB4A 1NDDA 5E6OA 3I63C 1SF0A 2KTFA 5G2NA 3DOWA 3M3JA 1WMHB 1BXTA 1UBQA 4WURA 2NS5A 2RSUA 3DBHB 2KDIA 1CJEA 2WQYB 5TR5A 1FD6A 1EU3A 2IO1B 5H92C 5C3JB 2XN9C 3RMKC 2KTRB 1N5XA 1MPEA 4S17A 2D3BA 1T5XD 2I38A 3CF6E 4KV2A 3Q6BA 4HCNB 4AOFA 2DBYA 2NBVB 3T8MA 4EFOA 2V0GA 1ZW7A 1WH3A 2W9NA 2M0AA 2CJOA 2MJ3A 5LLIA 4EZJA 4LNNA 1WIAA 4HKQA 5BMHA 3FILB 3CWIA 3V05A 1HZ5A 3AEGB 5BMIA 1XCTL 3B2FA 1ACCA 4OVZA 2KJRA 2DNFA 4P7IA 2L7RA 2PMVA 1SSNA 1SB3C 1WXVA 3Q3JA 4ZRKA 4YSZB 2M19A 3SD5A 3C0RB 1SXTA 4GGQA 1SE4A 4FLHA 1V80A 4NNJB 4RMAA 1UZXB 5JHAA 5J18A 1E8WA 1I4HA 4CQNA 2M17A 4A8XC 3L08A 4RGNA 4YWGG 2KQ4X 2BTEA 3GP7A 1V1PB 1WE6A 1WWTA 3PVLA 4GU2A 3AEAB 1XEEA 1V97A 4LTUA 1XO3A 1S3SG 4JWSC 1H8CA 2KHWB 2MWSB 4C7YA 1OQYA 2L00B 2MLBA 1SJHD 1XQQA 1NVID 2LGXA 2JSVX 4GIVA 2NR2A 4K81A 1WXSA 4J6IA 1BMLC 1WR6E 1WMHA 1L7YA 1R4MB 1E10A 4IM2A 1JQ4A 1E7UA 1IPGA 3UIPB 3TSSA 2A5UA 4A55A 5H8YE 2DZKA 1LM8B 1I42A 2IY1B 2M8SA 5EE3A 3APDA 4H2AA 5BYRA 3EECA 1FEHA 4HCPB 3IT6B 1V49A 3JYUA 2MW5A 2NTSA 2CKHB 1UUPA 2SAKA 3U4EG 4KKIA 1WX7A 4A3PA 3ZXVA 4HWIB 1D5ZC 1NYQA 3AE7B 2KJ6A 4A3OA 4I6NB 1JWAD 3W5VB 1ZOYB 3DQVA 4X57B 3O13A 4XWWA 3VVWB 3ALBA 2C5LC 2DZMA 3T9LA 4ICUA 2J4XA 2LGIA 1TIFA 2QSDA 3ZDMC 2MBBB 1ZXHA 2D07B 1QZEA 3SFDB 1PFDA 3Q3OC 4CYEA 1JW9D 2KC2A 1K51A 1V5TA 4ANXA 2VZKB 2BW2A 2KT7A 1F2RC 3U7DA 1YN3A 2WXIA 2WXFA 4YSXB 2LHDA 3WANA 2K25A 3B2GA 4I6PA 2AL3A 5C2TB 4NAWB 1KM7A 5BYSA 1YN4A 2LGSA 3KVFB 5KHQA 4B95A 2ZVNA 3ZJVA 4NPNA 5JXVA 2WNMA 2KVZA 3TEZA 4PK1A 3V61A 4PS3A 3VDZA 1CZPA 3QK0A 2WXMA 1RYJA 1UGJA 3UI3A 3MP9A 3PLVA 3X0WA 4WIPA 2MP2B 2D2QA 4DDGD 4IWPA 3RNGC 1T3QA 4ARIA 1SE3A 2C60A 3VAWA 4TQ0A 1J0GA 3BVMA 2WDRB 3AEFB 4J3OD 1UD7A 2WXPA 4EEWA 3RFZB 2WXLA 4PYZA 2O2VB 5GXGB 3I3TB 3R3MA 1UWXA 2L76A 1ZXIA 4PT5A 1TKYA 3KWLA 4BZAA 2LMCA 5DCNA 4B0MA 4HROA 2MP2A 2K0PA 3CIRB 1VR9A 2ACZB 1JWMD 3AE9B 2D3CA 4B0EA 1F77A 3PZDA 3CSFA 1AW7A 3LYYA 2DYBA 3AU5A 2I2YA 3ECIA 3ZO5B 1I35A 2PE9A 3IT4B 1D4BA 2AWTA 4W9JA 4ZHPA 4TQ1A 5IAAC 2EMSA 3EHVA 3ZGZA 4FULA 3H8HA 1MI0A 4GN1A 1UF0A 1OTRB 2DYOA 3NOBA 3VXWA 3RNBC 4N9F4 2JZ3B 1MJDA 1F1HA 1YMHE 3RNAC 3ZUNA 5E6PA 5G55A 3K9PB 1R4NB 3TIXA 1MVKA 3IXSA 3QHTA 3FKYA 4LNKA 4RH6A 2QCZA 1VDVA 3B0AA 4XX5A 4K3CA 1OQQA 2MBQA 3H7SA 3KH0A 4KIKB 3BVGA 1MG8A 4KDIC 4WAAA 2N9PC 4MT5A 2K6QA 2JRIB 1OQRA 1P1AA 2ON8A 4C4VB 3QCAA 4IM0A 2BKRB 3DBSA 1ENFA 4GXBA 1E6EB 4RF0A 3AXCA 2L32A 2PJHA 3NHEB 2TSSA 3QARA 1FM0D 2AL6A 2HDEA 3PTFC 4FXCA 4JQWC 3WALA 2V3PA 1N6ZA 1C9FA 3M95A 2Z8LA 2KO3A 1PUTA 2Y5PA 3ZLZA 3PSEB 2H88B 1WXAA 2FUHB 1QKZA 1PQSA 4BKGA 2WWZA 3OJ3A 2R61A 2NBUA 1VZ8A 2FIDA 1UBIA 2Q5WD 3FILA 5C1ZA 1C79A 1JRUA 4M8MA 1BUIC 4URKA 1UNSA 4B9KA 3RT3B 2M1MA 4WQOB 2XNAC 4N59A 1D5MC 3EFUA 3P42A 1HTOA 2OOBB 1KOTA 1WYGA 2ASQA 1DOYA 3Q8BA 1C76A 2RDHA 1I4PA 3AE1B 1EUVB 4PS8A 2LXCA 1QQRA 3LJ3A 4ANWA 2WP9B 3RNEC 4AP4C 1LO5D 1WY8A 2MJEA 1WZ0A 3IBEA 4F1SA 4YT0B 2XBBC 3GOEA 4RM9A 1LXDA 5IP4D 3GE8C 1ZDXA 5BMGA 4IKGA 3DHGC 4DHZB 1TKEA 2BB5A 4MSQB 3B1LX 5KHOA 2GLSA 4WJPA 5BO4B 4M0WA 3QWZB 2AQ3B 3TBLD 3PREA 3AEEB 2KWCA 1WSPA 3P4QB 2L05A 3AI5A 2IZVB 3H1UA 1WE7A 2K8CA 1KTKA 4MEMA 4FJZA 2IGDA 4LJOB 3ZJTA 2ZW0A 3ZKJC 1I4GA 1WX8A 1V86A 2RDGA 5D3IB 1C4PA 3B9JA 1FMAD 2NVUI 4LDTD 4EUTA 4W9HA 3BVZA 3JVZX 4MACA 2PVGC 3VH3B 5T8IA 4UDUC 2QEJC 1AWDA 2GRIA 3PLUA 5D2MB 3NUHB 5E6JA 4LNFA 3V60A 2K6DB 1CMXB 3RN9C 2YEPB 4K3BA 4KX6B 1E90A 1N62A 2KFKB 2LRWA 3PHXB 4RGOS 3DVGX 2WDQB 3R2TA 1Y56A 3APCA 1YQ3B 1XLNA 4ICVA 2EKEC 4W9KA 3Q69A 3PHWB 4JPSA 3DVNU 1Q5WB 3BY4B 1TS3A 4FA6A 5IN7A 4R3DA 1CK1A 3PS6A 3VRBB 1A5RA 3B08A 1YJIA 2WS3B 4KSKC 4OHJA 3DVGY 1T0SC 3VTUA 2PPHA 3A33B 2KZRA 3Q8AA 2BB6A 1SE9A 4XZ4A 2JVCA 2ZJDA 2KMMA 4JGHB 4OZCA 2KDBA 4BKSA 2WXJA 5AUIA 2CHXA 2EMTA 1JWBD 1KLVA 4RGTA 4DBGA 1HA5A 3EFCA 1QOGA 2WXOA 2VZKD 2LHEA 1J7AA 3HUIA 4HJGE 1WM3A 2INDC 2ZZPB 4NY0A 1P7EA 1TKGA 1F0ZA 5GMVA 3DHHC 4I6LB 2FAZA 3WAPA 3AE2B 5HHDG 1GTHA 5G5HA 1HZ6A 2I1KA 3MJWA 4OVVA 3ZQ4A 2DENB 2LJIA 4W9LA 3N30A 3DBRB 4HLEA 4YL8A 4GDLA 2KFKA 2GBNA 3VQIA 2KX3A 2ONQA 3Q3FA 4DHZE 2N7DA 2O2VA 3HK0A 4KVGB 3Q14C 3NVWA 2LWPA 3PRZA 1FNVA 2W82A 1L0XB 3MHZA 2CU3A 2DHZA 1YOVB 1RFAA 3UIOB 4EKUA 4BOZB 4CHKA 4RF1A 2IYDB 1E7VA 1YX6B 4GDKA 2INCC 2N1WA 3NJTA 4YTMB 1ESFA 5G5GA 4Q2JA 1WR1A 2PW9A 1E8XA 3DBRI 5LXHA 2WLBA 2JYTA 2FCQA 2NBWB 3Q2AC 1I4XA 2QC8A 2XEWA 2D3GA 4EZKA 4YXDB 4FADA 5IKCM 3IFWB 4TSSA 4WAFA 2MQJA 3AECB 3KWVA 4N6EB 3U2SC 4LJPB 3VTWA 1FPYA 1L2NA 1L5PA 1SIFA 2KN5A 1ZP0B 2QDFA 2VRRB 3NG0A 3OJ4B 5HG2A 4ZOHC 1U4AA 3NVVA 4TKNA 3APFA 4RNAA 2WHIA 2JPHA 4YSYB 3DBLI 1FXTB 1V2YA 5E6NA 3BIID 2D10A 2KTRA 2H89B 4L1BA 1QILA 1K50A 4GDLB 2FIFA 1DYQA 2MCNB 1XT9B 4BBNC 2LEKA 2PIAA 3L10B 5CHWA 1N63A 4KKJA 3I5JC 3BK2A 5EDSA 3IG3A 2MHJA 2L0FA 2OHFA 3AU4A 2HE7A 4PS7A 2J0KA 3UF8A 3KW5B 1LGRA 2AEHA 4II2B 1FNUA 3L0WB 3RULA 5DPWA 2L8JA 3AE6B 4JLCA 1WFYA 3GS2A 4GDKB 4KGSA 2DZJA 3AH7A 2JY6A 1JALA 