1P7FA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7fA00
2J53A 5HHDG 1ZXHA 2I2YA 2IGHA 1K51A 1XCQL 1GB1A 2N9LA 1K52A 5BMGA 1Q10A 2JU6X 5HI1A 3V3XA 3MP9A 2LUMA 2JWUA 1K50A 3GB1A 2LGIA 4OZAA 4MACA 2ZW0A 2KN4A 3FILA 1FCLA 1K53A 1XF5L 2LHEA 2IGDA 1KH0A 2KWDA 4GLSC 4HKZE 2ON8A 5JXVA 1FD6A 4KGSA 2RPVA 1IBXB 4IKGA 1YMHE 1PGXA 1MHHE 1GB4A 4WH4A 2KACA 2J52A 2OEDA 2KDMA 1MVKA 2NMQA 1QKZA 1PGAA 4KGTA 1PGBA 2RMMA 3UI3A 5BMHA 2JZPA 1FCCC 1MPEA 5HG2A 2JSVX 2GB1A 4OZBA 1JMLA 1C9FA 2K0PA 2ONQA 1P7EA 1XCTL 2KQ4X 2EELA 5BMIA 2N7JA 2GI9A 4KGRA 1UWXA 2QSDA 2PLPA 2I38A 2N9KA 1IGCA 2IGGA 3FILB 1MI0A 2QMTA 2PTLA 1IGDA 2PW9A 1HZ6A 2JXTA 4IOIE 1HZ5A 5HFYA 4HJGE 1D4BA 1IBXA 2LHDA 2ZW1A 1EM7A 1F2RI 1YNTE 1F2RC 1HEZE 1MHXA 1P7FA 4D2KA 4OZCA
chains in the Genus database with same CATH superfamily
3ZTDA 2L52A 1B9RA 3W1YA 4KSKC 4ZRJA 4KVGB 1WWTA 3Q3NC 5BYRA 2WXFA 5CTRC 4JE3B 2JVCA 4YWGG 3VHTC 1V86A 3RNBC 1LFDA 4FJZA 2VH1A 4I6PA 2MBEA 1V81A 1XT9B 4XZ4A 3KQ4A 4W9DA 5C2TB 2V1YA 2HJ1A 1X1MA 4WJOA 4IM3A 2LGIA 2DAFA 2IZVB 2YEPF 4M00A 2GBKA 2LI5A 2H89B 3N32A 2IGDA 4HEA1 4MELA 3SD5A 3NZUA 1G6JA 2M17A 1B1ZA 3H8HA 1GUAB 2MWSB 1IPGA 1FD6A 1ACCA 2LUEA 4TUUA 4I6LB 5EDSA 2MP2A 2ZVOA 2OEDA 2AWTA 3A9KB 2ZEQA 1Y56A 1L5PA 1YJIA 2EKEC 1WXAA 3IT6B 2GBJA 3EECA 3UF8A 2L1AA 1V2YA 1M4VA 1UGJA 2KJRA 2Q5WD 1R7SA 5L83A 4XDDA 3N1YC 1GPXA 3B2FA 4MH8A 2H88B 4YSYB 2BS2B 3L16A 2C5LC 3AEAB 1WGDA 2KMAA 3ZIMA 2PLPA 4EKUA 5KHQA 4CO7A 4B0EA 2FCMA 2M56B 2QC8A 2IO2B 1HZ6A 2OHFA 3Q69A 4DHZB 3QX1A 2XK5A 3OLMD 4DDGD 2BB6A 4LNNA 2WXHA 1HEZE 3E56A 3UIPB 3R3MA 2MH7A 4BKSD 1D3ZA 4W9GA 5HHDG 2MCNB 4A55A 2V3SA 1GJZA 1ET6A 2N9EB 1WR1A 1PYWD 5AUKA 2ZNVB 5BMGA 1YD8U 3RNFC 3P1MA 3CMMB 1WXSA 4BOSC 2JWUA 1P9DU 4NQLB 4DWFA 2NR2A 4ITKA 3N1ZC 2BB5A 3PZ7A 3R7QA 5BYQA 4HLEA 3QJZA 3WIMA 3KYCD 1KM7A 2FUHB 4KSLC 1STEA 2M19A 4FHKA 4MSQB 3ZW3A 1C4CA 1SGHA 2WU5B 1XQQA 1N61A 2RDHA 4FN2A 1E10A 1E8XA 2VH2A 2IY1B 3DWGC 5C1ZA 5EE3A 2PPHA 2VZKB 3W5UB 4DHJD 1V1PA 1WXQA 2RPQA 1V97A 4TSSA 1E7PB 5AUIA 4EOYA 2BKRB 4KGRA 4A20A 2L8JA 4RF0A 1WE7A 1GC6A 4R3DA 2ZCCA 3AULA 3LYYA 4RFBA 3ENEA 5D6JB 4FBJB 4ZDVA 1BXTA 1HZ5A 2YEPB 3RPFC 1D4BA 2KWUB 1IBXA 3PRZA 2JZ3B 4CHKA 2M0AA 5D7GA 2KKCA 2NBUA 4GDKB 2BBCA 5GMVA 1TKYA 4DHJB 2J53A 2X8XX 4ANUA 3IT4B 2IGHA 1NVID 1K51A 3HK0A 3T9LA 2ZZPB 1QOFA 5J18A 2WP9B 3IBEA 4IM0A 1WX9A 4M01A 1Q10A 3V05A 4W9FA 2BQQA 1FRDA 2IPKD 3PVLA 1VJKA 3EHVA 1VZ8A 1FXIA 3AEBB 1FCLA 3FKYA 2KWDA 3PGEA 1KOTA 2WDQB 1ENFA 4NQKE 2RR9A 2LRUA 2KAJA 3Q8AA 5I4DA 2RD0A 4L2YA 4KV2A 2QILA 4FA6A 2CJOA 3ZUNA 3Q14C 1VZ6A 2W55A 3GZNB 2NTSA 3EGRA 1YIWA 4RH6A 3VUWA 2ZCBA 3UI3A 2J7QB 2WXKA 4TQ0A 3WCQA 3TEZA 4PYUA 2LJIA 3PZDA 4C56C 2KANA 2WXIA 2JSVX 1L6UA 1FM0D 2AQ1B 3WA0A 2PVOD 4HDQA 1UELA 3M3JA 3MC8A 3NS8A 2JF5A 4YTNB 2R2QA 5LLIA 2JT4B 3EC8A 4HPMB 1YQBA 4LDTD 1M94A 3L17A 3DHHC 4P6VF 3ZQ4A 5DPRA 2BS4B 1V9JA 2KD0A 4K7UA 5BYSA 1I35A 4LNFA 1WGKA 4ZRQA 2N9PC 3N20C 1E9MA 2WXNA 1ZUD2 1WX7A 4LNKA 2DZKA 3DWMA 3APFA 3RT3B 3M62B 4LDTB 1RM6C 1K52A 1L6VA 5AZFA 3DBRB 4AP4C 3WAOA 3NOBA 2D3AA 3CSTA 2O2VB 3Q2AC 4HJKA 3EA6A 4US9A 3IFWB 4ANVA 4C00A 5D2MB 2DBYA 4TQ1A 1WJUA 5H92C 4HKZE 1OEYJ 5IKCM 2CU3A 1C78A 4GGQA 3V6CB 2NCNA 3AE4B 3RNGC 2KFKB 2CS4A 3ZDTA 1WGRA 4MGKE 1KLUD 4A8XC 4F8CB 2FCNA 3ZRCA 4P16A 4WWPA 2KC1A 5LXIB 1SE4A 4YT0B 1L0VB 2WYQA 5CX3A 3K9OB 4TV3A 2R2OA 1KTKA 1ZW7A 5G5HA 1NDDA 2KFJA 4RGNA 2FAZA 4UDUC 1J19A 4GDKA 2SAKA 2GBNA 4LCDE 2HE7A 2MHJA 2QSDA 4A6QA 4O1NA 2B3AA 1DGJA 5EE9A 2K8HA 5IN7A 4ACFA 2IJ0A 1Q5WB 1L0XB 2SEBD 3NZ3A 3U7DA 2LD9A 4JX1C 5C23A 1PUTA 3DBSA 1YN3A 1WR6E 5G55A 4B0MA 3H9DA 3N30A 4AOFA 1D5XC 4OZCA 1DYQA 1TS3A 1ZXIA 2UYZB 4FJYA 4OVVA 1UH6A 2EMTA 5LNK1 1Z2MA 4WURA 3RZFA 1KF6B 4I6NB 4WAAA 1NI2A 4MGZE 3RFZB 4ZYSA 1GC7A 3ZXVA 1L0YB 1FNUA 2MJ3A 4DK5A 4W9EA 4HDOA 3ZRFA 4PYZA 2N1VA 4AQ7A 3OWEB 2IO3B 1I4PA 3GS2A 1WFYA 3P42A 3PSEB 2L7RA 3I63C 3B08A 5D3DA 4RGMA 3W9CB 2ACZB 4BFRA 1ESFA 3HHMA 2CR5A 2V4IB 1T0QC 4BZAA 3MHSD 2DYOA 3AE3B 4WJQA 1SSNA 2C7HA 4WQOB 2V0GA 4YTPB 2WHIA 3W1SA 1KLGD 2XK5B 4IWOA 3S2AA 1C79A 3PTFC 2KACA 2NPTA 1FMAD 4RNAA 2BTEA 5DPWA 2ZNVC 4M02A 2K6DB 1XXGA 3ZXRA 3B0AA 3AEFB 2RMMA 2LWPA 3Q8FA 3B9JA 2N9XA 4M8NA 3SFEB 2MX2A 5JH5C 4GU2A 2L00B 3QARA 1J7BA 3IXSA 4GN1A 1C9FA 5J2RA 1P7EA 1EWCA 3NVWA 2EELA 1AW7A 3L0WB 3TL5A 1DOXA 2HDEA 2N7EA 4EZKA 2YVCA 2MJDA 2I38A 3ZNHB 2N7DA 1OGWA 3NZSA 1QOGA 2PTLA 1IGDA 1NEKB 3Q3JA 5JHAA 2JXTA 1JROA 3ZTCA 1HTOA 2LGSA 4HJGE 3QIJA 4AJWA 1MFWA 2V9HA 2KXJA 2DLBA 2Z59B 3EFUA 1CZPA 2DX5B 2KYWA 1WM2A 4KIKA 2NTTA 3MTNB 2BYEA 1SBBB 3TUOA 1JWBD 3ZYYX 1CJEA 2LGYA 1C76A 2G9HD 4W9HA 2N9LA 3I3TB 3KLSX 5JZEB 1JRPA 1J7AA 5H8YE 2BT6A 3JSVB 2MSED 2RGFA 4HPPA 4N6EB 4HKQA 3C19A 3HUIA 1FEHA 2K25A 2X38A 2O6VA 5IP4D 2IO1B 1V1PB 2ZW0A 2WLBA 4K3CA 2DWQA 1C4AA 2G4SA 2BPSA 3Q3MC 3DBLI 2AX5A 1ZPSA 3OAWA 1IBXB 2RSUA 1PGXA 1MHHE 2QEJC 4N58A 1UUPA 1FRRA 1TS2A 3E9SA 3VUXA 1T5XD 4PT5A 5BMHA 2I1KA 1I4XA 1LQBA 3OG5A 2KNBA 3DHIC 3ZDMC 2GB1A 1PQSA 1FXAA 3KUCB 1ROEA 1VLBA 2KTRB 3P63A 3HVDA 2C60A 2ONQA 4USAA 4XDCA 1P0RA 2JUOA 3NG0A 2N7JA 1PFDA 2CHZA 2KQSA 3AE5B 5FKAC 3MC0B 2KLGA 4IG7B 2YLMA 1GAQB 3UIOB 1LXDA 4LJOB 4WJPA 1YJJA 4PK1A 1BMLC 