2IGDA

Anisotropic structure of protein g igg-binding domain iii at 1.1 angstrom resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
61
structure length
61
Chain Sequence
MTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Igg-binding protein
molecule keywords PROTEIN G
publication title Anisotropic Refinement of a Protein G Domain at 1.1 Angstrom Resolution
rcsb
source organism Streptococcus sp.
total genus 16
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1997-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2igdA00
5JXVA 1K50A 4IKGA 2N7JA 2ON8A 2JWUA 1K52A 1PGXA 3V3XA 5HHDG 1F2RI 2N9KA 3MP9A 4HKZE 4KGTA 2ZW0A 2NMQA 3GB1A 1D4BA 2GB1A 2LHEA 1YMHE 1P7EA 1ZXHA 2RPVA 1K51A 4MACA 1HZ5A 2IGHA 2JZPA 2PW9A 1IGCA 2OEDA 2PTLA 1IBXB 1JMLA 3UI3A 1EM7A 4OZBA 1HZ6A 1HEZE 2KWDA 1UWXA 2I2YA 1K53A 2IGDA 1GB4A 1FD6A 2ONQA 2QMTA 1C9FA 1PGBA 1YNTE 1IBXA 2JSVX 2J53A 4IOIE 1FCLA 2RMMA 4GLSC 4D2KA 2LGIA 1MHXA 2KQ4X 2EELA 4OZCA 2N9LA 1XCTL 1IGDA 2ZW1A 2I38A 5HI1A 2KN4A 1XF5L 1MI0A 4OZAA 1GB1A 1P7FA 4WH4A 3FILB 1XCQL 5HFYA 2PLPA 1QKZA 5BMIA 4KGRA 2IGGA 1KH0A 2JXTA 1MHHE 5BMGA 2JU6X 2LUMA 2K0PA 5BMHA 1Q10A 2QSDA 3FILA 1MPEA 1MVKA 1F2RC 4KGSA 2GI9A 4HJGE 1PGAA 1FCCC 2KDMA 2KACA 5HG2A 2J52A 2LHDA
chains in the Genus database with same CATH superfamily
5JXVA 2D11A 1NBFC 2BB5A 5IA7A 1UGJA 1Q0WB 1E8YA 4YTMB 4HDOA 4AQ7A 2BYEA 2CHZA 2Y5PA 3Q14C 2C7HA 5LNK1 2J7QB 1P7EA 1V8CA 4GDLB 3TEZA 3SFEB 4BOSC 3EGRA 3QCAA 3HHMA 1IBXB 3KUCB 4FA6A 3QQ8B 3N9YC 2CJNA 4DXGA 3GE3C 3MJWA 4FADA 4AS1A 3DVGY 3ZNZB 1A70A 5AEKB 5D3IB 2ZVNA 3JYUA 2RMMA 1V1PA 2PMVA 4WWNA 4BKSD 1P0RA 3P1MA 3MC8A 2I38A 2NBUA 1QOFA 4KKIA 3ZNID 2L0FA 3DDCB 3SR6A 4E74A 4CYEA 4DHJB 1UZXB 4GN1A 2V3PA 2O2VA 1YN4A 2Y3AA 1OEYA 1IYFA 1XCQL 1OTRB 4DK5A 4BZAA 3NZUA 4XGAB 4JWSC 3HM6X 2I1KA 2K6DB 1TY2A 1YJIA 2WU5B 2JXXA 2J4XA 2HE7A 5E6NA 3KWLA 3QC8B 2UU7A 1WYWB 3NG0A 2KJRA 1YJ1A 4FN2A 5JZEB 1AN8A 4LNKA 1SIFA 2BWES 1V6EA 3ZKJC 3RPFC 3BZDB 3DWMA 4OVUA 5G55A 2E3TA 1WM3A 3NJTA 2MBQA 1AARA 1XD3B 1XT9B 1HTOA 1SEBD 4HKZE 3RNEC 3T8MA 3AE3B 3R66C 4DDGD 1DOYA 4RNAA 1QILA 2GMIC 1Y8RC 1WMHA 3VTVA 1L0XB 2OEDA 2J42A 1E10A 4A6QA 3ZGZA 1WXSA 4UDUC 2BKRB 4NAWB 4XE0A 2WXRA 3SEBA 3NOBA 2L7RA 4F7ZA 4ZRJA 3Q8EA 3U30A 2HTHA 3DVNU 3ZLZA 3EECA 1YD8U 2MJ3A 1ZE3D 1SIJA 3B08A 3KYDD 4RMAA 2M4NA 2A5UA 2MWSB 2MBHA 4KDIC 4LCDE 4RCOA 3NVZA 3L54A 3EUB2 3NZ3A 4ZYSA 4KSLC 2WDVB 4II3B 3PREA 4GU2A 3KUDB 1EU3A 4LNFA 4WWOA 3FILB 1Z5SB 1ZGUB 4WJPA 1QKZA 2PJHA 4KGRA 3ZVVA 4AWJA 1S3SG 2KJ6A 4OVZA 2FNJB 2L52A 3PV1A 3R2IA 4KGSA 2L1AA 3PRMB 2GI9A 4BKSA 2L05A 2LGDA 5KHOA 3CSTA 3H7PB 3S2AA 3B0AA 5JHAA 1K50A 4NJ7A 4ICUA 4IW0A 4JQWC 4ZDVA 1WGRA 1ACCA 3AXCA 1WM2A 3H6NA 1LXDA 4ARIA 2FE8A 5E6OA 4IM3A 3VFKA 2WP9B 4PYZA 2AQ1B 2RPVA 3U8ZA 3L0WB 4US8A 2KN5A 1R4MI 1F0ZA 2K8BA 1P9DU 1VR9A 1WJUA 4YSYB 1WZ0A 2LRWA 1I4GA 1SE4A 3AE9B 4C4VB 3UI3A 2LGYA 1EM7A 2YVCA 3P4QB 4OZBA 4TUUA 1CZPA 3ZDTA 2L32A 1C9FA 3AH7A 2W3SA 5H92C 2IO3B 4II2B 1FCLA 3OAWA 3JSVA 2KQ4X 1TS2A 2K8HA 1EWYC 1WXVA 3ETRA 2LWPA 2WXQA 1JALA 4WQOB 3QIJA 1JCKB 1SSNA 1TS4A 3VH4B 5J18A 4H2AA 3AE2B 1SE2A 3AE7B 4JL9A 1WIAA 2IO0B 1DOIA 3BK2A 2XK5B 1GOZA 2JPHA 3R2TA 5HFYA 3CSFA 3IHPC 1WWTA 2WXIA 3QWZB 2JX5A 3IAS1 1KM7A 1EO6A 3NVWA 4XX5A 3R7RA 4FBJB 2V9HA 4W9GA 3AM9A 1TT5B 3MJ5A 4GGQA 4P6VF 3PLVA 3IFWB 2FCNA 2SAKA 1E9MA 4PS3A 5BO4B 1GJZA 2PE9A 4IKGA 1E7PB 3C8YA 2LASA 3SDLC 2WX1A 3WA0A 3E56A 2FCSA 2G3QB 4M02A 1HA5A 4LNIA 4KSKC 3DHIC 2LI5A 3R3MA 4GOCA 2LMCA 3OG5A 2KWVB 1N61A 3VQIA 3A9JB 4TMAB 2GBMA 4RGTA 3VUYA 4JIOU 1T3QA 1FRRA 1TZ1A 3I5JC 1QOGA 3AECB 3W5UB 1WXMA 1F9JA 2C9WB 1LGRA 5MPOA 1NDDA 4CQNA 4MM3B 1GPXA 1T5XD 2HJ8A 3KVFB 5G5HA 2KX3A 4NZLB 3ZDMC 1L0YB 1P1AA 3P42A 1ZDVA 3ONSA 3QARA 1PGBA 4ZRPA 3VDZA 3ZJTA 2WXLA 4LDTD 4JWUC 1ESFA 2WXKA 5E6JA 3IXSA 3AU4A 1TTNA 3BIID 1GC6A 1UBQA 4DXAB 4FULA 2L83A 4W9HA 3UQBA 1XO3A 4FLHA 4WIPA 2N4FA 4OZAA 2D2QA 1J0GA 2RR9A 3DBHB 3DBRB 2KO3A 4HRSA 2AQ3B 2ICIA 2RPQA 4CO7A 1MHHE 4GXBA 2CR5A 2K5PA 3UINB 1FNWA 2WYQA 1WJ6A 2DYBA 4WAFA 3A33B 3ZRCA 3UIPB 3X0WA 3VUXA 3AE4B 2X8XX 4N59A 1V5TA 4M00A 2BBCA 4XZ4A 2JVCA 1XXGA 4CHKA 1WXAA 3Q3NC 5AUKA 4L2YA 2K3UA 4F8CB 1IP9A 4KGTA 1ISNA 5BYRA 2FCQA 3VRBB 2D10A 2RDHA 4FJZA 4QAYA 2NTTA 3EA6A 1JWSD 1V1PB 4FXCA 1T0SC 4AUQC 2PPHA 1JWAD 4C7YA 1GB4A 1TKGA 1YOVB 2PVGC 1TIFA 1BXTA 2RGFA 4TKNA 4J6IA 2ZJDA 5AZFA 4FJYA 3APDA 5DPTA 2O2VB 1KJTA 3HUIA 3JVZX 2ZZPB 1VZ8A 3NUHB 3ML9A 1N6ZA 1DOXA 1XF5L 2DLBA 3MC0B 4B0MA 5BYSA 4FHKA 2LJIA 4W9LA 2UWQA 2CKHB 2KQSA 2DX5B 1EWCA 5CTRC 2ZEQA 1STEA 2BTEA 2VRRB 3DQVA 1Q1OA 5C23A 1VRAB 4ANUA 2V0GA 2OJRA 2MJDA 1KH0A 3PLUA 3CMMB 4YWGG 1F1HA 1KLVA 5DPSA 2JZZA 4AJWA 2KMCA 1C4CA 2CS4A 2M0XA 1UH6A 1PQSA 3I63C 2KX0A 2NBWB 1IPGA 2C7MB 2V4LA 1JWBD 2M19A 1WFYA 3APFA 4IWOA 3NS1A 2KDFB 3PT2B 1RFAA 4C7ZA 4I6PA 2BW2A 2NR2A 1WMHB 3VXWA 3B2GA 1GG3A 1GAQB 1V5OA 4JE3B 2KC2A 1WR1A 3T9LA 2BB6A 1PFDA 1HZ5A 3EHVA 1L5PA 1UUPA 2MBBB 2VH1A 2INCC 1HEZE 3VR9B 3N3KB 2LVPA 5E6PA 1CQVA 1K8RB 2WWZA 2RSUA 2ONQA 3VAWA 3ZRFA 1AW7A 2QMTA 2HJ1A 4J3OD 3DBLI 3MFGA 3N1YC 2WGSA 5D7GA 3V6EB 2KLGA 3RNAC 1WE6A 3AEEB 1FRDA 1QLBB 3A9KA 2AL3A 4NQKE 3PZ7A 3W1YA 4RF0A 1KTKA 4N58A 1MJDA 3ABVB 4HVBA 1FO4A 1S1QB 5IP4D 2BYTA 5HKHA 5DCNA 