4NZLB

Extracellular proteins of staphylococcus aureus inhibit the neutrophil serine proteases
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
98
structure length
96
Chain Sequence
KHTVPYTISVDGITALHRTYFVFNKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Neutrophil elastase
publication title Staphylococcus aureus secretes a unique class of neutrophil serine protease inhibitors.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 29
structure length 96
sequence length 98
ec nomenclature
pdb deposition date 2013-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03642 MAP MAP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4nzlB00
1TS4A 1AW7A 1ESFA 1SEBD 1UUPA 3EA6A 1SE4A 1I4PA 2J4XA 2RDGA 3MC0B 1D5MC 1JWSD 4RGTA 1BXTA 1HXYD 1D5ZC 1SJHD 3KLSX 3OWEB 3BZDB 1LO5D 1D6EC 4NZLB 1YN4A 1L0YB 4DXGA 5D3IB 1JCKB 1DYQA 2Z8LA 1ET6A 3GP7A 3BVZA 2SEBD 3BYTB 5D3DA 2IJ0A 1JWUD 4RCOA 1SJED 1F77A 2XN9C 3SEBA 3R8BA 2AQ1B 2TSSA 3O13A 4UDUC 1V1OA 4OHJA 1TY2A 2ICIA 5FKAC 1TS5A 2QILA 3BYYB 2RDHA 5FK9C 1HA5A 1T5XD 4C56C 3R2IA 3URYA 2R61A 3R2TA 4ZYSA 2NTTA 1B1ZA 1FNWA 1GOZA 3BVGA 1I4QA 2G9HD 4RFBA 1CQVA 1I4HA 1STEA 1XXGA 1V1PB 4RH6A 1UNSA 1SE2A 1D5XC 3BVMA 5TSSA 1SBBB 2AQ3B 3W2DA 1I4GA 1I4RA 1KLGD 4RGMA 4O1NA 3TSSA 1FNVA 4TSSA 1AN8A 1SXTA 4RGNA 3V05A 1JWMD 1PYWD 1CK1A 1KLUD 1ENFA 1M4VA 1TS2A 3MFGA 5I4DA 4DXFA 2XNAC 1V1PA 2AQ2B 1L0XB 1FNUA 1YN5A 1I4XA 2QEJC 1ET9A 1SE3A 1TS3A 1TY0A 2NTSA 4RGOS 1EU4A 1YN3A 1KTKA 1QILA 1EU3A 2IPKD 1HQRD 1EWCA
chains in the Genus database with same CATH superfamily
2OEDA 4FA6A 2KWVB 3PZ8A 2BVCA 2C9WB 4ZRQA 2PVGC 4M8MA 1NEKB 1YQBA 5T8IA 2L7RA 4MELA 1XO3A 2KNBA 1JMLA 2DLBA 4NZLB 1YN4A 2KWCA 5L83A 4BZAA 2LI5A 3B08A 4K7WA 3I57A 1EM7A 2IJ0A 4QAYA 1D4BA 4MH0E 1RLFA 1WFYA 3O13A 3RYTA 1FXTB 1IBXB 2MBEA 2BGFA 1FIQA 4USAA 4IWOA 2GBJA 3UQAA 2RD0A 3SFDB 4FADA 5DPRA 2G45B 2JUOA 4ZRKA 4WJPA 3B2GA 3P4SB 1WR1A 1U4AA 1P7FA 1VDVA 2WXJA 4NY0A 4MSMB 3TJPA 2KWDA 2V4LA 1B9RA 3M3JA 2MJ3A 3DVGX 3VRAB 1SE9A 4MM3B 2PTLA 1TIFA 1ZW7A 2KX3A 2O6VB 5BYQA 4YSXB 2MJEA 2BF8B 3V05A 3FILA 1I7HA 2C60A 1N63A 1TTNA 2B76B 3PREA 1T0QC 3RNCC 5DPTA 1OQYA 4HDQA 2E3TA 1WXQA 3OJ3A 2DAFA 4NJCA 2WXGA 4GLSC 3ZLZA 3MJWA 1VJKA 3EECA 4ZOHC 3HVZA 1ZGUB 1TS3A 1SE3A 4HCPB 1G6JA 2QIEB 2JRIB 4LNIA 3VDZA 1KTKA 1L6UA 1MHXA 4B95A 5E6OA 4W9DA 3W5UB 1WX8A 4YTNB 3U30A 4AQ7A 2KXJA 1WYGA 2BWES 4P7IA 3J9CA 3AE7B 1D5ZC 1JW9D 1NENB 3BZDB 4B6WA 3PPAA 2JX5A 4D2KA 3BVZA 4E71A 3H7PA 3BINA 3V6CB 3Q8CA 3PRZA 1GNUA 1E10A 3DOWA 2M1MA 2LJ5A 2DZJA 2ICIA 3ZJVA 3DVNU 4HRSA 3MHZA 1P98A 1IP9A 3OAWA 1IGCA 3O65B 2KT7A 2LUMA 2NR2A 1R7SA 4HKZE 4IM0A 4M8NA 1XXGA 2GMIC 4KV2A 1QKZA 5IKCM 2WXLA 1DGJA 3VH4B 4K81A 3KUDB 1K53A 4WQOB 1J19A 4RGNA 2FIFA 1HEZE 3PLVA 5AUKA 4MGKE 3U52E 4DHJD 4AJYB 4ZHPA 1WJUA 4JLCA 1XF5L 2WXMA 1AARA 3PVLA 1BUIC 1UWMA 3Q6BA 1TY0A 4JL9A 3L13A 1R4MB 3HK0A 2BS2B 4RFBA 3C8YA 1EO6A 1ESFA 3AULA 2CKHB 1UUPA 2K6QA 1OQQA 2BWFA 4BBNF 3QJZA 2INCC 2KDMA 3EC8A 1WGKA 1GAQB 2X38A 3VR8B 2LMCA 2BYVE 4K3CA 2A4ZA 4I6PA 4MACA 5LLIA 2LGYA 4ZYNA 2KTRB 1ET6A 3K9OB 1HTOA 3NS8A 1N60A 4A3OA 3GZNI 3SEBA 1TKGA 4WIPA 3ZVVA 1YJJA 3U4EG 4WQMA 4MH8A 1IPGA 5AUIA 1Q1OA 2D3GA 3VHTC 3BYYB 1Y56A 3ZNID 3T8MA 2LHDA 4FN2A 4M02A 1V5OA 4FJVB 1MI0A 3TEXA 2GLSA 2G9HD 3CIRB 2KO3A 3AU4A 2AL3A 2MEKA 1EUVB 1M94A 2CJNA 1HTQA 3ZKJC 5D7GA 1FCLA 2W82A 4EZJA 4WAFA 2I1KA 2O2VB 1H4RA 2KFJA 1WXMA 4HJGE 1VRAB 1PGXA 4IM3A 4B0MA 2WX1A 1TT5B 3NJTA 3A1QA 3L08A 4W9HA 1KFYB 2JQRB 4IC7B 4EZLA 3L17A 1K50A 1WZ0A 2FAZA 4OW0A 2BQQA 1WGGA 2AQ2B 3TCAA 1PQSA 2ZCBA 4URKA 4OZCA 2MJDA 4BOZB 4HEA1 4KGTA 4ZRIA 1SSNA 4FHJA 3RI7C 1UH6A 3P4QB 2RSUA 1KF6B 3VVWB 2L05A 3ML8A 2KX0A 4FULA 2CS4A 3RNFC 1SEBD 1ZPSA 1I4PA 2K8CA 2KQ4X 2FBWB 4FHKA 2KC2A 4C4VB 3AE8B 2YLMA 1D6EC 2FCNA 1XQQA 1QF6A 2G4DB 1JWBD 2J53A 5CTRC 3V3XA 3R66C 1RWSA 2BS4B 1C77A 1C4AA 1E7VA 1E90A 3R3MA 4G50A 3AE4B 4UDUC 3Q8AA 3PTFC 3CSTA 1LFDA 1GC6A 4PYUA 2JYTA 3WA0A 3LJ3A 3RULA 4XE0A 3TIXA 2IBIB 1WGDA 4PS8A 4W9CA 2ZW1A 3IXSA 1L7YA 2OHFA 2QHOA 3U8ZA 1HE8A 1SE2A 3N32A 3ZJUA 1SBBB 1IYFA 4NAWA 4ZDVA 1XCTL 3I3TB 3UF8A 5DPWA 4AUQC 2JT4B 1UBQA 3KWVA 2VH1A 1SXTA 4L2YA 1Z5SB 4F8CB 2I1JA 2ZPNA 2LHEA 3EFCA 2N9EB 4BVUC 1RFKA 2WHIA 2N7DA 2LXAA 4TV3A 1P7EA 4DXFA 2WDRB 2D10A 4DWFA 3IBEA 2BPSA 3LXFA 1F2RI 1FNUA 2GBRA 4AS1A 1QZEA 4N59A 2KLCA 2UU7A 1I42A 3EFUA 2LGXA 3L10B 3CMMB 2MLBA 1J7BA 1R4NB 3SU8X 2KD0A 4TKNA 1YD8U 1N61A 1ZE3D 3PLUA 3Q3MC 1T0YA 1E8YA 1HXYD 2ASQA 5IO9A 3V62A 1ZP0B 4ACFA 3HM3A 2RDBC 1WXAA 3KQ4A 4GOCA 1TZOA 4HK2A 4IM2A 4REZA 3PHWB 1EF5A 3ZUNA 4IDIA 2IY0B 2JZZA 3DHIC 3AEDB 2UYZB 2RGFA 3H1UA 2RDHA 3WANA 1WM2A 3APCA 3N9YC 4NNJB 4Q2JA 2O6VD 1UGJA 2M17A 4WWNA 3B2FA 1L4DB 5CHVC 3RCZA 3AXCA 3PZDA 2LJIA 2MBQA 3VXWA 3UIOB 5C23A 1IGDA 2J0MA 1H8CA 3W1YA 3PRPB 3AECB 3N20C 1V8CA 4G0NB 1P3QU 2J0JA 3Q69A 2BTEA 1GB4A 4LLGM 1ZUD2 3NRZA 2KDFB 1WX7A 4KZ0A 5LXIB 3N1XC 3C0RB 3ZNHB 2LGIA 2KDEB 3C19A 2BKFA 3MTNB 3Q3NC 4BKSD 4MJSA 1M4VA 4NJ7A 1TS2A 2HD5B 3P63A 1FD6A 2N7JA 5IOIA 1OEYA 1P0RA 2JWUA 4CQNA 3V61A 2R2OA 1L0XB 1LXDA 3AI5A 4WAAA 4A20A 3TEZA 2L52A 3QHTA 2KC1A 4M01A 2CR5A 2L8JA 3HUIA 3PV1A 2KLGA 1ROEA 1GJZA 2N9KA 2R2QA 1F2RC 2RR9A 2BYFA 1Q10A 1SJHD 1XLNA 1FRDA 1Q0WB 3ZW3A 4KVGB 2ZCCA 1V6EA 3T3NA 1FM0D 3W9CB 2NPTB 3P42A 1EF1A 1L5PA 