1OQRA

Crystal structure of c73s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.65a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
molecule keywords Putidaredoxin
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqrA00
4N59A 4US8A 3AE7B 1IUEA 3AE5B 2MJEA 3NVZA 1TJEA 1NI3A 1L6UA 4YTNB 2CJNA 3HUIA 1FRRA 1FMAD 2WU2B 3VR8B 3AEBB 1KRHA 1CZPA 2KAJA 2MJDA 3AEFB 1L5PA 1QOBA 2BS2B 1NYRA 1V97A 2M19A 1DGJA 1XLPA 3AH7A 4FXCA 1N5WA 1B9RA 1NVID 4YSXB 2WP9B 1I7HA 1VLBA 1YJIA 4N6EB 3WCQA 1KF6B 2CJOA 4HRSA 4WQMA 4YSZB 1TKGA 2CU3A 2K5PA 2WDQB 2G1EA 2W3RA 1JROA 1PDXA 2WS3B 3AEEB 3B2FA 5AUKA 3EUB2 2MH7A 3FC4A 1NEKB 3P1MA 2Q5WD 3AM9A 5G5HA 1QF6A 1SIJA 3NVWA 4YSYB 3SFEB 3W5UB 1NYQA 1L6VA 1QOFA 1DOIA 1XO3A 3NVYA 2MJ3A 1JW9D 4YTPB 4C7ZA 1N63A 2M56B 1FO4A 1WYGA 1RM6C 1A70A 1E6EB 1FIQA 2JQRB 2OHFA 2H89B 1QLBB 1V8CA 3AE1B 4WWMA 1XLQA 3CWIA 1E9MA 1WGKA 1TKYA 3AE3B 4USAA 1E0ZA 4YTMB 3ETRA 1FM0D 3HVZA 1JWBD 4IDIA 3P4QB 4LTUA 3AE6B 1KFYB 1WXQA 3AECB 5GXGB 1FXIA 3VRAB 1T3QA 2K22A 2EKIA 2WDRB 3P4SB 4JWSC 4ZHPA 3AB5A 3ZYYX 1DOXA 3RPFC 3AEDB 1QOGA 1YQ3B 2ACZB 2WDVB 1DOYA 1J7CA 4ITKA 3LXFA 5H92C 3B9JA 3NS1A 4US9A 5MPOA 1JRPA 4JWUC 3SR6A 2BS4B 3VR9B 1RWSA 4ZHOA 1GAQB 1UWMA 3P63A 2AX5A 4A9AA 3W9CB 1L0VB 3DWGC 1NENB 4N58A 1FFVA 3P4RB 2B76B 3NRZA 4YXDB 1E10A 1CJEA 1FRDA 3AEGB 2HTME 2PKOA 2E3TA 3PO0A 4JX1C 5AUIA 1JWAD 2WQYB 2Y5CA 1R7SA 1OQRA 3HRDD 3AN1A 4P6VF 1OFFA 2PIAA 1FFUA 2BT6A 1XLNA 2QJLA 3AE8B 2K9XA 5EE0A 2BS3B 1E7PB 2PVGC 2DBYA 1WWTA 1EWYC 3W5VB 4KX6B 1XLOA 3NVVA 1JALA 2LEKA 2W55A 2L83A 1ZXIA 1SB3C 1SF0A 1F0ZA 1N5XA 1OQQA 2JX5A 2H88B 2PVOD 5G5GA 1TYGB 2KMMA 3LB8C 3BIID 4C80A 1N61A 3L4PA 4C7YA 5C2TB 1AWDA 2N0SB 1AYFA 1YQ4B 1J7BA 5EE3A 3P4PB 5C3JB 3B2GA 3ABVB 5EE1A 1ROEA 4YT0B 2W54A 1ZUD2 1ZP0B 3AE4B 3AMZA 1FXAA 1VDVA 4ZOHC 5H8YE 3AV8A 1GPXA 2FBWB 1PUTA 3CIRB 1QT9A 1ZOYB 1YJJA 1WRIA 2W3SA 3AE9B 1N62A 1J7AA 3KWLA 3VRBB 1N60A 2WU5B 3DWMA 3FAHA 2L52A 2QIEB 2WLBA 4HROA 3AE2B 1QOAA 3AEAB 5EE9A 1RFKA 1JQ4A 1PFDA 1TKEA 1VJKA 3SFDB 2DWQA 1RYJA
chains in the Genus database with same CATH superfamily
1YIWA 3T8MA 4NJCA 3B1LX 4YTNB 3PGEA 1EO6A 1L2NA 2JRIB 4JE3B 1WI0A 4WQOB 2N9LA 5BMIA 1L0YB 1NDDA 4UDUC 3I63C 2DZIA 2FIDA 4NZLB 1CK1A 2RGFA 1WF9A 1UGJA 2MH7A 1GC7A 2V9HA 3W5UB 1YMHE 3R7QA 1SJHD 2O6VA 2QILA 2BVCA 1WIAA 4C56C 2L05A 2IY1B 4FJYA 1WGKA 2KVZA 1E0ZA 5HHDG 3AECB 1PGXA 3DBLB 4A8XC 3ZDTA 2WDTB 1A5RA 3DCGA 2ACZB 2R2OA 2V3PA 1RFAA 1K8RB 1YOVB 2UYZB 4HDOA 4GU2A 4RFBA 1YX6B 1FCLA 5IOIA 3PHWB 1UWXA 5D3DA 2KVRA 3FILB 1WXSA 2TSSA 4F7ZA 1E7PB 3ZDMC 5IA7A 1Z5SB 1C4AA 2LEKA 2WYQA 1SF0A 2H88B 3VXWA 3KUDB 2EMSA 4KGSA 2N1VA 1SJED 3KLSX 1WXAA 4YT0B 2LRUA 4B95A 2IGDA 1ZDXA 3EECA 2I1KA 3AE9B 2PEAA 4W9HA 5IN7A 4AWJA 4B0MA 3VUYA 1PGAA 4BBNF 3RUIB 3DQVA 1VZ6A 1STEA 2BW2A 1E7VA 2JXXA 1HA5A 3VDZA 2D5GA 2V3NA 1V1PA 4W9IA 1ZW7A 2NTTA 2CR5A 4HRSA 1U4AA 2QDFA 4FN2A 3ZTCA 4BOSC 3ENEA 3SFEB 5C3JB 1XO3A 4MDKE 4NY0A 3PHXB 1WYGA 1A70A 1FIQA 4J6IA 2KWUB 1XLQA 2BBCA 1TS3A 3L54A 1C78A 5FR6A 3TBLD 2RDHA 4W9EA 2JU6X 1JRUA 1WR1A 2ZW1A 3WIMA 5H92C 4MGKE 4MM3B 2DZMA 3C8YA 3NZSA 3DBHB 3A9KA 2HDEA 1YQBA 1TIFA 3DHHC 3Q3NC 2PKOA 4DDGD 2IBIB 4P6VF 1R4MB 3CF6E 3QQ8B 4WJOA 4KIKB 1LGRA 4CO7A 1F1HA 4P7IA 3R7RA 1XLOA 1JALA 2N7JA 1N5XA 2UU7A 3NHEB 4NAWB 2KMMA 3QC8B 5L83A 1AWDA 2C9WB 3OAWA 3ZTDA 2W82A 2ZCBA 3SD5A 5AZGA 1S1QB 1WGDA 3CIRB 4XDDA 2SEBD 3KWVA 3Q69A 4W9LA 1J7AA 2Y3AA 3QARA 2IPKD 1ACCA 3HIZA 4N59A 4US8A 4HKQA 1I4PA 2MJEA 1UBIA 2RSUA 4XWTA 4IG7B 2KT7A 1CZPA 5G55A 2I2YA 1XLPA 4B0EA 3IHPC 1NVID 1JWUD 4ZDVA 2LVQA 2OJRA 4W9CA 3HM3A 5HFYA 2JXTA 2KFJA 1MG8A 1VLBA 1YJIA 4TUUA 2CJOA 5DPTA 2O6VB 1PQSA 3BVZA 1JROA 2D07B 4RGMA 2LGXA 4AJWA 4PS3A 3NUHB 1SSNA 2DYMA 1MVKA 1JW9D 2LVOA 4RGTA 4JL9A 2JQRB 2WX0A 4W9GA 2LJIA 1MG4A 5HG2A 2N7EA 3VFKA 1VR9A 3AE6B 1FXIA 3H7PB 3RZFA 5JH5C 3K9OB 4DWFA 2C7MB 4IUMB 3AEDB 3A9KB 4DHZB 4GDKB 1Q10A 2J0KA 2MQJA 4PYZA 3IXSA 2VRRB 1FRDA 4DHJB 4KSLC 3VH4B 5HKHA 2WXHA 4RM8A 2AL3A 3APFA 3GB1A 1VZ8A 3U8ZA 3AI5A 2KWDA 2HE7A 3V05A 2J0JA 4M0WA 2M0XA 4OZAA 3BIID 3N32A 3MFGA 4C7YA 2X8XX 3R8BA 2IJ0A 1TZOA 4CHKA 2GBNA 4WURA 4OVUA 4TSSA 5CX3A 4PS7A 1UBQA 4G50A 3ZXVA 1WGRA 3RN9C 2WXRA 3RNBC 4LNFA 1IUEA 5EDSA 2D10A 2CJNA 4KGTA 4BKGA 2WU2B 3NJTA 4MT5A 4OVVA 2BKFA 1N5WA 4KV2A 2NTSA 1JMLA 5D94A 3PSEB 3RI7C 2GOWA 5E6NA 1H4RA 1SE2A 4XX5A 1RAXA 1QF6A 5CHWA 2FCSA 1WFYA 2Y5BB 1NYQA 1QOFA 4YTPB 1N63A 2KN5A 2JT4B 2KDFB 1EF5A 3PREA 1GJZA 1TKYA 3PRZA 4RM9A 2N4FA 2KJ6A 1TS2A 4CYEA 2M4NA 1QOGA 3I57A 1J19A 4EKUA 2KJRA 3H7SA 3N1ZC 3RNCC 4US9A 3ZVVA 1FNWA 4ZHOA 4A3PA 3VTWA 2KDEB 1ZKHA 3PZ7A 4EFOA 3RNGC 4IOIE 1HTQA 2RD0A 4JGHB 2BQQA 5LXHA 1EF1A 2JYTA 3KYDD 3MJ5A 3N20C 4A90A 2FUG1 4MELA 4NAWA 3TEYA 2CHXA 3JSVB 2DBYA 2KMCA 2IO0B 2WXLA 2HJ8A 2ZCCA 1OQQA 5AEKB 1CMXB 2KANA 2KFKB 3OWEB 5C2TB 1VD2A 3R66C 1WMHB 5EE3A 3DVGX 4YL8A 2D3AA 1BXTA 4IC7B 1QT9A 2ICIA 1FPYA 4QAYA 4WIPA 3AEAB 1QOAA 3Q3FA 2QHOA 4II2B 4ZYSA 4ICVA 1L6UA 2NPTA 2J42A 4XWWA 2MJDA 4BBNC 1B9RA 1TTNA 1KLUD 4OW0A 2WP9B 2N9XA 4WWPA 3TEXA 3VQIA 2OEDA 1MJDA 2JF5A 4B6WA 3P1MA 3ZGZA 3MC0B 1I4GA 2MJ3A 1K50A 1XCQL 1QLBB 1OGWA 1OQYA 3BVMA 3TUOA 2L7RA 3ZNGC 1IGDA 4EUTA 4ZHPA 2NR2A 2M1MA 4X57B 1GG3A 5G2NA 2WXIA 4N9F4 1D6EC 3BYTB 3LXFA 1T6BX 3Q3OC 4WH4A 1JRPA 1LFDA 3GP7A 3Q14C 2LHEA 3TSSA 4XDCA 4PS8A 1F77A 4N58A 4YXDB 2RPVA 5AUIA 2KC1A 5JHBA 4HPLB 3A33B 1FFUA 3U52E 1KH0A 3RZWC 2LGDA 2QCZA 3GS2A 1UELA 1RLFA 3RT3B 3KUZA 5E6OA 5KHOA 3VAWA 2AYOB 1P9DU 5FR3A 2N0SB 2JZPA 1AYFA 4K7SA 1YX5B 3PV1A 3SEBA 1XF5L 2L32A 3LYYA 1WRIA 3WANA 1JWMD 2ZPYA 3L08A 3UINB 1F9JA 3ZO5B 2V0GA 3NS8A 2WXGA 3P2BA 3R2IA 3HUIA 5IP4D 2K1FA 3IG3A 3X23A 4IWPA 3L17A 3T9LA 4CQNA 4G11A 1V80A 2LFIA 2PE6B 4NQLB 3RNEC 2MP2A 1I35A 3O13A 5AUKA 3NZ3A 4HCPB 1K52A 1NEKB 4GDLB 2FIFA 1SIJA 1G6JA 3NVYA 4PK1A 5BMGA 1KJTA 2K25A 2W9NA 4NPNA 4I6LB 2NBWB 4ZRKA 4BKTA 4IM0A 3ETRA 3Q3JA 3P42A 2L76A 2NVUI 4EE2A 4AJYB 1LQBA 4JWSC 3DBLI 3RPFC 1YQ3B 3RNAC 4HCNB 2VH1A 5MPOA 2BS4B 5AZFA 4D2KA 1RWSA 2KNBA 2IGGA 5I4DA 5TR5A 1CJEA 3AEGB 1R7SA 1OQRA 1PYWD 2KDIA 3AN1A 4GSWA 3AE8B 2BS3B 4TKNA 3VTUA 3I9V1 3L13A 4MJSB 1WWTA 5CHVC 4DXGA 2W55A 3K9PB 3WALA 2DZJA 2N9EB 3HM6X 2BPSA 3ABVB 1Q5WB 2AQ1B 1ROEA 2BWFA 2V3SA 3APCA 2J52A 4HWIB 4IWQA 3Q8AA 1HZ5A 1D5MC 2WGSA 2WXOA 2QIEB 1WJ4A 2ONQA 3RD2A 2N9PC 4XZ4A 2KMAA 4MSQB 3BZDB 2KKCA 2ZVNA 1FRRA 3Q2AC 4M02A 2N7DA 2LUEA 4JIOU 1SBBB 4FXCA 2BYFA 2JZZA 4K1RB 5JXVA 3PLVA 2INDC 5HI1A 3WCQA 4WQMA 2CU3A 3B08A 4DHJD 5DPSA 4S0RA 5D6JB 3NG0A 3NVWA 2R2QA 3W1SC 2JZ3B 5BYQA 4C7ZA 4EOYA 3UF8A 2OJWA 1V8CA 3CSFA 1EU4A 1FD6A 4HPPA 2QSDA 2GLSA 4ASWC 4W9DA 4FJZA 3E9SA 3ZQ4A 3PRMB 3A4SC 2MLBA 2R61A 4RH6A 3M63B 2C60A 3DBHI 1L0VB 2BKRB 4HKZE 2MCNB 1D5ZC 4NAMA 4TV3A 1V86A 2ZNVC 3L10B 2MA9B 2AQ3B 3V3XA 2UWQA 1C1YB 2YEPF 4XGAB 1R4MI 2WWZA 2MRPA 4KX6B 1XQQA 2L1AA 1ZXIA 2M17A 1F52A 3ZNZB 4C80A 2IYDB 1ZXHA 1CQVA 1S3SG 2PTLA 5DPWA 2BGFA 1ZGUB 2Z0EB 2C7NB 3C19A 2G9HD 2JWZA 2KTFA 3FAHA 3PZDA 2D3GA 2GI9A 3L0WB 1VJKA 3SFDB 1C4CA 2KO3A 2LXCA 4HVBA 5JHAA 2D11A 3ZJUA 3M3JA 1D4BA 3ZUNA 4IM3A 4LJOB 1L5PA 1E7UA 1E8WA 4AOFA 1WM2A 4LNKA 1WSPA 3A4RA 4LDTB 3AEEB 4I6NB 4FJVB 4W9KA 2WXFA 2LZ6A 2C7HA 4XE0A 3ZNID 5CHFA 2CS4A 1I4XA 2M8SA 3UI3A 2L0TA 3CWIA 2OOBB 2JSVX 4JPSA 2I38A 1GB4A 2K39A 2M0AA 3P4QB 3WAOA 2ZJDA 1TY2A 3VRAB 3PPAA 2LD9A 4RCOA 3ZYYX 3CSTA 3GE3C 4LLGM 3ML8A 4ITKA 1MHXA 2NS5A 3SHQA 5LXIB 2DENB 2LWPA 2IDYA 3AU4A 3V6EB 4G3XB 4KGRA 2HTME 4FHJA 4DHZE 2IZVB 1ENFA 1WX8A 3TL5A 4HEA1 1BT0A 3ZJTA 1L0XB 2PMVA 3QX1A 4XYCA 3RCZA 2KC2A 1P0RA 4ANVA 2MEKA 5T8IA 5G5GA 4MJSA 3MJWA 1V81A 3LB8C 3U4EG 1LXDA 3VH3B 1H8CA 1MPEA 3WA0A 1WE6A 1OEYJ 4F8CB 3ZW3A 2WX1A 3AULA 4BAXA 5CTRC 2L8JA 3ECIA 2Y5PA 2MWSB 4M8NA 2VH2A 1L7YA 3AE2B 1DYQA 1HE8A 4Q2JA 4MEMA 4HJKA 2GBJA 2ZW0A 3TEWA 1FXTB 2J0MA 2K6QA 1NYRA 3Q8BA 2BYTA 1UD7A 1KLGD 2JWUA 2Z8LA 1KF6B 2J4XA 2DAJA 2WDQB 2G1EA 3Q6BA 2WS3B 4G0NB 5G5HA 1L4DB 1L6VA 2MW5A 1V2YA 3UQBA 3O65B 2KQ4X 4MGZE 4LNNA 5J17A 2LHDA 4PYUA 1XT9B 2RPQA 3IVFA 2B3AA 4MGIE 3EA6A 1WYWB 1ESFA 1V6EA 3ZJVA 1KTKA 2K8CA 2PE9A 3W9CB 4FA6A 3H1UA 3A9JA 1KOTA 5GMVA 4JX1C 2WQYB 1IBXA 3GZNI 2RMMA 3DBRI 1XLNA 2G3QB 1JCKB 2WXKA 1D5XC 4M01A 3U2SC 2G4DB 2XBBC 2WXQA 4GDLA 4MSMB 2INNE 1YQ4B 1J7BA 1TZ1A 4RMAA 5TSSA 1R4NB 3VTVA 3QA8A 4URKA 3LJ3A 2EELA 1IYFA 4GB9A 4ZOHC 1WJ6A 5LLIA 1YJ1A 2QEJC 4E71A 4GLSC 1KM7A 1UZXB 4HROA 4AQ7A 1RFKA 1WMHA 4DXAB 3N9YC 4YWGG 2N1WA 2BB6A 4LNOA 3VR8B 3J9CA 3L16A 3PS6A 3T3OA 4YSXB 3FKYA 1FEHA 4II3B 3T3NA 2HJ1A 2MBHA 4HLEA 4K3BA 4NNJB 3JW0X 2NPTB 5C23A 4A55A 3EUB2 3FC4A 5E6PA 1QILA 4LJPB 3PT2B 1DOIA 3Q8CA 2HTHA 3URYA 1E8ZA 5J2RA 3A1QA 4WWMA 1TBEA 4C4VB 4RGNA 1M4VA 5LNK1 2FNJB 1KFYB 3N3KB 3AB5A 4MGYE 4S17A 1DOYA 1WH3A 3OLMD 3FILA 1WX9A 5IO9A 5BYSA 1KLVA 3OG5A 3DBSA 1Q0WB 4A9AA 4W9JA 1QKZA 3P4RB 5D7GA 4WWNA 3PO0A 4FULA 1TGZB 2J53A 2A5UA 3KYCD 2AL6A 1JWSD 2PVGC 3KH0A 1Q1OA 2Z0DB 3PLUA 3HK0A 2KLGA 3VVWB 1ET6A 1TYGB 2DX5B 3MHZA 2INCC 3L4PA 2KDMA 2XEWA 4ZRJA 3BK2A 3TEZA 1BMLC 1WXVA 3P4PB 2LGYA 2D2QA 2FE8A 2LUMA 1ZP0B 1X1MA 1ET9A 3JYUA 2KQ7A 3N1YC 3W1SA 1C9FA 2WLBA 1XD3B 5EE9A 3MC8A 3BVGA 4REZA 2NCNA 1TKEA 2CHWA 4GDKA 3AE5B 2K0PA 4RF0A 5DPRA 1GC6A 2LXAA 2KZRA 1WM3A 4LNIA 1SGHA 2K3UA 2BS2B 2N9KA 3EFCA 1I7HA 1SIFA 3D32A 3ZKJC 1WY8A 2KQSA 3QIJA 2MSED 3DDCB 4ARIA 4YSYB 2VZKD 2VZKB 3B0AA 2WNMA 3H7PA 1RRBA 3QCAA 2KOXA 4OZCA 2Z59B 3P4SB 4TQ0A 3WAMA 2KTRA 1J7CA 1WGHA 2KACA 2INPE 3EC8A 3DHGC 3VR9B 1MI0A 2AX5A 1FCCC 4KKJA 1YD8U 2DNFA 4C4VA 2D3BA 2RDGA 1XXGA 2BT6A 3U30A 3GZNB 2KDBA 4GMVA 3V61A 3NOBA 3ALBA 2L83A 1Z2MA 2JX5A 1QQRA 2MBQA 1YN4A 2LASA 2WHIA 1WRDB 1EM7A 5BO4B 2DLBA 5EE1A 2IY0B 3AXCA 1WXMA 3EGRA 3SDLC 5D3IB 1B1ZA 1PUTA 2W3SA 1ZDVA 1YN3A 4E3CA 1PFDA 1K51A 1C77A 3ONSA 2IGHA 3DOWA 3AE7B 2IO1B 5E6JA 1TJEA 1E90A 2V4LA 3VUWA 2DHZA 4EEWA 1DGJA 2JPHA 2RDBC 3AH7A 4LDTD 1TY0A 1IP9A 4IWOA 2ZVOA 4EZLA 1NI2A 2K5PA 4M8MA 3BK1A 4KSKC 3AM9A 2ZNVB 3TMPB 4W9FA 1E6EB 2H89B 4TMAB 1E9MA 1L4ZB 2JYEA 5GXGB 1T3QA 2WDRB 2EKIA 2D3CA 2REXA 4E74A 1GUAB 5AZHA 3I3TB 2PJHA 1T0YA 3NS1A 3QWZB 1HTOA 2KX0A 2NBUA 1T0RC 3NRZA 2AQ2B 4ANUA 2XN9C 1V1PB 3RULA 4A3OA 2EMTA 3WAPA 3KUCB 2K9XA 3QHTA 3ZIMA 2KD0A 4M00A 1BUIC 3W5VB 3DVNU 4GOCA 2PVOD 2O2VA 4BVUC 4RNAA 1F2RC 4L23A 3Q8EA 1ZUD2 3HVDA 1FXAA 1WZ0A 3EHVA 1SEBD 4AP4C 3V60A 4ACFA 3X0WA 1T0SC 2K8BA 1HQRD 2SAKA 3CMMB 1UGMA 3H8HA 3IAS1 2QC8A 1E5WA 1D3ZA 2KWCA 1AARA 1SE9A 4ZRPA 2A4ZA 2L0FA 4OHJA 2KTRB 3M95A 3JSVA 1HEZE 4AUQC 4GN1A 3H6NA 3LDZE 4NQKE 1IPGA 1I4HA 3IT4B 3Q8FA 2NBVB 1FO4A 1RM6C 2LJ5A 2YEPB 3R2TA 4USAA 1FM0D 4FADA 1JWBD 1Y56A 1I42A 3DVGY 1E8YA 2JY6A 5L95C 2C5LC 4FHKA 2DYOA 4TQ1A 3V62A 2BYEA 2K22A 3ZNHB 3RFZB 1TS4A 2XK5A 2WDVB 1ZPSA 2DZKA 2MP2B 5IKCM 4JWUC 2GBKA 1GAQB 4KZCA 2PW9A 3P63A 1T5XD 4L2YA 2MX2A 3GOEA 5D2MB 2Y5CA 3HRDD 1P7FA 4ICUA 4HDQA 5EE0A 3DVNV 2KX3A 1SE3A 2BYVE 1EWYC 3ZRFA 4XC2A 1N61A 4MM3A 2X38A 4NJ7A 1GB1A 2JVCA 1TS5A 2O2VB 4O1NA 4ANWA 3KW5B 4BZAA 3AE4B 1VDVA 1GPXA 2I1JA 4MACA 3PZ8A 2WU5B 4P1CC 3E56A 3UIPB 1HZ6A 3OJ4B 3W2DA 1WGYA 3V6CB 2RR9A 1ISNA 1J8CA 4M0WB 1FMAD 4RF1A 4RGOS 3RMKC 2BTEA 2KAJA 2GMIC 2M19A 2L00B 3PVLA 1C79A 4N6EB 1UH6A 