4NPNA

Crystal structure of human tetra-sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 2
publication title Structural analysis of poly-SUMO chain recognition by the RNF4-SIMs domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4npnA00
3VHTC 2V4LA 4MGIE 5KHQA 3DVGY 4FJYA 4GGQA 4IWOA 3VTUA 2K6QA 1FXTB 2PEAA 4KSKC 2C7NB 3PRMB 3ECIA 3LJ3A 4HPLB 4MH0E 4DHZB 1P9DU 1C1YB 2CHXA 2K1FA 2NR2A 3RYTA 4AUQC 2C5LC 1EF1A 3ML9A 4GSWA 1E8ZA 3RZWC 2JWZA 3VTWA 1WRDB 4II2B 2RPQA 1J19A 2MWSB 2R2QA 2WDTB 1P1AA 4XC2A 2KKCA 5JHAA 1J0GA 2MBOA 2PE6B 3KUZA 2KNBA 1Q1OA 1WM2A 2ZCBA 2CHZA 2IBIB 4W9LA 4ANUA 2N9EB 2KDBA 2M0XA 3Q3JA 1U4AA 3MHSD 1OQYA 4TKNA 5G55A 4DHZE 3U30A 1TBEA 2CS4A 2O6VB 2C7MB 1L2NA 3ZLZA 1VD2A 4FJVB 4BKGA 2AL3A 3QHTA 4BFRA 3H6NA 3N32A 1WJ6A 2HD5B 2FAZA 2EMSA 4ZRIA 1E7VA 2BKFA 4B9KA 2KLGA 4KDIC 3HIZA 4LDTD 3ALBA 4A3PA 4DHJB 4ZRKA 4KZ0A 4HDQA 2UWQA 4K81A 2K39A 2L3ZA 3DBLI 4HCNB 1BT0A 3ZIMA 2D3GA 3ZO5B 2GBRA 5LXIB 3UQAA 5DPSA 5AZHA 2IO3B 2Z0EB 2IO1B 2AYOB 4WWNA 3ML8A 2DAJA 5CTRC 3VH4B 1WXAA 2NVUI 5LLIA 2MSED 4W9EA 3X0WA 1GUAB 2MCNB 2C9WB 2FCMA 3PHXB 5TR5A 2CR5A 3EC8A 4BOZB 2LI5A 1GNUA 2ZNVC 3QQ8B 2ZNVB 4HJKA 4WQOB 2MBQA 1WXVA 4GDKB 1EO6A 2N9XA 4MELA 1OEYA 2KN5A 5DPTA 3TJPA 2DYOA 3NS8A 4DDGD 2GBNA 2WYQA 4PS3A 4I6LB 3V60A 3RUIB 4WWOA 2O2VB 1WE7A 4W9GA 1TGZB 3D32A 2KDFB 2KDEB 2YLMA 2ZEQA 3AULA 3VDZA 5AEKB 4GDKA 2I1JA 2W9NA 1Q0WB 3TIXA 5J2RA 1TZ1A 2KJRA 2GMIC 1XQQA 2BYEA 4YL8A 1V81A 4GIVA 2O2VA 1D3ZA 3L16A 3B1LX 5HKHA 2MBBB 4MSQB 2L7RA 4F8CB 1JRUA 1E8YA 1LQBA 4EZJA 4DK5A 1WH3A 2CHWA 3L17A 3LDZE 2RD0A 4FN2A 4PS7A 3T9LA 3WA0A 3AU4A 2GOWA 1UBQA 2JZZA 3KVFB 4EEWA 1IPGA 2KZRA 3DQVA 4BKSD 4B6WA 2KLCA 1M94A 3RD2A 1WI0A 3QK0A 2PE9A 3H9DA 3UF8A 4B95A 3WIMA 2MQJA 1K8RB 3TMPB 3M62B 4HWIB 3L10B 3IHPC 3BY4B 3L08A 3IG3A 3MJWA 4LDTB 2MX2A 3RT3B 1Y8RC 4HPMB 1YQBA 3VFKA 2V3SA 3U8ZA 2KQ7A 3CSTA 1A5RA 3PLUA 3DVNU 2HTHA 4CYEA 2XK5B 2FCQA 2IO2B 2NBUA 2REXA 4WJQA 3SDLC 4KDLB 3U7DA 4EZKA 2NS5A 4RM8A 1P0RA 3KUDB 2JPHA 2FNJB 3M63B 5AZGA 2BF8B 4NJ7A 4CO7A 1WMHA 4TQ1A 4WJOA 4K7WA 1MG8A 4TUUA 5DCNA 2A4ZA 2J0MA 2PJHA 2PPHA 3IVFA 4FULA 4ZDVA 1H8CA 3QCAA 5E6PA 3SD5A 2DZIA 3PGEA 3CSFA 4LJPB 4A3OA 1OTRB 2KTFA 1AARA 4IC7B 4KSLC 2MLBA 3QIJA 1I35A 4DDID 4FLHA 4ZRJA 3QAQA 4NAWB 3ZNID 1Q5WB 2LZ6A 3L54A 1UD7A 2L0TA 2LASA 3HM6X 5G2NA 4G3XB 3PRPB 1E90A 2N7EA 2Z59B 3HHMA 4P7IA 4MEMA 2LWPA 3K9PB 1WGYA 4FBJB 2BPSA 2MBHA 2RGFA 4NAWA 3W1SC 3GOEA 4OVVA 3VAWA 4PS8A 2A5UA 3RZFA 2DZMA 4MSMB 3AU5A 2KJHB 1V80A 4WWPA 3V61A 2YVCA 1CMXB 3DOWA 1UGMA 3O65B 4KV2A 2L8JA 2N1WA 1WY8A 2D07B 3RULA 4HXDA 3W1SA 5BO4B 1WE6A 3BINA 1H4RA 4JQWC 4KIKB 4FADA 2BKRB 4MDKE 1WM3A 4ANVA 2Y5BB 4JIOU 2JXXA 5DPWA 3SU8X 1E7UA 1V86A 5AZFA 2DYBA 1WGHA 1WX8A 3NY5A 3VXWA 3N30A 3QARA 4JLCA 3QJZA 3APFA 4GMVA 3VQIA 4MGKE 3A4SC 1RAXA 3WANA 5JH5C 4KIKA 2K6DB 2MA9B 4NNJB 1EF5A 1P98A 1ZGUB 2G4SA 3DBRI 2OJRA 3ZNHB 3UQBA 4ICUA 4BKSA 5EDSA 3UGBB 2M17A 2MBEA 1NI2A 4LJOB 1KM7A 2KMCA 4F7ZA 1J8CA 3TL5A 1V9JA 2LXAA 3ZW3A 3VUYA 4GOCA 2C60A 1QZEA 1YIWA 4E71A 4KVGB 3TCAA 3PT2B 1YX5B 4BBNC 1GG3A 2MW5A 4M0WB 2R2OA 2DYMA 2KD0A 4EFOA 4PYZA 3PSEB 4KZCA 4ANWA 2BYVE 3PZDA 2JZ3B 3V6EB 4W9FA 2AWTA 1PQSA 1YJ1A 3WALA 3ZNGC 3JVZX 1WJNA 2LGYA 4OVUA 2KXJA 4N9F4 4ASWC 2LGXA 1LXDA 3JYUA 4IUMB 3X23A 3DCGA 1WZ0A 2KC1A 3M95A 3ENEA 3PTFC 1GC6A 4I6NB 1Z5SB 1WXMA 1WFYA 2NBWB 2CKHB 1XT9B 2D11A 3Q3FA 2FUHB 2I1KA 5GMVA 1L7YA 2FIDA 4I6PA 1NDDA 2IYDB 2KOXA 2IY0B 3VUWA 1WZ3A 2FIFA 4FHKA 4TV3A 1LFDA 1YX6B 2DAFA 3KYCD 3C0RB 3QA8A 5D7GA 3GZNI 2KVRA 3KYDD 2JRIB 4AOFA 2UYZB 4IWPA 3H7PB 3R7QA 2N9PC 3ZTDA 4J6IA 2GBMA 2KWVB 4XX5A 2KC2A 4FHJA 3UIOB 3HK0A 2LGDA 4W9JA 4GXBA 5CHFA 3A1QB 2HJ8A 3SHQA 4EOYA 1WMHB 1V49A 2KWCA 3EHVA 3PV1A 1I42A 2EMTA 2MRPA 5FR6A 3QC8B 3IBEA 4CHKA 1GC7A 3AXCA 4JL9A 2BWFA 4W9IA 2ASQA 3H7PA 2KMAA 2JY6A 1SE9A 5KHOA 1S1QB 2LRUA 2JF5A 2OOBB 3WAOA 3A1QA 3H7SA 2BWES 4IWQA 3RCZA 2WX0A 4GU2A 3OJ3A 3V6CB 5D2MB 2VRRB 1GJZA 4ICVA 4G11A 2KX0A 5JZEB 3DPDA 1WGGA 1WR1A 2KFJA 5D94A 2ZJDA 4HVBA 2FCSA 2MP2B 2B3AA 3WAPA 5D6JB 3IFWB 4AP4C 3OJ4B 2N1VA 4F1SA 4URKA 3DDCB 5LXHA 2M4NA 3ZDMC 2JRHA 4K7SA 2DENB 2ZPNA 4MM3A 3VH3B 2KQSA 4GB9A 2FCNA 4WJNA 4II3B 1Z2MA 4EUTA 2LRWA 4K1RB 2MP2A 1NBFC 2K25A 2DX5B 4DWFA 1P3QU 1LM8B 5L95C 4M8NA 4GDLB 3KW5B 3HM3A 4HCPB 4MGYE 2AEHA 2JUOA 5CHVC 4A20A 1RFAA 3PHWB 4IM0A 3MTNB 3APCA 3OLMD 1T0YA 4W9KA 3NZSA 3TBLD 4GDLA 2WWZA 3V62A 1KLVA 1E8WA 1IP9A 4G50A 1V5TA 4AWJA 2ZZPB 3CMMB 1V5OA 3PS6A 3A4RA 1E8XA 3JW0X 4AJYB 4NJ6A 1OEYJ 1V2YA 3ZNZB 1WJUA 4EKUA 2J0JA 3NHEB 3P2BA 4IM3A 4BBNF 3L0WB 3PPAA 2AL6A 1SGHA 3S2AA 3UIPB 3VUXA 1WGRA 3OAWA 1R4NI 1F9JA 1WX7A 1WX9A 4NY0A 1RRBA 4IM2A 3ZVVA 2IY1B 3W1YA 1EUVB 2O6VA 2BYFA 2ZCCA 1XD3B 4MGZE 4FJZA 4LCDE 4DBGA 1UBIA 2BGFA 2KWUB 3DBSA 4BOSC 5IAAC 5L83A 1WF9A 2V1YA 1YD8U 2WX1A 3KUCB 3ZUNA 2KO3A 1UZXB 3R3MA 3PREA 1ISNA 4HDOA 4BKTA 3ZTCA 2N4FA 4WJPA 4X57B 3PVLA 1WIAA 5DPRA 2LVOA 4RM9A 3NZUA 2IO0B 2G45B 3EECA 3B08A 3ONSA 4E74A 4GN1A 4HK2A 4E3CA 2JVCA 5E6NA 1ZW7A 4HLEA 4W9HA 5JHBA 3PRZA 3N3KB 2N7DA 2XEWA 1VCBA 2JT4B 3KH0A 2G3QB 2KTRB 1RLFA 2KANA 4NQKE 1TTNA 1WR6E 3H1UA 3AI5A 3M3JA 4W9CA 5J18A 3R66C 1WYWB 2NCNA 3JSVB 2L76A 2RSUA 4IW0A 5CX3A 2KTRA 3UINB 4AJWA 2DHZA 1KOTA 3DBHI 3ZRFA 1WGDA 2HE7A 4RMAA 2KDIA 3ZKJC 4JGHB 3K9OB 3L13A 2C7HA 1WJ4A 1KJTA 1X1MA 2KHWB 2KJ6A 2LXCA 2KFKB 3APDA 3JSVA 5J17A 4DXAB 1R4MI 2O6VD 1C3TA 4K7UA 2KK8A 2J0KA 3DVGX 2IZVB 2EKEC 4EZLA 5CHWA 1G6JA 2K8CA 2LVPA 1HE8A 2K8BA 2KFKA 2M1MA 2Z0DB 1S3SG 1V6EA 3A9JB 1UELA 2M8SA 3A9KB 2ZVNA 2L00B 4DHJD 2ZVOA 3VTVA 2RR9A 3EFUA 4WAAA 4ANXA 1WXSA 4MJSB 2K8HA 3QX1A 3DVNV 4G0NB 3ZRCA 1OGWA 4IG7B 1IYFA 2LVQA 2ZPYA 4M8MA 2D2QA 4ZYNA 2LJ5A 3A9JA 3A9KA 3I3TB 2LUEA 3PLVA 5E6OA 5C23A 2LD9A 4PYUA 4FA6A 1E5WA 1SIFA 3B0AA 3VVWB 2XBBC 4MJSA 2KX3A 5C1ZA 2NBVB 2DZJA 4NQLB 2GBKA 3QWZB 2NPTB 4W9DA 3T8MA 4NPNA 2CU1A 5IA7A 3WAMA 3R7RA 3CF6E 2GBJA 3NOBA 3A33B 3ZDTA 2G4DB 4XZ4A 4TQ0A 2L0FA 4BVUC 2L05A 2D10A 2QHOA 1UH6A 1ZKHA 2DZKA 2NPTA 2XK5A 2J7QB
chains in the Genus database with same CATH superfamily
