3QCAA

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords FAS-associated factor 1
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qcaA00
3HIZA 1V86A 2J7QB 2PJHA 4J6IA 1WF9A 1RAXA 2IY0B 4A3OA 3IFWB 4E71A 2BF8B 3JSVA 3TJPA 3UIOB 2KWVB 2BGFA 1Q5WB 2KJ6A 2DYBA 2D2QA 3V62A 2LVOA 4ICUA 2KKCA 2KD0A 3NS8A 3UF8A 1ISNA 1WJUA 4W9EA 1EF1A 2RD0A 3M95A 2JXXA 2DZIA 3PVLA 3T8MA 1E8YA 1WGDA 4TKNA 3A9JB 3QQ8B 2ZEQA 1UELA 4NNJB 3DBHI 3DVGX 4K81A 3VH3B 3WAPA 2MQJA 2M4NA 3ZNZB 4GB9A 2O6VD 3JYUA 3EHVA 4IUMB 4RM9A 3AU4A 4DK5A 4P7IA 3WANA 3V60A 4WJQA 1J8CA 1WI0A 1KLVA 4FLHA 4IM0A 1YX6B 1UH6A 4ASWC 1UBIA 1WR6E 4BVUC 4W9FA 5BO4B 2NPTA 2FIDA 2WYQA 5GMVA 3L0WB 2DZKA 2YLMA 2K39A 2L05A 2EMTA 2RR9A 3WA0A 5FR6A 3O65B 4GDKB 3ZNGC 1P9DU 1E7VA 1L7YA 1OGWA 4GU2A 2B3AA 1VD2A 2FCNA 1NI2A 1LM8B 1OQYA 3W1SC 4II3B 1F9JA 2CHXA 2LI5A 2N7EA 4PS7A 4TQ1A 4WQOB 3RYTA 2L0FA 2XEWA 4G11A 2LRWA 4ANWA 2DAJA 4DWFA 1WXSA 1RLFA 1XT9B 3A1QA 3K9PB 3NZUA 4W9IA 2LVQA 4HWIB 4HXDA 1BT0A 2AWTA 2UWQA 3KH0A 4YL8A 4KZ0A 4HCNB 4CO7A 3WAOA 3DBRI 2CR5A 1YQBA 2DZMA 3OAWA 3BINA 2ZJDA 3OLMD 3PT2B 3QA8A 3A1QB 2CS4A 2MBOA 4X57B 2KXJA 1I35A 1V80A 5D7GA 2JZ3B 2L7RA 2DZJA 4E74A 1WH3A 1WMHB 3RT3B 4IC7B 4LCDE 1OEYA 3PS6A 1WGYA 3QX1A 4LDTB 2FCMA 3DQVA 4JLCA 3H7SA 4AP4C 2KDFB 1E90A 4BKTA 5JHBA 3QAQA 3K9OB 4MEMA 3DCGA 2KVRA 2KFJA 2VRRB 4DBGA 4GIVA 4EZJA 2LZ6A 4PYZA 2IY1B 2PE6B 4MJSA 3ZTDA 4K7SA 4HCPB 1R4NI 2MW5A 4F1SA 2JF5A 3KYDD 4G3XB 2I1JA 2KO3A 3UIPB 3A4SC 5JZEB 2KHWB 3CSFA 1V5TA 5KHOA 3EC8A 1V9JA 4WJPA 2CHWA 3L17A 4W9GA 2ZVNA 2LD9A 3N3KB 2CU1A 3V6EB 4FHJA 2XBBC 3QHTA 2GMIC 2IZVB 1WJNA 2IO3B 1U4AA 1WGHA 2K1FA 4KIKB 1QZEA 2KJRA 1WIAA 3U30A 3W1SA 5J2RA 1KJTA 3DBLI 2DYOA 1WJ4A 2C7NB 3PZDA 1KM7A 2MBBB 1OTRB 3KUZA 4W9JA 4FJVB 3EECA 3Q3FA 3RUIB 3I3TB 4B9KA 5D2MB 2MWSB 3L54A 3PRPB 4A3PA 4K7UA 4WJNA 2KDBA 2GBRA 2LASA 1GUAB 3KUCB 4IWQA 2NS5A 1SE9A 1P1AA 2W9NA 3VTWA 1JRUA 2RGFA 2N9XA 1Q1OA 5L95C 3CF6E 2DHZA 3VQIA 4NQLB 2JPHA 2LWPA 1LQBA 3TCAA 2FIFA 2LRUA 2L00B 1AARA 2G3QB 2N1WA 3MJWA 1SIFA 3SU8X 1WY8A 1ZGUB 1A5RA 1EO6A 1WYWB 3ZDTA 3AXCA 2K6QA 3GOEA 5CX3A 5EDSA 4FHKA 2D3GA 2GBKA 3BY4B 3SHQA 2V1YA 2C7HA 2EMSA 2WX1A 2KQ7A 2MBHA 1UBQA 2L8JA 4G50A 4FADA 3QK0A 2REXA 1V5OA 4LJPB 3MTNB 4HPMB 3RULA 3ZNHB 2FNJB 3AULA 4GMVA 1P3QU 4NAWB 3PHWB 4AOFA 2MRPA 4I6PA 4IWOA 1P0RA 3N32A 3IVFA 3UQBA 2LGDA 1TBEA 3H7PA 4M0WB 2HTHA 1WX7A 1WZ0A 1NDDA 2MX2A 2V4LA 3OJ4B 3VXWA 4EEWA 3L13A 3ZIMA 1WR1A 4KSKC 3EFUA 2J0KA 2C5LC 4F7ZA 1WX8A 1EUVB 3HM3A 1UZXB 2C60A 3APDA 3VUWA 5D94A 2KOXA 3HK0A 3UQAA 3SDLC 1Z2MA 4GGQA 1XD3B 2CHZA 2HJ8A 3A9KB 3CSTA 1WE7A 2RSUA 3ONSA 1X1MA 2JRHA 1WXAA 4MELA 3WIMA 4DHZE 2JT4B 3DVNU 1ZW7A 3RZWC 1Y8RC 2D10A 3ZLZA 2KDEB 3APFA 3X0WA 3ZTCA 3TL5A 1E8ZA 2WDTB 1WXMA 2M17A 3B08A 2BWFA 2L76A 3KVFB 3ECIA 4FN2A 2M1MA 5CHVC 1C1YB 1K8RB 4NAWA 3ML9A 3NOBA 1WJ6A 2GBJA 4TQ0A 2JVCA 3L08A 2UYZB 3PRMB 4MDKE 1RFAA 2DYMA 2FCQA 3CMMB 3H1UA 4E3CA 3QWZB 5J18A 2KN5A 2LUEA 5CTRC 5AZFA 3R7RA 3JVZX 4BKSA 1Q0WB 4GN1A 2Y5BB 5HKHA 2G45B 1D3ZA 1T0YA 4EZLA 4DHJD 2G4SA 1CMXB 3TMPB 5CHWA 1UGMA 4AJWA 3KUDB 2OOBB 2J0JA 2N7DA 3WALA 4GDKA 2KQSA 2KX0A 3V61A 3LJ3A 3IBEA 3VDZA 2MBQA 1OEYJ 4K7WA 4KIKA 5DPWA 4KDLB 1ZKHA 3PTFC 2IYDB 5J17A 2OJRA 1WX9A 3VFKA 1FXTB 2Z0EB 3PHXB 3VUXA 2NVUI 4BBNF 4BOZB 4I6NB 1L2NA 4WWPA 2KZRA 2M0XA 4DHJB 3W1YA 2ZCCA 2O2VB 1TZ1A 3VTVA 2KX3A 4FBJB 5KHQA 3PRZA 1E8WA 2N9EB 3PREA 4JIOU 3UGBB 1H4RA 1J19A 4WWNA 3GZNI 3M62B 3ZVVA 3B1LX 4MGZE 1EF5A 3C0RB 3DVNV 1MG8A 2FAZA 1R4MI 4WJOA 4ANXA 4AJYB 4GSWA 4BKGA 5IA7A 1KOTA 4BKSD 2AEHA 2KWUB 4DXAB 2AYOB 2KWCA 2GOWA 3ZO5B 3KW5B 4EZKA 1GNUA 4KZCA 1WMHA 4W9KA 2MCNB 1H8CA 4BOSC 4HVBA 3U7DA 2Z59B 3VTUA 3VH4B 2A5UA 4GDLA 5D6JB 1J0GA 2BYEA 3L16A 3ZRCA 4M8MA 3LDZE 4HJKA 1RRBA 1WE6A 4ZDVA 3PGEA 4LDTD 3ALBA 3SD5A 2KJHB 1V6EA 2DX5B 3DVGY 4W9CA 5C23A 3HM6X 4GOCA 3ZRFA 2PE9A 3H9DA 2NBUA 5DPRA 4OVUA 4ZYNA 1XQQA 1YJ1A 4MGYE 1GC6A 3DBSA 4FULA 4WWOA 2KNBA 4ANUA 4AWJA 3VAWA 3S2AA 2FCSA 3H6NA 2ZPNA 2ZNVB 3N30A 2ZNVC 2GBNA 4HLEA 1IYFA 1TTNA 2K6DB 1GJZA 4ZRIA 2D11A 5E6PA 2ZPYA 2O2VA 4BFRA 2EKEC 3ZNID 3ZDMC 4XC2A 2IO1B 2K25A 4TV3A 2JRIB 2JY6A 2ZVOA 4IWPA 1SGHA 4HDQA 2KMAA 4NQKE 5DPSA 3VHTC 2CKHB 1HE8A 2V3SA 2Z0DB 4MGIE 4W9DA 4JGHB 3PLVA 3P2BA 2RPQA 2YVCA 1YX5B 4DDID 3MHSD 4LJOB 4K1RB 1S1QB 3KYCD 4DDGD 4HPLB 4ANVA 1G6JA 4NPNA 3H7PB 2PEAA 3DDCB 4HDOA 3OJ3A 2J0MA 4GDLB 3Q3JA 4F8CB 2LGXA 2O6VA 3U8ZA 5L83A 1YD8U 2K8CA 3PPAA 1UD7A 4M8NA 4W9LA 5IAAC 3WAMA 1WGGA 3QJZA 1IP9A 5DPTA 4WAAA 2L3ZA 1WM2A 4BBNC 5G55A 4GXBA 4G0NB 4MSQB 4IW0A 4ZRJA 4FA6A 4II2B 3QARA 3TIXA 1E7UA 2KDIA 4I6LB 4EFOA 3A9JA 3ZKJC 2K8HA 4B6WA 2BKFA 1WRDB 2DENB 2AL6A 1I42A 4MSMB 4ZRKA 4A20A 3HHMA 5LXIB 4B95A 5DCNA 2ZZPB 1NBFC 2LJ5A 3M63B 1WM3A 2KANA 1Z5SB 4RMAA 4IM2A 2NR2A 4TUUA 1V2YA 2MP2B 1M94A 5AZHA 1WGRA 3QC8B 2LVPA 2JZZA 3V6CB 4XX5A 4URKA 3JW0X 2KC2A 2HE7A 2KMCA 2LGYA 3R7QA 1WXVA 5E6NA 3VVWB 1PQSA 3JSVB 2D07B 5CHFA 4EKUA 5JH5C 4KDIC 2G4DB 1YIWA 2NBWB 2M8SA 3APCA 2HD5B 2XK5A 3QIJA 3VUYA 5LLIA 5C1ZA 4CYEA 5G2NA 5JHAA 3A4RA 2IO2B 3NHEB 2NBVB 2IBIB 4KVGB 4MJSB 2A4ZA 2JUOA 2KFKA 4AUQC 4HK2A 2N1VA 2BWES 2IO0B 3M3JA 3R3MA 4JL9A 4KSLC 3R66C 4MH0E 2MA9B 4NJ6A 4XZ4A 3PV1A 4EUTA 4NY0A 2O6VB 2R2OA 5AEKB 4CHKA 4DHZB 4W9HA 1GC7A 2C7MB 4RM8A 2BPSA 2AL3A 2KTRA 2BKRB 3DOWA 4PS8A 2WX0A 1V81A 4MGKE 3B0AA 4PYUA 5LXHA 3RCZA 4OVVA 2KFKB 3PLUA 2KLGA 3A33B 2PPHA 1TGZB 3ML8A 5E6OA 2KLCA 1V49A 2KTFA 4FJYA 3UINB 3T9LA 2QHOA 1WZ3A 3AI5A 1IPGA 4FJZA 2ASQA 2MP2A 3A9KA 3TBLD 2MSED 4KV2A 4IG7B 1VCBA 3IHPC 2NCNA 5TR5A 4IM3A 1GG3A 2MLBA 4NJ7A 2GBMA 2N4FA 3ZW3A 1LFDA 3RD2A 2L0TA 4MM3A 2BYVE 3RZFA 2LXAA 2FUHB 2KK8A 4EOYA 2I1KA 3IG3A 1S3SG 4JQWC 2R2QA 1C3TA 4ICVA 2XK5B 1P98A 3ZUNA 2JWZA 2ZCBA 1E8XA 2DAFA 2NPTB 3PSEB 2WWZA 1LXDA 2KC1A 1E5WA 5AZGA 3NY5A 4N9F4 4PS3A 2C9WB 2KTRB 3AU5A 3QCAA 2MBEA 2K8BA 3ENEA 3X23A 2BYFA 3D32A 3L10B 3NZSA 1WFYA 3DPDA 2N9PC 2LXCA
chains in the Genus database with same CATH superfamily
4A3OA 1I4XA 3BVMA 1QOAA 1D6EC 1GOZA 3Q8EA 1DGJA 2RD0A 3M95A 3LB8C 4NNJB 3DBHI 3VH3B 4K81A 2MQJA 4GB9A 3EHVA 2LFIA 3N20C 3AU4A 1WI0A 3ZXVA 1UBIA 3IAS1 4LLGM 1BUIC 2FIDA 2M56B 1MFWA 2WYQA 5GMVA 3L0WB 2K39A 3WA0A 1V8CA 5FR6A 3T3OA 5G5HA 1T0QC 1D5XC 2BB6A 3DBHB 1VD2A 2FCNA 4P16A 1LM8B 1SIJA 1F9JA 2CHXA 2LI5A 2N7EA 3RYTA 4IOIE 4IKGA 4IDIA 4DWFA 1XT9B 3A1QA 3E56A 2LVQA 1BT0A 3P4QB 2UWQA 4YL8A 2L1AA 3OG5A 4KZ0A 4HCNB 3DBRI 1WRIA 3QA8A 3DWGC 2JZ3B 1JCKB 4E74A 1WMHB 1JWUD 4L2YA 3CWIA 3H7SA 4BKTA 2J42A 3RFZB 2LZ6A 4PYZA 4MJSA 3I57A 2MW5A 2R61A 2WGSA 2KO3A 3A4SC 2L32A 4L1BA 2J4XA 1V5TA 3EC8A 1V9JA 3N1ZC 2XN9C 2IJ0A 1ZDXA 1C4PA 4FHJA 2GMIC 2DLBA 1YN4A 2K1FA 1KF6B 4KIKB 2KJRA 5J2RA 1TS5A 5C3JB 1OTRB 4FJVB 4HPPA 3RUIB 3PRPB 3PZ7A 4A3PA 4ACFA 4WJNA 3EA6A 4M01A 3DHGC 3KUCB 3Q69A 4IWQA 1SE9A 2W9NA 1JRUA 1HA5A 5L95C 2DHZA 2Y3AA 4YSXB 3I63C 2JPHA 2LRUA 2L00B 2G3QB 1I4PA 1SIFA 2JQRB 1HQRD 1ZGUB 3TSSA 3P63A 2JU6X 1UUPA 3GOEA 3IXSA 2D3GA 2KACA 2K5PA 1SE2A 2EMSA 2KQ7A 4FADA 3AEGB 1N5WA 1V5OA 3VR8B 3IT6B 4AOFA 3AULA 2JXTA 1YN3A 4GMVA 2MRPA 3L4PA 3N32A 3UQBA 2BYTA 3RNCC 2MX2A 3OJ4B 2KWDA 2WXFA 1WX8A 