3AEBB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 58
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aebB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aebB01
3CWIA 1UWMA 3AE7B 3AE1B 1R7SA 1ZUD2 2CJOA 3KWLA 4HROA 3W5VB 3W9CB 4US8A 3RPFC 1GTHA 1EWYC 2BS3B 1VLBA 1ZXIA 1L5PA 1OQQA 1L6UA 3NVYA 5EE0A 2MH7A 2K22A 2Q5WD 1GTEA 1E6EB 1NEKB 4YTNB 3AE3B 3NVVA 4KX6B 5GXGB 3CIRB 3AEEB 2PKOA 2WLBA 1QOBA 4YT0B 1H7WA 4A9AA 3DWGC 1DOYA 3P4QB 2WS3B 1H7XA 1N5WA 2FBWB 4LTUA 1AYFA 1YQ3B 1OFFA 4YXDB 2AX5A 1XLNA 3L4PA 1N5XA 4P6VF 1YJIA 1N63A 3AEDB 1SIJA 5G5GA 1OQRA 2WDQB 3BIID 1JWBD 4YSZB 2PVOD 1I7HA 1FMAD 1TYGB 2CU3A 4USAA 2MJEA 2W54A 3AM9A 2H89B 2HTME 2WU2B 1N61A 3CF4A 2QIEB 5H8YE 2KAJA 1FFUA 3NVZA 2L52A 1RWSA 1FIQA 1JQ4A 5C2TB 1QT9A 1SB3C 2WU5B 1V97A 4N6EB 1AWDA 1FM0D 1KRHA 2JX5A 3SR6A 2JQRB 1QOFA 3AN1A 2LEKA 3LXFA 3VR9B 4US9A 3AECB 3SFDB 3VR8B 3HUIA 2MJ3A 1PFDA 1V8CA 5AUIA 4ZHPA 1A70A 3AE2B 1KFYB 4ZOHC 1E7PB 2DBYA 2M19A 1WXQA 2H88B 4YSYB 1JWAD 1RYJA 1TKYA 1L0VB 1ZOYB 3FAHA 2DWQA 1FXAA 2BT6A 3P63A 3AEFB 3AE5B 5AUKA 3HVZA 2KMMA 1NYRA 2M56B 4WQMA 1QLBB 1N60A 3AE4B 2Y5CA 2B76B 1N62A 3P4SB 3AV8A 1ZP0B 1F0ZA 2CJNA 4JWUC 5H92C 1JROA 2BS4B 1VDVA 1E0ZA 3SFEB 3HRDD 3AB5A 3ETRA 3B9JA 1TKGA 4JWSC 1E10A 1PDXA 3B2FA 1E9MA 3AH7A 3P4RB 1FRRA 5EE1A 4ITKA 1NYQA 2K9XA 3ZYYX 4ZHOA 1RFKA 1NI3A 5EE3A 2OHFA 1FRDA 1DOIA 2WDRB 1WGKA 1VJKA 2WDVB 2EKIA 2W3RA 1GT8A 1WYGA 2PIAA 2N0SB 3LB8C 2WQYB 1XLOA 1ROEA 1XLQA 2E3TA 2PVGC 2W3SA 1WRIA 2WP9B 4IDIA 3NS1A 3VRAB 1XO3A 1CJEA 2K5PA 3DWMA 4YTMB 1J7BA 1QOAA 2BS2B 3AMZA 1FXIA 5MPOA 1WWTA 3NVWA 1YQ4B 3AEAB 3EUB2 3FC4A 1NVID 1KF6B 3P1MA 1DGJA 1J7CA 1L6VA 1QF6A 4C7ZA 3AEGB 4C7YA 3AE9B 3VRBB 2L83A 4WWMA 1JW9D 1FFVA 1B9RA 1CZPA 1FO4A 4C80A 3AEBB 1TKEA 3AE6B 1GAQB 4YSXB 1J7AA 1T3QA 3P4PB 4HRSA 3NRZA 3PO0A 3AE8B 2QJLA 4N59A 3W5UB 1JALA 2ACZB 4FXCA 1GPXA 1DOXA 1QOGA 3ABVB 1NENB 1IUEA 1RM6C 1JRPA 1XLPA 2G1EA 5C3JB 2W55A 3B2GA 5G5HA 4JX1C 1TJEA 1YJJA 3WCQA 4YTPB 1SF0A 1PUTA 5EE9A 4N58A 2MJDA
chains in the Genus database with same CATH superfamily
3NOBA 3AE1B 1ZUD2 2KKCA 1VLBA 1EWYC 2C7MB 1E8ZA 5D3DA 4XYCA 2BPSA 3AE3B 3CIRB 2INCC 1YN5A 4A9AA 2RDBC 2FUHB 1SIFA 1E90A 1PGXA 5HI1A 2W82A 3PREA 5FR6A 1V5OA 1K8RB 5IAAC 2HTME 4HCPB 4TKNA 2NTSA 2LVQA 4G0NB 4KGTA 4MSQB 2KXJA 3LDZE 1AW7A 1D5ZC 3RNFC 4CQNA 4YSYB 1L0VB 1ZOYB 5AUKA 1IYFA 2WGSA 3V6CB 1T0SC 1VDVA 1E0ZA 2KZRA 4NPNA 4CHKA 4JWSC 3P4RB 2SEBD 3ZRFA 4ZHOA 5HKHA 2JT4B 1VJKA 1QILA 1WR1A 1EF5A 4XZ4A 2KFKA 3MC9A 3T3OA 2YEPF 2IPKD 4IUMB 4D2KA 1CJEA 2XK5B 4YTMB 2BB5A 4LCDE 3QQ8B 4DXAB 4A90A 2G4SA 4NJ6A 3R3MA 2L7RA 4FULA 1EUVB 4KDLB 1TY0A 2QDFA 5J18A 4ANUA 3PGEA 1SE2A 5D6JB 2ACZB 2D3AA 1WFYA 2QHOA 2IY0B 2WXGA 3PT2B 2V3SA 4HROA 2LI5A 2RSUA 1ISNA 2FIDA 1L5PA 4JLCA 3RN9C 1QKZA 1E6EB 3DVNU 3VVWB 2RMMA 3VXWA 3GB1A 1UNSA 1OFFA 1YQ3B 3APFA 4OVUA 4B0MA 3DBRI 3CF6E 3AEDB 2FCSA 3ZJTA 2LGDA 2K6DB 4X57B 1JQ4A 5C2TB 4DXGA 3PRMB 1QOFA 1WX7A 1PFDA 2L00B 5AUIA 3VH3B 1A70A 3AE2B 4MSMB 1P1AA 3LJ3A 1RRBA 3HM3A 3KH0A 2KFJA 3IXSA 1N62A 1D3ZA 2TSSA 3DBRB 3V3XA 3X0WA 3WA0A 3A1QB 3QA8A 4J3OD 2GB1A 3OWEB 1ZW7A 3ZYYX 4NAWB 2G9HD 1FRDA 1DYQA 2ZPNA 1WXMA 2PIAA 2WQYB 2W3SA 1E7UA 2E3TA 4K7UA 2O6VB 3VH4B 1XD3B 2NMQA 1QZEA 5LXHA 1F1HA 3VUXA 4A3PA 3TSSA 2ZZPB 2V0GA 1NVID 1Y8RC 4R3DA 3OJ3A 3O65B 1TKEA 2N7DA 3V6EB 1Q1OA 5KHQA 1M4VA 5JHAA 3ZO5B 4FHKA 3APDA 1ZDXA 4DDGD 1UWMA 1XEEA 1VRAB 1A5RA 2CHXA 4K3BA 1GTHA 2BYVE 3HK0A 5L83A 1WR6E 3EHVA 2RDGA 2WLBA 4LJPB 1I4RA 1DOYA 3EFUA 2PE6B 1L4DB 4P6VF 1N5XA 2IBIB 3RNBC 5G5GA 2WDTB 3U7DA 2CU3A 2QIEB 3VTWA 4ICUA 4L2YA 4O1NA 1SE4A 1GC7A 1V5TA 5AZGA 3SR6A 1KH0A 3U4EG 4W9EA 3H6NA 4ZHPA 1F77A 4JE3B 3RNEC 2LUMA 3N30A 2V1YA 1WXQA 4WURA 3PS6A 3RNAC 3Q3JA 4ZYSA 3W1SC 2PE9A 4PT5A 2LGIA 1ZP0B 2BQQA 4JWUC 2BYFA 2KTRB 3R7RA 4P16A 4IM2A 1J19A 2BYTA 4F8CB 1T0QC 2DZJA 2OHFA 1WGKA 3R7QA 3Q3OC 4DWFA 5HHDG 3V05A 3GOEA 2E6XA 3VRAB 4NAWA 1B1ZA 3M62B 3X23A 4PYZA 5KHOA 1WWTA 4IWQA 1K52A 3UF8A 2IO2B 1YQ4B 4ANXA 1T0RC 2JXTA 4W9CA 2O6VA 2LFIA 3AEGB 4FJYA 1B9RA 3MHSD 3RZFA 2M17A 1ET6A 4OW0A 1TZ1A 2GBJA 2KN5A 1JWUD 2I1KA 4ZDVA 4DQOC 3EC8A 4LNOA 3WCQA 1ZE3D 4K3CA 2IO3B 3BY4B 4AWJA 4WJOA 2DHZA 2KQ7A 1ZXHA 4EE2A 4KZ0A 4US8A 3N1XC 3ZKJC 3BWUD 2W9NA 5EDSA 2RR9A 5IN7A 4ZRKA 4P1CC 1QOBA 2MBOA 1K51A 4F1SA 3KUZA 3NJTA 4NQKE 2WXOA 3U2SC 2FBWB 4LTUA 2O6VD 3WAOA 1PGBA 3Q8FA 3ZXRA 1OQRA 1IP9A 2MJEA 3AM9A 2ZVNA 3CF4A 2KAJA 2KLCA 3I57A 2ZEQA 3U30A 2OOBB 4MJSB 2LEKA 2M0AA 4XX5A 1V8CA 1H4RA 3DHHC 3DBHB 2FAZA 2FCQA 2CR5A 4G11A 1HA5A 2G45B 2J0KA 2KMMA 1NYRA 4FJZA 3ENEA 1L0YB 1H8CA 1I42A 2CJNA 2K3UA 5BMIA 1YJ1A 2RGFA 1WJNA 5AEKB 3IBEA 2WXRA 2KDFB 2KTRA 3Q3MC 2D3GA 2WP9B 3PLVA 3RCZA 2NS5A 3RNGC 3AXCA 3TJPA 1WJ4A 1L2NA 1QOAA 1EO6A 4WAFA 2LGYA 3N32A 3MJ5A 1UWXA 1HQRD 3PRPB 1QF6A 1UGMA 2ZPYA 2I2YA 2K1FA 2KWVB 4CO7A 2I1JA 3L10B 4J6IA 2AQ2B 2PLPA 2G1EA 1XQQA 3D32A 4JX1C 1WGHA 3Q8BA 3APCA 2BTEA 4N58A 2L0FA 2X8XX 4HJKA 2KJRA 3C19A 1TS4A 5IA7A 3AU5A 3WANA 4HLEA 3NVYA 5CX3A 2AYOB 3QC8B 2DAJA 2UWQA 1H7WA 4II2B 4WWOA 1YIWA 2REXA 2UYZB 1H7XA 2AX5A 1V9JA 2WNMA 2MEKA 2LRUA 2ZVOA 4F7ZA 4IOIE 4BKTA 1T5XD 2JU6X 3CSFA 2KANA 1FIQA 4XE0A 1KRHA 1WMHB 2IGHA 3ZNHB 3HM6X 3L13A 1HEZE 1KFYB 1OQYA 1RYJA 1SSNA 3I5JC 4HWIB 4MJSA 3PZ8A 2KT7A 2Y5CA 2OJRA 2KTFA 2NVUI 3SEBA 2WXNA 1F9JA 4HPPA 2BS4B 3VTVA 2KQ4X 1TY2A 1P3QU 1E9MA 4IWPA 4LLGM 4C00A 2FCNA 2LMCA 2WDRB 4RGOS 4P1BC 3TEWA 2VH2A 1KLVA 3RUIB 1OGWA 3HIZA 4KKJA 2L3ZA 2IO0B 3PZDA 4ZRQA 2CHZA 1TS3A 3Q6BA 2J42A 1Z2MA 4S0RA 3EUB2 4BBNF 4CYEA 1G6JA 3DVGY 2GI9A 4RH6A 2NBVB 4TMAB 1Q10A 3L16A 