4YSXB

Crystal structure of mitochondrial rhodoquinol-fumarate reductase from ascaris suum with the specific inhibitor nn23
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
250
structure length
250
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPANF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase flavoprotein
publication title Structural Insights into the Molecular Design of Flutolanil Derivatives Targeted for Fumarate Respiration of Parasite Mitochondria
pubmed doi rcsb
total genus 68
structure length 250
sequence length 250
chains with identical sequence F
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 4ysxB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4ysxB01
2JQRB 3AB5A 3EUB2 1FRRA 2K5PA 3CIRB 3FC4A 2FBWB 3RPFC 1RM6C 2BT6A 1QOAA 1FXIA 2CJOA 1H7XA 2WDQB 1CZPA 2MJDA 3W5VB 3VR8B 2N0SB 4HROA 3FAHA 5G5GA 3ZYYX 1IUEA 1CJEA 1TKYA 3L4PA 3AE5B 3AE8B 3P4PB 1NYRA 2BS2B 1N63A 1N5XA 3DWGC 3HVZA 1FRDA 1R7SA 4US9A 1OQQA 3AH7A 4C7YA 3AE4B 1H7WA 1WYGA 4WQMA 5C2TB 2WLBA 1GTHA 4YSYB 2KMMA 3NVWA 1QOFA 1NEKB 3AV8A 1FIQA 5EE3A 1YJIA 1L5PA 4N58A 3CWIA 1GPXA 1VLBA 4WWMA 3ABVB 1E0ZA 1WWTA 2PIAA 2K9XA 3P4SB 1I7HA 1JWAD 1GAQB 1RYJA 2WQYB 2DBYA 1ZOYB 1KF6B 1N5WA 2H88B 4YXDB 1JRPA 1L6UA 3P63A 5EE0A 1SF0A 2OHFA 4YSXB 1XLQA 4LTUA 4P6VF 1L6VA 5AUIA 4JX1C 2Y5CA 4C7ZA 2PVGC 2B76B 1QF6A 1E9MA 3AE7B 1SB3C 2W3SA 1FFUA 3BIID 1NENB 3P4RB 3AEGB 1VJKA 4YTMB 4A9AA 4N6EB 3NS1A 1AYFA 4YT0B 3HUIA 1FM0D 2WDRB 3WCQA 4KX6B 1N62A 2EKIA 1NYQA 4ZHOA 1DOYA 1ROEA 1FMAD 4YTPB 2W54A 1J7CA 2CU3A 3AE9B 1AWDA 1VDVA 2WU5B 1XLNA 2WP9B 3P4QB 1T3QA 2W55A 5AUKA 5H92C 2Q5WD 3NVYA 4YSZB 2JX5A 3LXFA 1PDXA 3AE2B 1QOGA 2K22A 2HTME 5G5HA 3B2GA 1JROA 3VRBB 2ACZB 1OQRA 3P1MA 1XLPA 3NRZA 1OFFA 1WXQA 3SR6A 2BS3B 1J7BA 1JQ4A 1ZUD2 1ZXIA 4ZHPA 4C80A 2BS4B 1TKEA 5MPOA 1YQ4B 3NVZA 5EE1A 1YQ3B 3AE1B 2PKOA 1QT9A 1XO3A 5GXGB 2W3RA 4N59A 3VR9B 1TJEA 2KAJA 3W9CB 1DOXA 3DWMA 1GT8A 2MH7A 1FO4A 1ZP0B 5H8YE 3SFEB 1WRIA 2WS3B 3PO0A 1YJJA 4HRSA 3ETRA 2MJ3A 1JALA 1UWMA 1N61A 3SFDB 1XLOA 3NVVA 3AN1A 1RFKA 3AEAB 4ZOHC 1DGJA 1V97A 3AEFB 2LEKA 4USAA 1E7PB 1V8CA 3AMZA 1J7AA 1FFVA 2QIEB 1E10A 1KFYB 5C3JB 1F0ZA 1NI3A 1PFDA 1RWSA 2M19A 2MJEA 2E3TA 3B2FA 3LB8C 2M56B 3AE6B 1N60A 3HRDD 1TYGB 1TKGA 3B9JA 4IDIA 3AECB 3AE3B 1E6EB 2QJLA 1FXAA 3CF4A 5EE9A 3AM9A 2WDVB 4JWUC 3AEBB 1WGKA 2H89B 3AEDB 2G1EA 1EWYC 2L83A 1QLBB 2AX5A 1SIJA 3VRAB 3AEEB 4ITKA 3W5UB 1A70A 2L52A 1KRHA 1B9RA 2CJNA 1GTEA 1PUTA 4FXCA 4YTNB 3KWLA 4US8A 1L0VB 2WU2B 1NVID 2DWQA 1JW9D 2PVOD 1QOBA 1DOIA 1JWBD 4JWSC
chains in the Genus database with same CATH superfamily
1FRRA 3AI5A 1E7VA 2CJOA 3UIPB 1C4CA 1SJHD 4RF1A 2IBIB 2WNMA 2C7MB 2NVUI 2K0PA 3ECIA 1KOTA 2KQ4X 2G3QB 1FIQA 2G45B 4M8NA 4N58A 4ACFA 2BGFA 1TS2A 3B0AA 1XLQA 2BW2A 5E6OA 2OJRA 3A9KB 3AE7B 1RAXA 1RFAA 1Q0WB 1UWXA 2WXMA 3UI3A 2NR2A 2K39A 3A33B 1UGMA 2GBNA 1XLNA 2HDEA 2Y5PA 1KLGD 3GZNB 5DPSA 2HTME 3R8BA 1T0YA 2ACZB 4K7WA 1XLPA 3O13A 1OFFA 3KUZA 1ZXIA 2JZ3B 3NVZA 2GB1A 3TEYA 4N59A 2O6VA 3ZLZA 3Q8CA 1I4QA 1Z2MA 3PO0A 3M3JA 3K9OB 1MG8A 1RFKA 1XT9B 2LEKA 5EDSA 1F0ZA 1FFVA 4XDDA 4RM8A 2QILA 4KDLB 3LB8C 1VZ7A 1PGAA 1R4MB 2UYZB 2QJLA 4M0WA 5AZFA 5J18A 3AEBB 1QKZA 2L83A 1NI2A 1J19A 4F1SA 1PUTA 3FILB 5C1ZA 1XQQA 1I4GA 4PS3A 3S2AA 2BT6A 2BWFA 4HJGE 3DOWA 4HROA 3A9JB 1HA5A 2ON8A 5CHVC 4C56C 3DWGC 2WXNA 3AE4B 3IT6B 1WGHA 3OLMD 4E3CA 1WMHA 2RMMA 2FIDA 2AL3A 4B0MA 1E0ZA 1FPYA 2QDFA 3DBRI 4G11A 4TQ1A 3NUHB 1SF0A 4NJ6A 3KUDB 4W9KA 3KW5B 1ESFA 2MBHA 3RFZB 1DYQA 3U7ZA 2W3SA 1FFUA 4BBNC 1AYFA 1JWUD 3ML8A 1TZOA 4KX6B 1DOYA 2KWDA 3L08A 2QHOA 2W55A 3SD5A 2Z59B 3NZUA 3R2TA 2CHZA 2NPTA 2KDBA 3RNGC 3PSEB 3TUOA 2Z8LA 2C5LC 5D2MB 3R66C 1GUAB 4AJWA 1WM3A 2KAJA 1PGXA 2KXJA 3ZVVA 4II2B 4NJ7A 3DVGX 2WS3B 3DVNU 4JLCA 3ZKJC 2WXKA 3U52E 4GLSC 4HK2A 2GOWA 3GE3C 3NZSA 3QX1A 2KTRB 3TL5A 1Q5WB 4RGTA 3ZNGC 1RRBA 3L54A 2QEJC 1WR1A 5J17A 2KJ6A 1A70A 1TBEA 3OAWA 4WJNA 4ZYNA 1GTEA 1C4PA 2XK5B 4LNFA 1C4AA 4AOFA 2M1MA 2W82A 2MJDA 2KT7A 3ZW3A 1L4DB 3P4PB 4NAWA 1OQQA 1JWSD 4CQNA 1SIFA 2LHDA 1WI0A 1JWAD 1V2YA 2AWTA 1KF6B 1N5WA 2LFIA 2NBWB 1L6UA 3P63A 4P16A 2J0MA 4A90A 2ASQA 1E8ZA 3ZRFA 1SB3C 3RYTA 2V4IB 3AEGB 2INDC 4LLGM 2PPHA 3DQVA 1AWDA 3N30A 1L7YA 5AUKA 3WALA 1QOGA 2L7RA 3ZTDA 3ZQ4A 5KHOA 4C80A 5MPOA 4DXFA 1VZ8A 3WAOA 1XO3A 2FUHB 2QSDA 3RD2A 2LJIA 4MEMA 1F77A 3W2DA 1MI0A 3PHWB 1JWMD 2L05A 1YJJA 1UWMA 1ZKHA 3N1ZC 2AEHA 3URYA 4E71A 3D32A 2M56B 1S1QB 4I6PA 1OEYJ 3RUIB 1V86A 1HTQA 4L1BA 2ZVOA 4UDUC 2LGXA 1QLBB 4FLHA 2L1AA 5D94A 3BK2A 2CKHB 2N7JA 5E6NA 2KFKA 5JZEB 4FA6A 4FXCA 1FEHA 3GB1A 3IAS1 3BWUD 2M0XA 4BKSD 4I6LB 2WXRA 1EU4A 4IWPA 3VR8B 3PV1A 2WXFA 3AE8B 3HVZA 3IAM1 2DHZA 1R7SA 3ZTCA 3U30A 3VDZA 3KQ4A 1WY8A 2JZZA 1GTHA 1QOFA 2LD9A 3CWIA 3GOEA 1MFWA 1YJ1A 4YWGG 1AW7A 3PRPB 1LM8B 3QC8B 1SSNA 5BYQA 3PLVA 4IOIE 2Y5CA 1QF6A 4MJSB 4IKGA 4KVGB 4S17A 1E5WA 4MH8A 3M95A 4KIKB 2D3CA 4P7IA 3APDA 3Q6BA 1J7CA 3H6NA 3AE9B 2JXXA 3KYDD 4RFBA 2Q5WD 2KNBA 2JF5A 2L0TA 2AQ3B 3VQIA 3DBLB 3QHTA 4WJPA 4XWWA 2IGDA 2LRWA 2G9HD 3Q3OC 3VFKA 4ZYSA 2KMCA 3PGEA 2IY0B 5CTRC 2JVCA 2LZ6A 4B6WA 4MM3B 4PT5A 3TEWA 4K7UA 4LNNA 2J53A 4HKQA 1J7AA 3GS2A 1TZ1A 3AE6B 2RDHA 3VTVA 3W1YA 3NG0A 2KJHB 1WX9A 2RDBC 1WXAA 4JWUC 2D3AA 4C4VB 2ONQA 5D6JB 3HM6X 1KRHA 2L8JA 3MJWA 2DZKA 4OZAA 2W9NA 1WF9A 4YTNB 4EUTA 3RNBC 3UIOB 1WE7A 1TIFA 2EKEC 2MRPA 2HE7A 2OJWA 3LYYA 1RM6C 2VZKD 1SBBB 2L76A 1N6ZA 2FUG1 3N20C 3ZYYX 2WXLA 2D5GA 1NYRA 1N5XA 3OJ3A 2I1JA 4TQ0A 4ARIA 2INPE 1LXDA 4JIOU 3V6EB 1VLBA 4FHJA 2MX2A 4WWNA 1CK1A 3BVZA 3AXCA 1FD6A 2KDFB 2J7QB 4EEWA 4WIPA 4PYZA 1TTNA 2MHJA 4H2AA 1WGRA 4P6VF 2V3NA 4EE2A 4W9LA 