4YSXB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
b'KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 68
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ysxB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ysxB01
1CZPA 1WGKA 2PKOA 3LXFA 1JROA 4YTPB 1J7AA 3AEFB 5GXGB 3AM9A 1OFFA 3AEBB 1AWDA 3AE4B 1NVID 2WLBA 1L6UA 2DBYA 2MJEA 1XO3A 1WWTA 1EWYC 5EE1A 1DOIA 4YSXB 1ZUD2 4JWSC 1VJKA 2CJOA 1E7PB 1GTEA 2KAJA 3VRAB 4YTNB 3NVZA 3HRDD 5C3JB 1JRPA 3BIID 4JX1C 3AE8B 2DWQA 4YSZB 1YQ3B 2LEKA 4WQMA 1QOFA 4ZHPA 2WDVB 1XLPA 1YJIA 1PUTA 1N60A 2EKIA 2MJDA 5EE3A 1FXAA 3NRZA 1GAQB 3P63A 4ZHOA 5G5HA 3AE2B 4FXCA 2WDQB 1ZP0B 5C2TB 1E0ZA 2CJNA 1RFKA 4ZOHC 3AH7A 1YQ4B 3EUB2 3P4SB 1NI3A 1NYQA 1DOXA 1GTHA 1JALA 1TKGA 1V8CA 2Y5CA 1T3QA 4YXDB 1J7CA 2HTME 1NYRA 1L5PA 4ITKA 4C7ZA 2JX5A 3AE7B 5AUKA 2BS2B 1XLNA 2W3SA 4YTMB 3L4PA 1WRIA 1TKYA 2AX5A 1FM0D 3CIRB 1RM6C 1TKEA 1DGJA 3SR6A 3SFDB 1N63A 1SIJA 3P1MA 1E9MA 3VRBB 3DWMA 3AE3B 2MJ3A 4YSYB 2K9XA 2Q5WD 4YT0B 3RPFC 3AV8A 2MH7A 4HROA 1A70A 1OQRA 1PFDA 2M19A 3PO0A 4JWUC 1FO4A 1TJEA 4IDIA 1NENB 2B76B 1WYGA 1N61A 2M56B 3AEEB 5EE9A 1RWSA 1GT8A 3B2FA 1ZOYB 2KMMA 4USAA 1E6EB 3AE1B 1GPXA 4US9A 1R7SA 3B2GA 3P4RB 1TYGB 1KF6B 2QJLA 2CU3A 1QOGA 1H7XA 3AEAB 4N6EB 2QIEB 1IUEA 4LTUA 1KRHA 5G5GA 4A9AA 3NVWA 1SB3C 4P6VF 3NVYA 4N58A 2BS4B 5MPOA 1F0ZA 2OHFA 2PVOD 1FRRA 1VDVA 2H88B 2E3TA 1JWAD 1UWMA 2WS3B 2K22A 1FIQA 1SF0A 4C80A 1I7HA 1NEKB 3AN1A 3FAHA 3AB5A 3AE9B 2W55A 1XLQA 2WU2B 1ZXIA 3HVZA 5AUIA 2BS3B 1JQ4A 3NVVA 1DOYA 2WQYB 3AEDB 2WDRB 2BT6A 1AYFA 4KX6B 1B9RA 5EE0A 1QOAA 1QF6A 2G1EA 3SFEB 1YJJA 2WU5B 1WXQA 3ETRA 3NS1A 3W9CB 2N0SB 1FXIA 3ABVB 3VR9B 1VLBA 1RYJA 1XLOA 2W54A 3AECB 3B9JA 3AMZA 5H92C 2JQRB 1FRDA 1ROEA 1E10A 3AEGB 1H7WA 1QT9A 2ACZB 1KFYB 3CF4A 3LB8C 3AE6B 2L83A 1FFVA 2PVGC 3ZYYX 1JWBD 1L0VB 4WWMA 3VR8B 1N5XA 4US8A 1CJEA 1OQQA 4C7YA 3CWIA 5H8YE 1L6VA 3W5VB 1FMAD 3P4PB 1J7BA 4N59A 1N5WA 2L52A 3DWGC 3W5UB 2WP9B 3AE5B 1V97A 3P4QB 1QLBB 1PDXA 3FC4A 3KWLA 2FBWB 2H89B 2W3RA 1FFUA 1JW9D 2PIAA 2K5PA 3HUIA 3WCQA 4HRSA 1N62A 1QOBA
chains in the Genus database with same CATH superfamily
2PKOA 2NTSA 2FNJB 1P0RA 2IDYA 2MBBB 4GDKA 1ET6A 3AEFB 2BGFA 2N1VA 1SIFA 3A1QB 1FNWA 2IGHA 3UI3A 2BTEA 4OZBA 3RMKC 1V81A 2IY1B 1XCTL 1C4AA 1UELA 1JRUA 4XC2A 2PMVA 5D7GA 3IAS1 2CHZA 5AZGA 1HQRD 4JE3B 1F9JA 2M1MA 3RI7C 1C76A 4GLSC 4AWJA 2REXA 2LVPA 3ZUNA 2KXJA 1V8CA 2KDBA 4W9DA 2Q5WD 4ICVA 5BYRA 1VZ8A 3TJPA 2NBVB 1ENFA 2JSVX 3BWUD 4B6WA 1WXAA 3RNGC 4AOFA 4NQKE 1L0YB 2XK5A 5J2RA 2GBRA 4AUQC 3PRPB 2OHFA 1FRRA 1K51A 3U7DA 4ASWC 1I7HA 3AE9B 1ZXHA 1LM8B 1DOYA 5LXIB 1V86A 1JCKB 2FCQA 3GP7A 2J52A 2IO3B 1FXIA 3L08A 5AZFA 3CF4A 2O6VD 3V6EB 4WAAA 1MFWA 5C23A 3H6NA 1OQQA 4EKUA 1L6VA 1UGMA 3P4PB 2WXRA 2BYTA 2LZ6A 3KYDD 4KKJA 2MP2B 2NPTA 3L13A 2H89B 2RPVA 4GB9A 4IWPA 4CHKA 1PGAA 2KWVB 5D3DA 1WZ0A 1IYFA 1NVID 3DVGY 4HCPB 1ZPSA 2N9EB 4A6QA 5IAAC 4YSXB 4JWSC 4W9EA 2RDGA 2FAZA 5LXHA 1HTOA 3APFA 2KAJA 4AP4C 2I2YA 3GB1A 3IT6B 1C77A 2MBEA 5HI1A 2Y3AA 1TGZB 1XLPA 4FHJA 5TSSA 4TQ1A 4N9F4 3UQBA 1FD6A 2VRRB 3P42A 1NI3A 3PLVA 4LCDE 2Y5CA 4K7UA 5FK9C 4P1BC 1YNTE 4OW0A 2N9LA 3EGRA 4A55A 2KWCA 4C4VA 3LDZE 3TSSA 4Q2JA 3U2SC 1DGJA 3ZTDA 5IN7A 1QILA 4CYEA 3CSTA 3AV8A 3VTVA 1AN8A 1CK1A 3N32A 3WAOA 5HFYA 5HHDG 5EE9A 3AEEB 2XNAC 3N30A 1RWSA 3RULA 1EU4A 2WX0A 2KN4A 1XF5L 1PGBA 4A20A 4XDDA 2K3UA 3SU8X 4ANUA 1V1PA 4E74A 2YEPF 3HHMA 1F0ZA 1WGYA 3C8YA 3KLSX 3AN1A 2NTTA 2BBCA 1X1MA 4TKNA 2KHWB 2LUEA 3PZDA 4KDIC 2ZNVC 2Z59B 4NJCA 2K8HA 3AMZA 2MRPA 3M95A 3AEGB 2GMIC 1PYWD 3EC8A 2D3GA 2L1AA 1N5XA 3QIJA 4DK5A 2NS5A 2VH1A 3MHSD 3JSVA 1UUPA 5CX3A 4DQOC 1V49A 2JVCA 4MT5A 3W2DA 1UH6A 1WFYA 3QAQA 1DYQA 3UINB 5HG2A 3ECIA 5DCNA 3N1YC 1J0GA 1ZUD2 2LRUA 1JRPA 3M62B 3QHTA 4WQMA 4NJ6A 2WDVB 5G55A 1Q10A 2L8JA 1GAQB 4W9IA 1J8CA 3I3TB 3ZXRA 2YLMA 4MH8A 4OVZA 3RZWC 4MGYE 2QILA 1OTRB 4C7ZA 3APDA 3OJ4B 4WAFA 4FJZA 1HTQA 1TKEA 2ZEQA 3P2BA 1WH3A 3AE3B 2ONQA 4YT0B 1MJDA 3U4EG 4LDTD 1NENB 3OWEB 2INCC 2BB6A 2WHIA 4XYCA 1L7YA 4LTUA 2LGIA 1WJ4A 3IHPC 2VZKB 3QA8A 4TUUA 3NOBA 2QMTA 2JRHA 2DZJA 1IBXA 1TS5A 1KH0A 2Z8LA 4JL9A 1WXQA 2QEJC 3PRZA 5H92C 2JQRB 3R8BA 2DZMA 3PZ7A 5IA7A 2J42A 4M8NA 4HDQA 2ASQA 3AE6B 1JWBD 4ZRJA 3CWIA 2K25A 5GMVA 1J7BA 1Y8RC 4CO7A 4O1NA 1WSPA 5FR6A 1E8WA 3FC4A 4EZJA 3WCQA 2KKCA 3APCA 4MDKE 3RFZB 1TZ1A 3OLMD 1YQBA 2JXXA 5E6NA 1XO3A 2JYEA 4YTNB 3NVZA 3RUIB 2MBQA 4I6PA 3GS2A 1YQ3B 2CU1A 1FCLA 3DVNU 2QDFA 4M00A 5E6OA 3KUDB 1S1QB 1V5OA 5I4DA 3DPDA 1VZ6A 2G3QB 1C79A 3AI5A 3EFUA 2IPKD 2O2VB 3BVMA 4ZRIA 2INDC 3RNFC 1E8YA 1MHXA 4HPPA 2JPHA 4RF0A 2JRIB 4HKZE 1LXDA 4HKQA 4JQWC 4KKIA 3PTFC 3CSFA 1WRDB 1N61A 2IJ0A 3B2FA 4KGRA 3MC8A 2KJ6A 2AQ1B 1H7XA 1IUEA 4AS1A 4N58A 2N7EA 4BKSA 3KQ4A 3DOWA 2WXMA 1I4RA 5L95C 5D2MB 2L0TA 3SFEB 3T3NA 3VXWA 2K8CA 3SEBA 5IOIA 3UF8A 3ABVB 1HXYD 2KN5A 3AECB 3BY4B 3L54A 1E10A 2BW2A 4PS7A 3LB8C 2J4XA 2D3CA 5CHVC 2IO0B 2LGYA 1E8ZA 5H8YE 3TIXA 2HTHA 4OHJA 4HRSA 3W1YA 2I1KA 3Q8AA 2LJ5A 1ACCA 2KJRA 2HD5B 3GZNI 3R2IA 5GXGB 4WURA 4B0EA 5D3IB 2N9KA 4A8XC 3ZJVA 1EWYC 2M17A 1WX9A 3Q8CA 4LNKA 1Z2MA 5C3JB 2V4LA 2XEWA 2LEKA 2EKIA 1FNUA 3C0RB 5EE3A 1OEYA 4KSLC 3RN9C 5G5HA 1ZP0B 3JVZX 3KVFB 3EUB2 3PREA 5KHQA 1JALA 3N9YC 1TKGA 4TMAB 1CQVA 2JX5A 3L4PA 1WRIA 3DHIC 4EE2A 2AX5A 2ZW1A 1UNSA 2L3ZA 4E71A 1N63A 3VUYA 2OOBB 3P1MA 3ZXVA 3DWMA 3ZO5B 2OEDA 2V3NA 5D94A 3RYTA 1YD8U 2FIFA 3I57A 1WE7A 2KYWA 4WIPA 2W9NA 2DYOA 1M94A 2KD0A 2KX0A 4RMAA 3KH0A 2JU6X 4RCOA 2PVOD 4L2YA 2C9WB 2ON8A 1EF5A 2V3SA 1SF0A 1EF1A 3TL5A 2KWDA 3HVZA 1TZOA 2GBKA 3DCGA 2WXJA 2BPSA 3OG5A 3RNBC 1XLOA 