4AP4C 1CZPA 1FO4A 1PYWD 4ANWA 5E6OA 4GSWA 2LD9A 2KYWA 3I9V1 4EUTA 2KWCA 1ET9A 4EZLA 1CQVA 1C76A 4BFRA 2ZCCA 4NJ7A 3AULA 2ZCBA 1M94A 3QAQA 4HCNB 4NNJB 5IP4D 3M63B 2HDEA 3W1YA 5C1ZA 4YXDB 3DHGC 3PTFC 3KWVA 4ANVA 3IT4B 4IWOA 2SAKA 1WF9A 2HE7A 1WE7A 1K50A 3ZIMA 1WJUA 2L8JA 1V6EA 2JY6A 2DBYA 4YWGG 1T0YA 1FXAA 1WMHA 3AE5B 3W1SA 1WX9A 2LRWA 4IKGA 1N60A 3AE4B 1PGAA 2WXLA 1CK1A 2FIFA 2GBMA 2LUEA 2XNAC 3KVFB 2V3NA 1MVKA 1E10A 5DCNA 1WH3A 3OG5A 2RPQA 2L05A 1YX5B 2JZPA 1DOIA 3MHZA 4ICVA 2HJ8A 2WX1A 3CMMB 3CSTA 3J9CA 5D7GA 3VAWA 2A4ZA 3JYUA 2ONQA 2KX3A 4MACA 4Q2JA 5E6PA 2G3QB 4P7IA 5T8IA 4TQ1A 3QWZB 1T6BX 2NBWB 1D6EC 4DBGA 4B9KA 3EA6A 2L0TA 4TQ0A 3TMPB 3BVGA 2LGSA 1SEBD 2WXFA 4HK2A 1JWMD 1AN8A 3IHPC 2MJDA 3KWLA 2FUG1 3RI7C 3R2IA 2DLBA 3Q8AA 4AOFA 2IO1B 4TUUA 4YTNB 2LVPA 2ON8A 4YT0B 1TIFA 2K8BA 3VTUA 5BO4B 2BW2A 1N63A 2PVOD 2DNFA 3TL5A 2N7EA 2H89B 2N7JA 4E74A 5H8YE 3DBLI 4DHJB 3HHMA 2KWDA 1Q0WB 4A6QA 2Z0DB 4BOZB 3DCGA 2N9PC 4XC2A 2I38A 2ZW1A 2M19A 4XDCA 2DWQA 1TS5A 2BT6A 3TEXA 2LASA 1I4XA 5DPWA 4M0WB 4HPLB 1UBIA 3IT6B 3ZXVA 2DZKA 1HE8A 3AV8A 1WXSA 3Q8CA 4IG7B 3GE8C 1GB4A 3ETRA 4LNFA 3B2FA 1VCBA 3DBLB 3H1UA 2MHJA 1JCKB 2KVZA 2XBBC 1WYGA 2IZVB 3K9PB 2KK8A 3EFCA 4NZLB 2AL3A 1YOVB 3QCAA 4H2AA 3P42A 1WGGA 4M01A 3NHEB 1C79A 1KLUD 4XWTA 1VD2A 3RYTA 2GOWA 3Q3NC 4MEMA 4DHZE 1SJED 3W5UB 4C56C 3ZLZA 1RLFA 2RD0A 1C9FA 1WE6A 2D2QA 5BYRA 1D5XC 4L23A 4B0EA 1TTNA 4IC7B 2GRIA 4NJCA 2MH7A 1WGDA 1GTEA 2R2QA 4FADA 2D07B 4M8MA 4W9LA 1UF0A 3DWGC 3P4QB 4HKZE 2IDYA 2L1AA 2WWZA 3KYDD 4RM8A 3OAWA 2WDQB 2EKEC 4FN2A 2VZKB 3M3JA 1RWSA 2BYEA 3B08A 4WJPA 4A8XC 5JHBA 3NS8A 2MLBA 4JIOU 2ZW0A 1JWAD 1TKYA 3BYYB 3P63A 4AUQC 4M02A 1WXVA 3GP7A 3KW5B 2LXAA 2JUOA 1LM8B 4AJWA 4BKSA 5LXIB 1F0ZA 2MBBB 3AI5A 2GBRA 1Q5WB 3AB5A 4HPMB 3TCAA 4M0WA 4DDID 1S3SG 3MC0B 5JH5C 5TR5A 2RDHA 4RGMA 1GOZA 1GUAB 2EKIA 3FKYA 3ZQ4A 1GG3A 1XLQA 1XLOA 2GLSA 2AQ3B 4A55A 2FCMA 1HXYD 2KOXA 2PW9A 4RNAA 3IAS1 4DHJD 2IJ0A 4AJYB 2KDMA 1WIAA 3NVWA 1BT0A 4GB9A 2LGXA 4BKSD 4WWMA 2X38A 1FFVA 3AE6B 4JGHB 1GAQB 3DDCB 3DPDA 1V1OA 3PO0A 1R4MI 5LNK1 1GPXA 4B95A 4BOSC 1I4QA 4ARIA 2NPTB 5C3JB 1UZXB 4LNKA 2R2OA 4YTPB 2IY1B 4BZAA 4DXFA 2L76A 5GMVA 3L54A 2KX0A 3W9CB 3QJZA 4DHZB 2WXQA 2KDIA 4EZKA 1NEKB 4KX6B 2G4DB 2K25A 5G55A 4N9F4 4NQLB 2KMAA 1WGYA 3L4PA 1R4MB 3BIID 2WU2B 1N61A 2C7NB 3JVZX 2MQJA 4GU2A 2J0JA 3R66C 3ZJUA 1QT9A 1LFDA 1E5WA 2JX5A 5DPSA 3AN1A 3VR9B 4US9A 3DBHI 2QSDA 2YVCA 4FHJA 3MFGA 2MCNB 2KN4A 2BWFA 1S1QB 1I4GA 4UDUC 4OZAA 2M56B 4MGYE 4GLSC 4W9FA 3V60A 2WXMA 3DQVA 3C0RB 2BF8B 3L0WB 3ZW3A 4BKGA 4MGKE 4W9HA 1NYQA 4PS3A 1BMLC 2ASQA 1RFKA 4ACFA 4XGAB 2WX0A 3Q69A 4KGSA 3H7PB 5J17A 4OZCA 3PHXB 2VZKD 1QQRA 4M00A 5MPOA 4ZRPA 3AEAB 4PYUA 2K0PA 1PQSA 3VRBB 4W9IA 3AEBB 1C78A 1J7AA 2OEDA 3DHIC 4N59A 4URKA 3NG0A 2HJ1A 4HKQA 5D3IB 3DOWA 3SD5A 2KDEB 3ABVB 1EU3A 1SF0A 4MH8A 3KUCB 3I3TB 4IM0A 3DVGX 3AE7B 5CHFA 2NPTA 4GN1A 3AEEB 3DBSA 1OEYJ 3RMKC 2N1VA 2LJ5A 2JWZA 3VDZA 1J8CA 3N1YC 3T8MA 1SJHD 2DYOA 4GIVA 1D5MC 1FMAD 3R2TA 2QC8A 3PRZA 1HTOA 1ZPSA 1AWDA 3A33B 2K6QA 3BVMA 3LYYA 1P0RA 1FXTB 2J0MA 3HUIA 1FD6A 1EM7A 4ZOHC 1I4PA 2KACA 3HVZA 4NY0A 2YLMA 2Y5BB 1P7FA 4G50A 4GGQA 1N6ZA 2BB6A 3MC8A 1ZGUB 3B9JA 4LNNA 4WJQA 4KSLC 2RPVA 1PDXA 1FPYA 3KYCD 1LO5D 2K9XA 4MGZE 3LB8C 2MBQA 4IDIA 2J4XA 1L4ZB 3A9KB 3ZDMC 1F2RI 4WQOB 3UIOB 3IVFA 1C1YB 2IGGA 3H7PA 4GOCA 2L83A 2WXHA 2K8CA 4S17A 2INPE 5D2MB 2D5GA 1YMHE 3MJWA 1D4BA 4HRSA 2GBKA 5BMGA 2BBCA 1DOXA 2KQSA 3OLMD 2JYTA 2BKFA 3RD2A 2W55A 2D11A 4RM9A 5EE9A 3P1MA 3ECIA 1V2YA 1R7SA 3W5VB 4FJVB 4ARCA 2KDBA 3PPAA 3RPFC 2V4IB 3UQBA 1MHHE 1V49A 2KMCA 3VFKA 3RNCC 3SHQA 3GE3C 1IPGA 3N1ZC 1ENFA 2R61A 3KQ4A 2IGDA 1WRDB 3JSVB 1FCLA 3ML9A 4E3CA 3N3KB 4HDOA 3WALA 3E9SA 2GMIC 4HEA1 1YN4A 4OVVA 1VZ7A 2KLGA 3AECB 3UIPB 2MJ3A 1XT9B 2MX2A 3PVLA 4KDIC 3FAHA 2D3BA 1LXDA 2DZIA 5L95C 2B76B 3ZDTA 1EU4A 5IO9A 3URYA 1GB1A 3AH7A 2J52A 4RFBA 5CTRC 1NI3A 5D94A 1LQBA 3TBLD 2FE8A 2KNBA 4EZJA 1WRIA 3MP9A 3ZUNA 3NS1A 3W2DA 3KUDB 4I6NB 2QEJC 2PMVA 1J7BA 4HJGE 5AZHA 3AMZA 1FXIA 3M95A 2AL6A 2V3PA 3N9YC 2JRIB 3FC4A 1ZKHA 5FK9C 1R4NI 2DAFA 1DGJA 1P9DU 2NCNA 1J7CA 2YEPB 1C4CA 3A9KA 3K9OB 2LWPA 4C4VB 1L0XB 1WX8A 5HFYA 4RF1A 3TEYA 2N9XA 3BVZA 3U7ZA 1XLPA 5G5HA 3PLUA 1YJJA 1PUTA 1SXTA 3CWIA 2CJOA 5JXVA 1MPEA 4OHJA 2QCZA 4W9GA 3U52E 4WIPA 1R4NB 2PKOA 4K7SA 4MT5A 3RULA 4MDKE 3V61A 4BAXA 1Z5SB 3C8YA 1HZ6A 1XLNA 4GDLB 1WM2A 5DPTA 2ZJDA 3PZ7A 4YSZB 4USAA 3E56A 2BVCA 2L52A 2PEAA 2BGFA 1V97A 2WU5B 3JSVA 4WAAA 1WJ6A 4M8NA 1K53A 1TBEA 2OJWA 4GDKB 2JZ3B 1UUPA 1YD8U 2C9WB 1JMLA 4A3OA 4REZA 1JRUA 3ZTDA 3OJ4B 1YX6B 1QLBB 1C4AA 4PS8A 3H8HA 1V86A 4HVBA 3UI3A 2KC1A 4L1BA 3RT3B 3A4SC 1IBXB 1GNUA 4ITKA 1UH6A 1ESFA 1OTRB 2N0SB 2LZ6A 2N9KA 2DZMA 2WXPA 2BS2B 1C77A 4KVGB 4GMVA 1FEHA 4C7YA 3VUWA 3TUOA 3EECA 2XN9C 5DPRA 4PK1A 2QJLA 3Q2AC 4RGNA 1EWCA 2MWSB 3B2GA 3MTNB 2WHIA 4C4VA 1VR9A 3SU8X 1SE9A 3R8BA 3ZNZB 1STEA 2K39A 1ZXIA 2ZNVB 2V4LA 3ONSA 5GXGB 3P2BA 1N5WA 3BK2A 3VHTC 1I4HA 2LJIA 2N4FA 2DYMA 1FFUA 2PTLA 4EEWA 1SB3C 2M4NA 2GBNA 5E6NA 5IKCM 4GDLA 3NUHB 3BZDB 2JQRB 3TEZA 3NZUA 2KO3A 1IGCA 2EELA 4EFOA 2DENB 3A9JB 2MA9B 2WYQA 2VRRB 4GDKA 4WQMA 2BWES 4WWNA 1MJDA 3HRDD 2KD0A 2QILA 1FRRA 5EE1A 4LJOB 2XK5A 4FA6A 1Y56A 2BKRB 2B3AA 3JW0X 4RMAA 3IG3A 3ZJVA 1U4AA 3A4RA 1IBXA 2MRPA 1WZ3A 3QIJA 2WXIA 2KHWB 1BUIC 3B0AA 2AWTA 1KF6B 3BK1A 3WIMA 3NZ3A 4IW0A 2C7HA 1FNVA 3VUYA 1E8XA 2V9HA 1WI0A 2XEWA 4C80A 1KM7A 4YSXB 3S2AA 3P4PB 1UELA 2N1WA 4K81A 3AE8B 3I63C 1GC6A 1KTKA 3PSEB 4WWPA 1NDDA 1UBQA 2MW5A 4KKIA 3L17A 4HXDA 4XDDA 4RF0A 1KJTA 2FNJB 1TZOA 4BBNC 