4NZLB

Extracellular proteins of staphylococcus aureus inhibit the neutrophil serine proteases
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
96
Chain Sequence
b'KHTVPYTISVDGITALHRTYFVFNKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil elastase
publication title Staphylococcus aureus secretes a unique class of neutrophil serine protease inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 29
structure length 96
sequence length 98
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4nzlB00
1SE4A 3TSSA 2IPKD 1JWMD 3BZDB 1SBBB 1SE3A 1D5ZC 1JWUD 2ICIA 1DYQA 1D5MC 1HQRD 2NTSA 1KLGD 3BVGA 1KLUD 1I4HA 1TS3A 1V1PB 3MFGA 4O1NA 1D6EC 3KLSX 4RGMA 1TS4A 3BVMA 2R61A 1ET9A 4RGOS 1SE2A 3SEBA 1HA5A 1L0YB 1I4XA 2IJ0A 1KTKA 4TSSA 1BXTA 3OWEB 1TS2A 3R8BA 2SEBD 2AQ2B 1QILA 1JWSD 1YN3A 1EU3A 4DXFA 1FNWA 1JCKB 4RFBA 1STEA 2RDHA 1YN4A 2TSSA 1HXYD 1FNUA 1TY0A 2RDGA 2XNAC 2AQ3B 1SXTA 1TY2A 5D3IB 3BYYB 3O13A 1ET6A 2G9HD 3EA6A 2J4XA 1T5XD 1UNSA 1ENFA 4NZLB 3BVZA 1AN8A 1FNVA 1F77A 5FK9C 1SJHD 4RH6A 4UDUC 1B1ZA 1LO5D 1EU4A 1CQVA 2AQ1B 4ZYSA 5I4DA 3V05A 4RGTA 1AW7A 1SEBD 4RCOA 1D5XC 1PYWD 1I4GA 4C56C 1I4RA 1EWCA 1XXGA 1ESFA 1YN5A 2XN9C 3GP7A 2QEJC 1M4VA 1L0XB 3MC0B 5FKAC 1TS5A 2NTTA 5D3DA 1I4PA 1V1OA 4OHJA 4RGNA 1I4QA 2QILA 4DXGA 2Z8LA 5TSSA 1V1PA 3R2IA 1CK1A 3URYA 3W2DA 1SJED 1GOZA 3R2TA 1UUPA 3BYTB
chains in the Genus database with same CATH superfamily
4WJPA 3WAMA 5IKCM 3QCAA 2KZRA 3AU4A 3KQ4A 2PE9A 2PLPA 3BVGA 1QT9A 3VRAB 1MHXA 4RGMA 3QJZA 1C3TA 2BW2A 2J0JA 2CS4A 2NBWB 2WX0A 4FN2A 1YX6B 2KMCA 3R8BA 3BY4B 4KGSA 4WURA 1N6ZA 1KJTA 1RYJA 2FUHB 5LXHA 2GBJA 1E8ZA 4TMAB 4AS1A 4JE3B 3L08A 4MEMA 2GOWA 1WGHA 3Q8CA 4E74A 1TY2A 5D3IB 2KYWA 2FNJB 3X0WA 5L95C 2LD9A 5C3JB 2EKIA 1RFAA 4ZDVA 1FNVA 4FJZA 1P98A 2AQ1B 2LJIA 4HLEA 2V3NA 4NAWA 2JYTA 3V05A 4ICUA 3TEYA 1OGWA 4W9LA 2K6QA 3P4SB 1E8WA 1FCLA 2MSED 2ZEQA 1I4RA 5HHDG 4LLGM 4RNAA 2MW5A 1WJUA 2NS5A 2YEPF 3AM9A 3IT6B 3L0WB 4ZHOA 3N9YC 3URYA 1C9FA 1UGMA 3MTNB 4MGIE 3SHQA 2MX2A 4BAXA 2LRUA 1SJED 2ACZB 2M4NA 1EO6A 1S3SG 4A55A 1MPEA 2CJNA 1UGJA 2N7DA 4C4VA 3ZIMA 3A4SC 3HUIA 4K1RB 4IWPA 4IWQA 2LXCA 3QA8A 1J8CA 3AE8B 1WGDA 2Z0EB 4EOYA 1P1AA 2GBMA 2HE7A 3AECB 1ET9A 4II2B 2Z59B 3VR8B 1SE2A 4EUTA 5FR3A 5IO9A 2V0GA 1ZXHA 3E9SA 4XDDA 3AE3B 4ZHPA 2DBYA 3A9JB 1UWMA 4OW0A 4NQLB 2BKFA 1JWSD 2OHFA 4IUMB 3R66C 3K9OB 2PMVA 2J0MA 2J0KA 3AU5A 4ZRIA 3HHMA 5J18A 1DOXA 2LRWA 2X38A 3ZRFA 5E6NA 4DWFA 3PZ7A 3ZYYX 3DVNU 3R7QA 1BMLC 2O2VA 3VH3B 3L4PA 4RCOA 4N59A 2FAZA 2NMQA 4BFRA 4YTPB 5EE0A 4YSXB 3VUXA 4MJSB 1C78A 4GSWA 2LGDA 4ANVA 1GG3A 3ZUNA 2IGHA 3PTFC 5E6PA 3AN1A 1LFDA 1V5TA 4HEA1 4ANXA 1KF6B 4DQOC 2NPTB 4LDTB 1H4RA 4YXDB 4LNFA 1UUPA 1IPGA 1YQ3B 1EF5A 1JRPA 1PFDA 1VD2A 1QOAA 2FE8A 2WP9B 1IBXB 3BZDB 4NPNA 1WZ0A 2ICIA 1DYQA 3OJ4B 3SR6A 3CF6E 3RNEC 4KGTA 4ZRJA 4C00A 4HDOA 1X1MA 2GBRA 2UU7A 2RSUA 3KUZA 3WCQA 4G3XB 3KW5B 1HEZE 4BVUC 3AEBB 2JZPA 4AOFA 1EF1A 4K81A 4P1BC 2BS3B 3CIRB 4B6WA 4M8MA 3J9CA 2O6VA 4M01A 2B76B 2KLGA 1TZ1A 3H7PA 3ZTDA 1TZOA 2FUG1 2FIDA 1L5PA 3VUWA 3BVZA 2QMTA 2ASQA 1P7FA 2O6VD 2V3PA 2ZVNA 4J3OD 4IDIA 3UI3A 3SU8X 4F7ZA 2UYZB 2UWQA 1L6UA 1PDXA 4WWNA 3LXFA 4G0NB 1YN5A 2B3AA 2XN9C 5FR6A 4OZBA 3ECIA 1TS5A 2NTTA 2QSDA 2WXOA 1UD7A 1WM2A 5D6JB 3FC4A 2MRPA 4AWJA 3ZRCA 1YJ1A 1V1PA 4US8A 3KWVA 1QKZA 4I6NB 2WXFA 4HKQA 1L4ZB 2N1WA 3ZXVA 1GPXA 2ONQA 4JX1C 4NQKE 1I4HA 1Q1OA 4ARCA 3AULA 2Q5WD 3NZ3A 2DENB 3IG3A 3AE1B 1UBQA 3UF8A 3GE8C 4NY0A 2JWZA 3BIID 1FXAA 1K53A 4WJNA 2WXIA 5AZGA 1WJ6A 3PT2B 2CJOA 1JW9D 1R4NI 4ACFA 4DXFA 1OQYA 1GC7A 4IM3A 2MQJA 3RCZA 1HZ5A 3MJ5A 2SAKA 3ZVVA 2L1AA 4W9IA 3N20C 4YL8A 1HXYD 1EUVB 2DLBA 3RNBC 1WGRA 4PS8A 5C23A 1LQBA 1SIFA 1XO3A 3AEGB 3DBLB 1KH0A 3EA6A 3GZNB 4R3DA 4A9AA 4C7YA 3MHSD 3VVWB 1CMXB 2KK8A 3IBEA 1T0RC 2AX5A 3HM6X 2JVCA 4PS3A 2V3SA 2WDRB 3NG0A 2CU3A 1WX9A 3TBLD 2D3CA 1WY8A 4YTMB 3BWUD 2DYOA 3ZJVA 4FULA 2DNFA 2IBIB 2LWPA 4Q2JA 5G55A 1V8CA 2DHZA 4JWSC 4MJSA 4CHKA 1I4PA 1ZW7A 2KX3A 1QOFA 3HK0A 2Z8LA 4LNIA 2WU2B 2HTHA 3C0RB 2BYFA 2M19A 1VR9A 3IAM1 3TL5A 3VTVA 2JY6A 1C77A 1V9JA 1N63A 4EZJA 3BYTB 1WGKA 1SE4A 4BZAA 1GB4A 3X23A 2KX0A 1ZKHA 3PRMB 3TJPA 3DBHI 1MG4A 4GLSC 4A3OA 2KLCA 4KDIC 2WLBA 2KDEB 1LGRA 2DX5B 3TUOA 5C1ZA 2GRIA 2FCNA 3UGBB 3RD2A 2BWES 3Q3FA 1I4XA 3B2FA 3VTUA 3RT3B 2RD0A 3NHEB 1PUTA 4XGAB 4FBJB 3AEFB 3O65B 2KOXA 4TQ0A 5AUKA 1TKEA 2JRHA 1NYRA 2KQ4X 1DOYA 1UF0A 3B0AA 1WF9A 1G6JA 1FEHA 3A9KB 1C1YB 1NVID 4J6IA 2MP2B 3QC8B 2KWVB 2RDGA 1NEKB 1HTQA 3DVGY 1DOIA 1OEYA 4W9JA 3U7DA 2KTRB 5J2RA 2XK5A 1V49A 3SD5A 4MGZE 1R4MI 2IO0B 3W1SA 2FCSA 4KIKB 3WIMA 3NVVA 3T9LA 1YJJA 3QK0A 1YJIA 3GOEA 2K8CA 2I38A 2JPHA 1TKYA 3Q3JA 2KWDA 3PVLA 3N30A 1RRBA 4NAMA 1T0QC 5HFYA 2G45B 3RUIB 3ML9A 4ZOHC 4BOSC 4OZCA 4TUUA 2N9KA 2INDC 2BS4B 2YVCA 1T0SC 3AEDB 1B9RA 1CK1A 1WI0A 3AE4B 3Q3OC 4F1SA 5LNK1 2D11A 3Q2AC 5H92C 4CQNA 1SGHA 4GB9A 3D32A 3TIXA 3R2TA 4K7WA 3H8HA 2ZNVB 2DYMA 5G5GA 2LHEA 5DPRA 2JXXA 4EZLA 1MVKA 2IGGA 2MJDA 1A5RA 3HIZA 3Q8BA 2I2YA 1EWYC 2WNMA 4PS7A 2IDYA 2IO2B 2M0XA 1RLFA 4HK2A 4FLHA 3BVMA 3MC9A 3Q6BA 3Q3MC 3RN9C 1C4AA 1HA5A 3RZFA 1ZGUB 2IJ0A 4HWIB 2WGSA 3JSVB 3CMMB 2V1YA 5BO4B 4L2YA 3AEEB 1VJKA 2ON8A 1D4BA 2Y3AA 4BBNC 1YX5B 2MWSB 4WJOA 1YN4A 4WWOA 1F2RC 3UIPB 2REXA 3U30A 2DAJA 1F9JA 3AMZA 4GIVA 1WMHA 