1P7FA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7fA00
1IGCA 1P7EA 5HI1A 1HZ5A 2KQ4X 2J52A 1K53A 1F2RI 1ZXHA 2RPVA 2N9LA 1Q10A 2PTLA 2N7JA 1EM7A 2KACA 1FD6A 1UWXA 3V3XA 3FILB 2NMQA 2K0PA 3GB1A 2LHDA 1IBXA 1K50A 1MVKA 4KGSA 2JSVX 2N9KA 1FCLA 2LHEA 4OZBA 2JU6X 1IGDA 3MP9A 1K52A 5BMHA 2QMTA 2ONQA 5HHDG 1JMLA 2EELA 5BMIA 1D4BA 5BMGA 2JWUA 4HKZE 4IOIE 2JZPA 1K51A 1XF5L 5JXVA 4IKGA 3FILA 2KDMA 2OEDA 1MPEA 1C9FA 1MHHE 2JXTA 1XCQL 2ZW0A 2RMMA 1PGXA 1GB4A 1YNTE 1XCTL 2IGDA 1HZ6A 2GB1A 2PLPA 1PGBA 2IGGA 1FCCC 1YMHE 1GB1A 1PGAA 2KN4A 1P7FA 1MHXA 4KGRA 2ON8A 4HJGE 4MACA 2J53A 3UI3A 2QSDA 4OZCA 1MI0A 2GI9A 2LGIA 1KH0A 2LUMA 2KWDA 4GLSC 5HG2A 2PW9A 4KGTA 4WH4A 4OZAA 4D2KA 5HFYA 2I38A 1HEZE 2ZW1A 2I2YA 1QKZA 1IBXB 1F2RC 2IGHA
chains in the Genus database with same CATH superfamily
4CO7A 1EWCA 2BYFA 2DZJA 4FHKA 3QIJA 5AUIA 1I35A 3RT3B 3L4PA 5MPOA 1NENB 2JXXA 1B9RA 3ZIMA 1VD2A 5LXIB 3QQ8B 4JX1C 1DOIA 1WGGA 1WGHA 1FD6A 2ZCCA 2OJWA 3LXFA 4F8CB 2O2VA 4F1SA 3B2FA 2K0PA 4LNOA 2VRRB 1WXAA 1F77A 1QF6A 4ZDVA 4IM0A 5FR6A 4XGAB 1ZW7A 2LRUA 3V6EB 4ANXA 3RYTA 1V6EA 2N1VA 3PHWB 1KF6B 3PHXB 2LWPA 4RH6A 3ZUNA 3OLMD 2LFIA 4G3XB 2CKHB 4K7SA 4HDQA 2JWUA 3APFA 2Y5BB 3GZNI 1UZXB 4NJ6A 2GLSA 1SSNA 4ZRIA 1WRIA 3GE3C 2DWQA 2BGFA 3SR6A 2IGDA 2GB1A 1QQRA 2WDRB 1DOYA 2KDIA 4PS8A 1WM3A 2CR5A 2LXAA 3N1XC 2K5PA 4DXFA 2SEBD 3TEWA 1EF1A 1TJEA 4HPLB 3DHGC 3PSEB 1L4DB 4KIKA 1WMHA 3AV8A 4RFBA 4PS3A 5L95C 4GLSC 4KSLC 4TMAB 1T5XD 3T8MA 1TTNA 3NVZA 4USAA 3NUHB 3RUIB 2KTFA 2YEPB 4XC2A 3R2IA 3L0WB 4ZHOA 3NVWA 3L10B 4WJPA 3W5VB 3B08A 3K9OB 2L32A 4RGMA 1ET9A 4YT0B 2BB5A 3EHVA 4IUMB 3JVZX 1WY8A 2IY1B 4WJQA 3BK2A 3SD5A 1U4AA 3H6NA 1EU4A 3GS2A 1V5OA 3JSVA 3I3TB 1TYGB 1BMLC 3E56A 4C56C 3BVGA 2WXKA 1OQQA 3IHPC 3FAHA 2ZPYA 4M01A 1N63A 2NR2A 4X57B 4EOYA 2KXJA 1LO5D 2K39A 1TIFA 4NJCA 3DQVA 4MDKE 3ZRCA 1WGRA 5L83A 1ZKHA 4K7WA 4IM2A 1CZPA 5BMGA 4A55A 4IOIE 1SIJA 1FMAD 1C3TA 4GN1A 1MPEA 4DHZE 2C7MB 4MH8A 1UF0A 2J42A 1SB3C 2WU2B 4P1CC 3Q2AC 2GBJA 2WS3B 1Z2MA 2M56B 4PT5A 4C00A 3LB8C 2PKOA 5EE3A 3M95A 4JGHB 4NAWB 3NZ3A 2BS3B 3AU4A 2IJ0A 2LJ5A 1AWDA 2L8JA 2LVPA 2GBMA 3ZKJC 4P1BC 4US9A 3UQAA 4W9IA 3DCGA 2KO3A 2JT4B 3AE3B 2QIEB 4YTPB 3MFGA 4AOFA 4KVGB 2K8HA 2MP2A 4YSZB 4CQNA 2FCNA 1IUEA 1Q10A 2IYDB 3A33B 2PJHA 2WXMA 2KJRA 2JUOA 1WYGA 4L2YA 3FILB 2DYMA 4PYUA 1E7PB 3WANA 3K9PB 2QJLA 3BVZA 4BFRA 2M17A 2XK5B 3V62A 1MVKA 1N61A 3RFZB 5TSSA 2ZZPB 3Q8CA 2SAKA 3R8BA 2KWUB 2ZVNA 4G0NB 1ET6A 1SJHD 1VZ8A 1XLNA 2CU1A 2OOBB 3MP9A 2MWSB 4ZRKA 4XWTA 3VTWA 3Q3MC 5HKHA 2HDEA 2W82A 2W54A 4N9F4 4E71A 2KD0A 4ICUA 3ZJUA 1C9FA 2ZW0A 4TQ1A 3QARA 3Q8EA 3Q3OC 1E8YA 3WAPA 2JYTA 2V4LA 5FKAC 2KDEB 3VXWA 2KKCA 3N1ZC 1P7FA 4KZCA 1MHXA 4LTUA 1CJEA 4P7IA 1SEBD 2C9WB 2LVOA 3IAM1 3ZQ4A 2GI9A 2ZPNA 3H7PA 5D3IB 4K3BA 2O6VA 2KWDA 5HG2A 1NYQA 4I6PA 5J2RA 3A4RA 3PREA 2HTHA 2I38A 4FLHA 1PFDA 2XNAC 3RNAC 3QCAA 1MG8A 1OEYJ 4M0WB 2C7NB 1XO3A 1HZ5A 3IBEA 1AW7A 4GDKA 4G50A 5DPRA 3W5UB 1FIQA 4LNFA 2DNFA 2KMAA 2WU5B 2IBIB 1IPGA 1ZGUB 3P4QB 3KH0A 2RDBC 4HJKA 2KACA 5JH5C 2KT7A 1D5XC 1WSPA 1TY2A 1ACCA 1E7UA 1YIWA 1K8RB 1OEYA 3RNBC 4IC7B 4NJ7A 4WWNA 4QAYA 1WYWB 1Q0WB 2L0TA 1L7YA 4REZA 1LQBA 2JX5A 4LLGM 3W1SA 2BYTA 1JMLA 4BBNF 5BMIA 5C23A 1YJ1A 2KFKB 1I4RA 3HM6X 3QX1A 2ACZB 1I4HA 1JWUD 4WWPA 2JZPA 5D7GA 2MX2A 4HXDA 3UIOB 1XLQA 2IPKD 2QCZA 1YJJA 3L17A 1A5RA 4EFOA 3Q8BA 2MJEA 2LXCA 2LJIA 3L13A 1UWMA 4H2AA 2G4DB 1MJDA 2K6DB 3VDZA 1WE6A 5AUKA 4MACA 4W9EA 3UI3A 3DBLB 3KWVA 3WIMA 2LASA 4OZCA 4W9FA 1MI0A 2D2QA 2KJ6A 1V80A 1WXSA 2PW9A 3DBHB 3NHEB 2O2VB 2V3PA 3IXSA 1E8XA 3ZO5B 2N7EA 2FCQA 3BYTB 5LNK1 3TUOA 4A9AA 4CHKA 3A9JA 1OTRB 2CJNA 5HI1A 2DHZA 4DDID 3ZGZA 5JZEB 1FEHA 3DVGY 1LXDA 2JRHA 2M0AA 1R4NB 1UBIA 3PT2B 1VCBA 3DHIC 3LDZE 1T6BX 3J9CA 4C7ZA 2JQRB 5IO9A 5AEKB 1YQ4B 1WR6E 3VRAB 1T0RC 2NMQA 1TGZB 2V4IB 3SFEB 1EO6A 2W9NA 1IBXA 2AQ1B 4GDLA 3ZNID 1F9JA 1YQ3B 1E8ZA 3PGEA 2A5UA 4KX6B 2LD9A 2FE8A 5BMHA 3P4PB 4MEMA 2IO0B 4KIKB 1WMHB 4MSQB 4XDDA 2QDFA 2DAJA 3MHZA 3DBRB 5AZFA 3PRPB 1CQVA 4DQOC 3N3KB 4M8MA 4JWUC 3EECA 1MHHE 2UU7A 1C76A 3WALA 1UELA 2PLPA 3OG5A 2KAJA 1OQRA 4RF1A 1RWSA 3DOWA 1FNWA 4Q2JA 2R2OA 2AL6A 2MBBB 3AEAB 4JE3B 3PVLA 4AS1A 5JHAA 3ALBA 1Z5SB 4FADA 1RFAA 5KHOA 2LEKA 3P2BA 2L0FA 3ZJVA 1JROA 3DHHC 1XT9B 2WXOA 5I4DA 1SE4A 2KNBA 2Y3AA 2WXLA 3DBLI 1QOFA 3NJTA 2FIFA 3AE5B 2WYQA 1IYFA 4OZAA 1RLFA 1EWYC 4TKNA 2RPQA 3OWEB 4WAAA 1YN3A 5DPWA 2AEHA 3DBHI 4ZRQA 1YX5B 4TV3A 4RMAA 2PIAA 3BK1A 3I57A 1VRAB 3ZDTA 2N9LA 3AI5A 2KX3A 4OVZA 3DVNU 1V2YA 1Y56A 2V9HA 5G2NA 1R4NI 4YWGG 4YSYB 2L83A 3MJ5A 5KHQA 4C4VA 2VH2A 1L0VB 1SXTA 1T3QA 3R2TA 1XLOA 4WWOA 3B0AA 2Z8LA 4MT5A 4A90A 2JY6A 3N30A 2CHZA 4XX5A 4DDGD 2EELA 5E6OA 2LVQA 2LZ6A 3KWLA 5LXHA 4IG7B 1ZXIA 1T0QC 2M1MA 3OJ3A 2KTRA 2D5GA 4NPNA 2MSED 2N1WA 2JXTA 3A9KA 3RNGC 3VH3B 1GB4A 3HM3A 3DBRI 3PZDA 3AE7B 3BYYB 2IGGA 2IZVB 3KUCB 4KSKC 1J19A 2LRWA 1UBQA 1GJZA 2I1KA 4TSSA 2WXJA 2UYZB 1HTQA 5AZGA 1N60A 1V86A 2BYVE 2EMSA 2UWQA 2N9EB 2LGSA 4GMVA 4HRSA 4OVUA 2K22A 1WIAA 4WJNA 4LK0M 3H9DA 1L6UA 2MA9B 4MELA 3AH7A 2BPSA 2ASQA 1OQYA 4ANUA 1YQBA 1ZOYB 2NPTA 3ZLZA 2ZVOA 5FK9C 2K8CA 2AL3A 2KMCA 2A4ZA 1EM7A 1YJIA 5D6JB 2C7HA 3B2GA 2ZNVB 