3QCAA

Crystal structure of faf1 ubx domain in complex with p97/vcp n domain reveals the conserved fcisp touch-turn motif of ubx domain suffering conformational change
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
80
structure length
80
Chain Sequence
EPVSKLRIRTPSGEFLERRFLASNKLQIVFDFVASKGFPWDEYKLLSTFPRRDVTQLDPNKSLLEVKLFPQETLFLEAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords FAS-associated factor 1
publication title Crystal structure of human FAF1 UBX domain reveals a novel FcisP touch-turn motif in p97/VCP-binding region
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 80
sequence length 80
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-01-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3qcaA00
3M3JA 1WMHB 2O2VA 1V2YA 2G4SA 1V5TA 3EHVA 4BKGA 1WY8A 2ZCCA 3IHPC 3ZTCA 3LDZE 3A9JB 4W9FA 4PYZA 2XK5A 4E74A 3R3MA 3GOEA 4IM3A 4G11A 5DPSA 4KV2A 4HWIB 4DDID 3WIMA 2LGYA 1T0YA 2LD9A 5E6PA 2AYOB 2KTFA 2MBEA 4FBJB 2DYBA 1WGYA 2N1WA 4ZRJA 3M62B 3UQAA 4MDKE 4I6PA 2KDFB 2K39A 2N9XA 2RD0A 4MGIE 4CO7A 2IO0B 1EO6A 1HE8A 4G0NB 4MSMB 4K1RB 1U4AA 3RT3B 2CKHB 2GBRA 3DOWA 4A3PA 2K25A 4W9CA 1LXDA 3PGEA 1A5RA 3PLUA 4EOYA 1NBFC 4RMAA 4TKNA 2WDTB 4W9EA 3H7PB 3RUIB 2FCMA 1WIAA 2NBVB 3A1QB 3CSFA 4FHJA 2L00B 5BO4B 2KFKA 2FIDA 2KK8A 3KYDD 2FCSA 2JT4B 4HLEA 5J18A 5AZGA 1RRBA 1WR1A 4FJZA 5LLIA 4F1SA 1SGHA 2MA9B 2M1MA 3ZTDA 1OQYA 3A4SC 4FLHA 4M8NA 4DWFA 4TQ0A 3P2BA 2DHZA 4ICUA 5LXIB 4II3B 1Q1OA 2JUOA 3A9KB 4NAWB 5CTRC 2MW5A 4DXAB 4TQ1A 4WWPA 3V62A 4ZRKA 2DAJA 4LDTB 2W9NA 4MJSB 5CHFA 2O6VD 3PS6A 4W9KA 2Z59B 1E5WA 3PRZA 4EUTA 3X0WA 3EC8A 2D11A 3GZNI 2OOBB 3QC8B 1K8RB 1WI0A 5D94A 3UIOB 4HXDA 2NCNA 3T9LA 4DHZB 2DENB 3W1SC 2NBWB 3KH0A 3VUYA 3PT2B 4NQKE 2IBIB 2K8HA 2HTHA 3DBSA 4KVGB 4F8CB 2GBJA 4P7IA 1UBIA 2N1VA 3JSVB 2FAZA 4W9LA 3QK0A 4CYEA 1E90A 4A20A 1WGDA 2D10A 2JZ3B 4MSQB 4II2B 1L7YA 3L0WB 4G3XB 4JLCA 3ZRFA 4NJ7A 2KX0A 3B1LX 3H9DA 4GDLB 3ZLZA 3PSEB 2DZJA 4K7WA 3RULA 2NR2A 3KW5B 5L83A 4KSLC 2LVQA 2D07B 5EDSA 3QA8A 1ISNA 4HJKA 2HD5B 1GNUA 3R7RA 2C7NB 2FIFA 3QIJA 4KSKC 5D6JB 3VTUA 2BWFA 4LJOB 2WWZA 3MTNB 4XC2A 1R4NI 4GIVA 3WAPA 3UQBA 4WWOA 1WX9A 3AU4A 4DBGA 3BINA 2KJ6A 4WJPA 3OJ3A 1V6EA 3QQ8B 4I6NB 2C9WB 3HK0A 2ZCBA 1WX8A 2HE7A 3I3TB 3ZKJC 2REXA 1OGWA 2LXAA 1EF5A 2XBBC 3AI5A 2PPHA 4BFRA 1C1YB 4PS8A 4ANWA 1WJ6A 3DVNV 4BKTA 4RM8A 4JL9A 1V9JA 4PS3A 2NPTA 2KDBA 4WJOA 5J17A 3VXWA 2G3QB 1WXAA 2MBQA 3PPAA 1WF9A 1WGRA 3CMMB 4HDQA 2ZVNA 3TCAA 1I42A 1L2NA 1VD2A 4URKA 2KHWB 1FXTB 1J8CA 2V3SA 4WJNA 1E8WA 3KUZA 3ZDTA 1J0GA 1S1QB 2C7MB 3NHEB 3RZFA 1G6JA 1IP9A 5CHVC 2DZIA 2K6QA 3RD2A 1RFAA 4AJYB 2M0XA 2KLCA 3DPDA 4GOCA 2KXJA 2N9EB 2JWZA 1WXVA 4LCDE 1H8CA 3NY5A 4OVVA 3D32A 3S2AA 2FNJB 4F7ZA 1P9DU 1WJUA 2RR9A 3ML9A 1XD3B 3NOBA 2J0MA 4W9JA 1RAXA 3DQVA 2BKFA 2C5LC 1LQBA 5DPTA 4EZJA 1D3ZA 3VTVA 2LGXA 4PS7A 5DCNA 2MP2B 5DPWA 3PRMB 3LJ3A 2L0FA 4IW0A 1KM7A 3RCZA 2DZMA 2VRRB 2RGFA 4N9F4 3ZNID 3HIZA 4AWJA 4E71A 3VH4B 2EMSA 3C0RB 2O6VA 2MLBA 3JYUA 4EKUA 1RLFA 1WMHA 3H6NA 2KO3A 4X57B 2GOWA 2KANA 2KFJA 3BY4B 2BYFA 3APCA 5E6OA 1YX5B 4GDKB 4B9KA 3A9JA 1AARA 4MGKE 2J0KA 2YVCA 3DVGY 3VVWB 4JGHB 1QZEA 4FJYA 1ZW7A 3NZUA 4IM2A 1WZ0A 1P1AA 4ANXA 1S3SG 3TMPB 2Z0EB 2LGDA 4BVUC 1E7UA 3VUXA 1KJTA 2AWTA 2PEAA 2RPQA 5E6NA 4BOZB 2R2OA 2KQSA 1KLVA 4CHKA 1KOTA 2ZPNA 3DBLI 2JZZA 3ZRCA 2MSED 3EFUA 4IWPA 1OEYJ 4DHJD 4EFOA 5J2RA 5DPRA 4DDGD 3ZIMA 2LI5A 2PJHA 5JZEB 2K6DB 2N7DA 3VHTC 3M63B 5IAAC 2WX1A 3B08A 3X23A 1UELA 3N3KB 3H7PA 1YQBA 3JVZX 4HDOA 3WALA 1Z2MA 3K9OB 3HM6X 4HCPB 4B6WA 4DK5A 2MBBB 1YJ1A 3R66C 1OEYA 3AXCA 4E3CA 3HHMA 2G45B 3UIPB 1SE9A 4TUUA 2JPHA 2LJ5A 3B0AA 2V1YA 2EKEC 1LM8B 4GN1A 1WJNA 2MQJA 4AJWA 3A9KA 3EECA 3QAQA 3KUCB 4NAWA 2LRWA 2CR5A 3Q3JA 1E8XA 2R2QA 1UH6A 4MEMA 2FUHB 2KTRA 5D7GA 1P0RA 3WAOA 2LASA 2XEWA 1YIWA 4XZ4A 4MJSA 3R7QA 3L13A 1NDDA 3SDLC 3WANA 4EZLA 2G4DB 2KZRA 2D3GA 1UD7A 3QHTA 3TL5A 2YLMA 4KZCA 2NS5A 4JIOU 5CHWA 2PE9A 3WAMA 2ZZPB 4W9GA 3ECIA 1MG8A 3W1YA 4KIKB 2MCNB 1X1MA 3L08A 1E8YA 4KDLB 1XQQA 3MJWA 2CHZA 2PE6B 3ZUNA 3L10B 1EUVB 1GC6A 3RZWC 3APDA 3JSVA 3RYTA 4GSWA 2IO2B 2JRIB 3PHXB 3AULA 2KOXA 4HK2A 4M8MA 4K7SA 3TBLD 4ANUA 2I1JA 3A33B 2WX0A 1J19A 2KMCA 1V81A 1Z5SB 2DZKA 2NPTB 4GDLA 4IM0A 2KDIA 2CHWA 2C7HA 3DCGA 3IFWB 4WAAA 2KLGA 2RSUA 3KVFB 3QCAA 3KUDB 1JRUA 1V49A 1XT9B 4WQOB 3PLVA 2MWSB 4ICVA 2M17A 1NI2A 5C1ZA 3ONSA 2GBMA 4FA6A 4LDTD 4BBNC 2KDEB 4MGYE 2DYOA 2O2VB 3ML8A 3V60A 3DBRI 2IO1B 2JY6A 2XK5B 4GB9A 3SHQA 1C3TA 3PRPB 5D2MB 2Z0DB 4OVUA 1WGGA 1WXSA 2KD0A 3MHSD 1M94A 3H7SA 3VTWA 2D2QA 2L3ZA 4GU2A 2HJ8A 4TV3A 2CS4A 1F9JA 3WA0A 5FR6A 4IWOA 4BKSA 3PV1A 2GBKA 1P3QU 2L76A 4I6LB 1WE7A 2KJRA 4BOSC 2IO3B 1I35A 3M95A 2O6VB 5JHAA 4MELA 1GUAB 3V6CB 1IPGA 1ZGUB 3U8ZA 4NQLB 1YX6B 3OJ4B 4MH0E 3V6EB 3ZNZB 4HPMB 5CX3A 2C60A 2EMTA 2KWCA 2KNBA 3PREA 3UF8A 2IYDB 2MBHA 4HPLB 2JRHA 5JHBA 3U30A 5C23A 2KN5A 3OAWA 3VQIA 2MBOA 2KWVB 1LFDA 2KFKB 4ASWC 4MM3A 2KJHB 2FCNA 2BPSA 3W1SA 1Y8RC 3IVFA 3DDCB 5IA7A 1V86A 4ANVA 4NNJB 1WFYA 4J6IA 3VFKA 2WYQA 3N30A 5KHOA 1UZXB 1SIFA 1V5OA 2BWES 2JVCA 2MP2A 1WRDB 4HCNB 4ZRIA 2KC2A 2AL3A 2L0TA 4ZYNA 2A5UA 4MGZE 1EF1A 4BKSD 2ZVOA 2CU1A 4AUQC 2NBUA 2JF5A 4DHZE 1CMXB 3CF6E 2J0JA 3UGBB 2N9PC 2ZNVC 3VAWA 3ZNGC 1WM2A 2AL6A 1GC7A 3AU5A 2MRPA 1TZ1A 2ASQA 2L05A 3H1UA 4IWQA 4W9HA 2DAFA 4GDKA 4B95A 3ZDMC 3APFA 2K1FA 2BF8B 5AZHA 4G50A 2N7EA 5LXHA 1WZ3A 1ZKHA 3A1QA 3ZNHB 4RM9A 3Q3FA 4W9DA 4WWNA 4XX5A 1WXMA 5AEKB 2KMAA 4W9IA 1WYWB 2BGFA 3L54A 4FHKA 4FULA 4FN2A 3DVNU 5TR5A 2LUEA 4YL8A 3N32A 3PZDA 2UWQA 4ZDVA 3V61A 1VCBA 3K9PB 2BYVE 2KTRB 2GMIC 3QARA 3PVLA 3U7DA 4EEWA 2LRUA 1H4RA 3L17A 2OJRA 3SD5A 3UINB 1P98A 1YD8U 2L7RA 2LWPA 3IG3A 4WJQA 4AP4C 1UGMA 4M0WB 2FCQA 2IY1B 2LVOA 3ZVVA 3L16A 3DVGX 2I1KA 2KVRA 1WJ4A 3NS8A 1TTNA 2LXCA 2GBNA 3KYCD 4FJVB 3IBEA 2M8SA 4BBNF 4KDIC 2DX5B 2ZPYA 2B3AA 3PHWB 3O65B 1UBQA 2KWUB 3HM3A 2KQ7A 2V4LA 3VUWA 3ZW3A 5HKHA 4FADA 1V80A 4NJ6A 1E8ZA 4IG7B 1WGHA 2N4FA 2NVUI 4K7UA 2AEHA 3QX1A 4EZKA 1WH3A 1WE6A 2BYEA 4NPNA 2A4ZA 3DBHI 3TJPA 3VH3B 4GGQA 5AZFA 1GJZA 2Y5BB 3OLMD 4LJPB 3ALBA 2KX3A 2IZVB 4GXBA 3CSTA 4IC7B 2MX2A 1TBEA 2IY0B 4KZ0A 4NY0A 3A4RA 2KC1A 2BKRB 3VDZA 2K8CA 2ZNVB 2QHOA 3SU8X 4KIKA 1Q5WB 5JH5C 1E7VA 1TGZB 2ZJDA 3QWZB 1BT0A 4PYUA 1OTRB 3JW0X 5L95C 4K81A 1R4MI 1PQSA 3NZSA 5G2NA 2JXXA 5GMVA 3T8MA 3TIXA 3ENEA 1WM3A 2CHXA 2M4NA 2UYZB 2L8JA 4IUMB 2DYMA 2LVPA 4A3OA 4DHJB 1GG3A 5KHQA 3PTFC 2J7QB 4GMVA 4JQWC 2KKCA 2K8BA 1WR6E 1WX7A 4HVBA 3QJZA 1IYFA 4AOFA 3ZO5B 1Q0WB 2LZ6A 5G55A 2ZEQA
chains in the Genus database with same CATH superfamily