5IAAC 4K3BA 2FUG1 3GZNI 1C1YB 1ZE3D 2UU7A 4K81A 2J0KA 1ZP0B 3K9PB 1HTQA 1J8CA 2WXLA 3V61A 3J9CA 2WQYB 1JALA 1A70A 1T0RC 1UNSA 3LJ3A 1HQRD 3MFGA 3PRMB 4IM2A 4XX5A 2BWES 2I2YA 1I7HA 3UINB 2MLBA 5IO9A 2RDGA 4C7YA 3IG3A 3PRPB 4RGTA 3N1XC 3LXFA 4C4VB 3U30A 3FC4A 1HE8A 2KK8A 3NVVA 4WWMA 3WAMA 4MGIE 5BO4B 3DPDA 3ZJVA 2JZZA 4RF1A 4DQOC 1L4DB 2G4DB 5E6PA 1C4PA 1AARA 4KGSA 1Q0WB 4MH0E 2BYTA 2KQ7A 2MA9B 1XO3A 2NBWB 1WZ3A 2KDMA 1FIQA 4YTMB 1WM3A 3VVWB 3DBRI 1RYJA 4RGOS 4XWTA 2VZKD 3V6EB 2WXRA 3ZNZB 3UQBA 2KC2A 1FCCC 2KX3A 3OJ4B 3ZJUA 1WZ0A 4FLHA 4IWPA 2QJLA 3HVZA 4US8A 3BK1A 4XE0A 2KJHB 3ZNID 5BMIA 1XLPA 2KJ6A 3ETRA 3W5VB 4HXDA 5JHBA 1JWSD 4REZA 1F52A 3PLUA 1TYGB 3JSVA 2ZW1A 2WXQA 3QA8A 3BY4B 1TT5B 1AWDA 1ZDXA 2PE9A 3BVZA 4XGAB 4BBNF 2MW5A 3T3OA 2R61A 4HRSA 2GOWA 2BKFA 4GDLB 1WJ4A 1IYFA 4H2AA 3VTVA 2L83A 1QF6A 1VDVA 4ZYNA 5AEKB 5IA7A 4HROA 3L10B 2JRIB 2INCC 1JWUD 3V3XA 5KHOA 2XEWA 3GE8C 2IY0B 2FBWB 3AM9A 3SU8X 5C3JB 3DBLB 2N0SB 4FJVB 1K53A 2QHOA 5E6OA 1JQ4A 5JXVA 4K7WA 1SIFA 4OVZA 1DOYA 3P4QB 3OJ3A 3AXCA 4J6IA 2KTRA 5G2NA 3NRZA 2QCZA 1YMHE 3A1QA 1CQVA 2LMCA 1I42A 1RFAA 5TR5A 4M0WA 2HTME 4EUTA 2L0TA 3N9YC 3CWIA 3VRAB 1TY2A 1E8YA 2C7NB 1MPEA 1E6EB 5GXGB 2KZRA 3DQVA 2AYOB 1FXTB 2I1JA 3BYTB 4G0NB 3L08A 1EUVB 3PHXB 2BVCA 3BK2A 2C7MB 3R66C 4DXGA 2Y5CA 3L54A 3PS6A 1IP9A 3RD2A 3WALA 1MI0A 1UBIA 3NHEB 5EE0A 5HKHA 2K5PA 5G5GA 4C4VA 3HRDD 3Q8EA 5TSSA 3BWUD 2NPTB 2VRRB 1JWAD 5DPSA 1JWMD 2L32A 4JWSC 3B2GA 3PO0A 2W9NA 3ZO5B 3KUZA 4DDID 4BOZB 3ONSA 1OFFA 3KUDB 1XLQA 4ICUA 2Y3AA 3MP9A 2LUMA 2KVRA 1RAXA 4MJSA 1WGHA 3UGBB 2LGXA 1K50A 4LJPB 3A4RA 1WXVA 3AEDB 3SHQA 2ON8A 2W82A 2DHZA 1L4ZB 2LGDA 3I5JC 4S0RA 4ICVA 4MEMA 2O6VD 3A9JA 1P3QU 2M4NA 1NI3A 1QKZA 2W3RA 2WX1A 4KIKB 1QOBA 1H8CA 1RLFA 2JY6A 3AEGB 2MQJA 2BYVE 3WANA 4OW0A 3KVFB 3PLVA 2WDVB 3H6NA 4JLCA 5IOIA 1ISNA 1JMLA 1HXYD 3Q3OC 3DVNU 2ZPNA 3URYA 3DBHI 3O13A 2G45B 4GDLA 4LTUA 4FHJA 3APDA 2O6VB 1C77A 3BZDB 2N9KA 1V6EA 4HCNB 4ASWC 2LHDA 3AE7B 3VTUA 1EM7A 2Z8LA 1DOIA 1R4MB 4JL9A 1P98A 1Z5SB 3P2BA 4RCOA 3QQ8B 1LGRA 1V1OA 3M63B 4N9F4 2PMVA 4GSWA 3AE9B 5E6NA 2FIDA 1UBQA 2IYDB 1YN5A 4ARIA 2K6QA 3Q8BA 1J0GA 4MM3A 4NJCA 2JU6X 2KMCA 4W9CA 3KH0A 1XD3B 3R7RA 4KKIA 1SJHD 1BUIC 1S1QB 1WRDB 1RFKA 3WAPA 4AWJA 1EF1A 2INDC 1XF5L 2MEKA 1OQQA 4L23A 3ZGZA 1T0YA 3ZJTA 3AE2B 3AI5A 4N59A 2LRWA 4RM8A 2K8CA 4JGHB 2M1MA 2ZPYA 1TZOA 2HD5B 1UF0A 3H7PB 4MGYE 1GB4A 4GB9A 2Z0EB 4FULA 1OEYA 2KOXA 2ZJDA 2N1WA 3V62A 1N6ZA 4G3XB 1V5TA 2GMIC 3RMKC 2WXMA 2WDRB 2K39A 1U4AA 1E7UA 1WY8A 1SB3C 2XNAC 4GOCA 1QOAA 3RZWC 1WMHB 4OZBA 4NAWA 1FFVA 2K0PA 1WGGA 1YN4A 1YQ4B 1TY0A 1L2NA 2KTFA 3AB5A 2KDFB 1UGMA 3VH3B 4W9LA 4G11A 4G50A 3AV8A 4HVBA 2KVZA 4B6WA 2CHWA 2KDEB 1RRBA 1F2RI 4CQNA 1F2RC 4II2B 3BIID 3MJWA 1MHXA 3PV1A 1WJNA 2FCQA 2LVOA 3D32A 3VR8B 3RN9C 1Y8RC 1MG4A 3U7ZA 1WJ6A 4NY0A 1XCQL 4XWWA 5CHFA 3MHZA 4ZOHC 1UD7A 4WWNA 2WS3B 4F7ZA 4AS1A 4WJNA 4WWOA 1R4NI 4EZLA 2V3PA 4OZAA 2KX0A 4B9KA 4YXDB 2WX0A 4RMAA 1YX5B 2D07B 3BVGA 1MG8A 3TSSA 4LLGM 1WGYA 2IO0B 3DVGX 3L4PA 2PKOA 3TBLD 3AU5A 3X23A 4LK0M 3VH4B 3RI7C 2UWQA 1I4GA 2LJ5A 3DBHB 3AN1A 4BAXA 2JPHA 2JZPA 4IC7B 3DOWA 1NENB 5D94A 3ZNGC 2WGSA 4NPNA 2WXOA 2GI9A 2NBVB 4LNOA 3RULA 2DENB 1JRUA 3QHTA 1SE2A 2HJ8A 4IW0A 3U8ZA 2DZJA 3AU4A 3PT2B 4IDIA 4B95A 1E0ZA 1ZDVA 2Y5PA 5MPOA 1N5XA 1WXMA 3EUB2 3U52E 2PEAA 2DAJA 1D5MC 3ML9A 2AL3A 2D3BA 3A1QB 2E6XA 4Q2JA 5DCNA 2LXAA 1V49A 1TS5A 3DVGY 4RM9A 1ZXHA 3JW0X 4PS3A 2AL6A 4ZHOA 1UWMA 4M0WB 3PREA 2BWFA 2BYFA 3A33B 2N4FA 5EE1A 3C8YA 3QAQA 4FADA 1HA5A 1D5ZC 3NVYA 2J0MA 4S17A 3H7PA 2K3UA 3V60A 4A9AA 3JVZX 2NVUI 1E90A 3I9V1 2D10A 3NVZA 2G3QB 3TIXA 2V3NA 4GLSC 2BGFA 1KJTA 3W1SC 1WMHA 4C7ZA 3L13A 3CIRB 1RWSA 1L7YA 4P1CC 3RNCC 1YJ1A 4IUMB 2D3CA 2INNE 1LM8B 4P7IA 4WH4A 1EWYC 1AN8A 3IAM1 4EZJA 3ZVVA 1XEEA 3VUYA 4YL8A 1PGBA 4KZCA 2BF8B 2OJWA 4BVUC 2JRHA 3BYYB 5HG2A 3PZ8A 4ZRPA 1K8RB 3DDCB 4M8MA 2KQ4X 3MC9A 1VRAB 4MJSB 2L05A 1UWXA 3AMZA 1N63A 2WXPA 3BVMA 2QIEB 1T6BX 1ZGUB 4PS8A 2IGGA 4F1SA 2AEHA 2QMTA 1SIJA 4XC2A 5AZHA 4E74A 2PW9A 4C80A 2Y5BB 1E7VA 4W9IA 3BINA 4NJ6A 1BT0A 1F0ZA 5CHWA 1ZKHA 4BBNC 3VDZA 1GNUA 2XN9C 3KW5B 3TJPA 1WYWB 4D2KA 3DVNV 5LXHA 2KO3A 2KHWB 3A9JB 1IUEA 3P4SB 3DHGC 3R2TA 4W9JA 3QWZB 4ZRIA 1GB1A 1GOZA 1R4NB 2BW2A 3IHPC 3T3NA 1N5WA 3QC8B 1NBFC 4KDIC 3ML8A 3LDZE 3FILA 1EU4A 2WWZA 3JYUA 3ZLZA 1R4MI 1SE3A 3AE6B 1VCBA 3VQIA 2K9XA 3AH7A 1VR9A 1FNVA 4L1BA 3MJ5A 3AE1B 1EU3A 1SJED 3NUHB 3NY5A 2D3GA 2KDBA 1SEBD 3CF6E 2NMQA 3SDLC 1OQYA 1T0SC 2FE8A 2JXXA 1FFUA 2AQ3B 4AUQC 1E8WA 3HM6X 4P1BC 3IVFA 3GP7A 4CYEA 4MM3B 4GMVA 1WX8A 1XCTL 4MSMB 3P4PB 3AEEB 4MT5A 4HCPB 2L76A 4TMAB 4EEWA 2W54A 4NZLB 2MBBB 1OQRA 3SR6A 4A3PA 5HFYA 1I4QA 3QCAA 2ASQA 2WNMA 4BKTA 2JYEA 2FIFA 2LZ6A 3A9KA 1CK1A 4KZ0A 3TEXA 5T8IA 2JX5A 2LFIA 3Q6BA 3KWLA 2IDYA 3VFKA 1EO6A 2CKHB 5FK9C 3UQAA 3TEYA 1VZ7A 5HI1A 2B76B 1FO4A 1ZOYB 4NAWB 2MBHA 4ZRKA 3HIZA 4ZHPA 4LNIA 2LASA 3SFDB 3EFCA 1Q1OA 2DYBA 2INPE 3TEWA 2D2QA 4IWQA 4AJYB 4NJ7A 2MBOA 1SF0A 1QZEA 1WSPA 4YSZB 3ABVB 3R8BA 3SEBA 2WU2B 2KDIA 2JYTA 3ZKJC 1TBEA 3VRBB 4OHJA 4E3CA 1AYFA 2M0XA 2D11A 2KT7A 1S3SG 1MJDA 1CMXB 1YX6B 3HM3A 3Q3FA 1WRIA 2WDTB 4NNJB 2C9WB 1TGZB 4ANWA 4A90A 