3VHTC 4MGIE 5KHQA 3DVGY 4FJYA 4GGQA 1ACCA 2K6QA 4KSKC 1J7CA 4HPLB 4MH0E 3ZGZA 4WH4A 4C7ZA 2CHXA 2FUG1 3RYTA 4AUQC 2C5LC 2V3PA 4GSWA 2V3NA 5IO9A 4LNIA 2Y5CA 2WDTB 4XC2A 1I4GA 1L4DB 2MBOA 2KNBA 4KGTA 4NZLB 2M0XA 1PFDA 4L1BA 5G55A 1TBEA 2O6VB 4BKGA 2AL3A 1JW9D 3H6NA 3HRDD 1ZXHA 4UDUC 5H92C 3MC9A 2EMSA 1C4PA 1E7VA 4LDTD 4DHJB 4HDQA 4K81A 2OHFA 2JXTA 2UWQA 3MP9A 5G5HA 5IOIA 2E6XA 5IP4D 5AZHA 2AYOB 4WWNA 3ML8A 2DAJA 2V4IB 3X0WA 3P4PB 2AQ1B 4WQOB 2MBQA 4HPPA 4GDKB 3P4QB 1EO6A 1OEYA 5FKAC 3NS8A 2BYTA 2WYQA 4I6LB 2O2VB 3D32A 2KDFB 5D3IB 1VLBA 2W9NA 3PO0A 5J2RA 4HKQA 1XQQA 2J42A 3L16A 2QIEB 3C8YA 2MBBB 4MSQB 1D6EC 2L7RA 3LB8C 4O1NA 1E8YA 1LQBA 1WH3A 2CHWA 3GS2A 3WA0A 4EEWA 3KVFB 1E10A 1FRDA 3AE7B 4BKSD 2KLCA 1M94A 3QK0A 2PE9A 2QMTA 3AE5B 3M62B 2WXOA 3AEAB 3L10B 3L08A 1E6EB 4HPMB 4YTMB 3W2DA 2Q5WD 4KGRA 3CSTA 3PLUA 2HTHA 4CYEA 2FCQA 1TS5A 4HJGE 2MJEA 4KDLB 4RM8A 3KUDB 1TKYA 2BF8B 4CO7A 4WJOA 3BYYB 4TUUA 2A4ZA 2J0MA 3IVFA 1H8CA 3SD5A 4LJPB 4REZA 1RWSA 2AQ2B 4IC7B 2MLBA 3QIJA 2L32A 2KAJA 2W55A 2WXLA 2L0TA 3HM6X 4RNAA 1E90A 2EKIA 2Z59B 2CJNA 3HHMA 4P7IA 2BPSA 3GOEA 1T0RC 4PS8A 2A5UA 1V8CA 2RDGA 3RZFA 2DZMA 4WWPA 1C9FA 2YVCA 1CMXB 1WY8A 3I63C 3IAM1 1FM0D 3BINA 3N1YC 1XEEA 5C3JB 4MDKE 2Y5BB 2JXXA 4C7YA 1SB3C 3VXWA 3VR9B 3QARA 2WU5B 1Q10A 4IDIA 4A9AA 3BVGA 2K6DB 1VJKA 1ZGUB 3AECB 2OJRA 3VR8B 2M17A 4P16A 1KM7A 4US8A 1YOVB 1N62A 2JX5A 1V9JA 3VUYA 1YIWA 3FILB 4M0WB 2R2OA 3AMZA 1N63A 4LNNA 4PYZA 4KZCA 1TY2A 3R2TA 2DWQA 3WALA 2WXJA 5BMHA 1WJNA 4OVUA 4HROA 2LGXA 2PMVA 1NENB 3X23A 3MHZA 1WXMA 5BMGA 2CKHB 1WGKA 4AQ7A 4C56C 2WDQB 1IUEA 3VUWA 1WZ3A 1FFVA 4BZAA 1YX6B 2DAFA 5D7GA 3GZNI 4S0RA 2PLPA 2CJOA 1NEKB 1CJEA 2N9PC 4J6IA 4RGOS 2W3SA 1KFYB 3HK0A 2LGDA 5CHFA 1D5MC 4EOYA 2KWCA 2EMTA 1UGJA 4CHKA 3IBEA 3TEZA 1BMLC 2JYTA 5KHOA 1TYGB 3A1QA 2BWES 4FXCA 4IWQA 1HZ5A 3I57A 1E7PB 3OJ3A 1GJZA 5JZEB 1WGGA 3AEEB 1ZXIA 4HVBA 2B3AA 5LXHA 2M4NA 4K7SA 2DENB 2JZPA 1BXTA 4WJNA 1J7AA 1QT9A 2LRWA 4K1RB 2MP2A 1N6ZA 1TS2A 3ZYYX 4M8NA 4JWSC 4HCPB 1RFAA 3PHWB 3APCA 4DQOC 1T0YA 3V62A 1IGDA 3MFGA 4AWJA 3CMMB 5EE0A 3E56A 1E8XA 4GLSC 3NHEB 2JQRB 1SE2A 3L0WB 3PPAA 2WXHA 1JWMD 1WX9A 4A90A 4LNKA 3P4SB 2GRIA 1N60A 4LCDE 1UBIA 4N59A 5IAAC 5L83A 2WDRB 1WF9A 2V1YA 3KUCB 2KO3A 4RM9A 2JSVX 2KN4A 3ONSA 1UWXA 4HLEA 3EFCA 2KTRB 2NTSA 1TIFA 4IKGA 2NCNA 5CX3A 4XWWA 2DHZA 3DBHI 2MH7A 3ZRFA 1SXTA 2HE7A 2D3CA 3ZKJC 4JGHB 3L13A 1T5XD 1X1MA 3JSVA 2KHWB 2WNMA 2JYEA 2D3BA 4DXAB 4K7UA 2KK8A 5AUIA 1FFUA 2IZVB 2VH1A 1DOYA 4ZRQA 3DBRB 5CHWA 4C00A 1G6JA 2E3TA 3ZJTA 2OJWA 2M1MA 2M8SA 5C2TB 2L00B 2ZVOA 4R3DA 2QJLA 2LUMA 1WXSA 4ITKA 4G0NB 4KKJA 2LVQA 2ZPYA 2D2QA 2LJ5A 4BAXA 3A9KA 3PLVA 2LD9A 3DHHC 4PYUA 2W3RA 3NS1A 5C1ZA 4MJSA 2KX3A 2NBVB 4NQLB 4W9DA 2NPTB 1EM7A 3NOBA 4TQ0A 4BVUC 2D10A 2QHOA 1K52A 1ZKHA 1ENFA 5H8YE 3VTUA 2FBWB 2ZW0A 3ECIA 2WU2B 3LJ3A 2M0AA 4N58A 4DHZB 5HHDG 4MH8A 2K1FA 2NR2A 1EF1A 1E8ZA 3RZWC 1WRDB 4II2B 2LGIA 2PE6B 3ABVB 5AUKA 2ZCBA 4W9LA 1TS4A 2N9EB 1U4AA 3MHSD 1OQYA 4OZBA 4OW0A 1SE4A 3ZLZA 1VD2A 1C77A 3FKYA 4FJVB 5HFYA 4P1CC 2V9HA 4BFRA 1QLBB 4NAMA 1WJ6A 2FAZA 4ZRIA 2BKFA 2KLGA 4KDIC 3HIZA 3RMKC 1XXGA 3ALBA 3ZXVA 1L5PA 4KZ0A 1K53A 2IGDA 3DBLI 1QOBA 2D5GA 3ZO5B 4OZCA 1P7FA 2Z0EB 1WXAA 1XLNA 1GUAB 2L52A 4BOZB 1GNUA 3AE6B 1JROA 1MG4A 3SFEB 2ZNVC 3QQ8B 4LK0M 4HJKA 4KKIA 5BYQA 1JRPA 3TJPA 4PS3A 2Y3AA 3V60A 4WWOA 1WE7A 2ZEQA 3AULA 1Q0WB 2GMIC 3RNFC 3AV8A 3AE4B 4YL8A 1T0SC 1IBXA 4GIVA 1OQRA 1KLGD 2KQ4X 3B1LX 4F8CB 2W54A 3URYA 1C4AA 2GOWA 2JZZA 1IPGA 2KZRA 2WXQA 3DQVA 4B6WA 3R8BA 1WI0A 3H9DA 3UF8A 3WIMA 3TMPB 1B9RA 2WP9B 3VFKA 1PUTA 2XK5B 2NBUA 1WXQA 4EZKA 5AZGA 3M63B 1I4RA 4K7WA 1E9MA 2PJHA 4ZDVA 2DZIA 3PGEA 1MPEA 3CSFA 2RDHA 4RCOA 1AARA 1D5XC 3MC0B 4HEA1 2WXNA 2D3AA 3RNGC 3ZNID 1HQRD 4YSYB 2N7EA 2MBHA 3W1SC 3NVWA 4OVVA 3VAWA 1QILA 3KLSX 1XF5L 3AU5A 1YNTE 3B2FA 1UGMA 3BVZA 3O65B 4KV2A 3KQ4A 1I4PA 1NVID 3W1SA 3H8HA 5BO4B 1WE6A 4JQWC 3KWVA 2BKRB 1JWBD 1JWUD 1V86A 3Q8EA 2DYBA 3N30A 1LO5D 3VQIA 3A4SC 1PGAA 5BYRA 3WANA 1L4ZB 4KIKA 2MA9B 2G4SA 2H88B 3ZNHB 4K3CA 4BKSA 1FEHA 1MHXA 2MBEA 1NI2A 3J9CA 4LJOB 3P1MA 1QZEA 4XDCA 3TCAA 4BBNC 3WCQA 2MW5A 2KD0A 2N7JA 2VZKB 3Q8CA 4ANWA 2QDFA 5T8IA 4W9FA 4XDDA 2AWTA 1YJ1A 3U4EG 2LHDA 4OVZA 4US9A 2LGYA 3N1XC 1LXDA 4RGTA 3M95A 1GC6A 4Q2JA 1M4VA 1Z5SB 3E9SA 1SJHD 1WFYA 1WRIA 1UUPA 1XT9B 3TEWA 3Q3FA 4L2YA 1UNSA 3DWMA 2I1KA 5GMVA 2HDEA 1L7YA 2FIDA 2DNFA 2HTME 3I5JC 1D5ZC 4FHKA 2FIFA 2KMMA 4TV3A 3C0RB 4HRSA 3QA8A 2BS3B 4AOFA 2TSSA 2UYZB 4WURA 2KWVB 4QAYA 4DXFA 4FHJA 3UIOB 4GXBA 3A1QB 1WMHB 2N9LA 1I42A 2MRPA 1GC7A 2AX5A 3AXCA 4JL9A 3H7PA 3P63A 2IGGA 2JY6A 3NVYA 1SE9A 1S1QB 2LRUA 3WAOA 4GU2A 1R7SA 1WR1A 5IN7A 5D94A 2ZJDA 1TT5B 2MP2B 3WAPA 3VRBB 1ZE3D 3SFDB 2N1VA 1Y56A 4S17A 2ZPNA 3VH3B 2KDMA 4EUTA 2K25A 1ZOYB 1I7HA 3GP7A 1GB4A 2JUOA 4A20A 3ZJUA 2BT6A 3NZSA 3L4PA 2YEPF 2MJDA 1E8WA 4JPSA 3V3XA 4KGSA 1V5TA 1F2RC 1XLOA 1V5OA 4AJYB 3ZNZB 3RNAC 2J0JA 2L1AA 4IM3A 4BBNF 1ET6A 2K22A 4N6EB 1CZPA 1FNVA 1EU4A 1QKZA 1RRBA 1KF6B 3AB5A 2IY1B 4YT0B 3W1YA 2O6VA 2BYFA 1XD3B 3W5VB 4MGZE 4WAFA 3IT6B 4DBGA 1UWMA 1YD8U 2WX1A 2QEJC 3PREA 4HDOA 4BKTA 3ZTCA 3NUHB 3PVLA 2V0GA 2LVOA 1QQRA 2LJIA 3B08A 4E74A 4RFBA 2JVCA 4W9HA 2NMQA 3PRZA 3TEXA 2N7DA 3KH0A 4NQKE 1WR6E 1FO4A 1JCKB 3AI5A 4MACA 1WYWB 3JSVB 2ACZB 2MHJA 1AN8A 4RMAA 2K0PA 2LXCA 1KJTA 1P7EA 5J17A 1YN5A 2O6VD 1C3TA 2LEKA 2J0KA 2WGSA 1T3QA 3BIID 4EZLA 2K8CA 2LVPA 1FD6A 3Q69A 2Z0DB 1JWAD 1S3SG 1A70A 1NYRA 3A9KB 1YJJA 2B76B 4DHJD 3VTVA 1SIJA 3AE9B 4MJSB 1KTKA 5IKCM 1OGWA 4IG7B 1IYFA 4OHJA 2KT7A 3A9JA 3GE3C 2LUEA 3AE1B 1I4XA 3VVWB 3EUB2 1PDXA 4NPNA 1FPYA 2CU1A 2G4DB 4XZ4A 2X8XX 2DZKA 2V4LA 1FXTB 1T0QC 1N5WA 1P9DU 3RNBC 1C1YB 2JWZA 3VTWA 2MWSB 5JHAA 2KKCA 1ZUD2 1HZ6A 3AN1A 3KUZA 3LYYA 2CHZA 2IJ0A 1UF0A 4TKNA 4DHZE 3U30A 2C7MB 1L2NA 1WYGA 4A6QA 1GOZA 1SF0A 3RN9C 1HTQA 3N32A 1L0VB 2HD5B 4WIPA 4B9KA 2K9XA 4A3PA 2K39A 3ZXRA 3AEGB 4HCNB 1FMAD 2GBRA 5LXIB 2RDBC 1EU3A 2IO1B 4A8XC 1LGRA 3VH4B 2NVUI 5LLIA 2MSED 1YN3A 3Q8AA 2C9WB 2FCMA 3PHXB 3EC8A 2LI5A 4WQMA 4XWTA 4USAA 1EWYC 4P1BC 3W9CB 2ZNVB 1WXVA 3DHGC 2N9XA 1QF6A 2KN5A 4DDGD 1IBXB 1BUIC 5FR3A 3RI7C 2YLMA 3VDZA 5AEKB 2KJRA 1B1ZA 1V81A 1D3ZA 4LNFA 4DXGA 1SEBD 1F0ZA 5HKHA 3AE8B 1JRUA 4DK5A 1R4NB 3L17A 3LDZE 2RD0A 4PS7A 2X38A 3AU4A 4YSZB 2WQYB 2PTLA 2W82A 3RD2A 1L6UA 2MEKA 1WWTA 2PIAA 1XO3A 2M19A 1QOAA 3MJWA 4LDTB 3IG3A 2MX2A 3RT3B 1YN4A 2CU3A 3U8ZA 1RM6C 1A5RA 2L83A 2GLSA 2IO2B 1L0XB 4WJQA 3U7DA 1ESFA 2NS5A 1P0RA 2FNJB 1YJIA 1SE3A 1EWCA 4NJ7A 3AEFB 1FXAA 2PPHA 4FULA 3QCAA 1K51A 4A3OA 2WXMA 3NJTA 1CQVA 1I35A 4DDID 4FLHA 4ZRJA 3W5UB 1Q5WB 2LZ6A 3L54A 4RGMA 1ZP0B 2BS2B 2INDC 2PVOD 4G3XB 1HTOA 5MPOA 1MFWA 1R4MB 2Z8LA 4MEMA 4FBJB 1TKGA 4NAWA 2KWDA 2I2YA 4MSMB 1V80A 3V61A 4B0EA 2N1WA 2N0SB 2RMMA 3N9YC 3AM9A 1H4RA 4KIKB 1WM3A 4ANVA 5DPWA 5G5GA 1WGHA 3NY5A 3PZ8A 4ZHOA 4GMVA 1RAXA 4L23A 5JH5C 1XCQL 4NNJB 2YEPB 5JXVA 3DBRI 3UQBA 1F52A 2UU7A 5EDSA 3UGBB 1I4HA 2N9KA 2KMCA 4F7ZA 3TL5A 3T3NA 1D4BA 3OG5A 4KVGB 3PT2B 1YX5B 2SAKA 2DYMA 3PSEB 3V6EB 2G9HD 3HUIA 5LNK1 4YXDB 1YQ4B 4N9F4 4RF0A 3JYUA 3DCGA 1WZ0A 2KC1A 2PW9A 3PTFC 4I6NB 2DBYA 3NG0A 2BVCA 2NBWB 2FUHB 2R61A 4JE3B 3EA6A 1RYJA 4M02A 1NDDA 1VR9A 2IYDB 2KOXA 2IY0B 1QOFA 3BZDB 2KVRA 3RNCC 4D2KA 2JRIB 4IWPA 3H7PB 3R7QA 2BW2A 2GBMA 2INPE 2KC2A 3N20C 4YTPB 3AEBB 2HJ8A 3SHQA 1V49A 3EHVA 3Q6BA 3QC8B 2BWFA 4W9IA 2ASQA 2OEDA 2J4XA 2IDYA 3IT4B 4IOIE 2WHIA 4RGNA 4PT5A 3DPDA 5D3DA 2KFJA 1K50A 5D6JB 3IFWB 4AP4C 4ZHPA 4URKA 3DDCB 4ARCA 4MM3A 4HKZE 2KQSA 2FCNA 3EGRA 3Q2AC 1NBFC 1P3QU 1LM8B 5L95C 3KW5B 2J52A 3U52E 3TSSA 3OWEB 1KLVA 3TBLD 4GDLA 3ZQ4A 4J3OD 3U2SC 4G50A 4NJ6A 1OEYJ 1WJUA 4EKUA 1ZDVA 1V1PA 2VH2A 2BTEA 3VUXA 1L0YB 1WX7A 1HXYD 4XGAB 4FJZA 2BGFA 2KWUB 2ON8A 3DBSA 1C79A 4YTNB 1NYQA 3ZUNA 4JWUC 1UZXB 3R3MA 1JQ4A 1ISNA 1V1OA 2N4FA 4WJPA 5DPRA 1WIAA 3NZUA 1TZOA 2G45B 4GN1A 3T3OA 5E6JA 5JHBA 3N3KB 3AH7A 2XEWA 4NJCA 1VCBA 1RLFA 4MT5A 3AEDB 1NI3A 2KANA 1STEA 3M3JA 5J18A 2L76A 3UINB 1DYQA 4AJWA 1KOTA 1AWDA 1WGDA 2KDIA 1KLUD 3LXFA 1AW7A 1JALA 1C4CA 2C7HA 1WJ4A 2KJ6A 1XLPA 5FK9C 4H2AA 4ACFA 1C76A 3MJ5A 2KFKA 4LNOA 3A9JB 2INNE 1I4QA 3UI3A 2RR9A 2ONQA 4WAAA 3QX1A 2WXPA 4ZYNA 3FC4A 1F2RI 3I3TB 