2IGDA

Anisotropic structure of protein g igg-binding domain iii at 1.1 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Anisotropic Refinement of a Protein G Domain at 1.1 Angstrom Resolution
rcsb
source organism Streptococcus sp.
molecule tags Igg-binding protein
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2igdA00
2EELA 4KGRA 4HJGE 2I2YA 5BMIA 3FILA 1KH0A 2ZW1A 4IKGA 1P7EA 1JMLA 2N7JA 2I38A 2KWDA 1MHXA 2PW9A 2PTLA 2RPVA 2GI9A 2OEDA 1PGAA 1IBXA 2NMQA 2J52A 2QSDA 1XCQL 1Q10A 3GB1A 1EM7A 2PLPA 1K52A 2JZPA 2IGHA 1K50A 2IGDA 1MVKA 1YMHE 5HHDG 2GB1A 2JWUA 1P7FA 4HKZE 4KGSA 1HZ5A 4D2KA 1D4BA 4OZAA 2IGGA 3UI3A 1GB1A 2LGIA 1MI0A 2KN4A 1IGCA 3FILB 4GLSC 2KACA 1YNTE 5HFYA 1FCLA 1C9FA 1K53A 2J53A 1F2RI 1FD6A 1F2RC 2LHDA 1HEZE 4OZBA 2N9LA 2JXTA 1QKZA 1K51A 3MP9A 2N9KA 2RMMA 1GB4A 1IBXB 1PGBA 4WH4A 2JSVX 4IOIE 2ZW0A 5BMGA 1ZXHA 5HG2A 4OZCA 4MACA 5BMHA 2KQ4X 2QMTA 2KDMA 2ONQA 4KGTA 1FCCC 2K0PA 1PGXA 1UWXA 1HZ6A 5JXVA 1XF5L 2ON8A 1MPEA 5HI1A 3V3XA 1MHHE 1IGDA 1XCTL 2LUMA 2LHEA 2JU6X
chains in the Genus database with same CATH superfamily
1OEYJ 4KIKB 1NI3A 2K6QA 4C7YA 3HIZA 3QWZB 2KFKA 3AEEB 1WJ6A 2FCMA 4N58A 4EZKA 2ZVOA 4W9JA 2HJ8A 2PTLA 2NR2A 4G3XB 4RFBA 1WZ0A 1TIFA 3IXSA 4A6QA 4BAXA 4LDTD 3AV8A 2BYVE 4L2YA 1FIQA 2JQRB 2INCC 1GOZA 3LXFA 3DDCB 4IWQA 1Q10A 2JRHA 4IM0A 3GB1A 3NY5A 3AB5A 4PK1A 3Q69A 2PLPA 3PGEA 1TZOA 4I6LB 3DHHC 3NUHB 1L7YA 3DPDA 3RULA 2L32A 4MDKE 4M0WB 3GZNI 3GE8C 2AWTA 3Q8EA 3UI3A 2JRIB 3ZO5B 3ZRCA 4W9IA 4B0EA 3HUIA 4MGYE 2LUEA 1VLBA 3ZIMA 3TIXA 4GU2A 4TKNA 1NEKB 2NVUI 4GDLA 3V60A 3UIOB 4EFOA 1KLUD 1UF0A 3ZJTA 4CYEA 1TY0A 2MRPA 3QCAA 1I42A 1K51A 3ZQ4A 1D3ZA 2N9KA 4B0MA 1WRIA 3VFKA 5CX3A 3WAPA 4JE3B 2JPHA 3ZUNA 3Q8AA 2LASA 1ZE3D 2M56B 1UUPA 2KANA 1EU4A 3BVZA 1TS3A 4FHJA 1WSPA 1TT5B 3PRZA 4E74A 5JXVA 3AN1A 3QARA 1XCTL 4MGZE 1NYQA 2DLBA 2N4FA 4K7WA 4WQMA 2VZKB 3DBLB 3RNFC 3SFEB 3BVMA 5AZFA 3M3JA 3VTUA 1FNUA 2MLBA 3B2GA 2I38A 2D5GA 2KWDA 3FC4A 4FJYA 1V2YA 3WAOA 2O6VA 2XK5B 5IAAC 2WXRA 5IP4D 1YJIA 3L08A 4RGMA 3WALA 4WJNA 5G5HA 3ZNID 4M8NA 4BOZB 3N1ZC 3R2IA 2JUOA 4K3BA 3DVGY 1EF5A 4B95A 1YQ3B 3PVLA 1E90A 3AECB 3BK1A 4MSQB 4D2KA 3N9YC 4GSWA 3IT6B 2WXOA 3BIID 4MEMA 4FBJB 3SEBA 2LZ6A 4OVUA 1C9FA 5CHVC 2DBYA 1R4NI 2PVGC 2BYTA 1QKZA 3MP9A 3P4SB 3ZW3A 4C4VB 2L00B 1M4VA 2KHWB 1GB4A 1OEYA 2AX5A 3ENEA 3L17A 4NPNA 2ZW0A 5G5GA 2EMTA 1Y56A 3OLMD 5HG2A 2KVZA 2PPHA 2L8JA 3RNCC 3HHMA 1FXIA 4USAA 1WH3A 3KUZA 2MP2B 1E6EB 4BKTA 5IN7A 3GE3C 2V9HA 5CHWA 2MSED 1XF5L 1WYGA 3P2BA 3ZJVA 3ABVB 2GBMA 2REXA 2RD0A 1VZ7A 2AL3A 4KX6B 2SAKA 4P1BC 4XWTA 3V62A 2FCQA 1B1ZA 1ZGUB 3NZUA 2LVPA 1QOGA 2DAFA 3AEDB 1YOVB 3AE4B 3RN9C 1I35A 4JQWC 2N9PC 3HRDD 1E0ZA 2QSDA 3AEAB 2IY1B 4BVUC 2J4XA 1JALA 2ACZB 2ZZPB 2INNE 3SD5A 4KGSA 3BWUD 2MBEA 2BGFA 2IYDB 2BWFA 1MI0A 1IGCA 4LCDE 2FUG1 2L83A 3O65B 4YTNB 2LHDA 3MJ5A 3L4PA 1N6ZA 3ZTDA 2RGFA 1V1PA 2JXTA 4HLEA 4RGTA 2ZPNA 3AU5A 1FMAD 1CK1A 1E9MA 2Z0DB 1P9DU 2R2QA 4HROA 1JWMD 1UD7A 1IBXB 2A4ZA 3Q2AC 1FPYA 4GDLB 2FCNA 4GB9A 1XT9B 1OQRA 4HJKA 3EUB2 4ARIA 5D94A 4AJYB 2VH2A 2YVCA 3A33B 5D2MB 4A3PA 5BMHA 3PZ8A 4LTUA 1V80A 4J6IA 2WQYB 1KJTA 4P7IA 1ESFA 3PHWB 3ZKJC 1FXAA 1LQBA 4RH6A 1WMHB 4FLHA 3T3NA 4US8A 2X8XX 3VRBB 1F9JA 2ZPYA 4Q2JA 4W9CA 3ETRA 2JYEA 3FILA 3PRPB 4IKGA 3TCAA 4BKSD 2D2QA 3W5UB 5JH5C 3DHIC 4N6EB 1GC7A 4TQ0A 2LXAA 2NCNA 1KRHA 2MHJA 1KLGD 4HXDA 4YWGG 3RYTA 2ZVNA 3JVZX 2L0TA 3NVWA 3DVNV 4GGQA 3P4QB 2GBKA 1F0ZA 4HPPA 2FCSA 2NBWB 2NBVB 2IPKD 1Y8RC 3R8BA 4X57B 5HHDG 1R4MB 1YX5B 3AEFB 4MT5A 3J9CA 4YSZB 1FRDA 2VH1A 3U2SC 1ACCA 4TQ1A 2LGIA 2C9WB 4FN2A 3T9LA 3U4EG 1FEHA 4RGNA 4W9KA 4RM8A 2LJIA 3UINB 1KTKA 2JZZA 2PEAA 1HEZE 4OZBA 3HVDA 1EUVB 2GBRA 3AE3B 3KVFB 2EKIA 2BPSA 3H7PA 4P6VF 4L1BA 4MM3A 4NQKE 3MC8A 4GXBA 5H8YE 2WXKA 4OZCA 3PZ7A 3W1SC 3TEZA 3UQAA 3DHGC 2GOWA 2KDMA 3GOEA 2LVOA 3JSVA 4RGOS 3PT2B 4WWNA 3A9KA 3MFGA 1TS4A 3V3XA 2MJDA 1FO4A 2OJRA 4HWIB 2INPE 2KJ6A 1C78A 2RDBC 3JYUA 1A70A 3W9CB 2CHXA 1QT9A 4PS3A 3OG5A 1HXYD 5BYQA 2HDEA 4ZRQA 2AEHA 4MGKE 3CMMB 2QC8A 2KYWA 4FJVB 3QAQA 3KYCD 2W3RA 1QOAA 4IW0A 3CF6E 2KC2A 4US9A 4TMAB 1M94A 1J19A 2H89B 4NAWB 2J0JA 4L23A 1BXTA 3WANA 3ZDTA 2JWZA 1GUAB 3PTFC 1X1MA 4RM9A 1Q1OA 4QAYA 1GPXA 4KSLC 1OGWA 4HPLB 1GB1A 2V4LA 1IPGA 4RCOA 1LO5D 5EDSA 1H4RA 1NVID 2C7HA 2N9EB 1FFVA 2KMAA 4YL8A 4F7ZA 2WXNA 3RNBC 3DQVA 1TKYA 2VZKD 3P63A 3U30A 2WXLA 2RMMA 1T0SC 1F52A 3VR8B 3DBRB 2AQ1B 2KN5A 4PS7A 2JSVX 1PDXA 3AI5A 2KJHB 1BT0A 3BINA 2IO1B 5EE3A 1V1PB 3Q6BA 1RM6C 2KZRA 2QEJC 1UBIA 1YJJA 2BYFA 4MACA 2SEBD 4FXCA 1JRPA 5AZGA 4YSYB 4EOYA 1GNUA 2H88B 3PSEB 1XLQA 2QILA 2KFJA 1WZ3A 3NZ3A 5C1ZA 2HE7A 2N7DA 4M01A 3PO0A 2W54A 1G6JA 3AE6B 3AE8B 1AYFA 2W55A 4DXAB 2LGSA 2KT7A 4HJGE 4KKJA 2R61A 3HM3A 4NZLB 2G1EA 1E7PB 1E8YA 1TGZB 1AARA 2BW2A 3ML9A 1N61A 2WP9B 5TR5A 2N1VA 4OVVA 2XN9C 4ITKA 4ZRIA 3VTWA 4GOCA 1LFDA 3W1SA 3B2FA 1C3TA 1F77A 3CWIA 3C0RB 1YX6B 2DZMA 2PIAA 3NS8A 1DOIA 2CU1A 1I4XA 4ANWA 3APDA 3M95A 3TBLD 3KYDD 3HVZA 2R2OA 3L0WB 2BYEA 1VZ8A 1WGHA 2PVOD 4K3CA 4GMVA 1P0RA 2B3AA 2MBQA 2LI5A 2K9XA 5E6NA 1VRAB 3H7PB 4ZDVA 3TUOA 2MBOA 3OWEB 1R7SA 1HZ6A 3I63C 1L2NA 1YD8U 1MG4A 3B08A 5E6OA 2V3NA 3BZDB 2D3GA 2LUMA 4UDUC 2K8BA 4W9GA 5I4DA 2EKEC 2CR5A 