1FCCC

Crystal structure of the c2 fragment of streptococcal protein g in complex with the fc domain of human igg
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
TTYKLVINGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/antigen)
molecule keywords IGG1 MO61 FC
publication title Crystal structure of the C2 fragment of streptococcal protein G in complex with the Fc domain of human IgG.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 56
sequence length 56
chains with identical sequence D
ec nomenclature
pdb deposition date 1995-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fccC00
2K0PA 1HZ5A 1PGAA 4HKZE 2JWUA 1IGCA 2KN4A 5BMHA 1XF5L 2GB1A 2LHDA 2N7JA 2JZPA 4KGRA 2J52A 2N9KA 1IBXB 1F2RI 1FD6A 2I2YA 2JXTA 4OZBA 2ON8A 1MVKA 2N9LA 3GB1A 4WH4A 2ZW1A 2RPVA 1IGDA 1HZ6A 1YNTE 2IGHA 1C9FA 3MP9A 4OZAA 2I38A 1MI0A 1XCTL 2GI9A 2PTLA 2LUMA 2QMTA 1P7EA 2PLPA 1FCCC 2LHEA 2QSDA 2NMQA 2IGGA 1XCQL 1K50A 4GLSC 1PGXA 5HG2A 2KWDA 4D2KA 1HEZE 2JU6X 2KQ4X 2ZW0A 1MPEA 5HHDG 3UI3A 4IKGA 2RMMA 1GB1A 5JXVA 1UWXA 5HFYA 2LGIA 4KGSA 4IOIE 1KH0A 1YMHE 1FCLA 5BMIA 2KACA 5HI1A 1K52A 2EELA 3FILA 1EM7A 1MHHE 2OEDA 1PGBA 3V3XA 1JMLA 1IBXA 2IGDA 2PW9A 3FILB 1K51A 2ONQA 1F2RC 5BMGA 1K53A 4HJGE 4MACA 1QKZA 1ZXHA 1D4BA 1MHXA 1Q10A 2KDMA 1GB4A 4OZCA 4KGTA 2JSVX 2J53A 1P7FA
chains in the Genus database with same CATH superfamily
3NS8A 2R2QA 2UYZB 4C56C 1S1QB 4OW0A 5G2NA 3R7RA 2DBYA 2KN4A 3ZXRA 2DENB 4DBGA 3BIID 3ZNZB 4REZA 2JZZA 5GXGB 3I57A 3D32A 1FD6A 3CF6E 4RCOA 4I6LB 4HVBA 3N20C 1NI3A 2BT6A 1V97A 4WJOA 1V80A 2DZIA 5CHFA 5LLIA 2J0KA 1J0GA 3OJ4B 1FRDA 2LUEA 4W9JA 4B9KA 3VVWB 2Z8LA 3HVZA 3QJZA 2Y5CA 2JPHA 2KKCA 3P4SB 1B1ZA 3CIRB 1T6BX 1XXGA 1B9RA 2I1KA 3AN1A 2NBWB 3DVNV 2KQ7A 1OQQA 1HTQA 2B76B 2DNFA 2NTTA 2W3SA 2KDBA 3VFKA 2ASQA 1FM0D 2AEHA 1WM3A 2LGDA 4AUQC 3ZVVA 3DBHI 3ZNGC 1C76A 4GDLB 2K6DB 2FAZA 3Q14C 2NTSA 1NEKB 4GDKA 3A9KA 2LASA 4ANUA 3W1SA 3AU4A 2KWUB 1VJKA 2LVPA 1E9MA 3AH7A 2MQJA 4BAXA 3A4SC 3PTFC 1FXAA 4S0RA 4BZAA 4PT5A 2WDRB 3AXCA 1QKZA 2DLBA 4HROA 1CQVA 2KDMA 1SJED 4YSYB 1WZ3A 2V4LA 3ECIA 3LJ3A 5EE0A 2NCNA 4II3B 4G11A 4WIPA 3ZJVA 2L32A 2JX5A 2LJ5A 2R2OA 1E8ZA 3VRAB 3QX1A 5AZGA 3W5VB 3B0AA 4M0WB 2C5LC 1QILA 3TEZA 2ON8A 3EFUA 2WDQB 4G0NB 2NPTA 4JL9A 4WH4A 3APFA 4GIVA 4MSQB 3OWEB 4ZRIA 4XC2A 1WE7A 2LXCA 4FN2A 1XT9B 4FULA 1UGMA 1J7CA 3PLVA 5EE3A 3H1UA 4YT0B 1XQQA 4PYUA 4NJCA 4WWOA 3IVFA 2OOBB 4IUMB 4HPLB 1FFVA 1Y56A 4EZKA 2K8HA 2IZVB 3GS2A 3Q8EA 4NAWB 5JXVA 4YL8A 3E9SA 1WXMA 3HK0A 3PHWB 4BKSA 1IUEA 1YMHE 2LGSA 4EEWA 2Y5PA 2BGFA 1K52A 1HTOA 3U7ZA 3AV8A 3KLSX 2LEKA 2WXFA 2DHZA 3AEDB 3PHXB 2AL6A 4XGAB 1IBXA 1FNUA 2BKRB 3V61A 4ANWA 5DPWA 3VTWA 5BYSA 3TBLD 2PIAA 2KJ6A 2AWTA 2ZCBA 1QOFA 4MACA 1WXQA 1MHXA 3EA6A 2WX0A 1NENB 2JWUA 3AEAB 3KH0A 1K8RB 1SEBD 3MC0B 2MRPA 2JZPA 1TZ1A 4A9AA 2J4XA 4K1RB 4ZHPA 1YIWA 3NVYA 4L23A 4DXGA 4JPSA 5MPOA 4MGZE 3M3JA 4EOYA 1IGDA 2WXGA 3DBHB 1TBEA 3Q3MC 3RFZB 2WXJA 2WXOA 1N6ZA 2BWES 2FCMA 3ZO5B 4C4VA 4NQKE 2ZCCA 4G50A 1SIFA 3EFCA 1XLQA 2BWFA 2R61A 2N7EA 4GSWA 1I4QA 2EMSA 3KYDD 4FJZA 1QQRA 4K7WA 3SFEB 5C3JB 3Q3OC 2KWVB 2Z59B 4A6QA 2N0SB 1N63A 3DPDA 4KZCA 2K39A 4DDGD 4RM8A 2V0GA 3V05A 1WYGA 4M02A 3HIZA 4GU2A 1L0YB 4MELA 3RNAC 3ZRFA 2JT4B 4A3PA 1TKEA 2ONQA 4XZ4A 3R66C 2INPE 1PDXA 5CHWA 4HRSA 1HXYD 3AB5A 1SE3A 4LCDE 4ASWC 1WGYA 4FJYA 3IFWB 3U4EG 1UH6A 2MBEA 2KAJA 3DVNU 4L2YA 2GMIC 1N5XA 3W1YA 4IWPA 3GZNI 2LHDA 3RNGC 4MEMA 1F1HA 4BOZB 1KM7A 1DOIA 2IO2B 3KW5B 1WGRA 2HTME 4TQ1A 1I4RA 4KZ0A 1DOXA 3SEBA 3DWGC 1J7AA 1JRPA 1ZXIA 4US8A 3DHIC 1JW9D 4OZAA 3RNEC 3WA0A 4MJSB 2GBRA 2W54A 3DBRB 2IJ0A 4RM9A 3QARA 2VH1A 4W9DA 4A8XC 5GMVA 4I6PA 4GXBA 2LJIA 4F8CB 3LB8C 1TKYA 2DWQA 2FBWB 1D3ZA 3TIXA 1KLUD 2G4SA 2MWSB 1YQ3B 5T8IA 4TUUA 1MFWA 5HG2A 1L4ZB 3W5UB 1JRUA 4YSXB 1TYGB 1CZPA 4LJPB 5H8YE 1V2YA 2KO3A 1FIQA 2KDIA 4JQWC 2ZNVB 2CS4A 2QHOA 4ZRKA 3RMKC 4JIOU 5EE1A 1FNWA 4EZLA 1WI0A 2WS3B 1TY0A 2HE7A 4B0MA 2K6QA 3RN9C 3IT6B 1V81A 4MGKE 1YQ4B 2JF5A 1R4MI 3ZKJC 1NDDA 3KWVA 2BYTA 5LXHA 3KYCD 2JWZA 1ZDXA 1J19A 3ZQ4A 1L7YA 1IGCA 2KTRB 3QHTA 2RR9A 3OLMD 4LDTB 1EWCA 1I4HA 4M01A 1VZ7A 3JVZX 3CSTA 4OZBA 4ITKA 2VZKB 3A1QA 3K9OB 2M1MA 2KLGA 2D3AA 2PJHA 1T3QA 4DHJB 4NAMA 4YXDB 4P7IA 4N6EB 1TS4A 3RCZA 3L13A 2PLPA 4M00A 4FBJB 5E6NA 2BYEA 3ZRCA 2L0FA 1OQRA 4PK1A 2NR2A 1R4NI 5G5GA 1L0VB 4WQMA 1I4XA 3M62B 2XEWA 3ZDMC 1HEZE 3M63B 4B95A 5IP4D 4IKGA 1N60A 1SXTA 4DWFA 4LLGM 3DBSA 1OEYJ 5BMIA 3GZNB 3VXWA 3ZDTA 3NZUA 3SD5A 5JHBA 2ZVOA 4LDTD 4GGQA 1T5XD 4BBNC 2GRIA 4OVZA 1F0ZA 4JWUC 2VZKD 3BK2A 1MJDA 5BMGA 2JY6A 1WR1A 2KK8A 1WWTA 2JXXA 1UBQA 2H89B 3DBLI 3BY4B 4C80A 2KOXA 4DHJD 4GOCA 1AWDA 3IXSA 2M0XA 1GB4A 3WALA 1EU4A 4HPPA 1P7FA 4KGSA 3GOEA 2KNBA 3QWZB 4ICVA 3EUB2 2L52A 1XF5L 5AUIA 2BTEA 2WU5B 4HLEA 3MJWA 1DOYA 1WGKA 1NYRA 2IY0B 4HCPB 1D5ZC 3DWMA 4BKGA 2I2YA 2GLSA 1WH3A 1OEYA 4GDKB 3A9KB 4YTMB 2ZW1A 4IG7B 4XWWA 1HZ6A 3MP9A 4IM0A 4GMVA 3TUOA 3PRPB 2X8XX 4W9IA 1XEEA 2W55A 3M95A 4NJ7A 3H7PB 2KMCA 1TGZB 2O6VA 2OJRA 4HJKA 4A20A 2BPSA 2LHEA 1GNUA 2BW2A 4MH8A 1KOTA 3IG3A 4ANXA 1R4MB 2FUG1 3VH4B 4GLSC 2N4FA 2LVQA 3N30A 3HVDA 3S2AA 2LFIA 3HM6X 3AE9B 2HJ8A 3T3OA 1ZDVA 2NPTB 1V5OA 2LI5A 4PS3A 3APCA 2EKEC 3DQVA 3WAOA 1PYWD 4C7YA 1VLBA 2BS2B 4H2AA 1PGBA 