5E6OA 1E5WA 2QSDA 2XBBC 3RNEC 1JWSD 2GBJA 4ARIA 2M56B 2L0FA 1XLQA 4ZYSA 3Q3OC 2QCZA 1JMLA 1CK1A 3AE2B 2PVGC 2XK5A 2J7QB 3IXSA 4IWOA 2AQ3B 2PEAA 2C7NB 3PRMB 4C4VA 3ML9A 3IAS1 2RPQA 1J19A 2R2QA 1P1AA 3GZNB 1J0GA 2G1EA 5HG2A 1Q1OA 1WM2A 1FNUA 3KWLA 2IBIB 5GXGB 4ANUA 2KDBA 3Q3JA 2CS4A 2RPVA 3U7ZA 3QHTA 5I4DA 1F1HA 4M01A 3Q3NC 4ZRKA 2L3ZA 3ZIMA 1BT0A 5EE1A 2D3GA 3UQAA 3PZ7A 5DPSA 2IO3B 1MHHE 5CTRC 4W9EA 2IPKD 2PKOA 1GPXA 2Y5PA 1GAQB 2LFIA 2WDVB 2MCNB 5TR5A 2CR5A 2QC8A 3NRZA 3R2IA 4MELA 5DPTA 4LTUA 2DYOA 3NVZA 3SR6A 2GBNA 3RUIB 1DOIA 4W9GA 1TGZB 1WSPA 2KDEB 1VRAB 4GDKA 2EELA 2I1JA 3TIXA 1TZ1A 2BYEA 2O2VA 1DGJA 4PK1A 3N1ZC 1J7BA 3NZ3A 2K5PA 4XYCA 1PGBA 1ZPSA 4EZJA 3Q8FA 4YSXB 3TUOA 1F77A 1VZ8A 4FN2A 3T9LA 1UBQA 5HI1A 4B95A 2MQJA 1K8RB 1QOGA 4EE2A 4HWIB 3IHPC 3BY4B 1Y8RC 1YQBA 2V3SA 2KQ7A 3P4RB 3DVNU 2IGHA 2REXA 3SDLC 1VZ6A 3GE8C 2JPHA 3GB1A 2VZKD 2WXKA 1E0ZA 1WMHA 4TQ1A 1FIQA 5DCNA 1MG8A 1VDVA 5E6PA 2J53A 1TY0A 1OTRB 4YWGG 2KTFA 1PGXA 4KSLC 3I9V1 2I38A 2BBCA 3DBHB 1DOXA 2FE8A 3QAQA 4NAWB 1UD7A 2INCC 2LASA 1ET9A 5G2NA 3PRPB 1KRHA 2ICIA 2LWPA 3K9PB 1WGYA 5EE3A 2RGFA 4P6VF 4JX1C 2KJHB 3DOWA 3Q8BA 2L8JA 2WLBA 2D07B 2QILA 3RULA 4HXDA 1V97A 4FADA 4JIOU 3SU8X 1E7UA 4A55A 5AZFA 2GB1A 1WX8A 3NVVA 4JLCA 3QJZA 1T6BX 2LMCA 3APFA 4MGKE 2HJ1A 3VRAB 2WXRA 1EF5A 1P98A 4ICUA 2WS3B 3P42A 1J8CA 2GI9A 3SEBA 2LXAA 3ZW3A 4GOCA 2C60A 3C19A 4E71A 1N5XA 1PYWD 1GG3A 3RPFC 3MC8A 2WXFA 4EFOA 1TS3A 1TKEA 1HEZE 2BYVE 1L6VA 1TJEA 3PZDA 2JZ3B 3FAHA 3FILA 1PQSA 3ZNGC 2WXGA 3JVZX 4M0WA 2KXJA 4LLGM 4ASWC 1YMHE 4IUMB 3ENEA 2D11A 1ROEA 1SBBB 4I6PA 2H89B 3TEYA 1LFDA 1MJDA 3KYCD 1MVKA 3DBLB 3KYDD 1RFKA 3ZTDA 1AYFA 2WXIA 4XX5A 4W9JA 1FRRA 3PV1A 3BK2A 5FR6A 2MJ3A 1HA5A 3DWGC 2KMAA 1XCTL 2JF5A 2OOBB 3H7SA 3RCZA 2WX0A 1YQ3B 4TMAB 3V6CB 5D2MB 2VRRB 1OQQA 3O13A 2KX0A 3Q14C 4G11A 4ICVA 4MM3B 1IGCA 2KVZA 2FCSA 3OJ4B 4F1SA 3ZDMC 2JRHA 2SEBD 1ZDXA 4GB9A 3BYTB 5BMIA 4II3B 1Z2MA 5TSSA 2DX5B 4DWFA 2DLBA 4GDLB 1C78A 1N61A 3HM3A 4AS1A 4MGYE 2AEHA 3CIRB 2JWUA 5CHVC 4IM0A 2BB6A 3MTNB 4KX6B 3OLMD 2BS4B 4W9KA 2WWZA 5BYSA 3AE3B 1IP9A 1V1PB 2BB5A 3RFZB 2LHEA 2ZZPB 1KH0A 3PS6A 3A4RA 3JW0X 1V2YA 3BVMA 3P2BA 2XNAC 2AL6A 1SGHA 3S2AA 3UIPB 1WGRA 3OAWA 1R4NI 1F9JA 1SSNA 5EE9A 4NY0A 4IM2A 4TSSA 3ZVVA 1EUVB 2ZCCA 4B0MA 4BOSC 4XE0A 3V05A 4X57B 4CQNA 3B9JA 2IO0B 1OFFA 3EECA 1FCLA 2XN9C 1GB1A 4HK2A 4E3CA 5E6NA 1ZW7A 1SJED 2BQQA 4M00A 2JT4B 2G3QB 2JU6X 3Q3MC 1TTNA 3H1UA 4W9CA 3R66C 3CWIA 3HVDA 2RSUA 4IW0A 2KTRA 4ZRPA 1FCCC 2KACA 4RF1A 3K9OB 3B2GA 4C80A 3APDA 2KFKB 3HVZA 1R4MI 4OZAA 4WWMA 3DVGX 3ZJVA 2EKEC 1MI0A 1HE8A 1FXIA 2K8BA 1V6EA 1UELA 2ZVNA 3EFUA 4ANXA 2K8HA 3DVNV 4RH6A 3ZRCA 1FNWA 4M8MA 5C23A 4FA6A 1SIFA 3B0AA 4ZOHC 2NTTA 3ETRA 2DZJA 2GBKA 3QWZB 3T8MA 5IA7A 3DHIC 3WAMA 3R7RA 3CF6E 3A33B 4K3BA 3ZDTA 2K3UA 2KYWA 1VZ7A 2LGSA 2L05A 3BK1A 1UH6A 4C4VB 3BWUD 2NPTA 2ZW1A
chains in the Genus database with same CATH topology
3VHTC 2V4LA 4MGIE 5KHQA 3DVGY 4FJYA 4GGQA 4IWOA 3VTUA 2K6QA 1FXTB 2PEAA 4KSKC 2C7NB 3PRMB 3ECIA 3LJ3A 4HPLB 4MH0E 4DHZB 1P9DU 1C1YB 2CHXA 2K1FA 2NR2A 3RYTA 4AUQC 2C5LC 1EF1A 3ML9A 4GSWA 1E8ZA 3RZWC 2JWZA 3VTWA 1WRDB 4II2B 2RPQA 1J19A 2MWSB 2R2QA 2WDTB 1P1AA 4XC2A 2KKCA 5JHAA 1J0GA 2MBOA 2PE6B 3KUZA 2KNBA 1Q1OA 1WM2A 2ZCBA 2CHZA 2IBIB 4W9LA 4ANUA 2N9EB 2KDBA 2M0XA 3Q3JA 1U4AA 3MHSD 1OQYA 4TKNA 5G55A 4DHZE 3U30A 1TBEA 2CS4A 2O6VB 2C7MB 1L2NA 3ZLZA 1VD2A 4FJVB 4BKGA 2AL3A 3QHTA 4BFRA 3H6NA 3N32A 1WJ6A 2HD5B 2FAZA 2EMSA 4ZRIA 1E7VA 2BKFA 4B9KA 2KLGA 4KDIC 3HIZA 4LDTD 3ALBA 4A3PA 4DHJB 4ZRKA 4KZ0A 4HDQA 2UWQA 4K81A 2K39A 2L3ZA 3DBLI 4HCNB 1BT0A 3ZIMA 2D3GA 3ZO5B 2GBRA 5LXIB 3UQAA 5DPSA 5AZHA 2IO3B 2Z0EB 2IO1B 2AYOB 4WWNA 3ML8A 2DAJA 5CTRC 3VH4B 1WXAA 2NVUI 5LLIA 2MSED 4W9EA 3X0WA 1GUAB 2MCNB 2C9WB 2FCMA 3PHXB 5TR5A 2CR5A 3EC8A 4BOZB 2LI5A 1GNUA 2ZNVC 3QQ8B 2ZNVB 4HJKA 4WQOB 2MBQA 1WXVA 4GDKB 1EO6A 2N9XA 4MELA 1OEYA 2KN5A 5DPTA 3TJPA 2DYOA 3NS8A 4DDGD 2GBNA 2WYQA 4PS3A 4I6LB 3V60A 3RUIB 4WWOA 2O2VB 1WE7A 4W9GA 1TGZB 3D32A 2KDFB 2KDEB 2YLMA 2ZEQA 3AULA 3VDZA 5AEKB 4GDKA 2I1JA 2W9NA 1Q0WB 3TIXA 5J2RA 1TZ1A 2KJRA 2GMIC 1XQQA 2BYEA 4YL8A 1V81A 4GIVA 2O2VA 1D3ZA 3L16A 3B1LX 5HKHA 2MBBB 4MSQB 2L7RA 4F8CB 1JRUA 1E8YA 1LQBA 4EZJA 4DK5A 1WH3A 2CHWA 3L17A 3LDZE 2RD0A 4FN2A 4PS7A 3T9LA 3WA0A 3AU4A 2GOWA 1UBQA 2JZZA 3KVFB 4EEWA 1IPGA 2KZRA 3DQVA 4BKSD 4B6WA 2KLCA 1M94A 3RD2A 1WI0A 3QK0A 2PE9A 3H9DA 3UF8A 4B95A 3WIMA 2MQJA 1K8RB 3TMPB 3M62B 4HWIB 3L10B 3IHPC 3BY4B 3L08A 3IG3A 3MJWA 4LDTB 2MX2A 3RT3B 1Y8RC 4HPMB 1YQBA 3VFKA 2V3SA 3U8ZA 2KQ7A 3CSTA 1A5RA 3PLUA 3DVNU 2HTHA 4CYEA 2XK5B 2FCQA 2IO2B 2NBUA 2REXA 4WJQA 3SDLC 4KDLB 3U7DA 4EZKA 2NS5A 4RM8A 1P0RA 3KUDB 2JPHA 2FNJB 3M63B 5AZGA 2BF8B 4NJ7A 4CO7A 1WMHA 4TQ1A 4WJOA 4K7WA 1MG8A 4TUUA 5DCNA 2A4ZA 2J0MA 2PJHA 2PPHA 3IVFA 4FULA 4ZDVA 1H8CA 3QCAA 5E6PA 3SD5A 2DZIA 3PGEA 3CSFA 4LJPB 4A3OA 1OTRB 2KTFA 1AARA 4IC7B 4KSLC 2MLBA 3QIJA 1I35A 4DDID 4FLHA 4ZRJA 3QAQA 4NAWB 3ZNID 1Q5WB 2LZ6A 3L54A 1UD7A 2L0TA 2LASA 3HM6X 5G2NA 4G3XB 3PRPB 1E90A 2N7EA 2Z59B 3HHMA 4P7IA 4MEMA 2LWPA 3K9PB 1WGYA 4FBJB 2BPSA 2MBHA 2RGFA 4NAWA 3W1SC 3GOEA 4OVVA 3VAWA 4PS8A 2A5UA 3RZFA 2DZMA 4MSMB 3AU5A 2KJHB 1V80A 4WWPA 3V61A 2YVCA 1CMXB 3DOWA 1UGMA 3O65B 4KV2A 2L8JA 2N1WA 1WY8A 2D07B 3RULA 4HXDA 3W1SA 5BO4B 1WE6A 3BINA 1H4RA 4JQWC 4KIKB 4FADA 2BKRB 4MDKE 1WM3A 4ANVA 2Y5BB 4JIOU 2JXXA 5DPWA 3SU8X 1E7UA 1V86A 5AZFA 2DYBA 1WGHA 1WX8A 3NY5A 3VXWA 3N30A 3QARA 4JLCA 3QJZA 3APFA 4GMVA 3VQIA 4MGKE 3A4SC 1RAXA 3WANA 5JH5C 4KIKA 2K6DB 2MA9B 4NNJB 1EF5A 1P98A 1ZGUB 2G4SA 3DBRI 2OJRA 3ZNHB 3UQBA 4ICUA 4BKSA 5EDSA 3UGBB 2M17A 2MBEA 1NI2A 4LJOB 1KM7A 2KMCA 4F7ZA 1J8CA 3TL5A 1V9JA 2LXAA 3ZW3A 3VUYA 4GOCA 2C60A 1QZEA 1YIWA 4E71A 4KVGB 3TCAA 3PT2B 1YX5B 4BBNC 1GG3A 2MW5A 4M0WB 2R2OA 2DYMA 2KD0A 4EFOA 4PYZA 3PSEB 4KZCA 4ANWA 2BYVE 3PZDA 2JZ3B 3V6EB 4W9FA 2AWTA 1PQSA 1YJ1A 3WALA 3ZNGC 3JVZX 1WJNA 2LGYA 4OVUA 2KXJA 4N9F4 4ASWC 2LGXA 1LXDA 3JYUA 4IUMB 3X23A 3DCGA 1WZ0A 2KC1A 3M95A 3ENEA 3PTFC 1GC6A 4I6NB 1Z5SB 1WXMA 1WFYA 2NBWB 2CKHB 1XT9B 2D11A 3Q3FA 2FUHB 2I1KA 5GMVA 1L7YA 2FIDA 4I6PA 1NDDA 2IYDB 2KOXA 2IY0B 3VUWA 1WZ3A 2FIFA 4FHKA 4TV3A 1LFDA 1YX6B 2DAFA 3KYCD 3C0RB 3QA8A 5D7GA 3GZNI 2KVRA 3KYDD 2JRIB 4AOFA 2UYZB 4IWPA 3H7PB 3R7QA 2N9PC 3ZTDA 4J6IA 2GBMA 2KWVB 4XX5A 2KC2A 4FHJA 3UIOB 3HK0A 2LGDA 4W9JA 4GXBA 5CHFA 3A1QB 2HJ8A 3SHQA 4EOYA 1WMHB 1V49A 2KWCA 3EHVA 3PV1A 1I42A 2EMTA 2MRPA 5FR6A 3QC8B 3IBEA 4CHKA 1GC7A 3AXCA 4JL9A 2BWFA 4W9IA 2ASQA 3H7PA 2KMAA 2JY6A 1SE9A 5KHOA 1S1QB 2LRUA 2JF5A 2OOBB 3WAOA 3A1QA 3H7SA 2BWES 4IWQA 3RCZA 2WX0A 4GU2A 3OJ3A 3V6CB 5D2MB 2VRRB 1GJZA 4ICVA 4G11A 2KX0A 5JZEB 3DPDA 1WGGA 1WR1A 2KFJA 5D94A 2ZJDA 4HVBA 2FCSA 2MP2B 2B3AA 3WAPA 5D6JB 3IFWB 4AP4C 3OJ4B 2N1VA 4F1SA 4URKA 3DDCB 5LXHA 2M4NA 3ZDMC 2JRHA 4K7SA 2DENB 2ZPNA 4MM3A 3VH3B 2KQSA 4GB9A 2FCNA 4WJNA 4II3B 1Z2MA 4EUTA 2LRWA 4K1RB 2MP2A 1NBFC 2K25A 2DX5B 4DWFA 1P3QU 1LM8B 5L95C 4M8NA 4GDLB 3KW5B 3HM3A 4HCPB 4MGYE 2AEHA 2JUOA 5CHVC 4A20A 1RFAA 3PHWB 4IM0A 3MTNB 3APCA 3OLMD 1T0YA 4W9KA 3NZSA 3TBLD 4GDLA 2WWZA 3V62A 1KLVA 1E8WA 1IP9A 4G50A 1V5TA 