2MW5A 2MX2A 4ZHOA 4IC7B 1YQBA 3SHQA 1JMLA 3DCGA 3ZNZB 2GLSA 3AMZA 2BB6A 2C7MB 3I5JC 1OQYA 4NJCA 2PW9A 3TMPB 3P1MA 2RDGA 3NVYA 4NY0A 1ET9A 1WXQA 1K52A 3VR9B 1TKEA 1N5WA 1T0RC 4CO7A 1UBQA 1WYWB 2WDTB 4WIPA 1I4QA 3VH3B 2IGGA 1R4MI 1JCKB 1L0XB 3QQ8B 3C19A 5LXHA 1RYJA 4IWPA 3AU4A 1NI2A 4K1RB 4W9FA 2FUHB 1WXMA 5J18A 1N63A 1J8CA 4HCNB 4CQNA 2KDBA 3IBEA 3AE2B 2O2VA 2MA9B 1KFYB 4G11A 3V61A 5KHOA 5AZHA 5BMGA 4GIVA 2KDIA 2KLCA 3K9OB 3B9JA 2IO0B 2KVRA 2LXCA 4ZHPA 2PE6B 3VH4B 1GJZA 5C3JB 2KQSA 1KM7A 5C2TB 3RZWC 1WR1A 2EMSA 2WXIA 3B0AA 2DHZA 4KGTA 1UWXA 1ZPSA 4YTPB 1E7VA 1AWDA 4MH8A 2K25A 2KD0A 1T0YA 4BBNC 1V8CA 1GC6A 1L6UA 3EFCA 5JHBA 3QX1A 1QLBB 2LVQA 2E6XA 4M8MA 2Y5PA 4GDKA 5E6JA 1WX7A 2I1JA 4AS1A 5MPOA 1JROA 4HDQA 2ZNVC 1L4ZB 2IY0B 2FE8A 2L1AA 1UNSA 2KMMA 3VRAB 2GMIC 3Q3MC 4EUTA 1WJNA 3HK0A 2WLBA 3QC8B 1V9JA 1SGHA 2W3SA 4PYUA 5EE0A 2ASQA 3EC8A 3Q8FA 2KFKB 1HTOA 4JGHB 2L3ZA 2KK8A 1L0VB 3VHTC 4G50A 3LYYA 2KDFB 1P1AA 2L0FA 4PYZA 1BUIC 4NAMA 2WU5B 2PKOA 3AH7A 1SEBD 4OHJA 4C80A 1ZXHA 3DBRI 3D32A 4HEA1 5TSSA 4N9F4 3PREA 2D3BA 3MJWA 3VUXA 2ZCBA 2DWQA 1JWBD 3RUIB 1PGXA 5J17A 4ZRKA 1JWUD 1J7CA 1YJ1A 4JPSA 1I4PA 4WAAA 1NENB 1VZ6A 1Q5WB 4J3OD 2G4SA 3Q3FA 4LLGM 5DPSA 2NTTA 4DHJB 2BKRB 1SIJA 2G45B 2J42A 4BKSA 1WGYA 1KOTA 4KZCA 3Q3OC 3BY4B 2DENB 3ONSA 3IFWB 2ZCCA 3GZNB 1SE3A 4DBGA 1TKGA 5FR3A 3AE9B 3N20C 3Q8BA 4YXDB 1MHXA 1I4RA 2CKHB 2D3CA 3W1YA 1J0GA 2RPVA 1E8WA 2DYOA 4RF1A 2FBWB 3IG3A 3WAMA 1CQVA 2NMQA 2KC1A 5GXGB 4A20A 3NVZA 1S1QB 2CJOA 2IGHA 1MVKA 5L95C 3AE5B 2N1WA 2WXJA 2MQJA 4ASWC 4LNOA 3PHXB 3H1UA 3ECIA 4RNAA 5D3DA 1DOYA 4KZ0A 2X38A 1FNVA 4ANUA 2M19A 3VUWA 1E5WA 4E71A 1PYWD 1F2RI 4IUMB 3H7SA 1QF6A 1QQRA 1TS2A 5DCNA 2O6VB 1KLVA 3APCA 3I3TB 2N0SB 4W9HA 3GS2A 2D11A 3RCZA 1PGBA 4EKUA 2WDVB 4A8XC 2IDYA 3T3OA 4W9EA 2QHOA 4B9KA 2QCZA 4II3B 3DVGX 3RFZB 4DDID 2Q5WD 4FJZA 4TV3A 4O1NA 3TJPA 1WGKA 3N32A 5AEKB 4ACFA 2MEKA 2DZIA 2IZVB 4KDIC 3QA8A 2MBBB 5T8IA 5EE1A 1IGDA 3V6EB 4LJPB 1QOBA 2WXMA 1C77A 2KTFA 1CMXB 2M0XA 2N7EA 5LNK1 1AW7A 2M1MA 4KGRA 1C1YB 2YLMA 3A4SC 4C56C 1P7EA 2Y3AA 2Y5BB 2WHIA 1ZDVA 4C7ZA 3MC9A 4MELA 1JWAD 2LRWA 4EE2A 1V5TA 3ZYYX 1GG3A 3QIJA 2KWVB 5CTRC 4PT5A 4M02A 1R4NB 3CSTA 1WRDB 2WWZA 3NG0A 5CHFA 3DBHB 1VDVA 2WDRB 3DBLI 1XO3A 3OAWA 4YTMB 1EO6A 1K8RB 3UGBB 2LD9A 1B9RA 1OTRB 2DZKA 2BKFA 3VDZA 2WXGA 3DWGC 3L54A 3T8MA 1JWSD 4WWPA 2KKCA 2KX3A 4AP4C 1C76A 3AE1B 2WXPA 3NVVA 4ARCA 2Z0EB 2L76A 3H6NA 3EHVA 1V1OA 3NZSA 3KLSX 3H8HA 3URYA 1SE2A 4WJQA 1WJUA 2XK5A 1FM0D 1WE7A 2K0PA 2OJWA 4R3DA 4IWOA 2D07B 2LWPA 1E8XA 3WIMA 4YT0B 4JWSC 2V1YA 3DBSA 2FAZA 2LGXA 4TSSA 2N9XA 1UH6A 2L7RA 5H92C 2DAJA 3IT4B 4II2B 1ZW7A 1P98A 3O13A 2IO2B 5BMIA 5BYSA 1ZKHA 1CZPA 2HTME 4GN1A 1SB3C 3E9SA 1YN5A 4G0NB 3ZNGC 1YIWA 1ET6A 3ZXVA 2JT4B 4S0RA 1YN4A 4HVBA 4MSMB 2ZJDA 1ENFA 1KF6B 2NS5A 3CSFA 3EFUA 1RFKA 3NHEB 4RF0A 4ZRJA 4IM3A 1WXVA 2YEPB 4WQOB 2JWUA 3Q3JA 3JW0X 2MP2A 4NJ6A 4HDOA 4OZAA 1TBEA 5DPTA 3ZJUA 2WS3B 3QK0A 1HA5A 2KN4A 3FILB 4GLSC 1YNTE 1ZXIA 2XBBC 4OW0A 2JF5A 1D5ZC 4MH0E 1WF9A 4WURA 3N1YC 1GAQB 3CIRB 3R3MA 4EEWA 2DX5B 3MHZA 3APFA 2QDFA 1RRBA 2AQ2B 4FA6A 2W9NA 2K22A 3BVGA 1TY2A 4ZRPA 3V05A 4I6PA 1RLFA 4ANXA 1NDDA 2D10A 1WFYA 1UGJA 1WY8A 1JRUA 1YN3A 2JX5A 4URKA 4IG7B 2BVCA 2FIFA 2LRUA 3WCQA 1VJKA 2ONQA 5L83A 1TZ1A 5IA7A 2IO3B 1XEEA 2ZNVB 1MG8A 3U7ZA 1OFFA 1STEA 3BYYB 1EU3A 2IBIB 2WXFA 2FNJB 3ZDMC 1WE6A 5C23A 3A1QA 5FKAC 5FK9C 3KWLA 4WAFA 3RD2A 3L13A 2CJNA 3KW5B 4WWOA 4W9DA 4KKIA 2Z8LA 4LJOB 3VXWA 2CHZA 4MM3B 4EZJA 2K39A 3AE7B 4E3CA 4ANVA 4HK2A 4JLCA 3LB8C 2G9HD 1ROEA 5LXIB 3IHPC 3SR6A 1PUTA 2K1FA 3M63B 1IBXA 4NJ7A 2PE9A 4LNNA 1AN8A 4M00A 3JSVB 3PV1A 1JW9D 3A9KB 4HRSA 2GBNA 2KQ7A 2M8SA 3OJ4B 4XE0A 3R66C 4PS8A 1WM2A 1ZOYB 2MCNB 3VAWA 2QIEB 2CS4A 3X23A 1SE9A 3DOWA 4DHZB 1V97A 2HJ1A 4A55A 3B1LX 1FCLA 4FULA 3ZVVA 3H9DA 4MJSA 1K53A 2KLGA 4IM2A 1WMHA 3FKYA 3P42A 4DQOC 3EGRA 2N9LA 3Q8CA 3DWMA 1TS5A 4LNFA 1FFUA 1T0QC 4DHJD 4I6NB 1FNWA 5IO9A 2UYZB 2JVCA 1XXGA 4WH4A 1SSNA 3RNGC 4S17A 3R7QA 3RZFA 3TL5A 4TUUA 4DK5A 2UWQA 1SF0A 1WX8A 4JX1C 1WR6E 1NYRA 2RDHA 3W2DA 3VUYA 1L4DB 5BYRA 3PLVA 2KQ4X 1EF1A 2V0GA 3SDLC 1WWTA 2PMVA 2WDQB 2ON8A 1MPEA 5HI1A 2NPTA 5E6PA 4N59A 1FRRA 4F1SA 2KO3A 3RI7C 3P4RB 2JU6X 4JIOU 2JZ3B 1EWCA 2LGDA 1WGRA 2B76B 5IKCM 3GP7A 2I2YA 4XGAB 1V86A 2LMCA 1C4AA 3AM9A 1P3QU 1F1HA 3KUDB 2HTHA 4JL9A 2KTRA 3L16A 2M17A 5D3IB 5D6JB 4DDGD 2LJ5A 3R2TA 4XX5A 1PGAA 2O6VD 3WA0A 1N60A 3R7RA 4CHKA 1Z5SB 1XCQL 2DYBA 1PFDA 4ZYSA 1EM7A 3IAM1 1K50A 2IGDA 3KH0A 1MJDA 3DBHI 3AULA 2W82A 2C5LC 3Q3NC 4XC2A 2QJLA 3HM6X 5KHQA 5EE9A 3MHSD 4H2AA 4LNIA 4K7SA 1V49A 1FD6A 1F2RC 2WGSA 1A5RA 4AWJA 4LDTB 1IYFA 1J7AA 3M62B 2V3SA 1IUEA 1VCBA 1UWMA 4WJPA 1ZUD2 2LFIA 2BQQA 3AEBB 3ML8A 2KMCA 2KX0A 4IOIE 2TSSA 2UU7A 1SBBB 3N3KB 4HCPB 2QMTA 5J2RA 1VR9A 1QILA 1UGMA 2IJ0A 2BF8B 3DVNU 1DGJA 4NAWA 5BO4B 2D3AA 4FHKA 3UQBA 3IVFA 5HKHA 3VQIA 3EA6A 3NOBA 1N62A 3A4RA 2MJEA 1V81A 3RNAC 2MJ3A 3BYTB 4F8CB 5D7GA 2L05A 1TJEA 1KH0A 2ZW1A 1DYQA 4ICVA 3QHTA 1XLPA 2JXXA 2ZEQA 2K5PA 4IDIA 1WI0A 3A1QB 2ICIA 1C4PA 2KJRA 1SIFA 1ZDXA 3W5VB 1JQ4A 3P4PB 2BWES 1WIAA 4K81A 2KNBA 5JHAA 1YMHE 1U4AA 5FR6A 2WYQA 4B6WA 3X0WA 1QOFA 4FADA 3NRZA 3N1XC 2V3PA 1E8ZA 4BFRA 3BK2A 2KACA 