4NPNA

Crystal structure of human tetra-sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Small ubiquitin-related modifier 2
publication title Structural analysis of poly-SUMO chain recognition by the RNF4-SIMs domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4npnA00
2LVOA 2BYVE 4FJVB 3Q3JA 1WYWB 4GDLB 4OVUA 2LGDA 2UYZB 4KV2A 2K6DB 4MJSB 3QJZA 4GOCA 4DXAB 2DYBA 1WGDA 4M0WB 3ECIA 2KJ6A 3KUZA 2DAFA 2L00B 2N9XA 4W9JA 2KTRA 3X0WA 3A9JA 4HJKA 3ZRFA 2DZIA 3PHXB 2LVPA 1RFAA 2KJHB 4ANXA 2KWUB 5D2MB 1ZW7A 2MBHA 4FADA 3HK0A 4MGIE 3JSVA 3KYDD 2DZMA 5JHBA 1WM2A 2MBEA 1VCBA 3AULA 2NBWB 2IYDB 4I6LB 2BKFA 2N7EA 3B1LX 4DHZB 4CHKA 4HCPB 4W9IA 3AI5A 2L8JA 2M1MA 4DHJD 3KW5B 4TKNA 4NQLB 1D3ZA 3VUWA 3RCZA 3RUIB 4KSKC 2KN5A 4PYUA 4LDTB 1SIFA 3S2AA 3VXWA 3ZDTA 3TJPA 3R66C 3A1QB 2LGXA 1WGHA 4HWIB 3ZDMC 1TBEA 1R4NI 1WR6E 1P9DU 4ANUA 2O2VA 4II3B 5G55A 1XD3B 2GOWA 3VFKA 2RD0A 5IAAC 1HE8A 3APDA 3PV1A 3SU8X 3ML9A 2QHOA 2C7HA 3DBRI 4IWQA 3GZNI 2K8HA 2D07B 3L0WB 4G50A 4TV3A 2BWES 2WWZA 2M17A 1GC6A 5CHFA 5J2RA 4KIKB 2WDTB 3OLMD 1I42A 2PJHA 4HCNB 1Z2MA 3A9KA 3ZO5B 2LWPA 4I6PA 1UGMA 1XT9B 1R4MI 5D94A 4W9LA 4CYEA 2C7MB 1UH6A 2PE9A 4GU2A 2L3ZA 4GN1A 2KQ7A 3L17A 1BT0A 1P3QU 3IFWB 5C1ZA 1E8XA 3QQ8B 1GG3A 3APCA 3PLUA 3PS6A 3WAOA 2C7NB 3H6NA 3QHTA 3W1SA 3WALA 3ZVVA 2IY0B 2K1FA 5EDSA 1WE6A 1KJTA 2KK8A 2BYFA 4BKGA 4URKA 3PRMB 2KTRB 1L7YA 3A9JB 4M8MA 5E6NA 4DHJB 2MSED 4PS7A 2NR2A 4ASWC 3NZSA 4NY0A 2XBBC 2MLBA 3PTFC 3RZWC 4GDLA 1WR1A 2GBMA 3ONSA 3AXCA 4W9EA 4MJSA 4GXBA 2G45B 2N4FA 2N7DA 2KD0A 3CF6E 3JSVB 4ZRJA 2HD5B 3UGBB 2DAJA 1M94A 2KTFA 3NY5A 2KDIA 4I6NB 3TIXA 4W9FA 1FXTB 2LI5A 4NJ6A 4NQKE 5LLIA 3I3TB 1E8ZA 2LUEA 2KXJA 1V9JA 3O65B 3L16A 1L2NA 2G3QB 1E8YA 2CKHB 4FHKA 4JGHB 3B08A 2JRHA 2O2VB 4E3CA 1WXVA 4GGQA 1E90A 5IA7A 3N30A 2KKCA 1YQBA 3R7QA 1UD7A 3PSEB 5KHOA 4FN2A 4BFRA 2XEWA 2GBNA 4LJOB 5CHWA 2NVUI 1YX6B 4RM9A 3V60A 3PPAA 2KC2A 4M8NA 4K1RB 5FR6A 2ZNVC 2FCSA 3VVWB 2GMIC 3A9KB 1H8CA 2EMSA 2JT4B 3UQAA 2AWTA 4EFOA 2CR5A 3CSFA 5LXIB 3LJ3A 2EKEC 1G6JA 4EOYA 4EUTA 3DVNV 4MEMA 4B6WA 5JHAA 1C1YB 2KFJA 3LDZE 3RYTA 4F7ZA 2CHZA 2RGFA 3C0RB 2BWFA 4DDID 2MBBB 1AARA 4WQOB 2PPHA 1C3TA 3DBHI 3VTUA 4HLEA 2IY1B 5J17A 4IUMB 5DPWA 4IM0A 3R7RA 4AWJA 3L13A 2KDFB 3H1UA 1Y8RC 4AUQC 2KX0A 4IC7B 4MGYE 3HHMA 3EC8A 4G3XB 1V5OA 2HE7A 3EFUA 5LXHA 1GJZA 2NCNA 3UIPB 3DBLI 4AOFA 1QZEA 3NZUA 4G11A 2IO0B 2CHWA 1H4RA 4EKUA 2MA9B 2K6QA 3QC8B 2KLCA 2ZNVB 4FJYA 4WJOA 2KFKA 4WAAA 4FHJA 3WAMA 5DPRA 3A4RA 2FUHB 1WXSA 2ZJDA 1VD2A 4J6IA 4FULA 4ANWA 4CO7A 2AYOB 4WWNA 1ZGUB 3ML8A 1WXAA 1GC7A 4IG7B 1KM7A 2FCNA 2B3AA 3OJ4B 4IM3A 2KX3A 2FCMA 2LZ6A 2IO1B 4MGKE 4PYZA 4BOSC 2MP2A 2NPTA 5L95C 2J0KA 2KNBA 2LRUA 1WX7A 3VHTC 3VTVA 5JZEB 4K7UA 2CS4A 3V6CB 1WX9A 4B9KA 2MW5A 4W9CA 4XX5A 1WY8A 3D32A 3HM6X 1F9JA 1WJ4A 2A5UA 1SGHA 2G4SA 5AZHA 2N1WA 3OAWA 3M62B 1LM8B 4BVUC 2FIFA 3PHWB 1NBFC 3WAPA 2BPSA 4FJZA 4BBNF 3H9DA 3X23A 5CHVC 4JL9A 1V6EA 4GIVA 2VRRB 4MDKE 3DVGY 3ENEA 4IWOA 5CX3A 2LGYA 4KZ0A 2I1KA 2V4LA 3L10B 2LJ5A 4AP4C 1YD8U 4FA6A 4K7SA 3NOBA 2JY6A 1ZKHA 3VUYA 2Y5BB 2J0JA 2YLMA 4X57B 3ZTCA 4MSMB 3VH4B 3ZNHB 3QWZB 4NPNA 2D11A 4BOZB 1WF9A 3H7SA 1WXMA 3V62A 4IW0A 3ZKJC 2ZZPB 1WGGA 2M4NA 3PRZA 4HPLB 3A4SC 3N32A 2ZVNA 2KFKB 4HDOA 1WRDB 3N3KB 4MM3A 2ZVOA 3PVLA 1TZ1A 3CSTA 4WJPA 4IM2A 3VTWA 4EZJA 4XZ4A 3ZNID 3MJWA 1WGYA 1OGWA 2ZCCA 4GSWA 4W9KA 3HIZA 3QK0A 4G0NB 1UELA 2FCQA 5E6OA 1UZXB 5CTRC 2R2QA 4WWOA 2C9WB 2K25A 4KVGB 1IYFA 4OVVA 3ZUNA 2MBQA 2MP2B 2NPTB 2LXCA 3JVZX 4GDKA 4ICUA 4BBNC 2J0MA 2ZPYA 1OTRB 3IBEA 2LXAA 3KUDB 5J18A 4TQ1A 2HTHA 1J19A 2LASA 2JXXA 3DCGA 1UBIA 4NAWA 2W9NA 2DYMA 2KMAA 1WM3A 1EUVB 2JZ3B 3VAWA 3T9LA 3R3MA 4K7WA 1U4AA 1T0YA 3ZW3A 1E7UA 3GOEA 3MHSD 1WZ0A 3ZNGC 3M95A 1EF5A 3TMPB 5TR5A 2A4ZA 1V80A 2DX5B 2IO2B 2RR9A 1YJ1A 4WWPA 2BKRB 3L08A 1WH3A 1EO6A 1WJNA 4GB9A 3QX1A 2C60A 1WGRA 2AEHA 4HDQA 4NNJB 5GMVA 1TGZB 1Z5SB 3DDCB 2L0FA 2DENB 2NBVB 2OOBB 4E71A 2LD9A 2Z0EB 2I1JA 4P7IA 2K8CA 3JW0X 3PGEA 3TL5A 1J0GA 2AL3A 1E8WA 5DCNA 2R2OA 2KC1A 4HVBA 1OEYA 1RLFA 4BKTA 4TQ0A 3PT2B 2M8SA 5AEKB 1E7VA 3H7PA 1LQBA 4PS3A 4EZKA 2MQJA 3VQIA 3B0AA 1UBQA 3ALBA 4DK5A 2WX1A 4FBJB 2GBRA 3SD5A 3PZDA 5JH5C 2REXA 1J8CA 3EHVA 1PQSA 3PREA 2KOXA 4ICVA 4GMVA 5AZGA 1P0RA 2JVCA 2LVQA 2N1VA 3KVFB 3HM3A 2DZKA 3RZFA 2XK5A 3AU4A 4GDKB 4KDLB 3SHQA 4ANVA 1S3SG 2KJRA 2PEAA 5KHQA 2O6VD 4ZDVA 3QA8A 2ASQA 4F8CB 4XC2A 1YIWA 3UINB 1Q5WB 1ISNA 3AU5A 4NAWB 1I35A 1GUAB 1P98A 5DPTA 1LXDA 3VDZA 1E5WA 4MSQB 1V49A 4MH0E 4AJYB 3DVGX 4PS8A 3V61A 3TCAA 5D7GA 1X1MA 4ZRKA 2L76A 3DPDA 3A33B 3OJ3A 3APFA 4HXDA 2KDEB 1WMHA 2L05A 4TUUA 2KMCA 2DZJA 3DVNU 3WA0A 2CU1A 2NS5A 3QIJA 4KSLC 3DOWA 4ZRIA 2YVCA 2LRWA 4A20A 4WJNA 3NHEB 2JZZA 4B95A 2D2QA 1XQQA 4BKSA 4A3OA 4JLCA 5D6JB 1WX8A 1SE9A 2K39A 4WJQA 3VH3B 1TTNA 5AZFA 1KOTA 3Q3FA 2N9PC 2AL6A 4HK2A 4K81A 2OJRA 4LCDE 5BO4B 2MRPA 3H7PB 3PLVA 3U7DA 4YL8A 1V5TA 3ZTDA 3L54A 1K8RB 3RULA 2D3GA 5C23A 2O6VB 3KYCD 2RPQA 4BKSD 1WZ3A 1WFYA 2Z59B 3UF8A 1WE7A 2FNJB 4IWPA 2KLGA 2CHXA 3JYUA 1LFDA 1P1AA 1EF1A 2JF5A 2G4DB 2JWZA 2MCNB 3QAQA 2WX0A 3VUXA 4DWFA 2K8BA 3EECA 2XK5B 1RRBA 2UWQA 5E6PA 3M63B 4DBGA 2KHWB 3W1YA 1KLVA 2ZPNA 3DBSA 2EMTA 2KVRA 2V1YA 3ZNZB 4ZYNA 3IHPC 2RSUA 3V6EB 4AJWA 5L83A 2ZEQA 4W9DA 2DYOA 5DPSA 2GBJA 2PE6B 3U8ZA 4NJ7A 2BGFA 3ZLZA 4EZLA 3RD2A 2J7QB 1WI0A 3IVFA 2C5LC 3SDLC 2ZCBA 2N9EB 3W1SC 2JRIB 3K9OB 3KH0A 1WMHB 4DHZE 2L7RA 4N9F4 3RT3B 2JUOA 3IG3A 4MGZE 4MELA 3P2BA 4LJPB 3QARA 1WJUA 1NI2A 3PRPB 1MG8A 3WANA 2DHZA 2KWVB 1IPGA 2L0TA 1GNUA 4F1SA 2NBUA 2HJ8A 1OEYJ 1Q0WB 1V2YA 3MTNB 3NS8A 1S1QB 2D10A 2WYQA 2IO3B 2BYEA 3BINA 3ZIMA 3WIMA 4RMAA 2KZRA 2IZVB 2BF8B 2Z0DB 3KUCB 1RAXA 1WJ6A 1A5RA 3A1QA 3UQBA 4FLHA 4KZCA 2MWSB 3ZRCA 2MBOA 3U30A 4EEWA 4JQWC 4E74A 1WIAA 3DQVA 2KWCA 3CMMB 3QCAA 4W9HA 2KDBA 2MX2A 3TBLD 3T8MA 3M3JA 2KANA 2FIDA 4RM8A 5G2NA 1IP9A 4JIOU 2FAZA 1CMXB 4LDTD 5HKHA 1OQYA 2M0XA 2V3SA 4KIKA 1V81A 2IBIB 2O6VA 4W9GA 3UIOB 2GBKA 4II2B 2KO3A 2JPHA 4A3PA 4HPMB 4DDGD 4KDIC 2KQSA 1Q1OA 1JRUA 1V86A 3K9PB 1NDDA 3BY4B 1YX5B
chains in the Genus database with same CATH superfamily
