3AEBB

Crystal structure of porcine heart mitochondrial complex ii bound with n-(3-phenoxy-phenyl)-2-trifluoromethyl-benzamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-(3-Phenoxy-phenyl)-2-trifluoromethyl-benzamide
rcsb
total genus 58
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3aebB02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3aebB01
3AE4B 4USAA 1KF6B 1V97A 2Y5CA 4N6EB 3W9CB 3AMZA 1ZUD2 2PVGC 1KFYB 2WU2B 1TJEA 2AX5A 1AWDA 1FRRA 4YT0B 1JRPA 1JWBD 1DOIA 2K9XA 2OHFA 3VR8B 1L6VA 1RFKA 1YQ3B 1JWAD 2BS3B 1NENB 1GPXA 4YTPB 2CJOA 4N59A 1DOXA 1XLOA 2ACZB 2QJLA 3AE3B 4YXDB 1WGKA 3AM9A 3W5VB 5AUIA 3AE1B 2K22A 3P4RB 3B2GA 3FAHA 4YSYB 3LXFA 2MJ3A 1YJIA 4ZHPA 2L83A 2MH7A 4C7YA 5EE0A 1ZXIA 3AV8A 3AE9B 4JWSC 1TKGA 5G5HA 3NVYA 1XLPA 1FFUA 3AB5A 1SB3C 1WWTA 1EWYC 3NRZA 1QOFA 4KX6B 3VRBB 1GAQB 1XLQA 2JQRB 1QLBB 2BS2B 2M56B 1GT8A 4YSZB 2BT6A 3BIID 4HROA 1QT9A 3AE5B 1TKYA 4C7ZA 2E3TA 1JQ4A 3WCQA 3NVWA 1VDVA 5MPOA 4ZOHC 4JWUC 4YTMB 2WLBA 3VRAB 4YTNB 1RWSA 1NEKB 3SFEB 1FRDA 3CF4A 1QOBA 2Q5WD 1OQRA 4P6VF 1VJKA 5C2TB 2WP9B 1UWMA 4US9A 1FXIA 1F0ZA 2WU5B 1XO3A 2PIAA 3LB8C 3ABVB 2W3SA 2K5PA 3SFDB 1J7AA 3P4QB 3AE8B 1ZOYB 1L5PA 2DBYA 2DWQA 3NVZA 3CWIA 3RPFC 1FIQA 2KMMA 1PDXA 5EE9A 1L0VB 3HRDD 1N63A 2W55A 5C3JB 1JALA 2PVOD 3EUB2 1JROA 3AEBB 3AEEB 2CJNA 1H7XA 2QIEB 1SF0A 1H7WA 3B9JA 2H88B 3HVZA 3VR9B 1N60A 1IUEA 4US8A 4ITKA 4WWMA 1QOGA 1QOAA 5EE3A 1OQQA 3L4PA 1RYJA 1N5XA 1NYRA 4IDIA 3SR6A 1CJEA 1SIJA 3P1MA 1V8CA 2N0SB 4N58A 5AUKA 1YJJA 3AECB 1XLNA 4YSXB 1N5WA 2WQYB 1FXAA 2WDRB 1N61A 3P4SB 3ETRA 2BS4B 2WDQB 1RM6C 2KAJA 1PUTA 3AN1A 3NS1A 3AEAB 2WDVB 1E10A 2MJDA 2W3RA 5H8YE 3B2FA 1FO4A 1E0ZA 3AE2B 1A70A 4C80A 1CZPA 3DWGC 3AEDB 1PFDA 4A9AA 1ZP0B 2M19A 2PKOA 1L6UA 1OFFA 2G1EA 1GTHA 2CU3A 3PO0A 2W54A 1I7HA 1ROEA 1GTEA 3KWLA 3DWMA 2WS3B 1WXQA 3W5UB 1B9RA 1J7BA 2LEKA 3AEGB 4FXCA 2L52A 3AEFB 1DOYA 3AH7A 1E6EB 1N62A 1AYFA 3NVVA 5GXGB 5H92C 3AE6B 1E9MA 1VLBA 1T3QA 1KRHA 1FM0D 1JW9D 4LTUA 1E7PB 2HTME 1NVID 1NYQA 2B76B 1FMAD 5G5GA 2MJEA 1TKEA 1DGJA 1YQ4B 5EE1A 3FC4A 2JX5A 1WYGA 1TYGB 4HRSA 1WRIA 3AE7B 4JX1C 2FBWB 3CIRB 1FFVA 1J7CA 4WQMA 2H89B 3ZYYX 4ZHOA 1QF6A 3HUIA 3P4PB 1NI3A 1R7SA 3P63A 2EKIA
chains in the Genus database with same CATH superfamily
1SXTA 2LRUA 2ZPNA 3RCZA 5IP4D 2BYEA 1CQVA 4ZRJA 4FHJA 4GB9A 3C0RB 5LXIB 2JWZA 1XLOA 3B1LX 4KKJA 3M63B 2ZEQA 1WXAA 3W2DA 3VTWA 4HDQA 2GRIA 4ANWA 2ZCBA 3CF6E 5CHWA 2D11A 2JYTA 2LWPA 3EA6A 3U7DA 2MBQA 1H8CA 2TSSA 1FRDA 4DHZE 4AQ7A 5CTRC 1WMHA 3H8HA 5C1ZA 1FCLA 3AE8B 3PV1A 2KMMA 1KM7A 1YN5A 3GE8C 4FN2A 3EUB2 3A1QA 2IY1B 2QEJC 3AEBB 4AJYB 3B9JA 2L8JA 3VR9B 3PRPB 5EE3A 1VCBA 2LD9A 1NYRA 2INDC 2BYFA 3PHXB 2WXRA 5AUKA 1YJJA 2BYTA 1FCCC 3L54A 4G3XB 2KAJA 3K9PB 4I6NB 2V9HA 2LZ6A 1KJTA 2V0GA 3I9V1 3U8ZA 3KWVA 4WQOB 1SIFA 3DWMA 2LHDA 2BQQA 4II2B 4M01A 2WX1A 5G5GA 1TS3A 1YQ4B 2BBCA 3ECIA 3J9CA 4MSMB 2D10A 2L3ZA 3NHEB 4A6QA 1V1OA 2NS5A 4ZHOA 3TEWA 1UBIA 2JUOA 1XF5L 3N9YC 3BY4B 3SD5A 1T0QC 1TS2A 1KFYB 3VH4B 2XBBC 2D3AA 4IWQA 2MW5A 3IAS1 1YQ3B 2REXA 3ZJVA 1DOXA 1SGHA 2DENB 2ON8A 1MHXA 3V6CB 1HZ5A 2GBRA 1TZ1A 2DLBA 2KDMA 2V1YA 1T0RC 1VZ8A 1R4NB 2M0AA 3V6EB 2W9NA 1RRBA 3GP7A 4HPLB 5JXVA 2A5UA 3W1YA 4DXFA 4UDUC 2XN9C 4NJ7A 4US9A 1F0ZA 2PE9A 2PIAA 3CSTA 3L16A 4L2YA 2D5GA 1MHHE 4TKNA 2IPKD 1N63A 1WXMA 1YJ1A 1ZPSA 1H7WA 2WDTB 2VH2A 4H2AA 1IUEA 2N7EA 1WF9A 3IAM1 4K3BA 4KGTA 2WXJA 3SEBA 5FR6A 3WANA 3ZTDA 4A90A 4ZDVA 3ZNHB 5D94A 2AEHA 1IPGA 2KFJA 1P0RA 2PKOA 1MPEA 2WNMA 1WXQA 2QDFA 3O65B 1MG8A 4XYCA 4BKTA 2B76B 3ML9A 1WGYA 3SU8X 3DOWA 3ZLZA 2N4FA 4XX5A 4USAA 1V97A 1GC6A 2QHOA 3MJ5A 3RUIB 3APFA 1TBEA 1HEZE 2L05A 2IZVB 4EE2A 4PS7A 2BKRB 1P1AA 2DZMA 1MVKA 4DBGA 2GBJA 1D3ZA 4CHKA 2M0XA 4K7UA 1FFUA 1SE4A 4OVZA 1GAQB 2LASA 4P1BC 4GSWA 2EKEC 1WGRA 2ZNVB 1WGDA 1HE8A 4ZRKA 3QA8A 3H7SA 2AQ2B 2J7QB 3TBLD 4NAWB 1XO3A 2MSED 2KTRB 3WCQA 3P4QB 2KDFB 2KDBA 3VXWA 3HRDD 1TS5A 5JHBA 4JPSA 2HD5B 5CHVC 3LYYA 3BK2A 4ANXA 1WR1A 2DNFA 2KOXA 4XDCA 4C00A 5TSSA 4K7WA 1JCKB 2KO3A 3PZDA 2XK5A 1KLGD 3BWUD 3KYCD 2FIFA 2L32A 1E5WA 1C4CA 1JWSD 1L2NA 3NJTA 3FILB 2L00B 3WAPA 4B6WA 3DWGC 2KMAA 1TS4A 5FKAC 2MP2A 4PS3A 1L4DB 3U4EG 1LO5D 1UD7A 2KQSA 3Q3FA 1KLVA 1WE7A 2N9XA 1WJ6A 3ENEA 3H9DA 1KRHA 2IJ0A 2J0MA 2LJ5A 4RH6A 2GMIC 2GBMA 2M17A 1MJDA 3JVZX 2QSDA 5EDSA 3AU5A 2DX5B 3D32A 5D2MB 1IP9A 2N9PC 4YT0B 1JWBD 1M94A 3LDZE 4LDTB 2BTEA 3MJWA 5IKCM 4YXDB 1V1PB 2WXKA 3W5VB 4HJKA 4OVUA 4C7YA 4BOZB 2NBWB 2N7DA 1P7EA 2SEBD 3VDZA 1QLBB 1QT9A 3PLUA 1JQ4A 4RGTA 2KT7A 4XGAB 3IG3A 1I35A 3RNGC 4LJPB 4P16A 2C60A 2RDBC 1FXIA 3Q3JA 5T8IA 3W1SA 3KW5B 3SFDB 1GB4A 3GB1A 1C79A 4OZAA 1T5XD 4I6LB 3QAQA 3LJ3A 3Q8CA 5JZEB 1PYWD 2INCC 2CR5A 1OQQA 2ICIA 1UGMA 4NJCA 2INNE 3NS8A 1N5WA 3AU4A 4KIKA 1T0YA 3P4SB 2EMSA 4DQOC 2WDVB 3IBEA 2V3SA 4EEWA 1PFDA 2M19A 1RAXA 1L6UA 2W54A 2FIDA 2WS3B 1DYQA 3AEFB 1N62A 1AYFA 4K7SA 4LTUA 4XC2A 1NYQA 4DHJD 4IOIE 2N9KA 2K3UA 1TYGB 3Q8EA 4IW0A 3IXSA 4W9GA 1GB1A 2EKIA 2VRRB 2J53A 3H7PB 4W9CA 5J18A 2GBNA 1JRPA 1DOIA 2C7MB 2KQ4X 2KJRA 4X57B 3DBLB 5AEKB 3BVGA 4EOYA 4LNFA 4YTPB 4FJYA 1WY8A 1HTOA 3VUYA 3V60A 1D4BA 3VUWA 3N3KB 2KNBA 4ZHPA 2WXMA 3T8MA 3EECA 2KQ7A 1SB3C 1EWYC 4YL8A 4KX6B 1PGAA 2B3AA 4ZRPA 3ZJTA 5HG2A 2WXHA 4II3B 3N1ZC 3RT3B 3MFGA 1ACCA 5AUIA 2LHEA 1WM3A 2W3SA 1J7AA 1WM2A 1C1YB 4WWOA 1T0SC 5D6JB 4KGRA 5DPRA 1F77A 1E8YA 3DHHC 4FBJB 4CQNA 4W9FA 2RMMA 1ET9A 4IM2A 1V80A 2ZCCA 3EGRA 5LXHA 4B0MA 1V86A 4J3OD 1ZXHA 2AQ3B 3NS1A 2M8SA 3ZDMC 1E10A 2KLGA 3KUZA 1YIWA 3AEDB 4LCDE 1ZP0B 1V9JA 2UU7A 4G0NB 4ZYNA 1AARA 1SJHD 2L52A 2BB6A 4W9EA 3Q8AA 1GUAB 4FJVB 3U52E 1FM0D 