3QCAA

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords FAS-associated factor 1
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qcaA00
2R2QA 3ZNID 1L2NA 4DBGA 4HXDA 4LJOB 3M62B 4HVBA 4HCNB 4AOFA 2A4ZA 3M95A 2W9NA 2JVCA 2LUEA 4I6NB 4WQOB 1T0YA 1YD8U 2KMCA 2N7DA 3ML8A 2EMTA 4P7IA 1V86A 4KSLC 2CHZA 2CR5A 3UQAA 4WJPA 4DHJB 1FXTB 2GMIC 4IM3A 3ZDMC 1WE7A 4JQWC 3BY4B 1WXSA 3WAMA 1Y8RC 4G11A 4MDKE 4MGZE 4W9GA 1WMHA 4FHKA 4XX5A 2YLMA 3PHWB 4IC7B 2KWCA 3V62A 5J17A 4KIKB 2LXAA 3DQVA 3QAQA 4EZJA 1J8CA 3W1SA 2M4NA 4MGIE 5G2NA 2O6VD 4GDKA 2KFKB 3PZDA 4NPNA 2MBQA 4B9KA 2HD5B 2NR2A 4CO7A 4IWPA 2J7QB 2KDBA 2NBVB 2IO1B 2FCSA 3AI5A 2EMSA 3NS8A 4BBNF 2AEHA 3QA8A 2L0FA 2KTRA 4II3B 5D94A 4MEMA 2ZJDA 3IHPC 3B0AA 3K9PB 2FNJB 1GC7A 1KM7A 2LJ5A 3QQ8B 3SU8X 2MP2A 1V9JA 4W9FA 2RPQA 3A33B 1IYFA 4ICVA 3I3TB 4DHJD 2C7NB 1JRUA 3TIXA 3A4SC 2BPSA 2WX1A 4J6IA 1WIAA 4ZRIA 3RCZA 1OEYJ 4NJ7A 3V6EB 1WJNA 3H7PB 2KDIA 3C0RB 2J0JA 3A9KA 4W9JA 5D6JB 3L16A 3UGBB 4ANUA 1ZGUB 1WZ0A 2MP2B 3O65B 4JGHB 4PYUA 3ML9A 4BOZB 3QIJA 4NNJB 2QHOA 1Q0WB 2KXJA 4IUMB 2BGFA 2V4LA 1R4NI 2V1YA 4GB9A 1YIWA 4GDLA 1U4AA 3Q3JA 4LDTB 2Z0DB 4HCPB 1WZ3A 4IWQA 3ZTDA 2LRWA 4AJWA 2VRRB 2Z59B 3DBHI 5JZEB 4XZ4A 3TMPB 2Z0EB 3QCAA 3PS6A 5JHAA 1NI2A 3QWZB 1GC6A 2N1WA 2C7MB 3K9OB 4WWPA 4E71A 3W1YA 3KUZA 3PRPB 2D3GA 4KIKA 1V80A 2K8CA 3ZLZA 2FIFA 2A5UA 3DVNU 2KANA 2XK5A 2MSED 3R7RA 5LXIB 3NHEB 4N9F4 2KJRA 2AL3A 4GOCA 4B95A 3UINB 1LXDA 1WRDB 2LGXA 2LRUA 3HHMA 3WANA 2KO3A 2L7RA 2ZNVC 2D2QA 2KTRB 1TGZB 2KDFB 2NBUA 2I1KA 3AXCA 2IO0B 3DCGA 1E5WA 2G4SA 4HDOA 4MSMB 1YQBA 4DK5A 1WYWB 2O6VB 3CSTA 5JHBA 2KVRA 1IP9A 4E3CA 2KWUB 5BO4B 2IO2B 1AARA 4BKSD 4EUTA 3HM3A 1C1YB 1WR6E 4ANVA 1KJTA 3BINA 1ZW7A 2WYQA 2DZMA 1MG8A 3KH0A 4JIOU 3EFUA 2PJHA 2ZNVB 3APFA 2JPHA 1E90A 2NVUI 4EZLA 1V5OA 2JZ3B 1UBIA 4HPLB 3OJ3A 5E6PA 3VH3B 2KTFA 2MW5A 3VTWA 3L0WB 1VD2A 5DPTA 2IYDB 2HE7A 1UH6A 3IVFA 2OOBB 1P3QU 2GBNA 1WGHA 1V5TA 2FCQA 2PE6B 2RSUA 4HJKA 2LASA 3VVWB 1YJ1A 1TZ1A 2DX5B 4W9HA 3UF8A 1RFAA 2LVQA 4DDGD 3APDA 3R66C 4A20A 2CKHB 4TUUA 4M8NA 4IM2A 1H4RA 4EKUA 3OAWA 1E8YA 1J19A 2HTHA 2K6DB 3ZW3A 4IM0A 2WDTB 4NQLB 3DVGY 4KDLB 1WR1A 4FHJA 1RAXA 1SGHA 3AULA 3VUYA 1EUVB 3PHXB 3JYUA 1WX7A 2C7HA 4KZ0A 2K25A 3PRZA 2L0TA 4K1RB 2DHZA 2DAFA 4B6WA 3U8ZA 5CTRC 1G6JA 4K81A 3RZFA 4ANXA 3V61A 4ASWC 3RUIB 2BKRB 1WGGA 1LM8B 2KD0A 2D11A 2KX0A 2RR9A 2V3SA 3ENEA 3JVZX 4WJOA 2LVOA 1L7YA 1WXAA 3WAOA 4KZCA 4CHKA 4RM8A 1WXMA 4DXAB 1YX5B 3EHVA 4MM3A 4RMAA 3LDZE 3ZVVA 2RD0A 3L13A 1UBQA 4PS8A 1WF9A 2KNBA 4GDKB 3RULA 2ZZPB 2GOWA 4LDTD 1P9DU 2D10A 3VXWA 4M8MA 3DBRI 1ZKHA 4ANWA 1EO6A 2ASQA 5TR5A 3ZDTA 1NBFC 2JRIB 3PREA 5AZFA 2MBEA 3DVGX 3QC8B 2KJHB 3ZRCA 4MELA 3HM6X 1D3ZA 4G3XB 2HJ8A 4DWFA 2FUHB 3APCA 2KK8A 1V2YA 2DYMA 1GUAB 2AYOB 2LD9A 2R2OA 5AZGA 3SHQA 3UIOB 4FA6A 5AEKB 4GIVA 1ISNA 1E8XA 2IY1B 5D7GA 4BKTA 5L95C 1PQSA 2LZ6A 1Q1OA 1SIFA 3ECIA 4GN1A 5DCNA 3A9JB 4F7ZA 4GU2A 3R7QA 4WWOA 1UELA 5IA7A 2ZEQA 1WE6A 5E6NA 3EC8A 4NAWA 3KUCB 3A4RA 1IPGA 5KHQA 2MA9B 4ZRJA 2L3ZA 1XD3B 5IAAC 1QZEA 4MJSA 4G50A 1GJZA 1KOTA 2C5LC 1LFDA 2NPTA 3ZTCA 2O2VB 1X1MA 2BYVE 4GGQA 3VAWA 3A9JA 5CHFA 1P1AA 1OQYA 2KJ6A 3KUDB 4F1SA 1S1QB 3IG3A 4JL9A 1WM2A 1WY8A 2UYZB 2MX2A 3N3KB 2C60A 4W9EA 4W9DA 3N32A 3L10B 1M94A 2KFJA 4FJYA 2LGYA 2KOXA 4JLCA 2BF8B 2FIDA 3X0WA 2BKFA 4EZKA 3WALA 4PYZA 3GOEA 2WX0A 2BWFA 4ZYNA 4OVVA 3VQIA 1A5RA 2KC2A 2JZZA 3PLVA 4K7WA 3NY5A 2KZRA 3A1QB 2L00B 3KVFB 3QHTA 4MJSB 3KW5B 2MQJA 1WJUA 2DENB 3MJWA 1WX9A 2M8SA 2PPHA 3DVNV 3DPDA 2MBHA 3NOBA 5E6OA 1SE9A 1YX6B 1S3SG 3L17A 4TQ1A 1Z2MA 3A1QA 3ONSA 5J2RA 4FADA 4LCDE 2G3QB 2LI5A 2G4DB 3WA0A 4FBJB 2XEWA 2BYFA 3QJZA 1GG3A 1RRBA 3IBEA 2JF5A 2L76A 2FCMA 4BOSC 5C1ZA 1P0RA 2GBJA 3PSEB 4K7UA 4BKGA 2FAZA 5D2MB 2L8JA 3DBSA 4HK2A 4DDID 4HWIB 3D32A 3A9KB 4KV2A 2NS5A 3H7PA 1WJ4A 2ZVNA 2JT4B 2O2VA 3VFKA 3LJ3A 4IG7B 2NPTB 4KSKC 2DYOA 3PVLA 2MBBB 5DPSA 1UZXB 4MSQB 2IY0B 1WFYA 2K1FA 4WAAA 4W9LA 4EOYA 1C3TA 5DPRA 3PGEA 5GMVA 3P2BA 3PV1A 4EEWA 1F9JA 3B08A 3QX1A 2KLGA 4IWOA 4WWNA 2GBRA 4IW0A 2N4FA 2K6QA 4DHZB 1WI0A 3CSFA 3RZWC 3H7SA 2FCNA 2N9XA 3L54A 2DZIA 2ZCCA 1E8WA 1E8ZA 4NQKE 4ZRKA 3VTUA 5JH5C 5C23A 4II2B 3EECA 2B3AA 5FR6A 4PS3A 1GNUA 4BFRA 3JSVA 3VHTC 4W9CA 4ICUA 2ZVOA 2WWZA 3M63B 3X23A 2MWSB 2G45B 3TCAA 2KWVB 4XC2A 4BVUC 1EF1A 4FN2A 3GZNI 4AP4C 1RLFA 1H8CA 3V6CB 2Y5BB 2OJRA 3PT2B 3VUXA 1WJ6A 4HLEA 4BBNC 1V49A 1I35A 3ZNZB 2CHWA 3CMMB 3ZRFA 2I1JA 4FULA 3T8MA 4BKSA 2IO3B 4PS7A 2JXXA 1TBEA 4MGKE 4A3PA 5G55A 1XQQA 3H1UA 4FLHA 1WXVA 4MGYE 2N9PC 4WJNA 4ZDVA 2GBMA 2J0KA 3MTNB 2O6VA 2NBWB 3TL5A 2MLBA 5AZHA 1V81A 2PE9A 2UWQA 3RYTA 3DOWA 4OVUA 4YL8A 3PTFC 4K7SA 1Q5WB 5HKHA 4KVGB 2ZPYA 1XT9B 5KHOA 4AJYB 4G0NB 3HK0A 1VCBA 2BYEA 1E7VA 3VTVA 4E74A 4DHZE 3SDLC 2KKCA 2YVCA 2KHWB 1R4MI 1LQBA 4GXBA 5J18A 5EDSA 2RGFA 2L05A 1Z5SB 3W1SC 2KLCA 3WAPA 5L83A 3VH4B 4GDLB 3ZNGC 1NDDA 3H9DA 3OLMD 2JUOA 2JWZA 3NZUA 2MBOA 5LLIA 2CHXA 2N1VA 3UIPB 1E7UA 2EKEC 2LGDA 1OTRB 1V6EA 3T9LA 5LXHA 3PRMB 1WM3A 2M1MA 1WGRA 4AWJA 2K8BA 3L08A 4NY0A 3H6NA 3OJ4B 3UQBA 2DAJA 3AU5A 5CHVC 1CMXB 4URKA 2KDEB 2REXA 3JW0X 3N30A 3S2AA 2BWES 2CS4A 1OEYA 2XK5B 2ZCBA 4I6PA 4LJPB 1I42A 2AWTA 2PEAA 2JY6A 4TV3A 3ALBA 1K8RB 3AU4A 2MCNB 2D07B 4EFOA 2DZKA 2LVPA 2M17A 3PLUA 5DPWA 2KFKA 4TKNA 3JSVB 2KMAA 3KYDD 2JRHA 4GMVA 5CHWA 4NAWB 2IBIB 2KQSA 3RT3B 4NJ6A 4TQ0A 2KC1A 3QARA 1UGMA 3V60A 4GSWA 3U30A 4HPMB 2GBKA 5CX3A 2AL6A 2N7EA 3M3JA 2K39A 4M0WB 3ZO5B 4W9KA 4F8CB 2N9EB 3CF6E 1EF5A 3NZSA 3QK0A 3SD5A 4AUQC 3Q3FA 4I6LB 3PPAA 1HE8A 2NCNA 2XBBC 2LXCA 4W9IA 1TTNA 3B1LX 2KQ7A 2MRPA 3R3MA 3MHSD 3ZIMA 4A3OA 3HIZA 4HDQA 1WMHB 2K8HA 1J0GA 3DBLI 4RM9A 4FJZA 1P98A 4X57B 2M0XA 2LWPA 2DZJA 2ZPNA 4KDIC 4MH0E 4WJQA 1WH3A 3TBLD 1OGWA 3TJPA 3ZKJC 1KLVA 3U7DA 1UD7A 2CU1A 3ZNHB 2IZVB 2KN5A 1BT0A 1WGYA 1WGDA 3KYCD 2DYBA 3IFWB 2KX3A 4FJVB 3WIMA 4CYEA 2J0MA 2C9WB 3ZUNA 3RD2A 3DDCB 3VDZA 3VUWA 1WX8A
chains in the Genus database with same CATH superfamily
2R2QA 1EWCA 4WURA 3AEGB 4DBGA 4HXDA 4LJOB 4HVBA 2LUEA 4WQOB 1YD8U 4XE0A 2KMCA 3ML8A 1V86A 3L4PA 4KSLC 1FXTB 1I4GA 3BYYB 3DHHC 3CWIA 1F52A 1KFYB 3BY4B 4YSYB 1Y8RC 1IBXA 4KIKB 1SXTA 1MJDA 3J9CA 2JWUA 5G2NA 2O6VD 2KFKB 1N6ZA 4B9KA 2HD5B 2EMSA 2V3NA 2ZJDA 1JWSD 2G1EA 2MP2A 3A33B 2L1AA 3I3TB 1XCQL 2C7NB 4YSXB 3AE5B 3TIXA 5IKCM 2IGDA 4NJ7A 2ONQA 2KDIA 3C0RB 3A9KA 4W9JA 4PYUA 3ML9A 3QIJA 1Q0WB 2KXJA 2V4LA 2RPVA 4HCPB 2W3SA 4AJWA 2VRRB 1V1OA 1K51A 4XZ4A 5T8IA 1NI2A 2N1WA 3N20C 2C7MB 4E71A 4RH6A 4Q2JA 2NMQA 2KANA 2XK5A 3R7RA 5LXIB 4LLGM 2XN9C 2HDEA 2JQRB 1F2RI 2LRUA 3R2TA 2L7RA 2ZNVC 2KTRB 1TGZB 2KDFB 4MSMB 5IN7A 2QC8A 5JHBA 1AARA 3B2FA 3EFUA 3APFA 2FE8A 3N1YC 2JPHA 1E90A 1V5OA 2JZ3B 2WXFA 1FCLA 1VD2A 4J3OD 2KACA 2OOBB 4KGTA 1P3QU 1L0YB 1SE3A 2PE6B 2RSUA 1KLGD 4H2AA 2M0AA 2DX5B 3UF8A 4KGRA 4ARCA 1ROEA 1C4CA 1MPEA 3R66C 2CKHB 4TUUA 4EKUA 1TKGA 1J19A 2K6DB 2KMMA 4IM0A 1LO5D 4NQLB 5FR3A 3GE8C 2NTSA 4FHJA 2V9HA 1CQVA 2WXNA 1XCTL 4B6WA 1ZDXA 2LMCA 5CTRC 3SFEB 1XO3A 3MC0B 1HZ6A 2VH1A 4YTMB 1AYFA 4R3DA 1WGGA 1UWXA 2XNAC 2V3SA 4RFBA 3ENEA 4KZCA 5BMIA 3SFDB 1YX5B 3BK1A 4RMAA 3Q14C 3N9YC 2D10A 