4NPNA

Crystal structure of human tetra-sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
b'HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 2
publication title Structural analysis of poly-SUMO chain recognition by the RNF4-SIMs domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4npnA00
2KX0A 3B08A 2K1FA 2C7MB 5IA7A 2JT4B 4IUMB 3V61A 4B6WA 1J8CA 4G0NB 5D7GA 1ZGUB 2LRWA 3WAOA 5E6NA 3ZW3A 4II3B 2ZVNA 3WA0A 2D07B 4TV3A 1IPGA 1WXSA 2HJ8A 1WF9A 1WH3A 3DVNV 4MGYE 5E6OA 5L83A 3AXCA 1KLVA 4FLHA 3BINA 2LVQA 1CMXB 3UIOB 2GBMA 3IFWB 3H7PA 4G3XB 2M17A 2KDIA 3A9JB 3WALA 5LLIA 1UH6A 3PPAA 2K8HA 4NJ7A 5FR6A 2IO3B 4A3PA 2HTHA 4GXBA 2KHWB 1SGHA 2BYFA 1UGMA 2L05A 1GUAB 2KZRA 4GB9A 3QCAA 4IW0A 4LJPB 4TKNA 1G6JA 4LCDE 2O6VA 2BF8B 2JVCA 1D3ZA 2OOBB 1NBFC 4NY0A 5AZFA 1OTRB 4XX5A 3R7QA 2I1KA 2REXA 2ZCBA 3H7PB 2G4SA 2WX1A 3QQ8B 3QHTA 1EUVB 4W9GA 3JYUA 2KLCA 4MJSA 3QAQA 2ZNVC 1WJ4A 4FADA 3PGEA 3KVFB 2K25A 1WX8A 1YD8U 4W9CA 2KC2A 3JSVB 2LGDA 3EC8A 2N1VA 2L0FA 3QIJA 4GOCA 4W9IA 3ZDTA 4XC2A 3ZRCA 1R4NI 1WX9A 1YIWA 3ZKJC 1E7VA 2RPQA 1KOTA 3L17A 2D3GA 4KIKB 1GC7A 2KTRB 4IM3A 3A1QA 4MGKE 2ZPNA 2FNJB 5CTRC 3ALBA 5DPRA 2PE9A 4DK5A 3RCZA 4DHZB 2DZIA 4WJOA 1TTNA 4HDOA 4HCPB 3A4RA 2BYEA 4W9KA 1GG3A 4B9KA 2MBOA 1GC6A 2UWQA 5DPWA 1BT0A 2CHWA 4HVBA 2XK5A 2KWVB 4PYZA 1VD2A 1WI0A 5J17A 1WX7A 3NY5A 3DVGY 1I42A 4KDIC 2CKHB 1Q0WB 3NS8A 3V60A 3OJ3A 2N4FA 2WWZA 1P9DU 1WY8A 2W9NA 2J0MA 3KYDD 4MDKE 1WGYA 3KH0A 3W1SA 2AL3A 1P1AA 2KO3A 3WANA 3IG3A 3OAWA 3TBLD 4FHKA 2EMSA 4ICVA 4AP4C 3A9KB 1EF5A 2MLBA 4WWNA 4IC7B 2KK8A 4URKA 3ZLZA 1WFYA 2NBUA 3V6EB 1S1QB 1WMHB 4ANVA 4FJVB 1WGGA 2LGXA 3R7RA 3LJ3A 3AI5A 3RT3B 2I1JA 4XZ4A 3L13A 3H7SA 3U7DA 2V1YA 3ZO5B 2JY6A 3AULA 1WXVA 4JL9A 1LQBA 2JWZA 2KLGA 2KMCA 5G55A 2KKCA 1XT9B 1WZ3A 3L08A 2EKEC 3I3TB 1V5TA 4JIOU 4NAWA 3UQBA 4LJOB 4ANWA 1WE6A 1XQQA 3UIPB 1H8CA 2R2OA 3OLMD 4BBNF 3PSEB 4ZRJA 3L54A 2ZNVB 1KM7A 2AYOB 3VUXA 1IYFA 1RFAA 2HE7A 3H9DA 4EOYA 1KJTA 1V49A 3KUZA 1RRBA 1XD3B 2JZZA 2KN5A 4JGHB 3SD5A 2BKRB 2V4LA 1R4MI 4MGIE 2IY0B 1NI2A 2MRPA 4GIVA 4NAWB 1Z5SB 1YX5B 3PTFC 4IM2A 3TL5A 4M0WB 2M8SA 3ML8A 2RR9A 4GSWA 2C9WB 4WAAA 2M1MA 2M0XA 4BKSD 3RZWC 2L0TA 3QWZB 2KDBA 4A3OA 1E8ZA 3PREA 4WQOB 2BGFA 2KFKB 3A9JA 3R3MA 4KSKC 1GJZA 1UELA 2L00B 2N9PC 1E8WA 4FHJA 4GDLA 3DVNU 3ENEA 5C1ZA 2KTFA 4BOZB 2V3SA 3QC8B 1UBQA 4HDQA 4HPMB 3VVWB 1PQSA 4PS7A 3HK0A 2KQSA 4EZLA 3CF6E 2LVOA 3V6CB 2NPTA 4ZRKA 3RYTA 4RMAA 1E8YA 3CSFA 2LWPA 4IWOA 2KOXA 4ICUA 1I35A 3KUDB 1WR1A 3DBHI 4FULA 3WAPA 2MBEA 4KZCA 2K6DB 2N7DA 4GDLB 2CHXA 3B1LX 3DQVA 3JW0X 3DPDA 2PE6B 5L95C 1HE8A 4HXDA 3JSVA 3QARA 2GBRA 4I6NB 2JRIB 4KV2A 4DHJD 4E3CA 4KZ0A 2NPTB 1IP9A 2NBVB 2MWSB 1C3TA 4WJQA 2KDFB 2NR2A 1Y8RC 4IWQA 2FUHB 3ML9A 3QX1A 4KIKA 2KTRA 3ZNGC 4AOFA 4K7UA 5GMVA 3EFUA 2IY1B 4E71A 4A20A 1OEYA 3PV1A 4P7IA 2AL6A 4MM3A 4II2B 3MHSD 2PJHA 4EKUA 2GMIC 1J19A 2UYZB 3NHEB 2GBKA 2JF5A 4NQLB 2RGFA 2PEAA 4WWOA 4EUTA 3H6NA 4W9EA 3PRMB 3A4SC 4ZYNA 4F7ZA 3QJZA 3NOBA 2MP2B 4EZKA 2N9EB 2D2QA 2O2VB 4LDTD 4ANUA 2MBQA 2DYMA 3PHXB 3QK0A 3TJPA 3UQAA 3PZDA 4F1SA 1K8RB 1YX6B 2N7EA 3K9PB 1YJ1A 2HD5B 1V5OA 4DXAB 5HKHA 2LXCA 3A9KA 4HJKA 3ZUNA 3K9OB 3T8MA 3N30A 1AARA 3N32A 2G45B 4X57B 1WMHA 4BOSC 4ASWC 4DBGA 2DYOA 3DBLI 2NS5A 2JZ3B 4F8CB 2GBJA 2KX3A 3M62B 4MSQB 3SDLC 1ISNA 4FJYA 3IHPC 1WM2A 3A33B 2K8CA 4K7SA 2BKFA 4PYUA 2KMAA 2LZ6A 4W9DA 3VFKA 1UBIA 3VTUA 1YQBA 3DBSA 1UD7A 1P0RA 3ZNZB 1Q1OA 3RZFA 2LI5A 2O6VD 3APDA 2CHZA 2L7RA 1RAXA 2BPSA 2WX0A 2LASA 2KFJA 3PLVA 1WZ0A 2C7HA 3Q3JA 1FXTB 3IBEA 3ECIA 4MH0E 5AZGA 4EFOA 2D11A 3BY4B 3KYCD 3VHTC 2KWUB 1OQYA 2L8JA 1WGDA 2ZJDA 2Z0DB 2FAZA 3DOWA 4FA6A 1P3QU 1V80A 4NNJB 2KDEB 3VDZA 1H4RA 2FCNA 1SE9A 3CMMB 2J0JA 4AWJA 4BKGA 4DDGD 3U8ZA 2OJRA 1L7YA 3CSTA 5D6JB 1VCBA 3SU8X 2KFKA 4ANXA 1OGWA 3VUYA 1M94A 3EHVA 4G11A 3TIXA 3OJ4B 1RLFA 3Q3FA 2MBHA 2G4DB 2QHOA 2LVPA 2DX5B 2ZCCA 3HM6X 2KXJA 3L16A 5DPSA 2DAJA 5J2RA 3AU5A 1L2NA 5JZEB 4W9HA 2LJ5A 3ZNHB 5CHVC 4CHKA 4MELA 5D2MB 4K1RB 2IO1B 3MJWA 4GN1A 4HCNB 1E7UA 3AU4A 3ZVVA 3DVGX 3HIZA 4GDKA 4W9JA 4I6LB 2KJ6A 3M3JA 1C1YB 1OEYJ 2ZVOA 3KW5B 2NBWB 2LUEA 3W1YA 4FJZA 3SHQA 4DWFA 2CR5A 1QZEA 3UF8A 2YVCA 3PS6A 4M8MA 3GOEA 2DZMA 4B95A 3VAWA 4HK2A 3ZIMA 5AEKB 2KC1A 3UGBB 3IVFA 3M95A 1WJUA 2JRHA 2MSED 1SIFA 3DBRI 4GDKB 4DHZE 2DYBA 4JLCA 3JVZX 2ZEQA 4ZDVA 2BWFA 4AUQC 5BO4B 5CHWA 3ZNID 1WJ6A 2GOWA 3V62A 3RULA 3ZRFA 4EEWA 2IZVB 2JUOA 3ONSA 4NPNA 3VTVA 5KHQA 3S2AA 1S3SG 2AWTA 4NJ6A 4J6IA 3VH3B 4WWPA 1Z2MA 3KUCB 4KSLC 2LGYA 3VUWA 2MA9B 2XBBC 2MP2A 1E5WA 1JRUA 1V2YA 2JPHA 3PHWB 2KD0A 4IG7B 2FCSA 1P98A 4ZRIA 2O2VA 2N9XA 3ZTCA 2XK5B 2C5LC 2L76A 2EMTA 1ZW7A 5KHOA 2MX2A 4LDTB 5DCNA 2YLMA 4G50A 1Q5WB 3QA8A 4HWIB 3ZTDA 2K39A 4AJWA 5LXIB 4MSMB 5JHAA 3P2BA 2GBNA 4GMVA 3X0WA 3WAMA 1MG8A 4OVUA 1V9JA 1ZKHA 1E90A 2FIDA 2JXXA 4IWPA 1NDDA 3T9LA 1WIAA 1EO6A 2KVRA 3W1SC 3C0RB 5G2NA 1LXDA 2D10A 2IO2B 2KJRA 5JHBA 1WGHA 1GNUA 4TUUA 5LXHA 2DZJA 3PVLA 3DCGA 2DHZA 4W9LA 4YL8A 5IAAC 4E74A 2NVUI 3L0WB 5E6PA 4TQ0A 1TZ1A 5CX3A 3M63B 2ASQA 4BFRA 1WGRA 2RSUA 1V86A 2O6VB 2M4NA 3L10B 1EF1A 2C7NB 2J7QB 3LDZE 3PT2B 2KJHB 2B3AA 5CHFA 4MEMA 3GZNI 2IBIB 3B0AA 1A5RA 4RM8A 2VRRB 4FN2A 1LM8B 3X23A 3DDCB 2K8BA 3PLUA 4MJSB 2AEHA 2WYQA 2Z0EB 2KWCA 3MTNB 3HM3A 4WJPA 3R66C 4KVGB 2IYDB 4GU2A 4BKSA 4GGQA 2Z59B 2MQJA 2NCNA 1TBEA 2FCMA 2KQ7A 5TR5A 3UINB 1WR6E 3A1QB 4MGZE 3RUIB 3TCAA 1TGZB 4K7WA 4AJYB 2WDTB 4PS8A 1WM3A 5EDSA 4DDID 2G3QB 1T0YA 2DZKA 4JQWC 4EZJA 3NZSA 2BWES 5DPTA 2XEWA 4TQ1A 2A5UA 5AZHA 2C60A 1J0GA 1E8XA 2IO0B 3NZUA 4N9F4 2LD9A 4BVUC 3VTWA 2K6QA 4OVVA 3VQIA 2Y5BB 4I6PA 3VXWA 3U30A 1WXAA 1WYWB 4FBJB 3H1UA 2CS4A 2LXAA 4K81A 4CO7A 3PRPB 5JH5C 1UZXB 4IM0A 4W9FA 4RM9A 2KANA 1F9JA 2J0KA 2MCNB 4BKTA 1V6EA 2PPHA 3O65B 1U4AA 3APFA 4M8NA 2FIFA 2KNBA 1LFDA 3TMPB 2DENB 4HLEA 2RD0A 3D32A 1WE7A 2MW5A 3RD2A 4CYEA 2MBBB 5D94A 3N3KB 2ZPYA 4PS3A 3WIMA 2DAFA 3EECA 1WJNA 3PRZA 4KDLB 1V81A 2ZZPB 4NQKE 2L3ZA 4BBNC 4DHJB 2R2QA 1WXMA 5C23A 4HPLB 3VH4B 3APCA 1WRDB 2CU1A 3HHMA 2N1WA 3ZDMC 2LRUA 2A4ZA 5J18A 2FCQA 1X1MA 2BYVE 4WJNA
chains in the Genus database with same CATH superfamily
