3AEBB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 58
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aebB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aebB01
1FXIA 2H88B 3AEBB 1YJIA 1JRPA 4WQMA 5GXGB 1JALA 1GAQB 2Q5WD 1GTHA 1WGKA 2EKIA 4ZHPA 1FRDA 2W54A 3AB5A 5C3JB 1T3QA 1NYRA 2LEKA 3AN1A 1KFYB 1JQ4A 4P6VF 3P63A 1WRIA 1QF6A 3AM9A 1R7SA 4JX1C 1ROEA 1L0VB 1NI3A 2M56B 4C7ZA 1NYQA 4US9A 2QJLA 3AEFB 3NVWA 2WS3B 4LTUA 1KF6B 2DWQA 2PIAA 1FIQA 1RM6C 2MJ3A 3LB8C 1ZP0B 1FXAA 1OQRA 1SB3C 2L83A 3DWGC 3W5UB 2AX5A 3HRDD 1OQQA 1TKEA 2OHFA 1FO4A 5AUIA 1GT8A 1FMAD 1N60A 2W3RA 1J7BA 1E6EB 1PDXA 3P4QB 1YJJA 1DOXA 2B76B 1E0ZA 4YSXB 2MH7A 1JW9D 1ZXIA 1XLQA 1E10A 3AV8A 1GTEA 4USAA 1DOIA 3NS1A 3P4SB 1EWYC 3RPFC 3AEGB 3AEDB 2HTME 2WDRB 4YSYB 1NEKB 1IUEA 1N5WA 2WU2B 1QLBB 2BS2B 2K5PA 2BS4B 4C7YA 1E9MA 3P4RB 1AYFA 1XLNA 2MJEA 3NRZA 1JWBD 3AE4B 1A70A 1ZUD2 3FAHA 4US8A 3ZYYX 3AEAB 1I7HA 1FM0D 1H7WA 3AE2B 1NENB 1L6VA 1N61A 3SFDB 3PO0A 3W5VB 3AE8B 1H7XA 1UWMA 3SR6A 1FRRA 3VRAB 3ABVB 2PVGC 4A9AA 4N59A 1CJEA 1TKYA 2N0SB 1RWSA 2DBYA 1WXQA 1GPXA 1N63A 1L5PA 3WCQA 3CF4A 1TYGB 2QIEB 5C2TB 4JWSC 4N58A 1VLBA 1B9RA 2PKOA 3KWLA 5EE3A 1PUTA 5EE1A 3AE3B 2WDVB 3AH7A 1N62A 1SF0A 4ZHOA 3AEEB 4KX6B 1V8CA 2L52A 3AE6B 3CWIA 1CZPA 2FBWB 3ETRA 3LXFA 1DOYA 3CIRB 2KAJA 4HRSA 2WP9B 2MJDA 4WWMA 1SIJA 2JX5A 3NVZA 4HROA 4C80A 2Y5CA 3P4PB 2KMMA 2W3SA 3SFEB 3VR8B 4FXCA 5AUKA 1TJEA 5EE0A 1FFUA 4N6EB 5H8YE 2ACZB 3HVZA 3L4PA 2CJNA 4YTMB 2G1EA 4YTPB 1WYGA 4YSZB 1XO3A 3B2GA 1QOFA 1J7CA 1TKGA 2PVOD 1QT9A 5G5HA 1DGJA 2JQRB 1N5XA 2K9XA 2WQYB 1VDVA 4ZOHC 4YTNB 1XLOA 4IDIA 2H89B 3AE5B 5MPOA 4YT0B 1AWDA 1J7AA 1ZOYB 2WDQB 1VJKA 1WWTA 3FC4A 1QOBA 4JWUC 1F0ZA 1JROA 3P1MA 3EUB2 1RFKA 3AE9B 1L6UA 1QOGA 3BIID 3AMZA 1NVID 2CU3A 4ITKA 5EE9A 1QOAA 3W9CB 2M19A 1KRHA 1V97A 2BT6A 2W55A 2E3TA 1YQ4B 5H92C 5G5GA 3B9JA 3HUIA 3B2FA 1E7PB 2WU5B 3AECB 1YQ3B 3AE1B 3AE7B 2WLBA 2CJOA 4YXDB 1FFVA 1JWAD 1XLPA 3NVYA 3DWMA 3VR9B 1OFFA 3NVVA 3VRBB 1RYJA 2K22A 1PFDA 2BS3B
chains in the Genus database with same CATH superfamily
4IC7B 3APCA 2L1AA 2Q5WD 2IY0B 4ANUA 1SEBD 4AS1A 2WWZA 4C7ZA 4NJ7A 2FAZA 1TY2A 1V1PA 1C9FA 2QJLA 3PRMB 2K8HA 1OQQA 2GB1A 3CMMB 4LNNA 2N9KA 4P1CC 2AL3A 2LUMA 3Q3NC 3ZTCA 1MJDA 3AEGB 1IUEA 4RCOA 2K5PA 1RAXA 2IO3B 1I7HA 2BF8B 1SE4A 2BYTA 4KZ0A 2AQ2B 4IWQA 4BOZB 2WX1A 2DZMA 1UH6A 1N62A 3DOWA 2LGYA 1SF0A 2K8BA 4KX6B 4RGNA 1DYQA 1CZPA 2N9PC 2WXRA 3OJ3A 4MSMB 3VXWA 5DPWA 5EE0A 4S17A 4XZ4A 2XBBC 1K51A 1UBIA 2KC1A 1I4QA 2C7NB 3B0AA 3RNFC 3NHEB 1JWUD 4YWGG 5BMHA 4P7IA 2LVOA 4IKGA 4MDKE 2BB5A 3V05A 1YQBA 4EEWA 4RGMA 2PE6B 1OQYA 1GC6A 5DPRA 3OAWA 5E6PA 1XT9B 3KYDD 2FE8A 4MELA 1SJHD 4K3CA 2M1MA 1GAQB 4GXBA 1G6JA 2BWES 1P9DU 1WGYA 3W1SC 2WXKA 1BT0A 2FIFA 3ZO5B 4MJSB 1YJ1A 3P42A 4PYZA 2N9EB 1HXYD 3ZNHB 4M8NA 1MVKA 1BUIC 3U4EG 1SB3C 1GT8A 2IO2B 3BY4B 4XC2A 3TEWA 3NJTA 3ONSA 2N1WA 1GUAB 1XLQA 1WR6E 1JMLA 2JZPA 2WDRB 3MC0B 3P4RB 1E8XA 1FPYA 1EM7A 2HJ1A 3IAM1 1D4BA 1Z2MA 2KZRA 2WX0A 4B0MA 3AE2B 4IW0A 3AE8B 1V81A 2QDFA 4MM3B 4OVUA 3VRAB 2PVGC 4HXDA 2K39A 2REXA 3CF4A 5C2TB 4HKZE 2V4LA 1V1OA 1WJNA 4RF1A 4WAFA 2KAJA 3ZJUA 3ZLZA 1SIJA 4A3OA 2Y5CA 1R4MI 3L0WB 1J0GA 3WALA 2BKFA 1TS2A 2AWTA 2PVOD 4K3BA 4I6LB 2JQRB 4GIVA 2MSED 3JSVB 3N3KB 3M62B 4AP4C 1ZOYB 2O6VD 4B95A 5I4DA 2BYFA 3WIMA 1RLFA 5KHQA 3JW0X 2A5UA 4A8XC 5AZHA 5G5GA 4G0NB 4M00A 1YQ3B 3VH3B 1ZE3D 3UIOB 2KWCA 2L32A 4HJKA 3VQIA 5JZEB 1V80A 1UGMA 3TL5A 3QARA 3IAS1 5IAAC 3TUOA 4KSLC 2WGSA 1LM8B 1TBEA 4MH0E 2KD0A 3L54A 2G3QB 1WM3A 1NYQA 4W9KA 2LHDA 4QAYA 4W9GA 3V3XA 2PIAA 1FO4A 1NDDA 3W5UB 4K1RB 2JYTA 2OHFA 1FMAD 1S3SG 3A4SC 4JGHB 4WWNA 2DLBA 2ICIA 4IM3A 1K8RB 3NS1A 3AU4A 2RSUA 3E9SA 1V2YA 3QWZB 1I4HA 2LMCA 4BAXA 3RD2A 3FILB 5D3DA 2MBHA 3N1ZC 3RYTA 2KMAA 1FM0D 3KW5B 3L13A 2WXOA 2JZZA 2BBCA 2N9XA 3MP9A 4TQ1A 1IP9A 3JYUA 3K9OB 1EWCA 3RULA 4M01A 1TYGB 2QIEB 4JQWC 4HPPA 1B9RA 3NG0A 1YIWA 3NOBA 1D5MC 3UQBA 1J8CA 3NVZA 4HROA 2L00B 4C80A 3CSTA 2KMMA 1OGWA 3UIPB 1LFDA 1T6BX 1A5RA 3HIZA 1T0SC 4GLSC 5D6JB 1ZXHA 2RGFA 2AYOB 4FBJB 4EZJA 1T0QC 1F52A 3M63B 4YTNB 2MBQA 5HFYA 3GE3C 3EECA 3PZ8A 4YT0B 1LGRA 1V49A 2DHZA 2IJ0A 3ZRCA 4ASWC 1E7PB 2WU5B 1SSNA 3ZKJC 4OVZA 2L8JA 1F2RI 3AE7B 1XLPA 2GMIC 3NVVA 1ET9A 1GOZA 2KTFA 2ZNVB 3NZ3A 2KDEB 2LVQA 2RR9A 1NYRA 2K0PA 2KOXA 3H7PA 3VTWA 3AM9A 4ZYNA 4PK1A 1UZXB 4J6IA 3LB8C 3R7RA 4HK2A 3PV1A 1WJUA 3EGRA 2W82A 1C76A 3PHXB 1DOXA 4BKSD 1E0ZA 2B76B 4C00A 2QC8A 3APFA 1WXMA 3ZXRA 4F1SA 2J0MA 1RRBA 4IG7B 1JWMD 3TEZA 4RGOS 1ZDXA 4BKSA 2UWQA 4J3OD 5D7GA 1N5WA 5T8IA 3LJ3A 4EUTA 2DX5B 4HVBA 3QA8A 4HPLB 1WZ3A 1WI0A 1C4CA 3EFCA 3MJ5A 3U52E 1H7XA 3SR6A 4N59A 3FILA 1TS4A 2ZPNA 1E5WA 1SGHA 1UUPA 2EMSA 3I5JC 3MHZA 2K3UA 2JRHA 2LVPA 3UGBB 4ANXA 2L52A 1HE8A 3DBLI 3ETRA 1F77A 2WP9B 2JYEA 4HRSA 2DZIA 3ZQ4A 1OTRB 4KGRA 3BWUD 1Y8RC 3IG3A 2W9NA 3DBRI 3N20C 1XO3A 5G5HA 3PREA 3WAOA 1VDVA 2KN4A 2PEAA 4GDLB 3AE5B 2KWDA 2N9LA 1WGHA 1GC7A 2VZKD 3Q14C 1NVID 4WAAA 2K25A 2N7EA 1MHHE 2M19A 3BVGA 2CR5A 2PLPA 4KSKC 1WJ6A 3AE1B 4E71A 4O1NA 1EF1A 2BS3B 4KIKA 3MC8A 4W9CA 2JT4B 2KDIA 2O6VB 2KDBA 5CHFA 2I1KA 3SHQA 3Q6BA 4PS3A 3DQVA 2J42A 4W9IA 2LJIA 1WE7A 3HM6X 3H7PB 1I35A 1B1ZA 4II2B 3ENEA 3Q2AC 3ECIA 3I3TB 1TIFA 3N1XC 5JHBA 2BWFA 2MCNB 1X1MA 2WDTB 4FULA 4IUMB 4JL9A 2RDHA 1C78A 2EELA 3ZUNA 3ZYYX 1FXTB 5BYQA 3W5VB 1KLGD 1ENFA 1Q5WB 1HEZE 1R4NB 2IGDA 1LO5D 1WJ4A 2DYBA 5FKAC 4NNJB 3Q8FA 2KKCA 1VRAB 4NAWB 1F1HA 4ZYSA 4GN1A 1JCKB 3DHGC 1P1AA 2ZPYA 1MG8A 2BQQA 1N5XA 4DBGA 4KGTA 4A6QA 2LGSA 2OJRA 3T9LA 1KOTA 4ZDVA 3AMZA 2CU3A 1QOAA 3GOEA 1V97A 4G3XB 3HUIA 