1UELA 3VUYA 2VZKB 5JHAA 3RD2A 3BYTB 3LYYA 2LRUA 1HZ5A 1NVID 3R8BA 2ZVNA 2C7HA 1MHHE 2BB6A 4GDKB 4WWPA 4GDKA 4IG7B 4G3XB 2WXHA 1QQRA 2HE7A 5FK9C 4A9AA 1FFVA 1NI3A 2PIAA 4NQLB 3IAS1 1OFFA 4WJQA 4FJZA 2L1AA 1GOZA 5E6JA 1PUTA 3DBLB 2V3PA 1QOFA 1IBXA 4US9A 2M0XA 3TSSA 2KVZA 4ICUA 4I6NB 1CK1A 4C00A 2J7QB 3AE3B 4A8XC 2A5UA 3BK2A 3L0WB 2C7NB 2RMMA 4MGIE 3NY5A 4MM3A 2MHJA 1T6BX 2M56B 2N9XA 4OZBA 1YN3A 5HFYA 2GBNA 2O6VA 1E9MA 2KK8A 4XWTA 3R7RA 3TUOA 1QT9A 3AEBB 2PEAA 4OVUA 4C7YA 4RGTA 4CHKA 3MP9A 2J42A 1FEHA 4RM9A 3N3KB 1V5TA 1FCCC 2Z59B 4DXGA 3A4SC 1JCKB 4IWQA 3DBHB 2K39A 1YJIA 4EEWA 4BKSA 1SJED 4P16A 4XYCA 2CU1A 2IGDA 2OOBB 4DK5A 2KACA 1R4MI 3JSVB 5H8YE 1ISNA 4TQ0A 1T5XD 4YT0B 5J18A 2LVOA 3PT2B 1A5RA 2HTHA 3B0AA 4A90A 2JXTA 2ACZB 4ZRJA 2BKRB 1BMLC 4NPNA 1QOAA 1V1PB 4MGZE 5BMIA 2WXOA 4AP4C 1D5XC 5BYRA 3ZRCA 3AE1B 3W2DA 2N0SB 2MBHA 3P1MA 5D94A 4KDIC 3QA8A 4LNNA 2JXXA 2DYMA 4S17A 2BW2A 1K51A 1WRDB 2KJHB 1KLUD 2NBUA 1N6ZA 4OZAA 3ZXRA 3GOEA 4EOYA 2W9NA 4R3DA 1YN5A 2WYQA 1YJ1A 3NOBA 4K1RB 2KVRA 1LQBA 1AWDA 1WGHA 2FCQA 2KHWB 3VQIA 2V9HA 4M0WB 1XEEA 1E7UA 3H6NA 1V49A 2LGDA 1C1YB 2V3SA 1XD3B 3BY4B 3VTUA 4US8A 2L76A 1YMHE 4J6IA 3PZ7A 4GDLB 4ITKA 2RDGA 2WWZA 1NYRA 4GDLA 1E5WA 3SHQA 3MC8A 2WXNA 5KHOA 3VR9B 2BYEA 2GI9A 3QIJA 1V81A 1ZDVA 1OGWA 3RFZB 2SEBD 4FJYA 4RCOA 2HJ8A 1PFDA 1WJNA 4HPPA 1ZXHA 1RYJA 2NS5A 2GBKA 2PVOD 1JWAD 3H7SA 1WE6A 1DOIA 1RM6C 3RNGC 2JPHA 3TL5A 2K6DB 4W9JA 3URYA 1V2YA 2IO0B 3IG3A 1FFUA 2KTRA 4EZKA 2WQYB 2K22A 1STEA 1K8RB 3GE3C 1MFWA 2NCNA 2PJHA 2JU6X 2AQ3B 3BK1A 5GMVA 3DBRB 3V6EB 4EUTA 4LNKA 2ZZPB 2LD9A 4YTPB 2MP2B 3Q2AC 2WXKA 4JE3B 1UWXA 4FLHA 1MPEA 1D3ZA 2X8XX 2CJOA 2IO2B 2IYDB 3N30A 2K9XA 2DNFA 4GSWA 2XNAC 3AU5A 3UIPB 1FPYA 2KDIA 1GG3A 3HM6X 4KX6B 2HTME 2NTSA 4PS7A 3P2BA 2O2VA 1QILA 4HDOA 3UI3A 1EWCA 1TS4A 1SE4A 2Y5CA 1JWSD 3VTWA 2WU2B 2WX0A 1WH3A 4ANWA 2BS3B 5BMGA 4AOFA 2IY1B 4KSKC 4WJOA 2KMMA 3AM9A 2L32A 3AEEB 2JSVX 2INNE 4KSLC 2M0AA 1UZXB 4X57B 1F77A 1WMHB 3OG5A 1T3QA 1Y8RC 2E6XA 5EE9A 2TSSA 3GE8C 2KJ6A 3ZYYX 1KJTA 2G1EA 4OHJA 4GN1A 5AEKB 5IN7A 2QILA 2IO1B 2B3AA 3N1YC 3SD5A 3LB8C 2AX5A 5AZFA 1R4NI 4TQ1A 4C4VA 2OJWA 3R2IA 4EE2A 4J3OD 1KM7A 1N5WA 3EUB2 3NVVA 3N1ZC 2HDEA 3EGRA 2MA9B 2JZ3B 3DPDA 3AEAB 2RPQA 3AEGB 4MGYE 2I2YA 3QK0A 2AWTA 4HLEA 3KW5B 2YVCA 2XK5B 4RGMA 3ZDTA 2D5GA 1LM8B 4JGHB 2Q5WD 3PHXB 4RMAA 1C9FA 2PE9A 3DBSA 2KANA 3RNEC 3QAQA 3A9KB 2PE6B 2N1WA 2DENB 1GB1A 2N9LA 4DQOC 1XCQL 2MQJA 1EU3A 2VZKD 1HQRD 3KVFB 4YXDB 2ZW0A 4NQKE 1MVKA 5DPSA 1QOGA 4ZRPA 4BFRA 3QC8B 1CMXB 3DCGA 4MT5A 3X23A 4EFOA 4M00A 4IUMB 1LO5D 2KOXA 5D3IB 1V86A 3PSEB 4BBNC 4OVVA 3KUZA 4JWSC 2LRWA 4PT5A 3DWMA 4BKTA 2QC8A 3ML9A 1XLPA 1VR9A 2XN9C 1E8WA 2FNJB 1V1OA 1TYGB 3FAHA 1ZOYB 3A9JB 1BT0A 4ZHOA 2KAJA 3ZJTA 3A33B 2L3ZA 2OJRA 3GB1A 1T0SC 3HVDA 2JYEA 4TMAB 2KZRA 3ZO5B 2BB5A 3W1SA 2DZKA 1SF0A 2NBWB 2ZNVC 4LCDE 1IUEA 2FIDA 1C79A 3BVMA 2D3BA 2EMSA 4I6LB 5AZHA 2JVCA 1MG4A 1I4RA 2QMTA 1F0ZA 3RNAC 1FNVA 3H9DA 1JWMD 4ARCA 2PW9A 3MC9A 2QDFA 1E7PB 5EDSA 4HJKA 3NHEB 4JPSA 5IA7A 2K8HA 2KFKB 2BT6A 5G5GA 2PLPA 2GRIA 3W1SC 2PKOA 2QEJC 4HVBA 2N4FA 3KUCB 3MJ5A 4K3BA 4XX5A 1N62A 1E8ZA 2MRPA 3DBLI 4MDKE 1JALA 5BMHA 2JWZA 1WIAA 4N58A 1A70A 2K8BA 3PRMB 4WURA 4WWOA 4YSYB 3H8HA 3GS2A 4GB9A 2EELA 3L54A 4KDLB 5J2RA 3IFWB 2DYBA 3ZIMA 3RZWC 4C7ZA 3WAPA 1S3SG 2XEWA 1JRUA 1L6VA 2MSED 1C76A 3ZGZA 4RNAA 1S1QB 4YTMB 5FR6A 1GC7A 2LFIA 2L0FA 1OQRA 3IAM1 3QX1A 2AQ1B 4XZ4A 3Q8EA 4KKJA 1ACCA 3L16A 3DHGC 1YOVB 3RUIB 4AJWA 4C56C 4ANUA 2NPTA 5EE3A 2K1FA 2FE8A 2NTTA 1B1ZA 3DDCB 4W9LA 4HWIB 3LDZE 3E9SA 3BVGA 1CQVA 4H2AA 3DBHI 2W55A 1RAXA 3APDA 1L2NA 5C3JB 2NVUI 2KMCA 2QJLA 2WXIA 3ENEA 3HRDD 5HKHA 1VLBA 4CYEA 1RFAA 1T0RC 1JRPA 5JZEB 5BO4B 1VCBA 1TJEA 3MFGA 2K3UA 3AEFB 3U7ZA 1WWTA 3DVGY 3KYDD 1WE7A 3RT3B 4XGAB 2REXA 1J7AA 2NBVB 3ZNGC 3E56A 5G5HA 1RRBA 4JWUC 1TGZB 3BWUD 2IPKD 3ETRA 2LGSA 4YL8A 3JVZX 3MC0B 1CZPA 5CX3A 3VRBB 2JRHA 1EWYC 1FXIA 3OWEB 2QCZA 1SB3C 2C7MB 1TBEA 2C5LC 4DBGA 2IDYA 2Z8LA 1YX6B 3U7DA 5G2NA 1WXVA 1V9JA 4LDTB 1AYFA 2LEKA 2MX2A 2CHWA 1JWUD 3IT4B 2L0TA 1SGHA 3AE5B 3P4PB 4IWPA 4DDID 4KZCA 4XDDA 4P1CC 3Q14C 3NZ3A 3WIMA 5IP4D 2MBBB 4E74A 2IGGA 3FILB 3ECIA 3CF6E 2D3CA 3Q3OC 4IW0A 1KOTA 4N6EB 3NUHB 4WWMA 5D6JB 1E0ZA 2V0GA 1KLVA 1WYWB 2Z0EB 1N5XA 2ZJDA 2N7EA 3T9LA 2DZMA 2FCSA 3JSVA 4W9EA 3NS1A 2W3SA 2DBYA 4YSZB 2WU5B 5GXGB 4S0RA 3RN9C 3APFA 1XLQA 1L0VB 3AE9B 4RM8A 5C2TB 3B9JA 3SDLC 1F1HA 4NAMA 3QARA 3DQVA 1MG8A 2WXFA 2PMVA 1V1PA 1FO4A 4ARIA 1PGBA 5LNK1 2H89B 4XWWA 1I4XA 2M8SA 3L4PA 1NDDA 4C80A 2M19A 2Y5PA 1OTRB 2NMQA 3H7PB 1Z2MA 1HZ6A 4KKIA 3I63C 4HKQA 2MBOA 3ZTCA 4E3CA 4W9IA 4PYZA 3ABVB 2J4XA 5JHBA 2IGHA 3PGEA 2D2QA 1D5MC 3DBRI 5TR5A 1BXTA 2KJRA 5CHWA 4FBJB 2I38A 4W9FA 4JIOU 2Z0DB 1ZDXA 2ZVOA 4W9KA 2KDBA 1L0YB 2EKIA 4IOIE 1DYQA 2INPE 2FUHB 2YEPB 5EE1A 5G55A 2DAJA 4M0WA 2WNMA 3QWZB 2BBCA 1F52A 3AB5A 5HG2A 3ZXVA 1XT9B 4ANXA 5LXHA 4JQWC 5HHDG 3IT6B 3NVWA 4HROA 4ANVA 1NI2A 3Q3JA 2D3AA 3AMZA 1I4HA 2N1VA 2KTFA 4W9GA 5C1ZA 5TSSA 2ZEQA 3D32A 4RF0A 1FRRA 2ONQA 3NVZA 4A55A 2G3QB 2DHZA 4HPMB 4DHZE 2M4NA 3ALBA 1LGRA 2D07B 3M62B 1JQ4A 5EE0A 5E6PA 2WDVB 5E6NA 3WALA 2K25A 4HXDA 1C4CA 5JH5C 5I4DA 3AN1A 1I35A 1V80A 1DOYA 3V60A 3RNBC 3DVNV 2BYTA 4GIVA 1GUAB 3AV8A 3AH7A 3WAMA 1L4ZB 1KRHA 5JXVA 1WF9A 2KWUB 2EKEC 2MP2A 4LJOB 