2HJ8A 4DHZB 3KUDB 1DGJA 4TQ1A 4PS8A 3AE7B 3SHQA 4HKZE 2KANA 4F8CB 1GOZA 1QZEA 3VAWA 4FJZA 2ONQA 1IGDA 1WX8A 1E8ZA 4W9DA 3JSVB 1I42A 2OHFA 2V3PA 3VHTC 4FLHA 1RFKA 3PRZA 1F2RI 4JL9A 2Y5PA 3H6NA 4B9KA 1IYFA 3NOBA 4B95A 3ALBA 3Q8BA 2AL6A 1E7UA 2N7JA 5IO9A 1D5MC 3TSSA 3IHPC 4BKSA 2BT6A 4MJSB 3CSFA 4GDKB 5AZGA 3TL5A 1VD2A 1XXGA 2FCQA 4R3DA 1I4QA 4DXGA 1QOBA 3DVNU 2CKHB 4TV3A 2JVCA 2WXQA 4BKSD 4HDOA 2NPTA 2UYZB 1UGJA 4AJWA 1PDXA 2R61A 1UBQA 5I4DA 1GG3A 1JALA 3R3MA 3MC0B 1IBXA 2D2QA 3GS2A 3Q3NC 2K8CA 1KOTA 1QOAA 4W9KA 3UF8A 2WYQA 5KHQA 3BK1A 3ETRA 2BS4B 4RM9A 2ZJDA 3AEAB 1Q1OA 1UF0A 4IM0A 1SE9A 3OAWA 3A9KA 4K81A 1WI0A 1GTHA 2CU3A 3VVWB 4MELA 1J7BA 1I4PA 2LEKA 5LLIA 1WX9A 2CHZA 1HA5A 2FNJB 4WWPA 1C4AA 2MJEA 1WMHB 3U2SC 2C9WB 1YOVB 3CMMB 2FBWB 2VZKD 3TIXA 4WQMA 1E8XA 1HQRD 3BINA 3BYYB 4IM3A 1E8WA 2KD0A 2MA9B 3QIJA 3RI7C 3PRMB 1EUVB 2FUG1 5JH5C 2LUEA 3RFZB 3LXFA 2L83A 2KJHB 4AS1A 2O6VA 2I38A 3RMKC 3AB5A 5J2RA 2KK8A 1SBBB 2AL3A 3VRBB 3RD2A 2LGDA 2M56B 3RZWC 2PJHA 2KX3A 3V61A 4C56C 3OJ3A 4AWJA 3N20C 2O6VD 3VRAB 1OEYJ 4GDLA 1FO4A 5AZHA 1XD3B 4BOSC 3NVZA 1YNTE 4QAYA 3AEEB 3VTUA 2LFIA 4US8A 3L4PA 1RYJA 2BWFA 2JU6X 1SE2A 2NBUA 4OHJA 1Z2MA 3U30A 1YN3A 3P42A 4FULA 4JQWC 3UIOB 3AI5A 1STEA 3B08A 5BO4B 3BVMA 3Q6BA 4I6PA 1WIAA 3DPDA 4HPPA 2QILA 2FAZA 1LFDA 2ASQA 4HRSA 4XDDA 2Z0EB 3DVGY 2KN5A 2MHJA 4S17A 2PLPA 3RN9C 3IT6B 4JE3B 1AWDA 4TMAB 4A8XC 1JWAD 2MX2A 2CJOA 4B0EA 5BYQA 2KWUB 2ACZB 1QKZA 1C9FA 3AE3B 2K22A 3P4RB 3B2GA 2JXXA 2MH7A 3Q3OC 1L7YA 5G5HA 1AW7A 3QQ8B 3MHZA 1WWTA 2BS2B 2KFKA 3V62A 4L1BA 1FNUA 1EU4A 5MPOA 2EELA 3I63C 4OZCA 2WLBA 4KKIA 1VJKA 2WP9B 3TEYA 1XQQA 2KHWB 2KC1A 2K5PA 2GB1A 2DBYA 4EZLA 2MQJA 3X23A 2DAFA 2IO2B 4KGSA 2CJNA 2CU1A 1H7XA 1SE3A 1WJUA 2RDGA 3PLVA 2OEDA 2Y3AA 2ZNVC 2JF5A 4IDIA 1SIJA 4N58A 1ZW7A 1FXAA 1IGCA 1RM6C 3PT2B 2W82A 4EUTA 2BW2A 1SSNA 2DAJA 1I4HA 4RM8A 3HM3A 1Q10A 3N30A 3AH7A 3A33B 4GXBA 5JHAA 3M3JA 2HTME 3FC4A 2PW9A 4JX1C 2HE7A 1A5RA 2NR2A 2VH1A 3VTVA 5BMIA 4REZA 3KYDD 4JIOU 1V5TA 2PTLA 1XEEA 4TQ0A 4NNJB 2AQ1B 4LLGM 4TUUA 2L0TA 2AX5A 2KJ6A 1KH0A 3DQVA 5E6PA 4NQKE 3EC8A 2N9EB 2KDIA 4PK1A 2IYDB 2XK5B 3ZGZA 2KACA 4J6IA 4WAAA 5E6OA 4BBNF 1TY0A 1YJIA 5L95C 1UWXA 1B1ZA 2D07B 4LNNA 2M4NA 2Z8LA 4ARIA 2MP2B 4M02A 2G3QB 2JQRB 1JWMD 1K8RB 4YSZB 1TKYA 3DVNV 3AXCA 3MHSD 3A9JA 2RPVA 4JWUC 3S2AA 2YEPB 3N1XC 3P2BA 1OQRA 1CK1A 5IAAC 3UQBA 3SDLC 2MBOA 1L5PA 1S3SG 1XT9B 2DZKA 5C3JB 3L10B 4DWFA 1JROA 5C23A 1MG4A 3R2IA 5HKHA 3UINB 4ZYSA 2KWDA 2OJWA 3Q3MC 1N5XA 2ZZPB 3QK0A 4ARCA 3ZTCA 2BGFA 2DZIA 1SEBD 2YLMA 4C80A 2NTTA 4A9AA 3A4SC 5AZFA 4E71A 1OFFA 2LXAA 2JSVX 2JYEA 1F9JA 3AEGB 1E90A 5H92C 2JT4B 2KYWA 4MH0E 3R8BA 3DDCB 2C7NB 2CHXA 3V05A 3DVGX 1L0YB 3KLSX 5DPTA 4WAFA 5BYRA 2KDEB 2JRHA 1NBFC 2V4LA 2PMVA 1E0ZA 4HVBA 1SJED 2K25A 5HI1A 3ZKJC 3DHGC 2IBIB 2JPHA 2LUMA 1NENB 3DBRB 2D3CA 2C5LC 2PPHA 2J4XA 3C8YA 3HM6X 3R7QA 4KIKB 4O1NA 2LRWA 3AE1B 4DDID 1U4AA 2I1KA 4DHJB 2JZPA 1XLPA 4HJGE 3H1UA 3VUXA 1K52A 3RULA 2FE8A 5FR3A 3OWEB 1WE6A 4C7ZA 3QWZB 2PEAA 3VFKA 2QCZA 2G4DB 3ZJUA 4YTNB 4P6VF 3HVDA 3SFEB 2LGXA 3CF4A 2YEPF 3R7RA 1WJNA 4A55A 2KWCA 1P98A 3ABVB 3HHMA 1MI0A 2DWQA 1SF0A 4A3OA 4PT5A 3RNAC 3SR6A 2L76A 1V8CA 2R2QA 4M0WB 3QCAA 1HZ6A 1N61A 1PUTA 2WXNA 3OG5A 2J52A 3PREA 2DHZA 4HCNB 1ET6A 4WJPA 4MM3A 1WX7A 4NZLB 2AYOB 3VQIA 4FXCA 4EZJA 3PSEB 1E9MA 1VLBA 4GMVA 4A20A 1E7PB 1TT5B 2ZPYA 3ZO5B 2IGHA 4Q2JA 3URYA 1WYGA 2L1AA 2NTSA 1PGXA 3ZYYX 2QC8A 3DBRI 1BMLC 1KF6B 2MBBB 1ZUD2 3QJZA 5TR5A 2Y5BB 3HK0A 4HLEA 4KZ0A 4FADA 3VR8B 3I5JC 2KN4A 5D3IB 3APDA 4WH4A 3AM9A 1Y56A 3FAHA 4C4VB 3KH0A 2I1JA 2WXLA 4AP4C 3NVYA 4ICVA 2KX0A 1GT8A 1I4XA 3JSVA 4WURA 3IFWB 1RWSA 1OTRB 4FHKA 3MC9A 3QARA 3QX1A 1BXTA 1M4VA 4G50A 3CWIA 3ZVVA 2X8XX 2KWVB 4PYUA 4RCOA 3EHVA 3U7ZA 4GDKA 1WJ4A 3DBHI 3RNEC 3P1MA 1JRUA 3ZNZB 1EWCA 4JLCA 2O2VB 4HCPB 3ZXRA 5J17A 4WJQA 1A70A 5G2NA 5D3DA 1CZPA 4EZKA 1I7HA 3W5UB 2XNAC 1LQBA 2V4IB 4LK0M 2GBKA 1DOYA 2LGYA 4KVGB 1E6EB 3HIZA 2LMCA 1WYWB 3Q8FA 4BVUC 1FXTB 1TKEA 4XE0A 2L0FA 2NPTB 1I4GA 3CIRB 3TMPB 3UGBB 1NI3A 3P63A 4M00A 4K1RB 1IBXB 2Y5CA 4N6EB 4HPMB 3AMZA 3RZFA 2NBVB 2BWES 1TJEA 4IUMB 2K9XA 2OJRA 3QHTA 3RNFC 1GNUA 4OW0A 4LNIA 1GPXA 2RDHA 4RFBA 4M8MA 2N1VA 4GN1A 1MFWA 4JGHB 2WXGA 1WZ3A 5BMGA 1QILA 3APCA 4W9IA 3A9KB 1V5OA 5DPSA 3A1QB 1QOFA 2VZKB 4MDKE 4M8NA 2CHWA 2KXJA 3ZQ4A 3GE3C 4L23A 3RYTA 3MC8A 5G55A 2LGIA 4KSLC 2WU5B 2D3GA 4MGZE 4ZRIA 3TJPA 2NCNA 4IWOA 3OJ4B 2W55A 1F1HA 1J8CA 2UWQA 2WX0A 1ZKHA 3HVZA 1ENFA 3K9OB 4F1SA 1I4RA 4NJ6A 1G6JA 1WRDB 1ESFA 4MGKE 2O6VB 1EU3A 2NVUI 2G1EA 4XZ4A 3PO0A 3KWLA 4MGIE 4W9HA 4FA6A 2FCSA 5GXGB 2Z0DB 3AE6B 1T3QA 4GDLB 3IT4B 5BYSA 1YMHE 1CMXB 2N9LA 1JMLA 3R2TA 5D7GA 5E6NA 1WRIA 3N1YC 3I57A 2ZW1A 1FFVA 1J7CA 2H89B 1S1QB 2RR9A 3BIID 3P4PB 2D3BA 1T6BX 2JZ3B 4W9LA 2LVOA 1TGZB 5E6JA 2JY6A 4E3CA 2DZJA 3DBSA 2MWSB 2FCNA 4G11A 4EFOA 1YN4A 1NDDA 3WALA 1VZ7A 4RF1A 4RGOS 3DCGA 2ZVNA 3N32A 3UI3A 4YSYB 4N9F4 1HTQA 3KQ4A 3WAOA 4HKQA 1V49A 1D5XC 3AE5B 2RSUA 4MACA 4MT5A 1KLUD 1R4MB 4YTMB 1D6EC 4BBNC 4RGMA 4OVVA 1BUIC 4IG7B 1FIQA 3Q14C 5EE9A 1K53A 2MEKA 4WJNA 3VH3B 3EFUA 4ACFA 4K3CA 2K6DB 4ITKA 3ZNID 2K0PA 2IO3B 1TY2A 1LXDA 2N0SB 1UELA 1H4RA 2I2YA 2JWUA 4BFRA 5FK9C 4LNKA 3AE2B 4NQLB 1Y8RC 3MP9A 2KVZA 2KFKB 3QC8B 2G9HD 1GTEA 4YWGG 3R66C 2K6QA 2LXCA 2L7RA 1R4NI 1J19A 1OEYA 4WWNA 1FMAD 2LVQA 2JX5A 3E9SA 4OZBA 1FNVA 4NAWA 2J0KA 3L08A 2KTRA 1QF6A 1OGWA 1RFAA 1R7SA 1WXSA 2BPSA 2CS4A 2NMQA 2PE6B 3UQAA 3ONSA 2HJ1A 1XCTL 3W9CB 1V6EA 1XCQL 2WU2B 1C76A 1UNSA 1C77A 4NAMA 1P9DU 2A4ZA 2K39A 1L6VA 2OOBB 1K50A 1YX5B 4P7IA 2FUHB 3PPAA 1WGKA 2SAKA 4LJOB 