2RDBC 1TTNA 5FR3A 2LVQA 1H4RA 4URKA 3APCA 2W3SA 1F1HA 2CU1A 4JPSA 1TKGA 2KWCA 4BKSA 2OJRA 1IGCA 2PE6B 2CHXA 3VAWA 2BS3B 3RNEC 3FAHA 2LEKA 1YNTE 2JQRB 2L0FA 1FPYA 2HTHA 4FXCA 1TS4A 4WQMA 1I4RA 1P7FA 1F9JA 2OOBB 1XLOA 3IAS1 1WF9A 2K8BA 5D3IB 3VTWA 4KX6B 2L3ZA 2KLCA 4DXFA 2LXCA 1SE9A 1JW9D 1GG3A 2WXJA 3QK0A 4MDKE 3KYDD 3O65B 2XBBC 3A4SC 2DZIA 4NAMA 3M95A 4A3OA 4MACA 2G1EA 2MJEA 2QDFA 2PVGC 2LHEA 2EMSA 2Z0DB 5FR6A 2DYMA 4EE2A 4YSXB 5J17A 2J0JA 3I57A 3TCAA 4WAFA 3RYTA 3W2DA 1QLBB 2FNJB 1WYGA 1TKEA 4EFOA 2V4LA 2K1FA 2GLSA 2D5GA 2KMMA 2PJHA 1QQRA 2J52A 4PS7A 4W9KA 4GXBA 2E3TA 1MVKA 1OTRB 4KKJA 1PGAA 4ARCA 1N60A 1EF5A 3AECB 3CSFA 5DPTA 1TJEA 4KDLB 3NJTA 3ALBA 2J4XA 4JIOU 3X0WA 1SXTA 2ICIA 5AZGA 1WE6A 2MP2B 3U2SC 2ZVNA 2WXGA 1FNWA 4K1RB 2IBIB 1A5RA 1KFYB 2JWZA 1WIAA 1UZXB 1NYQA 2J42A 1QT9A 3U4EG 3B1LX 4DXAB 1YOVB 1KRHA 1C3TA 3RUIB 1TIFA 1E8ZA 1V80A 3RNAC 4JWUC 1P1AA 3GE3C 4HPLB 3PPAA 2GBRA 3NS1A 4II3B 4XYCA 3P4RB 2MBQA 2K22A 3RCZA 5L95C 1N62A 4OVUA 3VXWA 3GB1A 3R2IA 2AQ2B 1YQ3B 3KWVA 1QILA 2A4ZA 2KN4A 2DZMA 1KH0A 1E5WA 4X57B 4TKNA 4E71A 2DNFA 4WIPA 4QAYA 2TSSA 1PDXA 2RPVA 4IKGA 1WH3A 5CHVC 1F77A 1VD2A 2CJNA 1LO5D 4J3OD 1ET9A 1WI0A 1J7CA 4K7SA 4DBGA 4JQWC 4KGTA 3DCGA 3VR9B 1D6EC 3N3KB 2GBMA 1TZ1A 5E6JA 2KN5A 2REXA 4GIVA 2EKIA 4ANXA 2MRPA 2O2VA 2KWVB 2GRIA 1XLNA 3AE8B 3LB8C 1V5OA 4DHZE 3PHWB 3H1UA 2LVPA 3C0RB 1V8CA 4HWIB 3FILB 3Q8CA 1KLVA 4IOIE 2PIAA 4BKGA 1NYRA 3GOEA 3TMPB 2FCSA 1I4HA 2A5UA 2KFKA 4HK2A 1JCKB 3H7SA 3T8MA 2NS5A 2M8SA 1T3QA 3ECIA
chains in the Genus database with same CATH topology
2L52A 1B9RA 1TS3A 1ZXIA 1JWAD 1JWMD 2L32A 4JWSC 1IUEA 3P4SB 5LNK1 3B2GA 1WWTA 4WURA 1KF6B 3PO0A 3R2TA 5BYRA 2WXFA 1GB1A 1GOZA 3RFZB 4ZYSA 4JE3B 4YWGG 1L0YB 1OFFA 1FNUA 2BW2A 2MJ3A 1XLQA 3T3NA 1N5WA 2Y3AA 3MP9A 2LUMA 4AQ7A 3KQ4A 5C2TB 3OWEB 1K50A 2LGIA 1I4PA 3GS2A 2YEPF 3P42A 3FILA 1EU4A 3W9CB 5D3DA 4RGMA 2H89B 1SE3A 2ACZB 3AEDB 2IGDA 3AE6B 1ESFA 4HEA1 3VQIA 2K9XA 2V4IB 3AH7A 1VR9A 2ON8A 1FNVA 2W82A 2DYOA 4L1BA 3AE3B 1B1ZA 1L4ZB 3H8HA 1SSNA 2V0GA 3MJ5A 3AE1B 1EU3A 1SJED 4YTPB 1FD6A 3NUHB 1ACCA 3W1SA 1KLGD 1C79A 2KACA 1SEBD 2OEDA 2NMQA 1Y56A 1NI3A 1FMAD 1QKZA 2W3RA 4RNAA 1L5PA 2BTEA 1YJIA 1QOBA 2FE8A 1XXGA 3AEFB 1FFUA 2AQ3B 2RMMA 3IT6B 3AEGB 4OW0A 2L1AA 1M4VA 3Q8FA 3B9JA 2WDVB 3SFEB 1UGJA 1JMLA 1HXYD 1J7BA 2Q5WD 3URYA 1R7SA 3GP7A 3IXSA 3O13A 4XDDA 1C9FA 4MM3B 1GPXA 4LTUA 1P7EA 3B2FA 4MH8A 1XCTL 1EWCA 3NVWA 2EELA 1AW7A 2H88B 2BS2B 3AEEB 3P4PB 4MT5A 4YSYB 1DOXA 3AEAB 2HDEA 1C77A 4TMAB 3BZDB 2MJDA 2PLPA 2I38A 2N9KA 2W54A 4NZLB 4B0EA 2M56B 1QOGA 2PTLA 1IGDA 1NEKB 1OQRA 3SR6A 1HZ6A 2JXTA 1JROA 2OHFA 3Q69A 5HFYA 1I4QA 4HJGE 2LHDA 3AE7B 1EM7A 2Z8LA 2DLBA 2WNMA 2JYEA 1DOIA 2BB6A 2WXHA 1HEZE 1CK1A 1CZPA 4RCOA 3TEXA 3E56A 5T8IA 2MH7A 2JX5A 2NTTA 2LFIA 3KWLA 1V1OA 5HHDG 1SBBB 2PMVA 2IDYA 3TUOA 3AE9B 1JWBD 3ZYYX 1CJEA 4A55A 1C76A 2G9HD 1ET6A 5FK9C 1YN5A 2N9LA 3KLSX 1PYWD 5AUKA 4ARIA 1JRPA 1J7AA 3Q8BA 5H8YE 2BT6A 5BMGA 4N6EB 3TEYA 4HKQA 3P1MA 4NJCA 1VZ7A 2JU6X 2B76B 3HUIA 5HI1A 1FO4A 1FEHA 1ZOYB 4NAWB 2JWUA 4KKIA 4ZHPA 2X38A 3SFDB 1SJHD 1BUIC 1V1PB 1RFKA 2ZW0A 2WLBA 2INPE 3TEWA 2DWQA 1XF5L 2MEKA 1C4AA 1OQQA 4L23A 4ITKA 3ZGZA 2BB5A 3ZJTA 3PZ7A 3AE2B 2AX5A 5BYQA 4N59A 1ZPSA 1SF0A 1WSPA 4YSZB 1IBXB 1TZOA 3ABVB 3R8BA 1PGXA 3SEBA 1MHHE 2WU2B 1GB4A 1STEA 2JYTA 2M19A 2QEJC 3VRBB 1C4CA 4N58A 4OHJA 1UUPA 2WU5B 1AYFA 1FRRA 1TS2A 3E9SA 1N61A 2WXMA 2RDHA 1T5XD 4PT5A 2WDRB 5BMHA 1WRIA 1E10A 1I4XA 1SB3C 2XNAC 1QOAA 3DWGC 5EE3A 2VZKB 3W5UB 4OZBA 2GB1A 4A90A 1FXAA 5FR3A 1FFVA 1ROEA 1VLBA 2K0PA 3P63A 3HVDA 1YN4A 1YQ4B 1TY0A 1V1PA 2ONQA 1WXQA 2W3SA 1V97A 3AB5A 4USAA 4XDCA 4TSSA 1E7PB 2N7JA 5AUIA 1PFDA 3AE5B 4KGRA 5FKAC 4JPSA 3MC0B 4RF0A 1TKGA 4R3DA 1IGCA 3LYYA 3AV8A 4RFBA 1GAQB 1YJJA 1BXTA 1HZ5A 2YEPB 1BMLC 3RPFC 2BS3B 1D4BA 1IBXA 2FUG1 1ZE3D 3FAHA 2LEKA 1F2RI 1YNTE 4CQNA 2JQRB 1ZP0B 1F2RC 2M0AA 3BIID 5D7GA 4FXCA 1MHXA 1TS4A 2WXLA 1I4RA 1P7FA 4WQMA 3J9CA 4GDKB 2WQYB 2BBCA 1JALA 1XLOA 3IAS1 3VR8B 1A70A 5D3IB 1TKYA 1UNSA 2J53A 1HQRD 3MFGA 4KX6B 4DXFA 2I2YA 1I7HA 3U7ZA 3IT4B 1JW9D 2IGHA 1NVID 1K51A 1XCQL 2RDGA 4XWWA 2WXJA 4C7YA 3MHZA 4ZOHC 4RGTA 1QOFA 2WS3B 3LXFA 2WP9B 4AS1A 1Q10A 3FC4A 3V05A 3NVVA 1FRDA 4WWMA 2IPKD 4NAMA 1VJKA 2V3PA 4OZAA 3ZJVA 1VZ8A 4MACA 4RF1A 1FXIA 2G1EA 2MJEA 3AEBB 1FCLA 2PVGC 4DQOC 2LHEA 1L4DB 2KWDA 4YXDB 2WDQB 1ENFA 1C4PA 2DYMA 4EE2A 4YSXB 3BVGA 3I57A 2KAJA 3TSSA 3Q8AA 4WAFA 4KGSA 1QLBB 3W2DA 4LLGM 5I4DA 1WYGA 4L2YA 1TKEA 2BYTA 2QILA 2D5GA 2KMMA 2CJOA 1QQRA 1XO3A 2J52A 2KDMA 2E3TA 3L4PA 1MVKA 2PKOA 1FIQA 1VZ6A 2W55A 4YTMB 4KKJA 2NTSA 3EGRA 1PGAA 4XWTA 1RYJA 4RGOS 4ARCA 1N60A 4RH6A 4LK0M 1I4GA 2VZKD 3UI3A 2WXRA 3AN1A 3AECB 2WXKA 4TQ0A 3WCQA 3TEZA 2LJIA 1TJEA 1FCCC 2JZPA 4C56C 2WXIA 2J4XA 2JSVX 3ZJUA 1L6UA 1FM0D 2AQ1B 1NENB 2QJLA 1SXTA 2PVOD 3HVZA 2ICIA 4US8A 3BK1A 4XE0A 4YTNB 5BMIA 2WXOA 1XLPA 2GI9A 3ETRA 3U2SC 3W5VB 1SE2A 2WXGA 4P6VF 1JWSD 3ZQ4A 1FNWA 4REZA 2BS4B 1KFYB 1TYGB 4IDIA 1E0ZA 5BYSA 1ZDVA 2Y5PA 2WXQA 2ZW1A 5MPOA 1NYQA 1AWDA 1N5XA 3EUB2 1ZDXA 2J42A 3U52E 1QT9A 3BVZA 1D5MC 1WGKA 3U4EG 3T3OA 2R61A 4HRSA 4ZRQA 1KRHA 2E6XA 4Q2JA 4GDLB 1E9MA 2WXNA 4JWUC 1ZUD2 4H2AA 