3QCAA

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FAS-associated factor 1
publication title Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qcaA00
3M3JA 2KJ6A 4WJNA 1L7YA 2LRUA 2JPHA 2K6QA 4GDKB 4CYEA 2LWPA 2OOBB 3VAWA 1WJNA 2KDIA 3A9JA 2KFKA 3PS6A 4MGYE 4AJYB 3GZNI 1K8RB 1RRBA 2CHZA 2EKEC 2LVPA 3ONSA 2WYQA 4G0NB 3PRPB 4F8CB 1RLFA 4MSQB 1HE8A 2N4FA 2FCNA 4FN2A 4AP4C 3RT3B 3K9PB 3CSTA 2RPQA 4GDLB 2FCMA 2KC2A 4II3B 1WGDA 3AXCA 3NOBA 3IVFA 2KK8A 2JRIB 2DZMA 2MRPA 3SU8X 3TJPA 4PS8A 1V5OA 2BWFA 3VXWA 4NJ7A 2K39A 2DYOA 3DBLI 3QWZB 3EFUA 5CHWA 4FJVB 1WY8A 3ZRCA 5JHBA 2ZCBA 4JGHB 4FULA 4N9F4 4ANUA 4IW0A 2Y5BB 4PYUA 2C5LC 1Q0WB 2KANA 3MJWA 3PHXB 1VCBA 2IBIB 4MJSA 1P0RA 4YL8A 2JXXA 2K8HA 2XK5A 3DCGA 4NAWB 2V3SA 5D2MB 3T8MA 3JSVB 1EO6A 2C7NB 2C7HA 1V80A 3NZUA 4KSLC 3ZNID 4GB9A 4M8MA 3H7PB 1H4RA 2ZNVB 2B3AA 2UWQA 2JUOA 3PREA 2MA9B 2C9WB 4MM3A 3ZDMC 5BO4B 4TV3A 1WX7A 3RCZA 3VH3B 3VTWA 2KZRA 4EUTA 2IO0B 3ZO5B 2DZIA 5G55A 4CHKA 2KTRA 1WGGA 1WXVA 4W9DA 2J0JA 4BOZB 3A1QA 2DX5B 4EFOA 3BY4B 3VHTC 2GBKA 4EZKA 1LFDA 4ZRJA 2KJHB 1JRUA 4DHZB 4BKSD 3GOEA 3PSEB 2BYFA 1EUVB 4KIKB 3VUXA 5LXHA 1WF9A 1SIFA 3WAMA 3ZRFA 3DBSA 4K7WA 3TIXA 3H6NA 4MEMA 4HDOA 2REXA 3A9KA 2M0XA 1VD2A 4FADA 4GSWA 2MLBA 4B6WA 2L00B 4GN1A 3OLMD 3QK0A 1KJTA 2N9PC 2LVOA 3HIZA 2MWSB 3QHTA 1E8XA 4AWJA 1WMHB 4NQKE 3ZDTA 2D10A 2PPHA 4BKTA 3JW0X 3NY5A 3PTFC 2IYDB 2KMAA 2LGYA 3PV1A 4BFRA 2ZZPB 2XBBC 1V5TA 1TGZB 1UELA 1WJUA 3LDZE 1EF1A 4M0WB 1E8YA 1FXTB 1UBQA 3OAWA 1UZXB 1WJ4A 2WX1A 3PLUA 4TUUA 4BOSC 3RZWC 2KDFB 3M63B 2WX0A 2KC1A 2LXCA 2MP2A 2GBNA 3QIJA 5FR6A 4DDGD 1SE9A 2NPTA 3PT2B 3UF8A 1X1MA 3ZNZB 4FBJB 1Q5WB 4PS3A 1P3QU 3L16A 4G50A 1V86A 2J0KA 5CHFA 3QQ8B 2N7DA 4GDKA 1YD8U 4AUQC 2RR9A 2DYBA 4GU2A 2DZKA 3UIOB 4GXBA 2I1KA 3PGEA 1Z5SB 2GMIC 4TQ1A 3N3KB 5GMVA 4KVGB 3N32A 2XEWA 2MBOA 4BKGA 4XX5A 3PLVA 3EHVA 1ZGUB 2LRWA 4P7IA 4KDIC 1WR1A 3DVNU 4WWOA 5LLIA 1GNUA 2KQSA 1S3SG 1OEYA 2MBBB 5D7GA 1YX6B 2CHXA 2R2QA 2D3GA 3VVWB 3W1SA 4GDLA 5C1ZA 1NI2A 2FUHB 5E6PA 2L0TA 2D07B 3RD2A 2AL3A 1GC6A 5C23A 2KWVB 1M94A 3RZFA 4K1RB 1J8CA 3APDA 4BBNC 4GOCA 3SD5A 4XC2A 1WGRA 3DQVA 2FNJB 1WR6E 2C60A 5JZEB 2KDEB 1QZEA 3KVFB 2UYZB 3W1SC 3H9DA 3EECA 1SGHA 2M8SA 4MDKE 3CMMB 3RUIB 4ZRKA 4A3PA 2G45B 3QAQA 1F9JA 2HJ8A 4NAWA 3CSFA 3JSVA 2MBQA 4CO7A 1KLVA 3ZVVA 2BKFA 1WZ0A 2GBJA 3H7PA 3WIMA 1E5WA 3AULA 1XQQA 3HK0A 4K7UA 2Z0DB 2ZJDA 3Q3JA 4DBGA 5AZFA 2JF5A 1LM8B 1EF5A 2KN5A 4HJKA 2K8BA 4B9KA 3L17A 4IM0A 2G4DB 2AEHA 3DDCB 1WJ6A 2L8JA 1XD3B 3VH4B 2LUEA 3N30A 4JQWC 1OQYA 3PZDA 2CHWA 4F1SA 2N7EA 2AYOB 2N1WA 2ZNVC 3HHMA 5IA7A 3QC8B 3V6EB 2KQ7A 2LVQA 4IC7B 1WX9A 4LDTD 4WJPA 1T0YA 5AZHA 3OJ3A 4KIKA 3ZIMA 2JT4B 3WA0A 3ALBA 2PE9A 2YVCA 2KWUB 3L10B 3TL5A 3LJ3A 3QCAA 1YQBA 1GUAB 1E8WA 1IP9A 5DPSA 1GJZA 2KX0A 1UGMA 1Z2MA 2EMTA 2NS5A 3WALA 3VUWA 4LDTB 4BKSA 1BT0A 5JHAA 1ISNA 2N9EB 3EC8A 4TQ0A 4DWFA 4G3XB 2KXJA 4ANXA 1LXDA 3ZNHB 2BF8B 1WMHA 3S2AA 3A33B 1P1AA 5JH5C 1MG8A 2KJRA 3ECIA 5CHVC 3T9LA 2LXAA 2MQJA 4JLCA 4FA6A 4WQOB 1ZW7A 5E6OA 3WAOA 4DDID 1I42A 3ZTCA 2BYVE 3X0WA 2MBHA 2K1FA 5CTRC 3QA8A 3SDLC 1OEYJ 1TZ1A 3A4SC 4ASWC 4MELA 1V9JA 3UIPB 3B0AA 4FJYA 2V1YA 3AU4A 4MGKE 4M8NA 3JYUA 2WWZA 3ZLZA 2VRRB 5J2RA 3JVZX 2HTHA 4II2B 3P2BA 3U7DA 3Q3FA 4A20A 3C0RB 3CF6E 4E74A 3DVGY 5AZGA 3ZW3A 4MGIE 4MGZE 3TBLD 2K6DB 4G11A 2KLCA 2FIFA 1RFAA 4ZDVA 4WJQA 3RYTA 3V6CB 3NZSA 2M17A 5IAAC 1OTRB 4MSMB 1V81A 3IBEA 4NPNA 3PVLA 2I1JA 3DVGX 4DXAB 1Q1OA 3B1LX 1J19A 3A4RA 3H7SA 3L13A 2DAJA 4HPLB 2R2OA 3U8ZA 4W9HA 3WANA 2O6VD 3IHPC 2M4NA 3M62B 4IG7B 4K81A 4TKNA 3IG3A 4WJOA 3U30A 3R3MA 4OVVA 1R4NI 4ZYNA 1WZ3A 3D32A 2DAFA 2BPSA 4IUMB 3DBHI 1L2NA 1P98A 4ICVA 5DCNA 4LJOB 1D3ZA 4FLHA 2KLGA 3R7QA 4F7ZA 2KFJA 2PJHA 3UQBA 1G6JA 2BKRB 2LASA 1WE6A 3NS8A 4W9IA 2O6VB 3B08A 4KDLB 5KHOA 2LZ6A 2ZVOA 1E8ZA 4KZCA 3PRMB 2MBEA 4PS7A 2D2QA 2HE7A 1IPGA 3KUCB 2IO2B 4IM3A 5D6JB 4EOYA 1S1QB 5DPTA 2IY1B 2GBRA 2KVRA 4HWIB 1NDDA 4JL9A 2ZCCA 4W9CA 2NCNA 4W9EA 3ML9A 5L83A 1E7VA 2NBVB 2M1MA 4NQLB 4OVUA 1CMXB 5D94A 1WYWB 4KSKC 4HVBA 1WX8A 4HXDA 4IWOA 3TMPB 1U4AA 2O2VB 5TR5A 1PQSA 2L05A 2D11A 3V61A 2LGDA 4PYZA 2PE6B 4RM8A 3BINA 2JWZA 3APFA 3R66C 2LD9A 4I6PA 1WGHA 2BGFA 2MX2A 2Z0EB 4URKA 2DYMA 3UQAA 2KHWB 2NVUI 3KUZA 4KZ0A 2ZVNA 2A4ZA 3NHEB 5J17A 2BYEA 1J0GA 1UD7A 2CR5A 4B95A 4LJPB 2MCNB 1OGWA 3V62A 1WGYA 3A9JB 4FHKA 2KFKB 3ZUNA 5G2NA 3H1UA 3MHSD 3QARA 4LCDE 4ZRIA 1IYFA 3PRZA 2G3QB 4WAAA 2DZJA 2NBUA 3IFWB 2DENB 2KKCA 1H8CA 1V2YA 2KO3A 4ANVA 3VUYA 2KMCA 3UINB 2AL6A 4EKUA 2JZ3B 4WWNA 4K7SA 2K25A 3VTUA 4X57B 2LJ5A 5J18A 2OJRA 4EZJA 2L0FA 1E7UA 3ZKJC 2FCQA 2FIDA 3DVNV 1KOTA 4W9GA 4KV2A 3DOWA 4W9LA 4W9FA 4AOFA 4NJ6A 1XT9B 4GGQA 4JIOU 2LGXA 4MH0E 3V60A 1E90A 1WRDB 2A5UA 2GOWA 4BVUC 1WI0A 2IO3B 1V49A 2IO1B 2RD0A 4HPMB 2JVCA 3L0WB 3UGBB 3KUDB 4A3OA 1WXAA 3SHQA 3HM6X 1GC7A 3KH0A 2L76A 1TBEA 3VQIA 3WAPA 4AJWA 2RGFA 2IY0B 3HM3A 4I6NB 3VTVA 3X23A 2HD5B 1V6EA 3DPDA 4MJSB 4XZ4A 4GIVA 5HKHA 2W9NA 4HCPB 1WXSA 2KWCA 2XK5B 1WE7A 2ASQA 2JY6A 2N9XA 2YLMA 4NNJB 4EEWA 3AI5A 2K8CA 3ML8A 2QHOA 2WDTB 1NBFC 3O65B 1WXMA 4RMAA 3AU5A 1C1YB 2KOXA 1C3TA 1UH6A 1WH3A 2BWES 3ZTDA 3KW5B 1GG3A 1P9DU 4RM9A 2ZPNA 3M95A 4E71A 2KTRB 1ZKHA 3APCA 4WWPA 2PEAA 2KDBA 3A1QB 1WFYA 2GBMA 4FJZA 4FHJA 1R4MI 2L7RA 4DK5A 1YX5B 4HK2A 4IWPA 5AEKB 3RULA 2FCSA 2O6VA 2CKHB 2JZZA 2KX3A 4I6LB 1TTNA 5DPWA 3QJZA 4DHJD 1UBIA 2MW5A 3I3TB 1RAXA 2CS4A 5L95C 2EMSA 3ZNGC 4NY0A 2C7MB 5CX3A 3MTNB 4E3CA 5EDSA 3L08A 2NBWB 2DHZA 4IWQA 3A9KB 2AWTA 2FAZA 2JRHA 1WM3A 1LQBA 2MSED 1YIWA 3OJ4B 3PPAA 1I35A 3DBRI 2V4LA 2Z59B 1WIAA 2LI5A 3L54A 2G4SA 4DHJB 4HCNB 3QX1A 4J6IA 3TCAA 4DHZE 4BBNF 4HDQA 4ANWA 1YJ1A 2IZVB 2NR2A 1AARA 5KHQA 4HLEA 2ZPYA 2ZEQA 4EZLA 2KNBA 2J0MA 2O2VA 3ENEA 1Y8RC 5E6NA 3VFKA 3PHWB 4IM2A 2KD0A 5LXIB 1WM2A 3K9OB 3R7RA 4W9JA 4W9KA 2J7QB 4GMVA 2CU1A 2KTFA 1KM7A 3W1YA 2MP2B 2RSUA 4ICUA 3KYCD 1A5RA 2NPTB 3VDZA 3KYDD 5DPRA 2N1VA 2L3ZA
chains in the Genus database with same CATH superfamily
2KJ6A 2KN4A 2JPHA 4CYEA 3VAWA 2OOBB 3A9JA 1UWXA 2KFKA 1FD6A 1VZ8A 4YSXB 1Q10A 1B9RA 4AJYB 3GZNI 1XLQA 1NEKB 4F8CB 1D4BA 2LHEA 2G1EA 2PVGC 4N58A 4ZHPA 4FN2A 3CSTA 3NVWA 1WGDA 2MRPA 5EE9A 1E10A 3VXWA 4HJGE 3EFUA 3AE8B 3ZRCA 3U7ZA 4JGHB 3MJWA 1P0RA 3T8MA 3ZNID 3H7PB 1TS2A 1QT9A 2UWQA 3VR8B 2JYEA 1JRPA 2C9WB 4MM3A 3ZDMC 4EUTA 2IO0B 1ET9A 4W9DA 2J0JA 4R3DA 1SE4A 1UNSA 2GBKA 1LFDA 1GOZA 1XCQL 2IGDA 3AE2B 3PSEB 4O1NA 1QKZA 3WAMA 3ZJUA 3DBSA 4K7WA 3H6NA 5LNK1 3DWMA 4GN1A 3TSSA 3AE4B 3HIZA 1HTQA 3NVZA 4AWJA 3ZDTA 3RNFC 4WIPA 1EF1A 3PZ8A 1R4MB 3OAWA 1UZXB 3PLUA 3KWLA 2MP2A 4REZA 5FR6A 2HTME 1PFDA 4YTPB 4FBJB 1KFYB 3MC0B 2MJEA 2J0KA 5CHFA 3QQ8B 3DBRB 5FR3A 3IAM1 1VLBA 1Z5SB 2JWUA 3N3KB 3N32A 4KGTA 1JCKB 1WWTA 1V1PB 1YX6B 3VVWB 3W1SA 4MACA 4KX6B 2D07B 2KWVB 3RZFA 1FMAD 3APDA 2WXIA 1WGRA 1WR6E 3AE6B 1OQQA 1VRAB 2UYZB 4XGAB 4YSZB 1SGHA 4MDKE 4JWUC 4A3PA 4HKQA 3QAQA 1KLVA 2MBQA 4CO7A 3H7PA 3AULA 1XQQA 2Z0DB 3Q3JA 5AZFA 1LM8B 3L17A 5HFYA 3DDCB 3PZDA 4F1SA 1CJEA 4WQMA 1OFFA 1C9FA 1QILA 1DOIA 4WJPA 3GE8C 5AZHA 3OJ3A 2PE9A 3N1ZC 1I4RA 3TL5A 3LJ3A 3N1XC 1GJZA 1UGMA 3BK1A 1DYQA 3EC8A 4HROA 