4W9DA 4PS7A 1XLNA 3ZW3A 1EF5A 3H9DA 2JYTA 2LZ6A 4ACFA 5BMGA 3NY5A 4NAMA 2CU1A 4RGMA 2QSDA 4OW0A 5AZGA 2LGXA 1PYWD 2KAJA 1ET9A 1V86A 2GBKA 1R4NB 3N1XC 1ZP0B 5JHBA 2KANA 1QOAA 1LQBA 3PZ8A 2MP2A 2BQQA 3V3XA 3MC9A 4TV3A 4HROA 3AEGB 3LXFA 2B76B 1F2RI 2L8JA 1RFKA 3AEDB 3IG3A 3TMPB 5CHFA 3V05A 5LXIB 3P4PB 3DWGC 1C77A 4WURA 3VRAB 1E8ZA 2KLCA 2PW9A 2GBNA 2W82A 5LXHA 2FUG1 4RM8A 3JSVB 1HE8A 3GZNI 1JRUA 3EFUA 1FNVA 1E8XA 3BK1A 4ZHOA 4US9A 1EUVB 1XLQA 4O1NA 4XWWA 1N60A 2WNMA 3MTNB 4B6WA 4WQMA 4YSZB 2KK8A 4HXDA 2RD0A 4PT5A 3BYYB 3V61A 4C80A 2K22A 3BY4B 3DPDA 3WIMA 3HVDA 3BVZA 2AQ2B 4DDID 5HI1A 2CHXA 4ITKA 1N5XA 3NZSA 2KVRA 3ZYYX 1KLUD 1OQYA 2HTME 1VLBA 2W9NA 4XYCA 3WAOA 1LFDA 1P7FA 5EE0A 2KDEB 2FIDA 3NHEB 1YIWA 1WGYA 2PLPA 1HTQA 2WS3B 2N0SB 1RAXA 2IGGA 2RDGA 2CU3A 5EDSA 1ROEA 1OFFA 3A1QA 2IY1B 3AI5A 1MPEA 2JRIB 3RT3B 1F2RC 1WGGA 2IY0B 2O6VD 2R2OA 2ASQA 2DYMA 3PGEA 2KDMA 1C4PA 1N5WA 5CHVC 2NPTB 2GBRA 3QAQA 2GOWA 1B1ZA 2KDIA 4LK0M 2FIFA 1T0QC 2DAJA 3WALA 1T6BX 2HDEA 2WX0A 2TSSA 1CK1A 3AEAB 3VUWA 3Q3JA 2OJWA 1YMHE 3Q8FA 1J7BA 1XLPA 1FNUA 3VHTC 1V97A 2L00B 3CWIA 4TQ0A 2J0MA 4YTNB 2C60A 2LVOA 1UWXA 4E3CA 3MHSD 2Y5CA 2PEAA 5FKAC 2INDC 2QCZA 3DOWA 3LJ3A 1N62A 3KH0A 2K39A 1E8WA 4M0WA 4URKA 4MGKE 1MHXA 3QJZA 3C0RB 1U4AA 3RD2A 4ASWC 2ZW1A 4ANWA 5IO9A 3AN1A 1TKYA 3A4RA 3ZXRA 1JWUD 2L3ZA 2MQJA 1MI0A 2KD0A 1DGJA 1NYQA 1I42A 2B3AA 2KTRA 3QHTA 1UNSA 4DHZB 3Q8CA 3TJPA 2VZKD 3ZUNA 2AWTA 3QK0A 2V1YA 2KYWA 2XN9C 1FXAA 1X1MA 2N9PC 3Q2AC 2HD5B 2MA9B 3AE8B 3VTWA 1JROA 4JPSA 4KX6B 4HEA1 2KNBA 2NVUI 3RNGC 4L23A 4RGOS 4TQ1A 1I4XA 4NJ6A 2H89B 4MDKE 2JF5A 2W54A 2WXPA 3DHGC 4K7SA 2JUOA 3ZIMA 5AUIA 4MJSA 3AE5B 3GB1A 4M01A 2M17A 3OWEB 4ZYNA 1UD7A 3HRDD 4R3DA 5EE9A 1K51A 3FAHA 4KIKA 3H1UA 1MFWA 3FC4A 2JZPA 1B9RA 2IJ0A 1C1YB 2IBIB 2MSED 4W9KA 2O6VA 3M62B 4BKGA 1D5ZC 2EKIA 2NPTA 2JRHA 4IC7B 1KFYB 4I6NB 3KUZA 4REZA 2JSVX 2J53A 5C2TB 3BVMA 2V3SA 1YX6B 2ZCBA 2C7NB 2SEBD 2PVOD 3OJ4B 4MH0E 3URYA 4XWTA 1QOBA 3ZTDA 3N30A 3N32A 3RN9C 2K1FA 1E0ZA 2WXOA 1XQQA 1E5WA 4RFBA 2FCMA 1VZ6A 2JU6X 2K0PA 4A9AA 4ANXA 4K3BA 1NI3A 2BT6A 1EF1A 4EZLA 5GMVA 3VR8B 4HJGE 1ZUD2 4B9KA 4HCPB 5HG2A 1JWMD 4ICVA 4I6LB 3PHWB 2BGFA 2ZNVC 2IDYA 2ON8A 2JWUA 3RZWC 1A5RA 4A90A 3RULA 4KVGB 4XC2A 2LJ5A 2R2QA 1F77A 1R4MB 2KFKA 2BF8B 2G4SA 2VH2A 3P63A 3MP9A 3NRZA 4G11A 3N20C 1P3QU 2WXJA 3U52E 2QC8A 2WXGA 4BKTA 2LHEA 2M8SA 2V3NA 4OHJA 3ALBA 1I7HA 2G4DB 2ACZB 2AL6A 2PTLA 1L4DB 4LNNA 4G0NB 1D3ZA 1OGWA 3L4PA 4L1BA 3LB8C 4NPNA 3A9KB 1WX8A 1M94A 2JZ3B 2OOBB 1BUIC 3T3OA 3HVZA 3DVNV 4W9EA 4FHJA 5C1ZA 2QHOA 1WJ4A 5TR5A 2NCNA 4JGHB 3GE8C 5J17A 3VH3B 3AE1B 4M8NA 3NVYA 1FIQA 4HPLB 4MH8A 3QA8A 4S0RA 2M1MA 2WDQB 2Z0DB 2DZKA 2REXA 2WDRB 2XBBC 4BBNC 2PIAA 2NS5A 4DXFA 4HLEA 1RLFA 1GB1A 2DHZA 3B2FA 1XEEA 4P7IA 4XDCA 2EKEC 4E71A 3Q3FA 3IT6B 4GMVA 5IN7A 4IM2A 3E9SA 4AOFA 3U7ZA 1WE7A 3LDZE 4YXDB 1TYGB 1ZW7A 2WHIA 2MP2B 4C56C 4MT5A 3AMZA 1QQRA 3UIOB 1J19A 3GP7A 2OHFA 4ZRQA 2QJLA 3DVGX 2L76A 2PKOA 1Q5WB 2D3AA 4IDIA 3Q6BA 1TKEA 2N7JA 5GXGB 1K52A 4PYUA 2Q5WD 2D3GA 2KC1A 1RYJA 3H8HA 4EZJA 1TS5A 3IBEA 4BVUC 2N9KA 2YEPF 3RI7C 2ZPNA 3RMKC 2R61A 4N6EB 4YTPB 4W9JA 2GB1A 4A3PA 2DBYA 2WQYB 3K9PB 1ZPSA 2M56B 4WJOA 1WI0A 3RNCC 5KHQA 3UQAA 4K7UA 3VTUA 3W1SC 4USAA 1UGMA 3ZJVA 4IG7B 1V81A 1K53A 1UWMA 5CHWA 4KZ0A 3UF8A 4EFOA 4DHZE 4EZKA 3R8BA 2KDBA 1L4ZB 2FAZA 2KWCA 4IM0A 1FFVA 2ZPYA 2KQ7A 4GLSC 1SXTA 2C5LC 3M63B 1WY8A 2BVCA 4GIVA 3RUIB 1N63A 2X38A 2A4ZA 1RM6C 2DZJA 1WXQA 4WAAA 4EOYA 4EE2A 3SD5A 2BWFA 2IZVB 3A1QB 4BBNF 2DZMA 3WAPA 3RYTA 2IO2B 2WXMA 1VCBA 3TUOA 2DAFA 2JXTA 2WDTB 1FMAD 4HPPA 2KJHB 2BS2B 2XNAC 4MSMB 1V49A 3PPAA 2BPSA 1MVKA 3L08A 1WSPA 3BINA 1L0VB 2AX5A 3PRZA 1FCCC 4ZRKA 4PS8A 4A20A 5BYQA 3SFDB 1YN5A 2J0JA 5DPRA 4YSXB 1HQRD 1YQBA 1ZXIA 4C00A 3DCGA 5HHDG 2MRPA 1V80A 2MHJA 3SU8X 1WR6E 3TBLD 2KKCA 1E90A 3ML8A 1SJED 5IOIA 3PS6A 2IGHA 4EEWA 1I4PA 4AJYB 3W5VB 1SB3C 4M0WB 1HZ6A 2KMAA 4DHJD 3PZDA 1WGDA 3RFZB 1CJEA 5LLIA 4IWPA 3ZO5B 1JQ4A 4IUMB 5G5GA 2Z59B 5DPWA 2DNFA 1D5XC 1LO5D 4OZCA 1WZ3A 1J8CA 4MSQB 1IGDA 2KTRB 2KFJA 3MHZA 1QF6A 4RM9A 3Q3OC 2KHWB 4DWFA 2G9HD 2N1WA 3KYCD 4X57B 3DBSA 2QDFA 4HWIB 2QEJC 1HXYD 5TSSA 2GLSA 2BS3B 5L83A 1WRDB 3V62A 5BMIA 4HJKA 2GBJA 2LUMA 1H8CA 1YQ4B 3BVGA 1YJJA 1Q10A 3FKYA 1VJKA 2L0TA 3PVLA 1TY0A 1ENFA 2LXAA 1ET6A 1PGAA 4GSWA 4MJSB 2JY6A 1ZKHA 3UGBB 5EE3A 2K9XA 1WGKA 2WXFA 3NVVA 4EUTA 1XLOA 1PGXA 4KIKB 4YT0B 3V6CB 2IPKD 4GDKA 2UYZB 2WLBA 4LNOA 2MBEA 1SE9A 4K1RB 2KOXA 2M0AA 2JQRB 3EFCA 2O6VB 2QILA 1TBEA 1H4RA 2KZRA 3RZFA 3ZTCA 4MACA 3SHQA 1T0YA 3W2DA 1MG4A 5IKCM 3AV8A 3I3TB 1I4HA 3HM3A 3DBLB 3B1LX 4KDLB 3RNBC 3Q8BA 3ZNHB 3L10B 4GDLA 1RRBA 3I9V1 1I4RA 4S17A 3U4EG 1IBXA 1FXTB 3H7SA 2ZCCA 3GOEA 3D32A 1KRHA 3TEWA 2EMSA 2EELA 2GRIA 4K7WA 3TCAA 3W1SA 4LTUA 1D6EC 5IAAC 2W3RA 2IO1B 4HKQA 5D6JB 1WX7A 1L6UA 2DYOA 3TL5A 4B0EA 3N1ZC 4NNJB 3OLMD 4NY0A 4OVVA 1PUTA 1WJNA 4ZRIA 3TIXA 4HPMB 2DZIA 3ENEA 3KLSX 4PK1A 4F1SA 3DBHI 1BT0A 3DBRI 2K6QA 4B95A 4Q2JA 2DWQA 1FXIA 3P2BA 4A3OA 3C19A 3PTFC 3Q3MC 1M4VA 1L7YA 3DHHC 2Y5BB 2NBVB 2KFKB 2CHWA 3P4RB 3EC8A 2BYFA 3RCZA 2NTSA 2KTFA 2K8CA 3BYTB 1UF0A 2VZKB 1TJEA 4HCNB 1P98A 4GB9A 1CMXB 2D3BA 3KW5B 2FUHB 4W9CA 5H8YE 2MJEA 5L95C 3Q69A 5FK9C 3BWUD 1AYFA 2YLMA 3PO0A 