1U4AA

Solution structure of human sumo-3 c47s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-like protein SMT3A
publication title Solution Structure of Human SUMO-3 C47S and Its Binding Surface for Ubc9
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1u4aA00
2IO3B 1H4RA 3NS8A 1TGZB 1WM3A 2QHOA 3A4SC 4EOYA 4G11A 2LVOA 3L13A 2ZVNA 4KDLB 2LVPA 1TTNA 3RULA 4M8MA 3O65B 2C5LC 2N9EB 3UIPB 3JSVB 2MCNB 1YX5B 2GOWA 4A3OA 3PLVA 4IM0A 4GMVA 1L7YA 5AZGA 5D7GA 4HVBA 4GGQA 5JH5C 2KFJA 3ML8A 2IO2B 4B95A 3JW0X 2MQJA 3N3KB 3PS6A 2KTRA 3M95A 2KWVB 4W9FA 2PE6B 4FBJB 3IBEA 2N9XA 2FIDA 2KFKB 2IO1B 1RRBA 3H1UA 2K25A 3MJWA 4CHKA 2W9NA 1E5WA 2O6VA 4J6IA 2MX2A 2GBMA 2L05A 4GDKA 4M8NA 4AOFA 1GC7A 4DDGD 4EKUA 5IA7A 5J18A 5G2NA 2IY0B 1I35A 3DDCB 3VH3B 1E8YA 3EECA 4ICUA 2Z0EB 3VVWB 4II3B 1LXDA 5AZHA 1WXMA 3ECIA 2BWES 2CHXA 2ASQA 2YVCA 1E8XA 4MM3A 4W9HA 1D3ZA 1YD8U 2NVUI 2ZCBA 3X23A 4IWOA 2NBUA 4KV2A 4MSQB 3LJ3A 3V60A 2FUHB 1M94A 2ZNVB 3QAQA 2KQ7A 4KZCA 2NCNA 4FN2A 4HK2A 3HIZA 1LFDA 4OVUA 4AJYB 4NY0A 1WR1A 2I1KA 2KDFB 3EFUA 5E6OA 1MG8A 2KXJA 3JVZX 3K9OB 2FCNA 1WJ4A 4HLEA 1SIFA 3W1SC 3EC8A 3APDA 1WX9A 1IPGA 3UIOB 1WI0A 1OTRB 1YJ1A 2LD9A 3ZNZB 4W9GA 3MHSD 1S3SG 1V80A 3U8ZA 1WR6E 2BYFA 2FIFA 2YLMA 2MA9B 3H7SA 1FXTB 1WGDA 1V9JA 4IC7B 3RUIB 5CTRC 3PT2B 1ZW7A 2BGFA 3N30A 3WAMA 4B9KA 3DVGY 1AARA 3HM3A 2J0MA 4LJOB 2XEWA 1R4MI 5GMVA 3PHXB 2KN5A 3IVFA 2CU1A 4MJSB 4DHJB 1WGYA 3OLMD 3QA8A 2ZJDA 2NPTB 4FHKA 4K81A 5HKHA 4XX5A 5CX3A 1WM2A 2JF5A 4BKTA 1PQSA 4NNJB 2JRIB 3R3MA 4GU2A 4AUQC 5LLIA 4IG7B 3TIXA 2DX5B 1OEYA 4WJQA 3L16A 3ZDMC 4E71A 4PYUA 1ZGUB 1WYWB 4DDID 2XK5B 1LQBA 2FCMA 2MLBA 2OJRA 1EO6A 3L0WB 4RM9A 2KK8A 2Z0DB 3RCZA 3VTUA 3K9PB 3DCGA 5DCNA 2MRPA 2KC2A 2D2QA 2BYVE 4I6LB 4WQOB 2D3GA 2DAFA 2MP2B 2D11A 4GDLB 4LJPB 1V5OA 4GXBA 1UGMA 2BKRB 3ALBA 2AYOB 3EHVA 4IUMB 3ML9A 4ANXA 2CHWA 1UBQA 4EZLA 2LRWA 1WRDB 3JSVA 4KDIC 2GBJA 2O6VD 2WX0A 2PJHA 2Y5BB 4CO7A 2RD0A 2JUOA 4ANUA 2G45B 4F7ZA 1KOTA 3VFKA 1ISNA 1X1MA 3CSFA 4GN1A 2M17A 4ZYNA 2L0FA 2R2QA 4LCDE 4BOSC 3ZNID 4IM3A 4NAWB 2KDEB 1WXAA 3S2AA 4AJWA 2IY1B 4FULA 4IWPA 2NBWB 1WE6A 4WAAA 3QARA 4XC2A 1C3TA 2KFKA 3ZVVA 4MEMA 4KSLC 4DHJD 3W1SA 2DYOA 4K7SA 4FHJA 3M62B 4NPNA 2J0KA 4HDOA 4JL9A 2KMCA 1WX7A 1TZ1A 3DBRI 2KLGA 4TV3A 5EDSA 2KKCA 2ZEQA 5J17A 3VUYA 3DOWA 3C0RB 4TKNA 2KD0A 3SHQA 2K8HA 1E8ZA 2I1JA 3BINA 3PSEB 2JRHA 3PZDA 5AZFA 2BKFA 4DXAB 2VRRB 2L00B 2EMSA 2RPQA 4CYEA 2L3ZA 4FADA 3BY4B 2DHZA 1YIWA 3ZKJC 2ZCCA 2RR9A 4ZRKA 3V61A 2NBVB 2LXCA 3UGBB 3X0WA 2UWQA 2HJ8A 3U7DA 1R4NI 2KNBA 4HWIB 3SD5A 2OOBB 3U30A 3CSTA 3ZRFA 3JYUA 4DHZB 1J8CA 3ENEA 3PRMB 3ZTDA 4GOCA 3ZNHB 3NY5A 3QWZB 2M8SA 2Z59B 1BT0A 4ICVA 2L76A 1SGHA 2KX3A 4TUUA 1WFYA 4K7WA 3WALA 4DWFA 3QCAA 1SE9A 1GJZA 1OGWA 3IFWB 2K8BA 3AI5A 3A4RA 2MBBB 3NHEB 2DENB 3AU5A 1T0YA 1GNUA 1WZ0A 4JIOU 4MDKE 4NJ6A 2MBEA 2IZVB 2D07B 4I6PA 5LXHA 3DBSA 3SU8X 2JPHA 4K1RB 1F9JA 2LUEA 2BPSA 2N7EA 2AEHA 2L7RA 3APCA 4X57B 3UINB 3AU4A 1WX8A 4WJOA 3TCAA 3B08A 4MJSA 4EUTA 1WF9A 3KH0A 1WXVA 2NPTA 2WYQA 2FAZA 4G50A 4WJNA 3PLUA 2JXXA 3HHMA 2J0JA 3DPDA 3PTFC 2KTFA 3L54A 3RT3B 2BYEA 1EF5A 4LDTB 4W9LA 2GBNA 4BOZB 3ZW3A 2XK5A 1LM8B 2GBRA 5CHFA 3B1LX 1J19A 2ZZPB 2KTRB 1IYFA 2EKEC 1GC6A 2JVCA 2ZPYA 2B3AA 3VQIA 4ASWC 4HDQA 2M1MA 2V1YA 2KQSA 4P7IA 3OAWA 4TQ1A 2MP2A 5BO4B 2CS4A 1E90A 4W9DA 4GSWA 4JLCA 3A9JB 2PPHA 4GDLA 1WJ6A 2KWUB 2DZIA 4EZKA 4W9JA 2KANA 1RFAA 3KUDB 4KVGB 3QJZA 4BBNF 5JHAA 1GG3A 3WA0A 3ZUNA 3PVLA 2XBBC 2KO3A 3KYCD 3M3JA 1TBEA 2KDBA 2LRUA 3VH4B 3ZTCA 4KIKB 2C60A 1NBFC 4MGIE 3WAOA 4E74A 4AWJA 2K6QA 2NR2A 4NAWA 2KC1A 4NJ7A 4W9IA 4IWQA 2LGDA 3A33B 5JHBA 2K1FA 3A1QB 1OQYA 3R66C 3V6CB 5AEKB 3VDZA 2AL3A 2HTHA 3V6EB 1P0RA 1P98A 3T8MA 4XZ4A 1WGRA 5DPRA 3OJ4B 1GUAB 4ANWA 1UELA 2CR5A 3MTNB 2KMAA 3NOBA 4I6NB 2M4NA 4HJKA 2O2VB 3W1YA 3KW5B 4ZRJA 3QQ8B 2BWFA 3Q3FA 4DBGA 2DAJA 1Z2MA 3APFA 1Y8RC 1ZKHA 4W9EA 2V3SA 2EMTA 2A4ZA 4FLHA 1HE8A 3Q3JA 1RLFA 2LWPA 3UQBA 2KJHB 1OEYJ 4A20A 1E7VA 3CF6E 4W9KA 1NI2A 2N4FA 3TMPB 4G0NB 2J7QB 5J2RA 4URKA 1XD3B 1P9DU 2KX0A 3TJPA 4MGZE 3R7RA 3RYTA 1H8CA 4JQWC 4EEWA 2GBKA 4AP4C 2FNJB 3DBLI 4B6WA 2KDIA 4F1SA 2KHWB 3PHWB 3QHTA 3PPAA 3DVNV 3KYDD 1QZEA 4GB9A 5C1ZA 4MGKE 1YQBA 4PS7A 3RZFA 4NQLB 3GZNI 3UF8A 3QIJA 1Q1OA 2MW5A 1E7UA 1CMXB 3KUCB 5L83A 3ZLZA 1V81A 1XQQA 1Z5SB 3DQVA 2WX1A 5CHVC 1EF1A 4M0WB 4BFRA 1EUVB 3SDLC 3QC8B 5D94A 1WMHB 4BVUC 2IYDB 2N7DA 4ZRIA 1P3QU 1UZXB 1G6JA 2PEAA 1V2YA 4BKSD 2BF8B 3IG3A 4G3XB 4HCPB 2LI5A 2C7MB 2RGFA 5E6NA 3H7PB 1UD7A 1WH3A 2D10A 3ZDTA 1WGHA 2LASA 3ZNGC 1I42A 3PREA 2N1VA 3A9KB 2FCSA 5D2MB 3QK0A 1NDDA 2GMIC 2DZKA 4IM2A 4WWPA 1E8WA 2KLCA 2KWCA 2JY6A 3N32A 3T9LA 3WAPA 3WIMA 2KOXA 2C7HA 3D32A 3OJ3A 3DBHI 2C9WB 1KJTA 3KUZA 3ONSA 5IAAC 3L10B 1U4AA 3WANA 1YX6B 5C23A 3TBLD 3IHPC 2AL6A 3A9JA 3NZSA 4A3PA 1P1AA 2C7NB 3PRZA 1S1QB 1WE7A 4FJVB 1V6EA 3HM6X 2N9PC 3PGEA 1Q5WB 4E3CA 2PE9A 3PV1A 5FR6A 4ANVA 2DYMA 2LVQA 2WWZA 2IBIB 4FJZA 4BKGA 5DPSA 4KIKA 1J0GA 3DVNU 1WIAA 2JWZA 3H9DA 2MBQA 4W9CA 1L2NA 3NZUA 1WJUA 2L8JA 4KZ0A 3R7QA 5L95C 1KLVA 3VTWA 3P2BA 2RSUA 3A1QA 2LGYA 3VHTC 1WY8A 3AULA 2HE7A 3H6NA 4KSKC 4BBNC 2KJ6A 3PRPB 4WJPA 2DZMA 4N9F4 2LXAA 4OVVA 4BKSA 4DK5A 2G3QB 2O6VB 1IP9A 4TQ0A 4GDKB 2LJ5A 2MBOA 3QX1A 4HXDA 2LZ6A 2O2VA 4JGHB 3HK0A 4II2B 2LGXA 5D6JB 2V4LA 4GIVA 1V49A 3VTVA 2DZJA 2KJRA 2UYZB 3L08A 1JRUA 3VAWA 3RD2A 2R2OA 1WJNA 4IW0A 2KZRA 2CKHB 2MWSB 5KHQA 5LXIB 1V86A 2REXA 4K7UA 4PYZA 4PS3A 2K39A 2ZNVC 3KVFB 4NQKE 1XT9B 2NS5A 3AXCA 5E6PA 2KVRA 2HD5B 3ZRCA 2MSED 2JT4B 2JZ3B 5DPTA 1RAXA 3M63B 1UH6A 2FCQA 1KM7A 1WXSA 2G4SA 4FA6A 1V5TA 4HPMB 4DHZE 3TL5A 1WZ3A 2IO0B 3CMMB 2ZPNA 3GOEA 4MGYE 3LDZE 2G4DB 2M0XA 5DPWA 3DVGX 4LDTD 4MH0E 4MSMB 5KHOA 2MBHA 3VUWA 3L17A 2AWTA 4WWNA 1VD2A 2ZVOA 3I3TB 3ZO5B 2CHZA 3V62A 1WMHA 4RMAA 4F8CB 5JZEB 4YL8A 2N1WA 1VCBA 3VUXA 1A5RA 5G55A 4MELA 1K8RB 4ZDVA 5CHWA 4FJYA 5TR5A 2K6DB 2JZZA 4HCNB 4PS8A 4RM8A 3H7PA 2DYBA 4EZJA 1Q0WB 3B0AA 3RZWC 3A9KA 1WGGA 2K8CA 4HPLB 2WDTB 3UQAA 4WWOA 2L0TA 3ZIMA 1UBIA 3VXWA 1C1YB 2A5UA 4EFOA
chains in the Genus database with same CATH superfamily
