2IGDA

Anisotropic structure of protein g igg-binding domain iii at 1.1 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
b'MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Anisotropic Refinement of a Protein G Domain at 1.1 Angstrom Resolution
rcsb
source organism Streptococcus sp.
molecule tags Igg-binding protein
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2igdA00
4GLSC 4D2KA 4KGTA 2QSDA 1MPEA 1XCQL 2OEDA 2JZPA 2PTLA 3UI3A 1XCTL 1FCLA 2LHEA 1K52A 2ON8A 1D4BA 1K50A 1PGXA 2J53A 4KGSA 4KGRA 1P7EA 1GB1A 1UWXA 5BMIA 1IGDA 1FD6A 4MACA 4WH4A 2K0PA 1PGAA 2I2YA 3GB1A 1P7FA 1F2RC 1HEZE 5HI1A 2LUMA 1K51A 2ONQA 2JSVX 1ZXHA 1FCCC 2RMMA 1YNTE 2LGIA 1HZ6A 4OZCA 1XF5L 1MHXA 2PLPA 2RPVA 2EELA 4HKZE 2IGGA 2KDMA 2JU6X 1HZ5A 2GI9A 1GB4A 2NMQA 5HHDG 4OZAA 4IOIE 3V3XA 1C9FA 5HG2A 1Q10A 2ZW1A 2KN4A 2N9LA 4HJGE 2KWDA 2GB1A 2KQ4X 1IBXB 2ZW0A 2LHDA 3MP9A 2QMTA 1IBXA 2KACA 2IGHA 2JXTA 1QKZA 5JXVA 5BMGA 1K53A 2JWUA 5BMHA 1MI0A 1PGBA 1EM7A 3FILB 1JMLA 1KH0A 1MHHE 1YMHE 2PW9A 1MVKA 5HFYA 3FILA 2IGDA 4OZBA 2N7JA 1F2RI 2I38A 2J52A 4IKGA 1IGCA 2N9KA
chains in the Genus database with same CATH superfamily
1SXTA 4LTUA 1WWTA 4MM3A 4MEMA 3VFKA 1PGXA 4FA6A 2E3TA 5AZHA 1L2NA 3K9OB 3FC4A 1I4HA 4MSMB 1FD6A 3VTUA 3UIOB 3W1YA 3NVVA 2WYQA 1TIFA 2JY6A 5DPRA 1WR1A 1LGRA 1C77A 4ZDVA 4YTMB 1E9MA 1WE7A 1JW9D 3KUZA 4LJPB 1WFYA 2FCSA 4AP4C 4FXCA 2A4ZA 2BYFA 2MCNB 1XF5L 4G0NB 4A3OA 3NS8A 2AL3A 3R7QA 1SJED 3A33B 3FAHA 5J17A 2I1KA 3APFA 2WXGA 2YVCA 2WXNA 3V62A 3JW0X 4I6PA 4ARIA 2RD0A 1Q5WB 2DNFA 2JU6X 1F52A 1VCBA 1AWDA 4E71A 1R4MI 4ZRQA 2LEKA 3URYA 4LNNA 4DDGD 1DOYA 1FRDA 1N61A 4DK5A 1IBXB 2BYEA 2W82A 1SB3C 4NZLB 2LXAA 4GOCA 3P4RB 1V49A 1SIJA 4XX5A 4W9DA 1XEEA 2PVOD 2V3PA 2K22A 4A90A 5BMHA 3VQIA 3ZJUA 4PYZA 3WANA 2DBYA 3Q3NC 3A9JB 2JF5A 1I42A 2LRUA 1FIQA 1RYJA 1YJIA 1E8WA 2BBCA 2V1YA 1OQYA 2BS4B 2VH1A 2ZVNA 2DYOA 1TS2A 3AE3B 1VZ6A 3EECA 1QILA 1Y56A 1UGJA 3PZDA 3JVZX 2LGXA 4WURA 3PRMB 4ZRKA 3QQ8B 1C79A 3AE5B 4WJNA 3A1QA 4X57B 5CHVC 1P7EA 4LK0M 3KUCB 1SE3A 2J0JA 4L2YA 2K8BA 2L0FA 3CMMB 1I4QA 3AE2B 3APCA 1IP9A 2FNJB 3RZWC 3QJZA 3TL5A 1S1QB 3L10B 2LMCA 3ZNGC 2ZNVB 2L05A 3DHIC 5FK9C 2IYDB 3OJ4B 4KV2A 4M00A 3QWZB 2EMTA 1P9DU 4LJOB 2WX0A 1V86A 4HKQA 1FNWA 1TKEA 2C60A 4C7ZA 2W9NA 1UWMA 4WAFA 3TBLD 4G11A 1V6EA 3DDCB 2G45B 1HE8A 3ENEA 2KFKB 1HA5A 4UDUC 2MBEA 2MWSB 4IC7B 1EWCA 1SGHA 4AJYB 1BMLC 2VH2A 1UGMA 3SHQA 3A4SC 2LVQA 2QDFA 2HTHA 1ESFA 3MFGA 2RGFA 2V0GA 3BYTB 3OG5A 1K53A 1YJ1A 4RH6A 3QCAA 3BYYB 3W2DA 3ZW3A 3Q8AA 5D7GA 2XEWA 3RYTA 2W54A 3IT4B 4EFOA 4M02A 3Q8EA 4FULA 1R4NI 4G3XB 1H4RA 3V6EB 2BYVE 2IO3B 4DXGA 2FUHB 2G3QB 3LJ3A 1WGKA 1SIFA 2WWZA 2K8CA 1T0QC 4A20A 3RFZB 1OTRB 2KWCA 5I4DA 2L32A 1L4ZB 2MP2B 2I2YA 4RF1A 1HEZE 2IJ0A 3AE1B 4K81A 1QZEA 1K51A 3VR8B 3OAWA 1I4XA 4I6LB 5FR6A 5E6NA 3TEWA 2HD5B 1ZKHA 2WXRA 1J7AA 4WJPA 2INDC 2BTEA 1HXYD 1WXAA 1MG4A 5GXGB 3QX1A 3NJTA 4YWGG 4B0EA 4WWMA 3B2GA 3Q8CA 4KSLC 3ZO5B 1WMHB 2BKFA 2KWDA 3P4QB 4W9HA 1SEBD 1YOVB 4GDLA 3L54A 3DBHB 1IBXA 1YQBA 4M8MA 1KJTA 1GAQB 1XO3A 1GOZA 4KDLB 1RFKA 1UBIA 4F8CB 5JZEB 2JQRB 2V3NA 1ET9A 3A9JA 2N4FA 1B9RA 1EUVB 4AWJA 1F9JA 3EFCA 1XCQL 1NDDA 2OEDA 1FCLA 2UWQA 4A55A 1J7BA 4GDKB 3KW5B 5IA7A 3AU5A 4ITKA 4P1CC 2V4IB 4HJKA 1IGDA 2G9HD 2CU3A 1MG8A 5HKHA 2AQ3B 4IM3A 3ZDTA 3TSSA 5BO4B 2YEPF 3Q3JA 3S2AA 4FHJA 2LUMA 4MELA 4O1NA 1LO5D 3ZTCA 4TUUA 3PTFC 4K3BA 3GOEA 2HTME 2MBQA 4EZKA 1FCCC 2INCC 2Z0EB 4BFRA 1A5RA 2IZVB 4P1BC 4YSYB 3ZRFA 2ZCBA 3AE4B 1WY8A 4NJCA 2MBOA 1YX6B 3X23A 1C76A 1JCKB 5C2TB 2J7QB 4P6VF 3Q3MC 1OQQA 2L1AA 4RNAA 2KDIA 2LGSA 2AWTA 2KFKA 1WXVA 2ZW1A 2KN4A 3WIMA 2Z0DB 5FKAC 4F1SA 4G50A 2KACA 1TS3A 4MH0E 3DVNU 4KZCA 1E5WA 1QKZA 1P3QU 4ZYNA 1V1PB 1R7SA 3AB5A 1V9JA 4OW0A 2NCNA 1D5ZC 3A9KA 2N7JA 2C7HA 3U4EG 3BVZA 4N6EB 3I57A 4YTNB 1TJEA 2DAFA 2KMMA 1PYWD 5IAAC 5IOIA 2L3ZA 4N9F4 2ASQA 3WAOA 2WNMA 1EF1A 2R2OA 4LNFA 3Q3FA 3BK1A 2LASA 4OVUA 1NI3A 3NZSA 2IO1B 5DPSA 1E10A 4B6WA 4YSXB 4A8XC 2MP2A 3QIJA 1QQRA 2MQJA 4CHKA 3L13A 3EUB2 1TS4A 1FM0D 4EUTA 3VH4B 2JSVX 3O65B 4BKSA 3PLUA 3PRPB 1E7VA 1TZ1A 3T8MA 4DHZB 4M01A 4YL8A 3UQBA 1ET6A 3AE8B 3KYCD 1E8YA 3IBEA 4RFBA 2PLPA 1WSPA 2NVUI 2RPVA 5MPOA 3SDLC 2L76A 2O6VB 4ZHOA 2WU5B 3DBLB 4JL9A 3NZ3A 4QAYA 5EE9A 3Q14C 1VDVA 3WAPA 2QEJC 1GB4A 1WGRA 4KVGB 2KX0A 4W9IA 3HVZA 2WDQB 1BT0A 3AEDB 1SBBB 1WMHA 2SAKA 2YEPB 2A5UA 3RPFC 4NAMA 4AQ7A 3Q2AC 2V9HA 1FFVA 3GZNB 1MI0A 1NI2A 1WIAA 3MTNB 2MW5A 5E6PA 2K8HA 3P1MA 4RM8A 3NVWA 2VZKD 3IT6B 1WXQA 4OZBA 4PYUA 3UQAA 1T0RC 1VRAB 1WM3A 1L7YA 3P4SB 3LDZE 3BK2A 4DHZE 3U52E 2JZPA 3L08A 2ZPYA 4HWIB 4NQKE 5D3DA 4NJ6A 3AEAB 2Z8LA 4EE2A 1Z5SB 4GDKA 2AQ1B 4IG7B 1BUIC 5BYRA 1FNVA 3SR6A 2ICIA 1CMXB 3U30A 5LNK1 1P7FA 1RRBA 3I63C 3L0WB 5H8YE 1GUAB 4BBNC 4FJYA 1FPYA 1XQQA 3DBRB 3ONSA 3RI7C 4TQ1A 1T0YA 2WXLA 3LB8C 3C19A 1VR9A 1V81A 1VD2A 1UNSA 2AQ2B 1WYWB 1G6JA 1DYQA 1XLQA 1V97A 1D3ZA 1C4PA 2KC2A 3DWGC 1SJHD 2L0TA 4GU2A 2L83A 2Y5CA 2MBBB 3NZUA 4JGHB 2RDGA 2R61A 2K9XA 2KVZA 3RNFC 2G1EA 2KX3A 4GXBA 1UZXB 2IO2B 2NMQA 5HHDG 4LNOA 1FFUA 1WH3A 2K6QA 1M94A 2UYZB 1Q10A 3GP7A 4P16A 3SEBA 2GB1A 2L8JA 4PT5A 1C78A 4RCOA 5D6JB 2JZ3B 4W9JA 3ZIMA 3KWVA 2BWES 3PV1A 2JPHA 1NENB 1PGBA 1CK1A 1V1PA 1PFDA 3U7DA 5C3JB 