5HHDG 1VR9A 4XWTA 4CO7A 3T3NA 3C19A 3ZIMA 1F52A 1K51A 3PZ8A 1C78A 2KMCA 3L17A 3FILA 5CX3A 2C7HA 1R4MI 3NRZA 1EF5A 3NY5A 4CYEA 4DDGD 3GZNB 3Q69A 4ZOHC 2ZW0A 5IN7A 4MSQB 4WJOA 5IOIA 3JYUA 5C2TB 1YX6B 3LB8C 2INPE 1L0VB 4URKA 3T3OA 2WGSA 2R2OA 2E6XA 1EM7A 2HTHA 2JRIB 1YD8U 2H88B 1Q0WB 3V3XA 1N60A 4WWMA 3TEZA 1J0GA 2K8BA 2RGFA 1CJEA 4HEA1 2EMTA 1GJZA 2G4SA 3TCAA 1C3TA 3AECB 2MBEA 2GI9A 2LI5A 1D5ZC 2WDRB 2ZVOA 1V1PA 1FD6A 1OQYA 1UH6A 1VZ6A 1ZDXA 3TEXA 4AOFA 4AUQC 5HFYA 4LDTD 1B9RA 3A9JB 2LVPA 3PHWB 1RLFA 1L4ZB 4BZAA 3NVVA 2G45B 3NZSA 1UUPA 2XEWA 3PVLA 1NVID 3BZDB 1WZ0A 5EE1A 3FKYA 2WHIA 2GLSA 3ZUNA 2AWTA 3Q2AC 2Z59B 2IGGA 1GC7A 2KLCA 3NZ3A 3NZUA 2BS3B 1ZE3D 4HK2A 4RGNA 1NI2A 5DCNA 2WWZA 4XWWA 4TSSA 4D2KA 2MBHA 2YVCA 3W1SC 2MJ3A 2RPQA 3X0WA 3AE9B 3GZNI 2LGSA 1TIFA 4PYZA 3I3TB 1HXYD 1XLQA 3NUHB 4HROA 2WXIA 2FCMA 3GOEA 3NVWA 1VDVA 4RF0A 4F7ZA 1ZGUB 2Q5WD 4NY0A 1UWMA 4DXAB 4KSKC 4KV2A 2WXFA 5EE0A 2JZZA 2JXTA 4GOCA 4GGQA 3RPFC 2BVCA 2IGDA 5DPWA 2PVOD 2RD0A 2LJIA 3H7PA 3L13A 2QIEB 2GOWA 3AULA 3BYTB 1V2YA 3PS6A 1Q5WB 2DYBA 3RNBC 4ANUA 1JWUD 3KUCB 4A3PA 1X1MA 1ISNA 4P1CC 3ZNGC 4KZCA 2W3RA 5H8YE 3B2FA 3PZ7A 3WA0A 4MEMA 1F2RC 3PTFC 3T9LA 2M1MA 3DHIC 4EKUA 4LNOA 4DK5A 1WXVA 1QQRA 3BVZA 3M95A 1VRAB 1E7VA 3WIMA 3KVFB 1LM8B 4M0WA 2MLBA 2V3NA 3IVFA 4ASWC 4ICUA 4HXDA 4W9JA 1PQSA 4MH8A 2WXPA 4BKGA 1UZXB 4WIPA 3ZRFA 2MRPA 3DBHB 2K8HA 3EFCA 4HWIB 3AE4B 5LNK1 4NPNA 4KDLB 2PVGC 3B0AA 4RMAA 1FRRA 2IO0B 2HDEA 2X38A 4N59A 2QJLA 1AN8A 3A4RA 1ZDVA 4IC7B 2DYOA 1ZXIA 3AV8A 3E56A 4JWSC 4RNAA 1TKGA 1N6ZA 1TTNA 3M62B 1KTKA 1WR6E 4MM3B 3WAMA 3ZXVA 1P7FA 2E3TA 2IY0B 2KVRA 4GLSC 5L83A 1LGRA 5GMVA 2WXOA 4IWPA 1FEHA 1NEKB 2KC2A 4C4VA 1EO6A 1ZOYB 1WSPA 3PGEA 3TUOA 3ZDTA 3NG0A 2BYVE 3ML8A 1FNWA 2IO1B 3JW0X 3O13A 1V81A 4E74A 2KZRA 2MCNB 3UIPB 1WH3A 1BT0A 3ZRCA 2BB5A 3L0WB 1QOGA 4MGYE 3MTNB 3OLMD 1YQBA 4KDIC 2IDYA 1XLNA 4YSXB 4IKGA 2WQYB 1L0XB 1TZOA 2BF8B 2WDQB 1C4PA 3AN1A 3ZW3A 2QMTA 2MJDA 2K1FA 3DBLI 2DYMA 5BMHA 1WGGA 1Z5SB 2J0JA 4BAXA 4GIVA 1ROEA 5KHOA 1WGHA 4MJSA 1P3QU 1EF1A 2N1WA 2J42A 1JW9D 4ZRQA 1PGBA 5IA7A 2BKFA 2KKCA 1FPYA 5CHFA 2KTFA 2O2VA 4GU2A 1WFYA 3RNCC 3HUIA 4S0RA 4ANVA
chains in the Genus database with same CATH topology
1SXTA 2J53A 2PTLA 1XEEA 4TQ0A 2AQ1B 4LLGM 5E6JA 2AX5A 1CQVA 1JRPA 1DOIA 1KH0A 2KQ4X 1YN4A 3BVGA 1VZ7A 3ZGZA 4RF1A 4YTPB 2KACA 1XLOA 4RGOS 1D4BA 4KKJA 3UI3A 4YSYB 3W2DA 1TY0A 1YJIA 4ZHPA 2WXMA 1UWXA 3KQ4A 1B1ZA 4HKQA 2GRIA 4ARIA 2Z8LA 1SB3C 1EWYC 1D5XC 4KX6B 2JQRB 1PGAA 1JWMD 2JYTA 4YSZB 3BIID 3AE5B 1TKYA 4ZRPA 4MACA 3EA6A 3ZJTA 5HG2A 2WXHA 4MT5A 2RPVA 1KLUD 4JWUC 2TSSA 4YTMB 3MFGA 1ACCA 1D6EC 1FRDA 2YEPB 5AUIA 1OQRA 1CK1A 4RGMA 4AQ7A 1FCLA 2LHEA 3H8HA 2W3SA 1J7AA 3AE8B 1L5PA 1BUIC 1FIQA 2KMMA 5EE9A 1K53A 1YN5A 4KGRA 5C3JB 2MEKA 3EUB2 1JROA 2QEJC 3AEBB 1F77A 3B9JA 3R2IA 4CQNA 4ZYSA 2RMMA 1ET9A 3VR9B 2KWDA 4ITKA 5EE3A 2K0PA 3EGRA 4B0MA 1TY2A 1N5XA 1NYRA 4J3OD 4ARCA 2WXRA 1ZXHA 2N0SB 5AUKA 1YJJA 2BYTA 1FCCC 2I2YA 2JWUA 2KAJA 2AQ3B 3NS1A 5FK9C 1E10A 1SEBD 3AE2B 4C80A 2V0GA 2NTTA 4A9AA 3AEDB 1ZP0B 3I9V1 3MP9A 1OFFA 3KWVA 2G9HD 1GTEA 2JSVX 3DWMA 4YWGG 1SJHD 2JYEA 2LHDA 3AEGB 2L52A 2BB6A 5H92C 3Q8AA 3U52E 1FM0D 3R8BA 1FMAD 5G5GA 1TS3A 3V05A 1DGJA 1YQ4B 1L0YB 4TQ1A 2BBCA 2JX5A 3E9SA 3KLSX 3J9CA 3AE7B 4A6QA 4OZBA 4HKZE 1V1OA 1FNVA 4WAFA 5BYRA 1GOZA 4ZHOA 1QF6A 3TEWA 2PMVA 1E0ZA 1R7SA 2ONQA 2NMQA 1XF5L 3N9YC 1IGDA 1XCTL 3W9CB 1SJED 1TS2A 1XCQL 5HI1A 1KFYB 2WU2B 1C76A 1UNSA 1C77A 4NAMA 2OHFA 2V3PA 1L6VA 3IAS1 1RFKA 1YQ3B 1K50A 1F2RI 2LUMA 1NENB 2Y5PA 3ZJVA 2J4XA 3C8YA 1DOXA 2ON8A 1MHXA 1HZ5A 1WGKA 2SAKA 5HHDG 4O1NA 1VR9A 2DLBA 3AE1B 4XWTA 2KDMA 3T3NA 1VZ8A 1K51A 3PZ8A 1C78A 2JZPA 1XLPA 2M0AA 3FILA 3Q8BA 4HJGE 3NRZA 1K52A 2N7JA 2FE8A 3GP7A 5FR3A 3OWEB 1D5MC 3TSSA 2BT6A 4C7ZA 4GDKB 5JXVA 3Q69A 1XXGA 2ZW0A 4ZOHC 4DXFA 4R3DA 3ZJUA 4UDUC 4YTNB 1I4QA 3HVDA 3SFEB 2XN9C 3CF4A 1QOBA 2YEPF 4P6VF 4DXGA 4A55A 5C2TB 4US9A 1F0ZA 2PIAA 2WXQA 3ABVB 3LB8C 4L2YA 2D5GA 1MI0A 2DWQA 1UGJA 2INPE 1MHHE 1PDXA 2IPKD 1L0VB 2R61A 1N63A 1ZPSA 5I4DA 1JALA 3T3OA 3MC0B 2E6XA 1EM7A 1SF0A 1H7WA 1IBXA 3GS2A 2H88B 3V3XA 4PT5A 4H2AA 1N60A 1IUEA 4WWMA 1QOAA 3TEZA 3SR6A 1CJEA 4HEA1 3IAM1 1V8CA 4KGTA 3AECB 2WXJA 1HZ6A 1N61A 1D5ZC 2WDRB 2GI9A 3SEBA 3BK1A 3ETRA 2BS4B 1V1PA 1PUTA 3AEAB 4A90A 2WXNA 1FD6A 1VZ6A 2J52A 1ZDXA 2PKOA 3TEXA 1MPEA 1ET6A 1GTHA 2CU3A 2WNMA 4NZLB 1WXQA 5HFYA 1B9RA 1J7BA 1I4PA 2LEKA 3VQIA 4FXCA 1L4ZB 1HA5A 3NVVA 1E9MA 1VLBA 1C4AA 1UUPA 1E7PB 1NVID 3BZDB 2B76B 2IGHA 2MJEA 5EE1A 3U2SC 4Q2JA 3URYA 1WYGA 2L1AA 2NTSA 2FBWB 1PGXA 2VZKD 4WQMA 3ZYYX 1HQRD 1BMLC 4USAA 1KF6B 1V97A 3BYYB 3MJ5A 2IGGA 1ZUD2 3NZ3A 1HEZE 4EE2A 3VR8B 2BS3B 2KN4A 1ZE3D 2FUG1 5D3IB 4RGNA 4WH4A 4XWWA 4TSSA 3AM9A 4D2KA 1MVKA 3RFZB 1Y56A 3FAHA 3LXFA 2MJ3A 2L83A 4AS1A 3AE9B 2WXLA 3NVYA 2I38A 1HXYD 1FFUA 3AB5A 1SE4A 4OVZA 1SBBB 3VRBB 1GAQB 1XLQA 3NUHB 2M56B 1GT8A 1I4XA 4HROA 2WXIA 4C56C 3NVWA 1VDVA 4WURA 4RF0A 3VRAB 1RWSA 1FO4A 2Q5WD 2AQ2B 1UWMA 4NAWB 1XO3A 2WXFA 1BXTA 5EE0A 3WCQA 3P4QB 1YNTE 2JXTA 3NVZA 1M4VA 3CWIA 3RPFC 3HRDD 1TS5A 2IGDA 4JPSA 2PVOD 2LJIA 3AEEB 2QIEB 3LYYA 3BK2A 4RCOA 2LFIA 4XDCA 3U7ZA 5TSSA 3BYTB 4US8A 3L4PA 1RYJA 2JU6X 1JCKB 3P1MA 1JWUD 1KLGD 1SE2A 3BWUD 1EWCA 4OHJA 2L32A 1C4CA 1JWSD 1YN3A 2W3RA 5H8YE 3B2FA 3P42A 3PZ7A 3FILB 1A70A 1F2RC 5D3DA 1CZPA 1STEA 3DWGC 1TS4A 5FKAC 1I7HA 3BVMA 1L4DB 3U4EG 3W5UB 1QQRA 2XNAC 3BVZA 1VRAB 1LO5D 2V4IB 2QILA 4LK0M 1DOYA 1E6EB 2LMCA 3Q8FA 1KRHA 2IJ0A 4M0WA 2V3NA 1TKEA 4RH6A 4XE0A 4MH8A 2WXPA 4HRSA 4XDDA 1I4GA 4WIPA 3CIRB 2QSDA 1NI3A 3P63A 2PLPA 3AE4B 1IBXB 