2JXTA 2WXJA 4RGTA 2KQ4X 1JCKB 1KFYB 4KDLB 3IAM1 4M8MA 3UIPB 1PGBA 3Q8CA 1JWUD 5JH5C 3JW0X 3N3KB 2KTRA 3MC0B 2PE6B 3IBEA 2FIDA 4OVZA 2IO1B 1RRBA 4J6IA 2MX2A 2L05A 5J18A 4EKUA 3KWVA 4A90A 2BW2A 5C3JB 2Z0EB 2WNMA 3NG0A 4II3B 3DWMA 5AZHA 2CHXA 4MM3A 2QJLA 3LJ3A 4OZCA 1M94A 1JWMD 2KQ7A 4FN2A 3MC8A 1N5WA 1WR1A 5E6OA 3K9OB 3EC8A 1HEZE 1WI0A 3Q8AA 2D3BA 3NRZA 3MHSD 1S3SG 3B2GA 3R8BA 3N30A 4HPPA 2XEWA 1XCTL 3DBLB 1TKGA 3Q14C 5FR3A 3SR6A 3Q3NC 5HKHA 4K81A 4ZHOA 4M01A 4BKTA 4IG7B 1OEYA 4RGNA 1DOIA 4PYUA 4N6EB 4DDID 4L23A 1VZ7A 2FCMA 4RM9A 1EO6A 1VDVA 2KK8A 5D3DA 5DCNA 2MRPA 1C9FA 2KC2A 2BYVE 4WQOB 1FPYA 2DAFA 1RM6C 4GDLB 4LJPB 1V5OA 4GXBA 2AYOB 4ANXA 1I4XA 1UBQA 3W2DA 4CQNA 2LRWA 3BWUD 2GLSA 4C80A 4L2YA 2FE8A 1JRPA 4ANUA 4IDIA 3CSFA 1X1MA 4GN1A 4LCDE 4LNIA 1FFUA 3E56A 1D4BA 3AE7B 4Q2JA 1PGXA 2D5GA 4KSLC 3W1SA 3M62B 4HDOA 4JL9A 1YNTE 1K53A 3VUYA 1MFWA 4TKNA 1SSNA 1E8ZA 2K8HA 3BINA 3PSEB 3PZDA 5AZFA 2MJDA 2L00B 2RPQA 4CYEA 4ZYSA 2RR9A 3V61A 3T3OA 2UWQA 2HJ8A 1R4NI 3SD5A 2OOBB 3RMKC 3U30A 4DHZB 3ZRFA 1J8CA 3ENEA 1ZXIA 1C76A 4RCOA 4GOCA 3NY5A 2M8SA 2R61A 2Z59B 1BT0A 2L76A 4TUUA 3WALA 1GJZA 2WXFA 3QCAA 3BZDB 3AI5A 4JIOU 2DLBA 2NTTA 1QT9A 1R4MB 5H92C 2BPSA 2AEHA 3APCA 2JYEA 1WX8A 3R2TA 3TCAA 4MJSA 3WCQA 4EUTA 1L0VB 2KWDA 1KLGD 4WJNA 3PLUA 1SBBB 2JXXA 2INNE 3KLSX 4LNKA 4LDTB 3AEAB 4AQ7A 2WLBA 3Q3MC 1E10A 3B1LX 1KLUD 4ZOHC 2KTRB 3MFGA 1IYFA 2ZPYA 2B3AA 1MPEA 3KWLA 2KQSA 4TQ1A 5BO4B 4S0RA 3P4PB 1F77A 3A9JB 1WJ6A 3VR8B 2LFIA 5IP4D 3QJZA 5JHAA 4KKIA 1GG3A 3MJ5A 3ZUNA 4TSSA 3M3JA 3Q2AC 3VH4B 1QOBA 4MGIE 2RPVA 4AWJA 2NR2A 4NJ7A 4W9IA 2K1FA 5AEKB 1T0SC 4C56C 3OJ4B 1I4RA 2CR5A 1LO5D 3MTNB 1K51A 4NZLB 5EE3A 1E0ZA 3NOBA 1IBXA 2D3AA 1SF0A 1T6BX 2WXIA 3W5UB 4DBGA 3APFA 1Y8RC 3PO0A 3Q3JA 3NUHB 2LWPA 1R7SA 2V3PA 3NVYA 4URKA 1FXIA 4MGZE 3RYTA 1H8CA 2V4IB 4JQWC 4DXGA 4B6WA 2KDIA 2KHWB 3PHWB 4HEA1 4RF0A 2AQ1B 1PUTA 3RZFA 1FCCC 4NQLB 1A70A 4N59A 1CMXB 3ZLZA 1V81A 1EF1A 1YN3A 5GXGB 3QC8B 1WMHB 2BTEA 2N7DA 1FD6A 1QOGA 1JQ4A 3IG3A 4G3XB 2LI5A 5E6NA 1HTQA 1WH3A 2LUMA 3SEBA 1F2RI 2PW9A 1CJEA 1E8WA 3WAPA 4RGMA 2KOXA 2C7HA 3D32A 2CJOA 3KUZA 2ZW1A 5C23A 3Q8FA 4EE2A 2AL6A 4A3PA 3PRZA 1WE7A 2N9PC 3PGEA 1N6ZA 2AQ2B 2WDVB 2PVOD 4ANVA 2X38A 4TMAB 2WWZA 3DVNU 2BB6A 2JWZA 3H9DA 1L2NA 3NZUA 1WJUA 3R7QA 3ZGZA 2LHDA 4ZRQA 3ETRA 4KSKC 4XDCA 3DWGC 2ICIA 4N9F4 2W54A 4DK5A 3HUIA 2G3QB 1KTKA 2O2VA 2WDQB 4II2B 3RNCC 5D6JB 1V49A 1SJHD 1JRUA 2R2OA 2ONQA 1WJNA 3N1YC 4IW0A 4RNAA 1V86A 2VZKB 4K7UA 1NEKB 2M19A 1XT9B 2HD5B 3ZRCA 2JZ3B 4ARIA 3M63B 1WXSA 2BQQA 1YOVB 2KMMA 3AE9B 3I5JC 4OHJA 3GOEA 4MGYE 1VZ8A 3LDZE 1NVID 2M0XA 4MSMB 4B0MA 5KHOA 3AEGB 2PIAA 1RFKA 1AW7A 4M0WA 3I3TB 1R4NB 1UF0A 1XF5L 5JZEB 4N58A 2RDBC 5G55A 4KKJA 4FJYA 2L1AA 2JZZA 1EM7A 1C4PA 2DYBA 1V1OA 4EZJA 1Q0WB 3RZWC 2L0TA 1UBIA 3VXWA 4RFBA 4P6VF 2IO3B 1H4RA 3NS8A 1WM3A 3AB5A 3AV8A 4YSXB 3L13A 2ZVNA 2LVPA 1TTNA 2BVCA 3O65B 2N9EB 3JSVB 1IBXB 2KAJA 1UNSA 4NJCA 1L7YA 5AZGA 1HTOA 4GGQA 2IO2B 4B95A 3OG5A 2MQJA 1SEBD 3AN1A 2KWVB 3P4SB 2KFKB 5C2TB 1D5MC 4CHKA 1YN4A 4M8NA 2GBMA 1D5XC 4DDGD 4AOFA 1SB3C 1I35A 5I4DA 4ICUA 1LXDA 1WXMA 1QF6A 2ASQA 3MHZA 4IWOA 4R3DA 2FUHB 4AJYB 2NCNA 3HIZA 2QMTA 4NY0A 1QQRA 2DBYA 3EFUA 4M02A 1KF6B 1WJ4A 3V05A 4KX6B 2QIEB 2JZPA 3ZJTA 1SIFA 3AH7A 3W1SC 4OZAA 1YJ1A 4UDUC 2KDMA 3ZNZB 4W9GA 4MT5A 3ZXRA 3U8ZA 2YLMA 3RNAC 3RNFC 2MA9B 3H7SA 3FILA 1WGDA 5CTRC 3PT2B 4S17A 3WAMA 1JALA 1R4MI 5GMVA 4C7YA 1PFDA 4DHJB 1WGYA 3N20C 3BK2A 3QA8A 1STEA 4FHKA 2WXRA 5CX3A 1V1PA 2JF5A 2V9HA 1PQSA 2JRIB 4GU2A 4IKGA 1YQ3B 3L16A 5EE1A 3ZDMC 1GB4A 1L0YB 1ZGUB 1WYWB 2XK5B 2OJRA 4RGOS 1MI0A 2Z0DB 4USAA 4ZRPA 3VTUA 3DCGA 1PDXA 4I6LB 2MP2B 1DYQA 1UGMA 4IUMB 3P42A 1V97A 2MJEA 4EZLA 5FKAC 1WRDB 2WXKA 2WX0A 4CO7A 2G45B 3GB1A 1E6EB 1KOTA 2M17A 4ZYNA 1YN5A 4BOSC 3ZNID 4NAWB 2IPKD 2KDEB 1WXAA 3AECB 1BUIC 1WXQA 1XLPA 4P1BC 1BMLC 2FBWB 1TY2A 2DYOA 1EWCA 4HROA 1TZ1A 2KLGA 2INCC 5J17A 3C0RB 2I1JA 2DHZA 1YIWA 2NBVB 3UGBB 2QDFA 2KNBA 3PRMB 2I38A 3QWZB 5D3IB 1WFYA 4FXCA 4K7WA 1SE9A 1OGWA 2MBBB 2DENB 1WZ0A 4MDKE 4M00A 4NJ6A 4K1RB 2LUEA 1SJED 3NJTA 3B08A 1WF9A 1SE3A 1WXVA 2NPTA 3P4QB 3HHMA 1JROA 3DPDA 3PTFC 1CZPA 2BS4B 1EF5A 1QKZA 4WURA 4W9LA 4WWMA 2GBRA 5CHFA 3P63A 3VQIA 1DGJA 2PLPA 2OEDA 3RNBC 2Y5PA 4EZKA 2KANA 1RFAA 4C4VA 2WXPA 3GE3C 3RNGC 2XBBC 1HQRD 1TS4A 3I57A 3ZTCA 4KIKB 2C60A 1NBFC 4XYCA 2B76B 1EU3A 1TZOA 2Y3AA 3A33B 3A1QB 5JHBA 1OQYA 3V6CB 2MJ3A 2AL3A 1P0RA 4XZ4A 3NVZA 2KMAA 5MPOA 4I6NB 4XWTA 1B1ZA 3RFZB 1IGDA 2A4ZA 2EMTA 3U2SC 3J9CA 1RLFA 2KJHB 1OEYJ 1E7VA 1NI2A 3TMPB 4G0NB 2J7QB 3HRDD 2MHJA 2WXGA 5J2RA 5EE9A 3R7RA 2J4XA 2QSDA 1J7CA 4F1SA 1C79A 2E6XA 3PPAA 3DVNV 1QZEA 3ZJUA 3NZ3A 2SAKA 1AYFA 2PTLA 3GZNI 1Q1OA 1T0QC 1Z5SB 1NENB 3DQVA 5CHVC 4BFRA 1BXTA 1EUVB 3EGRA 5D94A 2IYDB 1D6EC 2N0SB 3Q69A 1NYQA 4ZRIA 1P3QU 2QEJC 1G6JA 1I4PA 3LB8C 1V2YA 4BKSD 2BF8B 2C7MB 1FCLA 4JWUC 4MH8A 1HA5A 4K3BA 1L4ZB 3ZDTA 2Q5WD 3I9V1 2N1VA 2FCSA 2V3NA 3QK0A 1NDDA 4LNNA 2DZKA 4WWPA 2KLCA 3N32A 2JY6A 2K3UA 3ONSA 3WANA 1YX6B 5IKCM 5BMGA 2C7NB 4FJVB 2PE9A 3PV1A 4XDDA 2DYMA 2WS3B 5DPSA 3AEBB 3MP9A 2WXLA 4KZ0A 2DWQA 3VTWA 1MVKA 4D2KA 2DZMA 1N62A 3LXFA 1ZP0B 1DOXA 4HXDA 2YEPB 4GIVA 1UWMA 2QILA 1ET6A 1I4HA 3RD2A 2KZRA 5KHQA 4MM3B 4LNFA 2K39A 1JWBD 4NAMA 2NS5A 5E6PA 3U4EG 3FAHA 1RAXA 1UH6A 2JQRB 3TL5A 2N7JA 3CMMB 3GP7A 5DPWA 3DVGX 4MH0E 2BYTA 2MBHA 4OW0A 3VUWA 1ZDVA 3HVDA 1EU4A 2ZVOA 3BVGA 3ZO5B 3V62A 1SXTA 4RMAA 2GRIA 4YL8A 2N1WA 4JX1C 4ZDVA 3IT4B 2K6DB 2LMCA 1VJKA 1FNUA 4RM8A 3H7PA 1TYGB 1N61A 3B0AA 3A9KA 2KVZA 2K8CA 4HPLB 1L6UA 4YTMB 2A5UA 2G9HD 2VZKD 4EFOA 4WQMA 2QHOA 4EOYA 2JSVX 2ON8A 1ZDXA 2WGSA 1AWDA 1IGCA 1YX5B 3P4RB 3BIID 3PLVA 4GMVA 1YJJA 2J52A 5D7GA 4HVBA 2KFJA 3ML8A 3PS6A 3M95A 1C4CA 4FBJB 2EKIA 3RNEC 4US8A 1L0XB 2INDC 5H8YE 2K25A 3AE5B 3MJWA 1E5WA 2O6VA 4GDKA 1GC7A 5IA7A 1JWAD 2K9XA 5G2NA 3AE4B 1VR9A 3VH3B 3EECA 2WDRB 4HKZE 2EELA 3VVWB 3BVZA 3C19A 2YVCA 1ENFA 4W9HA 4KGSA 5G5GA 2ZCBA 3C8YA 3X23A 2NBUA 3V60A 2ZNVB 4KZCA 1XLOA 3QAQA 1LFDA 4RF1A 1FNVA 4LNOA 4JPSA 5BMHA 2I1KA 3B2FA 4ARCA 1E7PB 1MG8A 3JVZX 1N5XA 3Q8BA 3EFCA 1IPGA 3HVZA 4REZA 3NVWA 1TS2A 5HG2A 1WR6E 2WXOA 1I4QA 4YXDB 1FXTB 4IC7B 1SIJA 1UWXA 4B9KA 3DVGY 1AARA 1P7FA 2J0MA 4LJOB 1L4DB 1XCQL 2CU1A 4MJSB 1FRRA 3OLMD 3PZ7A 2IGGA 3AEEB 1WM2A 2AQ3B 4NNJB 5T8IA 5LLIA 3Q6BA 4WJQA 1UUPA 3GZNB 1XO3A 4E71A 1FXAA 3L0WB 2W3RA 4ZHPA 1MJDA 1WGKA 3KQ4A 2MEKA 3ALBA 5JXVA 2CHWA 3IT6B 2IGHA 2O6VD 2Y5BB 4L1BA 3DHGC 4US9A 5IN7A 3VFKA 4C00A 2L0FA 2R2QA 4IM3A 2QC8A 1OFFA 3S2AA 4AJWA 4FULA 2NBWB 1WE6A 1C3TA 4PK1A 3TUOA 3AE2B 5HHDG 4DHJD 2BS2B 3BVMA 2LJIA 4K7SA 4FHJA 2J0KA 1WX7A 3SFEB 2KKCA 3DOWA 2JRHA 2BKFA 3Q3OC 2VRRB 3W5VB 1TKEA 4HKQA 1V8CA 3ZKJC 4ZRKA 1YJIA 1YQ4B 3U7DA 2RDGA 4HWIB 1VRAB 3CSTA 3ZTDA 4ICVA 2K0PA 1SGHA 4DWFA 1QOAA 3A4RA 3CIRB 3I63C 2MBEA 2IZVB 4I6PA 4JWSC 5LXHA 3DBSA 1F9JA 2KYWA 1QOFA 2L7RA 3O13A 4X57B 3AU4A 4WJOA 4A9AA 1Q10A 3KH0A 1FM0D 2H89B 2JX5A 2XNAC 3FKYA 3L54A 3RT3B 3U7ZA 1GAQB 2VH1A 2GBNA 1WYGA 4BOZB 1ESFA 1L6VA 1J19A 2INPE 2EKEC 2JVCA 3RPFC 4HDQA 1VLBA 3SFDB 1F1HA 2CS4A 3RI7C 4KGTA 2PPHA 4GDLA 4HJGE 4YT0B 5IO9A 2DZIA 4W9JA 5HFYA 1JWSD 3WA0A 2KO3A 3KYCD 2QCZA 1PGAA 1TBEA 2LRUA 1TY0A 2WXMA 3WAOA 4E74A 2N9KA 2KC1A 2LGDA 3VDZA 1N60A 1P98A 1WGRA 3DBRB 2I2YA 3ABVB 2W55A 4HJKA 2O2VB 3KW5B 3Q3FA 1VZ6A 2DAJA 1MHXA 4W9EA 1HE8A 3TSSA 3UQBA 4A20A 1ZXHA 3CF6E 2N4FA 2HDEA 1WRIA 1XD3B 3H8HA 4EEWA 2GBKA 4AP4C 2FNJB 3KYDD 5C1ZA 2RMMA 4MGKE 4PS7A 2AX5A 1C77A 5L83A 3KUCB 4WH4A 4K3CA 2WX1A 3VRAB 4M0WB 1XXGA 3SDLC 3BYTB 3URYA 3N1ZC 2PEAA 2RGFA 4QAYA 2N9LA 2LASA 1P7EA 4ITKA 3ZNGC 1I42A 3AMZA 5D2MB 1C4AA 2GMIC 2MH7A 5AUKA 4BZAA 3WIMA 2KWCA 2JYTA 3OJ3A 2IGDA 3DBHI 2C9WB 2CU3A 2BT6A 5IAAC 3L10B 1CK1A 3TBLD 3A9JA 3NZSA 1TIFA 1S1QB 1ROEA 1V6EA 2OJWA 4E3CA 4A55A 5FR6A 4BKGA 1OQQA 3E9SA 1PYWD 4AS1A 4YWGG 4W9CA 3OWEB 2L8JA 5L95C 1I7HA 2LGYA 3H6NA 5LNK1 3TEYA 4OVVA 4BKSA 4TQ0A 3QX1A 2JWUA 2LZ6A 3GE8C 4JGHB 3HK0A 3VTVA 2DZJA 1T0RC 2WXHA 3TEZA 1RYJA 5FK9C 3VAWA 5HI1A 1ZUD2 2TSSA 1GB1A 2MWSB 2CKHB 5LXIB 2REXA 3TEXA 4PYZA 4PS3A 3KVFB 2V0GA 2WQYB 1FNWA 3ZJVA 1MG4A 2MSED 1SE2A 1TT5B 3IXSA 2FCQA 1KM7A 2G4SA 1V5TA 4HPMB 3VRBB 