2IGDA

Anisotropic structure of protein g igg-binding domain iii at 1.1 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN G
publication title Anisotropic Refinement of a Protein G Domain at 1.1 Angstrom Resolution
rcsb
source organism Streptococcus sp.
molecule tags Igg-binding protein
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2igdA00
2KWDA 5BMIA 2OEDA 4D2KA 2N9KA 4HJGE 1EM7A 2LGIA 2GB1A 1P7EA 1K52A 3V3XA 4KGRA 5HHDG 5BMHA 2ZW1A 1YNTE 4MACA 2IGGA 3MP9A 1PGAA 1K51A 1K50A 1MHXA 2PW9A 2J52A 2JU6X 5HFYA 2J53A 2QSDA 4WH4A 1IBXA 2JXTA 2LHDA 2LHEA 2IGHA 4OZBA 1HZ6A 2PTLA 1IBXB 2EELA 2I38A 2QMTA 1HEZE 1ZXHA 2K0PA 1F2RC 2JSVX 2JWUA 1FCLA 2KACA 2ONQA 2KQ4X 1MPEA 1HZ5A 1YMHE 2N7JA 1MI0A 4HKZE 5HG2A 1PGXA 4GLSC 2N9LA 1FCCC 2KDMA 1UWXA 2RMMA 1D4BA 1F2RI 2JZPA 2GI9A 1IGCA 4KGTA 1C9FA 1PGBA 1MHHE 3FILA 2IGDA 2NMQA 2ZW0A 5HI1A 1K53A 1FD6A 1IGDA 1JMLA 3UI3A 2I2YA 3FILB 4IKGA 4KGSA 3GB1A 1Q10A 1GB4A 1KH0A 1MVKA 5BMGA 1XCQL 1P7FA 2KN4A 2PLPA 1QKZA 5JXVA 4IOIE 1GB1A 2RPVA 4OZAA 2LUMA 1XCTL 1XF5L 4OZCA 2ON8A
chains in the Genus database with same CATH superfamily
1XO3A 2L7RA 3Q14C 2FCSA 2ICIA 1ESFA 1HTQA 3P4SB 4WWNA 1L0VB 1SE9A 1K52A 2QEJC 2HTHA 4GU2A 5HHDG 4LNOA 3AH7A 2D2QA 4XYCA 4ZDVA 2JQRB 3IAM1 3RULA 4MACA 2K5PA 4LJPB 3N1YC 4FBJB 3W2DA 3A9JA 4P6VF 2LHDA 3RNGC 3VQIA 1V49A 1ENFA 1WYWB 2IGHA 5E6NA 2AWTA 3SFEB 2I1KA 3B9JA 1HZ6A 1KM7A 1WX9A 4ARCA 3V62A 3KUCB 1OEYA 4HLEA 3FAHA 1QOAA 3NOBA 2RDBC 2JWUA 3CSTA 3ZQ4A 2N1VA 2RDGA 2WXHA 1MPEA 2C5LC 4KX6B 4EZLA 4FXCA 4LNIA 4N9F4 5L95C 2GBJA 4A9AA 5G5GA 5KHQA 2KC1A 2CKHB 5HI1A 1H4RA 1FD6A 1T6BX 4MGYE 3PSEB 1GB4A 5I4DA 4NPNA 4JE3B 3KWVA 4LK0M 1RFKA 2IDYA 1LXDA 2WS3B 4IOIE 1WE6A 3TCAA 2MLBA 5IOIA 1K8RB 2WLBA 2GLSA 2V3SA 2FE8A 2MBBB 3HVZA 2KOXA 3QAQA 2BB6A 1ZOYB 4EZKA 2CHXA 4JL9A 5H92C 3DBHI 3NJTA 3KYCD 4B6WA 2AL3A 5D7GA 5DCNA 1VZ6A 2G45B 4OVZA 4KGRA 4ANWA 3VUYA 2JZ3B 2DAJA 3DOWA 5L83A 1C4CA 4FJZA 4F1SA 4YSZB 3QA8A 3CF6E 3LDZE 2JXTA 2KLCA 2LVQA 2WXIA 2R2QA 2K1FA 2KFKA 5LXHA 3ZRCA 3TEYA 5D6JB 1WXSA 3VH4B 4C80A 1KFYB 4RCOA 3O13A 2I38A 1SIJA 3DCGA 4RGMA 1E8YA 3VUWA 1WE7A 3W5UB 4AOFA 2DBYA 3U30A 2KFJA 1KLVA 1QOFA 1MG4A 2J0JA 1ACCA 1GC7A 1V86A 3QARA 2Y5CA 2PJHA 4K3BA 5JH5C 4M01A 1EF1A 5DPRA 5TR5A 1IGCA 3DBRI 1XXGA 4G0NB 2NCNA 3R66C 4YTNB 3CIRB 1J8CA 2RPQA 3ZNHB 1FM0D 1NI3A 2MRPA 4RGOS 2KN4A 3Q8AA 2WXQA 2N1WA 1FXTB 4ASWC 2L0FA 2RPVA 1E7VA 1XF5L 3EUB2 2MQJA 3NZUA 2M1MA 3B08A 3WAPA 2AQ1B 1J0GA 2K6QA 4I6LB 2BS4B 2KWDA 5D94A 1LM8B 4EKUA 3L10B 4C7YA 2EMSA 2QDFA 4XDDA 1RFAA 2N7EA 4MJSB 2N7DA 4LTUA 2TSSA 4BFRA 4ICUA 4DDID 5CHWA 2G1EA 5JZEB 3KUZA 4BOZB 1T3QA 4WH4A 3PPAA 2LHEA 2W3SA 4FJYA 4EFOA 3NS8A 4AS1A 1XD3B 3PZ7A 1SIFA 4NAMA 3A9KA 4NJCA 4M8NA 2EELA 2BB5A 1M94A 1E7PB 3DVNV 4MSQB 1ZW7A 2V9HA 4BKTA 3RCZA 4MGKE 1WGHA 3DQVA 4I6PA 3APCA 3EA6A 3L54A 4US9A 3M63B 2AX5A 4RH6A 3N1XC 3ZDTA 1SE3A 2ONQA 3OJ4B 3A4RA 4W9GA 2ZCBA 4XWTA 1TS4A 1UUPA 2KZRA 2WU2B 3DBSA 3OLMD 5CTRC 3J9CA 4GDKA 4KSKC 3Q8FA 3BY4B 4HCNB 3URYA 3KLSX 2O6VD 3H8HA 2DZIA 3NVYA 4Q2JA 5MPOA 3M3JA 3MTNB 4ZHPA 1QOGA 1I4GA 4HRSA 5LNK1 1PUTA 5FR6A 3UI3A 4KGSA 2BWES 4RF1A 2M8SA 1P7FA 2MA9B 3PV1A 3NZSA 1QZEA 3IHPC 3U7ZA 4A20A 2O2VB 2LVOA 2I1JA 2LUMA 1E8WA 2GBRA 4FLHA 1DOYA 1C79A 2L3ZA 3PVLA 2K39A 4O1NA 1BUIC 1C4AA 2BKFA 3L13A 3MJ5A 4HJKA 1GOZA 5EE0A 2B3AA 2EMTA 3KQ4A 4W9EA 1F0ZA 5GMVA 2LD9A 5DPTA 2KWUB 2KMMA 2NTSA 4S17A 3H7PB 2E6XA 3V61A 2WYQA 4AJYB 1I7HA 1ZDVA 1UELA 3DBHB 4ANVA 5HFYA 2LVPA 2LZ6A 2ZJDA 1OFFA 2K8BA 3ML8A 2WXGA 3U7DA 5T8IA 4F8CB 2XBBC 4B0MA 1EF5A 1L0YB 2INCC 3O65B 2XK5B 1L6UA 3DVGY 2JRIB 2IO3B 3BK2A 4TV3A 1NDDA 1I42A 1NYQA 5HG2A 1Z5SB 3Q3OC 4NAWB 4LLGM 3PRMB 3PZDA 4XZ4A 5D3IB 2RMMA 1XLPA 1R4MI 1HA5A 3U4EG 4B95A 2NMQA 1VZ7A 4R3DA 2VH2A 2REXA 3N20C 5C2TB 2G3QB 2M0AA 1FNVA 4BKGA 1FFUA 1B1ZA 4F7ZA 2YLMA 4ZRKA 1XQQA 2JUOA 3D32A 4P7IA 1LGRA 1JWUD 3B0AA 3TSSA 2JXXA 3KUDB 1V5OA 1C1YB 3PLUA 1LQBA 1HTOA 3GE3C 4RNAA 2PIAA 1YN3A 4BBNC 5D3DA 2Q5WD 5BMIA 1WFYA 2OEDA 2M4NA 3BYYB 1I4QA 2Y3AA 4MT5A 1EM7A 1NVID 3RPFC 1SXTA 2BPSA 1TY2A 3P4QB 2KC2A 4JLCA 5G5HA 1FO4A 4A90A 2IGGA 3P42A 4G3XB 1V1OA 2LXCA 2JYEA 4PS3A 2OJRA 5GXGB 1P3QU 4MGZE 3JW0X 3NY5A 4B9KA 1ZPSA 3NVZA 3I5JC 1UGMA 4P1BC 3ZRFA 2MP2B 2KTFA 2KD0A 3P63A 3Q3FA 4MM3B 2KJRA 3PHWB 5AZFA 2WDVB 2Z8LA 4USAA 3SEBA 3EFCA 2V3PA 4JQWC 4RF0A 1ET6A 1OQYA 5H8YE 1TKEA 1C76A 3ZJTA 4DDGD 1RRBA 2A5UA 3UQBA 1FRRA 2JX5A 3RNFC 4AQ7A 1Q1OA 1KOTA 1TKYA 3VAWA 4DQOC 1YJJA 5C1ZA 1K53A 3RMKC 2YEPB 3QCAA 4GB9A 4WQOB 5AZGA 3FILB 2O6VB 3L0WB 5FK9C 1FEHA 1R4NI 3APFA 1QKZA 2LJ5A 2FUG1 3VTUA 5JXVA 1V80A 2WDQB 3Q69A 2NS5A 4IM0A 1TZ1A 2KAJA 2K8CA 1OEYJ 3ZJVA 1N62A 1YN4A 4ZRJA 3SFDB 3X23A 4CHKA 4RGTA 2BVCA 3ETRA 1WGKA 3NVVA 4TQ0A 1JROA 2D3CA 4WWPA 1P1AA 2K8HA 3HK0A 1AARA 1WGRA 1ZDXA 4CQNA 3QC8B 4KZCA 3VRBB 1T5XD 2LGDA 2Z0DB 3AECB 5E6PA 2PE9A 3QQ8B 2WDTB 2D5GA 4ZOHC 1YX6B 2UYZB 4MDKE 1WXAA 1IBXB 4UDUC 2ZPNA 2KJHB 1FPYA 1XEEA 3OG5A 2DYBA 1V6EA 3LB8C 1H8CA 2IBIB 4II2B 4IWQA 4W9LA 2SAKA 4W9CA 2GOWA 2JSVX 2L00B 1G6JA 1ZE3D 1FCLA 2AQ3B 3ZNID 2KX3A 3Q2AC 1RWSA 3RT3B 1ZKHA 3DVGX 2N9LA 3AULA 3N3KB 3UINB 4AWJA 3VVWB 1WJ6A 1OQRA 3ABVB 4ZRIA 2HTME 2YVCA 2C9WB 1MHHE 1HE8A 2X38A 1VRAB 2ZNVC 2LFIA 