1TS5A 1ZXHA 4ZHOA 1UWMA 2L83A 1QF6A 3DWMA 1VDVA 3NS1A 5EE1A 4HROA 3C8YA 1RM6C 1K52A 1L6VA 1HA5A 1D5ZC 3P4RB 3NVYA 1JWUD 2K3UA 3V3XA 2K22A 4A9AA 1N62A 3BWUD 2FBWB 3AM9A 5C3JB 3GB1A 3EA6A 3R2IA 4US9A 2N0SB 2AQ2B 1YQ3B 3KWVA 3I9V1 1QILA 2KN4A 2DBYA 1K53A 4TQ1A 3NVZA 5H92C 1KH0A 2V3NA 1JQ4A 4GLSC 4HKZE 5JXVA 2CU3A 1C78A 4WIPA 4C7ZA 4OVZA 3CIRB 1DOYA 3P4QB 2TSSA 1RWSA 1PDXA 2RPVA 3AE4B 3NRZA 4IKGA 1YMHE 1F77A 2INNE 1CQVA 4WH4A 2LMCA 1EWYC 1AN8A 2CJNA 1LO5D 3IAM1 4J3OD 1KLUD 1ET9A 4A8XC 1J7CA 4M0WA 2HTME 1XEEA 4P16A 4KGTA 3N9YC 3CWIA 3VR9B 1PGBA 3VRAB 1D6EC 1TY2A 1SE4A 4YT0B 5E6JA 1L0VB 1MPEA 1E6EB 5GXGB 3BYYB 2EKIA 5HG2A 1KTKA 5G5HA 3PZ8A 4ZRPA 4RGNA 4UDUC 2GRIA 1XLNA 2KQ4X 2SAKA 3AE8B 3BYTB 3LB8C 1VRAB 3BK2A 1UWXA 2QSDA 3AMZA 1N63A 2WXPA 3BVMA 4A6QA 4DXGA 2QIEB 2Y5CA 1T6BX 4O1NA 2IGGA 1V8CA 3FILB 1MI0A 2QMTA 1SIJA 3Q8CA 1DGJA 2PW9A 5EE9A 4C80A 5EE0A 4IOIE 2PIAA 2IJ0A 2K5PA 1NYRA 1F0ZA 5G5GA 3NZ3A 1L0XB 2SEBD 3HRDD 4JX1C 1I4HA 1PUTA 1YN3A 1JCKB 2XN9C 4B0MA 3Q8EA 5TSSA 4D2KA 1D5XC 1T3QA 4OZCA 1DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  5HHD G;  1ZXH A;  2I2Y A;  2IGH A;  1K51 A;  1XCQ L;  1GB1 A;  2N9L A;  1K52 A;  5BMG A;  1Q10 A;  2JU6 X;  5HI1 A;  3V3X A;  3MP9 A;  2LUM A;  2JWU A;  1K50 A;  3GB1 A;  2LGI A;  4OZA A;  4MAC A;  2ZW0 A;  2KN4 A;  3FIL A;  1FCL A;  1K53 A;  1XF5 L;  2LHE A;  2IGD A;  1KH0 A;  2KWD A;  4GLS C;  4HKZ E;  2ON8 A;  5JXV A;  1FD6 A;  4KGS A;  2RPV A;  1IBX B;  4IKG A;  1YMH E;  1PGX A;  1MHH E;  1GB4 A;  4WH4 A;  2KAC A;  2J52 A;  2OED A;  2KDM A;  1MVK A;  2NMQ A;  1QKZ A;  1PGA A;  4KGT A;  1PGB A;  2RMM A;  3UI3 A;  5BMH A;  2JZP A;  1FCC C;  1MPE A;  5HG2 A;  2JSV X;  2GB1 A;  4OZB A;  1JML A;  1C9F A;  2K0P A;  2ONQ A;  1P7E A;  1XCT L;  2KQ4 X;  2EEL A;  5BMI A;  2N7J A;  2GI9 A;  4KGR A;  1UWX A;  2QSD A;  2PLP A;  2I38 A;  2N9K A;  1IGC A;  2IGG A;  3FIL B;  1MI0 A;  2QMT A;  2PTL A;  1IGD A;  2PW9 A;  1HZ6 A;  2JXT A;  4IOI E;  1HZ5 A;  5HFY A;  4HJG E;  1D4B A;  1IBX A;  2LHD A;  2ZW1 A;  1EM7 A;  1F2R I;  1YNT E;  1F2R C;  1HEZ E;  1MHX A;  1P7F A;  4D2K A;  4OZC A; 
#chains in the Genus database with same CATH topology
 3ZTD A;  2L52 A;  1B9R A;  3W1Y A;  4KSK C;  4ZRJ A;  4KVG B;  1WWT A;  3Q3N C;  5BYR A;  2WXF A;  5CTR C;  4JE3 B;  2JVC A;  4YWG G;  3VHT C;  1V86 A;  3RNB C;  1LFD A;  4FJZ A;  2VH1 A;  4I6P A;  2MBE A;  1V81 A;  1XT9 B;  4XZ4 A;  3KQ4 A;  4W9D A;  5C2T B;  2V1Y A;  2HJ1 A;  1X1M A;  4WJO A;  4IM3 A;  2LGI A;  2DAF A;  2IZV B;  2YEP F;  4M00 A;  2GBK A;  2LI5 A;  2H89 B;  3N32 A;  2IGD A;  4HEA 1;  4MEL A;  3SD5 A;  3NZU A;  1G6J A;  2M17 A;  1B1Z A;  3H8H A;  1GUA B;  2MWS B;  1IPG A;  1FD6 A;  1ACC A;  2LUE A;  4TUU A;  4I6L B;  5EDS A;  2MP2 A;  2ZVO A;  2OED A;  2AWT A;  3A9K B;  2ZEQ A;  1Y56 A;  1L5P A;  1YJI A;  2EKE C;  1WXA A;  3IT6 B;  2GBJ A;  3EEC A;  3UF8 A;  2L1A A;  1V2Y A;  1M4V A;  1UGJ A;  2KJR A;  2Q5W D;  1R7S A;  5L83 A;  4XDD A;  3N1Y C;  1GPX A;  3B2F A;  4MH8 A;  2H88 B;  4YSY B;  2BS2 B;  3L16 A;  2C5L C;  3AEA B;  1WGD A;  2KMA A;  3ZIM A;  2PLP A;  4EKU A;  5KHQ A;  4CO7 A;  4B0E A;  2FCM A;  2M56 B;  2QC8 A;  2IO2 B;  1HZ6 A;  2OHF A;  3Q69 A;  4DHZ B;  3QX1 A;  2XK5 A;  3OLM D;  4DDG D;  2BB6 A;  4LNN A;  2WXH A;  1HEZ E;  3E56 A;  3UIP B;  3R3M A;  2MH7 A;  4BKS D;  1D3Z A;  4W9G A;  5HHD G;  2MCN B;  4A55 A;  2V3S A;  1GJZ A;  1ET6 A;  2N9E B;  1WR1 A;  1PYW D;  5AUK A;  2ZNV B;  5BMG A;  1YD8 U;  3RNF C;  3P1M A;  3CMM B;  1WXS A;  4BOS C;  2JWU A;  1P9D U;  4NQL B;  4DWF A;  2NR2 A;  4ITK A;  3N1Z C;  2BB5 A;  3PZ7 A;  3R7Q A;  5BYQ A;  4HLE A;  3QJZ A;  3WIM A;  3KYC D;  1KM7 A;  2FUH B;  4KSL C;  1STE A;  2M19 A;  4FHK A;  4MSQ B;  3ZW3 A;  1C4C A;  1SGH A;  2WU5 B;  1XQQ A;  1N61 A;  2RDH A;  4FN2 A;  1E10 A;  1E8X A;  2VH2 A;  2IY1 B;  3DWG C;  5C1Z A;  5EE3 A;  2PPH A;  2VZK B;  3W5U B;  4DHJ D;  1V1P A;  1WXQ A;  2RPQ A;  1V97 A;  4TSS A;  1E7P B;  5AUI A;  4EOY A;  2BKR B;  4KGR A;  4A20 A;  2L8J A;  4RF0 A;  1WE7 A;  1GC6 A;  4R3D A;  2ZCC A;  3AUL A;  3LYY A;  4RFB A;  3ENE A;  5D6J B;  4FBJ B;  4ZDV A;  1BXT A;  1HZ5 A;  2YEP B;  3RPF C;  1D4B A;  2KWU B;  1IBX A;  3PRZ A;  2JZ3 B;  4CHK A;  2M0A A;  5D7G A;  2KKC A;  2NBU A;  4GDK B;  2BBC A;  5GMV A;  1TKY A;  4DHJ B;  2J53 A;  2X8X X;  4ANU A;  3IT4 B;  2IGH A;  1NVI D;  1K51 A;  3HK0 A;  3T9L A;  2ZZP B;  1QOF A;  5J18 A;  2WP9 B;  3IBE A;  4IM0 A;  1WX9 A;  4M01 A;  1Q10 A;  3V05 A;  4W9F A;  2BQQ A;  1FRD A;  2IPK D;  3PVL A;  1VJK A;  3EHV A;  1VZ8 A;  1FXI A;  3AEB B;  1FCL A;  3FKY A;  2KWD A;  3PGE A;  1KOT A;  2WDQ B;  1ENF A;  4NQK E;  2RR9 A;  2LRU A;  2KAJ A;  3Q8A A;  5I4D A;  2RD0 A;  4L2Y A;  4KV2 A;  2QIL A;  4FA6 A;  2CJO A;  3ZUN A;  3Q14 C;  1VZ6 A;  2W55 A;  3GZN B;  2NTS A;  3EGR A;  1YIW A;  4RH6 A;  3VUW A;  2ZCB A;  3UI3 A;  2J7Q B;  2WXK A;  4TQ0 A;  3WCQ A;  3TEZ A;  4PYU A;  2LJI A;  3PZD A;  4C56 C;  2KAN A;  2WXI A;  2JSV X;  1L6U A;  1FM0 D;  2AQ1 B;  3WA0 A;  2PVO D;  4HDQ A;  1UEL A;  3M3J A;  3MC8 A;  3NS8 A;  2JF5 A;  4YTN B;  2R2Q A;  5LLI