1P7FA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
molecule keywords Immunoglobulin G binding protein G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7fA00
2IGHA 1P7FA 2IGGA 4KGTA 2IGDA 2N9KA 4OZCA 1IGCA 4OZAA 1YNTE 4KGRA 3MP9A 1MHHE 5HG2A 1MVKA 3GB1A 1K51A 2EELA 2J53A 1MPEA 2ON8A 1HZ6A 2KDMA 2LHDA 5BMHA 2JU6X 2I2YA 2QSDA 4IKGA 1C9FA 2GI9A 1D4BA 1HZ5A 1IBXB 4KGSA 1YMHE 2PLPA 2JXTA 2GB1A 2I38A 4MACA 5HFYA 4OZBA 1MHXA 2JZPA 1Q10A 4D2KA 1UWXA 1XF5L 1GB4A 4WH4A 2K0PA 2LUMA 4HKZE 3FILB 3FILA 1K52A 1PGXA 2PTLA 5BMIA 1GB1A 2LGIA 2ONQA 1PGAA 5BMGA 1PGBA 3V3XA 1KH0A 2OEDA 1FCLA 1XCTL 2JWUA 2KACA 1K53A 1EM7A 1JMLA 2JSVX 5HHDG 1ZXHA 5HI1A 1F2RC 1XCQL 1IGDA 2RMMA 2PW9A 4GLSC 1F2RI 2J52A 2KWDA 2LHEA 5JXVA 2QMTA 1P7EA 2RPVA 2NMQA 2N7JA 2ZW1A 1HEZE 4IOIE 1FCCC 1FD6A 1IBXA 2KN4A 1MI0A 2N9LA 3UI3A 4HJGE 1K50A 1QKZA 2KQ4X 2ZW0A
chains in the Genus database with same CATH superfamily
4PS8A 3EFUA 1NI3A 3JSVB 3IXSA 1ZP0B 4RMAA 2M0XA 3P4SB 2L32A 3VR9B 1MHHE 4II3B 2C7HA 2QJLA 4BZAA 1K51A 2JUOA 1E5WA 2LMCA 1JQ4A 2I2YA 3SU8X 4B6WA 4Q2JA 1C4PA 4WAFA 2HJ8A 4KGSA 1VZ8A 4N6EB 4WQOB 2SEBD 3Q8FA 4KVGB 1FEHA 4PS3A 4MEMA 2LI5A 2G45B 1FIQA 4IG7B 3ML9A 1TKGA 1VD2A 2N0SB 2B3AA 3O13A 3TCAA 2D3GA 4XWTA 3UIPB 3HVZA 3I3TB 1KH0A 1E0ZA 3PGEA 1C79A 1XCTL 3MC0B 3A4SC 2CJOA 1TIFA 3PV1A 1P3QU 2K6QA 3B0AA 2BYEA 3AECB 4URKA 1KF6B 1WM3A 4W9CA 4FBJB 3APCA 1KOTA 3MHZA 2FIFA 2A5UA 1ZDVA 3AE4B 5DCNA 2ZPYA 1QOAA 4XX5A 3P4QB 1D3ZA 3AULA 1KLGD 1FCCC 1WJUA 2KMAA 2KK8A 2MJ3A 4NY0A 4EFOA 2C5LC 3AE3B 4R3DA 4M8NA 1I7HA 3DCGA 3UGBB 3AE7B 3RFZB 4BFRA 2N7DA 1E7PB 1L7YA 2LVQA 1F0ZA 3MC9A 4OZAA 3FC4A 1QLBB 4JWUC 2IO0B 2J53A 2MSED 4MSQB 1PYWD 2YEPB 2ZZPB 2LFIA 4ZRPA 1C9FA 2W54A 5IKCM 4MACA 2KX0A 3OWEB 3W1SC 1V8CA 3AE2B 2ZVNA 3SHQA 1OTRB 1UNSA 2IY1B 4USAA 1TY2A 2UYZB 1DYQA 3MTNB 3W5VB 4YTMB 3NZ3A 3RNFC 3QK0A 3VAWA 2L8JA 1ENFA 4MGYE 4P6VF 3ENEA 2M19A 3Q3OC 4US8A 1YQ4B 4HKQA 1KFYB 1SB3C 1XLPA 4P7IA 4LTUA 2EKEC 3U4EG 1Z5SB 4MELA 1GAQB 4GXBA 4L2YA 4NZLB 2D3AA 4YT0B 3P4PB 3V60A 4J6IA 3NZUA 4GLSC 5IAAC 3NRZA 2ZCBA 2L00B 2ZW1A 4TV3A 3RULA 3RNBC 1I4PA 2KT7A 1FXIA 1YQ3B 4ZDVA 1LFDA 5JHBA 1UUPA 1WI0A 3AEDB 1WF9A 2LVOA 2CHXA 1UD7A 4ASWC 4ZRJA 4YSXB 1WRIA 2OOBB 5IOIA 4HPMB 4AUQC 4KGRA 4MM3B 2BPSA 4P1BC 3QARA 3W1YA 3OLMD 2IYDB 4BBNC 1ACCA 2K25A 1UBQA 3LB8C 1YN3A 1T0RC 5T8IA 4DDID 1YOVB 1OEYJ 3BVGA 2KQ7A 5H92C 3CF6E 3QAQA 2LRUA 3TEXA 2WXGA 5C23A 3UQAA 1EF5A 2M1MA 4OZBA 2KLCA 2KTFA 3ZDMC 4JQWC 3I63C 4WH4A 3QJZA 2KVRA 3KUZA 5LLIA 1F77A 5TR5A 3DHGC 3VHTC 5GMVA 1E6EB 4FJZA 3DBLB 4NNJB 2K1FA 2W82A 1HA5A 3Q3NC 1LM8B 3RCZA 3NVYA 1EUVB 3VDZA 4TQ0A 3Q8AA 1FXAA 5DPWA 2IJ0A 3EGRA 3ZJUA 3RNAC 3C19A 4B0MA 2WXOA 2WU5B 1TTNA 1JWMD 4ANWA 1E90A 4RM8A 3AE6B 4P1CC 1K8RB 1C76A 2N9LA 4LNKA 3OAWA 3NZSA 1NI2A 1JCKB 2GBMA 5BO4B 1F9JA 3ZDTA 1OFFA 2ZW0A 2GRIA 1J7AA 1R4NB 3KYDD 2BF8B 2RPQA 3BIID 2BVCA 2KC2A 3TIXA 2WX0A 1WE6A 3LYYA 1A70A 2ICIA 1MPEA 4A90A 2MP2A 3WAPA 3ABVB 4ARIA 2LASA 2YVCA 1HZ5A 3B2FA 4K7UA 3V6EB 2CHZA 4L1BA 2I1JA 2KVZA 1TBEA 3BYTB 2L52A 2MW5A 3TUOA 5BMIA 2Q5WD 2J0JA 2LXAA 2MQJA 4ZRQA 3T3NA 5FR3A 1RFAA 3A33B 3AH7A 4I6NB 1AYFA 5KHOA 3P4RB 2KACA 1ET9A 4WJNA 1CJEA 3NVVA 4C7ZA 2IO3B 2PMVA 1ZKHA 2NVUI 4WJPA 1V5TA 2FUHB 2ZNVC 1ZXHA 3N3KB 1JRUA 3TBLD 3BY4B 3PZ8A 5BYRA 2ZJDA 4KX6B 1LO5D 3ML8A 1R4MB 2M56B 2KWCA 2IO1B 2W3RA 3IHPC 1X1MA 2J52A 3SFEB 1P7EA 4JGHB 1YIWA 4WIPA 3ZXVA 2NBWB 2IDYA 4J3OD 4I6LB 2B76B 4HDQA 3WA0A 4KIKA 3DWGC 4H2AA 3OJ3A 2LGXA 4B0EA 3IAM1 2NBVB 1MJDA 4FHJA 2RDBC 1T3QA 2MRPA 3IT4B 4KZCA 2MJEA 1QOGA 2BKRB 4FN2A 3PSEB 3AU5A 4F1SA 2XBBC 4LJPB 3Q6BA 1WGGA 4ZHPA 2ZCCA 2KZRA 1KJTA 4M00A 1M4VA 2HTHA 3W1SA 2BWFA 4A3OA 3RUIB 2J0KA 2PVGC 2X8XX 2KNBA 5IP4D 2JPHA 2GB1A 3EUB2 3HVDA 5FK9C 4NQLB 3ZXRA 1DOXA 1XF5L 3H9DA 2K0PA 3RZFA 4WQMA 3Q69A 3Q14C 2KFJA 2BT6A 4DHJB 2J0MA 4W9IA 1AN8A 5D2MB 3DHIC 3WIMA 3BYYB 3AV8A 2MWSB 4CQNA 2RSUA 2VH1A 3P1MA 4M0WB 4CO7A 4GDLB 4W9FA 4HCPB 1I4RA 1NENB 2JX5A 2PEAA 2DNFA 5L95C 4M02A 1STEA 1CMXB 2GBNA 3GS2A 1ZGUB 2Y5CA 1I4XA 2EMSA 3IVFA 5AZHA 2G4DB 2N1VA 3X0WA 2NCNA 3CSTA 4ZYSA 4RGOS 1UH6A 1VJKA 4PT5A 4LNIA 3PRMB 2TSSA 3VUXA 2WYQA 2WXKA 1QKZA 3DVGX 1TS2A 4NAMA 4GOCA 1L2NA 1XLQA 1H8CA 4G0NB 4HDOA 4GGQA 2IGGA 3SFDB 1WMHB 1YJ1A 1J8CA 1SIFA 1SSNA 3AEBB 4IUMB 1N62A 3UINB 1EO6A 2V3SA 5JH5C 4RCOA 1N63A 3R2IA 2K5PA 3B2GA 2KWVB 2JRIB 2WXPA 3J9CA 5D94A 1HTQA 2PLPA 4DHZE 3MJ5A 4LCDE 3VRBB 3CMMB 4JWSC 3DBLI 1GB4A 1QILA 1P1AA 3VVWB 1HE8A 4EZLA 5JZEB 3SR6A 1E8ZA 4MJSB 1YX5B 4YXDB 4YL8A 3RMKC 1NYRA 3RZWC 2EMTA 4L23A 3PT2B 2M17A 2VZKD 2QCZA 3QWZB 4FJYA 4N9F4 4IM0A 1FRDA 1S1QB 1FPYA 3VRAB 3OJ4B 2KDFB 3Q3FA 3ZLZA 2GMIC 1YQBA 4A55A 4EZJA 4XZ4A 4OVZA 1F1HA 2JXXA 1L0VB 1UWMA 1WGYA 1HTOA 5AZGA 1FXTB 2LZ6A 2Y3AA 2R61A 1JW9D 3TEYA 1RLFA 4W9EA 1ROEA 2D07B 1BT0A 4K7WA 2REXA 4MGKE 4HRSA 5FR6A 2GBKA 2Y5BB 3DDCB 1P7FA 2KLGA 4ANVA 4DQOC 2BYFA 1KTKA 3ZJTA 2W55A 2N9KA 2INCC 4OZCA 2WP9B 2HJ1A 1IGCA 1GG3A 3Q3JA 1DOYA 2MHJA 4GMVA 4KSKC 3PZ7A 3ZIMA 4W9DA 3ZQ4A 3ONSA 2O6VB 5EE3A 1WGRA 2M0AA 1V81A 2EKIA 2JZPA 2LJIA 3FILA 3ZUNA 3MC8A 5G55A 5AZFA 2FAZA 2LGIA 4IM2A 3DVNU 1L0YB 4M0WA 2ZPNA 4CYEA 5BYSA 1FCLA 3L4PA 4A6QA 1U4AA 1K53A 3AB5A 2C7MB 