2EMTA 2K22A 2QMTA 3FILB 4G3XB 3TIXA 1WXAA 4LDTB 1I35A 2EMSA 4QAYA 2WXJA 2K8HA 3U8ZA 1SIJA 3RZWC 3ZNID 3O13A 1JWBD 3ALBA 1YN3A 2W54A 4KIKB 4NAMA 4JL9A 3NVZA 3ZRCA 1FM0D 1XXGA 2CS4A 1HTQA 4MM3B 2KJHB 3BINA 2NTTA 4B6WA 3VR8B 3ZTCA 3A1QA 1FCCC 2JF5A 2LHDA 5FR3A 2LHEA 2N9LA 4W9JA 3SDLC 1F2RC 2MBHA 2J53A 3A9JA 4AQ7A 1MFWA 1LGRA 3QARA 2CKHB 1WYWB 1SBBB 2MSED 4A20A 2WDVB 2W3RA 1KLGD 4K7WA 3Q3FA 1ROEA 4KV2A 2JSVX 1UD7A 2KWUB 4WH4A 2IYDB 2DX5B 1AARA 2K5PA 2JVCA 1V1PB 4MGIE 3UGBB 2JWUA 5BYQA 4ZRJA 1IGDA 4GXBA 4C7ZA 3IFWB 1JW9D 1C4PA 2M1MA 1FNWA 3V62A 3H7SA 3BYTB 4FXCA 2N9EB 3ZNGC 5JZEB 3PHWB 1RAXA 1TJEA 4KSKC 1JWSD 5TSSA 2UU7A 3B1LX 4KGRA 2BS3B 5CHVC 1UGJA 4LNIA 3QX1A 4JQWC 4ZYNA 3GZNI 1TGZB 2Y3AA 2WS3B 5AZFA 2INNE 3H9DA 1NI2A 3ML8A 1I7HA 1TYGB 3FILA 4ZRIA 2O2VB 5CHWA 2MP2B 4I6PA 2LXCA 3NY5A 1MI0A 2NBUA 4RGTA 3WAPA 3KLSX 1VZ8A 4KIKA 4AS1A 2H88B 1XCTL 2JRHA 4I6LB 4IM3A 4OVZA 3Q14C 3AEFB 2D10A 4MM3A 2C60A 3Q8EA 3GZNB 2WXKA 3UINB 1XF5L 3P4SB 1JROA 2DYBA 4JPSA 2C5LC 5C23A 2AEHA 1WGRA 1SGHA 5EE3A 1C3TA 4LDTD 4II3B 4MH0E 4WJNA 3QK0A 5BMHA 2NR2A 2MBEA 5LLIA 1YQBA 3N20C 2M0XA 4HDQA 1XO3A 4KZCA 5J2RA 5E6JA 1P7EA 4W9KA 4EOYA 2CU1A 2HD5B 4BVUC 5BYSA 1KOTA 1V1PA 2CHWA 2KVRA 4FLHA 1T3QA 3QHTA 1JALA 1V80A 2LVOA 1QOGA 1F52A 1MG4A 2M8SA 1NBFC 1YNTE 1MHXA 1E7VA 1J0GA 4LK0M 2D3CA 4XWWA 2Y5PA 4E71A 1L7YA 1OQQA 1L6UA 5EE0A 2JYEA 2VH1A 2Q5WD 4K1RB 3NVVA 1TT5B 3RFZB 2A5UA 3UQAA 1P98A 4W9DA 5IOIA 1AYFA 3ZVVA 1YJIA 1TS2A 2JXXA 4DK5A 1SE3A 2L32A 1MG8A 2PJHA 1WM3A 5HG2A 3T9LA 1XCQL 5G2NA 1EF1A 4TSSA 1ZDVA 4N6EB 1ACCA 1FNUA 2JPHA 3GS2A 3LXFA 4FBJB 3SFDB 1RFAA 2O2VA 2AQ1B 2MP2A 2INDC 1V81A 1E7PB 1E8WA 5I4DA 2Z59B 3DVNV 2ZNVC 2J7QB 4ASWC 2JZZA 5H92C 1VZ6A 3SFEB 2PPHA 3PV1A 1TKGA 2KFKB 3T3NA 1WY8A 2ICIA 3AU4A 4YL8A 1GT8A 3IAM1 3EGRA 4EKUA 2KJ6A 2KC2A 2PVGC 3NZSA 5FKAC 3WAMA 1OEYA 4PS7A 3DWMA 1WZ0A 3L08A 4TV3A 1HZ5A 4OZBA 1BXTA 1L6VA 1WSPA 2Z8LA 3AE9B 3ZGZA 1CMXB 1X1MA 1GJZA 2HTHA 3NRZA 1E8YA 3HVDA 4MELA 1NENB 1IUEA 1RM6C 1JRPA 3VQIA 4RCOA 2Z0EB
chains in the Genus database with same CATH topology
3AE1B 1ZUD2 3W9CB 3R8BA 1STEA 1VLBA 1EWYC 1TS4A 1ZXIA 2WXQA 5D3DA 3NVYA 1NEKB 3AE3B 4KX6B 5GXGB 3CIRB 1H7WA 1YN5A 4A9AA 1H7XA 1N5WA 3BK2A 1PGXA 3L4PA 2AX5A 5HI1A 2WNMA 1I4HA 2MEKA 2W82A 3BIID 4IOIE 2LJIA 1T5XD 2HTME 2WU2B 1N61A 2DYMA 2JU6X 1FFUA 2PTLA 1FIQA 3ZJUA 1SB3C 1QT9A 2NTSA 4XE0A 3NUHB 1KRHA 2JX5A 4KGTA 3BZDB 2IGHA 2JQRB 3AN1A 3TEZA 3VR9B 4US9A 1AW7A 1D5ZC 1IGCA 2QSDA 2EELA 3MFGA 4CQNA 1HEZE 1KFYB 2KN4A 4YSYB 1RYJA 1SSNA 1L0VB 1ZOYB 5AUKA 1I4GA 4UDUC 3PZ8A 4OZAA 2M56B 4WQMA 4GLSC 2WXMA 2Y5CA 3SEBA 2WXNA 1VDVA 2BS4B 1E0ZA 3HRDD 2KQ4X 1TY2A 4JWSC 1E9MA 2QILA 3P4RB 1FRRA 5EE1A 1NYQA 2SEBD 1Y56A 1BMLC 4LLGM 4ZHOA 1RFKA 2LMCA 2WDRB 1VJKA 1QILA 3Q69A 3ZJVA 4RGOS 3TEWA 3T3OA 1IBXA 2YEPF 2IPKD 4KGSA 4D2KA 4KKJA 4OZCA 2VZKD 1CJEA 1QQRA 2WXIA 4YTMB 2BB5A 4ZRQA 5MPOA 1BUIC 1TS3A 2J42A 4ZRPA 3AEAB 3EUB2 4A90A 1KF6B 3BK1A 3NZ3A 2K0PA 3VRBB 1FNVA 2GI9A 4RH6A 4TMAB 1Q10A 1TY0A 1CZPA 1FO4A 4C80A 3AEBB 1C78A 1PYWD 4YSXB 1J7AA 1SE2A 3P4PB 2OEDA 3AE8B 4N59A 2ACZB 4HKQA 5D3IB 3ABVB 1KTKA 1EU3A 2WXGA 3I9V1 4KKIA 1ET9A 1SF0A 4XDDA 4MH8A 4RF0A 1CQVA 3AE7B 4HROA 1C76A 1TZOA 1L5PA 1QKZA 2K22A 1E6EB 2RMMA 3AEEB 2QMTA 3FILB 3GB1A 1UNSA 2HDEA 1OFFA 1YQ3B 4B0MA 4YXDB 2WXJA 1SJHD 2DYOA 3AEDB 1SIJA 3KWVA 3IT4B 1D5MC 3O13A 1JWBD 1YN3A 1FMAD 2SAKA 2W54A 3R2TA 3ZJTA 4NAMA 3NVZA 1K50A 1ZPSA 1JQ4A 5C2TB 1AWDA 1FM0D 1XXGA 4DXGA 3BVMA 4MM3B 1QOFA 3LYYA 2NTTA 3HUIA 3VR8B 1PFDA 1FD6A 5AUIA 1A70A 3AE2B 1EM7A 1I4PA 2DBYA 4ZOHC 4YWGG 1FCCC 1FXAA 2KACA 2LHDA 3AE5B 3W1SA 3HVZA 5FR3A 2LHEA 2N9LA 1F2RC 4IKGA 1N60A 3AE4B 3IXSA 1PGAA 1P7FA 2WXLA 1N62A 1CK1A 2TSSA 3V3XA 2BB6A 2J53A 2XNAC 4AQ7A 2V3NA 1MVKA 3B9JA 4J3OD 1E10A 2RPVA 1PDXA 2GB1A 1SBBB 1LO5D 2K9XA 3OWEB 3ZYYX 4NAWB 2G9HD 2JZPA 1FRDA 1DOIA 1DYQA 3MHZA 2WDVB 2W3RA 1KLGD 2PIAA 3LB8C 2WQYB 2W3SA 1ROEA 2E3TA 2JSVX 3J9CA 4IDIA 4WH4A 5D7GA 2J4XA 2ONQA 1L4ZB 2K5PA 4MACA 2NMQA 4Q2JA 1F2RI 1V1PB 2JWUA 5T8IA 5BYQA 2IGGA 4TQ1A 3TSSA 2V0GA 1NVID 4R3DA 1IGDA 1T6BX 1D6EC 4C7ZA 2L83A 2WXHA 1JW9D 1C4PA 3EA6A 1TKEA 2INPE 2D5GA 1YMHE 4TQ0A 1D4BA 4HRSA 1FNWA 5BMGA 1M4VA 3BVGA 3BYTB 2BBCA 4FXCA 1DOXA 2JYTA 1SEBD 2WXFA 1JWMD 2W55A 1TJEA 1AN8A 1JWSD 5EE9A 1ZDXA 2MJDA 3P1MA 5TSSA 1UWMA 1XEEA 1R7SA 1VRAB 3KWLA 3W5VB 4ARCA 2FUG1 3RPFC 2V4IB 4KGRA 3R2IA 2DLBA 1GTHA 2BS3B 3Q8AA 1UGJA 1MHHE 4YTNB 2RDGA 2ON8A 2WLBA 4YT0B 1ENFA 2R61A 1I4RA 2Y3AA 1DOYA 2WS3B 3KQ4A 2IGDA 2INNE 1L4DB 4P6VF 1FCLA 1N5XA 4DXFA 2BW2A 1N63A 5G5GA 2PVOD 1I7HA 1TYGB 3FILA 2CU3A 2H89B 2N7JA 2QIEB 5H8YE 4L2YA 4O1NA 2KWDA 1MI0A 1SE4A 3E9SA 4RGTA 1KH0A 4HEA1 1YN4A 3SR6A 4A6QA 1VZ7A 3U4EG 3AECB 1VZ8A 3KLSX 2MJ3A 4ZHPA 1F77A 2I38A 4JE3B 2LUMA 2ZW1A 2M19A 1WXQA 4WURA 2H88B 1XCTL 4AS1A 4XDCA 3FAHA 4OVZA 2DWQA 1TS5A 2BT6A 3AEFB 3TEXA 3Q8EA 1I4XA 2WXKA 4ZYSA 1XF5L 3IT6B 4PT5A 2LGIA 2B76B 3P4SB 3AV8A 1ZP0B 4JWUC 1EU4A 1JROA 3Q8CA 1GB4A 3ETRA 4P16A 4JPSA 3URYA 3B2FA 1GB1A 3AH7A 2J52A 2BYTA 4RFBA 5EE3A 1NI3A 2OHFA 1JCKB 1WGKA 1WYGA 2FE8A 5BMHA 5HHDG 1WRIA 3MP9A 3V05A 2E6XA 3NS1A 3W2DA 3VRAB 1XO3A 1B1ZA 2QEJC 2PMVA 1J7BA 4NZLB 4HJGE 5E6JA 1P7EA 3AMZA 4H2AA 1FXIA 3P42A 1WWTA 1K52A 2V3PA 3N9YC 1YQ4B 1C79A 1KLUD 3FC4A 5FK9C 2YEPB 1DGJA 1J7CA 2JXTA 4XWTA 2LFIA 3AEGB 1C4CA 5BYSA 1B9RA 1V1PA 1ET6A 1L0XB 4OW0A 5HFYA 1SJED 1T3QA 4RF1A 3TEYA 3W5UB 1JALA 1JWUD 4C56C 3BVZA 1QOGA 3U7ZA 1C9FA 1XLPA 4DQOC 5G5HA 1YNTE 1MHXA 1YJJA 3WCQA 1ZE3D 1PUTA 1SXTA 4LK0M 3CWIA 2CJOA 1ZXHA 4EE2A 5JXVA 1MPEA 4US8A 5BYRA 4XWWA 1D5XC 