A;  2JT4 B;  3EC8 A;  4HPM B;  1YQB A;  4LDT D;  1M94 A;  3L17 A;  3DHH C;  4P6V F;  3ZQ4 A;  5DPR A;  2BS4 B;  1V9J A;  2KD0 A;  4K7U A;  5BYS A;  1I35 A;  4LNF A;  1WGK A;  4ZRQ A;  2N9P C;  3N20 C;  1E9M A;  2WXN A;  1ZUD 2;  1WX7 A;  4LNK A;  2DZK A;  3DWM A;  3APF A;  3RT3 B;  3M62 B;  4LDT B;  1RM6 C;  1K52 A;  1L6V A;  5AZF A;  3DBR B;  4AP4 C;  3WAO A;  3NOB A;  2D3A A;  3CST A;  2O2V B;  3Q2A C;  4HJK A;  3EA6 A;  4US9 A;  3IFW B;  4ANV A;  4C00 A;  5D2M B;  2DBY A;  4TQ1 A;  1WJU A;  5H92 C;  4HKZ E;  1OEY J;  5IKC M;  2CU3 A;  1C78 A;  4GGQ A;  3V6C B;  2NCN A;  3AE4 B;  3RNG C;  2KFK B;  2CS4 A;  3ZDT A;  1WGR A;  4MGK E;  1KLU D;  4A8X C;  4F8C B;  2FCN A;  3ZRC A;  4P16 A;  4WWP A;  2KC1 A;  5LXI B;  1SE4 A;  4YT0 B;  1L0V B;  2WYQ A;  5CX3 A;  3K9O B;  4TV3 A;  2R2O A;  1KTK A;  1ZW7 A;  5G5H A;  1NDD A;  2KFJ A;  4RGN A;  2FAZ A;  4UDU C;  1J19 A;  4GDK A;  2SAK A;  2GBN A;  4LCD E;  2HE7 A;  2MHJ A;  2QSD A;  4A6Q A;  4O1N A;  2B3A A;  1DGJ A;  5EE9 A;  2K8H A;  5IN7 A;  4ACF A;  2IJ0 A;  1Q5W B;  1L0X B;  2SEB D;  3NZ3 A;  3U7D A;  2LD9 A;  4JX1 C;  5C23 A;  1PUT A;  3DBS A;  1YN3 A;  1WR6 E;  5G55 A;  4B0M A;  3H9D A;  3N30 A;  4AOF A;  1D5X C;  4OZC A;  1DYQ A;  1TS3 A;  1ZXI A;  2UYZ B;  4FJY A;  4OVV A;  1UH6 A;  2EMT A;  5LNK 1;  1Z2M A;  4WUR A;  3RZF A;  1KF6 B;  4I6N B;  4WAA A;  1NI2 A;  4MGZ E;  3RFZ B;  4ZYS A;  1GC7 A;  3ZXV A;  1L0Y B;  1FNU A;  2MJ3 A;  4DK5 A;  4W9E A;  4HDO A;  3ZRF A;  4PYZ A;  2N1V A;  4AQ7 A;  3OWE B;  2IO3 B;  1I4P A;  3GS2 A;  1WFY A;  3P42 A;  3PSE B;  2L7R A;  3I63 C;  3B08 A;  5D3D A;  4RGM A;  3W9C B;  2ACZ B;  4BFR A;  1ESF A;  3HHM A;  2CR5 A;  2V4I B;  1T0Q C;  4BZA A;  3MHS D;  2DYO A;  3AE3 B;  4WJQ A;  1SSN A;  2C7H A;  4WQO B;  2V0G A;  4YTP B;  2WHI A;  3W1S A;  1KLG D;  2XK5 B;  4IWO A;  3S2A A;  1C79 A;  3PTF C;  2KAC A;  2NPT A;  1FMA D;  4RNA A;  2BTE A;  5DPW A;  2ZNV C;  4M02 A;  2K6D B;  1XXG A;  3ZXR A;  3B0A A;  3AEF B;  2RMM A;  2LWP A;  3Q8F A;  3B9J A;  2N9X A;  4M8N A;  3SFE B;  2MX2 A;  5JH5 C;  4GU2 A;  2L00 B;  3QAR A;  1J7B A;  3IXS A;  4GN1 A;  1C9F A;  5J2R A;  1P7E A;  1EWC A;  3NVW A;  2EEL A;  1AW7 A;  3L0W B;  3TL5 A;  1DOX A;  2HDE A;  2N7E A;  4EZK A;  2YVC A;  2MJD A;  2I38 A;  3ZNH B;  2N7D A;  1OGW A;  3NZS A;  1QOG A;  2PTL A;  1IGD A;  1NEK B;  3Q3J A;  5JHA A;  2JXT A;  1JRO A;  3ZTC A;  1HTO A;  2LGS A;  4HJG E;  3QIJ A;  4AJW A;  1MFW A;  2V9H A;  2KXJ A;  2DLB A;  2Z59 B;  3EFU A;  1CZP A;  2DX5 B;  2KYW A;  1WM2 A;  4KIK A;  2NTT A;  3MTN B;  2BYE A;  1SBB B;  3TUO A;  1JWB D;  3ZYY X;  1CJE A;  2LGY A;  1C76 A;  2G9H D;  4W9H A;  2N9L A;  3I3T B;  3KLS X;  5JZE B;  1JRP A;  1J7A A;  5H8Y E;  2BT6 A;  3JSV B;  2MSE D;  2RGF A;  4HPP A;  4N6E B;  4HKQ A;  3C19 A;  3HUI A;  1FEH A;  2K25 A;  2X38 A;  2O6V A;  5IP4 D;  2IO1 B;  1V1P B;  2ZW0 A;  2WLB A;  4K3C A;  2DWQ A;  1C4A A;  2G4S A;  2BPS A;  3Q3M C;  3DBL I;  2AX5 A;  1ZPS A;  3OAW A;  1IBX B;  2RSU A;  1PGX A;  1MHH E;  2QEJ C;  4N58 A;  1UUP A;  1FRR A;  1TS2 A;  3E9S A;  3VUX A;  1T5X D;  4PT5 A;  5BMH A;  2I1K A;  1I4X A;  1LQB A;  3OG5 A;  2KNB A;  3DHI C;  3ZDM C;  2GB1 A;  1PQS A;  1FXA A;  3KUC B;  1ROE A;  1VLB A;  2KTR B;  3P63 A;  3HVD A;  2C60 A;  2ONQ A;  4USA A;  4XDC A;  1P0R A;  2JUO A;  3NG0 A;  2N7J A;  1PFD A;  2CHZ A;  2KQS A;  3AE5 B;  5FKA C;  3MC0 B;  2KLG A;  4IG7 B;  2YLM A;  1GAQ B;  3UIO B;  1LXD A;  4LJO B;  4WJP A;  1YJJ A;  4PK1 A;  1BML C;  5IAA C;  4K3B A;  2FUG 1;  3GZN I;  1C1Y B;  1ZE3 D;  2UU7 A;  4K81 A;  2J0K A;  1ZP0 B;  3K9P B;  1HTQ A;  1J8C A;  2WXL A;  3V61 A;  3J9C A;  2WQY B;  1JAL A;  1A70 A;  1T0R C;  1UNS A;  3LJ3 A;  1HQR D;  3MFG A;  3PRM B;  4IM2 A;  4XX5 A;  2BWE S;  2I2Y A;  1I7H A;  3UIN B;  2MLB A;  5IO9 A;  2RDG A;  4C7Y A;  3IG3 A;  3PRP B;  4RGT A;  3N1X C;  3LXF A;  4C4V B;  3U30 A;  3FC4 A;  1HE8 A;  2KK8 A;  3NVV A;  4WWM A;  3WAM A;  4MGI E;  5BO4 B;  3DPD A;  3ZJV A;  2JZZ A;  4RF1 A;  4DQO C;  1L4D B;  2G4D B;  5E6P A;  1C4P A;  1AAR A;  4KGS A;  1Q0W B;  4MH0 E;  2BYT A;  2KQ7 A;  2MA9 B;  1XO3 A;  2NBW B;  1WZ3 A;  2KDM A;  1FIQ A;  4YTM B;  1WM3 A;  3VVW B;  3DBR I;  1RYJ A;  4RGO S;  4XWT A;  2VZK D;  3V6E B;  2WXR A;  3ZNZ B;  3UQB A;  2KC2 A;  1FCC C;  2KX3 A;  3OJ4 B;  3ZJU A;  1WZ0 A;  4FLH A;  4IWP A;  2QJL A;  3HVZ A;  4US8 A;  3BK1 A;  4XE0 A;  2KJH B;  3ZNI D;  5BMI A;  1XLP A;  2KJ6 A;  3ETR A;  3W5V B;  4HXD A;  5JHB A;  1JWS D;  4REZ A;  1F52 A;  3PLU A;  1TYG B;  3JSV A;  2ZW1 A;  2WXQ A;  3QA8 A;  3BY4 B;  1TT5 B;  1AWD A;  1ZDX A;  2PE9 A;  3BVZ A;  4XGA B;  4BBN F;  2MW5 A;  3T3O A;  2R61 A;  4HRS A;  2GOW A;  2BKF A;  4GDL B;  1WJ4 A;  1IYF A;  4H2A A;  3VTV A;  2L83 A;  1QF6 A;  1VDV A;  4ZYN A;  5AEK B;  5IA7 A;  4HRO A;  3L10 B;  2JRI B;  2INC C;  1JWU D;  3V3X A;  5KHO A;  2XEW A;  3GE8 C;  2IY0 B;  2FBW B;  3AM9 A;  3SU8 X;  5C3J B;  3DBL B;  2N0S B;  4FJV B;  1K53 A;  2QHO A;  5E6O A;  1JQ4 A;  5JXV A;  4K7W A;  1SIF A;  4OVZ A;  1DOY A;  3P4Q B;  3OJ3 A;  3AXC A;  4J6I A;  2KTR A;  5G2N A;  