2MH7A 3VXWA 2INCC 1GPXA 3IAS1 1R4MB 1QOAA 3BK2A 1UNSA 3QC8B 1PGAA 4MELA 3HM6X 5MPOA 2PVOD 1RFKA 1V2YA 2AYOB 3AEDB 1QOBA 4N59A 4USAA 4OHJA 4XWWA 4C4VA 1ISNA 1QQRA 1T3QA 3ECIA 2BB5A 1HA5A 3IAM1 3TSSA 2EELA 3TEZA 1UELA 1WE6A 1JMLA 3KUCB 2MA9B 5IAAC 3HVDA 2NPTA 1LFDA 1L0VB 2O2VB 3A9JA 5CHFA 4ZHPA 1ESFA 1WY8A 4LNKA 4US8A 4W9DA 2FIDA 2BKFA 3GOEA 4ZYNA 1VZ6A 4HROA 2L52A 2WXQA 2Q5WD 2KC2A 2J4XA 1JWUD 3QHTA 5HI1A 4KKIA 3N1ZC 1MHXA 2PPHA 1SE9A 4C7YA 3ONSA 3FC4A 2LI5A 3WA0A 1IGDA 3DBHB 5HFYA 2FCMA 2QSDA 4RCOA 2GBJA 4BKGA 2OEDA 2DNFA 3A9KB 1STEA 2GRIA 3HVZA 4NJCA 3PVLA 1UZXB 2IY0B 1WFYA 2K1FA 4WAAA 4PT5A 2M19A 2VZKB 3T3NA 3PV1A 4P1CC 2KYWA 1PUTA 1YN3A 4AS1A 2KLGA 4WWNA 3PO0A 4IW0A 2N4FA 3PZ7A 4S17A 2ZCCA 1E8WA 4NQKE 4ZRKA 5JH5C 1GNUA 4OZBA 3VHTC 4ICUA 1V1PB 2G45B 4XC2A 4BVUC 2R61A 4AP4C 1ET9A 1AW7A 1JWMD 4ZHOA 2CHWA 3CMMB 2JXXA 3GP7A 2D3AA 4K3CA 4FLHA 2GBMA 2O6VA 1MI0A 1V81A 3P42A 3NVVA 4WQMA 1XT9B 5KHOA 5G5GA 4HKQA 3VTVA 1VCBA 1E7VA 4DHZE 3SDLC 1DOXA 4A90A 1K50A 4GXBA 5EDSA 2LGSA 4OVZA 2IGHA 4KKJA 2MHJA 3VH4B 4YTNB 2D5GA 3ZNGC 1NDDA 3OLMD 4REZA 3NZUA 3Q2AC 2MBOA 5LLIA 2CHXA 1E10A 2K5PA 4IOIE 2PVGC 3PRMB 1WM3A 3GE3C 5EE0A 4NY0A 3H6NA 1CMXB 4MT5A 3S2AA 2BWES 1WYGA 2CS4A 2ZCBA 3NRZA 4D2KA 3B2GA 1OQQA 3I5JC 1E0ZA 4M0WA 2M17A 3KYDD 2JRHA 2PKOA 4GMVA 1WXQA 3QARA 1UGMA 2V4IB 4HPMB 5CX3A 1FRRA 1HQRD 2N7EA 2K39A 3ZO5B 3Q3FA 4I6LB 3PPAA 1HE8A 4ITKA 2MRPA 2GB1A 4A3OA 2W82A 3DBLI 4RM9A 4FJZA 2ICIA 4MH0E 4US9A 5TSSA 4MACA 1OGWA 1UD7A 1NYQA 2IZVB 3BWUD 4MM3B 2DYBA 2KX3A 2J0MA 3RMKC 3IG3A 3ZNID 1MHHE 2AQ2B 4HCNB 4AOFA 2A4ZA 2W9NA 2JX5A 4I6NB 1LGRA 2WHIA 1CJEA 4BAXA 3UQAA 1C4PA 1V97A 4JWSC 2MJEA 3ZDMC 4JQWC 4P6VF 4ZRQA 4ZRPA 4MDKE 4MGZE 1WMHA 4XX5A 4JWUC 4IC7B 3PHWB 3V62A 2KWCA 3DQVA 3W1SA 1T5XD 2M4NA 2BS2B 5AUIA 4ZYSA 2MBQA 2NR2A 2WXIA 4IWPA 2IO1B 3QA8A 2L0FA 2KTRA 2HJ1A 4MEMA 3I57A 2V3PA 2LJ5A 3SU8X 4W9FA 1IYFA 4DHJD 1JRUA 2WX1A 1WIAA 4OW0A 3RCZA 1R4NB 3H7PB 5D6JB 3UI3A 1ZGUB 3O65B 2DLBA 4YSZB 1R4NI 2V1YA 4GB9A 4GDLA 1CK1A 1OFFA 2Z0DB 4IWQA 1GOZA 2LRWA 2Z59B 2ACZB 2RDBC 1KTKA 2Z0EB 2WU5B 1J7BA 4HEA1 2BVCA 2D3GA 1FEHA 2BS4B 5H8YE 2MSED 2Y3AA 3NHEB 5IO9A 4GOCA 2JYEA 1WRDB 4AQ7A 3AXCA 2D2QA 2I1KA 1EU3A 3CSTA 3U2SC 5BO4B 4IKGA 1TY2A 3HM3A 3AM9A 1WR6E 3BINA 2DZMA 4JIOU 2JU6X 2PJHA 2NVUI 4EZLA 1PDXA 2QILA 3KWVA 3VH3B 2YEPF 2JYTA 1UH6A 5C3JB 1XLQA 2BBCA 2FCQA 4YWGG 1D6EC 4OZCA 3VVWB 3AMZA 2LVQA 1VZ8A 1QLBB 4M8NA 5LNK1 3OAWA 3EGRA 2HTHA 1XXGA 3DVGY 2J42A 1WR1A 3MC8A 4KZ0A 2X38A 1FIQA 1V1PA 2GLSA 1G6JA 4LNOA 5JXVA 3V61A 3RUIB 2D11A 1JQ4A 4WJOA 1YJIA 2LVOA 4CHKA 1WXMA 3GS2A 4MM3A 3ZVVA 3L13A 4C56C 4B0MA 3LXFA 2CJOA 1FNVA 3AE3B 1TT5B 2E6XA 1PYWD 4M8MA 3ABVB 2WP9B 5TR5A 3ZDTA 2JRIB 5AZFA 3NS1A 1D3ZA 2HJ8A 2FUHB 3APCA 3BYTB 2DYMA 3SHQA 5AZGA 3UIOB 3V05A 1TY0A 4XDDA 3EA6A 2IJ0A 1E8XA 2IY1B 3Q8AA 5D7GA 5L95C 2LZ6A 1SIFA 1XF5L 5DCNA 3A9JB 3DHGC 5E6NA 3EC8A 3FILA 5IOIA 4ZRJA 2PIAA 4G50A 1GJZA 2C5LC 1OQYA 4F1SA 1S1QB 3RPFC 1OQRA 4JL9A 2M56B 3N32A 4FJYA 2KFJA 4DXGA 2LGYA 2KOXA 3X0WA 1SSNA 1PGXA 2BWFA 4IDIA 1BXTA 3P4RB 5GXGB 2RDGA 1PGBA 1YJJA 3AEAB 2BYTA 1WJUA 1TKYA 2B76B 1WX9A 3RN9C 2M8SA 2QIEB 3URYA 1S3SG 3L17A 3MFGA 3R8BA 3CIRB 1N5XA 4HKZE 5H92C 3NVWA 1GG3A 1RRBA 2L76A 1DGJA 4ARIA 2L8JA 2QCZA 3DBSA 1QF6A 3DBLB 1YQ4B 1WJ4A 2ZVNA 2O2VA 1JROA 3LJ3A 4IG7B 3VFKA 1DOYA 1KH0A 3R2IA 4JE3B 5DPSA 4MSQB 1C3TA 3MC9A 1C79A 4EOYA 4W9LA 4YTPB 3Q3NC 5GMVA 1EM7A 3B08A 3IT4B 3QX1A 2GBRA 2WDVB 4DHZB 3RZWC 3AE8B 1N61A 5C23A 1HTQA 3JSVA 3TUOA 4W9CA 1HEZE 3X23A 3TCAA 5BYRA 4FN2A 3GZNI 1RLFA 1H8CA 1FRDA 2Y5BB 1P7EA 1QILA 3PT2B 4HLEA 1I35A 3ZGZA 1QOGA 3H1UA 3MHZA 4WJNA 2WDQB 3TL5A 2MLBA 1ZP0B 2PE9A 2BS3B 4OVUA 4YL8A 4MH8A 1Q5WB 2ZPYA 4AJYB 3HK0A 2BYEA 1L4DB 2MJ3A 2YVCA 1LQBA 2IGGA 2I2YA 3WAPA 3H9DA 1C4AA 1ZOYB 3TEWA 2WXHA 2N1VA 1E7UA 1OTRB 2DWQA 3ETRA 1WGRA 3MJ5A 2PMVA 4AWJA 3L08A 1HTOA 3OJ4B 5EE3A 5IP4D 2IDYA 2KDEB 1I4PA 1I42A 2V0GA 4I6PA 2AWTA 2PEAA 2JY6A 4TV3A 2AX5A 4WAFA 2YEPB 3RNFC 3JSVB 2KMAA 4NAWB 3H8HA 2IBIB 2KQSA 4JX1C 3O13A 2LJIA 2VZKD 4A6QA 3M3JA 2N9EB 1EF5A 3NZSA 3RNBC 2WXGA 4AUQC 1XLNA 2XBBC 2LXCA 4W9IA 2K3UA 3R3MA 3HIZA 4WH4A 2K8HA 1UUPA 1FCCC 1F77A 1R7SA 2LWPA 2BQQA 4YT0B 1J7AA 3TBLD 1KLVA 2KN5A 1BT0A 1WGDA 1FM0D 3OG5A 3VRBB 1TS3A 4FJVB 3KLSX 3ZUNA 3DDCB 1FD6A 3AH7A 1L2NA 5E6JA 4N6EB 3M95A 2JVCA 2N9KA 2EMTA 1I7HA 2CR5A 4DHJB 3NUHB 2GMIC 1WXSA 3Q69A 4FHKA 4XGAB 3LYYA 2LXAA 3QAQA 3Q8EA 1QOFA 1J8CA 1VJKA 2PW9A 4GDKA 1IBXB 1N63A 4NPNA 3BIID 2CU3A 3NS8A 2NBVB 4BBNF 1KRHA 3AV8A 3Q8FA 3TEXA 1E9MA 5D94A 3N1XC 3B0AA 1KM7A 3QQ8B 3ZJVA 3EFCA 2RPQA 5HHDG 4ICVA 4WWMA 5I4DA 2WLBA 4ZRIA 2BPSA 4J6IA 1OEYJ 3V6EB 2J0JA 4ANUA 3L16A 2MP2B 4JGHB 4BOZB 4HRSA 4NNJB 1YIWA 1U4AA 2OJWA 5D3IB 3DBHI 2K22A 5EE1A 5JZEB 2FBWB 3QCAA 3PS6A 1PFDA 3QWZB 1CZPA 4WWPA 3W1YA 3KUZA 3PRPB 1YMHE 3P4SB 4KIKA 1V80A 2K8CA 1TJEA 1KF6B 1SB3C 2TSSA 1DYQA 4XWTA 4N9F4 2KJRA 3UINB 1LXDA 5FK9C 2MEKA 4A3PA 4ACFA 3DCGA 4DK5A 4HDOA 1E5WA 1YQBA 2H88B 1WYWB 2H89B 2O6VB 1F0ZA 4BKSD 4EUTA 1C1YB 1KJTA 1ZW7A 3KH0A 1NVID 2WS3B 4HPLB 3OJ3A 5E6PA 2KAJA 1T0RC 2MW5A 2AQ3B 2WXMA 3VTWA 3OWEB 5DPTA 4DQOC 2HE7A 1WGHA 1F2RC 1WSPA 1TZ1A 3AEFB 3ZXRA 2X8XX 3AN1A 4W9HA 2LHDA 4DDGD 3APDA 1ZXHA 4UDUC 4LTUA 3ZW3A 2WDTB 4KDLB 3P1MA 1EUVB 3PHXB 2KVZA 1WX7A 1V8CA 3W5UB 2DAFA 3SR6A 3RZFA 4ANXA 4ASWC 2KN4A 4RNAA 2KD0A 2KX0A 3JVZX 1L7YA 1WXAA 4RM8A 1TS4A 2RD0A 2JSVX 1UBQA 4PS8A 4GDKB 2DBYA 4ZOHC 2ZZPB 4LDTD 3DBRI 2AQ1B 4K3BA 4ANWA 1EO6A 2ASQA 1NBFC 3Q8BA 3PREA 1QT9A 3ZRCA 2WU2B 4DWFA 1VZ7A 1J7CA 2R2OA 4B0EA 4FA6A 4O1NA 5AUKA 1ZUD2 5AEKB 1FO4A 4GIVA 1Q1OA 1RYJA 4GN1A 3VRAB 4F7ZA 1TS2A 3E9SA 4GU2A 4RGTA 1GB4A 1B1ZA 1N60A 4NAWA 3A4RA 2L3ZA 4NZLB 1QZEA 4BZAA 1UGJA 4MJSA 1NI3A 3AE7B 1VR9A 4A55A 4GGQA 1P1AA 2KJ6A 3KUDB 4GLSC 4A9AA 1WM2A 2UYZB 3N3KB 1C78A 3LB8C 3L10B 4JLCA 1UWMA 4EZKA 1B9RA 1MVKA 2WX0A 4OVVA 3VQIA 1A5RA 3ZQ4A 2JZZA 3W2DA 2KZRA 3A1QB 3KVFB 4MJSB 4KGSA 3KW5B 2MQJA 2DENB 3MJWA 1BMLC 2Y5PA 2GI9A 3NOBA 1YX6B 4TQ1A 1Z2MA 3A1QA 5J2RA 4LCDE 2WXOA 2E3TA 2G3QB 4FBJB 4C00A 2BYFA 3ZJTA 3IBEA 2JF5A 2ZW0A 1TZOA 3PSEB 4K7UA 5D2MB 4HWIB 3VR8B 2NS5A 2JT4B 1SE4A 2NPTB 4EE2A 3RNGC 2DYOA 2LEKA 1VRAB 3P2BA 4LNIA 5HG2A 4IWOA 2N0SB 4RGOS 1JWBD 1WI0A 2LGIA 3H7SA 2DZIA 1E8ZA 2BTEA 3VTUA 1IUEA 4II2B 3EECA 2B3AA 4PS3A 4M01A 4P1BC 2WWZA 3M63B 4N58A 4P16A 2MWSB 1SEBD 2KWVB 1TIFA 1ENFA 3V6CB 1SE2A 1V49A 3ZNZB 3WCQA 2N9LA 4BKSA 2IO3B 4PS7A 1TBEA 1TS5A 1WXVA 2CJNA 1L6VA 2N9PC 3NVYA 1JRPA 5AZHA 3RYTA 3DOWA 3PTFC 5HKHA 4RGNA 4E74A 2KKCA 2KHWB 1R4MI 2J53A 4XDCA 2RGFA 1AN8A 2WXKA 2KLCA 3U52E 1E7PB 5BMGA 2JZPA 3P4PB 1NEKB 3UIPB 3BVZA 2LGDA 5LXHA 1YQ3B 4RF0A 1FXIA 1UF0A 5CHVC 2REXA 4LJPB 1OEYA 2XK5B 1YN5A 1K8RB 4EFOA 2RDHA 2DZKA 3PLUA 1L0XB 4RGMA 1YN4A 3AB5A 4TKNA 3RNAC 1XLOA 2BT6A 1IGCA 2MJDA 2LFIA 3U30A 1D4BA 4S0RA 2GBKA 2AL6A 1I4XA 2INNE 1L6UA 1IP9A 3QK0A 3SD5A 2NCNA 1TTNA 3B1LX 3E56A 1BUIC 4HDQA 1WMHB 2BW2A 1P98A 2M0XA 3HRDD 1XLPA 3ZKJC 2LUMA 1A70A 3ZNHB 2JXTA 4HPPA 1EWYC 2D3CA 2C9WB 2D3BA 3RD2A 4KX6B 3VDZA 1WX8A 1P7FA 1ZPSA 3FILB 2BB6A 3M62B 3KWLA 1JCKB 1ET6A 4L2YA 1T0YA 1D5MC 3NVZA 2N7DA 