1U4AA

Solution structure of human sumo-3 c47s
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYSERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of Human SUMO-3 C47S and Its Binding Surface for Ubc9
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin-like protein SMT3A
total genus 14
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1u4aA00
2JVCA 3B0AA 4G0NB 2V1YA 3UINB 1Y8RC 4EZLA 4KZCA 1WGYA 4F8CB 4NQLB 1E7UA 1I42A 4DDID 1V5OA 3L54A 2QHOA 4WWPA 5C1ZA 1H4RA 4WJPA 1E5WA 4GMVA 4ICVA 3WAOA 4BBNC 5AZHA 3A33B 2R2QA 1Q1OA 2WYQA 2KO3A 2KK8A 2L3ZA 3JSVB 2HE7A 2KDBA 3ZVVA 1WGGA 2MP2A 2KNBA 4I6LB 1SIFA 3L13A 3ECIA 1WGHA 5HKHA 3VFKA 3DDCB 4BKGA 4ANWA 1EO6A 1GG3A 2JRHA 3N30A 2D11A 4XZ4A 2KFJA 1WMHB 2BGFA 2O6VD 1P9DU 1WR1A 3EFUA 5JH5C 4ZRIA 3KYCD 4BOSC 3VAWA 1OQYA 4GU2A 4DWFA 3OJ4B 1V86A 1UELA 3NHEB 4LJOB 4EZJA 1UGMA 2WDTB 2DYMA 4BKTA 4ICUA 3DVGX 1RFAA 2L7RA 4W9DA 4W9HA 3DOWA 1K8RB 1NI2A 4G3XB 4GN1A 4IW0A 2KWVB 3BINA 3KUDB 3L10B 3U30A 3AULA 5LXHA 3O65B 2EKEC 4GGQA 4GIVA 4YL8A 2LD9A 4ZYNA 4MSMB 3VTUA 3QA8A 2ZNVB 2ZCBA 3PHXB 3PRMB 3L08A 2MW5A 2NCNA 2K6DB 4MEMA 4BKSA 1E8WA 4LDTB 5CHWA 1WMHA 1WXMA 3DBHI 3TMPB 2DENB 4LCDE 1C1YB 1RAXA 4W9JA 2O2VB 4W9GA 2LASA 5IA7A 1WX8A 3VUXA 2LVQA 3KUCB 2PEAA 4HK2A 1S3SG 1YX6B 3DVNV 4N9F4 2KQSA 4PS3A 4F7ZA 2CHWA 2AWTA 2XBBC 4I6PA 2C7MB 4KZ0A 3S2AA 4II2B 2EMTA 3PGEA 2MWSB 2BYFA 3M95A 1V5TA 2C7HA 3ML8A 2NVUI 4OVUA 4EEWA 1WE7A 3QARA 4AWJA 4FJVB 4FHKA 4NQKE 1LQBA 5D2MB 2C60A 4HDQA 1KM7A 2JWZA 3APCA 2RPQA 1E90A 4EOYA 1WI0A 5J17A 1KLVA 1TGZB 3PV1A 1XQQA 3AU5A 5C23A 3A9KA 4DDGD 3UIOB 2MX2A 2B3AA 2KX0A 4II3B 3RYTA 1WY8A 3TBLD 1WM3A 1KJTA 2GBRA 2OOBB 3ML9A 5E6NA 3WAPA 2Z59B 4WWOA 2D3GA 2GBNA 1S1QB 4W9CA 1IPGA 3B08A 3V62A 1JRUA 1YX5B 1SGHA 5D7GA 5AZGA 1U4AA 4BKSD 3OLMD 3GZNI 5LLIA 5E6PA 3AXCA 2ZVOA 2JY6A 2KFKB 3QC8B 2LJ5A 4PS7A 4W9EA 3EC8A 2FUHB 1J0GA 2DAFA 3K9OB 3L16A 2NBWB 3CSFA 2J7QB 3PLVA 3QQ8B 2RGFA 4RM8A 2MP2B 2L00B 2L76A 1J8CA 4NJ6A 2MBOA 3QCAA 2N9XA 3HHMA 3QK0A 4WJQA 3K9PB 4FBJB 1TBEA 2FIDA 3A4RA 3ZRFA 4B6WA 3QIJA 4NNJB 1E7VA 3DBRI 2IZVB 2VRRB 2ZNVC 3PRZA 2IY0B 4HJKA 1YJ1A 4ZDVA 1T0YA 4TV3A 4FA6A 1ISNA 2XEWA 3L0WB 2G45B 4WWNA 2LRWA 2LVOA 2KFKA 4GB9A 2K25A 2KD0A 4E71A 4MGIE 3V6CB 3DBLI 2N1VA 2ASQA 2NBVB 3MTNB 4GSWA 2KJRA 3HM3A 2XK5A 3PZDA 4FULA 2RSUA 3ONSA 4LDTD 3MJWA 4FJZA 2DHZA 2M4NA 4HCNB 4W9FA 4AOFA 4W9LA 3NS8A 1C3TA 3MHSD 3IFWB 3RUIB 3JYUA 1WJ4A 2MBEA 1EF1A 3P2BA 4HWIB 2Z0EB 3H9DA 3R7QA 5G55A 1WH3A 3UQBA 3N32A 2L05A 1E8XA 1YQBA 3M3JA 4KDIC 2MA9B 2N9EB 3W1SA 4EZKA 1WFYA 1LM8B 2NPTB 4BBNF 2IY1B 2V3SA 3PTFC 3A9KB 3DBSA 4GOCA 2GOWA 1WE6A 4CHKA 3RULA 4MM3A 3R3MA 4FN2A 1SE9A 3VUYA 2KANA 3OJ3A 1ZKHA 4A3OA 3UQAA 2PPHA 1V49A 2BKFA 1E8ZA 1MG8A 3PPAA 3U7DA 3UIPB 2RD0A 4IM0A 2K39A 3A1QB 2JXXA 4M8MA 1WZ0A 3A9JB 1F9JA 3N3KB 1OEYA 4ANUA 2JF5A 2MSED 2LUEA 2JT4B 4F1SA 4RMAA 4TKNA 4TQ1A 2GMIC 3NZUA 3ZTDA 2AL6A 2MBQA 4PYZA 3W1YA 2KOXA 2NPTA 3H7PA 2BPSA 2DAJA 5CX3A 2JRIB 4IG7B 5DPWA 4EUTA 2BKRB 3VTVA 2MBHA 5BO4B 4K1RB 3ZKJC 2FNJB 4ZRKA 3RT3B 2KJHB 2KX3A 1XD3B 2AYOB 4IWOA 4WJNA 3LDZE 4PS8A 1WJNA 5JHAA 1RRBA 2KXJA 2ZCCA 2C7NB 2LGDA 3BY4B 5G2NA 2KC2A 1UD7A 3PS6A 2O6VA 3ZIMA 4KSKC 4DXAB 1WJUA 2A4ZA 2GBMA 1XT9B 4GDKB 3TL5A 1LXDA 4FLHA 3SU8X 2L0FA 3VDZA 2NS5A 1Z2MA 4G50A 4K81A 3IHPC 3VXWA 2K1FA 3JSVA 2K8CA 2KKCA 1TZ1A 2L0TA 4WAAA 2ZPYA 1V81A 4JGHB 1LFDA 3ZDMC 4W9KA 1V6EA 4EKUA 4BVUC 1WIAA 2BYVE 2FCNA 2NBUA 3VQIA 1P98A 3DPDA 3RD2A 4K7UA 4G11A 2MRPA 2GBKA 4HDOA 5EDSA 3KYDD 2BF8B 5DPTA 1ZW7A 2MQJA 3HIZA 3WANA 2KJ6A 5CHFA 4CO7A 2J0JA 4GDKA 2KTRB 4HPMB 4KIKB 5KHOA 5LXIB 3M62B 3EHVA 3APFA 2HJ8A 4IC7B 1E8YA 4HLEA 1IYFA 3VTWA 2DZIA 4AJWA 2C5LC 5AEKB 4XC2A 1WJ6A 3R7RA 3ENEA 1IP9A 1QZEA 2ZPNA 1AARA 3ZDTA 3UGBB 2N7DA 4MSQB 1UBIA 2IO1B 3PLUA 2LI5A 1I35A 1NDDA 3R66C 3WAMA 3Q3FA 3CSTA 4MELA 3B1LX 3DVNU 2KVRA 1EF5A 2DYBA 2KLCA 2REXA 1H8CA 2KDEB 3KH0A 3OAWA 2M8SA 3H6NA 1OTRB 3WA0A 1G6JA 2RR9A 2LXCA 4K7SA 3DQVA 3GOEA 1WRDB 4M8NA 1X1MA 4MGZE 2BYEA 1Z5SB 1V80A 4NAWB 1UBQA 3X0WA 1OGWA 2XK5B 4BOZB 2I1JA 2FCQA 1EUVB 3NY5A 3QWZB 4MGYE 1V2YA 2MBBB 4TQ0A 3V6EB 4BFRA 1ZGUB 4HXDA 2CHZA 3IVFA 1L2NA 4HPLB 1GC6A 4ANXA 2KQ7A 3LJ3A 2WX1A 1D3ZA 2LWPA 4EFOA 2KHWB 2V4LA 2LGYA 2N9PC 2Y5BB 4M0WB 2G4DB 4DK5A 1WXVA 1A5RA 4MGKE 3CF6E 2IO2B 4MDKE 2HD5B 3H1UA 2WX0A 2ZVNA 2FCSA 5TR5A 2D2QA 4KVGB 2M1MA 3PT2B 2K6QA 4LJPB 4XX5A 3DVGY 2KTFA 4RM9A 5L83A 2DZJA 3W1SC 4TUUA 2DZKA 4FJYA 1BT0A 1V9JA 3JW0X 4GDLA 2A5UA 2IO3B 3HK0A 3ZNHB 4PYUA 2W9NA 4IWQA 2AL3A 5GMVA 1WYWB 2MLBA 3A9JA 3EECA 3PRPB 3TCAA 3VHTC 3PVLA 1TTNA 3NZSA 2KDIA 2CHXA 3PREA 5DCNA 3ZRCA 4ZRJA 3ZUNA 5IAAC 2YVCA 4KSLC 4ANVA 5DPSA 2J0MA 2DX5B 4ASWC 1KOTA 3H7PB 5CHVC 3WIMA 3RZFA 2KLGA 1P0RA 5AZFA 2NR2A 2JPHA 2FAZA 4WQOB 3V60A 2FCMA 5FR6A 3UF8A 5DPRA 4URKA 3KVFB 3SDLC 2LXAA 4AP4C 2D07B 4B95A 1P1AA 2LVPA 3AU4A 3ZTCA 2ZZPB 2JZ3B 2L8JA 3IG3A 3QHTA 4NAWA 5D94A 2O6VB 2R2OA 3KW5B 2CU1A 1WM2A 3APDA 3ALBA 1VD2A 3PSEB 4FHJA 4MJSB 3VH3B 1PQSA 2JUOA 3RZWC 1P3QU 2KZRA 2UYZB 2PE6B 1HE8A 2M0XA 4HCPB 1J19A 2KDFB 4CYEA 1WGRA 4IWPA 2G3QB 2M17A 3QAQA 1UZXB 2D10A 2JZZA 2O2VA 1WXSA 4JQWC 3ZO5B 3TJPA 1YIWA 3I3TB 3ZW3A 2Z0DB 4JIOU 1Q5WB 1CMXB 2I1KA 2C9WB 2N7EA 2KC1A 4NJ7A 4DHJD 4I6NB 3VUWA 4DBGA 2N4FA 3WALA 4A20A 2ZEQA 2IBIB 1WF9A 1VCBA 1NBFC 1L7YA 4WJOA 2KTRA 4KIKA 4E3CA 4MH0E 4JL9A 4K7WA 2GBJA 3ZNZB 3ZNID 4IUMB 4HVBA 3VVWB 3Q3JA 3M63B 3RCZA 3T8MA 3ZLZA 4DHZB 2EMSA 3SD5A 1R4NI 5KHQA 1RLFA 3QJZA 4GXBA 4DHJB 4W9IA 3ZNGC 5JZEB 2ZJDA 4IM3A 5L95C 4AJYB 2LRUA 1OEYJ 1GJZA 1WX7A 2PE9A 4NPNA 3L17A 3NOBA 3D32A 2YLMA 1WZ3A 5CTRC 1YD8U 2DYOA 5JHBA 4B9KA 3DCGA 3QX1A 1WX9A 2N1WA 3HM6X 3IBEA 2KMAA 4NY0A 1WGDA 1GC7A 2KWCA 3A4SC 2J0KA 2LGXA 3H7SA 3TIXA 5D6JB 4X57B 1M94A 2K8BA 3C0RB 4DHZE 2WWZA 4AUQC 3T9LA 2BWFA 2HTHA 4JLCA 4J6IA 2K8HA 2KWUB 5E6OA 2CS4A 4OVVA 2LZ6A 4A3PA 3JVZX 4IM2A 2BWES 1WXAA 3A1QA 3CMMB 3KUZA 2FIFA 4MJSA 5J18A 2IO0B 2MCNB 3PHWB 2CR5A 4KDLB 4P7IA 3VH4B 2DZMA 4KV2A 1UH6A 2OJRA 3AI5A 1GNUA 4E74A 2KN5A 3V61A 1R4MI 1WR6E 2CKHB 2G4SA 5J2RA 1Q0WB 3SHQA 2AEHA 1FXTB 2IYDB 1GUAB 2KMCA 3U8ZA 3X23A 4FADA 2UWQA 2PJHA 4GDLB
chains in the Genus database with same CATH superfamily
