1FCCC

Crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 MO61 FC
publication title Crystal structure of the C2 fragment of streptococcal protein G in complex with the Fc domain of human IgG.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (antibody/antigen)
total genus 14
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature
pdb deposition date 1995-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fccC00
4HJGE 2IGDA 2NMQA 2JU6X 2PTLA 5JXVA 1K52A 1MPEA 2PW9A 1GB1A 2ON8A 2JZPA 5HHDG 2LHEA 3FILB 3FILA 1IBXB 1P7FA 2J53A 2KWDA 2JSVX 1F2RC 2GI9A 2EELA 1HZ5A 4OZAA 2LHDA 1PGXA 4D2KA 1P7EA 2LUMA 1YNTE 5BMIA 1HZ6A 4KGSA 5HFYA 5HI1A 2KN4A 1K51A 2KQ4X 5HG2A 1F2RI 2QSDA 2I2YA 2I38A 2QMTA 1K50A 4GLSC 2GB1A 3MP9A 1FD6A 1MI0A 2IGGA 4HKZE 1XCQL 1MHHE 1C9FA 3UI3A 2N9KA 2RPVA 1MVKA 3GB1A 2IGHA 1GB4A 4KGTA 1XCTL 2ZW1A 2JXTA 2N9LA 1IGCA 1PGBA 1IGDA 1MHXA 1HEZE 5BMHA 1QKZA 4IOIE 2ZW0A 4MACA 1EM7A 1KH0A 2LGIA 2OEDA 5BMGA 1PGAA 2KACA 1UWXA 4IKGA 4OZBA 2J52A 2JWUA 1Q10A 1XF5L 4OZCA 2N7JA 4KGRA 2K0PA 2ONQA 1FCLA 4WH4A 1FCCC 1JMLA 3V3XA 1IBXA 1YMHE 1D4BA 1ZXHA 1K53A 2KDMA 2RMMA 2PLPA
chains in the Genus database with same CATH superfamily
3VVWB 4I6PA 1WXSA 2V3NA 3HM3A 3PO0A 2FIFA 3RT3B 1K52A 4HPLB 4IW0A 2K25A 2WX0A 3AEBB 1D3ZA 2LHEA 3MC0B 3IHPC 2NBUA 4RFBA 3M63B 3A9JA 3VUWA 1DOYA 3VRAB 1V80A 2N1VA 1DOIA 3I63C 4B9KA 2G45B 3AE5B 1I4QA 2L8JA 1XEEA 3RNCC 1FFUA 2L05A 1J7CA 3BVMA 4A3OA 3URYA 4Q2JA 4PS3A 1H4RA 1TZOA 3KLSX 3DVNV 3ZJUA 1FM0D 4AOFA 3T3OA 3TEXA 3J9CA 1MVKA 1OQYA 3IAS1 2N1WA 3DBRI 2IY1B 1IP9A 3IFWB 3AECB 1RRBA 2K22A 5BMHA 3I9V1 3ZYYX 3RNFC 3UQBA 5FR3A 3RMKC 3A4SC 4PS7A 1YQBA 3O13A 4J6IA 2LJIA 2MBQA 3VH4B 2JX5A 3SR6A 4RCOA 1FNWA 3GZNI 1WE6A 1S1QB 4P16A 5AZGA 5JHBA 1Y56A 4FBJB 2J7QB 3MP9A 4M8MA 2LUEA 2CR5A 2V3SA 2WQYB 1ZGUB 2MJDA 2JU6X 2L1AA 2SEBD 4IDIA 1L2NA 3R2IA 4PYUA 5HHDG 1SSNA 1E7VA 1UZXB 2HJ8A 3CWIA 4DHZB 1IBXB 3A33B 4FULA 1V2YA 5DPRA 3HVDA 4GXBA 3WALA 3Q8BA 3KWLA 2O6VB 3UF8A 3NUHB 3PT2B 1AN8A 1EU4A 2L00B 1FXTB 3ZXVA 3TSSA 2KFKB 1OEYA 3DBHI 1MG4A 1KLGD 4OW0A 4JL9A 3ZNID 1ZKHA 2CJNA 3N9YC 3AE8B 2N9KA 1I35A 3APCA 3VR8B 1XCTL 2WDTB 2ZW1A 2AL6A 2O2VA 5EE3A 1FIQA 4A20A 4RH6A 3AE7B 1HEZE 1CK1A 4AS1A 1WRDB 3H9DA 1EUVB 4NNJB 2M56B 2W3SA 3NZUA 4FN2A 4GU2A 4KDLB 4HRSA 4KIKB 2A5UA 1KH0A 5E6JA 5FR6A 3TBLD 3AM9A 1GAQB 2G4SA 1V6EA 5IA7A 4IWPA 4HJKA 2H88B 3QAQA 2J0JA 1GNUA 4HDOA 3M62B 3X23A 3VHTC 2KX3A 2FCMA 1JALA 2I1JA 3MHZA 2KJRA 4MELA 4RM8A 4YSYB 3CF6E 1SE2A 4C7ZA 3BZDB 3UIOB 1WXQA 4P6VF 4YL8A 4NJ7A 2M0AA 1WE7A 1KTKA 1I4PA 2Y3AA 3AB5A 2PW9A 4HCPB 3KQ4A 2GRIA 2L7RA 3IXSA 4JLCA 1OFFA 3APDA 2CHXA 1CMXB 2J53A 3QIJA 4ITKA 2LEKA 5DCNA 1ZPSA 4GDKB 2GBRA 4B95A 1EO6A 2EKIA 3AV8A 4KZ0A 4XX5A 2M17A 2PJHA 4HVBA 1K8RB 4K1RB 1WXAA 3ZIMA 2BWES 3VR9B 2WU5B 1WJ6A 2LXAA 1XLNA 4KV2A 3H7PB 1TJEA 3Q3FA 2WXOA 2AX5A 2QCZA 2EMSA 4A90A 3WAPA 4K7WA 2K6QA 2ZCBA 2HD5B 1EWCA 1E6EB 3UI3A 4FHJA 5D94A 1WGHA 2IGHA 3A9KB 2D10A 1E7PB 1QOGA 2BKFA 2N9LA 3EC8A 1B9RA 3HUIA 4YT0B 3DVGY 1L0YB 1WFYA 1YOVB 3N30A 5FKAC 3CSFA 5AZHA 4TKNA 2G3QB 1Q0WB 3KUZA 1P1AA 1UNSA 2N7DA 2N7EA 4JWSC 1PGAA 2REXA 2KC2A 3R7QA 2RSUA 4YSXB 4ASWC 2ICIA 3PRMB 3IVFA 1I7HA 3RULA 3MC9A 1F52A 4IM2A 3RZWC 2PVGC 1D5ZC 4AP4C 3LYYA 2Y5BB 3NG0A 1J0GA 3DBRB 4X57B 2RMMA 2W3RA 3OG5A 3PS6A 2NMQA 2WDQB 5G5GA 1SJHD 2LRWA 1FEHA 3JW0X 1Y8RC 2RPQA 4ANVA 5JXVA 3L0WB 3Q8AA 3KH0A 4W9JA 3SDLC 1B1ZA 3TIXA 1KLUD 2MSED 5AEKB 1WMHA 1C3TA 1YN3A 3VUYA 1SGHA 1WRIA 2M1MA 4JQWC 2L32A 4MGIE 4DHJD 2NBVB 1E9MA 4YTPB 1HZ6A 2PVOD 5HFYA 1TT5B 1FXIA 1A70A 4BAXA 1MJDA 3ZNHB 1UGJA 1XLPA 4G50A 4B0EA 3EGRA 3PTFC 2PPHA 5J17A 2I38A 4HKQA 1K50A 2IYDB 3M3JA 2FCNA 5AUKA 2B76B 1SE3A 1WX7A 1LO5D 3L54A 5DPWA 1UBIA 1LXDA 4NAWB 4YSZB 1OQRA 4L23A 2W55A 2BBCA 1UUPA 5G55A 1DOXA 3ZQ4A 4KGTA 3ECIA 3ZTCA 4C00A 1IGCA 2WXJA 3TUOA 2MHJA 1F1HA 3RUIB 3GE3C 2KK8A 2R2QA 2RDGA 1VJKA 2BYFA 2V0GA 1V81A 1UGMA 1WI0A 2BYEA 3Q8CA 5AUIA 4MGKE 3RNAC 4MGYE 1L0VB 2NTTA 3BK1A 3NHEB 1RLFA 3RN9C 2MLBA 2KDFB 4G11A 1E8XA 2W9NA 4J3OD 4II2B 3V60A 4MM3B 4EZJA 2W82A 2KMAA 3DWGC 4LLGM 3E9SA 1STEA 2MWSB 2L76A 1QZEA 1VR9A 4GOCA 1ACCA 1YD8U 2AEHA 3ML8A 2LD9A 2HE7A 1FNVA 4HLEA 2INDC 4S0RA 3AI5A 4CQNA 3PZ8A 3SU8X 1FRDA 2XNAC 5LXIB 4DXGA 3A9JB 2WXRA 3A4RA 3MJ5A 2G1EA 1S3SG 1HTQA 2L83A 3HHMA 2WXPA 2M8SA 2XK5B 3Q8EA 3VH3B 2JT4B 3JSVA 1WR1A 4NJCA 1XT9B 1RFAA 5BMIA 4WAAA 4W9GA 4C7YA 3EA6A 4P7IA 1I4HA 1V5TA 2Z59B 3PGEA 3K9PB 4N6EB 1TS5A 1L6UA 2JZZA 2VH1A 1E90A 1QQRA 4MJSB 4E74A 1C4PA 4TUUA 3KUDB 2KLCA 4LCDE 4MH8A 3BIID 3WAMA 3Q3OC 2D5GA 1T0YA 3QK0A 2DYOA 3AU4A 4C4VB 2MP2A 1AWDA 3IT6B 3ZJVA 2QDFA 1N61A 1WZ3A 2DZJA 3ZUNA 2ZZPB 1UH6A 3L13A 3PZ7A 2EKEC 2IJ0A 4TQ0A 2KX0A 4GSWA 2Z0DB 4LTUA 2BT6A 4RF0A 4PK1A 1XLOA 3NVWA 1LM8B 2AYOB 3B1LX 5C1ZA 4W9DA 3ZKJC 1Q10A 4OHJA 2BS2B 2LMCA 5IAAC 1ZW7A 3MJWA 1AYFA 4XDCA 2IPKD 3NS8A 4C80A 4LDTD 1KLVA 2DAFA 2BB6A 4LJPB 4AUQC 1QLBB 2IGDA 1JRUA 5BYRA 2IO1B 1TS2A 4XGAB 4LNNA 2KJHB 1IPGA 3QARA 3N1YC 5BYQA 4RM9A 3GP7A 2AQ2B 1ZXIA 4W9CA 1JW9D 2KWDA 2PEAA 2N0SB 4A6QA 3R3MA 2LGSA 2JSVX 1JROA 5KHQA 2JQRB 3QQ8B 2K39A 4W9FA 2WWZA 4GDLA 4D2KA 3ZVVA 5L83A 2GBMA 4CYEA 1JWMD 3X0WA 2KN4A 1VLBA 1WX8A 4EFOA 4HWIB 2WGSA 4JWUC 4EZKA 1I42A 