4XYCA 4P7IA 2CHZA 4WJPA 3Q8CA 4WIPA 4IM3A 2NTTA 1WE7A 1WGKA 3WAMA 4G11A 1TKEA 3BVMA 4W9GA 1RWSA 1WWTA 2YLMA 1SJHD 3PZ8A 5J17A 4EZJA 4MGIE 1K53A 1AWDA 1FFUA 2QJLA 3PZDA 4CO7A 2J7QB 2KDBA 3AI5A 2FCSA 1HXYD 1T0SC 3C19A 1NYRA 2AEHA 4II3B 4LNFA 3IHPC 1WRIA 3K9PB 2FNJB 1GC7A 5G5HA 1V9JA 3FAHA 4OZAA 3A4SC 1C76A 1WJNA 3UGBB 1WZ0A 1FFVA 2INDC 2QHOA 4IUMB 1ACCA 1VLBA 2BGFA 2SAKA 2UU7A 3Q3JA 4LDTB 3AE2B 3ZTDA 1WZ3A 5BYQA 3TMPB 1QKZA 5JHAA 1GC6A 2WXLA 1XEEA 4FXCA 3K9OB 1D5XC 3ZLZA 2FIFA 2A5UA 3DVNU 2W55A 2QMTA 1Q10A 2OHFA 2AL3A 4B95A 3Q3MC 2LGXA 3HHMA 2EKIA 3WANA 2KO3A 3SEBA 2NBUA 3HUIA 3BVGA 2IO0B 2G4SA 2G9HD 1JWAD 2KVRA 4E3CA 2KWUB 3DWMA 3GZNB 2IO2B 4QAYA 4ANVA 2WYQA 3I9V1 1MG8A 2WQYB 2ZNVB 3RFZB 3C8YA 1L4ZB 1UBIA 2KTFA 3L0WB 2IYDB 3IVFA 2GBNA 3NG0A 1V5TA 4LNNA 4HJKA 2LASA 1YJ1A 1RFAA 2QEJC 2QDFA 4A20A 4IM2A 1JALA 1H4RA 2KDMA 1E8YA 3AEEB 2K0PA 1RAXA 1SGHA 3AULA 3VUYA 3AEBB 3JYUA 1ZDVA 2C7HA 2K25A 3PRZA 2L0TA 4K1RB 2DHZA 3U8ZA 5FKAC 4K81A 2W3RA 1Y56A 2BKRB 1SBBB 1LM8B 2RR9A 3ZYYX 2HTME 3WAOA 1FNUA 1SJED 3DWGC 2KWDA 4DXAB 2WGSA 3EHVA 3LDZE 1WF9A 2KNBA 3RULA 2N7JA 3RI7C 2GOWA 3EUB2 1GAQB 3AE9B 1P9DU 3P63A 4LK0M 1ZKHA 2MBEA 3DVGX 2KJHB 2Z8LA 1C9FA 1ZXIA 1KLUD 4G3XB 4NAMA 3I63C 2KK8A 4JPSA 2LD9A 1GUAB 2KQ4X 2WXJA 2KT7A 3P4QB 2WXRA 4BKTA 1PQSA 3R7QA 1FPYA 3DHIC 1NENB 4WWOA 5IA7A 2WDRB 2ZEQA 1ZE3D 1IPGA 5KHQA 1T0QC 1XD3B 1KOTA 3ZTCA 1X1MA 3RNCC 2BYVE 3VAWA 2MX2A 1K52A 2C60A 4M00A 1D5ZC 4W9EA 4KVGB 1M94A 2BF8B 3T3OA 3WALA 4PYZA 3KQ4A 3W5VB 2RMMA 3IXSA 3PLVA 4K7WA 3NY5A 1C77A 2L00B 3Q3OC 1FNWA 3DVNV 3DPDA 1DOIA 2MBHA 5E6OA 3ZXVA 2FUG1 4FADA 3ZJUA 2G4DB 3Q6BA 2XEWA 4PK1A 3QJZA 4BOSC 1N5WA 5C1ZA 1P0RA 2FAZA 1F1HA 4HK2A 4DDID 3D32A 4KV2A 3H7PA 1EU4A 1FXAA 2LHEA 4KSKC 4HJGE 3BZDB 2MBBB 5DPRA 3PGEA 2WXPA 4EEWA 2INPE 1F9JA 4RF1A 2K6QA 2ON8A 3CSFA 3V3XA 2W54A 1SF0A 2FCNA 2N9XA 3L54A 5C2TB 1N62A 4C7ZA 1SIJA 5FR6A 2L83A 4BFRA 2ZVOA 3U4EG 1EF1A 3TEYA 4YXDB 2I38A 4A8XC 4M02A 2OJRA 3VUXA 1WJ6A 1YNTE 1HZ5A 3NZ3A 4BBNC 1VDVA 2SEBD 1TYGB 3ZRFA 2I1JA 4FULA 3T8MA 3MP9A 4MGKE 5G55A 3AE6B 1XQQA 3B9JA 4MGYE 4ZDVA 2J0KA 3MTNB 2NBWB 2UWQA 4L1BA 4CQNA 1MFWA 4K7SA 1I4QA 4TSSA 1GB1A 2IPKD 4G0NB 2J52A 1MG4A 3W9CB 1L5PA 5J18A 2L05A 1Z5SB 3U7ZA 3W1SC 3VR9B 4C4VB 5L83A 4GDLB 2JUOA 1FMAD 2JWZA 5EE9A 1I4RA 2EKEC 5D3DA 1V6EA 3T9LA 2M1MA 1RM6C 2K8BA 4L23A 3UQBA 2DAJA 1E6EB 3AU5A 4URKA 3JW0X 3N30A 3ALBA 1T6BX 3AU4A 2MCNB 2D07B 1YOVB 2LVPA 2K9XA 2Y5CA 5DPWA 2KFKA 5CHWA 3RT3B 4NJ6A 4TQ0A 2KC1A 3V60A 4DXFA 4GSWA 2PTLA 5BYSA 3AE4B 4M0WB 1I4HA 2PLPA 4W9KA 3CF6E 4F8CB 4C80A 2KQ7A 3NJTA 3MHSD 3ZIMA 3FKYA 3GB1A 1J0GA 3AE1B 5BMHA 3RNEC 3IT6B 4X57B 2ZW1A 2DZJA 2ZPNA 3DBRB 4KDIC 4WJQA 1WH3A 3TJPA 3U7DA 2CU1A 4TMAB 1WGYA 2WNMA 2VH2A 3KYCD 3AECB 1M4VA 3IFWB 1JW9D 3WIMA 4CYEA 3VUWA 2L32A
chains in the Genus database with same CATH topology
2R2QA 3ZNID 1L2NA 4DBGA 4HXDA 4LJOB 3M62B 4HVBA 4HCNB 4AOFA 2A4ZA 3M95A 2W9NA 2JVCA 2LUEA 4I6NB 4WQOB 1T0YA 1YD8U 2KMCA 2N7DA 3ML8A 2EMTA 4P7IA 1V86A 4KSLC 2CHZA 2CR5A 3UQAA 4WJPA 4DHJB 1FXTB 2GMIC 4IM3A 3ZDMC 1WE7A 4JQWC 3BY4B 1WXSA 3WAMA 1Y8RC 4G11A 4MDKE 4MGZE 4W9GA 1WMHA 4FHKA 4XX5A 2YLMA 3PHWB 4IC7B 2KWCA 3V62A 5J17A 4KIKB 2LXAA 3DQVA 3QAQA 4EZJA 1J8CA 3W1SA 2M4NA 4MGIE 5G2NA 2O6VD 4GDKA 2KFKB 3PZDA 4NPNA 2MBQA 4B9KA 2HD5B 2NR2A 4CO7A 4IWPA 2J7QB 2KDBA 2NBVB 2IO1B 2FCSA 3AI5A 2EMSA 3NS8A 4BBNF 2AEHA 3QA8A 2L0FA 2KTRA 4II3B 5D94A 4MEMA 2ZJDA 3IHPC 3B0AA 3K9PB 2FNJB 1GC7A 1KM7A 2LJ5A 3QQ8B 3SU8X 2MP2A 1V9JA 4W9FA 2RPQA 3A33B 1IYFA 4ICVA 3I3TB 4DHJD 2C7NB 1JRUA 3TIXA 3A4SC 2BPSA 2WX1A 4J6IA 1WIAA 4ZRIA 3RCZA 1OEYJ 4NJ7A 3V6EB 1WJNA 3H7PB 2KDIA 3C0RB 2J0JA 3A9KA 4W9JA 5D6JB 3L16A 3UGBB 4ANUA 1ZGUB 1WZ0A 2MP2B 3O65B 4JGHB 4PYUA 3ML9A 4BOZB 3QIJA 4NNJB 2QHOA 1Q0WB 2KXJA 4IUMB 2BGFA 2V4LA 1R4NI 2V1YA 4GB9A 1YIWA 4GDLA 1U4AA 3Q3JA 4LDTB 2Z0DB 4HCPB 1WZ3A 4IWQA 3ZTDA 2LRWA 4AJWA 2VRRB 2Z59B 3DBHI 5JZEB 4XZ4A 3TMPB 2Z0EB 3QCAA 3PS6A 5JHAA 1NI2A 3QWZB 1GC6A 2N1WA 2C7MB 3K9OB 4WWPA 4E71A 3W1YA 3KUZA 3PRPB 2D3GA 4KIKA 1V80A 2K8CA 3ZLZA 2FIFA 2A5UA 3DVNU 2KANA 2XK5A 2MSED 3R7RA 5LXIB 3NHEB 4N9F4 2KJRA 2AL3A 4GOCA 4B95A 3UINB 1LXDA 1WRDB 2LGXA 2LRUA 3HHMA 3WANA 2KO3A 2L7RA 2ZNVC 2D2QA 2KTRB 1TGZB 2KDFB 2NBUA 2I1KA 3AXCA 2IO0B 3DCGA 1E5WA 2G4SA 4HDOA 4MSMB 1YQBA 4DK5A 1WYWB 2O6VB 3CSTA 5JHBA 2KVRA 1IP9A 4E3CA 2KWUB 5BO4B 2IO2B 1AARA 4BKSD 4EUTA 3HM3A 1C1YB 1WR6E 4ANVA 1KJTA 3BINA 1ZW7A 2WYQA 2DZMA 1MG8A 3KH0A 4JIOU 3EFUA 2PJHA 2ZNVB 3APFA 2JPHA 1E90A 2NVUI 4EZLA 1V5OA 2JZ3B 1UBIA 4HPLB 3OJ3A 5E6PA 3VH3B 2KTFA 2MW5A 3VTWA 3L0WB 1VD2A 5DPTA 2IYDB 2HE7A 1UH6A 3IVFA 2OOBB 1P3QU 2GBNA 1WGHA 1V5TA 2FCQA 2PE6B 2RSUA 4HJKA 2LASA 3VVWB 1YJ1A 1TZ1A 2DX5B 4W9HA 3UF8A 1RFAA 2LVQA 4DDGD 3APDA 3R66C 4A20A 2CKHB 4TUUA 4M8NA 4IM2A 1H4RA 4EKUA 3OAWA 1E8YA 1J19A 2HTHA 2K6DB 3ZW3A 4IM0A 2WDTB 4NQLB 3DVGY 4KDLB 1WR1A 4FHJA 1RAXA 1SGHA 3AULA 3VUYA 1EUVB 3PHXB 3JYUA 1WX7A 2C7HA 4KZ0A 2K25A 3PRZA 2L0TA 4K1RB 2DHZA 2DAFA 4B6WA 3U8ZA 5CTRC 1G6JA 4K81A 3RZFA 4ANXA 3V61A 4ASWC 3RUIB 2BKRB 1WGGA 1LM8B 2KD0A 2D11A 2KX0A 2RR9A 2V3SA 3ENEA 3JVZX 4WJOA 2LVOA 1L7YA 1WXAA 3WAOA 4KZCA 4CHKA 4RM8A 1WXMA 4DXAB 1YX5B 3EHVA 4MM3A 4RMAA 3LDZE 3ZVVA 2RD0A 3L13A 1UBQA 4PS8A 1WF9A 2KNBA 4GDKB 3RULA 2ZZPB 2GOWA 4LDTD 1P9DU 2D10A 3VXWA 4M8MA 3DBRI 1ZKHA 4ANWA 1EO6A 2ASQA 5TR5A 3ZDTA 1NBFC 2JRIB 3PREA 5AZFA 2MBEA 3DVGX 3QC8B 2KJHB 3ZRCA 4MELA 3HM6X 1D3ZA 4G3XB 2HJ8A 4DWFA 2FUHB 3APCA 2KK8A 1V2YA 2DYMA 1GUAB 2AYOB 2LD9A 2R2OA 5AZGA 3SHQA 3UIOB 4FA6A 5AEKB 4GIVA 1ISNA 1E8XA 2IY1B 5D7GA 4BKTA 5L95C 1PQSA 2LZ6A 1Q1OA 1SIFA 3ECIA 4GN1A 5DCNA 3A9JB 4F7ZA 4GU2A 3R7QA 4WWOA 1UELA 5IA7A 2ZEQA 1WE6A 5E6NA 3EC8A 4NAWA 3KUCB 3A4RA 1IPGA 5KHQA 2MA9B 4ZRJA 2L3ZA 1XD3B 5IAAC 1QZEA 4MJSA 4G50A 1GJZA 1KOTA 2C5LC 1LFDA 2NPTA 3ZTCA 2O2VB 1X1MA 2BYVE 4GGQA 3VAWA 3A9JA 5CHFA 1P1AA 1OQYA 2KJ6A 3KUDB 4F1SA 1S1QB 3IG3A 4JL9A 1WM2A 1WY8A 2UYZB 2MX2A 3N3KB 2C60A 4W9EA 4W9DA 3N32A 3L10B 1M94A 2KFJA 4FJYA 2LGYA 2KOXA 4JLCA 2BF8B 2FIDA 3X0WA 2BKFA 4EZKA 3WALA 4PYZA 3GOEA 2WX0A 2BWFA 4ZYNA 4OVVA 3VQIA 1A5RA 2KC2A 2JZZA 3PLVA 4K7WA 3NY5A 2KZRA 3A1QB 2L00B 3KVFB 3QHTA 4MJSB 3KW5B 2MQJA 1WJUA 2DENB 3MJWA 1WX9A 2M8SA 2PPHA 3DVNV 3DPDA 2MBHA 3NOBA 5E6OA 1SE9A 1YX6B 1S3SG 3L17A 4TQ1A 1Z2MA 3A1QA 3ONSA 5J2RA 4FADA 4LCDE 2G3QB 2LI5A 2G4DB 3WA0A 4FBJB 2XEWA 2BYFA 3QJZA 1GG3A 1RRBA 3IBEA 2JF5A 2L76A 2FCMA 4BOSC 5C1ZA 1P0RA 2GBJA 3PSEB 4K7UA 4BKGA 2FAZA 5D2MB 2L8JA 3DBSA 4HK2A 4DDID 4HWIB 3D32A 3A9KB 4KV2A 2NS5A 3H7PA 1WJ4A 2ZVNA 2JT4B 2O2VA 3VFKA 3LJ3A 4IG7B 2NPTB 4KSKC 2DYOA 3PVLA 2MBBB 5DPSA 1UZXB 4MSQB 2IY0B 1WFYA 2K1FA 4WAAA 4W9LA 4EOYA 1C3TA 5DPRA 3PGEA 5GMVA 3P2BA 3PV1A 4EEWA 1F9JA 3B08A 3QX1A 2KLGA 4IWOA 4WWNA 2GBRA 4IW0A 2N4FA 2K6QA 4DHZB 1WI0A 3CSFA 3RZWC 3H7SA 2FCNA 2N9XA 3L54A 2DZIA 2ZCCA 1E8WA 1E8ZA 4NQKE 4ZRKA 3VTUA 5JH5C 5C23A 4II2B 3EECA 2B3AA 5FR6A 4PS3A 1GNUA 4BFRA 3JSVA 3VHTC 4W9CA 4ICUA 2ZVOA 2WWZA 3M63B 3X23A 2MWSB 2G45B 3TCAA 2KWVB 4XC2A 4BVUC 1EF1A 4FN2A 3GZNI 4AP4C 1RLFA 1H8CA 3V6CB 2Y5BB 2OJRA 3PT2B 3VUXA 1WJ6A 4HLEA 4BBNC 1V49A 1I35A 