4NQKE 3HVDA 3S2AA 2W54A 2LJ5A 2HTME 1Z5SB 1WZ3A 4ANVA 3QJZA 5AZGA 1GUAB 5J17A 2Y5CA 1TS5A 1IBXA 4K7WA 4M01A 3UGBB 4W9CA 4GMVA 4DK5A 3AE8B 2V1YA 1T0RC 1YQ4B 3P1MA 2CJNA 1Q0WB 4MM3B 2JX5A 2ZPNA 4ZRQA 1YN5A 1FFVA 1P3QU 4WJNA 3R7QA 3RNFC 2LZ6A 4IWQA 2ICIA 3KUCB 4GLSC 1WJ4A 3OG5A 4W9DA 1SE2A 2ZEQA 1D5XC 1QLBB 2FCMA 4E71A 1JWSD 4P1BC 4F7ZA 3CSTA 1C78A 4US9A 3BWUD 2V9HA 2WU5B 1JCKB 1UH6A 2J0JA 4ASWC 1Y8RC 1SEBD 3P2BA 4K1RB 3TEYA 3UQAA 3NY5A 1JWUD 2DAFA 2LASA 4M0WB 2V4IB 2OJRA 2W3RA 2WYQA 1WGDA 2N1VA 1YQBA 3ZNGC 3R66C 2N9XA 3DDCB 1WYWB 2J42A 1V1PA 4ZRIA 1D6EC 4FHKA 2IGHA 4WQMA 4N58A 2ZVOA 5JZEB 3RD2A 4NJ6A 1SIJA 1WJ6A 3MHSD 1T0QC 4HPPA 1F2RI 2KVRA 2PKOA 3HIZA 5EE9A 1UGMA 1YX5B 3HHMA 2INNE 1LQBA 2IO3B 4GB9A 4XGAB 4HXDA 3Q8FA 1EO6A 5CX3A 3P4PB 1EM7A 4K7UA 5EE0A 3TL5A 4MH8A 1VCBA 3LXFA 1C77A 3J9CA 2NPTB 3RI7C 1P98A 1WGHA 3C19A 2IJ0A 3N9YC 1PGXA 4IWOA 5LXIB 4BKTA 3PRMB 1I7HA 4HKZE 2QHOA 3A4SC 1HQRD 2ZCBA 3N1YC 4HEA1 3W5UB 1VZ6A 2C7NB 3W9CB 2MSED 4JIOU 4C56C 1YD8U 2G9HD 2WXRA 1KH0A 4AQ7A 3IHPC 1MG4A 4MGKE 2WXKA 1C4CA 1H4RA 2C9WB 2YLMA 2BKFA 1PGBA 1WGKA 1BT0A 1SGHA 5HFYA 4IW0A 5DPRA 1KFYB 1NI2A 1TYGB 3ZNZB 4HDQA 2MA9B 4JWUC 2BVCA 1TY0A 3SU8X 4M8NA 3I9V1 5FK9C 2JZZA 1E8ZA 2IY0B 2V3SA 3MC0B 1GPXA 2Z0DB 4XDCA 2L1AA 4ZRPA 4MSMB 1GOZA 2K9XA 1E8YA 4NJ7A 1OGWA 2KMCA 2JQRB 1ZPSA 5BYQA 4A6QA 2BYFA 2ZNVB 3MC9A 2ZCCA 2BYTA 4IDIA 3VR9B 2GBJA 3ZNHB 3N1ZC 2KX0A 4RGMA 2W3SA 2LGDA 1MFWA 3H7PA 3NZ3A 1TBEA 1P7FA 2JRHA 3EA6A 4K7SA 1QF6A 4WWPA 1FRRA 5I4DA 3ZNID 5IOIA 3VTVA 3CF4A 3Q8EA 3QQ8B 2PLPA 3MFGA 1HXYD 3RUIB 1TZOA 1SJED 3GZNI 2Z0EB 4KGRA 3HM6X 4HVBA 3VFKA 2KAJA 1EWYC 4MJSB 1PYWD 3TCAA 3N1XC 2K22A 3HVZA 1VJKA 1WM2A 2PE6B 2WX1A 4IUMB 1UELA 3U8ZA 4HRSA 1Q10A 3NS8A 4GSWA 3AM9A 3PPAA 5HKHA 1Q1OA 2CHWA 2FBWB 2BF8B 4C4VA 4WWMA 3ZYYX 2NMQA 2BYVE 2K8BA 2MBOA 1R7SA 4IC7B 1J8CA 2IO0B 2C7MB 2M0XA 3IAM1 3T3OA 3HRDD 2KWDA 2LGYA 3VHTC 2KD0A 1TT5B 4LCDE 1NI3A 1JMLA 3QIJA 2Z59B 2IPKD 2G4SA 1T0YA 3IAS1 1WF9A 1HTQA 2DAJA 2JWUA 3A9JA 3AE4B 2EELA 3NZSA 1C1YB 4WH4A 3AE3B 1IGDA 1R4NI 5D7GA 3UQBA 4ARCA 3VR8B 2DYMA 3ZJUA 1B1ZA 1N61A 1ZE3D 2K1FA 4WWNA 1RFKA 3OWEB 4LNIA 4ANUA 3L54A 4W9FA 1M4VA 1Z2MA 1MHXA 2BS3B 3N32A 1WRIA 4KIKA 3RZWC 2WXNA 1GC7A 1ZGUB 4WJOA 2KC1A 3A9JB 1KLUD 4KDLB 2L0TA 3LB8C 5DPTA 1ISNA 3PRPB 2KWVB 4YTPB 4HDOA 3U52E 1FRDA 3DBLB 5MPOA 4ZYSA 3GB1A 1AYFA 4HPLB 3KQ4A 1FFUA 1WI0A 5CTRC 1VLBA 2WXGA 2J52A 2BBCA 2WDVB 3ML8A 3AEBB 2BT6A 1V9JA 5C23A 3EUB2 1WXMA 4LDTB 2RGFA 5AZFA 3NVYA 4A9AA 2C7HA 5L83A 1QOFA 2X8XX 2VH2A 3NZUA 2RR9A 2K5PA 1GT8A 4RM8A 3PGEA 3VUXA 3W1YA 1KJTA 4NJCA 4FJVB 2N7EA 3D32A 3ML9A 2NPTA 1K53A 3KYCD 5L95C 4XYCA 2IO2B 3ABVB 2GI9A 3GZNB 2D11A 3JSVA 1V8CA 4RCOA 5D6JB 2KQSA 1H7WA 5J2RA 2DWQA 1JRPA 2WXQA 4JX1C 3R7RA 1XF5L 4LNOA
chains in the Genus database with same CATH topology
3DWMA 2IDYA 2HTME 2J53A 1YMHE 3TEXA 3PZ8A 1FCLA 2Y5CA 1TS5A 2L52A 2L83A 2QMTA 1B9RA 1N5WA 1IBXA 4L2YA 3PZ7A 3P4SB 1T6BX 2N9LA 1L0YB 3AE8B 1MVKA 3IXSA 1YQ4B 3P1MA 2KDMA 1RWSA 2CJNA 4RH6A 1FXIA 1KLGD 1VDVA 2JX5A 4MM3B 1J7BA 1ET6A 1OQQA 4ZRQA 1YN5A 1FFVA 3BVGA 4OZBA 2ICIA 5TSSA 4GLSC 3E9SA 1ZUD2 2GB1A 3R2IA 1SE2A 3FC4A 3SFEB 1IGCA 4MT5A 1UWMA 1EWCA 1OQRA 4A90A 3BYTB 3AMZA 1D5XC 1NEKB 1PGAA 2ON8A 1QLBB 2Y3AA 1NENB 1HEZE 1ENFA 1IUEA 1E6EB 4RF0A 4DQOC 1JWSD 4JE3B 3EGRA 2L32A 4RFBA 1FNWA 2TSSA 3VRAB 2V3NA 4C7ZA 1C78A 4US9A 3BWUD 1FM0D 2HDEA 4FXCA 2WU5B 1JCKB 2V3PA 1C9FA 1I4QA 1SEBD 1JROA 1DOIA 4D2KA 2Z8LA 3TEYA 1GB1A 1E7PB 1JWUD 1PUTA 2Y5PA 3TUOA 2YEPF 2V4IB 2W3RA 1E0ZA 1L0VB 2H88B 3WCQA 1ZDVA 1GTEA 1C4AA 2AX5A 2JZPA 1QKZA 3P4RB 2J42A 1V1PA 3E56A 3T3NA 1D6EC 2R61A 4P16A 2IGHA 4WQMA 1VZ8A 4N58A 3FILA 2Q5WD 3V3XA 1YJJA 1C79A 3URYA 2PVOD 3NVZA 4AS1A 5EE1A 2BS4B 1SIJA 2N9KA 5FKAC 1BUIC 5LNK1 1UNSA 3ETRA 1KF6B 2M56B 2QJLA 2XNAC 1L6UA 3BK1A 4N59A 1D5MC 1PDXA 3P42A 2X38A 1RM6C 1E9MA 1WYGA 1F2RI 4XE0A 1DOYA 1AN8A 2FE8A 2PKOA 3Q8BA 5EE9A 1C76A 2G1EA 4O1NA 2RDHA 1I4PA 3AE1B 3L4PA 3AN1A 1ET9A 2INNE 2KACA 3I57A 1GB4A 1QQRA 2WP9B 3Q8FA 3P4PB 1LO5D 1EM7A 1SF0A 5EE0A 2MJEA 4YT0B 1BXTA 4MH8A 4WURA 2SEBD 3LXFA 1C77A 1CJEA 3J9CA 2WQYB 2BS2B 1FD6A 1EU3A 5H92C 5C3JB 1ZDXA 5BMGA 2XN9C 4IKGA 2E6XA 1N5XA 2IJ0A 1MPEA 1TKEA 4OW0A 1T5XD 2BB5A 1KRHA 4USAA 2I38A 3N9YC 1PGXA 1XCQL 2JU6X 2OEDA 3FAHA 4M0WA 1J7CA 1I7HA 1TJEA 1CQVA 4HKZE 2AQ3B 2DBYA 3TEWA 2V0GA 3P63A 3AEEB 1WSPA 3P4QB 1HQRD 2M0AA 2CJOA 2D5GA 4HEA1 3KLSX 2MJ3A 4DXFA 3W5UB 1KTKA 1L4DB 1VZ6A 4HKQA 1EU4A 5BMHA 2EKIA 3FILB 2IGDA 3C8YA 3CWIA 3W9CB 1QT9A 3ZJTA 4ITKA 3AV8A 4C56C 2ZW0A 3V05A 1HZ5A 3AEGB 5BMIA 1I4GA 2G9HD 2RDGA 2WXRA 1XCTL 1KH0A 3MJ5A 3B2FA 1C4PA 1ACCA 4OVZA 5D3IB 3B9JA 1FMAD 4AQ7A 2KN4A 2PMVA 1SSNA 1SB3C 2WXKA 2MH7A 3BVZA 4MACA 2PVGC 1C4CA 1XLQA 4YSZB 2M19A 1PGBA 5T8IA 4UDUC 2QEJC 1AWDA 1SXTA 1SE4A 1WGKA 2GRIA 3AEDB 1SBBB 3NUHB 5E6JA 5HFYA 3NS1A 1KFYB 1TYGB 1I4HA 4CQNA 2YEPB 4KX6B 