1U4AA

Solution structure of human sumo-3 c47s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human SUMO-3 C47S and Its Binding Surface for Ubc9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin-like protein SMT3A
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1u4aA00
4LJPB 3ONSA 4AUQC 2KDIA 3CMMB 2L8JA 3EHVA 3A9KB 5J17A 3Q3FA 1V80A 2KC2A 3M95A 3CSFA 3NY5A 4ZRKA 4RMAA 1LQBA 3QC8B 4W9FA 4IW0A 3DVGX 3UGBB 1ISNA 3L13A 3PLUA 2JZZA 3VUXA 4TQ0A 2DYBA 2ZCCA 1WGRA 2IO2B 3M63B 4WJQA 4FADA 2G45B 3H1UA 2GBRA 5KHOA 3DVGY 2LZ6A 1WXAA 4JL9A 2KXJA 4AJWA 1EF1A 2C9WB 2KTRA 2Z0EB 3VUWA 2BWES 2C60A 2MBOA 3L10B 4PS7A 2O6VD 3TJPA 4HJKA 4ZYNA 4B9KA 3PHXB 2DX5B 1LM8B 2K6DB 3EECA 2CHXA 1WM3A 4BOSC 3H7PB 1RLFA 3VTVA 3APFA 5CHVC 2N9PC 4CO7A 4DHJD 1BT0A 2Y5BB 4PYZA 4F1SA 4EUTA 2KJRA 3PTFC 1P98A 2KQ7A 1YIWA 4BVUC 3WANA 1WXVA 2BGFA 4NQKE 4K7WA 4KIKA 3ZW3A 3TIXA 1V49A 3AI5A 2O2VA 3QIJA 4P7IA 1RAXA 2GBMA 3N3KB 1J19A 2L00B 2BYFA 1EUVB 3RCZA 2N1WA 3CF6E 2DYMA 2NR2A 1WMHA 1GC7A 3IFWB 2KWUB 3DBRI 3DBHI 2KD0A 3V60A 4ASWC 4W9LA 1TGZB 2C5LC 2IO1B 2ZVOA 2LGDA 1E90A 1SGHA 3QWZB 3KYCD 4W9IA 4IC7B 2KNBA 1IP9A 4NJ7A 3L16A 4MJSB 1Q0WB 3VH4B 2D11A 4HXDA 2LGYA 2ZNVB 5DPSA 4KZCA 3UIOB 2FCNA 4XC2A 3N32A 3H7SA 4G11A 4EZJA 3ZNZB 2LRUA 1WX7A 2CHZA 3WIMA 5JHAA 2IY0B 2FCSA 5CTRC 4A20A 4CYEA 1GG3A 1OGWA 2WDTB 3DPDA 4WQOB 5CX3A 1UZXB 2HJ8A 2AYOB 1V6EA 2DENB 2L3ZA 2KLCA 2I1KA 1WF9A 4KIKB 4PYUA 2HTHA 2KDBA 2MBQA 3UQAA 1A5RA 5C1ZA 4HPMB 5G55A 3NZUA 3OAWA 2JT4B 1WFYA 2JZ3B 4BBNF 1M94A 4FJZA 3ML8A 3RZWC 2KWCA 3PZDA 1OEYA 4IG7B 2KFKA 2FIDA 4DHZB 4DK5A 4W9CA 1FXTB 5TR5A 4GOCA 1WI0A 1J8CA 2NPTB 2YVCA 3RYTA 3MJWA 3ZVVA 4GU2A 4WJNA 2HE7A 2W9NA 4RM8A 5L95C 2WYQA 5JZEB 5CHFA 2PE9A 4F7ZA 4TV3A 3IG3A 4G50A 2JXXA 2V4LA 1YQBA 2IZVB 3L0WB 4A3OA 3A9JB 4M8MA 3R7RA 4HDOA 3U30A 1S1QB 2FNJB 3PV1A 4A3PA 2KTFA 4LCDE 4DXAB 5JH5C 5J2RA 4HWIB 3QHTA 2JRHA 1D3ZA 1L7YA 2L76A 1KM7A 2MSED 2MBEA 4YL8A 1YX6B 5D2MB 1Z5SB 3IHPC 4LDTD 3U7DA 4F8CB 3OJ3A 3KVFB 1WX8A 3VTWA 1WR6E 2FCMA 2C7HA 4HDQA 2RD0A 1WXMA 2O6VB 3PREA 5LLIA 4J6IA 4AJYB 4EFOA 1WIAA 4PS3A 3B0AA 2G4DB 2NVUI 3PT2B 1AARA 2JF5A 2MX2A 3CSTA 3QCAA 2LJ5A 1WX9A 2AL3A 2ZPYA 3BINA 4KVGB 4AWJA 2OOBB 5E6OA 3WAPA 3ZIMA 2LXCA 2L05A 3WALA 2JPHA 1WZ3A 4HK2A 5D94A 2N9EB 4NAWA 2BKRB 4IUMB 1NI2A 3OLMD 2G4SA 3ZNHB 5IA7A 1SIFA 1R4NI 4NY0A 1Q5WB 4DBGA 4FJVB 1WY8A 4EEWA 4LDTB 2LI5A 3VFKA 2M0XA 4GDKB 1UBQA 1WMHB 4W9HA 3A4RA 3K9OB 2B3AA 2ZCBA 3M3JA 3R66C 4MSMB 3ZNGC 1E7UA 2OJRA 3KH0A 4JGHB 4K81A 4RM9A 3LDZE 4MGKE 2O2VB 3WA0A 4BBNC 1U4AA 3O65B 1SE9A 3ENEA 3ZTDA 3GOEA 2KJ6A 3KUCB 4GDLA 1V5TA 4MGYE 2NBUA 1T0YA 1WYWB 2KQSA 2R2OA 2FUHB 4HCPB 4W9EA 2KWVB 2IY1B 2ZPNA 3H7PA 1X1MA 3A9KA 2MRPA 2N1VA 2K39A 1S3SG 2ZVNA 3KYDD 3APDA 1WM2A 3ML9A 2GOWA 3PS6A 2IO3B 2J0MA 2KANA 3SDLC 3VAWA 3VTUA 4EZKA 2LVQA 3AXCA 3ECIA 3IVFA 3QARA 4M8NA 4ZRJA 4BOZB 1I35A 4BKSD 5KHQA 3WAOA 2N7DA 1KLVA 1Z2MA 4KSLC 3ZTCA 1CMXB 2CS4A 2GBNA 3A33B 1WGHA 2DAFA 3ZDTA 3ZRCA 3W1SC 3P2BA 3NS8A 4HLEA 1WGGA 1V86A 2C7NB 2LUEA 4W9JA 2K8CA 3NHEB 5FR6A 2LD9A 2AEHA 1E8YA 3HK0A 1V81A 2ZEQA 2L7RA 4II2B 4NNJB 4GDKA 4EZLA 3VH3B 2KKCA 2KFJA 2IO0B 4WWOA 2LWPA 4GMVA 4NQLB 3UF8A 2KO3A 3VUYA 2EKEC 3PSEB 1WH3A 1TZ1A 3KUZA 5GMVA 1YD8U 2NCNA 4BKGA 4FN2A 2LXAA 5DCNA 3PPAA 1RRBA 3TBLD 1L2NA 1UBIA 3A9JA 5CHWA 4IWQA 1WE7A 3OJ4B 2JY6A 2J0JA 3Q3JA 4FHKA 4WWPA 2I1JA 4NPNA 2O6VA 2NS5A 3X0WA 2ZJDA 3PRMB 1UD7A 3HM3A 2PPHA 1TBEA 2MW5A 3DVNU 2DAJA 2DZIA 1NBFC 1E8XA 3ALBA 4EKUA 2K8BA 2R2QA 2PEAA 1GNUA 2M17A 1WZ0A 1Y8RC 3U8ZA 4KDIC 2DZKA 1VCBA 4GXBA 2NBWB 1WJUA 5C23A 5G2NA 1K8RB 4CHKA 1V2YA 2GBJA 4NJ6A 1XT9B 1E7VA 3I3TB 3KUDB 4FJYA 4K7SA 1YX5B 4G3XB 4OVVA 4IM3A 2BYEA 5E6PA 3V62A 3A1QA 3TCAA 3JVZX 4FBJB 1WGYA 3RUIB 2WWZA 3VDZA 2HD5B 2DZJA 1XQQA 3TMPB 2EMSA 4DHJB 1KOTA 4B95A 2Z0DB 2RPQA 3T8MA 1WGDA 2XK5A 1XD3B 2L0TA 4TUUA 4ZDVA 5D7GA 2REXA 2RSUA 3PRPB 1E8ZA 1GC6A 3QQ8B 2V1YA 3DQVA 1G6JA 3EFUA 4NAWB 1ZW7A 1H8CA 4WWNA 2KFKB 2KDFB 2QHOA 3VXWA 4LJOB 2ZZPB 4IM0A 2IBIB 4XZ4A 3PLVA 5DPRA 3L54A 4GSWA 4JQWC 2AWTA 4WJPA 3RT3B 1WXSA 4B6WA 4K7UA 4DWFA 2A5UA 5DPTA 3EC8A 3DDCB 1WJNA 3DVNV 2N7EA 5D6JB 3RD2A 4N9F4 1UH6A 3ZNID 2KMCA 4W9GA 1R4MI 2D2QA 2MP2A 3JSVA 3UIPB 3PVLA 3QX1A 4AOFA 3QA8A 1C3TA 2NBVB 2CKHB 2MBHA 3A1QB 2MP2B 3H9DA 3JSVB 1EO6A 2KJHB 4GGQA 3UINB 3PGEA 1YJ1A 3ZKJC 1UGMA 2D07B 1C1YB 1I42A 3X23A 1IPGA 3QK0A 1WR1A 5AZFA 1IYFA 2MQJA 2PJHA 2J7QB 2MBBB 4KV2A 3W1SA 2KMAA 3BY4B 2J0KA 4IM2A 2YLMA 4II3B 4MEMA 4MSQB 5AZHA 3SU8X 3W1YA 5DPWA 2GMIC 4MGZE 4E74A 2LGXA 3B1LX 3SHQA 3NZSA 1V9JA 1Q1OA 4ICUA 1P1AA 4MELA 2JUOA 2NPTA 3V6EB 3RZFA 2A4ZA 2UWQA 1WE6A 1NDDA 1ZKHA 4X57B 3VVWB 2WX0A 4E3CA 3L08A 1WRDB 3DCGA 3ZUNA 2BPSA 3HIZA 1QZEA 4M0WB 2KTRB 2KDEB 3ZRFA 2MLBA 2C7MB 2PE6B 2K6QA 2KX3A 4AP4C 4BKTA 3ZLZA 1OEYJ 3DBLI 2G3QB 3JW0X 2KK8A 3VQIA 4WJOA 4I6NB 1H4RA 2ZNVC 2MCNB 1P3QU 2CHWA 3IBEA 3HM6X 4ANWA 1UELA 2MA9B 3AU5A 2D10A 4JIOU 4BKSA 1LFDA 2JWZA 2VRRB 4TKNA 2BF8B 2XK5B 3V61A 1LXDA 2FIFA 3DBSA 1E5WA 1F9JA 1TTNA 3GZNI 5L83A 2RGFA 2BYVE 4ICVA 5HKHA 1P0RA 5AZGA 3H6NA 5AEKB 5JHBA 2LRWA 3TL5A 3VHTC 1HE8A 4IWPA 2GBKA 4GN1A 3JYUA 3LJ3A 2K1FA 3QAQA 3ZDMC 4XX5A 2D3GA 4BFRA 2EMTA 4DHZE 4MM3A 2Z59B 5LXIB 1KJTA 2LVPA 4ANUA 3C0RB 2KN5A 2M4NA 3UQBA 4HPLB 2M8SA 3R7QA 3PRZA 3MHSD 4FLHA 1E8WA 4GB9A 1GUAB 2AL6A 3MTNB 2WX1A 2KOXA 4KSKC 2CU1A 5LXHA 1WJ6A 2FCQA 4TQ1A 3ZO5B 4OVUA 4WAAA 5BO4B 3S2AA 2LVOA 2M1MA 2FAZA 4G0NB 4KDLB 4FHJA 1V5OA 3R3MA 3A4SC 1VD2A 1RFAA 5J18A 2KX0A 4PS8A 2K8HA 3NOBA 4FULA 3V6CB 2KLGA 3M62B 3N30A 2UYZB 4GDLB 4GIVA 1ZGUB 4DDID 2KC1A 1GJZA 5E6NA 2DZMA 4FA6A 2K25A 3PHWB 4I6LB 4W9KA 2KVRA 4URKA 4MH0E 3T9LA 4DDGD 4HVBA 1OQYA 4I6PA 2N4FA 1EF5A 4ANXA 3K9PB 4IWOA 4MDKE 3RULA 1MG8A 2MWSB 2RR9A 3DOWA 4KZ0A 4MGIE 2KHWB 3HHMA 4ANVA 3D32A 2XBBC 2KZRA 2DYOA 4HCNB 2DHZA 4K1RB 5EDSA 1J0GA 4JLCA 2CR5A 2BWFA 2XEWA 4MJSA 3QJZA 4ZRIA 1OTRB 3APCA 2BKFA 3AULA 2JRIB 3AU4A 3L17A 3KW5B 4EOYA 2IYDB 1WJ4A 4W9DA 2ASQA 2LASA 2N9XA 1PQSA 2JVCA 1P9DU 3SD5A 4E71A 3WAMA 1JRUA 5IAAC 2V3SA 2L0FA 3B08A
chains in the Genus database with same CATH superfamily
