4NPNA

Crystal structure of human tetra-sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
71
structure length
71
Chain Sequence
HINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of poly-SUMO chain recognition by the RNF4-SIMs domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Small ubiquitin-related modifier 2
total genus 15
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2013-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4npnA00
3D32A 1V49A 1RFAA 2JF5A 1E7VA 2VRRB 2ZCCA 4G50A 5AZFA 5TR5A 1WJ6A 2KC1A 5JZEB 2MBEA 2KX3A 3PRMB 2MBOA 1EO6A 2ZNVC 2BPSA 4W9IA 4E3CA 5JHBA 2KDEB 3A9JA 4NAWB 3ZNID 4YL8A 4K7SA 3U8ZA 4GOCA 3VH4B 3CMMB 3JSVA 4GGQA 1WGRA 2HD5B 2Y5BB 3AXCA 3I3TB 5GMVA 1IP9A 4IM0A 1AARA 2KFKA 3MTNB 1JRUA 5G55A 3IG3A 4WJNA 3LJ3A 3PSEB 3A1QA 1TZ1A 4W9LA 1NBFC 2L76A 3UQBA 4GN1A 3DPDA 1E8YA 3PREA 4MEMA 1EF1A 3R7QA 1Q5WB 4WJQA 2AL3A 4FBJB 2MLBA 5J2RA 1OGWA 2KTRB 4WAAA 2C7MB 1UZXB 4FA6A 1YX5B 4NNJB 4BBNC 1RLFA 4GDLB 4MSQB 1WM3A 2KJRA 4MM3A 3RZWC 3TJPA 3ML8A 2GMIC 2V4LA 2A5UA 1YX6B 2IO0B 4DDGD 4IUMB 3JVZX 2ZJDA 1L2NA 4FULA 2DAFA 4E71A 3QA8A 5J17A 2N9PC 1V80A 4TV3A 2MP2A 3V6EB 2IO2B 2KLCA 4G11A 3TBLD 3OJ3A 4ANUA 2OOBB 3JW0X 1KM7A 3ZO5B 2J0KA 1WX8A 2HTHA 4W9DA 5E6NA 2KVRA 2UYZB 3NY5A 3Q3JA 1D3ZA 1WXVA 3KW5B 2KX0A 3KUDB 3PHXB 4FHKA 2IO3B 4X57B 2JT4B 3KUZA 3KUCB 3KYCD 3QC8B 1Z5SB 2O6VA 3ONSA 3VUWA 3UF8A 2K6QA 2KLGA 1GC7A 1P3QU 4IW0A 2N1WA 4CYEA 1J0GA 4KSKC 2AL6A 4ZRIA 4I6LB 4EZKA 1QZEA 1LQBA 3NOBA 1KJTA 5DPWA 3H1UA 3DDCB 2PE6B 3IHPC 2NVUI 4MJSA 5AEKB 1WGGA 2C7NB 3AU5A 4DHZB 1P98A 1M94A 3HHMA 2WX1A 1GG3A 1HE8A 2L0FA 2LD9A 4AP4C 3DVGY 2BYEA 2KKCA 3N3KB 2NR2A 3QWZB 4N9F4 4E74A 4JLCA 2FIFA 2ZPNA 1YIWA 1XQQA 2BWFA 2K1FA 2GOWA 2N7DA 4KVGB 3VVWB 2YLMA 1XT9B 4K1RB 2JXXA 2C7HA 1H8CA 3ZDMC 2Z0EB 2KZRA 5G2NA 2MBBB 5HKHA 4MGZE 1WJNA 1EF5A 3PLVA 4DHJB 4XZ4A 2EKEC 4BBNF 3CSTA 2O6VB 3WANA 2R2QA 2ASQA 5BO4B 3T8MA 3ML9A 1Q1OA 2BKRB 3UGBB 3RCZA 2BYVE 1S3SG 2D2QA 3QQ8B 1NI2A 4P7IA 1F9JA 1WYWB 2BKFA 2HJ8A 3VHTC 2DZIA 4BOSC 2K25A 2KO3A 2DZJA 2MSED 3IBEA 3R66C 4NPNA 5FR6A 3EHVA 1I35A 4KDLB 3V60A 2LI5A 4B95A 4FADA 3H7SA 2V1YA 2RR9A 3DVGX 4WJOA 3S2AA 1P1AA 2PPHA 4MGYE 3VTWA 2CS4A 2NPTB 2KANA 4AWJA 3KH0A 4I6NB 3SHQA 3C0RB 1SIFA 4OVVA 3W1SA 2NBUA 3DVNU 4K7WA 4ANXA 1WXSA 1ISNA 3PS6A 4G3XB 2KTRA 3RD2A 4EZJA 2ZZPB 4PS7A 4GIVA 3WAPA 1CMXB 1SE9A 2KWVB 3OJ4B 4J6IA 2C60A 4AUQC 1TBEA 3PTFC 4MGIE 3ZW3A 1R4MI 2MA9B 3ZRFA 4HWIB 4JGHB 3DBSA 2KNBA 3ZUNA 3BINA 5CHVC 3EECA 4URKA 1V9JA 1ZKHA 4ASWC 1P9DU 3VFKA 4GU2A 4BKSD 4DBGA 2CHWA 2FAZA 4W9JA 3QARA 5C23A 1WGHA 3X23A 2LGYA 1VCBA 4HPLB 1T0YA 1WJ4A 3UIOB 5LXIB 4PYUA 2DX5B 2IY1B 5KHOA 3VAWA 3VTUA 2KJ6A 1RRBA 1WXMA 2W9NA 2ZEQA 4IC7B 2DZMA 4EOYA 3PRZA 5JH5C 2GBRA 4W9KA 3B0AA 3APCA 1UH6A 3ECIA 4MJSB 4KIKB 4M8MA 2Z59B 2G3QB 3AULA 2YVCA 4XX5A 3A1QB 2FCQA 4K7UA 4RMAA 2KWCA 3L10B 3ENEA 1J19A 2M4NA 5IA7A 2WX0A 3QJZA 3K9OB 1E7UA 2N7EA 1OQYA 2DYOA 3Q3FA 4HCPB 3VXWA 3L0WB 2N9XA 4IM3A 3VQIA 1GUAB 2JPHA 2KQSA 4K81A 4CHKA 2CKHB 3TL5A 1KOTA 4HLEA 4W9FA 4HXDA 4WWPA 3QCAA 1WF9A 1V6EA 4A3OA 2LUEA 3NZUA 3PLUA 1U4AA 2ZVNA 3L17A 1G6JA 3W1SC 2GBMA 2MBHA 4HDOA 1R4NI 4RM8A 2D10A 1A5RA 3JYUA 2K39A 2R2OA 4MSMB 3SD5A 3H7PB 1WIAA 2RD0A 1VD2A 4HJKA 2DAJA 5CHWA 4TQ1A 4DK5A 3V62A 1RAXA 1WZ0A 2K8BA 2GBJA 3QIJA 5DPRA 2D11A 2M17A 4TQ0A 2GBNA 2UWQA 4KSLC 2MX2A 1NDDA 3WIMA 2JRHA 3L54A 3PZDA 4F1SA 4GB9A 2KQ7A 4NY0A 2BYFA 2KJHB 4DWFA 4HCNB 2KHWB 5KHQA 1BT0A 4GXBA 2LRUA 4LJPB 5CHFA 3WA0A 2XBBC 3ZTDA 3A9KB 3SDLC 3PPAA 1ZGUB 2L8JA 4GDKB 1WJUA 4A3PA 2FCMA 2PEAA 1Y8RC 2O2VA 2EMTA 2LASA 1WZ3A 3WALA 2LGXA 3IVFA 4M8NA 1UBIA 4AJYB 2JZZA 1C1YB 2XEWA 3R3MA 4LDTD 2NCNA 4W9CA 2IZVB 1ZW7A 1IYFA 2RSUA 2KTFA 4IG7B 4XC2A 2LRWA 1P0RA 3DBRI 4F8CB 3EC8A 3LDZE 4FJYA 4ZDVA 2LZ6A 2N9EB 3DOWA 1TTNA 2MW5A 1GC6A 2KFKB 2KDFB 3MHSD 2O6VD 2LXAA 3ZNHB 4ZRKA 5D2MB 2KWUB 4HVBA 1YJ1A 1PQSA 4KV2A 3DVNV 2IYDB 2L7RA 3PV1A 1WX9A 2LVOA 4IWPA 4WWNA 4AJWA 4MELA 4DXAB 4BKGA 3KVFB 1WM2A 5D6JB 5IAAC 4CO7A 2FCNA 1Z2MA 2D07B 4NAWA 2K8CA 4DHZE 3PRPB 2OJRA 3QK0A 3ZNZB 3T9LA 2KMCA 3TCAA 2IY0B 4BOZB 3PHWB 3NZSA 4LJOB 1L7YA 5DCNA 4IWOA 2DYMA 4FJZA 4II3B 5AZHA 2JVCA 2WWZA 3BY4B 4B9KA 2DYBA 1WH3A 2M0XA 3L13A 5LXHA 4FN2A 4BKSA 1WRDB 2D3GA 2LJ5A 4KDIC 4FHJA 1GJZA 3R7RA 1GNUA 1XD3B 1UD7A 3JSVB 3QAQA 3OLMD 5DPSA 2FUHB 3L16A 1E8XA 4ANWA 2C9WB 2LWPA 1OTRB 1OEYA 2ZPYA 1WR6E 2CU1A 3VTVA 4NJ7A 3RYTA 3UIPB 3B1LX 1KLVA 4BFRA 3ALBA 3RT3B 4WJPA 3UINB 2I1JA 3AU4A 3ZRCA 5C1ZA 4F7ZA 4M0WB 3GOEA 2BWES 4IM2A 3W1YA 2PE9A 2AEHA 4KZCA 2J0MA 4NQKE 3VUXA 5JHAA 5D94A 2CHXA 3ZLZA 1YD8U 2Z0DB 1SGHA 3ZVVA 2DENB 3A9KA 1WMHA 3QHTA 3IFWB 2AYOB 3HK0A 4FLHA 2NBVB 3H9DA 3ZDTA 3DBHI 4ICVA 2KC2A 1FXTB 5L83A 1V2YA 3ZIMA 3M95A 3NS8A 2KK8A 5D7GA 5AZGA 2BGFA 4HK2A 2FNJB 1WGDA 2IO1B 3VUYA 1WE6A 4NQLB 3RULA 3ZTCA 4EEWA 4MGKE 2WDTB 3APDA 4LCDE 2RPQA 2CR5A 1V86A 2EMSA 1MG8A 1WY8A 2CHZA 2M1MA 3EFUA 4LDTB 5CX3A 4A20A 2ZVOA 1V5TA 3CF6E 4NJ6A 4RM9A 4W9HA 2MQJA 4HDQA 4BKTA 4ANVA 3A4RA 3MJWA 3PGEA 5E6PA 2AWTA 2JY6A 4PS3A 2M8SA 3QX1A 2MCNB 1UGMA 3A9JB 4OVUA 1E5WA 3WAOA 1WFYA 2J7QB 2JRIB 3AI5A 3HIZA 3ZKJC 2LVQA 4JL9A 4TKNA 4DDID 2PJHA 2XK5B 1J8CA 2NS5A 2LXCA 4EZLA 2C5LC 3VDZA 3WAMA 2MRPA 5L95C 3DCGA 3M63B 4EKUA 4DHJD 4JIOU 1E90A 3CSFA 1OEYJ 3NHEB 3N32A 3VH3B 2I1KA 4PS8A 1WMHB 2L05A 4B6WA 2A4ZA 2JZ3B 2KFJA 1E8ZA 2FIDA 3H7PA 3M62B 3PVLA 4HPMB 4W9EA 3HM3A 3OAWA 1WX7A 2G4SA 4KIKA 3U7DA 3X0WA 3K9PB 3N30A 2N4FA 1V5OA 2IBIB 4IWQA 2V3SA 2MP2B 3DQVA 2ZCBA 3TIXA 1IPGA 3M3JA 1TGZB 1S1QB 1H4RA 2JUOA 4MH0E 4II2B 2DZKA 2KD0A 1LXDA 4TUUA 4ZRJA 2J0JA 2FCSA 3H6NA 3RUIB 1UBQA 5J18A 5E6OA 3B08A 2L00B 4ZYNA 2KXJA 2KMAA 4BVUC 2O2VB 2XK5A 5DPTA 1Q0WB 2KDBA 2ZNVB 1UELA 5CTRC 3UQAA 2WYQA 3V6CB 2G45B 1WI0A 2L0TA 3GZNI 3ZNGC 3KYDD 2REXA 1V81A 3PT2B 2MWSB 3TMPB 4GMVA 1WR1A 2N1VA 4G0NB 1WE7A 2QHOA 2G4DB 4ICUA 4W9GA 4EUTA 1I42A 3V61A 2LVPA 4GDKA 3APFA 2HE7A 2NPTA 3A33B 1LM8B 1LFDA 2DHZA 2KN5A 4PYZA 1EUVB 4I6PA 3P2BA 4JQWC 2KDIA 4WWOA 3O65B 3HM6X 1WXAA 2RGFA 1WGYA 4WQOB 2L3ZA 2B3AA 1X1MA 2JWZA 2KOXA 4MDKE 3U30A 2MBQA 2NBWB 2GBKA 1K8RB 5LLIA 3RZFA 1C3TA 3SU8X 3DBLI 2K8HA 4EFOA 4AOFA 2BF8B 4KZ0A 2K6DB 3L08A 4GSWA 3A4SC 2LGDA 4GDLA 5EDSA 4FJVB 1YQBA 1E8WA
chains in the Genus database with same CATH superfamily
