1P7FA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
b'MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7fA00
3FILB 1HEZE 2J52A 3UI3A 1IGCA 1K50A 1FD6A 1Q10A 2PW9A 2EELA 1C9FA 1F2RI 4KGRA 4HKZE 3GB1A 1D4BA 3MP9A 2IGHA 1GB1A 2LUMA 1MHXA 1QKZA 5HHDG 2N9LA 2KACA 2JWUA 2KDMA 4KGTA 1XCQL 2KWDA 2ON8A 2N9KA 2LHDA 2N7JA 1K51A 1YNTE 1IBXA 2ONQA 2PLPA 1PGBA 1GB4A 1PGAA 1MVKA 1ZXHA 2J53A 1K53A 4HJGE 1EM7A 3V3XA 1F2RC 2I2YA 4D2KA 1MHHE 1K52A 1KH0A 5JXVA 2QMTA 2K0PA 2JXTA 2LGIA 2LHEA 5HI1A 2PTLA 1MPEA 1PGXA 2RMMA 1P7EA 1XF5L 2GI9A 2ZW1A 4GLSC 1IGDA 1FCLA 2ZW0A 4OZBA 2NMQA 3FILA 2JSVX 4OZAA 4OZCA 1UWXA 2OEDA 2QSDA 1FCCC 2GB1A 1JMLA 1HZ6A 5HG2A 2IGDA 1XCTL 4WH4A 5HFYA 4KGSA 1MI0A 2JU6X 2RPVA 2KN4A 1P7FA 4IOIE 2IGGA 1IBXB 4MACA 4IKGA 1HZ5A 5BMGA 1YMHE 2KQ4X 5BMHA 2JZPA 2I38A 5BMIA
chains in the Genus database with same CATH superfamily
2KT7A 4WJPA 4LNKA 3QWZB 3R66C 3Q3FA 4PT5A 5L95C 1K50A 2MRPA 3Q8AA 1Q10A 2OHFA 3OWEB 2W3RA 1VCBA 4KGRA 2L05A 3E9SA 2AQ3B 3I5JC 3VFKA 2IBIB 2JWUA 3EGRA 1E7PB 1N60A 3WAOA 3QIJA 4KGTA 3ZO5B 2CHWA 2KMMA 1C79A 3EFCA 4XYCA 2LHDA 2KD0A 2JZZA 1HA5A 1PDXA 2BYEA 1AW7A 2FUG1 1YJ1A 1ZXHA 5JHBA 1NVID 2AL6A 1DOXA 3B9JA 1F2RC 2KTFA 5AEKB 1QT9A 1X1MA 4FJZA 1WX8A 4TUUA 5JXVA 2JYEA 4YL8A 3Q3NC 4RMAA 3A9JA 2K0PA 3IAS1 2L8JA 1F52A 3DWGC 2ICIA 4GOCA 2KDBA 2VRRB 2LASA 4ARIA 5FR6A 2CHZA 4KDLB 4ZRPA 2Z0EB 3U30A 2PVOD 1V81A 4JQWC 4EE2A 4YXDB 1L0XB 1HQRD 1JMLA 3RNFC 5EE3A 1YQ4B 4WH4A 2WX1A 2XNAC 4P1BC 2MQJA 2TSSA 3AE8B 2G1EA 4IKGA 2MBEA 4IM0A 1KF6B 4KKIA 1S3SG 1V1OA 2LXCA 1I7HA 3PVLA 2RPQA 3P4QB 2V3PA 2PIAA 2C60A 3RZFA 1FD6A 1RLFA 4GB9A 4IUMB 3P2BA 3NVWA 5CHWA 3AH7A 2O6VB 2G3QB 5JHAA 2ZPYA 5H8YE 2CS4A 2M4NA 3OG5A 3VUYA 3VVWB 3CIRB 4AOFA 2VZKD 3N32A 1QILA 2YEPF 1YOVB 2J0JA 3PTFC 1PFDA 1YX5B 3N1XC 2JWZA 1J19A 1L4ZB 1C1YB 1MG4A 3T8MA 3I63C 2ACZB 4N6EB 1NDDA 2KO3A 3JSVA 4MGKE 4RM9A 1P0RA 2J53A 4J6IA 1TS3A 2KVRA 3NRZA 2KC1A 2WLBA 3ALBA 1JRUA 2WX0A 3LDZE 2HDEA 2IPKD 3AE9B 2FCMA 3PREA 5FK9C 3Q8FA 4LK0M 4BAXA 1RWSA 4KIKB 5HI1A 3KWVA 4EEWA 2KX0A 1VZ6A 2BGFA 3ZIMA 1FNUA 1TZOA 1NENB 2WNMA 1XF5L 2WDRB 1JWMD 4P16A 3PLUA 3MJWA 4HRSA 2WDTB 3A9KA 4OZCA 4W9LA 1WR1A 3Q69A 2XN9C 4XE0A 4BOSC 1Z2MA 4C7ZA 1UGMA 1WI0A 3ETRA 5HFYA 2RDBC 2C7HA 3AU4A 2CU1A 3AE7B 1SE9A 3O13A 2C5LC 2O2VB 4GGQA 1SBBB 3BINA 2MBHA 1CK1A 1SB3C 4MGYE 4DDGD 5C23A 2WU2B 1STEA 2D3GA 4DHJB 4EZJA 4P7IA 5E6OA 4MJSB 2GBRA 1ZUD2 3HM3A 4C4VB 4CQNA 1WZ3A 1N63A 1B1ZA 3WCQA 3ZJVA 1I4PA 2LFIA 3LYYA 1N62A 4N9F4 2EMSA 1BT0A 3PPAA 5HHDG 3PZ8A 4MSQB 4PK1A 4KVGB 5KHOA 4HDOA 4GU2A 3AE3B 3BVGA 2KFKB 1QOGA 4EOYA 4CHKA 2LGSA 4YSZB 3IXSA 1YQBA 2N7JA 3W1SC 3RI7C 2ASQA 1KM7A 3L13A 4RH6A 2R2QA 3AV8A 3TBLD 3SDLC 1K52A 3TMPB 3RN9C 2RGFA 4ZDVA 3S2AA 1FM0D 1HTOA 3I3TB 1U4AA 3AECB 3M62B 2K25A 2MP2A 2GI9A 1R4NI 3NY5A 2N1VA 2QIEB 1TGZB 2FUHB 4HXDA 1OEYJ 3GZNB 3R7QA 2C7NB 5FKAC 3W2DA 1IYFA 2PVGC 5BYSA 3SEBA 1TS4A 3W5UB 3MHZA 2KQSA 1WF9A 1GUAB 4JPSA 1WGKA 3DHGC 1IBXB 1WR6E 1WGDA 4FA6A 4XDCA 4CO7A 2V1YA 2JZPA 3B1LX 3RMKC 3ML9A 4JWUC 3N3KB 2LI5A 1SIJA 2WXGA 3T3NA 5J17A 2BS3B 2MJEA 2ZVNA 4W9GA 5FR3A 1H4RA 4HKZE 2REXA 2XBBC 2LUMA 3KH0A 1TY0A 1ZXIA 1L5PA 2KACA 4M8NA 4A9AA 2L52A 1VJKA 2WHIA 1SF0A 1FXAA 3H7PA 5EE9A 2ZNVB 3OJ4B 1TIFA 1D3ZA 1DOYA 1GNUA 2ONQA 3SFEB 4P6VF 1UH6A 3UGBB 1FXTB 3V3XA 4MGZE 3QQ8B 3DQVA 2G9HD 4W9DA 3GE3C 1OGWA 1J8CA 3AE1B 2IO0B 3TEYA 1JROA 4MEMA 2MW5A 3IT6B 2DYBA 4B6WA 2JQRB 3K9PB 4S17A 2OJWA 4GDLA 3EFUA 2PMVA 4EKUA 1RYJA 2SAKA 1E8WA 3B2FA 2D2QA 2GB1A 1LM8B 1WRIA 2Z59B 3KVFB 2RPVA 1VRAB 4RF0A 5BMGA 3VXWA 1Q1OA 1ISNA 1QOBA 2AWTA 1UWMA 5J18A 5HKHA 1WSPA 1ACCA 3QK0A 2HTHA 4NQLB 3D32A 1EWCA 2KFJA 2KNBA 1J7BA 5TR5A 2KMCA 2BYVE 1WXAA 1WJ6A 1F2RI 4IM2A 1TBEA 3DBSA 1Q0WB 5C3JB 1C4PA 1WXSA 4WJNA 2IGHA 2NBVB 1GB1A 2LEKA 4WJQA 3BIID 2MA9B 2BTEA 3TL5A 2KJ6A 3QHTA 2AX5A 4NNJB 4C00A 1V9JA 4BVUC 4HPPA 4IWPA 5GXGB 2ON8A 2IO3B 4NAWA 1L7YA 1QZEA 3NZSA 2L0TA 2MWSB 2KX3A 4EFOA 1EF1A 2LRWA 1SJHD 3IT4B 3ENEA 2ZVOA 4XWWA 3BWUD 3VTWA 1VD2A 1C4CA 2SEBD 2B3AA 2EMTA 1SE3A 4C56C 4NJCA 3PT2B 4H2AA 3R2TA 3NZ3A 1FO4A 1XLQA 1EO6A 3T9LA 3WALA 3ZNID 1XLPA 3DWMA 1P98A 4WWPA 4BBNC 1R4NB 4YWGG 1KTKA 1FNWA 4M0WB 2NTTA 4DXFA 4LNIA 2KLGA 1QOFA 2OEDA 2WXOA 1HZ6A 2RD0A 1XCTL 4K1RB 3HUIA 4MGIE 2ZZPB 2IJ0A 1DYQA 4FHJA 2PJHA 2EKIA 5IKCM 4A8XC 1SE4A 1E5WA 4RCOA 5BMIA 2M0AA 2NVUI 1F0ZA 3HIZA 3C0RB 3RUIB 1SXTA 1TZ1A 2J52A 2VZKB 3WA0A 2MX2A 3NOBA 2HJ8A 5C2TB 2QJLA 2D07B 2FNJB 1YQ3B 1WMHB 2PW9A 4A90A 5IA7A 5IP4D 5I4DA 5JH5C 3DBRB 5CX3A 3R3MA 5TSSA 5DCNA 1LXDA 1P1AA 2BB5A 1N6ZA 3BYYB 3ZXVA 1RFAA 2L7RA 4FADA 2WGSA 4A3OA 5D2MB 3RCZA 1SSNA 3BY4B 3I9V1 2WXPA 3W5VB 4L1BA 2KK8A 2K6DB 3VH4B 4YTPB 3PS6A 2RDHA 1WJ4A 3P1MA 2WXQA 1RAXA 4DBGA 3Q6BA 3DBHI 4HJGE 1CJEA 2FCNA 1E7VA 1Y8RC 4W9EA 2OOBB 3RFZB 2N7DA 4MH0E 2KQ7A 2M19A 1JALA 3CSFA 3PZ7A 2KZRA 1BUIC 1WRDB 5T8IA 3EUB2 1ZDXA 3Q3MC 4O1NA 1J0GA 1V2YA 1FPYA 3PLVA 4GLSC 2K3UA 3T3OA 2KC2A 3GS2A 2NMQA 4IW0A 5D94A 2K39A 2L83A 1M4VA 3MTNB 3ECIA 3PSEB 4TQ1A 1L6UA 4CYEA 1L0YB 2G4SA 3FAHA 2I1KA 4L23A 2WXLA 4WAAA 3TJPA 3FC4A 4IOIE 3TEWA 1WGYA 2N9XA 5DPSA 2N9EB 3KLSX 4BOZB 3AI5A 4RFBA 1LFDA 2X8XX 2L3ZA 2YLMA 1T6BX 4W9JA 4E74A 4WWOA 