2PVGC 3JSVB 2J42A 1WX7A 3B08A 3OWEB 4WQOB 4MDKE 4OZCA 3IT4B 2J0JA 3AU4A 3L13A 1I4XA 1ZW7A 2LXAA 4DDID 1SE4A 2N9PC 5IAAC 2BKRB 4IWOA 4KV2A 4RCOA 4IM2A 1J7BA 3IVFA 5EE1A 3WAMA 1T0RC 3ZJTA 4LNKA 4MGIE 5DPWA 3SU8X 3RN9C 2WXQA 2HJ1A 1PGBA 4HRSA 1SE9A 3NVVA 3AN1A 2PMVA 2AL6A 2G4DB 2MJEA 2KVZA 1P0RA 2NMQA 2JUOA 1HTOA 4GGQA 1IBXA 5FR3A 2FCQA 3Q3FA 1ZDXA 4LDTD 1NVID 3HVDA 1QOBA 2KX3A 4WWOA 2V0GA 2C9WB 3ONSA 3U8ZA 2O2VA 1S3SG 4GDLB 4P1CC 3HHMA 4ZRIA 1GPXA 5T8IA 3V60A 1Q1OA 4AUQC 4J6IA 4BKTA 4KKIA 1GAQB 3CSTA 3NJTA 5L83A 1TS3A 3PVLA 1V1PB 2BF8B 3MC0B 1HE8A 2ZJDA 3P4RB 3H7PB 1Y8RC 2KC1A 3WIMA 4FADA 1FM0D 1UBQA 4R3DA 2KANA 2WX1A 3VUYA 4OVUA 3VRBB 1MVKA 2WXOA 3A1QA 4WJQA 2BS3B 1XD3B 2RPVA 4IWQA 2VRRB 3AE1B 3N3KB 1UUPA 3W9CB 4G50A 1LGRA 4DBGA 1C9FA 2KJRA 3NY5A 2PE9A 1UF0A 1KH0A 1F1HA 4TUUA 2L3ZA 1YMHE 2BYFA 1KLUD 3MC9A 3B1LX 5C3JB 4WJOA 3GP7A 2IO0B 3UGBB 4W9HA 1N60A 1TKGA 5CHWA 1ET6A 2SEBD 2BB6A 1C76A 2PW9A 2IDYA 1WGKA 1ZPSA 2QCZA 4OZBA 4DDGD 1R4NB 4JE3B 5C23A 1WH3A 2MQJA 3DVGY 4IM3A 4G3XB 4AJYB 2NS5A 3ZJUA 1EO6A 5FKAC 3UQAA 3WANA 2IYDB 3CIRB 1K51A 3SHQA 1P98A 2WXIA 2RDGA 3SEBA 1CQVA 1LO5D 3P42A 4F7ZA 2WWZA 2O6VB 2D11A 2IY1B 5G5GA 1HZ6A 2LVQA 4YL8A 1WFYA 4HXDA 5JHAA 4DXAB 2WLBA 3AU5A 4HPMB 3C19A 4G0NB 4HCNB 3T3OA 3ZIMA 4ANVA 2JWZA 2BB5A 3APFA 5BMGA 3ZXVA 4RGOS 2MWSB 4M0WB 2NBVB 4NY0A 2MSED 1AN8A 4A20A 3VXWA 1WSPA 1X1MA 2CU3A 2RSUA 5FK9C 5BO4B 4MGKE 2MBBB 4MT5A 4YSZB 1P7EA 2JX5A 3LXFA 4BVUC 1SE3A 1ISNA 3PRZA 1STEA 1V1OA 2CR5A 2J4XA 4M01A 5CX3A 5LLIA 1FNVA 4BKSA 4EFOA 4TKNA 3Q3MC 1GT8A 2VH2A 1WMHB 2WXGA 3DBHI 3SFDB 1UGJA 3AEAB 1V97A 4PS8A 4KZCA 1RWSA 2E3TA 1F9JA 4NNJB 3ZRCA 4MSMB 3B9JA 2N7DA 2LRUA 1E6EB 1YX6B 4BAXA 2INCC 4BKGA 3M62B 2AX5A 1D6EC 3RCZA 1SXTA 3C0RB 4JQWC 3TJPA 4HPPA 1K52A 3KWLA 1HXYD 2DWQA 1JW9D 2NPTB 1IPGA 2DYOA 3QAQA 3AB5A 2Y3AA 5D7GA 4A3OA 1HQRD 2N1WA 2MEKA 4GDKA 1M94A 2DLBA 1BUIC 3VAWA 1CJEA 2RD0A 1N63A 4US9A 3U7DA 1JRUA 3BK1A 2KZRA 2GBRA 2KMAA 2LMCA 1YJIA 5CHFA 3TBLD 2PIAA 3QA8A 3W1SC 2NTTA 2H88B 3QQ8B 3T9LA 3OJ4B 4YSXB 4LTUA 3HK0A 2M8SA 3PPAA 4LNIA 1GC7A 2WYQA 5DPTA 3Q3JA 1N62A 1V5OA 1TY2A 3TEZA 5H92C 1T0SC 3NOBA 3NVYA 3AE2B 5BMHA 2FCMA 3NRZA 4HVBA 1MPEA 1YOVB 1JQ4A 2LUMA 1CMXB 4IUMB 2K3UA 2V4LA 1I4RA 2IO1B 1DOXA 1TY0A 4M00A 3RNEC 4NAWB 3EECA 1QQRA 2EMTA 4CYEA 2N7EA 1GJZA 1IGCA 4RF0A 4USAA 3VTWA 5IA7A 4HLEA 2QIEB 4DHJB 1KFYB 3X0WA 2IJ0A 2BBCA 4F8CB 3HRDD 1TS5A 3FKYA 1FXTB 1WYWB 3T8MA 2GMIC 3DHGC 2KLGA 1KTKA 1SIJA 3VHTC 2KO3A 4GMVA 4W9GA 4US8A 4KGRA 2KDEB 4KGSA 1GG3A 2M4NA 3EFCA 2KACA 1K8RB 1MJDA 2UWQA 3CF6E 1OQYA 1ZE3D 2LVOA 3ZNZB 1OGWA 4K3BA 2RGFA 4D2KA 3MP9A 3NZ3A 3N1XC 1XXGA 3BZDB 2KMMA 2FCNA 1L5PA 4WWMA 1WJ4A 4M02A 1RYJA 3RZFA 1T5XD 2MBOA 4TV3A 1YX5B 1EUVB 2X38A 2B76B 2RR9A 2D3BA 3BIID 3Q8FA 4N6EB 4EZKA 3RT3B 4DK5A 1WGYA 4RNAA 2EKIA 2BQQA 4OVZA 2KFKB 2YEPB 4IG7B 1VRAB 1E8WA 2N9XA 5BYRA 1K53A 1L2NA 2R61A 2KFJA 3GZNI 1QT9A 3ZXRA 4Q2JA 1D4BA 3M63B 1TT5B 4IW0A 3P2BA 2HJ8A 4II3B 1E8YA 2D10A 4KSLC 2AQ1B 5H8YE 3TEXA 2MJ3A 3W1SA 4MH0E 4B95A 2ZNVC 2C7HA 2KC2A 2XN9C 2MLBA 1I4HA 2WDTB 4AS1A 5HI1A 1SE2A 3AM9A 2IZVB 1R4MI 4HDQA 2WXHA 3VRAB 3AEEB 4NAMA 1T0QC 2CU1A 1E8XA 3DVNV 4WH4A 3A4RA 4P1BC 1ACCA 2GRIA 1JCKB 1GB1A 2LGYA 3I63C 1WXSA 3JVZX 1UNSA 4K1RB 2N9KA 3VH3B 2B3AA 2DX5B 4DQOC 2CS4A 2JRHA 1EF1A 1YN4A 2MA9B 3OG5A 2ZW0A 1SJED 1YN3A 3DBRB 1TS4A 4YSYB 2BVCA 1D5XC 5D3IB 4FJVB 3P4SB 1I7HA 4A6QA 5GMVA 2ZCBA 1JRPA 1YD8U 1XCQL 2D07B 1NENB 1VJKA 2K8HA 2BYVE 2DNFA 3VH4B 4M8MA 4HCPB 3HUIA 2JZPA 1NYQA 1ROEA 1AARA 4YTPB 3NHEB 2JXTA 2JYEA 1WGDA 4A55A 2MP2A 1XEEA 1L0XB 2XNAC 3DPDA 4EZLA 1TKEA 2YLMA 4MACA 1YQ3B 2W3RA 3L10B 1YIWA 5DPRA 3V61A 4DWFA 5J2RA 3HIZA 1ZP0B 4CHKA 1GOZA 3IHPC 1WRIA 1WR6E 4EOYA 1M4VA 2KDMA 5L95C 1UH6A 2BTEA 4L2YA 1PFDA 1KLVA 4MSQB 3KH0A 2D3GA 4FHKA 1FXAA 3CF4A 5EE9A 1EWYC 1U4AA 3W5UB 4W9EA 2JYTA 4ANUA 1WGGA 1BXTA 2CJNA 1WE6A 1HZ5A 4A3PA 4OW0A 3EGRA 4BBNF 3FC4A 3L17A 3PS6A 1FXIA 2K8CA 1K50A 2L00B 3UINB 4ZDVA 4W9CA 2YEPF 1XF5L 3ZDMC 3AH7A 2KTFA 2ZEQA 3TMPB 4IM0A 1NEKB 5EE3A 3ABVB 4REZA 2RPQA 2E6XA 1F52A 2DZJA 2KYWA 4XZ4A 4TSSA 1V5TA 3NS8A 2LVPA 3MHZA 5JHBA 1V49A 3NS1A 1IBXB 1T6BX 2KWUB 3WCQA 3PZ8A 2KN5A 1VDVA 1T3QA 2ZNVB 1V6EA 1WXMA 1PDXA 2LGIA 3X23A 2L0FA 1ZXHA 4EKUA 2KQSA 4XWTA 4RM9A 2K8BA 2PKOA 2XBBC 3PREA 1MHXA 3L0WB 5BYSA 4A8XC 3LDZE 2O2VB 1MG4A 3V62A 3DWMA 1FCLA 4K3CA 1UELA 2BYTA 2KN4A 1GC6A 2A5UA 2K1FA 3AMZA 1NBFC 2J0KA 2C60A 4IDIA 2UU7A 4NJCA 2V9HA 4E74A 3A9KA 1P7FA 4XDCA 4KZ0A 4HEA1 4MGYE 5LXIB 3ZO5B 2I2YA 1TGZB 4XE0A 2JRIB 2AYOB 1C78A 1L4ZB 3V05A 3R7QA 4ZRQA 3VUWA 1FCCC 5KHQA 3A1QB 3RNAC 2JQRB 3EUB2 3RPFC 2LWPA 2ZVNA 3AULA 3N9YC 3W5VB 2N0SB 1TKYA 2KWVB 5G2NA 1EU3A 5IN7A 2TSSA 5C2TB 1B1ZA 4QAYA 1C1YB 2GI9A 1V81A 1Y56A 5HHDG 2PEAA 1BT0A 2ICIA 1WJ6A 3V3XA 2BKFA 4LK0M 1L0YB 1V9JA 1JMLA 2MW5A 2DAJA 2PTLA 2J52A 1E7UA 3FILA 2LGSA 2V3SA 1D5ZC 4N9F4 4W9DA 3Q8EA 4HKZE 1JROA 1OQRA 1LQBA 5TSSA 2EELA 3ENEA 2ZW1A 2MCNB 2BS4B 5TR5A 1ZDVA 4ANXA 2GBJA 5GXGB 3DBLI 3VR9B 3A9JA 3MHSD 2AQ2B 2C7NB 2SAKA 2A4ZA 2BWES 4O1NA 3ALBA 3E56A 3RULA 2LI5A 3H7SA 2JU6X 1WIAA 1V80A 3I5JC 4FBJB 3ML9A 1IP9A 1TYGB 4IC7B 1ENFA 4LNOA 4DHZB 1C77A 4ITKA 2KX0A 2D2QA 4PYUA 3L16A 2KWCA 4FN2A 2DENB 4RH6A 2WU2B 4KKJA 2LGDA 3PRMB 3JW0X 3ZGZA 1J8CA 3PLUA 1CZPA 3DHHC 3TCAA 3BYYB 1IUEA 3K9PB 3DDCB 3ZDTA 2BS2B 1I42A 1FRDA 3H9DA 4C7YA 5DCNA 1H7WA 4K81A 1E90A 2BYEA 3U2SC 5JH5C 2JPHA 4I6NB 1XCTL 3DBSA 2WQYB 2HD5B 2IGGA 5AZHA 5EE0A 2OEDA 2KTRA 3Q3NC 5AUIA 1E9MA 4KSKC 4YT0B 1FMAD 3R3MA 4AQ7A 3I3TB 1GNUA 2WU5B 2ZZPB 2XK5A 4KDIC 2GBMA 3PT2B 2DZMA 3PTFC 3SR6A 3UQBA 1ZUD2 4ZHPA 1WM2A 3WAPA 1PQSA 3RNFC 4GDKB 1I4PA 2KOXA 