2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords hypothetical protein Ta0895
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
3RPFC 2E3TA 4N6EB 3VR8B 2HTME 4YSZB 4US8A 1NYQA 1B9RA 1FIQA 2H88B 3AE5B 3BIID 4YTPB 1FMAD 4YTNB 2BT6A 2EKIA 1J7CA 2G1EA 2MJDA 3CIRB 5EE3A 1UWMA 3AE3B 2KMMA 1IUEA 5EE0A 5C2TB 4ZHPA 2BS4B 4ITKA 3AEBB 1TKYA 3FC4A 1N5XA 1DGJA 2DBYA 2OHFA 4YT0B 1R7SA 5AUIA 3ZYYX 2L52A 3P4SB 1FFUA 4HRSA 3P63A 5MPOA 1YJIA 1J7AA 2W3SA 1N62A 1E0ZA 1CZPA 3AV8A 3W9CB 1E10A 1RYJA 3CWIA 2WLBA 3WCQA 1N60A 4ZOHC 1SF0A 2WDQB 1AYFA 1FXAA 1J7BA 2BS3B 1EWYC 1N5WA 1PUTA 1L6UA 4YSYB 3FAHA 2K5PA 3SFDB 3VR9B 1PDXA 1VJKA 3AEEB 2PVGC 1QLBB 1CJEA 2JX5A 3AH7A 1V8CA 3NVYA 3W5UB 1RM6C 1XLQA 4N59A 1SIJA 4YSXB 2W54A 1YQ3B 3AE2B 2Q5WD 2WDRB 2CU3A 2ACZB 2K22A 3SFEB 1QT9A 2H89B 3EUB2 3LB8C 1RFKA 2WP9B 2WU5B 3AN1A 2M56B 1JQ4A 2M19A 3AECB 1YQ4B 3L4PA 4JWUC 1QF6A 1ZXIA 1JALA 2JQRB 1TKEA 1ZOYB 3AE4B 2LEKA 3DWMA 2CJNA 3HRDD 2MJEA 1XLPA 1L6VA 1GAQB 4USAA 5G5HA 3AEFB 3B9JA 1FXIA 2Y5CA 4WWMA 3AE9B 1TKGA 1XLOA 3AE1B 3AE6B 1RWSA 5EE1A 1QOAA 3NVWA 1F0ZA 1KF6B 3P4QB 2L83A 1DOIA 2W55A 1KRHA 3AEAB 3SR6A 1V97A 1OQQA 1FM0D 3P4RB 1PFDA 1JWAD 1WWTA 3KWLA 1NYRA 1WYGA 1E6EB 3B2GA 3AMZA 1VDVA 3PO0A 4JWSC 4C7YA 4ZHOA 1ZUD2 5C3JB 5EE9A 1E9MA 3ETRA 1L0VB 1WGKA 4WQMA 4C80A 3NS1A 3LXFA 2WQYB 4IDIA 3NRZA 1I7HA 3ABVB 3NVVA 2QIEB 4HROA 1VLBA 1N63A 2PVOD 1FFVA 1NEKB 2W3RA 1DOYA 2WU2B 3AEDB 2FBWB 3P4PB 5G5GA 1JROA 1NI3A 3W5VB 2MH7A 4YXDB 1QOGA 1TYGB 3AEGB 1A70A 1QOBA 1SB3C 2PKOA 5GXGB 4YTMB 1YJJA 2MJ3A 2WS3B 5H92C 3AE7B 1FO4A 5AUKA 2PIAA 1OFFA 2BS2B 4FXCA 1T3QA 1DOXA 1JRPA 2K9XA 3P1MA 1AWDA 1FRRA 3NVZA 4US9A 1JW9D 1WXQA 2CJOA 2WDVB 3AE8B 2KAJA 1L5PA 1N61A 3B2FA 3VRBB 4C7ZA 1NVID 2N0SB 3AB5A 3HVZA 2DWQA 1JWBD 1XLNA 3DWGC 1KFYB 4P6VF 4LTUA 4A9AA 2AX5A 2QJLA 3AM9A 1ROEA 1FRDA 1XO3A 1OQRA 1WRIA 1ZP0B 4JX1C 4KX6B 4N58A 3HUIA 1GPXA 5H8YE 1NENB 2B76B 1QOFA 1E7PB 1TJEA 3VRAB
chains in the Genus database with same CATH superfamily
2ZPNA 4K3BA 1JWMD 2BS4B 4ITKA 1YX5B 1T0YA 3KLSX 4NAMA 4ZRJA 4A20A 2WLBA 1K50A 4PYUA 2GRIA 1OTRB 2AQ1B 2JY6A 4HCPB 1VJKA 4HPMB 2MBOA 1EU4A 1TZ1A 2BTEA 4L23A 4MSMB 2BPSA 3PREA 3A9KA 2C60A 3ZUNA 1Q1OA 1QF6A 2RDBC 4PYZA 1ZOYB 2LEKA 4GGQA 4KKJA 4BKSA 2OOBB 1FCCC 2JPHA 3R3MA 1UF0A 1FXIA 2Y5CA 3KH0A 3AE9B 1TKGA 1PYWD 1WXVA 2VRRB 5HFYA 2LRWA 4FULA 3BVMA 3P4QB 4RH6A 3KVFB 1KRHA 2EELA 5HG2A 3Q3MC 2XBBC 3N9YC 1HEZE 4G3XB 3VUYA 4ANXA 4JLCA 1V1OA 3KUDB 2NTSA 1E90A 4NNJB 3UGBB 1J0GA 1P0RA 2N7JA 2IO1B 2AL3A 1TZOA 1NI3A 2LHEA 1K8RB 4FHKA 1A70A 2N1WA 1SXTA 4HLEA 2KZRA 2LMCA 3N1ZC 4O1NA 4W9CA 1DOXA 4RGOS 2MRPA 1FRRA 3GS2A 3JVZX 3ZNZB 1C3TA 3QC8B 3Q6BA 4GOCA 1ZP0B 2IO2B 1OQRA 5FR3A 2INNE 5AZHA 3HUIA 4EOYA 2R2OA 1TJEA 2NVUI 2HTME 4JQWC 3H9DA 3PS6A 2WHIA 2N9LA 2Y5PA 3RN9C 2NMQA 1WX7A 3L13A 2M0XA 5CX3A 1EWCA 1WXSA 1E10A 4RGMA 4E71A 3R7RA 4PS7A 4L1BA 2HD5B 4BOZB 2KACA 1IP9A 3DBRB 3ENEA 4NAWB 5LNK1 1WE7A 1FD6A 4WJNA 2K6QA 3Q3OC 2JSVX 5KHOA 2IJ0A 4W9LA 1VZ7A 2D07B 2CHXA 2I38A 4ANVA 4WAAA 4HWIB 5DPRA 4ANWA 4C4VB 4RM9A 2E6XA 5HI1A 4ASWC 1L2NA 1ZE3D 1FNVA 4DHJD 1PGXA 1C79A 4GXBA 3K9OB 3TEWA 3V6EB 2R61A 1PQSA 3RYTA 4K7SA 2WGSA 4N9F4 3CF6E 2IO3B 1JWAD 4AQ7A 1KH0A 3WAPA 2FIFA 2LZ6A 5DPWA 3PPAA 2JRIB 3BK2A 4UDUC 1V1PB 1X1MA 2G4DB 3L08A 2BGFA 2WXKA 4HKZE 3E56A 3GE3C 1E7UA 3CSFA 3A1QA 4X57B 3RD2A 4KIKB 1ESFA 1GNUA 3APFA 1LM8B 5L95C 1T6BX 3IT4B 1KLUD 2MQJA 1SGHA 2V3PA 1EUVB 1TTNA 1R4NB 2LVOA 4DWFA 3TEXA 3BIID 4GDKA 4MH0E 1RLFA 2KMMA 5EE0A 2KTFA 3IVFA 3FC4A 1D5MC 3RNAC 2Y5BB 2KLCA 1RYJA 3EA6A 1WIAA 2MCNB 1KM7A 2GBJA 1HTOA 4CYEA 2KT7A 4ZRIA 2K5PA 3SFDB 2DHZA 3LDZE 2N9PC 1Y56A 4YSXB 4GN1A 3PVLA 4FLHA 2K3UA 4RFBA 3ZXRA 3K9PB 2K22A 4QAYA 4E74A 4DK5A 4K7WA 1RFKA 2ZCCA 4ARIA 1MFWA 3E9SA 2KN5A 2EMTA 4EZJA 3VUXA 5BYQA 3W1SA 1YIWA 4USAA 2KDBA 3B9JA 2KANA 2HJ1A 3RFZB 4MDKE 3T3NA 2HJ8A 3A9JA 2KQSA 2J42A 2L0TA 3BZDB 3DBLB 3PO0A 2GBNA 2VH1A 4JWSC 4LNOA 2QEJC 1C77A 3L10B 4C80A 4JE3B 3NRZA 4PK1A 3NUHB 1WX8A 1D6EC 3RI7C 2QCZA 3RNFC 2I2YA 1TS3A 1BUIC 2RD0A 3AULA 4MM3B 3A9KB 4GSWA 1MG8A 3TIXA 1MG4A 3N20C 1C78A 3PLVA 2WXNA 4US9A 2KAJA 3VH4B 1XLNA 3ZDTA 4OHJA 3Q3JA 1F2RC 1NENB 4XYCA 2BF8B 4WWOA 2JXXA 2W82A 1K53A 4YSZB 4US8A 1FMAD 2X8XX 3DVNV 3W2DA 5JZEB 4YT0B 4TV3A 3KWVA 1V80A 1YJIA 4IWQA 2CKHB 3OLMD 2WDQB 1AYFA 2BYVE 2PJHA 2WYQA 2QILA 5HKHA 1WI0A 4XZ4A 5IP4D 3FKYA 3RT3B 2INCC 3WAOA 1YQ3B 1SE2A 1EO6A 4HEA1 4ANUA 1KTKA 5E6NA 3C0RB 2N7DA 2KXJA 3ZTCA 3DWMA 3MHSD 1WZ3A 5CHVC 1V86A 1QOAA 3NVWA 4J6IA 1F0ZA 3U7DA 1OQQA 3P4RB 3TSSA 3QCAA 3B0AA 2D3CA 3OJ4B 4J3OD 5E6JA 2IY1B 2D2QA 3QX1A 4ICUA 1H8CA 4KGTA 4II2B 3OWEB 1WE6A 4L2YA 3RZWC 2LUEA 1CQVA 4ZYSA 1OFFA 2TSSA 1AWDA 1HQRD 2L05A 1JW9D 4LCDE 2AEHA 3AM9A 3PRMB 2KDMA 5H8YE 4HJKA 2NTTA 1XD3B 3MC8A 4CO7A 3DPDA 3ZNHB 1GC6A 2IGHA 3WAMA 4HKQA 4XWWA 1TY0A 2L52A 5JXVA 3A1QB 2FCSA 1UELA 4XX5A 3U2SC 3UQBA 3H6NA 2BS3B 1N5WA 2JVCA 3ZJTA 2GLSA 3VR9B 1I4XA 2PVGC 3AH7A 4JIOU 1L0XB 2CS4A 1FNWA 4FA6A 4FBJB 4URKA 2REXA 4OZCA 1OEYJ 5D3IB 2K8BA 1XCQL 1TKEA 3HRDD 1ZKHA 1SBBB 4GDKB 5G5HA 3AEFB 2CHWA 4M02A 4DXFA 4OVUA 4WWMA 2BKFA 2XNAC 1VD2A 1KF6B 1OGWA 1HTQA 4WJQA 2RSUA 1PFDA 1E6EB 2G45B 1WGHA 1C4PA 2BWES 2KD0A 3MJWA 3NVVA 1BXTA 1P3QU 1MPEA 4LK0M 1KLGD 1WXAA 3ML9A 1D3ZA 2HTHA 5JHAA 1QOBA 1YD8U 3VXWA 4RF1A 2A4ZA 4LNNA 1NVID 5IOIA 4F7ZA 1I4QA 1YOVB 3A9JB 1E7PB 4F1SA 2V0GA 4N6EB 3GE8C 2FCNA 2K8CA 2B3AA 1TS2A 1UWMA 4DQOC 1TKYA 4RF0A 2ZJDA 1VRAB 4KKIA 2WXLA 2KO3A 2XK5A 4LNFA 1VZ8A 3JW0X 4DBGA 5LLIA 2C9WB 4HCNB 4IM2A 4MGZE 2AYOB 2KYWA 