1EUVB 1FNVA 3LXFA 3U2SC 5D3IB 4JE3B 3SDLC 1BXTA 3O13A 2CHZA 3A9KB 2D3BA 1JWBD 2JRHA 2H89B 2W55A 4MELA 4DHZE 2JT4B 1JWSD 3DVNU 1ZW7A 1QLBB 3ZLZA 1MHHE 2KDEB 4JPSA 4L23A 1IGCA 1E8ZA 2WDTB 2V0GA 3B08A 4FN2A 3ECIA 2M1MA 3ML9A 3NOBA 1WJ6A 1V1PA 4NJCA 4JX1C 2FCQA 3CMMB 3H1UA 1K52A 5CTRC 3R7RA 2CU3A 1FFUA 4EZLA 4DHJD 2G4SA 3VRBB 4C4VA 3KUDB 2V4IB 1RM6C 1HTQA 4XDCA 1OEYJ 4KDLB 2WXJA 2J52A 5J17A 1C9FA 1WX9A 4HRSA 1ESFA 4RGNA 2Z0EB 3PHXB 3VUXA 1L2NA 2OJWA 4WWPA 4DHJB 5E6JA 2ZCCA 4TMAB 2KX3A 3AEDB 1PUTA 3PRZA 1E8WA 2N9EB 1J19A 4MGZE 1L4ZB 1F0ZA 2VZKD 3B2FA 4GSWA 2W54A 2LGIA 1FXAA 4BKGA 3W5VB 2KWCA 3FC4A 2GOWA 1T5XD 4KZCA 1WMHA 4W9KA 4BOSC 4XWWA 3U7DA 3VTUA 1L0XB 2A5UA 3MHZA 2BYEA 3NJTA 4M8MA 1N6ZA 3LDZE 2X8XX 2TSSA 3ABVB 4HJKA 1YNTE 4ZDVA 3ALBA 4ZOHC 2JSVX 4W9CA 2QILA 4GOCA 1FXIA 1SEBD 1V97A 2NBUA 4ARCA 1VZ6A 1XQQA 4FULA 4WWOA 4ANUA 5HHDG 2FCSA 2ZPNA 3N30A 4LTUA 5HFYA 4LNFA 3ZDMC 2K25A 2JRIB 2JY6A 2PLPA 1SGHA 2ICIA 4MGIE 3PLVA 2YVCA 4P1BC 4K1RB 1ET9A 1S1QB 4Q2JA 2RPVA 1G6JA 4ANVA 2MH7A 4YWGG 1VR9A 2J0MA 4F8CB 1B9RA 2LGXA 1QOFA 3NVZA 1OQQA 4W9LA 2I38A 1WGGA 2AX5A 4C80A 2M0AA 2WXQA 2W82A 1WM2A 4XDDA 5BYSA 2D3AA 3QARA 4B6WA 2BKFA 3LYYA 1I42A 3HHMA 3EGRA 5DCNA 1NBFC 1ZXHA 1WM3A 3BYTB 1YN5A 2MP2B 3QC8B 2LVPA 2JZZA 3V6CB 4XX5A 3JW0X 1VLBA 1RFKA 1K51A 5AUKA 1T6BX 2HTME 4EKUA 3VVWB 5JH5C 3B9JA 3DWMA 3BVGA 1ZXIA 1NYQA 2BB5A 5C1ZA 4CYEA 3A4RA 2IO2B 1ZE3D 1E0ZA 1IGDA 2N1VA 5TSSA 3FAHA 3MC9A 3V3XA 1NENB 3PV1A 4NY0A 2O6VB 4W9HA 2C7MB 4RM8A 3RNFC 1D4BA 2GRIA 4PS8A 4MACA 3DOWA 2WXGA 1XCTL 4JWSC 2KFKB 3KQ4A 3A33B 1TGZB 3RNAC 2WXLA 2KLCA 4FJYA 1I4QA 3T9LA 3UINB 3TEWA 2QHOA 3AI5A 2ASQA 2KVZA 2MP2A 4PT5A 4IG7B 2MLBA 4NJ7A 1JALA 2L0TA 2BYVE 3RZFA 4EOYA 3IG3A 4JQWC 4M00A 1CQVA 2R2QA 1N62A 2WQYB 4ICVA 3RN9C 2B76B 5BMIA 2DAFA 2NPTB 3PSEB 2LJIA 1E5WA 1YQ3B 2BQQA 4N9F4 2C9WB 3U52E 2LHDA 3ENEA 4XYCA 3I9V1 3NZSA 1WFYA 1C79A 2AQ2B 2N9PC 2LXCA 4S0RA 4OZBA 3NG0A 2LGSA 1V86A 3NUHB 2J7QB 2PJHA 2IY0B 3IFWB 5IN7A 3UIOB 1TS2A 3KWLA 1Q5WB 2KJ6A 4ICUA 2KKCA 1WJUA 2LEKA 4BAXA 2JXXA 3AEAB 3PVLA 3QQ8B 1UELA 3DVGX 2I2YA 3JYUA 4RM9A 1TY2A 1QKZA 2EKIA 1J8CA 4MM3B 4US9A 1YX6B 1QT9A 2NPTA 2DZKA 4KGRA 2L05A 1GB1A 3ZNGC 3PZ8A 1E7VA 1ZDVA 2B3AA 3N1XC 3W1SC 4II3B 2KT7A 4PS7A 4K3CA 2XEWA 1XLQA 4ANWA 2DAJA 1WXSA 4LK0M 3K9PB 3NZUA 2DWQA 2INDC 2JYEA 3KH0A 2CR5A 1YQBA 1YJJA 3OAWA 3BINA 3OLMD 1XXGA 2CS4A 2MBOA 4X57B 1I35A 4RNAA 1V80A 5D7GA 2PW9A 1J7BA 4LCDE 2FCMA 4AP4C 2KDFB 4AS1A 1E90A 5JHBA 3MP9A 3K9OB 4MEMA 3DCGA 2KVRA 2KFJA 4EZJA 4GIVA 3MFGA 1I7HA 1R4NI 2JF5A 2I1JA 1BMLC 3UIPB 5JZEB 4R3DA 5KHOA 4WJPA 4W9GA 2NMQA 2CU1A 3AE9B 2IZVB 1WJNA 4WH4A 5EE0A 1QILA 5FK9C 1KJTA 1TKGA 1WYGA 3PZDA 2MBBB 3KUZA 4W9JA 3EECA 3Q3FA 3I3TB 4B9KA 1IBXA 2K22A 2LASA 5H8YE 1GUAB 1P1AA 3VTWA 1L6VA 1WWTA 2RGFA 4RGOS 1UF0A 2IDYA 2LHEA 4N6EB 1L5PA 1WYWB 2GB1A 4FHKA 2GBKA 3BY4B 3GE3C 1R7SA 3P4PB 1UBQA 2L8JA 4G50A 1TY0A 2REXA 4HPMB 3RULA 1P3QU 2NTSA 1QOGA 4EEWA 1WR1A 4KSKC 2J0KA 2C5LC 4F7ZA 3P1MA 1VJKA 1FEHA 1NYRA 3VUWA 1FNUA 3HK0A 3DHHC 4GGQA 2EELA 3RNBC 2HJ8A 1WE7A 3ONSA 1TZOA 4KGSA 3ZJVA 2WU2B 3ZTCA 3TL5A 5I4DA 2L76A 3R2IA 5CHVC 1C1YB 1K8RB 1M4VA 3TUOA 5IP4D 4TQ0A 1KLGD 3PRMB 5J18A 2WDRB 5AZFA 3JVZX 5BYRA 1CMXB 1VZ7A 5CHWA 4AJWA 3RPFC 1D5MC 1T0RC 2KX0A 3V61A 3LJ3A 3RI7C 1ZKHA 5IKCM 1SB3C 2NVUI 1FCLA 2KZRA 2M0XA 1F2RC 2LUMA 3VTVA 1I4HA 4HROA 1STEA 4JIOU 1H4RA 1F1HA 3GZNI 3M62B 2BBCA 3ZVVA 3B1LX 3DVNV 1MG8A 2FAZA 1R4MI 2E3TA 5IA7A 1KOTA 2AEHA 4DXAB 2AYOB 3OWEB 1EU3A 3ZO5B 2MCNB 5D3DA 4A90A 3VH4B 5D6JB 3ZRCA 4RFBA 3Q8FA 1PGXA 4A8XC 1V6EA 3FILA 5H92C 3ZRFA 3SEBA 3SFDB 3DBLB 1YJ1A 4M0WA 3BZDB 3DBSA 3ZJTA 3BVZA 2V3NA 2ZNVC 2GBNA 1GJZA 1TTNA 2K6DB 4ZRIA 5E6PA 4KKJA 1N60A 2EKEC 3ZNID 1YOVB 2L52A 4TV3A 2ZVOA 4M02A 2CKHB 2V3SA 2Z0DB 5BMHA 3MHSD 3KYCD 4NPNA 4HDOA 1CZPA 5L83A 1IP9A 4C56C 4KX6B 3NZ3A 4BBNC 5G55A 4GXBA 4IW0A 2VZKB 4II2B 1E7UA 3A9JA 2K8HA 2E6XA 2INPE 1SJED 2AL6A 3IAM1 2ZZPB 2LJ5A 2KANA 1HZ5A 1M94A 2WNMA 5AZHA 5HG2A 4URKA 2HE7A 3FKYA 1WXVA 5E6NA 3JSVB 2D07B 2K0PA 2HJ1A 2MHJA 2NBWB 2M8SA 4RF1A 2WXHA 3QIJA 3VUYA 4RGMA 3NHEB 3P4SB 4KVGB 2A4ZA 4AUQC 3HRDD 4KSLC 1K50A 2IO0B 3M3JA 4NJ6A 4MH0E 4XZ4A 2MA9B 3Q6BA 2BPSA 2Q5WD 2RDGA 3BIID 4MGKE 2K9XA 3TEYA 3AE1B 4EE2A 3PLUA 3EFCA 2QCZA 4FXCA 1JROA 1TT5B 1WZ3A 1C77A 4FJZA 3TBLD 3A9KA 4OHJA 1HEZE 1FRRA 1VCBA 2NCNA 1LFDA 3RD2A 2FUG1 4MM3A 2G9HD 1S3SG 3NVYA 4MH8A 3URYA 1C3TA 2XK5B 1FIQA 2H88B 3ZUNA 2JWZA 4WURA 3V05A 1E8XA 4D2KA 1FFVA 2KC1A 3W5UB 3QCAA 2K8BA 2BYFA 3L10B 4CQNA 3DPDA 5FKAC 1YMHE 2BS3B 3HIZA 4USAA 4J6IA 1WF9A 1RAXA 3TJPA 1JWMD 2BGFA 4US8A 3V62A 1GB4A 3UF8A 1ZOYB 2MJEA 4H2AA 2DZIA 1E8YA 1WGDA 4TKNA 2WHIA 1PYWD 2M4NA 3ZNZB 2O6VD 3MC0B 1GPXA 4IUMB 1QQRA 2KN4A 4P7IA 3WANA 1UNSA 3MJ5A 3V60A 4N58A 1KLVA 4FLHA 2RDHA 1UH6A 2JZPA 4ASWC 1WR6E 4BVUC 4W9FA 4MT5A 5BO4B 1ZP0B 2YLMA 3H8HA 3AB5A 2RR9A 1P9DU 3AE2B 1DOXA 1L7YA 4GU2A 2WXRA 1NI2A 1OQYA 2Y5PA 4NZLB 2K3UA 4OZCA 4WQOB 2L0FA 4G11A 1LO5D 2LRWA 4RGTA 3GB1A 4W9IA 3SR6A 4DXGA 4HWIB 2AWTA 1C78A 3WAOA 2BS4B 1E9MA 1KRHA 4DXFA 3PT2B 2AQ1B 2KXJA 4B0MA 3MC8A 2DZJA 1WH3A 2KAJA 3PS6A 3QX1A 3DQVA 2NTTA 1FPYA 2WDQB 3QAQA 4RH6A 2VRRB 3AV8A 4DBGA 3TEXA 1SXTA 1XCQL 2IY1B 4HCPB 2SAKA 2WP9B 4G3XB 3Q2AC 3GZNB 2CHWA 3L17A 2QDFA 2ZVNA 3V6EB 1EM7A 1MPEA 3QHTA 3Q3MC 2IO3B 1U4AA 4ZRPA 1WGHA 2V9HA 3TEZA 1QZEA 4LNIA 1WIAA 1AYFA 3W1SA 1IBXB 2FBWB 1E7PB 1KM7A 1MI0A 1XLNA 3BYYB 3Q8AA 1WXQA 4KKIA 4K7UA 2KDBA 2GBRA 1D5ZC 3J9CA 2J53A 2V3PA 1B1ZA 1Q1OA 3CF6E 1WGKA 4NQLB 3GE8C 1LQBA 1L0YB 1AARA 1P7FA 2W3SA 3ZDTA 5LNK1 2V1YA 2WX1A 3AE4B 4NAMA 4LJPB 3MTNB 3ZNHB 4NAWB 2FNJB 4I6PA 4IWOA 1P0RA 3BK2A 1TBEA 1E10A 2N9LA 4M0WB 2HTHA 1WZ0A 1NDDA 3VXWA 3ZIMA 1FM0D 5BYQA 3EFUA 1UZXB 1QOBA 5D94A 2KOXA 3Q14C 3UQAA 1JW9D 1XD3B 3CSTA 2RSUA 3AEFB 3RZWC 2D10A 3X0WA 2PMVA 1WXMA 2BWFA 3KVFB 4WIPA 3KLSX 2GLSA 4NAWA 5HI1A 4TSSA 1JMLA 3W9CB 2UYZB 4MDKE 1RFAA 3EUB2 4E3CA 1TKYA 4BKSA 1Q0WB 4GN1A 5HKHA 2G45B 1D3ZA 5BMGA 2QMTA 3ZYYX 2OEDA 4B0EA 4KGTA 2J0JA 2N7DA 1CK1A 4GDKA 4HKQA 2KQSA 2D5GA 3IBEA 3C8YA 3VDZA 2MBQA 4K7WA 4KIKA 3PTFC 2IYDB 5GXGB 1FXTB 1PDXA 1HXYD 2N0SB 3W1YA 2O2VB 5KHQA 3PREA 4WWNA 1V1OA 1LGRA 4GLSC 4ARIA 3C0RB 2UU7A 4AJYB 2QSDA 1YJIA 4BKSD 3VR9B 5G5GA 3ZJUA 1F52A 1GNUA 2Z59B 4REZA 2YEPF 5JXVA 1SF0A 3PGEA 4LDTD 3SD5A 3P42A 1EWYC 2DX5B 3DVGY 3AE6B 5C23A 3RNGC 3GS2A 3HM6X 2N7JA 4UDUC 4MGYE 5AUIA 2KNBA 4AWJA 1NEKB 1PFDA 3S2AA 3H6NA 2BT6A 1UWMA 3BK1A 1IUEA 3N9YC 4HLEA 1IYFA 2D11A 3W2DA 4YSYB 4XC2A 4A55A 4IWPA 4HDQA 4AQ7A 4NQKE 5DPSA 3VHTC 1HE8A 4W9DA 4JGHB 1ROEA 2FE8A 4LJOB 4HPLB 3R8BA 2PEAA 3OJ3A 4GDLB 2D3CA 2O6VA 3U8ZA 1YD8U 2K8CA 1UD7A 4HEA1 4M8NA 3WAMA 1QF6A 1C4AA 2BS2B 5DPTA 4WAAA 2XNAC 2L3ZA 3NVWA 3VRAB 4G0NB 4MSQB 4FA6A 3TIXA 2KDIA 5IOIA 2Y5CA 2DENB 2ON8A 3C19A 4ZRKA 4A20A 1TS3A 2KMMA 1SSNA 1Y56A 1P7EA 1XEEA 3M63B 4ITKA 1FNWA 1Z5SB 4TUUA 2MEKA 2PTLA 2ONQA 3AEEB 2LGYA 3R7QA 4ZHPA 1PQSA 2G4DB 4C7YA 4DQOC 5T8IA 2N9KA 1SBBB 5G2NA 2WXPA 1AW7A 2KFKA 2JUOA 4HK2A 4JL9A 2BWES 3R3MA 3B2GA 2BVCA 4YTMB 4DHZB 1J7CA 3U4EG 1FMAD 2KTRA 3HVZA 1I4RA 4YSZB 2KDMA 4PYUA 5LXHA 3RCZA 4OVVA 2PPHA 