1LGRA 4N59A 4TQ1A 1CJEA 1V97A 5TSSA 2YEPF 2KWUB 3DQVA 1YN4A 4MEMA 2O2VB 2RDBC 1V1PA 3AE3B 4WWNA 5CTRC 4S17A 5CHVC 1UF0A 1D6EC 1VDVA 5AZFA 2KYWA 4W9KA 3QJZA 1E10A 4K81A 2JYEA 5BMGA 4GMVA 3BINA 1Z2MA 1PUTA 2BW2A 2FNJB 1ZP0B 2JWUA 3LDZE 1Z5SB 1YJIA 2JF5A 4HK2A 1A5RA 3PHXB 1FCLA 1FCCC 2WXFA 4LNFA 2X38A 3TMPB 4WJPA 4KSLC 3N32A 2J0MA 4RGOS 2VZKD 3V6CB 4MGZE 3DHHC 2FIDA 4F7ZA 2D3CA 1QF6A 3Q6BA 3LXFA 1C77A 4XZ4A 2HTHA 4JGHB 1GB1A 4WQOB 5DPSA 5TR5A 1GOZA 1P0RA 2WXQA 4ICUA 4RGTA 2DENB 4I6LB 2K8HA 2V9HA 2FE8A 3W1SA 2MBHA 3V05A 5KHOA 4IWQA 4OZAA 4NZLB 4RNAA 1R4NB 3QX1A 3DDCB 4LNOA 3VTWA 2WXGA 1T6BX 2A4ZA 4RMAA 2C7MB 3JYUA 4WIPA 2BPSA 3RNEC 3NVVA 3VUXA 3FKYA 1P9DU 1VZ8A 4IWOA 1T0SC 2UYZB 4MH0E 3ZRFA 1MI0A 3DOWA 4WQMA 2V4IB 4HKZE 3A1QA 3H1UA 2BYTA 1NVID 1JRPA 1JWAD 3BWUD 2C5LC 1DYQA 1XXGA 3EECA 2ZNVC 2ACZB 4YXDB 5JH5C 2JZ3B 3AE2B 4K3BA 2GLSA 3FAHA 4QAYA 4M01A 2KAJA 2NTSA 1TY0A 4L1BA 2ASQA 2MW5A 2ONQA 2WXNA 3WCQA 3KWVA 1V8CA 2NVUI 4MT5A 2HJ1A 1SEBD 2MBOA 2FUG1 4M0WB 1RAXA 3DCGA 4NAMA 1L4DB 1KF6B 2PLPA 3QHTA 4XDDA 4M00A 3MFGA 4NJ6A 1E5WA 4C56C 1I4XA 4ZHPA 3ZTDA 4BBNF 1TBEA 3OJ4B 1U4AA 2E3TA 4N58A 3NS1A 1WGGA 3AH7A 3AEEB 1FNUA 1P3QU 2MH7A 4KKJA 2Q5WD 1WYWB 1VZ6A 3U2SC 1SIJA 1E8YA 1NEKB 4HEA1 1EWYC 1LQBA 3NY5A 1K51A 3SD5A 5D3DA 1WSPA 1BMLC 2AQ1B 4GLSC 3KYDD 1EF5A 2IGGA 2QIEB 1V49A 4HPPA 5LNK1 1SB3C 4NQLB 3AEGB 1F0ZA 2MJEA 2HTME 1WX9A 1N5XA 4ZHOA 4A55A 1QOAA 2V4LA 5C2TB 1EF1A 2BS3B 5JHAA 1IYFA 5LXHA 2NCNA 2BF8B 4XC2A 3AE6B 2O6VD 2ZW0A 4ANUA 1WJ4A 5BYSA 3TEYA 5IP4D 1D5XC 2OEDA 1C76A 2K8CA 3KW5B 4OZBA 1ZDVA 2KT7A 2N7JA 1NBFC 1MG8A 2V1YA 3CMMB 1IBXA 1FRRA 4FADA 2KQ7A 1UELA 4F1SA 4ZYSA 2YEPB 2QC8A 2TSSA 4MSQB 3WIMA 4HROA 2LGYA 3L16A 1TIFA 4HJGE 1F9JA 3AU5A 4II3B 1WYGA 1N5WA 1GG3A 3PLVA 1ZOYB 2L52A 3VDZA 1KM7A 1ENFA 4JPSA 1V1OA 3UGBB 3PRPB 4YWGG 3ZXRA 3H6NA 1F2RC 4BBNC 4HXDA 3PZDA 2LHDA 3JSVB 3Q3JA 4URKA 5IO9A 1P7EA 1YJJA 2Z8LA 3EFCA 1PFDA 3ZJTA 2UWQA 1SIFA 2FAZA 3GE8C 2MRPA 4EEWA 4IM3A 3MTNB 4ANXA 5G5HA 3CSTA 4XWTA 1FD6A 1JCKB 3TEZA 1VZ7A 1NYQA 4KZCA 2JRHA 3S2AA 1C9FA 3ZRCA 2IO2B 3ALBA 5CX3A 2C7HA 2FCQA 3NJTA 2JXXA 2CKHB 2N4FA 4PS8A 4FHKA 2KO3A 1ZE3D 5EE9A 3AXCA 4ACFA 4RGNA 2KVRA 1L4ZB 1NI2A 3VAWA 2L0FA 2DYBA 3RCZA 4ZRKA 1SF0A 1WH3A 3PLUA 4FLHA 2MCNB 1YIWA 2CS4A 4I6NB 4FXCA 4RF1A 1T3QA 2IZVB 2WXIA 1L7YA 1WWTA 3U7DA 4DXAB 2M19A 4WJQA 1YQ3B 1XO3A 2PE6B 2FUHB 3N3KB 4ZRPA 2D2QA 2Y5CA 2ON8A 3H7PA 5J18A 1WF9A 4XWWA 2ZJDA 3DVGX 2VH2A 2KTRA 2DAJA 1HXYD 1R4NI 2ZCCA 2CHWA 4M02A 3WAOA 2OHFA 4GDLB 2DLBA 1YQ4B 3DPDA 4IM0A 3N1XC 3P4SB 3N1ZC 4UDUC 1WGKA 2WXLA 1KRHA 3SFDB 5IKCM 2NBWB 4US8A 4PYZA 3ZO5B 1WGYA 1NI3A 1E8WA 3P42A 2LVPA 4USAA 3R2TA 4W9LA 4BVUC 1GB4A 5CHFA 2KQSA 1V1PB 1PGBA 1M4VA 1TZ1A 3BVGA 2JRIB 3I3TB 1YX6B 3NVYA 2LFIA 3BVZA 3NZSA 2WU2B 1T5XD 2LGIA 2WDRB 3AE1B 1WM2A 2CU3A 4IUMB 1C78A 1ET9A 4OZCA 2K9XA 2XN9C 1OGWA 2MEKA 1WGDA 2LJ5A 4TV3A 2KZRA 3L17A 2RDHA 2LGDA 1J7BA 1D4BA 5JZEB 3D32A 3FC4A 3HRDD 2KWVB 1TKEA 3U7ZA 4KVGB 2D3GA 2MBBB 3R7RA 4P1CC 3DHGC 2VRRB 3FILA 2PE9A 2PIAA 2KMCA 5E6NA 3TCAA 3QC8B 1QOFA 4HPMB 1NENB 2BVCA 1YX5B 1PYWD 2EELA 4GB9A 3ZGZA 4NAWA 2Z0EB 2K1FA 3PRZA 1WR6E 4KX6B 1TYGB 2KQ4X 5EDSA 2DZIA 1C1YB 5IN7A 4YTMB 5HG2A 4HCNB 2LZ6A 2IBIB 2QMTA 3L08A 2GBKA 5E6PA 4BFRA 1SE4A 1JWSD 2R2OA 3ZDTA 1HTOA 2KHWB 3AULA 1XCQL 4EE2A 3VTVA 1HQRD 4ZRQA 3TL5A 4US9A 2JY6A 3T3NA 5MPOA 4BZAA 3IT4B 4P1BC 3E56A 2JXTA 4GIVA 2KNBA 3ZNGC 5E6OA 2H89B 4RGMA 3PHWB 1GPXA 1MHXA 1KOTA 3RI7C 1EM7A 2YVCA 1YN5A 3H8HA 4LNIA 4N9F4 2KJ6A 2KDIA 2C7NB 3BYYB 4DHZE 3DHIC 2QILA 4WH4A 4DDID 3QA8A 2K8BA 4CHKA 4M8NA 3RZFA 2KOXA 4IC7B 3R8BA 1QILA 1NYRA 2WXKA 3HVZA 1GJZA 4BKGA 4MSMB 3ML9A 1P98A 2LRUA 4ARCA 1SBBB 2XK5A 3MC8A 4PT5A 2DZKA 3IAM1 1MPEA 3I57A 4MJSA 4AWJA 2INCC 3H7SA 4DK5A 5HKHA 3KUCB 3EFUA 4AJYB 4BOSC 3T8MA 3KYCD 3DBLB 3VTUA 2KFJA 3CIRB 1E7UA 2IO0B 4C4VA 3GS2A 2INPE 4KGSA 1ZUD2 1UBQA 2KWCA 3TEWA 1ET6A 1TTNA 3P1MA 2IDYA 2LI5A 4W9EA 4E71A 3Q8FA 2BYVE 1ESFA 4K3CA 2NPTA 1WXVA 1FO4A 3KVFB 1JQ4A 4LJOB 1J8CA 3GB1A 3L4PA 1FPYA 2D11A 3Q69A 4FJYA 3BY4B 1TKGA 1TS3A 1IGDA 1ISNA 3OLMD 3R66C 1RM6C 1D5MC 2EMTA 4IOIE 3RNBC 4AJWA 1C79A 2BB5A 3PVLA 2KMMA 5IOIA 4BKSD 3PPAA 3P4QB 2KACA 1R4MB 2J52A 3O65B 1OQQA 2K0PA 2DBYA 2BTEA 3AEFB 4K7UA 3M95A 4WJNA 2FCSA 3AMZA 2KDMA 1WGRA 4K7SA 1JWBD 5D6JB 2W54A 2PTLA 2E6XA 5EE0A 1I4RA 4BKSA 4A8XC 3B9JA 2JPHA 2OJRA 1JWUD 3C8YA 3WA0A 3HM6X 3LB8C 3SFEB 2LGXA 1WJNA 4G0NB 1QT9A 1H8CA 2JWZA 3AEDB 2KC1A 2BQQA 3U4EG 2GBJA 2AWTA 3EHVA 4ANWA 4H2AA 3BK2A 1LFDA 2BS4B 3U30A 2D07B 1KFYB 1WIAA 1F2RI 2QSDA 5CHWA 1RWSA 5D3IB 3VRBB 4G3XB 1WMHB 5D2MB 4A9AA 2IY0B 2MJ3A 1M94A 4DXFA 2N9PC 3OAWA 3GOEA 4AQ7A 2DNFA 1OEYJ 3VFKA 1X1MA 1N62A 3SHQA 3V61A 2C9WB 1BT0A 1E8ZA 2WLBA 4XE0A 4R3DA 4GN1A 3V62A 2L0TA 1BUIC 2XEWA 1SJED 2CU1A 1TY2A 1XLQA 3TJPA 1RYJA 4EUTA 5GXGB 1L5PA 4F8CB 1XF5L 3NZ3A 4DHJB 5I4DA 3RYTA 3V3XA 3OJ3A 1TS4A 1WXMA 4WWMA 1HE8A 1N6ZA 3ZW3A 2JYTA 4KKIA 4DDGD 2KN5A 1E0ZA 4WJOA 4E3CA 2BKRB 3RD2A 1ROEA 2HDEA 1L0XB 1AW7A 1G6JA 1EU3A 5L95C 4DWFA 3RPFC 1RFKA 3OWEB 2Y5PA 2ZNVB 3T9LA 2UU7A 2KTRB 1PQSA 2X8XX 2GI9A 3ZLZA 2QEJC 2O6VA 3LJ3A 2ZPYA 2WXMA 4LK0M 4LNKA 5HI1A 2CJOA 4KDIC 1ZDXA 2SAKA 2KFKA 2AQ3B 3C0RB 2LXCA 2N9EB 1F77A 1V86A 2AL3A 