3Q3JA 2AQ2B 2CKHB 2J42A 3EHVA 4W9FA 2QIEB 1TJEA 3RZWC 1F2RC 1V5TA 2V1YA 2W9NA 3IT4B 4FXCA 2JRHA 4W9EA 5IKCM 1C4CA 3ZXVA 5IAAC 2C60A 2B3AA 2ZPYA 1Q10A 4YSZB 2JSVX 2K3UA 1Q5WB 1UNSA 3I63C 1N5WA 1R4NB 1L6UA 1GPXA 4WQOB 4CQNA 5CTRC 2KJRA 4P16A 1LO5D 1N62A 1TS3A 4IWQA 1BMLC 1GC7A 1WJNA 2K8BA 3Q3FA 3ZIMA 1IBXB 1WJUA 4AWJA 1ROEA 2D3GA 1MVKA 1Q1OA 3H7PA 3B1LX 3B9JA 2KHWB 4LTUA 3MC9A 1XLNA 1V49A 2MJ3A 5D7GA 3X0WA 3P42A 2DYMA 3VTUA 2N9XA 2WXPA 3NS1A 4K3BA 1T0RC 3IAM1 1H8CA 5FKAC 4PS8A 1QOAA 2BS4B 2FCQA 3DBLB 3FKYA 5JHAA 1V1PA 1L2NA 2KWDA 1XLOA 4J3OD 2E6XA 2CU3A 3AE8B 3AE1B 4NZLB 2NBUA 2KJHB 3O65B 5C2TB 3FC4A 3VR8B 2LGIA 4NJ6A 1C3TA 4BKSD 2G9HD 2CJOA 1JQ4A 4HDQA 1KTKA 3NUHB 3AEGB 1GAQB 1WRIA 1EF5A 4ZYNA 2GBMA 3RNCC 1IYFA 1UWMA 2ZZPB 5DPSA 1JMLA 3MTNB 3BZDB 3PV1A 3WAMA 4C4VB 2BB5A 3RNBC 5BYRA 4W9CA 4WWNA 2GBKA 1PQSA 3AM9A 4WWPA 1NYQA 3WAPA 3AE6B 3AMZA 3Q2AC 4BOSC 4KGTA 2J53A 2J7QB 2BF8B 4QAYA 1WZ0A 5J18A 3C19A 3DBRI 1KLGD 2PE6B 1ZUD2 2AQ3B 1LGRA 5BMHA 3GE3C 2M4NA 2M19A 3EGRA 1TTNA 2HTHA 1ZP0B 3ZLZA 2VH2A 1HE8A 3N9YC 2GBNA 1AARA 2LRUA 2NS5A 3BINA 2JYTA 1ZKHA 1RM6C 2K5PA 2KN5A 3GB1A 3V6EB 2RPVA 1WRDB 2M17A 1GJZA 3NVWA 2JYEA 4ZYSA 3EC8A 2WYQA 1WIAA 2XN9C 2UU7A 1MG4A 2TSSA 1FCCC 1V6EA 2N9EB 4N59A 3PZDA 3R2TA 5EE9A 1ET6A 2IGGA 4RGNA 1STEA 4MGYE 1K50A 3C8YA 4GB9A 3AEFB 1ZW7A 2IDYA 1GB1A 5L95C 2L83A 4P1BC 1JALA 4ARIA 1WY8A 1QF6A 1VZ6A 4C7ZA 1FXIA 2J0JA 4IC7B 4FADA 1EU3A 2OEDA 1UELA 3I9V1 1P0RA 1QLBB 1D5MC 4FJVB 4HPMB 4CYEA 2ZPNA 2INNE 2IPKD 3L4PA 5FR6A 3V60A 1V86A 1E7VA 4R3DA 3MJ5A 1I7HA 1V9JA 4M8MA 1WE6A 4I6NB 2QILA 4RMAA 2GBJA 1WMHB 1QZEA 3P1MA 1E8XA 1HQRD 1TS5A 1WJ4A 3PS6A 3PRMB 3ML9A 2KT7A 2MEKA 3BWUD 1RYJA 2CHXA 2KDEB 4A55A 1SE2A 1UF0A 4FHJA 3IAS1 1VCBA 4RF1A 3DVGY 2KFJA 4F1SA 1FNVA 2WGSA 1YNTE 1WGHA 1E7PB 2FE8A 3BVMA 3BYTB 2IBIB 1R7SA 4TMAB 1PUTA 1RWSA 1A5RA 1KF6B 1E10A 4OVUA 1YD8U 2ZVNA 3VH3B 1AW7A 3L54A 1C77A 2KTFA 2NMQA 5J17A 1XCQL 2YVCA 1RAXA 1J8CA 2BKFA 4YTNB 4MM3A 3A1QB 4FHKA 2L00B 1LFDA 4KIKA 5IOIA 4WJNA 1FCLA 3DVGX 4PYZA 3ONSA 4ARCA 1T0SC 2WXQA 2N1VA 2WDVB 1FMAD 1WXAA 2FIFA 1YJ1A 1RLFA 1TKGA 3AI5A 2J0MA 1C4AA 3ZUNA 2IGDA 2DAFA 2RDBC 1WMHA 3H6NA 5IA7A 2V9HA 1L4DB 1UBIA 2WNMA 2HDEA 4KKJA 2V3NA 4TQ0A 2IYDB 3HM3A 3C0RB 2DAJA 2CU1A 4EUTA 2LWPA 5I4DA 4IW0A 5E6JA 4AS1A 3WCQA 1FPYA 4KSLC 1L5PA 2WX1A 3VTVA 4HXDA 1MG8A 1WJ6A 2K1FA 5TR5A 3Q8AA 2JXTA 1TZOA 5AEKB 3PZ7A 2XNAC 2N9LA 1E0ZA 2LGXA 3WIMA 2V3SA 1F77A 4E71A 2YEPF 4K7SA 1XLPA 4RGMA 2E3TA 1MI0A 2EMTA 4JLCA 3RD2A 1JWUD 5FR3A 1X1MA 2D3CA 3KQ4A 3P4RB 2M56B 4AP4C 3T3NA 3UGBB 3OG5A 3ML8A 4WJPA 4CHKA 1V1OA 3CWIA 3VR9B 1ISNA 3AU5A 3U8ZA 2O2VA 4EZJA 4OVVA 5D3IB 2Y5BB 5BO4B 3RT3B 1KJTA 5HFYA 4W9KA 3AE2B 1GUAB 3Q8FA 5HI1A 1LXDA 1YN5A 2KVZA 3NZ3A 3ZGZA 3AE3B 2EELA 2RDHA 3APDA 5EDSA 2WHIA 1XD3B 2CJNA 3TEWA 1E8WA 3ENEA 2L0TA 3ZJUA 1NI2A 3QA8A 1FRRA 1WR6E 1BT0A 2AQ1B 2FCNA 2O6VB 3AE5B 2WXRA 5BYQA 2IO1B 4W9LA 4AJWA 3FILB 3PSEB 4LNIA 2M0AA 2K8CA 4RNAA 2L7RA 2SEBD 2Z0DB 3ZTCA 4EE2A 1KRHA 2MSED 4P1CC 5JZEB 2L8JA 1F9JA 1YOVB 1L6VA 2INCC 5DCNA 1D4BA 3TJPA 4OZCA 1CK1A 2KXJA 1HZ5A 2LZ6A 3L17A 3KUDB 2D3BA 1P3QU 2WQYB 1QOGA 3UINB 1I42A 2GB1A 1J7BA 2N7JA 3ZJTA 1P1AA 1P98A 4ICUA 2W3RA 3L16A 2RDGA 3AEEB 2MBHA 2OJWA 3QIJA 4XE0A 4DHZB 2BS3B 2KFKA 2KQSA 1TS2A 2C7MB 3RNFC 5J2RA 4G3XB 5AZFA 3URYA 3PGEA 1ACCA 1GC6A 2O6VD 5DPTA 3UF8A 2MP2A 2KX0A 3R3MA 3VQIA 3DHGC 2OHFA 3ALBA 3P2BA 4II2B 4N9F4 1IP9A 4X57B 2M8SA 3JW0X 3VUYA 4WJQA 2H88B 3KUZA 2Z0EB 4HEA1 1C4PA 1YX6B 2ACZB 4BKTA 3NVVA 4NY0A 1T0YA 3RULA 1RFAA 4OHJA 1H4RA 1JCKB 1PFDA 3H9DA 3FILA 3GE8C 1A70A 2MX2A 3X23A 3HUIA 1E6EB 1SF0A 4RGTA 1HA5A 3RZFA 3ZNHB 4LNNA 2PEAA 1SSNA 4F7ZA 3BYYB 1ZGUB 2PW9A 1K51A 3JSVA 5D94A 1V1PB 1WF9A 4JE3B 2JRIB 1UD7A 1JROA 4JWSC 4LNFA 4AQ7A 1YJJA 2MA9B 3PREA 3P4PB 4MGIE 2L1AA 1P9DU 2MBOA 3Q8CA 4S17A 3J9CA 4P6VF 3R7QA 1I4PA 3PT2B 1VDVA 2D11A 3A9JA 4E3CA 2REXA 4JX1C 2KC2A 1ET9A 2KWCA 2N9KA 2XK5A 4KGRA 4LNOA 3NY5A 1E5WA 2LGYA 3CMMB 2NBVB 3QK0A 3L08A 2L05A 1ENFA 2I1JA 1C78A 4WWMA 3W9CB 3I5JC 5CX3A 4K7UA 4BFRA 4EKUA 4XDCA 2LUMA 3RUIB 1YJIA 5CHVC 1SIJA 5KHOA 5HKHA 2QSDA 3Q3NC 2D10A 1TIFA 4ACFA 1JWBD 1PGXA 1WXSA 2VRRB 2BBCA 3B08A 4IDIA 4YTPB 4B6WA 2KQ4X 3OAWA 2BYFA 1EUVB 2BB6A 3SDLC 3W2DA 3NRZA 4HWIB 3EECA 4EFOA 4PS7A 2JZ3B 3U52E 2RGFA 1AN8A 4MSMB 4ZDVA 2FCSA 2N1WA 2RD0A 2W82A 2WDTB 3SR6A 1JWAD 4FLHA 4RFBA 4HDOA 3Q6BA 1WGDA 5H92C 2KZRA 3RYTA 3I3TB 3WANA 2ZNVC 3UIPB 1K53A 1ZOYB 3VAWA 2C9WB 3A33B 2RSUA 3JYUA 3ZNID 2QDFA 4WAAA 2N7DA 5L83A 1OQYA 3ABVB 3H8HA 4WAFA 3AE7B 1ZPSA 2A5UA 2FIDA 2X38A 3A4RA 4NPNA 2V4IB 1I35A 4DDID 3QQ8B 1YN3A 3QCAA 1Q0WB 2QEJC 3U30A 1F2RI 2G4DB 4XX5A 5DPRA 3BK1A 2UWQA 2DYBA 5LNK1 2BYVE 4BBNF 2WWZA 1G6JA 4URKA 2AL3A 2QJLA 3H7SA 4LJOB 5IN7A 3RI7C 3PZ8A 4FA6A 1N61A 1FEHA 2PVOD 4GDLA 1I4GA 3N1YC 2HD5B 1OGWA 2MLBA 2D2QA 2WXLA 2FNJB 3PPAA 1M94A 3E56A 3P4QB 2WXNA 4D2KA 3QAQA 5HHDG 3UI3A 4XDDA 1GOZA 1BUIC 4A3OA 3PVLA 3O13A 3Q69A 4KVGB 3VRBB 3PRZA 1EO6A 2C7HA 1M4VA 3TEYA 2MW5A 1YQBA 4BVUC 2RPQA 2QC8A 4J6IA 3VHTC 1EM7A 1DGJA 3AEBB 1TY2A 3V3XA 3T8MA 4KV2A 3LYYA 4M0WA 3TCAA 2KC1A 1V8CA 4LNKA 4LK0M 2KVRA 2MBQA 2JVCA 1E8YA 2N9PC 2KANA 2SAKA 1KFYB 3Q8BA 1XO3A 1TT5B 4US9A 4NNJB 4MM3B 4ANVA 3AULA 2KLCA 1S3SG 1PGAA 2KDFB 3NG0A 