4AWJA 2ZZPB 3CMMB 1V5OA 3PS6A 3A4RA 1E8XA 3JW0X 4AJYB 4NJ6A 1OEYJ 1V2YA 3ZNZB 1WJUA 4EKUA 2J0JA 3NHEB 3P2BA 4IM3A 4BBNF 3L0WB 3PPAA 2AL6A 1SGHA 3S2AA 3UIPB 3VUXA 1WGRA 3OAWA 1R4NI 1F9JA 1WX7A 1WX9A 4NY0A 1RRBA 4IM2A 3ZVVA 2IY1B 3W1YA 1EUVB 2O6VA 2BYFA 2ZCCA 1XD3B 4MGZE 4FJZA 4LCDE 4DBGA 1UBIA 2BGFA 2KWUB 3DBSA 4BOSC 5IAAC 5L83A 1WF9A 2V1YA 1YD8U 2WX1A 3KUCB 3ZUNA 2KO3A 1UZXB 3R3MA 3PREA 1ISNA 4HDOA 4BKTA 3ZTCA 2N4FA 4WJPA 4X57B 3PVLA 1WIAA 5DPRA 2LVOA 4RM9A 3NZUA 2IO0B 2G45B 3EECA 3B08A 3ONSA 4E74A 4GN1A 4HK2A 4E3CA 2JVCA 5E6NA 1ZW7A 4HLEA 4W9HA 5JHBA 3PRZA 3N3KB 2N7DA 2XEWA 1VCBA 2JT4B 3KH0A 2G3QB 2KTRB 1RLFA 2KANA 4NQKE 1TTNA 1WR6E 3H1UA 3AI5A 3M3JA 4W9CA 5J18A 3R66C 1WYWB 2NCNA 3JSVB 2L76A 2RSUA 4IW0A 5CX3A 2KTRA 3UINB 4AJWA 2DHZA 1KOTA 3DBHI 3ZRFA 1WGDA 2HE7A 4RMAA 2KDIA 3ZKJC 4JGHB 3K9OB 3L13A 2C7HA 1WJ4A 1KJTA 1X1MA 2KHWB 2KJ6A 2LXCA 2KFKB 3APDA 3JSVA 5J17A 4DXAB 1R4MI 2O6VD 1C3TA 4K7UA 2KK8A 2J0KA 3DVGX 2IZVB 2EKEC 4EZLA 5CHWA 1G6JA 2K8CA 2LVPA 1HE8A 2K8BA 2KFKA 2M1MA 2Z0DB 1S3SG 1V6EA 3A9JB 1UELA 2M8SA 3A9KB 2ZVNA 2L00B 4DHJD 2ZVOA 3VTVA 2RR9A 3EFUA 4WAAA 4ANXA 1WXSA 4MJSB 2K8HA 3QX1A 3DVNV 4G0NB 3ZRCA 1OGWA 4IG7B 1IYFA 2LVQA 2ZPYA 4M8MA 2D2QA 4ZYNA 2LJ5A 3A9JA 3A9KA 3I3TB 2LUEA 3PLVA 5E6OA 5C23A 2LD9A 4PYUA 4FA6A 1E5WA 1SIFA 3B0AA 3VVWB 2XBBC 4MJSA 2KX3A 5C1ZA 2NBVB 2DZJA 4NQLB 2GBKA 3QWZB 2NPTB 4W9DA 3T8MA 4NPNA 2CU1A 5IA7A 3WAMA 3R7RA 3CF6E 2GBJA 3NOBA 3A33B 3ZDTA 2G4DB 4XZ4A 4TQ0A 2L0FA 4BVUC 2L05A 2D10A 2QHOA 1UH6A 1ZKHA 2DZKA 2NPTA 2XK5A 2J7QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VHT C;  2V4L A;  4MGI E;  5KHQ A;  3DVG Y;  4FJY A;  4GGQ A;  4IWO A;  3VTU A;  2K6Q A;  1FXT B;  2PEA A;  4KSK C;  2C7N B;  3PRM B;  3ECI A;  3LJ3 A;  4HPL B;  4MH0 E;  4DHZ B;  1P9D U;  1C1Y B;  2CHX A;  2K1F A;  2NR2 A;  3RYT A;  4AUQ C;  2C5L C;  1EF1 A;  3ML9 A;  4GSW A;  1E8Z A;  3RZW C;  2JWZ A;  3VTW A;  1WRD B;  4II2 B;  2RPQ A;  1J19 A;  2MWS B;  2R2Q A;  2WDT B;  1P1A A;  4XC2 A;  2KKC A;  5JHA A;  1J0G A;  2MBO A;  2PE6 B;  3KUZ A;  2KNB A;  1Q1O A;  1WM2 A;  2ZCB A;  2CHZ A;  2IBI B;  4W9L A;  4ANU A;  2N9E B;  2KDB A;  2M0X A;  3Q3J A;  1U4A A;  3MHS D;  1OQY A;  4TKN A;  5G55 A;  4DHZ E;  3U30 A;  1TBE A;  2CS4 A;  2O6V B;  2C7M B;  1L2N A;  3ZLZ A;  1VD2 A;  4FJV B;  4BKG A;  2AL3 A;  3QHT A;  4BFR A;  3H6N A;  3N32 A;  1WJ6 A;  2HD5 B;  2FAZ A;  2EMS A;  4ZRI A;  1E7V A;  2BKF A;  4B9K A;  2KLG A;  4KDI C;  3HIZ A;  4LDT D;  3ALB A;  4A3P A;  4DHJ B;  4ZRK A;  4KZ0 A;  4HDQ A;  2UWQ A;  4K81 A;  2K39 A;  2L3Z A;  3DBL I;  4HCN B;  1BT0 A;  3ZIM A;  2D3G A;  3ZO5 B;  2GBR A;  5LXI B;  3UQA A;  5DPS A;  5AZH A;  2IO3 B;  2Z0E B;  2IO1 B;  2AYO B;  4WWN A;  3ML8 A;  2DAJ A;  5CTR C;  3VH4 B;  1WXA A;  2NVU I;  5LLI A;  2MSE D;  4W9E A;  3X0W A;  1GUA B;  2MCN B;  2C9W B;  2FCM A;  3PHX B;  5TR5 A;  2CR5 A;  3EC8 A;  4BOZ B;  2LI5 A;  1GNU A;  2ZNV C;  3QQ8 B;  2ZNV B;  4HJK A;  4WQO B;  2MBQ A;  1WXV A;  4GDK B;  1EO6 A;  2N9X A;  4MEL A;  1OEY A;  2KN5 A;  5DPT A;  3TJP A;  2DYO A;  3NS8 A;  4DDG D;  2GBN A;  2WYQ A;  4PS3 A;  4I6L B;  3V60 A;  3RUI B;  4WWO A;  2O2V B;  1WE7 A;  4W9G A;  1TGZ B;  3D32 A;  2KDF B;  2KDE B;  2YLM A;  2ZEQ A;  3AUL A;  3VDZ A;  5AEK B;  4GDK A;  2I1J A;  2W9N A;  1Q0W B;  3TIX A;  5J2R A;  1TZ1 A;  2KJR A;  2GMI C;  1XQQ A;  2BYE A;  4YL8 A;  1V81 A;  4GIV A;  2O2V A;  1D3Z A;  3L16 A;  3B1L X;  5HKH A;  2MBB B;  4MSQ B;  2L7R A;  4F8C B;  1JRU A;  1E8Y A;  1LQB A;  4EZJ A;  4DK5 A;  1WH3 A;  2CHW A;  3L17 A;  3LDZ E;  2RD0 A;  4FN2 A;  4PS7 A;  3T9L A;  3WA0 A;  3AU4 A;  2GOW A;  1UBQ A;  2JZZ A;  3KVF B;  4EEW A;  1IPG A;  2KZR A;  3DQV A;  4BKS D;  4B6W A;  2KLC A;  1M94 A;  3RD2 A;  1WI0 A;  3QK0 A;  2PE9 A;  3H9D A;  3UF8 A;  4B95 A;  3WIM A;  2MQJ A;  1K8R B;  3TMP B;  3M62 B;  4HWI B;  3L10 B;  3IHP C;  3BY4 B;  3L08 A;  3IG3 A;  3MJW A;  4LDT B;  2MX2 A;  3RT3 B;  1Y8R C;  4HPM B;  1YQB A;  3VFK A;  2V3S A;  3U8Z A;  2KQ7 A;  3CST A;  1A5R A;  3PLU A;  3DVN U;  2HTH A;  4CYE A;  2XK5 B;  2FCQ A;  2IO2 B;  2NBU A;  2REX A;  4WJQ A;  3SDL C;  4KDL B;  3U7D A;  4EZK A;  2NS5 A;  4RM8 A;  1P0R A;  3KUD B;  2JPH A;  2FNJ B;  3M63 B;  5AZG A;  2BF8 B;  4NJ7 A;  4CO7 A;  1WMH A;  4TQ1 A;  4WJO A;  4K7W A;  1MG8 A;  4TUU A;  5DCN A;  2A4Z A;  2J0M A;  2PJH A;  2PPH A;  3IVF A;  4FUL A;  4ZDV A;  1H8C A;  3QCA A;  5E6P A;  3SD5 A;  2DZI A;  3PGE A;  3CSF A;  4LJP B;  4A3O A;  1OTR B;  2KTF A;  1AAR A;  4IC7 B;  4KSL C;  2MLB A;  3QIJ A;  1I35 A;  4DDI D;  4FLH A;  4ZRJ A;  3QAQ A;  4NAW B;  3ZNI D;  1Q5W B;  2LZ6 A;  3L54 A;  1UD7 A;  2L0T A;  2LAS A;  3HM6 X;  5G2N A;  4G3X B;  3PRP B;  1E90 A;  2N7E A;  2Z59 B;  3HHM A;  4P7I A;  4MEM A;  2LWP A;  3K9P B;  1WGY A;  4FBJ B;  2BPS A;  2MBH A;  2RGF A;  4NAW A;  3W1S C;  3GOE A;  4OVV A;  3VAW A;  4PS8 A;  2A5U A;  3RZF A;  2DZM A;  4MSM B;  3AU5 A;  2KJH B;  1V80 A;  4WWP A;  3V61 A;  2YVC A;  1CMX B;  3DOW A;  1UGM A;  3O65 B;  4KV2 A;  2L8J A;  2N1W A;  1WY8 A;  2D07 B;  3RUL A;  4HXD A;  3W1S A;  5BO4 B;  1WE6 A;  3BIN A;  1H4R A;  4JQW C;  4KIK B;  4FAD A;  2BKR B;  4MDK E;  1WM3 A;  4ANV A;  2Y5B B;  4JIO U;  2JXX A;  5DPW A;  3SU8 X;  1E7U A;  1V86 A;  5AZF A;  2DYB A;  1WGH A;  1WX8 A;  3NY5 A;  3VXW A;  3N30 A;  3QAR A;  4JLC A;  3QJZ A;  3APF A;  4GMV A;  3VQI A;  4MGK E;  3A4S C;  1RAX A;  3WAN A;  5JH5 C;  4KIK A;  2K6D B;  2MA9 B;  4NNJ B;  1EF5 A;  1P98 A;  1ZGU B;  2G4S A;  3DBR I;  2OJR A;  3ZNH B;  3UQB A;  4ICU A;  4BKS A;  5EDS A;  3UGB B;  2M17 A;  2MBE A;  1NI2 A;  4LJO B;  1KM7 A;  2KMC A;  4F7Z A;  1J8C A;  3TL5 A;  1V9J A;  2LXA A;  3ZW3 A;  3VUY A;  4GOC A;  2C60 A;  1QZE A;  1YIW A;  4E71 A;  4KVG B;  3TCA A;  3PT2 B;  1YX5 B;  4BBN C;  1GG3 A;  2MW5 A;  4M0W B;  2R2O A;  2DYM A;  2KD0 A;  4EFO A;  4PYZ A;  3PSE B;  4KZC A;  4ANW A;  2BYV E;  3PZD A;  2JZ3 B;  3V6E B;  4W9F A;  2AWT A;  1PQS A;  1YJ1 A;  3WAL A;  3ZNG C;  3JVZ X;  1WJN A;  2LGY A;  4OVU A;  2KXJ A;  4N9F 4;  4ASW C;  2LGX A;  1LXD A;  3JYU A;  4IUM B;  3X23 A;  3DCG A;  1WZ0 A;  2KC1 A;  3M95 A;  3ENE A;  3PTF C;  1GC6 A;  4I6N B;  1Z5S B;  1WXM A;  1WFY A;  2NBW B;  2CKH B;  1XT9 B;  2D11 A;  3Q3F A;  2FUH B;  2I1K A;  5GMV A;  1L7Y A;  2FID A;  4I6P A;  1NDD A;  2IYD B;  2KOX A;  2IY0 B;  3VUW A;  1WZ3 A;  2FIF A;  4FHK A;  4TV3 A;  1LFD A;  1YX6 B;  2DAF A;  3KYC D;  3C0R B;  3QA8 A;  5D7G A;  3GZN I;  2KVR A;  3KYD D;  2JRI B;  4AOF A;  2UYZ B;  4IWP A;  3H7P B;  3R7Q A;  2N9P C;  3ZTD A;  4J6I A;  2GBM A;  2KWV B;  4XX5 A;  2KC2 A;  4FHJ A;  3UIO B;  3HK0 A;  2LGD A;  4W9J A;  4GXB A;  5CHF A;  3A1Q B;  2HJ8 A;  3SHQ A;  4EOY A;  1WMH B;  1V49 A;  2KWC A;  3EHV A;  3PV1 A;  1I42 A;  2EMT A;  2MRP A;  5FR6 A;  3QC8 B;  3IBE A;  4CHK A;  1GC7 A;  3AXC A;  4JL9 A;  2BWF A;  4W9I A;  2ASQ A;  3H7P A;  2KMA A;  2JY6 A;  1SE9 A;  5KHO A;  1S1Q B;  2LRU A;  2JF5 A;  2OOB B;  3WAO A;  3A1Q A;  3H7S A;  2BWE S;  4IWQ A;  3RCZ A;  2WX0 A;  4GU2 A;  3OJ3 A;  