1N62A 4JWUC 4A8XC 1NYRA 1TY0A 4RGNA 4YWGG 2KQ4X 4RGOS 3I9V1 3GP7A 2WDQB 1GAQB 5FK9C 1Y56A 1V1PB 1WWTA 3R2TA 2BTEA 1YQ3B 3AEAB 1XEEA 1XLNA 1V97A 3MC0B 4LTUA 1GPXA 3RPFC 1XO3A 4JWSC 4XDCA 2L1AA 3Q69A 4ZRPA 4C7YA 1GOZA 2K9XA 4JPSA 3AE5B 2RMMA 2JQRB 1TS3A 1ZPSA 1SJHD 2NTTA 1NVID 5BYQA 4R3DA 4A6QA 1CK1A 2QILA 2JSVX 4P6VF 3VRBB 2BYTA 4IDIA 3VR9B 1YJIA 2WS3B 1BMLC 4RGMA 2W3SA 4OHJA 3W2DA 1E10A 3NZ3A 1JQ4A 2WU2B 1WXQA 3Q8AA 2BB6A 1P7FA 1XXGA 3TSSA 1VRAB 4LK0M 4XDDA 4A55A 2KMMA 5H8YE 5AUKA 1YNTE 3PO0A 3EA6A 1QF6A 1FIQA 1FRRA 5I4DA 2AQ1B 4OZCA 2WXJA 3AB5A 5AUIA 3CF4A 3Q8EA 1JWBD 2PLPA 5EE3A 4RGTA 3MFGA 1HA5A 1QOGA 2WXOA 2VZKD 4H2AA 1HXYD 1TZOA 1SJED 5BYRA 4KGRA 1FEHA 2LHEA 3IT6B 1J7AA 2B76B 3HUIA 2KAJA 4HJGE 1P7EA 1EWYC 1TKGA 2NTSA 1F0ZA 1UUPA 2SAKA 3U4EG 4KKIA 1PYWD 2K22A 3HVZA 1D5ZC 3AE2B 1VJKA 5HHDG 1GTHA 5G5HA 1NYQA 1HZ6A 2JYEA 3AE7B 1QOAA 3ZQ4A 4XWTA 1JWAD 2FUG1 3W5VB 2LJIA 3NRZA 1ZOYB 4HRSA 1Q10A 3O13A 4XWWA 3AM9A 2J4XA 2LGIA 2QSDA 2PTLA 2RPVA 2FBWB 1ZXHA 3SFDB 1PFDA 1L6VA 3VQIA 4WWMA 3ZYYX 2NMQA 2ONQA 1R7SA 1JW9D 1QOBA 3IAM1 3T3OA 1MHHE 1K51A 3HRDD 1DOXA 1XLOA 2KWDA 3NVWA 1FNVA 2W82A 1L0XB 2VZKB 1NI3A 3MHZA 2BW2A 2CU3A 3SR6A 2INPE 1F2RC 1JMLA 1YN3A 2WXIA 2WXFA 4YSXB 2IPKD 3DWGC 2LHDA 3IAS1 1A70A 3B2GA 2JWUA 4RF1A 2K3UA 3AE4B 2EELA 4WH4A 3AE3B 1IGDA 5C2TB 4YTMB 1ESFA 5D7GA 5G5GA 4Q2JA 4ARCA 3VR8B 4NAWB 5HI1A 2MJDA 2PW9A 2DYMA 5BYSA 3ZJUA 1B1ZA 1N61A 1YN4A 1ZE3D 1IBXB 1RFKA 4EE2A 3OWEB 2WLBA 3ZJVA 2JYTA 3R8BA 5JXVA 1M4VA 2WNMA 1I4XA 1FO4A 3SEBA 3BZDB 3TEZA 4YXDB 1TY2A 1K52A 1CZPA 2WXMA 1MHXA 2BS3B 4TSSA 4WAFA 1WRIA 3AECB 3KWVA 1RYJA 4N6EB 2WXNA 1UGJA 3U2SC 3UI3A 3MP9A 4IOIE 4WIPA 1FCCC 1KLUD 3Q8CA 3LB8C 1L5PA 2LFIA 1ZP0B 5D3DA 1T3QA 4ARIA 4US8A 1SE3A 4YTPB 2IGGA 4TQ0A 5HG2A 4ZOHC 1TS4A 1L4ZB 2LUMA 3BVMA 3U52E 2WDRB 1FRDA 3NVVA 3AEFB 4J3OD 4KGTA 4NAMA 4RNAA 5MPOA 4ZYSA 3GB1A 1AYFA 4YSYB 1FFUA 2WXPA 3KQ4A 4LLGM 2DLBA 3RFZB 2WXLA 4TMAB 1VLBA 2WXGA 5GXGB 1TS2A 2J52A 4C80A 1N60A 4ZHOA 2BBCA 1UWXA 2ZW1A 2WDVB 3BIID 1ZXIA 4PT5A 1TKYA 4DXGA 3KWLA 2N0SB 2E3TA 3AEBB 2LMCA 5FR3A 2H89B 4B0MA 1DGJA 4L1BA 4HROA 3W1SA 1QILA 2BT6A 2K0PA 2AQ2B 1VZ7A 1K50A 3CIRB 3EUB2 4GDLB 1VR9A 1DYQA 3NVYA 1I4RA 2ACZB 1JWMD 4OZAA 2LEKA 4A9AA 2PIAA 3AE9B 1QOFA 4B0EA 3BYYB 1F77A 2JXTA 4NZLB 1N63A 4KKJA 1OFFA 2K5PA 1GT8A 1V1OA 1AW7A 1XLPA 3LYYA 3BK2A 1H7XA 4NJCA 2I2YA 2QIEB 2OHFA 4REZA 3U7ZA 4YTNB 2MEKA 3IT4B 1D4BA 1K53A 1FNUA 3ABVB 4TQ1A 4ZHPA 2GI9A 3AE6B 3GS2A 4GDKB 1V8CA 4KGSA 4RCOA 1STEA 3ZGZA 1H7WA 3H8HA 4L23A 1MI0A 3AH7A 2N7JA 1JALA 2DYOA 2DWQA 1JRPA 2WXQA 3HVDA 4JX1C 2W55A 2W54A 1ROEA 1FXAA 1XF5L 2WXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWM A;  3VR8 B;  3VR9 B;  1YJI A;  2WS3 B;  2HTM E;  2MJD A;  2WP9 B;  1N61 A;  2W3S A;  3P4P B;  1RFK A;  1E10 A;  1SF0 A;  5EE0 A;  2Y5C A;  2L83 A;  2L52 A;  2MJE A;  2WLB A;  2WU2 B;  1WXQ A;  1JQ4 A;  4YT0 B;  1B9R A;  1N5W A;  3P4S B;  3LXF A;  1CJE A;  2WQY B;  1FO4 A;  2BS2 B;  5H92 C;  3AE8 B;  4YXD B;  5C3J B;  2KMM A;  1CZP A;  5H8Y E;  5AUK A;  2BS3 B;  3PO0 A;  1QF6 A;  1YQ4 B;  1FIQ A;  3AEC B;  1N5X A;  1FRR A;  1RWS A;  1RYJ A;  1WRI A;  1TKE A;  2CJN A;  4N6E B;  1FXI A;  1VDV A;  2JX5 A;  1J7B A;  5AUI A;  1KRH A;  1OQQ A;  3CF4 A;  3AB5 A;  4USA A;  1FFV A;  1JWB D;  3LB8 C;  5EE3 A;  1L5P A;  1QOG A;  1ZP0 B;  3FAH A;  1T3Q A;  1J7C A;  1I7H A;  4YTP B;  4US8 A;  1TJE A;  1ZUD 2;  2DBY A;  3FC4 A;  3SFE B;  4ZOH C;  3P63 A;  3AEE B;  3P1M A;  1J7A A;  2B76 B;  2WDR B;  3P4Q B;  3AEF B;  1FRD A;  1OQR A;  1UWM A;  2KAJ A;  3HUI A;  3NVV A;  5MPO A;  1EWY C;  2CJO A;  3AMZ A;  1NEK B;  1AYF A;  1TKG A;  1QLB B;  2MJ3 A;  4YSY B;  1FFU A;  1F0Z A;  1NEN B;  3W5U B;  1IUE A;  1E6E B;  2EKI A;  3W9C B;  1VLB A;  3CWI A;  1QT9 A;  2K22 A;  4ITK A;  3AV8 A;  3HVZ A;  5GXG B;  3AE2 B;  1N60 A;  1VJK A;  4C80 A;  4ZHO A;  1GTH A;  3AEG B;  3VRA B;  2WDV B;  1ZXI A;  1NYQ A;  3BII D;  5G5H A;  4C7Z A;  1TKY A;  4US9 A;  3KWL A;  3AE7 B;  2N0S B;  1QOA A;  1FM0 D;  3B2F A;  4FXC A;  2WU5 B;  1FMA D;  3AEB B;  2E3T A;  3B9J A;  1JWA D;  2H89 B;  3W5V B;  1DGJ A;  4HRO A;  3NRZ A;  1ZOY B;  1JRO A;  2BT6 A;  1SB3 C;  1DOI A;  2MH7 A;  3CIR B;  3EUB 2;  2PVG C;  1E7P B;  4HRS A;  1PUT A;  3NVY A;  1XLQ A;  4YSZ B;  2ACZ B;  2M19 A;  3AM9 A;  2LEK A;  5C2T B;  4A9A A;  2PIA A;  2W3R A;  3AE9 B;  1QOF A;  1E0Z A;  1L0V B;  1AWD A;  2H88 B;  1WGK A;  3WCQ A;  3AED B;  1GTE A;  2AX5 A;  1N63 A;  1OFF A;  2FBW B;  2K5P A;  1GT8 A;  3NS1 A;  1KFY B;  3SFD B;  1PFD A;  1TYG B;  1L6V A;  1XLP A;  3P4R B;  4WWM A;  3ZYY X;  1H7X A;  2QIE B;  4KX6 B;  1N62 A;  4JWU C;  1NYR A;  4WQM A;  1R7S A;  4N58 A;  1JW9 D;  1QOB A;  2OHF A;  2Q5W D;  1YJJ A;  2WDQ B;  1GAQ B;  1XLO A;  3HRD D;  1WWT A;  4YTN B;  1DOX A;  2PVO D;  3NVZ A;  3NVW A;  1YQ3 B;  3AEA B;  1XLN A;  1V97 A;  5EE1 A;  4LTU A;  2BS4 B;  1SIJ A;  1GPX A;  3RPF C;  1XO3 A;  4JWS C;  1NI3 A;  3ETR A;  1KF6 B;  2CU3 A;  3SR6 A;  2M56 B;  3ABV B;  2QJL A;  1L6U A;  4ZHP A;  4C7Y A;  2K9X A;  4N59 A;  3AE6 B;  3AE5 B;  4YSX B;  1PDX A;  1RM6 C;  1V8C A;  3DWG C;  1E9M A;  1H7W A;  1WYG A;  2JQR B;  3AH7 A;  1DOY A;  2PKO A;  1A70 A;  1JAL A;  1NVI D;  2DWQ A;  1JRP A;  2G1E A;  3B2G A;  3AE4 B;  4JX1 C;  5EE9 A;  3AE1 B;  2W55 A;  3L4P A;  3AN1 A;  2W54 A;  3AE3 B;  1ROE A;  4P6V F;  1FXA A;  4YTM B;  5G5G A;  3VRB B;  4IDI A; 