1T5XD 2MBHA 3I63C 1PQSA 2R2OA 2D5GA 1AN8A 2WWZA 3QIJA 2KDBA 2EELA 2FBWB 2O6VB 4LNOA 3NJTA 4RGTA 4OVZA 3H7PB 3AI5A 3ZO5B 2WX1A 4JLCA 1K50A 2QCZA 2KMAA 1FIQA 5IP4D 3APDA 2GBKA 1V1OA 2LEKA 1N61A 2CU1A 4RGNA 1K52A 5TSSA 1I42A 2HD5B 4PYZA 4DXAB 1XF5L 3UQAA 2WXRA 1ZOYB 1GOZA 3M95A 4XWWA 3Q8AA 3V6CB 4QAYA 4C7ZA 2PIAA 2D2QA 3DWMA 4E3CA 5H8YE 1YIWA 2BTEA 1HQRD 3VAWA 1V1PB 2KVRA 1IUEA 1JMLA 4HJKA 1K8RB 2JX5A 1V97A 2MHJA 4K7SA 1P3QU 4A6QA 2CKHB 1WRDB 4RGOS 4KKIA 1RWSA 1L4DB 1UBIA 3FILA 4LNNA 4W9GA 4DK5A 1PGXA 2BQQA 1WFYA 3Q3NC 1QILA 1MFWA 2W55A 1EU3A 1Q5WB 2WXKA 5EE3A 3BINA 5MPOA 2AYOB 1XLOA 1V80A 1N62A 2K39A 2Y5BB 2QHOA 3EGRA 5BYQA 3A9KA 2MH7A 2MP2A 3U8ZA 1ACCA 4I6LB 2W3SA 2R2QA 1FPYA 1KFYB 1Q10A 5I4DA 2KTRA 3PO0A 5DPTA 2YLMA 2L52A 4GN1A 1SEBD 1PYWD 1UELA 4KIKA 4HPMB 2WDTB 2MJ3A 4DBGA 1ZUD2 1E0ZA 3L13A 1I35A 2J52A 3P2BA 4MDKE 4ZRQA 2QILA 2DZJA 2ZPNA 5AZHA 3ZLZA 3W1SC 4PK1A 3SFEB 3CWIA 4ZYNA 3AXCA 3EUB2 5L83A 2MCNB 2K0PA 2WXJA 2MBOA 3EFUA 4XWTA 2G4DB 1TBEA 3MP9A 5HKHA 3WALA 1Y8RC 1JWMD 2PEAA 4DHJB 2NR2A 2HDEA 2W54A 3VRBB 3NVYA 2KANA 5JH5C 3MFGA 3BK2A 1FRDA 1WXSA 5JHBA 4S0RA 1F2RI 5BYRA 4NJ7A 1MJDA 1WJNA 2I1KA 2AL3A 4MACA 3W9CB 5BMIA 2KFKA 2Z0DB 2SEBD 2WXNA 4B0MA 4B95A 1J7BA 4P16A 3JSVA 3KUDB 4WJQA 5EE9A 3M3JA 2HTME 2BBCA 2JT4B 3H6NA 4TKNA 1V5OA 2KO3A 4I6PA 3KH0A 1WR6E 4LJPB 1SXTA 2LGIA 2I1JA 2WXGA 1WXAA 1I7HA 2KJHB 5G5HA 4A8XC 1ZE3D 1P9DU 1XEEA 3DBSA 2INNE 1XLQA 1ZXIA 2KHWB 5CX3A 3L54A 2L7RA 2V4LA 1AW7A 4G11A 4HXDA 3MHZA 5CTRC 3RPFC 4X57B 2L0TA 1UWXA 3PLVA 1TKGA 1L2NA 3H9DA 2QEJC 4AUQC 3RULA 4EFOA 2XK5B 2C60A 5GXGB 1WRIA 2PJHA 2BYTA 1FXTB 3DHHC 2DAFA 1E9MA 2L76A 5C2TB 4CYEA 2M1MA 3P63A 4MGKE 3PSEB 3SFDB 1GJZA 5D2MB 4XZ4A 2VZKD 2MJEA 1YQBA 3VXWA 4HKZE 4CO7A 1VRAB 2ZW1A 1JWUD 1WXMA 1WE6A 4JWUC 2DZKA 1JALA 3AE2B 4RM8A 1KTKA 2GBNA 2QDFA 3QQ8B 3U4EG 2N0SB 4ITKA 2G1EA 1E5WA 3PGEA 2Y5CA 3A1QB 3GE3C 4BKSA 2LHDA 1V2YA 3OJ3A 2N9LA 2KD0A 3DOWA 1STEA 1WR1A 1OEYJ 1TY0A 2OJRA 1AARA 3P4PB 1TT5B 5IN7A 4G50A 1ENFA 2KWUB 4BKSD 5FK9C 2KQ7A 4USAA 4RM9A 1WXQA 2RPVA 5EE1A 4IM0A 2LASA 1N5WA 4OZAA 2RPQA 4MGYE 4RMAA 1J7CA 4PT5A 1WMHB 1M4VA 2KC2A 2BWFA 1M94A 3UINB 3WA0A 1AWDA 4KGRA 4KX6B 1HZ6A 4ZRPA 1TTNA 2D10A 4BKGA 3AE7B 2LGYA 2PPHA 1YOVB 3RMKC 5CHFA 2MBBB 3I9V1 1JWBD 4MELA 1NYQA 3DBRB 1E90A 2PW9A 2WXMA 4JGHB 1WJ4A 3V60A 3HM3A 1QF6A 1KLUD 2AL6A 3EC8A 4B0EA 2WXPA 1F0ZA 1OQRA 2IO3B 2JRIB 5E6OA 4JPSA 4LCDE 4A20A 4EZKA 2EMSA 2R61A 5CHVC 2D07B 4GU2A 4HDQA 1LXDA 1NI2A 3UQBA 4HVBA 4GDLA 3OWEB 2QC8A 1Y56A 3W5UB 2ZNVC 4ARIA 2KWCA 3B9JA 4EKUA 3T8MA 1TJEA 1FRRA 3PRZA 2E6XA 2RDHA 2LVOA 2TSSA 3FILB 3DQVA 1FNUA 5LXIB 2K8HA 4M02A 2M8SA 2V4IB 1T6BX 1UNSA 4DHZB 2RDBC 1VCBA 3DBLI 3GZNI 4HPPA 1K51A 2KACA 3DVGX 1HE8A 3LB8C 3RNAC 1L7YA 3JYUA 3OG5A 2CHXA 1C76A 3KUCB 1P0RA 3APFA 2JZZA 5DPSA 3DBRI 3TMPB 4HJGE 4KZ0A 2JF5A 2JU6X 4W9KA 2OEDA 3NUHB 2A4ZA 2INCC 2KDFB 4XC2A 2WHIA 4P6VF 3M63B 4W9DA 1GAQB 2DZIA 1ZP0B 3DWGC 4DDID 4N6EB 4M8NA 2LGSA 4FADA 2EMTA 3NY5A 4HCPB 1C4CA 2DYBA 3N1XC 2IPKD 2K6DB 1FO4A 3Q8EA 2N9XA 3M62B 1SB3C 3VR9B 2BF8B 4O1NA 2RMMA 3W5VB 4HCNB 1KM7A 2HJ1A 2WXLA 4IOIE 1TS4A 3VDZA 1VZ8A 3PZ8A 1WX7A 4MSMB 1F1HA 2JQRB 1TS2A 2HJ8A 4IWOA 4NJCA 4YT0B 5BYSA 2LXAA 4AP4C 2MBEA 4W9EA 4FA6A 2LVPA 4RF1A 5D94A 4E71A 2FCMA 1YD8U 2KAJA 3A1QA 5JZEB 2C5LC 2IY0B 2AQ3B 2KFKB 4JL9A 2RR9A 2QIEB 2NCNA 2KDMA 2J4XA 4AJYB 1FFVA 1OTRB 2IO1B 3RNCC 2G3QB 2GMIC 3EHVA 3ZQ4A 1ZPSA 2WDVB 1LO5D 1YMHE 3N1YC 2JWUA 5TR5A 4KV2A 3U7ZA 3S2AA 2C7NB 2X8XX 3PLUA 1WM3A 2GB1A 1NI3A 2L32A 3B1LX 3CSTA 5DCNA 1I4GA 2NBUA 3N32A 2M0AA 2K3UA 2BS2B 5FKAC 2ZPYA 4IC7B 1XLPA 2BPSA 3RNFC 3JW0X 3V62A 2KC1A 3GB1A 2KTFA 3PV1A 2W3RA 4RF0A 5EDSA 2VZKB 2WYQA 2KQSA 3DDCB 3Q8FA 2CHZA 1SE3A 4IKGA 2N7JA 2WQYB 1D5ZC 2NTSA 1SSNA 2BGFA 3A33B 1T0YA 3NVWA 4KVGB 2JZ3B 3L10B 2KN5A 2WXHA 4PYUA 3Q14C 4IM2A 1P7EA 3SEBA 4REZA 4WWPA 2N9PC 2KDIA 1QOGA 4W9FA 1N5XA 3ABVB 2J7QB 2IGDA 4DHZE 2KMMA 4HPLB 1TYGB 2LMCA 4EE2A 4K3CA 2GLSA 1FM0D 2KJRA 3HRDD 3ZJTA 2KFJA 2XNAC 3T3NA 3U2SC 3I5JC 3TEWA 5JXVA 4WH4A 1PGBA 3PPAA 1WIAA 2KNBA 4NZLB 1J7AA 2V9HA 3W1YA 3NS8A 1SJHD 4UDUC 4WAFA 4D2KA 1Z2MA 3MC8A 1E8YA 3VH4B 1V6EA 1XCTL 3NS1A 4JQWC 3AB5A 3RI7C 3VTWA 4N9F4 4A90A 2LI5A 1ESFA 3E56A 1IGDA 3L16A 2J53A 2N4FA 1WYWB 1J19A 4M0WA 5LLIA 2W9NA 5E6JA 1RFKA 2BB6A 2PVGC 3V6EB 1KOTA 1WXVA 3W2DA 1U4AA 1CJEA 1LM8B 2JUOA 2KT7A 3ZJUA 2KKCA 3TSSA 3U52E 3C8YA 3MJWA 3ETRA 4DDGD 1VZ6A 1JRUA 3ZNID 5AUIA 5DPWA 3ML8A 3ZDTA 3P4QB 1E6EB 3EECA 2EKEC 1NBFC 1XD3B 2N9EB 1JQ4A 4K3BA 3WANA 2L0FA 2AWTA 5D7GA 1QZEA 3IXSA 3RYTA 4MM3A 1UH6A 3WAPA 5BMGA 1XQQA 3AEAB 1WGGA 1WH3A 4AQ7A 1FFUA 1YNTE 2K1FA 1JCKB 3B08A 4F8CB 3TEZA 2PE6B 4FXCA 1OFFA 2WDQB 3IAS1 3ENEA 3NVZA 4GDKA 3UIOB 4GDLB 3OAWA 2NBVB 3VUYA 1SE9A 1GB1A 3ZNHB 2D3GA 1F77A 2W82A 4ZYSA 1CQVA 3C19A 3ZNZB 3ALBA 2WS3B 4YTNB 1NDDA 2FCQA 3LYYA 4XDCA 4FJVB 1N60A 1RM6C 4FHJA 4YWGG 4BKTA 2KXJA 1L0VB 2NVUI 3AE5B 3RNGC 2RGFA 3JVZX 3QAQA 3HVZA 2ZVOA 3DHGC 2J42A 4KSLC 3I3TB 1I4QA 4DXGA 4K7UA 3K9PB 3AH7A 1WX8A 4NNJB 4P7IA 3IFWB 2N7EA 3R2IA 1V81A 4II3B 2CR5A 2LZ6A 2KJ6A 4TQ1A 3NOBA 4GGQA 1E8XA 4LNKA 1J0GA 1WYGA 2N1VA 3A4RA 4GOCA 3ZKJC 4BBNF 2WXQA 3QX1A 3CSFA 3KVFB 1V86A 5HG2A 1OQQA 2GI9A 2E3TA 1D5MC 2L3ZA 1D6EC 2PTLA 3KYCD 3OLMD 4L1BA 5AEKB 4W9CA 3AE6B 3PREA 1QQRA 