3UQAA 2KD0A 2M0XA 3P4PB 2DYMA 1AARA 3Q14C 4BOZB 4DQOC 1YJ1A 4KSKC 1J7AA 2G9HD 2L3ZA 2PKOA 2G4DB 3W2DA 5FK9C 2WX1A 1FXAA 4EZLA 3PV1A 2DZMA 2ZPNA 1FFVA 2MA9B 2CHZA 4M0WA 2ZEQA 1V5OA 4OVZA 1SE9A 4MACA 2JUOA 4TMAB 5J2RA 1PDXA 4KIKA 1N63A 2BWFA 4JE3B 3W5VB 1UWXA 2D3AA 4ZRIA 3APFA 2MP2B 4EOYA 2J0KA 1FMAD 5EE1A 3U8ZA 3W1YA 4NY0A 3DBSA 1JMLA 1WJUA 1VCBA 3B0AA 2LASA 4WAFA 4NPNA 3GZNB 4L2YA 2KVZA 1R7SA 2RR9A 3AN1A 1TGZB 4MDKE 2QJLA 3ZNZB 4EKUA 4ZRJA 3DBLI 3FILB 1P7FA 1WM3A 3AE9B 2C60A 2DHZA 4GDKA 3QWZB 3ABVB 3W1SC 1C4CA 2K6DB 1HZ5A 2V3PA 1PGXA 1GC7A 3PREA 2LUMA 3ENEA 4OVUA 3AE4B 5GMVA 1CZPA 3Q3MC 2J4XA 2I1KA 5D7GA 4TSSA 3MHSD 4BKTA 2I2YA 4ZOHC 2R61A 1MFWA 2GB1A 2WNMA 4DBGA 3PSEB 4B0MA 1HA5A 3HIZA 4IG7B 5BO4B 2GOWA 1NDDA 1MHHE 1Q1OA 2FBWB 3V6EB 3DBHB 2LVQA 3AEAB 1QOBA 2RPVA 4LDTB 4NQKE 4WURA 3A9KA 1DGJA 2K3UA 2KKCA 2M4NA 2GMIC 1T0QC 2K5PA 3B2GA 1KJTA 4HDQA 1IUEA 3IG3A 3VQIA 2IO3B 1R4MI 3ETRA 1C4AA 3C19A 4FJVB 3EUB2 3SEBA 1V9JA 2RD0A 1XD3B 2OOBB 3L10B 4IKGA 3Q2AC 2DWQA 2ZVOA 4XYCA 1TKYA 4KGRA 2BGFA 1CQVA 1UD7A 3BYTB 1L6VA 4FJZA 1J19A 3UINB 2WP9B 2GBNA 4ZYNA 1OTRB 2WDVB 1ZXHA 5LLIA 1VD2A 4ARIA 2KLGA 3Q3NC 3W9CB 2ZVNA 4O1NA 2KTFA 1VRAB 2JZPA 3HK0A 3N20C 1WY8A 2MBEA 4CO7A 4JX1C 2NR2A 3UIPB 4B6WA 2KXJA 2QHOA 2XBBC 5H8YE 1YNTE 3WANA 2OJWA 2NS5A 2MQJA 2RGFA 2WXHA 3ONSA 3U52E 3K9OB 4A3PA 1GC6A 3I5JC 4ICVA 4JIOU 4FA6A 2NPTB 3JVZX 2WYQA 2MX2A 2YLMA 2J42A 2N9XA 2D3BA 1T0RC 2INNE 3QCAA 3RNGC 5G2NA 3W5UB 2VZKB 2LWPA 2DX5B 4GGQA 5C3JB 5C23A 1I4GA 1SXTA 4YTNB 4W9IA 5DPTA 5T8IA 4WWOA 2B3AA 1QKZA 3NOBA 1XQQA 3DWMA 1UWMA 4REZA 1WZ0A 3A1QB 1BXTA 4W9HA 3RFZB 2WHIA 3NRZA 3P63A 2KDBA 2PMVA 4MM3A 1GUAB 1YMHE 5H92C 4ZDVA 2WS3B 4OVVA 3B08A 2KDEB 3VXWA 3B2FA 3DVNU 1N60A 3P2BA 2LVOA 2KANA 3IBEA 3ZDMC 1K53A 1Q5WB 2JVCA 4WWPA 3P4RB 3NVZA
chains in the Genus database with same CATH topology
4HJGE 1WYGA 1N5WA 1JWBD 1VR9A 1ACCA 2V3NA 3PO0A 1ZOYB 2W54A 2PTLA 2L52A 2E6XA 1FNVA 1K52A 5EE0A 1I4RA 1ENFA 3AEBB 4A8XC 3B9JA 1JWUD 4JPSA 4CQNA 1V1OA 2LHEA 3MC0B 3C8YA 3PZ8A 4RFBA 1FRDA 3LB8C 4YWGG 2XNAC 3SFEB 4DXGA 2WXRA 1QT9A 1F2RC 2G1EA 3MJ5A 3AEDB 1DOYA 3VRAB 2L83A 2WXPA 1DOIA 3Q8EA 2LHDA 3U4EG 3AE5B 1P7EA 1I4QA 1YJJA 2Z8LA 4NJCA 1PFDA 5BMIA 3ZJTA 1XEEA 4C7YA 3EA6A 3BK2A 4H2AA 1FFUA 1I4HA 4N6EB 2BS4B 1TS5A 1L6UA 1KFYB 1QQRA 1J7CA 3BVMA 1C4PA 1F2RI 2QSDA 3URYA 1RWSA 5D3IB 3VRBB 4MH8A 4Q2JA 5G5HA 3BIID 1TZOA 4XWTA 4A9AA 1FD6A 2D5GA 3KLSX 1JCKB 2MJ3A 3TEZA 1VZ7A 1NYQA 3ZJUA 4DXFA 1FM0D 2DYOA 3T3OA 3TEXA 1C9FA 3J9CA 4AQ7A 1MVKA 1AWDA 3IT6B 3ZJVA 1N62A 1N61A 3IAS1 2WLBA 4XE0A 4R3DA 3PZ7A 2IJ0A 1BUIC 4TQ0A 3AECB 1ZE3D 2K22A 5EE9A 5BMHA 1SJED 4LTUA 4RGNA 2BT6A 4RF0A 3I9V1 1L4ZB 3ZYYX 1TY2A 1XLQA 1XLOA 5FR3A 1SF0A 3NVWA 1RYJA 5GXGB 1Q10A 3O13A 1L5PA 2LJIA 4OHJA 1XF5L 2BS2B 2JX5A 3NZ3A 3SR6A 5I4DA 4RCOA 1FNWA 2LMCA 3V3XA 1TS4A 4FXCA 1AYFA 4WWMA 4RF1A 2IPKD 4XDCA 1T3QA 4P16A 2JYTA 4KKIA 4C80A 1E0ZA 1Y56A 2WXIA 1ROEA 2HDEA 3MP9A 1L0XB 2BB6A 1WWTA 1AW7A 1QLBB 2WQYB 2IGDA 5BYRA 2M19A 1EU3A 2MJDA 1YQ3B 1TS2A 1XO3A 2JU6X 2L1AA 2SEBD 4IDIA 3R2IA 4ZRPA 5BYQA 1RFKA 3RPFC 2Y5CA 2ON8A 3GP7A 3OWEB 2Y5PA 5HHDG 1SSNA 2AQ2B 1ZXIA 3CWIA 4XWWA 1IBXB 1JW9D 2KWDA 2N0SB 4A6QA 1HXYD 2JSVX 1JROA 3HVDA 2JQRB 2GI9A 2QEJC 2OHFA 3Q8BA 4GDLB 3KWLA 4D2KA 2DLBA 1YQ4B 3NUHB 1AN8A 1EU4A 2WXMA 4LK0M 5HI1A 1JWMD 3P4SB 2CJOA 2KN4A 1VLBA 4UDUC 1ZDXA 2SAKA 1WGKA 3TSSA 2WXLA 1KRHA 3SFDB 4JWUC 2AQ3B 1KLGD 4US8A 1F77A 4OW0A 4N59A 1NI3A 4TQ1A 3P42A 2CJNA 3N9YC 3AE8B 3P4PB 2DYMA 2N9KA 4USAA 4DQOC 3R2TA 1CJEA 1V97A 1J7AA 2G9HD 5TSSA 3VR8B 2YEPF 2PKOA 1GB4A 3W2DA 5FK9C 1XCTL 1FXAA 2ZW1A 1YN4A 5EE3A 1V1PB 1FIQA 1M4VA 1PGBA 1V1PA 3AE3B 4RH6A 1FFVA 3AE7B 1HEZE 1CK1A 4AS1A 3BVGA 1D6EC 1VDVA 4M0WA 2M56B 4OVZA 2W3SA 1E10A 3NVYA 2LFIA 3BVZA 4MACA 4TMAB 2JYEA 4HRSA 2WU2B 1PDXA 1KH0A 1T5XD 5E6JA 1N63A 2LGIA 2WDRB 3AE1B 2CU3A 4JE3B 5BMGA 3W5VB 3AM9A 1GAQB 1PUTA 2BW2A 1UWXA 1ZP0B 1C78A 2JWUA 1ET9A 1FMAD 1YJIA 2H88B 2K9XA 2XN9C 4OZCA 5EE1A 1FCLA 2MEKA 1FCCC 1JMLA 2WXFA 2X38A 1JALA 4WAFA 4RGOS 2RDHA 3MHZA 1J7BA 2VZKD 1D4BA 4L2YA 4YSYB 1SE2A 4C7ZA 3BZDB 1WXQA 1R7SA 4P6VF 3FC4A 3HRDD 3AN1A 2QJLA 2M0AA 1QF6A 1KTKA 1I4PA 2Y3AA 1TKEA 3AB5A 3U7ZA 3LXFA 2PW9A 1C77A 1GB1A 3KQ4A 2GRIA 3IXSA 3FILB 3FILA 1GOZA 1OFFA 2PIAA 2WXQA 1QOFA 4RGTA 1P7FA 2J53A 3AE9B 4ITKA 2LEKA 1ZPSA 2FE8A 4GDKB 1NENB 3W1SA 3ABVB 3V05A 1C4CA 2EKIA 3AV8A 1PYWD 2EELA 3ZGZA 1HZ5A 4OZAA 2V3PA 1PGXA 4NZLB 2LUMA 4RNAA 3AE4B 1CZPA 4KX6B 2J4XA 2WXGA 5D7GA 3VR9B 1TYGB 4TSSA 2WU5B 2KQ4X 1T6BX 1XLNA 4YTMB 5HG2A 1TJEA 2I2YA 4WIPA 4ZOHC 2R61A 2WXOA 2AX5A 2QMTA 3NVVA 4A90A 2GB1A 2WNMA 1VZ8A 4B0MA 1HA5A 1SE4A 1JWSD 1MI0A 4WQMA 2V4IB 4HKZE 1XCQL 2BYTA 1MHHE 1NVID 1JRPA 4EE2A 2FBWB 1JWAD 1EWCA 1E6EB 3AEAB 1HQRD 1QOBA 2RPVA 4ZRQA 3UI3A 3BWUD 4US9A 3T3NA 4WURA 2IGHA 1DYQA 5MPOA 1XXGA 1DGJA 1E7PB 2K3UA 3IT4B 1QOGA 3E56A 2JXTA 2N9LA 1B9RA 2ACZB 2H89B 3HUIA 4YT0B 4RGMA 4YXDB 1L0YB 1GPXA 1MHXA 5FKAC 2K5PA 3B2GA 3AE2B 1IUEA 3VQIA 3ETRA 1C4AA 1EM7A 3EUB2 1YN5A 3SEBA 1UNSA 3H8HA 3FAHA 4JWSC 1PGAA 3BYYB 4IKGA 4YSXB 2DWQA 2KAJA 2NTSA 1TKYA 1TY0A 2ICIA 4L1BA 1I7HA 4KGRA 2QILA 2ONQA 4WH4A 2WXNA 3WCQA 1CQVA 3BYTB 1L6VA 3KWVA 1V8CA 2PVGC 1D5ZC 4MT5A 1SEBD 2WP9B 