3Q8CA 3B08A 4LNNA 2G45B 2KYWA 3PHXB 1HTQA 2V4LA 2CJOA 2FAZA 3U7DA 1FFVA 4B0MA 4IWQA 4KZCA 4G3XB 1UBQA 1OTRB 1RFKA 2IZVB 3SR6A 4HCNB 1WJNA 3V05A 3VUWA 2KTRB 1B9RA 3HK0A 3RNAC 4WJOA 2NPTB 2AYOB 4WQOB 2PLPA 3AB5A 2JT4B 3APCA 1GB4A 3RPFC 3KUCB 2HJ1A 3SD5A 4S0RA 4YT0B 2IDYA 2AQ2B 2AL3A 2KAJA 3EA6A 1YN3A 2QMTA 2RSUA 1I4GA 2A5UA 3APFA 4TKNA 1WXVA 2JXTA 1LO5D 1XT9B 3MJ5A 4C80A 5LXIB 4HLEA 4AJWA 2C9WB 2K8BA 3OJ3A 3MFGA 1WX7A 4C7YA 2ZW1A 1GC6A 2W3SA 4KV2A 3LXFA 2XK5B 4HROA 1WE7A 2DENB 3ZTDA 5CHFA 4A3PA 1UWXA 4URKA 2HTME 1KLGD 4W9HA 1WGHA 1E8YA 1UELA 3DVNU 4WURA 3TCAA 2HD5B 1HZ5A 1R7SA 1V97A 4DWFA 3KUZA 4PS3A 4RGNA 3PRZA 2LUEA 2DYMA 3ZNHB 3CMMB 3VHTC 4DQOC 1VLBA 3ZQ4A 1R4MB 3WIMA 2L00B 1SE2A 2Z0DB 3ONSA 2BQQA 4ZRIA 3N1ZC 2MCNB 3U2SC 4BKGA 3W1YA 5J2RA 2KANA 2PE6B 2K8HA 4ZRJA 2W82A 4FJVB 4W9KA 3AE5B 3PRMB 1JWUD 4IDIA 3DVGX 3NVYA 5CTRC 1YIWA 5G55A 1NEKB 2IY0B 1WYWB 1UF0A 3DBHB 5LXHA 4BKSD 1L4DB 2LGDA 1YX6B 3NS1A 3PO0A 1EM7A 4JWSC 4NJ7A 1N5WA 1MG8A 1FEHA 3WAMA 2IYDB 3AEBB 4GN1A 4ANUA 1A5RA 2IO2B 1C3TA 2KLCA 4MH8A 1KJTA 2YEPB 4FHKA 2LGIA 2LHEA 3ML8A 3BZDB 2LVQA 3PRPB 3DPDA 4YTNB 3ZW3A 5G5HA 3KWLA 1E8XA 4LTUA 1P7EA 1DOIA 5IO9A 1ET6A 4ITKA 1WIAA 1UBIA 3JVZX 3NUHB 5DPRA 3HHMA 2W9NA 2DNFA 5D3IB 4AJYB 3RNGC 3SU8X 3O65B 5E6NA 3VRBB 1FCCC 3VH3B 3QX1A 4ZRKA 1MI0A 4ZHOA 4A6QA 4I6NB 3KQ4A 2C7MB 2WXJA 3E56A 4DXAB 4YSXB 3UF8A 2O6VD 4M8MA 4JGHB 4RF1A 2LJ5A 1UUPA 2K6QA 2MH7A 2MEKA 5BYRA 3VDZA 4MM3A 1D4BA 2JF5A 1N61A 1QF6A 4KZ0A 3P63A 1CZPA 5AZFA 1I4RA 1S1QB 2MBQA 3ZTCA 1GC7A 2KDEB 2UYZB 3IG3A 4M01A 3DDCB 2ZNVC 3QJZA 5AUKA 4IC7B 1YN4A 4GMVA 2V0GA 3IHPC 2JVCA 2KWVB 1WY8A 2BS4B 2GBKA 1PUTA 1WYGA 2D3AA 3V60A 2GLSA 5MPOA 3RNEC 4G0NB 4E71A 1Q5WB 1FCLA 2ZW0A 3ZXRA 1ZP0B 3H1UA 1FMAD 3FILA 4FJYA 4HKQA 3NVZA 3SFDB 1WM3A 1XD3B 5AZHA 1YN5A 2IY1B 2KKCA 4HVBA 1EU3A 4LDTB 1TS5A 5DPWA 4ZYNA 1D5XC 1XEEA 4MACA 2BYTA 1EWYC 3OAWA 3L10B 3AE2B 4HPMB 4ACFA 4DHJD 4W9FA 4A55A 2AQ1B 1EUVB 4RGTA 2INNE 3C19A 4KIKA 2LMCA 2CR5A 3A9JB 3V62A 3EECA 2CJNA 1TKEA 3PGEA 3RZWC 3GP7A 1V49A 1C77A 3QAQA 2VH2A 3AN1A 5LNK1 4BBNF 4II3B 1T0SC 3ZDTA 1ZW7A 2JZ3B 2N9KA 1T0RC 4F1SA 4NAMA 4KX6B 2O2VA 4HCPB 1JRPA 4XWTA 2LXAA 4XZ4A 1PGAA 2LRUA 2I2YA 1FRDA 1SEBD 3J9CA 4LCDE 3VUXA 1C4AA 3H8HA 3ABVB 2Y5BB 1Y56A 4MJSA 4W9CA 1K8RB 4DK5A 4AQ7A 1GG3A 1OQYA 3RNCC 1ENFA 3BK2A 2W55A 3JYUA 3QCAA 4JL9A 5BYQA 4BZAA 1TYGB 2DZKA 3P4SB 2JSVX 4OZAA 4HDQA 2KFKA 1T5XD 3EHVA 2BW2A 1EU4A 1VZ7A 5G2NA 2IGDA 1TS2A 3DBLI 4IG7B 3VQIA 2K1FA 1D5ZC 4RGOS 3RD2A 3ZUNA 2GMIC 3P4PB 3JSVB 4ICUA 4QAYA 1GAQB 4XX5A 4HWIB 3U7ZA 2JUOA 1XO3A 3W1SA 4BKTA 4ANWA 3L16A 2ZEQA 3LJ3A 4WWNA 1TKGA 2M1MA 2JPHA 1XXGA 1I4XA 4US8A 3ZDMC 4IWOA 2WXHA 3R8BA 3N9YC 3KYCD 1MHXA 2DX5B 4XDDA 1TJEA 1WE6A 4GXBA 3UQAA 2K22A 3U8ZA 2WXMA 4K81A 1KLVA 1A70A 3A9KB 4X57B 1F9JA 1NYQA 2KDFB 5E6PA 2J4XA 3C8YA 4LNFA 1IBXA 2DZMA 4DHZB 4RGMA 4II2B 2MBOA 4DHZE 3BVZA 1FRRA 2GBMA 2QDFA 5EDSA 2AEHA 4D2KA 3L54A 3I57A 2MSED 3NHEB 3DVNV 4G11A 3GE8C 3L08A 5DPTA 4EZLA 2J0MA 1FNVA 4B95A 2UU7A 2DZIA 3MC9A 1PGXA 4ICVA 3NG0A 3ZGZA 1ZPSA 1IGDA 1E0ZA 1XQQA 3IVFA 3Q8EA 1TT5B 1C78A 2INPE 2QSDA 2VH1A 3DHHC 3BVMA 3M95A 2RR9A 2FBWB 1V8CA 2JU6X 1HE8A 3KYDD 3ZRFA 5L83A 4TSSA 1N5XA 3GOEA 4GDKA 1UD7A 1UZXB 2PEAA 4ZOHC 2ZPNA 1L2NA 2LWPA 1BXTA 4PS7A 3BK1A 4EZKA 4K3BA 1SIFA 3UQBA 2BKFA 3QA8A 4PS8A 2MP2B 4TQ0A 4I6PA 2N7EA 2N9LA 2NCNA 3Q14C 3X0WA 4AWJA 1J7AA 2BBCA 2WDVB 5EE0A 1WFYA 2WS3B 4TMAB 2R2OA 4GIVA 1YNTE 2D3BA 2DZJA 3UINB 2L1AA 3AEFB 3M63B 2V3NA 4M00A 1I4QA 4MM3B 1ROEA 3VTUA 1ET9A 4NY0A 4RM8A 5KHQA 2GRIA 2BYFA 1UGJA 4XC2A 3L17A 2D5GA 2KJRA 3GZNI 3TUOA 1E10A 3CSTA 3H6NA 4EUTA 1KFYB 2WDQB 2N4FA 2DHZA 1MPEA 2ZCBA 2RMMA 2KN5A 2JXXA 3RNBC 5JZEB 1V1PA 1JWSD 1V5OA 4ANXA 1T0YA 2N9PC 3DBLB 3BYTB 4TV3A 4ASWC 1WXQA 2NS5A 2GOWA 4KGSA 3H7PB 1IP9A 4ARCA 3AE6B 3B2GA 4HJKA 1YJIA 4WWMA 3NZUA 3R2IA 2KQ4X 4RNAA 1GJZA 5BMHA 2LGYA 2DAJA 1D6EC 3FILB 2WXKA 2KOXA 3Q3JA 1WH3A 2UWQA 4WQMA 3ZJTA 2OJRA 1VZ8A 4LNOA 1VR9A 5E6JA 5D7GA 4KSKC 4YTMB 2WQYB 2A4ZA 2JX5A 4DDID 4PYZA 1WX9A 4IM3A 3IAM1 3MHSD 4M0WA 1E90A 4LJOB 1F77A 2CHXA 1QKZA 4GDLB 1ZE3D 2IO1B 2NTSA 2PE9A 3UIOB 2BB6A 2KWDA 2JYTA 2ZCCA 3U52E 2W54A 3A1QA 3Q2AC 3PV1A 3WAPA 2MHJA 2Q5WD 2V9HA 3NVVA 1PGBA 3KUDB 4US9A 1MVKA 2QILA 2L76A 3AULA 5AUIA 2GBNA 2JRHA 1G6JA 2CU3A 1MHHE 4PYUA 4JIOU 1D5MC 3B0AA 1ZDVA 1MFWA 3NS8A 2KHWB 2LVPA 4GSWA 2NBWB 3ZNGC 1OQQA 2J0KA 3X23A 4LLGM 1V80A 1ZOYB 1WMHA 2CKHB 2B76B 2D3CA 3AEDB 3PHWB 3AXCA 1XLOA 3QC8B 3UIPB 5G5GA 5IAAC 2WWZA 2PPHA 1AWDA 2INDC 2QHOA 3TIXA 4F7ZA 2D11A 2MJ3A 3QARA 1PQSA 4MELA 2KWUB 4NJ6A 1J7CA 2JY6A 2KXJA 5CHVC 2NBUA 3V6EB 1CMXB 4K3CA 5HG2A 4K7UA 4NAWB 3AEAB 2LVOA 3RT3B 4FULA 4WAFA 1ZGUB 3PZDA 2KVZA 1JWBD 1RM6C 5C1ZA 2I38A 3IFWB 1OFFA 1OEYA 4HEA1 3UI3A 2Y5PA 1KLUD 3KW5B 3ZLZA 2BWFA 2MJDA 3V6CB 2QC8A 3CWIA 4K7WA 4XGAB 2EELA 3HVDA 1E8ZA 3ZJUA 3GB1A 3LB8C 4BKSA 2LD9A 1V6EA 2HE7A 3A4SC 3APDA 4F8CB 3H7SA 2DBYA 1L0VB 2N1WA 3A4RA 4M02A 1GPXA 2JRIB 2INCC 3Q8BA 4FN2A 3AEEB 3RYTA 1E6EB 1QOAA 1L6VA 4BFRA 1XLNA 2Z8LA 1AYFA 3VRAB 1JCKB 2R61A 2X38A 2K9XA 4JX1C 4E3CA 2WXFA 1K53A 3V61A 2H88B 5AZGA 3P4RB 1KH0A 1T0QC 1TKYA 4YSYB 1NI2A 1LGRA 4B9KA 1OQRA 2BS2B 2ZJDA 3IBEA 