4DHZE 1WZ3A 2IO0B 2WP9B 2ZPNA 1EWYC 4LDTD 1KRHA 1K52A 3FILB 3IAS1 2X8XX 2D3CA 4F8CB 1WMHA 2PKOA 4YSZB 1WWTA 1VCBA 3VUXA 2M56B 1K8RB 5CHWA 2NMQA 2DNFA 4DXFA 4HCNB 1V1PB 4PS8A 4B0EA 2WDTB 3ZIMA 2W3SA 2JU6X 1C1YB 2XN9C 1TS3A 1TGZB 2K22A 2KACA 1JMLA 3A4SC 4WAFA 4G11A 3DHIC 3AE6B 2LVOA 3RULA 3UI3A 1AN8A 2C5LC 2MCNB 1F2RC 2GOWA 5G5HA 4A3OA 1ZE3D 4IM0A 3AEFB 4IOIE 1YMHE 3LYYA 4W9FA 4PT5A 2N9XA 1TS5A 4YTNB 1E9MA 3H1UA 3RN9C 2W9NA 4OZBA 1KH0A 2G1EA 4J3OD 4YSYB 2IY0B 3DDCB 1E8YA 4BAXA 3ECIA 2BWES 1D3ZA 1E8XA 2M0AA 1YD8U 2NVUI 1MHHE 1ZOYB 4KV2A 4MSQB 4HK2A 4OVUA 1D5ZC 2KDFB 2BS3B 2KXJA 1F52A 2FCNA 4HLEA 1QILA 3APDA 1WX9A 3UIOB 2LD9A 1OTRB 1V80A 1XLQA 2BYFA 2FIFA 3AEDB 1V9JA 3RUIB 1ZW7A 2BGFA 4P1CC 3HM3A 2L83A 1SE4A 3PHXB 2KN5A 3IVFA 1FIQA 2ZJDA 2NPTB 4XX5A 1CQVA 2K5PA 3R3MA 4AUQC 3TIXA 2DX5B 3AE3B 2BBCA 1LQBA 2MLBA 4JE3B 1HXYD 3RCZA 2CJNA 3K9PB 2D2QA 2D3GA 3GS2A 2GB1A 4XE0A 3ZQ4A 2D11A 2BB5A 3TEWA 3CWIA 2BKRB 3EHVA 3ML9A 4C4VB 1K50A 2Z8LA 3AE8B 3JSVA 4KDIC 2GBJA 2PJHA 2RD0A 2HJ1A 2JUOA 4F7ZA 4A8XC 1ISNA 3DBHB 2YEPF 1XLNA 2IY1B 4IWPA 2WXNA 4WAAA 3QARA 1FFVA 4XC2A 2KFKA 1M4VA 3ZVVA 3EA6A 4MEMA 4C7ZA 1UGJA 4NPNA 2LEKA 2KMCA 2KT7A 3DBRI 4TV3A 5EDSA 2ZEQA 2KD0A 3SHQA 1HZ5A 1N63A 4DXAB 3AE1B 4FADA 2EMSA 2L3ZA 3BY4B 4O1NA 2ZCCA 2LXCA 3X0WA 3JYUA 3ZNHB 3ZXVA 2IDYA 1ET9A 2HTME 2KX3A 3IFWB 1J7BA 2K8BA 3NHEB 3AU5A 1T0YA 1GNUA 1NYRA 2D07B 3SU8X 2JPHA 2UU7A 2N7EA 1XEEA 3UINB 2J42A 1LGRA 3DHHC 2FUG1 1NI3A 4LTUA 2RDHA 2WYQA 2FAZA 4G50A 1OQRA 1B9RA 2J0JA 2KTFA 2BYEA 1L5PA 3ZW3A 2XK5A 1LM8B 4XGAB 2ZZPB 2L52A 1GC6A 3NS1A 4ASWC 2M1MA 2V1YA 4P7IA 3N9YC 3OAWA 2MP2A 1DOYA 1E90A 4W9DA 4GSWA 4JLCA 2KWUB 2OHFA 3T3NA 3KUDB 4KVGB 4BBNF 3PVLA 3L4PA 2KDBA 1RWSA 1ZPSA 2PVGC 1QLBB 2K6QA 4NAWA 4XWWA 4IWQA 1Y56A 2GI9A 3R66C 2ACZB 5BYSA 2HTHA 3V6EB 3T8MA 4ACFA 5DPRA 4ANWA 1GUAB 1UELA 1FEHA 2M4NA 3W1YA 4ZRJA 3QQ8B 2BWFA 3B9JA 3MC9A 3BYYB 1Z2MA 1ZKHA 4MACA 2V3SA 4FLHA 1GOZA 4W9KA 1ACCA 1P9DU 2KX0A 2W82A 3TJPA 3R2IA 5E6JA 1TKYA 2WU2B 3DBLI 5BYRA 5TSSA 3QHTA 3V3XA 4GB9A 1J7AA 1YQBA 2H88B 2SEBD 1GPXA 3UF8A 3QIJA 2MW5A 4RH6A 1E7UA 2VH2A 3ZYYX 1XQQA 1IUEA 2LHEA 4BVUC 2J53A 1C78A 4GLSC 1T3QA 4KGRA 3W9CB 4DQOC 2ZW0A 1UZXB 4HCPB 2E3TA 3H7PB 1UD7A 1FMAD 2D10A 1WGHA 3U52E 3PREA 3A9KB 4IM2A 3T9LA 2WXQA 1KJTA 3EUB2 1U4AA 3IHPC 3VR9B 1P1AA 3HM6X 1Q5WB 1FO4A 4H2AA 4LK0M 1HZ6A 2LGIA 2LVQA 2IBIB 4FJZA 4KIKA 2Y5CA 1J0GA 1WIAA 2MBQA 1KLVA 3P2BA 2RSUA 3A1QA 3AM9A 5BMIA 3VHTC 1WY8A 1TJEA 3AULA 2HE7A 4BBNC 2KJ6A 3PRPB 4WJPA 1JW9D 2LXAA 2O6VB 1IP9A 3Q8EA 2LJ5A 4GDKB 2MBOA 2LGXA 2V4LA 5BYQA 3BK1A 3P1MA 2KJRA 2KN4A 2NTSA 1WSPA 2UYZB 3L08A 4HRSA 5AUIA 1T5XD 2ZNVC 4YTPB 4NQKE 3AXCA 1FRDA 2KVRA 2PMVA 2JT4B 5DPTA 4LLGM 4FA6A 2WHIA 5IOIA 1F0ZA 2G4DB 3N1XC 4A6QA 3L17A 5EE0A 2AWTA 4WWNA 1VD2A 4WIPA 2CHZA 3NVVA 4P16A 1A5RA 2IJ0A 4MELA 5TR5A 2LGSA 1I4GA 2L32A 1WGGA 3UQAA 4WWOA 3FC4A 2WU5B 3PZ8A
chains in the Genus database with same CATH topology
2IO3B 1H4RA 3NS8A 1TGZB 1WM3A 2QHOA 3A4SC 4EOYA 4G11A 2LVOA 3L13A 2ZVNA 4KDLB 2LVPA 1TTNA 3RULA 4M8MA 3O65B 2C5LC 2N9EB 3UIPB 3JSVB 2MCNB 1YX5B 2GOWA 4A3OA 3PLVA 4IM0A 4GMVA 1L7YA 5AZGA 5D7GA 4HVBA 4GGQA 5JH5C 2KFJA 3ML8A 2IO2B 4B95A 3JW0X 2MQJA 3N3KB 3PS6A 2KTRA 3M95A 2KWVB 4W9FA 2PE6B 4FBJB 3IBEA 2N9XA 2FIDA 2KFKB 2IO1B 1RRBA 3H1UA 2K25A 3MJWA 4CHKA 2W9NA 1E5WA 2O6VA 4J6IA 2MX2A 2GBMA 2L05A 4GDKA 4M8NA 4AOFA 1GC7A 4DDGD 4EKUA 5IA7A 5J18A 5G2NA 2IY0B 1I35A 3DDCB 3VH3B 1E8YA 3EECA 4ICUA 2Z0EB 3VVWB 4II3B 1LXDA 5AZHA 1WXMA 3ECIA 2BWES 2CHXA 2ASQA 2YVCA 1E8XA 4MM3A 4W9HA 1D3ZA 1YD8U 2NVUI 2ZCBA 3X23A 4IWOA 2NBUA 4KV2A 4MSQB 3LJ3A 3V60A 2FUHB 1M94A 2ZNVB 3QAQA 2KQ7A 4KZCA 2NCNA 4FN2A 4HK2A 3HIZA 1LFDA 4OVUA 4AJYB 4NY0A 1WR1A 2I1KA 2KDFB 3EFUA 5E6OA 1MG8A 2KXJA 3JVZX 3K9OB 2FCNA 1WJ4A 4HLEA 1SIFA 3W1SC 3EC8A 3APDA 1WX9A 1IPGA 3UIOB 1WI0A 1OTRB 1YJ1A 2LD9A 3ZNZB 4W9GA 3MHSD 1S3SG 1V80A 3U8ZA 1WR6E 2BYFA 2FIFA 2YLMA 2MA9B 3H7SA 1FXTB 1WGDA 1V9JA 4IC7B 3RUIB 5CTRC 3PT2B 1ZW7A 2BGFA 3N30A 3WAMA 4B9KA 3DVGY 1AARA 3HM3A 2J0MA 4LJOB 2XEWA 1R4MI 5GMVA 3PHXB 2KN5A 3IVFA 2CU1A 4MJSB 4DHJB 1WGYA 3OLMD 3QA8A 2ZJDA 2NPTB 4FHKA 4K81A 5HKHA 4XX5A 5CX3A 1WM2A 2JF5A 4BKTA 1PQSA 4NNJB 2JRIB 3R3MA 4GU2A 4AUQC 5LLIA 4IG7B 3TIXA 2DX5B 1OEYA 4WJQA 3L16A 3ZDMC 4E71A 4PYUA 1ZGUB 1WYWB 4DDID 2XK5B 1LQBA 2FCMA 2MLBA 2OJRA 1EO6A 3L0WB 4RM9A 2KK8A 2Z0DB 3RCZA 3VTUA 3K9PB 3DCGA 5DCNA 2MRPA 2KC2A 2D2QA 2BYVE 4I6LB 4WQOB 2D3GA 2DAFA 2MP2B 2D11A 4GDLB 4LJPB 1V5OA 4GXBA 1UGMA 2BKRB 3ALBA 2AYOB 3EHVA 4IUMB 3ML9A 4ANXA 2CHWA 1UBQA 4EZLA 2LRWA 1WRDB 3JSVA 4KDIC 2GBJA 2O6VD 2WX0A 2PJHA 2Y5BB 4CO7A 2RD0A 2JUOA 4ANUA 2G45B 4F7ZA 1KOTA 3VFKA 1ISNA 1X1MA 3CSFA 4GN1A 2M17A 4ZYNA 2L0FA 2R2QA 4LCDE 4BOSC 3ZNID 4IM3A 4NAWB 2KDEB 1WXAA 3S2AA 4AJWA 2IY1B 4FULA 4IWPA 2NBWB 1WE6A 4WAAA 3QARA 4XC2A 1C3TA 2KFKA 3ZVVA 4MEMA 4KSLC 4DHJD 3W1SA 2DYOA 4K7SA 4FHJA 3M62B 4NPNA 2J0KA 4HDOA 4JL9A 2KMCA 1WX7A 1TZ1A 3DBRI 2KLGA 4TV3A 5EDSA 2KKCA 2ZEQA 5J17A 3VUYA 3DOWA 3C0RB 4TKNA 2KD0A 3SHQA 2K8HA 1E8ZA 2I1JA 3BINA 3PSEB 2JRHA 3PZDA 5AZFA 2BKFA 4DXAB 2VRRB 2L00B 2EMSA 2RPQA 4CYEA 2L3ZA 4FADA 3BY4B 2DHZA 1YIWA 3ZKJC 2ZCCA 2RR9A 4ZRKA 3V61A 2NBVB 2LXCA 3UGBB 3X0WA 2UWQA 2HJ8A 3U7DA 1R4NI 2KNBA 4HWIB 3SD5A 2OOBB 3U30A 3CSTA 3ZRFA 3JYUA 4DHZB 1J8CA 3ENEA 3PRMB 3ZTDA 4GOCA 3ZNHB 3NY5A 3QWZB 2M8SA 2Z59B 1BT0A 4ICVA 2L76A 1SGHA 2KX3A 4TUUA 1WFYA 4K7WA 3WALA 4DWFA 3QCAA 1SE9A 1GJZA 1OGWA 3IFWB 2K8BA 3AI5A 3A4RA 2MBBB 3NHEB 2DENB 3AU5A 1T0YA 1GNUA 1WZ0A 4JIOU 4MDKE 4NJ6A 2MBEA 2IZVB 2D07B 4I6PA 5LXHA 3DBSA 3SU8X 2JPHA 4K1RB 1F9JA 2LUEA 2BPSA 2N7EA 2AEHA 2L7RA 3APCA 4X57B 3UINB 3AU4A 1WX8A 4WJOA 3TCAA 3B08A 4MJSA 4EUTA 1WF9A 3KH0A 1WXVA 2NPTA 2WYQA 2FAZA 4G50A 4WJNA 3PLUA 2JXXA 3HHMA 2J0JA 3DPDA 3PTFC 2KTFA 3L54A 3RT3B 2BYEA 1EF5A 4LDTB 4W9LA 2GBNA 4BOZB 3ZW3A 2XK5A 1LM8B 2GBRA 5CHFA 3B1LX 1J19A 2ZZPB 2KTRB 1IYFA 2EKEC 1GC6A 2JVCA 2ZPYA 2B3AA 3VQIA 4ASWC 4HDQA 2M1MA 2V1YA 2KQSA 4P7IA 3OAWA 4TQ1A 2MP2A 5BO4B 2CS4A 1E90A 4W9DA 4GSWA 4JLCA 3A9JB 2PPHA 4GDLA 1WJ6A 2KWUB 2DZIA 4EZKA 4W9JA 2KANA 1RFAA 3KUDB 4KVGB 3QJZA 4BBNF 5JHAA 1GG3A 3WA0A 3ZUNA 3PVLA 2XBBC 2KO3A 3KYCD 3M3JA 1TBEA 2KDBA 2LRUA 3VH4B 3ZTCA 4KIKB 2C60A 1NBFC 4MGIE 3WAOA 4E74A 4AWJA 2K6QA 2NR2A 4NAWA 2KC1A 4NJ7A 4W9IA 4IWQA 2LGDA 3A33B 5JHBA 2K1FA 3A1QB 1OQYA 3R66C 3V6CB 5AEKB 3VDZA 2AL3A 2HTHA 3V6EB 1P0RA 1P98A 3T8MA 4XZ4A 1WGRA 5DPRA 3OJ4B 1GUAB 4ANWA 1UELA 2CR5A 3MTNB 2KMAA 3NOBA 4I6NB 2M4NA 4HJKA 2O2VB 3W1YA 3KW5B 4ZRJA 3QQ8B 2BWFA 3Q3FA 4DBGA 2DAJA 1Z2MA 3APFA 1Y8RC 1ZKHA 4W9EA 2V3SA 2EMTA 2A4ZA 4FLHA 1HE8A 3Q3JA 1RLFA 2LWPA 3UQBA 2KJHB 1OEYJ 4A20A 1E7VA 3CF6E 4W9KA 1NI2A 2N4FA 3TMPB 4G0NB 2J7QB 5J2RA 4URKA 1XD3B 1P9DU 2KX0A 3TJPA 4MGZE 3R7RA 3RYTA 1H8CA 4JQWC 4EEWA 2GBKA 4AP4C 2FNJB 3DBLI 4B6WA 2KDIA 4F1SA 2KHWB 3PHWB 3QHTA 3PPAA 3DVNV 3KYDD 1QZEA 4GB9A 5C1ZA 4MGKE 1YQBA 4PS7A 3RZFA 4NQLB 3GZNI 3UF8A 3QIJA 1Q1OA 2MW5A 1E7UA 1CMXB 3KUCB 5L83A 3ZLZA 1V81A 1XQQA 1Z5SB 3DQVA 2WX1A 5CHVC 1EF1A 4M0WB 4BFRA 1EUVB 3SDLC 3QC8B 5D94A 1WMHB 4BVUC 2IYDB 2N7DA 4ZRIA 1P3QU 1UZXB 1G6JA 2PEAA 1V2YA 4BKSD 