2SEBD 2IPKD 3FILB 1V49A 3T3NA 3KWVA 4C00A 1N61A 1WSPA 2MSED 4LNOA 5TR5A 1GG3A 3GP7A 2N4FA 3ZW3A 1UWXA 2RMMA 4P1CC 1T0SC 2I1KA 3CIRB 3Q3NC 2CJOA 2IGHA 1J7AA 1RYJA 3PO0A 2ZCBA 2AQ3B 5AZGA 3BWUD 4PS3A 2KTRB 2MBEA 3D32A 2PVOD 4E71A 1L6UA 2BF8B 3JSVA 2KWVB 4QAYA 1SE4A 2DYBA 2D2QA 2LVOA 2KD0A 3NS8A 2WLBA 1ISNA 4W9EA 1EF1A 2WXOA 3T8MA 2KYWA 3A9JB 3AH7A 2ZEQA 3WAPA 1E6EB 1GAQB 2WXNA 1PGAA 3NRZA 2X38A 4DK5A 4WJQA 4C7ZA 2JYTA 3N1YC 2DBYA 4IM0A 3ZXRA 4XWTA 4WAFA 4RF0A 2EMTA 3O65B 4GDKB 1OGWA 2WXKA 3Q8CA 2BTEA 4TQ1A 4O1NA 1FRDA 2OHFA 4JWUC 3HUIA 4P6VF 5C2TB 1L0VB 1RLFA 3WCQA 2YEPB 1DOIA 4HXDA 3AE3B 4CO7A 3AN1A 2DZMA 2ZJDA 1N63A 3E9SA 2DNFA 3A1QB 1VDVA 2PKOA 4A6QA 1ENFA 2L7RA 3RT3B 4IC7B 1OEYA 1WGYA 4LDTB 4JLCA 1FO4A 2QEJC 1ZPSA 3AE7B 3ZTDA 2PE6B 1YQ4B 4K7SA 3P4RB 4F1SA 1NI3A 2INNE 3KYDD 4XGAB 1JQ4A 2W3RA 2KHWB 3CSFA 2BW2A 2LD9A 3N3KB 4OVZA 2XBBC 3DHIC 1ZUD2 1FCCC 2G1EA 2JWUA 3U30A 1XLOA 3DBLI 2DYOA 1WJ4A 2C7NB 1A70A 1AN8A 2L83A 4ZRQA 4A9AA 4YXDB 5D2MB 2MWSB 3L54A 1RWSA 2ACZB 3AMZA 1MHXA 2NS5A 2QC8A 1V1PB 2ZW0A 2N9XA 1PGBA 3VQIA 2LWPA 3TCAA 2FIFA 1DOYA 2N1WA 3MJWA 1MG4A 3SU8X 1WY8A 1A5RA 1EO6A 3AXCA 2K6QA 2QIEB 5CX3A 5EDSA 1R4MB 3SHQA 2C7HA 2MBHA 3QK0A 2INCC 3PHWB 1FD6A 3IVFA 4N59A 2LGDA 3H7PA 1WX7A 2CJNA 2V4LA 4J3OD 3L13A 1XF5L 3HM3A 2C60A 3APDA 5EE1A 4HKZE 1KFYB 1Z2MA 3AECB 2WS3B 1X1MA 1C76A 1WXAA 3WIMA 1KH0A 1Y8RC 3APFA 1KTKA 3Q3OC 2M17A 1DYQA 1VRAB 2JX5A 1EU4A 1MVKA 2GBJA 1XO3A 2JVCA 2PVGC 3L08A 2DYMA 1SJHD 3QWZB 2KN5A 1T3QA 2LUEA 4PK1A 3IT4B 2Y5BB 1T0YA 3TMPB 1Q10A 1UGMA 3R2TA 3U7ZA 2OOBB 2HDEA 3WALA 1OQRA 4S17A 5DPWA 2VH2A 2OJRA 3VFKA 3DBRB 4C4VB 4BZAA 1TJEA 4BBNF 1TYGB 2IGDA 4I6NB 4BOZB 1K53A 1TZ1A 4FBJB 3AEBB 5EE3A 3UGBB 3SFEB 1EF5A 1MJDA 2Z8LA 4WJOA 3ZQ4A 4ANXA 4HJGE 2WU5B 1F77A 2KWUB 1C4CA 1N5XA 1TKEA 3KW5B 3NS1A 4EZKA 4OZAA 1H8CA 4HVBA 4GDLA 1J0GA 3L16A 2IGGA 4RCOA 1RRBA 1WE6A 2KJHB 1HTOA 1L4DB 2PE9A 3H9DA 5DPRA 4OVUA 4ZYNA 1CJEA 1GC6A 3UI3A 3VAWA 1NVID 2ZNVB 2ZPYA 2O2VA 4BFRA 2IO1B 1SE3A 2LMCA 2KMAA 3P2BA 1JRPA 2RPQA 1YX5B 4DDID 4DDGD 3H7PB 3DDCB 5EE9A 1TIFA 3Q3JA 3AE8B 3PPAA 1EWCA 5IAAC 3QJZA 3NVVA 2WXIA 4YTPB 4ZRJA 1F2RI 4I6LB 4EFOA 3ZKJC 1WRDB 4LNKA 2RDBC 4MSMB 5LXIB 4B95A 4WQMA 1HZ6A 4RMAA 4IM2A 2NR2A 1V2YA 1WGRA 2KC2A 4K3BA 2KMCA 4ZHOA 1ET6A 2GI9A 2VH1A 1AWDA 4ZYSA 5CHFA 4KDIC 3AE5B 1KLUD 1YIWA 3AM9A 3APCA 2HD5B 2XK5A 1XLPA 1TS4A 3HVDA 5LLIA 5JHAA 3ZGZA 2NBVB 2IBIB 5IO9A 4MJSB 2ZW1A 3R66C 4EUTA 2R2OA 5AEKB 4CHKA 1GC7A 2AL3A 2BKRB 2WX0A 1V81A 3ETRA 3B0AA 4XE0A 1VZ8A 5FR3A 2MJDA 2KLGA 3ML8A 1ACCA 5E6OA 2KTFA 4WWMA 4LNNA 3RMKC 1IPGA 4KV2A 3IHPC 4IM3A 2KQ4X 2GBMA 5MPOA 4OW0A 3I5JC 2QJLA 2LXAA 2FUHB 2KK8A 3RNEC 2WDVB 3Q8BA 4YTNB 1P98A 1UGJA 1I4GA 1OFFA 2PIAA 2WWZA 4YT0B 1LXDA 2MJ3A 3NY5A 2M19A 1JWAD 1R4NB 3X23A 3AU5A 2WXMA
chains in the Genus database with same CATH topology
3HIZA 1V86A 2J7QB 2PJHA 4J6IA 1WF9A 1RAXA 2IY0B 4A3OA 3IFWB 4E71A 2BF8B 3JSVA 3TJPA 3UIOB 2KWVB 2BGFA 1Q5WB 2KJ6A 2DYBA 2D2QA 3V62A 2LVOA 4ICUA 2KKCA 2KD0A 3NS8A 3UF8A 1ISNA 1WJUA 4W9EA 1EF1A 2RD0A 3M95A 2JXXA 2DZIA 3PVLA 3T8MA 1E8YA 1WGDA 4TKNA 3A9JB 3QQ8B 2ZEQA 1UELA 4NNJB 3DBHI 3DVGX 4K81A 3VH3B 3WAPA 2MQJA 2M4NA 3ZNZB 4GB9A 2O6VD 3JYUA 3EHVA 4IUMB 4RM9A 3AU4A 4DK5A 4P7IA 3WANA 3V60A 4WJQA 1J8CA 1WI0A 1KLVA 4FLHA 4IM0A 1YX6B 1UH6A 4ASWC 1UBIA 1WR6E 4BVUC 4W9FA 5BO4B 2NPTA 2FIDA 2WYQA 5GMVA 3L0WB 2DZKA 2YLMA 2K39A 2L05A 2EMTA 2RR9A 3WA0A 5FR6A 3O65B 4GDKB 3ZNGC 1P9DU 1E7VA 1L7YA 1OGWA 4GU2A 2B3AA 1VD2A 2FCNA 1NI2A 1LM8B 1OQYA 3W1SC 4II3B 1F9JA 2CHXA 2LI5A 2N7EA 4PS7A 4TQ1A 4WQOB 3RYTA 2L0FA 2XEWA 4G11A 2LRWA 4ANWA 2DAJA 4DWFA 1WXSA 1RLFA 1XT9B 3A1QA 3K9PB 3NZUA 4W9IA 2LVQA 4HWIB 4HXDA 1BT0A 2AWTA 2UWQA 3KH0A 4YL8A 4KZ0A 4HCNB 4CO7A 3WAOA 3DBRI 2CR5A 1YQBA 2DZMA 3OAWA 3BINA 2ZJDA 3OLMD 3PT2B 3QA8A 3A1QB 2CS4A 2MBOA 4X57B 2KXJA 1I35A 1V80A 5D7GA 2JZ3B 2L7RA 2DZJA 4E74A 1WH3A 1WMHB 3RT3B 4IC7B 4LCDE 1OEYA 3PS6A 1WGYA 3QX1A 4LDTB 2FCMA 3DQVA 4JLCA 3H7SA 4AP4C 2KDFB 1E90A 4BKTA 5JHBA 3QAQA 3K9OB 4MEMA 3DCGA 2KVRA 2KFJA 2VRRB 4DBGA 4GIVA 4EZJA 2LZ6A 4PYZA 2IY1B 2PE6B 4MJSA 3ZTDA 4K7SA 4HCPB 1R4NI 2MW5A 4F1SA 2JF5A 3KYDD 4G3XB 2I1JA 2KO3A 3UIPB 3A4SC 5JZEB 2KHWB 3CSFA 1V5TA 5KHOA 3EC8A 1V9JA 4WJPA 2CHWA 3L17A 4W9GA 2ZVNA 2LD9A 3N3KB 2CU1A 3V6EB 4FHJA 2XBBC 3QHTA 2GMIC 2IZVB 1WJNA 2IO3B 1U4AA 1WGHA 2K1FA 4KIKB 1QZEA 2KJRA 1WIAA 3U30A 3W1SA 5J2RA 1KJTA 3DBLI 2DYOA 1WJ4A 2C7NB 3PZDA 1KM7A 2MBBB 1OTRB 3KUZA 4W9JA 4FJVB 3EECA 3Q3FA 3RUIB 3I3TB 4B9KA 5D2MB 2MWSB 3L54A 3PRPB 4A3PA 4K7UA 4WJNA 2KDBA 2GBRA 2LASA 1GUAB 3KUCB 4IWQA 2NS5A 1SE9A 1P1AA 2W9NA 3VTWA 1JRUA 2RGFA 2N9XA 1Q1OA 5L95C 3CF6E 2DHZA 3VQIA 4NQLB 2JPHA 2LWPA 1LQBA 3TCAA 2FIFA 2LRUA 2L00B 1AARA 2G3QB 2N1WA 3MJWA 1SIFA 3SU8X 1WY8A 1ZGUB 1A5RA 1EO6A 1WYWB 3ZDTA 3AXCA 2K6QA 3GOEA 5CX3A 5EDSA 4FHKA 2D3GA 2GBKA 3BY4B 3SHQA 2V1YA 2C7HA 2EMSA 2WX1A 2KQ7A 2MBHA 1UBQA 2L8JA 4G50A 4FADA 3QK0A 2REXA 1V5OA 4LJPB 3MTNB 4HPMB 3RULA 3ZNHB 2FNJB 3AULA 4GMVA 1P3QU 4NAWB 3PHWB 4AOFA 2MRPA 4I6PA 4IWOA 1P0RA 3N32A 3IVFA 3UQBA 2LGDA 1TBEA 3H7PA 4M0WB 2HTHA 1WX7A 1WZ0A 1NDDA 2MX2A 2V4LA 3OJ4B 3VXWA 4EEWA 3L13A 3ZIMA 1WR1A 4KSKC 3EFUA 2J0KA 2C5LC 4F7ZA 1WX8A 1EUVB 3HM3A 1UZXB 2C60A 3APDA 3VUWA 5D94A 2KOXA 3HK0A 3UQAA 3SDLC 1Z2MA 4GGQA 1XD3B 2CHZA 2HJ8A 3A9KB 3CSTA 1WE7A 2RSUA 3ONSA 1X1MA 2JRHA 1WXAA 4MELA 3WIMA 4DHZE 2JT4B 3DVNU 1ZW7A 3RZWC 1Y8RC 2D10A 3ZLZA 2KDEB 3APFA 3X0WA 3ZTCA 3TL5A 1E8ZA 2WDTB 1WXMA 2M17A 3B08A 2BWFA 2L76A 3KVFB 3ECIA 4FN2A 2M1MA 5CHVC 1C1YB 1K8RB 4NAWA 3ML9A 3NOBA 1WJ6A 2GBJA 4TQ0A 2JVCA 3L08A 2UYZB 3PRMB 4MDKE 1RFAA 2DYMA 2FCQA 3CMMB 3H1UA 4E3CA 3QWZB 5J18A 2KN5A 2LUEA 5CTRC 5AZFA 3R7RA 3JVZX 4BKSA 1Q0WB 4GN1A 2Y5BB 5HKHA 2G45B 1D3ZA 1T0YA 4EZLA 4DHJD 2G4SA 1CMXB 3TMPB 5CHWA 1UGMA 4AJWA 3KUDB 2OOBB 2J0JA 2N7DA 3WALA 4GDKA 2KQSA 2KX0A 3V61A 3LJ3A 3IBEA 3VDZA 2MBQA 1OEYJ 4K7WA 4KIKA 5DPWA 4KDLB 1ZKHA 3PTFC 2IYDB 5J17A 2OJRA 1WX9A 3VFKA 1FXTB 2Z0EB 3PHXB 3VUXA 2NVUI 4BBNF 4BOZB 4I6NB 1L2NA 4WWPA 2KZRA 2M0XA 4DHJB 3W1YA 2ZCCA 2O2VB 1TZ1A 3VTVA 2KX3A 4FBJB 5KHQA 3PRZA 1E8WA 2N9EB 3PREA 4JIOU 3UGBB 1H4RA 1J19A 4WWNA 3GZNI 3M62B 3ZVVA 3B1LX 4MGZE 1EF5A 3C0RB 3DVNV 1MG8A 2FAZA 1R4MI 4WJOA 4ANXA 4AJYB 4GSWA 4BKGA 5IA7A 1KOTA 4BKSD 2AEHA 2KWUB 4DXAB 2AYOB 2KWCA 2GOWA 3ZO5B 3KW5B 4EZKA 1GNUA 4KZCA 1WMHA 4W9KA 2MCNB 1H8CA 4BOSC 4HVBA 3U7DA 2Z59B 3VTUA 3VH4B 2A5UA 4GDLA 5D6JB 1J0GA 2BYEA 3L16A 3ZRCA 4M8MA 3LDZE 4HJKA 1RRBA 1WE6A 4ZDVA 3PGEA 4LDTD 3ALBA 3SD5A 2KJHB 1V6EA 2DX5B 3DVGY 4W9CA 5C23A 3HM6X 4GOCA 3ZRFA 2PE9A 3H9DA 2NBUA 5DPRA 4OVUA 4ZYNA 1XQQA 1YJ1A 4MGYE 1GC6A 3DBSA 4FULA 4WWOA 2KNBA 4ANUA 4AWJA 3VAWA 3S2AA 2FCSA 3H6NA 2ZPNA 2ZNVB 3N30A 2ZNVC 2GBNA 4HLEA 1IYFA 1TTNA 2K6DB 1GJZA 4ZRIA 2D11A 5E6PA 2ZPYA 2O2VA 4BFRA 2EKEC 3ZNID 3ZDMC 4XC2A 2IO1B 2K25A 4TV3A 2JRIB 2JY6A 2ZVOA 4IWPA 1SGHA 4HDQA 2KMAA 4NQKE 5DPSA 3VHTC 2CKHB 1HE8A 2V3SA 2Z0DB 4MGIE 4W9DA 4JGHB 3PLVA 3P2BA 2RPQA 2YVCA 1YX5B 4DDID 3MHSD 4LJOB 4K1RB 1S1QB 3KYCD 4DDGD 4HPLB 4ANVA 1G6JA 4NPNA 3H7PB 2PEAA 3DDCB 4HDOA 3OJ3A 2J0MA 4GDLB 3Q3JA 4F8CB 2LGXA 2O6VA 