#chains in the Genus database with same CATH topology
 4ZDV A;  3PZ8 A;  1TGZ B;  2L52 A;  2QMT A;  1N5W A;  3P4S B;  1T6B X;  2JT4 B;  1VD2 A;  1L0Y B;  4EOY A;  2KDM A;  3JSV B;  4G0N B;  1FXI A;  1KLG D;  1ET6 A;  5D94 A;  3ZXR A;  5TSS A;  1NBF C;  1V5O A;  2GB1 A;  4BBN F;  1IGC A;  2JUO A;  1G6J A;  4A90 A;  5IA7 A;  2KNB A;  3BYT B;  1XD3 B;  1PGA A;  3VH4 B;  3AUL A;  2FCN A;  4GOC A;  2UWQ A;  1ZKH A;  4JE3 B;  3EGR A;  4RFB A;  1GJZ A;  3M63 B;  3ZTC A;  2O6V D;  2IBI B;  3VRA B;  4ACF A;  4C7Z A;  4DHJ B;  2YVC A;  3DPD A;  2LVQ A;  1JRO A;  1DOI A;  4D2K A;  1E7P B;  4F8C B;  1IP9 A;  2RPQ A;  1WJU A;  3A1Q A;  1GTE A;  1C4A A;  2JZP A;  2MBH A;  4QAY A;  4NAW A;  3P4R B;  3E56 A;  2WDT B;  2KDF B;  3V3X A;  1YJJ A;  3URY A;  2RDB C;  4A20 A;  3NVZ A;  2D3A A;  2REX A;  4AJW A;  2CHZ A;  2BS4 B;  2N9K A;  3X23 A;  3L16 A;  3ZTD A;  5LNK 1;  1KF6 B;  1P9D U;  2HJ1 A;  2M56 B;  3OLM D;  1L6U A;  3BK1 A;  5CHF A;  2X38 A;  2BQQ A;  4XE0 A;  4MEL A;  2FE8 A;  2LRU A;  2G1E A;  4O1N A;  4S0R A;  3A1Q B;  3ENE A;  1ET9 A;  2ZNV C;  3I57 A;  2R2O A;  4W9I A;  3L13 A;  2JXX A;  2BPS A;  2R2Q A;  4II3 B;  3V6C B;  4MJS A;  3M62 B;  2JWZ A;  2SEB D;  1E5W A;  2BS2 B;  1GG3 A;  2E6X A;  2BYE A;  2CS4 A;  4FHJ A;  4OW0 A;  4M00 A;  1KRH A;  4USA A;  1XCQ L;  2JU6 X;  2OED A;  1X1M A;  3FAH A;  2KK8 A;  4AJY B;  1J7C A;  5JHB A;  1TJE A;  4AWJ A;  1CQV A;  1V81 A;  3TEW A;  4P1C C;  1S1Q B;  3P63 A;  3H7P B;  2D5G A;  2K39 A;  4FJY A;  3KLS X;  1OEY J;  4DXF A;  1L4D B;  3GE3 C;  1EU4 A;  2EKI A;  3C8Y A;  1QT9 A;  4ITK A;  3AV8 A;  1WGR A;  2CU1 A;  4G11 A;  4WWO A;  2GBR A;  2LD9 A;  3MJ5 A;  4BAX A;  2KN4 A;  2XK5 A;  2MH7 A;  4IM3 A;  1XLQ A;  4B6W A;  3RYT A;  3ONS A;  2V4L A;  3AED B;  2MBE A;  1SBB B;  3NS1 A;  4OVU A;  1F52 A;  1NYR A;  3ZDT A;  1GAQ B;  3MTN B;  2KXJ A;  2GBK A;  3RPF C;  1HE8 A;  3AE5 B;  2RMM A;  4DWF A;  4E74 A;  2NTT A;  2MRP A;  2KQ7 A;  2QIL A;  1F9J A;  4P6V F;  4MH0 E;  2Y5B B;  2A4Z A;  2RD0 A;  1RAX A;  3MC8 A;  3W2D A;  5AZH A;  3VUW A;  2WU2 B;  1WXQ A;  4IG7 B;  1XXG A;  2LUE A;  4W9E A;  3KYD D;  1TZ1 A;  1VRA B;  4LK0 M;  4XDD A;  3WA0 A;  3Q3M C;  1RRB A;  5AUK A;  1YNT E;  3PO0 A;  3V6E B;  1FIQ A;  4KZC A;  4FN2 A;  2KWU B;  4AUQ C;  2AQ1 B;  1LFD A;  2FNJ B;  2HD5 B;  2J0M A;  3AB5 A;  3SDL C;  3JW0 X;  4MM3 A;  3A9K B;  3O65 B;  4PYU A;  2LXA A;  2B76 B;  2NCN A;  4HJK A;  3W1S C;  2G45 B;  2WGS A;  2B3A A;  3CMM B;  3RNC C;  2LVP A;  3QC8 B;  2PEA A;  2XK5 B;  3QA8 A;  2JYE A;  1YJ1 A;  1QOA A;  4XWT A;  2FUG 1;  2KLG A;  5IO9 A;  3NRZ A;  4MGI E;  4NQL B;  2UU7 A;  4G3X B;  2G4D B;  4BVU C;  2PTL A;  2RPV A;  1L6V A;  2MX2 A;  1QOB A;  2DX5 B;  4ZYN A;  1MHH E;  2KDE B;  1DOX A;  3L17 A;  1XLO A;  5CHV C;  2BGF A;  1EF5 A;  3RCZ A;  3SR6 A;  2INP E;  5DPS A;  3DWG C;  3TJP A;  2WX0 A;  1A70 A;  2K3U A;  2KLC A;  3DCG A;  4JL9 A;  4DDI D;  2KYW A;  3V62 A;  4FBJ B;  3ZRC A;  3LDZ E;  5HI1 A;  2MJD A;  3UIN B;  1IBX B;  4EE2 A;  1RLF A;  3ZW3 A;  2GOW A;  1D3Z A;  4KSL C;  2KFJ A;  3R8B A;  4DXA B;  1FO4 A;  3SEB A;  3BZD B;  4MGY E;  1TY2 A;  1K52 A;  3VUY A;  2KKC A;  2M4N A;  3ZRF A;  2BWE S;  4IOI E;  3A9K A;  1FCC C;  3Q8C A;  2LFI A;  2KAN A;  5D3D A;  4US8 A;  2IGG A;  1C3T A;  1TS4 A;  1L4Z B;  2HTH A;  2LUM A;  2FCS A;  4NAM A;  2ZPY A;  4KGT A;  3TMP B;  1OEY A;  4LLG M;  2DLB A;  2N9E B;  4TMA B;  3WAM A;  1TS2 A;  4C80 A;  1N60 A;  4ZHO A;  2ZW1 A;  4DXG A;  2N0S B;  2E3T A;  4E3C A;  5FR3 A;  3PT2 B;  2GMI C;  1DGJ A;  3W1S A;  2AQ2 B;  3Q3N C;  1VZ7 A;  4BKS D;  3KUZ A;  4MGZ E;  1I4R A;  1P0R A;  4OZA A;  1K8R B;  2KMA A;  3BYY B;  4BFR A;  2JXT A;  4NZL B;  1OFF A;  1AAR A;  1V1O A;  1XLP A;  2I1J A;  4DHJ D;  1H7X A;  2QIE B;  3OAW A;  1WJN A;  1EF1 A;  2O6V B;  1YIW A;  4REZ A;  3KUD B;  3U7Z A;  4YTN B;  2J7Q B;  2MEK A;  4W9G A;  2KOX A;  2VH1 A;  1J19 A;  1STE A;  4L23 A;  4BOS C;  1M94 A;  5JH5 C;  1WGG A;  2N7J A;  3H6N A;  3QX1 A;  3N3K B;  4G50 A;  2W55 A;  1ROE A;  1FXA A;  2WXH A;  1V6E A;  3DWM A;  2IDY A;  2J53 A;  1WRD B;  2CR5 A;  1GC6 A;  3IVF A;  3TEX A;  1FCL A;  2G3Q B;  3DHI C;  2L83 A;  3H9D A;  1B9R A;  2AYO B;  4L2Y A;  3PZ7 A;  2L3Z A;  4M02 A;  