2LUEA 1TKEA 4MSMB 3K9OB 2AYOB 3M3JA 3HIZA 1I35A 2D11A 1VDVA 3WAOA 2ACZB 1GOZA 3A9JB 2KKCA 3KH0A 3PLVA 3SEBA 3HHMA 3QCAA 3WAMA 4W9HA 1SE2A 4NQKE 2WXRA 3U7DA 1BUIC 2JWZA 4RF1A 4W9LA 1WXVA 2BYTA 2QMTA 2W3SA 3N1ZC 2XK5A 4FLHA 1JALA 1RM6C 4WJQA 2V4IB 4EUTA 2FE8A 3I57A 5EE0A 3Q8BA 1GC7A 1RFKA 1H4RA 3KLSX 1E7VA 4XDDA 4G50A 3HUIA 2N9EB 4K81A 2MBBB 1YD8U 2K8HA 2BB6A 2RR9A 2C7NB 4BKGA 2NBUA 4AJYB 2KHWB 3DQVA 3KYCD 1YNTE 1P98A 2CU1A 3M95A 3MP9A 3NUHB 4RF0A 3L17A 2FCSA 2JU6X 2BWES 3CIRB 3AEGB 3PPAA 3DBHB 3BINA 5TSSA 3NVZA 4A20A 1WWTA 1MHXA 1Q10A 4D2KA 5C1ZA 2LXCA 1E10A 4HXDA 3H7SA 2L7RA 2IPKD 1VR9A 2H88B 1JWAD 2FBWB 3RNGC 1C3TA 4HEA1 4KSLC 2JY6A 5D3DA 5AUKA 2WDQB 2MBQA 1WGKA 4DXFA 2XK5B 3TJPA 2NR2A 2KDEB 1LXDA 1TKYA 4XGAB 5CX3A 3H8HA 4JL9A 2QHOA 2AX5A 3R2TA 3U52E 4BOZB 5AUIA 3P42A 2WS3B 3IAS1 2WXLA 1VLBA 2K6DB 2OJWA 4BKSA 3H7PB 3RN9C 1MI0A 4EEWA 2LGSA 2KJRA 1T0SC 2W9NA 2WDRB 2V9HA 3PVLA 2QDFA 1N5WA 2KJ6A 1B1ZA 1SXTA 1R4NI 2PJHA 1JWSD 2QC8A 1RRBA 1YJIA 5H8YE 4YSYB 3UF8A 4GU2A 2DENB 2G9HD 1CK1A 4HK2A 2DZIA 4KKJA 2NTTA 4C7YA 2N1WA 2BS3B 3RT3B 2KMMA 2ZVOA 4AP4C 2AQ2B 1QOFA 4IKGA 4K3CA 2GI9A 2NS5A 2JRHA 4ZRIA 1WZ0A 2WLBA 2XNAC 3VTVA 2RGFA 1FNVA 1WZ3A 3CSFA 2I38A 4W9JA 4GDKB 4AOFA 4RFBA 2C60A 4MH8A 1GPXA 1E9MA 1EWYC 1PDXA 3DWMA 5LXIB 1EU3A 4B95A 2BYVE 3HRDD 3FILB 3JW0X 2DZMA 5D3IB 3NY5A 1XO3A 4G11A 4G3XB 1PGBA 3U2SC 3GZNI 2G4SA 4ICVA 3V62A 3B08A 1L6VA 5BYQA 1D5ZC 2KX3A 3BWUD 3BK1A 2FCNA 2J4XA 5KHQA 1WX8A 4EOYA 2IZVB 5HHDG 2JSVX 4NJCA 2XN9C 5HI1A 3N32A 5G5HA 1J0GA 3ZO5B 2IY0B 3ZNGC 4XE0A 3N9YC 2WX1A 1TZ1A 2DHZA 1G6JA 4II2B 2AL6A 2K8BA 1D6EC 2PPHA 1HEZE 1V86A 2JYEA 4S17A 4K1RB 1UBIA 1V1PA 4N59A 3Q2AC 1JWUD 3UI3A 1GJZA 4ANUA 1C77A 1V6EA 4GDKA 4HVBA 3MJWA 3K9PB 4LNOA 1OQRA 3L10B 4IWOA 4RGNA 1TS4A 1OEYA 3EA6A 4W9KA 2FIDA 3R8BA 1SJHD 2KANA 5IA7A 4TQ1A 1T6BX 1UGMA 3L08A 2DAFA 2KFKB 3RNEC 2WXNA 4JPSA 1I42A 2MBOA 1FFVA 3U30A 1HZ6A 4PK1A 2D10A 2KDBA 4NJ6A 1WRDB 5AEKB 3LDZE 1JROA 2L0TA 2AQ3B 4WWMA 5L83A 5C2TB 1WR6E 4HROA 3M63B 2MCNB 5GXGB 1QZEA 1VRAB 5HFYA 4JLCA 4EKUA 3PHWB 1YN4A 2I1KA 2M4NA 2UU7A 2CR5A 1FNWA 4S0RA 4XC2A 1K52A 1PUTA 4OVVA 1RWSA 4DHJD 4FXCA 4NAWA 1ESFA 2AEHA 1KLVA 2LWPA 1FRRA 3H1UA 3U7ZA 2KC1A 3W5UB 3HK0A 4PYZA 2D3CA 3GZNB 2O2VA 1MG8A 3C0RB 1GC6A 2MLBA 3ETRA 1I4HA 4HWIB 1E8XA 3NS1A 2D2QA 1WJ4A 2QILA 1L4DB 4PYUA 1SGHA 2DYBA 4DBGA 2MH7A 4C4VB 1N60A 4F8CB 4NJ7A 4TSSA 1XD3B 3SD5A 4BOSC 5I4DA 1Q0WB 2J42A 2NPTA 2R2OA 1VZ6A 1P9DU 5EDSA 4E74A 3M62B 4K7SA 1QOBA 1WJNA 3IG3A 2IBIB 1J19A 2KMCA 4HJKA 2G3QB 2WDVB 3C8YA 4AJWA 1VZ7A 4KV2A 2L0FA 3ECIA 4BKTA 3P63A 1WE7A 4B9KA 4X57B 3ALBA 2GOWA 2AWTA 1D4BA 1SJED 1IBXB 5E6JA 3ZVVA 1WYGA 1E7UA 1SE9A 2MBHA 4MGIE 3EFCA 4US9A 3D32A 3NHEB 1E8YA 2DBYA 3R3MA 3N1YC 1DOIA 5CHWA 4UDUC 3KUCB 1PGXA 2KN5A 3R7RA 1GB1A 2PIAA 3KQ4A 2WXQA 1E8WA 2CHWA 4MDKE 1I4QA 1WX9A 5DPTA 3URYA 3L0WB 1P0RA 1PQSA 1ZW7A 2MA9B 4AWJA 4KIKB 1XQQA 2LGYA 1V9JA 3V61A 5CHVC 4FADA 1IUEA 1EU4A 1NYQA 2E6XA 3DVNV 1F2RC 2LEKA 2BQQA 1MFWA 5E6PA 3NG0A 3PZDA 2INPE 3BVZA 5CTRC 2LHEA 2L05A 4JX1C 2WXMA 3Q8EA 4DXAB 3ZRFA 4TUUA 1SEBD 2Z0DB 5E6NA 1L4ZB 2RDGA 3P2BA 4KDIC 2WXJA 2JT4B 4ZHOA 4NPNA 2KD0A 3UIOB 4C00A 3APDA 2WWZA 1CZPA 2L83A 2BGFA 1XXGA 2N7EA 2X38A 4M01A 2KYWA 1AW7A 2KDMA 3TSSA 5D6JB 5BMHA 3QC8B 1Q5WB 2V3NA 3BVMA 1Q1OA 3DHHC 1NVID 2WGSA 3A9KA 2CS4A 4DHZB 5IO9A 2YLMA 2PE9A 3N1XC 3WCQA 1XEEA 2LUMA 3NS8A 3GOEA 2V0GA 1AARA 1RAXA 3APFA 1WX7A 2XEWA 4GIVA 5E6OA 5CHFA 2K3UA 1RYJA 3A9KB 4FHKA 2PVOD 1M94A 2KOXA 4ANXA 3VFKA 4REZA 2KWUB 3AEEB 1DGJA 3JSVA 2Z59B 1C4AA 3A1QA 3VUWA 3I9V1 1IP9A 4BAXA 1FO4A 1SF0A 2LRWA 4YSZB 3WALA 3AEFB 1OQYA 1L6UA 3GE8C 3VQIA 4MJSA 3HM3A 2RDHA 2RPVA 1J7BA 4ZRKA 2FNJB 4YWGG 3H6NA 2MBEA 1KM7A 1VCBA 2JYTA 2JZZA 3ZNHB 3ZJVA 2IGHA 2INDC 4GDLA 3VTWA 4CHKA 1Y56A 1FM0D 3AI5A 2CJNA 2IGDA 2DZKA 2KXJA 5JHAA 2LJ5A 3A1QB 3QX1A 2HE7A 2NTSA 3TEZA 1ZDXA 4IDIA 4DK5A 1SIJA 2EELA 3L13A 1XLOA 2DZJA 1D5XC 3AE5B 5IN7A 1L0XB 5MPOA 1F52A 4WWNA 1GUAB 2J7QB 3L54A 4KKIA 1BXTA 3B1LX 1YMHE 2JXTA 3KWLA 2AL3A 4BVUC 4JIOU 3S2AA 1UWXA 1Y8RC 3W9CB 1WSPA 1WY8A 1V80A 3ZNID 2KDIA 1R4MI 2BKFA 1NEKB 1ZXIA 1SE4A 3OG5A 2ONQA 1PFDA 3WANA 3VH3B 1ZOYB 1WM2A 1T5XD 2JVCA 3GE3C 2OEDA 1B9RA 2SAKA 2RD0A 3PLUA 1LQBA 5G5GA 1YN5A 2JWUA 2MJDA 2MP2B 4LDTB 1N61A 3LJ3A 3IBEA 1IPGA 4DWFA 1QQRA 1TZOA 4M8MA 4C56C 3AEAB 2CKHB 2KTRA 4HCNB 3PRPB 5J17A 1XLNA 1FFUA 1WIAA 2INNE 4IWQA 3QHTA 2K22A 4LNNA 4FJVB 1EWCA 4EE2A 4OVUA 3RD2A 4GB9A 2HDEA 2KQSA 1TY0A 4OW0A 2BB5A 2O6VA 1KLUD 1XT9B 4WJOA 3ZRCA 3DBSA 1EF1A 2DYMA 1FD6A 1IBXA 1GNUA 2WXIA 3AM9A 2BTEA 2KTRB 2V4LA 2PKOA 2BS2B 2K8CA 3AE1B 2HTME 1LGRA 1HQRD 4E71A 2LGDA 1V49A 3PO0A 1T0QC 1WXMA 4RGTA 4C4VA 3FKYA 4BBNF 3AE8B 1D5MC 3R7QA 3AXCA 3AMZA 5HG2A 2V3PA 1R7SA 3GB1A 4ZYNA 4DXGA 4W9GA 5FKAC 3ZYYX 3ZTDA 4FA6A 1NDDA 1I4GA 1ZUD2 2FUG1 2E3TA 2V1YA 4MGZE 2N4FA 2ASQA 2AQ1B 3VTUA 3B9JA 2OHFA 1C4CA 2MX2A 4DDGD 4HKZE 2L76A 3DVGY 3KWVA 4MH0E 3JYUA 2WXFA 3NVWA 5DPSA 1QF6A 4N58A 4C80A 1ZPSA 1A5RA 5EE9A 3TL5A 2N9PC 2K9XA 1UGJA 2A4ZA 3L16A 1WGHA 5J2RA 2VZKB 3AN1A 4GN1A 3KW5B 4ICUA 1EM7A 4KDLB 1V5OA 1JMLA 1WXQA 4IW0A 2GBRA 3FAHA 4LNFA 3I5JC 3TMPB 4TKNA 2RMMA 2PW9A 4TMAB 4KZ0A 3T8MA 3QQ8B 