1OQRA

Crystal structure of c73s mutant of putidaredoxin, a [2fe-2s] ferredoxin from pseudomonas putida, at 1.65a resolution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
106
structure length
106
Chain Sequence
SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHVYVNEAFTDKVPAANEREIGMLESVTAELKPNSRLCCQIIMTPELDGIVVDVPDRQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Putidaredoxin
publication title Crystal structure of putidaredoxin, the [2Fe-2S] component of the P450cam monooxygenase system from Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
total genus 31
structure length 106
sequence length 106
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1oqrA00
3AEBB 1E6EB 1JWAD 2CJNA 1E10A 1WWTA 1DOYA 1J7BA 4FXCA 5C2TB 2DWQA 2BT6A 2WP9B 1RM6C 1XLOA 1A70A 1E9MA 1QLBB 4YTNB 4N58A 3W5VB 2MJEA 3P63A 4US8A 2ACZB 3HRDD 1AWDA 1FIQA 1SB3C 3AH7A 1DGJA 3L4PA 1FXIA 3NVVA 1XLPA 4YSXB 1FO4A 2W55A 3AE7B 2JX5A 5EE9A 1KFYB 3SFEB 2BS3B 5H8YE 2QIEB 1ZOYB 3NVZA 4YTMB 1J7AA 1TJEA 1B9RA 1VLBA 1YQ3B 1NYQA 1SIJA 2E3TA 3VRBB 2K9XA 3BIID 1VDVA 4ZHPA 3ZYYX 4ZOHC 3AB5A 2WDQB 1FFUA 3KWLA 2MJDA 4C80A 1N5XA 1TKGA 1QT9A 2MJ3A 1L6VA 2WS3B 5C3JB 4HROA 1F0ZA 1QOGA 3AE3B 1QOBA 3AE5B 4P6VF 4N59A 3NRZA 1ROEA 2AX5A 2LEKA 1ZXIA 1PDXA 1RFKA 3AM9A 5EE1A 4YXDB 1FRRA 1JALA 2PVOD 1PFDA 3NS1A 2MH7A 1IUEA 1OQRA 2WLBA 2OHFA 3AE4B 1WYGA 2K5PA 3P4QB 1KRHA 1SF0A 3AEAB 2PKOA 5H92C 1OFFA 1PUTA 2M19A 3EUB2 2H89B 1L0VB 3P1MA 4WQMA 5AUIA 1CZPA 3AE9B 4JWUC 3SFDB 1R7SA 1ZP0B 1JQ4A 1QOFA 3DWGC 3SR6A 1L5PA 1L6UA 3WCQA 1RYJA 2HTME 2QJLA 4LTUA 3NVWA 1FMAD 3AV8A 3AEFB 1E7PB 1V97A 1FFVA 3W5UB 5MPOA 4YT0B 1CJEA 2DBYA 3B9JA 1XLNA 2WU2B 4HRSA 4USAA 1AYFA 2Y5CA 2G1EA 3ETRA 3VR8B 1XO3A 1OQQA 1NYRA 3B2GA 1WGKA 3NVYA 1GPXA 1V8CA 5G5HA 2WQYB 5GXGB 1JROA 2WDVB 3HUIA 4WWMA 2W3SA 2N0SB 1E0ZA 4IDIA 1J7CA 1EWYC 1I7HA 4YSZB 2W3RA 2PIAA 3W9CB 2CJOA 2L83A 1XLQA 2W54A 3AE1B 3P4RB 4ZHOA 4N6EB 5EE0A 1ZUD2 2L52A 1T3QA 2K22A 1FM0D 1UWMA 1KF6B 5AUKA 1DOXA 1NEKB 2KAJA 1GAQB 4JX1C 3RPFC 1JW9D 1JRPA 1TYGB 3AEDB 2H88B 4US9A 3VRAB 3P4PB 3VR9B 3AECB 3CWIA 1N60A 2B76B 4A9AA 1YJIA 1N62A 3LB8C 1TKEA 3CIRB 3ABVB 1NENB 2JQRB 1FRDA 1N61A 2WDRB 3AEEB 2PVGC 4YTPB 4C7ZA 2KMMA 3FC4A 2WU5B 2BS2B 1RWSA 1DOIA 3DWMA 3AN1A 4YSYB 1QOAA 1NI3A 3AMZA 2M56B 2Q5WD 1N5WA 2FBWB 1FXAA 1NVID 1WRIA 1WXQA 3AEGB 5EE3A 3AE6B 2BS4B 5G5GA 1QF6A 3PO0A 3AE8B 3LXFA 1TKYA 3HVZA 1JWBD 2EKIA 1YQ4B 1N63A 4ITKA 3P4SB 4KX6B 1YJJA 3FAHA 1VJKA 3B2FA 2CU3A 4C7YA 3AE2B 4JWSC
chains in the Genus database with same CATH superfamily
1AW7A 4N58A 1WF9A 2DYMA 3TIXA 2BWFA 2D11A 2JXXA 5LLIA 3TCAA 1WIAA 4KDLB 4B9KA 3EFUA 3BIID 1VDVA 4ZHPA 1WX9A 1KOTA 4A90A 5DPWA 2G4SA 1TKGA 2Z59B 1WGYA 3UQBA 2A5UA 3RNBC 1C4AA 4EUTA 1FRRA 2MH7A 1SJHD 4K7SA 2M19A 2JF5A 3J9CA 2LGYA 1WSPA 2ZEQA 2NS5A 4LTUA 2KX0A 4YT0B 4B6WA 1YX5B 3V6CB 2WGSA 1P7FA 2J52A 3KUDB 2BW2A 3JSVA 3URYA 4W9CA 3A9JA 1UD7A 2N0SB 4YSZB 2W3RA 2ZZPB 2PIAA 4M0WB 1OEYJ 3AE1B 4PS3A 2KLCA 2INNE 3OAWA 3AI5A 2RDBC 4WWNA 2KWCA 3N20C 3DHIC 3VR9B 4IWOA 2BVCA 1WYWB 2B76B 1SXTA 1YJIA 2LHEA 1HE8A 5AZHA 3BK2A 1ZDXA 2J0JA 4DHZB 2IO3B 4NJ7A 2FBWB 3U52E 2LUMA 3TUOA 2UWQA 3I3TB 4II3B 3CMMB 1VJKA 4I6PA 3ML8A 2KJRA 4J6IA 5C2TB 2WXHA 2BWES 1HEZE 3D32A 4DHZE 2MJEA 2K6DB 5CHWA 4FADA 2BYTA 3AH7A 1I35A 3KUZA 1J7AA 3W1SA 2NR2A 3RZFA 4ZOHC 1FFUA 3PPAA 4M0WA 2WS3B 4HROA 1C1YB 5E6JA 3T8MA 1WR1A 3MC8A 1PFDA 4TQ1A 2WHIA 3DDCB 2V3SA 1RFAA 2LHDA 3L10B 1Q5WB 3C8YA 1D5XC 5H92C 1WXAA 5KHOA 3P1MA 4LDTB 4LNNA 3DBLB 4IC7B 3NY5A 3SR6A 2HJ1A 3RNCC 3GZNB 1P9DU 3PHXB 1XLNA 3R2IA 4WAFA 2CHZA 4KSKC 2FIFA 3DBSA 3B2GA 2EKEC 5JXVA 4OZBA 2W82A 3LJ3A 3WAPA 2L05A 3L0WB 4AJYB 3GB1A 1TZ1A 2J7QB 4FN2A 3W9CB 4RGTA 3MFGA 4IG7B 4DDGD 4O1NA 3PTFC 4E74A 1XT9B 2DX5B 4TSSA 4ANUA 3B0AA 4GLSC 4EZJA 1FRDA 3AEEB 4GSWA 1I4HA 4EE2A 4S0RA 2BPSA 2IO2B 5C1ZA 1UGJA 3W1SC 1GNUA 3B08A 1K51A 1V97A 2J4XA 1E8ZA 2KJ6A 4BKTA 1M94A 4DQOC 5IOIA 2D10A 5BMIA 3DBHB 1WZ3A 3L4PA 4ZYNA 3ZTCA 2VRRB 3V6EB 3U2SC 4WURA 1SJED 1F9JA 3RNFC 2VH1A 2K8BA 4IOIE 4MSQB 2MJDA 4LNKA 2LGDA 1WI0A 3H8HA 3Q3FA 4W9DA 3AE3B 3Q14C 3ZJTA 1PDXA 1Y56A 5EE1A 4REZA 4YXDB 1WRDB 3NS1A 1ZGUB 1UBIA 3QC8B 4XYCA 1OFFA 1PUTA 4HK2A 1E7VA 4EZLA 2H89B 1CZPA 1Z5SB 1MHXA 1WFYA 3DVGX 1RYJA 4A20A 5FR3A 1FFVA 5MPOA 3WA0A 4USAA 2UU7A 3DBHI 2DYOA 2KDBA 5E6NA 4EEWA 4LJPB 3ZDTA 4K3CA 2LVPA 4OZAA 3GS2A 2W54A 4N6EB 1ZUD2 1FCLA 1FM0D 2KTFA 2JRHA 4BKGA 4G0NB 3DPDA 3ZNID 4E71A 4P7IA 2FCSA 3X0WA 3DBRI 3NG0A 1YD8U 4DHJB 4L2YA 1WE7A 4HPPA 2HE7A 1NI3A 3QCAA 1IGCA 3C19A 4DBGA 2WWZA 3ZVVA 2MWSB 2V3PA 2JU6X 3Q69A 3DQVA 2MCNB 1T0YA 2PLPA 1K8RB 4M8MA 1QKZA 2ACZB 2DZJA 2JWZA 2VZKD 2LI5A 4IM0A 3NVZA 1D4BA 1Y8RC 2FAZA 2MX2A 3VXWA 5HKHA 4RMAA 2K25A 2KFKA 2NCNA 5KHQA 2KVZA 1K50A 3Q6BA 1D5ZC 3ZLZA 2PVOD 3IT4B 4FLHA 1GC7A 5CTRC 4WWOA 4GIVA 1ESFA 2IJ0A 1A5RA 1OGWA 4MM3B 1RRBA 3A33B 3BVGA 5L83A 4OHJA 3EC8A 4NQKE 4CQNA 5EDSA 2MP2B 3WCQA 1XEEA 1SE2A 3APCA 3CSTA 3ZDMC 2N9KA 1AARA 3UI3A 3ETRA 3ZUNA 1NYRA 2D3AA 2I2YA 3VTWA 3N3KB 3BYTB 3V05A 1C79A 4JIOU 3PHWB 1SE3A 1ENFA 4MH8A 1L0XB 4RM9A 1GB1A 3ZW3A 1UWMA 1GAQB 1GJZA 1WH3A 2JXTA 1PQSA 1PYWD 5IP4D 3AXCA 2QCZA 2KVRA 1L2NA 4AWJA 2KQ7A 3V61A 2FNJB 2V9HA 3I57A 4KKJA 2GOWA 1EF5A 2PE6B 1R4NB 2L7RA 3SHQA 1QF6A 3LXFA 1WJ6A 1BUIC 1C4CA 2CS4A 1T0SC 1YJJA 3WAOA 4MM3A 4WJQA 3SU8X 2N9XA 1TY2A 1FEHA 2KOXA 3W1YA 1A70A 3SEBA 4US8A 1FD6A 1KFYB 2N4FA 3HVDA 4NAMA 2HJ8A 4HCPB 1FCCC 3A9KB 1F1HA 2BYVE 4XDCA 5C23A 3WALA 3OWEB 1I4QA 5BO4B 2WXQA 4P6VF 3BK1A 1XCQL 1GC6A 4L1BA 1JALA 1R4NI 3E56A 1TTNA 4PT5A 1V1PB 2IGHA 3A4RA 2KMCA 3IG3A 1WMHA 1YNTE 