3QQ8B 3IVFA 1YQ3B 2GOWA 2VH2A 3M63B 3Q8FA 3HIZA 4DXAB 3EA6A 4PS3A 3VTVA 3SFEB 2DYOA 2WGSA 1VZ8A 2DX5B 2AL6A 1ZXIA 2KQSA 4WJNA 1ZKHA 4WH4A 4KIKB 4GMVA 2XBBC 2FUG1 4KIKA 3A4RA 5D3DA 1P1AA 3JW0X 3ZNZB 4PK1A 2W3RA 4K7SA 1J7CA 3MHSD 3I9V1 3KH0A 1WX9A 5FKAC 4GXBA 3NVYA 1TS5A 4BOSC 4LJPB 1HA5A 4DHZB 3A1QB 2N9PC 3VUWA 1NYQA 4ZYSA 1E6EB 5H92C 3TBLD 2WDQB 1C78A 1WGYA 2KYWA 3EHVA 1I4QA 2INDC 1K52A 2WLBA 1UGMA 4RH6A 1WMHA 1UD7A 1PDXA 2CHZA 1J0GA 1V97A 5FR3A 2FCMA 3BIID 3X0WA 4O1NA 2JZPA 2CHXA 4LTUA 4TSSA 4MSQB 3VUXA 1WZ3A 4BKGA 2Y3AA 3FC4A 1ENFA 4LK0M 2DZIA 1P9DU 1UF0A 2JY6A 4L1BA 3GZNB 1C4PA 4NJ6A 4P1BC 1YNTE 5AZGA 1XLOA 3WCQA 4MEMA 1ET9A 2WXPA 1NBFC 2V1YA 2MWSB 2XK5A 3SR6A 1WSPA 5BYSA 3VAWA 1E8XA 1C3TA 4DHJB 4KGSA 1VZ6A 3IHPC 2KN4A 3OLMD 1AW7A 3W5VB 1YX5B 2UWQA 2L00B 2L83A 4B0EA 3UGBB 3ZQ4A 3PS6A 3Q8BA 3KYCD 3KLSX 2PPHA 2QSDA 4A3PA 2J0KA 4LNFA 3A9KA 1TKEA 4F1SA 1FMAD 2LVPA 1Q5WB 2EMTA 2GB1A 2LUEA 3GP7A 2CU3A 1SIFA 3RMKC 2K5PA 1OEYJ 2H88B 5CHFA 4YWGG 4BAXA 1FXAA 3DWGC 3FKYA 3K9PB 3DHHC 2LXCA 1WRIA 4NAWB 1VZ7A 4HCNB 2WDTB 4HPLB 3RZFA 3RPFC 4XDCA 1J8CA 2WS3B 2ZPYA 2KN5A 3ZDMC 1FNWA 2D11A 1CJEA 3NZSA 3KWLA 2DWQA 1UNSA 3NZUA 2RPVA 2V3NA 2WP9B 5DCNA 2JF5A 4A6QA 2MCNB 1I4GA 1KLGD 2ZNVB 3P4RB 4IKGA 3A9JA 2G4SA 1AN8A 4B9KA 1PYWD 4G11A 2SAKA 2LASA 2Y5BB 5D2MB 4FXCA 3PO0A 4GGQA 4CO7A 2HJ1A 2KMAA 5L95C 5HI1A 2LVQA 1TZ1A 4L23A 3UINB 2MW5A 3ONSA 4RGOS 1WJ4A 1EU4A 1MJDA 3CWIA 3M95A 3ZRFA 4N9F4 3R7QA 2WXQA 1QLBB 1X1MA 5IAAC 4JX1C 4LDTD 4II3B 3VH3B 3TMPB 3UQBA 1JROA 2KFKA 2W54A 3I5JC 2J52A 1TKYA 2LZ6A 3VFKA 4ICVA 4TUUA 1WGRA 2K0PA 3QCAA 4K7UA 5MPOA 2VRRB 3CSFA 1QOBA 3S2AA 3AE6B 1YQ4B 4P6VF 3B1LX 1WI0A 4KGRA 1F9JA 1TY2A 3Q3FA 3JYUA 3NG0A 2MH7A 1PGAA 2R61A 1SIJA 2IZVB 1VD2A 3R2TA 5KHQA 3AE2B 4AWJA 4MJSB 4ASWC 2ON8A 4LNOA 3TEWA 4II2B 1WJ6A 3HHMA 2KKCA 2V4IB 1WXSA 4F7ZA 2WXRA 1WM3A 1KH0A 4RF1A 5J17A 2AYOB 1WY8A 4DDGD 1DOXA 1GPXA 3U2SC 1YIWA 4XC2A 3T3OA 3WAOA 4OVZA 2IO3B 4EKUA 1WR6E 3ZTDA 3OJ4B 1UBIA 4GU2A 2AEHA 2GBMA 2YEPF 2LWPA 2KQ7A 3TEYA
chains in the Genus database with same CATH topology
1TS4A 2OEDA 3ABVB 3PZ8A 1N61A 1SE4A 1ZE3D 2IGHA 2J4XA 2Y5CA 1D5MC 1JWSD 2WU2B 4ZRQA 2PVGC 1BXTA 1HXYD 2I38A 2BS3B 5BMGA 1NEKB 1ZDXA 5T8IA 1XO3A 1JMLA 1ZP0B 2DLBA 4NZLB 1YN4A 1L0YB 2KMMA 2EKIA 4IOIE 1DYQA 3AM9A 2INPE 2L32A 3AEEB 2JSVX 2YEPB 3KQ4A 5EE1A 1TZOA 2INNE 4M0WA 2M0AA 3I57A 1EM7A 2IJ0A 4REZA 1D4BA 2WNMA 2BBCA 1F77A 1T3QA 2E6XA 5EE9A 2TSSA 3AB5A 5HG2A 3O13A 4IDIA 1IBXB 3ZYYX 2G1EA 4OHJA 1FIQA 4USAA 2QILA 3AEDB 3SFDB 5HHDG 3LB8C 2AX5A 2RDHA 4TQ1A 3IT6B 3NVWA 3R2IA 4HROA 3B2GA 4EE2A 3P4SB 3N9YC 4J3OD 4Q2JA 1UGJA 1N5WA 3B2FA 1L4DB 3EUB2 3NVVA 1P7FA 1VDVA 2WXJA 2LJIA 3AMZA 2HDEA 2KWDA 1B9RA 1I4HA 3EGRA 2MJ3A 3AEAB 1IGDA 3VRAB 3AEGB 2I2YA 4MM3B 5TSSA 4RF0A 1FRRA 3AECB 2PTLA 1V8CA 2ONQA 3NVZA 3Q69A 4A55A 2BTEA 1GB4A 4RGMA 4LLGM 1ZUD2 3NRZA 5BYQA 4YSXB 2D5GA 2MJEA 3V05A 3FILA 1I7HA 2LGIA 1JQ4A 2Q5WD 1N63A 5EE0A 1C9FA 2B76B 1M4VA 2WDVB 1TS2A 1C4CA 3P63A 5I4DA 2E3TA 1WXQA 2N7JA 3AN1A 1FD6A 1DOYA 2JWUA 4CQNA 4NJCA 2WXGA 4GLSC 1L0XB 1VJKA 2BYTA 4ZOHC 3AV8A 3HVZA 3AH7A 3TEZA 2L52A 1L4ZB 1SE3A 1TS3A 1KRHA 2QIEB 1GB1A 5JXVA 2N9LA 4DQOC 1XCQL 1KTKA 1L6UA 1MHXA 1EU3A 2VZKD 1YQ3B 1HQRD 3HUIA 4YXDB 3Q8FA 2ZW0A 1MVKA 1ROEA 3EA6A 3W5UB 4YTNB 4AQ7A 2N9KA 1QOGA 4ZRPA 3SFEB 1WYGA 1F2RC 3J9CA 4MT5A 3AE7B 2DYOA 1D5ZC 1VZ8A 1Q10A 1SJHD 1XLNA 1FRDA 1JW9D 1NENB 1LO5D 3BZDB 3T3NA 1FM0D 3W9CB 3P42A 1ZXIA 1L5PA 5D3IB 2VZKB 4JWSC 2JX5A 4WH4A 4D2KA 3BVZA 4PT5A 3DWMA 3BYTB 3LYYA 2FUG1 5D3DA 1HZ5A 1NVID 1XLPA 1VR9A 2XN9C 2W3RA 3R8BA 1J7CA 4HKQA 3Q8CA 1MHHE 2BB6A 1V1OA 4GDKB 1E10A 1TYGB 3FAHA 3I9V1 2ICIA 1ZOYB 5FKAC 3NVYA 1TS5A 3ZJVA 2WXHA 1QQRA 5FK9C 4HRSA 2KAJA 3MHZA 4ZHOA 1HA5A 3ZJTA 4A9AA 1FFVA 1NI3A 2PIAA 1IGCA 3IAS1 1NYQA 1OFFA 4ZYSA 2LUMA 3GB1A 1E6EB 5H92C 2WDQB 1C78A 1R7SA 2L1AA 4HKZE 1GOZA 2JYEA 3HVDA 4TMAB 5E6JA 2BB5A 1I4QA 3W1SA 1PUTA 1XXGA 1SF0A 1K52A 2WLBA 4RH6A 1QKZA 1IUEA 1PDXA 1C79A 2WXLA 3BVMA 1DGJA 1V97A 2V3PA 5FR3A 1QOFA 1IBXA 3BIID 4US9A 1I4RA 2QMTA 4O1NA 3TSSA 2JZPA 1F0ZA 1FNVA 1K53A 4LTUA 4TSSA 2Y3AA 4RGNA 1JWMD 4ARCA 2PW9A 1HEZE 5AUKA 1CK1A 3FC4A 3U52E 1ENFA 4LK0M 3AE3B 1E7PB 4A8XC 4ZHPA 4JPSA 4L1BA 1C4PA 2BT6A 3BK2A 1YNTE 5G5GA 1XF5L 2PLPA 1XLOA 2GRIA 2RMMA 2PKOA 2WXMA 3WCQA 1BUIC 2QEJC 1ET9A 1T6BX 1UWMA 2M56B 1TY0A 2WXPA 4OZBA 3SR6A 1WSPA 3MJ5A 1YN3A 5BYSA 1N62A 5HFYA 1E9MA 1JALA 4XWTA 2BS2B 4RFBA 3TUOA 1QT9A 5BMHA 3C8YA 1VZ6A 4KGSA 2KN4A 1AW7A 1ESFA 3AEBB 4N58A 4WURA 1A70A 4YSYB 3W5VB 1UUPA 1OQQA 4C7YA 3H8HA 3GS2A 2L83A 4RGTA 2KDMA 2EELA 4B0EA 3ZQ4A 1WGKA 1GAQB 3MP9A 2X38A 3VR8B 2LMCA 2J42A 3Q8BA 1FEHA 3KLSX 2QSDA 4C7ZA 1TKEA 1L6VA 4MACA 1FMAD 1FCCC 4DXGA 2GB1A 1JCKB 1C76A 1ET6A 3ZGZA 1YJIA 3GP7A 1N60A 4RNAA 2CU3A 4YTMB 2K5PA 2LFIA 1SJED 2H88B 4YWGG 1FXAA 3DWGC 3SEBA 1OQRA 3IAM1 4P16A 1TKGA 2AQ1B 2IGDA 3Q8EA 4KKJA 1ACCA 4WIPA 1YJJA 2KACA 3U4EG 4NAWB 1WRIA 1VZ7A 4WQMA 4MH8A 5AUIA 5H8YE 3RPFC 3BYYB 4TQ0A 1T5XD 4YT0B 1Y56A 4C56C 5EE3A 2LHDA 4XDCA 2WS3B 2FE8A 2NTTA 1B1ZA 1FNWA 4A90A 2JXTA 1MI0A 2ACZB 1CJEA 3TEXA 3E9SA 1BMLC 3BVGA 2G9HD 3CIRB 1CQVA 1QOAA 1V1PB 3KWLA 5BMIA 2WXOA 2DWQA 1UNSA 2RPVA 2V3NA 4H2AA 2MEKA 2WP9B 2CJNA 1D5XC 5BYRA 4A6QA 3AE1B 3W2DA 2W55A 1I4GA 5D7GA 1KLGD 1FCLA 2W82A 3P4RB 2N0SB 