3SU8X 1D6EC 4RMAA 4HDOA 5DPTA 4B9KA 1YJIA 5GXGB 3TSSA 4ANVA 1IBXA 3ZW3A 3TCAA 4IM0A 3DVGY 4ZHPA 1D3ZA 1M94A 1C4AA 1IPGA 1E8ZA 1ZW7A 4JLCA 4KDIC 2KJ6A 2WXHA 3RNEC 2KVRA 1FIQA 1K52A 4DHZB 1FCLA 3HRDD 2Y5BB 5BO4B 3QCAA 5AZFA 1STEA 2MH7A 4FADA 1UD7A 2JRIB 2GOWA 3W1SA 1D5XC 3BK1A 2DNFA 4OVVA 3VTVA 4LDTB 1KLUD 5FK9C 4OZAA 2IY1B 3OLMD 4EE2A 2D5GA 1M4VA 4K7UA 4ARCA 1H7WA 1UWMA 1I4RA 3PGEA 3CSFA 3ZNID 5L95C 5E6NA 2O2VA 2X38A 2HDEA 5EE3A 5D94A 2I1JA 1HZ6A 2KLCA 2D10A 4BKGA 2C60A 5IOIA 1MFWA 3TBLD 4ZRQA 3H7SA 3N1YC 2ZVNA 3ZJVA 2KFKA 1UNSA 4K7SA 3VH4B 1EUVB 2GBJA 1GB4A 3DHIC 1UELA 1SE2A 3KWVA 4GB9A 4KZCA 3R7QA 2C7MB 2JXTA 2W55A 3DCGA 4KGSA 1WYWB 2ZNVC 1K53A 1YD8U 1N6ZA 2AL6A 2WLBA 3VUYA 2H88B 3RFZB 1BMLC 1HZ5A 4W9FA 1QZEA 1XXGA 1FRDA 2VZKB 5HG2A 4BBNC 3P63A 1F2RC 1WRIA 1R7SA 1WIAA 1Q0WB 2NVUI 4ZRPA 1FXAA 2KQSA 1AN8A 4ARIA 5HI1A 4S0RA 4F7ZA 2G45B 4MGZE 1PDXA 2MWSB 4CHKA 3EFUA 1EU3A 4NJ6A 5IA7A 3MC9A 4XWWA 3ZJTA 1ZXIA 3O65B 3P4SB 5D3IB 3FKYA 4AWJA 1FNWA 2HTME 2IBIB 3VFKA 3I57A 1PYWD 1ET6A 3BK2A 1EO6A 2RPVA 4PS7A 2Z59B 2D2QA 2A4ZA 2D07B 1WF9A 1YN3A 3KUZA 2D3GA 4EOYA 5BMGA 5AEKB 3RNBC 2DBYA 1L5PA 4NAMA 3EC8A 2L05A 4NAWA 3KWLA 2IZVB 2WDVB 1DOYA 2M0XA 4NZLB 4RF0A 4WJOA 5DCNA 3UF8A 4W9JA 2JPHA 3SFEB 3AXCA 1WMHA 2G1EA 4NJCA 5KHOA 2V1YA 2FIDA 3DBRB 2CKHB 3L16A 5IN7A 2IO1B 2ZW1A 2AQ3B 4NQLB 3PZDA 1IGDA 3RNCC 2V9HA 3GE8C 4FN2A 3L17A 3Q3OC 4W9LA 2PPHA 4WJNA 2KFKB 3IVFA 5H92C 1I42A 1PGXA 2D3BA 2R61A 1XEEA 1JWAD 2I2YA 4WQMA 3ZGZA 2EKIA 4GDKB 4ZRIA 2JUOA 4P6VF 3JVZX 4RM8A 3D32A 3SEBA 5FR6A 3ZDTA 4REZA 3PHWB 4N58A 1ZGUB 1RFAA 1T0RC 4FJVB 2G4DB 1TKEA 1WE6A 2W3RA 2M8SA 3M3JA 5JXVA 2RDGA 2NBVB 1JW9D 2SAKA 2M17A 1UGJA 3RPFC 2D3CA 2MLBA 3IHPC 1KLVA 2DAJA 3NZSA 3V61A 2V3PA 1E90A 1JWBD 1GJZA 4ZRJA 1TT5B 3AEAB 2B3AA 2LFIA 2HJ8A 2C7HA 1AARA 1TZOA 2TSSA 4GOCA 3U7DA 5LXIB 1N63A 3QC8B 3ML9A 3Q8BA 3T3NA 4KV2A 1MI0A 2K6DB 3OG5A 4K7WA 3PRZA 3LXFA 1KJTA 4M02A 2BW2A 3VR8B 3RZWC 2LGDA 3HVZA 3VUWA 2D3AA 4ANWA 2M4NA 2KANA 4WQOB 2XEWA 3W1YA 3MJWA 5C1ZA 3LYYA 2PE9A 3QQ8B 3FC4A 1F0ZA 1L6UA 4ITKA 5J2RA 4L23A 1IGCA 4H2AA 3PLVA 1OEYJ 3TEXA 4BKTA 2JXXA 2CJOA 4HCPB 3GZNB 3VDZA 3VRBB 1PFDA 1FXIA 3R66C 3BZDB 5LNK1 2DZKA 1VZ8A 4HCNB 5BYRA 2WXFA 2INDC 2DYOA 3H1UA 5IO9A 4GDKA 1C79A 1N60A 2NPTB 3L10B 1GNUA 2CHXA 4DWFA 4R3DA 1UBQA 1XD3B 2V0GA 1NI2A 3AV8A 3A1QB 3R2IA 2MBOA 2M0AA 4A3PA 2RMMA 4FHKA 2PW9A 3FAHA 4HKQA 4WJQA 2KTRA 2Y3AA 2YLMA 3UI3A 4NY0A 2EMTA 1WGGA 2GBKA 4C4VA 1WR1A 3C0RB 1GB1A 2N1VA 3ZIMA 3RZFA 4PT5A 4MH8A 1SE3A 3AE6B 2FBWB 2BB6A 4PS8A 3P4PB 1Z5SB 3Q8AA 4YTPB 1TY0A 1AW7A 1TKGA 2GBRA 2IPKD 2QILA 4IDIA 1XCQL 2JWZA 1P7FA 3ZTDA 2XK5B 1KRHA 2BTEA 3IT6B 4GMVA 2J4XA 5TSSA 3K9PB 4W9HA 3SD5A 2IO0B 4E74A 2R2OA 1JALA 2NBWB 1WGKA 2KT7A 1FD6A 2LXAA 2M56B 3A9KA 2Z8LA 4C56C 3AEFB 1KF6B 2LZ6A 2WXJA 5JH5C 2AX5A 2ZZPB 4RM9A 2HE7A 3PVLA 4I6NB 2KNBA 4CQNA 4B0EA 4W9EA 1OEYA 3A33B 2BS2B 2KDFB 2BS4B 1C3TA 2PTLA 1TS5A 3UQAA 2D11A 1D5ZC 3A1QA 3HHMA 4MEMA 1YX5B 2PJHA 2XN9C 1CJEA 5CX3A 2N0SB 3ML8A 2K6QA 4JWSC 3N30A 2HD5B 4P16A 2WXQA 5LXHA 1E7UA 1T5XD 5IKCM 5CHVC 3H9DA 2X8XX 4ZHOA 2FCMA 5H8YE 2KACA 5TR5A 2NMQA 3QJZA 1WFYA 4YTMB 5G2NA 4YSZB 3RCZA 3U7ZA 1JRUA 2K9XA 3DBHB 1TS3A 4A20A 3B1LX 5HKHA 4KKIA 4F8CB 4JWUC 3QHTA 1QOBA 1VCBA 4HLEA 1JROA 4FA6A 2E6XA 4HJGE 2VRRB 2LRUA 4GDLA 3AI5A 3IFWB 2JY6A 3DWMA 3AULA 4I6PA 2I38A 1GTHA 2MRPA 1VZ6A 2V3SA 5C3JB 2NPTA 4DHJD 4E3CA 1NI3A 3VVWB 2L3ZA 2LRWA 4KIKB 3TJPA 4CO7A 4US9A 3DWGC 2ZJDA 3T3OA 2O6VA 2KX0A 3MTNB 2RDBC 4A55A 3A9KB 1XCTL 2FCQA 3X0WA 4DHJB 4KKJA 2LXCA 1NEKB 1QLBB 2ZCCA 3APDA 5J17A 2ZW0A 2CU1A 2J0JA 2CS4A 1ZUD2 2MBEA 1BXTA 1WGRA 3RNGC 3PSEB 2JZ3B 2XNAC 4TUUA 3N32A 3ABVB 1PGAA 1ZKHA 5LLIA 1QQRA 1VLBA 4II3B 2JU6X 3Q3MC 1XQQA 4JIOU 2KXJA 2DZJA 1KM7A 3DDCB 3CIRB 2MJDA 1PGBA 4WWMA 1ISNA 2JX5A 1XF5L 1SBBB 2MBBB 3ZNZB 3AU5A 4DXAB 3IT4B 1L0YB 1ZPSA 2ZVOA 3X23A 1EF5A 2PMVA 2NS5A 4AUQC 4NQKE 1WXAA 2KMCA 3AE9B 3B08A 4N9F4 3DVNU 3KYCD 4RNAA 1SIFA 3ALBA 1YQ4B 3B9JA 3DBSA 3QK0A 4EZKA 4MJSA 3BYYB 1WX9A 1TTNA 1WH3A 4YXDB 4G11A 2BYEA 3H6NA 1V86A 2LHEA 1RYJA 3KUCB 3P2BA 2KJRA 5CTRC 3QIJA 4MACA 4MGKE 2RPQA 1MHXA 4FJYA 4LDTD 2W54A 1T3QA 2KWVB 4DXGA 4URKA 3TMPB 3C19A 3IXSA 4L2YA 4CYEA 3RN9C 1YMHE 4LTUA 1IYFA 3RNAC 4A90A 4AQ7A 1ZDVA 4JPSA 2INPE 3KUDB 3S2AA 1YJJA 1YN4A 1Q1OA 4DDID 1ACCA 2WHIA 1C4PA 4MM3A 4BFRA 4MGIE 2ONQA 2LWPA 1AYFA 4HDQA 3AE4B 1WXVA 4XGAB 2KWUB 2JSVX 1E8WA 1L6VA 4DHZE 1CMXB 2LI5A 1E7VA 4RH6A 1J19A 2DENB 3WCQA 2WXPA 3U8ZA 3WAPA 3DPDA 2PKOA 3DVNV 1PUTA 3AE3B 2SEBD 3RUIB 1V8CA 2L7RA 3NZUA 3KH0A 1TJEA 1WXSA 2O2VB 3HM3A 2C9WB 4BBNF 3B2GA 1QOFA 2AEHA 4G50A 1MPEA 1QT9A 4HWIB 4IM2A 4KDLB 3MHSD 4LK0M 1C1YB 1S1QB 2JWUA 2MHJA 1YN5A 3BINA 3ZVVA 3U30A 3PZ7A 1V6EA 2E3TA 2KVZA 2KQ7A 4ICVA 3AECB 1JWSD 4IWPA 2UYZB 3SDLC 2VH2A 4LNIA 2V3NA 3HK0A 1HA5A 3E56A 1GG3A 4DXFA 4TMAB 3NS8A 4JX1C 1ROEA 5J18A 2JVCA 4ACFA 3KLSX 2FNJB 1VZ7A 2L83A 3T8MA 4EKUA 1J7BA 1E6EB 2QCZA 2OJWA 1EU4A 4XX5A 2CHWA 3EHVA 2Z0DB 1DOIA 3LDZE 2KHWB 2KQ4X 3QAQA 3H8HA 2WU2B 3RT3B 1WX7A 4XDDA 3Q8CA 2OEDA 5BYSA 4DK5A 3GZNI 3TEYA 3DVGX 1TKYA 4YL8A 4GGQA 4LCDE 2WYQA 2OOBB 2L0TA 2L76A 3CWIA 2NTSA 3V6EB 3KVFB 5AUKA 4DDGD 2KLGA 4WH4A 2KN5A 4ZOHC 3A9JB 4GU2A 2WDQB 2KJHB 2Y5PA 2YVCA 2J7QB 1CQVA 1RFKA 4OZCA 4WURA 1KTKA 5JHAA 3W9CB 2VH1A 2N7JA 2BT6A 2WXMA 4M0WA 3I63C 3DBLB 2NCNA 3WA0A 1FFVA 3GS2A 3NVYA 3U2SC 4LJOB 2ZEQA 2FCNA 3VR9B 1KH0A 1TZ1A 3ZRFA 3HVDA 2FCSA 5D2MB 1P0RA 3WANA 3GB1A 4FLHA 4UDUC 1WX8A 4BVUC 3O13A 1CK1A 1HTQA 4FJZA 2WS3B 4XDCA 2MJ3A 1ZP0B 1OQRA 2G4SA 2UU7A 5AUIA 4MSQB 1V5TA 4MT5A 2MP2A 4YSXB 4ICUA 3VAWA 1H4RA 2J53A 4USAA 4RGTA 2N7DA 3URYA 3J9CA 1E9MA 3MFGA 4RFBA 2KO3A 1XLNA 1L4DB 2EKEC 3V62A 5BMIA 4Q2JA 1T0YA 2KYWA 2BYVE 2BKRB 2JF5A 4FHJA 4WWPA 4LLGM 1FRRA 1QKZA 3OJ4B 1WRDB 2Z0EB 2LGIA 3A4RA 2MX2A 1WMHB 3OWEB 1R4NI 5EE1A 2NTTA 2IDYA 2KFJA 3R2TA 1FFUA 1HQRD 4K81A 3UINB 1WY8A 1J7CA 5IP4D 1ESFA 4AJYB 1V5OA 1XLOA 2H89B 2WNMA 4B6WA 1WGDA 1AWDA 5G55A 1FNUA 1J7AA 3V60A 1WWTA 1L2NA 3P1MA 1UWXA 3EUB2 1YX6B 1WZ0A 3BIID 2N4FA 2QHOA 1QILA 1SJED 2WXNA 3IBEA 1Q10A 3A9JA 3EA6A 4TV3A 1OFFA 4XYCA 2NR2A 2K22A 4BOSC 3AEBB 1JRPA 4WWOA 2LD9A 1P98A 1L0XB 1LQBA 3CF6E 3KQ4A 2LEKA 3AN1A 2ON8A 2KK8A 3PPAA 1L0VB 2GBMA 4OW0A 4TQ0A 3NVWA 1IBXB 2DWQA 2K8CA 2FUHB 3BVZA 3W2DA 2NBUA 3P4QB 2IYDB 2WXIA 4GSWA 4LNKA 1EWYC 3PTFC 3ZDMC 1YOVB 2J52A 2LASA 4ZRKA 4C7YA 2MP2B 2K1FA 1A70A 4HPMB 4US8A 2ASQA 1L4ZB 4L1BA 4KVGB 1L7YA 1VR9A 3SFDB 2GRIA 3BYTB 1WM2A 2C5LC 1FNVA 4OHJA 4AOFA 2GLSA 4EZLA 1WXQA 5FR3A 2KTRB 2YEPF 1R4MB 1F9JA 4PYUA 2ZCBA 2LJ5A 3AH7A 2QMTA 2BGFA 2AQ1B 2MEKA 3Q8EA 3WAMA 2RD0A 2W3SA 2MA9B 4FXCA 5CHWA 2ACZB 3PRPB 1Y56A 5GMVA 2LUEA 5L83A 2KC2A 3VTUA 4M0WB 2MQJA 4HEA1 1V9JA 1PQSA 3Q69A 5EDSA 2FUG1 2L0FA 4XE0A 1H8CA 1QOGA 3PT2B 5EE9A 3V6CB 4LNOA 5C23A 3NUHB 3Q3JA 3B2FA 1U4AA 1K50A 2WXLA 2WXGA 3NY5A 1V1PB 3VHTC 3I9V1 3C8YA 1I4XA 3AB5A 2KDMA 1JQ4A 1KFYB 3DBHI 3BVMA 4DQOC 1QF6A 5DPSA 1FCCC 1RM6C 3PLUA 3QX1A 5HHDG 2INNE 2BPSA 2QSDA 3RI7C 5E6OA 2HTHA 4MGYE 3PS6A 3RMKC 4AJWA 2MW5A 1SE9A 1E10A 1GTEA 1HTOA 2LGXA 3AEDB 4YSYB 1WSPA 4C4VB 2INCC 3DHHC 2MJEA 3NRZA 1C77A 2GBNA 4IWOA 1P3QU 2G9HD 1NENB 1E8YA 1N61A 1UF0A 4EFOA 1VD2A 2GI9A 4A9AA 4W9DA 1RWSA 1GPXA 4D2KA 4X57B 3M95A 4WIPA 1P7EA 2DAFA 3Q3FA 3ZNGC 3AEEB 1FEHA 4IOIE 1YNTE 3GP7A 2CHZA 4OZBA 4M8MA 2IGHA 4N6EB 3TIXA 1SXTA 5E6JA 3L4PA 2CJNA 4TSSA 4XWTA 5AZGA 1WYGA 3N9YC 4LNFA 4JE3B 3R3MA 2QEJC 1DGJA 2IGGA 2WQYB 2XK5A 4BZAA 2DYMA 1I4PA 1TGZB 2KX3A 5MPOA 3ZXVA 1VJKA 1NBFC 1LXDA 4P1BC 1I4GA 2J0KA 2V4IB 3JSVA 3R8BA 3VUXA 4TKNA 4WJPA 2YEPB 1MG4A 2BVCA 3L08A 4NPNA 2R2QA 3PO0A 4LJPB
chains in the Genus database with same CATH topology
1FXIA 1HA5A 3BZDB 5LNK1 2L1AA 2Q5WD 3E56A 1VZ8A 5BYRA 2WXFA 4DXFA 2DYOA 4TMAB 1SEBD 4AS1A 4JX1C 1ROEA 4C7ZA 1TY2A 1V1PA 3KLSX 1C9FA 2QJLA 1VZ7A 2J42A 2L83A 2LJIA 1OQQA 1C79A 2GB1A 1N60A 1J7BA 1E6EB 1EU4A 2N9KA 4R3DA 1B1ZA 2LUMA 2V0GA 3AV8A 1DOIA 3R2IA 3AEGB 2KQ4X 1IUEA 4RCOA 3H8HA 2WU2B 2K5PA 2M0AA 2RMMA 2PW9A 4XDDA 3FAHA 4HKQA 3Q8CA 2OEDA 2RDHA 1C78A 2EELA 5BYSA 2Y3AA 3ZYYX 3UI3A 1I7HA 5BYQA 3W5VB 1KLGD 1ENFA 1SE4A 2BYTA 3TEYA 1TKYA 2AQ2B 1HEZE 2IGDA 1GB1A 1LO5D 5FKAC 4PT5A 1N62A 4MH8A 1SF0A 4KX6B 4RGNA 1SE3A 3AE6B 1DYQA 1CZPA 2FBWB 3CWIA 2BB6A 2NTSA 2WXRA 3Q8FA 3P4PB 1VRAB 5AUKA 4NAWB 5EE0A 1K51A 3Q8AA 4WH4A 4YTPB 1TY0A 4ZYSA 1JCKB 1AW7A 1TKGA 2IPKD 2QILA 1I4QA 1N5XA 4ZOHC 1JWUD 4YWGG 4IDIA 4KGTA 5BMHA 1XCQL 4A6QA 4IKGA 2BB5A 1P7FA 2WDQB 2Y5PA 3V05A 1CQVA 1RFKA 4RGMA 4OZCA 4WURA 1KTKA 3AMZA 3W9CB 2CU3A 1QOAA 2N7JA 1KRHA 1V97A 2BT6A 2BTEA 3IT6B 2WXMA 3HUIA 4M0WA 2J4XA 5TSSA 1D6EC 1FFVA 2FE8A 3GS2A 3NVYA 3U2SC 1SJHD 3VR9B 1KH0A 1GAQB 1YJIA 5GXGB 3TSSA 3HVDA 1JALA 1IBXA 1WGKA 2WXKA 4ZHPA 1FD6A 3GB1A 1C4AA 3P42A 4UDUC 1HXYD 2M56B 2WXHA 2Z8LA 1MVKA 3O13A 1CK1A 4C56C 3AEFB 2WS3B 1KF6B 1BUIC 4XDCA 1FIQA 1K52A 2MJ3A 2WXJA 1ZP0B 1OQRA 1SB3C 3U4EG 1FCLA 2AX5A 3HRDD 5AUIA 1GT8A 4MT5A 3TEWA 1STEA 4YSXB 2MH7A 4CQNA 2J53A 3W1SA 1XLQA 4B0EA 1D5XC 4USAA 4RGTA 3BK1A 3URYA 1JMLA 2JZPA 3J9CA 2WDRB 3MC0B 2BS2B 2BS4B 1E9MA 2PTLA 3P4RB 1KLUD 1TS5A 3MFGA 4RFBA 1XLNA 5FK9C 1L4DB 4OZAA 1EM7A 3IAM1 5BMIA 4EE2A 1D4BA 1D5ZC 2D5GA 4Q2JA 1M4VA 4ARCA 1H7WA 4B0MA 3AE2B 4LLGM 3AE8B 1UWMA 4MM3B 1FRRA 1QKZA 2XN9C 3VRAB 2PVGC 1I4RA 1CJEA 2N0SB 2LGIA 3CF4A 5C2TB 4JWSC 4HKZE 3OWEB 4P16A 2WXQA 2X38A 1V1OA 2HDEA 5EE1A 2NTTA 5EE3A 4RF1A 2IDYA 4WAFA 2KAJA 3ZJUA 1HZ6A 1T5XD 3R2TA 1SIJA 2Y5CA 4ZHOA 5H8YE 1FFUA 2KACA 1HQRD 2NMQA 4YTMB 4YSZB 1TS2A 1J7CA 4ZRQA 2PVOD 3U7ZA 1ESFA 2JQRB 2K9XA 3ZJVA 1XLOA 1TS3A 1UNSA 2H89B 2WNMA 1AWDA 4KKIA 1FNUA 1J7AA 1ZOYB 1WWTA 1GB4A 4JWUC 1QOBA 3KWVA 1SE2A 1JROA 1UWXA 3P1MA 3EUB2 5I4DA 2E6XA 3BIID 4HJGE 1QILA 1SJED 2JXTA 2WXNA 2W55A 4KGSA 4A8XC 5G5GA 1YQ3B 1Q10A 1K53A 2WLBA 1ZE3D 3EA6A 3DWMA 2L32A 1OFFA 3VQIA 2K22A 3RFZB 2H88B 3AEBB 1JRPA 2I38A 1BMLC 1HZ5A 3IAS1 3TUOA 1GTHA 1VZ6A 1L0XB 1XXGA 1FRDA 3KQ4A 5C3JB 2LEKA 2VZKB 3AN1A 5HG2A 2ON8A 3P63A 1F2RC 1WRIA 1R7SA 1L0VB 1NI3A 1NYQA 2LHDA 4OW0A 4TQ0A 3NVWA 1IBXB 2DWQA 2PIAA 4ZRPA 4US9A 3V3XA 1FXAA 3DWGC 1FO4A 3T3OA 3W5UB 1AN8A 2JYTA 2OHFA 4ARIA 3BVZA 1FMAD 5HI1A 3W2DA 1PDXA 3P4QB 1EU3A 4A55A 2DLBA 2ICIA 2WXIA 4XWWA 1XCTL 1ZXIA 3ZJTA 3NS1A 3P4SB 1EWYC 5D3IB 3E9SA 4KKJA 1FNWA 2HTME 2J52A 1NEKB 1I4HA 1QLBB 2LMCA 1PYWD 3I57A 1ET6A 4C7YA 2ZW0A 3BK2A 3FILB 1A70A 1ZUD2 5D3DA 4US8A 1BXTA 2RPVA 1L4ZB 2XNAC 4L1BA 1FM0D 1VR9A 3PO0A 2WXOA 3SFDB 2GRIA 3BYTB 2BBCA 3MP9A 1YN3A 3ABVB 4TQ1A 1FNVA 1PGAA 5BMGA 1QQRA 4OHJA 2DBYA 1WXQA 1EWCA 1L5PA 5FR3A 4NAMA 1TYGB 2QIEB 2YEPF 1VLBA 2JU6X 1B9RA 3KWLA 2WDVB 3AH7A 2QMTA 2MEKA 2AQ1B 1DOYA 1D5MC 3Q8EA 3CIRB 4NZLB 2MJDA 1PGBA 4RF0A 4WWMA 2JX5A 3NVZA 4HROA 4C80A 2KMMA 1XF5L 2W3SA 3SFEB 4FXCA 2ACZB 1T6BX 1SBBB 2G1EA 4NJCA 1Y56A 4GLSC 3IT4B 1ZXHA 1L0YB 1ZPSA 4YTNB 2ZW1A 5HFYA 2AQ3B 2PMVA 1IGDA 3PZ8A 4HEA1 4YT0B 3Q69A 2FUG1 3AE9B 4XE0A 1QOGA 5EE9A 4RNAA 2IJ0A 3NUHB 5H92C 1YQ4B 3B9JA 3B2FA 1E7PB 2WU5B 1SSNA 4OVZA 1PGXA 3BYYB 1F2RI 2R61A 3AE7B 1XEEA 1K50A 4YXDB 1JWAD 1XLPA 2WXLA 3NVVA 2LHEA 1RYJA 2WXGA 1V1PB 1ET9A 2I2YA 4WQMA 1GOZA 4MACA 3I9V1 1MHXA 3C8YA 3NZ3A 3ZGZA 1I4XA 2EKIA 4GDKB 2W54A 2KDMA 