3ZNZB 2CHWA 3CMMB 3ZRFA 2I1JA 4FULA 3T8MA 4BKSA 2IO3B 4PS7A 2JXXA 1TBEA 4MGKE 4A3PA 5G55A 1XQQA 3H1UA 4FLHA 1WXVA 4MGYE 2N9PC 4WJNA 4ZDVA 2GBMA 2J0KA 3MTNB 2O6VA 2NBWB 3TL5A 2MLBA 5AZHA 1V81A 2PE9A 2UWQA 3RYTA 3DOWA 4OVUA 4YL8A 3PTFC 4K7SA 1Q5WB 5HKHA 4KVGB 2ZPYA 1XT9B 5KHOA 4AJYB 4G0NB 3HK0A 1VCBA 2BYEA 1E7VA 3VTVA 4E74A 4DHZE 3SDLC 2KKCA 2YVCA 2KHWB 1R4MI 1LQBA 4GXBA 5J18A 5EDSA 2RGFA 2L05A 1Z5SB 3W1SC 2KLCA 3WAPA 5L83A 3VH4B 4GDLB 3ZNGC 1NDDA 3H9DA 3OLMD 2JUOA 2JWZA 3NZUA 2MBOA 5LLIA 2CHXA 2N1VA 3UIPB 1E7UA 2EKEC 2LGDA 1OTRB 1V6EA 3T9LA 5LXHA 3PRMB 1WM3A 2M1MA 1WGRA 4AWJA 2K8BA 3L08A 4NY0A 3H6NA 3OJ4B 3UQBA 2DAJA 3AU5A 5CHVC 1CMXB 4URKA 2KDEB 2REXA 3JW0X 3N30A 3S2AA 2BWES 2CS4A 1OEYA 2XK5B 2ZCBA 4I6PA 4LJPB 1I42A 2AWTA 2PEAA 2JY6A 4TV3A 3ALBA 1K8RB 3AU4A 2MCNB 2D07B 4EFOA 2DZKA 2LVPA 2M17A 3PLUA 5DPWA 2KFKA 4TKNA 3JSVB 2KMAA 3KYDD 2JRHA 4GMVA 5CHWA 4NAWB 2IBIB 2KQSA 3RT3B 4NJ6A 4TQ0A 2KC1A 3QARA 1UGMA 3V60A 4GSWA 3U30A 4HPMB 2GBKA 5CX3A 2AL6A 2N7EA 3M3JA 2K39A 4M0WB 3ZO5B 4W9KA 4F8CB 2N9EB 3CF6E 1EF5A 3NZSA 3QK0A 3SD5A 4AUQC 3Q3FA 4I6LB 3PPAA 1HE8A 2NCNA 2XBBC 2LXCA 4W9IA 1TTNA 3B1LX 2KQ7A 2MRPA 3R3MA 3MHSD 3ZIMA 4A3OA 3HIZA 4HDQA 1WMHB 2K8HA 1J0GA 3DBLI 4RM9A 4FJZA 1P98A 4X57B 2M0XA 2LWPA 2DZJA 2ZPNA 4KDIC 4MH0E 4WJQA 1WH3A 3TBLD 1OGWA 3TJPA 3ZKJC 1KLVA 3U7DA 1UD7A 2CU1A 3ZNHB 2IZVB 2KN5A 1BT0A 1WGYA 1WGDA 3KYCD 2DYBA 3IFWB 2KX3A 4FJVB 3WIMA 4CYEA 2J0MA 2C9WB 3ZUNA 3RD2A 3DDCB 3VDZA 3VUWA 1WX8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R2Q A;  3ZNI D;  1L2N A;  4DBG A;  4HXD A;  4LJO B;  3M62 B;  4HVB A;  4HCN B;  4AOF A;  2A4Z A;  3M95 A;  2W9N A;  2JVC A;  2LUE A;  4I6N B;  4WQO B;  1T0Y A;  1YD8 U;  2KMC A;  2N7D A;  3ML8 A;  2EMT A;  4P7I A;  1V86 A;  4KSL C;  2CHZ A;  2CR5 A;  3UQA A;  4WJP A;  4DHJ B;  1FXT B;  2GMI C;  4IM3 A;  3ZDM C;  1WE7 A;  4JQW C;  3BY4 B;  1WXS A;  3WAM A;  1Y8R C;  4G11 A;  4MDK E;  4MGZ E;  4W9G A;  1WMH A;  4FHK A;  4XX5 A;  2YLM A;  3PHW B;  4IC7 B;  2KWC A;  3V62 A;  5J17 A;  4KIK B;  2LXA A;  3DQV A;  3QAQ A;  4EZJ A;  1J8C A;  3W1S A;  2M4N A;  4MGI E;  5G2N A;  2O6V D;  4GDK A;  2KFK B;  3PZD A;  4NPN A;  2MBQ A;  4B9K A;  2HD5 B;  2NR2 A;  4CO7 A;  4IWP A;  2J7Q B;  2KDB A;  2NBV B;  2IO1 B;  2FCS A;  3AI5 A;  2EMS A;  3NS8 A;  4BBN F;  2AEH A;  3QA8 A;  2L0F A;  2KTR A;  4II3 B;  5D94 A;  4MEM A;  2ZJD A;  3IHP C;  3B0A A;  3K9P B;  2FNJ B;  1GC7 A;  1KM7 A;  2LJ5 A;  3QQ8 B;  3SU8 X;  2MP2 A;  1V9J A;  4W9F A;  2RPQ A;  3A33 B;  1IYF A;  4ICV A;  3I3T B;  4DHJ D;  2C7N B;  1JRU A;  3TIX A;  3A4S C;  2BPS A;  2WX1 A;  4J6I A;  1WIA A;  4ZRI A;  3RCZ A;  1OEY J;  4NJ7 A;  3V6E B;  1WJN A;  3H7P B;  2KDI A;  3C0R B;  2J0J A;  3A9K A;  4W9J A;  5D6J B;  3L16 A;  3UGB B;  4ANU A;  1ZGU B;  1WZ0 A;  2MP2 B;  3O65 B;  4JGH B;  4PYU A;  3ML9 A;  4BOZ B;  3QIJ A;  4NNJ B;  2QHO A;  1Q0W B;  2KXJ A;  4IUM B;  2BGF A;  2V4L A;  1R4N I;  2V1Y A;  4GB9 A;  1YIW A;  4GDL A;  1U4A A;  3Q3J A;  4LDT B;  2Z0D B;  4HCP B;  1WZ3 A;  4IWQ A;  3ZTD A;  2LRW A;  4AJW A;  2VRR B;  2Z59 B;  3DBH I;  5JZE B;  4XZ4 A;  3TMP B;  2Z0E B;  3QCA A;  3PS6 A;  5JHA A;  1NI2 A;  3QWZ B;  1GC6 A;  2N1W A;  2C7M B;  3K9O B;  4WWP A;  4E71 A;  3W1Y A;  3KUZ A;  3PRP B;  2D3G A;  4KIK A;  1V80 A;  2K8C A;  3ZLZ A;  2FIF A;  2A5U A;  3DVN U;  2KAN A;  2XK5 A;  2MSE D;  3R7R A;  5LXI B;  3NHE B;  4N9F 4;  2KJR A;  2AL3 A;  4GOC A;  4B95 A;  3UIN B;  1LXD A;  1WRD B;  2LGX A;  2LRU A;  3HHM A;  3WAN A;  2KO3 A;  2L7R A;  2ZNV C;  2D2Q A;  2KTR B;  1TGZ B;  2KDF B;  2NBU A;  2I1K A;  3AXC A;  2IO0 B;  3DCG A;  1E5W A;  2G4S A;  4HDO A;  4MSM B;  1YQB A;  4DK5 A;  1WYW B;  2O6V B;  3CST A;  5JHB A;  2KVR A;  1IP9 A;  4E3C A;  2KWU B;  5BO4 B;  2IO2 B;  1AAR A;  4BKS D;  4EUT A;  3HM3 A;  1C1Y B;  1WR6 E;  4ANV A;  1KJT A;  3BIN A;  1ZW7 A;  2WYQ A;  2DZM A;  1MG8 A;  3KH0 A;  4JIO U;  3EFU A;  2PJH A;  2ZNV B;  3APF A;  2JPH A;  1E90 A;  2NVU I;  4EZL A;  1V5O A;  2JZ3 B;  1UBI A;  4HPL B;  3OJ3 A;  5E6P A;  3VH3 B;  2KTF A;  2MW5 A;  3VTW A;  3L0W B;  1VD2 A;  5DPT A;  2IYD B;  2HE7 A;  1UH6 A;  3IVF A;  2OOB B;  1P3Q U;  2GBN A;  1WGH A;  1V5T A;  2FCQ A;  2PE6 B;  2RSU A;  4HJK A;  2LAS A;  3VVW B;  1YJ1 A;  1TZ1 A;  2DX5 B;  4W9H A;  3UF8 A;  1RFA A;  2LVQ A;  4DDG D;  3APD A;  3R66 C;  4A20 A;  2CKH B;  4TUU A;  4M8N A;  4IM2 A;  1H4R A;  4EKU A;  3OAW A;  1E8Y A;  1J19 A;  2HTH A;  2K6D B;  3ZW3 A;  4IM0 A;  2WDT B;  4NQL B;  3DVG Y;  4KDL B;  1WR1 A;  4FHJ A;  1RAX A;  1SGH A;  3AUL A;  3VUY A;  1EUV B;  3PHX B;  3JYU A;  1WX7 A;  2C7H A;  4KZ0 A;  2K25 A;  3PRZ A;  2L0T A;  4K1R B;  2DHZ A;  2DAF A;  4B6W A;  3U8Z A;  5CTR C;  1G6J A;  4K81 A;  3RZF A;  4ANX A;  3V61 A;  4ASW C;  3RUI B;  2BKR B;  1WGG A;  1LM8 B;  2KD0 A;  2D11 A;  2KX0 A;  2RR9 A;  2V3S A;  3ENE A;  3JVZ X;  4WJO A;  2LVO A;  1L7Y A;  1WXA A;  3WAO A;  4KZC A;  4CHK A;  4RM8 A;  1WXM A;  4DXA B;  1YX5 B;  3EHV A;  4MM3 A;  4RMA A;  3LDZ E;  3ZVV A;  2RD0 A;  3L13 A;  1UBQ A;  4PS8 A;  1WF9 A;  2KNB A;  4GDK B;  3RUL A;  2ZZP B;  2GOW A;  4LDT D;  1P9D U;  2D10 A;  3VXW A;  4M8M A;  3DBR I;  1ZKH A;  4ANW A;  1EO6 A;  2ASQ A;  5TR5 A;  3ZDT A;  1NBF C;  2JRI B;  3PRE A;  5AZF A;  2MBE A;  3DVG X;  3QC8 B;  2KJH B;  3ZRC A;  4MEL A;  3HM6 X;  1D3Z A;  4G3X B;  2HJ8 A;  4DWF A;  2FUH B;  3APC A;  2KK8 A;  1V2Y A;  2DYM A;  1GUA B;  2AYO B;  2LD9 A;  2R2O A;  5AZG A;  3SHQ A;  3UIO B;  4FA6 A;  5AEK B;  4GIV A;  1ISN A;  1E8X A;  2IY1 B;  5D7G A;  4BKT A;  5L95 C;  1PQS A;  2LZ6 A;  1Q1O A;  1SIF A;  3ECI A;  4GN1 A;  5DCN A;  3A9J B;  4F7Z A;  4GU2 A;  3R7Q A;  4WWO A;  1UEL A;  5IA7 A;  2ZEQ A;  1WE6 A;  5E6N A;  3EC8 A;  4NAW A;  3KUC B;  3A4R A;  1IPG A;  5KHQ A;  2MA9 B;  4ZRJ A;  2L3Z A;  1XD3 B;  5IAA C;  1QZE A;  4MJS A;  4G50 A;  1GJZ A;  1KOT A;  2C5L C;  1LFD A;  2NPT A;  3ZTC A;  2O2V B;  1X1M A;  2BYV E;  4GGQ A;  3VAW A;  3A9J A;  5CHF A;  1P1A A;  1OQY A;  2KJ6 A;  3KUD B;  4F1S A;  1S1Q B;  3IG3 A;  4JL9 A;  1WM2 A;  1WY8 A;  2UYZ B;  2MX2 A;  3N3K B;  2C60 A;  4W9E A;  4W9D A;  3N32 A;  3L10 B;  1M94 A;  2KFJ A;  4FJY A;  2LGY A;  2KOX A;  4JLC A;  2BF8 B;  2FID A;  3X0W A;  2BKF A;  4EZK A;  3WAL A;  4PYZ A;  3GOE A;  2WX0 A;  2BWF A;  4ZYN A;  4OVV A;  3VQI A;  1A5R A;  2KC2 A;  2JZZ A;  3PLV A;  4K7W A;  3NY5 A;  2KZR A;  3A1Q B;  2L00 B;  3KVF B;  3QHT A;  4MJS B;  3KW5 B;  2MQJ A;  1WJU A;  2DEN B;  3MJW A;  1WX9 A;  2M8S A;  2PPH A;  3DVN V;  3DPD A;  2MBH A;  3NOB A;  5E6O A;  1SE9 A;  1YX6 B;  1S3S G;  3L17 A;  4TQ1 A;  1Z2M A;  3A1Q A;  3ONS A;  5J2R A;  4FAD A;  4LCD E;  2G3Q B;  2LI5 A;  2G4D B;  3WA0 A;  4FBJ B;  2XEW A;  2BYF A;  3QJZ A;  1GG3 A;  1RRB A;  3IBE A;  2JF5 A;  2L76 A;  2FCM A;  4BOS C;  5C1Z A;  1P0R A;  2GBJ A;  3PSE B;  4K7U A;  4BKG A;  2FAZ A;  5D2M B;  2L8J A;  3DBS A;  4HK2 A;  4DDI D;  4HWI B;  3D32 A;  3A9K B;  4KV2 A;  2NS5 A;  3H7P A;  1WJ4 A;  2ZVN A;  2JT4 B;  2O2V A;  3VFK A;  3LJ3 A;  4IG7 