4B9KA 2M56B 2D3AA 2LUMA 2JXTA 4TSSA 4NJ6A 1BXTA 1VLBA 2L8JA 1R4NB 2MA9B 4OVUA 5HI1A 3N1ZC 4JIOU 2BB5A 4LTUA 4ANWA 3H7SA 1QOBA 4WAAA 1FCCC 3BYYB 1TGZB 1S1QB 1ZDXA 1GC6A 3QHTA 2KN4A 3P42A 5T8IA 4L23A 2K9XA 4YSZB 1EU4A 2IYDB 1T3QA 2DZMA 5GMVA 3IHPC 2M17A 4A3PA 1YQ4B 1D5XC 4C56C 2WU5B 1XXGA 3H1UA 3MC0B 4MT5A 3L17A 3KWLA 4KKJA 4MSQB 3ZNGC 5JHAA 2VRRB 2C7HA 1QLBB 2VH2A 2ZCBA 4M00A 1E10A 2ZZPB 2K25A 4YSYB 2LFIA 3ZDMC 1WGYA 1KLVA 2KVZA 4HRSA 3ZGZA 1Z5SB 4FJYA 1JROA 1IP9A 4S17A 1A70A 3EFCA 2JYEA 1VDVA 3R7RA 1H8CA 3AV8A 2VH1A 1Q0WB 3PRPB 2CHWA 2ZW0A 2C9WB 2INPE 3T3OA 4LJOB 2H89B 3DBHB 1SBBB 4C80A 4GXBA 3A9JA 1RAXA 2K8BA 1TS3A 3HVDA 3KLSX 3NZUA 1C79A 3PHXB 4WWMA 2L00B 1L0YB 1ROEA 1D3ZA 2H88B 2PKOA 4IG7B 3PHWB 2ZCCA 2OOBB 4RFBA 3VFKA 2MBQA 3BK1A 1WWTA 4XX5A 1ISNA 2OJWA 4KDLB 1MHHE 5G2NA 1NENB 2LGXA 1ET6A 2XEWA 4URKA 3AE9B 2G9HD 2BKRB 2BYVE 4WIPA 5KHQA 1TIFA 1BUIC 2L05A 3DVNV 4NAWB 1IYFA 1XLNA 4RH6A 3SDLC 2ZJDA 1R4MB 3DPDA 3RFZB 3P4RB 2LJ5A 5KHOA 1WSPA 1PGAA 2L83A 3IVFA 2NPTA 5J17A 3R3MA 4KZCA 2MEKA 4ZRKA 1EM7A 4DHJD 4EEWA 1R7SA 2FIFA 5IA7A 1IBXA 4XE0A 3VQIA 1WZ3A 4N58A 2C7MB 4FHKA 3ONSA 4LDTD 3ZXRA 5BMHA 3DCGA 1WE7A 2XBBC 1UZXB 3V3XA 1C4PA 3QWZB 5IOIA 1MI0A 4MH0E 1CZPA 3FKYA 4M0WB 4C4VB 2A5UA 1FD6A 4BOZB 1KLGD 2K22A 1MG8A 1SF0A 3ZW3A 2IY1B 4OVVA 2BVCA 4H2AA 2D3BA 1ZDVA 3VHTC 3TCAA 3GS2A 3IT4B 4HROA 3ZTCA 4TV3A 1DGJA 2AQ2B 2G4SA 1XT9B 1JWAD 1YN3A 2LVQA 4XYCA 2AEHA 2QJLA 3NRZA 4WQMA 1FNWA 1F52A 4LK0M 4WQOB 5CHWA 3KYDD 3PS6A 3O13A 4MM3B 4US9A 2MLBA 1IGCA 2BT6A 2Y5PA 3B2GA 3NZSA 4ANUA 3TEXA 2JSVX 4GMVA 2YEPB 2O2VB 4ASWC 4IW0A 1B1ZA 5IAAC 3WAOA 1GNUA 3FAHA 3P1MA 4GDKB 1FMAD 1FXIA 2K5PA 4KSKC 3QARA 1SIJA 1BT0A 1EWCA 3LDZE 3GP7A 2IZVB 1L0XB 4W9HA 1E7UA 3LJ3A 3N3KB 2LUEA 3Q69A 1XCQL 2PVOD 3I57A 1HTOA 3DHIC 1E7PB 5AZFA 5D3DA 1L6VA 3RZWC 4ICVA 4OHJA 1AYFA 4MH8A 2BYEA 3V61A 2DWQA 3APCA 1KRHA 1VZ7A 1GUAB 4AJWA 1E7VA 4P1CC 3PZDA
chains in the Genus database with same CATH topology
1SE4A 2VZKD 1GB4A 3TSSA 3U52E 2MJEA 3C8YA 3ETRA 4HKZE 3KQ4A 1VRAB 2PLPA 1VZ6A 2ZW1A 1JWUD 3BVGA 1QT9A 4GLSC 5AUIA 2WLBA 3VRAB 1MHXA 4RGMA 3TUOA 4JWUC 3P4QB 1E6EB 1JALA 2GRIA 2BW2A 3AE2B 1JQ4A 1I4XA 3B2FA 5D7GA 1KTKA 3IXSA 3R8BA 1PUTA 4KGSA 3U4EG 2N0SB 4WURA 4ITKA 2G1EA 3AEFB 5BMGA 1RYJA 3AEAB 2Y5CA 4AQ7A 1FFUA 5AUKA 1TKEA 4TQ0A 1YNTE 1NYRA 2LHDA 2KQ4X 1DOYA 1JCKB 2N9LA 3TEZA 1STEA 4FXCA 1FEHA 1OFFA 4TMAB 4AS1A 4JE3B 2WDQB 3IAS1 1NVID 3NVZA 1TY0A 2RDGA 1NEKB 4GDLB 3Q8CA 1TY2A 5D3IB 3P4PB 1DOIA 5C3JB 1ENFA 2EKIA 1GB1A 1FNVA 1F77A 5FK9C 4USAA 2W82A 4ZYSA 1CQVA 2AQ1B 2LJIA 2V3NA 1WXQA 2JYTA 2RPVA 3V05A 5EE1A 2WS3B 4YTNB 1N5WA 4OZAA 3W1SA 3TEYA 3LYYA 3NVVA 1YJJA 1J7CA 4XDCA 1N60A 3P4SB 4PT5A 1YJIA 1RM6C 1FCLA 1I4RA 5HHDG 2I38A 4YWGG 4LLGM 4RNAA 1TKYA 1M4VA 2KWDA 1L0VB 3AE5B 4NAMA 5HFYA 2YEPF 3HVZA 3AM9A 4ZOHC 3IT6B 2J42A 4OZCA 1AWDA 4KGRA 2N9KA 4KX6B 1I4QA 4DXGA 2BS4B 4ZHOA 1HZ6A 4ZRPA 3AH7A 3AEDB 1B9RA 3R2IA 1CK1A 3N9YC 3AE4B 3AE7B 3URYA 5LNK1 1C9FA 5H92C 3I9V1 1JWBD 4TQ1A 4CQNA 1NYQA 1SJED 2PW9A 3R2TA 1WYGA 2ACZB 2WXMA 2WXQA 3H8HA 2DYMA 5G5GA 2LHEA 4A55A 1MPEA 2CJNA 5HG2A 1OQQA 2GI9A 2E3TA 1MVKA 1UGJA 2IGGA 2MJDA 3Q8BA 1QF6A 1D5MC 3HUIA 2I2YA 1EWYC 2WNMA 1KLUD 4B0EA 2WXPA 1D6EC 2IDYA 1F0ZA 2PTLA 1OQRA 4JPSA 3AE8B 4L1BA 3AE6B 2R61A 3BVMA 1QQRA 3AECB 1ET9A 2M56B 3VR8B 1SE2A 2LUMA 1C4AA 5FR3A 2JXTA 2V0GA 1ZXHA 3E9SA 1HA5A 4XDDA 3AE3B 4ZHPA 2DBYA 2IJ0A 4TSSA 1BXTA 1VLBA 3OWEB 1UWMA 1Y56A 4OW0A 3W5UB 4L2YA 3AEEB 4ARIA 1VJKA 1JWSD 2ON8A 5HI1A 1D4BA 2Y3AA 3B9JA 2OHFA 1TJEA 2BB5A 1FRRA 2PMVA 4LTUA 2E6XA 2RDHA 1YN4A 2TSSA 1F2RC 3FILB 1FNUA 1QOBA 1FCCC 3BYYB 3AMZA 2V4IB 1DOXA 1T6BX 1ZDXA 1T5XD 1UNSA 2D5GA 2KN4A 1AN8A 1K51A 2X38A 3P42A 2KACA 2EELA 2FBWB 4L23A 2K9XA 5T8IA 4YSZB 3LB8C 3PZ7A 1EU4A 3ZYYX 1T3QA 1C76A 1BMLC 4RGTA 4OVZA 3L4PA 4RCOA 4N59A 1YQ4B 2NMQA 1D5XC 4C56C 4HJGE 2WU5B 4YTPB 5EE0A 4YSXB 1XXGA 1K50A 3MC0B 4MT5A 1C78A 3KWLA 2JU6X 1FIQA 2OEDA 3NUHB 4KKJA 2IGHA 1QLBB 1V1OA 2LEKA 1N61A 3AN1A 4RGNA 1E10A 4HEA1 4P6VF 1GAQB 1K52A 1KF6B 1ZP0B 3DWGC 5TSSA 4DQOC 4YSYB 2LFIA 1XF5L 4YXDB 4N6EB 4HRSA 3ZGZA 2WXRA 1ZOYB 1JROA 1GOZA 1A70A 1UUPA 1C4CA 4XWWA 2JYEA 1VDVA 3Q8AA 3AV8A 1YQ3B 1JRPA 1PFDA 2IPKD 4C7ZA 2ZW0A 3T3OA 2INPE 1QOAA 2FE8A 2WP9B 2PIAA 1IBXB 2H89B 3BZDB 1SBBB 4C80A 1FO4A 3DWMA 3Q8EA 5H8YE 2BTEA 2ICIA 1DYQA 1HQRD 1SB3C 3SR6A 1TS3A 1V1PB 4KGTA 3VR9B 4O1NA 1IUEA 1JMLA 3HVDA 2JX5A 1V97A 2RMMA 3KLSX 3W5VB 2WXLA 4IOIE 1TS4A 4A6QA 1VZ8A 3PZ8A 1C79A 4WWMA 4RGOS 4KKIA 3WCQA 1RWSA 1HEZE 1L4DB 3FILA 1L0YB 1ROEA 3AEBB 2JQRB 2H88B 2JZPA 1TS2A 1PGXA 2BS3B 3CIRB 4NJCA 4YT0B 5BYSA 2PKOA 1QILA 2W55A 1EU3A 3J9CA 2WXKA 5EE3A 4RF1A 5MPOA 4RFBA 3BK1A 2KAJA 2B76B 1WWTA 1XLOA 1N62A 1MHHE 3EGRA 5BYQA 1NENB 2AQ3B 1TZOA 1ET6A 2FUG1 2MH7A 2QIEB 3AE9B 2G9HD 2KDMA 2J4XA 4WIPA 1ACCA 1L5PA 1FFVA 1BUIC 2QMTA 3BVZA 4NAWB 2W3SA 3ZQ4A 1ZPSA 1XLNA 1P7FA 2WDVB 1KFYB 4RH6A 1Q10A 1LO5D 2V3PA 4J3OD 5I4DA 4IDIA 1YMHE 3PO0A 2JWUA 3U7ZA 3UI3A 3RFZB 3P4RB 2L52A 1WSPA 1PGAA 2L83A 2GB1A 1SEBD 1NI3A 1L6UA 1PDXA 2L32A 1PYWD 1I4GA 3LXFA 2M0AA 1YN5A 2K3UA 2MJ3A 2XN9C 2BS2B 2MEKA 4OZBA 5FKAC 1EM7A 1TS5A 1ZUD2 2NTTA 2QSDA 1E0ZA 1XLPA 2WXOA 1R7SA 2J52A 1IBXA 3FC4A 4ZRQA 2QILA 4XE0A 3VQIA 4N58A 1V1PA 4US8A 3KWVA 3GB1A 5BMHA 1QKZA 