4KIKB 1WX8A 4N58A 5JH5C 5G5HA 1IPGA 2KMAA 2WXMA 3DOWA 2KYWA 1NBFC 3LXFA 4RH6A 5D6JB 1WX7A 2CHWA 2D5GA 1SJHD 2IY1B 1WXVA 2YLMA 2WLBA 4XYCA 1AYFA 4IM2A 4NAWA 1L0XB 4TKNA 3N32A 3NJTA 3TMPB 2DZMA 3LDZE 1SGHA 2PVGC 2LD9A 3R2IA 2I38A 1XCTL 1FO4A 3W1SC 1P7EA 3BVGA 1VD2A 1EF1A 3VDZA 4KKIA 1JWSD 2DX5B 2MCNB 5AUKA 4ZHOA 3FAHA 3NZSA 3N1ZC 2JU6X 4XWTA 5C23A 2ZW0A 4K3CA 1WSPA 2PPHA 4W9HA 4TSSA 3MHSD 4MH0E 2Q5WD 2K22A 3DDCB 4IOIE 3KVFB 1GG3A 1YX5B 2EKIA 3GP7A 1CJEA 2AYOB 1UUPA 4TV3A 3IBEA 3V62A 3MHZA 5E6PA 1Y8RC 1KLVA 3K9PB 3PLUA 4KDLB 4ZRJA 4JGHB 1E7UA 2O2VB 2MBBB 3TSSA 3HRDD 1D5XC 2QCZA 1UGJA 3VUWA 1Z2MA 1VZ8A 4HCNB 3KWLA 2IO0B 1QT9A 2K0PA 3BVZA 4RF0A 3U7DA 1E90A 1CMXB 3ZTDA 2MJEA 3HHMA 2V3PA 5AZHA 3ZYYX 4HK2A 2PMVA 1JWMD 2J52A 1SE4A 1WX9A 2C7NB 2Y3AA 3TL5A 5D2MB 4GN1A 1ESFA 1OTRB 4AOFA 5KHQA 4ZOHC 2GOWA 3R8BA 2GI9A 1LQBA 3MC8A 3P63A 4AJYB 2LVOA 1SBBB 3L0WB 4NQLB 1D6EC 2BQQA 5G55A 2JUOA 1WFYA 4USAA 1WM2A 2BVCA 2G3QB 1OFFA 1DYQA 2WXKA 3KUCB 5TSSA 1VRAB 1UWXA 2HJ1A 2KFKB 1KH0A 4C00A 2KACA 3B2GA 3L10B 3ETRA 1FXTB 5C1ZA 5FK9C 2FUHB 3UQBA 3ZW3A 2MP2B 4KSKC 4L1BA 3V6CB 4CO7A 2KMMA 3NHEB 3UQAA 4IWOA 1QOBA 1RFKA 2L76A 4MJSA 2IO3B 2MJDA 4HJGE 2DYOA 2YEPB 3MFGA 3AE4B 4DQOC 2WP9B 4A90A 4IM3A 3DHHC 2G45B 4HKZE 1BXTA 1SE9A 3U2SC 1WYWB 4E74A 5E6OA 1ZE3D 4O1NA 1YN4A 1NVID 2KD0A 4WURA 4UDUC 1SB3C 5D3DA 3QC8B 3SHQA 3JSVB 4DHZE 3SU8X 4W9GA 2KX3A 2WXHA 2IGHA 3N1XC 1C9FA 4MT5A 1UZXB 4DXFA 1U4AA 2L3ZA 1EWYC 2PTLA 4K81A 2ZEQA 2WXIA 2QMTA 3IHPC 3PO0A 2K25A 1RRBA 5LXIB 2PE9A 1C79A 2WU2B 4ZRQA 4HKQA 3AECB 2PKOA 1C1YB 4DK5A 3A9JB 3T9LA 3VUXA 1Z5SB 2XK5B 1MPEA 2MH7A 4MDKE 2RMMA 3N3KB 4RGOS 2NVUI 2ZJDA 5IO9A 2DZJA 3B2FA 1VR9A 2INDC 2LXAA 3TEXA 2KTRA 2ICIA 4B0EA 1T0QC 4KX6B 1MHHE 3OJ3A 2A4ZA 4Q2JA 2DZKA 3NVZA 2LMCA 3NOBA 3DCGA 2CHZA 1LM8B 2LRWA 2CR5A 3CSFA 2G1EA 1FFUA 3RPFC 2K9XA 2D07B 2XBBC 2AX5A 2MHJA 4M8NA 2JQRB 4KDIC 4DXAB 1ZXHA 4YWGG 3SFDB 4ZRPA 1WGGA 1F52A 3UIOB
chains in the Genus database with same CATH topology
3ABVB 3H8HA 3P1MA 4WAFA 4C56C 1ZDXA 1ZPSA 2X38A 1HQRD 3AE7B 3ZQ4A 4OW0A 1IGCA 2DBYA 1TS5A 2KN4A 2V4IB 3BIID 1YN3A 4REZA 1EWCA 1I4HA 2MEKA 1VZ7A 3BWUD 1RYJA 5GXGB 4A55A 2QEJC 3I57A 1F2RI 1SE2A 1FD6A 3BK1A 4OZBA 4RCOA 4ITKA 3IAS1 2VZKB 5LNK1 4RF1A 1NI3A 2BT6A 1FNVA 1V97A 1YNTE 2QJLA 1E7PB 1T3QA 2FE8A 3BVMA 3PZ8A 1N61A 1FEHA 3BYTB 4NAMA 4YXDB 1R7SA 2PVOD 4TMAB 1FRDA 4N6EB 1PUTA 1RWSA 1E10A 1KF6B 1TS4A 1I4GA 2PLPA 1AW7A 1C77A 2Z8LA 2WXLA 3HVZA 2NMQA 1OQRA 3E56A 5G5GA 1L0VB 4WQMA 3P4QB 1XCQL 1I4XA 2Y5CA 2WXNA 4D2KA 1HEZE 3P4SB 1B1ZA 3CIRB 1T6BX 5HHDG 3UI3A 4IKGA 4XDDA 1GOZA 4YTNB 1BUIC 1XXGA 1B9RA 1N60A 1SXTA 3O13A 3Q69A 3VRBB 3AN1A 1OQQA 2B76B 4LLGM 1M4VA 3TEYA 2NTTA 2W3SA 1FCLA 5BMIA 1FM0D 4ARCA 2WXQA 1EM7A 2WDVB 1FMAD 1DGJA 1C76A 3AEBB 1T5XD 1TKGA 1TY2A 4GDLB 3V3XA 2GRIA 3LYYA 4M0WA 4OVZA 1C4AA 1F0ZA 2NTSA 1NEKB 4JWUC 1V8CA 2IGDA 2VZKD 4LK0M 3BK2A 3W1SA 5BMGA 1VJKA 1WWTA 1L4DB 1E9MA 2H89B 2SAKA 3AH7A 4C80A 1KFYB 2WNMA 2HDEA 1FXAA 4KKJA 3Q8BA 4PT5A 2V3NA 2WDRB 4TQ0A 1XO3A 1QKZA 4US9A 2DLBA 4HROA 1CQVA 1AWDA 2KDMA 3IXSA 1SJED 4MM3B 4YSYB 1GB4A 1EU4A 1P7FA 4KGSA 5I4DA 1PGAA 5E6JA 4AS1A 4N58A 3WCQA 5EE0A 5G5HA 2WXMA 3EUB2 2L52A 4WIPA 3ZJVA 1L5PA 2L32A 1XF5L 2JX5A 5AUIA 2BTEA 2WU5B 3LXFA 4RH6A 1DOYA 1WGKA 1NYRA 3VRAB 2D5GA 1SJHD 1D5ZC 3DWMA 3W5VB 2WLBA 2I2YA 3Q8AA 2JXTA 1TZOA 1QILA 1AYFA 1L0XB 3PZ7A 4GDKB 3TEZA 2ON8A 2N9LA 2XNAC 2WDQB 1E0ZA 4WH4A 4YTMB 2ZW1A 1F77A 2YEPF 4XWWA 1HZ6A 1XLPA 2PVGC 3MP9A 3OWEB 4RGMA 2E3TA 3R2IA 3TUOA 2I38A 1MI0A 1XCTL 1FO4A 1XEEA 2W55A 1JWUD 5FR3A 1P7EA 3BVGA 3KQ4A 3P4RB 3T3NA 2M56B 2LHEA 1V1OA 2BW2A 3CWIA 4KKIA 3VR9B 4MH8A 1J7CA 1JWSD 5EE3A 5AUKA 4ZHOA 4YT0B 2FUG1 3FAHA 4GLSC 4NJCA 2JU6X 4XWTA 3HVDA 2LFIA 2ZW0A 1FFVA 1Y56A 5D3IB 1WSPA 3AE9B 3GS2A 3Q8EA 4NAWB 5JXVA 3E9SA 3T3OA 4TSSA 1ZDVA 5HFYA 2Q5WD 2K22A 4IOIE 1IUEA 1YMHE 3AE2B 2Y5PA 3Q8FA 3NZ3A 1YN5A 1K52A 1PYWD 5HI1A 3ZGZA 3AE3B 2EELA 2RDHA 4C7YA 3U7ZA 3AV8A 1VLBA 3KLSX 2BS2B 4H2AA 2EKIA 2CJNA 3GP7A 3TEWA 1CJEA 1PGBA 3ZJUA 1UUPA 2AQ2B 2LEKA 2WXFA 1FRRA 2AQ1B 3AE5B 3AEDB 3MHZA 2J42A 2WXRA 1IBXA 5BYQA 3FILB 1FNUA 2QIEB 1TJEA 2M0AA 1F2RC 4RNAA 2SEBD 4EE2A 1KRHA 5BYSA 3IT4B 2PIAA 3TSSA 4FXCA 1C4CA 1QOFA 1L6VA 4MACA 1WXQA 3HRDD 1D5XC 1UGJA 1D4BA 1MHXA 1Q10A 1VZ8A 3EA6A 1NENB 3KWLA 2JSVX 1CK1A 4OZCA 2K3UA 1UNSA 4YSZB 1QT9A 2K0PA 1HZ5A 2JWUA 3BVZA 1N5WA 1L6UA 4RF0A 1GPXA 3AEAB 2WQYB 1QOGA 4CQNA 2GB1A 2MJEA 1SEBD 1J7BA 2V3PA 4P16A 1LO5D 2N7JA 1N62A 1TS3A 3MC0B 3ZJTA 1BMLC 3ZYYX 2PMVA 2JZPA 1JWMD 2W3RA 2J52A 4A9AA 1SE4A 1IBXB 2J4XA 1ROEA 4ZHPA 2RDGA 2Y3AA 3AEEB 3NVYA 1MVKA 4L23A 4XE0A 4DXGA 4JPSA 2BS3B 5MPOA 1ESFA 3B9JA 1TS2A 1IGDA 2WXGA 4LTUA 4ZOHC 1XLNA 2MJ3A 5D7GA 3URYA 3R8BA 2GI9A 2DYMA 3P42A 3RFZB 2WXPA 3NS1A 3P63A 1ACCA 2WXJA 2WXOA 3IAM1 5FKAC 1SBBB 3VQIA 2OHFA 1D6EC 1QOAA 2BS4B 1XLQA 1V1PA 4USAA 2R61A 2KWDA 1OFFA 1I4QA 1XLOA 1DYQA 4J3OD 2E6XA 2CU3A 3AE8B 2WXKA 3AE1B 4NZLB 1QQRA 2H88B 5TSSA 1VRAB 3SFEB 4HEA1 5C2TB 5C3JB 3FC4A 1C4PA 3VR8B 1UWXA 2ACZB 2LGIA 3NVVA 1KH0A 2G9HD 2CJOA 4A6QA 1JQ4A 2N0SB 1KTKA 1N63A 3NUHB 3AEGB 1GAQB 2KACA 3B2GA 1WRIA 4OHJA 1JCKB 1PFDA 3ETRA 3FILA 2V0GA 1A70A 3V05A 1UWMA 1WYGA 5FK9C 3HUIA 1E6EB 1L0YB 1SF0A 1HA5A 4RGTA 1JMLA 3BZDB 