1VLBA 1V80A 3KWVA 1WIAA 4BKSD 2ACZB 2MHJA 4G0NB 2L83A 1FFVA 3MFGA 1ZGUB 3ZGZA 4NAMA 2KQSA 1P3QU 3DWGC 3P4QB 4MGIE 4KIKA 1VCBA 1OEYJ 1ZDVA 2J0KA 4WH4A 2KC2A 3MHZA 4GDLB 4MSMB 3CF6E 2JWUA 1WWTA 4IKGA 3K9PB 1MHHE 3A9JA 3B08A 2C60A 1WR1A 3GE8C 4JIOU 1QOFA 4ANXA 4DDID 4ZHOA 2O6VB 2YEPB 4FXCA 2WDQB 3D32A 1LO5D 2MEKA 1Z5SB 1NYQA 2QCZA 4F8CB 3PV1A 1D6EC 1A5RA 1EO6A 1HEZE 3SFDB 2E6XA 2WWZA 1OQRA 4JWUC 4MJSA 2WXGA 1STEA 3NZSA 3AE1B 5BYQA 2N4FA 3ZVVA 1VR9A 3QK0A 4LNIA 3AEAB 1EUVB 2NBUA 2WXKA 1ZKHA 4DDGD 1MI0A 2QC8A 1LFDA 4GDKB 3KW5B 2K22A 1CMXB 1TS3A 3VFKA 3FAHA 5J17A 2JY6A 4K1RB 2ZZPB 2QHOA 5JHAA 3Q8BA 1B9RA 4XWWA 3DBHI 2WXNA 1WE6A 1YJJA 5TR5A 3W9CB 1JWSD 2J7QB 5BMGA 2WXQA 2RMMA 4BBNC 4MEMA 1Q1OA 1WGRA 2HJ1A 3RD2A 4REZA 4A3OA 5LNK1 2BVCA 1UGJA 4E3CA 2FUG1 4W9HA 2KFKA 1XEEA 1QLBB 3BYTB 4URKA 4PK1A 3M63B 2K6DB 1I42A 2N7DA 3DBSA 2JUOA 2KTFA 4P7IA 2IBIB 3ZLZA 2LI5A 3EFCA 4RNAA 3U52E 1JWMD 1FPYA 2L76A 2V0GA 3L0WB 2PPHA 2JZZA 3AE8B 2XK5B 4L1BA 4NAWA 4ANWA 1QQRA 1KOTA 2M0XA 4D2KA 2C7HA 3N3KB 4ARIA 2DYBA 2GB1A 2M4NA 5C2TB 3MJWA 3Q8FA 2AQ3B 4HJKA 3PRMB 3KUZA 1IGCA 4C00A 1UBIA 3RNCC 1BT0A 1R4NI 3Q3FA 3GE3C 3VTWA 4YSYB 3ZKJC 1V2YA 4HROA 1TJEA 2B76B 3MP9A 3C19A 1C4CA 4RGOS 4US9A 3T8MA 2NPTB 3DVGX 4LNOA 4DBGA 3DBLI 3GZNB 4XX5A 3SD5A 2KMCA 2W55A 1XLQA 1ZXIA 3BK1A 3PS6A 4IUMB 1TT5B 5FR3A 3V05A 4KGSA 2OJWA 1WGHA 3DVNV 4ACFA 1SJHD 2G45B 2WX1A 2GRIA 2LASA 1ROEA 3RT3B 3H7PA 1E90A 3BVGA 2GOWA 2D07B 4LDTB 1FMAD 4K81A 1N5WA 4UDUC 5EDSA 2BYVE 2KX3A 1PDXA 3O13A 2GBJA 1TS2A 2MX2A 4C4VB 1N62A 3TEZA 2ZCCA 3W1SC 3Q69A 1UF0A 2IGDA 3NUHB 4IWOA 4TQ0A 3AU5A 4XDCA 4TV3A 1H8CA 2K1FA 1D3ZA 3Q3OC 1V9JA 1VJKA 2X38A 4HVBA 1GTEA 2XBBC 4MGKE 4FJYA 1XQQA 4FADA 3ZRCA 1WJNA 2CS4A 1V1PB 3E9SA 1PUTA 2KVRA 2RPQA 4KSKC 3Q3JA 2V4IB 4LLGM 1E0ZA 1WGDA 1GTHA 1N6ZA 1SE4A 1T3QA 1IP9A 2RSUA 3PVLA 2MCNB 5BMIA 4MH0E 3KUCB 2MJ3A 2K9XA 4BFRA 4FBJB 1A70A 2TSSA 1HE8A 3IG3A 3QARA 2R2QA 2WGSA 1TYGB 3JSVB 1KRHA 2DZIA 3RCZA 1SB3C 1B1ZA 3IAM1 1WXSA 1L4ZB 1WI0A 1PQSA 1P9DU 2G4SA 1XCQL 2R61A 4LJPB 1NI2A 2RDBC 3NS1A 4EUTA 1WXMA 4BZAA 1SE2A 4WJPA 2ZW0A 3UGBB 3MJ5A 1P1AA 2ZJDA 4C7YA 4TSSA 2DAJA 3ZNHB 3A9KA 4II3B 1JW9D 1WGKA 2UYZB 3MC0B 3Q3MC 1ZE3D 2IO2B 3Q3NC 2SAKA 1GOZA 1L2NA 2J53A 1F1HA 2MJEA 2ZVNA 3X23A 4MELA 2BQQA 5EE1A 2AEHA 1E7PB 3VRAB 2BKRB 2IZVB 2JXTA 2MBOA 2DWQA 4YSZB 4FN2A 4ZHPA 3WAPA 3ZRFA 1L0XB 4DHZB 4H2AA 4GIVA 4M01A 4MGZE 1C4PA 3AH7A 4IWQA 2RDHA 2A4ZA 1IBXB 2D3BA 3DBHB 3EHVA 3HM6X 3CIRB 3ZTCA 2PLPA 4FLHA 3VRBB 4LNNA 2KDFB 2V3PA 4HLEA 1GUAB 2FCSA 2M56B 3U30A 2DHZA 3EECA 4G3XB 5C1ZA 1NDDA 4OZCA 3ALBA 4MACA 4PYUA 2WXPA 5JXVA 1YN5A 2MBHA 1VDVA 1TY0A 2D5GA 3BYYB 4AQ7A 4RGMA 5JH5C 4RH6A 4DXAB 1K53A 2WXHA 1AYFA 3Q14C 2I1JA 3PZ8A 3H8HA 2GBMA 2GI9A 3PSEB 3HVDA 2WXIA 2C7MB 3DDCB 1KFYB 2XN9C 2CR5A 1CJEA 3TEYA 1EM7A 3W5VB 1I4GA 2ZVOA 1WM3A 3TCAA 1SSNA 3TBLD 2G4DB 1WM2A 2FBWB 1D5ZC 3HUIA 1SEBD 3PHWB 4OVUA 2NBWB 4GU2A 4YTPB 1OFFA 4WWNA 3KYCD 1HA5A 3T9LA 4ZYNA 2UWQA 1DOIA 1RAXA 4LJOB 4NJ7A 2PJHA 2FCNA 3N1ZC 4W9FA 1YJIA 4EFOA 4M0WA 3NRZA 1IPGA 1OQYA 2BYEA 5DPWA 1QKZA 4G11A 3DBRI 2IYDB 3DBLB 2LUMA 4BVUC 1OGWA 5DPTA 4PS8A 2MQJA 2KTRA 4GN1A 3VH4B 3B1LX 3R7QA 2YVCA 2MSED 4ZDVA 2LXAA 4NNJB 1Q5WB 4DWFA 1YIWA 2MH7A 3W1SA 1FO4A 2M19A 2WNMA 4FULA 1AARA 1WF9A 1GB4A 2KMMA 4BAXA 2D2QA 1GPXA 3GOEA 1F52A 1C78A 1I4HA 1EWCA 4ZYSA 4PT5A 1BXTA 3O65B 2BS4B 5E6PA 3JW0X 2WS3B 1KLGD 3IFWB 4RGTA 1FIQA 3V61A 1NEKB 2Z0EB 2LGXA 1I4XA 5CTRC 4ZRQA 2WDRB 3Q8EA 3ZNZB 4EZKA 2BF8B 1SBBB 4R3DA 3VR9B 2ZNVB 2LFIA 2KQ4X 5CHFA 4WWMA 1WZ3A 2JYTA 1WMHA 1HZ6A 2BB5A 3LYYA 4OVVA 3WANA 4KZCA 1FFUA 2JT4B 5DPRA 3CMMB 3QC8B 4IG7B 1SXTA 2WLBA 1U4AA 3FKYA 1FCCC 5FKAC 1I4PA 4W9GA 2IO1B 4JLCA 4JX1C 2K0PA 2AQ2B 3NY5A 3VVWB 5G2NA 4YL8A 1MVKA 2LD9A 1TBEA 2WDTB 2LWPA 1SE3A 3L17A 1RFKA 2HTME 1L5PA 4LNFA 1ISNA 4YWGG 1UD7A 2MW5A 1SE9A 2FCMA 4AJYB 2IGGA 3ZIMA 3R66C 1T0SC 2QSDA 5D6JB 4IM3A 4XGAB 1I4QA 1PFDA 3PO0A 1TTNA 1NBFC 2WXOA 4S0RA 1R7SA 3B2GA 2CU3A 4KIKB 5L83A 4ANVA 2E3TA 2H88B 2JZ3B 3ZDTA 3H1UA 2WU2B 3ML9A 2BKFA 3A9JB 5AEKB 4RGNA 1QF6A 1IGDA 1T0YA 3ETRA 1Q0WB 2LGDA 2AL3A 2SEBD 3TEXA 1H7WA 1TY2A 1MG4A 2KK8A 1VZ7A 4US8A 2INNE 2DNFA 3I5JC 4N59A 4WWPA 4HPLB 2WP9B 3ZJUA 4F1SA 5BMHA 1QOBA 3WA0A 3VTUA 4MJSB 3M3JA 3R3MA 3LJ3A 1T0RC 2PE6B 3HRDD 2ZCBA 1E7VA 2MLBA 1K50A 4K7SA 4FA6A 2KDEB 2CJNA 1L4DB 1XXGA 3PPAA 2KT7A 4ITKA 4W9JA 2D11A 2NMQA 2D10A 2MP2A 4YTMB 1ZW7A 1VRAB 2IY0B 5KHOA 4WJQA 3MC9A 2JZPA 1VD2A 3EA6A 3WIMA 3N20C 3PT2B 2L00B 2LGSA 1WYGA 1T0QC 4NY0A 1ZOYB 4NZLB 2KFKB 4HPMB 4M8MA 2KLCA 5G5GA 3PGEA 3JYUA 4BOZB 1V6EA 2M0AA 2DLBA 3NVVA 4ZRPA 2WQYB 4KV2A 4DXGA 3AEDB 1MPEA 2FE8A 4KX6B 1F2RC 3PLUA 4I6NB 5EE0A 5BYSA 2LHEA 1ET9A 1XT9B 2DX5B 4NAWB 2K39A 3BINA 4DXFA 2CKHB 4LK0M 2LVQA 1WX8A 1QZEA 3V3XA 4P16A 3VR8B 1F2RI 4EOYA 2KDMA 4FJVB 3H9DA 5HKHA 3BVZA 3WALA 3DBRB 2KVZA 1GJZA 2DZKA 1FEHA 1E5WA 4S17A 4OZAA 1ESFA 3AE5B 1TIFA 2PTLA 4GSWA 4IW0A 3KWLA 2W3RA 4KDLB 2K5PA 4PS3A 4HCNB 4HJGE 4GGQA 2EMTA 4K3BA 2KANA 4HXDA 1J7AA 2WXFA 3ZNGC 2MWSB 3AE4B 4WWOA 1L6UA 2DBYA 2C5LC 4BOSC 3IVFA 1D5XC 3RNAC 3BK2A 2LMCA 2OJRA 4DHZE 2G9HD 2DENB 3X0WA 2AWTA 4IM0A 3P63A 2R2OA 1D5MC 3ZDMC 1UBQA 1V1OA 2N1WA 2WXLA 4YXDB 2BS2B 2FIDA 2GBNA 4KGTA 1GNUA 3SR6A 1YJ1A 2GLSA 3V60A 3H7PB 1T5XD 1SGHA 1WGGA 1K52A 2INPE 4USAA 1E6EB 5AZHA 3P4RB 1C9FA 3A4SC 1KF6B 1GC7A 5DPSA 4W9LA 4A9AA 3IXSA 4ZRKA 1UWMA 3N1XC 4C80A 3K9OB 3VDZA 4IM2A 2BT6A 2N9XA 1V5TA 2WU5B 1TS4A 2LRWA 2LXCA 5IKCM 3R2TA 1R4MI 1GC6A 4FHKA 2KOXA 1MG8A 3ZYYX 2KC1A 2KNBA 3U8ZA 4WJOA 3VH3B 2N7JA 2L52A 1XD3B 3NS8A 3WAMA 1YX5B 1CZPA 