1L0YB 1D5XC 1JCKB 4KV2A 2QDFA 2K6DB 4MJSB 4GOCA 1ESFA 4DXAB 1WGDA 2KJ6A 3MJ5A 4W9JA 2VH2A 3Q6BA 2KT7A 2KTRA 3OWEB 2LVPA 1RFAA 4ANXA 2KWUB 5D2MB 2MBHA 3HK0A 3KYDD 5JHBA 4WURA 2MBEA 2NBWB 1PGAA 4HCPB 3I5JC 3AI5A 2M1MA 2WXHA 4DHJD 2JYTA 4NQLB 2PVGC 3VUWA 1GPXA 2KN5A 1SIFA 3R66C 3ZDMC 1TBEA 1R4NI 3BVZA 3AECB 2GOWA 3HUIA 5HG2A 3RNFC 4YSZB 1HE8A 1ZXIA 2C7HA 3L0WB 1ZXHA 4IKGA 2WDTB 3ETRA 1FFUA 3OLMD 4LNKA 4J3OD 5D94A 2KQ7A 1BT0A 3IFWB 5C1ZA 1E8XA 1F0ZA 2N0SB 3PS6A 2JQRB 3WAOA 2C7NB 5EDSA 5T8IA 3ZVVA 2K1FA 2JU6X 1WE6A 1D4BA 4BKGA 4URKA 3PRMB 2EELA 2KTRB 5E6NA 3I57A 4NY0A 4K3CA 4BAXA 2MLBA 2QIEB 1WR1A 2GBMA 1B1ZA 4W9EA 2N4FA 2J53A 4REZA 2INDC 2LI5A 2E3TA 5LLIA 3W5UB 1E8ZA 1ET9A 4USAA 1SE4A 2CKHB 4C00A 3B08A 3DBHB 1WXVA 5IP4D 1UWMA 2AQ3B 2JWUA 2KKCA 3AE9B 5AUIA 1YJJA 2GBNA 5CHWA 3SEBA 1Q10A 5BYRA 3AE2B 3VVWB 2GMIC 4KKJA 1JWSD 1F2RC 2JT4B 2LUMA 1TS4A 3UQAA 2CR5A 5LXIB 2WXNA 5IO9A 3NVVA 3AEEB 4MEMA 4RNAA 3RYTA 3BYTB 2BWFA 3MFGA 3B2GA 2PPHA 2XN9C 2JZPA 4HLEA 5J17A 5FK9C 1QKZA 1YQ4B 5FKAC 1TS5A 4AWJA 1WWTA 1XLOA 4AUQC 3PZ7A 3EC8A 4G3XB 2HE7A 5LXHA 3EFUA 2WXIA 1TZOA 1JRPA 3P63A 1XLQA 4AOFA 2ONQA 3NZUA 3TEXA 2MJEA 3CWIA 3I63C 5BMIA 3QC8B 3B2FA 4FJYA 4US9A 2KFKA 4L23A 2K0PA 2MH7A 1V1OA 4CO7A 4WWNA 1ZGUB 3ML8A 1GC7A 4IM3A 4PYZA 2KX3A 5L95C 2LZ6A 3FILA 4A8XC 3VHTC 5IN7A 3ZYYX 4LNFA 2LGSA 4W9CA 4C4VA 1WY8A 3BK2A 4P16A 1WJ4A 3U2SC 2N1WA 3PO0A 1LM8B 2BPSA 4FJZA 3NZ3A 2WU2B 3DVGY 1J7CA 4KZ0A 3BK1A 2RDBC 3RNEC 2J0JA 2ZW0A 3QWZB 2KQ4X 3V62A 1WXMA 5G5HA 2ZZPB 3PRZA 3RNAC 3A4SC 3N32A 2ZVNA 2KFKB 4HDOA 2IJ0A 4NZLB 2ZVOA 3CSTA 4EZJA 1WGYA 2FCQA 5E6OA 1FD6A 3N20C 2C9WB 4ICUA 2J0MA 2ZPYA 1OTRB 3FILB 3KUDB 2K5PA 1J19A 2LASA 3TEYA 3DCGA 4C4VB 3BIID 1QOAA 2KMAA 1WM3A 1FEHA 4K7WA 3MHSD 1WZ0A 2QMTA 3TMPB 2BS3B 3NVYA 1IUEA 1TYGB 3ZJVA 3P42A 3P4QB 1XF5L 2IGGA 3L08A 1WJNA 4GB9A 4OVZA 4NNJB 1V8CA 4H2AA 2L0FA 1QT9A 3FAHA 3JW0X 1E8WA 1XO3A 4ZYSA 4HVBA 1RLFA 1MI0A 5BMHA 5H92C 5AUKA 3VQIA 1N63A 2UU7A 2L1AA 2GBRA 3SD5A 2REXA 1C4CA 1QF6A 3PREA 1FMAD 4GMVA 2LVQA 1PGXA 4FXCA 2XK5A 4KDLB 4PK1A 5FR3A 4LNNA 1T6BX 3UINB 4S0RA 2KMMA 3AU5A 1GUAB 2JSVX 3DVGX 3V61A 3TCAA 5D7GA 2WXFA 2L76A 3DPDA 2WDRB 2LMCA 3A33B 3Q8CA 3WA0A 2CU1A 4KSLC 3DOWA 2YVCA 3DHHC 1SJED 1UNSA 3NHEB 4BKSA 4JLCA 5D6JB 1SE9A 2BBCA 2W3RA 3Q3FA 4LTUA 2MRPA 3NVZA 4ZHPA 3L54A 2AX5A 4AS1A 3RULA 3KYCD 4IWPA 3JYUA 4JPSA 2NMQA 2JWZA 2WX0A 3MC8A 4DWFA 2XK5B 3EFCA 3M63B 1L4ZB 3I9V1 1FNVA 3DBSA 1N5XA 5LNK1 5L83A 2ZEQA 2DYOA 5DPSA 2PE6B 2DLBA 3Q69A 3U8ZA 2BGFA 3ZLZA 2W55A 2ZCBA 2WXRA 1TJEA 1V97A 2Q5WD 3MP9A 1FRDA 1QOBA 3RNGC 1MG8A 3WANA 2DHZA 2QC8A 1IPGA 2HJ8A 1OEYJ 1Q0WB 1V2YA 1L5PA 1S1QB 3LB8C 2BYEA 5JXVA 3NG0A 4KZCA 3SFDB 3TEWA 2MBOA 1TY2A 1AWDA 2KWCA 2BQQA 2DBYA 2KANA 2FIDA 5G2NA 1IP9A 4M02A 2I38A 4DXFA 1MPEA 4RH6A 1K50A 3PZ8A 2HTME 2BB6A 2KO3A 4HPMB 1Q1OA 1JRUA 1V86A 3BY4B 3MC9A 1E0ZA 1WYWB 2LGDA 1R4NB 1SB3C 2DYBA 2DAFA 2N9XA 3A9JA 2CJOA 1VCBA 2BYTA 2IYDB 2BTEA 2BKFA 2N7EA 2V3NA 3B1LX 4W9IA 3NUHB 1SIJA 4TKNA 2IPKD 1D3ZA 3RCZA 1L6UA 4KSKC 3BVMA 3ZDTA 3S2AA 3TJPA 3TSSA 2WS3B 4XYCA 1WR6E 3HVDA 1L4DB 4II3B 1XD3B 3PV1A 1FFVA 3ML9A 2LHEA 2QHOA 3GZNI 2D07B 4TV3A 2WWZA 5CHFA 1GC6A 3Q3NC 5J2RA 1Z2MA 2GLSA 2BW2A 1XT9B 2C7MB 3L17A 5D3DA 2WDVB 3OG5A 3WALA 4AQ7A 2N9KA 2E6XA 4MT5A 3FC4A 3A9JB 2L32A 2NR2A 4ASWC 2XBBC 4RGTA 3GP7A 4MJSA 2HJ1A 3UGBB 2DAJA 1M94A 2KDIA 3TIXA 1FXTB 4NJ6A 3RNBC 1C77A 2KXJA 4B0EA 1V9JA 1L2NA 2G3QB 1E8YA 3URYA 5IKCM 1F52A 4FHKA 3T3OA 3N30A 1YQBA 1JWAD 1I4QA 4GLSC 2NVUI 3N1XC 3PPAA 2FCSA 2EMSA 1STEA 4XGAB 2OEDA 4EUTA 4XWWA 5JHAA 1C1YB 1JALA 2RGFA 1QOGA 2M19A 1MG4A 4WQMA 1AARA 4ZOHC 3IT6B 4IM0A 1B9RA 3L13A 2GRIA 2KDFB 4HKZE 4MGYE 1XLPA 3DHIC 1GJZA 3UIPB 1Y56A 3DBLI 5BYQA 4G11A 2IO0B 4YWGG 2CHWA 5BYSA 4HJGE 2MA9B 3RMKC 2ZNVB 1FCLA 4C80A 3U4EG 1WXQA 1I4HA 2CU3A 2FCNA 2W3SA 3OJ4B 2MP2A 1VZ8A 1F1HA 3RPFC 2CS4A 1OQRA 2QJLA 4XX5A 2N9LA 3HM6X 1F9JA 3NVWA 3EA6A 2KDMA 1SE2A 4OZCA 2H88B 5G5GA 3WAPA 4JL9A 2IGHA 5CX3A 2I1KA 1YD8U 3NS1A 4K7SA 4FA6A 4HRSA 3AEGB 3ZNHB 2MJ3A 4D2KA 1WF9A 4ACFA 3ZKJC 4HPLB 3EGRA 3GB1A 4LK0M 4MM3A 5EE3A 1TZ1A 3VTWA 2ZCCA 3IAM1 3HIZA 3QK0A 2G9HD 1UZXB 2R2QA 3DHGC 2MBQA 2MP2B 3JVZX 3BZDB 4GDKA 1TS2A 3IBEA 4HPPA 4TQ1A 2W82A 2J42A 2GI9A 1EWCA 3VAWA 3SR6A 3T9LA 4NAMA 1U4AA 3ZW3A 3B9JA 1E7UA 1TKGA 3M95A 5TR5A 5HFYA 2DX5B 1KTKA 4WWPA 1EO6A 3QX1A 2C60A 4DXGA 3DDCB 3TEZA 4PT5A 3VR8B 2I1JA 3PGEA 2D3CA 3TL5A 1J0GA 1FNUA 1OEYA 2M8SA 2BVCA 1DYQA 1PFDA 4PS3A 4EZKA 2MQJA 2PTLA 1V1PA 4MM3B 1GB4A 3B0AA 4N58A 3Q14C 4DK5A 3Q8EA 4FBJB 1VJKA 1J8CA 2NTSA 3Q8AA 2KOXA 4ICVA 4GDKB 1WRIA 5KHQA 2PEAA 2KJRA 3UI3A 4ZDVA 3RFZB 3AE3B 4XC2A 1I7HA 1P98A 3VDZA 1LXDA 5IOIA 1CK1A 1V49A 5TSSA 1ENFA 1I4PA 3W2DA 3DVNU 4ZRIA 4A6QA 4WJNA 4WIPA 3P4PB 2J4XA 4A3OA 4HEA1 1RYJA 1VLBA 2K39A 5AZFA 4HK2A 2CJNA 4LCDE 4DQOC 2PW9A 2GB1A 3DWMA 3ZTDA 1NVID 1K8RB 1V1PB 2O6VB 4BKSD 3VRBB 2MEKA 1QLBB 1FRRA 2Z59B 3UF8A 2DNFA 2CHXA 4L2YA 1P1AA 1EF1A 2QILA 2G4DB 2MCNB 3QAQA 2K8BA 3EECA 1RRBA 2RDGA 3N9YC 3SFEB 1WYGA 1JWMD 1K52A 3AE4B 4ZYNA 2KN4A 2RSUA 2WXPA 1SEBD 4AJWA 3ZXVA 2FBWB 4EZLA 2J7QB 2C5LC 3SDLC 3BVGA 2N9EB 3W1SC 1YJIA 2L7RA 4N9F4 3RT3B 4OZAA 4ZRQA 3P2BA 3ZQ4A 1D6EC 3QARA 2Y5CA 1LO5D 1ZPSA 2NBUA 1RFKA 2WNMA 2H89B 3BINA 4RMAA 2KZRA 1HZ6A 3GE3C 3KUCB 3GE8C 3ZRCA 3AE5B 2K9XA 4E74A 3DQVA 3CMMB 3QCAA 4W9HA 3TBLD 2KDBA 2MX2A 4YSXB 3M3JA 3N1ZC 2WXQA 3AEBB 3HVZA 5HKHA 2IBIB 3GS2A 4II2B 2JPHA 4DDGD 3K9PB 1NDDA 3ZJUA 2PLPA 2BYVE 4FJVB 4GDLB 2UYZB 2D5GA 1D5MC 3P4RB 3KUZA 2VH1A 1T5XD 2WXKA 3X0WA 4HJKA 1KFYB 3GZNB 3PHXB 3BWUD 1ZW7A 4FADA 4Q2JA 3N1YC 1FXAA 1AW7A 1WM2A 4OHJA 2WXGA 1IGCA 4N59A 2L8JA 3KW5B 4LDTB 3VXWA 1NI3A 4HKQA 4HWIB 1P9DU 2WQYB 2O2VA 3VFKA 5IAAC 3APDA 4ARIA 3SU8X 3AH7A 2ZW1A 3DBRI 4IWQA 1KH0A 2K8HA 4G50A 4C7ZA 1LGRA 2BWES 2M17A 1I4GA 1NYQA 1I42A 2PJHA 2K3UA 1R4MI 4W9LA 4CYEA 4M00A 4GU2A 1JWBD 1P7EA 2L3ZA 1P3QU 1K53A 3AEAB 3QQ8B 1GG3A 3APCA 1KLUD 3PLUA 4K3BA 3W1SA 4US8A 1KJTA 2BYFA 4UDUC 4M8MA 2BT6A 2MSED 3NZSA 2SAKA 3BYYB 3AXCA 3ONSA 4GXBA 2G45B 2KD0A 3CF6E 4RGMA 2HD5B 5BMGA 1SE3A 4I6NB 2X8XX 4NQKE 1T0QC 1RM6C 3IAS1 1SBBB 3I3TB 2LUEA 3IXSA 1MHHE 1DGJA 2O2VB 1QOFA 3R7QA 1UD7A 1I4XA 4FN2A 2XEWA 4LJOB 1YX6B 1BUIC 2ZNVC 4YTPB 2AWTA 4EFOA 3DBLB 5HI1A 3CSFA 2EKEC 3P4SB 1G6JA 4B6WA 2KFJA 3LDZE 1YNTE 4RFBA 5E6JA 2WU5B 1GAQB 4WQOB 1C3TA 3W9CB 3VTUA 1K51A 1ACCA 5DPWA 2LJIA 1UWXA 1FIQA 2MHJA 4LLGM 1Y8RC 1C79A 1NEKB 5D3IB 4IC7B 1V5OA 4JWUC 5HHDG 1QZEA 1H4RA 4A90A 2LFIA 2K6QA 2KLCA 3AV8A 4FHJA 4ZRPA 1ZDXA 1VZ6A 3WAMA 5DPRA 3R2IA 3A4RA 3KWLA 2ZJDA 4JX1C 4FULA 1XEEA 1KRHA 2AYOB 1XCTL 4WWMA 3RNCC 1WXAA 4IG7B 2QSDA 2B3AA 4MGKE 2IO1B 2J0KA 2KNBA 1WX7A 2KVZA 3AM9A 4K7UA 3V6CB 2MW5A 3D32A 1E7PB 1SGHA 2BS4B 1HEZE 4BVUC 1F2RI 3PHWB 1V6EA 4GIVA 4CQNA 2VRRB 1BXTA 1CZPA 2LGYA 2V4LA 3L10B 3LYYA 2LJ5A 4AP4C 1JWUD 2JY6A 1ZKHA 3VUYA 2VZKB 2Y5BB 4X57B 1CJEA 4RF1A 1JW9D 1SJHD 2D11A 3H7SA 1YQ3B 4IW0A 3MHZA 2B76B 4YTNB 1JROA 2PMVA 2SEBD 1WRDB 3N3KB 3PVLA 4WJPA 1YN4A 2RMMA 4XZ4A 1OGWA 4GSWA 4W9KA 4G0NB 1UELA 5CTRC 4KVGB 3KLSX 1T0SC 4IOIE 1ZOYB 2LXCA 5J18A 4QAYA 2HTHA 1L0XB 1UBIA 2W9NA 4ARCA 1EUVB 2JZ3B 4KGRA 1T0YA 3W5VB 2KWDA 3RN9C 2A4ZA 1V80A 2RR9A 2RDHA 1WH3A 2Z8LA 2RPVA 1WGRA 2AEHA 4HDQA 5GMVA 1TGZB 1Z5SB 2OOBB 2LD9A 2Z0EB 2KC1A 1E7VA 3H7PA 1M4VA 3U52E 3AEDB 2QEJC 3ALBA 1N60A 2WX1A 3C8YA 3PZDA 3EHVA 1PQSA 1MFWA 2JVCA 3AE1B 2N1VA 3KVFB 1VR9A 4OW0A 3C19A 5MPOA 4RCOA 1S3SG 1XLNA 1N5WA 2O6VD 3QA8A 3TUOA 1UUPA 2M0AA 1ZDVA 1ISNA 2J52A 5DPTA 3AE7B 4LNOA 4AJYB 4PS8A 1EU3A 4HXDA 3CIRB 1WMHA 2L05A 4TUUA 3FKYA 2PVOD 1AN8A 3ZXRA 3R2TA 2DZJA 2NS5A 1JMLA 4WH4A 1E9MA 2JZZA 1XQQA 3WCQA 4WJQA 1T3QA 2N9PC 4K81A 2OJRA 3H7PB 2FUG1 2ICIA 3AEFB 3PLVA 2V9HA 1KLGD 5C23A 2IDYA 1ZUD2 1WE7A 3L4PA 2KLGA 2AQ2B 2EKIA 3R8BA 1LFDA 1XXGA 3AB5A 3VUXA 3KWVA 2UWQA 4XDDA 1N6ZA 4DBGA 1KLVA 3W1YA 2KVRA 2V1YA 1R7SA 4TSSA 4W9DA 2GBJA 4NJ7A 2KAJA 1WI0A 1FCCC 4M0WA 4MH8A 2JRIB 3K9OB 3KH0A 5GXGB 1WMHB 4DHZE 4MGZE 4KGTA 4LJPB 4XDCA 1WJUA 1NI2A 1QQRA 4BZAA 3PRPB 1VRAB 2KWVB 1SXTA 2BB5A 4F1SA 1XCQL 3NS8A 5EE1A 2IO3B 1N62A 3WIMA 2IZVB 2QCZA 2Z0DB 1CQVA 1A5RA 1RAXA 3A1QA 4FLHA 1TKEA 3U30A 1WIAA 4JIOU 2FAZA 