2WXQA 4ZYNA 2DYMA 3PSEB 3NZ3A 2BWFA 5E6OA 1E8WA 1M94A 2ACZB 1SSNA 3SFEB 1G6JA 4NJCA 2JXTA 3DCGA 5JH5C 3Q3FA 1WJ4A 3VQIA 2BYEA 5BMIA 2JQRB 2CJNA 3UI3A 1XCTL 2WXIA 4XWTA 1ZDVA 3VFKA 1HA5A 2INDC 1K51A 1XLOA 2A5UA 1WR6E 3SEBA 3U8ZA 2IBIB 2WNMA 1WWTA 2ZW0A 4IWPA 3R2TA 4A3OA 3VTVA 3MFGA 5EE9A 1F9JA 3ETRA 1WF9A 4MM3A 1WGKA 3UIPB 5L83A 3LXFA 3Q8FA 2L0FA 4B95A 1V2YA 1UWXA 1UZXB 3RNGC 2JZPA 2LVPA 1YQBA 1K52A 3R2IA 2KTRB 3NHEB 2FUG1 2O6VA 2ZEQA 3S2AA 3SD5A 2MH7A 1QOGA 4BAXA 2WWZA 2BS2B 4MEMA 3ALBA 4C7ZA 1T0QC 3T3OA 3JSVA 1JWSD 1KFYB 1OQYA 3M3JA 3WIMA 1M4VA 4N58A 4EEWA 4S17A 2E3TA 3P2BA 3WA0A 3RCZA 3KUCB 3AE3B 1SJED 1WMHA 3HM3A 1YN5A 1CMXB 4IOIE 1V9JA 1AW7A 1DGJA 1R7SA 2GB1A 4WWNA 3ZJUA 1CZPA 3W9CB 1J19A 4W9IA 3MC9A 2JRHA 2JF5A 3ZIMA 1C1YB 4GLSC 2WXJA 3BVZA 4B9KA 1XF5L 1WGYA 1RM6C 2DNFA 4LNIA 1HXYD 4ZRKA 2KJRA 2DYOA 4WURA 3N1YC 2H89B 4DDGD 3O13A 4LDTB 2J0KA 4HDQA 4DDID 2LJIA 3ZLZA 1EM7A 2MBHA 2PEAA 4FJYA 3U4EG 1SIFA 2QSDA 2C7NB 4KZCA 2V3SA 5AZGA 2YEPB 2MBQA 1FXTB 2MX2A 3OJ3A 5TSSA 2LI5A 4ZHOA 4WH4A 1XXGA 2NBUA 1BMLC 3APDA 2WQYB 1GJZA 3VUWA 2Z0DB 3DHGC 1GB4A 1C4AA 2FBWB 3TJPA 2KFKA 3PHXB 4YXDB 1Z5SB 1SB3C 1TGZB 1QKZA 2ON8A 1YJJA 2MJ3A 4A90A 1VCBA 4FXCA 2IPKD 2KDFB 2L76A 4IM0A 3TL5A 3DBHI 2V9HA 2WDVB 3MC0B 4IUMB 3ZVVA 1XO3A 4KSKC 3VRAB 1B9RA 3AE5B 2RGFA 2G4SA 3W1YA 4REZA 2WXMA 1OEYA 3P63A 1F77A 3N32A 2K1FA 3EECA 3AV8A 3CWIA 5HHDG 1N60A 2WXGA 1UBIA 1ET9A 2QMTA 4KGSA 1L7YA 4IW0A 1UBQA 1EWYC 2K6DB 2RPVA 1T5XD 1HZ6A 5T8IA 3DOWA 4AJWA 3Q8AA 2JWZA 3AE2B 2CHZA 1B1ZA 3PV1A 1RFAA 5FK9C 2WU5B 1Q10A 2KDEB 3OAWA 1JRUA 1AN8A 2GOWA 2D3BA 1R4MI 1GAQB 2WXPA 2M17A 4RGNA 3ZTDA 3RNEC 2HDEA 3L0WB 1TIFA 1DOIA 2XK5B 1NYRA 2K39A 4BZAA 2KWUB 2WXOA 2RMMA 4WQMA 2LXCA 1LO5D 2L00B 4BKSD 3ABVB 4II3B 1WGRA 4D2KA 3AU4A 2OJWA 4KSLC 2QDFA 3M95A 4TQ1A 3GP7A 4IG7B 5I4DA 2PKOA 4NY0A 1ET6A 2KFJA 4GIVA 4M01A 4HJGE 2LJ5A 1IGCA 3EFUA 4W9EA 2BW2A 1D5ZC 3DWGC 3MTNB 2QJLA 3N1XC 4Q2JA 2FUHB 2PMVA 3BVGA 4W9FA 3BYYB 4KZ0A 1S3SG 2EKIA 3BYTB 3RNCC 3NJTA 1WGDA 2IYDB 4C56C 1WM2A 2KJ6A 3IFWB 3AI5A 1FFUA 4C00A 1P98A 1MVKA 2J53A 1AARA 1ENFA 1SF0A 3IHPC 2O6VB 3PZDA 2LWPA 1L6UA 1E8YA 2DZMA 3FAHA 3ZNGC 2MLBA 2AQ3B 2FCMA 1QLBB 2QC8A 3BY4B 3ZO5B 5DPSA 2YLMA 1QZEA 3JSVB 4K7UA 1QT9A 1UD7A 1GOZA 2KWVB 2Z0EB 1V81A 2ONQA 2OJRA 1LFDA 4W9GA 4BVUC 4R3DA 1L6VA 2RR9A 1WMHB 2LHDA 2WXHA 4P7IA 4TQ0A 3AE1B 4MT5A 4AWJA 2KQ7A 4EE2A 1HE8A 3SR6A 2M0AA 4BKTA 2KMAA 1V97A 2J0MA 4XDDA 2KX0A 1MI0A 3LYYA 1VDVA 4P1CC 2KTRA 3V3XA 2I1KA 3QK0A 4BBNF 1FFVA 2N7EA 3HK0A 3NY5A 3A33B 1F2RI 2LFIA 3DVGX 3P4PB 1WGGA 4TKNA 4M8MA 1ZGUB 3WANA 3QWZB 4LJOB 2Z59B 5H92C 2PIAA 3Q8BA 1JRPA 3SHQA 3IAS1 3PHWB 4W9DA 3BINA 1L5PA 3DHHC 3I57A 2N0SB 1E8XA 3KW5B 3U7ZA 3PGEA 2NBVB 1MJDA 3RPFC 3IBEA 3NZUA 4A6QA 1NYQA 4FN2A 4YTNB 2BT6A 2G1EA 2ZCBA 5D3DA 3H1UA 5C2TB 1TY2A 4I6NB 1ZW7A 1WR1A 2BBCA 2BB6A 2JUOA 4NQKE 1J7AA 2W3SA 1ZDXA 3EFCA 2AL6A 2MP2A 2KFKB 3H8HA 3IAM1 2DZJA 3I63C 2G9HD 4RCOA 1E7VA 4HVBA 1NDDA 2KC2A 3DQVA 1ISNA 2LGYA 3OG5A 3VHTC 1V5OA 1E8ZA 2UYZB 2UU7A 1YNTE 3PTFC 3EUB2 2IGGA 2K25A 1E5WA 4JWUC 3AE4B 2L3ZA 1IBXB 2MBEA 2MJEA 3UQAA 4RGTA 5EE1A 1C4CA 3I9V1 3ZNID 3AEAB 2IDYA 1FM0D 3IT6B 2LVQA 3DDCB 4KGRA 4AUQC 4MACA 5GMVA 4IDIA 4TUUA 1P9DU 2VZKB 4HROA 3V62A 1V6EA 2PVOD 1NEKB 2W3RA 1GG3A 4P1BC 2KVRA 4ZRQA 3W5VB 1TBEA 3ZRCA 5CTRC 2NCNA 2XEWA 4AP4C 4BBNC 5IAAC 4TMAB 1T3QA 5BO4B 3KYCD 4H2AA 1IGDA 2JYTA 2K8HA 3HVZA 4XDCA 3SDLC 2DWQA 1P1AA 2D10A 2MEKA 2IZVB 2ZNVC 4BKGA 2BKRB 4JX1C 4MJSB 4LNKA 1I4GA 2B76B 3A4RA 4XGAB 3APCA 3HVDA 3C19A 1LGRA 3TMPB 1WFYA 2V1YA 2LASA 5D94A 3AEBB 4NQLB 3DBHB 3I5JC 2PE9A 3I3TB 4MGIE 1Y8RC 1XEEA 1F1HA 4NJ6A 3DHIC 3VAWA 1SE9A 1WYWB 2KHWB 2KK8A 4G11A 2BQQA 1PDXA 5G2NA 4B6WA 1TS5A 1XLQA 1WRDB 4M0WB 2IY0B 2INPE 1KLVA 2DENB 2KX3A 4DXAB 1KJTA 4G0NB 3PRPB 1JQ4A 4K1RB 1YQ4B 2LGDA 2LUMA 2GBKA 2SEBD 3IG3A 2WDTB 2YVCA 5IO9A 5J17A 4WJPA 1MHHE 3TBLD 1S1QB 2MWSB 1XQQA 4I6LB 2L83A 2W55A 3URYA 1QQRA 2FNJB 3U52E 3KWLA 2N1VA 1HZ5A 1SE3A 2C5LC 5C3JB 1T0SC 3ZDMC 3GOEA 3FILB 1R4MB 1MHXA 1N63A 2G3QB 1RRBA 2KDIA 3GB1A 4GMVA 1JROA 2KKCA 5LXHA 1V5TA 4WJOA 2M8SA 2GI9A 2WS3B 4BFRA 5AUKA 1L0YB 2LGIA 3NVZA 1JWUD 1SEBD 1BT0A 3AE8B 3PZ8A 2DYBA 3TEYA 2MSED 4NPNA 4M00A 3QARA 1GPXA 3A4SC 1FO4A 2ZW1A 1TT5B 1D4BA 4OW0A 1WXMA 2FIDA 1UUPA 3EGRA 1N5XA 2DBYA 2OHFA 4W9HA 5C23A 1E0ZA 4EFOA 4LDTD 2OEDA 1PUTA 3VTWA 1UGMA 4YL8A 1SE4A 1CJEA 1V8CA 4N59A 3M63B 4NJ7A 5E6PA 4MH8A 3GZNB 3Q69A 3NG0A 4AOFA 4HPPA 2W9NA 2V4LA 3NOBA 1WZ0A 4A55A 3L4PA 4GDLA 1ZXIA 1JALA 4B0MA 4GB9A 4MSQB 2L32A 2JYEA 4KV2A 2ASQA 2VH2A 3O65B 4NZLB 1Q5WB 4W9JA 3ZW3A 4HXDA 2J0JA 2DAJA 4EZLA 4AS1A 3EHVA 4CHKA 2L7RA 3ECIA 3TCAA 1WYGA 3RULA 1LQBA 2MP2B 2RPQA 3B2GA 2NPTA 3Q14C 1P7EA 1NBFC 3ONSA 3ZJVA 2DAFA 2SAKA 3KYDD 3LJ3A 3RMKC 2MHJA 2GMIC 3B08A 2L8JA 3JYUA 3RNBC 2PLPA 3BK1A 1Q0WB 1TYGB 3AEGB 1L4DB 2FCQA 2BB5A 3AE7B 2ZPYA 4ZDVA 2CJOA 3VRBB 4DXGA 3W1SC 4AJYB 2ICIA 2MW5A 2V4IB 1A5RA 4E3CA 1WSPA 2JZZA 4A8XC 4ZRPA 1IUEA 1RAXA 4W9KA 5AUIA 3DBSA 3P4SB 4FJZA 2N4FA 3ZRFA 4YWGG 4PT5A 4WQOB 2LGXA 3EC8A 3ZKJC 4KDLB 4IKGA 1T0RC 2L1AA 3TEZA 2LRUA 1ZPSA 3W5UB 1IBXA 5EDSA 4F8CB 1JCKB 3IXSA 2QHOA 2KJHB 3LB8C 3R66C 2D3GA 4RNAA 3AN1A 2YEPF 4IWOA 2PPHA 2ZVOA 5BYSA 2IGDA 3R7QA 1P7FA 1GC7A 3N3KB 2NS5A 2AQ2B 2JZ3B 5BMGA 1Z2MA 1ACCA 4C7YA 1ZUD2 4DHJB 3UF8A 4WAFA 2KQ4X 1ZXHA 2PW9A 1FEHA 4HDOA 4BOSC 1VLBA 4RM8A 3Q8CA 2M1MA 5FR6A 3H7PA 1DOYA 2KWCA 2WU2B 2FE8A 1IYFA 4EZKA 3UIOB 3X0WA 5G5GA 1I35A 1WX9A 4MJSA 2KVZA 3P42A 1XT9B 2O2VB 2UWQA 1YN4A 3NS8A 1WXQA 3RZFA 5CHWA 