3U8ZA 5L83A 1YD8U 2K8CA 3PPAA 1UD7A 4M8NA 4W9LA 5IAAC 3WAMA 1WGGA 3QJZA 1IP9A 5DPTA 4WAAA 2L3ZA 1WM2A 4BBNC 5G55A 4GXBA 4G0NB 4MSQB 4IW0A 4ZRJA 4FA6A 4II2B 3QARA 3TIXA 1E7UA 2KDIA 4I6LB 4EFOA 3A9JA 3ZKJC 2K8HA 4B6WA 2BKFA 1WRDB 2DENB 2AL6A 1I42A 4MSMB 4ZRKA 4A20A 3HHMA 5LXIB 4B95A 5DCNA 2ZZPB 1NBFC 2LJ5A 3M63B 1WM3A 2KANA 1Z5SB 4RMAA 4IM2A 2NR2A 4TUUA 1V2YA 2MP2B 1M94A 5AZHA 1WGRA 3QC8B 2LVPA 2JZZA 3V6CB 4XX5A 4URKA 3JW0X 2KC2A 2HE7A 2KMCA 2LGYA 3R7QA 1WXVA 5E6NA 3VVWB 1PQSA 3JSVB 2D07B 5CHFA 4EKUA 5JH5C 4KDIC 2G4DB 1YIWA 2NBWB 2M8SA 3APCA 2HD5B 2XK5A 3QIJA 3VUYA 5LLIA 5C1ZA 4CYEA 5G2NA 5JHAA 3A4RA 2IO2B 3NHEB 2NBVB 2IBIB 4KVGB 4MJSB 2A4ZA 2JUOA 2KFKA 4AUQC 4HK2A 2N1VA 2BWES 2IO0B 3M3JA 3R3MA 4JL9A 4KSLC 3R66C 4MH0E 2MA9B 4NJ6A 4XZ4A 3PV1A 4EUTA 4NY0A 2O6VB 2R2OA 5AEKB 4CHKA 4DHZB 4W9HA 1GC7A 2C7MB 4RM8A 2BPSA 2AL3A 2KTRA 2BKRB 3DOWA 4PS8A 2WX0A 1V81A 4MGKE 3B0AA 4PYUA 5LXHA 3RCZA 4OVVA 2KFKB 3PLUA 2KLGA 3A33B 2PPHA 1TGZB 3ML8A 5E6OA 2KLCA 1V49A 2KTFA 4FJYA 3UINB 3T9LA 2QHOA 1WZ3A 3AI5A 1IPGA 4FJZA 2ASQA 2MP2A 3A9KA 3TBLD 2MSED 4KV2A 4IG7B 1VCBA 3IHPC 2NCNA 5TR5A 4IM3A 1GG3A 2MLBA 4NJ7A 2GBMA 2N4FA 3ZW3A 1LFDA 3RD2A 2L0TA 4MM3A 2BYVE 3RZFA 2LXAA 2FUHB 2KK8A 4EOYA 2I1KA 3IG3A 1S3SG 4JQWC 2R2QA 1C3TA 4ICVA 2XK5B 1P98A 3ZUNA 2JWZA 2ZCBA 1E8XA 2DAFA 2NPTB 3PSEB 2WWZA 1LXDA 2KC1A 1E5WA 5AZGA 3NY5A 4N9F4 4PS3A 2C9WB 2KTRB 3AU5A 3QCAA 2MBEA 2K8BA 3ENEA 3X23A 2BYFA 3D32A 3L10B 3NZSA 1WFYA 3DPDA 2N9PC 2LXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIZ A;  1V86 A;  2J7Q B;  2PJH A;  4J6I A;  1WF9 A;  1RAX A;  2IY0 B;  4A3O A;  3IFW B;  4E71 A;  2BF8 B;  3JSV A;  3TJP A;  3UIO B;  2KWV B;  2BGF A;  1Q5W B;  2KJ6 A;  2DYB A;  2D2Q A;  3V62 A;  2LVO A;  4ICU A;  2KKC A;  2KD0 A;  3NS8 A;  3UF8 A;  1ISN A;  1WJU A;  4W9E A;  1EF1 A;  2RD0 A;  3M95 A;  2JXX A;  2DZI A;  3PVL A;  3T8M A;  1E8Y A;  1WGD A;  4TKN A;  3A9J B;  3QQ8 B;  2ZEQ A;  1UEL A;  4NNJ B;  3DBH I;  3DVG X;  4K81 A;  3VH3 B;  3WAP A;  2MQJ A;  2M4N A;  3ZNZ B;  4GB9 A;  2O6V D;  3JYU A;  3EHV A;  4IUM B;  4RM9 A;  3AU4 A;  4DK5 A;  4P7I A;  3WAN A;  3V60 A;  4WJQ A;  1J8C A;  1WI0 A;  1KLV A;  4FLH A;  4IM0 A;  1YX6 B;  1UH6 A;  4ASW C;  1UBI A;  1WR6 E;  4BVU C;  4W9F A;  5BO4 B;  2NPT A;  2FID A;  2WYQ A;  5GMV A;  3L0W B;  2DZK A;  2YLM A;  2K39 A;  2L05 A;  2EMT A;  2RR9 A;  3WA0 A;  5FR6 A;  3O65 B;  4GDK B;  3ZNG C;  1P9D U;  1E7V A;  1L7Y A;  1OGW A;  4GU2 A;  2B3A A;  1VD2 A;  2FCN A;  1NI2 A;  1LM8 B;  1OQY A;  3W1S C;  4II3 B;  1F9J A;  2CHX A;  2LI5 A;  2N7E A;  4PS7 A;  4TQ1 A;  4WQO B;  3RYT A;  2L0F A;  2XEW A;  4G11 A;  2LRW A;  4ANW A;  2DAJ A;  4DWF A;  1WXS A;  1RLF A;  1XT9 B;  3A1Q A;  3K9P B;  3NZU A;  4W9I A;  2LVQ A;  4HWI B;  4HXD A;  1BT0 A;  2AWT A;  2UWQ A;  3KH0 A;  4YL8 A;  4KZ0 A;  4HCN B;  4CO7 A;  3WAO A;  3DBR I;  2CR5 A;  1YQB A;  2DZM A;  3OAW A;  3BIN A;  2ZJD A;  3OLM D;  3PT2 B;  3QA8 A;  3A1Q B;  2CS4 A;  2MBO A;  4X57 B;  2KXJ A;  1I35 A;  1V80 A;  5D7G A;  2JZ3 B;  2L7R A;  2DZJ A;  4E74 A;  1WH3 A;  1WMH B;  3RT3 B;  4IC7 B;  4LCD E;  1OEY A;  3PS6 A;  1WGY A;  3QX1 A;  4LDT B;  2FCM A;  3DQV A;  4JLC A;  3H7S A;  4AP4 C;  2KDF B;  1E90 A;  4BKT A;  5JHB A;  3QAQ A;  3K9O B;  4MEM A;  3DCG A;  2KVR A;  2KFJ A;  2VRR B;  4DBG A;  4GIV A;  4EZJ A;  2LZ6 A;  4PYZ A;  2IY1 B;  2PE6 B;  4MJS A;  3ZTD A;  4K7S A;  4HCP B;  1R4N I;  2MW5 A;  4F1S A;  2JF5 A;  3KYD D;  4G3X B;  2I1J A;  2KO3 A;  3UIP B;  3A4S C;  5JZE B;  2KHW B;  3CSF A;  1V5T A;  5KHO A;  3EC8 A;  1V9J A;  4WJP A;  2CHW A;  3L17 A;  4W9G A;  2ZVN A;  2LD9 A;  3N3K B;  2CU1 A;  3V6E B;  4FHJ A;  2XBB C;  3QHT A;  2GMI C;  2IZV B;  1WJN A;  2IO3 B;  1U4A A;  1WGH A;  2K1F A;  4KIK B;  1QZE A;  2KJR A;  1WIA A;  3U30 A;  3W1S A;  5J2R A;  1KJT A;  3DBL I;  2DYO A;  1WJ4 A;  2C7N B;  3PZD A;  1KM7 A;  2MBB B;  1OTR B;  3KUZ A;  4W9J A;  4FJV B;  3EEC A;  3Q3F A;  3RUI B;  3I3T B;  4B9K A;  5D2M B;  2MWS B;  3L54 A;  3PRP B;  4A3P A;  4K7U A;  4WJN A;  2KDB A;  2GBR A;  2LAS A;  1GUA B;  3KUC B;  4IWQ A;  2NS5 A;  1SE9 A;  1P1A A;  2W9N A;  3VTW A;  1JRU A;  2RGF A;  2N9X A;  1Q1O A;  5L95 C;  3CF6 E;  2DHZ A;  3VQI A;  4NQL B;  2JPH A;  2LWP A;  1LQB A;  3TCA A;  2FIF A;  2LRU A;  2L00 B;  1AAR A;  2G3Q B;  2N1W A;  3MJW A;  1SIF A;  3SU8 X;  1WY8 A;  1ZGU B;  1A5R A;  1EO6 A;  1WYW B;  3ZDT A;  3AXC A;  2K6Q A;  3GOE A;  5CX3 A;  5EDS A;  4FHK A;  2D3G A;  2GBK A;  3BY4 B;  3SHQ A;  2V1Y A;  2C7H A;  2EMS A;  2WX1 A;  2KQ7 A;  2MBH A;  1UBQ A;  2L8J A;  4G50 A;  4FAD A;  3QK0 A;  2REX A;  1V5O A;  4LJP B;  3MTN B;  4HPM B;  3RUL A;  3ZNH B;  2FNJ B;  3AUL A;  4GMV A;  1P3Q U;  4NAW B;  3PHW B;  4AOF A;  2MRP A;  4I6P A;  4IWO A;  1P0R A;  3N32 A;  3IVF A;  3UQB A;  2LGD A;  1TBE A;  3H7P A;  4M0W B;  2HTH A;  1WX7 A;  1WZ0 A;  1NDD A;  2MX2 A;  2V4L A;  3OJ4 B;  3VXW A;  4EEW A;  3L13 A;  3ZIM A;  1WR1 A;  4KSK C;  3EFU A;  2J0K A;  2C5L C;  4F7Z A;  1WX8 A;  1EUV B;  3HM3 A;  1UZX B;  2C60 A;  3APD A;  3VUW A;  5D94 A;  2KOX A;  3HK0 A;  3UQA A;  3SDL C;  1Z2M A;  4GGQ A;  1XD3 B;  2CHZ A;  2HJ8 A;  3A9K B;  3CST A;  1WE7 A;  2RSU A;  3ONS A;  1X1M A;  2JRH A;  1WXA A;  4MEL A;  3WIM A;  4DHZ E;  2JT4 B;  3DVN U;  1ZW7 A;  3RZW C;  1Y8R C;  2D10 A;  3ZLZ A;  2KDE B;  3APF A;  3X0W A;  3ZTC A;  3TL5 A;  1E8Z A;  2WDT B;  1WXM A;  2M17 A;  3B08 A;  2BWF A;  2L76 A;  3KVF B;  3ECI A;  4FN2 A;  2M1M A;  5CHV C;  1C1Y B;  1K8R B;  4NAW A;  3ML9 A;  3NOB A;  1WJ6 A;  2GBJ A;  4TQ0 A;  2JVC A;  3L08 A;  2UYZ B;  3PRM B;  4MDK E;  1RFA A;  2DYM A;  2FCQ A;  3CMM B;  3H1U A;  4E3C A;  3QWZ B;  5J18 A;  2KN5 A;  2LUE A;  5CTR C;  5AZF A;  3R7R A;  3JVZ X;  4BKS A;  1Q0W B;  4GN1 A;  2Y5B B;  5HKH A;  2G45 B;  1D3Z A;  1T0Y A;  4EZL A;  4DHJ D;  2G4S A;  1CMX B;  3TMP B;  5CHW A;  1UGM A;  4AJW A;  3KUD B;  2OOB B;  2J0J A;  2N7D A;  3WAL A;  4GDK A;  2KQS A;  2KX0 A;  3V61 A;  3LJ3 A;  3IBE A;  3VDZ A;  2MBQ A;  1OEY J;  4K7W A;  4KIK A;  5DPW A;  4KDL B;  1ZKH A;  3PTF C;  2IYD B;  5J17 A;  2OJR A;  1WX9 A;  3VFK A;  1FXT B;  2Z0E B;  3PHX B;  3VUX A;  2NVU I;  4BBN F;  4BOZ B;  4I6N B;  1L2N A;  4WWP A;  2KZR A;  2M0X A;  4DHJ B;  3W1Y A;  2ZCC A;  2O2V B;  1TZ1 A;  3VTV A;  2KX3 A;  4FBJ B;  5KHQ A;  3PRZ A;  1E8W A;  2N9E B;  3PRE A;  4JIO U;  3UGB B;  1H4R A;  1J19 A;  4WWN A;  3GZN I;  3M62 B;  3ZVV A;  3B1L X;  4MGZ E;  1EF5 A;  3C0R B;  3DVN V;  1MG8 A;  2FAZ A;  1R4M I;  4WJO A;  4ANX A;  4AJY B;  4GSW A;  4BKG A;  5IA7 A;  1KOT A;  4BKS D;  2AEH A;  2KWU B;  4DXA B;  2AYO B;  2KWC A;  2GOW A;  3ZO5 B;  3KW5 B;  4EZK A;  1GNU A;  4KZC A;  1WMH A;  4W9K A;  2MCN B;  1H8C A;  4BOS C;  4HVB A;  3U7D A;  2Z59 B;  3VTU A;  3VH4 B;  2A5U A;  4GDL A;  5D6J B;  1J0G A;  2BYE A;  3L16 A;  3ZRC A;  4M8M A;  3LDZ E;  4HJK A;  1RRB A;  1WE6 A;  4ZDV A;  3PGE A;  4LDT D;  3ALB A;  3SD5 A;  2KJH B;  1V6E A;  2DX5 B;  3DVG Y;  4W9C A;  5C23 A;  3HM6 X;  4GOC A;  3ZRF A;  2PE9 A;  3H9D