3NS8A 3GZNB 2JWZA 1VZ7A 1R7SA 3W9CB 3K9OB 1IGCA 2FBWB 3ZJUA 4G50A 4WJNA 3TEYA 3AEFB 2IGDA 2LFIA 1ZDXA 1FD6A 2LUEA 2KMMA 3Q8AA 2H88B 3O65B 2EMTA 1QZEA 4BFRA 1WX9A 1C76A 2WXHA 2ZVOA 2LGIA 4NAWA 1IUEA 1GC7A 1SF0A 4MGIE 4BAXA 2I1JA 2N9XA 3QX1A 4LJPB 2MX2A 1OEYJ 1FPYA 5I4DA 5CX3A 1TS3A 5D2MB 3LYYA 3R7QA 3GS2A 2D3CA 2J0KA 2KWUB 2MW5A 1WGHA 1VD2A 3TEXA 3WCQA 4ZHPA 2E6XA 2CJOA 4IWQA 2JT4B 3CF6E 1C78A 4P1BC 4WJQA 1KF6B 1WH3A 4MGZE 5BMHA 1UELA 3OJ3A 3FILA 4EKUA 2MBOA 1I35A 4DBGA 2LD9A 1QT9A 4ZOHC 2LHDA 4LDTB 4M8MA 4YL8A 3O13A 5FR3A 4W9FA 1JW9D 1FM0D 1YX5B 4LJOB 3AEBB 1C79A 1MG8A 2AYOB 4N9F4 3APCA 4A55A 2KT7A 2LVQA 3H7PA 1KOTA 2ZW0A 2NMQA 3WANA 1JRPA 1DYQA 3AE6B 4P1CC 1ZXHA 1WF9A 4KKJA 2G1EA 3L16A 5D3DA 1JMLA 4LLGM 2KXJA 3IVFA 3PHXB 2WU2B 2KWDA 1E7UA 5AZHA 1WRIA 1V9JA 2PE6B 2W55A 3U2SC 1E7VA 1C3TA 1G6JA 3PSEB 1YNTE 3RNFC 4C4VA 3AU5A 1F52A 3IAM1 2LEKA 4D2KA 1Y56A 2MH7A 4RH6A 1XCTL 4P16A 1FEHA 3I57A 3L17A 1BMLC 1GUAB 2MLBA 3TSSA 3VVWB 1I4QA 2IYDB 2D5GA 1KLGD 2JYEA 1PDXA 3V60A 4BOZB 2BYVE 1OQQA 4WH4A 1LM8B 3JW0X 2BS4B 3M3JA 4AP4C 1D5MC 4JX1C 5G2NA 3B9JA 4A8XC 2LXCA 2N7EA 1AWDA 3A4SC 4KV2A 2XK5A 2AEHA 1Z2MA 2WXNA 3ZQ4A 4W9IA 2G45B 3CIRB 4HDQA 2N7DA 1J7CA 3X23A 2KACA 1UBIA 1T0RC 2Z0EB 1VDVA 2V4IB 3AB5A 2MEKA 1FFUA 4K3CA 4DQOC 4NQLB 2LGSA 4HK2A 3M95A 1R4NI 2BKFA 1RWSA 5J2RA 2LRUA 2ZNVB 2YEPB 3PRPB 3HIZA 4MELA 1D4BA 4MGYE 4KZCA 3HK0A 1OQRA 1GNUA 4NJCA 5JH5C 3A9JA 2INNE 2XEWA 1NYRA 1SGHA 1TGZB 3AULA 2MCNB 1V1OA 1NI2A 2I2YA 2D07B 4MEMA 4ANVA 2QIEB 2RDBC 1TZOA 1L6VA 1YQ3B 1ZOYB 4JLCA 3U7DA 1NENB 2DENB 4IOIE 1L2NA 4MM3A 1EU4A 2N9LA 3ECIA 2Z8LA 2N9EB 4WWPA 4K81A 3T3NA 4ARCA 2KN4A 1J7AA 3WAMA 4TSSA 5FR6A 5C3JB 2KVZA 1V2YA 3IT4B 3KWVA 1NVID 2INPE 3L13A 3P4SB 4XDDA 4RF1A 1YN3A 1NEKB 1C4AA 1WYGA 4FJVB 4WWMA 1E6EB 1SBBB 2K25A 5D94A 4RGNA 1SJHD 3KQ4A 5EE1A 4GDKB 3ZXVA 4G3XB 2N1VA 3ZNGC 1SE3A 3J9CA 5T8IA 2J52A
chains in the Genus database with same CATH topology
5JXVA 1WGKA 1XXGA 2W54A 2BB5A 2WXPA 2WXFA 3NVVA 1XLOA 1PGXA 1UGJA 4YT0B 5AUKA 4YTMB 4L2YA 2IPKD 2K3UA 5AUIA 4AQ7A 2WLBA 4KGTA 3AE5B 3GB1A 2M0AA 2JQRB 2Y5PA 5BYRA 3OWEB 3HRDD 5LNK1 2QILA 4R3DA 1P7EA 5EE9A 3VRBB 1K51A 2RDHA 1V8CA 3FAHA 4GDLB 3TEZA 4MACA 3SFEB 3EGRA 3FC4A 2JZPA 1B9RA 2IJ0A 2NTTA 3EA6A 3W2DA 1IBXB 3AV8A 1JWSD 1V1PB 4FXCA 1I4HA 3N9YC 2CJNA 1JWAD 4DXGA 4C7YA 1GB4A 1TKGA 3Q8BA 2PVGC 1D5ZC 2EKIA 4AS1A 1KFYB 3I9V1 1A70A 1I4RA 3U4EG 1BXTA 1IBXA 4REZA 2JSVX 2J53A 5D3IB 1KRHA 5C2TB 3TEWA 2RMMA 1V1PA 2PMVA 3BVMA 2EELA 3P1MA 2GRIA 2SEBD 3W1SA 2PVOD 1D6EC 2I38A 4LTUA 1QOFA 4KKIA 3URYA 3HUIA 3SR6A 1VZ8A 4XWTA 3NUHB 2W3RA 4HKQA 1QOBA 1L6UA 1DOXA 1XF5L 2DLBA 3MC0B 2DYOA 4B0MA 5BYSA 4B0EA 2LJIA 2V3PA 1E0ZA 1EWCA 1YN4A 2WXOA 1STEA 2BTEA 2Y3AA 1PUTA 1XCQL 1VRAB 4RFBA 2V0GA 4JWSC 2MJDA 1KH0A 4YWGG 1VZ6A 1TY2A 2JU6X 1YJIA 2K0PA 2WU5B 3KLSX 2J4XA 1C4CA 4Q2JA 3KWLA 2DWQA 4A9AA 1FXIA 1M4VA 1NI3A 2BT6A 3VR8B 4HJGE 1ZUD2 1AN8A 5HG2A 3P4RB 3RPFC 1JWMD 1JWBD 2NTSA 3BZDB 3DWMA 2M19A 3BYTB 2IDYA 2E3TA 2ON8A 2JWUA 2VZKB 3NS1A 1TJEA 4A90A 4C7ZA 2BW2A 3B2GA 1F77A 3P63A 3MP9A 3NRZA 1SEBD 4HKZE 5H8YE 2MJEA 1GAQB 4JE3B 2WXJA 3AE3B 3U52E 2WXGA 1DOYA 4RNAA 3Q69A 5FK9C 1QILA 2LHEA 3BWUD 1AYFA 2V3NA 2BB6A 3PO0A 4OHJA 1I7HA 1PFDA 1HZ5A 1VZ7A 1R7SA 1L5PA 2ACZB 1L0XB 1UUPA 3W9CB 1IGCA 2OEDA 2PTLA 2J42A 1L4DB 1E10A 4A6QA 2FBWB 3ZJUA 3ZGZA 3L4PA 3TEYA 1HEZE 4UDUC 4L1BA 3VR9B 3AEFB 4NAWB 4XE0A 2IGDA 2WXRA 2LFIA 3SEBA 3LB8C 1ZDXA 1CQVA 1FD6A 2ONQA 2KMMA 3Q8AA 3Q8EA 1AW7A 2H88B 2QMTA 1BUIC 4J3OD 3T3OA 3HVZA 3MFGA 1C76A 2WXHA 2MJ3A 2LGIA 1ZE3D 1SIJA 1IUEA 1SF0A 5D7GA 4RCOA 3AE1B 3AEEB 1FRDA 1QLBB 3NVYA 1FIQA 4MH8A 3NVZA 3PZ7A 3EUB2 2WDQB 4RF0A 3NZ3A 5I4DA 1KTKA 1TS3A 2WDRB 4N58A 3ABVB 2PIAA 3LYYA 4ZYSA 1FO4A 4DXFA 3GS2A 2WDVB 2BYTA 1GB1A 3B2FA 3TEXA 1EU3A 1XLNA 3WCQA 4ZHPA 3FILB 1XEEA 4XDCA 2E6XA 1QKZA 4KGRA 2CJOA 3IT6B 3E9SA 1C78A 2JYTA 5BMGA 3U7ZA 1KF6B 4NAMA 5BMHA 4YXDB 1TYGB 4RGMA 4C56C 4MT5A 4OVZA 2QSDA 2L52A 3AMZA 4OW0A 3FILA 1QQRA 3R2IA 3GP7A 1PYWD 2OHFA 2KAJA 2L1AA 4KGSA 1ET9A 2QJLA 4ZRQA 2GI9A 1QT9A 2PKOA 1ZP0B 4ZOHC 2LHDA 1QOAA 4IDIA 3PZ8A 1K50A 1TKEA 3O13A 1JW9D 1FM0D 2N7JA 5FR3A 3AEBB 5GXGB 1C79A 1K52A 2Q5WD 3V3XA 4A55A 4HROA 1RYJA 3AEGB 3LXFA 1ACCA 2B76B 3H8HA 1TS5A 1F2RI 2N9KA 2YEPF 1RFKA 4ARIA 3AEDB 2FE8A 3V05A 2ZW0A 2NMQA 2R61A 4N6EB 4YTPB 2WP9B 2AQ1B 1JRPA 1DYQA 3AE6B 3P4PB 2GB1A 3DWGC 1ZXHA 1C77A 2RPVA 2DBYA 4WURA 4US8A 2WQYB 3VRAB 1F0ZA 1ZPSA 2M56B 4KKJA 1VR9A 4YSYB 2G1EA 1I4GA 2PW9A 1SE4A 5D3DA 3AE9B 1JMLA 2W82A 4LLGM 4USAA 3UI3A 1EM7A 2FUG1 3ZJVA 2WU2B 3P4QB 4OZBA 1CZPA 2KWDA 1FNVA 1K53A 1UWMA 3BK1A 4ZHOA 1WRIA 4US9A 1XLQA 2W55A 4O1NA 4XWWA 1N60A 3R8BA 3U2SC 2WNMA 1L4ZB 4WQMA 4YSZB 2L32A 1C9FA 1YNTE 3AH7A 2W3SA 5H92C 3IAM1 2LEKA 1FCLA 1FFVA 4GLSC 4D2KA 1SXTA 4PT5A 3BYYB 2KQ4X 1Y56A 2MH7A 4C80A 2K22A 1TS2A 4RH6A 1EWYC 1XCTL 1FEHA 3HVDA 3I57A 4P16A 3BVZA 1BMLC 2AQ2B 3ETRA 2WXQA 3TSSA 1N63A 1I4QA 2X38A 5HI1A 1JALA 1RM6C 4ITKA 2D5GA 1JCKB 1SSNA 1N5XA 1KLGD 1TS4A 2JYEA 1PDXA 3ZYYX 1KLUD 2HTME 1VLBA 1WXQA 4H2AA 3AE2B 4EE2A 1SE2A 3AE7B 1P7FA 5EE0A 1OQQA 1DOIA 3BK2A 4WH4A 1GOZA 3R2TA 2BS4B 5HFYA 1D5MC 2PLPA 2WXMA 2WS3B 2N0SB 1WWTA 2IGGA 2WXIA 2RDGA 4JX1C 3TUOA 2CU3A 1ROEA 2JX5A 2JXTA 3B9JA 