2N9XA 3AB5A 3PZ7A 4EUTA 4KX6B 1WRIA 5D7GA 3TUOA 2O6VD 5AEKB 3J9CA 4YTPB 5EE3A 3CIRB 3VH3B 3NZSA 3QQ8B 1IPGA 1GB1A 3C8YA 2JWUA 5MPOA 5D2MB 4M0WA 4WWPA 4DHZE 2D11A 1YX6B 2DLBA 4JGHB 1FXAA 1J7BA 2C7HA 3N30A 1PGBA 3B1LX 3Q2AC 3NVYA 3SU8X 2BYTA 2GBMA 5C1ZA 5IA7A 3Q3NC 5J18A 2KC1A 3GZNI 5TR5A 3AECB 1D5XC 3H7SA 3CSTA 2RDGA 4LJPB 3MJ5A 5BMHA 3FILA 3AE6B 4PS3A 5J2RA 1RWSA 2JU6X 4FADA 2MA9B 3V60A 2KN4A 4OVZA 3AMZA 4FHJA 3U30A 3T9LA 1FCLA 1L0VB 5IKCM 3NS1A 2ZNVB 2C7MB 2QIEB 4GU2A 1I4RA 2LD9A 3AEDB 2K0PA 1U4AA 3HHMA 2DX5B 1QILA 4LLGM 3L17A 4GDLB 2DZIA 1GUAB 4K3CA 1J8CA 3AU5A 1H4RA 1N61A 1JWBD 3CMMB 5DCNA 3VDZA 2AX5A 3DVGY 1EF5A 1JMLA 1QOFA 4FJVB 2CR5A 3VR8B 1FIQA 3DBRI 2NPTB 3UINB 1J7CA 2MJDA 4ICVA 2J52A 3ZYYX 2RDHA 3V61A 2J4XA 2XN9C 3MP9A 1FPYA 3VTUA 4ZOHC 2KWDA 4EKUA 4TSSA 2N9KA 4B0EA 2PE6B 1LXDA 4YSYB 2ZVNA 2MBBB 3T8MA 5BYRA 3AEEB 2JX5A 3M62B 1EU3A 1PGAA 3MHZA 1FNUA 2Q5WD 4ARCA 2GBRA 2WDRB 4ACFA 3DVNU 2M4NA 4KDIC 1WM3A 3AXCA 2WP9B 4RMAA 2M56B 4S0RA 2M19A 3QAQA 1YMHE 1I42A 2JT4B 3R8BA 1NI2A 2I1JA 1TS4A 1XLPA 2KLGA 5AZFA 2BVCA 2VZKD 2HE7A 1YJ1A 4MGYE 2WX1A 2EMSA 2Y3AA 2IO0B 3HIZA 1KOTA 4HPLB 1C76A 5CHFA 1E9MA 1CK1A 2EKEC 2KNBA 3QHTA 1WH3A 3X23A 1I7HA 3PRZA 4K81A 4IM3A 3QA8A 3RUIB 2DZKA 4A3PA 1R4NI 4JPSA 5IN7A 3VVWB 5GXGB 4YTMB 4NAWA 1V49A 3PLUA 2K9XA 4PS8A 1UGJA 1DYQA 5KHQA 3ZGZA 4A9AA 2D3AA 3ZXVA 4C4VA 2V3NA 4MELA 1ROEA 2FAZA 4IC7B 3KUZA 1I4PA 3ZQ4A 1WJNA 5JHBA 1UH6A 1SJHD 2H88B 3L16A 3L54A 5G55A 5LXIB 1VZ6A 4ZHPA 1WJ6A 4M8NA 1STEA 4CQNA 4DHZB 4HRSA 3H7PB 1N62A 1F52A 4P16A 3WCQA 1I4HA 2LXAA 2D5GA 4OZBA 1V1PA 1VR9A 4I6PA 2ZZPB 1SIJA 2W54A 2KOXA 4WIPA 2CU3A 2CU1A 1WY8A 3QIJA 3D32A 1YN3A 4OZAA 4KIKA 1UNSA 2AWTA 3DBLI 5DPTA 3WALA 1WJUA 3KQ4A 1N6ZA 3BWUD 2NR2A 2X38A 3V05A 5FKAC 2R2QA 2NBWB 2KMCA 5D6JB 4KVGB 2WXFA 4JL9A 3HM6X 1C9FA 2J7QB 3V6CB 2O2VA 3ML8A 2LGSA 3PT2B 2PTLA 4HK2A 2WX0A 1EF1A 4G50A 3QJZA 2WXRA 3P1MA 4MGKE 3B2FA 3Q8EA 4XE0A 4P6VF 2BYFA 4LTUA 4OVVA 2N9EB 1FRDA 1L4ZB 2Z8LA 4XC2A
chains in the Genus database with same CATH topology
3BYYB 2EKIA 4A8XC 4ZRPA 3BYTB 2IGHA 1IUEA 1JWMD 2BS4B 4ITKA 4C56C 4HKQA 4XWWA 5AUIA 1TY0A 2L52A 3P4SB 1FFUA 5JXVA 3KLSX 4NAMA 1MVKA 4YWGG 2WLBA 4PT5A 2J53A 1ENFA 1K50A 1SF0A 3U2SC 2BS3B 1N5WA 1L6UA 2GRIA 4IKGA 3ZJTA 3FAHA 2AQ1B 2L1AA 3TEZA 3VR9B 1VJKA 2AQ3B 1I4XA 2PVGC 1QLBB 3AH7A 1ZPSA 1EU4A 3W5UB 1IBXA 2BTEA 4L23A 1L0XB 1JCKB 3IXSA 1FNWA 1QT9A 1GOZA 3LB8C 2ONQA 4RNAA 4OZCA 3AN1A 2YEPF 5D3IB 1QF6A 1XCQL 1TKEA 1ZOYB 2LEKA 3HRDD 4KKJA 1SBBB 1FCCC 4GDKB 1L6VA 4R3DA 5G5HA 3AEFB 2LHDA 2WXHA 4DXFA 5BYSA 1FXIA 2IGDA 2Y5CA 4WWMA 3AE9B 1P7FA 1TKGA 4TQ0A 1PYWD 3AE1B 4MT5A 5HFYA 2XNAC 4EE2A 3BVMA 1KF6B 3P4QB 4RH6A 1KRHA 2EELA 2M0AA 3SR6A 5HG2A 1V97A 2AQ2B 1PFDA 4XDDA 3N9YC 1MI0A 3LYYA 5BMGA 1E6EB 1ACCA 1HEZE 1VDVA 4C7YA 1ZUD2 1C4PA 3V3XA 4WAFA 2KQ4X 1ZXHA 1V1OA 2PW9A 1FEHA 2NTSA 3NVVA 1VLBA 3Q8CA 1FFVA 1BXTA 1DOYA 2WU2B 1F2RI 1MPEA 2N7JA 2FE8A 2LFIA 4LK0M 3P4PB 1KLGD 5G5GA 1TZOA 1NI3A 2LHEA 1A70A 1QOBA 1SXTA 5H92C 2LMCA 3P42A 2PIAA 3Q8BA 4O1NA 1DOXA 1JRPA 3IAS1 4RGOS 4RF1A 1FRRA 1YN4A 1WXQA 3GS2A 1L5PA 3I57A 1NVID 2N0SB 3AB5A 3PZ7A 1I4QA 1ZP0B 5FR3A 1OQRA 1WRIA 4KX6B 2INNE 3HUIA 5D7GA 3U7ZA 1E7PB 1TJEA 2V0GA 3RPFC 4N6EB 3TUOA 2HTME 4A6QA 1NYQA 3J9CA 4YTPB 4YTNB 2BT6A 5EE3A 2G1EA 3CIRB 1TS2A 1UWMA 2N9LA 5D3DA 2Y5PA 4DQOC 2NMQA 1TY2A 5C2TB 1TKYA 1GB1A 4RF0A 3C8YA 2JWUA 1VRAB 5MPOA 4KKIA 2BBCA 2WXLA 2BB6A 1J7AA 2W3SA 1ZDXA 4M0WA 1EWCA 1E10A 4RGMA 1VZ8A 2DLBA 1FXAA 3H8HA 1J7BA 3IAM1 4L1BA 2KACA 2G9HD 4NAWB 5LNK1 4RCOA 1PGBA 1FD6A 3NVYA 2WXQA 2DYMA 3NZ3A 2JSVX 2BYTA 2IJ0A 1VZ7A 2ACZB 2I38A 1SSNA 3SFEB 1YNTE 3EUB2 4NJCA 2E6XA 2JXTA 2IGGA 3AECB 3VQIA 4JWUC 5HI1A 5BMIA 2JQRB 3AE4B 1D5XC 2CJNA 1IBXB 3UI3A 1ZE3D 1FNVA 2MJEA 1XCTL 2WXIA 4XWTA 1ZDVA 1PGXA 2RDGA 1HA5A 3MJ5A 1C79A 5BMHA 1K51A 3FILA 1XLOA 3AE6B 3TEWA 2R61A 1RWSA 2JU6X 4RGTA 5EE1A 3SEBA 1C4CA 3I9V1 3AEAB 2IDYA 1FM0D 2KN4A 2WNMA 1WWTA 1JWAD 2ZW0A 3R2TA 4OVZA 1KH0A 3IT6B 4AQ7A 3AMZA 4KGRA 3BK2A 3MFGA 5EE9A 1FCLA 3ETRA 1L0VB 1WGKA 4UDUC 4MACA 1V1PB 3NS1A 3LXFA 3Q8FA 4IDIA 1UWXA 2WXKA 2VZKB 2QIEB 4HROA 4HKZE 3E56A 1I4RA 2JZPA 1NEKB 2PVOD 2W3RA 3AEDB 2K0PA 1K52A 3R2IA 4ZRQA 2FUG1 3W5VB 1ESFA 2MH7A 1QOGA 1QILA 4LLGM 4GDLB 4TMAB 2BS2B 1T3QA 1T6BX 3IT4B 4H2AA 1IGDA 1KLUD 2JYTA 4C7ZA 2V3PA 1N61A 3T3OA 3HVZA 4XDCA 2DWQA 1JWBD 1JWSD 1KFYB 2AX5A 2MEKA 4JX1C 1M4VA 4N58A 1JMLA 1I4GA 2B76B 1QOFA 2E3TA 3TEXA 3VR8B 3HVDA 1FIQA 3BIID 1J7CA 2MJDA 3AE3B 1SJED 2KMMA 1YN5A 5EE0A 4IOIE 3AEBB 1AW7A 3FC4A 2J52A 1DGJA 1D5MC 1R7SA 3ZYYX 2GB1A 2RDHA 2J4XA 2XN9C 3MP9A 3ZJUA 1XEEA 1CZPA 3W9CB 1RYJA 3EA6A 4ZOHC 2KWDA 4TSSA 2N9KA 4B0EA 4YSYB 4GLSC 2K5PA 2WXJA 3BVZA 3SFDB 5BYRA 1PDXA 1XF5L 3AEEB 2JX5A 1TS5A 1Y56A 1RM6C 1XLQA 4YSXB 1EU3A 1PGAA 3MHZA 1FNUA 2Q5WD 2K3UA 2INPE 2WDRB 4RFBA 1HXYD 4ARCA 2K22A 2DYOA 4WURA 2H89B 1RFKA 3O13A 2WP9B 2M56B 4ARIA 1JQ4A 2M19A 2LJIA 1YMHE 1YQ4B 1EM7A 2LUMA 3E9SA 3R8BA 3U4EG 5BYQA 2QSDA 2SEBD 1TS4A 1XLPA 3W1SA 4USAA 3B9JA 1MHHE 2YEPB 3RFZB 2VZKD 3T3NA 2L83A 2J42A 2W55A 2Y3AA 3BZDB 3URYA 1QQRA 5TSSA 3U52E 3KWLA 1HZ5A 4ZHOA 3PO0A 4JWSC 1SE3A 1C76A 2QEJC 5C3JB 1C77A 4WH4A 1XXGA 1E9MA 1CK1A 1BMLC 4C80A 3FILB 4JE3B 2WQYB 1MHXA 3NRZA 1I7HA 3NUHB 1N63A 1D6EC 1GB4A 1C4AA 2FBWB 2I2YA 4JPSA 3GB1A 1TS3A 1BUIC 1JROA 4YXDB 4MM3B 5GXGB 1SB3C 2ON8A 1QKZA 2GI9A 1YJJA 2MJ3A 2WS3B 4YTMB 4A90A 5AUKA 4FXCA 1C78A 2IPKD 1L0YB 2K9XA 2LGIA 2WXNA 3NVZA 4US9A 1JWUD 1SEBD 2WDVB 3AE8B 2KAJA 3PZ8A 3TEYA 1UGJA 3MC0B 1DYQA 1XLNA 3ZGZA 