B;  2NPT B;  4KSK C;  2DYO A;  3PVL A;  2MBB B;  5DPS A;  1UZX B;  4MSQ B;  2IY0 B;  1WFY A;  2K1F A;  4WAA A;  4W9L A;  4EOY A;  1C3T A;  5DPR A;  3PGE A;  5GMV A;  3P2B A;  3PV1 A;  4EEW A;  1F9J A;  3B08 A;  3QX1 A;  2KLG A;  4IWO A;  4WWN A;  2GBR A;  4IW0 A;  2N4F A;  2K6Q A;  4DHZ B;  1WI0 A;  3CSF A;  3RZW C;  3H7S A;  2FCN A;  2N9X A;  3L54 A;  2DZI A;  2ZCC A;  1E8W A;  1E8Z A;  4NQK E;  4ZRK A;  3VTU A;  5JH5 C;  5C23 A;  4II2 B;  3EEC A;  2B3A A;  5FR6 A;  4PS3 A;  1GNU A;  4BFR A;  3JSV A;  3VHT C;  4W9C A;  4ICU A;  2ZVO A;  2WWZ A;  3M63 B;  3X23 A;  2MWS B;  2G45 B;  3TCA A;  2KWV B;  4XC2 A;  4BVU C;  1EF1 A;  4FN2 A;  3GZN I;  4AP4 C;  1RLF A;  1H8C A;  3V6C B;  2Y5B B;  2OJR A;  3PT2 B;  3VUX A;  1WJ6 A;  4HLE A;  4BBN C;  1V49 A;  1I35 A;  3ZNZ B;  2CHW A;  3CMM B;  3ZRF A;  2I1J A;  4FUL A;  3T8M A;  4BKS A;  2IO3 B;  4PS7 A;  2JXX A;  1TBE A;  4MGK E;  4A3P A;  5G55 A;  1XQQ A;  3H1U A;  4FLH A;  1WXV A;  4MGY E;  2N9P C;  4WJN A;  4ZDV A;  2GBM A;  2J0K A;  3MTN B;  2O6V A;  2NBW B;  3TL5 A;  2MLB A;  5AZH A;  1V81 A;  2PE9 A;  2UWQ A;  3RYT A;  3DOW A;  4OVU A;  4YL8 A;  3PTF C;  4K7S A;  1Q5W B;  5HKH A;  4KVG B;  2ZPY A;  1XT9 B;  5KHO A;  4AJY B;  4G0N B;  3HK0 A;  1VCB A;  2BYE A;  1E7V A;  3VTV A;  4E74 A;  4DHZ E;  3SDL C;  2KKC A;  2YVC A;  2KHW B;  1R4M I;  1LQB A;  4GXB A;  5J18 A;  5EDS A;  2RGF A;  2L05 A;  1Z5S B;  3W1S C;  2KLC A;  3WAP A;  5L83 A;  3VH4 B;  4GDL B;  3ZNG C;  1NDD A;  3H9D A;  3OLM D;  2JUO A;  2JWZ A;  3NZU A;  2MBO A;  5LLI A;  2CHX A;  2N1V A;  3UIP B;  1E7U A;  2EKE C;  2LGD A;  1OTR B;  1V6E A;  3T9L A;  5LXH A;  3PRM B;  1WM3 A;  2M1M A;  1WGR A;  4AWJ A;  2K8B A;  3L08 A;  4NY0 A;  3H6N A;  3OJ4 B;  3UQB A;  2DAJ A;  3AU5 A;  5CHV C;  1CMX B;  4URK A;  2KDE B;  2REX A;  3JW0 X;  3N30 A;  3S2A A;  2BWE S;  2CS4 A;  1OEY A;  2XK5 B;  2ZCB A;  4I6P A;  4LJP B;  1I42 A;  2AWT A;  2PEA A;  2JY6 A;  4TV3 A;  3ALB A;  1K8R B;  3AU4 A;  2MCN B;  2D07 B;  4EFO A;  2DZK A;  2LVP A;  2M17 A;  3PLU A;  5DPW A;  2KFK A;  4TKN A;  3JSV B;  2KMA A;  3KYD D;  2JRH A;  4GMV A;  5CHW A;  4NAW B;  2IBI B;  2KQS A;  3RT3 B;  4NJ6 A;  4TQ0 A;  2KC1 A;  3QAR A;  1UGM A;  3V60 A;  4GSW A;  3U30 A;  4HPM B;  2GBK A;  5CX3 A;  2AL6 A;  2N7E A;  3M3J A;  2K39 A;  4M0W B;  3ZO5 B;  4W9K A;  4F8C B;  2N9E B;  3CF6 E;  1EF5 A;  3NZS A;  3QK0 A;  3SD5 A;  4AUQ C;  3Q3F A;  4I6L B;  3PPA A;  1HE8 A;  2NCN A;  2XBB C;  2LXC A;  4W9I A;  1TTN A;  3B1L X;  2KQ7 A;  2MRP A;  3R3M A;  3MHS D;  3ZIM A;  4A3O A;  3HIZ A;  4HDQ A;  1WMH B;  2K8H A;  1J0G A;  3DBL I;  4RM9 A;  4FJZ A;  1P98 A;  4X57 B;  2M0X A;  2LWP A;  2DZJ A;  2ZPN A;  4KDI C;  4MH0 E;  4WJQ A;  1WH3 A;  3TBL D;  1OGW A;  3TJP A;  3ZKJ C;  1KLV A;  3U7D A;  1UD7 A;  2CU1 A;  3ZNH B;  2IZV B;  2KN5 A;  1BT0 A;  1WGY A;  1WGD A;  3KYC D;  2DYB A;  3IFW B;  2KX3 A;  4FJV B;  3WIM A;  4CYE A;  2J0M A;  2C9W B;  3ZUN A;  3RD2 A;  3DDC B;  3VDZ A;  3VUW A;  1WX8 A; 
#chains in the Genus database with same CATH topology
 2R2Q A;  1EWC A;  4WUR A;  3AEG B;  4DBG A;  4HXD A;  4LJO B;  4HVB A;  2LUE A;  4WQO B;  1YD8 U;  4XE0 A;  2KMC A;  3ML8 A;  1V86 A;  3L4P A;  4KSL C;  1FXT B;  1I4G A;  3BYY B;  3DHH C;  3CWI A;  1F52 A;  1KFY B;  3BY4 B;  4YSY B;  1Y8R C;  1IBX A;  4KIK B;  1SXT A;  1MJD A;  3J9C A;  2JWU A;  5G2N A;  2O6V D;  2KFK B;  1N6Z A;  4B9K A;  2HD5 B;  2EMS A;  2V3N A;  2ZJD A;  1JWS D;  2G1E A;  2MP2 A;  3A33 B;  2L1A A;  3I3T B;  1XCQ L;  2C7N B;  4YSX B;  3AE5 B;  3TIX A;  5IKC M;  2IGD A;  4NJ7 A;  2ONQ A;  2KDI A;  3C0R B;  3A9K A;  4W9J A;  4PYU A;  3ML9 A;  3QIJ A;  1Q0W B;  2KXJ A;  2V4L A;  2RPV A;  4HCP B;  2W3S A;  4AJW A;  2VRR B;  1V1O A;  1K51 A;  4XZ4 A;  5T8I A;  1NI2 A;  2N1W A;  3N20 C;  2C7M B;  4E71 A;  4RH6 A;  4Q2J A;  2NMQ A;  2KAN A;  2XK5 A;  3R7R A;  5LXI B;  4LLG M;  2XN9 C;  2HDE A;  2JQR B;  1F2R I;  2LRU A;  3R2T A;  2L7R A;  2ZNV C;  2KTR B;  1TGZ B;  2KDF B;  4MSM B;  5IN7 A;  2QC8 A;  5JHB A;  1AAR A;  3B2F A;  3EFU A;  3APF A;  2FE8 A;  3N1Y C;  2JPH A;  1E90 A;  1V5O A;  2JZ3 B;  2WXF A;  1FCL A;  1VD2 A;  4J3O D;  2KAC A;  2OOB B;  4KGT A;  1P3Q U;  1L0Y B;  1SE3 A;  2PE6 B;  2RSU A;  1KLG D;  4H2A A;  2M0A A;  2DX5 B;  3UF8 A;  4KGR A;  4ARC A;  1ROE A;  1C4C A;  1MPE A;  3R66 C;  2CKH B;  4TUU A;  4EKU A;  1TKG A;  1J19 A;  2K6D B;  2KMM A;  4IM0 A;  1LO5 D;  4NQL B;  5FR3 A;  3GE8 C;  2NTS A;  4FHJ A;  2V9H A;  1CQV A;  2WXN A;  1XCT L;  4B6W A;  1ZDX A;  2LMC A;  5CTR C;  3SFE B;  1XO3 A;  3MC0 B;  1HZ6 A;  2VH1 A;  4YTM B;  1AYF A;  4R3D A;  1WGG A;  1UWX A;  2XNA C;  2V3S A;  4RFB A;  3ENE A;  4KZC A;  5BMI A;  3SFD B;  1YX5 B;  3BK1 A;  4RMA A;  3Q14 C;  3N9Y C;  2D10 A;  2MH7 A;  3VXW A;  2INC C;  1GPX A;  3IAS 1;  1R4M B;  1QOA A;  3BK2 A;  1UNS A;  3QC8 B;  1PGA A;  4MEL A;  3HM6 X;  5MPO A;  2PVO D;  1RFK A;  1V2Y A;  2AYO B;  3AED B;  1QOB A;  4N59 A;  4USA A;  4OHJ A;  4XWW A;  4C4V A;  1ISN A;  1QQR A;  1T3Q A;  3ECI A;  2BB5 A;  1HA5 A;  3IAM 1;  3TSS A;  2EEL A;  3TEZ A;  1UEL A;  1WE6 A;  1JML A;  3KUC B;  2MA9 B;  5IAA C;  3HVD A;  2NPT A;  1LFD A;  1L0V B;  2O2V B;  3A9J A;  5CHF A;  4ZHP A;  1ESF A;  1WY8 A;  4LNK A;  4US8 A;  4W9D A;  2FID A;  2BKF A;  3GOE A;  4ZYN A;  1VZ6 A;  4HRO A;  2L52 A;  2WXQ A;  2Q5W D;  2KC2 A;  2J4X A;  1JWU D;  3QHT A;  5HI1 A;  4KKI A;  3N1Z C;  1MHX A;  2PPH A;  1SE9 A;  4C7Y A;  3ONS A;  3FC4 A;  2LI5 A;  3WA0 A;  1IGD A;  3DBH B;  5HFY A;  2FCM A;  2QSD A;  4RCO A;  2GBJ A;  4BKG A;  2OED A;  2DNF A;  3A9K B;  1STE A;  2GRI A;  3HVZ A;  4NJC A;  3PVL A;  1UZX B;  2IY0 B;  1WFY A;  2K1F A;  4WAA A;  4PT5 A;  2M19 A;  2VZK B;  3T3N A;  3PV1 A;  4P1C C;  2KYW A;  1PUT A;  1YN3 A;  4AS1 A;  2KLG A;  4WWN A;  3PO0 A;  4IW0 A;  2N4F A;  3PZ7 A;  4S17 A;  2ZCC A;  1E8W A;  4NQK E;  4ZRK A;  5JH5 C;  1GNU A;  4OZB A;  3VHT C;  4ICU A;  1V1P B;  2G45 B;  4XC2 A;  4BVU C;  2R61 A;  4AP4 C;  1ET9 A;  1AW7 A;  1JWM D;  4ZHO A;  2CHW A;  3CMM B;  2JXX A;  3GP7 A;  2D3A A;  4K3C A;  4FLH A;  2GBM A;  2O6V A;  1MI0 A;  1V81 A;  3P42 A;  3NVV A;  4WQM A;  1XT9 B;  5KHO A;  5G5G A;  4HKQ A;  3VTV A;  1VCB A;  1E7V A;  4DHZ E;  3SDL C;  1DOX A;  4A90 A;  1K50 A;  4GXB A;  5EDS A;  2LGS A;  4OVZ A;  2IGH A;  4KKJ A;  2MHJ A;  3VH4 B;  4YTN B;  2D5G A;  3ZNG C;  1NDD A;  3OLM D;  4REZ A;  3NZU A;  3Q2A C;  2MBO A;  5LLI A;  2CHX A;  1E10 A;  2K5P A;  4IOI E;  2PVG C;  3PRM B;  1WM3 A;  3GE3 C;  5EE0 A;  4NY0 A;  3H6N A;  1CMX B;  4MT5 A;  3S2A A;  2BWE S;  1WYG A;  2CS4 A;  2ZCB A;  3NRZ A;  4D2K A;  3B2G A;  1OQQ A;  3I5J C;  1E0Z A;  4M0W A;  2M17 A;  3KYD D;  2JRH A;  2PKO A;  4GMV A;  1WXQ A;  3QAR A;  1UGM A;  2V4I B;  4HPM B;  5CX3 A;  1FRR A;  1HQR D;  2N7E A;  2K39 A;  3ZO5 B;  3Q3F A;  4I6L B;  3PPA A;  1HE8 A;  4ITK A;  2MRP A;  2GB1 A;  4A3O A;  2W82 A;  3DBL I;  4RM9 A;  4FJZ A;  2ICI A;  4MH0 E;  4US9 A;  5TSS A;  4MAC A;  1OGW A;  1UD7 A;  1NYQ A;  2IZV