3SFEB 3CWIA 2WXFA 3V3XA 2W3RA 3EUB2 1C4PA 2K0PA 1MI0A 4RF0A 2WXJA 4HKQA 1CZPA 1L4ZB 4XWTA 2VZKB 3MP9A 3Q8FA 1JWMD 1GPXA 1FD6A 2ONQA 1SE3A 4IKGA 4JX1C 2N7JA 2HDEA 2W54A 2WQYB 1D5ZC 2NTSA 1KLGD 3NVYA 3VRBB 2K22A 1I4HA 3MFGA 1SSNA 3BK2A 1SF0A 4ARCA 1FRDA 3NVWA 2Q5WD 3NZ3A 1F2RI 5BYRA 2WXHA 3AE1B 4H2AA 1ZDVA 1P7EA 3GS2A 3SEBA 3IT4B 3BIID 1FXAA 1K53A 4HROA 2WXIA 4MACA 4REZA 3W9CB 5BMIA 1QOGA 2SEBD 1DGJA 2AQ2B 1N5XA 2WXNA 2CJOA 1J7BA 4B0MA 1JW9D 3ABVB 4P16A 2IGDA 1JWAD 1YN3A 2KMMA 4DXFA 2QJLA 3NRZA 4WQMA 1FNWA 1TYGB 5EE9A 2HTME 2BBCA 2LMCA 1HZ5A 3MJ5A 4EE2A 2SAKA 4LK0M 2L1AA 1FM0D 3HRDD 1HXYD 3ZJTA 2DLBA 2XNAC 1SXTA 2LGIA 3T3NA 2WXGA 3U2SC 3O13A 3TEWA 4MM3B 5JXVA 4WH4A 1I7HA 4US9A 1IGCA 1PGBA 1XO3A 2BT6A 3AEGB 2Y5PA 1KH0A 3EA6A 4R3DA 3B2GA 5G5HA 4A9AA 4C7YA 4NZLB 4A8XC 1ZE3D 3TEXA 2JSVX 1J7AA 1XEEA 2YEPB 2INNE 1SJHD 2AX5A 4UDUC 4WAFA 1B1ZA 4D2KA 1XLQA 1ZXIA 1XCTL 2WDRB 3FAHA 3NS1A 2CU3A 1AW7A 3AB5A 3P1MA 4GDKB 1FMAD 1FXIA 2K5PA 4YTMB 3MHZA 3BWUD 1SIJA 2DYOA 3RPFC 1EWCA 1UWXA 4A90A 1TKGA 3E56A 1ESFA 3ZJVA 1IGDA 2QEJC 3GP7A 1L0XB 4Q2JA 1V8CA 3Q69A 1XCQL 2J53A 2PVOD 3I57A 4JWSC 1E7PB 5D3DA 1L6VA 1I4PA 4M0WA 5E6JA 5GXGB 1QOFA 1WRIA 1RFKA 2BB6A 4OHJA 2PVGC 1AYFA 2Z8LA 2BYTA 4MH8A 1E9MA 5C2TB 2WU2B 3P63A 3W2DA 2DWQA 1CJEA 1KRHA 3SFDB 2M19A 1VR9A 1VZ7A 3IAM1 1C77A 1N63A 3BYTB 3ZJUA 1WGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SE4 A;  3TSS A;  2IPK D;  1JWM D;  3BZD B;  1SBB B;  1SE3 A;  1D5Z C;  1JWU D;  2ICI A;  1DYQ A;  1D5M C;  1HQR D;  2NTS A;  1KLG D;  3BVG A;  1KLU D;  1I4H A;  1TS3 A;  1V1P B;  3MFG A;  4O1N A;  1D6E C;  3KLS X;  4RGM A;  1TS4 A;  3BVM A;  2R61 A;  1ET9 A;  4RGO S;  1SE2 A;  3SEB A;  1HA5 A;  1L0Y B;  1I4X A;  2IJ0 A;  1KTK A;  4TSS A;  1BXT A;  3OWE B;  1TS2 A;  3R8B A;  2SEB D;  2AQ2 B;  1QIL A;  1JWS D;  1YN3 A;  1EU3 A;  4DXF A;  1FNW A;  1JCK B;  4RFB A;  1STE A;  2RDH A;  1YN4 A;  2TSS A;  1HXY D;  1FNU A;  1TY0 A;  2RDG A;  2XNA C;  2AQ3 B;  1SXT A;  1TY2 A;  5D3I B;  3BYY B;  3O13 A;  1ET6 A;  2G9H D;  3EA6 A;  2J4X A;  1T5X D;  1UNS A;  1ENF A;  4NZL B;  3BVZ A;  1AN8 A;  1FNV A;  1F77 A;  5FK9 C;  1SJH D;  4RH6 A;  4UDU C;  1B1Z A;  1LO5 D;  1EU4 A;  1CQV A;  2AQ1 B;  4ZYS A;  5I4D A;  3V05 A;  4RGT A;  1AW7 A;  1SEB D;  4RCO A;  1D5X C;  1PYW D;  1I4G A;  4C56 C;  1I4R A;  1EWC A;  1XXG A;  1ESF A;  1YN5 A;  2XN9 C;  3GP7 A;  2QEJ C;  1M4V A;  1L0X B;  3MC0 B;  5FKA C;  1TS5 A;  2NTT A;  5D3D A;  1I4P A;  1V1O A;  4OHJ A;  4RGN A;  1I4Q A;  2QIL A;  4DXG A;  2Z8L A;  5TSS A;  1V1P A;  3R2I A;  1CK1 A;  3URY A;  3W2D A;  1SJE D;  1GOZ A;  3R2T A;  1UUP A;  3BYT B; 
#chains in the Genus database with same CATH topology
 4WJP A;  3WAM A;  5IKC M;  3QCA A;  2KZR A;  3AU4 A;  3KQ4 A;  2PE9 A;  2PLP A;  3BVG A;  1QT9 A;  3VRA B;  1MHX A;  4RGM A;  3QJZ A;  1C3T A;  2BW2 A;  2J0J A;  2CS4 A;  2NBW B;  2WX0 A;  4FN2 A;  1YX6 B;  2KMC A;  3R8B A;  3BY4 B;  4KGS A;  4WUR A;  1N6Z A;  1KJT A;  1RYJ A;  2FUH B;  5LXH A;  2GBJ A;  1E8Z A;  4TMA B;  4AS1 A;  4JE3 B;  3L08 A;  4MEM A;  2GOW A;  1WGH A;  3Q8C A;  4E74 A;  1TY2 A;  5D3I B;  2KYW A;  2FNJ B;  3X0W A;  5L95 C;  2LD9 A;  5C3J B;  2EKI A;  1RFA A;  4ZDV A;  1FNV A;  4FJZ A;  1P98 A;  2AQ1 B;  2LJI A;  4HLE A;  2V3N A;  4NAW A;  2JYT A;  3V05 A;  4ICU A;  3TEY A;  1OGW A;  4W9L A;  2K6Q A;  3P4S B;  1E8W A;  1FCL A;  2MSE D;  2ZEQ A;  1I4R A;  5HHD G;  4LLG M;  4RNA A;  2MW5 A;  1WJU A;  2NS5 A;  2YEP F;  3AM9 A;  3IT6 B;  3L0W B;  4ZHO A;  3N9Y C;  3URY A;  1C9F A;  1UGM A;  3MTN B;  4MGI E;  3SHQ A;  2MX2 A;  4BAX A;  2LRU A;  1SJE D;  2ACZ B;  2M4N A;  1EO6 A;  1S3S G;  4A55 A;  1MPE A;  2CJN A;  1UGJ A;  2N7D A;  4C4V A;  3ZIM A;  3A4S C;  3HUI A;  4K1R B;  4IWP A;  4IWQ A;  2LXC A;  3QA8 A;  1J8C A;  3AE8 B;  1WGD A;  2Z0E B;  4EOY A;  1P1A A;  2GBM A;  2HE7 A;  3AEC B;  1ET9 A;  4II2 B;  2Z59 B;  3VR8 B;  1SE2 A;  4EUT A;  5FR3 A;  5IO9 A;  2V0G A;  1ZXH A;  3E9S A;  4XDD A;  3AE3 B;  4ZHP A;  2DBY A;  3A9J B;  1UWM A;  4OW0 A;  4NQL B;  2BKF A;  1JWS D;  2OHF A;  4IUM B;  3R66 C;  3K9O B;  2PMV A;  2J0M A;  2J0K A;  3AU5 A;  4ZRI A;  3HHM A;  5J18 A;  1DOX A;  2LRW A;  2X38 A;  3ZRF A;  5E6N A;  4DWF A;  3PZ7 A;  3ZYY X;  3DVN U;  3R7Q A;  1BML C;  2O2V A;  3VH3 B;  3L4P A;  4RCO A;  4N59 A;  2FAZ A;  2NMQ A;  4BFR A;  4YTP B;  5EE0 A;  4YSX B;  3VUX A;  4MJS B;  1C78 A;  4GSW A;  2LGD A;  4ANV A;  1GG3 A;  3ZUN A;  2IGH A;  3PTF C;  5E6P A;  3AN1 A;  1LFD A;  1V5T A;  4HEA 1;  4ANX A;  1KF6 B;  4DQO C;  2NPT B;  4LDT B;  1H4R A;  4YXD B;  4LNF A;  1UUP A;  1IPG A;  1YQ3 B;  1EF5 A;  1JRP A;  1PFD A;  1VD2 A;  1QOA A;  2FE8 A;  2WP9 B;  1IBX B;  3BZD B;  4NPN A;  1WZ0 A;  2ICI A;  1DYQ A;  3OJ4 B;  3SR6 A;  3CF6 E;  3RNE C;  4KGT A;  4ZRJ A;  4C00 A;  4HDO A;  1X1M A;  2GBR A;  2UU7 A;  2RSU A;  3KUZ A;  3WCQ A;  4G3X B;  3KW5 B;  1HEZ E;  4BVU C;  3AEB B;  2JZP A;  4AOF A;  1EF1 A;  4K81 A;  4P1B C;  2BS3 B;  3CIR B;  4B6W A;  4M8M A;  3J9C A;  2O6V A;  4M01 A;  2B76 B;  2KLG A;  1TZ1 A;  3H7P A;  3ZTD A;  1TZO A;  2FUG 1;  2FID A;  1L5P A;  3VUW A;  3BVZ A;  2QMT A;  2ASQ A;  1P7F A;  2O6V D;  2V3P A;  2ZVN A;  4J3O D;  4IDI A;  3UI3 A;  3SU8 X;  