1V49A 2VRRB 5TR5A 3AEDB 1UF0A 5JZEB 2MBEA 3PRMB 4E3CA 2ZNVC 2UU7A 4GOCA 3VH4B 3JSVA 4NZLB 5GMVA 4IM0A 3MHZA 1AARA 2KFKA 3MTNB 1JRUA 3TSSA 3LJ3A 2WXMA 2DBYA 4GN1A 3W2DA 1E8YA 4MEMA 1EF1A 2AL3A 1UZXB 4FA6A 2X38A 4NNJB 3TEZA 1I4GA 1RLFA 4MSQB 2KJRA 4MM3A 4B0MA 1D6EC 3ABVB 3TJPA 1YX6B 1UUPA 2ZJDA 1HEZE 1GB4A 1HA5A 2E3TA 3TBLD 4ANUA 1TS4A 3ZO5B 1XLOA 3NY5A 2UYZB 4FHKA 3KUDB 1XO3A 3KUCB 1Z5SB 2O6VA 3ONSA 4P1CC 3VUWA 4XE0A 1QOAA 1DOIA 4KSKC 2AL6A 1QZEA 3R2TA 3U7ZA 3DDCB 2PE6B 2NVUI 1F2RC 2BS2B 1GG3A 1SIJA 1YQ3B 1YMHE 2KKCA 1FPYA 4JLCA 3MP9A 3MFGA 5H92C 1XT9B 2C7HA 3ZDMC 2KZRA 2NTTA 3NG0A 1LO5D 4XZ4A 3WANA 2R2QA 2BS3B 5BO4B 2LJIA 3RCZA 2BYVE 1S3SG 2D2QA 4YSYB 4P7IA 3VHTC 2Y5PA 1VDVA 4BOSC 2MSED 3R66C 5FR6A 3EHVA 1I35A 3N1YC 4FADA 2V1YA 2D3AA 2CS4A 2NPTB 2KDMA 2WQYB 4I6NB 1DYQA 4ANXA 1ISNA 2QMTA 3RD2A 5G5GA 1CMXB 3AEEB 4ACFA 3MC0B 3RFZB 1V1OA 3DBSA 1BUIC 3ZUNA 4R3DA 1ZKHA 4NJCA 4ASWC 1XF5L 1QILA 3Q14C 3VFKA 1N5XA 4DBGA 5TSSA 2JU6X 1C4PA 3QARA 5C23A 2LGYA 2RDHA 1WJ4A 2XN9C 1FRDA 1RRBA 1WXMA 2KJ6A 4IC7B 3ZJUA 4EOYA 3BWUD 3IXSA 3RNBC 1L0VB 2Z59B 2G3QB 4WH4A 2W3SA 4XX5A 2FCQA 4K7UA 5IA7A 2OEDA 3QJZA 3HVZA 4HCPB 1OQYA 4BZAA 3FC4A 2N0SB 1FRRA 2CJOA 3VQIA 2JPHA 2WU2B 1KOTA 1J7AA 4WWPA 2VH2A 4A3OA 1N62A 1QKZA 3PLUA 4A9AA 3L17A 1G6JA 3N1ZC 3W1SC 1ET6A 3AE6B 4DXGA 4RM8A 2D10A 2G1EA 2K39A 4WAFA 1WIAA 2BQQA 1K52A 4L2YA 2FBWB 4TQ1A 3I57A 4CQNA 1WZ0A 3QIJA 2GBNA 2UWQA 4KSLC 2MX2A 2W3RA 1YNTE 1EU4A 2KQ4X 3AE2B 3AV8A 1T0QC 3Q8BA 4DWFA 2MEKA 4HJGE 1L6UA 3SDLC 1SJHD 3PPAA 1ZGUB 4GDKB 2DLBA 1Y8RC 1JMLA 3EFCA 3WALA 2LGXA 3IVFA 2JYEA 4OZCA 1KTKA 2XEWA 3R3MA 3P4QB 4XDCA 4D2KA 1SJED 2E6XA 2IZVB 1E7PB 3DBLB 1IYFA 2RSUA 4XC2A 3RI7C 4UDUC 3DBRI 3EC8A 2MW5A 1GC6A 2KDFB 4ZRKA 5D3DA 3AE5B 3DVNV 3UI3A 2L7RA 3PV1A 1WX9A 1C76A 4AJWA 2Z8LA 2Q5WD 4BKGA 4CO7A 4DHZE 3PRPB 3T9LA 5G5HA 4BOZB 3PHWB 4LJOB 5DCNA 2WU5B 4FJZA 2JVCA 2WWZA 3BY4B 3L13A 1K51A 4YTNB 1JW9D 1WRDB 3MJ5A 2XNAC 1UD7A 3JSVB 2FUHB 2J4XA 2LHEA 3W5UB 1JWUD 2LGIA 1OTRB 4IOIE 2ZPYA 1WR6E 3AE9B 3RYTA 3B1LX 3AEGB 1QOFA 4IM2A 2AEHA 2IGDA 5D94A 2M19A 2G9HD 2Z0DB 1SGHA 1VZ7A 2DENB 2WDVB 3QHTA 3IFWB 1HTQA 1F52A 4ICVA 3ZIMA 5D7GA 1TS2A 4BAXA 3AE8B 3VUYA 4NQLB 3RULA 1YN4A 2CR5A 1V86A 2CHZA 3EFUA 1B1ZA 1NYQA 4LNOA 3P4PB 1XLPA 5E6PA 2AWTA 2JY6A 2M8SA 1WFYA 3AI5A 3HIZA 4DDID 1CZPA 4TKNA 2PJHA 3WAMA 2MRPA 5L95C 3DCGA 4EKUA 4DHJD 1GOZA 3B2GA 1VRAB 3NHEB 4PS8A 2L05A 2A4ZA 4A8XC 3H7PA 3M62B 3PVLA 1N61A 3OAWA 4KIKA 1JCKB 1WX7A 3AN1A 4ZOHC 4RGMA 4LLGM 2QSDA 3M3JA 3VRBB 4A90A 2HJ1A 1FNVA 4TUUA 2FCSA 3CWIA 4OW0A 3Q8FA 2KMAA 5DPTA 1Q0WB 2KDBA 5JXVA 3V6CB 1WI0A 2KYWA 3TMPB 1R7SA 1I42A 1MHHE 4GDKA 1EU3A 2RDGA 2ZW1A 3P2BA 1I4RA 2KDIA 4WWOA 2AQ3B 2QJLA 2B3AA 4MDKE 2KOXA 5LLIA 1E6EB 3IAS1 1FCLA 3A4SC 3DHIC 1TY0A 1P7FA 4FJVB 2AQ2B 5AUIA 3D32A 5AZFA 3C19A 1E7VA 1WJ6A 2KC1A 3PZ7A 2PVOD 1CJEA 5JHBA 3A9JA 4K7SA 2JYTA 2J42A 4GGQA 3ZJVA 1IP9A 3I3TB 2WHIA 2L1AA 4WJNA 3PSEB 2AQ1B 1V8CA 1TZ1A 4W9LA 1QQRA 3UQBA 1WYGA 3DBRB 3GE8C 4WAAA 2HDEA 2PLPA 1WM3A 1T5XD 1A70A 4XDDA 3URYA 2K9XA 5J17A 1J7CA 2N9PC 4TV3A 3V6EB 1CK1A 2KLCA 4G11A 2OOBB 1E0ZA 3JW0X 4W9DA 2V3NA 3Q3JA 1AYFA 1M4VA 5C2TB 1D3ZA 1WXVA 4X57B 4QAYA 4PK1A 3KUZA 3UF8A 2KLGA 1GC7A 4N59A 4CYEA 2QC8A 2N9KA 3BVZA 3NOBA 3H1UA 3PO0A 3IHPC 5AEKB 3AU5A 1PFDA 1P98A 3B9JA 3NVZA 4TMAB 2BYEA 2NR2A 4N9F4 2JXTA 4E74A 1TY2A 4K3BA 1R4NB 1YIWA 1ZDXA 3NRZA 3PLVA 1EF5A 4MGZE 5LNK1 3CSTA 2ASQA 1Q1OA 2BKRB 1C79A 1LGRA 5E6JA 1NI2A 1F9JA 1BMLC 3IBEA 1WGKA 2RR9A 2INCC 2IDYA 4M00A 4KGRA 2W54A 1OFFA 1PGBA 3AE1B 3SHQA 2NBUA 4K7WA 2DNFA 4EZJA 3PS6A 4G3XB 2KTRA 2ZZPB 4PS7A 2OJWA 1SE9A 3LYYA 3OJ4B 2WXQA 4MGIE 4HWIB 1YN3A 4JGHB 3BINA 3EECA 4GLSC 3ZYYX 2VZKD 2PTLA 2FAZA 4W9JA 4HPLB 5LXIB 2D3CA 2DX5B 1NYRA 2IY1B 5KHOA 5JH5C 4W9KA 1WXQA 3B0AA 3APCA 1YJJA 4MJSB 1C78A 2NTSA 3MC8A 4RGOS 1TKGA 3RMKC 4RMAA 2JQRB 1E7UA 2N7EA 2DYOA 3BVMA 2N7JA 4C7YA 4IM3A 1JQ4A 1PDXA 2KQSA 4CHKA 3TL5A 1UWXA 1TKEA 1L0YB 3RNAC 3NVYA 4W9FA 4HXDA 1WF9A 2LUEA 1U4AA 2ZVNA 2GBMA 3ZJTA 3IT4B 3JYUA 2R2OA 3SD5A 1L5PA 3H7PB 4HJKA 1VD2A 5CHWA 3V62A 2GBJA 2D11A 4TQ0A 2BB6A 1F0ZA 2WGSA 4F1SA 4GB9A 1L6VA 1YJIA 2KJHB 1RFKA 4GXBA 2LRUA 5CHFA 1D5MC 3Q8CA 2R61A 3KWLA 3ZTDA 5EE1A 2L8JA 2EMTA 3FILA 1DGJA 4M8NA 1XEEA 2JZZA 1C1YB 1ET9A 3ZXVA 1FXIA 4ZHOA 3E56A 1ZW7A 2H88B 2LRWA 2I38A 3LDZE 4ARIA 4ZDVA 2N9EB 1TTNA 3AB5A 2KFKB 2B76B 2O6VD 4HVBA 2BVCA 3HRDD 1YJ1A 1V1PA 3RPFC 4AS1A 4WWNA 4LNNA 4DXAB 1F2RI 3KVFB 1Z2MA 2D07B 4NAWA 2K8CA 3O13A 4XGAB 3QK0A 4A6QA 2IY0B 3N1XC 3NZSA 1L7YA 2PW9A 4B9KA 1T0RC 1WH3A 2M0XA 5LXHA 1KH0A 4FN2A 1PGXA 3BYYB 1ENFA 1GJZA 3R7RA 1GNUA 1XD3B 3QAQA 5DPSA 1QOBA 1FMAD 3NVWA 2C9WB 2EELA 5GXGB 3VTVA 1KLVA 3ALBA 3RT3B 2I1JA 3NZ3A 3NUHB 4M0WB 3GOEA 2BWES 3AEFB 3W1YA 3B2FA 3ZLZA 3P4SB 1FD6A 2BB5A 3ZVVA 1FNUA 1IGDA 3VRAB 2AYOB 3HK0A 2NBVB 3H9DA 3R2IA 1NI3A 2CJNA 2KT7A 2GLSA 4XWTA 5L83A 1SF0A 2BGFA 4HK2A 1WGDA 2PIAA 4O1NA 1WE6A 4MGKE 3APDA 1WWTA 2GRIA 2WXFA 4RFBA 1MG8A 5CX3A 2IJ0A 2ZVOA 2JX5A 4NJ6A 2MQJA 4RGNA 3RN9C 3A4RA 1SB3C 2MH7A 4PS3A 3QX1A 2MCNB 3A9JB 3WAOA 1E5WA 4M01A 4MT5A 2JRIB 4RF1A 3AE7B 1TIFA 4JIOU 1E90A 1VJKA 3CSFA 3ETRA 4OZBA 2I1KA 2X8XX 2FIDA 2ZW0A 1XLQA 2G4SA 3X0WA 3K9PB 2N4FA 1V5OA 1ESFA 1ZXHA 2MP2B 3TIXA 5FR3A 4JWSC 5IO9A 2JUOA 4RNAA 2KD0A 4ZRJA 2J0JA 3H6NA 1UBQA 4ZYSA 5E6OA 2V9HA 4P16A 1YN5A 1NEKB 3VR8B 2WYQA 2L0TA 3GZNI 3ZNGC 4C00A 1KLGD 2N1VA 3IAM1 2LVPA 3GS2A 2L83A 2HE7A 2WS3B 2Y3AA 1ROEA 2DHZA 2KN5A 3DHGC 4JQWC 1WXAA 2RGFA 1JROA 4WQOB 2JWZA 3U30A 1HQRD 3RZFA 1C3TA 3SU8X 3DBLI 3HVDA 2BF8B 4S0RA 3LB8C 1V1PB 2JF5A 4G50A 2MBOA 1FNWA 1V97A 3ZNID 2H89B 4YL8A 1D4BA 5T8IA 2HD5B 1AWDA 3AXCA 3W5VB 1QF6A 2N9LA 3AMZA 1MG4A 3H8HA 3IG3A 3A1QA 2QDFA 1R4MB 2EKIA 3Q3OC 2L76A 1FFUA 3DPDA 1SE3A 2PKOA 3PREA 4WJQA 1EWYC 1OGWA 2NMQA 1TT5B 2KTRB 4BBNC 3E9SA 4XYCA 1C4AA 2BW2A 2WXNA 2GMIC 2V4LA 2IO0B 4DDGD 3JVZX 1L2NA 4FULA 2DAFA 3EGRA 4OZAA 1V80A 2MP2A 4ZHPA 2IO2B 2DWQA 2J0KA 4C56C 1WX8A 3KW5B 2IO3B 3RNGC 5I4DA 2JT4B 3KYCD 3AM9A 3QC8B 2K6QA 4HROA 1MFWA 3IT6B 1TS3A 4KGTA 1N5WA 4ZRIA 1SBBB 1LQBA 2KVZA 4P6VF 5DPWA 1JWBD 1OQRA 1XXGA 3T3OA 2ONQA 1M94A 2LD9A 1HE8A 2L0FA 1DOXA 3DVGY 5IP4D 3QWZB 2MHJA 2FIFA 2YEPB 4USAA 1XQQA 1MJDA 2K1FA 3AECB 2N7DA 4KVGB 3VVWB 2YLMA 4K1RB 2MJDA 1K50A 2SEBD 4BBNF 2EKEC 3T8MA 3UGBB 2WXHA 3QQ8B 1VR9A 2DZIA 2DZJA 1B9RA 1N60A 1D5ZC 5HG2A 4B95A 2AX5A 3H7SA 1JWSD 1L4DB 3AH7A 3VTWA 4AWJA 3W1SA 1WXSA 2VZKB 4GIVA 4US9A 3FAHA 3PTFC 1R4MI 2MA9B 1C9FA 2KNBA 3Q6BA 4YT0B 2W82A 4JWUC 4URKA 1V9JA 5AUKA 4BKSD 4MACA 2CHWA 1GAQB 1WGHA 1Q10A 1T0YA 2KN4A 1NVID 4PYUA 3VAWA 2W9NA 2DZMA 1ZE3D 1UH6A 3OWEB 3ECIA 4KIKB 4M8MA 2WXJA 3DBHB 2YVCA 3A1QB 1IGCA 4DQOC 2KWCA 3L10B 4LNIA 2RMMA 3ENEA 2M4NA 4KKJA 4JPSA 2WX0A 5D3IB 5FK9C 3BK1A 3L0WB 4C80A 4WIPA 1I4XA 2CKHB 1KLUD 4Q2JA 3BIID 3FILB 2WNMA 1EWCA 1N63A 3U2SC 2MBHA 1FCCC 4HDOA 4REZA 1RYJA 1HZ5A 5MPOA 1SXTA 2RD0A 2DAJA 4DK5A 1RAXA 2JSVX 1F77A 1SE4A 5DPRA 3WIMA 2JRHA 3N20C 1HTOA 3SEBA 5C3JB 4NY0A 3AE3B 1I4QA 4HCNB 2KHWB 2WLBA 3WA0A 2VH1A 1VLBA 1WJUA 2FCMA 2PEAA 4WURA 4RF0A 1UBIA 4AJYB 2KWDA 4LDTD 4HRSA 3ZGZA 4NAMA 2K3UA 4FJYA 2LZ6A 3AE4B 1UGJA 4FXCA 5D2MB 3GP7A 4KV2A 1PQSA 3BK2A 2IYDB 4IWPA 3BYTB 2LVOA 2BYTA 4MELA 1WM2A 3P42A 4M0WA 5D6JB 2FCNA 4C7ZA 1FO4A 3ZQ4A 2OJRA 3ZNZB 2KMCA 3TCAA 2QEJC 3GE3C 4IWOA 2DYMA 1RWSA 2DYBA 1WRIA 1ZUD2 3P1MA 3EUB2 4BKSA 3T3NA 2V0GA 3NJTA 5EE3A 4KDIC 2LJ5A 3OLMD 2QILA 1E8XA 1KF6B 2K5PA 4L1BA 2PVGC 2LWPA 3J9CA 1OEYA 3P4RB 2CU1A 4NJ7A 3UIPB 1ZOYB 4BFRA 4WJPA 3UINB 3AU4A 3ZRCA 4F7ZA 4M02A 2PE9A 4KZCA 3VUXA 4J3OD 4AQ7A 1YD8U 2LEKA 1JWMD 3TUOA 3A9KA 3DHHC 2PMVA 3ZDTA 4FLHA 2BT6A 4JX1C 1ZPSA 2KC2A 1EM7A 3M95A 5AZGA 3Q3NC 5EE9A 2J53A 2M56B 4EEWA 4KX6B 2WDTB 4LCDE 1QLBB 4LDTB 2EMSA 1WY8A 4A20A 1AW7A 2CU3A 1K53A 3CF6E 3RNEC 4HKQA 4RM9A 2FUG1 1E9MA 4ANVA 3PGEA 4S17A 5BMHA 1UGMA 1N6ZA 4OVUA 2BTEA 2J7QB 1J8CA 4JL9A 2C5LC 3VDZA 1I7HA 1QT9A 1C77A 1OEYJ 5IKCM 2JZ3B 4HPMB 1JRPA 3HM3A 3SFEB 3N30A 4C4VA 3PZ8A 5BMGA 4IWQA 1NENB 1ZDVA 2WDQB 2ZCBA 1MHXA 