4ZHPA 1OQRA 4IM0A 4KKIA 2GMIC 4IKGA 3W5UB 3BIID 3HVDA 1GPXA 1J0GA 4WJQA 4JLCA 3UI3A 1OGWA 4YSZB 1K50A 2JUOA 2PE9A 3W1SA 2BB5A 4IWOA 5LXHA 2WXIA 1E7PB 3SFEB 4DXFA 1C1YB 1T5XD 2YLMA 2XN9C 2JRHA 3HRDD 1L0YB 3IVFA 1V80A 3ETRA 1UD7A 2M19A 2DYMA 4JX1C 2PVGC 3NVYA 3WA0A 1AARA 1JWBD 4PK1A 2JXXA 1I4GA 3BINA 3H7SA 4NY0A 1TKGA 2O6VA 4OVZA 1NYQA 2JRIB 3B1LX 3R2IA 1SE4A 1JWAD 4FADA 1FXTB 1JWUD 3T3OA 1PDXA 1UELA 3ZDMC 3ZXRA 4ANUA 3T3NA 2JYEA 4HJGE 2UU7A 2ZW0A 1K8RB 3HM3A 2K6DB 3GE8C 1P98A 1C4AA 2JXTA 4ICUA 3NS1A 1NYRA 3P63A 4XC2A 1V1OA 3FILB 2X38A 1Z2MA 2C7NB 3CSFA 2N1VA 1ZE3D 2KLCA 1HTOA 3RT3B 2FCNA 3PGEA 4RGTA 1D4BA 1EU3A 4C7YA 1WRDB 2BYTA 3Q8BA 2GBJA 1YIWA 1WGGA 3PT2B 1UWXA 3V05A 4KKJA 3ZNZB 1IYFA 5E6JA 1KOTA 2KTRB 3MC0B 2C5LC 3NHEB 3MC8A 1UH6A 2WXHA 5AZFA 4FN2A 5D94A 3JYUA 1Q0WB 2KTFA 5BYSA 2MEKA 4LNIA 1WJNA 3PRZA 1TBEA 5G55A 3VAWA 2RMMA 5LLIA 3ZUNA 1XXGA 2KMAA 3AXCA 4E74A 4BAXA 4NQLB 1L6UA 3N1YC 4IM2A 4GGQA 5TSSA 2NBWB 3SD5A 2ZCCA 2K25A 2WDTB 3OLMD 3R8BA 2ZEQA 2RSUA 2GI9A 1AW7A 2ZVOA 3PZ8A 1WM2A 3OJ3A 2KMCA 1XD3B 4OZAA 1WGHA 1L4DB 1TY0A 4JQWC 3AE9B 3R66C 2J4XA 4HEA1 3IXSA 1MFWA 2KJ6A 3IHPC 2JT4B 2W55A 1JALA 4FLHA 3DPDA 2KJHB 4USAA 2D07B 2VRRB 1J8CA 1OEYJ 1EWYC 3MJ5A 3DVNV 1MVKA 1TTNA 1D5MC 3ZJVA 1TGZB 4ANVA 1JRPA 2AL6A 4PS3A 4GLSC 3TEZA 2QSDA 3ABVB 3PPAA 4HDOA 3HK0A 2ACZB 2LZ6A 3P2BA 3N32A 4DXAB 2ZZPB 4ZRJA 1V2YA 4M8NA 2WXFA 4MACA 1XLPA 2BT6A 2V4LA 4HRSA 3QA8A 3AH7A 1SF0A 2WXOA 4IWQA 3CSTA 2D3GA 2L7RA 3BVGA 3AEFB 2FCMA 3AULA 4I6NB 4B95A 2NS5A 3HHMA 1ZXIA 5AZGA 3MJWA 2M0XA 2DENB 4YT0B 1L5PA 2G4SA 3QK0A 1Q1OA 3ZNHB 4TV3A 3ZYYX 5EDSA 1HTQA 1KFYB 2IO0B 3M62B 3DHGC 4HROA 4N58A 2FAZA 2OOBB 1CQVA 2D10A 1YD8U 3IG3A 4OHJA 2KKCA 3EA6A 1R4NB 1I4PA 3UIPB 1VZ8A 3DBLI 4KIKB 2N9LA 1WX9A 1FXAA 3VRBB 4C80A 4ZRIA 1EU4A 4MM3B 3UGBB 3U7ZA 4MGKE 2GBRA 1ZDVA 5D3IB 3ML9A 3VUWA 3KQ4A 5G2NA 4W9KA 3DHHC 4A9AA 4KZ0A 5IP4D 2WS3B 2Y5BB 3VVWB 1EM7A 3AI5A 2PJHA 1OEYA 2R2QA 1KH0A 3FILA 1H8CA 5EE1A 1QOGA 2D11A 4RMAA 4EKUA 4AUQC 2N7DA 2Y3AA 3GZNI 1WRIA 2MJEA 4J6IA 1F1HA 4FJZA 1XCTL 3VH3B 1XLNA 2KYWA 2LHEA 2LJ5A 4FJVB 4AJWA 1D5XC 5C1ZA 1UUPA 5AUKA 1STEA 5CX3A 2V3SA 2WDVB 2BWFA 5KHOA 2KNBA 1L6VA 4GIVA 3DBSA 5HI1A 3RNEC 3PSEB 4MJSB 3RNBC 2KLGA 2J42A 2J0MA 1PQSA 2K5PA 4US8A 3NOBA 1WI0A 1KTKA 3LYYA 4GB9A 1D6EC 1YX5B 3RD2A 1KLVA 2REXA 3M95A 1E8XA 5GMVA 1TKYA 2PEAA 4JPSA 1J19A 3EGRA 4HDQA 1L0VB 3RULA 5JHBA 2XK5B 2KDBA 3N9YC 4REZA 3VTWA 5AUIA 3W1SC 1HZ5A 3E9SA 2N9EB 5KHQA 4A3PA 4HXDA 3DWMA 2LVOA 2SEBD 4WWOA 1WR6E 2JWZA 2BPSA 3HUIA 1GC6A 3MHZA 4KSKC 1N5XA 2BW2A 2QMTA 3JSVB 4DHJD 4K7SA 3RN9C 1MJDA 3D32A 2MJDA 3A4RA 5BYQA 2PW9A 3M3JA 2N9PC 3N20C 1GC7A 3AECB 1F2RI 2I38A 2JVCA 3V61A 2N0SB 1F77A 1NVID 1IGCA 2BF8B 3DVGX 2GBNA 3VUYA 4ZRPA 3UF8A 1QT9A 1E90A 1WX8A 1OFFA 3N30A 3RNAC 1U4AA 1LM8B 4WIPA 2NTSA 1PUTA 5G5GA 2LVPA 2IPKD 4K1RB 2MBHA 4BOZB 3PVLA 1EO6A 2FUG1 1CJEA 2AEHA 3RNCC 4WH4A 3CWIA 3R2TA 1E6EB 3AE6B 2N1WA 2INPE 1SSNA 1HQRD 4LDTD 5IKCM 3W5VB 1AYFA 4MDKE 2LD9A 2D3BA 1TYGB 2L00B 4C56C 3U8ZA 2BVCA 2WX1A 5J18A 2OHFA 3ZVVA 4C00A 1X1MA 2G4DB 4IUMB 2WQYB 2FCQA 2PKOA 1ROEA 2KO3A 3ZTDA 3K9PB 2MA9B 1MHXA 2JZZA 3NY5A 4MSQB 2QHOA 2EELA 3I5JC 2M1MA 2IY0B 4XE0A 2NTTA 3EFUA 3TCAA 5DPWA 2MHJA 4ARCA 4BZAA 2IBIB 4W9CA 1DOIA 2GLSA 2AYOB 4IDIA 2LUEA 4KIKA 4ANXA 1KRHA 2M4NA 3H7PB 2LXCA 4OVVA 4W9FA 3SU8X 2GBKA 4AS1A 4S17A 1WZ3A 1YJJA 5TR5A 2CR5A 4XGAB 2DYBA 2KK8A 3IFWB 2KD0A 2FIDA 2ZPNA 1JRUA 4XDCA 4WWNA 5LXIB 1QOFA 1M4VA 2WHIA 1WGYA 4XDDA 4XZ4A 3AE7B 4C4VB 2JX5A 2N9KA 1WXSA 4DHJB 4D2KA 2KWUB 3I3TB 2M0AA 5IO9A 4MGZE 2KXJA 2QJLA 4A6QA 1ISNA 3RZFA 4EZLA 4KGSA 4KGRA 2PE6B 2NR2A 1N62A 1UF0A 2W3RA 2K0PA 4MT5A 3P42A 3ZLZA 1PGAA 2DWQA 2BS3B 3L4PA 2WXKA 4XYCA 4S0RA 2KDFB 3HM6X 3GB1A 2NBVB 1UBQA 1F2RC 4TQ0A 2KFJA 5IN7A 1TY2A 3TEXA 2NPTB 3PHXB 1RLFA 1ZP0B 2KHWB 2KJRA 2ONQA 1T6BX 4MJSA 2BS2B 1TT5B 3RCZA 1N60A 2VZKB 4BKTA 2FIFA 4HPMB 3DVGY 3C8YA 4GDLB 1LFDA 4II3B 4LDTB 1E8ZA 2DLBA 4CQNA 3N3KB 2ZJDA 3AEEB 3VR9B 4EZJA 5J2RA 2EKIA 3DOWA 4HPPA 2XK5A 5EE3A 4US9A 2C9WB 4K7WA 4JE3B 1C9FA 2IY1B 4XWTA 3E56A 3H6NA 4L1BA 2KAJA 3MHSD 3MP9A 2KANA 3M63B 2TSSA 4PS8A 2IGHA 2RDBC 2XNAC 5JXVA 3JSVA 1ACCA 2DZJA 3B0AA 4BKSD 4GMVA 3RMKC 3R3MA 1A70A 4HPLB 2KZRA 5DCNA 2DAJA 3WALA 1WX7A 3FKYA 2O2VB 4GN1A 2MLBA 2CHWA 4TMAB 3SFDB 1DOXA 3T9LA 1DGJA 1I7HA 2D3AA 3KWLA 2ZNVC 1V8CA 4KDIC 4DBGA 1IUEA 4II2B 4CYEA 5AEKB 3DBHI 5CHWA 5G5HA 2BGFA 3TUOA 3ZKJC 3KH0A 2RPQA 1JROA 1RAXA 2MX2A 4ASWC 2PMVA 3ZJTA 1WJ4A 2QC8A 4BKGA 1ZXHA 2RDHA 2H88B 4MGIE 3C0RB 4EOYA 1C3TA 1R4MB 1LQBA 3DQVA 4CO7A 2KQSA 3VDZA 1P1AA 4HCNB 1NEKB 3KUDB 1GNUA 4RF0A 3U2SC 4Q2JA 2CHXA 4GSWA 2HE7A 3A9KB 3V3XA 4W9LA 3VRAB 5HG2A 4F7ZA 1SE2A 4NNJB 1BXTA 2WDRB 2HDEA 2Q5WD 4AOFA 2CS4A 3QARA 4H2AA 2LJIA 3WAMA 3CF6E 3GS2A 3H7PA 3BY4B 3ECIA 3ZQ4A 2Z59B 1V5OA 3RNGC 3RUIB 2LGYA 4M0WB 1QOAA 2IGDA 2J52A 5L95C 2DZKA 2DZMA 2CJOA 2DHZA 1WJ6A 2QILA 3AN1A 2B76B 2N7EA 2DZIA 4C4VA 3L17A 3WCQA 3KLSX 4NAWB 2GRIA 3QHTA 4LLGM 1K52A 3EHVA 5EE0A 2J53A 4LCDE 3PREA 1ZGUB 5BMIA 4ZYSA 2X8XX 3AMZA 1VZ7A 5JHAA 2MSED 4EEWA 3DCGA 1N5WA 2PPHA 2LFIA 1JWSD 1ZW7A 1QOBA 1ENFA 1AN8A 2E6XA 2NPTA 4YXDB 2LI5A 3TJPA 4MGYE 5JH5C 2L52A 1WJUA 1WYGA 1YNTE 3BWUD 5H92C 2M8SA 