1T3QA 3AB5A 1NYRA 4DXGA 1JQ4A 1KFYB 2K0PA 4P6VF 3BVMA 4DQOC 3IXSA 1QF6A 3AM9A 3SEBA 4L2YA 4REZA 1FCCC 1YMHE 4LTUA 4N58A 3LB8C 1RM6C 4A90A 4AQ7A 5HHDG 3EGRA 2W82A 1TKEA 1ZDVA 2W3RA 1C76A 2INPE 4JPSA 2INNE 5JXVA 1DOXA 1YJJA 2QSDA 2B76B 1YN4A 2RDGA 1E0ZA 1JW9D 1ACCA 2SAKA 1JWMD 1E10A 3TEZA 1GTEA 4RGOS 1UGJA 1ZDXA 3RPFC 3AEDB 4YSYB 1C4PA 4J3OD 1N5WA 1WSPA 5D7GA 5T8IA 2ONQA 2V3PA 1AYFA 2MJEA 3NRZA 1JWBD 3AE4B 1C4CA 3MJ5A 1C77A 3AEAB 2LFIA 2G9HD 3U52E 2JSVX 1NENB 1L6VA 1N61A 1H7XA 1TZOA 3SR6A 2GI9A 4A9AA 2TSSA 4N59A 3FILA 1RWSA 4RH6A 1TS4A 1GPXA 4D2KA 1N63A 3WCQA 2WXPA 3Q8BA 3T3NA 1UUPA 4WIPA 2PKOA 2K3UA 3MHZA 1PUTA 1P7EA 3AE3B 2SEBD 1MI0A 3AEEB 2L52A 1V8CA 3LXFA 3ETRA 1FEHA 4IOIE 1F77A 2WP9B 1YNTE 2JYEA 3GP7A 4HRSA 4OZBA 3ZQ4A 2BW2A 3VR8B 2IGHA 1TJEA 4KGRA 4N6EB 3BWUD 3HVZA 1SXTA 5E6JA 3L4PA 2CJNA 4TSSA 4XWTA 1WYGA 3N9YC 1XO3A 3B2GA 1QOFA 4JE3B 1MPEA 1QT9A 2QEJC 5G5HA 1DGJA 2IGGA 2WQYB 4LK0M 1VDVA 2DYMA 2KN4A 3LYYA 1I4PA 4GDLB 3AE5B 2KWDA 2JWUA 2N9LA 5MPOA 1VJKA 2VZKD 3FC4A 1F0ZA 1YN5A 1L6UA 1I4GA 1NVID 4ITKA 4L23A 1MHHE 2M19A 1IGCA 2V4IB 3PZ7A 3BVGA 4H2AA 3R8BA 2E3TA 2YEPB 3AECB 3TEXA 2PLPA 1JWSD 3AE1B 2CJOA 4O1NA 2V3NA 3VRBB 1PFDA 2BS3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FXI A;  2H88 B;  3AEB B;  1YJI A;  1JRP A;  4WQM A;  5GXG B;  1JAL A;  1GAQ B;  2Q5W D;  1GTH A;  1WGK A;  2EKI A;  4ZHP A;  1FRD A;  2W54 A;  3AB5 A;  5C3J B;  1T3Q A;  1NYR A;  2LEK A;  3AN1 A;  1KFY B;  1JQ4 A;  4P6V F;  3P63 A;  1WRI A;  1QF6 A;  3AM9 A;  1R7S A;  4JX1 C;  1ROE A;  1L0V B;  1NI3 A;  2M56 B;  4C7Z A;  1NYQ A;  4US9 A;  2QJL A;  3AEF B;  3NVW A;  2WS3 B;  4LTU A;  1KF6 B;  2DWQ A;  2PIA A;  1FIQ A;  1RM6 C;  2MJ3 A;  3LB8 C;  1ZP0 B;  1FXA A;  1OQR A;  1SB3 C;  2L83 A;  3DWG C;  3W5U B;  2AX5 A;  3HRD D;  1OQQ A;  1TKE A;  2OHF A;  1FO4 A;  5AUI A;  1GT8 A;  1FMA D;  1N60 A;  2W3R A;  1J7B A;  1E6E B;  1PDX A;  3P4Q B;  1YJJ A;  1DOX A;  2B76 B;  1E0Z A;  4YSX B;  2MH7 A;  1JW9 D;  1ZXI A;  1XLQ A;  1E10 A;  3AV8 A;  1GTE A;  4USA A;  1DOI A;  3NS1 A;  3P4S B;  1EWY C;  3RPF C;  3AEG B;  3AED B;  2HTM E;  2WDR B;  4YSY B;  1NEK B;  1IUE A;  1N5W A;  2WU2 B;  1QLB B;  2BS2 B;  2K5P A;  2BS4 B;  4C7Y A;  1E9M A;  3P4R B;  1AYF A;  1XLN A;  2MJE A;  3NRZ A;  1JWB D;  3AE4 B;  1A70 A;  1ZUD 2;  3FAH A;  4US8 A;  3ZYY X;  3AEA B;  1I7H A;  1FM0 D;  1H7W A;  3AE2 B;  1NEN B;  1L6V A;  1N61 A;  3SFD B;  3PO0 A;  3W5V B;  3AE8 B;  1H7X A;  1UWM A;  3SR6 A;  1FRR A;  3VRA B;  3ABV B;  2PVG C;  4A9A A;  4N59 A;  1CJE A;  1TKY A;  2N0S B;  1RWS A;  2DBY A;  1WXQ A;  1GPX A;  1N63 A;  1L5P A;  3WCQ A;  3CF4 A;  1TYG B;  2QIE B;  5C2T B;  4JWS C;  4N58 A;  1VLB A;  1B9R A;  2PKO A;  3KWL A;  5EE3 A;  1PUT A;  5EE1 A;  3AE3 B;  2WDV B;  3AH7 A;  1N62 A;  1SF0 A;  4ZHO A;  3AEE B;  4KX6 B;  1V8C A;  2L52 A;  3AE6 B;  3CWI A;  1CZP A;  2FBW B;  3ETR A;  3LXF A;  1DOY A;  3CIR B;  2KAJ A;  4HRS A;  2WP9 B;  2MJD A;  4WWM A;  1SIJ A;  2JX5 A;  3NVZ A;  4HRO A;  4C80 A;  2Y5C A;  3P4P B;  2KMM A;  2W3S A;  3SFE B;  3VR8 B;  4FXC A;  5AUK A;  1TJE A;  5EE0 A;  1FFU A;  4N6E B;  5H8Y E;  2ACZ B;  3HVZ A;  3L4P A;  2CJN A;  4YTM B;  2G1E A;  4YTP B;  1WYG A;  4YSZ B;  1XO3 A;  3B2G A;  1QOF A;  1J7C A;  1TKG A;  2PVO D;  1QT9 A;  5G5H A;  1DGJ A;  2JQR B;  1N5X A;  2K9X A;  2WQY B;  1VDV A;  4ZOH C;  4YTN B;  1XLO A;  4IDI A;  2H89 B;  3AE5 B;  5MPO A;  4YT0 B;  1AWD A;  1J7A A;  1ZOY B;  2WDQ B;  1VJK A;  1WWT A;  3FC4 A;  1QOB A;  4JWU C;  1F0Z A;  1JRO A;  3P1M A;  3EUB 2;  1RFK A;  3AE9 B;  1L6U A;  1QOG A;  3BII D;  3AMZ A;  1NVI D;  2CU3 A;  4ITK A;  5EE9 A;  1QOA A;  3W9C B;  2M19 A;  1KRH A;  1V97 A;  2BT6 A;  2W55 A;  2E3T A;  1YQ4 B;  5H92 C;  5G5G A;  3B9J A;  3HUI A;  3B2F A;  1E7P B;  2WU5 B;  3AEC B;  1YQ3 B;  3AE1 B;  3AE7 B;  2WLB A;  2CJO A;  4YXD B;  1FFV A;  1JWA D;  1XLP A;  3NVY A;  3DWM A;  3VR9 B;  1OFF A;  3NVV A;  3VRB B;  1RYJ A;  2K22 A;  1PFD A;  2BS3 B; 
#chains in the Genus database with same CATH topology
 4IC7 B;  3APC A;  2L1A A;  2Q5W D;  2IY0 B;  4ANU A;  1SEB D;  4AS1 A;  2WWZ A;  4C7Z A;  4NJ7 A;  2FAZ A;  1TY2 A;  1V1P A;  1C9F A;  2QJL A;  3PRM B;  2K8H A;  1OQQ A;  2GB1 A;  3CMM B;  4LNN A;  2N9K A;  4P1C C;  2AL3 A;  2LUM A;  3Q3N C;  3ZTC A;  1MJD A;  3AEG B;  1IUE A;  4RCO A;  2K5P A;  1RAX A;  2IO3 B;  1I7H A;  2BF8 B;  1SE4 A;  2BYT A;  4KZ0 A;  2AQ2 B;  4IWQ A;  4BOZ B;  2WX1 A;  2DZM A;  1UH6 A;  1N62 A;  3DOW A;  2LGY A;  1SF0 A;  2K8B A;  4KX6 B;  4RGN A;  1DYQ A;  1CZP A;  2N9P C;  2WXR A;  3OJ3 A;  4MSM B;  3VXW A;  5DPW A;  5EE0 A;  4S17 A;  4XZ4 A;  2XBB C;  1K51 A;  1UBI A;  2KC1 A;  1I4Q A;  2C7N B;  3B0A A;  3RNF C;  3NHE B;  1JWU D;  4YWG G;  5BMH A;  4P7I A;  2LVO A;  4IKG A;  4MDK E;  2BB5 A;  3V05 A;  1YQB A;  4EEW A;  4RGM A;  2PE6 B;  1OQY A;  1GC6 A;  5DPR A;  3OAW A;  5E6P A;  1XT9 B;  3KYD D;  2FE8 A;  4MEL A;  1SJH D;  4K3C A;  2M1M A;  1GAQ B;  4GXB A;  1G6J A;  2BWE S;  1P9D U;  1WGY A;  3W1S C;  2WXK A;  1BT0 A;  2FIF A;  3ZO5 B;  4MJS B;  1YJ1 A;  3P42 A;  4PYZ A;  2N9E B;  1HXY D;  3ZNH B;  4M8N A;  1MVK A;  1BUI C;  3U4E G;  1SB3 C;  1GT8 A;  2IO2 B;  3BY4 B;  4XC2 A;  3TEW A;  3NJT A;  3ONS A;  2N1W A;  1GUA B;  1XLQ A;  1WR6 E;  1JML A;  2JZP A;  2WDR B;  3MC0 B;  3P4R B;  1E8X A;  1FPY A;  1EM7 A;  2HJ1 A;  3IAM 1;  1D4B A;  1Z2M A;  2KZR A;  2WX0 A;  4B0M A;  3AE2 B;  4IW0 A;  3AE8 B;  1V81 A;  2QDF A;  4MM3 B;  4OVU A;  3VRA B;  2PVG C;  4HXD A;  2K39 A;  