B;  3BWU D;  4MM3 B;  2DYB A;  2KX3 A;  2J0M A;  3RMK C;  3IG3 A;  3ZNI D;  1MHH E;  2AQ2 B;  4HCN B;  4AOF A;  2A4Z A;  2W9N A;  2JX5 A;  4I6N B;  1LGR A;  2WHI A;  1CJE A;  4BAX A;  3UQA A;  1C4P A;  1V97 A;  4JWS C;  2MJE A;  3ZDM C;  4JQW C;  4P6V F;  4ZRQ A;  4ZRP A;  4MDK E;  4MGZ E;  1WMH A;  4XX5 A;  4JWU C;  4IC7 B;  3PHW B;  3V62 A;  2KWC A;  3DQV A;  3W1S A;  1T5X D;  2M4N A;  2BS2 B;  5AUI A;  4ZYS A;  2MBQ A;  2NR2 A;  2WXI A;  4IWP A;  2IO1 B;  3QA8 A;  2L0F A;  2KTR A;  2HJ1 A;  4MEM A;  3I57 A;  2V3P A;  2LJ5 A;  3SU8 X;  4W9F A;  1IYF A;  4DHJ D;  1JRU A;  2WX1 A;  1WIA A;  4OW0 A;  3RCZ A;  1R4N B;  3H7P B;  5D6J B;  3UI3 A;  1ZGU B;  3O65 B;  2DLB A;  4YSZ B;  1R4N I;  2V1Y A;  4GB9 A;  4GDL A;  1CK1 A;  1OFF A;  2Z0D B;  4IWQ A;  1GOZ A;  2LRW A;  2Z59 B;  2ACZ B;  2RDB C;  1KTK A;  2Z0E B;  2WU5 B;  1J7B A;  4HEA 1;  2BVC A;  2D3G A;  1FEH A;  2BS4 B;  5H8Y E;  2MSE D;  2Y3A A;  3NHE B;  5IO9 A;  4GOC A;  2JYE A;  1WRD B;  4AQ7 A;  3AXC A;  2D2Q A;  2I1K A;  1EU3 A;  3CST A;  3U2S C;  5BO4 B;  4IKG A;  1TY2 A;  3HM3 A;  3AM9 A;  1WR6 E;  3BIN A;  2DZM A;  4JIO U;  2JU6 X;  2PJH A;  2NVU I;  4EZL A;  1PDX A;  2QIL A;  3KWV A;  3VH3 B;  2YEP F;  2JYT A;  1UH6 A;  5C3J B;  1XLQ A;  2BBC A;  2FCQ A;  4YWG G;  1D6E C;  4OZC A;  3VVW B;  3AMZ A;  2LVQ A;  1VZ8 A;  1QLB B;  4M8N A;  5LNK 1;  3OAW A;  3EGR A;  2HTH A;  1XXG A;  3DVG Y;  2J42 A;  1WR1 A;  3MC8 A;  4KZ0 A;  2X38 A;  1FIQ A;  1V1P A;  2GLS A;  1G6J A;  4LNO A;  5JXV A;  3V61 A;  3RUI B;  2D11 A;  1JQ4 A;  4WJO A;  1YJI A;  2LVO A;  4CHK A;  1WXM A;  3GS2 A;  4MM3 A;  3ZVV A;  3L13 A;  4C56 C;  4B0M A;  3LXF A;  2CJO A;  1FNV A;  3AE3 B;  1TT5 B;  2E6X A;  1PYW D;  4M8M A;  3ABV B;  2WP9 B;  5TR5 A;  3ZDT A;  2JRI B;  5AZF A;  3NS1 A;  1D3Z A;  2HJ8 A;  2FUH B;  3APC A;  3BYT B;  2DYM A;  3SHQ A;  5AZG A;  3UIO B;  3V05 A;  1TY0 A;  4XDD A;  3EA6 A;  2IJ0 A;  1E8X A;  2IY1 B;  3Q8A A;  5D7G A;  5L95 C;  2LZ6 A;  1SIF A;  1XF5 L;  5DCN A;  3A9J B;  3DHG C;  5E6N A;  3EC8 A;  3FIL A;  5IOI A;  4ZRJ A;  2PIA A;  4G50 A;  1GJZ A;  2C5L C;  1OQY A;  4F1S A;  1S1Q B;  3RPF C;  1OQR A;  4JL9 A;  2M56 B;  3N32 A;  4FJY A;  2KFJ A;  4DXG A;  2LGY A;  2KOX A;  3X0W A;  1SSN A;  1PGX A;  2BWF A;  4IDI A;  1BXT A;  3P4R B;  5GXG B;  2RDG A;  1PGB A;  1YJJ A;  3AEA B;  2BYT A;  1WJU A;  1TKY A;  2B76 B;  1WX9 A;  3RN9 C;  2M8S A;  2QIE B;  3URY A;  1S3S G;  3L17 A;  3MFG A;  3R8B A;  3CIR B;  1N5X A;  4HKZ E;  5H92 C;  3NVW A;  1GG3 A;  1RRB A;  2L76 A;  1DGJ A;  4ARI A;  2L8J A;  2QCZ A;  3DBS A;  1QF6 A;  3DBL B;  1YQ4 B;  1WJ4 A;  2ZVN A;  2O2V A;  1JRO A;  3LJ3 A;  4IG7 B;  3VFK A;  1DOY A;  1KH0 A;  3R2I A;  4JE3 B;  5DPS A;  4MSQ B;  1C3T A;  3MC9 A;  1C79 A;  4EOY A;  4W9L A;  4YTP B;  3Q3N C;  5GMV A;  1EM7 A;  3B08 A;  3IT4 B;  3QX1 A;  2GBR A;  2WDV B;  4DHZ B;  3RZW C;  3AE8 B;  1N61 A;  5C23 A;  1HTQ A;  3JSV A;  3TUO A;  4W9C A;  1HEZ E;  3X23 A;  3TCA A;  5BYR A;  4FN2 A;  3GZN I;  1RLF A;  1H8C A;  1FRD A;  2Y5B B;  1P7E A;  1QIL A;  3PT2 B;  4HLE A;  1I35 A;  3ZGZ A;  1QOG A;  3H1U A;  3MHZ A;  4WJN A;  2WDQ B;  3TL5 A;  2MLB A;  1ZP0 B;  2PE9 A;  2BS3 B;  4OVU A;  4YL8 A;  4MH8 A;  1Q5W B;  2ZPY A;  4AJY B;  3HK0 A;  2BYE A;  1L4D B;  2MJ3 A;  2YVC A;  1LQB A;  2IGG A;  2I2Y A;  3WAP A;  3H9D A;  1C4A A;  1ZOY B;  3TEW A;  2WXH A;  2N1V A;  1E7U A;  1OTR B;  2DWQ A;  3ETR A;  1WGR A;  3MJ5 A;  2PMV A;  4AWJ A;  3L08 A;  1HTO A;  3OJ4 B;  5EE3 A;  5IP4 D;  2IDY A;  2KDE B;  1I4P A;  1I42 A;  2V0G A;  4I6P A;  2AWT A;  2PEA A;  2JY6 A;  4TV3 A;  2AX5 A;  4WAF A;  2YEP B;  3RNF C;  3JSV B;  2KMA A;  4NAW B;  3H8H A;  2IBI B;  2KQS A;  4JX1 C;  3O13 A;  2LJI A;  2VZK D;  4A6Q A;  3M3J A;  2N9E B;  1EF5 A;  3NZS A;  3RNB C;  2WXG A;  4AUQ C;  1XLN A;  2XBB C;  2LXC A;  4W9I A;  2K3U A;  3R3M A;  3HIZ A;  4WH4 A;  2K8H A;  1UUP A;  1FCC C;  1F77 A;  1R7S A;  2LWP A;  2BQQ A;  4YT0 B;  1J7A A;  3TBL D;  1KLV A;  2KN5 A;  1BT0 A;  1WGD A;  1FM0 D;  3OG5 A;  3VRB B;  1TS3 A;  4FJV B;  3KLS X;  3ZUN A;  3DDC B;  1FD6 A;  3AH7 A;  1L2N A;  5E6J A;  4N6E B;  3M95 A;  2JVC A;  2N9K A;  2EMT A;  1I7H A;  2CR5 A;  4DHJ B;  3NUH B;  2GMI C;  1WXS A;  3Q69 A;  4FHK A;  4XGA B;  3LYY A;  2LXA A;  3QAQ A;  3Q8E A;  1QOF A;  1J8C A;  1VJK A;  2PW9 A;  4GDK A;  1IBX B;  1N63 A;  4NPN A;  3BII D;  2CU3 A;  3NS8 A;  2NBV B;  4BBN F;  1KRH A;  3AV8 A;  3Q8F A;  3TEX A;  1E9M A;  5D94 A;  3N1X C;  3B0A A;  1KM7 A;  3QQ8 B;  3ZJV A;  3EFC A;  2RPQ A;  5HHD G;  4ICV A;  4WWM A;  5I4D A;  2WLB A;  4ZRI A;  2BPS A;  4J6I A;  1OEY J;  3V6E B;  2J0J A;  4ANU A;  3L16 A;  2MP2 B;  4JGH B;  4BOZ B;  4HRS A;  4NNJ B;  1YIW A;  1U4A A;  2OJW A;  5D3I B;  3DBH I;  2K22 A;  5EE1 A;  5JZE B;  2FBW B;  3QCA A;  3PS6 A;  1PFD A;  3QWZ B;  1CZP A;  4WWP A;  3W1Y A;  3KUZ A;  3PRP B;  1YMH E;  3P4S B;  4KIK A;  1V80 A;  2K8C A;  1TJE A;  1KF6 B;  1SB3 C;  2TSS A;  1DYQ A;  4XWT A;  4N9F 4;  2KJR A;  3UIN B;  1LXD A;  5FK9 C;  2MEK A;  4A3P A;  4ACF A;  3DCG A;  4DK5 A;  4HDO A;  1E5W A;  1YQB A;  2H88 B;  1WYW B;  2H89 B;  2O6V B;  1F0Z A;  4BKS D;  4EUT A;  1C1Y B;  1KJT A;  1ZW7 A;  3KH0 A;  1NVI D;  2WS3 B;  4HPL B;  3OJ3 A;  5E6P A;  2KAJ A;  1T0R C;  2MW5 A;  2AQ3 B;  2WXM A;  3VTW A;  3OWE B;  5DPT A;  4DQO C;  2HE7 A;  1WGH A;  1F2R C;  1WSP A;  1TZ1 A;  3AEF B;  3ZXR A;  2X8X X;  3AN1 A;  4W9H A;  2LHD A;  4DDG D;  3APD A;  1ZXH A;  4UDU C;  4LTU A;  3ZW3 A;  2WDT B;  4KDL B;  3P1M A;  1EUV B;  3PHX B;  2KVZ A;  1WX7 A;  1V8C A;  3W5U B;  2DAF A;  3SR6 A;  3RZF A;  4ANX A;  4ASW C;  2KN4 A;  4RNA A;  2KD0 A;  2KX0 A;  3JVZ X;  1L7Y A;  1WXA A;  4RM8 A;  1TS4 A;  2RD0 A;  2JSV X;  1UBQ A;  4PS8 A;  4GDK B;  2DBY A;  4ZOH C;  2ZZP B;  4LDT D;  3DBR I;  2AQ1 B;  4K3B A;  4ANW A;  1EO6 A;  2ASQ A;  1NBF C;  3Q8B A;  3PRE A;  1QT9 A;  3ZRC A;  2WU2 B;  4DWF A;  1VZ7 A;  1J7C A;  2R2O A;  4B0E A;  4FA6 A;  4O1N A;  5AUK A;  1ZUD 2;  5AEK B;  1FO4 A;  4GIV A;  1Q1O A;  1RYJ A;  4GN1 A;  3VRA B;  4F7Z A;  1TS2 A;  3E9S A;  4GU2 A;  4RGT A;  1GB4 A;  1B1Z A;  1N60 A;  4NAW A;  3A4R A;  2L3Z A;  4NZL B;  1QZE A;  4BZA A;  1UGJ A;  4MJS A;  1NI3 A;  3AE7 B;  1VR9 A;  4A55 A;  4GGQ A;  1P1A A;  2KJ6 A;  3KUD B;  4GLS C;  4A9A A;  1WM2 A;  2UYZ B;  3N3K B;  1C78 A;  3LB8 C;  3L10 B;  4JLC A;  1UWM A;  4EZK A;  1B9R A;  1MVK A;  2WX0 A;  4OVV A;  3VQI A;  1A5R A;  3ZQ4 A;  2JZZ A;  3W2D A;  2KZR A;  3A1Q B;  3KVF B;  4MJS B;  4KGS A;  3KW5 B;  2MQJ A;  2DEN B;  3MJW A;  1BML C;  2Y5P A;  2GI9 A;  3NOB A;  1YX6 B;  4TQ1 A;  1Z2M A;  3A1Q A;  5J2R A;  4LCD E;  2WXO A;  2E3T A;  2G3Q B;  4FBJ B;  4C00 A;  2BYF A;  3ZJT A;  3IBE A;  2JF5 A;  2ZW0 A;  1TZO A;  3PSE B;  4K7U A;  5D2M B;  4HWI B;  3VR8 B;  2NS5 A;  2JT4 B;  1SE4 A;  2NPT B;  4EE2 A;  3RNG C;  2DYO A;  2LEK A;  1VRA B;  3P2B A;  4LNI A;  5HG2 A;  4IWO A;  2N0S B;  4RGO S;  1JWB D;  1WI0 A;  2LGI A;  3H7S A;  2DZI A;  1E8Z A;  2BTE A;  3VTU