3IT6B 1N6ZA 2WHIA 2FCMA 3HM6X 5JXVA 3JVZX 2D3BA 3SDLC 3ZTCA 1IYFA 4IC7B 4MM3A 1CQVA 2KN4A 3KVFB 2NPTB 3TEWA 1UF0A 3VXWA 1HXYD 2H89B 1TGZB 1L5PA 2QEJC 2KQ4X 2JF5A 4F7ZA 3DBHI 1WJ6A 2JZ3B 4LLGM 3AE9B 3O65B 4KGTA 4HLEA 3T3OA 1ET6A 5HKHA 4XWWA 3V6CB 2YEPF 1MVKA 1NBFC 1JWBD 2BS4B 4A9AA 2ON8A 3QIJA 2LHDA 3EHVA 4A8XC 2QSDA 3R66C 1OGWA 2DWQA 1WXAA 2O6VD 2C9WB 4WURA 1YX6B 3UQBA 4WWOA 3U8ZA 1SBBB 2WXHA 4RH6A 4EZKA 2GLSA 2LVPA 3CWIA 3PHXB 1WH3A 4LK0M 3DPDA 1TYGB 3N30A 4LDTD 1WR1A 4IWPA 3V3XA 1UELA 2PE6B 2VH2A 2N9XA 4E3CA 1WFYA 3BZDB 4A3PA 5LNK1 1WYWB 3A4RA 2DAJA 3V05A 3LXFA 3ZKJC 3RI7C 2VRRB 1TS5A 4K3BA 1WMHA 4LJOB 3Q3MC 4ITKA 1SE3A 3DOWA 1C78A 4HPPA 3DBRB 3GP7A 2DYOA 3MFGA 4FULA 4RGMA 4YTNB 2G1EA 5J18A 1YJJA 2L1AA 4IOIE 4IM3A 2K39A 3VUYA 2WNMA 4P16A 1K50A 2Z0EB 4RM9A 3EECA 2DLBA 3VH4B 4ZOHC 4OHJA 3W2DA 1MG4A 2O2VB 2L3ZA 2KJHB 1TJEA 3N20C 1FMAD 4AS1A 4AQ7A 1ZE3D 3PS6A 4JE3B 1J7CA 2QIEB 3AU4A 4ACFA 1UZXB 3X23A 3ZGZA 2JQRB 2WU2B 1TS3A 2BBCA 3ZNZB 4O1NA 1BMLC 3RNCC 2IO2B 3E9SA 3Q8CA 4GSWA 4XYCA 4YTPB 2CU3A 5EE1A 3KUDB 1S3SG 3H7PA 4PS7A 5D7GA 4BKSD 1WGDA 3IFWB 3NJTA 2KO3A 2ZNVB 2WDTB 3NOBA 2M8SA 1C1YB 3E56A 1V97A 2PTLA 1PGAA 5BMGA 1Z2MA 2WQYB 1QT9A 1WXSA 2MEKA 2KFKA 3QA8A 2HD5B 2Z8LA 1TT5B 3EC8A 4RNAA 1ISNA 5G2NA 2DX5B 4ARCA 5LXHA 4MT5A 3PREA 3PRZA 4WWPA 3MHSD 4HPLB 1N5XA 3RYTA 1JRPA 2KAJA 1XCQL 2R2QA 5DPRA 1IGDA 1FNUA 2UWQA 4XDCA 2OJRA 2GBJA 1OQQA 1V1PB 1F2RI 3VR8B 3T9LA 3RPFC 4NAWB 2FCQA 3ZW3A 4QAYA 2ZEQA 4WAAA 5C3JB 1V2YA 2KWDA 3A9JA 1AWDA 2N7JA 2NMQA 2BW2A 3DBRI 2D5GA 1V1OA 2Y5PA 3PTFC 4HJGE 1T0YA 4I6PA 1KRHA 2LD9A 3BK2A
chains in the Genus database with same CATH topology
2IGHA 3IT4B 1T3QA 2MJEA 1B1ZA 1QOGA 1SXTA 1NI3A 1JWSD 1FM0D 1Y56A 2CJNA 2IGDA 3IAM1 3IXSA 1YJIA 5H8YE 4YSYB 1ZP0B 2G9HD 2NTSA 1CK1A 3TEZA 3P4SB 2L32A 3VR9B 1MHHE 1ZDXA 2QJLA 1K51A 4IDIA 1SIJA 4KKJA 2EELA 2LMCA 1XLOA 2NTTA 4ZHPA 1D5XC 4C7YA 3AE5B 1JQ4A 1L0XB 2BS3B 2KMMA 5MPOA 2I2YA 2AQ2B 1QOFA 1M4VA 4IKGA 4Q2JA 2GI9A 1C4PA 3W1SA 4KKIA 4WAFA 1BXTA 2PVGC 2WLBA 4KGSA 1YMHE 2XNAC 1VZ8A 1FNVA 2JXTA 3KWLA 4N6EB 2SEBD 3Q8FA 2GB1A 2I38A 1FEHA 3EUB2 3HVDA 5FK9C 1FIQA 1DOXA 4GDKB 4RFBA 1UWXA 1XF5L 3W9CB 4MH8A 1GPXA 1E9MA 1EWYC 1TKGA 1PDXA 1WSPA 2K0PA 2N0SB 3DWMA 1EU3A 3O13A 4WQMA 3Q69A 1NEKB 3HRDD 3FILB 1ZXIA 4XWTA 5D3IB 1SE4A 1XO3A 2ONQA 1PFDA 2BT6A 3HVZA 1ZOYB 1PGBA 3U2SC 1T5XD 1KH0A 1AN8A 2OEDA 1B9RA 2SAKA 1E0ZA 1C79A 1L6VA 3BYYB 5BYQA 1XCTL 1D5ZC 1YN5A 2JWUA 3MC0B 5G5GA 3AV8A 3BWUD 2MJDA 3BK1A 4CQNA 2CJOA 2J4XA 1N61A 3P1MA 5HHDG 1QQRA 2JSVX 1TZOA 4GDLB 1I4RA 1NENB 4NJCA 4C56C 2XN9C 5HI1A 3AEAB 2JX5A 3AECB 5G5HA 1KF6B 1STEA 1XLNA 1FFUA 3MHZA 2INNE 4XE0A 3GS2A 2Y5CA 1ZDVA 1I4XA 3AE4B 2K22A 3N9YC 1QOAA 1EWCA 4EE2A 3P4QB 2HDEA 1D6EC 1TY0A 4OW0A 2BB5A 4ZYSA 1HEZE 1KLUD 1KLGD 4RGOS 1FCCC 1VJKA 2JYEA 2DYMA 4PT5A 1FD6A 1IBXA 2MJ3A 1V1PA 2TSSA 4N59A 2WXKA 2WXIA 3AM9A 1JWUD 3UI3A 2BTEA 3AE3B 4R3DA 1C77A 1QKZA 1I7HA 1TS2A 2PKOA 2BS2B 4NAMA 3AE1B 2HTME 1XLQA 1HQRD 1OQRA 4RGNA 3AE7B 3RFZB 3PO0A 1TS4A 4RGTA 3EA6A 2IGGA 3SFDB 3R8BA 1SJHD 3AE8B 1E7PB 4TQ1A 1SSNA 1T6BX 1D5MC 3FC4A 4OZAA 1F0ZA 3AEBB 1N62A 1QLBB 3AMZA 5HG2A 4JWUC 2V3PA 1R7SA 2WXNA 4JPSA 3GB1A 4DXGA 2J53A 1FFVA 1HZ6A 5FKAC 4RCOA 1PYWD 1N63A 2YEPB 3ZYYX 3R2IA 2K5PA 3B2GA 2LFIA 1I4GA 4ZRPA 1C9FA 1JROA 2AQ3B 4WWMA 1ZUD2 2WXPA 3J9CA 5C2TB 2FUG1 2PLPA 4HROA 3MJ5A 2E3TA 2W54A 5GXGB 4MACA 1VRAB 3OWEB 5HFYA 2AQ1B 3VRBB 3B9JA 4JWSC 1V8CA 3AE2B 1GB4A 1QILA 1UNSA 1YN4A 2OHFA 1C4CA 1FNWA 4USAA 4HKZE 3KWVA 1TY2A 1K52A 1PUTA 2WXFA 3NVWA 3SR6A 1QF6A 1RWSA 1DYQA 4N58A 3W5VB 4YTMB 3NZ3A 4C80A 4YXDB 1ZPSA 5EE9A 4FXCA 1NYRA 4L23A 1ENFA 1ESFA 2K9XA 1UGJA 4P6VF 1FRRA 2M19A 3U7ZA 2VZKD 4US8A 1YQ4B 3W5UB 4HKQA 1KFYB 2VZKB 3AN1A 1SB3C 1EM7A 1XLPA 4LTUA 1JMLA 1FRDA 1WXQA 3U4EG 3VRAB 1GAQB 3ETRA 1I4HA 3FAHA 4L2YA 4NZLB 4A55A 4YT0B 3P4PB 3NS1A 2RMMA 2QILA 2PW9A 4GLSC 4OVZA 1L4DB 4TMAB 3IT6B 3NRZA 1L0VB 2MH7A 1N60A 1UWMA 5JXVA 4TSSA 2ZW1A 5I4DA 2Y3AA 2R61A 1JW9D 2J42A 1I4PA 3TEYA 1CQVA 2KN4A 3TEWA 1HXYD 1FXIA 1YQ3B 1ROEA 1VZ6A 2H89B 1L5PA 2QEJC 1UUPA 2KQ4X 3AEDB 1QOBA 4HRSA 4LLGM 3AE9B 1P7FA 4DQOC 4YSXB 4KGTA 1WRIA 1KTKA 3ZJTA 3T3OA 2W55A 2WDVB 2N9KA 3C8YA 4OZCA 1ET6A 2WP9B 1IGCA 1VZ7A 4KGRA 4MM3B 4XWWA 2YEPF 1MVKA 3P63A 1DOYA 1JWBD 2BS4B 4A9AA 2ON8A 3PZ7A 1ACCA 2LHDA 3ZQ4A 3LB8C 1YN3A 4A8XC 2QSDA 5T8IA 1D4BA 5EE3A 2DWQA 3BVGA 5H92C 1SJED 2M0AA 1IBXB 5E6JA 3TEXA 1WYGA 2WXGA 4WURA 4US9A 4OZBA 2EKIA 2JZPA 2LJIA 1SBBB 2WXHA 4RH6A 4WH4A 3CWIA 2DBYA 1DOIA 4LK0M 4UDUC 1F77A 1TYGB 3FILA 1PGXA 1GB1A 2LGIA 2PIAA 3KQ4A 1E6EB 2WXQA 1L0YB 4M0WA 3V3XA 1I4QA 5BYSA 3URYA 1FCLA 2W82A 3L4PA 1HA5A 4A6QA 3BZDB 3AB5A 1K53A 5LNK1 3NVYA 1TKEA 3V05A 1IUEA 3LXFA 1EU4A 1NYQA 1VDVA 4TQ0A 2ACZB 1GOZA 3Q8AA 1FXAA 1TS5A 2E6XA 3SEBA 2IJ0A 1F2RC 3EGRA 4ITKA 2LEKA 3ZJUA 1SE3A 1C78A 1SE2A 2WXRA 1BUIC 4B0MA 2INPE 2WU5B 2DYOA 2WXOA 3BVZA 3GP7A 3MFGA 1JWMD 4RF1A 2LHEA 3AE6B 2BYTA 4RGMA 4YTNB 2QMTA 4JX1C 2G1EA 2W3SA 2WXMA 1YJJA 2L1AA 4IOIE 3Q8EA 1C76A 1JALA 2N9LA 1RM6C 1SEBD 2V4IB 2FE8A 2WNMA 4P16A 1K50A 3I57A 1L4ZB 1JCKB 2RDGA 5EE0A 3Q8BA 1RFKA 2DLBA 4ZOHC 2WXJA 4OHJA 1OFFA 3KLSX 3W2DA 2ZW0A 2GRIA 4XDDA 1J7AA 3HUIA 