1MI0A 1TGZB 1S1QB 4LNKA 1H4RA 4II2B 2DZKA 1Y56A 2JWUA 5J18A 4ZYNA 4BVUC 2XK5A 5CTRC 1YQ4B 3UQAA 3V05A 3KYDD 2MWSB 4GMVA 1WR1A 1BXTA 2LFIA 4G0NB 1WE7A 2QHOA 2G4DB 4EUTA 4L23A 1EUVB 2V4IB 4I6PA 2RDBC 1MVKA 1WGYA 1X1MA 2Y5CA 3P63A 2NBWB 1K8RB 5HFYA 4PT5A 2K8HA 4AOFA 1L4ZB 2K6DB 2INNE 3L08A 5EDSA 1XCQL 3I5JC 3OG5A 1HXYD 1YQBA 1E8WA 1RFAA 2ZCCA 2KX3A 1WSPA 1EO6A 3Q8EA 2BPSA 4W9IA 2KDEB 4NAWB 1FEHA 3U8ZA 3CMMB 4MM3B 1WGRA 2MJ3A 2Y5BB 3ZXRA 2QCZA 3DWGC 5G55A 1C4CA 1NBFC 4FBJB 3R7QA 5J2RA 1Q5WB 2MLBA 2C7MB 1YX5B 3GB1A 4GDLB 5BYQA 5IN7A 2BS4B 3RZWC 4OVZA 3W9CB 2JZPA 1ACCA 3ML8A 1IBXA 2IGHA 2A5UA 1FXAA 4IUMB 4A55A 5FKAC 4E71A 3QA8A 2KACA 1SE2A 3WCQA 3LXFA 3OJ3A 1KM7A 2KAJA 3SR6A 2HTHA 5E6NA 2KVRA 3KLSX 3PHXB 2KX0A 2IGGA 3C8YA 1P3QU 4IW0A 2N1WA 4EE2A 1J0GA 4I6LB 4EZKA 2LUMA 1KJTA 4MJSA 1WGGA 2C7NB 4YWGG 4DHZB 3HHMA 2WX1A 4AP4C 5HI1A 2GI9A 3N3KB 1F1HA 4ZRQA 2ZPNA 2WDRB 2BWFA 2GOWA 2INPE 2JXXA 1H8CA 2Z0EB 5G2NA 2MBBB 5HKHA 1WJNA 4DHJB 2O6VB 3ML9A 4LTUA 2V3PA 1SSNA 1SEBD 1WYWB 2BKFA 2HJ8A 4ARCA 2K25A 2KO3A 4NPNA 4KDLB 3V60A 2LI5A 3MC9A 1ZXIA 4DXFA 3DVGX 4WJOA 3S2AA 3NS1A 1P1AA 2PPHA 4MGYE 4RGTA 2KANA 3KH0A 3C0RB 1SIFA 1UWMA 4OVVA 4YSZB 3DVNU 5BYSA 2WXIA 3WAPA 1PGAA 2KWVB 2K0PA 1VZ8A 4J6IA 2C60A 4AUQC 1TBEA 3Q8AA 3ZW3A 3ZRFA 4K3CA 3U4EG 4LK0M 2WXLA 5CHVC 2SAKA 1P9DU 3VR9B 2WXOA 1FFVA 4GU2A 1FM0D 4WQMA 3BVGA 3L4PA 2L32A 1OQQA 3X23A 1VCBA 3UIOB 1KFYB 3VTUA 2ZEQA 3PRZA 3CIRB 2GBRA 3V3XA 1DOYA 4YTMB 3AULA 2D3BA 3I63C 4WWMA 1J19A 1PUTA 3K9OB 3Q3FA 2OHFA 3VXWA 2INDC 2J52A 3EA6A 2N9XA 4IDIA 1GUAB 5H8YE 4K81A 3U52E 4HLEA 1TKYA 1XLNA 3QCAA 1V6EA 3NZUA 1STEA 5IOIA 1T6BX 2WP9B 1R4NI 5HHDG 1A5RA 4MSMB 2WXKA 4KKIA 1IUEA 3Q2AC 1IBXB 2K8BA 4C4VB 3TEXA 2M17A 3SFDB 1NDDA 3PZDA 3L54A 2KQ7A 1HZ6A 2BYFA 5KHQA 1BT0A 3N9YC 2LGSA 4LJPB 2XBBC 1YOVB 3A9KB 2YEPF 4OHJA 4A3PA 1TYGB 2O2VA 2LASA 1WZ3A 2D5GA 3RNCC 3KWVA 1T3QA 4YTPB 4TSSA 2BBCA 5BMIA 4MH8A 2NCNA 4W9CA 2KTFA 4IG7B 1ZP0B 1P0RA 4F8CB 2WXGA 4HPPA 3DOWA 4IKGA 3MHSD 1GPXA 1E10A 2QIEB 2LXAA 3ZNHB 3Q3MC 2KWUB 2TSSA 1MPEA 2GB1A 1I4HA 5IAAC 3TEWA 1D5XC 4II3B 5AZHA 3NVVA 4N6EB 4RCOA 3GZNB 2D3GA 4FHJA 4N58A 3L16A 4ITKA 4H2AA 4ANWA 3AEBB 1KRHA 1TS5A 1RM6C 1UNSA 4YSXB 1JWAD 2WXRA 4ZRPA 5C1ZA 4HKZE 1CQVA 5JHAA 2J0MA 4NQKE 4RH6A 1TZOA 2CHXA 1WMHA 2ICIA 3DBHI 1AN8A 1FXTB 1V2YA 3NS8A 2LMCA 2KK8A 2FNJB 2IO1B 1FIQA 4LNFA 3ZTCA 1TJEA 2RPQA 3HUIA 2K22A 2M1MA 2WXPA 4P1BC 1V5TA 4W9HA 3Q69A 1L0XB 4HDQA 4BKTA 3RNFC 3MJWA 2FE8A 2L52A 2ON8A 2HTME 1I4PA 3ZKJC 2LVQA 4JE3B 2XK5B 2NS5A 2LXCA 2MJEA 4EZLA 1PYWD 1JALA 3M63B 1T0SC 3N32A 3VH3B 1WMHB 4B6WA 5BYRA 2KFJA 1E8ZA 3KQ4A 3BZDB 1XCTL 4W9EA 3U7DA 2IBIB 2V3SA 1J7BA 3DQVA 2I2YA 1IPGA 1QOGA 1P7EA 4KGSA 4MH0E 2M0AA 1LXDA 3RUIB 3B08A 2L00B 2KXJA 3AEAB 2O2VB 2ZNVB 1UELA 2LHDA 2G45B 2IPKD 2REXA 1V81A 3PT2B 3R8BA 4ICUA 4W9GA 4XWWA 3V61A 4YXDB 2KMMA 2W55A 3APFA 5EE0A 2NPTA 3A33B 1LM8B 1LFDA 4PYZA 1VZ6A 3O65B 3HM6X 3TEYA 4US8A 1GB1A 2L3ZA 2ACZB 2MBQA 2GBKA 3FKYA 4EFOA 4KZ0A 4B0EA 2RPVA 4GSWA 4GDLA 2LGDA 3DWMA 3I9V1 4HEA1
chains in the Genus database with same CATH topology
3D32A 1V49A 1RFAA 2JF5A 1E7VA 2VRRB 2ZCCA 4G50A 5AZFA 5TR5A 1WJ6A 2KC1A 5JZEB 2MBEA 2KX3A 3PRMB 2MBOA 1EO6A 2ZNVC 2BPSA 4W9IA 4E3CA 5JHBA 2KDEB 3A9JA 4NAWB 3ZNID 4YL8A 4K7SA 3U8ZA 4GOCA 3VH4B 3CMMB 3JSVA 4GGQA 1WGRA 2HD5B 2Y5BB 3AXCA 3I3TB 5GMVA 1IP9A 4IM0A 1AARA 2KFKA 3MTNB 1JRUA 5G55A 3IG3A 4WJNA 3LJ3A 3PSEB 3A1QA 1TZ1A 4W9LA 1NBFC 2L76A 3UQBA 4GN1A 3DPDA 1E8YA 3PREA 4MEMA 1EF1A 3R7QA 1Q5WB 4WJQA 2AL3A 4FBJB 2MLBA 5J2RA 1OGWA 2KTRB 4WAAA 2C7MB 1UZXB 4FA6A 1YX5B 4NNJB 4BBNC 1RLFA 4GDLB 4MSQB 1WM3A 2KJRA 4MM3A 3RZWC 3TJPA 3ML8A 2GMIC 2V4LA 2A5UA 1YX6B 2IO0B 4DDGD 4IUMB 3JVZX 2ZJDA 1L2NA 4FULA 2DAFA 4E71A 3QA8A 5J17A 2N9PC 1V80A 4TV3A 2MP2A 3V6EB 2IO2B 2KLCA 4G11A 3TBLD 3OJ3A 4ANUA 2OOBB 3JW0X 1KM7A 3ZO5B 2J0KA 1WX8A 2HTHA 4W9DA 5E6NA 2KVRA 2UYZB 3NY5A 3Q3JA 1D3ZA 1WXVA 3KW5B 2KX0A 3KUDB 3PHXB 4FHKA 2IO3B 4X57B 2JT4B 3KUZA 3KUCB 3KYCD 3QC8B 1Z5SB 2O6VA 3ONSA 3VUWA 3UF8A 2K6QA 2KLGA 1GC7A 1P3QU 4IW0A 2N1WA 4CYEA 1J0GA 4KSKC 2AL6A 4ZRIA 4I6LB 4EZKA 1QZEA 1LQBA 3NOBA 1KJTA 5DPWA 3H1UA 3DDCB 2PE6B 3IHPC 2NVUI 4MJSA 5AEKB 1WGGA 2C7NB 3AU5A 4DHZB 1P98A 1M94A 3HHMA 2WX1A 1GG3A 1HE8A 2L0FA 2LD9A 4AP4C 3DVGY 2BYEA 2KKCA 3N3KB 2NR2A 3QWZB 4N9F4 4E74A 4JLCA 2FIFA 2ZPNA 1YIWA 1XQQA 2BWFA 2K1FA 2GOWA 2N7DA 4KVGB 3VVWB 2YLMA 1XT9B 4K1RB 2JXXA 2C7HA 1H8CA 3ZDMC 2Z0EB 2KZRA 5G2NA 2MBBB 5HKHA 4MGZE 1WJNA 1EF5A 3PLVA 4DHJB 4XZ4A 2EKEC 4BBNF 3CSTA 2O6VB 3WANA 2R2QA 2ASQA 5BO4B 3T8MA 3ML9A 1Q1OA 2BKRB 3UGBB 3RCZA 2BYVE 1S3SG 2D2QA 3QQ8B 1NI2A 4P7IA 1F9JA 1WYWB 2BKFA 2HJ8A 3VHTC 2DZIA 4BOSC 2K25A 2KO3A 2DZJA 2MSED 3IBEA 3R66C 4NPNA 5FR6A 3EHVA 1I35A 4KDLB 3V60A 2LI5A 4B95A 4FADA 3H7SA 2V1YA 2RR9A 3DVGX 4WJOA 3S2AA 1P1AA 2PPHA 4MGYE 3VTWA 2CS4A 2NPTB 2KANA 4AWJA 3KH0A 4I6NB 3SHQA 3C0RB 1SIFA 4OVVA 3W1SA 2NBUA 3DVNU 4K7WA 4ANXA 1WXSA 1ISNA 3PS6A 4G3XB 2KTRA 3RD2A 4EZJA 2ZZPB 4PS7A 4GIVA 3WAPA 1CMXB 1SE9A 2KWVB 3OJ4B 4J6IA 2C60A 4AUQC 1TBEA 3PTFC 4MGIE 3ZW3A 1R4MI 2MA9B 3ZRFA 4HWIB 4JGHB 3DBSA 2KNBA 3ZUNA 3BINA 5CHVC 3EECA 4URKA 1V9JA 1ZKHA 4ASWC 1P9DU 3VFKA 4GU2A 4BKSD 4DBGA 2CHWA 2FAZA 4W9JA 3QARA 5C23A 1WGHA 3X23A 2LGYA 1VCBA 4HPLB 1T0YA 1WJ4A 3UIOB 5LXIB 4PYUA 2DX5B 2IY1B 5KHOA 3VAWA 3VTUA 2KJ6A 1RRBA 1WXMA 2W9NA 2ZEQA 4IC7B 2DZMA 4EOYA 3PRZA 5JH5C 2GBRA 4W9KA 3B0AA 3APCA 1UH6A 3ECIA 4MJSB 4KIKB 4M8MA 2Z59B 2G3QB 3AULA 2YVCA 4XX5A 3A1QB 2FCQA 4K7UA 4RMAA 2KWCA 3L10B 3ENEA 1J19A 2M4NA 5IA7A 2WX0A 3QJZA 3K9OB 1E7UA 2N7EA 1OQYA 2DYOA 3Q3FA 4HCPB 3VXWA 3L0WB 2N9XA 4IM3A 3VQIA 1GUAB 2JPHA 2KQSA 4K81A 4CHKA 2CKHB 3TL5A 1KOTA 4HLEA 4W9FA 4HXDA 4WWPA 3QCAA 1WF9A 1V6EA 4A3OA 2LUEA 3NZUA 3PLUA 1U4AA 2ZVNA 3L17A 1G6JA 3W1SC 2GBMA 2MBHA 4HDOA 1R4NI 4RM8A 2D10A 1A5RA 3JYUA 2K39A 2R2OA 4MSMB 3SD5A 3H7PB 1WIAA 2RD0A 1VD2A 4HJKA 2DAJA 5CHWA 4TQ1A 4DK5A 3V62A 1RAXA 1WZ0A 2K8BA 2GBJA 3QIJA 5DPRA 2D11A 2M17A 4TQ0A 2GBNA 2UWQA 4KSLC 2MX2A 1NDDA 3WIMA 2JRHA 3L54A 3PZDA 4F1SA 4GB9A 2KQ7A 4NY0A 2BYFA 2KJHB 4DWFA 4HCNB 2KHWB 5KHQA 1BT0A 4GXBA 2LRUA 4LJPB 5CHFA 3WA0A 2XBBC 3ZTDA 3A9KB 3SDLC 3PPAA 1ZGUB 2L8JA 4GDKB 1WJUA 4A3PA 2FCMA 2PEAA 1Y8RC 2O2VA 2EMTA 2LASA 1WZ3A 3WALA 2LGXA 3IVFA 4M8NA 1UBIA 4AJYB 2JZZA 1C1YB 2XEWA 3R3MA 4LDTD 2NCNA 4W9CA 2IZVB 1ZW7A 1IYFA 2RSUA 2KTFA 4IG7B 4XC2A 2LRWA 1P0RA 3DBRI 4F8CB 3EC8A 3LDZE 4FJYA 4ZDVA 2LZ6A 2N9EB 3DOWA 1TTNA 2MW5A 1GC6A 2KFKB 2KDFB 3MHSD 2O6VD 2LXAA 3ZNHB 4ZRKA 5D2MB 2KWUB 4HVBA 1YJ1A 1PQSA 4KV2A 3DVNV 2IYDB 2L7RA 3PV1A 1WX9A 2LVOA 4IWPA 4WWNA 4AJWA 4MELA 4DXAB 4BKGA 3KVFB 1WM2A 5D6JB 5IAAC 4CO7A 2FCNA 1Z2MA 2D07B 4NAWA 2K8CA 4DHZE 3PRPB 2OJRA 3QK0A 3ZNZB 3T9LA 2KMCA 3TCAA 2IY0B 4BOZB 3PHWB 3NZSA 4LJOB 1L7YA 5DCNA 4IWOA 2DYMA 4FJZA 4II3B 5AZHA 2JVCA 2WWZA 3BY4B 4B9KA 2DYBA 1WH3A 2M0XA 3L13A 5LXHA 4FN2A 4BKSA 1WRDB 2D3GA 2LJ5A 4KDIC 4FHJA 1GJZA 3R7RA 1GNUA 1XD3B 1UD7A 3JSVB 3QAQA 3OLMD 5DPSA 2FUHB 3L16A 1E8XA 4ANWA 2C9WB 2LWPA 1OTRB 1OEYA 2ZPYA 1WR6E 2CU1A 3VTVA 4NJ7A 3RYTA 3UIPB 3B1LX 1KLVA 4BFRA 3ALBA 3RT3B 4WJPA 3UINB 2I1JA 3AU4A 3ZRCA 5C1ZA 4F7ZA 4M0WB 3GOEA 2BWES 