3IAS1 4A8XC 1FMAD 1AWDA 1OFFA 2BS2B 2XNAC 3NVWA 2WXNA 1MPEA 1MVKA 3AM9A 1F2RC 1WSPA 3ZQ4A 1L0VB 3CIRB 3MJ5A 2AX5A 2DYMA 4P6VF 1J7CA 1FCCC 2KDMA 2KACA 1C4PA 1E9MA 2SAKA 1N5WA 1VDVA 2V4IB 3AB5A 2MEKA 4IKGA 1FFUA 1E7PB 5BYQA 3C8YA 3SFDB 4DQOC 1YN5A 1B1ZA 4LK0M 3E56A 1T6BX 2HDEA 1HA5A 4YSXB 1HQRD 1ZXIA 5HHDG 1RWSA 2LMCA 1N61A 2TSSA 1CK1A 3AEAB 3VQIA 2YEPB 4TMAB 1D4BA 4RGTA 1T3QA 1SJED 1FRRA 1YMHE 3Q8FA 1J7BA 1OQRA 1XLPA 1FNUA 1QOGA 1V97A 2IGHA 4NJCA 3AECB 3W5UB 1I4PA 3CWIA 4TQ0A 2INNE 5MPOA 1NYRA 3W5VB 1SB3C 1HZ6A 4CQNA 4MM3B 4YTNB 1GPXA 1V1OA 1UWXA 2I2YA 1T5XD 3RFZB 2Y5CA 5G5HA 4NZLB 1CJEA 1L0YB 2QIEB 1TZOA 3P42A 1ZDVA 5FKAC 1L6VA 1N62A 1YQ3B 1ZOYB 1JQ4A 1NENB 1PGBA 5G5GA 4ZRPA 3ZJTA 4M0WA 2WXLA 4IOIE 4JWUC 1ESFA 1MHXA 1EU4A 1D5XC 2WXKA 1LO5D 4OZCA 2N9LA 5E6JA 2Z8LA 3IXSA 1IGDA 2ZW1A 3BIID 3AN1A 3MHZA 1TKYA 1QF6A 3T3NA 2L83A 1JWUD 4ARCA 2G9HD 2KN4A 1J7AA 1XO3A 4WIPA 1MI0A 4OZAA 1DGJA 2QEJC 1HXYD 4TSSA 5C3JB 1NYQA 5TSSA 3IT4B 2BS3B 3KWVA 1NVID 1UNSA 2INPE 4HRSA 3P4SB 3Q8CA 2AQ3B 5BMIA 2ICIA 4XDDA 4RF1A 2VZKD 1YN3A 1MHHE 1NEKB 2K5PA 2XN9C 1FXAA 2LUMA 1C4AA 1WYGA 1YQ4B 3BVGA 1FNWA 1YJJA 1Q10A 4WWMA 1VJKA 1E6EB 1SBBB 1TY0A 3AE8B 4WAFA 1ENFA 4RGNA 1JROA 4JPSA 4KX6B 1SJHD 4HEA1 3KQ4A 5EE1A 3AE4B 1ET6A 4L23A 4RGOS 4GDKB 1PGAA 4N59A 4TQ1A 1I4XA 1SE3A 2H89B 3J9CA 5T8IA 2J52A 2BBCA 5EE3A 2K9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JXV A;  1K50 A;  4IKG A;  2N7J A;  2ON8 A;  2JWU A;  1K52 A;  1PGX A;  3V3X A;  5HHD G;  1F2R I;  2N9K A;  3MP9 A;  4HKZ E;  4KGT A;  2ZW0 A;  2NMQ A;  3GB1 A;  1D4B A;  2GB1 A;  2LHE A;  1YMH E;  1P7E A;  1ZXH A;  2RPV A;  1K51 A;  4MAC A;  1HZ5 A;  2IGH A;  2JZP A;  2PW9 A;  1IGC A;  2OED A;  2PTL A;  1IBX B;  1JML A;  3UI3 A;  1EM7 A;  4OZB A;  1HZ6 A;  1HEZ E;  2KWD A;  1UWX A;  2I2Y A;  1K53 A;  2IGD A;  1GB4 A;  1FD6 A;  2ONQ A;  2QMT A;  1C9F A;  1PGB A;  1YNT E;  1IBX A;  2JSV X;  2J53 A;  4IOI E;  1FCL A;  2RMM A;  4GLS C;  4D2K A;  2LGI A;  1MHX A;  2KQ4 X;  2EEL A;  4OZC A;  2N9L A;  1XCT L;  1IGD A;  2ZW1 A;  2I38 A;  5HI1 A;  2KN4 A;  1XF5 L;  1MI0 A;  4OZA A;  1GB1 A;  1P7F A;  4WH4 A;  3FIL B;  1XCQ L;  5HFY A;  2PLP A;  1QKZ A;  5BMI A;  4KGR A;  2IGG A;  1KH0 A;  2JXT A;  1MHH E;  5BMG A;  2JU6 X;  2LUM A;  2K0P A;  5BMH A;  1Q10 A;  2QSD A;  3FIL A;  1MPE A;  1MVK A;  1F2R C;  4KGS A;  2GI9 A;  4HJG E;  1PGA A;  1FCC C;  2KDM A;  2KAC A;  5HG2 A;  2J52 A;  2LHD A; 
#chains in the Genus database with same CATH topology
 5JXV A;  2D11 A;  1NBF C;  2BB5 A;  5IA7 A;  1UGJ A;  1Q0W B;  1E8Y A;  4YTM B;  4HDO A;  4AQ7 A;  2BYE A;  2CHZ A;  2Y5P A;  3Q14 C;  2C7H A;  5LNK 1;  2J7Q B;  1P7E A;  1V8C A;  4GDL B;  3TEZ A;  3SFE B;  4BOS C;  3EGR A;  3QCA A;  3HHM A;  1IBX B;  3KUC B;  4FA6 A;  3QQ8 B;  3N9Y C;  2CJN A;  4DXG A;  3GE3 C;  3MJW A;  4FAD A;  4AS1 A;  3DVG Y;  3ZNZ B;  1A70 A;  5AEK B;  5D3I B;  2ZVN A;  3JYU A;  2RMM A;  1V1P A;  2PMV A;  4WWN A;  4BKS D;  1P0R A;  3P1M A;  3MC8 A;  2I38 A;  2NBU A;  1QOF A;  4KKI A;  3ZNI D;  2L0F A;  3DDC B;  3SR6 A;  4E74 A;  4CYE A;  4DHJ B;  1UZX B;  4GN1 A;  2V3P A;  2O2V A;  1YN4 A;  2Y3A A;  1OEY A;  1IYF A;  1XCQ L;  1OTR B;  4DK5 A;  4BZA A;  3NZU A;  4XGA B;  4JWS C;  3HM6 X;  2I1K A;  2K6D B;  1TY2 A;  1YJI A;  2WU5 B;  2JXX A;  2J4X A;  2HE7 A;  5E6N A;  3KWL A;  3QC8 B;  2UU7 A;  1WYW B;  3NG0 A;  2KJR A;  1YJ1 A;  4FN2 A;  5JZE B;  1AN8 A;  4LNK A;  1SIF A;  2BWE S;  1V6E A;  3ZKJ C;  3RPF C;  3BZD B;  3DWM A;  4OVU A;  5G55 A;  2E3T A;  1WM3 A;  3NJT A;  2MBQ A;  1AAR A;  1XD3 B;  1XT9 B;  1HTO A;  1SEB D;  4HKZ E;  3RNE C;  3T8M A;  3AE3 B;  3R66 C;  4DDG D;  1DOY A;  4RNA A;  1QIL A;  2GMI C;  1Y8R C;  1WMH A;  3VTV A;  1L0X B;  2OED A;  2J42 A;  1E10 A;  4A6Q A;  3ZGZ A;  1WXS A;  4UDU C;  2BKR B;  4NAW B;  4XE0 A;  2WXR A;  3SEB A;  3NOB A;  2L7R A;  4F7Z A;  4ZRJ A;  3Q8E A;  3U30 A;  2HTH A;  3DVN U;  3ZLZ A;  3EEC A;  1YD8 U;  2MJ3 A;  1ZE3 D;  1SIJ A;  3B08 A;  3KYD D;  4RMA A;  2M4N A;  2A5U A;  2MWS B;  2MBH A;  4KDI C;  4LCD E;  4RCO A;  3NVZ A;  3L54 A;  3EUB 2;  3NZ3 A;  4ZYS A;  4KSL C;  2WDV B;  4II3 B;  3PRE A;  4GU2 A;  3KUD B;  1EU3 A;  4LNF A;  4WWO A;  3FIL B;  1Z5S B;  1ZGU B;  4WJP A;  1QKZ A;  2PJH A;  4KGR A;  3ZVV A;  4AWJ A;  1S3S G;  2KJ6 A;  4OVZ A;  2FNJ B;  2L52 A;  3PV1 A;  3R2I A;  4KGS A;  2L1A A;  3PRM B;  2GI9 A;  4BKS A;  2L05 A;  2LGD A;  5KHO A;  3CST A;  3H7P B;  3S2A A;  3B0A A;  5JHA A;  1K50 A;  4NJ7 A;  4ICU A;  4IW0 A;  4JQW C;  4ZDV A;  1WGR A;  1ACC A;  3AXC A;  1WM2 A;  3H6N A;  1LXD A;  4ARI A;  2FE8 A;  5E6O A;  4IM3 A;  3VFK A;  2WP9 B;  4PYZ A;  2AQ1 B;  2RPV A;  3U8Z A;  3L0W B;  4US8 A;  2KN5 A;  1R4M I;  1F0Z A;  2K8B A;  1P9D U;  1VR9 A;  1WJU A;  4YSY B;  1WZ0 A;  2LRW A;  1I4G A;  1SE4 A;  3AE9 B;  4C4V B;  3UI3 A;  2LGY A;  1EM7 A;  2YVC A;  3P4Q B;  4OZB A;  4TUU A;  1CZP A;  3ZDT A;  2L32 A;  1C9F A;  3AH7 A;  2W3S A;  5H92 C;  2IO3 B;  4II2 B;  1FCL A;  3OAW A;  3JSV A;  2KQ4 X;  1TS2 A;  2K8H A;  1EWY C;  1WXV A;  3ETR A;  2LWP A;  2WXQ A;  1JAL A;  4WQO B;  3QIJ A;  1JCK B;  1SSN A;  1TS4 A;  3VH4 B;  5J18 A;  4H2A A;  3AE2 B;  1SE2 