4L23A 4B0EA 2Y5PA 4OHJA 3BWUD 1OQQA 1L6UA 2GRIA 5EE0A 4NJCA 2JYEA 2MH7A 3U52E 2Q5WD 1GTEA 3NVVA 4WIPA 2PKOA 1QOBA 1K51A 4MT5A 3RFZB 3DWGC 2WXOA 3P4QB 3C8YA 3U2SC 4HKZE 2FBWB 4LTUA 1AYFA 2IDYA 1PGBA 1HZ6A 3Q8FA 1XLNA 2L1AA 4GDLB 1YJIA 1TS2A 1OQRA 2WDQB 3PZ7A 4YSZB 1SE3A 2L32A 4USAA 2MJEA 3E56A 3AM9A 5HG2A 1XCQL 2VZKB 3CF4A 2KAJA 3I57A 2L52A 1RWSA 4TSSA 1V97A 2WU5B 1ZDVA 4N6EB 1ACCA 1FNUA 4A8XC 1K53A 2LEKA 3GS2A 3LXFA 3SFDB 4GDKB 2M0AA 2AQ1B 1V8CA 2ZW0A 1UUPA 1E7PB 1JWAD 1TKYA 3BYYB 5I4DA 3P63A 1JMLA 4REZA 1HA5A 3GP7A 2KMMA 1NYRA 1QLBB 1C4AA 1L0YB 1F0ZA 2CJNA 3H8HA 5H92C 1VZ6A 3UI3A 3SFEB 3AB5A 4L1BA 1TKGA 2K3UA 5BMIA 1IBXB 4M0WA 4ITKA 3T3NA 3MC0B 2ICIA 2RDHA 2WXRA 4RGMA 1ESFA 1GOZA 2EKIA 1GT8A 3IAM1 3EGRA 3ZQ4A 2N0SB 1XLQA 1XLOA 2PVGC 2AQ3B 2N9KA 2WP9B 5FKAC 4A55A 1HXYD 2PW9A 4RNAA 3IAS1 3DWMA 2IJ0A 2WXPA 1QOAA 2KDMA 2BS2B 4WAFA 1C77A 1HZ5A 3NVWA 3MJ5A 1UWXA 1HQRD 4OZBA 1BXTA 1L6VA 1WSPA 1QF6A 2Z8LA 1FEHA 3AE9B 4C7YA 3TUOA 3ZGZA 4WWMA 2X38A 1FFVA 2XN9C 3AE6B 1GAQB 2I2YA 3NRZA 3PO0A 1V1OA 2QJLA 4RGNA 5LNK1 1GPXA 1EWCA 3HVDA 4ARIA 1I4QA 1NENB 1IUEA 1RM6C 1JRPA 2AQ2B 2G1EA 5C3JB 2PLPA 3B2GA 3VQIA 4JX1C 4RCOA 3Q8BA 4YTPB 2BTEA 4N58A 1VR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWI A;  1UWM A;  3AE7 B;  3AE1 B;  1R7S A;  1ZUD 2;  2CJO A;  3KWL A;  4HRO A;  3W5V B;  3W9C B;  4US8 A;  3RPF C;  1GTH A;  1EWY C;  2BS3 B;  1VLB A;  1ZXI A;  1L5P A;  1OQQ A;  1L6U A;  3NVY A;  5EE0 A;  2MH7 A;  2K22 A;  2Q5W D;  1GTE A;  1E6E B;  1NEK B;  4YTN B;  3AE3 B;  3NVV A;  4KX6 B;  5GXG B;  3CIR B;  3AEE B;  2PKO A;  2WLB A;  1QOB A;  4YT0 B;  1H7W A;  4A9A A;  3DWG C;  1DOY A;  3P4Q B;  2WS3 B;  1H7X A;  1N5W A;  2FBW B;  4LTU A;  1AYF A;  1YQ3 B;  1OFF A;  4YXD B;  2AX5 A;  1XLN A;  3L4P A;  1N5X A;  4P6V F;  1YJI A;  1N63 A;  3AED B;  1SIJ A;  5G5G A;  1OQR A;  2WDQ B;  3BII D;  1JWB D;  4YSZ B;  2PVO D;  1I7H A;  1FMA D;  1TYG B;  2CU3 A;  4USA A;  2MJE A;  2W54 A;  3AM9 A;  2H89 B;  2HTM E;  2WU2 B;  1N61 A;  3CF4 A;  2QIE B;  5H8Y E;  2KAJ A;  1FFU A;  3NVZ A;  2L52 A;  1RWS A;  1FIQ A;  1JQ4 A;  5C2T B;  1QT9 A;  1SB3 C;  2WU5 B;  1V97 A;  4N6E B;  1AWD A;  1FM0 D;  1KRH A;  2JX5 A;  3SR6 A;  2JQR B;  1QOF A;  3AN1 A;  2LEK A;  3LXF A;  3VR9 B;  4US9 A;  3AEC B;  3SFD B;  3VR8 B;  3HUI A;  2MJ3 A;  1PFD A;  1V8C A;  5AUI A;  4ZHP A;  1A70 A;  3AE2 B;  1KFY B;  4ZOH C;  1E7P B;  2DBY A;  2M19 A;  1WXQ A;  2H88 B;  4YSY B;  1JWA D;  1RYJ A;  1TKY A;  1L0V B;  1ZOY B;  3FAH A;  2DWQ A;  1FXA A;  2BT6 A;  3P63 A;  3AEF B;  3AE5 B;  5AUK A;  3HVZ A;  2KMM A;  1NYR A;  2M56 B;  4WQM A;  1QLB B;  1N60 A;  3AE4 B;  2Y5C A;  2B76 B;  1N62 A;  3P4S B;  3AV8 A;  1ZP0 B;  1F0Z A;  2CJN A;  4JWU C;  5H92 C;  1JRO A;  2BS4 B;  1VDV A;  1E0Z A;  3SFE B;  3HRD D;  3AB5 A;  3ETR A;  3B9J A;  1TKG A;  4JWS C;  1E10 A;  1PDX A;  3B2F A;  1E9M A;  3AH7 A;  3P4R B;  1FRR A;  5EE1 A;  4ITK A;  1NYQ A;  2K9X A;  3ZYY X;  4ZHO A;  1RFK A;  1NI3 A;  5EE3 A;  2OHF A;  1FRD A;  1DOI A;  2WDR B;  1WGK A;  1VJK A;  2WDV B;  2EKI A;  2W3R A;  1GT8 A;  1WYG A;  2PIA A;  2N0S B;  3LB8 C;  2WQY B;  1XLO A;  1ROE A;  1XLQ A;  2E3T A;  2PVG C;  2W3S A;  1WRI A;  2WP9 B;  4IDI A;  3NS1 A;  3VRA B;  1XO3 A;  1CJE A;  2K5P A;  3DWM A;  4YTM B;  1J7B A;  1QOA A;  2BS2 B;  3AMZ A;  1FXI A;  5MPO A;  1WWT A;  3NVW A;  1YQ4 B;  3AEA B;  3EUB 2;  3FC4 A;  1NVI D;  1KF6 B;  3P1M A;  1DGJ A;  1J7C A;  1L6V A;  1QF6 A;  4C7Z A;  3AEG B;  4C7Y A;  3AE9 B;  3VRB B;  2L83 A;  4WWM A;  1JW9 D;  1FFV A;  1B9R A;  1CZP A;  1FO4 A;  4C80 A;  3AEB B;  1TKE A;  3AE6 B;  1GAQ B;  4YSX B;  1J7A A;  1T3Q A;  3P4P B;  4HRS A;  3NRZ A;  3PO0 A;  3AE8 B;  2QJL A;  4N59 A;  3W5U B;  1JAL A;  2ACZ B;  4FXC A;  1GPX A;  1DOX A;  1QOG A;  3ABV B;  1NEN B;  1IUE A;  1RM6 C;  1JRP A;  1XLP A;  2G1E A;  5C3J B;  2W55 A;  3B2G A;  5G5H A;  4JX1 C;  1TJE A;  1YJJ A;  3WCQ A;  4YTP B;  1SF0 A;  1PUT A;  5EE9 A;  4N58 A;  2MJD A; 
#chains in the Genus database with same CATH topology
 3NOB A;  3AE1 B;  1ZUD 2;  2KKC A;  1VLB A;  1EWY C;  2C7M B;  1E8Z A;  5D3D A;  4XYC A;  2BPS A;  3AE3 B;  3CIR B;  2INC C;  1YN5 A;  4A9A A;  2RDB C;  2FUH B;  1SIF A;  1E90 A;  1PGX A;  5HI1 A;  2W82 A;  3PRE A;  5FR6 A;  1V5O A;  1K8R B;  5IAA C;  2HTM E;  4HCP B;  4TKN A;  2NTS A;  2LVQ A;  4G0N B;  4KGT A;  4MSQ B;  2KXJ A;  3LDZ E;  1AW7 A;  1D5Z C;  3RNF C;  4CQN A;  4YSY B;  1L0V B;  1ZOY B;  5AUK A;  1IYF A;  2WGS A;  3V6C B;  1T0S C;  1VDV A;  1E0Z A;  2KZR A;  4NPN A;  4CHK A;  4JWS C;  3P4R B;  2SEB D;  3ZRF A;  4ZHO A;  5HKH A;  2JT4 B;  1VJK A;  1QIL A;  1WR1 A;  1EF5 A;  4XZ4 A;  2KFK A;  3MC9 A;  3T3O A;  2YEP F;  2IPK D;  4IUM B;  4D2K A;  1CJE A;  2XK5 B;  4YTM B;  2BB5 A;  4LCD E;  3QQ8 B;  4DXA B;  4A90 A;  2G4S A;  4NJ6 A;  3R3M A;  2L7R A;  4FUL A;  1EUV B;  4KDL B;  1TY0 A;  2QDF A;  5J18 A;  4ANU A;  3PGE A;  1SE2 A;  5D6J B;  2ACZ B;  2D3A A;  1WFY A;  2QHO A;  2IY0 B;  2WXG A;  3PT2 B;  2V3S A;  4HRO A;  2LI5 A;  2RSU A;  1ISN A;  2FID A;  1L5P A;  4JLC A;  3RN9 C;  1QKZ A;  1E6E B;  3DVN U;  3VVW B;  2RMM A;  3VXW A;  3GB1 A;  1UNS A;  1OFF A;  1YQ3 B;  3APF A;  4OVU A;  4B0M A;  3DBR I;  3CF6 E;  3AED B;  2FCS A;  3ZJT A;  2LGD A;  2K6D B;  4X57 B;  1JQ4 A;  5C2T B;  4DXG A;  3PRM B;  1QOF A;  1WX7 A;  1PFD A;  2L00 B;  5AUI A;  3VH3 B;  1A70 A;  3AE2 B;  4MSM B;  1P1A A;  3LJ3 A;  1RRB A;  3HM3 A;  3KH0 A;  2KFJ A;  3IXS A;  1N62 A;  1D3Z A;  2TSS A;  3DBR B;  3V3X A;  