3NRZ A;  2QCZ A;  1YMH E;  3A1Q A;  1CQV A;  2LMC A;  1I42 A;  1RFA A;  5TR5 A;  4M0W A;  2HTM E;  4EUT A;  2L0T A;  3N9Y C;  3CWI A;  3VRA B;  1TY2 A;  1E8Y A;  2C7N B;  1MPE A;  1E6E B;  5GXG B;  2KZR A;  3DQV A;  2AYO B;  1FXT B;  2I1J A;  3BYT B;  4G0N B;  3L08 A;  1EUV B;  3PHX B;  2BVC A;  3BK2 A;  2C7M B;  3R66 C;  4DXG A;  2Y5C A;  3L54 A;  3PS6 A;  1IP9 A;  3RD2 A;  3WAL A;  1MI0 A;  1UBI A;  3NHE B;  5EE0 A;  5HKH A;  2K5P A;  5G5G A;  4C4V A;  3HRD D;  3Q8E A;  5TSS A;  3BWU D;  2NPT B;  2VRR B;  1JWA D;  5DPS A;  1JWM D;  2L32 A;  4JWS C;  3B2G A;  3PO0 A;  2W9N A;  3ZO5 B;  3KUZ A;  4DDI D;  4BOZ B;  3ONS A;  1OFF A;  3KUD B;  1XLQ A;  4ICU A;  2Y3A A;  3MP9 A;  2LUM A;  2KVR A;  1RAX A;  4MJS A;  1WGH A;  3UGB B;  2LGX A;  1K50 A;  4LJP B;  3A4R A;  1WXV A;  3AED B;  3SHQ A;  2ON8 A;  2W82 A;  2DHZ A;  1L4Z B;  2LGD A;  3I5J C;  4S0R A;  4ICV A;  4MEM A;  2O6V D;  3A9J A;  1P3Q U;  2M4N A;  1NI3 A;  1QKZ A;  2W3R A;  2WX1 A;  4KIK B;  1QOB A;  1H8C A;  1RLF A;  2JY6 A;  3AEG B;  2MQJ A;  2BYV E;  3WAN A;  4OW0 A;  3KVF B;  3PLV A;  2WDV B;  3H6N A;  4JLC A;  5IOI A;  1ISN A;  1JML A;  1HXY D;  3Q3O C;  3DVN U;  2ZPN A;  3URY A;  3DBH I;  3O13 A;  2G45 B;  4GDL A;  4LTU A;  4FHJ A;  3APD A;  2O6V B;  1C77 A;  3BZD B;  2N9K A;  1V6E A;  4HCN B;  4ASW C;  2LHD A;  3AE7 B;  3VTU A;  1EM7 A;  2Z8L A;  1DOI A;  1R4M B;  4JL9 A;  1P98 A;  1Z5S B;  3P2B A;  4RCO A;  3QQ8 B;  1LGR A;  1V1O A;  3M63 B;  4N9F 4;  2PMV A;  4GSW A;  3AE9 B;  5E6N A;  2FID A;  1UBQ A;  2IYD B;  1YN5 A;  4ARI A;  2K6Q A;  3Q8B A;  1J0G A;  4MM3 A;  4NJC A;  2JU6 X;  2KMC A;  4W9C A;  3KH0 A;  1XD3 B;  3R7R A;  4KKI A;  1SJH D;  1BUI C;  1S1Q B;  1WRD B;  1RFK A;  3WAP A;  4AWJ A;  1EF1 A;  2IND C;  1XF5 L;  2MEK A;  1OQQ A;  4L23 A;  3ZGZ A;  1T0Y A;  3ZJT A;  3AE2 B;  3AI5 A;  4N59 A;  2LRW A;  4RM8 A;  2K8C A;  4JGH B;  2M1M A;  2ZPY A;  1TZO A;  2HD5 B;  1UF0 A;  3H7P B;  4MGY E;  1GB4 A;  4GB9 A;  2Z0E B;  4FUL A;  1OEY A;  2KOX A;  2ZJD A;  2N1W A;  3V62 A;  1N6Z A;  4G3X B;  1V5T A;  2GMI C;  3RMK C;  2WXM A;  2WDR B;  2K39 A;  1U4A A;  1E7U A;  1WY8 A;  1SB3 C;  2XNA C;  4GOC A;  1QOA A;  3RZW C;  1WMH B;  4OZB A;  4NAW A;  1FFV A;  2K0P A;  1WGG A;  1YN4 A;  1YQ4 B;  1TY0 A;  1L2N A;  2KTF A;  3AB5 A;  2KDF B;  1UGM A;  3VH3 B;  4W9L A;  4G11 A;  4G50 A;  3AV8 A;  4HVB A;  2KVZ A;  4B6W A;  2CHW A;  2KDE B;  1RRB A;  1F2R I;  4CQN A;  1F2R C;  4II2 B;  3BII D;  3MJW A;  1MHX A;  3PV1 A;  1WJN A;  2FCQ A;  2LVO A;  3D32 A;  3VR8 B;  3RN9 C;  1Y8R C;  1MG4 A;  3U7Z A;  1WJ6 A;  4NY0 A;  1XCQ L;  4XWW A;  5CHF A;  3MHZ A;  4ZOH C;  1UD7 A;  4WWN A;  2WS3 B;  4F7Z A;  4AS1 A;  4WJN A;  4WWO A;  1R4N I;  4EZL A;  2V3P A;  4OZA A;  2KX0 A;  4B9K A;  4YXD B;  2WX0 A;  4RMA A;  1YX5 B;  2D07 B;  3BVG A;  1MG8 A;  3TSS A;  4LLG M;  1WGY A;  2IO0 B;  3DVG X;  3L4P A;  2PKO A;  3TBL D;  3AU5 A;  3X23 A;  4LK0 M;  3VH4 B;  3RI7 C;  2UWQ A;  1I4G A;  2LJ5 A;  3DBH B;  3AN1 A;  4BAX A;  2JPH A;  2JZP A;  4IC7 B;  3DOW A;  1NEN B;  5D94 A;  3ZNG C;  2WGS A;  4NPN A;  2WXO A;  2GI9 A;  2NBV B;  4LNO A;  3RUL A;  2DEN B;  1JRU A;  3QHT A;  1SE2 A;  2HJ8 A;  4IW0 A;  3U8Z A;  2DZJ A;  3AU4 A;  3PT2 B;  4IDI A;  4B95 A;  1E0Z A;  1ZDV A;  2Y5P A;  5MPO A;  1N5X A;  1WXM A;  3EUB 2;  3U52 E;  2PEA A;  2DAJ A;  1D5M C;  3ML9 A;  2AL3 A;  2D3B A;  3A1Q B;  2E6X A;  4Q2J A;  5DCN A;  2LXA A;  1V49 A;  1TS5 A;  3DVG Y;  4RM9 A;  1ZXH A;  3JW0 X;  4PS3 A;  2AL6 A;  4ZHO A;  1UWM A;  4M0W B;  3PRE A;  2BWF A;  2BYF A;  3A33 B;  2N4F A;  5EE1 A;  3C8Y A;  3QAQ A;  4FAD A;  1HA5 A;  1D5Z C;  3NVY A;  2J0M A;  4S17 A;  3H7P A;  2K3U A;  3V60 A;  4A9A A;  3JVZ X;  2NVU I;  1E90 A;  3I9V 1;  2D10 A;  3NVZ A;  2G3Q B;  3TIX A;  2V3N A;  4GLS C;  2BGF A;  1KJT A;  3W1S C;  1WMH A;  4C7Z A;  3L13 A;  3CIR B;  1RWS A;  1L7Y A;  4P1C C;  3RNC C;  1YJ1 A;  4IUM B;  2D3C A;  2INN E;  1LM8 B;  4P7I A;  4WH4 A;  1EWY C;  1AN8 A;  3IAM 1;  4EZJ A;  3ZVV A;  1XEE A;  3VUY A;  4YL8 A;  1PGB A;  4KZC A;  2BF8 B;  2OJW A;  4BVU C;  2JRH A;  3BYY B;  5HG2 A;  3PZ8 A;  4ZRP A;  1K8R B;  3DDC B;  4M8M A;  2KQ4 X;  3MC9 A;  1VRA B;  4MJS B;  2L05 A;  1UWX A;  3AMZ A;  1N63 A;  2WXP A;  3BVM A;  2QIE B;  1T6B X;  1ZGU B;  4PS8 A;  2IGG A;  4F1S A;  2AEH A;  2QMT A;  1SIJ A;  4XC2 A;  5AZH A;  4E74 A;  2PW9 A;  4C80 A;  2Y5B B;  1E7V A;  4W9I A;  3BIN A;  4NJ6 A;  1BT0 A;  1F0Z A;  5CHW A;  1ZKH A;  4BBN C;  3VDZ A;  1GNU A;  2XN9 C;  3KW5 B;  3TJP A;  1WYW B;  4D2K A;  3DVN V;  5LXH A;  2KO3 A;  2KHW B;  3A9J B;  1IUE A;  3P4S B;  3DHG C;  3R2T A;  4W9J A;  3QWZ B;  4ZRI A;  1GB1 A;  1GOZ A;  1R4N B;  2BW2 A;  3IHP C;  3T3N A;  1N5W A;  3QC8 B;  1NBF C;  4KDI C;  3ML8 A;  3LDZ E;  3FIL A;  1EU4 A;  2WWZ A;  3JYU A;  3ZLZ A;  1R4M I;  1SE3 A;  3AE6 B;  1VCB A;  3VQI A;  2K9X A;  3AH7 A;  1VR9 A;  1FNV A;  4L1B A;  3MJ5 A;  3AE1 B;  1EU3 A;  1SJE D;  3NUH B;  3NY5 A;  2D3G A;  2KDB A;  1SEB D;  3CF6 E;  2NMQ A;  3SDL C;  1OQY A;  1T0S C;  2FE8 A;  2JXX A;  1FFU A;  2AQ3 B;  4AUQ C;  1E8W A;  3HM6 