1OQQA 4LJPB 2KDIA 3A9KB 4S0RA 1LQBA 3QC8B 1ISNA 3PLUA 1XLNA 5AUKA 4LNNA 2IO2B 3H1UA 1WXAA 4JL9A 4AJWA 2C9WB 3I57A 1T5XD 4ZYNA 1LM8B 2W3SA 4BOSC 3P4PB 2D3AA 2M0AA 4PYZA 3ZJTA 1JALA 1P98A 2KQ7A 1AWDA 4M01A 3TIXA 3AI5A 3TSSA 2GBMA 3N3KB 3P42A 4N6EB 1SE4A 4ARIA 1XCQL 2DYMA 4J3OD 1WMHA 2PVGC 1PGXA 4LK0M 4ASWC 3BK1A 1QQRA 3N1ZC 3C19A 3DHHC 2OJWA 4RNAA 4W9IA 4YT0B 1IP9A 1TS4A 3O13A 3L16A 1Q0WB 4HKZE 2QC8A 4XYCA 3TUOA 3N32A 2Y3AA 4TMAB 2IY0B 2FCSA 1GG3A 5CX3A 2HJ8A 4RCOA 1YMHE 1UWMA 1YJIA 1WF9A 4BBNF 1KF6B 4FJZA 3PZDA 2FIDA 1PUTA 4EE2A 1KH0A 1JW9D 3ZVVA 2KACA 2HE7A 5HHDG 2JU6X 3IG3A 2JXXA 5LNK1 3R2TA 3NZ3A 4HDOA 4MT5A 2J52A 2Y5PA 5J2RA 1HZ6A 3QHTA 2WDRB 3NVWA 1D3ZA 1RWSA 5D2MB 3U7DA 4LDTD 3OJ3A 3KVFB 1ZXIA 2INDC 3VTWA 3VRAB 4HDQA 5MPOA 1NVID 1WXMA 3B0AA 5EE3A 1L4DB 2JF5A 1FXAA 1I7HA 2AL3A 3BINA 2OOBB 5E6OA 3CIRB 2BKRB 3OLMD 5IA7A 4NY0A 1ZE3D 2LGSA 1BMLC 1WGKA 1C4PA 4W9HA 2ZCBA 4MSMB 3SR6A 3ZNGC 1E7UA 4DXGA 4JGHB 1RYJA 4BBNC 2KN4A 1L0YB 4ZRQA 3ZTDA 3TEZA 3E9SA 4MGYE 2ICIA 1M4VA 2KWVB 1HQRD 5AUIA 2ZVNA 2MRPA 2K39A 3KYDD 1GB4A 2FE8A 1EU3A 3APDA 3PS6A 2J0MA 2KANA 2WXOA 4REZA 4US9A 3VTUA 4EZKA 1ZXHA 4C4VA 3ECIA 4BKSD 1NENB 4ARCA 3WAOA 3V05A 3ZTCA 3NUHB 2KVZA 3P2BA 3NS8A 2K8CA 5G5HA 2G9HD 1V81A 3P1MA 2ONQA 4C7ZA 2V3PA 4WWOA 4NQLB 1STEA 2WXIA 1C78A 3VUYA 3EGRA 5GMVA 5DCNA 1WE7A 1R7SA 2E3TA 4WWPA 4YWGG 1N5XA 4NPNA 2O6VA 2W3RA 1ENFA 1NYRA 1DYQA 2W54A 3N1XC 3ZYYX 1ZDXA 1UD7A 2NTSA 3HM3A 2QSDA 3DVNU 2TSSA 1NBFC 2XNAC 4KKIA 2M17A 1WZ0A 1K8RB 1SEBD 1XT9B 4ZRPA 1UGJA 4K7SA 1YX5B 4RH6A 4IM3A 2WXQA 2BYEA 1KLUD 3TCAA 3JVZX 1EWYC 3RUIB 2WWZA 2EMSA 3T8MA 1E0ZA 3MC8A 2L0TA 2REXA 3PRPB 4ZYSA 1G6JA 4NAWB 1ZW7A 2QHOA 3VXWA 2PVOD 3CWIA 4GSWA 3Q3NC 4WJPA 1WXSA 3EC8A 1Q10A 2N7EA 4WIPA 4W9GA 3UIPB 3RNAC 4H2AA 4LLGM 2WXKA 2MBHA 1GJZA 3H9DA 3ZKJC 2KJHB 2WXGA 5AZFA 1DOIA 1QT9A 2MQJA 2PJHA 3UI3A 4MEMA 3W1YA 2GMIC 2LGXA 3NZSA 1V9JA 1Q1OA 1B1ZA 2NPTA 3AE4B 2IGHA 1ZKHA 4BAXA 3NVVA 1MPEA 4OZCA 1UUPA 1FMAD 3AB5A 4BKTA 1C4AA 1N6ZA 3HVZA 1H4RA 2JZPA 2IJ0A 3W2DA 4LNIA 3AU5A 4JIOU 2L32A 4BKSA 4TKNA 1WXQA 1HZ5A 1LXDA 3U52E 1E5WA 1D5ZC 1CZPA 1YNTE 1P0RA 5AZGA 3H6NA 1JMLA 2CJOA 3VHTC 2KMMA 4XX5A 2D3GA 4BFRA 2D5GA 5BMHA 2M4NA 4HPLB 2M8SA 1V8CA 5H92C 2JYEA 1JQ4A 2LJIA 1MHHE 3PO0A 1WJ6A 2WXLA 4OVUA 2INPE 4G0NB 2M1MA 4KDLB 1V5OA 2WS3B 2KX0A 4PS8A 4YSZB 3NOBA 4GDLB 3R8BA 4A90A 4DDID 1EM7A 2KC1A 3SEBA 5E6NA 4URKA 3T9LA 4HVBA 1OQYA 1QOAA 4IWOA 3BVMA 2MWSB 1E6EB 3Q8FA 3Q6BA 1SBBB 3FAHA 3D32A 1BXTA 2XBBC 2KZRA 2DYOA 1J0GA 2WQYB 2BKFA 2JWUA 3AULA 4HROA 5IP4D 3T3NA 1SE2A 2N9XA 2RPVA 3DWMA 1JRUA 5IAAC 3AEDB 2L8JA 4US8A 2KC2A 4ZRKA 2I38A 4RMAA 1PDXA 4IW0A 3AEFB 3L13A 3VUXA 4O1NA 1WGRA 3RNEC 4MM3B 2G45B 3AE9B 5KHOA 2KXJA 4FXCA 1YN4A 3L10B 2O6VD 4HJKA 1XXGA 4B9KA 3PHXB 2K6DB 1RLFA 3APFA 1ESFA 2JSVX 1SJHD 1BT0A 1ET9A 1ZUD2 4MACA 3PTFC 1YIWA 3N1YC 3WANA 1WXVA 4NQKE 3IT4B 4P1BC 4P7IA 1J19A 2BYFA 2N1WA 1YN3A 3FILA 3IAS1 3AE3B 3DBRI 2KD0A 1FNVA 4HKQA 4W9LA 2V0GA 1SGHA 4KGRA 3IT6B 4NJ7A 2Q5WD 3Q69A 2D11A 2ZNVB 4XE0A 4WQMA 4C4VB 1HTOA 2WU2B 2BVCA 3ZNZB 2LRUA 4WWMA 3WIMA 5JHAA 2HJ1A 1IGCA 1OGWA 3DPDA 2XN9C 1V6EA 2DENB 2KLCA 2HTHA 1P7EA 2KDBA 1I4GA 3OAWA 2JZ3B 5HFYA 2BYTA 3ML8A 2KWCA 4IG7B 4W9CA 4GOCA 3Q2AC 2NPTB 3RYTA 4GU2A 4KGSA 3Q3MC 5L95C 5CHFA 4A3PA 3EFCA 4WH4A 3NVZA 2INNE 4OZBA 3BVGA 2L76A 2MSED 1Z5SB 3IHPC 1MG4A 1WR6E 4RGTA 2O6VB 1F0ZA 2NVUI 3PT2B 2MX2A 3CSTA 3QCAA 1AYFA 4HK2A 5D94A 2WXFA 3ZNHB 1NI2A 1Q5WB 2N9LA 4LDTB 1XEEA 2D3BA 1ACCA 2M0XA 3B2GA 4GDKB 3K9OB 3T3OA 4OW0A 1FRRA 3KH0A 1AW7A 4MGKE 1HEZE 3O65B 4KGTA 2KJ6A 4GDLA 1V5TA 2BS2B 3RNCC 1QOGA 1X1MA 1MHXA 1WM2A 1JWUD 2Z8LA 3SDLC 3VAWA 1VJKA 1ZP0B 1XF5L 4BOZB 3SFDB 2R61A 1Z2MA 4KSLC 3AMZA 3ZRCA 4RF1A 1V86A 4W9JA 4WURA 1JCKB 3NHEB 5FR6A 2LD9A 2QIEB 3GZNB 1HA5A 2ZEQA 3DBHB 4II2B 4NNJB 3I9V1 1YN5A 5FKAC 3AH7A 3UF8A 3N9YC 3PSEB 1WH3A 1TZ1A 1I4XA 4BKGA 4FN2A 2LXAA 1TS3A 3DHIC 1UNSA 1QF6A 3Q3JA 4XDDA 2I1JA 3AE5B 3X0WA 3PRMB 2PPHA 5BMGA 5I4DA 5HG2A 2KQ4X 4EKUA 2PEAA 1ZDVA 3U8ZA 1JWMD 3ABVB 4KDIC 1TYGB 1VCBA 2ZW1A 4GXBA 5C23A 4CHKA 4JWSC 1TKGA 4XGAB 1VZ6A 2GBJA 1E7VA 3KUDB 2BT6A 3A1QA 1TY2A 4FBJB 2MEKA 2HD5B 4DHJB 2RPQA 4M00A 1JRPA 5D3IB 4ZDVA 5D7GA 2RSUA 3RNBC 1GC6A 1RM6C 1N5WA 1HXYD 1C4CA 1PFDA 3DBRB 5DPRA 3L54A 3TEWA 4L2YA 1TIFA 1Y56A 1FRDA 3DVNV 1K53A 3RD2A 4N9F4 1UH6A 3ZNID 2B76B 4ACFA 4RGMA 3NVYA 3JSVA 3PVLA 2NTTA 3QX1A 3DWGC 4AOFA 1JWSD 3QA8A 2MP2B 3UINB 1FPYA 2D07B 1I42A 3IAM1 1IPGA 2FUG1 1L5PA 1WR1A 4A55A 1TT5B 1N62A 2J7QB 2MBBB 4KV2A 3W1SA 3BY4B 2J0KA 4IM2A 3SU8X 5DPWA 1FNWA 5AZHA 1JWAD 1KFYB 3R2IA 1P1AA 3V6EB 2RDHA 3BYYB 1NDDA 4X57B 1LGRA 4PT5A 3VVWB 3ZUNA 4KKJA 1C79A 1NYQA 3ZRFA 2N7JA 2PE6B 4C00A 1P7FA 3SFEB 1OEYJ 1T3QA 2G3QB 4WJOA 3MP9A 2VH1A 2CHWA 2BQQA 1UELA 1FIQA 3DHGC 1QKZA 2DBYA 4XDCA 2WDVB 5JXVA 1TTNA 2W55A 2RGFA 2BYVE 5BMIA 1VDVA 3ZXVA 5HKHA 1TKYA 4HEA1 3ETRA 3RFZB 2LRWA 4IWPA 4GN1A 3LJ3A 3RMKC 2K1FA 3QAQA 3TEXA 1KJTA 4HJGE 2WNMA 2V3NA 3R7QA 5BYQA 1DOYA 4FLHA 4GB9A 1GUAB 1YOVB 2AL6A 2RDBC 2WX1A 3MTNB 2CU1A 3MFGA 5LXHA 2WXHA 3ZO5B 1UF0A 5EE0A 3Q8AA 1ZOYB 1DGJA 1IGDA 1PGBA 2JQRB 1RFAA 2K22A 3BYTB 2K8HA 3V6CB 3M62B 2MHJA 2L83A 1SB3C 1C76A 4DDGD 1F2RI 4IKGA 2WXPA 3K9PB 3V3XA 2QILA 4MGIE 3HHMA 4MH8A 1QOBA 2Y5CA 1K52A 2BWFA 2XEWA 4MJSA 3QJZA 2MJEA 4LNOA 3NRZA 3MJ5A 1WJ4A 2ASQA 1PQSA 3SD5A 4E71A 3WAMA 1NEKB 2V3SA 2L0FA 1C77A 3AE7B 3ONSA 4AUQC 3CMMB 3LXFA 3EHVA 1MI0A 5J17A 3Q3FA 3CSFA 3NY5A 3C8YA 4W9FA 3GB1A 3UGBB 1SF0A 4TQ0A 2NMQA 2ZCCA 2INCC 2QEJC 4FADA 4YTMB 2GBRA 2M19A 2LZ6A 3I5JC 1YQ3B 2Z0EB 2BWES 2MBOA 2AX5A 3TJPA 2N0SB 1SE3A 2CHXA 1OFFA 1WM3A 3H7PB 5CHVC 4DHJD 4OZAA 2Y5BB 1I4QA 4F1SA 1ET6A 2WU5B 3KLSX 1N63A 5FR3A 2BGFA 4K7WA 3ZW3A 1XLPA 2O2VA 3QIJA 3BIID 1RAXA 1ROEA 2L00B 2WXRA 1EUVB 2JYTA 3RCZA 3IFWB 2KWUB 3DBHI 1TGZB 2IO1B 2ZVOA 2LGDA 4QAYA 3QWZB 3KYCD 4IC7B 4C7YA 3VH4B 4HXDA 5DPSA 1FD6A 4KZCA 3N20C 2FCNA 2V4IB 1SJED 3H7SA 3PZ7A 2ON8A 1T6BX 2CHZA 2WHIA 2WXJA 4A20A 4CYEA 2KYWA 1UZXB 1TY0A 2AYOB 2IGDA 2L3ZA 1V97A 2I1KA 4PYUA 2MBQA 1A5RA 3ZJUA 4PK1A 3J9CA 1WFYA 1M94A 4K3BA 1OEYA 1FXIA 4RFBA 1FXTB 4R3DA 1F52A 3MJWA 3W5VB 4WJNA 3EUB2 4RM8A 4F7ZA 2J42A 4G50A 1YQBA 2IZVB 4A3OA 1VZ7A 3U30A 1S1QB 2FNJB 5JH5C 1MVKA 2JRHA 1KTKA 1KM7A 2MBEA 4F8CB 2QDFA 1WX8A 2FBWB 2FCMA 2C7HA 2H88B 2PIAA 2RD0A 1KLGD 3PREA 1AN8A 5LLIA 4J6IA 4AJYB 4PS3A 2RDGA 1UWXA 1AARA 1FM0D 4YTPB 2LJ5A 1WX9A 4KVGB 1I4PA 5IO9A 4N59A 3WAPA 2L05A 2GRIA 1GAQB 4IUMB 1SIFA 4DBGA 2DNFA 1WY8A 3HVDA 1FCCC 1UBQA 1WMHB 3HRDD 3R66C 2B3AA 2AQ1B 3LYYA 4K81A 2J53A 4RGOS 3P4RB 2O2VB 4HRSA 4NJCA 4L23A 1T0SC 2R2OA 2KAJA 2KQSA 4HCPB 2FUHB 1L0VB 5T8IA 3E56A 2IY1B 3H7PA 3A9KA 5EE9A 2UU7A 2N1VA 2IPKD 1TKEA 1FCLA 2OEDA 3B9JA 3Q3OC 4M8NA 5KHQA 1KLVA 2OHFA 1PGAA 2GBNA 3A33B 1WGHA 2DAFA 3ZDTA 3W1SC 2L52A 2C7NB 2LUEA 1FFVA 2AEHA 1E8YA 3HK0A 4GDKA 2KKCA 2IO0B 4P16A 4GMVA 1OQRA 2VZKD 1GB1A 3KUZA 2NCNA 3ZJVA 1UBIA 3A9JA 3OJ4B 4TSSA 2J0JA 4NZLB 4FHKA 1EU4A 4A9AA 2N9KA 1FFUA 2SEBD 1TBEA 2DZIA 3ALBA 1T0QC 1GNUA 5IOIA 3RPFC 1F77A 2DZKA 4L1BA 5G2NA 4A6QA 1D4BA 1V2YA 4NJ6A 1N60A 4FJYA 1NI3A 4OVVA 4LNKA 4NAMA 5E6PA 5TSSA 3OWEB 4LTUA 3VDZA 2DZJA 1XQQA 1N61A 2WGSA 3U7ZA 3NG0A 2XK5A 4TUUA 4USAA 2BS3B 1E8ZA 3QQ8B 3EFUA 4LJOB 2ZZPB 1YJJA 4IM0A 2IBIB 3IXSA 2WDQB 2WXNA 3MC0B 3PLVA 4XZ4A 2AWTA 3RT3B 5HI1A 4B6WA 4K7UA 4DWFA 3RN9C 3KWLA 1EWCA 1F2RC 4CQNA 2IDYA 2MJ3A 1R4MI 1VLBA 1XLQA 1C3TA 2CKHB 3FILB 4YSXB 3AECB 1UGMA 1R4NB 1FEHA 1TJEA 2KMAA 5IKCM 2YLMA 4II3B 4MSQB 4MGZE 3P4SB 1I4RA 2E6XA 4MELA 3RZFA 2UWQA 1WE6A 2WX0A 2DLBA 4E3CA 3L08A 4DQOC 2IGGA 2KTRB 2KDEB 2MLBA 2C7MB 4AP4C 4RGNA 1E9MA 3ZLZA 3DBLI 2GI9A 2KK8A 4I6NB 3MHZA 3ZGZA 4KX6B 1IBXA 2MA9B 5FK9C 2VRRB 2PLPA 2BF8B 3V61A 2FIFA 1JWBD 1IBXB 1L0XB 3NJTA 2W82A 3TL5A 1E10A 3JYUA 3ZDMC 5LXIB 2BW2A 1J7BA 3RNFC 2QCZA 3UQBA 3PRZA 3MHSD 4JWUC 1E8WA 4ZOHC 2SAKA 5C3JB 2FCQA 3AE8B 5BO4B 3AV8A 3S2AA 4OHJA 2LVOA 3U4EG 2QJLA 4FHJA 5J18A 4FULA 1DOXA 2LHEA 3N30A 4GIVA 1ZGUB 1SIJA 4FA6A 1GOZA 2K25A 3PHWB 4I6LB 4W9KA 3GE3C 2H89B 2N4FA 1EF5A 4ANXA 3Q8BA 2KT7A 2GLSA 1MG8A 2RR9A 1V1OA 3DOWA 2K0PA 4KZ0A 2GB1A 4ANVA 4HCNB 2DHZA 1K51A 4JLCA 2CR5A 4ZRIA 1OTRB 2V9HA 