4A9AA 2V3NA 1ROEA 4OHJA 1XO3A 1GPXA 1F2RC 1NENB 1I4PA 3ZQ4A 3VRAB 1FO4A 2W82A 1K53A 4YSZB 4US8A 2ZW1A 1B9RA 1D4BA 1SJHD 2H88B 3AE5B 4OW0A 1FMAD 1UUPA 1VZ6A 4ZHPA 3W2DA 3EGRA 4REZA 1STEA 4CQNA 1N5XA 2DBYA 2OHFA 4YT0B 4HRSA 2WXMA 3KWVA 3P63A 1YJIA 1F77A 1N62A 1E0ZA 3AV8A 4P16A 3CWIA 5HHDG 3WCQA 1N60A 2WXGA 1ET9A 2QMTA 1I4HA 2WDQB 1AYFA 4KGSA 2OEDA 2QILA 2D5GA 1EWYC 1PUTA 4OZBA 1V1PA 2RPVA 1T5XD 1VR9A 1SE4A 1HZ6A 5T8IA 1CJEA 1V8CA 4N59A 1SIJA 2W54A 3Q8AA 1YQ3B 3AE2B 1SE2A 4WIPA 1B1ZA 2CU3A 4MH8A 5FK9C 1YN3A 3Q69A 4OZAA 4HEA1 1KTKA 1UNSA 2WU5B 1Q10A 4A55A 3L4PA 1ZXIA 1JALA 3KQ4A 1AN8A 3DWMA 4B0MA 1GAQB 2L32A 3BWUD 2JYEA 2WXPA 4NZLB 4RGNA 2HDEA 2X38A 3V05A 5FKAC 1QOAA 3NVWA 1F0ZA 1DOIA 2WXFA 4AS1A 1OQQA 3P4RB 3TSSA 1NYRA 1WYGA 3B2GA 1C9FA 2WXOA 1P7EA 4J3OD 3ZJVA 2RMMA 4WQMA 1LO5D 5E6JA 3ABVB 4KGTA 2SAKA 3OWEB 4D2KA 4L2YA 2PTLA 4TQ1A 3GP7A 2PLPA 3BK1A 1TYGB 3AEGB 1CQVA 1L4DB 5I4DA 2BB5A 2PKOA 1ET6A 3AE7B 4ZYSA 1OFFA 2WXRA 2TSSA 3P1MA 4HJGE 1AWDA 1HQRD 1JW9D 2CJOA 3B2FA 3Q8EA 1IGCA 3VRBB 4XE0A 4DXGA 2BW2A 4P6VF 1D5ZC 3DWGC 4LTUA 2QJLA 3AM9A 2ICIA 4Q2JA 2PMVA 1FRDA 3BVGA 2V4IB 2KDMA 5H8YE 1L4ZB 1WSPA 2NTTA 2Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RPF C;  2E3T A;  4N6E B;  3VR8 B;  2HTM E;  4YSZ B;  4US8 A;  1NYQ A;  1B9R A;  1FIQ A;  2H88 B;  3AE5 B;  3BII D;  4YTP B;  1FMA D;  4YTN B;  2BT6 A;  2EKI A;  1J7C A;  2G1E A;  2MJD A;  3CIR B;  5EE3 A;  1UWM A;  3AE3 B;  2KMM A;  1IUE A;  5EE0 A;  5C2T B;  4ZHP A;  2BS4 B;  4ITK A;  3AEB B;  1TKY A;  3FC4 A;  1N5X A;  1DGJ A;  2DBY A;  2OHF A;  4YT0 B;  1R7S A;  5AUI A;  3ZYY X;  2L52 A;  3P4S B;  1FFU A;  4HRS A;  3P63 A;  5MPO A;  1YJI A;  1J7A A;  2W3S A;  1N62 A;  1E0Z A;  1CZP A;  3AV8 A;  3W9C B;  1E10 A;  1RYJ A;  3CWI A;  2WLB A;  3WCQ A;  1N60 A;  4ZOH C;  1SF0 A;  2WDQ B;  1AYF A;  1FXA A;  1J7B A;  2BS3 B;  1EWY C;  1N5W A;  1PUT A;  1L6U A;  4YSY B;  3FAH A;  2K5P A;  3SFD B;  3VR9 B;  1PDX A;  1VJK A;  3AEE B;  2PVG C;  1QLB B;  1CJE A;  2JX5 A;  3AH7 A;  1V8C A;  3NVY A;  3W5U B;  1RM6 C;  1XLQ A;  4N59 A;  1SIJ A;  4YSX B;  2W54 A;  1YQ3 B;  3AE2 B;  2Q5W D;  2WDR B;  2CU3 A;  2ACZ B;  2K22 A;  3SFE B;  1QT9 A;  2H89 B;  3EUB 2;  3LB8 C;  1RFK A;  2WP9 B;  2WU5 B;  3AN1 A;  2M56 B;  1JQ4 A;  2M19 A;  3AEC B;  1YQ4 B;  3L4P A;  4JWU C;  1QF6 A;  1ZXI A;  1JAL A;  2JQR B;  1TKE A;  1ZOY B;  3AE4 B;  2LEK A;  3DWM A;  2CJN A;  3HRD D;  2MJE A;  1XLP A;  1L6V A;  1GAQ B;  4USA A;  5G5H A;  3AEF B;  3B9J A;  1FXI A;  2Y5C A;  4WWM A;  3AE9 B;  1TKG A;  1XLO A;  3AE1 B;  3AE6 B;  1RWS A;  5EE1 A;  1QOA A;  3NVW A;  1F0Z A;  1KF6 B;  3P4Q B;  2L83 A;  1DOI A;  2W55 A;  1KRH A;  3AEA B;  3SR6 A;  1V97 A;  1OQQ A;  1FM0 D;  3P4R B;  1PFD A;  1JWA D;  1WWT A;  3KWL A;  1NYR A;  1WYG A;  1E6E B;  3B2G A;  3AMZ A;  1VDV A;  3PO0 A;  4JWS C;  4C7Y A;  4ZHO A;  1ZUD 2;  5C3J B;  5EE9 A;  1E9M A;  3ETR A;  1L0V B;  1WGK A;  4WQM A;  4C80 A;  3NS1 A;  3LXF A;  2WQY B;  4IDI A;  3NRZ A;  1I7H A;  3ABV B;  3NVV A;  2QIE B;  4HRO A;  1VLB A;  1N63 A;  2PVO D;  1FFV A;  1NEK B;  2W3R A;  1DOY A;  2WU2 B;  3AED B;  2FBW B;  3P4P B;  5G5G A;  1JRO A;  1NI3 A;  3W5V B;  2MH7 A;  4YXD B;  1QOG A;  1TYG B;  3AEG B;  1A70 A;  1QOB A;  1SB3 C;  2PKO A;  5GXG B;  4YTM B;  1YJJ A;  2MJ3 A;  2WS3 B;  5H92 C;  3AE7 B;  1FO4 A;  5AUK A;  2PIA A;  1OFF A;  2BS2 B;  4FXC A;  1T3Q A;  1DOX A;  1JRP A;  2K9X A;  3P1M A;  1AWD A;  1FRR A;  3NVZ A;  4US9 A;  1JW9 D;  1WXQ A;  2CJO A;  2WDV B;  3AE8 B;  2KAJ A;  1L5P A;  1N61 A;  3B2F A;  3VRB B;  4C7Z A;  1NVI D;  2N0S B;  3AB5 A;  3HVZ A;  2DWQ A;  1JWB D;  1XLN A;  3DWG C;  1KFY B;  4P6V F;  4LTU A;  4A9A A;  2AX5 A;  2QJL A;  3AM9 A;  1ROE A;  1FRD A;  1XO3 A;  1OQR A;  1WRI A;  1ZP0 B;  4JX1 C;  4KX6 B;  4N58 A;  3HUI A;  1GPX A;  5H8Y E;  1NEN B;  2B76 B;  1QOF A;  1E7P B;  1TJE A;  3VRA B; 
#chains in the Genus database with same CATH topology
 2ZPN A;  4K3B A;  1JWM D;  2BS4 B;  4ITK A;  1YX5 B;  1T0Y A;  3KLS X;  4NAM A;  4ZRJ A;  4A20 A;  2WLB A;  1K50 A;  4PYU A;  2GRI A;  1OTR B;  2AQ1 B;  2JY6 A;  4HCP B;  1VJK A;  4HPM B;  2MBO A;  1EU4 A;  1TZ1 A;  2BTE A;  4L23 A;  4MSM B;  2BPS A;  3PRE A;  3A9K A;  2C60 A;  3ZUN A;  1Q1O A;  1QF6 A;  2RDB C;  4PYZ A;  1ZOY B;  2LEK A;  4GGQ A;  4KKJ A;  4BKS A;  2OOB B;  1FCC C;  2JPH A;  3R3M A;  1UF0 A;  1FXI A;  2Y5C A;  3KH0 A;  3AE9 B;  1TKG A;  1PYW D;  1WXV A;  2VRR B;  5HFY A;  2LRW A;  4FUL A;  3BVM A;  3P4Q B;  4RH6 A;  3KVF B;  1KRH A;  2EEL A;  5HG2 A;  3Q3M C;  2XBB C;  3N9Y C;  1HEZ E;  4G3X B;  3VUY A;  4ANX A;  4JLC A;  1V1O A;  3KUD B;  2NTS A;  1E90 A;  4NNJ B;  3UGB B;  1J0G A;  1P0R A;  2N7J A;  2IO1 B;  2AL3 A;  1TZO A;  1NI3 A;  2LHE A;  1K8R B;  4FHK A;  1A70 A;  2N1W A;  1SXT A;  4HLE A;  2KZR A;  2LMC A;  3N1Z C;  4O1N A;  4W9C A;  1DOX A;  4RGO S;  2MRP A;  1FRR A;  3GS2 A;  3JVZ X;  3ZNZ B;  1C3T A;  3QC8 B;  3Q6B A;  4GOC A;  1ZP0 B;  2IO2 B;  1OQR A;  5FR3 A;  2INN E;  5AZH A;  3HUI A;  4EOY A;  2R2O A;  1TJE A;  2NVU I;  2HTM E;  4JQW C;  3H9D A;  3PS6 A;  2WHI A;  2N9L A;  2Y5P A;  3RN9 C;  2NMQ A;  1WX7 A;  3L13 A;  2M0X A;  5CX3 A;  1EWC A;  1WXS A;  1E10 A;  4RGM A;  4E71 A;  3R7R A;  4PS7 A;  4L1B A;  2HD5 B;  4BOZ B;  2KAC A;  1IP9 A;  3DBR B;  3ENE A;  4NAW B;  5LNK 1;  1WE7 A;  1FD6 A;  4WJN A;  2K6Q A;  3Q3O C;  2JSV X;  5KHO A;  2IJ0 A;  4W9L A;  1VZ7 A;  2D07 B;  2CHX A;  2I38 A;  4ANV A;  4WAA A;  