4IM2A 3W1YA 2PE9A 2AEHA 4KZCA 2J0MA 4NQKE 3VUXA 5JHAA 5D94A 2CHXA 3ZLZA 1YD8U 2Z0DB 1SGHA 3ZVVA 2DENB 3A9KA 1WMHA 3QHTA 3IFWB 2AYOB 3HK0A 4FLHA 2NBVB 3H9DA 3ZDTA 3DBHI 4ICVA 2KC2A 1FXTB 5L83A 1V2YA 3ZIMA 3M95A 3NS8A 2KK8A 5D7GA 5AZGA 2BGFA 4HK2A 2FNJB 1WGDA 2IO1B 3VUYA 1WE6A 4NQLB 3RULA 3ZTCA 4EEWA 4MGKE 2WDTB 3APDA 4LCDE 2RPQA 2CR5A 1V86A 2EMSA 1MG8A 1WY8A 2CHZA 2M1MA 3EFUA 4LDTB 5CX3A 4A20A 2ZVOA 1V5TA 3CF6E 4NJ6A 4RM9A 4W9HA 2MQJA 4HDQA 4BKTA 4ANVA 3A4RA 3MJWA 3PGEA 5E6PA 2AWTA 2JY6A 4PS3A 2M8SA 3QX1A 2MCNB 1UGMA 3A9JB 4OVUA 1E5WA 3WAOA 1WFYA 2J7QB 2JRIB 3AI5A 3HIZA 3ZKJC 2LVQA 4JL9A 4TKNA 4DDID 2PJHA 2XK5B 1J8CA 2NS5A 2LXCA 4EZLA 2C5LC 3VDZA 3WAMA 2MRPA 5L95C 3DCGA 3M63B 4EKUA 4DHJD 4JIOU 1E90A 3CSFA 1OEYJ 3NHEB 3N32A 3VH3B 2I1KA 4PS8A 1WMHB 2L05A 4B6WA 2A4ZA 2JZ3B 2KFJA 1E8ZA 2FIDA 3H7PA 3M62B 3PVLA 4HPMB 4W9EA 3HM3A 3OAWA 1WX7A 2G4SA 4KIKA 3U7DA 3X0WA 3K9PB 3N30A 2N4FA 1V5OA 2IBIB 4IWQA 2V3SA 2MP2B 3DQVA 2ZCBA 3TIXA 1IPGA 3M3JA 1TGZB 1S1QB 1H4RA 2JUOA 4MH0E 4II2B 2DZKA 2KD0A 1LXDA 4TUUA 4ZRJA 2J0JA 2FCSA 3H6NA 3RUIB 1UBQA 5J18A 5E6OA 3B08A 2L00B 4ZYNA 2KXJA 2KMAA 4BVUC 2O2VB 2XK5A 5DPTA 1Q0WB 2KDBA 2ZNVB 1UELA 5CTRC 3UQAA 2WYQA 3V6CB 2G45B 1WI0A 2L0TA 3GZNI 3ZNGC 3KYDD 2REXA 1V81A 3PT2B 2MWSB 3TMPB 4GMVA 1WR1A 2N1VA 4G0NB 1WE7A 2QHOA 2G4DB 4ICUA 4W9GA 4EUTA 1I42A 3V61A 2LVPA 4GDKA 3APFA 2HE7A 2NPTA 3A33B 1LM8B 1LFDA 2DHZA 2KN5A 4PYZA 1EUVB 4I6PA 3P2BA 4JQWC 2KDIA 4WWOA 3O65B 3HM6X 1WXAA 2RGFA 1WGYA 4WQOB 2L3ZA 2B3AA 1X1MA 2JWZA 2KOXA 4MDKE 3U30A 2MBQA 2NBWB 2GBKA 1K8RB 5LLIA 3RZFA 1C3TA 3SU8X 3DBLI 2K8HA 4EFOA 4AOFA 2BF8B 4KZ0A 2K6DB 3L08A 4GSWA 3A4SC 2LGDA 4GDLA 5EDSA 4FJVB 1YQBA 1E8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D32 A;  1V49 A;  1RFA A;  2JF5 A;  1E7V A;  2VRR B;  2ZCC A;  4G50 A;  5AZF A;  5TR5 A;  1WJ6 A;  2KC1 A;  5JZE B;  2MBE A;  2KX3 A;  3PRM B;  2MBO A;  1EO6 A;  2ZNV C;  2BPS A;  4W9I A;  4E3C A;  5JHB A;  2KDE B;  3A9J A;  4NAW B;  3ZNI D;  4YL8 A;  4K7S A;  3U8Z A;  4GOC A;  3VH4 B;  3CMM B;  3JSV A;  4GGQ A;  1WGR A;  2HD5 B;  2Y5B B;  3AXC A;  3I3T B;  5GMV A;  1IP9 A;  4IM0 A;  1AAR A;  2KFK A;  3MTN B;  1JRU A;  5G55 A;  3IG3 A;  4WJN A;  3LJ3 A;  3PSE B;  3A1Q A;  1TZ1 A;  4W9L A;  1NBF C;  2L76 A;  3UQB A;  4GN1 A;  3DPD A;  1E8Y A;  3PRE A;  4MEM A;  1EF1 A;  3R7Q A;  1Q5W B;  4WJQ A;  2AL3 A;  4FBJ B;  2MLB A;  5J2R A;  1OGW A;  2KTR B;  4WAA A;  2C7M B;  1UZX B;  4FA6 A;  1YX5 B;  4NNJ B;  4BBN C;  1RLF A;  4GDL B;  4MSQ B;  1WM3 A;  2KJR A;  4MM3 A;  3RZW C;  3TJP A;  3ML8 A;  2GMI C;  2V4L A;  2A5U A;  1YX6 B;  2IO0 B;  4DDG D;  4IUM B;  3JVZ X;  2ZJD A;  1L2N A;  4FUL A;  2DAF A;  4E71 A;  3QA8 A;  5J17 A;  2N9P C;  1V80 A;  4TV3 A;  2MP2 A;  3V6E B;  2IO2 B;  2KLC A;  4G11 A;  3TBL D;  3OJ3 A;  4ANU A;  2OOB B;  3JW0 X;  1KM7 A;  3ZO5 B;  2J0K A;  1WX8 A;  2HTH A;  4W9D A;  5E6N A;  2KVR A;  2UYZ B;  3NY5 A;  3Q3J A;  1D3Z A;  1WXV A;  3KW5 B;  2KX0 A;  3KUD B;  3PHX B;  4FHK A;  2IO3 B;  4X57 B;  2JT4 B;  3KUZ A;  3KUC B;  3KYC D;  3QC8 B;  1Z5S B;  2O6V A;  3ONS A;  3VUW A;  3UF8 A;  2K6Q A;  2KLG A;  1GC7 A;  1P3Q U;  4IW0 A;  2N1W A;  4CYE A;  1J0G A;  4KSK C;  2AL6 A;  4ZRI A;  4I6L B;  4EZK A;  1QZE A;  1LQB A;  3NOB A;  1KJT A;  5DPW A;  3H1U A;  3DDC B;  2PE6 B;  3IHP C;  2NVU I;  4MJS A;  5AEK B;  1WGG A;  2C7N B;  3AU5 A;  4DHZ B;  1P98 A;  1M94 A;  3HHM A;  2WX1 A;  1GG3 A;  1HE8 A;  2L0F A;  2LD9 A;  4AP4 C;  3DVG Y;  2BYE A;  2KKC A;  3N3K B;  2NR2 A;  3QWZ B;  4N9F 4;  4E74 A;  4JLC A;  2FIF A;  2ZPN A;  1YIW A;  1XQQ A;  2BWF A;  2K1F A;  2GOW A;  2N7D A;  4KVG B;  3VVW B;  2YLM A;  1XT9 B;  4K1R B;  2JXX A;  2C7H A;  1H8C A;  3ZDM C;  2Z0E B;  2KZR A;  5G2N A;  2MBB B;  5HKH A;  4MGZ E;  1WJN A;  1EF5 A;  3PLV A;  4DHJ B;  4XZ4 A;  2EKE C;  4BBN F;  3CST A;  2O6V B;  3WAN A;  2R2Q A;  2ASQ A;  5BO4 B;  3T8M A;  3ML9 A;  1Q1O A;  2BKR B;  3UGB B;  3RCZ A;  2BYV E;  1S3S G;  2D2Q A;  3QQ8 B;  1NI2 A;  4P7I A;  1F9J A;  1WYW B;  2BKF A;  2HJ8 A;  3VHT C;  2DZI A;  4BOS C;  2K25 A;  2KO3 A;  2DZJ A;  2MSE D;  3IBE A;  3R66 C;  4NPN A;  5FR6 A;  3EHV A;  1I35 A;  4KDL B;  3V60 A;  2LI5 A;  4B95 A;  4FAD A;  3H7S A;  2V1Y A;  2RR9 A;  3DVG X;  4WJO A;  3S2A A;  1P1A A;  2PPH A;  4MGY E;  3VTW A;  2CS4 A;  2NPT B;  2KAN A;  4AWJ A;  3KH0 A;  4I6N B;  3SHQ A;  3C0R B;  1SIF A;  4OVV A;  3W1S A;  2NBU A;  3DVN U;  4K7W A;  4ANX A;  1WXS A;  1ISN A;  3PS6 A;  4G3X B;  2KTR A;  3RD2 A;  4EZJ A;  2ZZP B;  4PS7 A;  4GIV A;  3WAP A;  1CMX B;  1SE9 A;  2KWV B;  3OJ4 B;  4J6I A;  2C60 A;  4AUQ C;  1TBE A;  3PTF C;  4MGI E;  3ZW3 A;  1R4M I;  2MA9 B;  3ZRF A;  4HWI B;  4JGH B;  3DBS A;  2KNB A;  3ZUN A;  3BIN A;  5CHV C;  3EEC A;  4URK A;  1V9J A;  1ZKH A;  4ASW C;  1P9D U;  3VFK A;  4GU2 A;  4BKS D;  4DBG A;  2CHW A;  2FAZ A;  4W9J A;  3QAR A;  5C23 A;  1WGH A;  3X23 A;  2LGY A;  1VCB A;  4HPL B;  1T0Y A;  1WJ4 A;  3UIO B;  5LXI B;  4PYU A;  2DX5 B;  2IY1 B;  5KHO A;  3VAW A;  3VTU A;  2KJ6 A;  1RRB A;  1WXM A;  2W9N A;  2ZEQ A;  4IC7 B;  2DZM A;  4EOY A;  3PRZ A;  5JH5 C;  2GBR A;  4W9K A;  3B0A A;  3APC A;  1UH6 A;  3ECI A;  4MJS B;  4KIK B;  4M8M A;  2Z59 B;  2G3Q B;  3AUL A;  2YVC A;  4XX5 A;  3A1Q B;  2FCQ A;  4K7U A;  4RMA A;  2KWC A;  3L10 B;  3ENE A;  1J19 A;  2M4N A;  5IA7 A;  2WX0 A;  3QJZ A;  3K9O B;  1E7U A;  2N7E A;  1OQY A;  2DYO A;  3Q3F A;  4HCP B;  3VXW A;  3L0W B;  2N9X A;  4IM3 A;  3VQI A;  1GUA B;  2JPH A;  2KQS A;  4K81 A;  4CHK A;  2CKH B;  3TL5 A;  1KOT A;  4HLE A;  4W9F A;  4HXD A;  4WWP A;  3QCA A;  1WF9 A;  1V6E A;  4A3O A;  2LUE A;  3NZU A;  3PLU A;  1U4A A;  2ZVN A;  3L17 A;  1G6J A;  3W1S C;  2GBM A;  2MBH A;  4HDO A;  1R4N I;  4RM8 A;  2D10 A;  1A5R A;  3JYU A;  2K39 A;  2R2O A;  4MSM B;  3SD5 A;  3H7P B;  1WIA A;  2RD0 A;  1VD2 A;  4HJK A;  2DAJ A;  5CHW A;  4TQ1 A;  4DK5 A;  3V62 A;  1RAX A;  1WZ0 A;  2K8B A;  2GBJ A;  3QIJ A;  5DPR A;  2D11 A;  2M17 A;  4TQ0 A;  2GBN A;  2UWQ A;  4KSL C;  2MX2 A;  1NDD A;  3WIM A;  2JRH A;  3L54 A;  3PZD A;  4F1S A;  4GB9 A;  2KQ7 A;  4NY0 A;  2BYF A;  2KJH B;  4DWF A;  4HCN B;  2KHW B;  5KHQ A;  1BT0 A;  4GXB A;  2LRU A;  4LJP B;  5CHF A;  3WA0 A;  2XBB C;  3ZTD A;  3A9K B;  3SDL C;  3PPA A;  1ZGU B;  2L8J A;  4GDK B;  1WJU A;  4A3P A;  2FCM A;  2PEA A;  1Y8R C;  2O2V A;  2EMT A;  2LAS A;  1WZ3 A;  3WAL A;  2LGX A;  3IVF A;  4M8N A;  1UBI A;  4AJY B;  2JZZ A;  1C1Y B;  2XEW A;  3R3M A;  4LDT D;  2NCN A;  4W9C A;  2IZV B;  1ZW7 A;  1IYF A;  2RSU A;  2KTF A;  4IG7 B;  4XC2 A;  2LRW A;  1P0R A;  3DBR I;  4F8C B;  3EC8 A;  3LDZ E;  4FJY A;  4ZDV A;  2LZ6 A;  2N9E B;  3DOW A;  1TTN A;  2MW5 A;  1GC6 A;  2KFK B;  2KDF B;  3MHS D;  2O6V D;  2LXA A;  3ZNH B;  4ZRK A;  5D2M B;  2KWU B;  4HVB A;  1YJ1 A;  1PQS A;  4KV2 A;  3DVN V;  2IYD B;  2L7R A;  3PV1 A;  1WX9 A;  2LVO A;  4IWP A;  4WWN A;  4AJW A;  4MEL A;  4DXA B;  4BKG A;  3KVF B;  1WM2 A;  5D6J B;  5IAA C;  4CO7 A;  2FCN A;  1Z2M A;  2D07 B;  4NAW A;  2K8C A;  4DHZ E;  3PRP B;  2OJR A;  3QK0 A;  3ZNZ B;  