3M3JA 4REZA 2IGGA 2O2VA 1LO5D 1N63A 4XDCA 2G4SA 1ZDVA 3EHVA 1HQRD 1PGBA 3IHPC 3SFDB 4W9FA 3MFGA 3CIRB 3R3MA 4L23A 5MPOA 5G5HA 5DPSA 4KV2A 4DDID 3WIMA 2LGYA 2LD9A 1IGDA 4RCOA 2WU2B 4UDUC 3AE8B 2N1WA 4LTUA 4BZAA 1HEZE 3MHZA 2N9XA 2RD0A 4MGIE 4RGTA 4Q2JA 4G0NB 4K1RB 1U4AA 2CKHB 1ESFA 2GBRA 2GI9A 4A3PA 3PGEA 5BYRA 2KFKA 3KYDD 2JT4B 1YQ4B 4FJZA 2M1MA 4XWWA 4FLHA 4DWFA 4TQ0A 2DHZA 2MH7A 5LXIB 4BAXA 4II3B 1ENFA 1UGJA 4ZYSA 5BMIA 1ZUD2 3P42A 4MJSB 2O6VD 4C4VB 3EC8A 3GZNI 1ROEA 5D94A 4HXDA 2NCNA 1KLUD 2NBWB 1J7BA 2HTHA 3DBSA 4PT5A 1E90A 3AE6B 1F2RI 2D10A 4HJGE 2D5GA 3B1LX 3C19A 5HHDG 3ZLZA 1TS3A 1Q10A 2D07B 5EDSA 3BZDB 3QA8A 3NVZA 4HJKA 3R7RA 2BWFA 3NRZA 4XC2A 3I57A 1EU4A 4YSXB 3BINA 4WJPA 3ZXVA 2G9HD 4I6NB 3HK0A 3DHGC 1XCQL 3NG0A 3I3TB 3V3XA 2LXAA 3AI5A 2PPHA 1C1YB 1WJ6A 2HDEA 1I4QA 2E3TA 4RM8A 2KDBA 2XNAC 1B9RA 3VXWA 1WXAA 3TCAA 2BS4B 1WWTA 4K3BA 1VD2A 4D2KA 3Q6BA 2MEKA 2WDVB 1E8WA 2J42A 5D3DA 5CHVC 4AJYB 3AM9A 4M00A 2KXJA 2N9EB 2JWZA 3S2AA 1B1ZA 2FNJB 4F7ZA 2RR9A 4W9JA 5DPTA 1LQBA 4EZJA 3VTVA 2LGXA 4PS7A 3BK2A 1MVKA 3PRMB 4XYCA 1V8CA 4C00A 4NZLB 1WMHA 5IP4D 4X57B 2GOWA 2BYFA 3APCA 1FNUA 1R7SA 1YX5B 3AE4B 4MGKE 3VVWB 3AE3B 1UF0A 1TYGB 3VUXA 1KJTA 2AWTA 2RPQA 5E6NA 4KGSA 2WXRA 3DBLI 1UWMA 4DHJD 5J2RA 3ZXRA 1BUIC 1OFFA 3M63B 1F1HA 1K52A 3U4EG 4YTMB 2QMTA 3N3KB 3H7PA 4ZOHC 3JVZX 1SB3C 2PMVA 3R66C 1OEYA 1RWSA 4E3CA 1SE9A 2JPHA 3W5VB 2KN4A 2WXJA 2BS3B 2EKEC 1LM8B 2B76B 2INNE 4NAWA 3QAQA 2LRWA 2CR5A 4MEMA 2KTRA 2WU5B 1P0RA 3FAHA 3WAOA 1SIJA 4XZ4A 3Q3MC 2QEJC 3AMZA 3WANA 2D3GA 1UD7A 3TL5A 1J7AA 5CHWA 2PE9A 3WAMA 2OHFA 2LHDA 1MG8A 4JWSC 3L08A 1XXGA 1XQQA 1ZOYB 3AE7B 1GC6A 4H2AA 4N58A 3APDA 3JSVA 5EE3A 2IO2B 2JRIB 5IN7A 4ARIA 4HK2A 3A33B 2RPVA 4DXGA 2WX0A 2DZKA 1D5MC 3IFWB 1JRUA 1V49A 2MWSB 2M17A 3DHIC 1XLQA 2Y5PA 5JXVA 4MGYE 3EFCA 2IO1B 4YTNB 3ZJUA 5BMHA 2KD0A 2J4XA 1STEA 3MHSD 1N6ZA 3VTWA 2D2QA 1A70A 2L3ZA 5FR6A 4BKSA 2PTLA 3GP7A 4BOSC 2IO3B 1JCKB 3V6CB 3T3OA 3N1YC 3V6EB 3ZNZB 5CX3A 3PREA 3UF8A 2IYDB 2JRHA 2KN5A 3OAWA 4A6QA 3VQIA 2KWVB 4MM3A 3Q14C 2W3RA 3IVFA 1V86A 1DOXA 1WFYA 4LLGM 1NI3A 2R61A 1V5OA 1FM0D 1SIFA 1UZXB 4RGMA 4ZRIA 2RMMA 2A5UA 1EF1A 2ZVOA 1YNTE 2JF5A 1CMXB 1FEHA 1C79A 4RNAA 1TZ1A 4OHJA 3PZ8A 2WXFA 1ACCA 3APFA 2BF8B 3Q8CA 5FKAC 1WYWB 2BGFA 3NS1A 4FHKA 5TR5A 1JW9D 1I4HA 3PZDA 2UWQA 3V61A 2X8XX 1VCBA 2KTRB 2GMIC 2INPE 1CK1A 3B9JA 2NTTA 3BVZA 2SAKA 3UINB 3IG3A 4XE0A 4AP4C 1UGMA 4M0WB 2LVOA 2KVZA 2I1KA 1TTNA 2WXNA 4FJVB 4TMAB 3VR8B 3O65B 2INCC 2KQ7A 5AUIA 1F52A 1FFVA 2H89B 3P1MA 4EZKA 2RDGA 2BYEA 1MFWA 3DBHI 3TJPA 2DLBA 1GJZA 1FRDA 3OLMD 2W55A 1C76A 2KX3A 2IZVB 4GXBA 1R4MB 1QT9A 2VZKB 2XN9C 4NY0A 3VDZA 4KIKA 3I5JC 3W2DA 2ZJDA 1BT0A 1OTRB 2TSSA 3H8HA 3BYTB 5L95C 4K81A 5G2NA 3W5UB 3T8MA 4IUMB 2DYMA 2LVPA 4A3OA 1SJED 1SSNA 2IPKD 2J53A 4GMVA 2K8BA 3TEXA 5D3IB 1DOYA 3R2TA 1SEBD 4LNKA 1V2YA 1N5WA 4BKGA 3ZTCA 3U2SC 4E74A 3A9JB 4PYZA 2V4IB 4G11A 1JALA 2AYOB 4FBJB 3SR6A 4MDKE 2DNFA 4I6PA 1RM6C 2IO0B 4A90A 3RT3B 3DOWA 1LXDA 1QQRA 1JMLA 3I9V1 1A5RA 4EOYA 2DWQA 2WDTB 1WIAA 5C3JB 1QOAA 3BIID 4WWMA 2FIDA 2KMMA 2FCSA 2M19A 5AZGA 2SEBD 1WR1A 5LLIA 2MA9B 1OQYA 1FO4A 4ICUA 2FBWB 3GZNB 1HTOA 1E9MA 3A9KB 5CTRC 2MW5A 4C7YA 4DXAB 4TQ1A 4WWPA 3Q8BA 3V62A 3PS6A 4HEA1 2Z59B 1E5WA 3AE1B 4EUTA 3Q8EA 4TSSA 2OOBB 1JQ4A 1K8RB 4WAFA 4DHZB 2YEPF 2DENB 1J7CA 3W1SC 3KH0A 3VUYA 2ACZB 4NQKE 2IBIB 4F8CB 2L52A 4A20A 3AE5B 2JZ3B 1I4GA 3ZRFA 3H9DA 4GDLB 2KWDA 2K9XA 2DZJA 4B0MA 2M56B 3KW5B 2WQYB 2L83A 4KSLC 2LVQA 3SEBA 3AEFB 5D6JB 2W54A 4KSKC 2QJLA 1TS4A 4LJOB 3N1XC 1GB4A 1L6VA 3AU4A 3MC0B 1I4PA 1WGKA 1XF5L 3AECB 2V3NA 1ET9A 1RFKA 2JX5A 2HE7A 2REXA 2ICIA 1L0YB 4BFRA 4BKTA 4JL9A 4YWGG 4PS3A 1BMLC 4WJOA 1VRAB 2MBQA 3RPFC 2ZVNA 1I42A 4URKA 1AN8A 1J8CA 4WJNA 3ZDTA 1S1QB 1G6JA 4US8A 2DZIA 4L1BA 2KLCA 5TSSA 3I63C 4GOCA 2JYEA 5AUKA 4LCDE 1WXVA 4A9AA 4OVVA 1T0SC 1XD3B 2J0MA 1RAXA 3KWLA 1QILA 2MP2B 5DPWA 1L4ZB 4IW0A 1KM7A 3RCZA 1UUPA 2OEDA 3HIZA 3C0RB 3DWGC 2MLBA 1RLFA 2KO3A 3VR9B 2AX5A 2KANA 3BY4B 2WNMA 2VZKD 4GDKB 4B9KA 1AARA 3MJ5A 1CZPA 3DBLB 1QZEA 1ZW7A 5HFYA 4IM2A 5FR3A 4KX6B 2Z0EB 2LGDA 3NZ3A 4BOZB 4WIPA 2R2OA 3MC9A 4CHKA 2ZPNA 1Y56A 4JWUC 3ZRCA 1L5PA 4LNOA 3AEEB 3RMKC 3VHTC 3BVMA 3B08A 1V97A 1WXQA 1JWBD 1ZDXA 1Z2MA 3K9OB 4DK5A 4B6WA 3L4PA 1PDXA 4ZHPA 3R2IA 1D5XC 3HHMA 2WP9B 2LJ5A 3NVYA 2BB6A 1FCLA 4AJWA 2Z8LA 1SE4A 3SFEB 2FUHB 2LASA 5EE1A 2XEWA 2JQRB 5E6JA 3R7QA 2BBCA 2G4DB 3W9CB 4EZLA 4KZCA 2NS5A 4DXFA 4MT5A 4GLSC 4XWTA 3ECIA 1YOVB 1XLOA 3TEZA 1X1MA 1E8YA 1FPYA 2H88B 2AQ1B 3L10B 3RZWC 3RYTA 4GSWA 2CU3A 1AWDA 4JX1C 1V1PB 3ZQ4A 4K7SA 3TBLD 2I1JA 3EUB2 1J19A 1V81A 5H92C 3LXFA 2CHWA 3Q8AA 4WAAA 3ZGZA 2RSUA 3QCAA 3KUDB 4WQOB 4ICVA 2PLPA 1NI2A 5C1ZA 2GBMA 3CWIA 4BBNC 1T6BX 4DQOC 2KDEB 2O2VB 3ML8A 1IBXA 2JY6A 3HUIA 1MHHE 5D2MB 1BXTA 4OVUA 1M94A 1T3QA 2LGSA 2HJ8A 2CS4A 4IOIE 3WA0A 4IWOA 3PV1A 4I6LB 2KJRA 1I35A 2N7JA 5JHAA 3TEWA 4NQLB 1XLPA 1YX6B 4MH0E 4HPMB 2EMTA 2KWCA 3RNFC 3U30A 5C23A 2KFKB 2KJHB 2BPSA 2BT6A 3DDCB 5KHOA 2QSDA 2BWES 2CJNA 3BVGA 4IKGA 1WRDB 2KC2A 2L0TA 2ONQA 3UGBB 2N9PC 3VAWA 2HJ1A 1GC7A 2MRPA 2L05A 4B95A 2KYWA 1QKZA 1PYWD 1ET6A 5AZHA 5LXHA 2LEKA 1ZKHA 1E6EB 1FRRA 2MJDA 3A1QA 3Q3FA 2OJWA 2NTSA 4XDDA 4W9IA 4FN2A 3IXSA 2PW9A 3N32A 1OQQA 2BYVE 3L17A 2OJRA 3SD5A 2FCQA 2IY1B 1WJ4A 3KYCD 4BBNF 1SE2A 2DX5B 2B3AA 3PHWB 3DBHB 1VZ8A 2LUMA 1P7EA 1UBQA 2KWUB 3ZW3A 4KKIA 2MJEA 4FADA 1C4PA 1E8ZA 4IG7B 2VH1A 4NPNA 4GGQA 2Y5BB 1HXYD 3OWEB 2K5PA 2IGHA 3CSTA 5BYSA 4IC7B 2MX2A 2IY0B 2KT7A 1MG4A 1DYQA 2QHOA 1Q5WB 1FFUA 4YT0B 1XEEA 3NZSA 1TKGA 5GMVA 3ENEA 2CHXA 1YQ3B 2M4NA 2UYZB 2LJIA 2WXHA 5KHQA 3PTFC 2J7QB 1EWYC 2KKCA 4M01A 4QAYA 1TS5A 3QJZA 2DBYA 3IAM1 4AOFA 5GXGB 4ZRJA 4HPPA 1WMHB 4OZAA 1M4VA 1V5TA 4P1CC 1JROA 3LDZE 2XK5A 3GOEA 4IM3A 3AEGB 4HWIB 1T0YA 4OZCA 2KTFA 2MBEA 5FK9C 4RF1A 2DYBA 3U52E 2BYTA 1WGYA 4CO7A 1EU3A 3Q69A 2I38A 4NAMA 1HE8A 4MSMB 4LNFA 3AV8A 4TKNA 1AYFA 4W9EA 3H7PB 3RNCC 2FCMA 2BQQA 3A1QB 2L00B 4HLEA 1RRBA 4F1SA 2L32A 4KKJA 3ZTDA 2KACA 4P1BC 4HROA 1Q1OA 2JUOA 4NAWB 1L0XB 4ZRKA 4LDTB 1TJEA 2W9NA 2NMQA 4RGNA 3PRZA 4B0EA 4ACFA 1XCTL 4L2YA 5BYQA 1WI0A 1F77A 3UIOB 3T9LA 3HVZA 4P6VF 3PT2B 2K8HA 4KVGB 4J3OD 2K0PA 4P7IA 1UBIA 2N1VA 2WXGA 2FAZA 3JSVB 3QK0A 5C2TB 4CYEA 1YN5A 4N59A 3L0WB 4JLCA 2WXIA 1NVID 2KX0A 1QLBB 1PGXA 3RULA 4K7WA 3BK1A 1FXIA 4RGOS 3RNBC 5L83A 2J52A 1V1OA 2FIFA 3QIJA 4RH6A 3WAPA 4GIVA 2BS2B 4WWOA 1WX9A 3Q8FA 2KJ6A 3OJ3A 2D3CA 1V6EA 4FXCA 1MI0A 1WX8A 1EM7A 4WH4A 1VJKA 4US9A 1GAQB 1E7PB 5H8YE 4ANWA 1UWXA 1QF6A 1V9JA 5J17A 2W3SA 3FC4A 2FE8A 3PPAA 1WF9A 3Q2AC 1L2NA 1FXTB 2V3SA 3KUZA 5HG2A 1J0GA 2C7MB 3RZFA 1IP9A 3RD2A 1RFAA 2M0XA 3N9YC 3AEDB 3NY5A 4MM3B 2BVCA 1P9DU 1WJUA 4M02A 3ML9A 3NOBA 3ZYYX 2L0FA 2DZMA 3ZNID 1TY0A 3VH4B 1T5XD 2EMSA 2WDQB 3B2FA 2KFJA 5E6OA 3R8BA 4KGRA 2YVCA 4RF0A 3TSSA 4NJCA 1YN4A 3NZUA 3RNAC 1YN3A 1S3SG 2ZW1A 1TT5B 2JYTA 1E7UA 4R3DA 2Q5WD 3AEAB 1KLVA 2KQSA 2Y5CA 2KAJA 2IDYA 1KF6B 3URYA 2MSED 3EFUA 2V0GA 4EFOA 3PO0A 4DDGD 3ZIMA 2PJHA 3B2GA 4OW0A 5IAAC 3X23A 3ABVB 4HDOA 1SF0A 4AQ7A 3WALA 3HM6X 4YSYB 1YJ1A 3AXCA 3PZ7A 5IKCM 2LGIA 3TUOA 3RN9C 3RFZB 2PVGC 1WJNA 1C78A 3EECA 1XLNA 4RFBA 2AQ2B 2R2QA 1UH6A 1SJHD 2JZPA 1YIWA 5IO9A 3Q3NC 4MJSA 3SDLC 4C4VA 2KZRA 2KDMA 4YXDB 1XO3A 4JIOU 2WXKA 4KIKB 3ZUNA 3MJWA 2CHZA 2PE6B 4MH8A 1EUVB 3EA6A 2PIAA 2KOXA 4ANUA 2KMCA 1KRHA 2KLGA 3KVFB 1SXTA 1E0ZA 3PLVA 3ONSA 4FA6A 4LDTD 2PVOD 1L0VB 3V60A 3DBRI 1E10A 3PRPB 5IOIA 1SBBB 3EGRA 3H7SA 4YSZB 1TKEA 4GU2A 1F9JA 1JWAD 3GE3C 2GBKA 1P3QU 2L76A 3N1ZC 1WE7A 2G1EA 3NJTA 3M95A 1GUAB 1IPGA 1ZGUB 2QDFA 1VR9A 3ETRA 3AE2B 2MBHA 4ZRPA 2V9HA 2MBOA 1LFDA 4ASWC 1D6EC 3W1SA 1HTQA 3NVVA 4J6IA 2WYQA 1T0RC 3ZJVA 2JVCA 3P4PB 1N5XA 1K51A 4S0RA 4HCNB 2JWUA 2D3AA 4BKSD 4AUQC 1NYRA 2NBUA 5EE0A 4DHZE 1K50A 2WGSA 1FMAD 3AU5A 1WM2A 