2OJRA 2HJ1A 3W9CB 2M17A 3Q8FA 2AX5A 3PO0A 1KM7A 4DQOC 4P7IA 3LXFA 4HCPB 3B2FA 4HKZE 4XWWA 4JWSC 1I4RA 4HVBA 2KOXA 3VXWA 2WXMA 4K7UA 1KLGD 3V60A 2QCZA 4IOIE 1FMAD 3ZRCA 3ALBA 3UINB 4YTPB 4RGMA 2LHDA 1FRRA 4WQOB 5C23A 2KVRA 3PLVA 2BKRB 2KT7A 2KWVB 5BMGA 2JWUA 4J3OD 1FXIA 2MJ3A 1JMLA 3Q69A 1JWMD 4ZOHC 1YN4A 1EF5A 2LRWA 1TZOA 3Q3OC 4URKA 4DWFA 3EC8A 5FR3A 1ZPSA 4BOSC 1WXMA 3BVMA 2O2VA 2KQ7A 2DX5B 3O13A 1E7UA 1MPEA 2O6VD 1QLBB 2PTLA 2KDEB 2M56B 2H89B 3V6CB 1ZOYB 3ML8A 4ANWA 1F0ZA 2K1FA 4NJ7A 1RM6C 1GB1A 1T3QA 1WZ0A 1L0XB 1XLOA 2HJ8A 1YQ3B 2BQQA 2BB6A 4FHKA 1QF6A 2JYTA 2KN5A 2N9XA 2WXPA 4BBNF 2NBUA 3Q6BA 4B0MA 4ICVA 3QAQA 4L23A 1P0RA 2CJNA 5D2MB 2K39A 3L16A 5T8IA 3VTVA 1T0SC 3PS6A 1JQ4A 4OZCA 2D5GA 2MRPA 3AEGB 1CZPA 1TS5A 1FNUA 4JWUC 1WGDA 2KTRA 4WQMA 5CHFA 1YQ4B 2B3AA 3KYDD 2KC1A 3IAS1 4MH8A 2QIEB 4W9GA 3KVFB 2I1JA 3TEYA 4BVUC 4TSSA 4RGNA 1GJZA 2OJWA 3I9V1 3GE3C 3VUXA 1YN5A 3H1UA 1SE9A 1VJKA 3B9JA 2KQ4X 2INNE 3DBRI 3R7RA 4KX6B 2PIAA 1N6ZA 2XBBC 3TIXA 2LGDA 1B1ZA 2WXJA 1MHHE 1YMHE 3AM9A 3TMPB 1LXDA 3NVZA 4M0WA 5DPTA 3VHTC 1S3SG 4KGTA 2WU2B 3OWEB 2IDYA 2RR9A 4IWPA 2FE8A 3A1QB 2WXQA 1XT9B 2ON8A 2K3UA 1VLBA 1ZDXA 2D3CA 4NAWA 4TKNA 2J0KA 3MC9A 3AV8A 1KF6B 1V5TA 1RFAA 2FBWB 4FBJB 1YN3A 3IAM1 1WF9A 1Y8RC 4N59A 4W9EA 2EKEC 2WLBA 2W3SA 3QC8B 2GOWA 5CTRC 4E3CA 3CIRB 4DDID 4K3CA 3P4PB 2D2QA 2MH7A 2EMSA 2C7MB 3X0WA 2LGIA 1HZ6A 4HLEA 1WE6A 3BZDB 1FO4A 3NG0A 4NPNA 3B08A 3N1ZC 2CU1A 4PS7A 1I35A 1J7CA 4IW0A 2IGGA 2KDMA 4HK2A 1GG3A 3NRZA 2CKHB 4B9KA 3H9DA 5L83A 3NUHB 2Y5PA 3AEBB 4WJOA 1ZUD2 2CHZA 4RGOS 3ZXVA 3ZNID 3ZGZA 3HIZA 1FEHA 1C4CA 4RM9A 1IPGA 2WGSA 2LWPA 1NBFC 1N63A 5E6OA 4WWPA 1E0ZA 1KLUD 4WAAA 4JIOU 3J9CA 3PZ7A 5HFYA 3N1XC 2GBMA 3APDA 4R3DA 1RWSA 3H8HA 4LNKA 3AU4A 3PHWB 4ACFA 2WP9B
chains in the Genus database with same CATH topology
4GLSC 3TEZA 2QSDA 1DOXA 1DGJA 1I7HA 1SXTA 3ABVB 1WWTA 4LTUA 2ACZB 3KWLA 2WNMA 1PGXA 1V8CA 2E3TA 3FC4A 1IUEA 1I4HA 1FD6A 2WXFA 3BK1A 4MACA 1XLPA 5G5HA 3NVVA 1NI3A 2BT6A 3TUOA 1E10A 4YSXB 1JROA 4A8XC 4HRSA 3AH7A 1QQRA 1C77A 1SF0A 2WXOA 4YTMB 1E9MA 1JW9D 3EUB2 1TS4A 2PMVA 3BVGA 1FM0D 3AEFB 3ZJTA 4FXCA 2JSVX 1ZXHA 1ZXIA 2RDHA 2H88B 4YT0B 1L5PA 1XF5L 1ET6A 3AE8B 4RFBA 2PLPA 3ZYYX 1SJED 1KFYB 1WSPA 2RPVA 3FAHA 5MPOA 1NEKB 4HROA 4ZHOA 2WU5B 4RF0A 4N58A 2WXGA 2WXNA 1CQVA 3NZ3A 4ARIA 3U2SC 5EE9A 4Q2JA 2JU6X 1VDVA 4OHJA 2QEJC 1AWDA 1GB4A 4ZRQA 2LEKA 3EA6A 3URYA 3V3XA 3HVZA 3VRAB 1I4PA 2WDQB 5HG2A 1SE2A 1VZ8A 1DOYA 1FRDA 1BXTA 2N9LA 2WDRB 1N61A 1FXAA 2HDEA 3VRBB 4C80A 1IBXB 2Q5WD 2W82A 3AEDB 1SBBB 2SAKA 1EU4A 1SB3C 4MM3B 2YEPB 4NZLB 3U7ZA 3P4RB 1ZDVA 4H2AA 5D3IB 2LJIA 1SIJA 4NAMA 3RPFC 3KQ4A 4AQ7A 1XEEA 2PVOD 3GS2A 2V3PA 1FFVA 2K22A 4A90A 4A9AA 5BMHA 2WS3B 3ZQ4A 1MI0A 3VQIA 1EM7A 3ZJUA 1KH0A 2DBYA 3P1MA 1QOAA 3FILA 3NVWA 2IGDA 5EE1A 1QOGA 1FIQA 1RYJA 1YJIA 2VZKD 1WXQA 3IT6B 4OZBA 2J52A 2BBCA 1VRAB 2BS4B 3P4SB 2CJOA 2Y3AA 3BK2A 2DYOA 1TS2A 3AE3B 1VZ6A 1QILA 1Y56A 2QILA 1WRIA 3AN1A 1UGJA 2B76B 2MJEA 3U52E 2JZPA 1XCTL 3WCQA 3KLSX 4NAWB 2GRIA 4WURA 1XLNA 2LHEA 4LLGM 1K52A 1C79A 5D3DA 3AE5B 5EE0A 1D5XC 2J53A 1P7EA 4LK0M 3AEAB 2Z8LA 4EE2A 1UUPA 5BMIA 2AQ1B 1SE3A 5AUKA 4L2YA 1STEA 4ZYSA 1BUIC 3AMZA 5BYRA 1VZ7A 1FNVA 3SR6A 2ICIA 1I4QA 2WDVB 3AE2B 5LNK1 1N5WA 1L6VA 1P7FA 2LFIA 5H8YE 1JWSD 1QOBA 5HI1A 2LMCA 1ENFA 1AN8A 2E6XA 4TQ1A 4YXDB 2WXLA 2L52A 3LB8C 2J42A 1WYGA 1VR9A 5FK9C 1YNTE 3BWUD 5H92C 2K5PA 4US8A 1KTKA 3LYYA 1D6EC 1UNSA 2WP9B 2AQ2B 4HKQA 1FNWA 1DYQA 1TKEA 1XLQA 1V97A 3W9CB 1C4PA 1TKYA 3DWGC 1SJHD 4JPSA 3Q8FA 4C7ZA 2AX5A 3PO0A 1UWMA 4DQOC 4WAFA 3LXFA 3B2FA 3EGRA 4HKZE 4XWWA 2L83A 1L0VB 2Y5CA 4JWSC 2RDGA 2R61A 2K9XA 1I4RA 3N9YC 4REZA 2G1EA 5AUIA 1HZ5A 2NMQA 2WXMA 3E9SA 5HHDG 1HA5A 1KLGD 1FFUA 4UDUC 4IOIE 3DWMA 2SEBD 1FMAD 1EWCA 1Q10A 1BMLC 3GP7A 4P16A 3SEBA 2GB1A 4PT5A 1C78A 3HUIA 3MHZA 4YTPB 1N5XA 4RGMA 4RCOA 2LHDA 1FRRA 2BW2A 2QMTA 3KWVA 3MFGA 1ESFA 2V0GA 1NENB 3BYTB 5BMGA 1K53A 2JWUA 2MJDA 4RH6A 1PGBA 3BYYB 4J3OD 1FXIA 2MJ3A 3W2DA 1JMLA 3Q8AA 3Q69A 1JWMD 4ZOHC 1CK1A 1YN4A 5BYQA 5D7GA 1TZOA 2PW9A 1V1PA 1PFDA 5C3JB 3AECB 4ZHPA 1OQRA 1F2RI 2I38A 2W54A 5FR3A 4KKIA 1ZPSA 4IKGA 3BVMA 3IT4B 2N0SB 1F77A 1NVID 1IGCA 3W5UB 3BIID 3HVDA 1GPXA 4ZRPA 1QT9A 3Q8EA 1OFFA 3O13A 1MPEA 1QLBB 2PTLA 3UI3A 2M56B 2H89B 1ZOYB 4WIPA 4YSZB 1K50A 2NTSA 1PUTA 5G5GA 4DXGA 1F0ZA 1RM6C 2IPKD 1WGKA 1GB1A 1T3QA 3W1SA 1L0XB 1XLOA 2FUG1 1CJEA 3RFZB 4WH4A 3CWIA 3R2TA 1YQ3B 1E6EB 5I4DA 2BB5A 3AE6B 2BB6A 2L32A 1QF6A 1L4ZB 2JYTA 2INPE 2I2YA 2WXIA 4RF1A 1SSNA 1HQRD 1E7PB 3SFEB 4DXFA 3W5VB 1AYFA 1HEZE 2IJ0A 2WXPA 3AE1B 1T5XD 1TYGB 1K51A 2XN9C 4B0MA 3VR8B 3HRDD 1L0YB 1I4XA 4L23A 4C56C 2CJNA 3ETRA 2OHFA 2M19A 3TEWA 2DYMA 5T8IA 2WQYB 4JX1C 2PKOA 2PVGC 1ROEA 1JQ4A 4OZCA 2D5GA 2WXRA 3NVYA 1MHXA 3AEGB 1CZPA 1JWBD 1J7AA 1TS5A 1FNUA 4JWUC 2EELA 2BTEA 4WQMA 1I4GA 1YQ4B 1TKGA 3IAS1 1HXYD 4XE0A 2NTTA 4MH8A 2QIEB 4OVZA 1NYQA 3R2IA 5GXGB 4YWGG 4ARCA 4B0EA 4WWMA 1SE4A 1JWAD 3B2GA 3Q8CA 3TEYA 1JWUD 3T3OA 1PDXA 1DOIA 4RGNA 4TSSA 3I9V1 1YN5A 1VJKA 3B9JA 3T3NA 2JYEA 2KWDA 2KQ4X 2INNE 4HJGE 3P4QB 4IDIA 1SEBD 2ZW0A 1KRHA 1IBXA 4KX6B 2PIAA 4AS1A 1C4AA 2JXTA 1YJJA 1GAQB 3NS1A 1NYRA 1XO3A 3P63A 1B1ZA 1V1OA 3FILB 1GOZA 2WXJA 2X38A 1MHHE 