1WRIA 3V61A 1KH0A 3WAOA 3P1MA 5E6NA 4II3B 2ZVNA 1VZ7A 3WA0A 2L1AA 1WF9A 3AXCA 1R7SA 1M4VA 3A9JB 1UH6A 3BVGA 4O1NA 4A3PA 2HTHA 1IUEA 4A8XC 3SFEB 4IW0A 1G6JA 4LCDE 2O6VA 4XX5A 3QHTA 4W9GA 3V05A 4MJSA 3QAQA 3B2GA 1L6VA 2AQ1B 2KC2A 2LGDA 3EC8A 2N1VA 3QIJA 4GOCA 2DBYA 2N9KA 1E7VA 3L17A 3AEEB 2D3GA 3E9SA 2KTRB 4AQ7A 5CTRC 3ALBA 2WXNA 5DPRA 4DK5A 3AB5A 4XWWA 1T3QA 2DZIA 4WJOA 1N5XA 4W9KA 1GC6A 4C7YA 4M01A 4HVBA 4PYZA 5GXGB 2IJ0A 3NY5A 3DVGY 5BYQA 2N4FA 1E10A 1LGRA 2W9NA 1D4BA 2KO3A 1YN5A 1JRPA 1ZE3D 3A9KB 1EF5A 3NJTA 2MLBA 2D3CA 1NI3A 4IC7B 5IO9A 1V8CA 1WFYA 1UGJA 2LGXA 3R7RA 2RDGA 3TSSA 2I1JA 1PGXA 4XZ4A 2V1YA 1VLBA 3AULA 1WXVA 5G55A 4TSSA 1WZ3A 3N1XC 3UQBA 4LJOB 2R2OA 4M0WA 4BBNF 3PSEB 3VUXA 3I9V1 1DOIA 1N60A 5HHDG 1RRBA 3EFCA 1XD3B 2KN5A 2OHFA 4MGIE 3AE2B 4GIVA 5G5HA 1Z5SB 3PTFC 3FC4A 1J7AA 1YMHE 2C9WB 2QEJC 2M1MA 4WH4A 3AEGB 3DWMA 1YQ4B 1E8ZA 3R3MA 4KSKC 1VRAB 3VRBB 3LXFA 2KVZA 1E8WA 1IGCA 2NMQA 5EE3A 2V3SA 4HPMB 4HDQA 4FXCA 4PS7A 3HK0A 2KQSA 3LYYA 1E8YA 3CSFA 4ICUA 1WR1A 2QC8A 2N7DA 4GDLB 3MP9A 3JSVA 4KV2A 4KZ0A 1UF0A 2KDFB 2NR2A 3Q8AA 3ML9A 5GMVA 3PO0A 4A20A 3T3NA 4XWTA 4II2B 3MHSD 2PJHA 2GMIC 1EM7A 2UYZB 2GBKA 3NZ3A 1FO4A 1RWSA 4K3CA 3PRMB 3DBHB 4ZYNA 3QJZA 2MP2B 2PVOD 2O2VB 3PHXB 3UQAA 3HUIA 4DXAB 5HKHA 5BYRA 2LEKA 3N30A 3N32A 1WMHA 4ASWC 4P1BC 4YSXB 2WP9B 4DXGA 4MSQB 1ISNA 4FJYA 3A33B 2BS2B 4K7SA 2HJ1A 2J53A 2LZ6A 3VFKA 1UBIA 1NYQA 2WGSA 3RZFA 2O6VD 2L7RA 2W54A 3CWIA 2KFJA 3PLVA 2C7HA 1FXTB 2LMCA 3P63A 3BY4B 3KYCD 3VHTC 1OQYA 2ZJDA 3DBLB 2FE8A 1TS2A 3Q14C 2J0JA 1EWYC 1DOXA 3U8ZA 3CSTA 4RF1A 3SU8X 2KFKA 4HROA 2K0PA 3EHVA 3L16A 1L2NA 2DAJA 3AU5A 1ACCA 2LJ5A 4XYCA 3RN9C 2VZKB 3MJ5A 2PIAA 3I63C 5C2TB 4I6LB 1MI0A 3KW5B 2ONQA 3W1YA 2I38A 4DWFA 2QSDA 1SJHD 3PS6A 2D5GA 4JWUC 3RNEC 5AEKB 1ZUD2 4ZRQA 4YSYB 4GDKB 2QCZA 1Y56A 4KGRA 3RFZB 4ZDVA 2ZEQA 2G9HD 4AS1A 3ZNID 3AEAB 2DNFA 1VDVA 5AUIA 3V62A 1JW9D 2JUOA 3ONSA 4LTUA 1S3SG 4J6IA 1QQRA 1Z2MA 3HVZA 3FKYA 4BZAA 1V2YA 1MVKA 2FCSA 5AUKA 1P98A 2MX2A 5DCNA 2WLBA 5LXIB 2LJIA 3P2BA 3WAMA 1MG8A 2WXQA 3DBRB 3KWVA 3Q3NC 1ENFA 3T9LA 1EO6A 1STEA 1JMLA 1C79A 2KQ4X 2D10A 2KJRA 5JHBA 1GNUA 4TUUA 1F2RI 1MFWA 4W9LA 2RPVA 4RNAA 2NVUI 3L0WB 4TQ0A 5CX3A 1V86A 2M4NA 4KX6B 2C7NB 2HDEA 2B3AA 1FEHA 5CHFA 3B0AA 1A5RA 4FN2A 2FUG1 2WYQA 1P7EA 4WJPA 3R66C 4KVGB 2ICIA 4BKSA 2BS3B 2KQ7A 5TR5A 3A1QB 4MGZE 1GPXA 4C4VB 1MHXA 4AJYB 4PS8A 5EDSA 2ON8A 4EZJA 1T0YA 3NZSA 5JXVA 2W3SA 2GLSA 4TQ1A 2A5UA 1WGKA 5EE9A 1J0GA 1E8XA 3NZUA 4YTPB 4OVVA 2Y5BB 3HVDA 3U30A 1YNTE 5JH5C 4CO7A 3PRPB 1TT5B 4W9FA 2KANA 1F9JA 2J0KA 2MCNB 1U4AA 3APFA 1IBXB 4WQMA 2QMTA 2MW5A 4RGMA 1F1HA 3FILA 1T5XD 3WIMA 4KDLB 2LUMA 1KRHA 1J7BA 1V81A 4BBNC 2R2QA 1HQRD 3ZXRA 3HHMA 2FCQA 4WJNA 1PGAA 2C7MB 3VRAB 5IA7A 1E0ZA 2KDMA 1J8CA 2LRWA 1XCQL 2OEDA 2D07B 4MGYE 2HJ8A 4NAMA 1WH3A 3DVNV 5L83A 1KLVA 4FLHA 1K53A 3UIOB 3IFWB 3PPAA 4NJ7A 1B9RA 4JE3B 1N62A 2BYFA 1UGMA 2ZW0A 3QCAA 3AM9A 4TKNA 3RNGC 1NBFC 3PZ7A 4NY0A 1SBBB 2I1KA 3H7PB 2EELA 2V3NA 3JYUA 1VJKA 3U7ZA 4FADA 2K25A 4W9CA 3NVYA 1R4NI 1WX9A 2TSSA 1I4QA 1FNWA 1GC7A 4IM3A 2ZPNA 3TEZA 3Q3OC 1C77A 1TTNA 4HDOA 4KGSA 1C78A 3IAM1 4HCPB 1GG3A 4US9A 1VD2A 1WI0A 1WX7A 1I42A 1TKGA 4KDIC 2CKHB 3OJ3A 4ZHPA 2Y5CA 3KYDD 2J0MA 4MDKE 2INNE 3W1SA 2JQRB 1P1AA 4ICVA 2EMSA 2KT7A 1SB3C 3BVZA 2Y5PA 1L4DB 1S1QB 3N9YC 3LJ3A 4ZOHC 3ZO5B 3P4RB 4C00A 1LQBA 2KKCA 2EKEC 2I2YA 3N1ZC 1A70A 5H92C 1WE6A 1XQQA 3UIPB 1H8CA 2KN4A 1ZXIA 4ZRJA 1IYFA 4RFBA 1RFAA 5LNK1 3AE6B 2D3AA 1KJTA 3KUZA 1F0ZA 3O13A 4WIPA 2V0GA 1R4MI 1HZ6A 3NUHB 1YX5B 4HKZE 1PDXA 2M8SA 3ML8A 2RR9A 4WAAA 1FFUA 2M0XA 3P4PB 4BKSD 2L0TA 3QWZB 1SIJA 4A3OA 3B9JA 2CJOA 2BT6A 2PLPA 1JWUD 4ZRPA 2V3PA 1BXTA 4FHJA 4GDLA 3DVNU 3ENEA 5TSSA 5C1ZA 2KTFA 3VVWB 3QC8B 4EZLA 4RMAA 4IWOA 1I35A 4BAXA 4FULA 1GOZA 2K6DB 1L6UA 3B1LX 1FRDA 2PE6B 5HFYA 5E6JA 4I6NB 3OG5A 2MWSB 4WJQA 5EE0A 2QILA 4KIKA 1JWSD 3NS1A 2IY1B 2NTTA 4P7IA 4MM3A 3RNCC 1SE3A 2OJWA 4JX1C 4C56C 5HG2A 4EUTA 4W9EA 2WXRA 1D5XC 3Q8BA 2D2QA 4LDTD 3TJPA 1K8RB 3K9PB 1ET6A 1V5OA 5IOIA 1V97A 3ZUNA 2MJ3A 3K9OB 4REZA 2BS4B 2KWDA 3ZJUA 2GBJA 2YEPB 3RMKC 1ZP0B 3SDLC 2BKFA 1WSPA 3DBSA 3KQ4A 1XLOA 2CHZA 1RAXA 2WX0A 1C4AA 1WZ0A 3Q3JA 3IBEA 4RGOS 1HA5A 2KWUB 4YWGG 1XLPA 3NG0A 2KDEB 3VDZA 1H4RA 2WDRB 5D3IB 3CMMB 2G1EA 3DHGC 1DOYA 4DDGD 4HRSA 2OJRA 5D6JB 1RFKA 1VCBA 4HEA1 1OGWA 3BZDB 1M94A 3VTWA 1RLFA 2MBHA 2LVPA 3HM6X 5DPSA 5JZEB 1AW7A 4CHKA 2YEPF 4GN1A 4LLGM 1E7UA 3AU4A 1JWMD 3DVGX 4GDKA 1N5WA 2KJ6A 4MT5A 2ZVOA 4OW0A 4A55A 2NBWB 1AYFA 2LUEA 3UF8A 3GOEA 3ZIMA 1XLQA 5EE1A 4RF0A 1BMLC 2MSED 1PGBA 3ETRA 4NZLB 5CHWA 2GOWA 3RULA 1T0QC 3BIID 3ZRFA 3S2AA 5BMHA 4NJ6A 5BMGA 2IGDA 1UWMA 4KKJA 1MHHE 4WWPA 1N63A 4YSZB 3VUWA 2MA9B 2XBBC 1E5WA 1JRUA 2KD0A 3BK1A 4ZRIA 3ZTCA 2C5LC 1SEBD 3R2IA 2EMTA 3ZJTA 1Q5WB 1EWCA 3ZTDA 2WXMA 2K39A 1CZPA 4C7ZA 4TMAB 3X0WA 4ACFA 1E90A 2FIDA 2WQYB 1NDDA 2KVRA 1LXDA 1HTOA 3DCGA 4RGTA 2DHZA 4YL8A 2KAJA 3MHZA 1TZ1A 2ASQA 4BFRA 2O6VB 3PT2B 3GZNI 4MH8A 3AE1B 2VH1A 4RM8A 1GAQB 1D5MC 4N58A 5HI1A 3PLUA 4MJSB 1Q10A 2AEHA 2FBWB 2KWCA 4K3BA 3MTNB 2MH7A 4MACA 4IDIA 1JCKB 4GU2A 3KLSX 1NEKB 2Z59B 3UINB 3RUIB 4K7WA 2WDTB 4DDID 4JQWC 5DPTA 1I4GA 1IBXA 4N59A 2K6QA 3VQIA 4OZBA 1SSNA 4YTMB 2CS4A 2LXAA 1FXAA 4BKTA 3O65B 2FIFA 3TMPB 4HLEA 1WE7A 3RD2A 2X8XX 1OQRA 2PMVA 3N3KB 4PS3A 3AN1A 2MEKA 3IAS1 4D2KA 3PRZA 2JYTA 2ZZPB 5T8IA 4DHJB 1QILA 2GI9A 2JX5A 2CU1A 2LRUA 2A4ZA 3MC0B 2XK5A 4EKUA 1RM6C 3B08A 4IUMB 2KMMA 2JYEA 1FIQA 1D6EC 5D7GA 1ZGUB 4XE0A 1L0YB 2VZKD 1IPGA 2WHIA 1WXSA 3AV8A 1KFYB 3BINA 4HKQA 3AE7B 3H7PA 4ARCA 2H89B 2KDIA 3WALA 5FR6A 2IO3B 1ZOYB 2WNMA 4GXBA 1QT9A 2KHWB 2LHEA 1GUAB 2N0SB 2ACZB 1VR9A 2JVCA 1D3ZA 2OOBB 4RCOA 3DHIC 1OTRB 3P4SB 1KLUD 4LNOA 2G4SA 3QQ8B 1YQ3B 2J42A 3KVFB 2WXOA 4P6VF 1WX8A 1YD8U 1YN3A 3JSVB 3ZRCA 2L0FA 4XC2A 1YIWA 1EU3A 2JSVX 3H8HA 1RYJA 2NTSA 2BTEA 3V3XA 2PE9A 2GRIA 1OFFA 1YN4A 2KACA 4UDUC 4B9KA 3A4RA 2MBOA 1F77A 2UWQA 3TEYA 5DPWA 2KWVB 3NVWA 3ZQ4A 2WWZA 1C4PA 1P9DU 1WY8A 3KH0A 2AL3A 2XN9C 3IG3A 2JWUA 4WWNA 1L0XB 2KK8A 1NYRA 3ZLZA 4ANVA 1WMHB 3AI5A 3BYYB 3OWEB 3U7DA 1E9MA 4JL9A 3L08A 3I3TB 1V5TA 4ANWA 2M56B 3OLMD 3L54A 2ZNVB 2AYOB 3E56A 2K22A 1V49A 3ABVB 3Q6BA 3URYA 2JZZA 4JGHB 4B0EA 2IY0B 1NI2A 2MRPA 2L83A 4NAWB 4IM2A 3TL5A 4OVZA 3CIRB 3ZGZA 3RZWC 3PREA 4WQOB 2KFKB 3A9JA 4A6QA 1GJZA 2L00B 2N9PC 2GB1A 1GB4A 2PKOA 2BB5A 5IP4D 2LVOA 1HTQA 3RYTA 4KKIA 1YJJA 3KUDB 3DBHI 2QIEB 3R2TA 3DHHC 2CHXA 2PW9A 3NVVA 3JW0X 1T0RC 3SR6A 2GBRA 3Q3MC 2NPTB 1C3TA 1PYWD 3U52E 1I4PA 2FUHB 3QX1A 1TYGB 2KTRA 4AOFA 4K7UA 1I7HA 1OEYA 3PV1A 2AL6A 2N7JA 1AWDA 1J19A 3AMZA 3NHEB 1MPEA 2PEAA 2RGFA 1MG4A 4P16A 3H6NA 3A4SC 3N20C 3NOBA 2H88B 5FR3A 1K51A 3W5VB 4ANUA 2MBQA 3QK0A 3PZDA 4F1SA 2LXCA 3A9KA 3GS2A 1AARA 4DBGA 2G45B 4X57B 4BOSC 4OHJA 3DBLI 1TZOA 2NS5A 2SAKA 2JZ3B 2KX3A 3M62B 1XCTL 1WM2A 3ZJVA 1JWBD 2K8CA 1K52A 2KMAA 4W9DA 3BYTB 3VTUA 1B1ZA 1UD7A 3ZYYX 1L4ZB 4JPSA 4EE2A 2BPSA 2LASA 2V9HA 2BW2A 3AE8B 3Q8CA 4P1CC 4EFOA 3ECIA 5AZGA 1FD6A 2MHJA 2Z0DB 2FAZA 1ET9A 2BBCA 4FA6A 1V80A 2IGGA 2DWQA 1L5PA 4RH6A 2BYTA 3AEDB 4BKGA 5H8YE 1L7YA 2BQQA 3ZXVA 4RGNA 4ANXA 1LO5D 1XO3A 3VUYA 1C9FA 3OJ4B 3Q3FA 1QLBB 2QHOA 5FKAC 4XDCA 3P4QB 1FFVA 5CHVC 3AE5B 1PFDA 1OQQA 5D2MB 4K1RB 3MJWA 4HCNB 4XGAB 2PTLA 4W9JA 3W5UB 4M00A 3M3JA 1C1YB 4NJCA 3J9CA 3I5JC 4FJZA 3SHQA 1QZEA 2YVCA 4B95A 3VAWA 2EKIA 3LB8C 2KC1A 1TY0A 2LFIA 2JRHA 3KWLA 3DBRI 1IGDA 2WXPA 4DHZE 3DWGC 4JLCA 1XF5L 4YXDB 1QKZA 2BWFA 4AUQC 1ZDXA 3FILB 4N6EB 4Q2JA 5KHQA 3VTVA 2LGSA 4WWMA 2AWTA 3VH3B 2JXTA 3KUCB 1VZ6A 2MP2A 3PHWB 2RDBC 2O2VA 2N9XA 5KHOA 1ZW7A 4LDTB 4G50A 3QA8A 4HWIB 1WYGA 4XDDA 4MSMB 5JHAA 2RMMA 1HZ5A 2IDYA 1ZKHA 2V4IB 3NVZA 1FPYA 3N1YC 2AX5A 5I4DA 2IO2B 1WGHA 3W2DA 5LXHA 1JQ4A 3L4PA 5IAAC 5E6PA 3L10B 1EF1A 2J7QB 3RI7C 2KJHB 1XEEA 4MEMA 2K5PA 3W9CB 1KTKA 1FNUA 2VRRB 1LM8B 3X23A 1JROA 1NENB 4ZYSA 2IYDB 3U4EG 4GGQA 1ROEA 2MQJA 2NCNA 3AE9B 2FCMA 1SE4A 1WR6E 3TCAA 1WM3A 1J7CA 2QJLA 4US8A 1DGJA 2BWES 3VR9B 1P7FA 2C60A 5FK9C 4N9F4 1JWAD 1N6ZA 2LD9A 4BVUC 5MPOA 1ESFA 2WXJA 4QAYA 1WYWB 2Z8LA 4DXFA 3BWUD 4R3DA 3C19A 1V1PB 3C8YA 4IM0A 3NRZA 2PPHA 2J52A 3SEBA 1FRRA 3RNBC 1LFDA 2W82A 