4G0NB 4QAYA 2WXFA 1Y8RC 5BMGA 1I42A 4DDID 2J52A 2J53A 1DOIA 4WJPA 3NG0A 3MJ5A 2KK8A 1D5XC 1OQRA 1WGGA 1SIFA 3B2GA 3ECIA 1WGHA 1QQRA 1EO6A 5IN7A 2BB5A 1MHXA 2KFJA 1WMHB 3TEWA 1UF0A 1WR1A 5JH5C 4BOSC 1OQYA 3P63A 4H2AA 3OJ4B 1V86A 4DWFA 2J4XA 1UGMA 1UGJA 1K8RB 1EWCA 2PW9A 3BINA 3KUDB 4JPSA 4YL8A 2JX5A 4ZYNA 1YN4A 3QA8A 1ET6A 2ZCBA 3PHXB 3L08A 5C3JB 2MW5A 2K6DB 1E8WA 4LDTB 2JYTA 4DXFA 3DBHI 1XXGA 3T3OA 1C1YB 4W9JA 2O2VB 1QLBB 5BYQA 3NVWA 2NMQA 1YX6B 1I4PA 3DVNV 4ZHOA 3RNBC 3S2AA 2C7MB 3NVYA 2MWSB 1E7PB 3M95A 2WDQB 1WE7A 2X38A 4NQKE 5JXVA 1A70A 4HDQA 1HTOA 1WI0A 5J17A 1XQQA 3AU5A 2B3AA 3RYTA 3TBLD 4US8A 3RNCC 3ML9A 5E6NA 2BT6A 4WWOA 2XNAC 2GBNA 1S1QB 3LXFA 4BKSD 1YX5B 1SGHA 5AZGA 2MJ3A 5E6PA 2ZVOA 2JY6A 2KFKB 4M01A 4W9EA 2DAFA 2IDYA 1FNWA 3QQ8B 2RGFA 2MP2B 1J8CA 3QCAA 2N9XA 4J3OD 3SR6A 3K9PB 3A4RA 3ZRFA 2WDRB 5EE1A 1V97A 2RDHA 4P1CC 4B0MA 2IY0B 1Q10A 1ISNA 2LRWA 2KD0A 1WYGA 4MGIE 3DBLI 4AQ7A 2KJRA 2XK5A 4P6VF 5D3DA 1FMAD 1ZE3D 4HCNB 4W9FA 4AOFA 1TS3A 1WJ4A 2MBEA 1EF1A 4A6QA 4LNFA 4KKJA 2N9EB 1SE4A 1UWMA 4EZKA 1LM8B 2NPTB 2V3SA 4A3OA 2GB1A 2RD0A 3A1QB 1WZ0A 1ZXHA 1F9JA 1OEYA 4C00A 1PGBA 1XLOA 2JF5A 4UDUC 2JT4B 4F1SA 1D5MC 3NZUA 1JCKB 2MBQA 2BPSA 4HEA1 4IG7B 3BVZA 4EUTA 2BYTA 4YTPB 4B0EA 2Y5CA 4GLSC 4K1RB 3ZKJC 4M00A 2KJHB 2KACA 1NYQA 4XYCA 2AYOB 4WJNA 2RMMA 2INPE 1FXIA 5G2NA 2KC2A 2BS4B 1C9FA 2BW2A 3VRBB 1WJUA 2GBMA 4KKIA 4FLHA 3VDZA 2L0FA 4K81A 1LFDA 2BYVE 3DPDA 1ACCA 2KQ4X 4K7UA 1TY2A 5EDSA 1XLPA 5I4DA 5CHFA 2KTRB 4HPMB 5LXIB 3APFA 3VTWA 1N63A 5AEKB 1CQVA 1DGJA 3ENEA 1QZEA 2N7DA 3GS2A 3WAMA 3B1LX 3DVNU 2KLCA 2REXA 2BTEA 1VZ8A 3H6NA 1RM6C 1YMHE 4M8NA 3DQVA 3GOEA 1X1MA 3SFEB 4C7YA 1V80A 5H92C 1EUVB 3NY5A 3QWZB 1N6ZA 3V6EB 4RGTA 4BFRA 1FNVA 2V3PA 4HPLB 1GC6A 3FC4A 3FILA 2KHWB 4S17A 2K9XA 4ITKA 2N9PC 1WXVA 1ZOYB 3CF6E 1YN5A 1K50A 3I5JC 4AS1A 2K6QA 3TEYA 3DVGY 2AQ3B 3GZNB 4TUUA 4A90A 3MC0B 2DZKA 1BT0A 1BXTA 2HDEA 3V3XA 1JALA 2E6XA 2W9NA 1N5XA 5GMVA 5IO9A 4D2KA 3PRPB 3TCAA 3VHTC 3AE7B 1DOYA 3PVLA 2N9KA 4ZRJA 4NZLB 5IAAC 4ANVA 5DPSA 4ASWC 3W9CB 3ETRA 2KLGA 1N62A 1P0RA 1RYJA 2NR2A 5TSSA 3KVFB 4B95A 2WNMA 3ZTCA 2JZ3B 2L8JA 3IG3A 3QHTA 4NAWA 1LGRA 2O6VB 4JX1C 2R2OA 3KW5B 1FM0D 3GP7A 2QMTA 3TEZA 3PSEB 4ARCA 1XLNA 1TKGA 3RZWC 1GB1A 2UYZB 2PE6B 1HE8A 4CYEA 2QDFA 1WGRA 2G3QB 2M17A 1UZXB 1V8CA 3RNGC 2O2VA 1I4QA 4OZCA 3ZW3A 2W82A 2IGHA 2C9WB 4NJ7A 4DHJD 4I6NB 1WGKA 2VZKD 4IKGA 4A20A 2IBIB 1VCBA 4E3CA 2WXQA 3BK1A 3DBRB 4IUMB 3Q6BA 1ZDVA 1R4NI 5KHQA 3O13A 4DHJB 1TY0A 2WXMA 4LNNA 4IM3A 3CWIA 1OEYJ 4NPNA 3L17A 3W5UB 1WZ3A 2DYOA 3AE8B 4RF0A 2N1WA 5FK9C 2KMAA 3Q8BA 5HI1A 3P1MA 1L0VB 4RGNA 2CJNA 1C4PA 1M94A 2BS2B 3C0RB 2WXPA 2WWZA 2HTHA 1AW7A 2G9HD 3JVZX 2BWES 1WXAA 3CMMB 2BB6A 5GXGB 3KUZA 1AN8A 1PDXA 3P4RB 3ZXRA 1JWSD 2IO0B 4P7IA 3MP9A 1YQ3B 3AI5A 4E74A 2ICIA 4R3DA 5IKCM 2V4IB 4RNAA 3PZ8A 2UWQA 2JVCA 3B0AA 1I4HA 2V1YA 4KZCA 1FCCC 1WGYA 3I63C 2W55A 4WWPA 1H4RA 1SBBB 3ZJTA 4XDDA 1CJEA 3FAHA 3WAOA 2PMVA 3A33B 2VH1A 2R2QA 4JE3B 4C7ZA 2L3ZA 3JSVB 2HE7A 3ZVVA 2LUMA 2MP2A 2ZW1A 3L13A 3VFKA 3DDCB 4ANWA 2JRHA 2O6VD 2BGFA 1P9DU 1EU4A 3P4QB 3RMKC 1XLQA 2PTLA 2GRIA 2DYMA 3SEBA 3DBHB 3DVGX 1D4BA 4W9HA 3DOWA 4GN1A 4NAMA 1HEZE 5MPOA 3L10B 4GGQA 4GIVA 2D3AA 3P42A 2MJDA 2NCNA 5CHWA 1WXMA 1QF6A 3RPFC 4LNOA 1RAXA 4W9GA 2LASA 1M4VA 1JW9D 2KQSA 4PS3A 3U4EG 2XBBC 4II2B 3PGEA 2BYFA 1V5TA 2C7HA 2NVUI 4KGSA 2AX5A 4EEWA 4FJVB 4FHKA 1LQBA 4TMAB 5D2MB 1GAQB 2JWZA 2RPQA 1E90A 4EOYA 1KLVA 1JWUD 4YTNB 4N59A 3UIOB 4DDGD 1KJTA 2Z59B 1GB4A 2D3GA 3B08A 4LLGM 1U4AA 3GZNI 1KFYB 2LJ5A 4PS7A 1V1PA 1J0GA 3K9OB 3PLVA 1Y56A 2WXLA 2LMCA 2L76A 4NJ6A 2MBOA 4WJQA 4FBJB 2FIDA 2D3BA 4B6WA 1E7VA 3DBRI 1ENFA 3DWGC 2VRRB 3OWEB 2VH2A 2RPVA 1XO3A 4ZDVA 1UUPA 1T0YA 1QOAA 2G45B 4C4VB 2KFKA 2N1VA 2NBVB 2Y5PA 4XWTA 2K3UA 4FJZA 2BBCA 1DOXA 4OVZA 1C3TA 5T8IA 3EUB2 3AN1A 3R7QA 5G55A 4YSYB 4KDIC 3RNAC 1R7SA 3W1SA 1WFYA 1NVID 2L1AA 4REZA 3SFDB 1ROEA 5AUIA 1TS4A 1SE3A 3A9KB 3DBSA 4GOCA 2GOWA 3RULA 3R3MA 4FN2A 4PK1A 1E8ZA 3PPAA 4IM0A 2PVGC 4M8MA 3DHGC 2MSED 2LUEA 4TKNA 1UWXA 1E6EB 1NENB 5EE3A 2JRIB 5DPWA 1F77A 2JXTA 5BO4B 4ZRKA 4USAA 2Y3AA 1YN3A 2J42A 3T3NA 2LGDA 1UD7A 4O1NA 4A55A 3C8YA 1XT9B 1VDVA 2QEJC 3AE5B 1XCTL 3BWUD 3IHPC 2LHEA 2K1FA 2K8CA 2INNE 1V81A 3ZDMC 4KGTA 4BVUC 1WIAA 1L4ZB 1P98A 1IUEA 4HDOA 2LJIA 1ZW7A 3HIZA 3TSSA 2QJLA 2LGIA 1FO4A 2SEBD 1L0YB 3FKYA 5KHOA 2WXIA 3M62B 4HLEA 4IC7B 1E8YA 1WJ6A 3R7RA 1IP9A 3ZDTA 4MSQB 1UBIA 1FIQA 3R66C 5EE9A 3Q3FA 4ZHPA 1H8CA 3OAWA 3DHIC 3WA0A 4MGZE 2PKOA 4NAWB 2YEPB 1UBQA 3X0WA 3W5VB 2XK5B 4BOZB 2FCQA 2MBBB 1ZGUB 3IVFA 3BVMA 4ANXA 3AE1B 2LWPA 3N1YC 4P1BC 4EFOA 2G4DB 1A5RA 1PGAA 3RN9C 4MDKE 4WQMA 5BMHA 2ZVNA 3PT2B 4XX5A 5L83A 1HA5A 3AEAB 2UU7A 4HKQA 1R4MB 4FJYA 2TSSA 4GDLA 3NZ3A 2IO3B 3ZNHB 4IWQA 1WSPA 4JWUC 4PT5A 2ACZB 2AQ1B 4YXDB 2CHXA 3ZRCA 1HQRD 1YQ4B 3AEDB 3ZUNA 4C4VA 2YVCA 2DX5B 1J7BA 2V3NA 4L23A 2H88B 2JPHA 2FAZA 4WQOB 3V60A 2N7JA 4WH4A 2LXAA 4AP4C 1AYFA 3AU4A 1OQQA 5D94A 3TEXA 3VR8B 2DWQA 3L4PA 3R2TA 2D5GA 1P3QU 2YEPF 3QAQA 4US9A 2JZZA 1WXSA 1ZXIA 3TJPA 1Q5WB 1CMXB 4C56C 1FFVA 3U7ZA 3H8HA 3EFCA 2QCZA 2KTRA 2MEKA 3KWVA 3ZJVA 3PZ7A 4RGOS 2GBJA 3ZNZB 3M63B 3ZLZA 2EMSA 2AQ2B 1RLFA 3QJZA 4W9IA 5JZEB 4RGMA 5L95C 4AJYB 1GJZA 4XGAB 3HRDD 2LEKA 2YLMA 3J9CA 4ZOHC 5EE0A 3HM6X 2NTTA 1L4DB 3A4SC 2LGXA 3H7SA 4X57B 4IDIA 1VLBA 4DHZE 3W2DA 4AUQC 2BWFA 1SIJA 5LNK1 2CS4A 3MC8A 2LZ6A 4IM2A 4LK0M 3A1QA 3Q2AC 1R4NB 3AV8A 2MCNB 2CR5A 4KV2A 1UH6A 2L83A 2OJRA 3ZXVA 2KN5A 3V61A 1WR6E 2BVCA 5J2RA 1Q0WB 2AEHA 1GUAB 1T0QC 3X23A 3PO0A 1ESFA 2PJHA 2V9HA 4EZLA 3Q69A 4F8CB 4NQLB 1E10A 2Z8LA 1V5OA 3L54A 3AE2B 1QT9A 5C1ZA 1MVKA 3I9V1 1E5WA 4GMVA 4ICVA 5AZHA 1Q1OA 2WYQA 2KO3A 1C79A 1E9MA 2KDBA 2BS3B 2DLBA 1OFFA 5HKHA 4BKGA 1ZDXA 1ZP0B 1GG3A 1B9RA 3EFUA 3KWLA 3KYCD 1SEBD 4GU2A 1UELA 2KMMA 3DBLB 4LJOB 4EZJA 3NRZA 1E0ZA 1KLUD 2WDTB 4HKZE 4ICUA 1RFAA 2L7RA 1AWDA 4G3XB 4IW0A 3U30A 4IOIE 2LD9A 4MSMB 2DNFA 2I2YA 1WMHA 4LCDE 3AB5A 1CZPA 5IA7A 1WX8A 2LVQA 1DYQA 1S3SG 3NUHB 2CHWA 3AM9A 3R8BA 4C80A 2K0PA 5H8YE 3Q8CA 3RNEC 3ML8A 4OVUA 2JSVX 2CU3A 3QARA 4AWJA 1C78A 1KM7A 3APCA 1TIFA 3AH7A 1TGZB 3PV1A 4ARIA 2K5PA 2MX2A 3Q8FA 1I4RA 3WAPA 3IT4B 2HTME 4W9CA 1IPGA 3Q3MC 5D7GA 5LLIA 3AXCA 2JZPA 1VR9A 3QC8B 1BMLC 2FUHB 2NBWB 3CSFA 4YT0B 3BK2A 3HHMA 2FE8A 4NNJB 3LB8C 2WXOA 1FD6A 4YWGG 2ZNVC 3PRZA 1JWBD 4HJKA 4HROA 4TV3A 4FA6A 1CK1A 2XEWA 3P4SB 1QOGA 4GB9A 4YSXB 4E71A 4OZAA 4HJGE 2CJOA 4GSWA 2ASQA 3MTNB 3PZDA 1L0XB 1UNSA 1IGCA 3MJWA 2D3CA 3AE4B 3MHSD 3IFWB 3RUIB 3FILB 3JYUA 4HRSA 4HWIB 1WH3A 3UQBA 3N32A 2L05A 1E8XA 1YQBA 2WU5B 4FXCA 1TKYA 4RCOA 1VZ6A 4BBNF 2IY1B 1K51A 3GB1A 3PTFC 4OW0A 5IP4D 4CHKA 1MJDA 1SE9A 1PUTA 2KANA 2XN9C 3OJ3A 1ZKHA 3UQAA 3Q8AA 2BKFA 3UIPB 1TZOA 2JXXA 1P7FA 3A9JB 4ANUA 4ACFA 4TQ1A 4Q2JA 5FR3A 3ZTDA 2GLSA 3W1YA 2KN4A 2DAJA 3MC9A 4BAXA 2BKRB 2MBHA 1TS5A 2FNJB 3RT3B 4A9AA 3IXSA 1YJIA 1F2RC 1TS2A 1WJNA 5JHAA 2KXJA 1T5XD 5AUKA 1T0SC 1V1OA 2WXHA 3BY4B 2N0SB 3PS6A 2O6VA 4HPPA 2RDBC 4DXAB 3AECB 3NS1A 2A4ZA 3TL5A 1SJED 2NS5A 1Z2MA 4G50A 4NJCA 3ZJUA 3VXWA 1T3QA 3Q14C 5HHDG 1SE2A 1D5ZC 1NI3A 1I4GA 4JGHB 2EELA 3CIRB 2FCNA 5E6JA 4G11A 2GBKA 2BF8B 1I4XA 2M56B 1FRDA 2KDMA 2KJ6A 1PGXA 3EHVA 1RWSA 4ZRPA 4CQNA 3ZYYX 2ZPNA 1T0RC 2OEDA 2IO1B 3PLUA 1I35A 1NDDA 2JYEA 2RDGA 3CSTA 4MELA 2DYBA 2KDEB 3KH0A 3TUOA 2M8SA 1VZ7A 2RR9A 3DWMA 4K7SA 2E3TA 1Z5SB 4WAFA 1OGWA 4KX6B 3HUIA 2INCC 4MGYE 3NJTA 1V2YA 4HXDA 1L2NA 3KQ4A 2KQ7A 1D3ZA 4WURA 1TT5B 4K3BA 2Y5BB 3B2FA 4DK5A 3MHZA 3H1UA 2FCSA 3AEGB 3IAS1 4LJPB 3BYYB 3Q3NC 1NYRA 2DZJA 1V1PB 4MM3B 1V9JA 1GOZA 1TJEA 2KAJA 2OHFA 3EECA 2IJ0A 2VZKB 3N1XC 2ZW0A 4N6EB 2KDIA 5DCNA 2J0MA 1KOTA 3H7PB 5CHVC 3RZFA 4DXGA 3RI7C 4OZBA 2FCMA 1L6VA 3SDLC 2D07B 2ON8A 2ZZPB 1F52A 1N60A 2CU1A 3B9JA 4XWWA 1WM2A 3APDA 2IGGA 3ALBA 3VH3B 1RFKA 1JROA 2KZRA 2QC8A 2M0XA 2L52A 1YIWA 3I3TB 2Z0DB 1GPXA 2EKIA 3VUWA 1SJHD 4DBGA 2N4FA 2INDC 1WF9A 2PLPA 1L7YA 2WXKA 4KIKA 1KLGD 4MH0E 1K53A 1QKZA 4K7WA 2IGDA 4TSSA 4HVBA 4LNIA 3VVWB 3DHHC 4DQOC 4DHZB 4WWMA 1FEHA 4GXBA 2W54A 1SF0A 2ZJDA 2LRUA 5C2TB 2PE9A 2PIAA 1N5WA 5JHBA 3DCGA 3QX1A 3AMZA 