2WLBA 4GIVA 4RGTA 3SDLC 3DPDA 2HD5B 2IO3B 2MCNB 1S1QB 2LGDA 1WGKA 1SGHA 4OVVA 2BTEA 3CSTA 2J4XA 2WQYB 3PRMB 3SFDB 5BYRA 1F0ZA 4W9DA 2QMTA 1KOTA 3Q8AA 2VZKB 5D2MB 3BVMA 4RNAA 4JIOU 3KW5B 3H7PB 2ZJDA 1XEEA 2IY0B 4RGOS 4AP4C 1WI0A 1FXAA 2O6VB 1FPYA 3KYDD 1XF5L 2MBOA 2OEDA 2BYEA 2BS4B 1WZ0A 3A4SC 4JPSA 3L54A 2JF5A 2KN4A 4I6LB 1TS3A 3HVDA 3R3MA 2MQJA 4GDKB 1KLGD 2QSDA 3IT4B 2KK8A 5FR3A 3AU5A 4DK5A 3QC8B 2NCNA 4RM9A 2KDBA 1B1ZA 3HRDD 3NVYA 1TS2A 1GNUA 1C4PA 2J0KA 4IWQA 4HK2A 2ZW1A 3PLVA 1GUAB 1MFWA 2WXGA 2DZMA 3GE8C 2QC8A 5G5HA 2KQ4X 1NEKB 2AQ2B 2G4SA 4HLEA 1NI3A 4EZJA 3KVFB 1ZXHA 1L2NA 2RPVA 3V6CB 1FNUA 5D3DA 5J17A 1DYQA 3BIID 3U7DA 4LJOB 4A8XC 3LYYA 1KLVA 3OAWA 2DENB 2QHOA 2TSSA 3Q69A 2L7RA 3PRZA 4I6NB 3B9JA 4EEWA 5C1ZA 2D3BA 2NBWB 2LHEA 1XLPA 2JU6X 1C77A 3C0RB 1XD3B 3KUZA 5IN7A 4JWSC 4MH0E 1PQSA 3PO0A 3AEBB 4JLCA 1QT9A 4BKSA 1LGRA 2DZIA 3VH4B 4AWJA 2PVGC 1V49A 3AEFB 1E6EB 2HJ8A 2BT6A 2D10A 3MC0B 3IVFA 2OHFA 3ETRA 2FUHB 2V1YA 3A9JB 3QJZA 4O1NA 2K1FA 2WXNA 3M62B 1WZ3A 2M0XA 4ITKA 3RI7C 2XEWA 2CHWA 5EE9A 2KC2A 4L23A 4LJPB 4XWWA 3ENEA 1VR9A 1QZEA 4LNNA 4PYZA 4FJZA 3NZUA 3RCZA 1SE3A 2NS5A 4NNJB 3ZTDA 1KJTA 3AE2B 3RNCC 3SHQA 1TBEA 1V8CA 3Q3FA 1WWTA 1J7BA 2JVCA 3ZXRA 3TIXA 1IBXB 1F2RC 3ZW3A 4GDLB 2MBEA 4R3DA 4LDTB 1LFDA 1HE8A 3N32A 2K25A 2JRIB 3P63A 2GBKA 3DVNV 3T9LA 2PTLA 4KDLB 1ZE3D 4EE2A 3H7SA 1QOBA 4HEA1 3U4EG 2PEAA 4BKGA 1LM8B 1FO4A 3AECB 1FRRA 3B1LX 3ZXVA 2BW2A 3VR9B 2BKFA 2BKRB 4BOSC 3QHTA 3IG3A 1P98A 2N9KA 3VAWA 4OZBA 4DWFA 2X38A 1WX9A 2INDC 1TS5A 4WAFA 2BWFA 2G9HD 1E0ZA 3N9YC 2M19A 1P0RA 3P1MA 4HPPA 3EGRA 3I9V1 3KLSX 1J8CA 2EKIA 4IKGA 2KDMA 2IO1B 3V61A 4RCOA 3ZNHB 2DYOA 1I4PA 3SU8X 1F52A 1JW9D 2WNMA 2LGXA 3NRZA 4J3OD 1E9MA 1FCCC 2CS4A 1HXYD 2DX5B 2BF8B 1SBBB 3P4RB 2YEPF 2ON8A 4BBNC 1TT5B 1GC7A 1CK1A 5IKCM 1WJUA 3S2AA 1SE9A 3AXCA 2C60A 4A6QA 4US8A 5JHBA 3T3NA 3W2DA 1OGWA 4D2KA 1JQ4A 1D3ZA 5BO4B 5E6PA 4C4VB 1STEA 1KTKA 1QKZA 2INPE 2JYEA 3EC8A 2MJ3A 1VLBA 1C1YB 1UGJA 4B6WA 2AX5A 2E6XA 3UINB 2WDTB 3CWIA 1CMXB 1M94A 4IM3A 3V3XA 3A1QA 2KTRB 1GG3A 2HE7A 1WX8A 5EE0A 1OFFA 2GBNA 3NVVA 3PTFC 1WRDB 1UD7A 4W9HA 2J0MA 2AYOB 2XK5A 3GOEA 3ONSA 1IGDA 2VZKD 3U7ZA 1ROEA 2O6VD 4ANWA 1E7VA 1M4VA 4W9GA 3FKYA 3V60A 4W9JA 1UUPA 3NG0A 4KDIC 2K3UA 4A3PA 4DHZB 1XCQL 3NS1A 2WDQB 4GB9A 1S3SG 3VUXA 2MBQA 4JL9A 1PGBA 4W9KA 2G3QB 1WJ6A 2NPTB 4WJOA 3RZWC 2QILA 3APDA 2Y5PA 2N9PC 3RMKC 2KQSA 2J7QB 3DWMA 4EZKA 2MEKA 4EUTA 4K3CA 1N5WA 1VJKA 2NVUI 1YN5A 2BVCA 3ML9A 4URKA 1F1HA 2KWCA 2GMIC 3N20C 4LNIA 4N59A 1KM7A 3ML8A 1E10A 2EKEC 1IGCA 1MG4A 2WXFA 4W9CA 5GXGB 1KRHA 3ZNGC 4M00A 1QLBB 4K1RB 3TEYA 3X0WA 4II2B 4XDCA 3JSVB 4ASWC 2FBWB 3RD2A 3QAQA 1L5PA 2WHIA 1I4XA 1V81A 2QEJC 1GAQB 2E3TA 3JW0X 2XBBC 4FJVB 4DXGA 1NBFC 4PK1A 3IAS1 3Q14C 3GB1A 3I63C 3UF8A 2K9XA 4KGSA 1H4RA 2DAFA 2LI5A 4ARIA 2IO2B 4E74A 4G11A 4YTNB 2KHWB 3RNFC 4HVBA 2KVRA 4AJYB 3N1YC 4MJSA 3AN1A 3H1UA 4MGIE 4NAMA 2D3AA 2FUG1 4XE0A 3PV1A 3KQ4A 3MHSD 3TSSA 1V1PA 1J7CA 1RYJA 2WDVB 1A70A 2KFKA 4NQLB 1VZ7A 4HCNB 2WXQA 4GXBA 1P1AA 1V97A 2RMMA 4KZ0A 3AE6B 1XCTL 2KQ7A 1L0YB 2N4FA 2KVZA 3C19A 2Y5CA 2KOXA 3PLUA 1DGJA 2D11A 3H8HA 3LJ3A 4YL8A 4RF0A 2MLBA 1TKGA 3ZTCA 2MJDA 3HIZA 2J0JA 2KANA 3P42A 4WQMA 1BUIC 5CX3A 3IT6B 2B76B 3AE8B 2WXRA 4A20A 2HJ1A 3BWUD 2OJRA 4LDTD 1HEZE 1JRPA 3HHMA 3QA8A 2MP2B 1P7EA 1D5MC 1WJNA 2J52A 4L1BA 4IW0A 3DWGC 2INCC 1JWSD 2L52A 2FCSA 4WIPA 4BZAA 2ZEQA 3I5JC 2Z0DB 1FXIA 3PZ7A 1L0XB 4NQKE 3O65B 2RSUA 5C3JB 2M4NA 1K50A 5H8YE 2H89B 1FRDA 1FNVA 3ABVB 1FCLA 3M3JA 3AEEB 1Q5WB 4HKQA 1L6VA 3VVWB 4F7ZA 1RRBA 4HROA 3EUB2 3AMZA 2ONQA 5E6JA 5HHDG 2BBCA 4AJWA 3GP7A 1HA5A 4YXDB 2KX0A 1TS4A 3AE4B 4HKZE 2KFJA 1BXTA 5JXVA 3V05A 3EFCA 4FHJA 1JALA 3FC4A 2CHXA 4B9KA 2KLCA 2KDFB 3CF6E 1Q1OA 4B95A 4MGZE 4KKJA 1PDXA 1T0SC 4CYEA 5E6NA 3BZDB 1TKYA 3CMMB 3RNEC 1SJED 1D5ZC 1V5TA 1XXGA 4XZ4A 1ESFA 3CSFA 3RZFA 2LGYA 2LMCA 3W1YA 1ZUD2 3DDCB 2FAZA 4GU2A 2WXPA 1FFUA 4MM3A 5CHVC 1ENFA 2CU3A 1EUVB 2C5LC 1HQRD 2LUMA 3BINA 4FJYA 3X23A 2M8SA 3NZSA 3ECIA 5CHWA 1SF0A 5G5GA 2INNE 4RM8A 1UNSA 3PS6A 4IWOA 3DVGX 4PS7A 1RFKA 1C78A 2K6QA 2I1JA 1K53A 3ZJTA 1F2RI 1WJ4A 1WE7A 4HCPB 4KKIA 2WGSA 1EU3A 3M63B 4IWPA 5DPSA 2N7JA 5C2TB 3WA0A 1R7SA 4FN2A 5IA7A 4ANVA 1V1OA 1GPXA 4K7UA 1QOAA 2G45B 2JPHA 3VUYA 2RD0A 3L16A 2LHDA 1YN4A 4AQ7A 3W9CB 1FFVA 2KMMA 2JSVX 1E5WA 2PMVA 3AM9A 3O13A 3Q6BA 4WURA 2PPHA 2MH7A 1NI2A 3P4SB 1YOVB 3AE9B 3WCQA 4W9LA 1D4BA 2R2QA 1K51A 3C8YA 1YD8U 1T0YA 5IOIA 4P16A 1I7HA 3ZRFA 3EA6A 1VZ6A 1SE2A 3QWZB 1HZ6A 1P3QU 1YMHE 1TZOA 3R7QA 4FA6A 1E90A 1RAXA 2Q5WD 2KWVB 2BB6A 3VFKA 2J53A 2D3CA 3U30A 3U8ZA 2D3GA 2DLBA 4FBJB 4ZOHC 1E8WA 3VHTC 4NY0A 4E3CA 2PVOD 4EKUA 3A1QB 1R4MB 4ARCA 5TR5A 1GOZA 1GC6A 5EDSA 3UQBA 3HUIA 4DHJB 4NZLB 5D94A 4TUUA 3U52E 1WXMA 3RN9C 4KV2A 1NDDA 1N5XA 4LCDE 5T8IA 2KJHB 4A3OA 4TQ0A 2RGFA 1J0GA 4FULA 4HDOA 4HWIB 4K81A 1QOGA 1UH6A 1UWXA 2MBHA 2BWES 3Q3JA 3UGBB 1I4QA 1X1MA 3OJ4B 2KC1A 5GMVA 2JWZA 3AEDB 1G6JA 1Y8RC 2Z0EB 4HPMB 1PYWD 1BT0A 3AEGB 3MC8A 2H88B 4MSMB 2XN9C 4BKTA 2VH1A 1WFYA 1JWMD 4GSWA 2V3SA 3L08A 2FIDA 4WQOB 3TJPA 3IFWB 2EMTA 1WGYA 1PUTA 3TEZA 3NS8A 3MTNB 1KFYB 1HTOA 1KLUD 2AQ3B 1JWAD 2DZKA 3TL5A 2X8XX 2NTTA 4OW0A 