4NZLB

Extracellular proteins of staphylococcus aureus inhibit the neutrophil serine proteases
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
96
Chain Sequence
KHTVPYTISVDGITALHRTYFVFNKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil elastase
publication title Staphylococcus aureus secretes a unique class of neutrophil serine protease inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Hydrolase/hydrolase inhibitor
total genus 29
structure length 96
sequence length 98
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4nzlB00
1CK1A 1F77A 2RDGA 1EU4A 1YN5A 1JWUD 4RH6A 1TS3A 1D5ZC 2XNAC 5D3DA 1KLGD 1QILA 3R2IA 1SBBB 1TS5A 1AN8A 1SXTA 3BVZA 1HA5A 1EU3A 1DYQA 5FKAC 1I4RA 1AW7A 4RGTA 3TSSA 1XXGA 4NZLB 2RDHA 1V1PA 3BVMA 5I4DA 1V1PB 1D5MC 4DXFA 1M4VA 3KLSX 1I4HA 3V05A 1ESFA 5D3IB 1I4PA 3BZDB 4C56C 4UDUC 2AQ3B 4RFBA 2NTSA 3BYTB 4ZYSA 1I4QA 1D5XC 1V1OA 2Z8LA 4RCOA 1B1ZA 2NTTA 1CQVA 1YN4A 3URYA 2G9HD 3SEBA 1D6EC 1BXTA 1SJHD 1ET9A 3MC0B 1EWCA 1SJED 2J4XA 2AQ2B 3BVGA 1T5XD 1TY2A 1KLUD 2AQ1B 2TSSA 4RGNA 1GOZA 1KTKA 3W2DA 1FNVA 2SEBD 3EA6A 1JCKB 1HQRD 1FNUA 4DXGA 1SE4A 3BYYB 2XN9C 1STEA 1SE3A 1TY0A 1LO5D 3OWEB 3R8BA 1I4XA 3R2TA 1TS4A 4RGOS 5FK9C 2IJ0A 1ENFA 4TSSA 1SE2A 4O1NA 1SEBD 2QILA 1ET6A 5TSSA 2QEJC 1TS2A 1I4GA 3O13A 2R61A 1HXYD 2IPKD 1YN3A 1UUPA 1PYWD 3GP7A 4OHJA 1JWMD 1L0XB 1L0YB 1FNWA 1JWSD 3MFGA 1UNSA 2ICIA 4RGMA
chains in the Genus database with same CATH superfamily
1T0QC 3O65B 1KJTA 2I1KA 1WFYA 3U2SC 2FCMA 2CJNA 2E3TA 2NVUI 1VRAB 3EC8A 2BVCA 1WGDA 3I3TB 4ZRQA 3E56A 3KLSX 1UD7A 1MVKA 4PYZA 5DPRA 4XWWA 1T0RC 2FIFA 5JH5C 2DYBA 5IP4D 5HFYA 3KVFB 2Z59B 3M63B 2WXPA 3EECA 3AE2B 4YT0B 4F1SA 5IO9A 4IDIA 1OQYA 1EWCA 3PRZA 2UYZB 5AUKA 4WQMA 2PKOA 3PZ7A 2LUEA 3KWLA 4BBNF 2LHEA 3PZDA 2QJLA 3W2DA 3MHZA 2WXRA 1ZGUB 4ITKA 1JQ4A 3AM9A 1FCLA 1WE7A 1BT0A 3VTWA 4HXDA 2HJ8A 1WXMA 4URKA 1STEA 4TKNA 4G0NB 4YXDB 3OWEB 1I4XA 2BB6A 2MLBA 3Q69A 3R2TA 1ROEA 2ZZPB 3VUWA 2INCC 2KWDA 3AEAB 3B2GA 4LDTB 2QEJC 4J6IA 2KHWB 1EF5A 2ZEQA 1S1QB 1UZXB 1WYGA 2FCNA 3UIPB 2PIAA 3I9V1 4GLSC 1WX7A 5BYRA 3VR9B 2JPHA 4MGZE 5AEKB 1VZ8A 2ZPNA 1GUAB 2KDEB 3VXWA 4FBJB 2PE9A 3WIMA 1SBBB 2LRWA 4P16A 4OVUA 1ZOYB 2XBBC 2GBJA 1TGZB 1XEEA 2BW2A 2WXOA 2WXFA 1ZXIA 1PGBA 1JW9D 5CTRC 2HTHA 2ZNVC 2NS5A 2BB5A 4HLEA 2PLPA 3APCA 4KX6B 4I6LB 2LVQA 4WAAA 3TEWA 4FXCA 2M19A 2AL6A 3NVYA 2L32A 3IHPC 5AZGA 2FIDA 2CJOA 4FHJA 3UINB 1NVID 2MEKA 2L3ZA 5JZEB 2ZVOA 1WMHA 3AU4A 1H4RA 1E8ZA 2KMCA 3DVNU 2Z0EB 4NPNA 1SE4A 2OHFA 4B95A 1E7VA 3N9YC 2GOWA 1HZ6A 3PPAA 5E6JA 5CX3A 2K3UA 2MSED 3Q3NC 4MGKE 1SE2A 1WGGA 1SSNA 2D2QA 1WXVA 2ZNVB 4GMVA 1E9MA 4FJVB 2BPSA 2KD0A 5C2TB 3VRBB 2X38A 1HXYD 1J0GA 2RR9A 4MH0E 4DHZB 2LHDA 2ZW0A 3Q3JA 1MHHE 3ZNZB 1WH3A 5EE9A 2LMCA 3AE6B 4BVUC 2RDGA 2JVCA 4RH6A 3W9CB 4K7SA 3DCGA 4HEA1 3NS1A 3V3XA 2N7JA 1E5WA 2EMTA 5D94A 1R4NB 4HKQA 1A70A 1UELA 1P7EA 2VZKB 4M02A 2M4NA 1K52A 2LXCA 5EE0A 2ZCBA 3V6EB 3RFZB 2LGDA 2BS2B 2GMIC 4JPSA 3N1ZC 1V1OA 4BKSA 2L83A 1WY8A 1L6VA 4GDLA 1E10A 1FXAA 1E90A 3UIOB 3AN1A 2WDTB 3FC4A 2EELA 2LVOA 2RPQA 3R3MA 2JWUA 3MC0B 4DHZE 4W9HA 2G4DB 3KH0A 1E7PB 4KIKB 2CHZA 2KZRA 2IO0B 2AQ1B 2KT7A 4RGNA 2BF8B 3KQ4A 4WWMA 1GOZA 4ARIA 2L05A 2WHIA 3NS8A 4IWPA 3LYYA 3AV8A 2KJHB 2CHXA 2FCQA 3PLVA 3UQAA 4M0WB 1L0VB 4JWUC 1QOAA 2N1VA 4M00A 1GC6A 2IZVB 4DDID 3Q8FA 2KFKB 3TMPB 4ARCA 1OGWA 1UGMA 1RWSA 3J9CA 1P7FA 2WXKA 1UUPA 3DVNV 1T0YA 2QMTA 3MFGA 2ICIA 3GZNI 1EO6A 1CK1A 2KJ6A 3FKYA 5KHQA 2WDQB 1IP9A 1QILA 3TL5A 2DYMA 3U52E 4US9A 1IYFA 3PRPB 3ABVB 1QT9A 4NY0A 2QC8A 2BBCA 1OEYA 3TEXA 1I4HA 3QJZA 3RZWC 4NJ7A 1L4DB 2G3QB 2JX5A 2LRUA 3B08A 1MPEA 4AP4C 3PHXB 4A6QA 5G5GA 1UWXA 1NI2A 4XWTA 3MP9A 3H1UA 2GB1A 1AYFA 4HJGE 2NMQA 3CSTA 2Z0DB 2KWCA 3A9KA 1RFKA 4W9IA 4L23A 3QHTA 3BY4B 4BBNC 3NY5A 1T5XD 1TKYA 4CQNA 4LJPB 4IM3A 3M62B 3R7RA 2DZIA 3OAWA 3UF8A 4N59A 2QDFA 1JCKB 1TZOA 5JXVA 2W82A 4DXGA 2KC2A 3L0WB 2GBMA 2K1FA 1S3SG 2JZPA 3PREA 4KKJA 1XCQL 4HPPA 4PT5A 2FUHB 2JSVX 2LXAA 2UWQA 5TSSA 2WU5B 3Q3MC 3AEDB 3O13A 1WXSA 4ANUA 2WXJA 2N7DA 3IG3A 2D3CA 4W9LA 4USAA 3ZDTA 2NBUA 4YSZB 1CJEA 1WGRA 3APDA 1VD2A 2KXJA 2M1MA 1DGJA 3ZYYX 4HPMB 4ANWA 3DBSA 2XNAC 1FIQA 3T9LA 1DOYA 1BMLC 4WWNA 1AN8A 2K39A 1ZW7A 1K53A 1T6BX 2HTME 2RDHA 3QCAA 3RN9C 2JY6A 2GBNA 3TUOA 4KGTA 2JWZA 2KDBA 2WU2B 2L1AA 2Q5WD 1K8RB 2NTTA 4K81A 1OFFA 2DZKA 4LNKA 5EE1A 4OVVA 5HG2A 3UGBB 1K50A 1PDXA 2B3AA 1F52A 2Y5BB 1TYGB 2CU3A 2MBHA 2WWZA 1WGHA 1FNVA 1X1MA 3ZLZA 2BS3B 3VDZA 2J42A 2O6VD 2CR5A 1KM7A 4I6PA 3GZNB 2MBEA 1N63A 2MHJA 3Q3OC 4E74A 4EZKA 2JXXA 1ZKHA 2IBIB 2RGFA 4MGIE 1ET6A 2KYWA 3EGRA 4XC2A 3GE8C 4OZCA 2C7NB 4X57B 3U8ZA 2PTLA 3U4EG 2OJWA 1YN3A 3VTUA 3QA8A 2ZJDA 4ICVA 4K3BA 3ML8A 2WYQA 2R2QA 3C19A 3HHMA 4M8MA 1TS3A 4HCPB 4LCDE 1FCCC 1OTRB 2O6VA 4IKGA 4J3OD 4P1BC 2BWES 3ZKJC 4EFOA 2Y3AA 5J2RA 1V5TA 3NZ3A 4HWIB 5AZFA 4TMAB 1UF0A 2YVCA 3ZJVA 4WH4A 4ICUA 4EOYA 3HM3A 1WJ4A 1FO4A 4RCOA 4LK0M 5C23A 3H6NA 3BINA 4C7ZA 4AJWA 2D3AA 2G9HD 2MCNB 4JQWC 3V62A 5IOIA 5L95C 1K51A 4ASWC 3DBHB 3AH7A 2J0MA 1EM7A 2ON8A 2L52A 1Z5SB 3BK2A 2J0KA 2V3PA 1XCTL 3IT4B 4ANXA 4NQLB 1ZP0B 3I57A 4WWOA 2KWVB 3FILA 3W1SC 3L4PA 2SEBD 4RM8A 5BMIA 4N9F4 4YTNB 5HI1A 4GDLB 1TKEA 2SAKA 5DCNA 1LQBA 3WA0A 1VZ6A 3ZDMC 3Q8EA 2V3SA 1MI0A 3V61A 4B0MA 2VH1A 3TCAA 3B9JA 