3V6C B;  5D2M B;  2VRR B;  1GJZ A;  4ICV A;  4G11 A;  2KX0 A;  5JZE B;  3DPD A;  1WGG A;  1WR1 A;  2KFJ A;  5D94 A;  2ZJD A;  4HVB A;  2FCS A;  2MP2 B;  2B3A A;  3WAP A;  5D6J B;  3IFW B;  4AP4 C;  3OJ4 B;  2N1V A;  4F1S A;  4URK A;  3DDC B;  5LXH A;  2M4N A;  3ZDM C;  2JRH A;  4K7S A;  2DEN B;  2ZPN A;  4MM3 A;  3VH3 B;  2KQS A;  4GB9 A;  2FCN A;  4WJN A;  4II3 B;  1Z2M A;  4EUT A;  2LRW A;  4K1R B;  2MP2 A;  1NBF C;  2K25 A;  2DX5 B;  4DWF A;  1P3Q U;  1LM8 B;  5L95 C;  4M8N A;  4GDL B;  3KW5 B;  3HM3 A;  4HCP B;  4MGY E;  2AEH A;  2JUO A;  5CHV C;  4A20 A;  1RFA A;  3PHW B;  4IM0 A;  3MTN B;  3APC A;  3OLM D;  1T0Y A;  4W9K A;  3NZS A;  3TBL D;  4GDL A;  2WWZ A;  3V62 A;  1KLV A;  1E8W A;  1IP9 A;  4G50 A;  1V5T A;  4AWJ A;  2ZZP B;  3CMM B;  1V5O A;  3PS6 A;  3A4R A;  1E8X A;  3JW0 X;  4AJY B;  4NJ6 A;  1OEY J;  1V2Y A;  3ZNZ B;  1WJU A;  4EKU A;  2J0J A;  3NHE B;  3P2B A;  4IM3 A;  4BBN F;  3L0W B;  3PPA A;  2AL6 A;  1SGH A;  3S2A A;  3UIP B;  3VUX A;  1WGR A;  3OAW A;  1R4N I;  1F9J A;  1WX7 A;  1WX9 A;  4NY0 A;  1RRB A;  4IM2 A;  3ZVV A;  2IY1 B;  3W1Y A;  1EUV B;  2O6V A;  2BYF A;  2ZCC A;  1XD3 B;  4MGZ E;  4FJZ A;  4LCD E;  4DBG A;  1UBI A;  2BGF A;  2KWU B;  3DBS A;  4BOS C;  5IAA C;  5L83 A;  1WF9 A;  2V1Y A;  1YD8 U;  2WX1 A;  3KUC B;  3ZUN A;  2KO3 A;  1UZX B;  3R3M A;  3PRE A;  1ISN A;  4HDO A;  4BKT A;  3ZTC A;  2N4F A;  4WJP A;  4X57 B;  3PVL A;  1WIA A;  5DPR A;  2LVO A;  4RM9 A;  3NZU A;  2IO0 B;  2G45 B;  3EEC A;  3B08 A;  3ONS A;  4E74 A;  4GN1 A;  4HK2 A;  4E3C A;  2JVC A;  5E6N A;  1ZW7 A;  4HLE A;  4W9H A;  5JHB A;  3PRZ A;  3N3K B;  2N7D A;  2XEW A;  1VCB A;  2JT4 B;  3KH0 A;  2G3Q B;  2KTR B;  1RLF A;  2KAN A;  4NQK E;  1TTN A;  1WR6 E;  3H1U A;  3AI5 A;  3M3J A;  4W9C A;  5J18 A;  3R66 C;  1WYW B;  2NCN A;  3JSV B;  2L76 A;  2RSU A;  4IW0 A;  5CX3 A;  2KTR A;  3UIN B;  4AJW A;  2DHZ A;  1KOT A;  3DBH I;  3ZRF A;  1WGD A;  2HE7 A;  4RMA A;  2KDI A;  3ZKJ C;  4JGH B;  3K9O B;  3L13 A;  2C7H A;  1WJ4 A;  1KJT A;  1X1M A;  2KHW B;  2KJ6 A;  2LXC A;  2KFK B;  3APD A;  3JSV A;  5J17 A;  4DXA B;  1R4M I;  2O6V D;  1C3T A;  4K7U A;  2KK8 A;  2J0K A;  3DVG X;  2IZV B;  2EKE C;  4EZL A;  5CHW A;  1G6J A;  2K8C A;  2LVP A;  1HE8 A;  2K8B A;  2KFK A;  2M1M A;  2Z0D B;  1S3S G;  1V6E A;  3A9J B;  1UEL A;  2M8S A;  3A9K B;  2ZVN A;  2L00 B;  4DHJ D;  2ZVO A;  3VTV A;  2RR9 A;  3EFU A;  4WAA A;  4ANX A;  1WXS A;  4MJS B;  2K8H A;  3QX1 A;  3DVN V;  4G0N B;  3ZRC A;  1OGW A;  4IG7 B;  1IYF A;  2LVQ A;  2ZPY A;  4M8M A;  2D2Q A;  4ZYN A;  2LJ5 A;  3A9J A;  3A9K A;  3I3T B;  2LUE A;  3PLV A;  5E6O A;  5C23 A;  2LD9 A;  4PYU A;  4FA6 A;  1E5W A;  1SIF A;  3B0A A;  3VVW B;  2XBB C;  4MJS A;  2KX3 A;  5C1Z A;  2NBV B;  2DZJ A;  4NQL B;  2GBK A;  3QWZ B;  2NPT B;  4W9D A;  3T8M A;  4NPN A;  2CU1 A;  5IA7 A;  3WAM A;  3R7R A;  3CF6 E;  2GBJ A;  3NOB A;  3A33 B;  3ZDT A;  2G4D B;  4XZ4 A;  4TQ0 A;  2L0F A;  4BVU C;  2L05 A;  2D10 A;  2QHO A;  1UH6 A;  1ZKH A;  2DZK A;  2NPT A;  2XK5 A;  2J7Q B; 
#chains in the Genus database with same CATH topology
 3VHT C;  4MGI E;  5KHQ A;  3DVG Y;  4FJY A;  4GGQ A;  1ACC A;  2K6Q A;  4KSK C;  1J7C A;  4HPL B;  4MH0 E;  3ZGZ A;  4WH4 A;  4C7Z A;  2CHX A;  2FUG 1;  3RYT A;  4AUQ C;  2C5L C;  2V3P A;  4GSW A;  2V3N A;  5IO9 A;  4LNI A;  2Y5C A;  2WDT B;  4XC2 A;  1I4G A;  1L4D B;  2MBO A;  2KNB A;  4KGT A;  4NZL B;  2M0X A;  1PFD A;  4L1B A;  5G55 A;  1TBE A;  2O6V B;  4BKG A;  2AL3 A;  1JW9 D;  3H6N A;  3HRD D;  1ZXH A;  4UDU C;  5H92 C;  3MC9 A;  2EMS A;  1C4P A;  1E7V A;  4LDT D;  4DHJ B;  4HDQ A;  4K81 A;  2OHF A;  2JXT A;  2UWQ A;  3MP9 A;  5G5H A;  5IOI A;  2E6X A;  5IP4 D;  5AZH A;  2AYO B;  4WWN A;  3ML8 A;  2DAJ A;  2V4I B;  3X0W A;  3P4P B;  2AQ1 B;  4WQO B;  2MBQ A;  4HPP A;  4GDK B;  3P4Q B;  1EO6 A;  1OEY A;  5FKA C;  3NS8 A;  2BYT A;  2WYQ A;  4I6L B;  2O2V B;  3D32 A;  2KDF B;  5D3I B;  1VLB A;  2W9N A;  3PO0 A;  5J2R A;  4HKQ A;  1XQQ A;  2J42 A;  3L16 A;  2QIE B;  3C8Y A;  2MBB B;  4MSQ B;  1D6E C;  2L7R A;  3LB8 C;  4O1N A;  1E8Y A;  1LQB A;  1WH3 A;  2CHW A;  3GS2 A;  3WA0 A;  4EEW A;  3KVF B;  1E10 A;  1FRD A;  3AE7 B;  4BKS D;  2KLC A;  1M94 A;  3QK0 A;  2PE9 A;  2QMT A;  3AE5 B;  3M62 B;  2WXO A;  3AEA B;  3L10 B;  3L08 A;  1E6E B;  4HPM B;  4YTM B;  3W2D A;  2Q5W D;  4KGR A;  3CST A;  3PLU A;  2HTH A;  4CYE A;  2FCQ A;  1TS5 A;  4HJG E;  2MJE A;  4KDL B;  4RM8 A;  3KUD B;  1TKY A;  2BF8 B;  4CO7 A;  4WJO A;  3BYY B;  4TUU A;  2A4Z A;  2J0M A;  3IVF A;  1H8C A;  3SD5 A;  4LJP B;  4REZ A;  1RWS A;  2AQ2 B;  4IC7 B;  2MLB A;  3QIJ A;  2L32 A;  2KAJ A;  2W55 A;  2WXL A;  2L0T A;  3HM6 X;  4RNA A;  1E90 A;  2EKI A;  2Z59 B;  2CJN A;  3HHM A;  4P7I A;  2BPS A;  3GOE A;  1T0R C;  4PS8 A;  2A5U A;  1V8C A;  2RDG A;  3RZF A;  2DZM A;  4WWP A;  1C9F A;  2YVC A;  1CMX B;  1WY8 A;  3I63 C;  3IAM 1;  1FM0 D;  3BIN A;  3N1Y C;  1XEE A;  5C3J B;  4MDK E;  2Y5B B;  2JXX A;  4C7Y A;  1SB3 C;  3VXW A;  3VR9 B;  3QAR A;  2WU5 B;  1Q10 A;  4IDI A;  4A9A A;  3BVG A;  2K6D B;  1VJK A;  1ZGU B;  3AEC B;  2OJR A;  3VR8 B;  2M17 A;  4P16 A;  1KM7 A;  4US8 A;  1YOV B;  1N62 A;  2JX5 A;  1V9J A;  3VUY A;  1YIW A;  3FIL B;  4M0W B;  2R2O A;  3AMZ A;  1N63 A;  4LNN A;  4PYZ A;  4KZC A;  1TY2 A;  3R2T A;  2DWQ A;  3WAL A;  2WXJ A;  5BMH A;  1WJN A;  4OVU A;  4HRO A;  2LGX A;  2PMV A;  1NEN B;  3X23 A;  3MHZ A;  1WXM A;  5BMG A;  2CKH B;  1WGK A;  4AQ7 A;  4C56 C;  2WDQ B;  1IUE A;  3VUW A;  1WZ3 A;  1FFV A;  4BZA A;  1YX6 B;  2DAF A;  5D7G A;  3GZN I;  4S0R A;  2PLP A;  2CJO A;  1NEK B;  1CJE A;  2N9P C;  4J6I A;  4RGO S;  2W3S A;  1KFY B;  3HK0 A;  2LGD A;  5CHF A;  1D5M C;  4EOY A;  2KWC A;  2EMT A;  1UGJ A;  4CHK A;  3IBE A;  3TEZ A;  1BML C;  2JYT A;  5KHO A;  1TYG B;  3A1Q A;  2BWE S;  4FXC A;  4IWQ A;  1HZ5 A;  3I57 A;  1E7P B;  3OJ3 A;  1GJZ A;  5JZE B;  1WGG A;  3AEE B;  1ZXI A;  4HVB A;  2B3A A;  5LXH A;  2M4N A;  4K7S A;  2DEN B;  2JZP A;  1BXT A;  4WJN A;  1J7A A;  1QT9 A;  2LRW A;  4K1R B;  2MP2 A;  1N6Z A;  1TS2 A;  3ZYY X;  4M8N A;  4JWS C;  4HCP B;  1RFA A;  3PHW B;  3APC A;  4DQO C;  1T0Y A;  3V62 A;  1IGD A;  3MFG A;  4AWJ A;  3CMM B;  5EE0 A;  3E56 A;  1E8X A;  4GLS C;  3NHE B;  2JQR B;  1SE2 A;  3L0W B;  3PPA A;  2WXH A;  1JWM D;  1WX9 A;  4A90 A;  4LNK A;  3P4S B;  2GRI A;  1N60 A;  4LCD E;  1UBI A;  4N59 A;  5IAA C;  5L83 A;  2WDR B;  1WF9 A;  2V1Y A;  3KUC B;  2KO3 A;  4RM9 A;  2JSV X;  2KN4 A;  3ONS A;  1UWX A;  4HLE A;  3EFC A;  2KTR B;  2NTS A;  1TIF A;  4IKG A;  2NCN A;  5CX3 A;  4XWW A;  2DHZ A;  3DBH I;  2MH7 A;  3ZRF A;  1SXT A;  2HE7 A;  2D3C A;  3ZKJ C;  4JGH B;  3L13 A;  1T5X D;  1X1M A;  3JSV A;  2KHW B;  2WNM A;  2JYE A;  2D3B A;  4DXA B;  4K7U A;  2KK8 A;  5AUI A;  1FFU A;  2IZV B;  2VH1 A;  1DOY A;  4ZRQ A;  3DBR B;  5CHW A;  4C00 A;  1G6J A;  2E3T A;  3ZJT A;  2OJW A;  2M1M A;  2M8S A;  5C2T B;  2L00 B;  2ZVO A;  4R3D A;  2QJL A;  2LUM A;  1WXS A;  4ITK A;  4G0N B;  4KKJ A;  2LVQ A;  2ZPY A;  2D2Q A;  2LJ5 A;  4BAX A;  3A9K A;  3PLV A;  2LD9 A;  3DHH C;  4PYU A;  2W3R A;  3NS1 A;  5C1Z A;  4MJS A;  2KX3 A;  2NBV B;  4NQL B;  4W9D A;  2NPT B;  1EM7 A;  3NOB A;  4TQ0 A;  4BVU C;  2D10 A;  2QHO A;  1K52 A;  1ZKH A;  1ENF A;  5H8Y E;  3VTU A;  2FBW B;  2ZW0 A;  3ECI A;  2WU2 B;  3LJ3 A;  2M0A A;  4N58 A;  4DHZ B;  5HHD G;  4MH8 A;  2K1F A;  2NR2 A;  1EF1 A;  1E8Z A;  3RZW C;  1WRD B;  4II2 B;  2LGI A;  2PE6 B;  3ABV B;  5AUK A;  2ZCB A;  4W9L A;  1TS4 A;  2N9E B;  1U4A A;  3MHS D;  1OQY A;  4OZB A;  4OW0 A;  1SE4 A;  3ZLZ A;  1VD2 A;  1C77 A;  3FKY A;  4FJV B;  5HFY A;  4P1C C;  2V9H A;  4BFR A;  1QLB B;  4NAM A;  1WJ6 A;  2FAZ A;  4ZRI A;  2BKF A;  2KLG A;  4KDI C;  3HIZ A;  3RMK C;  1XXG A;  3ALB A;  3ZXV A;  1L5P A;  4KZ0 A;  1K53 A;  2IGD A;  3DBL I;  1QOB A;  2D5G A;  3ZO5 B;  4OZC A;  1P7F A;  2Z0E B;  1WXA A;  1XLN A;  1GUA B;  2L52 A;  4BOZ B;  1GNU A;  3AE6 B;  1JRO A;  1MG4 A;  3SFE B;  2ZNV C;  3QQ8 B;  4LK0 M;  4HJK A;  4KKI A;  5BYQ A;  1JRP A;  3TJP A;  4PS3 A;  2Y3A A;  3V60 A;  4WWO A;  1WE7 A;  2ZEQ A;  3AUL A;  1Q0W B;  2GMI C;  3RNF C;  3AV8 A;  3AE4 B;  4YL8 A;  1T0S C;  1IBX A;  4GIV A;  1OQR A;  1KLG D;  2KQ4 X;  3B1L X;  4F8C B;  2W54 A;  3URY A;  1C4A A;  2GOW A;  2JZZ A;  1IPG A;  2KZR A;  2WXQ A;  3DQV A;  4B6W A;  3R8B A;  1WI0 A;  3H9D A;  3UF8 A;  3WIM A;  3TMP B;  1B9R A;  2WP9 B;  3VFK A;  1PUT A;  2XK5 B;  2NBU A;  1WXQ A;  4EZK A;  5AZG A;  3M63 B;  1I4R A;  4K7W A;  1E9M A;  2PJH A;  4ZDV A;  2DZI A;  3PGE A;  1MPE A;  3CSF A;  2RDH A;  4RCO A;  1AAR A;  1D5X C;  3MC0 B;  4HEA 1;  2WXN A;  2D3A A;  3RNG C;  3ZNI D;  1HQR D;  4YSY B;  2N7E A;  2MBH A;  3W1S C;  3NVW A;  4OVV A;  3VAW A;  1QIL A;  3KLS X;  1XF5 L;  3AU5 A;  1YNT E;  3B2F A;  1UGM A;  3BVZ A;  3O65 B;  4KV2 A;  3KQ4 A;  1I4P A;  1NVI D;  3W1S A;  3H8H A;  5BO4 B;  1WE6 A;  4JQW C;  3KWV A;  2BKR B;  1JWB D;  1JWU D;  1V86 A;  3Q8E A;  2DYB A;  3N30 A;  1LO5 D;  3VQI A;  3A4S C;  1PGA A;  5BYR A;  3WAN A;  1L4Z B;  4KIK A;  2MA9 B;  2G4S A;  2H88 B;  3ZNH B;  4K3C A;  4BKS A;  1FEH A;  1MHX A;  2MBE A;  1NI2 A;  3J9C A;  4LJO B;  3P1M A;  1QZE A;  4XDC A;  3TCA A;  4BBN C;  3WCQ A;  2MW5 A;  2KD0 A;  2N7J A;  2VZK B;  3Q8C A;  4ANW A;  2QDF A;  5T8I A;  4W9F A;  4XDD A;  2AWT A;  1YJ1 A;  3U4E G;  2LHD A;  4OVZ A;  4US9 A;  2LGY A;  3N1X C;  1LXD A;  4RGT A;  3M95 A;  1GC6 A;  4Q2J A;  1M4V A;  1Z5S B;  3E9S A;  1SJH D;  1WFY A;  1WRI A;  1UUP A;  1XT9 B;  3TEW A;  3Q3F A;  4L2Y A;  1UNS A;  3DWM A;  2I1K A;  5GMV A;  2HDE A;  1L7Y A;  2FID A;  2DNF A;  2HTM E;  3I5J C;  1D5Z C;  4FHK A;  2FIF A;  2KMM A;  4TV3 A;  3C0R B;  4HRS A;  3QA8 A;  2BS3 B;  4AOF A;  2TSS A;  2UYZ B;  4WUR A;  2KWV B;  4QAY A;  4DXF A;  4FHJ A;  3UIO B;  4GXB A;  3A1Q B;  1WMH B;  2N9L A;  1I42 A;  2MRP A;  1GC7 A;  2AX5 A;  3AXC A;  4JL9 A;  3H7P A;  3P63 A;  2IGG A;  2JY6 A;  3NVY A;  1SE9 A;  1S1Q B;  2LRU A;  3WAO A;  4GU2 A;  1R7S A;  1WR1 A;  5IN7 A;  5D94 A;  2ZJD A;  1TT5 B;  2MP2 B;  3WAP A;  3VRB B;  1ZE3 D;  3SFD B;  2N1V A;  1Y56 A;  4S17 A;  2ZPN A;  3VH3 B;  2KDM A;  4EUT A;  2K25 A;  1ZOY B;  1I7H A;  3GP7 A;  1GB4 A;  2JUO A;  4A20 A;  3ZJU A;  2BT6 A;  3NZS A;  3L4P A;  2YEP F;  2MJD A;  1E8W A;  4JPS A;  3V3X A;  4KGS A;  1V5T A;  1F2R C;  1XLO A;  1V5O A;  4AJY B;  3ZNZ B;  3RNA C;  2J0J A;  2L1A A;  4IM3 A;  4BBN F;  1ET6 A;  2K22 A;  4N6E B;  1CZP A;  1FNV A;  1EU4 A;  1QKZ A;  1RRB A;  1KF6 B;  3AB5 A;  2IY1 B;  4YT0 B;  3W1Y A;  2O6V A;  2BYF A;  1XD3 B;  3W5V B;  4MGZ E;  4WAF A;  3IT6 B;  4DBG A;  1UWM A;  1YD8 U;  2WX1 A;  2QEJ C;  3PRE A;  4HDO A;  4BKT A;  3ZTC A;  3NUH B;  3PVL A;  2V0G A;  2LVO A;  1QQR A;  2LJI A;  3B08 A;  4E74 A;  4RFB A;  2JVC A;  4W9H A;  2NMQ A;  3PRZ A;  3TEX A;  2N7D A;  3KH0 A;  4NQK E;  1WR6 E;  1FO4 A;  1JCK B;  3AI5 A;  4MAC A;  1WYW B;  3JSV B;  2ACZ B;  2MHJ A;  1AN8 A;  4RMA A;  2K0P A;  2LXC A;  1KJT A;  1P7E A;  5J17 A;  1YN5 A;  2O6V D;  1C3T A;  2LEK A;  2J0K A;  2WGS A;  1T3Q A;  3BII D;  4EZL A;  2K8C A;  2LVP A;  1FD6 A;  3Q69 A;  2Z0D B;  1JWA D;  1S3S G;  1A70 A;  1NYR A;  3A9K B;  1YJJ A;  2B76 B;  4DHJ D;  3VTV A;  1SIJ A;  3AE9 B;  4MJS B;  1KTK A;  5IKC M;  1OGW A;  4IG7 B;  1IYF A;  4OHJ A;  2KT7 A;  3A9J A;  3GE3 C;  2LUE A;  3AE1 B;  1I4X A;  3VVW B;  3EUB 2;  1PDX A;  4NPN A;  1FPY A;  2CU1 A;  2G4D B;  4XZ4 A;  2X8X X;  2DZK A;  2V4L A;  1FXT B;  1T0Q C;  1N5W A;  1P9D U;  3RNB C;  1C1Y B;  2JWZ A;  3VTW A;  2MWS B;  5JHA A;  2KKC A;  1ZUD 2;  1HZ6 A;  3AN1 A;  3KUZ A;  3LYY A;  2CHZ A;  2IJ0 A;  1UF0 A;  4TKN A;  4DHZ E;  3U30 A;  2C7M B;  1L2N A;  1WYG A;  4A6Q A;  1GOZ A;  1SF0 A;  3RN9 C;  1HTQ A;  3N32 A;  1L0V B;  2HD5 B;  4WIP A;  4B9K A;  2K9X A;  4A3P A;  2K39 A;  3ZXR A;  3AEG B;  4HCN B;  1FMA D;  2GBR A;  5LXI B;  2RDB C;  1EU3 A;  2IO1 B;  4A8X C;  1LGR A;  3VH4 B;  2NVU I;  5LLI A;  2MSE D;  1YN3 A;  3Q8A A;  2C9W B;  2FCM A;  3PHX B;  3EC8 A;  2LI5 A;  4WQM A;  4XWT A;  4USA A;  1EWY C;  4P1B C;  3W9C B;  2ZNV B;  1WXV A;  3DHG C;  2N9X A;  1QF6 A;  2KN5 A;  4DDG D;  1IBX B;  1BUI C;  5FR3 A;  3RI7 C;  2YLM A;  3VDZ A;  5AEK B;  2KJR A;  1B1Z A;  1V81 A;  1D3Z A;  4LNF A;  4DXG A;  1SEB D;  1F0Z A;  5HKH A;  3AE8 B;  1JRU A;  4DK5 A;  1R4N B;  3L17 A;  3LDZ E;  2RD0 A;  4PS7 A;  2X38 A;  3AU4 A;  4YSZ B;  2WQY B;  2PTL A;  2W82 A;  3RD2 A;  1L6U A;  2MEK A;  1WWT A;  2PIA A;  1XO3 A;  2M19 A;  1QOA A;  3MJW A;  4LDT B;  3IG3 A;  2MX2 A;  3RT3 B;  1YN4 A;  2CU3 A;  3U8Z A;  1RM6 C;  1A5R A;  2L83 A;  2GLS A;  2IO2 B;  1L0X B;  4WJQ A;  3U7D A;  1ESF A;  2NS5 A;  1P0R A;  2FNJ B;  1YJI A;  1SE3 A;  1EWC A;  4NJ7 A;  3AEF B;  1FXA A;  2PPH A;  4FUL A;  3QCA A;  1K51 A;  4A3O A;  2WXM A;  3NJT A;  1CQV A;  1I35 A;  4DDI D;  4FLH A;  4ZRJ A;  3W5U B;  1Q5W B;  2LZ6 A;  3L54 A;  4RGM A;  1ZP0 B;  2BS2 B;  2IND C;  2PVO D;  4G3X B;  1HTO A;  5MPO A;  1MFW A;  1R4M B;  2Z8L A;  4MEM A;  4FBJ B;  1TKG A;  4NAW A;  2KWD A;  2I2Y A;  4MSM B;  1V80 A;  3V61 A;  4B0E A;  2N1W A;  2N0S B;  2RMM A;  3N9Y C;  3AM9 A;  1H4R A;  4KIK B;  1WM3 A;  4ANV A;  5DPW A;  5G5G A;  1WGH A;  3NY5 A;  3PZ8 A;  4ZHO A;  4GMV A;  1RAX A;  4L23 A;  5JH5 C;  1XCQ L;  4NNJ B;  2YEP B;  5JXV A;  3DBR I;  3UQB A;  1F52 A;  2UU7 A;  5EDS A;  3UGB B;  1I4H A;  2N9K A;  2KMC A;  4F7Z A;  3TL5 A;  3T3N A;  1D4B A;  3OG5 A;  4KVG B;  3PT2 B;  1YX5 B;  2SAK A;  2DYM A;  3PSE B;  3V6E B;  2G9H D;  3HUI A;  5LNK 1;  4YXD B;  1YQ4 B;  4N9F 4;  4RF0 A;  3JYU A;  3DCG A;  1WZ0 A;  2KC1 A;  2PW9 A;  3PTF C;  4I6N B;  2DBY A;  3NG0 A;  2BVC A;  2NBW B;  2FUH B;  2R61 A;  4JE3 B;  3EA6 A;  1RYJ A;  4M02 A;  1NDD A;  1VR9 A;  2IYD B;  2KOX A;  2IY0 B;  1QOF A;  3BZD B;  2KVR A;  3RNC C;  4D2K A;  2JRI B;  4IWP A;  3H7P B;  3R7Q A;  2BW2 A;  2GBM A;  2INP E;  2KC2 A;  3N20 C;  4YTP B;  3AEB B;  2HJ8 A;  3SHQ A;  1V49 A;  3EHV A;  3Q6B A;  3QC8 B;  2BWF A;  4W9I A;  2ASQ A;  2OED A;  2J4X A;  2IDY A;  3IT4 