3K9O B;  2N9L A;  1WX9 A;  3DBH I;  1IYF A;  1RWS A;  4XC2 A;  1J7B A;  5FR6 A;  4OZB A;  3QAQ A;  3DVN V;  2HJ8 A;  3E9S A;  1ZUD 2;  3R2I A;  3FC4 A;  3SFE B;  2OJW A;  3HM3 A;  1UWM A;  1EWC A;  3AMZ A;  1NEK B;  3BIN A;  2Y3A A;  1NEN B;  1HEZ E;  3A4R A;  1IUE A;  4DQO C;  4CO7 A;  1FNW A;  3WIM A;  2V3N A;  3PV1 A;  2DZI A;  2LI5 A;  2N4F A;  4ZRJ A;  1I4Q A;  1GB1 A;  4MDK E;  2K8H A;  4WJQ A;  3TUO A;  2YEP F;  4EZL A;  2JF5 A;  2GBM A;  1E0Z A;  1L0V B;  3SHQ A;  3WCQ A;  1ZDV A;  3EC8 A;  2AX5 A;  2BWF A;  2O6V A;  4C00 A;  5AEK B;  4KZ0 A;  3T3N A;  4P16 A;  1R4M I;  1WGY A;  3U30 A;  4HK2 A;  3RZF A;  2PVO D;  4TV3 A;  3N20 C;  4AS1 A;  1TTN A;  5EE1 A;  5FKA C;  3ETR A;  3WAO A;  2QJL A;  2LVO A;  4HPM B;  1PDX A;  1RM6 C;  2KJH B;  1E9M A;  1AN8 A;  3ZVV A;  3L4P A;  3AN1 A;  3ZIM A;  2UYZ B;  1GNU A;  2KAC A;  4TUU A;  1GB4 A;  1NDD A;  5E6O A;  3I63 C;  1SF0 A;  2KTF A;  5G2N A;  3DOW A;  3M3J A;  1WMH B;  1BXT A;  1UBQ A;  4WUR A;  2NS5 A;  2RSU A;  3DBH B;  2KDI A;  1CJE A;  2WQY B;  5TR5 A;  1FD6 A;  1EU3 A;  2IO1 B;  5H92 C;  5C3J B;  2XN9 C;  3RMK C;  2KTR B;  1N5X A;  1MPE A;  4S17 A;  2D3B A;  1T5X D;  2I38 A;  3CF6 E;  4KV2 A;  3Q6B A;  4HCN B;  4AOF A;  2DBY A;  2NBV B;  3T8M A;  4EFO A;  2V0G A;  1ZW7 A;  1WH3 A;  2W9N A;  2M0A A;  2CJO A;  2MJ3 A;  5LLI A;  4EZJ A;  4LNN A;  1WIA A;  4HKQ A;  5BMH A;  3FIL B;  3CWI A;  3V05 A;  1HZ5 A;  3AEG B;  5BMI A;  1XCT L;  3B2F A;  1ACC A;  4OVZ A;  2KJR A;  2DNF A;  4P7I A;  2L7R A;  2PMV A;  1SSN A;  1SB3 C;  1WXV A;  3Q3J A;  4ZRK A;  4YSZ B;  2M19 A;  3SD5 A;  3C0R B;  1SXT A;  4GGQ A;  1SE4 A;  4FLH A;  1V80 A;  4NNJ B;  4RMA A;  1UZX B;  5JHA A;  5J18 A;  1E8W A;  1I4H A;  4CQN A;  2M17 A;  4A8X C;  3L08 A;  4RGN A;  4YWG G;  2KQ4 X;  2BTE A;  3GP7 A;  1V1P B;  1WE6 A;  1WWT A;  3PVL A;  4GU2 A;  3AEA B;  1XEE A;  1V97 A;  4LTU A;  1XO3 A;  1S3S G;  4JWS C;  1H8C A;  2KHW B;  2MWS B;  4C7Y A;  1OQY A;  2L00 B;  2MLB A;  1SJH D;  1XQQ A;  1NVI D;  2LGX A;  2JSV X;  4GIV A;  2NR2 A;  4K81 A;  1WXS A;  4J6I A;  1BML C;  1WR6 E;  1WMH A;  1L7Y A;  1R4M B;  1E10 A;  4IM2 A;  1JQ4 A;  1E7U A;  1IPG A;  3UIP B;  3TSS A;  2A5U A;  4A55 A;  5H8Y E;  2DZK A;  1LM8 B;  1I42 A;  2IY1 B;  2M8S A;  5EE3 A;  3APD A;  4H2A A;  5BYR A;  3EEC A;  1FEH A;  4HCP B;  3IT6 B;  1V49 A;  3JYU A;  2MW5 A;  2NTS A;  2CKH B;  1UUP A;  2SAK A;  3U4E G;  4KKI A;  1WX7 A;  4A3P A;  3ZXV A;  4HWI B;  1D5Z C;  1NYQ A;  3AE7 B;  2KJ6 A;  4A3O A;  4I6N B;  1JWA D;  3W5V B;  1ZOY B;  3DQV A;  4X57 B;  3O13 A;  4XWW A;  3VVW B;  3ALB A;  2C5L C;  2DZM A;  3T9L A;  4ICU A;  2J4X A;  2LGI A;  1TIF A;  2QSD A;  3ZDM C;  2MBB B;  1ZXH A;  2D07 B;  1QZE A;  3SFD B;  1PFD A;  3Q3O C;  4CYE A;  1JW9 D;  2KC2 A;  1K51 A;  1V5T A;  4ANX A;  2VZK B;  2BW2 A;  2KT7 A;  1F2R C;  3U7D A;  1YN3 A;  2WXI A;  2WXF A;  4YSX B;  2LHD A;  3WAN A;  2K25 A;  3B2G A;  4I6P A;  2AL3 A;  5C2T B;  4NAW B;  1KM7 A;  5BYS A;  1YN4 A;  2LGS A;  3KVF B;  5KHQ A;  4B95 A;  2ZVN A;  3ZJV A;  4NPN A;  5JXV A;  2WNM A;  2KVZ A;  3TEZ A;  4PK1 A;  3V61 A;  4PS3 A;  3VDZ A;  1CZP A;  3QK0 A;  2WXM A;  1RYJ A;  1UGJ A;  3UI3 A;  3MP9 A;  3PLV A;  3X0W A;  4WIP A;  2MP2 B;  2D2Q A;  4DDG D;  4IWP A;  3RNG C;  1T3Q A;  4ARI A;  1SE3 A;  2C60 A;  3VAW A;  4TQ0 A;  1J0G A;  3BVM A;  2WDR B;  3AEF B;  4J3O D;  1UD7 A;  2WXP A;  4EEW A;  3RFZ B;  2WXL A;  4PYZ A;  2O2V B;  5GXG B;  3I3T B;  3R3M A;  1UWX A;  2L76 A;  1ZXI A;  4PT5 A;  1TKY A;  3KWL A;  4BZA A;  2LMC A;  5DCN A;  4B0M A;  4HRO A;  2MP2 A;  2K0P A;  3CIR B;  1VR9 A;  2ACZ B;  1JWM D;  3AE9 B;  2D3C A;  4B0E A;  1F77 A;  3PZD A;  3CSF A;  1AW7 A;  3LYY A;  2DYB A;  3AU5 A;  2I2Y A;  3ECI A;  3ZO5 B;  1I35 A;  2PE9 A;  3IT4 B;  1D4B A;  2AWT A;  4W9J A;  4ZHP A;  4TQ1 A;  5IAA C;  2EMS A;  3EHV A;  3ZGZ A;  4FUL A;  3H8H A;  1MI0 A;  4GN1 A;  1UF0 A;  1OTR B;  2DYO A;  3NOB A;  3VXW A;  3RNB C;  4N9F 4;  2JZ3 B;  1MJD A;  1F1H A;  1YMH E;  3RNA C;  3ZUN A;  5E6P A;  5G55 A;  3K9P B;  1R4N B;  3TIX A;  1MVK A;  3IXS A;  3QHT A;  3FKY A;  4LNK A;  4RH6 A;  2QCZ A;  1VDV A;  3B0A A;  4XX5 A;  4K3C A;  1OQQ A;  2MBQ A;  3H7S A;  3KH0 A;  4KIK B;  3BVG A;  1MG8 A;  4KDI C;  4WAA A;  2N9P C;  4MT5 A;  2K6Q A;  2JRI B;  1OQR A;  1P1A A;  2ON8 A;  4C4V B;  3QCA A;  4IM0 A;  2BKR B;  3DBS A;  1ENF A;  4GXB A;  1E6E B;  4RF0 A;  3AXC A;  2L32 A;  2PJH A;  3NHE B;  2TSS A;  3QAR A;  1FM0 D;  2AL6 A;  2HDE A;  3PTF C;  4FXC A;  4JQW C;  3WAL A;  2V3P A;  1N6Z A;  1C9F A;  3M95 A;  2Z8L A;  2KO3 A;  1PUT A;  2Y5P A;  3ZLZ A;  3PSE B;  2H88 B;  1WXA A;  2FUH B;  1QKZ A;  1PQS A;  4BKG A;  2WWZ A;  3OJ3 A;  2R61 A;  2NBU A;  1VZ8 A;  2FID A;  1UBI A;  2Q5W D;  3FIL A;  5C1Z A;  1C79 A;  1JRU A;  4M8M A;  1BUI C;  4URK