3X0W A;  3WA0 A;  3A1Q B;  3QA8 A;  4J3O D;  2GB1 A;  3OWE B;  1ZW7 A;  3ZYY X;  4NAW B;  2G9H D;  1FRD A;  1DYQ A;  2ZPN A;  1WXM A;  2PIA A;  2WQY B;  2W3S A;  1E7U A;  2E3T A;  4K7U A;  2O6V B;  3VH4 B;  1XD3 B;  2NMQ A;  1QZE A;  5LXH A;  1F1H A;  3VUX A;  4A3P A;  3TSS A;  2ZZP B;  2V0G A;  1NVI D;  1Y8R C;  4R3D A;  3OJ3 A;  3O65 B;  1TKE A;  2N7D A;  3V6E B;  1Q1O A;  5KHQ A;  1M4V A;  5JHA A;  3ZO5 B;  4FHK A;  3APD A;  1ZDX A;  4DDG D;  1UWM A;  1XEE A;  1VRA B;  1A5R A;  2CHX A;  4K3B A;  1GTH A;  2BYV E;  3HK0 A;  5L83 A;  1WR6 E;  3EHV A;  2RDG A;  2WLB A;  4LJP B;  1I4R A;  1DOY A;  3EFU A;  2PE6 B;  1L4D B;  4P6V F;  1N5X A;  2IBI B;  3RNB C;  5G5G A;  2WDT B;  3U7D A;  2CU3 A;  2QIE B;  3VTW A;  4ICU A;  4L2Y A;  4O1N A;  1SE4 A;  1GC7 A;  1V5T A;  5AZG A;  3SR6 A;  1KH0 A;  3U4E G;  4W9E A;  3H6N A;  4ZHP A;  1F77 A;  4JE3 B;  3RNE C;  2LUM A;  3N30 A;  2V1Y A;  1WXQ A;  4WUR A;  3PS6 A;  3RNA C;  3Q3J A;  4ZYS A;  3W1S C;  2PE9 A;  4PT5 A;  2LGI A;  1ZP0 B;  2BQQ A;  4JWU C;  2BYF A;  2KTR B;  3R7R A;  4P16 A;  4IM2 A;  1J19 A;  2BYT A;  4F8C B;  1T0Q C;  2DZJ A;  2OHF A;  1WGK A;  3R7Q A;  3Q3O C;  4DWF A;  5HHD G;  3V05 A;  3GOE A;  2E6X A;  3VRA B;  4NAW A;  1B1Z A;  3M62 B;  3X23 A;  4PYZ A;  5KHO A;  1WWT A;  4IWQ A;  1K52 A;  3UF8 A;  2IO2 B;  1YQ4 B;  4ANX A;  1T0R C;  2JXT A;  4W9C A;  2O6V A;  2LFI A;  3AEG B;  4FJY A;  1B9R A;  3MHS D;  3RZF A;  2M17 A;  1ET6 A;  4OW0 A;  1TZ1 A;  2GBJ A;  2KN5 A;  1JWU D;  2I1K A;  4ZDV A;  4DQO C;  3EC8 A;  4LNO A;  3WCQ A;  1ZE3 D;  4K3C A;  2IO3 B;  3BY4 B;  4AWJ A;  4WJO A;  2DHZ A;  2KQ7 A;  1ZXH A;  4EE2 A;  4KZ0 A;  4US8 A;  3N1X C;  3ZKJ C;  3BWU D;  2W9N A;  5EDS A;  2RR9 A;  5IN7 A;  4ZRK A;  4P1C C;  1QOB A;  2MBO A;  1K51 A;  4F1S A;  3KUZ A;  3NJT A;  4NQK E;  2WXO A;  3U2S C;  2FBW B;  4LTU A;  2O6V D;  3WAO A;  1PGB A;  3Q8F A;  3ZXR A;  1OQR A;  1IP9 A;  2MJE A;  3AM9 A;  2ZVN A;  3CF4 A;  2KAJ A;  2KLC A;  3I57 A;  2ZEQ A;  3U30 A;  2OOB B;  4MJS B;  2LEK A;  2M0A A;  4XX5 A;  1V8C A;  1H4R A;  3DHH C;  3DBH B;  2FAZ A;  2FCQ A;  2CR5 A;  4G11 A;  1HA5 A;  2G45 B;  2J0K A;  2KMM A;  1NYR A;  4FJZ A;  3ENE A;  1L0Y B;  1H8C A;  1I42 A;  2CJN A;  2K3U A;  5BMI A;  1YJ1 A;  2RGF A;  1WJN A;  5AEK B;  3IBE A;  2WXR A;  2KDF B;  2KTR A;  3Q3M C;  2D3G A;  2WP9 B;  3PLV A;  3RCZ A;  2NS5 A;  3RNG C;  3AXC A;  3TJP A;  1WJ4 A;  1L2N A;  1QOA A;  1EO6 A;  4WAF A;  2LGY A;  3N32 A;  3MJ5 A;  1UWX A;  1HQR D;  3PRP B;  1QF6 A;  1UGM A;  2ZPY A;  2I2Y A;  2K1F A;  2KWV B;  4CO7 A;  2I1J A;  3L10 B;  4J6I A;  2AQ2 B;  2PLP A;  2G1E A;  1XQQ A;  3D32 A;  4JX1 C;  1WGH A;  3Q8B A;  3APC A;  2BTE A;  4N58 A;  2L0F A;  2X8X X;  4HJK A;  2KJR A;  3C19 A;  1TS4 A;  5IA7 A;  3AU5 A;  3WAN A;  4HLE A;  3NVY A;  5CX3 A;  2AYO B;  3QC8 B;  2DAJ A;  2UWQ A;  1H7W A;  4II2 B;  4WWO A;  1YIW A;  2REX A;  2UYZ B;  1H7X A;  2AX5 A;  1V9J A;  2WNM A;  2MEK A;  2LRU A;  2ZVO A;  4F7Z A;  4IOI E;  4BKT A;  1T5X D;  2JU6 X;  3CSF A;  2KAN A;  1FIQ A;  4XE0 A;  1KRH A;  1WMH B;  2IGH A;  3ZNH B;  3HM6 X;  3L13 A;  1HEZ E;  1KFY B;  1OQY A;  1RYJ A;  1SSN A;  3I5J C;  4HWI B;  4MJS A;  3PZ8 A;  2KT7 A;  2Y5C A;  2OJR A;  2KTF A;  2NVU I;  3SEB A;  2WXN A;  1F9J A;  4HPP A;  2BS4 B;  3VTV A;  2KQ4 X;  1TY2 A;  1P3Q U;  1E9M A;  4IWP A;  4LLG M;  4C00 A;  2FCN A;  2LMC A;  2WDR B;  4RGO S;  4P1B C;  3TEW A;  2VH2 A;  1KLV A;  3RUI B;  1OGW A;  3HIZ A;  4KKJ A;  2L3Z A;  2IO0 B;  3PZD A;  4ZRQ A;  2CHZ A;  1TS3 A;  3Q6B A;  2J42 A;  1Z2M A;  4S0R A;  3EUB 2;  4BBN F;  4CYE A;  1G6J A;  3DVG Y;  2GI9 A;  4RH6 A;  2NBV B;  4TMA B;  1Q10 A;  3L16 A;  4AP4 C;  1CZP A;  1FO4 A;  1PYW D;  4ANW A;  5E6O A;  4GSW A;  2LD9 A;  2KYW A;  3I9V 1;  4EUT A;  2KWC A;  1ET9 A;  4EZL A;  1CQV A;  1C76 A;  4BFR A;  2ZCC A;  4NJ7 A;  3AUL A;  2ZCB A;  1M94 A;  3QAQ A;  4HCN B;  4NNJ B;  5IP4 D;  3M63 B;  2HDE A;  3W1Y A;  5C1Z A;  4YXD B;  3DHG C;  3PTF C;  3KWV A;  4ANV A;  3IT4 B;  4IWO A;  2SAK A;  1WF9 A;  2HE7 A;  1WE7 A;  1K50 A;  3ZIM A;  1WJU A;  2L8J A;  1V6E A;  2JY6 A;  2DBY A;  4YWG G;  1T0Y A;  1FXA A;  1WMH A;  3AE5 B;  3W1S A;  1WX9 A;  2LRW A;  4IKG A;  1N60 A;  3AE4 B;  1PGA A;  2WXL A;  1CK1 A;  2FIF A;  2GBM A;  2LUE A;  2XNA C;  3KVF B;  2V3N A;  1MVK A;  1E10 A;  5DCN A;  1WH3 A;  3OG5 A;  2RPQ A;  2L05 A;  1YX5 B;  2JZP A;  1DOI A;  3MHZ A;  4ICV A;  2HJ8 A;  2WX1 A;  3CMM B;  3CST A;  3J9C A;  5D7G A;  3VAW A;  2A4Z A;  3JYU A;  2ONQ A;  2KX3 A;  4MAC A;  4Q2J A;  5E6P A;  2G3Q B;  4P7I A;  5T8I A;  4TQ1 A;  3QWZ B;  1T6B X;  2NBW B;  1D6E C;  4DBG A;  4B9K A;  3EA6 A;  2L0T A;  4TQ0 A;  3TMP B;  3BVG A;  2LGS A;  1SEB D;  2WXF A;  4HK2 A;  1JWM D;  1AN8 A;  3IHP C;  2MJD A;  3KWL A;  2FUG 1;  3RI7 C;  3R2I A;  2DLB A;  3Q8A A;  4AOF A;  2IO1 B;  4TUU A;  4YTN B;  2LVP A;  2ON8 A;  4YT0 B;  1TIF A;  2K8B A;  3VTU A;  5BO4 B;  2BW2 A;  1N63 A;  2PVO D;  2DNF A;  3TL5 A;  2N7E A;  2H89 B;  2N7J A;  4E74 A;  5H8Y E;  3DBL I;  4DHJ B;  3HHM A;  2KWD A;  1Q0W B;  4A6Q A;  2Z0D B;  4BOZ B;  3DCG A;  2N9P C;  4XC2 A;  2I38 A;  2ZW1 A;  2M19 A;  4XDC A;  2DWQ A;  1TS5 A;  2BT6 A;  3TEX A;  2LAS A;  1I4X A;  5DPW A;  4M0W B;  4HPL B;  1UBI A;  3IT6 B;  3ZXV A;  2DZK A;  1HE8 A;  3AV8 A;  1WXS A;  3Q8C A;  4IG7 B;  3GE8 C;  1GB4 A;  3ETR A;  4LNF A;  3B2F A;  1VCB A;  3DBL B;  3H1U A;  2MHJ A;  1JCK B;  2KVZ A;  2XBB C;  1WYG A;  2IZV B;  3K9P B;  2KK8 A;  3EFC A;  4NZL