2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0895
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
4LTUA 2DBYA 1ROEA 4KX6B 1QLBB 4N58A 1DOXA 1L0VB 2B76B 1PUTA 1WYGA 3RPFC 1PDXA 1JALA 2K5PA 3W5UB 2KAJA 4FXCA 1L5PA 4WWMA 1FO4A 1VLBA 2L52A 1TYGB 2L83A 1OFFA 3AE8B 3AMZA 3P4RB 4ZOHC 3B2GA 2W54A 2PVOD 1XLPA 3SR6A 3VR8B 4ZHPA 2E3TA 5H92C 2BS3B 1J7BA 4C7YA 1TJEA 3SFDB 4A9AA 5C3JB 1FIQA 4YSYB 3NS1A 3P63A 1FMAD 2Q5WD 2WS3B 1E0ZA 2K22A 4ZHOA 2EKIA 1E9MA 3FAHA 4YTPB 2QJLA 3NVZA 2BS4B 3W9CB 1WGKA 3CIRB 3DWGC 2CU3A 1FXAA 3AM9A 2CJNA 1QOBA 4US8A 1N61A 2QIEB 1RFKA 2JX5A 2W55A 1NVID 2W3RA 3P1MA 4HROA 2FBWB 3B9JA 3AEEB 4N6EB 2WP9B 3AV8A 1JQ4A 4IDIA 1SF0A 1L6UA 5C2TB 1YJIA 2WU2B 3AEGB 1WWTA 1NYRA 1L6VA 1RWSA 3ABVB 3AEAB 4C7ZA 3VR9B 1NEKB 3FC4A 5EE1A 3B2FA 3HUIA 3KWLA 1QOGA 4JWSC 1NYQA 3AE2B 2LEKA 5EE9A 5AUIA 2H88B 5H8YE 1KRHA 1OQQA 1FRRA 1N60A 1ZP0B 1ZXIA 3AEBB 3AECB 1N62A 3HRDD 3AE7B 1CZPA 1DOIA 3DWMA 1A70A 1SB3C 2HTME 2Y5CA 1IUEA 1TKEA 1YJJA 4JWUC 1XLQA 3ZYYX 3BIID 1NENB 3L4PA 1JRPA 3WCQA 1E10A 2KMMA 3AEFB 4YT0B 5AUKA 3P4SB 1VJKA 1ZUD2 1N63A 2CJOA 1E7PB 2M56B 2DWQA 1UWMA 1J7AA 3AB5A 1SIJA 1XLOA 1N5XA 3NVVA 3HVZA 1I7HA 2WU5B 4WQMA 1XLNA 3SFEB 1XO3A 3CWIA 1FFVA 4N59A 1OQRA 1JWAD 1QOFA 2W3SA 3ETRA 5MPOA 2BS2B 3PO0A 2AX5A 1FXIA 3NVYA 5G5GA 1FFUA 2M19A 1RM6C 1V97A 3AEDB 4YTNB 4HRSA 1GAQB 3LB8C 3P4QB 1AYFA 1RYJA 3VRBB 1QOAA 1V8CA 1WXQA 2WQYB 4USAA 1QF6A 2WLBA 3W5VB 4ITKA 3AE1B 3AE5B 3NVWA 1JROA 2JQRB 3VRAB 4YSZB 1YQ3B 1ZOYB 1AWDA 2MH7A 3AE6B 1NI3A 2H89B 1TKGA 5G5HA 1QT9A 2OHFA 2MJEA 4C80A 2WDQB 2WDRB 1T3QA 1DOYA 2BT6A 2WDVB 3EUB2 3AE9B 1F0ZA 2K9XA 1PFDA 2N0SB 4YXDB 2MJDA 1TKYA 3LXFA 3NRZA 3AE4B 4YSXB 1B9RA 1KF6B 4P6VF 1E6EB 1VDVA 1JW9D 4YTMB 1DGJA 1N5WA 3AH7A 3AN1A 1CJEA 1WRIA 2MJ3A 3P4PB 2PKOA 2PIAA 1J7CA 5GXGB 1FM0D 2G1EA 5EE3A 1JWBD 2PVGC 4JX1C 3AE3B 1YQ4B 2ACZB 4US9A 5EE0A 1FRDA 1R7SA 1EWYC 1GPXA 1KFYB