2BF8B 3IG3A 4G3XB 4HCPB 2LI5A 2C7MB 2RGFA 5E6NA 3H7PB 1UD7A 1WH3A 2D10A 3ZDTA 1WGHA 2LASA 3ZNGC 1I42A 3PREA 2N1VA 3A9KB 2FCSA 5D2MB 3QK0A 1NDDA 2GMIC 2DZKA 4IM2A 4WWPA 1E8WA 2KLCA 2KWCA 2JY6A 3N32A 3T9LA 3WAPA 3WIMA 2KOXA 2C7HA 3D32A 3OJ3A 3DBHI 2C9WB 1KJTA 3KUZA 3ONSA 5IAAC 3L10B 1U4AA 3WANA 1YX6B 5C23A 3TBLD 3IHPC 2AL6A 3A9JA 3NZSA 4A3PA 1P1AA 2C7NB 3PRZA 1S1QB 1WE7A 4FJVB 1V6EA 3HM6X 2N9PC 3PGEA 1Q5WB 4E3CA 2PE9A 3PV1A 5FR6A 4ANVA 2DYMA 2LVQA 2WWZA 2IBIB 4FJZA 4BKGA 5DPSA 4KIKA 1J0GA 3DVNU 1WIAA 2JWZA 3H9DA 2MBQA 4W9CA 1L2NA 3NZUA 1WJUA 2L8JA 4KZ0A 3R7QA 5L95C 1KLVA 3VTWA 3P2BA 2RSUA 3A1QA 2LGYA 3VHTC 1WY8A 3AULA 2HE7A 3H6NA 4KSKC 4BBNC 2KJ6A 3PRPB 4WJPA 2DZMA 4N9F4 2LXAA 4OVVA 4BKSA 4DK5A 2G3QB 2O6VB 1IP9A 4TQ0A 4GDKB 2LJ5A 2MBOA 3QX1A 4HXDA 2LZ6A 2O2VA 4JGHB 3HK0A 4II2B 2LGXA 5D6JB 2V4LA 4GIVA 1V49A 3VTVA 2DZJA 2KJRA 2UYZB 3L08A 1JRUA 3VAWA 3RD2A 2R2OA 1WJNA 4IW0A 2KZRA 2CKHB 2MWSB 5KHQA 5LXIB 1V86A 2REXA 4K7UA 4PYZA 4PS3A 2K39A 2ZNVC 3KVFB 4NQKE 1XT9B 2NS5A 3AXCA 5E6PA 2KVRA 2HD5B 3ZRCA 2MSED 2JT4B 2JZ3B 5DPTA 1RAXA 3M63B 1UH6A 2FCQA 1KM7A 1WXSA 2G4SA 4FA6A 1V5TA 4HPMB 4DHZE 3TL5A 1WZ3A 2IO0B 3CMMB 2ZPNA 3GOEA 4MGYE 3LDZE 2G4DB 2M0XA 5DPWA 3DVGX 4LDTD 4MH0E 4MSMB 5KHOA 2MBHA 3VUWA 3L17A 2AWTA 4WWNA 1VD2A 2ZVOA 3I3TB 3ZO5B 2CHZA 3V62A 1WMHA 4RMAA 4F8CB 5JZEB 4YL8A 2N1WA 1VCBA 3VUXA 1A5RA 5G55A 4MELA 1K8RB 4ZDVA 5CHWA 4FJYA 5TR5A 2K6DB 2JZZA 4HCNB 4PS8A 4RM8A 3H7PA 2DYBA 4EZJA 1Q0WB 3B0AA 3RZWC 3A9KA 1WGGA 2K8CA 4HPLB 2WDTB 3UQAA 4WWOA 2L0TA 3ZIMA 1UBIA 3VXWA 1C1YB 2A5UA 4EFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  1H4R A;  3NS8 A;  1TGZ B;  1WM3 A;  2QHO A;  3A4S C;  4EOY A;  4G11 A;  2LVO A;  3L13 A;  2ZVN A;  4KDL B;  2LVP A;  1TTN A;  3RUL A;  4M8M A;  3O65 B;  2C5L C;  2N9E B;  3UIP B;  3JSV B;  2MCN B;  1YX5 B;  2GOW A;  4A3O A;  3PLV A;  4IM0 A;  4GMV A;  1L7Y A;  5AZG A;  5D7G A;  4HVB A;  4GGQ A;  5JH5 C;  2KFJ A;  3ML8 A;  2IO2 B;  4B95 A;  3JW0 X;  2MQJ A;  3N3K B;  3PS6 A;  2KTR A;  3M95 A;  2KWV B;  4W9F A;  2PE6 B;  4FBJ B;  3IBE A;  2N9X A;  2FID A;  2KFK B;  2IO1 B;  1RRB A;  3H1U A;  2K25 A;  3MJW A;  4CHK A;  2W9N A;  1E5W A;  2O6V A;  4J6I A;  2MX2 A;  2GBM A;  2L05 A;  4GDK A;  4M8N A;  4AOF A;  1GC7 A;  4DDG D;  4EKU A;  5IA7 A;  5J18 A;  5G2N A;  2IY0 B;  1I35 A;  3DDC B;  3VH3 B;  1E8Y A;  3EEC A;  4ICU A;  2Z0E B;  3VVW B;  4II3 B;  1LXD A;  5AZH A;  1WXM A;  3ECI A;  2BWE S;  2CHX A;  2ASQ A;  2YVC A;  1E8X A;  4MM3 A;  4W9H A;  1D3Z A;  1YD8 U;  2NVU I;  2ZCB A;  3X23 A;  4IWO A;  2NBU A;  4KV2 A;  4MSQ B;  3LJ3 A;  3V60 A;  2FUH B;  1M94 A;  2ZNV B;  3QAQ A;  2KQ7 A;  4KZC A;  2NCN A;  4FN2 A;  4HK2 A;  3HIZ A;  1LFD A;  4OVU A;  4AJY B;  4NY0 A;  1WR1 A;  2I1K A;  2KDF B;  3EFU A;  5E6O A;  1MG8 A;  2KXJ A;  3JVZ X;  3K9O B;  2FCN A;  1WJ4 A;  4HLE A;  1SIF A;  3W1S C;  3EC8 A;  3APD A;  1WX9 A;  1IPG A;  3UIO B;  1WI0 A;  1OTR B;  1YJ1 A;  2LD9 A;  3ZNZ B;  4W9G A;  3MHS D;  1S3S G;  1V80 A;  3U8Z A;  1WR6 E;  2BYF A;  2FIF A;  2YLM A;  2MA9 B;  3H7S A;  1FXT B;  1WGD A;  1V9J A;  4IC7 B;  3RUI B;  5CTR C;  3PT2 B;  1ZW7 A;  2BGF A;  3N30 A;  3WAM A;  4B9K A;  3DVG Y;  1AAR A;  3HM3 A;  2J0M A;  4LJO B;  2XEW A;  1R4M I;  5GMV A;  3PHX B;  2KN5 A;  3IVF A;  2CU1 A;  4MJS B;  4DHJ B;  1WGY A;  3OLM D;  3QA8 A;  2ZJD A;  2NPT B;  4FHK A;  4K81 A;  5HKH A;  4XX5 A;  5CX3 A;  1WM2 A;  2JF5 A;  4BKT A;  1PQS A;  4NNJ B;  2JRI B;  3R3M A;  4GU2 A;  4AUQ C;  5LLI A;  4IG7 B;  3TIX A;  2DX5 B;  1OEY A;  4WJQ A;  3L16 A;  3ZDM C;  4E71 A;  4PYU A;  1ZGU B;  1WYW B;  4DDI D;  2XK5 B;  1LQB A;  2FCM A;  2MLB A;  2OJR A;  1EO6 A;  3L0W B;  4RM9 A;  2KK8 A;  2Z0D B;  3RCZ A;  3VTU A;  3K9P B;  3DCG A;  5DCN A;  2MRP A;  2KC2 A;  2D2Q A;  2BYV E;  4I6L B;  4WQO B;  2D3G A;  2DAF A;  2MP2 B;  2D11 A;  4GDL B;  4LJP B;  1V5O A;  4GXB A;  1UGM A;  2BKR B;  3ALB A;  2AYO B;  3EHV A;  4IUM B;  3ML9 A;  4ANX A;  2CHW A;  1UBQ A;  4EZL A;  2LRW A;  1WRD B;  3JSV A;  4KDI C;  2GBJ A;  2O6V D;  2WX0 A;  2PJH A;  2Y5B B;  4CO7 A;  2RD0 A;  2JUO A;  4ANU A;  2G45 B;  4F7Z A;  1KOT A;  3VFK A;  1ISN A;  1X1M A;  3CSF A;  4GN1 A;  2M17 A;  4ZYN A;  2L0F A;  2R2Q A;  4LCD E;  4BOS C;  3ZNI D;  4IM3 A;  4NAW B;  2KDE B;  1WXA A;  3S2A A;  4AJW A;  2IY1 B;  4FUL A;  4IWP A;  2NBW B;  1WE6 A;  4WAA A;  3QAR A;  4XC2 A;  1C3T A;  2KFK A;  3ZVV A;  4MEM A;  4KSL C;  4DHJ D;  3W1S A;  2DYO A;  4K7S A;  4FHJ A;  3M62 B;  4NPN A;  2J0K A;  4HDO A;  4JL9 A;  2KMC A;  1WX7 A;  1TZ1 A;  3DBR I;  2KLG A;  4TV3 A;  5EDS A;  2KKC A;  2ZEQ A;  5J17 A;  3VUY A;  3DOW A;  3C0R B;  4TKN A;  2KD0 A;  3SHQ A;  2K8H A;  1E8Z A;  2I1J A;  3BIN A;  3PSE B;  2JRH A;  3PZD A;  5AZF A;  2BKF A;  4DXA B;  2VRR B;  2L00 B;  2EMS A;  2RPQ A;  4CYE A;  2L3Z A;  4FAD A;  3BY4 B;  2DHZ A;  1YIW A;  3ZKJ C;  2ZCC A;  2RR9 A;  4ZRK A;  3V61 A;  2NBV B;  2LXC A;  3UGB B;  3X0W A;  2UWQ A;  2HJ8 A;  3U7D A;  1R4N I;  2KNB A;  4HWI B;  3SD5 A;  2OOB B;  3U30 A;  3CST A;  3ZRF A;  3JYU A;  4DHZ B;  1J8C A;  3ENE A;  3PRM B;  3ZTD A;  4GOC A;  3ZNH B;  3NY5 A;  3QWZ B;  2M8S A;  2Z59 B;  1BT0 A;  4ICV A;  2L76 A;  1SGH A;  2KX3 A;  4TUU A;  1WFY A;  4K7W A;  3WAL A;  4DWF A;  3QCA A;  1SE9 A;  1GJZ A;  1OGW A;  3IFW B;  2K8B A;  3AI5 A;  3A4R A;  2MBB B;  3NHE B;  2DEN B;  3AU5 A;  1T0Y A;  1GNU A;  1WZ0 A;  4JIO U;  4MDK E;  4NJ6 A;  2MBE A;  2IZV B;  2D07 B;  4I6P A;  5LXH A;  3DBS A;  3SU8 X;  2JPH A;  4K1R B;  1F9J A;  2LUE A;  2BPS A;  2N7E A;  2AEH A;  2L7R A;  3APC A;  4X57 B;  3UIN B;  3AU4 A;  1WX8 A;  4WJO A;  3TCA A;  3B08 A;  4MJS A;  4EUT A;  1WF9 A;  3KH0 A;  1WXV A;  2NPT A;  2WYQ A;  2FAZ A;  4G50 A;  4WJN A;  3PLU A;  2JXX A;  3HHM A;  2J0J A;  3DPD A;  3PTF C;  2KTF A;  3L54 A;  3RT3 B;  2BYE A;  1EF5 A;  4LDT B;  4W9L A;  2GBN A;  4BOZ B;  3ZW3 A;  2XK5 A;  1LM8 B;  2GBR A;  5CHF A;  3B1L X;  1J19 A;  2ZZP B;  2KTR B;  1IYF A;  2EKE C;  1GC6 A;  2JVC A;  2ZPY A;  2B3A A;  3VQI A;  4ASW C;  4HDQ A;  2M1M A;  2V1Y A;  2KQS A;  4P7I A;  3OAW A;  4TQ1 A;  2MP2 A;  5BO4 B;  2CS4 A;  1E90 A;  4W9D A;  4GSW A;  4JLC A;  3A9J B;  2PPH A;  4GDL A;  1WJ6 A;  2KWU B;  2DZI A;  4EZK A;  4W9J A;  2KAN A;  1RFA A;  3KUD B;  4KVG B;  3QJZ A;  4BBN F;  5JHA A;  1GG3 A;  3WA0 A;  3ZUN A;  3PVL A;  2XBB C;  2KO3 A;  3KYC D;  3M3J A;  1TBE A;  2KDB A;  2LRU A;  3VH4 B;  3ZTC A;  4KIK B;  2C60 A;  1NBF C;  4MGI E;  3WAO A;  4E74 A;  4AWJ A;  2K6Q A;  2NR2 A;  4NAW A;  2KC1 A;  4NJ7 A;  4W9I A;  4IWQ A;  2LGD A;  3A33 B;  5JHB A;  2K1F A;  3A1Q B;  1OQY A;  3R66 C;  3V6C B;  5AEK B;  3VDZ A;  2AL3 A;  2HTH A;  3V6E B;  1P0R A;  1P98 A;  3T8M A;  4XZ4 A;  1WGR A;  5DPR A;  3OJ4 B;  1GUA B;  4ANW A;  1UEL A;  2CR5 A;  3MTN B;  2KMA A;  3NOB A;  4I6N B;  2M4N A;  4HJK A;  2O2V B;  3W1Y A;  3KW5 B;  4ZRJ A;  3QQ8 B;  2BWF A;  3Q3F A;  4DBG A;  2DAJ A;  1Z2M A;  3APF A;  1Y8R C;  1ZKH A;  4W9E A;  2V3S A;  2EMT A;  2A4Z A;  4FLH A;  1HE8 A;  3Q3J A;  1RLF A;  2LWP A;  3UQB