4ZHOA 1TJEA 2BB6A 3BIID 1FMAD 4AS1A 1CZPA 4AQ7A 1ZE3D 2L83A 4JE3B 3LYYA 1XXGA 1YNTE 1J7CA 2QIEB 3MP9A 1A70A 2X38A 3ZGZA 3NUHB 2JQRB 2WU2B 2ICIA 1TS3A 2BBCA 4RF0A 1MPEA 4O1NA 1AW7A 4A90A 1BMLC 3E9SA 3Q8CA 2KDMA 3ABVB 3TSSA 5BMHA 2JU6X 4YTPB 2CU3A 3CIRB 4ARIA 5EE1A 3AEGB 1HZ5A 2V3NA 3BVMA 3B2FA 5D7GA 1NVID 5TSSA 3NVZA 1WWTA 1MHXA 1Q10A 4D2KA 4L1BA 1E10A 3WCQA 1XEEA 2IPKD 2LUMA 1VR9A 3BYTB 2H88B 2L52A 3E56A 2V0GA 1JWAD 1V97A 3TUOA 2PTLA 5BMIA 2Q5WD 1PGAA 2FBWB 5BMGA 2WQYB 4ZRQA 1QT9A 3T3NA 4HEA1 2K3UA 5FR3A 2MEKA 1RYJA 5D3DA 2Z8LA 3AH7A 2PVOD 1AYFA 4RNAA 5AUKA 3P4RB 2KACA 1ET9A 1CJEA 2WDQB 4ARCA 3NVVA 1WGKA 4MT5A 4DXFA 4C7ZA 2PMVA 4REZA 1ZXHA 1N5XA 3PZ8A 3AEEB 1DGJA 5BYRA 1JRPA 1TKYA 2KAJA 1LO5D 1C4AA 4KX6B 1XCQL 1IGDA 1FNUA 4XDCA 3H8HA 3I9V1 2M56B 1OQQA 1V1PB 1F2RI 3VR8B 1FO4A 3RPFC 4NAWB 1SF0A 2AX5A 3R2TA 3U52E 2W3RA 4YSZB 3AEFB 3P42A 5AUIA 1L6UA 2J52A 2WS3B 3IAS1 5C3JB 3VQIA 2KWDA 2WXLA 3SFEB 1P7EA 2RDHA 2NMQA 1AWDA 1VLBA 2N7JA 1J7BA 2BW2A 2RPVA 4WIPA 2D5GA 1V1OA 1MI0A 2IDYA 2Y5PA 4J3OD 4YWGG 4HJGE 2B76B 1KRHA 2JYTA 2WDRB 3DWGC 3ZJVA 4H2AA 4B0EA 1N5WA 3BK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGH A;  1P7F A;  2IGG A;  4KGT A;  2IGD A;  2N9K A;  4OZC A;  1IGC A;  4OZA A;  1YNT E;  4KGR A;  3MP9 A;  1MHH E;  5HG2 A;  1MVK A;  3GB1 A;  1K51 A;  2EEL A;  2J53 A;  1MPE A;  2ON8 A;  1HZ6 A;  2KDM A;  2LHD A;  5BMH A;  2JU6 X;  2I2Y A;  2QSD A;  4IKG A;  1C9F A;  2GI9 A;  1D4B A;  1HZ5 A;  1IBX B;  4KGS A;  1YMH E;  2PLP A;  2JXT A;  2GB1 A;  2I38 A;  4MAC A;  5HFY A;  4OZB A;  1MHX A;  2JZP A;  1Q10 A;  4D2K A;  1UWX A;  1XF5 L;  1GB4 A;  4WH4 A;  2K0P A;  2LUM A;  4HKZ E;  3FIL B;  3FIL A;  1K52 A;  1PGX A;  2PTL A;  5BMI A;  1GB1 A;  2LGI A;  2ONQ A;  1PGA A;  5BMG A;  1PGB A;  3V3X A;  1KH0 A;  2OED A;  1FCL A;  1XCT L;  2JWU A;  2KAC A;  1K53 A;  1EM7 A;  1JML A;  2JSV X;  5HHD G;  1ZXH A;  5HI1 A;  1F2R C;  1XCQ L;  1IGD A;  2RMM A;  2PW9 A;  4GLS C;  1F2R I;  2J52 A;  2KWD A;  2LHE A;  5JXV A;  2QMT A;  1P7E A;  2RPV A;  2NMQ A;  2N7J A;  2ZW1 A;  1HEZ E;  4IOI E;  1FCC C;  1FD6 A;  1IBX A;  2KN4 A;  1MI0 A;  2N9L A;  3UI3 A;  4HJG E;  1K50 A;  1QKZ A;  2KQ4 X;  2ZW0 A; 
#chains in the Genus database with same CATH topology
 4PS8 A;  3EFU A;  1NI3 A;  3JSV B;  3IXS A;  1ZP0 B;  4RMA A;  2M0X A;  3P4S B;  2L32 A;  3VR9 B;  1MHH E;  4II3 B;  2C7H A;  2QJL A;  4BZA A;  1K51 A;  2JUO A;  1E5W A;  2LMC A;  1JQ4 A;  2I2Y A;  3SU8 X;  4B6W A;  4Q2J A;  1C4P A;  4WAF A;  2HJ8 A;  4KGS A;  1VZ8 A;  4N6E B;  4WQO B;  2SEB D;  3Q8F A;  4KVG B;  1FEH A;  4PS3 A;  4MEM A;  2LI5 A;  2G45 B;  1FIQ A;  4IG7 B;  3ML9 A;  1TKG A;  1VD2 A;  2N0S B;  2B3A A;  3O13 A;  3TCA A;  2D3G A;  4XWT A;  3UIP B;  3HVZ A;  3I3T B;  1KH0 A;  1E0Z A;  3PGE A;  1C79 A;  1XCT L;  3MC0 B;  3A4S C;  2CJO A;  1TIF A;  3PV1 A;  1P3Q U;  2K6Q A;  3B0A A;  2BYE A;  3AEC B;  4URK A;  1KF6 B;  1WM3 A;  4W9C A;  4FBJ B;  3APC A;  1KOT A;  3MHZ A;  2FIF A;  2A5U A;  1ZDV A;  3AE4 B;  5DCN A;  2ZPY A;  1QOA A;  4XX5 A;  3P4Q B;  1D3Z A;  3AUL A;  1KLG D;  1FCC C;  1WJU A;  2KMA A;  2KK8 A;  2MJ3 A;  4NY0 A;  4EFO A;  2C5L C;  3AE3 B;  4R3D A;  4M8N A;  1I7H A;  3DCG A;  3UGB B;  3AE7 B;  3RFZ B;  4BFR A;  2N7D A;  1E7P B;  1L7Y A;  2LVQ A;  1F0Z A;  3MC9 A;  4OZA A;  3FC4 A;  1QLB B;  4JWU C;  2IO0 B;  2J53 A;  2MSE D;  4MSQ B;  1PYW D;  2YEP B;  2ZZP B;  2LFI A;  4ZRP A;  1C9F A;  2W54 A;  5IKC M;  4MAC A;  2KX0 A;  3OWE B;  3W1S C;  1V8C A;  3AE2 B;  2ZVN A;  3SHQ A;  1OTR B;  1UNS A;  2IY1 B;  4USA A;  1TY2 A;  2UYZ B;  1DYQ A;  3MTN B;  3W5V B;  4YTM B;  3NZ3 A;  3RNF C;  3QK0 A;  3VAW A;  2L8J A;  1ENF A;  4MGY E;  4P6V F;  3ENE A;  2M19 A;  3Q3O C;  4US8 A;  1YQ4 B;  4HKQ A;  1KFY B;  1SB3 C;  1XLP A;  4P7I A;  4LTU A;  2EKE C;  3U4E G;  1Z5S B;  4MEL A;  1GAQ B;  4GXB A;  4L2Y A;  4NZL B;  2D3A A;  4YT0 B;  3P4P B;  3V60 A;  4J6I A;  3NZU A;  4GLS C;  5IAA C;  3NRZ A;  2ZCB A;  2L00 B;  2ZW1 A;  4TV3 A;  3RUL A;  3RNB C;  1I4P A;  2KT7 A;  1FXI A;  1YQ3 B;  4ZDV A;  1LFD A;  5JHB A;  1UUP A;  1WI0 A;  3AED B;  1WF9 A;  2LVO A;  2CHX A;  1UD7 A;  4ASW C;  4ZRJ A;  4YSX B;  1WRI A;  2OOB B;  5IOI A;  4HPM B;  4AUQ C;  4KGR A;  4MM3 B;  2BPS A;  4P1B C;  3QAR A;  3W1Y A;  3OLM D;  2IYD B;  4BBN C;  1ACC A;  2K25 A;  1UBQ A;  3LB8 C;  1YN3 A;  1T0R C;  5T8I A;  4DDI D;  1YOV B;  1OEY J;  3BVG A;  2KQ7 A;  5H92 C;  3CF6 E;  3QAQ A;  2LRU A;  3TEX A;  2WXG A;  5C23 A;  3UQA A;  1EF5 A;  2M1M A;  4OZB A;  2KLC A;  2KTF A;  3ZDM C;  4JQW C;  3I63 C;  4WH4 A;  3QJZ A;  2KVR A;  3KUZ A;  5LLI A;  1F77 A;  5TR5 A;  3DHG C;  3VHT C;  5GMV A;  1E6E B;  4FJZ A;  3DBL B;  4NNJ B;  2K1F A;  2W82 A;  1HA5 A;  3Q3N C;  1LM8 B;  3RCZ A;  3NVY A;  1EUV B;  3VDZ A;  4TQ0 A;  3Q8A A;  1FXA A;  5DPW A;  2IJ0 A;  3EGR A;  3ZJU A;  3RNA C;  3C19 A;  4B0M A;  2WXO A;  2WU5 B;  1TTN A;  1JWM D;  4ANW A;  1E90 A;  4RM8 A;  3AE6 B;  4P1C C;  1K8R B;  1C76 A;  2N9L A;  4LNK A;  3OAW A;  3NZS A;  1NI2 A;  1JCK B;  2GBM A;  5BO4 B;  1F9J A;  3ZDT A;  1OFF A;  2ZW0 A;  2GRI A;  1J7A A;  1R4N B;  3KYD D;  2BF8 