1U4AA

Solution structure of human sumo-3 c47s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein SMT3A
publication title Solution Structure of Human SUMO-3 C47S and Its Binding Surface for Ubc9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1u4aA00
4GMVA 2YLMA 3HIZA 4HXDA 4PS3A 4EZJA 4FADA 1J0GA 3HK0A 1UBIA 1RLFA 3UQAA 3OAWA 1WGDA 3PHWB 5D94A 2MBEA 4LDTD 5C23A 1RFAA 3ZNHB 4IM0A 3ZDMC 4ZDVA 3H6NA 2MBHA 3MJWA 2RPQA 4W9DA 4M8MA 2JZ3B 2D11A 2FCNA 2KTRA 1RRBA 4JLCA 1WIAA 2ZZPB 2ZEQA 3PHXB 2OOBB 1UH6A 4BFRA 5EDSA 3ZIMA 3DBLI 1WR1A 4GN1A 4G11A 2KC2A 2KO3A 2L00B 3T8MA 1AARA 4W9IA 3A9JA 1YQBA 2LRWA 1P9DU 5G55A 2ZPYA 4FHKA 3X23A 1OEYA 3VTUA 1TTNA 2HTHA 3BY4B 3B0AA 3IBEA 4MEMA 4F7ZA 4DHJB 3DDCB 2L76A 2KTRB 2KWUB 3W1SA 3R7QA 2C7NB 4KZCA 3TJPA 4BBNF 3CSTA 5C1ZA 4IM2A 2JUOA 2LI5A 2WYQA 5CTRC 3UF8A 1IP9A 2KK8A 3A9JB 4FJYA 4KZ0A 4PS7A 3ZRCA 1I35A 4LJOB 2Y5BB 3ZO5B 3VUWA 2M17A 2I1JA 3ZW3A 2NCNA 4ANWA 1V49A 5AEKB 2C7HA 2V4LA 2FAZA 4URKA 1Z2MA 4LCDE 2AL6A 3HM6X 2QHOA 1ISNA 2JXXA 2LVPA 4MELA 4ASWC 5DPTA 2KVRA 2MRPA 4IWOA 2NBUA 5DPRA 3B1LX 1WE6A 1YX6B 2N9PC 2LVQA 3U30A 1WI0A 2JT4B 2IBIB 4HCPB 1OTRB 1QZEA 4NJ6A 3DVGY 1ZKHA 2NPTA 3AXCA 5DCNA 2IYDB 4LDTB 1WJNA 3OLMD 1SE9A 2KDEB 2UYZB 4GU2A 2RSUA 1M94A 2L3ZA 3M95A 1I42A 4OVUA 4EOYA 2IY0B 2JWZA 1UBQA 2LVOA 4HK2A 5CX3A 3ZNZB 3KUDB 2YVCA 4WWPA 1D3ZA 2MBOA 3PREA 2UWQA 3M63B 4NQLB 1XQQA 3DVNU 2DZMA 3ZTCA 2NPTB 1IPGA 1LM8B 2ZCCA 2HJ8A 2CHWA 2EKEC 1OGWA 1WYWB 2D3GA 3ZTDA 1OQYA 4W9CA 4A3OA 4BKGA 3DBSA 4JL9A 2IZVB 3N30A 3PPAA 2D07B 2JZZA 2PPHA 4FN2A 4TKNA 2G4SA 2KDBA 1WJUA 4DDID 3IHPC 2BWFA 4EUTA 2DHZA 5CHWA 4A3PA 2M0XA 1PQSA 1HE8A 2KDFB 1KJTA 4DK5A 2R2OA 2K1FA 3V6CB 1WX7A 3BINA 3I3TB 1J8CA 4BKSD 2REXA 3A33B 2GMIC 2C60A 3L16A 2DZJA 2L7RA 4NNJB 3KUCB 2KXJA 4EZKA 3U8ZA 2BWES 1JRUA 2KOXA 4KIKA 5J18A 2KJRA 4AP4C 1S3SG 4P7IA 4EEWA 3HM3A 1WGYA 5CHFA 3D32A 4DHZE 4WQOB 4DHZB 2ZNVC 3IVFA 3WA0A 1TZ1A 4HCNB 2IO1B 5JHBA 1IYFA 2DX5B 2GBRA 3ZDTA 2LGXA 2KTFA 2Z0DB 4NQKE 3A1QA 2O6VD 2N1WA 3ALBA 2BF8B 2L0TA 2D10A 2FNJB 2O2VA 3RD2A 2DYOA 2JF5A 4KIKB 3JVZX 3A9KA 4NY0A 4XC2A 2KDIA 1SIFA 2KANA 2A4ZA 1XT9B 3ZRFA 1WH3A 4W9EA 1WXSA 2PJHA 1R4MI 5AZFA 1T0YA 4WWNA 5E6NA 2KQ7A 2ZJDA 2FCQA 1GC6A 2MCNB 2PE9A 2W9NA 3A1QB 1KM7A 3VTWA 3P2BA 3PGEA 4RM9A 2O2VB 1V5TA 3R7RA 2IO0B 2WDTB 2IY1B 2DAFA 3A9KB 1V80A 2CU1A 1X1MA 1WRDB 1WZ0A 4E3CA 3SU8X 3VUXA 3NS8A 3AI5A 3NZUA 3PRMB 3R3MA 3RT3B 5D6JB 1RAXA 5LXHA 3APDA 1WXMA 1VD2A 2GBNA 4GIVA 4KSLC 3RULA 1G6JA 3DVNV 1H8CA 3APCA 2O6VA 2CHXA 4II2B 1A5RA 3O65B 4II3B 5JHAA 2BGFA 1OEYJ 3L54A 1GUAB 2R2QA 2L8JA 4ICVA 3PRZA 1Q1OA 4JGHB 4XX5A 4RMAA 3DOWA 4TV3A 4PS8A 4MH0E 3ML9A 2JRIB 1J19A 1L7YA 3Q3FA 2LGDA 3H1UA 1YD8U 2DZIA 4MJSA 2KX3A 3U7DA 2O6VB 4IC7B 4TUUA 1WY8A 2DYBA 1XD3B 4HWIB 2K25A 4EFOA 3M3JA 1S1QB 4KV2A 2K8CA 4I6LB 3W1SC 3QAQA 4AJWA 1V9JA 4E71A 2LXCA 3VDZA 2GBJA 3AU5A 2L0FA 3RYTA 3VAWA 1E7VA 3CMMB 4X57B 2FCSA 2G45B 4I6NB 4MJSB 2FCMA 1Q0WB 4GB9A 2MBBB 1ZW7A 3ENEA 2KWVB 4MSMB 5E6OA 5D7GA 3QQ8B 2ZVNA 1WXVA 4FLHA 2LGYA 4ZRKA 3RUIB 1GC7A 1P0RA 3S2AA 2LZ6A 3PLUA 2BYFA 3ZVVA 4WJQA 4KSKC 2DYMA 3EC8A 3WAMA 2N4FA 3QX1A 4HPLB 3K9PB 2CHZA 4ANVA 1UZXB 2WWZA 2ZCBA 4AOFA 4B95A 4BOZB 2NBVB 3TCAA 3ZNGC 1WFYA 2K6QA 2KQSA 2MA9B 1WM2A 2Z59B 1WGGA 5FR6A 2N9XA 1TBEA 1H4RA 3APFA 2BKRB 1UELA 4J6IA 3L17A 3SHQA 3VVWB 4N9F4 2LXAA 1LQBA 2JY6A 4K7UA 4IWPA 4EZLA 5JH5C 2BKFA 1NDDA 3KUZA 5L83A 1P1AA 1WGRA 2K39A 2GOWA 2KLCA 2I1KA 2XBBC 2AYOB 2HE7A 2JRHA 3HHMA 4FHJA 3DQVA 4W9JA 1R4NI 4BBNC 4FULA 3WAPA 5GMVA 3X0WA 3V60A 5IA7A 4K7WA 5E6PA 3ZKJC 1UD7A 1YIWA 4W9GA 1P3QU 3EFUA 4CYEA 3V61A 4K1RB 2AEHA 3NOBA 3L0WB 4I6PA 2J7QB 2D2QA 2BPSA 2MSED 3LJ3A 2B3AA 5DPSA 3AU4A 2MX2A 3PV1A 4IW0A 1E8ZA 2KX0A 1K8RB 4WJOA 2JVCA 5IAAC 4MGYE 3IG3A 1Z5SB 1SGHA 3Q3JA 3RCZA 5L95C 3PSEB 3LDZE 4K81A 2KHWB 5KHQA 5BO4B 4F1SA 1WX9A 2PEAA 4RM8A 1WR6E 5HKHA 4NPNA 2ZVOA 3EECA 4CO7A 3K9OB 5JZEB 3JSVA 4W9HA 1TGZB 3VUYA 1LFDA 1MG8A 4M0WB 2K8HA 4FA6A 3QA8A 4ICUA 1WZ3A 2KZRA 4BKSA 2FUHB 3A4RA 4FJZA 2CKHB 2J0KA 1EF5A 3CF6E 1YX5B 3QIJA 3VFKA 3OJ3A 3TL5A 3UGBB 5TR5A 5LLIA 4HDOA 3NHEB 1WGHA 2N7DA 2AWTA 5KHOA 3ML8A 3WIMA 2KC1A 3DCGA 3PVLA 4IG7B 3H7PA 3WALA 3DBHI 3N3KB 3JSVB 3OJ4B 3GOEA 2LRUA 4DWFA 3EHVA 4AUQC 2XEWA 3QJZA 3TIXA 3ZLZA 1WJ4A 2KKCA 1WM3A 4B9KA 2NVUI 4W9KA 1GJZA 1C1YB 1L2NA 2NS5A 5LXIB 1GNUA 2PE6B 4B6WA 4ANXA 3SD5A 3DPDA 3QC8B 1WX8A 2MP2A 3H7PB 2DENB 3PLVA 1VCBA 5D2MB 4HPMB 4LJPB 4WJNA 4F8CB 2CR5A 1EUVB 3PT2B 2EMSA 3N32A 3WAOA 1E7UA 4ANUA 1E8XA 3GZNI 5AZHA 1KLVA 2MLBA 3UQBA 2JPHA 2A5UA 4JQWC 5G2NA 3PRPB 4K7SA 2MP2B 3AULA 2KJ6A 3KH0A 3PZDA 1WF9A 3H7SA 4G0NB 4G50A 4PYUA 4ZYNA 1P98A 1E5WA 2DZKA 3ONSA 4XZ4A 4FJVB 2KMAA 1BT0A 2DAJA 4KDIC 3VH3B 2V3SA 3VQIA 1EO6A 4TQ0A 5AZGA 3B08A 3T9LA 4BOSC 2IO3B 2AL3A 2M8SA 3RZFA 1NI2A 3DBRI 3NZSA 2N1VA 1WMHA 2V1YA 3DVGX 2L05A 4DXAB 2HD5B 3C0RB 1LXDA 4YL8A 2WX0A 2C7MB 2KWCA 2M4NA 3UIPB 1Y8RC 3VXWA 2LUEA 2MQJA 3JW0X 3KVFB 3ZUNA 4KDLB 4PYZA 3CSFA 2M1MA 4HVBA 2N9EB 3M62B 4FBJB 4W9LA 2KD0A 4M8NA 4GOCA 3L08A 1EF1A 1NBFC 1WMHB 3IFWB 1V81A 4ZRIA 4GDKA 2OJRA 4NAWA 3UIOB 2GBKA 2LWPA 4BKTA 3PTFC 2VRRB 4GXBA 3V62A 2KFKA 2RR9A 2XK5A 4G3XB 2MWSB 1Q5WB 4MGIE 2KLGA 2KJHB 2J0JA 3L10B 3H9DA 2Z0EB 1ZGUB 1V86A 4GSWA 2RD0A 2KMCA 2RGFA 1UGMA 2ZPNA 3VTVA 4CHKA 1C3TA 1WJ6A 2EMTA 3JYUA 3PS6A 3R66C 4IUMB 3SDLC 3KW5B 4GDKB 3UINB 5DPWA 4NAWB 4HLEA 2KFKB 3ECIA 3NY5A 4TQ1A 3V6EB 2XK5B 3MTNB 2C9WB 3QCAA 4MM3A 4WAAA 1E8WA 3KYDD 2WX1A 2ASQA 4ZRJA 4WJPA 4HJKA 1KOTA 4HDQA 4DBGA 2MBQA 3QK0A 4IM3A 2LJ5A 3QARA 1FXTB 2KN5A 1WXAA 4MGZE 2C5LC 4E74A 2K6DB 1V6EA 2KNBA 4AWJA 4OVVA 2BYVE 4A20A 1GG3A 3QWZB 2NBWB 3ZNID 5J2RA 4MGKE 1CMXB 4GDLA 4WWOA 2GBMA 4IWQA 1WE7A 2NR2A 4KVGB 2N7EA 2BYEA 4JIOU 4BVUC 4DHJD 4GGQA 2IO2B 4DDGD 2FIFA 4AJYB 1E90A 4MSQB 4MDKE 3VH4B 2FIDA 2ZNVB 3L13A 3TBLD 4NJ7A 2G4DB 2J0MA 2G3QB 3MHSD 3TMPB 1U4AA 2MW5A 1V5OA 3KYCD 5CHVC 4GDLB 4EKUA 2K8BA 3RZWC 5J17A 3W1YA 1YJ1A 2LASA 2CS4A 1V2YA 1F9JA 2LD9A 3A4SC 2KFJA 4W9FA 3VHTC 3WANA 1E8YA 3QHTA
chains in the Genus database with same CATH superfamily