3VHTC 2HJ8A 1JROA 2NCNA 1C1YB 1H4RA 3VUWA 1AWDA 3B0AA 4EZLA 4HK2A 1YMHE 2HE7A 2JF5A 2BWES 1HZ5A 1RLFA 3U7ZA 3QQ8B 3RNEC 1N60A 2V9HA 1FNVA 2MA9B 2K8BA 5IO9A 2A5UA 3V62A 1KM7A 1S3SG 2AYOB 2N9PC 4ARCA 1DOXA 1WJUA 4C56C 1YN3A 2LVOA 4GMVA 2ZPNA 5AUKA 4RF1A 1TKYA 1UZXB 1FM0D 2V1YA 5CHWA 3L16A 1P7FA 2KACA 3HK0A 2D3AA 5LLIA 3E56A 2RR9A 2KQ7A 1GT8A 2Z0DB 2L32A 3R7RA 3A9KB 1QOGA 4N6EB 2QIEB 3TMPB 4P6VF 3NVYA 1Y56A 2NVUI 4GOCA 4QAYA 1JWAD 3NZUA 3TUOA 4A3PA 3IT4B 2KMAA 3AB5A 2L05A 1JQ4A 2O2VA 3QX1A 3IBEA 1WX7A 2Y5PA 3TEWA 4MM3A 2W82A 4J3OD 3ZNID 2W54A 3B9JA 1FRDA 1E7UA 4DHJB 2PVGC 3QCAA 3URYA 2Y5BB 5E6JA 1LGRA 2RD0A 1BMLC 3W5UB 3L10B 3V6CB 4F7ZA 4NPNA 4WQOB 4RM8A 2L7RA 2CHWA 3AM9A 4ICUA 3AEBB 1FXTB 1WY8A 4IC7B 1KLUD 1G6JA 4MM3B 4GXBA 4MSQB 2CJOA 2FUHB 4L23A 1PGXA 4WJNA 3I9V1 3BIID 4K7WA 3ZQ4A 3PHXB 2EELA 2B3AA 2CHXA 2VZKD 4CQNA 4RFBA 1FXAA 2J0MA 2KZRA 3AE2B 2X8XX 3SHQA 3ZW3A 1P98A 4ZOHC 1YQ4B 1R4NB 1J7CA 3AXCA 1XLNA 4BKTA 4J6IA 3MTNB 2LHDA 1YOVB 2PW9A 2DAFA 2LJIA 4AJWA 1ZDXA 4M02A 1JMLA 2DYMA 1RFAA 3RZFA 1KLVA 1J19A 2ICIA 5MPOA 1WYWB 2PE9A 3VUXA 3A4RA 3ZJTA 2EKEC 1C3TA 3NJTA 1KJTA 3DHGC 5AUIA 4DHJD 4KVGB 3VAWA 2KO3A 2G1EA 1K8RB 2N0SB 3SDLC 3UIOB 3HIZA 4M0WB 5JHBA 2J0JA 4W9CA 5JZEB 1BUIC 2KLGA 4X57B 2AL6A 3Q6BA 1V97A 3NG0A 2KTRB 1JWUD 2PIAA 4EEWA 2NR2A 4RM9A 3Q2AC 3ML8A 3LXFA 2L0FA 4II2B 4XE0A 2PEAA 2HDEA 3DQVA 2K6QA 1I35A 1WJ6A 2KDIA 4HEA1 3QWZB 1WR6E 1YX6B 1P7EA 2MJDA 4B95A 3J9CA 3FILA 4KZ0A 3A33B 3P4SB 2BYFA 3NZ3A 2VH2A 4K3CA 1NYRA 3AE7B 1AW7A 2RGFA 2UU7A 3BZDB 2W3SA 1YN4A 4HWIB 1SJED 1RM6C 1UWXA 1KTKA 1RRBA 1SIJA 4HDOA 3HM3A 1E9MA 4IOIE 4JPSA 2ZPYA 1R4MB 4GDLA 3RPFC 3ENEA 4XWTA 4IDIA 2JWZA 5IP4D 1WMHB 1GG3A 3NHEB 4I6LB 3AULA 3ONSA 3I63C 5T8IA 3S2AA 2QJLA 3NVWA 3FILB 2WYQA 2KJHB 4PYZA 2O6VA 4B0MA 4XZ4A 1T6BX 3QJZA 3VQIA 1WXVA 2BS3B 2BWFA 2I38A 3AU4A 3UIPB 3H7SA 2EMSA 4BBNF 2KFJA 1QOAA 1LQBA 4B9KA 1M4VA 5BO4B 3A1QA 4BKGA 1GB1A 4A90A 3DHHC 3T3OA 1F77A 1RYJA 1D4BA 5J18A 3OJ3A 3UQAA 2M8SA 1QT9A 4P1CC 1L0VB 1EU3A 2KWUB 2C7NB 4W9KA 4JGHB 3OAWA 4NQLB 4G50A 1E8XA
chains in the Genus database with same CATH topology
1WGKA 3MC0B 4HJGE 3Q8AA 1ZE3D 1ACCA 2PKOA 2NTSA 2IDYA 2SAKA 1GOZA 1J7AA 1ET6A 2J53A 3AEFB 3R2IA 2WXFA 4WURA 5GXGB 4B0EA 3AE4B 5D3IB 1L6UA 2DBYA 2MJEA 2N9KA 4A8XC 3ZJVA 1EWYC 1D5XC 5EE1A 3BK2A 1E7PB 1FNWA 2LMCA 3Q8CA 3VRAB 2G9HD 2IGHA 5C3JB 2JXTA 3UI3A 2BTEA 4OZBA 2DWQA 4YSZB 2LEKA 4ZHPA 1XCTL 1C4AA 2EKIA 1FNUA 5EE3A 3P63A 2PMVA 5D7GA 5G5HA 1L0XB 3IAS1 1ZP0B 4H2AA 1HQRD 1D5MC 4JE3B 1C4PA 1C76A 3AH7A 3EUB2 4GLSC 1V1OA 2RDHA 1JALA 3N9YC 1TKGA 1V8CA 2WXLA 4YXDB 4TMAB 1CQVA 2JX5A 1IBXB 2BS2B 3L4PA 1WRIA 4EE2A 2AX5A 2ZW1A 3CIRB 4KGTA 1UNSA 3SR6A 2PLPA 1N63A 3P1MA 3VRBB 3DWMA 2Q5WD 2OEDA 5BYRA 1T5XD 2V3PA 2V3NA 1VZ8A 1K52A 2M56B 3I57A 1ENFA 2JSVX 2INPE 3BWUD 4WIPA 4USAA 1E6EB 3P4RB 2DYOA 1C9FA 1KF6B 1L0YB 4OZCA 4A9AA 2JU6X 4MACA 3IXSA 2WXPA 4RCOA 5JXVA 1YN5A 2OHFA 2PVOD 1FRRA 1VDVA 4L2YA 1UWMA 1K51A 2ON8A 1TY0A 2D5GA 1SF0A 3BYYB 4C80A 1I7HA 4AQ7A 4RGMA 3AE9B 1ZXHA 2KWDA 3HVZA 1K53A 1TZOA 4RH6A 1DOYA 2BT6A 2WXHA 1AYFA 1JCKB 2WXJA 3GP7A 2WU5B 2J52A 3PZ8A 3H8HA 1TS4A 1FXIA 1XLOA 2GI9A 1VLBA 3HVDA 2WXIA 3KWVA 3R2TA 2ACZB 1KFYB 3CF4A 2XN9C 2L83A 1FFVA 3MFGA 3ZYYX 1CJEA 1OQQA 3TEYA 2N7JA 1EM7A 1L6VA 3W5VB 4NAMA 3P4PB 3ZGZA 1I4GA 2L52A 2WXRA 3DWGC 2BYTA 1SSNA 4KKJA 3P4QB 2FBWB 2H89B 1D5ZC 3HUIA 2RPVA 1SEBD 1CZPA 1ZDVA 1JROA 4WH4A 4YTPB 1PGAA 5D3DA 1OFFA 1AWDA 3MHZA 1NVID 1HA5A 4GDLB 2JWUA 1ZPSA 1WWTA 4IKGA 1MHHE 4A6QA 1DOIA 4YSXB 4JWSC 1YMHE 2RDGA 2KAJA 1HZ5A 3U7ZA 2I2YA 3GB1A 3IT6B 1C77A 1QOFA 5HI1A 2Y3AA 1XLPA 1YJIA 5TSSA 1N60A 4TQ1A 1FNVA 4M0WA 3NRZA 4ZHOA 2YEPB 4FXCA 2WDQB 1FD6A 1QKZA 1LO5D 3P42A 4ARCA 2MEKA 1NI3A 1NYQA 2LUMA 1DOXA 2Y5CA 4C56C 1YN3A 5FK9C 5AUKA 1YNTE 4OW0A 2N9LA 3EGRA 4A55A 1D6EC 4RF1A 1TKYA 3TSSA 1FM0D 4Q2JA 3U2SC 1DGJA 1HEZE 3SFDB 2E6XA 1P7FA 1QILA 2KACA 3AV8A 2MH7A 3E56A 3W1SA 1FO4A 1AN8A 1OQRA 1CK1A 2M19A 2WNMA 4JWUC 5HFYA 5HHDG 5EE9A 2WXGA 3AEEB 2XNAC 1RWSA 1GT8A 1STEA 1GB4A 1EU4A 2KMMA 2L32A 3AE1B 1GPXA 5BYQA 2KN4A 1C78A 1I4HA 1EWCA 1PGBA 1XF5L 4ZYSA 1VR9A 1QOGA 4PT5A 4XDDA 3AEAB 2K3UA 4N6EB 2QIEB 1BXTA 2WXKA 4P6VF 3NVYA 1Y56A 2BS4B 1V1PA 2YEPF 1F0ZA 1MI0A 1JWAD 3C8YA 4GDKB 3TUOA 2WS3B 1KLGD 3KLSX 4RGTA 2K22A 1FIQA 1TS3A 3IT4B 1NEKB 2NTTA 3AN1A 3FAHA 2BBCA 3AB5A 1JQ4A 1I4XA 4ZRQA 2WDRB 2Y5PA 3Q8BA 1B9RA 3Q8EA 3TEWA 4XWWA 2WXNA 2W82A 4J3OD 1YJJA 1SBBB 3W9CB 4R3DA 3VR9B 2W54A 1JWSD 3B9JA 2LFIA 3AMZA 4NJCA 2WXQA 5BMGA 2KQ4X 1FRDA 3AEGB 2RMMA 1PYWD 2PVGC 4REZA 3URYA 2L1AA 1N5XA 4WWMA 5E6JA 5LNK1 1UGJA 2JYTA 1HZ6A 2BB5A 2FUG1 3LYYA 1BMLC 1UUPA 3W5UB 1XEEA 1QLBB 3BYTB 1FFUA 4DQOC 4MT5A 3W2DA 1DYQA 3AM9A 3AEBB 1SXTA 2WLBA 5HG2A 1KLUD 1FCCC 4RNAA 4MM3B 5FKAC 3U52E 1I4PA 1JWMD 1ZUD2 2CJOA 2V0GA 4L23A 1PGXA 3I9V1 1JRPA 3BIID 4JX1C 3ZQ4A 2K0PA 3AE8B 2AQ2B 2EELA 4L1BA 1QQRA 4WQMA 1MVKA 2WDVB 2VZKD 4CQNA 4RFBA 1FXAA 1Q10A 4D2KA 1GAQB 1SE3A 4ARIA 2GB1A 3AE2B 4MH8A 5C2TB 4OVZA 1RFKA 4ZOHC 1YQ4B 3Q8FA 2AQ3B 2QILA 1J7CA 2HTME 4C7ZA 1L5PA 1XLNA 1IGCA 4YWGG 4WAFA 2LHDA 1TKEA 2IGGA 2PW9A 2QSDA 3AE3B 2LJIA 1I4QA 2ONQA 4YSYB 4YT0B 4HROA 1PFDA 1ZDXA 3PO0A 3U4EG 1TJEA 1NENB 2B76B 2WXOA 3OWEB 3MP9A 1JMLA 2DYMA 1C4CA 4RGOS 2BB6A 4US9A 1R7SA 3B2GA 2CU3A 4LTUA 2LGIA 2ICIA 5MPOA 2VZKB 2E3TA 2H88B 3ZJTA 2W55A 1XLQA 2WU2B 1ZXIA 2QMTA 3BK1A 5AUIA 5FR3A 3V05A 1IBXA 4RGNA 1TS5A 1KH0A 4KGSA 1IGDA 2Z8LA 1QF6A 2G1EA 1SJHD 1WXQA 3ETRA 2QEJC 2N0SB 2GRIA 5H92C 2JQRB 3R8BA 1ROEA 3PZ7A 2SEBD 3TEXA 1H7WA 1TY2A 2J42A 3AE6B 3BVGA 1JWBD 1BUIC 1VZ7A 