2WXJA 1HZ5A 3ZJTA 4LDTD 1OQYA 4IDIA 4KIKA 1QILA 1V81A 2O6VA 3Q8FA 4W9GA 3UIOB 2KQSA 5EE0A 4C56C 1YX5B 2LVOA 3Q3JA 4OVUA 3QJZA 1IGDA 2Y3AA 4M0WB 3ECIA 2L00B 1TY0A 4EE2A 3ZRFA 3DBRB 2DZIA 2KJHB 1UGJA 4MGIE 1VZ7A 3JSVA 2DZMA 1R4MB 3AULA 4I6LB 4DHZB 4CHKA 3RUIB 4PYUA 1NYRA 5C3JB 1L0VB 3A1QB 2LGXA 1WGHA 1ZP0B 2K22A 4ANUA 3Q3OC 5G55A 4P1CC 3J9CA 2RD0A 2WGSA 1FM0D 2WDQB 1PDXA 4KIKB 3NJTA 2MJDA 4KX6B 4YTMB 2X38A 4HCNB 3A9KA 3ZO5B 2LWPA 4I6PA 1UGMA 4YXDB 2PE9A 1UH6A 2KACA 4GN1A 4R3DA 2DWQA 3H6NA 3QHTA 2IY0B 2KK8A 1E6EB 1L7YA 4DHJB 4PS7A 1C4PA 1UF0A 3PTFC 3RZWC 4GDLA 2N7DA 3JSVB 4ZRJA 2KTFA 3NY5A 4W9FA 1YMHE 3O65B 4TMAB 3L16A 2FE8A 3LXFA 1FO4A 4JGHB 2JRHA 4E3CA 4GGQA 1GB1A 2D3AA 1E90A 5IA7A 3PSEB 5KHOA 1HTOA 4P1BC 4BFRA 3V60A 4RM9A 2KC2A 4M8NA 4K1RB 5FR6A 1EU4A 3A9KB 1H8CA 3P1MA 1YN5A 4OZBA 1ROEA 1L6VA 3LJ3A 4N6EB 1MHXA 2NTTA 4EOYA 3DVNV 4F7ZA 2CHZA 3C0RB 4DDID 2MBBB 3DBHI 1P7FA 2IY1B 4IUMB 1YOVB 1ZE3D 4XE0A 2OJWA 3R7RA 4LNIA 3H1UA 1J7AA 2KX0A 2ON8A 1AYFA 3HHMA 2WXMA 4P6VF 2NCNA 2BS2B 1C4AA 4EKUA 1VDVA 2ACZB 2YEPF 1T0RC 3T3NA 4WJOA 4WAAA 1KF6B 2INPE 1EWYC 4YT0B 2FUHB 1J7BA 2VZKD 1WXSA 2JXTA 1VD2A 4J6IA 4ANWA 2PKOA 4C7YA 5I4DA 1KM7A 4BOSC 2FCMA 2NPTA 3Q2AC 2LRUA 3VTVA 5JZEB 1WX9A 4B9KA 1NENB 2A5UA 2G4SA 4XWTA 5AZHA 3OAWA 1C9FA 3V3XA 2WHIA 3M62B 2FIFA 1NBFC 4BBNF 3H9DA 3X23A 3AMZA 5CHVC 4NJCA 4YSYB 1HXYD 4MDKE 4IWOA 3ENEA 3Q8BA 3NOBA 4RGOS 1F77A 2YLMA 3ZTCA 4MSMB 3VH4B 3U7ZA 1IBXA 4NPNA 1TKYA 4BOZB 2Y5PA 2OHFA 1WGGA 2M4NA 4A9AA 2W54A 1WGKA 1FPYA 3RI7C 4IM2A 1OQQA 3ZNID 3MJWA 2I2YA 4WWOA 2K25A 3DWGC 1IYFA 4OVVA 3ZUNA 3KQ4A 2NPTB 4JE3B 4M01A 4BBNC 1HA5A 1FNWA 3IT4B 2LXAA 2R61A 5C2TB 2JXXA 1N61A 3H8HA 4NAWA 2DYMA 3R3MA 4L1BA 1HTQA 3GOEA 4ZHOA 3ZNGC 1EF5A 2JYEA 2IO2B 1YJ1A 2WLBA 2BKRB 1SF0A 2DENB 2D3BA 2NBVB 4E71A 2V3PA 4P7IA 1I4RA 3AN1A 2K8CA 2AL3A 2INCC 5DCNA 2R2OA 1IBXB 4BKTA 4TQ0A 3PT2B 1C76A 2JX5A 1EM7A 5AEKB 4JWSC 3O13A 1LQBA 1ET6A 2V4IB 4RGNA 4O1NA 2AQ1B 1UBQA 1MVKA 5JH5C 1JQ4A 5AZGA 1P0RA 3HM3A 3EUB2 2DZKA 2LGIA 5EE9A 3RZFA 3AU4A 4ANVA 3SHQA 1D5ZC 2ASQA 4F8CB 1YIWA 1Q5WB 2KYWA 3E9SA 4NAWB 1I35A 1E5WA 4MSQB 4MH0E 2LEKA 1X1MA 4ZRKA 3OJ3A 3ABVB 3APFA 2KDEB 2WXOA 2L83A 2TSSA 2KMCA 4MACA 2V0GA 4RF0A 3E56A 3QIJA 4A20A 2LRWA 4B95A 2D2QA 2XNAC 1TS3A 1WX8A 1PYWD 3VH3B 1TTNA 2PIAA 1KOTA 4ITKA 2AL6A 5BO4B 1TT5B 4YL8A 3U7DA 1V5TA 1SSNA 1C78A 3VRAB 2D3GA 1DOYA 2RPQA 1WZ3A 1WFYA 1E10A 1YN3A 2FNJB 3NRZA 2JF5A 1A70A 2G1EA 1GOZA 2N7JA 5E6PA 2KHWB 2ZPNA 1DOIA 2EMTA 3ZNZB 3IHPC 2HDEA 3V6EB 2LHDA 2WP9B 1MJDA 3MC0B 1TIFA 1WSPA 2WXLA 3RD2A 4A55A 3IVFA 2YEPB 1FXIA 3ZGZA 2JUOA 3IG3A 2M56B 4MELA 2IGDA 2L0TA 1GNUA 2L52A 3MTNB 2D10A 2WYQA 3HRDD 3ZIMA 2BF8B 2INNE 1WJ6A 3AE8B 3UQBA 2MWSB 1RWSA 3Q3MC 1OFFA 5H8YE 4JQWC 4EEWA 1PGBA 4KKIA 1HQRD 3VR9B 3T8MA 4RM8A 1DOXA 4S17A 1CMXB 2M0XA 2V3SA 4KGSA 1PUTA 2GBKA 4WAFA 4A3PA 3AE6B 4B0MA 4KDIC 3V05A 4HROA 1BMLC
chains in the Genus database with same CATH topology
2LVOA 2BYVE 4FJVB 3Q3JA 1WYWB 4GDLB 4OVUA 2LGDA 2UYZB 4KV2A 2K6DB 4MJSB 3QJZA 4GOCA 4DXAB 2DYBA 1WGDA 4M0WB 3ECIA 2KJ6A 3KUZA 2DAFA 2L00B 2N9XA 4W9JA 2KTRA 3X0WA 3A9JA 4HJKA 3ZRFA 2DZIA 3PHXB 2LVPA 1RFAA 2KJHB 4ANXA 2KWUB 5D2MB 1ZW7A 2MBHA 4FADA 3HK0A 4MGIE 3JSVA 3KYDD 2DZMA 5JHBA 1WM2A 2MBEA 1VCBA 3AULA 2NBWB 2IYDB 4I6LB 2BKFA 2N7EA 3B1LX 4DHZB 4CHKA 4HCPB 4W9IA 3AI5A 2L8JA 2M1MA 4DHJD 3KW5B 4TKNA 4NQLB 1D3ZA 3VUWA 3RCZA 3RUIB 4KSKC 2KN5A 4PYUA 4LDTB 1SIFA 3S2AA 3VXWA 3ZDTA 3TJPA 3R66C 3A1QB 2LGXA 1WGHA 4HWIB 3ZDMC 1TBEA 1R4NI 1WR6E 1P9DU 4ANUA 2O2VA 4II3B 5G55A 1XD3B 2GOWA 3VFKA 2RD0A 5IAAC 1HE8A 3APDA 3PV1A 3SU8X 3ML9A 2QHOA 2C7HA 3DBRI 4IWQA 3GZNI 2K8HA 2D07B 3L0WB 4G50A 4TV3A 2BWES 2WWZA 2M17A 1GC6A 5CHFA 5J2RA 4KIKB 2WDTB 3OLMD 1I42A 2PJHA 4HCNB 1Z2MA 3A9KA 3ZO5B 2LWPA 4I6PA 1UGMA 1XT9B 1R4MI 5D94A 4W9LA 4CYEA 2C7MB 1UH6A 2PE9A 4GU2A 2L3ZA 4GN1A 2KQ7A 3L17A 1BT0A 1P3QU 3IFWB 5C1ZA 1E8XA 3QQ8B 1GG3A 3APCA 3PLUA 3PS6A 3WAOA 2C7NB 3H6NA 3QHTA 3W1SA 3WALA 3ZVVA 2IY0B 2K1FA 5EDSA 1WE6A 1KJTA 2KK8A 2BYFA 4BKGA 4URKA 3PRMB 2KTRB 1L7YA 3A9JB 4M8MA 5E6NA 4DHJB 2MSED 4PS7A 2NR2A 4ASWC 3NZSA 4NY0A 2XBBC 2MLBA 3PTFC 3RZWC 4GDLA 1WR1A 2GBMA 3ONSA 3AXCA 4W9EA 4MJSA 4GXBA 2G45B 2N4FA 2N7DA 2KD0A 3CF6E 3JSVB 4ZRJA 2HD5B 3UGBB 2DAJA 1M94A 2KTFA 3NY5A 2KDIA 4I6NB 3TIXA 4W9FA 1FXTB 2LI5A 4NJ6A 4NQKE 5LLIA 3I3TB 1E8ZA 2LUEA 2KXJA 1V9JA 3O65B 3L16A 1L2NA 2G3QB 1E8YA 2CKHB 4FHKA 4JGHB 3B08A 2JRHA 2O2VB 4E3CA 1WXVA 4GGQA 1E90A 5IA7A 3N30A 2KKCA 1YQBA 3R7QA 1UD7A 3PSEB 5KHOA 4FN2A 4BFRA 2XEWA 2GBNA 4LJOB 5CHWA 2NVUI 1YX6B 4RM9A 3V60A 3PPAA 2KC2A 4M8NA 4K1RB 5FR6A 2ZNVC 2FCSA 3VVWB 2GMIC 3A9KB 1H8CA 2EMSA 2JT4B 3UQAA 2AWTA 4EFOA 2CR5A 3CSFA 5LXIB 3LJ3A 2EKEC 1G6JA 4EOYA 4EUTA 3DVNV 4MEMA 4B6WA 5JHAA 1C1YB 2KFJA 3LDZE 3RYTA 4F7ZA 2CHZA 2RGFA 3C0RB 2BWFA 4DDID 2MBBB 1AARA 4WQOB 2PPHA 1C3TA 3DBHI 3VTUA 4HLEA 2IY1B 5J17A 4IUMB 5DPWA 4IM0A 3R7RA 4AWJA 3L13A 2KDFB 3H1UA 1Y8RC 4AUQC 2KX0A 4IC7B 4MGYE 3HHMA 3EC8A 4G3XB 1V5OA 2HE7A 3EFUA 5LXHA 1GJZA 2NCNA 3UIPB 3DBLI 4AOFA 1QZEA 3NZUA 4G11A 2IO0B 2CHWA 1H4RA 4EKUA 2MA9B 2K6QA 3QC8B 2KLCA 2ZNVB 4FJYA 4WJOA 2KFKA 4WAAA 4FHJA 3WAMA 5DPRA 3A4RA 2FUHB 1WXSA 2ZJDA 1VD2A 4J6IA 4FULA 4ANWA 4CO7A 2AYOB 4WWNA 1ZGUB 3ML8A 1WXAA 1GC7A 4IG7B 1KM7A 2FCNA 2B3AA 3OJ4B 4IM3A 2KX3A 2FCMA 2LZ6A 2IO1B 4MGKE 4PYZA 4BOSC 2MP2A 2NPTA 5L95C 2J0KA 2KNBA 2LRUA 1WX7A 3VHTC 3VTVA 5JZEB 4K7UA 2CS4A 3V6CB 1WX9A 4B9KA 2MW5A 4W9CA 4XX5A 1WY8A 3D32A 3HM6X 1F9JA 1WJ4A 2A5UA 1SGHA 2G4SA 5AZHA 2N1WA 3OAWA 3M62B 1LM8B 4BVUC 2FIFA 3PHWB 1NBFC 3WAPA 2BPSA 4FJZA 4BBNF 3H9DA 3X23A 5CHVC 4JL9A 1V6EA 4GIVA 2VRRB 4MDKE 3DVGY 3ENEA 4IWOA 5CX3A 2LGYA 4KZ0A 2I1KA 2V4LA 3L10B 2LJ5A 4AP4C 1YD8U 4FA6A 4K7SA 3NOBA 2JY6A 1ZKHA 3VUYA 2Y5BB 2J0JA 2YLMA 4X57B 3ZTCA 4MSMB 3VH4B 3ZNHB 3QWZB 4NPNA 2D11A 4BOZB 1WF9A 3H7SA 1WXMA 3V62A 4IW0A 3ZKJC 2ZZPB 1WGGA 2M4NA 3PRZA 4HPLB 3A4SC 3N32A 2ZVNA 2KFKB 4HDOA 1WRDB 3N3KB 4MM3A 2ZVOA 3PVLA 1TZ1A 3CSTA 4WJPA 4IM2A 3VTWA 4EZJA 4XZ4A 3ZNID 3MJWA 1WGYA 1OGWA 2ZCCA 4GSWA 4W9KA 3HIZA 3QK0A 4G0NB 1UELA 2FCQA 5E6OA 1UZXB 5CTRC 2R2QA 4WWOA 2C9WB 2K25A 4KVGB 1IYFA 4OVVA 3ZUNA 2MBQA 2MP2B 2NPTB 2LXCA 3JVZX 4GDKA 4ICUA 4BBNC 2J0MA 2ZPYA 1OTRB 3IBEA 2LXAA 3KUDB 5J18A 4TQ1A 2HTHA 1J19A 2LASA 2JXXA 3DCGA 1UBIA 4NAWA 2W9NA 2DYMA 2KMAA 1WM3A 1EUVB 2JZ3B 3VAWA 3T9LA 3R3MA 4K7WA 1U4AA 1T0YA 3ZW3A 1E7UA 3GOEA 3MHSD 1WZ0A 3ZNGC 3M95A 1EF5A 3TMPB 5TR5A 2A4ZA 1V80A 2DX5B 2IO2B 2RR9A 1YJ1A 4WWPA 2BKRB 3L08A 1WH3A 1EO6A 1WJNA 4GB9A 3QX1A 2C60A 1WGRA 2AEHA 4HDQA 4NNJB 5GMVA 1TGZB 1Z5SB 3DDCB 2L0FA 2DENB 2NBVB 2OOBB 4E71A 2LD9A 2Z0EB 2I1JA 4P7IA 2K8CA 3JW0X 3PGEA 3TL5A 1J0GA 2AL3A 1E8WA 5DCNA 2R2OA 2KC1A 4HVBA 1OEYA 1RLFA 4BKTA 4TQ0A 3PT2B 2M8SA 5AEKB 1E7VA 3H7PA 1LQBA 4PS3A 4EZKA 2MQJA 3VQIA 3B0AA 1UBQA 3ALBA 4DK5A 2WX1A 4FBJB 2GBRA 3SD5A 3PZDA 5JH5C 2REXA 1J8CA 3EHVA 1PQSA 3PREA 2KOXA 4ICVA 4GMVA 5AZGA 1P0RA 2JVCA 2LVQA 2N1VA 3KVFB 3HM3A 2DZKA 3RZFA 2XK5A 3AU4A 4GDKB 4KDLB 3SHQA 4ANVA 1S3SG 2KJRA 2PEAA 5KHQA 2O6VD 4ZDVA 3QA8A 2ASQA 4F8CB 4XC2A 1YIWA 3UINB 1Q5WB 1ISNA 3AU5A 4NAWB 1I35A 1GUAB 1P98A 