4TQ0A 4OVZA 1P1AA 2WU2B 1VR9A 4YTNB 4HEA1 1MG8A 2KJRA 1SIJA 3T9LA 5CHVC 1YN3A 4FA6A 4WQOB 4BZAA 1K52A 4OZBA 2K1FA 5CTRC 3QA8A 4ZHOA 1OEYJ 1TZ1A 4ACFA 3B0AA 4M02A 2WXJA 5BYSA 3JYUA 3NJTA 2VRRB 1FXAA 3P2BA 2BS4B 3GP7A 3CF6E 1ESFA 4E74A 2ZW0A 3DVGY 5BYRA 3AE7B 1FIQA 5E6JA 3RPFC 2WNMA 1E7PB 2D3BA 3V6CB 1OTRB 1V81A 3IBEA 1V1PA 3DVGX 2OEDA 1J19A 3A4RA 1ET6A 2O6VD 2LGIA 3IHPC 4IG7B 1FRRA 2QSDA 3U30A 5H92C 2WXQA 3N1YC 4OVVA 2BPSA 1ZPSA 2N7JA 4LJOB 5BMGA 2ZW1A 3GE3C 3UQBA 1L4DB 1WE6A 2O6VB 4KDLB 4FXCA 1ENFA 1F52A 2K22A 2MBEA 1FNWA 1S1QB 5G5HA 2IY1B 2GBRA 4JL9A 3TUOA 4PK1A 5L83A 3AV8A 4IDIA 3Q8EA 3ZGZA 4RCOA 2MJ3A 2JYTA 1L0VB 2BS3B 4GLSC 4IWOA 3TMPB 4H2AA 1NYQA 1N5XA 2X38A 1PQSA 1D6EC 4OZCA 4HPPA 5EE3A 1WGHA 2MX2A 4URKA 1MFWA 2BYEA 1J0GA 3V62A 2Y5CA 4WURA 3ZUNA 1QOBA 1AW7A 1H8CA 3TEYA 4ANVA 1SE2A 2KMCA 2K25A 2VZKD 2LJ5A 5J18A 2QJLA 3NG0A 1IGCA 2XN9C 3DVNV 4KV2A 4NJ6A 4GGQA 2LGXA 4DQOC 2VZKB 1WI0A 2RD0A 2EKIA 2JVCA 3L0WB 3KUDB 1WXAA 3KH0A 4OZAA 4AJWA 2IY0B 3RNEC 4IOIE 1WE7A 4JE3B 2YLMA 3RI7C 3ML8A 2WDTB 1NBFC 3CWIA 2K0PA 3ZTDA 3KW5B 1MHHE 3M95A 4E71A 1ZKHA 3RNGC 3P4RB 4NJCA 1R4MI 3W5UB 2FCSA 2O6VA 1TTNA 1I7HA 4DHJD 3I3TB 2EMSA 3MTNB 3BVGA 2DHZA 1LQBA 3KLSX 4NZLB 1I35A 1BUIC 3DBRI 1WIAA 2G4SA 4DHJB 1T0SC 4YT0B 1AARA 4HLEA 5AUKA 1IUEA 1ZUD2 1Y8RC 2RDHA 2XNAC 2KD0A 4J3OD 2KACA 4GMVA 5C2TB 2WS3B 4ICUA 2NPTB 2V9HA 4GDKB 2KDIA 4MGYE 3U2SC 1VZ7A 3P4SB 1K8RB 1RRBA 2CHZA 2EKEC 3ONSA 2WYQA 2FCNA 4ITKA 4JX1C 1WGKA 3K9PB 4GDLB 1FFUA 4II3B 2KK8A 2WXNA 2CJNA 3NUHB 1MVKA 3TJPA 4PS8A 1V5OA 2PTLA 2K39A 5CHWA 4ANUA 3VRAB 4IW0A 4PYUA 2C5LC 1Q0WB 5IO9A 1L6VA 2G9HD 4YL8A 3HVDA 1EO6A 1KTKA 1YN5A 4WH4A 4KSLC 4A9AA 4XWTA 3PREA 1QOAA 2WHIA 5BO4B 3VH3B 1P7EA 2NTSA 4CHKA 2DZIA 2V4IB 1DOYA 2WXOA 2WGSA 4ZRQA 2JSVX 2WDVB 2RMMA 4DHZB 2KJHB 1JRUA 1FRDA 1XO3A 2K9XA 1BXTA 4A6QA 1YQ3B 3ZRFA 4MEMA 3IAS1 4FADA 4GSWA 2MLBA 3OLMD 3AEAB 3Q6BA 1Y56A 1WMHB 4NQKE 4BKTA 3NY5A 3PTFC 3PV1A 2BYTA 1E8YA 1FM0D 5AUIA 2WX1A 4BOSC 4OHJA 2LXCA 2GBNA 1SE9A 2NPTA 3UF8A 3ZNZB 2N7DA 4GDKA 1L0XB 1TS3A 4US9A 3PO0A 2LMCA 2DYBA 4GU2A 2DZKA 1XEEA 2I1KA 1D5MC 2AX5A 2GMIC 2FE8A 4KVGB 2WXRA 2XEWA 4XX5A 3PLVA 1ZGUB 1FNVA 2LRWA 3DVNU 5LLIA 2KQSA 4C4VB 1HXYD 5D7GA 2D3GA 4GDLA 1ZXIA 2L0TA 4RGOS 3RD2A 1NVID 2L1AA 1QOGA 4GOCA 4Q2JA 3RMKC 3KVFB 3H9DA 3EECA 2M8SA 4WWMA 3CMMB 3Q3OC 2HJ8A 1I4GA 3VR9B 2GBJA 4LNFA 3WIMA 2INDC 3HK0A 2ZJDA 3FKYA 2KN5A 2QCZA 1WJ6A 3VH4B 2WXHA 4JQWC 5FKAC 2CHWA 2N7EA 3Q3NC 2AYOB 2N1WA 2ZNVC 3HHMA 5IA7A 3QC8B 2KQ7A 4IC7B 2NMQA 1T0YA 3W5VB 3WA0A 4OW0A 2YVCA 3L10B 1GUAB 5DPSA 2KX0A 1EWCA 2NS5A 1BT0A 2LFIA 2QMTA 1K50A 2N9EB 2Q5WD 4C7ZA 1J7AA 2KXJA 1LXDA 1WMHA 1E6EB 1JWUD 5JH5C 4JWSC 1JROA 2LXAA 4JLCA 1NYRA 3WAOA 4D2KA 3ZTCA 2BYVE 4XYCA 3X0WA 2RPVA 4RH6A 2K3UA 4ASWC 3Q3MC 2GRIA 1TT5B 1C4PA 2V1YA 2KVZA 4M8NA 2WWZA 5J2RA 4II2B 2V3NA 1D5XC 3P4QB 4A20A 1SBBB 1RM6C 2IPKD 2H88B 1V1OA 3TBLD 1HEZE 4G11A 1QLBB 4AQ7A 4C4VA 2KWDA 4NPNA 2I1JA 4DXAB 4RNAA 3B1LX 2R2OA 1PDXA 4W9HA 2WP9B 3M62B 4K81A 1XLNA 1FCLA 3IG3A 4K3CA 4XDCA 3LYYA 1L2NA 2WXPA 1P7FA 4ICVA 3AE3B 3E9SA 2KLGA 3R7QA 4UDUC 1G6JA 1N63A 4W9IA 5KHOA 2UU7A 2AQ1B 2ZVOA 4KZCA 3AEEB 4PS7A 3PRMB 2D2QA 2HE7A 3KUCB 5D6JB 3I9V1 4HWIB 3AN1A 4W9EA 4LLGM 3ML9A 1E7VA 5FK9C 2N0SB 2WXGA 4OVUA 4USAA 3N9YC 1ZXHA 4LNKA 3I63C 5D3DA 5TR5A 1L0YB 2L05A 2D11A 2LGDA 3EFCA 4PYZA 2KDMA 3BINA 2SEBD 5BMIA 3R66C 1FXIA 2LD9A 3V05A 3UQAA 5HG2A 4LCDE 1IYFA 3QARA 4ZRIA 5EE0A 2NBUA 3OWEB 3CIRB 1V2YA 1ZDXA 3UINB 2JZ3B 3VTUA 1GPXA 4X57B 4C7YA 2OJRA 4AOFA 1XT9B 4MH0E 4RF1A 1E90A 2IO3B 1GB1A 2IO1B 2E3TA 1C78A 3VQIA 3WAPA 2RGFA 4I6NB 3VTVA 3Q8CA 4RGTA 4MJSB 4XZ4A 4IKGA 4GIVA 4HCPB 2H89B 2D3CA 4RF0A 1IBXB 1JQ4A 2JY6A 4NNJB 4EEWA 3W9CB 2KT7A 2OJWA 1T6BX 3O65B 1V8CA 1C3TA 3Q69A 2BWES 4BAXA 3AECB 1GG3A 1L6UA 3MHZA 2ZPNA 2KTRB 3APCA 2PEAA 4L2YA 2K5PA 1PGBA 1SE3A 1YMHE 2GBMA 1EU4A 2J4XA 2LJIA 4HK2A 4IWPA 5AEKB 3UI3A 1UBIA 2C7MB 2ONQA 5EDSA 3L08A 4IWQA 2AWTA 2V4LA 4LTUA 3KWVA 1T3QA 2KYWA 4B0EA 4N6EB 5KHQA 1R4NB 2ZPYA 2ZEQA 3ENEA 3PHWB 5LXIB 2AQ3B 1WM2A 3K9OB 4W9KA 2J7QB 2CU1A 2KTFA 2I38A 3KYCD 3RNCC 2MSED 3M3JA 1JALA 2PVOD 4WJNA 1L7YA 2LRUA 3AEDB 3OG5A 1F77A 5HI1A 2JX5A 3PS6A 3NRZA 3IT6B 1N6ZA 3HRDD 1SF0A 3PRPB 1RLFA 4A90A 1HE8A 1ROEA 2N4FA 4AP4C 3RT3B 2RPQA 2Z8LA 3AXCA 4YTMB 2PKOA 3SU8X 3EA6A 2BWFA 2BB6A 1WSPA 1WRIA 2DYOA 3DBLI 1WY8A 5JHBA 4N9F4 3W2DA 1TKYA 2Y5BB 2DBYA 2KANA 3PHXB 1E9MA 2IBIB 4MJSA 2K8HA 4NAWB 5D2MB 2V3SA 1IBXA 3JSVB 4GB9A 4C00A 5G5GA 3PZ7A 1H4RA 2ZNVB 4RGMA 2KAJA 1FO4A 4TV3A 1WX7A 1D5ZC 2KZRA 3SEBA 3AMZA 3EUB2 3ZO5B 3Q2AC 5G55A 2KTRA 1WXVA 4EFOA 3VHTC 4EZKA 4ZRJA 5GXGB 4BKSD 3DWGC 4EE2A 3GOEA 2BYFA 4KIKB 3VUXA 5LXHA 1SIFA 4LK0M 3TIXA 3ZXRA 1EU3A 1VZ6A 1VD2A 4B6WA 2L00B 3ABVB 4ZYSA 4ARCA 3H8HA 2N9PC 3Q8FA 3LXFA 1YNTE 3QHTA 1TS5A 2D10A 3RFZB 2LGYA 2ZZPB 2XBBC 1V5TA 4B0MA 1FPYA 1WXQA 1VDVA 4M0WB 1MJDA 1FXTB 1UBQA 4ZOHC 3AB5A 4TUUA 3RZWC 2KDFB 3M63B 3QIJA 3PT2B 1X1MA 2ACZB 5IN7A 1I4HA 4PS3A 1P3QU 2D5GA 3AEBB 2RR9A 3PGEA 1TJEA 1CZPA 2MBOA 1L4ZB 2WLBA 3EHVA 1HA5A 2GLSA 4WWOA 1GNUA 1S3SG 1OEYA 3AM9A 3KQ4A 5E6PA 2AL3A 5C23A 1PGXA 1M94A 1KF6B 2W54A 1N62A 2FNJB 2R61A 1SEBD 1XXGA 3Q8AA 4XWWA 3RUIB 4NAWA 3JSVA 1JMLA 2BKFA 1WZ0A 1F2RC 2INNE 1SXTA 3BVMA 3RNBC 2JF5A 1EF5A 1FCCC 4HJKA 2K8BA 4B9KA 4IM0A 2G4DB 2AEHA 3LB8C 2L8JA 1STEA 1OQYA 4ARIA 2IDYA 1R7SA 4KIKA 1ZE3D 3ZIMA 2B76B 2I2YA 2KWUB 3P4PB 1YQBA 3QCAA 1E8WA 1IP9A 3WALA 4DXFA 4BKSA 5JHAA 1JWBD 1ISNA 2M0AA 2ON8A 2BS2B 2BF8B 3S2AA 1PYWD 1ZOYB 2WXFA 1ZP0B 5JXVA 2QC8A 2MQJA 4M0WA 5E6OA 1I42A 1GAQB 5BYQA 2MBHA 1KH0A 1YN4A 1V9JA 3UIPB 4FJYA 3Q8BA 4N59A 2BW2A 3AU4A 3P63A 1SJED 1F1HA 1XLPA 1MPEA 3U7DA 2YEPB 3Q3FA 3C0RB 1TKEA 2QEJC 2JZPA 5AZGA 3ZW3A 4MGZE 2K6DB 2KLCA 2FIFA 1KRHA 1AYFA 4ZDVA 3RYTA 1A70A 1SB3C 5IAAC 2LEKA 1N5WA 3H7SA 3L13A 1IGDA 3WANA 1K51A 2M4NA 4TKNA 4XDDA 3R3MA 1R4NI 4ZYNA 4IUMB 4FLHA 3DHIC 2KFJA 2PJHA 2BKRB 2ICIA 2LASA 1HQRD 2WXLA 1E8ZA 2WDQB 1K53A 3HUIA 1FNUA 4IM3A 5DPTA 4LNNA 1OQRA 4YXDB 4KKJA 1NDDA 2WXMA 2ZCCA 4W9CA 1EWYC 2V3PA 1I4PA 1SJHD 2M1MA 3MFGA 4S17A 4NQLB 2Y3AA 1CMXB 4M00A 4WAFA 4HVBA 1YOVB 2N9LA 1U4AA 3ZJTA 2MH7A 5T8IA 1LO5D 2PE6B 4RM8A 2JWZA 3APFA 2NTTA 1I4QA 2BGFA 2Z0EB 2DYMA 3TEXA 3AEGB 2NVUI 3KUZA 2A4ZA 3NHEB 5J17A 1UD7A 2CR5A 4B95A 3DBLB 1OGWA 1WGYA 3EGRA 5G2NA 3H1UA 3AH7A 4WAAA 5H8YE 3IFWB 2KKCA 1EM7A 4NAMA 5C3JB 1NENB 3VUYA 2AL6A 2PIAA 3DHHC 2CJOA 4WWNA 4K7SA 1RYJA 2L0FA 3ZKJC 3NS1A 1KOTA 3P42A 1HZ5A 3T3NA 3V60A 3BIID 1VJKA 4BVUC 2A5UA 2GOWA 2DNFA 4HPMB 3URYA 3R8BA 3UGBB 4A3OA 4ZRPA 1AN8A 3SHQA 2CU3A 1DGJA 3X23A 3HVZA 1V6EA 3DPDA 1PUTA 2KWCA 2XK5B 1XF5L 3BZDB 3AI5A 2K8CA 1TY0A 2BVCA 4KKIA 1WXMA 3AU5A 1C1YB 3N20C 4MT5A 1P9DU 3U52E 1RFKA 3C19A 3Q14C 4WWPA 3A1QB 2KDBA 2DLBA 1WFYA 1QOFA 4FJZA 3NVYA 2OHFA 1YX5B 1HTOA 3RULA 2CKHB 2JZZA 5HHDG 3B2GA 3ZNGC 4NY0A 2NBWB 3A9KB 3MC9A 1C4CA 1WM3A 3I5JC 3L54A 3BYYB 4HCNB 3QX1A 4TMAB 2BBCA 4J6IA 3TCAA 4DHZE 2KMMA 1JWSD 3ETRA 4HDQA 1YJ1A 2NR2A 2WU5B 3AE1B 3DBHB 1HZ6A 4IM2A 3R7RA 2INCC 4W9JA 1YJJA 1KM7A 3W1YA 4P1BC 4L1BA 1A5RA 4RFBA 1T0RC 2L3ZA 3WCQA 2K6QA 2LWPA 4KGSA 