4US8A 2INNE 3CWIA 1FMAD 1J7BA 4N59A 1N5WA 4O1NA 1WSPA 4UDUC 2WP9B 1V97A 3ZJUA 1PDXA 3O13A 3FC4A 1JWUD 3WCQA 1TS2A 2PIAA 1N62A 5BMHA 1QOBA 3TEZA 3LXFA 3Q69A 2IGDA 3RFZB 3NUHB 4XE0A 4TQ0A 2HDEA 4XDCA 1XO3A 1VJKA 2X38A 1GTEA 2JYEA 4YTNB 3NVZA 4HEA1 3HRDD 3GS2A 1YQ3B 1FCLA 1P7EA 1V1PB 3E9SA 1PUTA 2MJDA 5I4DA 3J9CA 3FILA 1K50A 1VZ6A 2V4IB 4LLGM 1C79A 1E0ZA 2CJNA 2IPKD 1L4DB 3P4SB 3BVMA 1XXGA 3NZ3A 1GTHA 1SE4A 1T3QA 4ITKA 1NYRA 3AE7B 1AW7A 3BZDB 2NMQA 2W3SA 4YTMB 1YN4A 1MHXA 1SJED 1VRAB 1RM6C 1UWXA 4RF0A 1KTKA 4HKZE 1SIJA 5BMIA 1E9MA 4HKQA 4IOIE 4JPSA 4KKIA 2MJ3A 2K9XA 3RPFC 2JZPA 3EA6A 1A70A 4XWTA 2TSSA 4IDIA 1WYGA 1N61A 2IJ0A 3B2FA 1ZOYB 4KGRA 4NZLB 1TYGB 5T8IA 2QJLA 2AQ1B 1H7XA 1IUEA 5G5GA 1KRHA 3NVWA 1SB3C 4AS1A 3FILB 4N58A 1B1ZA 3IAM1 3KQ4A 2WXMA 4B0MA 1T6BX 2M0AA 1L4ZB 3VQIA 2DLBA 2BS3B 2I38A 3NVVA 4ZRPA 2WQYB 1XCQL 3AEDB 2R61A 1MPEA 2FE8A 4DXGA 1I4RA 4KX6B 1F2RC 5EE0A 1QOAA 5BYSA 1M4VA 3SFEB 1GB1A 4A90A 2LHEA 3T3NA 3NS1A 3SEBA 3T3OA 1ET9A 3ABVB 1HXYD 1F77A 1RYJA 4NAWB 1D4BA 3AECB 4DXFA 4LK0M 1E10A 2BW2A 1SE2A 1QT9A 3LB8C 2ZW0A 2J4XA 3V3XA 3MJ5A 1L0VB 4P16A 3VR8B 1F2RI 1EU3A 4C7YA 2KDMA 4TSSA 5H8YE 3BVZA 1FEHA 4OZAA 4OHJA 1ESFA 3AE5B 2PTLA 3KWLA 2W3RA 1JW9D 2K5PA 4HRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CZP A;  1WGK A;  2PKO A;  3LXF A;  1JRO A;  4YTP B;  1J7A A;  3AEF B;  5GXG B;  3AM9 A;  1OFF A;  3AEB B;  1AWD A;  3AE4 B;  1NVI D;  2WLB A;  1L6U A;  2DBY A;  2MJE A;  1XO3 A;  1WWT A;  1EWY C;  5EE1 A;  1DOI A;  4YSX B;  1ZUD 2;  4JWS C;  1VJK A;  2CJO A;  1E7P B;  1GTE A;  2KAJ A;  3VRA B;  4YTN B;  3NVZ A;  3HRD D;  5C3J B;  1JRP A;  3BII D;  4JX1 C;  3AE8 B;  2DWQ A;  4YSZ B;  1YQ3 B;  2LEK A;  4WQM A;  1QOF A;  4ZHP A;  2WDV B;  1XLP A;  1YJI A;  1PUT A;  1N60 A;  2EKI A;  2MJD A;  5EE3 A;  1FXA A;  3NRZ A;  1GAQ B;  3P63 A;  4ZHO A;  5G5H A;  3AE2 B;  4FXC A;  2WDQ B;  1ZP0 B;  5C2T B;  1E0Z A;  2CJN A;  1RFK A;  4ZOH C;  3AH7 A;  1YQ4 B;  3EUB 2;  3P4S B;  1NI3 A;  1NYQ A;  1DOX A;  1GTH A;  1JAL A;  1TKG A;  1V8C A;  2Y5C A;  1T3Q A;  4YXD B;  1J7C A;  2HTM E;  1NYR A;  1L5P A;  4ITK A;  4C7Z A;  2JX5 A;  3AE7 B;  5AUK A;  2BS2 B;  1XLN A;  2W3S A;  4YTM B;  3L4P A;  1WRI A;  1TKY A;  2AX5 A;  1FM0 D;  3CIR B;  1RM6 C;  1TKE A;  1DGJ A;  3SR6 A;  3SFD B;  1N63 A;  1SIJ A;  3P1M A;  1E9M A;  3VRB B;  3DWM A;  3AE3 B;  2MJ3 A;  4YSY B;  2K9X A;  2Q5W D;  4YT0 B;  3RPF C;  3AV8 A;  2MH7 A;  4HRO A;  1A70 A;  1OQR A;  1PFD A;  2M19 A;  3PO0 A;  4JWU C;  1FO4 A;  1TJE A;  4IDI A;  1NEN B;  2B76 B;  1WYG A;  1N61 A;  2M56 B;  3AEE B;  5EE9 A;  1RWS A;  1GT8 A;  3B2F A;  1ZOY B;  2KMM A;  4USA A;  1E6E B;  3AE1 B;  1GPX A;  4US9 A;  1R7S A;  3B2G A;  3P4R B;  1TYG B;  1KF6 B;  2QJL A;  2CU3 A;  1QOG A;  1H7X A;  3AEA B;  4N6E B;  2QIE B;  1IUE A;  4LTU A;  1KRH A;  5G5G A;  4A9A A;  3NVW A;  1SB3 C;  4P6V F;  3NVY A;  4N58 A;  2BS4 B;  5MPO A;  1F0Z A;  2OHF A;  2PVO D;  1FRR A;  1VDV A;  2H88 B;  2E3T A;  1JWA D;  1UWM A;  2WS3 B;  2K22 A;  1FIQ A;  1SF0 A;  4C80 A;  1I7H A;  1NEK B;  3AN1 A;  3FAH A;  3AB5 A;  3AE9 B;  2W55 A;  1XLQ A;  2WU2 B;  1ZXI A;  3HVZ A;  5AUI A;  2BS3 B;  1JQ4 A;  3NVV A;  1DOY A;  2WQY B;  3AED B;  2WDR B;  2BT6 A;  1AYF A;  4KX6 B;  1B9R A;  5EE0 A;  1QOA A;  1QF6 A;  2G1E A;  3SFE B;  1YJJ A;  2WU5 B;  1WXQ A;  3ETR A;  3NS1 A;  3W9C B;  2N0S B;  1FXI A;  3ABV B;  3VR9 B;  1VLB A;  1RYJ A;  1XLO A;  2W54 A;  3AEC B;  3B9J A;  3AMZ A;  5H92 C;  2JQR B;  1FRD A;  1ROE A;  1E10 A;  3AEG B;  1H7W A;  1QT9 A;  2ACZ B;  1KFY B;  3CF4 A;  3LB8 C;  3AE6 B;  2L83 A;  1FFV A;  2PVG C;  3ZYY X;  1JWB D;  1L0V B;  4WWM A;  3VR8 B;  1N5X A;  4US8 A;  1CJE A;  1OQQ A;  4C7Y A;  3CWI A;  5H8Y E;  1L6V A;  3W5V B;  1FMA D;  3P4P B;  1J7B A;  4N59 A;  1N5W A;  2L52 A;  3DWG C;  3W5U B;  2WP9 B;  3AE5 B;  1V97 A;  3P4Q B;  1QLB B;  1PDX A;  3FC4 A;  3KWL A;  2FBW B;  2H89 B;  2W3R A;  1FFU A;  1JW9 D;  2PIA A;  2K5P A;  3HUI A;  3WCQ A;  4HRS A;  1N62 A;  1QOB A; 
#chains in the Genus database with same CATH topology
 2PKO A;  2NTS A;  2FNJ B;  1P0R A;  2IDY A;  2MBB B;  4GDK A;  1ET6 A;  3AEF B;  2BGF A;  2N1V A;  1SIF A;  3A1Q B;  1FNW A;  2IGH A;  3UI3 A;  2BTE A;  4OZB A;  3RMK C;  1V81 A;  2IY1 B;  1XCT L;  1C4A A;  1UEL A;  1JRU A;  4XC2 A;  2PMV A;  5D7G A;  3IAS 1;  2CHZ A;  5AZG A;  1HQR D;  4JE3 B;  1F9J A;  2M1M A;  3RI7 C;  1C76 A;  4GLS C;  4AWJ A;  2REX A;  2LVP A;  3ZUN A;  2KXJ A;  1V8C A;  2KDB A;  4W9D A;  2Q5W D;  4ICV A;  5BYR A;  1VZ8 A;  3TJP A;  2NBV B;  1ENF A;  2JSV X;  3BWU D;  4B6W A;  1WXA A;  3RNG C;  4AOF A;  4NQK E;  1L0Y B;  2XK5 A;  5J2R A;  2GBR A;  4AUQ C;  3PRP B;  2OHF A;  1FRR A;  1K51 A;  3U7D A;  4ASW C;  1I7H A;  3AE9 B;  1ZXH A;  1LM8 B;  1DOY A;  5LXI B;  1V86 A;  1JCK B;  2FCQ A;  3GP7 A;  2J52 A;  2IO3 B;  1FXI A;  3L08 A;  5AZF A;  3CF4 A;  2O6V D;  3V6E B;  4WAA A;  1MFW A;  5C23 A;  3H6N A;  1OQQ A;  4EKU A;  1L6V A;  1UGM A;  3P4P B;  2WXR A;  2BYT A;  2LZ6 A;  3KYD D;  4KKJ A;  2MP2 B;  2NPT A;  3L13 A;  2H89 B;  2RPV A;  4GB9 A;  4IWP A;  4CHK A;  1PGA A;  2KWV B;  5D3D A;  1WZ0 A;  1IYF A;  1NVI D;  3DVG Y;  4HCP B;  1ZPS A;  2N9E B;  4A6Q A;  5IAA C;  4YSX B;  4JWS C;  4W9E A;  2RDG A;  2FAZ A;  5LXH A;  1HTO A;  3APF A;  2KAJ A;  4AP4 C;  2I2Y A;  3GB1 A;  3IT6 B;  1C77 A;  2MBE A;  5HI1 A;  2Y3A A;  1TGZ B;  1XLP A;  4FHJ A;  5TSS A;  4TQ1 A;  4N9F 4;  3UQB A;  1FD6 A;  2VRR B;  3P42 A;  1NI3 A;  3PLV A;  4LCD E;  2Y5C A;  4K7U A;  