2REX A;  3CF4 A;  5C2T B;  4HKZ E;  2V4L A;  1V1O A;  1WJN A;  4RF1 A;  4WAF A;  2KAJ A;  3ZJU A;  3ZLZ A;  1SIJ A;  4A3O A;  2Y5C A;  1R4M I;  3L0W B;  1J0G A;  3WAL A;  2BKF A;  1TS2 A;  2AWT A;  2PVO D;  4K3B A;  4I6L B;  2JQR B;  4GIV A;  2MSE D;  3JSV B;  3N3K B;  3M62 B;  4AP4 C;  1ZOY B;  2O6V D;  4B95 A;  5I4D A;  2BYF A;  3WIM A;  1RLF A;  5KHQ A;  3JW0 X;  2A5U A;  4A8X C;  5AZH A;  5G5G A;  4G0N B;  4M00 A;  1YQ3 B;  3VH3 B;  1ZE3 D;  3UIO B;  2KWC A;  2L32 A;  4HJK A;  3VQI A;  5JZE B;  1V80 A;  1UGM A;  3TL5 A;  3QAR A;  3IAS 1;  5IAA C;  3TUO A;  4KSL C;  2WGS A;  1LM8 B;  1TBE A;  4MH0 E;  2KD0 A;  3L54 A;  2G3Q B;  1WM3 A;  1NYQ A;  4W9K A;  2LHD A;  4QAY A;  4W9G A;  3V3X A;  2PIA A;  1FO4 A;  1NDD A;  3W5U B;  4K1R B;  2JYT A;  2OHF A;  1FMA D;  1S3S G;  3A4S C;  4JGH B;  4WWN A;  2DLB A;  2ICI A;  4IM3 A;  1K8R B;  3NS1 A;  3AU4 A;  2RSU A;  3E9S A;  1V2Y A;  3QWZ B;  1I4H A;  2LMC A;  4BAX A;  3RD2 A;  3FIL B;  5D3D A;  2MBH A;  3N1Z C;  3RYT A;  2KMA A;  1FM0 D;  3KW5 B;  3L13 A;  2WXO A;  2JZZ A;  2BBC A;  2N9X A;  3MP9 A;  4TQ1 A;  1IP9 A;  3JYU A;  3K9O B;  1EWC A;  3RUL A;  4M01 A;  1TYG B;  2QIE B;  4JQW C;  4HPP A;  1B9R A;  3NG0 A;  1YIW A;  3NOB A;  1D5M C;  3UQB A;  1J8C A;  3NVZ A;  4HRO A;  2L00 B;  4C80 A;  3CST A;  2KMM A;  1OGW A;  3UIP B;  1LFD A;  1T6B X;  1A5R A;  3HIZ A;  1T0S C;  4GLS C;  5D6J B;  1ZXH A;  2RGF A;  2AYO B;  4FBJ B;  4EZJ A;  1T0Q C;  1F52 A;  3M63 B;  4YTN B;  2MBQ A;  5HFY A;  3GE3 C;  3EEC A;  3PZ8 A;  4YT0 B;  1LGR A;  1V49 A;  2DHZ A;  2IJ0 A;  3ZRC A;  4ASW C;  1E7P B;  2WU5 B;  1SSN A;  3ZKJ C;  4OVZ A;  2L8J A;  1F2R I;  3AE7 B;  1XLP A;  2GMI C;  3NVV A;  1ET9 A;  1GOZ A;  2KTF A;  2ZNV B;  3NZ3 A;  2KDE B;  2LVQ A;  2RR9 A;  1NYR A;  2K0P A;  2KOX A;  3H7P A;  3VTW A;  3AM9 A;  4ZYN A;  4PK1 A;  1UZX B;  4J6I A;  3LB8 C;  3R7R A;  4HK2 A;  3PV1 A;  1WJU A;  3EGR A;  2W82 A;  1C76 A;  3PHX B;  1DOX A;  4BKS D;  1E0Z A;  2B76 B;  4C00 A;  2QC8 A;  3APF A;  1WXM A;  3ZXR A;  4F1S A;  2J0M A;  1RRB A;  4IG7 B;  1JWM D;  3TEZ A;  4RGO S;  1ZDX A;  4BKS A;  2UWQ A;  4J3O D;  5D7G A;  1N5W A;  5T8I A;  3LJ3 A;  4EUT A;  2DX5 B;  4HVB A;  3QA8 A;  4HPL B;  1WZ3 A;  1WI0 A;  1C4C A;  3EFC A;  3MJ5 A;  3U52 E;  1H7X A;  3SR6 A;  4N59 A;  3FIL A;  1TS4 A;  2ZPN A;  1E5W A;  1SGH A;  1UUP A;  2EMS A;  3I5J C;  3MHZ A;  2K3U A;  2JRH A;  2LVP A;  3UGB B;  4ANX A;  2L52 A;  1HE8 A;  3DBL I;  3ETR A;  1F77 A;  2WP9 B;  2JYE A;  4HRS A;  2DZI A;  3ZQ4 A;  1OTR B;  4KGR A;  3BWU D;  1Y8R C;  3IG3 A;  2W9N A;  3DBR I;  3N20 C;  1XO3 A;  5G5H A;  3PRE A;  3WAO A;  1VDV A;  2KN4 A;  2PEA A;  4GDL B;  3AE5 B;  2KWD A;  2N9L A;  1WGH A;  1GC7 A;  2VZK D;  3Q14 C;  1NVI D;  4WAA A;  2K25 A;  2N7E A;  1MHH E;  2M19 A;  3BVG A;  2CR5 A;  2PLP A;  4KSK C;  1WJ6 A;  3AE1 B;  4E71 A;  4O1N A;  1EF1 A;  2BS3 B;  4KIK A;  3MC8 A;  4W9C A;  2JT4 B;  2KDI A;  2O6V B;  2KDB A;  5CHF A;  2I1K A;  3SHQ A;  3Q6B A;  4PS3 A;  3DQV A;  2J42 A;  4W9I A;  2LJI A;  1WE7 A;  3HM6 X;  3H7P B;  1I35 A;  1B1Z A;  4II2 B;  3ENE A;  3Q2A C;  3ECI A;  3I3T B;  1TIF A;  3N1X C;  5JHB A;  2BWF A;  2MCN B;  1X1M A;  2WDT B;  4FUL A;  4IUM B;  4JL9 A;  2RDH A;  1C78 A;  2EEL A;  3ZUN A;  3ZYY X;  1FXT B;  5BYQ A;  3W5V B;  1KLG D;  1ENF A;  1Q5W B;  1HEZ E;  1R4N B;  2IGD A;  1LO5 D;  1WJ4 A;  2DYB A;  5FKA C;  4NNJ B;  3Q8F A;  2KKC A;  1VRA B;  4NAW B;  1F1H A;  4ZYS A;  4GN1 A;  1JCK B;  3DHG C;  1P1A A;  2ZPY A;  1MG8 A;  2BQQ A;  1N5X A;  4DBG A;  4KGT A;  4A6Q A;  2LGS A;  2OJR A;  3T9L A;  1KOT A;  4ZDV A;  3AMZ A;  2CU3 A;  1QOA A;  3GOE A;  1V97 A;  4G3X B;  3HUI A;  3SU8 X;  1D6E C;  4RMA A;  4HDO A;  5DPT A;  4B9K A;  1YJI A;  5GXG B;  3TSS A;  4ANV A;  1IBX A;  3ZW3 A;  3TCA A;  4IM0 A;  3DVG Y;  4ZHP A;  1D3Z A;  1M94 A;  1C4A A;  1IPG A;  1E8Z A;  1ZW7 A;  4JLC A;  4KDI C;  2KJ6 A;  2WXH A;  3RNE C;  2KVR A;  1FIQ A;  1K52 A;  4DHZ B;  1FCL A;  3HRD D;  2Y5B B;  5BO4 B;  3QCA A;  5AZF A;  1STE A;  2MH7 A;  4FAD A;  1UD7 A;  2JRI B;  2GOW A;  3W1S A;  1D5X C;  3BK1 A;  2DNF A;  4OVV A;  3VTV A;  4LDT B;  1KLU D;  5FK9 C;  4OZA A;  2IY1 B;  3OLM D;  4EE2 A;  2D5G A;  1M4V A;  4K7U A;  4ARC A;  1H7W A;  1UWM A;  1I4R A;  3PGE A;  3CSF A;  3ZNI D;  5L95 C;  5E6N A;  2O2V A;  2X38 A;  2HDE A;  5EE3 A;  5D94 A;  2I1J A;  1HZ6 A;  2KLC A;  2D10 A;  4BKG A;  2C60 A;  5IOI A;  1MFW A;  3TBL D;  4ZRQ A;  3H7S A;  3N1Y C;  2ZVN A;  3ZJV A;  2KFK A;  1UNS A;  4K7S A;  3VH4 B;  1EUV B;  2GBJ A;  1GB4 A;  3DHI C;  1UEL A;  1SE2 A;  3KWV A;  4GB9 A;  4KZC A;  3R7Q A;  2C7M B;  2JXT A;  2W55 A;  3DCG A;  4KGS A;  1WYW B;  2ZNV C;  1K53 A;  1YD8 U;  1N6Z A;  2AL6 A;  2WLB A;  3VUY A;  2H88 B;  3RFZ B;  1BML C;  1HZ5 A;  4W9F A;  1QZE A;  1XXG A;  1FRD A;  2VZK B;  5HG2 A;  4BBN C;  3P63 A;  1F2R C;  1WRI A;  1R7S A;  1WIA A;  1Q0W B;  2NVU I;  4ZRP A;  1FXA A;  2KQS A;  1AN8 A;  4ARI A;  5HI1 A;  4S0R A;  4F7Z A;  2G45 B;  4MGZ E;  1PDX A;  2MWS B;  4CHK A;  3EFU A;  1EU3 A;  4NJ6 A;  5IA7 A;  3MC9 A;  4XWW A;  3ZJT A;  1ZXI A;  3O65 B;  3P4S B;  5D3I B;  3FKY A;  4AWJ A;  1FNW A;  2HTM E;  2IBI B;  3VFK A;  3I57 A;  1PYW D;  1ET6 A;  3BK2 A;  1EO6 A;  2RPV A;  4PS7 A;  2Z59 B;  2D2Q A;  2A4Z A;  2D07 B;  1WF9 A;  1YN3 A;  3KUZ A;  2D3G A;  4EOY A;  5BMG A;  5AEK B;  3RNB C;  2DBY A;  1L5P A;  4NAM A;  3EC8 A;  2L05 A;  4NAW A;  3KWL A;  2IZV B;  2WDV B;  1DOY A;  2M0X A;  4NZL B;  4RF0 A;  4WJO