1UGJA 1WJNA 2RDBC 3FAHA 2LVPA 2BB5A 1MHXA 4G0NB 1QF6A 1T0QC 4MSQB 1YQ4B 4DXGA 2L52A 5TSSA 3AE5B 2FCMA 2KC2A 3NOBA 3IVFA 2JRIB 2DZMA 2JXTA 2LGSA 5MPOA 1JWMD 4NJ7A 3QWZB 4FJVB 2IGHA 2ZCBA 4FULA 3T3OA 1VCBA 3R2TA 2JXXA 2XK5A 3DCGA 2C7NB 2C7HA 1V80A 3NZUA 3BVZA 5BMHA 4M8MA 4L23A 2GB1A 2FUG1 1KLUD 2B3AA 2JUOA 2MA9B 2QDFA 3RCZA 3VTWA 1TY2A 1WGGA 4BOZB 3A1QA 2DX5B 1C76A 3BY4B 1WYGA 1EUVB 1WF9A 4HDOA 2REXA 3MC8A 3A9KA 2M0XA 2W3SA 1YJIA 3C8YA 4XE0A 3QK0A 1KJTA 1C79A 3RNAC 2LVOA 1FEHA 2X8XX 3O13A 1TS4A 3E56A 2MWSB 2FBWB 1E8XA 2PPHA 1C77A 3JW0X 4BFRA 2IYDB 2INPE 2KMAA 2W3RA 1F0ZA 2D3AA 1TGZB 1UELA 1WJUA 3LDZE 1C4AA 1WJ4A 1ZDVA 4C80A 1J7CA 2WX0A 2KC1A 2WXKA 4DDGD 1LGRA 3AEFB 1I4XA 1Q5WB 4CQNA 3B2FA 3L16A 4G50A 1V86A 1YD8U 4AUQC 1QQRA 3UIOB 4GXBA 4JPSA 2BTEA 4TQ1A 5GMVA 3ZXVA 2DWQA 4BKGA 1UUPA 3P1MA 4MH8A 4P7IA 4KDIC 1WR1A 2E6XA 1SSNA 4YWGG 3BYTB 2MBBB 2IGGA 2CHXA 2R2QA 2N9KA 1TYGB 2LUMA 5C1ZA 1NI2A 2FUHB 4LNIA 1MG4A 1GC6A 4P1CC 4K1RB 1J8CA 4BBNC 3SD5A 4XC2A 3DQVA 2C60A 5JZEB 2KDEB 1QZEA 3W1SC 4TSSA 3MP9A 4ZRKA 3GZNB 3NZ3A 2G45B 1F9JA 3CSFA 3SR6A 2MEKA 3ZVVA 3L4PA 1E5WA 4K7UA 4DBGA 4P16A 4M01A 2KQ4X 2HJ1A 1XD3B 2LUEA 3N30A 3V6EB 2LVQA 4LDTD 1WX9A 2EELA 2JT4B 3ALBA 1BMLC 1Z2MA 2EMTA 3VUWA 4LDTB 2J53A 4RGNA 3I57A 4DWFA 4G3XB 4ANXA 2Y5PA 3ZNHB 3TEWA 3BK2A 1DOXA 2PLPA 3A33B 3ECIA 1AWDA 1ZW7A 4DDID 2HDEA 5IP4D 2L32A 3SDLC 3A4SC 4MELA 3AE9B 1L5PA 3FILB 4MGKE 3GS2A 3ZLZA 2WDRB 3JVZX 2HTHA 4AS1A 3NVVA 1B1ZA 2BQQA 4K3BA 4S0RA 4MGIE 1TKGA 2LHDA 2JU6X 1RFAA 4WJQA 3NZSA 2M17A 3IT4B 1TZOA 4MSMB 3PVLA 1Q1OA 4US8A 3ZQ4A 2DAJA 4HPLB 3U8ZA 2M19A 4WJOA 2SAKA 2RDGA 1WZ3A 3D32A 2DAFA 1CQVA 3ZJVA 2JQRB 3DBHI 3DHGC 1P98A 5DCNA 1UF0A 1D3ZA 4F7ZA 2V0GA 3NS8A 3V3XA 3B08A 4LNOA 5I4DA 2LZ6A 1IPGA 2IO2B 4EOYA 2KVRA 4P6VF 3B9JA 1RWSA 2NCNA 2NBVB 1ACCA 2VH2A 5EE1A 3SFEB 5D94A 1WYWB 4KSKC 1WX8A 2MHJA 4HXDA 2GI9A 1J7BA 2O2VB 2QILA 1GB4A 3V61A 1TIFA 1N61A 1XCTL 4I6PA 1M4VA 2KHWB 1V97A 4KZ0A 2ZVNA 4LJPB 2MCNB 1F2RI 3A9JB 1KLGD 4FHKA 2KFKB 3MHSD 3RN9C 3PRZA 2G3QB 1FFVA 3BWUD 2DZJA 5IKCM 2DENB 2KO3A 1PGAA 4EKUA 2YEPF 4A8XC 1NI3A 4EZJA 1E7UA 2FCQA 2FIDA 4W9GA 4W9FA 3DOWA 4W9LA 5D3IB 4JIOU 3FILA 1WRDB 1V49A 4KGRA 4HKZE 3HM6X 1GC7A 1T5XD 1MI0A 2W55A 2L76A 1TBEA 2IJ0A 3HM3A 4A55A 2L83A 2HD5B 3SFDB 2W82A 5HKHA 5IOIA 2W9NA 1E0ZA 1WXSA 2ASQA 2N9XA 4PT5A 2M56B 1JWAD 2QHOA 4RMAA 3IXSA 2KOXA 1UH6A 1WH3A 3J9CA 4MM3B 4RM9A 4YSYB 2J52A 2WQYB 4FHJA 4DK5A 2L7RA 2BT6A 2PW9A 1CK1A 2QIEB 2KX3A 4I6LB 3GB1A 5DPWA 3QJZA 2MW5A 1RAXA 2CS4A 5L95C 1N60A 3FC4A 5CX3A 4E3CA 2FAZA 2JRHA 3OJ4B 1YIWA 3PPAA 4QAYA 3R2IA 4C56C 3MJ5A 2Z59B 2LI5A 3U4EG 2TSSA 4BBNF 4ANWA 1JW9D 2IZVB 2J42A 4HRSA 3TEZA 2MJDA 1UWMA 4EZLA 2AQ2B 2KNBA 2J0MA 2O2VA 3VFKA 5E6NA 2PMVA 1XLOA 2MP2B 2RSUA 3ZYYX 3VRBB 2VH1A 3VDZA 3KYDD 5DPRA 2N1VA
chains in the Genus database with same CATH topology
3M3JA 2KJ6A 4WJNA 1L7YA 2LRUA 2JPHA 2K6QA 4GDKB 4CYEA 2LWPA 2OOBB 3VAWA 1WJNA 2KDIA 3A9JA 2KFKA 3PS6A 4MGYE 4AJYB 3GZNI 1K8RB 1RRBA 2CHZA 2EKEC 2LVPA 3ONSA 2WYQA 4G0NB 3PRPB 4F8CB 1RLFA 4MSQB 1HE8A 2N4FA 2FCNA 4FN2A 4AP4C 3RT3B 3K9PB 3CSTA 2RPQA 4GDLB 2FCMA 2KC2A 4II3B 1WGDA 3AXCA 3NOBA 3IVFA 2KK8A 2JRIB 2DZMA 2MRPA 3SU8X 3TJPA 4PS8A 1V5OA 2BWFA 3VXWA 4NJ7A 2K39A 2DYOA 3DBLI 3QWZB 3EFUA 5CHWA 4FJVB 1WY8A 3ZRCA 5JHBA 2ZCBA 4JGHB 4FULA 4N9F4 4ANUA 4IW0A 2Y5BB 4PYUA 2C5LC 1Q0WB 2KANA 3MJWA 3PHXB 1VCBA 2IBIB 4MJSA 1P0RA 4YL8A 2JXXA 2K8HA 2XK5A 3DCGA 4NAWB 2V3SA 5D2MB 3T8MA 3JSVB 1EO6A 2C7NB 2C7HA 1V80A 3NZUA 4KSLC 3ZNID 4GB9A 4M8MA 3H7PB 1H4RA 2ZNVB 2B3AA 2UWQA 2JUOA 3PREA 2MA9B 2C9WB 4MM3A 3ZDMC 5BO4B 4TV3A 1WX7A 3RCZA 3VH3B 3VTWA 2KZRA 4EUTA 2IO0B 3ZO5B 2DZIA 5G55A 4CHKA 2KTRA 1WGGA 1WXVA 4W9DA 2J0JA 4BOZB 3A1QA 2DX5B 4EFOA 3BY4B 3VHTC 2GBKA 4EZKA 1LFDA 4ZRJA 2KJHB 1JRUA 4DHZB 4BKSD 3GOEA 3PSEB 2BYFA 1EUVB 4KIKB 3VUXA 5LXHA 1WF9A 1SIFA 3WAMA 3ZRFA 3DBSA 4K7WA 3TIXA 3H6NA 4MEMA 4HDOA 2REXA 3A9KA 2M0XA 1VD2A 4FADA 4GSWA 2MLBA 4B6WA 2L00B 4GN1A 3OLMD 3QK0A 1KJTA 2N9PC 2LVOA 3HIZA 2MWSB 3QHTA 1E8XA 4AWJA 1WMHB 4NQKE 3ZDTA 2D10A 2PPHA 4BKTA 3JW0X 3NY5A 3PTFC 2IYDB 2KMAA 2LGYA 3PV1A 4BFRA 2ZZPB 2XBBC 1V5TA 1TGZB 1UELA 1WJUA 3LDZE 1EF1A 4M0WB 1E8YA 1FXTB 1UBQA 3OAWA 1UZXB 1WJ4A 2WX1A 3PLUA 4TUUA 4BOSC 3RZWC 2KDFB 3M63B 2WX0A 2KC1A 2LXCA 2MP2A 2GBNA 3QIJA 5FR6A 4DDGD 1SE9A 2NPTA 3PT2B 3UF8A 1X1MA 3ZNZB 4FBJB 1Q5WB 4PS3A 1P3QU 3L16A 4G50A 1V86A 2J0KA 5CHFA 3QQ8B 2N7DA 4GDKA 1YD8U 4AUQC 2RR9A 2DYBA 4GU2A 2DZKA 3UIOB 4GXBA 2I1KA 3PGEA 1Z5SB 2GMIC 4TQ1A 3N3KB 5GMVA 4KVGB 3N32A 2XEWA 2MBOA 4BKGA 4XX5A 3PLVA 3EHVA 1ZGUB 2LRWA 4P7IA 4KDIC 1WR1A 3DVNU 4WWOA 5LLIA 1GNUA 2KQSA 1S3SG 1OEYA 2MBBB 5D7GA 1YX6B 2CHXA 2R2QA 2D3GA 3VVWB 3W1SA 4GDLA 5C1ZA 1NI2A 2FUHB 5E6PA 2L0TA 2D07B 3RD2A 2AL3A 1GC6A 5C23A 2KWVB 1M94A 3RZFA 4K1RB 1J8CA 3APDA 4BBNC 4GOCA 3SD5A 4XC2A 1WGRA 3DQVA 2FNJB 1WR6E 2C60A 5JZEB 2KDEB 1QZEA 3KVFB 2UYZB 3W1SC 3H9DA 3EECA 1SGHA 2M8SA 4MDKE 3CMMB 3RUIB 4ZRKA 4A3PA 2G45B 3QAQA 1F9JA 2HJ8A 4NAWA 3CSFA 3JSVA 2MBQA 4CO7A 1KLVA 3ZVVA 2BKFA 1WZ0A 2GBJA 3H7PA 3WIMA 1E5WA 3AULA 1XQQA 3HK0A 4K7UA 2Z0DB 2ZJDA 3Q3JA 4DBGA 5AZFA 2JF5A 1LM8B 1EF5A 2KN5A 4HJKA 2K8BA 4B9KA 3L17A 4IM0A 2G4DB 2AEHA 3DDCB 1WJ6A 2L8JA 1XD3B 3VH4B 2LUEA 3N30A 4JQWC 1OQYA 3PZDA 2CHWA 4F1SA 2N7EA 2AYOB 2N1WA 2ZNVC 3HHMA 5IA7A 3QC8B 3V6EB 2KQ7A 2LVQA 4IC7B 1WX9A 4LDTD 4WJPA 1T0YA 5AZHA 3OJ3A 4KIKA 3ZIMA 2JT4B 3WA0A 3ALBA 2PE9A 2YVCA 2KWUB 3L10B 3TL5A 3LJ3A 3QCAA 1YQBA 1GUAB 1E8WA 1IP9A 5DPSA 1GJZA 2KX0A 1UGMA 1Z2MA 2EMTA 2NS5A 3WALA 3VUWA 4LDTB 4BKSA 1BT0A 5JHAA 1ISNA 2N9EB 3EC8A 4TQ0A 4DWFA 4G3XB 2KXJA 4ANXA 1LXDA 3ZNHB 2BF8B 1WMHA 3S2AA 3A33B 1P1AA 5JH5C 1MG8A 2KJRA 3ECIA 5CHVC 3T9LA 2LXAA 2MQJA 4JLCA 4FA6A 4WQOB 1ZW7A 5E6OA 3WAOA 4DDID 1I42A 3ZTCA 2BYVE 3X0WA 2MBHA 2K1FA 5CTRC 3QA8A 3SDLC 1OEYJ 1TZ1A 3A4SC 4ASWC 4MELA 1V9JA 3UIPB 3B0AA 4FJYA 2V1YA 3AU4A 4MGKE 4M8NA 3JYUA 2WWZA 3ZLZA 2VRRB 5J2RA 3JVZX 2HTHA 4II2B 3P2BA 3U7DA 3Q3FA 4A20A 3C0RB 3CF6E 4E74A 3DVGY 5AZGA 3ZW3A 4MGIE 4MGZE 3TBLD 2K6DB 4G11A 2KLCA 2FIFA 1RFAA 4ZDVA 4WJQA 3RYTA 3V6CB 3NZSA 2M17A 5IAAC 1OTRB 4MSMB 1V81A 3IBEA 4NPNA 3PVLA 2I1JA 3DVGX 4DXAB 1Q1OA 3B1LX 1J19A 3A4RA 3H7SA 3L13A 2DAJA 4HPLB 2R2OA 3U8ZA 4W9HA 3WANA 2O6VD 3IHPC 2M4NA 3M62B 4IG7B 4K81A 4TKNA 3IG3A 4WJOA 3U30A 3R3MA 4OVVA 1R4NI 4ZYNA 1WZ3A 3D32A 2DAFA 2BPSA 4IUMB 3DBHI 1L2NA 1P98A 4ICVA 5DCNA 4LJOB 1D3ZA 4FLHA 2KLGA 3R7QA 4F7ZA 2KFJA 2PJHA 3UQBA 1G6JA 2BKRB 2LASA 1WE6A 3NS8A 4W9IA 2O6VB 3B08A 4KDLB 5KHOA 2LZ6A 2ZVOA 1E8ZA 4KZCA 3PRMB 2MBEA 4PS7A 2D2QA 2HE7A 1IPGA 3KUCB 2IO2B 4IM3A 5D6JB 4EOYA 1S1QB 5DPTA 2IY1B 2GBRA 2KVRA 4HWIB 1NDDA 4JL9A 2ZCCA 4W9CA 2NCNA 4W9EA 3ML9A 5L83A 1E7VA 2NBVB 2M1MA 4NQLB 4OVUA 1CMXB 5D94A 1WYWB 4KSKC 4HVBA 1WX8A 4HXDA 4IWOA 3TMPB 1U4AA 2O2VB 5TR5A 1PQSA 2L05A 2D11A 3V61A 2LGDA 4PYZA 2PE6B 4RM8A 3BINA 2JWZA 3APFA 3R66C 2LD9A 4I6PA 1WGHA 2BGFA 2MX2A 2Z0EB 4URKA 2DYMA 3UQAA 2KHWB 2NVUI 3KUZA 4KZ0A 2ZVNA 2A4ZA 3NHEB 5J17A 2BYEA 1J0GA 1UD7A 2CR5A 4B95A 4LJPB 2MCNB 1OGWA 3V62A 1WGYA 3A9JB 4FHKA 2KFKB 3ZUNA 5G2NA 3H1UA 3MHSD 3QARA 4LCDE 4ZRIA 