4HWI B;  5DPR A;  4ANW A;  4C4V B;  4RM9 A;  2E6X A;  5HI1 A;  4ASW C;  1L2N A;  1ZE3 D;  1FNV A;  4DHJ D;  1PGX A;  1C79 A;  4GXB A;  3K9O B;  3TEW A;  3V6E B;  2R61 A;  1PQS A;  3RYT A;  4K7S A;  2WGS A;  4N9F 4;  3CF6 E;  2IO3 B;  1JWA D;  4AQ7 A;  1KH0 A;  3WAP A;  2FIF A;  2LZ6 A;  5DPW A;  3PPA A;  2JRI B;  3BK2 A;  4UDU C;  1V1P B;  1X1M A;  2G4D B;  3L08 A;  2BGF A;  2WXK A;  4HKZ E;  3E56 A;  3GE3 C;  1E7U A;  3CSF A;  3A1Q A;  4X57 B;  3RD2 A;  4KIK B;  1ESF A;  1GNU A;  3APF A;  1LM8 B;  5L95 C;  1T6B X;  3IT4 B;  1KLU D;  2MQJ A;  1SGH A;  2V3P A;  1EUV B;  1TTN A;  1R4N B;  2LVO A;  4DWF A;  3TEX A;  3BII D;  4GDK A;  4MH0 E;  1RLF A;  2KMM A;  5EE0 A;  2KTF A;  3IVF A;  3FC4 A;  1D5M C;  3RNA C;  2Y5B B;  2KLC A;  1RYJ A;  3EA6 A;  1WIA A;  2MCN B;  1KM7 A;  2GBJ A;  1HTO A;  4CYE A;  2KT7 A;  4ZRI A;  2K5P A;  3SFD B;  2DHZ A;  3LDZ E;  2N9P C;  1Y56 A;  4YSX B;  4GN1 A;  3PVL A;  4FLH A;  2K3U A;  4RFB A;  3ZXR A;  3K9P B;  2K22 A;  4QAY A;  4E74 A;  4DK5 A;  4K7W A;  1RFK A;  2ZCC A;  4ARI A;  1MFW A;  3E9S A;  2KN5 A;  2EMT A;  4EZJ A;  3VUX A;  5BYQ A;  3W1S A;  1YIW A;  4USA A;  2KDB A;  3B9J A;  2KAN A;  2HJ1 A;  3RFZ B;  4MDK E;  3T3N A;  2HJ8 A;  3A9J A;  2KQS A;  2J42 A;  2L0T A;  3BZD B;  3DBL B;  3PO0 A;  2GBN A;  2VH1 A;  4JWS C;  4LNO A;  2QEJ C;  1C77 A;  3L10 B;  4C80 A;  4JE3 B;  3NRZ A;  4PK1 A;  3NUH B;  1WX8 A;  1D6E C;  3RI7 C;  2QCZ A;  3RNF C;  2I2Y A;  1TS3 A;  1BUI C;  2RD0 A;  3AUL A;  4MM3 B;  3A9K B;  4GSW A;  1MG8 A;  3TIX A;  1MG4 A;  3N20 C;  1C78 A;  3PLV A;  2WXN A;  4US9 A;  2KAJ A;  3VH4 B;  1XLN A;  3ZDT A;  4OHJ A;  3Q3J A;  1F2R C;  1NEN B;  4XYC A;  2BF8 B;  4WWO A;  2JXX A;  2W82 A;  1K53 A;  4YSZ B;  4US8 A;  1FMA D;  2X8X X;  3DVN V;  3W2D A;  5JZE B;  4YT0 B;  4TV3 A;  3KWV A;  1V80 A;  1YJI A;  4IWQ A;  2CKH B;  3OLM D;  2WDQ B;  1AYF A;  2BYV E;  2PJH A;  2WYQ A;  2QIL A;  5HKH A;  1WI0 A;  4XZ4 A;  5IP4 D;  3FKY A;  3RT3 B;  2INC C;  3WAO A;  1YQ3 B;  1SE2 A;  1EO6 A;  4HEA 1;  4ANU A;  1KTK A;  5E6N A;  3C0R B;  2N7D A;  2KXJ A;  3ZTC A;  3DWM A;  3MHS D;  1WZ3 A;  5CHV C;  1V86 A;  1QOA A;  3NVW A;  4J6I A;  1F0Z A;  3U7D A;  1OQQ A;  3P4R B;  3TSS A;  3QCA A;  3B0A A;  2D3C A;  3OJ4 B;  4J3O D;  5E6J A;  2IY1 B;  2D2Q A;  3QX1 A;  4ICU A;  1H8C A;  4KGT A;  4II2 B;  3OWE B;  1WE6 A;  4L2Y A;  3RZW C;  2LUE A;  1CQV A;  4ZYS A;  1OFF A;  2TSS A;  1AWD A;  1HQR D;  2L05 A;  1JW9 D;  4LCD E;  2AEH A;  3AM9 A;  3PRM B;  2KDM A;  5H8Y E;  4HJK A;  2NTT A;  1XD3 B;  3MC8 A;  4CO7 A;  3DPD A;  3ZNH B;  1GC6 A;  2IGH A;  3WAM A;  4HKQ A;  4XWW A;  1TY0 A;  2L52 A;  5JXV A;  3A1Q B;  2FCS A;  1UEL A;  4XX5 A;  3U2S C;  3UQB A;  3H6N A;  2BS3 B;  1N5W A;  2JVC A;  3ZJT A;  2GLS A;  3VR9 B;  1I4X A;  2PVG C;  3AH7 A;  4JIO U;  1L0X B;  2CS4 A;  1FNW A;  4FA6 A;  4FBJ B;  4URK A;  2REX A;  4OZC A;  1OEY J;  5D3I B;  2K8B A;  1XCQ L;  1TKE A;  3HRD D;  1ZKH A;  1SBB B;  4GDK B;  5G5H A;  3AEF B;  2CHW A;  4M02 A;  4DXF A;  4OVU A;  4WWM A;  2BKF A;  2XNA C;  1VD2 A;  1KF6 B;  1OGW A;  1HTQ A;  4WJQ A;  2RSU A;  1PFD A;  1E6E B;  2G45 B;  1WGH A;  1C4P A;  2BWE S;  2KD0 A;  3MJW A;  3NVV A;  1BXT A;  1P3Q U;  1MPE A;  4LK0 M;  1KLG D;  1WXA A;  3ML9 A;  1D3Z A;  2HTH A;  5JHA A;  1QOB A;  1YD8 U;  3VXW A;  4RF1 A;  2A4Z A;  4LNN A;  1NVI D;  5IOI A;  4F7Z A;  1I4Q A;  1YOV B;  3A9J B;  1E7P B;  4F1S A;  2V0G A;  4N6E B;  3GE8 C;  2FCN A;  2K8C A;  2B3A A;  1TS2 A;  1UWM A;  4DQO C;  1TKY A;  4RF0 A;  2ZJD A;  1VRA B;  4KKI A;  2WXL A;  2KO3 A;  2XK5 A;  4LNF A;  1VZ8 A;  3JW0 X;  4DBG A;  5LLI A;  2C9W B;  4HCN B;  4IM2 A;  4MGZ E;  2AYO B;  2KYW A;  2WXQ A;  4ZYN A;  2DYM A;  3PSE B;  3NZ3 A;  2BWF A;  5E6O A;  1E8W A;  1M94 A;  2ACZ B;  1SSN A;  3SFE B;  1G6J A;  4NJC A;  2JXT A;  3DCG A;  5JH5 C;  3Q3F A;  1WJ4 A;  3VQI A;  2BYE A;  5BMI A;  2JQR B;  2CJN A;  3UI3 A;  1XCT L;  2WXI A;  4XWT A;  1ZDV A;  3VFK A;  1HA5 A;  2IND C;  1K51 A;  1XLO A;  2A5U A;  1WR6 E;  3SEB A;  3U8Z A;  2IBI B;  2WNM A;  1WWT A;  2ZW0 A;  4IWP A;  3R2T A;  4A3O A;  3VTV A;  3MFG A;  5EE9 A;  1F9J A;  3ETR A;  1WF9 A;  4MM3 A;  1WGK A;  3UIP B;  5L83 A;  3LXF A;  3Q8F A;  2L0F A;  4B95 A;  1V2Y A;  1UWX A;  1UZX B;  3RNG C;  2JZP A;  2LVP A;  1YQB A;  1K52 A;  3R2I A;  2KTR B;  3NHE B;  2FUG 1;  2O6V A;  2ZEQ A;  3S2A A;  3SD5 A;  2MH7 A;  1QOG A;  4BAX A;  2WWZ A;  2BS2 B;  4MEM A;  3ALB A;  4C7Z A;  1T0Q C;  3T3O A;  3JSV A;  1JWS D;  1KFY B;  1OQY A;  3M3J A;  3WIM A;  1M4V A;  4N58 A;  4EEW A;  4S17 A;  2E3T A;  3P2B A;  3WA0 A;  3RCZ A;  3KUC B;  3AE3 B;  1SJE D;  1WMH A;  3HM3 A;  1YN5 A;  1CMX B;  4IOI E;  1V9J A;  1AW7 A;  1DGJ A;  1R7S A;  2GB1 A;  4WWN A;  3ZJU A;  1CZP A;  3W9C B;  1J19 A;  4W9I A;  3MC9 A;  2JRH A;  2JF5 A;  3ZIM A;  1C1Y B;  4GLS C;  2WXJ A;  3BVZ A;  4B9K A;  1XF5 L;  1WGY A;  1RM6 C;  2DNF A;  4LNI A;  1HXY D;  4ZRK A;  2KJR A;  2DYO A;  4WUR A;  3N1Y C;  2H89 B;  4DDG D;  3O13 A;  4LDT B;  2J0K A;  4HDQ A;  4DDI D;  2LJI A;  3ZLZ A;  1EM7 A;  2MBH A;  2PEA A;  4FJY A;  3U4E G;  1SIF A;  2QSD A;  2C7N B;  4KZC A;  2V3S A;  5AZG A;  2YEP B;  2MBQ A;  1FXT B;  2MX2 A;  3OJ3 A;  5TSS A;  2LI5 A;  4ZHO A;  4WH4 A;  1XXG A;  2NBU A;  1BML C;  3APD A;  2WQY B;  1GJZ A;  3VUW A;  2Z0D B;  3DHG C;  1GB4 A;  1C4A A;  2FBW B;  3TJP A;  2KFK A;  3PHX B;  4YXD B;  1Z5S B;  1SB3 C;  1TGZ B;  1QKZ A;  2ON8 A;  1YJJ A;  