2DLBA 2PTLA 2NR2A 3CF6E 4KSLC 4LJPB 1IUEA 2YVCA 2L32A 2BPSA 1SGHA 3VR9B 3RULA 5D3DA 2FCQA 3DHIC 2WU5B 1JWAD 1UNSA 1AARA 2KTRA 2XEWA 4MDKE 4I6LB 1DGJA 3ZRCA 2NPTA 1HXYD 4NZLB 4OHJA 1YD8U 3W9CB 2O6VA 1P9DU 3R7RA 1V86A 1SJED 3AE4B 2Y5CA 2IGGA 5IN7A 1WZ0A 2K8CA 1YMHE 2QCZA 3DBRI 4AUQC 2LJIA 3MC0B 1HEZE 2DAFA 1P3QU 4A20A 4NQKE 3URYA 1I35A 5GMVA 4DXGA 2V4IB 4G50A 3TEXA 2KDIA 3M3JA 3N20C 4GDKB 1TTNA 2XK5A 2PKOA 4REZA 1YJJA 4ZRQA 2L0FA 2QEJC 1WXMA 2KDMA 1XCQL 1BMLC 1WGRA 1F1HA 4OVUA 2E3TA 2GBJA 5EE1A 2J7QB 4N58A 4FXCA 1WM2A 2WXNA 3AEGB 2BF8B 2WYQA 2FIDA 3Q3OC 2BT6A 3TSSA 5D6JB 3ZYYX 4HPLB 3AMZA 4JLCA 1ZKHA 1E7UA 1H8CA 4NPNA 4ANVA 1NI3A 3JW0X 3AM9A 4OW0A 3EC8A 1IPGA 2LGXA 2FIFA 4UDUC 3K9OB 4OVZA 3N30A 2K5PA 4OZBA 1C76A 4B0EA 2FCSA 2M17A 1WWTA 1AN8A 1E9MA 2DWQA 2M0XA 2FE8A 4C4VA 1FXIA 1NYRA 2M56B 4K7SA 2BWES 2KN4A 4R3DA 2D10A 4WIPA 5IOIA 3TEZA 3A33B 4P1CC 1I4HA 2G4DB 3FKYA 2Y3AA 4USAA 3P42A 3VTVA 3ZVVA 4W9IA 3HRDD 1FFUA 1KOTA 1V1PB 1M94A 1EF5A 2KJHB 3VR8B 4JE3B 1IGCA 2N0SB 4MT5A 1VDVA 2H89B 4KKJA 1LQBA 1GOZA 3L0WB 2MLBA 1C9FA 2J42A 3NJTA 3U4EG 3DVGY 2BVCA 4ZYSA 3MP9A 4FBJB 2EKEC 2WXIA 2DYOA 4J3OD 3WANA 3L4PA 3H9DA 1QQRA 1Z5SB 3DCGA 3DOWA 1RRBA 4AP4C 2BKRB 1K51A 3SHQA 1I42A 3ZKJC 1NBFC 2KMAA 2RDGA 4L2YA 1CQVA 4OVVA 2V3SA 2WXRA 1V5TA 4FLHA 3MC8A 4MSMB 2MBBB 1T3QA 1TY2A 3A1QB 3VAWA 1PYWD 1MJDA 2KWCA 4Q2JA 4KDIC 5BO4B 4HK2A 4N59A 1FIQA 2I1JA 2E6XA 1JW9D 1KRHA 2M8SA 1WJUA 3ZNZB 1ESFA 2WP9B 5H92C 4LDTD 3AU5A 1R4MI 1QLBB 4AS1A 3N1YC 3HVZA 1JQ4A 1P7FA 4ZHPA 3HM6X 1WGGA 5LLIA 3OLMD 2LZ6A
chains in the Genus database with same CATH topology
3E56A 3FILB 2WXKA 1ACCA 4PT5A 4YSXB 1EWCA 1K50A 1J7BA 4WQMA 3ZJTA 4RF1A 1VZ8A 3Q8AA 1UUPA 1Q10A 1VR9A 2OHFA 5E6JA 2MH7A 5D7GA 3OWEB 2W3RA 2MEKA 1F2RI 5BYRA 4YTMB 2WQYB 4KGRA 5C3JB 2JX5A 3E9SA 1C4PA 1D4BA 2IGHA 3IAM1 4M0WA 1GB1A 2LEKA 1N61A 3BIID 2AQ3B 1QF6A 1F77A 2BTEA 3P63A 1QKZA 4GDLB 2AX5A 1CZPA 1ZE3D 2NTSA 2JWUA 3EGRA 1E7PB 1N60A 1I4RA 2BB6A 4KGTA 2KWDA 2ON8A 5GXGB 2JYTA 3U52E 2KMMA 1C79A 2W54A 2Q5WD 2LHDA 1SJHD 3IT4B 1HA5A 1PDXA 1AW7A 3NVVA 1PGBA 2FUG1 4US9A 1MVKA 1ZXHA 1NVID 4XWWA 1DOXA 2QILA 3B9JA 1F2RC 5AUIA 1QT9A 3BWUD 2CU3A 1MHHE 5AUKA 1D5MC 5JXVA 2JYEA 1C4CA 1ZDVA 2SEBD 1YN4A 1SE3A 2V0GA 4C56C 4NJCA 1OQQA 2BS4B 2K0PA 3IAS1 4LLGM 1PUTA 3DWGC 1ZOYB 2ICIA 4H2AA 3R2TA 1WYGA 3NZ3A 1FO4A 2B76B 1XLQA 3AEDB 1XLPA 3DWMA 4ARIA 4YWGG 1XLOA 4ZRPA 5MPOA 1KTKA 5G5GA 1FNWA 1AWDA 2PVOD 1FCLA 2NTTA 2ZW0A 2MJ3A 1ZP0B 4DXFA 1FMAD 3FILA 4HKQA 4EE2A 3NVZA 1J7CA 3SFDB 1QOFA 2OEDA 4YXDB 1L0XB 2WXOA 1YN5A 1HQRD 1JMLA 1HZ6A 5EE3A 1YQ4B 5HG2A 1XCTL 4NAWB 4WH4A 1EU3A 3HUIA 3AEAB 2XNAC 2IJ0A 1DYQA 1TS5A 2TSSA 2EKIA 4WAFA 1D5XC 3AE8B 1XEEA 2G1EA 4IKGA 4MACA 2BYTA 1EWYC 4A8XC 1JWBD 1KF6B 3AE2B 1SE4A 4KKIA 1RM6C 1V1OA 4RCOA 2I38A 1OFFA 2M0AA 2AQ1B 4A55A 1I7HA 5BMIA 1F0ZA 1SXTA 3P4QB 2J52A 2V3PA 4RGTA 4HEA1 2PIAA 2VZKB 3UI3A 2Y5PA 1KLUD 2INNE 2MJDA 2LMCA 5C2TB 2QJLA 1FD6A 3CWIA 1YQ3B 2CJNA 3NVWA 2PW9A 4A90A 2EELA 3AH7A 3HVDA 1TKEA 3ZJUA 5H8YE 5I4DA 3GB1A 3LB8C 3GP7A 5TSSA 1C77A 3AN1A 2BB5A 3CIRB 2DBYA 1L0VB 3BYYB 2VZKD 5LNK1 1GPXA 1QILA 2YEPF 3Q8BA 1PFDA 1SSNA 3AEEB 1L4ZB 1E6EB 2N9KA 1QOAA 1L6VA 3I9V1 1XLNA 2WXPA 4NAMA 2Z8LA 1AYFA 4KX6B 3W5VB 2ACZB 3VRAB 4L1BA 1JCKB 4N6EB 4YTPB 1JRPA 2R61A 4XWTA 2RDHA 3P1MA 2X38A 2K9XA 1PGAA 2WXQA 2J53A 2WXFA 1TS3A 1K53A 3NRZA 4JX1C 4HJGE 1CJEA 2WLBA 2I2YA 2H88B 1FRDA 1SEBD 3P4RB 3J9CA 1KH0A 2HDEA 3RFZB 1C4AA 2IPKD 3AE9B 3H8HA 3ABVB 1TKYA 4YSYB 1Y56A 5FK9C 2M19A 3Q8FA 1JALA 4LK0M 1RWSA 3PZ7A 1OQRA 2BS2B 2DLBA 4AQ7A 1BUIC 5HI1A 5T8IA 3EUB2 2PTLA 3KWVA 1ZDXA 1VZ6A 4O1NA 1IUEA 1ENFA 2L32A 2W55A 3BK2A 1FNUA 1TZOA 1NENB 3VR9B 2WNMA 1XF5L 5D3DA 4GLSC 2K3UA 3T3OA 2WDRB 1JWMD 3GS2A 4P16A 5BYQA 2NMQA 1TYGB 2WU5B 3P4SB 4HRSA 1JWAD 2JSVX 4OZAA 4OZCA 1UNSA 1T5XD 2BW2A 2L83A 2XN9C 3Q69A 1M4VA 1EU4A 1DGJA 1VZ7A 4XE0A 2IGDA 4C7ZA 4NZLB 1HXYD 1TS2A 3ETRA 4OHJA 4TQ1A 5HFYA 1L6UA 3VQIA 1L0YB 3FAHA 4L23A 3W9CB 2WXLA 1D5ZC 1SJED 4RGOS 3AE7B 3AE4B 3FC4A 3O13A 4IOIE 2Y5CA 2IGGA 3TEWA 1SBBB 1CK1A 1SB3C 1YMHE 3P4PB 3KLSX 1GAQB 2LJIA 4RFBA 3U7ZA 2WU2B 1XO3A 3MC0B 1STEA 1HEZE 3W1SA 1T6BX 1TKGA 3Q8CA 1ZUD2 4CQNA 3URYA 1XXGA 1I4XA 1N63A 2V4IB 1B1ZA 2CJOA 4DXGA 4US8A 3WCQA 3TEXA 1FFVA 3ZJVA 2WXHA 1I4PA 2LFIA 3N9YC 3LYYA 4GDKB 3R8BA 4B0MA 1N62A 1MHXA 2PKOA 4XDDA 1TJEA 4REZA 1YJJA 3PZ8A 4ZRQA 5HHDG 2K22A 2QEJC 1RFKA 3SR6A 3V05A 2KDMA 2WXMA 1A70A 3AE3B 3BVGA 1XCQL 1QOGA 1BMLC 4YSZB 1B9RA 1NYQA 2E3TA 3IXSA 2J4XA 2N7JA 5EE1A 4N58A 3C8YA 4FXCA 1IBXA 2PLPA 3AB5A 4RGMA 2WXNA 1GB4A 3AEGB 3RPFC 4RH6A 3BVZA 3AV8A 1FRRA 2BT6A 4YT0B 2IDYA 2AQ2B 4D2KA 3I57A 1K52A 3TSSA 2KAJA 3EA6A 3ZYYX 1YN3A 2QMTA 3AMZA 1I4GA 1FM0D 2JXTA 1LO5D 1NI3A 3MJ5A 1FNVA 3AM9A 3AECB 4C80A 4OW0A 1PGXA 4UDUC 3MFGA 4OVZA 4C7YA 3ZGZA 2GI9A 1ZPSA 2ZW1A 2W3SA 1IGDA 1E0ZA 2K5PA 2QIEB 3Q8EA 4OZBA 3LXFA 1C76A 4HROA 4B0EA 1C78A 1WWTA 1UWXA 2INPE 2QSDA 1AN8A 1E9MA 2DWQA 2HTME 5FKAC 3W2DA 2PVGC 3BVMA 2FE8A 5BYSA 1KLGD 3SEBA 1TS4A 3W5UB 2FBWB 1FXIA 1NYRA 3MHZA 1V8CA 2M56B 2JU6X 4JPSA 4WURA 2KN4A 4R3DA 4TSSA 1N5XA 1WGKA 4WIPA 1IBXB 3TEZA 1HZ5A 1R7SA 1I4HA 1V97A 4ZOHC 2Y3AA 4USAA 3P42A 4RGNA 