3IBEA 3URYA 4YTMB 2N9LA 4XE0A 1WGDA 2WXNA 2KWCA 2J0KA 3TIXA 1YOVB 5D6JB 1YJJA 5HG2A 4JWSC 3EGRA 3T9LA 4JLCA 4J6IA 2K8HA 2KWUB 5E6OA 1JWMD 3AEBB 2QSDA 1L5PA 2FIFA 5J18A 2OJWA 4KDLB 1R4MI 2LFIA 2CKHB 2G4SA 2QILA 2K22A 2IYDB 2KMCA 3U8ZA 3E9SA 2KYWA 4FADA 4GDLB 3UINB 1E7UA 3EA6A 2QHOA 2H89B 4BBNC 4YSZB 3OG5A 4L1BA 3Q8EA 2KNBA 4I6LB 2SAKA 3ZQ4A 2WXRA 3N30A 1JMLA 1ZPSA 2BQQA 1KRHA 2D11A 4XZ4A 3ZGZA 5G5GA 4ZRIA 3AEFB 1FCLA 3IT6B 3VAWA 3NHEB 3P4PB 1HXYD 3V05A 3AEEB 4BKTA 1TKEA 3AE6B 4W9DA 1D6EC 1NI2A 5G5HA 2KWVB 3AULA 5LXHA 3O65B 2EKEC 3VR9B 3VTUA 2ZNVB 3PRMB 3ABVB 4MEMA 4BKSA 3TMPB 2DENB 4MACA 1FFUA 3GE3C 3E56A 3WCQA 3VUXA 2FUG1 2WU2B 3KUCB 4HK2A 2PEAA 4N9F4 1KTKA 4F7ZA 1SXTA 2AWTA 4I6PA 4KZ0A 4XDCA 2EMTA 3C19A 2C60A 5BYSA 1FRRA 5C23A 3A9KA 4II3B 2KX0A 4M02A 1WY8A 1WM3A 2OOBB 2GBRA 2W3RA 2Q5WD 1FNUA 3V62A 1JRUA 3OLMD 4N58A 1YNTE 1FPYA 1FXAA 1XEEA 3R2IA 3EC8A 1MPEA 4K3CA 3L16A 2J7QB 3GE8C 1C77A 3BZDB 4RM8A 2L00B 1EU3A 3QK0A 1TBEA 3MFGA 3QIJA 2IZVB 1YJ1A 1F2RI 3L0WB 4WWNA 2LVOA 2K25A 3NVZA 3V6CB 1ET9A 3HM3A 4FULA 2RSUA 3ONSA 4LDTD 4RH6A 4EE2A 2DHZA 2M4NA 4W9LA 3NS8A 2LHDA 5FKAC 3P2BA 2Z0EB 3H9DA 2JWUA 2W3SA 2PVOD 3M3JA 2MA9B 1KF6B 1WRIA 1KH0A 1WE6A 4MM3A 3VUYA 2PPHA 1V49A 2JQRB 3U7DA 1MG8A 2K39A 2ONQA 3AE9B 3N3KB 4RMAA 1QOBA 4P16A 2GMIC 2AL6A 4PYZA 2KOXA 2NPTA 3H7PA 5CX3A 3U52E 3VTVA 1HTQA 3U2SC 3Q3OC 2KX3A 2WLBA 1QILA 1XD3B 4IWOA 4PS8A 3LDZE 1MFWA 2DBYA 1HZ6A 1F0ZA 1RRBA 2ZCCA 2C7NB 3RFZB 4L2YA 3ZIMA 4KSKC 4GDKB 1LXDA 2WS3B 3SU8X 3VRAB 3KLSX 3JSVA 1I7HA 2KKCA 1TZ1A 2L0TA 1JWAD 4WAAA 2ZPYA 3NVVA 4S0RA 1C4CA 4W9KA 5D3IB 1V6EA 4EKUA 3BYTB 2NBUA 3VQIA 3RD2A 2MRPA 1WXQA 3KYDD 5DPTA 2MQJA 3WANA 4CO7A 2J0JA 3IAM1 4GDKA 4KIKB 1IYFA 1EM7A 2HJ8A 2DZIA 4AJWA 2C5LC 4XC2A 1AARA 3I57A 3UGBB 1SSNA 2LI5A 2G1EA 4M0WA 2KVRA 1EF5A 4A8XC 1OTRB 2WQYB 1G6JA 2LXCA 1C76A 1WRDB 1IBXB 2BYEA 1VJKA 2I1JA 4ZRQA 4TQ0A 1NEKB 2CHZA 3N9YC 3LJ3A 2WP9B 2WX1A 2JU6X 2R61A 1PYWD 2V4LA 2LGYA 2MHJA 4M0WB 3HVDA 4MGKE 2IO2B 2HD5B 2WDVB 2WX0A 3N20C 5TR5A 2D2QA 4KVGB 1B1ZA 2M1MA 2FBWB 2KTFA 3LYYA 4RM9A 1JQ4A 1K52A 3W1SC 3BIID 3RNFC 3JW0X 2A5UA 3HK0A 2X8XX 4PYUA 1MHHE 2AL3A 1WYWB 2MLBA 1C4AA 3A9JA 1TTNA 2MJEA 3NZSA 3PREA 1SB3C 1EWYC 3N1ZC 4KSLC 4ZYSA 3WIMA 1P7EA 2QIEB 2IPKD 5AZFA 4KGRA 4URKA 5FR6A 3UF8A 5DPRA 4RF1A 2LGSA 2M19A 1P1AA 1F1HA 2LVPA 2KWDA 1IBXA 1VD2A 3UI3A 4FHJA 4MJSB 1PQSA 2JUOA 1N61A 1ZUD2 4HCPB 1J19A 2KDFB 4IWPA 1MI0A 1TYGB 2D10A 4OHJA 3BVGA 4JQWC 3ZO5B 2HJ1A 5BMIA 2I38A 1J7CA 2B76B 4JIOU 1J7AA 2I1KA 2N7EA 2WGSA 2KC1A 4BZAA 3WALA 2ZEQA 1HZ5A 1NBFC 2WHIA 4WJOA 1XF5L 4LTUA 4JL9A 5IOIA 1STEA 3ZNID 1PFDA 4MT5A 3Q3JA 3RCZA 3T8MA 3SD5A 5HFYA 2GI9A 2WXJA 1L6UA 3ZNGC 2MH7A 1JRPA 2V0GA 3HVZA 2WXGA 1WX7A 3NOBA 3D32A 5CTRC 1YD8U 3AE3B 4B9KA 1WX9A 4MH8A 4NY0A 1GC7A 1MG4A 2L32A 2KVZA 1XCQL 2K8BA 4LNKA 4OVVA 5BYRA 2M0AA 4A3PA 1T6BX 4MJSA 3PHWB 3VH4B 2DZMA 2NTSA 1GNUA 1WWTA 4RFBA 1VRAB 1LO5D 3SHQA 1FXTB 1BUIC 1QOFA 1IGDA 2KT7A 4WIPA
chains in the Genus database with same CATH topology
2JVCA 3B0AA 4G0NB 2V1YA 3UINB 1Y8RC 4EZLA 4KZCA 1WGYA 4F8CB 4NQLB 1E7UA 1I42A 4DDID 1V5OA 3L54A 2QHOA 4WWPA 5C1ZA 1H4RA 4WJPA 1E5WA 4GMVA 4ICVA 3WAOA 4BBNC 5AZHA 3A33B 2R2QA 1Q1OA 2WYQA 2KO3A 2KK8A 2L3ZA 3JSVB 2HE7A 2KDBA 3ZVVA 1WGGA 2MP2A 2KNBA 4I6LB 1SIFA 3L13A 3ECIA 1WGHA 5HKHA 3VFKA 3DDCB 4BKGA 4ANWA 1EO6A 1GG3A 2JRHA 3N30A 2D11A 4XZ4A 2KFJA 1WMHB 2BGFA 2O6VD 1P9DU 1WR1A 3EFUA 5JH5C 4ZRIA 3KYCD 4BOSC 3VAWA 1OQYA 4GU2A 4DWFA 3OJ4B 1V86A 1UELA 3NHEB 4LJOB 4EZJA 1UGMA 2WDTB 2DYMA 4BKTA 4ICUA 3DVGX 1RFAA 2L7RA 4W9DA 4W9HA 3DOWA 1K8RB 1NI2A 4G3XB 4GN1A 4IW0A 2KWVB 3BINA 3KUDB 3L10B 3U30A 3AULA 5LXHA 3O65B 2EKEC 4GGQA 4GIVA 4YL8A 2LD9A 4ZYNA 4MSMB 3VTUA 3QA8A 2ZNVB 2ZCBA 3PHXB 3PRMB 3L08A 2MW5A 2NCNA 2K6DB 4MEMA 4BKSA 1E8WA 4LDTB 5CHWA 1WMHA 1WXMA 3DBHI 3TMPB 2DENB 4LCDE 1C1YB 1RAXA 4W9JA 2O2VB 4W9GA 2LASA 5IA7A 1WX8A 3VUXA 2LVQA 3KUCB 2PEAA 4HK2A 1S3SG 1YX6B 3DVNV 4N9F4 2KQSA 4PS3A 4F7ZA 2CHWA 2AWTA 2XBBC 4I6PA 2C7MB 4KZ0A 3S2AA 4II2B 2EMTA 3PGEA 2MWSB 2BYFA 3M95A 1V5TA 2C7HA 3ML8A 2NVUI 4OVUA 4EEWA 1WE7A 3QARA 4AWJA 4FJVB 4FHKA 4NQKE 1LQBA 5D2MB 2C60A 4HDQA 1KM7A 2JWZA 3APCA 2RPQA 1E90A 4EOYA 1WI0A 5J17A 1KLVA 1TGZB 3PV1A 1XQQA 3AU5A 5C23A 3A9KA 4DDGD 3UIOB 2MX2A 2B3AA 2KX0A 4II3B 3RYTA 1WY8A 3TBLD 1WM3A 1KJTA 2GBRA 2OOBB 3ML9A 5E6NA 3WAPA 2Z59B 4WWOA 2D3GA 2GBNA 1S1QB 4W9CA 1IPGA 3B08A 3V62A 1JRUA 1YX5B 1SGHA 5D7GA 5AZGA 1U4AA 4BKSD 3OLMD 3GZNI 5LLIA 5E6PA 3AXCA 2ZVOA 2JY6A 2KFKB 3QC8B 2LJ5A 4PS7A 4W9EA 3EC8A 2FUHB 1J0GA 2DAFA 3K9OB 3L16A 2NBWB 3CSFA 2J7QB 3PLVA 3QQ8B 2RGFA 4RM8A 2MP2B 2L00B 2L76A 1J8CA 4NJ6A 2MBOA 3QCAA 2N9XA 3HHMA 3QK0A 4WJQA 3K9PB 4FBJB 1TBEA 2FIDA 3A4RA 3ZRFA 4B6WA 3QIJA 4NNJB 1E7VA 3DBRI 2IZVB 2VRRB 2ZNVC 3PRZA 2IY0B 4HJKA 1YJ1A 4ZDVA 1T0YA 4TV3A 4FA6A 1ISNA 2XEWA 3L0WB 2G45B 4WWNA 2LRWA 2LVOA 2KFKA 4GB9A 2K25A 2KD0A 4E71A 4MGIE 3V6CB 3DBLI 2N1VA 2ASQA 2NBVB 3MTNB 4GSWA 2KJRA 3HM3A 2XK5A 3PZDA 4FULA 2RSUA 3ONSA 4LDTD 3MJWA 4FJZA 2DHZA 2M4NA 4HCNB 4W9FA 4AOFA 4W9LA 3NS8A 1C3TA 3MHSD 3IFWB 3RUIB 3JYUA 1WJ4A 2MBEA 1EF1A 3P2BA 4HWIB 2Z0EB 3H9DA 3R7QA 5G55A 1WH3A 3UQBA 3N32A 2L05A 1E8XA 1YQBA 3M3JA 4KDIC 2MA9B 2N9EB 3W1SA 4EZKA 1WFYA 1LM8B 2NPTB 4BBNF 2IY1B 2V3SA 3PTFC 3A9KB 3DBSA 4GOCA 2GOWA 1WE6A 4CHKA 3RULA 4MM3A 3R3MA 4FN2A 1SE9A 3VUYA 2KANA 3OJ3A 1ZKHA 4A3OA 3UQAA 2PPHA 1V49A 2BKFA 1E8ZA 1MG8A 3PPAA 3U7DA 3UIPB 2RD0A 4IM0A 2K39A 3A1QB 2JXXA 4M8MA 1WZ0A 3A9JB 1F9JA 3N3KB 1OEYA 4ANUA 2JF5A 2MSED 2LUEA 2JT4B 4F1SA 4RMAA 4TKNA 4TQ1A 2GMIC 3NZUA 3ZTDA 2AL6A 2MBQA 4PYZA 3W1YA 2KOXA 2NPTA 3H7PA 2BPSA 2DAJA 5CX3A 2JRIB 4IG7B 5DPWA 4EUTA 2BKRB 3VTVA 2MBHA 5BO4B 4K1RB 3ZKJC 2FNJB 4ZRKA 3RT3B 2KJHB 2KX3A 1XD3B 2AYOB 4IWOA 4WJNA 3LDZE 4PS8A 1WJNA 5JHAA 1RRBA 2KXJA 2ZCCA 2C7NB 2LGDA 3BY4B 5G2NA 2KC2A 1UD7A 3PS6A 2O6VA 3ZIMA 4KSKC 4DXAB 1WJUA 2A4ZA 2GBMA 1XT9B 4GDKB 3TL5A 1LXDA 4FLHA 3SU8X 2L0FA 3VDZA 2NS5A 1Z2MA 4G50A 4K81A 3IHPC 3VXWA 2K1FA 3JSVA 2K8CA 2KKCA 1TZ1A 2L0TA 4WAAA 2ZPYA 1V81A 4JGHB 1LFDA 3ZDMC 4W9KA 1V6EA 4EKUA 4BVUC 1WIAA 2BYVE 2FCNA 2NBUA 3VQIA 1P98A 3DPDA 3RD2A 4K7UA 4G11A 2MRPA 2GBKA 4HDOA 5EDSA 3KYDD 2BF8B 5DPTA 1ZW7A 2MQJA 3HIZA 3WANA 2KJ6A 5CHFA 4CO7A 2J0JA 4GDKA 2KTRB 4HPMB 4KIKB 5KHOA 5LXIB 3M62B 3EHVA 3APFA 2HJ8A 4IC7B 1E8YA 4HLEA 1IYFA 3VTWA 2DZIA 4AJWA 2C5LC 5AEKB 4XC2A 1WJ6A 3R7RA 3ENEA 1IP9A 1QZEA 2ZPNA 1AARA 3ZDTA 3UGBB 2N7DA 4MSQB 1UBIA 2IO1B 3PLUA 2LI5A 1I35A 1NDDA 3R66C 3WAMA 3Q3FA 3CSTA 4MELA 3B1LX 3DVNU 2KVRA 1EF5A 2DYBA 2KLCA 2REXA 1H8CA 2KDEB 3KH0A 3OAWA 2M8SA 3H6NA 1OTRB 3WA0A 1G6JA 2RR9A 2LXCA 4K7SA 3DQVA 3GOEA 1WRDB 4M8NA 1X1MA 4MGZE 2BYEA 1Z5SB 1V80A 4NAWB 1UBQA 3X0WA 1OGWA 2XK5B 4BOZB 2I1JA 2FCQA 1EUVB 3NY5A 3QWZB 4MGYE 1V2YA 2MBBB 4TQ0A 3V6EB 4BFRA 1ZGUB 4HXDA 2CHZA 3IVFA 1L2NA 4HPLB 1GC6A 4ANXA 2KQ7A 3LJ3A 2WX1A 1D3ZA 2LWPA 4EFOA 2KHWB 2V4LA 2LGYA 2N9PC 2Y5BB 4M0WB 2G4DB 4DK5A 1WXVA 1A5RA 4MGKE 3CF6E 2IO2B 4MDKE 2HD5B 3H1UA 2WX0A 2ZVNA 2FCSA 5TR5A 2D2QA 4KVGB 2M1MA 3PT2B 2K6QA 4LJPB 4XX5A 3DVGY 2KTFA 4RM9A 5L83A 2DZJA 3W1SC 4TUUA 2DZKA 4FJYA 1BT0A 1V9JA 3JW0X 4GDLA 2A5UA 2IO3B 3HK0A 