4F7Z A;  2UYZ B;  2UWQ A;  1L6U A;  1PDX A;  4WWN A;  3LXF A;  4G0N B;  1YN5 A;  2B3A A;  2XN9 C;  5FR6 A;  4OZB A;  3ECI A;  1TS5 A;  2NTT A;  2QSD A;  2WXO A;  1UD7 A;  1WM2 A;  5D6J B;  3FC4 A;  2MRP A;  4AWJ A;  3ZRC A;  1YJ1 A;  1V1P A;  4US8 A;  3KWV A;  1QKZ A;  4I6N B;  2WXF A;  4HKQ A;  1L4Z B;  2N1W A;  3ZXV A;  1GPX A;  2ONQ A;  4JX1 C;  4NQK E;  1I4H A;  1Q1O A;  4ARC A;  3AUL A;  2Q5W D;  3NZ3 A;  2DEN B;  3IG3 A;  3AE1 B;  1UBQ A;  3UF8 A;  3GE8 C;  4NY0 A;  2JWZ A;  3BII D;  1FXA A;  1K53 A;  4WJN A;  2WXI A;  5AZG A;  1WJ6 A;  3PT2 B;  2CJO A;  1JW9 D;  1R4N I;  4ACF A;  4DXF A;  1OQY A;  1GC7 A;  4IM3 A;  2MQJ A;  3RCZ A;  1HZ5 A;  3MJ5 A;  2SAK A;  3ZVV A;  2L1A A;  4W9I A;  3N20 C;  4YL8 A;  1HXY D;  1EUV B;  2DLB A;  3RNB C;  1WGR A;  4PS8 A;  5C23 A;  1LQB A;  1SIF A;  1XO3 A;  3AEG B;  3DBL B;  1KH0 A;  3EA6 A;  3GZN B;  4R3D A;  4A9A A;  4C7Y A;  3MHS D;  3VVW B;  1CMX B;  2KK8 A;  3IBE A;  1T0R C;  2AX5 A;  3HM6 X;  2JVC A;  4PS3 A;  2V3S A;  2WDR B;  3NG0 A;  2CU3 A;  1WX9 A;  3TBL D;  2D3C A;  1WY8 A;  4YTM B;  3BWU D;  2DYO A;  3ZJV A;  4FUL A;  2DNF A;  2IBI B;  2LWP A;  4Q2J A;  5G55 A;  1V8C A;  2DHZ A;  4JWS C;  4MJS A;  4CHK A;  1I4P A;  1ZW7 A;  2KX3 A;  1QOF A;  3HK0 A;  2Z8L A;  4LNI A;  2WU2 B;  2HTH A;  3C0R B;  2BYF A;  2M19 A;  1VR9 A;  3IAM 1;  3TL5 A;  3VTV A;  2JY6 A;  1C77 A;  1V9J A;  1N63 A;  4EZJ A;  3BYT B;  1WGK A;  1SE4 A;  4BZA A;  1GB4 A;  3X23 A;  2KX0 A;  1ZKH A;  3PRM B;  3TJP A;  3DBH I;  1MG4 A;  4GLS C;  4A3O A;  2KLC A;  4KDI C;  2WLB A;  2KDE B;  1LGR A;  2DX5 B;  3TUO A;  5C1Z A;  2GRI A;  2FCN A;  3UGB B;  3RD2 A;  2BWE S;  3Q3F A;  1I4X A;  3B2F A;  3VTU A;  3RT3 B;  2RD0 A;  3NHE B;  1PUT A;  4XGA B;  4FBJ B;  3AEF B;  3O65 B;  2KOX A;  4TQ0 A;  5AUK A;  1TKE A;  2JRH A;  1NYR A;  2KQ4 X;  1DOY A;  1UF0 A;  3B0A A;  1WF9 A;  1G6J A;  1FEH A;  3A9K B;  1C1Y B;  1NVI D;  4J6I A;  2MP2 B;  3QC8 B;  2KWV B;  2RDG A;  1NEK B;  1HTQ A;  3DVG Y;  1DOI A;  1OEY A;  4W9J A;  3U7D A;  2KTR B;  5J2R A;  2XK5 A;  1V49 A;  3SD5 A;  4MGZ E;  1R4M I;  2IO0 B;  3W1S A;  2FCS A;  4KIK B;  3WIM A;  3NVV A;  3T9L A;  1YJJ A;  3QK0 A;  1YJI A;  3GOE A;  2K8C A;  2I38 A;  2JPH A;  1TKY A;  3Q3J A;  2KWD A;  3PVL A;  3N30 A;  1RRB A;  4NAM A;  1T0Q C;  5HFY A;  2G45 B;  3RUI B;  3ML9 A;  4ZOH C;  4BOS C;  4OZC A;  4TUU A;  2N9K A;  2IND C;  2BS4 B;  2YVC A;  1T0S C;  3AED B;  1B9R A;  1CK1 A;  1WI0 A;  3AE4 B;  3Q3O C;  4F1S A;  5LNK 1;  2D11 A;  3Q2A C;  5H92 C;  4CQN A;  1SGH A;  4GB9 A;  3D32 A;  3TIX A;  3R2T A;  4K7W A;  3H8H A;  2ZNV B;  2DYM A;  5G5G A;  2LHE A;  5DPR A;  2JXX A;  4EZL A;  1MVK A;  2IGG A;  2MJD A;  1A5R A;  3HIZ A;  3Q8B A;  2I2Y A;  1EWY C;  2WNM A;  4PS7 A;  2IDY A;  2IO2 B;  2M0X A;  1RLF A;  4HK2 A;  4FLH A;  3BVM A;  3MC9 A;  3Q6B A;  3Q3M C;  3RN9 C;  1C4A A;  1HA5 A;  3RZF A;  1ZGU B;  2IJ0 A;  4HWI B;  2WGS A;  3JSV B;  3CMM B;  2V1Y A;  5BO4 B;  4L2Y A;  3AEE B;  1VJK A;  2ON8 A;  1D4B A;  2Y3A A;  4BBN C;  1YX5 B;  2MWS B;  4WJO A;  1YN4 A;  4WWO A;  1F2R C;  3UIP B;  2REX A;  3U30 A;  2DAJ A;  1F9J A;  3AMZ A;  4GIV A;  1WMH A;  1T5X D;  2MBH A;  3I63 C;  1PQS A;  2R2O A;  2D5G A;  1AN8 A;  2WWZ A;  3QIJ A;  2KDB A;  2EEL A;  2FBW B;  2O6V B;  4LNO A;  3NJT A;  4RGT A;  4OVZ A;  3H7P B;  3AI5 A;  3ZO5 B;  2WX1 A;  4JLC A;  1K50 A;  2QCZ A;  2KMA A;  1FIQ A;  5IP4 D;  3APD A;  2GBK A;  1V1O A;  2LEK A;  1N61 A;  2CU1 A;  4RGN A;  1K52 A;  5TSS A;  1I42 A;  2HD5 B;  4PYZ A;  4DXA B;  1XF5 L;  3UQA A;  2WXR A;  1ZOY B;  1GOZ A;  3M95 A;  4XWW A;  3Q8A A;  3V6C B;  4QAY A;  4C7Z A;  2PIA A;  2D2Q A;  3DWM A;  4E3C A;  5H8Y E;  1YIW A;  2BTE A;  1HQR D;  3VAW A;  1V1P B;  2KVR A;  1IUE A;  1JML A;  4HJK A;  1K8R B;  2JX5 A;  1V97 A;  2MHJ A;  4K7S A;  1P3Q U;  4A6Q A;  2CKH B;  1WRD B;  4RGO S;  4KKI A;  1RWS A;  1L4D B;  1UBI A;  3FIL A;  4LNN A;  4W9G A;  4DK5 A;  1PGX A;  2BQQ A;  1WFY A;  3Q3N C;  1QIL A;  1MFW A;  2W55 A;  1EU3 A;  1Q5W B;  2WXK A;  5EE3 A;  3BIN A;  5MPO A;  2AYO B;  1XLO A;  1V80 A;  1N62 A;  2K39 A;  2Y5B B;  2QHO A;  3EGR A;  5BYQ A;  3A9K A;  2MH7 A;  2MP2 A;  3U8Z A;  1ACC A;  4I6L B;  2W3S A;  2R2Q A;  1FPY A;  1KFY B;  1Q10 A;  5I4D A;  2KTR A;  3PO0 A;  5DPT A;  2YLM A;  2L52 A;  4GN1 A;  1SEB D;  1PYW D;  1UEL A;  4KIK A;  4HPM B;  2WDT B;  2MJ3 A;  4DBG A;  1ZUD 2;  1E0Z A;  3L13 A;  1I35 A;  2J52 A;  3P2B A;  4MDK E;  4ZRQ A;  2QIL A;  2DZJ A;  2ZPN A;  5AZH A;  3ZLZ A;  3W1S C;  4PK1 A;  3SFE B;  3CWI A;  4ZYN A;  3AXC A;  3EUB 2;  5L83 A;  2MCN B;  2K0P A;  2WXJ A;  2MBO A;  3EFU A;  4XWT A;  2G4D B;  1TBE A;  3MP9 A;  5HKH A;  3WAL A;  1Y8R C;  1JWM D;  2PEA A;  4DHJ B;  2NR2 A;  2HDE A;  2W54 A;  3VRB B;  3NVY A;  2KAN A;  5JH5 C;  3MFG A;  3BK2 A;  1FRD A;  1WXS A;  5JHB A;  4S0R A;  1F2R I;  5BYR A;  4NJ7 A;  1MJD A;  1WJN A;  2I1K A;  2AL3 A;  4MAC A;  3W9C B;  5BMI A;  2KFK A;  2Z0D B;  2SEB D;  2WXN A;  4B0M A;  4B95 A;  1J7B A;  4P16 A;  3JSV A;  3KUD B;  4WJQ A;  5EE9 A;  3M3J A;  2HTM E;  2BBC A;  2JT4 B;  3H6N A;  4TKN A;  1V5O A;  2KO3 A;  4I6P A;  3KH0 A;  1WR6 E;  4LJP B;  1SXT A;  2LGI A;  2I1J A;  2WXG A;  1WXA