3APCA 2JRIB 3AU4A 4ITKA 3L17A 3KW5B 1TS2A 2IYDB 4EOYA 2LASA 4WAFA 3B08A 2BB6A 1T0RC 3L4PA 1V80A 3M95A 2BBCA 3DVGX 5GXGB 1WRIA 2JZZA 1VZ8A 2DYBA 3M63B 4WJQA 1GPXA 3FC4A 2PKOA 5IN7A 2MH7A 3DVGY 1V1PA 2PMVA 1EF1A 3VUWA 2KTRA 1J7CA 1ZPSA 3PZ8A 2C60A 4PS7A 2DX5B 3EECA 2LEKA 3VTVA 2N9PC 2LFIA 2PTLA 3U2SC 4CO7A 5BYSA 2CU3A 3BK2A 4EUTA 2KJRA 4BVUC 4KIKA 1CK1A 3LB8C 1V49A 1TS5A 3AE2B 1HTQA 3CF6E 3P63A 1LO5D 2NR2A 1GC7A 3AEEB 3V60A 4K3CA 1JROA 2DWQA 2C5LC 1E90A 2MJDA 4N58A 2KNBA 2LUMA 4MJSB 2LGYA 3UIOB 4XC2A 2HDEA 4G11A 4EZJA 1PYWD 2QMTA 1L6VA 1WX7A 4YXDB 2HTME 4S17A 4YSYB 1IUEA 5CTRC 4HPPA 1KRHA 2WDTB 1MFWA 2G1EA 4WQOB 2EKIA 1C9FA 4P6VF 2LGIA 4KIKB 3UQAA 5C1ZA 4HPMB 5G55A 3NZUA 2JT4B 3RZWC 2KFKA 4DHZB 4DK5A 5TR5A 4M02A 4M0WA 1WI0A 1J8CA 2YVCA 3AEGB 3AM9A 2JX5A 4GLSC 4JX1C 4D2KA 2W9NA 2VZKB 2WYQA 5JZEB 2PE9A 1VR9A 3RI7C 2BB5A 4TV3A 2V4LA 3L0WB 2K5PA 3A9JB 4M8MA 3R7RA 4P1CC 3AEAB 3PV1A 2KTFA 1D6EC 4LCDE 1WSPA 4DXAB 2WP9B 4HWIB 1L7YA 3EA6A 4YL8A 3AE1B 1YX6B 4XWWA 1TZOA 2RMMA 4DXFA 4EFOA 1WIAA 2G4DB 1E7PB 2EELA 2ZPYA 4ZHOA 2YEPF 4AWJA 4UDUC 3ZIMA 2LXCA 3WALA 2JPHA 1WZ3A 5BYRA 2N9EB 4NAWA 2G4SA 1R4NI 4FJVB 4EEWA 2LI5A 3VFKA 3A4RA 3M3JA 1CJEA 2OJRA 4RM9A 3LDZE 3VRBB 2ACZB 3WA0A 4BZAA 1U4AA 1SE9A 3ENEA 3GOEA 3KUCB 4W9EA 2NBUA 1T0YA 1WYWB 2ZPNA 2WXMA 3W9CB 2L1AA 1S3SG 3ML9A 3B2FA 2GOWA 2IO3B 2LMCA 1QILA 2LVQA 3AXCA 3IVFA 3QARA 4ZRJA 1I35A 2N7DA 1CMXB 1L6UA 2CS4A 1L4ZB 2VH2A 4JE3B 4XWTA 4HLEA 1WGGA 3I63C 4Q2JA 1XO3A 2L7RA 4EZLA 3VH3B 2KFJA 2LWPA 3AE6B 1CQVA 2KO3A 4B0EA 2EKEC 1YD8U 4AQ7A 3PPAA 1RRBA 3TBLD 1L2NA 5CHWA 4IWQA 1K50A 2JY6A 3URYA 1WWTA 2NS5A 2ZJDA 3AN1A 1VRAB 2LHDA 2MW5A 2DAJA 3BWUD 1E8XA 1J7AA 2K8BA 2R2QA 1Y8RC 2CJNA 2K3UA 1F1HA 4OVZA 1FNUA 2NBWB 1WJUA 3FKYA 2J4XA 1B9RA 3I3TB 4YTNB 3WCQA 3ZXRA 4G3XB 3ZQ4A 3GE8C 3V62A 1A70A 1WGYA 3TMPB 1KOTA 3AEBB 4ZHPA 4B95A 2Z0DB 2WLBA 1WGDA 1XD3B 4C56C 4LNFA 2V1YA 3DQVA 1MJDA 1H8CA 4WWNA 2KFKB 2KDFB 3NS1A 1QLBB 3OG5A 3W5UB 2PW9A 4JQWC 2A5UA 4IOIE 5DPTA 3DDCB 1WJNA 5D6JB 2YEPB 2AQ2B 2KMCA 2D2QA 2MP2A 1BUIC 2NBVB 4GGQA 3A1QB 3GP7A 3JSVB 1EO6A 3PGEA 1YJ1A 4A8XC 1C1YB 3X23A 3QK0A 1R4MB 2K9XA 1IYFA 1I4HA 3Q14C 4C80A 2BS4B 4E74A 2KWDA 3B1LX 1D5MC 3SHQA 4ICUA 2JUOA 2A4ZA 1WRDB 3DCGA 3Q8EA 2BPSA 3HIZA 4M0WB 1QZEA 3KWVA 3HUIA 3TEYA 3P4QB 2K6QA 2KX3A 3JW0X 5EE1A 3Q8CA 3VQIA 2ZNVC 2MCNB 1P3QU 3IBEA 3HM6X 4ANWA 2D10A 1LFDA 5C2TB 2JWZA 3DBLB 2ZW0A 5E6JA 1XLOA 2XK5B 3DBSA 2AQ3B 1F9JA 3GZNI 5L83A 4ICVA 4JPSA 5H8YE 5AEKB 5JHBA 1HE8A 2GBKA 1V1PB 2BTEA 4DHZE 2EMTA 4MM3A 2Z59B 2LVPA 4ANUA 3C0RB 1SSNA 1RFKA 2KN5A 3H8HA 2I2YA 4B0MA 1QOFA 2KOXA 4KSKC 5D3DA 2D3CA 2JXTA 4TQ1A 4WAAA 2FAZA 3R3MA 3A4SC 1VD2A 1YQ4B 2KLGA 2UYZB 3MC9A 3GS2A 2KDMA 2DZMA 2KVRA 4MH0E 2X8XX 4I6PA 1WYGA 1D5XC 4MDKE 3RULA 1XCTL 2X38A 3RNGC 2KHWB 4IDIA 3VR8B 4K1RB 3BVZA 3VR9B 5EDSA 3KQ4A 4W9DA 1FO4A 5G5GA 2JVCA 1P9DU 1SXTA 4AS1A 3BZDB 4RF0A 2M56B
chains in the Genus database with same CATH topology
4LJPB 3ONSA 4AUQC 2KDIA 3CMMB 2L8JA 3EHVA 3A9KB 5J17A 3Q3FA 1V80A 2KC2A 3M95A 3CSFA 3NY5A 4ZRKA 4RMAA 1LQBA 3QC8B 4W9FA 4IW0A 3DVGX 3UGBB 1ISNA 3L13A 3PLUA 2JZZA 3VUXA 4TQ0A 2DYBA 2ZCCA 1WGRA 2IO2B 3M63B 4WJQA 4FADA 2G45B 3H1UA 2GBRA 5KHOA 3DVGY 2LZ6A 1WXAA 4JL9A 2KXJA 4AJWA 1EF1A 2C9WB 2KTRA 2Z0EB 3VUWA 2BWES 2C60A 2MBOA 3L10B 4PS7A 2O6VD 3TJPA 4HJKA 4ZYNA 4B9KA 3PHXB 2DX5B 1LM8B 2K6DB 3EECA 2CHXA 1WM3A 4BOSC 3H7PB 1RLFA 3VTVA 3APFA 5CHVC 2N9PC 4CO7A 4DHJD 1BT0A 2Y5BB 4PYZA 4F1SA 4EUTA 2KJRA 3PTFC 1P98A 2KQ7A 1YIWA 4BVUC 3WANA 1WXVA 2BGFA 4NQKE 4K7WA 4KIKA 3ZW3A 3TIXA 1V49A 3AI5A 2O2VA 3QIJA 4P7IA 1RAXA 2GBMA 3N3KB 1J19A 2L00B 2BYFA 1EUVB 3RCZA 2N1WA 3CF6E 2DYMA 2NR2A 1WMHA 1GC7A 3IFWB 2KWUB 3DBRI 3DBHI 2KD0A 3V60A 4ASWC 4W9LA 1TGZB 2C5LC 2IO1B 2ZVOA 2LGDA 1E90A 1SGHA 3QWZB 3KYCD 4W9IA 4IC7B 2KNBA 1IP9A 4NJ7A 3L16A 4MJSB 1Q0WB 3VH4B 2D11A 4HXDA 2LGYA 2ZNVB 5DPSA 4KZCA 3UIOB 2FCNA 4XC2A 3N32A 3H7SA 4G11A 4EZJA 3ZNZB 2LRUA 1WX7A 2CHZA 3WIMA 5JHAA 2IY0B 2FCSA 5CTRC 4A20A 4CYEA 1GG3A 1OGWA 2WDTB 3DPDA 4WQOB 5CX3A 1UZXB 2HJ8A 2AYOB 1V6EA 2DENB 2L3ZA 2KLCA 2I1KA 1WF9A 4KIKB 4PYUA 2HTHA 2KDBA 2MBQA 3UQAA 1A5RA 5C1ZA 4HPMB 5G55A 3NZUA 3OAWA 2JT4B 1WFYA 2JZ3B 4BBNF 1M94A 4FJZA 3ML8A 3RZWC 2KWCA 3PZDA 1OEYA 4IG7B 2KFKA 2FIDA 4DHZB 4DK5A 4W9CA 1FXTB 5TR5A 4GOCA 1WI0A 1J8CA 2NPTB 2YVCA 3RYTA 3MJWA 3ZVVA 4GU2A 4WJNA 2HE7A 2W9NA 4RM8A 5L95C 2WYQA 5JZEB 5CHFA 2PE9A 4F7ZA 4TV3A 3IG3A 4G50A 2JXXA 2V4LA 1YQBA 2IZVB 3L0WB 4A3OA 3A9JB 4M8MA 3R7RA 4HDOA 3U30A 1S1QB 2FNJB 3PV1A 4A3PA 2KTFA 4LCDE 4DXAB 5JH5C 5J2RA 4HWIB 3QHTA 2JRHA 1D3ZA 1L7YA 2L76A 1KM7A 2MSED 2MBEA 4YL8A 1YX6B 5D2MB 1Z5SB 3IHPC 4LDTD 3U7DA 4F8CB 3OJ3A 3KVFB 1WX8A 3VTWA 1WR6E 2FCMA 2C7HA 4HDQA 2RD0A 1WXMA 2O6VB 3PREA 5LLIA 4J6IA 4AJYB 4EFOA 1WIAA 4PS3A 3B0AA 2G4DB 2NVUI 3PT2B 1AARA 2JF5A 2MX2A 3CSTA 3QCAA 2LJ5A 1WX9A 2AL3A 2ZPYA 3BINA 4KVGB 4AWJA 2OOBB 5E6OA 3WAPA 3ZIMA 2LXCA 2L05A 3WALA 2JPHA 1WZ3A 4HK2A 5D94A 2N9EB 4NAWA 2BKRB 4IUMB 1NI2A 3OLMD 2G4SA 3ZNHB 5IA7A 1SIFA 1R4NI 4NY0A 1Q5WB 4DBGA 4FJVB 1WY8A 4EEWA 4LDTB 2LI5A 3VFKA 2M0XA 4GDKB 1UBQA 1WMHB 4W9HA 3A4RA 3K9OB 2B3AA 2ZCBA 3M3JA 3R66C 4MSMB 3ZNGC 1E7UA 2OJRA 3KH0A 4JGHB 4K81A 4RM9A 3LDZE 4MGKE 2O2VB 3WA0A 4BBNC 1U4AA 3O65B 1SE9A 3ENEA 3ZTDA 3GOEA 2KJ6A 3KUCB 4GDLA 1V5TA 4MGYE 2NBUA 1T0YA 1WYWB 2KQSA 2R2OA 2FUHB 4HCPB 4W9EA 2KWVB 2IY1B 2ZPNA 3H7PA 1X1MA 3A9KA 2MRPA 2N1VA 2K39A 1S3SG 2ZVNA 3KYDD 3APDA 1WM2A 3ML9A 2GOWA 3PS6A 2IO3B 2J0MA 2KANA 3SDLC 3VAWA 3VTUA 4EZKA 2LVQA 3AXCA 3ECIA 3IVFA 3QARA 4M8NA 4ZRJA 4BOZB 1I35A 4BKSD 5KHQA 3WAOA 2N7DA 1KLVA 1Z2MA 4KSLC 3ZTCA 1CMXB 2CS4A 2GBNA 3A33B 1WGHA 2DAFA 3ZDTA 3ZRCA 3W1SC 3P2BA 3NS8A 4HLEA 1WGGA 1V86A 2C7NB 2LUEA 4W9JA 2K8CA 3NHEB 5FR6A 2LD9A 2AEHA 1E8YA 3HK0A 1V81A 2ZEQA 2L7RA 4II2B 4NNJB 4GDKA 4EZLA 3VH3B 2KKCA 2KFJA 2IO0B 4WWOA 2LWPA 4GMVA 4NQLB 3UF8A 2KO3A 3VUYA 2EKEC 3PSEB 1WH3A 1TZ1A 3KUZA 5GMVA 1YD8U 2NCNA 4BKGA 4FN2A 2LXAA 5DCNA 3PPAA 1RRBA 3TBLD 1L2NA 1UBIA 3A9JA 5CHWA 4IWQA 1WE7A 3OJ4B 2JY6A 2J0JA 3Q3JA 4FHKA 4WWPA 2I1JA 4NPNA 2O6VA 2NS5A 3X0WA 2ZJDA 3PRMB 1UD7A 3HM3A 2PPHA 1TBEA 2MW5A 3DVNU 2DAJA 2DZIA 1NBFC 1E8XA 3ALBA 4EKUA 2K8BA 2R2QA 2PEAA 1GNUA 2M17A 1WZ0A 1Y8RC 3U8ZA 4KDIC 2DZKA 1VCBA 4GXBA 2NBWB 1WJUA 5C23A 5G2NA 1K8RB 4CHKA 1V2YA 2GBJA 4NJ6A 1XT9B 1E7VA 3I3TB 3KUDB 4FJYA 4K7SA 1YX5B 4G3XB 4OVVA 4IM3A 2BYEA 5E6PA 3V62A 3A1QA 3TCAA 3JVZX 4FBJB 1WGYA 3RUIB 2WWZA 3VDZA 2HD5B 2DZJA 1XQQA 3TMPB 2EMSA 4DHJB 1KOTA 4B95A 2Z0DB 2RPQA 3T8MA 1WGDA 2XK5A 1XD3B 2L0TA 4TUUA 4ZDVA 5D7GA 2REXA 2RSUA 3PRPB 1E8ZA 1GC6A 3QQ8B 2V1YA 3DQVA 1G6JA 3EFUA 4NAWB 1ZW7A 1H8CA 4WWNA 2KFKB 2KDFB 2QHOA 3VXWA 4LJOB 2ZZPB 4IM0A 2IBIB 4XZ4A 3PLVA 5DPRA 3L54A 4GSWA 4JQWC 2AWTA 4WJPA 3RT3B 1WXSA 4B6WA 4K7UA 4DWFA 2A5UA 5DPTA 3EC8A 3DDCB 1WJNA 3DVNV 2N7EA 5D6JB 3RD2A 4N9F4 1UH6A 3ZNID 2KMCA 4W9GA 1R4MI 2D2QA 2MP2A 3JSVA 3UIPB 3PVLA 3QX1A 4AOFA 3QA8A 1C3TA 2NBVB 2CKHB 2MBHA 3A1QB 2MP2B 3H9DA 3JSVB 1EO6A 2KJHB 4GGQA 3UINB 3PGEA 1YJ1A 3ZKJC 1UGMA 2D07B 1C1YB 1I42A 3X23A 1IPGA 3QK0A 1WR1A 5AZFA 1IYFA 2MQJA 2PJHA 2J7QB 2MBBB 4KV2A 3W1SA 2KMAA 3BY4B 2J0KA 