1BXTA 4XDCA 3HRDD 1FFUA 2DYMA 2JZPA 1V1PB 4DQOC 1VLBA 3BK1A 3VR8B 3ZQ4A 4JE3B 1IGCA 4JWUC 2N0SB 1SIJA 4MT5A 1SE2A 1VDVA 2WXGA 2H89B 3T3NA 4KKJA 2BS3B 2MJEA 1GOZA 5FR3A 3U2SC 1C9FA 2J42A 3U4EG 4ZYSA 4HKZE 3MP9A 2LUMA 2W82A 1TY0A 2WXIA 2DYOA 4J3OD 1ZXIA 4TQ0A 1L5PA 2N9LA 2KACA 3L4PA 4A9AA 3AE5B 1JWUD 4IDIA 3NVYA 2L52A 1QQRA 1VJKA 1J7AA 2BBCA 2WDVB 1SF0A 1FXAA 5EE9A 5EE0A 1NEKB 2WS3B 4TMAB 1K51A 1YNTE 1DOYA 2ONQA 2L1AA 3AEFB 3SFEB 1L4DB 4P6VF 3NS1A 2V3NA 1I4QA 3PO0A 4MM3B 1EM7A 3V3XA 4JWSC 1ROEA 1N5WA 2RDGA 1ET9A 2G9HD 4L2YA 2GRIA 1FEHA 1CQVA 2WXRA 3AEBB 1UGJA 2D5GA 4MH8A 3TUOA 2YEPB 1E10A 2LGIA 2LHEA 1T3QA 3AE1B 1KFYB 1TY2A 2WDQB 1PYWD 3TEYA 1JROA 3BZDB 1MPEA 4YTNB 3IT6B 5G5HA 3KWLA 2RMMA 2JQRB 4Q2JA 4LTUA 1P7EA 1DOIA 1ET6A 4ITKA 1V1PA 4N59A 1JWSD 2PMVA 3NUHB 1FIQA 1RYJA 2E6XA 1JW9D 1KRHA 2SAKA 3B2FA 5D3IB 1ESFA 3BYTB 2WP9B 5H92C 3VRBB 1FCCC 2GB1A 1WRIA 1WXQA 1QLBB 4KGSA 4AS1A 1MI0A 4ZHOA 4ARCA 3HVZA 3AE6B 2RPVA 1JQ4A 1VRAB 3B2GA 4RF0A 4A6QA 1P7FA 4ZHPA 1YJIA 4WWMA 5BMGA 1QOBA 1UWMA 2KQ4X 3KQ4A 3R2IA 4RNAA 5BMHA 1WSPA 1D6EC 2WXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIL B;  1HEZ E;  2J52 A;  3UI3 A;  1IGC A;  1K50 A;  1FD6 A;  1Q10 A;  2PW9 A;  2EEL A;  1C9F A;  1F2R I;  4KGR A;  4HKZ E;  3GB1 A;  1D4B A;  3MP9 A;  2IGH A;  1GB1 A;  2LUM A;  1MHX A;  1QKZ A;  5HHD G;  2N9L A;  2KAC A;  2JWU A;  2KDM A;  4KGT A;  1XCQ L;  2KWD A;  2ON8 A;  2N9K A;  2LHD A;  2N7J A;  1K51 A;  1YNT E;  1IBX A;  2ONQ A;  2PLP A;  1PGB A;  1GB4 A;  1PGA A;  1MVK A;  1ZXH A;  2J53 A;  1K53 A;  4HJG E;  1EM7 A;  3V3X A;  1F2R C;  2I2Y A;  4D2K A;  1MHH E;  1K52 A;  1KH0 A;  5JXV A;  2QMT A;  2K0P A;  2JXT A;  2LGI A;  2LHE A;  5HI1 A;  2PTL A;  1MPE A;  1PGX A;  2RMM A;  1P7E A;  1XF5 L;  2GI9 A;  2ZW1 A;  4GLS C;  1IGD A;  1FCL A;  2ZW0 A;  4OZB A;  2NMQ A;  3FIL A;  2JSV X;  4OZA A;  4OZC A;  1UWX A;  2OED A;  2QSD A;  1FCC C;  2GB1 A;  1JML A;  1HZ6 A;  5HG2 A;  2IGD A;  1XCT L;  4WH4 A;  5HFY A;  4KGS A;  1MI0 A;  2JU6 X;  2RPV A;  2KN4 A;  1P7F A;  4IOI E;  2IGG A;  1IBX B;  4MAC A;  4IKG A;  1HZ5 A;  5BMG A;  1YMH E;  2KQ4 X;  5BMH A;  2JZP A;  2I38 A;  5BMI A; 
#chains in the Genus database with same CATH topology
 2KT7 A;  4WJP A;  4LNK A;  3QWZ B;  3R66 C;  3Q3F A;  4PT5 A;  5L95 C;  1K50 A;  2MRP A;  3Q8A A;  1Q10 A;  2OHF A;  3OWE B;  2W3R A;  1VCB A;  4KGR A;  2L05 A;  3E9S A;  2AQ3 B;  3I5J C;  3VFK A;  2IBI B;  2JWU A;  3EGR A;  1E7P B;  1N60 A;  3WAO A;  3QIJ A;  4KGT A;  3ZO5 B;  2CHW A;  2KMM A;  1C79 A;  3EFC A;  4XYC A;  2LHD A;  2KD0 A;  2JZZ A;  1HA5 A;  1PDX A;  2BYE A;  1AW7 A;  2FUG 1;  1YJ1 A;  1ZXH A;  5JHB A;  1NVI D;  2AL6 A;  1DOX A;  3B9J A;  1F2R C;  2KTF A;  5AEK B;  1QT9 A;  1X1M A;  4FJZ A;  1WX8 A;  4TUU A;  5JXV A;  2JYE A;  4YL8 A;  3Q3N C;  4RMA A;  3A9J A;  2K0P A;  3IAS 1;  2L8J A;  1F52 A;  3DWG C;  2ICI A;  4GOC A;  2KDB A;  2VRR B;  2LAS A;  4ARI A;  5FR6 A;  2CHZ A;  4KDL B;  4ZRP A;  2Z0E B;  3U30 A;  2PVO D;  1V81 A;  4JQW C;  4EE2 A;  4YXD B;  1L0X B;  1HQR D;  1JML A;  3RNF C;  5EE3 A;  1YQ4 B;  4WH4 A;  2WX1 A;  2XNA C;  4P1B C;  2MQJ A;  2TSS A;  3AE8 B;  2G1E A;  4IKG A;  2MBE A;  4IM0 A;  1KF6 B;  4KKI A;  1S3S G;  1V1O A;  2LXC A;  1I7H A;  3PVL A;  2RPQ A;  3P4Q B;  2V3P A;  2PIA A;  2C60 A;  3RZF A;  1FD6 A;  1RLF A;  4GB9 A;  4IUM B;  3P2B A;  3NVW A;  5CHW A;  3AH7 A;  2O6V B;  2G3Q B;  5JHA A;  2ZPY A;  5H8Y E;  2CS4 A;  2M4N A;  3OG5 A;  3VUY A;  3VVW B;  3CIR B;  4AOF A;  2VZK D;  3N32 A;  1QIL A;  2YEP F;  1YOV B;  2J0J A;  3PTF C;  1PFD A;  1YX5 B;  3N1X C;  2JWZ A;  1J19 A;  1L4Z B;  1C1Y B;  1MG4 A;  3T8M A;  3I63 C;  2ACZ B;  4N6E B;  1NDD A;  2KO3 A;  3JSV A;  4MGK E;  4RM9 A;  1P0R A;  2J53 A;  4J6I A;  1TS3 A;  2KVR A;  3NRZ A;  2KC1 A;  2WLB A;  3ALB A;  1JRU A;  2WX0 A;  3LDZ E;  2HDE A;  2IPK D;  3AE9 B;  2FCM A;  3PRE A;  5FK9 C;  3Q8F A;  4LK0 M;  4BAX A;  1RWS A;  4KIK B;  5HI1 A;  3KWV A;  4EEW A;  2KX0 A;  1VZ6 A;  2BGF A;  3ZIM A;  1FNU A;  1TZO A;  1NEN B;  2WNM A;  1XF5 L;  2WDR B;  1JWM D;  4P16 A;  3PLU A;  3MJW A;  4HRS A;  2WDT B;  3A9K A;  4OZC A;  4W9L A;  1WR1 A;  3Q69 A;  2XN9 C;  4XE0 A;  4BOS C;  1Z2M A;  4C7Z A;  1UGM A;  1WI0 A;  3ETR A;  5HFY A;  2RDB C;  2C7H A;  3AU4 A;  2CU1 A;  3AE7 B;  1SE9 A;  3O13 A;  2C5L C;  2O2V B;  4GGQ A;  1SBB B;  3BIN A;  2MBH A;  1CK1 A;  1SB3 C;  4MGY E;  4DDG D;  5C23 A;  2WU2 B;  1STE A;  2D3G A;  4DHJ B;  4EZJ A;  4P7I A;  5E6O A;  4MJS B;  2GBR A;  1ZUD 2;  3HM3 A;  4C4V B;  4CQN A;  1WZ3 A;  1N63 A;  1B1Z A;  3WCQ A;  3ZJV A;  1I4P A;  2LFI A;  3LYY A;  1N62 A;  4N9F 4;  2EMS A;  1BT0 A;  3PPA A;  5HHD G;  3PZ8 A;  4MSQ B;  4PK1 A;  4KVG B;  5KHO A;  4HDO A;  4GU2 A;  3AE3 B;  3BVG A;  2KFK B;  1QOG A;  4EOY A;  4CHK A;  2LGS A;  4YSZ B;  3IXS A;  1YQB A;  2N7J A;  3W1S C;  3RI7 C;  2ASQ A;  1KM7 A;  3L13 A;  4RH6 A;  2R2Q A;  3AV8 A;  3TBL D;  3SDL C;  1K52 A;  3TMP B;  3RN9 C;  2RGF A;  4ZDV A;  3S2A A;  1FM0 D;  1HTO A;  3I3T B;  1U4A A;  3AEC B;  3M62 B;  2K25 A;  2MP2 A;  2GI9 A;  1R4N I;  3NY5 A;  2N1V A;  2QIE B;  1TGZ B;  