1SSNA 2BB5A 3BYYB 4L1BA 2PW9A 1K51A 1TKEA 2ONQA 5BYRA 2INPE 1PDXA 3AM9A 1V1PB 2KMMA 1NYQA 1QOBA 1RFKA 4HRSA 1HXYD 3AB5A 2MJDA 1SE3A 4HJGE 2DYOA 2YEPB 3AE6B 3AMZA 4JE3B 3MFGA 1JROA 3AE4B 4JWSC 4KGTA 3U4EG 2J53A 4DQOC 2WP9B 4A90A 4AQ7A 1YJJA 3P4PB 4HKZE 1BXTA 1KLGD 2KAJA 4L2YA 2L1AA 1ZUD2 3U2SC 1N5XA 2AQ3B 3Q8CA 3J9CA 4P6VF 5BMHA 1ZE3D 4O1NA 1I4PA 2M19A 3EGRA 1VDVA 2LHDA 1YN4A 1NVID 1ZP0B 1DOIA 4JX1C 2N9KA 1ET9A 3N9YC 4KGRA 4UDUC 4WURA 2HTME 4TQ1A 1SB3C 1I4RA 5D3DA 2JYTA 1DOXA 1ENFA 1RM6C 2K5PA 3DWGC 1J7AA 1JRPA 3GB1A 1ZXIA 3SEBA 4US8A 2RPVA 1JW9D 1C78A 2WXHA 4WWMA 3NVWA 2IGHA 3W9CB 2JYEA 1C9FA 4MT5A 4DXFA 4ZYSA 4OZAA 2W54A 2XN9C 2IJ0A 1EWYC 2PTLA 2WXIA 4XDCA 2LUMA 4A8XC 2QMTA 3PO0A 1YJIA 2LJIA 1C79A 2TSSA 3LB8C 1SIJA 1FCCC 2WU2B 1TKYA 4N59A 2DWQA 3R2TA 5EE9A 2FBWB 4ZRQA 2QSDA 4HKQA 1KLUD 3AECB 1ET6A 2IGGA 2PKOA 1YQ3B 4RGNA 5T8IA 1STEA 1K50A 3C8YA 1JWBD 1PGXA 5HG2A 4IDIA 2BBCA 4YTPB 1L4ZB 3W5UB 2KQ4X 3AEFB 1MPEA 2MH7A 2BB6A 2IDYA 4YSXB 2RMMA 3W2DA 1GB1A 2L83A 3NRZA 4RGOS 1TYGB 1CZPA 3B2FA 1VR9A 5H8YE 1JALA 3U52E 1AN8A 4ARIA 1FIQA 1QF6A 1VZ6A 4C7ZA 1FXIA 3TEXA 2W82A 3SR6A 2ICIA 1JWAD 4B0EA 4KX6B 1MHHE 1EU3A 4RFBA 2OEDA 3I9V1 4Q2JA 3NVZA 5EE1A 1FNWA 5H92C 2LMCA 1QLBB 1D5MC 2WS3B 1TY0A 4B0MA 2G1EA 1FFUA 2INNE 2IPKD 3RPFC 3L4PA 2K9XA 1K53A 3IT6B 4R3DA 3MJ5A 1I7HA 2AX5A 1YQ4B 1ZOYB 2JQRB 2QILA 3KWVA 1ZXHA 2BYTA 4YWGG 3SFDB 4ZRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K0P A;  1HZ5 A;  1PGA A;  4HKZ E;  2JWU A;  1IGC A;  2KN4 A;  5BMH A;  1XF5 L;  2GB1 A;  2LHD A;  2N7J A;  2JZP A;  4KGR A;  2J52 A;  2N9K A;  1IBX B;  1F2R I;  1FD6 A;  2I2Y A;  2JXT A;  4OZB A;  2ON8 A;  1MVK A;  2N9L A;  3GB1 A;  4WH4 A;  2ZW1 A;  2RPV A;  1IGD A;  1HZ6 A;  1YNT E;  2IGH A;  1C9F A;  3MP9 A;  4OZA A;  2I38 A;  1MI0 A;  1XCT L;  2GI9 A;  2PTL A;  2LUM A;  2QMT A;  1P7E A;  2PLP A;  1FCC C;  2LHE A;  2QSD A;  2NMQ A;  2IGG A;  1XCQ L;  1K50 A;  4GLS C;  1PGX A;  5HG2 A;  2KWD A;  4D2K A;  1HEZ E;  2JU6 X;  2KQ4 X;  2ZW0 A;  1MPE A;  5HHD G;  3UI3 A;  4IKG A;  2RMM A;  1GB1 A;  5JXV A;  1UWX A;  5HFY A;  2LGI A;  4KGS A;  4IOI E;  1KH0 A;  1YMH E;  1FCL A;  5BMI A;  2KAC A;  5HI1 A;  1K52 A;  2EEL A;  3FIL A;  1EM7 A;  1MHH E;  2OED A;  1PGB A;  3V3X A;  1JML A;  1IBX A;  2IGD A;  2PW9 A;  3FIL B;  1K51 A;  2ONQ A;  1F2R C;  5BMG A;  1K53 A;  4HJG E;  4MAC A;  1QKZ A;  1ZXH A;  1D4B A;  1MHX A;  1Q10 A;  2KDM A;  1GB4 A;  4OZC A;  4KGT A;  2JSV X;  2J53 A;  1P7F A; 
#chains in the Genus database with same CATH topology
 3NS8 A;  2R2Q A;  2UYZ B;  4C56 C;  1S1Q B;  4OW0 A;  5G2N A;  3R7R A;  2DBY A;  2KN4 A;  3ZXR A;  2DEN B;  4DBG A;  3BII D;  3ZNZ B;  4REZ A;  2JZZ A;  5GXG B;  3I57 A;  3D32 A;  1FD6 A;  3CF6 E;  4RCO A;  4I6L B;  4HVB A;  3N20 C;  1NI3 A;  2BT6 A;  1V97 A;  4WJO A;  1V80 A;  2DZI A;  5CHF A;  5LLI A;  2J0K A;  1J0G A;  3OJ4 B;  1FRD A;  2LUE A;  4W9J A;  4B9K A;  3VVW B;  2Z8L A;  3HVZ A;  3QJZ A;  2Y5C A;  2JPH A;  2KKC A;  3P4S B;  1B1Z A;  3CIR B;  1T6B X;  1XXG A;  1B9R A;  2I1K A;  3AN1 A;  2NBW B;  3DVN V;  2KQ7 A;  1OQQ A;  1HTQ A;  2B76 B;  2DNF A;  2NTT A;  2W3S A;  2KDB A;  3VFK A;  2ASQ A;  1FM0 D;  2AEH A;  1WM3 A;  2LGD A;  4AUQ C;  3ZVV A;  3DBH I;  3ZNG C;  1C76 A;  4GDL B;  2K6D B;  2FAZ A;  3Q14 C;  2NTS A;  1NEK B;  4GDK A;  3A9K A;  2LAS A;  4ANU A;  3W1S A;  3AU4 A;  2KWU B;  1VJK A;  2LVP A;  1E9M A;  3AH7 A;  2MQJ A;  4BAX A;  3A4S C;  3PTF C;  1FXA A;  4S0R A;  4BZA A;  4PT5 A;  2WDR B;  3AXC A;  1QKZ A;  2DLB A;  4HRO A;  1CQV A;  2KDM A;  1SJE D;  4YSY B;  1WZ3 A;  2V4L A;  3ECI A;  3LJ3 A;  5EE0 A;  2NCN A;  4II3 B;  4G11 A;  4WIP A;  3ZJV A;  2L32 A;  2JX5 A;  2LJ5 A;  2R2O A;  1E8Z A;  3VRA B;  3QX1 A;  5AZG A;  3W5V B;  3B0A A;  4M0W B;  2C5L C;  1QIL A;  3TEZ A;  2ON8 A;  3EFU A;  2WDQ B;  4G0N B;  2NPT A;  4JL9 A;  4WH4 A;  3APF A;  4GIV A;  4MSQ B;  3OWE B;  4ZRI A;  4XC2 A;  1WE7 A;  2LXC A;  4FN2 A;  1XT9 B;  4FUL A;  1UGM A;  1J7C A;  3PLV A;  5EE3 A;  3H1U A;  4YT0 B;  1XQQ A;  4PYU A;  4NJC A;  4WWO A;  3IVF A;  2OOB B;  4IUM B;  4HPL B;  1FFV A;  1Y56 A;  4EZK A;  2K8H A;  2IZV B;  3GS2 A;  3Q8E A;  4NAW B;  5JXV A;  4YL8 A;  3E9S A;  1WXM A;  3HK0 A;  3PHW B;  4BKS A;  1IUE A;  1YMH E;  2LGS A;  4EEW A;  2Y5P A;  2BGF A;  1K52 A;  1HTO A;  3U7Z A;  3AV8 A;  3KLS X;  2LEK A;  2WXF A;  2DHZ A;  3AED B;  3PHX B;  2AL6 A;  4XGA B;  1IBX A;  1FNU A;  2BKR B;  3V61 A;  4ANW A;  5DPW A;  3VTW A;  5BYS A;  3TBL D;  2PIA A;  2KJ6 A;  2AWT A;  2ZCB A;  1QOF A;  4MAC A;  1WXQ A;  1MHX A;  3EA6 A;  2WX0 A;  1NEN B;  2JWU A;  3AEA B;  3KH0 A;  1K8R B;  1SEB D;  3MC0 B;  2MRP A;  2JZP A;  1TZ1 A;  4A9A A;  2J4X A;  4K1R B;  4ZHP A;  1YIW A;  3NVY A;  4L23 A;  4DXG A;  4JPS A;  5MPO A;  4MGZ E;  3M3J A;  4EOY A;  1IGD A;  2WXG A;  3DBH B;  1TBE A;  3Q3M C;  3RFZ B;  2WXJ A;  2WXO A;  1N6Z A;  2BWE S;  2FCM A;  3ZO5 B;  4C4V A;  4NQK E;  2ZCC A;  4G50 A;  1SIF A;  3EFC A;  1XLQ A;  2BWF A;  2R61 A;  2N7E A;  4GSW A;  1I4Q A;  2EMS A;  3KYD D;  4FJZ A;  1QQR A;  4K7W A;  3SFE B;  5C3J B;  3Q3O C;  2KWV B;  2Z59 B;  4A6Q A;  2N0S B;  1N63 A;  3DPD A;  4KZC A;  2K39 A;  4DDG D;  