3R8BA 3LYYA 1QILA 1NYRA 2FUG1 2WDVB 2WXKA 3HVZA 1ZXHA 2RMMA 4NAMA 2W3RA 1L4DB 1KF6B 2PLPA 4XDDA 4ARCA 3MFGA 1SBBB 4ARIA 2NMQA 4C56C 3W9CB 2WDQB 5G5GA 1SJHD 1FEHA 4PT5A 3IAM1 1I4XA 5JXVA 1MPEA 4ZHPA 3Q8AA 4O1NA 3I57A 1VRAB 2JZPA 1B1ZA 1KLUD 2E3TA 4N58A 3NS1A 1YN3A 3AH7A 4JX1C 1WRIA 3AEEB 2L32A 3CIRB 1FNUA 2MH7A 4KKJA 1E9MA 2Q5WD 3GS2A 5H8YE 1VZ6A 3U2SC 1SIJA 1YNTE 2INPE 4YTPB 1HZ6A 2PVOD 4KGSA 1ZUD2 5HFYA 1NEKB 1FXIA 1A70A 4HEA1 1EWYC 2WXHA 3TEWA 1ET6A 1K51A 3U52E 5D3DA 3P1MA 2IDYA 1UGJA 1XLPA 1WSPA 1BMLC 3EGRA 4B0EA 2AQ1B 2I38A 4HKQA 1K50A 4GLSC 3Q8FA 5AUKA 1ESFA 2B76B 1SE3A 2IGGA 2J42A 2QIEB 1LO5D 5LNK1 1FO4A 1SB3C 2INNE 3AEGB 4NAWB 1JQ4A 1F0ZA 3GB1A 3W5UB 4YSZB 2MJEA 1OQRA 2HTME 2VZKB 2BBCA 1UUPA 2W55A 4L23A 1N5XA 3L4PA 3ZQ4A 1DOXA 4ZHOA 4KGTA 4A55A 1QOAA 3Q69A 5C2TB 5C3JB 1I4GA 1IGCA 1SXTA 2BS3B 2WXJA 3TUOA 1TKGA 1TS3A 1IGDA 4YTNB 2RDGA 1RM6C 1D5MC 5T8IA 1VJKA 2V0GA 3AE6B 1QKZA 4IOIE 2ZW0A 3DWMA 3Q8CA 5BYSA 1C79A 3TEYA 2BB5A 1UWMA 4REZA 5AUIA 2KMMA 1D5XC 2OEDA 1C76A 1BXTA 3P4QB 2KACA 1L0VB 4OZBA 1ZDVA 2J52A 2NTTA 3BK1A 3RFZB 1OQQA 2N7JA 2K0PA 2DBYA 3NRZA 3P63A 2BTEA 4J3OD 4MM3B 2PMVA 1IBXA 1FRRA 1YMHE 2W82A 3AEFB 5H92C 2WS3B 3DWGC 3AMZA 3B2FA 4LLGM 1N60A 4ZYSA 3E9SA 2YEPB 1K53A 1STEA 2TSSA 2KDMA 4HROA 3P4RB 3NVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJG E;  2IGD A;  2NMQ A;  2JU6 X;  2PTL A;  5JXV A;  1K52 A;  1MPE A;  2PW9 A;  1GB1 A;  2ON8 A;  2JZP A;  5HHD G;  2LHE A;  3FIL B;  3FIL A;  1IBX B;  1P7F A;  2J53 A;  2KWD A;  2JSV X;  1F2R C;  2GI9 A;  2EEL A;  1HZ5 A;  4OZA A;  2LHD A;  1PGX A;  4D2K A;  1P7E A;  2LUM A;  1YNT E;  5BMI A;  1HZ6 A;  4KGS A;  5HFY A;  5HI1 A;  2KN4 A;  1K51 A;  2KQ4 X;  5HG2 A;  1F2R I;  2QSD A;  2I2Y A;  2I38 A;  2QMT A;  1K50 A;  4GLS C;  2GB1 A;  3MP9 A;  1FD6 A;  1MI0 A;  2IGG A;  4HKZ E;  1XCQ L;  1MHH E;  1C9F A;  3UI3 A;  2N9K A;  2RPV A;  1MVK A;  3GB1 A;  2IGH A;  1GB4 A;  4KGT A;  1XCT L;  2ZW1 A;  2JXT A;  2N9L A;  1IGC A;  1PGB A;  1IGD A;  1MHX A;  1HEZ E;  5BMH A;  1QKZ A;  4IOI E;  2ZW0 A;  4MAC A;  1EM7 A;  1KH0 A;  2LGI A;  2OED A;  5BMG A;  1PGA A;  2KAC A;  1UWX A;  4IKG A;  4OZB A;  2J52 A;  2JWU A;  1Q10 A;  1XF5 L;  4OZC A;  2N7J A;  4KGR A;  2K0P A;  2ONQ A;  1FCL A;  4WH4 A;  1FCC C;  1JML A;  3V3X A;  1IBX A;  1YMH E;  1D4B A;  1ZXH A;  1K53 A;  2KDM A;  2RMM A;  2PLP A; 
#chains in the Genus database with same CATH topology
 3VVW B;  4I6P A;  1WXS A;  2V3N A;  3HM3 A;  3PO0 A;  2FIF A;  3RT3 B;  1K52 A;  4HPL B;  4IW0 A;  2K25 A;  2WX0 A;  3AEB B;  1D3Z A;  2LHE A;  3MC0 B;  3IHP C;  2NBU A;  4RFB A;  3M63 B;  3A9J A;  3VUW A;  1DOY A;  3VRA B;  1V80 A;  2N1V A;  1DOI A;  3I63 C;  4B9K A;  2G45 B;  3AE5 B;  1I4Q A;  2L8J A;  1XEE A;  3RNC C;  1FFU A;  2L05 A;  1J7C A;  3BVM A;  4A3O A;  3URY A;  4Q2J A;  4PS3 A;  1H4R A;  1TZO A;  3KLS X;  3DVN V;  3ZJU A;  1FM0 D;  4AOF A;  3T3O A;  3TEX A;  3J9C A;  1MVK A;  1OQY A;  3IAS 1;  2N1W A;  3DBR I;  2IY1 B;  1IP9 A;  3IFW B;  3AEC B;  1RRB A;  2K22 A;  5BMH A;  3I9V 1;  3ZYY X;  3RNF C;  3UQB A;  5FR3 A;  3RMK C;  3A4S C;  4PS7 A;  1YQB A;  3O13 A;  4J6I A;  2LJI A;  2MBQ A;  3VH4 B;  2JX5 A;  3SR6 A;  4RCO A;  1FNW A;  3GZN I;  1WE6 A;  1S1Q B;  4P16 A;  5AZG A;  5JHB A;  1Y56 A;  4FBJ B;  2J7Q B;  3MP9 A;  4M8M A;  2LUE A;  2CR5 A;  2V3S A;  2WQY B;  1ZGU B;  2MJD A;  2JU6 X;  2L1A A;  2SEB D;  4IDI A;  1L2N A;  3R2I A;  4PYU A;  5HHD G;  1SSN A;  1E7V A;  1UZX B;  2HJ8 A;  3CWI A;  4DHZ B;  1IBX B;  3A33 B;  4FUL A;  1V2Y A;  5DPR A;  3HVD A;  4GXB A;  3WAL A;  3Q8B A;  3KWL A;  2O6V B;  3UF8 A;  3NUH B;  3PT2 B;  1AN8 A;  1EU4 A;  2L00 B;  1FXT B;  3ZXV A;  3TSS A;  2KFK B;  1OEY A;  3DBH I;  1MG4 A;  1KLG D;  4OW0 A;  4JL9 A;  3ZNI D;  1ZKH A;  2CJN A;  3N9Y C;  3AE8 B;  2N9K A;  1I35 A;  3APC A;  3VR8 B;  1XCT L;  2WDT B;  2ZW1 A;  2AL6 A;  2O2V A;  5EE3 A;  1FIQ A;  4A20 A;  4RH6 A;  3AE7 B;  1HEZ E;  1CK1 A;  4AS1 A;  1WRD B;  3H9D A;  1EUV B;  4NNJ B;  2M56 B;  2W3S A;  3NZU A;  4FN2 A;  4GU2 A;  4KDL B;  4HRS A;  4KIK B;  2A5U A;  1KH0 A;  5E6J A;  5FR6 A;  3TBL D;  3AM9 A;  1GAQ B;  2G4S A;  1V6E A;  5IA7 A;  4IWP A;  4HJK A;  2H88 B;  3QAQ A;  2J0J A;  1GNU A;  4HDO A;  3M62 B;  3X23 A;  3VHT C;  2KX3 A;  2FCM A;  1JAL A;  2I1J A;  3MHZ A;  2KJR A;  4MEL A;  4RM8 A;  4YSY B;  3CF6 E;  1SE2 A;  4C7Z A;  3BZD B;  3UIO B;  1WXQ A;  4P6V F;  4YL8 A;  4NJ7 A;  2M0A A;  1WE7 A;  1KTK A;  1I4P A;  2Y3A A;  3AB5 A;  2PW9 A;  4HCP B;  3KQ4 A;  2GRI A;  2L7R A;  3IXS A;  4JLC A;  1OFF A;  3APD A;  2CHX A;  1CMX B;  2J53 A;  3QIJ A;  4ITK A;  2LEK A;  5DCN A;  1ZPS A;  4GDK B;  2GBR A;  4B95 A;  1EO6 A;  2EKI A;  3AV8 A;  4KZ0 A;  4XX5 A;  2M17 A;  2PJH A;  4HVB A;  1K8R B;  4K1R B;  1WXA A;  3ZIM A;  2BWE S;  3VR9 B;  2WU5 B;  1WJ6 A;  2LXA A;  1XLN A;  4KV2 A;  3H7P B;  1TJE A;  3Q3F A;  2WXO A;  2AX5 A;  2QCZ A;  2EMS A;  4A90 A;  3WAP A;  4K7W A;  2K6Q A;  2ZCB A;  2HD5 B;  1EWC A;  1E6E B;  3UI3 A;  4FHJ A;  5D94 A;  1WGH A;  2IGH A;  3A9K B;  2D10 A;  1E7P B;  1QOG A;  2BKF A;  2N9L A;  3EC8 A;  1B9R A;  3HUI A;  4YT0 B;  3DVG Y;  1L0Y B;  1WFY A;  1YOV B;  