1OQRA

Crystal structure of c73s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.65a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putidaredoxin
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Electron transport
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqrA00
1L6UA 1RYJA 3AEGB 1VJKA 2W3SA 3AE4B 3HRDD 1XLNA 1V8CA 1TKGA 1CJEA 1ZUD2 5GXGB 3AV8A 3AEAB 5EE9A 2EKIA 4ITKA 5C3JB 5G5HA 1KF6B 2WU5B 1XLPA 4US8A 2HTME 2FBWB 1QOGA 1TKEA 1ZXIA 2MJEA 3CIRB 3NS1A 3NRZA 1NYQA 1DOXA 3AE5B 3B2FA 4ZHOA 3ABVB 1E10A 1TJEA 3NVZA 1JQ4A 1NI3A 3P63A 1GPXA 1QT9A 1OFFA 1YJJA 1N60A 4WWMA 4YSZB 1I7HA 1RM6C 4YSYB 3B9JA 1OQQA 1NVID 1FFVA 4N6EB 1J7BA 2QJLA 1SB3C 4HROA 2E3TA 3ETRA 2WLBA 3W9CB 1YQ3B 1R7SA 1QLBB 4IDIA 3AEDB 3CWIA 4A9AA 5MPOA 1DOIA 1QOFA 4HRSA 2BS4B 2L83A 3LXFA 3W5UB 1FXAA 2PVOD 1CZPA 3SR6A 1JRPA 1AYFA 4C7ZA 4YTMB 1E6EB 2W54A 4JX1C 1N61A 4YT0B 1A70A 1FO4A 1B9RA 1VDVA 3ZYYX 3LB8C 5EE1A 5G5GA 2BT6A 1YQ4B 4LTUA 2WDQB 1UWMA 2K5PA 3AH7A 4N58A 1NYRA 4ZHPA 1RFKA 2G1EA 2CJNA 1L5PA 4USAA 5C2TB 1E7PB 1L0VB 1QOBA 3BIID 3KWLA 1E0ZA 3P4RB 1GAQB 1ZP0B 2WDVB 1PFDA 3L4PA 4YSXB 1JWAD 1FRRA 1JW9D 2DBYA 3AECB 2PKOA 2WS3B 4YTNB 1V97A 3B2GA 3AE8B 2WU2B 2WQYB 3RPFC 1OQRA 1DGJA 3NVWA 3VRBB 1NENB 2L52A 1WXQA 2MJ3A 2BS3B 2BS2B 1FRDA 2MJDA 3NVVA 5EE3A 5AUKA 1FM0D 3AB5A 4US9A 2OHFA 1IUEA 3VRAB 4C7YA 1JROA 1XLOA 1FMAD 1WYGA 1XLQA 1WRIA 2JQRB 3P1MA 1T3QA 4C80A 1FIQA 4WQMA 4ZOHC 1ROEA 2B76B 2H88B 2W55A 3HUIA 1J7CA 2KAJA 5H8YE 1F0ZA 1AWDA 2LEKA 2CJOA 1NEKB 3DWMA 3AN1A 3AEFB 1N62A 3AE6B 2CU3A 4YTPB 1JALA 1WGKA 2DWQA 2K22A 2KMMA 3P4PB 3PO0A 5EE0A 3VR9B 1N63A 1E9MA 1EWYC 3AE7B 1SIJA 1FFUA 2WDRB 4P6VF 4JWSC 1VLBA 2JX5A 1TYGB 1FXIA 1N5XA 2AX5A 5AUIA 1XO3A 1JWBD 3SFDB 1KRHA 3AEBB 5H92C 1N5WA 1YJIA 2QIEB 3AE3B 2K9XA 3NVYA 1PUTA 4JWUC 4FXCA 1SF0A 2ACZB 2Q5WD 3AEEB 1RWSA 2M19A 2N0SB 2WP9B 3FC4A 3FAHA 4N59A 1QF6A 3P4SB 3SFEB 1DOYA 2PIAA 3AM9A 1QOAA 3W5VB 3P4QB 2Y5CA 4KX6B 2PVGC 3AE9B 3WCQA 2M56B 1PDXA 3AE2B 1J7AA 1TKYA 2MH7A 2W3RA 1L6VA 1ZOYB 3DWGC 1WWTA 2H89B 3AE1B 3HVZA 3EUB2 3VR8B 1KFYB 4YXDB 3AMZA
chains in the Genus database with same CATH superfamily
4RH6A 4XGAB 1WGGA 3VVWB 5BMHA 3UQBA 3GP7A 2MWSB 4XX5A 3K9PB 3DPDA 4F7ZA 3RZFA 4A90A 4TMAB 1F2RC 1D6EC 5D3DA 1P7EA 3ABVB 2D3BA 2K39A 2N7EA 1K8RB 2L7RA 3P63A 4MH8A 1YJJA 3ZTCA 1MG8A 4C56C 2JU6X 1BMLC 3JYUA 1ENFA 3CWIA 2A5UA 1DOIA 4OZBA 3AXCA 2BS4B 2CHXA 3BY4B 5TR5A 1HEZE 2LWPA 1ZGUB 2LGIA 2B3AA 2MLBA 1L0YB 2BYTA 2XK5B 1L0VB 4FHJA 4IM2A 3ZDTA 5KHOA 4FLHA 3DDCB 5FR3A 4IG7B 2JT4B 2OJWA 3ZQ4A 3KUDB 2ZEQA 3NY5A 2D11A 2D07B 2KDEB 1M4VA 3R3MA 4HPMB 1WE7A 4ZRQA 1HXYD 2KWVB 1R4NI 5HFYA 3DHIC 3A9KA 3D32A 2KMCA 2FCSA 3RFZB 2WHIA 2WDRB 1XQQA 2NBUA 3KUCB 5D94A 2JX5A 1I35A 5KHQA 1FNWA 1OGWA 3Q3FA 4M01A 2AL3A 1FNVA 2Y5PA 5DCNA 5BO4B 2WP9B 1F1HA 2KDIA 1P1AA 4H2AA 2PIAA 1GC6A 3KH0A 2PVGC 3N32A 2G9HD 2ZNVC 3IG3A 3SEBA 3AE1B 3KWLA 3H7SA 3MC9A 1ZE3D 3AE4B 3Q8CA 4I6NB 2KJRA 2KZRA 4PS8A 2LHDA 3OAWA 2INCC 4M8MA 2D10A 1EU3A 1DOXA 1UBQA 4FHKA 1TJEA 1XF5L 1WY8A 2KMAA 3ZO5B 3L13A 4IC7B 3PLVA 2PPHA 3QWZB 2BW2A 2HJ1A 4N6EB 3PS6A 4W9HA 1WGYA 3CMMB 2KLGA 2KFKA 2GMIC 4WH4A 4GDLB 2DYMA 3UF8A 4A55A 3B1LX 4ZYSA 3NOBA 3U8ZA 3PPAA 3BYTB 3UINB 3W5UB 4AOFA 3MHSD 3L08A 2LMCA 4YTMB 2W54A 1YMHE 4ANXA 1JWSD 4OHJA 1L5PA 3X23A 4GIVA 2WDVB 3PRZA 2DBYA 2V1YA 4M0WB 2N9KA 2JWUA 4GU2A 3OG5A 3CSTA 3RI7C 1MFWA 1KH0A 5D6JB 1SBBB 2D3AA 3EECA 3DVGX 3W2DA 4LJOB 2O6VB 3A4SC 1DYQA 3RUIB 1XCQL 2XN9C 1V5OA 1JWMD 1SIJA 3QHTA 4P6VF 4EE2A 1WF9A 5BMGA 2OOBB 4TSSA 2RD0A 2QIEB 3Q2AC 1KTKA 5C1ZA 4YL8A 5LLIA 2IY1B 2Y5BB 3JW0X 1ZDXA 1KLUD 2MH7A 2N9XA 4L1BA 2L00B 2DZIA 1WR1A 4JE3B 1L2NA 2JXTA 3WIMA 2AQ2B 1ZXIA 4NJ7A 4WIPA 1WX9A 4IW0A 5BYRA 2KQ7A 1JQ4A 1J19A 1BUIC 1QT9A 3MFGA 4ZRJA 3RMKC 1N60A 1J8CA 1Y8RC 2LFIA 3DBSA 2WLBA 2JVCA 2QMTA 4MELA 3URYA 2JXXA 3BVGA 1MVKA 3ECIA 4GSWA 2XK5A 1YNTE 3SR6A 2QCZA 5D7GA 3UIPB 4KZ0A 1VDVA 4HPPA 3VFKA 4BKSA 2BF8B 1P9DU 3HM6X 3RNAC 3ZUNA 2WX0A 1IGDA 4NY0A 5T8IA 4B9KA 3TEWA 4G3XB 2BS3B 3T9LA 3Q8BA 5AUKA 4AUQC 3ZW3A 2JPHA 4JPSA 2N7JA 2V4IB 4KSLC 1D3ZA 3HIZA 4IWPA 4KDIC 3V3XA 3U7ZA 1WGHA 1E8XA 4TUUA 1QKZA 2GI9A 2CKHB 2FUHB 2J52A 1C76A 1XO3A 1KOTA 1JWBD 4B95A 4PK1A 1R4MI 1ET6A 3AE3B 2K9XA 2KHWB 2Q5WD 4NAWB 2AYOB 4DXFA 4ARIA 1YOVB 1E7VA 2KT7A 3WCQA 1TKYA 4MH0E 2DLBA 2SAKA 1RYJA 2IY0B 2V4LA 4K81A 1CJEA 2EKEC 3AV8A 3AI5A 2J0MA 4C4VB 3Q8AA 3AE5B 4KGTA 2K6DB 2KJ6A 4II2B 1D5ZC 1E10A 3QJZA 2DENB 4GDLA 3ZRCA 1UWXA 1GPXA 3R2IA 1V1PB 4DHJD 2WXQA 2ZZPB 3I5JC 1JRUA 3PT2B 4HROA 4KZCA 3W9CB 2JF5A 1CZPA 1EUVB 3Q3MC 3UQAA 2ON8A 1N61A 4K7SA 3ZYYX 1SEBD 3U52E 4LTUA 4W9IA 4M0WA 2BKRB 1WGDA 4W9LA 1WE6A 3IT4B 1B1ZA 2O6VA 3C8YA 4FJVB 1JROA 3P1MA 1RRBA 2W55A 1AWDA 1HZ6A 2MSED 4TKNA 3AU4A 1S3SG 3DBHI 1C4AA 1N63A 4HJKA 3L0WB 1FFUA 1L4ZB 3RNBC 3APFA 4W9EA 1FXIA 1WX7A 2VZKB 2WXKA 1YJIA 2M4NA 4JWUC 2VH2A 1NBFC 3ZIMA 1FCLA 3DVNV 1SE3A 4R3DA 4I6PA 1I4GA 1PDXA 1WJNA 2XNAC 1VR9A 2RPQA 5EE9A 2REXA 1XLPA 1GB4A 2FBWB 2KVRA 3PRPB 3WA0A 1HA5A 3TEZA 1FFVA 1UBIA 4W9CA 2INNE 3V60A 2K8BA 3TSSA 3JVZX 4S0RA 3AEDB 5GMVA 3LXFA 2N1WA 4JX1C 2A4ZA 2WXMA 2BT6A 2WDQB 3EFUA 4KKJA 4GMVA 1J0GA 3N1ZC 4D2KA 1WFYA 3E9SA 1TZOA 3DHHC 1Q0WB 3X0WA 1ZP0B 1PFDA 1C78A 2NCNA 2QDFA 4J3OD 3AECB 4YTNB 4EEWA 5E6JA 3VAWA 3RPFC 5LXHA 4W9JA 1H4RA 1NENB 4LDTB 4RGMA 1OEYJ 3NVVA 2CHWA 1FM0D 2KOXA 1WH3A 1WRIA 2KANA 1ZW7A 2FUG1 5AZFA 1SE9A 1EF1A 2DWQA 1EWYC 3DHGC 4JWSC 4NAWA 2C5LC 3ZRFA 3SFDB 1MJDA 1TBEA 1V1OA 2QEJC 2KVZA 1YJ1A 1V5TA 3AULA 3DVGY 5D3IB 3R7QA 4RCOA 2KDMA 1J7AA 2DHZA 1MI0A 