3T9L A;  2KMC A;  3TCA A;  2IY0 B;  4BOZ B;  3PHW B;  3NZS A;  4LJO B;  1L7Y A;  5DCN A;  4IWO A;  2DYM A;  4FJZ A;  4II3 B;  5AZH A;  2JVC A;  2WWZ A;  3BY4 B;  4B9K A;  2DYB A;  1WH3 A;  2M0X A;  3L13 A;  5LXH A;  4FN2 A;  4BKS A;  1WRD B;  2D3G A;  2LJ5 A;  4KDI C;  4FHJ A;  1GJZ A;  3R7R A;  1GNU A;  1XD3 B;  1UD7 A;  3JSV B;  3QAQ A;  3OLM D;  5DPS A;  2FUH B;  3L16 A;  1E8X A;  4ANW A;  2C9W B;  2LWP A;  1OTR B;  1OEY A;  2ZPY A;  1WR6 E;  2CU1 A;  3VTV A;  4NJ7 A;  3RYT A;  3UIP B;  3B1L X;  1KLV A;  4BFR A;  3ALB A;  3RT3 B;  4WJP A;  3UIN B;  2I1J A;  3AU4 A;  3ZRC A;  5C1Z A;  4F7Z A;  4M0W B;  3GOE A;  2BWE S;  4IM2 A;  3W1Y A;  2PE9 A;  2AEH A;  4KZC A;  2J0M A;  4NQK E;  3VUX A;  5JHA A;  5D94 A;  2CHX A;  3ZLZ A;  1YD8 U;  2Z0D B;  1SGH A;  3ZVV A;  2DEN B;  3A9K A;  1WMH A;  3QHT A;  3IFW B;  2AYO B;  3HK0 A;  4FLH A;  2NBV B;  3H9D A;  3ZDT A;  3DBH I;  4ICV A;  2KC2 A;  1FXT B;  5L83 A;  1V2Y A;  3ZIM A;  3M95 A;  3NS8 A;  2KK8 A;  5D7G A;  5AZG A;  2BGF A;  4HK2 A;  2FNJ B;  1WGD A;  2IO1 B;  3VUY A;  1WE6 A;  4NQL B;  3RUL A;  3ZTC A;  4EEW A;  4MGK E;  2WDT B;  3APD A;  4LCD E;  2RPQ A;  2CR5 A;  1V86 A;  2EMS A;  1MG8 A;  1WY8 A;  2CHZ A;  2M1M A;  3EFU A;  4LDT B;  5CX3 A;  4A20 A;  2ZVO A;  1V5T A;  3CF6 E;  4NJ6 A;  4RM9 A;  4W9H A;  2MQJ A;  4HDQ A;  4BKT A;  4ANV A;  3A4R A;  3MJW A;  3PGE A;  5E6P A;  2AWT A;  2JY6 A;  4PS3 A;  2M8S A;  3QX1 A;  2MCN B;  1UGM A;  3A9J B;  4OVU A;  1E5W A;  3WAO A;  1WFY A;  2J7Q B;  2JRI B;  3AI5 A;  3HIZ A;  3ZKJ C;  2LVQ A;  4JL9 A;  4TKN A;  4DDI D;  2PJH A;  2XK5 B;  1J8C A;  2NS5 A;  2LXC A;  4EZL A;  2C5L C;  3VDZ A;  3WAM A;  2MRP A;  5L95 C;  3DCG A;  3M63 B;  4EKU A;  4DHJ D;  4JIO U;  1E90 A;  3CSF A;  1OEY J;  3NHE B;  3N32 A;  3VH3 B;  2I1K A;  4PS8 A;  1WMH B;  2L05 A;  4B6W A;  2A4Z A;  2JZ3 B;  2KFJ A;  1E8Z A;  2FID A;  3H7P A;  3M62 B;  3PVL A;  4HPM B;  4W9E A;  3HM3 A;  3OAW A;  1WX7 A;  2G4S A;  4KIK A;  3U7D A;  3X0W A;  3K9P B;  3N30 A;  2N4F A;  1V5O A;  2IBI B;  4IWQ A;  2V3S A;  2MP2 B;  3DQV A;  2ZCB A;  3TIX A;  1IPG A;  3M3J A;  1TGZ B;  1S1Q B;  1H4R A;  2JUO A;  4MH0 E;  4II2 B;  2DZK A;  2KD0 A;  1LXD A;  4TUU A;  4ZRJ A;  2J0J A;  2FCS A;  3H6N A;  3RUI B;  1UBQ A;  5J18 A;  5E6O A;  3B08 A;  2L00 B;  4ZYN A;  2KXJ A;  2KMA A;  4BVU C;  2O2V B;  2XK5 A;  5DPT A;  1Q0W B;  2KDB A;  2ZNV B;  1UEL A;  5CTR C;  3UQA A;  2WYQ A;  3V6C B;  2G45 B;  1WI0 A;  2L0T A;  3GZN I;  3ZNG C;  3KYD D;  2REX A;  1V81 A;  3PT2 B;  2MWS B;  3TMP B;  4GMV A;  1WR1 A;  2N1V A;  4G0N B;  1WE7 A;  2QHO A;  2G4D B;  4ICU A;  4W9G A;  4EUT A;  1I42 A;  3V61 A;  2LVP A;  4GDK A;  3APF A;  2HE7 A;  2NPT A;  3A33 B;  1LM8 B;  1LFD A;  2DHZ A;  2KN5 A;  4PYZ A;  1EUV B;  4I6P A;  3P2B A;  4JQW C;  2KDI A;  4WWO A;  3O65 B;  3HM6 X;  1WXA A;  2RGF A;  1WGY A;  4WQO B;  2L3Z A;  2B3A A;  1X1M A;  2JWZ A;  2KOX A;  4MDK E;  3U30 A;  2MBQ A;  2NBW B;  2GBK A;  1K8R B;  5LLI A;  3RZF A;  1C3T A;  3SU8 X;  3DBL I;  2K8H A;  4EFO A;  4AOF A;  2BF8 B;  4KZ0 A;  2K6D B;  3L08 A;  4GSW A;  3A4S C;  2LGD A;  4GDL A;  5EDS A;  4FJV B;  1YQB A;  1E8W A; 
#chains in the Genus database with same CATH topology
 1V49 A;  2VRR B;  5TR5 A;  3AED B;  1UF0 A;  5JZE B;  2MBE A;  3PRM B;  4E3C A;  2ZNV C;  2UU7 A;  4GOC A;  3VH4 B;  3JSV A;  4NZL B;  5GMV A;  4IM0 A;  3MHZ A;  1AAR A;  2KFK A;  3MTN B;  1JRU A;  3TSS A;  3LJ3 A;  2WXM A;  2DBY A;  4GN1 A;  3W2D A;  1E8Y A;  4MEM A;  1EF1 A;  2AL3 A;  1UZX B;  4FA6 A;  2X38 A;  4NNJ B;  3TEZ A;  1I4G A;  1RLF A;  4MSQ B;  2KJR A;  4MM3 A;  4B0M A;  1D6E C;  3ABV B;  3TJP A;  1YX6 B;  1UUP A;  2ZJD A;  1HEZ E;  1GB4 A;  1HA5 A;  2E3T A;  3TBL D;  4ANU A;  1TS4 A;  3ZO5 B;  1XLO A;  3NY5 A;  2UYZ B;  4FHK A;  3KUD B;  1XO3 A;  3KUC B;  1Z5S B;  2O6V A;  3ONS A;  4P1C C;  3VUW A;  4XE0 A;  1QOA A;  1DOI A;  4KSK C;  2AL6 A;  1QZE A;  3R2T A;  3U7Z A;  3DDC B;  2PE6 B;  2NVU I;  1F2R C;  2BS2 B;  1GG3 A;  1SIJ A;  1YQ3 B;  1YMH E;  2KKC A;  1FPY A;  4JLC A;  3MP9 A;  3MFG A;  5H92 C;  1XT9 B;  2C7H A;  3ZDM C;  2KZR A;  2NTT A;  3NG0 A;  1LO5 D;  4XZ4 A;  3WAN A;  2R2Q A;  2BS3 B;  5BO4 B;  2LJI A;  3RCZ A;  2BYV E;  1S3S G;  2D2Q A;  4YSY B;  4P7I A;  3VHT C;  2Y5P A;  1VDV A;  4BOS C;  2MSE D;  3R66 C;  5FR6 A;  3EHV A;  1I35 A;  3N1Y C;  4FAD A;  2V1Y A;  2D3A A;  2CS4 A;  2NPT B;  2KDM A;  2WQY B;  4I6N B;  1DYQ A;  4ANX A;  1ISN A;  2QMT A;  3RD2 A;  5G5G A;  1CMX B;  3AEE B;  4ACF A;  3MC0 B;  3RFZ B;  1V1O A;  3DBS A;  1BUI C;  3ZUN A;  4R3D A;  1ZKH A;  4NJC A;  4ASW C;  1XF5 L;  1QIL A;  3Q14 C;  3VFK A;  1N5X A;  4DBG A;  5TSS A;  2JU6 X;  1C4P A;  3QAR A;  5C23 A;  2LGY A;  2RDH A;  1WJ4 A;  2XN9 C;  1FRD A;  1RRB A;  1WXM A;  2KJ6 A;  4IC7 B;  3ZJU A;  4EOY A;  3BWU D;  3IXS A;  3RNB C;  1L0V B;  2Z59 B;  2G3Q B;  4WH4 A;  2W3S A;  4XX5 A;  2FCQ A;  4K7U A;  5IA7 A;  2OED A;  3QJZ A;  3HVZ A;  4HCP B;  1OQY A;  4BZA A;  3FC4 A;  2N0S B;  1FRR A;  2CJO A;  3VQI A;  2JPH A;  2WU2 B;  1KOT A;  1J7A A;  4WWP A;  2VH2 A;  4A3O A;  1N62 A;  1QKZ A;  3PLU A;  4A9A A;  3L17 A;  1G6J A;  3N1Z C;  3W1S C;  1ET6 A;  3AE6 B;  4DXG A;  4RM8 A;  2D10 A;  2G1E A;  2K39 A;  4WAF A;  1WIA A;  2BQQ A;  1K52 A;  4L2Y A;  2FBW B;  4TQ1 A;  3I57 A;  4CQN A;  1WZ0 A;  3QIJ A;  2GBN A;  2UWQ A;  4KSL C;  2MX2 A;  2W3R A;  1YNT E;  1EU4 A;  2KQ4 X;  3AE2 B;  3AV8 A;  1T0Q C;  3Q8B A;  4DWF A;  2MEK A;  4HJG E;  1L6U A;  3SDL C;  1SJH D;  3PPA A;  1ZGU B;  4GDK B;  2DLB A;  1Y8R C;  1JML A;  3EFC A;  3WAL A;  2LGX A;  3IVF A;  2JYE A;  4OZC A;  1KTK A;  2XEW A;  3R3M A;  3P4Q B;  4XDC A;  4D2K A;  1SJE D;  2E6X A;  2IZV B;  1E7P B;  3DBL B;  1IYF A;  2RSU A;  4XC2 A;  3RI7 C;  4UDU C;  3DBR I;  3EC8 A;  2MW5 A;  1GC6 A;  2KDF B;  4ZRK A;  5D3D A;  3AE5 B;  3DVN V;  3UI3 A;  2L7R A;  3PV1 A;  1WX9 A;  1C76 A;  4AJW A;  2Z8L A;  2Q5W D;  4BKG A;  4CO7 A;  4DHZ E;  3PRP B;  3T9L A;  5G5H A;  4BOZ B;  3PHW B;  4LJO B;  5DCN A;  2WU5 B;  4FJZ A;  2JVC A;  2WWZ A;  3BY4 B;  3L13 A;  1K51 A;  4YTN B;  1JW9 D;  1WRD B;  3MJ5 A;  2XNA C;  1UD7 A;  3JSV B;  2FUH B;  2J4X A;  2LHE A;  3W5U B;  1JWU D;  2LGI A;  1OTR B;  4IOI E;  2ZPY A;  1WR6 E;  3AE9 B;  3RYT A;  3B1L X;  3AEG B;  1QOF A;  4IM2 A;  2AEH A;  2IGD A;  5D94 A;  2M19 A;  2G9H D;  2Z0D B;  1SGH A;  1VZ7 A;  2DEN B;  2WDV B;  3QHT A;  3IFW B;  1HTQ A;  1F52 A;  4ICV A;  3ZIM A;  5D7G A;  1TS2 A;  4BAX A;  3AE8 B;  3VUY A;  4NQL B;  3RUL A;  1YN4 A;  2CR5 A;  1V86 A;  2CHZ A;  3EFU A;  1B1Z A;  1NYQ A;  4LNO A;  3P4P B;  1XLP A;  5E6P A;  2AWT A;  2JY6 A;  2M8S A;  1WFY A;  3AI5 A;  3HIZ A;  4DDI D;  1CZP A;  4TKN A;  2PJH A;  3WAM A;  2MRP A;  5L95 C;  3DCG A;  4EKU A;  4DHJ D;  1GOZ A;  3B2G A;  1VRA B;  3NHE B;  4PS8 A;  2L05 A;  2A4Z A;  4A8X C;  3H7P A;  3M62 B;  3PVL A;  1N61 A;  3OAW A;  4KIK A;  1JCK B;  1WX7 A;  3AN1 A;  4ZOH C;  4RGM A;  4LLG M;  2QSD A;  3M3J A;  3VRB B;  4A90 A;  2HJ1 A;  1FNV A;  4TUU A;  2FCS A;  3CWI A;  4OW0 A;  3Q8F