A;  3AE7 B;  4JL9 A;  1WIA A;  2IO0 B;  1DOI A;  3BK2 A;  2XK5 B;  1GOZ A;  2JPH A;  3R2T A;  5HFY A;  3CSF A;  3IHP C;  1WWT A;  2WXI A;  3QWZ B;  2JX5 A;  3IAS 1;  1KM7 A;  1EO6 A;  3NVW A;  4XX5 A;  3R7R A;  4FBJ B;  2V9H A;  4W9G A;  3AM9 A;  1TT5 B;  3MJ5 A;  4GGQ A;  4P6V F;  3PLV A;  3IFW B;  2FCN A;  2SAK A;  1E9M A;  4PS3 A;  5BO4 B;  1GJZ A;  2PE9 A;  4IKG A;  1E7P B;  3C8Y A;  2LAS A;  3SDL C;  2WX1 A;  3WA0 A;  3E56 A;  2FCS A;  2G3Q B;  4M02 A;  1HA5 A;  4LNI A;  4KSK C;  3DHI C;  2LI5 A;  3R3M A;  4GOC A;  2LMC A;  3OG5 A;  2KWV B;  1N61 A;  3VQI A;  3A9J B;  4TMA B;  2GBM A;  4RGT A;  3VUY A;  4JIO U;  1T3Q A;  1FRR A;  1TZ1 A;  3I5J C;  1QOG A;  3AEC B;  3W5U B;  1WXM A;  1F9J A;  2C9W B;  1LGR A;  5MPO A;  1NDD A;  4CQN A;  4MM3 B;  1GPX A;  1T5X D;  2HJ8 A;  3KVF B;  5G5H A;  2KX3 A;  4NZL B;  3ZDM C;  1L0Y B;  1P1A A;  3P42 A;  1ZDV A;  3ONS A;  3QAR A;  1PGB A;  4ZRP A;  3VDZ A;  3ZJT A;  2WXL A;  4LDT D;  4JWU C;  1ESF A;  2WXK A;  5E6J A;  3IXS A;  3AU4 A;  1TTN A;  3BII D;  1GC6 A;  1UBQ A;  4DXA B;  4FUL A;  2L83 A;  4W9H A;  3UQB A;  1XO3 A;  4FLH A;  4WIP A;  2N4F A;  4OZA A;  2D2Q A;  1J0G A;  2RR9 A;  3DBH B;  3DBR B;  2KO3 A;  4HRS A;  2AQ3 B;  2ICI A;  2RPQ A;  4CO7 A;  1MHH E;  4GXB A;  2CR5 A;  2K5P A;  3UIN B;  1FNW A;  2WYQ A;  1WJ6 A;  2DYB A;  4WAF A;  3A33 B;  3ZRC A;  3UIP B;  3X0W A;  3VUX A;  3AE4 B;  2X8X X;  4N59 A;  1V5T A;  4M00 A;  2BBC A;  4XZ4 A;  2JVC A;  1XXG A;  4CHK A;  1WXA A;  3Q3N C;  5AUK A;  4L2Y A;  2K3U A;  4F8C B;  1IP9 A;  4KGT A;  1ISN A;  5BYR A;  2FCQ A;  3VRB B;  2D10 A;  2RDH A;  4FJZ A;  4QAY A;  2NTT A;  3EA6 A;  1JWS D;  1V1P B;  4FXC A;  1T0S C;  4AUQ C;  2PPH A;  1JWA D;  4C7Y A;  1GB4 A;  1TKG A;  1YOV B;  2PVG C;  1TIF A;  1BXT A;  2RGF A;  4TKN A;  4J6I A;  2ZJD A;  5AZF A;  4FJY A;  3APD A;  5DPT A;  2O2V B;  1KJT A;  3HUI A;  3JVZ X;  2ZZP B;  1VZ8 A;  3NUH B;  3ML9 A;  1N6Z A;  1DOX A;  1XF5 L;  2DLB A;  3MC0 B;  4B0M A;  5BYS A;  4FHK A;  2LJI A;  4W9L A;  2UWQ A;  2CKH B;  2KQS A;  2DX5 B;  1EWC A;  5CTR C;  2ZEQ A;  1STE A;  2BTE A;  2VRR B;  3DQV A;  1Q1O A;  5C23 A;  1VRA B;  4ANU A;  2V0G A;  2OJR A;  2MJD A;  1KH0 A;  3PLU A;  3CMM B;  4YWG G;  1F1H A;  1KLV A;  5DPS A;  2JZZ A;  4AJW A;  2KMC A;  1C4C A;  2CS4 A;  2M0X A;  1UH6 A;  1PQS A;  3I63 C;  2KX0 A;  2NBW B;  1IPG A;  2C7M B;  2V4L A;  1JWB D;  2M19 A;  1WFY A;  3APF A;  4IWO A;  3NS1 A;  2KDF B;  3PT2 B;  1RFA A;  4C7Z A;  4I6P A;  2BW2 A;  2NR2 A;  1WMH B;  3VXW A;  3B2G A;  1GG3 A;  1GAQ B;  1V5O A;  4JE3 B;  2KC2 A;  1WR1 A;  3T9L A;  2BB6 A;  1PFD A;  1HZ5 A;  3EHV A;  1L5P A;  1UUP A;  2MBB B;  2VH1 A;  2INC C;  1HEZ E;  3VR9 B;  3N3K B;  2LVP A;  5E6P A;  1CQV A;  1K8R B;  2WWZ A;  2RSU A;  2ONQ A;  3VAW A;  3ZRF A;  1AW7 A;  2QMT A;  2HJ1 A;  4J3O D;  3DBL I;  3MFG A;  3N1Y C;  2WGS A;  5D7G A;  3V6E B;  2KLG A;  3RNA C;  1WE6 A;  3AEE B;  1FRD A;  1QLB B;  3A9K A;  2AL3 A;  4NQK E;  3PZ7 A;  3W1Y A;  4RF0 A;  1KTK A;  4N58 A;  1MJD A;  3ABV B;  4HVB A;  1FO4 A;  1S1Q B;  5IP4 D;  2BYT A;  5HKH A;  5DCN A;  4W9D A;  4PS7 A;  1XLN A;  3ZW3 A;  1EF5 A;  3H9D A;  2JYT A;  2LZ6 A;  4ACF A;  5BMG A;  3NY5 A;  4NAM A;  2CU1 A;  4RGM A;  2QSD A;  4OW0 A;  5AZG A;  2LGX A;  1PYW D;  2KAJ A;  1ET9 A;  1V86 A;  2GBK A;  1R4N B;  3N1X C;  1ZP0 B;  5JHB A;  2KAN A;  1QOA A;  1LQB A;  3PZ8 A;  2MP2 A;  2BQQ A;  3V3X A;  3MC9 A;  4TV3 A;  4HRO A;  3AEG B;  3LXF A;  2B76 B;  1F2R I;  2L8J A;  1RFK A;  3AED B;  3IG3 A;  3TMP B;  5CHF A;  3V05 A;  5LXI B;  3P4P B;  3DWG C;  1C77 A;  4WUR A;  3VRA B;  1E8Z A;  2KLC A;  2PW9 A;  2GBN A;  2W82 A;  5LXH A;  2FUG 1;  4RM8 A;  3JSV B;  1HE8 A;  3GZN I;  1JRU A;  3EFU A;  1FNV A;  1E8X A;  3BK1 A;  4ZHO A;  4US9 A;  1EUV B;  1XLQ A;  4O1N A;  4XWW A;  1N60 A;  2WNM A;  3MTN B;  4B6W A;  4WQM A;  4YSZ B;  2KK8 A;  4HXD A;  2RD0 A;  4PT5 A;  3BYY B;  3V61 A;  4C80 A;  2K22 A;  3BY4 B;  3DPD A;  3WIM A;  3HVD A;  3BVZ A;  2AQ2 B;  4DDI D;  5HI1 A;  2CHX A;  4ITK A;  1N5X A;  3NZS A;  2KVR A;  3ZYY X;  1KLU D;  1OQY A;  2HTM E;  1VLB A;  2W9N A;  4XYC A;  3WAO A;  1LFD A;  1P7F A;  5EE0 A;  2KDE B;  2FID A;  3NHE B;  1YIW A;  1WGY A;  2PLP A;  1HTQ A;  2WS3 B;  2N0S B;  1RAX A;  2IGG A;  2RDG A;  2CU3 A;  5EDS A;  1ROE A;  1OFF A;  3A1Q A;  2IY1 B;  3AI5 A;  1MPE A;  2JRI B;  3RT3 B;  1F2R C;  1WGG A;  2IY0 B;  2O6V D;  2R2O A;  2ASQ A;  2DYM A;  3PGE A;  2KDM A;  1C4P A;  1N5W A;  5CHV C;  2NPT B;  2GBR A;  3QAQ A;  2GOW A;  1B1Z A;  2KDI A;  4LK0 M;  2FIF A;  1T0Q C;  2DAJ A;  3WAL A;  1T6B X;  2HDE A;  2WX0 A;  2TSS A;  1CK1 A;  3AEA B;  3VUW A;  3Q3J A;  2OJW A;  1YMH E;  3Q8F A;  1J7B A;  1XLP A;  1FNU A;  3VHT C;  1V97 A;  2L00 B;  3CWI A;  4TQ0 A;  2J0M A;  4YTN B;  2C60 A;  2LVO A;  1UWX A;  4E3C A;  3MHS D;  2Y5C A;  2PEA A;  5FKA C;  2IND C;  2QCZ A;  3DOW A;  3LJ3 A;  1N62 A;  3KH0 A;  2K39 A;  1E8W A;  4M0W A;  4URK A;  4MGK E;  1MHX A;  3QJZ A;  3C0R B;  1U4A A;  3RD2 A;  4ASW C;  2ZW1 A;  4ANW A;  5IO9 A;  3AN1 A;  1TKY A;  3A4R A;  3ZXR A;  1JWU D;  2L3Z A;  2MQJ A;  1MI0 A;  2KD0 A;  1DGJ A;  1NYQ A;  1I42 A;  