5FK9 C;  4P1B C;  1YNT E;  4OW0 A;  2N9L A;  3EGR A;  4A55 A;  2KWC A;  4C4V A;  3LDZ E;  3TSS A;  4Q2J A;  3U2S C;  1DGJ A;  3ZTD A;  5IN7 A;  1QIL A;  4CYE A;  3CST A;  3AV8 A;  3VTV A;  1AN8 A;  1CK1 A;  3N32 A;  3WAO A;  5HFY A;  5HHD G;  5EE9 A;  3AEE B;  2XNA C;  3N30 A;  1RWS A;  3RUL A;  1EU4 A;  2WX0 A;  2KN4 A;  1XF5 L;  1PGB A;  4A20 A;  4XDD A;  2K3U A;  3SU8 X;  4ANU A;  1V1P A;  4E74 A;  2YEP F;  3HHM A;  1F0Z A;  1WGY A;  3C8Y A;  3KLS X;  3AN1 A;  2NTT A;  2BBC A;  1X1M A;  4TKN A;  2KHW B;  2LUE A;  3PZD A;  4KDI C;  2ZNV C;  2Z59 B;  4NJC A;  2K8H A;  3AMZ A;  2MRP A;  3M95 A;  3AEG B;  2GMI C;  1PYW D;  3EC8 A;  2D3G A;  2L1A A;  1N5X A;  3QIJ A;  4DK5 A;  2NS5 A;  2VH1 A;  3MHS D;  3JSV A;  1UUP A;  5CX3 A;  4DQO C;  1V49 A;  2JVC A;  4MT5 A;  3W2D A;  1UH6 A;  1WFY A;  3QAQ A;  1DYQ A;  3UIN B;  5HG2 A;  3ECI A;  5DCN A;  3N1Y C;  1J0G A;  1ZUD 2;  2LRU A;  1JRP A;  3M62 B;  3QHT A;  4WQM A;  4NJ6 A;  2WDV B;  5G55 A;  1Q10 A;  2L8J A;  1GAQ B;  4W9I A;  1J8C A;  3I3T B;  3ZXR A;  2YLM A;  4MH8 A;  4OVZ A;  3RZW C;  4MGY E;  2QIL A;  1OTR B;  4C7Z A;  3APD A;  3OJ4 B;  4WAF A;  4FJZ A;  1HTQ A;  1TKE A;  2ZEQ A;  3P2B A;  1WH3 A;  3AE3 B;  2ONQ A;  4YT0 B;  1MJD A;  3U4E G;  4LDT D;  1NEN B;  3OWE B;  2INC C;  2BB6 A;  2WHI A;  4XYC A;  1L7Y A;  4LTU A;  2LGI A;  1WJ4 A;  3IHP C;  2VZK B;  3QA8 A;  4TUU A;  3NOB A;  2QMT A;  2JRH A;  2DZJ A;  1IBX A;  1TS5 A;  1KH0 A;  2Z8L A;  4JL9 A;  1WXQ A;  2QEJ C;  3PRZ A;  5H92 C;  2JQR B;  3R8B A;  2DZM A;  3PZ7 A;  5IA7 A;  2J42 A;  4M8N A;  4HDQ A;  2ASQ A;  3AE6 B;  1JWB D;  4ZRJ A;  3CWI A;  2K25 A;  5GMV A;  1J7B A;  1Y8R C;  4CO7 A;  4O1N A;  1WSP A;  5FR6 A;  1E8W A;  3FC4 A;  4EZJ A;  3WCQ A;  2KKC A;  3APC A;  4MDK E;  3RFZ B;  1TZ1 A;  3OLM D;  1YQB A;  2JXX A;  5E6N A;  1XO3 A;  2JYE A;  4YTN B;  3NVZ A;  3RUI B;  2MBQ A;  4I6P A;  3GS2 A;  1YQ3 B;  2CU1 A;  1FCL A;  3DVN U;  2QDF A;  4M00 A;  5E6O A;  3KUD B;  1S1Q B;  1V5O A;  5I4D A;  3DPD A;  1VZ6 A;  2G3Q B;  1C79 A;  3AI5 A;  3EFU A;  2IPK D;  2O2V B;  3BVM A;  4ZRI A;  2IND C;  3RNF C;  1E8Y A;  1MHX A;  4HPP A;  2JPH A;  4RF0 A;  2JRI B;  4HKZ E;  1LXD A;  4HKQ A;  4JQW C;  4KKI A;  3PTF C;  3CSF A;  1WRD B;  1N61 A;  2IJ0 A;  3B2F A;  4KGR A;  3MC8 A;  2KJ6 A;  2AQ1 B;  1H7X A;  1IUE A;  4AS1 A;  4N58 A;  2N7E A;  4BKS A;  3KQ4 A;  3DOW A;  2WXM A;  1I4R A;  5L95 C;  5D2M B;  2L0T A;  3SFE B;  3T3N A;  3VXW A;  2K8C A;  3SEB A;  5IOI A;  3UF8 A;  3ABV B;  1HXY D;  2KN5 A;  3AEC B;  3BY4 B;  3L54 A;  1E10 A;  2BW2 A;  4PS7 A;  3LB8 C;  2J4X A;  2D3C A;  5CHV C;  2IO0 B;  2LGY A;  1E8Z A;  5H8Y E;  3TIX A;  2HTH A;  4OHJ A;  4HRS A;  3W1Y A;  2I1K A;  3Q8A A;  2LJ5 A;  1ACC A;  2KJR A;  2HD5 B;  3GZN I;  3R2I A;  5GXG B;  4WUR A;  4B0E A;  5D3I B;  2N9K A;  4A8X C;  3ZJV A;  1EWY C;  2M17 A;  1WX9 A;  3Q8C A;  4LNK A;  1Z2M A;  5C3J B;  2V4L A;  2XEW A;  2LEK A;  2EKI A;  1FNU A;  3C0R B;  5EE3 A;  1OEY A;  4KSL C;  3RN9 C;  5G5H A;  1ZP0 B;  3JVZ X;  3KVF B;  3EUB 2;  3PRE A;  5KHQ A;  1JAL A;  3N9Y C;  1TKG A;  4TMA B;  1CQV A;  2JX5 A;  3L4P A;  1WRI A;  3DHI C;  4EE2 A;  2AX5 A;  2ZW1 A;  1UNS A;  2L3Z A;  4E71 A;  1N63 A;  3VUY A;  2OOB B;  3P1M A;  3ZXV A;  3DWM A;  3ZO5 B;  2OED A;  2V3N A;  5D94 A;  3RYT A;  1YD8 U;  2FIF A;  3I57 A;  1WE7 A;  2KYW A;  4WIP A;  2W9N A;  2DYO A;  1M94 A;  2KD0 A;  2KX0 A;  4RMA A;  3KH0 A;  2JU6 X;  4RCO A;  2PVO D;  4L2Y A;  2C9W B;  2ON8 A;  1EF5 A;  2V3S A;  1SF0 A;  1EF1 A;  3TL5 A;  2KWD A;  3HVZ A;  1TZO A;  2GBK A;  3DCG A;  2WXJ A;  2BPS A;  3OG5 A;  3RNB C;  1XLO A;  1VLB A;  1V80 A;  3KWV A;  1WIA A;  4BKS D;  2ACZ B;  2MHJ A;  4G0N B;  2L83 A;  1FFV A;  3MFG A;  1ZGU B;  3ZGZ A;  4NAM A;  2KQS A;  1P3Q U;  3DWG C;  3P4Q B;  4MGI E;  4KIK A;  1VCB A;  1OEY J;  1ZDV A;  2J0K A;  4WH4 A;  2KC2 A;  3MHZ A;  4GDL B;  4MSM B;  3CF6 E;  2JWU A;  1WWT A;  4IKG A;  3K9P B;  1MHH E;  3A9J A;  3B08 A;  2C60 A;  1WR1 A;  3GE8 C;  4JIO U;  1QOF A;  4ANX A;  4DDI D;  4ZHO A;  2O6V B;  2YEP B;  4FXC A;  2WDQ B;  3D32 A;  1LO5 D;  2MEK A;  1Z5S B;  1NYQ A;  2QCZ A;  4F8C B;  3PV1 A;  1D6E C;  1A5R A;  1EO6 A;  1HEZ E;  3SFD B;  2E6X A;  2WWZ A;  1OQR A;  4JWU C;  4MJS A;  2WXG A;  1STE A;  3NZS A;  3AE1 B;  5BYQ A;  2N4F A;  3ZVV A;  1VR9 A;  3QK0 A;  4LNI A;  3AEA B;  1EUV B;  2NBU A;  2WXK A;  1ZKH A;  4DDG D;  1MI0 A;  2QC8 A;  1LFD A;  4GDK B;  3KW5 B;  2K22 A;  1CMX B;  1TS3 A;  3VFK A;  3FAH A;  5J17 A;  2JY6 A;  4K1R B;  2ZZP B;  2QHO A;  5JHA A;  3Q8B A;  1B9R A;  4XWW A;  3DBH I;  2WXN A;  1WE6 A;  1YJJ A;  5TR5 A;  3W9C B;  1JWS D;  2J7Q B;  5BMG A;  2WXQ A;  2RMM A;  4BBN C;  4MEM A;  1Q1O A;  1WGR A;  2HJ1 A;  3RD2 A;  4REZ A;  4A3O A;  5LNK 1;  2BVC A;  1UGJ A;  4E3C A;  2FUG 1;  4W9H A;  2KFK A;  1XEE A;  1QLB B;  3BYT B;  4URK A;  4PK1 A;  3M63 B;  2K6D B;  1I42 A;  2N7D A;  3DBS A;  2JUO A;  2KTF A;  4P7I A;  2IBI B;  3ZLZ A;  2LI5 A;  3EFC A;  4RNA A;  3U52 E;  1JWM D;  1FPY A;  2L76 A;  2V0G A;  3L0W B;  2PPH A;  2JZZ A;  3AE8 B;  2XK5 B;  4L1B A;  4NAW A;  4ANW A;  1QQR A;  1KOT A;  2M0X A;  4D2K A;  2C7H A;  3N3K B;  4ARI A;  2DYB A;  2GB1 A;  2M4N A;  5C2T B;  3MJW A;  3Q8F A;  2AQ3 B;  4HJK A;  3PRM B;  3KUZ A;  1IGC A;  4C00 A;  1UBI A;  3RNC C;  1BT0 A;  1R4N I;  3Q3F A;  3GE3 C;  3VTW A;  4YSY B;  3ZKJ C;  1V2Y A;  4HRO A;  1TJE A;  2B76 B;  3MP9 A;  3C19 A;  1C4C A;  4RGO S;  4US9 A;  3T8M A;  2NPT B;  3DVG X;  4LNO A;  