2M0AA 3D32A 2MBBB 3AH7A 2ZPYA 1DYQA 2SEBD 1WXQA 2DAFA 3EECA 3BVMA 2JZPA 3WCQA 3RNAC 4NQKE 2L3ZA 1PUTA 1WXMA 1QF6A 5C23A 4HPLB 3APCA 2N1WA 2BYVE 1PQSA 2KX0A 2LHDA 2K1FA 2WXIA 2JT4B 2UU7A 4B6WA 4ITKA 4G0NB 3ZW3A 3U2SC 2B76B 2MJDA 4IOIE 2BB6A 4TV3A 5E6OA 1CQVA 2LVQA 1CMXB 2GBMA 4G3XB 2M17A 5LLIA 2K8HA 1TY2A 1TS3A 4PK1A 4M02A 1SGHA 2L05A 2KZRA 2AQ2B 4GB9A 4LJPB 3R8BA 2BF8B 3P42A 2VH2A 2IGHA 5AZFA 3Q8FA 3R7QA 2L52A 2REXA 2ZCBA 2WX1A 1EUVB 2KLCA 3MC9A 2ZNVC 1WJ4A 3PGEA 4OZAA 2MJEA 4IKGA 4W9IA 3ZDTA 5D3DA 2Q5WD 3ZKJC 2WS3B 2RPQA 1KOTA 3T3OA 4KIKB 4MGKE 3A1QA 1FM0D 4C4VA 2FNJB 4MM3B 2WU5B 5BYSA 1QOGA 3RCZA 4DHZB 2BYEA 3TUOA 1BT0A 1UUPA 2CHWA 3AEFB 4KGTA 5J17A 4HPPA 4USAA 1TS4A 1Q0WB 3NS8A 3V60A 2WXFA 1WGYA 3WANA 1ZXHA 3OAWA 3TBLD 4FHKA 4AP4C 1WWTA 1R4NB 4URKA 2NBUA 3V6EB 1QOBA 4FJVB 1WGGA 1SF0A 3RT3B 1KF6B 3L13A 3H7SA 2E3TA 2JY6A 4J3OD 2JWZA 2KLGA 2KMCA 4B0MA 1XT9B 3GB1A 4JIOU 4NAWA 1C76A 1KM7A 3GE8C 2HE7A 3H9DA 4EOYA 2DLBA 4S17A 4ZHOA 3B2FA 3SD5A 2HTME 2BKRB 1EU4A 2V4LA 2QDFA 3IT4B 4HJGE 4M0WB 4LNIA 1FCCC 4GSWA 3PZ8A 3UI3A 2J4XA 2AQ3B 2KDBA 2BGFA 1UNSA 1UELA 2K3UA 1FCLA 4BOZB 1UBQA 1E6EB 1ZPSA 2RDHA 3AEBB 3CF6E 3V6CB 2NPTA 4ZRKA 2BVCA 2LWPA 2KOXA 1R4MB 3WAPA 2MBEA 4KZCA 2W3RA 3DQVA 1SJED 1N61A 3FAHA 1TS5A 3DPDA 5L95C 1HE8A 2PVGC 4HXDA 3QARA 4DHJD 4E3CA 2JRIB 3HRDD 1VZ8A 4CQNA 1IP9A 2Y3AA 2NBVB 3IT6B 3AECB 2L32A 1Y8RC 4IWQA 3RPFC 3ZNGC 3EFUA 1HEZE 4E71A 2WDVB 1AN8A 3IXSA 1C4CA 4DQOC 1E7PB 4WAFA 2JF5A 4NQLB 4WWOA 3VR8B 4F7ZA 1TKYA 1QOFA 1KLGD 4EZKA 2N9EB 3EA6A 2DYMA 1BUIC 5IN7A 1YX6B 2N7EA 1YJ1A 2HD5B 2K9XA 4HJKA 3T8MA 1K50A 2DYOA 2W55A 4F8CB 1F52A 1QOAA 2XNAC 1CK1A 3IHPC 4PYUA 4GLSC 3RNFC 1GB1A 1YQBA 2R61A 1P0RA 2INDC 3ZNZB 1Q1OA 1NVID 2INCC 2LI5A 3APDA 4LNNA 4MH0E 2D11A 4YTNB 2L8JA 1WGDA 3TEXA 1HXYD 4LNFA 3DOWA 1P3QU 3MFGA 4NNJB 2WXGA 2WXHA 2M19A 2FCNA 1SE9A 4AWJA 3GP7A 3AE3B 4A90A 4G11A 3TIXA 2ZCCA 2G4DB 2DX5B 5J2RA 2KXJA 3BK2A 4W9HA 5G5GA 1FNVA 4LNKA 3ZNHB 4MELA 2IO1B 4A9AA 3ZVVA 4WURA 3HIZA 4YT0B 2ZW1A 1OEYJ 1T6BX 1I4HA 2CR5A 4M8MA 2DZMA 2N9LA 4HK2A 1YJIA 2D3BA 4S0RA 3UGBB 1TIFA 3IVFA 3M95A 1ZDVA 1WJUA 1SIFA 2DYBA 3JVZX 5BO4B 1WJ6A 4EEWA 2IZVB 4NPNA 2LGIA 2WU2B 1MJDA 4OZCA 2CU3A 3Q8EA 4KSLC 2LGYA 1YOVB 1F2RC 4IG7B 2JPHA 4H2AA 1XXGA 2XK5B 2L76A 1T0SC 2YLMA 1D5ZC 4L23A 5BMIA 1JALA 4AJWA 4GMVA 2GBNA 4ARIA 4L2YA 4OVUA 1V9JA 1SXTA 2WDQB 2JXXA 4IWPA 3EGRA 1TJEA 1CJEA 1WIAA 3W1SC 3GE3C 3C0RB 5C3JB 5G2NA 3Q2AC 1UWXA 2E6XA 5IKCM 1SE2A 1L0VB 2DZJA 3PVLA 4JWSC 4C80A 2X38A 2JU6X 4E74A 1XLNA 3M63B 1WGRA 2RSUA 3LDZE 3I57A 2IBIB 1V1OA 3DDCB 2K8BA 2WXKA 4PT5A 2WXLA 2Z0EB 3HM3A 1FXIA 1TBEA 1I4XA 4LK0M 1TGZB 1V1PA 2G3QB 2DZKA 2XEWA 5AZHA 3GZNB 2IO0B 3MC8A 3EUB2 4I6PA 3VXWA 3SFDB 1WXAA 4FBJB 3H1UA 4K81A 3AE4B 1UZXB 4RM9A 2KYWA 1V6EA 4M8NA 2KNBA 2DENB 2RD0A 1TKEA 4CYEA 5D94A 1I4RA 3TEWA 2INPE 1WJNA 2CJNA 4L1BA 3Q69A 2IPKD 3VH4B 3ZDMC 1WRDB 1FMAD 5J18A 1X1MA
chains in the Genus database with same CATH topology
2KX0A 3B08A 2K1FA 2C7MB 5IA7A 2JT4B 4IUMB 3V61A 4B6WA 1J8CA 4G0NB 5D7GA 1ZGUB 2LRWA 3WAOA 5E6NA 3ZW3A 4II3B 2ZVNA 3WA0A 2D07B 4TV3A 1IPGA 1WXSA 2HJ8A 1WF9A 1WH3A 3DVNV 4MGYE 5E6OA 5L83A 3AXCA 1KLVA 4FLHA 3BINA 2LVQA 1CMXB 3UIOB 2GBMA 3IFWB 3H7PA 4G3XB 2M17A 2KDIA 3A9JB 3WALA 5LLIA 1UH6A 3PPAA 2K8HA 4NJ7A 5FR6A 2IO3B 4A3PA 2HTHA 4GXBA 2KHWB 1SGHA 2BYFA 1UGMA 2L05A 1GUAB 2KZRA 4GB9A 3QCAA 4IW0A 4LJPB 4TKNA 1G6JA 4LCDE 2O6VA 2BF8B 2JVCA 1D3ZA 2OOBB 1NBFC 4NY0A 5AZFA 1OTRB 4XX5A 3R7QA 2I1KA 2REXA 2ZCBA 3H7PB 2G4SA 2WX1A 3QQ8B 3QHTA 1EUVB 4W9GA 3JYUA 2KLCA 4MJSA 3QAQA 2ZNVC 1WJ4A 4FADA 3PGEA 3KVFB 2K25A 1WX8A 1YD8U 4W9CA 2KC2A 3JSVB 2LGDA 3EC8A 2N1VA 2L0FA 3QIJA 4GOCA 4W9IA 3ZDTA 4XC2A 3ZRCA 1R4NI 1WX9A 1YIWA 3ZKJC 1E7VA 2RPQA 1KOTA 3L17A 2D3GA 4KIKB 1GC7A 2KTRB 4IM3A 3A1QA 4MGKE 2ZPNA 2FNJB 5CTRC 3ALBA 5DPRA 2PE9A 4DK5A 3RCZA 4DHZB 2DZIA 4WJOA 1TTNA 4HDOA 4HCPB 3A4RA 2BYEA 4W9KA 1GG3A 4B9KA 2MBOA 1GC6A 2UWQA 5DPWA 1BT0A 2CHWA 4HVBA 2XK5A 2KWVB 4PYZA 1VD2A 1WI0A 5J17A 1WX7A 3NY5A 3DVGY 1I42A 4KDIC 2CKHB 1Q0WB 3NS8A 3V60A 3OJ3A 2N4FA 2WWZA 1P9DU 1WY8A 2W9NA 2J0MA 3KYDD 4MDKE 1WGYA 3KH0A 3W1SA 2AL3A 1P1AA 2KO3A 3WANA 3IG3A 3OAWA 3TBLD 4FHKA 2EMSA 4ICVA 4AP4C 3A9KB 1EF5A 2MLBA 4WWNA 4IC7B 2KK8A 4URKA 3ZLZA 1WFYA 2NBUA 3V6EB 1S1QB 1WMHB 4ANVA 4FJVB 1WGGA 2LGXA 3R7RA 3LJ3A 3AI5A 3RT3B 2I1JA 4XZ4A 3L13A 3H7SA 3U7DA 2V1YA 3ZO5B 2JY6A 3AULA 1WXVA 4JL9A 1LQBA 2JWZA 2KLGA 2KMCA 5G55A 2KKCA 1XT9B 1WZ3A 3L08A 2EKEC 3I3TB 1V5TA 4JIOU 4NAWA 3UQBA 4LJOB 4ANWA 1WE6A 1XQQA 3UIPB 1H8CA 2R2OA 3OLMD 4BBNF 3PSEB 4ZRJA 3L54A 2ZNVB 1KM7A 2AYOB 3VUXA 1IYFA 1RFAA 2HE7A 3H9DA 4EOYA 1KJTA 1V49A 3KUZA 1RRBA 1XD3B 2JZZA 2KN5A 4JGHB 3SD5A 2BKRB 2V4LA 1R4MI 4MGIE 2IY0B 1NI2A 2MRPA 4GIVA 4NAWB 1Z5SB 1YX5B 3PTFC 4IM2A 3TL5A 4M0WB 2M8SA 3ML8A 2RR9A 4GSWA 2C9WB 4WAAA 2M1MA 2M0XA 4BKSD 3RZWC 2L0TA 3QWZB 2KDBA 4A3OA 1E8ZA 3PREA 4WQOB 2BGFA 2KFKB 3A9JA 3R3MA 4KSKC 1GJZA 1UELA 2L00B 2N9PC 1E8WA 4FHJA 4GDLA 3DVNU 3ENEA 5C1ZA 2KTFA 4BOZB 2V3SA 3QC8B 1UBQA 4HDQA 4HPMB 3VVWB 1PQSA 4PS7A 3HK0A 2KQSA 4EZLA 3CF6E 2LVOA 3V6CB 2NPTA 4ZRKA 3RYTA 4RMAA 1E8YA 3CSFA 2LWPA 4IWOA 2KOXA 4ICUA 1I35A 3KUDB 1WR1A 3DBHI 4FULA 3WAPA 2MBEA 4KZCA 2K6DB 2N7DA 4GDLB 2CHXA 3B1LX 3DQVA 3JW0X 3DPDA 2PE6B 5L95C 1HE8A 4HXDA 3JSVA 3QARA 2GBRA 4I6NB 2JRIB 4KV2A 4DHJD 4E3CA 4KZ0A 2NPTB 1IP9A 2NBVB 2MWSB 1C3TA 4WJQA 2KDFB 2NR2A 1Y8RC 4IWQA 2FUHB 3ML9A 3QX1A 4KIKA 2KTRA 3ZNGC 4AOFA 4K7UA 5GMVA 3EFUA 2IY1B 4E71A 4A20A 1OEYA 3PV1A 4P7IA 2AL6A 4MM3A 4II2B 3MHSD 2PJHA 4EKUA 2GMIC 1J19A 2UYZB 3NHEB 2GBKA 2JF5A 4NQLB 2RGFA 2PEAA 4WWOA 4EUTA 3H6NA 4W9EA 3PRMB 3A4SC 4ZYNA 4F7ZA 3QJZA 3NOBA 2MP2B 4EZKA 2N9EB 2D2QA 2O2VB 4LDTD 4ANUA 2MBQA 2DYMA 3PHXB 3QK0A 3TJPA 3UQAA 3PZDA 4F1SA 1K8RB 1YX6B 2N7EA 3K9PB 1YJ1A 2HD5B 1V5OA 4DXAB 5HKHA 2LXCA 3A9KA 4HJKA 3ZUNA 3K9OB 3T8MA 3N30A 1AARA 3N32A 2G45B 4X57B 1WMHA 4BOSC 4ASWC 4DBGA 2DYOA 3DBLI 2NS5A 2JZ3B 4F8CB 2GBJA 2KX3A 3M62B 4MSQB 3SDLC 1ISNA 4FJYA 3IHPC 1WM2A 3A33B 2K8CA 4K7SA 2BKFA 4PYUA 2KMAA 2LZ6A 4W9DA 3VFKA 1UBIA 3VTUA 1YQBA 3DBSA 1UD7A 1P0RA 3ZNZB 1Q1OA 3RZFA 2LI5A 2O6VD 3APDA 2CHZA 2L7RA 1RAXA 2BPSA 2WX0A 2LASA 2KFJA 3PLVA 1WZ0A 2C7HA 3Q3JA 1FXTB 3IBEA 3ECIA 4MH0E 5AZGA 4EFOA 2D11A 3BY4B 3KYCD 3VHTC 2KWUB 1OQYA 2L8JA 1WGDA 2ZJDA 2Z0DB 2FAZA 3DOWA 4FA6A 1P3QU 1V80A 4NNJB 2KDEB 3VDZA 1H4RA 2FCNA 1SE9A 3CMMB 2J0JA 4AWJA 4BKGA 4DDGD 3U8ZA 2OJRA 1L7YA 3CSTA 5D6JB 1VCBA 3SU8X 2KFKA 4ANXA 1OGWA 3VUYA 1M94A 3EHVA 4G11A 3TIXA 3OJ4B 1RLFA 3Q3FA 2MBHA 2G4DB 2QHOA 2LVPA 2DX5B 2ZCCA 3HM6X 2KXJA 3L16A 5DPSA 2DAJA 5J2RA 3AU5A 1L2NA 5JZEB 4W9HA 2LJ5A 3ZNHB 5CHVC 4CHKA 4MELA 5D2MB 4K1RB 2IO1B 3MJWA 4GN1A 4HCNB 1E7UA 3AU4A 3ZVVA 3DVGX 3HIZA 4GDKA 4W9JA 4I6LB 2KJ6A 3M3JA 1C1YB 1OEYJ 2ZVOA 3KW5B 2NBWB 2LUEA 3W1YA 4FJZA 3SHQA 4DWFA 2CR5A 1QZEA 3UF8A 2YVCA 3PS6A 4M8MA 3GOEA 2DZMA 4B95A 3VAWA 4HK2A 3ZIMA 5AEKB 2KC1A 3UGBB 3IVFA 3M95A 1WJUA 2JRHA 2MSED 1SIFA 3DBRI 4GDKB 4DHZE 2DYBA 4JLCA 3JVZX 2ZEQA 4ZDVA 2BWFA 4AUQC 5BO4B 5CHWA 3ZNID 1WJ6A 2GOWA 3V62A 3RULA 3ZRFA 4EEWA 2IZVB 2JUOA 3ONSA 4NPNA 3VTVA 5KHQA 3S2AA 1S3SG 2AWTA 4NJ6A 