5DPTA 1LXDA 3VDZA 1E5WA 4MSQB 1V49A 4MH0E 4AJYB 3DVGX 4PS8A 3V61A 3TCAA 5D7GA 1X1MA 4ZRKA 2L76A 3DPDA 3A33B 3OJ3A 3APFA 4HXDA 2KDEB 1WMHA 2L05A 4TUUA 2KMCA 2DZJA 3DVNU 3WA0A 2CU1A 2NS5A 3QIJA 4KSLC 3DOWA 4ZRIA 2YVCA 2LRWA 4A20A 4WJNA 3NHEB 2JZZA 4B95A 2D2QA 1XQQA 4BKSA 4A3OA 4JLCA 5D6JB 1WX8A 1SE9A 2K39A 4WJQA 3VH3B 1TTNA 5AZFA 1KOTA 3Q3FA 2N9PC 2AL6A 4HK2A 4K81A 2OJRA 4LCDE 5BO4B 2MRPA 3H7PB 3PLVA 3U7DA 4YL8A 1V5TA 3ZTDA 3L54A 1K8RB 3RULA 2D3GA 5C23A 2O6VB 3KYCD 2RPQA 4BKSD 1WZ3A 1WFYA 2Z59B 3UF8A 1WE7A 2FNJB 4IWPA 2KLGA 2CHXA 3JYUA 1LFDA 1P1AA 1EF1A 2JF5A 2G4DB 2JWZA 2MCNB 3QAQA 2WX0A 3VUXA 4DWFA 2K8BA 3EECA 2XK5B 1RRBA 2UWQA 5E6PA 3M63B 4DBGA 2KHWB 3W1YA 1KLVA 2ZPNA 3DBSA 2EMTA 2KVRA 2V1YA 3ZNZB 4ZYNA 3IHPC 2RSUA 3V6EB 4AJWA 5L83A 2ZEQA 4W9DA 2DYOA 5DPSA 2GBJA 2PE6B 3U8ZA 4NJ7A 2BGFA 3ZLZA 4EZLA 3RD2A 2J7QB 1WI0A 3IVFA 2C5LC 3SDLC 2ZCBA 2N9EB 3W1SC 2JRIB 3K9OB 3KH0A 1WMHB 4DHZE 2L7RA 4N9F4 3RT3B 2JUOA 3IG3A 4MGZE 4MELA 3P2BA 4LJPB 3QARA 1WJUA 1NI2A 3PRPB 1MG8A 3WANA 2DHZA 2KWVB 1IPGA 2L0TA 1GNUA 4F1SA 2NBUA 2HJ8A 1OEYJ 1Q0WB 1V2YA 3MTNB 3NS8A 1S1QB 2D10A 2WYQA 2IO3B 2BYEA 3BINA 3ZIMA 3WIMA 4RMAA 2KZRA 2IZVB 2BF8B 2Z0DB 3KUCB 1RAXA 1WJ6A 1A5RA 3A1QA 3UQBA 4FLHA 4KZCA 2MWSB 3ZRCA 2MBOA 3U30A 4EEWA 4JQWC 4E74A 1WIAA 3DQVA 2KWCA 3CMMB 3QCAA 4W9HA 2KDBA 2MX2A 3TBLD 3T8MA 3M3JA 2KANA 2FIDA 4RM8A 5G2NA 1IP9A 4JIOU 2FAZA 1CMXB 4LDTD 5HKHA 1OQYA 2M0XA 2V3SA 4KIKA 1V81A 2IBIB 2O6VA 4W9GA 3UIOB 2GBKA 4II2B 2KO3A 2JPHA 4A3PA 4HPMB 4DDGD 4KDIC 2KQSA 1Q1OA 1JRUA 1V86A 3K9PB 1NDDA 3BY4B 1YX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVO A;  2BYV E;  4FJV B;  3Q3J A;  1WYW B;  4GDL B;  4OVU A;  2LGD A;  2UYZ B;  4KV2 A;  2K6D B;  4MJS B;  3QJZ A;  4GOC A;  4DXA B;  2DYB A;  1WGD A;  4M0W B;  3ECI A;  2KJ6 A;  3KUZ A;  2DAF A;  2L00 B;  2N9X A;  4W9J A;  2KTR A;  3X0W A;  3A9J A;  4HJK A;  3ZRF A;  2DZI A;  3PHX B;  2LVP A;  1RFA A;  2KJH B;  4ANX A;  2KWU B;  5D2M B;  1ZW7 A;  2MBH A;  4FAD A;  3HK0 A;  4MGI E;  3JSV A;  3KYD D;  2DZM A;  5JHB A;  1WM2 A;  2MBE A;  1VCB A;  3AUL A;  2NBW B;  2IYD B;  4I6L B;  2BKF A;  2N7E A;  3B1L X;  4DHZ B;  4CHK A;  4HCP B;  4W9I A;  3AI5 A;  2L8J A;  2M1M A;  4DHJ D;  3KW5 B;  4TKN A;  4NQL B;  1D3Z A;  3VUW A;  3RCZ A;  3RUI B;  4KSK C;  2KN5 A;  4PYU A;  4LDT B;  1SIF A;  3S2A A;  3VXW A;  3ZDT A;  3TJP A;  3R66 C;  3A1Q B;  2LGX A;  1WGH A;  4HWI B;  3ZDM C;  1TBE A;  1R4N I;  1WR6 E;  1P9D U;  4ANU A;  2O2V A;  4II3 B;  5G55 A;  1XD3 B;  2GOW A;  3VFK A;  2RD0 A;  5IAA C;  1HE8 A;  3APD A;  3PV1 A;  3SU8 X;  3ML9 A;  2QHO A;  2C7H A;  3DBR I;  4IWQ A;  3GZN I;  2K8H A;  2D07 B;  3L0W B;  4G50 A;  4TV3 A;  2BWE S;  2WWZ A;  2M17 A;  1GC6 A;  5CHF A;  5J2R A;  4KIK B;  2WDT B;  3OLM D;  1I42 A;  2PJH A;  4HCN B;  1Z2M A;  3A9K A;  3ZO5 B;  2LWP A;  4I6P A;  1UGM A;  1XT9 B;  1R4M I;  5D94 A;  4W9L A;  4CYE A;  2C7M B;  1UH6 A;  2PE9 A;  4GU2 A;  2L3Z A;  4GN1 A;  2KQ7 A;  3L17 A;  1BT0 A;  1P3Q U;  3IFW B;  5C1Z A;  1E8X A;  3QQ8 B;  1GG3 A;  3APC A;  3PLU A;  3PS6 A;  3WAO A;  2C7N B;  3H6N A;  3QHT A;  3W1S A;  3WAL A;  3ZVV A;  2IY0 B;  2K1F A;  5EDS A;  1WE6 A;  1KJT A;  2KK8 A;  2BYF A;  4BKG A;  4URK A;  3PRM B;  2KTR B;  1L7Y A;  3A9J B;  4M8M A;  5E6N A;  4DHJ B;  2MSE D;  4PS7 A;  2NR2 A;  4ASW C;  3NZS A;  4NY0 A;  2XBB C;  2MLB A;  3PTF C;  3RZW C;  4GDL A;  1WR1 A;  2GBM A;  3ONS A;  3AXC A;  4W9E A;  4MJS A;  4GXB A;  2G45 B;  2N4F A;  2N7D A;  2KD0 A;  3CF6 E;  3JSV B;  4ZRJ A;  2HD5 B;  3UGB B;  2DAJ A;  1M94 A;  2KTF A;  3NY5 A;  2KDI A;  4I6N B;  3TIX A;  4W9F A;  1FXT B;  2LI5 A;  4NJ6 A;  4NQK E;  5LLI A;  3I3T B;  1E8Z A;  2LUE A;  2KXJ A;  1V9J A;  3O65 B;  3L16 A;  1L2N A;  2G3Q B;  1E8Y A;  2CKH B;  4FHK A;  4JGH B;  3B08 A;  2JRH A;  2O2V B;  4E3C A;  1WXV A;  4GGQ A;  1E90 A;  5IA7 A;  3N30 A;  2KKC A;  1YQB A;  3R7Q A;  1UD7 A;  3PSE B;  5KHO A;  4FN2 A;  4BFR A;  2XEW A;  2GBN A;  4LJO B;  5CHW A;  2NVU I;  1YX6 B;  4RM9 A;  3V60 A;  3PPA A;  2KC2 A;  4M8N A;  4K1R B;  5FR6 A;  2ZNV C;  2FCS A;  3VVW B;  2GMI C;  3A9K B;  1H8C A;  2EMS A;  2JT4 B;  3UQA A;  2AWT A;  4EFO A;  2CR5 A;  3CSF A;  5LXI B;  3LJ3 A;  2EKE C;  1G6J A;  4EOY A;  4EUT A;  3DVN V;  4MEM A;  4B6W A;  5JHA A;  1C1Y B;  2KFJ A;  3LDZ E;  3RYT A;  4F7Z A;  2CHZ A;  2RGF A;  3C0R B;  2BWF A;  4DDI D;  2MBB B;  1AAR A;  4WQO B;  2PPH A;  1C3T A;  3DBH I;  3VTU A;  4HLE A;  2IY1 B;  5J17 A;  4IUM B;  5DPW A;  4IM0 A;  3R7R A;  4AWJ A;  3L13 A;  2KDF B;  3H1U A;  1Y8R C;  4AUQ C;  2KX0 A;  4IC7 B;  4MGY E;  3HHM A;  3EC8 A;  4G3X B;  1V5O A;  2HE7 A;  3EFU A;  5LXH A;  1GJZ A;  2NCN A;  3UIP B;  3DBL I;  4AOF A;  1QZE A;  3NZU A;  4G11 A;  2IO0 B;  2CHW A;  1H4R A;  4EKU A;  2MA9 B;  2K6Q A;  3QC8 B;  2KLC A;  2ZNV B;  4FJY A;  4WJO A;  2KFK A;  4WAA A;  4FHJ A;  3WAM A;  5DPR A;  3A4R A;  2FUH B;  1WXS A;  2ZJD A;  1VD2 A;  4J6I A;  4FUL A;  4ANW A;  4CO7 A;  2AYO B;  4WWN A;  1ZGU B;  3ML8 A;  1WXA A;  1GC7 A;  4IG7 B;  1KM7 A;  2FCN A;  2B3A A;  3OJ4 B;  4IM3 A;  2KX3 A;  2FCM A;  2LZ6 A;  2IO1 B;  4MGK E;  4PYZ A;  4BOS C;  2MP2 A;  2NPT A;  5L95 C;  2J0K A;  2KNB A;  2LRU A;  1WX7 A;  3VHT C;  3VTV A;  5JZE B;  4K7U A;  2CS4 A;  3V6C B;  1WX9 A;  4B9K A;  2MW5 A;  4W9C A;  4XX5 A;  1WY8 A;  3D32 A;  3HM6 X;  1F9J A;  1WJ4 A;  2A5U A;  1SGH A;  2G4S A;  5AZH A;  2N1W A;  3OAW A;  3M62 B;  1LM8 B;  4BVU C;  2FIF A;  3PHW B;  1NBF C;  3WAP A;  2BPS A;  4FJZ A;  4BBN F;  3H9D A;  3X23 A;  5CHV C;  4JL9 A;  1V6E A;  4GIV A;  2VRR B;  4MDK E;  3DVG Y;  3ENE A;  4IWO A;  5CX3 A;  2LGY A;  4KZ0 A;  2I1K A;  2V4L A;  3L10 B;  2LJ5 A;  4AP4 C;  1YD8 U;  4FA6 A;  4K7S A;  3NOB A;  2JY6 A;  1ZKH A;  3VUY A;  2Y5B B;  2J0J A;  2YLM A;  4X57 B;  3ZTC A;  4MSM B;  3VH4 B;  3ZNH B;  3QWZ B;  4NPN A;  2D11 A;  4BOZ B;  1WF9 A;  3H7S A;  1WXM A;  3V62 A;  4IW0 A;  3ZKJ C;  2ZZP B;  1WGG A;  2M4N A;  3PRZ A;  4HPL B;  3A4S C;  3N32 A;  2ZVN A;  2KFK B;  4HDO A;  1WRD B;  3N3K B;  4MM3 A;  2ZVO A;  3PVL A;  1TZ1 A;  3CST A;  4WJP A;  4IM2 A;  3VTW A;  4EZJ A;  4XZ4 A;  3ZNI D;  3MJW A;  1WGY A;  1OGW A;  2ZCC A;  4GSW A;  4W9K A;  3HIZ A;  3QK0 A;  4G0N B;  1UEL A;  2FCQ A;  5E6O A;  1UZX B;  5CTR C;  2R2Q A;  4WWO A;  2C9W B;  2K25 A;  4KVG B;  1IYF A;  4OVV A;  3ZUN A;  2MBQ A;  2MP2 B;  2NPT B;  2LXC A;  3JVZ X;  4GDK A;  4ICU A;  4BBN C;  2J0M A;  2ZPY A;  1OTR B;  3IBE A;  2LXA A;  3KUD B;  5J18 A;  4TQ1 A;  2HTH A;  1J19 A;  2LAS A;  2JXX A;  3DCG A;  1UBI A;  4NAW A;  2W9N A;  2DYM A;  2KMA A;  1WM3 A;  1EUV B;  2JZ3 B;  3VAW A;  3T9L A;  3R3M A;  4K7W A;  1U4A A;  1T0Y A;  3ZW3 A;  1E7U A;  3GOE A;  3MHS D;  1WZ0 A;  3ZNG C;  3M95 A;  1EF5 A;  3TMP B;  5TR5 A;  2A4Z A;  1V80 A;  2DX5 B;  2IO2 B;  2RR9 A;  1YJ1 A;  4WWP A;  2BKR B;  3L08 A;  1WH3 A;  1EO6 A;  1WJN A;  4GB9 A;  3QX1 A;  2C60 A;  1WGR A;  2AEH A;  4HDQ A;  4NNJ B;  5GMV A;  1TGZ B;  1Z5S B;  3DDC B;  2L0F A;  2DEN B;  2NBV B;  2OOB B;  4E71 A;  2LD9 A;  2Z0E B;  2I1J