2FUH B;  4HXD A;  1OEY J;  3GZN B;  3R7Q A;  2C7N B;  5FKA C;  3W2D A;  1IYF A;  2PVG C;  5BYS A;  3SEB A;  1TS4 A;  3W5U B;  3MHZ A;  2KQS A;  1WF9 A;  1GUA B;  4JPS A;  1WGK A;  3DHG C;  1IBX B;  1WR6 E;  1WGD A;  4FA6 A;  4XDC A;  4CO7 A;  2V1Y A;  2JZP A;  3B1L X;  3RMK C;  3ML9 A;  4JWU C;  3N3K B;  2LI5 A;  1SIJ A;  2WXG A;  3T3N A;  5J17 A;  2BS3 B;  2MJE A;  2ZVN A;  4W9G A;  5FR3 A;  1H4R A;  4HKZ E;  2REX A;  2XBB C;  2LUM A;  3KH0 A;  1TY0 A;  1ZXI A;  1L5P A;  2KAC A;  4M8N A;  4A9A A;  2L52 A;  1VJK A;  2WHI A;  1SF0 A;  1FXA A;  3H7P A;  5EE9 A;  2ZNV B;  3OJ4 B;  1TIF A;  1D3Z A;  1DOY A;  1GNU A;  2ONQ A;  3SFE B;  4P6V F;  1UH6 A;  3UGB B;  1FXT B;  3V3X A;  4MGZ E;  3QQ8 B;  3DQV A;  2G9H D;  4W9D A;  3GE3 C;  1OGW A;  1J8C A;  3AE1 B;  2IO0 B;  3TEY A;  1JRO A;  4MEM A;  2MW5 A;  3IT6 B;  2DYB A;  4B6W A;  2JQR B;  3K9P B;  4S17 A;  2OJW A;  4GDL A;  3EFU A;  2PMV A;  4EKU A;  1RYJ A;  2SAK A;  1E8W A;  3B2F A;  2D2Q A;  2GB1 A;  1LM8 B;  1WRI A;  2Z59 B;  3KVF B;  2RPV A;  1VRA B;  4RF0 A;  5BMG A;  3VXW A;  1Q1O A;  1ISN A;  1QOB A;  2AWT A;  1UWM A;  5J18 A;  5HKH A;  1WSP A;  1ACC A;  3QK0 A;  2HTH A;  4NQL B;  3D32 A;  1EWC A;  2KFJ A;  2KNB A;  1J7B A;  5TR5 A;  2KMC A;  2BYV E;  1WXA A;  1WJ6 A;  1F2R I;  4IM2 A;  1TBE A;  3DBS A;  1Q0W B;  5C3J B;  1C4P A;  1WXS A;  4WJN A;  2IGH A;  2NBV B;  1GB1 A;  2LEK A;  4WJQ A;  3BII D;  2MA9 B;  2BTE A;  3TL5 A;  2KJ6 A;  3QHT A;  2AX5 A;  4NNJ B;  4C00 A;  1V9J A;  4BVU C;  4HPP A;  4IWP A;  5GXG B;  2ON8 A;  2IO3 B;  4NAW A;  1L7Y A;  1QZE A;  3NZS A;  2L0T A;  2MWS B;  2KX3 A;  4EFO A;  1EF1 A;  2LRW A;  1SJH D;  3IT4 B;  3ENE A;  2ZVO A;  4XWW A;  3BWU D;  3VTW A;  1VD2 A;  1C4C A;  2SEB D;  2B3A A;  2EMT A;  1SE3 A;  4C56 C;  4NJC A;  3PT2 B;  4H2A A;  3R2T A;  3NZ3 A;  1FO4 A;  1XLQ A;  1EO6 A;  3T9L A;  3WAL A;  3ZNI D;  1XLP A;  3DWM A;  1P98 A;  4WWP A;  4BBN C;  1R4N B;  4YWG G;  1KTK A;  1FNW A;  4M0W B;  2NTT A;  4DXF A;  4LNI A;  2KLG A;  1QOF A;  2OED A;  2WXO A;  1HZ6 A;  2RD0 A;  1XCT L;  4K1R B;  3HUI A;  4MGI E;  2ZZP B;  2IJ0 A;  1DYQ A;  4FHJ A;  2PJH A;  2EKI A;  5IKC M;  4A8X C;  1SE4 A;  1E5W A;  4RCO A;  5BMI A;  2M0A A;  2NVU I;  1F0Z A;  3HIZ A;  3C0R B;  3RUI B;  1SXT A;  1TZ1 A;  2J52 A;  2VZK B;  3WA0 A;  2MX2 A;  3NOB A;  2HJ8 A;  5C2T B;  2QJL A;  2D07 B;  2FNJ B;  1YQ3 B;  1WMH B;  2PW9 A;  4A90 A;  5IA7 A;  5IP4 D;  5I4D A;  5JH5 C;  3DBR B;  5CX3 A;  3R3M A;  5TSS A;  5DCN A;  1LXD A;  1P1A A;  2BB5 A;  1N6Z A;  3BYY B;  3ZXV A;  1RFA A;  2L7R A;  4FAD A;  2WGS A;  4A3O A;  5D2M B;  3RCZ A;  1SSN A;  3BY4 B;  3I9V 1;  2WXP A;  3W5V B;  4L1B A;  2KK8 A;  2K6D B;  3VH4 B;  4YTP B;  3PS6 A;  2RDH A;  1WJ4 A;  3P1M A;  2WXQ A;  1RAX A;  4DBG A;  3Q6B A;  3DBH I;  4HJG E;  1CJE A;  2FCN A;  1E7V A;  1Y8R C;  4W9E A;  2OOB B;  3RFZ B;  2N7D A;  4MH0 E;  2KQ7 A;  2M19 A;  1JAL A;  3CSF A;  3PZ7 A;  2KZR A;  1BUI C;  1WRD B;  5T8I A;  3EUB 2;  1ZDX A;  3Q3M C;  4O1N A;  1J0G A;  1V2Y A;  1FPY A;  3PLV A;  4GLS C;  2K3U A;  3T3O A;  2KC2 A;  3GS2 A;  2NMQ A;  4IW0 A;  5D94 A;  2K39 A;  2L83 A;  1M4V A;  3MTN B;  3ECI A;  3PSE B;  4TQ1 A;  1L6U A;  4CYE A;  1L0Y B;  2G4S A;  3FAH A;  2I1K A;  4L23 A;  2WXL A;  4WAA A;  3TJP A;  3FC4 A;  4IOI E;  3TEW A;  1WGY A;  2N9X A;  5DPS A;  2N9E B;  3KLS X;  4BOZ B;  3AI5 A;  4RFB A;  1LFD A;  2X8X X;  2L3Z A;  2YLM A;  1T6B X;  4W9J A;  4E74 A;  4WWO A;  3Q8C A;  3B08 A;  4LNN A;  2G45 B;  2KYW A;  3PHX B;  1HTQ A;  2V4L A;  2CJO A;  2FAZ A;  3U7D A;  1FFV A;  4B0M A;  4IWQ A;  4KZC A;  4G3X B;  1UBQ A;  1OTR B;  1RFK A;  2IZV B;  3SR6 A;  4HCN B;  1WJN A;  3V05 A;  3VUW A;  2KTR B;  1B9R A;  3HK0 A;  3RNA C;  4WJO A;  2NPT B;  2AYO B;  4WQO B;  2PLP A;  3AB5 A;  2JT4 B;  3APC A;  1GB4 A;  3RPF C;  3KUC B;  2HJ1 A;  3SD5 A;  4S0R A;  4YT0 B;  2IDY A;  2AQ2 B;  2AL3 A;  2KAJ A;  3EA6 A;  1YN3 A;  2QMT A;  2RSU A;  1I4G A;  2A5U A;  3APF A;  4TKN A;  1WXV A;  2JXT A;  1LO5 D;  1XT9 B;  3MJ5 A;  4C80 A;  5LXI B;  4HLE A;  4AJW A;  2C9W B;  2K8B A;  3OJ3 A;  3MFG A;  1WX7 A;  4C7Y A;  2ZW1 A;  1GC6 A;  2W3S A;  4KV2 A;  3LXF A;  2XK5 B;  4HRO A;  1WE7 A;  2DEN B;  3ZTD A;  5CHF A;  4A3P A;  1UWX A;  4URK A;  2HTM E;  1KLG D;  4W9H A;  1WGH A;  1E8Y A;  1UEL A;  3DVN U;  4WUR A;  3TCA A;  2HD5 B;  1HZ5 A;  1R7S A;  1V97 A;  4DWF A;  3KUZ A;  4PS3 A;  4RGN A;  3PRZ A;  2LUE A;  2DYM A;  3ZNH B;  3CMM B;  3VHT C;  4DQO C;  1VLB A;  3ZQ4 A;  1R4M B;  3WIM A;  2L00 B;  1SE2 A;  2Z0D B;  3ONS A;  2BQQ A;  4ZRI A;  3N1Z C;  2MCN B;  3U2S C;  4BKG A;  3W1Y A;  5J2R A;  2KAN A;  2PE6 B;  2K8H A;  4ZRJ A;  2W82 A;  4FJV B;  4W9K A;  3AE5 B;  3PRM B;  1JWU D;  4IDI A;  3DVG X;  3NVY A;  5CTR C;  1YIW A;  5G55 A;  1NEK B;  2IY0 B;  1WYW B;  1UF0 A;  3DBH B;  5LXH A;  4BKS D;  1L4D B;  2LGD A;  1YX6 B;  3NS1 A;  3PO0 A;  1EM7 A;  4JWS C;  4NJ7 A;  1N5W A;  1MG8 A;  1FEH A;  3WAM A;  2IYD B;  3AEB B;  4GN1 A;  4ANU A;  1A5R A;  2IO2 B;  1C3T A;  2KLC A;  4MH8 A;  1KJT A;  2YEP B;  4FHK A;  2LGI A;  2LHE A;  3ML8 A;  3BZD B;  2LVQ A;  3PRP B;  3DPD A;  4YTN B;  3ZW3 A;  5G5H A;  3KWL A;  1E8X A;  4LTU A;  1P7E A;  1DOI A;  5IO9 A;  1ET6 A;  4ITK A;  1WIA A;  1UBI A;  3JVZ X;  3NUH B;  5DPR A;  3HHM A;  2W9N A;  2DNF A;  5D3I B;  4AJY B;  3RNG C;  3SU8 X;  3O65 B;  5E6N A;  3VRB B;  1FCC C;  3VH3 B;  3QX1 A;  4ZRK A;  1MI0 A;  4ZHO A;  4A6Q A;  4I6N B;  3KQ4 A;  2C7M B;  2WXJ A;  3E56 A;  4DXA B;  4YSX B;  3UF8 A;  2O6V D;  4M8M A;  4JGH B;  4RF1 A;  2LJ5 A;  1UUP A;  2K6Q A;  2MH7 A;  2MEK A;  5BYR A;  3VDZ A;  4MM3 A;  1D4B A;  2JF5 A;  1N61 A;  1QF6 A;  4KZ0 A;  3P63 A;  1CZP A;  5AZF A;  1I4R A;  1S1Q B;  2MBQ A;  3ZTC A;  1GC7 A;  2KDE B;  2UYZ B;  3IG3 A;  4M01 A;  3DDC B;  2ZNV C;  3QJZ A;  5AUK A;  4IC7 B;  1YN4 A;  4GMV A;  2V0G A;  3IHP C;  2JVC A;  2KWV B;  1WY8 A;  2BS4 B;  2GBK A;  1PUT A;  1WYG A;  2D3A A;  3V60 A;  2GLS A;  5MPO A;  3RNE C;  4G0N B;  4E71 A;  1Q5W B;  1FCL A;  2ZW0 A;  3ZXR A;  1ZP0 B;  3H1U A;  1FMA D;  3FIL A;  4FJY A;  4HKQ A;  3NVZ A;  3SFD B;  1WM3 A;  1XD3 B;  5AZH A;  1YN5 A;  2IY1 B;  2KKC A;  4HVB A;  1EU3 A;  4LDT B;  1TS5 A;  5DPW A;  4ZYN A;  1D5X C;  1XEE A;  4MAC A;  2BYT A;  1EWY C;  3OAW A;  3L10 B;  3AE2 B;  4HPM B;  4ACF A;  4DHJ D;  4W9F A;  4A55 A;  2AQ1 B;  1EUV B;  4RGT A;  2INN E;  3C19 A;  4KIK A;  2LMC A;  2CR5 A;  3A9J B;  3V62 A;  3EEC A;  2CJN A;  1TKE A;  3PGE A;  3RZW C;  3GP7 A;  1V49 A;  1C77 A;  3QAQ A;  2VH2 A;  3AN1 A;  5LNK 1;  4BBN F;  4II3 B;  1T0S C;  3ZDT A;  1ZW7 A;  2JZ3 B;  2N9K A;  1T0R C;  4F1S A;  4NAM A;  4KX6 B;  2O2V A;  4HCP B;  1JRP A;  4XWT A;  2LXA A;  4XZ4 A;  1PGA A;  2LRU A;  2I2Y A;  1FRD A;  1SEB D;  3J9C A;  4LCD E;  3VUX A;  1C4A A;  3H8H A;  3ABV B;  2Y5B B;  1Y56 A;  4MJS A;  4W9C A;  1K8R B;  4DK5 A;  4AQ7 A;  1GG3 A;  1OQY A;  3RNC C;  1ENF A;  3BK2 A;  2W55 A;  3JYU A;  3QCA A;  4JL9 A;  5BYQ A;  4BZA A;  1TYG B;  2DZK A;  3P4S B;  2JSV X;  4OZA A;  4HDQ A;  2KFK A;  1T5X D;  3EHV A;  2BW2 A;  1EU4 A;  1VZ7 A;  5G2N A;  2IGD A;  1TS2 A;  3DBL I;  4IG7 B;  3VQI A;  2K1F A;  1D5Z C;  4RGO S;  3RD2 A;  3ZUN A;  2GMI C;  3P4P B;  3JSV B;  4ICU A;  4QAY A;  1GAQ B;  4XX5 A;  4HWI B;  3U7Z A;  2JUO A;  1XO3 A;  3W1S A;  4BKT A;  4ANW A;  3L16 A;  2ZEQ A;  3LJ3 A;  4WWN A;  1TKG A;  2M1M A;  2JPH A;  1XXG A;  1I4X A;  4US8 A;  3ZDM C;  4IWO A;  2WXH A;  3R8B A;  3N9Y C;  3KYC D;  1MHX A;  2DX5 B;  4XDD A;  1TJE A;  1WE6 A;  4GXB A;  3UQA A;  2K22 A;  3U8Z A;  2WXM A;  4K81 A;  1KLV A;  1A70 A;  3A9K B;  4X57 B;  1F9J A;  1NYQ A;  2KDF B;  5E6P A;  2J4X A;  3C8Y A;  4LNF A;  1IBX A;  2DZM A;  4DHZ B;  4RGM A;  4II2 B;  2MBO A;  4DHZ E;  3BVZ A;  1FRR A;  2GBM A;  2QDF A;  5EDS A;  2AEH A;  4D2K A;  3L54 A;  3I57 A;  2MSE D;  3NHE B;  3DVN V;  4G11 A;  3GE8 C;  3L08 A;  5DPT A;  4EZL A;  2J0M A;  1FNV A;  4B95 A;  2UU7 A;  2DZI A;  3MC9 A;  1PGX A;  4ICV A;  3NG0 A;  3ZGZ A;  1ZPS A;  1IGD A;  1E0Z A;  1XQQ A;  3IVF A;  3Q8E A;  1TT5 B;  1C78 A;  2INP E;  2QSD A;  2VH1 A;  3DHH C;  3BVM A;  3M95 A;  2RR9 A;  2FBW B;  1V8C A;  2JU6 X;  1HE8 A;  3KYD D;  3ZRF A;  5L83 A;  4TSS A;  1N5X A;  3GOE A;  4GDK A;  1UD7 A;  1UZX B;  2PEA A;  4ZOH C;  2ZPN A;  1L2N A;  2LWP A;  1BXT A;  4PS7 A;  3BK1 A;  4EZK A;  4K3B A;  1SIF A;  3UQB A;  2BKF A;  3QA8 A;  4PS8 A;  2MP2 B;  4TQ0 A;  4I6P A;  2N7E A;  2N9L A;  2NCN A;  3Q14 C;  3X0W A;  4AWJ A;  1J7A A;  2BBC A;  2WDV B;  5EE0 A;  1WFY A;  2WS3 B;  4TMA B;  2R2O A;  4GIV A;  1YNT E;  2D3B A;  2DZJ A;  3UIN B;  2L1A A;  3AEF B;  3M63 B;  2V3N A;  4M00 A;  1I4Q A;  4MM3 B;  1ROE A;  3VTU A;  1ET9 A;  4NY0 A;  4RM8 A;  5KHQ A;  2GRI A;  2BYF A;  1UGJ A;  4XC2 A;  3L17 A;  2D5G A;  2KJR A;  3GZN I;  3TUO A;  1E10 A;  3CST A;  3H6N A;  4EUT A;  1KFY B;  2WDQ B;  2N4F A;  2DHZ A;  1MPE A;  2ZCB A;  2RMM A;  2KN5 A;  2JXX A;  3RNB C;  5JZE B;  1V1P A;  1JWS D;  1V5O A;  4ANX A;  1T0Y A;  2N9P C;  3DBL B;  3BYT B;  4TV3 A;  4ASW C;  1WXQ A;  2NS5 A;  2GOW A;  4KGS A;  3H7P B;  1IP9 A;  4ARC A;  3AE6 B;  3B2G A;  4HJK A;  1YJI A;  4WWM A;  3NZU A;  3R2I A;  2KQ4 X;  4RNA A;  1GJZ A;  5BMH A;  2LGY A;  2DAJ A;  1D6E C;  3FIL B;  2WXK A;  2KOX A;  3Q3J A;  1WH3 A;  2UWQ A;  4WQM A;  3ZJT A;  2OJR A;  1VZ8 A;  4LNO A;  1VR9 A;  5E6J A;  5D7G A;  4KSK C;  4YTM B;  2WQY B;  2A4Z A;  2JX5 A;  4DDI D;  4PYZ A;  1WX9 A;  4IM3 A;  3IAM 1;  3MHS D;  4M0W A;  1E90 A;  4LJO B;  1F77 A;  2CHX A;  1QKZ A;  4GDL B;  1ZE3 D;  2IO1 B;  2NTS A;  2PE9 A;  3UIO B;  2BB6 A;  2KWD A;  2JYT A;  2ZCC A;  3U52 E;  2W54 A;  3A1Q A;  3Q2A C;  3PV1 A;  3WAP A;  2MHJ A;  2Q5W D;  2V9H A;  3NVV A;  1PGB A;  3KUD B;  4US9 A;  1MVK A;  2QIL A;  2L76 A;  3AUL A;  5AUI A;  2GBN A;  2JRH A;  1G6J A;  2CU3 A;  1MHH E;  4PYU A;  4JIO U;  1D5M C;  3B0A A;  1ZDV A;  1MFW A;  3NS8 A;  2KHW B;  2LVP A;  4GSW A;  2NBW B;  3ZNG C;  1OQQ A;  2J0K A;  3X23 A;  4LLG M;  1V80 A;  1ZOY B;  1WMH A;  2CKH B;  2B76 B;  2D3C A;  3AED B;  3PHW B;  3AXC A;  1XLO A;  3QC8 B;  3UIP B;  5G5G A;  5IAA C;  2WWZ A;  2PPH A;  1AWD A;  2IND C;  2QHO A;  3TIX A;  4F7Z A;  2D11 A;  2MJ3 A;  3QAR A;  1PQS A;  4MEL A;  