A;  2NBU A;  5DPR A;  4OVU A;  4ZYN A;  1XQQ A;  1YJ1 A;  4MGY E;  1GC6 A;  3DBS A;  4FUL A;  4WWO A;  2KNB A;  4ANU A;  4AWJ A;  3VAW A;  3S2A A;  2FCS A;  3H6N A;  2ZPN A;  2ZNV B;  3N30 A;  2ZNV C;  2GBN A;  4HLE A;  1IYF A;  1TTN A;  2K6D B;  1GJZ A;  4ZRI A;  2D11 A;  5E6P A;  2ZPY A;  2O2V A;  4BFR A;  2EKE C;  3ZNI D;  3ZDM C;  4XC2 A;  2IO1 B;  2K25 A;  4TV3 A;  2JRI B;  2JY6 A;  2ZVO A;  4IWP A;  1SGH A;  4HDQ A;  2KMA A;  4NQK E;  5DPS A;  3VHT C;  2CKH B;  1HE8 A;  2V3S A;  2Z0D B;  4MGI E;  4W9D A;  4JGH B;  3PLV A;  3P2B A;  2RPQ A;  2YVC A;  1YX5 B;  4DDI D;  3MHS D;  4LJO B;  4K1R B;  1S1Q B;  3KYC D;  4DDG D;  4HPL B;  4ANV A;  1G6J A;  4NPN A;  3H7P B;  2PEA A;  3DDC B;  4HDO A;  3OJ3 A;  2J0M A;  4GDL B;  3Q3J A;  4F8C B;  2LGX A;  2O6V A;  3U8Z A;  5L83 A;  1YD8 U;  2K8C A;  3PPA A;  1UD7 A;  4M8N A;  4W9L A;  5IAA C;  3WAM A;  1WGG A;  3QJZ A;  1IP9 A;  5DPT A;  4WAA A;  2L3Z A;  1WM2 A;  4BBN C;  5G55 A;  4GXB A;  4G0N B;  4MSQ B;  4IW0 A;  4ZRJ A;  4FA6 A;  4II2 B;  3QAR A;  3TIX A;  1E7U A;  2KDI A;  4I6L B;  4EFO A;  3A9J A;  3ZKJ C;  2K8H A;  4B6W A;  2BKF A;  1WRD B;  2DEN B;  2AL6 A;  1I42 A;  4MSM B;  4ZRK A;  4A20 A;  3HHM A;  5LXI B;  4B95 A;  5DCN A;  2ZZP B;  1NBF C;  2LJ5 A;  3M63 B;  1WM3 A;  2KAN A;  1Z5S B;  4RMA A;  4IM2 A;  2NR2 A;  4TUU A;  1V2Y A;  2MP2 B;  1M94 A;  5AZH A;  1WGR A;  3QC8 B;  2LVP A;  2JZZ A;  3V6C B;  4XX5 A;  4URK A;  3JW0 X;  2KC2 A;  2HE7 A;  2KMC A;  2LGY A;  3R7Q A;  1WXV A;  5E6N A;  3VVW B;  1PQS A;  3JSV B;  2D07 B;  5CHF A;  4EKU A;  5JH5 C;  4KDI C;  2G4D B;  1YIW A;  2NBW B;  2M8S A;  3APC A;  2HD5 B;  2XK5 A;  3QIJ A;  3VUY A;  5LLI A;  5C1Z A;  4CYE A;  5G2N A;  5JHA A;  3A4R A;  2IO2 B;  3NHE B;  2NBV B;  2IBI B;  4KVG B;  4MJS B;  2A4Z A;  2JUO A;  2KFK A;  4AUQ C;  4HK2 A;  2N1V A;  2BWE S;  2IO0 B;  3M3J A;  3R3M A;  4JL9 A;  4KSL C;  3R66 C;  4MH0 E;  2MA9 B;  4NJ6 A;  4XZ4 A;  3PV1 A;  4EUT A;  4NY0 A;  2O6V B;  2R2O A;  5AEK B;  4CHK A;  4DHZ B;  4W9H A;  1GC7 A;  2C7M B;  4RM8 A;  2BPS A;  2AL3 A;  2KTR A;  2BKR B;  3DOW A;  4PS8 A;  2WX0 A;  1V81 A;  4MGK E;  3B0A A;  4PYU A;  5LXH A;  3RCZ A;  4OVV A;  2KFK B;  3PLU A;  2KLG A;  3A33 B;  2PPH A;  1TGZ B;  3ML8 A;  5E6O A;  2KLC A;  1V49 A;  2KTF A;  4FJY A;  3UIN B;  3T9L A;  2QHO A;  1WZ3 A;  3AI5 A;  1IPG A;  4FJZ A;  2ASQ A;  2MP2 A;  3A9K A;  3TBL D;  2MSE D;  4KV2 A;  4IG7 B;  1VCB A;  3IHP C;  2NCN A;  5TR5 A;  4IM3 A;  1GG3 A;  2MLB A;  4NJ7 A;  2GBM A;  2N4F A;  3ZW3 A;  1LFD A;  3RD2 A;  2L0T A;  4MM3 A;  2BYV E;  3RZF A;  2LXA A;  2FUH B;  2KK8 A;  4EOY A;  2I1K A;  3IG3 A;  1S3S G;  4JQW C;  2R2Q A;  1C3T A;  4ICV A;  2XK5 B;  1P98 A;  3ZUN A;  2JWZ A;  2ZCB A;  1E8X A;  2DAF A;  2NPT B;  3PSE B;  2WWZ A;  1LXD A;  2KC1 A;  1E5W A;  5AZG A;  3NY5 A;  4N9F 4;  4PS3 A;  2C9W B;  2KTR B;  3AU5 A;  3QCA A;  2MBE A;  2K8B A;  3ENE A;  3X23 A;  2BYF A;  3D32 A;  3L10 B;  3NZS A;  1WFY A;  3DPD A;  2N9P C;  2LXC A; 
#chains in the Genus database with same CATH topology
 4A3O A;  1I4X A;  3BVM A;  1QOA A;  1D6E C;  1GOZ A;  3Q8E A;  1DGJ A;  2RD0 A;  3M95 A;  3LB8 C;  4NNJ B;  3DBH I;  3VH3 B;  4K81 A;  2MQJ A;  4GB9 A;  3EHV A;  2LFI A;  3N20 C;  3AU4 A;  1WI0 A;  3ZXV A;  1UBI A;  3IAS 1;  4LLG M;  1BUI C;  2FID A;  2M56 B;  1MFW A;  2WYQ A;  5GMV A;  3L0W B;  2K39 A;  3WA0 A;  1V8C A;  5FR6 A;  3T3O A;  5G5H A;  1T0Q C;  1D5X C;  2BB6 A;  3DBH B;  1VD2 A;  2FCN A;  4P16 A;  1LM8 B;  1SIJ A;  1F9J A;  2CHX A;  2LI5 A;  2N7E A;  3RYT A;  4IOI E;  4IKG A;  4IDI A;  4DWF A;  1XT9 B;  3A1Q A;  3E56 A;  2LVQ A;  1BT0 A;  3P4Q B;  2UWQ A;  4YL8 A;  2L1A A;  3OG5 A;  4KZ0 A;  4HCN B;  3DBR I;  1WRI A;  3QA8 A;  3DWG C;  2JZ3 B;  1JCK B;  4E74 A;  1WMH B;  1JWU D;  4L2Y A;  3CWI A;  3H7S A;  4BKT A;  2J42 A;  3RFZ B;  2LZ6 A;  4PYZ A;  4MJS A;  3I57 A;  2MW5 A;  2R61 A;  2WGS A;  2KO3 A;  3A4S C;  2L32 A;  4L1B A;  2J4X A;  1V5T A;  3EC8 A;  1V9J A;  3N1Z C;  2XN9 C;  2IJ0 A;  1ZDX A;  1C4P A;  4FHJ A;  2GMI C;  2DLB A;  1YN4 A;  2K1F A;  1KF6 B;  4KIK B;  2KJR A;  5J2R A;  1TS5 A;  5C3J B;  1OTR B;  4FJV B;  4HPP A;  3RUI B;  3PRP B;  3PZ7 A;  4A3P A;  4ACF A;  4WJN A;  3EA6 A;  4M01 A;  3DHG C;  3KUC B;  3Q69 A;  4IWQ A;  1SE9 A;  2W9N A;  1JRU A;  1HA5 A;  5L95 C;  2DHZ A;  2Y3A A;  4YSX B;  3I63 C;  2JPH A;  2LRU A;  2L00 B;  2G3Q B;  1I4P A;  1SIF A;  2JQR B;  1HQR D;  1ZGU B;  3TSS A;  3P63 A;  2JU6 X;  1UUP A;  3GOE A;  3IXS A;  2D3G A;  2KAC A;  2K5P A;  1SE2 A;  2EMS A;  2KQ7 A;  4FAD A;  3AEG B;  1N5W A;  1V5O A;  3VR8 B;  3IT6 B;  4AOF A;  3AUL A;  2JXT A;  1YN3 A;  4GMV A;  2MRP A;  3L4P A;  3N32 A;  3UQB A;  2BYT A;  3RNC C;  2MX2 A;  3OJ4 B;  2KWD A;  2WXF A;  1WX8 A;  1EUV B;  1FNV A;  3LXF A;  3U2S C;  5D3I B;  4JE3 B;  3SDL C;  1BXT A;  3O13 A;  2CHZ A;  3A9K B;  2D3B A;  1JWB D;  2JRH A;  2H89 B;  2W55 A;  4MEL A;  4DHZ E;  2JT4 B;  1JWS D;  3DVN U;  1ZW7 A;  1QLB B;  3ZLZ A;  1MHH E;  2KDE B;  4JPS A;  4L23 A;  1IGC A;  1E8Z A;  2WDT B;  2V0G A;  3B08 A;  4FN2 A;  3ECI A;  2M1M A;  3ML9 A;  3NOB A;  1WJ6 A;  1V1P A;  4NJC A;  4JX1 C;  2FCQ A;  3CMM B;  3H1U A;  1K52 A;  5CTR C;  3R7R A;  2CU3 A;  1FFU A;  4EZL A;  4DHJ D;  2G4S A;  3VRB B;  4C4V A;  3KUD B;  2V4I B;  1RM6 C;  1HTQ A;  4XDC A;  1OEY J;  4KDL B;  2WXJ A;  2J52 A;  5J17 A;  1C9F A;  1WX9 A;  4HRS A;  1ESF A;  4RGN A;  2Z0E B;  3PHX B;  3VUX A;  1L2N A;  2OJW A;  4WWP A;  4DHJ B;  5E6J A;  2ZCC A;  4TMA B;  2KX3 A;  3AED B;  1PUT A;  3PRZ A;  1E8W A;  2N9E B;  1J19 A;  4MGZ E;  1L4Z B;  1F0Z A;  2VZK D;  3B2F A;  4GSW A;  2W54 A;  2LGI A;  1FXA A;  4BKG A;  3W5V B;  2KWC A;  3FC4 A;  2GOW A;  1T5X D;  4KZC A;  1WMH A;  4W9K A;  4BOS C;  4XWW A;  3U7D A;  3VTU A;  1L0X B;  2A5U A;  3MHZ A;  2BYE A;  3NJT A;  4M8M A;  1N6Z A;  3LDZ E;  2X8X X;  2TSS A;  3ABV B;  4HJK A;  1YNT E;  4ZDV A;  3ALB A;  4ZOH C;  2JSV X;  4W9C A;  2QIL A;  4GOC A;  1FXI A;  1SEB D;  1V97 A;  2NBU A;  4ARC A;  1VZ6 A;  1XQQ A;  4FUL A;  4WWO A;  4ANU A;  5HHD G;  2FCS A;  2ZPN A;  3N30 A;  4LTU A;  5HFY A;  4LNF A;  3ZDM C;  2K25 A;  2JRI B;  2JY6 A;  2PLP A;  1SGH A;  2ICI A;  4MGI E;  3PLV A;  2YVC A;  4P1B C;  4K1R B;  1ET9 A;  1S1Q B;  4Q2J A;  2RPV A;  1G6J A;  4ANV A;  2MH7 A;  4YWG G;  1VR9 A;  2J0M A;  4F8C B;  1B9R A;  2LGX A;  1QOF A;  3NVZ A;  1OQQ A;  4W9L A;  2I38 A;  1WGG A;  2AX5 A;  4C80 A;  2M0A A;  2WXQ A;  2W82 A;  1WM2 A;  4XDD A;  5BYS A;  2D3A A;  3QAR A;  4B6W A;  2BKF A;  3LYY A;  1I42 A;  3HHM A;  3EGR A;  5DCN A;  1NBF C;  1ZXH A;  1WM3 A;  3BYT B;  1YN5 A;  2MP2 B;  3QC8 B;  2LVP A;  2JZZ A;  3V6C B;  4XX5 A;  3JW0 X;  1VLB A;  1RFK A;  1K51 A;  5AUK A;  1T6B X;  2HTM E;  4EKU A;  3VVW B;  5JH5 C;  3B9J A;  3DWM A;  3BVG A;  1ZXI A;  1NYQ A;  2BB5 A;  5C1Z A;  4CYE A;  3A4R A;  2IO2 B;  1ZE3 D;  1E0Z A;  1IGD A;  2N1V A;  5TSS A;  3FAH A;  3MC9 A;  3V3X A;  1NEN B;  3PV1 A;  4NY0 A;  2O6V B;  4W9H A;  2C7M B;  4RM8 A;  3RNF