A;  1I7H A;  2KJH B;  5G5H A;  4A8X C;  1ZE3 D;  1P9D U;  1XEE A;  3DBS A;  2INN E;  1XLQ A;  1ZXI A;  2KHW B;  5CX3 A;  3L54 A;  2L7R A;  2V4L A;  1AW7 A;  4G11 A;  4HXD A;  3MHZ A;  5CTR C;  3RPF C;  4X57 B;  2L0T A;  1UWX A;  3PLV A;  1TKG A;  1L2N A;  3H9D A;  2QEJ C;  4AUQ C;  3RUL A;  4EFO A;  2XK5 B;  2C60 A;  5GXG B;  1WRI A;  2PJH A;  2BYT A;  1FXT B;  3DHH C;  2DAF A;  1E9M A;  2L76 A;  5C2T B;  4CYE A;  2M1M A;  3P63 A;  4MGK E;  3PSE B;  3SFD B;  1GJZ A;  5D2M B;  4XZ4 A;  2VZK D;  2MJE A;  1YQB A;  3VXW A;  4HKZ E;  4CO7 A;  1VRA B;  2ZW1 A;  1JWU D;  1WXM A;  1WE6 A;  4JWU C;  2DZK A;  1JAL A;  3AE2 B;  4RM8 A;  1KTK A;  2GBN A;  2QDF A;  3QQ8 B;  3U4E G;  2N0S B;  4ITK A;  2G1E A;  1E5W A;  3PGE A;  2Y5C A;  3A1Q B;  3GE3 C;  4BKS A;  2LHD A;  1V2Y A;  3OJ3 A;  2N9L A;  2KD0 A;  3DOW A;  1STE A;  1WR1 A;  1OEY J;  1TY0 A;  2OJR A;  1AAR A;  3P4P B;  1TT5 B;  5IN7 A;  4G50 A;  1ENF A;  2KWU B;  4BKS D;  5FK9 C;  2KQ7 A;  4USA A;  4RM9 A;  1WXQ A;  2RPV A;  5EE1 A;  4IM0 A;  2LAS A;  1N5W A;  4OZA A;  2RPQ A;  4MGY E;  4RMA A;  1J7C A;  4PT5 A;  1WMH B;  1M4V A;  2KC2 A;  2BWF A;  1M94 A;  3UIN B;  3WA0 A;  1AWD A;  4KGR A;  4KX6 B;  1HZ6 A;  4ZRP A;  1TTN A;  2D10 A;  4BKG A;  3AE7 B;  2LGY A;  2PPH A;  1YOV B;  3RMK C;  5CHF A;  2MBB B;  3I9V 1;  1JWB D;  4MEL A;  1NYQ A;  3DBR B;  1E90 A;  2PW9 A;  2WXM A;  4JGH B;  1WJ4 A;  3V60 A;  3HM3 A;  1QF6 A;  1KLU D;  2AL6 A;  3EC8 A;  4B0E A;  2WXP A;  1F0Z A;  1OQR A;  2IO3 B;  2JRI B;  5E6O A;  4JPS A;  4LCD E;  4A20 A;  4EZK A;  2EMS A;  2R61 A;  5CHV C;  2D07 B;  4GU2 A;  4HDQ A;  1LXD A;  1NI2 A;  3UQB A;  4HVB A;  4GDL A;  3OWE B;  2QC8 A;  1Y56 A;  3W5U B;  2ZNV C;  4ARI A;  2KWC A;  3B9J A;  4EKU A;  3T8M A;  1TJE A;  1FRR A;  3PRZ A;  2E6X A;  2RDH A;  2LVO A;  2TSS A;  3FIL B;  3DQV A;  1FNU A;  5LXI B;  2K8H A;  4M02 A;  2M8S A;  2V4I B;  1T6B X;  1UNS A;  4DHZ B;  2RDB C;  1VCB A;  3DBL I;  3GZN I;  4HPP A;  1K51 A;  2KAC A;  3DVG X;  1HE8 A;  3LB8 C;  3RNA C;  1L7Y A;  3JYU A;  3OG5 A;  2CHX A;  1C76 A;  3KUC B;  1P0R A;  3APF A;  2JZZ A;  5DPS A;  3DBR I;  3TMP B;  4HJG E;  4KZ0 A;  2JF5 A;  2JU6 X;  4W9K A;  2OED A;  3NUH B;  2A4Z A;  2INC C;  2KDF B;  4XC2 A;  2WHI A;  4P6V F;  3M63 B;  4W9D A;  1GAQ B;  2DZI A;  1ZP0 B;  3DWG C;  4DDI D;  4N6E B;  4M8N A;  2LGS A;  4FAD A;  2EMT A;  3NY5 A;  4HCP B;  1C4C A;  2DYB A;  3N1X C;  2IPK D;  2K6D B;  1FO4 A;  3Q8E A;  2N9X A;  3M62 B;  1SB3 C;  3VR9 B;  2BF8 B;  4O1N A;  2RMM A;  3W5V B;  4HCN B;  1KM7 A;  2HJ1 A;  2WXL A;  4IOI E;  1TS4 A;  3VDZ A;  1VZ8 A;  3PZ8 A;  1WX7 A;  4MSM B;  1F1H A;  2JQR B;  1TS2 A;  2HJ8 A;  4IWO A;  4NJC A;  4YT0 B;  5BYS A;  2LXA A;  4AP4 C;  2MBE A;  4W9E A;  4FA6 A;  2LVP A;  4RF1 A;  5D94 A;  4E71 A;  2FCM A;  1YD8 U;  2KAJ A;  3A1Q A;  5JZE B;  2C5L C;  2IY0 B;  2AQ3 B;  2KFK B;  4JL9 A;  2RR9 A;  2QIE B;  2NCN A;  2KDM A;  2J4X A;  4AJY B;  1FFV A;  1OTR B;  2IO1 B;  3RNC C;  2G3Q B;  2GMI C;  3EHV A;  3ZQ4 A;  1ZPS A;  2WDV B;  1LO5 D;  1YMH E;  3N1Y C;  2JWU A;  5TR5 A;  4KV2 A;  3U7Z A;  3S2A A;  2C7N B;  2X8X X;  3PLU A;  1WM3 A;  2GB1 A;  1NI3 A;  2L32 A;  3B1L X;  3CST A;  5DCN A;  1I4G A;  2NBU A;  3N32 A;  2M0A A;  2K3U A;  2BS2 B;  5FKA C;  2ZPY A;  4IC7 B;  1XLP A;  2BPS A;  3RNF C;  3JW0 X;  3V62 A;  2KC1 A;  3GB1 A;  2KTF A;  3PV1 A;  2W3R A;  4RF0 A;  5EDS A;  2VZK B;  2WYQ A;  2KQS A;  3DDC B;  3Q8F A;  2CHZ A;  1SE3 A;  4IKG A;  2N7J A;  2WQY B;  1D5Z C;  2NTS A;  1SSN A;  2BGF A;  3A33 B;  1T0Y A;  3NVW A;  4KVG B;  2JZ3 B;  3L10 B;  2KN5 A;  2WXH A;  4PYU A;  3Q14 C;  4IM2 A;  1P7E A;  3SEB A;  4REZ A;  4WWP A;  2N9P C;  2KDI A;  1QOG A;  4W9F A;  1N5X A;  3ABV B;  2J7Q B;  2IGD A;  4DHZ E;  2KMM A;  4HPL B;  1TYG B;  2LMC A;  4EE2 A;  4K3C A;  2GLS A;  1FM0 D;  2KJR A;  3HRD D;  3ZJT A;  2KFJ A;  2XNA C;  3T3N A;  3U2S C;  3I5J C;  3TEW A;  5JXV A;  4WH4 A;  1PGB A;  3PPA A;  1WIA A;  2KNB A;  4NZL B;  1J7A A;  2V9H A;  3W1Y A;  3NS8 A;  1SJH D;  4UDU C;  4WAF A;  4D2K A;  1Z2M A;  3MC8 A;  1E8Y A;  3VH4 B;  1V6E A;  1XCT L;  3NS1 A;  4JQW C;  3AB5 A;  3RI7 C;  3VTW A;  4N9F 4;  4A90 A;  2LI5 A;  1ESF A;  3E56 A;  1IGD A;  3L16 A;  2J53 A;  2N4F A;  1WYW B;  1J19 A;  4M0W A;  5LLI A;  2W9N A;  5E6J A;  1RFK A;  2BB6 A;  2PVG C;  3V6E B;  1KOT A;  1WXV A;  3W2D A;  1U4A A;  1CJE A;  1LM8 B;  2JUO A;  2KT7 A;  3ZJU A;  2KKC A;  3TSS A;  3U52 E;  3C8Y A;  3MJW A;  3ETR A;  4DDG D;  1VZ6 A;  1JRU A;  3ZNI D;  5AUI A;  5DPW A;  3ML8 A;  3ZDT A;  3P4Q B;  1E6E B;  3EEC A;  2EKE C;  1NBF C;  1XD3 B;  2N9E B;  1JQ4 A;  4K3B A;  3WAN A;  2L0F A;  2AWT A;  5D7G A;  1QZE A;  3IXS A;  3RYT A;  4MM3 A;  1UH6 A;  3WAP A;  5BMG A;  1XQQ A;  3AEA B;  1WGG A;  1WH3 A;  4AQ7 A;  1FFU A;  1YNT E;  2K1F A;  1JCK B;  3B08 A;  4F8C B;  3TEZ A;  2PE6 B;  4FXC A;  1OFF A;  2WDQ B;  3IAS 1;  3ENE A;  3NVZ A;  4GDK A;  3UIO B;  4GDL B;  3OAW A;  2NBV B;  3VUY A;  1SE9 A;  1GB1 A;  3ZNH B;  2D3G A;  1F77 A;  2W82 A;  4ZYS A;  1CQV A;  3C19 A;  3ZNZ B;  3ALB A;  2WS3 B;  4YTN B;  1NDD A;  2FCQ A;  3LYY A;  4XDC A;  4FJV B;  1N60 A;  1RM6 C;  4FHJ A;  4YWG G;  4BKT A;  2KXJ A;  1L0V B;  