2B3A A;  2KTR A;  3QHT A;  1UNS A;  4DHZ B;  3Q8C A;  3TJP A;  2VZK D;  3ZUN A;  2AWT A;  3QK0 A;  2V1Y A;  2KYW A;  2XN9 C;  1FXA A;  1X1M A;  2N9P C;  3Q2A C;  2HD5 B;  2MA9 B;  3AE8 B;  3VTW A;  1JRO A;  4JPS A;  4KX6 B;  4HEA 1;  2KNB A;  2NVU I;  3RNG C;  4L23 A;  4RGO S;  4TQ1 A;  1I4X A;  4NJ6 A;  2H89 B;  4MDK E;  2JF5 A;  2W54 A;  2WXP A;  3DHG C;  4K7S A;  2JUO A;  3ZIM A;  5AUI A;  4MJS A;  3AE5 B;  3GB1 A;  4M01 A;  2M17 A;  3OWE B;  4ZYN A;  1UD7 A;  3HRD D;  4R3D A;  5EE9 A;  1K51 A;  3FAH A;  4KIK A;  3H1U A;  1MFW A;  3FC4 A;  2JZP A;  1B9R A;  2IJ0 A;  1C1Y B;  2IBI B;  2MSE D;  4W9K A;  2O6V A;  3M62 B;  4BKG A;  1D5Z C;  2EKI A;  2NPT A;  2JRH A;  4IC7 B;  1KFY B;  4I6N B;  3KUZ A;  4REZ A;  2JSV X;  2J53 A;  5C2T B;  3BVM A;  2V3S A;  1YX6 B;  2ZCB A;  2C7N B;  2SEB D;  2PVO D;  3OJ4 B;  4MH0 E;  3URY A;  4XWT A;  1QOB A;  3ZTD A;  3N30 A;  3N32 A;  3RN9 C;  2K1F A;  1E0Z A;  2WXO A;  1XQQ A;  1E5W A;  4RFB A;  2FCM A;  1VZ6 A;  2JU6 X;  2K0P A;  4A9A A;  4ANX A;  4K3B A;  1NI3 A;  2BT6 A;  1EF1 A;  4EZL A;  5GMV A;  3VR8 B;  4HJG E;  1ZUD 2;  4B9K A;  4HCP B;  5HG2 A;  1JWM D;  4ICV A;  4I6L B;  3PHW B;  2BGF A;  2ZNV C;  2IDY A;  2ON8 A;  2JWU A;  3RZW C;  1A5R A;  4A90 A;  3RUL A;  4KVG B;  4XC2 A;  2LJ5 A;  2R2Q A;  1F77 A;  1R4M B;  2KFK A;  2BF8 B;  2G4S A;  2VH2 A;  3P63 A;  3MP9 A;  3NRZ A;  4G11 A;  3N20 C;  1P3Q U;  2WXJ A;  3U52 E;  2QC8 A;  2WXG A;  4BKT A;  2LHE A;  2M8S A;  2V3N A;  4OHJ A;  3ALB A;  1I7H A;  2G4D B;  2ACZ B;  2AL6 A;  2PTL A;  1L4D B;  4LNN A;  4G0N B;  1D3Z A;  1OGW A;  3L4P A;  4L1B A;  3LB8 C;  4NPN A;  3A9K B;  1WX8 A;  1M94 A;  2JZ3 B;  2OOB B;  1BUI C;  3T3O A;  3HVZ A;  3DVN V;  4W9E A;  4FHJ A;  5C1Z A;  2QHO A;  1WJ4 A;  5TR5 A;  2NCN A;  4JGH B;  3GE8 C;  5J17 A;  3VH3 B;  3AE1 B;  4M8N A;  3NVY A;  1FIQ A;  4HPL B;  4MH8 A;  3QA8 A;  4S0R A;  2M1M A;  2WDQ B;  2Z0D B;  2DZK A;  2REX A;  2WDR B;  2XBB C;  4BBN C;  2PIA A;  2NS5 A;  4DXF A;  4HLE A;  1RLF A;  1GB1 A;  2DHZ A;  3B2F A;  1XEE A;  4P7I A;  4XDC A;  2EKE C;  4E71 A;  3Q3F A;  3IT6 B;  4GMV A;  5IN7 A;  4IM2 A;  3E9S A;  4AOF A;  3U7Z A;  1WE7 A;  3LDZ E;  4YXD B;  1TYG B;  1ZW7 A;  2WHI A;  2MP2 B;  4C56 C;  4MT5 A;  3AMZ A;  1QQR A;  3UIO B;  1J19 A;  3GP7 A;  2OHF A;  4ZRQ A;  2QJL A;  3DVG X;  2L76 A;  2PKO A;  1Q5W B;  2D3A A;  4IDI A;  3Q6B A;  1TKE A;  2N7J A;  5GXG B;  1K52 A;  4PYU A;  2Q5W D;  2D3G A;  2KC1 A;  1RYJ A;  3H8H A;  4EZJ A;  1TS5 A;  3IBE A;  4BVU C;  2N9K A;  2YEP F;  3RI7 C;  2ZPN A;  3RMK C;  2R61 A;  4N6E B;  4YTP B;  4W9J A;  2GB1 A;  4A3P A;  2DBY A;  2WQY B;  3K9P B;  1ZPS A;  2M56 B;  4WJO A;  1WI0 A;  3RNC C;  5KHQ A;  3UQA A;  4K7U A;  3VTU A;  3W1S C;  4USA A;  1UGM A;  3ZJV A;  4IG7 B;  1V81 A;  1K53 A;  1UWM A;  5CHW A;  4KZ0 A;  3UF8 A;  4EFO A;  4DHZ E;  4EZK A;  3R8B A;  2KDB A;  1L4Z B;  2FAZ A;  2KWC A;  4IM0 A;  1FFV A;  2ZPY A;  2KQ7 A;  4GLS C;  1SXT A;  2C5L C;  3M63 B;  1WY8 A;  2BVC A;  4GIV A;  3RUI B;  1N63 A;  2X38 A;  2A4Z A;  1RM6 C;  2DZJ A;  1WXQ A;  4WAA A;  4EOY A;  4EE2 A;  3SD5 A;  2BWF A;  2IZV B;  3A1Q B;  4BBN F;  2DZM A;  3WAP A;  3RYT A;  2IO2 B;  2WXM A;  1VCB A;  3TUO A;  2DAF A;  2JXT A;  2WDT B;  1FMA D;  4HPP A;  2KJH B;  2BS2 B;  2XNA C;  4MSM B;  1V49 A;  3PPA A;  2BPS A;  1MVK A;  3L08 A;  1WSP A;  3BIN A;  1L0V B;  2AX5 A;  3PRZ A;  1FCC C;  4ZRK A;  4PS8 A;  4A20 A;  5BYQ A;  3SFD B;  1YN5 A;  2J0J A;  5DPR A;  4YSX B;  1HQR D;  1YQB A;  1ZXI A;  4C00 A;  3DCG A;  5HHD G;  2MRP A;  1V80 A;  2MHJ A;  3SU8 X;  1WR6 E;  3TBL D;  2KKC A;  1E90 A;  3ML8 A;  1SJE D;  5IOI A;  3PS6 A;  2IGH A;  4EEW A;  1I4P A;  4AJY B;  3W5V B;  1SB3 C;  4M0W B;  1HZ6 A;  2KMA A;  4DHJ D;  3PZD A;  1WGD A;  3RFZ B;  1CJE A;  5LLI A;  4IWP A;  3ZO5 B;  1JQ4 A;  4IUM B;  5G5G A;  2Z59 B;  5DPW A;  2DNF A;  1D5X C;  1LO5 D;  4OZC A;  1WZ3 A;  1J8C A;  4MSQ B;  1IGD A;  2KTR B;  2KFJ A;  3MHZ A;  1QF6 A;  4RM9 A;  3Q3O C;  2KHW B;  4DWF A;  2G9H D;  2N1W A;  3KYC D;  4X57 B;  3DBS A;  2QDF A;  4HWI B;  2QEJ C;  1HXY D;  5TSS A;  2GLS A;  2BS3 B;  5L83 A;  1WRD B;  3V62 A;  5BMI A;  4HJK A;  2GBJ A;  2LUM A;  1H8C A;  1YQ4 B;  3BVG A;  1YJJ A;  1Q10 A;  3FKY A;  1VJK A;  2L0T A;  3PVL A;  1TY0 A;  1ENF A;  2LXA A;  1ET6 A;  1PGA A;  4GSW A;  4MJS B;  2JY6 A;  1ZKH A;  3UGB B;  5EE3 A;  2K9X A;  1WGK A;  2WXF A;  3NVV A;  4EUT A;  1XLO A;  1PGX A;  4KIK B;  4YT0 B;  3V6C B;  2IPK D;  4GDK A;  2UYZ B;  2WLB A;  4LNO A;  2MBE A;  1SE9 A;  4K1R B;  2KOX A;  2M0A A;  2JQR B;  3EFC A;  2O6V B;  2QIL A;  1TBE A;  1H4R A;  2KZR A;  3RZF A;  3ZTC A;  4MAC A;  3SHQ A;  1T0Y A;  3W2D A;  1MG4 A;  5IKC M;  3AV8 A;  3I3T B;  1I4H A;  3HM3 A;  3DBL B;  3B1L X;  4KDL B;  3RNB C;  3Q8B A;  3ZNH B;  3L10 B;  4GDL A;  1RRB A;  3I9V 1;  1I4R A;  4S17 A;  3U4E G;  1IBX A;  1FXT B;  3H7S A;  2ZCC A;  3GOE A;  3D32 A;  1KRH A;  3TEW A;  2EMS A;  2EEL A;  2GRI A;  4K7W A;  3TCA A;  3W1S A;  4LTU A;  1D6E C;  5IAA C;  2W3R A;  2IO1 B;  4HKQ A;  5D6J B;  1WX7 A;  1L6U A;  2DYO A;  3TL5 A;  4B0E A;  3N1Z C;  4NNJ B;  3OLM D;  4NY0 A;  4OVV A;  1PUT A;  