C;  1D4B A;  2GRI A;  4PS8 A;  4MAC A;  3DOW A;  2WXG A;  1XCT L;  4JWS C;  2KFK B;  3KQ4 A;  3A33 B;  1TGZ B;  3RNA C;  2WXL A;  2KLC A;  4FJY A;  1I4Q A;  3T9L A;  3UIN B;  3TEW A;  2QHO A;  3AI5 A;  2ASQ A;  2KVZ A;  2MP2 A;  4PT5 A;  4IG7 B;  2MLB A;  4NJ7 A;  1JAL A;  2L0T A;  2BYV E;  3RZF A;  4EOY A;  3IG3 A;  4JQW C;  4M00 A;  1CQV A;  2R2Q A;  1N62 A;  2WQY B;  4ICV A;  3RN9 C;  2B76 B;  5BMI A;  2DAF A;  2NPT B;  3PSE B;  2LJI A;  1E5W A;  1YQ3 B;  2BQQ A;  4N9F 4;  2C9W B;  3U52 E;  2LHD A;  3ENE A;  4XYC A;  3I9V 1;  3NZS A;  1WFY A;  1C79 A;  2AQ2 B;  2N9P C;  2LXC A;  4S0R A;  4OZB A;  3NG0 A;  2LGS A;  1V86 A;  3NUH B;  2J7Q B;  2PJH A;  2IY0 B;  3IFW B;  5IN7 A;  3UIO B;  1TS2 A;  3KWL A;  1Q5W B;  2KJ6 A;  4ICU A;  2KKC A;  1WJU A;  2LEK A;  4BAX A;  2JXX A;  3AEA B;  3PVL A;  3QQ8 B;  1UEL A;  3DVG X;  2I2Y A;  3JYU A;  4RM9 A;  1TY2 A;  1QKZ A;  2EKI A;  1J8C A;  4MM3 B;  4US9 A;  1YX6 B;  1QT9 A;  2NPT A;  2DZK A;  4KGR A;  2L05 A;  1GB1 A;  3ZNG C;  3PZ8 A;  1E7V A;  1ZDV A;  2B3A A;  3N1X C;  3W1S C;  4II3 B;  2KT7 A;  4PS7 A;  4K3C A;  2XEW A;  1XLQ A;  4ANW A;  2DAJ A;  1WXS A;  4LK0 M;  3K9P B;  3NZU A;  2DWQ A;  2IND C;  2JYE A;  3KH0 A;  2CR5 A;  1YQB A;  1YJJ A;  3OAW A;  3BIN A;  3OLM D;  1XXG A;  2CS4 A;  2MBO A;  4X57 B;  1I35 A;  4RNA A;  1V80 A;  5D7G A;  2PW9 A;  1J7B A;  4LCD E;  2FCM A;  4AP4 C;  2KDF B;  4AS1 A;  1E90 A;  5JHB A;  3MP9 A;  3K9O B;  4MEM A;  3DCG A;  2KVR A;  2KFJ A;  4EZJ A;  4GIV A;  3MFG A;  1I7H A;  1R4N I;  2JF5 A;  2I1J A;  1BML C;  3UIP B;  5JZE B;  4R3D A;  5KHO A;  4WJP A;  4W9G A;  2NMQ A;  2CU1 A;  3AE9 B;  2IZV B;  1WJN A;  4WH4 A;  5EE0 A;  1QIL A;  5FK9 C;  1KJT A;  1TKG A;  1WYG A;  3PZD A;  2MBB B;  3KUZ A;  4W9J A;  3EEC A;  3Q3F A;  3I3T B;  4B9K A;  1IBX A;  2K22 A;  2LAS A;  5H8Y E;  1GUA B;  1P1A A;  3VTW A;  1L6V A;  1WWT A;  2RGF A;  4RGO S;  1UF0 A;  2IDY A;  2LHE A;  4N6E B;  1L5P A;  1WYW B;  2GB1 A;  4FHK A;  2GBK A;  3BY4 B;  3GE3 C;  1R7S A;  3P4P B;  1UBQ A;  2L8J A;  4G50 A;  1TY0 A;  2REX A;  4HPM B;  3RUL A;  1P3Q U;  2NTS A;  1QOG A;  4EEW A;  1WR1 A;  4KSK C;  2J0K A;  2C5L C;  4F7Z A;  3P1M A;  1VJK A;  1FEH A;  1NYR A;  3VUW A;  1FNU A;  3HK0 A;  3DHH C;  4GGQ A;  2EEL A;  3RNB C;  2HJ8 A;  1WE7 A;  3ONS A;  1TZO A;  4KGS A;  3ZJV A;  2WU2 B;  3ZTC A;  3TL5 A;  5I4D A;  2L76 A;  3R2I A;  5CHV C;  1C1Y B;  1K8R B;  1M4V A;  3TUO A;  5IP4 D;  4TQ0 A;  1KLG D;  3PRM B;  5J18 A;  2WDR B;  5AZF A;  3JVZ X;  5BYR A;  1CMX B;  1VZ7 A;  5CHW A;  4AJW A;  3RPF C;  1D5M C;  1T0R C;  2KX0 A;  3V61 A;  3LJ3 A;  3RI7 C;  1ZKH A;  5IKC M;  1SB3 C;  2NVU I;  1FCL A;  2KZR A;  2M0X A;  1F2R C;  2LUM A;  3VTV A;  1I4H A;  4HRO A;  1STE A;  4JIO U;  1H4R A;  1F1H A;  3GZN I;  3M62 B;  2BBC A;  3ZVV A;  3B1L X;  3DVN V;  1MG8 A;  2FAZ A;  1R4M I;  2E3T A;  5IA7 A;  1KOT A;  2AEH A;  4DXA B;  2AYO B;  3OWE B;  1EU3 A;  3ZO5 B;  2MCN B;  5D3D A;  4A90 A;  3VH4 B;  5D6J B;  3ZRC A;  4RFB A;  3Q8F A;  1PGX A;  4A8X C;  1V6E A;  3FIL A;  5H92 C;  3ZRF A;  3SEB A;  3SFD B;  3DBL B;  1YJ1 A;  4M0W A;  3BZD B;  3DBS A;  3ZJT A;  3BVZ A;  2V3N A;  2ZNV C;  2GBN A;  1GJZ A;  1TTN A;  2K6D B;  4ZRI A;  5E6P A;  4KKJ A;  1N60 A;  2EKE C;  3ZNI D;  1YOV B;  2L52 A;  4TV3 A;  2ZVO A;  4M02 A;  2CKH B;  2V3S A;  2Z0D B;  5BMH A;  3MHS D;  3KYC D;  4NPN A;  4HDO A;  1CZP A;  5L83 A;  1IP9 A;  4C56 C;  4KX6 B;  3NZ3 A;  4BBN C;  5G55 A;  4GXB A;  4IW0 A;  2VZK B;  4II2 B;  1E7U A;  3A9J A;  2K8H A;  2E6X A;  2INP E;  1SJE D;  2AL6 A;  3IAM 1;  2ZZP B;  2LJ5 A;  2KAN A;  1HZ5 A;  1M94 A;  2WNM A;  5AZH A;  5HG2 A;  4URK A;  2HE7 A;  3FKY A;  1WXV A;  5E6N A;  3JSV B;  2D07 B;  2K0P A;  2HJ1 A;  2MHJ A;  2NBW B;  2M8S A;  4RF1 A;  2WXH A;  3QIJ A;  3VUY A;  4RGM A;  3NHE B;  3P4S B;  4KVG B;  2A4Z A;  4AUQ C;  3HRD D;  4KSL C;  1K50 A;  2IO0 B;  3M3J A;  4NJ6 A;  4MH0 E;  4XZ4 A;  2MA9 B;  3Q6B A;  2BPS A;  2Q5W D;  2RDG A;  3BII D;  4MGK E;  2K9X A;  3TEY A;  3AE1 B;  4EE2 A;  3PLU A;  3EFC A;  2QCZ A;  4FXC A;  1JRO A;  1TT5 B;  1WZ3 A;  1C77 A;  4FJZ A;  3TBL D;  3A9K A;  4OHJ A;  1HEZ E;  1FRR A;  1VCB A;  2NCN A;  1LFD A;  3RD2 A;  2FUG 1;  4MM3 A;  2G9H D;  1S3S G;  3NVY A;  4MH8 A;  3URY A;  1C3T A;  2XK5 B;  1FIQ A;  2H88 B;  3ZUN A;  2JWZ A;  4WUR A;  3V05 A;  1E8X A;  4D2K A;  1FFV A;  2KC1 A;  3W5U B;  3QCA A;  2K8B A;  2BYF A;  3L10 B;  4CQN A;  3DPD A;  5FKA C;  1YMH E;  2BS3 B;  3HIZ A;  4USA A;  4J6I A;  1WF9 A;  1RAX A;  3TJP A;  1JWM D;  2BGF A;  4US8 A;  3V62 A;  1GB4 A;  3UF8 A;  1ZOY B;  2MJE A;  4H2A A;  2DZI A;  1E8Y A;  1WGD A;  4TKN A;  2WHI A;  1PYW D;  2M4N A;  3ZNZ B;  2O6V D;  3MC0 B;  1GPX A;  4IUM B;  1QQR A;  2KN4 A;  4P7I A;  3WAN A;  1UNS A;  3MJ5 A;  3V60 A;  4N58 A;  1KLV A;  4FLH A;  2RDH A;  1UH6 A;  2JZP A;  4ASW C;  1WR6 E;  4BVU C;  4W9F A;  4MT5 A;  5BO4 B;  1ZP0 B;  2YLM A;  3H8H A;  3AB5 A;  2RR9 A;  1P9D U;  3AE2 B;  1DOX A;  1L7Y A;  4GU2 A;  2WXR A;  1NI2 A;  1OQY A;  2Y5P A;  4NZL B;  2K3U A;  4OZC A;  4WQO B;  2L0F A;  4G11 A;  1LO5 D;  2LRW A;  4RGT A;  3GB1 A;  4W9I A;  3SR6 A;  4DXG A;  4HWI B;  2AWT A;  1C78 A;  3WAO A;  2BS4 B;  1E9M A;  1KRH A;  4DXF A;  3PT2 B;  2AQ1 B;  2KXJ A;  4B0M A;  3MC8 A;  2DZJ A;  1WH3 A;  2KAJ A;  3PS6 A;  3QX1 A;  3DQV A;  2NTT A;  1FPY A;  2WDQ B;  3QAQ A;  4RH6 A;  2VRR B;  3AV8 A;  4DBG A;  3TEX A;  1SXT A;  1XCQ L;  2IY1 B;  4HCP B;  2SAK A;  2WP9 B;  4G3X B;  3Q2A C;  3GZN B;  2CHW A;  3L17 A;  2QDF A;  2ZVN A;  3V6E B;  1EM7 A;  1MPE A;  3QHT A;  3Q3M C;  2IO3 B;  1U4A A;  4ZRP A;  1WGH A;  2V9H A;  3TEZ A;  1QZE A;  4LNI A;  1WIA A;  1AYF A;  3W1S A;  1IBX B;  2FBW B;  1E7P B;  1KM7 A;  1MI0 A;  1XLN A;  3BYY B;  3Q8A A;  1WXQ A;  4KKI A;  4K7U A;  2KDB A;  2GBR A;  1D5Z C;  3J9C A;  2J53 A;  2V3P A;  1B1Z A;  1Q1O A;  3CF6 E;  1WGK A;  4NQL B;  3GE8 C;  1LQB A;  1L0Y B;  1AAR A;  1P7F A;  2W3S A;  3ZDT A;  5LNK 1;  2V1Y A;  2WX1 A;  3AE4 B;  4NAM A;  4LJP B;  3MTN B;  3ZNH B;  4NAW B;  2FNJ B;  4I6P A;  4IWO A;  1P0R A;  3BK2 A;  1TBE A;  1E10 A;  2N9L A;  4M0W B;  2HTH A;  1WZ0 A;  1NDD A;  3VXW A;  3ZIM A;  1FM0 D;  5BYQ A;  3EFU A;  1UZX B;  1QOB A;  5D94 A;  2KOX A;  3Q14 C;  3UQA A;  1JW9 D;  1XD3 B;  3CST A;  2RSU A;  3AEF B;  3RZW C;  2D10 A;  3X0W A;  2PMV A;  1WXM A;  2BWF A;  3KVF B;  4WIP A;  3KLS X;  2GLS A;  4NAW A;  5HI1 A;  4TSS A;  1JML A;  3W9C B;  2UYZ B;  4MDK E;  1RFA A;  3EUB 2;  4E3C A;  1TKY A;  4BKS A;  1Q0W B;  4GN1 A;  5HKH A;  2G45 B;  1D3Z A;  5BMG A;  2QMT A;  3ZYY X;  2OED A;  4B0E A;  4KGT A;  2J0J A;  2N7D A;  1CK1 A;  4GDK A;  4HKQ A;  2KQS A;  2D5G A;  3IBE A;  3C8Y A;  3VDZ A;  2MBQ A;  4K7W A;  4KIK A;  3PTF C;  2IYD B;  5GXG B;  1FXT B;  1PDX A;  1HXY D;  2N0S B;  3W1Y A;  2O2V B;  5KHQ A;  3PRE A;  4WWN A;  1V1O A;  1LGR A;  4GLS C;  4ARI A;  3C0R B;  2UU7 A;  4AJY B;  2QSD A;  1YJI A;  4BKS D;  3VR9 B;  5G5G A;  3ZJU A;  1F52 A;  1GNU A;  2Z59 B;  4REZ A;  2YEP F;  5JXV A;  1SF0 A;  3PGE A;  4LDT D;  3SD5 A;  3P42 A;  1EWY C;  2DX5 B;  3DVG Y;  3AE6 B;  5C23 A;  3RNG C;  3GS2 A;  3HM6 X;  2N7J A;  4UDU C;  4MGY E;  5AUI A;  2KNB A;  4AWJ A;  1NEK B;  1PFD A;  3S2A A;  3H6N A;  2BT6 A;  1UWM A;  3BK1 A;  1IUE A;  3N9Y C;  4HLE A;  1IYF A;  2D11 A;  3W2D A;  4YSY B;  4XC2 A;  4A55 A;  4IWP A;  4HDQ A;  4AQ7 A;  4NQK E;  5DPS A;  3VHT C;  1HE8 A;  4W9D A;  4JGH B;  1ROE A;  2FE8 A;  4LJO B;  4HPL B;  3R8B A;  2PEA A;  3OJ3 A;  4GDL B;  2D3C A;  2O6V A;  3U8Z A;  1YD8 U;  2K8C A;  1UD7 A;  4HEA 1;  4M8N A;  3WAM A;  1QF6 A;  1C4A A;  2BS2 B;  5DPT A;  4WAA A;  2XNA C;  2L3Z A;  3NVW A;  3VRA B;  4G0N B;  4MSQ B;  4FA6 A;  3TIX A;  2KDI A;  5IOI A;  2Y5C A;  2DEN B;  2ON8 A;  3C19 A;  4ZRK A;  4A20 A;  1TS3 A;  2KMM A;  1SSN A;  1Y56 A;  1P7E A;  1XEE A;  3M63 B;  4ITK A;  1FNW A;  1Z5S B;  4TUU A;  2MEK A;  2PTL A;  2ONQ A;  3AEE B;  2LGY A;  3R7Q A;  4ZHP A;  1PQS A;  2G4D B;  4C7Y A;  4DQO C;  5T8I A;  2N9K A;  1SBB B;  5G2N A;  2WXP A;  1AW7 A;  2KFK A;  2JUO A;  4HK2 A;  4JL9 A;  2BWE S;  3R3M A;  3B2G A;  2BVC A;  4YTM B;  4DHZ B;  1J7C A;  3U4E G;  1FMA D;  2KTR A;  3HVZ A;  1I4R A;  4YSZ B;  2KDM A;  4PYU A;  5LXH A;  3RCZ A;  4OVV A;  2PPH A;  2SEB D;  2IPK D;  3FIL B;  1V49 A;  3T3N A;  3KWV A;  4C00 A;  1N61 A;  1WSP A;  2MSE D;  4LNO A;  5TR5 A;  1GG3 A;  3GP7 A;  2N4F A;  3ZW3 A;  1UWX A;  2RMM A;  4P1C C;  1T0S C;  2I1K A;  3CIR B;  3Q3N C;  2CJO A;  2IGH A;  1J7A A;  1RYJ A;  3PO0 A;  2ZCB A;  2AQ3 B;  5AZG A;  3BWU D;  4PS3 A;  2KTR B;  2MBE A;  3D32 A;  2PVO D;  4E71 A;  1L6U A;  2BF8 B;  3JSV A;  2KWV B;  4QAY A;  1SE4 A;  2DYB A;  2D2Q A;  2LVO A;  2KD0 A;  3NS8 A;  2WLB A;  1ISN A;  4W9E A;  1EF1 A;  2WXO A;  3T8M A;  2KYW A;  3A9J B;  3AH7 A;  2ZEQ A;  3WAP A;  1E6E B;  1GAQ B;  2WXN A;  1PGA A;  3NRZ A;  2X38 A;  4DK5 A;  4WJQ A;  4C7Z A;  2JYT A;  3N1Y C;  2DBY A;  4IM0 A;  3ZXR A;  4XWT A;  4WAF A;  4RF0 A;  2EMT A;  3O65 B;  4GDK B;  1OGW A;  2WXK A;  3Q8C A;  2BTE A;  4TQ1 A;  4O1N A;  1FRD A;  2OHF A;  4JWU C;  3HUI A;  4P6V F;  5C2T B;  1L0V B;  1RLF A;  3WCQ A;  2YEP B;  1DOI A;  4HXD A;  3AE3 B;  4CO7 A;  3AN1 A;  2DZM A;  2ZJD A;  1N63 A;  3E9S A;  2DNF A;  3A1Q B;  1VDV A;  2PKO A;  4A6Q A;  1ENF A;  2L7R A;  3RT3 B;  4IC7 B;  1OEY A;  1WGY A;  4LDT B;  4JLC A;  1FO4 A;  2QEJ C;  1ZPS A;  3AE7 B;  3ZTD A;  2PE6 B;  1YQ4 B;  4K7S A;  3P4R B;  4F1S A;  1NI3 A;  2INN E;  3KYD D;  4XGA B;  1JQ4 A;  2W3R A;  2KHW B;  3CSF A;  2BW2 A;  2LD9 A;  3N3K B;  4OVZ A;  2XBB C;  3DHI C;  1ZUD 2;  1FCC C;  2G1E A;  2JWU A;  3U30 A;  1XLO A;  3DBL I;  2DYO A;  1WJ4 A;  2C7N B;  1A70 A;  1AN8 A;  2L83 A;  4ZRQ A;  4A9A A;  4YXD B;  5D2M B;  2MWS B;  3L54 A;  1RWS A;  2ACZ B;  3AMZ A;  1MHX A;  2NS5 A;  2QC8 A;  1V1P B;  2ZW0 A;  2N9X A;  1PGB A;  3VQI A;  2LWP A;  3TCA A;  2FIF A;  1DOY A;  2N1W A;  3MJW A;  1MG4 A;  3SU8 X;  1WY8 A;  1A5R A;  1EO6 A;  3AXC A;  2K6Q A;  2QIE B;  5CX3 A;  5EDS A;  1R4M B;  3SHQ A;  2C7H A;  2MBH A;  3QK0 A;  2INC C;  3PHW B;  1FD6 A;  3IVF A;  4N59 A;  2LGD A;  3H7P A;  1WX7 A;  2CJN A;  2V4L A;  4J3O D;  3L13 A;  1XF5 L;  3HM3 A;  2C60 A;  3APD A;  5EE1 A;  4HKZ E;  1KFY B;  1Z2M A;  3AEC B;  2WS3 B;  1X1M A;  1C76 A;  1WXA A;  3WIM A;  1KH0 A;  1Y8R C;  3APF A;  1KTK A;  3Q3O C;  2M17 A;  1DYQ A;  1VRA B;  2JX5 A;  1EU4 A;  1MVK A;  2GBJ A;  1XO3 A;  2JVC A;  2PVG C;  3L08 A;  2DYM A;  1SJH D;  3QWZ B;  2KN5 A;  1T3Q A;  2LUE A;  4PK1 A;  3IT4 B;  2Y5B B;  1T0Y A;  3TMP B;  1Q10 A;  1UGM A;  3R2T A;  3U7Z A;  2OOB B;  2HDE A;  3WAL A;  1OQR A;  4S17 A;  5DPW A;  2VH2 A;  2OJR A;  3VFK A;  3DBR B;  4C4V B;  4BZA A;  1TJE A;  4BBN F;  1TYG B;  2IGD A;  4I6N B;  4BOZ B;  1K53 A;  1TZ1 A;  4FBJ B;  3AEB B;  5EE3 A;  3UGB B;  3SFE B;  1EF5 A;  1MJD A;  2Z8L A;  4WJO A;  3ZQ4 A;  4ANX A;  4HJG E;  2WU5 B;  1F77 A;  2KWU B;  1C4C A;  1N5X A;  1TKE A;  3KW5 B;  3NS1 A;  4EZK A;  4OZA A;  1H8C A;  4HVB A;  4GDL A;  1J0G A;  3L16 A;  2IGG A;  4RCO A;  1RRB A;  1WE6 A;  2KJH B;  1HTO A;  1L4D B;  2PE9 A;  3H9D A;  5DPR A;  4OVU A;  4ZYN A;  1CJE A;  1GC6 A;  3UI3 A;  3VAW A;  1NVI D;  2ZNV B;  2ZPY A;  2O2V A;  4BFR A;  2IO1 B;  1SE3 A;  2LMC A;  2KMA A;  3P2B A;  1JRP A;  2RPQ A;  1YX5 B;  4DDI D;  4DDG D;  3H7P B;  3DDC B;  5EE9 A;  1TIF A;  3Q3J A;  3AE8 B;  3PPA A;  1EWC A;  5IAA C;  3QJZ A;  3NVV A;  2WXI A;  4YTP B;  4ZRJ A;  1F2R I;  4I6L B;  4EFO A;  3ZKJ C;  1WRD B;  4LNK A;  2RDB C;  4MSM B;  5LXI B;  4B95 A;  4WQM A;  1HZ6 A;  4RMA A;  4IM2 A;  2NR2 A;  1V2Y A;  1WGR A;  2KC2 A;  4K3B A;  2KMC A;  4ZHO A;  1ET6 A;  2GI9 A;  2VH1 A;  1AWD A;  4ZYS A;  5CHF A;  4KDI C;  3AE5 B;  1KLU D;  1YIW A;  3AM9 A;  3APC A;  2HD5 B;  2XK5 A;  1XLP A;  1TS4 A;  3HVD A;  5LLI A;  5JHA A;  3ZGZ A;  2NBV B;  2IBI B;  5IO9 A;  4MJS B;  2ZW1 A;  3R66 C;  4EUT A;  2R2O A;  5AEK B;  4CHK A;  1GC7 A;  2AL3 A;  2BKR B;  2WX0 A;  1V81 A;  3ETR A;  3B0A A;  4XE0 A;  1VZ8 A;  5FR3 A;  2MJD A;  2KLG A;  3ML8 A;  1ACC A;  5E6O A;  2KTF A;  4WWM A;  4LNN A;  3RMK C;  1IPG A;  4KV2 A;  3IHP C;  4IM3 A;  2KQ4 X;  2GBM A;  5MPO A;  4OW0 A;  3I5J C;  2QJL A;  2LXA A;  2FUH B;  2KK8 A;  3RNE C;  2WDV B;  3Q8B A;  4YTN B;  1P98 A;  1UGJ A;  1I4G A;  1OFF A;  2PIA A;  2WWZ A;  4YT0 B;  1LXD A;  2MJ3 A;  3NY5 A;  2M19 A;  1JWA D;  1R4N B;  3X23 A;  3AU5 A;  2WXM A; 
#chains in the Genus database with same CATH homology
 3HIZ A;  1V86 A;  2J7Q B;  2PJH A;  4J6I A;  1WF9 A;  1RAX A;  2IY0 B;  4A3O A;  3IFW B;  4E71 A;  2BF8 B;  3JSV A;  3TJP A;  3UIO B;  2KWV B;  2BGF A;  1Q5W B;  2KJ6 A;  2DYB A;  2D2Q A;  3V62 A;  2LVO A;  4ICU A;  2KKC A;  2KD0 A;  3NS8 A;  3UF8 A;  1ISN A;  1WJU A;  4W9E A;  1EF1 A;  2RD0 A;  3M95 A;  2JXX A;  2DZI A;  3PVL A;  3T8M A;  1E8Y A;  1WGD A;  4TKN A;  3A9J B;  3QQ8 B;  2ZEQ A;  1UEL A;  4NNJ B;  3DBH I;  3DVG X;  4K81 A;  3VH3 B;  3WAP A;  2MQJ A;  2M4N A;  3ZNZ B;  4GB9 A;  2O6V D;  3JYU A;  3EHV A;  4IUM B;  4RM9 A;  3AU4 A;  4DK5 A;  4P7I A;  3WAN A;  3V60 A;  4WJQ A;  1J8C A;  1WI0 A;  1KLV A;  4FLH A;  4IM0 A;  1YX6 B;  1UH6 A;  4ASW C;  1UBI A;  1WR6 E;  4BVU C;  4W9F A;  5BO4 B;  2NPT A;  2FID A;  2WYQ A;  5GMV A;  3L0W B;  2DZK A;  2YLM A;  2K39 A;  2L05 A;  2EMT A;  2RR9 A;  3WA0 A;  5FR6 A;  3O65 B;  4GDK B;  3ZNG C;  1P9D U;  1E7V A;  1L7Y A;  1OGW A;  4GU2 A;  2B3A A;  1VD2 A;  2FCN A;  1NI2 A;  1LM8 B;  1OQY A;  3W1S C;  4II3 B;  1F9J A;  2CHX A;  2LI5 A;  2N7E A;  4PS7 A;  4TQ1 A;  4WQO B;  3RYT A;  2L0F A;  2XEW A;  4G11 A;  2LRW A;  4ANW A;  2DAJ A;  4DWF A;  1WXS A;  1RLF A;  1XT9 B;  3A1Q A;  3K9P B;  3NZU A;  4W9I A;  2LVQ A;  4HWI B;  4HXD A;  1BT0 A;  2AWT A;  2UWQ A;  3KH0 A;  4YL8 A;  4KZ0 A;  4HCN B;  4CO7 A;  3WAO A;  3DBR I;  2CR5 A;  1YQB A;  2DZM A;  3OAW A;  3BIN A;  2ZJD A;  3OLM D;  3PT2 B;  3QA8 A;  3A1Q B;  2CS4 A;  2MBO A;  4X57 B;  2KXJ A;  1I35 A;  1V80 A;  5D7G A;  2JZ3 B;  2L7R A;  2DZJ A;  4E74 A;  1WH3 