3P4RB 4LDTD 2NR2A 1R4MB 2N4FA 2KQ7A 1TTNA 2DENB 4YSYB 2FCMA 3RD2A 1HXYD 3PGEA 3R7RA 1MJDA 2AEHA 4DK5A 2DWQA 4DXFA 3IAS1 3AE3B 1XCTL 2BS3B 2JVCA 4MEMA 4OZCA 2WXJA 5LXIB 4MJSA 5C23A 2GBKA 2RGFA 4LNKA 3ZLZA 3C8YA 3L16A 4D2KA 2ZNVB 3T3OA 4FA6A 1RM6C 3RNAC 1Q5WB 3UQAA 2GBNA 4HPPA 4LCDE 2WGSA 4WURA 1KF6B 1SJED 2JWZA 2NBVB 1TZOA 3MHSD 2W3RA 4E71A 2K6DB 3P1MA 4GDLB 5G55A 5BYQA 4NJ6A 4OZBA 3VH3B 1KLUD 2WX1A 1YX5B 1L6VA 1YOVB 2ZPYA 1HEZE 2KQSA 4WAFA 1D3ZA 1KLGD 5J17A 4J3OD 1NBFC 3PHXB 3ZNZB 1VD2A 2V3NA 4DHZE 2ZEQA 2WU5B 4REZA 2KQ4X 2D11A 2DZMA 3NG0A 1MI0A 2N9PC 3W1SC 2ASQA 2XNAC 3K9OB 4IWOA 1FCCC 3ZXVA 1VR9A 2NPTB 3EC8A 1UWXA 2BWFA 4ACFA 4TKNA 1SB3C 3JYUA 3VTVA 2V4IB 1L2NA 2KHWB 2DYMA 4MGIE 1HQRD 3A1QB 3Q3MC 1N5WA 4WIPA 1P98A 4HWIB 4YL8A 1N63A 2LEKA 2W54A 3JSVB 4LJOB 4FN2A 2ACZB 4EOYA 3PTFC 1SE2A 1I35A 1E8ZA 4W9FA 3R3MA 2NBWB 2MX2A 3H6NA 1R4NB 2OHFA 1OGWA 2KTRB 4ICVA 3A9JB 3H7PA 2LGIA 5IP4D 1CQVA 5EDSA 3M62B 2N0SB 4X57B 2J7QB 2KVRA 3VHTC 3C0RB 3VTWA 1PFDA 3DVNU 1SJHD 3TIXA 2J0KA 4YTMB 3AE5B 2SEBD 1V5TA 3P2BA 4GIVA 4KVGB 2PTLA 3AE9B 2XK5A 3TL5A 1GAQB 4TQ1A 2QJLA 4ITKA 5IAAC 2K0PA 2KWCA 2UWQA 4NAWA 5JHAA 3HUIA 2LGXA 2WXPA 3U2SC 3R2IA 3SR6A 1I4XA 2MJ3A 2JZPA 2WXLA 2C7HA 4IC7B 4CO7A 5DPSA 2DNFA 1WRIA 4OVUA 1C9FA 2KDBA 4ZYNA 1FIQA 2INNE 2K3UA 2IPKD 1TIFA 2KMCA 4BKSD 2MJEA 2MSED 3ZDMC 2JZZA 3ZYYX 1YQ3B 3RZWC 3IFWB 2IO2B 4AUQC 2KKCA 4HVBA 1GB1A 3WANA 2BTEA 3RNBC 3NHEB 2W55A 3R2TA 4J6IA 1I4PA 1D6EC 4FJVB 1IUEA 3NZ3A 3AE7B 2IO1B 4M02A 3WAOA 2N9KA 1D5MC 1PYWD 3WIMA 2MW5A 3QHTA 1P7EA 4ZRQA 2V0GA 1DOXA 2OOBB 2IYDB 1RAXA 3BVMA 4WWOA 1QILA 4GOCA 1WGDA 1NEKB 3MP9A 4HEA1 3N9YC 1PQSA 3QJZA 2JF5A 1K51A 3ZTDA 4ANUA 1D5ZC 4DXGA 2WWZA 2MP2A 4MM3A 1E7UA 5E6OA 1C78A 2PKOA 3AE6B 2H89B 3DWMA 2PVOD 2MBHA 3BIID 3V6EB 3PRZA 2DYOA 2WXKA 3R8BA 3AEEB 1MG8A 3Q3NC 2INDC 4C4VB 3IT6B 1GG3A 3DBLI 3AN1A 2V1YA 4GSWA 3ZKJC 2L52A 2RR9A 4PK1A 4DXAB 4YTPB 5BO4B 3TEZA 3I63C 4XWWA 2HJ8A 3L17A 1L0XB 4WWMA 2GI9A 1V97A 5EE3A 4JPSA 4JWSC 2KWVB 3BVGA 1WMHB 1WF9A 1IPGA 3FILA 2O6VA 3VRAB 1BMLC 3BINA 3Q8EA 1YD8U 4NQLB 1JMLA 2QIEB 1QT9A 3QX1A 2AL6A 5BMGA 4JX1C 3AV8A 4EUTA 2LI5A 2PLPA 1WGYA 3GOEA 1XLQA 2JPHA 3TMPB 1FXAA 4HK2A 2L32A 3S2AA 4E3CA 2NBUA 3UIPB 4EZJA 3SD5A 2MHJA 1IP9A 1DGJA 3ALBA 3NRZA 2C7NB 1L5PA 3UF8A 4PT5A 1LFDA 1T0QC 4KDLB 4XGAB 4HJGE 4KIKB 2HE7A 4HDQA 1CK1A 2DZJA 5BMHA 3IBEA 2KNBA 1FFVA 3AXCA 3A9KB 1E6EB 2LASA 3I9V1 3EECA 1WM2A 2PW9A 2BYVE 2QSDA 1IBXA 2M19A 4W9KA 1E0ZA 5AZHA 4OVVA 2KX0A 1UH6A 4IDIA 2WHIA 1PDXA 2QCZA 2FCQA 2XN9C 3FKYA 4QAYA 4BBNF 3RZFA 3SHQA 4HPMB 1EWCA 1LO5D 1AWDA 1XLOA 1S1QB 2FAZA 4E74A 1F52A 2FIFA 3GS2A 2N7JA 4RM8A 2KDEB 2ZVNA 4FHJA 3KYDD 2WXMA 4GLSC 1A5RA 1XT9B 4DBGA 2HD5B 2BBCA 4L23A 1F2RI 3EFUA 1GUAB 4K7WA 1TBEA 4GXBA 5EE1A 3TJPA 5J2RA 3HRDD 1E90A 4YXDB 3K9PB 3A33B 1F1HA 2YEPF 4IWPA 2I2YA 1YIWA 4K7SA 2BQQA 2WXNA 1OTRB 3C19A 1VLBA 2Z59B 3WAMA 2HDEA 4C56C 2K9XA 1JWMD 3NS1A 2R61A 1AN8A 1WSPA 3MC0B 1RLFA 4ZYSA 1SE4A 3W9CB 4HROA 2L05A 3W1YA 3H7SA 3P4PB 4TSSA 4C7ZA 4LNNA 3RNCC 1KRHA 4HDOA 2BF8B 3VDZA 5IO9A 1YN5A 4EEWA 1EWYC 2QC8A 3N32A 1UBQA 2CU3A 3SDLC 1FRDA 1WX8A 3V6CB 3ZXRA 1DOIA 3H9DA 4ZRPA 5EE9A 3KW5B 4GDLA 4LNFA 3ONSA 2M0XA 1MFWA 2JU6X 2DHZA 2HJ1A 1GNUA 4OW0A 1STEA 1JCKB 3N30A 1FMAD 1TT5B 2QHOA 4K81A 1ZXHA 3ZUNA 4MH0E 1EUVB 1WM3A 3AEBB 1V2YA 3KVFB 3SU8X 2NPTA 1PGXA 3E9SA 4G50A 2LGYA 2INPE 2NTTA 4IM3A 4ARIA 2CS4A 2IY1B 3DBLB 3RUIB 1ET9A 1WJNA 3A1QA 1SSNA 2XEWA 1WZ0A 4KZ0A 1UNSA 2ZW0A 1JQ4A 1UZXB 2GBMA 4US8A 1N6ZA 3JSVA 1I4HA 1WXVA 3W1SA 2W82A 3BK1A 1JRPA 4DWFA 4OZAA 4RMAA 2KTRA 3HIZA 2FNJB 3ZGZA 4YT0B 4EE2A 2GMIC 1ROEA 1KJTA 2BT6A 3V60A 4FADA 2GB1A 4BZAA 1U4AA 4ANXA 3GE8C 1TKGA 3Q8CA 4IUMB 1WWTA 2CR5A 4W9IA 1JWSD 1C77A 3IVFA 3ZO5B 3ECIA 4XE0A 3VFKA 1X1MA 4L2YA 1NYRA 2VRRB 3PS6A 2CJNA 4N6EB 2D3AA 3IXSA 3AM9A 1ISNA 3CWIA 4M00A 2FIDA 3TEXA 2L0TA 3PRPB 3L08A 3Q3JA 3VR8B 4B0EA 1F2RC 3TEWA 1OQQA 2FBWB 1WR1A 2MWSB 2W9NA 3ENEA 1F77A 1ZGUB 2KANA 4KDIC 2KACA 3APDA 4W9HA 1M4VA 2FCNA 2J42A 4M8MA 1Q0WB 2BGFA 3Q6BA 2L76A 3GZNI 2KDMA 3MC8A 3VXWA 3KH0A 1V1PB 4WAAA 3W5VB 1E9MA 3UIOB 1UD7A 4N59A 5BYSA 4KKIA 1IGDA 2IO0B 3PREA 4IKGA 1Q10A 1WXMA 4W9JA 1XCQL 3ZW3A 3AI5A 3ML9A 1EO6A 1YJ1A 4S0RA 2LMCA 2LJIA 3AEDB 2BYFA 2ON8A 3PZ8A 2WXOA 1WI0A 3ZVVA 2GRIA 3GP7A 1DYQA 4M0WB 2BYEA 2JY6A 3IT4B 2DAFA 2O2VA 3RFZB 1FXIA 1UF0A 3AEAB 4TUUA 4WJPA 2Y5PA 4JWUC 3AE2B 4MSMB 4PS8A 4AJWA 1NENB 1WRDB 2CHZA 1K50A 2JT4B 2J53A 3T3NA 3DDCB 4II3B 2EKEC 2VH1A 3HM3A 2AQ2B 3OAWA 4HKQA 2N9XA 1N5XA 1V8CA 1VCBA 2LUEA 3R7QA 4C4VA 4G11A 2D10A 2PMVA 1GC6A 1L7YA 1E10A 3PT2B 1FNWA 2L83A 5CX3A 3IG3A 3CSFA 3AEGB 2WP9B 5TSSA 4JGHB 2RDHA 1WMHA 2MCNB 3MFGA 2MJDA 4YWGG 2IZVB 4K7UA 1B9RA 1UBIA 2K22A 3DHHC 2IGDA 2KJ6A 3ZJUA 3TBLD 1SGHA 1P9DU 1WJ4A 2PEAA 2WDRB 4YSXB 1ZUD2 2BS2B 4HPLB 2PE6B 3V05A 2KXJA 3ZIMA 2E3TA 1VZ8A 1Y8RC 1CJEA 4K1RB 3T9LA 1JWAD 2KK8A 3FC4A 3B1LX 5D2MB 2N9EB 1T0RC 3LXFA 2DLBA 3H1UA 3PLVA 4NY0A 2IJ0A 5DPWA 4KIKA 1V9JA 2MBEA 2RSUA 1WGGA 4IM2A 5IKCM 4MH8A 1N60A 2B76B 3HVDA 4BOSC 4PYUA 1TJEA 4RFBA 3PO0A 1A70A 1YJIA 1WR6E 3V3XA 3JVZX 1J19A 1JWBD 4JIOU 3EHVA 4ZHOA 3B2GA 3DHGC 4LDTB 5FKAC 2Z0EB 1IYFA 5CHVC 1PGAA 1WXQA 4WJQA 3U8ZA 5J18A 2J52A 4KV2A 4RM9A 