4WAFA 3P1MA 4IKGA 5C3JB 4HJGE 1VRAB 1PGXA 2QJLA 2WXIA 1AN8A 3HRDD 4B0MA 1VLBA 2DYMA 1KFYB 1PYWD 2JQRB 2SAKA 2BW2A 1K51A 1K50A 1KLUD 1JRPA 4FXCA 3PO0A 3MFGA 1TJEA 4OW0A 2K3UA 3AEFB 4OZAA 3U7ZA 1WWTA 2AQ2B 4R3DA 1YN5A 5HI1A 1J7AA 4L23A 3E56A 1AWDA 4OZCA 2MJDA 5G5HA 4RGOS 3VQIA 1EU4A 4HEA1 4JWUC 1XEEA 3CWIA 4KGTA 1SSNA 3BWUD 2IPKD 3P4QB 4US8A 1KF6B 3ETRA 2WXQA 1QLBB 4JX1C 1YMHE 1SEBD 1ZPSA 3MC0B 3PZ7A 1I4PA 4GDLB 1CZPA 2RDGA 4ITKA 1NYRA 3VRBB 2KQ4X 2FBWB 2WXNA 1EWYC 1FXIA 1JROA 3OWEB 3VR9B 2W54A 1SB3C 2GI9A 3AE8B 1D6EC 2J52A 1TKYA 1ZDVA 2IDYA 3RFZB 2Z8LA 1QF6A 1JWBD 2J53A 2K0PA 2SEBD 3V3XA 1AYFA 2LEKA 5MPOA 1RWSA 1JWUD 4RCOA 2BS4B 1PFDA 1C77A 1C4AA 1ZXHA 1QOBA 3IT4B 1RYJA 3AE5B 3AE6B 3P4PB 3AE4B 4UDUC 3Q8AA 1YQ4B 4P6VF 4XDDA 2PVOD 4KGRA 3NZ3A 1JWAD 1TY2A 1DOIA 2JYTA 1RM6C 2MH7A 2IGGA 4XE0A 3FILB 1PGAA 3URYA 2R61A 1SIJA 3R2TA 3AE2B 1FFUA 2ON8A 2WQYB 4N6EB 2K22A 2ZW1A 3NUHB 3TEWA 4WWMA 3IXSA 2OHFA 1STEA 1E0ZA 2V0GA 1SE2A 1N5XA 3ZJUA 1SBBB 2V4IB 2JU6X 2AQ3B 3BK1A 1XCTL 4YTPB 3NS1A 2WXKA 2W3SA 2DBYA 4JE3B 2WXRA 3KWVA 1SXTA 1UWXA 1KH0A 1MPEA 2WU5B 4RF1A 5GXGB 4YSZB 4L2YA 2CJOA 2LHEA 1XLQA 1L0VB 1RFKA 3AE9B 2K9XA 5C2TB 3B9JA 1P7EA 4NAMA 4DXFA 2WDRB 1DOXA 2XNAC 1GPXA 2WXFA 2PMVA 1V1PA 3U2SC 1FO4A 4ARIA 1PGBA 5LNK1 2H89B 3LXFA 4XWWA 3T3OA 1F2RI 4OVZA 1FNUA 4AS1A 4N59A 4KX6B 2HTME 1I4XA 2NTSA 3L4PA 4C80A 2M19A 2Y5PA 2NMQA 1J7BA 1QILA 2YEPF 4KKIA 1HZ6A 3UI3A 3TEYA 1EWCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TS4 A;  1AW7 A;  1ESF A;  1SEB D;  1UUP A;  3EA6 A;  1SE4 A;  1I4P A;  2J4X A;  2RDG A;  3MC0 B;  1D5M C;  1JWS D;  4RGT A;  1BXT A;  1HXY D;  1D5Z C;  1SJH D;  3KLS X;  3OWE B;  3BZD B;  1LO5 D;  1D6E C;  4NZL B;  1YN4 A;  1L0Y B;  4DXG A;  5D3I B;  1JCK B;  1DYQ A;  2Z8L A;  1ET6 A;  3GP7 A;  3BVZ A;  2SEB D;  3BYT B;  5D3D A;  2IJ0 A;  1JWU D;  4RCO A;  1SJE D;  1F77 A;  2XN9 C;  3SEB A;  3R8B A;  2AQ1 B;  2TSS A;  3O13 A;  4UDU C;  1V1O A;  4OHJ A;  1TY2 A;  2ICI A;  5FKA C;  1TS5 A;  2QIL A;  3BYY B;  2RDH A;  5FK9 C;  1HA5 A;  1T5X D;  4C56 C;  3R2I A;  3URY A;  2R61 A;  3R2T A;  4ZYS A;  2NTT A;  1B1Z A;  1FNW A;  1GOZ A;  3BVG A;  1I4Q A;  2G9H D;  4RFB A;  1CQV A;  1I4H A;  1STE A;  1XXG A;  1V1P B;  4RH6 A;  1UNS A;  1SE2 A;  1D5X C;  3BVM A;  5TSS A;  1SBB B;  2AQ3 B;  3W2D A;  1I4G A;  1I4R A;  1KLG D;  4RGM A;  4O1N A;  3TSS A;  1FNV A;  4TSS A;  1AN8 A;  1SXT A;  4RGN A;  3V05 A;  1JWM D;  1PYW D;  1CK1 A;  1KLU D;  1ENF A;  1M4V A;  1TS2 A;  3MFG A;  5I4D A;  4DXF A;  2XNA C;  1V1P A;  2AQ2 B;  1L0X B;  1FNU A;  1YN5 A;  1I4X A;  2QEJ C;  1ET9 A;  1SE3 A;  1TS3 A;  1TY0 A;  2NTS A;  4RGO S;  1EU4 A;  1YN3 A;  1KTK A;  1QIL A;  1EU3 A;  2IPK D;  1HQR D;  1EWC A; 
#chains in the Genus database with same CATH topology
 2OED A;  4FA6 A;  2KWV B;  3PZ8 A;  2BVC A;  2C9W B;  4ZRQ A;  2PVG C;  4M8M A;  1NEK B;  1YQB A;  5T8I A;  2L7R A;  4MEL A;  1XO3 A;  2KNB A;  1JML A;  2DLB A;  4NZL B;  1YN4 A;  2KWC A;  5L83 A;  4BZA A;  2LI5 A;  3B08 A;  4K7W A;  3I57 A;  1EM7 A;  2IJ0 A;  4QAY A;  1D4B A;  4MH0 E;  1RLF A;  1WFY A;  3O13 A;  3RYT A;  1FXT B;  1IBX B;  2MBE A;  2BGF A;  1FIQ A;  4USA A;  4IWO A;  2GBJ A;  3UQA A;  2RD0 A;  3SFD B;  4FAD A;  5DPR A;  2G45 B;  2JUO A;  4ZRK A;  4WJP A;  3B2G A;  3P4S B;  1WR1 A;  1U4A A;  1P7F A;  1VDV A;  2WXJ A;  4NY0 A;  4MSM B;  3TJP A;  2KWD A;  2V4L A;  1B9R A;  3M3J A;  2MJ3 A;  3DVG X;  3VRA B;  1SE9 A;  4MM3 B;  2PTL A;  1TIF A;  1ZW7 A;  2KX3 A;  2O6V B;  5BYQ A;  4YSX B;  2MJE A;  2BF8 B;  3V05 A;  3FIL A;  1I7H A;  2C60 A;  1N63 A;  1TTN A;  2B76 B;  3PRE A;  1T0Q C;  3RNC C;  5DPT A;  1OQY A;  4HDQ A;  2E3T A;  1WXQ A;  3OJ3 A;  2DAF A;  4NJC A;  2WXG A;  4GLS C;  3ZLZ A;  3MJW A;  1VJK A;  3EEC A;  4ZOH C;  3HVZ A;  1ZGU B;  1TS3 A;  1SE3 A;  4HCP B;  1G6J A;  2QIE B;  2JRI B;  4LNI A;  3VDZ A;  1KTK A;  1L6U A;  1MHX A;  4B95 A;  5E6O A;  4W9D A;  3W5U B;  1WX8 A;  4YTN B;  3U30 A;  4AQ7 A;  2KXJ A;  1WYG A;  2BWE S;  4P7I A;  3J9C A;  3AE7 B;  1D5Z C;  1JW9 D;  1NEN B;  3BZD B;  4B6W A;  3PPA A;  2JX5 A;  4D2K A;  3BVZ A;  4E71 A;  3H7P A;  3BIN A;  3V6C B;  3Q8C A;  3PRZ A;  1GNU A;  1E10 A;  3DOW A;  2M1M A;  2LJ5 A;  2DZJ A;  2ICI A;  3ZJV A;  3DVN U;  4HRS A;  3MHZ A;  1P98 A;  1IP9 A;  3OAW A;  1IGC A;  3O65 B;  2KT7 A;  2LUM A;  2NR2 A;  1R7S A;  4HKZ E;  4IM0 A;  4M8N A;  1XXG A;  2GMI C;  4KV2 A;  1QKZ A;  5IKC M;  2WXL A;  1DGJ A;  3VH4 B;  4K81 A;  3KUD B;  1K53 A;  4WQO B;  1J19 A;  4RGN A;  2FIF A;  1HEZ E;  3PLV A;  5AUK A;  4MGK E;  3U52 E;  4DHJ D;  4AJY B;  4ZHP A;  1WJU A;  4JLC A;  1XF5 L;  2WXM A;  1AAR A;  3PVL A;  1BUI C;  1UWM A;  3Q6B A;  1TY0 A;  4JL9 A;  3L13 A;  1R4M B;  3HK0 A;  2BS2 B;  4RFB A;  3C8Y A;  1EO6 A;  1ESF A;  3AUL A;  2CKH B;  1UUP A;  2K6Q A;  1OQQ A;  2BWF A;  4BBN F;  3QJZ A;  2INC C;  2KDM A;  3EC8 A;  1WGK A;  1GAQ B;  2X38 A;  3VR8 B;  2LMC A;  2BYV E;  4K3C A;  2A4Z A;  4I6P A;  4MAC A;  5LLI A;  2LGY A;  4ZYN A;  2KTR B;  1ET6 A;  3K9O B;  1HTO A;  3NS8 A;  1N60 A;  4A3O A;  3GZN I;  3SEB A;  1TKG A;  4WIP A;  3ZVV A;  1YJJ A;  3U4E G;  4WQM A;  4MH8 A;  1IPG A;  5AUI A;  1Q1O A;  2D3G A;  3VHT C;  3BYY B;  1Y56 A;  3ZNI D;  3T8M A;  