A;  1WMH B;  3RT3 B;  4IC7 B;  4LCD E;  1OEY A;  3PS6 A;  1WGY A;  3QX1 A;  4LDT B;  2FCM A;  3DQV A;  4JLC A;  3H7S A;  4AP4 C;  2KDF B;  1E90 A;  4BKT A;  5JHB A;  3QAQ A;  3K9O B;  4MEM A;  3DCG A;  2KVR A;  2KFJ A;  2VRR B;  4DBG A;  4GIV A;  4EZJ A;  2LZ6 A;  4PYZ A;  2IY1 B;  2PE6 B;  4MJS A;  3ZTD A;  4K7S A;  4HCP B;  1R4N I;  2MW5 A;  4F1S A;  2JF5 A;  3KYD D;  4G3X B;  2I1J A;  2KO3 A;  3UIP B;  3A4S C;  5JZE B;  2KHW B;  3CSF A;  1V5T A;  5KHO A;  3EC8 A;  1V9J A;  4WJP A;  2CHW A;  3L17 A;  4W9G A;  2ZVN A;  2LD9 A;  3N3K B;  2CU1 A;  3V6E B;  4FHJ A;  2XBB C;  3QHT A;  2GMI C;  2IZV B;  1WJN A;  2IO3 B;  1U4A A;  1WGH A;  2K1F A;  4KIK B;  1QZE A;  2KJR A;  1WIA A;  3U30 A;  3W1S A;  5J2R A;  1KJT A;  3DBL I;  2DYO A;  1WJ4 A;  2C7N B;  3PZD A;  1KM7 A;  2MBB B;  1OTR B;  3KUZ A;  4W9J A;  4FJV B;  3EEC A;  3Q3F A;  3RUI B;  3I3T B;  4B9K A;  5D2M B;  2MWS B;  3L54 A;  3PRP B;  4A3P A;  4K7U A;  4WJN A;  2KDB A;  2GBR A;  2LAS A;  1GUA B;  3KUC B;  4IWQ A;  2NS5 A;  1SE9 A;  1P1A A;  2W9N A;  3VTW A;  1JRU A;  2RGF A;  2N9X A;  1Q1O A;  5L95 C;  3CF6 E;  2DHZ A;  3VQI A;  4NQL B;  2JPH A;  2LWP A;  1LQB A;  3TCA A;  2FIF A;  2LRU A;  2L00 B;  1AAR A;  2G3Q B;  2N1W A;  3MJW A;  1SIF A;  3SU8 X;  1WY8 A;  1ZGU B;  1A5R A;  1EO6 A;  1WYW B;  3ZDT A;  3AXC A;  2K6Q A;  3GOE A;  5CX3 A;  5EDS A;  4FHK A;  2D3G A;  2GBK A;  3BY4 B;  3SHQ A;  2V1Y A;  2C7H A;  2EMS A;  2WX1 A;  2KQ7 A;  2MBH A;  1UBQ A;  2L8J A;  4G50 A;  4FAD A;  3QK0 A;  2REX A;  1V5O A;  4LJP B;  3MTN B;  4HPM B;  3RUL A;  3ZNH B;  2FNJ B;  3AUL A;  4GMV A;  1P3Q U;  4NAW B;  3PHW B;  4AOF A;  2MRP A;  4I6P A;  4IWO A;  1P0R A;  3N32 A;  3IVF A;  3UQB A;  2LGD A;  1TBE A;  3H7P A;  4M0W B;  2HTH A;  1WX7 A;  1WZ0 A;  1NDD A;  2MX2 A;  2V4L A;  3OJ4 B;  3VXW A;  4EEW A;  3L13 A;  3ZIM A;  1WR1 A;  4KSK C;  3EFU A;  2J0K A;  2C5L C;  4F7Z A;  1WX8 A;  1EUV B;  3HM3 A;  1UZX B;  2C60 A;  3APD A;  3VUW A;  5D94 A;  2KOX A;  3HK0 A;  3UQA A;  3SDL C;  1Z2M A;  4GGQ A;  1XD3 B;  2CHZ A;  2HJ8 A;  3A9K B;  3CST A;  1WE7 A;  2RSU A;  3ONS A;  1X1M A;  2JRH A;  1WXA A;  4MEL A;  3WIM A;  4DHZ E;  2JT4 B;  3DVN U;  1ZW7 A;  3RZW C;  1Y8R C;  2D10 A;  3ZLZ A;  2KDE B;  3APF A;  3X0W A;  3ZTC A;  3TL5 A;  1E8Z A;  2WDT B;  1WXM A;  2M17 A;  3B08 A;  2BWF A;  2L76 A;  3KVF B;  3ECI A;  4FN2 A;  2M1M A;  5CHV C;  1C1Y B;  1K8R B;  4NAW A;  3ML9 A;  3NOB A;  1WJ6 A;  2GBJ A;  4TQ0 A;  2JVC A;  3L08 A;  2UYZ B;  3PRM B;  4MDK E;  1RFA A;  2DYM A;  2FCQ A;  3CMM B;  3H1U A;  4E3C A;  3QWZ B;  5J18 A;  2KN5 A;  2LUE A;  5CTR C;  5AZF A;  3R7R A;  3JVZ X;  4BKS A;  1Q0W B;  4GN1 A;  2Y5B B;  5HKH A;  2G45 B;  1D3Z A;  1T0Y A;  4EZL A;  4DHJ D;  2G4S A;  1CMX B;  3TMP B;  5CHW A;  1UGM A;  4AJW A;  3KUD B;  2OOB B;  2J0J A;  2N7D A;  3WAL A;  4GDK A;  2KQS A;  2KX0 A;  3V61 A;  3LJ3 A;  3IBE A;  3VDZ A;  2MBQ A;  1OEY J;  4K7W A;  4KIK A;  5DPW A;  4KDL B;  1ZKH A;  3PTF C;  2IYD B;  5J17 A;  2OJR A;  1WX9 A;  3VFK A;  1FXT B;  2Z0E B;  3PHX B;  3VUX A;  2NVU I;  4BBN F;  4BOZ B;  4I6N B;  1L2N A;  4WWP A;  2KZR A;  2M0X A;  4DHJ B;  3W1Y A;  2ZCC A;  2O2V B;  1TZ1 A;  3VTV A;  2KX3 A;  4FBJ B;  5KHQ A;  3PRZ A;  1E8W A;  2N9E B;  3PRE A;  4JIO U;  3UGB B;  1H4R A;  1J19 A;  4WWN A;  3GZN I;  3M62 B;  3ZVV A;  3B1L X;  4MGZ E;  1EF5 A;  3C0R B;  3DVN V;  1MG8 A;  2FAZ A;  1R4M I;  4WJO A;  4ANX A;  4AJY B;  4GSW A;  4BKG A;  5IA7 A;  1KOT A;  4BKS D;  2AEH A;  2KWU B;  4DXA B;  2AYO B;  2KWC A;  2GOW A;  3ZO5 B;  3KW5 B;  4EZK A;  1GNU A;  4KZC A;  1WMH A;  4W9K A;  2MCN B;  1H8C A;  4BOS C;  4HVB A;  3U7D A;  2Z59 B;  3VTU A;  3VH4 B;  2A5U A;  4GDL A;  5D6J B;  1J0G A;  2BYE A;  3L16 A;  3ZRC A;  4M8M A;  3LDZ E;  4HJK A;  1RRB A;  1WE6 A;  4ZDV A;  3PGE A;  4LDT D;  3ALB A;  3SD5 A;  2KJH B;  1V6E A;  2DX5 B;  3DVG Y;  4W9C A;  5C23 A;  3HM6 X;  4GOC A;  3ZRF A;  2PE9 A;  3H9D A;  2NBU A;  5DPR A;  4OVU A;  4ZYN A;  1XQQ A;  1YJ1 A;  4MGY E;  1GC6 A;  3DBS A;  4FUL A;  4WWO A;  2KNB A;  4ANU A;  4AWJ A;  3VAW A;  3S2A A;  2FCS A;  3H6N A;  2ZPN A;  2ZNV B;  3N30 A;  2ZNV C;  2GBN A;  4HLE A;  1IYF A;  1TTN A;  2K6D B;  1GJZ A;  4ZRI A;  2D11 A;  5E6P A;  2ZPY A;  2O2V A;  4BFR A;  2EKE C;  3ZNI D;  3ZDM C;  4XC2 A;  2IO1 B;  2K25 A;  4TV3 A;  2JRI B;  2JY6 A;  2ZVO A;  4IWP A;  1SGH A;  4HDQ A;  2KMA A;  4NQK E;  5DPS A;  3VHT C;  2CKH B;  1HE8 A;  2V3S A;  2Z0D B;  4MGI E;  4W9D A;  4JGH B;  3PLV A;  3P2B A;  2RPQ A;  2YVC A;  1YX5 B;  4DDI D;  3MHS D;  4LJO B;  4K1R B;  1S1Q B;  3KYC D;  4DDG D;  4HPL B;  4ANV A;  1G6J A;  4NPN A;  3H7P B;  2PEA A;  3DDC B;  4HDO A;  3OJ3 A;  2J0M A;  4GDL B;  3Q3J A;  4F8C B;  2LGX A;  2O6V A;  3U8Z A;  5L83 A;  1YD8 U;  2K8C A;  3PPA A;  1UD7 A;  4M8N A;  4W9L A;  5IAA C;  3WAM A;  1WGG A;  3QJZ A;  1IP9 A;  5DPT A;  4WAA A;  2L3Z A;  1WM2 A;  4BBN C;  5G55 A;  4GXB A;  4G0N B;  4MSQ B;  4IW0 A;  4ZRJ A;  4FA6 A;  4II2 B;  3QAR A;  3TIX A;  1E7U A;  2KDI A;  4I6L B;  4EFO A;  3A9J A;  3ZKJ C;  2K8H A;  4B6W A;  2BKF A;  1WRD B;  2DEN B;  2AL6 A;  1I42 A;  4MSM B;  4ZRK A;  4A20 A;  3HHM A;  5LXI B;  4B95 A;  5DCN A;  2ZZP B;  1NBF C;  2LJ5 A;  3M63 B;  1WM3 A;  2KAN A;  1Z5S B;  4RMA A;  4IM2 A;  2NR2 A;  4TUU A;  1V2Y A;  2MP2 B;  1M94 A;  5AZH A;  1WGR A;  3QC8 B;  2LVP A;  2JZZ A;  3V6C B;  4XX5 A;  4URK A;  3JW0 X;  2KC2 A;  2HE7 A;  2KMC A;  2LGY A;  3R7Q A;  1WXV A;  5E6N A;  3VVW B;  1PQS A;  3JSV B;  2D07 B;  5CHF A;  4EKU A;  5JH5 C;  4KDI C;  2G4D B;  1YIW A;  2NBW B;  2M8S A;  3APC A;  2HD5 B;  2XK5 A;  3QIJ A;  3VUY A;  5LLI A;  5C1Z A;  4CYE A;  5G2N A;  5JHA A;  3A4R A;  2IO2 B;  3NHE B;  2NBV B;  2IBI B;  4KVG B;  4MJS B;  2A4Z A;  2JUO A;  2KFK A;  4AUQ C;  4HK2 A;  2N1V A;  2BWE S;  2IO0 B;  3M3J A;  3R3M A;  4JL9 A;  4KSL C;  3R66 C;  4MH0 E;  2MA9 B;  4NJ6 A;  4XZ4 A;  3PV1 A;  4EUT A;  4NY0 A;  2O6V B;  2R2O A;  5AEK B;  4CHK A;  4DHZ B;  4W9H A;  1GC7 A;  2C7M B;  4RM8 A;  2BPS A;  2AL3 A;  2KTR A;  2BKR B;  3DOW A;  4PS8 A;  2WX0 A;  1V81 A;  4MGK E;  3B0A A;  4PYU A;  5LXH A;  3RCZ A;  4OVV A;  2KFK B;  3PLU A;  2KLG A;  3A33 B;  2PPH A;  1TGZ B;  3ML8 A;  5E6O A;  2KLC A;  1V49 A;  2KTF A;  4FJY A;  3UIN B;  3T9L A;  2QHO A;  1WZ3 A;  3AI5 A;  1IPG A;  4FJZ A;  2ASQ A;  2MP2 A;  3A9K A;  3TBL D;  2MSE D;  4KV2 A;  4IG7 B;  1VCB A;  3IHP C;  2NCN A;  5TR5 A;  4IM3 A;  1GG3 A;  2MLB A;  4NJ7 A;  2GBM A;  2N4F A;  3ZW3 A;  1LFD A;  3RD2 A;  2L0T A;  4MM3 A;  2BYV E;  3RZF A;  2LXA A;  2FUH B;  2KK8 A;  4EOY A;  2I1K A;  3IG3 A;  1S3S G;  4JQW C;  2R2Q A;  1C3T A;  4ICV A;  2XK5 B;  1P98 A;  3ZUN A;  2JWZ A;  2ZCB A;  1E8X A;  2DAF A;  2NPT B;  3PSE B;  2WWZ A;  1LXD A;  2KC1 A;  1E5W A;  5AZG A;  3NY5 A;  4N9F 4;  4PS3 A;  2C9W B;  2KTR B;  3AU5 A;  3QCA A;  2MBE A;  2K8B A;  3ENE A;  3X23 A;  2BYF A;  3D32 A;  3L10 B;  3NZS A;  1WFY A;  3DPD A;  2N9P C;  2LXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...