4IM2A 2YLMA 4II3B 4MEMA 4MSQB 5AZHA 3SU8X 3W1YA 5DPWA 2GMIC 4MGZE 4E74A 2LGXA 3B1LX 3SHQA 3NZSA 1V9JA 1Q1OA 4ICUA 1P1AA 4MELA 2JUOA 2NPTA 3V6EB 3RZFA 2A4ZA 2UWQA 1WE6A 1NDDA 1ZKHA 4X57B 3VVWB 2WX0A 4E3CA 3L08A 1WRDB 3DCGA 3ZUNA 2BPSA 3HIZA 1QZEA 4M0WB 2KTRB 2KDEB 3ZRFA 2MLBA 2C7MB 2PE6B 2K6QA 2KX3A 4AP4C 4BKTA 3ZLZA 1OEYJ 3DBLI 2G3QB 3JW0X 2KK8A 3VQIA 4WJOA 4I6NB 1H4RA 2ZNVC 2MCNB 1P3QU 2CHWA 3IBEA 3HM6X 4ANWA 1UELA 2MA9B 3AU5A 2D10A 4JIOU 4BKSA 1LFDA 2JWZA 2VRRB 4TKNA 2BF8B 2XK5B 3V61A 1LXDA 2FIFA 3DBSA 1E5WA 1F9JA 1TTNA 3GZNI 5L83A 2RGFA 2BYVE 4ICVA 5HKHA 1P0RA 5AZGA 3H6NA 5AEKB 5JHBA 2LRWA 3TL5A 3VHTC 1HE8A 4IWPA 2GBKA 4GN1A 3JYUA 3LJ3A 2K1FA 3QAQA 3ZDMC 4XX5A 2D3GA 4BFRA 2EMTA 4DHZE 4MM3A 2Z59B 5LXIB 1KJTA 2LVPA 4ANUA 3C0RB 2KN5A 2M4NA 3UQBA 4HPLB 2M8SA 3R7QA 3PRZA 3MHSD 4FLHA 1E8WA 4GB9A 1GUAB 2AL6A 3MTNB 2WX1A 2KOXA 4KSKC 2CU1A 5LXHA 1WJ6A 2FCQA 4TQ1A 3ZO5B 4OVUA 4WAAA 5BO4B 3S2AA 2LVOA 2M1MA 2FAZA 4G0NB 4KDLB 4FHJA 1V5OA 3R3MA 3A4SC 1VD2A 1RFAA 5J18A 2KX0A 4PS8A 2K8HA 3NOBA 4FULA 3V6CB 2KLGA 3M62B 3N30A 2UYZB 4GDLB 4GIVA 1ZGUB 4DDID 2KC1A 1GJZA 5E6NA 2DZMA 4FA6A 2K25A 3PHWB 4I6LB 4W9KA 2KVRA 4URKA 4MH0E 3T9LA 4DDGD 4HVBA 1OQYA 4I6PA 2N4FA 1EF5A 4ANXA 3K9PB 4IWOA 4MDKE 3RULA 1MG8A 2MWSB 2RR9A 3DOWA 4KZ0A 4MGIE 2KHWB 3HHMA 4ANVA 3D32A 2XBBC 2KZRA 2DYOA 4HCNB 2DHZA 4K1RB 5EDSA 1J0GA 4JLCA 2CR5A 2BWFA 2XEWA 4MJSA 3QJZA 4ZRIA 1OTRB 3APCA 2BKFA 3AULA 2JRIB 3AU4A 3L17A 3KW5B 4EOYA 2IYDB 1WJ4A 4W9DA 2ASQA 2LASA 2N9XA 1PQSA 2JVCA 1P9DU 3SD5A 4E71A 3WAMA 1JRUA 5IAAC 2V3SA 2L0FA 3B08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LJP B;  3ONS A;  4AUQ C;  2KDI A;  3CMM B;  2L8J A;  3EHV A;  3A9K B;  5J17 A;  3Q3F A;  1V80 A;  2KC2 A;  3M95 A;  3CSF A;  3NY5 A;  4ZRK A;  4RMA A;  1LQB A;  3QC8 B;  4W9F A;  4IW0 A;  3DVG X;  3UGB B;  1ISN A;  3L13 A;  3PLU A;  2JZZ A;  3VUX A;  4TQ0 A;  2DYB A;  2ZCC A;  1WGR A;  2IO2 B;  3M63 B;  4WJQ A;  4FAD A;  2G45 B;  3H1U A;  2GBR A;  5KHO A;  3DVG Y;  2LZ6 A;  1WXA A;  4JL9 A;  2KXJ A;  4AJW A;  1EF1 A;  2C9W B;  2KTR A;  2Z0E B;  3VUW A;  2BWE S;  2C60 A;  2MBO A;  3L10 B;  4PS7 A;  2O6V D;  3TJP A;  4HJK A;  4ZYN A;  4B9K A;  3PHX B;  2DX5 B;  1LM8 B;  2K6D B;  3EEC A;  2CHX A;  1WM3 A;  4BOS C;  3H7P B;  1RLF A;  3VTV A;  3APF A;  5CHV C;  2N9P C;  4CO7 A;  4DHJ D;  1BT0 A;  2Y5B B;  4PYZ A;  4F1S A;  4EUT A;  2KJR A;  3PTF C;  1P98 A;  2KQ7 A;  1YIW A;  4BVU C;  3WAN A;  1WXV A;  2BGF A;  4NQK E;  4K7W A;  4KIK A;  3ZW3 A;  3TIX A;  1V49 A;  3AI5 A;  2O2V A;  3QIJ A;  4P7I A;  1RAX A;  2GBM A;  3N3K B;  1J19 A;  2L00 B;  2BYF A;  1EUV B;  3RCZ A;  2N1W A;  3CF6 E;  2DYM A;  2NR2 A;  1WMH A;  1GC7 A;  3IFW B;  2KWU B;  3DBR I;  3DBH I;  2KD0 A;  3V60 A;  4ASW C;  4W9L A;  1TGZ B;  2C5L C;  2IO1 B;  2ZVO A;  2LGD A;  1E90 A;  1SGH A;  3QWZ B;  3KYC D;  4W9I A;  4IC7 B;  2KNB A;  1IP9 A;  4NJ7 A;  3L16 A;  4MJS B;  1Q0W B;  3VH4 B;  2D11 A;  4HXD A;  2LGY A;  2ZNV B;  5DPS A;  4KZC A;  3UIO B;  2FCN A;  4XC2 A;  3N32 A;  3H7S A;  4G11 A;  4EZJ A;  3ZNZ B;  2LRU A;  1WX7 A;  2CHZ A;  3WIM A;  5JHA A;  2IY0 B;  2FCS A;  5CTR C;  4A20 A;  4CYE A;  1GG3 A;  1OGW A;  2WDT B;  3DPD A;  4WQO B;  5CX3 A;  1UZX B;  2HJ8 A;  2AYO B;  1V6E A;  2DEN B;  2L3Z A;  2KLC A;  2I1K A;  1WF9 A;  4KIK B;  4PYU A;  2HTH A;  2KDB A;  2MBQ A;  3UQA A;  1A5R A;  5C1Z A;  4HPM B;  5G55 A;  3NZU A;  3OAW A;  2JT4 B;  1WFY A;  2JZ3 B;  4BBN F;  1M94 A;  4FJZ A;  3ML8 A;  3RZW C;  2KWC A;  3PZD A;  1OEY A;  4IG7 B;  2KFK A;  2FID A;  4DHZ B;  4DK5 A;  4W9C A;  1FXT B;  5TR5 A;  4GOC A;  1WI0 A;  1J8C A;  2NPT B;  2YVC A;  3RYT A;  3MJW A;  3ZVV A;  4GU2 A;  4WJN A;  2HE7 A;  2W9N A;  4RM8 A;  5L95 C;  2WYQ A;  5JZE B;  5CHF A;  2PE9 A;  4F7Z A;  4TV3 A;  3IG3 A;  4G50 A;  2JXX A;  2V4L A;  1YQB A;  2IZV B;  3L0W B;  4A3O A;  3A9J B;  4M8M A;  3R7R A;  4HDO A;  3U30 A;  1S1Q B;  2FNJ B;  3PV1 A;  4A3P A;  2KTF A;  4LCD E;  4DXA B;  5JH5 C;  5J2R A;  4HWI B;  3QHT A;  2JRH A;  1D3Z A;  1L7Y A;  2L76 A;  1KM7 A;  2MSE D;  2MBE A;  4YL8 A;  1YX6 B;  5D2M B;  1Z5S B;  3IHP C;  4LDT D;  3U7D A;  4F8C B;  3OJ3 A;  3KVF B;  1WX8 A;  3VTW A;  1WR6 E;  2FCM A;  2C7H A;  4HDQ A;  2RD0 A;  1WXM A;  2O6V B;  3PRE A;  5LLI A;  4J6I A;  4AJY B;  4EFO A;  1WIA A;  4PS3 A;  3B0A A;  2G4D B;  2NVU I;  3PT2 B;  1AAR A;  2JF5 A;  2MX2 A;  3CST A;  3QCA A;  2LJ5 A;  1WX9 A;  2AL3 A;  2ZPY A;  3BIN A;  4KVG B;  4AWJ A;  2OOB B;  5E6O A;  3WAP A;  3ZIM A;  2LXC A;  2L05 A;  3WAL A;  2JPH A;  1WZ3 A;  4HK2 A;  5D94 A;  2N9E B;  4NAW A;  2BKR B;  4IUM B;  1NI2 A;  3OLM D;  2G4S A;  3ZNH B;  5IA7 A;  1SIF A;  1R4N I;  4NY0 A;  1Q5W B;  4DBG A;  4FJV B;  1WY8 A;  4EEW A;  4LDT B;  2LI5 A;  3VFK A;  2M0X A;  4GDK B;  1UBQ A;  1WMH B;  4W9H A;  3A4R A;  3K9O B;  2B3A A;  2ZCB A;  3M3J A;  3R66 C;  4MSM B;  3ZNG C;  1E7U A;  2OJR A;  3KH0 A;  4JGH B;  4K81 A;  4RM9 A;  3LDZ E;  4MGK E;  2O2V B;  3WA0 A;  4BBN C;  1U4A A;  3O65 B;  1SE9 A;  3ENE A;  3ZTD A;  3GOE A;  2KJ6 A;  3KUC B;  4GDL A;  1V5T A;  4MGY E;  2NBU A;  1T0Y A;  1WYW B;  2KQS A;  2R2O A;  2FUH B;  4HCP B;  4W9E A;  2KWV B;  2IY1 B;  2ZPN A;  3H7P A;  1X1M A;  3A9K A;  2MRP A;  2N1V A;  2K39 A;  1S3S G;  2ZVN A;  3KYD D;  3APD A;  1WM2 A;  3ML9 A;  2GOW A;  3PS6 A;  2IO3 B;  2J0M A;  2KAN A;  3SDL C;  3VAW A;  3VTU A;  4EZK A;  2LVQ A;  3AXC A;  3ECI A;  3IVF A;  3QAR A;  4M8N A;  4ZRJ A;  4BOZ B;  1I35 A;  4BKS D;  5KHQ A;  3WAO A;  2N7D A;  1KLV A;  1Z2M A;  4KSL C;  3ZTC A;  1CMX B;  2CS4 A;  2GBN A;  3A33 B;  1WGH A;  2DAF A;  3ZDT A;  3ZRC A;  3W1S C;  3P2B A;  3NS8 A;  4HLE A;  1WGG A;  1V86 A;  2C7N B;  2LUE A;  4W9J A;  2K8C A;  3NHE B;  5FR6 A;  2LD9 A;  2AEH A;  1E8Y A;  3HK0 A;  1V81 A;  2ZEQ A;  2L7R A;  4II2 B;  4NNJ B;  4GDK A;  4EZL A;  3VH3 B;  2KKC A;  2KFJ A;  2IO0 B;  4WWO A;  2LWP A;  4GMV A;  4NQL B;  3UF8 A;  2KO3 A;  3VUY A;  2EKE C;  3PSE B;  1WH3 A;  1TZ1 A;  3KUZ A;  5GMV A;  1YD8 U;  2NCN A;  4BKG A;  4FN2 A;  2LXA A;  5DCN A;  3PPA A;  1RRB A;  3TBL D;  1L2N A;  1UBI A;  3A9J A;  5CHW A;  4IWQ A;  1WE7 A;  3OJ4 B;  2JY6 A;  2J0J A;  3Q3J A;  4FHK A;  4WWP A;  2I1J A;  4NPN A;  2O6V A;  2NS5 A;  3X0W A;  2ZJD A;  3PRM B;  1UD7 A;  3HM3 A;  2PPH A;  1TBE A;  2MW5 A;  3DVN U;  2DAJ A;  2DZI A;  1NBF C;  1E8X A;  3ALB A;  4EKU A;  2K8B A;  2R2Q A;  2PEA A;  1GNU A;  2M17 A;  1WZ0 A;  1Y8R C;  3U8Z A;  4KDI C;  2DZK A;  1VCB A;  4GXB A;  2NBW B;  1WJU A;  5C23 A;  5G2N A;  1K8R B;  4CHK A;  1V2Y A;  2GBJ A;  4NJ6 A;  1XT9 B;  1E7V A;  3I3T B;  3KUD B;  4FJY A;  4K7S A;  1YX5 B;  4G3X B;  4OVV A;  4IM3 A;  2BYE A;  5E6P A;  3V62 A;  3A1Q A;  3TCA A;  3JVZ X;  4FBJ B;  1WGY A;  3RUI B;  2WWZ A;  3VDZ A;  2HD5 B;  2DZJ A;  1XQQ A;  3TMP B;  2EMS A;  4DHJ B;  1KOT A;  4B95 A;  2Z0D B;  2RPQ A;  3T8M A;  1WGD A;  2XK5 A;  1XD3 B;  2L0T A;  4TUU A;  4ZDV A;  5D7G A;  2REX A;  2RSU A;  3PRP B;  1E8Z A;  1GC6 A;  3QQ8 B;  2V1Y A;  3DQV A;  1G6J A;  3EFU A;  4NAW B;  1ZW7 A;  1H8C A;  