4W9HA 3T3NA 4IWQA 2ASQA 3H1UA 2DAFA 3LYYA 1EWCA 3ZDMC 2YEPB 1JRPA 1T0QC 4G50A 2W82A 1WZ3A 4RM9A 3AB5A 4W9DA 4XX5A 3IT4B 1WXMA 5AEKB 3L54A 1WSPA 3DVNU 2LUEA 2E6XA 4YL8A 4ZDVA 3Q3OC 2RDHA 3K9PB 3QARA 3U7DA 3V05A 4EEWA 1ZXIA 2LRUA 5T8IA 1H4RA 1YD8U 2L7RA 2LWPA 3AN1A 2GRIA 4OVZA 3L16A 3DVGX 3OG5A 3NS8A 4PK1A 2LXCA 2GBNA 2WS3B 2WXLA 3N20C 2V4LA 3AE9B 5HKHA 1V80A 1NEKB 1R4NB 2AEHA 1WE6A 5G5GA 4LNNA 5AZFA 2IJ0A 2WLBA 1I4XA 1HZ6A 1QOFA 2INDC 1TBEA 4KZ0A 3A4RA 2KC1A 4USAA 2K8CA 2ZNVB 5JH5C 1E7VA 1TGZB 4O1NA 1NENB 2JU6X 2X38A 3JW0X 4OZBA 3TIXA 3KWVA 3E9SA 1GG3A 2WHIA 1WX7A 1IYFA 1Q0WB 2WXQA 2LZ6A 3DHHC 2ZEQA 1FD6A 2D3BA 4LK0M 2HTME 1WY8A 2ZCCA 2ZW0A 2EKIA 1HZ5A 3C8YA 5E6PA 2N0SB 1DGJA 2GB1A 3BYYB 4ZRQA 1UNSA 3M62B 3UQAA 1L4DB 1L6UA 4XGAB 2KDFB 2K39A 1EO6A 2K25A 2QIEB 4W9CA 1P7FA 3PLUA 1NBFC 4RMAA 1AW7A 3RUIB 2FUG1 2NBVB 3CSFA 4FHJA 1I7HA 4JPSA 3IAS1 1YJJA 2KK8A 5BO4B 5I4DA 5J18A 1SGHA 3A4SC 4M8NA 3P2BA 1FNWA 3BWUD 3P4SB 1GB1A 1MHXA 2DAJA 1C4CA 4S17A 5CHFA 4W9KA 3X0WA 2D11A 1SE3A 3QC8B 1I4RA 2GBJA 4W9LA 1VZ6A 3NUHB 1WGDA 4MSQB 1YJIA 4II2B 1L7YA 4G3XB 4NJ7A 3PSEB 2NR2A 4M0WA 1ISNA 2HD5B 1GNUA 3VTUA 2C7NB 1K53A 2UU7A 2WWZA 3MTNB 3AH7A 1R4NI 3UQBA 4ITKA 4DBGA 1IBXB 3TEYA 3QQ8B 2C9WB 2ZCBA 1VLBA 3HRDD 1PUTA 3ZKJC 1OGWA 1EF5A 2XBBC 2WDRB 2PKOA 4PS8A 4WURA 3RI7C 3DVNV 1MJDA 2QCZA 2NPTA 2G3QB 1WGRA 3CMMB 4HDQA 2KHWB 1KFYB 3KQ4A 3GB1A 1F2RC 4CQNA 3NHEB 1QOBA 2K6QA 3DPDA 1H8CA 3D32A 3RNEC 3DQVA 2BKFA 2C5LC 2AQ3B 1D3ZA 1VDVA 5DCNA 2QC8A 1TIFA 2MJ3A 1TY2A 3LJ3A 2K3UA 3RNGC 2VRRB 2RGFA 4C80A 4N9F4 4AWJA 4E71A 2BTEA 2O6VA 1FNVA 3JYUA 4EKUA 3H6NA 5EE9A 2JSVX 3ZJTA 4P16A 3FILA 3A9JA 2J0KA 3DVGY 4JGHB 1FIQA 1MPEA 4FJYA 2WXMA 1WZ0A 1P1AA 4ANXA 2ON8A 3TMPB 4BVUC 2PEAA 1VZ7A 1KH0A 1KOTA 1N60A 2JZZA 1ZE3D 4IWPA 1OEYJ 4AS1A 5DPRA 2LI5A 4JE3B 2Y3AA 5JZEB 2K6DB 2N7DA 4A55A 2WXPA 2WX1A 3MP9A 1UELA 4HRSA 4HKQA 1YQBA 1LGRA 4HCPB 2MBBB 2L1AA 4EE2A 2K22A 4K3CA 1KTKA 2G45B 3P63A 3UIPB 4TUUA 3B0AA 2V1YA 4GN1A 2MQJA 3VRAB 1ZP0B 3A9KA 3HVDA 3KUCB 3Q3JA 5D7GA 1E8XA 1QOGA 2CJOA 4LNIA 2I2YA 1DOIA 3L13A 1NDDA 3QHTA 2YLMA 1FCCC 3WCQA 3P4RB 2ZZPB 4W9GA 3GE8C 2GLSA 3W1YA 2MCNB 3KLSX 4KDLB 4HKZE 1C4AA 3PHXB 3AULA 4M8MA 2NPTB 1Z5SB 3P4QB 4GDLA 3DBRB 4IM0A 2KDIA 1JWUD 2C7HA 3DCGA 1XT9B 1JWSD 1TZOA 2QILA 3J9CA 2DYOA 1D4BA 2N9LA 2XK5B 4GB9A 3SHQA 1C3TA 1ZPSA 2Z0DB 5LNK1 1WGGA 1WXSA 3VRBB 3LB8C 2BW2A 2BB5A 4TV3A 3E56A 4YTPB 2O6VB 4IDIA 4MELA 3U8ZA 3OJ4B 2MHJA 3UI3A 2C60A 2KNBA 3FILB 3DWMA 4HPLB 4A8XC 5JHBA 2RDBC 3NVWA 4MACA 2LFIA 2FCNA 1Y8RC 1OQRA 5IA7A 4ANVA 4NNJB 2IGDA 3U7ZA 3VFKA 1GOZA 3N30A 2MP2A 1TS2A 2AL3A 4ZYNA 4MGZE 2CU1A 1JWMD 3CF6E 2J0JA 2M0AA 5BMGA 2ZNVC 3ZNGC 2AL6A 3AEBB 2WXOA 4GDKA 2K1FA 1TKYA 4ARCA 2N7EA 1D5ZC 2JXTA 3ZNHB 4WWNA 2KMAA 4FULA 4ZHOA 4KGTA 3PVLA 1WRIA 1CJEA 1N62A 1P98A 3IT6B 4WJQA 3ZVVA 1F0ZA 2KVRA 1GPXA 2VH2A 3IBEA 2M8SA 1C77A 3GS2A 4KDIC 2ZPYA 1RYJA 3HM3A 2N9KA 3VUWA 4NJ6A 1WGHA 2N4FA 2NVUI 4K7UA 3QX1A 1PGAA 1WH3A 1IUEA 2A4ZA 3VH3B 1NYQA 2EELA 4LJPB 3ALBA 1KLGD 1N61A 2KQ4X 2V3PA 1ZXHA 1FXAA 2BKRB 2LHEA 3FKYA 3SU8X 1PFDA 1IGCA 3MC8A 1CQVA 3QWZB 4C56C 4PYUA 1C9FA 1R4MI 1PQSA 2JXXA 1WM3A 1V1PA 2L8JA 1WYGA 4C7ZA 4DHJB 3O13A 2LMCA 1YMHE 4WQMA 5HI1A 4HVBA 4JQWC 1WR6E 1HA5A 3ZO5B 5G55A 4N6EB
chains in the Genus database with same CATH topology
3M3JA 1WMHB 2O2VA 1V2YA 2G4SA 1V5TA 3EHVA 4BKGA 1WY8A 2ZCCA 3IHPC 3ZTCA 3LDZE 3A9JB 4W9FA 4PYZA 2XK5A 4E74A 3R3MA 3GOEA 4IM3A 4G11A 5DPSA 4KV2A 4HWIB 4DDID 3WIMA 2LGYA 1T0YA 2LD9A 5E6PA 2AYOB 2KTFA 2MBEA 4FBJB 2DYBA 1WGYA 2N1WA 4ZRJA 3M62B 3UQAA 4MDKE 4I6PA 2KDFB 2K39A 2N9XA 2RD0A 4MGIE 4CO7A 2IO0B 1EO6A 1HE8A 4G0NB 4MSMB 4K1RB 1U4AA 3RT3B 2CKHB 2GBRA 3DOWA 4A3PA 2K25A 4W9CA 1LXDA 3PGEA 1A5RA 3PLUA 4EOYA 1NBFC 4RMAA 4TKNA 2WDTB 4W9EA 3H7PB 3RUIB 2FCMA 1WIAA 2NBVB 3A1QB 3CSFA 4FHJA 2L00B 5BO4B 2KFKA 2FIDA 2KK8A 3KYDD 2FCSA 2JT4B 4HLEA 5J18A 5AZGA 1RRBA 1WR1A 4FJZA 5LLIA 4F1SA 1SGHA 2MA9B 2M1MA 3ZTDA 1OQYA 3A4SC 4FLHA 4M8NA 4DWFA 4TQ0A 3P2BA 2DHZA 4ICUA 5LXIB 4II3B 1Q1OA 2JUOA 3A9KB 4NAWB 5CTRC 2MW5A 4DXAB 4TQ1A 4WWPA 3V62A 4ZRKA 2DAJA 4LDTB 2W9NA 4MJSB 5CHFA 2O6VD 3PS6A 4W9KA 2Z59B 1E5WA 3PRZA 4EUTA 3X0WA 3EC8A 2D11A 3GZNI 2OOBB 3QC8B 1K8RB 1WI0A 5D94A 3UIOB 4HXDA 2NCNA 3T9LA 4DHZB 2DENB 3W1SC 2NBWB 3KH0A 3VUYA 3PT2B 4NQKE 2IBIB 2K8HA 2HTHA 3DBSA 4KVGB 4F8CB 2GBJA 4P7IA 1UBIA 2N1VA 3JSVB 2FAZA 4W9LA 3QK0A 4CYEA 1E90A 4A20A 1WGDA 2D10A 2JZ3B 4MSQB 4II2B 1L7YA 3L0WB 4G3XB 4JLCA 3ZRFA 4NJ7A 2KX0A 3B1LX 3H9DA 4GDLB 3ZLZA 3PSEB 2DZJA 4K7WA 3RULA 2NR2A 3KW5B 5L83A 4KSLC 2LVQA 2D07B 5EDSA 3QA8A 1ISNA 4HJKA 2HD5B 1GNUA 3R7RA 2C7NB 2FIFA 3QIJA 4KSKC 5D6JB 3VTUA 2BWFA 4LJOB 2WWZA 3MTNB 4XC2A 1R4NI 4GIVA 3WAPA 3UQBA 4WWOA 1WX9A 3AU4A 4DBGA 3BINA 2KJ6A 4WJPA 3OJ3A 1V6EA 3QQ8B 4I6NB 2C9WB 3HK0A 2ZCBA 1WX8A 2HE7A 3I3TB 3ZKJC 2REXA 1OGWA 2LXAA 1EF5A 2XBBC 3AI5A 2PPHA 4BFRA 1C1YB 4PS8A 4ANWA 1WJ6A 3DVNV 4BKTA 4RM8A 4JL9A 1V9JA 4PS3A 2NPTA 2KDBA 4WJOA 5J17A 3VXWA 2G3QB 1WXAA 2MBQA 3PPAA 1WF9A 1WGRA 3CMMB 4HDQA 2ZVNA 3TCAA 1I42A 1L2NA 1VD2A 4URKA 2KHWB 1FXTB 1J8CA 2V3SA 4WJNA 1E8WA 3KUZA 3ZDTA 1J0GA 1S1QB 2C7MB 3NHEB 3RZFA 1G6JA 1IP9A 5CHVC 2DZIA 2K6QA 3RD2A 1RFAA 4AJYB 2M0XA 2KLCA 3DPDA 4GOCA 2KXJA 2N9EB 2JWZA 1WXVA 4LCDE 1H8CA 3NY5A 4OVVA 3D32A 3S2AA 2FNJB 4F7ZA 1P9DU 1WJUA 2RR9A 3ML9A 1XD3B 3NOBA 2J0MA 4W9JA 1RAXA 3DQVA 2BKFA 2C5LC 1LQBA 5DPTA 4EZJA 1D3ZA 3VTVA 2LGXA 4PS7A 5DCNA 2MP2B 5DPWA 3PRMB 3LJ3A 2L0FA 4IW0A 1KM7A 3RCZA 2DZMA 2VRRB 2RGFA 4N9F4 3ZNID 3HIZA 4AWJA 4E71A 3VH4B 2EMSA 3C0RB 2O6VA 2MLBA 3JYUA 4EKUA 1RLFA 1WMHA 3H6NA 2KO3A 4X57B 2GOWA 2KANA 2KFJA 3BY4B 2BYFA 3APCA 5E6OA 1YX5B 4GDKB 4B9KA 3A9JA 1AARA 4MGKE 2J0KA 2YVCA 3DVGY 3VVWB 4JGHB 1QZEA 4FJYA 1ZW7A 3NZUA 4IM2A 1WZ0A 1P1AA 4ANXA 1S3SG 3TMPB 2Z0EB 2LGDA 4BVUC 1E7UA 3VUXA 1KJTA 2AWTA 2PEAA 2RPQA 5E6NA 4BOZB 2R2OA 2KQSA 1KLVA 4CHKA 1KOTA 2ZPNA 3DBLI 2JZZA 3ZRCA 2MSED 3EFUA 4IWPA 1OEYJ 4DHJD 4EFOA 5J2RA 5DPRA 4DDGD 3ZIMA 2LI5A 2PJHA 5JZEB 2K6DB 2N7DA 3VHTC 3M63B 5IAAC 2WX1A 3B08A 3X23A 1UELA 3N3KB 3H7PA 1YQBA 3JVZX 4HDOA 3WALA 1Z2MA 3K9OB 3HM6X 4HCPB 4B6WA 4DK5A 2MBBB 1YJ1A 3R66C 1OEYA 3AXCA 4E3CA 3HHMA 2G45B 3UIPB 1SE9A 4TUUA 2JPHA 2LJ5A 3B0AA 2V1YA 2EKEC 1LM8B 4GN1A 1WJNA 2MQJA 4AJWA 3A9KA 3EECA 3QAQA 3KUCB 4NAWA 2LRWA 2CR5A 3Q3JA 1E8XA 2R2QA 1UH6A 4MEMA 2FUHB 2KTRA 5D7GA 1P0RA 3WAOA 2LASA 2XEWA 1YIWA 4XZ4A 4MJSA 3R7QA 3L13A 1NDDA 3SDLC 3WANA 4EZLA 2G4DB 2KZRA 2D3GA 1UD7A 3QHTA 3TL5A 2YLMA 4KZCA 2NS5A 4JIOU 5CHWA 2PE9A 3WAMA 2ZZPB 4W9GA 3ECIA 1MG8A 3W1YA 4KIKB 2MCNB 1X1MA 3L08A 1E8YA 4KDLB 1XQQA 3MJWA 2CHZA 2PE6B 3ZUNA 3L10B 1EUVB 1GC6A 3RZWC 3APDA 3JSVA 3RYTA 4GSWA 2IO2B 2JRIB 3PHXB 3AULA 2KOXA 4HK2A 4M8MA 4K7SA 3TBLD 4ANUA 2I1JA 3A33B 2WX0A 1J19A 2KMCA 1V81A 1Z5SB 2DZKA 2NPTB 4GDLA 4IM0A 2KDIA 2CHWA 2C7HA 3DCGA 3IFWB 4WAAA 2KLGA 2RSUA 3KVFB 3QCAA 3KUDB 1JRUA 1V49A 1XT9B 4WQOB 3PLVA 2MWSB 4ICVA 2M17A 1NI2A 5C1ZA 3ONSA 2GBMA 4FA6A 4LDTD 4BBNC 2KDEB 4MGYE 2DYOA 2O2VB 3ML8A 3V60A 3DBRI 2IO1B 2JY6A 2XK5B 4GB9A 3SHQA 1C3TA 3PRPB 5D2MB 2Z0DB 4OVUA 1WGGA 1WXSA 2KD0A 3MHSD 1M94A 3H7SA 3VTWA 2D2QA 2L3ZA 4GU2A 2HJ8A 4TV3A 2CS4A 1F9JA 3WA0A 5FR6A 4IWOA 4BKSA 