4HXDA 4AS1A 2IGGA 4LLGM 3UQAA 3OAWA 2BT6A 1WGDA 2L32A 2HJ1A 5C23A 2RPQA 3BVMA 2KTRA 4JLCA 2INNE 2OOBB 1OFFA 2QDFA 3ZIMA 3DBLI 3WCQA 4KKJA 2KC2A 2KO3A 2L00B 1AARA 4W9IA 1CZPA 2DNFA 3MJ5A 3B0AA 3IBEA 2BS3B 2KTRB 3R7QA 1JROA 1HTQA 4YSXB 1HXYD 2JUOA 1QLBB 4KZ0A 4PS7A 1K51A 2Y5BB 3ZO5B 3NVWA 1V49A 3HM6X 4ASWC 1ISNA 5HFYA 3VRAB 4IWOA 3B1LX 2N9PC 3N1YC 4PK1A 1WI0A 2JT4B 1DOYA 1OTRB 4NJ6A 3RN9C 4GU2A 2G1EA 2RSUA 4Q2JA 1STEA 2LVOA 4RNAA 5CX3A 3KUDB 2MBOA 3PREA 3N1ZC 5MPOA 1LM8B 1D5ZC 2OEDA 5FK9C 1ESFA 3ZTDA 1OQYA 4W9CA 3NVVA 2IZVB 1HTOA 2D07B 2PPHA 4FN2A 2J4XA 2G4SA 4DDID 4A3PA 2M0XA 5LNK1 1KTKA 2KDFB 2RDBC 2NTSA 2WDVB 4BKSD 2REXA 1JALA 2C60A 4NNJB 4OZBA 3U8ZA 2BWES 3Q3NC 4P7IA 4EEWA 1WGYA 2BYTA 4HEA1 4ZYSA 3WA0A 3IVFA 2IO1B 3BWUD 2GBRA 4ARCA 2WXRA 3TEWA 2O6VD 2N1WA 1SE2A 2DYOA 2JF5A 3DBHB 2KDIA 1SIFA 2WNMA 2A4ZA 3EFCA 3P4SB 3ZRFA 2Y3AA 2PJHA 1M4VA 5AZFA 2XN9C 2FCQA 4KX6B 2W9NA 1OQRA 3P2BA 1V5TA 2WDTB 1X1MA 3SU8X 3NZUA 3RT3B 5LXHA 1DOIA 1WXMA 1R7SA 1G6JA 3APCA 3W2DA 1UUPA 2CHXA 4EE2A 1TKYA 1OEYJ 3L54A 1D6EC 2K0PA 1PDXA 1XF5L 2PIAA 4XX5A 3CIRB 2J53A 2LHEA 1N6ZA 2DZIA 3DBRB 4HKQA 1WY8A 4A8XC 3M3JA 3QAQA 1JWMD 1HQRD 2GBJA 3RYTA 2JYEA 3V3XA 3SEBA 1JMLA 1HA5A 1WXVA 4P1CC 2LGYA 4ZRKA 3S2AA 3PLUA 2BYFA 4OHJA 3TCAA 4KGSA 1I4GA 1XLNA 4L2YA 1WGGA 5FR6A 2W54A 4P1BC 3AMZA 2GLSA 2BKRB 4N9F4 4R3DA 1KF6B 4IWPA 4K7UA 1F2RC 2BKFA 3HVZA 1WGRA 2K39A 2GOWA 2SAKA 3N9YC 3HHMA 1TY2A 1SBBB 4W9JA 3WAPA 3X0WA 5IA7A 4K7WA 5E6PA 1YIWA 1Q10A 3NOBA 2PW9A 3BVZA 1C78A 4YTPB 3AU4A 1F1HA 3PV1A 2KX0A 1GOZA 3RNGC 1P7EA 4RCOA 4LTUA 3ZYYX 3AV8A 5JXVA 3TEZA 3EECA 4CO7A 3K9OB 4W9HA 1TGZB 2AQ2B 1FEHA 3Q6BA 4USAA 1E7PB 3VFKA 2QEJC 4FXCA 1YX5B 3I57A 3OJ3A 1ZXIA 4AQ7A 1WGHA 1I4QA 1RFKA 4C00A 4IG7B 3WALA 3DBHI 1L0XB 3EHVA 3MC8A 3QJZA 1BUIC 3TIXA 1FXIA 1T0RC 1C9FA 4ANXA 3SD5A 3PLVA 5I4DA 4F8CB 5E6JA 1SXTA 3AB5A 3AECB 5AZHA 2JPHA 2A5UA 2EELA 3PRPB 1JRPA 2DLBA 2K22A 3PZDA 1WF9A 4PYUA 1P98A 1E5WA 2LMCA 1BT0A 4C80A 3KWVA 4N58A 1EO6A 1F52A 5AZGA 3B2GA 3RZFA 3DBRI 3L4PA 2N1VA 3O13A 3DVGX 2AQ1B 4D2KA 3EGRA 1N61A 4DXAB 4YWGG 4NAMA 1LXDA 5IKCM 2VZKB 2M4NA 1Y8RC 3KVFB 1ZP0B 4KDLB 2M1MA 4QAYA 1QT9A 2KN4A 4M8NA 1EF1A 2QIEB 4ZRIA 4GDKA 1B9RA 1RWSA 2OJRA 1SE3A 4NAWA 4BKTA 2VRRB 4GXBA 3V62A 5C3JB 4MGIE 3AE3B 2MJDA 1ZGUB 1V86A 1UGMA 2ZPNA 3JYUA 2EMTA 4IUMB 4GDKB 4NAWB 1TKGA 4LNKA 4HLEA 3ECIA 2ZW0A 3OWEB 2N9LA 4MM3A 4WAAA 3KYDD 2ASQA 4ZRJA 1PGXA 4IM3A 2LJ5A 4XDCA 4O1NA 2KN5A 5EE3A 1WXAA 1SJED 1V6EA 4OVVA 3W5VB 2V9HA 4DXFA 1N5XA 2NBWB 4MM3B 2GBMA 1WE7A 1J7CA 1T3QA 2FIFA 1FXAA 4MDKE 1C76A 1N62A 2VH1A 2W55A 2G3QB 3AE9B 2MW5A 3BVGA 2RDHA 3RZWC 3W1YA 1DYQA 2LD9A 3VHTC 1F9JA 2GB1A 4W9FA 1T6BX 2ONQA 2YLMA 1N5WA 3HIZA 4PS3A 4YT0B 1D5XC 2BB5A 4FADA 1J0GA 1RLFA 4RGTA 4L1BA 3RNFC 4LDTD 2KACA 1RFAA 3ZNHB 3ZDMC 3H6NA 3MJWA 4W9DA 2QMTA 4M8MA 2JZ3B 2D11A 1GAQB 4M00A 3AEDB 1UH6A 5EDSA 4GN1A 5IO9A 3A9JA 2LRWA 2MEKA 4FHKA 3X23A 1OEYA 1TTNA 2HTHA 4MEMA 2GRIA 4DHJB 3DDCB 1QKZA 3I63C 4YTNB 3VR8B 4KZCA 4IM2A 2WYQA 3UF8A 1IP9A 1WWTA 3A9JB 4FJYA 4C7YA 4LJOB 2I1JA 3ZW3A 2NCNA 3RNCC 2V4LA 4LCDE 5DPTA 2NBUA 4MT5A 1WE6A 3U30A 4C4VA 3E9SA 3MHZA 1QZEA 4XWWA 5DCNA 2UYZB 2Y5CA 1M94A 2L3ZA 3M95A 4EOYA 4HK2A 3GS2A 1D3ZA 4C4VB 4NQLB 1XQQA 4RGNA 1R4NB 2HJ8A 2EKEC 1OGWA 1WYWB 3TSSA 4JL9A 4TMAB 1I4HA 3DWMA 4JE3B 3IHPC 2E3TA 2DHZA 4WH4A 1C77A 1QOAA 4J3OD 3V6CB 2M0AA 2KMMA 3BINA 3I3TB 1KFYB 1UGJA 2GMIC 2WXFA 3L16A 2L7RA 3KUCB 2KXJA 1JRUA 5J18A 3U7ZA 3Q8CA 1K50A 3D32A 2JZPA 4S17A 4WQOB 4DHZB 1JWAD 3P42A 1TZ1A 1IYFA 2DX5B 4XDDA 1ZXHA 2Z0DB 4NQKE 3ALBA 2D10A 1L6VA 3AN1A 1WH3A 1TKEA 3MC0B 4WWNA 1F0ZA 2JU6X 1SEBD 3VTWA 1KM7A 1VDVA 2IY1B 3PO0A 1RYJA 2WGSA 2CU1A 3SFEB 3NS8A 3AI5A 1AYFA 5D6JB 5EE9A 2GBNA 4GIVA 3DVNV 1MHXA 4II2B 3DHIC 4MACA 4ZRPA 4II3B 3MFGA 3LB8C 5JHAA 2BGFA 2R2QA 1NVID 4ICVA 1ET6A 1Q1OA 3AM9A 4RMAA 3DOWA 4TV3A 5GXGB 4PS8A 4MH0E 2JRIB 2LGDA 3H1UA 3U7DA 4IC7B 4TUUA 3BIID 3BYTB 3DHHC 2DYBA 4HWIB 2K8CA 1QF6A 4N59A 1K53A 4E71A 2LXCA 3NRZA 2L0FA 2D5GA 4ZHPA 4XGAB 2G45B 4I6NB 2FCMA 2D3BA 1A70A 4MSMB 3QQ8B 1N60A 4FLHA 1GC7A 1ROEA 4HPLB 3K9PB 4B95A 2WWZA 4AOFA 2VH2A 3ZNGC 3ZJVA 1UWXA 1H4RA 4J6IA 4US8A 1T5XD 3Q2AC 5C2TB 2V3PA 1P1AA 3FC4A 2D3CA 2I1KA 2HE7A 2W82A 3P4QB 1R4NI 5GMVA 3V60A 3ZKJC 4W9GA 1P3QU 2LFIA 2AEHA 4I6PA 2BPSA 3FKYA 2B3AA 1L0YB 2JVCA 1TS4A 3NG0A 2ACZB 3RCZA 3PSEB 5EE0A 3LDZE 4PT5A 5KHQA 4F1SA 4RM8A 3IAS1 2ZVOA 5JZEB 2HTME 1ZUD2 2HDEA 2K3UA 3VUYA 4JX1C 3QA8A 4ICUA 2FUG1 2KZRA 4FJZA 2CKHB 3CF6E 4ACFA 3AE7B 1PUTA 1TS2A 2AWTA 5G5GA 2KC1A 3DCGA 1PYWD 3DWGC 3OJ4B 1LO5D 2W3SA 1YN5A 3RNAC 1TZOA 4YTMB 2NVUI 1PFDA 4W9KA 1TIFA 2NS5A 1GNUA 2KVZA 2PE6B 1FIQA 3DPDA 1XCTL 4JPSA 2DENB 5BMHA 1VCBA 1EWCA 3NJTA 2BS2B 4WJNA 1EUVB 3PT2B 2CJNA 2EMSA 1NEKB 1KLVA 5AUKA 1FNVA 4CQNA 3H7SA 5HHDG 1E0ZA 4FJVB 4KDIC 3VH3B 2V3SA 4GLSC 1VLBA 4LNNA 2WU5B 1FCLA 2V1YA 5FKAC 4JWSC 2FE8A 2HD5B 1SSNA 4YL8A 2C7MB 1DGJA 4OZCA 4PYZA 1KH0A 1JCKB 4GOCA 3L08A 1NBFC 1V81A 1TS3A 3UIOB 1P7FA 2GBKA 2KFKA 2RR9A 3LYYA 2JYTA 2CJOA 1QOGA 3RNBC 4GSWA 4RGOS 1XLOA 2RGFA 1WJ6A 3PS6A 3R66C 4KKIA 3SDLC 3N1XC 1FNUA 2INPE 2L83A 2FBWB 2UU7A 2KFKB 3NY5A 2C9WB 1F2RI 2WX1A 4WJPA 4DBGA 3ETRA 3SFDB 2V3NA 2N0SB 1VRAB 4E74A 2C5LC 1NENB 1I4PA 1E10A 2KYWA 4AWJA 1GG3A 3QWZB 3NUHB 5J2RA 1CMXB 4GDLA 4HJGE 1JWSD 2N7EA 2QCZA 3U52E 2MJEA 4HROA 1E90A 3VH4B 2FIDA 2ZNVB 3L13A 3AEFB 4KGRA 2G4DB 2J0MA 1MHHE 3TMPB 1SJHD 3KYCD 5CHVC 4GDLB 4EKUA 3T3NA 2M56B 3Q8BA 1YJ1A 1NYRA 3H8HA 1V2YA 3WANA 1E8YA 4GMVA 2AX5A 4K3BA 2LEKA 4EZJA 3HK0A 1T0QC 2LHDA 1IGDA 3PHWB 2MBEA 2SEBD 2FCNA 4A90A 2INDC 1RRBA 4ZHOA 1WIAA 2ZEQA 2H88B 1V1PA 1WR1A 3IXSA 3BY4B 3BK1A 2IGDA 4HKZE 4JWUC 1YJIA 2Y5PA 3TJPA 4BBNF 4IKGA 5C1ZA 1V1PB 2LI5A 2RDGA 1I35A 2M17A 4ANWA 3RPFC 3URYA 3RFZB 2FAZA 2PTLA 1Z2MA 4URKA 2AL6A 2NTTA 2X38A 2RMMA 1XLPA 1YX6B 2TSSA 1SIJA 4HCPB 1ENFA 2G9HD 2WDQB 3DVGY 2IYDB 1WJNA 3KWLA 3OLMD 2BS4B 2KDEB 1HEZE 1I42A 4OVUA 1UNSA 2IY0B 2JWZA 3ZNZB 2YVCA 4WWPA 2UWQA 2WDRB 3M63B 1C4PA 5BYSA 3GE8C 3DVNU 3ZTCA 1D5MC 2ZCCA 3AEEB 2CHWA 1UF0A 4BKGA 3LXFA 3U4EG 3N30A 4DQOC 1NI3A 2JZZA 3W9CB 4EUTA 1JWBD 5CHWA 3KQ4A 1HE8A 2QSDA 1KJTA 2K1FA 2KAJA 2K9XA 1YMHE 3A33B 2DZJA 3NZ3A 1XXGA 1ZE3D 2KOXA 3R2TA 3PZ7A 2L1AA 2MH7A 4M01A 4DHZE 2ZNVC 5JHBA 4HCNB 2WXQA 3ZDTA 2KTFA 3A1QA 2L0TA 4HRSA 1T0SC 2O2VA 1K52A 1I4XA 4NY0A 1WXSA 2WXPA 3Q14C 4S0RA 2ZJDA 3PZ8A 5D3DA 1GC6A 2MCNB 2PE9A 3A1QB 4YSYB 2O2VB 3R7RA 1TJEA 2KQ4X 1C79A 4REZA 3UI3A 1V80A 1WRDB 4E3CA 3PRMB 3R3MA 3DBLB 3APDA 3C19A 3GZNB 3RULA 3ZXRA 1H8CA 4LNIA 2O6VA 1SE4A 3O65B 3R2IA 3GE3C 2L8JA 3PRZA 1C4AA 3N20C 3T3OA 3ML9A 3Q3FA 1IBXA 2O6VB 2QC8A 3C8YA 1XD3B 4EFOA 1VZ6A 1S1QB 4KV2A 2WHIA 4WURA 4TSSA 4K3CA 1E7VA 1PGBA 1IBXB 4X57B 2FCSA 2OHFA 2W3RA 1Q0WB 4GB9A 1IUEA 2KWVB 2ZVNA 4M02A 2WQYB 1P0RA 4WJQA 1I4RA 3ZJUA 3EC8A 2N4FA 2OJWA 3QX1A 1E6EB 2CHZA 4ANVA 2PLPA 2ZCBA 4BOZB 4HPPA 1XEEA 2K6QA 1ZDXA 2KQSA 4IOIE 4ZOHC 2N9XA 3APFA 3L17A 3SHQA 3VVWB 4RF0A 2JY6A 1SB3C 2WLBA 5JH5C 2IGHA 3KUZA 2JX5A 2PVOD 2KLCA 1B1ZA 3J9CA 3DQVA 1KLGD 3RNEC 1YN4A 2B76B 1AN8A 3EFUA 4CYEA 3GB1A 1FRRA 4K1RB 5T8IA 1F77A 2D2QA 2MSED 5BMIA 4A6QA 5AUIA 2MX2A 4IW0A 1K8RB 4IDIA 1LGRA 4NZLB 4MGYE 3IG3A 1IGCA 1SGHA 1Z5SB 3Q3JA 1QQRA 5BO4B 2PEAA 3VR9B 1WR6E 5HKHA 3HVDA 1L5PA 1XCQL 4P16A 2K8HA 1YQ4B 2FUHB 3A4RA 3QIJA 3TL5A 3UGBB 5TR5A 5LLIA 2N7DA 1CK1A 1FO4A 5KHOA 3ML8A 3WIMA 3PVLA 4DXGA 4C56C 3GOEA 2LRUA 4DWFA 4AUQC 2XEWA 2VZKD 3ZLZA 2KKCA 4WQMA 1VR9A 1EM7A 5LXIB 4B6WA 1WX8A 4HPMB 2CR5A 2K5PA 1QILA 3N32A 1NYQA 1E7UA 3TEXA 1E8XA 1FNWA 3GZNI 1TT5B 3UQBA 4JQWC 5G2NA 4K7SA 2J42A 1VJKA 2KJ6A 3KH0A 4G0NB 4ZYNA 1FMAD 3ZXVA 1FD6A 3ONSA 3DHGC 1GB1A 3T9LA 1FFVA 4BOSC 1D4BA 5H92C 2AL3A 1FFUA 2N9KA 2KWCA 1XLQA 2BVCA 2LUEA 2MQJA 3JW0X 3ZUNA 4HVBA 2N9EB 2CU3A 2KD0A 4BZAA 3IFWB 3AEBB 3PTFC 2RPVA 1YN3A 3Q8AA 3Q8EA 4G3XB 2Z8LA 1Q5WB 3BZDB 5HI1A 1SF0A 3H9DA 2Z0EB 3L10B 3Q69A 2RD0A 1C3TA 4RH6A 2I38A 3KW5B 3MP9A 3V6EB 3QCAA 4WAFA 4HJKA 1KOTA 2MBQA 3QARA 1FXTB 3AE2B 4YSZB 4KGTA 4MGZE 3NVYA 1WYGA 2BYVE 3FILA 1MI0A 4N6EB 4A20A 3EUB2 3ZNID 2BB6A 1TS5A 1L0VB 4MGKE 4LK0M 4WWOA 1MJDA 5G5HA 2BYEA 4DHJD 4GGQA 4DDGD 1QOBA 4AJYB 1R4MB 3HRDD 4MSQB 2XNAC 1ET9A 