1RFKA 1YMHE 3AM9A 4XDCA 3NVZA 4M0WA 2JQRB 2V3NA 1QOFA 1ET9A 1M4VA 4XDDA 1ZE3D 3AE7B 2JX5A 2N9KA 1B9RA 4D2KA 4KGTA 2WU2B 3OWEB 1XCQL 2IDYA 2M0AA 2OEDA 1FCLA 2FE8A 2WXQA 4RGTA 4A55A 2QJLA 2ON8A 4A6QA 1EU3A 2K3UA 1VLBA 1J7BA 4C7YA 1ZDXA 4GDKB 2BYTA 1D4BA 3Q8BA 4ITKA 4KGSA 4KGRA 2V4IB 1UWXA 3AV8A 3V05A 4KKJA 1IGDA 1KF6B 2G9HD 5E6JA 2CU3A 1N62A 2W3RA 2K0PA 4MT5A 3P42A 1PGAA 2AQ3B 2DWQA 2FBWB 2BS3B 3MC0B 3TSSA 1YN3A 3IAM1 3L4PA 2WXKA 2WXHA 4N59A 3GB1A 2WLBA 2YEPF 2W3SA 1F2RC 4TQ0A 1TY2A 3TEXA 2LUMA 5BYSA 2MEKA 1LO5D 1ZP0B 4O1NA 3CIRB 2ONQA 1T6BX 2HTME 2BS2B 3P4PB 2RMMA 1FCCC 2MH7A 1N60A 1XXGA 2VZKB 2LGIA 1HZ6A 3C8YA 4GDLB 4YSYB 3AE4B 3BZDB 4NJCA 1FO4A 1L6UA 2DLBA 1C76A 1J7CA 1JCKB 5C2TB 4CQNA 5TSSA 2IGGA 4P6VF 2KDMA 3R8BA 3NRZA 3AEEB 1OQQA 2GI9A 3VR9B 1AW7A 2L1AA 2EKIA 2Y5PA 3AEBB 3NUHB 3PZ8A 5EE3A 1ZUD2 4US9A 4RGOS 4JE3B 4OZAA 4RNAA 1C9FA 3ZGZA 4XWTA 1L4DB 1TY0A 3E56A 1FEHA 2ZW1A 1C4CA 3AE9B 2KN4A 4L1BA 2J4XA 2KAJA 5FKAC 4HEA1 3MP9A 3IXSA 2KACA 2TSSA 1TS3A 2W55A 2IGHA 1JALA 1N63A 1QKZA 2XNAC 5JXVA 4USAA 1E0ZA 1ACCA 1KLUD 1V1PB 1R7SA 3AB5A 3J9CA 4OW0A 1A70A 1EWYC 3MJ5A 1D5ZC 1MVKA 3PZ7A 5HFYA 4R3DA 2N7JA 1RWSA 3H8HA 3BVZA 1D5MC 4N6EB 3I57A 3U4EG 4YTNB 3ZJVA 1TJEA 2KMMA 1JRPA 1PYWD 4TMAB 3SFDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GLS C;  4D2K A;  4KGT A;  2QSD A;  1MPE A;  1XCQ L;  2OED A;  2JZP A;  2PTL A;  3UI3 A;  1XCT L;  1FCL A;  2LHE A;  1K52 A;  2ON8 A;  1D4B A;  1K50 A;  1PGX A;  2J53 A;  4KGS A;  4KGR A;  1P7E A;  1GB1 A;  1UWX A;  5BMI A;  1IGD A;  1FD6 A;  4MAC A;  4WH4 A;  2K0P A;  1PGA A;  2I2Y A;  3GB1 A;  1P7F A;  1F2R C;  1HEZ E;  5HI1 A;  2LUM A;  1K51 A;  2ONQ A;  2JSV X;  1ZXH A;  1FCC C;  2RMM A;  1YNT E;  2LGI A;  1HZ6 A;  4OZC A;  1XF5 L;  1MHX A;  2PLP A;  2RPV A;  2EEL A;  4HKZ E;  2IGG A;  2KDM A;  2JU6 X;  1HZ5 A;  2GI9 A;  1GB4 A;  2NMQ A;  5HHD G;  4OZA A;  4IOI E;  3V3X A;  1C9F A;  5HG2 A;  1Q10 A;  2ZW1 A;  2KN4 A;  2N9L A;  4HJG E;  2KWD A;  2GB1 A;  2KQ4 X;  1IBX B;  2ZW0 A;  2LHD A;  3MP9 A;  2QMT A;  1IBX A;  2KAC A;  2IGH A;  2JXT A;  1QKZ A;  5JXV A;  5BMG A;  1K53 A;  2JWU A;  5BMH A;  1MI0 A;  1PGB A;  1EM7 A;  3FIL B;  1JML A;  1KH0 A;  1MHH E;  1YMH E;  2PW9 A;  1MVK A;  5HFY A;  3FIL A;  2IGD A;  4OZB A;  2N7J A;  1F2R I;  2I38 A;  2J52 A;  4IKG A;  1IGC A;  2N9K A; 
#chains in the Genus database with same CATH topology
 1SXT A;  4LTU A;  1WWT A;  4MM3 A;  4MEM A;  3VFK A;  1PGX A;  4FA6 A;  2E3T A;  5AZH A;  1L2N A;  3K9O B;  3FC4 A;  1I4H A;  4MSM B;  1FD6 A;  3VTU A;  3UIO B;  3W1Y A;  3NVV A;  2WYQ A;  1TIF A;  2JY6 A;  5DPR A;  1WR1 A;  1LGR A;  1C77 A;  4ZDV A;  4YTM B;  1E9M A;  1WE7 A;  1JW9 D;  3KUZ A;  4LJP B;  1WFY A;  2FCS A;  4AP4 C;  4FXC A;  2A4Z A;  2BYF A;  2MCN B;  1XF5 L;  4G0N B;  4A3O A;  3NS8 A;  2AL3 A;  3R7Q A;  1SJE D;  3A33 B;  3FAH A;  5J17 A;  2I1K A;  3APF A;  2WXG A;  2YVC A;  2WXN A;  3V62 A;  3JW0 X;  4I6P A;  4ARI A;  2RD0 A;  1Q5W B;  2DNF A;  2JU6 X;  1F52 A;  1VCB A;  1AWD A;  4E71 A;  1R4M I;  4ZRQ A;  2LEK A;  3URY A;  4LNN A;  4DDG D;  1DOY A;  1FRD A;  1N61 A;  4DK5 A;  1IBX B;  2BYE A;  2W82 A;  1SB3 C;  4NZL B;  2LXA A;  4GOC A;  3P4R B;  1V49 A;  1SIJ A;  4XX5 A;  4W9D A;  1XEE A;  2PVO D;  2V3P A;  2K22 A;  4A90 A;  5BMH A;  3VQI A;  3ZJU A;  4PYZ A;  3WAN A;  2DBY A;  3Q3N C;  3A9J B;  2JF5 A;  1I42 A;  2LRU A;  1FIQ A;  1RYJ A;  1YJI A;  1E8W A;  2BBC A;  2V1Y A;  1OQY A;  2BS4 B;  2VH1 A;  2ZVN A;  2DYO A;  1TS2 A;  3AE3 B;  1VZ6 A;  3EEC A;  1QIL A;  1Y56 A;  1UGJ A;  3PZD A;  3JVZ X;  2LGX A;  4WUR A;  3PRM B;  4ZRK A;  3QQ8 B;  1C79 A;  3AE5 B;  4WJN A;  3A1Q A;  4X57 B;  5CHV C;  1P7E A;  4LK0 M;  3KUC B;  1SE3 A;  2J0J A;  4L2Y A;  2K8B A;  2L0F A;  3CMM B;  1I4Q A;  3AE2 B;  3APC A;  1IP9 A;  2FNJ B;  3RZW C;  3QJZ A;  3TL5 A;  1S1Q B;  3L10 B;  2LMC A;  3ZNG C;  2ZNV B;  2L05 A;  3DHI C;  5FK9 C;  2IYD B;  3OJ4 B;  4KV2 A;  4M00 A;  3QWZ B;  2EMT A;  1P9D U;  4LJO B;  2WX0 A;  1V86 A;  4HKQ A;  1FNW A;  1TKE A;  2C60 A;  4C7Z A;  2W9N A;  1UWM A;  4WAF A;  3TBL D;  4G11 A;  1V6E A;  3DDC B;  2G45 B;  1HE8 A;  3ENE A;  2KFK B;  1HA5 A;  4UDU C;  2MBE A;  2MWS B;  4IC7 B;  1EWC A;  1SGH A;  4AJY B;  1BML C;  2VH2 A;  1UGM A;  3SHQ A;  3A4S C;  2LVQ A;  2QDF A;  2HTH A;  1ESF A;  3MFG A;  2RGF A;  2V0G A;  3BYT B;  3OG5 A;  1K53 A;  1YJ1 A;  4RH6 A;  3QCA A;  3BYY B;  3W2D A;  3ZW3 A;  3Q8A A;  5D7G A;  2XEW A;  3RYT A;  2W54 A;  3IT4 B;  4EFO A;  4M02 A;  3Q8E A;  4FUL A;  1R4N I;  4G3X B;  1H4R A;  3V6E B;  2BYV E;  2IO3 B;  4DXG A;  2FUH B;  2G3Q B;  3LJ3 A;  1WGK A;  1SIF A;  2WWZ A;  2K8C A;  1T0Q C;  4A20 A;  3RFZ B;  1OTR B;  2KWC A;  5I4D A;  2L32 A;  1L4Z B;  2MP2 B;  2I2Y A;  4RF1 A;  1HEZ E;  2IJ0 A;  3AE1 B;  4K81 A;  1QZE A;  1K51 A;  3VR8 B;  3OAW A;  1I4X A;  4I6L B;  5FR6 A;  5E6N A;  3TEW A;  2HD5 B;  1ZKH A;  2WXR A;  1J7A A;  4WJP A;  2IND C;  2BTE A;  1HXY D;  1WXA A;  1MG4 A;  5GXG B;  3QX1 A;  3NJT A;  4YWG G;  4B0E A;  4WWM A;  3B2G A;  3Q8C A;  4KSL C;  3ZO5 B;  1WMH B;  2BKF A;  2KWD A;  3P4Q B;  4W9H A;  1SEB D;  1YOV B;  4GDL A;  3L54 A;  3DBH B;  