4B0MA 1GB1A 1N62A 3TEXA 3NY5A 4XYCA 4KGRA 4HJGE 2V3NA 2JZZA 5BYSA 2L76A 5J18A 4C80A 3CIRB 1WH3A 5IAAC 2NBUA 1TY0A 1ISNA 4KGTA 4ZRPA 2MHJA 1EF5A 4OHJA 2WX1A 2W3RA 2I2YA 2RR9A 3R66C 1WXVA 1N6ZA 1H8CA 1R4MI 2NTSA 2GBRA 2ZNVC 3JYUA 5BYQA 5AZHA 3U2SC 1WM2A 4BKSD 3TCAA 2W55A 4M02A 1V9JA 4MJSB 4NAWA 3TMPB 4ZYSA 5G55A 4IDIA 3URYA 2ZCBA 1V1PB 1UGMA 2JZ3B 2FCMA 2PE9A 2REXA 1AARA 1WF9A 5DCNA 4BVUC 3KYCD 3ZNZB 1I42A 1DOXA 1WGDA 5H92C 4ZRJA 2DBYA 3RULA 4S0RA 2N7DA 2G1EA 1K52A 2N9XA 4B0EA 3BY4B 1VDVA 1D6EC 1SIFA 2RDGA 3A9KB 2DYBA 2RDHA 2WXIA 4ZYNA 3FILA 4BOZB 4MGYE 2WX0A 1ZDXA 4N6EB 2CJOA 4EZLA 2K8BA 4WWMA 1PGXA 1C4CA 1YNTE 2GRIA 4ACFA 2MRPA 2WXHA 3VTVA 1XQQA 4FXCA 1I4GA 5DPTA 1TZ1A 3APCA 4LNKA 1C4AA 5EE1A 1FXTB 4M8NA 1AN8A 1TKEA 3WAMA 3W1SC 3AULA 2KZRA 2LGIA 3T3OA 2FNJB 4DXAB 4ZHPA 4YSXB 2W3SA 1WXQA 3NOBA 1WX7A 2NBVB 2L3ZA 2YLMA 4ICVA 4C7YA 3TBLD 1ZP0B 1ZDVA 2L00B 3VTUA 2PE6B 2B3AA 3RPFC 2WWZA 2ICIA 4AUQC 2BQQA 1J7AA 3SEBA 2N0SB 3VQIA 5CTRC 3VR8B 3AB5A 4II3B 4J6IA 3R7RA 3QK0A 2AWTA 3MJWA 3DBSA 3VRBB 1IP9A 3ZDMC 2LUEA 1JRUA 2KLGA 2R61A 4M0WA 3PZ8A 2V0GA 1L4ZB 2WP9B 4BAXA 4S17A 3E9SA 3UIPB 1JWBD 2MW5A 2GOWA 1RM6C 3GZNB 2L05A 2IDYA 4MM3B 3Q3NC 2BS2B 3Q8FA 4P6VF 4RGNA 3ZYYX 2D07B 4JQWC 5IP4D 4MGKE 2KYWA 1FM0D 2HTME 3ZVVA 4GOCA 3MC9A 4N58A 1C79A 1JCKB 1WR1A 2KN5A 5LLIA 3HK0A 3EFUA 1PGAA 3PPAA 1AYFA 1P9DU 2L1AA 5CHFA 3HVZA 4GGQA 4YTMB 1YX6B 1NYRA 2Z59B 3KUDB 4DHJD 1KH0A 4UDUC 3VUWA 1NVID 1ZPSA 4WH4A 4DBGA 5HFYA 2YVCA 3D32A 3AE1B 3WAOA 1QILA 2IGHA
chains in the Genus database with same CATH topology
4R3DA 2CJNA 1EWCA 5HI1A 1RFKA 1C78A 3ZGZA 1K53A 3ZJTA 5AUIA 1F2RI 1FEHA 3L4PA 5MPOA 2M0AA 1NENB 3P63A 4KKIA 1EU3A 1T6BX 3J9CA 1B9RA 2PTLA 2N7JA 4C7ZA 1ZE3D 2JQRB 4JX1C 5C2TB 1DOIA 1R7SA 1YQ4B 4EE2A 1FD6A 3LXFA 1V1OA 3VRAB 1QOBA 4HEA1 1GPXA 3B2FA 2NMQA 3U4EG 1QOAA 2K0PA 2V4IB 1FO4A 3AECB 3SFEB 1FRRA 2LHDA 1YN4A 1IBXA 2BW2A 3VR9B 3W9CB 4AQ7A 2AQ1B 1F77A 1FFVA 1QF6A 2KMMA 2JSVX 2N9KA 4OZBA 1YQ3B 2PMVA 3AM9A 3O13A 2X38A 4WURA 1TS5A 1KF6B 4KX6B 4RH6A 4WAFA 2MH7A 3P4SB 2G9HD 2LFIA 1E0ZA 2FE8A 3N9YC 3P4PB 2M19A 5BMHA 3P1MA 3AE9B 3WCQA 3EGRA 4XDDA 1D4BA 3MHZA 3I9V1 2JWUA 3KLSX 1K51A 2EKIA 4IKGA 3C8YA 2KDMA 1CQVA 4DQOC 1SSNA 4P16A 1I7HA 1WRIA 4JWUC 4RCOA 1MHHE 3EA6A 2DYOA 1I4PA 1VZ6A 1SE2A 1C76A 1JW9D 2WNMA 2DWQA 3SR6A 3NRZA 2IGDA 4J3OD 1HZ6A 2GB1A 1QQRA 2PLPA 2WDRB 1E9MA 1FCCC 1YMHE 2KAJA 1DOYA 1TZOA 1OQRA 1HXYD 4RF1A 1RWSA 1SBBB 1FNWA 3P4RB 4Q2JA 2YEPF 2Q5WD 2ON8A 2K5PA 2BB6A 3AEAB 4JE3B 2SEBD 2J53A 4DXFA 3TEWA 4AS1A 1CK1A 2DLBA 1TJEA 4ZOHC 2LEKA 3ZJVA 1JROA 1L4DB 2WXOA 3AV8A 5I4DA 1SE4A 4RFBA 2Y3AA 4A6QA 2PVOD 4US8A 2WXLA 4GLSC 4TMAB 1QOFA 4ARCA 1T5XD 3NVZA 1GOZA 3AE5B 3W2DA 3T3NA 4USAA 4OZAA 4D2KA 3HUIA 3NUHB 1JQ4A 4NZLB 1EWYC 1STEA 1KTKA 3U52E 2YEPB 3OWEB 3R2IA 1QKZA 2INPE 1YN3A 4ZHOA 2JYEA 3NVWA 2MJ3A 1VLBA 3W5VB 4ZRQA 2L32A 1N5XA 1UGJA 4RGMA 2AX5A 1ET9A 4YT0B 2BB5A 2PIAA 5T8IA 3BK1A 3I57A 4TQ0A 1VRAB 2E6XA 2N9LA 3BK2A 4OVZA 3CWIA 1Y56A 1EU4A 3GS2A 1QOGA 1UWXA 3V3XA 4YWGG 1TYGB 4YSYB 2L83A 1BMLC 3MJ5A 3E56A 5EE0A 4C56C 1I4QA 3BVGA 2WXKA 1L0VB 1OQQA 1SXTA 1OFFA 1T3QA 3R2TA 3NVVA 3FAHA 1XLOA 3AEDB 1N63A 2Z8LA 4MT5A 1PYWD 3AEGB 4A90A 1LO5D 1IGDA 2VZKD 2H88B 2XN9C 3U7ZA 4NJCA 1JWMD 1ROEA 2EELA 1CZPA 3KWLA 5BMGA 1M4VA 1ZXIA 4A55A 4IOIE 1PUTA 1SIJA 3TEZA 1FMAD 1KFYB 1UUPA 2D5GA 1MPEA 4MH8A 2K3UA 2JXTA 1XCQL 3NS1A 1KLUD 2AQ3B 1JWAD 2WDQB 1GB4A 2J42A 3AE7B 3BYYB 2IGGA 1PGBA 1SB3C 2WU2B 2NTTA 4OW0A 4B0MA 1GB1A 2WS3B 2M56B 1N62A 3TEXA 4PT5A 2QILA 4KGRA 2Y5PA 4HJGE 2V3NA 3DWMA 3LB8C 2PKOA 4TSSA 2WXJA 5BYSA 5EE3A 4C80A 3CIRB 4NAWB 2MEKA 3NZ3A 2BS3B 1N60A 2IJ0A 1TY0A 1N5WA 1AWDA 4KGTA 1VJKA 4ZRPA 1YN5A 4HRSA 2K22A 4LK0M 4US9A 4OHJA 1L6UA 2W3RA 2I2YA 3AH7A 3AE3B 4N59A 1E10A 1IGCA 2QIEB 2NTSA 4YTPB 2WXFA 5BYQA 5GXGB 3U2SC 3MFGA 1ZOYB 4YSZB 1KRHA 4CQNA 1IUEA 2W55A 5FK9C 1QLBB 3TEYA 1Q10A 4XDCA 2FBWB 2WXMA 4ZYSA 1L5PA 4IDIA 1EM7A 1YJIA 1WYGA 3URYA 1I4XA 2QEJC 4L2YA 1GAQB 3FILB 1V1PB 3B2GA 2E3TA 2DYMA 4DXGA 1E7PB 2QJLA 2WLBA 3BVZA 1DOXA 4RGTA 3IAS1 3GB1A 1MVKA 5H92C 1N61A 2DBYA 3RFZB 2K9XA 1WGKA 4KGSA 5TSSA 3Q8CA 2SAKA 4ARIA 3R8BA 2BTEA 2J4XA 2WQYB 3SFDB 1ET6A 1SJHD 1VZ8A 1XLNA 3MP9A 5BYRA 2G1EA 1K52A 4YTNB 4XWTA 1F0ZA 4B0EA 2QMTA 3Q8AA 2VZKB 3BVMA 4RNAA 3AN1A 1VDVA 1D6EC 4NAMA 2RDGA 2HDEA 1XEEA 4RGOS 2FUG1 4XE0A 1FXAA 3KQ4A 2W82A 1XF5L 2RDHA 2W54A 2WXIA 3TSSA 3FILA 1V1PA 1J7CA 1RYJA 2OEDA 2WDVB 1A70A 3ZJUA 1VZ7A 1C9FA 1ZDXA 2WXQA 4N6EB 2CJOA 1V97A 2ZW0A 4WWMA 2RMMA 1PGXA 1C4CA 4TQ1A 2BS4B 1YNTE 3AE6B 3Q8EA 1XCTL 2GRIA 1L0YB 2JYTA 4JPSA 5FKAC 2WXHA 2KN4A 2Y5CA 1TS3A 1P7FA 4FXCA 1I4GA 3HVDA 1MHXA 1DGJA 4LTUA 1CJEA 4GDKB 3H8HA 1C4AA 1KLGD 1SEBD 2QSDA 3IT4B 4RF0A 5EE1A 5FR3A 1TKGA 1AN8A 1TKEA 3IAM1 2MJDA 3ZQ4A 2GI9A 3P42A 4WQMA 1BUIC 2LGIA 1B1ZA 3IT6B 5D3IB 3T3OA 3HRDD 3NVYA 1TS2A 2B76B 2KWDA 5HG2A 3AE8B 1C4PA 1NYQA 2WXRA 4YSXB 4ZHPA 2W3SA 1WXQA 2I38A 1PFDA 3BWUD 1HEZE 2XNAC 1JRPA 2ZW1A 2WXGA 1P7EA 1D5MC 5G5HA 1XO3A 1HZ5A 1NEKB 2AQ2B 2KQ4X 2J52A 4C7YA 4L1BA 1NI3A 1ZP0B 1ZDVA 1ZXHA 3DWGC 1AW7A 1JWSD 2RPVA 2L52A 1FNUA 3W5UB 3RPFC 1FIQA 2ICIA 2WU5B 5D3DA 4WIPA 1J7AA 3SEBA 1DYQA 2N0SB 