2GBNA 3TJPA 4C4VA 2J7QB 4RFBA 3VR8B 3HHMA 1L6UA 2N9PC 3RNFC 4BOZB 2EKIA 2NVUI 1JWUD 2RGFA 2WXFA 1V1PA 3PHXB 5CX3A 1A5RA 4NPNA 3TIXA 3U7DA 4A8XC 2K0PA 4GB9A 1C9FA 2RDHA 4MJSB 2DZMA 1VZ7A 2LGYA 1I4XA 2LXCA 5D2MB 3EC8A 4IDIA 5MPOA 1FXAA 4RM9A 2ZJDA 4C7ZA 4ZRPA 2ZPNA 4URKA 4HKZE 1TT5B 2G1EA 2CJNA 5CHVC 2C7HA 2DAFA 1GC7A 2L05A 3TL5A 3NHEB 2N1VA 2LUEA 1PGAA 3IAM1 1ZPSA 1V97A 3PGEA 3AE8B 4P16A 4JQWC 3PTFC 4BAXA 2RDGA 4B0EA 1OQYA 2KTFA 2JQRB 4WAAA 4UDUC 4A6QA 2C7MB 4ZOHC 2H88B 4MSMB 4P7IA 4EOYA 3QQ8B 3OJ3A 3QA8A 1EF5A 3UGBB 3AE6B 3PO0A 1WGKA 2K22A 4WJNA 3Q8FA 2R2QA 4NQLB 2IJ0A 3AE7B 4QAYA 5JHBA 3I63C 1PGXA 2ICIA 1UGMA 1ISNA 3ZJTA 3GZNI 3H1UA 4HJGE 3VUYA 4FADA 2G45B 2ACZB 4MGYE 4BFRA 2N0SB 3NZ3A 1LFDA 4E74A 3DBLB 3BZDB 1VZ8A 3ZDMC 3ZTDA 3DWGC 2KX3A 4DBGA 2YEPF 1WI0A 1ZUD2 4PYZA 3ZXRA 4HKQA 1OEYA 2LVOA 3BVZA 4HPLB 3N20C 3B9JA 2KC1A 1NVID 3M63B 2QJLA 1SB3C 1AW7A 1WJ6A 1K51A 1SIFA 1LO5D 1R7SA 1QLBB 1TS5A 4HRSA 2FAZA 3IAS1 2LXAA 2KFJA 1WJ4A 3NG0A 1UWMA 2RSUA 2LJ5A 4EZKA 1E8ZA 2MBHA 3FKYA 3N30A 5IN7A 2WU2B 3QIJA 4ARCA 5J18A 2FCMA 1TGZB 1FRDA 3NUHB 1EWCA 2GOWA 3KW5B 1MG4A 3V6EB 1Q5WB 1TS4A 1WX8A 1UUPA 3I57A 2QHOA 2HE7A 4W9GA 2BB5A 3P4PB 4XDDA 3PVLA 3U30A 2BYVE 2JYTA 1XXGA 1T0SC 2W82A 2AX5A 4ICVA 2PE6B 5E6OA 1SXTA 2L0FA 4TQ0A 1QF6A 2FCQA 4G11A 4XYCA 3ENEA 1FPYA 3I9V1 4K3CA 3A4RA 3DBHB 3AEGB 3HRDD 4FULA 2MX2A 1XLNA 1V8CA 2KN5A 3AEAB 4ITKA 3ALBA 5G5HA 4MJSA 4N9F4 5J17A 1V86A 4HLEA 4AJWA 2KO3A 1SJHD 2LHEA 4RM8A 3Q14C 4DHZB 2QILA 1J7BA 5DPSA 5BYQA 1F77A 4A9AA 3ZJUA 4W9KA 4A3OA 3UIOB 2BYFA 4DHJB 2QSDA 4GXBA 1IPGA 4YT0B 5G5GA 1WJUA 1YQ4B 1H8CA 2K5PA 1HZ5A 2NBVB 3DBRI 4L2YA 3VTVA 4Q2JA 2WX1A 4HEA1 1E5WA 4EZLA 3VRBB 3SHQA 4HDQA 1XT9B 2YLMA 3SU8X 1WGRA 3O65B 2NPTB 2DAJA 3BYYB 4O1NA 4ACFA 3ZVVA 1MPEA 2PE9A 3CF6E 4WQMA 3APDA 3OLMD 3SDLC 2ZW0A 4GLSC 3U4EG 2ONQA 1RFAA 3ML8A 1ESFA 3TMPB 2LRUA 1V49A 4PS3A 1WIAA 1N5WA 2KC2A 3VH3B 3WANA 4BBNF 4TQ1A 2MCNB 1PQSA 3EFCA 2OEDA 3V6CB 1PYWD 2KD0A 2KLCA 1YIWA 4ZRKA 2V0GA 1P3QU 1YQBA 1KFYB 5CHFA 5EDSA 2K6QA 3VXWA 2LD9A 1TKGA 1C4PA 5C3JB 3V05A 4JL9A 3HM3A 2G4DB 2LVPA 2YEPB 4LNIA 4E71A 2NR2A 1CMXB 1EO6A 2DYOA 3R8BA 4IOIE 1UELA 4KGRA 4IWOA 1WMHB 3M3JA 2GBKA 4DK5A 2ZVOA 4RNAA 3RT3B 2O6VD 4LK0M 3HVDA 1V80A 3OWEB 4LNKA 1HTOA 2X8XX 1SJED 2AQ1B 1HE8A 4DXGA 1JWAD 4S17A 4LNOA 4NJCA 4F8CB 2WQYB 2GB1A 3DVNU 3QAQA 3H7PB 2KYWA 3EA6A 3SD5A 2LJIA 3L16A 4C7YA 1YX6B 2E6XA 1KLVA 2MHJA 1FD6A 2RDBC 2DNFA 2KACA 2BPSA 2WXOA 3AEFB 3RNEC 4LNNA 4YTPB 3KYCD 1FEHA 2PTLA 1F2RI 3L17A 3H9DA 1WM2A 3IT6B 5IKCM 1XD3B 3AEBB 3NVYA 3O13A 1FXTB 1Z5SB 2M19A 3P4SB 1ACCA 4LCDE 2N9LA 4JIOU 3AE2B 2BTEA 3HVZA 3EUB2 4YXDB 3NZUA 3PZDA 4EUTA 2IYDB 2FE8A 1X1MA 4US8A 4HCPB 3CIRB 1CQVA 2ZVNA 1TTNA 4HVBA 3ZNID 3ZJVA 1T0YA 2KN4A 2MBQA 4HK2A 4WWPA 1I4PA 2M17A 2JY6A 1OFFA 4FN2A 3ONSA 1R4NB 2IO0B 3GOEA 5LXIB 2LGDA 2IBIB 1IBXB 4DDID 4CO7A 2LI5A 2O2VB 2BQQA 1ZDVA 2KTRB 4IM3A 1QOFA 1V81A 4LLGM 2ZCCA 1GB1A 3AU5A 4MGZE 4I6LB 1N6ZA 3LJ3A 3Q3JA 4PYUA 3B08A 3RCZA 5JHAA 3WAOA 2NPTA 2DZJA 1K52A 5DPWA 2HJ8A 2OHFA 1XLOA 2MQJA 5JH5C 4M02A 3ZLZA 4ANVA 2WXHA 2KAJA 5BMIA 2IO1B 1E8YA 2WXGA 2LEKA 2CJOA 1NEKB 3W1SA 2CU3A 1JALA 4RGOS 5HHDG 4NZLB 2ZPYA 1TZ1A 2AWTA 3MC0B 5AUIA 1KRHA 4XWTA 1U4AA 4FJZA 1IGCA 4EZJA 4W9FA 2KDBA 1TY2A 1E7UA 4OZCA 2V3NA 2L0TA 2W3SA 1YD8U 3TEYA 2FIDA 2R61A 4OW0A 4GDKB 1OTRB 2L3ZA 1V6EA 2IDYA 5JZEB 4WURA 1C1YB 1LGRA 2RPVA 1WMHA 4YSZB 1GOZA 2LASA 1RM6C 1YN4A 2WXPA 1L0XB 3WAPA 4DXAB 2OJRA 1HTQA 5IO9A 4RGNA 3KLSX 2LGSA 4BKTA 4ANWA 1E6EB 4IM0A 3IHPC 2FCNA 2NBWB 5EE1A 1NI2A 1VD2A 4EKUA 3K9OB 4MSQB 4ZDVA 1QOBA 2VZKD 3RNCC 3P4RB 1GAQB 3H7PA 2JYEA 1NDDA 2IO2B 5L95C 3B2GA 1UF0A 4IUMB 4KV2A 2MJ3A 3PREA 2BKFA 1E8WA 4REZA 5TSSA 1IUEA 2K8CA 1TIFA 3ML9A 1T3QA 2INDC 4XE0A 1RLFA 4LNFA 3DBRB 1N62A 3DQVA 3FILB 3N1YC 2BB6A 3MTNB 2L1AA 2KWUB 3P42A 2MA9B 3T8MA 4F1SA 1T5XD 1UGJA 3GB1A 1Q1OA 4P1CC 2K1FA 3VTUA 1SF0A 3TCAA 1MHXA 2PLPA 1Q10A 3PV1A 3W5VB 2Y5CA 3VDZA 1WSPA 4P1BC 3KYDD 2WXNA 3N9YC 3A33B 3BK1A 4NJ6A 2X38A 3H6NA 5GXGB 4J6IA 3IFWB 2MJEA 1GUAB 5C23A 1E90A 1IBXA 2WDTB 2WWZA 3QC8B 1NI3A 2ZW1A 2CU1A 4WJPA 2O2VA 3HK0A 3WAMA 4LDTD 1XEEA 3Q69A 2KTRA 2KK8A 5IAAC 2PW9A 5DPTA 2LUMA 3VH4B 4FBJB 4C00A 1JCKB 3IXSA 2GBMA 2KX0A 2PEAA 4XZ4A 2M0XA 1R4MB 2BGFA 1YN5A 4K3BA 3LB8C 3L10B 4DDGD 2KKCA 4MACA 2WNMA 2DZKA 2BBCA 3L4PA 1RAXA 4JLCA 4W9DA 4HXDA 3H8HA 4KIKB 5IP4D 3NVWA 5FR6A 2L52A 2J0JA 3RNGC 2HTHA 1T0QC 2MJDA 2V3SA 2NTSA 1WM3A 1SE4A 1BXTA 3VRAB 2Z0EB 1FIQA 2WXIA 5AEKB 5H8YE 1F0ZA 2WYQA 3DWMA 3AN1A 3MC8A 1E9MA 1TY0A 1WXAA 1VLBA 2LGXA 1MHHE 2L76A 4X57B 1PUTA 4FXCA 3AEEB 3W1SC 1JMLA 4WJOA 3A1QB 3AM9A 1QOAA 4MEMA 3C19A 2MBOA 4GN1A 4GDKA 4HWIB 2RR9A 2G4SA 4OVVA 2JRIB 4K7UA 2XBBC 3NRZA 4OZAA 5AZGA 3DOWA 1V2YA 2BWES 1WZ3A 2WXLA 1TS2A 3PRMB 2GLSA 2WXJA 2JZPA 3TEXA 1I42A 1YQ3B 4MM3B 2Z8LA 3MJWA 4AS1A 1SE2A 1TS3A 2L8JA 2AL6A 3MHZA 1FO4A 5E6NA 3ZKJC 3KUZA 1I4HA 4BKSD 2XEWA 1UD7A 1RFKA 1E0ZA 4AP4C 2BWFA 1YX5B 2UYZB 4AQ7A 1WZ0A 1VRAB 3M62B 2NS5A 1F52A 3Q3OC 3TUOA 4BKGA 4RF0A 3NJTA 4WWNA 2MBEA 2YVCA 3ZNHB 3T3OA 3FILA 1XLQA 2RMMA 4C80A 1PGBA 3KWVA 1I4QA 4KVGB 4E3CA 3QX1A 4JGHB 2M1MA 3RD2A 2KDFB 2AEHA 3VR9B 3PHWB 1LM8B 1GNUA 4G50A 2QC8A 5I4DA 5FK9C 1BT0A 2IGGA 1SGHA 3QCAA 4WJQA 2JSVX 3I3TB 2I38A 2VRRB 3JSVB 3R66C 2KWCA 2ZNVB 3V62A 2L32A 3U2SC 4XDCA 1D5XC 2ASQA 4KSKC 1ZXHA 2EELA 3DCGA 1L6VA 3IBEA 1ZOYB 3QARA 3R7RA 5LNK1 3PSEB 3AMZA 1WRDB 1VJKA 3RZWC 2AQ3B 2J42A 1C77A 2WU5B 2HTME 2PMVA 3NS1A 2KJHB 2LZ6A 2IGDA 3E56A 4OVUA 4XC2A 5CHWA 3WALA 4YSYB 4CHKA 4NQKE 3S2AA 3ZGZA 