4J6IA 3VH3B 4WWPA 1Z2MA 3KUCB 4KSLC 2LGYA 3VUWA 2MA9B 2XBBC 2MP2A 1E5WA 1JRUA 1V2YA 2JPHA 3PHWB 2KD0A 4IG7B 2FCSA 1P98A 4ZRIA 2O2VA 2N9XA 3ZTCA 2XK5B 2C5LC 2L76A 2EMTA 1ZW7A 5KHOA 2MX2A 4LDTB 5DCNA 2YLMA 4G50A 1Q5WB 3QA8A 4HWIB 3ZTDA 2K39A 4AJWA 5LXIB 4MSMB 5JHAA 3P2BA 2GBNA 4GMVA 3X0WA 3WAMA 1MG8A 4OVUA 1V9JA 1ZKHA 1E90A 2FIDA 2JXXA 4IWPA 1NDDA 3T9LA 1WIAA 1EO6A 2KVRA 3W1SC 3C0RB 5G2NA 1LXDA 2D10A 2IO2B 2KJRA 5JHBA 1WGHA 1GNUA 4TUUA 5LXHA 2DZJA 3PVLA 3DCGA 2DHZA 4W9LA 4YL8A 5IAAC 4E74A 2NVUI 3L0WB 5E6PA 4TQ0A 1TZ1A 5CX3A 3M63B 2ASQA 4BFRA 1WGRA 2RSUA 1V86A 2O6VB 2M4NA 3L10B 1EF1A 2C7NB 2J7QB 3LDZE 3PT2B 2KJHB 2B3AA 5CHFA 4MEMA 3GZNI 2IBIB 3B0AA 1A5RA 4RM8A 2VRRB 4FN2A 1LM8B 3X23A 3DDCB 2K8BA 3PLUA 4MJSB 2AEHA 2WYQA 2Z0EB 2KWCA 3MTNB 3HM3A 4WJPA 3R66C 4KVGB 2IYDB 4GU2A 4BKSA 4GGQA 2Z59B 2MQJA 2NCNA 1TBEA 2FCMA 2KQ7A 5TR5A 3UINB 1WR6E 3A1QB 4MGZE 3RUIB 3TCAA 1TGZB 4K7WA 4AJYB 2WDTB 4PS8A 1WM3A 5EDSA 4DDID 2G3QB 1T0YA 2DZKA 4JQWC 4EZJA 3NZSA 2BWES 5DPTA 2XEWA 4TQ1A 2A5UA 5AZHA 2C60A 1J0GA 1E8XA 2IO0B 3NZUA 4N9F4 2LD9A 4BVUC 3VTWA 2K6QA 4OVVA 3VQIA 2Y5BB 4I6PA 3VXWA 3U30A 1WXAA 1WYWB 4FBJB 3H1UA 2CS4A 2LXAA 4K81A 4CO7A 3PRPB 5JH5C 1UZXB 4IM0A 4W9FA 4RM9A 2KANA 1F9JA 2J0KA 2MCNB 4BKTA 1V6EA 2PPHA 3O65B 1U4AA 3APFA 4M8NA 2FIFA 2KNBA 1LFDA 3TMPB 2DENB 4HLEA 2RD0A 3D32A 1WE7A 2MW5A 3RD2A 4CYEA 2MBBB 5D94A 3N3KB 2ZPYA 4PS3A 3WIMA 2DAFA 3EECA 1WJNA 3PRZA 4KDLB 1V81A 2ZZPB 4NQKE 2L3ZA 4BBNC 4DHJB 2R2QA 1WXMA 5C23A 4HPLB 3VH4B 3APCA 1WRDB 2CU1A 3HHMA 2N1WA 3ZDMC 2LRUA 2A4ZA 5J18A 2FCQA 1X1MA 2BYVE 4WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KX0 A;  3B08 A;  2K1F A;  2C7M B;  5IA7 A;  2JT4 B;  4IUM B;  3V61 A;  4B6W A;  1J8C A;  4G0N B;  5D7G A;  1ZGU B;  2LRW A;  3WAO A;  5E6N A;  3ZW3 A;  4II3 B;  2ZVN A;  3WA0 A;  2D07 B;  4TV3 A;  1IPG A;  1WXS A;  2HJ8 A;  1WF9 A;  1WH3 A;  3DVN V;  4MGY E;  5E6O A;  5L83 A;  3AXC A;  1KLV A;  4FLH A;  3BIN A;  2LVQ A;  1CMX B;  3UIO B;  2GBM A;  3IFW B;  3H7P A;  4G3X B;  2M17 A;  2KDI A;  3A9J B;  3WAL A;  5LLI A;  1UH6 A;  3PPA A;  2K8H A;  4NJ7 A;  5FR6 A;  2IO3 B;  4A3P A;  2HTH A;  4GXB A;  2KHW B;  1SGH A;  2BYF A;  1UGM A;  2L05 A;  1GUA B;  2KZR A;  4GB9 A;  3QCA A;  4IW0 A;  4LJP B;  4TKN A;  1G6J A;  4LCD E;  2O6V A;  2BF8 B;  2JVC A;  1D3Z A;  2OOB B;  1NBF C;  4NY0 A;  5AZF A;  1OTR B;  4XX5 A;  3R7Q A;  2I1K A;  2REX A;  2ZCB A;  3H7P B;  2G4S A;  2WX1 A;  3QQ8 B;  3QHT A;  1EUV B;  4W9G A;  3JYU A;  2KLC A;  4MJS A;  3QAQ A;  2ZNV C;  1WJ4 A;  4FAD A;  3PGE A;  3KVF B;  2K25 A;  1WX8 A;  1YD8 U;  4W9C A;  2KC2 A;  3JSV B;  2LGD A;  3EC8 A;  2N1V A;  2L0F A;  3QIJ A;  4GOC A;  4W9I A;  3ZDT A;  4XC2 A;  3ZRC A;  1R4N I;  1WX9 A;  1YIW A;  3ZKJ C;  1E7V A;  2RPQ A;  1KOT A;  3L17 A;  2D3G A;  4KIK B;  1GC7 A;  2KTR B;  4IM3 A;  3A1Q A;  4MGK E;  2ZPN A;  2FNJ B;  5CTR C;  3ALB A;  5DPR A;  2PE9 A;  4DK5 A;  3RCZ A;  4DHZ B;  2DZI A;  4WJO A;  1TTN A;  4HDO A;  4HCP B;  3A4R A;  2BYE A;  4W9K A;  1GG3 A;  4B9K A;  2MBO A;  1GC6 A;  2UWQ A;  5DPW A;  1BT0 A;  2CHW A;  4HVB A;  2XK5 A;  2KWV B;  4PYZ A;  1VD2 A;  1WI0 A;  5J17 A;  1WX7 A;  3NY5 A;  3DVG Y;  1I42 A;  4KDI C;  2CKH B;  1Q0W B;  3NS8 A;  3V60 A;  3OJ3 A;  2N4F A;  2WWZ A;  1P9D U;  1WY8 A;  2W9N A;  2J0M A;  3KYD D;  4MDK E;  1WGY A;  3KH0 A;  3W1S A;  2AL3 A;  1P1A A;  2KO3 A;  3WAN A;  3IG3 A;  3OAW A;  3TBL D;  4FHK A;  2EMS A;  4ICV A;  4AP4 C;  3A9K B;  1EF5 A;  2MLB A;  4WWN A;  4IC7 B;  2KK8 A;  4URK A;  3ZLZ A;  1WFY A;  2NBU A;  3V6E B;  1S1Q B;  1WMH B;  4ANV A;  4FJV B;  1WGG A;  2LGX A;  3R7R A;  3LJ3 A;  3AI5 A;  3RT3 B;  2I1J A;  4XZ4 A;  3L13 A;  3H7S A;  3U7D A;  2V1Y A;  3ZO5 B;  2JY6 A;  3AUL A;  1WXV A;  4JL9 A;  1LQB A;  2JWZ A;  2KLG A;  2KMC A;  5G55 A;  2KKC A;  1XT9 B;  1WZ3 A;  3L08 A;  2EKE C;  3I3T B;  1V5T A;  4JIO U;  4NAW A;  3UQB A;  4LJO B;  4ANW A;  1WE6 A;  1XQQ A;  3UIP B;  1H8C A;  2R2O A;  3OLM D;  4BBN F;  3PSE B;  4ZRJ A;  3L54 A;  2ZNV B;  1KM7 A;  2AYO B;  3VUX A;  1IYF A;  1RFA A;  2HE7 A;  3H9D A;  4EOY A;  1KJT A;  1V49 A;  3KUZ A;  1RRB A;  1XD3 B;  2JZZ A;  2KN5 A;  4JGH B;  3SD5 A;  2BKR B;  2V4L A;  1R4M I;  4MGI E;  2IY0 B;  1NI2 A;  2MRP A;  4GIV A;  4NAW B;  1Z5S B;  1YX5 B;  3PTF C;  4IM2 A;  3TL5 A;  4M0W B;  2M8S A;  3ML8 A;  2RR9 A;  4GSW A;  2C9W B;  4WAA A;  2M1M A;  2M0X A;  4BKS D;  3RZW C;  2L0T A;  3QWZ B;  2KDB A;  4A3O A;  1E8Z A;  3PRE A;  4WQO B;  2BGF A;  2KFK B;  3A9J A;  3R3M A;  4KSK C;  1GJZ A;  1UEL A;  2L00 B;  2N9P C;  1E8W A;  4FHJ A;  4GDL A;  3DVN U;  3ENE A;  5C1Z A;  2KTF A;  4BOZ B;  2V3S A;  3QC8 B;  1UBQ A;  4HDQ A;  4HPM B;  3VVW B;  1PQS A;  4PS7 A;  3HK0 A;  2KQS A;  4EZL A;  3CF6 E;  2LVO A;  3V6C B;  2NPT A;  4ZRK A;  3RYT A;  4RMA A;  1E8Y A;  3CSF A;  2LWP A;  4IWO A;  2KOX A;  4ICU A;  1I35 A;  3KUD B;  1WR1 A;  3DBH I;  4FUL A;  3WAP A;  2MBE A;  4KZC A;  2K6D B;  2N7D A;  4GDL B;  2CHX A;  3B1L X;  3DQV A;  3JW0 X;  3DPD A;  2PE6 B;  5L95 C;  1HE8 A;  4HXD A;  3JSV A;  3QAR A;  2GBR A;  4I6N B;  2JRI B;  4KV2 A;  4DHJ D;  4E3C A;  4KZ0 A;  2NPT B;  1IP9 A;  2NBV B;  2MWS B;  1C3T A;  4WJQ A;  2KDF B;  2NR2 A;  1Y8R C;  4IWQ A;  2FUH B;  3ML9 A;  3QX1 A;  4KIK A;  2KTR A;  3ZNG C;  4AOF A;  4K7U A;  5GMV A;  3EFU A;  2IY1 B;  4E71 A;  4A20 A;  1OEY A;  3PV1 A;  4P7I A;  2AL6 A;  4MM3 A;  4II2 B;  3MHS D;  2PJH A;  4EKU A;  2GMI C;  1J19 A;  2UYZ B;  3NHE B;  2GBK A;  2JF5 A;  4NQL B;  2RGF A;  2PEA A;  4WWO A;  4EUT A;  3H6N A;  4W9E A;  3PRM B;  3A4S C;  4ZYN A;  4F7Z A;  3QJZ A;  3NOB A;  2MP2 B;  4EZK A;  2N9E B;  2D2Q A;  2O2V B;  4LDT D;  4ANU A;  2MBQ A;  2DYM A;  3PHX B;  3QK0 A;  3TJP A;  3UQA A;  3PZD A;  4F1S A;  1K8R B;  1YX6 B;  2N7E A;  3K9P B;  1YJ1 A;  2HD5 B;  1V5O A;  4DXA B;  5HKH A;  2LXC A;  3A9K A;  4HJK A;  3ZUN A;  3K9O B;  3T8M A;  3N30 A;  1AAR A;  3N32 A;  2G45 B;  4X57 B;  1WMH A;  4BOS C;  4ASW C;  4DBG A;  2DYO A;  3DBL I;  2NS5 A;  2JZ3 B;  4F8C B;  2GBJ A;  2KX3 A;  3M62 B;  4MSQ B;  3SDL C;  1ISN A;  4FJY A;  3IHP C;  1WM2 A;  3A33 B;  2K8C A;  4K7S A;  2BKF A;  4PYU A;  2KMA A;  2LZ6 A;  4W9D A;  3VFK A;  1UBI A;  3VTU A;  1YQB A;  3DBS A;  1UD7 A;  1P0R A;  3ZNZ B;  1Q1O A;  3RZF A;  2LI5 A;  2O6V D;  3APD A;  2CHZ A;  2L7R A;  1RAX A;  2BPS A;  2WX0 A;  2LAS A;  2KFJ A;  3PLV A;  1WZ0 A;  2C7H A;  3Q3J A;  1FXT B;  3IBE A;  3ECI A;  4MH0 E;  5AZG A;  4EFO A;  2D11 A;  3BY4 B;  3KYC D;  3VHT C;  2KWU B;  1OQY A;  2L8J A;  1WGD A;  2ZJD A;  2Z0D B;  2FAZ A;  3DOW A;  4FA6 A;  1P3Q U;  1V80 A;  4NNJ B;  2KDE B;  3VDZ A;  1H4R A;  2FCN A;  1SE9 A;  3CMM B;  2J0J A;  4AWJ A;  4BKG A;  4DDG D;  3U8Z A;  2OJR A;  1L7Y A;  3CST A;  5D6J B;  1VCB A;  3SU8 X;  2KFK A;  4ANX A;  1OGW A;  3VUY A;  1M94 A;  3EHV A;  4G11 A;  3TIX A;  3OJ4 B;  1RLF A;  3Q3F A;  2MBH A;  2G4D B;  2QHO A;  2LVP A;  2DX5 B;  2ZCC A;  3HM6 X;  2KXJ A;  3L16 A;  5DPS A;  2DAJ A;  5J2R A;  3AU5 A;  1L2N A;  5JZE B;  4W9H A;  2LJ5 A;  3ZNH B;  5CHV C;  