B;  2AL3 A;  1YOV B;  3QCA A;  4H2A A;  3P42 A;  1WGG A;  4M01 A;  3NHE B;  1C79 A;  1KLU D;  4XWT A;  1VD2 A;  3RYT A;  2GOW A;  3Q3N C;  4MEM A;  4DHZ E;  1SJE D;  3W5U B;  4C56 C;  3ZLZ A;  1RLF A;  2RD0 A;  1C9F A;  1WE6 A;  2D2Q A;  5BYR A;  1D5X C;  4L23 A;  4B0E A;  1TTN A;  4IC7 B;  2GRI A;  4NJC A;  2MH7 A;  1WGD A;  1GTE A;  2R2Q A;  4FAD A;  2D07 B;  4M8M A;  4W9L A;  1UF0 A;  3DWG C;  3P4Q B;  4HKZ E;  2IDY A;  2L1A A;  2WWZ A;  3KYD D;  4RM8 A;  3OAW A;  2WDQ B;  2EKE C;  4FN2 A;  2VZK B;  3M3J A;  1RWS A;  2BYE A;  3B08 A;  4WJP A;  4A8X C;  5JHB A;  3NS8 A;  2MLB A;  4JIO U;  2ZW0 A;  1JWA D;  1TKY A;  3BYY B;  3P63 A;  4AUQ C;  4M02 A;  1WXV A;  3GP7 A;  3KW5 B;  2LXA A;  2JUO A;  1LM8 B;  4AJW A;  4BKS A;  5LXI B;  1F0Z A;  2MBB B;  3AI5 A;  2GBR A;  1Q5W B;  3AB5 A;  4HPM B;  3TCA A;  4M0W A;  4DDI D;  1S3S G;  3MC0 B;  5JH5 C;  5TR5 A;  2RDH A;  4RGM A;  1GOZ A;  1GUA B;  2EKI A;  3FKY A;  3ZQ4 A;  1GG3 A;  1XLQ A;  1XLO A;  2GLS A;  2AQ3 B;  4A55 A;  2FCM A;  1HXY D;  2KOX A;  2PW9 A;  4RNA A;  3IAS 1;  4DHJ D;  2IJ0 A;  4AJY B;  2KDM A;  1WIA A;  3NVW A;  1BT0 A;  4GB9 A;  2LGX A;  4BKS D;  4WWM A;  2X38 A;  1FFV A;  3AE6 B;  4JGH B;  1GAQ B;  3DDC B;  3DPD A;  1V1O A;  3PO0 A;  1R4M I;  5LNK 1;  1GPX A;  4B95 A;  4BOS C;  1I4Q A;  4ARI A;  2NPT B;  5C3J B;  1UZX B;  4LNK A;  2R2O A;  4YTP B;  2IY1 B;  4BZA A;  4DXF A;  2L76 A;  5GMV A;  3L54 A;  2KX0 A;  3W9C B;  3QJZ A;  4DHZ B;  2WXQ A;  2KDI A;  4EZK A;  1NEK B;  4KX6 B;  2G4D B;  2K25 A;  5G55 A;  4N9F 4;  4NQL B;  2KMA A;  1WGY A;  3L4P A;  1R4M B;  3BII D;  2WU2 B;  1N61 A;  2C7N B;  3JVZ X;  2MQJ A;  4GU2 A;  2J0J A;  3R66 C;  3ZJU A;  1QT9 A;  1LFD A;  1E5W A;  2JX5 A;  5DPS A;  3AN1 A;  3VR9 B;  4US9 A;  3DBH I;  2QSD A;  2YVC A;  4FHJ A;  3MFG A;  2MCN B;  2KN4 A;  2BWF A;  1S1Q B;  1I4G A;  4UDU C;  4OZA A;  2M56 B;  4MGY E;  4GLS C;  4W9F A;  3V60 A;  2WXM A;  3DQV A;  3C0R B;  2BF8 B;  3L0W B;  3ZW3 A;  4BKG A;  4MGK E;  4W9H A;  1NYQ A;  4PS3 A;  1BML C;  2ASQ A;  1RFK A;  4ACF A;  4XGA B;  2WX0 A;  3Q69 A;  4KGS A;  3H7P B;  5J17 A;  4OZC A;  3PHX B;  2VZK D;  1QQR A;  4M00 A;  5MPO A;  4ZRP A;  3AEA B;  4PYU A;  2K0P A;  1PQS A;  3VRB B;  4W9I A;  3AEB B;  1C78 A;  1J7A A;  2OED A;  3DHI C;  4N59 A;  4URK A;  3NG0 A;  2HJ1 A;  4HKQ A;  5D3I B;  3DOW A;  3SD5 A;  2KDE B;  3ABV B;  1EU3 A;  1SF0 A;  4MH8 A;  3KUC B;  3I3T B;  4IM0 A;  3DVG X;  3AE7 B;  5CHF A;  2NPT A;  4GN1 A;  3AEE B;  3DBS A;  1OEY J;  3RMK C;  2N1V A;  2LJ5 A;  2JWZ A;  3VDZ A;  1J8C A;  3N1Y C;  3T8M A;  1SJH D;  2DYO A;  4GIV A;  1D5M C;  1FMA D;  3R2T A;  2QC8 A;  3PRZ A;  1HTO A;  1ZPS A;  1AWD A;  3A33 B;  2K6Q A;  3BVM A;  3LYY A;  1P0R A;  1FXT B;  2J0M A;  3HUI A;  1FD6 A;  1EM7 A;  4ZOH C;  1I4P A;  2KAC A;  3HVZ A;  4NY0 A;  2YLM A;  2Y5B B;  1P7F A;  4G50 A;  4GGQ A;  1N6Z A;  2BB6 A;  3MC8 A;  1ZGU B;  3B9J A;  4LNN A;  4WJQ A;  4KSL C;  2RPV A;  1PDX A;  1FPY A;  3KYC D;  1LO5 D;  2K9X A;  4MGZ E;  3LB8 C;  2MBQ A;  4IDI A;  2J4X A;  1L4Z B;  3A9K B;  3ZDM C;  1F2R I;  4WQO B;  3UIO B;  3IVF A;  1C1Y B;  2IGG A;  3H7P A;  4GOC A;  2L83 A;  2WXH A;  2K8C A;  4S17 A;  2INP E;  5D2M B;  2D5G A;  1YMH E;  3MJW A;  1D4B A;  4HRS A;  2GBK A;  5BMG A;  2BBC A;  1DOX A;  2KQS A;  3OLM D;  2JYT A;  2BKF A;  3RD2 A;  2W55 A;  2D11 A;  4RM9 A;  5EE9 A;  3P1M A;  3ECI A;  1V2Y A;  1R7S A;  3W5V B;  4FJV B;  4ARC A;  2KDB A;  3PPA A;  3RPF C;  2V4I B;  3UQB A;  1MHH E;  1V49 A;  2KMC A;  3VFK A;  3RNC C;  3SHQ A;  3GE3 C;  1IPG A;  3N1Z C;  1ENF A;  2R61 A;  3KQ4 A;  2IGD A;  1WRD B;  3JSV B;  1FCL A;  3ML9 A;  4E3C A;  3N3K B;  4HDO A;  3WAL A;  3E9S A;  2GMI C;  4HEA 1;  1YN4 A;  4OVV A;  1VZ7 A;  2KLG A;  3AEC B;  3UIP B;  2MJ3 A;  1XT9 B;  2MX2 A;  3PVL A;  4KDI C;  3FAH A;  2D3B A;  1LXD A;  2DZI A;  5L95 C;  2B76 B;  3ZDT A;  1EU4 A;  5IO9 A;  3URY A;  1GB1 A;  3AH7 A;  2J52 A;  4RFB A;  5CTR C;  1NI3 A;  5D94 A;  1LQB A;  3TBL D;  2FE8 A;  2KNB A;  4EZJ A;  1WRI A;  3MP9 A;  3ZUN A;  3NS1 A;  3W2D A;  3KUD B;  4I6N B;  2QEJ C;  2PMV A;  1J7B A;  4HJG E;  5AZH A;  3AMZ A;  1FXI A;  3M95 A;  2AL6 A;  2V3P A;  3N9Y C;  2JRI B;  3FC4 A;  1ZKH A;  5FK9 C;  1R4N I;  2DAF A;  1DGJ A;  1P9D U;  2NCN A;  1J7C A;  2YEP B;  1C4C A;  3A9K A;  3K9O B;  2LWP A;  4C4V B;  1L0X B;  1WX8 A;  5HFY A;  4RF1 A;  3TEY A;  2N9X A;  3BVZ A;  3U7Z A;  1XLP A;  5G5H A;  3PLU A;  1YJJ A;  1PUT A;  1SXT A;  3CWI A;  2CJO A;  5JXV A;  1MPE A;  4OHJ A;  2QCZ A;  4W9G A;  3U52 E;  4WIP A;  1R4N B;  2PKO A;  4K7S A;  4MT5 A;  3RUL A;  4MDK E;  3V61 A;  4BAX A;  1Z5S B;  3C8Y A;  1HZ6 A;  1XLN A;  4GDL B;  1WM2 A;  5DPT A;  2ZJD A;  3PZ7 A;  4YSZ B;  4USA A;  3E56 A;  2BVC A;  2L52 A;  2PEA A;  2BGF A;  1V97 A;  2WU5 B;  3JSV A;  4WAA A;  1WJ6 A;  4M8N A;  1K53 A;  1TBE A;  2OJW A;  4GDK B;  2JZ3 B;  1UUP A;  1YD8 U;  2C9W B;  1JML A;  4A3O A;  4REZ A;  1JRU A;  3ZTD A;  3OJ4 B;  1YX6 B;  1QLB B;  1C4A A;  4PS8 A;  3H8H A;  1V86 A;  4HVB A;  3UI3 A;  2KC1 A;  4L1B A;  3RT3 B;  3A4S C;  1IBX B;  1GNU A;  4ITK A;  1UH6 A;  1ESF A;  1OTR B;  2N0S B;  2LZ6 A;  2N9K A;  2DZM A;  2WXP A;  2BS2 B;  1C77 A;  4KVG B;  4GMV A;  1FEH A;  4C7Y A;  3VUW A;  3TUO A;  3EEC A;  2XN9 C;  5DPR A;  4PK1 A;  2QJL A;  3Q2A C;  4RGN A;  1EWC A;  2MWS B;  3B2G A;  3MTN B;  2WHI A;  4C4V A;  1VR9 A;  3SU8 X;  1SE9 A;  3R8B A;  3ZNZ B;  1STE A;  2K39 A;  1ZXI A;  2ZNV B;  2V4L A;  3ONS A;  5GXG B;  