5HKHA 3APCA 2Z59B 1QQRA 2MEKA 5E6PA 3BK2A 2V9HA 2L83A 2CR5A 5AZHA 2JWZA 2JZ3B 1A70A 4ASWC 3DBLI 4GOCA 4N58A 3AH7A 2BYEA 1LXDA 2K8HA 2PJHA 4NNJB 2N7DA 2BVCA 4KIKA 5C2TB 4WWOA 3N3KB 2J53A 2HD5B 4ZRIA 3W1YA 3B0AA 4AWJA 1FCCC 3ZNGC 1P7FA 1FRRA 2MP2B 2I1KA 2ZCBA 2Z0DB 2FIFA 4NAMA 2DX5B 5JXVA 1OQRA 3ZXVA 2R2OA 3OJ4B 2BS2B 2EMSA 3VTWA 2IGHA 4AJYB 2KQSA 5EE3A 3LDZE 3AB5A 2N9EB 5DPRA 2W9NA 2EMTA 2WGSA 1ROEA 2UWQA 1J7CA 3A9JB 1WYWB 1WXVA 1CK1A 1VCBA 3A1QA 5IOIA 2GBJA 1N5XA 1EM7A 1P0RA 3NZSA 2INPE 1RWSA 4N59A 3QK0A 3FAHA 4RMAA 1DOYA 2NTTA 4BZAA 5J2RA 1T0RC 2WXRA 1WXMA 1Z2MA 3BVMA 4BBNC 4WAFA 1C79A 4KKIA 1KF6B 2D3GA 1QOGA 1TKEA 2G3QB 2C60A 4EFOA 4OVZA 1C4CA 4ANUA 3RYTA 2J0KA 3EHVA 4ZHOA 4RGTA 3NVZA 1P98A 4MM3A 1HQRD 1OQQA 1VZ6A 2V3PA 3NS8A 2E3TA 3ETRA 3GS2A 1IP9A 1K53A 1C3TA 3Q6BA 3LYYA 2GBRA 3GZNB 3Q8EA 1KM7A 1JRPA 4MT5A 1D4BA 4ZHPA 1NYRA 4USAA 3J9CA 4FA6A 4WQOB 1K50A 4YSXB 2D2QA 2K25A 1GG3A 1JW9D 1XCTL 2C9WB 3GE3C 4FJYA 2I2YA 1DGJA 2MBBB 2TSSA 1V9JA 1YN3A 1D5MC 1M94A 3KQ4A 4M00A 4PS7A 2B76B 3HUIA 2D3CA 2KNBA 3KVFB 2MW5A 3CSFA 1S1QB 4XWWA 4MGIE 2KMMA 1L7YA 3JSVA 5FKAC 4YWGG 1GJZA 1ET9A 2LVQA 3A9KB 3Q3NC 4BOSC 5L83A 5H92C 5G55A 1KLGD 3UI3A 2SEBD 4IWQA 1IYFA 1QILA 3FC4A 1AN8A 3EGRA 4KX6B 3AE9B 3GE8C 2VH1A 1Y56A 1WR6E 2IPKD 2UU7A 3C0RB 3PLUA 4CQNA 1WWTA 4IKGA 4KGSA 4MDKE 2JZZA 3N1XC 2KXJA 3BWUD 1WXSA 3RULA 4PT5A 2M8SA 3T3NA 1QZEA 2FNJB 1NYQA 1UZXB 4G0NB 3R2TA 5HG2A 4KDLB 3B2FA 4B6WA 2DYBA 1LQBA 1G6JA 1AARA 4LJPB 4WWMA 3PZ8A 2CS4A 1I7HA 2KQ4X 1SSNA 3MJ5A 1FNUA 3IVFA 4M8NA 4HCNB 3M95A 1STEA 1UNSA 2PVOD 4K7WA 2M0AA 2MRPA 5IA7A 1AYFA 1B9RA 2KFKB 2GRIA 2IO3B 4DHZE 4DWFA 1EU4A 2MP2A 3L54A 4GGQA 4RF1A 2IZVB 2LRWA 1E7PB 3BIID 5G2NA 2J4XA 4ZYNA 2PKOA 2WS3B 2NMQA 5BYSA 2JRHA 2D5GA 4II3B 1UH6A 2KWDA 1WXQA 1L4DB 3A9JA 3VUXA 1KJTA 4US9A 1FMAD 1WYGA 3PZ7A 1ZKHA 3TBLD 2C7NB 4A20A 4CYEA 5HI1A 3ZNZB 1T6BX 4DQOC 5EE0A 2CHZA 4A3PA 3MP9A 1TYGB 4ICUA 4TV3A 1I4RA 3BINA 2HDEA 3VUWA 2I1JA 3RN9C 4B0MA 3SFEB 3V61A 3P4QB 3VHTC 4L23A 4HDOA 2Y3AA 2M56B 2JUOA 5CTRC 2W3RA 1F9JA 2N4FA 4K1RB 4BVUC 4MGKE 3VQIA 2K3UA 2H89B 3P2BA
chains in the Genus database with same CATH topology
4RH6A 2XNAC 5BMHA 3GP7A 1TKGA 1VR9A 1C4PA 5C3JB 5EE9A 1XLPA 1GB4A 2FBWB 4A90A 4TMAB 3NRZA 3V05A 1F2RC 4OZAA 1D6EC 5D3DA 1P7EA 2YEPB 3ABVB 3P63A 4MH8A 1HA5A 1YJJA 2WXLA 1TS2A 3TEZA 2DYOA 4C56C 1FFVA 2JU6X 1BMLC 2INNE 2WXJA 3R8BA 2JZPA 4IOIE 3TEXA 1YQ3B 3TSSA 4KGRA 4MM3B 2Z8LA 3AEDB 1ENFA 3CWIA 1DOIA 4AS1A 4OZBA 1SE2A 4RNAA 2BS4B 3LXFA 1TS3A 4LK0M 1HEZE 3HVDA 3MHZA 3OWEB 1FO4A 4JX1C 2LGIA 2WXMA 2BT6A 1I4HA 2WDQB 1SJED 2AQ1B 1RFKA 1L0YB 2BYTA 4KKJA 4D2KA 1L0VB 3E9SA 1TZOA 1E0ZA 1ZP0B 1PFDA 1C78A 4DXGA 1JWAD 4AQ7A 5FR3A 4J3OD 3AECB 4YTNB 5E6JA 1VRAB 4NJCA 2WQYB 3RPFC 3ZQ4A 1NENB 2GB1A 4RGMA 3TUOA 3NVVA 1M4VA 3EA6A 4RF0A 2LJIA 1FM0D 4C7YA 3T3OA 2E6XA 3FILA 1XLQA 4ZRQA 1HXYD 1WRIA 2RMMA 1PGBA 3KWVA 4C80A 1FD6A 1I4QA 2KACA 5HFYA 2FUG1 2WXOA 3AEFB 4YTPB 2DWQA 1FEHA 3VR9B 3RFZB 1EWYC 2PTLA 2WDRB 5I4DA 4JWSC 1F2RI 5FK9C 2JX5A 2IGGA 3IT6B 3SFDB 3AEBB 1FNWA 2JSVX 2Y5PA 1FNVA 3NVYA 3O13A 2QEJC 1V1OA 2I38A 2M19A 2WP9B 4H2AA 3P4SB 5D3IB 2PIAA 1ACCA 2L32A 3U2SC 4RCOA 4XDCA 2PVGC 1D5XC 2N9LA 1ZXHA 2G9HD 2KDMA 3AE2B 2BTEA 1J7AA 2EELA 1L6VA 3SEBA 1ZOYB 1MI0A 3AE1B 3HVZA 3KWLA 3EUB2 4RFBA 3VR8B 5LNK1 4YXDB 3AMZA 1L6UA 1VJKA 1ZE3D 3AE4B 3Q8CA 2AQ3B 2J42A 2FE8A 2EKIA 1C77A 2LHDA 2WU5B 4US8A 2HTME 2PMVA 3CIRB 1CQVA 3NS1A 1JWUD 2WXFA 1V1PA 1EU3A 3ZJVA 2KN4A 1DOXA 1TJEA 1I4PA 1XF5L 2K0PA 4A8XC 2IGDA 3E56A 2RDHA 1C9FA 1OFFA 1VZ7A 1I4XA 2BW2A 4YSYB 4N6EB 3ZGZA 1IBXB 4WH4A 4GDLB 2DYMA 1QQRA 4IDIA 4A55A 2MEKA 4ZYSA 3BK2A 1ZDVA 5MPOA 1QOFA 2L83A 3BYTB 4LLGM 1FXAA 3W5UB 2LMCA 4C7ZA 1GB1A 4YTMB 2W54A 4ZRPA 1A70A 1YMHE 4HKZE 1JWSD 4N58A 3AH7A 2G1EA 4OHJA 2CJNA 1L5PA 5C2TB 2J53A 2WDVB 1FCCC 1P7FA 1PGAA 1FRRA 2DBYA 3IAM1 1ZPSA 1K52A 2N9KA 1V97A 4NAMA 2JWUA 3AE8B 5JXVA 1OQRA 4P16A 1KH0A 2BS2B 2IGHA 2RDGA 4B0EA 1SBBB 5EE3A 3AB5A 2OHFA 1XLOA 2JQRB 4UDUC 4A6QA 4ZOHC 3W2DA 1ROEA 2H88B 2WXHA 1J7CA 2KAJA 5BMIA 2WXGA 2LEKA 2CJOA 1NEKB 3W1SA 3AE6B 2CU3A 1DYQA 1JALA 1WGKA 2K22A 3PO0A 3Q8FA 4RGOS 1XCQL 5HHDG 2XN9C 4NZLB 1CK1A 2IJ0A 3AE7B 1JWMD 1SIJA 4P6VF 1PGXA 2ICIA 4EE2A 5BMGA 1N5XA 1EM7A 3MC0B 4TSSA 5AUIA 3ZJTA 1KRHA 4HJGE 4XWTA 2QIEB 1KTKA 2ACZB 2INPE 1RWSA 1IGCA 2N0SB 4N59A 3FAHA 1DOYA 3NZ3A 2NTTA 1ZDXA 3BZDB 1KLUD 1VZ8A 2MH7A 4L1BA 3DWGC 1TY2A 2WXRA 4OZCA 2V3NA 3BVMA 2W3SA 4JE3B 2YEPF 2JXTA 1ZUD2 4WAFA 1C79A 4KKIA 3TEYA 1KF6B 2AQ2B 2R61A 1QOGA 1TKEA 1ZXIA 4OW0A 4WIPA 4GDKB 4OVZA 4HKQA 5BYRA 1C4CA 2IDYA 3BVZA 4ZHOA 1JQ4A 4RGTA 3NVZA 4WURA 2RPVA 1BUIC 1QT9A 3MFGA 1N60A 4YSZB 1GOZA 1RM6C 1HQRD 3B9JA 1OQQA 1YN4A 2WXPA 1NVID 1L0XB 1VZ6A 2LFIA 2QJLA 2V3PA 1SB3C 2E3TA 1AW7A 3ETRA 1K51A 2WLBA 3GS2A 2QMTA 1LO5D 1R7SA 1QLBB 3URYA 1K53A 3BVGA 1MVKA 1TS5A 4HRSA 3LYYA 3IAS1 1YNTE 3SR6A 3Q8EA 4RGNA 1JRPA 3KLSX 5D7GA 1E6EB 4MT5A 1VDVA 5EE1A 1UWMA 4ZHPA 1D4BA 1NYRA 4USAA 3J9CA 1QOBA 2VZKD 3P4RB 1GAQB 1K50A 2JYEA 1IGDA 4YSXB 1JW9D 1XCTL 5T8IA 3B2GA 3TEWA 2WU2B 2I2YA 4ARCA 1DGJA 2MJ3A 2BS3B 2TSSA 1FRDA 3NUHB 3Q8BA 1YN3A 1EWCA 5AUKA 1D5MC 5TSSA 4REZA 1IUEA 3KQ4A 1T3QA 4JPSA 4XE0A 1TS4A 2B76B 1UUPA 2N7JA 2V4IB 3HUIA 3I57A 3V3XA 1N62A 4XWWA 3U7ZA 3FILB 2BB5A 2KMMA 3P4PB 4XDDA 1QKZA 2JYTA 1XXGA 2W82A 2BB6A 2GI9A 2L1AA 5FKAC 2AX5A 2J52A 3P42A 1C76A 1XO3A 4YWGG 1ET9A 1JWBD 5H92C 1SXTA 1T5XD 1UGJA 1ET6A 3GB1A 3AE3B 2K9XA 1KLGD 3UI3A 4TQ0A 2SEBD 1SF0A 2Q5WD 4NAWB 1MHXA 1QF6A 1QILA 3FC4A 2PLPA 1Q10A 4DXFA 4ARIA 1AN8A 3W5VB 