B;  2RPQ A;  3BII D;  2BVC A;  2KC2 A;  3TIX A;  2WX0 A;  1WE6 A;  3LYY A;  1A70 A;  2ICI A;  1MPE A;  4A90 A;  2MP2 A;  3WAP A;  3ABV B;  4ARI A;  2LAS A;  2YVC A;  1HZ5 A;  3B2F A;  4K7U A;  3V6E B;  2CHZ A;  4L1B A;  2I1J A;  2KVZ A;  1TBE A;  3BYT B;  2L52 A;  2MW5 A;  3TUO A;  5BMI A;  2Q5W D;  2J0J A;  2LXA A;  2MQJ A;  4ZRQ A;  3T3N A;  5FR3 A;  1RFA A;  3A33 B;  3AH7 A;  4I6N B;  1AYF A;  5KHO A;  3P4R B;  2KAC A;  1ET9 A;  4WJN A;  1CJE A;  3NVV A;  4C7Z A;  2IO3 B;  2PMV A;  1ZKH A;  2NVU I;  4WJP A;  1V5T A;  2FUH B;  2ZNV C;  1ZXH A;  3N3K B;  1JRU A;  3TBL D;  3BY4 B;  3PZ8 A;  5BYR A;  2ZJD A;  4KX6 B;  1LO5 D;  3ML8 A;  1R4M B;  2M56 B;  2KWC A;  2IO1 B;  2W3R A;  3IHP C;  1X1M A;  2J52 A;  3SFE B;  1P7E A;  4JGH B;  1YIW A;  4WIP A;  3ZXV A;  2NBW B;  2IDY A;  4J3O D;  4I6L B;  2B76 B;  4HDQ A;  3WA0 A;  4KIK A;  3DWG C;  4H2A A;  3OJ3 A;  2LGX A;  4B0E A;  3IAM 1;  2NBV B;  1MJD A;  4FHJ A;  2RDB C;  1T3Q A;  2MRP A;  3IT4 B;  4KZC A;  2MJE A;  1QOG A;  2BKR B;  4FN2 A;  3PSE B;  3AU5 A;  4F1S A;  2XBB C;  4LJP B;  3Q6B A;  1WGG A;  4ZHP A;  2ZCC A;  2KZR A;  1KJT A;  4M00 A;  1M4V A;  2HTH A;  3W1S A;  2BWF A;  4A3O A;  3RUI B;  2J0K A;  2PVG C;  2X8X X;  2KNB A;  5IP4 D;  2JPH A;  2GB1 A;  3EUB 2;  3HVD A;  5FK9 C;  4NQL B;  3ZXR A;  1DOX A;  1XF5 L;  3H9D A;  2K0P A;  3RZF A;  4WQM A;  3Q69 A;  3Q14 C;  2KFJ A;  2BT6 A;  4DHJ B;  2J0M A;  4W9I A;  1AN8 A;  5D2M B;  3DHI C;  3WIM A;  3BYY B;  3AV8 A;  2MWS B;  4CQN A;  2RSU A;  2VH1 A;  3P1M A;  4M0W B;  4CO7 A;  4GDL B;  4W9F A;  4HCP B;  1I4R A;  1NEN B;  2JX5 A;  2PEA A;  2DNF A;  5L95 C;  4M02 A;  1STE A;  1CMX B;  2GBN A;  3GS2 A;  1ZGU B;  2Y5C A;  1I4X A;  2EMS A;  3IVF A;  5AZH A;  2G4D B;  2N1V A;  3X0W A;  2NCN A;  3CST A;  4ZYS A;  4RGO S;  1UH6 A;  1VJK A;  4PT5 A;  4LNI A;  3PRM B;  2TSS A;  3VUX A;  2WYQ A;  2WXK A;  1QKZ A;  3DVG X;  1TS2 A;  4NAM A;  4GOC A;  1L2N A;  1XLQ A;  1H8C A;  4G0N B;  4HDO A;  4GGQ A;  2IGG A;  3SFD B;  1WMH B;  1YJ1 A;  1J8C A;  1SIF A;  1SSN A;  3AEB B;  4IUM B;  1N62 A;  3UIN B;  1EO6 A;  2V3S A;  5JH5 C;  4RCO A;  1N63 A;  3R2I A;  2K5P A;  3B2G A;  2KWV B;  2JRI B;  2WXP A;  3J9C A;  5D94 A;  1HTQ A;  2PLP A;  4DHZ E;  3MJ5 A;  4LCD E;  3VRB B;  3CMM B;  4JWS C;  3DBL I;  1GB4 A;  1QIL A;  1P1A A;  3VVW B;  1HE8 A;  4EZL A;  5JZE B;  3SR6 A;  1E8Z A;  4MJS B;  1YX5 B;  4YXD B;  4YL8 A;  3RMK C;  1NYR A;  3RZW C;  2EMT A;  4L23 A;  3PT2 B;  2M17 A;  2VZK D;  2QCZ A;  3QWZ B;  4FJY A;  4N9F 4;  4IM0 A;  1FRD A;  1S1Q B;  1FPY A;  3VRA B;  3OJ4 B;  2KDF B;  3Q3F A;  3ZLZ A;  2GMI C;  1YQB A;  4A55 A;  4EZJ A;  4XZ4 A;  4OVZ A;  1F1H A;  2JXX A;  1L0V B;  1UWM A;  1WGY A;  1HTO A;  5AZG A;  1FXT B;  2LZ6 A;  2Y3A A;  2R61 A;  1JW9 D;  3TEY A;  1RLF A;  4W9E A;  1ROE A;  2D07 B;  1BT0 A;  4K7W A;  2REX A;  4MGK E;  4HRS A;  5FR6 A;  2GBK A;  2Y5B B;  3DDC B;  1P7F A;  2KLG A;  4ANV A;  4DQO C;  2BYF A;  1KTK A;  3ZJT A;  2W55 A;  2N9K A;  2INC C;  4OZC A;  2WP9 B;  2HJ1 A;  1IGC A;  1GG3 A;  3Q3J A;  1DOY A;  2MHJ A;  4GMV A;  4KSK C;  3PZ7 A;  3ZIM A;  4W9D A;  3ZQ4 A;  3ONS A;  2O6V B;  5EE3 A;  1WGR A;  2M0A A;  1V81 A;  2EKI A;  2JZP A;  2LJI A;  3FIL A;  3ZUN A;  3MC8 A;  5G55 A;  5AZF A;  2FAZ A;  2LGI A;  4IM2 A;  3DVN U;  1L0Y B;  4M0W A;  2ZPN A;  4CYE A;  5BYS A;  1FCL A;  3L4P A;  4A6Q A;  1U4A A;  1K53 A;  3AB5 A;  2C7M B;  2LUE A;  1TKE A;  4MSM B;  3K9O B;  2AYO B;  3M3J A;  3HIZ A;  1I35 A;  2D11 A;  1VDV A;  3WAO A;  2ACZ B;  1GOZ A;  3A9J B;  2KKC A;  3KH0 A;  3PLV A;  3SEB A;  3HHM A;  3QCA A;  3WAM A;  4W9H A;  1SE2 A;  4NQK E;  2WXR A;  3U7D A;  1BUI C;  2JWZ A;  4RF1 A;  4W9L A;  1WXV A;  2BYT A;  2QMT A;  2W3S A;  3N1Z C;  2XK5 A;  4FLH A;  1JAL A;  1RM6 C;  4WJQ A;  2V4I B;  4EUT A;  2FE8 A;  3I57 A;  5EE0 A;  3Q8B A;  1GC7 A;  1RFK A;  1H4R A;  3KLS X;  1E7V A;  4XDD A;  4G50 A;  3HUI A;  2N9E B;  4K81 A;  2MBB B;  1YD8 U;  2K8H A;  2BB6 A;  2RR9 A;  2C7N B;  4BKG A;  2NBU A;  4AJY B;  2KHW B;  3DQV A;  3KYC D;  1YNT E;  1P98 A;  2CU1 A;  3M95 A;  3MP9 A;  3NUH B;  4RF0 A;  3L17 A;  2FCS A;  2JU6 X;  2BWE S;  3CIR B;  3AEG B;  3PPA A;  3DBH B;  3BIN A;  5TSS A;  3NVZ A;  4A20 A;  1WWT A;  1MHX A;  1Q10 A;  4D2K A;  5C1Z A;  2LXC A;  1E10 A;  4HXD A;  3H7S A;  2L7R A;  2IPK D;  1VR9 A;  2H88 B;  1JWA D;  2FBW B;  3RNG C;  1C3T A;  4HEA 1;  4KSL C;  2JY6 A;  5D3D A;  5AUK A;  2WDQ B;  2MBQ A;  1WGK A;  4DXF A;  2XK5 B;  3TJP A;  2NR2 A;  2KDE B;  1LXD A;  1TKY A;  4XGA B;  5CX3 A;  3H8H A;  4JL9 A;  2QHO A;  2AX5 A;  3R2T A;  3U52 E;  4BOZ B;  5AUI A;  3P42 A;  2WS3 B;  3IAS 1;  2WXL A;  1VLB A;  2K6D B;  2OJW A;  4BKS A;  3H7P B;  3RN9 C;  1MI0 A;  4EEW A;  2LGS A;  2KJR A;  1T0S C;  2W9N A;  2WDR B;  2V9H A;  3PVL A;  2QDF A;  1N5W A;  2KJ6 A;  1B1Z A;  1SXT A;  1R4N I;  2PJH A;  1JWS D;  2QC8 A;  1RRB A;  1YJI A;  5H8Y E;  4YSY B;  3UF8 A;  4GU2 A;  2DEN B;  2G9H D;  1CK1 A;  4HK2 A;  2DZI A;  4KKJ A;  2NTT A;  4C7Y A;  2N1W A;  2BS3 B;  3RT3 B;  2KMM A;  2ZVO A;  4AP4 C;  2AQ2 B;  1QOF A;  4IKG A;  4K3C A;  2GI9 