A;  5DCN A;  3UF8 A;  4W9J A;  2JPH A;  3SFE B;  3AXC A;  1WMH A;  2G1E A;  4NJC A;  5KHO A;  2V1Y A;  2FID A;  3DBR B;  2CKH B;  3L16 A;  5IN7 A;  2IO1 B;  2ZW1 A;  2AQ3 B;  4NQL B;  3PZD A;  1IGD A;  3RNC C;  2V9H A;  3GE8 C;  4FN2 A;  3L17 A;  3Q3O C;  4W9L A;  2PPH A;  4WJN A;  2KFK B;  3IVF A;  5H92 C;  1I42 A;  1PGX A;  2D3B A;  2R61 A;  1XEE A;  1JWA D;  2I2Y A;  4WQM A;  3ZGZ A;  2EKI A;  4GDK B;  4ZRI A;  2JUO A;  4P6V F;  3JVZ X;  4RM8 A;  3D32 A;  3SEB A;  5FR6 A;  3ZDT A;  4REZ A;  3PHW B;  4N58 A;  1ZGU B;  1RFA A;  1T0R C;  4FJV B;  2G4D B;  1TKE A;  1WE6 A;  2W3R A;  2M8S A;  3M3J A;  5JXV A;  2RDG A;  2NBV B;  1JW9 D;  2SAK A;  2M17 A;  1UGJ A;  3RPF C;  2D3C A;  2MLB A;  3IHP C;  1KLV A;  2DAJ A;  3NZS A;  3V61 A;  2V3P A;  1E90 A;  1JWB D;  1GJZ A;  4ZRJ A;  1TT5 B;  3AEA B;  2B3A A;  2LFI A;  2HJ8 A;  2C7H A;  1AAR A;  1TZO A;  2TSS A;  4GOC A;  3U7D A;  5LXI B;  1N63 A;  3QC8 B;  3ML9 A;  3Q8B A;  3T3N A;  4KV2 A;  1MI0 A;  2K6D B;  3OG5 A;  4K7W A;  3PRZ A;  3LXF A;  1KJT A;  4M02 A;  2BW2 A;  3VR8 B;  3RZW C;  2LGD A;  3HVZ A;  3VUW A;  2D3A A;  4ANW A;  2M4N A;  2KAN A;  4WQO B;  2XEW A;  3W1Y A;  3MJW A;  5C1Z A;  3LYY A;  2PE9 A;  3QQ8 B;  3FC4 A;  1F0Z A;  1L6U A;  4ITK A;  5J2R A;  4L23 A;  1IGC A;  4H2A A;  3PLV A;  1OEY J;  3TEX A;  4BKT A;  2JXX A;  2CJO A;  4HCP B;  3GZN B;  3VDZ A;  3VRB B;  1PFD A;  1FXI A;  3R66 C;  3BZD B;  5LNK 1;  2DZK A;  1VZ8 A;  4HCN B;  5BYR A;  2WXF A;  2IND C;  2DYO A;  3H1U A;  5IO9 A;  4GDK A;  1C79 A;  1N60 A;  2NPT B;  3L10 B;  1GNU A;  2CHX A;  4DWF A;  4R3D A;  1UBQ A;  1XD3 B;  2V0G A;  1NI2 A;  3AV8 A;  3A1Q B;  3R2I A;  2MBO A;  2M0A A;  4A3P A;  2RMM A;  4FHK A;  2PW9 A;  3FAH A;  4HKQ A;  4WJQ A;  2KTR A;  2Y3A A;  2YLM A;  3UI3 A;  4NY0 A;  2EMT A;  1WGG A;  2GBK A;  4C4V A;  1WR1 A;  3C0R B;  1GB1 A;  2N1V A;  3ZIM A;  3RZF A;  4PT5 A;  4MH8 A;  1SE3 A;  3AE6 B;  2FBW B;  2BB6 A;  4PS8 A;  3P4P B;  1Z5S B;  3Q8A A;  4YTP B;  1TY0 A;  1AW7 A;  1TKG A;  2GBR A;  2IPK D;  2QIL A;  4IDI A;  1XCQ L;  2JWZ A;  1P7F A;  3ZTD A;  2XK5 B;  1KRH A;  2BTE A;  3IT6 B;  4GMV A;  2J4X A;  5TSS A;  3K9P B;  4W9H A;  3SD5 A;  2IO0 B;  4E74 A;  2R2O A;  1JAL A;  2NBW B;  1WGK A;  2KT7 A;  1FD6 A;  2LXA A;  2M56 B;  3A9K A;  2Z8L A;  4C56 C;  3AEF B;  1KF6 B;  2LZ6 A;  2WXJ A;  5JH5 C;  2AX5 A;  2ZZP B;  4RM9 A;  2HE7 A;  3PVL A;  4I6N B;  2KNB A;  4CQN A;  4B0E A;  4W9E A;  1OEY A;  3A33 B;  2BS2 B;  2KDF B;  2BS4 B;  1C3T A;  2PTL A;  1TS5 A;  3UQA A;  2D11 A;  1D5Z C;  3A1Q A;  3HHM A;  4MEM A;  1YX5 B;  2PJH A;  2XN9 C;  1CJE A;  5CX3 A;  2N0S B;  3ML8 A;  2K6Q A;  4JWS C;  3N30 A;  2HD5 B;  4P16 A;  2WXQ A;  5LXH A;  1E7U A;  1T5X D;  5IKC M;  5CHV C;  3H9D A;  2X8X X;  4ZHO A;  2FCM A;  5H8Y E;  2KAC A;  5TR5 A;  2NMQ A;  3QJZ A;  1WFY A;  4YTM B;  5G2N A;  4YSZ B;  3RCZ A;  3U7Z A;  1JRU A;  2K9X A;  3DBH B;  1TS3 A;  4A20 A;  3B1L X;  5HKH A;  4KKI A;  4F8C B;  4JWU C;  3QHT A;  1QOB A;  1VCB A;  4HLE A;  1JRO A;  4FA6 A;  2E6X A;  4HJG E;  2VRR B;  2LRU A;  4GDL A;  3AI5 A;  3IFW B;  2JY6 A;  3DWM A;  3AUL A;  4I6P A;  2I38 A;  1GTH A;  2MRP A;  1VZ6 A;  2V3S A;  5C3J B;  2NPT A;  4DHJ D;  4E3C A;  1NI3 A;  3VVW B;  2L3Z A;  2LRW A;  4KIK B;  3TJP A;  4CO7 A;  4US9 A;  3DWG C;  2ZJD A;  3T3O A;  2O6V A;  2KX0 A;  3MTN B;  2RDB C;  4A55 A;  3A9K B;  1XCT L;  2FCQ A;  3X0W A;  4DHJ B;  4KKJ A;  2LXC A;  1NEK B;  1QLB B;  2ZCC A;  3APD A;  5J17 A;  2ZW0 A;  2CU1 A;  2J0J A;  2CS4 A;  1ZUD 2;  2MBE A;  1BXT A;  1WGR A;  3RNG C;  3PSE B;  2JZ3 B;  2XNA C;  4TUU A;  3N32 A;  3ABV B;  1PGA A;  1ZKH A;  5LLI A;  1QQR A;  1VLB A;  4II3 B;  2JU6 X;  3Q3M C;  1XQQ A;  4JIO U;  2KXJ A;  2DZJ A;  1KM7 A;  3DDC B;  3CIR B;  2MJD A;  1PGB A;  4WWM A;  1ISN A;  2JX5 A;  1XF5 L;  1SBB B;  2MBB B;  3ZNZ B;  3AU5 A;  4DXA B;  3IT4 B;  1L0Y B;  1ZPS A;  2ZVO A;  3X23 A;  1EF5 A;  2PMV A;  2NS5 A;  4AUQ C;  4NQK E;  1WXA A;  2KMC A;  3AE9 B;  3B08 A;  4N9F 4;  3DVN U;  3KYC D;  4RNA A;  1SIF A;  3ALB A;  1YQ4 B;  3B9J A;  3DBS A;  3QK0 A;  4EZK A;  4MJS A;  3BYY B;  1WX9 A;  1TTN A;  1WH3 A;  4YXD B;  4G11 A;  2BYE A;  3H6N A;  1V86 A;  2LHE A;  1RYJ A;  3KUC B;  3P2B A;  2KJR A;  5CTR C;  3QIJ A;  4MAC A;  4MGK E;  2RPQ A;  1MHX A;  4FJY A;  4LDT D;  2W54 A;  1T3Q A;  2KWV B;  4DXG A;  4URK A;  3TMP B;  3C19 A;  3IXS A;  4L2Y A;  4CYE A;  3RN9 C;  1YMH E;  4LTU A;  1IYF A;  3RNA C;  4A90 A;  4AQ7 A;  1ZDV A;  4JPS A;  2INP E;  3KUD B;  3S2A A;  1YJJ A;  1YN4 A;  1Q1O A;  4DDI D;  1ACC A;  2WHI A;  1C4P A;  4MM3 A;  4BFR A;  4MGI E;  2ONQ A;  2LWP A;  1AYF A;  4HDQ A;  3AE4 B;  1WXV A;  4XGA B;  2KWU B;  2JSV X;  1E8W A;  1L6V A;  4DHZ E;  1CMX B;  2LI5 A;  1E7V A;  4RH6 A;  1J19 A;  2DEN B;  3WCQ A;  2WXP A;  3U8Z A;  3WAP A;  3DPD A;  2PKO A;  3DVN V;  1PUT A;  3AE3 B;  2SEB D;  3RUI B;  1V8C A;  2L7R A;  3NZU A;  3KH0 A;  1TJE A;  1WXS A;  2O2V B;  3HM3 A;  2C9W B;  4BBN F;  3B2G A;  1QOF A;  2AEH A;  4G50 A;  1MPE A;  1QT9 A;  4HWI B;  4IM2 A;  4KDL B;  3MHS D;  4LK0 M;  1C1Y B;  1S1Q B;  2JWU A;  2MHJ A;  1YN5 A;  3BIN A;  3ZVV A;  3U30 A;  3PZ7 A;  1V6E A;  2E3T A;  2KVZ A;  2KQ7 A;  4ICV A;  3AEC B;  1JWS D;  4IWP A;  2UYZ B;  3SDL C;  2VH2 A;  4LNI A;  2V3N A;  3HK0 A;  1HA5 A;  3E56 A;  1GG3 A;  4DXF A;  4TMA B;  3NS8 A;  4JX1 C;  1ROE A;  5J18 A;  2JVC A;  4ACF A;  3KLS X;  2FNJ B;  1VZ7 A;  2L83 A;  3T8M A;  4EKU A;  1J7B A;  1E6E B;  2QCZ A;  2OJW A;  