chains in the Genus database with same CATH superfamily
3WIMA 1TIFA 1L0VB 3MC0B 1XF5L 3DBRB 4GDKB 3K9OB 3P4RB 5DPRA 1PYWD 2KDIA 3NUHB 3ML8A 4WURA 1B1ZA 1WX8A 2IO2B 2IO3B 2R61A 3V60A 3HVDA 3M95A 2KMAA 3W1SA 5DCNA 3JVZX 3QARA 4BKSA 2MRPA 3FC4A 4D2KA 2KDFB 2J53A 1OQYA 5G55A 3R7RA 2ONQA 1YJJA 1XLQA 2V0GA 1NI2A 2WX0A 3SD5A 5BMIA 4BKGA 4NAWB 3BINA 2NVUI 4M02A 4RF1A 3ZVVA 2G4SA 5MPOA 4AJYB 1BXTA 3D32A 2VZKB 3Q14C 2WXNA 3X0WA 4XDDA 4IUMB 3AE5B 2ON8A 3O13A 4WJOA 2NCNA 2IBIB 1WMHB 3OLMD 4KGSA 3L16A 5C1ZA 2LJ5A 2MJDA 2AYOB 4WH4A 1E6EB 3ECIA 4OVVA 2K0PA 5JHAA 1RRBA 3BZDB 1R4NI 1Y56A 4K7WA 3SDLC 5J17A 4RCOA 2K3UA 2ZPYA 1EWYC 4PYUA 2C5LC 1SJED 2GI9A 5IAAC 1TYGB 2L83A 2RMMA 2W54A 2L7RA 1I35A 1C9FA 4B9KA 2Y5PA 2MSED 2WS3B 1D5XC 2MCNB 2BQQA 3FAHA 2NS5A 3NVZA 4K1RB 3WA0A 1V9JA 1V2YA 2IDYA 4N6EB 2KFJA 2V9HA 3MHSD 1RWSA 4C7ZA 3UIOB 5EE1A 4M0WB 4NQKE 1ACCA 3AE7B 3UQAA 1GNUA 1IGCA 1IBXA 3CSFA 3ZNGC 3AEFB 4JE3B 1ZUD2 1MHXA 4DQOC 5CHVC 1XLOA 3E9SA 3HVZA 4II2B 2J0MA 1WSPA 1ZE3D 1Q0WB 2WXIA 1FXIA 3NVYA 3APDA 1C1YB 1EU3A 2X38A 3P4QB 1RYJA 4MJSB 3Q6BA 1QOAA 2QMTA 1WJNA 3AXCA 2IGGA 2KN4A 2M17A 2MH7A 1LM8B 2PMVA 1ZDVA 3EGRA 4RM8A 4ZRKA 2KO3A 2LI5A 1L4ZB 3PRPB 3V05A 3VFKA 1P9DU 4MDKE 1D5ZC 1KF6B 2WXQA 4XYCA 1DGJA 1F2RI 1EUVB 4EZLA 1C4CA 2MJ3A 3Q3NC 4KSLC 5BMGA 1L0YB 3OJ4B 4BFRA 2LUEA 3GE8C 3H1UA 2BWFA 2L8JA 1VZ8A 4DDGD 5D6JB 1QLBB 2XN9C 4AQ7A 4GDKA 1UUPA 2XBBC 1OFFA 3SR6A 2LVOA 2OOBB 4MH0E 1WXAA 2M8SA 1WJ4A 1OEYA 3P63A 4NJCA 1ET9A 1C77A 4A55A 3OG5A 3W9CB 1TS4A 1WGKA 2Z0DB 1YIWA 2W55A 2A5UA 4HROA 3R2IA 3AV8A 2D3BA 4WWNA 2FCQA 2MEKA 3R2TA 4W9EA 5E6JA 2RGFA 1P0RA 1NYQA 2LRWA 3AE2B 4L2YA 4NQLB 5EE9A 1JWSD 3H9DA 3RUIB 3AEBB 1OQQA 1ZXIA 1N60A 1ZP0B 2FIDA 3IXSA 3Q8EA 4MGIE 