2MJ3 A;  4A90 A;  1VCB A;  4FXC A;  2IPK D;  2KDF B;  2L76 A;  4IM0 A;  3TL5 A;  3DBH I;  2V9H A;  2WDV B;  3MC0 B;  4IUM B;  3ZVV A;  1XO3 A;  4KSK C;  3VRA B;  1B9R A;  3AE5 B;  2RGF A;  2G4S A;  3W1Y A;  4REZ A;  2WXM A;  1OEY A;  3P63 A;  1F77 A;  3N32 A;  2K1F A;  3EEC A;  3AV8 A;  3CWI A;  5HHD G;  1N60 A;  2WXG A;  1UBI A;  1ET9 A;  2QMT A;  4KGS A;  1L7Y A;  4IW0 A;  1UBQ A;  1EWY C;  2K6D B;  2RPV A;  1T5X D;  1HZ6 A;  5T8I A;  3DOW A;  4AJW A;  3Q8A A;  2JWZ A;  3AE2 B;  2CHZ A;  1B1Z A;  3PV1 A;  1RFA A;  5FK9 C;  2WU5 B;  1Q10 A;  2KDE B;  3OAW A;  1JRU A;  1AN8 A;  2GOW A;  2D3B A;  1R4M I;  1GAQ B;  2WXP A;  2M17 A;  4RGN A;  3ZTD A;  3RNE C;  2HDE A;  3L0W B;  1TIF A;  1DOI A;  2XK5 B;  1NYR A;  2K39 A;  4BZA A;  2KWU B;  2WXO A;  2RMM A;  4WQM A;  2LXC A;  1LO5 D;  2L00 B;  4BKS D;  3ABV B;  4II3 B;  1WGR A;  4D2K A;  3AU4 A;  2OJW A;  4KSL C;  2QDF A;  3M95 A;  4TQ1 A;  3GP7 A;  4IG7 B;  5I4D A;  2PKO A;  4NY0 A;  1ET6 A;  2KFJ A;  4GIV A;  4M01 A;  4HJG E;  2LJ5 A;  1IGC A;  3EFU A;  4W9E A;  2BW2 A;  1D5Z C;  3DWG C;  3MTN B;  2QJL A;  3N1X C;  4Q2J A;  2FUH B;  2PMV A;  3BVG A;  4W9F A;  3BYY B;  4KZ0 A;  1S3S G;  2EKI A;  3BYT B;  3RNC C;  3NJT A;  1WGD A;  2IYD B;  4C56 C;  1WM2 A;  2KJ6 A;  3IFW B;  3AI5 A;  1FFU A;  4C00 A;  1P98 A;  1MVK A;  2J53 A;  1AAR A;  1ENF A;  1SF0 A;  3IHP C;  2O6V B;  3PZD A;  2LWP A;  1L6U A;  1E8Y A;  2DZM A;  3FAH A;  3ZNG C;  2MLB A;  2AQ3 B;  2FCM A;  1QLB B;  2QC8 A;  3BY4 B;  3ZO5 B;  5DPS A;  2YLM A;  1QZE A;  3JSV B;  4K7U A;  1QT9 A;  1UD7 A;  1GOZ A;  2KWV B;  2Z0E B;  1V81 A;  2ONQ A;  2OJR A;  1LFD A;  4W9G A;  4BVU C;  4R3D A;  1L6V A;  2RR9 A;  1WMH B;  2LHD A;  2WXH A;  4P7I A;  4TQ0 A;  3AE1 B;  4MT5 A;  4AWJ A;  2KQ7 A;  4EE2 A;  1HE8 A;  3SR6 A;  2M0A A;  4BKT A;  2KMA A;  1V97 A;  2J0M A;  4XDD A;  2KX0 A;  1MI0 A;  3LYY A;  1VDV A;  4P1C C;  2KTR A;  3V3X A;  2I1K A;  3QK0 A;  4BBN F;  1FFV A;  2N7E A;  3HK0 A;  3NY5 A;  3A33 B;  1F2R I;  2LFI A;  3DVG X;  3P4P B;  1WGG A;  4TKN A;  4M8M A;  1ZGU B;  3WAN A;  3QWZ B;  4LJO B;  2Z59 B;  5H92 C;  2PIA A;  3Q8B A;  1JRP A;  3SHQ A;  3IAS 1;  3PHW B;  4W9D A;  3BIN A;  1L5P A;  3DHH C;  3I57 A;  2N0S B;  1E8X A;  3KW5 B;  3U7Z A;  3PGE A;  2NBV B;  1MJD A;  3RPF C;  3IBE A;  3NZU A;  4A6Q A;  1NYQ A;  4FN2 A;  4YTN B;  2BT6 A;  2G1E A;  2ZCB A;  5D3D A;  3H1U A;  5C2T B;  1TY2 A;  4I6N B;  1ZW7 A;  1WR1 A;  2BBC A;  2BB6 A;  2JUO A;  4NQK E;  1J7A A;  2W3S A;  1ZDX A;  3EFC A;  2AL6 A;  2MP2 A;  2KFK B;  3H8H A;  3IAM 1;  2DZJ A;  3I63 C;  2G9H D;  4RCO A;  1E7V A;  4HVB A;  1NDD A;  2KC2 A;  3DQV A;  1ISN A;  2LGY A;  3OG5 A;  3VHT C;  1V5O A;  1E8Z A;  2UYZ B;  2UU7 A;  1YNT E;  3PTF C;  3EUB 2;  2IGG A;  2K25 A;  1E5W A;  4JWU C;  3AE4 B;  2L3Z A;  1IBX B;  2MBE A;  2MJE A;  3UQA A;  4RGT A;  5EE1 A;  1C4C A;  3I9V 1;  3ZNI D;  3AEA B;  2IDY A;  1FM0 D;  3IT6 B;  2LVQ A;  3DDC B;  4KGR A;  4AUQ C;  4MAC A;  5GMV A;  4IDI A;  4TUU A;  1P9D U;  2VZK B;  4HRO A;  3V62 A;  1V6E A;  2PVO D;  1NEK B;  2W3R A;  1GG3 A;  4P1B C;  2KVR A;  4ZRQ A;  3W5V B;  1TBE A;  3ZRC A;  5CTR C;  2NCN A;  2XEW A;  4AP4 C;  4BBN C;  5IAA C;  4TMA B;  1T3Q A;  5BO4 B;  3KYC D;  4H2A A;  1IGD A;  2JYT A;  2K8H A;  3HVZ A;  4XDC A;  3SDL C;  2DWQ A;  1P1A A;  2D10 A;  2MEK A;  2IZV B;  2ZNV C;  4BKG A;  2BKR B;  4JX1 C;  4MJS B;  4LNK A;  1I4G A;  2B76 B;  3A4R A;  4XGA B;  3APC A;  3HVD A;  3C19 A;  1LGR A;  3TMP B;  1WFY A;  2V1Y A;  2LAS A;  5D94 A;  3AEB B;  4NQL B;  3DBH B;  3I5J C;  2PE9 A;  3I3T B;  4MGI E;  1Y8R C;  1XEE A;  1F1H A;  4NJ6 A;  3DHI C;  3VAW A;  1SE9 A;  1WYW B;  2KHW B;  2KK8 A;  4G11 A;  2BQQ A;  1PDX A;  5G2N A;  4B6W A;  1TS5 A;  1XLQ A;  1WRD B;  4M0W B;  2IY0 B;  2INP E;  1KLV A;  2DEN B;  2KX3 A;  4DXA B;  1KJT A;  4G0N B;  3PRP B;  1JQ4 A;  4K1R B;  1YQ4 B;  2LGD A;  2LUM A;  2GBK A;  2SEB D;  3IG3 A;  2WDT B;  2YVC A;  5IO9 A;  5J17 A;  4WJP A;  1MHH E;  3TBL D;  1S1Q B;  2MWS B;  1XQQ A;  4I6L B;  2L83 A;  2W55 A;  3URY A;  1QQR A;  2FNJ B;  3U52 E;  3KWL A;  2N1V A;  1HZ5 A;  1SE3 A;  2C5L C;  5C3J B;  1T0S C;  3ZDM C;  3GOE A;  3FIL B;  1R4M B;  1MHX A;  1N63 A;  2G3Q B;  1RRB A;  2KDI A;  3GB1 A;  4GMV A;  1JRO A;  2KKC A;  5LXH A;  1V5T A;  4WJO A;  2M8S A;  2GI9 A;  2WS3 B;  4BFR A;  5AUK A;  1L0Y B;  2LGI A;  3NVZ A;  1JWU D;  1SEB D;  1BT0 A;  3AE8 B;  3PZ8 A;  2DYB A;  3TEY A;  2MSE D;  4NPN A;  4M00 A;  3QAR A;  1GPX A;  3A4S C;  1FO4 A;  2ZW1 A;  1TT5 B;  1D4B A;  4OW0 A;  1WXM A;  2FID A;  1UUP A;  3EGR A;  1N5X A;  2DBY A;  2OHF A;  4W9H A;  5C23 A;  1E0Z A;  4EFO A;  4LDT D;  2OED A;  1PUT A;  3VTW A;  1UGM A;  4YL8 A;  1SE4 A;  1CJE A;  1V8C A;  4N59 A;  3M63 B;  4NJ7 A;  5E6P A;  4MH8 A;  3GZN B;  3Q69 A;  3NG0 A;  4AOF A;  4HPP A;  2W9N A;  2V4L A;  3NOB A;  1WZ0 A;  4A55 A;  3L4P A;  4GDL A;  1ZXI A;  1JAL A;  4B0M A;  4GB9 A;  4MSQ B;  2L32 A;  2JYE A;  4KV2 A;  2ASQ A;  2VH2 A;  3O65 B;  4NZL B;  1Q5W B;  4W9J A;  3ZW3 A;  4HXD A;  2J0J A;  2DAJ A;  4EZL A;  4AS1 A;  3EHV A;  4CHK A;  2L7R A;  3ECI A;  3TCA A;  1WYG A;  3RUL A;  1LQB A;  2MP2 B;  2RPQ A;  3B2G A;  2NPT A;  3Q14 C;  1P7E A;  1NBF C;  3ONS A;  3ZJV A;  2DAF A;  2SAK A;  3KYD D;  3LJ3 A;  3RMK C;  2MHJ A;  2GMI C;  3B08 A;  2L8J A;  3JYU A;  3RNB C;  2PLP A;  3BK1 A;  1Q0W B;  1TYG B;  3AEG B;  1L4D B;  2FCQ A;  2BB5 A;  3AE7 B;  2ZPY A;  4ZDV A;  2CJO A;  3VRB