1EU4 A;  4XX5 A;  2CHW A;  3EHV A;  2Z0D B;  1DOI A;  3LDZ E;  2KHW B;  2KQ4 X;  3QAQ A;  3H8H A;  2WU2 B;  3RT3 B;  1WX7 A;  4XDD A;  3Q8C A;  2OED A;  5BYS A;  4DK5 A;  3GZN I;  3TEY A;  3DVG X;  1TKY A;  4YL8 A;  4GGQ A;  4LCD E;  2WYQ A;  2OOB B;  2L0T A;  2L76 A;  3CWI A;  2NTS A;  3V6E B;  3KVF B;  5AUK A;  4DDG D;  2KLG A;  4WH4 A;  2KN5 A;  4ZOH C;  3A9J B;  4GU2 A;  2WDQ B;  2KJH B;  2Y5P A;  2YVC A;  2J7Q B;  1CQV A;  1RFK A;  4OZC A;  4WUR A;  1KTK A;  5JHA A;  3W9C B;  2VH1 A;  2N7J A;  2BT6 A;  2WXM A;  4M0W A;  3I63 C;  3DBL B;  2NCN A;  3WA0 A;  1FFV A;  3GS2 A;  3NVY A;  3U2S C;  4LJO B;  2ZEQ A;  2FCN A;  3VR9 B;  1KH0 A;  1TZ1 A;  3ZRF A;  3HVD A;  2FCS A;  5D2M B;  1P0R A;  3WAN A;  3GB1 A;  4FLH A;  4UDU C;  1WX8 A;  4BVU C;  3O13 A;  1CK1 A;  1HTQ A;  4FJZ A;  2WS3 B;  4XDC A;  2MJ3 A;  1ZP0 B;  1OQR A;  2G4S A;  2UU7 A;  5AUI A;  4MSQ B;  1V5T A;  4MT5 A;  2MP2 A;  4YSX B;  4ICU A;  3VAW A;  1H4R A;  2J53 A;  4USA A;  4RGT A;  2N7D A;  3URY A;  3J9C A;  1E9M A;  3MFG A;  4RFB A;  2KO3 A;  1XLN A;  1L4D B;  2EKE C;  3V62 A;  5BMI A;  4Q2J A;  1T0Y A;  2KYW A;  2BYV E;  2BKR B;  2JF5 A;  4FHJ A;  4WWP A;  4LLG M;  1FRR A;  1QKZ A;  3OJ4 B;  1WRD B;  2Z0E B;  2LGI A;  3A4R A;  2MX2 A;  1WMH B;  3OWE B;  1R4N I;  5EE1 A;  2NTT A;  2IDY A;  2KFJ A;  3R2T A;  1FFU A;  1HQR D;  4K81 A;  3UIN B;  1WY8 A;  1J7C A;  5IP4 D;  1ESF A;  4AJY B;  1V5O A;  1XLO A;  2H89 B;  2WNM A;  4B6W A;  1WGD A;  1AWD A;  5G55 A;  1FNU A;  1J7A A;  3V60 A;  1WWT A;  1L2N A;  3P1M A;  1UWX A;  3EUB 2;  1YX6 B;  1WZ0 A;  3BII D;  2N4F A;  2QHO A;  1QIL A;  1SJE D;  2WXN A;  3IBE A;  1Q10 A;  3A9J A;  3EA6 A;  4TV3 A;  1OFF A;  4XYC A;  2NR2 A;  2K22 A;  4BOS C;  3AEB B;  1JRP A;  4WWO A;  2LD9 A;  1P98 A;  1L0X B;  1LQB A;  3CF6 E;  3KQ4 A;  2LEK A;  3AN1 A;  2ON8 A;  2KK8 A;  3PPA A;  1L0V B;  2GBM A;  4OW0 A;  4TQ0 A;  3NVW A;  1IBX B;  2DWQ A;  2K8C A;  2FUH B;  3BVZ A;  3W2D A;  2NBU A;  3P4Q B;  2IYD B;  2WXI A;  4GSW A;  4LNK A;  1EWY C;  3PTF C;  3ZDM C;  1YOV B;  2J52 A;  2LAS A;  4ZRK A;  4C7Y A;  2MP2 B;  2K1F A;  1A70 A;  4HPM B;  4US8 A;  2ASQ A;  1L4Z B;  4L1B A;  4KVG B;  1L7Y A;  1VR9 A;  3SFD B;  2GRI A;  3BYT B;  1WM2 A;  2C5L C;  1FNV A;  4OHJ A;  4AOF A;  2GLS A;  4EZL A;  1WXQ A;  5FR3 A;  2KTR B;  2YEP F;  1R4M B;  1F9J A;  4PYU A;  2ZCB A;  2LJ5 A;  3AH7 A;  2QMT A;  2BGF A;  2AQ1 B;  2MEK A;  3Q8E A;  3WAM A;  2RD0 A;  2W3S A;  2MA9 B;  4FXC A;  5CHW A;  2ACZ B;  3PRP B;  1Y56 A;  5GMV A;  2LUE A;  5L83 A;  2KC2 A;  3VTU A;  4M0W B;  2MQJ A;  4HEA 1;  1V9J A;  1PQS A;  3Q69 A;  5EDS A;  2FUG 1;  2L0F A;  4XE0 A;  1H8C A;  1QOG A;  3PT2 B;  5EE9 A;  3V6C B;  4LNO A;  5C23 A;  3NUH B;  3Q3J A;  3B2F A;  1U4A A;  1K50 A;  2WXL A;  2WXG A;  3NY5 A;  1V1P B;  3VHT C;  3I9V 1;  3C8Y A;  1I4X A;  3AB5 A;  2KDM A;  1JQ4 A;  1KFY B;  3DBH I;  3BVM A;  4DQO C;  1QF6 A;  5DPS A;  1FCC C;  1RM6 C;  3PLU A;  3QX1 A;  5HHD G;  2INN E;  2BPS A;  2QSD A;  3RI7 C;  5E6O A;  2HTH A;  4MGY E;  3PS6 A;  3RMK C;  4AJW A;  2MW5 A;  1SE9 A;  1E10 A;  1GTE A;  1HTO A;  2LGX A;  3AED B;  4YSY B;  1WSP A;  4C4V B;  2INC C;  3DHH C;  2MJE A;  3NRZ A;  1C77 A;  2GBN A;  4IWO A;  1P3Q U;  2G9H D;  1NEN B;  1E8Y A;  1N61 A;  1UF0 A;  4EFO A;  1VD2 A;  2GI9 A;  4A9A A;  4W9D A;  1RWS A;  1GPX A;  4D2K A;  4X57 B;  3M95 A;  4WIP A;  1P7E A;  2DAF A;  3Q3F A;  3ZNG C;  3AEE B;  1FEH A;  4IOI E;  1YNT E;  3GP7 A;  2CHZ A;  4OZB A;  4M8M A;  2IGH A;  4N6E B;  3TIX A;  1SXT A;  5E6J A;  3L4P A;  2CJN A;  4TSS A;  4XWT A;  5AZG A;  1WYG A;  3N9Y C;  4LNF A;  4JE3 B;  3R3M A;  2QEJ C;  1DGJ A;  2IGG A;  2WQY B;  2XK5 A;  4BZA A;  2DYM A;  1I4P A;  1TGZ B;  2KX3 A;  5MPO A;  3ZXV A;  1VJK A;  1NBF C;  1LXD A;  4P1B C;  1I4G A;  2J0K A;  2V4I B;  3JSV A;  3R8B A;  3VUX A;  4TKN A;  4WJP A;  2YEP B;  1MG4 A;  2BVC A;  3L08 A;  4NPN A;  2R2Q A;  3PO0 A;  4LJP B; 
#chains in the Genus database with same CATH homology
 1FXI A;  1HA5 A;  3BZD B;  5LNK 1;  2L1A A;  2Q5W D;  3E56 A;  1VZ8 A;  5BYR A;  2WXF A;  4DXF A;  2DYO A;  4TMA B;  1SEB D;  4AS1 A;  4JX1 C;  1ROE A;  4C7Z A;  1TY2 A;  1V1P A;  3KLS X;  1C9F A;  2QJL A;  1VZ7 A;  2J42 A;  2L83 A;  2LJI A;  1OQQ A;  1C79 A;  2GB1 A;  1N60 A;  1J7B A;  1E6E B;  1EU4 A;  2N9K A;  4R3D A;  1B1Z A;  2LUM A;  2V0G A;  3AV8 A;  1DOI A;  3R2I A;  3AEG B;  2KQ4 X;  1IUE A;  4RCO A;  3H8H A;  2WU2 B;  2K5P A;  2M0A A;  2RMM A;  2PW9 A;  4XDD A;  3FAH A;  4HKQ A;  3Q8C A;  2OED A;  2RDH A;  1C78 A;  2EEL A;  5BYS A;  2Y3A A;  3ZYY X;  3UI3 A;  1I7H A;  5BYQ A;  3W5V B;  1KLG D;  1ENF A;  1SE4 A;  2BYT A;  3TEY A;  1TKY A;  2AQ2 B;  1HEZ E;  2IGD A;  1GB1 A;  1LO5 D;  5FKA C;  4PT5 A;  1N62 A;  4MH8 A;  1SF0 A;  4KX6 B;  4RGN A;  1SE3 A;  3AE6 B;  1DYQ A;  1CZP A;  2FBW B;  3CWI A;  2BB6 A;  2NTS A;  2WXR A;  3Q8F A;  3P4P B;  1VRA B;  5AUK A;  4NAW B;  5EE0 A;  1K51 A;  3Q8A A;  4WH4 A;  4YTP B;  1TY0 A;  4ZYS A;  1JCK B;  1AW7 A;  1TKG A;  2IPK D;  2QIL A;  1I4Q A;  1N5X A;  4ZOH C;  1JWU D;  4YWG G;  4IDI A;  4KGT A;  5BMH A;  1XCQ L;  4A6Q A;  4IKG A;  2BB5 A;  1P7F A;  2WDQ B;  2Y5P A;  3V05 A;  1CQV A;  1RFK A;  4RGM A;  4OZC A;  4WUR A;  1KTK A;  3AMZ A;  3W9C B;  2CU3 A;  1QOA A;  2N7J A;  1KRH A;  1V97 A;  2BT6 A;  2BTE A;  3IT6 B;  2WXM A;  3HUI A;  4M0W A;  2J4X A;  5TSS A;  1D6E C;  1FFV A;  2FE8 A;  3GS2 A;  3NVY A;  3U2S C;  1SJH D;  3VR9 B;  1KH0 A;  1GAQ B;  1YJI A;  5GXG B;  