2KWU B;  4NJ6 A;  1J7C A;  2JY6 A;  2KXJ A;  5CHV C;  2NBU A;  3V6E B;  1CMX B;  4K3C A;  5HG2 A;  4K7U A;  4NAW B;  3AEA B;  2LVO A;  3RT3 B;  4FUL A;  4WAF A;  1ZGU B;  3PZD A;  2KVZ A;  1JWB D;  1RM6 C;  5C1Z A;  2I38 A;  3IFW B;  1OFF A;  1OEY A;  4HEA 1;  3UI3 A;  2Y5P A;  1KLU D;  3KW5 B;  3ZLZ A;  2BWF A;  2MJD A;  3V6C B;  2QC8 A;  3CWI A;  4K7W A;  4XGA B;  2EEL A;  3HVD A;  1E8Z A;  3ZJU A;  3GB1 A;  3LB8 C;  4BKS A;  2LD9 A;  1V6E A;  2HE7 A;  3A4S C;  3APD A;  4F8C B;  3H7S A;  2DBY A;  1L0V B;  2N1W A;  3A4R A;  4M02 A;  1GPX A;  2JRI B;  2INC C;  3Q8B A;  4FN2 A;  3AEE B;  3RYT A;  1E6E B;  1QOA A;  1L6V A;  4BFR A;  1XLN A;  2Z8L A;  1AYF A;  3VRA B;  1JCK B;  2R61 A;  2X38 A;  2K9X A;  4JX1 C;  4E3C A;  2WXF A;  1K53 A;  3V61 A;  2H88 B;  5AZG A;  3P4R B;  1KH0 A;  1T0Q C;  1TKY A;  4YSY B;  1NI2 A;  1LGR A;  4B9K A;  1OQR A;  2BS2 B;  2ZJD A;  3IBE A;  2DLB A;  2PTL A;  2NR2 A;  3CF6 E;  4KSL C;  4LJP B;  1IUE A;  2YVC A;  2L32 A;  2BPS A;  1SGH A;  3VR9 B;  3RUL A;  5D3D A;  2FCQ A;  3DHI C;  2WU5 B;  1JWA D;  1UNS A;  1AAR A;  2KTR A;  2XEW A;  4MDK E;  4I6L B;  1DGJ A;  3ZRC A;  2NPT A;  1HXY D;  4NZL B;  4OHJ A;  1YD8 U;  3W9C B;  2O6V A;  1P9D U;  3R7R A;  1V86 A;  1SJE D;  3AE4 B;  2Y5C A;  2IGG A;  5IN7 A;  1WZ0 A;  2K8C A;  1YMH E;  2QCZ A;  3DBR I;  4AUQ C;  2LJI A;  3MC0 B;  1HEZ E;  2DAF A;  1P3Q U;  4A20 A;  4NQK E;  3URY A;  1I35 A;  5GMV A;  4DXG A;  2V4I B;  4G50 A;  3TEX A;  2KDI A;  3M3J A;  3N20 C;  4GDK B;  1TTN A;  2XK5 A;  2PKO A;  4REZ A;  1YJJ A;  4ZRQ A;  2L0F A;  2QEJ C;  1WXM A;  2KDM A;  1XCQ L;  1BML C;  1WGR A;  1F1H A;  4OVU A;  2E3T A;  2GBJ A;  5EE1 A;  2J7Q B;  4N58 A;  4FXC A;  1WM2 A;  2WXN A;  3AEG B;  2BF8 B;  2WYQ A;  2FID A;  3Q3O C;  2BT6 A;  3TSS A;  5D6J B;  3ZYY X;  4HPL B;  3AMZ A;  4JLC A;  1ZKH A;  1E7U A;  1H8C A;  4NPN A;  4ANV A;  1NI3 A;  3JW0 X;  3AM9 A;  4OW0 A;  3EC8 A;  1IPG A;  2LGX A;  2FIF A;  4UDU C;  3K9O B;  4OVZ A;  3N30 A;  2K5P A;  4OZB A;  1C76 A;  4B0E A;  2FCS A;  2M17 A;  1WWT A;  1AN8 A;  1E9M A;  2DWQ A;  2M0X A;  2FE8 A;  4C4V A;  1FXI A;  1NYR A;  2M56 B;  4K7S A;  2BWE S;  2KN4 A;  4R3D A;  2D10 A;  4WIP A;  5IOI A;  3TEZ A;  3A33 B;  4P1C C;  1I4H A;  2G4D B;  3FKY A;  2Y3A A;  4USA A;  3P42 A;  3VTV A;  3ZVV A;  4W9I A;  3HRD D;  1FFU A;  1KOT A;  1V1P B;  1M94 A;  1EF5 A;  2KJH B;  3VR8 B;  4JE3 B;  1IGC A;  2N0S B;  4MT5 A;  1VDV A;  2H89 B;  4KKJ A;  1LQB A;  1GOZ A;  3L0W B;  2MLB A;  1C9F A;  2J42 A;  3NJT A;  3U4E G;  3DVG Y;  2BVC A;  4ZYS A;  3MP9 A;  4FBJ B;  2EKE C;  2WXI A;  2DYO A;  4J3O D;  3WAN A;  3L4P A;  3H9D A;  1QQR A;  1Z5S B;  3DCG A;  3DOW A;  1RRB A;  4AP4 C;  2BKR B;  1K51 A;  3SHQ A;  1I42 A;  3ZKJ C;  1NBF C;  2KMA A;  2RDG A;  4L2Y A;  1CQV A;  4OVV A;  2V3S A;  2WXR A;  1V5T A;  4FLH A;  3MC8 A;  4MSM B;  2MBB B;  1T3Q A;  1TY2 A;  3A1Q B;  3VAW A;  1PYW D;  1MJD A;  2KWC A;  4Q2J A;  4KDI C;  5BO4 B;  4HK2 A;  4N59 A;  1FIQ A;  2I1J A;  2E6X A;  1JW9 D;  1KRH A;  2M8S A;  1WJU A;  3ZNZ B;  1ESF A;  2WP9 B;  5H92 C;  4LDT D;  3AU5 A;  1R4M I;  1QLB B;  4AS1 A;  3N1Y C;  3HVZ A;  1JQ4 A;  1P7F A;  4ZHP A;  3HM6 X;  1WGG A;  5LLI A;  3OLM D;  2LZ6 A; 
#chains in the Genus database with same CATH homology
 3E56 A;  3FIL B;  2WXK A;  1ACC A;  4PT5 A;  4YSX B;  1EWC A;  1K50 A;  1J7B A;  4WQM A;  3ZJT A;  4RF1 A;  1VZ8 A;  3Q8A A;  1UUP A;  1Q10 A;  1VR9 A;  2OHF A;  5E6J A;  2MH7 A;  5D7G A;  3OWE B;  2W3R A;  2MEK A;  1F2R I;  5BYR A;  4YTM B;  2WQY B;  4KGR A;  5C3J B;  2JX5 A;  3E9S A;  1C4P A;  1D4B A;  2IGH A;  3IAM 1;  4M0W A;  1GB1 A;  2LEK A;  1N61 A;  3BII D;  2AQ3 B;  1QF6 A;  1F77 A;  2BTE A;  3P63 A;  1QKZ A;  4GDL B;  2AX5 A;  1CZP A;  1ZE3 D;  2NTS A;  2JWU A;  3EGR A;  1E7P B;  1N60 A;  1I4R A;  2BB6 A;  4KGT A;  2KWD A;  2ON8 A;  5GXG B;  2JYT A;  3U52 E;  2KMM A;  1C79 A;  2W54 A;  2Q5W D;  2LHD A;  1SJH D;  3IT4 B;  1HA5 A;  1PDX A;  1AW7 A;  3NVV A;  1PGB A;  2FUG 1;  4US9 A;  1MVK A;  1ZXH A;  1NVI D;  4XWW A;  1DOX A;  2QIL A;  3B9J A;  1F2R C;  5AUI A;  1QT9 A;  3BWU D;  2CU3 A;  1MHH E;  5AUK A;  1D5M C;  5JXV A;  2JYE A;  1C4C A;  1ZDV A;  2SEB D;  1YN4 A;  1SE3 A;  2V0G A;  4C56 C;  4NJC A;  1OQQ A;  2BS4 B;  2K0P A;  3IAS 1;  4LLG M;  1PUT A;  3DWG C;  1ZOY B;  2ICI A;  4H2A A;  3R2T A;  1WYG A;  3NZ3 A;  1FO4 A;  2B76 B;  1XLQ A;  3AED B;  1XLP A;  3DWM A;  4ARI A;  4YWG G;  1XLO A;  4ZRP A;  5MPO A;  1KTK A;  5G5G A;  1FNW A;  1AWD A;  2PVO D;  1FCL A;  2NTT A;  2ZW0 A;  2MJ3 A;  1ZP0 B;  4DXF A;  1FMA D;  3FIL A;  4HKQ A;  4EE2 A;  3NVZ A;  1J7C A;  3SFD B;  1QOF A;  2OED A;  4YXD B;  1L0X B;  2WXO A;  1YN5 A;  1HQR D;  1JML A;  1HZ6 A;  5EE3 A;  1YQ4 B;  5HG2 A;  1XCT L;  4NAW B;  4WH4 A;  1EU3 A;  3HUI A;  3AEA B;  2XNA C;  2IJ0 A;  1DYQ A;  1TS5 A;  2TSS A;  2EKI A;  4WAF A;  1D5X C;  3AE8 B;  1XEE A;  2G1E A;  4IKG A;  4MAC A;  2BYT A;  1EWY C;  4A8X C;  1JWB D;  1KF6 B;  3AE2 B;  1SE4 A;  4KKI A;  1RM6 C;  1V1O A;  4RCO A;  2I38 A;  1OFF A;  2M0A A;  2AQ1 B;  4A55 A;  1I7H A;  5BMI A;  1F0Z A;  