A;  2KMA A;  5DPT A;  1Q0W B;  2KDB A;  5JXV A;  3V6C B;  1WI0 A;  2KYW A;  3TMP B;  1R7S A;  1I42 A;  1MHH E;  4GDK A;  1EU3 A;  2RDG A;  2ZW1 A;  3P2B A;  1I4R A;  2KDI A;  4WWO A;  2AQ3 B;  2QJL A;  2B3A A;  4MDK E;  2KOX A;  5LLI A;  1E6E B;  3IAS 1;  1FCL A;  3A4S C;  3DHI C;  1TY0 A;  1P7F A;  4FJV B;  2AQ2 B;  5AUI A;  3D32 A;  5AZF A;  3C19 A;  1E7V A;  1WJ6 A;  2KC1 A;  3PZ7 A;  2PVO D;  1CJE A;  5JHB A;  3A9J A;  4K7S A;  2JYT A;  2J42 A;  4GGQ A;  3ZJV A;  1IP9 A;  3I3T B;  2WHI A;  2L1A A;  4WJN A;  3PSE B;  2AQ1 B;  1V8C A;  1TZ1 A;  4W9L A;  1QQR A;  3UQB A;  1WYG A;  3DBR B;  3GE8 C;  4WAA A;  2HDE A;  2PLP A;  1WM3 A;  1T5X D;  1A70 A;  4XDD A;  3URY A;  2K9X A;  5J17 A;  1J7C A;  2N9P C;  4TV3 A;  3V6E B;  1CK1 A;  2KLC A;  4G11 A;  2OOB B;  1E0Z A;  3JW0 X;  4W9D A;  2V3N A;  3Q3J A;  1AYF A;  1M4V A;  5C2T B;  1D3Z A;  1WXV A;  4X57 B;  4QAY A;  4PK1 A;  3KUZ A;  3UF8 A;  2KLG A;  1GC7 A;  4N59 A;  4CYE A;  2QC8 A;  2N9K A;  3BVZ A;  3NOB A;  3H1U A;  3PO0 A;  3IHP C;  5AEK B;  3AU5 A;  1PFD A;  1P98 A;  3B9J A;  3NVZ A;  4TMA B;  2BYE A;  2NR2 A;  4N9F 4;  2JXT A;  4E74 A;  1TY2 A;  4K3B A;  1R4N B;  1YIW A;  1ZDX A;  3NRZ A;  3PLV A;  1EF5 A;  4MGZ E;  5LNK 1;  3CST A;  2ASQ A;  1Q1O A;  2BKR B;  1C79 A;  1LGR A;  5E6J A;  1NI2 A;  1F9J A;  1BML C;  3IBE A;  1WGK A;  2RR9 A;  2INC C;  2IDY A;  4M00 A;  4KGR A;  2W54 A;  1OFF A;  1PGB A;  3AE1 B;  3SHQ A;  2NBU A;  4K7W A;  2DNF A;  4EZJ A;  3PS6 A;  4G3X B;  2KTR A;  2ZZP B;  4PS7 A;  2OJW A;  1SE9 A;  3LYY A;  3OJ4 B;  2WXQ A;  4MGI E;  4HWI B;  1YN3 A;  4JGH B;  3BIN A;  3EEC A;  4GLS C;  3ZYY X;  2VZK D;  2PTL A;  2FAZ A;  4W9J A;  4HPL B;  5LXI B;  2D3C A;  2DX5 B;  1NYR A;  2IY1 B;  5KHO A;  5JH5 C;  4W9K A;  1WXQ A;  3B0A A;  3APC A;  1YJJ A;  4MJS B;  1C78 A;  2NTS A;  3MC8 A;  4RGO S;  1TKG A;  3RMK C;  4RMA A;  2JQR B;  1E7U A;  2N7E A;  2DYO A;  3BVM A;  2N7J A;  4C7Y A;  4IM3 A;  1JQ4 A;  1PDX A;  2KQS A;  4CHK A;  3TL5 A;  1UWX A;  1TKE A;  1L0Y B;  3RNA C;  3NVY A;  4W9F A;  4HXD A;  1WF9 A;  2LUE A;  1U4A A;  2ZVN A;  2GBM A;  3ZJT A;  3IT4 B;  3JYU A;  2R2O A;  3SD5 A;  1L5P A;  3H7P B;  4HJK A;  1VD2 A;  5CHW A;  3V62 A;  2GBJ A;  2D11 A;  4TQ0 A;  2BB6 A;  1F0Z A;  2WGS A;  4F1S A;  4GB9 A;  1L6V A;  1YJI A;  2KJH B;  1RFK A;  4GXB A;  2LRU A;  5CHF A;  1D5M C;  3Q8C A;  2R61 A;  3KWL A;  3ZTD A;  5EE1 A;  2L8J A;  2EMT A;  3FIL A;  1DGJ A;  4M8N A;  1XEE A;  2JZZ A;  1C1Y B;  1ET9 A;  3ZXV A;  1FXI A;  4ZHO A;  3E56 A;  1ZW7 A;  2H88 B;  2LRW A;  2I38 A;  3LDZ E;  4ARI A;  4ZDV A;  2N9E B;  1TTN A;  3AB5 A;  2KFK B;  2B76 B;  2O6V D;  4HVB A;  2BVC A;  3HRD D;  1YJ1 A;  1V1P A;  3RPF C;  4AS1 A;  4WWN A;  4LNN A;  4DXA B;  1F2R I;  3KVF B;  1Z2M A;  2D07 B;  4NAW A;  2K8C A;  3O13 A;  4XGA B;  3QK0 A;  4A6Q A;  2IY0 B;  3N1X C;  3NZS A;  1L7Y A;  2PW9 A;  4B9K A;  1T0R C;  1WH3 A;  2M0X A;  5LXH A;  1KH0 A;  4FN2 A;  1PGX A;  3BYY B;  1ENF A;  1GJZ A;  3R7R A;  1GNU A;  1XD3 B;  3QAQ A;  5DPS A;  1QOB A;  1FMA D;  3NVW A;  2C9W B;  2EEL A;  5GXG B;  3VTV A;  1KLV A;  3ALB A;  3RT3 B;  2I1J A;  3NZ3 A;  3NUH B;  4M0W B;  3GOE A;  2BWE S;  3AEF B;  3W1Y A;  3B2F A;  3ZLZ A;  3P4S B;  1FD6 A;  2BB5 A;  3ZVV A;  1FNU A;  1IGD A;  3VRA B;  2AYO B;  3HK0 A;  2NBV B;  3H9D A;  3R2I A;  1NI3 A;  2CJN A;  2KT7 A;  2GLS A;  4XWT A;  5L83 A;  1SF0 A;  2BGF A;  4HK2 A;  1WGD A;  2PIA A;  4O1N A;  1WE6 A;  4MGK E;  3APD A;  1WWT A;  2GRI A;  2WXF A;  4RFB A;  1MG8 A;  5CX3 A;  2IJ0 A;  2ZVO A;  2JX5 A;  4NJ6 A;  2MQJ A;  4RGN A;  3RN9 C;  3A4R A;  1SB3 C;  2MH7 A;  4PS3 A;  3QX1 A;  2MCN B;  3A9J B;  3WAO A;  1E5W A;  4M01 A;  4MT5 A;  2JRI B;  4RF1 A;  3AE7 B;  1TIF A;  4JIO U;  1E90 A;  1VJK A;  3CSF A;  3ETR A;  4OZB A;  2I1K A;  2X8X X;  2FID A;  2ZW0 A;  1XLQ A;  2G4S A;  3X0W A;  3K9P B;  2N4F A;  1V5O A;  1ESF A;  1ZXH A;  2MP2 B;  3TIX A;  5FR3 A;  4JWS C;  5IO9 A;  2JUO A;  4RNA A;  2KD0 A;  4ZRJ A;  2J0J A;  3H6N A;  1UBQ A;  4ZYS A;  5E6O A;  2V9H A;  4P16 A;  1YN5 A;  1NEK B;  3VR8 B;  2WYQ A;  2L0T A;  3GZN I;  3ZNG C;  4C00 A;  1KLG D;  2N1V A;  3IAM 1;  2LVP A;  3GS2 A;  2L83 A;  2HE7 A;  2WS3 B;  2Y3A A;  1ROE A;  2DHZ A;  2KN5 A;  3DHG C;  4JQW C;  1WXA A;  2RGF A;  1JRO A;  4WQO B;  2JWZ A;  3U30 A;  1HQR D;  3RZF A;  1C3T A;  3SU8 X;  3DBL I;  3HVD A;  2BF8 B;  4S0R A;  3LB8 C;  1V1P B;  2JF5 A;  4G50 A;  2MBO A;  1FNW A;  1V97 A;  3ZNI D;  2H89 B;  4YL8 A;  1D4B A;  5T8I A;  2HD5 B;  1AWD A;  3AXC A;  3W5V B;  1QF6 A;  2N9L A;  3AMZ A;  1MG4 A;  3H8H A;  3IG3 A;  3A1Q A;  2QDF A;  1R4M B;  2EKI A;  3Q3O C;  2L76 A;  1FFU A;  3DPD A;  1SE3 A;  2PKO A;  3PRE A;  4WJQ A;  1EWY C;  1OGW A;  2NMQ A;  1TT5 B;  2KTR B;  4BBN C;  3E9S A;  4XYC A;  1C4A A;  2BW2 A;  2WXN A;  2GMI C;  2V4L A;  2IO0 B;  4DDG D;  3JVZ X;  1L2N A;  4FUL A;  2DAF A;  3EGR A;  4OZA A;  1V80 A;  2MP2 A;  4ZHP A;  2IO2 B;  2DWQ A;  2J0K A;  4C56 C;  1WX8 A;  3KW5 B;  2IO3 B;  3RNG C;  5I4D A;  2JT4 B;  3KYC D;  3AM9 A;  3QC8 B;  2K6Q A;  4HRO A;  1MFW A;  3IT6 B;  1TS3 A;  4KGT A;  1N5W A;  4ZRI A;  1SBB B;  1LQB A;  2KVZ A;  4P6V F;  5DPW A;  1JWB D;  1OQR A;  1XXG A;  3T3O A;  2ONQ A;  1M94 A;  2LD9 A;  1HE8 A;  2L0F A;  1DOX A;  3DVG Y;  5IP4 D;  3QWZ B;  2MHJ A;  2FIF A;  2YEP B;  4USA A;  1XQQ A;  1MJD A;  2K1F A;  3AEC B;  2N7D A;  4KVG B;  3VVW B;  2YLM A;  4K1R B;  2MJD A;  1K50 A;  2SEB D;  4BBN F;  2EKE C;  3T8M A;  3UGB B;  2WXH A;  3QQ8 B;  1VR9 A;  2DZI A;  2DZJ A;  1B9R A;  1N60 A;  1D5Z C;  5HG2 A;  4B95 A;  2AX5 A;  3H7S A;  1JWS D;  1L4D B;  3AH7 A;  3VTW A;  4AWJ A;  3W1S A;  1WXS A;  2VZK B;  4GIV A;  4US9 A;  3FAH A;  3PTF C;  1R4M I;  2MA9 B;  1C9F A;  2KNB A;  3Q6B A;  4YT0 B;  2W82 A;  4JWU C;  4URK A;  1V9J A;  5AUK A;  4BKS D;  4MAC A;  2CHW A;  1GAQ B;  1WGH A;  1Q10 A;  1T0Y A;  2KN4 A;  1NVI D;  4PYU A;  3VAW A;  2W9N A;  2DZM A;  1ZE3 D;  1UH6 A;  3OWE B;  3ECI A;  4KIK B;  4M8M A;  2WXJ A;  3DBH B;  2YVC A;  3A1Q B;  1IGC A;  4DQO C;  2KWC A;  3L10 B;  4LNI A;  2RMM A;  3ENE A;  2M4N A;  4KKJ A;  4JPS A;  2WX0 A;  5D3I B;  5FK9 C;  3BK1 A;  3L0W B;  4C80 A;  4WIP A;  1I4X A;  2CKH B;  1KLU D;  4Q2J A;  3BII D;  3FIL B;  2WNM A;  1EWC A;  1N63 A;  3U2S C;  2MBH A;  1FCC C;  4HDO A;  4REZ A;  1RYJ A;  1HZ5 A;  5MPO A;  1SXT A;  2RD0 A;  2DAJ A;  4DK5 A;  1RAX A;  2JSV X;  1F77 A;  1SE4 A;  5DPR A;  3WIM A;  2JRH A;  3N20 C;  1HTO A;  3SEB A;  5C3J B;  4NY0 A;  3AE3 B;  1I4Q A;  4HCN B;  2KHW B;  2WLB A;  3WA0 A;  2VH1 A;  1VLB A;  1WJU A;  2FCM A;  2PEA A;  4WUR A;  4RF0 A;  1UBI A;  4AJY B;  2KWD A;  4LDT D;  4HRS A;  3ZGZ A;  4NAM A;  2K3U A;  4FJY A;  2LZ6 A;  3AE4 B;  1UGJ A;  4FXC A;  5D2M B;  3GP7 A;  4KV2 A;  1PQS A;  3BK2 A;  2IYD B;  4IWP A;  3BYT B;  2LVO A;  2BYT A;  4MEL A;  1WM2 A;  3P42 A;  4M0W A;  5D6J B;  2FCN A;  4C7Z A;  1FO4 A;  3ZQ4 A;  2OJR A;  3ZNZ B;  2KMC A;  3TCA A;  2QEJ C;  3GE3 C;  4IWO A;  2DYM A;  1RWS A;  2DYB A;  1WRI A;  1ZUD 2;  3P1M A;  3EUB 2;  