1VD2A 2IZVB 1ZP0B 4NY0A 5IA7A 3H7PB 4YWGG 1NDDA 2QHOA 3EA6A 4HRSA 3MC0B 1UGMA 2M8SA 2HTHA 4HWIB 2AL3A 2KLGA 1E0ZA 2XN9C 5E6PA 4ARCA 3L08A 1GUAB 2L83A 2OOBB 3MHSD 2RSUA 1T3QA 5AUKA 5FKAC 3Q3JA 3DHGC 3RT3B 3R66C 4XX5A 1SBBB 4OVVA 4F8CB 3SDLC 3LB8C 3ZGZA 4IKGA 2ZCCA 2JQRB 3A9KA 2KFJA 4CO7A 2PVGC 3H7SA 2WU5B 4KVGB 1QOAA 3EHVA 2Q5WD 5G55A 2KT7A 2JWUA 2NBWB 4WJNA 1Z2MA 2LWPA 2EKIA 3ZQ4A 4XC2A 4BOSC 1V1PA 4MJSB 1L0YB 2CU3A 2LMCA 5IKCM 1J0GA 5D6JB 1DOYA 4FXCA 3R7QA 4YTNB 1EU4A 3H7PA 3P63A 2JYTA 1DGJA 3ZO5B 4W9EA 2PPHA 2KWUB 1YN4A 5H8YE 3PLUA 2J53A 1IP9A 4BAXA 5DPRA 3S2AA 1UBQA 4G11A 2WDQB 1C77A 1Q1OA 2YEPB 1ISNA 4ACFA 4BBNF 4D2KA 3ZRFA 3RD2A 4AS1A 3TEYA 3NJTA 4WH4A 3QQ8B 1IBXB 2WXOA 2KHWB 1KRHA 4W9IA 3NZUA 4FHJA 1M4VA 4WJOA 3EUB2 1YOVB 4J3OD 1QOFA 1S3SG 2HTME 4JE3B 5IN7A 2EMTA 1SSNA 2YLMA 1TBEA 4MJSA 2XNAC 2LVOA 3Q3NC 2D3BA 1J7CA 2LUEA 4C56C 4NZLB 4F1SA 4B95A 4KGRA 3U7ZA 2SAKA 1UNSA 1JWUD 4OZCA 2K22A 1JCKB 2ZW1A 4XE0A 4BKSA 3AECB 3UF8A 2KQ4X 2LGSA 4BBNC 3K9PB 3CF6E 5J18A 3ONSA 1OTRB 2M56B 1QILA 3AEGB 1T5XD 3AE8B 3OJ3A 3N9YC 3NZ3A 1IBXA 3VAWA 5GMVA 3TEZA 4C7YA 2O2VB 1J7BA 2IDYA 2BT6A 1QLBB 2YEPF 3GP7A 1VZ7A 4HKZE 1MG8A 2Y5BB 3IT6B 2QIEB 4ANWA 3N32A 3Q8AA 3Q8FA 2Z0EB 3H9DA 2L0TA 4EFOA 2L1AA 2INDC 3DHHC 1WY8A 5D2MB 2RR9A 1C4PA 1C3TA 2AEHA 3TSSA 3A1QB 5TR5A 5LXIB 2IPKD 2WYQA 4FULA 4HCNB 2KDEB 2LGIA 2L32A 3PREA 2KDIA 4DWFA 1STEA 2OJRA 2UYZB 1ET6A 2C5LC 3L16A 4NQLB 2KC2A 3O13A 2WXMA 1EO6A 4KZ0A 1RLFA 1IPGA 2C7MB 1V8CA 2ZNVC 1JROA 1MPEA 2O2VA 3HUIA 4IDIA 3MJ5A 3VUWA 2HDEA 5EE0A 4PYUA 2BB6A 3EFCA 5BYRA 3ZNHB 2KZRA 4AJWA 1DOXA 3AULA 3APDA 3QA8A 5LXHA 2J0MA 1N60A 4A9AA 2DAFA 3L17A 1R4MB 1AN8A 1I4RA 2N1VA 3BINA 3OJ4B 3LDZE 1TGZB 4RFBA 1T6BX 1DOIA 2IO1B 2MSED 3PVLA 4S17A 4F7ZA 2D5GA 4IUMB 3A1QA 3RUIB 1YQ4B 4ITKA 2JUOA 2L8JA 4RCOA 3Q8BA 3U30A 4Q2JA 4MH0E 3AEBB 1E10A 2WP9B 1HZ5A 2QMTA 3HK0A 3HRDD 3W2DA 3UINB 2LJ5A 1LFDA 1KLUD 4FA6A 5EE9A 2JX5A 3PZDA 2LZ6A 4BFRA 3DBLI 4RGNA 3BWUD 2JZZA 2K9XA 3OLMD 1SEBD 3GZNI 2Y3AA 4MT5A 3HM6X 1L4DB 1QT9A 1L6VA 3RI7C 1PGBA 1R4MI 1QOGA 3VUXA 4RGMA 4N59A 2XEWA 3NRZA 2LRUA 3U7DA 2ZCBA 1ZXIA 2QSDA 1IUEA 2WLBA 1UH6A 3AU4A 1CQVA 1SF0A 3AEAB 4ZYSA 4A6QA 2J0KA 3DWGC 3MTNB 1L6UA 5JH5C 2ON8A 4XDDA 3IXSA 3B9JA 2WU2B 2N9EB 3VR8B 3QHTA 4JGHB 3RCZA 4HJGE 5IAAC 1KLVA 4GU2A 4K81A 1TS2A 1YMHE 3HIZA 2N9PC 3RMKC 2CHWA 2X38A 2K39A 3NS8A 3PZ8A 1V86A 1Q0WB 3VFKA 5JZEB 4N9F4 5DCNA 3H6NA 1TKEA 1YJ1A 4R3DA 4DHJD 1U4AA 2IY0B 2Y5PA 3I5JC 4C7ZA 2OEDA 3FC4A 5CHVC 2ZPYA 5J17A 2BYEA 2PMVA 2WNMA 1TS3A 3KWVA 1TKYA 4MEMA 2KFKB 3Q2AC 1JWBD 3I9V1 3BZDB 4OVUA 2EMSA 4JLCA 1WWTA 1MHHE 4ZRKA 2DWQA 3KH0A 4LNIA 1XQQA 3ZIMA 1P3QU 1FIQA 3Q8EA 1QZEA 4ANVA 2PJHA 2KDFB 4GB9A 4TMAB 3IAM1 3BY4B 3U4EG 2Z8LA 1D6EC 3PT2B 1LQBA 1F0ZA 5J2RA 2WXIA 5HFYA 4JPSA 2IGGA 1GB4A 1J8CA 1ZKHA 4CHKA 1WGDA 4IWQA 1G6JA 5AUIA 2GBJA 4OW0A 2R2OA 4PK1A 1N6ZA 4LJOB 1E5WA 4WAAA 2PEAA 4W9LA 3UIPB 3TBLD 3APFA 3OG5A 1C9FA 4WIPA 3JYUA 3KQ4A 1XCTL 2PE9A 2CKHB 4A8XC 3ZKJC 2AQ3B 5D3DA 2GBMA 1NEKB 2RMMA 4RF0A 4YL8A 2KN5A 4HXDA 5T8IA 4RNAA 4K7WA 3CWIA 1TS5A 2O6VB 1UELA 2WDTB 2XBBC 1WXMA 1EU3A 2N7DA 2FCQA 2WDRB 1FNUA 3C0RB 4YTPB 2JZ3B 4ASWC 4M8NA 2BKFA 1WRIA 5HHDG 3V3XA 2N7JA 3K9OB 1I42A 2KC1A 3PO0A 3VQIA 3PV1A 2V4LA 2LGXA 2MEKA 2RDHA 1TS4A 3TMPB 3W5VB 1LO5D 2QC8A 1WMHB 1NI2A 3QARA 1AWDA 2CU1A 3NVVA 1V6EA 1NBFC 2MBOA 3HM3A 4DXFA 1VLBA 3FKYA 1SIJA 4KIKA 5HG2A 3ZYYX 2LXAA 4WWPA 1FXTB 1N5XA 4K3BA 2GRIA 5C3JB 2V1YA 2WXPA 2LVQA 1QOBA 3TJPA 4TKNA 4A55A 2VH2A 2AWTA 3DOWA 2O6VA 3ZJVA 3VDZA 5CHFA 2KDMA 1HTOA 2KQSA 1MG4A 3IAS1 4IWPA 3NHEB 1L5PA 2I1JA 1WXVA 3NVWA 2JSVX 1FMAD 1E8YA 2LASA 2ZPNA 2OJWA 1ZDVA 1CJEA 1AYFA 3PS6A 1GOZA 1WE6A 4OVZA 4A3OA 1V2YA 2EELA 1CK1A 4WWMA 2KO3A 5AEKB 1VZ6A 1I4XA 1PGXA 1P7EA 2LFIA 2ZVNA 1FNVA 3CSFA 2J42A 2L52A 3M95A 4FHKA 1KF6B 3ALBA 2KACA 5BYSA 3MC9A 2M4NA 3VH3B 4HDQA 1T0RC 2ZW0A 3JW0X 1JMLA 3TEXA 2V0GA 1WM3A 3PLVA 4P16A 4YSYB 5EE3A 4DXAB 4C4VB 2L0FA 3AE6B 2BS4B 2JZPA 1KTKA 2M17A 1WZ0A 4FJVB 1WGHA 5FK9C 4P1CC 2V3NA 3X23A 2IGDA 4BKSD 2D07B 4AOFA 2B3AA 2JT4B 3SFEB 3U8ZA 1SGHA 1YN5A 3BYYB 2ASQA 3VRBB 4ZDVA 4GMVA 4IM3A 4NJ6A 1J19A 2TSSA 4RH6A 2GBNA 2MJ3A 2IYDB 1L4ZB 2FE8A 3L54A 4M02A 2WXJA 4MSMB 4L23A 2BF8B 2PKOA 4M01A 4IM2A 4WQMA 4JWUC 4FJYA 4DXGA 2C60A 1EF1A 4HPLB 4XWTA 2DBYA 4C4VA 1I4GA 1E7UA 2G1EA 5HI1A 3GE8C 1ZPSA 4GN1A 3ZNZB 4LNOA 1FPYA 2FUG1 3EECA 1DYQA 1P98A 4KDIC 1ET9A 1I7HA 2CJOA 4TV3A 3P4RB 4HDOA 3KW5B 1LXDA 2HD5B 2ZJDA 5I4DA 1JRPA 2H88B 1HXYD 2NVUI 3QIJA 3PRMB 2BS2B 1RWSA 4XGAB 4PS7A 3AMZA 1NVID 4RF1A 1MVKA 3KYDD 4A3PA 3HVZA 5AZGA 1B1ZA 2GBKA 2QEJC 1EUVB 3B1LX 3VTVA 3B2FA 2DHZA 1JWAD 2CJNA 4W9FA 2WX0A 2WXKA 1E9MA 4HPMB 3BVZA 1FO4A 3WANA 1MJDA 1BT0A 2REXA 5BMHA 1VCBA 1ZOYB 2GMIC 4LLGM 2LRWA 2MBEA 5D94A 2RGFA 2K3UA 4MGYE 2M0AA 1V49A 4B0EA 2I38A 4M00A 1ROEA 4W9KA 3M3JA 4URKA 3ZXVA 3UGBB 5G2NA 2K5PA 1D5MC 1XD3B 1F2RC 3ML9A 5LNK1 4KGTA 2L00B 1XF5L 2RPVA 2KKCA 1OEYA 2LD9A 1V5OA 4HKQA 1EM7A 3UIOB 4BZAA 2KWDA 2MHJA 2AQ1B 1YX6B 2K0PA 1JWSD 2KWVB 1FNWA 4PS8A 2N7EA 1HTQA 4NAWB 2KD0A 3NVYA 5GXGB 4LDTD 1L7YA 3ENEA 2KN4A 4II2B 2MBHA 1VZ8A 5FR6A 1E8WA 4RGOS 1WM2A 3TEWA 3RPFC 3AEDB 3H1UA 3PRZA 2CR5A 3R8BA 3V60A 1ZE3D 4HEA1 4FJZA 4G3XB 4I6NB 4K7UA 4JQWC 2KTRB 2C7NB 2V4IB 4EOYA 4EKUA 3M62B 2FUHB 2YVCA 5G5GA 2FCNA 3R7RA 1E8XA 3N1YC 1N63A 4WJPA 1BMLC 3A4SC 4W9JA 3IFWB 3ZRCA 1XLOA 5D7GA 2G3QB 3RULA 2N1WA 1WGGA 3E9SA 1UWXA 2DLBA 4GGQA 3AE7B 2BS3B 1WR6E 1NYQA 4KV2A 4NAWA 4NJCA 1X1MA 3LYYA 2K1FA 1WX8A 3KWLA 2JRIB 2ICIA 4DK5A 1TZOA 4JL9A 2LEKA 1UZXB 3AM9A 3MHZA 2GBRA 2X8XX 2G45B 1C78A 1F77A 4BVUC 3KVFB 