4GN1A 2BW2A 2MBQA 3DHIC 2PVGC 5HKHA 2LWPA 1R7SA 3DPDA 4GMVA 2DZKA 2KFKB 3TUOA 2J4XA 1XLNA 1WIAA 1J7BA 4WJNA 5BYRA 4NZLB 3MHZA 1YQ4B 2ZZPB 2QILA 5AUKA 1T0YA 2M17A 1I4RA 1HZ5A 3I3TB 4AP4C 4HKZE 2VZKD 3UGBB 1TS2A 4XDCA 3RYTA 1RYJA 2L8JA 4P1CC 2C7MB 1NI2A 4A6QA 1E8XA 2M56B 1AYFA 4KGTA 2D3BA 3KWLA 4HCPB 4H2AA 3I57A 2G4DB 4A3OA 2LGSA 2IY0B 1TGZB 4DHJD 2R2OA 3GZNB 3BYTB 4W9DA 3MJWA 1VDVA 1MVKA 2KDFB 2H88B 4BKSA 4C00A 2UU7A 4XX5A 1UGJA 3QWZB 5IA7A 2KYWA 4N58A 1V81A 1AW7A 2JRHA 4FHKA 2CU1A 1TS3A 3QK0A 1QLBB 2MBOA 1L4DB 2AYOB 1UWMA 1P0RA 3NUHB 3X0WA 4RGNA 2BYTA 4I6NB 4P16A 2ZW1A 3BVZA 3ZTCA 1SF0A 5LLIA 1T0SC 4GGQA 2ZCCA 3BWUD 3EGRA 1ZP0B 2KMAA 3QIJA 2G4SA 3AEFB 4A8XC 5CHFA 3N1ZC 3RI7C 3LYYA 2WXRA 3A4SC 1TS5A 4HXDA 1WYGA 5IN7A 4A3PA 1QF6A 1J7CA 2D07B 4OHJA 2LXAA 4NNJB 1YMHE 2L1AA 3DBRB 4K3CA 5C3JB 4DHZB 1F9JA 3NVWA 1CMXB 3OJ3A 3T8MA 3VR9B 1C4PA 3ZNGC 3BZDB 2KO3A 1VJKA 1JW9D 4GDKB 5G2NA 5E6JA 1YQBA 3GB1A 3OWEB 1KH0A 3B2FA 3AE8B 2MEKA 3AE1B 1BT0A 2BKRB 1WZ3A 4NJ7A 5JHBA 4IG7B 3U52E 1TY0A 1SEBD 2WX0A 3WALA 1TYGB 4URKA 5AUIA 2KLGA 2G9HD 4PS7A 2EKIA 2KVZA 3WA0A 2DX5B 1KTKA 3M95A 2JYTA 2NVUI 4XC2A 1Y56A 3HM6X 3LJ3A 4KKJA 1ZXIA 3WCQA 2PPHA 1GJZA 1YNTE 2ZVOA 3E56A 5AEKB 1MHXA 1WY8A 3DWGC 1N61A 4A55A 1D5XC 3HHMA 4L1BA 3AMZA 1J7AA 4CYEA 1EU4A 4TMAB 4KSLC 1BXTA 2CJOA 1EU3A 1GPXA 2A4ZA 2D3GA 5KHOA 2QMTA 1CZPA 3AU4A 3AE4B 1S3SG 2Y5BB 4WJOA 2K25A 1E5WA 1WH3A 4BVUC 1QQRA 2WQYB 1WJUA 2J0MA 4WQMA 3MC9A 2WXFA 3RN9C 2V4LA 4PYZA 4BAXA 3L4PA 1C3TA 2OJWA 1JRUA 1V1PA 3RNEC 2FUHB 4IW0A 1D4BA 1QOBA 2C60A 3VUXA 2VZKB 3AB5A 1PGBA 1Z2MA 2WNMA 3AU5A 1WX7A 2KN5A 2LRUA 3Q8BA 4NQKE 1L4ZB 2RD0A 2CHWA 3CMMB 1FNUA 5FR3A 4DHJB 2MH7A 1JALA 4MELA 1SBBB 2KT7A 2X8XX 2LRWA 2KDIA 4FULA 4M0WA
chains in the Genus database with same CATH topology
1IUEA 1XO3A 2WXOA 2Q5WD 3NZ3A 2GRIA 2ICIA 5BMIA 1ESFA 3GP7A 3AE7B 2OEDA 1DYQA 3P4SB 3BYYB 2N9KA 1I4QA 2Y3AA 3IT4B 4MT5A 3RFZB 1L0VB 1D5MC 1PYWD 1EM7A 1NVID 1FXIA 1P7EA 4ZRQA 1K52A 3RPFC 2V0GA 1DOXA 2QEJC 1SXTA 3AEAB 5HHDG 3BVMA 1TY2A 3P4QB 3AH7A 5G5HA 2Y5PA 4JWUC 1FO4A 2JQRB 3AE2B 4A90A 3IAM1 1QILA 4MACA 2IGGA 1NEKB 2K5PA 3MP9A 3N9YC 3P42A 4HEA1 1NENB 1V1OA 2JYEA 1K51A 1K50A 1D5ZC 4DXGA 3W2DA 5GXGB 4P6VF 2J53A 2LHDA 3VQIA 1ENFA 2IGHA 3T3NA 3SFEB 1ZPSA 3B9JA 3NVZA 2AQ2B 1C78A 2PKOA 1HZ6A 4HKQA 1N5XA 3AE6B 4ARCA 2H89B 1V8CA 3DWMA 3P63A 4MM3B 2PVOD 3BIID 2DYOA 2WDVB 2WXKA 2PMVA 3FAHA 3R8BA 2Z8LA 3AEEB 1E10A 4USAA 1QOAA 3IT6B 1FNWA 2L83A 3SEBA 2V3PA 2JWUA 3ZQ4A 3AN1A 2RDGA 2L52A 2WXHA 4RF0A 1ET6A 1MPEA 5H8YE 1TKEA 1C76A 4KX6B 3ZJTA 4YTPB 3AEGB 4FXCA 3TEZA 2WP9B 5TSSA 4XWWA 2RDHA 1FRRA 2JX5A 4AQ7A 1L0XB 4WWMA 3MFGA 2GI9A 4A9AA 1V97A 5EE3A 4JPSA 1TKYA 2MJDA 4YWGG 5G5GA 4DQOC 4JWSC 1B9RA 2K22A 1YJJA 3BVGA 3VRAB 3FILA 2IGDA 1BMLC 5HI1A 3Q8EA 1K53A 2YEPB 3ZJUA 1FD6A 1JMLA 1T6BX 2WDRB 3FILB 2QIEB 4YSXB 1QT9A 1ZUD2 2BS2B 1GB4A 3V05A 5I4DA 4JE3B 3KWVA 5FK9C 1FEHA 5BMGA 2E3TA 4JX1C 3AV8A 1VZ8A 2PLPA 1QKZA 1CJEA 1RFKA 2FUG1 2IDYA 4LK0M 1JWAD 1XLQA 3FC4A 5JXVA 2WS3B 1FXAA 4IOIE 2WDQB 2L32A 3LXFA 3Q69A 2DLBA 2KAJA 2IJ0A 2WLBA 1DGJA 3NRZA 2FE8A 3HVZA 3ZJVA 1L5PA 1N62A 1YN4A 4MH8A 2BB6A 1N60A 1ZOYB 4PT5A 3SFDB 2B76B 3HVDA 1TJEA 4HJGE 5H92C 4RFBA 3PO0A 4RGTA 1A70A 1YJIA 3V3XA 5D7GA 1CK1A 1VZ6A 3ETRA 4OVZA 4KGRA 5BMHA 1JWBD 1WGKA 3NVVA 4ZHOA 3B2GA 4TQ0A 1FFVA 1JROA 1E6EB 3I9V1 5FKAC 1C4CA 1PGAA 1WXQA 1ZDXA 4YSZB 2PW9A 2J52A 4CQNA 3VRBB 2QSDA 1T5XD 1IBXA 2JXTA 2M19A 3AECB 1E0ZA 2WXIA 2BW2A 2D5GA 2PVGC 4ZOHC 3TEYA 4IDIA 1R7SA 1IBXB 4C80A 1PDXA 2XN9C 4UDUC 1KFYB 4RCOA 3O13A 2I38A 1XEEA 3TUOA 1SIJA 2J4XA 1XLNA 4RGMA 1EWCA 1J7BA 1LO5D 3LB8C 3W5UB 5BYRA 4NZLB 2SAKA 1AWDA 3MHZA 2JSVX 1XLOA 2DBYA 1YQ4B 2QILA 5AUKA 1ZE3D 1FCLA 2AQ3B 1I4RA 3GS2A 1QOFA 1HZ5A 2N7JA 4HKZE 1RWSA 2VZKD 1ACCA 1TS2A 4XDCA 2WXMA 2Y5CA 4GLSC 2N9LA 1RYJA 2BBCA 4L23A 1F2RI 1IGCA 1XXGA 4A6QA 1OQRA 2M56B 3ABVB 4YTNB 5EE1A 1AYFA 4KGTA 3KWLA 4H2AA 2HTME 3CIRB 1MHHE 2X38A 3I57A 1VRAB 2LFIA 3HRDD 4YXDB 3P4RB 3BYTB 2YEPF 2I2YA 1FM0D 2WXNA 1NI3A 1VLBA 1VDVA 1MVKA 2HDEA 4C56C 2H88B 4YSYB 4RGOS 2KN4A 2K9XA 1HXYD 1JWMD 3NS1A 3Q8AA 2R61A 2WXQA 1AN8A 1WSPA 3MC0B 2DWQA 4DXFA 3IAS1 1UGJA 4ZYSA 2RPVA 1SE4A 3AE3B 3W9CB 1XCTL 1XF5L 2BS3B 3EUB2 4HROA 4OZCA 4N58A 2AQ1B 3P4PB 2WXJA 4TSSA 1AW7A 4C7ZA 1KRHA 1TS3A 2BS4B 2KWDA 1QLBB 1YN5A 3C8YA 4C7YA 4XDDA 1L4DB 4D2KA 3T3OA 1UWMA 3NUHB 1EWYC 4RGNA 4LTUA 1RM6C 2BYTA 2CU3A 4P16A 2TSSA 1FRDA 2ZW1A 3BVZA 2G1EA 1DOIA 4WURA 1KF6B 1SF0A 4ZRPA 5EE9A 1SJED 1TZOA 3BWUD 2JU6X 1T3QA 3EGRA 2W3RA 4WH4A 1ZP0B 2LHEA 3P1MA 4OW0A 4GDLB 2W3SA 5BYQA 3AEFB 4A8XC 1STEA 4OZBA 3LYYA 2WXRA 1JCKB 1KLUD 4AS1A 3PZ7A 1FMAD 4NAMA 4NJCA 1L6VA 2EELA 2BB5A 1E7PB 1TS5A 1HEZE 1WYGA 1ZXHA 4WAFA 3EA6A 1KLGD 4J3OD 4US9A 1QF6A 1J7CA 2AX5A 3AEBB 4RH6A 4OHJA 2V3NA 1SE3A 2WU5B 2ONQA 4REZA 2KQ4X 1YMHE 1MI0A 2L1AA 4XWTA 1PGXA 1TS4A 1UUPA 2WU2B 3E9SA 2INPE 2NTTA 2XNAC 5C3JB 1FCCC 1VR9A 4ARIA 1UWXA 3NVWA 3J9CA 3VR9B 3Q8FA 1C4PA 3URYA 3BZDB 3KLSX 3NVYA 3H8HA 4Q2JA 1ET9A 5MPOA 1SB3C 1VJKA 2V4IB 1JW9D 2DYMA 4ZHPA 1HQRD 1QOGA 1SSNA 4GDKB 1I4GA 1UNSA 2ZW0A 4HRSA 5LNK1 5E6JA 1JQ4A 1PUTA 4US8A 3UI3A 4KGSA 1N5WA 3GB1A 3OWEB 4WIPA 1I4HA 1KH0A 3B2FA 3AE8B 4RF1A 1N63A 