2KAJA 4REZA 3W5VB 1E8WA 2DZJA 3Q14C 1LFDA 3HVZA 5TR5A 2L0FA 2KTFA 1I42A 4ZRJA 4NNJB 2L8JA 1VJKA 3LB8C 1L0XB 2NBWB 2DHZA 4GOCA 4HPLB 4WAFA 1V49A 1F77A 3DWGC 2MBQA 2X8XX 3T3OA 1NBFC 4C7YA 1FRRA 1UGJA 1TS5A 2JUOA 1ISNA 1AW7A 3CF6E 3HVDA 4KSLC 1XT9B 2H89B 3TSSA 1E7UA 4JLCA 5E6NA 5HHDG 2W9NA 4K7WA 4BKTA 2KN5A 2C9WB 1HTQA 2JRIB 2L7RA 3DPDA 4RFBA 1D5XC 3BIID 4D2KA 2JYEA 2WXQA 3M95A 1V81A 5C3JB 1WX9A 2K9XA 5GXGB 1WZ3A 1WM2A 1EF1A 1D6EC 4ACFA 4EKUA 2NCNA 5LNK1 2INNE 1FMAD 1OQQA 2J4XA 4HDOA 2DAFA 2VRRB 4RF0A 1C9FA 3CSFA 1J8CA 2IO2B 3PSEB 3L17A 3I63C 4S17A 4EE2A 3RUIB 3HRDD 3K9OB 2LASA 5IAAC 4DBGA 1HQRD 1C4PA 1VCBA 1KH0A 3X23A 4GN1A 1TZ1A 3RNEC 1YQ4B 1SF0A 3NVWA 2IDYA 1RRBA 2PPHA 3A9KB 3VUXA 1KFYB 4KSKC 4ZYNA 3OJ3A 4YSYB 2PMVA 3E9SA 3R8BA 2J53A 2GRIA 4RGOS 2GLSA 5FK9C 2MH7A 1UBIA 3WAPA 4ZRPA 2QILA 3LXFA 1P9DU 2WX1A 1F0ZA 1JWAD 3A1QA 5DPSA 3I5JC 2RD0A 4PS8A 1Z2MA 2LJIA 2I38A 2LI5A 2NBVB 2YEPB 1HE8A 1M94A 2BYVE 2WDRB 5BYSA 2K8HA 5D3DA 1MG8A 3EFUA 3RNAC 3BVZA 2KC1A 1WRIA 1TT5B 2V1YA 2WQYB 1KLVA 4RGTA 3QAQA 4TQ0A 4GGQA 1C1YB 2REXA 2AEHA 1M4VA 2KJRA 1JROA 1BUIC 4UDUC 3BYTB 2JQRB 5JHAA 3Q8CA 3R66C 2G1EA 5LXIB 1B1ZA 5DPTA 2WP9B 3QIJA 3DVGY 4HK2A 1YQBA 4HCNB 1XLNA 2H88B 1UWMA 1WGYA 2LD9A 3IT6B 1ET9A 2IY1B 1C3TA 1SJED 3ZNGC 3ZO5B 3KWVA 5E6PA 3PT2B 1AARA 2N9PC 4WJNA 3BVGA 2KKCA 3SFDB 2BQQA 1J7BA 5EE3A 4W9KA 4ZRKA 3A9JA 1YQ3B 4FJYA 1GAQB 3Q6BA 4TQ1A 3NUHB 3VVWB 3AE7B 1QOGA 3BK1A 1XO3A 2WNMA 4EZJA 5G55A 1P0RA 3CMMB 1QOFA 2M17A 2O2VA 2PE6B 3P42A 2PW9A 4A3OA 3OLMD 4B0EA 4YTMB 3AECB 4DDGD 2MW5A 1V9JA 4C4VA 4GU2A 3GP7A 1JWMD 1FNWA 1TTNA 5H92C 2RPVA 5IN7A 4W9GA 2W3RA 3X0WA 1R4MI 1IGCA 1YN5A 2MBOA 1ZDXA 4A9AA 1I35A 4W9JA 4DHJD 3Q8AA 3DQVA 1EU3A 3W1SA 5T8IA 2JF5A 4BOSC 2KMAA 2WLBA 4IOIE 3R7QA 1FPYA 2KVZA 2KK8A 4MSMB 3WAOA 3SFEB 1HZ5A 2LFIA 5H8YE 1QQRA 4ZYSA 4FHKA 4FADA 5EDSA 3OG5A 1ZXHA 4MM3A 2M0XA 1SB3C 4LNNA 5HKHA 2O6VB 1HTOA 4GB9A 2V0GA 4NJ6A 3B0AA 1JWBD 3OJ4B 3B1LX 1TY2A 3U7ZA 1GNUA 2BGFA 1IBXB 3ML9A 2JZZA 4LNFA 4S0RA 3H8HA 5D6JB 2KDMA 1PUTA 1N62A 5CHWA 3L13A 2LGXA 2KQ4X 3VQIA 1PFDA 4C00A 3D32A 5KHOA 3TEZA 1JMLA 3VH3B 2K6QA 1YJ1A 3FAHA 4TSSA 3VFKA 3AE9B 4W9CA 4FULA 4HDQA 3FILB 1CZPA 1WGKA 2N7EA 2GI9A 5JHBA 1QLBB 2CS4A 1QOBA 3NHEB 4MACA 4YSXB 1E8XA 4RGMA 2LGIA 2KQSA 3NG0A 1EU4A 2W54A 2B76B 2ONQA 1KLGD 1WRDB 3H7PA 2MP2A 3PHWB 5FKAC 1NYRA 3JW0X 1B9RA 3HK0A 5I4DA 3SR6A 1WYWB 1QZEA 3AEGB 4DXFA 2FAZA 3N3KB 3AE3B 1HEZE 2KX3A 1YX6B 4XDDA 4AUQC 1I4QA 4LNOA 2WXHA 2KOXA 2Z8LA 4JGHB 2BYFA 3ALBA 4G50A 1XD3B 3N20C 1CQVA 3ZRFA 4E3CA 2N9KA 1YIWA 3VAWA 2JRHA 1BXTA 1N60A 1SJHD 3TIXA 4DXAB 3AULA 1PQSA 1GPXA 2PJHA 2Y5PA 4G3XB 3KUDB 2KFJA 2AWTA 1WI0A 1LM8B 2WX0A 3WANA 3DWMA 4TV3A 2IGGA 2D07B 4AWJA 1SIFA 1V86A 3ENEA 3P2BA 4MJSA 3N1YC 2Y5CA 2LWPA 2CU1A 1WM3A 3W5UB 4KDLB 1R4MB 3GE3C 5BMGA 4KVGB 4MH8A 1WF9A 5IA7A 3Q3FA 4HJKA 3P4SB 4IC7B 3UQBA 4JL9A 3RCZA 2K5PA 2IJ0A 2K25A 1YX5B 2KO3A 3RZFA 3M3JA 4XZ4A 2NPTB 3NRZA 3NVVA 3Q2AC 1N5WA 2WDVB 2WXGA 1Q0WB 3ZXVA 1XLPA 2JU6X 1XLOA 4MEMA 4TUUA 1Q1OA 2GBKA 4MGYE 1FEHA 4GXBA 5J17A 1C76A 1RLFA 3ZJTA 2IYDB 3A1QB 2DNFA 1MG4A 1GB1A 3ZIMA 2NTSA 3DOWA 2PEAA 2IGDA 1L7YA 2G45B 3PS6A 4FLHA 1L4ZB 4FN2A 1QKZA 4IG7B 3URYA 4IWQA 2WGSA 1WSPA 3SEBA 1IUEA 1NEKB 4PS3A 1V80A 4A90A 2XEWA 2HJ1A 1E0ZA 2PVGC 1C4AA 1OQRA 3NVZA 3DBRI 3C8YA 1ZPSA 4IM0A 1IBXA 4NAWA 3AE1B 2KTRA 5CHFA 1OEYJ 1TJEA 2WS3B 3RI7C 1XLQA 1C4CA 5D7GA 2XN9C 4BOZB 3IAM1 1FFVA 4NAMA 2PVOD 3N32A 3SHQA 4W9FA 3T3NA 2ZVNA 5G5HA 2KDIA 2JYTA 3SD5A 2MJDA 4XE0A 4OW0A 4JWSC 1IPGA 1WJ6A 4L2YA 2IGHA 2MJ3A 3A9JB 1I4GA 2N4FA 4ZOHC 2R61A 1QF6A 2HE7A 2KVRA 2K8BA 2E6XA 3T8MA 1TBEA 3KW5B 5GMVA 1UNSA 4AQ7A 1IGDA 1RYJA 2G4SA 3DBLI 1JWUD 4QAYA 2O2VB 3ZGZA 2D11A 3W1YA 4XX5A 2V4IB 4WIPA 2YLMA 1RAXA 4FJZA 3A33B 4NJCA 1R4NI 5C1ZA 1MFWA 2K8CA 2FE8A 4RF1A 3PVLA 5J18A 4II3B 1VLBA 2MJEA 4C4VB 4C56C 3EHVA 2LUMA 1GB4A 4BFRA 2LGYA 2C60A 4W9EA 2IY0B 1YN4A 4JX1C 1RM6C 2L00B 1ZE3D 3AB5A 3PV1A 3K9PB 1L2NA 3PRMB 5AUIA 3P1MA 4EUTA 4K3CA 4E71A 2MRPA 4N58A 4WWPA 4MM3B 4KZCA 3A4SC 3VH4B 3QC8B 2BWFA 1ZUD2 4OZAA 3BYYB 5E6OA 4AJYB 1SE3A 1UBQA 3GB1A 5BMHA 2ASQA 4OVZA 1LO5D 2QIEB 4F7ZA 5DPWA 3L08A 4LJOB 3RNBC 3RMKC 1ENFA 4O1NA 5L83A 2NPTA 4DHJB 3TBLD 1V5OA 4DK5A 4M8NA 4KKIA 1TS2A 3UI3A 2KMMA 3EFCA 4MDKE 1EWYC 1YNTE 2J52A 2V4LA 2DENB 2W55A 2BYEA 3NZUA 1WR6E 4R3DA 1I7HA 1N6ZA 4PYUA 1JWSD 1T0SC 1U4AA 1SGHA 2QHOA 3PZ8A 4N6EB 2MBBB 3L16A 3V6CB 1G6JA 1WR1A 3MHSD 4H2AA 4HKZE 5D2MB 4XYCA 5LLIA 2JZ3B 2ACZB 3MJWA 2EKIA 3PGEA 3SU8X 3JSVB 3DBRB 4BZAA 3GOEA 5BO4B 2GBRA 2WXNA 1D4BA 5D3IB 4II2B 5FR6A 4IW0A 1FXTB 3IAS1 2N9XA 1V6EA 4ANVA 4DWFA 2CHWA 2EKEC 1WIAA 2BKRB 1F2RI 3GS2A 2C5LC 3H7PB 2MP2B 5G2NA 4IUMB 3ZQ4A 2ZW1A 1C77A 1N5XA 4K7UA 2BTEA 2AQ2B 3ZNID 4A20A 1GJZA 2OEDA 2TSSA 2OOBB 2ZPYA 1F1HA 1KTKA 2C7MB 2WXLA 3AE4B 3A4RA 4BKSD 1NYQA 1WJNA 2WXMA 2KANA 2D5GA 2BKFA 3BWUD 3AEEB 3KUCB 3IFWB 4CHKA 1SIJA 1FNUA 2DYOA 2N1WA 1C79A 3DBLB 4C80A 4YWGG 4GIVA 2K6DB 1WXQA 3AEBB 4GDKB 3ZTDA 3NJTA 4KV2A 1JALA 1E6EB 3S2AA 1E8YA 3ZNHB 1SEBD 2KN4A 3N30A 4XGAB 3WALA 3KYDD 1C78A 2IPKD 3MTNB 3RNFC 4MJSB 1L0YB 2LVPA 1FFUA 2HDEA 3IXSA 3HM6X 3DHHC 3MC9A 4RMAA 5LXHA 2D3GA 4LDTD 1SXTA 1HA5A 3P63A 3MJ5A 3ZJUA 1H8CA 4NZLB 4B6WA 1V1PB 4AOFA 1V8CA 4YTPB 3V05A 3VR8B 1WZ0A 1SE9A 1NDDA 3IVFA 2RDBC 