3FILB 2BW2A 2LUMA 3MHSD 1U4AA 1V5OA 2NMQA 5H8YE 2IPKD 2LASA 2CS4A 4A55A 3QHTA 3IT4B 4WWMA 1UWMA 1UBIA 1KLUD 5D94A 2J52A 4IM0A 4ZDVA 2MBHA 3AE4B 1L4ZB 2ZZPB 2M19A 3PHXB 4BFRA 2BTEA 4G11A 3T8MA 4LNFA 3B2FA 1YQBA 5G55A 1P9DU 3SR6A 2WXIA 2ZPYA 2INCC 3VTUA 4YXDB 4F7ZA 2L76A 2KWUB 3W1SA 1KRHA 2C7NB 3CSTA 3B9JA 1YQ3B 1EU4A 5CTRC 2KK8A 4UDUC 2N7JA 3ZRCA 1V1OA 3VUWA 4RF1A 3V05A 4LNOA 5AEKB 2C7HA 2L52A 3AEAB 2QHOA 2JXXA 4MELA 2LVPA 2Q5WD 4OW0A 2KVRA 1ACCA 2MRPA 5DPRA 1Y56A 2LVQA 2IBIB 1ZKHA 1WXQA 2NPTA 3AXCA 4LDTB 5BYQA 1SE9A 3U2SC 1UBQA 2WXNA 2X8XX 1C4CA 5BYRA 2DZMA 1OQQA 1EU3A 2D3AA 2NPTB 1WRIA 1IPGA 2D3GA 2AQ3B 2R61A 1FCCC 4A3OA 4ITKA 3DBSA 1ZPSA 3PPAA 1MVKA 4TKNA 4XE0A 2KDBA 1WJUA 2BWFA 4RGMA 3I5JC 4RFBA 1PQSA 2R2OA 1WX7A 1J7AA 1J8CA 3RI7C 5IN7A 1AWDA 1FM0D 4EZKA 4KIKA 4WIPA 2KJRA 3EA6A 1S3SG 4AP4C 2DWQA 1YJJA 1MG4A 3HM3A 3P4PB 5CHFA 3AE6B 1L6UA 2LGXA 3KLSX 1V8CA 2BF8B 2FNJB 3HUIA 1AW7A 3RD2A 4KIKB 3JVZX 3A9KA 4H2AA 4XC2A 2KANA 1XT9B 3E56A 4W9EA 1WSPA 1TY0A 1EWYC 1R4MI 1T0YA 5E6NA 2KQ7A 2LGSA 3ABVB 4RM9A 3PGEA 1CQVA 3AH7A 2JXTA 2IO0B 2DAFA 3A9KB 3AE5B 1WZ0A 2YEPB 3VUXA 1RAXA 4C7ZA 1VD2A 4KSLC 1JWUD 2BBCA 4XWTA 4BAXA 4OVZA 5TSSA 1A5RA 2WXJA 1FPYA 1GUAB 1QOFA 4JGHB 1V97A 3OG5A 1GB4A 3P63A 1J19A 1L7YA 1YD8U 4MJSA 2KX3A 2K25A 4I6LB 3Q8FA 3W1SC 5FR3A 4AJWA 1V9JA 3ZQ4A 3VDZA 3AU5A 3VAWA 3W5UB 3CMMB 2ZW1A 4MJSB 2MBBB 1ZW7A 3ENEA 5E6OA 5D7GA 3RUIB 1PGAA 3P1MA 1ZDVA 3TEYA 3GP7A 2LZ6A 3P4RB 2E6XA 3ZVVA 4KSKC 2DYMA 3WAMA 2JSVX 2WXLA 1UZXB 2BQQA 2NBVB 1TYGB 1WFYA 2MA9B 1WM2A 2Z59B 1TBEA 2YEPF 1UELA 2LXAA 1LQBA 4EZLA 1JQ4A 2IJ0A 5BMGA 1NDDA 4US9A 5L83A 1RM6C 1VZ8A 2WXGA 2XBBC 2AYOB 2JRHA 4FHJA 5IP4D 4BBNC 4FULA 1UD7A 1FRDA 2MJ3A 3RMKC 3V61A 4ARIA 3AE8B 3L0WB 2WXOA 2J7QB 2DBYA 3LJ3A 4P6VF 5DPSA 4A9AA 1E8ZA 4M0WA 4WJOA 2KT7A 5IAAC 2MHJA 3NVZA 5L95C 2KWDA 4K81A 2KHWB 1WX9A 2WXKA 1HZ5A 5HG2A 4NPNA 1N63A 5IOIA 3JSVA 1LFDA 1MG8A 4M0WB 4FA6A 1YOVB 4B0EA 1WZ3A 4BKSA 2J0KA 4DK5A 1EF5A 3MC9A 1CJEA 4HDOA 3NHEB 1MPEA 3H7PA 3N3KB 2WP9B 3JSVB 1BMLC 1WJ4A 1WM3A 4XYCA 4B9KA 1GJZA 1C1YB 1L2NA 3AEGB 3QC8B 2ON8A 2QJLA 2MP2A 3H7PB 2WXHA 5D2MB 4LJPB 2IDYA 2WS3B 2KDMA 3WAOA 4ANUA 4NJCA 2ICIA 1XO3A 2MLBA 1L4DB 3I9V1 3CWIA 2MP2B 2PMVA 3AULA 3ZJTA 2JQRB 1JW9D 3FAHA 4G50A 4MH8A 2DZKA 4XZ4A 2KMAA 3IT6B 2DAJA 3Q3OC 1ZOYB 3VQIA 4TQ0A 3B08A 2IO3B 2M8SA 1NI2A 3NZSA 2EKIA 2H89B 1WMHA 3AE1B 2L05A 3C0RB 4B0MA 2WX0A 3UIPB 3VXWA 3CSFA 3VRBB 3M62B 4FBJB 4W9LA 2WU2B 1I7HA 1WMHB 3NS1A 4OZAA 1BXTA 2LWPA 2XK5A 2MWSB 2KLGA 5EE1A 3BYYB 2KJHB 2J0JA 1WGKA 2WXMA 2KMCA 4CHKA 3VTVA 3UINB 5DPWA 1GPXA 2GI9A 2QILA 4TQ1A 2V4IB 2XK5B 3MTNB 5D3IB 3R8BA 1E8WA 2I2YA 3Q3MC 4HDQA 3QK0A 1HZ6A 2PVGC 1E9MA 4L23A 2K6DB 2JWUA 2KNBA 2LJIA 3IAM1 2V0GA 1VZ7A 1DOXA 2LGIA 4IWQA 2NR2A 4KVGB 4JIOU 4ZRQA 4BVUC 2IO2B 3BK2A 3ZGZA 1YNTE 3TBLD 4NJ7A 1J7BA 1MFWA 2PKOA 5J17A 2K8BA 3A4SC 3TUOA 2KFJA
chains in the Genus database with same CATH topology
4GMVA 2YLMA 3HIZA 4HXDA 4PS3A 4EZJA 4FADA 1J0GA 3HK0A 1UBIA 1RLFA 3UQAA 3OAWA 1WGDA 3PHWB 5D94A 2MBEA 4LDTD 5C23A 1RFAA 3ZNHB 4IM0A 3ZDMC 4ZDVA 3H6NA 2MBHA 3MJWA 2RPQA 4W9DA 4M8MA 2JZ3B 2D11A 2FCNA 2KTRA 1RRBA 4JLCA 1WIAA 2ZZPB 2ZEQA 3PHXB 2OOBB 1UH6A 4BFRA 5EDSA 3ZIMA 3DBLI 1WR1A 4GN1A 4G11A 2KC2A 2KO3A 2L00B 3T8MA 1AARA 4W9IA 3A9JA 1YQBA 2LRWA 1P9DU 5G55A 2ZPYA 4FHKA 3X23A 1OEYA 3VTUA 1TTNA 2HTHA 3BY4B 3B0AA 3IBEA 4MEMA 4F7ZA 4DHJB 3DDCB 2L76A 2KTRB 2KWUB 3W1SA 3R7QA 2C7NB 4KZCA 3TJPA 4BBNF 3CSTA 5C1ZA 4IM2A 2JUOA 2LI5A 2WYQA 5CTRC 3UF8A 1IP9A 2KK8A 3A9JB 4FJYA 4KZ0A 4PS7A 3ZRCA 1I35A 4LJOB 2Y5BB 3ZO5B 3VUWA 2M17A 2I1JA 3ZW3A 2NCNA 4ANWA 1V49A 5AEKB 2C7HA 2V4LA 2FAZA 4URKA 1Z2MA 4LCDE 2AL6A 3HM6X 2QHOA 1ISNA 2JXXA 2LVPA 4MELA 4ASWC 5DPTA 2KVRA 2MRPA 4IWOA 2NBUA 5DPRA 3B1LX 1WE6A 1YX6B 2N9PC 2LVQA 3U30A 1WI0A 2JT4B 2IBIB 4HCPB 1OTRB 1QZEA 4NJ6A 3DVGY 1ZKHA 2NPTA 3AXCA 5DCNA 2IYDB 4LDTB 1WJNA 3OLMD 1SE9A 2KDEB 2UYZB 4GU2A 2RSUA 1M94A 2L3ZA 3M95A 1I42A 4OVUA 4EOYA 2IY0B 2JWZA 1UBQA 2LVOA 4HK2A 5CX3A 3ZNZB 3KUDB 2YVCA 4WWPA 1D3ZA 2MBOA 3PREA 2UWQA 3M63B 4NQLB 1XQQA 3DVNU 2DZMA 3ZTCA 2NPTB 1IPGA 1LM8B 2ZCCA 2HJ8A 2CHWA 2EKEC 1OGWA 1WYWB 2D3GA 3ZTDA 1OQYA 4W9CA 4A3OA 4BKGA 3DBSA 4JL9A 2IZVB 3N30A 3PPAA 2D07B 2JZZA 2PPHA 4FN2A 4TKNA 2G4SA 2KDBA 1WJUA 4DDID 3IHPC 2BWFA 4EUTA 2DHZA 5CHWA 4A3PA 2M0XA 1PQSA 1HE8A 2KDFB 1KJTA 4DK5A 2R2OA 2K1FA 3V6CB 1WX7A 3BINA 3I3TB 1J8CA 4BKSD 2REXA 3A33B 2GMIC 2C60A 3L16A 2DZJA 2L7RA 4NNJB 3KUCB 2KXJA 4EZKA 3U8ZA 2BWES 1JRUA 2KOXA 4KIKA 5J18A 2KJRA 4AP4C 1S3SG 4P7IA 4EEWA 3HM3A 1WGYA 5CHFA 3D32A 4DHZE 4WQOB 4DHZB 2ZNVC 3IVFA 3WA0A 1TZ1A 4HCNB 2IO1B 5JHBA 1IYFA 2DX5B 2GBRA 3ZDTA 2LGXA 2KTFA 2Z0DB 4NQKE 3A1QA 2O6VD 2N1WA 3ALBA 2BF8B 2L0TA 2D10A 2FNJB 2O2VA 3RD2A 2DYOA 2JF5A 4KIKB 3JVZX 3A9KA 4NY0A 4XC2A 2KDIA 1SIFA 2KANA 2A4ZA 1XT9B 3ZRFA 1WH3A 4W9EA 1WXSA 2PJHA 1R4MI 5AZFA 1T0YA 4WWNA 5E6NA 2KQ7A 2ZJDA 2FCQA 1GC6A 2MCNB 2PE9A 2W9NA 3A1QB 1KM7A 3VTWA 3P2BA 3PGEA 4RM9A 2O2VB 1V5TA 3R7RA 2IO0B 2WDTB 2IY1B 2DAFA 3A9KB 1V80A 2CU1A 1X1MA 1WRDB 1WZ0A 4E3CA 3SU8X 3VUXA 3NS8A 3AI5A 3NZUA 3PRMB 3R3MA 3RT3B 5D6JB 1RAXA 5LXHA 3APDA 1WXMA 1VD2A 2GBNA 4GIVA 4KSLC 3RULA 1G6JA 3DVNV 1H8CA 3APCA 2O6VA 2CHXA 4II2B 1A5RA 3O65B 4II3B 5JHAA 2BGFA 1OEYJ 3L54A 1GUAB 2R2QA 2L8JA 4ICVA 3PRZA 1Q1OA 4JGHB 4XX5A 4RMAA 3DOWA 4TV3A 4PS8A 4MH0E 3ML9A 2JRIB 1J19A 1L7YA 3Q3FA 2LGDA 3H1UA 1YD8U 2DZIA 4MJSA 2KX3A 3U7DA 2O6VB 4IC7B 4TUUA 1WY8A 2DYBA 1XD3B 4HWIB 2K25A 4EFOA 3M3JA 1S1QB 4KV2A 2K8CA 4I6LB 3W1SC 3QAQA 4AJWA 1V9JA 4E71A 2LXCA 3VDZA 2GBJA 3AU5A 2L0FA 3RYTA 3VAWA 1E7VA 3CMMB 4X57B 2FCSA 2G45B 4I6NB 4MJSB 2FCMA 1Q0WB 4GB9A 2MBBB 1ZW7A 3ENEA 2KWVB 4MSMB 5E6OA 5D7GA 3QQ8B 2ZVNA 1WXVA 4FLHA 2LGYA 4ZRKA 3RUIB 1GC7A 1P0RA 3S2AA 2LZ6A 3PLUA 2BYFA 3ZVVA 4WJQA 4KSKC 2DYMA 3EC8A 3WAMA 2N4FA 3QX1A 4HPLB 3K9PB 2CHZA 4ANVA 1UZXB 2WWZA 2ZCBA 4AOFA 4B95A 4BOZB 2NBVB 3TCAA 3ZNGC 1WFYA 2K6QA 2KQSA 2MA9B 1WM2A 2Z59B 1WGGA 5FR6A 2N9XA 1TBEA 1H4RA 3APFA 2BKRB 1UELA 4J6IA 3L17A 3SHQA 3VVWB 4N9F4 2LXAA 1LQBA 2JY6A 4K7UA 4IWPA 4EZLA 5JH5C 2BKFA 1NDDA 3KUZA 5L83A 1P1AA 1WGRA 2K39A 2GOWA 2KLCA 2I1KA 2XBBC 2AYOB 2HE7A 2JRHA 3HHMA 4FHJA 3DQVA 4W9JA 1R4NI 4BBNC 4FULA 3WAPA 5GMVA 3X0WA 3V60A 5IA7A 4K7WA 5E6PA 3ZKJC 1UD7A 1YIWA 4W9GA 1P3QU 3EFUA 4CYEA 3V61A 4K1RB 2AEHA 3NOBA 3L0WB 4I6PA 2J7QB 2D2QA 2BPSA 2MSED 3LJ3A 2B3AA 5DPSA 3AU4A 2MX2A 3PV1A 4IW0A 1E8ZA 2KX0A 1K8RB 4WJOA 2JVCA 5IAAC 4MGYE 3IG3A 1Z5SB 1SGHA 3Q3JA 3RCZA 5L95C 3PSEB 3LDZE 4K81A 2KHWB 5KHQA 5BO4B 4F1SA 1WX9A 2PEAA 4RM8A 1WR6E 5HKHA 4NPNA 2ZVOA 3EECA 4CO7A 3K9OB 5JZEB 3JSVA 4W9HA 1TGZB 3VUYA 1LFDA 1MG8A 4M0WB 2K8HA 4FA6A 3QA8A 4ICUA 1WZ3A 2KZRA 4BKSA 2FUHB 3A4RA 4FJZA 2CKHB 2J0KA 1EF5A 3CF6E 1YX5B 3QIJA 3VFKA 3OJ3A 3TL5A 3UGBB 5TR5A 5LLIA 4HDOA 3NHEB 1WGHA 2N7DA 2AWTA 5KHOA 3ML8A 3WIMA 2KC1A 3DCGA 3PVLA 4IG7B 3H7PA 3WALA 3DBHI 3N3KB 3JSVB 3OJ4B 3GOEA 2LRUA 4DWFA 3EHVA 4AUQC 2XEWA 3QJZA 3TIXA 3ZLZA 1WJ4A 2KKCA 1WM3A 4B9KA 2NVUI 4W9KA 1GJZA 1C1YB 1L2NA 2NS5A 5LXIB 1GNUA 2PE6B 4B6WA 4ANXA 3SD5A 3DPDA 3QC8B 1WX8A 2MP2A 3H7PB 2DENB 3PLVA 1VCBA 5D2MB 4HPMB 4LJPB 