4BZAA 5E6JA 3R2IA 4XGAB 4NQLB 2LASA 3BYTB 3Q2AC 1FO4A 2ZPNA 5IKCM 3SFEB 2EMSA 1H4RA 4RGNA 1N61A 4LJPB 1XLOA 2IO2B 4ICVA 2NCNA 4S0RA 4CO7A 1V8CA 4DXGA 2V3PA 2DAFA 1SEBD 4XC2A 3PZDA 1YN5A 2QMTA 3ZNID 3AEDB 3BINA 3KUCB 3V6CB 3LJ3A 1BMLC 4WAFA 5AEKB 2N9LA 4ASWC 4EZJA 3Q8BA 4OVVA 3QWZB 4JWSC 2O6VD 2K6DB 4MGZE 1VD2A 2FBWB 3MTNB 4BOZB 1QILA 1QOAA 4NPNA 3A4SC 3VVWB 4RMAA 2XEWA 3CSFA 3L4PA 1OTRB 3AE5B 1UZXB 2M17A 2VZKB 3O65B 2PJHA 4GOCA 3TIXA 2MBEA 3H8HA 2FAZA 2N4FA 2FCSA 4GIVA 3C8YA 2DBYA 3Q69A 1ZOYB 4OHJA 4W9IA 1EM7A 3UF8A 2Y5BB 4YXDB 2FNJB 3QJZA 5IP4D 1L6VA 2CHXA 4YTMB 2PLPA 2WDRB 2JSVX 3RNCC 2W54A 2X8XX 4PS7A 2WXPA 2WGSA 2G4SA 1UBIA 1WXQA 2N9EB 3J9CA 5HG2A 1H8CA 2Z0DB 1ET9A 3EC8A 4K7SA 2MH7A 4ZOHC 4L23A 1C79A 3ZJVA 3QK0A 3AEFB 3Q8AA 1E10A 4WURA 1NI3A 3B2FA 2KDIA 5I4DA 1EF5A 4URKA 3AECB 3AE3B 1WX8A 4MJSA 2WDVB 2GBKA 5IOIA 3RZWC 3DCGA 5BMIA 4ZRJA 4KIKA 2NBUA 2QC8A 1FNUA 3I57A 3BVGA 4AP4C 4W9FA 4JL9A 1R4NI 1F2RI 5LNK1 2I38A 4DHZE 1JWBD 1YQBA 4LDTB 1H7XA 2WX0A 5HFYA 3FAHA 3MJ5A 3BVMA 2WHIA 1QZEA 1P3QU 1WYGA 3JYUA 3NVWA 4MM3A 1FNWA 2K9XA 2FIFA 1Q10A 3EA6A 3RMKC 3MC8A 2R2OA 2LHEA 4B9KA 3I9V1 4JX1C 2CHWA 2REXA 2ZCCA 2Z0EB 4A9AA 4C4VA 3KLSX 3MFGA 1VR9A 3HM3A 4FJZA 3BY4B 4ZHOA 3IFWB 1Z5SB 3SDLC 3P4QB 1LFDA 3APCA 5G5HA 2M0AA 3P1MA 2PE6B 2N1VA 1YQ4B 3QIJA 1IGDA 3KVFB 3EHVA 3N1YC 2K25A 2IGHA 1HEZE 5LXHA 3DBHB 3QCAA 4NQKE 4DHJD 3H1UA 2JWUA 4X57B 1VZ6A 1DGJA 4ANWA 1E7PB 1G6JA 2DYBA 3VUXA 1OEYA 4GN1A 4ZRKA 1WRDB 1WZ0A 3JSVA 2DYMA 4W9JA 2GLSA 2FE8A 2H89B 1NDDA 2L52A 1PYWD 1J0GA 3DHIC 2KHWB 2IPKD 3IBEA 2MP2B 2V1YA 1F2RC 2LUEA 1DOIA 3VTUA 3PZ7A 2MBQA 4BFRA 2BPSA 2HTHA 3IXSA 2K5PA 3Q14C 2DZIA 3KYCD 2WDQB 2KVRA 1A5RA 4B0EA 4NZLB 4GXBA 1VCBA 4GU2A 4J3OD 4WQMA 3GE8C 1UD7A 1YNTE 4LJOB 2KKCA 3AV8A 3WA0A 3E9SA 1WJUA 4BOSC 1WWTA 2JY6A 1WJNA 4KGTA 5JXVA 2OHFA 1ZGUB 3N32A 5G55A 2KLCA 4FULA 4C7ZA 5FR6A 2NTSA 4GB9A 3IG3A 4XYCA 1KM7A 4ICUA 3ZNHB 2K6QA 4JGHB 4TMAB 2WP9B 2VH1A 4ARCA 1IYFA 2INNE 2K22A 1P1AA 2KK8A 3B2GA 1GB4A 2ZPYA 1C3TA 3EFUA 4JPSA 4FJYA 1WZ3A 2OOBB 3R7RA 2WXJA 1RLFA 3ZUNA 1TJEA 2IO3B 2KD0A 4HPLB 5AZGA 1MHHE 1D3ZA 3QARA 4GDLA 2L32A 2LJ5A 3ETRA 1JALA 2LXCA 4HDOA 4RGMA 4WWPA 5E6PA 1WXVA 4LCDE 2R2QA 4HJKA 2M19A 4HWIB 4PK1A 1I35A 1SGHA 1V1PA 2I1KA 4GSWA 1EWCA 1D5MC 3RI7C 4AWJA 3H7PA 3CMMB 2G1EA 2KQ7A 3PHXB 5HKHA 1KJTA 4C00A 4WAAA 3TSSA 5IO9A 1B9RA 3U4EG 5D3DA 3KWVA 2JT4B 4MELA 2YVCA 1L0VB 4XX5A 2PVOD 1P9DU 3T3NA 4ZRPA
chains in the Genus database with same CATH topology
1FRRA 3LYYA 1RM6C 3ZGZA 2CJOA 2KACA 2VZKD 1C4CA 1SJHD 4RF1A 1CZPA 1SBBB 2WNMA 2FUG1 1ZE3D 3BYYB 3ZYYX 1IUEA 2WXLA 2D5GA 1NYRA 2BS2B 1N5XA 4D2KA 1FRDA 3MP9A 4C7YA 2K0PA 4TQ0A 1H7WA 3NZ3A 4ARIA 2KQ4X 2INPE 1XXGA 3BZDB 2KMMA 3U2SC 1FIQA 1L5PA 4N58A 1VLBA 4WWMA 1XCTL 1RYJA 1CK1A 2WQYB 1TS2A 1T5XD 3BVZA 2IGGA 1FD6A 5EE0A 2OEDA 4WIPA 1XLQA 4P6VF 4H2AA 2BW2A 5AUIA 2V3NA 4EE2A 2X38A 2PVGC 2B76B 1E9MA 3AE7B 2J42A 3BIID 3Q8FA 4N6EB 3OWEB 4YT0B 4OZCA 3IT4B 1UWXA 2EKIA 2WXMA 4RNAA 3UI3A 4OVZA 1FMAD 1I4XA 2YEPB 4AQ7A 1VRAB 1SE4A 2WU5B 1XLNA 2HDEA 2Y5PA 1KLGD 3R8BA 2HTME 5BYRA 2ACZB 1K53A 1XLPA 3O13A 1OFFA 2R61A 3SR6A 4RCOA 1J7BA 1ZUD2 1ZXIA 4ZHPA 3NVZA 4GDKB 5EE1A 1I4PA 1QT9A 2GB1A 3TEYA 3ZJTA 4N59A 4Q2JA 5E6JA 1D4BA 3R2IA 3BYTB 1FO4A 2AQ1B 2WXQA 3Q8CA 1I4QA 5H8YE 3SFEB 1PGBA 3PO0A 4HRSA 3TEXA 4RGNA 2MJ3A 3W1SA 1N61A 1XLOA 3NVVA 3AN1A 1RFKA 2PMVA 2LEKA 4DXGA 1V8CA 1F0ZA 1FFVA 4XDDA 2QILA 2MJEA 2V3PA 3LB8C 1VZ7A 1PGAA 2XN9C 1SEBD 1I4HA 4AS1A 5HI1A 2NMQA 1SE2A 2QJLA 4M0WA 1YN5A 2QMTA 3AM9A 3AEBB 2WXHA 1QKZA 3AEDB 2L83A 3VRAB 3AEEB 1IBXA 5FR3A 4NAMA 1ZDXA 1BMLC 1PUTA 4WH4A 4WAFA 2N9LA 3FILB 1NVID 3HVDA 3Q8BA 1QOBA 4JWSC 1I4GA 1ACCA 2GRIA 1JCKB 1GB1A 2FBWB 1QILA 2V0GA 2BT6A 1QOAA 4HJGE 1UNSA 2N9KA 4HROA 4DQOC 1HA5A 2ON8A 3L4PA 3AE5B 4C56C 3DWGC 1YN4A 2WXNA 2VZKB 4GDLB 3AE4B 2ZW0A 3IT6B 1SJED 1YN3A 1TS4A 4YSYB 3H8HA 2RMMA 1GPXA 1D5XC 5D3IB 5T8IA 4B0MA 1E0ZA 3P4SB 1I7HA 2DBYA 1GAQB 3C8YA 3Q69A 4KKIA 4A6QA 1ZOYB 4OHJA 1EM7A 4YXDB 1JRPA 1TS3A 4TQ1A 3NUHB 1SF0A 1V1PB 1XCQL 3MC0B 1L6VA 1ESFA 3RFZB 1DYQA 3U7ZA 2W3SA 1FFUA 1NENB 3P4RB 1VJKA 4YTMB 2PLPA 1AYFA 1JWUD 3HUIA 1FM0D 2WDRB 2JZPA 1TZOA 4KX6B 2JSVX 1NYQA 2KWDA 1DOYA 1ROEA 4YTPB 2W54A 4R3DA 2JXTA 2JYEA 4A55A 2W55A 1XEEA 2WXPA 1L0XB 2XNAC 3R2TA 3VRBB 1MVKA 2WXOA 1WXQA 2BS3B 2RPVA 1TKEA 4MACA 3TUOA 1YQ3B 3AE1B 2Z8LA 1UUPA 2W3RA 3J9CA 5HG2A 2KAJA 3W9CB 1PGXA 1ET9A 1C9FA 2MH7A 1ZP0B 1GOZA 1WRIA 2WS3B 1KH0A 4ZOHC 1M4VA 2KDMA 2WXKA 4L23A 1C79A 3U52E 1YMHE 3ZJVA 4GLSC 3AEFB 1KLUD 3Q8AA 1E10A 2BTEA 5C3JB 4L2YA 4WURA 1NI3A 1PFDA 3GP7A 3B2FA 1N60A 5I4DA 4RGTA 1TKGA 1ET6A 2SEBD 3AECB 3AE3B 2BB6A 1C76A 1FXAA 3CF4A 2PW9A 5EE9A 2IDYA 2WDVB 1WGKA 2QEJC 1EWYC 3W5UB 1ZPSA 4OZBA 5BMIA 1A70A 2JYTA 4JE3B 1BXTA 1GTEA 2CJNA 1FNUA 1C4PA 3I57A 3BVGA 1HZ5A 4OW0A 3EGRA 3ZJUA 1F2RI 5LNK1 2I38A 5FKAC 1C4AA 1JWBD 3CIRB 3FC4A 1K51A 1FXIA 2W82A 1H7XA 2WXIA 1K50A 2RDGA 3SEBA 1CQVA 1LO5D 2MJDA 3P42A 5HFYA 3FAHA 5G5GA 3MJ5A 1L4DB 2YEPF 1HZ6A 1XF5L 3BVMA 3P4PB 1OQQA 3AH7A 1JWSD 4CQNA 1WYGA 2LHDA 2WLBA 3NVWA 1NEKB 5EE3A 1FNWA 3ABVB 4REZA 2K9XA 1JWAD 1Q10A 2E6XA 3EA6A 3T3OA 1KF6B 1N5WA 2LFIA 1L6UA 3P63A 2BB5A 5BMGA 2LHEA 4P16A 4TSSA 4RGOS 4A90A 3I9V1 4JX1C 3MHZA 1SB3C 2V4IB 3AEGB 4A9AA 3KLSX 1AN8A 3NS1A 3MFGA 4LLGM 1IBXB 1T6BX 1VR9A 3WCQA 4ZHOA 1WSPA 3PZ8A 2CU3A 1AWDA 5FK9C 1VDVA 3P4QB 1T3QA 5AUKA 4MT5A 4YSZB 1P7EA 2JX5A 1PDXA 1QOGA 3LXFA 5G5HA 2LGIA 2M0AA 1SE3A 3P1MA 3ZQ4A 1ZXHA 1STEA 4XWTA 1V1OA 4C80A 5MPOA 1YQ4B 4DXFA 1VZ8A 2J4XA 2PKOA 1IGDA 1XO3A 2QSDA 1MHXA 1FNVA 5BYSA 2LJIA 4A8XC 1F77A 2IGHA 1HEZE 3DWMA 1MI0A 3W2DA 1FCLA 1GT8A 2BYTA 