2Y5CA 4N6EB 5LNK1 3AMZA 3IT6B 4JE3B 2PVGC 1TJEA 1AWDA 1FRRA 4YT0B 1JWBD 2K9XA 1GB1A 4TMAB 4A8XC 2HDEA 1JWAD 2X38A 4OW0A 1GPXA 2CJOA 2RDHA 4N59A 5BYQA 2QJLA 2ACZB 4B0EA 2BTEA 1AN8A 1QKZA 3AE3B 1C9FA 4YXDB 4RFBA 1V1PB 2WXKA 3W5VB 2K22A 3P4RB 3B2GA 1ZDVA 2WXGA 2DYOA 2MH7A 4C7YA 1ZXIA 3AV8A 3E56A 4JWSC 4RNAA 1TKGA 5BMGA 1QILA 5G5HA 1AW7A 3MHZA 1KTKA 4MM3B 1WWTA 1P7EA 1QOFA 2VZKB 2SEBD 1QLBB 2BS2B 1QT9A 1P7FA 2E3TA 1JQ4A 4L1BA 1FNUA 4RGTA 1EU4A 4GLSC 3ZQ4A 5MPOA 2EELA 4L23A 4OZCA 4P16A 2WLBA 2WXOA 1FEHA 1NEKB 2LGIA 4KKIA 1VJKA 2WP9B 3TEYA 1FXIA 2WU5B 5T8IA 3W1SA 2K5PA 3SFDB 2GB1A 1GB4A 1ZOYB 3GB1A 1WSPA 2DBYA 1C79A 3TUOA 4OZAA 2W55A 1T5XD 1FNWA 4KGSA 3O13A 2CJNA 1H7XA 1SE3A 2RDGA 3Q8CA 1PYWD 2OEDA 3HVZA 1ENFA 2BB5A 1QOGA 1OQQA 2ICIA 1I4RA 2Y3AA 4IDIA 2IDYA 1SIJA 1ESFA 4NJCA 4N58A 2INNE 1XLNA 4YSXB 1N5WA 2WQYB 1FXAA 1L0XB 1TZOA 3P4SB 4IKGA 2WDQB 1IGCA 1RM6C 2W82A 1C4PA 3AN1A 2QMTA 4DQOC 2WDVB 2BW2A 2MJDA 1EU3A 2DYMA 1PFDA 1SSNA 5BMHA 2M19A 1I4HA 1L6UA 2G1EA 3PO0A 2W54A 1ROEA 3KWLA 2WS3B 1Q10A 1DYQA 3AEFB 3AH7A 5GXGB 1N62A 1AYFA 3AE6B 2J42A 1T3QA 4GDLB 1JW9D 3IT4B 2HTME 4LTUA 4ZRQA 1PGBA 5BYSA 1YMHE 1NYQA 2N9LA 4IOIE 1JMLA 2N9KA 3R2TA 2K3UA 5D7GA 3FC4A 1TYGB 2PW9A 1WRIA 3Q8EA 4JX1C 3I57A 2ZW1A 1FFVA 1J7CA 3IXSA 2H89B 3HUIA 3P4PB 5BMIA 1T6BX 2EKIA 4REZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE4 B;  4USA A;  1KF6 B;  1V97 A;  2Y5C A;  4N6E B;  3W9C B;  3AMZ A;  1ZUD 2;  2PVG C;  1KFY B;  2WU2 B;  1TJE A;  2AX5 A;  1AWD A;  1FRR A;  4YT0 B;  1JRP A;  1JWB D;  1DOI A;  2K9X A;  2OHF A;  3VR8 B;  1L6V A;  1RFK A;  1YQ3 B;  1JWA D;  2BS3 B;  1NEN B;  1GPX A;  4YTP B;  2CJO A;  4N59 A;  1DOX A;  1XLO A;  2ACZ B;  2QJL A;  3AE3 B;  4YXD B;  1WGK A;  3AM9 A;  3W5V B;  5AUI A;  3AE1 B;  2K22 A;  3P4R B;  3B2G A;  3FAH A;  4YSY B;  3LXF A;  2MJ3 A;  1YJI A;  4ZHP A;  2L83 A;  2MH7 A;  4C7Y A;  5EE0 A;  1ZXI A;  3AV8 A;  3AE9 B;  4JWS C;  1TKG A;  5G5H A;  3NVY A;  1XLP A;  1FFU A;  3AB5 A;  1SB3 C;  1WWT A;  1EWY C;  3NRZ A;  1QOF A;  4KX6 B;  3VRB B;  1GAQ B;  1XLQ A;  2JQR B;  1QLB B;  2BS2 B;  2M56 B;  1GT8 A;  4YSZ B;  2BT6 A;  3BII D;  4HRO A;  1QT9 A;  3AE5 B;  1TKY A;  4C7Z A;  2E3T A;  1JQ4 A;  3WCQ A;  3NVW A;  1VDV A;  5MPO A;  4ZOH C;  4JWU C;  4YTM B;  2WLB A;  3VRA B;  4YTN B;  1RWS A;  1NEK B;  3SFE B;  1FRD A;  3CF4 A;  1QOB A;  2Q5W D;  1OQR A;  4P6V F;  1VJK A;  5C2T B;  2WP9 B;  1UWM A;  4US9 A;  1FXI A;  1F0Z A;  2WU5 B;  1XO3 A;  2PIA A;  3LB8 C;  3ABV B;  2W3S A;  2K5P A;  3SFD B;  1J7A A;  3P4Q B;  3AE8 B;  1ZOY B;  1L5P A;  2DBY A;  2DWQ A;  3NVZ A;  3CWI A;  3RPF C;  1FIQ A;  2KMM A;  1PDX A;  5EE9 A;  1L0V B;  3HRD D;  1N63 A;  2W55 A;  5C3J B;  1JAL A;  2PVO D;  3EUB 2;  1JRO A;  3AEB B;  3AEE B;  2CJN A;  1H7X A;  2QIE B;  1SF0 A;  1H7W A;  3B9J A;  2H88 B;  3HVZ A;  3VR9 B;  1N60 A;  1IUE A;  4US8 A;  4ITK A;  4WWM A;  1QOG A;  1QOA A;  5EE3 A;  1OQQ A;  3L4P A;  1RYJ A;  1N5X A;  1NYR A;  4IDI A;  3SR6 A;  1CJE A;  1SIJ A;  3P1M A;  1V8C A;  2N0S B;  4N58 A;  5AUK A;  1YJJ A;  3AEC B;  1XLN A;  4YSX B;  1N5W A;  2WQY B;  1FXA A;  2WDR B;  1N61 A;  3P4S B;  3ETR A;  2BS4 B;  2WDQ B;  1RM6 C;  2KAJ A;  1PUT A;  3AN1 A;  3NS1 A;  3AEA B;  2WDV B;  1E10 A;  2MJD A;  2W3R A;  5H8Y E;  3B2F A;  1FO4 A;  1E0Z A;  3AE2 B;  1A70 A;  4C80 A;  1CZP A;  3DWG C;  3AED B;  1PFD A;  4A9A A;  1ZP0 B;  2M19 A;  2PKO A;  1L6U A;  1OFF A;  2G1E A;  1GTH A;  2CU3 A;  3PO0 A;  2W54 A;  1I7H A;  1ROE A;  1GTE A;  3KWL A;  3DWM A;  2WS3 B;  1WXQ A;  3W5U B;  1B9R A;  1J7B A;  2LEK A;  3AEG B;  4FXC A;  2L52 A;  3AEF B;  1DOY A;  3AH7 A;  1E6E B;  1N62 A;  1AYF A;  3NVV A;  5GXG B;  5H92 C;  3AE6 B;  1E9M A;  1VLB A;  1T3Q A;  1KRH A;  1FM0 D;  1JW9 D;  4LTU A;  1E7P B;  2HTM E;  1NVI D;  1NYQ A;  2B76 B;  1FMA D;  5G5G A;  2MJE A;  1TKE A;  1DGJ A;  1YQ4 B;  5EE1 A;  3FC4 A;  2JX5 A;  1WYG A;  1TYG B;  4HRS A;  1WRI A;  3AE7 B;  4JX1 C;  2FBW B;  3CIR B;  1FFV A;  1J7C A;  4WQM A;  2H89 B;  3ZYY X;  4ZHO A;  1QF6 A;  3HUI A;  3P4P B;  1NI3 A;  1R7S A;  3P63 A;  2EKI A; 
#chains in the Genus database with same CATH topology
 1SXT A;  2LRU A;  2ZPN A;  3RCZ A;  5IP4 D;  2BYE A;  1CQV A;  4ZRJ A;  4FHJ A;  4GB9 A;  3C0R B;  5LXI B;  2JWZ A;  1XLO A;  3B1L X;  4KKJ A;  3M63 B;  2ZEQ A;  1WXA A;  3W2D A;  3VTW A;  4HDQ A;  2GRI A;  4ANW A;  2ZCB A;  3CF6 E;  5CHW A;  2D11 A;  2JYT A;  2LWP A;  3EA6 A;  3U7D A;  2MBQ A;  1H8C A;  2TSS A;  1FRD A;  4DHZ E;  4AQ7 A;  5CTR C;  1WMH A;  3H8H A;  5C1Z A;  1FCL A;  3AE8 B;  3PV1 A;  2KMM A;  1KM7 A;  1YN5 A;  3GE8 C;  4FN2 A;  3EUB 2;  3A1Q A;  2IY1 B;  2QEJ C;  3AEB B;  4AJY B;  3B9J A;  2L8J A;  3VR9 B;  3PRP B;  5EE3 A;  1VCB A;  2LD9 A;  1NYR A;  2IND C;  2BYF A;  3PHX B;  2WXR A;  5AUK A;  1YJJ A;  2BYT A;  1FCC C;  3L54 A;  4G3X B;  2KAJ A;  3K9P B;  4I6N B;  2V9H A;  2LZ6 A;  1KJT A;  2V0G A;  3I9V 1;  3U8Z A;  3KWV A;  4WQO B;  1SIF A;  3DWM A;  2LHD A;  2BQQ A;  4II2 B;  4M01 A;  2WX1 A;  5G5G A;  1TS3 A;  1YQ4 B;  2BBC A;  3ECI A;  3J9C A;  4MSM B;  2D10 A;  2L3Z A;  3NHE B;  4A6Q A;  1V1O A;  2NS5 A;  4ZHO A;  3TEW A;  1UBI A;  2JUO A;  1XF5 L;  3N9Y C;  3BY4 B;  3SD5 A;  1T0Q C;  1TS2 A;  1KFY B;  3VH4 B;  2XBB C;  2D3A A;  4IWQ A;  2MW5 A;  3IAS 1;  1YQ3 B;  2REX A;  3ZJV A;  1DOX A;  1SGH A;  2DEN B;  2ON8 A;  1MHX A;  3V6C B;  1HZ5 A;  2GBR A;  1TZ1 A;  2DLB A;  2KDM A;  2V1Y A;  1T0R C;  1VZ8 A;  1R4N B;  2M0A A;  3V6E B;  2W9N A;  1RRB A;  3GP7 A;  4HPL B;  5JXV A;  2A5U