4CHK A;  4MEL A;  5D2M B;  4K1R B;  2IO1 B;  3MJW A;  4GN1 A;  4HCN B;  1E7U A;  3AU4 A;  3ZVV A;  3DVG X;  3HIZ A;  4GDK A;  4W9J A;  4I6L B;  2KJ6 A;  3M3J A;  1C1Y B;  1OEY J;  2ZVO A;  3KW5 B;  2NBW B;  2LUE A;  3W1Y A;  4FJZ A;  3SHQ A;  4DWF A;  2CR5 A;  1QZE A;  3UF8 A;  2YVC A;  3PS6 A;  4M8M A;  3GOE A;  2DZM A;  4B95 A;  3VAW A;  4HK2 A;  3ZIM A;  5AEK B;  2KC1 A;  3UGB B;  3IVF A;  3M95 A;  1WJU A;  2JRH A;  2MSE D;  1SIF A;  3DBR I;  4GDK B;  4DHZ E;  2DYB A;  4JLC A;  3JVZ X;  2ZEQ A;  4ZDV A;  2BWF A;  4AUQ C;  5BO4 B;  5CHW A;  3ZNI D;  1WJ6 A;  2GOW A;  3V62 A;  3RUL A;  3ZRF A;  4EEW A;  2IZV B;  2JUO A;  3ONS A;  4NPN A;  3VTV A;  5KHQ A;  3S2A A;  1S3S G;  2AWT A;  4NJ6 A;  4J6I A;  3VH3 B;  4WWP A;  1Z2M A;  3KUC B;  4KSL C;  2LGY A;  3VUW A;  2MA9 B;  2XBB C;  2MP2 A;  1E5W A;  1JRU A;  1V2Y A;  2JPH A;  3PHW B;  2KD0 A;  4IG7 B;  2FCS A;  1P98 A;  4ZRI A;  2O2V A;  2N9X A;  3ZTC A;  2XK5 B;  2C5L C;  2L76 A;  2EMT A;  1ZW7 A;  5KHO A;  2MX2 A;  4LDT B;  5DCN A;  2YLM A;  4G50 A;  1Q5W B;  3QA8 A;  4HWI B;  3ZTD A;  2K39 A;  4AJW A;  5LXI B;  4MSM B;  5JHA A;  3P2B A;  2GBN A;  4GMV A;  3X0W A;  3WAM A;  1MG8 A;  4OVU A;  1V9J A;  1ZKH A;  1E90 A;  2FID A;  2JXX A;  4IWP A;  1NDD A;  3T9L A;  1WIA A;  1EO6 A;  2KVR A;  3W1S C;  3C0R B;  5G2N A;  1LXD A;  2D10 A;  2IO2 B;  2KJR A;  5JHB A;  1WGH A;  1GNU A;  4TUU A;  5LXH A;  2DZJ A;  3PVL A;  3DCG A;  2DHZ A;  4W9L A;  4YL8 A;  5IAA C;  4E74 A;  2NVU I;  3L0W B;  5E6P A;  4TQ0 A;  1TZ1 A;  5CX3 A;  3M63 B;  2ASQ A;  4BFR A;  1WGR A;  2RSU A;  1V86 A;  2O6V B;  2M4N A;  3L10 B;  1EF1 A;  2C7N B;  2J7Q B;  3LDZ E;  3PT2 B;  2KJH B;  2B3A A;  5CHF A;  4MEM A;  3GZN I;  2IBI B;  3B0A A;  1A5R A;  4RM8 A;  2VRR B;  4FN2 A;  1LM8 B;  3X23 A;  3DDC B;  2K8B A;  3PLU A;  4MJS B;  2AEH A;  2WYQ A;  2Z0E B;  2KWC A;  3MTN B;  3HM3 A;  4WJP A;  3R66 C;  4KVG B;  2IYD B;  4GU2 A;  4BKS A;  4GGQ A;  2Z59 B;  2MQJ A;  2NCN A;  1TBE A;  2FCM A;  2KQ7 A;  5TR5 A;  3UIN B;  1WR6 E;  3A1Q B;  4MGZ E;  3RUI B;  3TCA A;  1TGZ B;  4K7W A;  4AJY B;  2WDT B;  4PS8 A;  1WM3 A;  5EDS A;  4DDI D;  2G3Q B;  1T0Y A;  2DZK A;  4JQW C;  4EZJ A;  3NZS A;  2BWE S;  5DPT A;  2XEW A;  4TQ1 A;  2A5U A;  5AZH A;  2C60 A;  1J0G A;  1E8X A;  2IO0 B;  3NZU A;  4N9F 4;  2LD9 A;  4BVU C;  3VTW A;  2K6Q A;  4OVV A;  3VQI A;  2Y5B B;  4I6P A;  3VXW A;  3U30 A;  1WXA A;  1WYW B;  4FBJ B;  3H1U A;  2CS4 A;  2LXA A;  4K81 A;  4CO7 A;  3PRP B;  5JH5 C;  1UZX B;  4IM0 A;  4W9F A;  4RM9 A;  2KAN A;  1F9J A;  2J0K A;  2MCN B;  4BKT A;  1V6E A;  2PPH A;  3O65 B;  1U4A A;  3APF A;  4M8N A;  2FIF A;  2KNB A;  1LFD A;  3TMP B;  2DEN B;  4HLE A;  2RD0 A;  3D32 A;  1WE7 A;  2MW5 A;  3RD2 A;  4CYE A;  2MBB B;  5D94 A;  3N3K B;  2ZPY A;  4PS3 A;  3WIM A;  2DAF A;  3EEC A;  1WJN A;  3PRZ A;  4KDL B;  1V81 A;  2ZZP B;  4NQK E;  2L3Z A;  4BBN C;  4DHJ B;  2R2Q A;  1WXM A;  5C23 A;  4HPL B;  3VH4 B;  3APC A;  1WRD B;  2CU1 A;  3HHM A;  2N1W A;  3ZDM C;  2LRU A;  2A4Z A;  5J18 A;  2FCQ A;  1X1M A;  2BYV E;  4WJN A; 
#chains in the Genus database with same CATH topology
 1WRI A;  3V61 A;  1KH0 A;  3WAO A;  3P1M A;  5E6N A;  4II3 B;  2ZVN A;  1VZ7 A;  3WA0 A;  2L1A A;  1WF9 A;  3AXC A;  1R7S A;  1M4V A;  3A9J B;  1UH6 A;  3BVG A;  4O1N A;  4A3P A;  2HTH A;  1IUE A;  4A8X C;  3SFE B;  4IW0 A;  1G6J A;  4LCD E;  2O6V A;  4XX5 A;  3QHT A;  4W9G A;  3V05 A;  4MJS A;  3QAQ A;  3B2G A;  1L6V A;  2AQ1 B;  2KC2 A;  2LGD A;  3EC8 A;  2N1V A;  3QIJ A;  4GOC A;  2DBY A;  2N9K A;  1E7V A;  3L17 A;  3AEE B;  2D3G A;  3E9S A;  2KTR B;  4AQ7 A;  5CTR C;  3ALB A;  2WXN A;  5DPR A;  4DK5 A;  3AB5 A;  4XWW A;  1T3Q A;  2DZI A;  4WJO A;  1N5X A;  4W9K A;  1GC6 A;  4C7Y A;  4M01 A;  4HVB A;  4PYZ A;  5GXG B;  2IJ0 A;  3NY5 A;  3DVG Y;  5BYQ A;  2N4F A;  1E10 A;  1LGR A;  2W9N A;  1D4B A;  2KO3 A;  1YN5 A;  1JRP A;  1ZE3 D;  3A9K B;  1EF5 A;  3NJT A;  2MLB A;  2D3C A;  1NI3 A;  4IC7 B;  5IO9 A;  1V8C A;  1WFY A;  1UGJ A;  2LGX A;  3R7R A;  2RDG A;  3TSS A;  2I1J A;  1PGX A;  4XZ4 A;  2V1Y A;  1VLB A;  3AUL A;  1WXV A;  5G55 A;  4TSS A;  1WZ3 A;  3N1X C;  3UQB A;  4LJO B;  2R2O A;  4M0W A;  4BBN F;  3PSE B;  3VUX A;  3I9V 1;  1DOI A;  1N60 A;  5HHD G;  1RRB A;  3EFC A;  1XD3 B;  2KN5 A;  2OHF A;  4MGI E;  3AE2 B;  4GIV A;  5G5H A;  1Z5S B;  3PTF C;  3FC4 A;  1J7A A;  1YMH E;  2C9W B;  2QEJ C;  2M1M A;  4WH4 A;  3AEG B;  3DWM A;  1YQ4 B;  1E8Z A;  3R3M A;  4KSK C;  1VRA B;  3VRB B;  3LXF A;  2KVZ A;  1E8W A;  1IGC A;  2NMQ A;  5EE3 A;  2V3S A;  4HPM B;  4HDQ A;  4FXC A;  4PS7 A;  3HK0 A;  2KQS A;  3LYY A;  1E8Y A;  3CSF A;  4ICU A;  1WR1 A;  2QC8 A;  2N7D A;  4GDL B;  3MP9 A;  3JSV A;  4KV2 A;  4KZ0 A;  1UF0 A;  2KDF B;  2NR2 A;  3Q8A A;  3ML9 A;  5GMV A;  3PO0 A;  4A20 A;  3T3N A;  4XWT A;  4II2 B;  3MHS D;  2PJH A;  2GMI C;  1EM7 A;  2UYZ B;  2GBK A;  3NZ3 A;  1FO4 A;  1RWS A;  4K3C A;  3PRM B;  3DBH B;  4ZYN A;  3QJZ A;  2MP2 B;  2PVO D;  2O2V B;  3PHX B;  3UQA A;  3HUI A;  4DXA B;  5HKH A;  5BYR A;  2LEK A;  3N30 A;  3N32 A;  1WMH A;  4ASW C;  4P1B C;  4YSX B;  2WP9 B;  4DXG A;  4MSQ B;  1ISN A;  4FJY A;  3A33 B;  2BS2 B;  4K7S A;  2HJ1 A;  2J53 A;  2LZ6 A;  3VFK A;  1UBI A;  1NYQ A;  2WGS A;  3RZF A;  2O6V D;  2L7R A;  2W54 A;  3CWI A;  2KFJ A;  3PLV A;  2C7H A;  1FXT B;  2LMC A;  3P63 A;  3BY4 B;  3KYC D;  3VHT C;  1OQY A;  2ZJD A;  3DBL B;  2FE8 A;  1TS2 A;  3Q14 C;  2J0J A;  1EWY C;  1DOX A;  3U8Z A;  3CST A;  4RF1 A;  3SU8 X;  2KFK A;  4HRO A;  2K0P A;  3EHV A;  3L16 A;  1L2N A;  2DAJ A;  3AU5 A;  1ACC A;  2LJ5 A;  4XYC A;  3RN9 C;  2VZK B;  3MJ5 A;  2PIA A;  3I63 C;  5C2T B;  4I6L B;  1MI0 A;  3KW5 B;  2ONQ A;  3W1Y A;  2I38 A;  4DWF A;  2QSD A;  1SJH D;  3PS6 A;  2D5G A;  4JWU C;  3RNE C;  5AEK B;  1ZUD 2;  4ZRQ A;  4YSY B;  4GDK B;  2QCZ A;  1Y56 A;  4KGR A;  3RFZ B;  4ZDV A;  2ZEQ A;  2G9H D;  4AS1 A;  3ZNI D;  3AEA B;  2DNF A;  1VDV A;  5AUI A;  3V62 A;  1JW9 D;  2JUO A;  3ONS A;  4LTU A;  1S3S G;  4J6I A;  1QQR A;  1Z2M A;  3HVZ A;  3FKY A;  4BZA A;  1V2Y A;  1MVK A;  2FCS A;  5AUK A;  1P98 A;  2MX2 A;  5DCN A;  2WLB A;  5LXI B;  2LJI A;  3P2B A;  3WAM A;  1MG8 A;  2WXQ A;  3DBR B;  3KWV A;  3Q3N C;  1ENF A;  3T9L A;  1EO6 A;  1STE A;  1JML A;  1C79 A;  2KQ4 X;  2D10 A;  2KJR A;  5JHB A;  1GNU A;  4TUU A;  1F2R I;  1MFW A;  4W9L A;  2RPV A;  4RNA A;  2NVU I;  3L0W B;  4TQ0 A;  5CX3 A;  1V86 A;  2M4N A;  4KX6 B;  2C7N B;  2HDE A;  2B3A A;  1FEH A;  5CHF A;  3B0A A;  1A5R A;  4FN2 A;  2FUG 1;  2WYQ A;  1P7E A;  4WJP A;  3R66 C;  4KVG B;  2ICI A;  4BKS A;  2BS3 B;  2KQ7 A;  5TR5 A;  3A1Q B;  4MGZ E;  1GPX A;  4C4V B;  1MHX A;  4AJY B;  4PS8 A;  5EDS A;  2ON8 A;  4EZJ A;  1T0Y A;  3NZS A;  5JXV A;  2W3S A;  2GLS A;  4TQ1 A;  2A5U A;  1WGK A;  5EE9 A;  1J0G A;  1E8X A;  3NZU A;  4YTP B;  4OVV A;  2Y5B B;  3HVD A;  3U30 A;  1YNT E;  5JH5 C;  4CO7 A;  3PRP B;  1TT5 B;  4W9F A;  2KAN A;  1F9J A;  2J0K A;  2MCN B;  1U4A A;  3APF A;  1IBX B;  4WQM A;  2QMT A;  