1P3QU 3AMZA 1Q5WB 2DX5B 1NENB 2FUG1 2OJRA 4W9DA 3WAMA 4BKGA 2DWQA 1F2RC 3V60A 2VH2A 3ECIA 2V3NA 5BYQA 4AS1A 5CHVC 4OZBA 1P98A 1KLUD 1FXIA 1FRDA 3ZUNA 2MWSB 1P1AA 1DOIA 2KLGA 2KX0A 3TEYA 4WQOB 4IWOA 4L1BA 1LGRA 3HUIA 2BYTA 3N1XC 2DBYA 4RNAA 4US8A 4WJPA 2FBWB 3DHIC 4YL8A 3DDCB 1TY0A 1VZ7A 2V9HA 2AL3A 1YOVB 3AXCA 2L0TA 3ZRCA 3RD2A 4EEWA 4NAWB 4WJOA 3AU5A 3DHGC 3HIZA 3P4RB 2KTRB 4ZRIA 3CWIA 1GC7A 4I6NB 4K1RB 4CYEA 1WXAA 2INPE 4A8XC 1YJIA 2XK5B 3EUB2 2QCZA 3CIRB 4MELA 3B2FA 4KDIC 1XQQA 1KOTA 1GG3A 1PGAA 2J0JA 3R2IA 2M56B 2A4ZA 2DLBA 3ONSA 2I1JA 3JYUA 1FM0D 3JSVA 3DVGX 2KWUB 3IBEA 3BVMA 2KDFB 3RPFC 3NOBA 2W3SA 3PTFC 1ESFA 2YEPF 4BAXA 1LXDA 3BZDB 1VDVA 3LDZE 2AQ3B 3VTVA 3ETRA 2AYOB 1MHXA 3H9DA 3RULA 2CKHB 2KLCA 3RYTA 1FD6A 3C0RB 4B9KA 1WE6A 2N9EB 5AZHA 3ZW3A 4LTUA 4G11A 1D3ZA 1JRPA 3PLUA 4FA6A 3L10B 2A5UA 1DOXA 2INDC 2LEKA 2NR2A 2MQJA 3PO0A 4DQOC 2VZKD 2D10A 3DBHI 1UH6A 2KQ7A 1A5RA 3QX1A 1J19A 2IO1B 4KZ0A 1WX8A 2UU7A 5IKCM 4ZDVA 3KUZA 1CMXB 1N61A 2JXTA 3VUYA 1JRUA 3NZSA 3QQ8B 1KRHA 1ZDVA 2M8SA 3VRAB 2AX5A 1YJJA 1WWTA 2WXIA 1AWDA 4LLGM 1V97A 4RM9A 4GDKA 2BS4B 3RNGC 1TS4A 2KACA 3RT3B 4ZHOA 2EMSA 2KNBA 4WJQA 2DAJA 3U7DA 2IO3B 4JE3B 2LZ6A 4Q2JA 4F8CB 1Y8RC 1YD8U 1R7SA 2R2OA 4WURA 3SDLC 3Q8BA 2K22A 4PS7A 5MPOA 4KGRA 4M01A 4HRSA 3APFA 3ZXRA 1Y56A 3P4PB 2D3BA 2C7HA 3U30A 2L76A 1EUVB 1D5ZC 1WJUA 2RMMA 3AEFB 2HD5B 1TIFA 3TJPA 1ACCA 1F9JA 1DYQA 1VR9A 1I4RA 4XDCA 4CO7A 4GSWA 2ZCCA 3QK0A 4EZLA 5FR3A 2N9LA 2JT4B 1XXGA 1V1PA 2K0PA 4MSQB 1D5MC 1L5PA 4KIKA 2DZMA 3ZTCA 3VHTC 4KGSA 2M0AA 1I4PA 4JIOU 4HROA 1L6UA 1RFAA 4NQKE 3KYCD 1XF5L 1Q10A 3WCQA 3RNCC 4A3PA 4A55A 1PGXA 4M0WA 2BT6A 3JVZX 1KF6B 2N0SB 2FCSA 4IM2A 1J7AA 3MC8A 2RSUA 3P4QB 2LGSA 2KFKA 1WMHB 3QARA 3EA6A 1T3QA 3H7SA 1YMHE 1TKGA 4P7IA 3QWZB 1J7CA 3AE5B 4LNIA 4MT5A 2J7QB 2MX2A 4HVBA 3ZVVA 4ZHPA 2I2YA 1V2YA 3LJ3A 1NI3A 4P1CC 4PK1A 4P6VF 2QSDA 2MA9B 2FNJB 3AE8B 1PYWD 2XK5A 4OHJA 2LJ5A 3L54A 1MJDA 3AI5A
chains in the Genus database with same CATH topology
2W3RA 3PZ8A 4N6EB 1IGCA 1YN5A 1ZDXA 4A9AA 2XNAC 1FIQA 3U2SC 1DOYA 1BMLC 1AN8A 3Q8AA 4H2AA 1EU3A 3W1SA 5T8IA 4HKZE 2CJNA 1K53A 2ACZB 2E3TA 1T6BX 2WLBA 4IOIE 1VRAB 2EKIA 2HTME 2RDHA 4ZRQA 1HZ5A 3SFEB 3E56A 3KLSX 2LFIA 5H8YE 2WXNA 3TUOA 1D4BA 5D3IB 1MVKA 1QQRA 3IAS1 4ZYSA 4XWWA 4KGTA 2WU2B 2L1AA 1ZXHA 2Q5WD 1F2RI 2NTTA 1SB3C 3GS2A 5HFYA 1OFFA 2WXPA 3ZQ4A 2ZW1A 5EE1A 1C77A 1N5XA 5HG2A 3AE2B 4YT0B 2V0GA 4IDIA 2BTEA 1K50A 1EWCA 1PDXA 2AQ2B 1JWBD 5AUKA 4WQMA 2PKOA 1TY2A 3PZ7A 3U7ZA 1TYGB 2CU3A 2OEDA 3KWLA 2TSSA 2LHEA 1IBXB 1KTKA 2QJLA 2WXLA 3H8HA 3W2DA 1FNVA 3AE4B 3MHZA 1NYQA 2WXRA 2WXMA 2KDMA 4ITKA 2D5GA 1PUTA 1JQ4A 2BS3B 3BWUD 3AEEB 1N62A 2J42A 3AM9A 1FCLA 1SIJA 2KQ4X 1FNUA 2DYOA 1C79A 3VQIA 4C80A 1N63A 1PFDA 1STEA 3TEZA 1JMLA 4YWGG 4YXDB 3OWEB 1I4XA 2BB6A 3R2TA 3Q69A 1ROEA 1WXQA 3AEBB 4GDKB 1JALA 1E6EB 3FAHA 4TSSA 2KWDA 3AEAB 1SEBD 3AE9B 3B2GA 1ET6A 2KN4A 3EGRA 4OZCA 2QEJC 3FILB 1CZPA 1WGKA 2PTLA 3U4EG 1WYGA 2GI9A 1QLBB 1QOBA 1C78A 2IPKD 2PIAA 1YN3A 3I9V1 4MACA 4YSXB 4GLSC 5BYRA 1L0YB 3VR9B 4RGMA 2LGIA 1VZ8A 1FFUA 1EU4A 2HDEA 1TS3A 2W54A 3IXSA 2B76B 2ONQA 1KLGD 1SBBB 1FCCC 1SXTA 1HA5A 4IKGA 5FKAC 4P16A 1NYRA 4J3OD 1ZOYB 3P63A 3MJ5A 1B9RA 3ZJUA 2Y3AA 4NZLB 3NZ3A 5I4DA 4TMAB 3SR6A 1V1PB 1XEEA 2BW2A 3AEGB 4DXFA 3ZJVA 1V8CA 4YTPB 2WXOA 3AE3B 4WH4A 2WXFA 3V05A 1ZXIA 3VR8B 1HEZE 4XDDA 1I4QA 1PGBA 1JW9D 2WXHA 2Z8LA 1FO4A 4RCOA 4LK0M 4C7ZA 3AMZA 1CQVA 2BB5A 2G9HD 2N9KA 2PLPA 4KX6B 1K51A 1NENB 1BXTA 3AH7A 2FUG1 1N60A 1SJHD 3TEWA 4FXCA 2DWQA 1F2RC 1EM7A 2M19A 3NVYA 2L32A 2ON8A 2V3NA 2L52A 5BYQA 3BK2A 2V3PA 4AS1A 2CJOA 1XCTL 4OZBA 1KLUD 1NVID 1FXIA 2MEKA 1FRDA 3IT4B 1GPXA 2Y5PA 1DOIA 1ZP0B 3I57A 3TEYA 3FILA 3L4PA 2SEBD 3DWMA 2IGGA 4L1BA 5BMIA 3HUIA 4YTNB 5HI1A 2BYTA 4GDLB 2DBYA 1TKEA 2SAKA 2Y5CA 4RNAA 4US8A 1SE4A 3W5UB 2OHFA 1VZ6A 2FBWB 5BMGA 3Q8EA 3N9YC 4MH8A 1MI0A 1TY0A 1VZ7A 4B0MA 1HZ6A 3P4SB 3B9JA 5E6JA 2K5PA 2IJ0A 2K3UA 2KAJA 4REZA 1SE2A 3W5VB 4NAWB 1SSNA 3HVZA 3NRZA 3P4RB 3NVVA 1E9MA 1N5WA 3CWIA 5C2TB 3VRBB 2X38A 2WDVB 1HXYD 2WXGA 2INPE 4A8XC 2LHDA 2ZW0A 1VJKA 1MHHE 3LB8C 1YJIA 3EUB2 1L0XB 5EE9A 1XLPA 2JU6X 1XLOA 2LMCA 3AE6B 3CIRB 4WAFA 3B2FA 1F77A 1FEHA 3DWGC 2RDGA 3W9CB 4RH6A 1PGAA 1C76A 4HEA1 3T3OA 3NS1A 3V3XA 2N7JA 3R2IA 4C7YA 1FRRA 1UGJA 3ZJTA 1TS5A 2M56B 2DLBA 4HKQA 1AW7A 1A70A 1FM0D 3HVDA 2H89B 3TSSA 3BVMA 1P7EA 3RPFC 2VZKB 5HHDG 2W3SA 1K52A 1ESFA 2YEPF 5EE0A 1GB1A 3BZDB 1VDVA 3RFZB 2AQ3B 4RFBA 2NTSA 2BS2B 1D5XC 3BIID 4JPSA 3ETRA 1MHXA 1V1OA 2IGDA 4D2KA 2JYEA 2WXQA 5C3JB 1FD6A 1L4ZB 2L83A 1QKZA 1L6VA 2K9XA 4LTUA 3URYA 1E10A 5GXGB 1FXAA 1WSPA 1JRPA 3SEBA 1IUEA 3AN1A 1NEKB 3FC4A 2EELA 1D6EC 1DOXA 4A90A 2LEKA 1E0ZA 5LNK1 2PVGC 2INNE 3PO0A 2JWUA 3MC0B 1FMAD 1C4AA 1OQRA 1OQQA 2J4XA 4DQOC 2VZKD 3NVZA 1E7PB 4RF0A 1C9FA 3C8YA 1ZPSA 1IBXA 2AQ1B 3AE1B 4RGNA 3KQ4A 4WWMA 1GOZA 4ARIA 4EE2A 1N61A 3HRDD 2JXTA 3LYYA 1KRHA 1ZDVA 3AV8A 1TJEA 1HQRD 1C4PA 2WS3B 3VRAB 1KH0A 2AX5A 1XLQA 1C4CA 1YQ4B 1SF0A 3NVWA 5D7GA 1YJJA 2XN9C 1L0VB 2IDYA 3IAM1 1KFYB 1WWTA 1FFVA 2WXIA 1AWDA 4JWUC 1V97A 1QOAA 2PMVA 2PVOD 4LLGM 4NAMA 4YSYB 3E9SA 3R8BA 2BS4B 2J53A 1TS4A 2GRIA 4RGOS 5G5HA 5FK9C 3T3NA 2KACA 2MH7A 4ZHOA 2JYTA 2MJDA 4XE0A 4OW0A 4ZRPA 2QILA 4JWSC 3LXFA 4JE3B 4L2YA 2IGHA 4Q2JA 1F0ZA 