4WWN A;  2KFK B;  2KDF B;  2QHO A;  3VXW A;  4LJO B;  2ZZP B;  4IM0 A;  2IBI B;  4XZ4 A;  3PLV A;  5DPR A;  3L54 A;  4GSW A;  4JQW C;  2AWT A;  4WJP A;  3RT3 B;  1WXS A;  4B6W A;  4K7U A;  4DWF A;  2A5U A;  5DPT A;  3EC8 A;  3DDC B;  1WJN A;  3DVN V;  2N7E A;  5D6J B;  3RD2 A;  4N9F 4;  1UH6 A;  3ZNI D;  2KMC A;  4W9G A;  1R4M I;  2D2Q A;  2MP2 A;  3JSV A;  3UIP B;  3PVL A;  3QX1 A;  4AOF A;  3QA8 A;  1C3T A;  2NBV B;  2CKH B;  2MBH A;  3A1Q B;  2MP2 B;  3H9D A;  3JSV B;  1EO6 A;  2KJH B;  4GGQ A;  3UIN B;  3PGE A;  1YJ1 A;  3ZKJ C;  1UGM A;  2D07 B;  1C1Y B;  1I42 A;  3X23 A;  1IPG A;  3QK0 A;  1WR1 A;  5AZF A;  1IYF A;  2MQJ A;  2PJH A;  2J7Q B;  2MBB B;  4KV2 A;  3W1S A;  2KMA A;  3BY4 B;  2J0K A;  4IM2 A;  2YLM A;  4II3 B;  4MEM A;  4MSQ B;  5AZH A;  3SU8 X;  3W1Y A;  5DPW A;  2GMI C;  4MGZ E;  4E74 A;  2LGX A;  3B1L X;  3SHQ A;  3NZS A;  1V9J A;  1Q1O A;  4ICU A;  1P1A A;  4MEL A;  2JUO A;  2NPT A;  3V6E B;  3RZF A;  2A4Z A;  2UWQ A;  1WE6 A;  1NDD A;  1ZKH A;  4X57 B;  3VVW B;  2WX0 A;  4E3C A;  3L08 A;  1WRD B;  3DCG A;  3ZUN A;  2BPS A;  3HIZ A;  1QZE A;  4M0W B;  2KTR B;  2KDE B;  3ZRF A;  2MLB A;  2C7M B;  2PE6 B;  2K6Q A;  2KX3 A;  4AP4 C;  4BKT A;  3ZLZ A;  1OEY J;  3DBL I;  2G3Q B;  3JW0 X;  2KK8 A;  3VQI A;  4WJO A;  4I6N B;  1H4R A;  2ZNV C;  2MCN B;  1P3Q U;  2CHW A;  3IBE A;  3HM6 X;  4ANW A;  1UEL A;  2MA9 B;  3AU5 A;  2D10 A;  4JIO U;  4BKS A;  1LFD A;  2JWZ A;  2VRR B;  4TKN A;  2BF8 B;  2XK5 B;  3V61 A;  1LXD A;  2FIF A;  3DBS A;  1E5W A;  1F9J A;  1TTN A;  3GZN I;  5L83 A;  2RGF A;  2BYV E;  4ICV A;  5HKH A;  1P0R A;  5AZG A;  3H6N A;  5AEK B;  5JHB A;  2LRW A;  3TL5 A;  3VHT C;  1HE8 A;  4IWP A;  2GBK A;  4GN1 A;  3JYU A;  3LJ3 A;  2K1F A;  3QAQ A;  3ZDM C;  4XX5 A;  2D3G A;  4BFR A;  2EMT A;  4DHZ E;  4MM3 A;  2Z59 B;  5LXI B;  1KJT A;  2LVP A;  4ANU A;  3C0R B;  2KN5 A;  2M4N A;  3UQB A;  4HPL B;  2M8S A;  3R7Q A;  3PRZ A;  3MHS D;  4FLH A;  1E8W A;  4GB9 A;  1GUA B;  2AL6 A;  3MTN B;  2WX1 A;  2KOX A;  4KSK C;  2CU1 A;  5LXH A;  1WJ6 A;  2FCQ A;  4TQ1 A;  3ZO5 B;  4OVU A;  4WAA A;  5BO4 B;  3S2A A;  2LVO A;  2M1M A;  2FAZ A;  4G0N B;  4KDL B;  4FHJ A;  1V5O A;  3R3M A;  3A4S C;  1VD2 A;  1RFA A;  5J18 A;  2KX0 A;  4PS8 A;  2K8H A;  3NOB A;  4FUL A;  3V6C B;  2KLG A;  3M62 B;  3N30 A;  2UYZ B;  4GDL B;  4GIV A;  1ZGU B;  4DDI D;  2KC1 A;  1GJZ A;  5E6N A;  2DZM A;  4FA6 A;  2K25 A;  3PHW B;  4I6L B;  4W9K A;  2KVR A;  4URK A;  4MH0 E;  3T9L A;  4DDG D;  4HVB A;  1OQY A;  4I6P A;  2N4F A;  1EF5 A;  4ANX A;  3K9P B;  4IWO A;  4MDK E;  3RUL A;  1MG8 A;  2MWS B;  2RR9 A;  3DOW A;  4KZ0 A;  4MGI E;  2KHW B;  3HHM A;  4ANV A;  3D32 A;  2XBB C;  2KZR A;  2DYO A;  4HCN B;  2DHZ A;  4K1R B;  5EDS A;  1J0G A;  4JLC A;  2CR5 A;  2BWF A;  2XEW A;  4MJS A;  3QJZ A;  4ZRI A;  1OTR B;  3APC A;  2BKF A;  3AUL A;  2JRI B;  3AU4 A;  3L17 A;  3KW5 B;  4EOY A;  2IYD B;  1WJ4 A;  4W9D A;  2ASQ A;  2LAS A;  2N9X A;  1PQS A;  2JVC A;  1P9D U;  3SD5 A;  4E71 A;  3WAM A;  1JRU A;  5IAA C;  2V3S A;  2L0F A;  3B08 A; 
#chains in the Genus database with same CATH topology
 1OQQ A;  4LJP B;  2KDI A;  3A9K B;  4S0R A;  1LQB A;  3QC8 B;  1ISN A;  3PLU A;  1XLN A;  5AUK A;  4LNN A;  2IO2 B;  3H1U A;  1WXA A;  4JL9 A;  4AJW A;  2C9W B;  3I57 A;  1T5X D;  4ZYN A;  1LM8 B;  2W3S A;  4BOS C;  3P4P B;  2D3A A;  2M0A A;  4PYZ A;  3ZJT A;  1JAL A;  1P98 A;  2KQ7 A;  1AWD A;  4M01 A;  3TIX A;  3AI5 A;  3TSS A;  2GBM A;  3N3K B;  3P42 A;  4N6E B;  1SE4 A;  4ARI A;  1XCQ L;  2DYM A;  4J3O D;  1WMH A;  2PVG C;  1PGX A;  4LK0 M;  4ASW C;  3BK1 A;  1QQR A;  3N1Z C;  3C19 A;  3DHH C;  2OJW A;  4RNA A;  4W9I A;  4YT0 B;  1IP9 A;  1TS4 A;  3O13 A;  3L16 A;  1Q0W B;  4HKZ E;  2QC8 A;  4XYC A;  3TUO A;  3N32 A;  2Y3A A;  4TMA B;  2IY0 B;  2FCS A;  1GG3 A;  5CX3 A;  2HJ8 A;  4RCO A;  1YMH E;  1UWM A;  1YJI A;  1WF9 A;  4BBN F;  1KF6 B;  4FJZ A;  3PZD A;  2FID A;  1PUT A;  4EE2 A;  1KH0 A;  1JW9 D;  3ZVV A;  2KAC A;  2HE7 A;  5HHD G;  2JU6 X;  3IG3 A;  2JXX A;  5LNK 1;  3R2T A;  3NZ3 A;  4HDO A;  4MT5 A;  2J52 A;  2Y5P A;  5J2R A;  1HZ6 A;  3QHT A;  2WDR B;  3NVW A;  1D3Z A;  1RWS A;  5D2M B;  3U7D A;  4LDT D;  3OJ3 A;  3KVF B;  1ZXI A;  2IND C;  3VTW A;  3VRA B;  4HDQ A;  5MPO A;  1NVI D;  1WXM A;  3B0A A;  5EE3 A;  1L4D B;  2JF5 A;  1FXA A;  1I7H A;  2AL3 A;  3BIN A;  2OOB B;  5E6O A;  3CIR B;  2BKR B;  3OLM D;  5IA7 A;  4NY0 A;  1ZE3 D;  2LGS A;  1BML C;  1WGK A;  1C4P A;  4W9H A;  2ZCB A;  4MSM B;  3SR6 A;  3ZNG C;  1E7U A;  4DXG A;  4JGH B;  1RYJ A;  4BBN C;  2KN4 A;  1L0Y B;  4ZRQ A;  3ZTD A;  3TEZ A;  3E9S A;  4MGY E;  2ICI A;  1M4V A;  2KWV B;  1HQR D;  5AUI A;  2ZVN A;  2MRP A;  2K39 A;  3KYD D;  1GB4 A;  2FE8 A;  1EU3 A;  3APD A;  3PS6 A;  2J0M A;  2KAN A;  2WXO A;  4REZ A;  4US9 A;  3VTU A;  4EZK A;  1ZXH A;  4C4V A;  3ECI A;  4BKS D;  1NEN B;  4ARC A;  3WAO A;  3V05 A;  3ZTC A;  3NUH B;  2KVZ A;  3P2B A;  3NS8 A;  2K8C A;  5G5H A;  2G9H D;  1V81 A;  3P1M A;  2ONQ A;  4C7Z A;  2V3P A;  4WWO A;  4NQL B;  1STE A;  2WXI A;  1C78 A;  3VUY A;  3EGR A;  5GMV A;  5DCN A;  1WE7 A;  1R7S A;  2E3T A;  4WWP A;  4YWG G;  1N5X A;  4NPN A;  2O6V A;  2W3R A;  1ENF A;  1NYR A;  1DYQ A;  2W54 A;  3N1X C;  3ZYY X;  1ZDX A;  1UD7 A;  2NTS A;  3HM3 A;  2QSD A;  3DVN U;  2TSS A;  1NBF C;  2XNA C;  4KKI A;  2M17 A;  1WZ0 A;  1K8R B;  1SEB D;  1XT9 B;  4ZRP A;  1UGJ A;  4K7S A;  1YX5 B;  4RH6 A;  4IM3 A;  2WXQ A;  2BYE A;  1KLU D;  3TCA A;  3JVZ X;  1EWY C;  3RUI B;  2WWZ A;  2EMS A;  3T8M A;  1E0Z A;  3MC8 A;  2L0T A;  2REX A;  3PRP B;  4ZYS A;  1G6J A;  4NAW B;  1ZW7 A;  2QHO A;  3VXW A;  2PVO D;  3CWI A;  4GSW A;  3Q3N C;  4WJP A;  1WXS A;  3EC8 A;  1Q10 A;  2N7E A;  4WIP A;  4W9G A;  3UIP B;  3RNA C;  4H2A A;  4LLG M;  2WXK A;  2MBH A;  1GJZ A;  3H9D A;  3ZKJ C;  2KJH B;  2WXG A;  5AZF A;  1DOI A;  1QT9 A;  2MQJ A;  2PJH A;  3UI3 A;  4MEM A;  3W1Y A;  2GMI C;  2LGX A;  3NZS A;  1V9J A;  1Q1O A;  1B1Z A;  2NPT A;  3AE4 B;  2IGH A;  1ZKH A;  4BAX A;  3NVV A;  1MPE A;  4OZC A;  1UUP A;  1FMA D;  3AB5 A;  4BKT A;  1C4A A;  1N6Z A;  3HVZ A;  1H4R A;  2JZP A;  2IJ0 A;  3W2D A;  4LNI A;  3AU5 A;  4JIO U;  2L32 A;  4BKS A;  4TKN A;  1WXQ A;  1HZ5 A;  1LXD A;  3U52 E;  1E5W A;  1D5Z C;  1CZP A;  1YNT E;  1P0R A;  5AZG A;  3H6N A;  1JML A;  2CJO A;  3VHT C;  2KMM A;  4XX5 A;  2D3G A;  4BFR A;  2D5G A;  5BMH A;  2M4N A;  4HPL B;  2M8S A;  1V8C A;  5H92 C;  2JYE A;  1JQ4 A;  2LJI A;  1MHH E;  3PO0 A;  1WJ6 A;  2WXL A;  4OVU A;  2INP E;  4G0N B;  2M1M A;  4KDL B;  1V5O A;  2WS3 B;  2KX0 A;  4PS8 A;  4YSZ B;  3NOB A;  4GDL B;  3R8B A;  4A90 A;  4DDI D;  1EM7 A;  2KC1 A;  3SEB A;  5E6N A;  4URK A;  3T9L A;  4HVB A;  1OQY A;  1QOA A;  4IWO A;  3BVM A;  2MWS B;  1E6E B;  3Q8F A;  3Q6B A;  1SBB B;  3FAH A;  3D32 A;  1BXT A;  2XBB C;  2KZR A;  2DYO A;  1J0G A;  2WQY B;  2BKF A;  2JWU A;  3AUL A;  4HRO A;  5IP4 D;  3T3N A;  1SE2 A;  2N9X A;  2RPV A;  3DWM A;  1JRU A;  5IAA C;  3AED B;  2L8J A;  4US8 A;  