B;  4DXG A;  3W1S C;  4AJY B;  2ICI A;  2MW5 A;  2V4I B;  1A5R A;  4E3C A;  1WSP A;  2JZZ A;  4A8X C;  4ZRP A;  1IUE A;  1RAX A;  4W9K A;  5AUI A;  3DBS A;  3P4S B;  4FJZ A;  2N4F A;  3ZRF A;  4YWG G;  4PT5 A;  4WQO B;  2LGX A;  3EC8 A;  3ZKJ C;  4KDL B;  4IKG A;  1T0R C;  2L1A A;  3TEZ A;  2LRU A;  1ZPS A;  3W5U B;  1IBX A;  5EDS A;  4F8C B;  1JCK B;  3IXS A;  2QHO A;  2KJH B;  3LB8 C;  3R66 C;  2D3G A;  4RNA A;  3AN1 A;  2YEP F;  4IWO A;  2PPH A;  2ZVO A;  5BYS A;  2IGD A;  3R7Q A;  1P7F A;  1GC7 A;  3N3K B;  2NS5 A;  2AQ2 B;  2JZ3 B;  5BMG A;  1Z2M A;  1ACC A;  4C7Y A;  1ZUD 2;  4DHJ B;  3UF8 A;  4WAF A;  2KQ4 X;  1ZXH A;  2PW9 A;  1FEH A;  4HDO A;  4BOS C;  1VLB A;  4RM8 A;  3Q8C A;  2M1M A;  5FR6 A;  3H7P A;  1DOY A;  2KWC A;  2WU2 B;  2FE8 A;  1IYF A;  4EZK A;  3UIO B;  3X0W A;  5G5G A;  1I35 A;  1WX9 A;  4MJS A;  2KVZ A;  3P42 A;  1XT9 B;  2O2V B;  2UWQ A;  1YN4 A;  3NS8 A;  1WXQ A;  3RZF A;  5CHW A;  2N9X A;  3AB5 A;  3PZ7 A;  4EUT A;  4KX6 B;  1WRI A;  5D7G A;  3TUO A;  2O6V D;  5AEK B;  3J9C A;  4YTP B;  5EE3 A;  3CIR B;  3VH3 B;  3NZS A;  3QQ8 B;  1IPG A;  1GB1 A;  3C8Y A;  2JWU A;  5MPO A;  5D2M B;  4M0W A;  4WWP A;  4DHZ E;  2D11 A;  1YX6 B;  2DLB A;  4JGH B;  1FXA A;  1J7B A;  2C7H A;  3N30 A;  1PGB A;  3B1L X;  3Q2A C;  3NVY A;  3SU8 X;  2BYT A;  2GBM A;  5C1Z A;  5IA7 A;  3Q3N C;  5J18 A;  2KC1 A;  3GZN I;  5TR5 A;  3AEC B;  1D5X C;  3H7S A;  3CST A;  2RDG A;  4LJP B;  3MJ5 A;  5BMH A;  3FIL A;  3AE6 B;  4PS3 A;  5J2R A;  1RWS A;  2JU6 X;  4FAD A;  2MA9 B;  3V60 A;  2KN4 A;  4OVZ A;  3AMZ A;  4FHJ A;  3U30 A;  3T9L A;  1FCL A;  1L0V B;  5IKC M;  3NS1 A;  2ZNV B;  2C7M B;  2QIE B;  4GU2 A;  1I4R A;  2LD9 A;  3AED B;  2K0P A;  1U4A A;  3HHM A;  2DX5 B;  1QIL A;  4LLG M;  3L17 A;  4GDL B;  2DZI A;  1GUA B;  4K3C A;  1J8C A;  3AU5 A;  1H4R A;  1N61 A;  1JWB D;  3CMM B;  5DCN A;  3VDZ A;  2AX5 A;  3DVG Y;  1EF5 A;  1JML A;  1QOF A;  4FJV B;  2CR5 A;  3VR8 B;  1FIQ A;  3DBR I;  2NPT B;  3UIN B;  1J7C A;  2MJD A;  4ICV A;  2J52 A;  3ZYY X;  2RDH A;  3V61 A;  2J4X A;  2XN9 C;  3MP9 A;  1FPY A;  3VTU A;  4ZOH C;  2KWD A;  4EKU A;  4TSS A;  2N9K A;  4B0E A;  2PE6 B;  1LXD A;  4YSY B;  2ZVN A;  2MBB B;  3T8M A;  5BYR A;  3AEE B;  2JX5 A;  3M62 B;  1EU3 A;  1PGA A;  3MHZ A;  1FNU A;  2Q5W D;  4ARC A;  2GBR A;  2WDR B;  4ACF A;  3DVN U;  2M4N A;  4KDI C;  1WM3 A;  3AXC A;  2WP9 B;  4RMA A;  2M56 B;  4S0R A;  2M19 A;  3QAQ A;  1YMH E;  1I42 A;  2JT4 B;  3R8B A;  1NI2 A;  2I1J A;  1TS4 A;  1XLP A;  2KLG A;  5AZF A;  2BVC A;  2VZK D;  2HE7 A;  1YJ1 A;  4MGY E;  2WX1 A;  2EMS A;  2Y3A A;  2IO0 B;  3HIZ A;  1KOT A;  4HPL B;  1C76 A;  5CHF A;  1E9M A;  1CK1 A;  2EKE C;  2KNB A;  3QHT A;  1WH3 A;  3X23 A;  1I7H A;  3PRZ A;  4K81 A;  4IM3 A;  3QA8 A;  3RUI B;  2DZK A;  4A3P A;  1R4N I;  4JPS A;  5IN7 A;  3VVW B;  5GXG B;  4YTM B;  4NAW A;  1V49 A;  3PLU A;  2K9X A;  4PS8 A;  1UGJ A;  1DYQ A;  5KHQ A;  3ZGZ A;  4A9A A;  2D3A A;  3ZXV A;  4C4V A;  2V3N A;  4MEL A;  1ROE A;  2FAZ A;  4IC7 B;  3KUZ A;  1I4P A;  3ZQ4 A;  1WJN A;  5JHB A;  1UH6 A;  1SJH D;  2H88 B;  3L16 A;  3L54 A;  5G55 A;  5LXI B;  1VZ6 A;  4ZHP A;  1WJ6 A;  4M8N A;  1STE A;  4CQN A;  4DHZ B;  4HRS A;  3H7P B;  1N62 A;  1F52 A;  4P16 A;  3WCQ A;  1I4H A;  2LXA A;  2D5G A;  4OZB A;  1V1P A;  1VR9 A;  4I6P A;  2ZZP B;  1SIJ A;  2W54 A;  2KOX A;  4WIP A;  2CU3 A;  2CU1 A;  1WY8 A;  3QIJ A;  3D32 A;  1YN3 A;  4OZA A;  4KIK A;  1UNS A;  2AWT A;  3DBL I;  5DPT A;  3WAL A;  1WJU A;  3KQ4 A;  1N6Z A;  3BWU D;  2NR2 A;  2X38 A;  3V05 A;  5FKA C;  2R2Q A;  2NBW B;  2KMC A;  5D6J B;  4KVG B;  2WXF A;  4JL9 A;  3HM6 X;  1C9F A;  2J7Q B;  3V6C B;  2O2V A;  3ML8 A;  2LGS A;  3PT2 B;  2PTL A;  4HK2 A;  2WX0 A;  1EF1 A;  4G50 A;  3QJZ A;  2WXR A;  3P1M A;  4MGK E;  3B2F A;  3Q8E A;  4XE0 A;  4P6V F;  2BYF A;  4LTU A;  4OVV A;  2N9E B;  1FRD A;  1L4Z B;  2Z8L A;  4XC2 A; 
#chains in the Genus database with same CATH homology
 3BYY B;  2EKI A;  4A8X C;  4ZRP A;  3BYT B;  2IGH A;  1IUE A;  1JWM D;  2BS4 B;  4ITK A;  4C56 C;  4HKQ A;  4XWW A;  5AUI A;  1TY0 A;  2L52 A;  3P4S B;  1FFU A;  5JXV A;  3KLS X;  4NAM A;  1MVK A;  4YWG G;  2WLB A;  4PT5 A;  2J53 A;  1ENF A;  1K50 A;  1SF0 A;  3U2S C;  2BS3 B;  1N5W A;  1L6U A;  2GRI A;  4IKG A;  3ZJT A;  3FAH A;  2AQ1 B;  2L1A A;  3TEZ A;  3VR9 B;  1VJK A;  2AQ3 B;  1I4X A;  2PVG C;  1QLB B;  3AH7 A;  1ZPS A;  1EU4 A;  3W5U B;  1IBX A;  2BTE A;  4L23 A;  1L0X B;  1JCK B;  3IXS A;  1FNW A;  1QT9 A;  1GOZ A;  3LB8 C;  2ONQ A;  4RNA A;  4OZC A;  3AN1 A;  2YEP F;  5D3I B;  1QF6 A;  1XCQ L;  1TKE A;  1ZOY B;  2LEK A;  3HRD D;  4KKJ A;  1SBB B;  1FCC C;  4GDK B;  1L6V A;  4R3D A;  5G5H A;  3AEF B;  2LHD A;  2WXH A;  4DXF A;  5BYS A;  1FXI A;  2IGD A;  2Y5C A;  4WWM A;  3AE9 B;  1P7F A;  1TKG A;  4TQ0 A;  1PYW D;  3AE1 B;  4MT5 A;  5HFY A;  2XNA C;  4EE2 A;  3BVM A;  1KF6 B;  3P4Q B;  4RH6 A;  1KRH A;  2EEL A;  2M0A A;  3SR6 A;  5HG2 A;  1V97 A;  2AQ2 B;  1PFD A;  4XDD A;  3N9Y C;  1MI0 A;  3LYY A;  5BMG A;  1E6E B;  1ACC A;  1HEZ E;  1VDV A;  4C7Y A;  1ZUD 2;  1C4P A;  3V3X A;  4WAF A;  2KQ4 X;  1ZXH A;  1V1O A;  2PW9 A;  1FEH A;  2NTS A;  3NVV A;  1VLB A;  3Q8C A;  1FFV A;  1BXT A;  1DOY A;  2WU2 B;  1F2R I;  1MPE A;  2N7J A;  2FE8 A;  2LFI A;  4LK0 M;  3P4P B;  1KLG D;  5G5G A;  1TZO A;  1NI3 A;  2LHE A;  1A70 A;  1QOB A;  1SXT A;  5H92 C;  2LMC A;  3P42 A;  2PIA A;  3Q8B A;  4O1N A;  