4BKS A;  3T3N A;  2V0G A;  3NJT A;  5EE3 A;  4KDI C;  2LJ5 A;  3OLM D;  2QIL A;  1E8X A;  1KF6 B;  2K5P A;  4L1B A;  2PVG C;  2LWP A;  3J9C A;  1OEY A;  3P4R B;  2CU1 A;  4NJ7 A;  3UIP B;  1ZOY B;  4BFR A;  4WJP A;  3UIN B;  3AU4 A;  3ZRC A;  4F7Z A;  4M02 A;  2PE9 A;  4KZC A;  3VUX A;  4J3O D;  4AQ7 A;  1YD8 U;  2LEK A;  1JWM D;  3TUO A;  3A9K A;  3DHH C;  2PMV A;  3ZDT A;  4FLH A;  2BT6 A;  4JX1 C;  1ZPS A;  2KC2 A;  1EM7 A;  3M95 A;  5AZG A;  3Q3N C;  5EE9 A;  2J53 A;  2M56 B;  4EEW A;  4KX6 B;  2WDT B;  4LCD E;  1QLB B;  4LDT B;  2EMS A;  1WY8 A;  4A20 A;  1AW7 A;  2CU3 A;  1K53 A;  3CF6 E;  3RNE C;  4HKQ A;  4RM9 A;  2FUG 1;  1E9M A;  4ANV A;  3PGE A;  4S17 A;  5BMH A;  1UGM A;  1N6Z A;  4OVU A;  2BTE A;  2J7Q B;  1J8C A;  4JL9 A;  2C5L C;  3VDZ A;  1I7H A;  1QT9 A;  1C77 A;  1OEY J;  5IKC M;  2JZ3 B;  4HPM B;  1JRP A;  3HM3 A;  3SFE B;  3N30 A;  4C4V A;  3PZ8 A;  5BMG A;  4IWQ A;  1NEN B;  1ZDV A;  2WDQ B;  2ZCB A;  1MHX A;  1MI0 A;  1TGZ B;  1S1Q B;  4LNK A;  1H4R A;  4II2 B;  2DZK A;  1Y56 A;  2JWU A;  5J18 A;  4ZYN A;  4BVU C;  2XK5 A;  5CTR C;  1YQ4 B;  3UQA A;  3V05 A;  3KYD D;  2MWS B;  4GMV A;  1WR1 A;  1BXT A;  2LFI A;  4G0N B;  1WE7 A;  2QHO A;  2G4D B;  4EUT A;  4L23 A;  1EUV B;  2V4I B;  4I6P A;  2RDB C;  1MVK A;  1WGY A;  1X1M A;  2Y5C A;  3P63 A;  2NBW B;  1K8R B;  5HFY A;  4PT5 A;  2K8H A;  4AOF A;  1L4Z B;  2K6D B;  2INN E;  3L08 A;  5EDS A;  1XCQ L;  3I5J C;  3OG5 A;  1HXY D;  1YQB A;  1E8W A;  1RFA A;  2ZCC A;  2KX3 A;  1WSP A;  1EO6 A;  3Q8E A;  2BPS A;  4W9I A;  2KDE B;  4NAW B;  1FEH A;  3U8Z A;  3CMM B;  4MM3 B;  1WGR A;  2MJ3 A;  2Y5B B;  3ZXR A;  2QCZ A;  3DWG C;  5G55 A;  1C4C A;  1NBF C;  4FBJ B;  3R7Q A;  5J2R A;  1Q5W B;  2MLB A;  2C7M B;  1YX5 B;  3GB1 A;  4GDL B;  5BYQ A;  5IN7 A;  2BS4 B;  3RZW C;  4OVZ A;  3W9C B;  2JZP A;  1ACC A;  3ML8 A;  1IBX A;  2IGH A;  2A5U A;  1FXA A;  4IUM B;  4A55 A;  5FKA C;  4E71 A;  3QA8 A;  2KAC A;  1SE2 A;  3WCQ A;  3LXF A;  3OJ3 A;  1KM7 A;  2KAJ A;  3SR6 A;  2HTH A;  5E6N A;  2KVR A;  3KLS X;  3PHX B;  2KX0 A;  2IGG A;  3C8Y A;  1P3Q U;  4IW0 A;  2N1W A;  4EE2 A;  1J0G A;  4I6L B;  4EZK A;  2LUM A;  1KJT A;  4MJS A;  1WGG A;  2C7N B;  4YWG G;  4DHZ B;  3HHM A;  2WX1 A;  4AP4 C;  5HI1 A;  2GI9 A;  3N3K B;  1F1H A;  4ZRQ A;  2ZPN A;  2WDR B;  2BWF A;  2GOW A;  2INP E;  2JXX A;  1H8C A;  2Z0E B;  5G2N A;  2MBB B;  5HKH A;  1WJN A;  4DHJ B;  2O6V B;  3ML9 A;  4LTU A;  2V3P A;  1SSN A;  1SEB D;  1WYW B;  2BKF A;  2HJ8 A;  4ARC A;  2K25 A;  2KO3 A;  4NPN A;  4KDL B;  3V60 A;  2LI5 A;  3MC9 A;  1ZXI A;  4DXF A;  3DVG X;  4WJO A;  3S2A A;  3NS1 A;  1P1A A;  2PPH A;  4MGY E;  4RGT A;  2KAN A;  3KH0 A;  3C0R B;  1SIF A;  1UWM A;  4OVV A;  4YSZ B;  3DVN U;  5BYS A;  2WXI A;  3WAP A;  1PGA A;  2KWV B;  2K0P A;  1VZ8 A;  4J6I A;  2C60 A;  4AUQ C;  1TBE A;  3Q8A A;  3ZW3 A;  3ZRF A;  4K3C A;  3U4E G;  4LK0 M;  2WXL A;  5CHV C;  2SAK A;  1P9D U;  3VR9 B;  2WXO A;  1FFV A;  4GU2 A;  1FM0 D;  4WQM A;  3BVG A;  3L4P A;  2L32 A;  1OQQ A;  3X23 A;  1VCB A;  3UIO B;  1KFY B;  3VTU A;  2ZEQ A;  3PRZ A;  3CIR B;  2GBR A;  3V3X A;  1DOY A;  4YTM B;  3AUL A;  2D3B A;  3I63 C;  4WWM A;  1J19 A;  1PUT A;  3K9O B;  3Q3F A;  2OHF A;  3VXW A;  2IND C;  2J52 A;  3EA6 A;  2N9X A;  4IDI A;  1GUA B;  5H8Y E;  4K81 A;  3U52 E;  4HLE A;  1TKY A;  1XLN A;  3QCA A;  1V6E A;  3NZU A;  1STE A;  5IOI A;  1T6B X;  2WP9 B;  1R4N I;  5HHD G;  1A5R A;  4MSM B;  2WXK A;  4KKI A;  1IUE A;  3Q2A C;  1IBX B;  2K8B A;  4C4V B;  3TEX A;  2M17 A;  3SFD B;  1NDD A;  3PZD A;  3L54 A;  2KQ7 A;  1HZ6 A;  2BYF A;  5KHQ A;  1BT0 A;  3N9Y C;  2LGS A;  4LJP B;  2XBB C;  1YOV B;  3A9K B;  2YEP F;  4OHJ A;  4A3P A;  1TYG B;  2O2V A;  2LAS A;  1WZ3 A;  2D5G A;  3RNC C;  3KWV A;  1T3Q A;  4YTP B;  4TSS A;  2BBC A;  5BMI A;  4MH8 A;  2NCN A;  4W9C A;  2KTF A;  4IG7 B;  1ZP0 B;  1P0R A;  4F8C B;  2WXG A;  4HPP A;  3DOW A;  4IKG A;  3MHS D;  1GPX A;  1E10 A;  2QIE B;  2LXA A;  3ZNH B;  3Q3M C;  2KWU B;  2TSS A;  1MPE A;  2GB1 A;  1I4H A;  5IAA C;  3TEW A;  1D5X C;  4II3 B;  5AZH A;  3NVV A;  4N6E B;  4RCO A;  3GZN B;  2D3G A;  4FHJ A;  4N58 A;  3L16 A;  4ITK A;  4H2A A;  4ANW A;  3AEB B;  1KRH A;  1TS5 A;  1RM6 C;  1UNS A;  4YSX B;  1JWA D;  2WXR A;  4ZRP A;  5C1Z A;  4HKZ E;  1CQV A;  5JHA A;  2J0M A;  4NQK E;  4RH6 A;  1TZO A;  2CHX A;  1WMH A;  2ICI A;  3DBH I;  1AN8 A;  1FXT B;  1V2Y A;  3NS8 A;  2LMC A;  2KK8 A;  2FNJ B;  2IO1 B;  1FIQ A;  4LNF A;  3ZTC A;  1TJE A;  2RPQ A;  3HUI A;  2K22 A;  2M1M A;  2WXP A;  4P1B C;  1V5T A;  4W9H A;  3Q69 A;  1L0X B;  4HDQ A;  4BKT A;  3RNF C;  3MJW A;  2FE8 A;  2L52 A;  2ON8 A;  2HTM E;  1I4P A;  3ZKJ C;  2LVQ A;  4JE3 B;  2XK5 B;  2NS5 A;  2LXC A;  2MJE A;  4EZL A;  1PYW D;  1JAL A;  3M63 B;  1T0S C;  3N32 A;  3VH3 B;  1WMH B;  4B6W A;  5BYR A;  2KFJ A;  1E8Z A;  3KQ4 A;  3BZD B;  1XCT L;  4W9E A;  3U7D A;  2IBI B;  2V3S A;  1J7B A;  3DQV A;  2I2Y A;  1IPG A;  1QOG A;  1P7E A;  4KGS A;  4MH0 E;  2M0A A;  1LXD A;  3RUI B;  3B08 A;  2L00 B;  2KXJ A;  3AEA B;  2O2V B;  2ZNV B;  1UEL A;  2LHD A;  2G45 B;  2IPK D;  2REX A;  1V81 A;  3PT2 B;  3R8B A;  4ICU A;  4W9G A;  4XWW A;  3V61 A;  4YXD B;  2KMM A;  2W55 A;  3APF A;  5EE0 A;  2NPT A;  3A33 B;  1LM8 B;  1LFD A;  4PYZ A;  1VZ6 A;  3O65 B;  3HM6 X;  3TEY A;  4US8 A;  1GB1 A;  2L3Z A;  2ACZ B;  2MBQ A;  2GBK A;  3FKY A;  4EFO A;  4KZ0 A;  4B0E A;  2RPV A;  4GSW A;  4GDL A;  2LGD A;  3DWM A;  3I9V 1;  4HEA 1; 
#chains in the Genus database with same CATH homology
 3D32 A;  1V49 A;  1RFA A;  2JF5 A;  1E7V A;  2VRR B;  2ZCC A;  4G50 A;  5AZF A;  5TR5 A;  1WJ6 A;  2KC1 A;  5JZE B;  2MBE A;  2KX3 A;  3PRM B;  2MBO A;  1EO6 A;  2ZNV C;  2BPS A;  4W9I A;  4E3C A;  5JHB A;  2KDE B;  3A9J A;  4NAW B;  3ZNI D;  4YL8 A;  4K7S A;  3U8Z A;  4GOC A;  3VH4 B;  3CMM B;  3JSV A;  4GGQ A;  1WGR A;  2HD5 B;  2Y5B B;  3AXC A;  3I3T B;  5GMV A;  1IP9 A;  4IM0 A;  1AAR A;  2KFK A;  3MTN B;  1JRU A;  5G55 A;  3IG3 A;  4WJN A;  3LJ3 A;  3PSE B;  3A1Q A;  1TZ1 A;  4W9L A;  1NBF C;  2L76 A;  3UQB A;  4GN1 A;  3DPD A;  1E8Y A;  3PRE A;  4MEM A;  1EF1 A;  3R7Q A;  1Q5W B;  4WJQ A;  2AL3 A;  4FBJ B;  2MLB A;  5J2R A;  1OGW A;  2KTR B;  4WAA A;  2C7M B;  1UZX B;  4FA6 A;  1YX5 B;  4NNJ B;  4BBN C;  1RLF A;  4GDL B;  4MSQ B;  1WM3 A;  2KJR A;  4MM3 A;  3RZW C;  3TJP A;  3ML8 A;  2GMI C;  2V4L A;  2A5U A;  1YX6 B;  2IO0 B;  4DDG D;  4IUM B;  3JVZ X;  2ZJD A;  1L2N A;  4FUL A;  2DAF A;  4E71 A;  3QA8 A;  5J17 A;  2N9P C;  1V80 A;  4TV3 A;  2MP2 A;  3V6E B;  2IO2 B;  2KLC A;  4G11 A;  3TBL D;  3OJ3 A;  4ANU A;  2OOB B;  3JW0 X;  1KM7 A;  3ZO5 B;  2J0K A;  1WX8 A;  2HTH A;  4W9D A;  5E6N A;  2KVR A;  2UYZ B;  3NY5 A;  3Q3J A;  1D3Z A;  1WXV A;  3KW5 B;  2KX0 A;  3KUD B;  3PHX B;  4FHK A;  2IO3 B;  4X57 B;  2JT4 B;  3KUZ A;  3KUC B;  3KYC D;  3QC8 B;  1Z5S B;  2O6V A;  3ONS A;  3VUW A;  3UF8 A;  2K6Q A;  2KLG A;  1GC7 A;  1P3Q U;  4IW0 A;  2N1W A;  4CYE A;  1J0G A;  4KSK C;  2AL6 A;  4ZRI A;  4I6L B;  4EZK A;  