X;  4P1B C;  3IVF A;  3GP7 A;  4CYE A;  4MM3 B;  4GMV A;  1WX8 A;  1XCT L;  4MSM B;  3P4P B;  3AEE B;  4MT5 A;  4HCP B;  2L76 A;  4TMA B;  4EEW A;  2W54 A;  4NZL B;  2MBB B;  1OQR A;  3SR6 A;  4A3P A;  5HFY A;  1I4Q A;  3QCA A;  2ASQ A;  2WNM A;  4BKT A;  2JYE A;  2FIF A;  2LZ6 A;  3A9K A;  1CK1 A;  4KZ0 A;  3TEX A;  5T8I A;  2JX5 A;  2LFI A;  3Q6B A;  3KWL A;  2IDY A;  3VFK A;  1EO6 A;  2CKH B;  5FK9 C;  3UQA A;  3TEY A;  1VZ7 A;  5HI1 A;  2B76 B;  1FO4 A;  1ZOY B;  4NAW B;  2MBH A;  4ZRK A;  3HIZ A;  4ZHP A;  4LNI A;  2LAS A;  3SFD B;  3EFC A;  1Q1O A;  2DYB A;  2INP E;  3TEW A;  2D2Q A;  4IWQ A;  4AJY B;  4NJ7 A;  2MBO A;  1SF0 A;  1QZE A;  1WSP A;  4YSZ B;  3ABV B;  3R8B A;  3SEB A;  2WU2 B;  2KDI A;  2JYT A;  3ZKJ C;  1TBE A;  3VRB B;  4OHJ A;  4E3C A;  1AYF A;  2M0X A;  2D11 A;  2KT7 A;  1S3S G;  1MJD A;  1CMX B;  1YX6 B;  3HM3 A;  3Q3F A;  1WRI A;  2WDT B;  4NNJ B;  2C9W B;  1TGZ B;  4ANW A;  4A90 A;  2RDB C;  1TTN A;  5FR3 A;  2LVQ A;  1H4R A;  4URK A;  3APC A;  2W3S A;  1F1H A;  2CU1 A;  4JPS A;  1TKG A;  2KWC A;  4BKS A;  2OJR A;  1IGC A;  2PE6 B;  2CHX A;  3VAW A;  2BS3 B;  3RNE C;  3FAH A;  2LEK A;  1YNT E;  2JQR B;  2L0F A;  1FPY A;  2HTH A;  4FXC A;  1TS4 A;  4WQM A;  1I4R A;  1P7F A;  1F9J A;  2OOB B;  1XLO A;  3IAS 1;  1WF9 A;  2K8B A;  5D3I B;  3VTW A;  4KX6 B;  2L3Z A;  2KLC A;  4DXF A;  2LXC A;  1SE9 A;  1JW9 D;  1GG3 A;  2WXJ A;  3QK0 A;  4MDK E;  3KYD D;  3O65 B;  2XBB C;  3A4S C;  2DZI A;  4NAM A;  3M95 A;  4A3O A;  4MAC A;  2G1E A;  2MJE A;  2QDF A;  2PVG C;  2LHE A;  2EMS A;  2Z0D B;  5FR6 A;  2DYM A;  4EE2 A;  4YSX B;  5J17 A;  2J0J A;  3I57 A;  3TCA A;  4WAF A;  3RYT A;  3W2D A;  1QLB B;  2FNJ B;  1WYG A;  1TKE A;  4EFO A;  2V4L A;  2K1F A;  2GLS A;  2D5G A;  2KMM A;  2PJH A;  1QQR A;  2J52 A;  4PS7 A;  4W9K A;  4GXB A;  2E3T A;  1MVK A;  1OTR B;  4KKJ A;  1PGA A;  4ARC A;  1N60 A;  1EF5 A;  3AEC B;  3CSF A;  5DPT A;  1TJE A;  4KDL B;  3NJT A;  3ALB A;  2J4X A;  4JIO U;  3X0W A;  1SXT A;  2ICI A;  5AZG A;  1WE6 A;  2MP2 B;  3U2S C;  2ZVN A;  2WXG A;  1FNW A;  4K1R B;  2IBI B;  1A5R A;  1KFY B;  2JWZ A;  1WIA A;  1UZX B;  1NYQ A;  2J42 A;  1QT9 A;  3U4E G;  3B1L X;  4DXA B;  1YOV B;  1KRH A;  1C3T A;  3RUI B;  1TIF A;  1E8Z A;  1V80 A;  3RNA C;  4JWU C;  1P1A A;  3GE3 C;  4HPL B;  3PPA A;  2GBR A;  3NS1 A;  4II3 B;  4XYC A;  3P4R B;  2MBQ A;  2K22 A;  3RCZ A;  5L95 C;  1N62 A;  4OVU A;  3VXW A;  3GB1 A;  3R2I A;  2AQ2 B;  1YQ3 B;  3KWV A;  1QIL A;  2A4Z A;  2KN4 A;  2DZM A;  1KH0 A;  1E5W A;  4X57 B;  4TKN A;  4E71 A;  2DNF A;  4WIP A;  4QAY A;  2TSS A;  1PDX A;  2RPV A;  4IKG A;  1WH3 A;  5CHV C;  1F77 A;  1VD2 A;  2CJN A;  1LO5 D;  4J3O D;  1ET9 A;  1WI0 A;  1J7C A;  4K7S A;  4DBG A;  4JQW C;  4KGT A;  3DCG A;  3VR9 B;  1D6E C;  3N3K B;  2GBM A;  1TZ1 A;  5E6J A;  2KN5 A;  2REX A;  4GIV A;  2EKI A;  4ANX A;  2MRP A;  2O2V A;  2KWV B;  2GRI A;  1XLN A;  3AE8 B;  3LB8 C;  1V5O A;  4DHZ E;  3PHW B;  3H1U A;  2LVP A;  3C0R B;  1V8C A;  4HWI B;  3FIL B;  3Q8C A;  1KLV A;  4IOI E;  2PIA A;  4BKG A;  1NYR A;  3GOE A;  3TMP B;  2FCS A;  1I4H A;  2A5U A;  2KFK A;  4HK2 A;  1JCK B;  3H7S A;  3T8M A;  2NS5 A;  2M8S A;  1T3Q A;  3ECI A; 
#chains in the Genus database with same CATH homology
 2L52 A;  1B9R A;  1TS3 A;  1ZXI A;  1JWA D;  1JWM D;  2L32 A;  4JWS C;  1IUE A;  3P4S B;  5LNK 1;  3B2G A;  1WWT A;  4WUR A;  1KF6 B;  3PO0 A;  3R2T A;  5BYR A;  2WXF A;  1GB1 A;  1GOZ A;  3RFZ B;  4ZYS A;  4JE3 B;  4YWG G;  1L0Y B;  1OFF A;  1FNU A;  2BW2 A;  2MJ3 A;  1XLQ A;  3T3N A;  1N5W A;  2Y3A A;  3MP9 A;  2LUM A;  4AQ7 A;  3KQ4 A;  5C2T B;  3OWE B;  1K50 A;  2LGI A;  1I4P A;  3GS2 A;  2YEP F;  3P42 A;  3FIL A;  1EU4 A;  3W9C B;  5D3D A;  4RGM A;  2H89 B;  1SE3 A;  2ACZ B;  3AED B;  2IGD A;  3AE6 B;  1ESF A;  4HEA 1;  3VQI A;  2K9X A;  2V4I B;  3AH7 A;  1VR9 A;  2ON8 A;  1FNV A;  2W82 A;  2DYO A;  4L1B A;  3AE3 B;  1B1Z A;  1L4Z B;  3H8H A;  1SSN A;  2V0G A;  3MJ5 A;  3AE1 B;  1EU3 A;  1SJE D;  4YTP B;  1FD6 A;  3NUH B;  1ACC A;  3W1S A;  1KLG D;  1C79 A;  2KAC A;  1SEB D;  2OED A;  2NMQ A;  1Y56 A;  1NI3 A;  1FMA D;  1QKZ A;  2W3R A;  4RNA A;  1L5P A;  2BTE A;  1YJI A;  1QOB A;  2FE8 A;  1XXG A;  3AEF B;  1FFU A;  2AQ3 B;  2RMM A;  3IT6 B;  3AEG B;  4OW0 A;  2L1A A;  1M4V A;  3Q8F A;  3B9J A;  2WDV B;  3SFE B;  1UGJ A;  1JML A;  1HXY D;  1J7B A;  2Q5W D;  3URY A;  1R7S A;  3GP7 A;  3IXS A;  3O13 A;  4XDD A;  1C9F A;  4MM3 B;  1GPX A;  4LTU A;  1P7E A;  3B2F A;  4MH8 A;  1XCT L;  1EWC A;  3NVW A;  2EEL A;  1AW7 A;  2H88 B;  2BS2 B;  3AEE B;  3P4P B;  4MT5 A;  4YSY B;  1DOX A;  3AEA B;  2HDE A;  1C77 A;  4TMA B;  3BZD B;  2MJD A;  2PLP A;  2I38 A;  2N9K A;  2W54 A;  4NZL B;  4B0E A;  2M56 B;  1QOG A;  2PTL A;  1IGD A;  1NEK B;  1OQR A;  3SR6 A;  1HZ6 A;  2JXT A;  1JRO A;  2OHF A;  3Q69 A;  5HFY A;  1I4Q A;  4HJG E;  2LHD A;  3AE7 B;  1EM7 A;  2Z8L A;  2DLB A;  2WNM A;  2JYE A;  1DOI A;  2BB6 A;  2WXH A;  1HEZ E;  1CK1 A;  1CZP A;  4RCO A;  3TEX A;  3E56 A;  5T8I A;  2MH7 A;  2JX5 A;  2NTT A;  2LFI A;  3KWL A;  1V1O A;  5HHD G;  