A;  4P7I A;  2K8C A;  3JW0 X;  3PGE A;  3TL5 A;  1J0G A;  2AL3 A;  1E8W A;  5DCN A;  2R2O A;  2KC1 A;  4HVB A;  1OEY A;  1RLF A;  4BKT A;  4TQ0 A;  3PT2 B;  2M8S A;  5AEK B;  1E7V A;  3H7P A;  1LQB A;  4PS3 A;  4EZK A;  2MQJ A;  3VQI A;  3B0A A;  1UBQ A;  3ALB A;  4DK5 A;  2WX1 A;  4FBJ B;  2GBR A;  3SD5 A;  3PZD A;  5JH5 C;  2REX A;  1J8C A;  3EHV A;  1PQS A;  3PRE A;  2KOX A;  4ICV A;  4GMV A;  5AZG A;  1P0R A;  2JVC A;  2LVQ A;  2N1V A;  3KVF B;  3HM3 A;  2DZK A;  3RZF A;  2XK5 A;  3AU4 A;  4GDK B;  4KDL B;  3SHQ A;  4ANV A;  1S3S G;  2KJR A;  2PEA A;  5KHQ A;  2O6V D;  4ZDV A;  3QA8 A;  2ASQ A;  4F8C B;  4XC2 A;  1YIW A;  3UIN B;  1Q5W B;  1ISN A;  3AU5 A;  4NAW B;  1I35 A;  1GUA B;  1P98 A;  5DPT A;  1LXD A;  3VDZ A;  1E5W A;  4MSQ B;  1V49 A;  4MH0 E;  4AJY B;  3DVG X;  4PS8 A;  3V61 A;  3TCA A;  5D7G A;  1X1M A;  4ZRK A;  2L76 A;  3DPD A;  3A33 B;  3OJ3 A;  3APF A;  4HXD A;  2KDE B;  1WMH A;  2L05 A;  4TUU A;  2KMC A;  2DZJ A;  3DVN U;  3WA0 A;  2CU1 A;  2NS5 A;  3QIJ A;  4KSL C;  3DOW A;  4ZRI A;  2YVC A;  2LRW A;  4A20 A;  4WJN A;  3NHE B;  2JZZ A;  4B95 A;  2D2Q A;  1XQQ A;  4BKS A;  4A3O A;  4JLC A;  5D6J B;  1WX8 A;  1SE9 A;  2K39 A;  4WJQ A;  3VH3 B;  1TTN A;  5AZF A;  1KOT A;  3Q3F A;  2N9P C;  2AL6 A;  4HK2 A;  4K81 A;  2OJR A;  4LCD E;  5BO4 B;  2MRP A;  3H7P B;  3PLV A;  3U7D A;  4YL8 A;  1V5T A;  3ZTD A;  3L54 A;  1K8R B;  3RUL A;  2D3G A;  5C23 A;  2O6V B;  3KYC D;  2RPQ A;  4BKS D;  1WZ3 A;  1WFY A;  2Z59 B;  3UF8 A;  1WE7 A;  2FNJ B;  4IWP A;  2KLG A;  2CHX A;  3JYU A;  1LFD A;  1P1A A;  1EF1 A;  2JF5 A;  2G4D B;  2JWZ A;  2MCN B;  3QAQ A;  2WX0 A;  3VUX A;  4DWF A;  2K8B A;  3EEC A;  2XK5 B;  1RRB A;  2UWQ A;  5E6P A;  3M63 B;  4DBG A;  2KHW B;  3W1Y A;  1KLV A;  2ZPN A;  3DBS A;  2EMT A;  2KVR A;  2V1Y A;  3ZNZ B;  4ZYN A;  3IHP C;  2RSU A;  3V6E B;  4AJW A;  5L83 A;  2ZEQ A;  4W9D A;  2DYO A;  5DPS A;  2GBJ A;  2PE6 B;  3U8Z A;  4NJ7 A;  2BGF A;  3ZLZ A;  4EZL A;  3RD2 A;  2J7Q B;  1WI0 A;  3IVF A;  2C5L C;  3SDL C;  2ZCB A;  2N9E B;  3W1S C;  2JRI B;  3K9O B;  3KH0 A;  1WMH B;  4DHZ E;  2L7R A;  4N9F 4;  3RT3 B;  2JUO A;  3IG3 A;  4MGZ E;  4MEL A;  3P2B A;  4LJP B;  3QAR A;  1WJU A;  1NI2 A;  3PRP B;  1MG8 A;  3WAN A;  2DHZ A;  2KWV B;  1IPG A;  2L0T A;  1GNU A;  4F1S A;  2NBU A;  2HJ8 A;  1OEY J;  1Q0W B;  1V2Y A;  3MTN B;  3NS8 A;  1S1Q B;  2D10 A;  2WYQ A;  2IO3 B;  2BYE A;  3BIN A;  3ZIM A;  3WIM A;  4RMA A;  2KZR A;  2IZV B;  2BF8 B;  2Z0D B;  3KUC B;  1RAX A;  1WJ6 A;  1A5R A;  3A1Q A;  3UQB A;  4FLH A;  4KZC A;  2MWS B;  3ZRC A;  2MBO A;  3U30 A;  4EEW A;  4JQW C;  4E74 A;  1WIA A;  3DQV A;  2KWC A;  3CMM B;  3QCA A;  4W9H A;  2KDB A;  2MX2 A;  3TBL D;  3T8M A;  3M3J A;  2KAN A;  2FID A;  4RM8 A;  5G2N A;  1IP9 A;  4JIO U;  2FAZ A;  1CMX B;  4LDT D;  5HKH A;  1OQY A;  2M0X A;  2V3S A;  4KIK A;  1V81 A;  2IBI B;  2O6V A;  4W9G A;  3UIO B;  2GBK A;  4II2 B;  2KO3 A;  2JPH A;  4A3P A;  4HPM B;  4DDG D;  4KDI C;  2KQS A;  1Q1O A;  1JRU A;  1V86 A;  3K9P B;  1NDD A;  3BY4 B;  1YX5 B; 
#chains in the Genus database with same CATH topology
 1L0Y B;  1D5X C;  1JCK B;  4KV2 A;  2QDF A;  2K6D B;  4MJS B;  4GOC A;  1ESF A;  4DXA B;  1WGD A;  2KJ6 A;  3MJ5 A;  4W9J A;  2VH2 A;  3Q6B A;  2KT7 A;  2KTR A;  3OWE B;  2LVP A;  1RFA A;  4ANX A;  2KWU B;  5D2M B;  2MBH A;  3HK0 A;  3KYD D;  5JHB A;  4WUR A;  2MBE A;  2NBW B;  1PGA A;  4HCP B;  3I5J C;  3AI5 A;  2M1M A;  2WXH A;  4DHJ D;  2JYT A;  4NQL B;  2PVG C;  3VUW A;  1GPX A;  2KN5 A;  1SIF A;  3R66 C;  3ZDM C;  1TBE A;  1R4N I;  3BVZ A;  3AEC B;  2GOW A;  3HUI A;  5HG2 A;  3RNF C;  4YSZ B;  1HE8 A;  1ZXI A;  2C7H A;  3L0W B;  1ZXH A;  4IKG A;  2WDT B;  3ETR A;  1FFU A;  3OLM D;  4LNK A;  4J3O D;  5D94 A;  2KQ7 A;  1BT0 A;  3IFW B;  5C1Z A;  1E8X A;  1F0Z A;  2N0S B;  3PS6 A;  2JQR B;  3WAO A;  2C7N B;  5EDS A;  5T8I A;  3ZVV A;  2K1F A;  2JU6 X;  1WE6 A;  1D4B A;  4BKG A;  4URK A;  3PRM B;  2EEL A;  2KTR B;  5E6N A;  3I57 A;  4NY0 A;  4K3C A;  4BAX A;  2MLB A;  2QIE B;  1WR1 A;  2GBM A;  1B1Z A;  4W9E A;  2N4F A;  2J53 A;  4REZ A;  2IND C;  2LI5 A;  2E3T A;  5LLI A;  3W5U B;  1E8Z A;  1ET9 A;  4USA A;  1SE4 A;  2CKH B;  4C00 A;  3B08 A;  3DBH B;  1WXV A;  5IP4 D;  1UWM A;  2AQ3 B;  2JWU A;  2KKC A;  3AE9 B;  5AUI A;  1YJJ A;  2GBN A;  5CHW A;  3SEB A;  1Q10 A;  5BYR A;  3AE2 B;  3VVW B;  2GMI C;  4KKJ A;  1JWS D;  1F2R C;  2JT4 B;  2LUM A;  1TS4 A;  3UQA A;  2CR5 A;  5LXI B;  2WXN A;  5IO9 A;  3NVV A;  3AEE B;  4MEM A;  4RNA A;  3RYT A;  3BYT B;  2BWF A;  3MFG A;  3B2G A;  2PPH A;  2XN9 C;  2JZP A;  4HLE A;  5J17 A;  5FK9 C;  1QKZ A;  1YQ4 B;  5FKA C;  1TS5 A;  4AWJ A;  1WWT A;  1XLO A;  4AUQ C;  3PZ7 A;  3EC8 A;  4G3X B;  2HE7 A;  5LXH A;  3EFU A;  2WXI A;  1TZO A;  1JRP A;  3P63 A;  1XLQ A;  4AOF A;  2ONQ A;  3NZU A;  3TEX A;  2MJE A;  3CWI A;  3I63 C;  5BMI A;  3QC8 B;  3B2F A;  4FJY A;  4US9 A;  2KFK A;  4L23 A;  2K0P A;  2MH7 A;  1V1O A;  4CO7 A;  4WWN A;  1ZGU B;  3ML8 A;  1GC7 A;  4IM3 A;  4PYZ A;  2KX3 A;  5L95 C;  2LZ6 A;  3FIL A;  4A8X C;  3VHT C;  5IN7 A;  3ZYY X;  4LNF A;  2LGS A;  4W9C A;  4C4V A;  1WY8 A;  3BK2 A;  4P16 A;  1WJ4 A;  3U2S C;  2N1W A;  3PO0 A;  1LM8 B;  2BPS A;  4FJZ A;  3NZ3 A;  2WU2 B;  3DVG Y;  1J7C A;  4KZ0 A;  3BK1 A;  2RDB C;  3RNE C;  2J0J A;  2ZW0 A;  3QWZ B;  2KQ4 X;  3V62 A;  1WXM A;  5G5H A;  2ZZP B;  3PRZ A;  3RNA C;  3A4S C;  3N32 A;  2ZVN A;  2KFK B;  4HDO A;  2IJ0 A;  4NZL B;  2ZVO A;  3CST A;  4EZJ A;  1WGY A;  2FCQ A;  5E6O A;  1FD6 A;  3N20 C;  2C9W B;  4ICU A;  2J0M A;  2ZPY A;  1OTR B;  3FIL B;  3KUD B;  2K5P A;  1J19 A;  2LAS A;  3TEY A;  3DCG A;  4C4V B;  3BII D;  1QOA A;  2KMA A;  1WM3 A;  1FEH A;  4K7W A;  3MHS D;  1WZ0 A;  2QMT A;  3TMP B;  2BS3 B;  3NVY A;  1IUE A;  1TYG B;  3ZJV A;  3P42 A;  3P4Q B;  1XF5 L;  2IGG A;  3L08 A;  1WJN A;  4GB9 A;  4OVZ A;  4NNJ B;  1V8C A;  4H2A A;  2L0F A;  1QT9 A;  3FAH A;  3JW0 X;  1E8W A;  1XO3 A;  4ZYS A;  4HVB A;  1RLF A;  1MI0 A;  5BMH A;  5H92 C;  5AUK A;  3VQI A;  1N63 A;  2UU7 A;  2L1A A;  2GBR A;  3SD5 A;  2REX A;  1C4C A;  1QF6 A;  3PRE A;  1FMA D;  4GMV A;  2LVQ A;  1PGX A;  4FXC A;  2XK5 A;  4KDL B;  4PK1 A;  5FR3 A;  4LNN A;  1T6B X;  3UIN B;  4S0R A;  2KMM A;  3AU5 A;  1GUA B;  2JSV X;  3DVG X;  3V61 A;  3TCA A;  5D7G A;  2WXF A;  2L76 A;  3DPD A;  2WDR B;  2LMC A;  3A33 B;  3Q8C A;  3WA0 A;  2CU1 A;  4KSL C;  3DOW A;  2YVC A;  3DHH C;  1SJE D;  1UNS A;  3NHE B;  4BKS A;  4JLC A;  5D6J B;  1SE9 A;  2BBC A;  2W3R A;  3Q3F A;  4LTU A;  2MRP A;  3NVZ A;  4ZHP A;  3L54 A;  2AX5 A;  4AS1 A;  3RUL A;  3KYC D;  4IWP A;  3JYU A;  4JPS A;  2NMQ A;  2JWZ A;  2WX0 A;  3MC8 A;  4DWF A;  2XK5 B;  3EFC A;  3M63 B;  1L4Z B;  3I9V 1;  1FNV A;  3DBS A;  1N5X A;  5LNK 1;  5L83 A;  2ZEQ A;  2DYO A;  5DPS A;  2PE6 B;  2DLB A;  3Q69 A;  3U8Z A;  2BGF A;  3ZLZ A;  2W55 A;  2ZCB A;  2WXR A;  1TJE A;  1V97 A;  2Q5W D;  3MP9 A;  1FRD A;  1QOB A;  3RNG C;  1MG8 A;  3WAN A;  2DHZ A;  2QC8 A;  1IPG A;  