A;  1UNS A;  4B9K A;  3RT3 B;  2M1M A;  4WQO B;  2XNA C;  4N59 A;  1D5M C;  3EFU A;  3P42 A;  1HTO A;  2OOB B;  1KOT A;  1WYG A;  2ASQ A;  1DOY A;  3Q8B A;  1C76 A;  2RDH A;  1I4P A;  3AE1 B;  1EUV B;  4PS8 A;  2LXC A;  1QQR A;  3LJ3 A;  4ANW A;  2WP9 B;  3RNE C;  4AP4 C;  1LO5 D;  1WY8 A;  2MJE A;  1WZ0 A;  3IBE A;  4F1S A;  4YT0 B;  2XBB C;  3GOE A;  4RM9 A;  1LXD A;  5IP4 D;  3GE8 C;  1ZDX A;  5BMG A;  4IKG A;  3DHG C;  4DHZ B;  1TKE A;  2BB5 A;  4MSQ B;  3B1L X;  5KHO A;  2GLS A;  4WJP A;  5BO4 B;  4M0W A;  3QWZ B;  2AQ3 B;  3TBL D;  3PRE A;  3AEE B;  2KWC A;  1WSP A;  3P4Q B;  2L05 A;  3AI5 A;  2IZV B;  3H1U A;  1WE7 A;  2K8C A;  1KTK A;  4MEM A;  4FJZ A;  2IGD A;  4LJO B;  3ZJT A;  2ZW0 A;  3ZKJ C;  1I4G A;  1WX8 A;  1V86 A;  2RDG A;  5D3I B;  1C4P A;  3B9J A;  1FMA D;  2NVU I;  4LDT D;  4EUT A;  4W9H A;  3BVZ A;  3JVZ X;  4MAC A;  2PVG C;  3VH3 B;  5T8I A;  4UDU C;  2QEJ C;  1AWD A;  2GRI A;  3PLU A;  5D2M B;  3NUH B;  5E6J A;  4LNF A;  3V60 A;  2K6D B;  1CMX B;  3RN9 C;  2YEP B;  4K3B A;  4KX6 B;  1E90 A;  1N62 A;  2KFK B;  2LRW A;  3PHX B;  4RGO S;  3DVG X;  2WDQ B;  3R2T A;  1Y56 A;  3APC A;  1YQ3 B;  1XLN A;  4ICV A;  2EKE C;  4W9K A;  3Q69 A;  3PHW B;  4JPS A;  3DVN U;  1Q5W B;  3BY4 B;  1TS3 A;  4FA6 A;  5IN7 A;  4R3D A;  1CK1 A;  3PS6 A;  3VRB B;  1A5R A;  3B08 A;  1YJI A;  2WS3 B;  4KSK C;  4OHJ A;  3DVG Y;  1T0S C;  3VTU A;  2PPH A;  3A33 B;  2KZR A;  3Q8A A;  2BB6 A;  1SE9 A;  4XZ4 A;  2JVC A;  2ZJD A;  2KMM A;  4JGH B;  4OZC A;  2KDB A;  4BKS A;  2WXJ A;  5AUI A;  2CHX A;  2EMT A;  1JWB D;  1KLV A;  4RGT A;  4DBG A;  1HA5 A;  3EFC A;  1QOG A;  2WXO A;  2VZK D;  2LHE A;  1J7A A;  3HUI A;  4HJG E;  1WM3 A;  2IND C;  2ZZP B;  4NY0 A;  1P7E A;  1TKG A;  1F0Z A;  5GMV A;  3DHH C;  4I6L B;  2FAZ A;  3WAP A;  3AE2 B;  5HHD G;  1GTH A;  5G5H A;  1HZ6 A;  2I1K A;  3MJW A;  4OVV A;  3ZQ4 A;  2DEN B;  2LJI A;  4W9L A;  3N30 A;  3DBR B;  4HLE A;  4YL8 A;  4GDL A;  2KFK A;  2GBN A;  3VQI A;  2KX3 A;  2ONQ A;  3Q3F A;  4DHZ E;  2N7D A;  2O2V A;  3HK0 A;  4KVG B;  3Q14 C;  3NVW A;  2LWP A;  3PRZ A;  1FNV A;  2W82 A;  1L0X B;  3MHZ A;  2CU3 A;  2DHZ A;  1YOV B;  1RFA A;  3UIO B;  4EKU A;  4BOZ B;  4CHK A;  4RF1 A;  2IYD B;  1E7V A;  1YX6 B;  4GDK A;  2INC C;  2N1W A;  3NJT A;  4YTM B;  1ESF A;  5G5G A;  4Q2J A;  1WR1 A;  2PW9 A;  1E8X A;  3DBR I;  5LXH A;  2WLB A;  2JYT A;  2FCQ A;  2NBW B;  3Q2A C;  1I4X A;  2QC8 A;  2XEW A;  2D3G A;  4EZK A;  4YXD B;  4FAD A;  5IKC M;  3IFW B;  4TSS A;  4WAF A;  2MQJ A;  3AEC B;  3KWV A;  4N6E B;  3U2S C;  4LJP B;  3VTW A;  1FPY A;  1L2N A;  1L5P A;  1SIF A;  2KN5 A;  1ZP0 B;  2QDF A;  2VRR B;  3NG0 A;  3OJ4 B;  5HG2 A;  4ZOH C;  1U4A A;  3NVV A;  4TKN A;  3APF A;  4RNA A;  2WHI A;  2JPH A;  4YSY B;  3DBL I;  1FXT B;  1V2Y A;  5E6N A;  3BII D;  2D10 A;  2KTR A;  2H89 B;  4L1B A;  1QIL A;  1K50 A;  4GDL B;  2FIF A;  1DYQ A;  2MCN B;  1XT9 B;  4BBN C;  2LEK A;  2PIA A;  3L10 B;  5CHW A;  1N63 A;  4KKJ A;  3I5J C;  3BK2 A;  5EDS A;  3IG3 A;  2MHJ A;  2L0F A;  2OHF A;  3AU4 A;  2HE7 A;  4PS7 A;  2J0K A;  3UF8 A;  3KW5 B;  1LGR A;  2AEH A;  4II2 B;  1FNU A;  3L0W B;  3RUL A;  5DPW A;  2L8J A;  3AE6 B;  4JLC A;  1WFY A;  3GS2 A;  4GDK B;  4KGS A;  2DZJ A;  3AH7 A;  2JY6 A;  1JAL A;  4NQK E;  3HVD A;  3S2A A;  2W54 A;  2LJ5 A;  2HTM E;  1Z5S B;  1WZ3 A;  4ANV A;  3QJZ A;  5AZG A;  1GUA B;  5J17 A;  2Y5C A;  1TS5 A;  1IBX A;  4K7W A;  4M01 A;  3UGB B;  4W9C A;  4GMV A;  4DK5 A;  3AE8 B;  2V1Y A;  1T0R C;  1YQ4 B;  3P1M A;  2CJN A;  1Q0W B;  4MM3 B;  2JX5 A;  2ZPN A;  4ZRQ A;  1YN5 A;  1FFV A;  1P3Q U;  4WJN A;  3R7Q A;  3RNF C;  2LZ6 A;  4IWQ A;  2ICI A;  3KUC B;  4GLS C;  1WJ4 A;  3OG5 A;  4W9D A;  1SE2 A;  2ZEQ A;  1D5X C;  1QLB B;  2FCM A;  4E71 A;  1JWS D;  4P1B C;  4F7Z A;  3CST A;  1C78 A;  4US9 A;  3BWU D;  2V9H A;  2WU5 B;  1JCK B;  1UH6 A;  2J0J A;  4ASW C;  1Y8R C;  1SEB D;  3P2B A;  4K1R B;  3TEY A;  3UQA A;  3NY5 A;  1JWU D;  2DAF A;  2LAS A;  4M0W B;  2V4I B;  2OJR A;  2W3R A;  2WYQ A;  1WGD A;  2N1V A;  1YQB A;  3ZNG C;  3R66 C;  2N9X A;  3DDC B;  1WYW B;  2J42 A;  1V1P A;  4ZRI A;  1D6E C;  4FHK A;  2IGH A;  4WQM A;  4N58 A;  2ZVO A;  5JZE B;  3RD2 A;  4NJ6 A;  1SIJ A;  1WJ6 A;  3MHS D;  1T0Q C;  4HPP A;  1F2R I;  2KVR A;  2PKO A;  3HIZ A;  5EE9 A;  1UGM A;  1YX5 B;  3HHM A;  2INN E;  1LQB A;  2IO3 B;  4GB9 A;  4XGA B;  4HXD A;  3Q8F A;  1EO6 A;  5CX3 A;  3P4P B;  1EM7 A;  4K7U A;  5EE0 A;  3TL5 A;  4MH8 A;  1VCB A;  3LXF A;  1C77 A;  3J9C A;  2NPT B;  3RI7 C;  1P98 A;  1WGH A;  3C19 A;  2IJ0 A;  3N9Y C;  1PGX A;  4IWO A;  5LXI B;  4BKT A;  3PRM B;  1I7H A;  4HKZ E;  2QHO A;  3A4S C;  1HQR D;  2ZCB A;  3N1Y C;  4HEA 1;  3W5U B;  1VZ6 A;  2C7N B;  3W9C B;  2MSE D;  4JIO U;  4C56 C;  1YD8 U;  2G9H D;  2WXR A;  1KH0 A;  