1ZXHA 3FILB 2RPQA 2KTRA 2LXCA 3NZSA 3KYCD 1V9JA 3O65B 1KLGD 4FBJB 4AQ7A 2DENB 1WGKA 4H2AA 4MGZE 2MBQA 2NBVB 3Q3MC 3DVNV 1LGRA 4NPNA 1MI0A 2KANA 4JX1C 3DVNU 3RNAC 3ECIA 2A4ZA 1ACCA 2JY6A 2K8HA 4BOZB 2DZMA 2DNFA 2D3CA 1ZW7A 1HZ6A 3DVGY 1YIWA 2NPTB 3DWMA 5BYQA 2NBUA 3Q8CA 1N5WA 3T9LA 1UUPA 2KK8A 4MACA 3RYTA 2PTLA 2G9HD 3ZNGC 1SE9A 1MFWA 2BQQA 3AN1A 3FILA 4W9HA 2ONQA 2RDGA 4HLEA 1YQBA 2FIDA 1RM6C 3V62A 3Q3OC 3DBRB 4YSXB 2WXRA 4AP4C 3PGEA 3TL5A 1OQYA 4YTMB 1B9RA 1TJEA 2XK5B 1K52A 3QX1A 3P42A 4HVBA 4LK0M 2G4DB 2BTEA 4ICVA 3WIMA 3AE5B 3RNGC 3P2BA 2AX5A 4ZRPA 4NNJB 3NOBA 2OHFA 1BXTA 1V5TA 1P0RA 3R3MA 3RN9C 4DDID 3AE9B 1I4PA 2AYOB 2NPTA 3M63B 2INPE 5JHBA 1E7PB 2IBIB 2L76A 5TSSA 1S1QB 1TT5B 3DCGA 2JYEA 2K8CA 4ARIA 5DPSA 2KYWA 2MQJA 3IVFA 2ZVOA 2D3GA 5G5HA 5E6OA 2W3SA 5BMGA 4KSLC 3VUYA 4CYEA 3GOEA 4E3CA 3MJWA 3ZJUA 3IBEA 2O6VD 2KAJA 2K6QA 3VRAB 4GOCA 3N1ZC 5AZFA 4GDKB 2XK5A 3R2TA 2N9LA 2RD0A 3ZXRA 3ABVB 1V80A 2NTSA 4KIKB 2KMMA 5IO9A 3L13A 1H4RA 1WXQA 2NTTA 3IHPC 3MP9A 4G50A 2R61A 3EGRA 4LNFA 4KZCA 2DAJA 2BBCA 3UQAA 3VTUA 4I6LB 1LM8B 1WJUA 2BKRB 2WXFA 1SE4A 2PW9A 2KX3A 1HQRD 2QDFA 2WXLA 2JVCA 2FCMA 1SB3C 4ANXA 1WJNA 4HJKA 1VR9A 4AUQC 2L3ZA 3JVZX 2VZKB 3QJZA 2CHXA 1WGRA 2E3TA 2MLBA 3VH4B 1UF0A 4QAYA 3AB5A 2E6XA 4XWWA 2IY1B 1GG3A 2GLSA 4C80A 2R2QA 2INCC 2QILA 1Q10A 2WX1A 1JRUA 1RFKA 2GB1A 4MELA 2M0XA 1OQRA 4TUUA 3AE4B 4GDKA 1WYGA 1V81A 3RNEC 1R7SA 2IO0B 2I1KA 5L95C 4LCDE 2QJLA 3W5UB 3AEFB 4K1RB 1WX7A 4XZ4A 4ZRJA 1WJ4A 2Y5CA 3AU5A 1XO3A 2C9WB 1CMXB 5DPTA 1VRAB 1GPXA 2KJHB 3RFZB 1EWYC 1JWMD 4IW0A 2MA9B 4B0MA 1KH0A 1JW9D 4US9A 1KM7A 2DYBA 3KUCB 3VHTC 2MW5A 2MP2A 4GDLB 3T3OA 2BYFA 3QWZB 1NENB 1N61A 4WQOB 1IGDA 2KMAA 4W9GA 1FXAA 1RAXA 4KKIA 1F52A 1K53A 3PRPB 2BB5A 4KX6B 4EZKA 3T3NA 3FAHA 4JWSC 1C76A 1E6EB 3SD5A 4RM8A 1YN3A 4X57B 5D3IB 4MGKE 1FXIA 1XLPA 2W55A 2MBBB 3I63C 1E90A 1YQ3B 1TY0A 2C7HA 1KJTA 2DZKA 2WXNA 2D2QA 2Z0DB 3WAMA 4C00A 1P1AA 3N30A 3BVMA 4KGSA 5JHAA 4ZRQA 3P4QB 1TIFA 2KNBA 1IYFA 3N1XC 2GI9A 4GDLA 1L0VB 3SFDB 4GXBA 1JQ4A 1SIFA 1D3ZA 5CX3A 4TQ0A 3AV8A 2MRPA 3NUHB 4ICUA 1HA5A 2AL6A 1OQQA 1XXGA 2WQYB 1H8CA 2DZIA 2M1MA 2WDVB 3ZTDA 4PYZA 3PZ7A 4ZRIA 3QAQA 1QQRA 1XLQA 4ZHOA 4MDKE 2W9NA 1TYGB 1F2RI 2JPHA 1WXSA 3RZWC 3P4PB 1PGAA 1T0QC 3HHMA 2LJIA 3QK0A 1N62A 4UDUC 3CIRB 1EWCA 2AQ2B 3VVWB 1V1OA 2WXGA 4P1BC 4MGIE 3GE3C 2KXJA 3PSEB 2BGFA 2NMQA 3P4SB 2SEBD 2ZNVB 3KLSX 3JSVB 3A9JB 3AE2B
chains in the Genus database with same CATH topology
1WWTA 1MHHE 1TY2A 1FEHA 2DWQA 1AW7A 1XLOA 1A70A 3SEBA 4N58A 5D7GA 4US8A 2DYMA 3Q8EA 1FIQA 3E9SA 1UWXA 2DLBA 1FD6A 3AE7B 1KFYB 2BS3B 4TMAB 1NYQA 3HVDA 4NAMA 3IAM1 3BIID 1VDVA 2Z8LA 4NJCA 1D6EC 3U4EG 4ZHPA 3LYYA 1FCCC 4A90A 3KWLA 4XDCA 1TKGA 3OWEB 1I4QA 1F0ZA 2WXQA 2ICIA 4P6VF 3BK1A 2WXIA 1TZOA 1C4AA 2LEKA 1XCQL 5HFYA 3AM9A 4L1BA 3MHZA 1FRRA 1JALA 4JPSA 2IGGA 2MH7A 3E56A 1GB4A 1SJHD 4PT5A 1C78A 1F77A 1V1PB 2IGHA 1ZXHA 3FILB 2M19A 1YNTE 3J9CA 5AUIA 4OW0A 1ZP0B 1WSPA 4YWGG 4LTUA 4YT0B 4HRSA 3EA6A 1KLGD 4AQ7A 3MC0B 1P7FA 2J52A 2BW2A 3URYA 1WGKA 1C9FA 4H2AA 4WIPA 3KQ4A 1E0ZA 1XCTL 2N0SB 2XN9C 4YSZB 4ARCA 2W3RA 2PIAA 2L83A 3AE1B 1MI0A 4A8XC 2INNE 1T3QA 2AQ3B 5D3DA 5AUKA 1NEKB 2RMMA 4JX1C 4RF0A 5FKAC 5T8IA 4RNAA 3VR9B 1ACCA 3CWIA 1TS5A 1SBBB 1SXTA 2B76B 1YJIA 2LHEA 1EU3A 3LB8C 3ZGZA 4IKGA 3BK2A 2JQRB 1ZDXA 2WDRB 1HZ6A 1FNUA 2PVGC 4YTPB 2WU5B 3DWMA 5BYQA 1QOAA 2Q5WD 3Q8CA 1N5WA 2FBWB 1WRIA 5HHDG 3U52E 1UUPA 3V3XA 2LUMA 2N7JA 2JWUA 4MACA 3TUOA 3PO0A 3VQIA 2PTLA 2EKIA 2G9HD 3ZQ4A 1V1PA 1VJKA 1L0YB 2CU3A 3AN1A 3FILA 2LMCA 2MEKA 2ONQA 2RDHA 2RDGA 1DOYA 4FXCA 5C2TB 1TS4A 2WXHA 1RM6C 4YTNB 1HEZE 1EU4A 3W5VB 2MJEA 1LO5D 3P63A 2JYTA 2BYTA 1AWDA 3AH7A 1DGJA 3NVVA 4YSXB 4DXFA 2WXRA 4YTMB 1YN4A 5H8YE 1B9RA 1J7AA 1TJEA 1VLBA 2J53A 1K52A 3P42A 3W1SA 1SIJA 4LK0M 5HG2A 3ZYYX 4ZOHC 2WDQB 1FFUA 2BTEA 1C77A 2YEPB 1N5XA 4M0WA 2GRIA 2WS3B 4D2KA 2WXPA 4HROA 5C3JB 1QOBA 3AE5B 5E6JA 4AS1A 3TEYA 2AX5A 4A55A 4ZRPA 4WH4A 4TQ1A 1PFDA 2OHFA 1IBXB 2WXOA 1BXTA 2LHDA 1KRHA 5H92C 3C8YA 1D5XC 3ZJVA 1M4VA 3EUB2 3P1MA 3AE9B 1I4PA 2KDMA 4J3OD 1QOFA 3IAS1 3SR6A 2INPE 1L5PA 2HTME 3NVWA 2JSVX 1FMAD 4JE3B 1E7PB 1ZDVA 1CJEA 1XLNA 3R2IA 4WAFA 1AYFA 5TSSA 1GOZA 1SSNA 2JYEA 4OVZA 4ARIA 3B2GA 5JXVA 4OZBA 2W82A 2XNAC 5G5HA 2EELA 1CK1A 4WWMA 2W3SA 3GB1A 1J7CA 1VZ6A 5BMGA 1I4XA 4NZLB 1PGXA 4C56C 4KGRA 1P7EA 2LFIA 3U7ZA 3W9CB 4RGTA 1FNVA 2SAKA 3MFGA 1UNSA 2J42A 2L52A 1JWUD 4OZCA 2K22A 3ZJUA 1JCKB 1KF6B 2ZW1A 4XE0A 4O1NA 2KACA 2KAJA 5BYSA 3VRAB 4GDKB 3AECB 2KQ4X 3R2TA 4TSSA 2N9LA 2ZW0A 1JMLA 3ABVB 4GLSC 3TEXA 2V0GA 1FRDA 2NTSA 3AEEB 1I4HA 2KMMA 4P16A 4EE2A 4YSYB 1UGJA 1QILA 2M56B 1WXQA 2NTTA 3AEGB 3MP9A 5EE3A 3AE6B 1T5XD 2BS4B 2R61A 3AE8B 2JZPA 3EGRA 3N9YC 3NZ3A 1KTKA 2BBCA 1IBXA 3TEZA 1K51A 1V97A 2J4XA 2WXFA 4C7YA 1SE4A 2PW9A 1HQRD 1J7BA 2IDYA 5FK9C 2BT6A 2WXLA 1QLBB 2YEPF 3GP7A 2V3NA 4DQOC 2IGDA 1VZ7A 5BMIA 1SB3C 4HKZE 3L4PA 1VR9A 3U2SC 3IT6B 4WURA 3SFEB 2QIEB 1SJED 1YN5A 2VZKB 3Q8AA 3BYYB 3Q8FA 2E3TA 3VRBB 4IOIE 3AB5A 2TSSA 2E6XA 4RH6A 4XWWA 2MJDA 4C80A 2MJ3A 3H8HA 2QILA 1Q10A 2L1AA 3AE3B 1L4ZB 2FE8A 3ZJTA 1PDXA 1RFKA 1Y56A 2GB1A 4REZA 1C4PA 2WXJA 5EE1A 4YXDB 3TSSA 3NS1A 1OQRA 4L23A 3AE4B 1WYGA 2IPKD 2PKOA 1OFFA 1PUTA 4WQMA 2H89B 1CZPA 2LGIA 4JWUC 1R7SA 1MHXA 2L32A 4DXGA 1RYJA 2QJLA 1STEA 5FR3A 3W5UB 3AEFB 1FFVA 5MPOA 4XWTA 1ET6A 2DBYA 4USAA 1I4GA 2Y5CA 2G1EA 3O13A 1XO3A 2DYOA 5HI1A 2WXMA 1ZPSA 1VRAB 1GPXA 1V8CA 2FUG1 1JROA 1MPEA 3HUIA 3RFZB 4IDIA 4OZAA 1DYQA 1EWYC 1ET9A 1I7HA 2CJOA 3GS2A 1JWMD 3MJ5A 2W54A 2HDEA 3P4RB 4N6EB 5EE0A 2BB6A 1ZUD2 4B0MA 1FCLA 1FM0D 5BYRA 1KH0A 