2HJ8 A;  1OEY J;  1Q0W B;  1V2Y A;  1L5P A;  1S1Q B;  3LB8 C;  2BYE A;  5JXV A;  3NG0 A;  4KZC A;  3SFD B;  3TEW A;  2MBO A;  1TY2 A;  1AWD A;  2KWC A;  2BQQ A;  2DBY A;  2KAN A;  2FID A;  5G2N A;  1IP9 A;  4M02 A;  2I38 A;  4DXF A;  1MPE A;  4RH6 A;  1K50 A;  3PZ8 A;  2HTM E;  2BB6 A;  2KO3 A;  4HPM B;  1Q1O A;  1JRU A;  1V86 A;  3BY4 B;  3MC9 A;  1E0Z A;  1WYW B;  2LGD A;  1R4N B;  1SB3 C;  2DYB A;  2DAF A;  2N9X A;  3A9J A;  2CJO A;  1VCB A;  2BYT A;  2IYD B;  2BTE A;  2BKF A;  2N7E A;  2V3N A;  3B1L X;  4W9I A;  3NUH B;  1SIJ A;  4TKN A;  2IPK D;  1D3Z A;  3RCZ A;  1L6U A;  4KSK C;  3BVM A;  3ZDT A;  3S2A A;  3TJP A;  3TSS A;  2WS3 B;  4XYC A;  1WR6 E;  3HVD A;  1L4D B;  4II3 B;  1XD3 B;  3PV1 A;  1FFV A;  3ML9 A;  2LHE A;  2QHO A;  3GZN I;  2D07 B;  4TV3 A;  2WWZ A;  5CHF A;  1GC6 A;  3Q3N C;  5J2R A;  1Z2M A;  2GLS A;  2BW2 A;  1XT9 B;  2C7M B;  3L17 A;  5D3D A;  2WDV B;  3OG5 A;  3WAL A;  4AQ7 A;  2N9K A;  2E6X A;  4MT5 A;  3FC4 A;  3A9J B;  2L32 A;  2NR2 A;  4ASW C;  2XBB C;  4RGT A;  3GP7 A;  4MJS A;  2HJ1 A;  3UGB B;  2DAJ A;  1M94 A;  2KDI A;  3TIX A;  1FXT B;  4NJ6 A;  3RNB C;  1C77 A;  2KXJ A;  4B0E A;  1V9J A;  1L2N A;  2G3Q B;  1E8Y A;  3URY A;  5IKC M;  1F52 A;  4FHK A;  3T3O A;  3N30 A;  1YQB A;  1JWA D;  1I4Q A;  4GLS C;  2NVU I;  3N1X C;  3PPA A;  2FCS A;  2EMS A;  1STE A;  4XGA B;  2OED A;  4EUT A;  4XWW A;  5JHA A;  1C1Y B;  1JAL A;  2RGF A;  1QOG A;  2M19 A;  1MG4 A;  4WQM A;  1AAR A;  4ZOH C;  3IT6 B;  4IM0 A;  1B9R A;  3L13 A;  2GRI A;  2KDF B;  4HKZ E;  4MGY E;  1XLP A;  3DHI C;  1GJZ A;  3UIP B;  1Y56 A;  3DBL I;  5BYQ A;  4G11 A;  2IO0 B;  4YWG G;  2CHW A;  5BYS A;  4HJG E;  2MA9 B;  3RMK C;  2ZNV B;  1FCL A;  4C80 A;  3U4E G;  1WXQ A;  1I4H A;  2CU3 A;  2FCN A;  2W3S A;  3OJ4 B;  2MP2 A;  1VZ8 A;  1F1H A;  3RPF C;  2CS4 A;  1OQR A;  2QJL A;  4XX5 A;  2N9L A;  3HM6 X;  1F9J A;  3NVW A;  3EA6 A;  2KDM A;  1SE2 A;  4OZC A;  2H88 B;  5G5G A;  3WAP A;  4JL9 A;  2IGH A;  5CX3 A;  2I1K A;  1YD8 U;  3NS1 A;  4K7S A;  4FA6 A;  4HRS A;  3AEG B;  3ZNH B;  2MJ3 A;  4D2K A;  1WF9 A;  4ACF A;  3ZKJ C;  4HPL B;  3EGR A;  3GB1 A;  4LK0 M;  4MM3 A;  5EE3 A;  1TZ1 A;  3VTW A;  2ZCC A;  3IAM 1;  3HIZ A;  3QK0 A;  2G9H D;  1UZX B;  2R2Q A;  3DHG C;  2MBQ A;  2MP2 B;  3JVZ X;  3BZD B;  4GDK A;  1TS2 A;  3IBE A;  4HPP A;  4TQ1 A;  2W82 A;  2J42 A;  2GI9 A;  1EWC A;  3VAW A;  3SR6 A;  3T9L A;  4NAM A;  1U4A A;  3ZW3 A;  3B9J A;  1E7U A;  1TKG A;  3M95 A;  5TR5 A;  5HFY A;  2DX5 B;  1KTK A;  4WWP A;  1EO6 A;  3QX1 A;  2C60 A;  4DXG A;  3DDC B;  3TEZ A;  4PT5 A;  3VR8 B;  2I1J A;  3PGE A;  2D3C A;  3TL5 A;  1J0G A;  1FNU A;  1OEY A;  2M8S A;  2BVC A;  1DYQ A;  1PFD A;  4PS3 A;  4EZK A;  2MQJ A;  2PTL A;  1V1P A;  4MM3 B;  1GB4 A;  3B0A A;  4N58 A;  3Q14 C;  4DK5 A;  3Q8E A;  4FBJ B;  1VJK A;  1J8C A;  2NTS A;  3Q8A A;  2KOX A;  4ICV A;  4GDK B;  1WRI A;  5KHQ A;  2PEA A;  2KJR A;  3UI3 A;  4ZDV A;  3RFZ B;  3AE3 B;  4XC2 A;  1I7H A;  1P98 A;  3VDZ A;  1LXD A;  5IOI A;  1CK1 A;  1V49 A;  5TSS A;  1ENF A;  1I4P A;  3W2D A;  3DVN U;  4ZRI A;  4A6Q A;  4WJN A;  4WIP A;  3P4P B;  2J4X A;  4A3O A;  4HEA 1;  1RYJ A;  1VLB A;  2K39 A;  5AZF A;  4HK2 A;  2CJN A;  4LCD E;  4DQO C;  2PW9 A;  2GB1 A;  3DWM A;  3ZTD A;  1NVI D;  1K8R B;  1V1P B;  2O6V B;  4BKS D;  3VRB B;  2MEK A;  1QLB B;  1FRR A;  2Z59 B;  3UF8 A;  2DNF A;  2CHX A;  4L2Y A;  1P1A A;  1EF1 A;  2QIL A;  2G4D B;  2MCN B;  3QAQ A;  2K8B A;  3EEC A;  1RRB A;  2RDG A;  3N9Y C;  3SFE B;  1WYG A;  1JWM D;  1K52 A;  3AE4 B;  4ZYN A;  2KN4 A;  2RSU A;  2WXP A;  1SEB D;  4AJW A;  3ZXV A;  2FBW B;  4EZL A;  2J7Q B;  2C5L C;  3SDL C;  3BVG A;  2N9E B;  3W1S C;  1YJI A;  2L7R A;  4N9F 4;  3RT3 B;  4OZA A;  4ZRQ A;  3P2B A;  3ZQ4 A;  1D6E C;  3QAR A;  2Y5C A;  1LO5 D;  1ZPS A;  2NBU A;  1RFK A;  2WNM A;  2H89 B;  3BIN A;  4RMA A;  2KZR A;  1HZ6 A;  3GE3 C;  3KUC B;  3GE8 C;  3ZRC A;  3AE5 B;  2K9X A;  4E74 A;  3DQV A;  3CMM B;  3QCA A;  4W9H A;  3TBL D;  2KDB A;  2MX2 A;  4YSX B;  3M3J A;  3N1Z C;  2WXQ A;  3AEB B;  3HVZ A;  5HKH A;  2IBI B;  3GS2 A;  4II2 B;  2JPH A;  4DDG D;  3K9P B;  1NDD A;  3ZJU A;  2PLP A;  2BYV E;  4FJV B;  4GDL B;  2UYZ B;  2D5G A;  1D5M C;  3P4R B;  3KUZ A;  2VH1 A;  1T5X D;  2WXK A;  3X0W A;  4HJK A;  1KFY B;  3GZN B;  3PHX B;  3BWU D;  1ZW7 A;  4FAD A;  4Q2J A;  3N1Y C;  1FXA A;  1AW7 A;  1WM2 A;  4OHJ A;  2WXG A;  1IGC A;  4N59 A;  2L8J A;  3KW5 B;  4LDT B;  3VXW A;  1NI3 A;  4HKQ A;  4HWI B;  1P9D U;  2WQY B;  2O2V A;  3VFK A;  5IAA C;  3APD A;  4ARI A;  3SU8 X;  3AH7 A;  2ZW1 A;  3DBR I;  4IWQ A;  1KH0 A;  2K8H A;  4G50 A;  4C7Z A;  1LGR A;  2BWE S;  2M17 A;  1I4G A;  1NYQ A;  1I42 A;  2PJH A;  2K3U A;  1R4M I;  4W9L A;  4CYE A;  4M00 A;  4GU2 A;  1JWB D;  1P7E A;  2L3Z A;  1P3Q U;  1K53 A;  3AEA B;  3QQ8 B;  1GG3 A;  3APC A;  1KLU D;  3PLU A;  4K3B A;  3W1S A;  4US8 A;  1KJT A;  2BYF A;  4UDU C;  4M8M A;  2BT6 A;  2MSE D;  3NZS A;  2SAK A;  3BYY B;  3AXC A;  3ONS A;  4GXB A;  2G45 B;  2KD0 A;  3CF6 E;  4RGM A;  2HD5 B;  5BMG A;  1SE3 A;  4I6N B;  2X8X X;  4NQK E;  1T0Q C;  1RM6 C;  3IAS 1;  1SBB B;  3I3T B;  2LUE A;  3IXS A;  1MHH E;  1DGJ A;  2O2V B;  1QOF A;  3R7Q A;  1UD7 A;  1I4X A;  4FN2 A;  2XEW A;  4LJO B;  1YX6 B;  1BUI C;  2ZNV C;  4YTP B;  2AWT A;  4EFO A;  3DBL B;  5HI1 A;  3CSF A;  2EKE C;  3P4S B;  1G6J A;  4B6W A;  2KFJ A;  3LDZ E;  1YNT E;  4RFB A;  5E6J A;  2WU5 B;  1GAQ B;  4WQO B;  1C3T A;  3W9C B;  3VTU A;  1K51 A;  1ACC A;  5DPW A;  2LJI A;  1UWX A;  1FIQ A;  2MHJ A;  4LLG M;  1Y8R C;  1C79 A;  1NEK B;  5D3I B;  4IC7 B;  1V5O A;  4JWU C;  5HHD G;  1QZE A;  1H4R A;  4A90 A;  2LFI A;  2K6Q A;  2KLC A;  3AV8 A;  4FHJ A;  4ZRP A;  1ZDX A;  1VZ6 A;  3WAM A;  5DPR A;  3R2I A;  3A4R A;  3KWL A;  2ZJD A;  4JX1 C;  4FUL A;  1XEE A;  1KRH A;  2AYO B;  1XCT L;  4WWM A;  3RNC C;  1WXA A;  4IG7 B;  2QSD A;  2B3A A;  4MGK E;  2IO1 B;  2J0K A;  2KNB A;  1WX7 A;  2KVZ A;  3AM9 A;  4K7U A;  3V6C B;  2MW5 A;  3D32 A;  1E7P B;  1SGH A;  2BS4 B;  1HEZ E;  4BVU C;  1F2R I;  3PHW B;  1V6E A;  4GIV A;  4CQN A;  2VRR B;  1BXT A;  1CZP A;  2LGY A;  2V4L A;  3L10 B;  3LYY A;  2LJ5 A;  4AP4 C;  1JWU D;  2JY6 A;  1ZKH A;  3VUY A;  2VZK B;  2Y5B B;  4X57 B;  1CJE A;  4RF1 A;  1JW9 D;  1SJH D;  2D11 A;  3H7S A;  1YQ3 B;  4IW0 A;  3MHZ A;  2B76 B;  4YTN B;  1JRO A;  2PMV A;  2SEB D;  1WRD B;  3N3K B;  3PVL A;  4WJP A;  1YN4 A;  2RMM A;  4XZ4 A;  1OGW A;  4GSW A;  4W9K A;  4G0N B;  1UEL A;  5CTR C;  4KVG B;  3KLS X;  1T0S C;  4IOI E;  1ZOY B;  2LXC A;  5J18 A;  4QAY A;  2HTH A;  1L0X B;  1UBI A;  2W9N A;  4ARC A;  1EUV B;  2JZ3 B;  4KGR A;  1T0Y A;  3W5V B;  2KWD A;  3RN9 C;  2A4Z A;  1V80 A;  2RR9 A;  2RDH A;  1WH3 A;  2Z8L A;  2RPV A;  1WGR A;  2AEH A;  4HDQ A;  5GMV A;  1TGZ B;  1Z5S B;  2OOB B;  2LD9 A;  2Z0E B;  2KC1 A;  1E7V A;  3H7P A;  1M4V A;  3U52 E;  3AED B;  2QEJ C;  3ALB A;  1N60 A;  2WX1 A;  3C8Y A;  3PZD A;  3EHV A;  1PQS A;  1MFW A;  2JVC A;  3AE1 B;  2N1V A;  3KVF B;  