1Z2MA 3RT3B 5HFYA 3AXCA 4AUQC 3QJZA 3A9JA 2NBUA 2RR9A 1XLOA 3KQ4A 2WX1A 1C4CA 2AQ3B 5G55A 4MJSB 3SU8X 3AEGB 3N30A 3UIPB 1YQ4B 2M0AA 1T5XD 2XEWA 1V6EA 2YEPF 3S2AA 4KIKA 1FCCC 3ZNHB 2K3UA 4P16A 1D5MC 2MBHA 2DZJA 2INDC 1HE8A 1QZEA 2LHEA 1LM8B 2EELA 1UELA 2Z59B 1I7HA 2FIDA 1LGRA 4C00A 4MGIE 2O2VB 3MC0B 5LLIA 4BBNF 4ZOHC 2NPTB 2L52A 2N7JA 3ZTCA 3V6CB 2NTSA 2DYMA 1H8CA 4KDLB 3E56A 2BTEA 2GI9A 4ZYNA 5IOIA 2OEDA 1PQSA 2M4NA 4OVZA 1TTNA 4M0WA 3ALBA 2J52A 3ZGZA 2CU3A 5JZEB 1FXTB 1DOXA 2KTRB 1BMLC 1V5OA 1NBFC 2AL6A 4ICUA 1CJEA 1SJED 1P7FA 4KSKC 1D5XC 2CHWA 2BS2B 1TYGB 2WXQA 2G4DB 1HZ5A 2DNFA 4K7UA 1S3SG 3U7DA 5G2NA 3L10B 2LGYA 1SE4A 3MTNB 4BZAA 2WX0A 2WXHA 4GDKB 4KV2A 2HD5B 3I57A 3PPAA 1WGGA 3KUCB 2J0KA 1HQRD 2JY6A 4HKQA 3VTVA 3SFDB 2MWSB 2J0MA 2KOXA 5AUIA 2RSUA 3FAHA 3I9V1 4WWMA 3UF8A 4WJOA 2LEKA 3K9PB 3VVWB 2A5UA 2E3TA 4RMAA 1D6EC 3NJTA 4KVGB 1T6BX 5AUKA 4AOFA 1N5XA 3C8YA 2BB5A 2VRRB 3TEWA 2XNAC 1EWYC 2G3QB 4XYCA 1SXTA 3OJ3A 1WJ4A 4A90A 1LXDA 1OQQA 1E10A 5DPRA 2OHFA 1WXAA 3TSSA 1WM3A 1RWSA 3PZDA 2KAJA 2KDEB 2AYOB 3PS6A 4NNJB 1ISNA 2K6DB 3LDZE 4DXGA 1UZXB 2WNMA 1HTQA 4DXFA 3U52E 1T3QA 4HPMB 3KWVA 1WXSA 3NS1A 2OOBB 1WGDA 2C7NB 2PJHA 4P1CC 1C79A 4REZA 4YSXB 3TEYA 2GRIA 1I4HA 1I4GA 4W9LA 2JYTA 4XWWA 2JZPA 2WU2B 2GB1A 1E7UA 2BT6A 2KWUB 4HKZE 1XLNA 1ZP0B 2RPQA 4AJWA 1D4BA 4DWFA 2KWCA 1SJHD 2BS3B 3IAS1 4BOSC 1J7BA 4DHZE 2C60A 4C4VA 1RAXA 3U8ZA 4A3OA 4XDCA 3RNEC 2J53A 3RMKC 1VD2A 2KXJA 5DPWA 2V4IB 4LK0M 1L0YB 3ZXRA 4AQ7A 1MFWA 3TEXA 4EZLA 3EECA 1XQQA 4BKGA 1Q0WB 5GMVA 3LJ3A 4XDDA 2K8HA 1L6VA 3Q14C 3A9JB 2BS4B 2K8CA 4A9AA 3ZLZA 1IP9A 1L5PA 1XD3B 2GBJA 1WX9A 1RFAA 2I1KA 2MH7A 3PRMB 2Y5CA 3RPFC 4NQLB 3PLUA 4XZ4A 2J7QB 1MHHE 4JWUC 3ZRFA 2BBCA 4LNKA
chains in the Genus database with same CATH topology
1A70A 2NTTA 1EWCA 3W9CB 1NI3A 1SIJA 2B76B 2J42A 4C7YA 1QT9A 1HXYD 3GP7A 5BYQA 2I2YA 2HDEA 4ZRQA 1SE3A 1TKGA 2LMCA 1C4AA 5FR3A 3AM9A 3AEEB 3AE9B 3Q8BA 4YXDB 4N58A 1MHXA 1I4RA 2PTLA 4RFBA 2W3RA 1QOAA 2RPVA 2DYOA 3IXSA 4A6QA 4RF1A 3AV8A 5D3IB 4US9A 4L2YA 1FIQA 3R2TA 2JQRB 4TMAB 2FBWB 1PGAA 1CQVA 1GOZA 3LXFA 1N60A 2NMQA 2H89B 5GXGB 1XCQL 1Q10A 4NAWB 3NVZA 4L23A 3GB1A 1PFDA 1BXTA 3AB5A 4ZYSA 1EM7A 3Q69A 2PLPA 1TZOA 2CJOA 2IGHA 3IAM1 1K50A 2IGDA 1MVKA 3NUHB 3AE5B 2L32A 1GPXA 2W82A 2WXJA 2QJLA 3Q8EA 1GB1A 3UI3A 4RNAA 4RCOA 1LO5D 5D3DA 4B0EA 1DOYA 3HUIA 2X38A 1FNVA 1VLBA 5EE9A 2M19A 4H2AA 1NEKB 1PYWD 1F2RI 1NVID 1FD6A 1F2RC 1FFVA 1KLUD 1QF6A 1QQRA 3ZJTA 1J7AA 1TY0A 1TS2A 2WXNA 1K51A 1IUEA 3ZQ4A 1TKYA 2N9KA 2VZKD 3P63A 1UWMA 2WXLA 1ZUD2 2LFIA 2N0SB 3AEBB 2RMMA 4B0MA 3GS2A 3VR8B 1WRIA 1PGBA 2AQ1B 2WDVB 4A8XC 2IDYA 3T3OA 2JSVX 1PDXA 4LLGM 4IOIE 2TSSA 1SBBB 4JE3B 3RFZB 5EE3A 1V1PB 3Q8AA 1RM6C 2QEJC 2Q5WD 1YJJA 3ZJUA 1ZE3D 2M56B 4O1NA 4MACA 1UUPA 1WGKA 2SEBD 4FXCA 2QMTA 1VR9A 1JRPA 1QILA 2MEKA 1EU4A 2IJ0A 4YSYB 3BVZA 1TS3A 2H88B 1DGJA 1WSPA 1XLQA 2QILA 5JXVA 5T8IA 3AN1A 3NZ3A 5EE1A 1IGDA 1XCTL 1QOBA 3VQIA 3EA6A 2WXMA 1NYQA 1N62A 3PO0A 2DLBA 2W54A 1C77A 2MJEA 4WQMA 2VZKB 3AE6B 3AE8B 1AYFA 2W55A 2MJ3A 3BYTB 5LNK1 1AW7A 5D7GA 3SFEB 4KGRA 1TJEA 4HJGE 3BVMA 4KKJA 2R61A 1KH0A 2ZW1A 4C56C 1DYQA 1FNUA 1P7EA 2Y3AA 4NZLB 2G1EA 3B2GA 2I38A 1XLPA 1ZDVA 4C7ZA 2D5GA 2KWDA 1E7PB 2K5PA 1JWAD 2BW2A 3FC4A 1N61A 4EE2A 2WP9B 3ZYYX 4IDIA 2XN9C 4PT5A 2WXRA 4ITKA 1YJIA 2ICIA 1C4PA 4RGMA 5G5HA 1ZDXA 3W5VB 3W1SA 3R2IA 3B2FA 3P4PB 1VDVA 1JQ4A 2WDRB 1F77A 3CWIA 1XO3A 1YMHE 4YTMB 1YQ3B 2PIAA 1DOIA 1QOFA 3AECB 3BK1A 1B9RA 4D2KA 3N9YC 3IT6B 2WXOA 3NRZA 2V3PA 2WXGA 1I4XA 3DWGC 5HFYA 3BK2A 2KACA 3BIID 3SEBA 1JWSD 1C9FA 3HVZA 2DBYA 2PVGC 2BYTA 1QKZA 1C76A 1XLOA 3AE1B 1VZ8A 3KQ4A 3MP9A 2PVOD 1C4CA 2WXPA 3P4SB 1M4VA 2AQ3B 3NVVA 1GB4A 4ARCA 2AX5A 1V1OA 3AEGB 2ZW0A 3KLSX 3H8HA 5G5GA 2K9XA 3URYA 1Y56A 5HG2A 1SE2A 1YQ4B 2M0AA 1T5XD 1VRAB 1FM0D 4USAA 1FXIA 2YEPF 3TUOA 3OWEB 1FCCC 2K0PA 1E6EB 2K3UA 4R3DA 1R7SA 1HZ6A 4P16A 1XF5L 1D5MC 4YT0B 4JWSC 1WYGA 2V3NA 3ZJVA 3BZDB 3ABVB 2LUMA 2LHEA 4UDUC 5I4DA 4TSSA 1VZ7A 2EELA 1I7HA 5H92C 4KX6B 3IT4B 2SAKA 4ZHOA 3O13A 5BMIA 3MC0B 5BYSA 4XWTA 4ZOHC 2L52A 1JMLA 1CZPA 2HTME 2N7JA 1SB3C 3E9SA 1YN5A 1B1ZA 3AMZA 1ET6A 1QOGA 2BB6A 4NJCA 2NTSA 2PW9A 2DYMA 1YN4A 3AEDB 3AE4B 1ENFA 3E56A 2BTEA 2GI9A 3P1MA 2RDGA 2OEDA 3HRDD 1E0ZA 3NVYA 4OVZA 1KF6B 4M0WA 1RFKA 2J52A 2QSDA 3ZGZA 2CU3A 4RF0A 3AEAB 1DOXA 1ET9A 1BMLC 2J4XA 1WXQA 1K52A 1JALA 1TKEA 1N5WA 3VR9B 2ACZB 2YEPB 2JWUA 1CJEA 1SJED 1P7FA 1D5XC 4WIPA 1I4QA 2BS2B 1TYGB 2INNE 2WXQA 4KGSA 1HZ5A 3BWUD 4OZAA 2IGGA 1JCKB 1MI0A 2WS3B 1HA5A 1L0XB 1SE4A 1IGCA 2KN4A 3FILB 1RYJA 1YNTE 4GLSC 1ZXIA 2FUG1 4OW0A 1D5ZC 2WXHA 4GDKB 2L83A 3I57A 4YTNB 2LHDA 4WURA 3MJ5A 3L4PA 1HQRD 1GAQB 3CIRB 1N63A 1V1PA 4HKQA 2JXTA 3SFDB 4CQNA 3MHZA 4RGTA 1FMAD 1CK1A 1E9MA 3AE2B 5AUIA 2AQ2B 4HROA 1JWMD 2K22A 1IBXB 3BVGA 1KFYB 3FAHA 3I9V1 4WWMA 1TY2A 4GDLB 4ZRPA 2LEKA 3V05A 2E3TA 5BMGA 1D6EC 1OQRA 3B9JA 3EUB2 4ARIA 1UGJA 4ZHPA 1T6BX 5AUKA 1YN3A 2JX5A 5BMHA 5C3JB 5C2TB 3PZ8A 3WCQA 2WXIA 1VJKA 2ONQA 4KGTA 1N5XA 1UWXA 1ZPSA 3C8YA 1XEEA 4LTUA 2BB5A 4YTPB 2WQYB 3U7ZA 3TEWA 2XNAC 1EWYC 1AWDA 1OFFA 1SXTA 1ESFA 1STEA 4MH8A 3BYYB 1EU3A 1V8CA 4A90A 1FXAA 2WXFA 1L6UA 4RH6A 3T3NA 1OQQA 4US8A 1E10A 3VRBB 2OHFA 4Q2JA 1QLBB 