2KN4A 3BINA 3B2FA 2V1YA 2J7QB 4GXBA 2Q5WD 5KHQA 3SU8X 3NY5A 3C0RB 2OHFA 1V5OA 3AE3B 3GE8C 4BKSD 4EZKA 3QJZA 4IDIA 1WZ3A 4KIKA 1K53A 2JUOA 4HPMB 4IM2A 4BOZB 2BB5A 2ZEQA 4KDLB 3A1QB 2QMTA 1ZE3D 2BF8B 5JZEB 3SR6A 2K6DB 2HD5B 2PPHA 2MBOA 4IW0A 3PRPB 3DWGC 1AW7A 3U7ZA 3U7DA 5J18A 1V49A 2FCMA 1C4PA 4R3DA 1OFFA 2PIAA 3DPDA 4OZBA 1C3TA 2KLCA 2QJLA 1TT5B 4BKSA 2LMCA 5BYRA 2XK5B 1SXTA 4FBJB 2XNAC 1WX7A 3B2GA 3IFWB 4I6PA 1MHHE 1QZEA 4L1BA 1EWCA 5DCNA 4WJNA 3AV8A 2FBWB 1P1AA 2ON8A 4KKIA 2WXPA 1EUVB 1ZOYB 4P16A 1N62A 3KWLA 4K7UA 1N6ZA 2ZZPB 4HK2A 2CKHB 2KHWB 1XCTL 2DWQA 1RYJA 4F1SA 3TJPA 4MH0E 1UNSA 1I4RA 2LGIA 2MHJA 3A9JB 3BYYB 2KK8A 2JRHA 4A20A 1OTRB 4DBGA 1QOBA 2FCQA 1SE4A 4ANXA 3UQAA 4WWOA 1VCBA 4J3OD 1F2RI 3HHMA 3DHIC 1XEEA 2KJHB 4YSZB 4WJPA 3JVZX 3MTNB 1PDXA 3AU5A 3QK0A 4LCDE 4DDID 2WXNA 1I4QA 4ZYNA 1Y8RC 2GBRA 2M56B 3M62B 4MH8A 4DQOC 2YLMA 2LVPA 5FKAC 3AE1B 1OEYA 3ZXRA 1UUPA 2KFKA 4YTMB 3HVZA 3OJ3A 2WXJA 2LGSA 1WXQA 2CHZA 3RYTA 3Q3MC 1YN5A 4DXFA 1MFWA 1V5TA 1VRAB 1EU3A 4KZ0A 4WAFA 3VUXA 3I5JC 1C76A 3B9JA 4P1BC 4PT5A 4DK5A 1T0QC 4AS1A 1NENB 2BWES 1E10A 1IGCA 1FNVA 3DBRB 3BWUD 2LI5A 3ML9A 3TIXA 3PTFC 1HXYD 3MP9A 1FNUA 4KDIC 2FAZA 3R3MA 2IO3B 4BFRA 2GRIA 2K8HA 4K7WA 1R4NI 2LRWA 2ZPNA 4HXDA 4KVGB 3UIOB 1NBFC 3S2AA 3MC9A 2W54A 2GB1A 3AMZA 2DYBA 4WJQA 1M94A 3ZLZA 4JQWC 1J0GA 3NZUA 1JQ4A 1P98A 3QAQA 4ZRIA 1WGGA 3NVZA 3KQ4A 1NI3A 4B9KA 1GNUA 3AEBB 3VHTC 2ASQA 1KRHA 2PLPA 2V4IB 2AWTA 3AEFB 2WXMA 1PGBA 1V97A 4HJGE 2L3ZA 1TKGA 2W3RA 4K81A 2AEHA 4JLCA 5BMHA 3IBEA 1F0ZA 3N30A 1GOZA 1V1OA 1WJNA 4NJ6A 3TCAA 2MBEA 3MHSD 1WE7A 1P7EA 4LTUA 3KVFB 4ARCA 3W1YA 3UGBB 1DOXA 3IT6B 1UF0A 4EZJA 1LM8B 4LK0M 4GGQA 3N1XC 2YVCA 2MBBB 5IAAC 4K3CA 1E8XA 3RNFC 1UWMA 1P3QU 2NMQA 1FFVA 3BY4B 2B76B 4IKGA 1V9JA 3IAM1 2E3TA 1JWAD 1AN8A 1WR6E 3APDA 2O6VD 2KWVB 2EKEC 3EFUA 3ZRCA 5FK9C 5C1ZA 2KXJA 3NVVA 2GBMA 1SB3C 1YNTE 2DAFA 4A6QA 2IO2B 4ZRQA 2FUHB 1LO5D 2G45B 4FLHA 2E6XA 4H2AA 4OVZA 5H8YE 2FCNA 1YJJA 4GIVA 3VRBB 1IBXB 3H9DA 1N60A 3DWMA 4C00A 1VZ7A 2L52A 2G4SA 4WAAA 2KYWA 1WJUA 2CU1A
chains in the Genus database with same CATH topology
4NJCA 4Q2JA 1HQRD 2SAKA 4ZYSA 1L6UA 4YTNB 2J42A 3H8HA 4XWWA 2ZW0A 3TEWA 3IAS1 2MJDA 4JE3B 1NYRA 3Q8BA 4ZRPA 2N9LA 1B9RA 4OHJA 5BMIA 1KLUD 2BYTA 1L0YB 2WP9B 4OW0A 1KLGD 2JWUA 2Z8LA 3TEXA 3VQIA 1KF6B 4UDUC 1HEZE 2OEDA 2J4XA 4NZLB 2WDQB 1CK1A 2G1EA 2WS3B 1UGJA 2MH7A 3P1MA 3ZGZA 5G5HA 1L4DB 3MC0B 1I4GA 3W5UB 1YMHE 1L6VA 1I4HA 1SJHD 2QILA 2MJ3A 3IT4B 3Q8FA 1K50A 1FO4A 1RM6C 4C56C 1XCQL 2KQ4X 1QLBB 3BVMA 3TUOA 1WGKA 2LHDA 2YEPB 3R2TA 4USAA 1E0ZA 1FM0D 1JWBD 1Y56A 5HHDG 1IGDA 3AECB 1PGXA 4A8XC 4TQ1A 2DYOA 2K22A 4ZHPA 3RFZB 1TS4A 3EA6A 2ACZB 2WXIA 1ESFA 2V3PA 1D6EC 2WDVB 1ZPSA 3BYTB 3LXFA 1T6BX 4WH4A 3ZJVA 1JRPA 4JWUC 1KTKA 3GP7A 4RFBA 2LHEA 3TSSA 1GAQB 2PW9A 3P63A 4XDCA 1T5XD 1FCLA 3W9CB 4L2YA 1F77A 4N58A 4YXDB 2RPVA 4JX1C 5AUIA 2WQYB 1UWXA 2Y5CA 3HRDD 1IBXA 5D3DA 1FFUA 1P7FA 3FILB 3U52E 1KH0A 2RMMA 2TSSA 1XLNA 5EE0A 1E7PB 1JCKB 2WXKA 3GS2A 1D5XC 1SE3A 1EWYC 1C4AA 2LEKA 3U2SC 2WXQA 1SF0A 2H88B 2INNE 4KGSA 1SJED 1N61A 5FR3A 3KLSX 2N0SB 2JZPA 1AYFA 1YQ4B 1J7BA 2X38A 5TSSA 1GB1A 4YT0B 1TS5A 3SEBA 4O1NA 1XF5L 2EELA 3AE4B 4ZOHC 1VDVA 1GPXA 2L32A 2IGDA 3LYYA 1ZDXA 2QEJC 4GLSC 1WRIA 3AE9B 4MACA 3PZ8A 2WU5B 3E56A 1JWMD 4HROA 4AQ7A 1HZ6A 1RFKA 3N9YC 4B0MA 1PGAA 3W2DA 4YWGG 2V0GA 1VZ6A 2WXGA 1STEA 2BB6A 2BW2A 3R2IA 3HUIA 3VR8B 1FMAD 4RF1A 4RGOS 1HA5A 3J9CA 4XDDA 2D5GA 2BTEA 2KAJA 2V3NA 3T3OA 1V1PA 2M19A 4CQNA 4YSXB 1FEHA 1C79A 4N6EB 2NTTA 3T3NA 2LFIA 4HRSA 2KN4A 4A55A 3B2FA 3O13A 5AUKA 3EUB2 3NZ3A 1K52A 1NEKB 3FC4A 2Q5WD 4GDLB 1SIJA 1QILA 3SFEB 3NVYA 5C3JB 1DOIA 1XO3A 5BMGA 3Q8CA 3URYA 1WYGA 1A70A 1FIQA 2OHFA 4WWMA 1XLQA 2BBCA 1TS3A 3AE3B 4RGNA 1C78A 3ETRA 4IDIA 2RDHA 3P42A 1M4VA 5LNK1 4EE2A 1KFYB 1K53A 2JU6X 4JWSC 3AB5A 2BB5A 3RPFC 1YQ3B 1DOYA 2ZW1A 5H92C 2QMTA 1ZE3D 4MM3B 3C8YA 3FILA 5MPOA 3SR6A 2BS4B 4D2KA 5BYSA 1RWSA 2IGGA 2HDEA 4A9AA 3DWGC 1AW7A 5I4DA 1QKZA 3P4RB 5D7GA 3U7ZA 1CJEA 3AEGB 2PKOA 3PO0A 1R7SA 1OQRA 1PYWD 3AN1A 4P6VF 1C4PA 4R3DA 1OFFA 2PIAA 4OZBA 2J53A 2QJLA 2LMCA 1JWSD 3AE8B 5BYRA 2BS3B 2PVGC 3I9V1 1WWTA 1SXTA 1XLOA 1JALA 2N7JA 4DXGA 2W55A 1N5XA 1ET6A 4NAWB 1TYGB 2KMMA 3MHZA 3L4PA 2KDMA 2XNAC 1AWDA 3BK2A 3TEZA 1BMLC 3P4PB 3B2GA 3ABVB 2AQ1B 1ROEA 1MHHE 2FE8A 4L1BA 2LUMA 1EWCA 2W82A 1ZP0B 3AV8A 2J52A 1ET9A 2FBWB 2ON8A 3CIRB 2WXPA 4KKIA 2SEBD 1ZOYB 3Q8AA 4P16A 1HZ5A 3KWVA 3Q69A 1D5MC 1J7AA 1N62A 3KWLA 2WXOA 3W1SA 1C9FA 2WLBA 2QIEB 2Y3AA 5EE9A 2IPKD 2ONQA 3BVGA 4REZA 1TKEA 1XCTL 2DWQA 1ACCA 1RYJA 4N59A 4US8A 4HKQA 1I4PA 3AE5B 1UNSA 2K0PA 2MJEA 1I4RA 3BZDB 4RF0A 2LGIA 4XWTA 3BYYB 1FRRA 1CZPA 2K3UA 2I2YA 1SBBB 1QOBA 2BS2B 4FXCA 1SE4A 1XLPA 4B0EA 1NVID 1JWUD 2N9KA 5JXVA 1I7HA 4J3OD 5HFYA 2JXTA 1F2RI 1VLBA 1YJIA 5HI1A 3WCQA 1XEEA 2CJOA 4WQMA 4YSZB 2CU3A 3BVZA 1JROA 1PDXA 4RGMA 4ARIA 3NUHB 1SSNA 2DYMA 2WXNA 1I4QA 1MVKA 3NVWA 4YSYB 5BYQA 2VZKD 1JW9D 2VZKB 4C7ZA 2M56B 4MH8A 4DQOC 4RGTA 2WNMA 2JQRB 5FKAC 3AE1B 1V8CA 2LJIA 1EU4A 1UUPA 1FD6A 2QSDA 4YTMB 3HVZA 5HG2A 2WXJA 1VR9A 3AE6B 1WXQA 4OZCA 1FXIA 3P4SB 1YN5A 4TQ0A 4DXFA 3E9SA 1VRAB 3ZQ4A 3AEDB 1EU3A 1J7CA 4WAFA 2KACA 4GDKB 1C76A 2INPE 3B9JA 1Q10A 4PT5A 2R61A 4RH6A 3VR9B 1MI0A 2AX5A 1FCCC 1L0VB 1NENB 4HKZE 3IXSA 4KKJA 4AS1A 1E10A 1D5ZC 1FRDA 4NAMA 1IGCA 1FNVA 2WXHA 3BWUD 3GB1A 1VZ8A 2AQ3B 1HXYD 1XXGA 2RDGA 1FNUA 2KWDA 2BT6A 3MP9A 3V3XA 2YEPF 4KX6B 3V05A 2L1AA 2GRIA 2L83A 1ZXIA 4M0WA 4OZAA 2JX5A 1QQRA 3BIID 4C80A 1YN4A 3MFGA 1ZXHA 4C7YA 1CQVA 1EM7A 2PTLA 