1IYFA 3PRZA 2G3QB 4WAAA 2DZJA 2NBUA 3IFWB 2DENB 2KKCA 1H8CA 1V2YA 2KO3A 4ANVA 3VUYA 2KMCA 3UINB 2AL6A 4EKUA 2JZ3B 4WWNA 4K7SA 2K25A 3VTUA 4X57B 2LJ5A 5J18A 2OJRA 4EZJA 2L0FA 1E7UA 3ZKJC 2FCQA 2FIDA 3DVNV 1KOTA 4W9GA 4KV2A 3DOWA 4W9LA 4W9FA 4AOFA 4NJ6A 1XT9B 4GGQA 4JIOU 2LGXA 4MH0E 3V60A 1E90A 1WRDB 2A5UA 2GOWA 4BVUC 1WI0A 2IO3B 1V49A 2IO1B 2RD0A 4HPMB 2JVCA 3L0WB 3UGBB 3KUDB 4A3OA 1WXAA 3SHQA 3HM6X 1GC7A 3KH0A 2L76A 1TBEA 3VQIA 3WAPA 4AJWA 2RGFA 2IY0B 3HM3A 4I6NB 3VTVA 3X23A 2HD5B 1V6EA 3DPDA 4MJSB 4XZ4A 4GIVA 5HKHA 2W9NA 4HCPB 1WXSA 2KWCA 2XK5B 1WE7A 2ASQA 2JY6A 2N9XA 2YLMA 4NNJB 4EEWA 3AI5A 2K8CA 3ML8A 2QHOA 2WDTB 1NBFC 3O65B 1WXMA 4RMAA 3AU5A 1C1YB 2KOXA 1C3TA 1UH6A 1WH3A 2BWES 3ZTDA 3KW5B 1GG3A 1P9DU 4RM9A 2ZPNA 3M95A 4E71A 2KTRB 1ZKHA 3APCA 4WWPA 2PEAA 2KDBA 3A1QB 1WFYA 2GBMA 4FJZA 4FHJA 1R4MI 2L7RA 4DK5A 1YX5B 4HK2A 4IWPA 5AEKB 3RULA 2FCSA 2O6VA 2CKHB 2JZZA 2KX3A 4I6LB 1TTNA 5DPWA 3QJZA 4DHJD 1UBIA 2MW5A 3I3TB 1RAXA 2CS4A 5L95C 2EMSA 3ZNGC 4NY0A 2C7MB 5CX3A 3MTNB 4E3CA 5EDSA 3L08A 2NBWB 2DHZA 4IWQA 3A9KB 2AWTA 2FAZA 2JRHA 1WM3A 1LQBA 2MSED 1YIWA 3OJ4B 3PPAA 1I35A 3DBRI 2V4LA 2Z59B 1WIAA 2LI5A 3L54A 2G4SA 4DHJB 4HCNB 3QX1A 4J6IA 3TCAA 4DHZE 4BBNF 4HDQA 4ANWA 1YJ1A 2IZVB 2NR2A 1AARA 5KHQA 4HLEA 2ZPYA 2ZEQA 4EZLA 2KNBA 2J0MA 2O2VA 3ENEA 1Y8RC 5E6NA 3VFKA 3PHWB 4IM2A 2KD0A 5LXIB 1WM2A 3K9OB 3R7RA 4W9JA 4W9KA 2J7QB 4GMVA 2CU1A 2KTFA 1KM7A 3W1YA 2MP2B 2RSUA 4ICUA 3KYCD 1A5RA 2NPTB 3VDZA 3KYDD 5DPRA 2N1VA 2L3ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3J A;  2KJ6 A;  4WJN A;  1L7Y A;  2LRU A;  2JPH A;  2K6Q A;  4GDK B;  4CYE A;  2LWP A;  2OOB B;  3VAW A;  1WJN A;  2KDI A;  3A9J A;  2KFK A;  3PS6 A;  4MGY E;  4AJY B;  3GZN I;  1K8R B;  1RRB A;  2CHZ A;  2EKE C;  2LVP A;  3ONS A;  2WYQ A;  4G0N B;  3PRP B;  4F8C B;  1RLF A;  4MSQ B;  1HE8 A;  2N4F A;  2FCN A;  4FN2 A;  4AP4 C;  3RT3 B;  3K9P B;  3CST A;  2RPQ A;  4GDL B;  2FCM A;  2KC2 A;  4II3 B;  1WGD A;  3AXC A;  3NOB A;  3IVF A;  2KK8 A;  2JRI B;  2DZM A;  2MRP A;  3SU8 X;  3TJP A;  4PS8 A;  1V5O A;  2BWF A;  3VXW A;  4NJ7 A;  2K39 A;  2DYO A;  3DBL I;  3QWZ B;  3EFU A;  5CHW A;  4FJV B;  1WY8 A;  3ZRC A;  5JHB A;  2ZCB A;  4JGH B;  4FUL A;  4N9F 4;  4ANU A;  4IW0 A;  2Y5B B;  4PYU A;  2C5L C;  1Q0W B;  2KAN A;  3MJW A;  3PHX B;  1VCB A;  2IBI B;  4MJS A;  1P0R A;  4YL8 A;  2JXX A;  2K8H A;  2XK5 A;  3DCG A;  4NAW B;  2V3S A;  5D2M B;  3T8M A;  3JSV B;  1EO6 A;  2C7N B;  2C7H A;  1V80 A;  3NZU A;  4KSL C;  3ZNI D;  4GB9 A;  4M8M A;  3H7P B;  1H4R A;  2ZNV B;  2B3A A;  2UWQ A;  2JUO A;  3PRE A;  2MA9 B;  2C9W B;  4MM3 A;  3ZDM C;  5BO4 B;  4TV3 A;  1WX7 A;  3RCZ A;  3VH3 B;  3VTW A;  2KZR A;  4EUT A;  2IO0 B;  3ZO5 B;  2DZI A;  5G55 A;  4CHK A;  2KTR A;  1WGG A;  1WXV A;  4W9D A;  2J0J A;  4BOZ B;  3A1Q A;  2DX5 B;  4EFO A;  3BY4 B;  3VHT C;  2GBK A;  4EZK A;  1LFD A;  4ZRJ A;  2KJH B;  1JRU A;  4DHZ B;  4BKS D;  3GOE A;  3PSE B;  2BYF A;  1EUV B;  4KIK B;  3VUX A;  5LXH A;  1WF9 A;  1SIF A;  3WAM A;  3ZRF A;  3DBS A;  4K7W A;  3TIX A;  3H6N A;  4MEM A;  4HDO A;  2REX A;  3A9K A;  2M0X A;  1VD2 A;  4FAD A;  4GSW A;  2MLB A;  4B6W A;  2L00 B;  4GN1 A;  3OLM D;  3QK0 A;  1KJT A;  2N9P C;  2LVO A;  3HIZ A;  2MWS B;  3QHT A;  1E8X A;  4AWJ A;  1WMH B;  4NQK E;  3ZDT A;  2D10 A;  2PPH A;  4BKT A;  3JW0 X;  3NY5 A;  3PTF C;  2IYD B;  2KMA A;  2LGY A;  3PV1 A;  4BFR A;  2ZZP B;  2XBB C;  1V5T A;  1TGZ B;  1UEL A;  1WJU A;  3LDZ E;  1EF1 A;  4M0W B;  1E8Y A;  1FXT B;  1UBQ A;  3OAW A;  1UZX B;  1WJ4 A;  2WX1 A;  3PLU A;  4TUU A;  4BOS C;  3RZW C;  2KDF B;  3M63 B;  2WX0 A;  2KC1 A;  2LXC A;  2MP2 A;  2GBN A;  3QIJ A;  5FR6 A;  4DDG D;  1SE9 A;  2NPT A;  3PT2 B;  3UF8 A;  1X1M A;  3ZNZ B;  4FBJ B;  1Q5W B;  4PS3 A;  1P3Q U;  3L16 A;  4G50 A;  1V86 A;  2J0K A;  5CHF A;  3QQ8 B;  2N7D A;  4GDK A;  1YD8 U;  4AUQ C;  2RR9 A;  2DYB A;  4GU2 A;  2DZK A;  3UIO B;  4GXB A;  2I1K A;  3PGE A;  1Z5S B;  2GMI C;  4TQ1 A;  3N3K B;  5GMV A;  4KVG B;  3N32 A;  2XEW A;  2MBO A;  4BKG A;  4XX5 A;  3PLV A;  3EHV A;  1ZGU B;  2LRW A;  4P7I A;  4KDI C;  1WR1 A;  3DVN U;  4WWO A;  5LLI A;  1GNU A;  2KQS A;  1S3S G;  1OEY A;  2MBB B;  5D7G A;  1YX6 B;  2CHX A;  2R2Q A;  2D3G A;  3VVW B;  3W1S A;  4GDL A;  5C1Z A;  1NI2 A;  2FUH B;  5E6P A;  2L0T A;  2D07 B;  3RD2 A;  2AL3 A;  1GC6 A;  5C23 A;  2KWV B;  1M94 A;  3RZF A;  4K1R B;  1J8C A;  3APD A;  4BBN C;  4GOC A;  3SD5 A;  4XC2 A;  1WGR A;  3DQV A;  2FNJ B;  1WR6 E;  2C60 A;  5JZE B;  2KDE B;  1QZE A;  3KVF B;  2UYZ B;  3W1S C;  3H9D A;  3EEC A;  1SGH A;  2M8S A;  4MDK E;  3CMM B;  3RUI B;  4ZRK A;  4A3P A;  2G45 B;  3QAQ A;  1F9J A;  2HJ8 A;  4NAW A;  3CSF A;  3JSV A;  2MBQ A;  4CO7 A;  1KLV A;  3ZVV A;  2BKF A;  1WZ0 A;  2GBJ A;  3H7P A;  3WIM A;  1E5W A;  3AUL A;  1XQQ A;  3HK0 A;  4K7U A;  2Z0D B;  2ZJD A;  3Q3J A;  4DBG A;  5AZF A;  2JF5 A;  1LM8 B;  1EF5 A;  2KN5 A;  4HJK A;  2K8B A;  4B9K A;  3L17 A;  4IM0 A;  2G4D B;  2AEH A;  3DDC B;  1WJ6 A;  2L8J A;  1XD3 B;  3VH4 B;  2LUE A;  3N30 A;  4JQW C;  1OQY A;  3PZD A;  2CHW A;  4F1S A;  2N7E A;  2AYO B;  2N1W A;  2ZNV C;  3HHM A;  5IA7 A;  3QC8 B;  3V6E B;  2KQ7 A;  2LVQ A;  4IC7 B;  1WX9 A;  4LDT D;  4WJP A;  1T0Y A;  5AZH A;  3OJ3 A;  4KIK A;  3ZIM A;  2JT4 B;  3WA0 A;  3ALB A;  2PE9 A;  2YVC A;  2KWU B;  3L10 B;  3TL5 A;  3LJ3 A;  3QCA A;  1YQB A;  1GUA B;  1E8W A;  1IP9 A;  5DPS A;  1GJZ A;  2KX0 A;  1UGM A;  1Z2M A;  2EMT A;  2NS5 A;  3WAL A;  3VUW A;  4LDT B;  4BKS A;  1BT0 A;  5JHA A;  1ISN A;  2N9E B;  3EC8 A;  4TQ0 A;  4DWF A;  4G3X B;  2KXJ A;  4ANX A;  1LXD A;  3ZNH B;  2BF8 B;  1WMH A;  3S2A A;  3A33 B;  1P1A A;  5JH5 C;  1MG8 A;  2KJR A;  3ECI A;  5CHV C;  3T9L A;  2LXA A;  2MQJ A;  4JLC A;  4FA6 A;  4WQO B;  1ZW7 A;  5E6O A;  3WAO A;  4DDI D;  1I42 A;  3ZTC A;  2BYV E;  3X0W A;  2MBH A;  2K1F A;  5CTR C;  3QA8 A;  3SDL C;  1OEY J;  1TZ1 A;  3A4S C;  4ASW C;  4MEL A;  1V9J A;  3UIP B;  3B0A A;  4FJY A;  2V1Y A;  3AU4 A;  4MGK E;  4M8N A;  3JYU A;  2WWZ A;  3ZLZ A;  2VRR B;  5J2R A;  3JVZ X;  2HTH A;  4II2 B;  3P2B A;  3U7D A;  3Q3F A;  4A20 A;  3C0R B;  3CF6 E;  4E74 A;  3DVG Y;  5AZG A;  3ZW3 A;  4MGI E;  4MGZ E;  3TBL D;  2K6D B;  4G11 A;  2KLC A;  2FIF A;  1RFA A;  4ZDV A;  4WJQ A;  3RYT A;  3V6C B;  3NZS A;  2M17 A;  5IAA C;  1OTR B;  4MSM B;  1V81 A;  3IBE A;  4NPN A;  3PVL A;  2I1J A;  3DVG X;  4DXA B;  1Q1O A;  3B1L X;  1J19 A;  3A4R A;  3H7S A;  3L13 A;  2DAJ A;  4HPL B;  2R2O A;  3U8Z A;  4W9H A;  3WAN A;  2O6V D;  3IHP C;  2M4N A;  3M62 B;  4IG7 B;  4K81 A;  4TKN A;  3IG3 A;  4WJO A;  3U30 A;  3R3M A;  4OVV A;  1R4N I;  4ZYN A;  1WZ3 A;  3D32 A;  2DAF A;  2BPS A;  4IUM B;  3DBH I;  1L2N A;  1P98 A;  4ICV A;  5DCN A;  4LJO B;  1D3Z A;  4FLH A;  2KLG A;  3R7Q A;  4F7Z A;  2KFJ A;  2PJH A;  3UQB A;  1G6J A;  2BKR B;  2LAS A;  1WE6 A;  3NS8 A;  4W9I A;  2O6V B;  3B08 A;  4KDL B;  5KHO A;  2LZ6 A;  2ZVO A;  1E8Z A;  4KZC A;  3PRM B;  2MBE A;  4PS7 A;  2D2Q A;  2HE7 A;  1IPG A;  3KUC B;  