1DOXA 1JW9D 1JRPA 4US9A 5I4DA 2H88B 1N60A 4A9AA 4GDLB 3T3OA 1NENB 1HXYD 1N61A 1AN8A 1I4RA 4RFBA 4L2YA 2BS2B 1RWSA 1T6BX 1DOIA 1IGDA 1NI3A 3AMZA 1FXAA 1NVID 4RF1A 4KKIA 1IGCA 1MVKA 1K53A 2D5GA 3HVZA 2BB5A 1B1ZA 1YQ4B 4ITKA 4KX6B 4RCOA 2QEJC 2V3PA 3Q8BA 3T3NA 3FAHA 4Q2JA 3B2FA 2JU6X 3Q69A 4JWSC 1C76A 1E6EB 1JWAD 3AEBB 2CJNA 1E10A 1YN3A 2WP9B 2WXKA 1E9MA 2PLPA 5D3IB 1HZ5A 2QMTA 3BVZA 1QKZA 2ACZB 3HRDD 3W2DA 1FO4A 1FXIA 1XLPA 2VZKD 1KLUD 2W55A 5EE9A 2JX5A 5BMHA 4LLGM 1ZOYB 3NVZA 4RGNA 1D4BA 3BWUD 1YQ3B 1TY0A 2K9XA 2WXNA 1SEBD 2K3UA 2Y3AA 4MT5A 1L4DB 1QT9A 1L6VA 1PGBA 1QOGA 2M0AA 4B0EA 2I38A 4RGMA 4N59A 3NRZA 1ROEA 1K50A 1ZXIA 1D5ZC 3BVMA 2QSDA 2PVOD 4KGSA 3IT4B 1IUEA 2WLBA 2K5PA 1D5MC 1ESFA 3P4QB 4ZRQA 1CQVA 2IJ0A 1SF0A 3AEAB 1F2RC 4MM3B 2GI9A 5LNK1 3BVGA 4KGTA 4OHJA 1L0VB 3SFDB 4ZYSA 1XF5L 2RPVA 4A6QA 1JQ4A 4CQNA 3DWGC 4HKQA 1L6UA 3WCQA 1EM7A 1XEEA 2ON8A 4XDDA 4TQ0A 1SE2A 3IXSA 2KWDA 3AV8A 3NUHB 3B9JA 2WU2B 2AQ1B 1HA5A 2N9KA 2K0PA 1JWSD 3UI3A 1FNWA 3ETRA 3VR8B 1OQQA 1NYRA 4NAWB 3NVYA 2I2YA 4HJGE 1XXGA 2WQYB 5GXGB 3BYTB 2WDVB 3V05A 1C79A 3PZ7A 1TS2A 1YMHE 1SE3A 1ENFA 1QQRA 4MH8A 1XLQA 2KN4A 1L0XB 2X38A 4ZHOA 1GB1A 1VZ8A 4RGOS 1UWMA 3TEWA 1GAQB 3RPFC 3PZ8A 1TYGB 1F2RI 3AEDB 3P4PB 2JXTA 1PGAA 3R8BA 2LJIA 1PYWD 1N62A 4UDUC 1TKEA 1ZE3D 4HEA1 4R3DA 3CIRB 2Y5PA 1EWCA 2AQ2B 1V1OA 4C7ZA 2WXGA 2OEDA 2V4IB 3FC4A 3I57A 4KKJA 2PMVA 2WNMA 1TS3A 5G5GA 1QF6A 3KWVA 3LXFA 1TKYA 1JWBD 1N63A 1BUIC 2NMQA 3P4SB 1C4CA 2SEBD 1BMLC 3KLSX 3I9V1 3BZDB 1YJJA 3AE2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEB B;  1E6E B;  1JWA D;  2CJN A;  1E10 A;  1WWT A;  1DOY A;  1J7B A;  4FXC A;  5C2T B;  2DWQ A;  2BT6 A;  2WP9 B;  1RM6 C;  1XLO A;  1A70 A;  1E9M A;  1QLB B;  4YTN B;  4N58 A;  3W5V B;  2MJE A;  3P63 A;  4US8 A;  2ACZ B;  3HRD D;  1AWD A;  1FIQ A;  1SB3 C;  3AH7 A;  1DGJ A;  3L4P A;  1FXI A;  3NVV A;  1XLP A;  4YSX B;  1FO4 A;  2W55 A;  3AE7 B;  2JX5 A;  5EE9 A;  1KFY B;  3SFE B;  2BS3 B;  5H8Y E;  2QIE B;  1ZOY B;  3NVZ A;  4YTM B;  1J7A A;  1TJE A;  1B9R A;  1VLB A;  1YQ3 B;  1NYQ A;  1SIJ A;  2E3T A;  3VRB B;  2K9X A;  3BII D;  1VDV A;  4ZHP A;  3ZYY X;  4ZOH C;  3AB5 A;  2WDQ B;  1FFU A;  3KWL A;  2MJD A;  4C80 A;  1N5X A;  1TKG A;  1QT9 A;  2MJ3 A;  1L6V A;  2WS3 B;  5C3J B;  4HRO A;  1F0Z A;  1QOG A;  3AE3 B;  1QOB A;  3AE5 B;  4P6V F;  4N59 A;  3NRZ A;  1ROE A;  2AX5 A;  2LEK A;  1ZXI A;  1PDX A;  1RFK A;  3AM9 A;  5EE1 A;  4YXD B;  1FRR A;  1JAL A;  2PVO D;  1PFD A;  3NS1 A;  2MH7 A;  1IUE A;  1OQR A;  2WLB A;  2OHF A;  3AE4 B;  1WYG A;  2K5P A;  3P4Q B;  1KRH A;  1SF0 A;  3AEA B;  2PKO A;  5H92 C;  1OFF A;  1PUT A;  2M19 A;  3EUB 2;  2H89 B;  1L0V B;  3P1M A;  4WQM A;  5AUI A;  1CZP A;  3AE9 B;  4JWU C;  3SFD B;  1R7S A;  1ZP0 B;  1JQ4 A;  1QOF A;  3DWG C;  3SR6 A;  1L5P A;  1L6U A;  3WCQ A;  1RYJ A;  2HTM E;  2QJL A;  4LTU A;  3NVW A;  1FMA D;  3AV8 A;  3AEF B;  1E7P B;  1V97 A;  1FFV A;  3W5U B;  5MPO A;  4YT0 B;  1CJE A;  2DBY A;  3B9J A;  1XLN A;  2WU2 B;  4HRS A;  4USA A;  1AYF A;  2Y5C A;  2G1E A;  3ETR A;  3VR8 B;  1XO3 A;  1OQQ A;  1NYR A;  3B2G A;  1WGK A;  3NVY A;  1GPX A;  1V8C A;  5G5H A;  2WQY B;  5GXG B;  1JRO A;  2WDV B;  3HUI A;  4WWM A;  2W3S A;  2N0S B;  1E0Z A;  4IDI A;  1J7C A;  1EWY C;  1I7H A;  4YSZ B;  2W3R A;  2PIA A;  3W9C B;  2CJO A;  2L83 A;  1XLQ A;  2W54 A;  3AE1 B;  3P4R B;  4ZHO A;  4N6E B;  5EE0 A;  1ZUD 2;  2L52 A;  1T3Q A;  2K22 A;  1FM0 D;  1UWM A;  1KF6 B;  5AUK A;  1DOX A;  1NEK B;  2KAJ A;  1GAQ B;  4JX1 C;  3RPF C;  1JW9 D;  1JRP A;  1TYG B;  3AED B;  2H88 B;  4US9 A;  3VRA B;  3P4P B;  3VR9 B;  3AEC B;  3CWI A;  1N60 A;  2B76 B;  4A9A A;  1YJI A;  1N62 A;  3LB8 C;  1TKE A;  3CIR B;  3ABV B;  1NEN B;  2JQR B;  1FRD A;  1N61 A;  2WDR B;  3AEE B;  2PVG C;  4YTP B;  4C7Z A;  2KMM A;  3FC4 A;  2WU5 B;  2BS2 B;  1RWS A;  1DOI A;  3DWM A;  3AN1 A;  4YSY B;  1QOA A;  1NI3 A;  3AMZ A;  2M56 B;  2Q5W D;  1N5W A;  2FBW B;  1FXA A;  1NVI D;  1WRI A;  1WXQ A;  3AEG B;  5EE3 A;  3AE6 B;  2BS4 B;  5G5G A;  1QF6 A;  3PO0 A;  3AE8 B;  3LXF A;  1TKY A;  3HVZ A;  1JWB D;  2EKI A;  1YQ4 B;  1N63 A;  4ITK A;  3P4S B;  4KX6 B;  1YJJ A;  3FAH A;  1VJK A;  3B2F A;  2CU3 A;  4C7Y A;  3AE2 B;  4JWS C; 
#chains in the Genus database with same CATH topology
 1AW7 A;  4N58 A;  1WF9 A;  2DYM A;  3TIX A;  2BWF A;  2D11 A;  2JXX A;  5LLI A;  3TCA A;  1WIA A;  4KDL B;  4B9K A;  3EFU A;  3BII D;  1VDV A;  4ZHP A;  1WX9 A;  1KOT A;  4A90 A;  5DPW A;  2G4S A;  1TKG A;  2Z59 B;  1WGY A;  3UQB A;  2A5U A;  3RNB C;  1C4A A;  4EUT A;  1FRR A;  2MH7 A;  1SJH D;  4K7S A;  2M19 A;  2JF5 A;  3J9C A;  2LGY A;  1WSP A;  2ZEQ A;  2NS5 A;  4LTU A;  2KX0 A;  4YT0 B;  4B6W A;  1YX5 B;  3V6C B;  2WGS A;  1P7F A;  2J52 A;  3KUD B;  2BW2 A;  3JSV A;  3URY A;  4W9C A;  3A9J A;  1UD7 A;  2N0S B;  4YSZ B;  2W3R A;  2ZZP B;  2PIA A;  4M0W B;  1OEY J;  3AE1 B;  4PS3 A;  2KLC A;  2INN E;  3OAW A;  3AI5 A;  2RDB C;  4WWN A;  2KWC A;  3N20 C;  3DHI C;  3VR9 B;  4IWO A;  2BVC A;  1WYW B;  2B76 B;  1SXT A;  1YJI A;  2LHE A;  1HE8 A;  5AZH A;  3BK2 A;  1ZDX A;  2J0J A;  4DHZ B;  2IO3 B;  4NJ7 A;  2FBW B;  3U52 E;  2LUM A;  3TUO A;  2UWQ A;  3I3T B;  4II3 B;  3CMM B;  1VJK A;  4I6P A;  3ML8 A;  2KJR A;  4J6I A;  5C2T B;  2WXH A;  2BWE S;  1HEZ E;  3D32 A;  4DHZ E;  2MJE A;  2K6D B;  5CHW A;  4FAD A;  2BYT A;  3AH7 A;  1I35 A;  3KUZ A;  1J7A A;  3W1S A;  2NR2 A;  3RZF A;  4ZOH C;  1FFU A;  3PPA A;  4M0W A;  2WS3 B;  4HRO A;  1C1Y B;  5E6J A;  3T8M A;  1WR1 A;  3MC8 A;  