1JWMD 2KN4A 1YJJA 2JWUA 2WXGA 1UWMA 3SFDB 1UGJA 3AEAB 1VZ6A 1DGJA 1V97A 1E7PB 3AMZA 3URYA 1RWSA 2E3TA 2M56B 3B9JA 4IDIA 4NJCA 1E6EB 1P7FA 4XDCA 2DYMA 4HEA1 4L1BA 4UDUC 2FE8A 2H89B 1QLBB 2AX5A 2L1AA 2I2YA 1D6EC 3BK2A 4XE0A 2L52A 1PYWD 1SXTA 2N7JA 2IPKD 1C78A 1L4ZB 4FXCA 1K52A 3KWLA 3V05A 1F2RC 1FEHA 1HXYD 2DWQA 3GB1A 3IAS1 1JW9D 4ZRQA 3BWUD 1FCCC 1DOIA 3PZ7A 2DYOA 2JQRB 3AB5A 2Y3AA 3EUB2 5D7GA 3IXSA 2WXRA 1EU4A 2K5PA 3RPFC 1HQRD 2MEKA 2WDQB 3N9YC 3W5VB 3VR8B 2DLBA 2N0SB 4B0EA 1BUIC 4NZLB 1CJEA 2WXFA 1TKYA 3AE8B 3HVZA 1N63A 3IAM1 1R7SA 4US9A 1EU3A 4J3OD 3BK1A 4WQMA 2TSSA 3KQ4A 5C2TB 1YNTE 1GTHA 2LMCA 1QOFA 1B1ZA 3AV8A 1YJIA 3CWIA 3E9SA 1WWTA 2PIAA 4YWGG 1AW7A 2NTTA 4KGTA 2H88B 2GI9A 1SSNA 1Y56A 5JXVA 5HHDG 2OHFA 4YSXB 4LTUA 5BYQA 2ICIA 4IOIE 2Y5CA 4C7ZA 1QF6A 3V3XA 4LK0M 2NTSA 1L0YB 4IKGA 4MH8A 1N62A 1JMLA 2PTLA 1J7CA 1TY2A 3AE9B 3TEZA 2J52A 2WP9B 3FILA 4RFBA 4TMAB 5H92C 4ARCA 2Q5WD 3NVYA 1D5ZC 2INNE 3AE2B 5BMHA 2K22A 3B2GA 1JROA 1OQRA 3Q8EA 4HKZE 5TSSA 1GB4A 2AQ3B 2EELA 3NRZA 3VQIA 1MPEA 4JPSA 1JQ4A 2LUMA 2ZW1A 2BS4B 1ZDVA 2K3UA 5GXGB 4XWWA 2IGDA 2WXJA 3VR9B 1I4RA 1TJEA 2G9HD 2AQ2B 1DOXA 1TY0A 2SAKA 4ZYSA 4NAWB 1MHHE 1QQRA 2L32A 3ETRA 1JALA 4O1NA 4MM3B 3E56A 1IGCA 4PT5A 4RF0A 4RGMA 3TEWA 4USAA 2J53A 2JU6X 4HKQA 1J7AA 3GS2A 2QIEB 1KFYB 2IJ0A 2M19A 2BBCA 3AE6B 2RDHA 1V1PA 3HRDD 1TS5A 1TYGB 1EWCA 1D5MC 1ENFA 4JWUC 1KTKA 2ONQA 2G1EA 1C77A 1SIJA 4ITKA 3TSSA 1KRHA 1B9RA 3U4EG 5D3DA 3KWVA 4OZAA 4YTNB 4RH6A 4US8A 1L0VB 2WU2B 4KGRA 4KKJA 4KGSA 2PVOD 3T3NA 4ZRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQR B;  3AB5 A;  3EUB 2;  1FRR A;  2K5P A;  3CIR B;  3FC4 A;  2FBW B;  3RPF C;  1RM6 C;  2BT6 A;  1QOA A;  1FXI A;  2CJO A;  1H7X A;  2WDQ B;  1CZP A;  2MJD A;  3W5V B;  3VR8 B;  2N0S B;  4HRO A;  3FAH A;  5G5G A;  3ZYY X;  1IUE A;  1CJE A;  1TKY A;  3L4P A;  3AE5 B;  3AE8 B;  3P4P B;  1NYR A;  2BS2 B;  1N63 A;  1N5X A;  3DWG C;  3HVZ A;  1FRD A;  1R7S A;  4US9 A;  1OQQ A;  3AH7 A;  4C7Y A;  3AE4 B;  1H7W A;  1WYG A;  4WQM A;  5C2T B;  2WLB A;  1GTH A;  4YSY B;  2KMM A;  3NVW A;  1QOF A;  1NEK B;  3AV8 A;  1FIQ A;  5EE3 A;  1YJI A;  1L5P A;  4N58 A;  3CWI A;  1GPX A;  1VLB A;  4WWM A;  3ABV B;  1E0Z A;  1WWT A;  2PIA A;  2K9X A;  3P4S B;  1I7H A;  1JWA D;  1GAQ B;  1RYJ A;  2WQY B;  2DBY A;  1ZOY B;  1KF6 B;  1N5W A;  2H88 B;  4YXD B;  1JRP A;  1L6U A;  3P63 A;  5EE0 A;  1SF0 A;  2OHF A;  4YSX B;  1XLQ A;  4LTU A;  4P6V F;  1L6V A;  5AUI A;  4JX1 C;  2Y5C A;  4C7Z A;  2PVG C;  2B76 B;  1QF6 A;  1E9M A;  3AE7 B;  1SB3 C;  2W3S A;  1FFU A;  3BII D;  1NEN B;  3P4R B;  3AEG B;  1VJK A;  4YTM B;  4A9A A;  4N6E B;  3NS1 A;  1AYF A;  4YT0 B;  3HUI A;  1FM0 D;  2WDR B;  3WCQ A;  4KX6 B;  1N62 A;  2EKI A;  1NYQ A;  4ZHO A;  1DOY A;  1ROE A;  1FMA D;  4YTP B;  2W54 A;  1J7C A;  2CU3 A;  3AE9 B;  1AWD A;  1VDV A;  2WU5 B;  1XLN A;  2WP9 B;  3P4Q B;  1T3Q A;  2W55 A;  5AUK A;  5H92 C;  2Q5W D;  3NVY A;  4YSZ B;  2JX5 A;  3LXF A;  1PDX A;  3AE2 B;  1QOG A;  2K22 A;  2HTM E;  5G5H A;  3B2G A;  1JRO A;  3VRB B;  2ACZ B;  1OQR A;  3P1M A;  1XLP A;  3NRZ A;  1OFF A;  1WXQ A;  3SR6 A;  2BS3 B;  1J7B A;  1JQ4 A;  1ZUD 2;  1ZXI A;  4ZHP A;  4C80 A;  2BS4 B;  1TKE A;  5MPO A;  1YQ4 B;  3NVZ A;  5EE1 A;  1YQ3 B;  3AE1 B;  2PKO A;  1QT9 A;  1XO3 A;  5GXG B;  2W3R A;  4N59 A;  3VR9 B;  1TJE A;  2KAJ A;  3W9C B;  1DOX A;  3DWM A;  1GT8 A;  2MH7 A;  1FO4 A;  1ZP0 B;  5H8Y E;  3SFE B;  1WRI A;  2WS3 B;  3PO0 A;  1YJJ A;  4HRS A;  3ETR A;  2MJ3 A;  1JAL A;  1UWM A;  1N61 A;  3SFD B;  1XLO A;  3NVV A;  3AN1 A;  1RFK A;  3AEA B;  4ZOH C;  1DGJ A;  1V97 A;  3AEF B;  2LEK A;  4USA A;  1E7P B;  1V8C A;  3AMZ A;  1J7A A;  1FFV A;  2QIE B;  1E10 A;  1KFY B;  5C3J B;  1F0Z A;  1NI3 A;  1PFD A;  1RWS A;  2M19 A;  2MJE A;  2E3T A;  3B2F A;  3LB8 C;  2M56 B;  3AE6 B;  1N60 A;  3HRD D;  1TYG B;  1TKG A;  3B9J A;  4IDI A;  3AEC B;  3AE3 B;  1E6E B;  2QJL A;  1FXA A;  3CF4 A;  5EE9 A;  3AM9 A;  2WDV B;  4JWU C;  3AEB B;  1WGK A;  2H89 B;  3AED B;  2G1E A;  1EWY C;  2L83 A;  1QLB B;  2AX5 A;  1SIJ A;  3VRA B;  3AEE B;  4ITK A;  3W5U B;  1A70 A;  2L52 A;  1KRH A;  1B9R A;  2CJN A;  1GTE A;  1PUT A;  4FXC A;  4YTN B;  3KWL A;  4US8 A;  1L0V B;  2WU2 B;  1NVI D;  2DWQ A;  1JW9 D;  2PVO D;  1QOB A;  1DOI A;  1JWB D;  4JWS C; 
#chains in the Genus database with same CATH topology
 1FRR A;  3AI5 A;  1E7V A;  2CJO A;  3UIP B;  1C4C A;  1SJH D;  4RF1 A;  2IBI B;  2WNM A;  2C7M B;  2NVU I;  2K0P A;  3ECI A;  1KOT A;  2KQ4 X;  2G3Q B;  1FIQ A;  2G45 B;  4M8N A;  4N58 A;  4ACF A;  2BGF A;  1TS2 A;  3B0A A;  1XLQ A;  2BW2 A;  5E6O A;  2OJR A;  3A9K B;  3AE7 B;  1RAX A;  1RFA A;  1Q0W B;  1UWX A;  2WXM A;  3UI3 A;  2NR2 A;  2K39 A;  3A33 B;  1UGM A;  2GBN A;  1XLN A;  2HDE A;  2Y5P A;  1KLG D;  3GZN B;  5DPS A;  2HTM E;  3R8B A;  1T0Y A;  2ACZ B;  4K7W A;  1XLP A;  3O13 A;  1OFF A;  3KUZ A;  1ZXI A;  2JZ3 B;  3NVZ A;  2GB1 A;  3TEY A;  4N59 A;  2O6V A;  3ZLZ A;  3Q8C A;  1I4Q A;  1Z2M A;  3PO0 A;  3M3J A;  3K9O B;  1MG8 A;  1RFK A;  1XT9 B;  2LEK A;  5EDS A;  1F0Z A;  1FFV A;  4XDD A;  4RM8 A;  2QIL A;  4KDL B;  3LB8 C;  1VZ7 A;  1PGA A;  1R4M B;  2UYZ B;  2QJL A;  4M0W A;  5AZF A;  5J18 A;  3AEB B;  1QKZ A;  2L83 A;  1NI2 A;  1J19 A;  4F1S A;  1PUT A;  3FIL B;  5C1Z A;  1XQQ A;  1I4G A;  4PS3 A;  3S2A A;  2BT6 A;  2BWF A;  4HJG E;  3DOW A;  4HRO A;  3A9J B;  1HA5 A;  2ON8 A;  5CHV C;  4C56 C;  3DWG C;  2WXN A;  3AE4 B;  3IT6 B;  1WGH A;  3OLM D;  4E3C A;  1WMH A;  2RMM A;  2FID A;  2AL3 A;  4B0M A;  1E0Z A;  1FPY A;  2QDF A;  