3ZNHB 4PYUA 2W9NA 4IWQA 2AL3A 5GMVA 1WYWB 2MLBA 3A9JA 3EECA 3PRPB 3TCAA 3VHTC 3PVLA 1TTNA 3NZSA 2KDIA 2CHXA 3PREA 5DCNA 3ZRCA 4ZRJA 3ZUNA 5IAAC 2YVCA 4KSLC 4ANVA 5DPSA 2J0MA 2DX5B 4ASWC 1KOTA 3H7PB 5CHVC 3WIMA 3RZFA 2KLGA 1P0RA 5AZFA 2NR2A 2JPHA 2FAZA 4WQOB 3V60A 2FCMA 5FR6A 3UF8A 5DPRA 4URKA 3KVFB 3SDLC 2LXAA 4AP4C 2D07B 4B95A 1P1AA 2LVPA 3AU4A 3ZTCA 2ZZPB 2JZ3B 2L8JA 3IG3A 3QHTA 4NAWA 5D94A 2O6VB 2R2OA 3KW5B 2CU1A 1WM2A 3APDA 3ALBA 1VD2A 3PSEB 4FHJA 4MJSB 3VH3B 1PQSA 2JUOA 3RZWC 1P3QU 2KZRA 2UYZB 2PE6B 1HE8A 2M0XA 4HCPB 1J19A 2KDFB 4CYEA 1WGRA 4IWPA 2G3QB 2M17A 3QAQA 1UZXB 2D10A 2JZZA 2O2VA 1WXSA 4JQWC 3ZO5B 3TJPA 1YIWA 3I3TB 3ZW3A 2Z0DB 4JIOU 1Q5WB 1CMXB 2I1KA 2C9WB 2N7EA 2KC1A 4NJ7A 4DHJD 4I6NB 3VUWA 4DBGA 2N4FA 3WALA 4A20A 2ZEQA 2IBIB 1WF9A 1VCBA 1NBFC 1L7YA 4WJOA 2KTRA 4KIKA 4E3CA 4MH0E 4JL9A 4K7WA 2GBJA 3ZNZB 3ZNID 4IUMB 4HVBA 3VVWB 3Q3JA 3M63B 3RCZA 3T8MA 3ZLZA 4DHZB 2EMSA 3SD5A 1R4NI 5KHQA 1RLFA 3QJZA 4GXBA 4DHJB 4W9IA 3ZNGC 5JZEB 2ZJDA 4IM3A 5L95C 4AJYB 2LRUA 1OEYJ 1GJZA 1WX7A 2PE9A 4NPNA 3L17A 3NOBA 3D32A 2YLMA 1WZ3A 5CTRC 1YD8U 2DYOA 5JHBA 4B9KA 3DCGA 3QX1A 1WX9A 2N1WA 3HM6X 3IBEA 2KMAA 4NY0A 1WGDA 1GC7A 2KWCA 3A4SC 2J0KA 2LGXA 3H7SA 3TIXA 5D6JB 4X57B 1M94A 2K8BA 3C0RB 4DHZE 2WWZA 4AUQC 3T9LA 2BWFA 2HTHA 4JLCA 4J6IA 2K8HA 2KWUB 5E6OA 2CS4A 4OVVA 2LZ6A 4A3PA 3JVZX 4IM2A 2BWES 1WXAA 3A1QA 3CMMB 3KUZA 2FIFA 4MJSA 5J18A 2IO0B 2MCNB 3PHWB 2CR5A 4KDLB 4P7IA 3VH4B 2DZMA 4KV2A 1UH6A 2OJRA 3AI5A 1GNUA 4E74A 2KN5A 3V61A 1R4MI 1WR6E 2CKHB 2G4SA 5J2RA 1Q0WB 3SHQA 2AEHA 1FXTB 2IYDB 1GUAB 2KMCA 3U8ZA 3X23A 4FADA 2UWQA 2PJHA 4GDLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JVC A;  3B0A A;  4G0N B;  2V1Y A;  3UIN B;  1Y8R C;  4EZL A;  4KZC A;  1WGY A;  4F8C B;  4NQL B;  1E7U A;  1I42 A;  4DDI D;  1V5O A;  3L54 A;  2QHO A;  4WWP A;  5C1Z A;  1H4R A;  4WJP A;  1E5W A;  4GMV A;  4ICV A;  3WAO A;  4BBN C;  5AZH A;  3A33 B;  2R2Q A;  1Q1O A;  2WYQ A;  2KO3 A;  2KK8 A;  2L3Z A;  3JSV B;  2HE7 A;  2KDB A;  3ZVV A;  1WGG A;  2MP2 A;  2KNB A;  4I6L B;  1SIF A;  3L13 A;  3ECI A;  1WGH A;  5HKH A;  3VFK A;  3DDC B;  4BKG A;  4ANW A;  1EO6 A;  1GG3 A;  2JRH A;  3N30 A;  2D11 A;  4XZ4 A;  2KFJ A;  1WMH B;  2BGF A;  2O6V D;  1P9D U;  1WR1 A;  3EFU A;  5JH5 C;  4ZRI A;  3KYC D;  4BOS C;  3VAW A;  1OQY A;  4GU2 A;  4DWF A;  3OJ4 B;  1V86 A;  1UEL A;  3NHE B;  4LJO B;  4EZJ A;  1UGM A;  2WDT B;  2DYM A;  4BKT A;  4ICU A;  3DVG X;  1RFA A;  2L7R A;  4W9D A;  4W9H A;  3DOW A;  1K8R B;  1NI2 A;  4G3X B;  4GN1 A;  4IW0 A;  2KWV B;  3BIN A;  3KUD B;  3L10 B;  3U30 A;  3AUL A;  5LXH A;  3O65 B;  2EKE C;  4GGQ A;  4GIV A;  4YL8 A;  2LD9 A;  4ZYN A;  4MSM B;  3VTU A;  3QA8 A;  2ZNV B;  2ZCB A;  3PHX B;  3PRM B;  3L08 A;  2MW5 A;  2NCN A;  2K6D B;  4MEM A;  4BKS A;  1E8W A;  4LDT B;  5CHW A;  1WMH A;  1WXM A;  3DBH I;  3TMP B;  2DEN B;  4LCD E;  1C1Y B;  1RAX A;  4W9J A;  2O2V B;  4W9G A;  2LAS A;  5IA7 A;  1WX8 A;  3VUX A;  2LVQ A;  3KUC B;  2PEA A;  4HK2 A;  1S3S G;  1YX6 B;  3DVN V;  4N9F 4;  2KQS A;  4PS3 A;  4F7Z A;  2CHW A;  2AWT A;  2XBB C;  4I6P A;  2C7M B;  4KZ0 A;  3S2A A;  4II2 B;  2EMT A;  3PGE A;  2MWS B;  2BYF A;  3M95 A;  1V5T A;  2C7H A;  3ML8 A;  2NVU I;  4OVU A;  4EEW A;  1WE7 A;  3QAR A;  4AWJ A;  4FJV B;  4FHK A;  4NQK E;  1LQB A;  5D2M B;  2C60 A;  4HDQ A;  1KM7 A;  2JWZ A;  3APC A;  2RPQ A;  1E90 A;  4EOY A;  1WI0 A;  5J17 A;  1KLV A;  1TGZ B;  3PV1 A;  1XQQ A;  3AU5 A;  5C23 A;  3A9K A;  4DDG D;  3UIO B;  2MX2 A;  2B3A A;  2KX0 A;  4II3 B;  3RYT A;  1WY8 A;  3TBL D;  1WM3 A;  1KJT A;  2GBR A;  2OOB B;  3ML9 A;  5E6N A;  3WAP A;  2Z59 B;  4WWO A;  2D3G A;  2GBN A;  1S1Q B;  4W9C A;  1IPG A;  3B08 A;  3V62 A;  1JRU A;  1YX5 B;  1SGH A;  5D7G A;  5AZG A;  1U4A A;  4BKS D;  3OLM D;  3GZN I;  5LLI A;  5E6P A;  3AXC A;  2ZVO A;  2JY6 A;  2KFK B;  3QC8 B;  2LJ5 A;  4PS7 A;  4W9E A;  3EC8 A;  2FUH B;  1J0G A;  2DAF A;  3K9O B;  3L16 A;  2NBW B;  3CSF A;  2J7Q B;  3PLV A;  3QQ8 B;  2RGF A;  4RM8 A;  2MP2 B;  2L00 B;  2L76 A;  1J8C A;  4NJ6 A;  2MBO A;  3QCA A;  2N9X A;  3HHM A;  3QK0 A;  4WJQ A;  3K9P B;  4FBJ B;  1TBE A;  2FID A;  3A4R A;  3ZRF A;  4B6W A;  3QIJ A;  4NNJ B;  1E7V A;  3DBR I;  2IZV B;  2VRR B;  2ZNV C;  3PRZ A;  2IY0 B;  4HJK A;  1YJ1 A;  4ZDV A;  1T0Y A;  4TV3 A;  4FA6 A;  1ISN A;  2XEW A;  3L0W B;  2G45 B;  4WWN A;  2LRW A;  2LVO A;  2KFK A;  4GB9 A;  2K25 A;  2KD0 A;  4E71 A;  4MGI E;  3V6C B;  3DBL I;  2N1V A;  2ASQ A;  2NBV B;  3MTN B;  4GSW A;  2KJR A;  3HM3 A;  2XK5 A;  3PZD A;  4FUL A;  2RSU A;  3ONS A;  4LDT D;  3MJW A;  4FJZ A;  2DHZ A;  2M4N A;  4HCN B;  4W9F A;  4AOF A;  4W9L A;  3NS8 A;  1C3T A;  3MHS D;  3IFW B;  3RUI B;  3JYU A;  1WJ4 A;  2MBE A;  1EF1 A;  3P2B A;  4HWI B;  2Z0E B;  3H9D A;  3R7Q A;  5G55 A;  1WH3 A;  3UQB A;  3N32 A;  2L05 A;  1E8X A;  1YQB A;  3M3J A;  4KDI C;  2MA9 B;  2N9E B;  3W1S A;  4EZK A;  1WFY A;  1LM8 B;  2NPT B;  4BBN F;  2IY1 B;  2V3S A;  3PTF C;  3A9K B;  3DBS A;  4GOC A;  2GOW A;  1WE6 A;  4CHK A;  3RUL A;  4MM3 A;  3R3M A;  4FN2 A;  1SE9 A;  3VUY A;  2KAN A;  3OJ3 A;  1ZKH A;  4A3O A;  3UQA A;  2PPH A;  1V49 A;  2BKF A;  1E8Z A;  1MG8 A;  3PPA A;  3U7D A;  3UIP B;  2RD0 A;  4IM0 A;  2K39 A;  3A1Q B;  2JXX A;  4M8M A;  1WZ0 A;  3A9J B;  1F9J A;  3N3K B;  1OEY A;  4ANU A;  2JF5 A;  2MSE D;  2LUE A;  2JT4 B;  4F1S A;  4RMA A;  4TKN A;  4TQ1 A;  2GMI C;  3NZU A;  3ZTD A;  2AL6 A;  2MBQ A;  4PYZ A;  3W1Y A;  2KOX A;  2NPT A;  3H7P A;  2BPS A;  2DAJ A;  5CX3 A;  2JRI B;  4IG7 B;  5DPW A;  4EUT A;  2BKR B;  3VTV A;  2MBH A;  5BO4 B;  4K1R B;  3ZKJ C;  2FNJ B;  4ZRK A;  3RT3 B;  2KJH B;  2KX3 A;  1XD3 B;  2AYO B;  4IWO A;  4WJN A;  3LDZ E;  4PS8 A;  1WJN A;  5JHA A;  1RRB A;  2KXJ A;  2ZCC A;  2C7N B;  2LGD A;  3BY4 B;  5G2N A;  2KC2 A;  1UD7 A;  3PS6 A;  2O6V A;  3ZIM A;  4KSK C;  4DXA B;  1WJU A;  2A4Z A;  2GBM A;  1XT9 B;  4GDK B;  3TL5 A;  1LXD A;  4FLH A;  3SU8 X;  2L0F A;  3VDZ A;  2NS5 A;  1Z2M A;  4G50 A;  4K81 A;  3IHP C;  3VXW A;  2K1F A;  3JSV A;  2K8C A;  2KKC A;  1TZ1 A;  2L0T A;  4WAA A;  2ZPY A;  1V81 A;  4JGH B;  1LFD A;  3ZDM C;  4W9K A;  1V6E A;  4EKU A;  4BVU C;  1WIA A;  2BYV E;  2FCN A;  2NBU A;  3VQI A;  1P98 A;  3DPD A;  3RD2 A;  4K7U A;  4G11 A;  2MRP A;  2GBK A;  4HDO A;  5EDS A;  3KYD D;  2BF8 B;  5DPT A;  1ZW7 A;  2MQJ A;  3HIZ A;  3WAN A;  2KJ6 A;  5CHF A;  4CO7 A;  2J0J A;  4GDK A;  2KTR B;  4HPM B;  4KIK B;  5KHO A;  5LXI B;  3M62 B;  3EHV A;  3APF A;  2HJ8 A;  4IC7 B;  1E8Y A;  4HLE A;  1IYF A;  3VTW A;  2DZI A;  4AJW A;  2C5L C;  5AEK B;  4XC2 A;  1WJ6 A;  3R7R A;  3ENE A;  1IP9 A;  1QZE A;  2ZPN A;  1AAR A;  3ZDT A;  3UGB B;  2N7D A;  4MSQ B;  1UBI A;  2IO1 B;  3PLU A;  2LI5 A;  1I35 A;  1NDD A;  3R66 C;  3WAM A;  3Q3F A;  3CST A;  4MEL A;  3B1L X;  3DVN U;  2KVR A;  1EF5 A;  2DYB A;  2KLC A;  2REX A;  1H8C A;  2KDE B;  3KH0 A;  3OAW A;  2M8S A;  3H6N A;  1OTR B;  3WA0 A;  1G6J A;  2RR9 A;  2LXC A;  4K7S A;  3DQV A;  3GOE A;  1WRD B;  4M8N A;  1X1M A;  4MGZ E;  2BYE A;  1Z5S