3PV1A 2GBKA 1P3QU 2L76A 4I6LB 1WE7A 2KJRA 4BOSC 2IO3B 1I35A 3M95A 2O6VB 5JHAA 4MELA 1GUAB 3V6CB 1IPGA 1ZGUB 3U8ZA 4NQLB 1YX6B 3OJ4B 4MH0E 3V6EB 3ZNZB 4HPMB 5CX3A 2C60A 2EMTA 2KWCA 2KNBA 3PREA 3UF8A 2IYDB 2MBHA 4HPLB 2JRHA 5JHBA 3U30A 5C23A 2KN5A 3OAWA 3VQIA 2MBOA 2KWVB 1LFDA 2KFKB 4ASWC 4MM3A 2KJHB 2FCNA 2BPSA 3W1SA 1Y8RC 3IVFA 3DDCB 5IA7A 1V86A 4ANVA 4NNJB 1WFYA 4J6IA 3VFKA 2WYQA 3N30A 5KHOA 1UZXB 1SIFA 1V5OA 2BWES 2JVCA 2MP2A 1WRDB 4HCNB 4ZRIA 2KC2A 2AL3A 2L0TA 4ZYNA 2A5UA 4MGZE 1EF1A 4BKSD 2ZVOA 2CU1A 4AUQC 2NBUA 2JF5A 4DHZE 1CMXB 3CF6E 2J0JA 3UGBB 2N9PC 2ZNVC 3VAWA 3ZNGC 1WM2A 2AL6A 1GC7A 3AU5A 2MRPA 1TZ1A 2ASQA 2L05A 3H1UA 4IWQA 4W9HA 2DAFA 4GDKA 4B95A 3ZDMC 3APFA 2K1FA 2BF8B 5AZHA 4G50A 2N7EA 5LXHA 1WZ3A 1ZKHA 3A1QA 3ZNHB 4RM9A 3Q3FA 4W9DA 4WWNA 4XX5A 1WXMA 5AEKB 2KMAA 4W9IA 1WYWB 2BGFA 3L54A 4FHKA 4FULA 4FN2A 3DVNU 5TR5A 2LUEA 4YL8A 3N32A 3PZDA 2UWQA 4ZDVA 3V61A 1VCBA 3K9PB 2BYVE 2KTRB 2GMIC 3QARA 3PVLA 3U7DA 4EEWA 2LRUA 1H4RA 3L17A 2OJRA 3SD5A 3UINB 1P98A 1YD8U 2L7RA 2LWPA 3IG3A 4WJQA 4AP4C 1UGMA 4M0WB 2FCQA 2IY1B 2LVOA 3ZVVA 3L16A 3DVGX 2I1KA 2KVRA 1WJ4A 3NS8A 1TTNA 2LXCA 2GBNA 3KYCD 4FJVB 3IBEA 2M8SA 4BBNF 4KDIC 2DX5B 2ZPYA 2B3AA 3PHWB 3O65B 1UBQA 2KWUB 3HM3A 2KQ7A 2V4LA 3VUWA 3ZW3A 5HKHA 4FADA 1V80A 4NJ6A 1E8ZA 4IG7B 1WGHA 2N4FA 2NVUI 4K7UA 2AEHA 3QX1A 4EZKA 1WH3A 1WE6A 2BYEA 4NPNA 2A4ZA 3DBHI 3TJPA 3VH3B 4GGQA 5AZFA 1GJZA 2Y5BB 3OLMD 4LJPB 3ALBA 2KX3A 2IZVB 4GXBA 3CSTA 4IC7B 2MX2A 1TBEA 2IY0B 4KZ0A 4NY0A 3A4RA 2KC1A 2BKRB 3VDZA 2K8CA 2ZNVB 2QHOA 3SU8X 4KIKA 1Q5WB 5JH5C 1E7VA 1TGZB 2ZJDA 3QWZB 1BT0A 4PYUA 1OTRB 3JW0X 5L95C 4K81A 1R4MI 1PQSA 3NZSA 5G2NA 2JXXA 5GMVA 3T8MA 3TIXA 3ENEA 1WM3A 2CHXA 2M4NA 2UYZB 2L8JA 4IUMB 2DYMA 2LVPA 4A3OA 4DHJB 1GG3A 5KHQA 3PTFC 2J7QB 4GMVA 4JQWC 2KKCA 2K8BA 1WR6E 1WX7A 4HVBA 3QJZA 1IYFA 4AOFA 3ZO5B 1Q0WB 2LZ6A 5G55A 2ZEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M3J A;  1WMH B;  2O2V A;  1V2Y A;  2G4S A;  1V5T A;  3EHV A;  4BKG A;  1WY8 A;  2ZCC A;  3IHP C;  3ZTC A;  3LDZ E;  3A9J B;  4W9F A;  4PYZ A;  2XK5 A;  4E74 A;  3R3M A;  3GOE A;  4IM3 A;  4G11 A;  5DPS A;  4KV2 A;  4HWI B;  4DDI D;  3WIM A;  2LGY A;  1T0Y A;  2LD9 A;  5E6P A;  2AYO B;  2KTF A;  2MBE A;  4FBJ B;  2DYB A;  1WGY A;  2N1W A;  4ZRJ A;  3M62 B;  3UQA A;  4MDK E;  4I6P A;  2KDF B;  2K39 A;  2N9X A;  2RD0 A;  4MGI E;  4CO7 A;  2IO0 B;  1EO6 A;  1HE8 A;  4G0N B;  4MSM B;  4K1R B;  1U4A A;  3RT3 B;  2CKH B;  2GBR A;  3DOW A;  4A3P A;  2K25 A;  4W9C A;  1LXD A;  3PGE A;  1A5R A;  3PLU A;  4EOY A;  1NBF C;  4RMA A;  4TKN A;  2WDT B;  4W9E A;  3H7P B;  3RUI B;  2FCM A;  1WIA A;  2NBV B;  3A1Q B;  3CSF A;  4FHJ A;  2L00 B;  5BO4 B;  2KFK A;  2FID A;  2KK8 A;  3KYD D;  2FCS A;  2JT4 B;  4HLE A;  5J18 A;  5AZG A;  1RRB A;  1WR1 A;  4FJZ A;  5LLI A;  4F1S A;  1SGH A;  2MA9 B;  2M1M A;  3ZTD A;  1OQY A;  3A4S C;  4FLH A;  4M8N A;  4DWF A;  4TQ0 A;  3P2B A;  2DHZ A;  4ICU A;  5LXI B;  4II3 B;  1Q1O A;  2JUO A;  3A9K B;  4NAW B;  5CTR C;  2MW5 A;  4DXA B;  4TQ1 A;  4WWP A;  3V62 A;  4ZRK A;  2DAJ A;  4LDT B;  2W9N A;  4MJS B;  5CHF A;  2O6V D;  3PS6 A;  4W9K A;  2Z59 B;  1E5W A;  3PRZ A;  4EUT A;  3X0W A;  3EC8 A;  2D11 A;  3GZN I;  2OOB B;  3QC8 B;  1K8R B;  1WI0 A;  5D94 A;  3UIO B;  4HXD A;  2NCN A;  3T9L A;  4DHZ B;  2DEN B;  3W1S C;  2NBW B;  3KH0 A;  3VUY A;  3PT2 B;  4NQK E;  2IBI B;  2K8H A;  2HTH A;  3DBS A;  4KVG B;  4F8C B;  2GBJ A;  4P7I A;  1UBI A;  2N1V A;  3JSV B;  2FAZ A;  4W9L A;  3QK0 A;  4CYE A;  1E90 A;  4A20 A;  1WGD A;  2D10 A;  2JZ3 B;  4MSQ B;  4II2 B;  1L7Y A;  3L0W B;  4G3X B;  4JLC A;  3ZRF A;  4NJ7 A;  2KX0 A;  3B1L X;  3H9D A;  4GDL B;  3ZLZ A;  3PSE B;  2DZJ A;  4K7W A;  3RUL A;  2NR2 A;  3KW5 B;  5L83 A;  4KSL C;  2LVQ A;  2D07 B;  5EDS A;  3QA8 A;  1ISN A;  4HJK A;  2HD5 B;  1GNU A;  3R7R A;  2C7N B;  2FIF A;  3QIJ A;  4KSK C;  5D6J B;  3VTU A;  2BWF A;  4LJO B;  2WWZ A;  3MTN B;  4XC2 A;  1R4N I;  4GIV A;  3WAP A;  3UQB A;  4WWO A;  1WX9 A;  3AU4 A;  4DBG A;  3BIN A;  2KJ6 A;  4WJP A;  3OJ3 A;  1V6E A;  3QQ8 B;  4I6N B;  2C9W B;  3HK0 A;  2ZCB A;  1WX8 A;  2HE7 A;  3I3T B;  3ZKJ C;  2REX A;  1OGW A;  2LXA A;  1EF5 A;  2XBB C;  3AI5 A;  2PPH A;  4BFR A;  1C1Y B;  4PS8 A;  4ANW A;  1WJ6 A;  3DVN V;  4BKT A;  4RM8 A;  4JL9 A;  1V9J A;  4PS3 A;  2NPT A;  2KDB A;  4WJO A;  5J17 A;  3VXW A;  2G3Q B;  1WXA A;  2MBQ A;  3PPA A;  1WF9 A;  1WGR A;  3CMM B;  4HDQ A;  2ZVN A;  3TCA A;  1I42 A;  1L2N A;  1VD2 A;  4URK A;  2KHW B;  1FXT B;  1J8C A;  2V3S A;  4WJN A;  1E8W A;  3KUZ A;  3ZDT A;  1J0G A;  1S1Q B;  2C7M B;  3NHE B;  3RZF A;  1G6J A;  1IP9 A;  5CHV C;  2DZI A;  2K6Q A;  3RD2 A;  1RFA A;  4AJY B;  2M0X A;  2KLC A;  3DPD A;  4GOC A;  2KXJ A;  2N9E B;  2JWZ A;  1WXV A;  4LCD E;  1H8C A;  3NY5 A;  4OVV A;  3D32 A;  3S2A A;  2FNJ B;  4F7Z A;  1P9D U;  1WJU A;  2RR9 A;  3ML9 A;  1XD3 B;  3NOB A;  2J0M A;  4W9J A;  1RAX A;  3DQV A;  2BKF A;  2C5L C;  1LQB A;  5DPT A;  4EZJ A;  1D3Z A;  3VTV A;  2LGX A;  4PS7 A;  5DCN A;  2MP2 B;  5DPW A;  3PRM B;  3LJ3 A;  2L0F A;  4IW0 A;  1KM7 A;  3RCZ A;  2DZM A;  2VRR B;  2RGF A;  4N9F 4;  3ZNI D;  3HIZ A;  4AWJ A;  4E71 A;  3VH4 B;  2EMS A;  3C0R B;  2O6V A;  2MLB A;  3JYU A;  4EKU A;  1RLF A;  1WMH A;  3H6N A;  2KO3 A;  4X57 B;  2GOW A;  2KAN A;  2KFJ A;  3BY4 B;  2BYF A;  3APC A;  5E6O A;  1YX5 B;  4GDK B;  4B9K A;  3A9J A;  1AAR A;  4MGK E;  2J0K A;  2YVC A;  3DVG Y;  3VVW B;  4JGH B;  1QZE A;  4FJY A;  1ZW7 A;  3NZU A;  4IM2 A;  1WZ0 A;  1P1A A;  4ANX A;  1S3S G;  3TMP B;  2Z0E B;  2LGD A;  4BVU C;  1E7U A;  3VUX A;  1KJT A;  2AWT A;  2PEA A;  2RPQ A;  5E6N A;  4BOZ B;  2R2O A;  2KQS A;  1KLV A;  4CHK A;  1KOT A;  2ZPN A;  3DBL I;  2JZZ A;  3ZRC A;  2MSE D;  3EFU A;  4IWP A;  1OEY J;  4DHJ D;  4EFO A;  5J2R A;  5DPR A;  4DDG D;  3ZIM A;  2LI5 A;  2PJH A;  5JZE B;  2K6D B;  2N7D A;  3VHT C;  3M63 B;  5IAA C;  2WX1 A;  3B08 A;  3X23 A;  1UEL A;  3N3K B;  3H7P A;  1YQB A;  3JVZ X;  4HDO A;  3WAL A;  1Z2M A;  3K9O B;  3HM6 X;  4HCP B;  4B6W A;  4DK5 A;  2MBB B;  1YJ1 A;  3R66 C;  1OEY A;  3AXC A;  4E3C A;  3HHM A;  2G45 B;  3UIP B;  1SE9 A;  4TUU A;  2JPH A;  2LJ5 A;  3B0A A;  2V1Y A;  2EKE C;  1LM8 B;  4GN1 A;  1WJN A;  2MQJ A;  4AJW A;  3A9K A;  3EEC A;  3QAQ A;  3KUC B;  4NAW A;  2LRW A;  2CR5 A;  3Q3J A;  1E8X A;  2R2Q A;  1UH6 A;  4MEM A;  2FUH B;  2KTR A;  5D7G A;  1P0R A;  3WAO A;  2LAS A;  2XEW A;  1YIW A;  4XZ4 A;  4MJS A;  3R7Q A;  3L13 A;  1NDD A;  3SDL C;  3WAN A;  4EZL A;  2G4D B;  2KZR A;  2D3G A;  1UD7 A;  3QHT A;  3TL5 A;  2YLM A;  4KZC A;  2NS5 A;  4JIO U;  5CHW A;  2PE9 A;  3WAM A;  2ZZP B;  4W9G A;  3ECI A;  1MG8 A;  3W1Y A;  4KIK B;  2MCN B;  1X1M A;  3L08 A;  1E8Y A;  4KDL B;  1XQQ A;  3MJW A;  2CHZ A;  2PE6 B;  3ZUN A;  3L10 B;  1EUV B;  1GC6 A;  3RZW C;  3APD A;  3JSV A;  3RYT A;  4GSW A;  2IO2 B;  2JRI B;  3PHX B;  3AUL A;  2KOX A;  4HK2 A;  4M8M A;  4K7S A;  3TBL D;  4ANU A;  2I1J A;  3A33 B;  2WX0 A;  1J19 A;  2KMC A;  1V81 A;  1Z5S B;  2DZK A;  2NPT B;  4GDL A;  4IM0 A;  2KDI A;  2CHW A;  2C7H A;  3DCG A;  3IFW