A;  2KJH B;  1OEY J;  4A20 A;  1E7V A;  3CF6 E;  4W9K A;  1NI2 A;  2N4F A;  3TMP B;  4G0N B;  2J7Q B;  5J2R A;  4URK A;  1XD3 B;  1P9D U;  2KX0 A;  3TJP A;  4MGZ E;  3R7R A;  3RYT A;  1H8C A;  4JQW C;  4EEW A;  2GBK A;  4AP4 C;  2FNJ B;  3DBL I;  4B6W A;  2KDI A;  4F1S A;  2KHW B;  3PHW B;  3QHT A;  3PPA A;  3DVN V;  3KYD D;  1QZE A;  4GB9 A;  5C1Z A;  4MGK E;  1YQB A;  4PS7 A;  3RZF A;  4NQL B;  3GZN I;  3UF8 A;  3QIJ A;  1Q1O A;  2MW5 A;  1E7U A;  1CMX B;  3KUC B;  5L83 A;  3ZLZ A;  1V81 A;  1XQQ A;  1Z5S B;  3DQV A;  2WX1 A;  5CHV C;  1EF1 A;  4M0W B;  4BFR A;  1EUV B;  3SDL C;  3QC8 B;  5D94 A;  1WMH B;  4BVU C;  2IYD B;  2N7D A;  4ZRI A;  1P3Q U;  1UZX B;  1G6J A;  2PEA A;  1V2Y A;  4BKS D;  2BF8 B;  3IG3 A;  4G3X B;  4HCP B;  2LI5 A;  2C7M B;  2RGF A;  5E6N A;  3H7P B;  1UD7 A;  1WH3 A;  2D10 A;  3ZDT A;  1WGH A;  2LAS A;  3ZNG C;  1I42 A;  3PRE A;  2N1V A;  3A9K B;  2FCS A;  5D2M B;  3QK0 A;  1NDD A;  2GMI C;  2DZK A;  4IM2 A;  4WWP A;  1E8W A;  2KLC A;  2KWC A;  2JY6 A;  3N32 A;  3T9L A;  3WAP A;  3WIM A;  2KOX A;  2C7H A;  3D32 A;  3OJ3 A;  3DBH I;  2C9W B;  1KJT A;  3KUZ A;  3ONS A;  5IAA C;  3L10 B;  1U4A A;  3WAN A;  1YX6 B;  5C23 A;  3TBL D;  3IHP C;  2AL6 A;  3A9J A;  3NZS A;  4A3P A;  1P1A A;  2C7N B;  3PRZ A;  1S1Q B;  1WE7 A;  4FJV B;  1V6E A;  3HM6 X;  2N9P C;  3PGE A;  1Q5W B;  4E3C A;  2PE9 A;  3PV1 A;  5FR6 A;  4ANV A;  2DYM A;  2LVQ A;  2WWZ A;  2IBI B;  4FJZ A;  4BKG A;  5DPS A;  4KIK A;  1J0G A;  3DVN U;  1WIA A;  2JWZ A;  3H9D A;  2MBQ A;  4W9C A;  1L2N A;  3NZU A;  1WJU A;  2L8J A;  4KZ0 A;  3R7Q A;  5L95 C;  1KLV A;  3VTW A;  3P2B A;  2RSU A;  3A1Q A;  2LGY A;  3VHT C;  1WY8 A;  3AUL A;  2HE7 A;  3H6N A;  4KSK C;  4BBN C;  2KJ6 A;  3PRP B;  4WJP A;  2DZM A;  4N9F 4;  2LXA A;  4OVV A;  4BKS A;  4DK5 A;  2G3Q B;  2O6V B;  1IP9 A;  4TQ0 A;  4GDK B;  2LJ5 A;  2MBO A;  3QX1 A;  4HXD A;  2LZ6 A;  2O2V A;  4JGH B;  3HK0 A;  4II2 B;  2LGX A;  5D6J B;  2V4L A;  4GIV A;  1V49 A;  3VTV A;  2DZJ A;  2KJR A;  2UYZ B;  3L08 A;  1JRU A;  3VAW A;  3RD2 A;  2R2O A;  1WJN A;  4IW0 A;  2KZR A;  2CKH B;  2MWS B;  5KHQ A;  5LXI B;  1V86 A;  2REX A;  4K7U A;  4PYZ A;  4PS3 A;  2K39 A;  2ZNV C;  3KVF B;  4NQK E;  1XT9 B;  2NS5 A;  3AXC A;  5E6P A;  2KVR A;  2HD5 B;  3ZRC A;  2MSE D;  2JT4 B;  2JZ3 B;  5DPT A;  1RAX A;  3M63 B;  1UH6 A;  2FCQ A;  1KM7 A;  1WXS A;  2G4S A;  4FA6 A;  1V5T A;  4HPM B;  4DHZ E;  3TL5 A;  1WZ3 A;  2IO0 B;  3CMM B;  2ZPN A;  3GOE A;  4MGY E;  3LDZ E;  2G4D B;  2M0X A;  5DPW A;  3DVG X;  4LDT D;  4MH0 E;  4MSM B;  5KHO A;  2MBH A;  3VUW A;  3L17 A;  2AWT A;  4WWN A;  1VD2 A;  2ZVO A;  3I3T B;  3ZO5 B;  2CHZ A;  3V62 A;  1WMH A;  4RMA A;  4F8C B;  5JZE B;  4YL8 A;  2N1W A;  1VCB A;  3VUX A;  1A5R A;  5G55 A;  4MEL A;  1K8R B;  4ZDV A;  5CHW A;  4FJY A;  5TR5 A;  2K6D B;  2JZZ A;  4HCN B;  4PS8 A;  4RM8 A;  3H7P A;  2DYB A;  4EZJ A;  1Q0W B;  3B0A A;  3RZW C;  3A9K A;  1WGG A;  2K8C A;  4HPL B;  2WDT B;  3UQA A;  4WWO A;  2L0T A;  3ZIM A;  1UBI A;  3VXW A;  1C1Y B;  2A5U A;  4EFO A; 
#chains in the Genus database with same CATH topology
 2JXT A;  2WXJ A;  4RGT A;  2KQ4 X;  1JCK B;  1KFY B;  4KDL B;  3IAM 1;  4M8M A;  3UIP B;  1PGB A;  3Q8C A;  1JWU D;  5JH5 C;  3JW0 X;  3N3K B;  2KTR A;  3MC0 B;  2PE6 B;  3IBE A;  2FID A;  4OVZ A;  2IO1 B;  1RRB A;  4J6I A;  2MX2 A;  2L05 A;  5J18 A;  4EKU A;  3KWV A;  4A90 A;  2BW2 A;  5C3J B;  2Z0E B;  2WNM A;  3NG0 A;  4II3 B;  3DWM A;  5AZH A;  2CHX A;  4MM3 A;  2QJL A;  3LJ3 A;  4OZC A;  1M94 A;  1JWM D;  2KQ7 A;  4FN2 A;  3MC8 A;  1N5W A;  1WR1 A;  5E6O A;  3K9O B;  3EC8 A;  1HEZ E;  1WI0 A;  3Q8A A;  2D3B A;  3NRZ A;  3MHS D;  1S3S G;  3B2G A;  3R8B A;  3N30 A;  4HPP A;  2XEW A;  1XCT L;  3DBL B;  1TKG A;  3Q14 C;  5FR3 A;  3SR6 A;  3Q3N C;  5HKH A;  4K81 A;  4ZHO A;  4M01 A;  4BKT A;  4IG7 B;  1OEY A;  4RGN A;  1DOI A;  4PYU A;  4N6E B;  4DDI D;  4L23 A;  1VZ7 A;  2FCM A;  4RM9 A;  1EO6 A;  1VDV A;  2KK8 A;  5D3D A;  5DCN A;  2MRP A;  1C9F A;  2KC2 A;  2BYV E;  4WQO B;  1FPY A;  2DAF A;  1RM6 C;  4GDL B;  4LJP B;  1V5O A;  4GXB A;  2AYO B;  4ANX A;  1I4X A;  1UBQ A;  3W2D A;  4CQN A;  2LRW A;  3BWU D;  2GLS A;  4C80 A;  4L2Y A;  2FE8 A;  1JRP A;  4ANU A;  4IDI A;  3CSF A;  1X1M A;  4GN1 A;  4LCD E;  4LNI A;  1FFU A;  3E56 A;  1D4B A;  3AE7 B;  4Q2J A;  1PGX A;  2D5G A;  4KSL C;  3W1S A;  3M62 B;  4HDO A;  4JL9 A;  1YNT E;  1K53 A;  3VUY A;  1MFW A;  4TKN A;  1SSN A;  1E8Z A;  2K8H A;  3BIN A;  3PSE B;  3PZD A;  5AZF A;  2MJD A;  2L00 B;  2RPQ A;  4CYE A;  4ZYS A;  2RR9 A;  3V61 A;  3T3O A;  2UWQ A;  2HJ8 A;  1R4N I;  3SD5 A;  2OOB B;  3RMK C;  3U30 A;  4DHZ B;  3ZRF A;  1J8C A;  3ENE A;  1ZXI A;  1C76 A;  4RCO A;  4GOC A;  3NY5 A;  2M8S A;  2R61 A;  2Z59 B;  1BT0 A;  2L76 A;  4TUU A;  3WAL A;  1GJZ A;  2WXF A;  3QCA A;  3BZD B;  3AI5 A;  4JIO U;  2DLB A;  2NTT A;  1QT9 A;  1R4M B;  5H92 C;  2BPS A;  2AEH A;  3APC A;  2JYE A;  1WX8 A;  3R2T A;  3TCA A;  4MJS A;  3WCQ A;  4EUT A;  1L0V B;  2KWD A;  1KLG D;  4WJN A;  3PLU A;  1SBB B;  2JXX A;  2INN E;  3KLS X;  4LNK A;  4LDT B;  3AEA B;  4AQ7 A;  2WLB A;  3Q3M C;  1E10 A;  3B1L X;  1KLU D;  4ZOH C;  2KTR B;  3MFG A;  1IYF A;  2ZPY A;  2B3A A;  1MPE A;  3KWL A;  2KQS A;  4TQ1 A;  5BO4 B;  4S0R A;  3P4P B;  1F77 A;  3A9J B;  1WJ6 A;  3VR8 B;  2LFI A;  5IP4 D;  3QJZ A;  5JHA A;  4KKI A;  1GG3 A;  3MJ5 A;  3ZUN A;  4TSS A;  3M3J A;  3Q2A C;  3VH4 B;  1QOB A;  4MGI E;  2RPV A;  4AWJ A;  2NR2 A;  4NJ7 A;  4W9I A;  2K1F A;  5AEK B;  1T0S C;  4C56 C;  3OJ4 B;  1I4R A;  2CR5 A;  1LO5 D;  3MTN B;  1K51 A;  4NZL B;  5EE3 A;  1E0Z A;  3NOB A;  1IBX A;  2D3A A;  1SF0 A;  1T6B X;  2WXI A;  3W5U B;  4DBG A;  3APF A;  1Y8R C;  3PO0 A;  3Q3J A;  3NUH B;  2LWP A;  1R7S A;  2V3P A;  3NVY A;  4URK A;  1FXI A;  4MGZ E;  3RYT A;  1H8C A;  2V4I B;  4JQW C;  4DXG A;  4B6W A;  2KDI A;  2KHW B;  3PHW B;  4HEA 1;  4RF0 A;  2AQ1 B;  1PUT A;  3RZF A;  1FCC C;  4NQL B;  1A70 A;  4N59 A;  1CMX B;  3ZLZ A;  1V81 A;  1EF1 A;  1YN3 A;  5GXG B;  3QC8 B;  1WMH B;  2BTE A;  2N7D A;  1FD6 A;  1QOG A;  1JQ4 A;  3IG3 A;  4G3X B;  2LI5 A;  5E6N A;  1HTQ A;  1WH3 A;  2LUM A;  3SEB A;  1F2R I;  2PW9 A;  1CJE A;  1E8W A;  3WAP A;  4RGM A;  2KOX A;  2C7H A;  3D32 A;  2CJO A;  3KUZ A;  2ZW1 A;  5C23 A;  3Q8F A;  4EE2 A;  2AL6 A;  4A3P A;  3PRZ A;  1WE7 A;  2N9P C;  3PGE A;  1N6Z A;  2AQ2 B;  2WDV B;  2PVO D;  4ANV A;  2X38 A;  4TMA B;  2WWZ A;  3DVN U;  2BB6 A;  2JWZ A;  3H9D A;  1L2N A;  3NZU A;  1WJU A;  3R7Q A;  3ZGZ A;  2LHD A;  4ZRQ A;  3ETR A;  4KSK C;  4XDC A;  3DWG C;  2ICI A;  4N9F 4;  2W54 A;  4DK5 A;  3HUI A;  2G3Q B;  1KTK A;  2O2V A;  2WDQ B;  4II2 B;  3RNC C;  5D6J B;  1V49 A;  1SJH D;  1JRU A;  2R2O A;  2ONQ A;  1WJN A;  3N1Y C;  4IW0 A;  4RNA A;  1V86 A;  2VZK B;  4K7U A;  1NEK B;  2M19 A;  1XT9 B;  2HD5 B;  3ZRC A;  2JZ3 B;  4ARI A;  3M63 B;  1WXS A;  2BQQ A;  1YOV B;  2KMM A;  3AE9 B;  3I5J C;  4OHJ A;  3GOE A;  4MGY E;  1VZ8 A;  3LDZ E;  1NVI D;  2M0X A;  