3TSS A;  3HVD A;  1JAL A;  1IBX A;  1WGK A;  2WXK A;  4ZHP A;  1FD6 A;  3GB1 A;  1C4A A;  3P42 A;  4UDU C;  1HXY D;  2M56 B;  2WXH A;  2Z8L A;  1MVK A;  3O13 A;  1CK1 A;  4C56 C;  3AEF B;  2WS3 B;  1KF6 B;  1BUI C;  4XDC A;  1FIQ A;  1K52 A;  2MJ3 A;  2WXJ A;  1ZP0 B;  1OQR A;  1SB3 C;  3U4E G;  1FCL A;  2AX5 A;  3HRD D;  5AUI A;  1GT8 A;  4MT5 A;  3TEW A;  1STE A;  4YSX B;  2MH7 A;  4CQN A;  2J53 A;  3W1S A;  1XLQ A;  4B0E A;  1D5X C;  4USA A;  4RGT A;  3BK1 A;  3URY A;  1JML A;  2JZP A;  3J9C A;  2WDR B;  3MC0 B;  2BS2 B;  2BS4 B;  1E9M A;  2PTL A;  3P4R B;  1KLU D;  1TS5 A;  3MFG A;  4RFB A;  1XLN A;  5FK9 C;  1L4D B;  4OZA A;  1EM7 A;  3IAM 1;  5BMI A;  4EE2 A;  1D4B A;  1D5Z C;  2D5G A;  4Q2J A;  1M4V A;  4ARC A;  1H7W A;  4B0M A;  3AE2 B;  4LLG M;  3AE8 B;  1UWM A;  4MM3 B;  1FRR A;  1QKZ A;  2XN9 C;  3VRA B;  2PVG C;  1I4R A;  1CJE A;  2N0S B;  2LGI A;  3CF4 A;  5C2T B;  4JWS C;  4HKZ E;  3OWE B;  4P16 A;  2WXQ A;  2X38 A;  1V1O A;  2HDE A;  5EE1 A;  2NTT A;  5EE3 A;  4RF1 A;  2IDY A;  4WAF A;  2KAJ A;  3ZJU A;  1HZ6 A;  1T5X D;  3R2T A;  1SIJ A;  2Y5C A;  4ZHO A;  5H8Y E;  1FFU A;  2KAC A;  1HQR D;  2NMQ A;  4YTM B;  4YSZ B;  1TS2 A;  1J7C A;  4ZRQ A;  2PVO D;  3U7Z A;  1ESF A;  2JQR B;  2K9X A;  3ZJV A;  1XLO A;  1TS3 A;  1UNS A;  2H89 B;  2WNM A;  1AWD A;  4KKI A;  1FNU A;  1J7A A;  1ZOY B;  1WWT A;  1GB4 A;  4JWU C;  1QOB A;  3KWV A;  1SE2 A;  1JRO A;  1UWX A;  3P1M A;  3EUB 2;  5I4D A;  2E6X A;  3BII D;  4HJG E;  1QIL A;  1SJE D;  2JXT A;  2WXN A;  2W55 A;  4KGS A;  4A8X C;  5G5G A;  1YQ3 B;  1Q10 A;  1K53 A;  2WLB A;  1ZE3 D;  3EA6 A;  3DWM A;  2L32 A;  1OFF A;  3VQI A;  2K22 A;  3RFZ B;  2H88 B;  3AEB B;  1JRP A;  2I38 A;  1BML C;  1HZ5 A;  3IAS 1;  3TUO A;  1GTH A;  1VZ6 A;  1L0X B;  1XXG A;  1FRD A;  3KQ4 A;  5C3J B;  2LEK A;  2VZK B;  3AN1 A;  5HG2 A;  2ON8 A;  3P63 A;  1F2R C;  1WRI A;  1R7S A;  1L0V B;  1NI3 A;  1NYQ A;  2LHD A;  4OW0 A;  4TQ0 A;  3NVW A;  1IBX B;  2DWQ A;  2PIA A;  4ZRP A;  4US9 A;  3V3X A;  1FXA A;  3DWG C;  1FO4 A;  3T3O A;  3W5U B;  1AN8 A;  2JYT A;  2OHF A;  4ARI A;  3BVZ A;  1FMA D;  5HI1 A;  3W2D A;  1PDX A;  3P4Q B;  1EU3 A;  4A55 A;  2DLB A;  2ICI A;  2WXI A;  4XWW A;  1XCT L;  1ZXI A;  3ZJT A;  3NS1 A;  3P4S B;  1EWY C;  5D3I B;  3E9S A;  4KKJ A;  1FNW A;  2HTM E;  2J52 A;  1NEK B;  1I4H A;  1QLB B;  2LMC A;  1PYW D;  3I57 A;  1ET6 A;  4C7Y A;  2ZW0 A;  3BK2 A;  3FIL B;  1A70 A;  1ZUD 2;  5D3D A;  4US8 A;  1BXT A;  2RPV A;  1L4Z B;  2XNA C;  4L1B A;  1FM0 D;  1VR9 A;  3PO0 A;  2WXO A;  3SFD B;  2GRI A;  3BYT B;  2BBC A;  3MP9 A;  1YN3 A;  3ABV B;  4TQ1 A;  1FNV A;  1PGA A;  5BMG A;  1QQR A;  4OHJ A;  2DBY A;  1WXQ A;  1EWC A;  1L5P A;  5FR3 A;  4NAM A;  1TYG B;  2QIE B;  2YEP F;  1VLB A;  2JU6 X;  1B9R A;  3KWL A;  2WDV B;  3AH7 A;  2QMT A;  2MEK A;  2AQ1 B;  1DOY A;  1D5M C;  3Q8E A;  3CIR B;  4NZL B;  2MJD A;  1PGB A;  4RF0 A;  4WWM A;  2JX5 A;  3NVZ A;  4HRO A;  4C80 A;  2KMM A;  1XF5 L;  2W3S A;  3SFE B;  4FXC A;  2ACZ B;  1T6B X;  1SBB B;  2G1E A;  4NJC A;  1Y56 A;  4GLS C;  3IT4 B;  1ZXH A;  1L0Y B;  1ZPS A;  4YTN B;  2ZW1 A;  5HFY A;  2AQ3 B;  2PMV A;  1IGD A;  3PZ8 A;  4HEA 1;  4YT0 B;  3Q69 A;  2FUG 1;  3AE9 B;  4XE0 A;  1QOG A;  5EE9 A;  4RNA A;  2IJ0 A;  3NUH B;  5H92 C;  1YQ4 B;  3B9J A;  3B2F A;  1E7P B;  2WU5 B;  1SSN A;  4OVZ A;  1PGX A;  3BYY B;  1F2R I;  2R61 A;  3AE7 B;  1XEE A;  1K50 A;  4YXD B;  1JWA D;  1XLP A;  2WXL A;  3NVV A;  2LHE A;  1RYJ A;  2WXG A;  1V1P B;  1ET9 A;  2I2Y A;  4WQM A;  1GOZ A;  4MAC A;  3I9V 1;  1MHX A;  3C8Y A;  3NZ3 A;  3ZGZ A;  1I4X A;  2EKI A;  4GDK B;  2W54 A;  2KDM A;  1T3Q A;  3AB5 A;  1NYR A;  4DXG A;  1JQ4 A;  1KFY B;  2K0P A;  4P6V F;  3BVM A;  4DQO C;  3IXS A;  1QF6 A;  3AM9 A;  3SEB A;  4L2Y A;  4REZ A;  1FCC C;  1YMH E;  4LTU A;  4N58 A;  3LB8 C;  1RM6 C;  4A90 A;  4AQ7 A;  5HHD G;  3EGR A;  2W82 A;  1TKE A;  1ZDV A;  2W3R A;  1C76 A;  2INP E;  4JPS A;  2INN E;  5JXV A;  1DOX A;  1YJJ A;  2QSD A;  2B76 B;  1YN4 A;  2RDG A;  1E0Z A;  1JW9 D;  1ACC A;  2SAK A;  1JWM D;  1E10 A;  3TEZ A;  1GTE A;  4RGO S;  1UGJ A;  1ZDX A;  3RPF C;  3AED B;  4YSY B;  1C4P A;  4J3O D;  1N5W A;  1WSP A;  5D7G A;  5T8I A;  2ONQ A;  2V3P A;  1AYF A;  2MJE A;  3NRZ A;  1JWB D;  3AE4 B;  1C4C A;  3MJ5 A;  1C77 A;  3AEA B;  2LFI A;  2G9H D;  3U52 E;  2JSV X;  1NEN B;  1L6V A;  1N61 A;  1H7X A;  1TZO A;  3SR6 A;  2GI9 A;  4A9A A;  2TSS A;  4N59 A;  3FIL A;  1RWS A;  4RH6 A;  1TS4 A;  1GPX A;  4D2K A;  1N63 A;  3WCQ A;  2WXP A;  3Q8B A;  3T3N A;  1UUP A;  4WIP A;  2PKO A;  2K3U A;  3MHZ A;  1PUT A;  1P7E A;  3AE3 B;  2SEB D;  1MI0 A;  3AEE B;  2L52 A;  1V8C A;  3LXF A;  3ETR A;  1FEH A;  4IOI E;  1F77 A;  2WP9 B;  1YNT E;  2JYE A;  3GP7 A;  4HRS A;  4OZB A;  3ZQ4 A;  2BW2 A;  3VR8 B;  2IGH A;  1TJE A;  4KGR A;  4N6E B;  3BWU D;  3HVZ A;  1SXT A;  5E6J A;  3L4P A;  2CJN A;  4TSS A;  4XWT A;  1WYG A;  3N9Y C;  1XO3 A;  3B2G A;  1QOF A;  4JE3 B;  1MPE A;  1QT9 A;  2QEJ C;  5G5H A;  1DGJ A;  2IGG A;  2WQY B;  4LK0 M;  1VDV A;  2DYM A;  2KN4 A;  3LYY A;  1I4P A;  4GDL B;  3AE5 B;  2KWD A;  2JWU A;  2N9L A;  5MPO A;  1VJK A;  2VZK D;  3FC4 A;  1F0Z A;  1YN5 A;  1L6U A;  1I4G A;  1NVI D;  4ITK A;  4L23 A;  1MHH E;  2M19 A;  1IGC A;  2V4I B;  3PZ7 A;  3BVG A;  4H2A A;  3R8B A;  2E3T A;  2YEP B;  3AEC B;  3TEX A;  2PLP A;  1JWS D;  3AE1 B;  2CJO A;  4O1N A;  2V3N A;  3VRB B;  1PFD A;  2BS3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...