4RM8 A;  2V0G A;  3V05 A;  1WYG A;  4M02 A;  3HIZ A;  4GU2 A;  1L0Y B;  4MEL A;  3RNA C;  3ZRF A;  2JT4 B;  4A3P A;  1TKE A;  2ONQ A;  4XZ4 A;  3R66 C;  2INP E;  1PDX A;  5CHW A;  4HRS A;  1HXY D;  3AB5 A;  1SE3 A;  4LCD E;  4ASW C;  1WGY A;  4FJY A;  3IFW B;  3U4E G;  1UH6 A;  2MBE A;  2KAJ A;  3DVN U;  4L2Y A;  2GMI C;  1N5X A;  3W1Y A;  4IWP A;  3GZN I;  2LHD A;  3RNG C;  4MEM A;  1F1H A;  4BOZ B;  1KM7 A;  1DOI A;  2IO2 B;  3KW5 B;  1WGR A;  2HTM E;  4TQ1 A;  1I4R A;  4KZ0 A;  1DOX A;  3SEB A;  3DWG C;  1J7A A;  1JRP A;  1ZXI A;  4US8 A;  3DHI C;  1JW9 D;  4OZA A;  3RNE C;  3WA0 A;  4MJS B;  2GBR A;  2W54 A;  3DBR B;  2IJ0 A;  4RM9 A;  3QAR A;  2VH1 A;  4W9D A;  4A8X C;  5GMV A;  4I6P A;  4GXB A;  2LJI A;  4F8C B;  3LB8 C;  1TKY A;  2DWQ A;  2FBW B;  1D3Z A;  3TIX A;  1KLU D;  2G4S A;  2MWS B;  1YQ3 B;  5T8I A;  4TUU A;  1MFW A;  5HG2 A;  1L4Z B;  3W5U B;  1JRU A;  4YSX B;  1TYG B;  1CZP A;  4LJP B;  5H8Y E;  1V2Y A;  2KO3 A;  1FIQ A;  2KDI A;  4JQW C;  2ZNV B;  2CS4 A;  2QHO A;  4ZRK A;  3RMK C;  4JIO U;  5EE1 A;  1FNW A;  4EZL A;  1WI0 A;  2WS3 B;  1TY0 A;  2HE7 A;  4B0M A;  2K6Q A;  3RN9 C;  3IT6 B;  1V81 A;  4MGK E;  1YQ4 B;  2JF5 A;  1R4M I;  3ZKJ C;  1NDD A;  3KWV A;  2BYT A;  5LXH A;  3KYC D;  2JWZ A;  1ZDX A;  1J19 A;  3ZQ4 A;  1L7Y A;  1IGC A;  2KTR B;  3QHT A;  2RR9 A;  3OLM D;  4LDT B;  1EWC A;  1I4H A;  4M01 A;  1VZ7 A;  3JVZ X;  3CST A;  4OZB A;  4ITK A;  2VZK B;  3A1Q A;  3K9O B;  2M1M A;  2KLG A;  2D3A A;  2PJH A;  1T3Q A;  4DHJ B;  4NAM A;  4YXD B;  4P7I A;  4N6E B;  1TS4 A;  3RCZ A;  3L13 A;  2PLP A;  4M00 A;  4FBJ B;  5E6N A;  2BYE A;  3ZRC A;  2L0F A;  1OQR A;  4PK1 A;  2NR2 A;  1R4N I;  5G5G A;  1L0V B;  4WQM A;  1I4X A;  3M62 B;  2XEW A;  3ZDM C;  1HEZ E;  3M63 B;  4B95 A;  5IP4 D;  4IKG A;  1N60 A;  1SXT A;  4DWF A;  4LLG M;  3DBS A;  1OEY J;  5BMI A;  3GZN B;  3VXW A;  3ZDT A;  3NZU A;  3SD5 A;  5JHB A;  2ZVO A;  4LDT D;  4GGQ A;  1T5X D;  4BBN C;  2GRI A;  4OVZ A;  1F0Z A;  4JWU C;  2VZK D;  3BK2 A;  1MJD A;  5BMG A;  2JY6 A;  1WR1 A;  2KK8 A;  1WWT A;  2JXX A;  1UBQ A;  2H89 B;  3DBL I;  3BY4 B;  4C80 A;  2KOX A;  4DHJ D;  4GOC A;  1AWD A;  3IXS A;  2M0X A;  1GB4 A;  3WAL A;  1EU4 A;  4HPP A;  1P7F A;  4KGS A;  3GOE A;  2KNB A;  3QWZ B;  4ICV A;  3EUB 2;  2L52 A;  1XF5 L;  5AUI A;  2BTE A;  2WU5 B;  4HLE A;  3MJW A;  1DOY A;  1WGK A;  1NYR A;  2IY0 B;  4HCP B;  1D5Z C;  3DWM A;  4BKG A;  2I2Y A;  2GLS A;  1WH3 A;  1OEY A;  4GDK B;  3A9K B;  4YTM B;  2ZW1 A;  4IG7 B;  4XWW A;  1HZ6 A;  3MP9 A;  4IM0 A;  4GMV A;  3TUO A;  3PRP B;  2X8X X;  4W9I A;  1XEE A;  2W55 A;  3M95 A;  4NJ7 A;  3H7P B;  2KMC A;  1TGZ B;  2O6V A;  2OJR A;  4HJK A;  4A20 A;  2BPS A;  2LHE A;  1GNU A;  2BW2 A;  4MH8 A;  1KOT A;  3IG3 A;  4ANX A;  1R4M B;  2FUG 1;  3VH4 B;  4GLS C;  2N4F A;  2LVQ A;  3N30 A;  3HVD A;  3S2A A;  2LFI A;  3HM6 X;  3AE9 B;  2HJ8 A;  3T3O A;  1ZDV A;  2NPT B;  1V5O A;  2LI5 A;  4PS3 A;  3APC A;  2EKE C;  3DQV A;  3WAO A;  1PYW D;  4C7Y A;  1VLB A;  2BS2 B;  4H2A A;  1PGB A;  3Q3J A;  2AQ2 B;  2CKH B;  2J42 A;  3EHV A;  4W9F A;  2QIE B;  1TJE A;  3RZW C;  1F2R C;  1V5T A;  2V1Y A;  2W9N A;  3IT4 B;  4FXC A;  2JRH A;  4W9E A;  5IKC M;  1C4C A;  3ZXV A;  5IAA C;  2C60 A;  2B3A A;  2ZPY A;  1Q10 A;  4YSZ B;  2JSV X;  2K3U A;  1Q5W B;  1UNS A;  3I63 C;  1N5W A;  1R4N B;  1L6U A;  1GPX A;  4WQO B;  4CQN A;  5CTR C;  2KJR A;  4P16 A;  1LO5 D;  1N62 A;  1TS3 A;  4IWQ A;  1BML C;  1GC7 A;  1WJN A;  2K8B A;  3Q3F A;  3ZIM A;  1IBX B;  1WJU A;  4AWJ A;  1ROE A;  2D3G A;  1MVK A;  1Q1O A;  3H7P A;  3B1L X;  3B9J A;  2KHW B;  4LTU A;  3MC9 A;  1XLN A;  1V49 A;  2MJ3 A;  5D7G A;  3X0W A;  3P42 A;  2DYM A;  3VTU A;  2N9X A;  2WXP A;  3NS1 A;  4K3B A;  1T0R C;  3IAM 1;  1H8C A;  5FKA C;  4PS8 A;  1QOA A;  2BS4 B;  2FCQ A;  3DBL B;  3FKY A;  5JHA A;  1V1P A;  1L2N A;  2KWD A;  1XLO A;  4J3O D;  2E6X A;  2CU3 A;  3AE8 B;  3AE1 B;  4NZL B;  2NBU A;  2KJH B;  3O65 B;  5C2T B;  3FC4 A;  3VR8 B;  2LGI A;  4NJ6 A;  1C3T A;  4BKS D;  2G9H D;  2CJO A;  1JQ4 A;  4HDQ A;  1KTK A;  3NUH B;  3AEG B;  1GAQ B;  1WRI A;  1EF5 A;  4ZYN A;  2GBM A;  3RNC C;  1IYF A;  1UWM A;  2ZZP B;  5DPS A;  1JML A;  3MTN B;  3BZD B;  3PV1 A;  3WAM A;  4C4V B;  2BB5 A;  3RNB C;  5BYR A;  4W9C A;  4WWN A;  2GBK A;  1PQS A;  3AM9 A;  4WWP A;  1NYQ A;  3WAP A;  3AE6 B;  3AMZ A;  3Q2A C;  4BOS C;  4KGT A;  2J53 A;  2J7Q B;  2BF8 B;  4QAY A;  1WZ0 A;  5J18 A;  3C19 A;  3DBR I;  1KLG D;  2PE6 B;  1ZUD 2;  2AQ3 B;  1LGR A;  5BMH A;  3GE3 C;  2M4N A;  2M19 A;  3EGR A;  1TTN A;  2HTH A;  1ZP0 B;  3ZLZ A;  2VH2 A;  1HE8 A;  3N9Y C;  2GBN A;  1AAR A;  2LRU A;  2NS5 A;  3BIN A;  2JYT A;  1ZKH A;  1RM6 C;  2K5P A;  2KN5 A;  3GB1 A;  3V6E B;  2RPV A;  1WRD B;  2M17 A;  1GJZ A;  3NVW A;  2JYE A;  4ZYS A;  3EC8 A;  2WYQ A;  1WIA A;  2XN9 C;  2UU7 A;  1MG4 A;  2TSS A;  1FCC C;  1V6E A;  2N9E B;  4N59 A;  3PZD A;  3R2T A;  5EE9 A;  1ET6 A;  2IGG A;  4RGN A;  1STE A;  4MGY E;  1K50 A;  3C8Y A;  4GB9 A;  3AEF B;  1ZW7 A;  2IDY A;  1GB1 A;  5L95 C;  2L83 A;  4P1B C;  1JAL A;  4ARI A;  1WY8 A;  1QF6 A;  1VZ6 A;  4C7Z A;  1FXI A;  2J0J A;  4IC7 B;  4FAD