3DBR I;  4G11 A;  4TQ1 A;  3NUH B;  1SF0 A;  4NJ6 A;  3KUD B;  4W9K A;  3KW5 B;  1ESF A;  2MBH A;  3RFZ B;  1DYQ A;  3U7Z A;  2W3S A;  1FFU A;  4BBN C;  1AYF A;  1JWU D;  3ML8 A;  1TZO A;  4KX6 B;  1DOY A;  2KWD A;  3L08 A;  2QHO A;  2W55 A;  3SD5 A;  2Z59 B;  3NZU A;  3R2T A;  2CHZ A;  2NPT A;  2KDB A;  3RNG C;  3PSE B;  3TUO A;  2Z8L A;  2C5L C;  5D2M B;  3R66 C;  1GUA B;  4AJW A;  1WM3 A;  2KAJ A;  1PGX A;  2KXJ A;  3ZVV A;  4II2 B;  4NJ7 A;  3DVG X;  2WS3 B;  3DVN U;  4JLC A;  3ZKJ C;  2WXK A;  3U52 E;  4GLS C;  4HK2 A;  2GOW A;  3GE3 C;  3NZS A;  3QX1 A;  2KTR B;  3TL5 A;  1Q5W B;  4RGT A;  3ZNG C;  1RRB A;  3L54 A;  2QEJ C;  1WR1 A;  5J17 A;  2KJ6 A;  1A70 A;  1TBE A;  3OAW A;  4WJN A;  4ZYN A;  1GTE A;  1C4P A;  2XK5 B;  4LNF A;  1C4A A;  4AOF A;  2M1M A;  2W82 A;  2MJD A;  2KT7 A;  3ZW3 A;  1L4D B;  3P4P B;  4NAW A;  1OQQ A;  1JWS D;  4CQN A;  1SIF A;  2LHD A;  1WI0 A;  1JWA D;  1V2Y A;  2AWT A;  1KF6 B;  1N5W A;  2LFI A;  2NBW B;  1L6U A;  3P63 A;  4P16 A;  2J0M A;  4A90 A;  2ASQ A;  1E8Z A;  3ZRF A;  1SB3 C;  3RYT A;  2V4I B;  3AEG B;  2IND C;  4LLG M;  2PPH A;  3DQV A;  1AWD A;  3N30 A;  1L7Y A;  5AUK A;  3WAL A;  1QOG A;  2L7R A;  3ZTD A;  3ZQ4 A;  5KHO A;  4C80 A;  5MPO A;  4DXF A;  1VZ8 A;  3WAO A;  1XO3 A;  2FUH B;  2QSD A;  3RD2 A;  2LJI A;  4MEM A;  1F77 A;  3W2D A;  1MI0 A;  3PHW B;  1JWM D;  2L05 A;  1YJJ A;  1UWM A;  1ZKH A;  3N1Z C;  2AEH A;  3URY A;  4E71 A;  3D32 A;  2M56 B;  1S1Q B;  4I6P A;  1OEY J;  3RUI B;  1V86 A;  1HTQ A;  4L1B A;  2ZVO A;  4UDU C;  2LGX A;  1QLB B;  4FLH A;  2L1A A;  5D94 A;  3BK2 A;  2CKH B;  2N7J A;  5E6N A;  2KFK A;  5JZE B;  4FA6 A;  4FXC A;  1FEH A;  3GB1 A;  3IAS 1;  3BWU D;  2M0X A;  4BKS D;  4I6L B;  2WXR A;  1EU4 A;  4IWP A;  3VR8 B;  3PV1 A;  2WXF A;  3AE8 B;  3HVZ A;  3IAM 1;  2DHZ A;  1R7S A;  3ZTC A;  3U30 A;  3VDZ A;  3KQ4 A;  1WY8 A;  2JZZ A;  1GTH A;  1QOF A;  2LD9 A;  3CWI A;  3GOE A;  1MFW A;  1YJ1 A;  4YWG G;  1AW7 A;  3PRP B;  1LM8 B;  3QC8 B;  1SSN A;  5BYQ A;  3PLV A;  4IOI E;  2Y5C A;  1QF6 A;  4MJS B;  4IKG A;  4KVG B;  4S17 A;  1E5W A;  4MH8 A;  3M95 A;  4KIK B;  2D3C A;  4P7I A;  3APD A;  3Q6B A;  1J7C A;  3H6N A;  3AE9 B;  2JXX A;  3KYD D;  4RFB A;  2Q5W D;  2KNB A;  2JF5 A;  2L0T A;  2AQ3 B;  3VQI A;  3DBL B;  3QHT A;  4WJP A;  4XWW A;  2IGD A;  2LRW A;  2G9H D;  3Q3O C;  3VFK A;  4ZYS A;  2KMC A;  3PGE A;  2IY0 B;  5CTR C;  2JVC A;  2LZ6 A;  4B6W A;  4MM3 B;  4PT5 A;  3TEW A;  4K7U A;  4LNN A;  2J53 A;  4HKQ A;  1J7A A;  3GS2 A;  1TZ1 A;  3AE6 B;  2RDH A;  3VTV A;  3W1Y A;  3NG0 A;  2KJH B;  1WX9 A;  2RDB C;  1WXA A;  4JWU C;  2D3A A;  4C4V B;  2ONQ A;  5D6J B;  3HM6 X;  1KRH A;  2L8J A;  3MJW A;  2DZK A;  4OZA A;  2W9N A;  1WF9 A;  4YTN B;  4EUT A;  3RNB C;  3UIO B;  1WE7 A;  1TIF A;  2EKE C;  2MRP A;  2HE7 A;  2OJW A;  3LYY A;  1RM6 C;  2VZK D;  1SBB B;  2L76 A;  1N6Z A;  2FUG 1;  3N20 C;  3ZYY X;  2WXL A;  2D5G A;  1NYR A;  1N5X A;  3OJ3 A;  2I1J A;  4TQ0 A;  4ARI A;  2INP E;  1LXD A;  4JIO U;  3V6E B;  1VLB A;  4FHJ A;  2MX2 A;  4WWN A;  1CK1 A;  3BVZ A;  3AXC A;  1FD6 A;  2KDF B;  2J7Q B;  4EEW A;  4WIP A;  4PYZ A;  1TTN A;  2MHJ A;  4H2A A;  1WGR A;  4P6V F;  2V3N A;  4EE2 A;  4W9L A;  2PVG C;  3JSV B;  2J42 A;  1WX7 A;  3B08 A;  3OWE B;  4WQO B;  4MDK E;  4OZC A;  3IT4 B;  2J0J A;  3AU4 A;  3L13 A;  1I4X A;  1ZW7 A;  2LXA A;  4DDI D;  1SE4 A;  2N9P C;  5IAA C;  2BKR B;  4IWO A;  4KV2 A;  4RCO A;  4IM2 A;  1J7B A;  3IVF A;  5EE1 A;  3WAM A;  1T0R C;  3ZJT A;  4LNK A;  4MGI E;  5DPW A;  3SU8 X;  3RN9 C;  2WXQ A;  2HJ1 A;  1PGB A;  4HRS A;  1SE9 A;  3NVV A;  3AN1 A;  2PMV A;  2AL6 A;  2G4D B;  2MJE A;  2KVZ A;  1P0R A;  2NMQ A;  2JUO A;  1HTO A;  4GGQ A;  1IBX A;  5FR3 A;  2FCQ A;  3Q3F A;  1ZDX A;  4LDT D;  1NVI D;  3HVD A;  1QOB A;  2KX3 A;  4WWO A;  2V0G A;  2C9W B;  3ONS A;  3U8Z A;  2O2V A;  1S3S G;  4GDL B;  4P1C C;  3HHM A;  4ZRI A;  1GPX A;  5T8I A;  3V60 A;  1Q1O A;  4AUQ C;  4J6I A;  4BKT A;  4KKI A;  1GAQ B;  3CST A;  3NJT A;  5L83 A;  1TS3 A;  3PVL A;  1V1P B;  2BF8 B;  3MC0 B;  1HE8 A;  2ZJD A;  3P4R B;  3H7P B;  1Y8R C;  2KC1 A;  3WIM A;  4FAD A;  1FM0 D;  1UBQ A;  4R3D A;  2KAN A;  2WX1 A;  3VUY A;  4OVU A;  3VRB B;  1MVK A;  2WXO A;  3A1Q A;  4WJQ A;  2BS3 B;  1XD3 B;  2RPV A;  4IWQ A;  2VRR B;  3AE1 B;  3N3K B;  1UUP A;  3W9C B;  4G50 A;  1LGR A;  4DBG A;  1C9F A;  2KJR A;  3NY5 A;  2PE9 A;  1UF0 A;  1KH0 A;  1F1H A;  4TUU A;  2L3Z A;  1YMH E;  2BYF A;  1KLU D;  3MC9 A;  3B1L X;  5C3J B;  4WJO A;  3GP7 A;  2IO0 B;  3UGB B;  4W9H A;  1N60 A;  1TKG A;  5CHW A;  1ET6 A;  2SEB D;  2BB6 A;  1C76 A;  2PW9 A;  2IDY A;  1WGK A;  1ZPS A;  2QCZ A;  4OZB A;  4DDG D;  1R4N B;  4JE3 B;  5C23 A;  1WH3 A;  2MQJ A;  3DVG Y;  4IM3 A;  4G3X B;  4AJY B;  2NS5 A;  3ZJU A;  1EO6 A;  5FKA C;  3UQA A;  3WAN A;  2IYD B;  3CIR B;  1K51 A;  3SHQ A;  1P98 A;  2WXI A;  2RDG A;  3SEB A;  1CQV A;  1LO5 D;  3P42 A;  4F7Z A;  2WWZ A;  2O6V B;  2D11 A;  2IY1 B;  5G5G A;  1HZ6 A;  2LVQ A;  4YL8 A;  1WFY A;  4HXD A;  5JHA A;  4DXA B;  2WLB A;  3AU5 A;  4HPM B;  3C19 A;  4G0N B;  4HCN B;  3T3O A;  3ZIM A;  4ANV A;  2JWZ A;  2BB5 A;  3APF A;  5BMG A;  3ZXV A;  4RGO S;  2MWS B;  4M0W B;  2NBV B;  4NY0 A;  2MSE D;  1AN8 A;  4A20 A;  3VXW A;  1WSP A;  1X1M A;  2CU3 A;  2RSU A;  5FK9 C;  5BO4 B;  4MGK E;  2MBB B;  4MT5 A;  4YSZ B;  1P7E A;  2JX5 A;  3LXF A;  4BVU C;  1SE3 A;  1ISN A;  3PRZ A;  1STE A;  1V1O A;  2CR5 A;  2J4X A;  4M01 A;  5CX3 A;  5LLI A;  1FNV A;  4BKS A;  4EFO A;  4TKN A;  3Q3M C;  1GT8 A;  2VH2 