3BIID 3VQIA 3P4QB 3VR8B 2KACA 3AB5A 4A8XC 3LYYA 1FXIA 3PZ7A 1D5XC 1L0XB 1WSPA 1TY2A 1ACCA 5C3JB 3VRBB 2TSSA 3Q69A 1K50A 3B9JA 5H8YE 2H89B 2R61A 3PZ8A 4M0WA 1L4ZB 2V0GA 1FRDA 1FNVA 2WP9B 3ABVB 1FCLA 2LHEA 4REZA 1XLPA 2JX5A 2JU6X 3AEEB 1C77A 3E9SA 4LLGM 3W1SA 4HKQA 1L6VA 1JWBD 4JWSC 1RM6C 2BYTA 4HROA 3EUB2 3PO0A 3AEBB 3AMZA 2ONQA 5E6JA 1JMLA 1QT9A 5HHDG 2BBCA 2IDYA 3GP7A 1HA5A 4MM3B 4YXDB 5BMIA 2BS2B 3Q8FA 4P6VF 4RGNA 3ZYYX 1I4RA 1TS4A 2ACZB 1I4HA 1JWUD 3AE4B 4HKZE 2JZPA 1BXTA 1FM0D 2PVGC 5JXVA 2HTME 3V05A 5D7GA 3AEFB 1XLQA 2IPKD 1E6EB 1JALA 1YJJA 3FC4A 2BT6A 3MC0B 4N58A 2OHFA 3ETRA 3Q8BA 4KKJA 1PDXA 4O1NA 2WXNA 2MJEA 1C79A 3BZDB 1TKYA 2LJIA 1JCKB 1UWMA 4H2AA 1PGAA 1SJED 4ITKA 1D5ZC 1AYFA 1XXGA 5AUKA 2L1AA 5EE9A 1ESFA 4L23A 4MACA 3UI3A 4XWWA 3HVZA 2LMCA 3KWVA 1ZUD2 4YTMB 1VR9A 1NYRA 4OZCA 2WXPA 1FFUA 1MI0A 1ENFA 1SE3A 2CU3A 1KH0A 1HQRD 2LUMA 4UDUC 1NVID 2PW9A 1ZPSA 4WH4A 2V3PA 3AE2B 3IXSA 5HFYA 1SF0A 1V8CA 1WWTA 3AE1B 1J7BA 5G5GA 2INNE 3BYTB 5LNK1 3TUOA 4A9AA 1UNSA 1IBXB 1F2RC 1QILA 2IGHA 4GDLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGC A;  1P7E A;  5HI1 A;  1HZ5 A;  2KQ4 X;  2J52 A;  1K53 A;  1F2R I;  1ZXH A;  2RPV A;  2N9L A;  1Q10 A;  2PTL A;  2N7J A;  1EM7 A;  2KAC A;  1FD6 A;  1UWX A;  3V3X A;  3FIL B;  2NMQ A;  2K0P A;  3GB1 A;  2LHD A;  1IBX A;  1K50 A;  1MVK A;  4KGS A;  2JSV X;  2N9K A;  1FCL A;  2LHE A;  4OZB A;  2JU6 X;  1IGD A;  3MP9 A;  1K52 A;  5BMH A;  2QMT A;  2ONQ A;  5HHD G;  1JML A;  2EEL A;  5BMI A;  1D4B A;  5BMG A;  2JWU A;  4HKZ E;  4IOI E;  2JZP A;  1K51 A;  1XF5 L;  5JXV A;  4IKG A;  3FIL A;  2KDM A;  2OED A;  1MPE A;  1C9F A;  1MHH E;  2JXT A;  1XCQ L;  2ZW0 A;  2RMM A;  1PGX A;  1GB4 A;  1YNT E;  1XCT L;  2IGD A;  1HZ6 A;  2GB1 A;  2PLP A;  1PGB A;  2IGG A;  1FCC C;  1YMH E;  1GB1 A;  1PGA A;  2KN4 A;  1P7F A;  1MHX A;  4KGR A;  2ON8 A;  4HJG E;  4MAC A;  2J53 A;  3UI3 A;  2QSD A;  4OZC A;  1MI0 A;  2GI9 A;  2LGI A;  1KH0 A;  2LUM A;  2KWD A;  4GLS C;  5HG2 A;  2PW9 A;  4KGT A;  4WH4 A;  4OZA A;  4D2K A;  5HFY A;  2I38 A;  1HEZ E;  2ZW1 A;  2I2Y A;  1QKZ A;  1IBX B;  1F2R C;  2IGH A; 
#chains in the Genus database with same CATH topology
 4CO7 A;  1EWC A;  2BYF A;  2DZJ A;  4FHK A;  3QIJ A;  5AUI A;  1I35 A;  3RT3 B;  3L4P A;  5MPO A;  1NEN B;  2JXX A;  1B9R A;  3ZIM A;  1VD2 A;  5LXI B;  3QQ8 B;  4JX1 C;  1DOI A;  1WGG A;  1WGH A;  1FD6 A;  2ZCC A;  2OJW A;  3LXF A;  4F8C B;  2O2V A;  4F1S A;  3B2F A;  2K0P A;  4LNO A;  2VRR B;  1WXA A;  1F77 A;  1QF6 A;  4ZDV A;  4IM0 A;  5FR6 A;  4XGA B;  1ZW7 A;  2LRU A;  3V6E B;  4ANX A;  3RYT A;  1V6E A;  2N1V A;  3PHW B;  1KF6 B;  3PHX B;  2LWP A;  4RH6 A;  3ZUN A;  3OLM D;  2LFI A;  4G3X B;  2CKH B;  4K7S A;  4HDQ A;  2JWU A;  3APF A;  2Y5B B;  3GZN I;  1UZX B;  4NJ6 A;  2GLS A;  1SSN A;  4ZRI A;  1WRI A;  3GE3 C;  2DWQ A;  2BGF A;  3SR6 A;  2IGD A;  2GB1 A;  1QQR A;  2WDR B;  1DOY A;  2KDI A;  4PS8 A;  1WM3 A;  2CR5 A;  2LXA A;  3N1X C;  2K5P A;  4DXF A;  2SEB D;  3TEW A;  1EF1 A;  1TJE A;  4HPL B;  3DHG C;  3PSE B;  1L4D B;  4KIK A;  1WMH A;  3AV8 A;  4RFB A;  4PS3 A;  5L95 C;  4GLS C;  4KSL C;  4TMA B;  1T5X D;  3T8M A;  1TTN A;  3NVZ A;  4USA A;  3NUH B;  3RUI B;  2KTF A;  2YEP B;  4XC2 A;  3R2I A;  3L0W B;  4ZHO A;  3NVW A;  3L10 B;  4WJP A;  3W5V B;  3B08 A;  3K9O B;  2L32 A;  4RGM A;  1ET9 A;  4YT0 B;  2BB5 A;  3EHV A;  4IUM B;  3JVZ X;  1WY8 A;  2IY1 B;  4WJQ A;  3BK2 A;  3SD5 A;  1U4A A;  3H6N A;  1EU4 A;  3GS2 A;  1V5O A;  3JSV A;  3I3T B;  1TYG B;  1BML C;  3E56 A;  4C56 C;  3BVG A;  2WXK A;  1OQQ A;  3IHP C;  3FAH A;  2ZPY A;  4M01 A;  1N63 A;  2NR2 A;  4X57 B;  4EOY A;  2KXJ A;  1LO5 D;  2K39 A;  1TIF A;  4NJC A;  3DQV A;  4MDK E;  3ZRC A;  1WGR A;  5L83 A;  1ZKH A;  4K7W A;  4IM2 A;  1CZP A;  5BMG A;  4A55 A;  4IOI E;  1SIJ A;  1FMA D;  1C3T A;  4GN1 A;  1MPE A;  4DHZ E;  2C7M B;  4MH8 A;  1UF0 A;  2J42 A;  1SB3 C;  2WU2 B;  4P1C C;  3Q2A C;  2GBJ A;  2WS3 B;  1Z2M A;  2M56 B;  4PT5 A;  4C00 A;  3LB8 C;  2PKO A;  5EE3 A;  3M95 A;  4JGH B;  4NAW B;  3NZ3 A;  2BS3 B;  3AU4 A;  2IJ0 A;  2LJ5 A;  1AWD A;  2L8J A;  2LVP A;  2GBM A;  3ZKJ C;  4P1B C;  4US9 A;  3UQA A;  4W9I A;  3DCG A;  2KO3 A;  2JT4 B;  3AE3 B;  2QIE B;  4YTP B;  3MFG A;  4AOF A;  4KVG B;  2K8H A;  2MP2 A;  4YSZ B;  4CQN A;  2FCN A;  1IUE A;  1Q10 A;  2IYD B;  3A33 B;  2PJH A;  2WXM A;  2KJR A;  2JUO A;  1WYG A;  4L2Y A;  3FIL B;  2DYM A;  4PYU A;  1E7P B;  3WAN A;  3K9P B;  2QJL A;  3BVZ A;  4BFR A;  2M17 A;  2XK5 B;  3V62 A;  1MVK A;  1N61 A;  3RFZ B;  5TSS A;  2ZZP B;  3Q8C A;  2SAK A;  3R8B A;  2KWU B;  2ZVN A;  4G0N B;  1ET6 A;  1SJH D;  1VZ8 A;  1XLN A;  2CU1 A;  2OOB B;  3MP9 A;  2MWS B;  4ZRK A;  4XWT A;  3VTW A;  3Q3M C;  5HKH A;  2HDE A;  2W82 A;  2W54 A;  4N9F 4;  4E71 A;  2KD0 A;  4ICU A;  3ZJU A;  1C9F A;  2ZW0 A;  4TQ1 A;  3QAR A;  3Q8E A;  3Q3O C;  1E8Y A;  3WAP A;  2JYT A;  2V4L A;  5FKA C;  2KDE B;  3VXW A;  2KKC A;  3N1Z C;  1P7F A;  4KZC A;  1MHX A;  4LTU A;  1CJE A;  4P7I A;  1SEB D;  2C9W B;  2LVO A;  3IAM 1;  3ZQ4 A;  2GI9 A;  2ZPN A;  3H7P A;  5D3I B;  4K3B A;  2O6V