2MJ3A 3Q8FA 1JWAD 1R7SA 4ARCA 1I4GA 4WURA 4ZOHC 2R61A 1QF6A 1RWSA 3J9CA 1P7FA 2LJIA 2WXKA 2K22A 3Q8BA 5MPOA 1UUPA 2I38A 4KGRA 4HRSA 2E6XA 2YEPB 1Y56A 3P4PB 2QMTA 1UNSA 3MFGA 2ICIA 4AQ7A 1CK1A 1IGDA 1RYJA 1JWUD 2WDRB 1D5ZC 5BYSA 5D3DA 2RMMA 3ZGZA 2WDQB 3AEFB 1QILA 3ZYYX 2DYMA 2V4IB 1ACCA 3BVZA 1WRIA 1DYQA 4WIPA 1VR9A 1I4RA 2WQYB 4XDCA 3U52E 4US9A 5FR3A 2N9LA 4NJCA 4RGTA 1XXGA 3ABVB 1V1PA 1QT9A 2FE8A 2K0PA 4RF1A 4TQ0A 2BBCA 1D5MC 1L5PA 3TEXA 1M4VA 1VLBA 1I4HA 2MJEA 4KGSA 2M0AA 1I4PA 1JROA 1L4DB 1BUIC 2JX5A 4HROA 4C56C 4UDUC 1L6UA 3BYTB 2JQRB 1MPEA 4A6QA 2LUMA 3Q8CA 5G5GA 2G1EA 1UWXA 1GB4A 1B1ZA 2WP9B 4XWTA 1YN4A 4JX1C 1XF5L 1Q10A 1XLNA 3MP9A 1RM6C 2GB1A 2H88B 3WCQA 1AYFA 4A55A 1PGXA 1UWMA 4HJGE 4M0WA 2NMQA 1ZE3D 2BT6A 3IT6B 1KF6B 1RFKA 1ET9A 2N0SB 4L23A 3AB5A 1J7AA 1SJED 3KWVA 5AUIA 3P4QB 3BVGA 1T5XD 3P1MA 1TKYA 3SFDB 1J7BA 5EE3A 4CQNA 4N58A 1YQ3B 1GAQB 4N59A 4TQ1A 3EA6A 4MM3B 3NUHB 1JCKB 1T3QA 1TZOA 3AE7B 5JXVA 1QOGA 1YMHE 1TKGA 2W82A 3BK1A 1XO3A 2WNMA 1ZUD2 4DXGA 4OZAA 3BYYB 1J7CA 1SE3A 3GB1A 3AE5B 5BMHA 4OVZA 1LO5D 2QIEB 4MT5A 1QOFA 2JZPA 4KKJA 3P42A 1XCQL 1ENFA 4ZHPA 4PT5A 2I2YA 2PW9A 4O1NA 2JSVX 1NI3A 4B0EA 5TSSA 4YTMB 4P6VF 3AECB 4KKIA 1TS2A 2WU5B 3AEDB 3O13A 2QSDA 3UI3A 2KMMA 2WXJA 4USAA 1EWYC 3AE8B 4YSZB 1CJEA 1YNTE 2J52A 1PYWD 2W55A 3GP7A 4OHJA 1JWMD 4R3DA 1FNWA 1I7HA 1JWSD 5H92C 1DGJA 2RPVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CK1 A;  1F77 A;  2RDG A;  1EU4 A;  1YN5 A;  1JWU D;  4RH6 A;  1TS3 A;  1D5Z C;  2XNA C;  5D3D A;  1KLG D;  1QIL A;  3R2I A;  1SBB B;  1TS5 A;  1AN8 A;  1SXT A;  3BVZ A;  1HA5 A;  1EU3 A;  1DYQ A;  5FKA C;  1I4R A;  1AW7 A;  4RGT A;  3TSS A;  1XXG A;  4NZL B;  2RDH A;  1V1P A;  3BVM A;  5I4D A;  1V1P B;  1D5M C;  4DXF A;  1M4V A;  3KLS X;  1I4H A;  3V05 A;  1ESF A;  5D3I B;  1I4P A;  3BZD B;  4C56 C;  4UDU C;  2AQ3 B;  4RFB A;  2NTS A;  3BYT B;  4ZYS A;  1I4Q A;  1D5X C;  1V1O A;  2Z8L A;  4RCO A;  1B1Z A;  2NTT A;  1CQV A;  1YN4 A;  3URY A;  2G9H D;  3SEB A;  1D6E C;  1BXT A;  1SJH D;  1ET9 A;  3MC0 B;  1EWC A;  1SJE D;  2J4X A;  2AQ2 B;  3BVG A;  1T5X D;  1TY2 A;  1KLU D;  2AQ1 B;  2TSS A;  4RGN A;  1GOZ A;  1KTK A;  3W2D A;  1FNV A;  2SEB D;  3EA6 A;  1JCK B;  1HQR D;  1FNU A;  4DXG A;  1SE4 A;  3BYY B;  2XN9 C;  1STE A;  1SE3 A;  1TY0 A;  1LO5 D;  3OWE B;  3R8B A;  1I4X A;  3R2T A;  1TS4 A;  4RGO S;  5FK9 C;  2IJ0 A;  1ENF A;  4TSS A;  1SE2 A;  4O1N A;  1SEB D;  2QIL A;  1ET6 A;  5TSS A;  2QEJ C;  1TS2 A;  1I4G A;  3O13 A;  2R61 A;  1HXY D;  2IPK D;  1YN3 A;  1UUP A;  1PYW D;  3GP7 A;  4OHJ A;  1JWM D;  1L0X B;  1L0Y B;  1FNW A;  1JWS D;  3MFG A;  1UNS A;  2ICI A;  4RGM A; 
#chains in the Genus database with same CATH topology
 1T0Q C;  3O65 B;  1KJT A;  2I1K A;  1WFY A;  3U2S C;  2FCM A;  2CJN A;  2E3T A;  2NVU I;  1VRA B;  3EC8 A;  2BVC A;  1WGD A;  3I3T B;  4ZRQ A;  3E56 A;  3KLS X;  1UD7 A;  1MVK A;  4PYZ A;  5DPR A;  4XWW A;  1T0R C;  2FIF A;  5JH5 C;  2DYB A;  5IP4 D;  5HFY A;  3KVF B;  2Z59 B;  3M63 B;  2WXP A;  3EEC A;  3AE2 B;  4YT0 B;  4F1S A;  5IO9 A;  4IDI A;  1OQY A;  1EWC A;  3PRZ A;  2UYZ B;  5AUK A;  4WQM A;  2PKO A;  3PZ7 A;  2LUE A;  3KWL A;  4BBN F;  2LHE A;  3PZD A;  2QJL A;  3W2D A;  3MHZ A;  2WXR A;  1ZGU B;  4ITK A;  1JQ4 A;  3AM9 A;  1FCL A;  1WE7 A;  1BT0 A;  3VTW A;  4HXD A;  2HJ8 A;  1WXM A;  4URK A;  1STE A;  4TKN A;  4G0N B;  4YXD B;  3OWE B;  1I4X A;  2BB6 A;  2MLB A;  3Q69 A;  3R2T A;  1ROE A;  2ZZP B;  3VUW A;  2INC C;  2KWD A;  3AEA B;  3B2G A;  4LDT B;  2QEJ C;  4J6I A;  2KHW B;  1EF5 A;  2ZEQ A;  1S1Q B;  1UZX B;  1WYG A;  2FCN A;  3UIP B;  2PIA A;  3I9V 1;  4GLS C;  1WX7 A;  5BYR A;  3VR9 B;  2JPH A;  4MGZ E;  5AEK B;  1VZ8 A;  2ZPN A;  1GUA B;  2KDE B;  3VXW A;  4FBJ B;  2PE9 A;  3WIM A;  1SBB B;  2LRW A;  4P16 A;  4OVU A;  1ZOY B;  2XBB C;  2GBJ A;  1TGZ B;  1XEE A;  2BW2 A;  2WXO A;  2WXF A;  1ZXI A;  1PGB A;  1JW9 D;  5CTR C;  2HTH A;  2ZNV C;  2NS5 A;  2BB5 A;  4HLE A;  2PLP A;  3APC A;  4KX6 B;  4I6L B;  2LVQ A;  4WAA A;  3TEW A;  4FXC A;  2M19 A;  2AL6 A;  3NVY A;  2L32 A;  3IHP C;  5AZG A;  2FID A;  2CJO A;  4FHJ A;  3UIN B;  1NVI D;  2MEK A;  2L3Z A;  5JZE B;  2ZVO A;  1WMH A;  3AU4 A;  1H4R A;  1E8Z A;  2KMC A;  3DVN U;  2Z0E B;  4NPN A;  1SE4 A;  2OHF A;  4B95 A;  1E7V A;  3N9Y C;  2GOW A;  1HZ6 A;  3PPA A;  5E6J A;  5CX3 A;  2K3U A;  2MSE D;  3Q3N C;  4MGK E;  1SE2 A;  1WGG A;  1SSN A;  2D2Q A;  1WXV A;  2ZNV B;  4GMV A;  1E9M A;  4FJV B;  2BPS A;  2KD0 A;  5C2T B;  3VRB B;  2X38 A;  1HXY D;  1J0G A;  2RR9 A;  4MH0 E;  4DHZ B;  2LHD A;  2ZW0 A;  3Q3J A;  1MHH E;  3ZNZ B;  1WH3 A;  5EE9 A;  2LMC A;  3AE6 B;  4BVU C;  2RDG A;  2JVC A;  4RH6 A;  3W9C B;  4K7S A;  3DCG A;  4HEA 1;  3NS1 A;  3V3X A;  2N7J A;  1E5W A;  2EMT A;  5D94 A;  1R4N B;  4HKQ A;  1A70 A;  1UEL A;  1P7E A;  2VZK B;  4M02 A;  2M4N A;  1K52 A;  2LXC A;  5EE0 A;  2ZCB A;  3V6E B;  3RFZ B;  2LGD A;  2BS2 B;  2GMI C;  4JPS A;  3N1Z C;  1V1O A;  4BKS A;  2L83 A;  1WY8 A;  1L6V A;  4GDL A;  1E10 A;  1FXA A;  1E90 A;  3UIO B;  3AN1 A;  2WDT B;  3FC4 A;  2EEL A;  2LVO A;  2RPQ A;  3R3M A;  2JWU A;  3MC0 B;  4DHZ E;  4W9H A;  2G4D B;  3KH0 A;  1E7P B;  4KIK B;  2CHZ A;  2KZR A;  2IO0 B;  