A;  1EU3 A;  2OED A;  1UEL A;  3I9V 1;  1P0R A;  1QLB B;  1D5M C;  4FJV B;  4HPM B;  4CYE A;  2ZPN A;  2INN E;  2IPK D;  3L4P A;  5FR6 A;  3V60 A;  1V86 A;  1E7V A;  4R3D A;  3MJ5 A;  1I7H A;  1V9J A;  4M8M A;  1WE6 A;  4I6N B;  2QIL A;  4RMA A;  2GBJ A;  1WMH B;  1QZE A;  3P1M A;  1E8X A;  1HQR D;  1TS5 A;  1WJ4 A;  3PS6 A;  3PRM B;  3ML9 A;  2KT7 A;  2MEK A;  3BWU D;  1RYJ A;  2CHX A;  2KDE B;  4A55 A;  1SE2 A;  1UF0 A;  4FHJ A;  3IAS 1;  1VCB A;  4RF1 A;  3DVG Y;  2KFJ A;  4F1S A;  1FNV A;  2WGS A;  1YNT E;  1WGH A;  1E7P B;  2FE8 A;  3BVM A;  3BYT B;  2IBI B;  1R7S A;  4TMA B;  1PUT A;  1RWS A;  1A5R A;  1KF6 B;  1E10 A;  4OVU A;  1YD8 U;  2ZVN A;  3VH3 B;  1AW7 A;  3L54 A;  1C77 A;  2KTF A;  2NMQ A;  5J17 A;  1XCQ L;  2YVC A;  1RAX A;  1J8C A;  2BKF A;  4YTN B;  4MM3 A;  3A1Q B;  4FHK A;  2L00 B;  1LFD A;  4KIK A;  5IOI A;  4WJN A;  1FCL A;  3DVG X;  4PYZ A;  3ONS A;  4ARC A;  1T0S C;  2WXQ A;  2N1V A;  2WDV B;  1FMA D;  1WXA A;  2FIF A;  1YJ1 A;  1RLF A;  1TKG A;  3AI5 A;  2J0M A;  1C4A A;  3ZUN A;  2IGD A;  2DAF A;  2RDB C;  1WMH A;  3H6N A;  5IA7 A;  2V9H A;  1L4D B;  1UBI A;  2WNM A;  2HDE A;  4KKJ A;  2V3N A;  4TQ0 A;  2IYD B;  3HM3 A;  3C0R B;  2DAJ A;  2CU1 A;  4EUT A;  2LWP A;  5I4D A;  4IW0 A;  5E6J A;  4AS1 A;  3WCQ A;  1FPY A;  4KSL C;  1L5P A;  2WX1 A;  3VTV A;  4HXD A;  1MG8 A;  1WJ6 A;  2K1F A;  5TR5 A;  3Q8A A;  2JXT A;  1TZO A;  5AEK B;  3PZ7 A;  2XNA C;  2N9L A;  1E0Z A;  2LGX A;  3WIM A;  2V3S A;  1F77 A;  4E71 A;  2YEP F;  4K7S A;  1XLP A;  4RGM A;  2E3T A;  1MI0 A;  2EMT A;  4JLC A;  3RD2 A;  1JWU D;  5FR3 A;  1X1M A;  2D3C A;  3KQ4 A;  3P4R B;  2M56 B;  4AP4 C;  3T3N A;  3UGB B;  3OG5 A;  3ML8 A;  4WJP A;  4CHK A;  1V1O A;  3CWI A;  3VR9 B;  1ISN A;  3AU5 A;  3U8Z A;  2O2V A;  4EZJ A;  4OVV A;  5D3I B;  2Y5B B;  5BO4 B;  3RT3 B;  1KJT A;  5HFY A;  4W9K A;  3AE2 B;  1GUA B;  3Q8F A;  5HI1 A;  1LXD A;  1YN5 A;  2KVZ A;  3NZ3 A;  3ZGZ A;  3AE3 B;  2EEL A;  2RDH A;  3APD A;  5EDS A;  2WHI A;  1XD3 B;  2CJN A;  3TEW A;  1E8W A;  3ENE A;  2L0T A;  3ZJU A;  1NI2 A;  3QA8 A;  1FRR A;  1WR6 E;  1BT0 A;  2AQ1 B;  2FCN A;  2O6V B;  3AE5 B;  2WXR A;  5BYQ A;  2IO1 B;  4W9L A;  4AJW A;  3FIL B;  3PSE B;  4LNI A;  2M0A A;  2K8C A;  4RNA A;  2L7R A;  2SEB D;  2Z0D B;  3ZTC A;  4EE2 A;  1KRH A;  2MSE D;  4P1C C;  5JZE B;  2L8J A;  1F9J A;  1YOV B;  1L6V A;  2INC C;  5DCN A;  1D4B A;  3TJP A;  4OZC A;  1CK1 A;  2KXJ A;  1HZ5 A;  2LZ6 A;  3L17 A;  3KUD B;  2D3B A;  1P3Q U;  2WQY B;  1QOG A;  3UIN B;  1I42 A;  2GB1 A;  1J7B A;  2N7J A;  3ZJT A;  1P1A A;  1P98 A;  4ICU A;  2W3R A;  3L16 A;  2RDG A;  3AEE B;  2MBH A;  2OJW A;  3QIJ A;  4XE0 A;  4DHZ B;  2BS3 B;  2KFK A;  2KQS A;  1TS2 A;  2C7M B;  3RNF C;  5J2R A;  4G3X B;  5AZF A;  3URY A;  3PGE A;  1ACC A;  1GC6 A;  2O6V D;  5DPT A;  3UF8 A;  2MP2 A;  2KX0 A;  3R3M A;  3VQI A;  3DHG C;  2OHF A;  3ALB A;  3P2B A;  4II2 B;  4N9F 4;  1IP9 A;  4X57 B;  2M8S A;  3JW0 X;  3VUY A;  4WJQ A;  2H88 B;  3KUZ A;  2Z0E B;  4HEA 1;  1C4P A;  1YX6 B;  2ACZ B;  4BKT A;  3NVV A;  4NY0 A;  1T0Y A;  3RUL A;  1RFA A;  4OHJ A;  1H4R A;  1JCK B;  1PFD A;  3H9D A;  3FIL A;  3GE8 C;  1A70 A;  2MX2 A;  3X23 A;  3HUI A;  1E6E B;  1SF0 A;  4RGT A;  1HA5 A;  3RZF A;  3ZNH B;  4LNN A;  2PEA A;  1SSN A;  4F7Z A;  3BYY B;  1ZGU B;  2PW9 A;  1K51 A;  3JSV A;  5D94 A;  1V1P B;  1WF9 A;  4JE3 B;  2JRI B;  1UD7 A;  1JRO A;  4JWS C;  4LNF A;  4AQ7 A;  1YJJ A;  2MA9 B;  3PRE A;  3P4P B;  4MGI E;  2L1A A;  1P9D U;  2MBO A;  3Q8C A;  4S17 A;  3J9C A;  4P6V F;  3R7Q A;  1I4P A;  3PT2 B;  1VDV A;  2D11 A;  3A9J A;  4E3C A;  2REX A;  4JX1 C;  2KC2 A;  1ET9 A;  2KWC A;  2N9K A;  2XK5 A;  4KGR A;  4LNO A;  3NY5 A;  1E5W A;  2LGY A;  3CMM B;  2NBV B;  3QK0 A;  3L08 A;  2L05 A;  1ENF A;  2I1J A;  1C78 A;  4WWM A;  3W9C B;  3I5J C;  5CX3 A;  4K7U A;  4BFR A;  4EKU A;  4XDC A;  2LUM A;  3RUI B;  1YJI A;  5CHV C;  1SIJ A;  5KHO A;  5HKH A;  2QSD A;  3Q3N C;  2D10 A;  1TIF A;  4ACF A;  1JWB D;  1PGX A;  1WXS A;  2VRR B;  2BBC A;  3B08 A;  4IDI A;  4YTP B;  4B6W A;  2KQ4 X;  3OAW A;  2BYF A;  1EUV B;  2BB6 A;  3SDL C;  3W2D A;  3NRZ A;  4HWI B;  3EEC A;  4EFO A;  4PS7 A;  2JZ3 B;  3U52 E;  2RGF A;  1AN8 A;  4MSM B;  4ZDV A;  2FCS A;  2N1W A;  2RD0 A;  2W82 A;  2WDT B;  3SR6 A;  1JWA D;  4FLH A;  4RFB A;  4HDO A;  3Q6B A;  1WGD A;  5H92 C;  2KZR A;  3RYT A;  3I3T B;  3WAN A;  2ZNV C;  3UIP B;  1K53 A;  1ZOY B;  3VAW A;  2C9W B;  3A33 B;  2RSU A;  3JYU A;  3ZNI D;  2QDF A;  4WAA A;  2N7D A;  5L83 A;  1OQY A;  3ABV B;  3H8H A;  4WAF A;  3AE7 B;  1ZPS A;  2A5U A;  2FID A;  2X38 A;  3A4R A;  4NPN A;  2V4I B;  1I35 A;  4DDI D;  3QQ8 B;  1YN3 A;  3QCA A;  1Q0W B;  2QEJ C;  3U30 A;  1F2R I;  2G4D B;  4XX5 A;  5DPR A;  3BK1 A;  2UWQ A;  2DYB A;  5LNK 1;  2BYV E;  4BBN F;  2WWZ A;  1G6J A;  4URK A;  2AL3 A;  2QJL A;  3H7S A;  4LJO B;  5IN7 A;  3RI7 C;  3PZ8 A;  4FA6 A;  1N61 A;  1FEH A;  2PVO D;  4GDL A;  1I4G A;  3N1Y C;  2HD5 B;  1OGW A;  2MLB A;  2D2Q A;  2WXL A;  2FNJ B;  3PPA A;  1M94 A;  3E56 A;  3P4Q B;  2WXN A;  4D2K A;  3QAQ A;  5HHD G;  3UI3 A;  4XDD A;  1GOZ A;  1BUI C;  4A3O A;  3PVL A;  3O13 