1WJN A;  4ZRI A;  3TIX A;  4HPM B;  2DZI A;  3ENE A;  3KLS X;  4PK1 A;  4F1S A;  3DBH I;  1BT0 A;  3DBR I;  2K6Q A;  4B95 A;  4Q2J A;  2DWQ A;  1FXI A;  3P2B A;  4A3O A;  3C19 A;  3PTF C;  3Q3M C;  1M4V A;  1L7Y A;  3DHH C;  2Y5B B;  2NBV B;  2KFK B;  2CHW A;  3P4R B;  3EC8 A;  2BYF A;  3RCZ A;  2NTS A;  2KTF A;  2K8C A;  3BYT B;  1UF0 A;  2VZK B;  1TJE A;  4HCN B;  1P98 A;  4GB9 A;  1CMX B;  2D3B A;  3KW5 B;  2FUH B;  4W9C A;  5H8Y E;  2MJE A;  5L95 C;  3Q69 A;  5FK9 C;  3BWU D;  1AYF A;  2YLM A;  3PO0 A;  3NS8 A;  3GZN B;  2JWZ A;  1VZ7 A;  1R7S A;  3W9C B;  3K9O B;  1IGC A;  2FBW B;  3ZJU A;  4G50 A;  4WJN A;  3TEY A;  3AEF B;  2IGD A;  2LFI A;  1ZDX A;  1FD6 A;  2LUE A;  2KMM A;  3Q8A A;  2H88 B;  3O65 B;  2EMT A;  1QZE A;  4BFR A;  1WX9 A;  1C76 A;  2WXH A;  2ZVO A;  2LGI A;  4NAW A;  1IUE A;  1GC7 A;  1SF0 A;  4MGI E;  4BAX A;  2I1J A;  2N9X A;  3QX1 A;  4LJP B;  2MX2 A;  1OEY J;  1FPY A;  5I4D A;  5CX3 A;  1TS3 A;  5D2M B;  3LYY A;  3R7Q A;  3GS2 A;  2D3C A;  2J0K A;  2KWU B;  2MW5 A;  1WGH A;  1VD2 A;  3TEX A;  3WCQ A;  4ZHP A;  2E6X A;  2CJO A;  4IWQ A;  2JT4 B;  3CF6 E;  1C78 A;  4P1B C;  4WJQ A;  1KF6 B;  1WH3 A;  4MGZ E;  5BMH A;  1UEL A;  3OJ3 A;  3FIL A;  4EKU A;  2MBO A;  1I35 A;  4DBG A;  2LD9 A;  1QT9 A;  4ZOH C;  2LHD A;  4LDT B;  4M8M A;  4YL8 A;  3O13 A;  5FR3 A;  4W9F A;  1JW9 D;  1FM0 D;  1YX5 B;  4LJO B;  3AEB B;  1C79 A;  1MG8 A;  2AYO B;  4N9F 4;  3APC A;  4A55 A;  2KT7 A;  2LVQ A;  3H7P A;  1KOT A;  2ZW0 A;  2NMQ A;  3WAN A;  1JRP A;  1DYQ A;  3AE6 B;  4P1C C;  1ZXH A;  1WF9 A;  4KKJ A;  2G1E A;  3L16 A;  5D3D A;  1JML A;  4LLG M;  2KXJ A;  3IVF A;  3PHX B;  2WU2 B;  2KWD A;  1E7U A;  5AZH A;  1WRI A;  1V9J A;  2PE6 B;  2W55 A;  3U2S C;  1E7V A;  1C3T A;  1G6J A;  3PSE B;  1YNT E;  3RNF C;  4C4V A;  3AU5 A;  1F52 A;  3IAM 1;  2LEK A;  4D2K A;  1Y56 A;  2MH7 A;  4RH6 A;  1XCT L;  4P16 A;  1FEH A;  3I57 A;  3L17 A;  1BML C;  1GUA B;  2MLB A;  3TSS A;  3VVW B;  1I4Q A;  2IYD B;  2D5G A;  1KLG D;  2JYE A;  1PDX A;  3V60 A;  4BOZ B;  2BYV E;  1OQQ A;  4WH4 A;  1LM8 B;  3JW0 X;  2BS4 B;  3M3J A;  4AP4 C;  1D5M C;  4JX1 C;  5G2N A;  3B9J A;  4A8X C;  2LXC A;  2N7E A;  1AWD A;  3A4S C;  4KV2 A;  2XK5 A;  2AEH A;  1Z2M A;  2WXN A;  3ZQ4 A;  4W9I A;  2G45 B;  3CIR B;  4HDQ A;  2N7D A;  1J7C A;  3X23 A;  2KAC A;  1UBI A;  1T0R C;  2Z0E B;  1VDV A;  2V4I B;  3AB5 A;  2MEK A;  1FFU A;  4K3C A;  4DQO C;  4NQL B;  2LGS A;  4HK2 A;  3M95 A;  1R4N I;  2BKF A;  1RWS A;  5J2R A;  2LRU A;  2ZNV B;  2YEP B;  3PRP B;  3HIZ A;  4MEL A;  1D4B A;  4MGY E;  4KZC A;  3HK0 A;  1OQR A;  1GNU A;  4NJC A;  5JH5 C;  3A9J A;  2INN E;  2XEW A;  1NYR A;  1SGH A;  1TGZ B;  3AUL A;  2MCN B;  1V1O A;  1NI2 A;  2I2Y A;  2D07 B;  4MEM A;  4ANV A;  2QIE B;  2RDB C;  1TZO A;  1L6V A;  1YQ3 B;  1ZOY B;  4JLC A;  3U7D A;  1NEN B;  2DEN B;  4IOI E;  1L2N A;  4MM3 A;  1EU4 A;  2N9L A;  3ECI A;  2Z8L A;  2N9E B;  4WWP A;  4K81 A;  3T3N A;  4ARC A;  2KN4 A;  1J7A A;  3WAM A;  4TSS A;  5FR6 A;  5C3J B;  2KVZ A;  1V2Y A;  3IT4 B;  3KWV A;  1NVI D;  2INP E;  3L13 A;  3P4S B;  4XDD A;  4RF1 A;  1YN3 A;  1NEK B;  1C4A A;  1WYG A;  4FJV B;  4WWM A;  1E6E B;  1SBB B;  2K25 A;  5D94 A;  4RGN A;  1SJH D;  3KQ4 A;  5EE1 A;  4GDK B;  3ZXV A;  4G3X B;  2N1V A;  3ZNG C;  1SE3 A;  3J9C A;  5T8I A;  2J52 A; 
#chains in the Genus database with same CATH homology
 5JXV A;  1WGK A;  1XXG A;  2W54 A;  2BB5 A;  2WXP A;  2WXF A;  3NVV A;  1XLO A;  1PGX A;  1UGJ A;  4YT0 B;  5AUK A;  4YTM B;  4L2Y A;  2IPK D;  2K3U A;  5AUI A;  4AQ7 A;  2WLB A;  4KGT A;  3AE5 B;  3GB1 A;  2M0A A;  2JQR B;  2Y5P A;  5BYR A;  3OWE B;  3HRD D;  5LNK 1;  2QIL A;  4R3D A;  1P7E A;  5EE9 A;  3VRB B;  1K51 A;  2RDH A;  1V8C A;  3FAH A;  4GDL B;  3TEZ A;  4MAC A;  3SFE B;  3EGR A;  3FC4 A;  2JZP A;  1B9R A;  2IJ0 A;  2NTT A;  3EA6 A;  3W2D A;  1IBX B;  3AV8 A;  1JWS D;  1V1P B;  4FXC A;  1I4H A;  3N9Y C;  2CJN A;  1JWA D;  4DXG A;  4C7Y A;  1GB4 A;  1TKG A;  3Q8B A;  2PVG C;  1D5Z C;  2EKI A;  4AS1 A;  1KFY B;  3I9V 1;  1A70 A;  1I4R A;  3U4E G;  1BXT A;  1IBX A;  4REZ A;  2JSV X;  2J53 A;  5D3I B;  1KRH A;  5C2T B;  3TEW A;  2RMM A;  1V1P A;  2PMV A;  3BVM A;  2EEL A;  3P1M A;  2GRI A;  2SEB D;  3W1S A;  2PVO D;  1D6E C;  2I38 A;  4LTU A;  1QOF A;  4KKI A;  3URY A;  3HUI A;  3SR6 A;  1VZ8 A;  4XWT A;  3NUH B;  2W3R A;  4HKQ A;  1QOB A;  1L6U A;  1DOX A;  1XF5 L;  2DLB A;  3MC0 B;  2DYO A;  4B0M A;  5BYS A;  4B0E A;  2LJI A;  2V3P A;  1E0Z A;  1EWC A;  1YN4 A;  2WXO A;  1STE A;  2BTE A;  2Y3A A;  1PUT A;  1XCQ L;  1VRA B;  4RFB A;  2V0G A;  4JWS C;  2MJD A;  1KH0 A;  4YWG G;  1VZ6 A;  1TY2 A;  2JU6 X;  1YJI A;  2K0P A;  2WU5 B;  3KLS X;  2J4X A;  1C4C A;  4Q2J A;  3KWL A;  2DWQ A;  4A9A A;  1FXI A;  1M4V A;  1NI3 A;  2BT6 A;  3VR8 B;  4HJG E;  1ZUD 2;  1AN8 A;  5HG2 A;  3P4R B;  3RPF C;  1JWM D;  1JWB D;  2NTS A;  3BZD B;  3DWM A;  2M19 A;  3BYT B;  2IDY A;  2E3T A;  2ON8 A;  2JWU A;  2VZK B;  3NS1 A;  1TJE A;  4A90 A;  4C7Z A;  2BW2 A;  3B2G A;  1F77 A;  3P63 A;  3MP9 A;  3NRZ A;  1SEB D;  4HKZ E;  5H8Y E;  2MJE A;  1GAQ B;  4JE3 B;  2WXJ A;  3AE3 B;  3U52 E;  2WXG