5CHFA 3VTVA 3V61A 3QHTA 2I1JA 3TSSA 5HFYA 2JSVX 4NAWA 1DYQA 2C7MB 1VJKA 5IOIA 3KYDD 3RULA 4MGZE 3TEYA 3SFEB 3PZ8A 2GBRA 1GC7A 3TUOA 1FNVA 3P42A 2KJHB 2Z8LA 3A1QA 2PPHA 5HKHA 3EA6A 3LB8C 2RDBC 3C8YA 1SXTA 2LFIA 4HJKA 4MT5A 1XXGA 1WMHA 1WGDA 4MACA 4P1CC 3N1XC 1I4PA 3AU4A 5D94A 2NPTB 1CJEA 5JHBA 1J7CA 3L54A 4LNKA 5EE3A 4MELA 3PSEB 2NTTA 4KX6B 3W5UB 3DBHI 1D5MC 1WM3A 2WXOA 1KH0A 2RPQA 5IN7A 1SE2A 4JQWC 1E9MA 2AL6A 4ZYSA 2QJLA 2BS4B 4BZAA 1SIFA 3AM9A 2WYQA 2WXKA 3P1MA 2FBWB 4K3BA 1C4PA 3QC8B 5FK9C 2V4IB 5C2TB 1NYRA 4K7SA 5LLIA 3BYYB 3HUIA 3UI3A 1KJTA 2SEBD 5LXHA 4M0WA 4XX5A 3KYCD 2CU1A 2IY0B 1QQRA 4AP4C 1IUEA 3DBRI 4A3OA 1UWMA 2KVRA 3NHEB 2GBJA 1T0QC 3CF6E 2G3QB 2QCZA 1CK1A 4GIVA 2QHOA 4MJSA 3PHXB 2WGSA 3I9V1 2M0AA 4AWJA 3IFWB 1AWDA 4FA6A 1X1MA 2H89B 1TKGA 2L0FA 3T8MA 4C80A 3B08A 1DOYA 4L1BA 2K9XA 5CTRC 4M00A 1QKZA 3ENEA 4RF0A 2MHJA 3KWVA 1KLVA 2BB6A 1WRIA 4RGMA 4IWQA 1L4DB 4LJPB 2EMSA 2D3GA 2PVGC 4XE0A 2YVCA 1DOXA 4HCNB 1WYGA 5HI1A 5L83A 1MI0A 1SEBD 1F52A 2K5PA 2MBEA 1VLBA 2BGFA 3I5JC 4NJ7A 3SFDB 4C4VB 1FIQA 4YSYB 4B0EA 1FMAD 2Q5WD 2K22A 5E6OA 2LWPA 2HD5B 3DOWA 2C7HA 3ZTDA 3P2BA 3APFA 1N61A 4IKGA 1WH3A 4HKZE 5BYRA 4FBJB 2WP9B 3Q3MC 5D7GA 2N9EB 3RI7C 2INCC 4LK0M 1E8WA 2K6QA 2JWUA 2Y5BB 2LZ6A 2LHDA 1V6EA 3Q2AC 4LNIA 3ZO5B 2HTME 1H8CA 1I4HA 3IAS1 1NENB 1XD3B 1Z2MA 2J42A 2LUMA 3W1YA 4NPNA 1UNSA 4ZDVA 4HKQA 2CJOA 2TSSA 4HPMB 1GB1A 1J7AA 1IPGA 1SIJA 4TUUA 4WQMA 4ANXA 4XC2A 2W3SA 1LQBA 4N9F4 2RR9A 3HK0A 4MEMA 5TSSA 2D2QA 3BK1A 4Q2JA 1YQBA 4W9KA 3URYA 3AE1B 2MBOA 2DYMA 1ZOYB 2KDBA 2RPVA 5G5HA 5G2NA 2OHFA 2BKFA 2W82A 3FILB 3RD2A 2DZIA 1PFDA 3N32A 1R4MI 3AE4B 2NPTA 1ET6A 4YTMB 3NZUA 5J18A 1ZGUB 2MBBB 4AOFA 1JWBD 4MSMB 1R7SA 1C78A 3U52E 1IP9A 3CMMB 2GRIA 1HQRD 1D3ZA 3HIZA 1WF9A 2FUG1 3H8HA 1JRUA 3IT4B 3NS1A 3MFGA 1V80A 1J8CA 3TJPA 1FXTB 