A;  1WMH B;  2WXG A;  3DBH I;  3SFD B;  1UGJ A;  3AEA B;  1V97 A;  4PS8 A;  4KZC A;  1RWS A;  2E3T A;  1F9J A;  4NNJ B;  3ZRC A;  4MSM B;  3B9J A;  2N7D A;  2LRU A;  1E6E B;  1YX6 B;  4BAX A;  2INC C;  4BKG A;  3M62 B;  2AX5 A;  1D6E C;  3RCZ A;  1SXT A;  3C0R B;  4JQW C;  3TJP A;  4HPP A;  1K52 A;  3KWL A;  1HXY D;  2DWQ A;  1JW9 D;  2NPT B;  1IPG A;  2DYO A;  3QAQ A;  3AB5 A;  2Y3A A;  5D7G A;  4A3O A;  1HQR D;  2N1W A;  2MEK A;  4GDK A;  1M94 A;  2DLB A;  1BUI C;  3VAW A;  1CJE A;  2RD0 A;  1N63 A;  4US9 A;  3U7D A;  1JRU A;  3BK1 A;  2KZR A;  2GBR A;  2KMA A;  2LMC A;  1YJI A;  5CHF A;  3TBL D;  2PIA A;  3QA8 A;  3W1S C;  2NTT A;  2H88 B;  3QQ8 B;  3T9L A;  3OJ4 B;  4YSX B;  4LTU A;  3HK0 A;  2M8S A;  3PPA A;  4LNI A;  1GC7 A;  2WYQ A;  5DPT A;  3Q3J A;  1N62 A;  1V5O A;  1TY2 A;  3TEZ A;  5H92 C;  1T0S C;  3NOB A;  3NVY A;  3AE2 B;  5BMH A;  2FCM A;  3NRZ A;  4HVB A;  1MPE A;  1YOV B;  1JQ4 A;  2LUM A;  1CMX B;  4IUM B;  2K3U A;  2V4L A;  1I4R A;  2IO1 B;  1DOX A;  1TY0 A;  4M00 A;  3RNE C;  4NAW B;  3EEC A;  1QQR A;  2EMT A;  4CYE A;  2N7E A;  1GJZ A;  1IGC A;  4RF0 A;  4USA A;  3VTW A;  5IA7 A;  4HLE A;  2QIE B;  4DHJ B;  1KFY B;  3X0W A;  2IJ0 A;  2BBC A;  4F8C B;  3HRD D;  1TS5 A;  3FKY A;  1FXT B;  1WYW B;  3T8M A;  2GMI C;  3DHG C;  2KLG A;  1KTK A;  1SIJ A;  3VHT C;  2KO3 A;  4GMV A;  4W9G A;  4US8 A;  4KGR A;  2KDE B;  4KGS A;  1GG3 A;  2M4N A;  3EFC A;  2KAC A;  1K8R B;  1MJD A;  2UWQ A;  3CF6 E;  1OQY A;  1ZE3 D;  2LVO A;  3ZNZ B;  1OGW A;  4K3B A;  2RGF A;  4D2K A;  3MP9 A;  3NZ3 A;  3N1X C;  1XXG A;  3BZD B;  2KMM A;  2FCN A;  1L5P A;  4WWM A;  1WJ4 A;  4M02 A;  1RYJ A;  3RZF A;  1T5X D;  2MBO A;  4TV3 A;  1YX5 B;  1EUV B;  2X38 A;  2B76 B;  2RR9 A;  2D3B A;  3BII D;  3Q8F A;  4N6E B;  4EZK A;  3RT3 B;  4DK5 A;  1WGY A;  4RNA A;  2EKI A;  2BQQ A;  4OVZ A;  2KFK B;  2YEP B;  4IG7 B;  1VRA B;  1E8W A;  2N9X A;  5BYR A;  1K53 A;  1L2N A;  2R61 A;  2KFJ A;  3GZN I;  1QT9 A;  3ZXR A;  4Q2J A;  1D4B A;  3M63 B;  1TT5 B;  4IW0 A;  3P2B A;  2HJ8 A;  4II3 B;  1E8Y A;  2D10 A;  4KSL C;  2AQ1 B;  5H8Y E;  3TEX A;  2MJ3 A;  3W1S A;  4MH0 E;  4B95 A;  2ZNV C;  2C7H A;  2KC2 A;  2XN9 C;  2MLB A;  1I4H A;  2WDT B;  4AS1 A;  5HI1 A;  1SE2 A;  3AM9 A;  2IZV B;  1R4M I;  4HDQ A;  2WXH A;  3VRA B;  3AEE B;  4NAM A;  1T0Q C;  2CU1 A;  1E8X A;  3DVN V;  4WH4 A;  3A4R A;  4P1B C;  1ACC A;  2GRI A;  1JCK B;  1GB1 A;  2LGY A;  3I63 C;  1WXS A;  3JVZ X;  1UNS A;  4K1R B;  2N9K A;  3VH3 B;  2B3A A;  2DX5 B;  4DQO C;  2CS4 A;  2JRH A;  1EF1 A;  1YN4 A;  2MA9 B;  3OG5 A;  2ZW0 A;  1SJE D;  1YN3 A;  3DBR B;  1TS4 A;  4YSY B;  2BVC A;  1D5X C;  5D3I B;  4FJV B;  3P4S B;  1I7H A;  4A6Q A;  5GMV A;  2ZCB A;  1JRP A;  1YD8 U;  1XCQ L;  2D07 B;  1NEN B;  1VJK A;  2K8H A;  2BYV E;  2DNF A;  3VH4 B;  4M8M A;  4HCP B;  3HUI A;  2JZP A;  1NYQ A;  1ROE A;  1AAR A;  4YTP B;  3NHE B;  2JXT A;  2JYE A;  1WGD A;  4A55 A;  2MP2 A;  1XEE A;  1L0X B;  2XNA C;  3DPD A;  4EZL A;  1TKE A;  2YLM A;  4MAC A;  1YQ3 B;  2W3R A;  3L10 B;  1YIW A;  5DPR A;  3V61 A;  4DWF A;  5J2R A;  3HIZ A;  1ZP0 B;  4CHK A;  1GOZ A;  3IHP C;  1WRI A;  1WR6 E;  4EOY A;  1M4V A;  2KDM A;  5L95 C;  1UH6 A;  2BTE A;  4L2Y A;  1PFD A;  1KLV A;  4MSQ B;  3KH0 A;  2D3G A;  4FHK A;  1FXA A;  3CF4 A;  5EE9 A;  1EWY C;  1U4A A;  3W5U B;  4W9E A;  2JYT A;  4ANU A;  1WGG A;  1BXT A;  2CJN A;  1WE6 A;  1HZ5 A;  4A3P A;  4OW0 A;  3EGR A;  4BBN F;  3FC4 A;  3L17 A;  3PS6 A;  1FXI A;  2K8C A;  1K50 A;  2L00 B;  3UIN B;  4ZDV A;  4W9C A;  2YEP F;  1XF5 L;  3ZDM C;  3AH7 A;  2KTF A;  2ZEQ A;  3TMP B;  4IM0 A;  1NEK B;  5EE3 A;  3ABV B;  4REZ A;  2RPQ A;  2E6X A;  1F52 A;  2DZJ A;  2KYW A;  4XZ4 A;  4TSS A;  1V5T A;  3NS8 A;  2LVP A;  3MHZ A;  5JHB A;  1V49 A;  3NS1 A;  1IBX B;  1T6B X;  2KWU B;  3WCQ A;  3PZ8 A;  2KN5 A;  1VDV A;  1T3Q A;  2ZNV B;  1V6E A;  1WXM A;  1PDX A;  2LGI A;  3X23 A;  2L0F A;  1ZXH A;  4EKU A;  2KQS A;  4XWT A;  4RM9 A;  2K8B A;  2PKO A;  2XBB C;  3PRE A;  1MHX A;  3L0W B;  5BYS A;  4A8X C;  3LDZ E;  2O2V B;  1MG4 A;  3V62 A;  3DWM A;  1FCL A;  4K3C A;  1UEL A;  2BYT A;  2KN4 A;  1GC6 A;  2A5U A;  2K1F A;  3AMZ A;  1NBF C;  2J0K A;  2C60 A;  4IDI A;  2UU7 A;  4NJC A;  2V9H A;  4E74 A;  3A9K A;  1P7F A;  4XDC A;  4KZ0 A;  4HEA 1;  4MGY E;  5LXI B;  3ZO5 B;  2I2Y A;  1TGZ B;  4XE0 A;  2JRI B;  2AYO B;  1C78 A;  1L4Z B;  3V05 A;  3R7Q A;  4ZRQ A;  3VUW A;  1FCC C;  5KHQ A;  3A1Q B;  3RNA C;  2JQR B;  3EUB 2;  3RPF C;  2LWP A;  2ZVN A;  3AUL A;  3N9Y C;  3W5V B;  2N0S B;  1TKY A;  2KWV B;  5G2N A;  1EU3 A;  5IN7 A;  2TSS A;  5C2T B;  1B1Z A;  4QAY A;  1C1Y B;  2GI9 A;  1V81 A;  1Y56 A;  5HHD G;  2PEA A;  1BT0 A;  2ICI A;  1WJ6 A;  3V3X A;  2BKF A;  4LK0 M;  1L0Y B;  1V9J A;  1JML A;  2MW5 A;  2DAJ A;  2PTL A;  2J52 A;  1E7U A;  3FIL A;  2LGS A;  2V3S A;  1D5Z C;  4N9F 4;  4W9D A;  3Q8E A;  4HKZ E;  1JRO A;  1OQR A;  1LQB A;  5TSS A;  2EEL A;  3ENE A;  2ZW1 A;  2MCN B;  2BS4 B;  5TR5 A;  1ZDV A;  4ANX A;  2GBJ A;  5GXG B;  3DBL I;  3VR9 B;  3A9J A;  3MHS D;  2AQ2 B;  2C7N B;  2SAK A;  2A4Z A;  2BWE S;  4O1N A;  3ALB A;  3E56 A;  3RUL A;  2LI5 A;  3H7S A;  2JU6 X;  1WIA A;  1V80 A;  3I5J C;  4FBJ B;  3ML9 A;  1IP9 A;  1TYG B;  4IC7 B;  1ENF A;  4LNO A;  4DHZ B;  1C77 A;  4ITK A;  2KX0 A;  2D2Q A;  4PYU A;  3L16 A;  2KWC A;  4FN2 A;  2DEN B;  4RH6 A;  2WU2 B;  4KKJ A;  2LGD A;  3PRM B;  3JW0 X;  3ZGZ A;  1J8C A;  3PLU A;  1CZP A;  3DHH C;  3TCA A;  3BYY B;  1IUE A;  3K9P B;  3DDC B;  3ZDT A;  2BS2 B;  1I42 A;  1FRD A;  3H9D