1PFD A;  4TQ1 A;  2WHI A;  3DDC B;  2V3S A;  1RFA A;  2LHD A;  3L10 B;  1Q5W B;  3C8Y A;  1D5X C;  5H92 C;  1WXA A;  5KHO A;  3P1M A;  4LDT B;  4LNN A;  3DBL B;  4IC7 B;  3NY5 A;  3SR6 A;  2HJ1 A;  3RNC C;  3GZN B;  1P9D U;  3PHX B;  1XLN A;  3R2I A;  4WAF A;  2CHZ A;  4KSK C;  2FIF A;  3DBS A;  3B2G A;  2EKE C;  5JXV A;  4OZB A;  2W82 A;  3LJ3 A;  3WAP A;  2L05 A;  3L0W B;  4AJY B;  3GB1 A;  1TZ1 A;  2J7Q B;  4FN2 A;  3W9C B;  4RGT A;  3MFG A;  4IG7 B;  4DDG D;  4O1N A;  3PTF C;  4E74 A;  1XT9 B;  2DX5 B;  4TSS A;  4ANU A;  3B0A A;  4GLS C;  4EZJ A;  1FRD A;  3AEE B;  4GSW A;  1I4H A;  4EE2 A;  4S0R A;  2BPS A;  2IO2 B;  5C1Z A;  1UGJ A;  3W1S C;  1GNU A;  3B08 A;  1K51 A;  1V97 A;  2J4X A;  1E8Z A;  2KJ6 A;  4BKT A;  1M94 A;  4DQO C;  5IOI A;  2D10 A;  5BMI A;  3DBH B;  1WZ3 A;  3L4P A;  4ZYN A;  3ZTC A;  2VRR B;  3V6E B;  3U2S C;  4WUR A;  1SJE D;  1F9J A;  3RNF C;  2VH1 A;  2K8B A;  4IOI E;  4MSQ B;  2MJD A;  4LNK A;  2LGD A;  1WI0 A;  3H8H A;  3Q3F A;  4W9D A;  3AE3 B;  3Q14 C;  3ZJT A;  1PDX A;  1Y56 A;  5EE1 A;  4REZ A;  4YXD B;  1WRD B;  3NS1 A;  1ZGU B;  1UBI A;  3QC8 B;  4XYC A;  1OFF A;  1PUT A;  4HK2 A;  1E7V A;  4EZL A;  2H89 B;  1CZP A;  1Z5S B;  1MHX A;  1WFY A;  3DVG X;  1RYJ A;  4A20 A;  5FR3 A;  1FFV A;  5MPO A;  3WA0 A;  4USA A;  2UU7 A;  3DBH I;  2DYO A;  2KDB A;  5E6N A;  4EEW A;  4LJP B;  3ZDT A;  4K3C A;  2LVP A;  4OZA A;  3GS2 A;  2W54 A;  4N6E B;  1ZUD 2;  1FCL A;  1FM0 D;  2KTF A;  2JRH A;  4BKG A;  4G0N B;  3DPD A;  3ZNI D;  4E71 A;  4P7I A;  2FCS A;  3X0W A;  3DBR I;  3NG0 A;  1YD8 U;  4DHJ B;  4L2Y A;  1WE7 A;  4HPP A;  2HE7 A;  1NI3 A;  3QCA A;  1IGC A;  3C19 A;  4DBG A;  2WWZ A;  3ZVV A;  2MWS B;  2V3P A;  2JU6 X;  3Q69 A;  3DQV A;  2MCN B;  1T0Y A;  2PLP A;  1K8R B;  4M8M A;  1QKZ A;  2ACZ B;  2DZJ A;  2JWZ A;  2VZK D;  2LI5 A;  4IM0 A;  3NVZ A;  1D4B A;  1Y8R C;  2FAZ A;  2MX2 A;  3VXW A;  5HKH A;  4RMA A;  2K25 A;  2KFK A;  2NCN A;  5KHQ A;  2KVZ A;  1K50 A;  3Q6B A;  1D5Z C;  3ZLZ A;  2PVO D;  3IT4 B;  4FLH A;  1GC7 A;  5CTR C;  4WWO A;  4GIV A;  1ESF A;  2IJ0 A;  1A5R A;  1OGW A;  4MM3 B;  1RRB A;  3A33 B;  3BVG A;  5L83 A;  4OHJ A;  3EC8 A;  4NQK E;  4CQN A;  5EDS A;  2MP2 B;  3WCQ A;  1XEE A;  1SE2 A;  3APC A;  3CST A;  3ZDM C;  2N9K A;  1AAR A;  3UI3 A;  3ETR A;  3ZUN A;  1NYR A;  2D3A A;  2I2Y A;  3VTW A;  3N3K B;  3BYT B;  3V05 A;  1C79 A;  4JIO U;  3PHW B;  1SE3 A;  1ENF A;  4MH8 A;  1L0X B;  4RM9 A;  1GB1 A;  3ZW3 A;  1UWM A;  1GAQ B;  1GJZ A;  1WH3 A;  2JXT A;  1PQS A;  1PYW D;  5IP4 D;  3AXC A;  2QCZ A;  2KVR A;  1L2N A;  4AWJ A;  2KQ7 A;  3V61 A;  2FNJ B;  2V9H A;  3I57 A;  4KKJ A;  2GOW A;  1EF5 A;  2PE6 B;  1R4N B;  2L7R A;  3SHQ A;  1QF6 A;  3LXF A;  1WJ6 A;  1BUI C;  1C4C A;  2CS4 A;  1T0S C;  1YJJ A;  3WAO A;  4MM3 A;  4WJQ A;  3SU8 X;  2N9X A;  1TY2 A;  1FEH A;  2KOX A;  3W1Y A;  1A70 A;  3SEB A;  4US8 A;  1FD6 A;  1KFY B;  2N4F A;  3HVD A;  4NAM A;  2HJ8 A;  4HCP B;  1FCC C;  3A9K B;  1F1H A;  2BYV E;  4XDC A;  5C23 A;  3WAL A;  3OWE B;  1I4Q A;  5BO4 B;  2WXQ A;  4P6V F;  3BK1 A;  1XCQ L;  1GC6 A;  4L1B A;  1JAL A;  1R4N I;  3E56 A;  1TTN A;  4PT5 A;  1V1P B;  2IGH A;  3A4R A;  2KMC A;  3IG3 A;  1WMH A;  1YNT E;  1VD2 A;  2IZV B;  1ZP0 B;  4NY0 A;  5IA7 A;  3H7P B;  4YWG G;  1NDD A;  2QHO A;  3EA6 A;  4HRS A;  3MC0 B;  1UGM A;  2M8S A;  2HTH A;  4HWI B;  2AL3 A;  2KLG A;  1E0Z A;  2XN9 C;  5E6P A;  4ARC A;  3L08 A;  1GUA B;  2L83 A;  2OOB B;  3MHS D;  2RSU A;  1T3Q A;  5AUK A;  5FKA C;  3Q3J A;  3DHG C;  3RT3 B;  3R66 C;  4XX5 A;  1SBB B;  4OVV A;  4F8C B;  3SDL C;  3LB8 C;  3ZGZ A;  4IKG A;  2ZCC A;  2JQR B;  3A9K A;  2KFJ A;  4CO7 A;  2PVG C;  3H7S A;  2WU5 B;  4KVG B;  1QOA A;  3EHV A;  2Q5W D;  5G55 A;  2KT7 A;  2JWU A;  2NBW B;  4WJN A;  1Z2M A;  2LWP A;  2EKI A;  3ZQ4 A;  4XC2 A;  4BOS C;  1V1P A;  4MJS B;  1L0Y B;  2CU3 A;  2LMC A;  5IKC M;  1J0G A;  5D6J B;  1DOY A;  4FXC A;  3R7Q A;  4YTN B;  1EU4 A;  3H7P A;  3P63 A;  2JYT A;  1DGJ A;  3ZO5 B;  4W9E A;  2PPH A;  2KWU B;  1YN4 A;  5H8Y E;  3PLU A;  2J53 A;  1IP9 A;  4BAX A;  5DPR A;  3S2A A;  1UBQ A;  4G11 A;  2WDQ B;  1C77 A;  1Q1O A;  2YEP B;  1ISN A;  4ACF A;  4BBN F;  4D2K A;  3ZRF A;  3RD2 A;  4AS1 A;  3TEY A;  3NJT A;  4WH4 A;  3QQ8 B;  1IBX B;  2WXO A;  2KHW B;  1KRH A;  4W9I A;  3NZU A;  4FHJ A;  1M4V A;  4WJO A;  3EUB 2;  1YOV B;  4J3O D;  1QOF A;  1S3S G;  2HTM E;  4JE3 B;  5IN7 A;  2EMT A;  1SSN A;  2YLM A;  1TBE A;  4MJS A;  2XNA C;  2LVO A;  3Q3N C;  2D3B A;  1J7C A;  2LUE A;  4C56 C;  4NZL B;  4F1S A;  4B95 A;  4KGR A;  3U7Z A;  2SAK A;  1UNS A;  1JWU D;  4OZC A;  2K22 A;  1JCK B;  2ZW1 A;  4XE0 A;  4BKS A;  3AEC B;  3UF8 A;  2KQ4 X;  2LGS A;  4BBN C;  3K9P B;  3CF6 E;  5J18 A;  3ONS A;  1OTR B;  2M56 B;  1QIL A;  3AEG B;  1T5X D;  3AE8 B;  3OJ3 A;  3N9Y C;  3NZ3 A;  1IBX A;  3VAW A;  5GMV A;  3TEZ A;  4C7Y A;  2O2V B;  1J7B A;  2IDY A;  2BT6 A;  1QLB B;  2YEP F;  3GP7 A;  1VZ7 A;  4HKZ E;  1MG8 A;  2Y5B B;  3IT6 B;  2QIE B;  4ANW A;  3N32 A;  3Q8A A;  3Q8F A;  2Z0E B;  3H9D A;  2L0T A;  4EFO A;  2L1A A;  2IND C;  3DHH C;  1WY8 A;  5D2M B;  2RR9 A;  1C4P A;  1C3T A;  2AEH A;  3TSS A;  3A1Q B;  5TR5 A;  5LXI B;  2IPK D;  2WYQ A;  4FUL A;  4HCN B;  2KDE B;  2LGI A;  2L32 A;  3PRE A;  2KDI A;  4DWF A;  1STE A;  2OJR A;  2UYZ B;  1ET6 A;  2C5L C;  3L16 A;  4NQL B;  2KC2 A;  3O13 A;  2WXM A;  1EO6 A;  4KZ0 A;  1RLF A;  1IPG A;  2C7M B;  1V8C A;  2ZNV C;  1JRO A;  1MPE A;  2O2V A;  3HUI A;  4IDI A;  3MJ5 A;  3VUW