2Y5CA 3EGRA 4KX6B 3AE9B 3WCQA 1Y56A 1TKYA 3I9V1 2DLBA 2IPKD 4CQNA 1WWTA 2WXNA 3N9YC 4IKGA 4KGSA 2SAKA 1RYJA 3AEGB 3HRDD 3BK1A 1XLNA 1V8CA 2X38A 1CJEA 5GXGB 3AV8A 3AEAB 3BWUD 4ITKA 5G5HA 4PT5A 2MJEA 3T3NA 1NYQA 3Q8AA 3R2TA 3AE5B 5HG2A 4KGTA 1D5ZC 3B2FA 1E10A 1IBXA 1NI3A 2ZW1A 1GPXA 1UWXA 1SJHD 3R2IA 1XEEA 2LHEA 3Q69A 4WWMA 3PZ8A 1I7HA 1V1PB 2KQ4X 2WXQA 1SSNA 2PW9A 1J7BA 2QILA 2LUMA 4HROA 3MJ5A 3W9CB 1FNUA 5BYQA 1F77A 1JCKB 4A9AA 3ZJUA 3IXSA 1STEA 1UNSA 2PVOD 1CZPA 2M0AA 2QSDA 1AYFA 2ON8A 1B9RA 1N61A 4YT0B 1YN5A 3ZYYX 2GRIA 3LB8C 5G5GA 1SEBD 1YQ4B 4LTUA 3U52E 1EU4A 2K5PA 4RF1A 1HZ5A 4M0WA 4L2YA 4MACA 2WNMA 1E7PB 3BIID 2BBCA 4Q2JA 3L4PA 2J4XA 2PKOA 2WS3B 2NMQA 5BYSA 4HEA1 3H8HA 2D5GA 2KWDA 3NVWA 3VRBB 2L52A 1WXQA 3IT4B 1L4DB 2MJDA 1B1ZA 2NTSA 3C8YA 4US9A 1SE4A 1BXTA 3VRAB 1JROA 1FMAD 1WYGA 3BYYB 4O1NA 3P1MA 1MPEA 1FIQA 2WXIA 3PZ7A 4WQMA 2W55A 5H8YE 1F0ZA 2ZW0A 1AWDA 4GLSC 3DWMA 3AN1A 1HZ6A 3U4EG 2ONQA 5HI1A 1T6BX 4DQOC 5EE0A 1C4AA 1N63A 1ESFA 1E9MA 1TY0A 3MP9A 1FFUA 1L4ZB 1VLBA 1TYGB 1FXIA 1I4RA 1MHHE 2HDEA 2VZKB 2WXKA 1N5WA 1YJIA 4TQ1A 4JWUC 1PUTA 4FXCA 4B0MA 3AEEB 1JMLA 1FCLA 1SE3A 3SFEB 3AM9A 2OEDA 1QOAA 4R3DA 3P4QB 4L23A 1I4GA 1PYWD 2Y3AA 2M56B 1PDXA 2W3RA 2V0GA 3VQIA 2K3UA 2H89B 1WSPA 1KFYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6U A;  1RYJ A;  3AEG B;  1VJK A;  2W3S A;  3AE4 B;  3HRD D;  1XLN A;  1V8C A;  1TKG A;  1CJE A;  1ZUD 2;  5GXG B;  3AV8 A;  3AEA B;  5EE9 A;  2EKI A;  4ITK A;  5C3J B;  5G5H A;  1KF6 B;  2WU5 B;  1XLP A;  4US8 A;  2HTM E;  2FBW B;  1QOG A;  1TKE A;  1ZXI A;  2MJE A;  3CIR B;  3NS1 A;  3NRZ A;  1NYQ A;  1DOX A;  3AE5 B;  3B2F A;  4ZHO A;  3ABV B;  1E10 A;  1TJE A;  3NVZ A;  1JQ4 A;  1NI3 A;  3P63 A;  1GPX A;  1QT9 A;  1OFF A;  1YJJ A;  1N60 A;  4WWM A;  4YSZ B;  1I7H A;  1RM6 C;  4YSY B;  3B9J A;  1OQQ A;  1NVI D;  1FFV A;  4N6E B;  1J7B A;  2QJL A;  1SB3 C;  4HRO A;  2E3T A;  3ETR A;  2WLB A;  3W9C B;  1YQ3 B;  1R7S A;  1QLB B;  4IDI A;  3AED B;  3CWI A;  4A9A A;  5MPO A;  1DOI A;  1QOF A;  4HRS A;  2BS4 B;  2L83 A;  3LXF A;  3W5U B;  1FXA A;  2PVO D;  1CZP A;  3SR6 A;  1JRP A;  1AYF A;  4C7Z A;  4YTM B;  1E6E B;  2W54 A;  4JX1 C;  1N61 A;  4YT0 B;  1A70 A;  1FO4 A;  1B9R A;  1VDV A;  3ZYY X;  3LB8 C;  5EE1 A;  5G5G A;  2BT6 A;  1YQ4 B;  4LTU A;  2WDQ B;  1UWM A;  2K5P A;  3AH7 A;  4N58 A;  1NYR A;  4ZHP A;  1RFK A;  2G1E A;  2CJN A;  1L5P A;  4USA A;  5C2T B;  1E7P B;  1L0V B;  1QOB A;  3BII D;  3KWL A;  1E0Z A;  3P4R B;  1GAQ B;  1ZP0 B;  2WDV B;  1PFD A;  3L4P A;  4YSX B;  1JWA D;  1FRR A;  1JW9 D;  2DBY A;  3AEC B;  2PKO A;  2WS3 B;  4YTN B;  1V97 A;  3B2G A;  3AE8 B;  2WU2 B;  2WQY B;  3RPF C;  1OQR A;  1DGJ A;  3NVW A;  3VRB B;  1NEN B;  2L52 A;  1WXQ A;  2MJ3 A;  2BS3 B;  2BS2 B;  1FRD A;  2MJD A;  3NVV A;  5EE3 A;  5AUK A;  1FM0 D;  3AB5 A;  4US9 A;  2OHF A;  1IUE A;  3VRA B;  4C7Y A;  1JRO A;  1XLO A;  1FMA D;  1WYG A;  1XLQ A;  1WRI A;  2JQR B;  3P1M A;  1T3Q A;  4C80 A;  1FIQ A;  4WQM A;  4ZOH C;  1ROE A;  2B76 B;  2H88 B;  2W55 A;  3HUI A;  1J7C A;  2KAJ A;  5H8Y E;  1F0Z A;  1AWD A;  2LEK A;  2CJO A;  1NEK B;  3DWM A;  3AN1 A;  3AEF B;  1N62 A;  3AE6 B;  2CU3 A;  4YTP B;  1JAL A;  1WGK A;  2DWQ A;  2K22 A;  2KMM A;  3P4P B;  3PO0 A;  5EE0 A;  3VR9 B;  1N63 A;  1E9M A;  1EWY C;  3AE7 B;  1SIJ A;  1FFU A;  2WDR B;  4P6V F;  4JWS C;  1VLB A;  2JX5 A;  1TYG B;  1FXI A;  1N5X A;  2AX5 A;  5AUI A;  1XO3 A;  1JWB D;  3SFD B;  1KRH A;  3AEB B;  5H92 C;  1N5W A;  1YJI A;  2QIE B;  3AE3 B;  2K9X A;  3NVY A;  1PUT A;  4JWU C;  4FXC A;  1SF0 A;  2ACZ B;  2Q5W D;  3AEE B;  1RWS A;  2M19 A;  2N0S B;  2WP9 B;  3FC4 A;  3FAH A;  4N59 A;  1QF6 A;  3P4S B;  3SFE B;  1DOY A;  2PIA A;  3AM9 A;  1QOA A;  3W5V B;  3P4Q B;  2Y5C A;  4KX6 B;  2PVG C;  3AE9 B;  3WCQ A;  2M56 B;  1PDX A;  3AE2 B;  1J7A A;  1TKY A;  2MH7 A;  2W3R A;  1L6V A;  1ZOY B;  3DWG C;  1WWT A;  2H89 B;  3AE1 B;  3HVZ A;  3EUB 2;  3VR8 B;  1KFY B;  4YXD B;  3AMZ A; 
#chains in the Genus database with same CATH topology
 4RH6 A;  4XGA B;  1WGG A;  3VVW B;  5BMH A;  3UQB A;  3GP7 A;  2MWS B;  4XX5 A;  3K9P B;  3DPD A;  4F7Z A;  3RZF A;  4A90 A;  4TMA B;  1F2R C;  1D6E C;  5D3D A;  1P7E A;  3ABV B;  2D3B A;  2K39 A;  2N7E A;  1K8R B;  2L7R A;  3P63 A;  4MH8 A;  1YJJ A;  3ZTC A;  1MG8 A;  4C56 C;  2JU6 X;  1BML C;  3JYU A;  1ENF A;  3CWI A;  2A5U A;  1DOI A;  4OZB A;  3AXC A;  2BS4 B;  2CHX A;  3BY4 B;  5TR5 A;  1HEZ E;  2LWP A;  1ZGU B;  2LGI A;  2B3A A;  2MLB A;  1L0Y B;  2BYT A;  2XK5 B;  1L0V B;  4FHJ A;  4IM2 A;  3ZDT A;  5KHO A;  4FLH A;  3DDC B;  5FR3 A;  4IG7 B;  2JT4 B;  2OJW A;  3ZQ4 A;  3KUD B;  2ZEQ A;  3NY5 A;  2D11 A;  2D07 B;  2KDE B;  1M4V A;  3R3M A;  4HPM B;  1WE7 A;  4ZRQ A;  1HXY D;  2KWV B;  1R4N I;  5HFY A;  3DHI C;  3A9K A;  3D32 A;  2KMC A;  2FCS A;  3RFZ B;  2WHI A;  2WDR B;  1XQQ A;  2NBU A;  3KUC B;  5D94 A;  2JX5 A;  1I35 A;  5KHQ A;  1FNW A;  1OGW A;  3Q3F A;  4M01 A;  2AL3 A;  1FNV A;  2Y5P A;  5DCN A;  5BO4 B;  2WP9 B;  1F1H A;  2KDI A;  1P1A A;  4H2A A;  2PIA A;  1GC6 A;  3KH0 A;  2PVG C;  3N32 A;  2G9H D;  2ZNV C;  3IG3 A;  3SEB A;  3AE1 B;  3KWL A;  3H7S A;  3MC9 A;  1ZE3 D;  3AE4 B;  3Q8C A;  4I6N B;  2KJR A;  2KZR A;  4PS8 A;  2LHD A;  3OAW A;  2INC C;  4M8M A;  2D10 A;  1EU3 A;  1DOX A;  1UBQ A;  4FHK A;  1TJE A;  1XF5 L;  1WY8 A;  2KMA A;  3ZO5 B;  3L13 A;  4IC7 B;  3PLV A;  2PPH A;  3QWZ B;  2BW2 A;  2HJ1 A;  4N6E B;  3PS6 A;  4W9H A;  1WGY A;  3CMM B;  