5FKAC 3ETRA 2JYEA 3FILA 3KWLA 4WAFA 4IKGA 5FK9C 3TSSA 2E6XA 1RWSA 2CJNA 2KAJA 2Y5PA 3W5UB 4KKIA 5E6JA 2Z8LA 4AS1A 4N6EB 4MM3B 4TQ0A 5MPOA 3AE7B 4DXGA 3LB8C 1KRHA 2WNMA 1KLGD 1JROA 4YWGG 2G9HD 1ROEA 4DXFA 3NVWA 3U52E 1T3QA 3SR6A 1L4ZB 1PUTA 3KWVA 3NS1A 1IBXA 3P4QB 1C79A 1F0ZA 1AN8A 4REZA 4YSXB 2FE8A 2L1AA 3TEYA 2GRIA 1JW9D 4HRSA 1I4HA 1I4GA 2IPKD 1UNSA 2JYTA 4XWWA 2KMMA 2JZPA 3VRAB 3R8BA 4XE0A 2WU2B 5HHDG 2GB1A 3AEFB 4MT5A 3J9CA 2BT6A 4HKZE 1ZOYB 1XLNA 1ZP0B 4YSZB 1FRDA 2WLBA 2QIEB 1D4BA 3U2SC 1SJHD 1ACCA 2BS3B 2W3SA 4TQ1A 3IAS1 2LGIA 1V97A 4A55A 5EE0A 1J7BA 3Q8FA 3U4EG 1FEHA 1FCLA 4RGNA 4XDCA 2LJIA 1K53A 2J53A 1KTKA 4DQOC 1HEZE 3P42A 4OZBA 3EGRA 1L0VB 3HVDA 2V4IB 4LK0M 1L0YB 2N9LA 3AE3B 3LYYA 3Q8CA 3DWMA 1TS5A 2EKIA 1FFUA 4AQ7A 3TEXA 1BUIC 4NAMA 1FNWA 4P6VF 2WU5B 2PKOA 3AH7A 4XDDA 1L6VA 1SEBD 4L1BA 2BS4B 4OHJA 1XXGA 4WH4A 1SSNA 4C80A 4A9AA 1ZXHA 1L5PA 5H8YE 1SF0A 4JX1C 2WXKA 1NYRA 4HEA1 4OZCA 2RDHA 3PZ7A 5TSSA 3W2DA 3TEZA 1L4DB 5BYRA 2KQ4X 2KDMA 2MH7A 2DWQA 2Y5CA 3RPFC 1JWBD 1PGXA 2V0GA 4RGOS 1JWUD 1J7CA 1WWTA 2PMVA 2WDQB 3MFGA 4JPSA 1TS4A 1I4PA 2MJDA 1MPEA 2ON8A 1NENB 5HI1A 3V3XA 1MHHE 1VZ6A 1FO4A 4N59A 4J3OD 1FRRA 4JWUC 2INPE 2BBCA 1C78A 3P4RB 2JU6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EEL A;  4KGR A;  4HJG E;  2I2Y A;  5BMI A;  3FIL A;  1KH0 A;  2ZW1 A;  4IKG A;  1P7E A;  1JML A;  2N7J A;  2I38 A;  2KWD A;  1MHX A;  2PW9 A;  2PTL A;  2RPV A;  2GI9 A;  2OED A;  1PGA A;  1IBX A;  2NMQ A;  2J52 A;  2QSD A;  1XCQ L;  1Q10 A;  3GB1 A;  1EM7 A;  2PLP A;  1K52 A;  2JZP A;  2IGH A;  1K50 A;  2IGD A;  1MVK A;  1YMH E;  5HHD G;  2GB1 A;  2JWU A;  1P7F A;  4HKZ E;  4KGS A;  1HZ5 A;  4D2K A;  1D4B A;  4OZA A;  2IGG A;  3UI3 A;  1GB1 A;  2LGI A;  1MI0 A;  2KN4 A;  1IGC A;  3FIL B;  4GLS C;  2KAC A;  1YNT E;  5HFY A;  1FCL A;  1C9F A;  1K53 A;  2J53 A;  1F2R I;  1FD6 A;  1F2R C;  2LHD A;  1HEZ E;  4OZB A;  2N9L A;  2JXT A;  1QKZ A;  1K51 A;  3MP9 A;  2N9K A;  2RMM A;  1GB4 A;  1IBX B;  1PGB A;  4WH4 A;  2JSV X;  4IOI E;  2ZW0 A;  5BMG A;  1ZXH A;  5HG2 A;  4OZC A;  4MAC A;  5BMH A;  2KQ4 X;  2QMT A;  2KDM A;  2ONQ A;  4KGT A;  1FCC C;  2K0P A;  1PGX A;  1UWX A;  1HZ6 A;  5JXV A;  1XF5 L;  2ON8 A;  1MPE A;  5HI1 A;  3V3X A;  1MHH E;  1IGD A;  1XCT L;  2LUM A;  2LHE A;  2JU6 X; 
#chains in the Genus database with same CATH topology
 1OEY J;  4KIK B;  1NI3 A;  2K6Q A;  4C7Y A;  3HIZ A;  3QWZ B;  2KFK A;  3AEE B;  1WJ6 A;  2FCM A;  4N58 A;  4EZK A;  2ZVO A;  4W9J A;  2HJ8 A;  2PTL A;  2NR2 A;  4G3X B;  4RFB A;  1WZ0 A;  1TIF A;  3IXS A;  4A6Q A;  4BAX A;  4LDT D;  3AV8 A;  2BYV E;  4L2Y A;  1FIQ A;  2JQR B;  2INC C;  1GOZ A;  3LXF A;  3DDC B;  4IWQ A;  1Q10 A;  2JRH A;  4IM0 A;  3GB1 A;  3NY5 A;  3AB5 A;  4PK1 A;  3Q69 A;  2PLP A;  3PGE A;  1TZO A;  4I6L B;  3DHH C;  3NUH B;  1L7Y A;  3DPD A;  3RUL A;  2L32 A;  4MDK E;  4M0W B;  3GZN I;  3GE8 C;  2AWT A;  3Q8E A;  3UI3 A;  2JRI B;  3ZO5 B;  3ZRC A;  4W9I A;  4B0E A;  3HUI A;  4MGY E;  2LUE A;  1VLB A;  3ZIM A;  3TIX A;  4GU2 A;  4TKN A;  1NEK B;  2NVU I;  4GDL A;  3V60 A;  3UIO B;  4EFO A;  1KLU D;  1UF0 A;  3ZJT A;  4CYE A;  1TY0 A;  2MRP A;  3QCA A;  1I42 A;  1K51 A;  3ZQ4 A;  1D3Z A;  2N9K A;  4B0M A;  1WRI A;  3VFK A;  5CX3 A;  3WAP A;  4JE3 B;  2JPH A;  3ZUN A;  3Q8A A;  2LAS A;  1ZE3 D;  2M56 B;  1UUP A;  2KAN A;  1EU4 A;  3BVZ A;  1TS3 A;  4FHJ A;  1WSP A;  1TT5 B;  3PRZ A;  4E74 A;  5JXV A;  3AN1 A;  3QAR A;  1XCT L;  4MGZ E;  1NYQ A;  2DLB A;  2N4F A;  4K7W A;  4WQM A;  2VZK B;  3DBL B;  3RNF C;  3SFE B;  3BVM A;  5AZF A;  3M3J A;  3VTU A;  1FNU A;  2MLB A;  3B2G A;  2I38 A;  2D5G A;  2KWD A;  3FC4 A;  4FJY A;  1V2Y A;  3WAO A;  2O6V A;  2XK5 B;  5IAA C;  2WXR A;  5IP4 D;  1YJI A;  3L08 A;  4RGM A;  3WAL A;  4WJN A;  5G5H A;  3ZNI D;  4M8N A;  4BOZ B;  3N1Z C;  3R2I A;  2JUO A;  4K3B A;  3DVG Y;  1EF5 A;  4B95 A;  1YQ3 B;  3PVL A;  1E90 A;  3AEC B;  3BK1 A;  4MSQ B;  4D2K A;  3N9Y C;  4GSW A;  3IT6 B;  2WXO A;  3BII D;  4MEM A;  4FBJ B;  3SEB A;  2LZ6 A;  4OVU A;  1C9F A;  5CHV C;  2DBY A;  1R4N I;  2PVG C;  2BYT A;  1QKZ A;  3MP9 A;  3P4S B;  3ZW3 A;  4C4V B;  2L00 B;  1M4V A;  2KHW B;  1GB4 A;  1OEY A;  2AX5 A;  3ENE A;  3L17 A;  4NPN A;  2ZW0 A;  5G5G A;  2EMT A;  1Y56 A;  3OLM D;  5HG2 A;  2KVZ A;  2PPH A;  2L8J A;  3RNC C;  3HHM A;  1FXI A;  4USA A;  1WH3 A;  3KUZ A;  2MP2 B;  1E6E B;  4BKT A;  5IN7 A;  3GE3 C;  2V9H A;  5CHW A;  2MSE D;  1XF5 L;  1WYG A;  3P2B A;  3ZJV A;  3ABV B;  2GBM A;  2REX A;  2RD0 A;  1VZ7 A;  2AL3 A;  4KX6 B;  2SAK A;  4P1B C;  4XWT A;  3V62 A;  2FCQ A;  1B1Z A;  1ZGU B;  3NZU A;  2LVP A;  1QOG A;  2DAF A;  3AED B;  1YOV B;  3AE4 B;  3RN9 C;  1I35 A;  4JQW C;  2N9P C;  3HRD D;  1E0Z A;  2QSD A;  3AEA B;  2IY1 B;  4BVU C;  2J4X A;  1JAL A;  2ACZ B;  2ZZP B;  2INN E;  3SD5 A;  4KGS A;  3BWU D;  2MBE A;  2BGF A;  2IYD B;  2BWF A;  1MI0 A;  1IGC A;  4LCD E;  2FUG 1;  2L83 A;  3O65 B;  4YTN B;  2LHD A;  3MJ5 A;  3L4P A;  1N6Z A;  3ZTD A;  2RGF A;  1V1P A;  2JXT A;  4HLE A;  4RGT A;  2ZPN A;  3AU5 A;  1FMA D;  1CK1 A;  1E9M A;  2Z0D B;  1P9D U;  2R2Q A;  4HRO A;  1JWM D;  1UD7 A;  1IBX