B;  1V80 A;  4NAW B;  1UBQ A;  3X0W A;  1OGW A;  2XK5 B;  4BOZ B;  2I1J A;  2FCQ A;  1EUV B;  3NY5 A;  3QWZ B;  4MGY E;  1V2Y A;  2MBB B;  4TQ0 A;  3V6E B;  4BFR A;  1ZGU B;  4HXD A;  2CHZ A;  3IVF A;  1L2N A;  4HPL B;  1GC6 A;  4ANX A;  2KQ7 A;  3LJ3 A;  2WX1 A;  1D3Z A;  2LWP A;  4EFO A;  2KHW B;  2V4L A;  2LGY A;  2N9P C;  2Y5B B;  4M0W B;  2G4D B;  4DK5 A;  1WXV A;  1A5R A;  4MGK E;  3CF6 E;  2IO2 B;  4MDK E;  2HD5 B;  3H1U A;  2WX0 A;  2ZVN A;  2FCS A;  5TR5 A;  2D2Q A;  4KVG B;  2M1M A;  3PT2 B;  2K6Q A;  4LJP B;  4XX5 A;  3DVG Y;  2KTF A;  4RM9 A;  5L83 A;  2DZJ A;  3W1S C;  4TUU A;  2DZK A;  4FJY A;  1BT0 A;  1V9J A;  3JW0 X;  4GDL A;  2A5U A;  2IO3 B;  3HK0 A;  3ZNH B;  4PYU A;  2W9N A;  4IWQ A;  2AL3 A;  5GMV A;  1WYW B;  2MLB A;  3A9J A;  3EEC A;  3PRP B;  3TCA A;  3VHT C;  3PVL A;  1TTN A;  3NZS A;  2KDI A;  2CHX A;  3PRE A;  5DCN A;  3ZRC A;  4ZRJ A;  3ZUN A;  5IAA C;  2YVC A;  4KSL C;  4ANV A;  5DPS A;  2J0M A;  2DX5 B;  4ASW C;  1KOT A;  3H7P B;  5CHV C;  3WIM A;  3RZF A;  2KLG A;  1P0R A;  5AZF A;  2NR2 A;  2JPH A;  2FAZ A;  4WQO B;  3V60 A;  2FCM A;  5FR6 A;  3UF8 A;  5DPR A;  4URK A;  3KVF B;  3SDL C;  2LXA A;  4AP4 C;  2D07 B;  4B95 A;  1P1A A;  2LVP A;  3AU4 A;  3ZTC A;  2ZZP B;  2JZ3 B;  2L8J A;  3IG3 A;  3QHT A;  4NAW A;  5D94 A;  2O6V B;  2R2O A;  3KW5 B;  2CU1 A;  1WM2 A;  3APD A;  3ALB A;  1VD2 A;  3PSE B;  4FHJ A;  4MJS B;  3VH3 B;  1PQS A;  2JUO A;  3RZW C;  1P3Q U;  2KZR A;  2UYZ B;  2PE6 B;  1HE8 A;  2M0X A;  4HCP B;  1J19 A;  2KDF B;  4CYE A;  1WGR A;  4IWP A;  2G3Q B;  2M17 A;  3QAQ A;  1UZX B;  2D10 A;  2JZZ A;  2O2V A;  1WXS A;  4JQW C;  3ZO5 B;  3TJP A;  1YIW A;  3I3T B;  3ZW3 A;  2Z0D B;  4JIO U;  1Q5W B;  1CMX B;  2I1K A;  2C9W B;  2N7E A;  2KC1 A;  4NJ7 A;  4DHJ D;  4I6N B;  3VUW A;  4DBG A;  2N4F A;  3WAL A;  4A20 A;  2ZEQ A;  2IBI B;  1WF9 A;  1VCB A;  1NBF C;  1L7Y A;  4WJO A;  2KTR A;  4KIK A;  4E3C A;  4MH0 E;  4JL9 A;  4K7W A;  2GBJ A;  3ZNZ B;  3ZNI D;  4IUM B;  4HVB A;  3VVW B;  3Q3J A;  3M63 B;  3RCZ A;  3T8M A;  3ZLZ A;  4DHZ B;  2EMS A;  3SD5 A;  1R4N I;  5KHQ A;  1RLF A;  3QJZ A;  4GXB A;  4DHJ B;  4W9I A;  3ZNG C;  5JZE B;  2ZJD A;  4IM3 A;  5L95 C;  4AJY B;  2LRU A;  1OEY J;  1GJZ A;  1WX7 A;  2PE9 A;  4NPN A;  3L17 A;  3NOB A;  3D32 A;  2YLM A;  1WZ3 A;  5CTR C;  1YD8 U;  2DYO A;  5JHB A;  4B9K A;  3DCG A;  3QX1 A;  1WX9 A;  2N1W A;  3HM6 X;  3IBE A;  2KMA A;  4NY0 A;  1WGD A;  1GC7 A;  2KWC A;  3A4S C;  2J0K A;  2LGX A;  3H7S A;  3TIX A;  5D6J B;  4X57 B;  1M94 A;  2K8B A;  3C0R B;  4DHZ E;  2WWZ A;  4AUQ C;  3T9L A;  2BWF A;  2HTH A;  4JLC A;  4J6I A;  2K8H A;  2KWU B;  5E6O A;  2CS4 A;  4OVV A;  2LZ6 A;  4A3P A;  3JVZ X;  4IM2 A;  2BWE S;  1WXA A;  3A1Q A;  3CMM B;  3KUZ A;  2FIF A;  4MJS A;  5J18 A;  2IO0 B;  2MCN B;  3PHW B;  2CR5 A;  4KDL B;  4P7I A;  3VH4 B;  2DZM A;  4KV2 A;  1UH6 A;  2OJR A;  3AI5 A;  1GNU A;  4E74 A;  2KN5 A;  3V61 A;  1R4M I;  1WR6 E;  2CKH B;  2G4S A;  5J2R A;  1Q0W B;  3SHQ A;  2AEH A;  1FXT B;  2IYD B;  1GUA B;  2KMC A;  3U8Z A;  3X23 A;  4FAD A;  2UWQ A;  2PJH A;  4GDL B; 
#chains in the Genus database with same CATH topology
 4G0N B;  4QAY A;  2WXF A;  1Y8R C;  5BMG A;  1I42 A;  4DDI D;  2J52 A;  2J53 A;  1DOI A;  4WJP A;  3NG0 A;  3MJ5 A;  2KK8 A;  1D5X C;  1OQR A;  1WGG A;  1SIF A;  3B2G A;  3ECI A;  1WGH A;  1QQR A;  1EO6 A;  5IN7 A;  2BB5 A;  1MHX A;  2KFJ A;  1WMH B;  3TEW A;  1UF0 A;  1WR1 A;  5JH5 C;  4BOS C;  1OQY A;  3P63 A;  4H2A A;  3OJ4 B;  1V86 A;  4DWF A;  2J4X A;  1UGM A;  1UGJ A;  1K8R B;  1EWC A;  2PW9 A;  3BIN A;  3KUD B;  4JPS A;  4YL8 A;  2JX5 A;  4ZYN A;  1YN4 A;  3QA8 A;  1ET6 A;  2ZCB A;  3PHX B;  3L08 A;  5C3J B;  2MW5 A;  2K6D B;  1E8W A;  4LDT B;  2JYT A;  4DXF A;  3DBH I;  1XXG A;  3T3O A;  1C1Y B;  4W9J A;  2O2V B;  1QLB B;  5BYQ A;  3NVW A;  2NMQ A;  1YX6 B;  1I4P A;  3DVN V;  4ZHO A;  3RNB C;  3S2A A;  2C7M B;  3NVY A;  2MWS B;  1E7P B;  3M95 A;  2WDQ B;  1WE7 A;  2X38 A;  4NQK E;  5JXV A;  1A70 A;  4HDQ A;  1HTO A;  1WI0 A;  5J17 A;  1XQQ A;  3AU5 A;  2B3A A;  3RYT A;  3TBL D;  4US8 A;  3RNC C;  3ML9 A;  5E6N A;  2BT6 A;  4WWO A;  2XNA C;  2GBN A;  1S1Q B;  3LXF A;  4BKS D;  1YX5 B;  1SGH A;  5AZG A;  2MJ3 A;  5E6P A;  2ZVO A;  2JY6 A;  2KFK B;  4M01 A;  4W9E A;  2DAF A;  2IDY A;  1FNW A;  3QQ8 B;  2RGF A;  2MP2 B;  1J8C A;  3QCA A;  2N9X A;  4J3O D;  3SR6 A;  3K9P B;  3A4R A;  3ZRF A;  2WDR B;  5EE1 A;  1V97 A;  2RDH A;  4P1C C;  4B0M A;  2IY0 B;  1Q10 A;  1ISN A;  2LRW A;  2KD0 A;  1WYG A;  4MGI E;  3DBL I;  4AQ7 A;  2KJR A;  2XK5 A;  4P6V F;  5D3D A;  1FMA D;  1ZE3 D;  4HCN B;  4W9F A;  4AOF A;  1TS3 A;  1WJ4 A;  2MBE A;  1EF1 A;  4A6Q A;  4LNF A;  4KKJ A;  2N9E B;  1SE4 A;  1UWM A;  4EZK A;  1LM8 B;  2NPT B;  2V3S A;  4A3O A;  2GB1 A;  2RD0 A;  3A1Q B;  1WZ0 A;  1ZXH A;  1F9J A;  1OEY A;  4C00 A;  1PGB A;  1XLO A;  2JF5 A;  4UDU C;  2JT4 B;  4F1S A;  1D5M C;  3NZU A;  1JCK B;  2MBQ A;  2BPS A;  4HEA 1;  4IG7 B;  3BVZ A;  4EUT A;  2BYT A;  4YTP B;  4B0E A;  2Y5C A;  4GLS C;  4K1R B;  3ZKJ C;  4M00 A;  2KJH B;  2KAC A;  1NYQ A;  4XYC A;  2AYO B;  4WJN A;  2RMM A;  2INP E;  1FXI A;  5G2N A;  2KC2 A;  2BS4 B;  1C9F A;  2BW2 A;  3VRB B;  1WJU A;  2GBM A;  4KKI A;  4FLH A;  3VDZ A;  2L0F A;  4K81 A;  1LFD A;  2BYV E;  3DPD A;  1ACC A;  2KQ4 X;  4K7U A;  1TY2 A;  5EDS A;  1XLP A;  5I4D A;  5CHF A;  2KTR B;  4HPM B;  5LXI B;  3APF A;  3VTW A;  1N63 A;  5AEK B;  1CQV A;  1DGJ A;  3ENE A;  1QZE A;  2N7D A;  3GS2 A;  3WAM A;  3B1L X;  3DVN U;  2KLC A;  2REX A;  2BTE A;  1VZ8 A;  3H6N A;  1RM6 C;  1YMH E;  4M8N A;  3DQV A;  3GOE A;  1X1M A;  3SFE B;  4C7Y A;  1V80 A;  5H92 C;  1EUV B;  3NY5 A;  3QWZ B;  1N6Z A;  3V6E B;  4RGT A;  4BFR A;  1FNV A;  2V3P A;  4HPL B;  1GC6 A;  3FC4 A;  3FIL A;  2KHW B;  4S17 A;  2K9X A;  4ITK A;  2N9P C;  1WXV A;  1ZOY B;  3CF6 E;  1YN5 A;  1K50 A;  3I5J C;  4AS1 A;  2K6Q A;  3TEY A;  3DVG Y;  2AQ3 B;  3GZN B;  4TUU A;  4A90 A;  3MC0 B;  2DZK A;  1BT0 A;  1BXT A;  2HDE A;  3V3X A;  1JAL A;  2E6X A;  2W9N A;  1N5X A;  5GMV A;  5IO9 A;  4D2K A;  3PRP B;  3TCA A;  3VHT C;  3AE7 B;  1DOY A;  3PVL A;  2N9K A;  4ZRJ A;  4NZL B;  5IAA C;  4ANV A;  5DPS A;  4ASW C;  3W9C B;  3ETR A;  2KLG A;  1N62 A;  1P0R A;  1RYJ A;  2NR2 A;  5TSS A;  3KVF B;  4B95 A;  2WNM A;  3ZTC A;  2JZ3 B;  2L8J A;  3IG3 A;  3QHT A;  4NAW A;  1LGR A;  2O6V B;  4JX1 C;  2R2O A;  3KW5 B;  1FM0 D;  3GP7 A;  2QMT A;  3TEZ A;  3PSE B;  4ARC A;  1XLN A;  1TKG A;  3RZW C;  1GB1 A;  2UYZ B;  2PE6 B;  1HE8 A;  4CYE A;  2QDF A;  1WGR A;  2G3Q B;  2M17 A;  1UZX B;  1V8C A;  3RNG C;  2O2V A;  1I4Q A;  4OZC A;  3ZW3 A;  2W82 A;  2IGH A;  2C9W B;  4NJ7 A;  4DHJ D;  4I6N B;  1WGK A;  2VZK D;  4IKG A;  4A20 A;  2IBI B;  1VCB A;  4E3C A;  2WXQ A;  3BK1 A;  3DBR B;  4IUM B;  3Q6B A;  1ZDV A;  1R4N I;  5KHQ A;  3O13 A;  4DHJ B;  1TY0 A;  2WXM A;  4LNN A;  4IM3 A;  3CWI A;  1OEY J;  4NPN A;  3L17 A;  3W5U B;  1WZ3 A;  2DYO A;  3AE8 B;  4RF0 A;  2N1W A;  5FK9 C;  2KMA A;  3Q8B