2NVU I;  3AE5 B;  3RNG C;  2RGF A;  3JVZ X;  3QAQ A;  3HVZ A;  2ZVO A;  3DHG C;  2J42 A;  4KSL C;  3I3T B;  1I4Q A;  4DXG A;  4K7U A;  3K9P B;  3AH7 A;  1WX8 A;  4NNJ B;  4P7I A;  3IFW B;  2N7E A;  3R2I A;  1V81 A;  4II3 B;  2CR5 A;  2LZ6 A;  2KJ6 A;  4TQ1 A;  3NOB A;  4GGQ A;  1E8X A;  4LNK A;  1J0G A;  1WYG A;  2N1V A;  3A4R A;  4GOC A;  3ZKJ C;  4BBN F;  2WXQ A;  3QX1 A;  3CSF A;  3KVF B;  1V86 A;  5HG2 A;  1OQQ A;  2GI9 A;  2E3T A;  1D5M C;  2L3Z A;  1D6E C;  2PTL A;  3KYC D;  3OLM D;  4L1B A;  5AEK B;  4W9C A;  3AE6 B;  3PRE A;  1QQR A;  4B9K A;  2M56 B;  2D3A A;  2LUM A;  2JXT A;  4TSS A;  4NJ6 A;  1BXT A;  1VLB A;  2L8J A;  1R4N B;  2MA9 B;  4OVU A;  5HI1 A;  3N1Z C;  4JIO U;  2BB5 A;  4LTU A;  4ANW A;  3H7S A;  1QOB A;  4WAA A;  1FCC C;  3BYY B;  1TGZ B;  1S1Q B;  1ZDX A;  1GC6 A;  3QHT A;  2KN4 A;  3P42 A;  5T8I A;  4L23 A;  2K9X A;  4YSZ B;  1EU4 A;  2IYD B;  1T3Q A;  2DZM A;  5GMV A;  3IHP C;  2M17 A;  4A3P A;  1YQ4 B;  1D5X C;  4C56 C;  2WU5 B;  1XXG A;  3H1U A;  3MC0 B;  4MT5 A;  3L17 A;  3KWL A;  4KKJ A;  4MSQ B;  3ZNG C;  5JHA A;  2VRR B;  2C7H A;  1QLB B;  2VH2 A;  2ZCB A;  4M00 A;  1E10 A;  2ZZP B;  2K25 A;  4YSY B;  2LFI A;  3ZDM C;  1WGY A;  1KLV A;  2KVZ A;  4HRS A;  3ZGZ A;  1Z5S B;  4FJY A;  1JRO A;  1IP9 A;  4S17 A;  1A70 A;  3EFC A;  2JYE A;  1VDV A;  3R7R A;  1H8C A;  3AV8 A;  2VH1 A;  1Q0W B;  3PRP B;  2CHW A;  2ZW0 A;  2C9W B;  2INP E;  3T3O A;  4LJO B;  2H89 B;  3DBH B;  1SBB B;  4C80 A;  4GXB A;  3A9J A;  1RAX A;  2K8B A;  1TS3 A;  3HVD A;  3KLS X;  3NZU A;  1C79 A;  3PHX B;  4WWM A;  2L00 B;  1L0Y B;  1ROE A;  1D3Z A;  2H88 B;  2PKO A;  4IG7 B;  3PHW B;  2ZCC A;  2OOB B;  4RFB A;  3VFK A;  2MBQ A;  3BK1 A;  1WWT A;  4XX5 A;  1ISN A;  2OJW A;  4KDL B;  1MHH E;  5G2N A;  1NEN B;  2LGX A;  1ET6 A;  2XEW A;  4URK A;  3AE9 B;  2G9H D;  2BKR B;  2BYV E;  4WIP A;  5KHQ A;  1TIF A;  1BUI C;  2L05 A;  3DVN V;  4NAW B;  1IYF A;  1XLN A;  4RH6 A;  3SDL C;  2ZJD A;  1R4M B;  3DPD A;  3RFZ B;  3P4R B;  2LJ5 A;  5KHO A;  1WSP A;  1PGA A;  2L83 A;  3IVF A;  2NPT A;  5J17 A;  3R3M A;  4KZC A;  2MEK A;  4ZRK A;  1EM7 A;  4DHJ D;  4EEW A;  1R7S A;  2FIF A;  5IA7 A;  1IBX A;  4XE0 A;  3VQI A;  1WZ3 A;  4N58 A;  2C7M B;  4FHK A;  3ONS A;  4LDT D;  3ZXR A;  5BMH A;  3DCG A;  1WE7 A;  2XBB C;  1UZX B;  3V3X A;  1C4P A;  3QWZ B;  5IOI A;  1MI0 A;  4MH0 E;  1CZP A;  3FKY A;  4M0W B;  4C4V B;  2A5U A;  1FD6 A;  4BOZ B;  1KLG D;  2K22 A;  1MG8 A;  1SF0 A;  3ZW3 A;  2IY1 B;  4OVV A;  2BVC A;  4H2A A;  2D3B A;  1ZDV A;  3VHT C;  3TCA A;  3GS2 A;  3IT4 B;  4HRO A;  3ZTC A;  4TV3 A;  1DGJ A;  2AQ2 B;  2G4S A;  1XT9 B;  1JWA D;  1YN3 A;  2LVQ A;  4XYC A;  2AEH A;  2QJL A;  3NRZ A;  4WQM A;  1FNW A;  1F52 A;  4LK0 M;  4WQO B;  5CHW A;  3KYD D;  3PS6 A;  3O13 A;  4MM3 B;  4US9 A;  2MLB A;  1IGC A;  2BT6 A;  2Y5P A;  3B2G A;  3NZS A;  4ANU A;  3TEX A;  2JSV X;  4GMV A;  2YEP B;  2O2V B;  4ASW C;  4IW0 A;  1B1Z A;  5IAA C;  3WAO A;  1GNU A;  3FAH A;  3P1M A;  4GDK B;  1FMA D;  1FXI A;  2K5P A;  4KSK C;  3QAR A;  1SIJ A;  1BT0 A;  1EWC A;  3LDZ E;  3GP7 A;  2IZV B;  1L0X B;  4W9H A;  1E7U A;  3LJ3 A;  3N3K B;  2LUE A;  3Q69 A;  1XCQ L;  2PVO D;  3I57 A;  1HTO A;  3DHI C;  1E7P B;  5AZF A;  5D3D A;  1L6V A;  3RZW C;  4ICV A;  4OHJ A;  1AYF A;  4MH8 A;  2BYE A;  3V61 A;  2DWQ A;  3APC A;  1KRH A;  1VZ7 A;  1GUA B;  4AJW A;  1E7V A;  4P1C C;  3PZD A; 
#chains in the Genus database with same CATH homology
 1SE4 A;  2VZK D;  1GB4 A;  3TSS A;  3U52 E;  2MJE A;  3C8Y A;  3ETR A;  4HKZ E;  3KQ4 A;  1VRA B;  2PLP A;  1VZ6 A;  2ZW1 A;  1JWU D;  3BVG A;  1QT9 A;  4GLS C;  5AUI A;  2WLB A;  3VRA B;  1MHX A;  4RGM A;  3TUO A;  4JWU C;  3P4Q B;  1E6E B;  1JAL A;  2GRI A;  2BW2 A;  3AE2 B;  1JQ4 A;  1I4X A;  3B2F A;  5D7G A;  1KTK A;  3IXS A;  3R8B A;  1PUT A;  4KGS A;  3U4E G;  2N0S B;  4WUR A;  4ITK A;  2G1E A;  3AEF B;  5BMG A;  1RYJ A;  3AEA B;  2Y5C A;  4AQ7 A;  1FFU A;  5AUK A;  1TKE A;  4TQ0 A;  1YNT E;  1NYR A;  2LHD A;  2KQ4 X;  1DOY A;  1JCK B;  2N9L A;  3TEZ A;  1STE A;  4FXC A;  1FEH A;  1OFF A;  4TMA B;  4AS1 A;  4JE3 B;  2WDQ B;  3IAS 1;  1NVI D;  3NVZ A;  1TY0 A;  2RDG A;  1NEK B;  4GDL B;  3Q8C A;  1TY2 A;  5D3I B;  3P4P B;  1DOI A;  5C3J B;  1ENF A;  2EKI A;  1GB1 A;  1FNV A;  1F77 A;  5FK9 C;  4USA A;  2W82 A;  4ZYS A;  1CQV A;  2AQ1 B;  2LJI A;  2V3N A;  1WXQ A;  2JYT A;  2RPV A;  3V05 A;  5EE1 A;  2WS3 B;  4YTN B;  1N5W A;  4OZA A;  3W1S A;  3TEY A;  3LYY A;  3NVV A;  1YJJ A;  1J7C A;  4XDC A;  1N60 A;  3P4S B;  4PT5 A;  1YJI A;  1RM6 C;  1FCL A;  1I4R A;  5HHD G;  2I38 A;  4YWG G;  4LLG M;  4RNA A;  1TKY A;  1M4V A;  2KWD A;  1L0V B;  3AE5 B;  4NAM A;  5HFY A;  2YEP F;  3HVZ A;  3AM9 A;  4ZOH C;  3IT6 B;  2J42 A;  4OZC A;  1AWD A;  4KGR A;  2N9K A;  4KX6 B;  1I4Q A;  4DXG A;  2BS4 B;  4ZHO A;  1HZ6 A;  4ZRP A;  3AH7 A;  3AED B;  1B9R A;  3R2I A;  1CK1 A;  3N9Y C;  3AE4 B;  3AE7 B;  3URY A;  5LNK 1;  1C9F A;  5H92 C;  3I9V 1;  1JWB D;  4TQ1 A;  4CQN A;  1NYQ A;  1SJE D;  2PW9 A;  3R2T A;  1WYG A;  2ACZ B;  2WXM A;  2WXQ A;  3H8H A;  2DYM A;  5G5G A;  2LHE A;  4A55 A;  1MPE A;  2CJN A;  5HG2 A;  1OQQ A;  2GI9 A;  2E3T A;  1MVK A;  