1UBQA 1FXAA 1UF0A 4EE2A 3UF8A 1V1PB 1JQ4A 2V4LA 2ASQA 3MP9A 4RNAA 1WZ3A 1GC6A 1RFAA 1F1HA 2QSDA 2WXLA 1BUIC 1ISNA 1E8ZA 1LXDA 4I6NB 5AUIA 3IG3A 1TTNA 4B6WA 2ZNVB 4JIOU 5D3DA 3UINB 3U7DA 4DWFA 1A5RA 3DBSA 4MGKE 1ZPSA 3ZIMA 4W9DA 4G3XB 4JLCA 2ZW1A 5DPTA 3GE3C 3H6NA 2N7EA 4PT5A 2I38A 1OQRA 2R2QA 3N1ZC 1C76A 1XCQL 1ZDXA 2AQ2B 3PRMB 5BYSA 4KKIA 4FJVB 1VR9A 3JW0X 4GU2A 3GZNB 2DZJA 1K50A 3JSVB 3QIJA 3DVNU 5T8IA 1WX7A 1GUAB 3C0RB 4GN1A 1KTKA 1PGAA 1I42A 3IVFA 1EF1A 4IW0A 3J9CA 4GOCA 1WRDB 1D6EC 2M4NA 2KMCA 1TY2A 3R8BA 3A1QB 3SEBA 5GXGB 1FM0D 4LDTD 4JX1C 4BVUC 2ACZB 2YEPF 5LNK1 5EE0A 4EEWA 4A6QA 1PGBA 1WYWB 1MJDA 3NOBA 4LTUA 1YD8U 1PDXA 2KAJA 1V1OA 1WXSA 1FO4A 4KIKB 3B2GA 3H7PA 1LGRA 4C4VA 4BOSC 4IM3A 2L3ZA 3R3MA 2AQ3B 4IOIE 4KV2A 5AEKB 2IJ0A 4FJYA 3MHZA 3U2SC 3RN9C 3PV1A 3DWGC 3PVLA 4L23A 2HTHA 1WR6E 1TZOA 3VH3B 3DHGC 4REZA 4DXGA 1YJIA 3UIPB 3VR9B 1E8XA 3PHWB 3PS6A 2K8CA 2LEKA 2LVPA 3ZQ4A 3ZXRA 4W9HA 1QZEA 3WAMA 2KQSA 2KLGA 2V3PA 1UD7A 3RNAC 1E90A 1XT9B 3BIID 2KMMA 4WIPA 5L95C 2ZNVC 2NBWB 1J0GA 3ZDMC 3KUCB 3V3XA 3ETRA 4OVUA 3N30A 4C56C 3VHTC 5IP4D 1T6BX 2K39A 1RM6C 1UH6A 2MP2A 2DLBA 1GAQB 2N7DA 4LLGM 3VRBB 1CMXB 1V8CA 1TBEA 2KTRB 3W5VB 3ZJTA 5CX3A 3FILA 5IO9A 4FADA 1T3QA 4TSSA 1OTRB 2V3NA 4FLHA 2XK5A 1HZ6A 4W9IA 2PW9A 1N5WA 3HHMA 3Q3FA 4KGRA 1ZXHA 2DENB 2VH2A 4NZLB 2L76A 3WAOA 2DBYA 2KVZA 5FKAC 4WWOA 4FXCA 2L52A 3AE8B 2RDGA 1XLPA 2L0TA 3PTFC 4FJZA 4C7YA 2KC1A 2YLMA 4AS1A 1C3TA 2L00B 1Q1OA 2WXRA 3VVWB 2K25A 2CU3A 1WGRA 1K53A 2BYFA 1V1PA 4E71A 1SE9A 1WJ6A 3BVGA 1EWCA 1L6UA 2MX2A 1XQQA 2LHEA 1NBFC 5KHQA 4IG7B 2KN5A 5H8YE 3HRDD 2PE6B 5AZHA 2Y5CA 3APCA 2BPSA 3I63C 2NBUA 2CKHB 5D2MB 3RCZA 1I4RA 2FE8A 2MQJA 3NG0A 1JWUD 3A4SC 2L1AA 2KFKB 2WU5B 1XLNA 4BKTA 3CWIA 4HDOA 1QOFA 3HM6X 3Q8FA 4HPPA 1S1QB 1C4AA 3JSVA 1IGDA 1WXQA 2LJIA 1QF6A 