A;  1DOY A;  4RNA A;  3Q69 A;  5FK9 C;  1QIL A;  2LHE A;  3BWU D;  1AYF A;  2V3N A;  2BB6 A;  3PO0 A;  4OHJ A;  1I7H A;  1PFD A;  1HZ5 A;  1VZ7 A;  1R7S A;  1L5P A;  2ACZ B;  1L0X B;  1UUP A;  3W9C B;  1IGC A;  2OED A;  2PTL A;  2J42 A;  1L4D B;  1E10 A;  4A6Q A;  2FBW B;  3ZJU A;  3ZGZ A;  3L4P A;  3TEY A;  1HEZ E;  4UDU C;  4L1B A;  3VR9 B;  3AEF B;  4NAW B;  4XE0 A;  2IGD A;  2WXR A;  2LFI A;  3SEB A;  3LB8 C;  1ZDX A;  1CQV A;  1FD6 A;  2ONQ A;  2KMM A;  3Q8A A;  3Q8E A;  1AW7 A;  2H88 B;  2QMT A;  1BUI C;  4J3O D;  3T3O A;  3HVZ A;  3MFG A;  1C76 A;  2WXH A;  2MJ3 A;  2LGI A;  1ZE3 D;  1SIJ A;  1IUE A;  1SF0 A;  5D7G A;  4RCO A;  3AE1 B;  3AEE B;  1FRD A;  1QLB B;  3NVY A;  1FIQ A;  4MH8 A;  3NVZ A;  3PZ7 A;  3EUB 2;  2WDQ B;  4RF0 A;  3NZ3 A;  5I4D A;  1KTK A;  1TS3 A;  2WDR B;  4N58 A;  3ABV B;  2PIA A;  3LYY A;  4ZYS A;  1FO4 A;  4DXF A;  3GS2 A;  2WDV B;  2BYT A;  1GB1 A;  3B2F A;  3TEX A;  1EU3 A;  1XLN A;  3WCQ A;  4ZHP A;  3FIL B;  1XEE A;  4XDC A;  2E6X A;  1QKZ A;  4KGR A;  2CJO A;  3IT6 B;  3E9S A;  1C78 A;  2JYT A;  5BMG A;  3U7Z A;  1KF6 B;  4NAM A;  5BMH A;  4YXD B;  1TYG B;  4RGM A;  4C56 C;  4MT5 A;  4OVZ A;  2QSD A;  2L52 A;  3AMZ A;  4OW0 A;  3FIL A;  1QQR A;  3R2I A;  3GP7 A;  1PYW D;  2OHF A;  2KAJ A;  2L1A A;  4KGS A;  1ET9 A;  2QJL A;  4ZRQ A;  2GI9 A;  1QT9 A;  2PKO A;  1ZP0 B;  4ZOH C;  2LHD A;  1QOA A;  4IDI A;  3PZ8 A;  1K50 A;  1TKE A;  3O13 A;  1JW9 D;  1FM0 D;  2N7J A;  5FR3 A;  3AEB B;  5GXG B;  1C79 A;  1K52 A;  2Q5W D;  3V3X A;  4A55 A;  4HRO A;  1RYJ A;  3AEG B;  3LXF A;  1ACC A;  2B76 B;  3H8H A;  1TS5 A;  1F2R I;  2N9K A;  2YEP F;  1RFK A;  4ARI A;  3AED B;  2FE8 A;  3V05 A;  2ZW0 A;  2NMQ A;  2R61 A;  4N6E B;  4YTP B;  2WP9 B;  2AQ1 B;  1JRP A;  1DYQ A;  3AE6 B;  3P4P B;  2GB1 A;  3DWG C;  1ZXH A;  1C77 A;  2RPV A;  2DBY A;  4WUR A;  4US8 A;  2WQY B;  3VRA B;  1F0Z A;  1ZPS A;  2M56 B;  4KKJ A;  1VR9 A;  4YSY B;  2G1E A;  1I4G A;  2PW9 A;  1SE4 A;  5D3D A;  3AE9 B;  1JML A;  2W82 A;  4LLG M;  4USA A;  3UI3 A;  1EM7 A;  2FUG 1;  3ZJV A;  2WU2 B;  3P4Q B;  4OZB A;  1CZP A;  2KWD A;  1FNV A;  1K53 A;  1UWM A;  3BK1 A;  4ZHO A;  1WRI A;  4US9 A;  1XLQ A;  2W55 A;  4O1N A;  4XWW A;  1N60 A;  3R8B A;  3U2S C;  2WNM A;  1L4Z B;  4WQM A;  4YSZ B;  2L32 A;  1C9F A;  1YNT E;  3AH7 A;  2W3S A;  5H92 C;  3IAM 1;  2LEK A;  1FCL A;  1FFV A;  4GLS C;  4D2K A;  1SXT A;  4PT5 A;  3BYY B;  2KQ4 X;  1Y56 A;  2MH7 A;  4C80 A;  2K22 A;  1TS2 A;  4RH6 A;  1EWY C;  1XCT L;  1FEH A;  3HVD A;  3I57 A;  4P16 A;  3BVZ A;  1BML C;  2AQ2 B;  3ETR A;  2WXQ A;  3TSS A;  1N63 A;  1I4Q A;  2X38 A;  5HI1 A;  1JAL A;  1RM6 C;  4ITK A;  2D5G A;  1JCK B;  1SSN A;  1N5X A;  1KLG D;  1TS4 A;  2JYE A;  1PDX A;  3ZYY X;  1KLU D;  2HTM E;  1VLB A;  1WXQ A;  4H2A A;  3AE2 B;  4EE2 A;  1SE2 A;  3AE7 B;  1P7F A;  5EE0 A;  1OQQ A;  1DOI A;  3BK2 A;  4WH4 A;  1GOZ A;  3R2T A;  2BS4 B;  5HFY A;  1D5M C;  2PLP A;  2WXM A;  2WS3 B;  2N0S B;  1WWT A;  2IGG A;  2WXI A;  2RDG A;  4JX1 C;  3TUO A;  2CU3 A;  1ROE A;  2JX5 A;  2JXT A;  3B9J A;  3IAS 1;  4A8X C;  1FMA D;  1AWD A;  1OFF A;  2BS2 B;  2XNA C;  3NVW A;  2WXN A;  1MPE A;  1MVK A;  3AM9 A;  1F2R C;  1WSP A;  3ZQ4 A;  1L0V B;  3CIR B;  3MJ5 A;  2AX5 A;  2DYM A;  4P6V F;  1J7C A;  1FCC C;  2KDM A;  2KAC A;  1C4P A;  1E9M A;  2SAK A;  1N5W A;  1VDV A;  2V4I B;  3AB5 A;  2MEK A;  4IKG A;  1FFU A;  1E7P B;  5BYQ A;  3C8Y A;  3SFD B;  4DQO C;  1YN5 A;  1B1Z A;  4LK0 M;  3E56 A;  1T6B X;  2HDE A;  1HA5 A;  4YSX B;  1HQR D;  1ZXI A;  5HHD G;  1RWS A;  2LMC A;  1N61 A;  2TSS A;  1CK1 A;  3AEA B;  3VQI A;  2YEP B;  4TMA B;  1D4B A;  4RGT A;  1T3Q A;  1SJE D;  1FRR A;  1YMH E;  3Q8F A;  1J7B A;  1OQR A;  1XLP A;  1FNU A;  1QOG A;  1V97 A;  2IGH A;  4NJC A;  3AEC B;  3W5U B;  1I4P A;  3CWI A;  4TQ0 A;  2INN E;  5MPO A;  1NYR A;  3W5V B;  1SB3 C;  1HZ6 A;  4CQN A;  4MM3 B;  4YTN B;  1GPX A;  1V1O A;  1UWX A;  2I2Y A;  1T5X D;  3RFZ B;  2Y5C A;  5G5H A;  4NZL B;  1CJE A;  1L0Y B;  2QIE B;  1TZO A;  3P42 A;  1ZDV A;  5FKA C;  1L6V A;  1N62 A;  1YQ3 B;  1ZOY B;  1JQ4 A;  1NEN B;  1PGB A;  5G5G A;  4ZRP A;  3ZJT A;  4M0W A;  2WXL A;  4IOI E;  4JWU C;  1ESF A;  1MHX A;  1EU4 A;  1D5X C;  2WXK A;  1LO5 D;  4OZC A;  2N9L A;  5E6J A;  2Z8L A;  3IXS A;  1IGD A;  2ZW1 A;  3BII D;  3AN1 A;  3MHZ A;  1TKY A;  1QF6 A;  3T3N A;  2L83 A;  1JWU D;  4ARC A;  2G9H D;  2KN4 A;  1J7A A;  1XO3 A;  4WIP A;  1MI0 A;  4OZA A;  1DGJ A;  2QEJ C;  1HXY D;  4TSS A;  5C3J B;  1NYQ A;  5TSS A;  3IT4 B;  2BS3 B;  3KWV A;  1NVI D;  1UNS A;  2INP E;  4HRS A;  3P4S B;  3Q8C A;  2AQ3 B;  5BMI A;  2ICI A;  4XDD A;  4RF1 A;  2VZK D;  1YN3 A;  1MHH E;  1NEK B;  2K5P A;  2XN9 C;  1FXA A;  2LUM A;  1C4A A;  1WYG A;  1YQ4 B;  3BVG A;  1FNW A;  1YJJ A;  1Q10 A;  4WWM A;  1VJK A;  1E6E B;  1SBB B;  1TY0 A;  3AE8 B;  4WAF A;  1ENF A;  4RGN A;  1JRO A;  4JPS A;  4KX6 B;  1SJH D;  4HEA 1;  3KQ4 A;  5EE1 A;  3AE4 B;  1ET6 A;  4L23 A;  4RGO S;  4GDK B;  1PGA A;  4N59 A;  4TQ1 A;  1I4X A;  1SE3 A;  2H89 B;  3J9C A;  5T8I A;  2J52 A;  2BBC A;  5EE3 A;  2K9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...