4MSM B;  4B0M A;  5KHO A;  3AEG B;  2PIA A;  1RFK A;  1AW7 A;  4M0W A;  3I3T B;  1R4N B;  1UF0 A;  1XF5 L;  5JZE B;  4N58 A;  2RDB C;  5G55 A;  4KKJ A;  4FJY A;  2L1A A;  2JZZ A;  1EM7 A;  1C4P A;  2DYB A;  1V1O A;  4EZJ A;  1Q0W B;  3RZW C;  2L0T A;  1UBI A;  3VXW A;  4RFB A;  4P6V F;  2IO3 B;  1H4R A;  3NS8 A;  1WM3 A;  3AB5 A;  3AV8 A;  4YSX B;  3L13 A;  2ZVN A;  2LVP A;  1TTN A;  2BVC A;  3O65 B;  2N9E B;  3JSV B;  1IBX B;  2KAJ A;  1UNS A;  4NJC A;  1L7Y A;  5AZG A;  1HTO A;  4GGQ A;  2IO2 B;  4B95 A;  3OG5 A;  2MQJ A;  1SEB D;  3AN1 A;  2KWV B;  3P4S B;  2KFK B;  5C2T B;  1D5M C;  4CHK A;  1YN4 A;  4M8N A;  2GBM A;  1D5X C;  4DDG D;  4AOF A;  1SB3 C;  1I35 A;  5I4D A;  4ICU A;  1LXD A;  1WXM A;  1QF6 A;  2ASQ A;  3MHZ A;  4IWO A;  4R3D A;  2FUH B;  4AJY B;  2NCN A;  3HIZ A;  2QMT A;  4NY0 A;  1QQR A;  2DBY A;  3EFU A;  4M02 A;  1KF6 B;  1WJ4 A;  3V05 A;  4KX6 B;  2QIE B;  2JZP A;  3ZJT A;  1SIF A;  3AH7 A;  3W1S C;  4OZA A;  1YJ1 A;  4UDU C;  2KDM A;  3ZNZ B;  4W9G A;  4MT5 A;  3ZXR A;  3U8Z A;  2YLM A;  3RNA C;  3RNF C;  2MA9 B;  3H7S A;  3FIL A;  1WGD A;  5CTR C;  3PT2 B;  4S17 A;  3WAM A;  1JAL A;  1R4M I;  5GMV A;  4C7Y A;  1PFD A;  4DHJ B;  1WGY A;  3N20 C;  3BK2 A;  3QA8 A;  1STE A;  4FHK A;  2WXR A;  5CX3 A;  1V1P A;  2JF5 A;  2V9H A;  1PQS A;  2JRI B;  4GU2 A;  4IKG A;  1YQ3 B;  3L16 A;  5EE1 A;  3ZDM C;  1GB4 A;  1L0Y B;  1ZGU B;  1WYW B;  2XK5 B;  2OJR A;  4RGO S;  1MI0 A;  2Z0D B;  4USA A;  4ZRP A;  3VTU A;  3DCG A;  1PDX A;  4I6L B;  2MP2 B;  1DYQ A;  1UGM A;  4IUM B;  3P42 A;  1V97 A;  2MJE A;  4EZL A;  5FKA C;  1WRD B;  2WXK A;  2WX0 A;  4CO7 A;  2G45 B;  3GB1 A;  1E6E B;  1KOT A;  2M17 A;  4ZYN A;  1YN5 A;  4BOS C;  3ZNI D;  4NAW B;  2IPK D;  2KDE B;  1WXA A;  3AEC B;  1BUI C;  1WXQ A;  1XLP A;  4P1B C;  1BML C;  2FBW B;  1TY2 A;  2DYO A;  1EWC A;  4HRO A;  1TZ1 A;  2KLG A;  2INC C;  5J17 A;  3C0R B;  2I1J A;  2DHZ A;  1YIW A;  2NBV B;  3UGB B;  2QDF A;  2KNB A;  3PRM B;  2I38 A;  3QWZ B;  5D3I B;  1WFY A;  4FXC A;  4K7W A;  1SE9 A;  1OGW A;  2MBB B;  2DEN B;  1WZ0 A;  4MDK E;  4M00 A;  4NJ6 A;  4K1R B;  2LUE A;  1SJE D;  3NJT A;  3B08 A;  1WF9 A;  1SE3 A;  1WXV A;  2NPT A;  3P4Q B;  3HHM A;  1JRO A;  3DPD A;  3PTF C;  1CZP A;  2BS4 B;  1EF5 A;  1QKZ A;  4WUR A;  4W9L A;  4WWM A;  2GBR A;  5CHF A;  3P63 A;  3VQI A;  1DGJ A;  2PLP A;  2OED A;  3RNB C;  2Y5P A;  4EZK A;  2KAN A;  1RFA A;  4C4V A;  2WXP A;  3GE3 C;  3RNG C;  2XBB C;  1HQR D;  1TS4 A;  3I57 A;  3ZTC A;  4KIK B;  2C60 A;  1NBF C;  4XYC A;  2B76 B;  1EU3 A;  1TZO A;  2Y3A A;  3A33 B;  3A1Q B;  5JHB A;  1OQY A;  3V6C B;  2MJ3 A;  2AL3 A;  1P0R A;  4XZ4 A;  3NVZ A;  2KMA A;  5MPO A;  4I6N B;  4XWT A;  1B1Z A;  3RFZ B;  1IGD A;  2A4Z A;  2EMT A;  3U2S C;  3J9C A;  1RLF A;  2KJH B;  1OEY J;  1E7V A;  1NI2 A;  3TMP B;  4G0N B;  2J7Q B;  3HRD D;  2MHJ A;  2WXG A;  5J2R A;  5EE9 A;  3R7R A;  2J4X A;  2QSD A;  1J7C A;  4F1S A;  1C79 A;  2E6X A;  3PPA A;  3DVN V;  1QZE A;  3ZJU A;  3NZ3 A;  2SAK A;  1AYF A;  2PTL A;  3GZN I;  1Q1O A;  1T0Q C;  1Z5S B;  1NEN B;  3DQV A;  5CHV C;  4BFR A;  1BXT A;  1EUV B;  3EGR A;  5D94 A;  2IYD B;  1D6E C;  2N0S B;  3Q69 A;  1NYQ A;  4ZRI A;  1P3Q U;  2QEJ C;  1G6J A;  1I4P A;  3LB8 C;  1V2Y A;  4BKS D;  2BF8 B;  2C7M B;  1FCL A;  4JWU C;  4MH8 A;  1HA5 A;  4K3B A;  1L4Z B;  3ZDT A;  2Q5W D;  3I9V 1;  2N1V A;  2FCS A;  2V3N A;  3QK0 A;  1NDD A;  4LNN A;  2DZK A;  4WWP A;  2KLC A;  3N32 A;  2JY6 A;  2K3U A;  3ONS A;  3WAN A;  1YX6 B;  5IKC M;  5BMG A;  2C7N B;  4FJV B;  2PE9 A;  3PV1 A;  4XDD A;  2DYM A;  2WS3 B;  5DPS A;  3AEB B;  3MP9 A;  2WXL A;  4KZ0 A;  2DWQ A;  3VTW A;  1MVK A;  4D2K A;  2DZM A;  1N62 A;  3LXF A;  1ZP0 B;  1DOX A;  4HXD A;  2YEP B;  4GIV A;  1UWM A;  2QIL A;  1ET6 A;  1I4H A;  3RD2 A;  2KZR A;  5KHQ A;  4MM3 B;  4LNF A;  2K39 A;  1JWB D;  4NAM A;  2NS5 A;  5E6P A;  3U4E G;  3FAH A;  1RAX A;  1UH6 A;  2JQR B;  3TL5 A;  2N7J A;  3CMM B;  3GP7 A;  5DPW A;  3DVG X;  4MH0 E;  2BYT A;  2MBH A;  4OW0 A;  3VUW A;  1ZDV A;  3HVD A;  1EU4 A;  2ZVO A;  3BVG A;  3ZO5 B;  3V62 A;  1SXT A;  4RMA A;  2GRI A;  4YL8 A;  2N1W A;  4JX1 C;  4ZDV A;  3IT4 B;  2K6D B;  2LMC A;  1VJK A;  1FNU A;  4RM8 A;  3H7P A;  1TYG B;  1N61 A;  3B0A A;  3A9K A;  2KVZ A;  2K8C A;  4HPL B;  1L6U A;  4YTM B;  2A5U A;  2G9H D;  2VZK D;  4EFO A;  4WQM A;  2QHO A;  4EOY A;  2JSV X;  2ON8 A;  1ZDX A;  2WGS A;  1AWD A;  1IGC A;  1YX5 B;  3P4R B;  3BII D;  3PLV A;  4GMV A;  1YJJ A;  2J52 A;  5D7G A;  4HVB A;  2KFJ A;  3ML8 A;  3PS6 A;  3M95 A;  1C4C A;  4FBJ B;  2EKI A;  3RNE C;  4US8 A;  1L0X B;  2IND C;  5H8Y E;  2K25 A;  3AE5 B;  3MJW A;  1E5W A;  2O6V A;  4GDK A;  1GC7 A;  5IA7 A;  1JWA D;  2K9X A;  5G2N A;  3AE4 B;  1VR9 A;  3VH3 B;  3EEC A;  2WDR B;  4HKZ E;  2EEL A;  3VVW B;  3BVZ A;  3C19 A;  2YVC A;  1ENF A;  4W9H A;  4KGS A;  5G5G A;  2ZCB A;  3C8Y A;  3X23 A;  2NBU A;  3V60 A;  2ZNV B;  4KZC A;  1XLO A;  3QAQ A;  1LFD A;  4RF1 A;  1FNV A;  4LNO A;  4JPS A;  5BMH A;  2I1K A;  3B2F A;  4ARC A;  1E7P B;  1MG8 A;  3JVZ X;  1N5X A;  3Q8B A;  3EFC A;  1IPG A;  3HVZ A;  4REZ A;  3NVW A;  1TS2 A;  5HG2 A;  1WR6 E;  2WXO A;  1I4Q A;  4YXD B;  1FXT B;  4IC7 B;  1SIJ A;  1UWX A;  4B9K A;  3DVG Y;  1AAR A;  1P7F A;  2J0M A;  4LJO B;  1L4D B;  1XCQ L;  2CU1 A;  4MJS B;  1FRR A;  3OLM D;  3PZ7 A;  2IGG A;  3AEE B;  1WM2 A;  2AQ3 B;  4NNJ B;  5T8I A;  5LLI A;  3Q6B A;  4WJQ A;  1UUP A;  3GZN B;  1XO3 A;  4E71 A;  1FXA A;  3L0W B;  2W3R A;  4ZHP A;  1MJD A;  1WGK A;  3KQ4 A;  2MEK A;  3ALB A;  5JXV A;  2CHW A;  3IT6 B;  2IGH A;  2O6V D;  2Y5B B;  4L1B A;  3DHG C;  4US9 A;  5IN7 A;  3VFK A;  4C00 A;  2L0F A;  2R2Q A;  4IM3 A;  2QC8 A;  1OFF A;  3S2A A;  4AJW A;  4FUL A;  2NBW B;  1WE6 A;  1C3T A;  4PK1 A;  3TUO A;  3AE2 B;  5HHD G;  4DHJ D;  2BS2 B;  3BVM A;  2LJI A;  4K7S A;  4FHJ A;  2J0K A;  1WX7 A;  3SFE B;  2KKC A;  3DOW A;  2JRH A;  2BKF A;  3Q3O C;  2VRR B;  3W5V B;  1TKE A;  4HKQ A;  1V8C A;  3ZKJ C;  4ZRK A;  1YJI A;  1YQ4 B;  3U7D A;  2RDG A;  4HWI B;  1VRA B;  3CST A;  3ZTD A;  4ICV A;  2K0P A;  1SGH A;  4DWF A;  1QOA A;  3A4R A;  3CIR B;  3I63 C;  2MBE A;  2IZV B;  4I6P A;  4JWS C;  5LXH A;  3DBS A;  1F9J A;  2KYW A;  1QOF A;  2L7R A;  3O13 A;  4X57 B;  3AU4 A;  4WJO A;  4A9A A;  1Q10 A;  3KH0 A;  1FM0 D;  2H89 B;  2JX5 A;  2XNA C;  3FKY A;  3L54 A;  3RT3 B;  3U7Z A;  1GAQ B;  2VH1 A;  2GBN A;  1WYG A;  4BOZ B;  1ESF A;  1L6V A;  1J19 A;  2INP E;  2EKE C;  2JVC A;  3RPF C;  4HDQ A;  1VLB A;  3SFD B;  1F1H A;  2CS4 A;  3RI7 C;  4KGT A;  2PPH A;  4GDL A;  4HJG E;  4YT0 B;  5IO9 A;  2DZI A;  4W9J A;  5HFY A;  1JWS D;  3WA0 A;  2KO3 A;  3KYC D;  2QCZ A;  1PGA A;  1TBE A;  2LRU A;  1TY0 A;  2WXM A;  3WAO A;  4E74 A;  2N9K A;  2KC1 A;  2LGD A;  3VDZ A;  1N60 A;  1P98 A;  1WGR A;  3DBR B;  2I2Y A;  3ABV B;  2W55 A;  4HJK A;  2O2V B;  3KW5 B;  3Q3F A;  1VZ6 A;  2DAJ A;  1MHX A;  4W9E A;  1HE8 A;  3TSS A;  3UQB A;  4A20 A;  1ZXH A;  3CF6 E;  2N4F A;  2HDE A;  1WRI