A;  5HI1 A;  3P1M A;  1L0V B;  4RGN A;  2CJN A;  1C4P A;  1M94 A;  2BS2 B;  3C0R B;  2WXP A;  2WWZ A;  2HTH A;  1AW7 A;  2G9H D;  3JVZ X;  2BWE S;  1WXA A;  3CMM B;  2BB6 A;  5GXG B;  3KUZ A;  1AN8 A;  1PDX A;  3P4R B;  3ZXR A;  1JWS D;  2IO0 B;  4P7I A;  3MP9 A;  1YQ3 B;  3AI5 A;  4E74 A;  2ICI A;  4R3D A;  5IKC M;  2V4I B;  4RNA A;  3PZ8 A;  2UWQ A;  2JVC A;  3B0A A;  1I4H A;  2V1Y A;  4KZC A;  1FCC C;  1WGY A;  3I63 C;  2W55 A;  4WWP A;  1H4R A;  1SBB B;  3ZJT A;  4XDD A;  1CJE A;  3FAH A;  3WAO A;  2PMV A;  3A33 B;  2VH1 A;  2R2Q A;  4JE3 B;  4C7Z A;  2L3Z A;  3JSV B;  2HE7 A;  3ZVV A;  2LUM A;  2MP2 A;  2ZW1 A;  3L13 A;  3VFK A;  3DDC B;  4ANW A;  2JRH A;  2O6V D;  2BGF A;  1P9D U;  1EU4 A;  3P4Q B;  3RMK C;  1XLQ A;  2PTL A;  2GRI A;  2DYM A;  3SEB A;  3DBH B;  3DVG X;  1D4B A;  4W9H A;  3DOW A;  4GN1 A;  4NAM A;  1HEZ E;  5MPO A;  3L10 B;  4GGQ A;  4GIV A;  2D3A A;  3P42 A;  2MJD A;  2NCN A;  5CHW A;  1WXM A;  1QF6 A;  3RPF C;  4LNO A;  1RAX A;  4W9G A;  2LAS A;  1M4V A;  1JW9 D;  2KQS A;  4PS3 A;  3U4E G;  2XBB C;  4II2 B;  3PGE A;  2BYF A;  1V5T A;  2C7H A;  2NVU I;  4KGS A;  2AX5 A;  4EEW A;  4FJV B;  4FHK A;  1LQB A;  4TMA B;  5D2M B;  1GAQ B;  2JWZ A;  2RPQ A;  1E90 A;  4EOY A;  1KLV A;  1JWU D;  4YTN B;  4N59 A;  3UIO B;  4DDG D;  1KJT A;  2Z59 B;  1GB4 A;  2D3G A;  3B08 A;  4LLG M;  1U4A A;  3GZN I;  1KFY B;  2LJ5 A;  4PS7 A;  1V1P A;  1J0G A;  3K9O B;  3PLV A;  1Y56 A;  2WXL A;  2LMC A;  2L76 A;  4NJ6 A;  2MBO A;  4WJQ A;  4FBJ B;  2FID A;  2D3B A;  4B6W A;  1E7V A;  3DBR I;  1ENF A;  3DWG C;  2VRR B;  3OWE B;  2VH2 A;  2RPV A;  1XO3 A;  4ZDV A;  1UUP A;  1T0Y A;  1QOA A;  2G45 B;  4C4V B;  2KFK A;  2N1V A;  2NBV B;  2Y5P A;  4XWT A;  2K3U A;  4FJZ A;  2BBC A;  1DOX A;  4OVZ A;  1C3T A;  5T8I A;  3EUB 2;  3AN1 A;  3R7Q A;  5G55 A;  4YSY B;  4KDI C;  3RNA C;  1R7S A;  3W1S A;  1WFY A;  1NVI D;  2L1A A;  4REZ A;  3SFD B;  1ROE A;  5AUI A;  1TS4 A;  1SE3 A;  3A9K B;  3DBS A;  4GOC A;  2GOW A;  3RUL A;  3R3M A;  4FN2 A;  4PK1 A;  1E8Z A;  3PPA A;  4IM0 A;  2PVG C;  4M8M A;  3DHG C;  2MSE D;  2LUE A;  4TKN A;  1UWX A;  1E6E B;  1NEN B;  5EE3 A;  2JRI B;  5DPW A;  1F77 A;  2JXT A;  5BO4 B;  4ZRK A;  4USA A;  2Y3A A;  1YN3 A;  2J42 A;  3T3N A;  2LGD A;  1UD7 A;  4O1N A;  4A55 A;  3C8Y A;  1XT9 B;  1VDV A;  2QEJ C;  3AE5 B;  1XCT L;  3BWU D;  3IHP C;  2LHE A;  2K1F A;  2K8C A;  2INN E;  1V81 A;  3ZDM C;  4KGT A;  4BVU C;  1WIA A;  1L4Z B;  1P98 A;  1IUE A;  4HDO A;  2LJI A;  1ZW7 A;  3HIZ A;  3TSS A;  2QJL A;  2LGI A;  1FO4 A;  2SEB D;  1L0Y B;  3FKY A;  5KHO A;  2WXI A;  3M62 B;  4HLE A;  4IC7 B;  1E8Y A;  1WJ6 A;  3R7R A;  1IP9 A;  3ZDT A;  4MSQ B;  1UBI A;  1FIQ A;  3R66 C;  5EE9 A;  3Q3F A;  4ZHP A;  1H8C A;  3OAW A;  3DHI C;  3WA0 A;  4MGZ E;  2PKO A;  4NAW B;  2YEP B;  1UBQ A;  3X0W A;  3W5V B;  2XK5 B;  4BOZ B;  2FCQ A;  2MBB B;  1ZGU B;  3IVF A;  3BVM A;  4ANX A;  3AE1 B;  2LWP A;  3N1Y C;  4P1B C;  4EFO A;  2G4D B;  1A5R A;  1PGA A;  3RN9 C;  4MDK E;  4WQM A;  5BMH A;  2ZVN A;  3PT2 B;  4XX5 A;  5L83 A;  1HA5 A;  3AEA B;  2UU7 A;  4HKQ A;  1R4M B;  4FJY A;  2TSS A;  4GDL A;  3NZ3 A;  2IO3 B;  3ZNH B;  4IWQ A;  1WSP A;  4JWU C;  4PT5 A;  2ACZ B;  2AQ1 B;  4YXD B;  2CHX A;  3ZRC A;  1HQR D;  1YQ4 B;  3AED B;  3ZUN A;  4C4V A;  2YVC A;  2DX5 B;  1J7B A;  2V3N A;  4L23 A;  2H88 B;  2JPH A;  2FAZ A;  4WQO B;  3V60 A;  2N7J A;  4WH4 A;  2LXA A;  4AP4 C;  1AYF A;  3AU4 A;  1OQQ A;  5D94 A;  3TEX A;  3VR8 B;  2DWQ A;  3L4P A;  3R2T A;  2D5G A;  1P3Q U;  2YEP F;  3QAQ A;  4US9 A;  2JZZ A;  1WXS A;  1ZXI A;  3TJP A;  1Q5W B;  1CMX B;  4C56 C;  1FFV A;  3U7Z A;  3H8H A;  3EFC A;  2QCZ A;  2KTR A;  2MEK A;  3KWV A;  3ZJV A;  3PZ7 A;  4RGO S;  2GBJ A;  3ZNZ B;  3M63 B;  3ZLZ A;  2EMS A;  2AQ2 B;  1RLF A;  3QJZ A;  4W9I A;  5JZE B;  4RGM A;  5L95 C;  4AJY B;  1GJZ A;  4XGA B;  3HRD D;  2LEK A;  2YLM A;  3J9C A;  4ZOH C;  5EE0 A;  3HM6 X;  2NTT A;  1L4D B;  3A4S C;  2LGX A;  3H7S A;  4X57 B;  4IDI A;  1VLB A;  4DHZ E;  3W2D A;  4AUQ C;  2BWF A;  1SIJ A;  5LNK 1;  2CS4 A;  3MC8 A;  2LZ6 A;  4IM2 A;  4LK0 M;  3A1Q A;  3Q2A C;  1R4N B;  3AV8 A;  2MCN B;  2CR5 A;  4KV2 A;  1UH6 A;  2L83 A;  2OJR A;  3ZXV A;  2KN5 A;  3V61 A;  1WR6 E;  2BVC A;  5J2R A;  1Q0W B;  2AEH A;  1GUA B;  1T0Q C;  3X23 A;  3PO0 A;  1ESF A;  2PJH A;  2V9H A;  4EZL A;  3Q69 A;  4F8C B;  4NQL B;  1E10 A;  2Z8L A;  1V5O A;  3L54 A;  3AE2 B;  1QT9 A;  5C1Z A;  1MVK A;  3I9V 1;  1E5W A;  4GMV A;  4ICV A;  5AZH A;  1Q1O A;  2WYQ A;  2KO3 A;  1C79 A;  1E9M A;  2KDB A;  2BS3 B;  2DLB A;  1OFF A;  5HKH A;  4BKG A;  1ZDX A;  1ZP0 B;  1GG3 A;  1B9R A;  3EFU A;  3KWL A;  3KYC D;  1SEB D;  4GU2 A;  1UEL A;  2KMM A;  3DBL B;  4LJO B;  4EZJ A;  3NRZ A;  1E0Z A;  1KLU D;  2WDT B;  4HKZ E;  4ICU A;  1RFA A;  2L7R A;  1AWD A;  4G3X B;  4IW0 A;  3U30 A;  4IOI E;  2LD9 A;  4MSM B;  2DNF A;  2I2Y A;  1WMH A;  4LCD E;  3AB5 A;  1CZP A;  5IA7 A;  1WX8 A;  2LVQ A;  1DYQ A;  1S3S G;  3NUH B;  2CHW A;  3AM9 A;  3R8B A;  4C80 A;  2K0P A;  5H8Y E;  3Q8C A;  3RNE C;  3ML8 A;  4OVU A;  2JSV X;  2CU3 A;  3QAR A;  4AWJ A;  1C78 A;  1KM7 A;  3APC A;  1TIF A;  3AH7 A;  1TGZ B;  3PV1 A;  4ARI A;  2K5P A;  2MX2 A;  3Q8F A;  1I4R A;  3WAP A;  3IT4 B;  2HTM E;  4W9C A;  1IPG A;  3Q3M C;  5D7G A;  5LLI A;  3AXC A;  2JZP A;  1VR9 A;  3QC8 B;  1BML C;  2FUH B;  2NBW B;  3CSF A;  4YT0 B;  3BK2 A;  3HHM A;  2FE8 A;  4NNJ B;  3LB8 C;  2WXO A;  1FD6 A;  4YWG G;  2ZNV C;  3PRZ A;  1JWB D;  4HJK A;  4HRO A;  4TV3 A;  4FA6 A;  1CK1 A;  2XEW A;  3P4S B;  1QOG A;  4GB9 A;  4YSX B;  4E71 A;  4OZA A;  4HJG E;  2CJO A;  4GSW A;  2ASQ A;  3MTN B;  3PZD A;  1L0X B;  1UNS A;  1IGC A;  3MJW A;  2D3C A;  3AE4 B;  3MHS D;  3IFW B;  3RUI B;  3FIL B;  3JYU A;  4HRS A;  4HWI B;  1WH3 A;  3UQB A;  3N32 A;  2L05 A;  1E8X A;  1YQB A;  2WU5 B;  4FXC A;  1TKY A;  4RCO A;  1VZ6 A;  4BBN F;  2IY1 B;  1K51 A;  3GB1 A;  3PTF C;  4OW0 A;  5IP4 D;  4CHK A;  1MJD A;  1SE9 A;  1PUT A;  2KAN A;  2XN9 C;  3OJ3 A;  1ZKH A;  3UQA A;  3Q8A A;  2BKF A;  3UIP B;  1TZO A;  2JXX A;  1P7F A;  3A9J B;  4ANU A;  4ACF A;  4TQ1 A;  4Q2J A;  5FR3 A;  3ZTD A;  2GLS A;  3W1Y A;  2KN4 A;  2DAJ A;  3MC9 A;  4BAX A;  2BKR B;  2MBH A;  1TS5 A;  2FNJ B;  3RT3 B;  4A9A A;  3IXS A;  1YJI A;  1F2R C;  1TS2 A;  1WJN A;  5JHA A;  2KXJ A;  1T5X D;  5AUK A;  1T0S C;  1V1O A;  2WXH A;  3BY4 B;  2N0S B;  3PS6 A;  2O6V A;  4HPP A;  2RDB C;  4DXA B;  3AEC B;  3NS1 A;  2A4Z A;  3TL5 A;  1SJE D;  2NS5 A;  1Z2M A;  4G50 A;  4NJC A;  3ZJU A;  3VXW A;  1T3Q A;  3Q14 C;  5HHD G;  1SE2 A;  1D5Z C;  1NI3 A;  1I4G A;  4JGH B;  2EEL A;  3CIR B;  2FCN A;  5E6J A;  4G11 A;  2GBK A;  2BF8 B;  1I4X A;  2M56 B;  1FRD A;  2KDM A;  2KJ6 A;  1PGX A;  3EHV A;  1RWS A;  4ZRP A;  4CQN A;  3ZYY X;  2ZPN A;  1T0R C;  2OED A;  2IO1 B;  3PLU A;  1I35 A;  1NDD A;  2JYE A;  2RDG A;  3CST A;  4MEL A;  2DYB A;  2KDE B;  3KH0 A;  3TUO A;  2M8S A;  1VZ7 A;  2RR9 A;  3DWM A;  4K7S A;  2E3T A;  1Z5S B;  4WAF A;  1OGW A;  4KX6 