2AQ1 B;  2KT7 A;  4RGN A;  2BF8 B;  3KQ4 A;  4WWM A;  1GOZ A;  4ARI A;  2L05 A;  2WHI A;  3NS8 A;  4IWP A;  3LYY A;  3AV8 A;  2KJH B;  2CHX A;  2FCQ A;  3PLV A;  3UQA A;  4M0W B;  1L0V B;  4JWU C;  1QOA A;  2N1V A;  4M00 A;  1GC6 A;  2IZV B;  4DDI D;  3Q8F A;  2KFK B;  3TMP B;  4ARC A;  1OGW A;  1UGM A;  1RWS A;  3J9C A;  1P7F A;  2WXK A;  1UUP A;  3DVN V;  1T0Y A;  2QMT A;  3MFG A;  2ICI A;  3GZN I;  1EO6 A;  1CK1 A;  2KJ6 A;  3FKY A;  5KHQ A;  2WDQ B;  1IP9 A;  1QIL A;  3TL5 A;  2DYM A;  3U52 E;  4US9 A;  1IYF A;  3PRP B;  3ABV B;  1QT9 A;  4NY0 A;  2QC8 A;  2BBC A;  1OEY A;  3TEX A;  1I4H A;  3QJZ A;  3RZW C;  4NJ7 A;  1L4D B;  2G3Q B;  2JX5 A;  2LRU A;  3B08 A;  1MPE A;  4AP4 C;  3PHX B;  4A6Q A;  5G5G A;  1UWX A;  1NI2 A;  4XWT A;  3MP9 A;  3H1U A;  2GB1 A;  1AYF A;  4HJG E;  2NMQ A;  3CST A;  2Z0D B;  2KWC A;  3A9K A;  1RFK A;  4W9I A;  4L23 A;  3QHT A;  3BY4 B;  4BBN C;  3NY5 A;  1T5X D;  1TKY A;  4CQN A;  4LJP B;  4IM3 A;  3M62 B;  3R7R A;  2DZI A;  3OAW A;  3UF8 A;  4N59 A;  2QDF A;  1JCK B;  1TZO A;  5JXV A;  2W82 A;  4DXG A;  2KC2 A;  3L0W B;  2GBM A;  2K1F A;  1S3S G;  2JZP A;  3PRE A;  4KKJ A;  1XCQ L;  4HPP A;  4PT5 A;  2FUH B;  2JSV X;  2LXA A;  2UWQ A;  5TSS A;  2WU5 B;  3Q3M C;  3AED B;  3O13 A;  1WXS A;  4ANU A;  2WXJ A;  2N7D A;  3IG3 A;  2D3C A;  4W9L A;  4USA A;  3ZDT A;  2NBU A;  4YSZ B;  1CJE A;  1WGR A;  3APD A;  1VD2 A;  2KXJ A;  2M1M A;  1DGJ A;  3ZYY X;  4HPM B;  4ANW A;  3DBS A;  2XNA C;  1FIQ A;  3T9L A;  1DOY A;  1BML C;  4WWN A;  1AN8 A;  2K39 A;  1ZW7 A;  1K53 A;  1T6B X;  2HTM E;  2RDH A;  3QCA A;  3RN9 C;  2JY6 A;  2GBN A;  3TUO A;  4KGT A;  2JWZ A;  2KDB A;  2WU2 B;  2L1A A;  2Q5W D;  1K8R B;  2NTT A;  4K81 A;  1OFF A;  2DZK A;  4LNK A;  5EE1 A;  4OVV A;  5HG2 A;  3UGB B;  1K50 A;  1PDX A;  2B3A A;  1F52 A;  2Y5B B;  1TYG B;  2CU3 A;  2MBH A;  2WWZ A;  1WGH A;  1FNV A;  1X1M A;  3ZLZ A;  2BS3 B;  3VDZ A;  2J42 A;  2O6V D;  2CR5 A;  1KM7 A;  4I6P A;  3GZN B;  2MBE A;  1N63 A;  2MHJ A;  3Q3O C;  4E74 A;  4EZK A;  2JXX A;  1ZKH A;  2IBI B;  2RGF A;  4MGI E;  1ET6 A;  2KYW A;  3EGR A;  4XC2 A;  3GE8 C;  4OZC A;  2C7N B;  4X57 B;  3U8Z A;  2PTL A;  3U4E G;  2OJW A;  1YN3 A;  3VTU A;  3QA8 A;  2ZJD A;  4ICV A;  4K3B A;  3ML8 A;  2WYQ A;  2R2Q A;  3C19 A;  3HHM A;  4M8M A;  1TS3 A;  4HCP B;  4LCD E;  1FCC C;  1OTR B;  2O6V A;  4IKG A;  4J3O D;  4P1B C;  2BWE S;  3ZKJ C;  4EFO A;  2Y3A A;  5J2R A;  1V5T A;  3NZ3 A;  4HWI B;  5AZF A;  4TMA B;  1UF0 A;  2YVC A;  3ZJV A;  4WH4 A;  4ICU A;  4EOY A;  3HM3 A;  1WJ4 A;  1FO4 A;  4RCO A;  4LK0 M;  5C23 A;  3H6N A;  3BIN A;  4C7Z A;  4AJW A;  2D3A A;  2G9H D;  2MCN B;  4JQW C;  3V62 A;  5IOI A;  5L95 C;  1K51 A;  4ASW C;  3DBH B;  3AH7 A;  2J0M A;  1EM7 A;  2ON8 A;  2L52 A;  1Z5S B;  3BK2 A;  2J0K A;  2V3P A;  1XCT L;  3IT4 B;  4ANX A;  4NQL B;  1ZP0 B;  3I57 A;  4WWO A;  2KWV B;  3FIL A;  3W1S C;  3L4P A;  2SEB D;  4RM8 A;  5BMI A;  4N9F 4;  4YTN B;  5HI1 A;  4GDL B;  1TKE A;  2SAK A;  5DCN A;  1LQB A;  3WA0 A;  1VZ6 A;  3ZDM C;  3Q8E A;  2V3S A;  1MI0 A;  3V61 A;  4B0M A;  2VH1 A;  3TCA A;  3B9J A;  2KAJ A;  4REZ A;  3W5V B;  1E8W A;  2DZJ A;  3Q14 C;  1LFD A;  3HVZ A;  5TR5 A;  2L0F A;  2KTF A;  1I42 A;  4ZRJ A;  4NNJ B;  2L8J A;  1VJK A;  3LB8 C;  1L0X B;  2NBW B;  2DHZ A;  4GOC A;  4HPL B;  4WAF A;  1V49 A;  1F77 A;  3DWG C;  2MBQ A;  2X8X X;  3T3O A;  1NBF C;  4C7Y A;  1FRR A;  1UGJ A;  1TS5 A;  2JUO A;  1ISN A;  1AW7 A;  3CF6 E;  3HVD A;  4KSL C;  1XT9 B;  2H89 B;  3TSS A;  1E7U A;  4JLC A;  5E6N A;  5HHD G;  2W9N A;  4K7W A;  4BKT A;  2KN5 A;  2C9W B;  1HTQ A;  2JRI B;  2L7R A;  3DPD A;  4RFB A;  1D5X C;  3BII D;  4D2K A;  2JYE A;  2WXQ A;  3M95 A;  1V81 A;  5C3J B;  1WX9 A;  2K9X A;  5GXG B;  1WZ3 A;  1WM2 A;  1EF1 A;  1D6E C;  4ACF A;  4EKU A;  2NCN A;  5LNK 1;  2INN E;  1FMA D;  1OQQ A;  2J4X A;  4HDO A;  2DAF A;  2VRR B;  4RF0 A;  1C9F A;  3CSF A;  1J8C A;  2IO2 B;  3PSE B;  3L17 A;  3I63 C;  4S17 A;  4EE2 A;  3RUI B;  3HRD D;  3K9O B;  2LAS A;  5IAA C;  4DBG A;  1HQR D;  1C4P A;  1VCB A;  1KH0 A;  3X23 A;  4GN1 A;  1TZ1 A;  3RNE C;  1YQ4 B;  1SF0 A;  3NVW A;  2IDY A;  1RRB A;  2PPH A;  3A9K B;  3VUX A;  1KFY B;  4KSK C;  4ZYN A;  3OJ3 A;  4YSY B;  2PMV A;  3E9S A;  3R8B A;  2J53 A;  2GRI A;  4RGO S;  2GLS A;  5FK9 C;  2MH7 A;  1UBI A;  3WAP A;  4ZRP A;  2QIL A;  3LXF A;  1P9D U;  2WX1 A;  1F0Z A;  1JWA D;  3A1Q A;  5DPS A;  3I5J C;  2RD0 A;  4PS8 A;  1Z2M A;  2LJI A;  2I38 A;  2LI5 A;  2NBV B;  2YEP B;  1HE8 A;  1M94 A;  2BYV E;  2WDR B;  5BYS A;  2K8H A;  5D3D A;  1MG8 A;  3EFU A;  3RNA C;  3BVZ A;  2KC1 A;  1WRI A;  1TT5 B;  2V1Y A;  2WQY B;  1KLV A;  4RGT A;  3QAQ A;  4TQ0 A;  4GGQ A;  1C1Y B;  2REX A;  2AEH A;  1M4V A;  2KJR A;  1JRO A;  1BUI C;  4UDU C;  3BYT B;  2JQR B;  5JHA A;  3Q8C A;  3R66 C;  2G1E A;  5LXI B;  1B1Z A;  5DPT A;  2WP9 B;  3QIJ A;  3DVG Y;  4HK2 A;  1YQB A;  4HCN B;  1XLN A;  2H88 B;  1UWM A;  1WGY A;  2LD9 A;  3IT6 B;  1ET9 A;  2IY1 B;  1C3T A;  1SJE D;  3ZNG C;  3ZO5 B;  3KWV A;  5E6P A;  3PT2 B;  1AAR A;  2N9P C;  4WJN A;  3BVG A;  2KKC A;  3SFD B;  2BQQ A;  1J7B A;  5EE3 A;  4W9K A;  4ZRK A;  3A9J A;  1YQ3 B;  4FJY A;  1GAQ B;  