A;  3W1Y A;  4DXF A;  4UDU C;  2XN9 C;  4NJ7 A;  4US9 A;  1F0Z A;  2PE9 A;  2PIA A;  3CST A;  3L16 A;  4L2Y A;  2D5G A;  1MHH E;  4TKN A;  2IPK D;  1N63 A;  1WXM A;  1YJ1 A;  1ZPS A;  1H7W A;  2WDT B;  2VH2 A;  4H2A A;  1IUE A;  2N7E A;  1WF9 A;  3IAM 1;  4K3B A;  4KGT A;  2WXJ A;  3SEB A;  5FR6 A;  3WAN A;  3ZTD A;  4A90 A;  4ZDV A;  3ZNH B;  5D94 A;  2AEH A;  1IPG A;  2KFJ A;  1P0R A;  2PKO A;  1MPE A;  2WNM A;  1WXQ A;  2QDF A;  3O65 B;  1MG8 A;  4XYC A;  4BKT A;  2B76 B;  3ML9 A;  1WGY A;  3SU8 X;  3DOW A;  3ZLZ A;  2N4F A;  4XX5 A;  4USA A;  1V97 A;  1GC6 A;  2QHO A;  3MJ5 A;  3RUI B;  3APF A;  1TBE A;  1HEZ E;  2L05 A;  2IZV B;  4EE2 A;  4PS7 A;  2BKR B;  1P1A A;  2DZM A;  1MVK A;  4DBG A;  2GBJ A;  1D3Z A;  4CHK A;  2M0X A;  4K7U A;  1FFU A;  1SE4 A;  4OVZ A;  1GAQ B;  2LAS A;  4P1B C;  4GSW A;  2EKE C;  1WGR A;  2ZNV B;  1WGD A;  1HE8 A;  4ZRK A;  3QA8 A;  3H7S A;  2AQ2 B;  2J7Q B;  3TBL D;  4NAW B;  1XO3 A;  2MSE D;  2KTR B;  3WCQ A;  3P4Q B;  2KDF B;  2KDB A;  3VXW A;  3HRD D;  1TS5 A;  5JHB A;  4JPS A;  2HD5 B;  5CHV C;  3LYY A;  3BK2 A;  4ANX A;  1WR1 A;  2DNF A;  2KOX A;  4XDC A;  4C00 A;  5TSS A;  4K7W A;  1JCK B;  2KO3 A;  3PZD A;  2XK5 A;  1KLG D;  3BWU D;  3KYC D;  2FIF A;  2L32 A;  1E5W A;  1C4C A;  1JWS D;  1L2N A;  3NJT A;  3FIL B;  2L00 B;  3WAP A;  4B6W A;  3DWG C;  2KMA A;  1TS4 A;  5FKA C;  2MP2 A;  4PS3 A;  1L4D B;  3U4E G;  1LO5 D;  1UD7 A;  2KQS A;  3Q3F A;  1KLV A;  1WE7 A;  2N9X A;  1WJ6 A;  3ENE A;  3H9D A;  1KRH A;  2IJ0 A;  2J0M A;  2LJ5 A;  4RH6 A;  2GMI C;  2GBM A;  2M17 A;  1MJD A;  3JVZ X;  2QSD A;  5EDS A;  3AU5 A;  2DX5 B;  3D32 A;  5D2M B;  1IP9 A;  2N9P C;  4YT0 B;  1JWB D;  1M94 A;  3LDZ E;  4LDT B;  2BTE A;  3MJW A;  5IKC M;  4YXD B;  1V1P B;  2WXK A;  3W5V B;  4HJK A;  4OVU A;  4C7Y A;  4BOZ B;  2NBW B;  2N7D A;  1P7E A;  2SEB D;  3VDZ A;  1QLB B;  1QT9 A;  3PLU A;  1JQ4 A;  4RGT A;  2KT7 A;  4XGA B;  3IG3 A;  1I35 A;  3RNG C;  4LJP B;  4P16 A;  2C60 A;  2RDB C;  1FXI A;  3Q3J A;  5T8I A;  3W1S A;  3KW5 B;  3SFD B;  1GB4 A;  3GB1 A;  1C79 A;  4OZA A;  1T5X D;  4I6L B;  3QAQ A;  3LJ3 A;  3Q8C A;  5JZE B;  1PYW D;  2INC C;  2CR5 A;  1OQQ A;  2ICI A;  1UGM A;  4NJC A;  2INN E;  3NS8 A;  1N5W A;  3AU4 A;  4KIK A;  1T0Y A;  3P4S B;  2EMS A;  4DQO C;  2WDV B;  3IBE A;  2V3S A;  4EEW A;  1PFD A;  2M19 A;  1RAX A;  1L6U A;  2W54 A;  2FID A;  2WS3 B;  1DYQ A;  3AEF B;  1N62 A;  1AYF A;  4K7S A;  4LTU A;  4XC2 A;  1NYQ A;  4DHJ D;  4IOI E;  2N9K A;  2K3U A;  1TYG B;  3Q8E A;  4IW0 A;  3IXS A;  4W9G A;  1GB1 A;  2EKI A;  2VRR B;  2J53 A;  3H7P B;  4W9C A;  5J18 A;  2GBN A;  1JRP A;  1DOI A;  2C7M B;  2KQ4 X;  2KJR A;  4X57 B;  3DBL B;  5AEK B;  3BVG A;  4EOY A;  4LNF A;  4YTP B;  4FJY A;  1WY8 A;  1HTO A;  3VUY A;  3V60 A;  1D4B A;  3VUW A;  3N3K B;  2KNB A;  4ZHP A;  2WXM A;  3T8M A;  3EEC A;  2KQ7 A;  1SB3 C;  1EWY C;  4YL8 A;  4KX6 B;  1PGA A;  2B3A A;  4ZRP A;  3ZJT A;  5HG2 A;  2WXH A;  4II3 B;  3N1Z C;  3RT3 B;  3MFG A;  1ACC A;  5AUI A;  2LHE A;  1WM3 A;  2W3S A;  1J7A A;  1WM2 A;  1C1Y B;  4WWO A;  1T0S C;  5D6J B;  4KGR A;  5DPR A;  1F77 A;  1E8Y A;  3DHH C;  4FBJ B;  4CQN A;  4W9F A;  2RMM A;  1ET9 A;  4IM2 A;  1V80 A;  2ZCC A;  3EGR A;  5LXH A;  4B0M A;  1V86 A;  4J3O D;  1ZXH A;  2AQ3 B;  3NS1 A;  2M8S A;  3ZDM C;  1E10 A;  2KLG A;  3KUZ A;  1YIW A;  3AED B;  4LCD E;  1ZP0 B;  1V9J A;  2UU7 A;  4G0N B;  4ZYN A;  1AAR A;  1SJH D;  2L52 A;  2BB6 A;  4W9E A;  3Q8A A;  1GUA B;  4FJV B;  3U52 E;  1FM0 D;  2HJ8 A;  4DHZ B;  3KUD B;  1DGJ A;  4TQ1 A;  4PS8 A;  3AE7 B;  3SHQ A;  4HKZ E;  2KAN A;  4F8C B;  1GOZ A;  1QZE A;  3VAW A;  4FJZ A;  2ONQ A;  1IGD A;  1WX8 A;  1E8Z A;  4W9D A;  3JSV B;  1I42 A;  2OHF A;  2V3P A;  3VHT C;  4FLH A;  1RFK A;  3PRZ A;  1F2R I;  4JL9 A;  2Y5P A;  3H6N A;  4B9K A;  1IYF A;  3NOB A;  4B95 A;  3ALB A;  3Q8B A;  2AL6 A;  1E7U A;  2N7J A;  5IO9 A;  1D5M C;  3TSS A;  3IHP C;  4BKS A;  2BT6 A;  4MJS B;  3CSF A;  4GDK B;  5AZG A;  3TL5 A;  1VD2 A;  1XXG A;  2FCQ A;  4R3D A;  1I4Q A;  4DXG A;  1QOB A;  3DVN U;  2CKH B;  4TV3 A;  2JVC A;  2WXQ A;  4BKS D;  4HDO A;  2NPT A;  2UYZ B;  1UGJ A;  4AJW A;  1PDX A;  2R61 A;  1UBQ A;  5I4D A;  1GG3 A;  1JAL A;  3R3M A;  3MC0 B;  1IBX A;  2D2Q A;  3GS2 A;  3Q3N C;  2K8C A;  1KOT A;  1QOA A;  4W9K A;  3UF8 A;  2WYQ A;  5KHQ A;  3BK1 A;  3ETR A;  2BS4 B;  4RM9 A;  2ZJD A;  3AEA B;  1Q1O A;  1UF0 A;  4IM0 A;  1SE9 A;  3OAW A;  3A9K A;  4K81 A;  1WI0 A;  1GTH A;  2CU3 A;  3VVW B;  4MEL A;  1J7B A;  1I4P A;  2LEK A;  5LLI A;  1WX9 A;  2CHZ A;  1HA5 A;  2FNJ B;  4WWP A;  1C4A A;  2MJE A;  1WMH B;  3U2S C;  2C9W B;  1YOV B;  3CMM B;  2FBW B;  2VZK D;  3TIX A;  4WQM A;  1E8X A;  1HQR D;  3BIN A;  3BYY B;  4IM3 A;  1E8W A;  2KD0 A;  2MA9 B;  3QIJ A;  3RI7 C;  3PRM B;  1EUV B;  2FUG 1;  5JH5 C;  2LUE A;  3RFZ B;  3LXF A;  2L83 A;  2KJH B;  4AS1 A;  2O6V A;  2I38 A;  3RMK C;  3AB5 A;  5J2R A;  2KK8 A;  1SBB B;  2AL3 A;  3VRB B;  3RD2 A;  2LGD A;  2M56 B;  3RZW C;  2PJH A;  2KX3 A;  3V61 A;  4C56 C;  3OJ3 A;  4AWJ A;  3N20 C;  2O6V D;  3VRA B;  1OEY J;  4GDL A;  1FO4 A;  5AZH A;  1XD3 B;  4BOS C;  3NVZ A;  1YNT E;  4QAY A;  3AEE B;  3VTU A;  2LFI A;  4US8 A;  3L4P A;  1RYJ A;  2BWF A;  2JU6 X;  1SE2 A;  2NBU A;  4OHJ A;  1Z2M A;  3U30 A;  1YN3 A;  3P42 A;  4FUL A;  4JQW C;  3UIO B;  3AI5 A;  1STE A;  3B08 A;  5BO4 B;  3BVM A;  3Q6B A;  4I6P A;  1WIA A;  3DPD A;  4HPP A;  2QIL A;  2FAZ A;  1LFD A;  2ASQ A;  4HRS A;  4XDD A;  2Z0E B;  3DVG