2DLBA 5EE1A 3R8BA 2W54A 2IJ0A 3EGRA 2GB1A 1TZOA 3AMZA 5D3IB 1B1ZA 1PUTA 4WURA 2W3SA 4TSSA 1ZDVA 2G9HD 1YN3A 3FAHA 1JQ4A 2GI9A 1PFDA 1VJKA 1K51A 3SFDB 1C4CA 1C77A 2WXRA 2IGHA 3AE7B 1IUEA 5E6JA 3NVZA 3KQ4A 1TJEA 1NI3A 2CJNA 4KGTA 3ZJUA 2WU2B 3AEBB 1D4BA 1KRHA 2PLPA 2V4IB 3AEFB 4MT5A 1L5PA 1PGBA 1V97A 2WXMA 1DGJA 3AH7A 4HJGE 1N5WA 1TY0A 2NTSA 1JMLA 1WSPA 1TKGA 2K5PA 1SE2A 2W3RA 3AEEB 3BK1A 2WXFA 3AM9A 1QF6A 5BMHA 1NYQA 1QOFA 1F0ZA 4YTPB 4XE0A 1N63A 1GOZA 1E6EB 1V1OA 1I4XA 2H89B 4TMAB 3UI3A 3CWIA 1E9MA 2JSVX 1TKYA 4JPSA 2I38A 1GB4A 2M0AA 3P4QB 1P7EA 4LTUA 4ARCA 1L4ZB 2JYEA 5GXGB 1TY2A 3VRAB 1T3QA 2WDRB 2EKIA 3IT6B 1DOXA 4LK0M 1TS2A 4RCOA 3ZYYX 4LLGM 1QOGA 3I57A 4ITKA 1MHXA 3NS1A 4US9A 2IDYA 1FNWA 4ZHOA 1UWMA 2NMQA 1FFVA 2B76B 3NRZA 3PZ7A 4IKGA 2AQ2B 3IAM1 4IOIE 4KGRA 2HTME 2E3TA 1JWAD 1AN8A 2XN9C 1V1PB 1ENFA 4HEA1 3ZJTA 1L0XB 2PMVA 2JYTA 3MJ5A 5FK9C 4A90A 2K9XA 2FUG1 3TEYA 2DBYA 1BUIC 3W5VB 2MEKA 2WXLA 3NVVA 1SB3C 5T8IA 1OQQA 5G5GA 2PVOD 1YNTE 4A6QA 3LB8C 4ZRQA 3U4EG 1MPEA 3OWEB 5C2TB 4RNAA 5EE3A 1F2RC 1LO5D 4L23A 2E6XA 3Q8EA 1ZUD2 3HVDA 4H2AA 1FXAA 1BXTA 4OVZA 5H8YE 2Y5PA 1QT9A 1SEBD 1YJJA 2ICIA 3VRBB 1IBXB 4WIPA 1N60A 3DWMA 1VZ7A 2L52A 3AE2B 1QOAA 3AEAB 1DYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N59 A;  4US8 A;  3AE7 B;  1IUE A;  3AE5 B;  2MJE A;  3NVZ A;  1TJE A;  1NI3 A;  1L6U A;  4YTN B;  2CJN A;  3HUI A;  1FRR A;  1FMA D;  2WU2 B;  3VR8 B;  3AEB B;  1KRH A;  1CZP A;  2KAJ A;  2MJD A;  3AEF B;  1L5P A;  1QOB A;  2BS2 B;  1NYR A;  1V97 A;  2M19 A;  1DGJ A;  1XLP A;  3AH7 A;  4FXC A;  1N5W A;  1B9R A;  1NVI D;  4YSX B;  2WP9 B;  1I7H A;  1VLB A;  1YJI A;  4N6E B;  3WCQ A;  1KF6 B;  2CJO A;  4HRS A;  4WQM A;  4YSZ B;  1TKG A;  2CU3 A;  2K5P A;  2WDQ B;  2G1E A;  2W3R A;  1JRO A;  1PDX A;  2WS3 B;  3AEE B;  3B2F A;  5AUK A;  3EUB 2;  2MH7 A;  3FC4 A;  1NEK B;  3P1M A;  2Q5W D;  3AM9 A;  5G5H A;  1QF6 A;  1SIJ A;  3NVW A;  4YSY B;  3SFE B;  3W5U B;  1NYQ A;  1L6V A;  1QOF A;  1DOI A;  1XO3 A;  3NVY A;  2MJ3 A;  1JW9 D;  4YTP B;  4C7Z A;  1N63 A;  2M56 B;  1FO4 A;  1WYG A;  1RM6 C;  1A70 A;  1E6E B;  1FIQ A;  2JQR B;  2OHF A;  2H89 B;  1QLB B;  1V8C A;  3AE1 B;  4WWM A;  1XLQ A;  3CWI A;  1E9M A;  1WGK A;  1TKY A;  3AE3 B;  4USA A;  1E0Z A;  4YTM B;  3ETR A;  1FM0 D;  3HVZ A;  1JWB D;  4IDI A;  3P4Q B;  4LTU A;  3AE6 B;  1KFY B;  1WXQ A;  3AEC B;  5GXG B;  1FXI A;  3VRA B;  1T3Q A;  2K22 A;  2EKI A;  2WDR B;  3P4S B;  4JWS C;  4ZHP A;  3AB5 A;  3ZYY X;  1DOX A;  3RPF C;  3AED B;  1QOG A;  1YQ3 B;  2ACZ B;  2WDV B;  1DOY A;  1J7C A;  4ITK A;  3LXF A;  5H92 C;  3B9J A;  3NS1 A;  4US9 A;  5MPO A;  1JRP A;  4JWU C;  3SR6 A;  2BS4 B;  3VR9 B;  1RWS A;  4ZHO A;  1GAQ B;  1UWM A;  3P63 A;  2AX5 A;  4A9A A;  3W9C B;  1L0V B;  3DWG C;  1NEN B;  4N58 A;  1FFV A;  3P4R B;  2B76 B;  3NRZ A;  4YXD B;  1E10 A;  1CJE A;  1FRD A;  3AEG B;  2HTM E;  2PKO A;  2E3T A;  3PO0 A;  4JX1 C;  5AUI A;  1JWA D;  2WQY B;  2Y5C A;  1R7S A;  1OQR A;  3HRD D;  3AN1 A;  4P6V F;  1OFF A;  2PIA A;  1FFU A;  2BT6 A;  1XLN A;  2QJL A;  3AE8 B;  2K9X A;  5EE0 A;  2BS3 B;  1E7P B;  2PVG C;  2DBY A;  1WWT A;  1EWY C;  3W5V B;  4KX6 B;  1XLO A;  3NVV A;  1JAL A;  2LEK A;  2W55 A;  2L83 A;  1ZXI A;  1SB3 C;  1SF0 A;  1F0Z A;  1N5X A;  1OQQ A;  2JX5 A;  2H88 B;  2PVO D;  5G5G A;  1TYG B;  2KMM A;  3LB8 C;  3BII D;  4C80 A;  1N61 A;  3L4P A;  4C7Y A;  5C2T B;  1AWD A;  2N0S B;  1AYF A;  1YQ4 B;  1J7B A;  5EE3 A;  3P4P B;  5C3J B;  3B2G A;  3ABV B;  5EE1 A;  1ROE A;  4YT0 B;  2W54 A;  1ZUD 2;  1ZP0 B;  3AE4 B;  3AMZ A;  1FXA A;  1VDV A;  4ZOH C;  5H8Y E;  3AV8 A;  1GPX A;  2FBW B;  1PUT A;  3CIR B;  1QT9 A;  1ZOY B;  1YJJ A;  1WRI A;  2W3S A;  3AE9 B;  1N62 A;  1J7A A;  3KWL A;  3VRB B;  1N60 A;  2WU5 B;  3DWM A;  3FAH A;  2L52 A;  2QIE B;  2WLB A;  4HRO A;  3AE2 B;  1QOA A;  3AEA B;  5EE9 A;  1RFK A;  1JQ4 A;  1PFD A;  1TKE A;  1VJK A;  3SFD B;  2DWQ A;  1RYJ A; 
#chains in the Genus database with same CATH topology
 1YIW A;  3T8M A;  4NJC A;  3B1L X;  4YTN B;  3PGE A;  1EO6 A;  1L2N A;  2JRI B;  4JE3 B;  1WI0 A;  4WQO B;  2N9L A;  5BMI A;  1L0Y B;  1NDD A;  4UDU C;  3I63 C;  2DZI A;  2FID A;  4NZL B;  1CK1 A;  2RGF A;  1WF9 A;  1UGJ A;  2MH7 A;  1GC7 A;  2V9H A;  3W5U B;  1YMH E;  3R7Q A;  1SJH D;  2O6V A;  2QIL A;  2BVC A;  1WIA A;  4C56 C;  2L05 A;  2IY1 B;  4FJY A;  1WGK A;  2KVZ A;  1E0Z A;  5HHD G;  3AEC B;  1PGX A;  3DBL B;  4A8X C;  3ZDT A;  2WDT B;  1A5R A;  3DCG A;  2ACZ B;  2R2O A;  2V3P A;  1RFA A;  1K8R B;  1YOV B;  2UYZ B;  4HDO A;  4GU2 A;  4RFB A;  1YX6 B;  1FCL A;  5IOI A;  3PHW B;  1UWX A;  5D3D A;  2KVR A;  3FIL B;  1WXS A;  2TSS A;  4F7Z A;  1E7P B;  3ZDM C;  5IA7 A;  1Z5S B;  1C4A A;  2LEK A;  2WYQ A;  1SF0 A;  2H88 B;  3VXW A;  3KUD B;  2EMS A;  4KGS A;  2N1V A;  1SJE D;  3KLS X;  1WXA A;  4YT0 B;  2LRU A;  4B95 A;  2IGD A;  1ZDX A;  3EEC A;  2I1K A;  3AE9 B;  2PEA A;  4W9H A;  5IN7 A;  4AWJ A;  4B0M A;  3VUY A;  1PGA A;  4BBN F;  3RUI B;  3DQV A;  1VZ6 A;  1STE A;  2BW2 A;  1E7V A;  2JXX A;  1HA5 A;  3VDZ A;  2D5G A;  2V3N A;  1V1P A;  4W9I A;  1ZW7 A;  2NTT A;  2CR5 A;  4HRS A;  1U4A A;  2QDF A;  4FN2 A;  3ZTC A;  4BOS C;  3ENE A;  3SFE B;  5C3J B;  1XO3 A;  4MDK E;  4NY0 A;  3PHX B;  1WYG A;  1A70 A;  1FIQ A;  4J6I A;  2KWU B;  1XLQ A;  2BBC A;  1TS3 A;  3L54 A;  1C78 A;  5FR6 A;  3TBL D;  2RDH A;  4W9E A;  2JU6 X;  1JRU A;  1WR1 A;  2ZW1 A;  3WIM A;  5H92 C;  4MGK E;  4MM3 B;  2DZM A;  