2MW5 A;  4RGM A;  1F1H A;  3FIL A;  1T5X D;  3WIM A;  4KDL B;  2LUM A;  1KRH A;  1J7B A;  1V81 A;  4BBN C;  2R2Q A;  1HQR D;  3ZXR A;  3HHM A;  2FCQ A;  4WJN A;  1PGA A;  2C7M B;  3VRA B;  5IA7 A;  1E0Z A;  2KDM A;  1J8C A;  2LRW A;  1XCQ L;  2OED A;  2D07 B;  4MGY E;  2HJ8 A;  4NAM A;  1WH3 A;  3DVN V;  5L83 A;  1KLV A;  4FLH A;  1K53 A;  3UIO B;  3IFW B;  3PPA A;  4NJ7 A;  1B9R A;  4JE3 B;  1N62 A;  2BYF A;  1UGM A;  2ZW0 A;  3QCA A;  3AM9 A;  4TKN A;  3RNG C;  1NBF C;  3PZ7 A;  4NY0 A;  1SBB B;  2I1K A;  3H7P B;  2EEL A;  2V3N A;  3JYU A;  1VJK A;  3U7Z A;  4FAD A;  2K25 A;  4W9C A;  3NVY A;  1R4N I;  1WX9 A;  2TSS A;  1I4Q A;  1FNW A;  1GC7 A;  4IM3 A;  2ZPN A;  3TEZ A;  3Q3O C;  1C77 A;  1TTN A;  4HDO A;  4KGS A;  1C78 A;  3IAM 1;  4HCP B;  1GG3 A;  4US9 A;  1VD2 A;  1WI0 A;  1WX7 A;  1I42 A;  1TKG A;  4KDI C;  2CKH B;  3OJ3 A;  4ZHP A;  2Y5C A;  3KYD D;  2J0M A;  4MDK E;  2INN E;  3W1S A;  2JQR B;  1P1A A;  4ICV A;  2EMS A;  2KT7 A;  1SB3 C;  3BVZ A;  2Y5P A;  1L4D B;  1S1Q B;  3N9Y C;  3LJ3 A;  4ZOH C;  3ZO5 B;  3P4R B;  4C00 A;  1LQB A;  2KKC A;  2EKE C;  2I2Y A;  3N1Z C;  1A70 A;  5H92 C;  1WE6 A;  1XQQ A;  3UIP B;  1H8C A;  2KN4 A;  1ZXI A;  4ZRJ A;  1IYF A;  4RFB A;  1RFA A;  5LNK 1;  3AE6 B;  2D3A A;  1KJT A;  3KUZ A;  1F0Z A;  3O13 A;  4WIP A;  2V0G A;  1R4M I;  1HZ6 A;  3NUH B;  1YX5 B;  4HKZ E;  1PDX A;  2M8S A;  3ML8 A;  2RR9 A;  4WAA A;  1FFU A;  2M0X A;  3P4P B;  4BKS D;  2L0T A;  3QWZ B;  1SIJ A;  4A3O A;  3B9J A;  2CJO A;  2BT6 A;  2PLP A;  1JWU D;  4ZRP A;  2V3P A;  1BXT A;  4FHJ A;  4GDL A;  3DVN U;  3ENE A;  5TSS A;  5C1Z A;  2KTF A;  3VVW B;  3QC8 B;  4EZL A;  4RMA A;  4IWO A;  1I35 A;  4BAX A;  4FUL A;  1GOZ A;  2K6D B;  1L6U A;  3B1L X;  1FRD A;  2PE6 B;  5HFY A;  5E6J A;  4I6N B;  3OG5 A;  2MWS B;  4WJQ A;  5EE0 A;  2QIL A;  4KIK A;  1JWS D;  3NS1 A;  2IY1 B;  2NTT A;  4P7I A;  4MM3 A;  3RNC C;  1SE3 A;  2OJW A;  4JX1 C;  4C56 C;  5HG2 A;  4EUT A;  4W9E A;  2WXR A;  1D5X C;  3Q8B A;  2D2Q A;  4LDT D;  3TJP A;  1K8R B;  3K9P B;  1ET6 A;  1V5O A;  5IOI A;  1V97 A;  3ZUN A;  2MJ3 A;  3K9O B;  4REZ A;  2BS4 B;  2KWD A;  3ZJU A;  2GBJ A;  2YEP B;  3RMK C;  1ZP0 B;  3SDL C;  2BKF A;  1WSP A;  3DBS A;  3KQ4 A;  1XLO A;  2CHZ A;  1RAX A;  2WX0 A;  1C4A A;  1WZ0 A;  3Q3J A;  3IBE A;  4RGO S;  1HA5 A;  2KWU B;  4YWG G;  1XLP A;  3NG0 A;  2KDE B;  3VDZ A;  1H4R A;  2WDR B;  5D3I B;  3CMM B;  2G1E A;  3DHG C;  1DOY A;  4DDG D;  4HRS A;  2OJR A;  5D6J B;  1RFK A;  1VCB A;  4HEA 1;  1OGW A;  3BZD B;  1M94 A;  3VTW A;  1RLF A;  2MBH A;  2LVP A;  3HM6 X;  5DPS A;  5JZE B;  1AW7 A;  4CHK A;  2YEP F;  4GN1 A;  4LLG M;  1E7U A;  3AU4 A;  1JWM D;  3DVG X;  4GDK A;  1N5W A;  2KJ6 A;  4MT5 A;  2ZVO A;  4OW0 A;  4A55 A;  2NBW B;  1AYF A;  2LUE A;  3UF8 A;  3GOE A;  3ZIM A;  1XLQ A;  5EE1 A;  4RF0 A;  1BML C;  2MSE D;  1PGB A;  3ETR A;  4NZL B;  5CHW A;  2GOW A;  3RUL A;  1T0Q C;  3BII D;  3ZRF A;  3S2A A;  5BMH A;  4NJ6 A;  5BMG A;  2IGD A;  1UWM A;  4KKJ A;  1MHH E;  4WWP A;  1N63 A;  4YSZ B;  3VUW A;  2MA9 B;  2XBB C;  1E5W A;  1JRU A;  2KD0 A;  3BK1 A;  4ZRI A;  3ZTC A;  2C5L C;  1SEB D;  3R2I A;  2EMT A;  3ZJT A;  1Q5W B;  1EWC A;  3ZTD A;  2WXM A;  2K39 A;  1CZP A;  4C7Z A;  4TMA B;  3X0W A;  4ACF A;  1E90 A;  2FID A;  2WQY B;  1NDD A;  2KVR A;  1LXD A;  1HTO A;  3DCG A;  4RGT A;  2DHZ A;  4YL8 A;  2KAJ A;  3MHZ A;  1TZ1 A;  2ASQ A;  4BFR A;  2O6V B;  3PT2 B;  3GZN I;  4MH8 A;  3AE1 B;  2VH1 A;  4RM8 A;  1GAQ B;  1D5M C;  4N58 A;  5HI1 A;  3PLU A;  4MJS B;  1Q10 A;  2AEH A;  2FBW B;  2KWC A;  4K3B A;  3MTN B;  2MH7 A;  4MAC A;  4IDI A;  1JCK B;  4GU2 A;  3KLS X;  1NEK B;  2Z59 B;  3UIN B;  3RUI B;  4K7W A;  2WDT B;  4DDI D;  4JQW C;  5DPT A;  1I4G A;  1IBX A;  4N59 A;  2K6Q A;  3VQI A;  4OZB A;  1SSN A;  4YTM B;  2CS4 A;  2LXA A;  1FXA A;  4BKT A;  3O65 B;  2FIF A;  3TMP B;  4HLE A;  1WE7 A;  3RD2 A;  2X8X X;  1OQR A;  2PMV A;  3N3K B;  4PS3 A;  3AN1 A;  2MEK A;  3IAS 1;  4D2K A;  3PRZ A;  2JYT A;  2ZZP B;  5T8I A;  4DHJ B;  1QIL A;  2GI9 A;  2JX5 A;  2CU1 A;  2LRU A;  2A4Z A;  3MC0 B;  2XK5 A;  4EKU A;  1RM6 C;  3B08 A;  4IUM B;  2KMM A;  2JYE A;  1FIQ A;  1D6E C;  5D7G A;  1ZGU B;  4XE0 A;  1L0Y B;  2VZK D;  1IPG A;  2WHI A;  1WXS A;  3AV8 A;  1KFY B;  3BIN A;  4HKQ A;  3AE7 B;  3H7P A;  4ARC A;  2H89 B;  2KDI A;  3WAL A;  5FR6 A;  2IO3 B;  1ZOY B;  2WNM A;  4GXB A;  1QT9 A;  2KHW B;  2LHE A;  1GUA B;  2N0S B;  2ACZ B;  1VR9 A;  2JVC A;  1D3Z A;  2OOB B;  4RCO A;  3DHI C;  1OTR B;  3P4S B;  1KLU D;  4LNO A;  2G4S A;  3QQ8 B;  1YQ3 B;  2J42 A;  3KVF B;  2WXO A;  4P6V F;  1WX8 A;  1YD8 U;  1YN3 A;  3JSV B;  3ZRC A;  2L0F A;  4XC2 A;  1YIW A;  1EU3 A;  2JSV X;  3H8H A;  1RYJ A;  2NTS A;  2BTE A;  3V3X A;  2PE9 A;  2GRI A;  1OFF A;  1YN4 A;  2KAC A;  4UDU C;  4B9K A;  3A4R A;  2MBO A;  1F77 A;  2UWQ A;  3TEY A;  5DPW A;  2KWV B;  3NVW A;  3ZQ4 A;  2WWZ A;  1C4P A;  1P9D U;  1WY8 A;  3KH0 A;  2AL3 A;  2XN9 C;  3IG3 A;  2JWU A;  4WWN A;  1L0X B;  2KK8 A;  1NYR A;  3ZLZ A;  4ANV A;  1WMH B;  3AI5 A;  3BYY B;  3OWE B;  3U7D A;  1E9M A;  4JL9 A;  3L08 A;  3I3T B;  1V5T A;  4ANW A;  2M56 B;  3OLM D;  3L54 A;  2ZNV B;  2AYO B;  3E56 A;  2K22 A;  1V49 A;  3ABV B;  3Q6B A;  3URY A;  2JZZ A;  4JGH B;  4B0E A;  2IY0 B;  1NI2 A;  2MRP A;  2L83 A;  4NAW B;  4IM2 A;  3TL5 A;  4OVZ A;  3CIR B;  3ZGZ A;  3RZW C;  3PRE A;  4WQO B;  2KFK B;  3A9J A;  4A6Q A;  1GJZ A;  2L00 B;  2N9P C;  2GB1 A;  1GB4 A;  2PKO A;  2BB5 A;  5IP4 D;  2LVO A;  1HTQ A;  3RYT A;  4KKI A;  1YJJ A;  3KUD B;  3DBH I;  2QIE B;  3R2T A;  3DHH C;  2CHX A;  2PW9 A;  3NVV A;  3JW0 X;  1T0R C;  3SR6 A;  2GBR A;  3Q3M C;  2NPT B;  1C3T A;  1PYW D;  3U52 E;  1I4P A;  2FUH B;  3QX1 A;  1TYG B;  2KTR A;  4AOF A;  4K7U A;  1I7H A;  1OEY A;  3PV1 A;  2AL6 A;  2N7J A;  1AWD A;  1J19 A;  3AMZ A;  3NHE B;  1MPE A;  2PEA A;  2RGF A;  1MG4 A;  4P16 A;  3H6N A;  3A4S C;  3N20 C;  3NOB A;  2H88 B;  5FR3 A;  1K51 A;  3W5V B;  4ANU A;  2MBQ A;  3QK0 A;  3PZD A;  4F1S A;  2LXC A;  3A9K A;  3GS2 A;  1AAR A;  4DBG A;  2G45 B;  4X57 B;  4BOS C;  4OHJ A;  3DBL I;  1TZO A;  2NS5 A;  2SAK A;  2JZ3 B;  2KX3 A;  3M62 B;  1XCT L;  1WM2 A;  3ZJV A;  1JWB D;  2K8C A;  1K52 A;  2KMA A;  4W9D A;  3BYT B;  3VTU A;  1B1Z A;  1UD7 A;  3ZYY X;  1L4Z B;  4JPS A;  4EE2 A;  2BPS A;  2LAS A;  2V9H A;  2BW2 A;  3AE8 B;  3Q8C A;  4P1C C;  4EFO A;  3ECI A;  5AZG A;  1FD6 A;  2MHJ A;  2Z0D B;  2FAZ A;  1ET9 A;  2BBC A;  4FA6 A;  1V80 A;  2IGG A;  2DWQ A;  1L5P A;  4RH6 A;  2BYT A;  3AED B;  4BKG A;  5H8Y E;  1L7Y A;  2BQQ A;  3ZXV A;  4RGN A;  4ANX A;  1LO5 D;  1XO3 A;  3VUY A;  1C9F A;  3OJ4 B;  3Q3F A;  1QLB B;  2QHO A;  5FKA C;  4XDC A;  3P4Q B;  1FFV A;  5CHV C;  3AE5 B;  1PFD A;  1OQQ A;  5D2M B;  4K1R B;  3MJW A;  4HCN B;  4XGA B;  2PTL A;  4W9J A;  3W5U B;  4M00 A;  3M3J A;  1C1Y B;  4NJC A;  3J9C A;  3I5J C;  4FJZ A;  3SHQ A;  1QZE A;  2YVC A;  4B95 A;  3VAW A;  2EKI A;  3LB8 C;  2KC1 A;  1TY0 A;  2LFI A;  2JRH A;  3KWL A;  