A;  2NS5 A;  2JRH A;  4ZRI A;  1WZ0 A;  2WLB A;  2XNA C;  3VTV A;  2RGF A;  1FNV A;  1WZ3 A;  3CSF A;  2I38 A;  4W9J A;  4GDK B;  4AOF A;  4RFB A;  2C60 A;  4MH8 A;  1GPX A;  1E9M A;  1EWY C;  1PDX A;  3DWM A;  5LXI B;  1EU3 A;  4B95 A;  2BYV E;  3HRD D;  3FIL B;  3JW0 X;  2DZM A;  5D3I B;  3NY5 A;  1XO3 A;  4G11 A;  4G3X B;  1PGB A;  3U2S C;  3GZN I;  2G4S A;  4ICV A;  3V62 A;  3B08 A;  1L6V A;  5BYQ A;  1D5Z C;  2KX3 A;  3BWU D;  3BK1 A;  2FCN A;  2J4X A;  5KHQ A;  1WX8 A;  4EOY A;  2IZV B;  5HHD G;  2JSV X;  4NJC A;  2XN9 C;  5HI1 A;  3N32 A;  5G5H A;  1J0G A;  3ZO5 B;  2IY0 B;  3ZNG C;  4XE0 A;  3N9Y C;  2WX1 A;  1TZ1 A;  2DHZ A;  1G6J A;  4II2 B;  2AL6 A;  2K8B A;  1D6E C;  2PPH A;  1HEZ E;  1V86 A;  2JYE A;  4S17 A;  4K1R B;  1UBI A;  1V1P A;  4N59 A;  3Q2A C;  1JWU D;  3UI3 A;  1GJZ A;  4ANU A;  1C77 A;  1V6E A;  4GDK A;  4HVB A;  3MJW A;  3K9P B;  4LNO A;  1OQR A;  3L10 B;  4IWO A;  4RGN A;  1TS4 A;  1OEY A;  3EA6 A;  4W9K A;  2FID A;  3R8B A;  1SJH D;  2KAN A;  5IA7 A;  4TQ1 A;  1T6B X;  1UGM A;  3L08 A;  2DAF A;  2KFK B;  3RNE C;  2WXN A;  4JPS A;  1I42 A;  2MBO A;  1FFV A;  3U30 A;  1HZ6 A;  4PK1 A;  2D10 A;  2KDB A;  4NJ6 A;  1WRD B;  5AEK B;  3LDZ E;  1JRO A;  2L0T A;  2AQ3 B;  4WWM A;  5L83 A;  5C2T B;  1WR6 E;  4HRO A;  3M63 B;  2MCN B;  5GXG B;  1QZE A;  1VRA B;  5HFY A;  4JLC A;  4EKU A;  3PHW B;  1YN4 A;  2I1K A;  2M4N A;  2UU7 A;  2CR5 A;  1FNW A;  4S0R A;  4XC2 A;  1K52 A;  1PUT A;  4OVV A;  1RWS A;  4DHJ D;  4FXC A;  4NAW A;  1ESF A;  2AEH A;  1KLV A;  2LWP A;  1FRR A;  3H1U A;  3U7Z A;  2KC1 A;  3W5U B;  3HK0 A;  4PYZ A;  2D3C A;  3GZN B;  2O2V A;  1MG8 A;  3C0R B;  1GC6 A;  2MLB A;  3ETR A;  1I4H A;  4HWI B;  1E8X A;  3NS1 A;  2D2Q A;  1WJ4 A;  2QIL A;  1L4D B;  4PYU A;  1SGH A;  2DYB A;  4DBG A;  2MH7 A;  4C4V B;  1N60 A;  4F8C B;  4NJ7 A;  4TSS A;  1XD3 B;  3SD5 A;  4BOS C;  5I4D A;  1Q0W B;  2J42 A;  2NPT A;  2R2O A;  1VZ6 A;  1P9D U;  5EDS A;  4E74 A;  3M62 B;  4K7S A;  1QOB A;  1WJN A;  3IG3 A;  2IBI B;  1J19 A;  2KMC A;  4HJK A;  2G3Q B;  2WDV B;  3C8Y A;  4AJW A;  1VZ7 A;  4KV2 A;  2L0F A;  3ECI A;  4BKT A;  3P63 A;  1WE7 A;  4B9K A;  4X57 B;  3ALB A;  2GOW A;  2AWT A;  1D4B A;  1SJE D;  1IBX B;  5E6J A;  3ZVV A;  1WYG A;  1E7U A;  1SE9 A;  2MBH A;  4MGI E;  3EFC A;  4US9 A;  3D32 A;  3NHE B;  1E8Y A;  2DBY A;  3R3M A;  3N1Y C;  1DOI A;  5CHW A;  4UDU C;  3KUC B;  1PGX A;  2KN5 A;  3R7R A;  1GB1 A;  2PIA A;  3KQ4 A;  2WXQ A;  1E8W A;  2CHW A;  4MDK E;  1I4Q A;  1WX9 A;  5DPT A;  3URY A;  3L0W B;  1P0R A;  1PQS A;  1ZW7 A;  2MA9 B;  4AWJ A;  4KIK B;  1XQQ A;  2LGY A;  1V9J A;  3V61 A;  5CHV C;  4FAD A;  1IUE A;  1EU4 A;  1NYQ A;  2E6X A;  3DVN V;  1F2R C;  2LEK A;  2BQQ A;  1MFW A;  5E6P A;  3NG0 A;  3PZD A;  2INP E;  3BVZ A;  5CTR C;  2LHE A;  2L05 A;  4JX1 C;  2WXM A;  3Q8E A;  4DXA B;  3ZRF A;  4TUU A;  1SEB D;  2Z0D B;  5E6N A;  1L4Z B;  2RDG A;  3P2B A;  4KDI C;  2WXJ A;  2JT4 B;  4ZHO A;  4NPN A;  2KD0 A;  3UIO B;  4C00 A;  3APD A;  2WWZ A;  1CZP A;  2L83 A;  2BGF A;  1XXG A;  2N7E A;  2X38 A;  4M01 A;  2KYW A;  1AW7 A;  2KDM A;  3TSS A;  5D6J B;  5BMH A;  3QC8 B;  1Q5W B;  2V3N A;  3BVM A;  1Q1O A;  3DHH C;  1NVI D;  2WGS A;  3A9K A;  2CS4 A;  4DHZ B;  5IO9 A;  2YLM A;  2PE9 A;  3N1X C;  3WCQ A;  1XEE A;  2LUM A;  3NS8 A;  3GOE A;  2V0G A;  1AAR A;  1RAX A;  3APF A;  1WX7 A;  2XEW A;  4GIV A;  5E6O A;  5CHF A;  2K3U A;  1RYJ A;  3A9K B;  4FHK A;  2PVO D;  1M94 A;  2KOX A;  4ANX A;  3VFK A;  4REZ A;  2KWU B;  3AEE B;  1DGJ A;  3JSV A;  2Z59 B;  1C4A A;  3A1Q A;  3VUW A;  3I9V 1;  1IP9 A;  4BAX A;  1FO4 A;  1SF0 A;  2LRW A;  4YSZ B;  3WAL A;  3AEF B;  1OQY A;  1L6U A;  3GE8 C;  3VQI A;  4MJS A;  3HM3 A;  2RDH A;  2RPV A;  1J7B A;  4ZRK A;  2FNJ B;  4YWG G;  3H6N A;  2MBE A;  1KM7 A;  1VCB A;  2JYT A;  2JZZ A;  3ZNH B;  3ZJV A;  2IGH A;  2IND C;  4GDL A;  3VTW A;  4CHK A;  1Y56 A;  1FM0 D;  3AI5 A;  2CJN A;  2IGD A;  2DZK A;  2KXJ A;  5JHA A;  2LJ5 A;  3A1Q B;  3QX1 A;  2HE7 A;  2NTS A;  3TEZ A;  1ZDX A;  4IDI A;  4DK5 A;  1SIJ A;  2EEL A;  3L13 A;  1XLO A;  2DZJ A;  1D5X C;  3AE5 B;  5IN7 A;  1L0X B;  5MPO A;  1F52 A;  4WWN A;  1GUA B;  2J7Q B;  3L54 A;  4KKI A;  1BXT A;  3B1L X;  1YMH E;  2JXT A;  3KWL A;  2AL3 A;  4BVU C;  4JIO U;  3S2A A;  1UWX A;  1Y8R C;  3W9C B;  1WSP A;  1WY8 A;  1V80 A;  3ZNI D;  2KDI A;  1R4M I;  2BKF A;  1NEK B;  1ZXI A;  1SE4 A;  3OG5 A;  2ONQ A;  1PFD A;  3WAN A;  3VH3 B;  1ZOY B;  1WM2 A;  1T5X D;  2JVC A;  3GE3 C;  2OED A;  1B9R A;  2SAK A;  2RD0 A;  3PLU A;  1LQB A;  5G5G A;  1YN5 A;  2JWU A;  2MJD A;  2MP2 B;  4LDT B;  1N61 A;  3LJ3 A;  3IBE A;  1IPG A;  4DWF A;  1QQR A;  1TZO A;  4M8M A;  4C56 C;  3AEA B;  2CKH B;  2KTR A;  4HCN B;  3PRP B;  5J17 A;  1XLN A;  1FFU A;  1WIA A;  2INN E;  4IWQ A;  3QHT A;  2K22 A;  4LNN A;  4FJV B;  1EWC A;  4EE2 A;  4OVU A;  3RD2 A;  4GB9 A;  2HDE A;  2KQS A;  1TY0 A;  4OW0 A;  2BB5 A;  2O6V A;  1KLU D;  1XT9 B;  4WJO A;  3ZRC A;  3DBS A;  1EF1 A;  2DYM A;  1FD6 A;  1IBX A;  1GNU A;  2WXI A;  3AM9 A;  2BTE A;  2KTR B;  2V4L A;  2PKO A;  2BS2 B;  2K8C