3C8Y A;  3NZS A;  3DBH B;  3A9K A;  2HDE A;  1YQB A;  1TIF A;  3DHH C;  3Q3N C;  2PKO A;  4DDG D;  2IBI B;  4P6V F;  1R4M B;  3CF6 E;  3QQ8 B;  4WJO A;  4KIK B;  1LGR A;  4CO7 A;  1F1H A;  4P7I A;  3R7R A;  1XLO A;  1JAL A;  2N7J A;  1N5X A;  2UU7 A;  3NHE B;  4NAW B;  2KMM A;  3QC8 B;  5L83 A;  1AWD A;  2C9W B;  3OAW A;  3ZTD A;  2W82 A;  2ZCB A;  3SD5 A;  5AZG A;  1S1Q B;  1WGD A;  3CIR B;  4XDD A;  2SEB D;  3KWV A;  3Q69 A;  4W9L A;  1J7A A;  2Y3A A;  3QAR A;  2IPK D;  1ACC A;  3HIZ A;  4N59 A;  4US8 A;  4HKQ A;  1I4P A;  2MJE A;  1UBI A;  2RSU A;  4XWT A;  4IG7 B;  2KT7 A;  1CZP A;  5G55 A;  2I2Y A;  1XLP A;  4B0E A;  3IHP C;  1NVI D;  1JWU D;  4ZDV A;  2LVQ A;  2OJR A;  4W9C A;  3HM3 A;  5HFY A;  2JXT A;  2KFJ A;  1MG8 A;  1VLB A;  1YJI A;  4TUU A;  2CJO A;  5DPT A;  2O6V B;  1PQS A;  3BVZ A;  1JRO A;  2D07 B;  4RGM A;  2LGX A;  4AJW A;  4PS3 A;  3NUH B;  1SSN A;  2DYM A;  1MVK A;  1JW9 D;  2LVO A;  4RGT A;  4JL9 A;  2JQR B;  2WX0 A;  4W9G A;  2LJI A;  1MG4 A;  5HG2 A;  2N7E A;  3VFK A;  1VR9 A;  3AE6 B;  1FXI A;  3H7P B;  3RZF A;  5JH5 C;  3K9O B;  4DWF A;  2C7M B;  4IUM B;  3AED B;  3A9K B;  4DHZ B;  4GDK B;  1Q10 A;  2J0K A;  2MQJ A;  4PYZ A;  3IXS A;  2VRR B;  1FRD A;  4DHJ B;  4KSL C;  3VH4 B;  5HKH A;  2WXH A;  4RM8 A;  2AL3 A;  3APF A;  3GB1 A;  1VZ8 A;  3U8Z A;  3AI5 A;  2KWD A;  2HE7 A;  3V05 A;  2J0J A;  4M0W A;  2M0X A;  4OZA A;  3BII D;  3N32 A;  3MFG A;  4C7Y A;  2X8X X;  3R8B A;  2IJ0 A;  1TZO A;  4CHK A;  2GBN A;  4WUR A;  4OVU A;  4TSS A;  5CX3 A;  4PS7 A;  1UBQ A;  4G50 A;  3ZXV A;  1WGR A;  3RN9 C;  2WXR A;  3RNB C;  4LNF A;  1IUE A;  5EDS A;  2D10 A;  2CJN A;  4KGT A;  4BKG A;  2WU2 B;  3NJT A;  4MT5 A;  4OVV A;  2BKF A;  1N5W A;  4KV2 A;  2NTS A;  1JML A;  5D94 A;  3PSE B;  3RI7 C;  2GOW A;  5E6N A;  1H4R A;  1SE2 A;  4XX5 A;  1RAX A;  1QF6 A;  5CHW A;  2FCS A;  1WFY A;  2Y5B B;  1NYQ A;  1QOF A;  4YTP B;  1N63 A;  2KN5 A;  2JT4 B;  2KDF B;  1EF5 A;  3PRE A;  1GJZ A;  1TKY A;  3PRZ A;  4RM9 A;  2N4F A;  2KJ6 A;  1TS2 A;  4CYE A;  2M4N A;  1QOG A;  3I57 A;  1J19 A;  4EKU A;  2KJR A;  3H7S A;  3N1Z C;  3RNC C;  4US9 A;  3ZVV A;  1FNW A;  4ZHO A;  4A3P A;  3VTW A;  2KDE B;  1ZKH A;  3PZ7 A;  4EFO A;  3RNG C;  4IOI E;  1HTQ A;  2RD0 A;  4JGH B;  2BQQ A;  5LXH A;  1EF1 A;  2JYT A;  3KYD D;  3MJ5 A;  3N20 C;  4A90 A;  2FUG 1;  4MEL A;  4NAW A;  3TEY A;  2CHX A;  3JSV B;  2DBY A;  2KMC A;  2IO0 B;  2WXL A;  2HJ8 A;  2ZCC A;  1OQQ A;  5AEK B;  1CMX B;  2KAN A;  2KFK B;  3OWE B;  5C2T B;  1VD2 A;  3R66 C;  1WMH B;  5EE3 A;  3DVG X;  4YL8 A;  2D3A A;  1BXT A;  4IC7 B;  1QT9 A;  2ICI A;  1FPY A;  4QAY A;  4WIP A;  3AEA B;  1QOA A;  3Q3F A;  2QHO A;  4II2 B;  4ZYS A;  4ICV A;  1L6U A;  2NPT A;  2J42 A;  4XWW A;  2MJD A;  4BBN C;  1B9R A;  1TTN A;  1KLU D;  4OW0 A;  2WP9 B;  2N9X A;  4WWP A;  3TEX A;  3VQI A;  2OED A;  1MJD A;  2JF5 A;  4B6W A;  3P1M A;  3ZGZ A;  3MC0 B;  1I4G A;  2MJ3 A;  1K50 A;  1XCQ L;  1QLB B;  1OGW A;  1OQY A;  3BVM A;  3TUO A;  2L7R A;  3ZNG C;  1IGD A;  4EUT A;  4ZHP A;  2NR2 A;  2M1M A;  4X57 B;  1GG3 A;  5G2N A;  2WXI A;  4N9F 4;  1D6E C;  3BYT B;  3LXF A;  1T6B X;  3Q3O C;  4WH4 A;  1JRP A;  1LFD A;  3GP7 A;  3Q14 C;  2LHE A;  3TSS A;  4XDC A;  4PS8 A;  1F77 A;  4N58 A;  4YXD B;  2RPV A;  5AUI A;  2KC1 A;  5JHB A;  4HPL B;  3A33 B;  1FFU A;  3U52 E;  1KH0 A;  3RZW C;  2LGD A;  2QCZ A;  3GS2 A;  1UEL A;  1RLF A;  3RT3 B;  3KUZ A;  5E6O A;  5KHO A;  3VAW A;  2AYO B;  1P9D U;  5FR3 A;  2N0S B;  2JZP A;  1AYF A;  4K7S A;  1YX5 B;  3PV1 A;  3SEB A;  1XF5 L;  2L32 A;  3LYY A;  1WRI A;  3WAN A;  1JWM D;  2ZPY A;  3L08 A;  3UIN B;  1F9J A;  3ZO5 B;  2V0G A;  3NS8 A;  2WXG A;  3P2B A;  3R2I A;  3HUI A;  5IP4 D;  2K1F A;  3IG3 A;  3X23 A;  4IWP A;  3L17 A;  3T9L A;  4CQN A;  4G11 A;  1V80 A;  2LFI A;  2PE6 B;  4NQL B;  3RNE C;  2MP2 A;  1I35 A;  3O13 A;  5AUK A;  3NZ3 A;  4HCP B;  1K52 A;  1NEK B;  4GDL B;  2FIF A;  1SIJ A;  1G6J A;  3NVY A;  4PK1 A;  5BMG A;  1KJT A;  2K25 A;  2W9N A;  4NPN A;  4I6L B;  2NBW B;  4ZRK A;  4BKT A;  4IM0 A;  3ETR A;  3Q3J A;  3P42 A;  2L76 A;  2NVU I;  4EE2 A;  4AJY B;  1LQB A;  4JWS C;  3DBL I;  3RPF C;  1YQ3 B;  3RNA C;  4HCN B;  2VH1 A;  5MPO A;  2BS4 B;  5AZF A;  4D2K A;  1RWS A;  2KNB A;  2IGG A;  5I4D A;  5TR5 A;  1CJE A;  3AEG B;  1R7S A;  1OQR A;  1PYW D;  2KDI A;  3AN1 A;  4GSW A;  3AE8 B;  2BS3 B;  4TKN A;  3VTU A;  3I9V 1;  3L13 A;  4MJS B;  1WWT A;  5CHV C;  4DXG A;  2W55 A;  3K9P B;  3WAL A;  2DZJ A;  2N9E B;  3HM6 X;  2BPS A;  3ABV B;  1Q5W B;  2AQ1 B;  1ROE A;  2BWF A;  2V3S A;  3APC A;  2J52 A;  4HWI B;  4IWQ A;  3Q8A A;  1HZ5 A;  1D5M C;  2WGS A;  2WXO A;  2QIE B;  1WJ4 A;  2ONQ A;  3RD2 A;  2N9P C;  4XZ4 A;  2KMA A;  4MSQ B;  3BZD B;  2KKC A;  2ZVN A;  1FRR A;  3Q2A C;  4M02 A;  2N7D A;  2LUE A;  4JIO U;  1SBB B;  4FXC A;  2BYF A;  2JZZ A;  4K1R B;  5JXV A;  3PLV A;  2IND C;  5HI1 A;  3WCQ A;  4WQM A;  2CU3 A;  3B08 A;  4DHJ D;  5DPS A;  4S0R A;  5D6J B;  3NG0 A;  3NVW A;  2R2Q A;  3W1S C;  2JZ3 B;  5BYQ A;  4C7Z A;  4EOY A;  3UF8 A;  2OJW A;  1V8C A;  3CSF A;  1EU4 A;  1FD6 A;  4HPP A;  2QSD A;  2GLS A;  4ASW C;  4W9D A;  4FJZ A;  3E9S A;  3ZQ4 A;  3PRM B;  3A4S C;  2MLB A;  2R61 A;  4RH6 A;  3M63 B;  2C60 A;  3DBH I;  1L0V B;  2BKR B;  4HKZ E;  2MCN B;  1D5Z C;  4NAM A;  4TV3 A;  1V86 A;  2ZNV C;  3L10 B;  2MA9 B;  2AQ3 B;  3V3X A;  2UWQ A;  1C1Y B;  2YEP F;  4XGA B;  1R4M I;  2WWZ A;  2MRP A;  4KX6 