3Q6B A;  4TQ1 A;  3NUH B;  3VVW B;  3AE7 B;  1QOG A;  3BK1 A;  1XO3 A;  2WNM A;  4EZJ A;  5G55 A;  1P0R A;  3CMM B;  1QOF A;  2M17 A;  2O2V A;  2PE6 B;  3P42 A;  2PW9 A;  4A3O A;  3OLM D;  4B0E A;  4YTM B;  3AEC B;  4DDG D;  2MW5 A;  1V9J A;  4C4V A;  4GU2 A;  3GP7 A;  1JWM D;  1FNW A;  1TTN A;  5H92 C;  2RPV A;  5IN7 A;  4W9G A;  2W3R A;  3X0W A;  1R4M I;  1IGC A;  1YN5 A;  2MBO A;  1ZDX A;  4A9A A;  1I35 A;  4W9J A;  4DHJ D;  3Q8A A;  3DQV A;  1EU3 A;  3W1S A;  5T8I A;  2JF5 A;  4BOS C;  2KMA A;  2WLB A;  4IOI E;  3R7Q A;  1FPY A;  2KVZ A;  2KK8 A;  4MSM B;  3WAO A;  3SFE B;  1HZ5 A;  2LFI A;  5H8Y E;  1QQR A;  4ZYS A;  4FHK A;  4FAD A;  5EDS A;  3OG5 A;  1ZXH A;  4MM3 A;  2M0X A;  1SB3 C;  4LNN A;  5HKH A;  2O6V B;  1HTO A;  4GB9 A;  2V0G A;  4NJ6 A;  3B0A A;  1JWB D;  3OJ4 B;  3B1L X;  1TY2 A;  3U7Z A;  1GNU A;  2BGF A;  1IBX B;  3ML9 A;  2JZZ A;  4LNF A;  4S0R A;  3H8H A;  5D6J B;  2KDM A;  1PUT A;  1N62 A;  5CHW A;  3L13 A;  2LGX A;  2KQ4 X;  3VQI A;  1PFD A;  4C00 A;  3D32 A;  5KHO A;  3TEZ A;  1JML A;  3VH3 B;  2K6Q A;  1YJ1 A;  3FAH A;  4TSS A;  3VFK A;  3AE9 B;  4W9C A;  4FUL A;  4HDQ A;  3FIL B;  1CZP A;  1WGK A;  2N7E A;  2GI9 A;  5JHB A;  1QLB B;  2CS4 A;  1QOB A;  3NHE B;  4MAC A;  4YSX B;  1E8X A;  4RGM A;  2LGI A;  2KQS A;  3NG0 A;  1EU4 A;  2W54 A;  2B76 B;  2ONQ A;  1KLG D;  1WRD B;  3H7P A;  2MP2 A;  3PHW B;  5FKA C;  1NYR A;  3JW0 X;  1B9R A;  3HK0 A;  5I4D A;  3SR6 A;  1WYW B;  1QZE A;  3AEG B;  4DXF A;  2FAZ A;  3N3K B;  3AE3 B;  1HEZ E;  2KX3 A;  1YX6 B;  4XDD A;  4AUQ C;  1I4Q A;  4LNO A;  2WXH A;  2KOX A;  2Z8L A;  4JGH B;  2BYF A;  3ALB A;  4G50 A;  1XD3 B;  3N20 C;  1CQV A;  3ZRF A;  4E3C A;  2N9K A;  1YIW A;  3VAW A;  2JRH A;  1BXT A;  1N60 A;  1SJH D;  3TIX A;  4DXA B;  3AUL A;  1PQS A;  1GPX A;  2PJH A;  2Y5P A;  4G3X B;  3KUD B;  2KFJ A;  2AWT A;  1WI0 A;  1LM8 B;  2WX0 A;  3WAN A;  3DWM A;  4TV3 A;  2IGG A;  2D07 B;  4AWJ A;  1SIF A;  1V86 A;  3ENE A;  3P2B A;  4MJS A;  3N1Y C;  2Y5C A;  2LWP A;  2CU1 A;  1WM3 A;  3W5U B;  4KDL B;  1R4M B;  3GE3 C;  5BMG A;  4KVG B;  4MH8 A;  1WF9 A;  5IA7 A;  3Q3F A;  4HJK A;  3P4S B;  4IC7 B;  3UQB A;  4JL9 A;  3RCZ A;  2K5P A;  2IJ0 A;  2K25 A;  1YX5 B;  2KO3 A;  3RZF A;  3M3J A;  4XZ4 A;  2NPT B;  3NRZ A;  3NVV A;  3Q2A C;  1N5W A;  2WDV B;  2WXG A;  1Q0W B;  3ZXV A;  1XLP A;  2JU6 X;  1XLO A;  4MEM A;  4TUU A;  1Q1O A;  2GBK A;  4MGY E;  1FEH A;  4GXB A;  5J17 A;  1C76 A;  1RLF A;  3ZJT A;  2IYD B;  3A1Q B;  2DNF A;  1MG4 A;  1GB1 A;  3ZIM A;  2NTS A;  3DOW A;  2PEA A;  2IGD A;  1L7Y A;  2G45 B;  3PS6 A;  4FLH A;  1L4Z B;  4FN2 A;  1QKZ A;  4IG7 B;  3URY A;  4IWQ A;  2WGS A;  1WSP A;  3SEB A;  1IUE A;  1NEK B;  4PS3 A;  1V80 A;  4A90 A;  2XEW A;  2HJ1 A;  1E0Z A;  2PVG C;  1C4A A;  1OQR A;  3NVZ A;  3DBR I;  3C8Y A;  1ZPS A;  4IM0 A;  1IBX A;  4NAW A;  3AE1 B;  2KTR A;  5CHF A;  1OEY J;  1TJE A;  2WS3 B;  3RI7 C;  1XLQ A;  1C4C A;  5D7G A;  2XN9 C;  4BOZ B;  3IAM 1;  1FFV A;  4NAM A;  2PVO D;  3N32 A;  3SHQ A;  4W9F A;  3T3N A;  2ZVN A;  5G5H A;  2KDI A;  2JYT A;  3SD5 A;  2MJD A;  4XE0 A;  4OW0 A;  4JWS C;  1IPG A;  1WJ6 A;  4L2Y A;  2IGH A;  2MJ3 A;  3A9J B;  1I4G A;  2N4F A;  4ZOH C;  2R61 A;  1QF6 A;  2HE7 A;  2KVR A;  2K8B A;  2E6X A;  3T8M A;  1TBE A;  3KW5 B;  5GMV A;  1UNS A;  4AQ7 A;  1IGD A;  1RYJ A;  2G4S A;  3DBL I;  1JWU D;  4QAY A;  2O2V B;  3ZGZ A;  2D11 A;  3W1Y A;  4XX5 A;  2V4I B;  4WIP A;  2YLM A;  1RAX A;  4FJZ A;  3A33 B;  4NJC A;  1R4N I;  5C1Z A;  1MFW A;  2K8C A;  2FE8 A;  4RF1 A;  3PVL A;  5J18 A;  4II3 B;  1VLB A;  2MJE A;  4C4V B;  4C56 C;  3EHV A;  2LUM A;  1GB4 A;  4BFR A;  2LGY A;  2C60 A;  4W9E A;  2IY0 B;  1YN4 A;  4JX1 C;  1RM6 C;  2L00 B;  1ZE3 D;  3AB5 A;  3PV1 A;  3K9P B;  1L2N A;  3PRM B;  5AUI A;  3P1M A;  4EUT A;  4K3C A;  4E71 A;  2MRP A;  4N58 A;  4WWP A;  4MM3 B;  4KZC A;  3A4S C;  3VH4 B;  3QC8 B;  2BWF A;  1ZUD 2;  4OZA A;  3BYY B;  5E6O A;  4AJY B;  1SE3 A;  1UBQ A;  3GB1 A;  5BMH A;  2ASQ A;  4OVZ A;  1LO5 D;  2QIE B;  4F7Z A;  5DPW A;  3L08 A;  4LJO B;  3RNB C;  3RMK C;  1ENF A;  4O1N A;  5L83 A;  2NPT A;  4DHJ B;  3TBL D;  1V5O A;  4DK5 A;  4M8N A;  4KKI A;  1TS2 A;  3UI3 A;  2KMM A;  3EFC A;  4MDK E;  1EWY C;  1YNT E;  2J52 A;  2V4L A;  2DEN B;  2W55 A;  2BYE A;  3NZU A;  1WR6 E;  4R3D A;  1I7H A;  1N6Z A;  4PYU A;  1JWS D;  1T0S C;  1U4A A;  1SGH A;  2QHO A;  3PZ8 A;  4N6E B;  2MBB B;  3L16 A;  3V6C B;  1G6J A;  1WR1 A;  3MHS D;  4H2A A;  4HKZ E;  5D2M B;  4XYC A;  5LLI A;  2JZ3 B;  2ACZ B;  3MJW A;  2EKI A;  3PGE A;  3SU8 X;  3JSV B;  3DBR B;  4BZA A;  3GOE A;  5BO4 B;  2GBR A;  2WXN A;  1D4B A;  5D3I B;  4II2 B;  5FR6 A;  4IW0 A;  1FXT B;  3IAS 1;  2N9X A;  1V6E A;  4ANV A;  4DWF A;  2CHW A;  2EKE C;  1WIA A;  2BKR B;  1F2R I;  3GS2 A;  2C5L C;  3H7P B;  2MP2 B;  5G2N A;  4IUM B;  3ZQ4 A;  2ZW1 A;  1C77 A;  1N5X A;  4K7U A;  2BTE A;  2AQ2 B;  3ZNI D;  4A20 A;  1GJZ A;  2OED A;  2TSS A;  2OOB B;  2ZPY A;  1F1H A;  1KTK A;  2C7M B;  2WXL A;  3AE4 B;  3A4R A;  4BKS D;  1NYQ A;  1WJN A;  2WXM A;  2KAN A;  2D5G A;  2BKF A;  3BWU D;  3AEE B;  3KUC B;  3IFW B;  4CHK A;  1SIJ A;  1FNU A;  2DYO A;  2N1W A;  1C79 A;  3DBL B;  