1IBX A;  1YQB A;  4M8M A;  1KJT A;  1GAQ B;  1XO3 A;  1GOZ A;  4KDL B;  1RFK A;  1UBI A;  4F8C B;  5JZE B;  2JQR B;  2V3N A;  1ET9 A;  3A9J A;  2N4F A;  1B9R A;  1EUV B;  4AWJ A;  1F9J A;  3EFC A;  1XCQ L;  1NDD A;  2OED A;  1FCL A;  2UWQ A;  4A55 A;  1J7B A;  4GDK B;  3KW5 B;  5IA7 A;  3AU5 A;  4ITK A;  4P1C C;  2V4I B;  4HJK A;  1IGD A;  2G9H D;  2CU3 A;  1MG8 A;  5HKH A;  2AQ3 B;  4IM3 A;  3ZDT A;  3TSS A;  5BO4 B;  2YEP F;  3Q3J A;  3S2A A;  4FHJ A;  2LUM A;  4MEL A;  4O1N A;  1LO5 D;  3ZTC A;  4TUU A;  3PTF C;  4K3B A;  3GOE A;  2HTM E;  2MBQ A;  4EZK A;  1FCC C;  2INC C;  2Z0E B;  4BFR A;  1A5R A;  2IZV B;  4P1B C;  4YSY B;  3ZRF A;  2ZCB A;  3AE4 B;  1WY8 A;  4NJC A;  2MBO A;  1YX6 B;  3X23 A;  1C76 A;  1JCK B;  5C2T B;  2J7Q B;  4P6V F;  3Q3M C;  1OQQ A;  2L1A A;  4RNA A;  2KDI A;  2LGS A;  2AWT A;  2KFK A;  1WXV A;  2ZW1 A;  2KN4 A;  3WIM A;  2Z0D B;  5FKA C;  4F1S A;  4G50 A;  2KAC A;  1TS3 A;  4MH0 E;  3DVN U;  4KZC A;  1E5W A;  1QKZ A;  1P3Q U;  4ZYN A;  1V1P B;  1R7S A;  3AB5 A;  1V9J A;  4OW0 A;  2NCN A;  1D5Z C;  3A9K A;  2N7J A;  2C7H A;  3U4E G;  3BVZ A;  4N6E B;  3I57 A;  4YTN B;  1TJE A;  2DAF A;  2KMM A;  1PYW D;  5IAA C;  5IOI A;  2L3Z A;  4N9F 4;  2ASQ A;  3WAO A;  2WNM A;  1EF1 A;  2R2O A;  4LNF A;  3Q3F A;  3BK1 A;  2LAS A;  4OVU A;  1NI3 A;  3NZS A;  2IO1 B;  5DPS A;  1E10 A;  4B6W A;  4YSX B;  4A8X C;  2MP2 A;  3QIJ A;  1QQR A;  2MQJ A;  4CHK A;  3L13 A;  3EUB 2;  1TS4 A;  1FM0 D;  4EUT A;  3VH4 B;  2JSV X;  3O65 B;  4BKS A;  3PLU A;  3PRP B;  1E7V A;  1TZ1 A;  3T8M A;  4DHZ B;  4M01 A;  4YL8 A;  3UQB A;  1ET6 A;  3AE8 B;  3KYC D;  1E8Y A;  3IBE A;  4RFB A;  2PLP A;  1WSP A;  2NVU I;  2RPV A;  5MPO A;  3SDL C;  2L76 A;  2O6V B;  4ZHO A;  2WU5 B;  3DBL B;  4JL9 A;  3NZ3 A;  4QAY A;  5EE9 A;  3Q14 C;  1VDV A;  3WAP A;  2QEJ C;  1GB4 A;  1WGR A;  4KVG B;  2KX0 A;  4W9I A;  3HVZ A;  2WDQ B;  1BT0 A;  3AED B;  1SBB B;  1WMH A;  2SAK A;  2YEP B;  2A5U A;  3RPF C;  4NAM A;  4AQ7 A;  3Q2A C;  2V9H A;  1FFV A;  3GZN B;  1MI0 A;  1NI2 A;  1WIA A;  3MTN B;  2MW5 A;  5E6P A;  2K8H A;  3P1M A;  4RM8 A;  3NVW A;  2VZK D;  3IT6 B;  1WXQ A;  4OZB A;  4PYU A;  3UQA A;  1T0R C;  1VRA B;  1WM3 A;  1L7Y A;  3P4S B;  3LDZ E;  3BK2 A;  4DHZ E;  3U52 E;  2JZP A;  3L08 A;  2ZPY A;  4HWI B;  4NQK E;  5D3D A;  4NJ6 A;  3AEA B;  2Z8L A;  4EE2 A;  1Z5S B;  4GDK A;  2AQ1 B;  4IG7 B;  1BUI C;  5BYR A;  1FNV A;  3SR6 A;  2ICI A;  1CMX B;  3U30 A;  5LNK 1;  1P7F A;  1RRB A;  3I63 C;  3L0W B;  5H8Y E;  1GUA B;  4BBN C;  4FJY A;  1FPY A;  1XQQ A;  3DBR B;  3ONS A;  3RI7 C;  4TQ1 A;  1T0Y A;  2WXL A;  3LB8 C;  3C19 A;  1VR9 A;  1V81 A;  1VD2 A;  1UNS A;  2AQ2 B;  1WYW B;  1G6J A;  1DYQ A;  1XLQ A;  1V97 A;  1D3Z A;  1C4P A;  2KC2 A;  3DWG C;  1SJH D;  2L0T A;  4GU2 A;  2L83 A;  2Y5C A;  2MBB B;  3NZU A;  4JGH B;  2RDG A;  2R61 A;  2K9X A;  2KVZ A;  3RNF C;  2G1E A;  2KX3 A;  4GXB A;  1UZX B;  2IO2 B;  2NMQ A;  5HHD G;  4LNO A;  1FFU A;  1WH3 A;  2K6Q A;  1M94 A;  2UYZ B;  1Q10 A;  3GP7 A;  4P16 A;  3SEB A;  2GB1 A;  2L8J A;  4PT5 A;  1C78 A;  4RCO A;  5D6J B;  2JZ3 B;  4W9J A;  3ZIM A;  3KWV A;  2BWE S;  3PV1 A;  2JPH A;  1NEN B;  1PGB A;  1CK1 A;  1V1P A;  1PFD A;  3U7D A;  5C3J B;  4ZHP A;  1OQR A;  4IM0 A;  4KKI A;  2GMI C;  4IKG A;  3W5U B;  3BII D;  3HVD A;  1GPX A;  1J0G A;  4WJQ A;  4JLC A;  3UI3 A;  1OGW A;  4YSZ B;  1K50 A;  2JUO A;  2PE9 A;  3W1S A;  2BB5 A;  4IWO A;  5LXH A;  2WXI A;  1E7P B;  3SFE B;  4DXF A;  1C1Y B;  1T5X D;  2YLM A;  2XN9 C;  2JRH A;  3HRD D;  1L0Y B;  3IVF A;  1V80 A;  3ETR A;  1UD7 A;  2M19 A;  2DYM A;  4JX1 C;  2PVG C;  3NVY A;  3WA0 A;  1AAR A;  1JWB D;  4PK1 A;  2JXX A;  1I4G A;  3BIN A;  3H7S A;  4NY0 A;  1TKG A;  2O6V A;  4OVZ A;  1NYQ A;  2JRI B;  3B1L X;  3R2I A;  1SE4 A;  1JWA D;  4FAD A;  1FXT B;  1JWU D;  3T3O A;  1PDX A;  1UEL A;  3ZDM C;  3ZXR A;  4ANU A;  3T3N A;  2JYE A;  4HJG E;  2UU7 A;  2ZW0 A;  1K8R B;  3HM3 A;  2K6D B;  3GE8 C;  1P98 A;  1C4A A;  2JXT A;  4ICU A;  3NS1 A;  1NYR A;  3P63 A;  4XC2 A;  1V1O A;  3FIL B;  2X38 A;  1Z2M A;  2C7N B;  3CSF A;  2N1V A;  1ZE3 D;  2KLC A;  1HTO A;  3RT3 B;  2FCN A;  3PGE A;  4RGT A;  1D4B A;  1EU3 A;  4C7Y A;  1WRD B;  2BYT A;  3Q8B A;  2GBJ A;  1YIW A;  1WGG A;  3PT2 B;  1UWX A;  3V05 A;  4KKJ A;  3ZNZ B;  1IYF A;  5E6J A;  1KOT A;  2KTR B;  3MC0 B;  2C5L C;  3NHE B;  3MC8 A;  1UH6 A;  2WXH A;  5AZF A;  4FN2 A;  5D94 A;  3JYU A;  1Q0W B;  2KTF A;  5BYS A;  2MEK A;  4LNI A;  1WJN A;  3PRZ A;  1TBE A;  5G55 A;  3VAW A;  2RMM A;  5LLI A;  3ZUN A;  1XXG A;  2KMA A;  3AXC A;  4E74 A;  4BAX A;  4NQL B;  1L6U A;  3N1Y C;  4IM2 A;  4GGQ A;  5TSS A;  2NBW B;  3SD5 A;  2ZCC A;  2K25 A;  2WDT B;  3OLM D;  3R8B A;  2ZEQ A;  2RSU A;  2GI9 A;  1AW7 A;  2ZVO A;  3PZ8 A;  1WM2 A;  3OJ3 A;  2KMC A;  1XD3 B;  4OZA A;  1WGH A;  1L4D B;  1TY0 A;  4JQW C;  3AE9 B;  3R66 C;  2J4X A;  4HEA 1;  3IXS A;  1MFW A;  2KJ6 A;  3IHP C;  2JT4 B;  2W55 A;  1JAL A;  4FLH A;  3DPD A;  2KJH B;  4USA A;  2D07 B;  2VRR B;  1J8C A;  1OEY J;  1EWY C;  3MJ5 A;  3DVN V;  1MVK A;  1TTN A;  1D5M C;  3ZJV A;  1TGZ B;  4ANV A;  1JRP A;  2AL6 