B;  1XQQ A;  2L1A A;  1ZXI A;  2M17 A;  1F52 A;  3ZNZ B;  4C80 A;  2IYD B;  1ZXH A;  1CQV A;  1S3S G;  2PTL A;  5DPW A;  2BGF A;  1ZGU B;  2Z0E B;  2C7N B;  3C19 A;  2G9H D;  2JWZ A;  2KTF A;  3FAH A;  3PZD A;  2D3G A;  2GI9 A;  3L0W B;  1VJK A;  3SFD B;  1C4C A;  2KO3 A;  2LXC A;  4HVB A;  5JHA A;  2D11 A;  3ZJU A;  3M3J A;  1D4B A;  3ZUN A;  4IM3 A;  4LJO B;  1L5P A;  1E7U A;  1E8W A;  4AOF A;  1WM2 A;  4LNK A;  1WSP A;  3A4R A;  4LDT B;  3AEE B;  4I6N B;  4FJV B;  4W9K A;  2WXF A;  2LZ6 A;  2C7H A;  4XE0 A;  3ZNI D;  5CHF A;  2CS4 A;  1I4X A;  2M8S A;  3UI3 A;  2L0T A;  3CWI A;  2OOB B;  2JSV X;  4JPS A;  2I38 A;  1GB4 A;  2K39 A;  2M0A A;  3P4Q B;  3WAO A;  2ZJD A;  1TY2 A;  3VRA B;  3PPA A;  2LD9 A;  4RCO A;  3ZYY X;  3CST A;  3GE3 C;  4LLG M;  3ML8 A;  4ITK A;  1MHX A;  2NS5 A;  3SHQ A;  5LXI B;  2DEN B;  2LWP A;  2IDY A;  3AU4 A;  3V6E B;  4G3X B;  4KGR A;  2HTM E;  4FHJ A;  4DHZ E;  2IZV B;  1ENF A;  1WX8 A;  3TL5 A;  4HEA 1;  1BT0 A;  3ZJT A;  1L0X B;  2PMV A;  3QX1 A;  4XYC A;  3RCZ A;  2KC2 A;  1P0R A;  4ANV A;  2MEK A;  5T8I A;  5G5G A;  4MJS A;  3MJW A;  1V81 A;  3LB8 C;  3U4E G;  1LXD A;  3VH3 B;  1H8C A;  1MPE A;  3WA0 A;  1WE6 A;  1OEY J;  4F8C B;  3ZW3 A;  2WX1 A;  3AUL A;  4BAX A;  5CTR C;  2L8J A;  3ECI A;  2Y5P A;  2MWS B;  4M8N A;  2VH2 A;  1L7Y A;  3AE2 B;  1DYQ A;  1HE8 A;  4Q2J A;  4MEM A;  4HJK A;  2GBJ A;  2ZW0 A;  3TEW A;  1FXT B;  2J0M A;  2K6Q A;  1NYR A;  3Q8B A;  2BYT A;  1UD7 A;  1KLG D;  2JWU A;  2Z8L A;  1KF6 B;  2J4X A;  2DAJ A;  2WDQ B;  2G1E A;  3Q6B A;  2WS3 B;  4G0N B;  5G5H A;  1L4D B;  1L6V A;  2MW5 A;  1V2Y A;  3UQB A;  3O65 B;  2KQ4 X;  4MGZ E;  4LNN A;  5J17 A;  2LHD A;  4PYU A;  1XT9 B;  2RPQ A;  3IVF A;  2B3A A;  4MGI E;  3EA6 A;  1WYW B;  1ESF A;  1V6E A;  3ZJV A;  1KTK A;  2K8C A;  2PE9 A;  3W9C B;  4FA6 A;  3H1U A;  3A9J A;  1KOT A;  5GMV A;  4JX1 C;  2WQY B;  1IBX A;  3GZN I;  2RMM A;  3DBR I;  1XLN A;  2G3Q B;  1JCK B;  2WXK A;  1D5X C;  4M01 A;  3U2S C;  2G4D B;  2XBB C;  2WXQ A;  4GDL A;  4MSM B;  2INN E;  1YQ4 B;  1J7B A;  1TZ1 A;  4RMA A;  5TSS A;  1R4N B;  3VTV A;  3QA8 A;  4URK A;  3LJ3 A;  2EEL A;  1IYF A;  4GB9 A;  4ZOH C;  1WJ6 A;  5LLI A;  1YJ1 A;  2QEJ C;  4E71 A;  4GLS C;  1KM7 A;  1UZX B;  4HRO A;  4AQ7 A;  1RFK A;  1WMH A;  4DXA B;  3N9Y C;  4YWG G;  2N1W A;  2BB6 A;  4LNO A;  3VR8 B;  3J9C A;  3L16 A;  3PS6 A;  3T3O A;  4YSX B;  3FKY A;  1FEH A;  4II3 B;  3T3N A;  2HJ1 A;  2MBH A;  4HLE A;  4K3B A;  4NNJ B;  3JW0 X;  2NPT B;  5C23 A;  4A55 A;  3EUB 2;  3FC4 A;  5E6P A;  1QIL A;  4LJP B;  3PT2 B;  1DOI A;  3Q8C A;  2HTH A;  3URY A;  1E8Z A;  5J2R A;  3A1Q A;  4WWM A;  1TBE A;  4C4V B;  4RGN A;  1M4V A;  5LNK 1;  2FNJ B;  1KFY B;  3N3K B;  3AB5 A;  4MGY E;  4S17 A;  1DOY A;  1WH3 A;  3OLM D;  3FIL A;  1WX9 A;  5IO9 A;  5BYS A;  1KLV A;  3OG5 A;  3DBS A;  1Q0W B;  4A9A A;  4W9J A;  1QKZ A;  3P4R B;  5D7G A;  4WWN A;  3PO0 A;  4FUL A;  1TGZ B;  2J53 A;  2A5U A;  3KYC D;  2AL6 A;  1JWS D;  2PVG C;  3KH0 A;  1Q1O A;  2Z0D B;  3PLU A;  3HK0 A;  2KLG A;  3VVW B;  1ET6 A;  1TYG B;  2DX5 B;  3MHZ A;  2INC C;  3L4P A;  2KDM A;  2XEW A;  4ZRJ A;  3BK2 A;  3TEZ A;  1BML C;  1WXV A;  3P4P B;  2LGY A;  2D2Q A;  2FE8 A;  2LUM A;  1ZP0 B;  1X1M A;  1ET9 A;  3JYU A;  2KQ7 A;  3N1Y C;  3W1S A;  1C9F A;  2WLB A;  1XD3 B;  5EE9 A;  3MC8 A;  3BVG A;  4REZ A;  2NCN A;  1TKE A;  2CHW A;  4GDK A;  3AE5 B;  2K0P A;  4RF0 A;  5DPR A;  1GC6 A;  2LXA A;  2KZR A;  1WM3 A;  4LNI A;  1SGH A;  2K3U A;  2BS2 B;  2N9K A;  3EFC A;  1I7H A;  1SIF A;  3D32 A;  3ZKJ C;  1WY8 A;  2KQS A;  3QIJ A;  2MSE D;  3DDC B;  4ARI A;  4YSY B;  2VZK D;  2VZK B;  3B0A A;  2WNM A;  3H7P A;  1RRB A;  3QCA A;  2KOX A;  4OZC A;  2Z59 B;  3P4S B;  4TQ0 A;  3WAM A;  2KTR A;  1J7C A;  1WGH A;  2KAC A;  2INP E;  3EC8 A;  3DHG C;  3VR9 B;  1MI0 A;  2AX5 A;  1FCC C;  4KKJ A;  1YD8 U;  2DNF A;  4C4V A;  2D3B A;  2RDG A;  1XXG A;  2BT6 A;  3U30 A;  3GZN B;  2KDB A;  4GMV A;  3V61 A;  3NOB A;  3ALB A;  2L83 A;  1Z2M A;  2JX5 A;  1QQR A;  2MBQ A;  1YN4 A;  2LAS A;  2WHI A;  1WRD B;  1EM7 A;  5BO4 B;  2DLB A;  5EE1 A;  2IY0 B;  3AXC A;  1WXM A;  3EGR A;  3SDL C;  5D3I B;  1B1Z A;  1PUT A;  2W3S A;  1ZDV A;  1YN3 A;  4E3C A;  1PFD A;  1K51 A;  1C77 A;  3ONS A;  2IGH A;  3DOW A;  3AE7 B;  2IO1 B;  5E6J A;  1TJE A;  1E90 A;  2V4L A;  3VUW A;  2DHZ A;  4EEW A;  1DGJ A;  2JPH A;  2RDB C;  3AH7 A;  4LDT D;  1TY0 A;  1IP9 A;  4IWO A;  2ZVO A;  4EZL A;  1NI2 A;  2K5P A;  4M8M A;  3BK1 A;  4KSK C;  3AM9 A;  2ZNV B;  3TMP B;  4W9F A;  1E6E B;  2H89 B;  4TMA B;  1E9M A;  1L4Z B;  2JYE A;  5GXG B;  1T3Q A;  2WDR B;  2EKI A;  2D3C A;  2REX A;  4E74 A;  1GUA B;  5AZH A;  3I3T B;  2PJH A;  1T0Y A;  3NS1 A;  3QWZ B;  1HTO A;  2KX0 A;  2NBU A;  1T0R C;  3NRZ A;  2AQ2 B;  4ANU A;  2XN9 C;  1V1P B;  3RUL A;  4A3O A;  2EMT A;  3WAP A;  3KUC B;  2K9X A;  3QHT A;  3ZIM A;  2KD0 A;  4M00 A;  1BUI C;  3W5V B;  3DVN U;  4GOC A;  2PVO D;  2O2V A;  4BVU C;  4RNA A;  1F2R C;  4L23 A;  3Q8E A;  1ZUD 2;  3HVD A;  1FXA A;  1WZ0 A;  3EHV A;  1SEB D;  4AP4 C;  3V60 A;  4ACF A;  3X0W A;  1T0S C;  2K8B A;  1HQR D;  2SAK A;  3CMM B;  1UGM A;  3H8H A;  3IAS 1;  2QC8 A;  1E5W A;  1D3Z A;  2KWC A;  1AAR A;  1SE9 A;  4ZRP A;  2A4Z A;  2L0F A;  4OHJ A;  2KTR B;  3M95 A;  3JSV A;  1HEZ E;  4AUQ C;  4GN1 A;  3H6N A;  3LDZ E;  4NQK E;  1IPG A;  1I4H A;  3IT4 B;  3Q8F A;  2NBV B;  1FO4 A;  1RM6 C;  2LJ5 A;  2YEP B;  3R2T A;  