3N30 A;  5FKA C;  3CSF A;  5AZH A;  4TKN A;  2G3Q B;  1Q0W B;  3KUZ A;  1P1A A;  1UNS A;  2N7D A;  2N7E A;  4JWS C;  1PGA A;  2REX A;  2KC2 A;  3R7Q A;  2RSU A;  4YSX B;  4ASW C;  2ICI A;  3PRM B;  3IVF A;  1I7H A;  3RUL A;  3MC9 A;  1F52 A;  4IM2 A;  3RZW C;  2PVG C;  1D5Z C;  4AP4 C;  3LYY A;  2Y5B B;  3NG0 A;  1J0G A;  3DBR B;  4X57 B;  2RMM A;  2W3R A;  3OG5 A;  3PS6 A;  2NMQ A;  2WDQ B;  5G5G A;  1SJH D;  2LRW A;  1FEH A;  3JW0 X;  1Y8R C;  2RPQ A;  4ANV A;  5JXV A;  3L0W B;  3Q8A A;  3KH0 A;  4W9J A;  3SDL C;  1B1Z A;  3TIX A;  1KLU D;  2MSE D;  5AEK B;  1WMH A;  1C3T A;  1YN3 A;  3VUY A;  1SGH A;  1WRI A;  2M1M A;  4JQW C;  2L32 A;  4MGI E;  4DHJ D;  2NBV B;  1E9M A;  4YTP B;  1HZ6 A;  2PVO D;  5HFY A;  1TT5 B;  1FXI A;  1A70 A;  4BAX A;  1MJD A;  3ZNH B;  1UGJ A;  1XLP A;  4G50 A;  4B0E A;  3EGR A;  3PTF C;  2PPH A;  5J17 A;  2I38 A;  4HKQ A;  1K50 A;  2IYD B;  3M3J A;  2FCN A;  5AUK A;  2B76 B;  1SE3 A;  1WX7 A;  1LO5 D;  3L54 A;  5DPW A;  1UBI A;  1LXD A;  4NAW B;  4YSZ B;  1OQR A;  4L23 A;  2W55 A;  2BBC A;  1UUP A;  5G55 A;  1DOX A;  3ZQ4 A;  4KGT A;  3ECI A;  3ZTC A;  4C00 A;  1IGC A;  2WXJ A;  3TUO A;  2MHJ A;  1F1H A;  3RUI B;  3GE3 C;  2KK8 A;  2R2Q A;  2RDG A;  1VJK A;  2BYF A;  2V0G A;  1V81 A;  1UGM A;  1WI0 A;  2BYE A;  3Q8C A;  5AUI A;  4MGK E;  3RNA C;  4MGY E;  1L0V B;  2NTT A;  3BK1 A;  3NHE B;  1RLF A;  3RN9 C;  2MLB A;  2KDF B;  4G11 A;  1E8X A;  2W9N A;  4J3O D;  4II2 B;  3V60 A;  4MM3 B;  4EZJ A;  2W82 A;  2KMA A;  3DWG C;  4LLG M;  3E9S A;  1STE A;  2MWS B;  2L76 A;  1QZE A;  1VR9 A;  4GOC A;  1ACC A;  1YD8 U;  2AEH A;  3ML8 A;  2LD9 A;  2HE7 A;  1FNV A;  4HLE A;  2IND C;  4S0R A;  3AI5 A;  4CQN A;  3PZ8 A;  3SU8 X;  1FRD A;  2XNA C;  5LXI B;  4DXG A;  3A9J B;  2WXR A;  3A4R A;  3MJ5 A;  2G1E A;  1S3S G;  1HTQ A;  2L83 A;  3HHM A;  2WXP A;  2M8S A;  2XK5 B;  3Q8E A;  3VH3 B;  2JT4 B;  3JSV A;  1WR1 A;  4NJC A;  1XT9 B;  1RFA A;  5BMI A;  4WAA A;  4W9G A;  4C7Y A;  3EA6 A;  4P7I A;  1I4H A;  1V5T A;  2Z59 B;  3PGE A;  3K9P B;  4N6E B;  1TS5 A;  1L6U A;  2JZZ A;  2VH1 A;  1E90 A;  1QQR A;  4MJS B;  4E74 A;  1C4P A;  4TUU A;  3KUD B;  2KLC A;  4LCD E;  4MH8 A;  3BII D;  3WAM A;  3Q3O C;  2D5G A;  1T0Y A;  3QK0 A;  2DYO A;  3AU4 A;  4C4V B;  2MP2 A;  1AWD A;  3IT6 B;  3ZJV A;  2QDF A;  1N61 A;  1WZ3 A;  2DZJ A;  3ZUN A;  2ZZP B;  1UH6 A;  3L13 A;  3PZ7 A;  2EKE C;  2IJ0 A;  4TQ0 A;  2KX0 A;  4GSW A;  2Z0D B;  4LTU A;  2BT6 A;  4RF0 A;  4PK1 A;  1XLO A;  3NVW A;  1LM8 B;  2AYO B;  3B1L X;  5C1Z A;  4W9D A;  3ZKJ C;  1Q10 A;  4OHJ A;  2BS2 B;  2LMC A;  5IAA C;  1ZW7 A;  3MJW A;  1AYF A;  4XDC A;  2IPK D;  3NS8 A;  4C80 A;  4LDT D;  1KLV A;  2DAF A;  2BB6 A;  4LJP B;  4AUQ C;  1QLB B;  2IGD A;  1JRU A;  5BYR A;  2IO1 B;  1TS2 A;  4XGA B;  4LNN A;  2KJH B;  1IPG A;  3QAR A;  3N1Y C;  5BYQ A;  4RM9 A;  3GP7 A;  2AQ2 B;  1ZXI A;  4W9C A;  1JW9 D;  2KWD A;  2PEA A;  2N0S B;  4A6Q A;  3R3M A;  2LGS A;  2JSV X;  1JRO A;  5KHQ A;  2JQR B;  3QQ8 B;  2K39 A;  4W9F A;  2WWZ A;  4GDL A;  4D2K A;  3ZVV A;  5L83 A;  2GBM A;  4CYE A;  1JWM D;  3X0W A;  2KN4 A;  1VLB A;  1WX8 A;  4EFO A;  4HWI B;  2WGS A;  4JWU C;  4EZK A;  1I42 A;  1LGR A;  4N59 A;  4TQ1 A;  1CJE A;  1V97 A;  5TSS A;  2YEP F;  2KWU B;  3DQV A;  1YN4 A;  4MEM A;  2O2V B;  2RDB C;  1V1P A;  3AE3 B;  4WWN A;  5CTR C;  4S17 A;  5CHV C;  1UF0 A;  1D6E C;  1VDV A;  5AZF A;  2KYW A;  4W9K A;  3QJZ A;  1E10 A;  4K81 A;  2JYE A;  5BMG A;  4GMV A;  3BIN A;  1Z2M A;  1PUT A;  2BW2 A;  2FNJ B;  1ZP0 B;  2JWU A;  3LDZ E;  1Z5S B;  1YJI A;  2JF5 A;  4HK2 A;  1A5R A;  3PHX B;  1FCL A;  1FCC C;  2WXF A;  4LNF A;  2X38 A;  3TMP B;  4WJP A;  4KSL C;  3N32 A;  2J0M A;  4RGO S;  2VZK D;  3V6C B;  4MGZ E;  3DHH C;  2FID A;  4F7Z A;  2D3C A;  1QF6 A;  3Q6B A;  3LXF A;  1C77 A;  4XZ4 A;  2HTH A;  4JGH B;  1GB1 A;  4WQO B;  5DPS A;  5TR5 A;  1GOZ A;  1P0R A;  2WXQ A;  4ICU A;  4RGT A;  2DEN B;  4I6L B;  2K8H A;  2V9H A;  2FE8 A;  3W1S A;  2MBH A;  3V05 A;  5KHO A;  4IWQ A;  4OZA A;  4NZL B;  4RNA A;  1R4N B;  3QX1 A;  3DDC B;  4LNO A;  3VTW A;  2WXG A;  1T6B X;  2A4Z A;  4RMA A;  2C7M B;  3JYU A;  4WIP A;  2BPS A;  3RNE C;  3NVV A;  3VUX A;  3FKY A;  1P9D U;  1VZ8 A;  4IWO A;  1T0S C;  2UYZ B;  4MH0 E;  3ZRF A;  1MI0 A;  3DOW A;  4WQM A;  2V4I B;  4HKZ E;  3A1Q A;  3H1U A;  2BYT A;  1NVI D;  1JRP A;  1JWA D;  3BWU D;  2C5L C;  1DYQ A;  1XXG A;  3EEC A;  2ZNV C;  2ACZ B;  4YXD B;  5JH5 C;  2JZ3 B;  3AE2 B;  4K3B A;  2GLS A;  3FAH A;  4QAY A;  4M01 A;  2KAJ A;  2NTS A;  1TY0 A;  4L1B A;  2ASQ A;  2MW5 A;  2ONQ A;  2WXN A;  3WCQ A;  3KWV A;  1V8C A;  2NVU I;  4MT5 A;  2HJ1 A;  1SEB D;  2MBO A;  2FUG 1;  4M0W B;  1RAX A;  3DCG A;  4NAM A;  1L4D B;  1KF6 B;  2PLP A;  3QHT A;  4XDD A;  4M00 A;  3MFG A;  4NJ6 A;  1E5W A;  4C56 C;  1I4X A;  4ZHP A;  3ZTD A;  4BBN F;  1TBE A;  3OJ4 B;  1U4A A;  2E3T A;  4N58 A;  3NS1 A;  1WGG A;  3AH7 A;  3AEE B;  1FNU A;  1P3Q U;  2MH7 A;  4KKJ A;  2Q5W D;  1WYW B;  1VZ6 A;  3U2S C;  1SIJ A;  1E8Y A;  1NEK B;  4HEA 1;  1EWY C;  1LQB A;  3NY5 A;  1K51 A;  3SD5 A;  5D3D A;  1WSP A;  1BML C;  2AQ1 B;  4GLS C;  