3P2B A;  1N5W A;  3BK2 A;  3VHT C;  1I4H A;  2LJI A;  2N4F A;  2DYM A;  1FFU A;  2PTL A;  4EEW A;  1SB3 C;  2M4N A;  2GBN A;  5E6N A;  5IKC M;  4GDL A;  3NUH B;  3BZD B;  2JQR B;  3TEZ A;  3NZU A;  2KO3 A;  1IGC A;  2EEL A;  4EFO A;  2DEN B;  3A9J B;  2MA9 B;  2WYQ A;  2VRR B;  4GDK A;  4WQM A;  2BWE S;  4WWN A;  1MJD A;  3HRD D;  2KD0 A;  2QIL A;  1FRR A;  5EE1 A;  4LJO B;  2XK5 A;  4FA6 A;  1Y56 A;  2BKR B;  2B3A A;  3JW0 X;  4RMA A;  3IG3 A;  3ZJV A;  1U4A A;  3A4R A;  1IBX A;  2MRP A;  1WZ3 A;  3QIJ A;  2WXI A;  2KHW B;  1BUI C;  3B0A A;  2AWT A;  1KF6 B;  3BK1 A;  3WIM A;  3NZ3 A;  4IW0 A;  2C7H A;  1FNV A;  3VUY A;  1E8X A;  2V9H A;  1WI0 A;  2XEW A;  4C80 A;  1KM7 A;  4YSX B;  3S2A A;  3P4P B;  1UEL A;  2N1W A;  4K81 A;  3AE8 B;  3I63 C;  1GC6 A;  1KTK A;  3PSE B;  4WWP A;  1NDD A;  1UBQ A;  2MW5 A;  4KKI A;  3L17 A;  4HXD A;  4XDD A;  4RF0 A;  1KJT A;  2FNJ B;  1TZO A;  4BBN C;  2EMT A;  2K22 A;  2QMT A;  3FIL B;  4G3X B;  3TIX A;  1WXA A;  4LDT B;  1I35 A;  2EMS A;  4QAY A;  2WXJ A;  2K8H A;  3U8Z A;  1SIJ A;  3RZW C;  3ZNI D;  3O13 A;  1JWB D;  3ALB A;  1YN3 A;  2W54 A;  4KIK B;  4NAM A;  4JL9 A;  3NVZ A;  3ZRC A;  1FM0 D;  1XXG A;  2CS4 A;  1HTQ A;  4MM3 B;  2KJH B;  3BIN A;  2NTT A;  4B6W A;  3VR8 B;  3ZTC A;  3A1Q A;  1FCC C;  2JF5 A;  2LHD A;  5FR3 A;  2LHE A;  2N9L A;  4W9J A;  3SDL C;  1F2R C;  2MBH A;  2J53 A;  3A9J A;  4AQ7 A;  1MFW A;  1LGR A;  3QAR A;  2CKH B;  1WYW B;  1SBB B;  2MSE D;  4A20 A;  2WDV B;  2W3R A;  1KLG D;  4K7W A;  3Q3F A;  1ROE A;  4KV2 A;  2JSV X;  1UD7 A;  2KWU B;  4WH4 A;  2IYD B;  2DX5 B;  1AAR A;  2K5P A;  2JVC A;  1V1P B;  4MGI E;  3UGB B;  2JWU A;  5BYQ A;  4ZRJ A;  1IGD A;  4GXB A;  4C7Z A;  3IFW B;  1JW9 D;  1C4P A;  2M1M A;  1FNW A;  3V62 A;  3H7S A;  3BYT B;  4FXC A;  2N9E B;  3ZNG C;  5JZE B;  3PHW B;  1RAX A;  1TJE A;  4KSK C;  1JWS D;  5TSS A;  2UU7 A;  3B1L X;  4KGR A;  2BS3 B;  5CHV C;  1UGJ A;  4LNI A;  3QX1 A;  4JQW C;  4ZYN A;  3GZN I;  1TGZ B;  2Y3A A;  2WS3 B;  5AZF A;  2INN E;  3H9D A;  1NI2 A;  3ML8 A;  1I7H A;  1TYG B;  3FIL A;  4ZRI A;  2O2V B;  5CHW A;  2MP2 B;  4I6P A;  2LXC A;  3NY5 A;  1MI0 A;  2NBU A;  4RGT A;  3WAP A;  3KLS X;  1VZ8 A;  4KIK A;  4AS1 A;  2H88 B;  1XCT L;  2JRH A;  4I6L B;  4IM3 A;  4OVZ A;  3Q14 C;  3AEF B;  2D10 A;  4MM3 A;  2C60 A;  3Q8E A;  3GZN B;  2WXK A;  3UIN B;  1XF5 L;  3P4S B;  1JRO A;  2DYB A;  4JPS A;  2C5L C;  5C23 A;  2AEH A;  1WGR A;  1SGH A;  5EE3 A;  1C3T A;  4LDT D;  4II3 B;  4MH0 E;  4WJN A;  3QK0 A;  5BMH A;  2NR2 A;  2MBE A;  5LLI A;  1YQB A;  3N20 C;  2M0X A;  4HDQ A;  1XO3 A;  4KZC A;  5J2R A;  5E6J A;  1P7E A;  4W9K A;  4EOY A;  2CU1 A;  2HD5 B;  4BVU C;  5BYS A;  1KOT A;  1V1P A;  2CHW A;  2KVR A;  4FLH A;  1T3Q A;  3QHT A;  1JAL A;  1V80 A;  2LVO A;  1QOG A;  1F52 A;  1MG4 A;  2M8S A;  1NBF C;  1YNT E;  1MHX A;  1E7V A;  1J0G A;  4LK0 M;  2D3C A;  4XWW A;  2Y5P A;  4E71 A;  1L7Y A;  1OQQ A;  1L6U A;  5EE0 A;  2JYE A;  2VH1 A;  2Q5W D;  4K1R B;  3NVV A;  1TT5 B;  3RFZ B;  2A5U A;  3UQA A;  1P98 A;  4W9D A;  5IOI A;  1AYF A;  3ZVV A;  1YJI A;  1TS2 A;  2JXX A;  4DK5 A;  1SE3 A;  2L32 A;  1MG8 A;  2PJH A;  1WM3 A;  5HG2 A;  3T9L A;  1XCQ L;  5G2N A;  1EF1 A;  4TSS A;  1ZDV A;  4N6E B;  1ACC A;  1FNU A;  2JPH A;  3GS2 A;  3LXF A;  4FBJ B;  3SFD B;  1RFA A;  2O2V A;  2AQ1 B;  2MP2 A;  2IND C;  1V81 A;  1E7P B;  1E8W A;  5I4D A;  2Z59 B;  3DVN V;  2ZNV C;  2J7Q B;  4ASW C;  2JZZ A;  5H92 C;  1VZ6 A;  3SFE B;  2PPH A;  3PV1 A;  1TKG A;  2KFK B;  3T3N A;  1WY8 A;  2ICI A;  3AU4 A;  4YL8 A;  1GT8 A;  3IAM 1;  3EGR A;  4EKU A;  2KJ6 A;  2KC2 A;  2PVG C;  3NZS A;  5FKA C;  3WAM A;  1OEY A;  4PS7 A;  3DWM A;  1WZ0 A;  3L08 A;  4TV3 A;  1HZ5 A;  4OZB A;  1BXT A;  1L6V A;  1WSP A;  2Z8L A;  3AE9 B;  3ZGZ A;  1CMX B;  1X1M A;  1GJZ A;  2HTH A;  3NRZ A;  1E8Y A;  3HVD A;  4MEL A;  1NEN B;  1IUE A;  1RM6 C;  1JRP A;  3VQI A;  4RCO A;  2Z0E B; 
#chains in the Genus database with same CATH homology
 3AE1 B;  1ZUD 2;  3W9C B;  3R8B A;  1STE A;  1VLB A;  1EWY C;  1TS4 A;  1ZXI A;  2WXQ A;  5D3D A;  3NVY A;  1NEK B;  3AE3 B;  4KX6 B;  5GXG B;  3CIR B;  1H7W A;  1YN5 A;  4A9A A;  1H7X A;  1N5W A;  3BK2 A;  1PGX A;  3L4P A;  2AX5 A;  5HI1 A;  2WNM A;  1I4H A;  2MEK A;  2W82 A;  3BII D;  4IOI E;  2LJI A;  1T5X D;  2HTM E;  2WU2 B;  1N61 A;  2DYM A;  2JU6 X;  1FFU A;  2PTL A;  1FIQ A;  3ZJU A;  1SB3 C;  1QT9 A;  2NTS A;  4XE0 A;  3NUH B;  1KRH A;  2JX5 A;  4KGT A;  3BZD B;  2IGH A;  2JQR B;  3AN1 A;  3TEZ A;  3VR9 B;  4US9 A;  1AW7 A;  1D5Z C;  1IGC A;  2QSD A;  2EEL A;  3MFG A;  4CQN A;  1HEZ E;  1KFY B;  2KN4 A;  4YSY B;  1RYJ A;  1SSN A;  1L0V B;  1ZOY B;  5AUK A;  1I4G A;  4UDU C;  3PZ8 A;  4OZA A;  2M56 B;  4WQM A;  4GLS C;  2WXM A;  2Y5C A;  3SEB A;  2WXN A;  1VDV A;  2BS4 B;  1E0Z A;  3HRD D;  2KQ4 X;  1TY2 A;  4JWS C;  1E9M A;  2QIL A;  3P4R B;  1FRR A;  5EE1 A;  1NYQ A;  2SEB D;  1Y56 A;  1BML C;  4LLG M;  4ZHO A;  1RFK A;  2LMC A;  2WDR B;  1VJK A;  1QIL A;  3Q69 A;  3ZJV A;  4RGO S;  3TEW A;  3T3O A;  1IBX A;  2YEP F;  2IPK D;  4KGS A;  4D2K A;  4KKJ A;  4OZC A;  2VZK D;  1CJE A;  1QQR A;  2WXI A;  4YTM B;  2BB5 A;  4ZRQ A;  5MPO A;  1BUI C;  1TS3 A;  2J42 A;  4ZRP A;  3AEA B;  3EUB 2;  4A90 A;  1KF6 B;  3BK1 A;  3NZ3 A;  2K0P A;  3VRB B;  1FNV A;  2GI9 A;  4RH6 A;  4TMA B;  1Q10 A;  1TY0 A;  1CZP A;  1FO4 A;  4C80 A;  3AEB B;  1C78 A;  1PYW D;  4YSX B;  1J7A A;  1SE2 A;  3P4P B;  2OED A;  3AE8 B;  4N59 A;  