4USA A;  1FM0 D;  4FAD A;  1JWB D;  1Y56 A;  1I42 A;  3DVG Y;  1E8Y A;  2JY6 A;  5L95 C;  2C5L C;  4FHK A;  2DYO A;  4TQ1 A;  3V62 A;  2BYE A;  2K22 A;  3ZNH B;  3RFZ B;  1TS4 A;  2XK5 A;  2WDV B;  1ZPS A;  2DZK A;  2MP2 B;  5IKC M;  4JWU C;  2GBK A;  1GAQ B;  4KZC A;  2PW9 A;  3P63 A;  1T5X D;  4L2Y A;  2MX2 A;  3GOE A;  5D2M B;  2Y5C A;  3HRD D;  1P7F A;  4ICU A;  4HDQ A;  5EE0 A;  3DVN V;  2KX3 A;  1SE3 A;  2BYV E;  1EWY C;  3ZRF A;  4XC2 A;  1N61 A;  4MM3 A;  2X38 A;  4NJ7 A;  1GB1 A;  2JVC A;  1TS5 A;  2O2V B;  4O1N A;  4ANW A;  3KW5 B;  4BZA A;  3AE4 B;  1VDV A;  1GPX A;  2I1J A;  4MAC A;  3PZ8 A;  2WU5 B;  4P1C C;  3E56 A;  3UIP B;  1HZ6 A;  3OJ4 B;  3W2D A;  1WGY A;  3V6C B;  2RR9 A;  1ISN A;  1J8C A;  4M0W B;  1FMA D;  4RF1 A;  4RGO S;  3RMK C;  2BTE A;  2KAJ A;  2GMI C;  2M19 A;  2L00 B;  3PVL A;  1C79 A;  4N6E B;  1UH6 A;  2KN4 A;  3BIN A;  3B2F A;  2V1Y A;  2J7Q B;  4GXB A;  2Q5W D;  5KHQ A;  3SU8 X;  3NY5 A;  3C0R B;  2OHF A;  1V5O A;  3AE3 B;  3GE8 C;  4BKS D;  4EZK A;  3QJZ A;  4IDI A;  1WZ3 A;  4KIK A;  1K53 A;  2JUO A;  4HPM B;  4IM2 A;  4BOZ B;  2BB5 A;  2ZEQ A;  4KDL B;  3A1Q B;  2QMT A;  1ZE3 D;  2BF8 B;  5JZE B;  3SR6 A;  2K6D B;  2HD5 B;  2PPH A;  2MBO A;  4IW0 A;  3PRP B;  3DWG C;  1AW7 A;  3U7Z A;  3U7D A;  5J18 A;  1V49 A;  2FCM A;  1C4P A;  4R3D A;  1OFF A;  2PIA A;  3DPD A;  4OZB A;  1C3T A;  2KLC A;  2QJL A;  1TT5 B;  4BKS A;  2LMC A;  5BYR A;  2XK5 B;  1SXT A;  4FBJ B;  2XNA C;  1WX7 A;  3B2G A;  3IFW B;  4I6P A;  1MHH E;  1QZE A;  4L1B A;  1EWC A;  5DCN A;  4WJN A;  3AV8 A;  2FBW B;  1P1A A;  2ON8 A;  4KKI A;  2WXP A;  1EUV B;  1ZOY B;  4P16 A;  1N62 A;  3KWL A;  4K7U A;  1N6Z A;  2ZZP B;  4HK2 A;  2CKH B;  2KHW B;  1XCT L;  2DWQ A;  1RYJ A;  4F1S A;  3TJP A;  4MH0 E;  1UNS A;  1I4R A;  2LGI A;  2MHJ A;  3A9J B;  3BYY B;  2KK8 A;  2JRH A;  4A20 A;  1OTR B;  4DBG A;  1QOB A;  2FCQ A;  1SE4 A;  4ANX A;  3UQA A;  4WWO A;  1VCB A;  4J3O D;  1F2R I;  3HHM A;  3DHI C;  1XEE A;  2KJH B;  4YSZ B;  4WJP A;  3JVZ X;  3MTN B;  1PDX A;  3AU5 A;  3QK0 A;  4LCD E;  4DDI D;  2WXN A;  1I4Q A;  4ZYN A;  1Y8R C;  2GBR A;  2M56 B;  3M62 B;  4MH8 A;  4DQO C;  2YLM A;  2LVP A;  5FKA C;  3AE1 B;  1OEY A;  3ZXR A;  1UUP A;  2KFK A;  4YTM B;  3HVZ A;  3OJ3 A;  2WXJ A;  2LGS A;  1WXQ A;  2CHZ A;  3RYT A;  3Q3M C;  1YN5 A;  4DXF A;  1MFW A;  1V5T A;  1VRA B;  1EU3 A;  4KZ0 A;  4WAF A;  3VUX A;  3I5J C;  1C76 A;  3B9J A;  4P1B C;  4PT5 A;  4DK5 A;  1T0Q C;  4AS1 A;  1NEN B;  2BWE S;  1E10 A;  1IGC A;  1FNV A;  3DBR B;  3BWU D;  2LI5 A;  3ML9 A;  3TIX A;  3PTF C;  1HXY D;  3MP9 A;  1FNU A;  4KDI C;  2FAZ A;  3R3M A;  2IO3 B;  4BFR A;  2GRI A;  2K8H A;  4K7W A;  1R4N I;  2LRW A;  2ZPN A;  4HXD A;  4KVG B;  3UIO B;  1NBF C;  3S2A A;  3MC9 A;  2W54 A;  2GB1 A;  3AMZ A;  2DYB A;  4WJQ A;  1M94 A;  3ZLZ A;  4JQW C;  1J0G A;  3NZU A;  1JQ4 A;  1P98 A;  3QAQ A;  4ZRI A;  1WGG A;  3NVZ A;  3KQ4 A;  1NI3 A;  4B9K A;  1GNU A;  3AEB B;  3VHT C;  2ASQ A;  1KRH A;  2PLP A;  2V4I B;  2AWT A;  3AEF B;  2WXM A;  1PGB A;  1V97 A;  4HJG E;  2L3Z A;  1TKG A;  2W3R A;  4K81 A;  2AEH A;  4JLC A;  5BMH A;  3IBE A;  1F0Z A;  3N30 A;  1GOZ A;  1V1O A;  1WJN A;  4NJ6 A;  3TCA A;  2MBE A;  3MHS D;  1WE7 A;  1P7E A;  4LTU A;  3KVF B;  4ARC A;  3W1Y A;  3UGB B;  1DOX A;  3IT6 B;  1UF0 A;  4EZJ A;  1LM8 B;  4LK0 M;  4GGQ A;  3N1X C;  2YVC A;  2MBB B;  5IAA C;  4K3C A;  1E8X A;  3RNF C;  1UWM A;  1P3Q U;  2NMQ A;  1FFV A;  3BY4 B;  2B76 B;  4IKG A;  1V9J A;  3IAM 1;  2E3T A;  1JWA D;  1AN8 A;  1WR6 E;  3APD A;  2O6V D;  2KWV B;  2EKE C;  3EFU A;  3ZRC A;  5FK9 C;  5C1Z A;  2KXJ A;  3NVV A;  2GBM A;  1SB3 C;  1YNT E;  2DAF A;  4A6Q A;  2IO2 B;  4ZRQ A;  2FUH B;  1LO5 D;  2G45 B;  4FLH A;  2E6X A;  4H2A A;  4OVZ A;  5H8Y E;  2FCN A;  1YJJ A;  4GIV A;  3VRB B;  1IBX B;  3H9D A;  1N60 A;  3DWM A;  4C00 A;  1VZ7 A;  2L52 A;  2G4S A;  4WAA A;  2KYW A;  1WJU A;  2CU1 A; 
#chains in the Genus database with same CATH homology
 4NJC A;  4Q2J A;  1HQR D;  2SAK A;  4ZYS A;  1L6U A;  4YTN B;  2J42 A;  3H8H A;  4XWW A;  2ZW0 A;  3TEW A;  3IAS 1;  2MJD A;  4JE3 B;  1NYR A;  3Q8B A;  4ZRP A;  2N9L A;  1B9R A;  4OHJ A;  5BMI A;  1KLU D;  2BYT A;  1L0Y B;  2WP9 B;  4OW0 A;  1KLG D;  2JWU A;  2Z8L A;  3TEX A;  3VQI A;  1KF6 B;  4UDU C;  1HEZ E;  2OED A;  2J4X A;  4NZL B;  2WDQ B;  1CK1 A;  2G1E A;  2WS3 B;  1UGJ A;  2MH7 A;  3P1M A;  3ZGZ A;  5G5H A;  1L4D B;  3MC0 B;  1I4G A;  3W5U B;  1YMH E;  1L6V A;  1I4H A;  1SJH D;  2QIL A;  2MJ3 A;  3IT4 B;  3Q8F A;  1K50 A;  1FO4 A;  1RM6 C;  4C56 C;  1XCQ L;  2KQ4 X;  1QLB B;  3BVM A;  3TUO A;  1WGK A;  2LHD A;  2YEP B;  3R2T A;  4USA A;  1E0Z A;  1FM0 D;  1JWB D;  1Y56 A;  5HHD G;  1IGD A;  3AEC B;  1PGX A;  4A8X C;  4TQ1 A;  2DYO A;  2K22 A;  4ZHP A;  3RFZ B;  1TS4 A;  3EA6 A;  2ACZ B;  2WXI A;  1ESF A;  2V3P A;  1D6E C;  2WDV B;  1ZPS A;  3BYT B;  3LXF A;  1T6B X;  4WH4 A;  3ZJV A;  1JRP A;  4JWU C;  1KTK A;  3GP7 A;  4RFB A;  2LHE A;  3TSS A;  1GAQ B;  2PW9 A;  3P63 A;  4XDC A;  1T5X D;  1FCL A;  3W9C B;  4L2Y A;  1F77 A;  4N58 A;  4YXD B;  2RPV A;  4JX1 C;  5AUI A;  2WQY B;  1UWX A;  2Y5C A;  3HRD D;  1IBX A;  5D3D A;  1FFU A;  1P7F A;  3FIL B;  3U52 E;  1KH0 A;  2RMM A;  2TSS A;  1XLN A;  5EE0 A;  1E7P B;  1JCK B;  2WXK A;  3GS2 A;  1D5X C;  1SE3 A;  1EWY C;  1C4A A;  2LEK A;  3U2S C;  2WXQ A;  1SF0 A;  2H88 B;  2INN E;  4KGS A;  1SJE D;  1N61 A;  5FR3 A;  3KLS X;  2N0S B;  