4DBG A;  3DBL I;  3GZN B;  4XX5 A;  3SD5 A;  2KMC A;  2W55 A;  1XLQ A;  1ZXI A;  3BK1 A;  3PS6 A;  4IUM B;  1TT5 B;  5FR3 A;  3V05 A;  4KGS A;  2OJW A;  1WGH A;  3DVN V;  4ACF A;  1SJH D;  2G45 B;  2WX1 A;  2GRI A;  2LAS A;  1ROE A;  3RT3 B;  3H7P A;  1E90 A;  3BVG A;  2GOW A;  2D07 B;  4LDT B;  1FMA D;  4K81 A;  1N5W A;  4UDU C;  5EDS A;  2BYV E;  2KX3 A;  1PDX A;  3O13 A;  2GBJ A;  1TS2 A;  2MX2 A;  4C4V B;  1N62 A;  3TEZ A;  2ZCC A;  3W1S C;  3Q69 A;  1UF0 A;  2IGD A;  3NUH B;  4IWO A;  4TQ0 A;  3AU5 A;  4XDC A;  4TV3 A;  1H8C A;  2K1F A;  1D3Z A;  3Q3O C;  1V9J A;  1VJK A;  2X38 A;  4HVB A;  1GTE A;  2XBB C;  4MGK E;  4FJY A;  1XQQ A;  4FAD A;  3ZRC A;  1WJN A;  2CS4 A;  1V1P B;  3E9S A;  1PUT A;  2KVR A;  2RPQ A;  4KSK C;  3Q3J A;  2V4I B;  4LLG M;  1E0Z A;  1WGD A;  1GTH A;  1N6Z A;  1SE4 A;  1T3Q A;  1IP9 A;  2RSU A;  3PVL A;  2MCN B;  5BMI A;  4MH0 E;  3KUC B;  2MJ3 A;  2K9X A;  4BFR A;  4FBJ B;  1A70 A;  2TSS A;  1HE8 A;  3IG3 A;  3QAR A;  2R2Q A;  2WGS A;  1TYG B;  3JSV B;  1KRH A;  2DZI A;  3RCZ A;  1SB3 C;  1B1Z A;  3IAM 1;  1WXS A;  1L4Z B;  1WI0 A;  1PQS A;  1P9D U;  2G4S A;  1XCQ L;  2R61 A;  4LJP B;  1NI2 A;  2RDB C;  3NS1 A;  4EUT A;  1WXM A;  4BZA A;  1SE2 A;  4WJP A;  2ZW0 A;  3UGB B;  3MJ5 A;  1P1A A;  2ZJD A;  4C7Y A;  4TSS A;  2DAJ A;  3ZNH B;  3A9K A;  4II3 B;  1JW9 D;  1WGK A;  2UYZ B;  3MC0 B;  3Q3M C;  1ZE3 D;  2IO2 B;  3Q3N C;  2SAK A;  1GOZ A;  1L2N A;  2J53 A;  1F1H A;  2MJE A;  2ZVN A;  3X23 A;  4MEL A;  2BQQ A;  5EE1 A;  2AEH A;  1E7P B;  3VRA B;  2BKR B;  2IZV B;  2JXT A;  2MBO A;  2DWQ A;  4YSZ B;  4FN2 A;  4ZHP A;  3WAP A;  3ZRF A;  1L0X B;  4DHZ B;  4H2A A;  4GIV A;  4M01 A;  4MGZ E;  1C4P A;  3AH7 A;  4IWQ A;  2RDH A;  2A4Z A;  1IBX B;  2D3B A;  3DBH B;  3EHV A;  3HM6 X;  3CIR B;  3ZTC A;  2PLP A;  4FLH A;  3VRB B;  4LNN A;  2KDF B;  2V3P A;  4HLE A;  1GUA B;  2FCS A;  2M56 B;  3U30 A;  2DHZ A;  3EEC A;  4G3X B;  5C1Z A;  1NDD A;  4OZC A;  3ALB A;  4MAC A;  4PYU A;  2WXP A;  5JXV A;  1YN5 A;  2MBH A;  1VDV A;  1TY0 A;  2D5G A;  3BYY B;  4AQ7 A;  4RGM A;  5JH5 C;  4RH6 A;  4DXA B;  1K53 A;  2WXH A;  1AYF A;  3Q14 C;  2I1J A;  3PZ8 A;  3H8H A;  2GBM A;  2GI9 A;  3PSE B;  3HVD A;  2WXI A;  2C7M B;  3DDC B;  1KFY B;  2XN9 C;  2CR5 A;  1CJE A;  3TEY A;  1EM7 A;  3W5V B;  1I4G A;  2ZVO A;  1WM3 A;  3TCA A;  1SSN A;  3TBL D;  2G4D B;  1WM2 A;  2FBW B;  1D5Z C;  3HUI A;  1SEB D;  3PHW B;  4OVU A;  2NBW B;  4GU2 A;  4YTP B;  1OFF A;  4WWN A;  3KYC D;  1HA5 A;  3T9L A;  4ZYN A;  2UWQ A;  1DOI A;  1RAX A;  4LJO B;  4NJ7 A;  2PJH A;  2FCN A;  3N1Z C;  4W9F A;  1YJI A;  4EFO A;  4M0W A;  3NRZ A;  1IPG A;  1OQY A;  2BYE A;  5DPW A;  1QKZ A;  4G11 A;  3DBR I;  2IYD B;  3DBL B;  2LUM A;  4BVU C;  1OGW A;  5DPT A;  4PS8 A;  2MQJ A;  2KTR A;  4GN1 A;  3VH4 B;  3B1L X;  3R7Q A;  2YVC A;  2MSE D;  4ZDV A;  2LXA A;  4NNJ B;  1Q5W B;  4DWF A;  1YIW A;  2MH7 A;  3W1S A;  1FO4 A;  2M19 A;  2WNM A;  4FUL A;  1AAR A;  1WF9 A;  1GB4 A;  2KMM A;  4BAX A;  2D2Q A;  1GPX A;  3GOE A;  1F52 A;  1C78 A;  1I4H A;  1EWC A;  4ZYS A;  4PT5 A;  1BXT A;  3O65 B;  2BS4 B;  5E6P A;  3JW0 X;  2WS3 B;  1KLG D;  3IFW B;  4RGT A;  1FIQ A;  3V61 A;  1NEK B;  2Z0E B;  2LGX A;  1I4X A;  5CTR C;  4ZRQ A;  2WDR B;  3Q8E A;  3ZNZ B;  4EZK A;  2BF8 B;  1SBB B;  4R3D A;  3VR9 B;  2ZNV B;  2LFI A;  2KQ4 X;  5CHF A;  4WWM A;  1WZ3 A;  2JYT A;  1WMH A;  1HZ6 A;  2BB5 A;  3LYY A;  4OVV A;  3WAN A;  4KZC A;  1FFU A;  2JT4 B;  5DPR A;  3CMM B;  3QC8 B;  4IG7 B;  1SXT A;  2WLB A;  1U4A A;  3FKY A;  1FCC C;  5FKA C;  1I4P A;  4W9G A;  2IO1 B;  4JLC A;  4JX1 C;  2K0P A;  2AQ2 B;  3NY5 A;  3VVW B;  5G2N A;  4YL8 A;  1MVK A;  2LD9 A;  1TBE A;  2WDT B;  2LWP A;  1SE3 A;  3L17 A;  1RFK A;  2HTM E;  1L5P A;  4LNF A;  1ISN A;  4YWG G;  1UD7 A;  2MW5 A;  1SE9 A;  2FCM A;  4AJY B;  2IGG A;  3ZIM A;  3R66 C;  1T0S C;  2QSD A;  5D6J B;  4IM3 A;  4XGA B;  1I4Q A;  1PFD A;  3PO0 A;  1TTN A;  1NBF C;  2WXO A;  4S0R A;  1R7S A;  3B2G A;  2CU3 A;  4KIK B;  5L83 A;  4ANV A;  2E3T A;  2H88 B;  2JZ3 B;  3ZDT A;  3H1U A;  2WU2 B;  3ML9 A;  2BKF A;  3A9J B;  5AEK B;  4RGN A;  1QF6 A;  1IGD A;  1T0Y A;  3ETR A;  1Q0W B;  2LGD A;  2AL3 A;  2SEB D;  3TEX A;  1H7W A;  1TY2 A;  1MG4 A;  2KK8 A;  1VZ7 A;  4US8 A;  2INN E;  2DNF A;  3I5J C;  4N59 A;  4WWP A;  4HPL B;  2WP9 B;  3ZJU A;  4F1S A;  5BMH A;  1QOB A;  3WA0 A;  3VTU A;  4MJS B;  3M3J A;  3R3M A;  3LJ3 A;  1T0R C;  2PE6 B;  3HRD D;  2ZCB A;  1E7V A;  2MLB A;  1K50 A;  4K7S A;  4FA6 A;  2KDE B;  2CJN A;  1L4D B;  1XXG A;  3PPA A;  2KT7 A;  4ITK A;  4W9J A;  2D11 A;  2NMQ A;  2D10 A;  2MP2 A;  4YTM B;  1ZW7 A;  1VRA B;  2IY0 B;  5KHO A;  4WJQ A;  3MC9 A;  2JZP A;  1VD2 A;  3EA6 A;  3WIM A;  3N20 C;  3PT2 B;  2L00 B;  2LGS A;  1WYG A;  1T0Q C;  4NY0 A;  1ZOY B;  4NZL B;  2KFK B;  4HPM B;  4M8M A;  2KLC A;  5G5G A;  3PGE A;  3JYU A;  4BOZ B;  1V6E A;  2M0A A;  2DLB A;  3NVV A;  4ZRP A;  2WQY B;  4KV2 A;  4DXG A;  3AED B;  1MPE A;  2FE8 A;  4KX6 B;  1F2R C;  3PLU A;  4I6N B;  5EE0 A;  5BYS A;  2LHE A;  1ET9 A;  1XT9 B;  2DX5 B;  4NAW B;  2K39 A;  3BIN A;  4DXF A;  2CKH B;  4LK0 M;  2LVQ A;  1WX8 A;  1QZE A;  3V3X A;  4P16 A;  3VR8 B;  1F2R I;  4EOY A;  2KDM A;  4FJV B;  3H9D A;  5HKH A;  3BVZ A;  3WAL A;  3DBR B;  2KVZ A;  1GJZ A;  2DZK A;  1FEH A;  1E5W A;  4S17 A;  4OZA A;  1ESF A;  3AE5 B;  1TIF A;  2PTL A;  4GSW A;  4IW0 A;  3KWL A;  2W3R A;  4KDL B;  2K5P A;  4PS3 A;  4HCN B;  4HJG E;  4GGQ A;  2EMT A;  