Y;  2KN5 A;  2MHJ A;  4S17 A;  2PLP A;  3RN9 C;  3IT6 B;  4JE3 B;  1AWD A;  4TMA B;  4A8X C;  1JWA D;  2MX2 A;  2CJO A;  4B0E A;  5BYQ A;  2KWU B;  2ACZ B;  1QKZ A;  1C9F A;  3AE3 B;  2K22 A;  3P4R B;  3B2G A;  2JXX A;  2MH7 A;  3Q3O C;  1L7Y A;  5G5H A;  1AW7 A;  3QQ8 B;  3MHZ A;  1WWT A;  2BS2 B;  2KFK A;  3V62 A;  4L1B A;  1FNU A;  1EU4 A;  5MPO A;  2EEL A;  3I63 C;  4OZC A;  2WLB A;  4KKI A;  1VJK A;  2WP9 B;  3TEY A;  1XQQ A;  2KHW B;  2KC1 A;  2K5P A;  2GB1 A;  2DBY A;  4EZL A;  2MQJ A;  3X23 A;  2DAF A;  2IO2 B;  4KGS A;  2CJN A;  2CU1 A;  1H7X A;  1SE3 A;  1WJU A;  2RDG A;  3PLV A;  2OED A;  2Y3A A;  2ZNV C;  2JF5 A;  4IDI A;  1SIJ A;  4N58 A;  1ZW7 A;  1FXA A;  1IGC A;  1RM6 C;  3PT2 B;  2W82 A;  4EUT A;  2BW2 A;  1SSN A;  2DAJ A;  1I4H A;  4RM8 A;  3HM3 A;  1Q10 A;  3N30 A;  3AH7 A;  3A33 B;  4GXB A;  5JHA A;  3M3J A;  2HTM E;  3FC4 A;  2PW9 A;  4JX1 C;  2HE7 A;  1A5R A;  2NR2 A;  2VH1 A;  3VTV A;  5BMI A;  4REZ A;  3KYD D;  4JIO U;  1V5T A;  2PTL A;  1XEE A;  4TQ0 A;  4NNJ B;  2AQ1 B;  4LLG M;  4TUU A;  2L0T A;  2AX5 A;  2KJ6 A;  1KH0 A;  3DQV A;  5E6P A;  4NQK E;  3EC8 A;  2N9E B;  2KDI A;  4PK1 A;  2IYD B;  2XK5 B;  3ZGZ A;  2KAC A;  4J6I A;  4WAA A;  5E6O A;  4BBN F;  1TY0 A;  1YJI A;  5L95 C;  1UWX A;  1B1Z A;  2D07 B;  4LNN A;  2M4N A;  2Z8L A;  4ARI A;  2MP2 B;  4M02 A;  2G3Q B;  2JQR B;  1JWM D;  1K8R B;  4YSZ B;  1TKY A;  3DVN V;  3AXC A;  3MHS D;  3A9J A;  2RPV A;  4JWU C;  3S2A A;  2YEP B;  3N1X C;  3P2B A;  1OQR A;  1CK1 A;  5IAA C;  3UQB A;  3SDL C;  2MBO A;  1L5P A;  1S3S G;  1XT9 B;  2DZK A;  5C3J B;  3L10 B;  4DWF A;  1JRO A;  5C23 A;  1MG4 A;  3R2I A;  5HKH A;  3UIN B;  4ZYS A;  2KWD A;  2OJW A;  3Q3M C;  1N5X A;  2ZZP B;  3QK0 A;  4ARC A;  3ZTC A;  2BGF A;  2DZI A;  1SEB D;  2YLM A;  4C80 A;  2NTT A;  4A9A A;  3A4S C;  5AZF A;  4E71 A;  1OFF A;  2LXA A;  2JSV X;  2JYE A;  1F9J A;  3AEG B;  1E90 A;  5H92 C;  2JT4 B;  2KYW A;  4MH0 E;  3R8B A;  3DDC B;  2C7N B;  2CHX A;  3V05 A;  3DVG X;  1L0Y B;  3KLS X;  5DPT A;  4WAF A;  5BYR A;  2KDE B;  2JRH A;  1NBF C;  2V4L A;  2PMV A;  1E0Z A;  4HVB A;  1SJE D;  2K25 A;  5HI1 A;  3ZKJ C;  3DHG C;  2IBI B;  2JPH A;  2LUM A;  1NEN B;  3DBR B;  2D3C A;  2C5L C;  2PPH A;  2J4X A;  3C8Y A;  3HM6 X;  3R7Q A;  4KIK B;  4O1N A;  2LRW A;  3AE1 B;  4DDI D;  1U4A A;  2I1K A;  4DHJ B;  2JZP A;  1XLP A;  4HJG E;  3H1U A;  3VUX A;  1K52 A;  3RUL A;  2FE8 A;  5FR3 A;  3OWE B;  1WE6 A;  4C7Z A;  3QWZ B;  2PEA A;  3VFK A;  2QCZ A;  2G4D B;  3ZJU A;  4YTN B;  4P6V F;  3HVD A;  3SFE B;  2LGX A;  3CF4 A;  2YEP F;  3R7R A;  1WJN A;  4A55 A;  2KWC A;  1P98 A;  3ABV B;  3HHM A;  1MI0 A;  2DWQ A;  1SF0 A;  4A3O A;  4PT5 A;  3RNA C;  3SR6 A;  2L76 A;  1V8C A;  2R2Q A;  4M0W B;  3QCA A;  1HZ6 A;  1N61 A;  1PUT A;  2WXN A;  3OG5 A;  2J52 A;  3PRE A;  2DHZ A;  4HCN B;  1ET6 A;  4WJP A;  4MM3 A;  1WX7 A;  4NZL B;  2AYO B;  3VQI A;  4FXC A;  4EZJ A;  3PSE B;  1E9M A;  1VLB A;  4GMV A;  4A20 A;  1E7P B;  1TT5 B;  2ZPY A;  3ZO5 B;  2IGH A;  4Q2J A;  3URY A;  1WYG A;  2L1A A;  2NTS A;  1PGX A;  3ZYY X;  2QC8 A;  3DBR I;  1BML C;  1KF6 B;  2MBB B;  1ZUD 2;  3QJZ A;  5TR5 A;  2Y5B B;  3HK0 A;  4HLE A;  4KZ0 A;  4FAD A;  3VR8 B;  3I5J C;  2KN4 A;  5D3I B;  3APD A;  4WH4 A;  3AM9 A;  1Y56 A;  3FAH A;  4C4V B;  3KH0 A;  2I1J A;  2WXL A;  4AP4 C;  3NVY A;  4ICV A;  2KX0 A;  1GT8 A;  1I4X A;  3JSV A;  4WUR A;  3IFW B;  1RWS A;  1OTR B;  4FHK A;  3MC9 A;  3QAR A;  3QX1 A;  1BXT A;  1M4V A;  4G50 A;  3CWI A;  3ZVV A;  2X8X X;  2KWV B;  4PYU A;  4RCO A;  3EHV A;  3U7Z A;  4GDK A;  1WJ4 A;  3DBH I;  3RNE C;  3P1M A;  1JRU A;  3ZNZ B;  1EWC A;  4JLC A;  2O2V B;  4HCP B;  3ZXR A;  5J17 A;  4WJQ A;  1A70 A;  5G2N A;  5D3D A;  1CZP A;  4EZK A;  1I7H A;  3W5U B;  2XNA C;  1LQB A;  2V4I B;  4LK0 M;  2GBK A;  1DOY A;  2LGY A;  4KVG B;  1E6E B;  3HIZ A;  2LMC A;  1WYW B;  3Q8F A;  4BVU C;  1FXT B;  1TKE A;  4XE0 A;  2L0F A;  2NPT B;  1I4G A;  3CIR B;  3TMP B;  3UGB B;  1NI3 A;  3P63 A;  4M00 A;  4K1R B;  1IBX B;  2Y5C A;  4N6E B;  4HPM B;  3AMZ A;  3RZF A;  2NBV B;  2BWE S;  1TJE A;  4IUM B;  2K9X A;  2OJR A;  3QHT A;  3RNF C;  1GNU A;  4OW0 A;  4LNI A;  1GPX A;  2RDH A;  4RFB A;  4M8M A;  2N1V A;  4GN1 A;  1MFW A;  4JGH B;  2WXG A;  1WZ3 A;  5BMG A;  1QIL A;  3APC A;  4W9I A;  3A9K B;  1V5O A;  5DPS A;  3A1Q B;  1QOF A;  2VZK B;  4MDK E;  4M8N A;  2CHW A;  2KXJ A;  3ZQ4 A;  3GE3 C;  4L23 A;  3RYT A;  3MC8 A;  5G55 A;  2LGI A;  4KSL C;  2WU5 B;  2D3G A;  4MGZ E;  4ZRI A;  3TJP A;  2NCN A;  4IWO A;  3OJ4 B;  2W55 A;  1F1H A;  1J8C A;  2UWQ A;  2WX0 A;  1ZKH A;  3HVZ A;  1ENF A;  3K9O B;  4F1S A;  1I4R A;  4NJ6 A;  1G6J A;  1WRD B;  1ESF A;  4MGK E;  2O6V B;  1EU3 A;  2NVU I;  2G1E A;  4XZ4 A;  3PO0 A;  3KWL A;  4MGI E;  4W9H A;  4FA6 A;  2FCS A;  5GXG B;  2Z0D B;  3AE6 B;  1T3Q A;  4GDL B;  3IT4 B;  5BYS A;  1YMH E;  1CMX B;  2N9L A;  1JML A;  3R2T A;  5D7G A;  5E6N A;  1WRI A;  3N1Y C;  3I57 A;  2ZW1 A;  1FFV A;  1J7C A;  2H89 B;  1S1Q B;  2RR9 A;  3BII D;  3P4P B;  2D3B A;  1T6B X;  2JZ3 B;  4W9L A;  2LVO A;  1TGZ B;  5E6J A;  2JY6 A;  4E3C A;  2DZJ A;  3DBS A;  2MWS B;  2FCN A;  4G11 A;  4EFO A;  1YN4 A;  1NDD A;  3WAL A;  1VZ7 A;  4RF1 A;  4RGO S;  3DCG A;  2ZVN A;  3N32 A;  3UI3 A;  4YSY B;  4N9F 4;  1HTQ A;  3KQ4 A;  3WAO A;  4HKQ A;  1V49 A;  1D5X C;  3AE5 B;  2RSU A;  4MAC A;  4MT5 A;  1KLU D;  1R4M B;  4YTM B;  1D6E C;  4BBN C;  4RGM A;  4OVV A;  1BUI C;  4IG7 B;  1FIQ A;  3Q14 C;  5EE9 A;  1K53 A;  2MEK