A;  4PS3 A;  4GLS C;  3TEZ A;  2QSD A;  3ABV B;  3PPA A;  4HDO A;  3HK0 A;  2ACZ B;  2LZ6 A;  3P2B A;  3N32 A;  4DXA B;  2ZZP B;  4ZRJ A;  1V2Y A;  4M8N A;  2WXF A;  4MAC A;  1XLP A;  2BT6 A;  2V4L A;  4HRS A;  3QA8 A;  3AH7 A;  1SF0 A;  2WXO A;  4IWQ A;  3CST A;  2D3G A;  2L7R A;  3BVG A;  3AEF B;  2FCM A;  3AUL A;  4I6N B;  4B95 A;  2NS5 A;  3HHM A;  1ZXI A;  5AZG A;  3MJW A;  2M0X A;  2DEN B;  4YT0 B;  1L5P A;  2G4S A;  3QK0 A;  1Q1O A;  3ZNH B;  4TV3 A;  3ZYY X;  5EDS A;  1HTQ A;  1KFY B;  2IO0 B;  3M62 B;  3DHG C;  4HRO A;  4N58 A;  2FAZ A;  2OOB B;  1CQV A;  2D10 A;  1YD8 U;  3IG3 A;  4OHJ A;  2KKC A;  3EA6 A;  1R4N B;  1I4P A;  3UIP B;  1VZ8 A;  3DBL I;  4KIK B;  2N9L A;  1WX9 A;  1FXA A;  3VRB B;  4C80 A;  4ZRI A;  1EU4 A;  4MM3 B;  3UGB B;  3U7Z A;  4MGK E;  2GBR A;  1ZDV A;  5D3I B;  3ML9 A;  3VUW A;  3KQ4 A;  5G2N A;  4W9K A;  3DHH C;  4A9A A;  4KZ0 A;  5IP4 D;  2WS3 B;  2Y5B B;  3VVW B;  1EM7 A;  3AI5 A;  2PJH A;  1OEY A;  2R2Q A;  1KH0 A;  3FIL A;  1H8C A;  5EE1 A;  1QOG A;  2D11 A;  4RMA A;  4EKU A;  4AUQ C;  2N7D A;  2Y3A A;  3GZN I;  1WRI A;  2MJE A;  4J6I A;  1F1H A;  4FJZ A;  1XCT L;  3VH3 B;  1XLN A;  2KYW A;  2LHE A;  2LJ5 A;  4FJV B;  4AJW A;  1D5X C;  5C1Z A;  1UUP A;  5AUK A;  1STE A;  5CX3 A;  2V3S A;  2WDV B;  2BWF A;  5KHO A;  2KNB A;  1L6V A;  4GIV A;  3DBS A;  5HI1 A;  3RNE C;  3PSE B;  4MJS B;  3RNB C;  2KLG A;  2J42 A;  2J0M A;  1PQS A;  2K5P A;  4US8 A;  3NOB A;  1WI0 A;  1KTK A;  3LYY A;  4GB9 A;  1D6E C;  1YX5 B;  3RD2 A;  1KLV A;  2REX A;  3M95 A;  1E8X A;  5GMV A;  1TKY A;  2PEA A;  4JPS A;  1J19 A;  3EGR A;  4HDQ A;  1L0V B;  3RUL A;  5JHB A;  2XK5 B;  2KDB A;  3N9Y C;  4REZ A;  3VTW A;  5AUI A;  3W1S C;  1HZ5 A;  3E9S A;  2N9E B;  5KHQ A;  4A3P A;  4HXD A;  3DWM A;  2LVO A;  2SEB D;  4WWO A;  1WR6 E;  2JWZ A;  2BPS A;  3HUI A;  1GC6 A;  3MHZ A;  4KSK C;  1N5X A;  2BW2 A;  2QMT A;  3JSV B;  4DHJ D;  4K7S A;  3RN9 C;  1MJD A;  3D32 A;  2MJD A;  3A4R A;  5BYQ A;  2PW9 A;  3M3J A;  2N9P C;  3N20 C;  1GC7 A;  3AEC B;  1F2R I;  2I38 A;  2JVC A;  3V61 A;  2N0S B;  1F77 A;  1NVI D;  1IGC A;  2BF8 B;  3DVG X;  2GBN A;  3VUY A;  4ZRP A;  3UF8 A;  1QT9 A;  1E90 A;  1WX8 A;  1OFF A;  3N30 A;  3RNA C;  1U4A A;  1LM8 B;  4WIP A;  2NTS A;  1PUT A;  5G5G A;  2LVP A;  2IPK D;  4K1R B;  2MBH A;  4BOZ B;  3PVL A;  1EO6 A;  2FUG 1;  1CJE A;  2AEH A;  3RNC C;  4WH4 A;  3CWI A;  3R2T A;  1E6E B;  3AE6 B;  2N1W A;  2INP E;  1SSN A;  1HQR D;  4LDT D;  5IKC M;  3W5V B;  1AYF A;  4MDK E;  2LD9 A;  2D3B A;  1TYG B;  2L00 B;  4C56 C;  3U8Z A;  2BVC A;  2WX1 A;  5J18 A;  2OHF A;  3ZVV A;  4C00 A;  1X1M A;  2G4D B;  4IUM B;  2WQY B;  2FCQ A;  2PKO A;  1ROE A;  2KO3 A;  3ZTD A;  3K9P B;  2MA9 B;  1MHX A;  2JZZ A;  3NY5 A;  4MSQ B;  2QHO A;  2EEL A;  3I5J C;  2M1M A;  2IY0 B;  4XE0 A;  2NTT A;  3EFU A;  3TCA A;  5DPW A;  2MHJ A;  4ARC A;  4BZA A;  2IBI B;  4W9C A;  1DOI A;  2GLS A;  2AYO B;  4IDI A;  2LUE A;  4KIK A;  4ANX A;  1KRH A;  2M4N A;  3H7P B;  2LXC A;  4OVV A;  4W9F A;  3SU8 X;  2GBK A;  4AS1 A;  4S17 A;  1WZ3 A;  1YJJ A;  5TR5 A;  2CR5 A;  4XGA B;  2DYB A;  2KK8 A;  3IFW B;  2KD0 A;  2FID A;  2ZPN A;  1JRU A;  4XDC A;  4WWN A;  5LXI B;  1QOF A;  1M4V A;  2WHI A;  1WGY A;  4XDD A;  4XZ4 A;  3AE7 B;  4C4V B;  2JX5 A;  2N9K A;  1WXS A;  4DHJ B;  4D2K A;  2KWU B;  3I3T B;  2M0A A;  5IO9 A;  4MGZ E;  2KXJ A;  2QJL A;  4A6Q A;  1ISN A;  3RZF A;  4EZL A;  4KGS A;  4KGR A;  2PE6 B;  2NR2 A;  1N62 A;  1UF0 A;  2W3R A;  2K0P A;  4MT5 A;  3P42 A;  3ZLZ A;  1PGA A;  2DWQ A;  2BS3 B;  3L4P A;  2WXK A;  4XYC A;  4S0R A;  2KDF B;  3HM6 X;  3GB1 A;  2NBV B;  1UBQ A;  1F2R C;  4TQ0 A;  2KFJ A;  5IN7 A;  1TY2 A;  3TEX A;  2NPT B;  3PHX B;  1RLF A;  1ZP0 B;  2KHW B;  2KJR A;  2ONQ A;  1T6B X;  4MJS A;  2BS2 B;  1TT5 B;  3RCZ A;  1N60 A;  2VZK B;  4BKT A;  2FIF A;  4HPM B;  3DVG Y;  3C8Y A;  4GDL B;  1LFD A;  4II3 B;  4LDT B;  1E8Z A;  2DLB A;  4CQN A;  3N3K B;  2ZJD A;  3AEE B;  3VR9 B;  4EZJ A;  5J2R A;  2EKI A;  3DOW A;  4HPP A;  2XK5 A;  5EE3 A;  4US9 A;  2C9W B;  4K7W A;  4JE3 B;  1C9F A;  2IY1 B;  4XWT A;  3E56 A;  3H6N A;  4L1B A;  2KAJ A;  3MHS D;  3MP9 A;  2KAN A;  3M63 B;  2TSS A;  4PS8 A;  2IGH A;  2RDB C;  2XNA C;  5JXV A;  3JSV A;  1ACC A;  2DZJ A;  3B0A A;  4BKS D;  4GMV A;  3RMK C;  3R3M A;  1A70 A;  4HPL B;  2KZR A;  5DCN A;  2DAJ A;  3WAL A;  1WX7 A;  3FKY A;  2O2V B;  4GN1 A;  2MLB A;  2CHW A;  4TMA B;  3SFD B;  1DOX A;  3T9L A;  1DGJ A;  1I7H A;  2D3A A;  3KWL A;  2ZNV C;  1V8C A;  4KDI C;  4DBG A;  1IUE A;  4II2 B;  4CYE A;  5AEK B;  3DBH I;  5CHW A;  5G5H A;  2BGF A;  3TUO A;  3ZKJ C;  3KH0 A;  2RPQ A;  1JRO A;  1RAX A;  2MX2 A;  4ASW C;  2PMV A;  3ZJT A;  1WJ4 A;  2QC8 A;  4BKG A;  1ZXH A;  2RDH A;  2H88 B;  4MGI E;  3C0R B;  4EOY A;  1C3T A;  1R4M B;  1LQB A;  3DQV A;  4CO7 A;  2KQS A;  3VDZ A;  1P1A A;  4HCN B;  1NEK B;  3KUD B;  1GNU A;  4RF0 A;  3U2S C;  4Q2J A;  2CHX A;  4GSW A;  2HE7 A;  3A9K B;  3V3X A;  4W9L A;  3VRA B;  5HG2 A;  4F7Z A;  1SE2 A;  4NNJ B;  1BXT A;  2WDR B;  2HDE A;  2Q5W D;  4AOF A;  2CS4 A;  3QAR A;  4H2A A;  2LJI A;  3WAM A;  3CF6 