A;  2HDE A;  5EE0 A;  4PYU A;  2BB6 A;  3EFC A;  5BYR A;  3ZNH B;  2KZR A;  4AJW A;  1DOX A;  3AUL A;  3APD A;  3QA8 A;  5LXH A;  2J0M A;  1N60 A;  4A9A A;  2DAF A;  3L17 A;  1R4M B;  1AN8 A;  1I4R A;  2N1V A;  3BIN A;  3OJ4 B;  3LDZ E;  1TGZ B;  4RFB A;  1T6B X;  1DOI A;  2IO1 B;  2MSE D;  3PVL A;  4S17 A;  4F7Z A;  2D5G A;  4IUM B;  3A1Q A;  3RUI B;  1YQ4 B;  4ITK A;  2JUO A;  2L8J A;  4RCO A;  3Q8B A;  3U30 A;  4Q2J A;  4MH0 E;  3AEB B;  1E10 A;  2WP9 B;  1HZ5 A;  2QMT A;  3HK0 A;  3HRD D;  3W2D A;  3UIN B;  2LJ5 A;  1LFD A;  1KLU D;  4FA6 A;  5EE9 A;  2JX5 A;  3PZD A;  2LZ6 A;  4BFR A;  3DBL I;  4RGN A;  3BWU D;  2JZZ A;  2K9X A;  3OLM D;  1SEB D;  3GZN I;  2Y3A A;  4MT5 A;  3HM6 X;  1L4D B;  1QT9 A;  1L6V A;  3RI7 C;  1PGB A;  1R4M I;  1QOG A;  3VUX A;  4RGM A;  4N59 A;  2XEW A;  3NRZ A;  2LRU A;  3U7D A;  2ZCB A;  1ZXI A;  2QSD A;  1IUE A;  2WLB A;  1UH6 A;  3AU4 A;  1CQV A;  1SF0 A;  3AEA B;  4ZYS A;  4A6Q A;  2J0K A;  3DWG C;  3MTN B;  1L6U A;  5JH5 C;  2ON8 A;  4XDD A;  3IXS A;  3B9J A;  2WU2 B;  2N9E B;  3VR8 B;  3QHT A;  4JGH B;  3RCZ A;  4HJG E;  5IAA C;  1KLV A;  4GU2 A;  4K81 A;  1TS2 A;  1YMH E;  3HIZ A;  2N9P C;  3RMK C;  2CHW A;  2X38 A;  2K39 A;  3NS8 A;  3PZ8 A;  1V86 A;  1Q0W B;  3VFK A;  5JZE B;  4N9F 4;  5DCN A;  3H6N A;  1TKE A;  1YJ1 A;  4R3D A;  4DHJ D;  1U4A A;  2IY0 B;  2Y5P A;  3I5J C;  4C7Z A;  2OED A;  3FC4 A;  5CHV C;  2ZPY A;  5J17 A;  2BYE A;  2PMV A;  2WNM A;  1TS3 A;  3KWV A;  1TKY A;  4MEM A;  2KFK B;  3Q2A C;  1JWB D;  3I9V 1;  3BZD B;  4OVU A;  2EMS A;  4JLC A;  1WWT A;  1MHH E;  4ZRK A;  2DWQ A;  3KH0 A;  4LNI A;  1XQQ A;  3ZIM A;  1P3Q U;  1FIQ A;  3Q8E A;  1QZE A;  4ANV A;  2PJH A;  2KDF B;  4GB9 A;  4TMA B;  3IAM 1;  3BY4 B;  3U4E G;  2Z8L A;  1D6E C;  3PT2 B;  1LQB A;  1F0Z A;  5J2R A;  2WXI A;  5HFY A;  4JPS A;  2IGG A;  1GB4 A;  1J8C A;  1ZKH A;  4CHK A;  1WGD A;  4IWQ A;  1G6J A;  5AUI A;  2GBJ A;  4OW0 A;  2R2O A;  4PK1 A;  1N6Z A;  4LJO B;  1E5W A;  4WAA A;  2PEA A;  4W9L A;  3UIP B;  3TBL D;  3APF A;  3OG5 A;  1C9F A;  4WIP A;  3JYU A;  3KQ4 A;  1XCT L;  2PE9 A;  2CKH B;  4A8X C;  3ZKJ C;  2AQ3 B;  5D3D A;  2GBM A;  1NEK B;  2RMM A;  4RF0 A;  4YL8 A;  2KN5 A;  4HXD A;  5T8I A;  4RNA A;  4K7W A;  3CWI A;  1TS5 A;  2O6V B;  1UEL A;  2WDT B;  2XBB C;  1WXM A;  1EU3 A;  2N7D A;  2FCQ A;  2WDR B;  1FNU A;  3C0R B;  4YTP B;  2JZ3 B;  4ASW C;  4M8N A;  2BKF A;  1WRI A;  5HHD G;  3V3X A;  2N7J A;  3K9O B;  1I42 A;  2KC1 A;  3PO0 A;  3VQI A;  3PV1 A;  2V4L A;  2LGX A;  2MEK A;  2RDH A;  1TS4 A;  3TMP B;  3W5V B;  1LO5 D;  2QC8 A;  1WMH B;  1NI2 A;  3QAR A;  1AWD A;  2CU1 A;  3NVV A;  1V6E A;  1NBF C;  2MBO A;  3HM3 A;  4DXF A;  1VLB A;  3FKY A;  1SIJ A;  4KIK A;  5HG2 A;  3ZYY X;  2LXA A;  4WWP A;  1FXT B;  1N5X A;  4K3B A;  2GRI A;  5C3J B;  2V1Y A;  2WXP A;  2LVQ A;  1QOB A;  3TJP A;  4TKN A;  4A55 A;  2VH2 A;  2AWT A;  3DOW A;  2O6V A;  3ZJV A;  3VDZ A;  5CHF A;  2KDM A;  1HTO A;  2KQS A;  1MG4 A;  3IAS 1;  4IWP A;  3NHE B;  1L5P A;  2I1J A;  1WXV A;  3NVW A;  2JSV X;  1FMA D;  1E8Y A;  2LAS A;  2ZPN A;  2OJW A;  1ZDV A;  1CJE A;  1AYF A;  3PS6 A;  1GOZ A;  1WE6 A;  4OVZ A;  4A3O A;  1V2Y A;  2EEL A;  1CK1 A;  4WWM A;  2KO3 A;  5AEK B;  1VZ6 A;  1I4X A;  1PGX A;  1P7E A;  2LFI A;  2ZVN A;  1FNV A;  3CSF A;  2J42 A;  2L52 A;  3M95 A;  4FHK A;  1KF6 B;  3ALB A;  2KAC A;  5BYS A;  3MC9 A;  2M4N A;  3VH3 B;  4HDQ A;  1T0R C;  2ZW0 A;  3JW0 X;  1JML A;  3TEX A;  2V0G A;  1WM3 A;  3PLV A;  4P16 A;  4YSY B;  5EE3 A;  4DXA B;  4C4V B;  2L0F A;  3AE6 B;  2BS4 B;  2JZP A;  1KTK A;  2M17 A;  1WZ0 A;  4FJV B;  1WGH A;  5FK9 C;  4P1C C;  2V3N A;  3X23 A;  2IGD A;  4BKS D;  2D07 B;  4AOF A;  2B3A A;  2JT4 B;  3SFE B;  3U8Z A;  1SGH A;  1YN5 A;  3BYY B;  2ASQ A;  3VRB B;  4ZDV A;  4GMV A;  4IM3 A;  4NJ6 A;  1J19 A;  2TSS A;  4RH6 A;  2GBN A;  2MJ3 A;  2IYD B;  1L4Z B;  2FE8 A;  3L54 A;  4M02 A;  2WXJ A;  4MSM B;  4L23 A;  2BF8 B;  2PKO A;  4M01 A;  4IM2 A;  4WQM A;  4JWU C;  4FJY A;  4DXG A;  2C60 A;  1EF1 A;  4HPL B;  4XWT A;  2DBY A;  4C4V A;  1I4G A;  1E7U A;  2G1E A;  5HI1 A;  3GE8 C;  1ZPS A;  4GN1 A;  3ZNZ B;  4LNO A;  1FPY A;  2FUG 1;  3EEC A;  1DYQ A;  1P98 A;  4KDI C;  1ET9 A;  1I7H A;  2CJO A;  4TV3 A;  3P4R B;  4HDO A;  3KW5 B;  1LXD A;  2HD5 B;  2ZJD A;  5I4D A;  1JRP A;  2H88 B;  1HXY D;  2NVU I;  3QIJ A;  3PRM B;  2BS2 B;  1RWS A;  4XGA B;  4PS7 A;  3AMZ A;  1NVI D;  4RF1 A;  1MVK A;  3KYD D;  4A3P A;  3HVZ A;  5AZG A;  1B1Z A;  2GBK A;  2QEJ C;  1EUV B;  3B1L X;  3VTV A;  3B2F A;  2DHZ A;  1JWA D;  2CJN A;  4W9F A;  2WX0 A;  2WXK A;  1E9M A;  4HPM B;  3BVZ A;  1FO4 A;  3WAN A;  1MJD A;  1BT0 A;  2REX A;  5BMH A;  1VCB A;  1ZOY B;  2GMI C;  4LLG M;  2LRW A;  2MBE A;  5D94 A;  2RGF A;  2K3U A;  4MGY E;  2M0A A;  1V49 A;  4B0E A;  2I38 A;  4M00 A;  1ROE A;  4W9K A;  3M3J A;  4URK A;  3ZXV A;  3UGB B;  5G2N A;  2K5P A;  1D5M C;  1XD3 B;  1F2R C;  3ML9 A;  5LNK 1;  4KGT A;  2L00 B;  1XF5 L;  2RPV A;  2KKC A;  1OEY A;  2LD9 A;  1V5O A;  4HKQ A;  1EM7 A;  3UIO B;  4BZA A;  2KWD A;  2MHJ A;  2AQ1 B;  1YX6 B;  2K0P A;  1JWS D;  2KWV B;  1FNW A;  4PS8 A;  2N7E A;  1HTQ A;  4NAW B;  2KD0 A;  3NVY A;  5GXG B;  4LDT D;  1L7Y A;  3ENE A;  2KN4 A;  4II2 B;  2MBH A;  1VZ8 A;  5FR6 A;  1E8W A;  4RGO S;  1WM2 A;  3TEW A;  3RPF C;  3AED B;  3H1U A;  3PRZ A;  2CR5 A;  3R8B A;  3V60 A;  1ZE3 D;  4HEA 1;  4FJZ A;  4G3X B;  4I6N B;  4K7U A;  4JQW C;  2KTR B;  2C7N B;  2V4I B;  4EOY A;  4EKU A;  3M62 B;  2FUH B;  2YVC