A;  2KWD A;  5HG2 A;  1NYQ A;  4I6P A;  5J2R A;  3A4R A;  3PRE A;  2HTH A;  2I38 A;  4FLH A;  1PFD A;  2XNA C;  3RNA C;  3QCA A;  1MG8 A;  1OEY J;  4M0W B;  2C7N B;  1XO3 A;  1HZ5 A;  3IBE A;  1AW7 A;  4GDK A;  4G50 A;  5DPR A;  3W5U B;  1FIQ A;  4LNF A;  2DNF A;  2KMA A;  2WU5 B;  2IBI B;  1IPG A;  1ZGU B;  3P4Q B;  3KH0 A;  2RDB C;  4HJK A;  2KAC A;  5JH5 C;  2KT7 A;  1D5X C;  1WSP A;  1TY2 A;  1ACC A;  1E7U A;  1YIW A;  1K8R B;  1OEY A;  3RNB C;  4IC7 B;  4NJ7 A;  4WWN A;  4QAY A;  1WYW B;  1Q0W B;  2L0T A;  1L7Y A;  4REZ A;  1LQB A;  2JX5 A;  4LLG M;  3W1S A;  2BYT A;  1JML A;  4BBN F;  5BMI A;  5C23 A;  1YJ1 A;  2KFK B;  1I4R A;  3HM6 X;  3QX1 A;  2ACZ B;  1I4H A;  1JWU D;  4WWP A;  2JZP A;  5D7G A;  2MX2 A;  4HXD A;  3UIO B;  1XLQ A;  2IPK D;  2QCZ A;  1YJJ A;  3L17 A;  1A5R A;  4EFO A;  3Q8B A;  2MJE A;  2LXC A;  2LJI A;  3L13 A;  1UWM A;  4H2A A;  2G4D B;  1MJD A;  2K6D B;  3VDZ A;  1WE6 A;  5AUK A;  4MAC A;  4W9E A;  3UI3 A;  3DBL B;  3KWV A;  3WIM A;  2LAS A;  4OZC A;  4W9F A;  1MI0 A;  2D2Q A;  2KJ6 A;  1V80 A;  1WXS A;  2PW9 A;  3DBH B;  3NHE B;  2O2V B;  2V3P A;  3IXS A;  1E8X A;  3ZO5 B;  2N7E A;  2FCQ A;  3BYT B;  5LNK 1;  3TUO A;  4A9A A;  4CHK A;  3A9J A;  1OTR B;  2CJN A;  5HI1 A;  2DHZ A;  4DDI D;  3ZGZ A;  5JZE B;  1FEH A;  3DVG Y;  1LXD A;  2JRH A;  2M0A A;  1R4N B;  1UBI A;  3PT2 B;  1VCB A;  3DHI C;  3LDZ E;  1T6B X;  3J9C A;  4C7Z A;  2JQR B;  5IO9 A;  5AEK B;  1YQ4 B;  1WR6 E;  3VRA B;  1T0R C;  2NMQ A;  1TGZ B;  2V4I B;  3SFE B;  1EO6 A;  2W9N A;  1IBX A;  2AQ1 B;  4GDL A;  3ZNI D;  1F9J A;  1YQ3 B;  1E8Z A;  3PGE A;  2A5U A;  4KX6 B;  2LD9 A;  2FE8 A;  5BMH A;  3P4P B;  4MEM A;  2IO0 B;  4KIK B;  1WMH B;  4MSQ B;  4XDD A;  2QDF A;  2DAJ A;  3MHZ A;  3DBR B;  5AZF A;  3PRP B;  1CQV A;  4DQO C;  3N3K B;  4M8M A;  4JWU C;  3EEC A;  1MHH E;  2UU7 A;  1C76 A;  3WAL A;  1UEL A;  2PLP A;  3OG5 A;  2KAJ A;  1OQR A;  4RF1 A;  1RWS A;  3DOW A;  1FNW A;  4Q2J A;  2R2O A;  2AL6 A;  2MBB B;  3AEA B;  4JE3 B;  3PVL A;  4AS1 A;  5JHA A;  3ALB A;  1Z5S B;  4FAD A;  1RFA A;  5KHO A;  2LEK A;  3P2B A;  2L0F A;  3ZJV A;  1JRO A;  3DHH C;  1XT9 B;  2WXO A;  5I4D A;  1SE4 A;  2KNB A;  2Y3A A;  2WXL A;  3DBL I;  1QOF A;  3NJT A;  2FIF A;  3AE5 B;  2WYQ A;  1IYF A;  4OZA A;  1RLF A;  1EWY C;  4TKN A;  2RPQ A;  3OWE B;  4WAA A;  1YN3 A;  5DPW A;  2AEH A;  3DBH I;  4ZRQ A;  1YX5 B;  4TV3 A;  4RMA A;  2PIA A;  3BK1 A;  3I57 A;  1VRA B;  3ZDT A;  2N9L A;  3AI5 A;  2KX3 A;  4OVZ A;  3DVN U;  1V2Y A;  1Y56 A;  2V9H A;  5G2N A;  1R4N I;  4YWG G;  4YSY B;  2L83 A;  3MJ5 A;  5KHQ A;  4C4V A;  2VH2 A;  1L0V B;  1SXT A;  1T3Q A;  3R2T A;  1XLO A;  4WWO A;  3B0A A;  2Z8L A;  4MT5 A;  4A90 A;  2JY6 A;  3N30 A;  2CHZ A;  4XX5 A;  4DDG D;  2EEL A;  5E6O A;  2LVQ A;  2LZ6 A;  3KWL A;  5LXH A;  4IG7 B;  1ZXI A;  1T0Q C;  2M1M A;  3OJ3 A;  2KTR A;  2D5G A;  4NPN A;  2MSE D;  2N1W A;  2JXT A;  3A9K A;  3RNG C;  3VH3 B;  1GB4 A;  3HM3 A;  3DBR I;  3PZD A;  3AE7 B;  3BYY B;  2IGG A;  2IZV B;  3KUC B;  4KSK C;  1J19 A;  2LRW A;  1UBQ A;  1GJZ A;  2I1K A;  4TSS A;  2WXJ A;  2UYZ B;  1HTQ A;  5AZG A;  1N60 A;  1V86 A;  2BYV E;  2EMS A;  2UWQ A;  2N9E B;  2LGS A;  4GMV A;  4HRS A;  4OVU A;  2K22 A;  1WIA A;  4WJN A;  4LK0 M;  3H9D A;  1L6U A;  2MA9 B;  4MEL A;  3AH7 A;  2BPS A;  2ASQ A;  1OQY A;  4ANU A;  1YQB A;  1ZOY B;  2NPT A;  3ZLZ A;  2ZVO A;  5FK9 C;  2K8C A;  2AL3 A;  2KMC A;  2A4Z A;  1EM7 A;  1YJI A;  5D6J B;  2C7H A;  3B2G A;  2ZNV B;  2WLB A;  4GIV A;  4RGT A;  3SDL C;  3DPD A;  2HD5 B;  2IO3 B;  2MCN B;  1S1Q B;  2LGD A;  1WGK A;  1SGH A;  4OVV A;  2BTE A;  3CST A;  2J4X A;  2WQY B;  3PRM B;  3SFD B;  5BYR A;  1F0Z A;  4W9D A;  2QMT A;  1KOT A;  3Q8A A;  2VZK B;  5D2M B;  3BVM A;  4RNA A;  4JIO U;  3KW5 B;  3H7P B;  2ZJD A;  1XEE A;  2IY0 B;  4RGO S;  4AP4 C;  1WI0 A;  1FXA A;  2O6V B;  1FPY A;  3KYD D;  1XF5 L;  2MBO A;  2OED A;  2BYE A;  2BS4 B;  1WZ0 A;  3A4S C;  4JPS A;  3L54 A;  2JF5 A;  2KN4 A;  4I6L B;  1TS3 A;  3HVD A;  3R3M A;  2MQJ A;  4GDK B;  1KLG D;  2QSD A;  3IT4 B;  2KK8 A;  5FR3 A;  3AU5 A;  4DK5 A;  3QC8 B;  2NCN A;  4RM9 A;  2KDB A;  1B1Z A;  3HRD D;  3NVY A;  1TS2 A;  1GNU A;  1C4P A;  2J0K A;  4IWQ A;  4HK2 A;  2ZW1 A;  3PLV A;  1GUA B;  1MFW A;  2WXG A;  2DZM A;  3GE8 C;  2QC8 A;  5G5H A;  2KQ4 X;  1NEK B;  2AQ2 B;  2G4S A;  4HLE A;  1NI3 A;  4EZJ A;  3KVF B;  1ZXH A;  1L2N A;  2RPV A;  3V6C B;  1FNU A;  5D3D A;  5J17 A;  1DYQ A;  3BII D;  3U7D A;  4LJO B;  4A8X C;  3LYY A;  1KLV A;  3OAW A;  2DEN B;  2QHO A;  2TSS A;  3Q69 A;  2L7R A;  3PRZ A;  4I6N B;  3B9J A;  4EEW A;  5C1Z A;  2D3B A;  2NBW B;  2LHE A;  1XLP A;  2JU6 X;  1C77 A;  3C0R B;  1XD3 B;  3KUZ A;  5IN7 A;  4JWS C;  4MH0 E;  1PQS A;  3PO0 A;  3AEB B;  4JLC A;  1QT9 A;  4BKS A;  1LGR A;  2DZI A;  3VH4 B;  4AWJ A;  2PVG C;  1V49 A;  3AEF B;  1E6E B;  2HJ8 A;  2BT6 A;  2D10 A;  3MC0 B;  3IVF A;  2OHF A;  3ETR A;  2FUH B;  2V1Y A;  3A9J B;  3QJZ A;  4O1N A;  2K1F A;  2WXN A;  3M62 B;  1WZ3 A;  2M0X A;  4ITK A;  3RI7 C;  2XEW A;  2CHW A;  5EE9 A;  2KC2 A;  4L23 A;  