4K3B A;  2KAN A;  4HXD A;  1J7A A;  2WXF A;  3ZNG C;  2MWS B;  3AE4 B;  4WWO A;  1L6U A;  2DBY A;  2C5L C;  4BOS C;  3IVF A;  1D5X C;  3RNA C;  3BK2 A;  2LMC A;  2OJR A;  4DHZ E;  2G9H D;  2DEN B;  3X0W A;  2AWT A;  4IM0 A;  3P63 A;  2R2O A;  1D5M C;  3ZDM C;  1UBQ A;  1V1O A;  2N1W A;  2WXL A;  4YXD B;  2BS2 B;  2FID A;  2GBN A;  4KGT A;  1GNU A;  3SR6 A;  1YJ1 A;  2GLS A;  3V60 A;  3H7P B;  1T5X D;  1SGH A;  1WGG A;  1K52 A;  2INP E;  4USA A;  1E6E B;  5AZH A;  3P4R B;  1C9F A;  3A4S C;  1KF6 B;  1GC7 A;  5DPS A;  4W9L A;  4A9A A;  3IXS A;  4ZRK A;  1UWM A;  3N1X C;  4C80 A;  3K9O B;  3VDZ A;  4IM2 A;  2BT6 A;  2N9X A;  1V5T A;  2WU5 B;  1TS4 A;  2LRW A;  2LXC A;  5IKC M;  3R2T A;  1R4M I;  1GC6 A;  4FHK A;  2KOX A;  1MG8 A;  3ZYY X;  2KC1 A;  2KNB A;  3U8Z A;  4WJO A;  3VH3 B;  2N7J A;  2L52 A;  1XD3 B;  3NS8 A;  3WAM A;  1YX5 B;  1CZP A;  3VHT C;  2HJ8 A;  1JRO A;  2NCN A;  1C1Y B;  1H4R A;  3VUW A;  1AWD A;  3B0A A;  4EZL A;  4HK2 A;  1YMH E;  2HE7 A;  2JF5 A;  2BWE S;  1HZ5 A;  1RLF A;  3U7Z A;  3QQ8 B;  3RNE C;  1N60 A;  2V9H A;  1FNV A;  2MA9 B;  2K8B A;  5IO9 A;  2A5U A;  3V62 A;  1KM7 A;  1S3S G;  2AYO B;  2N9P C;  4ARC A;  1DOX A;  1WJU A;  4C56 C;  1YN3 A;  2LVO A;  4GMV A;  2ZPN A;  5AUK A;  4RF1 A;  1TKY A;  1UZX B;  1FM0 D;  2V1Y A;  5CHW A;  3L16 A;  1P7F A;  2KAC A;  3HK0 A;  2D3A A;  5LLI A;  3E56 A;  2RR9 A;  2KQ7 A;  1GT8 A;  2Z0D B;  2L32 A;  3R7R A;  3A9K B;  1QOG A;  4N6E B;  2QIE B;  3TMP B;  4P6V F;  3NVY A;  1Y56 A;  2NVU I;  4GOC A;  4QAY A;  1JWA D;  3NZU A;  3TUO A;  4A3P A;  3IT4 B;  2KMA A;  3AB5 A;  2L05 A;  1JQ4 A;  2O2V A;  3QX1 A;  3IBE A;  1WX7 A;  2Y5P A;  3TEW A;  4MM3 A;  2W82 A;  4J3O D;  3ZNI D;  2W54 A;  3B9J A;  1FRD A;  1E7U A;  4DHJ B;  2PVG C;  3QCA A;  3URY A;  2Y5B B;  5E6J A;  1LGR A;  2RD0 A;  1BML C;  3W5U B;  3L10 B;  3V6C B;  4F7Z A;  4NPN A;  4WQO B;  4RM8 A;  2L7R A;  2CHW A;  3AM9 A;  4ICU A;  3AEB B;  1FXT B;  1WY8 A;  4IC7 B;  1KLU D;  1G6J A;  4MM3 B;  4GXB A;  4MSQ B;  2CJO A;  2FUH B;  4L23 A;  1PGX A;  4WJN A;  3I9V 1;  3BII D;  4K7W A;  3ZQ4 A;  3PHX B;  2EEL A;  2B3A A;  2CHX A;  2VZK D;  4CQN A;  4RFB A;  1FXA A;  2J0M A;  2KZR A;  3AE2 B;  2X8X X;  3SHQ A;  3ZW3 A;  1P98 A;  4ZOH C;  1YQ4 B;  1R4N B;  1J7C A;  3AXC A;  1XLN A;  4BKT A;  4J6I A;  3MTN B;  2LHD A;  1YOV B;  2PW9 A;  2DAF A;  2LJI A;  4AJW A;  1ZDX A;  4M02 A;  1JML A;  2DYM A;  1RFA A;  3RZF A;  1KLV A;  1J19 A;  2ICI A;  5MPO A;  1WYW B;  2PE9 A;  3VUX A;  3A4R A;  3ZJT A;  2EKE C;  1C3T A;  3NJT A;  1KJT A;  3DHG C;  5AUI A;  4DHJ D;  4KVG B;  3VAW A;  2KO3 A;  2G1E A;  1K8R B;  2N0S B;  3SDL C;  3UIO B;  3HIZ A;  4M0W B;  5JHB A;  2J0J A;  4W9C A;  5JZE B;  1BUI C;  2KLG A;  4X57 B;  2AL6 A;  3Q6B A;  1V97 A;  3NG0 A;  2KTR B;  1JWU D;  2PIA A;  4EEW A;  2NR2 A;  4RM9 A;  3Q2A C;  3ML8 A;  3LXF A;  2L0F A;  4II2 B;  4XE0 A;  2PEA A;  2HDE A;  3DQV A;  2K6Q A;  1I35 A;  1WJ6 A;  2KDI A;  4HEA 1;  3QWZ B;  1WR6 E;  1YX6 B;  1P7E A;  2MJD A;  4B95 A;  3J9C A;  3FIL A;  4KZ0 A;  3A33 B;  3P4S B;  2BYF A;  3NZ3 A;  2VH2 A;  4K3C A;  1NYR A;  3AE7 B;  1AW7 A;  2RGF A;  2UU7 A;  3BZD B;  2W3S A;  1YN4 A;  4HWI B;  1SJE D;  1RM6 C;  1UWX A;  1KTK A;  1RRB A;  1SIJ A;  4HDO A;  3HM3 A;  1E9M A;  4IOI E;  4JPS A;  2ZPY A;  1R4M B;  4GDL A;  3RPF C;  3ENE A;  4XWT A;  4IDI A;  2JWZ A;  5IP4 D;  1WMH B;  1GG3 A;  3NHE B;  4I6L B;  3AUL A;  3ONS A;  3I63 C;  5T8I A;  3S2A A;  2QJL A;  3NVW A;  3FIL B;  2WYQ A;  2KJH B;  4PYZ A;  2O6V A;  4B0M A;  4XZ4 A;  1T6B X;  3QJZ A;  3VQI A;  1WXV A;  2BS3 B;  2BWF A;  2I38 A;  3AU4 A;  3UIP B;  3H7S A;  2EMS A;  4BBN F;  2KFJ A;  1QOA A;  1LQB A;  4B9K A;  1M4V A;  5BO4 B;  3A1Q A;  4BKG A;  1GB1 A;  4A90 A;  3DHH C;  3T3O A;  1F77 A;  1RYJ A;  1D4B A;  5J18 A;  3OJ3 A;  3UQA A;  2M8S A;  1QT9 A;  4P1C C;  1L0V B;  1EU3 A;  2KWU B;  2C7N B;  4W9K A;  4JGH B;  3OAW A;  4NQL B;  4G50 A;  1E8X A; 
#chains in the Genus database with same CATH homology
 1WGK A;  3MC0 B;  4HJG E;  3Q8A A;  1ZE3 D;  1ACC A;  2PKO A;  2NTS A;  2IDY A;  2SAK A;  1GOZ A;  1J7A A;  1ET6 A;  2J53 A;  3AEF B;  3R2I A;  2WXF A;  4WUR A;  5GXG B;  4B0E A;  3AE4 B;  5D3I B;  1L6U A;  2DBY A;  2MJE A;  2N9K A;  4A8X C;  3ZJV A;  1EWY C;  1D5X C;  5EE1 A;  3BK2 A;  1E7P B;  1FNW A;  2LMC A;  3Q8C A;  3VRA B;  2G9H D;  2IGH A;  5C3J B;  2JXT A;  3UI3 A;  2BTE A;  4OZB A;  2DWQ A;  4YSZ B;  2LEK A;  4ZHP A;  1XCT L;  1C4A A;  2EKI A;  1FNU A;  5EE3 A;  3P63 A;  2PMV A;  5D7G A;  5G5H A;  1L0X B;  3IAS 1;  1ZP0 B;  4H2A A;  1HQR D;  1D5M C;  4JE3 B;  1C4P A;  1C76 A;  3AH7 A;  3EUB 2;  4GLS C;  1V1O A;  2RDH A;  1JAL A;  3N9Y C;  1TKG A;  1V8C A;  2WXL A;  4YXD B;  4TMA B;  1CQV A;  2JX5 A;  1IBX B;  2BS2 B;  3L4P A;  1WRI A;  4EE2 A;  2AX5 A;  2ZW1 A;  3CIR B;  4KGT A;  1UNS A;  3SR6 A;  2PLP A;  1N63 A;  3P1M A;  3VRB B;  3DWM A;  2Q5W D;  2OED A;  5BYR A;  1T5X D;  2V3P A;  2V3N A;  1VZ8 A;  1K52 A;  2M56 B;  3I57 A;  1ENF A;  2JSV X;  2INP E;  3BWU D;  4WIP A;  4USA A;  1E6E B;  3P4R B;  2DYO A;  1C9F A;  1KF6 B;  1L0Y B;  4OZC A;  4A9A A;  2JU6 X;  4MAC A;  3IXS A;  2WXP A;  4RCO A;  5JXV A;  1YN5 A;  2OHF A;  2PVO D;  1FRR A;  1VDV A;  4L2Y A;  1UWM A;  1K51 A;  2ON8 A;  1TY0 A;  2D5G A;  1SF0 A;  3BYY B;  4C80 A;  1I7H A;  4AQ7 A;  4RGM A;  3AE9 B;  1ZXH A;  2KWD A;  3HVZ A;  1K53 A;  1TZO A;  4RH6 A;  1DOY A;  2BT6 A;  2WXH A;  1AYF A;  1JCK B;  2WXJ A;  3GP7 A;  2WU5 B;  2J52 A;  3PZ8 