4WJNA 4F8CB 2CR5A 1EUVB 3PT2B 2EMSA 3N32A 3WAOA 1E7UA 4ANUA 1E8XA 3GZNI 5AZHA 1KLVA 2MLBA 3UQBA 2JPHA 2A5UA 4JQWC 5G2NA 3PRPB 4K7SA 2MP2B 3AULA 2KJ6A 3KH0A 3PZDA 1WF9A 3H7SA 4G0NB 4G50A 4PYUA 4ZYNA 1P98A 1E5WA 2DZKA 3ONSA 4XZ4A 4FJVB 2KMAA 1BT0A 2DAJA 4KDIC 3VH3B 2V3SA 3VQIA 1EO6A 4TQ0A 5AZGA 3B08A 3T9LA 4BOSC 2IO3B 2AL3A 2M8SA 3RZFA 1NI2A 3DBRI 3NZSA 2N1VA 1WMHA 2V1YA 3DVGX 2L05A 4DXAB 2HD5B 3C0RB 1LXDA 4YL8A 2WX0A 2C7MB 2KWCA 2M4NA 3UIPB 1Y8RC 3VXWA 2LUEA 2MQJA 3JW0X 3KVFB 3ZUNA 4KDLB 4PYZA 3CSFA 2M1MA 4HVBA 2N9EB 3M62B 4FBJB 4W9LA 2KD0A 4M8NA 4GOCA 3L08A 1EF1A 1NBFC 1WMHB 3IFWB 1V81A 4ZRIA 4GDKA 2OJRA 4NAWA 3UIOB 2GBKA 2LWPA 4BKTA 3PTFC 2VRRB 4GXBA 3V62A 2KFKA 2RR9A 2XK5A 4G3XB 2MWSB 1Q5WB 4MGIE 2KLGA 2KJHB 2J0JA 3L10B 3H9DA 2Z0EB 1ZGUB 1V86A 4GSWA 2RD0A 2KMCA 2RGFA 1UGMA 2ZPNA 3VTVA 4CHKA 1C3TA 1WJ6A 2EMTA 3JYUA 3PS6A 3R66C 4IUMB 3SDLC 3KW5B 4GDKB 3UINB 5DPWA 4NAWB 4HLEA 2KFKB 3ECIA 3NY5A 4TQ1A 3V6EB 2XK5B 3MTNB 2C9WB 3QCAA 4MM3A 4WAAA 1E8WA 3KYDD 2WX1A 2ASQA 4ZRJA 4WJPA 4HJKA 1KOTA 4HDQA 4DBGA 2MBQA 3QK0A 4IM3A 2LJ5A 3QARA 1FXTB 2KN5A 1WXAA 4MGZE 2C5LC 4E74A 2K6DB 1V6EA 2KNBA 4AWJA 4OVVA 2BYVE 4A20A 1GG3A 3QWZB 2NBWB 3ZNID 5J2RA 4MGKE 1CMXB 4GDLA 4WWOA 2GBMA 4IWQA 1WE7A 2NR2A 4KVGB 2N7EA 2BYEA 4JIOU 4BVUC 4DHJD 4GGQA 2IO2B 4DDGD 2FIFA 4AJYB 1E90A 4MSQB 4MDKE 3VH4B 2FIDA 2ZNVB 3L13A 3TBLD 4NJ7A 2G4DB 2J0MA 2G3QB 3MHSD 3TMPB 1U4AA 2MW5A 1V5OA 3KYCD 5CHVC 4GDLB 4EKUA 2K8BA 3RZWC 5J17A 3W1YA 1YJ1A 2LASA 2CS4A 1V2YA 1F9JA 2LD9A 3A4SC 2KFJA 4W9FA 3VHTC 3WANA 1E8YA 3QHTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GMV A;  2YLM A;  3HIZ A;  4HXD A;  4PS3 A;  4EZJ A;  4FAD A;  1J0G A;  3HK0 A;  1UBI A;  1RLF A;  3UQA A;  3OAW A;  1WGD A;  3PHW B;  5D94 A;  2MBE A;  4LDT D;  5C23 A;  1RFA A;  3ZNH B;  4IM0 A;  3ZDM C;  4ZDV A;  3H6N A;  2MBH A;  3MJW A;  2RPQ A;  4W9D A;  4M8M A;  2JZ3 B;  2D11 A;  2FCN A;  2KTR A;  1RRB A;  4JLC A;  1WIA A;  2ZZP B;  2ZEQ A;  3PHX B;  2OOB B;  1UH6 A;  4BFR A;  5EDS A;  3ZIM A;  3DBL I;  1WR1 A;  4GN1 A;  4G11 A;  2KC2 A;  2KO3 A;  2L00 B;  3T8M A;  1AAR A;  4W9I A;  3A9J A;  1YQB A;  2LRW A;  1P9D U;  5G55 A;  2ZPY A;  4FHK A;  3X23 A;  1OEY A;  3VTU A;  1TTN A;  2HTH A;  3BY4 B;  3B0A A;  3IBE A;  4MEM A;  4F7Z A;  4DHJ B;  3DDC B;  2L76 A;  2KTR B;  2KWU B;  3W1S A;  3R7Q A;  2C7N B;  4KZC A;  3TJP A;  4BBN F;  3CST A;  5C1Z A;  4IM2 A;  2JUO A;  2LI5 A;  2WYQ A;  5CTR C;  3UF8 A;  1IP9 A;  2KK8 A;  3A9J B;  4FJY A;  4KZ0 A;  4PS7 A;  3ZRC A;  1I35 A;  4LJO B;  2Y5B B;  3ZO5 B;  3VUW A;  2M17 A;  2I1J A;  3ZW3 A;  2NCN A;  4ANW A;  1V49 A;  5AEK B;  2C7H A;  2V4L A;  2FAZ A;  4URK A;  1Z2M A;  4LCD E;  2AL6 A;  3HM6 X;  2QHO A;  1ISN A;  2JXX A;  2LVP A;  4MEL A;  4ASW C;  5DPT A;  2KVR A;  2MRP A;  4IWO A;  2NBU A;  5DPR A;  3B1L X;  1WE6 A;  1YX6 B;  2N9P C;  2LVQ A;  3U30 A;  1WI0 A;  2JT4 B;  2IBI B;  4HCP B;  1OTR B;  1QZE A;  4NJ6 A;  3DVG Y;  1ZKH A;  2NPT A;  3AXC A;  5DCN A;  2IYD B;  4LDT B;  1WJN A;  3OLM D;  1SE9 A;  2KDE B;  2UYZ B;  4GU2 A;  2RSU A;  1M94 A;  2L3Z A;  3M95 A;  1I42 A;  4OVU A;  4EOY A;  2IY0 B;  2JWZ A;  1UBQ A;  2LVO A;  4HK2 A;  5CX3 A;  3ZNZ B;  3KUD B;  2YVC A;  4WWP A;  1D3Z A;  2MBO A;  3PRE A;  2UWQ A;  3M63 B;  4NQL B;  1XQQ A;  3DVN U;  2DZM A;  3ZTC A;  2NPT B;  1IPG A;  1LM8 B;  2ZCC A;  2HJ8 A;  2CHW A;  2EKE C;  1OGW A;  1WYW B;  2D3G A;  3ZTD A;  1OQY A;  4W9C A;  4A3O A;  4BKG A;  3DBS A;  4JL9 A;  2IZV B;  3N30 A;  3PPA A;  2D07 B;  2JZZ A;  2PPH A;  4FN2 A;  4TKN A;  2G4S A;  2KDB A;  1WJU A;  4DDI D;  3IHP C;  2BWF A;  4EUT A;  2DHZ A;  5CHW A;  4A3P A;  2M0X A;  1PQS A;  1HE8 A;  2KDF B;  1KJT A;  4DK5 A;  2R2O A;  2K1F A;  3V6C B;  1WX7 A;  3BIN A;  3I3T B;  1J8C A;  4BKS D;  2REX A;  3A33 B;  2GMI C;  2C60 A;  3L16 A;  2DZJ A;  2L7R A;  4NNJ B;  3KUC B;  2KXJ A;  4EZK A;  3U8Z A;  2BWE S;  1JRU A;  2KOX A;  4KIK A;  5J18 A;  2KJR A;  4AP4 C;  1S3S G;  4P7I A;  4EEW A;  3HM3 A;  1WGY A;  5CHF A;  3D32 A;  4DHZ E;  4WQO B;  4DHZ B;  2ZNV C;  3IVF A;  3WA0 A;  1TZ1 A;  4HCN B;  2IO1 B;  5JHB A;  1IYF A;  2DX5 B;  2GBR A;  3ZDT A;  2LGX A;  2KTF A;  2Z0D B;  4NQK E;  3A1Q A;  2O6V D;  2N1W A;  3ALB A;  2BF8 B;  2L0T A;  2D10 A;  2FNJ B;  2O2V A;  3RD2 A;  2DYO A;  2JF5 A;  4KIK B;  3JVZ X;  3A9K A;  4NY0 A;  4XC2 A;  2KDI A;  1SIF A;  2KAN A;  2A4Z A;  1XT9 B;  3ZRF A;  1WH3 A;  4W9E A;  1WXS A;  2PJH A;  1R4M I;  5AZF A;  1T0Y A;  4WWN A;  5E6N A;  2KQ7 A;  2ZJD A;  2FCQ A;  1GC6 A;  2MCN B;  2PE9 A;  2W9N A;  3A1Q B;  1KM7 A;  3VTW A;  3P2B A;  3PGE A;  4RM9 A;  2O2V B;  1V5T A;  3R7R A;  2IO0 B;  2WDT B;  2IY1 B;  2DAF A;  3A9K B;  1V80 A;  2CU1 A;  1X1M A;  1WRD B;  1WZ0 A;  4E3C A;  3SU8 X;  3VUX A;  3NS8 A;  3AI5 A;  3NZU A;  3PRM B;  3R3M A;  3RT3 B;  5D6J B;  1RAX A;  5LXH A;  3APD A;  1WXM A;  1VD2 A;  2GBN A;  4GIV A;  4KSL C;  3RUL A;  1G6J A;  3DVN V;  1H8C A;  3APC A;  2O6V A;  2CHX A;  4II2 B;  1A5R A;  3O65 B;  4II3 B;  5JHA A;  2BGF A;  1OEY J;  3L54 A;  1GUA B;  2R2Q A;  2L8J A;  4ICV A;  3PRZ A;  1Q1O A;  4JGH B;  4XX5 A;  4RMA A;  3DOW A;  4TV3 A;  4PS8 A;  4MH0 E;  3ML9 A;  2JRI B;  1J19 A;  1L7Y A;  3Q3F A;  2LGD A;  3H1U A;  1YD8 U;  2DZI A;  4MJS A;  2KX3 A;  3U7D A;  2O6V B;  4IC7 B;  4TUU A;  1WY8 A;  2DYB A;  1XD3 B;  4HWI B;  2K25 A;  4EFO A;  3M3J A;  1S1Q B;  4KV2 A;  2K8C A;  4I6L B;  3W1S C;  3QAQ A;  4AJW A;  1V9J A;  4E71 A;  2LXC A;  3VDZ A;  2GBJ A;  3AU5 A;  2L0F A;  3RYT A;  3VAW A;  1E7V A;  3CMM B;  4X57 B;  2FCS A;  2G45 B;  4I6N B;  4MJS B;  2FCM A;  1Q0W B;  4GB9 A;  2MBB B;  1ZW7 A;  3ENE A;  2KWV B;  4MSM B;  5E6O A;  5D7G A;  3QQ8 B;  2ZVN A;  1WXV A;  4FLH A;  2LGY A;  4ZRK A;  3RUI B;  1GC7 A;  1P0R A;  3S2A A;  2LZ6 A;  3PLU A;  2BYF A;  3ZVV A;  4WJQ A;  4KSK C;  2DYM A;  3EC8 A;  3WAM A;  2N4F A;  3QX1 A;  4HPL B;  3K9P B;  2CHZ A;  4ANV A;  1UZX B;  2WWZ A;  2ZCB A;  4AOF A;  4B95 A;  4BOZ B;  2NBV B;  3TCA A;  3ZNG C;  1WFY A;  2K6Q A;  2KQS A;  2MA9 B;  1WM2 A;  2Z59 B;  1WGG A;  5FR6 A;  2N9X A;  1TBE A;  1H4R A;  3APF A;  2BKR B;  1UEL A;  4J6I A;  3L17 A;  3SHQ A;  3VVW B;  4N9F 4;  2LXA A;  1LQB A;  2JY6 A;  4K7U A;  4IWP A;  4EZL A;  5JH5 C;  2BKF A;  1NDD A;  3KUZ A;  5L83 A;  1P1A A;  1WGR A;  2K39 A;  2GOW A;  2KLC A;  2I1K A;  2XBB C;  2AYO B;  2HE7 A;  2JRH A;  3HHM A;  4FHJ A;  3DQV A;  4W9J A;  1R4N I;  4BBN C;  4FUL A;  3WAP A;  5GMV A;  3X0W A;  3V60 A;  5IA7 A;  4K7W A;  5E6P A;  3ZKJ C;  1UD7 A;  1YIW A;  4W9G A;  1P3Q U;  3EFU A;  4CYE A;  3V61 A;  4K1R B;  2AEH A;  3NOB A;  3L0W B;  4I6P A;  2J7Q B;  2D2Q A;  2BPS A;  2MSE D;  3LJ3 A;  2B3A A;  5DPS A;  3AU4 A;  2MX2 A;  3PV1 A;  4IW0 A;  1E8Z A;  2KX0 A;  1K8R B;  4WJO A;  2JVC A;  5IAA C;  4MGY E;  3IG3 A;  1Z5S B;  1SGH A;  3Q3J A;  3RCZ A;  5L95 C;  3PSE B;  3LDZ E;  4K81 A;  2KHW B;  5KHQ A;  5BO4 B;  4F1S A;  1WX9 A;  2PEA A;  4RM8 A;  1WR6 E;  5HKH A;  4NPN A;  2ZVO A;  3EEC A;  4CO7 A;  3K9O B;  5JZE B;  3JSV A;  4W9H A;  1TGZ B;  3VUY