A;  1IUE A;  4II2 B;  3EEC A;  2B3A A;  4PS3 A;  4M01 A;  4P1B C;  2WWZ A;  3M63 B;  4N58 A;  4P16 A;  2MWS B;  1SEB D;  2KWV B;  1TIF A;  1ENF A;  3V6C B;  1SE2 A;  1V49 A;  3ZNZ B;  3WCQ A;  2N9L A;  4BKS A;  2IO3 B;  4PS7 A;  1TBE A;  1TS5 A;  1WXV A;  2CJN A;  1L6V A;  2N9P C;  3NVY A;  1JRP A;  5AZH A;  3RYT A;  3DOW A;  3PTF C;  5HKH A;  4RGN A;  4E74 A;  2KKC A;  2KHW B;  1R4M I;  2J53 A;  4XDC A;  2RGF A;  1AN8 A;  2WXK A;  2KLC A;  3U52 E;  1E7P B;  5BMG A;  2JZP A;  3P4P B;  1NEK B;  3UIP B;  3BVZ A;  2LGD A;  5LXH A;  1YQ3 B;  4RF0 A;  1FXI A;  1UF0 A;  5CHV C;  2REX A;  4LJP B;  1OEY A;  2XK5 B;  1YN5 A;  1K8R B;  4EFO A;  2RDH A;  2DZK A;  3PLU A;  1L0X B;  4RGM A;  1YN4 A;  3AB5 A;  4TKN A;  3RNA C;  1XLO A;  2BT6 A;  1IGC A;  2MJD A;  2LFI A;  3U30 A;  1D4B A;  4S0R A;  2GBK A;  2AL6 A;  1I4X A;  2INN E;  1L6U A;  1IP9 A;  3QK0 A;  3SD5 A;  2NCN A;  1TTN A;  3B1L X;  3E56 A;  1BUI C;  4HDQ A;  1WMH B;  2BW2 A;  1P98 A;  2M0X A;  3HRD D;  1XLP A;  3ZKJ C;  2LUM A;  1A70 A;  3ZNH B;  2JXT A;  4HPP A;  1EWY C;  2D3C A;  2C9W B;  2D3B A;  3RD2 A;  4KX6 B;  3VDZ A;  1WX8 A;  1P7F A;  1ZPS A;  3FIL B;  2BB6 A;  3M62 B;  3KWL A;  1JCK B;  1ET6 A;  4L2Y A;  1T0Y A;  1D5M C;  3NVZ A;  2N7D A;  4XYC A;  4P7I A;  2CHZ A;  4WJP A;  3Q8C A;  4WIP A;  4IM3 A;  2NTT A;  1WE7 A;  1WGK A;  3WAM A;  4G11 A;  1TKE A;  3BVM A;  4W9G A;  1RWS A;  1WWT A;  2YLM A;  1SJH D;  3PZ8 A;  5J17 A;  4EZJ A;  4MGI E;  1K53 A;  1AWD A;  1FFU A;  2QJL A;  3PZD A;  4CO7 A;  2J7Q B;  2KDB A;  3AI5 A;  2FCS A;  1HXY D;  1T0S C;  3C19 A;  1NYR A;  2AEH A;  4II3 B;  4LNF A;  3IHP C;  1WRI A;  3K9P B;  2FNJ B;  1GC7 A;  5G5H A;  1V9J A;  3FAH A;  4OZA A;  3A4S C;  1C76 A;  1WJN A;  3UGB B;  1WZ0 A;  1FFV A;  2IND C;  2QHO A;  4IUM B;  1ACC A;  1VLB A;  2BGF A;  2SAK A;  2UU7 A;  3Q3J A;  4LDT B;  3AE2 B;  3ZTD A;  1WZ3 A;  5BYQ A;  3TMP B;  1QKZ A;  5JHA A;  1GC6 A;  2WXL A;  1XEE A;  4FXC A;  3K9O B;  1D5X C;  3ZLZ A;  2FIF A;  2A5U A;  3DVN U;  2W55 A;  2QMT A;  1Q10 A;  2OHF A;  2AL3 A;  4B95 A;  3Q3M C;  2LGX A;  3HHM A;  2EKI A;  3WAN A;  2KO3 A;  3SEB A;  2NBU A;  3HUI A;  3BVG A;  2IO0 B;  2G4S A;  2G9H D;  1JWA D;  2KVR A;  4E3C A;  2KWU B;  3DWM A;  3GZN B;  2IO2 B;  4QAY A;  4ANV A;  2WYQ A;  3I9V 1;  1MG8 A;  2WQY B;  2ZNV B;  3RFZ B;  3C8Y A;  1L4Z B;  1UBI A;  2KTF A;  3L0W B;  2IYD B;  3IVF A;  2GBN A;  3NG0 A;  1V5T A;  4LNN A;  4HJK A;  2LAS A;  1YJ1 A;  1RFA A;  2QEJ C;  2QDF A;  4A20 A;  4IM2 A;  1JAL A;  1H4R A;  2KDM A;  1E8Y A;  3AEE B;  2K0P A;  1RAX A;  1SGH A;  3AUL A;  3VUY A;  3AEB B;  3JYU A;  1ZDV A;  2C7H A;  2K25 A;  3PRZ A;  2L0T A;  4K1R B;  2DHZ A;  3U8Z A;  5FKA C;  4K81 A;  2W3R A;  1Y56 A;  2BKR B;  1SBB B;  1LM8 B;  2RR9 A;  3ZYY X;  2HTM E;  3WAO A;  1FNU A;  1SJE D;  3DWG C;  2KWD A;  4DXA B;  2WGS A;  3EHV A;  3LDZ E;  1WF9 A;  2KNB A;  3RUL A;  2N7J A;  3RI7 C;  2GOW A;  3EUB 2;  1GAQ B;  3AE9 B;  1P9D U;  3P63 A;  4LK0 M;  1ZKH A;  2MBE A;  3DVG X;  2KJH B;  2Z8L A;  1C9F A;  1ZXI A;  1KLU D;  4G3X B;  4NAM A;  3I63 C;  2KK8 A;  4JPS A;  2LD9 A;  1GUA B;  2KQ4 X;  2WXJ A;  2KT7 A;  3P4Q B;  2WXR A;  4BKT A;  1PQS A;  3R7Q A;  1FPY A;  3DHI C;  1NEN B;  4WWO A;  5IA7 A;  2WDR B;  2ZEQ A;  1ZE3 D;  1IPG A;  5KHQ A;  1T0Q C;  1XD3 B;  1KOT A;  3ZTC A;  1X1M A;  3RNC C;  2BYV E;  3VAW A;  2MX2 A;  1K52 A;  2C60 A;  4M00 A;  1D5Z C;  4W9E A;  4KVG B;  1M94 A;  2BF8 B;  3T3O A;  3WAL A;  4PYZ A;  3KQ4 A;  3W5V B;  2RMM A;  3IXS A;  3PLV A;  4K7W A;  3NY5 A;  1C77 A;  2L00 B;  3Q3O C;  1FNW A;  3DVN V;  3DPD A;  1DOI A;  2MBH A;  5E6O A;  3ZXV A;  2FUG 1;  4FAD A;  3ZJU A;  2G4D B;  3Q6B A;  2XEW A;  4PK1 A;  3QJZ A;  4BOS C;  1N5W A;  5C1Z A;  1P0R A;  2FAZ A;  1F1H A;  4HK2 A;  4DDI D;  3D32 A;  4KV2 A;  3H7P A;  1EU4 A;  1FXA A;  2LHE A;  4KSK C;  4HJG E;  3BZD B;  2MBB B;  5DPR A;  3PGE A;  2WXP A;  4EEW A;  2INP E;  1F9J A;  4RF1 A;  2K6Q A;  2ON8 A;  3CSF A;  3V3X A;  2W54 A;  1SF0 A;  2FCN A;  2N9X A;  3L54 A;  5C2T B;  1N62 A;  4C7Z A;  1SIJ A;  5FR6 A;  2L83 A;  4BFR A;  2ZVO A;  3U4E G;  1EF1 A;  3TEY A;  4YXD B;  2I38 A;  4A8X C;  4M02 A;  2OJR A;  3VUX A;  1WJ6 A;  1YNT E;  1HZ5 A;  3NZ3 A;  4BBN C;  1VDV A;  2SEB D;  1TYG B;  3ZRF A;  2I1J A;  4FUL A;  3T8M A;  3MP9 A;  4MGK E;  5G55 A;  3AE6 B;  1XQQ A;  3B9J A;  4MGY E;  4ZDV A;  2J0K A;  3MTN B;  2NBW B;  2UWQ A;  4L1B A;  4CQN A;  1MFW A;  4K7S A;  1I4Q A;  4TSS A;  1GB1 A;  2IPK D;  4G0N B;  2J52 A;  1MG4 A;  3W9C B;  1L5P A;  5J18 A;  2L05 A;  1Z5S B;  3U7Z A;  3W1S C;  3VR9 B;  4C4V B;  5L83 A;  4GDL B;  2JUO A;  1FMA D;  2JWZ A;  5EE9 A;  1I4R A;  2EKE C;  5D3D A;  1V6E A;  3T9L A;  2M1M A;  1RM6 C;  2K8B A;  4L23 A;  3UQB A;  2DAJ A;  1E6E B;  3AU5 A;  4URK A;  3JW0 X;  3N30 A;  3ALB A;  1T6B X;  3AU4 A;  2MCN B;  2D07 B;  1YOV B;  2LVP A;  2K9X A;  2Y5C A;  5DPW A;  2KFK A;  5CHW A;  3RT3 B;  4NJ6 A;  4TQ0 A;  2KC1 A;  3V60 A;  4DXF A;  4GSW A;  2PTL A;  5BYS A;  3AE4 B;  4M0W B;  1I4H A;  2PLP A;  4W9K A;  3CF6 E;  4F8C B;  4C80 A;  2KQ7 A;  3NJT A;  3MHS D;  3ZIM A;  3FKY A;  3GB1 A;  1J0G A;  3AE1 B;  5BMH A;  3RNE C;  3IT6 B;  4X57 B;  2ZW1 A;  2DZJ A;  2ZPN A;  3DBR B;  4KDI C;  4WJQ A;  1WH3 A;  3TJP A;  3U7D A;  2CU1 A;  4TMA B;  1WGY A;  2WNM A;  2VH2 A;  3KYC D;  3AEC B;  1M4V A;  3IFW B;  1JW9 D;  3WIM A;  4CYE A;  3VUW A;  2L32 A; 
#chains in the Genus database with same CATH homology
 2R2Q A;  3ZNI D;  1L2N A;  4DBG A;  4HXD A;  4LJO B;  3M62 B;  4HVB A;  4HCN B;  4AOF A;  2A4Z A;  3M95 A;  2W9N A;  2JVC A;  2LUE A;  4I6N B;  4WQO B;  1T0Y A;  1YD8 U;  2KMC A;  2N7D A;  3ML8 A;  2EMT A;  4P7I A;  1V86 A;  4KSL C;  2CHZ A;  2CR5 A;  3UQA A;  4WJP A;  4DHJ B;  1FXT B;  2GMI C;  4IM3 A;  3ZDM C;  1WE7 A;  4JQW C;  3BY4 B;  1WXS A;  3WAM A;  1Y8R C;  4G11 A;  4MDK E;  4MGZ E;  4W9G A;  1WMH A;  4FHK A;  4XX5 A;  2YLM A;  3PHW B;  4IC7 B;  2KWC A;  3V62 A;  5J17 A;  4KIK B;  2LXA A;  3DQV A;  3QAQ A;  4EZJ A;  1J8C A;  3W1S A;  2M4N A;  4MGI E;  5G2N A;  2O6V D;  4GDK A;  2KFK B;  3PZD A;  4NPN A;  2MBQ A;  4B9K A;  2HD5 B;  2NR2 A;  4CO7 A;  4IWP A;  2J7Q B;  2KDB A;  2NBV B;  2IO1 B;  2FCS A;  3AI5 A;  2EMS A;  3NS8 A;  4BBN F;  2AEH A;  3QA8 A;  2L0F A;  2KTR A;  4II3 B;  5D94 A;  4MEM A;  2ZJD A;  3IHP C;  3B0A A;  3K9P B;  2FNJ B;  1GC7 A;  1KM7 A;  2LJ5 A;  3QQ8 B;  3SU8 X;  2MP2 A;  1V9J A;  4W9F A;  2RPQ A;  3A33 B;  1IYF A;  4ICV A;  3I3T B;  4DHJ D;  2C7N B;  1JRU A;  3TIX A;  3A4S C;  2BPS A;  2WX1 A;  4J6I A;  1WIA A;  4ZRI A;  3RCZ A;  1OEY J;  4NJ7 A;  3V6E B;  1WJN A;  3H7P B;  2KDI A;  3C0R B;  2J0J A;  3A9K A;  4W9J A;  5D6J B;  3L16 A;  3UGB B;  4ANU A;  1ZGU B;  1WZ0 A;  2MP2 B;  3O65 B;  4JGH B;  4PYU A;  3ML9 A;  4BOZ B;  3QIJ A;  4NNJ B;  2QHO A;  1Q0W B;  2KXJ A;  4IUM B;  2BGF A;  2V4L A;  1R4N I;  2V1Y A;  4GB9 A;  1YIW A;  4GDL A;  1U4A A;  3Q3J A;  4LDT B;  2Z0D B;  4HCP B;  1WZ3 A;  4IWQ A;  3ZTD A;  2LRW A;  4AJW