1DOX A;  1JRP A;  3IAS 1;  4RGO S;  4RF1 A;  1FRR A;  1YN4 A;  1WXQ A;  3GS2 A;  1L5P A;  3I57 A;  1NVI D;  2N0S B;  3AB5 A;  3PZ7 A;  1I4Q A;  1ZP0 B;  5FR3 A;  1OQR A;  1WRI A;  4KX6 B;  2INN E;  3HUI A;  5D7G A;  3U7Z A;  1E7P B;  1TJE A;  2V0G A;  3RPF C;  4N6E B;  3TUO A;  2HTM E;  4A6Q A;  1NYQ A;  3J9C A;  4YTP B;  4YTN B;  2BT6 A;  5EE3 A;  2G1E A;  3CIR B;  1TS2 A;  1UWM A;  2N9L A;  5D3D A;  2Y5P A;  4DQO C;  2NMQ A;  1TY2 A;  5C2T B;  1TKY A;  1GB1 A;  4RF0 A;  3C8Y A;  2JWU A;  1VRA B;  5MPO A;  4KKI A;  2BBC A;  2WXL A;  2BB6 A;  1J7A A;  2W3S A;  1ZDX A;  4M0W A;  1EWC A;  1E10 A;  4RGM A;  1VZ8 A;  2DLB A;  1FXA A;  3H8H A;  1J7B A;  3IAM 1;  4L1B A;  2KAC A;  2G9H D;  4NAW B;  5LNK 1;  4RCO A;  1PGB A;  1FD6 A;  3NVY A;  2WXQ A;  2DYM A;  3NZ3 A;  2JSV X;  2BYT A;  2IJ0 A;  1VZ7 A;  2ACZ B;  2I38 A;  1SSN A;  3SFE B;  1YNT E;  3EUB 2;  4NJC A;  2E6X A;  2JXT A;  2IGG A;  3AEC B;  3VQI A;  4JWU C;  5HI1 A;  5BMI A;  2JQR B;  3AE4 B;  1D5X C;  2CJN A;  1IBX B;  3UI3 A;  1ZE3 D;  1FNV A;  2MJE A;  1XCT L;  2WXI A;  4XWT A;  1ZDV A;  1PGX A;  2RDG A;  1HA5 A;  3MJ5 A;  1C79 A;  5BMH A;  1K51 A;  3FIL A;  1XLO A;  3AE6 B;  3TEW A;  2R61 A;  1RWS A;  2JU6 X;  4RGT A;  5EE1 A;  3SEB A;  1C4C A;  3I9V 1;  3AEA B;  2IDY A;  1FM0 D;  2KN4 A;  2WNM A;  1WWT A;  1JWA D;  2ZW0 A;  3R2T A;  4OVZ A;  1KH0 A;  3IT6 B;  4AQ7 A;  3AMZ A;  4KGR A;  3BK2 A;  3MFG A;  5EE9 A;  1FCL A;  3ETR A;  1L0V B;  1WGK A;  4UDU C;  4MAC A;  1V1P B;  3NS1 A;  3LXF A;  3Q8F A;  4IDI A;  1UWX A;  2WXK A;  2VZK B;  2QIE B;  4HRO A;  4HKZ E;  3E56 A;  1I4R A;  2JZP A;  1NEK B;  2PVO D;  2W3R A;  3AED B;  2K0P A;  1K52 A;  3R2I A;  4ZRQ A;  2FUG 1;  3W5V B;  1ESF A;  2MH7 A;  1QOG A;  1QIL A;  4LLG M;  4GDL B;  4TMA B;  2BS2 B;  1T3Q A;  1T6B X;  3IT4 B;  4H2A A;  1IGD A;  1KLU D;  2JYT A;  4C7Z A;  2V3P A;  1N61 A;  3T3O A;  3HVZ A;  4XDC A;  2DWQ A;  1JWB D;  1JWS D;  1KFY B;  2AX5 A;  2MEK A;  4JX1 C;  1M4V A;  4N58 A;  1JML A;  1I4G A;  2B76 B;  1QOF A;  2E3T A;  3TEX A;  3VR8 B;  3HVD A;  1FIQ A;  3BII D;  1J7C A;  2MJD A;  3AE3 B;  1SJE D;  2KMM A;  1YN5 A;  5EE0 A;  4IOI E;  3AEB B;  1AW7 A;  3FC4 A;  2J52 A;  1DGJ A;  1D5M C;  1R7S A;  3ZYY X;  2GB1 A;  2RDH A;  2J4X A;  2XN9 C;  3MP9 A;  3ZJU A;  1XEE A;  1CZP A;  3W9C B;  1RYJ A;  3EA6 A;  4ZOH C;  2KWD A;  4TSS A;  2N9K A;  4B0E A;  4YSY B;  4GLS C;  2K5P A;  2WXJ A;  3BVZ A;  3SFD B;  5BYR A;  1PDX A;  1XF5 L;  3AEE B;  2JX5 A;  1TS5 A;  1Y56 A;  1RM6 C;  1XLQ A;  4YSX B;  1EU3 A;  1PGA A;  3MHZ A;  1FNU A;  2Q5W D;  2K3U A;  2INP E;  2WDR B;  4RFB A;  1HXY D;  4ARC A;  2K22 A;  2DYO A;  4WUR A;  2H89 B;  1RFK A;  3O13 A;  2WP9 B;  2M56 B;  4ARI A;  1JQ4 A;  2M19 A;  2LJI A;  1YMH E;  1YQ4 B;  1EM7 A;  2LUM A;  3E9S A;  3R8B A;  3U4E G;  5BYQ A;  2QSD A;  2SEB D;  1TS4 A;  1XLP A;  3W1S A;  4USA A;  3B9J A;  1MHH E;  2YEP B;  3RFZ B;  2VZK D;  3T3N A;  2L83 A;  2J42 A;  2W55 A;  2Y3A A;  3BZD B;  3URY A;  1QQR A;  5TSS A;  3U52 E;  3KWL A;  1HZ5 A;  4ZHO A;  3PO0 A;  4JWS C;  1SE3 A;  1C76 A;  2QEJ C;  5C3J B;  1C77 A;  4WH4 A;  1XXG A;  1E9M A;  1CK1 A;  1BML C;  4C80 A;  3FIL B;  4JE3 B;  2WQY B;  1MHX A;  3NRZ A;  1I7H A;  3NUH B;  1N63 A;  1D6E C;  1GB4 A;  1C4A A;  2FBW B;  2I2Y A;  4JPS A;  3GB1 A;  1TS3 A;  1BUI C;  1JRO A;  4YXD B;  4MM3 B;  5GXG B;  1SB3 C;  2ON8 A;  1QKZ A;  2GI9 A;  1YJJ A;  2MJ3 A;  2WS3 B;  4YTM B;  4A90 A;  5AUK A;  4FXC A;  1C78 A;  2IPK D;  1L0Y B;  2K9X A;  2LGI A;  2WXN A;  3NVZ A;  4US9 A;  1JWU D;  1SEB D;  2WDV B;  3AE8 B;  2KAJ A;  3PZ8 A;  3TEY A;  1UGJ A;  3MC0 B;  1DYQ A;  1XLN A;  3ZGZ A;  4A9A A;  2V3N A;  1ROE A;  4OHJ A;  1XO3 A;  1GPX A;  1F2R C;  1NEN B;  1I4P A;  3ZQ4 A;  3VRA B;  1FO4 A;  2W82 A;  1K53 A;  4YSZ B;  4US8 A;  2ZW1 A;  1B9R A;  1D4B A;  1SJH D;  2H88 B;  3AE5 B;  4OW0 A;  1FMA D;  1UUP A;  1VZ6 A;  4ZHP A;  3W2D A;  3EGR A;  4REZ A;  1STE A;  4CQN A;  1N5X A;  2DBY A;  2OHF A;  4YT0 B;  4HRS A;  2WXM A;  3KWV A;  3P63 A;  1YJI A;  1F77 A;  1N62 A;  1E0Z A;  3AV8 A;  4P16 A;  3CWI A;  5HHD G;  3WCQ A;  1N60 A;  2WXG A;  1ET9 A;  2QMT A;  1I4H A;  2WDQ B;  1AYF A;  4KGS A;  2OED A;  2QIL A;  2D5G A;  1EWY C;  1PUT A;  4OZB A;  1V1P A;  2RPV A;  1T5X D;  1VR9 A;  1SE4 A;  1HZ6 A;  5T8I A;  1CJE A;  1V8C A;  4N59 A;  1SIJ A;  2W54 A;  3Q8A A;  1YQ3 B;  3AE2 B;  1SE2 A;  4WIP A;  1B1Z A;  2CU3 A;  4MH8 A;  5FK9 C;  1YN3 A;  3Q69 A;  4OZA A;  4HEA 1;  1KTK A;  1UNS A;  2WU5 B;  1Q10 A;  4A55 A;  3L4P A;  1ZXI A;  1JAL A;  3KQ4 A;  1AN8 A;  3DWM A;  4B0M A;  1GAQ B;  2L32 A;  3BWU D;  2JYE A;  2WXP A;  4NZL B;  4RGN A;  2HDE A;  2X38 A;  3V05 A;  5FKA C;  1QOA A;  3NVW A;  1F0Z A;  1DOI A;  2WXF A;  4AS1 A;  1OQQ A;  3P4R B;  3TSS A;  1NYR A;  1WYG A;  3B2G A;  1C9F A;  2WXO A;  1P7E A;  4J3O D;  3ZJV A;  2RMM A;  4WQM A;  1LO5 D;  5E6J A;  3ABV B;  4KGT A;  2SAK A;  3OWE B;  4D2K A;  4L2Y A;  2PTL A;  4TQ1 A;  3GP7 A;  2PLP A;  3BK1 A;  1TYG B;  3AEG B;  1CQV A;  1L4D B;  5I4D A;  2BB5 A;  2PKO A;  1ET6 A;  3AE7 B;  4ZYS A;  1OFF A;  2WXR A;  2TSS A;  3P1M A;  4HJG E;  1AWD A;  1HQR D;  1JW9 D;  2CJO A;  3B2F A;  3Q8E A;  1IGC A;  3VRB B;  4XE0 A;  4DXG A;  2BW2 A;  4P6V F;  1D5Z C;  3DWG C;  4LTU A;  2QJL A;  3AM9 A;  2ICI A;  4Q2J A;  2PMV A;  1FRD A;  3BVG A;  2V4I B;  2KDM A;  5H8Y E;  1L4Z B;  1WSP A;  2NTT A;  2Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...