B;  4WAA A;  2KLG A;  2RSU A;  3KVF B;  3QCA A;  3KUD B;  1JRU A;  1V49 A;  1XT9 B;  4WQO B;  3PLV A;  2MWS B;  4ICV A;  2M17 A;  1NI2 A;  5C1Z A;  3ONS A;  2GBM A;  4FA6 A;  4LDT D;  4BBN C;  2KDE B;  4MGY E;  2DYO A;  2O2V B;  3ML8 A;  3V60 A;  3DBR I;  2IO1 B;  2JY6 A;  2XK5 B;  4GB9 A;  3SHQ A;  1C3T A;  3PRP B;  5D2M B;  2Z0D B;  4OVU A;  1WGG A;  1WXS A;  2KD0 A;  3MHS D;  1M94 A;  3H7S A;  3VTW A;  2D2Q A;  2L3Z A;  4GU2 A;  2HJ8 A;  4TV3 A;  2CS4 A;  1F9J A;  3WA0 A;  5FR6 A;  4IWO A;  4BKS A;  3PV1 A;  2GBK A;  1P3Q U;  2L76 A;  4I6L B;  1WE7 A;  2KJR A;  4BOS C;  2IO3 B;  1I35 A;  3M95 A;  2O6V B;  5JHA A;  4MEL A;  1GUA B;  3V6C B;  1IPG A;  1ZGU B;  3U8Z A;  4NQL B;  1YX6 B;  3OJ4 B;  4MH0 E;  3V6E B;  3ZNZ B;  4HPM B;  5CX3 A;  2C60 A;  2EMT A;  2KWC A;  2KNB A;  3PRE A;  3UF8 A;  2IYD B;  2MBH A;  4HPL B;  2JRH A;  5JHB A;  3U30 A;  5C23 A;  2KN5 A;  3OAW A;  3VQI A;  2MBO A;  2KWV B;  1LFD A;  2KFK B;  4ASW C;  4MM3 A;  2KJH B;  2FCN A;  2BPS A;  3W1S A;  1Y8R C;  3IVF A;  3DDC B;  5IA7 A;  1V86 A;  4ANV A;  4NNJ B;  1WFY A;  4J6I A;  3VFK A;  2WYQ A;  3N30 A;  5KHO A;  1UZX B;  1SIF A;  1V5O A;  2BWE S;  2JVC A;  2MP2 A;  1WRD B;  4HCN B;  4ZRI A;  2KC2 A;  2AL3 A;  2L0T A;  4ZYN A;  2A5U A;  4MGZ E;  1EF1 A;  4BKS D;  2ZVO A;  2CU1 A;  4AUQ C;  2NBU A;  2JF5 A;  4DHZ E;  1CMX B;  3CF6 E;  2J0J A;  3UGB B;  2N9P C;  2ZNV C;  3VAW A;  3ZNG C;  1WM2 A;  2AL6 A;  1GC7 A;  3AU5 A;  2MRP A;  1TZ1 A;  2ASQ A;  2L05 A;  3H1U A;  4IWQ A;  4W9H A;  2DAF A;  4GDK A;  4B95 A;  3ZDM C;  3APF A;  2K1F A;  2BF8 B;  5AZH A;  4G50 A;  2N7E A;  5LXH A;  1WZ3 A;  1ZKH A;  3A1Q A;  3ZNH B;  4RM9 A;  3Q3F A;  4W9D A;  4WWN A;  4XX5 A;  1WXM A;  5AEK B;  2KMA A;  4W9I A;  1WYW B;  2BGF A;  3L54 A;  4FHK A;  4FUL A;  4FN2 A;  3DVN U;  5TR5 A;  2LUE A;  4YL8 A;  3N32 A;  3PZD A;  2UWQ A;  4ZDV A;  3V61 A;  1VCB A;  3K9P B;  2BYV E;  2KTR B;  2GMI C;  3QAR A;  3PVL A;  3U7D A;  4EEW A;  2LRU A;  1H4R A;  3L17 A;  2OJR A;  3SD5 A;  3UIN B;  1P98 A;  1YD8 U;  2L7R A;  2LWP A;  3IG3 A;  4WJQ A;  4AP4 C;  1UGM A;  4M0W B;  2FCQ A;  2IY1 B;  2LVO A;  3ZVV A;  3L16 A;  3DVG X;  2I1K A;  2KVR A;  1WJ4 A;  3NS8 A;  1TTN A;  2LXC A;  2GBN A;  3KYC D;  4FJV B;  3IBE A;  2M8S A;  4BBN F;  4KDI C;  2DX5 B;  2ZPY A;  2B3A A;  3PHW B;  3O65 B;  1UBQ A;  2KWU B;  3HM3 A;  2KQ7 A;  2V4L A;  3VUW A;  3ZW3 A;  5HKH A;  4FAD A;  1V80 A;  4NJ6 A;  1E8Z A;  4IG7 B;  1WGH A;  2N4F A;  2NVU I;  4K7U A;  2AEH A;  3QX1 A;  4EZK A;  1WH3 A;  1WE6 A;  2BYE A;  4NPN A;  2A4Z A;  3DBH I;  3TJP A;  3VH3 B;  4GGQ A;  5AZF A;  1GJZ A;  2Y5B B;  3OLM D;  4LJP B;  3ALB A;  2KX3 A;  2IZV B;  4GXB A;  3CST A;  4IC7 B;  2MX2 A;  1TBE A;  2IY0 B;  4KZ0 A;  4NY0 A;  3A4R A;  2KC1 A;  2BKR B;  3VDZ A;  2K8C A;  2ZNV B;  2QHO A;  3SU8 X;  4KIK A;  1Q5W B;  5JH5 C;  1E7V A;  1TGZ B;  2ZJD A;  3QWZ B;  1BT0 A;  4PYU A;  1OTR B;  3JW0 X;  5L95 C;  4K81 A;  1R4M I;  1PQS A;  3NZS A;  5G2N A;  2JXX A;  5GMV A;  3T8M A;  3TIX A;  3ENE A;  1WM3 A;  2CHX A;  2M4N A;  2UYZ B;  2L8J A;  4IUM B;  2DYM A;  2LVP A;  4A3O A;  4DHJ B;  1GG3 A;  5KHQ A;  3PTF C;  2J7Q B;  4GMV A;  4JQW C;  2KKC A;  2K8B A;  1WR6 E;  1WX7 A;  4HVB A;  3QJZ A;  1IYF A;  4AOF A;  3ZO5 B;  1Q0W B;  2LZ6 A;  5G55 A;  2ZEQ A; 
#chains in the Genus database with same CATH topology
 3M3J A;  4REZ A;  2IGG A;  2O2V A;  1LO5 D;  1N63 A;  4XDC A;  2G4S A;  1ZDV A;  3EHV A;  1HQR D;  1PGB A;  3IHP C;  3SFD B;  4W9F A;  3MFG A;  3CIR B;  3R3M A;  4L23 A;  5MPO A;  5G5H A;  5DPS A;  4KV2 A;  4DDI D;  3WIM A;  2LGY A;  2LD9 A;  1IGD A;  4RCO A;  2WU2 B;  4UDU C;  3AE8 B;  2N1W A;  4LTU A;  4BZA A;  1HEZ E;  3MHZ A;  2N9X A;  2RD0 A;  4MGI E;  4RGT A;  4Q2J A;  4G0N B;  4K1R B;  1U4A A;  2CKH B;  1ESF A;  2GBR A;  2GI9 A;  4A3P A;  3PGE A;  5BYR A;  2KFK A;  3KYD D;  2JT4 B;  1YQ4 B;  4FJZ A;  2M1M A;  4XWW A;  4FLH A;  4DWF A;  4TQ0 A;  2DHZ A;  2MH7 A;  5LXI B;  4BAX A;  4II3 B;  1ENF A;  1UGJ A;  4ZYS A;  5BMI A;  1ZUD 2;  3P42 A;  4MJS B;  2O6V D;  4C4V B;  3EC8 A;  3GZN I;  1ROE A;  5D94 A;  4HXD A;  2NCN A;  1KLU D;  2NBW B;  1J7B A;  2HTH A;  3DBS A;  4PT5 A;  1E90 A;  3AE6 B;  1F2R I;  2D10 A;  4HJG E;  2D5G A;  3B1L X;  3C19 A;  5HHD G;  3ZLZ A;  1TS3 A;  1Q10 A;  2D07 B;  5EDS A;  3BZD B;  3QA8 A;  3NVZ A;  4HJK A;  3R7R A;  2BWF A;  3NRZ A;  4XC2 A;  3I57 A;  1EU4 A;  4YSX B;  3BIN A;  4WJP A;  3ZXV A;  2G9H D;  4I6N B;  3HK0 A;  3DHG C;  1XCQ L;  3NG0 A;  3I3T B;  3V3X A;  2LXA A;  3AI5 A;  2PPH A;  1C1Y B;  1WJ6 A;  2HDE A;  1I4Q A;  2E3T A;  4RM8 A;  2KDB A;  2XNA C;  1B9R A;  3VXW A;  1WXA A;  3TCA A;  2BS4 B;  1WWT A;  4K3B A;  1VD2 A;  4D2K A;  3Q6B A;  2MEK A;  2WDV B;  1E8W A;  2J42 A;  5D3D A;  5CHV C;  4AJY B;  3AM9 A;  4M00 A;  2KXJ A;  2N9E B;  2JWZ A;  3S2A A;  1B1Z A;  2FNJ B;  4F7Z A;  2RR9 A;  4W9J A;  5DPT A;  1LQB A;  4EZJ A;  3VTV A;  2LGX A;  4PS7 A;  3BK2 A;  1MVK A;  3PRM B;  4XYC A;  1V8C A;  4C00 A;  4NZL B;  1WMH A;  5IP4 D;  4X57 B;  2GOW A;  2BYF A;  3APC A;  1FNU A;  1R7S A;  1YX5 B;  3AE4 B;  4MGK E;  3VVW B;  3AE3 B;  1UF0 A;  1TYG B;  3VUX A;  1KJT A;  2AWT A;  2RPQ A;  5E6N A;  4KGS A;  2WXR A;  3DBL I;  1UWM A;  4DHJ D;  5J2R A;  3ZXR A;  1BUI C;  1OFF A;  3M63 B;  1F1H A;  1K52 A;  3U4E G;  4YTM B;  2QMT A;  3N3K B;  3H7P A;  4ZOH C;  3JVZ X;  1SB3 C;  2PMV A;  3R66 C;  1OEY A;  1RWS A;  4E3C A;  1SE9 A;  2JPH A;  3W5V B;  2KN4 A;  2WXJ A;  2BS3 B;  2EKE C;  1LM8 B;  2B76 B;  2INN E;  4NAW A;  3QAQ A;  2LRW A;  2CR5 A;  4MEM A;  2KTR A;  2WU5 B;  1P0R A;  3FAH A;  3WAO A;  1SIJ A;  4XZ4 A;  3Q3M C;  2QEJ C;  3AMZ A;  3WAN A;  2D3G A;  1UD7 A;  3TL5 A;  1J7A A;  5CHW A;  2PE9 A;  3WAM A;  2OHF A;  2LHD A;  1MG8 A;  4JWS C;  3L08 A;  1XXG A;  1XQQ A;  1ZOY B;  3AE7 B;  1GC6 A;  4H2A A;  4N58 A;  3APD A;  3JSV A;  5EE3 A;  2IO2 B;  2JRI B;  5IN7 A;  4ARI A;  4HK2 A;  3A33 B;  2RPV A;  4DXG A;  2WX0 A;  2DZK A;  1D5M C;  3IFW B;  1JRU A;  1V49 A;  2MWS B;  2M17 A;  3DHI C;  1XLQ A;  2Y5P A;  5JXV A;  4MGY E;  3EFC A;  2IO1 B;  4YTN B;  3ZJU A;  5BMH A;  2KD0 A;  2J4X A;  1STE A;  3MHS D;  1N6Z A;  3VTW A;  2D2Q A;  1A70 A;  2L3Z A;  5FR6 A;  4BKS A;  2PTL A;  3GP7 A;  4BOS C;  2IO3 B;  1JCK B;  3V6C B;  3T3O A;  3N1Y C;  3V6E B;  3ZNZ B;  5CX3 A;  3PRE A;  3UF8 A;  2IYD B;  2JRH A;  2KN5 A;  3OAW A;  4A6Q A;  3VQI A;  2KWV B;  4MM3 A;  3Q14 C;  2W3R A;  3IVF A;  1V86 A;  1DOX A;  1WFY A;  4LLG M;  1NI3 A;  2R61 A;  1V5O A;  1FM0 D;  1SIF A;  1UZX B;  4RGM A;  4ZRI A;  2RMM A;  2A5U A;  1EF1 A;  2ZVO A;  1YNT E;  2JF5 A;  1CMX B;  1FEH A;  1C79 A;  4RNA A;  1TZ1 A;  4OHJ A;  3PZ8 A;  2WXF A;  1ACC A;  3APF A;  2BF8 B;  3Q8C A;  5FKA C;  1WYW B;  2BGF A;  3NS1 A;  4FHK A;  5TR5 A;  1JW9 D;  1I4H A;  3PZD A;  2UWQ A;  3V61 A;  2X8X X;  1VCB A;  2KTR B;  2GMI C;  2INP E;  1CK1 A;  3B9J A;  2NTT A;  3BVZ A;  2SAK A;  3UIN B;  3IG3 A;  4XE0 A;  4AP4 C;  1UGM A;  4M0W B;  2LVO A;  2KVZ A;  2I1K A;  1TTN A;  2WXN A;  4FJV B;  4TMA B;  3VR8 B;  3O65 B;  2INC C;  2KQ7 A;  