3KYD D;  1EF5 A;  2IGG A;  2QIE B;  1V49 A;  4HPP A;  5LNK 1;  1SB3 C;  4NQL B;  3AEG B;  1F0Z A;  2MJE A;  2HTM E;  1WX9 A;  1N5X A;  4ZHO A;  4A55 A;  1QOA A;  2V4L A;  5C2T B;  1EF1 A;  2BS3 B;  5JHA A;  1IYF A;  5LXH A;  2NCN A;  2BF8 B;  4XC2 A;  3AE6 B;  2O6V D;  2ZW0 A;  4ANU A;  1WJ4 A;  5BYS A;  3TEY A;  5IP4 D;  1D5X C;  2OED A;  1C76 A;  2K8C A;  3KW5 B;  4OZB A;  1ZDV A;  2KT7 A;  2N7J A;  1NBF C;  1MG8 A;  2V1Y A;  3CMM B;  1IBX A;  1FRR A;  4FAD A;  2KQ7 A;  1UEL A;  4F1S A;  4ZYS A;  2YEP B;  2QC8 A;  2TSS A;  4MSQ B;  3WIM A;  4HRO A;  2LGY A;  3L16 A;  1TIF A;  4HJG E;  1F9J A;  3AU5 A;  4II3 B;  1WYG A;  1N5W A;  1GG3 A;  3PLV A;  1ZOY B;  2L52 A;  3VDZ A;  1KM7 A;  1ENF A;  4JPS A;  1V1O A;  3UGB B;  3PRP B;  4YWG G;  3ZXR A;  3H6N A;  1F2R C;  4BBN C;  4HXD A;  3PZD A;  2LHD A;  3JSV B;  3Q3J A;  4URK A;  5IO9 A;  1P7E A;  1YJJ A;  2Z8L A;  3EFC A;  1PFD A;  3ZJT A;  2UWQ A;  1SIF A;  2FAZ A;  3GE8 C;  2MRP A;  4EEW A;  4IM3 A;  3MTN B;  4ANX A;  5G5H A;  3CST A;  4XWT A;  1FD6 A;  1JCK B;  3TEZ A;  1VZ7 A;  1NYQ A;  4KZC A;  2JRH A;  3S2A A;  1C9F A;  3ZRC A;  2IO2 B;  3ALB A;  5CX3 A;  2C7H A;  2FCQ A;  3NJT A;  2JXX A;  2CKH B;  2N4F A;  4PS8 A;  4FHK A;  2KO3 A;  1ZE3 D;  5EE9 A;  3AXC A;  4ACF A;  4RGN A;  2KVR A;  1L4Z B;  1NI2 A;  3VAW A;  2L0F A;  2DYB A;  3RCZ A;  4ZRK A;  1SF0 A;  1WH3 A;  3PLU A;  4FLH A;  2MCN B;  1YIW A;  2CS4 A;  4I6N B;  4FXC A;  4RF1 A;  1T3Q A;  2IZV B;  2WXI A;  1L7Y A;  1WWT A;  3U7D A;  4DXA B;  2M19 A;  4WJQ A;  1YQ3 B;  1XO3 A;  2PE6 B;  2FUH B;  3N3K B;  4ZRP A;  2D2Q A;  2Y5C A;  2ON8 A;  3H7P A;  5J18 A;  1WF9 A;  4XWW A;  2ZJD A;  3DVG X;  2VH2 A;  2KTR A;  2DAJ A;  1HXY D;  1R4N I;  2ZCC A;  2CHW A;  4M02 A;  3WAO A;  2OHF A;  4GDL B;  2DLB A;  1YQ4 B;  3DPD A;  4IM0 A;  3N1X C;  3P4S B;  3N1Z C;  4UDU C;  1WGK A;  2WXL A;  1KRH A;  3SFD B;  5IKC M;  2NBW B;  4US8 A;  4PYZ A;  3ZO5 B;  1WGY A;  1NI3 A;  1E8W A;  3P42 A;  2LVP A;  4USA A;  3R2T A;  4W9L A;  4BVU C;  1GB4 A;  5CHF A;  2KQS A;  1V1P B;  1PGB A;  1M4V A;  1TZ1 A;  3BVG A;  2JRI B;  3I3T B;  1YX6 B;  3NVY A;  2LFI A;  3BVZ A;  3NZS A;  2WU2 B;  1T5X D;  2LGI A;  2WDR B;  3AE1 B;  1WM2 A;  2CU3 A;  4IUM B;  1C78 A;  1ET9 A;  4OZC A;  2K9X A;  2XN9 C;  1OGW A;  2MEK A;  1WGD A;  2LJ5 A;  4TV3 A;  2KZR A;  3L17 A;  2RDH A;  2LGD A;  1J7B A;  1D4B A;  5JZE B;  3D32 A;  3FC4 A;  3HRD D;  2KWV B;  1TKE A;  3U7Z A;  4KVG B;  2D3G A;  2MBB B;  3R7R A;  4P1C C;  3DHG C;  2VRR B;  3FIL A;  2PE9 A;  2PIA A;  2KMC A;  5E6N A;  3TCA A;  3QC8 B;  1QOF A;  4HPM B;  1NEN B;  2BVC A;  1YX5 B;  1PYW D;  2EEL A;  4GB9 A;  3ZGZ A;  4NAW A;  2Z0E B;  2K1F A;  3PRZ A;  1WR6 E;  4KX6 B;  1TYG B;  2KQ4 X;  5EDS A;  2DZI A;  1C1Y B;  5IN7 A;  4YTM B;  5HG2 A;  4HCN B;  2LZ6 A;  2IBI B;  2QMT A;  3L08 A;  2GBK A;  5E6P A;  4BFR A;  1SE4 A;  1JWS D;  2R2O A;  3ZDT A;  1HTO A;  2KHW B;  3AUL A;  1XCQ L;  4EE2 A;  3VTV A;  1HQR D;  4ZRQ A;  3TL5 A;  4US9 A;  2JY6 A;  3T3N A;  5MPO A;  4BZA A;  3IT4 B;  4P1B C;  3E56 A;  2JXT A;  4GIV A;  2KNB A;  3ZNG C;  5E6O A;  2H89 B;  4RGM A;  3PHW B;  1GPX A;  1MHX A;  1KOT A;  3RI7 C;  1EM7 A;  2YVC A;  1YN5 A;  3H8H A;  4LNI A;  4N9F 4;  2KJ6 A;  2KDI A;  2C7N B;  3BYY B;  4DHZ E;  3DHI C;  2QIL A;  4WH4 A;  4DDI D;  3QA8 A;  2K8B A;  4CHK A;  4M8N A;  3RZF A;  2KOX A;  4IC7 B;  3R8B A;  1QIL A;  1NYR A;  2WXK A;  3HVZ A;  1GJZ A;  4BKG A;  4MSM B;  3ML9 A;  1P98 A;  2LRU A;  4ARC A;  1SBB B;  2XK5 A;  3MC8 A;  4PT5 A;  2DZK A;  3IAM 1;  1MPE A;  3I57 A;  4MJS A;  4AWJ A;  2INC C;  3H7S A;  4DK5 A;  5HKH A;  3KUC B;  3EFU A;  4AJY B;  4BOS C;  3T8M A;  3KYC D;  3DBL B;  3VTU A;  2KFJ A;  3CIR B;  1E7U A;  2IO0 B;  4C4V A;  3GS2 A;  2INP E;  4KGS A;  1ZUD 2;  1UBQ A;  2KWC A;  3TEW A;  1ET6 A;  1TTN A;  3P1M A;  2IDY A;  2LI5 A;  4W9E A;  4E71 A;  3Q8F A;  2BYV E;  1ESF A;  4K3C A;  2NPT A;  1WXV A;  1FO4 A;  3KVF B;  1JQ4 A;  4LJO B;  1J8C A;  3GB1 A;  3L4P A;  1FPY A;  2D11 A;  3Q69 A;  4FJY A;  3BY4 B;  1TKG A;  1TS3 A;  1IGD A;  1ISN A;  3OLM D;  3R66 C;  1RM6 C;  1D5M C;  2EMT A;  4IOI E;  3RNB C;  4AJW A;  1C79 A;  2BB5 A;  3PVL A;  2KMM A;  5IOI A;  4BKS D;  3PPA A;  3P4Q B;  2KAC A;  1R4M B;  2J52 A;  3O65 B;  1OQQ A;  2K0P A;  2DBY A;  2BTE A;  3AEF B;  4K7U A;  3M95 A;  4WJN A;  2FCS A;  3AMZ A;  2KDM A;  1WGR A;  4K7S A;  1JWB D;  5D6J B;  2W54 A;  2PTL A;  2E6X A;  5EE0 A;  1I4R A;  4BKS A;  4A8X C;  3B9J A;  2JPH A;  2OJR A;  1JWU D;  3C8Y A;  3WA0 A;  3HM6 X;  3LB8 C;  3SFE B;  2LGX A;  1WJN A;  4G0N B;  1QT9 A;  1H8C A;  2JWZ A;  3AED B;  2KC1 A;  2BQQ A;  3U4E G;  2GBJ A;  2AWT A;  3EHV A;  4ANW A;  4H2A A;  3BK2 A;  1LFD A;  2BS4 B;  3U30 A;  2D07 B;  1KFY B;  1WIA A;  1F2R I;  2QSD A;  5CHW A;  1RWS A;  5D3I B;  3VRB B;  4G3X B;  1WMH B;  5D2M B;  4A9A A;  2IY0 B;  2MJ3 A;  1M94 A;  4DXF A;  2N9P C;  3OAW A;  3GOE A;  4AQ7 A;  2DNF A;  1OEY J;  3VFK A;  1X1M A;  1N62 A;  3SHQ A;  3V61 A;  2C9W B;  1BT0 A;  1E8Z A;  2WLB A;  4XE0 A;  4R3D A;  4GN1 A;  3V62 A;  2L0T A;  1BUI C;  2XEW A;  1SJE D;  2CU1 A;  1TY2 A;  1XLQ A;  3TJP