1QZE A;  1LQB A;  3NOB A;  1KJT A;  5DPW A;  3H1U A;  3DDC B;  2PE6 B;  3IHP C;  2NVU I;  4MJS A;  5AEK B;  1WGG A;  2C7N B;  3AU5 A;  4DHZ B;  1P98 A;  1M94 A;  3HHM A;  2WX1 A;  1GG3 A;  1HE8 A;  2L0F A;  2LD9 A;  4AP4 C;  3DVG Y;  2BYE A;  2KKC A;  3N3K B;  2NR2 A;  3QWZ B;  4N9F 4;  4E74 A;  4JLC A;  2FIF A;  2ZPN A;  1YIW A;  1XQQ A;  2BWF A;  2K1F A;  2GOW A;  2N7D A;  4KVG B;  3VVW B;  2YLM A;  1XT9 B;  4K1R B;  2JXX A;  2C7H A;  1H8C A;  3ZDM C;  2Z0E B;  2KZR A;  5G2N A;  2MBB B;  5HKH A;  4MGZ E;  1WJN A;  1EF5 A;  3PLV A;  4DHJ B;  4XZ4 A;  2EKE C;  4BBN F;  3CST A;  2O6V B;  3WAN A;  2R2Q A;  2ASQ A;  5BO4 B;  3T8M A;  3ML9 A;  1Q1O A;  2BKR B;  3UGB B;  3RCZ A;  2BYV E;  1S3S G;  2D2Q A;  3QQ8 B;  1NI2 A;  4P7I A;  1F9J A;  1WYW B;  2BKF A;  2HJ8 A;  3VHT C;  2DZI A;  4BOS C;  2K25 A;  2KO3 A;  2DZJ A;  2MSE D;  3IBE A;  3R66 C;  4NPN A;  5FR6 A;  3EHV A;  1I35 A;  4KDL B;  3V60 A;  2LI5 A;  4B95 A;  4FAD A;  3H7S A;  2V1Y A;  2RR9 A;  3DVG X;  4WJO A;  3S2A A;  1P1A A;  2PPH A;  4MGY E;  3VTW A;  2CS4 A;  2NPT B;  2KAN A;  4AWJ A;  3KH0 A;  4I6N B;  3SHQ A;  3C0R B;  1SIF A;  4OVV A;  3W1S A;  2NBU A;  3DVN U;  4K7W A;  4ANX A;  1WXS A;  1ISN A;  3PS6 A;  4G3X B;  2KTR A;  3RD2 A;  4EZJ A;  2ZZP B;  4PS7 A;  4GIV A;  3WAP A;  1CMX B;  1SE9 A;  2KWV B;  3OJ4 B;  4J6I A;  2C60 A;  4AUQ C;  1TBE A;  3PTF C;  4MGI E;  3ZW3 A;  1R4M I;  2MA9 B;  3ZRF A;  4HWI B;  4JGH B;  3DBS A;  2KNB A;  3ZUN A;  3BIN A;  5CHV C;  3EEC A;  4URK A;  1V9J A;  1ZKH A;  4ASW C;  1P9D U;  3VFK A;  4GU2 A;  4BKS D;  4DBG A;  2CHW A;  2FAZ A;  4W9J A;  3QAR A;  5C23 A;  1WGH A;  3X23 A;  2LGY A;  1VCB A;  4HPL B;  1T0Y A;  1WJ4 A;  3UIO B;  5LXI B;  4PYU A;  2DX5 B;  2IY1 B;  5KHO A;  3VAW A;  3VTU A;  2KJ6 A;  1RRB A;  1WXM A;  2W9N A;  2ZEQ A;  4IC7 B;  2DZM A;  4EOY A;  3PRZ A;  5JH5 C;  2GBR A;  4W9K A;  3B0A A;  3APC A;  1UH6 A;  3ECI A;  4MJS B;  4KIK B;  4M8M A;  2Z59 B;  2G3Q B;  3AUL A;  2YVC A;  4XX5 A;  3A1Q B;  2FCQ A;  4K7U A;  4RMA A;  2KWC A;  3L10 B;  3ENE A;  1J19 A;  2M4N A;  5IA7 A;  2WX0 A;  3QJZ A;  3K9O B;  1E7U A;  2N7E A;  1OQY A;  2DYO A;  3Q3F A;  4HCP B;  3VXW A;  3L0W B;  2N9X A;  4IM3 A;  3VQI A;  1GUA B;  2JPH A;  2KQS A;  4K81 A;  4CHK A;  2CKH B;  3TL5 A;  1KOT A;  4HLE A;  4W9F A;  4HXD A;  4WWP A;  3QCA A;  1WF9 A;  1V6E A;  4A3O A;  2LUE A;  3NZU A;  3PLU A;  1U4A A;  2ZVN A;  3L17 A;  1G6J A;  3W1S C;  2GBM A;  2MBH A;  4HDO A;  1R4N I;  4RM8 A;  2D10 A;  1A5R A;  3JYU A;  2K39 A;  2R2O A;  4MSM B;  3SD5 A;  3H7P B;  1WIA A;  2RD0 A;  1VD2 A;  4HJK A;  2DAJ A;  5CHW A;  4TQ1 A;  4DK5 A;  3V62 A;  1RAX A;  1WZ0 A;  2K8B A;  2GBJ A;  3QIJ A;  5DPR A;  2D11 A;  2M17 A;  4TQ0 A;  2GBN A;  2UWQ A;  4KSL C;  2MX2 A;  1NDD A;  3WIM A;  2JRH A;  3L54 A;  3PZD A;  4F1S A;  4GB9 A;  2KQ7 A;  4NY0 A;  2BYF A;  2KJH B;  4DWF A;  4HCN B;  2KHW B;  5KHQ A;  1BT0 A;  4GXB A;  2LRU A;  4LJP B;  5CHF A;  3WA0 A;  2XBB C;  3ZTD A;  3A9K B;  3SDL C;  3PPA A;  1ZGU B;  2L8J A;  4GDK B;  1WJU A;  4A3P A;  2FCM A;  2PEA A;  1Y8R C;  2O2V A;  2EMT A;  2LAS A;  1WZ3 A;  3WAL A;  2LGX A;  3IVF A;  4M8N A;  1UBI A;  4AJY B;  2JZZ A;  1C1Y B;  2XEW A;  3R3M A;  4LDT D;  2NCN A;  4W9C A;  2IZV B;  1ZW7 A;  1IYF A;  2RSU A;  2KTF A;  4IG7 B;  4XC2 A;  2LRW A;  1P0R A;  3DBR I;  4F8C B;  3EC8 A;  3LDZ E;  4FJY A;  4ZDV A;  2LZ6 A;  2N9E B;  3DOW A;  1TTN A;  2MW5 A;  1GC6 A;  2KFK B;  2KDF B;  3MHS D;  2O6V D;  2LXA A;  3ZNH B;  4ZRK A;  5D2M B;  2KWU B;  4HVB A;  1YJ1 A;  1PQS A;  4KV2 A;  3DVN V;  2IYD B;  2L7R A;  3PV1 A;  1WX9 A;  2LVO A;  4IWP A;  4WWN A;  4AJW A;  4MEL A;  4DXA B;  4BKG A;  3KVF B;  1WM2 A;  5D6J B;  5IAA C;  4CO7 A;  2FCN A;  1Z2M A;  2D07 B;  4NAW A;  2K8C A;  4DHZ E;  3PRP B;  2OJR A;  3QK0 A;  3ZNZ B;  3T9L A;  2KMC A;  3TCA A;  2IY0 B;  4BOZ B;  3PHW B;  3NZS A;  4LJO B;  1L7Y A;  5DCN A;  4IWO A;  2DYM A;  4FJZ A;  4II3 B;  5AZH A;  2JVC A;  2WWZ A;  3BY4 B;  4B9K A;  2DYB A;  1WH3 A;  2M0X A;  3L13 A;  5LXH A;  4FN2 A;  4BKS A;  1WRD B;  2D3G A;  2LJ5 A;  4KDI C;  4FHJ A;  1GJZ A;  3R7R A;  1GNU A;  1XD3 B;  1UD7 A;  3JSV B;  3QAQ A;  3OLM D;  5DPS A;  2FUH B;  3L16 A;  1E8X A;  4ANW A;  2C9W B;  2LWP A;  1OTR B;  1OEY A;  2ZPY A;  1WR6 E;  2CU1 A;  3VTV A;  4NJ7 A;  3RYT A;  3UIP B;  3B1L X;  1KLV A;  4BFR A;  3ALB A;  3RT3 B;  4WJP A;  3UIN B;  2I1J A;  3AU4 A;  3ZRC A;  5C1Z A;  4F7Z A;  4M0W B;  3GOE A;  2BWE S;  4IM2 A;  3W1Y A;  2PE9 A;  2AEH A;  4KZC A;  2J0M A;  4NQK E;  3VUX A;  5JHA A;  5D94 A;  2CHX A;  3ZLZ A;  1YD8 U;  2Z0D B;  1SGH A;  3ZVV A;  2DEN B;  3A9K A;  1WMH A;  3QHT A;  3IFW B;  2AYO B;  3HK0 A;  4FLH A;  2NBV B;  3H9D A;  3ZDT A;  3DBH I;  4ICV A;  2KC2 A;  1FXT B;  5L83 A;  1V2Y A;  3ZIM A;  3M95 A;  3NS8 A;  2KK8 A;  5D7G A;  5AZG A;  2BGF A;  4HK2 A;  2FNJ B;  1WGD A;  2IO1 B;  3VUY A;  1WE6 A;  4NQL B;  3RUL A;  3ZTC A;  4EEW A;  4MGK E;  2WDT B;  3APD A;  4LCD E;  2RPQ A;  2CR5 A;  1V86 A;  2EMS A;  1MG8 A;  1WY8 A;  2CHZ A;  2M1M A;  3EFU A;  4LDT B;  5CX3 A;  4A20 A;  2ZVO A;  1V5T A;  3CF6 E;  4NJ6 A;  4RM9 A;  4W9H A;  2MQJ A;  4HDQ A;  4BKT A;  4ANV A;  3A4R A;  3MJW A;  3PGE A;  5E6P A;  2AWT A;  2JY6 A;  4PS3 A;  2M8S A;  3QX1 A;  2MCN B;  1UGM A;  3A9J B;  4OVU A;  1E5W A;  3WAO A;  1WFY A;  2J7Q B;  2JRI B;  3AI5 A;  3HIZ A;  3ZKJ C;  2LVQ A;  4JL9 A;  4TKN A;  4DDI D;  2PJH A;  2XK5 B;  1J8C A;  2NS5 A;  2LXC A;  4EZL A;  2C5L C;  3VDZ A;  3WAM A;  2MRP A;  5L95 C;  3DCG A;  3M63 B;  4EKU A;  4DHJ D;  4JIO U;  1E90 A;  3CSF A;  1OEY J;  3NHE B;  3N32 A;  3VH3 B;  2I1K A;  4PS8 A;  1WMH B;  2L05 A;  4B6W A;  2A4Z A;  2JZ3 B;  2KFJ A;  1E8Z A;  2FID A;  3H7P A;  3M62 B;  3PVL A;  4HPM B;  4W9E A;  3HM3 A;  3OAW A;  1WX7 A;  2G4S A;  4KIK A;  3U7D A;  3X0W A;  3K9P B;  3N30 A;  2N4F A;  1V5O A;  2IBI B;  4IWQ A;  2V3S A;  2MP2 B;  3DQV A;  2ZCB A;  3TIX A;  1IPG A;  3M3J A;  1TGZ B;  1S1Q B;  1H4R A;  2JUO A;  4MH0 E;  4II2 B;  2DZK A;  2KD0 A;  1LXD A;  4TUU A;  4ZRJ A;  2J0J A;  2FCS A;  3H6N A;  3RUI B;  1UBQ A;  5J18 A;  5E6O A;  3B08 A;  2L00 B;  4ZYN A;  2KXJ A;  2KMA A;  4BVU C;  2O2V B;  2XK5 A;  5DPT A;  1Q0W B;  2KDB A;  2ZNV B;  1UEL A;  5CTR C;  3UQA A;  2WYQ A;  3V6C B;  2G45 B;  1WI0 A;  2L0T A;  3GZN I;  3ZNG C;  3KYD D;  2REX A;  1V81 A;  3PT2 B;  2MWS B;  3TMP B;  4GMV A;  1WR1 A;  2N1V A;  4G0N B;  1WE7 A;  2QHO A;  2G4D B;  4ICU A;  4W9G A;  4EUT A;  1I42 A;  3V61 A;  2LVP A;  4GDK A;  3APF A;  2HE7 A;  2NPT A;  3A33 B;  1LM8 B;  1LFD A;  2DHZ A;  2KN5 A;  4PYZ A;  1EUV B;  4I6P A;  3P2B A;  4JQW C;  2KDI A;  4WWO A;  3O65 B;  3HM6 X;  1WXA A;  2RGF A;  1WGY A;  4WQO B;  2L3Z A;  2B3A A;  1X1M A;  2JWZ A;  2KOX A;  4MDK E;  3U30 A;  2MBQ A;  2NBW B;  2GBK A;  1K8R B;  5LLI A;  3RZF A;  1C3T A;  3SU8 X;  3DBL I;  2K8H A;  4EFO A;  4AOF A;  2BF8 B;  4KZ0 A;  2K6D B;  3L08 A;  4GSW A;  3A4S C;  2LGD A;  4GDL A;  5EDS A;  4FJV B;  1YQB A;  1E8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...