5AUI A;  1F52 A;  1FFV A;  2H89 B;  3P1M A;  4EZK A;  2RDG A;  2BYE A;  1MFW A;  3DBH I;  3TJP A;  2DLB A;  1GJZ A;  1FRD A;  3OLM D;  2W55 A;  1C76 A;  2KX3 A;  2IZV B;  4GXB A;  1R4M B;  1QT9 A;  2VZK B;  2XN9 C;  4NY0 A;  3VDZ A;  4KIK A;  3I5J C;  3W2D A;  2ZJD A;  1BT0 A;  1OTR B;  2TSS A;  3H8H A;  3BYT B;  5L95 C;  4K81 A;  5G2N A;  3W5U B;  3T8M A;  4IUM B;  2DYM A;  2LVP A;  4A3O A;  1SJE D;  1SSN A;  2IPK D;  2J53 A;  4GMV A;  2K8B A;  3TEX A;  5D3I B;  1DOY A;  3R2T A;  1SEB D;  4LNK A;  1V2Y A;  1N5W A;  4BKG A;  3ZTC A;  3U2S C;  4E74 A;  3A9J B;  4PYZ A;  2V4I B;  4G11 A;  1JAL A;  2AYO B;  4FBJ B;  3SR6 A;  4MDK E;  2DNF A;  4I6P A;  1RM6 C;  2IO0 B;  4A90 A;  3RT3 B;  3DOW A;  1LXD A;  1QQR A;  1JML A;  3I9V 1;  1A5R A;  4EOY A;  2DWQ A;  2WDT B;  1WIA A;  5C3J B;  1QOA A;  3BII D;  4WWM A;  2FID A;  2KMM A;  2FCS A;  2M19 A;  5AZG A;  2SEB D;  1WR1 A;  5LLI A;  2MA9 B;  1OQY A;  1FO4 A;  4ICU A;  2FBW B;  3GZN B;  1HTO A;  1E9M A;  3A9K B;  5CTR C;  2MW5 A;  4C7Y A;  4DXA B;  4TQ1 A;  4WWP A;  3Q8B A;  3V62 A;  3PS6 A;  4HEA 1;  2Z59 B;  1E5W A;  3AE1 B;  4EUT A;  3Q8E A;  4TSS A;  2OOB B;  1JQ4 A;  1K8R B;  4WAF A;  4DHZ B;  2YEP F;  2DEN B;  1J7C A;  3W1S C;  3KH0 A;  3VUY A;  2ACZ B;  4NQK E;  2IBI B;  4F8C B;  2L52 A;  4A20 A;  3AE5 B;  2JZ3 B;  1I4G A;  3ZRF A;  3H9D A;  4GDL B;  2KWD A;  2K9X A;  2DZJ A;  4B0M A;  2M56 B;  3KW5 B;  2WQY B;  2L83 A;  4KSL C;  2LVQ A;  3SEB A;  3AEF B;  5D6J B;  2W54 A;  4KSK C;  2QJL A;  1TS4 A;  4LJO B;  3N1X C;  1GB4 A;  1L6V A;  3AU4 A;  3MC0 B;  1I4P A;  1WGK A;  1XF5 L;  3AEC B;  2V3N A;  1ET9 A;  1RFK A;  2JX5 A;  2HE7 A;  2REX A;  2ICI A;  1L0Y B;  4BFR A;  4BKT A;  4JL9 A;  4YWG G;  4PS3 A;  1BML C;  4WJO A;  1VRA B;  2MBQ A;  3RPF C;  2ZVN A;  1I42 A;  4URK A;  1AN8 A;  1J8C A;  4WJN A;  3ZDT A;  1S1Q B;  1G6J A;  4US8 A;  2DZI A;  4L1B A;  2KLC A;  5TSS A;  3I63 C;  4GOC A;  2JYE A;  5AUK A;  4LCD E;  1WXV A;  4A9A A;  4OVV A;  1T0S C;  1XD3 B;  2J0M A;  1RAX A;  3KWL A;  1QIL A;  2MP2 B;  5DPW A;  1L4Z B;  4IW0 A;  1KM7 A;  3RCZ A;  1UUP A;  2OED A;  3HIZ A;  3C0R B;  3DWG C;  2MLB A;  1RLF A;  2KO3 A;  3VR9 B;  2AX5 A;  2KAN A;  3BY4 B;  2WNM A;  2VZK D;  4GDK B;  4B9K A;  1AAR A;  3MJ5 A;  1CZP A;  3DBL B;  1QZE A;  1ZW7 A;  5HFY A;  4IM2 A;  5FR3 A;  4KX6 B;  2Z0E B;  2LGD A;  3NZ3 A;  4BOZ B;  4WIP A;  2R2O A;  3MC9 A;  4CHK A;  2ZPN A;  1Y56 A;  4JWU C;  3ZRC A;  1L5P A;  4LNO A;  3AEE B;  3RMK C;  3VHT C;  3BVM A;  3B08 A;  1V97 A;  1WXQ A;  1JWB D;  1ZDX A;  1Z2M A;  3K9O B;  4DK5 A;  4B6W A;  3L4P A;  1PDX A;  4ZHP A;  3R2I A;  1D5X C;  3HHM A;  2WP9 B;  2LJ5 A;  3NVY A;  2BB6 A;  1FCL A;  4AJW A;  2Z8L A;  1SE4 A;  3SFE B;  2FUH B;  2LAS A;  5EE1 A;  2XEW A;  2JQR B;  5E6J A;  3R7Q A;  2BBC A;  2G4D B;  3W9C B;  4EZL A;  4KZC A;  2NS5 A;  4DXF A;  4MT5 A;  4GLS C;  4XWT A;  3ECI A;  1YOV B;  1XLO A;  3TEZ A;  1X1M A;  1E8Y A;  1FPY A;  2H88 B;  2AQ1 B;  3L10 B;  3RZW C;  3RYT A;  4GSW A;  2CU3 A;  1AWD A;  4JX1 C;  1V1P B;  3ZQ4 A;  4K7S A;  3TBL D;  2I1J A;  3EUB 2;  1J19 A;  1V81 A;  5H92 C;  3LXF A;  2CHW A;  3Q8A A;  4WAA A;  3ZGZ A;  2RSU A;  3QCA A;  3KUD B;  4WQO B;  4ICV A;  2PLP A;  1NI2 A;  5C1Z A;  2GBM A;  3CWI A;  4BBN C;  1T6B X;  4DQO C;  2KDE B;  2O2V B;  3ML8 A;  1IBX A;  2JY6 A;  3HUI A;  1MHH E;  5D2M B;  1BXT A;  4OVU A;  1M94 A;  1T3Q A;  2LGS A;  2HJ8 A;  2CS4 A;  4IOI E;  3WA0 A;  4IWO A;  3PV1 A;  4I6L B;  2KJR A;  1I35 A;  2N7J A;  5JHA A;  3TEW A;  4NQL B;  1XLP A;  1YX6 B;  4MH0 E;  4HPM B;  2EMT A;  2KWC A;  3RNF C;  3U30 A;  5C23 A;  2KFK B;  2KJH B;  2BPS A;  2BT6 A;  3DDC B;  5KHO A;  2QSD A;  2BWE S;  2CJN A;  3BVG A;  4IKG A;  1WRD B;  2KC2 A;  2L0T A;  2ONQ A;  3UGB B;  2N9P C;  3VAW A;  2HJ1 A;  1GC7 A;  2MRP A;  2L05 A;  4B95 A;  2KYW A;  1QKZ A;  1PYW D;  1ET6 A;  5AZH A;  5LXH A;  2LEK A;  1ZKH A;  1E6E B;  1FRR A;  2MJD A;  3A1Q A;  3Q3F A;  2OJW A;  2NTS A;  4XDD A;  4W9I A;  4FN2 A;  3IXS A;  2PW9 A;  3N32 A;  1OQQ A;  2BYV E;  3L17 A;  2OJR A;  3SD5 A;  2FCQ A;  2IY1 B;  1WJ4 A;  3KYC D;  4BBN F;  1SE2 A;  2DX5 B;  2B3A A;  3PHW B;  3DBH B;  1VZ8 A;  2LUM A;  1P7E A;  1UBQ A;  2KWU B;  3ZW3 A;  4KKI A;  2MJE A;  4FAD A;  1C4P A;  1E8Z A;  4IG7 B;  2VH1 A;  4NPN A;  4GGQ A;  2Y5B B;  1HXY D;  3OWE B;  2K5P A;  2IGH A;  3CST A;  5BYS A;  4IC7 B;  2MX2 A;  2IY0 B;  2KT7 A;  1MG4 A;  1DYQ A;  2QHO A;  1Q5W B;  1FFU A;  4YT0 B;  1XEE A;  3NZS A;  1TKG A;  5GMV A;  3ENE A;  2CHX A;  1YQ3 B;  2M4N A;  2UYZ B;  2LJI A;  2WXH A;  5KHQ A;  3PTF C;  2J7Q B;  1EWY C;  2KKC A;  4M01 A;  4QAY A;  1TS5 A;  3QJZ A;  2DBY A;  3IAM 1;  4AOF A;  5GXG B;  4ZRJ A;  4HPP A;  1WMH B;  4OZA A;  1M4V A;  1V5T A;  4P1C C;  1JRO A;  3LDZ E;  2XK5 A;  3GOE A;  4IM3 A;  3AEG B;  4HWI B;  1T0Y A;  4OZC A;  2KTF A;  2MBE A;  5FK9 C;  4RF1 A;  2DYB A;  3U52 E;  2BYT A;  1WGY A;  4CO7 A;  1EU3 A;  3Q69 A;  2I38 A;  4NAM A;  1HE8 A;  4MSM B;  4LNF A;  3AV8 A;  4TKN A;  1AYF A;  4W9E A;  3H7P B;  3RNC C;  2FCM A;  2BQQ A;  3A1Q B;  2L00 B;  4HLE A;  1RRB A;  4F1S A;  2L32 A;  4KKJ A;  3ZTD A;  2KAC A;  4P1B C;  4HRO A;  1Q1O A;  2JUO A;  4NAW B;  1L0X B;  4ZRK A;  4LDT B;  1TJE A;  2W9N A;  2NMQ A;  4RGN A;  3PRZ A;  4B0E A;  4ACF A;  1XCT L;  4L2Y A;  5BYQ A;  1WI0 A;  1F77 A;  3UIO B;  3T9L A;  3HVZ A;  4P6V F;  3PT2 B;  2K8H A;  4KVG B;  4J3O D;  2K0P A;  4P7I A;  1UBI A;  2N1V A;  2WXG A;  2FAZ A;  3JSV B;  3QK0 A;  5C2T B;  4CYE A;  1YN5 A;  4N59 A;  3L0W B;  4JLC A;  2WXI A;  1NVI D;  2KX0 A;  1QLB B;  1PGX A;  3RUL A;  4K7W A;  3BK1 A;  1FXI A;  4RGO S;  3RNB C;  5L83 A;  2J52 A;  1V1O A;  2FIF A;  3QIJ A;  4RH6 A;  3WAP A;  4GIV A;  2BS2 B;  4WWO A;  1WX9 A;  3Q8F A;  2KJ6 A;  3OJ3 A;  2D3C A;  1V6E A;  4FXC A;  1MI0 A;  1WX8 A;  1EM7 A;  4WH4 A;  1VJK A;  4US9 A;  1GAQ B;  1E7P B;  5H8Y E;  4ANW A;  1UWX A;  1QF6 A;  1V9J A;  5J17 A;  2W3S A;  3FC4 A;  2FE8 A;  3PPA A;  1WF9 A;  3Q2A C;  1L2N A;  1FXT B;  2V3S A;  3KUZ A;  5HG2 A;  1J0G A;  2C7M B;  3RZF A;  1IP9 A;  3RD2 A;  1RFA A;  2M0X A;  3N9Y C;  3AED B;  3NY5 A;  4MM3 B;  2BVC A;  1P9D U;  1WJU A;  4M02 A;  3ML9 A;  3NOB A;  3ZYY X;  2L0F A;  2DZM A;  3ZNI D;  1TY0 A;  3VH4 B;  1T5X D;  2EMS A;  2WDQ B;  3B2F A;  2KFJ A;  5E6O A;  3R8B A;  4KGR A;  2YVC A;  4RF0 A;  3TSS A;  4NJC A;  1YN4 A;  3NZU A;  3RNA C;  1YN3 A;  1S3S G;  2ZW1 A;  1TT5 B;  2JYT A;  1E7U A;  4R3D A;  2Q5W D;  3AEA B;  1KLV A;  2KQS A;  2Y5C A;  2KAJ A;  2IDY A;  1KF6 B;  3URY A;  2MSE D;  3EFU A;  2V0G A;  4EFO A;  3PO0 A;  4DDG D;  3ZIM A;  2PJH A;  3B2G A;  4OW0 A;  5IAA C;  3X23 A;  3ABV B;  4HDO A;  1SF0 A;  4AQ7 A;  3WAL A;  3HM6 X;  4YSY B;  1YJ1 A;  3AXC A;  3PZ7 A;  5IKC M;  2LGI A;  3TUO A;  3RN9 C;  3RFZ B;  2PVG C;  1WJN A;  1C78 A;  3EEC A;  1XLN A;  4RFB A;  2AQ2 B;  2R2Q A;  1UH6 A;  1SJH D;  2JZP A;  1YIW A;  5IO9 A;  3Q3N C;  4MJS A;  3SDL C;  4C4V A;  2KZR A;  2KDM A;  4YXD B;  1XO3 A;  4JIO U;  2WXK A;  4KIK B;  3ZUN A;  3MJW A;  2CHZ A;  2PE6 B;  4MH8 A;  1EUV B;  