A;  2VRR B;  2Z59 B;  3DBH I;  5JZE B;  4XZ4 A;  3TMP B;  2Z0E B;  3QCA A;  3PS6 A;  5JHA A;  1NI2 A;  3QWZ B;  1GC6 A;  2N1W A;  2C7M B;  3K9O B;  4WWP A;  4E71 A;  3W1Y A;  3KUZ A;  3PRP B;  2D3G A;  4KIK A;  1V80 A;  2K8C A;  3ZLZ A;  2FIF A;  2A5U A;  3DVN U;  2KAN A;  2XK5 A;  2MSE D;  3R7R A;  5LXI B;  3NHE B;  4N9F 4;  2KJR A;  2AL3 A;  4GOC A;  4B95 A;  3UIN B;  1LXD A;  1WRD B;  2LGX A;  2LRU A;  3HHM A;  3WAN A;  2KO3 A;  2L7R A;  2ZNV C;  2D2Q A;  2KTR B;  1TGZ B;  2KDF B;  2NBU A;  2I1K A;  3AXC A;  2IO0 B;  3DCG A;  1E5W A;  2G4S A;  4HDO A;  4MSM B;  1YQB A;  4DK5 A;  1WYW B;  2O6V B;  3CST A;  5JHB A;  2KVR A;  1IP9 A;  4E3C A;  2KWU B;  5BO4 B;  2IO2 B;  1AAR A;  4BKS D;  4EUT A;  3HM3 A;  1C1Y B;  1WR6 E;  4ANV A;  1KJT A;  3BIN A;  1ZW7 A;  2WYQ A;  2DZM A;  1MG8 A;  3KH0 A;  4JIO U;  3EFU A;  2PJH A;  2ZNV B;  3APF A;  2JPH A;  1E90 A;  2NVU I;  4EZL A;  1V5O A;  2JZ3 B;  1UBI A;  4HPL B;  3OJ3 A;  5E6P A;  3VH3 B;  2KTF A;  2MW5 A;  3VTW A;  3L0W B;  1VD2 A;  5DPT A;  2IYD B;  2HE7 A;  1UH6 A;  3IVF A;  2OOB B;  1P3Q U;  2GBN A;  1WGH A;  1V5T A;  2FCQ A;  2PE6 B;  2RSU A;  4HJK A;  2LAS A;  3VVW B;  1YJ1 A;  1TZ1 A;  2DX5 B;  4W9H A;  3UF8 A;  1RFA A;  2LVQ A;  4DDG D;  3APD A;  3R66 C;  4A20 A;  2CKH B;  4TUU A;  4M8N A;  4IM2 A;  1H4R A;  4EKU A;  3OAW A;  1E8Y A;  1J19 A;  2HTH A;  2K6D B;  3ZW3 A;  4IM0 A;  2WDT B;  4NQL B;  3DVG Y;  4KDL B;  1WR1 A;  4FHJ A;  1RAX A;  1SGH A;  3AUL A;  3VUY A;  1EUV B;  3PHX B;  3JYU A;  1WX7 A;  2C7H A;  4KZ0 A;  2K25 A;  3PRZ A;  2L0T A;  4K1R B;  2DHZ A;  2DAF A;  4B6W A;  3U8Z A;  5CTR C;  1G6J A;  4K81 A;  3RZF A;  4ANX A;  3V61 A;  4ASW C;  3RUI B;  2BKR B;  1WGG A;  1LM8 B;  2KD0 A;  2D11 A;  2KX0 A;  2RR9 A;  2V3S A;  3ENE A;  3JVZ X;  4WJO A;  2LVO A;  1L7Y A;  1WXA A;  3WAO A;  4KZC A;  4CHK A;  4RM8 A;  1WXM A;  4DXA B;  1YX5 B;  3EHV A;  4MM3 A;  4RMA A;  3LDZ E;  3ZVV A;  2RD0 A;  3L13 A;  1UBQ A;  4PS8 A;  1WF9 A;  2KNB A;  4GDK B;  3RUL A;  2ZZP B;  2GOW A;  4LDT D;  1P9D U;  2D10 A;  3VXW A;  4M8M A;  3DBR I;  1ZKH A;  4ANW A;  1EO6 A;  2ASQ A;  5TR5 A;  3ZDT A;  1NBF C;  2JRI B;  3PRE A;  5AZF A;  2MBE A;  3DVG X;  3QC8 B;  2KJH B;  3ZRC A;  4MEL A;  3HM6 X;  1D3Z A;  4G3X B;  2HJ8 A;  4DWF A;  2FUH B;  3APC A;  2KK8 A;  1V2Y A;  2DYM A;  1GUA B;  2AYO B;  2LD9 A;  2R2O A;  5AZG A;  3SHQ A;  3UIO B;  4FA6 A;  5AEK B;  4GIV A;  1ISN A;  1E8X A;  2IY1 B;  5D7G A;  4BKT A;  5L95 C;  1PQS A;  2LZ6 A;  1Q1O A;  1SIF A;  3ECI A;  4GN1 A;  5DCN A;  3A9J B;  4F7Z A;  4GU2 A;  3R7Q A;  4WWO A;  1UEL A;  5IA7 A;  2ZEQ A;  1WE6 A;  5E6N A;  3EC8 A;  4NAW A;  3KUC B;  3A4R A;  1IPG A;  5KHQ A;  2MA9 B;  4ZRJ A;  2L3Z A;  1XD3 B;  5IAA C;  1QZE A;  4MJS A;  4G50 A;  1GJZ A;  1KOT A;  2C5L C;  1LFD A;  2NPT A;  3ZTC A;  2O2V B;  1X1M A;  2BYV E;  4GGQ A;  3VAW A;  3A9J A;  5CHF A;  1P1A A;  1OQY A;  2KJ6 A;  3KUD B;  4F1S A;  1S1Q B;  3IG3 A;  4JL9 A;  1WM2 A;  1WY8 A;  2UYZ B;  2MX2 A;  3N3K B;  2C60 A;  4W9E A;  4W9D A;  3N32 A;  3L10 B;  1M94 A;  2KFJ A;  4FJY A;  2LGY A;  2KOX A;  4JLC A;  2BF8 B;  2FID A;  3X0W A;  2BKF A;  4EZK A;  3WAL A;  4PYZ A;  3GOE A;  2WX0 A;  2BWF A;  4ZYN A;  4OVV A;  3VQI A;  1A5R A;  2KC2 A;  2JZZ A;  3PLV A;  4K7W A;  3NY5 A;  2KZR A;  3A1Q B;  2L00 B;  3KVF B;  3QHT A;  4MJS B;  3KW5 B;  2MQJ A;  1WJU A;  2DEN B;  3MJW A;  1WX9 A;  2M8S A;  2PPH A;  3DVN V;  3DPD A;  2MBH A;  3NOB A;  5E6O A;  1SE9 A;  1YX6 B;  1S3S G;  3L17 A;  4TQ1 A;  1Z2M A;  3A1Q A;  3ONS A;  5J2R A;  4FAD A;  4LCD E;  2G3Q B;  2LI5 A;  2G4D B;  3WA0 A;  4FBJ B;  2XEW A;  2BYF A;  3QJZ A;  1GG3 A;  1RRB A;  3IBE A;  2JF5 A;  2L76 A;  2FCM A;  4BOS C;  5C1Z A;  1P0R A;  2GBJ A;  3PSE B;  4K7U A;  4BKG A;  2FAZ A;  5D2M B;  2L8J A;  3DBS A;  4HK2 A;  4DDI D;  4HWI B;  3D32 A;  3A9K B;  4KV2 A;  2NS5 A;  3H7P A;  1WJ4 A;  2ZVN A;  2JT4 B;  2O2V A;  3VFK A;  3LJ3 A;  4IG7 B;  2NPT B;  4KSK C;  2DYO A;  3PVL A;  2MBB B;  5DPS A;  1UZX B;  4MSQ B;  2IY0 B;  1WFY A;  2K1F A;  4WAA A;  4W9L A;  4EOY A;  1C3T A;  5DPR A;  3PGE A;  5GMV A;  3P2B A;  3PV1 A;  4EEW A;  1F9J A;  3B08 A;  3QX1 A;  2KLG A;  4IWO A;  4WWN A;  2GBR A;  4IW0 A;  2N4F A;  2K6Q A;  4DHZ B;  1WI0 A;  3CSF A;  3RZW C;  3H7S A;  2FCN A;  2N9X A;  3L54 A;  2DZI A;  2ZCC A;  1E8W A;  1E8Z A;  4NQK E;  4ZRK A;  3VTU A;  5JH5 C;  5C23 A;  4II2 B;  3EEC A;  2B3A A;  5FR6 A;  4PS3 A;  1GNU A;  4BFR A;  3JSV A;  3VHT C;  4W9C A;  4ICU A;  2ZVO A;  2WWZ A;  3M63 B;  3X23 A;  2MWS B;  2G45 B;  3TCA A;  2KWV B;  4XC2 A;  4BVU C;  1EF1 A;  4FN2 A;  3GZN I;  4AP4 C;  1RLF A;  1H8C A;  3V6C B;  2Y5B B;  2OJR A;  3PT2 B;  3VUX A;  1WJ6 A;  4HLE A;  4BBN C;  1V49 A;  1I35 A;  3ZNZ B;  2CHW A;  3CMM B;  3ZRF A;  2I1J A;  4FUL A;  3T8M A;  4BKS A;  2IO3 B;  4PS7 A;  2JXX A;  1TBE A;  4MGK E;  4A3P A;  5G55 A;  1XQQ A;  3H1U A;  4FLH A;  1WXV A;  4MGY E;  2N9P C;  4WJN A;  4ZDV A;  2GBM A;  2J0K A;  3MTN B;  2O6V A;  2NBW B;  3TL5 A;  2MLB A;  5AZH A;  1V81 A;  2PE9 A;  2UWQ A;  3RYT A;  3DOW A;  4OVU A;  4YL8 A;  3PTF C;  4K7S A;  1Q5W B;  5HKH A;  4KVG B;  2ZPY A;  1XT9 B;  5KHO A;  4AJY B;  4G0N B;  3HK0 A;  1VCB A;  2BYE A;  1E7V A;  3VTV A;  4E74 A;  4DHZ E;  3SDL C;  2KKC A;  2YVC A;  2KHW B;  1R4M I;  1LQB A;  4GXB A;  5J18 A;  5EDS A;  2RGF A;  2L05 A;  1Z5S B;  3W1S C;  2KLC A;  3WAP A;  5L83 A;  3VH4 B;  4GDL B;  3ZNG C;  1NDD A;  3H9D A;  3OLM D;  2JUO A;  2JWZ A;  3NZU A;  2MBO A;  5LLI A;  2CHX A;  2N1V A;  3UIP B;  1E7U A;  2EKE C;  2LGD A;  1OTR B;  1V6E A;  3T9L A;  5LXH A;  3PRM B;  1WM3 A;  2M1M A;  1WGR A;  4AWJ A;  2K8B A;  3L08 A;  4NY0 A;  3H6N A;  3OJ4 B;  3UQB A;  2DAJ A;  3AU5 A;  5CHV C;  1CMX B;  4URK A;  2KDE B;  2REX A;  3JW0 X;  3N30 A;  3S2A A;  2BWE S;  2CS4 A;  1OEY A;  2XK5 B;  2ZCB A;  4I6P A;  4LJP B;  1I42 A;  2AWT A;  2PEA A;  2JY6 A;  4TV3 A;  3ALB A;  1K8R B;  3AU4 A;  2MCN B;  2D07 B;  4EFO A;  2DZK A;  2LVP A;  2M17 A;  3PLU A;  5DPW A;  2KFK A;  4TKN A;  3JSV B;  2KMA A;  3KYD D;  2JRH A;  4GMV A;  5CHW A;  4NAW B;  2IBI B;  2KQS A;  3RT3 B;  4NJ6 A;  4TQ0 A;  2KC1 A;  3QAR A;  1UGM A;  3V60 A;  4GSW A;  3U30 A;  4HPM B;  2GBK A;  5CX3 A;  2AL6 A;  2N7E A;  3M3J A;  2K39 A;  4M0W B;  3ZO5 B;  4W9K A;  4F8C B;  2N9E B;  3CF6 E;  1EF5 A;  3NZS A;  3QK0 A;  3SD5 A;  4AUQ C;  3Q3F A;  4I6L B;  3PPA A;  1HE8 A;  2NCN A;  2XBB C;  2LXC A;  4W9I A;  1TTN A;  3B1L X;  2KQ7 A;  2MRP A;  3R3M A;  3MHS D;  3ZIM A;  4A3O A;  3HIZ A;  4HDQ A;  1WMH B;  2K8H A;  1J0G A;  3DBL I;  4RM9 A;  4FJZ A;  1P98 A;  4X57 B;  2M0X A;  2LWP A;  2DZJ A;  2ZPN A;  4KDI C;  4MH0 E;  4WJQ A;  1WH3 A;  3TBL D;  1OGW A;  3TJP A;  3ZKJ C;  1KLV A;  3U7D A;  1UD7 A;  2CU1 A;  3ZNH B;  2IZV B;  2KN5 A;  1BT0 A;  1WGY A;  1WGD A;  3KYC D;  2DYB A;  3IFW B;  2KX3 A;  4FJV B;  3WIM A;  4CYE A;  2J0M A;  2C9W B;  3ZUN A;  3RD2 A;  3DDC B;  3VDZ A;  3VUW A;  1WX8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...