A;  3Q69 A;  4KVG B;  3VRB B;  3PRZ A;  1EO6 A;  2C7H A;  1M4V A;  3TEY A;  2MW5 A;  1YQB A;  4BVU C;  2RPQ A;  2QC8 A;  4J6I A;  3VHT C;  1EM7 A;  1DGJ A;  3AEB B;  1TY2 A;  3V3X A;  3T8M A;  4KV2 A;  3LYY A;  4M0W A;  3TCA A;  2KC1 A;  1V8C A;  4LNK A;  4LK0 M;  2KVR A;  2MBQ A;  2JVC A;  1E8Y A;  2N9P C;  2KAN A;  2SAK A;  1KFY B;  3Q8B A;  1XO3 A;  1TT5 B;  4US9 A;  4NNJ B;  4MM3 B;  4ANV A;  3AUL A;  2KLC A;  1S3S G;  1PGA A;  2KDF B;  3NG0 A;  4KIK B;  1WX8 A;  4N58 A;  5JH5 C;  5G5H A;  1IPG A;  2KMA A;  2WXM A;  3DOW A;  2KYW A;  1NBF C;  3LXF A;  4RH6 A;  5D6J B;  1WX7 A;  2CHW A;  2D5G A;  1SJH D;  2IY1 B;  1WXV A;  2YLM A;  2WLB A;  4XYC A;  1AYF A;  4IM2 A;  4NAW A;  1L0X B;  4TKN A;  3N32 A;  3NJT A;  3TMP B;  2DZM A;  3LDZ E;  1SGH A;  2PVG C;  2LD9 A;  3R2I A;  2I38 A;  1XCT L;  1FO4 A;  3W1S C;  1P7E A;  3BVG A;  1VD2 A;  1EF1 A;  3VDZ A;  4KKI A;  1JWS D;  2DX5 B;  2MCN B;  5AUK A;  4ZHO A;  3FAH A;  3NZS A;  3N1Z C;  2JU6 X;  4XWT A;  5C23 A;  2ZW0 A;  4K3C A;  1WSP A;  2PPH A;  4W9H A;  4TSS A;  3MHS D;  4MH0 E;  2Q5W D;  2K22 A;  3DDC B;  4IOI E;  3KVF B;  1GG3 A;  1YX5 B;  2EKI A;  3GP7 A;  1CJE A;  2AYO B;  1UUP A;  4TV3 A;  3IBE A;  3V62 A;  3MHZ A;  5E6P A;  1Y8R C;  1KLV A;  3K9P B;  3PLU A;  4KDL B;  4ZRJ A;  4JGH B;  1E7U A;  2O2V B;  2MBB B;  3TSS A;  3HRD D;  1D5X C;  2QCZ A;  1UGJ A;  3VUW A;  1Z2M A;  1VZ8 A;  4HCN B;  3KWL A;  2IO0 B;  1QT9 A;  2K0P A;  3BVZ A;  4RF0 A;  3U7D A;  1E90 A;  1CMX B;  3ZTD A;  2MJE A;  3HHM A;  2V3P A;  5AZH A;  3ZYY X;  4HK2 A;  2PMV A;  1JWM D;  2J52 A;  1SE4 A;  1WX9 A;  2C7N B;  2Y3A A;  3TL5 A;  5D2M B;  4GN1 A;  1ESF A;  1OTR B;  4AOF A;  5KHQ A;  4ZOH C;  2GOW A;  3R8B A;  2GI9 A;  1LQB A;  3MC8 A;  3P63 A;  4AJY B;  2LVO A;  1SBB B;  3L0W B;  4NQL B;  1D6E C;  2BQQ A;  5G55 A;  2JUO A;  1WFY A;  4USA A;  1WM2 A;  2BVC A;  2G3Q B;  1OFF A;  1DYQ A;  2WXK A;  3KUC B;  5TSS A;  1VRA B;  1UWX A;  2HJ1 A;  2KFK B;  1KH0 A;  4C00 A;  2KAC A;  3B2G A;  3L10 B;  3ETR A;  1FXT B;  5C1Z A;  5FK9 C;  2FUH B;  3UQB A;  3ZW3 A;  2MP2 B;  4KSK C;  4L1B A;  3V6C B;  4CO7 A;  2KMM A;  3NHE B;  3UQA A;  4IWO A;  1QOB A;  1RFK A;  2L76 A;  4MJS A;  2IO3 B;  2MJD A;  4HJG E;  2DYO A;  2YEP B;  3MFG A;  3AE4 B;  4DQO C;  2WP9 B;  4A90 A;  4IM3 A;  3DHH C;  2G45 B;  4HKZ E;  1BXT A;  1SE9 A;  3U2S C;  1WYW B;  4E74 A;  5E6O A;  1ZE3 D;  4O1N A;  1YN4 A;  1NVI D;  2KD0 A;  4WUR A;  4UDU C;  1SB3 C;  5D3D A;  3QC8 B;  3SHQ A;  3JSV B;  4DHZ E;  3SU8 X;  4W9G A;  2KX3 A;  2WXH A;  2IGH A;  3N1X C;  1C9F A;  4MT5 A;  1UZX B;  4DXF A;  1U4A A;  2L3Z A;  1EWY C;  2PTL A;  4K81 A;  2ZEQ A;  2WXI A;  2QMT A;  3IHP C;  3PO0 A;  2K25 A;  1RRB A;  5LXI B;  2PE9 A;  1C79 A;  2WU2 B;  4ZRQ A;  4HKQ A;  3AEC B;  2PKO A;  1C1Y B;  4DK5 A;  3A9J B;  3T9L A;  3VUX A;  1Z5S B;  2XK5 B;  1MPE A;  2MH7 A;  4MDK E;  2RMM A;  3N3K B;  4RGO S;  2NVU I;  2ZJD A;  5IO9 A;  2DZJ A;  3B2F A;  1VR9 A;  2IND C;  2LXA A;  3TEX A;  2KTR A;  2ICI A;  4B0E A;  1T0Q C;  4KX6 B;  1MHH E;  3OJ3 A;  2A4Z A;  4Q2J A;  2DZK A;  3NVZ A;  2LMC A;  3NOB A;  3DCG A;  2CHZ A;  1LM8 B;  2LRW A;  2CR5 A;  3CSF A;  2G1E A;  1FFU A;  3RPF C;  2K9X A;  2D07 B;  2XBB C;  2AX5 A;  2MHJ A;  4M8N A;  2JQR B;  4KDI C;  4DXA B;  1ZXH A;  4YWG G;  3SFD B;  4ZRP A;  1WGG A;  1F52 A;  3UIO B; 
#chains in the Genus database with same CATH homology
 3ABV B;  3H8H A;  3P1M A;  4WAF A;  4C56 C;  1ZDX A;  1ZPS A;  2X38 A;  1HQR D;  3AE7 B;  3ZQ4 A;  4OW0 A;  1IGC A;  2DBY A;  1TS5 A;  2KN4 A;  2V4I B;  3BII D;  1YN3 A;  4REZ A;  1EWC A;  1I4H A;  2MEK A;  1VZ7 A;  3BWU D;  1RYJ A;  5GXG B;  4A55 A;  2QEJ C;  3I57 A;  1F2R I;  1SE2 A;  1FD6 A;  3BK1 A;  4OZB A;  4RCO A;  4ITK A;  3IAS 1;  2VZK B;  5LNK 1;  4RF1 A;  1NI3 A;  2BT6 A;  1FNV A;  1V97 A;  1YNT E;  2QJL A;  1E7P B;  1T3Q A;  2FE8 A;  3BVM A;  3PZ8 A;  1N61 A;  1FEH A;  3BYT B;  4NAM A;  4YXD B;  1R7S A;  2PVO D;  4TMA B;  1FRD A;  4N6E B;  1PUT A;  1RWS A;  1E10 A;  1KF6 B;  1TS4 A;  1I4G A;  2PLP A;  1AW7 A;  1C77 A;  2Z8L A;  2WXL A;  3HVZ A;  2NMQ A;  1OQR A;  3E56 A;  5G5G A;  1L0V B;  4WQM A;  3P4Q B;  1XCQ L;  1I4X A;  2Y5C A;  2WXN A;  4D2K A;  1HEZ E;  3P4S B;  1B1Z A;  3CIR B;  1T6B X;  5HHD G;  3UI3 A;  4IKG A;  4XDD A;  1GOZ A;  4YTN B;  1BUI C;  1XXG A;  1B9R A;  1N60 A;  1SXT A;  3O13 A;  3Q69 A;  3VRB B;  3AN1 A;  1OQQ A;  2B76 B;  4LLG M;  1M4V A;  3TEY A;  2NTT A;  2W3S A;  1FCL A;  5BMI A;  1FM0 D;  4ARC A;  2WXQ A;  1EM7 A;  2WDV B;  1FMA D;  1DGJ A;  1C76 A;  3AEB B;  1T5X D;  1TKG A;  1TY2 A;  4GDL B;  3V3X A;  2GRI A;  3LYY A;  4M0W A;  4OVZ A;  1C4A A;  1F0Z A;  2NTS A;  1NEK B;  4JWU C;  1V8C A;  2IGD A;  2VZK D;  4LK0 M;  3BK2 A;  3W1S A;  5BMG A;  1VJK A;  1WWT A;  1L4D B;  1E9M A;  2H89 B;  2SAK A;  3AH7 A;  4C80 A;  1KFY B;  2WNM A;  2HDE A;  1FXA A;  4KKJ A;  3Q8B A;  4PT5 A;  2V3N A;  2WDR B;  4TQ0 A;  1XO3 A;  1QKZ A;  4US9 A;  2DLB A;  4HRO A;  1CQV A;  1AWD A;  2KDM A;  3IXS A;  1SJE D;  4MM3 B;  4YSY B;  1GB4 A;  1EU4 A;  1P7F A;  4KGS A;  5I4D A;  1PGA A;  5E6J A;  4AS1 A;  4N58 A;  3WCQ A;  5EE0 A;  5G5H A;  2WXM A;  3EUB 