4LJP B;  4XWW A;  3ENE A;  1VR9 A;  1QZE A;  4LNN A;  4PYZ A;  4FJZ A;  3NZU A;  3RCZ A;  1SE3 A;  2NS5 A;  4NNJ B;  3ZTD A;  1KJT A;  3AE2 B;  3RNC C;  3SHQ A;  1TBE A;  1V8C A;  3Q3F A;  1WWT A;  1J7B A;  2JVC A;  3ZXR A;  3TIX A;  1IBX B;  1F2R C;  3ZW3 A;  4GDL B;  2MBE A;  4R3D A;  4LDT B;  1LFD A;  1HE8 A;  3N32 A;  2K25 A;  2JRI B;  3P63 A;  2GBK A;  3DVN V;  3T9L A;  2PTL A;  4KDL B;  1ZE3 D;  4EE2 A;  3H7S A;  1QOB A;  4HEA 1;  3U4E G;  2PEA A;  4BKG A;  1LM8 B;  1FO4 A;  3AEC B;  1FRR A;  3B1L X;  3ZXV A;  2BW2 A;  3VR9 B;  2BKF A;  2BKR B;  4BOS C;  3QHT A;  3IG3 A;  1P98 A;  2N9K A;  3VAW A;  4OZB A;  4DWF A;  2X38 A;  1WX9 A;  2IND C;  1TS5 A;  4WAF A;  2BWF A;  2G9H D;  1E0Z A;  3N9Y C;  2M19 A;  1P0R A;  3P1M A;  4HPP A;  3EGR A;  3I9V 1;  3KLS X;  1J8C A;  2EKI A;  4IKG A;  2KDM A;  2IO1 B;  3V61 A;  4RCO A;  3ZNH B;  2DYO A;  1I4P A;  3SU8 X;  1F52 A;  1JW9 D;  2WNM A;  2LGX A;  3NRZ A;  4J3O D;  1E9M A;  1FCC C;  2CS4 A;  1HXY D;  2DX5 B;  2BF8 B;  1SBB B;  3P4R B;  2YEP F;  2ON8 A;  4BBN C;  1TT5 B;  1GC7 A;  1CK1 A;  5IKC M;  1WJU A;  3S2A A;  1SE9 A;  3AXC A;  2C60 A;  4A6Q A;  4US8 A;  5JHB A;  3T3N A;  3W2D A;  1OGW A;  4D2K A;  1JQ4 A;  1D3Z A;  5BO4 B;  5E6P A;  4C4V B;  1STE A;  1KTK A;  1QKZ A;  2INP E;  2JYE A;  3EC8 A;  2MJ3 A;  1VLB A;  1C1Y B;  1UGJ A;  4B6W A;  2AX5 A;  2E6X A;  3UIN B;  2WDT B;  3CWI A;  1CMX B;  1M94 A;  4IM3 A;  3V3X A;  3A1Q A;  2KTR B;  1GG3 A;  2HE7 A;  1WX8 A;  5EE0 A;  1OFF A;  2GBN A;  3NVV A;  3PTF C;  1WRD B;  1UD7 A;  4W9H A;  2J0M A;  2AYO B;  2XK5 A;  3GOE A;  3ONS A;  1IGD A;  2VZK D;  3U7Z A;  1ROE A;  2O6V D;  4ANW A;  1E7V A;  1M4V A;  4W9G A;  3FKY A;  3V60 A;  4W9J A;  1UUP A;  3NG0 A;  4KDI C;  2K3U A;  4A3P A;  4DHZ B;  1XCQ L;  3NS1 A;  2WDQ B;  4GB9 A;  1S3S G;  3VUX A;  2MBQ A;  4JL9 A;  1PGB A;  4W9K A;  2G3Q B;  1WJ6 A;  2NPT B;  4WJO A;  3RZW C;  2QIL A;  3APD A;  2Y5P A;  2N9P C;  3RMK C;  2KQS A;  2J7Q B;  3DWM A;  4EZK A;  2MEK A;  4EUT A;  4K3C A;  1N5W A;  1VJK A;  2NVU I;  1YN5 A;  2BVC A;  3ML9 A;  4URK A;  1F1H A;  2KWC A;  2GMI C;  3N20 C;  4LNI A;  4N59 A;  1KM7 A;  3ML8 A;  1E10 A;  2EKE C;  1IGC A;  1MG4 A;  2WXF A;  4W9C A;  5GXG B;  1KRH A;  3ZNG C;  4M00 A;  1QLB B;  4K1R B;  3TEY A;  3X0W A;  4II2 B;  4XDC A;  3JSV B;  4ASW C;  2FBW B;  3RD2 A;  3QAQ A;  1L5P A;  2WHI A;  1I4X A;  1V81 A;  2QEJ C;  1GAQ B;  2E3T A;  3JW0 X;  2XBB C;  4FJV B;  4DXG A;  1NBF C;  4PK1 A;  3IAS 1;  3Q14 C;  3GB1 A;  3I63 C;  3UF8 A;  2K9X A;  4KGS A;  1H4R A;  2DAF A;  2LI5 A;  4ARI A;  2IO2 B;  4E74 A;  4G11 A;  4YTN B;  2KHW B;  3RNF C;  4HVB A;  2KVR A;  4AJY B;  3N1Y C;  4MJS A;  3AN1 A;  3H1U A;  4MGI E;  4NAM A;  2D3A A;  2FUG 1;  4XE0 A;  3PV1 A;  3KQ4 A;  3MHS D;  3TSS A;  1V1P A;  1J7C A;  1RYJ A;  2WDV B;  1A70 A;  2KFK A;  4NQL B;  1VZ7 A;  4HCN B;  2WXQ A;  4GXB A;  1P1A A;  1V97 A;  2RMM A;  4KZ0 A;  3AE6 B;  1XCT L;  2KQ7 A;  1L0Y B;  2N4F A;  2KVZ A;  3C19 A;  2Y5C A;  2KOX A;  3PLU A;  1DGJ A;  2D11 A;  3H8H A;  3LJ3 A;  4YL8 A;  4RF0 A;  2MLB A;  1TKG A;  3ZTC A;  2MJD A;  3HIZ A;  2J0J A;  2KAN A;  3P42 A;  4WQM A;  1BUI C;  5CX3 A;  3IT6 B;  2B76 B;  3AE8 B;  2WXR A;  4A20 A;  2HJ1 A;  3BWU D;  2OJR A;  4LDT D;  1HEZ E;  1JRP A;  3HHM A;  3QA8 A;  2MP2 B;  1P7E A;  1D5M C;  1WJN A;  2J52 A;  4L1B A;  4IW0 A;  3DWG C;  2INC C;  1JWS D;  2L52 A;  2FCS A;  4WIP A;  4BZA A;  2ZEQ A;  3I5J C;  2Z0D B;  1FXI A;  3PZ7 A;  1L0X B;  4NQK E;  3O65 B;  2RSU A;  5C3J B;  2M4N A;  1K50 A;  5H8Y E;  2H89 B;  1FRD A;  1FNV A;  3ABV B;  1FCL A;  3M3J A;  3AEE B;  1Q5W B;  4HKQ A;  1L6V A;  3VVW B;  4F7Z A;  1RRB A;  4HRO A;  3EUB 2;  3AMZ A;  2ONQ A;  5E6J A;  5HHD G;  2BBC A;  4AJW A;  3GP7 A;  1HA5 A;  4YXD B;  2KX0 A;  1TS4 A;  3AE4 B;  4HKZ E;  2KFJ A;  1BXT A;  5JXV A;  3V05 A;  3EFC A;  4FHJ A;  1JAL A;  3FC4 A;  2CHX A;  4B9K A;  2KLC A;  2KDF B;  3CF6 E;  1Q1O A;  4B95 A;  4MGZ E;  4KKJ A;  1PDX A;  1T0S C;  4CYE A;  5E6N A;  3BZD B;  1TKY A;  3CMM B;  3RNE C;  1SJE D;  1D5Z C;  1V5T A;  1XXG A;  4XZ4 A;  1ESF A;  3CSF A;  3RZF A;  2LGY A;  2LMC A;  3W1Y A;  1ZUD 2;  3DDC B;  2FAZ A;  4GU2 A;  2WXP A;  1FFU A;  4MM3 A;  5CHV C;  1ENF A;  2CU3 A;  1EUV B;  2C5L C;  1HQR D;  2LUM A;  3BIN A;  4FJY A;  3X23 A;  2M8S A;  3NZS A;  3ECI A;  5CHW A;  1SF0 A;  5G5G A;  2INN E;  4RM8 A;  1UNS A;  3PS6 A;  4IWO A;  3DVG X;  4PS7 A;  1RFK A;  1C78 A;  2K6Q A;  2I1J A;  1K53 A;  3ZJT A;  1F2R I;  1WJ4 A;  1WE7 A;  4HCP B;  4KKI A;  2WGS A;  1EU3 A;  3M63 B;  4IWP A;  5DPS A;  2N7J A;  5C2T B;  3WA0 A;  1R7S A;  4FN2 A;  5IA7 A;  4ANV A;  1V1O A;  1GPX A;  4K7U A;  1QOA A;  2G45 B;  2JPH A;  3VUY A;  2RD0 A;  3L16 A;  2LHD A;  1YN4 A;  4AQ7 A;  3W9C B;  1FFV A;  2KMM A;  2JSV X;  1E5W A;  2PMV A;  3AM9 A;  3O13 A;  3Q6B A;  4WUR A;  2PPH A;  2MH7 A;  1NI2 A;  3P4S B;  1YOV B;  3AE9 B;  3WCQ A;  4W9L A;  1D4B A;  2R2Q A;  1K51 A;  3C8Y A;  1YD8 U;  1T0Y A;  5IOI A;  4P16 A;  1I7H A;  3ZRF A;  3EA6 A;  1VZ6 A;  1SE2 A;  3QWZ B;  1HZ6 A;  1P3Q U;  1YMH E;  1TZO A;  3R7Q