A;  1RYJ A;  4EUT A;  5GXG B;  1L5P A;  4F8C B;  1XF5 L;  3NZ3 A;  4DHJ B;  5I4D A;  3RYT A;  3V3X A;  3OJ3 A;  1TS4 A;  1WXM A;  4WWM A;  1HE8 A;  1N6Z A;  3ZW3 A;  2JYT A;  4KKI A;  4DDG D;  2KN5 A;  1E0Z A;  4WJO A;  4E3C A;  2BKR B;  3RD2 A;  1ROE A;  2HDE A;  1L0X B;  1AW7 A;  1G6J A;  1EU3 A;  5L95 C;  4DWF A;  3RPF C;  1RFK A;  3OWE B;  2Y5P A;  2ZNV B;  3T9L A;  2UU7 A;  2KTR B;  1PQS A;  2X8X X;  2GI9 A;  3ZLZ A;  2QEJ C;  2O6V A;  3LJ3 A;  2ZPY A;  2WXM A;  4LK0 M;  4LNK A;  5HI1 A;  2CJO A;  4KDI C;  1ZDX A;  2SAK A;  2KFK A;  2AQ3 B;  3C0R B;  2LXC A;  2N9E B;  1F77 A;  1V86 A;  2AL3 A;  3UQA A;  2KD0 A;  2M0X A;  3P4P B;  2DYM A;  1AAR A;  3Q14 C;  4BOZ B;  4DQO C;  1YJ1 A;  4KSK C;  1J7A A;  2G9H D;  2L3Z A;  2PKO A;  2G4D B;  3W2D A;  5FK9 C;  2WX1 A;  1FXA A;  4EZL A;  3PV1 A;  2DZM A;  2ZPN A;  1FFV A;  2MA9 B;  2CHZ A;  4M0W A;  2ZEQ A;  1V5O A;  4OVZ A;  1SE9 A;  4MAC A;  2JUO A;  4TMA B;  5J2R A;  1PDX A;  4KIK A;  1N63 A;  2BWF A;  4JE3 B;  3W5V B;  1UWX A;  2D3A A;  4ZRI A;  3APF A;  2MP2 B;  4EOY A;  2J0K A;  1FMA D;  5EE1 A;  3U8Z A;  3W1Y A;  4NY0 A;  3DBS A;  1JML A;  1WJU A;  1VCB A;  3B0A A;  2LAS A;  4WAF A;  4NPN A;  3GZN B;  4L2Y A;  2KVZ A;  1R7S A;  2RR9 A;  3AN1 A;  1TGZ B;  4MDK E;  2QJL A;  3ZNZ B;  4EKU A;  4ZRJ A;  3DBL I;  3FIL B;  1P7F A;  1WM3 A;  3AE9 B;  2C60 A;  2DHZ A;  4GDK A;  3QWZ B;  3ABV B;  3W1S C;  1C4C A;  2K6D B;  1HZ5 A;  2V3P A;  1PGX A;  1GC7 A;  3PRE A;  2LUM A;  3ENE A;  4OVU A;  3AE4 B;  5GMV A;  1CZP A;  3Q3M C;  2J4X A;  2I1K A;  5D7G A;  4TSS A;  3MHS D;  4BKT A;  2I2Y A;  4ZOH C;  2R61 A;  1MFW A;  2GB1 A;  2WNM A;  4DBG A;  3PSE B;  4B0M A;  1HA5 A;  3HIZ A;  4IG7 B;  5BO4 B;  2GOW A;  1NDD A;  1MHH E;  1Q1O A;  2FBW B;  3V6E B;  3DBH B;  2LVQ A;  3AEA B;  1QOB A;  2RPV A;  4LDT B;  4NQK E;  4WUR A;  3A9K A;  1DGJ A;  2K3U A;  2KKC A;  2M4N A;  2GMI C;  1T0Q C;  2K5P A;  3B2G A;  1KJT A;  4HDQ A;  1IUE A;  3IG3 A;  3VQI A;  2IO3 B;  1R4M I;  3ETR A;  1C4A A;  3C19 A;  4FJV B;  3EUB 2;  3SEB A;  1V9J A;  2RD0 A;  1XD3 B;  2OOB B;  3L10 B;  4IKG A;  3Q2A C;  2DWQ A;  2ZVO A;  4XYC A;  1TKY A;  4KGR A;  2BGF A;  1CQV A;  1UD7 A;  3BYT B;  1L6V A;  4FJZ A;  1J19 A;  3UIN B;  2WP9 B;  2GBN A;  4ZYN A;  1OTR B;  2WDV B;  1ZXH A;  5LLI A;  1VD2 A;  4ARI A;  2KLG A;  3Q3N C;  3W9C B;  2ZVN A;  4O1N A;  2KTF A;  1VRA B;  2JZP A;  3HK0 A;  3N20 C;  1WY8 A;  2MBE A;  4CO7 A;  4JX1 C;  2NR2 A;  3UIP B;  4B6W A;  2KXJ A;  2QHO A;  2XBB C;  5H8Y E;  1YNT E;  3WAN A;  2OJW A;  2NS5 A;  2MQJ A;  2RGF A;  2WXH A;  3ONS A;  3U52 E;  3K9O B;  4A3P A;  1GC6 A;  3I5J C;  4ICV A;  4JIO U;  4FA6 A;  2NPT B;  3JVZ X;  2WYQ A;  2MX2 A;  2YLM A;  2J42 A;  2N9X A;  2D3B A;  1T0R C;  2INN E;  3QCA A;  3RNG C;  5G2N A;  3W5U B;  2VZK B;  2LWP A;  2DX5 B;  4GGQ A;  5C3J B;  5C23 A;  1I4G A;  1SXT A;  4YTN B;  4W9I A;  5DPT A;  5T8I A;  4WWO A;  2B3A A;  1QKZ A;  3NOB A;  1XQQ A;  3DWM A;  1UWM A;  4REZ A;  1WZ0 A;  3A1Q B;  1BXT A;  4W9H A;  3RFZ B;  2WHI A;  3NRZ A;  3P63 A;  2KDB A;  2PMV A;  4MM3 A;  1GUA B;  1YMH E;  5H92 C;  4ZDV A;  2WS3 B;  4OVV A;  3B08 A;  2KDE B;  3VXW A;  3B2F A;  3DVN U;  1N60 A;  3P2B A;  2LVO A;  2KAN A;  3IBE A;  3ZDM C;  1K53 A;  1Q5W B;  2JVC A;  4WWP A;  3P4R B;  3NVZ A; 
#chains in the Genus database with same CATH homology
 4HJG E;  1WYG A;  1N5W A;  1JWB D;  1VR9 A;  1ACC A;  2V3N A;  3PO0 A;  1ZOY B;  2W54 A;  2PTL A;  2L52 A;  2E6X A;  1FNV A;  1K52 A;  5EE0 A;  1I4R A;  1ENF A;  3AEB B;  4A8X C;  3B9J A;  1JWU D;  4JPS A;  4CQN A;  1V1O A;  2LHE A;  3MC0 B;  3C8Y A;  3PZ8 A;  4RFB A;  1FRD A;  3LB8 C;  4YWG G;  2XNA C;  3SFE B;  4DXG A;  2WXR A;  1QT9 A;  1F2R C;  2G1E A;  3MJ5 A;  3AED B;  1DOY A;  3VRA B;  2L83 A;  2WXP A;  1DOI A;  3Q8E A;  2LHD A;  3U4E G;  3AE5 B;  1P7E A;  1I4Q A;  1YJJ A;  2Z8L A;  4NJC A;  1PFD A;  5BMI A;  3ZJT A;  1XEE A;  4C7Y A;  3EA6 A;  3BK2 A;  4H2A A;  1FFU A;  1I4H A;  4N6E B;  2BS4 B;  1TS5 A;  1L6U A;  1KFY B;  1QQR A;  1J7C A;  3BVM A;  1C4P A;  1F2R I;  2QSD A;  3URY A;  1RWS A;  5D3I B;  3VRB B;  4MH8 A;  4Q2J A;  5G5H A;  3BII D;  1TZO A;  4XWT A;  4A9A A;  1FD6 A;  2D5G A;  3KLS X;  1JCK B;  2MJ3 A;  3TEZ A;  1VZ7 A;  1NYQ A;  3ZJU A;  4DXF A;  1FM0 D;  2DYO A;  3T3O A;  3TEX A;  1C9F A;  3J9C A;  4AQ7 A;  1MVK A;  1AWD A;  3IT6 B;  3ZJV A;  1N62 A;  1N61 A;  3IAS 1;  2WLB A;  4XE0 A;  4R3D A;  3PZ7 A;  2IJ0 A;  1BUI C;  4TQ0 A;  3AEC B;  1ZE3 D;  2K22 A;  5EE9 A;  5BMH A;  1SJE D;  4LTU A;  4RGN A;  2BT6 A;  4RF0 A;  3I9V 1;  1L4Z B;  3ZYY X;  1TY2 A;  1XLQ A;  1XLO A;  5FR3 A;  1SF0 A;  3NVW A;  1RYJ A;  5GXG B;  1Q10 A;  3O13 A;  1L5P A;  2LJI A;  4OHJ A;  1XF5 L;  2BS2 B;  2JX5 A;  3NZ3 A;  3SR6 A;  5I4D A;  4RCO A;  1FNW A;  2LMC A;  3V3X A;  1TS4 A;  4FXC A;  1AYF A;  4WWM A;  4RF1 A;  2IPK D;  4XDC A;  1T3Q A;  4P16 A;  2JYT A;  4KKI A;  4C80 A;  1E0Z A;  1Y56 A;  2WXI A;  1ROE A;  2HDE A;  3MP9 A;  1L0X B;  2BB6 A;  1WWT A;  1AW7 A;  1QLB B;  2WQY B;  2IGD A;  5BYR A;  2M19 A;  1EU3 A;  2MJD A;  1YQ3 B;  1TS2 A;  1XO3 A;  2JU6 X;  2L1A A;  2SEB D;  4IDI A;  