2KC2 A;  4ZRK A;  2I38 A;  4RMA A;  1PDX A;  4IW0 A;  3AEF B;  3L13 A;  3VUX A;  4O1N A;  1WGR A;  3RNE C;  4MM3 B;  2G45 B;  3AE9 B;  5KHO A;  2KXJ A;  4FXC A;  1YN4 A;  3L10 B;  2O6V D;  4HJK A;  1XXG A;  4B9K A;  3PHX B;  2K6D B;  1RLF A;  3APF A;  1ESF A;  2JSV X;  1SJH D;  1BT0 A;  1ET9 A;  1ZUD 2;  4MAC A;  3PTF C;  1YIW A;  3N1Y C;  3WAN A;  1WXV A;  4NQK E;  3IT4 B;  4P1B C;  4P7I A;  1J19 A;  2BYF A;  2N1W A;  1YN3 A;  3FIL A;  3IAS 1;  3AE3 B;  3DBR I;  2KD0 A;  1FNV A;  4HKQ A;  4W9L A;  2V0G A;  1SGH A;  4KGR A;  3IT6 B;  4NJ7 A;  2Q5W D;  3Q69 A;  2D11 A;  2ZNV B;  4XE0 A;  4WQM A;  4C4V B;  1HTO A;  2WU2 B;  2BVC A;  3ZNZ B;  2LRU A;  4WWM A;  3WIM A;  5JHA A;  2HJ1 A;  1IGC A;  1OGW A;  3DPD A;  2XN9 C;  1V6E A;  2DEN B;  2KLC A;  2HTH A;  1P7E A;  2KDB A;  1I4G A;  3OAW A;  2JZ3 B;  5HFY A;  2BYT A;  3ML8 A;  2KWC A;  4IG7 B;  4W9C A;  4GOC A;  3Q2A C;  2NPT B;  3RYT A;  4GU2 A;  4KGS A;  3Q3M C;  5L95 C;  5CHF A;  4A3P A;  3EFC A;  4WH4 A;  3NVZ A;  2INN E;  4OZB A;  3BVG A;  2L76 A;  2MSE D;  1Z5S B;  3IHP C;  1MG4 A;  1WR6 E;  4RGT A;  2O6V B;  1F0Z A;  2NVU I;  3PT2 B;  2MX2 A;  3CST A;  3QCA A;  1AYF A;  4HK2 A;  5D94 A;  2WXF A;  3ZNH B;  1NI2 A;  1Q5W B;  2N9L A;  4LDT B;  1XEE A;  2D3B A;  1ACC A;  2M0X A;  3B2G A;  4GDK B;  3K9O B;  3T3O A;  4OW0 A;  1FRR A;  3KH0 A;  1AW7 A;  4MGK E;  1HEZ E;  3O65 B;  4KGT A;  2KJ6 A;  4GDL A;  1V5T A;  2BS2 B;  3RNC C;  1QOG A;  1X1M A;  1MHX A;  1WM2 A;  1JWU D;  2Z8L A;  3SDL C;  3VAW A;  1VJK A;  1ZP0 B;  1XF5 L;  4BOZ B;  3SFD B;  2R61 A;  1Z2M A;  4KSL C;  3AMZ A;  3ZRC A;  4RF1 A;  1V86 A;  4W9J A;  4WUR A;  1JCK B;  3NHE B;  5FR6 A;  2LD9 A;  2QIE B;  3GZN B;  1HA5 A;  2ZEQ A;  3DBH B;  4II2 B;  4NNJ B;  3I9V 1;  1YN5 A;  5FKA C;  3AH7 A;  3UF8 A;  3N9Y C;  3PSE B;  1WH3 A;  1TZ1 A;  1I4X A;  4BKG A;  4FN2 A;  2LXA A;  1TS3 A;  3DHI C;  1UNS A;  1QF6 A;  3Q3J A;  4XDD A;  2I1J A;  3AE5 B;  3X0W A;  3PRM B;  2PPH A;  5BMG A;  5I4D A;  5HG2 A;  2KQ4 X;  4EKU A;  2PEA A;  1ZDV A;  3U8Z A;  1JWM D;  3ABV B;  4KDI C;  1TYG B;  1VCB A;  2ZW1 A;  4GXB A;  5C23 A;  4CHK A;  4JWS C;  1TKG A;  4XGA B;  1VZ6 A;  2GBJ A;  1E7V A;  3KUD B;  2BT6 A;  3A1Q A;  1TY2 A;  4FBJ B;  2MEK A;  2HD5 B;  4DHJ B;  2RPQ A;  4M00 A;  1JRP A;  5D3I B;  4ZDV A;  5D7G A;  2RSU A;  3RNB C;  1GC6 A;  1RM6 C;  1N5W A;  1HXY D;  1C4C A;  1PFD A;  3DBR B;  5DPR A;  3L54 A;  3TEW A;  4L2Y A;  1TIF A;  1Y56 A;  1FRD A;  3DVN V;  1K53 A;  3RD2 A;  4N9F 4;  1UH6 A;  3ZNI D;  2B76 B;  4ACF A;  4RGM A;  3NVY A;  3JSV A;  3PVL A;  2NTT A;  3QX1 A;  3DWG C;  4AOF A;  1JWS D;  3QA8 A;  2MP2 B;  3UIN B;  1FPY A;  2D07 B;  1I42 A;  3IAM 1;  1IPG A;  2FUG 1;  1L5P A;  1WR1 A;  4A55 A;  1TT5 B;  1N62 A;  2J7Q B;  2MBB B;  4KV2 A;  3W1S A;  3BY4 B;  2J0K A;  4IM2 A;  3SU8 X;  5DPW A;  1FNW A;  5AZH A;  1JWA D;  1KFY B;  3R2I A;  1P1A A;  3V6E B;  2RDH A;  3BYY B;  1NDD A;  4X57 B;  1LGR A;  4PT5 A;  3VVW B;  3ZUN A;  4KKJ A;  1C79 A;  1NYQ A;  3ZRF A;  2N7J A;  2PE6 B;  4C00 A;  1P7F A;  3SFE B;  1OEY J;  1T3Q A;  2G3Q B;  4WJO A;  3MP9 A;  2VH1 A;  2CHW A;  2BQQ A;  1UEL A;  1FIQ A;  3DHG C;  1QKZ A;  2DBY A;  4XDC A;  2WDV B;  5JXV A;  1TTN A;  2W55 A;  2RGF A;  2BYV E;  5BMI A;  1VDV A;  3ZXV A;  5HKH A;  1TKY A;  4HEA 1;  3ETR A;  3RFZ B;  2LRW A;  4IWP A;  4GN1 A;  3LJ3 A;  3RMK C;  2K1F A;  3QAQ A;  3TEX A;  1KJT A;  4HJG E;  2WNM A;  2V3N A;  3R7Q A;  5BYQ A;  1DOY A;  4FLH A;  4GB9 A;  1GUA B;  1YOV B;  2AL6 A;  2RDB C;  2WX1 A;  3MTN B;  2CU1 A;  3MFG A;  5LXH A;  2WXH A;  3ZO5 B;  1UF0 A;  5EE0 A;  3Q8A A;  1ZOY B;  1DGJ A;  1IGD A;  1PGB A;  2JQR B;  1RFA A;  2K22 A;  3BYT B;  2K8H A;  3V6C B;  3M62 B;  2MHJ A;  2L83 A;  1SB3 C;  1C76 A;  4DDG D;  1F2R I;  4IKG A;  2WXP A;  3K9P B;  3V3X A;  2QIL A;  4MGI E;  3HHM A;  4MH8 A;  1QOB A;  2Y5C A;  1K52 A;  2BWF A;  2XEW A;  4MJS A;  3QJZ A;  2MJE A;  4LNO A;  3NRZ A;  3MJ5 A;  1WJ4 A;  2ASQ A;  1PQS A;  3SD5 A;  4E71 A;  3WAM A;  1NEK B;  2V3S A;  2L0F A;  1C77 A;  3AE7 B;  3ONS A;  4AUQ C;  3CMM B;  3LXF A;  3EHV A;  1MI0 A;  5J17 A;  3Q3F A;  3CSF A;  3NY5 A;  3C8Y A;  4W9F A;  3GB1 A;  3UGB B;  1SF0 A;  4TQ0 A;  2NMQ A;  2ZCC A;  2INC C;  2QEJ C;  4FAD A;  4YTM B;  2GBR A;  2M19 A;  2LZ6 A;  3I5J C;  1YQ3 B;  2Z0E B;  2BWE S;  2MBO A;  2AX5 A;  3TJP A;  2N0S B;  1SE3 A;  2CHX A;  1OFF A;  1WM3 A;  3H7P B;  5CHV C;  4DHJ D;  4OZA A;  2Y5B B;  1I4Q A;  4F1S A;  1ET6 A;  2WU5 B;  3KLS X;  1N63 A;  5FR3 A;  2BGF A;  4K7W A;  3ZW3 A;  1XLP A;  2O2V A;  3QIJ A;  3BII D;  1RAX A;  1ROE A;  2L00 B;  2WXR A;  1EUV B;  2JYT A;  3RCZ A;  3IFW B;  2KWU B;  3DBH I;  1TGZ B;  2IO1 B;  2ZVO A;  2LGD A;  4QAY A;  3QWZ B;  3KYC D;  4IC7 B;  4C7Y A;  3VH4 B;  4HXD A;  5DPS A;  1FD6 A;  4KZC A;  3N20 C;  2FCN A;  2V4I B;  1SJE D;  3H7S A;  3PZ7 A;  2ON8 A;  1T6B X;  2CHZ A;  2WHI A;  2WXJ A;  4A20 A;  4CYE A;  2KYW A;  1UZX B;  1TY0 A;  2AYO B;  2IGD A;  2L3Z A;  1V97 A;  2I1K A;  4PYU A;  2MBQ A;  1A5R A;  3ZJU A;  4PK1 A;  3J9C A;  1WFY A;  1M94 A;  4K3B A;  1OEY A;  1FXI A;  4RFB A;  1FXT B;  4R3D A;  1F52 A;  3MJW A;  3W5V B;  4WJN A;  3EUB 2;  4RM8 A;  4F7Z A;  2J42 A;  4G50 A;  1YQB A;  2IZV B;  4A3O A;  1VZ7 A;  3U30 A;  1S1Q B;  2FNJ B;  5JH5 C;  1MVK A;  2JRH A;  1KTK A;  1KM7 A;  2MBE A;  4F8C B;  2QDF A;  1WX8 A;  2FBW B;  2FCM A;  2C7H A;  2H88 B;  2PIA A;  2RD0 A;  1KLG D;  3PRE A;  1AN8 A;  5LLI A;  4J6I A;  4AJY B;  4PS3 A;  2RDG A;  1UWX A;  1AAR A;  1FM0 D;  4YTP B;  2LJ5 A;  1WX9 A;  4KVG B;  1I4P A;  5IO9 A;  4N59 A;  3WAP A;  2L05 A;  2GRI A;  1GAQ B;  4IUM B;  1SIF A;  4DBG A;  2DNF A;  1WY8 A;  3HVD A;  1FCC C;  1UBQ A;  1WMH B;  3HRD D;  3R66 C;  2B3A A;  2AQ1 B;  3LYY A;  4K81 A;  2J53 A;  4RGO S;  3P4R B;  2O2V B;  4HRS A;  4NJC A;  4L23 A;  1T0S C;  2R2O A;  2KAJ A;  2KQS A;  4HCP B;  2FUH B;  1L0V B;  5T8I A;  3E56 A;  2IY1 B;  3H7P A;  3A9K A;  5EE9 A;  2UU7 A;  2N1V A;  2IPK D;  1TKE A;  1FCL A;  2OED A;  3B9J A;  3Q3O C;  4M8N A;  5KHQ A;  1KLV A;  2OHF A;  1PGA A;  2GBN A;  3A33 B;  1WGH A;  2DAF A;  3ZDT A;  3W1S C;  2L52 A;  2C7N B;  2LUE A;  1FFV A;  2AEH A;  1E8Y A;  3HK0 A;  4GDK A;  2KKC A;  2IO0 B;  4P16 A;  4GMV A;  1OQR A;  2VZK D;  1GB1 A;  3KUZ A;  2NCN A;  3ZJV A;  1UBI A;  3A9J A;  3OJ4 B;  4TSS A;  2J0J A;  4NZL B;  4FHK A;  1EU4 A;  4A9A A;  2N9K A;  1FFU A;  2SEB D;  1TBE A;  2DZI A;  3ALB A;  1T0Q C;  1GNU A;  5IOI A;  3RPF C;  1F77 A;  2DZK A;  4L1B A;  5G2N A;  4A6Q A;  1D4B A;  1V2Y A;  4NJ6 A;  1N60 A;  4FJY A;  1NI3 A;  4OVV A;  4LNK A;  4NAM A;  5E6P A;  5TSS A;  3OWE B;  4LTU A;  3VDZ A;  2DZJ A;  1XQQ A;  1N61 A;  2WGS A;  3U7Z A;  3NG0 A;  2XK5 A;  4TUU A;  4USA A;  2BS3 B;  1E8Z A;  3QQ8 B;  3EFU A;  4LJO B;  2ZZP B;  1YJJ A;  4IM0 A;  2IBI B;  3IXS A;  2WDQ B;  2WXN A;  3MC0 B;  3PLV A;  4XZ4 A;  2AWT A;  3RT3 B;  5HI1 A;  4B6W A;  4K7U A;  4DWF A;  3RN9 C;  3KWL A;  1EWC A;  1F2R C;  4CQN A;  2IDY A;  2MJ3 A;  1R4M I;  1VLB A;  