A;  3AE1 B;  2HTM E;  1LGR A;  1HQR D;  4E71 A;  2LGD A;  1V49 A;  3PO0 A;  1T0Q C;  1WXM A;  4RGT A;  4C4V A;  3FKY A;  4BBN F;  3AE8 B;  1D5M C;  3R7Q A;  3AXC A;  3AMZ A;  5HG2 A;  2V3P A;  1R7S A;  3GB1 A;  4ZYN A;  4DXG A;  4W9G A;  5FKA C;  3ZYY X;  3ZTD A;  4FA6 A;  1NDD A;  1I4G A;  1ZUD 2;  2FUG 1;  2E3T A;  2V1Y A;  4MGZ E;  2N4F A;  2ASQ A;  2AQ1 B;  3VTU A;  3B9J A;  2OHF A;  1C4C A;  2MX2 A;  4DDG D;  4HKZ E;  2L76 A;  3DVG Y;  3KWV A;  4MH0 E;  3JYU A;  2WXF A;  3NVW A;  5DPS A;  1QF6 A;  4N58 A;  4C80 A;  1ZPS A;  1A5R A;  5EE9 A;  3TL5 A;  2N9P C;  2K9X A;  1UGJ A;  2A4Z A;  3L16 A;  1WGH A;  5J2R A;  2VZK B;  3AN1 A;  4GN1 A;  3KW5 B;  4ICU A;  1EM7 A;  4KDL B;  1V5O A;  1JML A;  1WXQ A;  4IW0 A;  2GBR A;  3FAH A;  4LNF A;  3I5J C;  3TMP B;  4TKN A;  2RMM A;  2PW9 A;  4TMA B;  4KZ0 A;  3T8M A;  3QQ8 B;  3IT6 B;  1N6Z A;  2WHI A;  2FCM A;  3HM6 X;  5JXV A;  3JVZ X;  2D3B A;  3SDL C;  3ZTC A;  1IYF A;  4IC7 B;  4MM3 A;  1CQV A;  2KN4 A;  3KVF B;  2NPT B;  3TEW A;  1UF0 A;  3VXW A;  1HXY D;  2H89 B;  1TGZ B;  1L5P A;  2QEJ C;  2KQ4 X;  2JF5 A;  4F7Z A;  3DBH I;  1WJ6 A;  2JZ3 B;  4LLG M;  3AE9 B;  3O65 B;  4KGT A;  4HLE A;  3T3O A;  1ET6 A;  5HKH A;  4XWW A;  3V6C B;  2YEP F;  1MVK A;  1NBF C;  1JWB D;  2BS4 B;  4A9A A;  2ON8 A;  3QIJ A;  2LHD A;  3EHV A;  4A8X C;  2QSD A;  3R66 C;  1OGW A;  2DWQ A;  1WXA A;  2O6V D;  2C9W B;  4WUR A;  1YX6 B;  3UQB A;  4WWO A;  3U8Z A;  1SBB B;  2WXH A;  4RH6 A;  4EZK A;  2GLS A;  2LVP A;  3CWI A;  3PHX B;  1WH3 A;  4LK0 M;  3DPD A;  1TYG B;  3N30 A;  4LDT D;  1WR1 A;  4IWP A;  3V3X A;  1UEL A;  2PE6 B;  2VH2 A;  2N9X A;  4E3C A;  1WFY A;  3BZD B;  4A3P A;  5LNK 1;  1WYW B;  3A4R A;  2DAJ A;  3V05 A;  3LXF A;  3ZKJ C;  3RI7 C;  2VRR B;  1TS5 A;  4K3B A;  1WMH A;  4LJO B;  3Q3M C;  4ITK A;  1SE3 A;  3DOW A;  1C78 A;  4HPP A;  3DBR B;  3GP7 A;  2DYO A;  3MFG A;  4FUL A;  4RGM A;  4YTN B;  2G1E A;  5J18 A;  1YJJ A;  2L1A A;  4IOI E;  4IM3 A;  2K39 A;  3VUY A;  2WNM A;  4P16 A;  1K50 A;  2Z0E B;  4RM9 A;  3EEC A;  2DLB A;  3VH4 B;  4ZOH C;  4OHJ A;  3W2D A;  1MG4 A;  2O2V B;  2L3Z A;  2KJH B;  1TJE A;  3N20 C;  1FMA D;  4AS1 A;  4AQ7 A;  1ZE3 D;  3PS6 A;  4JE3 B;  1J7C A;  2QIE B;  3AU4 A;  4ACF A;  1UZX B;  3X23 A;  3ZGZ A;  2JQR B;  2WU2 B;  1TS3 A;  2BBC A;  3ZNZ B;  4O1N A;  1BML C;  3RNC C;  2IO2 B;  3E9S A;  3Q8C A;  4GSW A;  4XYC A;  4YTP B;  2CU3 A;  5EE1 A;  3KUD B;  1S3S G;  3H7P A;  4PS7 A;  5D7G A;  4BKS D;  1WGD A;  3IFW B;  3NJT A;  2KO3 A;  2ZNV B;  2WDT B;  3NOB A;  2M8S A;  1C1Y B;  3E56 A;  1V97 A;  2PTL A;  1PGA A;  5BMG A;  1Z2M A;  2WQY B;  1QT9 A;  1WXS A;  2MEK A;  2KFK A;  3QA8 A;  2HD5 B;  2Z8L A;  1TT5 B;  3EC8 A;  4RNA A;  1ISN A;  5G2N A;  2DX5 B;  4ARC A;  5LXH A;  4MT5 A;  3PRE A;  3PRZ A;  4WWP A;  3MHS D;  4HPL B;  1N5X A;  3RYT A;  1JRP A;  2KAJ A;  1XCQ L;  2R2Q A;  5DPR A;  1IGD A;  1FNU A;  2UWQ A;  4XDC A;  2OJR A;  2GBJ A;  1OQQ A;  1V1P B;  1F2R I;  3VR8 B;  3T9L A;  3RPF C;  4NAW B;  2FCQ A;  3ZW3 A;  4QAY A;  2ZEQ A;  4WAA A;  5C3J B;  1V2Y A;  2KWD A;  3A9J A;  1AWD A;  2N7J A;  2NMQ A;  2BW2 A;  3DBR I;  2D5G A;  1V1O A;  2Y5P A;  3PTF C;  4HJG E;  1T0Y A;  4I6P A;  1KRH A;  2LD9 A;  3BK2 A; 
#chains in the Genus database with same CATH homology
 2IGH A;  3IT4 B;  1T3Q A;  2MJE A;  1B1Z A;  1QOG A;  1SXT A;  1NI3 A;  1JWS D;  1FM0 D;  1Y56 A;  2CJN A;  2IGD A;  3IAM 1;  3IXS A;  1YJI A;  5H8Y E;  4YSY B;  1ZP0 B;  2G9H D;  2NTS A;  1CK1 A;  3TEZ A;  3P4S B;  2L32 A;  3VR9 B;  1MHH E;  1ZDX A;  2QJL A;  1K51 A;  4IDI A;  1SIJ A;  4KKJ A;  2EEL A;  2LMC A;  1XLO A;  2NTT A;  4ZHP A;  1D5X C;  4C7Y A;  3AE5 B;  1JQ4 A;  1L0X B;  2BS3 B;  2KMM A;  5MPO A;  2I2Y A;  2AQ2 B;  1QOF A;  1M4V A;  4IKG A;  4Q2J A;  2GI9 A;  1C4P A;  3W1S A;  4KKI A;  4WAF A;  1BXT A;  2PVG C;  2WLB A;  4KGS A;  1YMH E;  2XNA C;  1VZ8 A;  1FNV A;  2JXT A;  3KWL A;  4N6E B;  2SEB D;  3Q8F A;  2GB1 A;  2I38 A;  1FEH A;  3EUB 2;  3HVD A;  5FK9 C;  1FIQ A;  1DOX A;  4GDK B;  4RFB A;  1UWX A;  1XF5 L;  3W9C B;  4MH8 A;  1GPX A;  1E9M A;  1EWY C;  1TKG A;  1PDX A;  1WSP A;  2K0P A;  2N0S B;  3DWM A;  1EU3 A;  3O13 A;  4WQM A;  3Q69 A;  1NEK B;  3HRD D;  3FIL B;  1ZXI A;  4XWT A;  5D3I B;  1SE4 A;  1XO3 A;  2ONQ A;  1PFD A;  2BT6 A;  3HVZ A;  1ZOY B;  1PGB A;  3U2S C;  1T5X D;  1KH0 A;  1AN8 A;  2OED A;  1B9R A;  2SAK A;  1E0Z A;  1C79 A;  1L6V A;  3BYY B;  5BYQ A;  1XCT L;  1D5Z C;  1YN5 A;  2JWU A;  3MC0 B;  5G5G A;  3AV8 A;  3BWU D;  2MJD A;  3BK1 A;  4CQN A;  2CJO A;  2J4X A;  1N61 A;  3P1M A;  5HHD G;  1QQR A;  2JSV X;  1TZO A;  4GDL B;  1I4R A;  1NEN B;  4NJC A;  4C56 C;  2XN9 C;  5HI1 A;  3AEA B;  2JX5 A;  3AEC B;  5G5H A;  1KF6 B;  1STE A;  1XLN A;  1FFU A;  3MHZ A;  2INN E;  4XE0 A;  3GS2 A;  2Y5C A;  1ZDV A;  1I4X A;  3AE4 B;  2K22 A;  3N9Y C;  1QOA A;  1EWC A;  4EE2 A;  3P4Q B;  2HDE A;  1D6E C;  1TY0 A;  4OW0 A;  2BB5 A;  4ZYS A;  1HEZ E;  1KLU D;  1KLG D;  4RGO S;  1FCC C;  1VJK A;  2JYE A;  2DYM A;  4PT5 A;  1FD6 A;  1IBX A;  2MJ3 A;  1V1P A;  2TSS A;  4N59 A;  2WXK A;  2WXI A;  3AM9 