1P7FA 3W1SA 2MEKA 2W82A 3BK1A 2LEKA 3AE1B 1JRPA 2W54A 3U7ZA 2ACZB 3U52E 4OZAA 2LUMA 1SE2A 1TY0A 1DOYA 1C79A 1SEBD 3ZGZA 4YT0B 1TYGB 4O1NA 1BUIC 1C4AA 3MJ5A 5AUIA 4EE2A 2G9HD 2OHFA 1ROEA 2BT6A 1GOZA 2EKIA 5EE0A 3KQ4A 1KTKA 1F0ZA 2LGIA 2GB1A 2JYTA 1CQVA 1Y56A 4KKJA 1TKGA 1ZXIA 2KMMA 2NTSA 3Q8CA 3WCQA 2N0SB 1YNTE 1WWTA 1JWSD 2E6XA 1C77A 1PFDA 4XE0A 1I7HA 1ZDVA 3E56A 1MHXA 3DWGC 1SJHD 1N61A 4A55A 4YTMB 1D5XC 3AE5B 5HFYA 4L2YA 1OFFA 4L1BA 2SEBD 1NYRA 1J7AA 3AMZA 2CJNA 4N6EB 2WXGA 3IXSA 1EU4A 3AM9A 4TMAB 1BXTA 2CJOA 3CWIA 1EU3A 2PTLA 3AE9B 5T8IA 1GAQB 4B0MA 1GPXA 4TQ1A 3TEXA 2QJLA 2QMTA 1CZPA 3VR8B 1L0YB 3AE4B 4ITKA 4B0EA 1L6UA 2K0PA 1F2RC 3TEWA 1OQQA 2FBWB 3BK2A 1F77A 2KACA 3HUIA 1QQRA 1M4VA 2WQYB 1NYQA 2J42A 2WXPA 4WQMA 5HG2A 3U2SC 2WXFA 4NAWB 4LLGM 3L4PA 3R2IA 1V1PA 2KDMA 5D3IB 3SR6A 1I4XA 2RMMA 1D4BA 1QOBA 1XLPA 2MJ3A 2JZPA 2WXLA 2VZKB 1HA5A 1V1PB 1WRIA 3U4EG 3W5VB 3AB5A 1C9FA 1PGBA 1E9MA 2WNMA 1FIQA 2NMQA 2INNE 4N59A 2K3UA 1VZ7A 4R3DA 5BYSA 2IPKD 4KKIA 1IGDA 5C2TB 2M0AA 2MJEA 4IKGA 1FNVA 3Q8BA 1FFUA 1B1ZA 1Q10A 3ZYYX 1YQ3B 1L4ZB 1XCQL 1JWUD 3TSSA 1FNUA 5FR3A 2MH7A 1GB1A 1JALA 1SBBB 2BTEA 4RNAA 2LMCA 2LJIA 2PIAA 2W55A 4M0WA 1YN3A 3AEDB 1I4PA 3R2TA 1D6EC 2ON8A 5D3DA 3PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KWD A;  5BMI A;  2OED A;  4D2K A;  2N9K A;  4HJG E;  1EM7 A;  2LGI A;  2GB1 A;  1P7E A;  1K52 A;  3V3X A;  4KGR A;  5HHD G;  5BMH A;  2ZW1 A;  1YNT E;  4MAC A;  2IGG A;  3MP9 A;  1PGA A;  1K51 A;  1K50 A;  1MHX A;  2PW9 A;  2J52 A;  2JU6 X;  5HFY A;  2J53 A;  2QSD A;  4WH4 A;  1IBX A;  2JXT A;  2LHD A;  2LHE A;  2IGH A;  4OZB A;  1HZ6 A;  2PTL A;  1IBX B;  2EEL A;  2I38 A;  2QMT A;  1HEZ E;  1ZXH A;  2K0P A;  1F2R C;  2JSV X;  2JWU A;  1FCL A;  2KAC A;  2ONQ A;  2KQ4 X;  1MPE A;  1HZ5 A;  1YMH E;  2N7J A;  1MI0 A;  4HKZ E;  5HG2 A;  1PGX A;  4GLS C;  2N9L A;  1FCC C;  2KDM A;  1UWX A;  2RMM A;  1D4B A;  1F2R I;  2JZP A;  2GI9 A;  1IGC A;  4KGT A;  1C9F A;  1PGB A;  1MHH E;  3FIL A;  2IGD A;  2NMQ A;  2ZW0 A;  5HI1 A;  1K53 A;  1FD6 A;  1IGD A;  1JML A;  3UI3 A;  2I2Y A;  3FIL B;  4IKG A;  4KGS A;  3GB1 A;  1Q10 A;  1GB4 A;  1KH0 A;  1MVK A;  5BMG A;  1XCQ L;  1P7F A;  2KN4 A;  2PLP A;  1QKZ A;  5JXV A;  4IOI E;  1GB1 A;  2RPV A;  4OZA A;  2LUM A;  1XCT L;  1XF5 L;  4OZC A;  2ON8 A; 
#chains in the Genus database with same CATH topology
 1XO3 A;  2L7R A;  3Q14 C;  2FCS A;  2ICI A;  1ESF A;  1HTQ A;  3P4S B;  4WWN A;  1L0V B;  1SE9 A;  1K52 A;  2QEJ C;  2HTH A;  4GU2 A;  5HHD G;  4LNO A;  3AH7 A;  2D2Q A;  4XYC A;  4ZDV A;  2JQR B;  3IAM 1;  3RUL A;  4MAC A;  2K5P A;  4LJP B;  3N1Y C;  4FBJ B;  3W2D A;  3A9J A;  4P6V F;  2LHD A;  3RNG C;  3VQI A;  1V49 A;  1ENF A;  1WYW B;  2IGH A;  5E6N A;  2AWT A;  3SFE B;  2I1K A;  3B9J A;  1HZ6 A;  1KM7 A;  1WX9 A;  4ARC A;  3V62 A;  3KUC B;  1OEY A;  4HLE A;  3FAH A;  1QOA A;  3NOB A;  2RDB C;  2JWU A;  3CST A;  3ZQ4 A;  2N1V A;  2RDG A;  2WXH A;  1MPE A;  2C5L C;  4KX6 B;  4EZL A;  4FXC A;  4LNI A;  4N9F 4;  5L95 C;  2GBJ A;  4A9A A;  5G5G A;  5KHQ A;  2KC1 A;  2CKH B;  5HI1 A;  1H4R A;  1FD6 A;  1T6B X;  4MGY E;  3PSE B;  1GB4 A;  5I4D A;  4NPN A;  4JE3 B;  3KWV A;  4LK0 M;  1RFK A;  2IDY A;  1LXD A;  2WS3 B;  4IOI E;  1WE6 A;  3TCA A;  2MLB A;  5IOI A;  1K8R B;  2WLB A;  2GLS A;  2V3S A;  2FE8 A;  2MBB B;  3HVZ A;  2KOX A;  3QAQ A;  2BB6 A;  1ZOY B;  4EZK A;  2CHX A;  4JL9 A;  5H92 C;  3DBH I;  3NJT A;  3KYC D;  4B6W A;  2AL3 A;  5D7G A;  5DCN A;  1VZ6 A;  2G45 B;  4OVZ A;  4KGR A;  4ANW A;  3VUY A;  2JZ3 B;  2DAJ A;  3DOW A;  5L83 A;  1C4C A;  4FJZ A;  4F1S A;  4YSZ B;  3QA8 A;  3CF6 E;  3LDZ E;  2JXT A;  2KLC A;  2LVQ A;  2WXI A;  2R2Q A;  2K1F A;  2KFK A;  5LXH A;  3ZRC A;  3TEY A;  5D6J B;  1WXS A;  3VH4 B;  4C80 A;  1KFY B;  4RCO A;  3O13 A;  2I38 A;  1SIJ A;  3DCG A;  4RGM A;  1E8Y A;  3VUW A;  1WE7 A;  3W5U B;  4AOF A;  2DBY A;  3U30 A;  2KFJ A;  1KLV A;  1QOF A;  1MG4 A;  2J0J A;  1ACC A;  1GC7 A;  1V86 A;  3QAR A;  2Y5C A;  2PJH A;  4K3B A;  5JH5 C;  4M01 A;  1EF1 A;  5DPR A;  5TR5 A;  1IGC A;  3DBR I;  1XXG A;  4G0N B;  2NCN A;  3R66 C;  4YTN B;  3CIR B;  1J8C A;  2RPQ A;  3ZNH B;  1FM0 D;  1NI3 A;  2MRP A;  4RGO S;  2KN4 A;  3Q8A A;  2WXQ A;  2N1W A;  1FXT B;  4ASW C;  2L0F A;  2RPV A;  1E7V A;  1XF5 L;  3EUB 2;  2MQJ A;  3NZU A;  2M1M A;  3B08 A;  3WAP A;  2AQ1 B;  1J0G A;  2K6Q A;  4I6L B;  2BS4 B;  2KWD A;  5D94 A;  1LM8 B;  4EKU A;  3L10 B;  4C7Y A;  2EMS A;  2QDF A;  4XDD A;  1RFA A;  2N7E A;  4MJS B;  2N7D A;  4LTU A;  2TSS A;  4BFR A;  4ICU A;  4DDI D;  5CHW A;  2G1E A;  5JZE B;  3KUZ A;  4BOZ B;  1T3Q A;  4WH4 A;  3PPA A;  2LHE A;  2W3S A;  4FJY A;  4EFO A;  3NS8 A;  4AS1 A;  1XD3 B;  3PZ7 A;  1SIF A;  4NAM A;  3A9K A;  4NJC A;  4M8N A;  2EEL A;  2BB5 A;  1M94 A;  1E7P B;  3DVN V;  4MSQ B;  1ZW7 A;  2V9H A;  4BKT A;  3RCZ A;  4MGK E;  1WGH A;  3DQV A;  4I6P A;  3APC A;  3EA6 A;  3L54 A;  4US9 A;  3M63 B;  2AX5 A;  4RH6 A;  3N1X C;  3ZDT A;  1SE3 A;  2ONQ A;  3OJ4 B;  3A4R A;  4W9G A;  2ZCB A;  4XWT A;  1TS4 A;  1UUP A;  2KZR A;  2WU2 B;  3DBS A;  3OLM D;  5CTR C;  3J9C A;  4GDK A;  4KSK C;  3Q8F A;  