3R2I A;  4ZRP A;  5BYQ A;  1RFK A;  3RPF C;  2Y5C A;  2ON8 A;  3GP7 A;  3OWE B;  2Y5P A;  5HHD G;  1SSN A;  2AQ2 B;  1ZXI A;  3CWI A;  4XWW A;  1IBX B;  1JW9 D;  2KWD A;  2N0S B;  4A6Q A;  1HXY D;  2JSV X;  1JRO A;  3HVD A;  2JQR B;  2GI9 A;  2QEJ C;  2OHF A;  3Q8B A;  4GDL B;  3KWL A;  4D2K A;  2DLB A;  1YQ4 B;  3NUH B;  1AN8 A;  1EU4 A;  2WXM A;  4LK0 M;  5HI1 A;  1JWM D;  3P4S B;  2CJO A;  2KN4 A;  1VLB A;  4UDU C;  1ZDX A;  2SAK A;  1WGK A;  3TSS A;  2WXL A;  1KRH A;  3SFD B;  4JWU C;  2AQ3 B;  1KLG D;  4US8 A;  1F77 A;  4OW0 A;  4N59 A;  1NI3 A;  4TQ1 A;  3P42 A;  2CJN A;  3N9Y C;  3AE8 B;  3P4P B;  2DYM A;  2N9K A;  4USA A;  4DQO C;  3R2T A;  1CJE A;  1V97 A;  1J7A A;  2G9H D;  5TSS A;  3VR8 B;  2YEP F;  2PKO A;  1GB4 A;  3W2D A;  5FK9 C;  1XCT L;  1FXA A;  2ZW1 A;  1YN4 A;  5EE3 A;  1V1P B;  1FIQ A;  1M4V A;  1PGB A;  1V1P A;  3AE3 B;  4RH6 A;  1FFV A;  3AE7 B;  1HEZ E;  1CK1 A;  4AS1 A;  3BVG A;  1D6E C;  1VDV A;  4M0W A;  2M56 B;  4OVZ A;  2W3S A;  1E10 A;  3NVY A;  2LFI A;  3BVZ A;  4MAC A;  4TMA B;  2JYE A;  4HRS A;  2WU2 B;  1PDX A;  1KH0 A;  1T5X D;  5E6J A;  1N63 A;  2LGI A;  2WDR B;  3AE1 B;  2CU3 A;  4JE3 B;  5BMG A;  3W5V B;  3AM9 A;  1GAQ B;  1PUT A;  2BW2 A;  1UWX A;  1ZP0 B;  1C78 A;  2JWU A;  1ET9 A;  1FMA D;  1YJI A;  2H88 B;  2K9X A;  2XN9 C;  4OZC A;  5EE1 A;  1FCL A;  2MEK A;  1FCC C;  1JML A;  2WXF A;  2X38 A;  1JAL A;  4WAF A;  4RGO S;  2RDH A;  3MHZ A;  1J7B A;  2VZK D;  1D4B A;  4L2Y A;  4YSY B;  1SE2 A;  4C7Z A;  3BZD B;  1WXQ A;  1R7S A;  4P6V F;  3FC4 A;  3HRD D;  3AN1 A;  2QJL A;  2M0A A;  1QF6 A;  1KTK A;  1I4P A;  2Y3A A;  1TKE A;  3AB5 A;  3U7Z A;  3LXF A;  2PW9 A;  1C77 A;  1GB1 A;  3KQ4 A;  2GRI A;  3IXS A;  3FIL B;  3FIL A;  1GOZ A;  1OFF A;  2PIA A;  2WXQ A;  1QOF A;  4RGT A;  1P7F A;  2J53 A;  3AE9 B;  4ITK A;  2LEK A;  1ZPS A;  2FE8 A;  4GDK B;  1NEN B;  3W1S A;  3ABV B;  3V05 A;  1C4C A;  2EKI A;  3AV8 A;  1PYW D;  2EEL A;  3ZGZ A;  1HZ5 A;  4OZA A;  2V3P A;  1PGX A;  4NZL B;  2LUM A;  4RNA A;  3AE4 B;  1CZP A;  4KX6 B;  2J4X A;  2WXG A;  5D7G A;  3VR9 B;  1TYG B;  4TSS A;  2WU5 B;  2KQ4 X;  1T6B X;  1XLN A;  4YTM B;  5HG2 A;  1TJE A;  2I2Y A;  4WIP A;  4ZOH C;  2R61 A;  2WXO A;  2AX5 A;  2QMT A;  3NVV A;  4A90 A;  2GB1 A;  2WNM A;  1VZ8 A;  4B0M A;  1HA5 A;  1SE4 A;  1JWS D;  1MI0 A;  4WQM A;  2V4I B;  4HKZ E;  1XCQ L;  2BYT A;  1MHH E;  1NVI D;  1JRP A;  4EE2 A;  2FBW B;  1JWA D;  1EWC A;  1E6E B;  3AEA B;  1HQR D;  1QOB A;  2RPV A;  4ZRQ A;  3UI3 A;  3BWU D;  4US9 A;  3T3N A;  4WUR A;  2IGH A;  1DYQ A;  5MPO A;  1XXG A;  1DGJ A;  1E7P B;  2K3U A;  3IT4 B;  1QOG A;  3E56 A;  2JXT A;  2N9L A;  1B9R A;  2ACZ B;  2H89 B;  3HUI A;  4YT0 B;  4RGM A;  4YXD B;  1L0Y B;  1GPX A;  1MHX A;  5FKA C;  2K5P A;  3B2G A;  3AE2 B;  1IUE A;  3VQI A;  3ETR A;  1C4A A;  1EM7 A;  3EUB 2;  1YN5 A;  3SEB A;  1UNS A;  3H8H A;  3FAH A;  4JWS C;  1PGA A;  3BYY B;  4IKG A;  4YSX B;  2DWQ A;  2KAJ A;  2NTS A;  1TKY A;  1TY0 A;  2ICI A;  4L1B A;  1I7H A;  4KGR A;  2QIL A;  2ONQ A;  4WH4 A;  2WXN A;  3WCQ A;  1CQV A;  3BYT B;  1L6V A;  3KWV A;  1V8C A;  2PVG C;  1D5Z C;  4MT5 A;  1SEB D;  2WP9 B;  3R8B A;  3LYY A;  1QIL A;  1NYR A;  2FUG 1;  2WDV B;  2WXK A;  3HVZ A;  1ZXH A;  2RMM A;  4NAM A;  2W3R A;  1L4D B;  1KF6 B;  2PLP A;  4XDD A;  4ARC A;  3MFG A;  1SBB B;  4ARI A;  2NMQ A;  4C56 C;  3W9C B;  2WDQ B;  5G5G A;  1SJH D;  1FEH A;  4PT5 A;  3IAM 1;  1I4X A;  5JXV A;  1MPE A;  4ZHP A;  3Q8A A;  4O1N A;  3I57 A;  1VRA B;  2JZP A;  1B1Z A;  1KLU D;  2E3T A;  4N58 A;  3NS1 A;  1YN3 A;  3AH7 A;  4JX1 C;  1WRI A;  3AEE B;  2L32 A;  3CIR B;  1FNU A;  2MH7 A;  4KKJ A;  1E9M A;  2Q5W D;  3GS2 A;  5H8Y E;  1VZ6 A;  3U2S C;  1SIJ A;  1YNT E;  2INP E;  4YTP B;  1HZ6 A;  2PVO D;  4KGS A;  1ZUD 2;  5HFY A;  1NEK B;  1FXI A;  1A70 A;  4HEA 1;  1EWY C;  2WXH A;  3TEW A;  1ET6 A;  1K51 A;  3U52 E;  5D3D A;  3P1M A;  2IDY A;  1UGJ A;  1XLP A;  1WSP A;  1BML C;  3EGR A;  4B0E A;  2AQ1 B;  2I38 A;  4HKQ A;  1K50 A;  4GLS C;  3Q8F A;  5AUK A;  1ESF A;  2B76 B;  1SE3 A;  2IGG A;  2J42 A;  2QIE B;  1LO5 D;  5LNK 1;  1FO4 A;  1SB3 C;  2INN E;  3AEG B;  4NAW B;  1JQ4 A;  1F0Z A;  3GB1 A;  3W5U B;  4YSZ B;  2MJE A;  1OQR A;  2HTM E;  2VZK B;  2BBC A;  1UUP A;  2W55 A;  4L23 A;  1N5X A;  3L4P A;  3ZQ4 A;  1DOX A;  4ZHO A;  4KGT A;  4A55 A;  1QOA A;  3Q69 A;  5C2T B;  5C3J B;  1I4G A;  1IGC A;  1SXT A;  2BS3 B;  2WXJ A;  3TUO A;  1TKG A;  1TS3 A;  1IGD A;  4YTN B;  2RDG A;  1RM6 C;  1D5M C;  5T8I A;  1VJK A;  2V0G A;  3AE6 B;  1QKZ A;  4IOI E;  2ZW0 A;  3DWM A;  3Q8C A;  5BYS A;  1C79 A;  3TEY A;  2BB5 A;  1UWM A;  4REZ A;  5AUI A;  2KMM A;  1D5X C;  2OED A;  1C76 A;  1BXT A;  3P4Q B;  2KAC A;  1L0V B;  4OZB A;  1ZDV A;  2J52 A;  2NTT A;  3BK1 A;  3RFZ B;  1OQQ A;  2N7J A;  2K0P A;  2DBY A;  3NRZ A;  3P63 A;  2BTE A;  4J3O D;  4MM3 B;  2PMV A;  1IBX A;  1FRR A;  1YMH E;  2W82 A;  3AEF B;  5H92 C;  2WS3 B;  3DWG C;  3AMZ A;  3B2F A;  4LLG M;  1N60 A;  4ZYS A;  3E9S A;  2YEP B;  1K53 A;  1STE A;  2TSS A;  2KDM A;  4HRO A;  3P4R B;  3NVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...