2IO2 B;  4IM3 A;  5D6J B;  4EOY A;  1S1Q B;  5DPT A;  2IY1 B;  2GBR A;  2KVR A;  4HWI B;  1NDD A;  4JL9 A;  2ZCC A;  4W9C A;  2NCN A;  4W9E A;  3ML9 A;  5L83 A;  1E7V A;  2NBV B;  2M1M A;  4NQL B;  4OVU A;  1CMX B;  5D94 A;  1WYW B;  4KSK C;  4HVB A;  1WX8 A;  4HXD A;  4IWO A;  3TMP B;  1U4A A;  2O2V B;  5TR5 A;  1PQS A;  2L05 A;  2D11 A;  3V61 A;  2LGD A;  4PYZ A;  2PE6 B;  4RM8 A;  3BIN A;  2JWZ A;  3APF A;  3R66 C;  2LD9 A;  4I6P A;  1WGH A;  2BGF A;  2MX2 A;  2Z0E B;  4URK A;  2DYM A;  3UQA A;  2KHW B;  2NVU I;  3KUZ A;  4KZ0 A;  2ZVN A;  2A4Z A;  3NHE B;  5J17 A;  2BYE A;  1J0G A;  1UD7 A;  2CR5 A;  4B95 A;  4LJP B;  2MCN B;  1OGW A;  3V62 A;  1WGY A;  3A9J B;  4FHK A;  2KFK B;  3ZUN A;  5G2N A;  3H1U A;  3MHS D;  3QAR A;  4LCD E;  4ZRI A;  1IYF A;  3PRZ A;  2G3Q B;  4WAA A;  2DZJ A;  2NBU A;  3IFW B;  2DEN B;  2KKC A;  1H8C A;  1V2Y A;  2KO3 A;  4ANV A;  3VUY A;  2KMC A;  3UIN B;  2AL6 A;  4EKU A;  2JZ3 B;  4WWN A;  4K7S A;  2K25 A;  3VTU A;  4X57 B;  2LJ5 A;  5J18 A;  2OJR A;  4EZJ A;  2L0F A;  1E7U A;  3ZKJ C;  2FCQ A;  2FID A;  3DVN V;  1KOT A;  4W9G A;  4KV2 A;  3DOW A;  4W9L A;  4W9F A;  4AOF A;  4NJ6 A;  1XT9 B;  4GGQ A;  4JIO U;  2LGX A;  4MH0 E;  3V60 A;  1E90 A;  1WRD B;  2A5U A;  2GOW A;  4BVU C;  1WI0 A;  2IO3 B;  1V49 A;  2IO1 B;  2RD0 A;  4HPM B;  2JVC A;  3L0W B;  3UGB B;  3KUD B;  4A3O A;  1WXA A;  3SHQ A;  3HM6 X;  1GC7 A;  3KH0 A;  2L76 A;  1TBE A;  3VQI A;  3WAP A;  4AJW A;  2RGF A;  2IY0 B;  3HM3 A;  4I6N B;  3VTV A;  3X23 A;  2HD5 B;  1V6E A;  3DPD A;  4MJS B;  4XZ4 A;  4GIV A;  5HKH A;  2W9N A;  4HCP B;  1WXS A;  2KWC A;  2XK5 B;  1WE7 A;  2ASQ A;  2JY6 A;  2N9X A;  2YLM A;  4NNJ B;  4EEW A;  3AI5 A;  2K8C A;  3ML8 A;  2QHO A;  2WDT B;  1NBF C;  3O65 B;  1WXM A;  4RMA A;  3AU5 A;  1C1Y B;  2KOX A;  1C3T A;  1UH6 A;  1WH3 A;  2BWE S;  3ZTD A;  3KW5 B;  1GG3 A;  1P9D U;  4RM9 A;  2ZPN A;  3M95 A;  4E71 A;  2KTR B;  1ZKH A;  3APC A;  4WWP A;  2PEA A;  2KDB A;  3A1Q B;  1WFY A;  2GBM A;  4FJZ A;  4FHJ A;  1R4M I;  2L7R A;  4DK5 A;  1YX5 B;  4HK2 A;  4IWP A;  5AEK B;  3RUL A;  2FCS A;  2O6V A;  2CKH B;  2JZZ A;  2KX3 A;  4I6L B;  1TTN A;  5DPW A;  3QJZ A;  4DHJ D;  1UBI A;  2MW5 A;  3I3T B;  1RAX A;  2CS4 A;  5L95 C;  2EMS A;  3ZNG C;  4NY0 A;  2C7M B;  5CX3 A;  3MTN B;  4E3C A;  5EDS A;  3L08 A;  2NBW B;  2DHZ A;  4IWQ A;  3A9K B;  2AWT A;  2FAZ A;  2JRH A;  1WM3 A;  1LQB A;  2MSE D;  1YIW A;  3OJ4 B;  3PPA A;  1I35 A;  3DBR I;  2V4L A;  2Z59 B;  1WIA A;  2LI5 A;  3L54 A;  2G4S A;  4DHJ B;  4HCN B;  3QX1 A;  4J6I A;  3TCA A;  4DHZ E;  4BBN F;  4HDQ A;  4ANW A;  1YJ1 A;  2IZV B;  2NR2 A;  1AAR A;  5KHQ A;  4HLE A;  2ZPY A;  2ZEQ A;  4EZL A;  2KNB A;  2J0M A;  2O2V A;  3ENE A;  1Y8R C;  5E6N A;  3VFK A;  3PHW B;  4IM2 A;  2KD0 A;  5LXI B;  1WM2 A;  3K9O B;  3R7R A;  4W9J A;  4W9K A;  2J7Q B;  4GMV A;  2CU1 A;  2KTF A;  1KM7 A;  3W1Y A;  2MP2 B;  2RSU A;  4ICU A;  3KYC D;  1A5R A;  2NPT B;  3VDZ A;  3KYD D;  5DPR A;  2N1V A;  2L3Z A; 
#chains in the Genus database with same CATH topology
 2KJ6 A;  2KN4 A;  2JPH A;  4CYE A;  3VAW A;  2OOB B;  3A9J A;  1UWX A;  2KFK A;  1FD6 A;  1VZ8 A;  4YSX B;  1Q10 A;  1B9R A;  4AJY B;  3GZN I;  1XLQ A;  1NEK B;  4F8C B;  1D4B A;  2LHE A;  2G1E A;  2PVG C;  4N58 A;  4ZHP A;  4FN2 A;  3CST A;  3NVW A;  1WGD A;  2MRP A;  5EE9 A;  1E10 A;  3VXW A;  4HJG E;  3EFU A;  3AE8 B;  3ZRC A;  3U7Z A;  4JGH B;  3MJW A;  1P0R A;  3T8M A;  3ZNI D;  3H7P B;  1TS2 A;  1QT9 A;  2UWQ A;  3VR8 B;  2JYE A;  1JRP A;  2C9W B;  4MM3 A;  3ZDM C;  4EUT A;  2IO0 B;  1ET9 A;  4W9D A;  2J0J A;  4R3D A;  1SE4 A;  1UNS A;  2GBK A;  1LFD A;  1GOZ A;  1XCQ L;  2IGD A;  3AE2 B;  3PSE B;  4O1N A;  1QKZ A;  3WAM A;  3ZJU A;  3DBS A;  4K7W A;  3H6N A;  5LNK 1;  3DWM A;  4GN1 A;  3TSS A;  3AE4 B;  3HIZ A;  1HTQ A;  3NVZ A;  4AWJ A;  3ZDT A;  3RNF C;  4WIP A;  1EF1 A;  3PZ8 A;  1R4M B;  3OAW A;  1UZX B;  3PLU A;  3KWL A;  2MP2 A;  4REZ A;  5FR6 A;  2HTM E;  1PFD A;  4YTP B;  4FBJ B;  1KFY B;  3MC0 B;  2MJE A;  2J0K A;  5CHF A;  3QQ8 B;  3DBR B;  5FR3 A;  3IAM 1;  1VLB A;  1Z5S B;  2JWU A;  3N3K B;  3N32 A;  4KGT A;  1JCK B;  1WWT A;  1V1P B;  1YX6 B;  3VVW B;  3W1S A;  4MAC A;  4KX6 B;  2D07 B;  2KWV B;  3RZF A;  1FMA D;  3APD A;  2WXI A;  1WGR A;  1WR6 E;  3AE6 B;  1OQQ A;  1VRA B;  2UYZ B;  4XGA B;  4YSZ B;  1SGH A;  4MDK E;  4JWU C;  4A3P A;  4HKQ A;  3QAQ A;  1KLV A;  2MBQ A;  4CO7 A;  3H7P A;  3AUL A;  1XQQ A;  2Z0D B;  3Q3J A;  5AZF A;  1LM8 B;  3L17 A;  5HFY A;  3DDC B;  3PZD A;  4F1S A;  1CJE A;  4WQM A;  1OFF A;  1C9F A;  1QIL A;  1DOI A;  4WJP A;  3GE8 C;  5AZH A;  3OJ3 A;  2PE9 A;  3N1Z C;  1I4R A;  3TL5 A;  3LJ3 A;  3N1X C;  1GJZ A;  1UGM A;  3BK1 A;  1DYQ A;  3EC8 A;  4HRO A;  4TQ0 A;  4OVZ A;  1P1A A;  2WU2 B;  1VR9 A;  4YTN B;  4HEA 1;  1MG8 A;  2KJR A;  1SIJ A;  3T9L A;  5CHV C;  1YN3 A;  4FA6 A;  4WQO B;  4BZA A;  1K52 A;  4OZB A;  2K1F A;  5CTR C;  3QA8 A;  4ZHO A;  1OEY J;  1TZ1 A;  4ACF A;  3B0A A;  4M02 A;  2WXJ A;  5BYS A;  3JYU A;  3NJT A;  2VRR B;  1FXA A;  3P2B A;  2BS4 B;  3GP7 A;  3CF6 E;  1ESF A;  4E74 A;  2ZW0 A;  3DVG Y;  5BYR A;  3AE7 B;  1FIQ A;  5E6J A;  3RPF C;  2WNM A;  1E7P B;  2D3B A;  3V6C B;  1OTR B;  1V81 A;  3IBE A;  1V1P A;  3DVG X;  2OED A;  1J19 A;  3A4R A;  1ET6 A;  2O6V D;  2LGI A;  3IHP C;  4IG7 B;  1FRR A;  2QSD A;  3U30 A;  5H92 C;  2WXQ A;  3N1Y C;  4OVV A;  2BPS A;  1ZPS A;  2N7J A;  4LJO B;  5BMG A;  2ZW1 A;  3GE3 C;  3UQB A;  1L4D B;  1WE6 A;  2O6V B;  4KDL B;  4FXC A;  1ENF A;  1F52 A;  2K22 A;  2MBE A;  1FNW A;  1S1Q B;  5G5H A;  2IY1 B;  2GBR A;  4JL9 A;  3TUO A;  4PK1 A;  5L83 A;  3AV8 A;  4IDI A;  3Q8E A;  3ZGZ A;  4RCO A;  2MJ3 A;  2JYT A;  1L0V B;  2BS3 B;  4GLS C;  4IWO A;  3TMP B;  4H2A A;  1NYQ A;  1N5X A;  2X38 A;  1PQS A;  1D6E C;  4OZC A;  4HPP A;  5EE3 A;  1WGH A;  2MX2 A;  4URK A;  1MFW A;  2BYE A;  1J0G A;  3V62 A;  2Y5C A;  4WUR A;  3ZUN A;  1QOB A;  1AW7 A;  1H8C A;  3TEY A;  4ANV A;  1SE2 A;  2KMC A;  2K25 A;  2VZK D;  2LJ5 A;  5J18 A;  2QJL A;  3NG0 A;  1IGC A;  2XN9 C;  3DVN V;  4KV2 A;  4NJ6 A;  4GGQ A;  2LGX A;  4DQO C;  2VZK B;  1WI0 A;  2RD0 A;  2EKI A;  2JVC A;  3L0W B;  3KUD B;  1WXA A;  3KH0 A;  4OZA A;  4AJW A;  2IY0 B;  3RNE C;  4IOI E;  1WE7 A;  4JE3 B;  2YLM A;  3RI7 C;  3ML8 A;  2WDT B;  1NBF C;  3CWI A;  2K0P A;  3ZTD A;  3KW5 B;  1MHH E;  3M95 A;  4E71 A;  1ZKH A;  3RNG C;  3P4R B;  4NJC A;  1R4M I;  3W5U B;  2FCS A;  2O6V A;  1TTN A;  1I7H A;  4DHJ D;  3I3T B;  2EMS A;  3MTN B;  3BVG A;  2DHZ A;  1LQB A;  3KLS X;  4NZL B;  1I35 A;  1BUI C;  3DBR I;  1WIA A;  2G4S A;  4DHJ B;  1T0S C;  4YT0 B;  1AAR A;  4HLE A;  5AUK A;  1IUE A;  1ZUD 2;  1Y8R C;  2RDH A;  2XNA C;  2KD0 A;  4J3O D;  2KAC A;  4GMV A;  5C2T B;  2WS3 B;  4ICU A;  2NPT B;  2V9H A;  4GDK B;  2KDI A;  4MGY E;  3U2S C;  1VZ7 A;  3P4S B;  1K8R B;  1RRB A;  2CHZ A;  2EKE C;  3ONS A;  2WYQ A;  2FCN A;  4ITK A;  4JX1 C;  1WGK A;  3K9P B;  4GDL B;  1FFU A;  4II3 B;  2KK8 A;  