2LHD A;  4FN2 A;  4M02 A;  1V5O A;  4FJV B;  1MI0 A;  3TEX A;  2GLS A;  2G9H D;  3CIR B;  2KO3 A;  3AU4 A;  2AL3 A;  2MEK A;  1EUV B;  1M94 A;  2CJN A;  1HTQ A;  3ZKJ C;  5D7G A;  1FCL A;  2W82 A;  4EZJ A;  4WAF A;  2I1K A;  2O2V B;  1H4R A;  2KFJ A;  1WXM A;  4HJG E;  1VRA B;  1PGX A;  4IM3 A;  4B0M A;  2WX1 A;  1TT5 B;  3NJT A;  3A1Q A;  3L08 A;  4W9H A;  1KFY B;  2JQR B;  4IC7 B;  4EZL A;  3L17 A;  1K50 A;  1WZ0 A;  2FAZ A;  4OW0 A;  2BQQ A;  1WGG A;  2AQ2 B;  3TCA A;  1PQS A;  2ZCB A;  4URK A;  4OZC A;  2MJD A;  4BOZ B;  4HEA 1;  4KGT A;  4ZRI A;  1SSN A;  4FHJ A;  3RI7 C;  1UH6 A;  3P4Q B;  2RSU A;  1KF6 B;  3VVW B;  2L05 A;  3ML8 A;  2KX0 A;  4FUL A;  2CS4 A;  3RNF C;  1SEB D;  1ZPS A;  1I4P A;  2K8C A;  2KQ4 X;  2FBW B;  4FHK A;  2KC2 A;  4C4V B;  3AE8 B;  2YLM A;  1D6E C;  2FCN A;  1XQQ A;  1QF6 A;  2G4D B;  1JWB D;  2J53 A;  5CTR C;  3V3X A;  3R66 C;  1RWS A;  2BS4 B;  1C77 A;  1C4A A;  1E7V A;  1E90 A;  3R3M A;  4G50 A;  3AE4 B;  4UDU C;  3Q8A A;  3PTF C;  3CST A;  1LFD A;  1GC6 A;  4PYU A;  2JYT A;  3WA0 A;  3LJ3 A;  3RUL A;  4XE0 A;  3TIX A;  2IBI B;  1WGD A;  4PS8 A;  4W9C A;  2ZW1 A;  3IXS A;  1L7Y A;  2OHF A;  2QHO A;  3U8Z A;  1HE8 A;  1SE2 A;  3N32 A;  3ZJU A;  1SBB B;  1IYF A;  4NAW A;  4ZDV A;  1XCT L;  3I3T B;  3UF8 A;  5DPW A;  4AUQ C;  2JT4 B;  1UBQ A;  3KWV A;  2VH1 A;  1SXT A;  4L2Y A;  1Z5S B;  4F8C B;  2I1J A;  2ZPN A;  2LHE A;  3EFC A;  2N9E B;  4BVU C;  1RFK A;  2WHI A;  2N7D A;  2LXA A;  4TV3 A;  1P7E A;  4DXF A;  2WDR B;  2D10 A;  4DWF A;  3IBE A;  2BPS A;  3LXF A;  1F2R I;  1FNU A;  2GBR A;  4AS1 A;  1QZE A;  4N59 A;  2KLC A;  2UU7 A;  1I42 A;  3EFU A;  2LGX A;  3L10 B;  3CMM B;  2MLB A;  1J7B A;  1R4N B;  3SU8 X;  2KD0 A;  4TKN A;  1YD8 U;  1N61 A;  1ZE3 D;  3PLU A;  3Q3M C;  1T0Y A;  1E8Y A;  1HXY D;  2ASQ A;  5IO9 A;  3V62 A;  1ZP0 B;  4ACF A;  3HM3 A;  2RDB C;  1WXA A;  3KQ4 A;  4GOC A;  1TZO A;  4HK2 A;  4IM2 A;  4REZ A;  3PHW B;  1EF5 A;  3ZUN A;  4IDI A;  2IY0 B;  2JZZ A;  3DHI C;  3AED B;  2UYZ B;  2RGF A;  3H1U A;  2RDH A;  3WAN A;  1WM2 A;  3APC A;  3N9Y C;  4NNJ B;  4Q2J A;  2O6V D;  1UGJ A;  2M17 A;  4WWN A;  3B2F A;  1L4D B;  5CHV C;  3RCZ A;  3AXC A;  3PZD A;  2LJI A;  2MBQ A;  3VXW A;  3UIO B;  5C23 A;  1IGD A;  2J0M A;  1H8C A;  3W1Y A;  3PRP B;  3AEC B;  3N20 C;  1V8C A;  4G0N B;  1P3Q U;  2J0J A;  3Q69 A;  2BTE A;  1GB4 A;  4LLG M;  1ZUD 2;  3NRZ A;  2KDF B;  1WX7 A;  4KZ0 A;  5LXI B;  3N1X C;  3C0R B;  3ZNH B;  2LGI A;  2KDE B;  3C19 A;  2BKF A;  3MTN B;  3Q3N C;  4BKS D;  4MJS A;  1M4V A;  4NJ7 A;  1TS2 A;  2HD5 B;  3P63 A;  1FD6 A;  2N7J A;  5IOI A;  1OEY A;  1P0R A;  2JWU A;  4CQN A;  3V61 A;  2R2O A;  1L0X B;  1LXD A;  3AI5 A;  4WAA A;  4A20 A;  3TEZ A;  2L52 A;  3QHT A;  2KC1 A;  4M01 A;  2CR5 A;  2L8J A;  3HUI A;  3PV1 A;  2KLG A;  1ROE A;  1GJZ A;  2N9K A;  2R2Q A;  1F2R C;  2RR9 A;  2BYF A;  1Q10 A;  1SJH D;  1XLN A;  1FRD A;  1Q0W B;  3ZW3 A;  4KVG B;  2ZCC A;  1V6E A;  3T3N A;  1FM0 D;  3W9C B;  2NPT B;  3P42 A;  1EF1 A;  1L5P A;  1UEL A;  3VUY A;  2VZK B;  5JHA A;  3RD2 A;  3BYT B;  3LYY A;  2LRU A;  1HZ5 A;  1NVI D;  3R8B A;  2ZVN A;  2C7H A;  1MHH E;  2BB6 A;  4GDK B;  4WWP A;  4GDK A;  4IG7 B;  4G3X B;  2WXH A;  1QQR A;  2HE7 A;  5FK9 C;  4A9A A;  1FFV A;  1NI3 A;  2PIA A;  4NQL B;  3IAS 1;  1OFF A;  4WJQ A;  4FJZ A;  2L1A A;  1GOZ A;  5E6J A;  1PUT A;  3DBL B;  2V3P A;  1QOF A;  1IBX A;  4US9 A;  2M0X A;  3TSS A;  2KVZ A;  4ICU A;  4I6N B;  1CK1 A;  4C00 A;  2J7Q B;  3AE3 B;  4A8X C;  2A5U A;  3BK2 A;  3L0W B;  2C7N B;  2RMM A;  4MGI E;  3NY5 A;  4MM3 A;  2MHJ A;  1T6B X;  2M56 B;  2N9X A;  4OZB A;  1YN3 A;  5HFY A;  2GBN A;  2O6V A;  1E9M A;  2KK8 A;  4XWT A;  3R7R A;  3TUO A;  1QT9 A;  3AEB B;  2PEA A;  4OVU A;  4C7Y A;  4RGT A;  4CHK A;  3MP9 A;  2J42 A;  1FEH A;  4RM9 A;  3N3K B;  1V5T A;  1FCC C;  2Z59 B;  4DXG A;  3A4S C;  1JCK B;  4IWQ A;  3DBH B;  2K39 A;  1YJI A;  4EEW A;  4BKS A;  1SJE D;  4P16 A;  4XYC A;  2CU1 A;  2IGD A;  2OOB B;  4DK5 A;  2KAC A;  1R4M I;  3JSV B;  5H8Y E;  1ISN A;  4TQ0 A;  1T5X D;  4YT0 B;  5J18 A;  2LVO A;  3PT2 B;  1A5R A;  2HTH A;  3B0A A;  4A90 A;  2JXT A;  2ACZ B;  4ZRJ A;  2BKR B;  1BML C;  4NPN A;  1QOA A;  1V1P B;  4MGZ E;  5BMI A;  2WXO A;  4AP4 C;  1D5X C;  5BYR A;  3ZRC A;  3AE1 B;  3W2D A;  2N0S B;  2MBH A;  3P1M A;  5D94 A;  4KDI C;  3QA8 A;  4LNN A;  2JXX A;  2DYM A;  4S17 A;  2BW2 A;  1K51 A;  1WRD B;  2KJH B;  1KLU D;  2NBU A;  1N6Z A;  4OZA A;  3ZXR A;  3GOE A;  4EOY A;  2W9N A;  4R3D A;  1YN5 A;  2WYQ A;  1YJ1 A;  3NOB A;  4K1R B;  2KVR A;  1LQB A;  1AWD A;  1WGH A;  2FCQ A;  2KHW B;  3VQI A;  2V9H A;  4M0W B;  1XEE A;  1E7U A;  3H6N A;  1V49 A;  2LGD A;  1C1Y B;  2V3S A;  1XD3 B;  3BY4 B;  3VTU A;  4US8 A;  2L76 A;  1YMH E;  4J6I A;  3PZ7 A;  4GDL B;  4ITK A;  2RDG A;  2WWZ A;  1NYR A;  4GDL A;  1E5W A;  3SHQ A;  3MC8 A;  2WXN A;  5KHO A;  3VR9 B;  2BYE A;  2GI9 A;  3QIJ A;  1V81 A;  1ZDV A;  1OGW A;  3RFZ B;  2SEB D;  4FJY A;  4RCO A;  2HJ8 A;  1PFD A;  1WJN A;  4HPP A;  1ZXH A;  1RYJ A;  2NS5 A;  2GBK A;  2PVO D;  1JWA D;  3H7S A;  1WE6 A;  1DOI A;  1RM6 C;  3RNG C;  2JPH A;  3TL5 A;  2K6D B;  4W9J A;  3URY A;  1V2Y A;  2IO0 B;  3IG3 