1SXT A;  3P4Q B;  2J52 A;  2V3P A;  4RGT A;  4HEA 1;  2PIA A;  2VZK B;  3UI3 A;  2Y5P A;  1KLU D;  2INN E;  2MJD A;  2LMC A;  5C2T B;  2QJL A;  1FD6 A;  3CWI A;  1YQ3 B;  2CJN A;  3NVW A;  2PW9 A;  4A90 A;  2EEL A;  3AH7 A;  3HVD A;  1TKE A;  3ZJU A;  5H8Y E;  5I4D A;  3GB1 A;  3LB8 C;  3GP7 A;  5TSS A;  1C77 A;  3AN1 A;  2BB5 A;  3CIR B;  2DBY A;  1L0V B;  3BYY B;  2VZK D;  5LNK 1;  1GPX A;  1QIL A;  2YEP F;  3Q8B A;  1PFD A;  1SSN A;  3AEE B;  1L4Z B;  1E6E B;  2N9K A;  1QOA A;  1L6V A;  3I9V 1;  1XLN A;  2WXP A;  4NAM A;  2Z8L A;  1AYF A;  4KX6 B;  3W5V B;  2ACZ B;  3VRA B;  4L1B A;  1JCK B;  4N6E B;  4YTP B;  1JRP A;  2R61 A;  4XWT A;  2RDH A;  3P1M A;  2X38 A;  2K9X A;  1PGA A;  2WXQ A;  2J53 A;  2WXF A;  1TS3 A;  1K53 A;  3NRZ A;  4JX1 C;  4HJG E;  1CJE A;  2WLB A;  2I2Y A;  2H88 B;  1FRD A;  1SEB D;  3P4R B;  3J9C A;  1KH0 A;  2HDE A;  3RFZ B;  1C4A A;  2IPK D;  3AE9 B;  3H8H A;  3ABV B;  1TKY A;  4YSY B;  1Y56 A;  5FK9 C;  2M19 A;  3Q8F A;  1JAL A;  4LK0 M;  1RWS A;  3PZ7 A;  1OQR A;  2BS2 B;  2DLB A;  4AQ7 A;  1BUI C;  5HI1 A;  5T8I A;  3EUB 2;  2PTL A;  3KWV A;  1ZDX A;  1VZ6 A;  4O1N A;  1IUE A;  1ENF A;  2L32 A;  2W55 A;  3BK2 A;  1FNU A;  1TZO A;  1NEN B;  3VR9 B;  2WNM A;  1XF5 L;  5D3D A;  4GLS C;  2K3U A;  3T3O A;  2WDR B;  1JWM D;  3GS2 A;  4P16 A;  5BYQ A;  2NMQ A;  1TYG B;  2WU5 B;  3P4S B;  4HRS A;  1JWA D;  2JSV X;  4OZA A;  4OZC A;  1UNS A;  1T5X D;  2BW2 A;  2L83 A;  2XN9 C;  3Q69 A;  1M4V A;  1EU4 A;  1DGJ A;  1VZ7 A;  4XE0 A;  2IGD A;  4C7Z A;  4NZL B;  1HXY D;  1TS2 A;  3ETR A;  4OHJ A;  4TQ1 A;  5HFY A;  1L6U A;  3VQI A;  1L0Y B;  3FAH A;  4L23 A;  3W9C B;  2WXL A;  1D5Z C;  1SJE D;  4RGO S;  3AE7 B;  3AE4 B;  3FC4 A;  3O13 A;  4IOI E;  2Y5C A;  2IGG A;  3TEW A;  1SBB B;  1CK1 A;  1SB3 C;  1YMH E;  3P4P B;  3KLS X;  1GAQ B;  2LJI A;  4RFB A;  3U7Z A;  2WU2 B;  1XO3 A;  3MC0 B;  1STE A;  1HEZ E;  3W1S A;  1T6B X;  1TKG A;  3Q8C A;  1ZUD 2;  4CQN A;  3URY A;  1XXG A;  1I4X A;  1N63 A;  2V4I B;  1B1Z A;  2CJO A;  4DXG A;  4US8 A;  3WCQ A;  3TEX A;  1FFV A;  3ZJV A;  2WXH A;  1I4P A;  2LFI A;  3N9Y C;  3LYY A;  4GDK B;  3R8B A;  4B0M A;  1N62 A;  1MHX A;  2PKO A;  4XDD A;  1TJE A;  4REZ A;  1YJJ A;  3PZ8 A;  4ZRQ A;  5HHD G;  2K22 A;  2QEJ C;  1RFK A;  3SR6 A;  3V05 A;  2KDM A;  2WXM A;  1A70 A;  3AE3 B;  3BVG A;  1XCQ L;  1QOG A;  1BML C;  4YSZ B;  1B9R A;  1NYQ A;  2E3T A;  3IXS A;  2J4X A;  2N7J A;  5EE1 A;  4N58 A;  3C8Y A;  4FXC A;  1IBX A;  2PLP A;  3AB5 A;  4RGM A;  2WXN A;  1GB4 A;  3AEG B;  3RPF C;  4RH6 A;  3BVZ A;  3AV8 A;  1FRR A;  2BT6 A;  4YT0 B;  2IDY A;  2AQ2 B;  4D2K A;  3I57 A;  1K52 A;  3TSS A;  2KAJ A;  3EA6 A;  3ZYY X;  1YN3 A;  2QMT A;  3AMZ A;  1I4G A;  1FM0 D;  2JXT A;  1LO5 D;  1NI3 A;  3MJ5 A;  1FNV A;  3AM9 A;  3AEC B;  4C80 A;  4OW0 A;  1PGX A;  4UDU C;  3MFG A;  4OVZ A;  4C7Y A;  3ZGZ A;  2GI9 A;  1ZPS A;  2ZW1 A;  2W3S A;  1IGD A;  1E0Z A;  2K5P A;  2QIE B;  3Q8E A;  4OZB A;  3LXF A;  1C76 A;  4HRO A;  4B0E A;  1C78 A;  1WWT A;  1UWX A;  2INP E;  2QSD A;  1AN8 A;  1E9M A;  2DWQ A;  2HTM E;  5FKA C;  3W2D A;  2PVG C;  3BVM A;  2FE8 A;  5BYS A;  1KLG D;  3SEB A;  1TS4 A;  3W5U B;  2FBW B;  1FXI A;  1NYR A;  3MHZ A;  1V8C A;  2M56 B;  2JU6 X;  4JPS A;  4WUR A;  2KN4 A;  4R3D A;  4TSS A;  1N5X A;  1WGK A;  4WIP A;  1IBX B;  3TEZ A;  1HZ5 A;  1R7S A;  1I4H A;  1V97 A;  4ZOH C;  2Y3A A;  4USA A;  3P42 A;  4RGN A;  1BXT A;  4XDC A;  3HRD D;  1FFU A;  2DYM A;  2JZP A;  1V1P B;  4DQO C;  1VLB A;  3BK1 A;  3VR8 B;  3ZQ4 A;  4JE3 B;  1IGC A;  4JWU C;  2N0S B;  1SIJ A;  4MT5 A;  1SE2 A;  1VDV A;  2WXG A;  2H89 B;  3T3N A;  4KKJ A;  2BS3 B;  2MJE A;  1GOZ A;  5FR3 A;  3U2S C;  1C9F A;  2J42 A;  3U4E G;  4ZYS A;  4HKZ E;  3MP9 A;  2LUM A;  2W82 A;  1TY0 A;  2WXI A;  2DYO A;  4J3O D;  1ZXI A;  4TQ0 A;  1L5P A;  2N9L A;  2KAC A;  3L4P A;  4A9A A;  3AE5 B;  1JWU D;  4IDI A;  3NVY A;  2L52 A;  1QQR A;  1VJK A;  1J7A A;  2BBC A;  2WDV B;  1SF0 A;  1FXA A;  5EE9 A;  5EE0 A;  1NEK B;  2WS3 B;  4TMA B;  1K51 A;  1YNT E;  1DOY A;  2ONQ A;  2L1A A;  3AEF B;  3SFE B;  1L4D B;  4P6V F;  3NS1 A;  2V3N A;  1I4Q A;  3PO0 A;  4MM3 B;  1EM7 A;  3V3X A;  4JWS C;  1ROE A;  1N5W A;  2RDG A;  1ET9 A;  2G9H D;  4L2Y A;  2GRI A;  1FEH A;  1CQV A;  2WXR A;  3AEB B;  1UGJ A;  2D5G A;  4MH8 A;  3TUO A;  2YEP B;  1E10 A;  2LGI A;  2LHE A;  1T3Q A;  3AE1 B;  1KFY B;  1TY2 A;  2WDQ B;  1PYW D;  3TEY A;  1JRO A;  3BZD B;  1MPE A;  4YTN B;  3IT6 B;  5G5H A;  3KWL A;  2RMM A;  2JQR B;  4Q2J A;  4LTU A;  1P7E A;  1DOI A;  1ET6 A;  4ITK A;  1V1P A;  4N59 A;  1JWS D;  2PMV A;  3NUH B;  1FIQ A;  1RYJ A;  2E6X A;  1JW9 D;  1KRH A;  2SAK A;  3B2F A;  5D3I B;  1ESF A;  3BYT B;  2WP9 B;  5H92 C;  3VRB B;  1FCC C;  2GB1 A;  1WRI A;  1WXQ A;  1QLB B;  4KGS A;  4AS1 A;  1MI0 A;  4ZHO A;  4ARC A;  3HVZ A;  3AE6 B;  2RPV A;  1JQ4 A;  1VRA B;  3B2G A;  4RF0 A;  4A6Q A;  1P7F A;  4ZHP A;  1YJI A;  4WWM A;  5BMG A;  1QOB A;  1UWM A;  2KQ4 X;  3KQ4 A;  3R2I A;  4RNA A;  5BMH A;  1WSP A;  1D6E C;  2WXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...