2;  2L52 A;  4WIP A;  3ZJV A;  1L5P A;  2L32 A;  1XF5 L;  2JX5 A;  5AUI A;  2BTE A;  2WU5 B;  3LXF A;  4RH6 A;  1DOY A;  1WGK A;  1NYR A;  3VRA B;  2D5G A;  1SJH D;  1D5Z C;  3DWM A;  3W5V B;  2WLB A;  2I2Y A;  3Q8A A;  2JXT A;  1TZO A;  1QIL A;  1AYF A;  1L0X B;  3PZ7 A;  4GDK B;  3TEZ A;  2ON8 A;  2N9L A;  2XNA C;  2WDQ B;  1E0Z A;  4WH4 A;  4YTM B;  2ZW1 A;  1F77 A;  2YEP F;  4XWW A;  1HZ6 A;  1XLP A;  2PVG C;  3MP9 A;  3OWE B;  4RGM A;  2E3T A;  3R2I A;  3TUO A;  2I38 A;  1MI0 A;  1XCT L;  1FO4 A;  1XEE A;  2W55 A;  1JWU D;  5FR3 A;  1P7E A;  3BVG A;  3KQ4 A;  3P4R B;  3T3N A;  2M56 B;  2LHE A;  1V1O A;  2BW2 A;  3CWI A;  4KKI A;  3VR9 B;  4MH8 A;  1J7C A;  1JWS D;  5EE3 A;  5AUK A;  4ZHO A;  4YT0 B;  2FUG 1;  3FAH A;  4GLS C;  4NJC A;  2JU6 X;  4XWT A;  3HVD A;  2LFI A;  2ZW0 A;  1FFV A;  1Y56 A;  5D3I B;  1WSP A;  3AE9 B;  3GS2 A;  3Q8E A;  4NAW B;  5JXV A;  3E9S A;  3T3O A;  4TSS A;  1ZDV A;  5HFY A;  2Q5W D;  2K22 A;  4IOI E;  1IUE A;  1YMH E;  3AE2 B;  2Y5P A;  3Q8F A;  3NZ3 A;  1YN5 A;  1K52 A;  1PYW D;  5HI1 A;  3ZGZ A;  3AE3 B;  2EEL A;  2RDH A;  4C7Y A;  3U7Z A;  3AV8 A;  1VLB A;  3KLS X;  2BS2 B;  4H2A A;  2EKI A;  2CJN A;  3GP7 A;  3TEW A;  1CJE A;  1PGB A;  3ZJU A;  1UUP A;  2AQ2 B;  2LEK A;  2WXF A;  1FRR A;  2AQ1 B;  3AE5 B;  3AED B;  3MHZ A;  2J42 A;  2WXR A;  1IBX A;  5BYQ A;  3FIL B;  1FNU A;  2QIE B;  1TJE A;  2M0A A;  1F2R C;  4RNA A;  2SEB D;  4EE2 A;  1KRH A;  5BYS A;  3IT4 B;  2PIA A;  3TSS A;  4FXC A;  1C4C A;  1QOF A;  1L6V A;  4MAC A;  1WXQ A;  3HRD D;  1D5X C;  1UGJ A;  1D4B A;  1MHX A;  1Q10 A;  1VZ8 A;  3EA6 A;  1NEN B;  3KWL A;  2JSV X;  1CK1 A;  4OZC A;  2K3U A;  1UNS A;  4YSZ B;  1QT9 A;  2K0P A;  1HZ5 A;  2JWU A;  3BVZ A;  1N5W A;  1L6U A;  4RF0 A;  1GPX A;  3AEA B;  2WQY B;  1QOG A;  4CQN A;  2GB1 A;  2MJE A;  1SEB D;  1J7B A;  2V3P A;  4P16 A;  1LO5 D;  2N7J A;  1N62 A;  1TS3 A;  3MC0 B;  3ZJT A;  1BML C;  3ZYY X;  2PMV A;  2JZP A;  1JWM D;  2W3R A;  2J52 A;  4A9A A;  1SE4 A;  1IBX B;  2J4X A;  1ROE A;  4ZHP A;  2RDG A;  2Y3A A;  3AEE B;  3NVY A;  1MVK A;  4L23 A;  4XE0 A;  4DXG A;  4JPS A;  2BS3 B;  5MPO A;  1ESF A;  3B9J A;  1TS2 A;  1IGD A;  2WXG A;  4LTU A;  4ZOH C;  1XLN A;  2MJ3 A;  5D7G A;  3URY A;  3R8B A;  2GI9 A;  2DYM A;  3P42 A;  3RFZ B;  2WXP A;  3NS1 A;  3P63 A;  1ACC A;  2WXJ A;  2WXO A;  3IAM 1;  5FKA C;  1SBB B;  3VQI A;  2OHF A;  1D6E C;  1QOA A;  2BS4 B;  1XLQ A;  1V1P A;  4USA A;  2R61 A;  2KWD A;  1OFF A;  1I4Q A;  1XLO A;  1DYQ A;  4J3O D;  2E6X A;  2CU3 A;  3AE8 B;  2WXK A;  3AE1 B;  4NZL B;  1QQR A;  2H88 B;  5TSS A;  1VRA B;  3SFE B;  4HEA 1;  5C2T B;  5C3J B;  3FC4 A;  1C4P A;  3VR8 B;  1UWX A;  2ACZ B;  2LGI A;  3NVV A;  1KH0 A;  2G9H D;  2CJO A;  4A6Q A;  1JQ4 A;  2N0S B;  1KTK A;  1N63 A;  3NUH B;  3AEG B;  1GAQ B;  2KAC A;  3B2G A;  1WRI A;  4OHJ A;  1JCK B;  1PFD A;  3ETR A;  3FIL A;  2V0G A;  1A70 A;  3V05 A;  1UWM A;  1WYG A;  5FK9 C;  3HUI A;  1E6E B;  1L0Y B;  1SF0 A;  1HA5 A;  4RGT A;  1JML A;  3BZD B;  1SSN A;  2BB5 A;  3BYY B;  4L1B A;  2PW9 A;  1K51 A;  1TKE A;  2ONQ A;  5BYR A;  2INP E;  1PDX A;  3AM9 A;  1V1P B;  2KMM A;  1NYQ A;  1QOB A;  1RFK A;  4HRS A;  1HXY D;  3AB5 A;  2MJD A;  1SE3 A;  4HJG E;  2DYO A;  2YEP B;  3AE6 B;  3AMZ A;  4JE3 B;  3MFG A;  1JRO A;  3AE4 B;  4JWS C;  4KGT A;  3U4E G;  2J53 A;  4DQO C;  2WP9 B;  4A90 A;  4AQ7 A;  1YJJ A;  3P4P B;  4HKZ E;  1BXT A;  1KLG D;  2KAJ A;  4L2Y A;  2L1A A;  1ZUD 2;  3U2S C;  1N5X A;  2AQ3 B;  3Q8C A;  3J9C A;  4P6V F;  5BMH A;  1ZE3 D;  4O1N A;  1I4P A;  2M19 A;  3EGR A;  1VDV A;  2LHD A;  1YN4 A;  1NVI D;  1ZP0 B;  1DOI A;  4JX1 C;  2N9K A;  1ET9 A;  3N9Y C;  4KGR A;  4UDU C;  4WUR A;  2HTM E;  4TQ1 A;  1SB3 C;  1I4R A;  5D3D A;  2JYT A;  1DOX A;  1ENF A;  1RM6 C;  2K5P A;  3DWG C;  1J7A A;  1JRP A;  3GB1 A;  1ZXI A;  3SEB A;  4US8 A;  2RPV A;  1JW9 D;  1C78 A;  2WXH A;  4WWM A;  3NVW A;  2IGH A;  3W9C B;  2JYE A;  1C9F A;  4MT5 A;  4DXF A;  4ZYS A;  4OZA A;  2W54 A;  2XN9 C;  2IJ0 A;  1EWY C;  2PTL A;  2WXI A;  4XDC A;  2LUM A;  4A8X C;  2QMT A;  3PO0 A;  1YJI A;  2LJI A;  1C79 A;  2TSS A;  3LB8 C;  1SIJ A;  1FCC C;  2WU2 B;  1TKY A;  4N59 A;  2DWQ A;  3R2T A;  5EE9 A;  2FBW B;  4ZRQ A;  2QSD A;  4HKQ A;  1KLU D;  3AEC B;  1ET6 A;  2IGG A;  2PKO A;  1YQ3 B;  4RGN A;  5T8I A;  1STE A;  1K50 A;  3C8Y A;  1JWB D;  1PGX A;  5HG2 A;  4IDI A;  2BBC A;  4YTP B;  1L4Z B;  3W5U B;  2KQ4 X;  3AEF B;  1MPE A;  2MH7 A;  2BB6 A;  2IDY A;  4YSX B;  2RMM A;  3W2D A;  1GB1 A;  2L83 A;  3NRZ A;  4RGO S;  1TYG B;  1CZP A;  3B2F A;  1VR9 A;  5H8Y E;  1JAL A;  3U52 E;  1AN8 A;  4ARI A;  1FIQ A;  1QF6 A;  1VZ6 A;  4C7Z A;  1FXI A;  3TEX A;  2W82 A;  3SR6 A;  2ICI A;  1JWA D;  4B0E A;  4KX6 B;  1MHH E;  1EU3 A;  4RFB A;  2OED A;  3I9V 1;  4Q2J A;  3NVZ A;  5EE1 A;  1FNW A;  5H92 C;  2LMC A;  1QLB B;  1D5M C;  2WS3 B;  1TY0 A;  4B0M A;  2G1E A;  1FFU A;  2INN E;  2IPK D;  3RPF C;  3L4P A;  2K9X A;  1K53 A;  3IT6 B;  4R3D A;  3MJ5 A;  1I7H A;  2AX5 A;  1YQ4 B;  1ZOY B;  2JQR B;  2QIL A;  3KWV A;  1ZXH A;  2BYT A;  4YWG G;  3SFD B;  4ZRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...