4C80 A;  4YWG G;  4GIV A;  2K6D B;  1WXQ A;  3AEB B;  4GDK B;  3ZTD A;  3NJT A;  4KV2 A;  1JAL A;  1E6E B;  3S2A A;  1E8Y A;  3ZNH B;  1SEB D;  2KN4 A;  3N30 A;  4XGA B;  3WAL A;  3KYD D;  1C78 A;  2IPK D;  3MTN B;  3RNF C;  4MJS B;  1L0Y B;  2LVP A;  1FFU A;  2HDE A;  3IXS A;  3HM6 X;  3DHH C;  3MC9 A;  4RMA A;  5LXH A;  2D3G A;  4LDT D;  1SXT A;  1HA5 A;  3P63 A;  3MJ5 A;  3ZJU A;  1H8C A;  4NZL B;  4B6W A;  1V1P B;  4AOF A;  1V8C A;  4YTP B;  3V05 A;  3VR8 B;  1WZ0 A;  1SE9 A;  1NDD A;  3IVF A;  2RDB C;  1P3Q U;  3AMZ A;  1Q5W B;  2DX5 B;  1NEN B;  2FUG 1;  2OJR A;  4W9D A;  3WAM A;  4BKG A;  2DWQ A;  1F2R C;  3V60 A;  2VH2 A;  3ECI A;  2V3N A;  5BYQ A;  4AS1 A;  5CHV C;  4OZB A;  1P98 A;  1KLU D;  1FXI A;  1FRD A;  3ZUN A;  2MWS B;  1P1A A;  1DOI A;  2KLG A;  2KX0 A;  3TEY A;  4WQO B;  4IWO A;  4L1B A;  1LGR A;  3HUI A;  2BYT A;  3N1X C;  2DBY A;  4RNA A;  4US8 A;  4WJP A;  2FBW B;  3DHI C;  4YL8 A;  3DDC B;  1TY0 A;  1VZ7 A;  2V9H A;  2AL3 A;  1YOV B;  3AXC A;  2L0T A;  3ZRC A;  3RD2 A;  4EEW A;  4NAW B;  4WJO A;  3AU5 A;  3DHG C;  3HIZ A;  3P4R B;  2KTR B;  4ZRI A;  3CWI A;  1GC7 A;  4I6N B;  4K1R B;  4CYE A;  1WXA A;  2INP E;  4A8X C;  1YJI A;  2XK5 B;  3EUB 2;  2QCZ A;  3CIR B;  4MEL A;  3B2F A;  4KDI C;  1XQQ A;  1KOT A;  1GG3 A;  1PGA A;  2J0J A;  3R2I A;  2M56 B;  2A4Z A;  2DLB A;  3ONS A;  2I1J A;  3JYU A;  1FM0 D;  3JSV A;  3DVG X;  2KWU B;  3IBE A;  3BVM A;  2KDF B;  3RPF C;  3NOB A;  2W3S A;  3PTF C;  1ESF A;  2YEP F;  4BAX A;  1LXD A;  3BZD B;  1VDV A;  3LDZ E;  2AQ3 B;  3VTV A;  3ETR A;  2AYO B;  1MHX A;  3H9D A;  3RUL A;  2CKH B;  2KLC A;  3RYT A;  1FD6 A;  3C0R B;  4B9K A;  1WE6 A;  2N9E B;  5AZH A;  3ZW3 A;  4LTU A;  4G11 A;  1D3Z A;  1JRP A;  3PLU A;  4FA6 A;  3L10 B;  2A5U A;  1DOX A;  2IND C;  2LEK A;  2NR2 A;  2MQJ A;  3PO0 A;  4DQO C;  2VZK D;  2D10 A;  3DBH I;  1UH6 A;  2KQ7 A;  1A5R A;  3QX1 A;  1J19 A;  2IO1 B;  4KZ0 A;  1WX8 A;  2UU7 A;  5IKC M;  4ZDV A;  3KUZ A;  1CMX B;  1N61 A;  2JXT A;  3VUY A;  1JRU A;  3NZS A;  3QQ8 B;  1KRH A;  1ZDV A;  2M8S A;  3VRA B;  2AX5 A;  1YJJ A;  1WWT A;  2WXI A;  1AWD A;  4LLG M;  1V97 A;  4RM9 A;  4GDK A;  2BS4 B;  3RNG C;  1TS4 A;  2KAC A;  3RT3 B;  4ZHO A;  2EMS A;  2KNB A;  4WJQ A;  2DAJ A;  3U7D A;  2IO3 B;  4JE3 B;  2LZ6 A;  4Q2J A;  4F8C B;  1Y8R C;  1YD8 U;  1R7S A;  2R2O A;  4WUR A;  3SDL C;  3Q8B A;  2K22 A;  4PS7 A;  5MPO A;  4KGR A;  4M01 A;  4HRS A;  3APF A;  3ZXR A;  1Y56 A;  3P4P B;  2D3B A;  2C7H A;  3U30 A;  2L76 A;  1EUV B;  1D5Z C;  1WJU A;  2RMM A;  3AEF B;  2HD5 B;  1TIF A;  3TJP A;  1ACC A;  1F9J A;  1DYQ A;  1VR9 A;  1I4R A;  4XDC A;  4CO7 A;  4GSW A;  2ZCC A;  3QK0 A;  4EZL A;  5FR3 A;  2N9L A;  2JT4 B;  1XXG A;  1V1P A;  2K0P A;  4MSQ B;  1D5M C;  1L5P A;  4KIK A;  2DZM A;  3ZTC A;  3VHT C;  4KGS A;  2M0A A;  1I4P A;  4JIO U;  4HRO A;  1L6U A;  1RFA A;  4NQK E;  3KYC D;  1XF5 L;  1Q10 A;  3WCQ A;  3RNC C;  4A3P A;  4A55 A;  1PGX A;  4M0W A;  2BT6 A;  3JVZ X;  1KF6 B;  2N0S B;  2FCS A;  4IM2 A;  1J7A A;  3MC8 A;  2RSU A;  3P4Q B;  2LGS A;  2KFK A;  1WMH B;  3QAR A;  3EA6 A;  1T3Q A;  3H7S A;  1YMH E;  1TKG A;  4P7I A;  3QWZ B;  1J7C A;  3AE5 B;  4LNI A;  4MT5 A;  2J7Q B;  2MX2 A;  4HVB A;  3ZVV A;  4ZHP A;  2I2Y A;  1V2Y A;  3LJ3 A;  1NI3 A;  4P1C C;  4PK1 A;  4P6V F;  2QSD A;  2MA9 B;  2FNJ B;  3AE8 B;  1PYW D;  2XK5 A;  4OHJ A;  2LJ5 A;  3L54 A;  1MJD A;  3AI5 A; 
#chains in the Genus database with same CATH homology
 2W3R A;  3PZ8 A;  4N6E B;  1IGC A;  1YN5 A;  1ZDX A;  4A9A A;  2XNA C;  1FIQ A;  3U2S C;  1DOY A;  1BML C;  1AN8 A;  3Q8A A;  4H2A A;  1EU3 A;  3W1S A;  5T8I A;  4HKZ E;  2CJN A;  1K53 A;  2ACZ B;  2E3T A;  1T6B X;  2WLB A;  4IOI E;  1VRA B;  2EKI A;  2HTM E;  2RDH A;  4ZRQ A;  1HZ5 A;  3SFE B;  3E56 A;  3KLS X;  2LFI A;  5H8Y E;  2WXN A;  3TUO A;  1D4B A;  5D3I B;  1MVK A;  1QQR A;  3IAS 1;  4ZYS A;  4XWW A;  4KGT A;  2WU2 B;  2L1A A;  1ZXH A;  2Q5W D;  1F2R I;  2NTT A;  1SB3 C;  3GS2 A;  5HFY A;  1OFF A;  2WXP A;  3ZQ4 A;  2ZW1 A;  5EE1 A;  1C77 A;  1N5X A;  5HG2 A;  3AE2 B;  4YT0 B;  2V0G A;  4IDI A;  2BTE A;  1K50 A;  1EWC A;  1PDX A;  2AQ2 B;  1JWB D;  5AUK A;  4WQM A;  2PKO A;  1TY2 A;  3PZ7 A;  3U7Z A;  1TYG B;  2CU3 A;  2OED A;  3KWL A;  2TSS A;  2LHE A;  1IBX B;  1KTK A;  2QJL A;  2WXL A;  3H8H A;  3W2D A;  1FNV A;  3AE4 B;  3MHZ A;  1NYQ A;  2WXR A;  2WXM A;  2KDM A;  4ITK A;  2D5G A;  1PUT A;  1JQ4 A;  2BS3 B;  3BWU D;  3AEE B;  1N62 A;  2J42 A;  3AM9 A;  1FCL A;  1SIJ A;  2KQ4 X;  1FNU A;  2DYO A;  1C79 A;  3VQI A;  4C80 A;  1N63 A;  1PFD A;  1STE A;  3TEZ A;  1JML A;  4YWG G;  4YXD B;  3OWE B;  1I4X A;  2BB6 A;  3R2T A;  3Q69 A;  1ROE A;  1WXQ A;  3AEB B;  4GDK B;  1JAL A;  1E6E B;  3FAH A;  4TSS A;  2KWD A;  3AEA B;  1SEB D;  3AE9 B;  3B2G A;  1ET6 A;  2KN4 A;  3EGR A;  4OZC A;  2QEJ C;  3FIL B;  1CZP A;  1WGK A;  2PTL A;  3U4E G;  1WYG A;  2GI9 A;  1QLB B;  1QOB A;  1C78 A;  2IPK D;  2PIA A;  1YN3 A;  3I9V 1;  4MAC A;  4YSX B;  4GLS C;  5BYR A;  1L0Y B;  3VR9 B;  4RGM A;  2LGI A;  1VZ8 A;  1FFU A;  1EU4 A;  2HDE A;  1TS3 A;  2W54 A;  3IXS A;  2B76 B;  2ONQ A;  1KLG D;  1SBB B;  1FCC C;  1SXT A;  1HA5 A;  4IKG A;  5FKA