B;  3HUI A;  2INC C;  4MGY E;  3NJT A;  1V2Y A;  4HXD A;  1L2N A;  3KQ4 A;  2KQ7 A;  1D3Z A;  4WUR A;  1TT5 B;  4K3B A;  2Y5B B;  3B2F A;  4DK5 A;  3MHZ A;  3H1U A;  2FCS A;  3AEG B;  3IAS 1;  4LJP B;  3BYY B;  3Q3N C;  1NYR A;  2DZJ A;  1V1P B;  4MM3 B;  1V9J A;  1GOZ A;  1TJE A;  2KAJ A;  2OHF A;  3EEC A;  2IJ0 A;  2VZK B;  3N1X C;  2ZW0 A;  4N6E B;  2KDI A;  5DCN A;  2J0M A;  1KOT A;  3H7P B;  5CHV C;  3RZF A;  4DXG A;  3RI7 C;  4OZB A;  2FCM A;  1L6V A;  3SDL C;  2D07 B;  2ON8 A;  2ZZP B;  1F52 A;  1N60 A;  2CU1 A;  3B9J A;  4XWW A;  1WM2 A;  3APD A;  2IGG A;  3ALB A;  3VH3 B;  1RFK A;  1JRO A;  2KZR A;  2QC8 A;  2M0X A;  2L52 A;  1YIW A;  3I3T B;  2Z0D B;  1GPX A;  2EKI A;  3VUW A;  1SJH D;  4DBG A;  2N4F A;  2IND C;  1WF9 A;  2PLP A;  1L7Y A;  2WXK A;  4KIK A;  1KLG D;  4MH0 E;  1K53 A;  1QKZ A;  4K7W A;  2IGD A;  4TSS A;  4HVB A;  4LNI A;  3VVW B;  3DHH C;  4DQO C;  4DHZ B;  4WWM A;  1FEH A;  4GXB A;  2W54 A;  1SF0 A;  2ZJD A;  2LRU A;  5C2T B;  2PE9 A;  2PIA A;  1N5W A;  5JHB A;  3DCG A;  3QX1 A;  3AMZ A;  3IBE A;  3URY A;  4YTM B;  2N9L A;  4XE0 A;  1WGD A;  2WXN A;  2KWC A;  2J0K A;  3TIX A;  1YOV B;  5D6J B;  1YJJ A;  5HG2 A;  4JWS C;  3EGR A;  3T9L A;  4JLC A;  4J6I A;  2K8H A;  2KWU B;  5E6O A;  1JWM D;  3AEB B;  2QSD A;  1L5P A;  2FIF A;  5J18 A;  2OJW A;  4KDL B;  1R4M I;  2LFI A;  2CKH B;  2G4S A;  2QIL A;  2K22 A;  2IYD B;  2KMC A;  3U8Z A;  3E9S A;  2KYW A;  4FAD A;  4GDL B;  3UIN B;  1E7U A;  3EA6 A;  2QHO A;  2H89 B;  4BBN C;  4YSZ B;  3OG5 A;  4L1B A;  3Q8E A;  2KNB A;  4I6L B;  2SAK A;  3ZQ4 A;  2WXR A;  3N30 A;  1JML A;  1ZPS A;  2BQQ A;  1KRH A;  2D11 A;  4XZ4 A;  3ZGZ A;  5G5G A;  4ZRI A;  3AEF B;  1FCL A;  3IT6 B;  3VAW A;  3NHE B;  3P4P B;  1HXY D;  3V05 A;  3AEE B;  4BKT A;  1TKE A;  3AE6 B;  4W9D A;  1D6E C;  1NI2 A;  5G5H A;  2KWV B;  3AUL A;  5LXH A;  3O65 B;  2EKE C;  3VR9 B;  3VTU A;  2ZNV B;  3PRM B;  3ABV B;  4MEM A;  4BKS A;  3TMP B;  2DEN B;  4MAC A;  1FFU A;  3GE3 C;  3E56 A;  3WCQ A;  3VUX A;  2FUG 1;  2WU2 B;  3KUC B;  4HK2 A;  2PEA A;  4N9F 4;  1KTK A;  4F7Z A;  1SXT A;  2AWT A;  4I6P A;  4KZ0 A;  4XDC A;  2EMT A;  3C19 A;  2C60 A;  5BYS A;  1FRR A;  5C23 A;  3A9K A;  4II3 B;  2KX0 A;  4M02 A;  1WY8 A;  1WM3 A;  2OOB B;  2GBR A;  2W3R A;  2Q5W D;  1FNU A;  3V62 A;  1JRU A;  3OLM D;  4N58 A;  1YNT E;  1FPY A;  1FXA A;  1XEE A;  3R2I A;  3EC8 A;  1MPE A;  4K3C A;  3L16 A;  2J7Q B;  3GE8 C;  1C77 A;  3BZD B;  4RM8 A;  2L00 B;  1EU3 A;  3QK0 A;  1TBE A;  3MFG A;  3QIJ A;  2IZV B;  1YJ1 A;  1F2R I;  3L0W B;  4WWN A;  2LVO A;  2K25 A;  3NVZ A;  3V6C B;  1ET9 A;  3HM3 A;  4FUL A;  2RSU A;  3ONS A;  4LDT D;  4RH6 A;  4EE2 A;  2DHZ A;  2M4N A;  4W9L A;  3NS8 A;  2LHD A;  5FKA C;  3P2B A;  2Z0E B;  3H9D A;  2JWU A;  2W3S A;  2PVO D;  3M3J A;  2MA9 B;  1KF6 B;  1WRI A;  1KH0 A;  1WE6 A;  4MM3 A;  3VUY A;  2PPH A;  1V49 A;  2JQR B;  3U7D A;  1MG8 A;  2K39 A;  2ONQ A;  3AE9 B;  3N3K B;  4RMA A;  1QOB A;  4P16 A;  2GMI C;  2AL6 A;  4PYZ A;  2KOX A;  2NPT A;  3H7P A;  5CX3 A;  3U52 E;  3VTV A;  1HTQ A;  3U2S C;  3Q3O C;  2KX3 A;  2WLB A;  1QIL A;  1XD3 B;  4IWO A;  4PS8 A;  3LDZ E;  1MFW A;  2DBY A;  1HZ6 A;  1F0Z A;  1RRB A;  2ZCC A;  2C7N B;  3RFZ B;  4L2Y A;  3ZIM A;  4KSK C;  4GDK B;  1LXD A;  2WS3 B;  3SU8 X;  3VRA B;  3KLS X;  3JSV A;  1I7H A;  2KKC A;  1TZ1 A;  2L0T A;  1JWA D;  4WAA A;  2ZPY A;  3NVV A;  4S0R A;  1C4C A;  4W9K A;  5D3I B;  1V6E A;  4EKU A;  3BYT B;  2NBU A;  3VQI A;  3RD2 A;  2MRP A;  1WXQ A;  3KYD D;  5DPT A;  2MQJ A;  3WAN A;  4CO7 A;  2J0J A;  3IAM 1;  4GDK A;  4KIK B;  1IYF A;  1EM7 A;  2HJ8 A;  2DZI A;  4AJW A;  2C5L C;  4XC2 A;  1AAR A;  3I57 A;  3UGB B;  1SSN A;  2LI5 A;  2G1E A;  4M0W A;  2KVR A;  1EF5 A;  4A8X C;  1OTR B;  2WQY B;  1G6J A;  2LXC A;  1C76 A;  1WRD B;  1IBX B;  2BYE A;  1VJK A;  2I1J A;  4ZRQ A;  4TQ0 A;  1NEK B;  2CHZ A;  3N9Y C;  3LJ3 A;  2WP9 B;  2WX1 A;  2JU6 X;  2R61 A;  1PYW D;  2V4L A;  2LGY A;  2MHJ A;  4M0W B;  3HVD A;  4MGK E;  2IO2 B;  2HD5 B;  2WDV B;  2WX0 A;  3N20 C;  5TR5 A;  2D2Q A;  4KVG B;  1B1Z A;  2M1M A;  2FBW B;  2KTF A;  3LYY A;  4RM9 A;  1JQ4 A;  1K52 A;  3W1S C;  3BII D;  3RNF C;  3JW0 X;  2A5U A;  3HK0 A;  2X8X X;  4PYU A;  1MHH E;  2AL3 A;  1WYW B;  2MLB A;  1C4A A;  3A9J A;  1TTN A;  2MJE A;  3NZS A;  3PRE A;  1SB3 C;  1EWY C;  3N1Z C;  4KSL C;  4ZYS A;  3WIM A;  1P7E A;  2QIE B;  2IPK D;  5AZF A;  4KGR A;  4URK A;  5FR6 A;  3UF8 A;  5DPR A;  4RF1 A;  2LGS A;  2M19 A;  1P1A A;  1F1H A;  2LVP A;  2KWD A;  1IBX A;  1VD2 A;  3UI3 A;  4FHJ A;  4MJS B;  1PQS A;  2JUO A;  1N61 A;  1ZUD 2;  4HCP B;  1J19 A;  2KDF B;  4IWP A;  1MI0 A;  1TYG B;  2D10 A;  4OHJ A;  3BVG A;  4JQW C;  3ZO5 B;  2HJ1 A;  5BMI A;  2I38 A;  1J7C A;  2B76 B;  4JIO U;  1J7A A;  2I1K A;  2N7E A;  2WGS A;  2KC1 A;  4BZA A;  3WAL A;  2ZEQ A;  1HZ5 A;  1NBF C;  2WHI A;  4WJO A;  1XF5 L;  4LTU A;  4JL9 A;  5IOI A;  1STE A;  3ZNI D;  1PFD A;  4MT5 A;  3Q3J A;  3RCZ A;  3T8M A;  3SD5 A;  5HFY A;  2GI9 A;  2WXJ A;  1L6U A;  3ZNG C;  2MH7 A;  1JRP A;  2V0G A;  3HVZ A;  2WXG A;  1WX7 A;  3NOB A;  3D32 A;  5CTR C;  1YD8 U;  3AE3 B;  4B9K A;  1WX9 A;  4MH8 A;  4NY0 A;  1GC7 A;  1MG4 A;  2L32 A;  2KVZ A;  1XCQ L;  2K8B A;  4LNK A;  4OVV A;  5BYR A;  2M0A A;  4A3P A;  1T6B X;  4MJS A;  3PHW B;  3VH4 B;  2DZM A;  2NTS A;  1GNU A;  1WWT A;  4RFB A;  1VRA B;  1LO5 D;  3SHQ A;  1FXT B;  1BUI C;  1QOF A;  1IGD A;  2KT7 A;  4WIP A; 
#chains in the Genus database with same CATH homology
 2JVC A;  3B0A A;  4G0N B;  2V1Y A;  3UIN B;  1Y8R C;  4EZL A;  4KZC A;  1WGY A;  4F8C B;  4NQL B;  1E7U A;  1I42 A;  4DDI D;  1V5O A;  3L54 A;  2QHO A;  4WWP A;  5C1Z A;  1H4R A;  4WJP A;  1E5W A;  4GMV A;  4ICV A;  3WAO A;  4BBN C;  5AZH A;  3A33 B;  2R2Q A;  1Q1O A;  2WYQ A;  2KO3 A;  2KK8 A;  2L3Z A;  3JSV B;  2HE7 A;  2KDB A;  3ZVV A;  1WGG A;  2MP2 A;  2KNB A;  4I6L B;  1SIF A;  3L13 A;  3ECI A;  1WGH A;  5HKH A;  3VFK A;  3DDC B;  4BKG A;  4ANW A;  1EO6 A;  1GG3 A;  2JRH A;  3N30 A;  2D11 A;  4XZ4 A;  2KFJ A;  1WMH B;  2BGF A;  2O6V D;  1P9D U;  1WR1 A;  3EFU A;  5JH5 C;  4ZRI A;  3KYC D;  4BOS C;  3VAW A;  1OQY A;  4GU2 A;  4DWF A;  3OJ4 B;  1V86 A;  1UEL A;  3NHE B;  4LJO B;  4EZJ A;  1UGM A;  2WDT B;  2DYM A;  4BKT A;  4ICU A;  3DVG X;  1RFA A;  2L7R A;  4W9D A;  4W9H A;  3DOW A;  1K8R B;  1NI2 A;  4G3X B;  4GN1 A;  4IW0 A;  2KWV B;  3BIN A;  3KUD B;  3L10 B;  3U30 A;  3AUL A;  5LXH A;  3O65 B;  2EKE C;  4GGQ A;  4GIV A;  4YL8 A;  2LD9 A;  4ZYN A;  4MSM B;  3VTU A;  3QA8 A;  2ZNV B;  2ZCB A;  3PHX B;  3PRM B;  3L08 A;  2MW5 A;  2NCN A;  2K6D B;  4MEM A;  4BKS A;  1E8W A;  4LDT B;  5CHW A;  1WMH A;  1WXM A;  3DBH I;  3TMP B;  2DEN B;  4LCD E;  1C1Y B;  1RAX A;  4W9J A;  2O2V B;  4W9G A;  2LAS A;  5IA7 A;  1WX8 A;  3VUX A;  2LVQ A;  3KUC B;  2PEA A;  4HK2 A;  1S3S G;  1YX6 B;  3DVN V;  4N9F 4;  2KQS A;  4PS3 A;  4F7Z A;  2CHW A;  2AWT A;  2XBB C;  4I6P A;  2C7M B;  4KZ0 A;  3S2A A;  4II2 B;  2EMT A;  3PGE A;  2MWS B;  2BYF