A;  5G5G A;  2FCN A;  3R7R A;  1E8X A;  3N1Y C;  1N63 A;  4WJP A;  1BML C;  3A4S C;  4W9J A;  3IFW B;  3ZRC A;  1XLO A;  5D7G A;  2G3Q B;  3RUL A;  2N1W A;  1WGG A;  3E9S A;  1UWX A;  2DLB A;  4GGQ A;  3AE7 B;  2BS3 B;  1WR6 E;  1NYQ A;  4KV2 A;  4NAW A;  4NJC A;  1X1M A;  3LYY A;  2K1F A;  1WX8 A;  3KWL A;  2JRI B;  2ICI A;  4DK5 A;  1TZO A;  4JL9 A;  2LEK A;  1UZX B;  3AM9 A;  3MHZ A;  2GBR A;  2X8X X;  2G45 B;  1C78 A;  1F77 A;  4BVU C;  3KVF B;  1ZXH A;  3FIL B;  2RPQ A;  2KTR A;  2LXC A;  3NZS A;  3KYC D;  1V9J A;  3O65 B;  1KLG D;  4FBJ B;  4AQ7 A;  2DEN B;  1WGK A;  4H2A A;  4MGZ E;  2MBQ A;  2NBV B;  3Q3M C;  3DVN V;  1LGR A;  4NPN A;  1MI0 A;  2KAN A;  4JX1 C;  3DVN U;  3RNA C;  3ECI A;  2A4Z A;  1ACC A;  2JY6 A;  2K8H A;  4BOZ B;  2DZM A;  2DNF A;  2D3C A;  1ZW7 A;  1HZ6 A;  3DVG Y;  1YIW A;  2NPT B;  3DWM A;  5BYQ A;  2NBU A;  3Q8C A;  1N5W A;  3T9L A;  1UUP A;  2KK8 A;  4MAC A;  3RYT A;  2PTL A;  2G9H D;  3ZNG C;  1SE9 A;  1MFW A;  2BQQ A;  3AN1 A;  3FIL A;  4W9H A;  2ONQ A;  2RDG A;  4HLE A;  1YQB A;  2FID A;  1RM6 C;  3V62 A;  3Q3O C;  3DBR B;  4YSX B;  2WXR A;  4AP4 C;  3PGE A;  3TL5 A;  1OQY A;  4YTM B;  1B9R A;  1TJE A;  2XK5 B;  1K52 A;  3QX1 A;  3P42 A;  4HVB A;  4LK0 M;  2G4D B;  2BTE A;  4ICV A;  3WIM A;  3AE5 B;  3RNG C;  3P2B A;  2AX5 A;  4ZRP A;  4NNJ B;  3NOB A;  2OHF A;  1BXT A;  1V5T A;  1P0R A;  3R3M A;  3RN9 C;  4DDI D;  3AE9 B;  1I4P A;  2AYO B;  2NPT A;  3M63 B;  2INP E;  5JHB A;  1E7P B;  2IBI B;  2L76 A;  5TSS A;  1S1Q B;  1TT5 B;  3DCG A;  2JYE A;  2K8C A;  4ARI A;  5DPS A;  2KYW A;  2MQJ A;  3IVF A;  2ZVO A;  2D3G A;  5G5H A;  5E6O A;  2W3S A;  5BMG A;  4KSL C;  3VUY A;  4CYE A;  3GOE A;  4E3C A;  3MJW A;  3ZJU A;  3IBE A;  2O6V D;  2KAJ A;  2K6Q A;  3VRA B;  4GOC A;  3N1Z C;  5AZF A;  4GDK B;  2XK5 A;  3R2T A;  2N9L A;  2RD0 A;  3ZXR A;  3ABV B;  1V80 A;  2NTS A;  4KIK B;  2KMM A;  5IO9 A;  3L13 A;  1H4R A;  1WXQ A;  2NTT A;  3IHP C;  3MP9 A;  4G50 A;  2R61 A;  3EGR A;  4LNF A;  4KZC A;  2DAJ A;  2BBC A;  3UQA A;  3VTU A;  4I6L B;  1LM8 B;  1WJU A;  2BKR B;  2WXF A;  1SE4 A;  2PW9 A;  2KX3 A;  1HQR D;  2QDF A;  2WXL A;  2JVC A;  2FCM A;  1SB3 C;  4ANX A;  1WJN A;  4HJK A;  1VR9 A;  4AUQ C;  2L3Z A;  3JVZ X;  2VZK B;  3QJZ A;  2CHX A;  1WGR A;  2E3T A;  2MLB A;  3VH4 B;  1UF0 A;  4QAY A;  3AB5 A;  2E6X A;  4XWW A;  2IY1 B;  1GG3 A;  2GLS A;  4C80 A;  2R2Q A;  2INC C;  2QIL A;  1Q10 A;  2WX1 A;  1JRU A;  1RFK A;  2GB1 A;  4MEL A;  2M0X A;  1OQR A;  4TUU A;  3AE4 B;  4GDK A;  1WYG A;  1V81 A;  3RNE C;  1R7S A;  2IO0 B;  2I1K A;  5L95 C;  4LCD E;  2QJL A;  3W5U B;  3AEF B;  4K1R B;  1WX7 A;  4XZ4 A;  4ZRJ A;  1WJ4 A;  2Y5C A;  3AU5 A;  1XO3 A;  2C9W B;  1CMX B;  5DPT A;  1VRA B;  1GPX A;  2KJH B;  3RFZ B;  1EWY C;  1JWM D;  4IW0 A;  2MA9 B;  4B0M A;  1KH0 A;  1JW9 D;  4US9 A;  1KM7 A;  2DYB A;  3KUC B;  3VHT C;  2MW5 A;  2MP2 A;  4GDL B;  3T3O A;  2BYF A;  3QWZ B;  1NEN B;  1N61 A;  4WQO B;  1IGD A;  2KMA A;  4W9G A;  1FXA A;  1RAX A;  4KKI A;  1F52 A;  1K53 A;  3PRP B;  2BB5 A;  4KX6 B;  4EZK A;  3T3N A;  3FAH A;  4JWS C;  1C76 A;  1E6E B;  3SD5 A;  4RM8 A;  1YN3 A;  4X57 B;  5D3I B;  4MGK E;  1FXI A;  1XLP A;  2W55 A;  2MBB B;  3I63 C;  1E90 A;  1YQ3 B;  1TY0 A;  2C7H A;  1KJT A;  2DZK A;  2WXN A;  2D2Q A;  2Z0D B;  3WAM A;  4C00 A;  1P1A A;  3N30 A;  3BVM A;  4KGS A;  5JHA A;  4ZRQ A;  3P4Q B;  1TIF A;  2KNB A;  1IYF A;  3N1X C;  2GI9 A;  4GDL A;  1L0V B;  3SFD B;  4GXB A;  1JQ4 A;  1SIF A;  1D3Z A;  5CX3 A;  4TQ0 A;  3AV8 A;  2MRP A;  3NUH B;  4ICU A;  1HA5 A;  2AL6 A;  1OQQ A;  1XXG A;  2WQY B;  1H8C A;  2DZI A;  2M1M A;  2WDV B;  3ZTD A;  4PYZ A;  3PZ7 A;  4ZRI A;  3QAQ A;  1QQR A;  1XLQ A;  4ZHO A;  4MDK E;  2W9N A;  1TYG B;  1F2R I;  2JPH A;  1WXS A;  3RZW C;  3P4P B;  1PGA A;  1T0Q C;  3HHM A;  2LJI A;  3QK0 A;  1N62 A;  4UDU C;  3CIR B;  1EWC A;  2AQ2 B;  3VVW B;  1V1O A;  2WXG A;  4P1B C;  4MGI E;  3GE3 C;  2KXJ A;  3PSE B;  2BGF A;  2NMQ A;  3P4S B;  2SEB D;  2ZNV B;  3KLS X;  3JSV B;  3A9J B;  3AE2 B; 
#chains in the Genus database with same CATH homology
 1WWT A;  1MHH E;  1TY2 A;  1FEH A;  2DWQ A;  1AW7 A;  1XLO A;  1A70 A;  3SEB A;  4N58 A;  5D7G A;  4US8 A;  2DYM A;  3Q8E A;  1FIQ A;  3E9S A;  1UWX A;  2DLB A;  1FD6 A;  3AE7 B;  1KFY B;  2BS3 B;  4TMA B;  1NYQ A;  3HVD A;  4NAM A;  3IAM 1;  3BII D;  1VDV A;  2Z8L A;  4NJC A;  1D6E C;  3U4E G;  4ZHP A;  3LYY A;  1FCC C;  4A90 A;  3KWL A;  4XDC A;  1TKG A;  3OWE B;  1I4Q A;  1F0Z A;  2WXQ A;  2ICI A;  4P6V F;  3BK1 A;  2WXI A;  1TZO A;  1C4A A;  2LEK A;  1XCQ L;  5HFY A;  3AM9 A;  4L1B A;  3MHZ A;  1FRR A;  1JAL A;  4JPS A;  2IGG A;  2MH7 A;  3E56 A;  1GB4 A;  1SJH D;  4PT5 A;  1C78 A;  1F77 A;  1V1P B;  2IGH A;  1ZXH A;  3FIL B;  2M19 A;  1YNT E;  3J9C A;  5AUI A;  4OW0 A;  1ZP0 B;  1WSP A;  4YWG G;  4LTU A;  4YT0 B;  4HRS A;  3EA6 A;  1KLG D;  4AQ7 A;  3MC0 B;  1P7F A;  2J52 A;  2BW2 A;  3URY A;  1WGK A;  1C9F A;  4H2A A;  4WIP A;  3KQ4 A;  1E0Z A;  1XCT L;  2N0S B;  2XN9 C;  4YSZ B;  4ARC A;  2W3R A;  2PIA A;  2L83 A;  3AE1 B;  1MI0 A;  4A8X C;  2INN E;  1T3Q A;  2AQ3 B;  5D3D A;  5AUK A;  1NEK B;  2RMM A;  4JX1 C;  4RF0 A;  5FKA C;  5T8I A;  4RNA A;  3VR9 B;  1ACC A;  3CWI A;  1TS5 A;  1SBB B;  1SXT A;  2B76 B;  1YJI A;  2LHE A;  1EU3 A;  3LB8 C;  3ZGZ A;  4IKG A;  3BK2 A;  2JQR B;  1ZDX A;  2WDR B;  1HZ6 A;  1FNU A;  2PVG C;  4YTP B;  2WU5 B;  3DWM A;  5BYQ A;  1QOA A;  2Q5W D;  3Q8C A;  1N5W A;  2FBW B;  1WRI A;  5HHD G;  3U52 E;  