A;  4WJN A;  3VH3 B;  3EFU A;  4ACF A;  4K3C A;  2K6D B;  4ITK A;  3ZNI D;  2K0P A;  2IO3 B;  1TY2 A;  1LXD A;  2N0S B;  1UEL A;  1H4R A;  2I2Y A;  2JWU A;  4BFR A;  5FK9 C;  4LNK A;  3AE2 B;  4NQL B;  1Y8R C;  3MP9 A;  2KVZ A;  2KFK B;  3QC8 B;  2G9H D;  1GTE A;  4YWG G;  3R66 C;  2K6Q A;  2LXC A;  2L7R A;  1R4N I;  1J19 A;  1OEY A;  4WWN A;  1FMA D;  2LVQ A;  2JX5 A;  3E9S A;  4OZB A;  1FNV A;  4NAW A;  2J0K A;  3L08 A;  2KTR A;  1QF6 A;  1OGW A;  1RFA A;  1R7S A;  1WXS A;  2BPS A;  2CS4 A;  2NMQ A;  2PE6 B;  3UQA A;  3ONS A;  2HJ1 A;  1XCT L;  3W9C B;  1V6E A;  1XCQ L;  2WU2 B;  1C76 A;  1UNS A;  1C77 A;  4NAM A;  1P9D U;  2A4Z A;  2K39 A;  1L6V A;  2OOB B;  1K50 A;  1YX5 B;  4P7I A;  2FUH B;  3PPA A;  1WGK A;  2SAK A;  4LJO B;  5HHD G;  1VR9 A;  4XWT A;  4CO7 A;  3T3N A;  3C19 A;  3ZIM A;  1F52 A;  1K51 A;  3PZ8 A;  1C78 A;  2KMC A;  3L17 A;  3FIL A;  5CX3 A;  2C7H A;  1R4M I;  3NRZ A;  1EF5 A;  3NY5 A;  4CYE A;  4DDG D;  3GZN B;  3Q69 A;  4ZOH C;  2ZW0 A;  5IN7 A;  4MSQ B;  4WJO A;  5IOI A;  3JYU A;  5C2T B;  1YX6 B;  3LB8 C;  2INP E;  1L0V B;  4URK A;  3T3O A;  2WGS A;  2R2O A;  2E6X A;  1EM7 A;  2HTH A;  2JRI B;  1YD8 U;  2H88 B;  1Q0W B;  3V3X A;  1N60 A;  4WWM A;  3TEZ A;  1J0G A;  2K8B A;  2RGF A;  1CJE A;  4HEA 1;  2EMT A;  1GJZ A;  2G4S A;  3TCA A;  1C3T A;  3AEC B;  2MBE A;  2GI9 A;  2LI5 A;  1D5Z C;  2WDR B;  2ZVO A;  1V1P A;  1FD6 A;  1OQY A;  1UH6 A;  1VZ6 A;  1ZDX A;  3TEX A;  4AOF A;  4AUQ C;  5HFY A;  4LDT D;  1B9R A;  3A9J B;  2LVP A;  3PHW B;  1RLF A;  1L4Z B;  4BZA A;  3NVV A;  2G45 B;  3NZS A;  1UUP A;  2XEW A;  3PVL A;  1NVI D;  3BZD B;  1WZ0 A;  5EE1 A;  3FKY A;  2WHI A;  2GLS A;  3ZUN A;  2AWT A;  3Q2A C;  2Z59 B;  2IGG A;  1GC7 A;  2KLC A;  3NZ3 A;  3NZU A;  2BS3 B;  1ZE3 D;  4HK2 A;  4RGN A;  1NI2 A;  5DCN A;  2WWZ A;  4XWW A;  4TSS A;  4D2K A;  2MBH A;  2YVC A;  3W1S C;  2MJ3 A;  2RPQ A;  3X0W A;  3AE9 B;  3GZN I;  2LGS A;  1TIF A;  4PYZ A;  3I3T B;  1HXY D;  1XLQ A;  3NUH B;  4HRO A;  2WXI A;  2FCM A;  3GOE A;  3NVW A;  1VDV A;  4RF0 A;  4F7Z A;  1ZGU B;  2Q5W D;  4NY0 A;  1UWM A;  4DXA B;  4KSK C;  4KV2 A;  2WXF A;  5EE0 A;  2JZZ A;  2JXT A;  4GOC A;  4GGQ A;  3RPF C;  2BVC A;  2IGD A;  5DPW A;  2PVO D;  2RD0 A;  2LJI A;  3H7P A;  3L13 A;  2QIE B;  2GOW A;  3AUL A;  3BYT B;  1V2Y A;  3PS6 A;  1Q5W B;  2DYB A;  3RNB C;  4ANU A;  1JWU D;  3KUC B;  4A3P A;  1X1M A;  1ISN A;  4P1C C;  3ZNG C;  4KZC A;  2W3R A;  5H8Y E;  3B2F A;  3PZ7 A;  3WA0 A;  4MEM A;  1F2R C;  3PTF C;  3T9L A;  2M1M A;  3DHI C;  4EKU A;  4LNO A;  4DK5 A;  1WXV A;  1QQR A;  3BVZ A;  3M95 A;  1VRA B;  1E7V A;  3WIM A;  3KVF B;  1LM8 B;  4M0W A;  2MLB A;  2V3N A;  3IVF A;  4ASW C;  4ICU A;  4HXD A;  4W9J A;  1PQS A;  4MH8 A;  2WXP A;  4BKG A;  1UZX B;  4WIP A;  3ZRF A;  2MRP A;  3DBH B;  2K8H A;  3EFC A;  4HWI B;  3AE4 B;  5LNK 1;  4NPN A;  4KDL B;  2PVG C;  3B0A A;  4RMA A;  1FRR A;  2IO0 B;  2HDE A;  2X38 A;  4N59 A;  2QJL A;  1AN8 A;  3A4R A;  1ZDV A;  4IC7 B;  2DYO A;  1ZXI A;  3AV8 A;  3E56 A;  4JWS C;  4RNA A;  1TKG A;  1N6Z A;  1TTN A;  3M62 B;  1KTK A;  1WR6 E;  4MM3 B;  3WAM A;  3ZXV A;  1P7F A;  2E3T A;  2IY0 B;  2KVR A;  4GLS C;  5L83 A;  1LGR A;  5GMV A;  2WXO A;  4IWP A;  1FEH A;  1NEK B;  2KC2 A;  4C4V A;  1EO6 A;  1ZOY B;  1WSP A;  3PGE A;  3TUO A;  3ZDT A;  3NG0 A;  2BYV E;  3ML8 A;  1FNW A;  2IO1 B;  3JW0 X;  3O13 A;  1V81 A;  4E74 A;  2KZR A;  2MCN B;  3UIP B;  1WH3 A;  1BT0 A;  3ZRC A;  2BB5 A;  3L0W B;  1QOG A;  4MGY E;  3MTN B;  3OLM D;  1YQB A;  4KDI C;  2IDY A;  1XLN A;  4YSX B;  4IKG A;  2WQY B;  1L0X B;  1TZO A;  2BF8 B;  2WDQ B;  1C4P A;  3AN1 A;  3ZW3 A;  2QMT A;  2MJD A;  2K1F A;  3DBL I;  2DYM A;  5BMH A;  1WGG A;  1Z5S B;  2J0J A;  4BAX A;  4GIV A;  1ROE A;  5KHO A;  1WGH A;  4MJS A;  1P3Q U;  1EF1 A;  2N1W A;  2J42 A;  1JW9 D;  4ZRQ A;  1PGB A;  5IA7 A;  2BKF A;  2KKC A;  1FPY A;  5CHF A;  2KTF A;  2O2V A;  4GU2 A;  1WFY A;  3RNC C;  3HUI A;  4S0R A;  4ANV A; 
#chains in the Genus database with same CATH homology
 1SXT A;  2J53 A;  2PTL A;  1XEE A;  4TQ0 A;  2AQ1 B;  4LLG M;  5E6J A;  2AX5 A;  1CQV A;  1JRP A;  1DOI A;  1KH0 A;  2KQ4 X;  1YN4 A;  3BVG A;  1VZ7 A;  3ZGZ A;  4RF1 A;  4YTP B;  2KAC A;  1XLO A;  4RGO S;  1D4B A;  4KKJ A;  3UI3 A;  4YSY B;  3W2D A;  1TY0 A;  1YJI A;  4ZHP A;  2WXM A;  1UWX A;  3KQ4 A;  1B1Z A;  4HKQ A;  2GRI A;  4ARI A;  2Z8L A;  1SB3 C;  1EWY C;  1D5X C;  4KX6 B;  2JQR B;  1PGA A;  1JWM D;  2JYT A;  4YSZ B;  3BII D;  3AE5 B;  1TKY A;  4ZRP A;  4MAC A;  3EA6 A;  3ZJT A;  5HG2 A;  2WXH A;  4MT5 A;  2RPV A;  1KLU D;  4JWU C;  2TSS A;  4YTM B;  3MFG A;  1ACC A;  1D6E C;  1FRD A;  2YEP B;  5AUI A;  1OQR A;  1CK1 A;  4RGM A;  4AQ7 A;  1FCL A;  2LHE A;  3H8H A;  2W3S A;  1J7A A;  3AE8 B;  1L5P A;  1BUI C;  1FIQ A;  2KMM A;  5EE9 A;  1K53 A;  1YN5 A;  4KGR A;  5C3J B;  2MEK A;  3EUB 2;  1JRO A;  2QEJ C;  3AEB B;  1F77 A;  3B9J A;  3R2I A;  4CQN A;  4ZYS A;  2RMM A;  1ET9 A;  3VR9 B;  2KWD A;  4ITK A;  5EE3 A;  2K0P A;  3EGR A;  4B0M A;  1TY2 A;  1N5X A;  1NYR A;  4J3O D;  4ARC A;  2WXR A;  1ZXH A;  2N0S B;  5AUK A;  1YJJ A;  2BYT A;  1FCC C;  2I2Y A;  2JWU A;  2KAJ A;  2AQ3 B;  3NS1 A;  5FK9 C;  1E10 A;  1SEB D;  3AE2 B;  4C80 A;  2V0G A;  2NTT A;  4A9A A;  3AED B;  1ZP0 B;  3I9V 1;  3MP9 A;  1OFF A;  3KWV A;  2G9H D;  1GTE A;  2JSV X;  3DWM A;  4YWG G;  1SJH D;  2JYE A;  2LHD A;  3AEG B;  2L52 A;  2BB6 A;  5H92 C;  3Q8A A;  3U52 E;  1FM0 D;  3R8B A;  1FMA D;  5G5G A;  1TS3 A;  3V05 