A;  3M95 A;  1V5T A;  2C7H A;  3ML8 A;  2NVU I;  4OVU A;  4EEW A;  1WE7 A;  3QAR A;  4AWJ A;  4FJV B;  4FHK A;  4NQK E;  1LQB A;  5D2M B;  2C60 A;  4HDQ A;  1KM7 A;  2JWZ A;  3APC A;  2RPQ A;  1E90 A;  4EOY A;  1WI0 A;  5J17 A;  1KLV A;  1TGZ B;  3PV1 A;  1XQQ A;  3AU5 A;  5C23 A;  3A9K A;  4DDG D;  3UIO B;  2MX2 A;  2B3A A;  2KX0 A;  4II3 B;  3RYT A;  1WY8 A;  3TBL D;  1WM3 A;  1KJT A;  2GBR A;  2OOB B;  3ML9 A;  5E6N A;  3WAP A;  2Z59 B;  4WWO A;  2D3G A;  2GBN A;  1S1Q B;  4W9C A;  1IPG A;  3B08 A;  3V62 A;  1JRU A;  1YX5 B;  1SGH A;  5D7G A;  5AZG A;  1U4A A;  4BKS D;  3OLM D;  3GZN I;  5LLI A;  5E6P A;  3AXC A;  2ZVO A;  2JY6 A;  2KFK B;  3QC8 B;  2LJ5 A;  4PS7 A;  4W9E A;  3EC8 A;  2FUH B;  1J0G A;  2DAF A;  3K9O B;  3L16 A;  2NBW B;  3CSF A;  2J7Q B;  3PLV A;  3QQ8 B;  2RGF A;  4RM8 A;  2MP2 B;  2L00 B;  2L76 A;  1J8C A;  4NJ6 A;  2MBO A;  3QCA A;  2N9X A;  3HHM A;  3QK0 A;  4WJQ A;  3K9P B;  4FBJ B;  1TBE A;  2FID A;  3A4R A;  3ZRF A;  4B6W A;  3QIJ A;  4NNJ B;  1E7V A;  3DBR I;  2IZV B;  2VRR B;  2ZNV C;  3PRZ A;  2IY0 B;  4HJK A;  1YJ1 A;  4ZDV A;  1T0Y A;  4TV3 A;  4FA6 A;  1ISN A;  2XEW A;  3L0W B;  2G45 B;  4WWN A;  2LRW A;  2LVO A;  2KFK A;  4GB9 A;  2K25 A;  2KD0 A;  4E71 A;  4MGI E;  3V6C B;  3DBL I;  2N1V A;  2ASQ A;  2NBV B;  3MTN B;  4GSW A;  2KJR A;  3HM3 A;  2XK5 A;  3PZD A;  4FUL A;  2RSU A;  3ONS A;  4LDT D;  3MJW A;  4FJZ A;  2DHZ A;  2M4N A;  4HCN B;  4W9F A;  4AOF A;  4W9L A;  3NS8 A;  1C3T A;  3MHS D;  3IFW B;  3RUI B;  3JYU A;  1WJ4 A;  2MBE A;  1EF1 A;  3P2B A;  4HWI B;  2Z0E B;  3H9D A;  3R7Q A;  5G55 A;  1WH3 A;  3UQB A;  3N32 A;  2L05 A;  1E8X A;  1YQB A;  3M3J A;  4KDI C;  2MA9 B;  2N9E B;  3W1S A;  4EZK A;  1WFY A;  1LM8 B;  2NPT B;  4BBN F;  2IY1 B;  2V3S A;  3PTF C;  3A9K B;  3DBS A;  4GOC A;  2GOW A;  1WE6 A;  4CHK A;  3RUL A;  4MM3 A;  3R3M A;  4FN2 A;  1SE9 A;  3VUY A;  2KAN A;  3OJ3 A;  1ZKH A;  4A3O A;  3UQA A;  2PPH A;  1V49 A;  2BKF A;  1E8Z A;  1MG8 A;  3PPA A;  3U7D A;  3UIP B;  2RD0 A;  4IM0 A;  2K39 A;  3A1Q B;  2JXX A;  4M8M A;  1WZ0 A;  3A9J B;  1F9J A;  3N3K B;  1OEY A;  4ANU A;  2JF5 A;  2MSE D;  2LUE A;  2JT4 B;  4F1S A;  4RMA A;  4TKN A;  4TQ1 A;  2GMI C;  3NZU A;  3ZTD A;  2AL6 A;  2MBQ A;  4PYZ A;  3W1Y A;  2KOX A;  2NPT A;  3H7P A;  2BPS A;  2DAJ A;  5CX3 A;  2JRI B;  4IG7 B;  5DPW A;  4EUT A;  2BKR B;  3VTV A;  2MBH A;  5BO4 B;  4K1R B;  3ZKJ C;  2FNJ B;  4ZRK A;  3RT3 B;  2KJH B;  2KX3 A;  1XD3 B;  2AYO B;  4IWO A;  4WJN A;  3LDZ E;  4PS8 A;  1WJN A;  5JHA A;  1RRB A;  2KXJ A;  2ZCC A;  2C7N B;  2LGD A;  3BY4 B;  5G2N A;  2KC2 A;  1UD7 A;  3PS6 A;  2O6V A;  3ZIM A;  4KSK C;  4DXA B;  1WJU A;  2A4Z A;  2GBM A;  1XT9 B;  4GDK B;  3TL5 A;  1LXD A;  4FLH A;  3SU8 X;  2L0F A;  3VDZ A;  2NS5 A;  1Z2M A;  4G50 A;  4K81 A;  3IHP C;  3VXW A;  2K1F A;  3JSV A;  2K8C A;  2KKC A;  1TZ1 A;  2L0T A;  4WAA A;  2ZPY A;  1V81 A;  4JGH B;  1LFD A;  3ZDM C;  4W9K A;  1V6E A;  4EKU A;  4BVU C;  1WIA A;  2BYV E;  2FCN A;  2NBU A;  3VQI A;  1P98 A;  3DPD A;  3RD2 A;  4K7U A;  4G11 A;  2MRP A;  2GBK A;  4HDO A;  5EDS A;  3KYD D;  2BF8 B;  5DPT A;  1ZW7 A;  2MQJ A;  3HIZ A;  3WAN A;  2KJ6 A;  5CHF A;  4CO7 A;  2J0J A;  4GDK A;  2KTR B;  4HPM B;  4KIK B;  5KHO A;  5LXI B;  3M62 B;  3EHV A;  3APF A;  2HJ8 A;  4IC7 B;  1E8Y A;  4HLE A;  1IYF A;  3VTW A;  2DZI A;  4AJW A;  2C5L C;  5AEK B;  4XC2 A;  1WJ6 A;  3R7R A;  3ENE A;  1IP9 A;  1QZE A;  2ZPN A;  1AAR A;  3ZDT A;  3UGB B;  2N7D A;  4MSQ B;  1UBI A;  2IO1 B;  3PLU A;  2LI5 A;  1I35 A;  1NDD A;  3R66 C;  3WAM A;  3Q3F A;  3CST A;  4MEL A;  3B1L X;  3DVN U;  2KVR A;  1EF5 A;  2DYB A;  2KLC A;  2REX A;  1H8C A;  2KDE B;  3KH0 A;  3OAW A;  2M8S A;  3H6N A;  1OTR B;  3WA0 A;  1G6J A;  2RR9 A;  2LXC A;  4K7S A;  3DQV A;  3GOE A;  1WRD B;  4M8N A;  1X1M A;  4MGZ E;  2BYE A;  1Z5S B;  1V80 A;  4NAW B;  1UBQ A;  3X0W A;  1OGW A;  2XK5 B;  4BOZ B;  2I1J A;  2FCQ A;  1EUV B;  3NY5 A;  3QWZ B;  4MGY E;  1V2Y A;  2MBB B;  4TQ0 A;  3V6E B;  4BFR A;  1ZGU B;  4HXD A;  2CHZ A;  3IVF A;  1L2N A;  4HPL B;  1GC6 A;  4ANX A;  2KQ7 A;  3LJ3 A;  2WX1 A;  1D3Z A;  2LWP A;  4EFO A;  2KHW B;  2V4L A;  2LGY A;  2N9P C;  2Y5B B;  4M0W B;  2G4D B;  4DK5 A;  1WXV A;  1A5R A;  4MGK E;  3CF6 E;  2IO2 B;  4MDK E;  2HD5 B;  3H1U A;  2WX0 A;  2ZVN A;  2FCS A;  5TR5 A;  2D2Q A;  4KVG B;  2M1M A;  3PT2 B;  2K6Q A;  4LJP B;  4XX5 A;  3DVG Y;  2KTF A;  4RM9 A;  5L83 A;  2DZJ A;  3W1S C;  4TUU A;  2DZK A;  4FJY A;  1BT0 A;  1V9J A;  3JW0 X;  4GDL A;  2A5U A;  2IO3 B;  3HK0 A;  3ZNH B;  4PYU A;  2W9N A;  4IWQ A;  2AL3 A;  5GMV A;  1WYW B;  2MLB A;  3A9J A;  3EEC A;  3PRP B;  3TCA A;  3VHT C;  3PVL A;  1TTN A;  3NZS A;  2KDI A;  2CHX A;  3PRE A;  5DCN A;  3ZRC A;  4ZRJ A;  3ZUN A;  5IAA C;  2YVC A;  4KSL C;  4ANV A;  5DPS A;  2J0M A;  2DX5 B;  4ASW C;  1KOT A;  3H7P B;  5CHV C;  3WIM A;  3RZF A;  2KLG A;  1P0R A;  5AZF A;  2NR2 A;  2JPH A;  2FAZ A;  4WQO B;  3V60 A;  2FCM A;  5FR6 A;  3UF8 A;  5DPR A;  4URK A;  3KVF B;  3SDL C;  2LXA A;  4AP4 C;  2D07 B;  4B95 A;  1P1A A;  2LVP A;  3AU4 A;  3ZTC A;  2ZZP B;  2JZ3 B;  2L8J A;  3IG3 A;  3QHT A;  4NAW A;  5D94 A;  2O6V B;  2R2O A;  3KW5 B;  2CU1 A;  1WM2 A;  3APD A;  3ALB A;  1VD2 A;  3PSE B;  4FHJ A;  4MJS B;  3VH3 B;  1PQS A;  2JUO A;  3RZW C;  1P3Q U;  2KZR A;  2UYZ B;  2PE6 B;  1HE8 A;  2M0X A;  4HCP B;  1J19 A;  2KDF B;  4CYE A;  1WGR A;  4IWP A;  2G3Q B;  2M17 A;  3QAQ A;  1UZX B;  2D10 A;  2JZZ A;  2O2V A;  1WXS A;  4JQW C;  3ZO5 B;  3TJP A;  1YIW A;  3I3T B;  3ZW3 A;  2Z0D B;  4JIO U;  1Q5W B;  1CMX B;  2I1K A;  2C9W B;  2N7E A;  2KC1 A;  4NJ7 A;  4DHJ D;  4I6N B;  3VUW A;  4DBG A;  2N4F A;  3WAL A;  4A20 A;  2ZEQ A;  2IBI B;  1WF9 A;  1VCB A;  1NBF C;  1L7Y A;  4WJO A;  2KTR A;  4KIK A;  4E3C A;  4MH0 E;  4JL9 A;  4K7W A;  2GBJ A;  3ZNZ B;  3ZNI D;  4IUM B;  4HVB A;  3VVW B;  3Q3J A;  3M63 B;  3RCZ A;  3T8M A;  3ZLZ A;  4DHZ B;  2EMS A;  3SD5 A;  1R4N I;  5KHQ A;  1RLF A;  3QJZ A;  4GXB A;  4DHJ B;  4W9I A;  3ZNG C;  5JZE B;  2ZJD A;  4IM3 A;  5L95 C;  4AJY B;  2LRU A;  1OEY J;  1GJZ A;  1WX7 A;  2PE9 A;  4NPN A;  3L17 A;  3NOB A;  3D32 A;  2YLM A;  1WZ3 A;  5CTR C;  1YD8 U;  2DYO A;  5JHB A;  4B9K A;  3DCG A;  3QX1 A;  1WX9 A;  2N1W A;  3HM6 X;  3IBE A;  2KMA A;  4NY0 A;  1WGD A;  1GC7 A;  2KWC A;  3A4S C;  2J0K A;  2LGX A;  3H7S A;  3TIX A;  5D6J B;  4X57 B;  1M94 A;  2K8B A;  3C0R B;  4DHZ E;  2WWZ A;  4AUQ C;  3T9L A;  2BWF A;  2HTH A;  4JLC A;  4J6I A;  2K8H A;  2KWU B;  5E6O A;  2CS4 A;  4OVV A;  2LZ6 A;  4A3P A;  3JVZ X;  4IM2 A;  2BWE S;  1WXA A;  3A1Q A;  3CMM B;  3KUZ A;  2FIF A;  4MJS A;  5J18 A;  2IO0 B;  2MCN B;  3PHW B;  2CR5 A;  4KDL B;  4P7I A;  3VH4 B;  2DZM A;  4KV2 A;  1UH6 A;  2OJR A;  3AI5 A;  1GNU A;  4E74 A;  2KN5 A;  3V61 A;  1R4M I;  1WR6 E;  2CKH B;  2G4S A;  5J2R A;  1Q0W B;  3SHQ A;  2AEH A;  1FXT B;  2IYD B;  1GUA B;  2KMC A;  3U8Z A;  3X23 A;  4FAD A;  2UWQ A;  2PJH A;  4GDL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...