2JZP A;  1AYF A;  1YQ4 B;  1J7B A;  2X38 A;  5TSS A;  1GB1 A;  4YT0 B;  1TS5 A;  3SEB A;  4O1N A;  1XF5 L;  2EEL A;  3AE4 B;  4ZOH C;  1VDV A;  1GPX A;  2L32 A;  2IGD A;  3LYY A;  1ZDX A;  2QEJ C;  4GLS C;  1WRI A;  3AE9 B;  4MAC A;  3PZ8 A;  2WU5 B;  3E56 A;  1JWM D;  4HRO A;  4AQ7 A;  1HZ6 A;  1RFK A;  3N9Y C;  4B0M A;  1PGA A;  3W2D A;  4YWG G;  2V0G A;  1VZ6 A;  2WXG A;  1STE A;  2BB6 A;  2BW2 A;  3R2I A;  3HUI A;  3VR8 B;  1FMA D;  4RF1 A;  4RGO S;  1HA5 A;  3J9C A;  4XDD A;  2D5G A;  2BTE A;  2KAJ A;  2V3N A;  3T3O A;  1V1P A;  2M19 A;  4CQN A;  4YSX B;  1FEH A;  1C79 A;  4N6E B;  2NTT A;  3T3N A;  2LFI A;  4HRS A;  2KN4 A;  4A55 A;  3B2F A;  3O13 A;  5AUK A;  3EUB 2;  3NZ3 A;  1K52 A;  1NEK B;  3FC4 A;  2Q5W D;  4GDL B;  1SIJ A;  1QIL A;  3SFE B;  3NVY A;  5C3J B;  1DOI A;  1XO3 A;  5BMG A;  3Q8C A;  3URY A;  1WYG A;  1A70 A;  1FIQ A;  2OHF A;  4WWM A;  1XLQ A;  2BBC A;  1TS3 A;  3AE3 B;  4RGN A;  1C78 A;  3ETR A;  4IDI A;  2RDH A;  3P42 A;  1M4V A;  5LNK 1;  4EE2 A;  1KFY B;  1K53 A;  2JU6 X;  4JWS C;  3AB5 A;  2BB5 A;  3RPF C;  1YQ3 B;  1DOY A;  2ZW1 A;  5H92 C;  2QMT A;  1ZE3 D;  4MM3 B;  3C8Y A;  3FIL A;  5MPO A;  3SR6 A;  2BS4 B;  4D2K A;  5BYS A;  1RWS A;  2IGG A;  2HDE A;  4A9A A;  3DWG C;  1AW7 A;  5I4D A;  1QKZ A;  3P4R B;  5D7G A;  3U7Z A;  1CJE A;  3AEG B;  2PKO A;  3PO0 A;  1R7S A;  1OQR A;  1PYW D;  3AN1 A;  4P6V F;  1C4P A;  4R3D A;  1OFF A;  2PIA A;  4OZB A;  2J53 A;  2QJL A;  2LMC A;  1JWS D;  3AE8 B;  5BYR A;  2BS3 B;  2PVG C;  3I9V 1;  1WWT A;  1SXT A;  1XLO A;  1JAL A;  2N7J A;  4DXG A;  2W55 A;  1N5X A;  1ET6 A;  4NAW B;  1TYG B;  2KMM A;  3MHZ A;  3L4P A;  2KDM A;  2XNA C;  1AWD A;  3BK2 A;  3TEZ A;  1BML C;  3P4P B;  3B2G A;  3ABV B;  2AQ1 B;  1ROE A;  1MHH E;  2FE8 A;  4L1B A;  2LUM A;  1EWC A;  2W82 A;  1ZP0 B;  3AV8 A;  2J52 A;  1ET9 A;  2FBW B;  2ON8 A;  3CIR B;  2WXP A;  4KKI A;  2SEB D;  1ZOY B;  3Q8A A;  4P16 A;  1HZ5 A;  3KWV A;  3Q69 A;  1D5M C;  1J7A A;  1N62 A;  3KWL A;  2WXO A;  3W1S A;  1C9F A;  2WLB A;  2QIE B;  2Y3A A;  5EE9 A;  2IPK D;  2ONQ A;  3BVG A;  4REZ A;  1TKE A;  1XCT L;  2DWQ A;  1ACC A;  1RYJ A;  4N59 A;  4US8 A;  4HKQ A;  1I4P A;  3AE5 B;  1UNS A;  2K0P A;  2MJE A;  1I4R A;  3BZD B;  4RF0 A;  2LGI A;  4XWT A;  3BYY B;  1FRR A;  1CZP A;  2K3U A;  2I2Y A;  1SBB B;  1QOB A;  2BS2 B;  4FXC A;  1SE4 A;  1XLP A;  4B0E A;  1NVI D;  1JWU D;  2N9K A;  5JXV A;  1I7H A;  4J3O D;  5HFY A;  2JXT A;  1F2R I;  1VLB A;  1YJI A;  5HI1 A;  3WCQ A;  1XEE A;  2CJO A;  4WQM A;  4YSZ B;  2CU3 A;  3BVZ A;  1JRO A;  1PDX A;  4RGM A;  4ARI A;  3NUH B;  1SSN A;  2DYM A;  2WXN A;  1I4Q A;  1MVK A;  3NVW A;  4YSY B;  5BYQ A;  2VZK D;  1JW9 D;  2VZK B;  4C7Z A;  2M56 B;  4MH8 A;  4DQO C;  4RGT A;  2WNM A;  2JQR B;  5FKA C;  3AE1 B;  1V8C A;  2LJI A;  1EU4 A;  1UUP A;  1FD6 A;  2QSD A;  4YTM B;  3HVZ A;  5HG2 A;  2WXJ A;  1VR9 A;  3AE6 B;  1WXQ A;  4OZC A;  1FXI A;  3P4S B;  1YN5 A;  4TQ0 A;  4DXF A;  3E9S A;  1VRA B;  3ZQ4 A;  3AED B;  1EU3 A;  1J7C A;  4WAF A;  2KAC A;  4GDK B;  1C76 A;  2INP E;  3B9J A;  1Q10 A;  4PT5 A;  2R61 A;  4RH6 A;  3VR9 B;  1MI0 A;  2AX5 A;  1FCC C;  1L0V B;  1NEN B;  4HKZ E;  3IXS A;  4KKJ A;  4AS1 A;  1E10 A;  1D5Z C;  1FRD A;  4NAM A;  1IGC A;  1FNV A;  2WXH A;  3BWU D;  3GB1 A;  1VZ8 A;  2AQ3 B;  1HXY D;  1XXG A;  2RDG A;  1FNU A;  2KWD A;  2BT6 A;  3MP9 A;  3V3X A;  2YEP F;  4KX6 B;  3V05 A;  2L1A A;  2GRI A;  2L83 A;  1ZXI A;  4M0W A;  4OZA A;  2JX5 A;  1QQR A;  3BII D;  4C80 A;  1YN4 A;  3MFG A;  1ZXH A;  4C7Y A;  1CQV A;  1EM7 A;  2PTL A;  2DLB A;  5EE1 A;  3R8B A;  2W54 A;  2IJ0 A;  3EGR A;  2GB1 A;  1TZO A;  3AMZ A;  5D3I B;  1B1Z A;  1PUT A;  4WUR A;  2W3S A;  4TSS A;  1ZDV A;  2G9H D;  1YN3 A;  3FAH A;  1JQ4 A;  2GI9 A;  1PFD A;  1VJK A;  1K51 A;  3SFD B;  1C4C A;  1C77 A;  2WXR A;  2IGH A;  3AE7 B;  1IUE A;  5E6J A;  3NVZ A;  3KQ4 A;  1TJE A;  1NI3 A;  2CJN A;  4KGT A;  3ZJU A;  2WU2 B;  3AEB B;  1D4B A;  1KRH A;  2PLP A;  2V4I B;  3AEF B;  4MT5 A;  1L5P A;  1PGB A;  1V97 A;  2WXM A;  1DGJ A;  3AH7 A;  4HJG E;  1N5W A;  1TY0 A;  2NTS A;  1JML A;  1WSP A;  1TKG A;  2K5P A;  1SE2 A;  2W3R A;  3AEE B;  3BK1 A;  2WXF A;  3AM9 A;  1QF6 A;  5BMH A;  1NYQ A;  1QOF A;  1F0Z A;  4YTP B;  4XE0 A;  1N63 A;  1GOZ A;  1E6E B;  1V1O A;  1I4X A;  2H89 B;  4TMA B;  3UI3 A;  3CWI A;  1E9M A;  2JSV X;  1TKY A;  4JPS A;  2I38 A;  1GB4 A;  2M0A A;  3P4Q B;  1P7E A;  4LTU A;  4ARC A;  1L4Z B;  2JYE A;  5GXG B;  1TY2 A;  3VRA B;  1T3Q A;  2WDR B;  2EKI A;  3IT6 B;  1DOX A;  4LK0 M;  1TS2 A;  4RCO A;  3ZYY X;  4LLG M;  1QOG A;  3I57 A;  4ITK A;  1MHX A;  3NS1 A;  4US9 A;  2IDY A;  1FNW A;  4ZHO A;  1UWM A;  2NMQ A;  1FFV A;  2B76 B;  3NRZ A;  3PZ7 A;  4IKG A;  2AQ2 B;  3IAM 1;  4IOI E;  4KGR A;  2HTM E;  2E3T A;  1JWA D;  1AN8 A;  2XN9 C;  1V1P B;  1ENF A;  4HEA 1;  3ZJT A;  1L0X B;  2PMV A;  2JYT A;  3MJ5 A;  5FK9 C;  4A90 A;  2K9X A;  2FUG 1;  3TEY A;  2DBY A;  1BUI C;  3W5V B;  2MEK A;  2WXL A;  3NVV A;  1SB3 C;  5T8I A;  1OQQ A;  5G5G A;  2PVO D;  1YNT E;  4A6Q A;  3LB8 C;  4ZRQ A;  3U4E G;  1MPE A;  3OWE B;  5C2T B;  4RNA A;  5EE3 A;  1F2R C;  1LO5 D;  4L23 A;  2E6X A;  3Q8E A;  1ZUD 2;  3HVD A;  4H2A A;  1FXA A;  1BXT A;  4OVZ A;  5H8Y E;  2Y5P A;  1QT9 A;  1SEB D;  1YJJ A;  2ICI A;  3VRB B;  1IBX B;  4WIP A;  1N60 A;  3DWM A;  1VZ7 A;  2L52 A;  3AE2 B;  1QOA A;  3AEA B;  1DYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...