2KLG A;  2KFK A;  2GMI C;  4WH4 A;  4GDL B;  2DYM A;  3UF8 A;  4A55 A;  3B1L X;  4ZYS A;  3NOB A;  3U8Z A;  3PPA A;  3BYT B;  3UIN B;  3W5U B;  4AOF A;  3MHS D;  3L08 A;  2LMC A;  4YTM B;  2W54 A;  1YMH E;  4ANX A;  1JWS D;  4OHJ A;  1L5P A;  3X23 A;  4GIV A;  2WDV B;  3PRZ A;  2DBY A;  2V1Y A;  4M0W B;  2N9K A;  2JWU A;  4GU2 A;  3OG5 A;  3CST A;  3RI7 C;  1MFW A;  1KH0 A;  5D6J B;  1SBB B;  2D3A A;  3EEC A;  3DVG X;  3W2D A;  4LJO B;  2O6V B;  3A4S C;  1DYQ A;  3RUI B;  1XCQ L;  2XN9 C;  1V5O A;  1JWM D;  1SIJ A;  3QHT A;  4P6V F;  4EE2 A;  1WF9 A;  5BMG A;  2OOB B;  4TSS A;  2RD0 A;  2QIE B;  3Q2A C;  1KTK A;  5C1Z A;  4YL8 A;  5LLI A;  2IY1 B;  2Y5B B;  3JW0 X;  1ZDX A;  1KLU D;  2MH7 A;  2N9X A;  4L1B A;  2L00 B;  2DZI A;  1WR1 A;  4JE3 B;  1L2N A;  2JXT A;  3WIM A;  2AQ2 B;  1ZXI A;  4NJ7 A;  4WIP A;  1WX9 A;  4IW0 A;  5BYR A;  2KQ7 A;  1JQ4 A;  1J19 A;  1BUI C;  1QT9 A;  3MFG A;  4ZRJ A;  3RMK C;  1N60 A;  1J8C A;  1Y8R C;  2LFI A;  3DBS A;  2WLB A;  2JVC A;  2QMT A;  4MEL A;  3URY A;  2JXX A;  3BVG A;  1MVK A;  3ECI A;  4GSW A;  2XK5 A;  1YNT E;  3SR6 A;  2QCZ A;  5D7G A;  3UIP B;  4KZ0 A;  1VDV A;  4HPP A;  3VFK A;  4BKS A;  2BF8 B;  1P9D U;  3HM6 X;  3RNA C;  3ZUN A;  2WX0 A;  1IGD A;  4NY0 A;  5T8I A;  4B9K A;  3TEW A;  4G3X B;  2BS3 B;  3T9L A;  3Q8B A;  5AUK A;  4AUQ C;  3ZW3 A;  2JPH A;  4JPS A;  2N7J A;  2V4I B;  4KSL C;  1D3Z A;  3HIZ A;  4IWP A;  4KDI C;  3V3X A;  3U7Z A;  1WGH A;  1E8X A;  4TUU A;  1QKZ A;  2GI9 A;  2CKH B;  2FUH B;  2J52 A;  1C76 A;  1XO3 A;  1KOT A;  1JWB D;  4B95 A;  4PK1 A;  1R4M I;  1ET6 A;  3AE3 B;  2K9X A;  2KHW B;  2Q5W D;  4NAW B;  2AYO B;  4DXF A;  4ARI A;  1YOV B;  1E7V A;  2KT7 A;  3WCQ A;  1TKY A;  4MH0 E;  2DLB A;  2SAK A;  1RYJ A;  2IY0 B;  2V4L A;  4K81 A;  1CJE A;  2EKE C;  3AV8 A;  3AI5 A;  2J0M A;  4C4V B;  3Q8A A;  3AE5 B;  4KGT A;  2K6D B;  2KJ6 A;  4II2 B;  1D5Z C;  1E10 A;  3QJZ A;  2DEN B;  4GDL A;  3ZRC A;  1UWX A;  1GPX A;  3R2I A;  1V1P B;  4DHJ D;  2WXQ A;  2ZZP B;  3I5J C;  1JRU A;  3PT2 B;  4HRO A;  4KZC A;  3W9C B;  2JF5 A;  1CZP A;  1EUV B;  3Q3M C;  3UQA A;  2ON8 A;  1N61 A;  4K7S A;  3ZYY X;  1SEB D;  3U52 E;  4LTU A;  4W9I A;  4M0W A;  2BKR B;  1WGD A;  4W9L A;  1WE6 A;  3IT4 B;  1B1Z A;  2O6V A;  3C8Y A;  4FJV B;  1JRO A;  3P1M A;  1RRB A;  2W55 A;  1AWD A;  1HZ6 A;  2MSE D;  4TKN A;  3AU4 A;  1S3S G;  3DBH I;  1C4A A;  1N63 A;  4HJK A;  3L0W B;  1FFU A;  1L4Z B;  3RNB C;  3APF A;  4W9E A;  1FXI A;  1WX7 A;  2VZK B;  2WXK A;  1YJI A;  2M4N A;  4JWU C;  2VH2 A;  1NBF C;  3ZIM A;  1FCL A;  3DVN V;  1SE3 A;  4R3D A;  4I6P A;  1I4G A;  1PDX A;  1WJN A;  2XNA C;  1VR9 A;  2RPQ A;  5EE9 A;  2REX A;  1XLP A;  1GB4 A;  2FBW B;  2KVR A;  3PRP B;  3WA0 A;  1HA5 A;  3TEZ A;  1FFV A;  1UBI A;  4W9C A;  2INN E;  3V60 A;  2K8B A;  3TSS A;  3JVZ X;  4S0R A;  3AED B;  5GMV A;  3LXF A;  2N1W A;  4JX1 C;  2A4Z A;  2WXM A;  2BT6 A;  2WDQ B;  3EFU A;  4KKJ A;  4GMV A;  1J0G A;  3N1Z C;  4D2K A;  1WFY A;  3E9S A;  1TZO A;  3DHH C;  1Q0W B;  3X0W A;  1ZP0 B;  1PFD A;  1C78 A;  2NCN A;  2QDF A;  4J3O D;  3AEC B;  4YTN B;  4EEW A;  5E6J A;  3VAW A;  3RPF C;  5LXH A;  4W9J A;  1H4R A;  1NEN B;  4LDT B;  4RGM A;  1OEY J;  3NVV A;  2CHW A;  1FM0 D;  2KOX A;  1WH3 A;  1WRI A;  2KAN A;  1ZW7 A;  2FUG 1;  5AZF A;  1SE9 A;  1EF1 A;  2DWQ A;  1EWY C;  3DHG C;  4JWS C;  4NAW A;  2C5L C;  3ZRF A;  3SFD B;  1MJD A;  1TBE A;  1V1O A;  2QEJ C;  2KVZ A;  1YJ1 A;  1V5T A;  3AUL A;  3DVG Y;  5D3I B;  3R7Q A;  4RCO A;  2KDM A;  1J7A A;  2DHZ A;  1MI0 A;  2GBN A;  3TJP A;  4C4V A;  2J7Q B;  4RFB A;  3VR8 B;  3HHM A;  1L6U A;  2N9P C;  3RNF C;  4BOZ B;  2EKI A;  2NVU I;  1JWU D;  2RGF A;  2WXF A;  1V1P A;  3PHX B;  5CX3 A;  1A5R A;  4NPN A;  3TIX A;  3U7D A;  4A8X C;  2K0P A;  4GB9 A;  1C9F A;  2RDH A;  4MJS B;  2DZM A;  1VZ7 A;  2LGY A;  1I4X A;  2LXC A;  5D2M B;  3EC8 A;  4IDI A;  5MPO A;  1FXA A;  4RM9 A;  2ZJD A;  4C7Z A;  4ZRP A;  2ZPN A;  4URK A;  4HKZ E;  1TT5 B;  2G1E A;  2CJN A;  5CHV C;  2C7H A;  2DAF A;  1GC7 A;  2L05 A;  3TL5 A;  3NHE B;  2N1V A;  2LUE A;  1PGA A;  3IAM 1;  1ZPS A;  1V97 A;  3PGE A;  3AE8 B;  4P16 A;  4JQW C;  3PTF C;  4BAX A;  2RDG A;  4B0E A;  1OQY A;  2KTF A;  2JQR B;  4WAA A;  4UDU C;  4A6Q A;  2C7M B;  4ZOH C;  2H88 B;  4MSM B;  4P7I A;  4EOY A;  3QQ8 B;  3OJ3 A;  3QA8 A;  1EF5 A;  3UGB B;  3AE6 B;  3PO0 A;  1WGK A;  2K22 A;  4WJN A;  3Q8F A;  2R2Q A;  4NQL B;  2IJ0 A;  3AE7 B;  4QAY A;  5JHB A;  3I63 C;  1PGX A;  2ICI A;  1UGM A;  1ISN A;  3ZJT A;  3GZN I;  3H1U A;  4HJG E;  3VUY A;  4FAD A;  2G45 B;  2ACZ B;  4MGY E;  4BFR A;  2N0S B;  3NZ3 A;  1LFD A;  4E74 A;  3DBL B;  3BZD B;  1VZ8 A;  3ZDM C;  3ZTD A;  3DWG C;  2KX3 A;  4DBG A;  2YEP F;  1WI0 A;  1ZUD 2;  4PYZ A;  3ZXR A;  4HKQ A;  1OEY A;  2LVO A;  3BVZ A;  4HPL B;  3N20 C;  3B9J A;  2KC1 A;  1NVI D;  3M63 B;  2QJL A;  1SB3 C;  1AW7 A;  1WJ6 A;  1K51 A;  1SIF A;  1LO5 D;  1R7S A;  1QLB B;  1TS5 A;  4HRS A;  2FAZ A;  3IAS 1;  2LXA A;  2KFJ A;  1WJ4 A;  3NG0 A;  1UWM A;  2RSU A;  2LJ5 A;  4EZK A;  1E8Z A;  2MBH A;  3FKY A;  3N30 A;  5IN7 A;  2WU2 B;  3QIJ A;  4ARC A;  5J18 A;  2FCM A;  1TGZ B;  1FRD A;  3NUH B;  1EWC A;  2GOW A;  3KW5 B;  1MG4 A;  3V6E B;  1Q5W B;  1TS4 A;  1WX8 A;  1UUP A;  3I57 A;  2QHO A;  2HE7 A;  4W9G A;  2BB5 A;  3P4P B;  4XDD A;  3PVL A;  3U30 A;  2BYV E;  2JYT A;  1XXG A;  1T0S C;  2W82 A;  2AX5 A;  4ICV A;  2PE6 B;  5E6O A;  1SXT A;  2L0F A;  