B;  2A4Z A;  3Q2A C;  1FPY A;  4GDL B;  2FCN A;  4GB9 A;  1XT9 B;  1OQR A;  4HJK A;  3EUB 2;  4ARI A;  5D94 A;  4AJY B;  2VH2 A;  2YVC A;  3A33 B;  5D2M B;  4A3P A;  5BMH A;  3PZ8 A;  4LTU A;  1V80 A;  4J6I A;  2WQY B;  1KJT A;  4P7I A;  1ESF A;  3PHW B;  3ZKJ C;  1FXA A;  1LQB A;  4RH6 A;  1WMH B;  4FLH A;  3T3N A;  4US8 A;  2X8X X;  3VRB B;  1F9J A;  2ZPY A;  4Q2J A;  4W9C A;  3ETR A;  2JYE A;  3FIL A;  3PRP B;  4IKG A;  3TCA A;  4BKS D;  2D2Q A;  3W5U B;  5JH5 C;  3DHI C;  4N6E B;  1GC7 A;  4TQ0 A;  2LXA A;  2NCN A;  1KRH A;  2MHJ A;  1KLG D;  4HXD A;  4YWG G;  3RYT A;  2ZVN A;  3JVZ X;  2L0T A;  3NVW A;  3DVN V;  4GGQ A;  3P4Q B;  2GBK A;  1F0Z A;  4HPP A;  2FCS A;  2NBW B;  2NBV B;  2IPK D;  1Y8R C;  3R8B A;  4X57 B;  5HHD G;  1R4M B;  1YX5 B;  3AEF B;  4MT5 A;  3J9C A;  4YSZ B;  1FRD A;  2VH1 A;  3U2S C;  1ACC A;  4TQ1 A;  2LGI A;  2C9W B;  4FN2 A;  3T9L A;  3U4E G;  1FEH A;  4RGN A;  4W9K A;  4RM8 A;  2LJI A;  3UIN B;  1KTK A;  2JZZ A;  2PEA A;  1HEZ E;  4OZB A;  3HVD A;  1EUV B;  2GBR A;  3AE3 B;  3KVF B;  2EKI A;  2BPS A;  3H7P A;  4P6V F;  4L1B A;  4MM3 A;  4NQK E;  3MC8 A;  4GXB A;  5H8Y E;  2WXK A;  4OZC A;  3PZ7 A;  3W1S C;  3TEZ A;  3UQA A;  3DHG C;  2GOW A;  2KDM A;  3GOE A;  2LVO A;  3JSV A;  4RGO S;  3PT2 B;  4WWN A;  3A9K A;  3MFG A;  1TS4 A;  3V3X A;  2MJD A;  1FO4 A;  2OJR A;  4HWI B;  2INP E;  2KJ6 A;  1C78 A;  2RDB C;  3JYU A;  1A70 A;  3W9C B;  2CHX A;  1QT9 A;  4PS3 A;  3OG5 A;  1HXY D;  5BYQ A;  2HDE A;  4ZRQ A;  2AEH A;  4MGK E;  3CMM B;  2QC8 A;  2KYW A;  4FJV B;  3QAQ A;  3KYC D;  2W3R A;  1QOA A;  4IW0 A;  3CF6 E;  2KC2 A;  4US9 A;  4TMA B;  1M94 A;  1J19 A;  2H89 B;  4NAW B;  2J0J A;  4L23 A;  1BXT A;  3WAN A;  3ZDT A;  2JWZ A;  1GUA B;  3PTF C;  1X1M A;  4RM9 A;  1Q1O A;  4QAY A;  1GPX A;  4KSL C;  1OGW A;  4HPL B;  1GB1 A;  2V4L A;  1IPG A;  4RCO A;  1LO5 D;  5EDS A;  1H4R A;  1NVI D;  2C7H A;  2N9E B;  1FFV A;  2KMA A;  4YL8 A;  4F7Z A;  2WXN A;  3RNB C;  3DQV A;  1TKY A;  2VZK D;  3P63 A;  3U30 A;  2WXL A;  2RMM A;  1T0S C;  1F52 A;  3VR8 B;  3DBR B;  2AQ1 B;  2KN5 A;  4PS7 A;  2JSV X;  1PDX A;  3AI5 A;  2KJH B;  1BT0 A;  3BIN A;  2IO1 B;  5EE3 A;  1V1P B;  3Q6B A;  1RM6 C;  2KZR A;  2QEJ C;  1UBI A;  1YJJ A;  2BYF A;  4MAC A;  2SEB D;  4FXC A;  1JRP A;  5AZG A;  4YSY B;  4EOY A;  1GNU A;  2H88 B;  3PSE B;  1XLQ A;  2QIL A;  2KFJ A;  1WZ3 A;  3NZ3 A;  5C1Z A;  2HE7 A;  2N7D A;  4M01 A;  3PO0 A;  2W54 A;  1G6J A;  3AE6 B;  3AE8 B;  1AYF A;  2W55 A;  4DXA B;  2LGS A;  2KT7 A;  4HJG E;  4KKJ A;  2R61 A;  3HM3 A;  4NZL B;  2G1E A;  1E7P B;  1E8Y A;  1TGZ B;  1AAR A;  2BW2 A;  3ML9 A;  1N61 A;  2WP9 B;  5TR5 A;  2N1V A;  4OVV A;  2XN9 C;  4ITK A;  4ZRI A;  3VTW A;  4GOC A;  1LFD A;  3W1S A;  3B2F A;  1C3T A;  1F77 A;  3CWI A;  3C0R B;  1YX6 B;  2DZM A;  2PIA A;  3NS8 A;  1DOI A;  2CU1 A;  1I4X A;  4ANW A;  3APD A;  3M95 A;  3TBL D;  3KYD D;  3HVZ A;  2R2O A;  3L0W B;  2BYE A;  1VZ8 A;  1WGH A;  2PVO D;  4K3C A;  4GMV A;  1P0R A;  2B3A A;  2MBQ A;  2LI5 A;  2K9X A;  5E6N A;  1VRA B;  3H7P B;  4ZDV A;  3TUO A;  2MBO A;  3OWE B;  1R7S A;  1HZ6 A;  3I63 C;  1L2N A;  1YD8 U;  1MG4 A;  3B08 A;  5E6O A;  2V3N A;  3BZD B;  2D3G A;  2LUM A;  4UDU C;  2K8B A;  4W9G A;  5I4D A;  2EKE C;  2CR5 A;  2MW5 A;  2MX2 A;  4ZHO A;  4IC7 B;  1YQB A;  3SHQ A;  1JML A;  3DCG A;  3ZNZ B;  2GLS A;  3AMZ A;  2BB6 A;  2C7M B;  3I5J C;  1OQY A;  4NJC A;  2PW9 A;  3TMP B;  3P1M A;  2RDG A;  3NVY A;  4NY0 A;  1ET9 A;  1WXQ A;  1K52 A;  3VR9 B;  1TKE A;  1N5W A;  1T0R C;  4CO7 A;  1UBQ A;  1WYW B;  2WDT B;  4WIP A;  1I4Q A;  3VH3 B;  2IGG A;  1R4M I;  1JCK B;  1L0X B;  3QQ8 B;  3C19 A;  5LXH A;  1RYJ A;  4IWP A;  3AU4 A;  1NI2 A;  4K1R B;  4W9F A;  2FUH B;  1WXM A;  5J18 A;  1N63 A;  1J8C A;  4HCN B;  4CQN A;  2KDB A;  3IBE A;  3AE2 B;  2O2V A;  2MA9 B;  1KFY B;  4G11 A;  3V61 A;  5KHO A;  5AZH A;  5BMG A;  4GIV A;  2KDI A;  2KLC A;  3K9O B;  3B9J A;  2IO0 B;  2KVR A;  2LXC A;  4ZHP A;  2PE6 B;  3VH4 B;  1GJZ A;  5C3J B;  2KQS A;  1KM7 A;  5C2T B;  3RZW C;  1WR1 A;  2EMS A;  2WXI A;  3B0A A;  2DHZ A;  4KGT A;  1UWX A;  1ZPS A;  4YTP B;  1E7V A;  1AWD A;  4MH8 A;  2K25 A;  2KD0 A;  1T0Y A;  4BBN C;  1V8C A;  1GC6 A;  1L6U A;  3EFC A;  5JHB A;  3QX1 A;  1QLB B;  2LVQ A;  2E6X A;  4M8M A;  2Y5P A;  4GDK A;  5E6J A;  1WX7 A;  2I1J A;  4AS1 A;  5MPO A;  1JRO A;  4HDQ A;  2ZNV C;  1L4Z B;  2IY0 B;  2FE8 A;  2L1A A;  1UNS A;  2KMM A;  3VRA B;  2GMI C;  3Q3M C;  4EUT A;  1WJN A;  3HK0 A;  2WLB A;  3QC8 B;  1V9J A;  1SGH A;  2W3S A;  4PYU A;  5EE0 A;  2ASQ A;  3EC8 A;  3Q8F A;  2KFK B;  1HTO A;  4JGH B;  2L3Z A;  2KK8 A;  1L0V B;  3VHT C;  4G50 A;  3LYY A;  2KDF B;  1P1A A;  2L0F A;  4PYZ A;  1BUI C;  4NAM A;  2WU5 B;  2PKO A;  3AH7 A;  1SEB D;  4OHJ A;  4C80 A;  1ZXH A;  3DBR I;  3D32 A;  4HEA 1;  5TSS A;  4N9F 4;  3PRE A;  2D3B A;  3MJW A;  3VUX A;  2ZCB A;  2DWQ A;  1JWB D;  3RUI B;  1PGX A;  5J17 A;  4ZRK A;  1JWU D;  1J7C A;  1YJ1 A;  4JPS A;  1I4P A;  4WAA A;  1NEN B;  1VZ6 A;  1Q5W B;  4J3O D;  2G4S A;  3Q3F A;  4LLG M;  5DPS A;  2NTT A;  4DHJ B;  2BKR B;  1SIJ A;  2G45 