2WXN A;  2CJN A;  3NUH B;  1MVK A;  3TJP A;  4PS8 A;  1V5O A;  2PTL A;  2K39 A;  5CHW A;  4ANU A;  3VRA B;  4IW0 A;  4PYU A;  2C5L C;  1Q0W B;  5IO9 A;  1L6V A;  2G9H D;  4YL8 A;  3HVD A;  1EO6 A;  1KTK A;  1YN5 A;  4WH4 A;  4KSL C;  4A9A A;  4XWT A;  3PRE A;  1QOA A;  2WHI A;  5BO4 B;  3VH3 B;  1P7E A;  2NTS A;  4CHK A;  2DZI A;  2V4I B;  1DOY A;  2WXO A;  2WGS A;  4ZRQ A;  2JSV X;  2WDV B;  2RMM A;  4DHZ B;  2KJH B;  1JRU A;  1FRD A;  1XO3 A;  2K9X A;  1BXT A;  4A6Q A;  1YQ3 B;  3ZRF A;  4MEM A;  3IAS 1;  4FAD A;  4GSW A;  2MLB A;  3OLM D;  3AEA B;  3Q6B A;  1Y56 A;  1WMH B;  4NQK E;  4BKT A;  3NY5 A;  3PTF C;  3PV1 A;  2BYT A;  1E8Y A;  1FM0 D;  5AUI A;  2WX1 A;  4BOS C;  4OHJ A;  2LXC A;  2GBN A;  1SE9 A;  2NPT A;  3UF8 A;  3ZNZ B;  2N7D A;  4GDK A;  1L0X B;  1TS3 A;  4US9 A;  3PO0 A;  2LMC A;  2DYB A;  4GU2 A;  2DZK A;  1XEE A;  2I1K A;  1D5M C;  2AX5 A;  2GMI C;  2FE8 A;  4KVG B;  2WXR A;  2XEW A;  4XX5 A;  3PLV A;  1ZGU B;  1FNV A;  2LRW A;  3DVN U;  5LLI A;  2KQS A;  4C4V B;  1HXY D;  5D7G A;  2D3G A;  4GDL A;  1ZXI A;  2L0T A;  4RGO S;  3RD2 A;  1NVI D;  2L1A A;  1QOG A;  4GOC A;  4Q2J A;  3RMK C;  3KVF B;  3H9D A;  3EEC A;  2M8S A;  4WWM A;  3CMM B;  3Q3O C;  2HJ8 A;  1I4G A;  3VR9 B;  2GBJ A;  4LNF A;  3WIM A;  2IND C;  3HK0 A;  2ZJD A;  3FKY A;  2KN5 A;  2QCZ A;  1WJ6 A;  3VH4 B;  2WXH A;  4JQW C;  5FKA C;  2CHW A;  2N7E A;  3Q3N C;  2AYO B;  2N1W A;  2ZNV C;  3HHM A;  5IA7 A;  3QC8 B;  2KQ7 A;  4IC7 B;  2NMQ A;  1T0Y A;  3W5V B;  3WA0 A;  4OW0 A;  2YVC A;  3L10 B;  1GUA B;  5DPS A;  2KX0 A;  1EWC A;  2NS5 A;  1BT0 A;  2LFI A;  2QMT A;  1K50 A;  2N9E B;  2Q5W D;  4C7Z A;  1J7A A;  2KXJ A;  1LXD A;  1WMH A;  1E6E B;  1JWU D;  5JH5 C;  4JWS C;  1JRO A;  2LXA A;  4JLC A;  1NYR A;  3WAO A;  4D2K A;  3ZTC A;  2BYV E;  4XYC A;  3X0W A;  2RPV A;  4RH6 A;  2K3U A;  4ASW C;  3Q3M C;  2GRI A;  1TT5 B;  1C4P A;  2V1Y A;  2KVZ A;  4M8N A;  2WWZ A;  5J2R A;  4II2 B;  2V3N A;  1D5X C;  3P4Q B;  4A20 A;  1SBB B;  1RM6 C;  2IPK D;  2H88 B;  1V1O A;  3TBL D;  1HEZ E;  4G11 A;  1QLB B;  4AQ7 A;  4C4V A;  2KWD A;  4NPN A;  2I1J A;  4DXA B;  4RNA A;  3B1L X;  2R2O A;  1PDX A;  4W9H A;  2WP9 B;  3M62 B;  4K81 A;  1XLN A;  1FCL A;  3IG3 A;  4K3C A;  4XDC A;  3LYY A;  1L2N A;  2WXP A;  1P7F A;  4ICV A;  3AE3 B;  3E9S A;  2KLG A;  3R7Q A;  4UDU C;  1G6J A;  1N63 A;  4W9I A;  5KHO A;  2UU7 A;  2AQ1 B;  2ZVO A;  4KZC A;  3AEE B;  4PS7 A;  3PRM B;  2D2Q A;  2HE7 A;  3KUC B;  5D6J B;  3I9V 1;  4HWI B;  3AN1 A;  4W9E A;  4LLG M;  3ML9 A;  1E7V A;  5FK9 C;  2N0S B;  2WXG A;  4OVU A;  4USA A;  3N9Y C;  1ZXH A;  4LNK A;  3I63 C;  5D3D A;  5TR5 A;  1L0Y B;  2L05 A;  2D11 A;  2LGD A;  3EFC A;  4PYZ A;  2KDM A;  3BIN A;  2SEB D;  5BMI A;  3R66 C;  1FXI A;  2LD9 A;  3V05 A;  3UQA A;  5HG2 A;  4LCD E;  1IYF A;  3QAR A;  4ZRI A;  5EE0 A;  2NBU A;  3OWE B;  3CIR B;  1V2Y A;  1ZDX A;  3UIN B;  2JZ3 B;  3VTU A;  1GPX A;  4X57 B;  4C7Y A;  2OJR A;  4AOF A;  1XT9 B;  4MH0 E;  4RF1 A;  1E90 A;  2IO3 B;  1GB1 A;  2IO1 B;  2E3T A;  1C78 A;  3VQI A;  3WAP A;  2RGF A;  4I6N B;  3VTV A;  3Q8C A;  4RGT A;  4MJS B;  4XZ4 A;  4IKG A;  4GIV A;  4HCP B;  2H89 B;  2D3C A;  4RF0 A;  1IBX B;  1JQ4 A;  2JY6 A;  4NNJ B;  4EEW A;  3W9C B;  2KT7 A;  2OJW A;  1T6B X;  3O65 B;  1V8C A;  1C3T A;  3Q69 A;  2BWE S;  4BAX A;  3AEC B;  1GG3 A;  1L6U A;  3MHZ A;  2ZPN A;  2KTR B;  3APC A;  2PEA A;  4L2Y A;  2K5P A;  1PGB A;  1SE3 A;  1YMH E;  2GBM A;  1EU4 A;  2J4X A;  2LJI A;  4HK2 A;  4IWP A;  5AEK B;  3UI3 A;  1UBI A;  2C7M B;  2ONQ A;  5EDS A;  3L08 A;  4IWQ A;  2AWT A;  2V4L A;  4LTU A;  3KWV A;  1T3Q A;  2KYW A;  4B0E A;  4N6E B;  5KHQ A;  1R4N B;  2ZPY A;  2ZEQ A;  3ENE A;  3PHW B;  5LXI B;  2AQ3 B;  1WM2 A;  3K9O B;  4W9K A;  2J7Q B;  2CU1 A;  2KTF A;  2I38 A;  3KYC D;  3RNC C;  2MSE D;  3M3J A;  1JAL A;  2PVO D;  4WJN A;  1L7Y A;  2LRU A;  3AED B;  3OG5 A;  1F77 A;  5HI1 A;  2JX5 A;  3PS6 A;  3NRZ A;  3IT6 B;  1N6Z A;  3HRD D;  1SF0 A;  3PRP B;  1RLF A;  4A90 A;  1HE8 A;  1ROE A;  2N4F A;  4AP4 C;  3RT3 B;  2RPQ A;  2Z8L A;  3AXC A;  4YTM B;  2PKO A;  3SU8 X;  3EA6 A;  2BWF A;  2BB6 A;  1WSP A;  1WRI A;  2DYO A;  3DBL I;  1WY8 A;  5JHB A;  4N9F 4;  3W2D A;  1TKY A;  2Y5B B;  2DBY A;  2KAN A;  3PHX B;  1E9M A;  2IBI B;  4MJS A;  2K8H A;  4NAW B;  5D2M B;  2V3S A;  1IBX A;  3JSV B;  4GB9 A;  4C00 A;  5G5G A;  3PZ7 A;  1H4R A;  2ZNV B;  4RGM A;  2KAJ A;  1FO4 A;  4TV3 A;  1WX7 A;  1D5Z C;  2KZR A;  3SEB A;  3AMZ A;  3EUB 2;  3ZO5 B;  3Q2A C;  5G55 A;  2KTR A;  1WXV A;  4EFO A;  3VHT C;  4EZK A;  4ZRJ A;  5GXG B;  4BKS D;  3DWG C;  4EE2 A;  3GOE A;  2BYF A;  4KIK B;  3VUX A;  5LXH A;  1SIF A;  4LK0 M;  3TIX A;  3ZXR A;  1EU3 A;  1VZ6 A;  1VD2 A;  4B6W A;  2L00 B;  3ABV B;  4ZYS A;  4ARC A;  3H8H A;  2N9P C;  3Q8F A;  3LXF A;  1YNT E;  3QHT A;  1TS5 A;  2D10 A;  3RFZ B;  2LGY A;  2ZZP B;  2XBB C;  1V5T A;  4B0M A;  1FPY A;  1WXQ A;  1VDV A;  4M0W B;  1MJD A;  1FXT B;  1UBQ A;  4ZOH C;  3AB5 A;  4TUU A;  3RZW C;  2KDF B;  3M63 B;  3QIJ A;  3PT2 B;  1X1M A;  2ACZ B;  5IN7 A;  1I4H A;  4PS3 A;  1P3Q U;  2D5G A;  3AEB B;  2RR9 A;  3PGE A;  1TJE A;  1CZP A;  2MBO A;  1L4Z B;  2WLB A;  3EHV A;  1HA5 A;  2GLS A;  4WWO A;  1GNU A;  1S3S G;  1OEY A;  3AM9 A;  3KQ4 A;  5E6P A;  2AL3 A;  5C23 A;  1PGX A;  1M94 A;  1KF6 B;  2W54 A;  1N62 A;  2FNJ B;  2R61 A;  1SEB D;  1XXG A;  3Q8A A;  4XWW A;  3RUI B;  4NAW A;  3JSV A;  1JML A;  2BKF A;  1WZ0 A;  1F2R C;  2INN E;  1SXT A;  3BVM A;  3RNB C;  2JF5 A;  1EF5 A;  1FCC C;  4HJK A;  2K8B A;  4B9K A;  4IM0 A;  2G4D B;  2AEH A;  3LB8 C;  2L8J A;  1STE A;  1OQY A;  4ARI A;  2IDY A;  1R7S A;  4KIK A;  1ZE3 D;  3ZIM A;  2B76 B;  2I2Y A;  2KWU B;  3P4P B;  1YQB A;  3QCA A;  1E8W A;  1IP9 A;  3WAL A;  4DXF A;  4BKS A;  5JHA A;  1JWB D;  1ISN A;  2M0A A;  2ON8 A;  2BS2 B;  2BF8 B;  3S2A A;  1PYW D;  1ZOY B;  2WXF A;  1ZP0 B;  5JXV A;  2QC8 A;  2MQJ A;  4M0W A;  5E6O A;  1I42 A;  1GAQ B;  5BYQ A;  2MBH A;  1KH0 A;  1YN4 A;  1V9J A;  3UIP B;  4FJY A;  3Q8B A;  4N59 A;  2BW2 A;  3AU4 A;  3P63 A;  1SJE D;  1F1H A;  1XLP A;  1MPE A;  3U7D A;  2YEP B;  3Q3F A;  3C0R B;  1TKE A;  2QEJ C;  2JZP A;  5AZG A;  3ZW3 A;  4MGZ E;  2K6D B;  2KLC A;  2FIF A;  1KRH A;  1AYF A;  4ZDV A;  3RYT A;  1A70 A;  1SB3 C;  5IAA C;  2LEK A;  1N5W A;  3H7S A;  3L13 A;  1IGD A;  3WAN A;  1K51 A;  2M4N A;  4TKN A;  4XDD A;  3R3M A;  1R4N I;  4ZYN A;  4IUM B;  4FLH A;  3DHI C;  2KFJ A;  2PJH A;  2BKR B;  2ICI A;  2LAS A;  1HQR D;  2WXL A;  1E8Z A;  2WDQ B;  1K53 A;  3HUI A;  1FNU A;  4IM3 A;  5DPT A;  4LNN A;  1OQR A;  4YXD B;  4KKJ A;  1NDD A;  2WXM A;  2ZCC A;  4W9C A;  1EWY C;  2V3P A;  1I4P A;  1SJH D;  2M1M A;  3MFG A;  4S17 A;  4NQL B;  2Y3A A;  1CMX B;  4M00 A;  4WAF A;  4HVB A;  1YOV B;  2N9L A;  1U4A A;  3ZJT A;  2MH7 A;  5T8I A;  1LO5 D;  2PE6 B;  4RM8 A;  2JWZ A;  3APF A;  2NTT A;  1I4Q A;  2BGF A;  2Z0E B;  2DYM A;  3TEX A;  3AEG B;  2NVU I;  3KUZ A;  2A4Z A;  3NHE B;  5J17 A;  