B;  4IOI E;  2WHI A;  4RGN A;  4PT5 A;  3DPD A;  5D3D A;  2KFJ A;  1K50 A;  5D6J B;  3IFW B;  4AP4 C;  4ZHP A;  4URK A;  3DDC B;  4ARC A;  4MM3 A;  4HKZ E;  2KQS A;  2FCN A;  3EGR A;  3Q2A C;  1NBF C;  1P3Q U;  1LM8 B;  5L95 C;  3KW5 B;  2J52 A;  3U52 E;  3TSS A;  3OWE B;  1KLV A;  3TBL D;  4GDL A;  3ZQ4 A;  4J3O D;  3U2S C;  4G50 A;  4NJ6 A;  1OEY J;  1WJU A;  4EKU A;  1ZDV A;  1V1P A;  2VH2 A;  2BTE A;  3VUX A;  1L0Y B;  1WX7 A;  1HXY D;  4XGA B;  4FJZ A;  2BGF A;  2KWU B;  2ON8 A;  3DBS A;  1C79 A;  4YTN B;  1NYQ A;  3ZUN A;  4JWU C;  1UZX B;  3R3M A;  1JQ4 A;  1ISN A;  1V1O A;  2N4F A;  4WJP A;  5DPR A;  1WIA A;  3NZU A;  1TZO A;  2G45 B;  4GN1 A;  3T3O A;  5E6J A;  5JHB A;  3N3K B;  3AH7 A;  2XEW A;  4NJC A;  1VCB A;  1RLF A;  4MT5 A;  3AED B;  1NI3 A;  2KAN A;  1STE A;  3M3J A;  5J18 A;  2L76 A;  3UIN B;  1DYQ A;  4AJW A;  1KOT A;  1AWD A;  1WGD A;  2KDI A;  1KLU D;  3LXF A;  1AW7 A;  1JAL A;  1C4C A;  2C7H A;  1WJ4 A;  2KJ6 A;  1XLP A;  5FK9 C;  4H2A A;  4ACF A;  1C76 A;  3MJ5 A;  2KFK A;  4LNO A;  3A9J B;  2INN E;  1I4Q A;  3UI3 A;  2RR9 A;  2ONQ A;  4WAA A;  3QX1 A;  2WXP A;  4ZYN A;  3FC4 A;  1F2R I;  3I3T B;  5E6O A;  1E5W A;  2QSD A;  2XBB C;  3RNE C;  1JWS D;  2GBJ A;  4ARI A;  2M56 B;  2L0F A;  1XLQ A;  4ZYS A;  3Q3O C;  2QCZ A;  1JML A;  1CK1 A;  3AE2 B;  2PVG C;  2XK5 A;  2J7Q B;  3IXS A;  4IWO A;  2AQ3 B;  2PEA A;  2C7N B;  3PRM B;  4C4V A;  3ML9 A;  3IAS 1;  2RPQ A;  1J19 A;  2R2Q A;  1P1A A;  3GZN B;  1J0G A;  2G1E A;  5HG2 A;  1Q1O A;  1WM2 A;  1FNU A;  3KWL A;  2IBI B;  5GXG B;  4ANU A;  2KDB A;  3Q3J A;  2CS4 A;  2RPV A;  3U7Z A;  3QHT A;  5I4D A;  1F1H A;  4M01 A;  3Q3N C;  4ZRK A;  2L3Z A;  3ZIM A;  1BT0 A;  5EE1 A;  2D3G A;  3UQA A;  3PZ7 A;  5DPS A;  2IO3 B;  1MHH E;  5CTR C;  4W9E A;  2IPK D;  2PKO A;  1GPX A;  2Y5P A;  1GAQ B;  2LFI A;  2WDV B;  2MCN B;  5TR5 A;  2CR5 A;  2QC8 A;  3NRZ A;  3R2I A;  4MEL A;  5DPT A;  4LTU A;  2DYO A;  3NVZ A;  3SR6 A;  2GBN A;  3RUI B;  1DOI A;  4W9G A;  1TGZ B;  1WSP A;  2KDE B;  1VRA B;  4GDK A;  2EEL A;  2I1J A;  3TIX A;  1TZ1 A;  2BYE A;  2O2V A;  1DGJ A;  4PK1 A;  3N1Z C;  1J7B A;  3NZ3 A;  2K5P A;  4XYC A;  1PGB A;  1ZPS A;  4EZJ A;  3Q8F A;  4YSX B;  3TUO A;  1F77 A;  1VZ8 A;  4FN2 A;  3T9L A;  1UBQ A;  5HI1 A;  4B95 A;  2MQJ A;  1K8R B;  1QOG A;  4EE2 A;  4HWI B;  3IHP C;  3BY4 B;  1Y8R C;  1YQB A;  2V3S A;  2KQ7 A;  3P4R B;  3DVN U;  2IGH A;  2REX A;  3SDL C;  1VZ6 A;  3GE8 C;  2JPH A;  3GB1 A;  2VZK D;  2WXK A;  1E0Z A;  1WMH A;  4TQ1 A;  1FIQ A;  5DCN A;  1MG8 A;  1VDV A;  5E6P A;  2J53 A;  1TY0 A;  1OTR B;  4YWG G;  2KTF A;  1PGX A;  4KSL C;  3I9V 1;  2I38 A;  2BBC A;  3DBH B;  1DOX A;  2FE8 A;  3QAQ A;  4NAW B;  1UD7 A;  2INC C;  2LAS A;  1ET9 A;  5G2N A;  3PRP B;  1KRH A;  2ICI A;  2LWP A;  3K9P B;  1WGY A;  5EE3 A;  2RGF A;  4P6V F;  4JX1 C;  2KJH B;  3DOW A;  3Q8B A;  2L8J A;  2WLB A;  2D07 B;  2QIL A;  3RUL A;  4HXD A;  1V97 A;  4FAD A;  4JIO U;  3SU8 X;  1E7U A;  4A55 A;  5AZF A;  2GB1 A;  1WX8 A;  3NVV A;  4JLC A;  3QJZ A;  1T6B X;  2LMC A;  3APF A;  4MGK E;  2HJ1 A;  3VRA B;  2WXR A;  1EF5 A;  1P98 A;  4ICU A;  2WS3 B;  3P42 A;  1J8C A;  2GI9 A;  3SEB A;  2LXA A;  3ZW3 A;  4GOC A;  2C60 A;  3C19 A;  4E71 A;  1N5X A;  1PYW D;  1GG3 A;  3RPF C;  3MC8 A;  2WXF A;  4EFO A;  1TS3 A;  1TKE A;  1HEZ E;  2BYV E;  1L6V A;  1TJE A;  3PZD A;  2JZ3 B;  3FAH A;  3FIL A;  1PQS A;  3ZNG C;  2WXG A;  3JVZ X;  4M0W A;  2KXJ A;  4LLG M;  4ASW C;  1YMH E;  4IUM B;  3ENE A;  2D11 A;  1ROE A;  1SBB B;  4I6P A;  2H89 B;  3TEY A;  1LFD A;  1MJD A;  3KYC D;  1MVK A;  3DBL B;  3KYD D;  1RFK A;  3ZTD A;  1AYF A;  2WXI A;  4XX5 A;  4W9J A;  1FRR A;  3PV1 A;  3BK2 A;  5FR6 A;  2MJ3 A;  1HA5 A;  3DWG C;  2KMA A;  1XCT L;  2JF5 A;  2OOB B;  3H7S A;  3RCZ A;  2WX0 A;  1YQ3 B;  4TMA B;  3V6C B;  5D2M B;  2VRR B;  1OQQ A;  3O13 A;  2KX0 A;  3Q14 C;  4G11 A;  4ICV A;  4MM3 B;  1IGC A;  2KVZ A;  2FCS A;  3OJ4 B;  4F1S A;  3ZDM C;  2JRH A;  2SEB D;  1ZDX A;  4GB9 A;  3BYT B;  5BMI A;  4II3 B;  1Z2M A;  5TSS A;  2DX5 B;  4DWF A;  2DLB A;  4GDL B;  1C78 A;  1N61 A;  3HM3 A;  4AS1 A;  4MGY E;  2AEH A;  3CIR B;  2JWU A;  5CHV C;  4IM0 A;  2BB6 A;  3MTN B;  4KX6 B;  3OLM D;  2BS4 B;  4W9K A;  2WWZ A;  5BYS A;  3AE3 B;  1IP9 A;  1V1P B;  2BB5 A;  3RFZ B;  2LHE A;  2ZZP B;  1KH0 A;  3PS6 A;  3A4R A;  3JW0 X;  1V2Y A;  3BVM A;  3P2B A;  2XNA C;  2AL6 A;  1SGH A;  3S2A A;  3UIP B;  1WGR A;  3OAW A;  1R4N I;  1F9J A;  1SSN A;  5EE9 A;  4NY0 A;  4IM2 A;  4TSS A;  3ZVV A;  1EUV B;  2ZCC A;  4B0M A;  4BOS C;  4XE0 A;  3V05 A;  4X57 B;  4CQN A;  3B9J A;  2IO0 B;  1OFF A;  3EEC A;  1FCL A;  2XN9 C;  1GB1 A;  4HK2 A;  4E3C A;  5E6N A;  1ZW7 A;  1SJE D;  2BQQ A;  4M00 A;  2JT4 B;  2G3Q B;  2JU6 X;  3Q3M C;  1TTN A;  3H1U A;  4W9C A;  3R66 C;  3CWI A;  3HVD A;  2RSU A;  4IW0 A;  2KTR A;  4ZRP A;  1FCC C;  2KAC A;  4RF1 A;  3K9O B;  3B2G A;  4C80 A;  3APD A;  2KFK B;  3HVZ A;  1R4M I;  4OZA A;  4WWM A;  3DVG X;  3ZJV A;  2EKE C;  1MI0 A;  1HE8 A;  1FXI A;  2K8B A;  1V6E A;  1UEL A;  2ZVN A;  3EFU A;  4ANX A;  2K8H A;  3DVN V;  4RH6 A;  3ZRC A;  1FNW A;  4M8M A;  5C23 A;  4FA6 A;  1SIF A;  3B0A A;  4ZOH C;  2NTT A;  3ETR A;  2DZJ A;  2GBK A;  3QWZ B;  3T8M A;  5IA7 A;  3DHI C;  3WAM A;  3R7R A;  3CF6 E;  3A33 B;  4K3B A;  3ZDT A;  2K3U A;  2KYW A;  1VZ7 A;  2LGS A;  2L05 A;  3BK1 A;  1UH6 A;  4C4V B;  3BWU D;  2NPT A;  2ZW1 A; 
#chains in the Genus database with same CATH homology
 3VHT C;  2V4L A;  4MGI E;  5KHQ A;  3DVG Y;  4FJY A;  4GGQ A;  4IWO A;  3VTU A;  2K6Q A;  1FXT B;  2PEA A;  4KSK C;  2C7N B;  3PRM B;  3ECI A;  3LJ3 A;  4HPL B;  4MH0 E;  4DHZ B;  1P9D U;  1C1Y B;  2CHX A;  2K1F A;  2NR2 A;  3RYT A;  4AUQ C;  2C5L C;  1EF1 A;  3ML9 A;  4GSW A;  1E8Z A;  3RZW C;  2JWZ A;  3VTW A;  1WRD B;  4II2 B;  2RPQ A;  1J19 A;  2MWS B;  2R2Q A;  2WDT B;  1P1A A;  4XC2 A;  2KKC A;  5JHA A;  1J0G A;  2MBO A;  2PE6 B;  3KUZ A;  2KNB A;  1Q1O A;  1WM2 A;  2ZCB A;  2CHZ A;  2IBI B;  4W9L A;  4ANU A;  2N9E B;  2KDB A;  2M0X A;  3Q3J A;  1U4A A;  3MHS D;  1OQY A;  4TKN A;  5G55 A;  4DHZ E;  3U30 A;  1TBE A;  2CS4 A;  2O6V B;  2C7M B;  1L2N A;  3ZLZ A;  1VD2 A;  4FJV B;  4BKG A;  2AL3 A;  3QHT A;  4BFR A;  3H6N A;  3N32 A;  1WJ6 A;  2HD5 B;  2FAZ A;  2EMS A;  4ZRI A;  1E7V A;  2BKF A;  4B9K A;  2KLG A;  4KDI C;  3HIZ A;  4LDT D;  3ALB A;  4A3P A;  4DHJ B;  4ZRK A;  4KZ0 A;  4HDQ A;  2UWQ A;  4K81 A;  2K39 A;  2L3Z A;  3DBL I;  4HCN B;  1BT0 A;  3ZIM A;  2D3G A;  3ZO5 B;  2GBR A;  5LXI B;  3UQA A;  5DPS A;  5AZH A;  2IO3 B;  2Z0E B;  2IO1 B;  2AYO B;  4WWN A;  3ML8 A;  2DAJ A;  5CTR C;  3VH4 B;  1WXA A;  2NVU I;  5LLI A;  2MSE D;  4W9E A;  3X0W A;  1GUA B;  2MCN B;  2C9W B;  2FCM A;  3PHX B;  5TR5 A;  2CR5 A;  3EC8 A;  4BOZ B;  2LI5 A;  1GNU A;  2ZNV C;  3QQ8 B;  2ZNV B;  4HJK A;  4WQO B;  2MBQ A;  1WXV A;  4GDK B;  1EO6 A;  2N9X A;  4MEL A;  1OEY A;  2KN5 A;  5DPT A;  3TJP A;  2DYO A;  3NS8 A;  4DDG D;  2GBN A;  2WYQ A;  4PS3 A;  