3DBR I;  1IGD A;  2WXP A;  4DHZ E;  3DWG C;  4JLC A;  1XF5 L;  4YXD B;  1QKZ A;  2BWF A;  4AUQ C;  1ZDX A;  3FIL B;  4N6E B;  4Q2J A;  5KHQ A;  3VTV A;  2LGS A;  4WWM A;  2AWT A;  3VH3 B;  2JXT A;  3KUC B;  1VZ6 A;  2MP2 A;  3PHW B;  2RDB C;  2O2V A;  2N9X A;  5KHO A;  1ZW7 A;  4LDT B;  4G50 A;  3QA8 A;  4HWI B;  1WYG A;  4XDD A;  4MSM B;  5JHA A;  2RMM A;  1HZ5 A;  2IDY A;  1ZKH A;  2V4I B;  3NVZ A;  1FPY A;  3N1Y C;  2AX5 A;  5I4D A;  2IO2 B;  1WGH A;  3W2D A;  5LXH A;  1JQ4 A;  3L4P A;  5IAA C;  5E6P A;  3L10 B;  1EF1 A;  2J7Q B;  3RI7 C;  2KJH B;  1XEE A;  4MEM A;  2K5P A;  3W9C B;  1KTK A;  1FNU A;  2VRR B;  1LM8 B;  3X23 A;  1JRO A;  1NEN B;  4ZYS A;  2IYD B;  3U4E G;  4GGQ A;  1ROE A;  2MQJ A;  2NCN A;  3AE9 B;  2FCM A;  1SE4 A;  1WR6 E;  3TCA A;  1WM3 A;  1J7C A;  2QJL A;  4US8 A;  1DGJ A;  2BWE S;  3VR9 B;  1P7F A;  2C60 A;  5FK9 C;  4N9F 4;  1JWA D;  1N6Z A;  2LD9 A;  4BVU C;  5MPO A;  1ESF A;  2WXJ A;  4QAY A;  1WYW B;  2Z8L A;  4DXF A;  3BWU D;  4R3D A;  3C19 A;  1V1P B;  3C8Y A;  4IM0 A;  3NRZ A;  2PPH A;  2J52 A;  3SEB A;  1FRR A;  3RNB C;  1LFD A;  2W82 A;  2M0A A;  3D32 A;  2MBB B;  3AH7 A;  2ZPY A;  1DYQ A;  2SEB D;  1WXQ A;  2DAF A;  3EEC A;  3BVM A;  2JZP A;  3WCQ A;  3RNA C;  4NQK E;  2L3Z A;  1PUT A;  1WXM A;  1QF6 A;  5C23 A;  4HPL B;  3APC A;  2N1W A;  2BYV E;  1PQS A;  2KX0 A;  2LHD A;  2K1F A;  2WXI A;  2JT4 B;  2UU7 A;  4B6W A;  4ITK A;  4G0N B;  3ZW3 A;  3U2S C;  2B76 B;  2MJD A;  4IOI E;  2BB6 A;  4TV3 A;  5E6O A;  1CQV A;  2LVQ A;  1CMX B;  2GBM A;  4G3X B;  2M17 A;  5LLI A;  2K8H A;  1TY2 A;  1TS3 A;  4PK1 A;  4M02 A;  1SGH A;  2L05 A;  2KZR A;  2AQ2 B;  4GB9 A;  4LJP B;  3R8B A;  2BF8 B;  3P42 A;  2VH2 A;  2IGH A;  5AZF A;  3Q8F A;  3R7Q A;  2L52 A;  2REX A;  2ZCB A;  2WX1 A;  1EUV B;  2KLC A;  3MC9 A;  2ZNV C;  1WJ4 A;  3PGE A;  4OZA A;  2MJE A;  4IKG A;  4W9I A;  3ZDT A;  5D3D A;  2Q5W D;  3ZKJ C;  2WS3 B;  2RPQ A;  1KOT A;  3T3O A;  4KIK B;  4MGK E;  3A1Q A;  1FM0 D;  4C4V A;  2FNJ B;  4MM3 B;  2WU5 B;  5BYS A;  1QOG A;  3RCZ A;  4DHZ B;  2BYE A;  3TUO A;  1BT0 A;  1UUP A;  2CHW A;  3AEF B;  4KGT A;  5J17 A;  4HPP A;  4USA A;  1TS4 A;  1Q0W B;  3NS8 A;  3V60 A;  2WXF A;  1WGY A;  3WAN A;  1ZXH A;  3OAW A;  3TBL D;  4FHK A;  4AP4 C;  1WWT A;  1R4N B;  4URK A;  2NBU A;  3V6E B;  1QOB A;  4FJV B;  1WGG A;  1SF0 A;  3RT3 B;  1KF6 B;  3L13 A;  3H7S A;  2E3T A;  2JY6 A;  4J3O D;  2JWZ A;  2KLG A;  2KMC A;  4B0M A;  1XT9 B;  3GB1 A;  4JIO U;  4NAW A;  1C76 A;  1KM7 A;  3GE8 C;  2HE7 A;  3H9D A;  4EOY A;  2DLB A;  4S17 A;  4ZHO A;  3B2F A;  3SD5 A;  2HTM E;  2BKR B;  1EU4 A;  2V4L A;  2QDF A;  3IT4 B;  4HJG E;  4M0W B;  4LNI A;  1FCC C;  4GSW A;  3PZ8 A;  3UI3 A;  2J4X A;  2AQ3 B;  2KDB A;  2BGF A;  1UNS A;  1UEL A;  2K3U A;  1FCL A;  4BOZ B;  1UBQ A;  1E6E B;  1ZPS A;  2RDH A;  3AEB B;  3CF6 E;  3V6C B;  2NPT A;  4ZRK A;  2BVC A;  2LWP A;  2KOX A;  1R4M B;  3WAP A;  2MBE A;  4KZC A;  2W3R A;  3DQV A;  1SJE D;  1N61 A;  3FAH A;  1TS5 A;  3DPD A;  5L95 C;  1HE8 A;  2PVG C;  4HXD A;  3QAR A;  4DHJ D;  4E3C A;  2JRI B;  3HRD D;  1VZ8 A;  4CQN A;  1IP9 A;  2Y3A A;  2NBV B;  3IT6 B;  3AEC B;  2L32 A;  1Y8R C;  4IWQ A;  3RPF C;  3ZNG C;  3EFU A;  1HEZ E;  4E71 A;  2WDV B;  1AN8 A;  3IXS A;  1C4C A;  4DQO C;  1E7P B;  4WAF A;  2JF5 A;  4NQL B;  4WWO A;  3VR8 B;  4F7Z A;  1TKY A;  1QOF A;  1KLG D;  4EZK A;  2N9E B;  3EA6 A;  2DYM A;  1BUI C;  5IN7 A;  1YX6 B;  2N7E A;  1YJ1 A;  2HD5 B;  2K9X A;  4HJK A;  3T8M A;  1K50 A;  2DYO A;  2W55 A;  4F8C B;  1F52 A;  1QOA A;  2XNA C;  1CK1 A;  3IHP C;  4PYU A;  4GLS C;  3RNF C;  1GB1 A;  1YQB A;  2R61 A;  1P0R A;  2IND C;  3ZNZ B;  1Q1O A;  1NVI D;  2INC C;  2LI5 A;  3APD A;  4LNN A;  4MH0 E;  2D11 A;  4YTN B;  2L8J A;  1WGD A;  3TEX A;  1HXY D;  4LNF A;  3DOW A;  1P3Q U;  3MFG A;  4NNJ B;  2WXG A;  2WXH A;  2M19 A;  2FCN A;  1SE9 A;  4AWJ A;  3GP7 A;  3AE3 B;  4A90 A;  4G11 A;  3TIX A;  2ZCC A;  2G4D B;  2DX5 B;  5J2R A;  2KXJ A;  3BK2 A;  4W9H A;  5G5G A;  1FNV A;  4LNK A;  3ZNH B;  4MEL A;  2IO1 B;  4A9A A;  3ZVV A;  4WUR A;  3HIZ A;  4YT0 B;  2ZW1 A;  1OEY J;  1T6B X;  1I4H A;  2CR5 A;  4M8M A;  2DZM A;  2N9L A;  4HK2 A;  1YJI A;  2D3B A;  4S0R A;  3UGB B;  1TIF A;  3IVF A;  3M95 A;  1ZDV A;  1WJU A;  1SIF A;  2DYB A;  3JVZ X;  5BO4 B;  1WJ6 A;  4EEW A;  2IZV B;  4NPN A;  2LGI A;  2WU2 B;  1MJD A;  4OZC A;  2CU3 A;  3Q8E A;  4KSL C;  2LGY A;  1YOV B;  1F2R C;  4IG7 B;  2JPH A;  4H2A A;  1XXG A;  2XK5 B;  2L76 A;  1T0S C;  2YLM A;  1D5Z C;  4L23 A;  5BMI A;  1JAL A;  4AJW A;  4GMV A;  2GBN A;  4ARI A;  4L2Y A;  4OVU A;  1V9J A;  1SXT A;  2WDQ B;  2JXX A;  4IWP A;  3EGR A;  1TJE A;  1CJE A;  1WIA A;  3W1S C;  3GE3 C;  3C0R B;  5C3J B;  5G2N A;  3Q2A C;  1UWX A;  2E6X A;  5IKC M;  1SE2 A;  1L0V B;  2DZJ A;  3PVL A;  4JWS C;  4C80 A;  2X38 A;  2JU6 X;  4E74 A;  1XLN A;  3M63 B;  1WGR A;  2RSU A;  3LDZ E;  3I57 A;  2IBI B;  1V1O A;  3DDC B;  2K8B A;  2WXK A;  4PT5 A;  2WXL A;  2Z0E B;  3HM3 A;  1FXI A;  1TBE A;  1I4X A;  4LK0 M;  1TGZ B;  1V1P A;  2G3Q B;  2DZK A;  2XEW A;  5AZH A;  3GZN B;  2IO0 B;  3MC8 A;  3EUB 2;  4I6P A;  3VXW A;  3SFD B;  1WXA A;  4FBJ B;  3H1U A;  4K81 A;  3AE4 B;  1UZX B;  4RM9 A;  2KYW A;  1V6E A;  4M8N A;  2KNB A;  2DEN B;  2RD0 A;  1TKE A;  4CYE A;  5D94 A;  1I4R A;  3TEW A;  2INP E;  1WJN A;  2CJN A;  4L1B A;  3Q69 A;  2IPK D;  3VH4 B;  3ZDM C;  1WRD B;  1FMA D;  5J18 A;  1X1M A; 
#chains in the Genus database with same CATH homology
 2KX0 A;  3B08 A;  2K1F A;  2C7M B;  5IA7 A;  2JT4 B;  4IUM B;  3V61 A;  4B6W A;  1J8C A;  4G0N B;  5D7G A;  1ZGU B;  2LRW A;  3WAO A;  5E6N A;  3ZW3 A;  4II3 B;  2ZVN A;  3WA0 A;  2D07 B;  4TV3 A;  1IPG A;  1WXS A;  2HJ8 A;  1WF9 A;  1WH3 A;  3DVN V;  4MGY E;  5E6O A;  5L83 A;  3AXC A;  1KLV A;  4FLH A;  3BIN A;  2LVQ A;  1CMX B;  3UIO B;  2GBM A;  3IFW B;  3H7P A;  4G3X B;  2M17 A;  2KDI A;  3A9J B;  3WAL A;  5LLI A;  1UH6 A;  3PPA A;  2K8H A;  4NJ7 A;  5FR6 A;  2IO3 B;  4A3P A;  2HTH A;  4GXB A;  2KHW B;  1SGH A;  2BYF A;  1UGM A;  2L05 A;  1GUA B;  2KZR A;  4GB9 A;  3QCA A;  4IW0 A;  4LJP B;  4TKN A;  1G6J A;  4LCD E;  2O6V A;  2BF8 B;  2JVC A;  1D3Z A;  2OOB B;  1NBF C;  4NY0 A;  5AZF A;  1OTR B;  4XX5 A;  3R7Q A;  2I1K A;  2REX A;  2ZCB A;  3H7P B;  2G4S A;  2WX1 A;  3QQ8 B;  3QHT A;  1EUV B;  4W9G A;  3JYU A;  2KLC A;  4MJS A;  3QAQ A;  2ZNV C;  1WJ4 A;  4FAD A;  3PGE A;  3KVF B;  2K25 A;  1WX8 A;  1YD8 U;  4W9C A;  2KC2 A;  3JSV B;  2LGD A;  3EC8 A;  2N1V A;  2L0F A;  3QIJ A;  4GOC A;  4W9I A;  3ZDT A;  4XC2 A;  3ZRC A;  1R4N I;  1WX9 A;  1YIW A;  3ZKJ C;  1E7V A;  2RPQ A;  1KOT A;  3L17 A;  2D3G A;  4KIK B;  1GC7 A;  2KTR B;  4IM3 A;  3A1Q A;  4MGK E;  2ZPN A;  2FNJ B;  5CTR C;  3ALB A;  5DPR A;  2PE9 A;  4DK5 A;  3RCZ A;  4DHZ B;  2DZI A;  4WJO A;  1TTN A;  4HDO A;  4HCP B;  3A4R A;  2BYE A;  4W9K A;  1GG3 A;  4B9K A;  2MBO A;  1GC6 A;  2UWQ A;  5DPW A;  1BT0 A;  2CHW A;  4HVB A;  2XK5 A;  2KWV B;  4PYZ A;  1VD2 A;  1WI0 A;  