4TQ0 A;  1QF6 A;  2FCQ A;  4G11 A;  4XYC A;  3ENE A;  1FPY A;  3I9V 1;  4K3C A;  3A4R A;  3DBH B;  3AEG B;  3HRD D;  4FUL A;  2MX2 A;  1XLN A;  1V8C A;  2KN5 A;  3AEA B;  4ITK A;  3ALB A;  5G5H A;  4MJS A;  4N9F 4;  5J17 A;  1V86 A;  4HLE A;  4AJW A;  2KO3 A;  1SJH D;  2LHE A;  4RM8 A;  3Q14 C;  4DHZ B;  2QIL A;  1J7B A;  5DPS A;  5BYQ A;  1F77 A;  4A9A A;  3ZJU A;  4W9K A;  4A3O A;  3UIO B;  2BYF A;  4DHJ B;  2QSD A;  4GXB A;  1IPG A;  4YT0 B;  5G5G A;  1WJU A;  1YQ4 B;  1H8C A;  2K5P A;  1HZ5 A;  2NBV B;  3DBR I;  4L2Y A;  3VTV A;  4Q2J A;  2WX1 A;  4HEA 1;  1E5W A;  4EZL A;  3VRB B;  3SHQ A;  4HDQ A;  1XT9 B;  2YLM A;  3SU8 X;  1WGR A;  3O65 B;  2NPT B;  2DAJ A;  3BYY B;  4O1N A;  4ACF A;  3ZVV A;  1MPE A;  2PE9 A;  3CF6 E;  4WQM A;  3APD A;  3OLM D;  3SDL C;  2ZW0 A;  4GLS C;  3U4E G;  2ONQ A;  1RFA A;  3ML8 A;  1ESF A;  3TMP B;  2LRU A;  1V49 A;  4PS3 A;  1WIA A;  1N5W A;  2KC2 A;  3VH3 B;  3WAN A;  4BBN F;  4TQ1 A;  2MCN B;  1PQS A;  3EFC A;  2OED A;  3V6C B;  1PYW D;  2KD0 A;  2KLC A;  1YIW A;  4ZRK A;  2V0G A;  1P3Q U;  1YQB A;  1KFY B;  5CHF A;  5EDS A;  2K6Q A;  3VXW A;  2LD9 A;  1TKG A;  1C4P A;  5C3J B;  3V05 A;  4JL9 A;  3HM3 A;  2G4D B;  2LVP A;  2YEP B;  4LNI A;  4E71 A;  2NR2 A;  1CMX B;  1EO6 A;  2DYO A;  3R8B A;  4IOI E;  1UEL A;  4KGR A;  4IWO A;  1WMH B;  3M3J A;  2GBK A;  4DK5 A;  2ZVO A;  4RNA A;  3RT3 B;  2O6V D;  4LK0 M;  3HVD A;  1V80 A;  3OWE B;  4LNK A;  1HTO A;  2X8X X;  1SJE D;  2AQ1 B;  1HE8 A;  4DXG A;  1JWA D;  4S17 A;  4LNO A;  4NJC A;  4F8C B;  2WQY B;  2GB1 A;  3DVN U;  3QAQ A;  3H7P B;  2KYW A;  3EA6 A;  3SD5 A;  2LJI A;  3L16 A;  4C7Y A;  1YX6 B;  2E6X A;  1KLV A;  2MHJ A;  1FD6 A;  2RDB C;  2DNF A;  2KAC A;  2BPS A;  2WXO A;  3AEF B;  3RNE C;  4LNN A;  4YTP B;  3KYC D;  1FEH A;  2PTL A;  1F2R I;  3L17 A;  3H9D A;  1WM2 A;  3IT6 B;  5IKC M;  1XD3 B;  3AEB B;  3NVY A;  3O13 A;  1FXT B;  1Z5S B;  2M19 A;  3P4S B;  1ACC A;  4LCD E;  2N9L A;  4JIO U;  3AE2 B;  2BTE A;  3HVZ A;  3EUB 2;  4YXD B;  3NZU A;  3PZD A;  4EUT A;  2IYD B;  2FE8 A;  1X1M A;  4US8 A;  4HCP B;  3CIR B;  1CQV A;  2ZVN A;  1TTN A;  4HVB A;  3ZNI D;  3ZJV A;  1T0Y A;  2KN4 A;  2MBQ A;  4HK2 A;  4WWP A;  1I4P A;  2M17 A;  2JY6 A;  1OFF A;  4FN2 A;  3ONS A;  1R4N B;  2IO0 B;  3GOE A;  5LXI B;  2LGD A;  2IBI B;  1IBX B;  4DDI D;  4CO7 A;  2LI5 A;  2O2V B;  2BQQ A;  1ZDV A;  2KTR B;  4IM3 A;  1QOF A;  1V81 A;  4LLG M;  2ZCC A;  1GB1 A;  3AU5 A;  4MGZ E;  4I6L B;  1N6Z A;  3LJ3 A;  3Q3J A;  4PYU A;  3B08 A;  3RCZ A;  5JHA A;  3WAO A;  2NPT A;  2DZJ A;  1K52 A;  5DPW A;  2HJ8 A;  2OHF A;  1XLO A;  2MQJ A;  5JH5 C;  4M02 A;  3ZLZ A;  4ANV A;  2WXH A;  2KAJ A;  5BMI A;  2IO1 B;  1E8Y A;  2WXG A;  2LEK A;  2CJO A;  1NEK B;  3W1S A;  2CU3 A;  1JAL A;  4RGO S;  5HHD G;  4NZL B;  2ZPY A;  1TZ1 A;  2AWT A;  3MC0 B;  5AUI A;  1KRH A;  4XWT A;  1U4A A;  4FJZ A;  1IGC A;  4EZJ A;  4W9F A;  2KDB A;  1TY2 A;  1E7U A;  4OZC A;  2V3N A;  2L0T A;  2W3S A;  1YD8 U;  3TEY A;  2FID A;  2R61 A;  4OW0 A;  4GDK B;  1OTR B;  2L3Z A;  1V6E A;  2IDY A;  5JZE B;  4WUR A;  1C1Y B;  1LGR A;  2RPV A;  1WMH A;  4YSZ B;  1GOZ A;  2LAS A;  1RM6 C;  1YN4 A;  2WXP A;  1L0X B;  3WAP A;  4DXA B;  2OJR A;  1HTQ A;  5IO9 A;  4RGN A;  3KLS X;  2LGS A;  4BKT A;  4ANW A;  1E6E B;  4IM0 A;  3IHP C;  2FCN A;  2NBW B;  5EE1 A;  1NI2 A;  1VD2 A;  4EKU A;  3K9O B;  4MSQ B;  4ZDV A;  1QOB A;  2VZK D;  3RNC C;  3P4R B;  1GAQ B;  3H7P A;  2JYE A;  1NDD A;  2IO2 B;  5L95 C;  3B2G A;  1UF0 A;  4IUM B;  4KV2 A;  2MJ3 A;  3PRE A;  2BKF A;  1E8W A;  4REZ A;  5TSS A;  1IUE A;  2K8C A;  1TIF A;  3ML9 A;  1T3Q A;  2IND C;  4XE0 A;  1RLF A;  4LNF A;  3DBR B;  1N62 A;  3DQV A;  3FIL B;  3N1Y C;  2BB6 A;  3MTN B;  2L1A A;  2KWU B;  3P42 A;  2MA9 B;  3T8M A;  4F1S A;  1T5X D;  1UGJ A;  3GB1 A;  1Q1O A;  4P1C C;  2K1F A;  3VTU A;  1SF0 A;  3TCA A;  1MHX A;  2PLP A;  1Q10 A;  3PV1 A;  3W5V B;  2Y5C A;  3VDZ A;  1WSP A;  4P1B C;  3KYD D;  2WXN A;  3N9Y C;  3A33 B;  3BK1 A;  4NJ6 A;  2X38 A;  3H6N A;  5GXG B;  4J6I A;  3IFW B;  2MJE A;  1GUA B;  5C23 A;  1E90 A;  1IBX A;  2WDT B;  2WWZ A;  3QC8 B;  1NI3 A;  2ZW1 A;  2CU1 A;  4WJP A;  2O2V A;  3HK0 A;  3WAM A;  4LDT D;  1XEE A;  3Q69 A;  2KTR A;  2KK8 A;  5IAA C;  2PW9 A;  5DPT A;  2LUM A;  3VH4 B;  4FBJ B;  4C00 A;  1JCK B;  3IXS A;  2GBM A;  2KX0 A;  2PEA A;  4XZ4 A;  2M0X A;  1R4M B;  2BGF A;  1YN5 A;  4K3B A;  3LB8 C;  3L10 B;  4DDG D;  2KKC A;  4MAC A;  2WNM A;  2DZK A;  2BBC A;  3L4P A;  1RAX A;  4JLC A;  4W9D A;  4HXD A;  3H8H A;  4KIK B;  5IP4 D;  3NVW A;  5FR6 A;  2L52 A;  2J0J A;  3RNG C;  2HTH A;  1T0Q C;  2MJD A;  2V3S A;  2NTS A;  1WM3 A;  1SE4 A;  1BXT A;  3VRA B;  2Z0E B;  1FIQ A;  2WXI A;  5AEK B;  5H8Y E;  1F0Z A;  2WYQ A;  3DWM A;  3AN1 A;  3MC8 A;  1E9M A;  1TY0 A;  1WXA A;  1VLB A;  2LGX A;  1MHH E;  2L76 A;  4X57 B;  1PUT A;  4FXC A;  3AEE B;  3W1S C;  1JML A;  4WJO A;  3A1Q B;  3AM9 A;  1QOA A;  4MEM A;  3C19 A;  2MBO A;  4GN1 A;  4GDK A;  4HWI B;  2RR9 A;  2G4S A;  4OVV A;  2JRI B;  4K7U A;  2XBB C;  3NRZ A;  4OZA A;  5AZG A;  3DOW A;  1V2Y A;  2BWE S;  1WZ3 A;  2WXL A;  1TS2 A;  3PRM B;  2GLS A;  2WXJ A;  2JZP A;  3TEX A;  1I42 A;  1YQ3 B;  4MM3 B;  2Z8L A;  3MJW A;  4AS1 A;  1SE2 A;  1TS3 A;  2L8J A;  2AL6 A;  3MHZ A;  1FO4 A;  5E6N A;  3ZKJ C;  3KUZ A;  1I4H A;  4BKS D;  2XEW A;  1UD7 A;  1RFK A;  1E0Z A;  4AP4 C;  2BWF A;  1YX5 B;  2UYZ B;  4AQ7 A;  1WZ0 A;  1VRA B;  3M62 B;  2NS5 