A;  1FFU A;  2KTR A;  4EZK A;  2WQY B;  2K22 A;  1STE A;  1K8R B;  3GE3 C;  1MFW A;  2NCN A;  2PJH A;  2JU6 X;  2AQ3 B;  3BK1 A;  5GMV A;  3DBR B;  3V6E B;  4EUT A;  4LNK A;  2ZZP B;  2LD9 A;  4YTP B;  2MP2 B;  3Q2A C;  2WXK A;  4JE3 B;  1UWX A;  4FLH A;  1MPE A;  1D3Z A;  2X8X X;  2CJO A;  2IO2 B;  2IYD B;  3N30 A;  2K9X A;  2DNF A;  4GSW A;  2XNA C;  3AU5 A;  3UIP B;  1FPY A;  2KDI A;  1GG3 A;  3HM6 X;  4KX6 B;  2HTM E;  2NTS A;  4PS7 A;  3P2B A;  2O2V A;  1QIL A;  4HDO A;  3UI3 A;  1EWC A;  1TS4 A;  1SE4 A;  2Y5C A;  1JWS D;  3VTW A;  2WU2 B;  2WX0 A;  1WH3 A;  4ANW A;  2BS3 B;  5BMG A;  4AOF A;  2IY1 B;  4KSK C;  4WJO A;  2KMM A;  3AM9 A;  2L32 A;  3AEE B;  2JSV X;  2INN E;  4KSL C;  2M0A A;  1UZX B;  4X57 B;  1F77 A;  1WMH B;  3OG5 A;  1T3Q A;  1Y8R C;  2E6X A;  5EE9 A;  2TSS A;  3GE8 C;  2KJ6 A;  3ZYY X;  1KJT A;  2G1E A;  4OHJ A;  4GN1 A;  5AEK B;  5IN7 A;  2QIL A;  2IO1 B;  2B3A A;  3N1Y C;  3SD5 A;  3LB8 C;  2AX5 A;  5AZF A;  1R4N I;  4TQ1 A;  4C4V A;  2OJW A;  3R2I A;  4EE2 A;  4J3O D;  1KM7 A;  1N5W A;  3EUB 2;  3NVV A;  3N1Z C;  2HDE A;  3EGR A;  2MA9 B;  2JZ3 B;  3DPD A;  3AEA B;  2RPQ A;  3AEG B;  4MGY E;  2I2Y A;  3QK0 A;  2AWT A;  4HLE A;  3KW5 B;  2YVC A;  2XK5 B;  4RGM A;  3ZDT A;  2D5G A;  1LM8 B;  4JGH B;  2Q5W D;  3PHX B;  4RMA A;  1C9F A;  2PE9 A;  3DBS A;  2KAN A;  3RNE C;  3QAQ A;  3A9K B;  2PE6 B;  2N1W A;  2DEN B;  1GB1 A;  2N9L A;  4DQO C;  1XCQ L;  2MQJ A;  1EU3 A;  2VZK D;  1HQR D;  3KVF B;  4YXD B;  2ZW0 A;  4NQK E;  1MVK A;  5DPS A;  1QOG A;  4ZRP A;  4BFR A;  3QC8 B;  1CMX B;  3DCG A;  4MT5 A;  3X23 A;  4EFO A;  4M00 A;  4IUM B;  1LO5 D;  2KOX A;  5D3I B;  1V86 A;  3PSE B;  4BBN C;  4OVV A;  3KUZ A;  4JWS C;  2LRW A;  4PT5 A;  3DWM A;  4BKT A;  2QC8 A;  3ML9 A;  1XLP A;  1VR9 A;  2XN9 C;  1E8W A;  2FNJ B;  1V1O A;  1TYG B;  3FAH A;  1ZOY B;  3A9J B;  1BT0 A;  4ZHO A;  2KAJ A;  3ZJT A;  3A33 B;  2L3Z A;  2OJR A;  3GB1 A;  1T0S C;  3HVD A;  2JYE A;  4TMA B;  2KZR A;  3ZO5 B;  2BB5 A;  3W1S A;  2DZK A;  1SF0 A;  2NBW B;  2ZNV C;  4LCD E;  1IUE A;  2FID A;  1C79 A;  3BVM A;  2D3B A;  2EMS A;  4I6L B;  5AZH A;  2JVC A;  1MG4 A;  1I4R A;  2QMT A;  1F0Z A;  3RNA C;  1FNV A;  3H9D A;  1JWM D;  4ARC A;  2PW9 A;  3MC9 A;  2QDF A;  1E7P B;  5EDS A;  4HJK A;  3NHE B;  4JPS A;  5IA7 A;  2K8H A;  2KFK B;  2BT6 A;  5G5G A;  2PLP A;  2GRI A;  3W1S C;  2PKO A;  2QEJ C;  4HVB A;  2N4F A;  3KUC B;  3MJ5 A;  4K3B A;  4XX5 A;  1N62 A;  1E8Z A;  2MRP A;  3DBL I;  4MDK E;  1JAL A;  5BMH A;  2JWZ A;  1WIA A;  4N58 A;  1A70 A;  2K8B A;  3PRM B;  4WUR A;  4WWO A;  4YSY B;  3H8H A;  3GS2 A;  4GB9 A;  2EEL A;  3L54 A;  4KDL B;  5J2R A;  3IFW B;  2DYB A;  3ZIM A;  3RZW C;  4C7Z A;  3WAP A;  1S3S G;  2XEW A;  1JRU A;  1L6V A;  2MSE D;  1C76 A;  3ZGZ A;  4RNA A;  1S1Q B;  4YTM B;  5FR6 A;  1GC7 A;  2LFI A;  2L0F A;  1OQR A;  3IAM 1;  3QX1 A;  2AQ1 B;  4XZ4 A;  3Q8E A;  4KKJ A;  1ACC A;  3L16 A;  3DHG C;  1YOV B;  3RUI B;  4AJW A;  4C56 C;  4ANU A;  2NPT A;  5EE3 A;  2K1F A;  2FE8 A;  2NTT A;  1B1Z A;  3DDC B;  4W9L A;  4HWI B;  3LDZ E;  3E9S A;  3BVG A;  1CQV A;  4H2A A;  3DBH I;  2W55 A;  1RAX A;  3APD A;  1L2N A;  5C3J B;  2NVU I;  2KMC A;  2QJL A;  2WXI A;  3ENE A;  3HRD D;  5HKH A;  1VLB A;  4CYE A;  1RFA A;  1T0R C;  1JRP A;  5JZE B;  5BO4 B;  1VCB A;  1TJE A;  3MFG A;  2K3U A;  3AEF B;  3U7Z A;  1WWT A;  3DVG Y;  3KYD D;  1WE7 A;  3RT3 B;  4XGA B;  2REX A;  1J7A A;  2NBV B;  3ZNG C;  3E56 A;  5G5H A;  1RRB A;  4JWU C;  1TGZ B;  3BWU D;  2IPK D;  3ETR A;  2LGS A;  4YL8 A;  3JVZ X;  3MC0 B;  1CZP A;  5CX3 A;  3VRB B;  2JRH A;  1EWY C;  1FXI A;  3OWE B;  2QCZ A;  1SB3 C;  2C7M B;  1TBE A;  2C5L C;  4DBG A;  2IDY A;  2Z8L A;  1YX6 B;  3U7D A;  5G2N A;  1WXV A;  1V9J A;  4LDT B;  1AYF A;  2LEK A;  2MX2 A;  2CHW A;  1JWU D;  3IT4 B;  2L0T A;  1SGH A;  3AE5 B;  3P4P B;  4IWP A;  4DDI D;  4KZC A;  4XDD A;  4P1C C;  3Q14 C;  3NZ3 A;  3WIM A;  5IP4 D;  2MBB B;  4E74 A;  2IGG A;  3FIL B;  3ECI A;  3CF6 E;  2D3C A;  3Q3O C;  4IW0 A;  1KOT A;  4N6E B;  3NUH B;  4WWM A;  5D6J B;  1E0Z A;  2V0G A;  1KLV A;  1WYW B;  2Z0E B;  1N5X A;  2ZJD A;  2N7E A;  3T9L A;  2DZM A;  2FCS A;  3JSV A;  4W9E A;  3NS1 A;  2W3S A;  2DBY A;  4YSZ B;  2WU5 B;  5GXG B;  4S0R A;  3RN9 C;  3APF A;  1XLQ A;  1L0V B;  3AE9 B;  4RM8 A;  5C2T B;  3B9J A;  3SDL C;  1F1H A;  4NAM A;  3QAR A;  3DQV A;  1MG8 A;  2WXF A;  2PMV A;  1V1P A;  1FO4 A;  4ARI A;  1PGB A;  5LNK 1;  2H89 B;  4XWW A;  1I4X A;  2M8S A;  3L4P A;  1NDD A;  4C80 A;  2M19 A;  2Y5P A;  1OTR B;  2NMQ A;  3H7P B;  1Z2M A;  1HZ6 A;  4KKI A;  3I63 C;  4HKQ A;  2MBO A;  3ZTC A;  4E3C A;  4W9I A;  4PYZ A;  3ABV B;  2J4X A;  5JHB A;  2IGH A;  3PGE A;  2D2Q A;  1D5M C;  3DBR I;  5TR5 A;  1BXT A;  2KJR A;  5CHW A;  4FBJ B;  2I38 A;  4W9F A;  4JIO U;  2Z0D B;  1ZDX A;  2ZVO A;  4W9K A;  2KDB A;  1L0Y B;  2EKI A;  4IOI E;  1DYQ A;  2INP E;  2FUH B;  2YEP B;  5EE1 A;  5G55 A;  2DAJ A;  4M0W A;  2WNM A;  3QWZ B;  2BBC A;  1F52 A;  3AB5 A;  5HG2 A;  3ZXV A;  1XT9 B;  4ANX A;  5LXH A;  4JQW C;  5HHD G;  3IT6 B;  3NVW A;  4HRO A;  4ANV A;  1NI2 A;  3Q3J A;  2D3A A;  3AMZ A;  1I4H A;  2N1V A;  2KTF A;  4W9G A;  5C1Z A;  5TSS A;  2ZEQ A;  