A;  1LFD A;  1MG8 A;  4M0W B;  2K8H A;  4FA6 A;  3QA8 A;  4ICU A;  1WZ3 A;  2KZR A;  4BKS A;  2FUH B;  3A4R A;  4FJZ A;  2CKH B;  2J0K A;  1EF5 A;  3CF6 E;  1YX5 B;  3QIJ A;  3VFK A;  3OJ3 A;  3TL5 A;  3UGB B;  5TR5 A;  5LLI A;  4HDO A;  3NHE B;  1WGH A;  2N7D A;  2AWT A;  5KHO A;  3ML8 A;  3WIM A;  2KC1 A;  3DCG A;  3PVL A;  4IG7 B;  3H7P A;  3WAL A;  3DBH I;  3N3K B;  3JSV B;  3OJ4 B;  3GOE A;  2LRU A;  4DWF A;  3EHV A;  4AUQ C;  2XEW A;  3QJZ A;  3TIX A;  3ZLZ A;  1WJ4 A;  2KKC A;  1WM3 A;  4B9K A;  2NVU I;  4W9K A;  1GJZ A;  1C1Y B;  1L2N A;  2NS5 A;  5LXI B;  1GNU A;  2PE6 B;  4B6W A;  4ANX A;  3SD5 A;  3DPD A;  3QC8 B;  1WX8 A;  2MP2 A;  3H7P B;  2DEN B;  3PLV A;  1VCB A;  5D2M B;  4HPM B;  4LJP B;  4WJN A;  4F8C B;  2CR5 A;  1EUV B;  3PT2 B;  2EMS A;  3N32 A;  3WAO A;  1E7U A;  4ANU A;  1E8X A;  3GZN I;  5AZH A;  1KLV A;  2MLB A;  3UQB A;  2JPH A;  2A5U A;  4JQW C;  5G2N A;  3PRP B;  4K7S A;  2MP2 B;  3AUL A;  2KJ6 A;  3KH0 A;  3PZD A;  1WF9 A;  3H7S A;  4G0N B;  4G50 A;  4PYU A;  4ZYN A;  1P98 A;  1E5W A;  2DZK A;  3ONS A;  4XZ4 A;  4FJV B;  2KMA A;  1BT0 A;  2DAJ A;  4KDI C;  3VH3 B;  2V3S A;  3VQI A;  1EO6 A;  4TQ0 A;  5AZG A;  3B08 A;  3T9L A;  4BOS C;  2IO3 B;  2AL3 A;  2M8S A;  3RZF A;  1NI2 A;  3DBR I;  3NZS A;  2N1V A;  1WMH A;  2V1Y A;  3DVG X;  2L05 A;  4DXA B;  2HD5 B;  3C0R B;  1LXD A;  4YL8 A;  2WX0 A;  2C7M B;  2KWC A;  2M4N A;  3UIP B;  1Y8R C;  3VXW A;  2LUE A;  2MQJ A;  3JW0 X;  3KVF B;  3ZUN A;  4KDL B;  4PYZ A;  3CSF A;  2M1M A;  4HVB A;  2N9E B;  3M62 B;  4FBJ B;  4W9L A;  2KD0 A;  4M8N A;  4GOC A;  3L08 A;  1EF1 A;  1NBF C;  1WMH B;  3IFW B;  1V81 A;  4ZRI A;  4GDK A;  2OJR A;  4NAW A;  3UIO B;  2GBK A;  2LWP A;  4BKT A;  3PTF C;  2VRR B;  4GXB A;  3V62 A;  2KFK A;  2RR9 A;  2XK5 A;  4G3X B;  2MWS B;  1Q5W B;  4MGI E;  2KLG A;  2KJH B;  2J0J A;  3L10 B;  3H9D A;  2Z0E B;  1ZGU B;  1V86 A;  4GSW A;  2RD0 A;  2KMC A;  2RGF A;  1UGM A;  2ZPN A;  3VTV A;  4CHK A;  1C3T A;  1WJ6 A;  2EMT A;  3JYU A;  3PS6 A;  3R66 C;  4IUM B;  3SDL C;  3KW5 B;  4GDK B;  3UIN B;  5DPW A;  4NAW B;  4HLE A;  2KFK B;  3ECI A;  3NY5 A;  4TQ1 A;  3V6E B;  2XK5 B;  3MTN B;  2C9W B;  3QCA A;  4MM3 A;  4WAA A;  1E8W A;  3KYD D;  2WX1 A;  2ASQ A;  4ZRJ A;  4WJP A;  4HJK A;  1KOT A;  4HDQ A;  4DBG A;  2MBQ A;  3QK0 A;  4IM3 A;  2LJ5 A;  3QAR A;  1FXT B;  2KN5 A;  1WXA A;  4MGZ E;  2C5L C;  4E74 A;  2K6D B;  1V6E A;  2KNB A;  4AWJ A;  4OVV A;  2BYV E;  4A20 A;  1GG3 A;  3QWZ B;  2NBW B;  3ZNI D;  5J2R A;  4MGK E;  1CMX B;  4GDL A;  4WWO A;  2GBM A;  4IWQ A;  1WE7 A;  2NR2 A;  4KVG B;  2N7E A;  2BYE A;  4JIO U;  4BVU C;  4DHJ D;  4GGQ A;  2IO2 B;  4DDG D;  2FIF A;  4AJY B;  1E90 A;  4MSQ B;  4MDK E;  3VH4 B;  2FID A;  2ZNV B;  3L13 A;  3TBL D;  4NJ7 A;  2G4D B;  2J0M A;  2G3Q B;  3MHS D;  3TMP B;  1U4A A;  2MW5 A;  1V5O A;  3KYC D;  5CHV C;  4GDL B;  4EKU A;  2K8B A;  3RZW C;  5J17 A;  3W1Y A;  1YJ1 A;  2LAS A;  2CS4 A;  1V2Y A;  1F9J A;  2LD9 A;  3A4S C;  2KFJ A;  4W9F A;  3VHT C;  3WAN A;  1E8Y A;  3QHT A; 
#chains in the Genus database with same CATH topology
 4HXD A;  4AS1 A;  2IGG A;  4LLG M;  3UQA A;  3OAW A;  2BT6 A;  1WGD A;  2L32 A;  2HJ1 A;  5C23 A;  2RPQ A;  3BVM A;  2KTR A;  4JLC A;  2INN E;  2OOB B;  1OFF A;  2QDF A;  3ZIM A;  3DBL I;  3WCQ A;  4KKJ A;  2KC2 A;  2KO3 A;  2L00 B;  1AAR A;  4W9I A;  1CZP A;  2DNF A;  3MJ5 A;  3B0A A;  3IBE A;  2BS3 B;  2KTR B;  3R7Q A;  1JRO A;  1HTQ A;  4YSX B;  1HXY D;  2JUO A;  1QLB B;  4KZ0 A;  4PS7 A;  1K51 A;  2Y5B B;  3ZO5 B;  3NVW A;  1V49 A;  3HM6 X;  4ASW C;  1ISN A;  5HFY A;  3VRA B;  4IWO A;  3B1L X;  2N9P C;  3N1Y C;  4PK1 A;  1WI0 A;  2JT4 B;  1DOY A;  1OTR B;  4NJ6 A;  3RN9 C;  4GU2 A;  2G1E A;  2RSU A;  4Q2J A;  1STE A;  2LVO A;  4RNA A;  5CX3 A;  3KUD B;  2MBO A;  3PRE A;  3N1Z C;  5MPO A;  1LM8 B;  1D5Z C;  2OED A;  5FK9 C;  1ESF A;  3ZTD A;  1OQY A;  4W9C A;  3NVV A;  2IZV B;  1HTO A;  2D07 B;  2PPH A;  4FN2 A;  2J4X A;  2G4S A;  4DDI D;  4A3P A;  2M0X A;  5LNK 1;  1KTK A;  2KDF B;  2RDB C;  2NTS A;  2WDV B;  4BKS D;  2REX A;  1JAL A;  2C60 A;  4NNJ B;  4OZB A;  3U8Z A;  2BWE S;  3Q3N C;  4P7I A;  4EEW A;  1WGY A;  2BYT A;  4HEA 1;  4ZYS A;  3WA0 A;  3IVF A;  2IO1 B;  3BWU D;  2GBR A;  4ARC A;  2WXR A;  3TEW A;  2O6V D;  2N1W A;  1SE2 A;  2DYO A;  2JF5 A;  3DBH B;  2KDI A;  1SIF A;  2WNM A;  2A4Z A;  3EFC A;  3P4S B;  3ZRF A;  2Y3A A;  2PJH A;  1M4V A;  5AZF A;  2XN9 C;  2FCQ A;  4KX6 B;  2W9N A;  1OQR A;  3P2B A;  1V5T A;  2WDT B;  1X1M A;  3SU8 X;  3NZU A;  3RT3 B;  5LXH A;  1DOI A;  1WXM A;  1R7S A;  1G6J A;  3APC A;  3W2D A;  1UUP A;  2CHX A;  4EE2 A;  1TKY A;  1OEY J;  3L54 A;  1D6E C;  2K0P A;  1PDX A;  1XF5 L;  2PIA A;  4XX5 A;  3CIR B;  2J53 A;  2LHE A;  1N6Z A;  2DZI A;  3DBR B;  4HKQ A;  1WY8 A;  4A8X C;  3M3J A;  3QAQ A;  1JWM D;  1HQR D;  2GBJ A;  3RYT A;  2JYE A;  3V3X A;  3SEB A;  1JML A;  1HA5 A;  1WXV A;  4P1C C;  2LGY A;  4ZRK A;  3S2A A;  3PLU A;  2BYF A;  4OHJ A;  3TCA A;  4KGS A;  1I4G A;  1XLN A;  4L2Y A;  1WGG A;  5FR6 A;  2W54 A;  4P1B C;  3AMZ A;  2GLS A;  2BKR B;  4N9F 4;  4R3D A;  1KF6 B;  4IWP A;  4K7U A;  1F2R C;  2BKF A;  3HVZ A;  1WGR A;  2K39 A;  2GOW A;  2SAK A;  3N9Y C;  3HHM A;  1TY2 A;  1SBB B;  4W9J A;  3WAP A;  3X0W A;  5IA7 A;  4K7W A;  5E6P A;  1YIW A;  1Q10 A;  3NOB A;  2PW9 A;  3BVZ A;  1C78 A;  4YTP B;  3AU4 A;  1F1H A;  3PV1 A;  2KX0 A;  1GOZ A;  3RNG C;  1P7E A;  4RCO A;  4LTU A;  3ZYY X;  3AV8 A;  5JXV A;  3TEZ A;  3EEC A;  4CO7 A;  3K9O B;  4W9H A;  1TGZ B;  2AQ2 B;  1FEH A;  3Q6B A;  4USA A;  1E7P B;  3VFK A;  2QEJ C;  4FXC A;  1YX5 B;  3I57 A;  3OJ3 A;  1ZXI A;  4AQ7 A;  1WGH A;  1I4Q A;  1RFK A;  4C00 A;  4IG7 B;  3WAL A;  3DBH I;  1L0X B;  3EHV A;  3MC8 A;  3QJZ A;  1BUI C;  3TIX A;  1FXI A;  1T0R C;  1C9F A;  4ANX A;  3SD5 A;  3PLV A;  5I4D A;  4F8C B;  5E6J A;  1SXT A;  3AB5 A;  3AEC B;  5AZH A;  2JPH A;  2A5U A;  2EEL A;  3PRP B;  1JRP A;  2DLB A;  2K22 A;  3PZD A;  1WF9 A;  4PYU A;  1P98 A;  1E5W A;  2LMC A;  1BT0 A;  4C80 A;  3KWV A;  4N58 A;  1EO6 A;  1F52 A;  5AZG A;  3B2G A;  3RZF A;  3DBR I;  3L4P A;  2N1V A;  3O13 A;  3DVG X;  2AQ1 B;  4D2K A;  3EGR A;  1N61 A;  4DXA B;  4YWG G;  4NAM A;  1LXD A;  5IKC M;  2VZK B;  2M4N A;  1Y8R C;  3KVF B;  1ZP0 B;  4KDL B;  2M1M A;  4QAY A;  1QT9 A;  2KN4 A;  4M8N A;  1EF1 A;  2QIE B;  4ZRI A;  4GDK A;  1B9R A;  1RWS A;  2OJR A;  1SE3 A;  4NAW A;  4BKT A;  2VRR B;  4GXB A;  3V62 A;  5C3J B;  4MGI E;  3AE3 B;  2MJD A;  1ZGU B;  1V86 A;  1UGM A;  2ZPN A;  3JYU A;  2EMT A;  4IUM B;  4GDK B;  4NAW B;  1TKG A;  4LNK A;  4HLE A;  3ECI A;  2ZW0 A;  3OWE B;  2N9L A;  4MM3 A;  4WAA A;  3KYD D;  2ASQ A;  4ZRJ A;  1PGX A;  4IM3 A;  2LJ5 A;  4XDC A;  4O1N A;  2KN5 A;  5EE3 A;  1WXA A;  1SJE D;  1V6E A;  4OVV A;  3W5V B;  2V9H A;  4DXF A;  1N5X A;  2NBW B;  4MM3 B;  2GBM A;  1WE7 A;  1J7C A;  1T3Q A;  2FIF A;  1FXA A;  4MDK E;  1C76 A;  1N62 A;  2VH1 A;  2W55 A;  2G3Q B;  3AE9 B;  2MW5 A;  3BVG A;  2RDH A;  