A;  1F52 A;  3Q3O C;  3TUO A;  4BKG A;  4RF0 A;  3NJT A;  4WWN A;  2MBE A;  2YVC A;  3ZNH B;  3T3O A;  3FIL A;  1XLQ A;  2RMM A;  4C80 A;  1PGB A;  3KWV A;  1I4Q A;  4KVG B;  4E3C A;  3QX1 A;  4JGH B;  2M1M A;  3RD2 A;  2KDF B;  2AEH A;  3VR9 B;  3PHW B;  1LM8 B;  1GNU A;  4G50 A;  2QC8 A;  5I4D A;  5FK9 C;  1BT0 A;  2IGG A;  1SGH A;  3QCA A;  4WJQ A;  2JSV X;  3I3T B;  2I38 A;  2VRR B;  3JSV B;  3R66 C;  2KWC A;  2ZNV B;  3V62 A;  2L32 A;  3U2S C;  4XDC A;  1D5X C;  2ASQ A;  4KSK C;  1ZXH A;  2EEL A;  3DCG A;  1L6V A;  3IBE A;  1ZOY B;  3QAR A;  3R7R A;  5LNK 1;  3PSE B;  3AMZ A;  1WRD B;  1VJK A;  3RZW C;  2AQ3 B;  2J42 A;  1C77 A;  2WU5 B;  2HTM E;  2PMV A;  3NS1 A;  2KJH B;  2LZ6 A;  2IGD A;  3E56 A;  4OVU A;  4XC2 A;  5CHW A;  3WAL A;  4YSY B;  4CHK A;  4NQK E;  3S2A A;  3ZGZ A;  5HKH A;  3APC A;  2Z59 B;  1QQR A;  2MEK A;  5E6P A;  3BK2 A;  2V9H A;  2L83 A;  2CR5 A;  5AZH A;  2JWZ A;  2JZ3 B;  1A70 A;  4ASW C;  3DBL I;  4GOC A;  4N58 A;  3AH7 A;  2BYE A;  1LXD A;  2K8H A;  2PJH A;  4NNJ B;  2N7D A;  2BVC A;  4KIK A;  5C2T B;  4WWO A;  3N3K B;  2J53 A;  2HD5 B;  4ZRI A;  3W1Y A;  3B0A A;  4AWJ A;  1FCC C;  3ZNG C;  1P7F A;  1FRR A;  2MP2 B;  2I1K A;  2ZCB A;  2Z0D B;  2FIF A;  4NAM A;  2DX5 B;  5JXV A;  1OQR A;  3ZXV A;  2R2O A;  3OJ4 B;  2BS2 B;  2EMS A;  3VTW A;  2IGH A;  4AJY B;  2KQS A;  5EE3 A;  3LDZ E;  3AB5 A;  2N9E B;  5DPR A;  2W9N A;  2EMT A;  2WGS A;  1ROE A;  2UWQ A;  1J7C A;  3A9J B;  1WYW B;  1WXV A;  1CK1 A;  1VCB A;  3A1Q A;  5IOI A;  2GBJ A;  1N5X A;  1EM7 A;  1P0R A;  3NZS A;  2INP E;  1RWS A;  4N59 A;  3QK0 A;  3FAH A;  4RMA A;  1DOY A;  2NTT A;  4BZA A;  5J2R A;  1T0R C;  2WXR A;  1WXM A;  1Z2M A;  3BVM A;  4BBN C;  4WAF A;  1C79 A;  4KKI A;  1KF6 B;  2D3G A;  1QOG A;  1TKE A;  2G3Q B;  2C60 A;  4EFO A;  4OVZ A;  1C4C A;  4ANU A;  3RYT A;  2J0K A;  3EHV A;  4ZHO A;  4RGT A;  3NVZ A;  1P98 A;  4MM3 A;  1HQR D;  1OQQ A;  1VZ6 A;  2V3P A;  3NS8 A;  2E3T A;  3ETR A;  3GS2 A;  1IP9 A;  1K53 A;  1C3T A;  3Q6B A;  3LYY A;  2GBR A;  3GZN B;  3Q8E A;  1KM7 A;  1JRP A;  4MT5 A;  1D4B A;  4ZHP A;  1NYR A;  4USA A;  3J9C A;  4FA6 A;  4WQO B;  1K50 A;  4YSX B;  2D2Q A;  2K25 A;  1GG3 A;  1JW9 D;  1XCT L;  2C9W B;  3GE3 C;  4FJY A;  2I2Y A;  1DGJ A;  2MBB B;  2TSS A;  1V9J A;  1YN3 A;  1D5M C;  1M94 A;  3KQ4 A;  4M00 A;  4PS7 A;  2B76 B;  3HUI A;  2D3C A;  2KNB A;  3KVF B;  2MW5 A;  3CSF A;  1S1Q B;  4XWW A;  4MGI E;  2KMM A;  1L7Y A;  3JSV A;  5FKA C;  4YWG G;  1GJZ A;  1ET9 A;  2LVQ A;  3A9K B;  3Q3N C;  4BOS C;  5L83 A;  5H92 C;  5G55 A;  1KLG D;  3UI3 A;  2SEB D;  4IWQ A;  1IYF A;  1QIL A;  3FC4 A;  1AN8 A;  3EGR A;  4KX6 B;  3AE9 B;  3GE8 C;  2VH1 A;  1Y56 A;  1WR6 E;  2IPK D;  2UU7 A;  3C0R B;  3PLU A;  4CQN A;  1WWT A;  4IKG A;  4KGS A;  4MDK E;  2JZZ A;  3N1X C;  2KXJ A;  3BWU D;  1WXS A;  3RUL A;  4PT5 A;  2M8S A;  3T3N A;  1QZE A;  2FNJ B;  1NYQ A;  1UZX B;  4G0N B;  3R2T A;  5HG2 A;  4KDL B;  3B2F A;  4B6W A;  2DYB A;  1LQB A;  1G6J A;  1AAR A;  4LJP B;  4WWM A;  3PZ8 A;  2CS4 A;  1I7H A;  2KQ4 X;  1SSN A;  3MJ5 A;  1FNU A;  3IVF A;  4M8N A;  4HCN B;  3M95 A;  1STE A;  1UNS A;  2PVO D;  4K7W A;  2M0A A;  2MRP A;  5IA7 A;  1AYF A;  1B9R A;  2KFK B;  2GRI A;  2IO3 B;  4DHZ E;  4DWF A;  1EU4 A;  2MP2 A;  3L54 A;  4GGQ A;  4RF1 A;  2IZV B;  2LRW A;  1E7P B;  3BII D;  5G2N A;  2J4X A;  4ZYN A;  2PKO A;  2WS3 B;  2NMQ A;  5BYS A;  2JRH A;  2D5G A;  4II3 B;  1UH6 A;  2KWD A;  1WXQ A;  1L4D B;  3A9J A;  3VUX A;  1KJT A;  4US9 A;  1FMA D;  1WYG A;  3PZ7 A;  1ZKH A;  3TBL D;  2C7N B;  4A20 A;  4CYE A;  5HI1 A;  3ZNZ B;  1T6B X;  4DQO C;  5EE0 A;  2CHZ A;  4A3P A;  3MP9 A;  1TYG B;  4ICU A;  4TV3 A;  1I4R A;  3BIN A;  2HDE A;  3VUW A;  2I1J A;  3RN9 C;  4B0M A;  3SFE B;  3V61 A;  3P4Q B;  3VHT C;  4L23 A;  4HDO A;  2Y3A A;  2M56 B;  2JUO A;  5CTR C;  2W3R A;  1F9J A;  2N4F A;  4K1R B;  4BVU C;  4MGK E;  3VQI A;  2K3U A;  2H89 B;  3P2B A; 
#chains in the Genus database with same CATH homology
 4RH6 A;  2XNA C;  5BMH A;  3GP7 A;  1TKG A;  1VR9 A;  1C4P A;  5C3J B;  5EE9 A;  1XLP A;  1GB4 A;  2FBW B;  4A90 A;  4TMA B;  3NRZ A;  3V05 A;  1F2R C;  4OZA A;  1D6E C;  5D3D A;  1P7E A;  2YEP B;  3ABV B;  3P63 A;  4MH8 A;  1HA5 A;  1YJJ A;  2WXL A;  1TS2 A;  3TEZ A;  2DYO A;  4C56 C;  1FFV A;  2JU6 X;  1BML C;  2INN E;  2WXJ A;  3R8B A;  2JZP A;  4IOI E;  3TEX A;  1YQ3 B;  3TSS A;  4KGR A;  4MM3 B;  2Z8L A;  3AED B;  1ENF A;  3CWI A;  1DOI A;  4AS1 A;  4OZB A;  1SE2 A;  4RNA A;  2BS4 B;  3LXF A;  1TS3 A;  4LK0 M;  1HEZ E;  3HVD A;  3MHZ A;  3OWE B;  1FO4 A;  4JX1 C;  2LGI A;  2WXM A;  2BT6 A;  1I4H A;  2WDQ B;  1SJE D;  2AQ1 B;  1RFK A;  1L0Y B;  2BYT A;  4KKJ A;  4D2K A;  1L0V B;  3E9S A;  1TZO A;  1E0Z A;  1ZP0 B;  1PFD A;  1C78 A;  4DXG A;  1JWA D;  4AQ7 A;  5FR3 A;  4J3O D;  3AEC B;  4YTN B;  5E6J A;  1VRA B;  4NJC A;  2WQY B;  3RPF C;  3ZQ4 A;  1NEN B;  2GB1 A;  4RGM A;  3TUO A;  3NVV A;  1M4V A;  3EA6 A;  4RF0 A;  2LJI A;  1FM0 D;  4C7Y A;  3T3O A;  2E6X A;  3FIL A;  1XLQ A;  4ZRQ A;  1HXY D;  1WRI A;  2RMM A;  1PGB A;  3KWV A;  4C80 A;  1FD6 A;  1I4Q A;  2KAC A;  5HFY A;  2FUG 1;  2WXO A;  3AEF B;  4YTP B;  2DWQ A;  1FEH A;  3VR9 B;  3RFZ B;  1EWY C;  2PTL A;  2WDR B;  5I4D A;  4JWS C;  1F2R I;  5FK9 C;  2JX5 A;  2IGG A;  3IT6 B;  3SFD B;  3AEB B;  1FNW A;  2JSV X;  2Y5P A;  1FNV A;  3NVY A;  3O13 A;  2QEJ C;  1V1O A;  2I38 A;  2M19 A;  2WP9 B;  4H2A A;  3P4S B;  5D3I B;  2PIA