A;  4C7Y A;  5DCN A;  1H7W A;  4K81 A;  1E90 A;  2BYE A;  3U2S C;  5JH5 C;  2JPH A;  4I6N B;  1XCT L;  3DBS A;  2WQY B;  2HD5 B;  2IGG A;  5AZH A;  5EE0 A;  2OED A;  2KTR A;  3Q3N C;  5AUI A;  1E9M A;  4KSK C;  4YT0 B;  1FMA D;  3R3M A;  4AQ7 A;  3I3T B;  1GNU A;  2WU5 B;  2ZZP B;  2XK5 A;  4KDI C;  2GBM A;  3PT2 B;  2DZM A;  3PTF C;  3SR6 A;  3UQB A;  1ZUD 2;  4ZHP A;  1WM2 A;  3WAP A;  1PQS A;  3RNF C;  4GDK B;  1I4P A;  2KOX A;  4BZA A;  5E6J A;  3R2I A;  4XGA B;  4NQL B;  2LAS A;  3BYT B;  3Q2A C;  1FO4 A;  2ZPN A;  5IKC M;  3SFE B;  2EMS A;  1H4R A;  4RGN A;  1N61 A;  4LJP B;  1XLO A;  2IO2 B;  4ICV A;  2NCN A;  4S0R A;  4CO7 A;  1V8C A;  4DXG A;  2V3P A;  2DAF A;  1SEB D;  4XC2 A;  3PZD A;  1YN5 A;  2QMT A;  3ZNI D;  3AED B;  3BIN A;  3KUC B;  3V6C B;  3LJ3 A;  1BML C;  4WAF A;  5AEK B;  2N9L A;  4ASW C;  4EZJ A;  3Q8B A;  4OVV A;  3QWZ B;  4JWS C;  2O6V D;  2K6D B;  4MGZ E;  1VD2 A;  2FBW B;  3MTN B;  4BOZ B;  1QIL A;  1QOA A;  4NPN A;  3A4S C;  3VVW B;  4RMA A;  2XEW A;  3CSF A;  3L4P A;  1OTR B;  3AE5 B;  1UZX B;  2M17 A;  2VZK B;  3O65 B;  2PJH A;  4GOC A;  3TIX A;  2MBE A;  3H8H A;  2FAZ A;  2N4F A;  2FCS A;  4GIV A;  3C8Y A;  2DBY A;  3Q69 A;  1ZOY B;  4OHJ A;  4W9I A;  1EM7 A;  3UF8 A;  2Y5B B;  4YXD B;  2FNJ B;  3QJZ A;  5IP4 D;  1L6V A;  2CHX A;  4YTM B;  2PLP A;  2WDR B;  2JSV X;  3RNC C;  2W54 A;  2X8X X;  4PS7 A;  2WXP A;  2WGS A;  2G4S A;  1UBI A;  1WXQ A;  2N9E B;  3J9C A;  5HG2 A;  1H8C A;  2Z0D B;  1ET9 A;  3EC8 A;  4K7S A;  2MH7 A;  4ZOH C;  4L23 A;  1C79 A;  3ZJV A;  3QK0 A;  3AEF B;  3Q8A A;  1E10 A;  4WUR A;  1NI3 A;  3B2F A;  2KDI A;  5I4D A;  1EF5 A;  4URK A;  3AEC B;  3AE3 B;  1WX8 A;  4MJS A;  2WDV B;  2GBK A;  5IOI A;  3RZW C;  3DCG A;  5BMI A;  4ZRJ A;  4KIK A;  2NBU A;  2QC8 A;  1FNU A;  3I57 A;  3BVG A;  4AP4 C;  4W9F A;  4JL9 A;  1R4N I;  1F2R I;  5LNK 1;  2I38 A;  4DHZ E;  1JWB D;  1YQB A;  4LDT B;  1H7X A;  2WX0 A;  5HFY A;  3FAH A;  3MJ5 A;  3BVM A;  2WHI A;  1QZE A;  1P3Q U;  1WYG A;  3JYU A;  3NVW A;  4MM3 A;  1FNW A;  2K9X A;  2FIF A;  1Q10 A;  3EA6 A;  3RMK C;  3MC8 A;  2R2O A;  2LHE A;  4B9K A;  3I9V 1;  4JX1 C;  2CHW A;  2REX A;  2ZCC A;  2Z0E B;  4A9A A;  4C4V A;  3KLS X;  3MFG A;  1VR9 A;  3HM3 A;  4FJZ A;  3BY4 B;  4ZHO A;  3IFW B;  1Z5S B;  3SDL C;  3P4Q B;  1LFD A;  3APC A;  5G5H A;  2M0A A;  3P1M A;  2PE6 B;  2N1V A;  1YQ4 B;  3QIJ A;  1IGD A;  3KVF B;  3EHV A;  3N1Y C;  2K25 A;  2IGH A;  1HEZ E;  5LXH A;  3DBH B;  3QCA A;  4NQK E;  4DHJ D;  3H1U A;  2JWU A;  4X57 B;  1VZ6 A;  1DGJ A;  4ANW A;  1E7P B;  1G6J A;  2DYB A;  3VUX A;  1OEY A;  4GN1 A;  4ZRK A;  1WRD B;  1WZ0 A;  3JSV A;  2DYM A;  4W9J A;  2GLS A;  2FE8 A;  2H89 B;  1NDD A;  2L52 A;  1PYW D;  1J0G A;  3DHI C;  2KHW B;  2IPK D;  3IBE A;  2MP2 B;  2V1Y A;  1F2R C;  2LUE A;  1DOI A;  3VTU A;  3PZ7 A;  2MBQ A;  4BFR A;  2BPS A;  2HTH A;  3IXS A;  2K5P A;  3Q14 C;  2DZI A;  3KYC D;  2WDQ B;  2KVR A;  1A5R A;  4B0E A;  4NZL B;  4GXB A;  1VCB A;  4GU2 A;  4J3O D;  4WQM A;  3GE8 C;  1UD7 A;  1YNT E;  4LJO B;  2KKC A;  3AV8 A;  3WA0 A;  3E9S A;  1WJU A;  4BOS C;  1WWT A;  2JY6 A;  1WJN A;  4KGT A;  5JXV A;  2OHF A;  1ZGU B;  3N32 A;  5G55 A;  2KLC A;  4FUL A;  4C7Z A;  5FR6 A;  2NTS A;  4GB9 A;  3IG3 A;  4XYC A;  1KM7 A;  4ICU A;  3ZNH B;  2K6Q A;  4JGH B;  4TMA B;  2WP9 B;  2VH1 A;  4ARC A;  1IYF A;  2INN E;  2K22 A;  1P1A A;  2KK8 A;  3B2G A;  1GB4 A;  2ZPY A;  1C3T A;  3EFU A;  4JPS A;  4FJY A;  1WZ3 A;  2OOB B;  3R7R A;  2WXJ A;  1RLF A;  3ZUN A;  1TJE A;  2IO3 B;  2KD0 A;  4HPL B;  5AZG A;  1MHH E;  1D3Z A;  3QAR A;  4GDL A;  2L32 A;  2LJ5 A;  3ETR A;  1JAL A;  2LXC A;  4HDO A;  4RGM A;  4WWP A;  5E6P A;  1WXV A;  4LCD E;  2R2Q A;  4HJK A;  2M19 A;  4HWI B;  4PK1 A;  1I35 A;  1SGH A;  1V1P A;  2I1K A;  4GSW A;  1EWC A;  1D5M C;  3RI7 C;  4AWJ A;  3H7P A;  3CMM B;  2G1E A;  2KQ7 A;  3PHX B;  5HKH A;  1KJT A;  4C00 A;  4WAA A;  3TSS A;  5IO9 A;  1B9R A;  3U4E G;  5D3D A;  3KWV A;  2JT4 B;  4MEL A;  2YVC A;  1L0V B;  4XX5 A;  2PVO D;  1P9D U;  3T3N A;  4ZRP A; 
#chains in the Genus database with same CATH homology
 1FRR A;  3LYY A;  1RM6 C;  3ZGZ A;  2CJO A;  2KAC A;  2VZK D;  1C4C A;  1SJH D;  4RF1 A;  1CZP A;  1SBB B;  2WNM A;  2FUG 1;  1ZE3 D;  3BYY B;  3ZYY X;  1IUE A;  2WXL A;  2D5G A;  1NYR A;  2BS2 B;  1N5X A;  4D2K A;  1FRD A;  3MP9 A;  4C7Y A;  2K0P A;  4TQ0 A;  1H7W A;  3NZ3 A;  4ARI A;  2KQ4 X;  2INP E;  1XXG A;  3BZD B;  2KMM A;  3U2S C;  1FIQ A;  1L5P A;  4N58 A;  1VLB A;  4WWM A;  1XCT L;  1RYJ A;  1CK1 A;  2WQY B;  1TS2 A;  1T5X D;  3BVZ A;  2IGG A;  1FD6 A;  5EE0 A;  2OED A;  4WIP A;  1XLQ A;  4P6V F;  4H2A A;  2BW2 A;  5AUI A;  2V3N A;  4EE2 A;  2X38 A;  2PVG C;  2B76 B;  1E9M A;  3AE7 B;  2J42 A;  3BII D;  3Q8F A;  4N6E B;  3OWE B;  4YT0 B;  4OZC A;  3IT4 B;  1UWX A;  2EKI A;  2WXM A;  4RNA A;  3UI3 A;  4OVZ A;  1FMA D;  1I4X A;  2YEP B;  4AQ7 A;  1VRA B;  1SE4 A;  2WU5 B;  1XLN A;  2HDE A;  2Y5P A;  1KLG D;  3R8B A;  2HTM E;  5BYR A;  2ACZ B;  1K53 A;  1XLP A;  3O13 A;  1OFF A;  2R61 A;  3SR6 A;  4RCO A;  1J7B A;  1ZUD 2;  1ZXI A;  4ZHP A;  3NVZ A;  4GDK B;  5EE1 A;  1I4P A;  1QT9 A;  2GB1 A;  3TEY A;  3ZJT A;  4N59 A;  4Q2J A;  5E6J A;  1D4B A;  3R2I A;  3BYT B;  1FO4 A;  2AQ1 B;  2WXQ A;  3Q8C A;  1I4Q A;  5H8Y E;  3SFE B;  1PGB A;  3PO0 A;  4HRS A;  3TEX A;  4RGN A;  2MJ3 A;  3W1S A;  1N61 A;  1XLO A;  3NVV A;  3AN1 A;  1RFK A;  2PMV A;  2LEK A;  4DXG A;  1V8C A;  1F0Z A;  1FFV A;  4XDD A;  2QIL A;  2MJE A;  2V3P A;  3LB8 C;  1VZ7 A;  1PGA A;  