1SBB B;  2PMV A;  2IDY A;  3TUO A;  3AE9 B;  1JWB D;  3ZYY X;  1CJE A;  4A55 A;  1C76 A;  2G9H D;  1ET6 A;  5FK9 C;  1YN5 A;  2N9L A;  3KLS X;  1PYW D;  5AUK A;  4ARI A;  1JRP A;  1J7A A;  3Q8B A;  5H8Y E;  2BT6 A;  5BMG A;  4N6E B;  3TEY A;  4HKQ A;  3P1M A;  4NJC A;  1VZ7 A;  2JU6 X;  2B76 B;  3HUI A;  5HI1 A;  1FO4 A;  1FEH A;  1ZOY B;  4NAW B;  2JWU A;  4KKI A;  4ZHP A;  2X38 A;  3SFD B;  1SJH D;  1BUI C;  1V1P B;  1RFK A;  2ZW0 A;  2WLB A;  2INP E;  3TEW A;  2DWQ A;  1XF5 L;  2MEK A;  1C4A A;  1OQQ A;  4L23 A;  4ITK A;  3ZGZ A;  2BB5 A;  3ZJT A;  3PZ7 A;  3AE2 B;  2AX5 A;  5BYQ A;  4N59 A;  1ZPS A;  1SF0 A;  1WSP A;  4YSZ B;  1IBX B;  1TZO A;  3ABV B;  3R8B A;  1PGX A;  3SEB A;  1MHH E;  2WU2 B;  1GB4 A;  1STE A;  2JYT A;  2M19 A;  2QEJ C;  3VRB B;  1C4C A;  4N58 A;  4OHJ A;  1UUP A;  2WU5 B;  1AYF A;  1FRR A;  1TS2 A;  3E9S A;  1N61 A;  2WXM A;  2RDH A;  1T5X D;  4PT5 A;  2WDR B;  5BMH A;  1WRI A;  1E10 A;  1I4X A;  1SB3 C;  2XNA C;  1QOA A;  3DWG C;  5EE3 A;  2VZK B;  3W5U B;  4OZB A;  2GB1 A;  4A90 A;  1FXA A;  5FR3 A;  1FFV A;  1ROE A;  1VLB A;  2K0P A;  3P63 A;  3HVD A;  1YN4 A;  1YQ4 B;  1TY0 A;  1V1P A;  2ONQ A;  1WXQ A;  2W3S A;  1V97 A;  3AB5 A;  4USA A;  4XDC A;  4TSS A;  1E7P B;  2N7J A;  5AUI A;  1PFD A;  3AE5 B;  4KGR A;  5FKA C;  4JPS A;  3MC0 B;  4RF0 A;  1TKG A;  4R3D A;  1IGC A;  3LYY A;  3AV8 A;  4RFB A;  1GAQ B;  1YJJ A;  1BXT A;  1HZ5 A;  2YEP B;  1BML C;  3RPF C;  2BS3 B;  1D4B A;  1IBX A;  2FUG 1;  1ZE3 D;  3FAH A;  2LEK A;  1F2R I;  1YNT E;  4CQN A;  2JQR B;  1ZP0 B;  1F2R C;  2M0A A;  3BII D;  5D7G A;  4FXC A;  1MHX A;  1TS4 A;  2WXL A;  1I4R A;  1P7F A;  4WQM A;  3J9C A;  4GDK B;  2WQY B;  2BBC A;  1JAL A;  1XLO A;  3IAS 1;  3VR8 B;  1A70 A;  5D3I B;  1TKY A;  1UNS A;  2J53 A;  1HQR D;  3MFG A;  4KX6 B;  4DXF A;  2I2Y A;  1I7H A;  3U7Z A;  3IT4 B;  1JW9 D;  2IGH A;  1NVI D;  1K51 A;  1XCQ L;  2RDG A;  4XWW A;  2WXJ A;  4C7Y A;  3MHZ A;  4ZOH C;  4RGT A;  1QOF A;  2WS3 B;  3LXF A;  2WP9 B;  4AS1 A;  1Q10 A;  3FC4 A;  3V05 A;  3NVV A;  1FRD A;  4WWM A;  2IPK D;  4NAM A;  1VJK A;  2V3P A;  4OZA A;  3ZJV A;  1VZ8 A;  4MAC A;  4RF1 A;  1FXI A;  2G1E A;  2MJE A;  3AEB B;  1FCL A;  2PVG C;  4DQO C;  2LHE A;  1L4D B;  2KWD A;  4YXD B;  2WDQ B;  1ENF A;  1C4P A;  2DYM A;  4EE2 A;  4YSX B;  3BVG A;  3I57 A;  2KAJ A;  3TSS A;  3Q8A A;  4WAF A;  4KGS A;  1QLB B;  3W2D A;  4LLG M;  5I4D A;  1WYG A;  4L2Y A;  1TKE A;  2BYT A;  2QIL A;  2D5G A;  2KMM A;  2CJO A;  1QQR A;  1XO3 A;  2J52 A;  2KDM A;  2E3T A;  3L4P A;  1MVK A;  2PKO A;  1FIQ A;  1VZ6 A;  2W55 A;  4YTM B;  4KKJ A;  2NTS A;  3EGR A;  1PGA A;  4XWT A;  1RYJ A;  4RGO S;  4ARC A;  1N60 A;  4RH6 A;  4LK0 M;  1I4G A;  2VZK D;  3UI3 A;  2WXR A;  3AN1 A;  3AEC B;  2WXK A;  4TQ0 A;  3WCQ A;  3TEZ A;  2LJI A;  1TJE A;  1FCC C;  2JZP A;  4C56 C;  2WXI A;  2J4X A;  2JSV X;  3ZJU A;  1L6U A;  1FM0 D;  2AQ1 B;  1NEN B;  2QJL A;  1SXT A;  2PVO D;  3HVZ A;  2ICI A;  4US8 A;  3BK1 A;  4XE0 A;  4YTN B;  5BMI A;  2WXO A;  1XLP A;  2GI9 A;  3ETR A;  3U2S C;  3W5V B;  1SE2 A;  2WXG A;  4P6V F;  1JWS D;  3ZQ4 A;  1FNW A;  4REZ A;  2BS4 B;  1KFY B;  1TYG B;  4IDI A;  1E0Z A;  5BYS A;  1ZDV A;  2Y5P A;  2WXQ A;  2ZW1 A;  5MPO A;  1NYQ A;  1AWD A;  1N5X A;  3EUB 2;  1ZDX A;  2J42 A;  3U52 E;  1QT9 A;  3BVZ A;  1D5M C;  1WGK A;  3U4E G;  3T3O A;  2R61 A;  4HRS A;  4ZRQ A;  1KRH A;  2E6X A;  4Q2J A;  4GDL B;  1E9M A;  2WXN A;  4JWU C;  1ZUD 2;  4H2A A;  1TS5 A;  1ZXH A;  4ZHO A;  1UWM A;  2L83 A;  1QF6 A;  3DWM A;  1VDV A;  3NS1 A;  5EE1 A;  4HRO A;  3C8Y A;  1RM6 C;  1K52 A;  1L6V A;  1HA5 A;  1D5Z C;  3P4R B;  3NVY A;  1JWU D;  2K3U A;  3V3X A;  2K22 A;  4A9A A;  1N62 A;  3BWU D;  2FBW B;  3AM9 A;  5C3J B;  3GB1 A;  3EA6 A;  3R2I A;  4US9 A;  2N0S B;  2AQ2 B;  1YQ3 B;  3KWV A;  3I9V 1;  1QIL A;  2KN4 A;  2DBY A;  1K53 A;  4TQ1 A;  3NVZ A;  5H92 C;  1KH0 A;  2V3N A;  1JQ4 A;  4GLS C;  4HKZ E;  5JXV A;  2CU3 A;  1C78 A;  4WIP A;  4C7Z A;  4OVZ A;  3CIR B;  1DOY A;  3P4Q B;  2TSS A;  1RWS A;  1PDX A;  2RPV A;  3AE4 B;  3NRZ A;  4IKG A;  1YMH E;  1F77 A;  2INN E;  1CQV A;  4WH4 A;  2LMC A;  1EWY C;  1AN8 A;  2CJN A;  1LO5 D;  3IAM 1;  4J3O D;  1KLU D;  1ET9 A;  4A8X C;  1J7C A;  4M0W A;  2HTM E;  1XEE A;  4P16 A;  4KGT A;  3N9Y C;  3CWI A;  3VR9 B;  1PGB A;  3VRA B;  1D6E C;  1TY2 A;  1SE4 A;  4YT0 B;  5E6J A;  1L0V B;  1MPE A;  1E6E B;  5GXG B;  3BYY B;  2EKI A;  5HG2 A;  1KTK A;  5G5H A;  3PZ8 A;  4ZRP A;  4RGN A;  4UDU C;  2GRI A;  1XLN A;  2KQ4 X;  2SAK A;  3AE8 B;  3BYT B;  3LB8 C;  1VRA B;  3BK2 A;  1UWX A;  2QSD A;  3AMZ A;  1N63 A;  2WXP A;  3BVM A;  4A6Q A;  4DXG A;  2QIE B;  2Y5C A;  1T6B X;  4O1N A;  2IGG A;  1V8C A;  3FIL B;  1MI0 A;  2QMT A;  1SIJ A;  3Q8C A;  1DGJ A;  2PW9 A;  5EE9 A;  4C80 A;  5EE0 A;  4IOI E;  2PIA A;  2IJ0 A;  2K5P A;  1NYR A;  1F0Z A;  5G5G A;  3NZ3 A;  1L0X B;  2SEB D;  3HRD D;  4JX1 C;  1I4H A;  1PUT A;  1YN3 A;  1JCK B;  2XN9 C;  4B0M A;  3Q8E A;  5TSS A;  4D2K A;  1D5X C;  1T3Q A;  4OZC A;  1DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...