3RZW C;  3W1Y A;  1DYQ A;  2LD9 A;  3VHT C;  1F9J A;  2GB1 A;  4W9F A;  1T6B X;  2ONQ A;  2YLM A;  1N5W A;  3HIZ A;  4PS3 A;  4YT0 B;  1D5X C;  2BB5 A;  4FAD A;  1J0G A;  1RLF A;  4RGT A;  4L1B A;  3RNF C;  4LDT D;  2KAC A;  1RFA A;  3ZNH B;  3ZDM C;  3H6N A;  3MJW A;  4W9D A;  2QMT A;  4M8M A;  2JZ3 B;  2D11 A;  1GAQ B;  4M00 A;  3AED B;  1UH6 A;  5EDS A;  4GN1 A;  5IO9 A;  3A9J A;  2LRW A;  2MEK A;  4FHK A;  3X23 A;  1OEY A;  1TTN A;  2HTH A;  4MEM A;  2GRI A;  4DHJ B;  3DDC B;  1QKZ A;  3I63 C;  4YTN B;  3VR8 B;  4KZC A;  4IM2 A;  2WYQ A;  3UF8 A;  1IP9 A;  1WWT A;  3A9J B;  4FJY A;  4C7Y A;  4LJO B;  2I1J A;  3ZW3 A;  2NCN A;  3RNC C;  2V4L A;  4LCD E;  5DPT A;  2NBU A;  4MT5 A;  1WE6 A;  3U30 A;  4C4V A;  3E9S A;  3MHZ A;  1QZE A;  4XWW A;  5DCN A;  2UYZ B;  2Y5C A;  1M94 A;  2L3Z A;  3M95 A;  4EOY A;  4HK2 A;  3GS2 A;  1D3Z A;  4C4V B;  4NQL B;  1XQQ A;  4RGN A;  1R4N B;  2HJ8 A;  2EKE C;  1OGW A;  1WYW B;  3TSS A;  4JL9 A;  4TMA B;  1I4H A;  3DWM A;  4JE3 B;  3IHP C;  2E3T A;  2DHZ A;  4WH4 A;  1C77 A;  1QOA A;  4J3O D;  3V6C B;  2M0A A;  2KMM A;  3BIN A;  3I3T B;  1KFY B;  1UGJ A;  2GMI C;  2WXF A;  3L16 A;  2L7R A;  3KUC B;  2KXJ A;  1JRU A;  5J18 A;  3U7Z A;  3Q8C A;  1K50 A;  3D32 A;  2JZP A;  4S17 A;  4WQO B;  4DHZ B;  1JWA D;  3P42 A;  1TZ1 A;  1IYF A;  2DX5 B;  4XDD A;  1ZXH A;  2Z0D B;  4NQK E;  3ALB A;  2D10 A;  1L6V A;  3AN1 A;  1WH3 A;  1TKE A;  3MC0 B;  4WWN A;  1F0Z A;  2JU6 X;  1SEB D;  3VTW A;  1KM7 A;  1VDV A;  2IY1 B;  3PO0 A;  1RYJ A;  2WGS A;  2CU1 A;  3SFE B;  3NS8 A;  3AI5 A;  1AYF A;  5D6J B;  5EE9 A;  2GBN A;  4GIV A;  3DVN V;  1MHX A;  4II2 B;  3DHI C;  4MAC A;  4ZRP A;  4II3 B;  3MFG A;  3LB8 C;  5JHA A;  2BGF A;  2R2Q A;  1NVI D;  4ICV A;  1ET6 A;  1Q1O A;  3AM9 A;  4RMA A;  3DOW A;  4TV3 A;  5GXG B;  4PS8 A;  4MH0 E;  2JRI B;  2LGD A;  3H1U A;  3U7D A;  4IC7 B;  4TUU A;  3BII D;  3BYT B;  3DHH C;  2DYB A;  4HWI B;  2K8C A;  1QF6 A;  4N59 A;  1K53 A;  4E71 A;  2LXC A;  3NRZ A;  2L0F A;  2D5G A;  4ZHP A;  4XGA B;  2G45 B;  4I6N B;  2FCM A;  2D3B A;  1A70 A;  4MSM B;  3QQ8 B;  1N60 A;  4FLH A;  1GC7 A;  1ROE A;  4HPL B;  3K9P B;  4B95 A;  2WWZ A;  4AOF A;  2VH2 A;  3ZNG C;  3ZJV A;  1UWX A;  1H4R A;  4J6I A;  4US8 A;  1T5X D;  3Q2A C;  5C2T B;  2V3P A;  1P1A A;  3FC4 A;  2D3C A;  2I1K A;  2HE7 A;  2W82 A;  3P4Q B;  1R4N I;  5GMV A;  3V60 A;  3ZKJ C;  4W9G A;  1P3Q U;  2LFI A;  2AEH A;  4I6P A;  2BPS A;  3FKY A;  2B3A A;  1L0Y B;  2JVC A;  1TS4 A;  3NG0 A;  2ACZ B;  3RCZ A;  3PSE B;  5EE0 A;  3LDZ E;  4PT5 A;  5KHQ A;  4F1S A;  4RM8 A;  3IAS 1;  2ZVO A;  5JZE B;  2HTM E;  1ZUD 2;  2HDE A;  2K3U A;  3VUY A;  4JX1 C;  3QA8 A;  4ICU A;  2FUG 1;  2KZR A;  4FJZ A;  2CKH B;  3CF6 E;  4ACF A;  3AE7 B;  1PUT A;  1TS2 A;  2AWT A;  5G5G A;  2KC1 A;  3DCG A;  1PYW D;  3DWG C;  3OJ4 B;  1LO5 D;  2W3S A;  1YN5 A;  3RNA C;  1TZO A;  4YTM B;  2NVU I;  1PFD A;  4W9K A;  1TIF A;  2NS5 A;  1GNU A;  2KVZ A;  2PE6 B;  1FIQ A;  3DPD A;  1XCT L;  4JPS A;  2DEN B;  5BMH A;  1VCB A;  1EWC A;  3NJT A;  2BS2 B;  4WJN A;  1EUV B;  3PT2 B;  2CJN A;  2EMS A;  1NEK B;  1KLV A;  5AUK A;  1FNV A;  4CQN A;  3H7S A;  5HHD G;  1E0Z A;  4FJV B;  4KDI C;  3VH3 B;  2V3S A;  4GLS C;  1VLB A;  4LNN A;  2WU5 B;  1FCL A;  2V1Y A;  5FKA C;  4JWS C;  2FE8 A;  2HD5 B;  1SSN A;  4YL8 A;  2C7M B;  1DGJ A;  4OZC A;  4PYZ A;  1KH0 A;  1JCK B;  4GOC A;  3L08 A;  1NBF C;  1V81 A;  1TS3 A;  3UIO B;  1P7F A;  2GBK A;  2KFK A;  2RR9 A;  3LYY A;  2JYT A;  2CJO A;  1QOG A;  3RNB C;  4GSW A;  4RGO S;  1XLO A;  2RGF A;  1WJ6 A;  3PS6 A;  3R66 C;  4KKI A;  3SDL C;  3N1X C;  1FNU A;  2INP E;  2L83 A;  2FBW B;  2UU7 A;  2KFK B;  3NY5 A;  2C9W B;  1F2R I;  2WX1 A;  4WJP A;  4DBG A;  3ETR A;  3SFD B;  2V3N A;  2N0S B;  1VRA B;  4E74 A;  2C5L C;  1NEN B;  1I4P A;  1E10 A;  2KYW A;  4AWJ A;  1GG3 A;  3QWZ B;  3NUH B;  5J2R A;  1CMX B;  4GDL A;  4HJG E;  1JWS D;  2N7E A;  2QCZ A;  3U52 E;  2MJE A;  4HRO A;  1E90 A;  3VH4 B;  2FID A;  2ZNV B;  3L13 A;  3AEF B;  4KGR A;  2G4D B;  2J0M A;  1MHH E;  3TMP B;  1SJH D;  3KYC D;  5CHV C;  4GDL B;  4EKU A;  3T3N A;  2M56 B;  3Q8B A;  1YJ1 A;  1NYR A;  3H8H A;  1V2Y A;  3WAN A;  1E8Y A;  4GMV A;  2AX5 A;  4K3B A;  2LEK A;  4EZJ A;  3HK0 A;  1T0Q C;  2LHD A;  1IGD A;  3PHW B;  2MBE A;  2SEB D;  2FCN A;  4A90 A;  2IND C;  1RRB A;  4ZHO A;  1WIA A;  2ZEQ A;  2H88 B;  1V1P A;  1WR1 A;  3IXS A;  3BY4 B;  3BK1 A;  2IGD A;  4HKZ E;  4JWU C;  1YJI A;  2Y5P A;  3TJP A;  4BBN F;  4IKG A;  5C1Z A;  1V1P B;  2LI5 A;  2RDG A;  1I35 A;  2M17 A;  4ANW A;  3RPF C;  3URY A;  3RFZ B;  2FAZ A;  2PTL A;  1Z2M A;  4URK A;  2AL6 A;  2NTT A;  2X38 A;  2RMM A;  1XLP A;  1YX6 B;  2TSS A;  1SIJ A;  4HCP B;  1ENF A;  2G9H D;  2WDQ B;  3DVG Y;  2IYD B;  1WJN A;  3KWL A;  3OLM D;  2BS4 B;  2KDE B;  1HEZ E;  1I42 A;  4OVU A;  1UNS A;  2IY0 B;  2JWZ A;  3ZNZ B;  2YVC A;  4WWP A;  2UWQ A;  2WDR B;  3M63 B;  1C4P A;  5BYS A;  3GE8 C;  3DVN U;  3ZTC A;  1D5M C;  2ZCC A;  3AEE B;  2CHW A;  1UF0 A;  4BKG A;  3LXF A;  3U4E G;  3N30 A;  4DQO C;  1NI3 A;  2JZZ A;  3W9C B;  4EUT A;  1JWB D;  5CHW A;  3KQ4 A;  1HE8 A;  2QSD A;  1KJT A;  2K1F A;  2KAJ A;  2K9X A;  1YMH E;  3A33 B;  2DZJ A;  3NZ3 A;  1XXG A;  1ZE3 D;  2KOX A;  3R2T A;  3PZ7 A;  2L1A A;  2MH7 A;  4M01 A;  4DHZ E;  2ZNV C;  5JHB A;  4HCN B;  2WXQ A;  3ZDT A;  2KTF A;  3A1Q A;  2L0T A;  4HRS A;  1T0S C;  2O2V A;  1K52 A;  1I4X A;  4NY0 A;  1WXS A;  2WXP A;  3Q14 C;  4S0R A;  2ZJD A;  3PZ8 A;  5D3D A;  1GC6 A;  2MCN B;  2PE9 A;  3A1Q B;  4YSY B;  2O2V B;  3R7R A;  1TJE A;  2KQ4 X;  1C79 A;  4REZ A;  3UI3 A;  1V80 A;  1WRD B;  4E3C A;  3PRM B;  3R3M A;  3DBL B;  3APD A;  3C19 A;  3GZN B;  3RUL A;  3ZXR A;  1H8C A;  4LNI A;  2O6V A;  1SE4 A;  3O65 B;  3R2I A;  3GE3 C;  2L8J A;  3PRZ A;  1C4A A;  3N20 C;  3T3O A;  3ML9 A;  3Q3F A;  1IBX A;  2O6V B;  2QC8 A;  3C8Y A;  1XD3 B;  4EFO A;  1VZ6 A;  1S1Q B;  4KV2 A;  2WHI A;  4WUR A;  4TSS A;  4K3C A;  1E7V A;  1PGB A;  1IBX B;  4X57 B;  2FCS A;  2OHF A;  2W3R A;  1Q0W B;  4GB9 A;  1IUE A;  2KWV B;  2ZVN A;  4M02 A;  2WQY B;  1P0R A;  4WJQ A;  1I4R A;  3ZJU A;  3EC8 A;  2N4F A;  2OJW A;  3QX1 A;  1E6E B;  2CHZ A;  4ANV A;  2PLP A;  2ZCB A;  4BOZ B;  4HPP A;  1XEE A;  2K6Q A;  1ZDX A;  2KQS A;  4IOI E;  4ZOH C;  2N9X A;  3APF A;  3L17 A;  3SHQ A;  3VVW B;  4RF0 A;  2JY6 A;  1SB3 C;  2WLB A;  5JH5 C;  2IGH A;  3KUZ A;  2JX5 A;  2PVO D;  2KLC A;  1B1Z A;  3J9C A;  3DQV A;  1KLG D;  3RNE C;  1YN4 A;  2B76 B;  1AN8 A;  3EFU A;  4CYE A;  3GB1 A;  1FRR A;  4K1R B;  5T8I A;  1F77 A;  2D2Q A;  2MSE D;  5BMI A;  4A6Q A;  5AUI A;  2MX2 A;  4IW0 A;  1K8R B;  4IDI A;  1LGR A;  4NZL B;  4MGY E;  3IG3 A;  1IGC A;  1SGH A;  1Z5S B;  3Q3J A;  1QQR A;  5BO4 B;  2PEA A;  3VR9 B;  1WR6 E;  5HKH A;  3HVD A;  1L5P A;  1XCQ L;  4P16 A;  2K8H A;  1YQ4 B;  2FUH B;  3A4R A;  3QIJ A;  3TL5 A;  3UGB B;  5TR5 A;  5LLI A;  2N7D A;  1CK1 A;  1FO4 A;  5KHO A;  3ML8 A;  3WIM A;  3PVL A;  4DXG A;  4C56 C;  3GOE