A;  1DGJ A;  1YQ4 B;  1L0Y B;  4TQ1 A;  2BBC A;  2JX5 A;  3E9S A;  3KLS X;  3J9C A;  3AE7 B;  4A6Q A;  4OZB A;  4HKZ E;  1V1O A;  1FNV A;  4WAF A;  5BYR A;  1GOZ A;  4ZHO A;  1QF6 A;  3TEW A;  2PMV A;  1E0Z A;  1R7S A;  2ONQ A;  2NMQ A;  1XF5 L;  3N9Y C;  1IGD A;  1XCT L;  3W9C B;  1SJE D;  1TS2 A;  1XCQ L;  5HI1 A;  1KFY B;  2WU2 B;  1C76 A;  1UNS A;  1C77 A;  4NAM A;  2OHF A;  2V3P A;  1L6V A;  3IAS 1;  1RFK A;  1YQ3 B;  1K50 A;  1F2R I;  2LUM A;  1NEN B;  2Y5P A;  3ZJV A;  2J4X A;  3C8Y A;  1DOX A;  2ON8 A;  1MHX A;  1HZ5 A;  1WGK A;  2SAK A;  5HHD G;  4O1N A;  1VR9 A;  2DLB A;  3AE1 B;  4XWT A;  2KDM A;  3T3N A;  1VZ8 A;  1K51 A;  3PZ8 A;  1C78 A;  2JZP A;  1XLP A;  2M0A A;  3FIL A;  3Q8B A;  4HJG E;  3NRZ A;  1K52 A;  2N7J A;  2FE8 A;  3GP7 A;  5FR3 A;  3OWE B;  1D5M C;  3TSS A;  2BT6 A;  4C7Z A;  4GDK B;  5JXV A;  3Q69 A;  1XXG A;  2ZW0 A;  4ZOH C;  4DXF A;  4R3D A;  3ZJU A;  4UDU C;  4YTN B;  1I4Q A;  3HVD A;  3SFE B;  2XN9 C;  3CF4 A;  1QOB A;  2YEP F;  4P6V F;  4DXG A;  4A55 A;  5C2T B;  4US9 A;  1F0Z A;  2PIA A;  2WXQ A;  3ABV B;  3LB8 C;  4L2Y A;  2D5G A;  1MI0 A;  2DWQ A;  1UGJ A;  2INP E;  1MHH E;  1PDX A;  2IPK D;  1L0V B;  2R61 A;  1N63 A;  1ZPS A;  5I4D A;  1JAL A;  3T3O A;  3MC0 B;  2E6X A;  1EM7 A;  1SF0 A;  1H7W A;  1IBX A;  3GS2 A;  2H88 B;  3V3X A;  4PT5 A;  4H2A A;  1N60 A;  1IUE A;  4WWM A;  1QOA A;  3TEZ A;  3SR6 A;  1CJE A;  4HEA 1;  3IAM 1;  1V8C A;  4KGT A;  3AEC B;  2WXJ A;  1HZ6 A;  1N61 A;  1D5Z C;  2WDR B;  2GI9 A;  3SEB A;  3BK1 A;  3ETR A;  2BS4 B;  1V1P A;  1PUT A;  3AEA B;  4A90 A;  2WXN A;  1FD6 A;  1VZ6 A;  2J52 A;  1ZDX A;  2PKO A;  3TEX A;  1MPE A;  1ET6 A;  1GTH A;  2CU3 A;  2WNM A;  4NZL B;  1WXQ A;  5HFY A;  1B9R A;  1J7B A;  1I4P A;  2LEK A;  3VQI A;  4FXC A;  1L4Z B;  1HA5 A;  3NVV A;  1E9M A;  1VLB A;  1C4A A;  1UUP A;  1E7P B;  1NVI D;  3BZD B;  2B76 B;  2IGH A;  2MJE A;  5EE1 A;  3U2S C;  4Q2J A;  3URY A;  1WYG A;  2L1A A;  2NTS A;  2FBW B;  1PGX A;  2VZK D;  4WQM A;  3ZYY X;  1HQR D;  1BML C;  4USA A;  1KF6 B;  1V97 A;  3BYY B;  3MJ5 A;  2IGG A;  1ZUD 2;  3NZ3 A;  1HEZ E;  4EE2 A;  3VR8 B;  2BS3 B;  2KN4 A;  1ZE3 D;  2FUG 1;  5D3I B;  4RGN A;  4WH4 A;  4XWW A;  4TSS A;  3AM9 A;  4D2K A;  1MVK A;  3RFZ B;  1Y56 A;  3FAH A;  3LXF A;  2MJ3 A;  2L83 A;  4AS1 A;  3AE9 B;  2WXL A;  3NVY A;  2I38 A;  1HXY D;  1FFU A;  3AB5 A;  1SE4 A;  4OVZ A;  1SBB B;  3VRB B;  1GAQ B;  1XLQ A;  3NUH B;  2M56 B;  1GT8 A;  1I4X A;  4HRO A;  2WXI A;  4C56 C;  3NVW A;  1VDV A;  4WUR A;  4RF0 A;  3VRA B;  1RWS A;  1FO4 A;  2Q5W D;  2AQ2 B;  1UWM A;  4NAW B;  1XO3 A;  2WXF A;  1BXT A;  5EE0 A;  3WCQ A;  3P4Q B;  1YNT E;  2JXT A;  3NVZ A;  1M4V A;  3CWI A;  3RPF C;  3HRD D;  1TS5 A;  2IGD A;  4JPS A;  2PVO D;  2LJI A;  3AEE B;  2QIE B;  3LYY A;  3BK2 A;  4RCO A;  2LFI A;  4XDC A;  3U7Z A;  5TSS A;  3BYT B;  4US8 A;  3L4P A;  1RYJ A;  2JU6 X;  1JCK B;  3P1M A;  1JWU D;  1KLG D;  1SE2 A;  3BWU D;  1EWC A;  4OHJ A;  2L32 A;  1C4C A;  1JWS D;  1YN3 A;  2W3R A;  5H8Y E;  3B2F A;  3P42 A;  3PZ7 A;  3FIL B;  1A70 A;  1F2R C;  5D3D A;  1CZP A;  1STE A;  3DWG C;  1TS4 A;  5FKA C;  1I7H A;  3BVM A;  1L4D B;  3U4E G;  3W5U B;  1QQR A;  2XNA C;  3BVZ A;  1VRA B;  1LO5 D;  2V4I B;  2QIL A;  4LK0 M;  1DOY A;  1E6E B;  2LMC A;  3Q8F A;  1KRH A;  2IJ0 A;  4M0W A;  2V3N A;  1TKE A;  4RH6 A;  4XE0 A;  4MH8 A;  2WXP A;  4HRS A;  4XDD A;  1I4G A;  4WIP A;  3CIR B;  2QSD A;  1NI3 A;  3P63 A;  2PLP A;  3AE4 B;  1IBX B;  2Y5C A;  4N6E B;  5LNK 1;  3AMZ A;  3IT6 B;  4JE3 B;  2PVG C;  1TJE A;  1AWD A;  1FRR A;  4YT0 B;  1JWB D;  2K9X A;  1GB1 A;  4TMA B;  4A8X C;  2HDE A;  1JWA D;  2X38 A;  4OW0 A;  1GPX A;  2CJO A;  2RDH A;  4N59 A;  5BYQ A;  2QJL A;  2ACZ B;  4B0E A;  2BTE A;  1AN8 A;  1QKZ A;  3AE3 B;  1C9F A;  4YXD B;  4RFB A;  1V1P B;  2WXK A;  3W5V B;  2K22 A;  3P4R B;  3B2G A;  1ZDV A;  2WXG A;  2DYO A;  2MH7 A;  4C7Y A;  1ZXI A;  3AV8 A;  3E56 A;  4JWS C;  4RNA A;  1TKG A;  5BMG A;  1QIL A;  5G5H A;  1AW7 A;  3MHZ A;  1KTK A;  4MM3 B;  1WWT A;  1P7E A;  1QOF A;  2VZK B;  2SEB D;  1QLB B;  2BS2 B;  1QT9 A;  1P7F A;  2E3T A;  1JQ4 A;  4L1B A;  1FNU A;  4RGT A;  1EU4 A;  4GLS C;  3ZQ4 A;  5MPO A;  2EEL A;  4L23 A;  4OZC A;  4P16 A;  2WLB A;  2WXO A;  1FEH A;  1NEK B;  2LGI A;  4KKI A;  1VJK A;  2WP9 B;  3TEY A;  1FXI A;  2WU5 B;  5T8I A;  3W1S A;  2K5P A;  3SFD B;  2GB1 A;  1GB4 A;  1ZOY B;  3GB1 A;  1WSP A;  2DBY A;  1C79 A;  3TUO A;  4OZA A;  2W55 A;  1T5X D;  1FNW A;  4KGS A;  3O13 A;  2CJN A;  1H7X A;  1SE3 A;  2RDG A;  3Q8C A;  1PYW D;  2OED A;  3HVZ A;  1ENF A;  2BB5 A;  1QOG A;  1OQQ A;  2ICI A;  1I4R A;  2Y3A A;  4IDI A;  2IDY A;  1SIJ A;  1ESF A;  4NJC A;  4N58 A;  2INN E;  1XLN A;  4YSX B;  1N5W A;  2WQY B;  1FXA A;  1L0X B;  1TZO A;  3P4S B;  4IKG A;  2WDQ B;  1IGC A;  1RM6 C;  2W82 A;  1C4P A;  3AN1 A;  2QMT A;  4DQO C;  2WDV B;  2BW2 A;  2MJD A;  1EU3 A;  2DYM A;  1PFD A;  1SSN A;  5BMH A;  2M19 A;  1I4H A;  1L6U A;  2G1E A;  3PO0 A;  2W54 A;  1ROE A;  3KWL A;  2WS3 B;  1Q10 A;  1DYQ A;  3AEF B;  3AH7 A;  5GXG B;  1N62 A;  1AYF A;  3AE6 B;  2J42 A;  1T3Q A;  4GDL B;  1JW9 D;  3IT4 B;  2HTM E;  4LTU A;  4ZRQ A;  1PGB A;  5BYS A;  1YMH E;  1NYQ A;  2N9L A;  4IOI E;  1JML A;  2N9K A;  3R2T A;  2K3U A;  5D7G A;  3FC4 A;  1TYG B;  2PW9 A;  1WRI A;  3Q8E A;  4JX1 C;  3I57 A;  2ZW1 A;  1FFV A;  1J7C A;  3IXS A;  2H89 B;  3HUI A;  3P4P B;  5BMI A;  1T6B X;  2EKI A;  4REZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...