A;  1JWU D;  3UI3 A;  2BTE A;  3AE3 B;  4R3D A;  1C77 A;  1QKZ A;  1I7H A;  1TS2 A;  2PKO A;  2BS2 B;  4NAM A;  3AE1 B;  2HTM E;  1XLQ A;  1HQR D;  1OQR A;  4RGN A;  3AE7 B;  3RFZ B;  3PO0 A;  1TS4 A;  4RGT A;  3EA6 A;  2IGG A;  3SFD B;  3R8B A;  1SJH D;  3AE8 B;  1E7P B;  4TQ1 A;  1SSN A;  1T6B X;  1D5M C;  3FC4 A;  4OZA A;  1F0Z A;  3AEB B;  1N62 A;  1QLB B;  3AMZ A;  5HG2 A;  4JWU C;  2V3P A;  1R7S A;  2WXN A;  4JPS A;  3GB1 A;  4DXG A;  2J53 A;  1FFV A;  1HZ6 A;  5FKA C;  4RCO A;  1PYW D;  1N63 A;  2YEP B;  3ZYY X;  3R2I A;  2K5P A;  3B2G A;  2LFI A;  1I4G A;  4ZRP A;  1C9F A;  1JRO A;  2AQ3 B;  4WWM A;  1ZUD 2;  2WXP A;  3J9C A;  5C2T B;  2FUG 1;  2PLP A;  4HRO A;  3MJ5 A;  2E3T A;  2W54 A;  5GXG B;  4MAC A;  1VRA B;  3OWE B;  5HFY A;  2AQ1 B;  3VRB B;  3B9J A;  4JWS C;  1V8C A;  3AE2 B;  1GB4 A;  1QIL A;  1UNS A;  1YN4 A;  2OHF A;  1C4C A;  1FNW A;  4USA A;  4HKZ E;  3KWV A;  1TY2 A;  1K52 A;  1PUT A;  2WXF A;  3NVW A;  3SR6 A;  1QF6 A;  1RWS A;  1DYQ A;  4N58 A;  3W5V B;  4YTM B;  3NZ3 A;  4C80 A;  4YXD B;  1ZPS A;  5EE9 A;  4FXC A;  1NYR A;  4L23 A;  1ENF A;  1ESF A;  2K9X A;  1UGJ A;  4P6V F;  1FRR A;  2M19 A;  3U7Z A;  2VZK D;  4US8 A;  1YQ4 B;  3W5U B;  4HKQ A;  1KFY B;  2VZK B;  3AN1 A;  1SB3 C;  1EM7 A;  1XLP A;  4LTU A;  1JML A;  1FRD A;  1WXQ A;  3U4E G;  3VRA B;  1GAQ B;  3ETR A;  1I4H A;  3FAH A;  4L2Y A;  4NZL B;  4A55 A;  4YT0 B;  3P4P B;  3NS1 A;  2RMM A;  2QIL A;  2PW9 A;  4GLS C;  4OVZ A;  1L4D B;  4TMA B;  3IT6 B;  3NRZ A;  1L0V B;  2MH7 A;  1N60 A;  1UWM A;  5JXV A;  4TSS A;  2ZW1 A;  5I4D A;  2Y3A A;  2R61 A;  1JW9 D;  2J42 A;  1I4P A;  3TEY A;  1CQV A;  2KN4 A;  3TEW A;  1HXY D;  1FXI A;  1YQ3 B;  1ROE A;  1VZ6 A;  2H89 B;  1L5P A;  2QEJ C;  1UUP A;  2KQ4 X;  3AED B;  1QOB A;  4HRS A;  4LLG M;  3AE9 B;  1P7F A;  4DQO C;  4YSX B;  4KGT A;  1WRI A;  1KTK A;  3ZJT A;  3T3O A;  2W55 A;  2WDV B;  2N9K A;  3C8Y A;  4OZC A;  1ET6 A;  2WP9 B;  1IGC A;  1VZ7 A;  4KGR A;  4MM3 B;  4XWW A;  2YEP F;  1MVK A;  3P63 A;  1DOY A;  1JWB D;  2BS4 B;  4A9A A;  2ON8 A;  3PZ7 A;  1ACC A;  2LHD A;  3ZQ4 A;  3LB8 C;  1YN3 A;  4A8X C;  2QSD A;  5T8I A;  1D4B A;  5EE3 A;  2DWQ A;  3BVG A;  5H92 C;  1SJE D;  2M0A A;  1IBX B;  5E6J A;  3TEX A;  1WYG A;  2WXG A;  4WUR A;  4US9 A;  4OZB A;  2EKI A;  2JZP A;  2LJI A;  1SBB B;  2WXH A;  4RH6 A;  4WH4 A;  3CWI A;  2DBY A;  1DOI A;  4LK0 M;  4UDU C;  1F77 A;  1TYG B;  3FIL A;  1PGX A;  1GB1 A;  2LGI A;  2PIA A;  3KQ4 A;  1E6E B;  2WXQ A;  1L0Y B;  4M0W A;  3V3X A;  1I4Q A;  5BYS A;  3URY A;  1FCL A;  2W82 A;  3L4P A;  1HA5 A;  4A6Q A;  3BZD B;  3AB5 A;  1K53 A;  5LNK 1;  3NVY A;  1TKE A;  3V05 A;  1IUE A;  3LXF A;  1EU4 A;  1NYQ A;  1VDV A;  4TQ0 A;  2ACZ B;  1GOZ A;  3Q8A A;  1FXA A;  1TS5 A;  2E6X A;  3SEB A;  2IJ0 A;  1F2R C;  3EGR A;  4ITK A;  2LEK A;  3ZJU A;  1SE3 A;  1C78 A;  1SE2 A;  2WXR A;  1BUI C;  4B0M A;  2INP E;  2WU5 B;  2DYO A;  2WXO A;  3BVZ A;  3GP7 A;  3MFG A;  1JWM D;  4RF1 A;  2LHE A;  3AE6 B;  2BYT A;  4RGM A;  4YTN B;  2QMT A;  4JX1 C;  2G1E A;  2W3S A;  2WXM A;  1YJJ A;  2L1A A;  4IOI E;  3Q8E A;  1C76 A;  1JAL A;  2N9L A;  1RM6 C;  1SEB D;  2V4I B;  2FE8 A;  2WNM A;  4P16 A;  1K50 A;  3I57 A;  1L4Z B;  1JCK B;  2RDG A;  5EE0 A;  3Q8B A;  1RFK A;  2DLB A;  4ZOH C;  2WXJ A;  4OHJ A;  1OFF A;  3KLS X;  3W2D A;  2ZW0 A;  2GRI A;  4XDD A;  1J7A A;  3HUI A;  4ZHO A;  1TJE A;  2BB6 A;  3BII D;  1FMA D;  4AS1 A;  1CZP A;  4AQ7 A;  1ZE3 D;  2L83 A;  4JE3 B;  3LYY A;  1XXG A;  1YNT E;  1J7C A;  2QIE B;  3MP9 A;  1A70 A;  2X38 A;  3ZGZ A;  3NUH B;  2JQR B;  2WU2 B;  2ICI A;  1TS3 A;  2BBC A;  4RF0 A;  1MPE A;  4O1N A;  1AW7 A;  4A90 A;  1BML C;  3E9S A;  3Q8C A;  2KDM A;  3ABV B;  3TSS A;  5BMH A;  2JU6 X;  4YTP B;  2CU3 A;  3CIR B;  4ARI A;  5EE1 A;  3AEG B;  1HZ5 A;  2V3N A;  3BVM A;  3B2F A;  5D7G A;  1NVI D;  5TSS A;  3NVZ A;  1WWT A;  1MHX A;  1Q10 A;  4D2K A;  4L1B A;  1E10 A;  3WCQ A;  1XEE A;  2IPK D;  2LUM A;  1VR9 A;  3BYT B;  2H88 B;  2L52 A;  3E56 A;  2V0G A;  1JWA D;  1V97 A;  3TUO A;  2PTL A;  5BMI A;  2Q5W D;  1PGA A;  2FBW B;  5BMG A;  2WQY B;  4ZRQ A;  1QT9 A;  3T3N A;  4HEA 1;  2K3U A;  5FR3 A;  2MEK A;  1RYJ A;  5D3D A;  2Z8L A;  3AH7 A;  2PVO D;  1AYF A;  4RNA A;  5AUK A;  3P4R B;  2KAC A;  1ET9 A;  1CJE A;  2WDQ B;  4ARC A;  3NVV A;  1WGK A;  4MT5 A;  4DXF A;  4C7Z A;  2PMV A;  4REZ A;  1ZXH A;  1N5X A;  3PZ8 A;  3AEE B;  1DGJ A;  5BYR A;  1JRP A;  1TKY A;  2KAJ A;  1LO5 D;  1C4A A;  4KX6 B;  1XCQ L;  1IGD A;  1FNU A;  4XDC A;  3H8H A;  3I9V 1;  2M56 B;  1OQQ A;  1V1P B;  1F2R I;  3VR8 B;  1FO4 A;  3RPF C;  4NAW B;  1SF0 A;  2AX5 A;  3R2T A;  3U52 E;  2W3R A;  4YSZ B;  3AEF B;  3P42 A;  5AUI A;  1L6U A;  2J52 A;  2WS3 B;  3IAS 1;  5C3J B;  3VQI A;  2KWD A;  2WXL A;  3SFE B;  1P7E A;  2RDH A;  2NMQ A;  1AWD A;  1VLB A;  2N7J A;  1J7B A;  2BW2 A;  2RPV A;  4WIP A;  2D5G A;  1V1O A;  1MI0 A;  2IDY A;  2Y5P A;  4J3O D;  4YWG G;  4HJG E;  2B76 B;  1KRH A;  2JYT A;  2WDR B;  3DWG C;  3ZJV A;  4H2A A;  4B0E A;  1N5W A;  3BK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...