3BY4 B;  4HCN B;  3URY A;  3KLS X;  2O6V D;  3H8H A;  2DZI A;  3NVY A;  4Q2J A;  5MPO A;  3M3J A;  3MTN B;  4ZHP A;  1QOG A;  1I4G A;  4HRS A;  5LNK 1;  1PUT A;  5FR6 A;  3UI3 A;  4KGS A;  2BWE S;  4RF1 A;  2M8S A;  1P7F A;  2MA9 B;  3PV1 A;  3NZS A;  1QZE A;  3IHP C;  3U7Z A;  4A20 A;  2O2V B;  2LVO A;  2I1J A;  2LUM A;  1E8W A;  2GBR A;  4FLH A;  1DOY A;  1C79 A;  2L3Z A;  3PVL A;  2K39 A;  4O1N A;  1BUI C;  1C4A A;  2BKF A;  3L13 A;  3MJ5 A;  4HJK A;  1GOZ A;  5EE0 A;  2B3A A;  2EMT A;  3KQ4 A;  4W9E A;  1F0Z A;  5GMV A;  2LD9 A;  5DPT A;  2KWU B;  2KMM A;  2NTS A;  4S17 A;  3H7P B;  2E6X A;  3V61 A;  2WYQ A;  4AJY B;  1I7H A;  1ZDV A;  1UEL A;  3DBH B;  4ANV A;  5HFY A;  2LVP A;  2LZ6 A;  2ZJD A;  1OFF A;  2K8B A;  3ML8 A;  2WXG A;  3U7D A;  5T8I A;  4F8C B;  2XBB C;  4B0M A;  1EF5 A;  1L0Y B;  2INC C;  3O65 B;  2XK5 B;  1L6U A;  3DVG Y;  2JRI B;  2IO3 B;  3BK2 A;  4TV3 A;  1NDD A;  1I42 A;  1NYQ A;  5HG2 A;  1Z5S B;  3Q3O C;  4NAW B;  4LLG M;  3PRM B;  3PZD A;  4XZ4 A;  5D3I B;  2RMM A;  1XLP A;  1R4M I;  1HA5 A;  3U4E G;  4B95 A;  2NMQ A;  1VZ7 A;  4R3D A;  2VH2 A;  2REX A;  3N20 C;  5C2T B;  2G3Q B;  2M0A A;  1FNV A;  4BKG A;  1FFU A;  1B1Z A;  4F7Z A;  2YLM A;  4ZRK A;  1XQQ A;  2JUO A;  3D32 A;  4P7I A;  1LGR A;  1JWU D;  3B0A A;  3TSS A;  2JXX A;  3KUD B;  1V5O A;  1C1Y B;  3PLU A;  1LQB A;  1HTO A;  3GE3 C;  4RNA A;  2PIA A;  1YN3 A;  4BBN C;  5D3D A;  2Q5W D;  5BMI A;  1WFY A;  2OED A;  2M4N A;  3BYY B;  1I4Q A;  2Y3A A;  4MT5 A;  1EM7 A;  1NVI D;  3RPF C;  1SXT A;  2BPS A;  1TY2 A;  3P4Q B;  2KC2 A;  4JLC A;  5G5H A;  1FO4 A;  4A90 A;  2IGG A;  3P42 A;  4G3X B;  1V1O A;  2LXC A;  2JYE A;  4PS3 A;  2OJR A;  5GXG B;  1P3Q U;  4MGZ E;  3JW0 X;  3NY5 A;  4B9K A;  1ZPS A;  3NVZ A;  3I5J C;  1UGM A;  4P1B C;  3ZRF A;  2MP2 B;  2KTF A;  2KD0 A;  3P63 A;  3Q3F A;  4MM3 B;  2KJR A;  3PHW B;  5AZF A;  2WDV B;  2Z8L A;  4USA A;  3SEB A;  3EFC A;  2V3P A;  4JQW C;  4RF0 A;  1ET6 A;  1OQY A;  5H8Y E;  1TKE A;  1C76 A;  3ZJT A;  4DDG D;  1RRB A;  2A5U A;  3UQB A;  1FRR A;  2JX5 A;  3RNF C;  4AQ7 A;  1Q1O A;  1KOT A;  1TKY A;  3VAW A;  4DQO C;  1YJJ A;  5C1Z A;  1K53 A;  3RMK C;  2YEP B;  3QCA A;  4GB9 A;  4WQO B;  5AZG A;  3FIL B;  2O6V B;  3L0W B;  5FK9 C;  1FEH A;  1R4N I;  3APF A;  1QKZ A;  2LJ5 A;  2FUG 1;  3VTU A;  5JXV A;  1V80 A;  2WDQ B;  3Q69 A;  2NS5 A;  4IM0 A;  1TZ1 A;  2KAJ A;  2K8C A;  1OEY J;  3ZJV A;  1N62 A;  1YN4 A;  4ZRJ A;  3SFD B;  3X23 A;  4CHK A;  4RGT A;  2BVC A;  3ETR A;  1WGK A;  3NVV A;  4TQ0 A;  1JRO A;  2D3C A;  4WWP A;  1P1A A;  2K8H A;  3HK0 A;  1AAR A;  1WGR A;  1ZDX A;  4CQN A;  3QC8 B;  4KZC A;  3VRB B;  1T5X D;  2LGD A;  2Z0D B;  3AEC B;  5E6P A;  2PE9 A;  3QQ8 B;  2WDT B;  2D5G A;  4ZOH C;  1YX6 B;  2UYZ B;  4MDK E;  1WXA A;  1IBX B;  4UDU C;  2ZPN A;  2KJH B;  1FPY A;  1XEE A;  3OG5 A;  2DYB A;  1V6E A;  3LB8 C;  1H8C A;  2IBI B;  4II2 B;  4IWQ A;  4W9L A;  2SAK A;  4W9C A;  2GOW A;  2JSV X;  2L00 B;  1G6J A;  1ZE3 D;  1FCL A;  2AQ3 B;  3ZNI D;  2KX3 A;  3Q2A C;  1RWS A;  3RT3 B;  1ZKH A;  3DVG X;  2N9L A;  3AUL A;  3N3K B;  3UIN B;  4AWJ A;  3VVW B;  1WJ6 A;  1OQR A;  3ABV B;  4ZRI A;  2HTM E;  2YVC A;  2C9W B;  1MHH E;  1HE8 A;  2X38 A;  1VRA B;  2ZNV C;  2LFI A;  3P4R B;  4LDT D;  2NR2 A;  1R4M B;  2N4F A;  2KQ7 A;  1TTN A;  2DEN B;  4YSY B;  2FCM A;  3RD2 A;  1HXY D;  3PGE A;  3R7R A;  1MJD A;  2AEH A;  4DK5 A;  2DWQ A;  4DXF A;  3IAS 1;  3AE3 B;  1XCT L;  2BS3 B;  2JVC A;  4MEM A;  4OZC A;  2WXJ A;  5LXI B;  4MJS A;  5C23 A;  2GBK A;  2RGF A;  4LNK A;  3ZLZ A;  3C8Y A;  3L16 A;  4D2K A;  2ZNV B;  3T3O A;  4FA6 A;  1RM6 C;  3RNA C;  1Q5W B;  3UQA A;  2GBN A;  4HPP A;  4LCD E;  2WGS A;  4WUR A;  1KF6 B;  1SJE D;  2JWZ A;  2NBV B;  1TZO A;  3MHS D;  2W3R A;  4E71 A;  2K6D B;  3P1M A;  4GDL B;  5G55 A;  5BYQ A;  4NJ6 A;  4OZB A;  3VH3 B;  1KLU D;  2WX1 A;  1YX5 B;  1L6V A;  1YOV B;  2ZPY A;  1HEZ E;  2KQS A;  4WAF A;  1D3Z A;  1KLG D;  5J17 A;  4J3O D;  1NBF C;  3PHX B;  3ZNZ B;  1VD2 A;  2V3N A;  4DHZ E;  2ZEQ A;  2WU5 B;  4REZ A;  2KQ4 X;  2D11 A;  2DZM A;  3NG0 A;  1MI0 A;  2N9P C;  3W1S C;  2ASQ A;  2XNA C;  3K9O B;  4IWO A;  1FCC C;  3ZXV A;  1VR9 A;  2NPT B;  3EC8 A;  1UWX A;  2BWF A;  4ACF A;  4TKN A;  1SB3 C;  3JYU A;  3VTV A;  2V4I B;  1L2N A;  2KHW B;  2DYM A;  4MGI E;  1HQR D;  3A1Q B;  3Q3M C;  1N5W A;  4WIP A;  1P98 A;  4HWI B;  4YL8 A;  1N63 A;  2LEK A;  2W54 A;  3JSV B;  4LJO B;  4FN2 A;  2ACZ B;  4EOY A;  3PTF C;  1SE2 A;  1I35 A;  1E8Z A;  4W9F A;  3R3M A;  2NBW B;  2MX2 A;  3H6N A;  1R4N B;  2OHF A;  1OGW A;  2KTR B;  4ICV A;  3A9J B;  3H7P A;  2LGI A;  5IP4 D;  1CQV A;  5EDS A;  3M62 B;  2N0S B;  4X57 B;  2J7Q B;  2KVR A;  3VHT C;  3C0R B;  3VTW A;  1PFD A;  3DVN U;  1SJH D;  3TIX A;  2J0K A;  4YTM B;  3AE5 B;  2SEB D;  1V5T A;  3P2B A;  4GIV A;  4KVG B;  2PTL A;  3AE9 B;  2XK5 A;  3TL5 A;  1GAQ B;  4TQ1 A;  2QJL A;  4ITK A;  5IAA C;  2K0P A;  2KWC A;  2UWQ A;  4NAW A;  5JHA A;  3HUI A;  2LGX A;  2WXP A;  3U2S C;  3R2I A;  3SR6 A;  1I4X A;  2MJ3 A;  2JZP A;  2WXL A;  2C7H A;  4IC7 B;  4CO7 A;  5DPS A;  2DNF A;  1WRI A;  