B;  2J42 A;  4BKS A;  1WGY A;  1KOT A;  4KZC A;  3Q3O C;  3BY4 B;  2DEN B;  3ONS A;  3IFW B;  2ZCC A;  3GZN B;  1SE3 A;  4DBG A;  1TKG A;  5FR3 A;  3AE9 B;  3N20 C;  3Q8B A;  4YXD B;  1MHX A;  1I4R A;  2CKH B;  2D3C A;  3W1Y A;  1J0G A;  2RPV A;  1E8W A;  2DYO A;  4RF1 A;  2FBW B;  3IG3 A;  3WAM A;  1CQV A;  2NMQ A;  2KC1 A;  5GXG B;  4A20 A;  3NVZ A;  1S1Q B;  2CJO A;  2IGH A;  1MVK A;  5L95 C;  3AE5 B;  2N1W A;  2WXJ A;  2MQJ A;  4ASW C;  4LNO A;  3PHX B;  3H1U A;  3ECI A;  4RNA A;  5D3D A;  1DOY A;  4KZ0 A;  2X38 A;  1FNV A;  4ANU A;  2M19 A;  3VUW A;  1E5W A;  4E71 A;  1PYW D;  1F2R I;  4IUM B;  3H7S A;  1QF6 A;  1QQR A;  1TS2 A;  5DCN A;  2O6V B;  1KLV A;  3APC A;  3I3T B;  2N0S B;  4W9H A;  3GS2 A;  2D11 A;  3RCZ A;  1PGB A;  4EKU A;  2WDV B;  4A8X C;  2IDY A;  3T3O A;  4W9E A;  2QHO A;  4B9K A;  2QCZ A;  4II3 B;  3DVG X;  3RFZ B;  4DDI D;  2Q5W D;  4FJZ A;  4TV3 A;  4O1N A;  3TJP A;  1WGK A;  3N32 A;  5AEK B;  4ACF A;  2MEK A;  2DZI A;  2IZV B;  4KDI C;  3QA8 A;  2MBB B;  5T8I A;  5EE1 A;  1IGD A;  3V6E B;  4LJP B;  1QOB A;  2WXM A;  1C77 A;  2KTF A;  1CMX B;  2M0X A;  2N7E A;  5LNK 1;  1AW7 A;  2M1M A;  4KGR A;  1C1Y B;  2YLM A;  3A4S C;  4C56 C;  1P7E A;  2Y3A A;  2Y5B B;  2WHI A;  1ZDV A;  4C7Z A;  3MC9 A;  4MEL A;  1JWA D;  2LRW A;  4EE2 A;  1V5T A;  3ZYY X;  1GG3 A;  3QIJ A;  2KWV B;  5CTR C;  4PT5 A;  4M02 A;  1R4N B;  3CST A;  1WRD B;  2WWZ A;  3NG0 A;  5CHF A;  3DBH B;  1VDV A;  2WDR B;  3DBL I;  1XO3 A;  3OAW A;  4YTM B;  1EO6 A;  1K8R B;  3UGB B;  2LD9 A;  1B9R A;  1OTR B;  2DZK A;  2BKF A;  3VDZ A;  2WXG A;  3DWG C;  3L54 A;  3T8M A;  1JWS D;  4WWP A;  2KKC A;  2KX3 A;  4AP4 C;  1C76 A;  3AE1 B;  2WXP A;  3NVV A;  4ARC A;  2Z0E B;  2L76 A;  3H6N A;  3EHV A;  1V1O A;  3NZS A;  3KLS X;  3H8H A;  3URY A;  1SE2 A;  4WJQ A;  1WJU A;  2XK5 A;  1FM0 D;  1WE7 A;  2K0P A;  2OJW A;  4R3D A;  4IWO A;  2D07 B;  2LWP A;  1E8X A;  3WIM A;  4YT0 B;  4JWS C;  2V1Y A;  3DBS A;  2FAZ A;  2LGX A;  4TSS A;  2N9X A;  1UH6 A;  2L7R A;  5H92 C;  2DAJ A;  3IT4 B;  4II2 B;  1ZW7 A;  1P98 A;  3O13 A;  2IO2 B;  5BMI A;  5BYS A;  1ZKH A;  1CZP A;  2HTM E;  4GN1 A;  1SB3 C;  3E9S A;  1YN5 A;  4G0N B;  3ZNG C;  1YIW A;  1ET6 A;  3ZXV A;  2JT4 B;  4S0R A;  1YN4 A;  4HVB A;  4MSM B;  2ZJD A;  1ENF A;  1KF6 B;  2NS5 A;  3CSF A;  3EFU A;  1RFK A;  3NHE B;  4RF0 A;  4ZRJ A;  4IM3 A;  1WXV A;  2YEP B;  4WQO B;  2JWU A;  3Q3J A;  3JW0 X;  2MP2 A;  4NJ6 A;  4HDO A;  4OZA A;  1TBE A;  5DPT A;  3ZJU A;  2WS3 B;  3QK0 A;  1HA5 A;  2KN4 A;  3FIL B;  4GLS C;  1YNT E;  1ZXI A;  2XBB C;  4OW0 A;  2JF5 A;  1D5Z C;  4MH0 E;  1WF9 A;  4WUR A;  3N1Y C;  1GAQ B;  3CIR B;  3R3M A;  4EEW A;  2DX5 B;  3MHZ A;  3APF A;  2QDF A;  1RRB A;  2AQ2 B;  4FA6 A;  2W9N A;  2K22 A;  3BVG A;  1TY2 A;  4ZRP A;  3V05 A;  4I6P A;  1RLF A;  4ANX A;  1NDD A;  2D10 A;  1WFY A;  1UGJ A;  1WY8 A;  1JRU A;  1YN3 A;  2JX5 A;  4URK A;  4IG7 B;  2BVC A;  2FIF A;  2LRU A;  3WCQ A;  1VJK A;  2ONQ A;  5L83 A;  1TZ1 A;  5IA7 A;  2IO3 B;  1XEE A;  2ZNV B;  1MG8 A;  3U7Z A;  1OFF A;  1STE A;  3BYY B;  1EU3 A;  2IBI B;  2WXF A;  2FNJ B;  3ZDM C;  1WE6 A;  5C23 A;  3A1Q A;  5FKA C;  5FK9 C;  3KWL A;  4WAF A;  3RD2 A;  3L13 A;  2CJN A;  3KW5 B;  4WWO A;  4W9D A;  4KKI A;  2Z8L A;  4LJO B;  3VXW A;  2CHZ A;  4MM3 B;  4EZJ A;  2K39 A;  3AE7 B;  4E3C A;  4ANV A;  4HK2 A;  4JLC A;  3LB8 C;  2G9H D;  1ROE A;  5LXI B;  3IHP C;  3SR6 A;  1PUT A;  2K1F A;  3M63 B;  1IBX A;  4NJ7 A;  2PE9 A;  4LNN A;  1AN8 A;  4M00 A;  3JSV B;  3PV1 A;  1JW9 D;  3A9K B;  4HRS A;  2GBN A;  2KQ7 A;  2M8S A;  3OJ4 B;  4XE0 A;  3R66 C;  4PS8 A;  1WM2 A;  1ZOY B;  2MCN B;  3VAW A;  2QIE B;  2CS4 A;  3X23 A;  1SE9 A;  3DOW A;  4DHZ B;  1V97 A;  2HJ1 A;  4A55 A;  3B1L X;  1FCL A;  4FUL A;  3ZVV A;  3H9D A;  4MJS A;  1K53 A;  2KLG A;  4IM2 A;  1WMH A;  3FKY A;  3P42 A;  4DQO C;  3EGR A;  2N9L A;  3Q8C A;  3DWM A;  1TS5 A;  4LNF A;  1FFU A;  1T0Q C;  4DHJ D;  4I6N B;  1FNW A;  5IO9 A;  2UYZ B;  2JVC A;  1XXG A;  4WH4 A;  1SSN A;  3RNG C;  4S17 A;  3R7Q A;  3RZF A;  3TL5 A;  4TUU A;  4DK5 A;  2UWQ A;  1SF0 A;  1WX8 A;  4JX1 C;  1WR6 E;  1NYR A;  2RDH A;  3W2D A;  3VUY A;  1L4D B;  5BYR A;  3PLV A;  2KQ4 X;  1EF1 A;  2V0G A;  3SDL C;  1WWT A;  2PMV A;  2WDQ B;  2ON8 A;  1MPE A;  5HI1 A;  2NPT A;  5E6P A;  4N59 A;  1FRR A;  4F1S A;  2KO3 A;  3RI7 C;  3P4R B;  2JU6 X;  4JIO U;  2JZ3 B;  1EWC A;  2LGD A;  1WGR A;  2B76 B;  5IKC M;  3GP7 A;  2I2Y A;  4XGA B;  1V86 A;  2LMC A;  1C4A A;  3AM9 A;  1P3Q U;  1F1H A;  3KUD B;  2HTH A;  4JL9 A;  2KTR A;  3L16 A;  2M17 A;  5D3I B;  5D6J B;  4DDG D;  2LJ5 A;  3R2T A;  4XX5 A;  1PGA A;  2O6V D;  3WA0 A;  1N60 A;  3R7R A;  4CHK A;  1Z5S B;  1XCQ L;  2DYB A;  1PFD A;  4ZYS A;  1EM7 A;  3IAM 1;  1K50 A;  2IGD A;  3KH0 A;  1MJD A;  3DBH I;  3AUL A;  2W82 A;  2C5L C;  3Q3N C;  4XC2 A;  2QJL A;  3HM6 X;  5KHQ A;  5EE9 A;  3MHS D;  4H2A A;  4LNI A;  4K7S A;  1V49 A;  1FD6 A;  1F2R C;  2WGS A;  1A5R A;  4AWJ A;  4LDT B;  1IYF A;  1J7A A;  3M62 B;  2V3S A;  1IUE A;  1VCB A;  1UWM A;  4WJP A;  1ZUD 2;  2LFI A;  2BQQ A;  3AEB B;  3ML8 A;  2KMC A;  