A;  2LRU A;  4DWF A;  4AUQ C;  2XEW A;  2VZK D;  3ZLZ A;  2KKC A;  4WQM A;  1VR9 A;  1EM7 A;  5LXI B;  4B6W A;  1WX8 A;  4HPM B;  2CR5 A;  2K5P A;  1QIL A;  3N32 A;  1NYQ A;  1E7U A;  3TEX A;  1E8X A;  1FNW A;  3GZN I;  1TT5 B;  3UQB A;  4JQW C;  5G2N A;  4K7S A;  2J42 A;  1VJK A;  2KJ6 A;  3KH0 A;  4G0N B;  4ZYN A;  1FMA D;  3ZXV A;  1FD6 A;  3ONS A;  3DHG C;  1GB1 A;  3T9L A;  1FFV A;  4BOS C;  1D4B A;  5H92 C;  2AL3 A;  1FFU A;  2N9K A;  2KWC A;  1XLQ A;  2BVC A;  2LUE A;  2MQJ A;  3JW0 X;  3ZUN A;  4HVB A;  2N9E B;  2CU3 A;  2KD0 A;  4BZA A;  3IFW B;  3AEB B;  3PTF C;  2RPV A;  1YN3 A;  3Q8A A;  3Q8E A;  4G3X B;  2Z8L A;  1Q5W B;  3BZD B;  5HI1 A;  1SF0 A;  3H9D A;  2Z0E B;  3L10 B;  3Q69 A;  2RD0 A;  1C3T A;  4RH6 A;  2I38 A;  3KW5 B;  3MP9 A;  3V6E B;  3QCA A;  4WAF A;  4HJK A;  1KOT A;  2MBQ A;  3QAR A;  1FXT B;  3AE2 B;  4YSZ B;  4KGT A;  4MGZ E;  3NVY A;  1WYG A;  2BYV E;  3FIL A;  1MI0 A;  4N6E B;  4A20 A;  3EUB 2;  3ZNI D;  2BB6 A;  1TS5 A;  1L0V B;  4MGK E;  4LK0 M;  4WWO A;  1MJD A;  5G5H A;  2BYE A;  4DHJ D;  4GGQ A;  4DDG D;  1QOB A;  4AJY B;  1R4M B;  3HRD D;  4MSQ B;  2XNA C;  1ET9 A;  3FIL B;  2BW2 A;  2LUM A;  3MHS D;  1U4A A;  1V5O A;  2NMQ A;  5H8Y E;  2IPK D;  2LAS A;  2CS4 A;  4A55 A;  3QHT A;  3IT4 B;  4WWM A;  1UWM A;  1UBI A;  1KLU D;  5D94 A;  2J52 A;  4IM0 A;  4ZDV A;  2MBH A;  3AE4 B;  1L4Z B;  2ZZP B;  2M19 A;  3PHX B;  4BFR A;  2BTE A;  4G11 A;  3T8M A;  4LNF A;  3B2F A;  1YQB A;  5G55 A;  1P9D U;  3SR6 A;  2WXI A;  2ZPY A;  2INC C;  3VTU A;  4YXD B;  4F7Z A;  2L76 A;  2KWU B;  3W1S A;  1KRH A;  2C7N B;  3CST A;  3B9J A;  1YQ3 B;  1EU4 A;  5CTR C;  2KK8 A;  4UDU C;  2N7J A;  3ZRC A;  1V1O A;  3VUW A;  4RF1 A;  3V05 A;  4LNO A;  5AEK B;  2C7H A;  2L52 A;  3AEA B;  2QHO A;  2JXX A;  4MEL A;  2LVP A;  2Q5W D;  4OW0 A;  2KVR A;  1ACC A;  2MRP A;  5DPR A;  1Y56 A;  2LVQ A;  2IBI B;  1ZKH A;  1WXQ A;  2NPT A;  3AXC A;  4LDT B;  5BYQ A;  1SE9 A;  3U2S C;  1UBQ A;  2WXN A;  2X8X X;  1C4C A;  5BYR A;  2DZM A;  1OQQ A;  1EU3 A;  2D3A A;  2NPT B;  1WRI A;  1IPG A;  2D3G A;  2AQ3 B;  2R61 A;  1FCC C;  4A3O A;  4ITK A;  3DBS A;  1ZPS A;  3PPA A;  1MVK A;  4TKN A;  4XE0 A;  2KDB A;  1WJU A;  2BWF A;  4RGM A;  3I5J C;  4RFB A;  1PQS A;  2R2O A;  1WX7 A;  1J7A A;  1J8C A;  3RI7 C;  5IN7 A;  1AWD A;  1FM0 D;  4EZK A;  4KIK A;  4WIP A;  2KJR A;  3EA6 A;  1S3S G;  4AP4 C;  2DWQ A;  1YJJ A;  1MG4 A;  3HM3 A;  3P4P B;  5CHF A;  3AE6 B;  1L6U A;  2LGX A;  3KLS X;  1V8C A;  2BF8 B;  2FNJ B;  3HUI A;  1AW7 A;  3RD2 A;  4KIK B;  3JVZ X;  3A9K A;  4H2A A;  4XC2 A;  2KAN A;  1XT9 B;  3E56 A;  4W9E A;  1WSP A;  1TY0 A;  1EWY C;  1R4M I;  1T0Y A;  5E6N A;  2KQ7 A;  2LGS A;  3ABV B;  4RM9 A;  3PGE A;  1CQV A;  3AH7 A;  2JXT A;  2IO0 B;  2DAF A;  3A9K B;  3AE5 B;  1WZ0 A;  2YEP B;  3VUX A;  1RAX A;  4C7Z A;  1VD2 A;  4KSL C;  1JWU D;  2BBC A;  4XWT A;  4BAX A;  4OVZ A;  5TSS A;  1A5R A;  2WXJ A;  1FPY A;  1GUA B;  1QOF A;  4JGH B;  1V97 A;  3OG5 A;  1GB4 A;  3P63 A;  1J19 A;  1L7Y A;  1YD8 U;  4MJS A;  2KX3 A;  2K25 A;  4I6L B;  3Q8F A;  3W1S C;  5FR3 A;  4AJW A;  1V9J A;  3ZQ4 A;  3VDZ A;  3AU5 A;  3VAW A;  3W5U B;  3CMM B;  2ZW1 A;  4MJS B;  2MBB B;  1ZW7 A;  3ENE A;  5E6O A;  5D7G A;  3RUI B;  1PGA A;  3P1M A;  1ZDV A;  3TEY A;  3GP7 A;  2LZ6 A;  3P4R B;  2E6X A;  3ZVV A;  4KSK C;  2DYM A;  3WAM A;  2JSV X;  2WXL A;  1UZX B;  2BQQ A;  2NBV B;  1TYG B;  1WFY A;  2MA9 B;  1WM2 A;  2Z59 B;  1TBE A;  2YEP F;  1UEL A;  2LXA A;  1LQB A;  4EZL A;  1JQ4 A;  2IJ0 A;  5BMG A;  1NDD A;  4US9 A;  5L83 A;  1RM6 C;  1VZ8 A;  2WXG A;  2XBB C;  2AYO B;  2JRH A;  4FHJ A;  5IP4 D;  4BBN C;  4FUL A;  1UD7 A;  1FRD A;  2MJ3 A;  3RMK C;  3V61 A;  4ARI A;  3AE8 B;  3L0W B;  2WXO A;  2J7Q B;  2DBY A;  3LJ3 A;  4P6V F;  5DPS A;  4A9A A;  1E8Z A;  4M0W A;  4WJO A;  2KT7 A;  5IAA C;  2MHJ A;  3NVZ A;  5L95 C;  2KWD A;  4K81 A;  2KHW B;  1WX9 A;  2WXK A;  1HZ5 A;  5HG2 A;  4NPN A;  1N63 A;  5IOI A;  3JSV A;  1LFD A;  1MG8 A;  4M0W B;  4FA6 A;  1YOV B;  4B0E A;  1WZ3 A;  4BKS A;  2J0K A;  4DK5 A;  1EF5 A;  3MC9 A;  1CJE A;  4HDO A;  3NHE B;  1MPE A;  3H7P A;  3N3K B;  2WP9 B;  3JSV B;  1BML C;  1WJ4 A;  1WM3 A;  4XYC A;  4B9K A;  1GJZ A;  1C1Y B;  1L2N A;  3AEG B;  3QC8 B;  2ON8 A;  2QJL A;  2MP2 A;  3H7P B;  2WXH A;  5D2M B;  4LJP B;  2IDY A;  2WS3 B;  2KDM A;  3WAO A;  4ANU A;  4NJC A;  2ICI A;  1XO3 A;  2MLB A;  1L4D B;  3I9V 1;  3CWI A;  2MP2 B;  2PMV A;  3AUL A;  3ZJT A;  2JQR B;  1JW9 D;  3FAH A;  4G50 A;  4MH8 A;  2DZK A;  4XZ4 A;  2KMA A;  3IT6 B;  2DAJ A;  3Q3O C;  1ZOY B;  3VQI A;  4TQ0 A;  3B08 A;  2IO3 B;  2M8S A;  1NI2 A;  3NZS A;  2EKI A;  2H89 B;  1WMH A;  3AE1 B;  2L05 A;  3C0R B;  4B0M A;  2WX0 A;  3UIP B;  3VXW A;  3CSF A;  3VRB B;  3M62 B;  4FBJ B;  4W9L A;  2WU2 B;  1I7H A;  1WMH B;  3NS1 A;  4OZA A;  1BXT A;  2LWP A;  2XK5 A;  2MWS B;  2KLG A;  5EE1 A;  3BYY B;  2KJH B;  2J0J A;  1WGK A;  2WXM A;  2KMC A;  4CHK A;  3VTV A;  3UIN B;  5DPW A;  1GPX A;  2GI9 A;  2QIL A;  4TQ1 A;  2V4I B;  2XK5 B;  3MTN B;  5D3I B;  3R8B A;  1E8W A;  2I2Y A;  3Q3M C;  4HDQ A;  3QK0 A;  1HZ6 A;  2PVG C;  1E9M A;  4L23 A;  2K6D B;  2JWU A;  2KNB A;  2LJI A;  3IAM 1;  2V0G A;  1VZ7 A;  1DOX A;  2LGI A;  4IWQ A;  2NR2 A;  4KVG B;  4JIO U;  4ZRQ A;  4BVU C;  2IO2 B;  3BK2 A;  3ZGZ A;  1YNT E;  3TBL D;  4NJ7 A;  1J7B A;  1MFW A;  2PKO A;  5J17 A;  2K8B A;  3A4S C;  3TUO A;  2KFJ A; 
#chains in the Genus database with same CATH homology
 4GMV A;  2YLM A;  3HIZ A;  4HXD A;  4PS3 A;  4EZJ A;  4FAD A;  1J0G A;  3HK0 A;  1UBI A;  1RLF A;  3UQA A;  3OAW A;  1WGD A;  3PHW B;  5D94 A;  2MBE A;  4LDT D;  5C23 A;  1RFA A;  3ZNH B;  4IM0 A;  3ZDM C;  4ZDV A;  3H6N A;  2MBH A;  3MJW A;  2RPQ A;  4W9D A;  4M8M A;  2JZ3 B;  2D11 A;  2FCN A;  2KTR A;  1RRB A;  4JLC A;  1WIA A;  2ZZP B;  2ZEQ A;  3PHX B;  2OOB B;  1UH6 A;  4BFR A;  5EDS A;  3ZIM A;  3DBL I;  1WR1 A;  4GN1 A;  4G11 A;  2KC2 A;  2KO3 A;  2L00 B;  3T8M A;  1AAR A;  4W9I A;  3A9J A;  1YQB A;  2LRW A;  1P9D U;  5G55 A;  2ZPY A;  4FHK A;  3X23 A;  1OEY A;  3VTU A;  1TTN A;  2HTH A;  3BY4 B;  3B0A A;  3IBE A;  4MEM A;  4F7Z A;  4DHJ B;  3DDC B;  2L76 A;  2KTR B;  2KWU B;  3W1S A;  3R7Q A;  2C7N B;  4KZC A;  3TJP A;  4BBN F;  3CST A;  5C1Z A;  4IM2 A;  2JUO A;  2LI5 A;  2WYQ A;  5CTR C;  3UF8 A;  1IP9 A;  2KK8 A;  3A9J B;  4FJY A;  4KZ0 A;  4PS7 A;  3ZRC A;  1I35 A;  4LJO B;  2Y5B B;  3ZO5 B;  3VUW A;  2M17 A;  2I1J A;  3ZW3 A;  2NCN A;  4ANW A;  1V49 A;  5AEK B;  2C7H A;  2V4L A;  2FAZ A;  4URK A;  1Z2M A;  4LCD E;  2AL6 A;  3HM6 X;  2QHO A;  1ISN A;  2JXX A;  2LVP A;  4MEL A;  4ASW C;  5DPT A;  2KVR A;  2MRP A;  4IWO A;  2NBU A;  5DPR A;  3B1L X;  1WE6 A;  1YX6 B;  2N9P C;  2LVQ A;  3U30 A;  1WI0 A;  2JT4 B;  2IBI B;  4HCP B;  1OTR B;  1QZE A;  4NJ6 A;  3DVG Y;  1ZKH A;  2NPT A;  3AXC A;  5DCN A;  2IYD B;  4LDT B;  1WJN A;  3OLM D;  1SE9 A;  2KDE B;  2UYZ B;  4GU2 A;  2RSU A;  1M94 A;  2L3Z A;  3M95 A;  1I42 A;  4OVU A;  4EOY A;  