1UGJ A;  2IGG A;  2MJD A;  3Q8B A;  1QF6 A;  1D5M C;  3HUI A;  2I2Y A;  1EWY C;  2WNM A;  1KLU D;  4B0E A;  2WXP A;  1D6E C;  2IDY A;  1F0Z A;  2PTL A;  1OQR A;  4JPS A;  3AE8 B;  4L1B A;  3AE6 B;  2R61 A;  3BVM A;  1QQR A;  3AEC B;  1ET9 A;  2M56 B;  3VR8 B;  1SE2 A;  2LUM A;  1C4A A;  5FR3 A;  2JXT A;  2V0G A;  1ZXH A;  3E9S A;  1HA5 A;  4XDD A;  3AE3 B;  4ZHP A;  2DBY A;  2IJ0 A;  4TSS A;  1BXT A;  1VLB A;  3OWE B;  1UWM A;  1Y56 A;  4OW0 A;  3W5U B;  4L2Y A;  3AEE B;  4ARI A;  1VJK A;  1JWS D;  2ON8 A;  5HI1 A;  1D4B A;  2Y3A A;  3B9J A;  2OHF A;  1TJE A;  2BB5 A;  1FRR A;  2PMV A;  4LTU A;  2E6X A;  2RDH A;  1YN4 A;  2TSS A;  1F2R C;  3FIL B;  1FNU A;  1QOB A;  1FCC C;  3BYY B;  3AMZ A;  2V4I B;  1DOX A;  1T6B X;  1ZDX A;  1T5X D;  1UNS A;  2D5G A;  2KN4 A;  1AN8 A;  1K51 A;  2X38 A;  3P42 A;  2KAC A;  2EEL A;  2FBW B;  4L23 A;  2K9X A;  5T8I A;  4YSZ B;  3LB8 C;  3PZ7 A;  1EU4 A;  3ZYY X;  1T3Q A;  1C76 A;  1BML C;  4RGT A;  4OVZ A;  3L4P A;  4RCO A;  4N59 A;  1YQ4 B;  2NMQ A;  1D5X C;  4C56 C;  4HJG E;  2WU5 B;  4YTP B;  5EE0 A;  4YSX B;  1XXG A;  1K50 A;  3MC0 B;  4MT5 A;  1C78 A;  3KWL A;  2JU6 X;  1FIQ A;  2OED A;  3NUH B;  4KKJ A;  2IGH A;  1QLB B;  1V1O A;  2LEK A;  1N61 A;  3AN1 A;  4RGN A;  1E10 A;  4HEA 1;  4P6V F;  1GAQ B;  1K52 A;  1KF6 B;  1ZP0 B;  3DWG C;  5TSS A;  4DQO C;  4YSY B;  2LFI A;  1XF5 L;  4YXD B;  4N6E B;  4HRS A;  3ZGZ A;  2WXR A;  1ZOY B;  1JRO A;  1GOZ A;  1A70 A;  1UUP A;  1C4C A;  4XWW A;  2JYE A;  1VDV A;  3Q8A A;  3AV8 A;  1YQ3 B;  1JRP A;  1PFD A;  2IPK D;  4C7Z A;  2ZW0 A;  3T3O A;  2INP E;  1QOA A;  2FE8 A;  2WP9 B;  2PIA A;  1IBX B;  2H89 B;  3BZD B;  1SBB B;  4C80 A;  1FO4 A;  3DWM A;  3Q8E A;  5H8Y E;  2BTE A;  2ICI A;  1DYQ A;  1HQR D;  1SB3 C;  3SR6 A;  1TS3 A;  1V1P B;  4KGT A;  3VR9 B;  4O1N A;  1IUE A;  1JML A;  3HVD A;  2JX5 A;  1V97 A;  2RMM A;  3KLS X;  3W5V B;  2WXL A;  4IOI E;  1TS4 A;  4A6Q A;  1VZ8 A;  3PZ8 A;  1C79 A;  4WWM A;  4RGO S;  4KKI A;  3WCQ A;  1RWS A;  1HEZ E;  1L4D B;  3FIL A;  1L0Y B;  1ROE A;  3AEB B;  2JQR B;  2H88 B;  2JZP A;  1TS2 A;  1PGX A;  2BS3 B;  3CIR B;  4NJC A;  4YT0 B;  5BYS A;  2PKO A;  1QIL A;  2W55 A;  1EU3 A;  3J9C A;  2WXK A;  5EE3 A;  4RF1 A;  5MPO A;  4RFB A;  3BK1 A;  2KAJ A;  2B76 B;  1WWT A;  1XLO A;  1N62 A;  1MHH E;  3EGR A;  5BYQ A;  1NEN B;  2AQ3 B;  1TZO A;  1ET6 A;  2FUG 1;  2MH7 A;  2QIE B;  3AE9 B;  2G9H D;  2KDM A;  2J4X A;  4WIP A;  1ACC A;  1L5P A;  1FFV A;  1BUI C;  2QMT A;  3BVZ A;  4NAW B;  2W3S A;  3ZQ4 A;  1ZPS A;  1XLN A;  1P7F A;  2WDV B;  1KFY B;  4RH6 A;  1Q10 A;  1LO5 D;  2V3P A;  4J3O D;  5I4D A;  4IDI A;  1YMH E;  3PO0 A;  2JWU A;  3U7Z A;  3UI3 A;  3RFZ B;  3P4R B;  2L52 A;  1WSP A;  1PGA A;  2L83 A;  2GB1 A;  1SEB D;  1NI3 A;  1L6U A;  1PDX A;  2L32 A;  1PYW D;  1I4G A;  3LXF A;  2M0A A;  1YN5 A;  2K3U A;  2MJ3 A;  2XN9 C;  2BS2 B;  2MEK A;  4OZB A;  5FKA C;  1EM7 A;  1TS5 A;  1ZUD 2;  2NTT A;  2QSD A;  1E0Z A;  1XLP A;  2WXO A;  1R7S A;  2J52 A;  1IBX A;  3FC4 A;  4ZRQ A;  2QIL A;  4XE0 A;  3VQI A;  4N58 A;  1V1P A;  4US8 A;  3KWV A;  3GB1 A;  5BMH A;  1QKZ A;  3SFE B;  3CWI A;  2WXF A;  3V3X A;  2W3R A;  3EUB 2;  1C4P A;  2K0P A;  1MI0 A;  4RF0 A;  2WXJ A;  4HKQ A;  1CZP A;  1L4Z B;  4XWT A;  2VZK B;  3MP9 A;  3Q8F A;  1JWM D;  1GPX A;  1FD6 A;  2ONQ A;  1SE3 A;  4IKG A;  4JX1 C;  2N7J A;  2HDE A;  2W54 A;  2WQY B;  1D5Z C;  2NTS A;  1KLG D;  3NVY A;  3VRB B;  2K22 A;  1I4H A;  3MFG A;  1SSN A;  3BK2 A;  1SF0 A;  4ARC A;  1FRD A;  3NVW A;  2Q5W D;  3NZ3 A;  1F2R I;  5BYR A;  2WXH A;  3AE1 B;  4H2A A;  1ZDV A;  1P7E A;  3GS2 A;  3SEB A;  3IT4 B;  3BII D;  1FXA A;  1K53 A;  4HRO A;  2WXI A;  4MAC A;  4REZ A;  3W9C B;  5BMI A;  1QOG A;  2SEB D;  1DGJ A;  2AQ2 B;  1N5X A;  2WXN A;  2CJO A;  1J7B A;  4B0M A;  1JW9 D;  3ABV B;  4P16 A;  2IGD A;  1JWA D;  1YN3 A;  2KMM A;  4DXF A;  2QJL A;  3NRZ A;  4WQM A;  1FNW A;  1TYG B;  5EE9 A;  2HTM E;  2BBC A;  2LMC A;  1HZ5 A;  3MJ5 A;  4EE2 A;  2SAK A;  4LK0 M;  2L1A A;  1FM0 D;  3HRD D;  1HXY D;  3ZJT A;  2DLB A;  2XNA C;  1SXT A;  2LGI A;  3T3N A;  2WXG A;  3U2S C;  3O13 A;  3TEW A;  4MM3 B;  5JXV A;  4WH4 A;  1I7H A;  4US9 A;  1IGC A;  1PGB A;  1XO3 A;  2BT6 A;  3AEG B;  2Y5P A;  1KH0 A;  3EA6 A;  4R3D A;  3B2G A;  5G5H A;  4A9A A;  4C7Y A;  4NZL B;  4A8X C;  1ZE3 D;  3TEX A;  2JSV X;  1J7A A;  1XEE A;  2YEP B;  2INN E;  1SJH D;  2AX5 A;  4UDU C;  4WAF A;  1B1Z A;  4D2K A;  1XLQ A;  1ZXI A;  1XCT L;  2WDR B;  3FAH A;  3NS1 A;  2CU3 A;  1AW7 A;  3AB5 A;  3P1M A;  4GDK B;  1FMA D;  1FXI A;  2K5P A;  4YTM B;  3MHZ A;  3BWU D;  1SIJ A;  2DYO A;  3RPF C;  1EWC A;  1UWX A;  4A90 A;  1TKG A;  3E56 A;  1ESF A;  3ZJV A;  1IGD A;  2QEJ C;  3GP7 A;  1L0X B;  4Q2J A;  1V8C A;  3Q69 A;  1XCQ L;  2J53 A;  2PVO D;  3I57 A;  4JWS C;  1E7P B;  5D3D A;  1L6V A;  1I4P A;  4M0W A;  5E6J A;  5GXG B;  1QOF A;  1WRI A;  1RFK A;  2BB6 A;  4OHJ A;  2PVG C;  1AYF A;  2Z8L A;  2BYT A;  4MH8 A;  1E9M A;  5C2T B;  2WU2 B;  3P63 A;  3W2D A;  2DWQ A;  1CJE A;  1KRH A;  3SFD B;  2M19 A;  1VR9 A;  1VZ7 A;  3IAM 1;  1C77 A;  1N63 A;  3BYT B;  3ZJU A;  1WGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...