4I6L B;  3V60 A;  3RUI B;  4WWO A;  2O2V B;  1WE7 A;  4W9G A;  1TGZ B;  3D32 A;  2KDF B;  2KDE B;  2YLM A;  2ZEQ A;  3AUL A;  3VDZ A;  5AEK B;  4GDK A;  2I1J A;  2W9N A;  1Q0W B;  3TIX A;  5J2R A;  1TZ1 A;  2KJR A;  2GMI C;  1XQQ A;  2BYE A;  4YL8 A;  1V81 A;  4GIV A;  2O2V A;  1D3Z A;  3L16 A;  3B1L X;  5HKH A;  2MBB B;  4MSQ B;  2L7R A;  4F8C B;  1JRU A;  1E8Y A;  1LQB A;  4EZJ A;  4DK5 A;  1WH3 A;  2CHW A;  3L17 A;  3LDZ E;  2RD0 A;  4FN2 A;  4PS7 A;  3T9L A;  3WA0 A;  3AU4 A;  2GOW A;  1UBQ A;  2JZZ A;  3KVF B;  4EEW A;  1IPG A;  2KZR A;  3DQV A;  4BKS D;  4B6W A;  2KLC A;  1M94 A;  3RD2 A;  1WI0 A;  3QK0 A;  2PE9 A;  3H9D A;  3UF8 A;  4B95 A;  3WIM A;  2MQJ A;  1K8R B;  3TMP B;  3M62 B;  4HWI B;  3L10 B;  3IHP C;  3BY4 B;  3L08 A;  3IG3 A;  3MJW A;  4LDT B;  2MX2 A;  3RT3 B;  1Y8R C;  4HPM B;  1YQB A;  3VFK A;  2V3S A;  3U8Z A;  2KQ7 A;  3CST A;  1A5R A;  3PLU A;  3DVN U;  2HTH A;  4CYE A;  2XK5 B;  2FCQ A;  2IO2 B;  2NBU A;  2REX A;  4WJQ A;  3SDL C;  4KDL B;  3U7D A;  4EZK A;  2NS5 A;  4RM8 A;  1P0R A;  3KUD B;  2JPH A;  2FNJ B;  3M63 B;  5AZG A;  2BF8 B;  4NJ7 A;  4CO7 A;  1WMH A;  4TQ1 A;  4WJO A;  4K7W A;  1MG8 A;  4TUU A;  5DCN A;  2A4Z A;  2J0M A;  2PJH A;  2PPH A;  3IVF A;  4FUL A;  4ZDV A;  1H8C A;  3QCA A;  5E6P A;  3SD5 A;  2DZI A;  3PGE A;  3CSF A;  4LJP B;  4A3O A;  1OTR B;  2KTF A;  1AAR A;  4IC7 B;  4KSL C;  2MLB A;  3QIJ A;  1I35 A;  4DDI D;  4FLH A;  4ZRJ A;  3QAQ A;  4NAW B;  3ZNI D;  1Q5W B;  2LZ6 A;  3L54 A;  1UD7 A;  2L0T A;  2LAS A;  3HM6 X;  5G2N A;  4G3X B;  3PRP B;  1E90 A;  2N7E A;  2Z59 B;  3HHM A;  4P7I A;  4MEM A;  2LWP A;  3K9P B;  1WGY A;  4FBJ B;  2BPS A;  2MBH A;  2RGF A;  4NAW A;  3W1S C;  3GOE A;  4OVV A;  3VAW A;  4PS8 A;  2A5U A;  3RZF A;  2DZM A;  4MSM B;  3AU5 A;  2KJH B;  1V80 A;  4WWP A;  3V61 A;  2YVC A;  1CMX B;  3DOW A;  1UGM A;  3O65 B;  4KV2 A;  2L8J A;  2N1W A;  1WY8 A;  2D07 B;  3RUL A;  4HXD A;  3W1S A;  5BO4 B;  1WE6 A;  3BIN A;  1H4R A;  4JQW C;  4KIK B;  4FAD A;  2BKR B;  4MDK E;  1WM3 A;  4ANV A;  2Y5B B;  4JIO U;  2JXX A;  5DPW A;  3SU8 X;  1E7U A;  1V86 A;  5AZF A;  2DYB A;  1WGH A;  1WX8 A;  3NY5 A;  3VXW A;  3N30 A;  3QAR A;  4JLC A;  3QJZ A;  3APF A;  4GMV A;  3VQI A;  4MGK E;  3A4S C;  1RAX A;  3WAN A;  5JH5 C;  4KIK A;  2K6D B;  2MA9 B;  4NNJ B;  1EF5 A;  1P98 A;  1ZGU B;  2G4S A;  3DBR I;  2OJR A;  3ZNH B;  3UQB A;  4ICU A;  4BKS A;  5EDS A;  3UGB B;  2M17 A;  2MBE A;  1NI2 A;  4LJO B;  1KM7 A;  2KMC A;  4F7Z A;  1J8C A;  3TL5 A;  1V9J A;  2LXA A;  3ZW3 A;  3VUY A;  4GOC A;  2C60 A;  1QZE A;  1YIW A;  4E71 A;  4KVG B;  3TCA A;  3PT2 B;  1YX5 B;  4BBN C;  1GG3 A;  2MW5 A;  4M0W B;  2R2O A;  2DYM A;  2KD0 A;  4EFO A;  4PYZ A;  3PSE B;  4KZC A;  4ANW A;  2BYV E;  3PZD A;  2JZ3 B;  3V6E B;  4W9F A;  2AWT A;  1PQS A;  1YJ1 A;  3WAL A;  3ZNG C;  3JVZ X;  1WJN A;  2LGY A;  4OVU A;  2KXJ A;  4N9F 4;  4ASW C;  2LGX A;  1LXD A;  3JYU A;  4IUM B;  3X23 A;  3DCG A;  1WZ0 A;  2KC1 A;  3M95 A;  3ENE A;  3PTF C;  1GC6 A;  4I6N B;  1Z5S B;  1WXM A;  1WFY A;  2NBW B;  2CKH B;  1XT9 B;  2D11 A;  3Q3F A;  2FUH B;  2I1K A;  5GMV A;  1L7Y A;  2FID A;  4I6P A;  1NDD A;  2IYD B;  2KOX A;  2IY0 B;  3VUW A;  1WZ3 A;  2FIF A;  4FHK A;  4TV3 A;  1LFD A;  1YX6 B;  2DAF A;  3KYC D;  3C0R B;  3QA8 A;  5D7G A;  3GZN I;  2KVR A;  3KYD D;  2JRI B;  4AOF A;  2UYZ B;  4IWP A;  3H7P B;  3R7Q A;  2N9P C;  3ZTD A;  4J6I A;  2GBM A;  2KWV B;  4XX5 A;  2KC2 A;  4FHJ A;  3UIO B;  3HK0 A;  2LGD A;  4W9J A;  4GXB A;  5CHF A;  3A1Q B;  2HJ8 A;  3SHQ A;  4EOY A;  1WMH B;  1V49 A;  2KWC A;  3EHV A;  3PV1 A;  1I42 A;  2EMT A;  2MRP A;  5FR6 A;  3QC8 B;  3IBE A;  4CHK A;  1GC7 A;  3AXC A;  4JL9 A;  2BWF A;  4W9I A;  2ASQ A;  3H7P A;  2KMA A;  2JY6 A;  1SE9 A;  5KHO A;  1S1Q B;  2LRU A;  2JF5 A;  2OOB B;  3WAO A;  3A1Q A;  3H7S A;  2BWE S;  4IWQ A;  3RCZ A;  2WX0 A;  4GU2 A;  3OJ3 A;  3V6C B;  5D2M B;  2VRR B;  1GJZ A;  4ICV A;  4G11 A;  2KX0 A;  5JZE B;  3DPD A;  1WGG A;  1WR1 A;  2KFJ A;  5D94 A;  2ZJD A;  4HVB A;  2FCS A;  2MP2 B;  2B3A A;  3WAP A;  5D6J B;  3IFW B;  4AP4 C;  3OJ4 B;  2N1V A;  4F1S A;  4URK A;  3DDC B;  5LXH A;  2M4N A;  3ZDM C;  2JRH A;  4K7S A;  2DEN B;  2ZPN A;  4MM3 A;  3VH3 B;  2KQS A;  4GB9 A;  2FCN A;  4WJN A;  4II3 B;  1Z2M A;  4EUT A;  2LRW A;  4K1R B;  2MP2 A;  1NBF C;  2K25 A;  2DX5 B;  4DWF A;  1P3Q U;  1LM8 B;  5L95 C;  4M8N A;  4GDL B;  3KW5 B;  3HM3 A;  4HCP B;  4MGY E;  2AEH A;  2JUO A;  5CHV C;  4A20 A;  1RFA A;  3PHW B;  4IM0 A;  3MTN B;  3APC A;  3OLM D;  1T0Y A;  4W9K A;  3NZS A;  3TBL D;  4GDL A;  2WWZ A;  3V62 A;  1KLV A;  1E8W A;  1IP9 A;  4G50 A;  1V5T A;  4AWJ A;  2ZZP B;  3CMM B;  1V5O A;  3PS6 A;  3A4R A;  1E8X A;  3JW0 X;  4AJY B;  4NJ6 A;  1OEY J;  1V2Y A;  3ZNZ B;  1WJU A;  4EKU A;  2J0J A;  3NHE B;  3P2B A;  4IM3 A;  4BBN F;  3L0W B;  3PPA A;  2AL6 A;  1SGH A;  3S2A A;  3UIP B;  3VUX A;  1WGR A;  3OAW A;  1R4N I;  1F9J A;  1WX7 A;  1WX9 A;  4NY0 A;  1RRB A;  4IM2 A;  3ZVV A;  2IY1 B;  3W1Y A;  1EUV B;  2O6V A;  2BYF A;  2ZCC A;  1XD3 B;  4MGZ E;  4FJZ A;  4LCD E;  4DBG A;  1UBI A;  2BGF A;  2KWU B;  3DBS A;  4BOS C;  5IAA C;  5L83 A;  1WF9 A;  2V1Y A;  1YD8 U;  2WX1 A;  3KUC B;  3ZUN A;  2KO3 A;  1UZX B;  3R3M A;  3PRE A;  1ISN A;  4HDO A;  4BKT A;  3ZTC A;  2N4F A;  4WJP A;  4X57 B;  3PVL A;  1WIA A;  5DPR A;  2LVO A;  4RM9 A;  3NZU A;  2IO0 B;  2G45 B;  3EEC A;  3B08 A;  3ONS A;  4E74 A;  4GN1 A;  4HK2 A;  4E3C A;  2JVC A;  5E6N A;  1ZW7 A;  4HLE A;  4W9H A;  5JHB A;  3PRZ A;  3N3K B;  2N7D A;  2XEW A;  1VCB A;  2JT4 B;  3KH0 A;  2G3Q B;  2KTR B;  1RLF A;  2KAN A;  4NQK E;  1TTN A;  1WR6 E;  3H1U A;  3AI5 A;  3M3J A;  4W9C A;  5J18 A;  3R66 C;  1WYW B;  2NCN A;  3JSV B;  2L76 A;  2RSU A;  4IW0 A;  5CX3 A;  2KTR A;  3UIN B;  4AJW A;  2DHZ A;  1KOT A;  3DBH I;  3ZRF A;  1WGD A;  2HE7 A;  4RMA A;  2KDI A;  3ZKJ C;  4JGH B;  3K9O B;  3L13 A;  2C7H A;  1WJ4 A;  1KJT A;  1X1M A;  2KHW B;  2KJ6 A;  2LXC A;  2KFK B;  3APD A;  3JSV A;  5J17 A;  4DXA B;  1R4M I;  2O6V D;  1C3T A;  4K7U A;  2KK8 A;  2J0K A;  3DVG X;  2IZV B;  2EKE C;  4EZL A;  5CHW A;  1G6J A;  2K8C A;  2LVP A;  1HE8 A;  2K8B A;  2KFK A;  2M1M A;  2Z0D B;  1S3S G;  1V6E A;  3A9J B;  1UEL A;  2M8S A;  3A9K B;  2ZVN A;  2L00 B;  4DHJ D;  2ZVO A;  3VTV A;  2RR9 A;  3EFU A;  4WAA A;  4ANX A;  1WXS A;  4MJS B;  2K8H A;  3QX1 A;  3DVN V;  4G0N B;  3ZRC A;  1OGW A;  4IG7 B;  1IYF A;  2LVQ A;  2ZPY A;  4M8M A;  2D2Q A;  4ZYN A;  2LJ5 A;  3A9J A;  3A9K A;  3I3T B;  2LUE A;  3PLV A;  5E6O A;  5C23 A;  2LD9 A;  4PYU A;  4FA6 A;  1E5W A;  1SIF A;  3B0A A;  3VVW B;  2XBB C;  4MJS A;  2KX3 A;  5C1Z A;  2NBV B;  2DZJ A;  4NQL B;  2GBK A;  3QWZ B;  2NPT B;  4W9D A;  3T8M A;  4NPN A;  2CU1 A;  5IA7 A;  3WAM A;  3R7R A;  3CF6 E;  2GBJ A;  3NOB A;  3A33 B;  3ZDT A;  2G4D B;  4XZ4 A;  4TQ0 A;  2L0F A;  4BVU C;  2L05 A;  2D10 A;  2QHO A;  1UH6 A;  1ZKH A;  2DZK A;  2NPT A;  2XK5 A;  2J7Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...