4OVU A;  1C9F A;  2KDB A;  4ZYN A;  1FIQ A;  2INN E;  2K3U A;  2IPK D;  1TIF A;  2KMC A;  4BKS D;  2MJE A;  2MSE D;  3ZDM C;  2JZZ A;  3ZYY X;  1YQ3 B;  3RZW C;  3IFW B;  2IO2 B;  4AUQ C;  2KKC A;  4HVB A;  1GB1 A;  3WAN A;  2BTE A;  3RNB C;  3NHE B;  2W55 A;  3R2T A;  4J6I A;  1I4P A;  1D6E C;  4FJV B;  1IUE A;  3NZ3 A;  3AE7 B;  2IO1 B;  4M02 A;  3WAO A;  2N9K A;  1D5M C;  1PYW D;  3WIM A;  2MW5 A;  3QHT A;  1P7E A;  4ZRQ A;  2V0G A;  1DOX A;  2OOB B;  2IYD B;  1RAX A;  3BVM A;  4WWO A;  1QIL A;  4GOC A;  1WGD A;  1NEK B;  3MP9 A;  4HEA 1;  3N9Y C;  1PQS A;  3QJZ A;  2JF5 A;  1K51 A;  3ZTD A;  4ANU A;  1D5Z C;  4DXG A;  2WWZ A;  2MP2 A;  4MM3 A;  1E7U A;  5E6O A;  1C78 A;  2PKO A;  3AE6 B;  2H89 B;  3DWM A;  2PVO D;  2MBH A;  3BII D;  3V6E B;  3PRZ A;  2DYO A;  2WXK A;  3R8B A;  3AEE B;  1MG8 A;  3Q3N C;  2IND C;  4C4V B;  3IT6 B;  1GG3 A;  3DBL I;  3AN1 A;  2V1Y A;  4GSW A;  3ZKJ C;  2L52 A;  2RR9 A;  4PK1 A;  4DXA B;  4YTP B;  5BO4 B;  3TEZ A;  3I63 C;  4XWW A;  2HJ8 A;  3L17 A;  1L0X B;  4WWM A;  2GI9 A;  1V97 A;  5EE3 A;  4JPS A;  4JWS C;  2KWV B;  3BVG A;  1WMH B;  1WF9 A;  1IPG A;  3FIL A;  2O6V A;  3VRA B;  1BML C;  3BIN A;  3Q8E A;  1YD8 U;  4NQL B;  1JML A;  2QIE B;  1QT9 A;  3QX1 A;  2AL6 A;  5BMG A;  4JX1 C;  3AV8 A;  4EUT A;  2LI5 A;  2PLP A;  1WGY A;  3GOE A;  1XLQ A;  2JPH A;  3TMP B;  1FXA A;  4HK2 A;  2L32 A;  3S2A A;  4E3C A;  2NBU A;  3UIP B;  4EZJ A;  3SD5 A;  2MHJ A;  1IP9 A;  1DGJ A;  3ALB A;  3NRZ A;  2C7N B;  1L5P A;  3UF8 A;  4PT5 A;  1LFD A;  1T0Q C;  4KDL B;  4XGA B;  4HJG E;  4KIK B;  2HE7 A;  4HDQ A;  1CK1 A;  2DZJ A;  5BMH A;  3IBE A;  2KNB A;  1FFV A;  3AXC A;  3A9K B;  1E6E B;  2LAS A;  3I9V 1;  3EEC A;  1WM2 A;  2PW9 A;  2BYV E;  2QSD A;  1IBX A;  2M19 A;  4W9K A;  1E0Z A;  5AZH A;  4OVV A;  2KX0 A;  1UH6 A;  4IDI A;  2WHI A;  1PDX A;  2QCZ A;  2FCQ A;  2XN9 C;  3FKY A;  4QAY A;  4BBN F;  3RZF A;  3SHQ A;  4HPM B;  1EWC A;  1LO5 D;  1AWD A;  1XLO A;  1S1Q B;  2FAZ A;  4E74 A;  1F52 A;  2FIF A;  3GS2 A;  2N7J A;  4RM8 A;  2KDE B;  2ZVN A;  4FHJ A;  3KYD D;  2WXM A;  4GLS C;  1A5R A;  1XT9 B;  4DBG A;  2HD5 B;  2BBC A;  4L23 A;  1F2R I;  3EFU A;  1GUA B;  4K7W A;  1TBE A;  4GXB A;  5EE1 A;  3TJP A;  5J2R A;  3HRD D;  1E90 A;  4YXD B;  3K9P B;  3A33 B;  1F1H A;  2YEP F;  4IWP A;  2I2Y A;  1YIW A;  4K7S A;  2BQQ A;  2WXN A;  1OTR B;  3C19 A;  1VLB A;  2Z59 B;  3WAM A;  2HDE A;  4C56 C;  2K9X A;  1JWM D;  3NS1 A;  2R61 A;  1AN8 A;  1WSP A;  3MC0 B;  1RLF A;  4ZYS A;  1SE4 A;  3W9C B;  4HRO A;  2L05 A;  3W1Y A;  3H7S A;  3P4P B;  4TSS A;  4C7Z A;  4LNN A;  3RNC C;  1KRH A;  4HDO A;  2BF8 B;  3VDZ A;  5IO9 A;  1YN5 A;  4EEW A;  1EWY C;  2QC8 A;  3N32 A;  1UBQ A;  2CU3 A;  3SDL C;  1FRD A;  1WX8 A;  3V6C B;  3ZXR A;  1DOI A;  3H9D A;  4ZRP A;  5EE9 A;  3KW5 B;  4GDL A;  4LNF A;  3ONS A;  2M0X A;  1MFW A;  2JU6 X;  2DHZ A;  2HJ1 A;  1GNU A;  4OW0 A;  1STE A;  1JCK B;  3N30 A;  1FMA D;  1TT5 B;  2QHO A;  4K81 A;  1ZXH A;  3ZUN A;  4MH0 E;  1EUV B;  1WM3 A;  3AEB B;  1V2Y A;  3KVF B;  3SU8 X;  2NPT A;  1PGX A;  3E9S A;  4G50 A;  2LGY A;  2INP E;  2NTT A;  4IM3 A;  4ARI A;  2CS4 A;  2IY1 B;  3DBL B;  3RUI B;  1ET9 A;  1WJN A;  3A1Q A;  1SSN A;  2XEW A;  1WZ0 A;  4KZ0 A;  1UNS A;  2ZW0 A;  1JQ4 A;  1UZX B;  2GBM A;  4US8 A;  1N6Z A;  3JSV A;  1I4H A;  1WXV A;  3W1S A;  2W82 A;  3BK1 A;  1JRP A;  4DWF A;  4OZA A;  4RMA A;  2KTR A;  3HIZ A;  2FNJ B;  3ZGZ A;  4YT0 B;  4EE2 A;  2GMI C;  1ROE A;  1KJT A;  2BT6 A;  3V60 A;  4FAD A;  2GB1 A;  4BZA A;  1U4A A;  4ANX A;  3GE8 C;  1TKG A;  3Q8C A;  4IUM B;  1WWT A;  2CR5 A;  4W9I A;  1JWS D;  1C77 A;  3IVF A;  3ZO5 B;  3ECI A;  4XE0 A;  3VFK A;  1X1M A;  4L2Y A;  1NYR A;  2VRR B;  3PS6 A;  2CJN A;  4N6E B;  2D3A A;  3IXS A;  3AM9 A;  1ISN A;  3CWI A;  4M00 A;  2FID A;  3TEX A;  2L0T A;  3PRP B;  3L08 A;  3Q3J A;  3VR8 B;  4B0E A;  1F2R C;  3TEW A;  1OQQ A;  2FBW B;  1WR1 A;  2MWS B;  2W9N A;  3ENE A;  1F77 A;  1ZGU B;  2KAN A;  4KDI C;  2KAC A;  3APD A;  4W9H A;  1M4V A;  2FCN A;  2J42 A;  4M8M A;  1Q0W B;  2BGF A;  3Q6B A;  2L76 A;  3GZN I;  2KDM A;  3MC8 A;  3VXW A;  3KH0 A;  1V1P B;  4WAA A;  3W5V B;  1E9M A;  3UIO B;  1UD7 A;  4N59 A;  5BYS A;  4KKI A;  1IGD A;  2IO0 B;  3PRE A;  4IKG A;  1Q10 A;  1WXM A;  4W9J A;  1XCQ L;  3ZW3 A;  3AI5 A;  3ML9 A;  1EO6 A;  1YJ1 A;  4S0R A;  2LMC A;  2LJI A;  3AED B;  2BYF A;  2ON8 A;  3PZ8 A;  2WXO A;  1WI0 A;  3ZVV A;  2GRI A;  3GP7 A;  1DYQ A;  4M0W B;  2BYE A;  2JY6 A;  3IT4 B;  2DAF A;  2O2V A;  3RFZ B;  1FXI A;  1UF0 A;  3AEA B;  4TUU A;  4WJP A;  2Y5P A;  4JWU C;  3AE2 B;  4MSM B;  4PS8 A;  4AJW A;  1NEN B;  1WRD B;  2CHZ A;  1K50 A;  2JT4 B;  2J53 A;  3T3N A;  3DDC B;  4II3 B;  2EKE C;  2VH1 A;  3HM3 A;  2AQ2 B;  3OAW A;  4HKQ A;  2N9X A;  1N5X A;  1V8C A;  1VCB A;  2LUE A;  3R7Q A;  4C4V A;  4G11 A;  2D10 A;  2PMV A;  1GC6 A;  1L7Y A;  1E10 A;  3PT2 B;  1FNW A;  2L83 A;  5CX3 A;  3IG3 A;  3CSF A;  3AEG B;  2WP9 B;  5TSS A;  4JGH B;  2RDH A;  1WMH A;  2MCN B;  3MFG A;  2MJD A;  4YWG G;  2IZV B;  4K7U A;  1B9R A;  1UBI A;  2K22 A;  3DHH C;  2IGD A;  2KJ6 A;  3ZJU