1UD7 A;  2CR5 A;  4B95 A;  3DBL B;  1OGW A;  1WGY A;  3EGR A;  5G2N A;  3H1U A;  3AH7 A;  4WAA A;  5H8Y E;  3IFW B;  2KKC A;  1EM7 A;  4NAM A;  5C3J B;  1NEN B;  3VUY A;  2AL6 A;  2PIA A;  3DHH C;  2CJO A;  4WWN A;  4K7S A;  1RYJ A;  2L0F A;  3ZKJ C;  3NS1 A;  1KOT A;  3P42 A;  1HZ5 A;  3T3N A;  3V60 A;  3BII D;  1VJK A;  4BVU C;  2A5U A;  2GOW A;  2DNF A;  4HPM B;  3URY A;  3R8B A;  3UGB B;  4A3O A;  4ZRP A;  1AN8 A;  3SHQ A;  2CU3 A;  1DGJ A;  3X23 A;  3HVZ A;  1V6E A;  3DPD A;  1PUT A;  2KWC A;  2XK5 B;  1XF5 L;  3BZD B;  3AI5 A;  2K8C A;  1TY0 A;  2BVC A;  4KKI A;  1WXM A;  3AU5 A;  1C1Y B;  3N20 C;  4MT5 A;  1P9D U;  3U52 E;  1RFK A;  3C19 A;  3Q14 C;  4WWP A;  3A1Q B;  2KDB A;  2DLB A;  1WFY A;  1QOF A;  4FJZ A;  3NVY A;  2OHF A;  1YX5 B;  1HTO A;  3RUL A;  2CKH B;  2JZZ A;  5HHD G;  3B2G A;  3ZNG C;  4NY0 A;  2NBW B;  3A9K B;  3MC9 A;  1C4C A;  1WM3 A;  3I5J C;  3L54 A;  3BYY B;  4HCN B;  3QX1 A;  4TMA B;  2BBC A;  4J6I A;  3TCA A;  4DHZ E;  2KMM A;  1JWS D;  3ETR A;  4HDQ A;  1YJ1 A;  2NR2 A;  2WU5 B;  3AE1 B;  3DBH B;  1HZ6 A;  4IM2 A;  3R7R A;  2INC C;  4W9J A;  1YJJ A;  1KM7 A;  3W1Y A;  4P1B C;  4L1B A;  1A5R A;  4RFB A;  1T0R C;  2L3Z A;  3WCQ A;  2K6Q A;  2LWP A;  4KGS A;  1UGJ A;  1WJN A;  2RDB C;  3FAH A;  2LVP A;  2BB5 A;  1MHX A;  4G0N B;  1QF6 A;  1T0Q C;  4MSQ B;  1YQ4 B;  4DXG A;  2L52 A;  5TSS A;  3AE5 B;  2FCM A;  2KC2 A;  3NOB A;  3IVF A;  2JRI B;  2DZM A;  2JXT A;  2LGS A;  5MPO A;  1JWM D;  4NJ7 A;  3QWZ B;  4FJV B;  2IGH A;  2ZCB A;  4FUL A;  3T3O A;  1VCB A;  3R2T A;  2JXX A;  2XK5 A;  3DCG A;  2C7N B;  2C7H A;  1V80 A;  3NZU A;  3BVZ A;  5BMH A;  4M8M A;  4L23 A;  2GB1 A;  2FUG 1;  1KLU D;  2B3A A;  2JUO A;  2MA9 B;  2QDF A;  3RCZ A;  3VTW A;  1TY2 A;  1WGG A;  4BOZ B;  3A1Q A;  2DX5 B;  1C76 A;  3BY4 B;  1WYG A;  1EUV B;  1WF9 A;  4HDO A;  2REX A;  3MC8 A;  3A9K A;  2M0X A;  2W3S A;  1YJI A;  3C8Y A;  4XE0 A;  3QK0 A;  1KJT A;  1C79 A;  3RNA C;  2LVO A;  1FEH A;  2X8X X;  3O13 A;  1TS4 A;  3E56 A;  2MWS B;  2FBW B;  1E8X A;  2PPH A;  1C77 A;  3JW0 X;  4BFR A;  2IYD B;  2INP E;  2KMA A;  2W3R A;  1F0Z A;  2D3A A;  1TGZ B;  1UEL A;  1WJU A;  3LDZ E;  1C4A A;  1WJ4 A;  1ZDV A;  4C80 A;  1J7C A;  2WX0 A;  2KC1 A;  2WXK A;  4DDG D;  1LGR A;  3AEF B;  1I4X A;  1Q5W B;  4CQN A;  3B2F A;  3L16 A;  4G50 A;  1V86 A;  1YD8 U;  4AUQ C;  1QQR A;  3UIO B;  4GXB A;  4JPS A;  2BTE A;  4TQ1 A;  5GMV A;  3ZXV A;  2DWQ A;  4BKG A;  1UUP A;  3P1M A;  4MH8 A;  4P7I A;  4KDI C;  1WR1 A;  2E6X A;  1SSN A;  4YWG G;  3BYT B;  2MBB B;  2IGG A;  2CHX A;  2R2Q A;  2N9K A;  1TYG B;  2LUM A;  5C1Z A;  1NI2 A;  2FUH B;  4LNI A;  1MG4 A;  1GC6 A;  4P1C C;  4K1R B;  1J8C A;  4BBN C;  3SD5 A;  4XC2 A;  3DQV A;  2C60 A;  5JZE B;  2KDE B;  1QZE A;  3W1S C;  4TSS A;  3MP9 A;  4ZRK A;  3GZN B;  3NZ3 A;  2G45 B;  1F9J A;  3CSF A;  3SR6 A;  2MEK A;  3ZVV A;  3L4P A;  1E5W A;  4K7U A;  4DBG A;  4P16 A;  4M01 A;  2KQ4 X;  2HJ1 A;  1XD3 B;  2LUE A;  3N30 A;  3V6E B;  2LVQ A;  4LDT D;  1WX9 A;  2EEL A;  2JT4 B;  3ALB A;  1BML C;  1Z2M A;  2EMT A;  3VUW A;  4LDT B;  2J53 A;  4RGN A;  3I57 A;  4DWF A;  4G3X B;  4ANX A;  2Y5P A;  3ZNH B;  3TEW A;  3BK2 A;  1DOX A;  2PLP A;  3A33 B;  3ECI A;  1AWD A;  1ZW7 A;  4DDI D;  2HDE A;  5IP4 D;  2L32 A;  3SDL C;  3A4S C;  4MEL A;  3AE9 B;  1L5P A;  3FIL B;  4MGK E;  3GS2 A;  3ZLZ A;  2WDR B;  3JVZ X;  2HTH A;  4AS1 A;  3NVV A;  1B1Z A;  2BQQ A;  4K3B A;  4S0R A;  4MGI E;  1TKG A;  2LHD A;  2JU6 X;  1RFA A;  4WJQ A;  3NZS A;  2M17 A;  3IT4 B;  1TZO A;  4MSM B;  3PVL A;  1Q1O A;  4US8 A;  3ZQ4 A;  2DAJ A;  4HPL B;  3U8Z A;  2M19 A;  4WJO A;  2SAK A;  2RDG A;  1WZ3 A;  3D32 A;  2DAF A;  1CQV A;  3ZJV A;  2JQR B;  3DBH I;  3DHG C;  1P98 A;  5DCN A;  1UF0 A;  1D3Z A;  4F7Z A;  2V0G A;  3NS8 A;  3V3X A;  3B08 A;  4LNO A;  5I4D A;  2LZ6 A;  1IPG A;  2IO2 B;  4EOY A;  2KVR A;  4P6V F;  3B9J A;  1RWS A;  2NCN A;  2NBV B;  1ACC A;  2VH2 A;  5EE1 A;  3SFE B;  5D94 A;  1WYW B;  4KSK C;  1WX8 A;  2MHJ A;  4HXD A;  2GI9 A;  1J7B A;  2O2V B;  2QIL A;  1GB4 A;  3V61 A;  1TIF A;  1N61 A;  1XCT L;  4I6P A;  1M4V A;  2KHW B;  1V97 A;  4KZ0 A;  2ZVN A;  4LJP B;  2MCN B;  1F2R I;  3A9J B;  1KLG D;  4FHK A;  2KFK B;  3MHS D;  3RN9 C;  3PRZ A;  2G3Q B;  1FFV A;  3BWU D;  2DZJ A;  5IKC M;  2DEN B;  2KO3 A;  1PGA A;  4EKU A;  2YEP F;  4A8X C;  1NI3 A;  4EZJ A;  1E7U A;  2FCQ A;  2FID A;  4W9G A;  4W9F A;  3DOW A;  4W9L A;  5D3I B;  4JIO U;  3FIL A;  1WRD B;  1V49 A;  4KGR A;  4HKZ E;  3HM6 X;  1GC7 A;  1T5X D;  1MI0 A;  2W55 A;  2L76 A;  1TBE A;  2IJ0 A;  3HM3 A;  4A55 A;  2L83 A;  2HD5 B;  3SFD B;  2W82 A;  5HKH A;  5IOI A;  2W9N A;  1E0Z A;  1WXS A;  2ASQ A;  2N9X A;  4PT5 A;  2M56 B;  1JWA D;  2QHO A;  4RMA A;  3IXS A;  2KOX A;  1UH6 A;  1WH3 A;  3J9C A;  4MM3 B;  4RM9 A;  4YSY B;  2J52 A;  2WQY B;  4FHJ A;  4DK5 A;  2L7R A;  2BT6 A;  2PW9 A;  1CK1 A;  2QIE B;  2KX3 A;  4I6L B;  3GB1 A;  5DPW A;  3QJZ A;  2MW5 A;  1RAX A;  2CS4 A;  5L95 C;  1N60 A;  3FC4 A;  5CX3 A;  4E3C A;  2FAZ A;  2JRH A;  3OJ4 B;  1YIW A;  3PPA A;  4QAY A;  3R2I A;  4C56 C;  3MJ5 A;  2Z59 B;  2LI5 A;  3U4E G;  2TSS A;  4BBN F;  4ANW A;  1JW9 D;  2IZV B;  2J42 A;  4HRS A;  3TEZ A;  2MJD A;  1UWM A;  4EZL A;  2AQ2 B;  2KNB A;  2J0M A;  2O2V A;  3VFK A;  5E6N A;  2PMV A;  1XLO A;  2MP2 B;  2RSU A;  3ZYY X;  3VRB B;  2VH1 A;  3VDZ A;  3KYD D;  5DPR A;  2N1V A; 
#chains in the Genus database with same CATH homology
 3M3J A;  2KJ6 A;  4WJN A;  1L7Y A;  2LRU A;  2JPH A;  2K6Q A;  4GDK B;  4CYE A;  2LWP A;  2OOB B;  3VAW A;  1WJN A;  2KDI A;  3A9J A;  2KFK A;  3PS6 A;  4MGY E;  4AJY B;  3GZN I;  1K8R B;  1RRB A;  2CHZ A;  2EKE C;  2LVP A;  3ONS A;  2WYQ A;  4G0N B;  3PRP B;  4F8C B;  1RLF A;  4MSQ B;  1HE8 A;  2N4F A;  2FCN A;  4FN2 A;  4AP4 C;  3RT3 B;  3K9P B;  3CST A;  2RPQ A;  4GDL B;  2FCM A;  2KC2 A;  4II3 B;  1WGD A;  3AXC A;  3NOB A;  3IVF A;  2KK8 A;  2JRI B;  2DZM A;  2MRP A;  3SU8 X;  3TJP A;  4PS8 A;  1V5O A;  2BWF A;  3VXW A;  4NJ7 A;  2K39 A;  2DYO A;  3DBL I;  3QWZ B;  3EFU A;  5CHW A;  4FJV B;  1WY8 A;  3ZRC A;  5JHB A;  2ZCB A;  4JGH B;  4FUL A;  4N9F 4;  4ANU A;  4IW0 A;  2Y5B B;  4PYU A;  2C5L C;  1Q0W B;  2KAN A;  3MJW A;  3PHX B;  1VCB A;  2IBI B;  4MJS A;  1P0R A;  4YL8 A;  2JXX A;  2K8H A;  2XK5 A;  3DCG A;  4NAW B;  2V3S A;  5D2M B;  3T8M A;  3JSV B;  1EO6 A;  2C7N B;  2C7H A;  1V80 A;  3NZU A;  4KSL C;  3ZNI D;  4GB9 A;  4M8M A;  3H7P B;  1H4R A;  2ZNV B;  2B3A A;  2UWQ A;  2JUO A;  3PRE A;  2MA9 B;  2C9W B;  4MM3 A;  3ZDM C;  5BO4 B;  4TV3 A;  1WX7 A;  3RCZ A;  3VH3 B;  3VTW A;  2KZR A;  4EUT A;  2IO0 B;  3ZO5 B;  2DZI A;  5G55 A;  4CHK A;  2KTR A;  1WGG A;  1WXV A;  4W9D A;  2J0J A;  4BOZ B;  3A1Q A;  2DX5 B;  4EFO A;  3BY4 B;  3VHT C;  2GBK A;  4EZK A;  1LFD A;  4ZRJ A;  2KJH B;  1JRU A;  4DHZ B;  4BKS D;  3GOE A;  3PSE B;  2BYF A;  1EUV B;  4KIK B;  3VUX A;  5LXH A;  1WF9 A;  1SIF A;  3WAM A;  3ZRF A;  3DBS A;  4K7W A;  3TIX A;  3H6N A;  4MEM