2IY0 B;  2JWZ A;  1UBQ A;  2LVO A;  4HK2 A;  5CX3 A;  3ZNZ B;  3KUD B;  2YVC A;  4WWP A;  1D3Z A;  2MBO A;  3PRE A;  2UWQ A;  3M63 B;  4NQL B;  1XQQ A;  3DVN U;  2DZM A;  3ZTC A;  2NPT B;  1IPG A;  1LM8 B;  2ZCC A;  2HJ8 A;  2CHW A;  2EKE C;  1OGW A;  1WYW B;  2D3G A;  3ZTD A;  1OQY A;  4W9C A;  4A3O A;  4BKG A;  3DBS A;  4JL9 A;  2IZV B;  3N30 A;  3PPA A;  2D07 B;  2JZZ A;  2PPH A;  4FN2 A;  4TKN A;  2G4S A;  2KDB A;  1WJU A;  4DDI D;  3IHP C;  2BWF A;  4EUT A;  2DHZ A;  5CHW A;  4A3P A;  2M0X A;  1PQS A;  1HE8 A;  2KDF B;  1KJT A;  4DK5 A;  2R2O A;  2K1F A;  3V6C B;  1WX7 A;  3BIN A;  3I3T B;  1J8C A;  4BKS D;  2REX A;  3A33 B;  2GMI C;  2C60 A;  3L16 A;  2DZJ A;  2L7R A;  4NNJ B;  3KUC B;  2KXJ A;  4EZK A;  3U8Z A;  2BWE S;  1JRU A;  2KOX A;  4KIK A;  5J18 A;  2KJR A;  4AP4 C;  1S3S G;  4P7I A;  4EEW A;  3HM3 A;  1WGY A;  5CHF A;  3D32 A;  4DHZ E;  4WQO B;  4DHZ B;  2ZNV C;  3IVF A;  3WA0 A;  1TZ1 A;  4HCN B;  2IO1 B;  5JHB A;  1IYF A;  2DX5 B;  2GBR A;  3ZDT A;  2LGX A;  2KTF A;  2Z0D B;  4NQK E;  3A1Q A;  2O6V D;  2N1W A;  3ALB A;  2BF8 B;  2L0T A;  2D10 A;  2FNJ B;  2O2V A;  3RD2 A;  2DYO A;  2JF5 A;  4KIK B;  3JVZ X;  3A9K A;  4NY0 A;  4XC2 A;  2KDI A;  1SIF A;  2KAN A;  2A4Z A;  1XT9 B;  3ZRF A;  1WH3 A;  4W9E A;  1WXS A;  2PJH A;  1R4M I;  5AZF A;  1T0Y A;  4WWN A;  5E6N A;  2KQ7 A;  2ZJD A;  2FCQ A;  1GC6 A;  2MCN B;  2PE9 A;  2W9N A;  3A1Q B;  1KM7 A;  3VTW A;  3P2B A;  3PGE A;  4RM9 A;  2O2V B;  1V5T A;  3R7R A;  2IO0 B;  2WDT B;  2IY1 B;  2DAF A;  3A9K B;  1V80 A;  2CU1 A;  1X1M A;  1WRD B;  1WZ0 A;  4E3C A;  3SU8 X;  3VUX A;  3NS8 A;  3AI5 A;  3NZU A;  3PRM B;  3R3M A;  3RT3 B;  5D6J B;  1RAX A;  5LXH A;  3APD A;  1WXM A;  1VD2 A;  2GBN A;  4GIV A;  4KSL C;  3RUL A;  1G6J A;  3DVN V;  1H8C A;  3APC A;  2O6V A;  2CHX A;  4II2 B;  1A5R A;  3O65 B;  4II3 B;  5JHA A;  2BGF A;  1OEY J;  3L54 A;  1GUA B;  2R2Q A;  2L8J A;  4ICV A;  3PRZ A;  1Q1O A;  4JGH B;  4XX5 A;  4RMA A;  3DOW A;  4TV3 A;  4PS8 A;  4MH0 E;  3ML9 A;  2JRI B;  1J19 A;  1L7Y A;  3Q3F A;  2LGD A;  3H1U A;  1YD8 U;  2DZI A;  4MJS A;  2KX3 A;  3U7D A;  2O6V B;  4IC7 B;  4TUU A;  1WY8 A;  2DYB A;  1XD3 B;  4HWI B;  2K25 A;  4EFO A;  3M3J A;  1S1Q B;  4KV2 A;  2K8C A;  4I6L B;  3W1S C;  3QAQ A;  4AJW A;  1V9J A;  4E71 A;  2LXC A;  3VDZ A;  2GBJ A;  3AU5 A;  2L0F A;  3RYT A;  3VAW A;  1E7V A;  3CMM B;  4X57 B;  2FCS A;  2G45 B;  4I6N B;  4MJS B;  2FCM A;  1Q0W B;  4GB9 A;  2MBB B;  1ZW7 A;  3ENE A;  2KWV B;  4MSM B;  5E6O A;  5D7G A;  3QQ8 B;  2ZVN A;  1WXV A;  4FLH A;  2LGY A;  4ZRK A;  3RUI B;  1GC7 A;  1P0R A;  3S2A A;  2LZ6 A;  3PLU A;  2BYF A;  3ZVV A;  4WJQ A;  4KSK C;  2DYM A;  3EC8 A;  3WAM A;  2N4F A;  3QX1 A;  4HPL B;  3K9P B;  2CHZ A;  4ANV A;  1UZX B;  2WWZ A;  2ZCB A;  4AOF A;  4B95 A;  4BOZ B;  2NBV B;  3TCA A;  3ZNG C;  1WFY A;  2K6Q A;  2KQS A;  2MA9 B;  1WM2 A;  2Z59 B;  1WGG A;  5FR6 A;  2N9X A;  1TBE A;  1H4R A;  3APF A;  2BKR B;  1UEL A;  4J6I A;  3L17 A;  3SHQ A;  3VVW B;  4N9F 4;  2LXA A;  1LQB A;  2JY6 A;  4K7U A;  4IWP A;  4EZL A;  5JH5 C;  2BKF A;  1NDD A;  3KUZ A;  5L83 A;  1P1A A;  1WGR A;  2K39 A;  2GOW A;  2KLC A;  2I1K A;  2XBB C;  2AYO B;  2HE7 A;  2JRH A;  3HHM A;  4FHJ A;  3DQV A;  4W9J A;  1R4N I;  4BBN C;  4FUL A;  3WAP A;  5GMV A;  3X0W A;  3V60 A;  5IA7 A;  4K7W A;  5E6P A;  3ZKJ C;  1UD7 A;  1YIW A;  4W9G A;  1P3Q U;  3EFU A;  4CYE A;  3V61 A;  4K1R B;  2AEH A;  3NOB A;  3L0W B;  4I6P A;  2J7Q B;  2D2Q A;  2BPS A;  2MSE D;  3LJ3 A;  2B3A A;  5DPS A;  3AU4 A;  2MX2 A;  3PV1 A;  4IW0 A;  1E8Z A;  2KX0 A;  1K8R B;  4WJO A;  2JVC A;  5IAA C;  4MGY E;  3IG3 A;  1Z5S B;  1SGH A;  3Q3J A;  3RCZ A;  5L95 C;  3PSE B;  3LDZ E;  4K81 A;  2KHW B;  5KHQ A;  5BO4 B;  4F1S A;  1WX9 A;  2PEA A;  4RM8 A;  1WR6 E;  5HKH A;  4NPN A;  2ZVO A;  3EEC A;  4CO7 A;  3K9O B;  5JZE B;  3JSV A;  4W9H A;  1TGZ B;  3VUY A;  1LFD A;  1MG8 A;  4M0W B;  2K8H A;  4FA6 A;  3QA8 A;  4ICU A;  1WZ3 A;  2KZR A;  4BKS A;  2FUH B;  3A4R A;  4FJZ A;  2CKH B;  2J0K A;  1EF5 A;  3CF6 E;  1YX5 B;  3QIJ A;  3VFK A;  3OJ3 A;  3TL5 A;  3UGB B;  5TR5 A;  5LLI A;  4HDO A;  3NHE B;  1WGH A;  2N7D A;  2AWT A;  5KHO A;  3ML8 A;  3WIM A;  2KC1 A;  3DCG A;  3PVL A;  4IG7 B;  3H7P A;  3WAL A;  3DBH I;  3N3K B;  3JSV B;  3OJ4 B;  3GOE A;  2LRU A;  4DWF A;  3EHV A;  4AUQ C;  2XEW A;  3QJZ A;  3TIX A;  3ZLZ A;  1WJ4 A;  2KKC A;  1WM3 A;  4B9K A;  2NVU I;  4W9K A;  1GJZ A;  1C1Y B;  1L2N A;  2NS5 A;  5LXI B;  1GNU A;  2PE6 B;  4B6W A;  4ANX A;  3SD5 A;  3DPD A;  3QC8 B;  1WX8 A;  2MP2 A;  3H7P B;  2DEN B;  3PLV A;  1VCB A;  5D2M B;  4HPM B;  4LJP B;  4WJN A;  4F8C B;  2CR5 A;  1EUV B;  3PT2 B;  2EMS A;  3N32 A;  3WAO A;  1E7U A;  4ANU A;  1E8X A;  3GZN I;  5AZH A;  1KLV A;  2MLB A;  3UQB A;  2JPH A;  2A5U A;  4JQW C;  5G2N A;  3PRP B;  4K7S A;  2MP2 B;  3AUL A;  2KJ6 A;  3KH0 A;  3PZD A;  1WF9 A;  3H7S A;  4G0N B;  4G50 A;  4PYU A;  4ZYN A;  1P98 A;  1E5W A;  2DZK A;  3ONS A;  4XZ4 A;  4FJV B;  2KMA A;  1BT0 A;  2DAJ A;  4KDI C;  3VH3 B;  2V3S A;  3VQI A;  1EO6 A;  4TQ0 A;  5AZG A;  3B08 A;  3T9L A;  4BOS C;  2IO3 B;  2AL3 A;  2M8S A;  3RZF A;  1NI2 A;  3DBR I;  3NZS A;  2N1V A;  1WMH A;  2V1Y A;  3DVG X;  2L05 A;  4DXA B;  2HD5 B;  3C0R B;  1LXD A;  4YL8 A;  2WX0 A;  2C7M B;  2KWC A;  2M4N A;  3UIP B;  1Y8R C;  3VXW A;  2LUE A;  2MQJ A;  3JW0 X;  3KVF B;  3ZUN A;  4KDL B;  4PYZ A;  3CSF A;  2M1M A;  4HVB A;  2N9E B;  3M62 B;  4FBJ B;  4W9L A;  2KD0 A;  4M8N A;  4GOC A;  3L08 A;  1EF1 A;  1NBF C;  1WMH B;  3IFW B;  1V81 A;  4ZRI A;  4GDK A;  2OJR A;  4NAW A;  3UIO B;  2GBK A;  2LWP A;  4BKT A;  3PTF C;  2VRR B;  4GXB A;  3V62 A;  2KFK A;  2RR9 A;  2XK5 A;  4G3X B;  2MWS B;  1Q5W B;  4MGI E;  2KLG A;  2KJH B;  2J0J A;  3L10 B;  3H9D A;  2Z0E B;  1ZGU B;  1V86 A;  4GSW A;  2RD0 A;  2KMC A;  2RGF A;  1UGM A;  2ZPN A;  3VTV A;  4CHK A;  1C3T A;  1WJ6 A;  2EMT A;  3JYU A;  3PS6 A;  3R66 C;  4IUM B;  3SDL C;  3KW5 B;  4GDK B;  3UIN B;  5DPW A;  4NAW B;  4HLE A;  2KFK B;  3ECI A;  3NY5 A;  4TQ1 A;  3V6E B;  2XK5 B;  3MTN B;  2C9W B;  3QCA A;  4MM3 A;  4WAA A;  1E8W A;  3KYD D;  2WX1 A;  2ASQ A;  4ZRJ A;  4WJP A;  4HJK A;  1KOT A;  4HDQ A;  4DBG A;  2MBQ A;  3QK0 A;  4IM3 A;  2LJ5 A;  3QAR A;  1FXT B;  2KN5 A;  1WXA A;  4MGZ E;  2C5L C;  4E74 A;  2K6D B;  1V6E A;  2KNB A;  4AWJ A;  4OVV A;  2BYV E;  4A20 A;  1GG3 A;  3QWZ B;  2NBW B;  3ZNI D;  5J2R A;  4MGK E;  1CMX B;  4GDL A;  4WWO A;  2GBM A;  4IWQ A;  1WE7 A;  2NR2 A;  4KVG B;  2N7E A;  2BYE A;  4JIO U;  4BVU C;  4DHJ D;  4GGQ A;  2IO2 B;  4DDG D;  2FIF A;  4AJY B;  1E90 A;  4MSQ B;  4MDK E;  3VH4 B;  2FID A;  2ZNV B;  3L13 A;  3TBL D;  4NJ7 A;  2G4D B;  2J0M A;  2G3Q B;  3MHS D;  3TMP B;  1U4A A;  2MW5 A;  1V5O A;  3KYC D;  5CHV C;  4GDL B;  4EKU A;  2K8B A;  3RZW C;  5J17 A;  3W1Y A;  1YJ1 A;  2LAS A;  2CS4 A;  1V2Y A;  1F9J A;  2LD9 A;  3A4S C;  2KFJ A;  4W9F A;  3VHT C;  3WAN A;  1E8Y A;  3QHT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...