1XLQ A;  1C3T A;  2CKH B;  3FIL B;  4YSX B;  3AEC B;  1UGM A;  1R4N B;  1FEH A;  1TJE A;  2KMA A;  5IKC M;  2YLM A;  4II3 B;  4MSQ B;  4MGZ E;  3P4S B;  1I4R A;  2E6X A;  4MEL A;  3RZF A;  2UWQ A;  1WE6 A;  2WX0 A;  2DLB A;  4E3C A;  3L08 A;  4DQO C;  2IGG A;  2KTR B;  2KDE B;  2MLB A;  2C7M B;  4AP4 C;  4RGN A;  1E9M A;  3ZLZ A;  3DBL I;  2GI9 A;  2KK8 A;  4I6N B;  3MHZ A;  3ZGZ A;  4KX6 B;  1IBX A;  2MA9 B;  5FK9 C;  2VRR B;  2PLP A;  2BF8 B;  3V61 A;  2FIF A;  1JWB D;  1IBX B;  1L0X B;  3NJT A;  2W82 A;  3TL5 A;  1E10 A;  3JYU A;  3ZDM C;  5LXI B;  2BW2 A;  1J7B A;  3RNF C;  2QCZ A;  3UQB A;  3PRZ A;  3MHS D;  4JWU C;  1E8W A;  4ZOH C;  2SAK A;  5C3J B;  2FCQ A;  3AE8 B;  5BO4 B;  3AV8 A;  3S2A A;  4OHJ A;  2LVO A;  3U4E G;  2QJL A;  4FHJ A;  5J18 A;  4FUL A;  1DOX A;  2LHE A;  3N30 A;  4GIV A;  1ZGU B;  1SIJ A;  4FA6 A;  1GOZ A;  2K25 A;  3PHW B;  4I6L B;  4W9K A;  3GE3 C;  2H89 B;  2N4F A;  1EF5 A;  4ANX A;  3Q8B A;  2KT7 A;  2GLS A;  1MG8 A;  2RR9 A;  1V1O A;  3DOW A;  2K0P A;  4KZ0 A;  2GB1 A;  4ANV A;  4HCN B;  2DHZ A;  1K51 A;  4JLC A;  2CR5 A;  4ZRI A;  1OTR B;  2V9H A;  3APC A;  2JRI B;  3AU4 A;  4ITK A;  3L17 A;  3KW5 B;  1TS2 A;  2IYD B;  4EOY A;  2LAS A;  4WAF A;  3B08 A;  2BB6 A;  1T0R C;  3L4P A;  1V80 A;  3M95 A;  2BBC A;  3DVG X;  5GXG B;  1WRI A;  2JZZ A;  1VZ8 A;  2DYB A;  3M63 B;  4WJQ A;  1GPX A;  3FC4 A;  2PKO A;  5IN7 A;  2MH7 A;  3DVG Y;  1V1P A;  2PMV A;  1EF1 A;  3VUW A;  2KTR A;  1J7C A;  1ZPS A;  3PZ8 A;  2C60 A;  4PS7 A;  2DX5 B;  3EEC A;  2LEK A;  3VTV A;  2N9P C;  2LFI A;  2PTL A;  3U2S C;  4CO7 A;  5BYS A;  2CU3 A;  3BK2 A;  4EUT A;  2KJR A;  4BVU C;  4KIK A;  1CK1 A;  3LB8 C;  1V49 A;  1TS5 A;  3AE2 B;  1HTQ A;  3CF6 E;  3P63 A;  1LO5 D;  2NR2 A;  1GC7 A;  3AEE B;  3V60 A;  4K3C A;  1JRO A;  2DWQ A;  2C5L C;  1E90 A;  2MJD A;  4N58 A;  2KNB A;  2LUM A;  4MJS B;  2LGY A;  3UIO B;  4XC2 A;  2HDE A;  4G11 A;  4EZJ A;  1PYW D;  2QMT A;  1L6V A;  1WX7 A;  4YXD B;  2HTM E;  4S17 A;  4YSY B;  1IUE A;  5CTR C;  4HPP A;  1KRH A;  2WDT B;  1MFW A;  2G1E A;  4WQO B;  2EKI A;  1C9F A;  4P6V F;  2LGI A;  4KIK B;  3UQA A;  5C1Z A;  4HPM B;  5G55 A;  3NZU A;  2JT4 B;  3RZW C;  2KFK A;  4DHZ B;  4DK5 A;  5TR5 A;  4M02 A;  4M0W A;  1WI0 A;  1J8C A;  2YVC A;  3AEG B;  3AM9 A;  2JX5 A;  4GLS C;  4JX1 C;  4D2K A;  2W9N A;  2VZK B;  2WYQ A;  5JZE B;  2PE9 A;  1VR9 A;  3RI7 C;  2BB5 A;  4TV3 A;  2V4L A;  3L0W B;  2K5P A;  3A9J B;  4M8M A;  3R7R A;  4P1C C;  3AEA B;  3PV1 A;  2KTF A;  1D6E C;  4LCD E;  1WSP A;  4DXA B;  2WP9 B;  4HWI B;  1L7Y A;  3EA6 A;  4YL8 A;  3AE1 B;  1YX6 B;  4XWW A;  1TZO A;  2RMM A;  4DXF A;  4EFO A;  1WIA A;  2G4D B;  1E7P B;  2EEL A;  2ZPY A;  4ZHO A;  2YEP F;  4AWJ A;  4UDU C;  3ZIM A;  2LXC A;  3WAL A;  2JPH A;  1WZ3 A;  5BYR A;  2N9E B;  4NAW A;  2G4S A;  1R4N I;  4FJV B;  4EEW A;  2LI5 A;  3VFK A;  3A4R A;  3M3J A;  1CJE A;  2OJR A;  4RM9 A;  3LDZ E;  3VRB B;  2ACZ B;  3WA0 A;  4BZA A;  1U4A A;  1SE9 A;  3ENE A;  3GOE A;  3KUC B;  4W9E A;  2NBU A;  1T0Y A;  1WYW B;  2ZPN A;  2WXM A;  3W9C B;  2L1A A;  1S3S G;  3ML9 A;  3B2F A;  2GOW A;  2IO3 B;  2LMC A;  1QIL A;  2LVQ A;  3AXC A;  3IVF A;  3QAR A;  4ZRJ A;  1I35 A;  2N7D A;  1CMX B;  1L6U A;  2CS4 A;  1L4Z B;  2VH2 A;  4JE3 B;  4XWT A;  4HLE A;  1WGG A;  3I63 C;  4Q2J A;  1XO3 A;  2L7R A;  4EZL A;  3VH3 B;  2KFJ A;  2LWP A;  3AE6 B;  1CQV A;  2KO3 A;  4B0E A;  2EKE C;  1YD8 U;  4AQ7 A;  3PPA A;  1RRB A;  3TBL D;  1L2N A;  5CHW A;  4IWQ A;  1K50 A;  2JY6 A;  3URY A;  1WWT A;  2NS5 A;  2ZJD A;  3AN1 A;  1VRA B;  2LHD A;  2MW5 A;  2DAJ A;  3BWU D;  1E8X A;  1J7A A;  2K8B A;  2R2Q A;  1Y8R C;  2CJN A;  2K3U A;  1F1H A;  4OVZ A;  1FNU A;  2NBW B;  1WJU A;  3FKY A;  2J4X A;  1B9R A;  3I3T B;  4YTN B;  3WCQ A;  3ZXR A;  4G3X B;  3ZQ4 A;  3GE8 C;  3V62 A;  1A70 A;  1WGY A;  3TMP B;  1KOT A;  3AEB B;  4ZHP A;  4B95 A;  2Z0D B;  2WLB A;  1WGD A;  1XD3 B;  4C56 C;  4LNF A;  2V1Y A;  3DQV A;  1MJD A;  1H8C A;  4WWN A;  2KFK B;  2KDF B;  3NS1 A;  1QLB B;  3OG5 A;  3W5U B;  2PW9 A;  4JQW C;  2A5U A;  4IOI E;  5DPT A;  3DDC B;  1WJN A;  5D6J B;  2YEP B;  2AQ2 B;  2KMC A;  2D2Q A;  2MP2 A;  1BUI C;  2NBV B;  4GGQ A;  3A1Q B;  3GP7 A;  3JSV B;  1EO6 A;  3PGE A;  1YJ1 A;  4A8X C;  1C1Y B;  3X23 A;  3QK0 A;  1R4M B;  2K9X A;  1IYF A;  1I4H A;  3Q14 C;  4C80 A;  2BS4 B;  4E74 A;  2KWD A;  3B1L X;  1D5M C;  3SHQ A;  4ICU A;  2JUO A;  2A4Z A;  1WRD B;  3DCG A;  3Q8E A;  2BPS A;  3HIZ A;  4M0W B;  1QZE A;  3KWV A;  3HUI A;  3TEY A;  3P4Q B;  2K6Q A;  2KX3 A;  3JW0 X;  5EE1 A;  3Q8C A;  3VQI A;  2ZNV C;  2MCN B;  1P3Q U;  3IBE A;  3HM6 X;  4ANW A;  2D10 A;  1LFD A;  5C2T B;  2JWZ A;  3DBL B;  2ZW0 A;  5E6J A;  1XLO A;  2XK5 B;  3DBS A;  2AQ3 B;  1F9J A;  3GZN I;  5L83 A;  4ICV A;  4JPS A;  5H8Y E;  5AEK B;  5JHB A;  1HE8 A;  2GBK A;  1V1P B;  2BTE A;  4DHZ E;  2EMT A;  4MM3 A;  2Z59 B;  2LVP A;  4ANU A;  3C0R B;  1SSN A;  1RFK A;  2KN5 A;  3H8H A;  2I2Y A;  4B0M A;  1QOF A;  2KOX A;  4KSK C;  5D3D A;  2D3C A;  2JXT A;  4TQ1 A;  4WAA A;  2FAZ A;  3R3M A;  3A4S C;  1VD2 A;  1YQ4 B;  2KLG A;  2UYZ B;  3MC9 A;  3GS2 A;  2KDM A;  2DZM A;  2KVR A;  4MH0 E;  2X8X X;  4I6P A;  1WYG A;  1D5X C;  4MDK E;  3RUL A;  1XCT L;  2X38 A;  3RNG C;  2KHW B;  4IDI A;  3VR8 B;  4K1R B;  3BVZ A;  3VR9 B;  5EDS A;  3KQ4 A;  4W9D A;  1FO4 A;  5G5G A;  2JVC A;  1P9D U;  1SXT A;  4AS1 A;  3BZD B;  4RF0 A;  2M56 B; 
#chains in the Genus database with same CATH homology
 4LJP B;  3ONS A;  4AUQ C;  2KDI A;  3CMM B;  2L8J A;  3EHV A;  3A9K B;  5J17 A;  3Q3F A;  1V80 A;  2KC2 A;  3M95 A;  3CSF A;  3NY5 A;  4ZRK A;  4RMA A;  1LQB A;  3QC8 B;  4W9F A;  4IW0 A;  3DVG X;  3UGB B;  1ISN A;  3L13 A;  3PLU A;  2JZZ A;  3VUX A;  4TQ0 A;  2DYB A;  2ZCC A;  1WGR A;  2IO2 B;  3M63 B;  4WJQ A;  4FAD A;  2G45 B;  3H1U A;  2GBR A;  5KHO A;  3DVG Y;  2LZ6 A;  1WXA A;  4JL9 A;  2KXJ A;  4AJW A;  1EF1 A;  2C9W B;  2KTR A;  2Z0E B;  3VUW A;  2BWE S;  2C60 A;  2MBO A;  3L10 B;  4PS7 A;  2O6V D;  3TJP A;  4HJK A;  4ZYN A;  4B9K A;  3PHX B;  2DX5 B;  1LM8 B;  2K6D B;  3EEC A;  2CHX A;  1WM3 A;  4BOS C;  3H7P B;  1RLF A;  3VTV A;  3APF A;  5CHV C;  2N9P C;  4CO7 A;  4DHJ D;  1BT0 A;  2Y5B B;  4PYZ A;  4F1S A;  4EUT A;  2KJR A;  3PTF C;  1P98 A;  2KQ7 A;  1YIW A;  4BVU C;  3WAN A;  1WXV A;  2BGF A;  4NQK E;  4K7W A;  4KIK A;  3ZW3 A;  3TIX A;  1V49 A;  3AI5 A;  2O2V A;  3QIJ A;  4P7I A;  1RAX A;  2GBM A;  3N3K B;  1J19 A;  2L00 B;  2BYF A;  1EUV B;  3RCZ A;  2N1W A;  3CF6 E;  2DYM A;  2NR2 A;  1WMH A;  1GC7 A;  3IFW B;  2KWU B;  3DBR I;  3DBH I;  2KD0 A;  3V60 A;  4ASW C;  4W9L A;  1TGZ B;  2C5L C;  2IO1 B;  2ZVO A;  2LGD A;  1E90 A;  1SGH A;  3QWZ B;  3KYC D;  4W9I A;  4IC7 B;  2KNB A;  1IP9 A;  4NJ7 A;  3L16 A;  4MJS B;  1Q0W B;  3VH4 B;  2D11 A;  4HXD A;  2LGY A;  2ZNV B;  5DPS A;  4KZC A;  3UIO B;  2FCN A;  4XC2 A;  3N32 A;  3H7S A;  4G11 A;  4EZJ A;  3ZNZ B;  2LRU A;  1WX7 A;  2CHZ A;  3WIM A;  5JHA A;  2IY0 B;  2FCS A;  5CTR