2KX0 A;  4IOI E;  2TSS A;  2UU7 A;  1SBB B;  3N3K B;  4HCP B;  2QMT A;  5J2R A;  1VR9 A;  1QIL A;  1UGM A;  2IJ0 A;  2BF8 B;  3DVN U;  1DGJ A;  4NAW A;  5BO4 B;  2D3A A;  4FHK A;  3UQB A;  3IVF A;  5HKH A;  3VQI A;  3EA6 A;  3NOB A;  1N62 A;  3A4R A;  2MJE A;  1V81 A;  3RNA C;  2MJ3 A;  3BYT B;  4F8C B;  5D7G A;  2L05 A;  1TJE A;  1KH0 A;  2ZW1 A;  1DYQ A;  4ICV A;  3QHT A;  1XLP A;  2JXX A;  2ZEQ A;  2K5P A;  4IDI A;  1WI0 A;  3A1Q B;  2ICI A;  1C4P A;  2KJR A;  1SIF A;  1ZDX A;  3W5V B;  1JQ4 A;  3P4P B;  2BWE S;  1WIA A;  4K81 A;  2KNB A;  5JHA A;  1YMH E;  1U4A A;  5FR6 A;  2WYQ A;  4B6W A;  3X0W A;  1QOF A;  4FAD A;  3NRZ A;  3N1X C;  2V3P A;  1E8Z A;  4BFR A;  3BK2 A;  2KAC A;  1Z2M A;  3RT3 B;  5HFY A;  3AXC A;  4AUQ C;  3QJZ A;  3A9J A;  2NBU A;  2RR9 A;  1XLO A;  3KQ4 A;  2WX1 A;  1C4C A;  2AQ3 B;  5G55 A;  4MJS B;  3SU8 X;  3AEG B;  3N30 A;  3UIP B;  1YQ4 B;  2M0A A;  1T5X D;  2XEW A;  1V6E A;  2YEP F;  3S2A A;  4KIK A;  1FCC C;  3ZNH B;  2K3U A;  4P16 A;  1D5M C;  2MBH A;  2DZJ A;  2IND C;  1HE8 A;  1QZE A;  2LHE A;  1LM8 B;  2EEL A;  1UEL A;  2Z59 B;  1I7H A;  2FID A;  1LGR A;  4C00 A;  4MGI E;  2O2V B;  3MC0 B;  5LLI A;  4BBN F;  4ZOH C;  2NPT B;  2L52 A;  2N7J A;  3ZTC A;  3V6C B;  2NTS A;  2DYM A;  1H8C A;  4KDL B;  3E56 A;  2BTE A;  2GI9 A;  4ZYN A;  5IOI A;  2OED A;  1PQS A;  2M4N A;  4OVZ A;  1TTN A;  4M0W A;  3ALB A;  2J52 A;  3ZGZ A;  2CU3 A;  5JZE B;  1FXT B;  1DOX A;  2KTR B;  1BML C;  1V5O A;  1NBF C;  2AL6 A;  4ICU A;  1CJE A;  1SJE D;  1P7F A;  4KSK C;  1D5X C;  2CHW A;  2BS2 B;  1TYG B;  2WXQ A;  2G4D B;  1HZ5 A;  2DNF A;  4K7U A;  1S3S G;  3U7D A;  5G2N A;  3L10 B;  2LGY A;  1SE4 A;  3MTN B;  4BZA A;  2WX0 A;  2WXH A;  4GDK B;  4KV2 A;  2HD5 B;  3I57 A;  3PPA A;  1WGG A;  3KUC B;  2J0K A;  1HQR D;  2JY6 A;  4HKQ A;  3VTV A;  3SFD B;  2MWS B;  2J0M A;  2KOX A;  5AUI A;  2RSU A;  3FAH A;  3I9V 1;  4WWM A;  3UF8 A;  4WJO A;  2LEK A;  3K9P B;  3VVW B;  2A5U A;  2E3T A;  4RMA A;  1D6E C;  3NJT A;  4KVG B;  1T6B X;  5AUK A;  4AOF A;  1N5X A;  3C8Y A;  2BB5 A;  2VRR B;  3TEW A;  2XNA C;  1EWY C;  2G3Q B;  4XYC A;  1SXT A;  3OJ3 A;  1WJ4 A;  4A90 A;  1LXD A;  1OQQ A;  1E10 A;  5DPR A;  2OHF A;  1WXA A;  3TSS A;  1WM3 A;  1RWS A;  3PZD A;  2KAJ A;  2KDE B;  2AYO B;  3PS6 A;  4NNJ B;  1ISN A;  2K6D B;  3LDZ E;  4DXG A;  1UZX B;  2WNM A;  1HTQ A;  4DXF A;  3U52 E;  1T3Q A;  4HPM B;  3KWV A;  1WXS A;  3NS1 A;  2OOB B;  1WGD A;  2C7N B;  2PJH A;  4P1C C;  1C79 A;  4REZ A;  4YSX B;  3TEY A;  2GRI A;  1I4H A;  1I4G A;  4W9L A;  2JYT A;  4XWW A;  2JZP A;  2WU2 B;  2GB1 A;  1E7U A;  2BT6 A;  2KWU B;  4HKZ E;  1XLN A;  1ZP0 B;  2RPQ A;  4AJW A;  1D4B A;  4DWF A;  2KWC A;  1SJH D;  2BS3 B;  3IAS 1;  4BOS C;  1J7B A;  4DHZ E;  2C60 A;  4C4V A;  1RAX A;  3U8Z A;  4A3O A;  4XDC A;  3RNE C;  2J53 A;  3RMK C;  1VD2 A;  2KXJ A;  5DPW A;  2V4I B;  4LK0 M;  1L0Y B;  3ZXR A;  4AQ7 A;  1MFW A;  3TEX A;  4EZL A;  3EEC A;  1XQQ A;  4BKG A;  1Q0W B;  5GMV A;  3LJ3 A;  4XDD A;  2K8H A;  1L6V A;  3Q14 C;  3A9J B;  2BS4 B;  2K8C A;  4A9A A;  3ZLZ A;  1IP9 A;  1L5P A;  1XD3 B;  2GBJ A;  1WX9 A;  1RFA A;  2I1K A;  2MH7 A;  3PRM B;  2Y5C A;  3RPF C;  4NQL B;  3PLU A;  4XZ4 A;  2J7Q B;  1MHH E;  4JWU C;  3ZRF A;  2BBC A;  4LNK A; 
#chains in the Genus database with same CATH homology
 1A70 A;  2NTT A;  1EWC A;  3W9C B;  1NI3 A;  1SIJ A;  2B76 B;  2J42 A;  4C7Y A;  1QT9 A;  1HXY D;  3GP7 A;  5BYQ A;  2I2Y A;  2HDE A;  4ZRQ A;  1SE3 A;  1TKG A;  2LMC A;  1C4A A;  5FR3 A;  3AM9 A;  3AEE B;  3AE9 B;  3Q8B A;  4YXD B;  4N58 A;  1MHX A;  1I4R A;  2PTL A;  4RFB A;  2W3R A;  1QOA A;  2RPV A;  2DYO A;  3IXS A;  4A6Q A;  4RF1 A;  3AV8 A;  5D3I B;  4US9 A;  4L2Y A;  1FIQ A;  3R2T A;  2JQR B;  4TMA B;  2FBW B;  1PGA A;  1CQV A;  1GOZ A;  3LXF A;  1N60 A;  2NMQ A;  2H89 B;  5GXG B;  1XCQ L;  1Q10 A;  4NAW B;  3NVZ A;  4L23 A;  3GB1 A;  1PFD A;  1BXT A;  3AB5 A;  4ZYS A;  1EM7 A;  3Q69 A;  2PLP A;  1TZO A;  2CJO A;  2IGH A;  3IAM 1;  1K50 A;  2IGD A;  1MVK A;  3NUH B;  3AE5 B;  2L32 A;  1GPX A;  2W82 A;  2WXJ A;  2QJL A;  3Q8E A;  1GB1 A;  3UI3 A;  4RNA A;  4RCO A;  1LO5 D;  5D3D A;  4B0E A;  1DOY A;  3HUI A;  2X38 A;  1FNV A;  1VLB A;  5EE9 A;  2M19 A;  4H2A A;  1NEK B;  1PYW D;  1F2R I;  1NVI D;  1FD6 A;  1F2R C;  1FFV A;  1KLU D;  1QF6 A;  1QQR A;  3ZJT A;  1J7A A;  1TY0 A;  1TS2 A;  2WXN A;  1K51 A;  1IUE A;  3ZQ4 A;  1TKY A;  2N9K A;  2VZK D;  3P63 A;  1UWM A;  2WXL A;  1ZUD 2;  2LFI A;  2N0S B;  3AEB B;  2RMM A;  4B0M A;  3GS2 A;  3VR8 B;  1WRI A;  1PGB A;  2AQ1 B;  2WDV B;  4A8X C;  2IDY A;  3T3O A;  2JSV X;  1PDX A;  4LLG M;  4IOI E;  2TSS A;  1SBB B;  4JE3 B;  3RFZ B;  5EE3 A;  1V1P B;  3Q8A A;  1RM6 C;  2QEJ C;  2Q5W D;  1YJJ A;  3ZJU A;  1ZE3 D;  2M56 B;  4O1N A;  4MAC A;  1UUP A;  1WGK A;  2SEB D;  4FXC A;  2QMT A;  1VR9 A;  1JRP A;  1QIL A;  2MEK A;  1EU4 A;  2IJ0 A;  4YSY B;  3BVZ A;  1TS3 A;  2H88 B;  1DGJ A;  1WSP A;  1XLQ A;  2QIL A;  5JXV A;  5T8I A;  3AN1 A;  3NZ3 A;  5EE1 A;  1IGD A;  1XCT L;  1QOB A;  3VQI A;  3EA6 A;  2WXM A;  1NYQ A;  1N62 A;  3PO0 A;  2DLB A;  2W54 A;  1C77 