A;  1XD3 B;  3H8H A;  4EEW A;  2GBK A;  4AP4 C;  2FNJ B;  3KYD D;  5C1Z A;  2RMM A;  4MGK E;  4PS7 A;  2AX5 A;  1C77 A;  5L83 A;  3KUC B;  4WH4 A;  4K3C A;  2WX1 A;  3VRA B;  4M0W B;  1XXG A;  3SDL C;  3BYT B;  3URY A;  3N1Z C;  2PEA A;  2RGF A;  4QAY A;  2N9L A;  2LAS A;  1P7E A;  4ITK A;  3ZNG C;  1I42 A;  3AMZ A;  5D2M B;  1C4A A;  2GMI C;  2MH7 A;  5AUK A;  4BZA A;  3WIM A;  2KWC A;  2JYT A;  3OJ3 A;  2IGD A;  3DBH I;  2C9W B;  2CU3 A;  2BT6 A;  5IAA C;  3L10 B;  1CK1 A;  3TBL D;  3A9J A;  3NZS A;  1TIF A;  1S1Q B;  1ROE A;  1V6E A;  2OJW A;  4E3C A;  4A55 A;  5FR6 A;  4BKG A;  1OQQ A;  3E9S A;  1PYW D;  4AS1 A;  4YWG G;  4W9C A;  3OWE B;  2L8J A;  5L95 C;  1I7H A;  2LGY A;  3H6N A;  5LNK 1;  3TEY A;  4OVV A;  4BKS A;  4TQ0 A;  3QX1 A;  2JWU A;  2LZ6 A;  3GE8 C;  4JGH B;  3HK0 A;  3VTV A;  2DZJ A;  1T0R C;  2WXH A;  3TEZ A;  1RYJ A;  5FK9 C;  3VAW A;  5HI1 A;  1ZUD 2;  2TSS A;  1GB1 A;  2MWS B;  2CKH B;  5LXI B;  2REX A;  3TEX A;  4PYZ A;  4PS3 A;  3KVF B;  2V0G A;  2WQY B;  1FNW A;  3ZJV A;  1MG4 A;  2MSE D;  1SE2 A;  1TT5 B;  3IXS A;  2FCQ A;  1KM7 A;  2G4S A;  1V5T A;  4HPM B;  3VRB B;  4DHZ E;  1WZ3 A;  2IO0 B;  2WP9 B;  2ZPN A;  1EWY C;  4LDT D;  1KRH A;  1K52 A;  3FIL B;  3IAS 1;  2X8X X;  2D3C A;  4F8C B;  1WMH A;  2PKO A;  4YSZ B;  1WWT A;  1VCB A;  3VUX A;  2M56 B;  1K8R B;  5CHW A;  2NMQ A;  2DNF A;  4DXF A;  4HCN B;  1V1P B;  4PS8 A;  4B0E A;  2WDT B;  3ZIM A;  2W3S A;  2JU6 X;  1C1Y B;  2XN9 C;  1TS3 A;  1TGZ B;  2K22 A;  2KAC A;  1JML A;  3A4S C;  4WAF A;  4G11 A;  3DHI C;  3AE6 B;  2LVO A;  3RUL A;  3UI3 A;  1AN8 A;  2C5L C;  2MCN B;  1F2R C;  2GOW A;  5G5H A;  4A3O A;  1ZE3 D;  4IM0 A;  3AEF B;  4IOI E;  1YMH E;  3LYY A;  4W9F A;  4PT5 A;  2N9X A;  1TS5 A;  4YTN B;  1E9M A;  3H1U A;  3RN9 C;  2W9N A;  4OZB A;  1KH0 A;  2G1E A;  4J3O D;  4YSY B;  2IY0 B;  3DDC B;  1E8Y A;  4BAX A;  3ECI A;  2BWE S;  1D3Z A;  1E8X A;  2M0A A;  1YD8 U;  2NVU I;  1MHH E;  1ZOY B;  4KV2 A;  4MSQ B;  4HK2 A;  4OVU A;  1D5Z C;  2KDF B;  2BS3 B;  2KXJ A;  1F52 A;  2FCN A;  4HLE A;  1QIL A;  3APD A;  1WX9 A;  3UIO B;  2LD9 A;  1OTR B;  1V80 A;  1XLQ A;  2BYF A;  2FIF A;  3AED B;  1V9J A;  3RUI B;  1ZW7 A;  2BGF A;  4P1C C;  3HM3 A;  2L83 A;  1SE4 A;  3PHX B;  2KN5 A;  3IVF A;  1FIQ A;  2ZJD A;  2NPT B;  4XX5 A;  1CQV A;  2K5P A;  3R3M A;  4AUQ C;  3TIX A;  2DX5 B;  3AE3 B;  2BBC A;  1LQB A;  2MLB A;  4JE3 B;  1HXY D;  3RCZ A;  2CJN A;  3K9P B;  2D2Q A;  2D3G A;  3GS2 A;  2GB1 A;  4XE0 A;  3ZQ4 A;  2D11 A;  2BB5 A;  3TEW A;  3CWI A;  2BKR B;  3EHV A;  3ML9 A;  4C4V B;  1K50 A;  2Z8L A;  3AE8 B;  3JSV A;  4KDI C;  2GBJ A;  2PJH A;  2RD0 A;  2HJ1 A;  2JUO A;  4F7Z A;  4A8X C;  1ISN A;  3DBH B;  2YEP F;  1XLN A;  2IY1 B;  4IWP A;  2WXN A;  4WAA A;  3QAR A;  1FFV A;  4XC2 A;  2KFK A;  1M4V A;  3ZVV A;  3EA6 A;  4MEM A;  4C7Z A;  1UGJ A;  4NPN A;  2LEK A;  2KMC A;  2KT7 A;  3DBR I;  4TV3 A;  5EDS A;  2ZEQ A;  2KD0 A;  3SHQ A;  1HZ5 A;  1N63 A;  4DXA B;  3AE1 B;  4FAD A;  2EMS A;  2L3Z A;  3BY4 B;  4O1N A;  2ZCC A;  2LXC A;  3X0W A;  3JYU A;  3ZNH B;  3ZXV A;  2IDY A;  1ET9 A;  2HTM E;  2KX3 A;  3IFW B;  1J7B A;  2K8B A;  3NHE B;  3AU5 A;  1T0Y A;  1GNU A;  1NYR A;  2D07 B;  3SU8 X;  2JPH A;  2UU7 A;  2N7E A;  1XEE A;  3UIN B;  2J42 A;  1LGR A;  3DHH C;  2FUG 1;  1NI3 A;  4LTU A;  2RDH A;  2WYQ A;  2FAZ A;  4G50 A;  1OQR A;  1B9R A;  2J0J A;  2KTF A;  2BYE A;  1L5P A;  3ZW3 A;  2XK5 A;  1LM8 B;  4XGA B;  2ZZP B;  2L52 A;  1GC6 A;  3NS1 A;  4ASW C;  2M1M A;  2V1Y A;  4P7I A;  3N9Y C;  3OAW A;  2MP2 A;  1DOY A;  1E90 A;  4W9D A;  4GSW A;  4JLC A;  2KWU B;  2OHF A;  3T3N A;  3KUD B;  4KVG B;  4BBN F;  3PVL A;  3L4P A;  2KDB A;  1RWS A;  1ZPS A;  2PVG C;  1QLB B;  2K6Q A;  4NAW A;  4XWW A;  4IWQ A;  1Y56 A;  2GI9 A;  3R66 C;  2ACZ B;  5BYS A;  2HTH A;  3V6E B;  3T8M A;  4ACF A;  5DPR A;  4ANW A;  1GUA B;  1UEL A;  1FEH A;  2M4N A;  3W1Y A;  4ZRJ A;  3QQ8 B;  2BWF A;  3B9J A;  3MC9 A;  3BYY B;  1Z2M A;  1ZKH A;  4MAC A;  2V3S A;  4FLH A;  1GOZ A;  4W9K A;  1ACC A;  1P9D U;  2KX0 A;  2W82 A;  3TJP A;  3R2I A;  5E6J A;  1TKY A;  2WU2 B;  3DBL I;  5BYR A;  5TSS A;  3QHT A;  3V3X A;  4GB9 A;  1J7A A;  1YQB A;  2H88 B;  2SEB D;  1GPX A;  3UF8 A;  3QIJ A;  2MW5 A;  4RH6 A;  1E7U A;  2VH2 A;  3ZYY X;  1XQQ A;  1IUE A;  2LHE A;  4BVU C;  2J53 A;  1C78 A;  4GLS C;  1T3Q A;  4KGR A;  3W9C B;  4DQO C;  2ZW0 A;  1UZX B;  4HCP B;  2E3T A;  3H7P B;  1UD7 A;  1FMA D;  2D10 A;  1WGH A;  3U52 E;  3PRE A;  3A9K B;  4IM2 A;  3T9L A;  2WXQ A;  1KJT A;  3EUB 2;  1U4A A;  3IHP C;  3VR9 B;  1P1A A;  3HM6 X;  1Q5W B;  1FO4 A;  4H2A A;  4LK0 M;  1HZ6 A;  2LGI A;  2LVQ A;  2IBI B;  4FJZ A;  4KIK A;  2Y5C A;  1J0G A;  1WIA A;  2MBQ A;  1KLV A;  3P2B A;  2RSU A;  3A1Q A;  3AM9 A;  5BMI A;  3VHT C;  1WY8 A;  1TJE A;  3AUL A;  2HE7 A;  4BBN C;  2KJ6 A;  3PRP B;  4WJP A;  1JW9 D;  2LXA A;  2O6V B;  1IP9 A;  3Q8E A;  2LJ5 A;  4GDK B;  2MBO A;  2LGX A;  2V4L A;  5BYQ A;  3BK1 A;  3P1M A;  2KJR A;  2KN4 A;  2NTS A;  1WSP A;  2UYZ B;  3L08 A;  4HRS A;  5AUI A;  1T5X D;  2ZNV C;  4YTP B;  4NQK E;  3AXC A;  1FRD A;  2KVR A;  2PMV A;  2JT4 B;  5DPT A;  4LLG M;  4FA6 A;  2WHI A;  5IOI A;  1F0Z A;  2G4D B;  3N1X C;  4A6Q A;  3L17 A;  5EE0 A;  2AWT A;  4WWN A;  1VD2 A;  4WIP A;  2CHZ A;  3NVV A;  4P16 A;  1A5R A;  2IJ0 A;  4MEL A;  5TR5 A;  2LGS A;  1I4G A;  2L32 A;  1WGG A;  3UQA A;  4WWO A;  3FC4 A;  2WU5 B;  3PZ8 A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  1H4R A;  3NS8 A;  1TGZ B;  1WM3 A;  2QHO A;  3A4S C;  4EOY A;  4G11 A;  2LVO A;  3L13 A;  2ZVN A;  4KDL B;  2LVP A;  1TTN A;  3RUL A;  4M8M A;  3O65 B;  2C5L C;  2N9E B;  3UIP B;  3JSV B;  2MCN B;  1YX5 B;  2GOW A;  4A3O A;  3PLV A;  4IM0 A;  4GMV A;  1L7Y A;  5AZG A;  5D7G A;  4HVB A;  4GGQ A;  5JH5 C;  2KFJ A;  3ML8 A;  2IO2 B;  4B95 A;  3JW0 X;  2MQJ A;  3N3K B;  3PS6 A;  2KTR A;  3M95 A;  2KWV B;  4W9F A;  2PE6 B;  4FBJ B;  3IBE A;  2N9X A;  2FID A;  2KFK B;  2IO1 B;  1RRB A;  3H1U A;  2K25 A;  3MJW A;  4CHK A;  2W9N A;  1E5W A;  2O6V A;  4J6I A;  2MX2 A;  2GBM A;  2L05 A;  4GDK A;  4M8N A;  4AOF A;  1GC7 A;  4DDG D;  4EKU A;  5IA7 A;  5J18 A;  5G2N A;  2IY0 B;  1I35 A;  3DDC B;  3VH3 B;  1E8Y A;  3EEC A;  4ICU A;  2Z0E B;  3VVW B;  4II3 B;  1LXD A;  5AZH A;  1WXM A;  3ECI A;  2BWE S;  2CHX A;  2ASQ A;  2YVC A;  1E8X A;  4MM3 A;  4W9H A;  1D3Z A;  1YD8 U;  2NVU I;  2ZCB A;  3X23 A;  4IWO A;  2NBU A;  4KV2 A;  4MSQ B;  3LJ3 A;  3V60 A;  2FUH B;  1M94 A;  2ZNV B;  3QAQ A;  2KQ7 A;  4KZC A;  2NCN A;  4FN2 A;  4HK2 A;  3HIZ A;  1LFD A;  4OVU A;  4AJY B;  4NY0 A;  1WR1 A;  2I1K A;  2KDF B;  3EFU A;  5E6O A;  1MG8 A;  2KXJ A;  3JVZ X;  3K9O B;  2FCN A;  1WJ4 A;  4HLE A;  1SIF A;  3W1S C;  3EC8 A;  3APD A;  1WX9 A;  1IPG A;  3UIO B;  1WI0 A;  1OTR B;  1YJ1 A;  2LD9 A;  3ZNZ B;  4W9G A;  3MHS D;  1S3S G;  1V80 A;  3U8Z A;  1WR6 E;  2BYF A;  2FIF A;  2YLM A;  2MA9 B;  3H7S A;  1FXT B;  1WGD A;  1V9J A;  4IC7 B;  3RUI B;  5CTR C;  3PT2 B;  