3EA6 A;  2PIA A;  2KOX A;  4ANU A;  2KMC A;  1KRH A;  2KLG A;  3KVF B;  1SXT A;  1E0Z A;  3PLV A;  3ONS A;  4FA6 A;  4LDT D;  2PVO D;  1L0V B;  3V60 A;  3DBR I;  1E10 A;  3PRP B;  5IOI A;  1SBB B;  3EGR A;  3H7S A;  4YSZ B;  1TKE A;  4GU2 A;  1F9J A;  1JWA D;  3GE3 C;  2GBK A;  1P3Q U;  2L76 A;  3N1Z C;  1WE7 A;  2G1E A;  3NJT A;  3M95 A;  1GUA B;  1IPG A;  1ZGU B;  2QDF A;  1VR9 A;  3ETR A;  3AE2 B;  2MBH A;  4ZRP A;  2V9H A;  2MBO A;  1LFD A;  4ASW C;  1D6E C;  3W1S A;  1HTQ A;  3NVV A;  4J6I A;  2WYQ A;  1T0R C;  3ZJV A;  2JVC A;  3P4P B;  1N5X A;  1K51 A;  4S0R A;  4HCN B;  2JWU A;  2D3A A;  4BKS D;  4AUQ C;  1NYR A;  2NBU A;  5EE0 A;  4DHZ E;  1K50 A;  2WGS A;  1FMA D;  3AU5 A;  1WM2 A;  4W9H A;  3T3N A;  4IWQ A;  2ASQ A;  3H1U A;  2DAF A;  3LYY A;  1EWC A;  3ZDM C;  2YEP B;  1JRP A;  1T0Q C;  4G50 A;  2W82 A;  1WZ3 A;  4RM9 A;  3AB5 A;  4W9D A;  4XX5 A;  3IT4 B;  1WXM A;  5AEK B;  3L54 A;  1WSP A;  3DVN U;  2LUE A;  2E6X A;  4YL8 A;  4ZDV A;  3Q3O C;  2RDH A;  3K9P B;  3QAR A;  3U7D A;  3V05 A;  4EEW A;  1ZXI A;  2LRU A;  5T8I A;  1H4R A;  1YD8 U;  2L7R A;  2LWP A;  3AN1 A;  2GRI A;  4OVZ A;  3L16 A;  3DVG X;  3OG5 A;  3NS8 A;  4PK1 A;  2LXC A;  2GBN A;  2WS3 B;  2WXL A;  3N20 C;  2V4L A;  3AE9 B;  5HKH A;  1V80 A;  1NEK B;  1R4N B;  2AEH A;  1WE6 A;  5G5G A;  4LNN A;  5AZF A;  2IJ0 A;  2WLB A;  1I4X A;  1HZ6 A;  1QOF A;  2IND C;  1TBE A;  4KZ0 A;  3A4R A;  2KC1 A;  4USA A;  2K8C A;  2ZNV B;  5JH5 C;  1E7V A;  1TGZ B;  4O1N A;  1NEN B;  2JU6 X;  2X38 A;  3JW0 X;  4OZB A;  3TIX A;  3KWV A;  3E9S A;  1GG3 A;  2WHI A;  1WX7 A;  1IYF A;  1Q0W B;  2WXQ A;  2LZ6 A;  3DHH C;  2ZEQ A;  1FD6 A;  2D3B A;  4LK0 M;  2HTM E;  1WY8 A;  2ZCC A;  2ZW0 A;  2EKI A;  1HZ5 A;  3C8Y A;  5E6P A;  2N0S B;  1DGJ A;  2GB1 A;  3BYY B;  4ZRQ A;  1UNS A;  3M62 B;  3UQA A;  1L4D B;  1L6U A;  4XGA B;  2KDF B;  2K39 A;  1EO6 A;  2K25 A;  2QIE B;  4W9C A;  1P7F A;  3PLU A;  1NBF C;  4RMA A;  1AW7 A;  3RUI B;  2FUG 1;  2NBV B;  3CSF A;  4FHJ A;  1I7H A;  4JPS A;  3IAS 1;  1YJJ A;  2KK8 A;  5BO4 B;  5I4D A;  5J18 A;  1SGH A;  3A4S C;  4M8N A;  3P2B A;  1FNW A;  3BWU D;  3P4S B;  1GB1 A;  1MHX A;  2DAJ A;  1C4C A;  4S17 A;  5CHF A;  4W9K A;  3X0W A;  2D11 A;  1SE3 A;  3QC8 B;  1I4R A;  2GBJ A;  4W9L A;  1VZ6 A;  3NUH B;  1WGD A;  4MSQ B;  1YJI A;  4II2 B;  1L7Y A;  4G3X B;  4NJ7 A;  3PSE B;  2NR2 A;  4M0W A;  1ISN A;  2HD5 B;  1GNU A;  3VTU A;  2C7N B;  1K53 A;  2UU7 A;  2WWZ A;  3MTN B;  3AH7 A;  1R4N I;  3UQB A;  4ITK A;  4DBG A;  1IBX B;  3TEY A;  3QQ8 B;  2C9W B;  2ZCB A;  1VLB A;  3HRD D;  1PUT A;  3ZKJ C;  1OGW A;  1EF5 A;  2XBB C;  2WDR B;  2PKO A;  4PS8 A;  4WUR A;  3RI7 C;  3DVN V;  1MJD A;  2QCZ A;  2NPT A;  2G3Q B;  1WGR A;  3CMM B;  4HDQ A;  2KHW B;  1KFY B;  3KQ4 A;  3GB1 A;  1F2R C;  4CQN A;  3NHE B;  1QOB A;  2K6Q A;  3DPD A;  1H8C A;  3D32 A;  3RNE C;  3DQV A;  2BKF A;  2C5L C;  2AQ3 B;  1D3Z A;  1VDV A;  5DCN A;  2QC8 A;  1TIF A;  2MJ3 A;  1TY2 A;  3LJ3 A;  2K3U A;  3RNG C;  2VRR B;  2RGF A;  4C80 A;  4N9F 4;  4AWJ A;  4E71 A;  2BTE A;  2O6V A;  1FNV A;  3JYU A;  4EKU A;  3H6N A;  5EE9 A;  2JSV X;  3ZJT A;  4P16 A;  3FIL A;  3A9J A;  2J0K A;  3DVG Y;  4JGH B;  1FIQ A;  1MPE A;  4FJY A;  2WXM A;  1WZ0 A;  1P1A A;  4ANX A;  2ON8 A;  3TMP B;  4BVU C;  2PEA A;  1VZ7 A;  1KH0 A;  1KOT A;  1N60 A;  2JZZ A;  1ZE3 D;  4IWP A;  1OEY J;  4AS1 A;  5DPR A;  2LI5 A;  4JE3 B;  2Y3A A;  5JZE B;  2K6D B;  2N7D A;  4A55 A;  2WXP A;  2WX1 A;  3MP9 A;  1UEL A;  4HRS A;  4HKQ A;  1YQB A;  1LGR A;  4HCP B;  2MBB B;  2L1A A;  4EE2 A;  2K22 A;  4K3C A;  1KTK A;  2G45 B;  3P63 A;  3UIP B;  4TUU A;  3B0A A;  2V1Y A;  4GN1 A;  2MQJ A;  3VRA B;  1ZP0 B;  3A9K A;  3HVD A;  3KUC B;  3Q3J A;  5D7G A;  1E8X A;  1QOG A;  2CJO A;  4LNI A;  2I2Y A;  1DOI A;  3L13 A;  1NDD A;  3QHT A;  2YLM A;  1FCC C;  3WCQ A;  3P4R B;  2ZZP B;  4W9G A;  3GE8 C;  2GLS A;  3W1Y A;  2MCN B;  3KLS X;  4KDL B;  4HKZ E;  1C4A A;  3PHX B;  3AUL A;  4M8M A;  2NPT B;  1Z5S B;  3P4Q B;  4GDL A;  3DBR B;  4IM0 A;  2KDI A;  1JWU D;  2C7H A;  3DCG A;  1XT9 B;  1JWS D;  1TZO A;  2QIL A;  3J9C A;  2DYO A;  1D4B A;  2N9L A;  2XK5 B;  4GB9 A;  3SHQ A;  1C3T A;  1ZPS A;  2Z0D B;  5LNK 1;  1WGG A;  1WXS A;  3VRB B;  3LB8 C;  2BW2 A;  2BB5 A;  4TV3 A;  3E56 A;  4YTP B;  2O6V B;  4IDI A;  4MEL A;  3U8Z A;  3OJ4 B;  2MHJ A;  3UI3 A;  2C60 A;  2KNB A;  3FIL B;  3DWM A;  4HPL B;  4A8X C;  5JHB A;  2RDB C;  3NVW A;  4MAC A;  2LFI A;  2FCN A;  1Y8R C;  1OQR A;  5IA7 A;  4ANV A;  4NNJ B;  2IGD A;  3U7Z A;  3VFK A;  1GOZ A;  3N30 A;  2MP2 A;  1TS2 A;  2AL3 A;  4ZYN A;  4MGZ E;  2CU1 A;  1JWM D;  3CF6 E;  2J0J A;  2M0A A;  5BMG A;  2ZNV C;  3ZNG C;  2AL6 A;  3AEB B;  2WXO A;  4GDK A;  2K1F A;  1TKY A;  4ARC A;  2N7E A;  1D5Z C;  2JXT A;  3ZNH B;  4WWN A;  2KMA A;  4FUL A;  4ZHO A;  4KGT A;  3PVL A;  1WRI A;  1CJE A;  1N62 A;  1P98 A;  3IT6 B;  4WJQ A;  3ZVV A;  1F0Z A;  2KVR A;  1GPX A;  2VH2 A;  3IBE A;  2M8S A;  1C77 A;  3GS2 A;  4KDI C;  2ZPY A;  1RYJ A;  3HM3 A;  2N9K A;  3VUW A;  4NJ6 A;  1WGH A;  2N4F A;  2NVU I;  4K7U A;  3QX1 A;  1PGA A;  1WH3 A;  1IUE A;  2A4Z A;  3VH3 B;  1NYQ A;  2EEL A;  4LJP B;  3ALB A;  1KLG D;  1N61 A;  2KQ4 X;  2V3P A;  1ZXH A;  1FXA A;  2BKR B;  2LHE A;  3FKY A;  3SU8 X;  1PFD A;  1IGC A;  3MC8 A;  1CQV A;  3QWZ B;  4C56 C;  4PYU A;  1C9F A;  1R4M I;  1PQS A;  2JXX A;  1WM3 A;  1V1P A;  2L8J A;  1WYG A;  4C7Z A;  4DHJ B;  3O13 A;  2LMC A;  1YMH E;  4WQM A;  5HI1 A;  4HVB A;  4JQW C;  1WR6 E;  1HA5 A;  3ZO5 B;  5G55 A;  4N6E B; 
#chains in the Genus database with same CATH homology
 3M3J A;  1WMH B;  2O2V A;  1V2Y A;  2G4S A;  1V5T A;  3EHV A;  4BKG A;  1WY8 A;  2ZCC A;  3IHP C;  3ZTC A;  3LDZ E;  3A9J B;  4W9F A;  4PYZ A;  2XK5 A;  4E74 A;  3R3M A;  3GOE A;  4IM3 A;  4G11 A;  5DPS A;  4KV2 A;  4HWI B;  4DDI D;  3WIM A;  2LGY A;  1T0Y A;  2LD9 A;  5E6P A;  2AYO B;  2KTF A;  2MBE A;  4FBJ B;  2DYB A;  1WGY A;  2N1W A;  4ZRJ A;  3M62 B;  3UQA A;  4MDK E;  4I6P A;  2KDF B;  2K39 A;  2N9X A;  2RD0 A;  4MGI E;  4CO7 A;  2IO0 B;  1EO6 A;  1HE8 A;  4G0N B;  4MSM B;  4K1R B;  1U4A A;  3RT3 B;  2CKH B;  2GBR A;  3DOW A;  4A3P A;  2K25 A;  4W9C A;  1LXD A;  3PGE A;  1A5R A;  3PLU A;  4EOY A;  1NBF C;  4RMA A;  4TKN A;  2WDT B;  4W9E A;  3H7P B;  3RUI B;  2FCM A;  1WIA A;  2NBV B;  3A1Q B;  3CSF A;  4FHJ A;  2L00 B;  5BO4 B;  2KFK A;  2FID A;  2KK8 A;  3KYD D;  2FCS A;  2JT4 B;  4HLE A;  5J18 A;  5AZG A;  1RRB A;  1WR1 A;  4FJZ A;  5LLI A;  4F1S A;  1SGH A;  2MA9 B;  2M1M A;  3ZTD A;  1OQY A;  3A4S C;  4FLH A;  4M8N A;  4DWF A;  4TQ0 A;  3P2B A;  2DHZ A;  4ICU A;  5LXI B;  4II3 B;  1Q1O A;  2JUO A;  3A9K B;  4NAW B;  5CTR C;  2MW5 A;  4DXA B;  4TQ1 A;  4WWP A;  3V62 A;  4ZRK A;  2DAJ A;  4LDT B;  2W9N A;  4MJS B;  5CHF A;  2O6V D;  3PS6 A;  4W9K A;  2Z59 B;  1E5W A;  3PRZ A;  4EUT A;  3X0W A;  3EC8 A;  2D11 A;  3GZN I;  2OOB B;  3QC8 B;  1K8R B;  1WI0 A;  5D94 A;  3UIO B;  4HXD A;  2NCN A;  3T9L A;  4DHZ B;  2DEN B;  3W1S C;  2NBW B;  3KH0 A;  3VUY A;  3PT2 B;  4NQK E;  