C;  4A20 A;  4CYE A;  1GG3 A;  1OGW A;  2WDT B;  3DPD A;  4WQO B;  5CX3 A;  1UZX B;  2HJ8 A;  2AYO B;  1V6E A;  2DEN B;  2L3Z A;  2KLC A;  2I1K A;  1WF9 A;  4KIK B;  4PYU A;  2HTH A;  2KDB A;  2MBQ A;  3UQA A;  1A5R A;  5C1Z A;  4HPM B;  5G55 A;  3NZU A;  3OAW A;  2JT4 B;  1WFY A;  2JZ3 B;  4BBN F;  1M94 A;  4FJZ A;  3ML8 A;  3RZW C;  2KWC A;  3PZD A;  1OEY A;  4IG7 B;  2KFK A;  2FID A;  4DHZ B;  4DK5 A;  4W9C A;  1FXT B;  5TR5 A;  4GOC A;  1WI0 A;  1J8C A;  2NPT B;  2YVC A;  3RYT A;  3MJW A;  3ZVV A;  4GU2 A;  4WJN A;  2HE7 A;  2W9N A;  4RM8 A;  5L95 C;  2WYQ A;  5JZE B;  5CHF A;  2PE9 A;  4F7Z A;  4TV3 A;  3IG3 A;  4G50 A;  2JXX A;  2V4L A;  1YQB A;  2IZV B;  3L0W B;  4A3O A;  3A9J B;  4M8M A;  3R7R A;  4HDO A;  3U30 A;  1S1Q B;  2FNJ B;  3PV1 A;  4A3P A;  2KTF A;  4LCD E;  4DXA B;  5JH5 C;  5J2R A;  4HWI B;  3QHT A;  2JRH A;  1D3Z A;  1L7Y A;  2L76 A;  1KM7 A;  2MSE D;  2MBE A;  4YL8 A;  1YX6 B;  5D2M B;  1Z5S B;  3IHP C;  4LDT D;  3U7D A;  4F8C B;  3OJ3 A;  3KVF B;  1WX8 A;  3VTW A;  1WR6 E;  2FCM A;  2C7H A;  4HDQ A;  2RD0 A;  1WXM A;  2O6V B;  3PRE A;  5LLI A;  4J6I A;  4AJY B;  4EFO A;  1WIA A;  4PS3 A;  3B0A A;  2G4D B;  2NVU I;  3PT2 B;  1AAR A;  2JF5 A;  2MX2 A;  3CST A;  3QCA A;  2LJ5 A;  1WX9 A;  2AL3 A;  2ZPY A;  3BIN A;  4KVG B;  4AWJ A;  2OOB B;  5E6O A;  3WAP A;  3ZIM A;  2LXC A;  2L05 A;  3WAL A;  2JPH A;  1WZ3 A;  4HK2 A;  5D94 A;  2N9E B;  4NAW A;  2BKR B;  4IUM B;  1NI2 A;  3OLM D;  2G4S A;  3ZNH B;  5IA7 A;  1SIF A;  1R4N I;  4NY0 A;  1Q5W B;  4DBG A;  4FJV B;  1WY8 A;  4EEW A;  4LDT B;  2LI5 A;  3VFK A;  2M0X A;  4GDK B;  1UBQ A;  1WMH B;  4W9H A;  3A4R A;  3K9O B;  2B3A A;  2ZCB A;  3M3J A;  3R66 C;  4MSM B;  3ZNG C;  1E7U A;  2OJR A;  3KH0 A;  4JGH B;  4K81 A;  4RM9 A;  3LDZ E;  4MGK E;  2O2V B;  3WA0 A;  4BBN C;  1U4A A;  3O65 B;  1SE9 A;  3ENE A;  3ZTD A;  3GOE A;  2KJ6 A;  3KUC B;  4GDL A;  1V5T A;  4MGY E;  2NBU A;  1T0Y A;  1WYW B;  2KQS A;  2R2O A;  2FUH B;  4HCP B;  4W9E A;  2KWV B;  2IY1 B;  2ZPN A;  3H7P A;  1X1M A;  3A9K A;  2MRP A;  2N1V A;  2K39 A;  1S3S G;  2ZVN A;  3KYD D;  3APD A;  1WM2 A;  3ML9 A;  2GOW A;  3PS6 A;  2IO3 B;  2J0M A;  2KAN A;  3SDL C;  3VAW A;  3VTU A;  4EZK A;  2LVQ A;  3AXC A;  3ECI A;  3IVF A;  3QAR A;  4M8N A;  4ZRJ A;  4BOZ B;  1I35 A;  4BKS D;  5KHQ A;  3WAO A;  2N7D A;  1KLV A;  1Z2M A;  4KSL C;  3ZTC A;  1CMX B;  2CS4 A;  2GBN A;  3A33 B;  1WGH A;  2DAF A;  3ZDT A;  3ZRC A;  3W1S C;  3P2B A;  3NS8 A;  4HLE A;  1WGG A;  1V86 A;  2C7N B;  2LUE A;  4W9J A;  2K8C A;  3NHE B;  5FR6 A;  2LD9 A;  2AEH A;  1E8Y A;  3HK0 A;  1V81 A;  2ZEQ A;  2L7R A;  4II2 B;  4NNJ B;  4GDK A;  4EZL A;  3VH3 B;  2KKC A;  2KFJ A;  2IO0 B;  4WWO A;  2LWP A;  4GMV A;  4NQL B;  3UF8 A;  2KO3 A;  3VUY A;  2EKE C;  3PSE B;  1WH3 A;  1TZ1 A;  3KUZ A;  5GMV A;  1YD8 U;  2NCN A;  4BKG A;  4FN2 A;  2LXA A;  5DCN A;  3PPA A;  1RRB A;  3TBL D;  1L2N A;  1UBI A;  3A9J A;  5CHW A;  4IWQ A;  1WE7 A;  3OJ4 B;  2JY6 A;  2J0J A;  3Q3J A;  4FHK A;  4WWP A;  2I1J A;  4NPN A;  2O6V A;  2NS5 A;  3X0W A;  2ZJD A;  3PRM B;  1UD7 A;  3HM3 A;  2PPH A;  1TBE A;  2MW5 A;  3DVN U;  2DAJ A;  2DZI A;  1NBF C;  1E8X A;  3ALB A;  4EKU A;  2K8B A;  2R2Q A;  2PEA A;  1GNU A;  2M17 A;  1WZ0 A;  1Y8R C;  3U8Z A;  4KDI C;  2DZK A;  1VCB A;  4GXB A;  2NBW B;  1WJU A;  5C23 A;  5G2N A;  1K8R B;  4CHK A;  1V2Y A;  2GBJ A;  4NJ6 A;  1XT9 B;  1E7V A;  3I3T B;  3KUD B;  4FJY A;  4K7S A;  1YX5 B;  4G3X B;  4OVV A;  4IM3 A;  2BYE A;  5E6P A;  3V62 A;  3A1Q A;  3TCA A;  3JVZ X;  4FBJ B;  1WGY A;  3RUI B;  2WWZ A;  3VDZ A;  2HD5 B;  2DZJ A;  1XQQ A;  3TMP B;  2EMS A;  4DHJ B;  1KOT A;  4B95 A;  2Z0D B;  2RPQ A;  3T8M A;  1WGD A;  2XK5 A;  1XD3 B;  2L0T A;  4TUU A;  4ZDV A;  5D7G A;  2REX A;  2RSU A;  3PRP B;  1E8Z A;  1GC6 A;  3QQ8 B;  2V1Y A;  3DQV A;  1G6J A;  3EFU A;  4NAW B;  1ZW7 A;  1H8C A;  4WWN A;  2KFK B;  2KDF B;  2QHO A;  3VXW A;  4LJO B;  2ZZP B;  4IM0 A;  2IBI B;  4XZ4 A;  3PLV A;  5DPR A;  3L54 A;  4GSW A;  4JQW C;  2AWT A;  4WJP A;  3RT3 B;  1WXS A;  4B6W A;  4K7U A;  4DWF A;  2A5U A;  5DPT A;  3EC8 A;  3DDC B;  1WJN A;  3DVN V;  2N7E A;  5D6J B;  3RD2 A;  4N9F 4;  1UH6 A;  3ZNI D;  2KMC A;  4W9G A;  1R4M I;  2D2Q A;  2MP2 A;  3JSV A;  3UIP B;  3PVL A;  3QX1 A;  4AOF A;  3QA8 A;  1C3T A;  2NBV B;  2CKH B;  2MBH A;  3A1Q B;  2MP2 B;  3H9D A;  3JSV B;  1EO6 A;  2KJH B;  4GGQ A;  3UIN B;  3PGE A;  1YJ1 A;  3ZKJ C;  1UGM A;  2D07 B;  1C1Y B;  1I42 A;  3X23 A;  1IPG A;  3QK0 A;  1WR1 A;  5AZF A;  1IYF A;  2MQJ A;  2PJH A;  2J7Q B;  2MBB B;  4KV2 A;  3W1S A;  2KMA A;  3BY4 B;  2J0K A;  4IM2 A;  2YLM A;  4II3 B;  4MEM A;  4MSQ B;  5AZH A;  3SU8 X;  3W1Y A;  5DPW A;  2GMI C;  4MGZ E;  4E74 A;  2LGX A;  3B1L X;  3SHQ A;  3NZS A;  1V9J A;  1Q1O A;  4ICU A;  1P1A A;  4MEL A;  2JUO A;  2NPT A;  3V6E B;  3RZF A;  2A4Z A;  2UWQ A;  1WE6 A;  1NDD A;  1ZKH A;  4X57 B;  3VVW B;  2WX0 A;  4E3C A;  3L08 A;  1WRD B;  3DCG A;  3ZUN A;  2BPS A;  3HIZ A;  1QZE A;  4M0W B;  2KTR B;  2KDE B;  3ZRF A;  2MLB A;  2C7M B;  2PE6 B;  2K6Q A;  2KX3 A;  4AP4 C;  4BKT A;  3ZLZ A;  1OEY J;  3DBL I;  2G3Q B;  3JW0 X;  2KK8 A;  3VQI A;  4WJO A;  4I6N B;  1H4R A;  2ZNV C;  2MCN B;  1P3Q U;  2CHW A;  3IBE A;  3HM6 X;  4ANW A;  1UEL A;  2MA9 B;  3AU5 A;  2D10 A;  4JIO U;  4BKS A;  1LFD A;  2JWZ A;  2VRR B;  4TKN A;  2BF8 B;  2XK5 B;  3V61 A;  1LXD A;  2FIF A;  3DBS A;  1E5W A;  1F9J A;  1TTN A;  3GZN I;  5L83 A;  2RGF A;  2BYV E;  4ICV A;  5HKH A;  1P0R A;  5AZG A;  3H6N A;  5AEK B;  5JHB A;  2LRW A;  3TL5 A;  3VHT C;  1HE8 A;  4IWP A;  2GBK A;  4GN1 A;  3JYU A;  3LJ3 A;  2K1F A;  3QAQ A;  3ZDM C;  4XX5 A;  2D3G A;  4BFR A;  2EMT A;  4DHZ E;  4MM3 A;  2Z59 B;  5LXI B;  1KJT A;  2LVP A;  4ANU A;  3C0R B;  2KN5 A;  2M4N A;  3UQB A;  4HPL B;  2M8S A;  3R7Q A;  3PRZ A;  3MHS D;  4FLH A;  1E8W A;  4GB9 A;  1GUA B;  2AL6 A;  3MTN B;  2WX1 A;  2KOX A;  4KSK C;  2CU1 A;  5LXH A;  1WJ6 A;  2FCQ A;  4TQ1 A;  3ZO5 B;  4OVU A;  4WAA A;  5BO4 B;  3S2A A;  2LVO A;  2M1M A;  2FAZ A;  4G0N B;  4KDL B;  4FHJ A;  1V5O A;  3R3M A;  3A4S C;  1VD2 A;  1RFA A;  5J18 A;  2KX0 A;  4PS8 A;  2K8H A;  3NOB A;  4FUL A;  3V6C B;  2KLG A;  3M62 B;  3N30 A;  2UYZ B;  4GDL B;  4GIV A;  1ZGU B;  4DDI D;  2KC1 A;  1GJZ A;  5E6N A;  2DZM A;  4FA6 A;  2K25 A;  3PHW B;  4I6L B;  4W9K A;  2KVR A;  4URK A;  4MH0 E;  3T9L A;  4DDG D;  4HVB A;  1OQY A;  4I6P A;  2N4F A;  1EF5 A;  4ANX A;  3K9P B;  4IWO A;  4MDK E;  3RUL A;  1MG8 A;  2MWS B;  2RR9 A;  3DOW A;  4KZ0 A;  4MGI E;  2KHW B;  3HHM A;  4ANV A;  3D32 A;  2XBB C;  2KZR A;  2DYO A;  4HCN B;  2DHZ A;  4K1R B;  5EDS A;  1J0G A;  4JLC A;  2CR5 A;  2BWF A;  2XEW A;  4MJS A;  3QJZ A;  4ZRI A;  1OTR B;  3APC A;  2BKF A;  3AUL A;  2JRI B;  3AU4 A;  3L17 A;  3KW5 B;  4EOY A;  2IYD B;  1WJ4 A;  4W9D A;  2ASQ A;  2LAS A;  2N9X A;  1PQS A;  2JVC A;  1P9D U;  3SD5 A;  4E71 A;  3WAM A;  1JRU A;  5IAA C;  2V3S A;  2L0F A;  3B08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...