A;  3TBL D;  1SGH A;  1P9D U;  1WJ4 A;  2PEA A;  2WDR B;  4YSX B;  1ZUD 2;  2BS2 B;  4HPL B;  2PE6 B;  3V05 A;  2KXJ A;  3ZIM A;  2E3T A;  1VZ8 A;  1Y8R C;  1CJE A;  4K1R B;  3T9L A;  1JWA D;  2KK8 A;  3FC4 A;  3B1L X;  5D2M B;  2N9E B;  1T0R C;  3LXF A;  2DLB A;  3H1U A;  3PLV A;  4NY0 A;  2IJ0 A;  5DPW A;  4KIK A;  1V9J A;  2MBE A;  2RSU A;  1WGG A;  4IM2 A;  5IKC M;  4MH8 A;  1N60 A;  2B76 B;  3HVD A;  4BOS C;  4PYU A;  1TJE A;  4RFB A;  3PO0 A;  1A70 A;  1YJI A;  1WR6 E;  3V3X A;  3JVZ X;  1J19 A;  1JWB D;  4JIO U;  3EHV A;  4ZHO A;  3B2G A;  3DHG C;  4LDT B;  5FKA C;  2Z0E B;  1IYF A;  5CHV C;  1PGA A;  1WXQ A;  4WJQ A;  3U8Z A;  5J18 A;  2J52 A;  4KV2 A;  4RM9 A;  4GN1 A;  2BW2 A;  2MBQ A;  3DHI C;  2PVG C;  5HKH A;  2LWP A;  1R7S A;  3DPD A;  4GMV A;  2DZK A;  2KFK B;  3TUO A;  2J4X A;  1XLN A;  1WIA A;  1J7B A;  4WJN A;  5BYR A;  4NZL B;  3MHZ A;  1YQ4 B;  2ZZP B;  2QIL A;  5AUK A;  1T0Y A;  2M17 A;  1I4R A;  1HZ5 A;  3I3T B;  4AP4 C;  4HKZ E;  2VZK D;  3UGB B;  1TS2 A;  4XDC A;  3RYT A;  1RYJ A;  2L8J A;  4P1C C;  2C7M B;  1NI2 A;  4A6Q A;  1E8X A;  2M56 B;  1AYF A;  4KGT A;  2D3B A;  3KWL A;  4HCP B;  4H2A A;  3I57 A;  2G4D B;  4A3O A;  2LGS A;  2IY0 B;  1TGZ B;  4DHJ D;  2R2O A;  3GZN B;  3BYT B;  4W9D A;  3MJW A;  1VDV A;  1MVK A;  2KDF B;  2H88 B;  4BKS A;  4C00 A;  2UU7 A;  4XX5 A;  1UGJ A;  3QWZ B;  5IA7 A;  2KYW A;  4N58 A;  1V81 A;  1AW7 A;  2JRH A;  4FHK A;  2CU1 A;  1TS3 A;  3QK0 A;  1QLB B;  2MBO A;  1L4D B;  2AYO B;  1UWM A;  1P0R A;  3NUH B;  3X0W A;  4RGN A;  2BYT A;  4I6N B;  4P16 A;  2ZW1 A;  3BVZ A;  3ZTC A;  1SF0 A;  5LLI A;  1T0S C;  4GGQ A;  2ZCC A;  3BWU D;  3EGR A;  1ZP0 B;  2KMA A;  3QIJ A;  2G4S A;  3AEF B;  4A8X C;  5CHF A;  3N1Z C;  3RI7 C;  3LYY A;  2WXR A;  3A4S C;  1TS5 A;  4HXD A;  1WYG A;  5IN7 A;  4A3P A;  1QF6 A;  1J7C A;  2D07 B;  4OHJ A;  2LXA A;  4NNJ B;  1YMH E;  2L1A A;  3DBR B;  4K3C A;  5C3J B;  4DHZ B;  1F9J A;  3NVW A;  1CMX B;  3OJ3 A;  3T8M A;  3VR9 B;  1C4P A;  3ZNG C;  3BZD B;  2KO3 A;  1VJK A;  1JW9 D;  4GDK B;  5G2N A;  5E6J A;  1YQB A;  3GB1 A;  3OWE B;  1KH0 A;  3B2F A;  3AE8 B;  2MEK A;  3AE1 B;  1BT0 A;  2BKR B;  1WZ3 A;  4NJ7 A;  5JHB A;  4IG7 B;  3U52 E;  1TY0 A;  1SEB D;  2WX0 A;  3WAL A;  1TYG B;  4URK A;  5AUI A;  2KLG A;  2G9H D;  4PS7 A;  2EKI A;  2KVZ A;  3WA0 A;  2DX5 B;  1KTK A;  3M95 A;  2JYT A;  2NVU I;  4XC2 A;  1Y56 A;  3HM6 X;  3LJ3 A;  4KKJ A;  1ZXI A;  3WCQ A;  2PPH A;  1GJZ A;  1YNT E;  2ZVO A;  3E56 A;  5AEK B;  1MHX A;  1WY8 A;  3DWG C;  1N61 A;  4A55 A;  1D5X C;  3HHM A;  4L1B A;  3AMZ A;  1J7A A;  4CYE A;  1EU4 A;  4TMA B;  4KSL C;  1BXT A;  2CJO A;  1EU3 A;  1GPX A;  2A4Z A;  2D3G A;  5KHO A;  2QMT A;  1CZP A;  3AU4 A;  3AE4 B;  1S3S G;  2Y5B B;  4WJO A;  2K25 A;  1E5W A;  1WH3 A;  4BVU C;  1QQR A;  2WQY B;  1WJU A;  2J0M A;  4WQM A;  3MC9 A;  2WXF A;  3RN9 C;  2V4L A;  4PYZ A;  4BAX A;  3L4P A;  1C3T A;  2OJW A;  1JRU A;  1V1P A;  3RNE C;  2FUH B;  4IW0 A;  1D4B A;  1QOB A;  2C60 A;  3VUX A;  2VZK B;  3AB5 A;  1PGB A;  1Z2M A;  2WNM A;  3AU5 A;  1WX7 A;  2KN5 A;  2LRU A;  3Q8B A;  4NQK E;  1L4Z B;  2RD0 A;  2CHW A;  3CMM B;  1FNU A;  5FR3 A;  4DHJ B;  2MH7 A;  1JAL A;  4MEL A;  1SBB B;  2KT7 A;  2X8X X;  2LRW A;  2KDI A;  4FUL A;  4M0W A; 
#chains in the Genus database with same CATH homology
 1IUE A;  1XO3 A;  2WXO A;  2Q5W D;  3NZ3 A;  2GRI A;  2ICI A;  5BMI A;  1ESF A;  3GP7 A;  3AE7 B;  2OED A;  1DYQ A;  3P4S B;  3BYY B;  2N9K A;  1I4Q A;  2Y3A A;  3IT4 B;  4MT5 A;  3RFZ B;  1L0V B;  1D5M C;  1PYW D;  1EM7 A;  1NVI D;  1FXI A;  1P7E A;  4ZRQ A;  1K52 A;  3RPF C;  2V0G A;  1DOX A;  2QEJ C;  1SXT A;  3AEA B;  5HHD G;  3BVM A;  1TY2 A;  3P4Q B;  3AH7 A;  5G5H A;  2Y5P A;  4JWU C;  1FO4 A;  2JQR B;  3AE2 B;  4A90 A;  3IAM 1;  1QIL A;  4MAC A;  2IGG A;  1NEK B;  2K5P A;  3MP9 A;  3N9Y C;  3P42 A;  4HEA 1;  1NEN B;  1V1O A;  2JYE A;  1K51 A;  1K50 A;  1D5Z C;  4DXG A;  3W2D A;  5GXG B;  4P6V F;  2J53 A;  2LHD A;  3VQI A;  1ENF A;  2IGH A;  3T3N A;  3SFE B;  1ZPS A;  3B9J A;  3NVZ A;  2AQ2 B;  1C78 A;  2PKO A;  1HZ6 A;  4HKQ A;  1N5X A;  3AE6 B;  4ARC A;  2H89 B;  1V8C A;  3DWM A;  3P63 A;  4MM3 B;  2PVO D;  3BII D;  2DYO A;  2WDV B;  2WXK A;  2PMV A;  3FAH A;  3R8B A;  2Z8L A;  3AEE B;  1E10 A;  4USA A;  1QOA A;  3IT6 B;  1FNW A;  2L83 A;  3SEB A;  2V3P A;  2JWU A;  3ZQ4 A;  3AN1 A;  2RDG A;  2L52 A;  2WXH A;  4RF0 A;  1ET6 A;  1MPE A;  5H8Y E;  1TKE A;  1C76 A;  4KX6 B;  3ZJT A;  4YTP B;  3AEG B;  4FXC A;  3TEZ A;  2WP9 B;  5TSS A;  4XWW A;  2RDH A;  1FRR A;  2JX5 A;  4AQ7 A;  1L0X B;  4WWM A;  3MFG A;  2GI9 A;  4A9A A;  1V97 A;  5EE3 A;  4JPS A;  1TKY A;  2MJD A;  4YWG G;  5G5G A;  4DQO C;  4JWS C;  1B9R A;  2K22 A;  1YJJ A;  3BVG A;  3VRA B;  3FIL A;  2IGD A;  1BML C;  5HI1 A;  3Q8E A;  1K53 A;  2YEP B;  3ZJU A;  1FD6 A;  1JML A;  1T6B X;  2WDR B;  3FIL B;  2QIE B;  4YSX B;  1QT9 A;  1ZUD 2;  2BS2 B;  1GB4 A;  3V05 A;  5I4D A;  4JE3 B;  3KWV A;  5FK9 C;  1FEH A;  5BMG A;  2E3T A;  4JX1 C;  3AV8 A;  1VZ8 A;  2PLP A;  1QKZ A;  1CJE A;  1RFK A;  2FUG 1;  2IDY A;  4LK0 M;  1JWA D;  1XLQ A;  