A;  4HDO A;  2REX A;  3A9K A;  2M0X A;  1VD2 A;  4FAD A;  4GSW A;  2MLB A;  4B6W A;  2L00 B;  4GN1 A;  3OLM D;  3QK0 A;  1KJT A;  2N9P C;  2LVO A;  3HIZ A;  2MWS B;  3QHT A;  1E8X A;  4AWJ A;  1WMH B;  4NQK E;  3ZDT A;  2D10 A;  2PPH A;  4BKT A;  3JW0 X;  3NY5 A;  3PTF C;  2IYD B;  2KMA A;  2LGY A;  3PV1 A;  4BFR A;  2ZZP B;  2XBB C;  1V5T A;  1TGZ B;  1UEL A;  1WJU A;  3LDZ E;  1EF1 A;  4M0W B;  1E8Y A;  1FXT B;  1UBQ A;  3OAW A;  1UZX B;  1WJ4 A;  2WX1 A;  3PLU A;  4TUU A;  4BOS C;  3RZW C;  2KDF B;  3M63 B;  2WX0 A;  2KC1 A;  2LXC A;  2MP2 A;  2GBN A;  3QIJ A;  5FR6 A;  4DDG D;  1SE9 A;  2NPT A;  3PT2 B;  3UF8 A;  1X1M A;  3ZNZ B;  4FBJ B;  1Q5W B;  4PS3 A;  1P3Q U;  3L16 A;  4G50 A;  1V86 A;  2J0K A;  5CHF A;  3QQ8 B;  2N7D A;  4GDK A;  1YD8 U;  4AUQ C;  2RR9 A;  2DYB A;  4GU2 A;  2DZK A;  3UIO B;  4GXB A;  2I1K A;  3PGE A;  1Z5S B;  2GMI C;  4TQ1 A;  3N3K B;  5GMV A;  4KVG B;  3N32 A;  2XEW A;  2MBO A;  4BKG A;  4XX5 A;  3PLV A;  3EHV A;  1ZGU B;  2LRW A;  4P7I A;  4KDI C;  1WR1 A;  3DVN U;  4WWO A;  5LLI A;  1GNU A;  2KQS A;  1S3S G;  1OEY A;  2MBB B;  5D7G A;  1YX6 B;  2CHX A;  2R2Q A;  2D3G A;  3VVW B;  3W1S A;  4GDL A;  5C1Z A;  1NI2 A;  2FUH B;  5E6P A;  2L0T A;  2D07 B;  3RD2 A;  2AL3 A;  1GC6 A;  5C23 A;  2KWV B;  1M94 A;  3RZF A;  4K1R B;  1J8C A;  3APD A;  4BBN C;  4GOC A;  3SD5 A;  4XC2 A;  1WGR A;  3DQV A;  2FNJ B;  1WR6 E;  2C60 A;  5JZE B;  2KDE B;  1QZE A;  3KVF B;  2UYZ B;  3W1S C;  3H9D A;  3EEC A;  1SGH A;  2M8S A;  4MDK E;  3CMM B;  3RUI B;  4ZRK A;  4A3P A;  2G45 B;  3QAQ A;  1F9J A;  2HJ8 A;  4NAW A;  3CSF A;  3JSV A;  2MBQ A;  4CO7 A;  1KLV A;  3ZVV A;  2BKF A;  1WZ0 A;  2GBJ A;  3H7P A;  3WIM A;  1E5W A;  3AUL A;  1XQQ A;  3HK0 A;  4K7U A;  2Z0D B;  2ZJD A;  3Q3J A;  4DBG A;  5AZF A;  2JF5 A;  1LM8 B;  1EF5 A;  2KN5 A;  4HJK A;  2K8B A;  4B9K A;  3L17 A;  4IM0 A;  2G4D B;  2AEH A;  3DDC B;  1WJ6 A;  2L8J A;  1XD3 B;  3VH4 B;  2LUE A;  3N30 A;  4JQW C;  1OQY A;  3PZD A;  2CHW A;  4F1S A;  2N7E A;  2AYO B;  2N1W A;  2ZNV C;  3HHM A;  5IA7 A;  3QC8 B;  3V6E B;  2KQ7 A;  2LVQ A;  4IC7 B;  1WX9 A;  4LDT D;  4WJP A;  1T0Y A;  5AZH A;  3OJ3 A;  4KIK A;  3ZIM A;  2JT4 B;  3WA0 A;  3ALB A;  2PE9 A;  2YVC A;  2KWU B;  3L10 B;  3TL5 A;  3LJ3 A;  3QCA A;  1YQB A;  1GUA B;  1E8W A;  1IP9 A;  5DPS A;  1GJZ A;  2KX0 A;  1UGM A;  1Z2M A;  2EMT A;  2NS5 A;  3WAL A;  3VUW A;  4LDT B;  4BKS A;  1BT0 A;  5JHA A;  1ISN A;  2N9E B;  3EC8 A;  4TQ0 A;  4DWF A;  4G3X B;  2KXJ A;  4ANX A;  1LXD A;  3ZNH B;  2BF8 B;  1WMH A;  3S2A A;  3A33 B;  1P1A A;  5JH5 C;  1MG8 A;  2KJR A;  3ECI A;  5CHV C;  3T9L A;  2LXA A;  2MQJ A;  4JLC A;  4FA6 A;  4WQO B;  1ZW7 A;  5E6O A;  3WAO A;  4DDI D;  1I42 A;  3ZTC A;  2BYV E;  3X0W A;  2MBH A;  2K1F A;  5CTR C;  3QA8 A;  3SDL C;  1OEY J;  1TZ1 A;  3A4S C;  4ASW C;  4MEL A;  1V9J A;  3UIP B;  3B0A A;  4FJY A;  2V1Y A;  3AU4 A;  4MGK E;  4M8N A;  3JYU A;  2WWZ A;  3ZLZ A;  2VRR B;  5J2R A;  3JVZ X;  2HTH A;  4II2 B;  3P2B A;  3U7D A;  3Q3F A;  4A20 A;  3C0R B;  3CF6 E;  4E74 A;  3DVG Y;  5AZG A;  3ZW3 A;  4MGI E;  4MGZ E;  3TBL D;  2K6D B;  4G11 A;  2KLC A;  2FIF A;  1RFA A;  4ZDV A;  4WJQ A;  3RYT A;  3V6C B;  3NZS A;  2M17 A;  5IAA C;  1OTR B;  4MSM B;  1V81 A;  3IBE A;  4NPN A;  3PVL A;  2I1J A;  3DVG X;  4DXA B;  1Q1O A;  3B1L X;  1J19 A;  3A4R A;  3H7S A;  3L13 A;  2DAJ A;  4HPL B;  2R2O A;  3U8Z A;  4W9H A;  3WAN A;  2O6V D;  3IHP C;  2M4N A;  3M62 B;  4IG7 B;  4K81 A;  4TKN A;  3IG3 A;  4WJO A;  3U30 A;  3R3M A;  4OVV A;  1R4N I;  4ZYN A;  1WZ3 A;  3D32 A;  2DAF A;  2BPS A;  4IUM B;  3DBH I;  1L2N A;  1P98 A;  4ICV A;  5DCN A;  4LJO B;  1D3Z A;  4FLH A;  2KLG A;  3R7Q A;  4F7Z A;  2KFJ A;  2PJH A;  3UQB A;  1G6J A;  2BKR B;  2LAS A;  1WE6 A;  3NS8 A;  4W9I A;  2O6V B;  3B08 A;  4KDL B;  5KHO A;  2LZ6 A;  2ZVO A;  1E8Z A;  4KZC A;  3PRM B;  2MBE A;  4PS7 A;  2D2Q A;  2HE7 A;  1IPG A;  3KUC B;  2IO2 B;  4IM3 A;  5D6J B;  4EOY A;  1S1Q B;  5DPT A;  2IY1 B;  2GBR A;  2KVR A;  4HWI B;  1NDD A;  4JL9 A;  2ZCC A;  4W9C A;  2NCN A;  4W9E A;  3ML9 A;  5L83 A;  1E7V A;  2NBV B;  2M1M A;  4NQL B;  4OVU A;  1CMX B;  5D94 A;  1WYW B;  4KSK C;  4HVB A;  1WX8 A;  4HXD A;  4IWO A;  3TMP B;  1U4A A;  2O2V B;  5TR5 A;  1PQS A;  2L05 A;  2D11 A;  3V61 A;  2LGD A;  4PYZ A;  2PE6 B;  4RM8 A;  3BIN A;  2JWZ A;  3APF A;  3R66 C;  2LD9 A;  4I6P A;  1WGH A;  2BGF A;  2MX2 A;  2Z0E B;  4URK A;  2DYM A;  3UQA A;  2KHW B;  2NVU I;  3KUZ A;  4KZ0 A;  2ZVN A;  2A4Z A;  3NHE B;  5J17 A;  2BYE A;  1J0G A;  1UD7 A;  2CR5 A;  4B95 A;  4LJP B;  2MCN B;  1OGW A;  3V62 A;  1WGY A;  3A9J B;  4FHK A;  2KFK B;  3ZUN A;  5G2N A;  3H1U A;  3MHS D;  3QAR A;  4LCD E;  4ZRI A;  1IYF A;  3PRZ A;  2G3Q B;  4WAA A;  2DZJ A;  2NBU A;  3IFW B;  2DEN B;  2KKC A;  1H8C A;  1V2Y A;  2KO3 A;  4ANV A;  3VUY A;  2KMC A;  3UIN B;  2AL6 A;  4EKU A;  2JZ3 B;  4WWN A;  4K7S A;  2K25 A;  3VTU A;  4X57 B;  2LJ5 A;  5J18 A;  2OJR A;  4EZJ A;  2L0F A;  1E7U A;  3ZKJ C;  2FCQ A;  2FID A;  3DVN V;  1KOT A;  4W9G A;  4KV2 A;  3DOW A;  4W9L A;  4W9F A;  4AOF A;  4NJ6 A;  1XT9 B;  4GGQ A;  4JIO U;  2LGX A;  4MH0 E;  3V60 A;  1E90 A;  1WRD B;  2A5U A;  2GOW A;  4BVU C;  1WI0 A;  2IO3 B;  1V49 A;  2IO1 B;  2RD0 A;  4HPM B;  2JVC A;  3L0W B;  3UGB B;  3KUD B;  4A3O A;  1WXA A;  3SHQ A;  3HM6 X;  1GC7 A;  3KH0 A;  2L76 A;  1TBE A;  3VQI A;  3WAP A;  4AJW A;  2RGF A;  2IY0 B;  3HM3 A;  4I6N B;  3VTV A;  3X23 A;  2HD5 B;  1V6E A;  3DPD A;  4MJS B;  4XZ4 A;  4GIV A;  5HKH A;  2W9N A;  4HCP B;  1WXS A;  2KWC A;  2XK5 B;  1WE7 A;  2ASQ A;  2JY6 A;  2N9X A;  2YLM A;  4NNJ B;  4EEW A;  3AI5 A;  2K8C A;  3ML8 A;  2QHO A;  2WDT B;  1NBF C;  3O65 B;  1WXM A;  4RMA A;  3AU5 A;  1C1Y B;  2KOX A;  1C3T A;  1UH6 A;  1WH3 A;  2BWE S;  3ZTD A;  3KW5 B;  1GG3 A;  1P9D U;  4RM9 A;  2ZPN A;  3M95 A;  4E71 A;  2KTR B;  1ZKH A;  3APC A;  4WWP A;  2PEA A;  2KDB A;  3A1Q B;  1WFY A;  2GBM A;  4FJZ A;  4FHJ A;  1R4M I;  2L7R A;  4DK5 A;  1YX5 B;  4HK2 A;  4IWP A;  5AEK B;  3RUL A;  2FCS A;  2O6V A;  2CKH B;  2JZZ A;  2KX3 A;  4I6L B;  1TTN A;  5DPW A;  3QJZ A;  4DHJ D;  1UBI A;  2MW5 A;  3I3T B;  1RAX A;  2CS4 A;  5L95 C;  2EMS A;  3ZNG C;  4NY0 A;  2C7M B;  5CX3 A;  3MTN B;  4E3C A;  5EDS A;  3L08 A;  2NBW B;  2DHZ A;  4IWQ A;  3A9K B;  2AWT A;  2FAZ A;  2JRH A;  1WM3 A;  1LQB A;  2MSE D;  1YIW A;  3OJ4 B;  3PPA A;  1I35 A;  3DBR I;  2V4L A;  2Z59 B;  1WIA A;  2LI5 A;  3L54 A;  2G4S A;  4DHJ B;  4HCN B;  3QX1 A;  4J6I A;  3TCA A;  4DHZ E;  4BBN F;  4HDQ A;  4ANW A;  1YJ1 A;  2IZV B;  2NR2 A;  1AAR A;  5KHQ A;  4HLE A;  2ZPY A;  2ZEQ A;  4EZL A;  2KNB A;  2J0M A;  2O2V A;  3ENE A;  1Y8R C;  5E6N A;  3VFK A;  3PHW B;  4IM2 A;  2KD0 A;  5LXI B;  1WM2 A;  3K9O B;  3R7R A;  4W9J A;  4W9K A;  2J7Q B;  4GMV A;  2CU1 A;  2KTF A;  1KM7 A;  3W1Y A;  2MP2 B;  2RSU A;  4ICU A;  3KYC D;  1A5R A;  2NPT B;  3VDZ A;  3KYD D;  5DPR A;  2N1V A;  2L3Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...