1VR9 A;  4OW0 A;  3C19 A;  5MPO A;  4RCO A;  1S3S G;  1XLN A;  1N5W A;  2O6V D;  3QA8 A;  3TUO A;  1UUP A;  2M0A A;  1ZDV A;  1ISN A;  2J52 A;  5DPT A;  3AE7 B;  4LNO A;  4AJY B;  4PS8 A;  1EU3 A;  4HXD A;  3CIR B;  1WMH A;  2L05 A;  4TUU A;  3FKY A;  2PVO D;  1AN8 A;  3ZXR A;  3R2T A;  2DZJ A;  2NS5 A;  1JML A;  4WH4 A;  1E9M A;  2JZZ A;  1XQQ A;  3WCQ A;  4WJQ A;  1T3Q A;  2N9P C;  4K81 A;  2OJR A;  3H7P B;  2FUG 1;  2ICI A;  3AEF B;  3PLV A;  2V9H A;  1KLG D;  5C23 A;  2IDY A;  1ZUD 2;  1WE7 A;  3L4P A;  2KLG A;  2AQ2 B;  2EKI A;  3R8B A;  1LFD A;  1XXG A;  3AB5 A;  3VUX A;  3KWV A;  2UWQ A;  4XDD A;  1N6Z A;  4DBG A;  1KLV A;  3W1Y A;  2KVR A;  2V1Y A;  1R7S A;  4TSS A;  4W9D A;  2GBJ A;  4NJ7 A;  2KAJ A;  1WI0 A;  1FCC C;  4M0W A;  4MH8 A;  2JRI B;  3K9O B;  3KH0 A;  5GXG B;  1WMH B;  4DHZ E;  4MGZ E;  4KGT A;  4LJP B;  4XDC A;  1WJU A;  1NI2 A;  1QQR A;  4BZA A;  3PRP B;  1VRA B;  2KWV B;  1SXT A;  2BB5 A;  4F1S A;  1XCQ L;  3NS8 A;  5EE1 A;  2IO3 B;  1N62 A;  3WIM A;  2IZV B;  2QCZ A;  2Z0D B;  1CQV A;  1A5R A;  1RAX A;  3A1Q A;  4FLH A;  1TKE A;  3U30 A;  1WIA A;  4JIO U;  2FAZ A;  2WXJ A;  1HZ5 A;  3ZJT A;  4LDT D;  1OQY A;  4IDI A;  4KIK A;  1QIL A;  1V81 A;  2O6V A;  3Q8F A;  4W9G A;  3UIO B;  2KQS A;  5EE0 A;  4C56 C;  1YX5 B;  2LVO A;  3Q3J A;  4OVU A;  3QJZ A;  1IGD A;  2Y3A A;  4M0W B;  3ECI A;  2L00 B;  1TY0 A;  4EE2 A;  3ZRF A;  3DBR B;  2DZI A;  2KJH B;  1UGJ A;  4MGI E;  1VZ7 A;  3JSV A;  2DZM A;  1R4M B;  3AUL A;  4I6L B;  4DHZ B;  4CHK A;  3RUI B;  4PYU A;  1NYR A;  5C3J B;  1L0V B;  3A1Q B;  2LGX A;  1WGH A;  1ZP0 B;  2K22 A;  4ANU A;  3Q3O C;  5G55 A;  4P1C C;  3J9C A;  2RD0 A;  2WGS A;  1FM0 D;  2WDQ B;  1PDX A;  4KIK B;  3NJT A;  2MJD A;  4KX6 B;  4YTM B;  2X38 A;  4HCN B;  3A9K A;  3ZO5 B;  2LWP A;  4I6P A;  1UGM A;  4YXD B;  2PE9 A;  1UH6 A;  2KAC A;  4GN1 A;  4R3D A;  2DWQ A;  3H6N A;  3QHT A;  2IY0 B;  2KK8 A;  1E6E B;  1L7Y A;  4DHJ B;  4PS7 A;  1C4P A;  1UF0 A;  3PTF C;  3RZW C;  4GDL A;  2N7D A;  3JSV B;  4ZRJ A;  2KTF A;  3NY5 A;  4W9F A;  1YMH E;  3O65 B;  4TMA B;  3L16 A;  2FE8 A;  3LXF A;  1FO4 A;  4JGH B;  2JRH A;  4E3C A;  4GGQ A;  1GB1 A;  2D3A A;  1E90 A;  5IA7 A;  3PSE B;  5KHO A;  1HTO A;  4P1B C;  4BFR A;  3V60 A;  4RM9 A;  2KC2 A;  4M8N A;  4K1R B;  5FR6 A;  1EU4 A;  3A9K B;  1H8C A;  3P1M A;  1YN5 A;  4OZB A;  1ROE A;  1L6V A;  3LJ3 A;  4N6E B;  1MHX A;  2NTT A;  4EOY A;  3DVN V;  4F7Z A;  2CHZ A;  3C0R B;  4DDI D;  2MBB B;  3DBH I;  1P7F A;  2IY1 B;  4IUM B;  1YOV B;  1ZE3 D;  4XE0 A;  2OJW A;  3R7R A;  4LNI A;  3H1U A;  1J7A A;  2KX0 A;  2ON8 A;  1AYF A;  3HHM A;  2WXM A;  4P6V F;  2NCN A;  2BS2 B;  1C4A A;  4EKU A;  1VDV A;  2ACZ B;  2YEP F;  1T0R C;  3T3N A;  4WJO A;  4WAA A;  1KF6 B;  2INP E;  1EWY C;  4YT0 B;  2FUH B;  1J7B A;  2VZK D;  1WXS A;  2JXT A;  1VD2 A;  4J6I A;  4ANW A;  2PKO A;  4C7Y A;  5I4D A;  1KM7 A;  4BOS C;  2FCM A;  2NPT A;  3Q2A C;  2LRU A;  3VTV A;  5JZE B;  1WX9 A;  4B9K A;  1NEN B;  2A5U A;  2G4S A;  4XWT A;  5AZH A;  3OAW A;  1C9F A;  3V3X A;  2WHI A;  3M62 B;  2FIF A;  1NBF C;  4BBN F;  3H9D A;  3X23 A;  3AMZ A;  5CHV C;  4NJC A;  4YSY B;  1HXY D;  4MDK E;  4IWO A;  3ENE A;  3Q8B A;  3NOB A;  4RGO S;  1F77 A;  2YLM A;  3ZTC A;  4MSM B;  3VH4 B;  3U7Z A;  1IBX A;  4NPN A;  1TKY A;  4BOZ B;  2Y5P A;  2OHF A;  1WGG A;  2M4N A;  4A9A A;  2W54 A;  1WGK A;  1FPY A;  3RI7 C;  4IM2 A;  1OQQ A;  3ZNI D;  3MJW A;  2I2Y A;  4WWO A;  2K25 A;  3DWG C;  1IYF A;  4OVV A;  3ZUN A;  3KQ4 A;  2NPT B;  4JE3 B;  4M01 A;  4BBN C;  1HA5 A;  1FNW A;  3IT4 B;  2LXA A;  2R61 A;  5C2T B;  2JXX A;  1N61 A;  3H8H A;  4NAW A;  2DYM A;  3R3M A;  4L1B A;  1HTQ A;  3GOE A;  4ZHO A;  3ZNG C;  1EF5 A;  2JYE A;  2IO2 B;  1YJ1 A;  2WLB A;  2BKR B;  1SF0 A;  2DEN B;  2D3B A;  2NBV B;  4E71 A;  2V3P A;  4P7I A;  1I4R A;  3AN1 A;  2K8C A;  2AL3 A;  2INC C;  5DCN A;  2R2O A;  1IBX B;  4BKT A;  4TQ0 A;  3PT2 B;  1C76 A;  2JX5 A;  1EM7 A;  5AEK B;  4JWS C;  3O13 A;  1LQB A;  1ET6 A;  2V4I B;  4RGN A;  4O1N A;  2AQ1 B;  1UBQ A;  1MVK A;  5JH5 C;  1JQ4 A;  5AZG A;  1P0R A;  3HM3 A;  3EUB 2;  2DZK A;  2LGI A;  5EE9 A;  3RZF A;  3AU4 A;  4ANV A;  3SHQ A;  1D5Z C;  2ASQ A;  4F8C B;  1YIW A;  1Q5W B;  2KYW A;  3E9S A;  4NAW B;  1I35 A;  1E5W A;  4MSQ B;  4MH0 E;  2LEK A;  1X1M A;  4ZRK A;  3OJ3 A;  3ABV B;  3APF A;  2KDE B;  2WXO A;  2L83 A;  2TSS A;  2KMC A;  4MAC A;  2V0G A;  4RF0 A;  3E56 A;  3QIJ A;  4A20 A;  2LRW A;  4B95 A;  2D2Q A;  2XNA C;  1TS3 A;  1WX8 A;  1PYW D;  3VH3 B;  1TTN A;  2PIA A;  1KOT A;  4ITK A;  2AL6 A;  5BO4 B;  1TT5 B;  4YL8 A;  3U7D A;  1V5T A;  1SSN A;  1C78 A;  3VRA B;  2D3G A;  1DOY A;  2RPQ A;  1WZ3 A;  1WFY A;  1E10 A;  1YN3 A;  2FNJ B;  3NRZ A;  2JF5 A;  1A70 A;  2G1E A;  1GOZ A;  2N7J A;  5E6P A;  2KHW B;  2ZPN A;  1DOI A;  2EMT A;  3ZNZ B;  3IHP C;  2HDE A;  3V6E B;  2LHD A;  2WP9 B;  1MJD A;  3MC0 B;  1TIF A;  1WSP A;  2WXL A;  3RD2 A;  4A55 A;  3IVF A;  2YEP B;  1FXI A;  3ZGZ A;  2JUO A;  3IG3 A;  2M56 B;  4MEL A;  2IGD A;  2L0T A;  1GNU A;  2L52 A;  3MTN B;  2D10 A;  2WYQ A;  3HRD D;  3ZIM A;  2BF8 B;  2INN E;  1WJ6 A;  3AE8 B;  3UQB A;  2MWS B;  1RWS A;  3Q3M C;  1OFF A;  5H8Y E;  4JQW C;  4EEW A;  1PGB A;  4KKI A;  1HQR D;  3VR9 B;  3T8M A;  4RM8 A;  1DOX A;  4S17 A;  1CMX B;  2M0X A;  2V3S A;  4KGS A;  1PUT A;  2GBK A;  4WAF A;  4A3P A;  3AE6 B;  4B0M A;  4KDI C;  3V05 A;  4HRO A;  1BML C; 
#chains in the Genus database with same CATH homology
 2LVO A;  2BYV E;  4FJV B;  3Q3J A;  1WYW B;  4GDL B;  4OVU A;  2LGD A;  2UYZ B;  4KV2 A;  2K6D B;  4MJS B;  3QJZ A;  4GOC A;  4DXA B;  2DYB A;  1WGD A;  4M0W B;  3ECI A;  2KJ6 A;  3KUZ A;  2DAF A;  2L00 B;  2N9X A;  4W9J A;  2KTR A;  3X0W A;  3A9J A;  4HJK A;  3ZRF A;  2DZI A;  3PHX B;  2LVP A;  1RFA A;  2KJH B;  4ANX A;  2KWU B;  5D2M B;  1ZW7 A;  2MBH A;  4FAD A;  3HK0 A;  4MGI E;  3JSV A;  3KYD D;  2DZM A;  5JHB A;  1WM2 A;  2MBE A;  1VCB A;  3AUL A;  2NBW B;  2IYD B;  4I6L B;  2BKF A;  2N7E A;  3B1L X;  4DHZ B;  4CHK A;  4HCP B;  4W9I A;  3AI5 A;  2L8J A;  2M1M A;  4DHJ D;  3KW5 B;  4TKN A;  4NQL B;  1D3Z A;  3VUW A;  3RCZ A;  3RUI B;  4KSK C;  2KN5 A;  4PYU A;  4LDT B;  1SIF A;  3S2A A;  3VXW A;  3ZDT A;  3TJP A;  3R66 C;  3A1Q B;  2LGX A;  1WGH A;  4HWI B;  3ZDM C;  1TBE A;  1R4N I;  1WR6 E;  1P9D U;  4ANU A;  2O2V A;  4II3 B;  5G55 A;  1XD3 B;  2GOW A;  3VFK A;  2RD0 A;  5IAA C;  1HE8 A;  3APD A;  3PV1 A;  3SU8 X;  3ML9 A;  2QHO A;  2C7H A;  3DBR I;  4IWQ A;  3GZN I;  2K8H A;  2D07 B;  3L0W B;  4G50 A;  4TV3 A;  2BWE S;  2WWZ A;  2M17 A;  1GC6 A;  5CHF A;  5J2R A;  4KIK B;  2WDT B;  3OLM D;  1I42 A;  2PJH A;  4HCN B;  1Z2M A;  3A9K A;  3ZO5 B;  2LWP A;  4I6P A;  1UGM A;  1XT9 B;  1R4M I;  5D94 A;  4W9L A;  4CYE A;  2C7M B;  1UH6 A;  2PE9 A;  4GU2 A;  2L3Z A;  4GN1 A;  2KQ7 A;  3L17 A;  1BT0 A;  1P3Q U;  3IFW B;  5C1Z A;  1E8X A;  3QQ8 B;  1GG3 A;  3APC A;  3PLU A;  3PS6 A;  3WAO A;  2C7N B;  3H6N A;  3QHT A;  3W1S A;  3WAL A;  3ZVV