4AQ7 A;  3IHP C;  1MG4 A;  4MGK E;  2WXK A;  1C4C A;  1H4R A;  2C9W B;  2YLM A;  2BKF A;  1PGB A;  1WGK A;  1BT0 A;  1SGH A;  5HFY A;  4IW0 A;  5DPR A;  1KFY B;  1NI2 A;  1TYG B;  3ZNZ B;  4HDQ A;  2MA9 B;  4JWU C;  2BVC A;  1TY0 A;  3SU8 X;  4M8N A;  3I9V 1;  5FK9 C;  2JZZ A;  1E8Z A;  2IY0 B;  2V3S A;  3MC0 B;  1GPX A;  2Z0D B;  4XDC A;  2L1A A;  4ZRP A;  4MSM B;  1GOZ A;  2K9X A;  1E8Y A;  4NJ7 A;  1OGW A;  2KMC A;  2JQR B;  1ZPS A;  5BYQ A;  4A6Q A;  2BYF A;  2ZNV B;  3MC9 A;  2ZCC A;  2BYT A;  4IDI A;  3VR9 B;  2GBJ A;  3ZNH B;  3N1Z C;  2KX0 A;  4RGM A;  2W3S A;  2LGD A;  1MFW A;  3H7P A;  3NZ3 A;  1TBE A;  1P7F A;  2JRH A;  3EA6 A;  4K7S A;  1QF6 A;  4WWP A;  1FRR A;  5I4D A;  3ZNI D;  5IOI A;  3VTV A;  3CF4 A;  3Q8E A;  3QQ8 B;  2PLP A;  3MFG A;  1HXY D;  3RUI B;  1TZO A;  1SJE D;  3GZN I;  2Z0E B;  4KGR A;  3HM6 X;  4HVB A;  3VFK A;  2KAJ A;  1EWY C;  4MJS B;  1PYW D;  3TCA A;  3N1X C;  2K22 A;  3HVZ A;  1VJK A;  1WM2 A;  2PE6 B;  2WX1 A;  4IUM B;  1UEL A;  3U8Z A;  4HRS A;  1Q10 A;  3NS8 A;  4GSW A;  3AM9 A;  3PPA A;  5HKH A;  1Q1O A;  2CHW A;  2FBW B;  2BF8 B;  4C4V A;  4WWM A;  3ZYY X;  2NMQ A;  2BYV E;  2K8B A;  2MBO A;  1R7S A;  4IC7 B;  1J8C A;  2IO0 B;  2C7M B;  2M0X A;  3IAM 1;  3T3O A;  3HRD D;  2KWD A;  2LGY A;  3VHT C;  2KD0 A;  1TT5 B;  4LCD E;  1NI3 A;  1JML A;  3QIJ A;  2Z59 B;  2IPK D;  2G4S A;  1T0Y A;  3IAS 1;  1WF9 A;  1HTQ A;  2DAJ A;  2JWU A;  3A9J A;  3AE4 B;  2EEL A;  3NZS A;  1C1Y B;  4WH4 A;  3AE3 B;  1IGD A;  1R4N I;  5D7G A;  3UQB A;  4ARC A;  3VR8 B;  2DYM A;  3ZJU A;  1B1Z A;  1N61 A;  1ZE3 D;  2K1F A;  4WWN A;  1RFK A;  3OWE B;  4LNI A;  4ANU A;  3L54 A;  4W9F A;  1M4V A;  1Z2M A;  1MHX A;  2BS3 B;  3N32 A;  1WRI A;  4KIK A;  3RZW C;  2WXN A;  1GC7 A;  1ZGU B;  4WJO A;  2KC1 A;  3A9J B;  1KLU D;  4KDL B;  2L0T A;  3LB8 C;  5DPT A;  1ISN A;  3PRP B;  2KWV B;  4YTP B;  4HDO A;  3U52 E;  1FRD A;  3DBL B;  5MPO A;  4ZYS A;  3GB1 A;  1AYF A;  4HPL B;  3KQ4 A;  1FFU A;  1WI0 A;  5CTR C;  1VLB A;  2WXG A;  2J52 A;  2BBC A;  2WDV B;  3ML8 A;  3AEB B;  2BT6 A;  1V9J A;  5C23 A;  3EUB 2;  1WXM A;  4LDT B;  2RGF A;  5AZF A;  3NVY A;  4A9A A;  2C7H A;  5L83 A;  1QOF A;  2X8X X;  2VH2 A;  3NZU A;  2RR9 A;  2K5P A;  1GT8 A;  4RM8 A;  3PGE A;  3VUX A;  3W1Y A;  1KJT A;  4NJC A;  4FJV B;  2N7E A;  3D32 A;  3ML9 A;  2NPT A;  1K53 A;  3KYC D;  5L95 C;  4XYC A;  2IO2 B;  3ABV B;  2GI9 A;  3GZN B;  2D11 A;  3JSV A;  1V8C A;  4RCO A;  5D6J B;  2KQS A;  1H7W A;  5J2R A;  2DWQ A;  1JRP A;  2WXQ A;  4JX1 C;  3R7R A;  1XF5 L;  4LNO A; 
#chains in the Genus database with same CATH homology
 3DWM A;  2IDY A;  2HTM E;  2J53 A;  1YMH E;  3TEX A;  3PZ8 A;  1FCL A;  2Y5C A;  1TS5 A;  2L52 A;  2L83 A;  2QMT A;  1B9R A;  1N5W A;  1IBX A;  4L2Y A;  3PZ7 A;  3P4S B;  1T6B X;  2N9L A;  1L0Y B;  3AE8 B;  1MVK A;  3IXS A;  1YQ4 B;  3P1M A;  2KDM A;  1RWS A;  2CJN A;  4RH6 A;  1FXI A;  1KLG D;  1VDV A;  2JX5 A;  4MM3 B;  1J7B A;  1ET6 A;  1OQQ A;  4ZRQ A;  1YN5 A;  1FFV A;  3BVG A;  4OZB A;  2ICI A;  5TSS A;  4GLS C;  3E9S A;  1ZUD 2;  2GB1 A;  3R2I A;  1SE2 A;  3FC4 A;  3SFE B;  1IGC A;  4MT5 A;  1UWM A;  1EWC A;  1OQR A;  4A90 A;  3BYT B;  3AMZ A;  1D5X C;  1NEK B;  1PGA A;  2ON8 A;  1QLB B;  2Y3A A;  1NEN B;  1HEZ E;  1ENF A;  1IUE A;  1E6E B;  4RF0 A;  4DQO C;  1JWS D;  4JE3 B;  3EGR A;  2L32 A;  4RFB A;  1FNW A;  2TSS A;  3VRA B;  2V3N A;  4C7Z A;  1C78 A;  4US9 A;  3BWU D;  1FM0 D;  2HDE A;  4FXC A;  2WU5 B;  1JCK B;  2V3P A;  1C9F A;  1I4Q A;  1SEB D;  1JRO A;  1DOI A;  4D2K A;  2Z8L A;  3TEY A;  1GB1 A;  1E7P B;  1JWU D;  1PUT A;  2Y5P A;  3TUO A;  2YEP F;  2V4I B;  2W3R A;  1E0Z A;  1L0V B;  2H88 B;  3WCQ A;  1ZDV A;  1GTE A;  1C4A A;  2AX5 A;  2JZP A;  1QKZ A;  3P4R B;  2J42 A;  1V1P A;  3E56 A;  3T3N A;  1D6E C;  2R61 A;  4P16 A;  2IGH A;  4WQM A;  1VZ8 A;  4N58 A;  3FIL A;  2Q5W D;  3V3X A;  1YJJ A;  1C79 A;  3URY A;  2PVO D;  3NVZ A;  4AS1 A;  5EE1 A;  2BS4 B;  1SIJ A;  2N9K A;  5FKA C;  1BUI C;  5LNK 1;  1UNS A;  3ETR A;  1KF6 B;  2M56 B;  2QJL A;  2XNA C;  1L6U A;  3BK1 A;  4N59 A;  1D5M C;  1PDX A;  3P42 A;  2X38 A;  1RM6 C;  1E9M A;  1WYG A;  1F2R I;  4XE0 A;  1DOY A;  1AN8 A;  2FE8 A;  2PKO A;  3Q8B A;  5EE9 A;  1C76 A;  2G1E A;  4O1N A;  2RDH A;  1I4P A;  3AE1 B;  3L4P A;  3AN1 A;  1ET9 A;  2INN E;  2KAC A;  3I57 A;  1GB4 A;  1QQR A;  2WP9 B;  3Q8F A;  3P4P B;  1LO5 D;  1EM7 A;  1SF0 A;  5EE0 A;  2MJE A;  4YT0 B;  1BXT A;  4MH8 A;  4WUR A;  2SEB D;  3LXF A;  1C77 A;  1CJE A;  3J9C A;  2WQY B;  2BS2 B;  1FD6 A;  1EU3 A;  5H92 C;  5C3J B;  1ZDX A;  5BMG A;  2XN9 C;  4IKG A;  2E6X A;  1N5X A;  2IJ0 A;  1MPE A;  1TKE A;  4OW0 A;  1T5X D;  2BB5 A;  1KRH A;  4USA A;  2I38 A;  3N9Y C;  1PGX A;  1XCQ L;  2JU6 X;  2OED A;  3FAH A;  4M0W A;  1J7C A;  1I7H A;  1TJE A;  1CQV A;  4HKZ E;  2AQ3 B;  2DBY A;  3TEW A;  2V0G A;  3P63 A;  3AEE B;  1WSP A;  3P4Q B;  1HQR D;  2M0A A;  2CJO A;  2D5G A;  4HEA 1;  3KLS X;  2MJ3 A;  4DXF A;  3W5U B;  1KTK A;  1L4D B;  1VZ6 A;  4HKQ A;  1EU4 A;  5BMH A;  2EKI A;  3FIL B;  2IGD A;  3C8Y A;  3CWI A;  3W9C B;  1QT9 A;  3ZJT A;  4ITK A;  3AV8 A;  4C56 C;  2ZW0 A;  3V05 A;  1HZ5 A;  3AEG B;  5BMI A;  1I4G A;  2G9H D;  2RDG A;  2WXR A;  1XCT L;  1KH0 A;  3MJ5 A;  3B2F A;  1C4P A;  1ACC A;  4OVZ A;  5D3I B;  3B9J A;  1FMA D;  4AQ7 A;  2KN4 A;  2PMV A;  1SSN A;  1SB3 C;  2WXK A;  2MH7 A;  3BVZ A;  4MAC A;  2PVG C;  1C4C A;  1XLQ A;  4YSZ B;  2M19 A;  1PGB A;  5T8I A;  4UDU C;  2QEJ C;  1AWD A;  1SXT A;  1SE4 A;  1WGK A;  2GRI A;  3AED B;  1SBB B;  3NUH B;  5E6J A;  5HFY A;  3NS1 A;  1KFY B;  1TYG B;  1I4H A;  4CQN A;  2YEP B;  4KX6 B;  1N62 A;  4JWU C;  4A8X C;  1NYR A;  1TY0 A;  4RGN A;  4YWG G;  2KQ4 X;  4RGO S;  3I9V 1;  3GP7 A;  2WDQ B;  1GAQ B;  5FK9 C;  1Y56 A;  1V1P B;  1WWT A;  3R2T A;  2BTE A;  1YQ3 B;  3AEA B;  1XEE A;  1XLN A;  1V97 A;  3MC0 B;  4LTU A;  1GPX A;  3RPF C;  1XO3 A;  4JWS C;  4XDC A;  2L1A A;  3Q69 A;  4ZRP A;  4C7Y A;  1GOZ A;  2K9X A;  4JPS A;  3AE5 B;  2RMM A;  2JQR B;  1TS3 A;  1ZPS A;  1SJH D;  2NTT A;  1NVI D;  5BYQ A;  4R3D A;  4A6Q A;  1CK1 A;  2QIL A;  2JSV X;  4P6V F;  3VRB B;  2BYT A;  4IDI A;  3VR9 B;  1YJI A;  2WS3 B;  1BML C;  4RGM A;  2W3S A;  4OHJ A;  3W2D A;  1E10 A;  3NZ3 A;  1JQ4 A;  2WU2 B;  1WXQ A;  3Q8A A;  2BB6 A;  1P7F A;  1XXG A;  3TSS A;  1VRA B;  4LK0 M;  4XDD A;  4A55 A;  2KMM A;  5H8Y E;  5AUK A;  1YNT E;  3PO0 A;  3EA6 A;  1QF6 A;  1FIQ A;  1FRR A;  5I4D A;  2AQ1 B;  4OZC A;  2WXJ A;  3AB5 A;  5AUI A;  3CF4 A;  3Q8E A;  1JWB D;  2PLP A;  5EE3 A;  4RGT A;  3MFG A;  1HA5 A;  1QOG A;  2WXO A;  2VZK D;  4H2A A;  1HXY D;  1TZO A;  1SJE D;  5BYR A;  4KGR A;  1FEH A;  2LHE A;  3IT6 B;  1J7A A;  2B76 B;  3HUI A;  2KAJ A;  4HJG E;  1P7E A;  1EWY C;  1TKG A;  2NTS A;  1F0Z A;  1UUP A;  2SAK A;  3U4E G;  4KKI A;  1PYW D;  2K22 A;  3HVZ A;  1D5Z C;  3AE2 B;  1VJK A;  5HHD G;  1GTH A;  5G5H A;  1NYQ A;  1HZ6 A;  2JYE A;  3AE7 B;  1QOA A;  3ZQ4 A;  4XWT A;  1JWA D;  2FUG 1;  3W5V B;  2LJI A;  3NRZ A;  1ZOY B;  4HRS A;  1Q10 A;  3O13 A;  4XWW A;  3AM9 A;  2J4X A;  2LGI A;  2QSD A;  2PTL A;  2RPV A;  2FBW B;  1ZXH A;  3SFD B;  1PFD A;  1L6V A;  3VQI A;  4WWM A;  3ZYY X;  2NMQ A;  2ONQ A;  1R7S A;  1JW9 D;  1QOB A;  3IAM 1;  3T3O A;  1MHH E;  1K51 A;  3HRD D;  1DOX A;  1XLO A;  2KWD A;  3NVW A;  1FNV A;  2W82 A;  1L0X B;  2VZK B;  1NI3 A;  3MHZ A;  2BW2 A;  2CU3 A;  3SR6 A;  2INP E;  1F2R C;  1JML A;  1YN3 A;  2WXI A;  2WXF A;  4YSX B;  2IPK D;  3DWG C;  2LHD A;  3IAS 1;  1A70 A;  3B2G A;  2JWU A;  4RF1 A;  2K3U A;  3AE4 B;  2EEL A;  4WH4 A;  3AE3 B;  1IGD A;  5C2T B;  4YTM B;  1ESF A;  5D7G A;  5G5G A;  4Q2J A;  4ARC A;  3VR8 B;  4NAW B;  5HI1 A;  2MJD A;  2PW9 A;  2DYM A;  5BYS A;  3ZJU A;  1B1Z A;  1N61 A;  1YN4 A;  1ZE3 D;  1IBX B;  1RFK A;  4EE2 A;  3OWE B;  2WLB A;  3ZJV A;  2JYT A;  3R8B A;  5JXV A;  1M4V A;  2WNM A;  1I4X A;  1FO4 A;  3SEB A;  3BZD B;  3TEZ A;  4YXD B;  1TY2 A;  1K52 A;  1CZP A;  2WXM A;  1MHX A;  2BS3 B;  4TSS A;  4WAF A;  1WRI A;  3AEC B;  3KWV A;  1RYJ A;  4N6E B;  2WXN A;  1UGJ A;  3U2S C;  3UI3 A;  3MP9 A;  4IOI E;  4WIP A;  1FCC C;  1KLU D;  3Q8C A;  3LB8 C;  1L5P A;  2LFI A;  1ZP0 B;  5D3D A;  1T3Q A;  4ARI A;  4US8 A;  1SE3 A;  4YTP B;  2IGG A;  4TQ0 A;  5HG2 A;  4ZOH C;  1TS4 A;  1L4Z B;  2LUM A;  3BVM A;  3U52 E;  2WDR B;  1FRD A;  3NVV A;  3AEF B;  4J3O D;  4KGT A;  4NAM A;  4RNA A;  5MPO A;  4ZYS A;  3GB1 A;  1AYF A;  4YSY B;  1FFU A;  2WXP A;  3KQ4 A;  4LLG M;  2DLB A;  3RFZ B;  2WXL A;  4TMA B;  1VLB A;  2WXG A;  5GXG B;  1TS2 A;  2J52 A;  4C80 A;  1N60 A;  4ZHO A;  2BBC A;  1UWX A;  2ZW1 A;  2WDV B;  3BII D;  1ZXI A;  4PT5 A;  1TKY A;  4DXG A;  3KWL A;  2N0S B;  2E3T A;  3AEB B;  2LMC A;  5FR3 A;  2H89 B;  4B0M A;  1DGJ A;  4L1B A;  4HRO A;  3W1S A;  1QIL A;  2BT6 A;  2K0P A;  2AQ2 B;  1VZ7 A;  1K50 A;  3CIR B;  3EUB 2;  4GDL B;  1VR9 A;  1DYQ A;  3NVY A;  1I4R A;  2ACZ B;  1JWM D;  4OZA A;  2LEK A;  4A9A A;  2PIA A;  3AE9 B;  1QOF A;  4B0E A;  3BYY B;  1F77 A;  2JXT A;  4NZL B;  1N63 A;  4KKJ A;  1OFF A;  2K5P A;  1GT8 A;  1V1O A;  1AW7 A;  1XLP A;  3LYY A;  3BK2 A;  1H7X A;  4NJC A;  2I2Y A;  2QIE B;  2OHF A;  4REZ A;  3U7Z A;  4YTN B;  2MEK A;  3IT4 B;  1D4B A;  1K53 A;  1FNU A;  3ABV B;  4TQ1 A;  4ZHP A;  2GI9 A;  3AE6 B;  3GS2 A;  4GDK B;  1V8C A;  4KGS A;  4RCO A;  1STE A;  3ZGZ A;  1H7W A;  3H8H A;  4L23 A;  1MI0 A;  3AH7 A;  2N7J A;  1JAL A;  2DYO A;  2DWQ A;  1JRP A;  2WXQ A;  3HVD A;  4JX1 C;  2W55 A;  2W54 A;  1ROE A;  1FXA A;  1XF5 L;  2WXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...