A;  4FA6 A;  1E90 A;  1RAX A;  2Q5W D;  2KWV B;  2BB6 A;  3VFK A;  2J53 A;  2D3C A;  3U30 A;  3U8Z A;  2D3G A;  2DLB A;  4FBJ B;  4ZOH C;  1E8W A;  3VHT C;  4NY0 A;  4E3C A;  2PVO D;  4EKU A;  3A1Q B;  1R4M B;  4ARC A;  5TR5 A;  1GOZ A;  1GC6 A;  5EDS A;  3UQB A;  3HUI A;  4DHJ B;  4NZL B;  5D94 A;  4TUU A;  3U52 E;  1WXM A;  3RN9 C;  4KV2 A;  1NDD A;  1N5X A;  4LCD E;  5T8I A;  2KJH B;  4A3O A;  4TQ0 A;  2RGF A;  1J0G A;  4FUL A;  4HDO A;  4HWI B;  4K81 A;  1QOG A;  1UH6 A;  1UWX A;  2MBH A;  2BWE S;  3Q3J A;  3UGB B;  1I4Q A;  1X1M A;  3OJ4 B;  2KC1 A;  5GMV A;  2JWZ A;  3AED B;  1G6J A;  1Y8R C;  2Z0E B;  4HPM B;  1PYW D;  1BT0 A;  3AEG B;  3MC8 A;  2H88 B;  4MSM B;  2XN9 C;  4BKT A;  2VH1 A;  1WFY A;  1JWM D;  4GSW A;  2V3S A;  3L08 A;  2FID A;  4WQO B;  3TJP A;  3IFW B;  2EMT A;  1WGY A;  1PUT A;  3TEZ A;  3NS8 A;  3MTN B;  1KFY B;  1HTO A;  1KLU D;  2AQ3 B;  1JWA D;  2DZK A;  3TL5 A;  2X8X X;  2NTT A;  4OW0 A;  4B0M A;  1GB1 A;  1N62 A;  3TEX A;  3NY5 A;  4XYC A;  4KGR A;  4HJG E;  2V3N A;  2JZZ A;  5BYS A;  2L76 A;  5J18 A;  4C80 A;  3CIR B;  1WH3 A;  5IAA C;  2NBU A;  1TY0 A;  1ISN A;  4KGT A;  4ZRP A;  2MHJ A;  1EF5 A;  4OHJ A;  2WX1 A;  2W3R A;  2I2Y A;  2RR9 A;  3R66 C;  1WXV A;  1N6Z A;  1H8C A;  1R4M I;  2NTS A;  2GBR A;  2ZNV C;  3JYU A;  5BYQ A;  5AZH A;  3U2S C;  1WM2 A;  4BKS D;  3TCA A;  2W55 A;  4M02 A;  1V9J A;  4MJS B;  4NAW A;  3TMP B;  4ZYS A;  5G55 A;  4IDI A;  3URY A;  2ZCB A;  1V1P B;  1UGM A;  2JZ3 B;  2FCM A;  2PE9 A;  2REX A;  1AAR A;  1WF9 A;  5DCN A;  4BVU C;  3KYC D;  3ZNZ B;  1I42 A;  1DOX A;  1WGD A;  5H92 C;  4ZRJ A;  2DBY A;  3RUL A;  4S0R A;  2N7D A;  2G1E A;  1K52 A;  2N9X A;  4B0E A;  3BY4 B;  1VDV A;  1D6E C;  1SIF A;  2RDG A;  3A9K B;  2DYB A;  2RDH A;  2WXI A;  4ZYN A;  3FIL A;  4BOZ B;  4MGY E;  2WX0 A;  1ZDX A;  4N6E B;  2CJO A;  4EZL A;  2K8B A;  4WWM A;  1PGX A;  1C4C A;  1YNT E;  2GRI A;  4ACF A;  2MRP A;  2WXH A;  3VTV A;  1XQQ A;  4FXC A;  1I4G A;  5DPT A;  1TZ1 A;  3APC A;  4LNK A;  1C4A A;  5EE1 A;  1FXT B;  4M8N A;  1AN8 A;  1TKE A;  3WAM A;  3W1S C;  3AUL A;  2KZR A;  2LGI A;  3T3O A;  2FNJ B;  4DXA B;  4ZHP A;  4YSX B;  2W3S A;  1WXQ A;  3NOB A;  1WX7 A;  2NBV B;  2L3Z A;  2YLM A;  4ICV A;  4C7Y A;  3TBL D;  1ZP0 B;  1ZDV A;  2L00 B;  3VTU A;  2PE6 B;  2B3A A;  3RPF C;  2WWZ A;  2ICI A;  4AUQ C;  2BQQ A;  1J7A A;  3SEB A;  2N0S B;  3VQI A;  5CTR C;  3VR8 B;  3AB5 A;  4II3 B;  4J6I A;  3R7R A;  3QK0 A;  2AWT A;  3MJW A;  3DBS A;  3VRB B;  1IP9 A;  3ZDM C;  2LUE A;  1JRU A;  2KLG A;  2R61 A;  4M0W A;  3PZ8 A;  2V0G A;  1L4Z B;  2WP9 B;  4BAX A;  4S17 A;  3E9S A;  3UIP B;  1JWB D;  2MW5 A;  2GOW A;  1RM6 C;  3GZN B;  2L05 A;  2IDY A;  4MM3 B;  3Q3N C;  2BS2 B;  3Q8F A;  4P6V F;  4RGN A;  3ZYY X;  2D07 B;  4JQW C;  5IP4 D;  4MGK E;  2KYW A;  1FM0 D;  2HTM E;  3ZVV A;  4GOC A;  3MC9 A;  4N58 A;  1C79 A;  1JCK B;  1WR1 A;  2KN5 A;  5LLI A;  3HK0 A;  3EFU A;  1PGA A;  3PPA A;  1AYF A;  1P9D U;  2L1A A;  5CHF A;  3HVZ A;  4GGQ A;  4YTM B;  1YX6 B;  1NYR A;  2Z59 B;  3KUD B;  4DHJ D;  1KH0 A;  4UDU C;  3VUW A;  1NVI D;  1ZPS A;  4WH4 A;  4DBG A;  5HFY A;  2YVC A;  3D32 A;  3AE1 B;  3WAO A;  1QIL A;  2IGH A; 
#chains in the Genus database with same CATH homology
 4R3D A;  2CJN A;  1EWC A;  5HI1 A;  1RFK A;  1C78 A;  3ZGZ A;  1K53 A;  3ZJT A;  5AUI A;  1F2R I;  1FEH A;  3L4P A;  5MPO A;  2M0A A;  1NEN B;  3P63 A;  4KKI A;  1EU3 A;  1T6B X;  3J9C A;  1B9R A;  2PTL A;  2N7J A;  4C7Z A;  1ZE3 D;  2JQR B;  4JX1 C;  5C2T B;  1DOI A;  1R7S A;  1YQ4 B;  4EE2 A;  1FD6 A;  3LXF A;  1V1O A;  3VRA B;  1QOB A;  4HEA 1;  1GPX A;  3B2F A;  2NMQ A;  3U4E G;  1QOA A;  2K0P A;  2V4I B;  1FO4 A;  3AEC B;  3SFE B;  1FRR A;  2LHD A;  1YN4 A;  1IBX A;  2BW2 A;  3VR9 B;  3W9C B;  4AQ7 A;  2AQ1 B;  1F77 A;  1FFV A;  1QF6 A;  2KMM A;  2JSV X;  2N9K A;  4OZB A;  1YQ3 B;  2PMV A;  3AM9 A;  3O13 A;  2X38 A;  4WUR A;  1TS5 A;  1KF6 B;  4KX6 B;  4RH6 A;  4WAF A;  2MH7 A;  3P4S B;  2G9H D;  2LFI A;  1E0Z A;  2FE8 A;  3N9Y C;  3P4P B;  2M19 A;  5BMH A;  3P1M A;  3AE9 B;  3WCQ A;  3EGR A;  4XDD A;  1D4B A;  3MHZ A;  3I9V 1;  2JWU A;  3KLS X;  1K51 A;  2EKI A;  4IKG A;  3C8Y A;  2KDM A;  1CQV A;  4DQO C;  1SSN A;  4P16 A;  1I7H A;  1WRI A;  4JWU C;  4RCO A;  1MHH E;  3EA6 A;  2DYO A;  1I4P A;  1VZ6 A;  1SE2 A;  1C76 A;  1JW9 D;  2WNM A;  2DWQ A;  3SR6 A;  3NRZ A;  2IGD A;  4J3O D;  1HZ6 A;  2GB1 A;  1QQR A;  2PLP A;  2WDR B;  1E9M A;  1FCC C;  1YMH E;  2KAJ A;  1DOY A;  1TZO A;  1OQR A;  1HXY D;  4RF1 A;  1RWS A;  1SBB B;  1FNW A;  3P4R B;  4Q2J A;  2YEP F;  2Q5W D;  2ON8 A;  2K5P A;  2BB6 A;  3AEA B;  4JE3 B;  2SEB D;  2J53 A;  4DXF A;  3TEW A;  4AS1 A;  1CK1 A;  2DLB A;  1TJE A;  4ZOH C;  2LEK A;  3ZJV A;  1JRO A;  1L4D B;  2WXO A;  3AV8 A;  5I4D A;  1SE4 A;  4RFB A;  2Y3A A;  4A6Q A;  2PVO D;  4US8 A;  2WXL A;  4GLS C;  4TMA B;  1QOF A;  4ARC A;  1T5X D;  3NVZ A;  1GOZ A;  3AE5 B;  3W2D A;  3T3N A;  4USA A;  4OZA A;  4D2K A;  3HUI A;  3NUH B;  1JQ4 A;  4NZL B;  1EWY C;  1STE A;  1KTK A;  3U52 E;  2YEP B;  3OWE B;  3R2I A;  