3FC4 A;  5JXV A;  2WS3 B;  1FXA A;  4IOI E;  2WDQ B;  2L32 A;  3LXF A;  3Q69 A;  2DLB A;  2KAJ A;  2IJ0 A;  2WLB A;  1DGJ A;  3NRZ A;  2FE8 A;  3HVZ A;  3ZJV A;  1L5P A;  1N62 A;  1YN4 A;  4MH8 A;  2BB6 A;  1N60 A;  1ZOY B;  4PT5 A;  3SFD B;  2B76 B;  3HVD A;  1TJE A;  4HJG E;  5H92 C;  4RFB A;  3PO0 A;  4RGT A;  1A70 A;  1YJI A;  3V3X A;  5D7G A;  1CK1 A;  1VZ6 A;  3ETR A;  4OVZ A;  4KGR A;  5BMH A;  1JWB D;  1WGK A;  3NVV A;  4ZHO A;  3B2G A;  4TQ0 A;  1FFV A;  1JRO A;  1E6E B;  3I9V 1;  5FKA C;  1C4C A;  1PGA A;  1WXQ A;  1ZDX A;  4YSZ B;  2PW9 A;  2J52 A;  4CQN A;  3VRB B;  2QSD A;  1T5X D;  1IBX A;  2JXT A;  2M19 A;  3AEC B;  1E0Z A;  2WXI A;  2BW2 A;  2D5G A;  2PVG C;  4ZOH C;  3TEY A;  4IDI A;  1R7S A;  1IBX B;  4C80 A;  1PDX A;  2XN9 C;  4UDU C;  1KFY B;  4RCO A;  3O13 A;  2I38 A;  1XEE A;  3TUO A;  1SIJ A;  2J4X A;  1XLN A;  4RGM A;  1EWC A;  1J7B A;  1LO5 D;  3LB8 C;  3W5U B;  5BYR A;  4NZL B;  2SAK A;  1AWD A;  3MHZ A;  2JSV X;  1XLO A;  2DBY A;  1YQ4 B;  2QIL A;  5AUK A;  1ZE3 D;  1FCL A;  2AQ3 B;  1I4R A;  3GS2 A;  1QOF A;  1HZ5 A;  2N7J A;  4HKZ E;  1RWS A;  2VZK D;  1ACC A;  1TS2 A;  4XDC A;  2WXM A;  2Y5C A;  4GLS C;  2N9L A;  1RYJ A;  2BBC A;  4L23 A;  1F2R I;  1IGC A;  1XXG A;  4A6Q A;  1OQR A;  2M56 B;  3ABV B;  4YTN B;  5EE1 A;  1AYF A;  4KGT A;  3KWL A;  4H2A A;  2HTM E;  3CIR B;  1MHH E;  2X38 A;  3I57 A;  1VRA B;  2LFI A;  3HRD D;  4YXD B;  3P4R B;  3BYT B;  2YEP F;  2I2Y A;  1FM0 D;  2WXN A;  1NI3 A;  1VLB A;  1VDV A;  1MVK A;  2HDE A;  4C56 C;  2H88 B;  4YSY B;  4RGO S;  2KN4 A;  2K9X A;  1HXY D;  1JWM D;  3NS1 A;  3Q8A A;  2R61 A;  2WXQ A;  1AN8 A;  1WSP A;  3MC0 B;  2DWQ A;  4DXF A;  3IAS 1;  1UGJ A;  4ZYS A;  2RPV A;  1SE4 A;  3AE3 B;  3W9C B;  1XCT L;  1XF5 L;  2BS3 B;  3EUB 2;  4HRO A;  4OZC A;  4N58 A;  2AQ1 B;  3P4P B;  2WXJ A;  4TSS A;  1AW7 A;  4C7Z A;  1KRH A;  1TS3 A;  2BS4 B;  2KWD A;  1QLB B;  1YN5 A;  3C8Y A;  4C7Y A;  4XDD A;  1L4D B;  4D2K A;  3T3O A;  1UWM A;  3NUH B;  1EWY C;  4RGN A;  4LTU A;  1RM6 C;  2BYT A;  2CU3 A;  4P16 A;  2TSS A;  1FRD A;  2ZW1 A;  3BVZ A;  2G1E A;  1DOI A;  4WUR A;  1KF6 B;  1SF0 A;  4ZRP A;  5EE9 A;  1SJE D;  1TZO A;  3BWU D;  2JU6 X;  1T3Q A;  3EGR A;  2W3R A;  4WH4 A;  1ZP0 B;  2LHE A;  3P1M A;  4OW0 A;  4GDL B;  2W3S A;  5BYQ A;  3AEF B;  4A8X C;  1STE A;  4OZB A;  3LYY A;  2WXR A;  1JCK B;  1KLU D;  4AS1 A;  3PZ7 A;  1FMA D;  4NAM A;  4NJC A;  1L6V A;  2EEL A;  2BB5 A;  1E7P B;  1TS5 A;  1HEZ E;  1WYG A;  1ZXH A;  4WAF A;  3EA6 A;  1KLG D;  4J3O D;  4US9 A;  1QF6 A;  1J7C A;  2AX5 A;  3AEB B;  4RH6 A;  4OHJ A;  2V3N A;  1SE3 A;  2WU5 B;  2ONQ A;  4REZ A;  2KQ4 X;  1YMH E;  1MI0 A;  2L1A A;  4XWT A;  1PGX A;  1TS4 A;  1UUP A;  2WU2 B;  3E9S A;  2INP E;  2NTT A;  2XNA C;  5C3J B;  1FCC C;  1VR9 A;  4ARI A;  1UWX A;  3NVW A;  3J9C A;  3VR9 B;  3Q8F A;  1C4P A;  3URY A;  3BZD B;  3KLS X;  3NVY A;  3H8H A;  4Q2J A;  1ET9 A;  5MPO A;  1SB3 C;  1VJK A;  2V4I B;  1JW9 D;  2DYM A;  4ZHP A;  1HQR D;  1QOG A;  1SSN A;  4GDK B;  1I4G A;  1UNS A;  2ZW0 A;  4HRS A;  5LNK 1;  5E6J A;  1JQ4 A;  1PUT A;  4US8 A;  3UI3 A;  4KGS A;  1N5W A;  3GB1 A;  3OWE B;  4WIP A;  1I4H A;  1KH0 A;  3B2F A;  3AE8 B;  4RF1 A;  1N63 A;  1P7F A;  3W1S A;  2MEK A;  2W82 A;  3BK1 A;  2LEK A;  3AE1 B;  1JRP A;  2W54 A;  3U7Z A;  2ACZ B;  3U52 E;  4OZA A;  2LUM A;  1SE2 A;  1TY0 A;  1DOY A;  1C79 A;  1SEB D;  3ZGZ A;  4YT0 B;  1TYG B;  4O1N A;  1BUI C;  1C4A A;  3MJ5 A;  5AUI A;  4EE2 A;  2G9H D;  2OHF A;  1ROE A;  2BT6 A;  1GOZ A;  2EKI A;  5EE0 A;  3KQ4 A;  1KTK A;  1F0Z A;  2LGI A;  2GB1 A;  2JYT A;  1CQV A;  1Y56 A;  4KKJ A;  1TKG A;  1ZXI A;  2KMM A;  2NTS A;  3Q8C A;  3WCQ A;  2N0S B;  1YNT E;  1WWT A;  1JWS D;  2E6X A;  1C77 A;  1PFD A;  4XE0 A;  1I7H A;  1ZDV A;  3E56 A;  1MHX A;  3DWG C;  1SJH D;  1N61 A;  4A55 A;  4YTM B;  1D5X C;  3AE5 B;  5HFY A;  4L2Y A;  1OFF A;  4L1B A;  2SEB D;  1NYR A;  1J7A A;  3AMZ A;  2CJN A;  4N6E B;  2WXG A;  3IXS A;  1EU4 A;  3AM9 A;  4TMA B;  1BXT A;  2CJO A;  3CWI A;  1EU3 A;  2PTL A;  3AE9 B;  5T8I A;  1GAQ B;  4B0M A;  1GPX A;  4TQ1 A;  3TEX A;  2QJL A;  2QMT A;  1CZP A;  3VR8 B;  1L0Y B;  3AE4 B;  4ITK A;  4B0E A;  1L6U A;  2K0P A;  1F2R C;  3TEW A;  1OQQ A;  2FBW B;  3BK2 A;  1F77 A;  2KAC A;  3HUI A;  1QQR A;  1M4V A;  2WQY B;  1NYQ A;  2J42 A;  2WXP A;  4WQM A;  5HG2 A;  3U2S C;  2WXF A;  4NAW B;  4LLG M;  3L4P A;  3R2I A;  1V1P A;  2KDM A;  5D3I B;  3SR6 A;  1I4X A;  2RMM A;  1D4B A;  1QOB A;  1XLP A;  2MJ3 A;  2JZP A;  2WXL A;  2VZK B;  1HA5 A;  1V1P B;  1WRI A;  3U4E G;  3W5V B;  3AB5 A;  1C9F A;  1PGB A;  1E9M A;  2WNM A;  1FIQ A;  2NMQ A;  2INN E;  4N59 A;  2K3U A;  1VZ7 A;  4R3D A;  5BYS A;  2IPK D;  4KKI A;  1IGD A;  5C2T B;  2M0A A;  2MJE A;  4IKG A;  1FNV A;  3Q8B A;  1FFU A;  1B1Z A;  1Q10 A;  3ZYY X;  1YQ3 B;  1L4Z B;  1XCQ L;  1JWU D;  3TSS A;  1FNU A;  5FR3 A;  2MH7 A;  1GB1 A;  1JAL A;  1SBB B;  2BTE A;  4RNA A;  2LMC A;  2LJI A;  2PIA A;  2W55 A;  4M0W A;  1YN3 A;  3AED B;  1I4P A;  3R2T A;  1D6E C;  2ON8 A;  5D3D A;  3PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...