A;  2MJE A;  4WQM A;  2VZK B;  3AE6 B;  3AE8 B;  1AYF A;  2W55 A;  2MJ3 A;  3BYT B;  5LNK 1;  1AW7 A;  5D7G A;  3SFE B;  4KGR A;  1TJE A;  4HJG E;  3BVM A;  4KKJ A;  2R61 A;  1KH0 A;  2ZW1 A;  4C56 C;  1DYQ A;  1FNU A;  1P7E A;  2Y3A A;  4NZL B;  2G1E A;  3B2G A;  2I38 A;  1XLP A;  1ZDV A;  4C7Z A;  2D5G A;  2KWD A;  1E7P B;  2K5P A;  1JWA D;  2BW2 A;  3FC4 A;  1N61 A;  4EE2 A;  2WP9 B;  3ZYY X;  4IDI A;  2XN9 C;  4PT5 A;  2WXR A;  4ITK A;  1YJI A;  2ICI A;  1C4P A;  4RGM A;  5G5H A;  1ZDX A;  3W5V B;  3W1S A;  3R2I A;  3B2F A;  3P4P B;  1VDV A;  1JQ4 A;  2WDR B;  1F77 A;  3CWI A;  1XO3 A;  1YMH E;  4YTM B;  1YQ3 B;  2PIA A;  1DOI A;  1QOF A;  3AEC B;  3BK1 A;  1B9R A;  4D2K A;  3N9Y C;  3IT6 B;  2WXO A;  3NRZ A;  2V3P A;  2WXG A;  1I4X A;  3DWG C;  5HFY A;  3BK2 A;  2KAC A;  3BII D;  3SEB A;  1JWS D;  1C9F A;  3HVZ A;  2DBY A;  2PVG C;  2BYT A;  1QKZ A;  1C76 A;  1XLO A;  3AE1 B;  1VZ8 A;  3KQ4 A;  3MP9 A;  2PVO D;  1C4C A;  2WXP A;  3P4S B;  1M4V A;  2AQ3 B;  3NVV A;  1GB4 A;  4ARC A;  2AX5 A;  1V1O A;  3AEG B;  2ZW0 A;  3KLS X;  3H8H A;  5G5G A;  2K9X A;  3URY A;  1Y56 A;  5HG2 A;  1SE2 A;  1YQ4 B;  2M0A A;  1T5X D;  1VRA B;  1FM0 D;  4USA A;  1FXI A;  2YEP F;  3TUO A;  3OWE B;  1FCC C;  2K0P A;  1E6E B;  2K3U A;  4R3D A;  1R7S A;  1HZ6 A;  4P16 A;  1XF5 L;  1D5M C;  4YT0 B;  4JWS C;  1WYG A;  2V3N A;  3ZJV A;  3BZD B;  3ABV B;  2LUM A;  2LHE A;  4UDU C;  5I4D A;  4TSS A;  1VZ7 A;  2EEL A;  1I7H A;  5H92 C;  4KX6 B;  3IT4 B;  2SAK A;  4ZHO A;  3O13 A;  5BMI A;  3MC0 B;  5BYS A;  4XWT A;  4ZOH C;  2L52 A;  1JML A;  1CZP A;  2HTM E;  2N7J A;  1SB3 C;  3E9S A;  1YN5 A;  1B1Z A;  3AMZ A;  1ET6 A;  1QOG A;  2BB6 A;  4NJC A;  2NTS A;  2PW9 A;  2DYM A;  1YN4 A;  3AED B;  3AE4 B;  1ENF A;  3E56 A;  2BTE A;  2GI9 A;  3P1M A;  2RDG A;  2OED A;  3HRD D;  1E0Z A;  3NVY A;  4OVZ A;  1KF6 B;  4M0W A;  1RFK A;  2J52 A;  2QSD A;  3ZGZ A;  2CU3 A;  4RF0 A;  3AEA B;  1DOX A;  1ET9 A;  1BML C;  2J4X A;  1WXQ A;  1K52 A;  1JAL A;  1TKE A;  1N5W A;  3VR9 B;  2ACZ B;  2YEP B;  2JWU A;  1CJE A;  1SJE D;  1P7F A;  1D5X C;  4WIP A;  1I4Q A;  2BS2 B;  1TYG B;  2INN E;  2WXQ A;  4KGS A;  1HZ5 A;  3BWU D;  4OZA A;  2IGG A;  1JCK B;  1MI0 A;  2WS3 B;  1HA5 A;  1L0X B;  1SE4 A;  1IGC A;  2KN4 A;  3FIL B;  1RYJ A;  1YNT E;  4GLS C;  1ZXI A;  2FUG 1;  4OW0 A;  1D5Z C;  2WXH A;  4GDK B;  2L83 A;  3I57 A;  4YTN B;  2LHD A;  4WUR A;  3MJ5 A;  3L4P A;  1HQR D;  1GAQ B;  3CIR B;  1N63 A;  1V1P A;  4HKQ A;  2JXT A;  3SFD B;  4CQN A;  3MHZ A;  4RGT A;  1FMA D;  1CK1 A;  1E9M A;  3AE2 B;  5AUI A;  2AQ2 B;  4HRO A;  1JWM D;  2K22 A;  1IBX B;  3BVG A;  1KFY B;  3FAH A;  3I9V 1;  4WWM A;  1TY2 A;  4GDL B;  4ZRP A;  2LEK A;  3V05 A;  2E3T A;  5BMG A;  1D6E C;  1OQR A;  3B9J A;  3EUB 2;  4ARI A;  1UGJ A;  4ZHP A;  1T6B X;  5AUK A;  1YN3 A;  2JX5 A;  5BMH A;  5C3J B;  5C2T B;  3PZ8 A;  3WCQ A;  2WXI A;  1VJK A;  2ONQ A;  4KGT A;  1N5X A;  1UWX A;  1ZPS A;  3C8Y A;  1XEE A;  4LTU A;  2BB5 A;  4YTP B;  2WQY B;  3U7Z A;  3TEW A;  2XNA C;  1EWY C;  1AWD A;  1OFF A;  1SXT A;  1ESF A;  1STE A;  4MH8 A;  3BYY B;  1EU3 A;  1V8C A;  4A90 A;  1FXA A;  2WXF A;  1L6U A;  4RH6 A;  3T3N A;  1OQQ A;  4US8 A;  1E10 A;  3VRB B;  2OHF A;  4Q2J A;  1QLB B;  5FKA C;  3ETR A;  2JYE A;  3FIL A;  3KWL A;  4WAF A;  4IKG A;  5FK9 C;  3TSS A;  2E6X A;  1RWS A;  2CJN A;  2KAJ A;  2Y5P A;  3W5U B;  4KKI A;  5E6J A;  2Z8L A;  4AS1 A;  4N6E B;  4MM3 B;  4TQ0 A;  5MPO A;  3AE7 B;  4DXG A;  3LB8 C;  1KRH A;  2WNM A;  1KLG D;  1JRO A;  4YWG G;  2G9H D;  1ROE A;  4DXF A;  3NVW A;  3U52 E;  1T3Q A;  3SR6 A;  1L4Z B;  1PUT A;  3KWV A;  3NS1 A;  1IBX A;  3P4Q B;  1C79 A;  1F0Z A;  1AN8 A;  4REZ A;  4YSX B;  2FE8 A;  2L1A A;  3TEY A;  2GRI A;  1JW9 D;  4HRS A;  1I4H A;  1I4G A;  2IPK D;  1UNS A;  2JYT A;  4XWW A;  2KMM A;  2JZP A;  3VRA B;  3R8B A;  4XE0 A;  2WU2 B;  5HHD G;  2GB1 A;  3AEF B;  4MT5 A;  3J9C A;  2BT6 A;  4HKZ E;  1ZOY B;  1XLN A;  1ZP0 B;  4YSZ B;  1FRD A;  2WLB A;  2QIE B;  1D4B A;  3U2S C;  1SJH D;  1ACC A;  2BS3 B;  2W3S A;  4TQ1 A;  3IAS 1;  2LGI A;  1V97 A;  4A55 A;  5EE0 A;  1J7B A;  3Q8F A;  3U4E G;  1FEH A;  1FCL A;  4RGN A;  4XDC A;  2LJI A;  1K53 A;  2J53 A;  1KTK A;  4DQO C;  1HEZ E;  3P42 A;  4OZB A;  3EGR A;  1L0V B;  3HVD A;  2V4I B;  4LK0 M;  1L0Y B;  2N9L A;  3AE3 B;  3LYY A;  3Q8C A;  3DWM A;  1TS5 A;  2EKI A;  1FFU A;  4AQ7 A;  3TEX A;  1BUI C;  4NAM A;  1FNW A;  4P6V F;  2WU5 B;  2PKO A;  3AH7 A;  4XDD A;  1L6V A;  1SEB D;  4L1B A;  2BS4 B;  4OHJ A;  1XXG A;  4WH4 A;  1SSN A;  4C80 A;  4A9A A;  1ZXH A;  1L5P A;  5H8Y E;  1SF0 A;  4JX1 C;  2WXK A;  1NYR A;  4HEA 1;  4OZC A;  2RDH A;  3PZ7 A;  5TSS A;  3W2D A;  3TEZ A;  1L4D B;  5BYR A;  2KQ4 X;  2KDM A;  2MH7 A;  2DWQ A;  2Y5C A;  3RPF C;  1JWB D;  1PGX A;  2V0G A;  4RGO S;  1JWU D;  1J7C A;  1WWT A;  2PMV A;  2WDQ B;  3MFG A;  4JPS A;  1TS4 A;  1I4P A;  2MJD A;  1MPE A;  2ON8 A;  1NEN B;  5HI1 A;  3V3X A;  1MHH E;  1VZ6 A;  1FO4 A;  4N59 A;  4J3O D;  1FRR A;  4JWU C;  2INP E;  2BBC A;  1C78 A;  3P4R B;  2JU6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...