1QKZ A;  2INP E;  1YN3 A;  4ZHO A;  2JYE A;  3NVW A;  2MJ3 A;  1VLB A;  3W5V B;  4ZRQ A;  2L32 A;  1N5X A;  1UGJ A;  4RGM A;  2AX5 A;  1ET9 A;  4YT0 B;  2BB5 A;  2PIA A;  5T8I A;  3BK1 A;  3I57 A;  4TQ0 A;  1VRA B;  2E6X A;  2N9L A;  3BK2 A;  4OVZ A;  3CWI A;  1Y56 A;  1EU4 A;  3GS2 A;  1QOG A;  1UWX A;  3V3X A;  4YWG G;  1TYG B;  4YSY B;  2L83 A;  1BML C;  3MJ5 A;  3E56 A;  5EE0 A;  4C56 C;  1I4Q A;  3BVG A;  2WXK A;  1L0V B;  1OQQ A;  1SXT A;  1OFF A;  1T3Q A;  3R2T A;  3NVV A;  3FAH A;  1XLO A;  3AED B;  1N63 A;  2Z8L A;  4MT5 A;  1PYW D;  3AEG B;  4A90 A;  1LO5 D;  1IGD A;  2VZK D;  2H88 B;  2XN9 C;  3U7Z A;  4NJC A;  1JWM D;  1ROE A;  2EEL A;  1CZP A;  3KWL A;  5BMG A;  1M4V A;  1ZXI A;  4A55 A;  4IOI E;  1PUT A;  1SIJ A;  3TEZ A;  1FMA D;  1KFY B;  1UUP A;  2D5G A;  1MPE A;  4MH8 A;  2K3U A;  2JXT A;  1XCQ L;  3NS1 A;  1KLU D;  2AQ3 B;  1JWA D;  2WDQ B;  1GB4 A;  2J42 A;  3AE7 B;  3BYY B;  2IGG A;  1PGB A;  1SB3 C;  2WU2 B;  2NTT A;  4OW0 A;  4B0M A;  1GB1 A;  2WS3 B;  2M56 B;  1N62 A;  3TEX A;  4PT5 A;  2QIL A;  4KGR A;  2Y5P A;  4HJG E;  2V3N A;  3DWM A;  3LB8 C;  2PKO A;  4TSS A;  2WXJ A;  5BYS A;  5EE3 A;  4C80 A;  3CIR B;  4NAW B;  2MEK A;  3NZ3 A;  2BS3 B;  1N60 A;  2IJ0 A;  1TY0 A;  1N5W A;  1AWD A;  4KGT A;  1VJK A;  4ZRP A;  1YN5 A;  4HRS A;  2K22 A;  4LK0 M;  4US9 A;  4OHJ A;  1L6U A;  2W3R A;  2I2Y A;  3AH7 A;  3AE3 B;  4N59 A;  1E10 A;  1IGC A;  2QIE B;  2NTS A;  4YTP B;  2WXF A;  5BYQ A;  5GXG B;  3U2S C;  3MFG A;  1ZOY B;  4YSZ B;  1KRH A;  4CQN A;  1IUE A;  2W55 A;  5FK9 C;  1QLB B;  3TEY A;  1Q10 A;  4XDC A;  2FBW B;  2WXM A;  4ZYS A;  1L5P A;  4IDI A;  1EM7 A;  1YJI A;  1WYG A;  3URY A;  1I4X A;  2QEJ C;  4L2Y A;  1GAQ B;  3FIL B;  1V1P B;  3B2G A;  2E3T A;  2DYM A;  4DXG A;  1E7P B;  2QJL A;  2WLB A;  3BVZ A;  1DOX A;  4RGT A;  3IAS 1;  3GB1 A;  1MVK A;  5H92 C;  1N61 A;  2DBY A;  3RFZ B;  2K9X A;  1WGK A;  4KGS A;  5TSS A;  3Q8C A;  2SAK A;  4ARI A;  3R8B A;  2BTE A;  2J4X A;  2WQY B;  3SFD B;  1ET6 A;  1SJH D;  1VZ8 A;  1XLN A;  3MP9 A;  5BYR A;  2G1E A;  1K52 A;  4YTN B;  4XWT A;  1F0Z A;  4B0E A;  2QMT A;  3Q8A A;  2VZK B;  3BVM A;  4RNA A;  3AN1 A;  1VDV A;  1D6E C;  4NAM A;  2RDG A;  2HDE A;  1XEE A;  4RGO S;  2FUG 1;  4XE0 A;  1FXA A;  3KQ4 A;  2W82 A;  1XF5 L;  2RDH A;  2W54 A;  2WXI A;  3TSS A;  3FIL A;  1V1P A;  1J7C A;  1RYJ A;  2OED A;  2WDV B;  1A70 A;  3ZJU A;  1VZ7 A;  1C9F A;  1ZDX A;  2WXQ A;  4N6E B;  2CJO A;  1V97 A;  2ZW0 A;  4WWM A;  2RMM A;  1PGX A;  1C4C A;  4TQ1 A;  2BS4 B;  1YNT E;  3AE6 B;  3Q8E A;  1XCT L;  2GRI A;  1L0Y B;  2JYT A;  4JPS A;  5FKA C;  2WXH A;  2KN4 A;  2Y5C A;  1TS3 A;  1P7F A;  4FXC A;  1I4G A;  3HVD A;  1MHX A;  1DGJ A;  4LTU A;  1CJE A;  4GDK B;  3H8H A;  1C4A A;  1KLG D;  1SEB D;  2QSD A;  3IT4 B;  4RF0 A;  5EE1 A;  5FR3 A;  1TKG A;  1AN8 A;  1TKE A;  3IAM 1;  2MJD A;  3ZQ4 A;  2GI9 A;  3P42 A;  4WQM A;  1BUI C;  2LGI A;  1B1Z A;  3IT6 B;  5D3I B;  3T3O A;  3HRD D;  3NVY A;  1TS2 A;  2B76 B;  2KWD A;  5HG2 A;  3AE8 B;  1C4P A;  1NYQ A;  2WXR A;  4YSX B;  4ZHP A;  2W3S A;  1WXQ A;  2I38 A;  1PFD A;  3BWU D;  1HEZ E;  2XNA C;  1JRP A;  2ZW1 A;  2WXG A;  1P7E A;  1D5M C;  5G5H A;  1XO3 A;  1HZ5 A;  1NEK B;  2AQ2 B;  2KQ4 X;  2J52 A;  4C7Y A;  4L1B A;  1NI3 A;  1ZP0 B;  1ZDV A;  1ZXH A;  3DWG C;  1AW7 A;  1JWS D;  2RPV A;  2L52 A;  1FNU A;  3W5U B;  3RPF C;  1FIQ A;  2ICI A;  2WU5 B;  5D3D A;  4WIP A;  1J7A A;  3SEB A;  1DYQ A;  2N0S B;  3BII D;  3VQI A;  3P4Q B;  3VR8 B;  2KAC A;  3AB5 A;  4A8X C;  3LYY A;  1FXI A;  3PZ7 A;  1D5X C;  1L0X B;  1WSP A;  1TY2 A;  1ACC A;  5C3J B;  3VRB B;  2TSS A;  3Q69 A;  1K50 A;  3B9J A;  5H8Y E;  2H89 B;  2R61 A;  3PZ8 A;  4M0W A;  1L4Z B;  2V0G A;  1FRD A;  1FNV A;  2WP9 B;  3ABV B;  1FCL A;  2LHE A;  4REZ A;  1XLP A;  2JX5 A;  2JU6 X;  3AEE B;  1C77 A;  3E9S A;  4LLG M;  3W1S A;  4HKQ A;  1L6V A;  1JWB D;  4JWS C;  1RM6 C;  2BYT A;  4HRO A;  3EUB 2;  3PO0 A;  3AEB B;  3AMZ A;  2ONQ A;  5E6J A;  1JML A;  1QT9 A;  5HHD G;  2BBC A;  2IDY A;  3GP7 A;  1HA5 A;  4MM3 B;  4YXD B;  5BMI A;  2BS2 B;  3Q8F A;  4P6V F;  4RGN A;  3ZYY X;  1I4R A;  1TS4 A;  2ACZ B;  1I4H A;  1JWU D;  3AE4 B;  4HKZ E;  2JZP A;  1BXT A;  1FM0 D;  2PVG C;  5JXV A;  2HTM E;  3V05 A;  5D7G A;  3AEF B;  1XLQ A;  2IPK D;  1E6E B;  1JAL A;  1YJJ A;  3FC4 A;  2BT6 A;  3MC0 B;  4N58 A;  2OHF A;  3ETR A;  3Q8B A;  4KKJ A;  1PDX A;  4O1N A;  2WXN A;  2MJE A;  1C79 A;  3BZD B;  1TKY A;  2LJI A;  1JCK B;  1UWM A;  4H2A A;  1PGA A;  1SJE D;  4ITK A;  1D5Z C;  1AYF A;  1XXG A;  5AUK A;  2L1A A;  5EE9 A;  1ESF A;  4L23 A;  4MAC A;  3UI3 A;  4XWW A;  3HVZ A;  2LMC A;  3KWV A;  1ZUD 2;  4YTM B;  1VR9 A;  1NYR A;  4OZC A;  2WXP A;  1FFU A;  1MI0 A;  1ENF A;  1SE3 A;  2CU3 A;  1KH0 A;  1HQR D;  2LUM A;  4UDU C;  1NVI D;  2PW9 A;  1ZPS A;  4WH4 A;  2V3P A;  3AE2 B;  3IXS A;  5HFY A;  1SF0 A;  1V8C A;  1WWT A;  3AE1 B;  1J7B A;  5G5G A;  2INN E;  3BYT B;  5LNK 1;  3TUO A;  4A9A A;  1UNS A;  1IBX B;  1F2R C;  1QIL A;  2IGH A;  4GDL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...