A;  1ACC A;  2L32 A;  3U2S C;  4RCO A;  4XDC A;  2PVG C;  1D5X C;  2N9L A;  1ZXH A;  2G9H D;  2KDM A;  3AE2 B;  2BTE A;  1J7A A;  2EEL A;  1L6V A;  3SEB A;  1ZOY B;  1MI0 A;  3AE1 B;  3HVZ A;  3KWL A;  3EUB 2;  4RFB A;  3VR8 B;  5LNK 1;  4YXD B;  3AMZ A;  1L6U A;  1VJK A;  1ZE3 D;  3AE4 B;  3Q8C A;  2AQ3 B;  2J42 A;  2FE8 A;  2EKI A;  1C77 A;  2LHD A;  2WU5 B;  4US8 A;  2HTM E;  2PMV A;  3CIR B;  1CQV A;  3NS1 A;  1JWU D;  2WXF A;  1V1P A;  1EU3 A;  3ZJV A;  2KN4 A;  1DOX A;  1TJE A;  1I4P A;  1XF5 L;  2K0P A;  4A8X C;  2IGD A;  3E56 A;  2RDH A;  1C9F A;  1OFF A;  1VZ7 A;  1I4X A;  2BW2 A;  4YSY B;  4N6E B;  3ZGZ A;  1IBX B;  4WH4 A;  4GDL B;  2DYM A;  1QQR A;  4IDI A;  4A55 A;  2MEK A;  4ZYS A;  3BK2 A;  1ZDV A;  5MPO A;  1QOF A;  2L83 A;  3BYT B;  4LLG M;  1FXA A;  3W5U B;  2LMC A;  4C7Z A;  1GB1 A;  4YTM B;  2W54 A;  4ZRP A;  1A70 A;  1YMH E;  4HKZ E;  1JWS D;  4N58 A;  3AH7 A;  2G1E A;  4OHJ A;  2CJN A;  1L5P A;  5C2T B;  2J53 A;  2WDV B;  1FCC C;  1P7F A;  1PGA A;  1FRR A;  2DBY A;  3IAM 1;  1ZPS A;  1K52 A;  2N9K A;  1V97 A;  4NAM A;  2JWU A;  3AE8 B;  5JXV A;  1OQR A;  4P16 A;  1KH0 A;  2BS2 B;  2IGH A;  2RDG A;  4B0E A;  1SBB B;  5EE3 A;  3AB5 A;  2OHF A;  1XLO A;  2JQR B;  4UDU C;  4A6Q A;  4ZOH C;  3W2D A;  1ROE A;  2H88 B;  2WXH A;  1J7C A;  2KAJ A;  5BMI A;  2WXG A;  2LEK A;  2CJO A;  1NEK B;  3W1S A;  3AE6 B;  2CU3 A;  1DYQ A;  1JAL A;  1WGK A;  2K22 A;  3PO0 A;  3Q8F A;  4RGO S;  1XCQ L;  5HHD G;  2XN9 C;  4NZL B;  1CK1 A;  2IJ0 A;  3AE7 B;  1JWM D;  1SIJ A;  4P6V F;  1PGX A;  2ICI A;  4EE2 A;  5BMG A;  1N5X A;  1EM7 A;  3MC0 B;  4TSS A;  5AUI A;  3ZJT A;  1KRH A;  4HJG E;  4XWT A;  2QIE B;  1KTK A;  2ACZ B;  2INP E;  1RWS A;  1IGC A;  2N0S B;  4N59 A;  3FAH A;  1DOY A;  3NZ3 A;  2NTT A;  1ZDX A;  3BZD B;  1KLU D;  1VZ8 A;  2MH7 A;  4L1B A;  3DWG C;  1TY2 A;  2WXR A;  4OZC A;  2V3N A;  3BVM A;  2W3S A;  4JE3 B;  2YEP F;  2JXT A;  1ZUD 2;  4WAF A;  1C79 A;  4KKI A;  3TEY A;  1KF6 B;  2AQ2 B;  2R61 A;  1QOG A;  1TKE A;  1ZXI A;  4OW0 A;  4WIP A;  4GDK B;  4OVZ A;  4HKQ A;  5BYR A;  1C4C A;  2IDY A;  3BVZ A;  4ZHO A;  1JQ4 A;  4RGT A;  3NVZ A;  4WUR A;  2RPV A;  1BUI C;  1QT9 A;  3MFG A;  1N60 A;  4YSZ B;  1GOZ A;  1RM6 C;  1HQR D;  3B9J A;  1OQQ A;  1YN4 A;  2WXP A;  1NVI D;  1L0X B;  1VZ6 A;  2LFI A;  2QJL A;  2V3P A;  1SB3 C;  2E3T A;  1AW7 A;  3ETR A;  1K51 A;  2WLB A;  3GS2 A;  2QMT A;  1LO5 D;  1R7S A;  1QLB B;  3URY A;  1K53 A;  3BVG A;  1MVK A;  1TS5 A;  4HRS A;  3LYY A;  3IAS 1;  1YNT E;  3SR6 A;  3Q8E A;  4RGN A;  1JRP A;  3KLS X;  5D7G A;  1E6E B;  4MT5 A;  1VDV A;  5EE1 A;  1UWM A;  4ZHP A;  1D4B A;  1NYR A;  4USA A;  3J9C A;  1QOB A;  2VZK D;  3P4R B;  1GAQ B;  1K50 A;  2JYE A;  1IGD A;  4YSX B;  1JW9 D;  1XCT L;  5T8I A;  3B2G A;  3TEW A;  2WU2 B;  2I2Y A;  4ARC A;  1DGJ A;  2MJ3 A;  2BS3 B;  2TSS A;  1FRD A;  3NUH B;  3Q8B A;  1YN3 A;  1EWC A;  5AUK A;  1D5M C;  5TSS A;  4REZ A;  1IUE A;  3KQ4 A;  1T3Q A;  4JPS A;  4XE0 A;  1TS4 A;  2B76 B;  1UUP A;  2N7J A;  2V4I B;  3HUI A;  3I57 A;  3V3X A;  1N62 A;  4XWW A;  3U7Z A;  3FIL B;  2BB5 A;  2KMM A;  3P4P B;  4XDD A;  1QKZ A;  2JYT A;  1XXG A;  2W82 A;  2BB6 A;  2GI9 A;  2L1A A;  5FKA C;  2AX5 A;  2J52 A;  3P42 A;  1C76 A;  1XO3 A;  4YWG G;  1ET9 A;  1JWB D;  5H92 C;  1SXT A;  1T5X D;  1UGJ A;  1ET6 A;  3GB1 A;  3AE3 B;  2K9X A;  1KLG D;  3UI3 A;  4TQ0 A;  2SEB D;  1SF0 A;  2Q5W D;  4NAW B;  1MHX A;  1QF6 A;  1QIL A;  3FC4 A;  2PLP A;  1Q10 A;  4DXF A;  4ARI A;  1AN8 A;  3W5V B;  2Y5C A;  3EGR A;  4KX6 B;  3AE9 B;  3WCQ A;  1Y56 A;  1TKY A;  3I9V 1;  2DLB A;  2IPK D;  4CQN A;  1WWT A;  2WXN A;  3N9Y C;  4IKG A;  4KGS A;  2SAK A;  1RYJ A;  3AEG B;  3HRD D;  3BK1 A;  1XLN A;  1V8C A;  2X38 A;  1CJE A;  5GXG B;  3AV8 A;  3AEA B;  3BWU D;  4ITK A;  5G5H A;  4PT5 A;  2MJE A;  3T3N A;  1NYQ A;  3Q8A A;  3R2T A;  3AE5 B;  5HG2 A;  4KGT A;  1D5Z C;  3B2F A;  1E10 A;  1IBX A;  1NI3 A;  2ZW1 A;  1GPX A;  1UWX A;  1SJH D;  3R2I A;  1XEE A;  2LHE A;  3Q69 A;  4WWM A;  3PZ8 A;  1I7H A;  1V1P B;  2KQ4 X;  2WXQ A;  1SSN A;  2PW9 A;  1J7B A;  2QIL A;  2LUM A;  4HRO A;  3MJ5 A;  3W9C B;  1FNU A;  5BYQ A;  1F77 A;  1JCK B;  4A9A A;  3ZJU A;  3IXS A;  1STE A;  1UNS A;  2PVO D;  1CZP A;  2M0A A;  2QSD A;  1AYF A;  2ON8 A;  1B9R A;  1N61 A;  4YT0 B;  1YN5 A;  3ZYY X;  2GRI A;  3LB8 C;  5G5G A;  1SEB D;  1YQ4 B;  4LTU A;  3U52 E;  1EU4 A;  2K5P A;  4RF1 A;  1HZ5 A;  4M0W A;  4L2Y A;  4MAC A;  2WNM A;  1E7P B;  3BII D;  2BBC A;  4Q2J A;  3L4P A;  2J4X A;  2PKO A;  2WS3 B;  2NMQ A;  5BYS A;  4HEA 1;  3H8H A;  2D5G A;  2KWD A;  3NVW A;  3VRB B;  2L52 A;  1WXQ A;  3IT4 B;  1L4D B;  2MJD A;  1B1Z A;  2NTS A;  3C8Y A;  4US9 A;  1SE4 A;  1BXT A;  3VRA B;  1JRO A;  1FMA D;  1WYG A;  3BYY B;  4O1N A;  3P1M A;  1MPE A;  1FIQ A;  2WXI A;  3PZ7 A;  4WQM A;  2W55 A;  5H8Y E;  1F0Z A;  2ZW0 A;  1AWD A;  4GLS C;  3DWM A;  3AN1 A;  1HZ6 A;  3U4E G;  2ONQ A;  5HI1 A;  1T6B X;  4DQO C;  5EE0 A;  1C4A A;  1N63 A;  1ESF A;  1E9M A;  1TY0 A;  3MP9 A;  1FFU A;  1L4Z B;  1VLB A;  1TYG B;  1FXI A;  1I4R A;  1MHH E;  2HDE A;  2VZK B;  2WXK A;  1N5W A;  1YJI A;  4TQ1 A;  4JWU C;  1PUT A;  4FXC A;  4B0M A;  3AEE B;  1JML A;  1FCL A;  1SE3 A;  3SFE B;  3AM9 A;  2OED A;  1QOA A;  4R3D A;  3P4Q B;  4L23 A;  1I4G A;  1PYW D;  2Y3A A;  2M56 B;  1PDX A;  2W3R A;  2V0G A;  3VQI A;  2K3U A;  2H89 B;  1WSP A;  1KFY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...