A;  2IY0 B;  2K1F A;  5EDS A;  1WE6 A;  1KJT A;  2KK8 A;  2BYF A;  4BKG A;  4URK A;  3PRM B;  2KTR B;  1L7Y A;  3A9J B;  4M8M A;  5E6N A;  4DHJ B;  2MSE D;  4PS7 A;  2NR2 A;  4ASW C;  3NZS A;  4NY0 A;  2XBB C;  2MLB A;  3PTF C;  3RZW C;  4GDL A;  1WR1 A;  2GBM A;  3ONS A;  3AXC A;  4W9E A;  4MJS A;  4GXB A;  2G45 B;  2N4F A;  2N7D A;  2KD0 A;  3CF6 E;  3JSV B;  4ZRJ A;  2HD5 B;  3UGB B;  2DAJ A;  1M94 A;  2KTF A;  3NY5 A;  2KDI A;  4I6N B;  3TIX A;  4W9F A;  1FXT B;  2LI5 A;  4NJ6 A;  4NQK E;  5LLI A;  3I3T B;  1E8Z A;  2LUE A;  2KXJ A;  1V9J A;  3O65 B;  3L16 A;  1L2N A;  2G3Q B;  1E8Y A;  2CKH B;  4FHK A;  4JGH B;  3B08 A;  2JRH A;  2O2V B;  4E3C A;  1WXV A;  4GGQ A;  1E90 A;  5IA7 A;  3N30 A;  2KKC A;  1YQB A;  3R7Q A;  1UD7 A;  3PSE B;  5KHO A;  4FN2 A;  4BFR A;  2XEW A;  2GBN A;  4LJO B;  5CHW A;  2NVU I;  1YX6 B;  4RM9 A;  3V60 A;  3PPA A;  2KC2 A;  4M8N A;  4K1R B;  5FR6 A;  2ZNV C;  2FCS A;  3VVW B;  2GMI C;  3A9K B;  1H8C A;  2EMS A;  2JT4 B;  3UQA A;  2AWT A;  4EFO A;  2CR5 A;  3CSF A;  5LXI B;  3LJ3 A;  2EKE C;  1G6J A;  4EOY A;  4EUT A;  3DVN V;  4MEM A;  4B6W A;  5JHA A;  1C1Y B;  2KFJ A;  3LDZ E;  3RYT A;  4F7Z A;  2CHZ A;  2RGF A;  3C0R B;  2BWF A;  4DDI D;  2MBB B;  1AAR A;  4WQO B;  2PPH A;  1C3T A;  3DBH I;  3VTU A;  4HLE A;  2IY1 B;  5J17 A;  4IUM B;  5DPW A;  4IM0 A;  3R7R A;  4AWJ A;  3L13 A;  2KDF B;  3H1U A;  1Y8R C;  4AUQ C;  2KX0 A;  4IC7 B;  4MGY E;  3HHM A;  3EC8 A;  4G3X B;  1V5O A;  2HE7 A;  3EFU A;  5LXH A;  1GJZ A;  2NCN A;  3UIP B;  3DBL I;  4AOF A;  1QZE A;  3NZU A;  4G11 A;  2IO0 B;  2CHW A;  1H4R A;  4EKU A;  2MA9 B;  2K6Q A;  3QC8 B;  2KLC A;  2ZNV B;  4FJY A;  4WJO A;  2KFK A;  4WAA A;  4FHJ A;  3WAM A;  5DPR A;  3A4R A;  2FUH B;  1WXS A;  2ZJD A;  1VD2 A;  4J6I A;  4FUL A;  4ANW A;  4CO7 A;  2AYO B;  4WWN A;  1ZGU B;  3ML8 A;  1WXA A;  1GC7 A;  4IG7 B;  1KM7 A;  2FCN A;  2B3A A;  3OJ4 B;  4IM3 A;  2KX3 A;  2FCM A;  2LZ6 A;  2IO1 B;  4MGK E;  4PYZ A;  4BOS C;  2MP2 A;  2NPT A;  5L95 C;  2J0K A;  2KNB A;  2LRU A;  1WX7 A;  3VHT C;  3VTV A;  5JZE B;  4K7U A;  2CS4 A;  3V6C B;  1WX9 A;  4B9K A;  2MW5 A;  4W9C A;  4XX5 A;  1WY8 A;  3D32 A;  3HM6 X;  1F9J A;  1WJ4 A;  2A5U A;  1SGH A;  2G4S A;  5AZH A;  2N1W A;  3OAW A;  3M62 B;  1LM8 B;  4BVU C;  2FIF A;  3PHW B;  1NBF C;  3WAP A;  2BPS A;  4FJZ A;  4BBN F;  3H9D A;  3X23 A;  5CHV C;  4JL9 A;  1V6E A;  4GIV A;  2VRR B;  4MDK E;  3DVG Y;  3ENE A;  4IWO A;  5CX3 A;  2LGY A;  4KZ0 A;  2I1K A;  2V4L A;  3L10 B;  2LJ5 A;  4AP4 C;  1YD8 U;  4FA6 A;  4K7S A;  3NOB A;  2JY6 A;  1ZKH A;  3VUY A;  2Y5B B;  2J0J A;  2YLM A;  4X57 B;  3ZTC A;  4MSM B;  3VH4 B;  3ZNH B;  3QWZ B;  4NPN A;  2D11 A;  4BOZ B;  1WF9 A;  3H7S A;  1WXM A;  3V62 A;  4IW0 A;  3ZKJ C;  2ZZP B;  1WGG A;  2M4N A;  3PRZ A;  4HPL B;  3A4S C;  3N32 A;  2ZVN A;  2KFK B;  4HDO A;  1WRD B;  3N3K B;  4MM3 A;  2ZVO A;  3PVL A;  1TZ1 A;  3CST A;  4WJP A;  4IM2 A;  3VTW A;  4EZJ A;  4XZ4 A;  3ZNI D;  3MJW A;  1WGY A;  1OGW A;  2ZCC A;  4GSW A;  4W9K A;  3HIZ A;  3QK0 A;  4G0N B;  1UEL A;  2FCQ A;  5E6O A;  1UZX B;  5CTR C;  2R2Q A;  4WWO A;  2C9W B;  2K25 A;  4KVG B;  1IYF A;  4OVV A;  3ZUN A;  2MBQ A;  2MP2 B;  2NPT B;  2LXC A;  3JVZ X;  4GDK A;  4ICU A;  4BBN C;  2J0M A;  2ZPY A;  1OTR B;  3IBE A;  2LXA A;  3KUD B;  5J18 A;  4TQ1 A;  2HTH A;  1J19 A;  2LAS A;  2JXX A;  3DCG A;  1UBI A;  4NAW A;  2W9N A;  2DYM A;  2KMA A;  1WM3 A;  1EUV B;  2JZ3 B;  3VAW A;  3T9L A;  3R3M A;  4K7W A;  1U4A A;  1T0Y A;  3ZW3 A;  1E7U A;  3GOE A;  3MHS D;  1WZ0 A;  3ZNG C;  3M95 A;  1EF5 A;  3TMP B;  5TR5 A;  2A4Z A;  1V80 A;  2DX5 B;  2IO2 B;  2RR9 A;  1YJ1 A;  4WWP A;  2BKR B;  3L08 A;  1WH3 A;  1EO6 A;  1WJN A;  4GB9 A;  3QX1 A;  2C60 A;  1WGR A;  2AEH A;  4HDQ A;  4NNJ B;  5GMV A;  1TGZ B;  1Z5S B;  3DDC B;  2L0F A;  2DEN B;  2NBV B;  2OOB B;  4E71 A;  2LD9 A;  2Z0E B;  2I1J A;  4P7I A;  2K8C A;  3JW0 X;  3PGE A;  3TL5 A;  1J0G A;  2AL3 A;  1E8W A;  5DCN A;  2R2O A;  2KC1 A;  4HVB A;  1OEY A;  1RLF A;  4BKT A;  4TQ0 A;  3PT2 B;  2M8S A;  5AEK B;  1E7V A;  3H7P A;  1LQB A;  4PS3 A;  4EZK A;  2MQJ A;  3VQI A;  3B0A A;  1UBQ A;  3ALB A;  4DK5 A;  2WX1 A;  4FBJ B;  2GBR A;  3SD5 A;  3PZD A;  5JH5 C;  2REX A;  1J8C A;  3EHV A;  1PQS A;  3PRE A;  2KOX A;  4ICV A;  4GMV A;  5AZG A;  1P0R A;  2JVC A;  2LVQ A;  2N1V A;  3KVF B;  3HM3 A;  2DZK A;  3RZF A;  2XK5 A;  3AU4 A;  4GDK B;  4KDL B;  3SHQ A;  4ANV A;  1S3S G;  2KJR A;  2PEA A;  5KHQ A;  2O6V D;  4ZDV A;  3QA8 A;  2ASQ A;  4F8C B;  4XC2 A;  1YIW A;  3UIN B;  1Q5W B;  1ISN A;  3AU5 A;  4NAW B;  1I35 A;  1GUA B;  1P98 A;  5DPT A;  1LXD A;  3VDZ A;  1E5W A;  4MSQ B;  1V49 A;  4MH0 E;  4AJY B;  3DVG X;  4PS8 A;  3V61 A;  3TCA A;  5D7G A;  1X1M A;  4ZRK A;  2L76 A;  3DPD A;  3A33 B;  3OJ3 A;  3APF A;  4HXD A;  2KDE B;  1WMH A;  2L05 A;  4TUU A;  2KMC A;  2DZJ A;  3DVN U;  3WA0 A;  2CU1 A;  2NS5 A;  3QIJ A;  4KSL C;  3DOW A;  4ZRI A;  2YVC A;  2LRW A;  4A20 A;  4WJN A;  3NHE B;  2JZZ A;  4B95 A;  2D2Q A;  1XQQ A;  4BKS A;  4A3O A;  4JLC A;  5D6J B;  1WX8 A;  1SE9 A;  2K39 A;  4WJQ A;  3VH3 B;  1TTN A;  5AZF A;  1KOT A;  3Q3F A;  2N9P C;  2AL6 A;  4HK2 A;  4K81 A;  2OJR A;  4LCD E;  5BO4 B;  2MRP A;  3H7P B;  3PLV A;  3U7D A;  4YL8 A;  1V5T A;  3ZTD A;  3L54 A;  1K8R B;  3RUL A;  2D3G A;  5C23 A;  2O6V B;  3KYC D;  2RPQ A;  4BKS D;  1WZ3 A;  1WFY A;  2Z59 B;  3UF8 A;  1WE7 A;  2FNJ B;  4IWP A;  2KLG A;  2CHX A;  3JYU A;  1LFD A;  1P1A A;  1EF1 A;  2JF5 A;  2G4D B;  2JWZ A;  2MCN B;  3QAQ A;  2WX0 A;  3VUX A;  4DWF A;  2K8B A;  3EEC A;  2XK5 B;  1RRB A;  2UWQ A;  5E6P A;  3M63 B;  4DBG A;  2KHW B;  3W1Y A;  1KLV A;  2ZPN A;  3DBS A;  2EMT A;  2KVR A;  2V1Y A;  3ZNZ B;  4ZYN A;  3IHP C;  2RSU A;  3V6E B;  4AJW A;  5L83 A;  2ZEQ A;  4W9D A;  2DYO A;  5DPS A;  2GBJ A;  2PE6 B;  3U8Z A;  4NJ7 A;  2BGF A;  3ZLZ A;  4EZL A;  3RD2 A;  2J7Q B;  1WI0 A;  3IVF A;  2C5L C;  3SDL C;  2ZCB A;  2N9E B;  3W1S C;  2JRI B;  3K9O B;  3KH0 A;  1WMH B;  4DHZ E;  2L7R A;  4N9F 4;  3RT3 B;  2JUO A;  3IG3 A;  4MGZ E;  4MEL A;  3P2B A;  4LJP B;  3QAR A;  1WJU A;  1NI2 A;  3PRP B;  1MG8 A;  3WAN A;  2DHZ A;  2KWV B;  1IPG A;  2L0T A;  1GNU A;  4F1S A;  2NBU A;  2HJ8 A;  1OEY J;  1Q0W B;  1V2Y A;  3MTN B;  3NS8 A;  1S1Q B;  2D10 A;  2WYQ A;  2IO3 B;  2BYE A;  3BIN A;  3ZIM A;  3WIM A;  4RMA A;  2KZR A;  2IZV B;  2BF8 B;  2Z0D B;  3KUC B;  1RAX A;  1WJ6 A;  1A5R A;  3A1Q A;  3UQB A;  4FLH A;  4KZC A;  2MWS B;  3ZRC A;  2MBO A;  3U30 A;  4EEW A;  4JQW C;  4E74 A;  1WIA A;  3DQV A;  2KWC A;  3CMM B;  3QCA A;  4W9H A;  2KDB A;  2MX2 A;  3TBL D;  3T8M A;  3M3J A;  2KAN A;  2FID A;  4RM8 A;  5G2N A;  1IP9 A;  4JIO U;  2FAZ A;  1CMX B;  4LDT D;  5HKH A;  1OQY A;  2M0X A;  2V3S A;  4KIK A;  1V81 A;  2IBI B;  2O6V A;  4W9G A;  3UIO B;  2GBK A;  4II2 B;  2KO3 A;  2JPH A;  4A3P A;  4HPM B;  4DDG D;  4KDI C;  2KQS A;  1Q1O A;  1JRU A;  1V86 A;  3K9P B;  1NDD A;  3BY4 B;  1YX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...