E;  3GS2 A;  3H7P A;  3BY4 B;  3ECI A;  3ZQ4 A;  2Z59 B;  1V5O A;  3RNG C;  3RUI B;  2LGY A;  4M0W B;  1QOA A;  2IGD A;  2J52 A;  5L95 C;  2DZK A;  2DZM A;  2CJO A;  2DHZ A;  1WJ6 A;  2QIL A;  3AN1 A;  2B76 B;  2N7E A;  2DZI A;  4C4V A;  3L17 A;  3WCQ A;  3KLS X;  4NAW B;  2GRI A;  3QHT A;  4LLG M;  1K52 A;  3EHV A;  5EE0 A;  2J53 A;  4LCD E;  3PRE A;  1ZGU B;  5BMI A;  4ZYS A;  2X8X X;  3AMZ A;  1VZ7 A;  5JHA A;  2MSE D;  4EEW A;  3DCG A;  1N5W A;  2PPH A;  2LFI A;  1JWS D;  1ZW7 A;  1QOB A;  1ENF A;  1AN8 A;  2E6X A;  2NPT A;  4YXD B;  2LI5 A;  3TJP A;  4MGY E;  5JH5 C;  2L52 A;  1WJU A;  1WYG A;  1YNT E;  3BWU D;  5H92 C;  2M8S A;  2OJR A;  2HJ1 A;  3W9C B;  2M17 A;  3Q8F A;  2AX5 A;  3PO0 A;  1KM7 A;  4DQO C;  4P7I A;  3LXF A;  4HCP B;  3B2F A;  4HKZ E;  4XWW A;  4JWS C;  1I4R A;  4HVB A;  2KOX A;  3VXW A;  2WXM A;  4K7U A;  1KLG D;  3V60 A;  2QCZ A;  4IOI E;  1FMA D;  3ZRC A;  3ALB A;  3UIN B;  4YTP B;  4RGM A;  2LHD A;  1FRR A;  4WQO B;  5C23 A;  2KVR A;  3PLV A;  2BKR B;  2KT7 A;  2KWV B;  5BMG A;  2JWU A;  4J3O D;  1FXI A;  2MJ3 A;  1JML A;  3Q69 A;  1JWM D;  4ZOH C;  1YN4 A;  1EF5 A;  2LRW A;  1TZO A;  3Q3O C;  4URK A;  4DWF A;  3EC8 A;  5FR3 A;  1ZPS A;  4BOS C;  1WXM A;  3BVM A;  2O2V A;  2KQ7 A;  2DX5 B;  3O13 A;  1E7U A;  1MPE A;  2O6V D;  1QLB B;  2PTL A;  2KDE B;  2M56 B;  2H89 B;  3V6C B;  1ZOY B;  3ML8 A;  4ANW A;  1F0Z A;  2K1F A;  4NJ7 A;  1RM6 C;  1GB1 A;  1T3Q A;  1WZ0 A;  1L0X B;  1XLO A;  2HJ8 A;  1YQ3 B;  2BQQ A;  2BB6 A;  4FHK A;  1QF6 A;  2JYT A;  2KN5 A;  2N9X A;  2WXP A;  4BBN F;  2NBU A;  3Q6B A;  4B0M A;  4ICV A;  3QAQ A;  4L23 A;  1P0R A;  2CJN A;  5D2M B;  2K39 A;  3L16 A;  5T8I A;  3VTV A;  1T0S C;  3PS6 A;  1JQ4 A;  4OZC A;  2D5G A;  2MRP A;  3AEG B;  1CZP A;  1TS5 A;  1FNU A;  4JWU C;  1WGD A;  2KTR A;  4WQM A;  5CHF A;  1YQ4 B;  2B3A A;  3KYD D;  2KC1 A;  3IAS 1;  4MH8 A;  2QIE B;  4W9G A;  3KVF B;  2I1J A;  3TEY A;  4BVU C;  4TSS A;  4RGN A;  1GJZ A;  2OJW A;  3I9V 1;  3GE3 C;  3VUX A;  1YN5 A;  3H1U A;  1SE9 A;  1VJK A;  3B9J A;  2KQ4 X;  2INN E;  3DBR I;  3R7R A;  4KX6 B;  2PIA A;  1N6Z A;  2XBB C;  3TIX A;  2LGD A;  1B1Z A;  2WXJ A;  1MHH E;  1YMH E;  3AM9 A;  3TMP B;  1LXD A;  3NVZ A;  4M0W A;  5DPT A;  3VHT C;  1S3S G;  4KGT A;  2WU2 B;  3OWE B;  2IDY A;  2RR9 A;  4IWP A;  2FE8 A;  3A1Q B;  2WXQ A;  1XT9 B;  2ON8 A;  2K3U A;  1VLB A;  1ZDX A;  2D3C A;  4NAW A;  4TKN A;  2J0K A;  3MC9 A;  3AV8 A;  1KF6 B;  1V5T A;  1RFA A;  2FBW B;  4FBJ B;  1YN3 A;  3IAM 1;  1WF9 A;  1Y8R C;  4N59 A;  4W9E A;  2EKE C;  2WLB A;  2W3S A;  3QC8 B;  2GOW A;  5CTR C;  4E3C A;  3CIR B;  4DDI D;  4K3C A;  3P4P B;  2D2Q A;  2MH7 A;  2EMS A;  2C7M B;  3X0W A;  2LGI A;  1HZ6 A;  4HLE A;  1WE6 A;  3BZD B;  1FO4 A;  3NG0 A;  4NPN A;  3B08 A;  3N1Z C;  2CU1 A;  4PS7 A;  1I35 A;  1J7C A;  4IW0 A;  2IGG A;  2KDM A;  4HK2 A;  1GG3 A;  3NRZ A;  2CKH B;  4B9K A;  3H9D A;  5L83 A;  3NUH B;  2Y5P A;  3AEB B;  4WJO A;  1ZUD 2;  2CHZ A;  4RGO S;  3ZXV A;  3ZNI D;  3ZGZ A;  3HIZ A;  1FEH A;  1C4C A;  4RM9 A;  1IPG A;  2WGS A;  2LWP A;  1NBF C;  1N63 A;  5E6O A;  4WWP A;  1E0Z A;  1KLU D;  4WAA A;  4JIO U;  3J9C A;  3PZ7 A;  5HFY A;  3N1X C;  2GBM A;  3APD A;  4R3D A;  1RWS A;  3H8H A;  4LNK A;  3AU4 A;  3PHW B;  4ACF A;  2WP9 B; 
#chains in the Genus database with same CATH homology
 4GLS C;  3TEZ A;  2QSD A;  1DOX A;  1DGJ A;  1I7H A;  1SXT A;  3ABV B;  1WWT A;  4LTU A;  2ACZ B;  3KWL A;  2WNM A;  1PGX A;  1V8C A;  2E3T A;  3FC4 A;  1IUE A;  1I4H A;  1FD6 A;  2WXF A;  3BK1 A;  4MAC A;  1XLP A;  5G5H A;  3NVV A;  1NI3 A;  2BT6 A;  3TUO A;  1E10 A;  4YSX B;  1JRO A;  4A8X C;  4HRS A;  3AH7 A;  1QQR A;  1C77 A;  1SF0 A;  2WXO A;  4YTM B;  1E9M A;  1JW9 D;  3EUB 2;  1TS4 A;  2PMV A;  3BVG A;  1FM0 D;  3AEF B;  3ZJT A;  4FXC A;  2JSV X;  1ZXH A;  1ZXI A;  2RDH A;  2H88 B;  4YT0 B;  1L5P A;  1XF5 L;  1ET6 A;  3AE8 B;  4RFB A;  2PLP A;  3ZYY X;  1SJE D;  1KFY B;  1WSP A;  2RPV A;  3FAH A;  5MPO A;  1NEK B;  4HRO A;  4ZHO A;  2WU5 B;  4RF0 A;  4N58 A;  2WXG A;  2WXN A;  1CQV A;  3NZ3 A;  4ARI A;  3U2S C;  5EE9 A;  4Q2J A;  2JU6 X;  1VDV A;  4OHJ A;  2QEJ C;  1AWD A;  1GB4 A;  4ZRQ A;  2LEK A;  3EA6 A;  3URY A;  3V3X A;  3HVZ A;  3VRA B;  1I4P A;  2WDQ B;  5HG2 A;  1SE2 A;  1VZ8 A;  1DOY A;  1FRD A;  1BXT A;  2N9L A;  2WDR B;  1N61 A;  1FXA A;  2HDE A;  3VRB B;  4C80 A;  1IBX B;  2Q5W D;  2W82 A;  3AED B;  1SBB B;  2SAK A;  1EU4 A;  1SB3 C;  4MM3 B;  2YEP B;  4NZL B;  3U7Z A;  3P4R B;  1ZDV A;  4H2A A;  5D3I B;  2LJI A;  1SIJ A;  4NAM A;  3RPF C;  3KQ4 A;  4AQ7 A;  1XEE A;  2PVO D;  3GS2 A;  2V3P A;  1FFV A;  2K22 A;  4A90 A;  4A9A A;  5BMH A;  2WS3 B;  3ZQ4 A;  1MI0 A;  3VQI A;  1EM7 A;  3ZJU A;  1KH0 A;  2DBY A;  3P1M A;  1QOA A;  3FIL A;  3NVW A;  2IGD A;  5EE1 A;  1QOG A;  1FIQ A;  1RYJ A;  1YJI A;  2VZK D;  1WXQ A;  3IT6 B;  4OZB A;  2J52 A;  2BBC A;  1VRA B;  2BS4 B;  3P4S B;  2CJO A;  2Y3A A;  3BK2 A;  2DYO A;  1TS2 A;  3AE3 B;  1VZ6 A;  1QIL A;  1Y56 A;  2QIL A;  1WRI A;  3AN1 A;  1UGJ A;  2B76 B;  2MJE A;  3U52 E;  2JZP A;  1XCT L;  3WCQ A;  3KLS X;  4NAW B;  2GRI A;  4WUR