5J17 A;  1WX7 A;  3NY5 A;  3DVG Y;  1I42 A;  4KDI C;  2CKH B;  1Q0W B;  3NS8 A;  3V60 A;  3OJ3 A;  2N4F A;  2WWZ A;  1P9D U;  1WY8 A;  2W9N A;  2J0M A;  3KYD D;  4MDK E;  1WGY A;  3KH0 A;  3W1S A;  2AL3 A;  1P1A A;  2KO3 A;  3WAN A;  3IG3 A;  3OAW A;  3TBL D;  4FHK A;  2EMS A;  4ICV A;  4AP4 C;  3A9K B;  1EF5 A;  2MLB A;  4WWN A;  4IC7 B;  2KK8 A;  4URK A;  3ZLZ A;  1WFY A;  2NBU A;  3V6E B;  1S1Q B;  1WMH B;  4ANV A;  4FJV B;  1WGG A;  2LGX A;  3R7R A;  3LJ3 A;  3AI5 A;  3RT3 B;  2I1J A;  4XZ4 A;  3L13 A;  3H7S A;  3U7D A;  2V1Y A;  3ZO5 B;  2JY6 A;  3AUL A;  1WXV A;  4JL9 A;  1LQB A;  2JWZ A;  2KLG A;  2KMC A;  5G55 A;  2KKC A;  1XT9 B;  1WZ3 A;  3L08 A;  2EKE C;  3I3T B;  1V5T A;  4JIO U;  4NAW A;  3UQB A;  4LJO B;  4ANW A;  1WE6 A;  1XQQ A;  3UIP B;  1H8C A;  2R2O A;  3OLM D;  4BBN F;  3PSE B;  4ZRJ A;  3L54 A;  2ZNV B;  1KM7 A;  2AYO B;  3VUX A;  1IYF A;  1RFA A;  2HE7 A;  3H9D A;  4EOY A;  1KJT A;  1V49 A;  3KUZ A;  1RRB A;  1XD3 B;  2JZZ A;  2KN5 A;  4JGH B;  3SD5 A;  2BKR B;  2V4L A;  1R4M I;  4MGI E;  2IY0 B;  1NI2 A;  2MRP A;  4GIV A;  4NAW B;  1Z5S B;  1YX5 B;  3PTF C;  4IM2 A;  3TL5 A;  4M0W B;  2M8S A;  3ML8 A;  2RR9 A;  4GSW A;  2C9W B;  4WAA A;  2M1M A;  2M0X A;  4BKS D;  3RZW C;  2L0T A;  3QWZ B;  2KDB A;  4A3O A;  1E8Z A;  3PRE A;  4WQO B;  2BGF A;  2KFK B;  3A9J A;  3R3M A;  4KSK C;  1GJZ A;  1UEL A;  2L00 B;  2N9P C;  1E8W A;  4FHJ A;  4GDL A;  3DVN U;  3ENE A;  5C1Z A;  2KTF A;  4BOZ B;  2V3S A;  3QC8 B;  1UBQ A;  4HDQ A;  4HPM B;  3VVW B;  1PQS A;  4PS7 A;  3HK0 A;  2KQS A;  4EZL A;  3CF6 E;  2LVO A;  3V6C B;  2NPT A;  4ZRK A;  3RYT A;  4RMA A;  1E8Y A;  3CSF A;  2LWP A;  4IWO A;  2KOX A;  4ICU A;  1I35 A;  3KUD B;  1WR1 A;  3DBH I;  4FUL A;  3WAP A;  2MBE A;  4KZC A;  2K6D B;  2N7D A;  4GDL B;  2CHX A;  3B1L X;  3DQV A;  3JW0 X;  3DPD A;  2PE6 B;  5L95 C;  1HE8 A;  4HXD A;  3JSV A;  3QAR A;  2GBR A;  4I6N B;  2JRI B;  4KV2 A;  4DHJ D;  4E3C A;  4KZ0 A;  2NPT B;  1IP9 A;  2NBV B;  2MWS B;  1C3T A;  4WJQ A;  2KDF B;  2NR2 A;  1Y8R C;  4IWQ A;  2FUH B;  3ML9 A;  3QX1 A;  4KIK A;  2KTR A;  3ZNG C;  4AOF A;  4K7U A;  5GMV A;  3EFU A;  2IY1 B;  4E71 A;  4A20 A;  1OEY A;  3PV1 A;  4P7I A;  2AL6 A;  4MM3 A;  4II2 B;  3MHS D;  2PJH A;  4EKU A;  2GMI C;  1J19 A;  2UYZ B;  3NHE B;  2GBK A;  2JF5 A;  4NQL B;  2RGF A;  2PEA A;  4WWO A;  4EUT A;  3H6N A;  4W9E A;  3PRM B;  3A4S C;  4ZYN A;  4F7Z A;  3QJZ A;  3NOB A;  2MP2 B;  4EZK A;  2N9E B;  2D2Q A;  2O2V B;  4LDT D;  4ANU A;  2MBQ A;  2DYM A;  3PHX B;  3QK0 A;  3TJP A;  3UQA A;  3PZD A;  4F1S A;  1K8R B;  1YX6 B;  2N7E A;  3K9P B;  1YJ1 A;  2HD5 B;  1V5O A;  4DXA B;  5HKH A;  2LXC A;  3A9K A;  4HJK A;  3ZUN A;  3K9O B;  3T8M A;  3N30 A;  1AAR A;  3N32 A;  2G45 B;  4X57 B;  1WMH A;  4BOS C;  4ASW C;  4DBG A;  2DYO A;  3DBL I;  2NS5 A;  2JZ3 B;  4F8C B;  2GBJ A;  2KX3 A;  3M62 B;  4MSQ B;  3SDL C;  1ISN A;  4FJY A;  3IHP C;  1WM2 A;  3A33 B;  2K8C A;  4K7S A;  2BKF A;  4PYU A;  2KMA A;  2LZ6 A;  4W9D A;  3VFK A;  1UBI A;  3VTU A;  1YQB A;  3DBS A;  1UD7 A;  1P0R A;  3ZNZ B;  1Q1O A;  3RZF A;  2LI5 A;  2O6V D;  3APD A;  2CHZ A;  2L7R A;  1RAX A;  2BPS A;  2WX0 A;  2LAS A;  2KFJ A;  3PLV A;  1WZ0 A;  2C7H A;  3Q3J A;  1FXT B;  3IBE A;  3ECI A;  4MH0 E;  5AZG A;  4EFO A;  2D11 A;  3BY4 B;  3KYC D;  3VHT C;  2KWU B;  1OQY A;  2L8J A;  1WGD A;  2ZJD A;  2Z0D B;  2FAZ A;  3DOW A;  4FA6 A;  1P3Q U;  1V80 A;  4NNJ B;  2KDE B;  3VDZ A;  1H4R A;  2FCN A;  1SE9 A;  3CMM B;  2J0J A;  4AWJ A;  4BKG A;  4DDG D;  3U8Z A;  2OJR A;  1L7Y A;  3CST A;  5D6J B;  1VCB A;  3SU8 X;  2KFK A;  4ANX A;  1OGW A;  3VUY A;  1M94 A;  3EHV A;  4G11 A;  3TIX A;  3OJ4 B;  1RLF A;  3Q3F A;  2MBH A;  2G4D B;  2QHO A;  2LVP A;  2DX5 B;  2ZCC A;  3HM6 X;  2KXJ A;  3L16 A;  5DPS A;  2DAJ A;  5J2R A;  3AU5 A;  1L2N A;  5JZE B;  4W9H A;  2LJ5 A;  3ZNH B;  5CHV C;  4CHK A;  4MEL A;  5D2M B;  4K1R B;  2IO1 B;  3MJW A;  4GN1 A;  4HCN B;  1E7U A;  3AU4 A;  3ZVV A;  3DVG X;  3HIZ A;  4GDK A;  4W9J A;  4I6L B;  2KJ6 A;  3M3J A;  1C1Y B;  1OEY J;  2ZVO A;  3KW5 B;  2NBW B;  2LUE A;  3W1Y A;  4FJZ A;  3SHQ A;  4DWF A;  2CR5 A;  1QZE A;  3UF8 A;  2YVC A;  3PS6 A;  4M8M A;  3GOE A;  2DZM A;  4B95 A;  3VAW A;  4HK2 A;  3ZIM A;  5AEK B;  2KC1 A;  3UGB B;  3IVF A;  3M95 A;  1WJU A;  2JRH A;  2MSE D;  1SIF A;  3DBR I;  4GDK B;  4DHZ E;  2DYB A;  4JLC A;  3JVZ X;  2ZEQ A;  4ZDV A;  2BWF A;  4AUQ C;  5BO4 B;  5CHW A;  3ZNI D;  1WJ6 A;  2GOW A;  3V62 A;  3RUL A;  3ZRF A;  4EEW A;  2IZV B;  2JUO A;  3ONS A;  4NPN A;  3VTV A;  5KHQ A;  3S2A A;  1S3S G;  2AWT A;  4NJ6 A;  4J6I A;  3VH3 B;  4WWP A;  1Z2M A;  3KUC B;  4KSL C;  2LGY A;  3VUW A;  2MA9 B;  2XBB C;  2MP2 A;  1E5W A;  1JRU A;  1V2Y A;  2JPH A;  3PHW B;  2KD0 A;  4IG7 B;  2FCS A;  1P98 A;  4ZRI A;  2O2V A;  2N9X A;  3ZTC A;  2XK5 B;  2C5L C;  2L76 A;  2EMT A;  1ZW7 A;  5KHO A;  2MX2 A;  4LDT B;  5DCN A;  2YLM A;  4G50 A;  1Q5W B;  3QA8 A;  4HWI B;  3ZTD A;  2K39 A;  4AJW A;  5LXI B;  4MSM B;  5JHA A;  3P2B A;  2GBN A;  4GMV A;  3X0W A;  3WAM A;  1MG8 A;  4OVU A;  1V9J A;  1ZKH A;  1E90 A;  2FID A;  2JXX A;  4IWP A;  1NDD A;  3T9L A;  1WIA A;  1EO6 A;  2KVR A;  3W1S C;  3C0R B;  5G2N A;  1LXD A;  2D10 A;  2IO2 B;  2KJR A;  5JHB A;  1WGH A;  1GNU A;  4TUU A;  5LXH A;  2DZJ A;  3PVL A;  3DCG A;  2DHZ A;  4W9L A;  4YL8 A;  5IAA C;  4E74 A;  2NVU I;  3L0W B;  5E6P A;  4TQ0 A;  1TZ1 A;  5CX3 A;  3M63 B;  2ASQ A;  4BFR A;  1WGR A;  2RSU A;  1V86 A;  2O6V B;  2M4N A;  3L10 B;  1EF1 A;  2C7N B;  2J7Q B;  3LDZ E;  3PT2 B;  2KJH B;  2B3A A;  5CHF A;  4MEM A;  3GZN I;  2IBI B;  3B0A A;  1A5R A;  4RM8 A;  2VRR B;  4FN2 A;  1LM8 B;  3X23 A;  3DDC B;  2K8B A;  3PLU A;  4MJS B;  2AEH A;  2WYQ A;  2Z0E B;  2KWC A;  3MTN B;  3HM3 A;  4WJP A;  3R66 C;  4KVG B;  2IYD B;  4GU2 A;  4BKS A;  4GGQ A;  2Z59 B;  2MQJ A;  2NCN A;  1TBE A;  2FCM A;  2KQ7 A;  5TR5 A;  3UIN B;  1WR6 E;  3A1Q B;  4MGZ E;  3RUI B;  3TCA A;  1TGZ B;  4K7W A;  4AJY B;  2WDT B;  4PS8 A;  1WM3 A;  5EDS A;  4DDI D;  2G3Q B;  1T0Y A;  2DZK A;  4JQW C;  4EZJ A;  3NZS A;  2BWE S;  5DPT A;  2XEW A;  4TQ1 A;  2A5U A;  5AZH A;  2C60 A;  1J0G A;  1E8X A;  2IO0 B;  3NZU A;  4N9F 4;  2LD9 A;  4BVU C;  3VTW A;  2K6Q A;  4OVV A;  3VQI A;  2Y5B B;  4I6P A;  3VXW A;  3U30 A;  1WXA A;  1WYW B;  4FBJ B;  3H1U A;  2CS4 A;  2LXA A;  4K81 A;  4CO7 A;  3PRP B;  5JH5 C;  1UZX B;  4IM0 A;  4W9F A;  4RM9 A;  2KAN A;  1F9J A;  2J0K A;  2MCN B;  4BKT A;  1V6E A;  2PPH A;  3O65 B;  1U4A A;  3APF A;  4M8N A;  2FIF A;  2KNB A;  1LFD A;  3TMP B;  2DEN B;  4HLE A;  2RD0 A;  3D32 A;  1WE7 A;  2MW5 A;  3RD2 A;  4CYE A;  2MBB B;  5D94 A;  3N3K B;  2ZPY A;  4PS3 A;  3WIM A;  2DAF A;  3EEC A;  1WJN A;  3PRZ A;  4KDL B;  1V81 A;  2ZZP B;  4NQK E;  2L3Z A;  4BBN C;  4DHJ B;  2R2Q A;  1WXM A;  5C23 A;  4HPL B;  3VH4 B;  3APC A;  1WRD B;  2CU1 A;  3HHM A;  2N1W A;  3ZDM C;  2LRU A;  2A4Z A;  5J18 A;  2FCQ A;  1X1M A;  2BYV E;  4WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...