A;  3H8H A;  1TS4 A;  1FXI A;  1XLO A;  2GI9 A;  1VLB A;  3HVD A;  2WXI A;  3KWV A;  3R2T A;  2ACZ B;  1KFY B;  3CF4 A;  2XN9 C;  2L83 A;  1FFV A;  3MFG A;  3ZYY X;  1CJE A;  1OQQ A;  3TEY A;  2N7J A;  1EM7 A;  1L6V A;  3W5V B;  4NAM A;  3P4P B;  3ZGZ A;  1I4G A;  2L52 A;  2WXR A;  3DWG C;  2BYT A;  1SSN A;  4KKJ A;  3P4Q B;  2FBW B;  2H89 B;  1D5Z C;  3HUI A;  2RPV A;  1SEB D;  1CZP A;  1ZDV A;  1JRO A;  4WH4 A;  4YTP B;  1PGA A;  5D3D A;  1OFF A;  1AWD A;  3MHZ A;  1NVI D;  1HA5 A;  4GDL B;  2JWU A;  1ZPS A;  1WWT A;  4IKG A;  1MHH E;  4A6Q A;  1DOI A;  4YSX B;  4JWS C;  1YMH E;  2RDG A;  2KAJ A;  1HZ5 A;  3U7Z A;  2I2Y A;  3GB1 A;  3IT6 B;  1C77 A;  1QOF A;  5HI1 A;  2Y3A A;  1XLP A;  1YJI A;  5TSS A;  1N60 A;  4TQ1 A;  1FNV A;  4M0W A;  3NRZ A;  4ZHO A;  2YEP B;  4FXC A;  2WDQ B;  1FD6 A;  1QKZ A;  1LO5 D;  3P42 A;  4ARC A;  2MEK A;  1NI3 A;  1NYQ A;  2LUM A;  1DOX A;  2Y5C A;  4C56 C;  1YN3 A;  5FK9 C;  5AUK A;  1YNT E;  4OW0 A;  2N9L A;  3EGR A;  4A55 A;  1D6E C;  4RF1 A;  1TKY A;  3TSS A;  1FM0 D;  4Q2J A;  3U2S C;  1DGJ A;  1HEZ E;  3SFD B;  2E6X A;  1P7F A;  1QIL A;  2KAC A;  3AV8 A;  2MH7 A;  3E56 A;  3W1S A;  1FO4 A;  1AN8 A;  1OQR A;  1CK1 A;  2M19 A;  2WNM A;  4JWU C;  5HFY A;  5HHD G;  5EE9 A;  2WXG A;  3AEE B;  2XNA C;  1RWS A;  1GT8 A;  1STE A;  1GB4 A;  1EU4 A;  2KMM A;  2L32 A;  3AE1 B;  1GPX A;  5BYQ A;  2KN4 A;  1C78 A;  1I4H A;  1EWC A;  1PGB A;  1XF5 L;  4ZYS A;  1VR9 A;  1QOG A;  4PT5 A;  4XDD A;  3AEA B;  2K3U A;  4N6E B;  2QIE B;  1BXT A;  2WXK A;  4P6V F;  3NVY A;  1Y56 A;  2BS4 B;  1V1P A;  2YEP F;  1F0Z A;  1MI0 A;  1JWA D;  3C8Y A;  4GDK B;  3TUO A;  2WS3 B;  1KLG D;  3KLS X;  4RGT A;  2K22 A;  1FIQ A;  1TS3 A;  3IT4 B;  1NEK B;  2NTT A;  3AN1 A;  3FAH A;  2BBC A;  3AB5 A;  1JQ4 A;  1I4X A;  4ZRQ A;  2WDR B;  2Y5P A;  3Q8B A;  1B9R A;  3Q8E A;  3TEW A;  4XWW A;  2WXN A;  2W82 A;  4J3O D;  1YJJ A;  1SBB B;  3W9C B;  4R3D A;  3VR9 B;  2W54 A;  1JWS D;  3B9J A;  2LFI A;  3AMZ A;  4NJC A;  2WXQ A;  5BMG A;  2KQ4 X;  1FRD A;  3AEG B;  2RMM A;  1PYW D;  2PVG C;  4REZ A;  3URY A;  2L1A A;  1N5X A;  4WWM A;  5E6J A;  5LNK 1;  1UGJ A;  2JYT A;  1HZ6 A;  2BB5 A;  2FUG 1;  3LYY A;  1BML C;  1UUP A;  3W5U B;  1XEE A;  1QLB B;  3BYT B;  1FFU A;  4DQO C;  4MT5 A;  3W2D A;  1DYQ A;  3AM9 A;  3AEB B;  1SXT A;  2WLB A;  5HG2 A;  1KLU D;  1FCC C;  4RNA A;  4MM3 B;  5FKA C;  3U52 E;  1I4P A;  1JWM D;  1ZUD 2;  2CJO A;  2V0G A;  4L23 A;  1PGX A;  3I9V 1;  1JRP A;  3BII D;  4JX1 C;  3ZQ4 A;  2K0P A;  3AE8 B;  2AQ2 B;  2EEL A;  4L1B A;  1QQR A;  4WQM A;  1MVK A;  2WDV B;  2VZK D;  4CQN A;  4RFB A;  1FXA A;  1Q10 A;  4D2K A;  1GAQ B;  1SE3 A;  4ARI A;  2GB1 A;  3AE2 B;  4MH8 A;  5C2T B;  4OVZ A;  1RFK A;  4ZOH C;  1YQ4 B;  3Q8F A;  2AQ3 B;  2QIL A;  1J7C A;  2HTM E;  4C7Z A;  1L5P A;  1XLN A;  1IGC A;  4YWG G;  4WAF A;  2LHD A;  1TKE A;  2IGG A;  2PW9 A;  2QSD A;  3AE3 B;  2LJI A;  1I4Q A;  2ONQ A;  4YSY B;  4YT0 B;  4HRO A;  1PFD A;  1ZDX A;  3PO0 A;  3U4E G;  1TJE A;  1NEN B;  2B76 B;  2WXO A;  3OWE B;  3MP9 A;  1JML A;  2DYM A;  1C4C A;  4RGO S;  2BB6 A;  4US9 A;  1R7S A;  3B2G A;  2CU3 A;  4LTU A;  2LGI A;  2ICI A;  5MPO A;  2VZK B;  2E3T A;  2H88 B;  3ZJT A;  2W55 A;  1XLQ A;  2WU2 B;  1ZXI A;  2QMT A;  3BK1 A;  5AUI A;  5FR3 A;  3V05 A;  1IBX A;  4RGN A;  1TS5 A;  1KH0 A;  4KGS A;  1IGD A;  2Z8L A;  1QF6 A;  2G1E A;  1SJH D;  1WXQ A;  3ETR A;  2QEJ C;  2N0S B;  2GRI A;  5H92 C;  2JQR B;  3R8B A;  1ROE A;  3PZ7 A;  2SEB D;  3TEX A;  1H7W A;  1TY2 A;  2J42 A;  3AE6 B;  3BVG A;  1JWB D;  1BUI C;  1VZ7 A;  4US8 A;  2INN E;  3CWI A;  1FMA D;  1J7B A;  4N59 A;  1N5W A;  4O1N A;  1WSP A;  4UDU C;  2WP9 B;  1V97 A;  3ZJU A;  1PDX A;  3O13 A;  3FC4 A;  1JWU D;  3WCQ A;  1TS2 A;  2PIA A;  1N62 A;  5BMH A;  1QOB A;  3TEZ A;  3LXF A;  3Q69 A;  2IGD A;  3RFZ B;  3NUH B;  4XE0 A;  4TQ0 A;  2HDE A;  4XDC A;  1XO3 A;  1VJK A;  2X38 A;  1GTE A;  2JYE A;  4YTN B;  3NVZ A;  4HEA 1;  3HRD D;  3GS2 A;  1YQ3 B;  1FCL A;  1P7E A;  1V1P B;  3E9S A;  1PUT A;  2MJD A;  5I4D A;  3J9C A;  3FIL A;  1K50 A;  1VZ6 A;  2V4I B;  4LLG M;  1C79 A;  1E0Z A;  2CJN A;  2IPK D;  1L4D B;  3P4S B;  3BVM A;  1XXG A;  3NZ3 A;  1GTH A;  1SE4 A;  1T3Q A;  4ITK A;  1NYR A;  3AE7 B;  1AW7 A;  3BZD B;  2NMQ A;  2W3S A;  4YTM B;  1YN4 A;  1MHX A;  1SJE D;  1VRA B;  1RM6 C;  1UWX A;  4RF0 A;  1KTK A;  4HKZ E;  1SIJ A;  5BMI A;  1E9M A;  4HKQ A;  4IOI E;  4JPS A;  4KKI A;  2MJ3 A;  2K9X A;  3RPF C;  2JZP A;  3EA6 A;  1A70 A;  4XWT A;  2TSS A;  4IDI A;  1WYG A;  1N61 A;  2IJ0 A;  3B2F A;  1ZOY B;  4KGR A;  4NZL B;  1TYG B;  5T8I A;  2QJL A;  2AQ1 B;  1H7X A;  1IUE A;  5G5G A;  1KRH A;  3NVW A;  1SB3 C;  4AS1 A;  3FIL B;  4N58 A;  1B1Z A;  3IAM 1;  3KQ4 A;  2WXM A;  4B0M A;  1T6B X;  2M0A A;  1L4Z B;  3VQI A;  2DLB A;  2BS3 B;  2I38 A;  3NVV A;  4ZRP A;  2WQY B;  1XCQ L;  3AED B;  2R61 A;  1MPE A;  2FE8 A;  4DXG A;  1I4R A;  4KX6 B;  1F2R C;  5EE0 A;  1QOA A;  5BYS A;  1M4V A;  3SFE B;  1GB1 A;  4A90 A;  2LHE A;  3T3N A;  3NS1 A;  3SEB A;  3T3O A;  1ET9 A;  3ABV B;  1HXY D;  1F77 A;  1RYJ A;  4NAW B;  1D4B A;  3AEC B;  4DXF A;  4LK0 M;  1E10 A;  2BW2 A;  1SE2 A;  1QT9 A;  3LB8 C;  2ZW0 A;  2J4X A;  3V3X A;  3MJ5 A;  1L0V B;  4P16 A;  3VR8 B;  1F2R I;  1EU3 A;  4C7Y A;  2KDM A;  4TSS A;  5H8Y E;  3BVZ A;  1FEH A;  4OZA A;  4OHJ A;  1ESF A;  3AE5 B;  2PTL A;  3KWL A;  2W3R A;  1JW9 D;  2K5P A;  4HRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...