A;  1XLN A;  2LHE A;  4LLG M;  1K52 A;  1C79 A;  5D3D A;  3AE5 B;  5EE0 A;  1D5X C;  2J53 A;  1P7E A;  4LK0 M;  3AEA B;  2Z8L A;  4EE2 A;  1UUP A;  5BMI A;  2AQ1 B;  1SE3 A;  5AUK A;  4L2Y A;  1STE A;  4ZYS A;  1BUI C;  3AMZ A;  5BYR A;  1VZ7 A;  1FNV A;  3SR6 A;  2ICI A;  1I4Q A;  2WDV B;  3AE2 B;  5LNK 1;  1N5W A;  1L6V A;  1P7F A;  2LFI A;  5H8Y E;  1JWS D;  1QOB A;  5HI1 A;  2LMC A;  1ENF A;  1AN8 A;  2E6X A;  4TQ1 A;  4YXD B;  2WXL A;  2L52 A;  3LB8 C;  2J42 A;  1WYG A;  1VR9 A;  5FK9 C;  1YNT E;  3BWU D;  5H92 C;  2K5P A;  4US8 A;  1KTK A;  3LYY A;  1D6E C;  1UNS A;  2WP9 B;  2AQ2 B;  4HKQ A;  1FNW A;  1DYQ A;  1TKE A;  1XLQ A;  1V97 A;  3W9C B;  1C4P A;  1TKY A;  3DWG C;  1SJH D;  4JPS A;  3Q8F A;  4C7Z A;  2AX5 A;  3PO0 A;  1UWM A;  4DQO C;  4WAF A;  3LXF A;  3B2F A;  3EGR A;  4HKZ E;  4XWW A;  2L83 A;  1L0V B;  2Y5C A;  4JWS C;  2RDG A;  2R61 A;  2K9X A;  1I4R A;  3N9Y C;  4REZ A;  2G1E A;  5AUI A;  1HZ5 A;  2NMQ A;  2WXM A;  3E9S A;  5HHD G;  1HA5 A;  1KLG D;  1FFU A;  4UDU C;  4IOI E;  3DWM A;  2SEB D;  1FMA D;  1EWC A;  1Q10 A;  1BML C;  3GP7 A;  4P16 A;  3SEB A;  2GB1 A;  4PT5 A;  1C78 A;  3HUI A;  3MHZ A;  4YTP B;  1N5X A;  4RGM A;  4RCO A;  2LHD A;  1FRR A;  2BW2 A;  2QMT A;  3KWV A;  3MFG A;  1ESF A;  2V0G A;  1NEN B;  3BYT B;  5BMG A;  1K53 A;  2JWU A;  2MJD A;  4RH6 A;  1PGB A;  3BYY B;  4J3O D;  1FXI A;  2MJ3 A;  3W2D A;  1JML A;  3Q8A A;  3Q69 A;  1JWM D;  4ZOH C;  1CK1 A;  1YN4 A;  5BYQ A;  5D7G A;  1TZO A;  2PW9 A;  1V1P A;  1PFD A;  5C3J B;  3AEC B;  4ZHP A;  1OQR A;  1F2R I;  2I38 A;  2W54 A;  5FR3 A;  4KKI A;  1ZPS A;  4IKG A;  3BVM A;  3IT4 B;  2N0S B;  1F77 A;  1NVI D;  1IGC A;  3W5U B;  3BII D;  3HVD A;  1GPX A;  4ZRP A;  1QT9 A;  3Q8E A;  1OFF A;  3O13 A;  1MPE A;  1QLB B;  2PTL A;  3UI3 A;  2M56 B;  2H89 B;  1ZOY B;  4WIP A;  4YSZ B;  1K50 A;  2NTS A;  1PUT A;  5G5G A;  4DXG A;  1F0Z A;  1RM6 C;  2IPK D;  1WGK A;  1GB1 A;  1T3Q A;  3W1S A;  1L0X B;  1XLO A;  2FUG 1;  1CJE A;  3RFZ B;  4WH4 A;  3CWI A;  3R2T A;  1YQ3 B;  1E6E B;  5I4D A;  2BB5 A;  3AE6 B;  2BB6 A;  2L32 A;  1QF6 A;  1L4Z B;  2JYT A;  2INP E;  2I2Y A;  2WXI A;  4RF1 A;  1SSN A;  1HQR D;  1E7P B;  3SFE B;  4DXF A;  3W5V B;  1AYF A;  1HEZ E;  2IJ0 A;  2WXP A;  3AE1 B;  1T5X D;  1TYG B;  1K51 A;  2XN9 C;  4B0M A;  3VR8 B;  3HRD D;  1L0Y B;  1I4X A;  4L23 A;  4C56 C;  2CJN A;  3ETR A;  2OHF A;  2M19 A;  3TEW A;  2DYM A;  5T8I A;  2WQY B;  4JX1 C;  2PKO A;  2PVG C;  1ROE A;  1JQ4 A;  4OZC A;  2D5G A;  2WXR A;  3NVY A;  1MHX A;  3AEG B;  1CZP A;  1JWB D;  1J7A A;  1TS5 A;  1FNU A;  4JWU C;  2EEL A;  2BTE A;  4WQM A;  1I4G A;  1YQ4 B;  1TKG A;  3IAS 1;  1HXY D;  4XE0 A;  2NTT A;  4MH8 A;  2QIE B;  4OVZ A;  1NYQ A;  3R2I A;  5GXG B;  4YWG G;  4ARC A;  4B0E A;  4WWM A;  1SE4 A;  1JWA D;  3B2G A;  3Q8C A;  3TEY A;  1JWU D;  3T3O A;  1PDX A;  1DOI A;  4RGN A;  4TSS A;  3I9V 1;  1YN5 A;  1VJK A;  3B9J A;  3T3N A;  2JYE A;  2KWD A;  2KQ4 X;  2INN E;  4HJG E;  3P4Q B;  4IDI A;  1SEB D;  2ZW0 A;  1KRH A;  1IBX A;  4KX6 B;  2PIA A;  4AS1 A;  1C4A A;  2JXT A;  1YJJ A;  1GAQ B;  3NS1 A;  1NYR A;  1XO3 A;  3P63 A;  1B1Z A;  1V1O A;  3FIL B;  1GOZ A;  2WXJ A;  2X38 A;  1MHH E;  1RFK A;  1YMH E;  3AM9 A;  4XDC A;  3NVZ A;  4M0W A;  2JQR B;  2V3N A;  1QOF A;  1ET9 A;  1M4V A;  4XDD A;  1ZE3 D;  3AE7 B;  2JX5 A;  2N9K A;  1B9R A;  4D2K A;  4KGT A;  2WU2 B;  3OWE B;  1XCQ L;  2IDY A;  2M0A A;  2OED A;  1FCL A;  2FE8 A;  2WXQ A;  4RGT A;  4A55 A;  2QJL A;  2ON8 A;  4A6Q A;  1EU3 A;  2K3U A;  1VLB A;  1J7B A;  4C7Y A;  1ZDX A;  4GDK B;  2BYT A;  1D4B A;  3Q8B A;  4ITK A;  4KGS A;  4KGR A;  2V4I B;  1UWX A;  3AV8 A;  3V05 A;  4KKJ A;  1IGD A;  1KF6 B;  2G9H D;  5E6J A;  2CU3 A;  1N62 A;  2W3R A;  2K0P A;  4MT5 A;  3P42 A;  1PGA A;  2AQ3 B;  2DWQ A;  2FBW B;  2BS3 B;  3MC0 B;  3TSS A;  1YN3 A;  3IAM 1;  3L4P A;  2WXK A;  2WXH A;  4N59 A;  3GB1 A;  2WLB A;  2YEP F;  2W3S A;  1F2R C;  4TQ0 A;  1TY2 A;  3TEX A;  2LUM A;  5BYS A;  2MEK A;  1LO5 D;  1ZP0 B;  4O1N A;  3CIR B;  2ONQ A;  1T6B X;  2HTM E;  2BS2 B;  3P4P B;  2RMM A;  1FCC C;  2MH7 A;  1N60 A;  1XXG A;  2VZK B;  2LGI A;  1HZ6 A;  3C8Y A;  4GDL B;  4YSY B;  3AE4 B;  3BZD B;  4NJC A;  1FO4 A;  1L6U A;  2DLB A;  1C76 A;  1J7C A;  1JCK B;  5C2T B;  4CQN A;  5TSS A;  2IGG A;  4P6V F;  2KDM A;  3R8B A;  3NRZ A;  3AEE B;  1OQQ A;  2GI9 A;  3VR9 B;  1AW7 A;  2L1A A;  2EKI A;  2Y5P A;  3AEB B;  3NUH B;  3PZ8 A;  5EE3 A;  1ZUD 2;  4US9 A;  4RGO S;  4JE3 B;  4OZA A;  4RNA A;  1C9F A;  3ZGZ A;  4XWT A;  1L4D B;  1TY0 A;  3E56 A;  1FEH A;  2ZW1 A;  1C4C A;  3AE9 B;  2KN4 A;  4L1B A;  2J4X A;  2KAJ A;  5FKA C;  4HEA 1;  3MP9 A;  3IXS A;  2KAC A;  2TSS A;  1TS3 A;  2W55 A;  2IGH A;  1JAL A;  1N63 A;  1QKZ A;  2XNA C;  5JXV A;  4USA A;  1E0Z A;  1ACC A;  1KLU D;  1V1P B;  1R7S A;  3AB5 A;  3J9C A;  4OW0 A;  1A70 A;  1EWY C;  3MJ5 A;  1D5Z C;  1MVK A;  3PZ7 A;  5HFY A;  4R3D A;  2N7J A;  1RWS A;  3H8H A;  3BVZ A;  1D5M C;  4N6E B;  3I57 A;  3U4E G;  4YTN B;  3ZJV A;  1TJE A;  2KMM A;  1JRP A;  1PYW D;  4TMA B;  3SFD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...