3D32 A;  4RF0 A;  1FRR A;  2ONQ A;  3NVZ A;  4A55 A;  2G3Q B;  2DHZ A;  4HPM B;  4DHZ E;  2M4N A;  3ALB A;  1LGR A;  2D07 B;  3M62 B;  1JQ4 A;  5EE0 A;  5E6P A;  2WDV B;  5E6N A;  3WAL A;  2K25 A;  4HXD A;  1C4C A;  5JH5 C;  5I4D A;  3AN1 A;  1I35 A;  1V80 A;  1DOY A;  3V60 A;  3RNB C;  3DVN V;  2BYT A;  4GIV A;  1GUA B;  3AV8 A;  3AH7 A;  3WAM A;  1L4Z B;  1KRH A;  5JXV A;  1WF9 A;  2KWU B;  2EKE C;  2MP2 A;  4LJO B;  3QQ8 B;  3IVF A;  1YQ3 B;  2GOW A;  2VH2 A;  3M63 B;  3Q8F A;  3HIZ A;  4DXA B;  3EA6 A;  4PS3 A;  3VTV A;  3SFE B;  2DYO A;  2WGS A;  1VZ8 A;  2DX5 B;  2AL6 A;  1ZXI A;  2KQS A;  4WJN A;  1ZKH A;  4WH4 A;  4KIK B;  4GMV A;  2XBB C;  2FUG 1;  4KIK A;  3A4R A;  5D3D A;  1P1A A;  3JW0 X;  3ZNZ B;  4PK1 A;  2W3R A;  4K7S A;  1J7C A;  3MHS D;  3I9V 1;  3KH0 A;  1WX9 A;  5FKA C;  4GXB A;  3NVY A;  1TS5 A;  4BOS C;  4LJP B;  1HA5 A;  4DHZ B;  3A1Q B;  2N9P C;  3VUW A;  1NYQ A;  4ZYS A;  1E6E B;  5H92 C;  3TBL D;  2WDQ B;  1C78 A;  1WGY A;  2KYW A;  3EHV A;  1I4Q A;  2IND C;  1K52 A;  2WLB A;  1UGM A;  4RH6 A;  1WMH A;  1UD7 A;  1PDX A;  2CHZ A;  1J0G A;  1V97 A;  5FR3 A;  2FCM A;  3BII D;  3X0W A;  4O1N A;  2JZP A;  2CHX A;  4LTU A;  4TSS A;  4MSQ B;  3VUX A;  1WZ3 A;  4BKG A;  2Y3A A;  3FC4 A;  1ENF A;  4LK0 M;  2DZI A;  1P9D U;  1UF0 A;  2JY6 A;  4L1B A;  3GZN B;  1C4P A;  4NJ6 A;  4P1B C;  1YNT E;  5AZG A;  1XLO A;  3WCQ A;  4MEM A;  1ET9 A;  2WXP A;  1NBF C;  2V1Y A;  2MWS B;  2XK5 A;  3SR6 A;  1WSP A;  5BYS A;  3VAW A;  1E8X A;  1C3T A;  4DHJ B;  4KGS A;  1VZ6 A;  3IHP C;  2KN4 A;  3OLM D;  1AW7 A;  3W5V B;  1YX5 B;  2UWQ A;  2L00 B;  2L83 A;  4B0E A;  3UGB B;  3ZQ4 A;  3PS6 A;  3Q8B A;  3KYC D;  3KLS X;  2PPH A;  2QSD A;  4A3P A;  2J0K A;  4LNF A;  3A9K A;  1TKE A;  4F1S A;  1FMA D;  2LVP A;  1Q5W B;  2EMT A;  2GB1 A;  2LUE A;  3GP7 A;  2CU3 A;  1SIF A;  3RMK C;  2K5P A;  1OEY J;  2H88 B;  5CHF A;  4YWG G;  4BAX A;  1FXA A;  3DWG C;  3FKY A;  3K9P B;  3DHH C;  2LXC A;  1WRI A;  4NAW B;  1VZ7 A;  4HCN B;  2WDT B;  4HPL B;  3RZF A;  3RPF C;  4XDC A;  1J8C A;  2WS3 B;  2ZPY A;  2KN5 A;  3ZDM C;  1FNW A;  2D11 A;  1CJE A;  3NZS A;  3KWL A;  2DWQ A;  1UNS A;  3NZU A;  2RPV A;  2V3N A;  2WP9 B;  5DCN A;  2JF5 A;  4A6Q A;  2MCN B;  1I4G A;  1KLG D;  2ZNV B;  3P4R B;  4IKG A;  3A9J A;  2G4S A;  1AN8 A;  4B9K A;  1PYW D;  4G11 A;  2SAK A;  2LAS A;  2Y5B B;  5D2M B;  4FXC A;  3PO0 A;  4GGQ A;  4CO7 A;  2HJ1 A;  2KMA A;  5L95 C;  5HI1 A;  2LVQ A;  1TZ1 A;  4L23 A;  3UIN B;  2MW5 A;  3ONS A;  4RGO S;  1WJ4 A;  1EU4 A;  1MJD A;  3CWI A;  3M95 A;  3ZRF A;  4N9F 4;  3R7Q A;  2WXQ A;  1QLB B;  1X1M A;  5IAA C;  4JX1 C;  4LDT D;  4II3 B;  3VH3 B;  3TMP B;  3UQB A;  1JRO A;  2KFK A;  2W54 A;  3I5J C;  2J52 A;  1TKY A;  2LZ6 A;  3VFK A;  4ICV A;  4TUU A;  1WGR A;  2K0P A;  3QCA A;  4K7U A;  5MPO A;  2VRR B;  3CSF A;  1QOB A;  3S2A A;  3AE6 B;  1YQ4 B;  4P6V F;  3B1L X;  1WI0 A;  4KGR A;  1F9J A;  1TY2 A;  3Q3F A;  3JYU A;  3NG0 A;  2MH7 A;  1PGA A;  2R61 A;  1SIJ A;  2IZV B;  1VD2 A;  3R2T A;  5KHQ A;  3AE2 B;  4AWJ A;  4MJS B;  4ASW C;  2ON8 A;  4LNO A;  3TEW A;  4II2 B;  1WJ6 A;  3HHM A;  2KKC A;  2V4I B;  1WXS A;  4F7Z A;  2WXR A;  1WM3 A;  1KH0 A;  4RF1 A;  5J17 A;  2AYO B;  1WY8 A;  4DDG D;  1DOX A;  1GPX A;  3U2S C;  1YIW A;  4XC2 A;  3T3O A;  3WAO A;  4OVZ A;  2IO3 B;  4EKU A;  1WR6 E;  3ZTD A;  3OJ4 B;  1UBI A;  4GU2 A;  2AEH A;  2GBM A;  2YEP F;  2LWP A;  2KQ7 A;  3TEY A; 
#chains in the Genus database with same CATH homology
 1TS4 A;  2OED A;  3ABV B;  3PZ8 A;  1N61 A;  1SE4 A;  1ZE3 D;  2IGH A;  2J4X A;  2Y5C A;  1D5M C;  1JWS D;  2WU2 B;  4ZRQ A;  2PVG C;  1BXT A;  1HXY D;  2I38 A;  2BS3 B;  5BMG A;  1NEK B;  1ZDX A;  5T8I A;  1XO3 A;  1JML A;  1ZP0 B;  2DLB A;  4NZL B;  1YN4 A;  1L0Y B;  2KMM A;  2EKI A;  4IOI E;  1DYQ A;  3AM9 A;  2INP E;  2L32 A;  3AEE B;  2JSV X;  2YEP B;  3KQ4 A;  5EE1 A;  1TZO A;  2INN E;  4M0W A;  2M0A A;  3I57 A;  1EM7 A;  2IJ0 A;  4REZ A;  1D4B A;  2WNM A;  2BBC A;  1F77 A;  1T3Q A;  2E6X A;  5EE9 A;  2TSS A;  3AB5 A;  5HG2 A;  3O13 A;  4IDI A;  1IBX B;  3ZYY X;  2G1E A;  4OHJ A;  1FIQ A;  4USA A;  2QIL A;  3AED B;  3SFD B;  5HHD G;  3LB8 C;  2AX5 A;  2RDH A;  4TQ1 A;  3IT6 B;  3NVW A;  3R2I A;  4HRO A;  3B2G A;  4EE2 A;  3P4S B;  3N9Y C;  4J3O D;  4Q2J A;  1UGJ A;  1N5W A;  3B2F A;  1L4D B;  3EUB 2;  3NVV A;  1P7F A;  1VDV A;  2WXJ A;  2LJI A;  3AMZ A;  2HDE A;  2KWD A;  1B9R A;  1I4H A;  3EGR A;  2MJ3 A;  3AEA B;  1IGD A;  3VRA B;  3AEG B;  2I2Y A;  4MM3 B;  5TSS A;  4RF0 A;  1FRR A;  3AEC B;  2PTL A;  1V8C A;  2ONQ A;  3NVZ A;  3Q69 A;  4A55 A;  2BTE A;  1GB4 A;  4RGM A;  4LLG M;  1ZUD 2;  3NRZ A;  5BYQ A;  4YSX B;  2D5G A;  2MJE A;  3V05 A;  3FIL A;  1I7H A;  2LGI A;  1JQ4 A;  2Q5W D;  1N63 A;  5EE0 A;  1C9F A;  2B76 B;  1M4V A;  2WDV B;  1TS2 A;  1C4C A;  3P63 A;  5I4D A;  2E3T A;  1WXQ A;  2N7J A;  3AN1 A;  1FD6 A;  1DOY A;  2JWU A;  4CQN A;  4NJC A;  2WXG A;  4GLS C;  1L0X B;  1VJK A;  2BYT A;  4ZOH C;  3AV8 A;  3HVZ A;  3AH7 A;  3TEZ A;  2L52 A;  1L4Z B;  1SE3 A;  1TS3 A;  1KRH A;  2QIE B;  1GB1 A;  5JXV A;  2N9L A;  4DQO C;  1XCQ L;  1KTK A;  1L6U A;  1MHX A;  1EU3 A;  2VZK D;  1YQ3 B;  1HQR D;  3HUI A;  