1UUP A;  3V3X A;  2LUM A;  2N7J A;  2JWU A;  4MAC A;  3TUO A;  3PO0 A;  3VQI A;  2PTL A;  2EKI A;  2G9H D;  3ZQ4 A;  1V1P A;  1VJK A;  1L0Y B;  2CU3 A;  3AN1 A;  3FIL A;  2LMC A;  2MEK A;  2ONQ A;  2RDH A;  2RDG A;  1DOY A;  4FXC A;  5C2T B;  1TS4 A;  2WXH A;  1RM6 C;  4YTN B;  1HEZ E;  1EU4 A;  3W5V B;  2MJE A;  1LO5 D;  3P63 A;  2JYT A;  2BYT A;  1AWD A;  3AH7 A;  1DGJ A;  3NVV A;  4YSX B;  4DXF A;  2WXR A;  4YTM B;  1YN4 A;  5H8Y E;  1B9R A;  1J7A A;  1TJE A;  1VLB A;  2J53 A;  1K52 A;  3P42 A;  3W1S A;  1SIJ A;  4LK0 M;  5HG2 A;  3ZYY X;  4ZOH C;  2WDQ B;  1FFU A;  2BTE A;  1C77 A;  2YEP B;  1N5X A;  4M0W A;  2GRI A;  2WS3 B;  4D2K A;  2WXP A;  4HRO A;  5C3J B;  1QOB A;  3AE5 B;  5E6J A;  4AS1 A;  3TEY A;  2AX5 A;  4A55 A;  4ZRP A;  4WH4 A;  4TQ1 A;  1PFD A;  2OHF A;  1IBX B;  2WXO A;  1BXT A;  2LHD A;  1KRH A;  5H92 C;  3C8Y A;  1D5X C;  3ZJV A;  1M4V A;  3EUB 2;  3P1M A;  3AE9 B;  1I4P A;  2KDM A;  4J3O D;  1QOF A;  3IAS 1;  3SR6 A;  2INP E;  1L5P A;  2HTM E;  3NVW A;  2JSV X;  1FMA D;  4JE3 B;  1E7P B;  1ZDV A;  1CJE A;  1XLN A;  3R2I A;  4WAF A;  1AYF A;  5TSS A;  1GOZ A;  1SSN A;  2JYE A;  4OVZ A;  4ARI A;  3B2G A;  5JXV A;  4OZB A;  2W82 A;  2XNA C;  5G5H A;  2EEL A;  1CK1 A;  4WWM A;  2W3S A;  3GB1 A;  1J7C A;  1VZ6 A;  5BMG A;  1I4X A;  4NZL B;  1PGX A;  4C56 C;  4KGR A;  1P7E A;  2LFI A;  3U7Z A;  3W9C B;  4RGT A;  1FNV A;  2SAK A;  3MFG A;  1UNS A;  2J42 A;  2L52 A;  1JWU D;  4OZC A;  2K22 A;  3ZJU A;  1JCK B;  1KF6 B;  2ZW1 A;  4XE0 A;  4O1N A;  2KAC A;  2KAJ A;  5BYS A;  3VRA B;  4GDK B;  3AEC B;  2KQ4 X;  3R2T A;  4TSS A;  2N9L A;  2ZW0 A;  1JML A;  3ABV B;  4GLS C;  3TEX A;  2V0G A;  1FRD A;  2NTS A;  3AEE B;  1I4H A;  2KMM A;  4P16 A;  4EE2 A;  4YSY B;  1UGJ A;  1QIL A;  2M56 B;  1WXQ A;  2NTT A;  3AEG B;  3MP9 A;  5EE3 A;  3AE6 B;  1T5X D;  2BS4 B;  2R61 A;  3AE8 B;  2JZP A;  3EGR A;  3N9Y C;  3NZ3 A;  1KTK A;  2BBC A;  1IBX A;  3TEZ A;  1K51 A;  1V97 A;  2J4X A;  2WXF A;  4C7Y A;  1SE4 A;  2PW9 A;  1HQR D;  1J7B A;  2IDY A;  5FK9 C;  2BT6 A;  2WXL A;  1QLB B;  2YEP F;  3GP7 A;  2V3N A;  4DQO C;  2IGD A;  1VZ7 A;  5BMI A;  1SB3 C;  4HKZ E;  3L4P A;  1VR9 A;  3U2S C;  3IT6 B;  4WUR A;  3SFE B;  2QIE B;  1SJE D;  1YN5 A;  2VZK B;  3Q8A A;  3BYY B;  3Q8F A;  2E3T A;  3VRB B;  4IOI E;  3AB5 A;  2TSS A;  2E6X A;  4RH6 A;  4XWW A;  2MJD A;  4C80 A;  2MJ3 A;  3H8H A;  2QIL A;  1Q10 A;  2L1A A;  3AE3 B;  1L4Z B;  2FE8 A;  3ZJT A;  1PDX A;  1RFK A;  1Y56 A;  2GB1 A;  4REZ A;  1C4P A;  2WXJ A;  5EE1 A;  4YXD B;  3TSS A;  3NS1 A;  1OQR A;  4L23 A;  3AE4 B;  1WYG A;  2IPK D;  2PKO A;  1OFF A;  1PUT A;  4WQM A;  2H89 B;  1CZP A;  2LGI A;  4JWU C;  1R7S A;  1MHX A;  2L32 A;  4DXG A;  1RYJ A;  2QJL A;  1STE A;  5FR3 A;  3W5U B;  3AEF B;  1FFV A;  5MPO A;  4XWT A;  1ET6 A;  2DBY A;  4USA A;  1I4G A;  2Y5C A;  2G1E A;  3O13 A;  1XO3 A;  2DYO A;  5HI1 A;  2WXM A;  1ZPS A;  1VRA B;  1GPX A;  1V8C A;  2FUG 1;  1JRO A;  1MPE A;  3HUI A;  3RFZ B;  4IDI A;  4OZA A;  1DYQ A;  1EWY C;  1ET9 A;  1I7H A;  2CJO A;  3GS2 A;  1JWM D;  3MJ5 A;  2W54 A;  2HDE A;  3P4R B;  4N6E B;  5EE0 A;  2BB6 A;  1ZUD 2;  4B0M A;  1FCL A;  1FM0 D;  5BYR A;  1KH0 A;  1DOX A;  1JW9 D;  1JRP A;  4US9 A;  5I4D A;  2H88 B;  1N60 A;  4A9A A;  4GDL B;  3T3O A;  1NEN B;  1HXY D;  1N61 A;  1AN8 A;  1I4R A;  4RFB A;  4L2Y A;  2BS2 B;  1RWS A;  1T6B X;  1DOI A;  1IGD A;  1NI3 A;  3AMZ A;  1FXA A;  1NVI D;  4RF1 A;  4KKI A;  1IGC A;  1MVK A;  1K53 A;  2D5G A;  3HVZ A;  2BB5 A;  1B1Z A;  1YQ4 B;  4ITK A;  4KX6 B;  4RCO A;  2QEJ C;  2V3P A;  3Q8B A;  3T3N A;  3FAH A;  4Q2J A;  3B2F A;  2JU6 X;  3Q69 A;  4JWS C;  1C76 A;  1E6E B;  1JWA D;  3AEB B;  2CJN A;  1E10 A;  1YN3 A;  2WP9 B;  2WXK A;  1E9M A;  2PLP A;  5D3I B;  1HZ5 A;  2QMT A;  3BVZ A;  1QKZ A;  2ACZ B;  3HRD D;  3W2D A;  1FO4 A;  1FXI A;  1XLP A;  2VZK D;  1KLU D;  2W55 A;  5EE9 A;  2JX5 A;  5BMH A;  4LLG M;  1ZOY B;  3NVZ A;  4RGN A;  1D4B A;  3BWU D;  1YQ3 B;  1TY0 A;  2K9X A;  2WXN A;  1SEB D;  2K3U A;  2Y3A A;  4MT5 A;  1L4D B;  1QT9 A;  1L6V A;  1PGB A;  1QOG A;  2M0A A;  4B0E A;  2I38 A;  4RGM A;  4N59 A;  3NRZ A;  1ROE A;  1K50 A;  1ZXI A;  1D5Z C;  3BVM A;  2QSD A;  2PVO D;  4KGS A;  3IT4 B;  1IUE A;  2WLB A;  2K5P A;  1D5M C;  1ESF A;  3P4Q B;  4ZRQ A;  1CQV A;  2IJ0 A;  1SF0 A;  3AEA B;  1F2R C;  4MM3 B;  2GI9 A;  5LNK 1;  3BVG A;  4KGT A;  4OHJ A;  1L0V B;  3SFD B;  4ZYS A;  1XF5 L;  2RPV A;  4A6Q A;  1JQ4 A;  4CQN A;  3DWG C;  4HKQ A;  1L6U A;  3WCQ A;  1EM7 A;  1XEE A;  2ON8 A;  4XDD A;  4TQ0 A;  1SE2 A;  3IXS A;  2KWD A;  3AV8 A;  3NUH B;  3B9J A;  2WU2 B;  2AQ1 B;  1HA5 A;  2N9K A;  2K0P A;  1JWS D;  3UI3 A;  1FNW A;  3ETR A;  3VR8 B;  1OQQ A;  1NYR A;  4NAW B;  3NVY A;  2I2Y A;  4HJG E;  1XXG A;  2WQY B;  5GXG B;  3BYT B;  2WDV B;  3V05 A;  1C79 A;  3PZ7 A;  1TS2 A;  1YMH E;  1SE3 A;  1ENF A;  1QQR A;  4MH8 A;  1XLQ A;  2KN4 A;  1L0X B;  2X38 A;  4ZHO A;  1GB1 A;  1VZ8 A;  4RGO S;  1UWM A;  3TEW A;  1GAQ B;  3RPF C;  3PZ8 A;  1TYG B;  1F2R I;  3AED B;  3P4P B;  2JXT A;  1PGA A;  3R8B A;  2LJI A;  1PYW D;  1N62 A;  4UDU C;  1TKE A;  1ZE3 D;  4HEA 1;  4R3D A;  3CIR B;  2Y5P A;  1EWC A;  2AQ2 B;  1V1O A;  4C7Z A;  2WXG A;  2OED A;  2V4I B;  3FC4 A;  3I57 A;  4KKJ A;  2PMV A;  2WNM A;  1TS3 A;  5G5G A;  1QF6 A;  3KWV A;  3LXF A;  1TKY A;  1JWB D;  1N63 A;  1BUI C;  2NMQ A;  3P4S B;  1C4C A;  2SEB D;  1BML C;  3KLS X;  3I9V 1;  3BZD B;  1YJJ A;  3AE2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...