2XN9 C;  1SEB D;  1I4H A;  4AS1 A;  5HI1 A;  2NMQ A;  1SE2 A;  2QJL A;  4M0W A;  1YN5 A;  2QMT A;  3AM9 A;  3AEB B;  2WXH A;  1QKZ A;  3AED B;  2L83 A;  3VRA B;  3AEE B;  1IBX A;  5FR3 A;  4NAM A;  1ZDX A;  1BML C;  1PUT A;  4WH4 A;  4WAF A;  2N9L A;  3FIL B;  1NVI D;  3HVD A;  3Q8B A;  1QOB A;  4JWS C;  1I4G A;  1ACC A;  2GRI A;  1JCK B;  1GB1 A;  2FBW B;  1QIL A;  2V0G A;  2BT6 A;  1QOA A;  4HJG E;  1UNS A;  2N9K A;  4HRO A;  4DQO C;  1HA5 A;  2ON8 A;  3L4P A;  3AE5 B;  4C56 C;  3DWG C;  1YN4 A;  2WXN A;  2VZK B;  4GDL B;  3AE4 B;  2ZW0 A;  3IT6 B;  1SJE D;  1YN3 A;  1TS4 A;  4YSY B;  3H8H A;  2RMM A;  1GPX A;  1D5X C;  5D3I B;  5T8I A;  4B0M A;  1E0Z A;  3P4S B;  1I7H A;  2DBY A;  1GAQ B;  3C8Y A;  3Q69 A;  4KKI A;  4A6Q A;  1ZOY B;  4OHJ A;  1EM7 A;  4YXD B;  1JRP A;  1TS3 A;  4TQ1 A;  3NUH B;  1SF0 A;  1V1P B;  1XCQ L;  3MC0 B;  1L6V A;  1ESF A;  3RFZ B;  1DYQ A;  3U7Z A;  2W3S A;  1FFU A;  1NEN B;  3P4R B;  1VJK A;  4YTM B;  2PLP A;  1AYF A;  1JWU D;  3HUI A;  1FM0 D;  2WDR B;  2JZP A;  1TZO A;  4KX6 B;  2JSV X;  1NYQ A;  2KWD A;  1DOY A;  1ROE A;  4YTP B;  2W54 A;  4R3D A;  2JXT A;  2JYE A;  4A55 A;  2W55 A;  1XEE A;  2WXP A;  1L0X B;  2XNA C;  3R2T A;  3VRB B;  1MVK A;  2WXO A;  1WXQ A;  2BS3 B;  2RPV A;  1TKE A;  4MAC A;  3TUO A;  1YQ3 B;  3AE1 B;  2Z8L A;  1UUP A;  2W3R A;  3J9C A;  5HG2 A;  2KAJ A;  3W9C B;  1PGX A;  1ET9 A;  1C9F A;  2MH7 A;  1ZP0 B;  1GOZ A;  1WRI A;  2WS3 B;  1KH0 A;  4ZOH C;  1M4V A;  2KDM A;  2WXK A;  4L23 A;  1C79 A;  3U52 E;  1YMH E;  3ZJV A;  4GLS C;  3AEF B;  1KLU D;  3Q8A A;  1E10 A;  2BTE A;  5C3J B;  4L2Y A;  4WUR A;  1NI3 A;  1PFD A;  3GP7 A;  3B2F A;  1N60 A;  5I4D A;  4RGT A;  1TKG A;  1ET6 A;  2SEB D;  3AEC B;  3AE3 B;  2BB6 A;  1C76 A;  1FXA A;  3CF4 A;  2PW9 A;  5EE9 A;  2IDY A;  2WDV B;  1WGK A;  2QEJ C;  1EWY C;  3W5U B;  1ZPS A;  4OZB A;  5BMI A;  1A70 A;  2JYT A;  4JE3 B;  1BXT A;  1GTE A;  2CJN A;  1FNU A;  1C4P A;  3I57 A;  3BVG A;  1HZ5 A;  4OW0 A;  3EGR A;  3ZJU A;  1F2R I;  5LNK 1;  2I38 A;  5FKA C;  1C4A A;  1JWB D;  3CIR B;  3FC4 A;  1K51 A;  1FXI A;  2W82 A;  1H7X A;  2WXI A;  1K50 A;  2RDG A;  3SEB A;  1CQV A;  1LO5 D;  2MJD A;  3P42 A;  5HFY A;  3FAH A;  5G5G A;  3MJ5 A;  1L4D B;  2YEP F;  1HZ6 A;  1XF5 L;  3BVM A;  3P4P B;  1OQQ A;  3AH7 A;  1JWS D;  4CQN A;  1WYG A;  2LHD A;  2WLB A;  3NVW A;  1NEK B;  5EE3 A;  1FNW A;  3ABV B;  4REZ A;  2K9X A;  1JWA D;  1Q10 A;  2E6X A;  3EA6 A;  3T3O A;  1KF6 B;  1N5W A;  2LFI A;  1L6U A;  3P63 A;  2BB5 A;  5BMG A;  2LHE A;  4P16 A;  4TSS A;  4RGO S;  4A90 A;  3I9V 1;  4JX1 C;  3MHZ A;  1SB3 C;  2V4I B;  3AEG B;  4A9A A;  3KLS X;  1AN8 A;  3NS1 A;  3MFG A;  4LLG M;  1IBX B;  1T6B X;  1VR9 A;  3WCQ A;  4ZHO A;  1WSP A;  3PZ8 A;  2CU3 A;  1AWD A;  5FK9 C;  1VDV A;  3P4Q B;  1T3Q A;  5AUK A;  4MT5 A;  4YSZ B;  1P7E A;  2JX5 A;  1PDX A;  1QOG A;  3LXF A;  5G5H A;  2LGI A;  2M0A A;  1SE3 A;  3P1M A;  3ZQ4 A;  1ZXH A;  1STE A;  4XWT A;  1V1O A;  4C80 A;  5MPO A;  1YQ4 B;  4DXF A;  1VZ8 A;  2J4X A;  2PKO A;  1IGD A;  1XO3 A;  2QSD A;  1MHX A;  1FNV A;  5BYS A;  2LJI A;  4A8X C;  1F77 A;  2IGH A;  1HEZ E;  3DWM A;  1MI0 A;  3W2D A;  1FCL A;  1GT8 A;  2BYT A;  1JWM D;  2KN4 A;  1YJJ A;  2JWU A;  2WXG A;  1UWM A;  3SFD B;  1UGJ A;  3AEA B;  1VZ6 A;  1DGJ A;  1V97 A;  1E7P B;  3AMZ A;  3URY A;  1RWS A;  2E3T A;  2M56 B;  3B9J A;  4IDI A;  4NJC A;  1E6E B;  1P7F A;  4XDC A;  2DYM A;  4HEA 1;  4L1B A;  4UDU C;  2FE8 A;  2H89 B;  1QLB B;  2AX5 A;  2L1A A;  2I2Y A;  1D6E C;  3BK2 A;  4XE0 A;  2L52 A;  1PYW D;  1SXT A;  2N7J A;  2IPK D;  1C78 A;  1L4Z B;  4FXC A;  1K52 A;  3KWL A;  3V05 A;  1F2R C;  1FEH A;  1HXY D;  2DWQ A;  3GB1 A;  3IAS 1;  1JW9 D;  4ZRQ A;  3BWU D;  1FCC C;  1DOI A;  3PZ7 A;  2DYO A;  2JQR B;  3AB5 A;  2Y3A A;  3EUB 2;  5D7G A;  3IXS A;  2WXR A;  1EU4 A;  2K5P A;  3RPF C;  1HQR D;  2MEK A;  2WDQ B;  3N9Y C;  3W5V B;  3VR8 B;  2DLB A;  2N0S B;  4B0E A;  1BUI C;  4NZL B;  1CJE A;  2WXF A;  1TKY A;  3AE8 B;  3HVZ A;  1N63 A;  3IAM 1;  1R7S A;  4US9 A;  1EU3 A;  4J3O D;  3BK1 A;  4WQM A;  2TSS A;  3KQ4 A;  5C2T B;  1YNT E;  1GTH A;  2LMC A;  1QOF A;  1B1Z A;  3AV8 A;  1YJI A;  3CWI A;  3E9S A;  1WWT A;  2PIA A;  4YWG G;  1AW7 A;  2NTT A;  4KGT A;  2H88 B;  2GI9 A;  1SSN A;  1Y56 A;  5JXV A;  5HHD G;  2OHF A;  4YSX B;  4LTU A;  5BYQ A;  2ICI A;  4IOI E;  2Y5C A;  4C7Z A;  1QF6 A;  3V3X A;  4LK0 M;  2NTS A;  1L0Y B;  4IKG A;  4MH8 A;  1N62 A;  1JML A;  2PTL A;  1J7C A;  1TY2 A;  3AE9 B;  3TEZ A;  2J52 A;  2WP9 B;  3FIL A;  4RFB A;  4TMA B;  5H92 C;  4ARC A;  2Q5W D;  3NVY A;  1D5Z C;  2INN E;  3AE2 B;  5BMH A;  2K22 A;  3B2G A;  1JRO A;  1OQR A;  3Q8E A;  4HKZ E;  5TSS A;  1GB4 A;  2AQ3 B;  2EEL A;  3NRZ A;  3VQI A;  1MPE A;  4JPS A;  1JQ4 A;  2LUM A;  2ZW1 A;  2BS4 B;  1ZDV A;  2K3U A;  5GXG B;  4XWW A;  2IGD A;  2WXJ A;  3VR9 B;  1I4R A;  1TJE A;  2G9H D;  2AQ2 B;  1DOX A;  1TY0 A;  2SAK A;  4ZYS A;  4NAW B;  1MHH E;  1QQR A;  2L32 A;  3ETR A;  1JAL A;  4O1N A;  4MM3 B;  3E56 A;  1IGC A;  4PT5 A;  4RF0 A;  4RGM A;  3TEW A;  4USA A;  2J53 A;  2JU6 X;  4HKQ A;  1J7A A;  3GS2 A;  2QIE B;  1KFY B;  2IJ0 A;  2M19 A;  2BBC A;  3AE6 B;  2RDH A;  1V1P A;  3HRD D;  1TS5 A;  1TYG B;  1EWC A;  1D5M C;  1ENF A;  4JWU C;  1KTK A;  2ONQ A;  2G1E A;  1C77 A;  1SIJ A;  4ITK A;  3TSS A;  1KRH A;  1B9R A;  3U4E G;  5D3D A;  3KWV A;  4OZA A;  4YTN B;  4RH6 A;  4US8 A;  1L0V B;  2WU2 B;  4KGR A;  4KKJ A;  4KGS A;  2PVO D;  3T3N A;  4ZRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...