2IBI B;  2K8H A;  2HTH A;  3DBS A;  4KVG B;  4F8C B;  2GBJ A;  4P7I A;  1UBI A;  2N1V A;  3JSV B;  2FAZ A;  4W9L A;  3QK0 A;  4CYE A;  1E90 A;  4A20 A;  1WGD A;  2D10 A;  2JZ3 B;  4MSQ B;  4II2 B;  1L7Y A;  3L0W B;  4G3X B;  4JLC A;  3ZRF A;  4NJ7 A;  2KX0 A;  3B1L X;  3H9D A;  4GDL B;  3ZLZ A;  3PSE B;  2DZJ A;  4K7W A;  3RUL A;  2NR2 A;  3KW5 B;  5L83 A;  4KSL C;  2LVQ A;  2D07 B;  5EDS A;  3QA8 A;  1ISN A;  4HJK A;  2HD5 B;  1GNU A;  3R7R A;  2C7N B;  2FIF A;  3QIJ A;  4KSK C;  5D6J B;  3VTU A;  2BWF A;  4LJO B;  2WWZ A;  3MTN B;  4XC2 A;  1R4N I;  4GIV A;  3WAP A;  3UQB A;  4WWO A;  1WX9 A;  3AU4 A;  4DBG A;  3BIN A;  2KJ6 A;  4WJP A;  3OJ3 A;  1V6E A;  3QQ8 B;  4I6N B;  2C9W B;  3HK0 A;  2ZCB A;  1WX8 A;  2HE7 A;  3I3T B;  3ZKJ C;  2REX A;  1OGW A;  2LXA A;  1EF5 A;  2XBB C;  3AI5 A;  2PPH A;  4BFR A;  1C1Y B;  4PS8 A;  4ANW A;  1WJ6 A;  3DVN V;  4BKT A;  4RM8 A;  4JL9 A;  1V9J A;  4PS3 A;  2NPT A;  2KDB A;  4WJO A;  5J17 A;  3VXW A;  2G3Q B;  1WXA A;  2MBQ A;  3PPA A;  1WF9 A;  1WGR A;  3CMM B;  4HDQ A;  2ZVN A;  3TCA A;  1I42 A;  1L2N A;  1VD2 A;  4URK A;  2KHW B;  1FXT B;  1J8C A;  2V3S A;  4WJN A;  1E8W A;  3KUZ A;  3ZDT A;  1J0G A;  1S1Q B;  2C7M B;  3NHE B;  3RZF A;  1G6J A;  1IP9 A;  5CHV C;  2DZI A;  2K6Q A;  3RD2 A;  1RFA A;  4AJY B;  2M0X A;  2KLC A;  3DPD A;  4GOC A;  2KXJ A;  2N9E B;  2JWZ A;  1WXV A;  4LCD E;  1H8C A;  3NY5 A;  4OVV A;  3D32 A;  3S2A A;  2FNJ B;  4F7Z A;  1P9D U;  1WJU A;  2RR9 A;  3ML9 A;  1XD3 B;  3NOB A;  2J0M A;  4W9J A;  1RAX A;  3DQV A;  2BKF A;  2C5L C;  1LQB A;  5DPT A;  4EZJ A;  1D3Z A;  3VTV A;  2LGX A;  4PS7 A;  5DCN A;  2MP2 B;  5DPW A;  3PRM B;  3LJ3 A;  2L0F A;  4IW0 A;  1KM7 A;  3RCZ A;  2DZM A;  2VRR B;  2RGF A;  4N9F 4;  3ZNI D;  3HIZ A;  4AWJ A;  4E71 A;  3VH4 B;  2EMS A;  3C0R B;  2O6V A;  2MLB A;  3JYU A;  4EKU A;  1RLF A;  1WMH A;  3H6N A;  2KO3 A;  4X57 B;  2GOW A;  2KAN A;  2KFJ A;  3BY4 B;  2BYF A;  3APC A;  5E6O A;  1YX5 B;  4GDK B;  4B9K A;  3A9J A;  1AAR A;  4MGK E;  2J0K A;  2YVC A;  3DVG Y;  3VVW B;  4JGH B;  1QZE A;  4FJY A;  1ZW7 A;  3NZU A;  4IM2 A;  1WZ0 A;  1P1A A;  4ANX A;  1S3S G;  3TMP B;  2Z0E B;  2LGD A;  4BVU C;  1E7U A;  3VUX A;  1KJT A;  2AWT A;  2PEA A;  2RPQ A;  5E6N A;  4BOZ B;  2R2O A;  2KQS A;  1KLV A;  4CHK A;  1KOT A;  2ZPN A;  3DBL I;  2JZZ A;  3ZRC A;  2MSE D;  3EFU A;  4IWP A;  1OEY J;  4DHJ D;  4EFO A;  5J2R A;  5DPR A;  4DDG D;  3ZIM A;  2LI5 A;  2PJH A;  5JZE B;  2K6D B;  2N7D A;  3VHT C;  3M63 B;  5IAA C;  2WX1 A;  3B08 A;  3X23 A;  1UEL A;  3N3K B;  3H7P A;  1YQB A;  3JVZ X;  4HDO A;  3WAL A;  1Z2M A;  3K9O B;  3HM6 X;  4HCP B;  4B6W A;  4DK5 A;  2MBB B;  1YJ1 A;  3R66 C;  1OEY A;  3AXC A;  4E3C A;  3HHM A;  2G45 B;  3UIP B;  1SE9 A;  4TUU A;  2JPH A;  2LJ5 A;  3B0A A;  2V1Y A;  2EKE C;  1LM8 B;  4GN1 A;  1WJN A;  2MQJ A;  4AJW A;  3A9K A;  3EEC A;  3QAQ A;  3KUC B;  4NAW A;  2LRW A;  2CR5 A;  3Q3J A;  1E8X A;  2R2Q A;  1UH6 A;  4MEM A;  2FUH B;  2KTR A;  5D7G A;  1P0R A;  3WAO A;  2LAS A;  2XEW A;  1YIW A;  4XZ4 A;  4MJS A;  3R7Q A;  3L13 A;  1NDD A;  3SDL C;  3WAN A;  4EZL A;  2G4D B;  2KZR A;  2D3G A;  1UD7 A;  3QHT A;  3TL5 A;  2YLM A;  4KZC A;  2NS5 A;  4JIO U;  5CHW A;  2PE9 A;  3WAM A;  2ZZP B;  4W9G A;  3ECI A;  1MG8 A;  3W1Y A;  4KIK B;  2MCN B;  1X1M A;  3L08 A;  1E8Y A;  4KDL B;  1XQQ A;  3MJW A;  2CHZ A;  2PE6 B;  3ZUN A;  3L10 B;  1EUV B;  1GC6 A;  3RZW C;  3APD A;  3JSV A;  3RYT A;  4GSW A;  2IO2 B;  2JRI B;  3PHX B;  3AUL A;  2KOX A;  4HK2 A;  4M8M A;  4K7S A;  3TBL D;  4ANU A;  2I1J A;  3A33 B;  2WX0 A;  1J19 A;  2KMC A;  1V81 A;  1Z5S B;  2DZK A;  2NPT B;  4GDL A;  4IM0 A;  2KDI A;  2CHW A;  2C7H A;  3DCG A;  3IFW B;  4WAA A;  2KLG A;  2RSU A;  3KVF B;  3QCA A;  3KUD B;  1JRU A;  1V49 A;  1XT9 B;  4WQO B;  3PLV A;  2MWS B;  4ICV A;  2M17 A;  1NI2 A;  5C1Z A;  3ONS A;  2GBM A;  4FA6 A;  4LDT D;  4BBN C;  2KDE B;  4MGY E;  2DYO A;  2O2V B;  3ML8 A;  3V60 A;  3DBR I;  2IO1 B;  2JY6 A;  2XK5 B;  4GB9 A;  3SHQ A;  1C3T A;  3PRP B;  5D2M B;  2Z0D B;  4OVU A;  1WGG A;  1WXS A;  2KD0 A;  3MHS D;  1M94 A;  3H7S A;  3VTW A;  2D2Q A;  2L3Z A;  4GU2 A;  2HJ8 A;  4TV3 A;  2CS4 A;  1F9J A;  3WA0 A;  5FR6 A;  4IWO A;  4BKS A;  3PV1 A;  2GBK A;  1P3Q U;  2L76 A;  4I6L B;  1WE7 A;  2KJR A;  4BOS C;  2IO3 B;  1I35 A;  3M95 A;  2O6V B;  5JHA A;  4MEL A;  1GUA B;  3V6C B;  1IPG A;  1ZGU B;  3U8Z A;  4NQL B;  1YX6 B;  3OJ4 B;  4MH0 E;  3V6E B;  3ZNZ B;  4HPM B;  5CX3 A;  2C60 A;  2EMT A;  2KWC A;  2KNB A;  3PRE A;  3UF8 A;  2IYD B;  2MBH A;  4HPL B;  2JRH A;  5JHB A;  3U30 A;  5C23 A;  2KN5 A;  3OAW A;  3VQI A;  2MBO A;  2KWV B;  1LFD A;  2KFK B;  4ASW C;  4MM3 A;  2KJH B;  2FCN A;  2BPS A;  3W1S A;  1Y8R C;  3IVF A;  3DDC B;  5IA7 A;  1V86 A;  4ANV A;  4NNJ B;  1WFY A;  4J6I A;  3VFK A;  2WYQ A;  3N30 A;  5KHO A;  1UZX B;  1SIF A;  1V5O A;  2BWE S;  2JVC A;  2MP2 A;  1WRD B;  4HCN B;  4ZRI A;  2KC2 A;  2AL3 A;  2L0T A;  4ZYN A;  2A5U A;  4MGZ E;  1EF1 A;  4BKS D;  2ZVO A;  2CU1 A;  4AUQ C;  2NBU A;  2JF5 A;  4DHZ E;  1CMX B;  3CF6 E;  2J0J A;  3UGB B;  2N9P C;  2ZNV C;  3VAW A;  3ZNG C;  1WM2 A;  2AL6 A;  1GC7 A;  3AU5 A;  2MRP A;  1TZ1 A;  2ASQ A;  2L05 A;  3H1U A;  4IWQ A;  4W9H A;  2DAF A;  4GDK A;  4B95 A;  3ZDM C;  3APF A;  2K1F A;  2BF8 B;  5AZH A;  4G50 A;  2N7E A;  5LXH A;  1WZ3 A;  1ZKH A;  3A1Q A;  3ZNH B;  4RM9 A;  3Q3F A;  4W9D A;  4WWN A;  4XX5 A;  1WXM A;  5AEK B;  2KMA A;  4W9I A;  1WYW B;  2BGF A;  3L54 A;  4FHK A;  4FUL A;  4FN2 A;  3DVN U;  5TR5 A;  2LUE A;  4YL8 A;  3N32 A;  3PZD A;  2UWQ A;  4ZDV A;  3V61 A;  1VCB A;  3K9P B;  2BYV E;  2KTR B;  2GMI C;  3QAR A;  3PVL A;  3U7D A;  4EEW A;  2LRU A;  1H4R A;  3L17 A;  2OJR A;  3SD5 A;  3UIN B;  1P98 A;  1YD8 U;  2L7R A;  2LWP A;  3IG3 A;  4WJQ A;  4AP4 C;  1UGM A;  4M0W B;  2FCQ A;  2IY1 B;  2LVO A;  3ZVV A;  3L16 A;  3DVG X;  2I1K A;  2KVR A;  1WJ4 A;  3NS8 A;  1TTN A;  2LXC A;  2GBN A;  3KYC D;  4FJV B;  3IBE A;  2M8S A;  4BBN F;  4KDI C;  2DX5 B;  2ZPY A;  2B3A A;  3PHW B;  3O65 B;  1UBQ A;  2KWU B;  3HM3 A;  2KQ7 A;  2V4L A;  3VUW A;  3ZW3 A;  5HKH A;  4FAD A;  1V80 A;  4NJ6 A;  1E8Z A;  4IG7 B;  1WGH A;  2N4F A;  2NVU I;  4K7U A;  2AEH A;  3QX1 A;  4EZK A;  1WH3 A;  1WE6 A;  2BYE A;  4NPN A;  2A4Z A;  3DBH I;  3TJP A;  3VH3 B;  4GGQ A;  5AZF A;  1GJZ A;  2Y5B B;  3OLM D;  4LJP B;  3ALB A;  2KX3 A;  2IZV B;  4GXB A;  3CST A;  4IC7 B;  2MX2 A;  1TBE A;  2IY0 B;  4KZ0 A;  4NY0 A;  3A4R A;  2KC1 A;  2BKR B;  3VDZ A;  2K8C A;  2ZNV B;  2QHO A;  3SU8 X;  4KIK A;  1Q5W B;  5JH5 C;  1E7V A;  1TGZ B;  2ZJD A;  3QWZ B;  1BT0 A;  4PYU A;  1OTR B;  3JW0 X;  5L95 C;  4K81 A;  1R4M I;  1PQS A;  3NZS A;  5G2N A;  2JXX A;  5GMV A;  3T8M A;  3TIX A;  3ENE A;  1WM3 A;  2CHX A;  2M4N A;  2UYZ B;  2L8J A;  4IUM B;  2DYM A;  2LVP A;  4A3O A;  4DHJ B;  1GG3 A;  5KHQ A;  3PTF C;  2J7Q B;  4GMV A;  4JQW C;  2KKC A;  2K8B A;  1WR6 E;  1WX7 A;  4HVB A;  3QJZ A;  1IYF A;  4AOF A;  3ZO5 B;  1Q0W B;  2LZ6 A;  5G55 A;  2ZEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...