2ACZ B;  4HKQ A;  5D3I B;  3ABV B;  1KTK A;  1EU3 A;  2WXG A;  3I9V 1;  4KKI A;  1ET9 A;  1SF0 A;  4XDD A;  4MH8 A;  4RF0 A;  1CQV A;  3AE7 B;  4HRO A;  1C76 A;  1TZO A;  1L5P A;  1QKZ A;  2K22 A;  1E6E B;  2RMM A;  3AEE B;  2QMT A;  3FIL B;  3GB1 A;  1UNS A;  2HDE A;  1OFF A;  1YQ3 B;  4B0M A;  4YXD B;  2WXJ A;  1SJH D;  2DYO A;  3AED B;  1SIJ A;  3KWV A;  3IT4 B;  1D5M C;  3O13 A;  1JWB D;  1YN3 A;  1FMA D;  2SAK A;  2W54 A;  3R2T A;  3ZJT A;  4NAM A;  3NVZ A;  1K50 A;  1ZPS A;  1JQ4 A;  5C2T B;  1AWD A;  1FM0 D;  1XXG A;  4DXG A;  3BVM A;  4MM3 B;  1QOF A;  3LYY A;  2NTT A;  3HUI A;  3VR8 B;  1PFD A;  1FD6 A;  5AUI A;  1A70 A;  3AE2 B;  1EM7 A;  1I4P A;  2DBY A;  4ZOH C;  4YWG G;  1FCC C;  1FXA A;  2KAC A;  2LHD A;  3AE5 B;  3W1S A;  3HVZ A;  5FR3 A;  2LHE A;  2N9L A;  1F2R C;  4IKG A;  1N60 A;  3AE4 B;  3IXS A;  1PGA A;  1P7F A;  2WXL A;  1N62 A;  1CK1 A;  2TSS A;  3V3X A;  2BB6 A;  2J53 A;  2XNA C;  4AQ7 A;  2V3N A;  1MVK A;  3B9J A;  4J3O D;  1E10 A;  2RPV A;  1PDX A;  2GB1 A;  1SBB B;  1LO5 D;  2K9X A;  3OWE B;  3ZYY X;  4NAW B;  2G9H D;  2JZP A;  1FRD A;  1DOI A;  1DYQ A;  3MHZ A;  2WDV B;  2W3R A;  1KLG D;  2PIA A;  3LB8 C;  2WQY B;  2W3S A;  1ROE A;  2E3T A;  2JSV X;  3J9C A;  4IDI A;  4WH4 A;  5D7G A;  2J4X A;  2ONQ A;  1L4Z B;  2K5P A;  4MAC A;  2NMQ A;  4Q2J A;  1F2R I;  1V1P B;  2JWU A;  5T8I A;  5BYQ A;  2IGG A;  4TQ1 A;  3TSS A;  2V0G A;  1NVI D;  4R3D A;  1IGD A;  1T6B X;  1D6E C;  4C7Z A;  2L83 A;  2WXH A;  1JW9 D;  1C4P A;  3EA6 A;  1TKE A;  2INP E;  2D5G A;  1YMH E;  4TQ0 A;  1D4B A;  4HRS A;  1FNW A;  5BMG A;  1M4V A;  3BVG A;  3BYT B;  2BBC A;  4FXC A;  1DOX A;  2JYT A;  1SEB D;  2WXF A;  1JWM D;  2W55 A;  1TJE A;  1AN8 A;  1JWS D;  5EE9 A;  1ZDX A;  2MJD A;  3P1M A;  5TSS A;  1UWM A;  1XEE A;  1R7S A;  1VRA B;  3KWL A;  3W5V B;  4ARC A;  2FUG 1;  3RPF C;  2V4I B;  4KGR A;  3R2I A;  2DLB A;  1GTH A;  2BS3 B;  3Q8A A;  1UGJ A;  1MHH E;  4YTN B;  2RDG A;  2ON8 A;  2WLB A;  4YT0 B;  1ENF A;  2R61 A;  1I4R A;  2Y3A A;  1DOY A;  2WS3 B;  3KQ4 A;  2IGD A;  2INN E;  1L4D B;  4P6V F;  1FCL A;  1N5X A;  4DXF A;  2BW2 A;  1N63 A;  5G5G A;  2PVO D;  1I7H A;  1TYG B;  3FIL A;  2CU3 A;  2H89 B;  2N7J A;  2QIE B;  5H8Y E;  4L2Y A;  4O1N A;  2KWD A;  1MI0 A;  1SE4 A;  3E9S A;  4RGT A;  1KH0 A;  4HEA 1;  1YN4 A;  3SR6 A;  4A6Q A;  1VZ7 A;  3U4E G;  3AEC B;  1VZ8 A;  3KLS X;  2MJ3 A;  4ZHP A;  1F77 A;  2I38 A;  4JE3 B;  2LUM A;  2ZW1 A;  2M19 A;  1WXQ A;  4WUR A;  2H88 B;  1XCT L;  4AS1 A;  4XDC A;  3FAH A;  4OVZ A;  2DWQ A;  1TS5 A;  2BT6 A;  3AEF B;  3TEX A;  3Q8E A;  1I4X A;  2WXK A;  4ZYS A;  1XF5 L;  3IT6 B;  4PT5 A;  2LGI A;  2B76 B;  3P4S B;  3AV8 A;  1ZP0 B;  4JWU C;  1EU4 A;  1JRO A;  3Q8C A;  1GB4 A;  3ETR A;  4P16 A;  4JPS A;  3URY A;  3B2F A;  1GB1 A;  3AH7 A;  2J52 A;  2BYT A;  4RFB A;  5EE3 A;  1NI3 A;  2OHF A;  1JCK B;  1WGK A;  1WYG A;  2FE8 A;  5BMH A;  5HHD G;  1WRI A;  3MP9 A;  3V05 A;  2E6X A;  3NS1 A;  3W2D A;  3VRA B;  1XO3 A;  1B1Z A;  2QEJ C;  2PMV A;  1J7B A;  4NZL B;  4HJG E;  5E6J A;  1P7E A;  3AMZ A;  4H2A A;  1FXI A;  3P42 A;  1WWT A;  1K52 A;  2V3P A;  3N9Y C;  1YQ4 B;  1C79 A;  1KLU D;  3FC4 A;  5FK9 C;  2YEP B;  1DGJ A;  1J7C A;  2JXT A;  4XWT A;  2LFI A;  3AEG B;  1C4C A;  5BYS A;  1B9R A;  1V1P A;  1ET6 A;  1L0X B;  4OW0 A;  5HFY A;  1SJE D;  1T3Q A;  4RF1 A;  3TEY A;  3W5U B;  1JAL A;  1JWU D;  4C56 C;  3BVZ A;  1QOG A;  3U7Z A;  1C9F A;  1XLP A;  4DQO C;  5G5H A;  1YNT E;  1MHX A;  1YJJ A;  3WCQ A;  1ZE3 D;  1PUT A;  1SXT A;  4LK0 M;  3CWI A;  2CJO A;  1ZXH A;  4EE2 A;  5JXV A;  1MPE A;  4US8 A;  5BYR A;  4XWW A;  1D5X C;  4L23 A;  4B0E A;  2Y5P A;  4OHJ A;  3BWU D;  1OQQ A;  1L6U A;  2GRI A;  5EE0 A;  4NJC A;  2JYE A;  2MH7 A;  3U52 E;  2Q5W D;  1GTE A;  3NVV A;  4WIP A;  2PKO A;  1QOB A;  1K51 A;  4MT5 A;  3RFZ B;  3DWG C;  2WXO A;  3P4Q B;  3C8Y A;  3U2S C;  4HKZ E;  2FBW B;  4LTU A;  1AYF A;  2IDY A;  1PGB A;  1HZ6 A;  3Q8F A;  1XLN A;  2L1A A;  4GDL B;  1YJI A;  1TS2 A;  1OQR A;  2WDQ B;  3PZ7 A;  4YSZ B;  1SE3 A;  2L32 A;  4USA A;  2MJE A;  3E56 A;  3AM9 A;  5HG2 A;  1XCQ L;  2VZK B;  3CF4 A;  2KAJ A;  3I57 A;  2L52 A;  1RWS A;  4TSS A;  1V97 A;  2WU5 B;  1ZDV A;  4N6E B;  1ACC A;  1FNU A;  4A8X C;  1K53 A;  2LEK A;  3GS2 A;  3LXF A;  3SFD B;  4GDK B;  2M0A A;  2AQ1 B;  1V8C A;  2ZW0 A;  1UUP A;  1E7P B;  1JWA D;  1TKY A;  3BYY B;  5I4D A;  3P63 A;  1JML A;  4REZ A;  1HA5 A;  3GP7 A;  2KMM A;  1NYR A;  1QLB B;  1C4A A;  1L0Y B;  1F0Z A;  2CJN A;  3H8H A;  5H92 C;  1VZ6 A;  3UI3 A;  3SFE B;  3AB5 A;  4L1B A;  1TKG A;  2K3U A;  5BMI A;  1IBX B;  4M0W A;  4ITK A;  3T3N A;  3MC0 B;  2ICI A;  2RDH A;  2WXR A;  4RGM A;  1ESF A;  1GOZ A;  2EKI A;  1GT8 A;  3IAM 1;  3EGR A;  3ZQ4 A;  2N0S B;  1XLQ A;  1XLO A;  2PVG C;  2AQ3 B;  2N9K A;  2WP9 B;  5FKA C;  4A55 A;  1HXY D;  2PW9 A;  4RNA A;  3IAS 1;  3DWM A;  2IJ0 A;  2WXP A;  1QOA A;  2KDM A;  2BS2 B;  4WAF A;  1C77 A;  1HZ5 A;  3NVW A;  3MJ5 A;  1UWX A;  1HQR D;  4OZB A;  1BXT A;  1L6V A;  1WSP A;  1QF6 A;  2Z8L A;  1FEH A;  3AE9 B;  4C7Y A;  3TUO A;  3ZGZ A;  4WWM A;  2X38 A;  1FFV A;  2XN9 C;  3AE6 B;  1GAQ B;  2I2Y A;  3NRZ A;  3PO0 A;  1V1O A;  2QJL A;  4RGN A;  5LNK 1;  1GPX A;  1EWC A;  3HVD A;  4ARI A;  1I4Q A;  1NEN B;  1IUE A;  1RM6 C;  1JRP A;  2AQ2 B;  2G1E A;  5C3J B;  2PLP A;  3B2G A;  3VQI A;  4JX1 C;  4RCO A;  3Q8B A;  4YTP B;  2BTE A;  4N58 A;  1VR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...