4YXD B;  3Q8F A;  2ZW0 A;  1MVK A;  1ROE A;  3EA6 A;  3W5U B;  4YTN B;  4AQ7 A;  2N9K A;  1QOG A;  4ZRP A;  3SFE B;  1WYG A;  1F2R C;  3J9C A;  4MT5 A;  3AE7 B;  2DYO A;  1D5Z C;  1VZ8 A;  1Q10 A;  1SJH D;  1XLN A;  1FRD A;  1JW9 D;  1NEN B;  1LO5 D;  3BZD B;  3T3N A;  1FM0 D;  3W9C B;  3P42 A;  1ZXI A;  1L5P A;  5D3I B;  2VZK B;  4JWS C;  2JX5 A;  4WH4 A;  4D2K A;  3BVZ A;  4PT5 A;  3DWM A;  3BYT B;  3LYY A;  2FUG 1;  5D3D A;  1HZ5 A;  1NVI D;  1XLP A;  1VR9 A;  2XN9 C;  2W3R A;  3R8B A;  1J7C A;  4HKQ A;  3Q8C A;  1MHH E;  2BB6 A;  1V1O A;  4GDK B;  1E10 A;  1TYG B;  3FAH A;  3I9V 1;  2ICI A;  1ZOY B;  5FKA C;  3NVY A;  1TS5 A;  3ZJV A;  2WXH A;  1QQR A;  5FK9 C;  4HRS A;  2KAJ A;  3MHZ A;  4ZHO A;  1HA5 A;  3ZJT A;  4A9A A;  1FFV A;  1NI3 A;  2PIA A;  1IGC A;  3IAS 1;  1NYQ A;  1OFF A;  4ZYS A;  2LUM A;  3GB1 A;  1E6E B;  5H92 C;  2WDQ B;  1C78 A;  1R7S A;  2L1A A;  4HKZ E;  1GOZ A;  2JYE A;  3HVD A;  4TMA B;  5E6J A;  2BB5 A;  1I4Q A;  3W1S A;  1PUT A;  1XXG A;  1SF0 A;  1K52 A;  2WLB A;  4RH6 A;  1QKZ A;  1IUE A;  1PDX A;  1C79 A;  2WXL A;  3BVM A;  1DGJ A;  1V97 A;  2V3P A;  5FR3 A;  1QOF A;  1IBX A;  3BII D;  4US9 A;  1I4R A;  2QMT A;  4O1N A;  3TSS A;  2JZP A;  1F0Z A;  1FNV A;  1K53 A;  4LTU A;  4TSS A;  2Y3A A;  4RGN A;  1JWM D;  4ARC A;  2PW9 A;  1HEZ E;  5AUK A;  1CK1 A;  3FC4 A;  3U52 E;  1ENF A;  4LK0 M;  3AE3 B;  1E7P B;  4A8X C;  4ZHP A;  4JPS A;  4L1B A;  1C4P A;  2BT6 A;  3BK2 A;  1YNT E;  5G5G A;  1XF5 L;  2PLP A;  1XLO A;  2GRI A;  2RMM A;  2PKO A;  2WXM A;  3WCQ A;  1BUI C;  2QEJ C;  1ET9 A;  1T6B X;  1UWM A;  2M56 B;  1TY0 A;  2WXP A;  4OZB A;  3SR6 A;  1WSP A;  3MJ5 A;  1YN3 A;  5BYS A;  1N62 A;  5HFY A;  1E9M A;  1JAL A;  4XWT A;  2BS2 B;  4RFB A;  3TUO A;  1QT9 A;  5BMH A;  3C8Y A;  1VZ6 A;  4KGS A;  2KN4 A;  1AW7 A;  1ESF A;  3AEB B;  4N58 A;  4WUR A;  1A70 A;  4YSY B;  3W5V B;  1UUP A;  1OQQ A;  4C7Y A;  3H8H A;  3GS2 A;  2L83 A;  4RGT A;  2KDM A;  2EEL A;  4B0E A;  3ZQ4 A;  1WGK A;  1GAQ B;  3MP9 A;  2X38 A;  3VR8 B;  2LMC A;  2J42 A;  3Q8B A;  1FEH A;  3KLS X;  2QSD A;  4C7Z A;  1TKE A;  1L6V A;  4MAC A;  1FMA D;  1FCC C;  4DXG A;  2GB1 A;  1JCK B;  1C76 A;  1ET6 A;  3ZGZ A;  1YJI A;  3GP7 A;  1N60 A;  4RNA A;  2CU3 A;  4YTM B;  2K5P A;  2LFI A;  1SJE D;  2H88 B;  4YWG G;  1FXA A;  3DWG C;  3SEB A;  1OQR A;  3IAM 1;  4P16 A;  1TKG A;  2AQ1 B;  2IGD A;  3Q8E A;  4KKJ A;  1ACC A;  4WIP A;  1YJJ A;  2KAC A;  3U4E G;  4NAW B;  1WRI A;  1VZ7 A;  4WQM A;  4MH8 A;  5AUI A;  5H8Y E;  3RPF C;  3BYY B;  4TQ0 A;  1T5X D;  4YT0 B;  1Y56 A;  4C56 C;  5EE3 A;  2LHD A;  4XDC A;  2WS3 B;  2FE8 A;  2NTT A;  1B1Z A;  1FNW A;  4A90 A;  2JXT A;  1MI0 A;  2ACZ B;  1CJE A;  3TEX A;  3E9S A;  1BML C;  3BVG A;  2G9H D;  3CIR B;  1CQV A;  1QOA A;  1V1P B;  3KWL A;  5BMI A;  2WXO A;  2DWQ A;  1UNS A;  2RPV A;  2V3N A;  4H2A A;  2MEK A;  2WP9 B;  2CJN A;  1D5X C;  5BYR A;  4A6Q A;  3AE1 B;  3W2D A;  2W55 A;  1I4G A;  5D7G A;  1KLG D;  1FCL A;  2W82 A;  3P4R B;  2N0S B;  4WAF A;  3P1M A;  4IKG A;  5C3J B;  4HJG E;  1VRA B;  1PGX A;  2QJL A;  2WXI A;  1AN8 A;  3HRD D;  4B0M A;  1VLB A;  2DYM A;  1KFY B;  1PYW D;  2JQR B;  2SAK A;  2BW2 A;  1K51 A;  1K50 A;  1KLU D;  1JRP A;  4FXC A;  3PO0 A;  3MFG A;  1TJE A;  4OW0 A;  2K3U A;  3AEF B;  4OZA A;  3U7Z A;  1WWT A;  2AQ2 B;  4R3D A;  1YN5 A;  5HI1 A;  1J7A A;  4L23 A;  3E56 A;  1AWD A;  4OZC A;  2MJD A;  5G5H A;  4RGO S;  3VQI A;  1EU4 A;  4HEA 1;  4JWU C;  1XEE A;  3CWI A;  4KGT A;  1SSN A;  3BWU D;  2IPK D;  3P4Q B;  4US8 A;  1KF6 B;  3ETR A;  2WXQ A;  1QLB B;  4JX1 C;  1YMH E;  1SEB D;  1ZPS A;  3MC0 B;  3PZ7 A;  1I4P A;  4GDL B;  1CZP A;  2RDG A;  4ITK A;  1NYR A;  3VRB B;  2KQ4 X;  2FBW B;  2WXN A;  1EWY C;  1FXI A;  1JRO A;  3OWE B;  3VR9 B;  2W54 A;  1SB3 C;  2GI9 A;  3AE8 B;  1D6E C;  2J52 A;  1TKY A;  1ZDV A;  2IDY A;  3RFZ B;  2Z8L A;  1QF6 A;  1JWB D;  2J53 A;  2K0P A;  2SEB D;  3V3X A;  1AYF A;  2LEK A;  5MPO A;  1RWS A;  1JWU D;  4RCO A;  2BS4 B;  1PFD A;  1C77 A;  1C4A A;  1ZXH A;  1QOB A;  3IT4 B;  1RYJ A;  3AE5 B;  3AE6 B;  3P4P B;  3AE4 B;  4UDU C;  3Q8A A;  1YQ4 B;  4P6V F;  4XDD A;  2PVO D;  4KGR A;  3NZ3 A;  1JWA D;  1TY2 A;  1DOI A;  2JYT A;  1RM6 C;  2MH7 A;  2IGG A;  4XE0 A;  3FIL B;  1PGA A;  3URY A;  2R61 A;  1SIJ A;  3R2T A;  3AE2 B;  1FFU A;  2ON8 A;  2WQY B;  4N6E B;  2K22 A;  2ZW1 A;  3NUH B;  3TEW A;  4WWM A;  3IXS A;  2OHF A;  1STE A;  1E0Z A;  2V0G A;  1SE2 A;  1N5X A;  3ZJU A;  1SBB B;  2V4I B;  2JU6 X;  2AQ3 B;  3BK1 A;  1XCT L;  4YTP B;  3NS1 A;  2WXK A;  2W3S A;  2DBY A;  4JE3 B;  2WXR A;  3KWV A;  1SXT A;  1UWX A;  1KH0 A;  1MPE A;  2WU5 B;  4RF1 A;  5GXG B;  4YSZ B;  4L2Y A;  2CJO A;  2LHE A;  1XLQ A;  1L0V B;  1RFK A;  3AE9 B;  2K9X A;  5C2T B;  3B9J A;  1P7E A;  4NAM A;  4DXF A;  2WDR B;  1DOX A;  2XNA C;  1GPX A;  2WXF A;  2PMV A;  1V1P A;  3U2S C;  1FO4 A;  4ARI A;  1PGB A;  5LNK 1;  2H89 B;  3LXF A;  4XWW A;  3T3O A;  1F2R I;  4OVZ A;  1FNU A;  4AS1 A;  4N59 A;  4KX6 B;  2HTM E;  1I4X A;  2NTS A;  3L4P A;  4C80 A;  2M19 A;  2Y5P A;  2NMQ A;  1J7B A;  1QIL A;  2YEP F;  4KKI A;  1HZ6 A;  3UI3 A;  3TEY A;  1EWC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...