C;  4P16 A;  1NYR A;  4J3O D;  1ZOY B;  3P63 A;  3MJ5 A;  1B9R A;  3ZJU A;  2Y3A A;  4NZL B;  3NZ3 A;  5I4D A;  4TMA B;  3SR6 A;  1V1P B;  1XEE A;  2BW2 A;  3AEG B;  4DXF A;  3ZJV A;  1V8C A;  4YTP B;  2WXO A;  3AE3 B;  4WH4 A;  2WXF A;  3V05 A;  1ZXI A;  3VR8 B;  1HEZ E;  4XDD A;  1I4Q A;  1PGB A;  1JW9 D;  2WXH A;  2Z8L A;  1FO4 A;  4RCO A;  4LK0 M;  4C7Z A;  3AMZ A;  1CQV A;  2BB5 A;  2G9H D;  2N9K A;  2PLP A;  4KX6 B;  1K51 A;  1NEN B;  1BXT A;  3AH7 A;  2FUG 1;  1N60 A;  1SJH D;  3TEW A;  4FXC A;  2DWQ A;  1F2R C;  1EM7 A;  2M19 A;  3NVY A;  2L32 A;  2ON8 A;  2V3N A;  2L52 A;  5BYQ A;  3BK2 A;  2V3P A;  4AS1 A;  2CJO A;  1XCT L;  4OZB A;  1KLU D;  1NVI D;  1FXI A;  2MEK A;  1FRD A;  3IT4 B;  1GPX A;  2Y5P A;  1DOI A;  1ZP0 B;  3I57 A;  3TEY A;  3FIL A;  3L4P A;  2SEB D;  3DWM A;  2IGG A;  4L1B A;  5BMI A;  3HUI A;  4YTN B;  5HI1 A;  2BYT A;  4GDL B;  2DBY A;  1TKE A;  2SAK A;  2Y5C A;  4RNA A;  4US8 A;  1SE4 A;  3W5U B;  2OHF A;  1VZ6 A;  2FBW B;  5BMG A;  3Q8E A;  3N9Y C;  4MH8 A;  1MI0 A;  1TY0 A;  1VZ7 A;  4B0M A;  1HZ6 A;  3P4S B;  3B9J A;  5E6J A;  2K5P A;  2IJ0 A;  2K3U A;  2KAJ A;  4REZ A;  1SE2 A;  3W5V B;  4NAW B;  1SSN A;  3HVZ A;  3NRZ A;  3P4R B;  3NVV A;  1E9M A;  1N5W A;  3CWI A;  5C2T B;  3VRB B;  2X38 A;  2WDV B;  1HXY D;  2WXG A;  2INP E;  4A8X C;  2LHD A;  2ZW0 A;  1VJK A;  1MHH E;  3LB8 C;  1YJI A;  3EUB 2;  1L0X B;  5EE9 A;  1XLP A;  2JU6 X;  1XLO A;  2LMC A;  3AE6 B;  3CIR B;  4WAF A;  3B2F A;  1F77 A;  1FEH A;  3DWG C;  2RDG A;  3W9C B;  4RH6 A;  1PGA A;  1C76 A;  4HEA 1;  3T3O A;  3NS1 A;  3V3X A;  2N7J A;  3R2I A;  4C7Y A;  1FRR A;  1UGJ A;  3ZJT A;  1TS5 A;  2M56 B;  2DLB A;  4HKQ A;  1AW7 A;  1A70 A;  1FM0 D;  3HVD A;  2H89 B;  3TSS A;  3BVM A;  1P7E A;  3RPF C;  2VZK B;  5HHD G;  2W3S A;  1K52 A;  1ESF A;  2YEP F;  5EE0 A;  1GB1 A;  3BZD B;  1VDV A;  3RFZ B;  2AQ3 B;  4RFB A;  2NTS A;  2BS2 B;  1D5X C;  3BII D;  4JPS A;  3ETR A;  1MHX A;  1V1O A;  2IGD A;  4D2K A;  2JYE A;  2WXQ A;  5C3J B;  1FD6 A;  1L4Z B;  2L83 A;  1QKZ A;  1L6V A;  2K9X A;  4LTU A;  3URY A;  1E10 A;  5GXG B;  1FXA A;  1WSP A;  1JRP A;  3SEB A;  1IUE A;  3AN1 A;  1NEK B;  3FC4 A;  2EEL A;  1D6E C;  1DOX A;  4A90 A;  2LEK A;  1E0Z A;  5LNK 1;  2PVG C;  2INN E;  3PO0 A;  2JWU A;  3MC0 B;  1FMA D;  1C4A A;  1OQR A;  1OQQ A;  2J4X A;  4DQO C;  2VZK D;  3NVZ A;  1E7P B;  4RF0 A;  1C9F A;  3C8Y A;  1ZPS A;  1IBX A;  2AQ1 B;  3AE1 B;  4RGN A;  3KQ4 A;  4WWM A;  1GOZ A;  4ARI A;  4EE2 A;  1N61 A;  3HRD D;  2JXT A;  3LYY A;  1KRH A;  1ZDV A;  3AV8 A;  1TJE A;  1HQR D;  1C4P A;  2WS3 B;  3VRA B;  1KH0 A;  2AX5 A;  1XLQ A;  1C4C A;  1YQ4 B;  1SF0 A;  3NVW A;  5D7G A;  1YJJ A;  2XN9 C;  1L0V B;  2IDY A;  3IAM 1;  1KFY B;  1WWT A;  1FFV A;  2WXI A;  1AWD A;  4JWU C;  1V97 A;  1QOA A;  2PMV A;  2PVO D;  4LLG M;  4NAM A;  4YSY B;  3E9S A;  3R8B A;  2BS4 B;  2J53 A;  1TS4 A;  2GRI A;  4RGO S;  5G5H A;  5FK9 C;  3T3N A;  2KAC A;  2MH7 A;  4ZHO A;  2JYT A;  2MJD A;  4XE0 A;  4OW0 A;  4ZRP A;  2QIL A;  4JWS C;  3LXF A;  4JE3 B;  4L2Y A;  2IGH A;  4Q2J A;  1F0Z A;  2MJ3 A;  3Q8F A;  1JWA D;  1R7S A;  4ARC A;  1I4G A;  4WUR A;  4ZOH C;  2R61 A;  1QF6 A;  1RWS A;  3J9C A;  1P7F A;  2LJI A;  2WXK A;  2K22 A;  3Q8B A;  5MPO A;  1UUP A;  2I38 A;  4KGR A;  4HRS A;  2E6X A;  2YEP B;  1Y56 A;  3P4P B;  2QMT A;  1UNS A;  3MFG A;  2ICI A;  4AQ7 A;  1CK1 A;  1IGD A;  1RYJ A;  1JWU D;  2WDR B;  1D5Z C;  5BYS A;  5D3D A;  2RMM A;  3ZGZ A;  2WDQ B;  3AEF B;  1QIL A;  3ZYY X;  2DYM A;  2V4I B;  1ACC A;  3BVZ A;  1WRI A;  1DYQ A;  4WIP A;  1VR9 A;  1I4R A;  2WQY B;  4XDC A;  3U52 E;  4US9 A;  5FR3 A;  2N9L A;  4NJC A;  4RGT A;  1XXG A;  3ABV B;  1V1P A;  1QT9 A;  2FE8 A;  2K0P A;  4RF1 A;  4TQ0 A;  2BBC A;  1D5M C;  1L5P A;  3TEX A;  1M4V A;  1VLB A;  1I4H A;  2MJE A;  4KGS A;  2M0A A;  1I4P A;  1JRO A;  1L4D B;  1BUI C;  2JX5 A;  4HRO A;  4C56 C;  4UDU C;  1L6U A;  3BYT B;  2JQR B;  1MPE A;  4A6Q A;  2LUM A;  3Q8C A;  5G5G A;  2G1E A;  1UWX A;  1GB4 A;  1B1Z A;  2WP9 B;  4XWT A;  1YN4 A;  4JX1 C;  1XF5 L;  1Q10 A;  1XLN A;  3MP9 A;  1RM6 C;  2GB1 A;  2H88 B;  3WCQ A;  1AYF A;  4A55 A;  1PGX A;  1UWM A;  4HJG E;  4M0W A;  2NMQ A;  1ZE3 D;  2BT6 A;  3IT6 B;  1KF6 B;  1RFK A;  1ET9 A;  2N0S B;  4L23 A;  3AB5 A;  1J7A A;  1SJE D;  3KWV A;  5AUI A;  3P4Q B;  3BVG A;  1T5X D;  3P1M A;  1TKY A;  3SFD B;  1J7B A;  5EE3 A;  4CQN A;  4N58 A;  1YQ3 B;  1GAQ B;  4N59 A;  4TQ1 A;  3EA6 A;  4MM3 B;  3NUH B;  1JCK B;  1T3Q A;  1TZO A;  3AE7 B;  5JXV A;  1QOG A;  1YMH E;  1TKG A;  2W82 A;  3BK1 A;  1XO3 A;  2WNM A;  1ZUD 2;  4DXG A;  4OZA A;  3BYY B;  1J7C A;  1SE3 A;  3GB1 A;  3AE5 B;  5BMH A;  4OVZ A;  1LO5 D;  2QIE B;  4MT5 A;  1QOF A;  2JZP A;  4KKJ A;  3P42 A;  1XCQ L;  1ENF A;  4ZHP A;  4PT5 A;  2I2Y A;  2PW9 A;  4O1N A;  2JSV X;  1NI3 A;  4B0E A;  5TSS A;  4YTM B;  4P6V F;  3AEC B;  4KKI A;  1TS2 A;  2WU5 B;  3AED B;  3O13 A;  2QSD A;  3UI3 A;  2KMM A;  2WXJ A;  4USA A;  1EWY C;  3AE8 B;  4YSZ B;  1CJE A;  1YNT E;  2J52 A;  1PYW D;  2W55 A;  3GP7 A;  4OHJ A;  1JWM D;  4R3D A;  1FNW A;  1I7H A;  1JWS D;  5H92 C;  1DGJ A;  2RPV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...