1ZW7 A;  2BGF A;  3N30 A;  3WAM A;  4B9K A;  3DVG Y;  1AAR A;  3HM3 A;  2J0M A;  4LJO B;  2XEW A;  1R4M I;  5GMV A;  3PHX B;  2KN5 A;  3IVF A;  2CU1 A;  4MJS B;  4DHJ B;  1WGY A;  3OLM D;  3QA8 A;  2ZJD A;  2NPT B;  4FHK A;  4K81 A;  5HKH A;  4XX5 A;  5CX3 A;  1WM2 A;  2JF5 A;  4BKT A;  1PQS A;  4NNJ B;  2JRI B;  3R3M A;  4GU2 A;  4AUQ C;  5LLI A;  4IG7 B;  3TIX A;  2DX5 B;  1OEY A;  4WJQ A;  3L16 A;  3ZDM C;  4E71 A;  4PYU A;  1ZGU B;  1WYW B;  4DDI D;  2XK5 B;  1LQB A;  2FCM A;  2MLB A;  2OJR A;  1EO6 A;  3L0W B;  4RM9 A;  2KK8 A;  2Z0D B;  3RCZ A;  3VTU A;  3K9P B;  3DCG A;  5DCN A;  2MRP A;  2KC2 A;  2D2Q A;  2BYV E;  4I6L B;  4WQO B;  2D3G A;  2DAF A;  2MP2 B;  2D11 A;  4GDL B;  4LJP B;  1V5O A;  4GXB A;  1UGM A;  2BKR B;  3ALB A;  2AYO B;  3EHV A;  4IUM B;  3ML9 A;  4ANX A;  2CHW A;  1UBQ A;  4EZL A;  2LRW A;  1WRD B;  3JSV A;  4KDI C;  2GBJ A;  2O6V D;  2WX0 A;  2PJH A;  2Y5B B;  4CO7 A;  2RD0 A;  2JUO A;  4ANU A;  2G45 B;  4F7Z A;  1KOT A;  3VFK A;  1ISN A;  1X1M A;  3CSF A;  4GN1 A;  2M17 A;  4ZYN A;  2L0F A;  2R2Q A;  4LCD E;  4BOS C;  3ZNI D;  4IM3 A;  4NAW B;  2KDE B;  1WXA A;  3S2A A;  4AJW A;  2IY1 B;  4FUL A;  4IWP A;  2NBW B;  1WE6 A;  4WAA A;  3QAR A;  4XC2 A;  1C3T A;  2KFK A;  3ZVV A;  4MEM A;  4KSL C;  4DHJ D;  3W1S A;  2DYO A;  4K7S A;  4FHJ A;  3M62 B;  4NPN A;  2J0K A;  4HDO A;  4JL9 A;  2KMC A;  1WX7 A;  1TZ1 A;  3DBR I;  2KLG A;  4TV3 A;  5EDS A;  2KKC A;  2ZEQ A;  5J17 A;  3VUY A;  3DOW A;  3C0R B;  4TKN A;  2KD0 A;  3SHQ A;  2K8H A;  1E8Z A;  2I1J A;  3BIN A;  3PSE B;  2JRH A;  3PZD A;  5AZF A;  2BKF A;  4DXA B;  2VRR B;  2L00 B;  2EMS A;  2RPQ A;  4CYE A;  2L3Z A;  4FAD A;  3BY4 B;  2DHZ A;  1YIW A;  3ZKJ C;  2ZCC A;  2RR9 A;  4ZRK A;  3V61 A;  2NBV B;  2LXC A;  3UGB B;  3X0W A;  2UWQ A;  2HJ8 A;  3U7D A;  1R4N I;  2KNB A;  4HWI B;  3SD5 A;  2OOB B;  3U30 A;  3CST A;  3ZRF A;  3JYU A;  4DHZ B;  1J8C A;  3ENE A;  3PRM B;  3ZTD A;  4GOC A;  3ZNH B;  3NY5 A;  3QWZ B;  2M8S A;  2Z59 B;  1BT0 A;  4ICV A;  2L76 A;  1SGH A;  2KX3 A;  4TUU A;  1WFY A;  4K7W A;  3WAL A;  4DWF A;  3QCA A;  1SE9 A;  1GJZ A;  1OGW A;  3IFW B;  2K8B A;  3AI5 A;  3A4R A;  2MBB B;  3NHE B;  2DEN B;  3AU5 A;  1T0Y A;  1GNU A;  1WZ0 A;  4JIO U;  4MDK E;  4NJ6 A;  2MBE A;  2IZV B;  2D07 B;  4I6P A;  5LXH A;  3DBS A;  3SU8 X;  2JPH A;  4K1R B;  1F9J A;  2LUE A;  2BPS A;  2N7E A;  2AEH A;  2L7R A;  3APC A;  4X57 B;  3UIN B;  3AU4 A;  1WX8 A;  4WJO A;  3TCA A;  3B08 A;  4MJS A;  4EUT A;  1WF9 A;  3KH0 A;  1WXV A;  2NPT A;  2WYQ A;  2FAZ A;  4G50 A;  4WJN A;  3PLU A;  2JXX A;  3HHM A;  2J0J A;  3DPD A;  3PTF C;  2KTF A;  3L54 A;  3RT3 B;  2BYE A;  1EF5 A;  4LDT B;  4W9L A;  2GBN A;  4BOZ B;  3ZW3 A;  2XK5 A;  1LM8 B;  2GBR A;  5CHF A;  3B1L X;  1J19 A;  2ZZP B;  2KTR B;  1IYF A;  2EKE C;  1GC6 A;  2JVC A;  2ZPY A;  2B3A A;  3VQI A;  4ASW C;  4HDQ A;  2M1M A;  2V1Y A;  2KQS A;  4P7I A;  3OAW A;  4TQ1 A;  2MP2 A;  5BO4 B;  2CS4 A;  1E90 A;  4W9D A;  4GSW A;  4JLC A;  3A9J B;  2PPH A;  4GDL A;  1WJ6 A;  2KWU B;  2DZI A;  4EZK A;  4W9J A;  2KAN A;  1RFA A;  3KUD B;  4KVG B;  3QJZ A;  4BBN F;  5JHA A;  1GG3 A;  3WA0 A;  3ZUN A;  3PVL A;  2XBB C;  2KO3 A;  3KYC D;  3M3J A;  1TBE A;  2KDB A;  2LRU A;  3VH4 B;  3ZTC A;  4KIK B;  2C60 A;  1NBF C;  4MGI E;  3WAO A;  4E74 A;  4AWJ A;  2K6Q A;  2NR2 A;  4NAW A;  2KC1 A;  4NJ7 A;  4W9I A;  4IWQ A;  2LGD A;  3A33 B;  5JHB A;  2K1F A;  3A1Q B;  1OQY A;  3R66 C;  3V6C B;  5AEK B;  3VDZ A;  2AL3 A;  2HTH A;  3V6E B;  1P0R A;  1P98 A;  3T8M A;  4XZ4 A;  1WGR A;  5DPR A;  3OJ4 B;  1GUA B;  4ANW A;  1UEL A;  2CR5 A;  3MTN B;  2KMA A;  3NOB A;  4I6N B;  2M4N A;  4HJK A;  2O2V B;  3W1Y A;  3KW5 B;  4ZRJ A;  3QQ8 B;  2BWF A;  3Q3F A;  4DBG A;  2DAJ A;  1Z2M A;  3APF A;  1Y8R C;  1ZKH A;  4W9E A;  2V3S A;  2EMT A;  2A4Z A;  4FLH A;  1HE8 A;  3Q3J A;  1RLF A;  2LWP A;  3UQB A;  2KJH B;  1OEY J;  4A20 A;  1E7V A;  3CF6 E;  4W9K A;  1NI2 A;  2N4F A;  3TMP B;  4G0N B;  2J7Q B;  5J2R A;  4URK A;  1XD3 B;  1P9D U;  2KX0 A;  3TJP A;  4MGZ E;  3R7R A;  3RYT A;  1H8C A;  4JQW C;  4EEW A;  2GBK A;  4AP4 C;  2FNJ B;  3DBL I;  4B6W A;  2KDI A;  4F1S A;  2KHW B;  3PHW B;  3QHT A;  3PPA A;  3DVN V;  3KYD D;  1QZE A;  4GB9 A;  5C1Z A;  4MGK E;  1YQB A;  4PS7 A;  3RZF A;  4NQL B;  3GZN I;  3UF8 A;  3QIJ A;  1Q1O A;  2MW5 A;  1E7U A;  1CMX B;  3KUC B;  5L83 A;  3ZLZ A;  1V81 A;  1XQQ A;  1Z5S B;  3DQV A;  2WX1 A;  5CHV C;  1EF1 A;  4M0W B;  4BFR A;  1EUV B;  3SDL C;  3QC8 B;  5D94 A;  1WMH B;  4BVU C;  2IYD B;  2N7D A;  4ZRI A;  1P3Q U;  1UZX B;  1G6J A;  2PEA A;  1V2Y A;  4BKS D;  2BF8 B;  3IG3 A;  4G3X B;  4HCP B;  2LI5 A;  2C7M B;  2RGF A;  5E6N A;  3H7P B;  1UD7 A;  1WH3 A;  2D10 A;  3ZDT A;  1WGH A;  2LAS A;  3ZNG C;  1I42 A;  3PRE A;  2N1V A;  3A9K B;  2FCS A;  5D2M B;  3QK0 A;  1NDD A;  2GMI C;  2DZK A;  4IM2 A;  4WWP A;  1E8W A;  2KLC A;  2KWC A;  2JY6 A;  3N32 A;  3T9L A;  3WAP A;  3WIM A;  2KOX A;  2C7H A;  3D32 A;  3OJ3 A;  3DBH I;  2C9W B;  1KJT A;  3KUZ A;  3ONS A;  5IAA C;  3L10 B;  1U4A A;  3WAN A;  1YX6 B;  5C23 A;  3TBL D;  3IHP C;  2AL6 A;  3A9J A;  3NZS A;  4A3P A;  1P1A A;  2C7N B;  3PRZ A;  1S1Q B;  1WE7 A;  4FJV B;  1V6E A;  3HM6 X;  2N9P C;  3PGE A;  1Q5W B;  4E3C A;  2PE9 A;  3PV1 A;  5FR6 A;  4ANV A;  2DYM A;  2LVQ A;  2WWZ A;  2IBI B;  4FJZ A;  4BKG A;  5DPS A;  4KIK A;  1J0G A;  3DVN U;  1WIA A;  2JWZ A;  3H9D A;  2MBQ A;  4W9C A;  1L2N A;  3NZU A;  1WJU A;  2L8J A;  4KZ0 A;  3R7Q A;  5L95 C;  1KLV A;  3VTW A;  3P2B A;  2RSU A;  3A1Q A;  2LGY A;  3VHT C;  1WY8 A;  3AUL A;  2HE7 A;  3H6N A;  4KSK C;  4BBN C;  2KJ6 A;  3PRP B;  4WJP A;  2DZM A;  4N9F 4;  2LXA A;  4OVV A;  4BKS A;  4DK5 A;  2G3Q B;  2O6V B;  1IP9 A;  4TQ0 A;  4GDK B;  2LJ5 A;  2MBO A;  3QX1 A;  4HXD A;  2LZ6 A;  2O2V A;  4JGH B;  3HK0 A;  4II2 B;  2LGX A;  5D6J B;  2V4L A;  4GIV A;  1V49 A;  3VTV A;  2DZJ A;  2KJR A;  2UYZ B;  3L08 A;  1JRU A;  3VAW A;  3RD2 A;  2R2O A;  1WJN A;  4IW0 A;  2KZR A;  2CKH B;  2MWS B;  5KHQ A;  5LXI B;  1V86 A;  2REX A;  4K7U A;  4PYZ A;  4PS3 A;  2K39 A;  2ZNV C;  3KVF B;  4NQK E;  1XT9 B;  2NS5 A;  3AXC A;  5E6P A;  2KVR A;  2HD5 B;  3ZRC A;  2MSE D;  2JT4 B;  2JZ3 B;  5DPT A;  1RAX A;  3M63 B;  1UH6 A;  2FCQ A;  1KM7 A;  1WXS A;  2G4S A;  4FA6 A;  1V5T A;  4HPM B;  4DHZ E;  3TL5 A;  1WZ3 A;  2IO0 B;  3CMM B;  2ZPN A;  3GOE A;  4MGY E;  3LDZ E;  2G4D B;  2M0X A;  5DPW A;  3DVG X;  4LDT D;  4MH0 E;  4MSM B;  5KHO A;  2MBH A;  3VUW A;  3L17 A;  2AWT A;  4WWN A;  1VD2 A;  2ZVO A;  3I3T B;  3ZO5 B;  2CHZ A;  3V62 A;  1WMH A;  4RMA A;  4F8C B;  5JZE B;  4YL8 A;  2N1W A;  1VCB A;  3VUX A;  1A5R A;  5G55 A;  4MEL A;  1K8R B;  4ZDV A;  5CHW A;  4FJY A;  5TR5 A;  2K6D B;  2JZZ A;  4HCN B;  4PS8 A;  4RM8 A;  3H7P A;  2DYB A;  4EZJ A;  1Q0W B;  3B0A A;  3RZW C;  3A9K A;  1WGG A;  2K8C A;  4HPL B;  2WDT B;  3UQA A;  4WWO A;  2L0T A;  3ZIM A;  1UBI A;  3VXW A;  1C1Y B;  2A5U A;  4EFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...