1L0XB 1YQ3B 4O1NA 1FD6A 4CO7A 2BW2A 4DXAB 1WXMA 1CQVA 3LJ3A 1UBIA 2WDRB 1FPYA 4UDUC 2IGDA 1F9JA 3DDCB 5JZEB 4DDID 3ZLZA 2JXTA 2N1WA 4IM2A 4HLEA 2HJ1A 2KWVB 1WIAA 2YEPB 1MG8A 2KX3A 2PLPA 2DAFA 3QWZB 2KNBA 3WAPA 2D10A 4OW0A 2HDEA 4ZRPA 3RPFC 3ZUNA 4KGTA 2DAJA 4KIKA 2IYDB 3N9YC 2BWES 2K1FA 4ZRJA 2FCSA 3N1YC 2MWSB 3GP7A 4PS3A 4BBNF 4ANUA 2XEWA 2PTLA 4NNJB 2WXFA 2CHZA 4PS8A 2EKEC 3QQ8B 2DYBA 3DVGX 2WXPA 1TGZB 1PGXA 5IA7A 2AWTA 3PZDA 1QOGA 2JVCA 3WALA 3Q3JA 2FUHB 3BYTB 3EC8A 3PLUA 4WAFA 4JWUC 1LFDA 3H7SA 5AUKA 3SU8X 2GBNA 3U8ZA 1E7UA 3AB5A 2LMCA 3KUDB 4RMAA 1FFVA 2O2VB 5LXIB 1AW7A 1KLGD 2WNMA 1I4QA 2UU7A 4AUQC 3AEDB 4KDIC 3DCGA 3BVMA 3TCAA 2WDTB 2BKRB 2ICIA 2BYEA 2KTRA 3TEWA 2EELA 3RNBC 4USAA 2WLBA 1JROA 4YSZB 2AL3A 1SE4A 3QX1A 3AE6B 1NI3A 1V5TA 1I4XA 1YJ1A 2Z59B 3PT2B 4YXDB 1K52A 3VTWA 2JT4B 1ZW7A 4G0NB 4P6VF 1JW9D 1T0YA 2CHXA 1YN3A 2INNE 3B1LX 4FHJA 1OGWA 3TIXA 2NTSA 4LJOB 2WQYB 2WX1A 2K8HA 3L08A 2ZZPB 2LGXA 3AMZA 5EDSA 3RNCC 2UWQA 1SJHD 1V49A 3C19A 4TQ0A 2IO1B 1T0RC 4US8A 1JMLA 4YWGG 3O65B 4WJNA 3RNEC 3RNFC 1L7YA 3QJZA 1FCCC 3PRZA 2MLBA 1WWTA 4KVGB 2WWZA 3H7PB 1RAXA 4P1BC 2LD9A 2KWDA 3MC8A 4W9FA 2D11A 2KLCA 4HCPB 4ANVA 4GSWA 1SB3C 5D3IB 5FR3A 3VUWA 1V5OA 1GJZA 3GB1A 3P4SB 2RSUA 2KFKA 1I4GA 3ZXVA 3ZGZA 1VZ6A 1WGGA 4NAMA 2QEJC 1XO3A 2LVQA 3I3TB 3JYUA 2LASA 3KQ4A 4IWOA 2OJRA 2LGDA 1FFUA 4ASWC 4IC7B 2OEDA 1HEZE 2KYWA 4WJPA 5DPSA 2GBKA 2CHWA 1SE3A 3RMKC 1H4RA 3T3OA 4K7UA 1T5XD 2NMQA 3HM3A 3ZW3A 1NDDA 2MBQA 1OEYJ 2WDVB 4WWPA 2KOXA 4URKA 3AULA 1VCBA 4KZ0A 4G50A 1EM7A 2FIFA 1VD2A 5E6NA 1GG3A 4AJWA 3UGBB 4HPLB 1SSNA 3KUZA 2MP2B 4LDTB 2DX5B 3U30A 4DXFA 3VQIA 3TEXA 1ROEA 1T0SC 5HHDG 1E7VA 1HTQA 2FAZA 2EKIA 4DHJD 3BK2A 2XK5B 4HWIB 3OJ3A 1AN8A 2I2YA 3KH0A 2N7JA 2CJNA 2GB1A 2ZCCA 3K9PB 2W3RA 4HJGE 1UELA 2XNAC 1YX6B 4TQ1A 2AQ1B 3A4RA 5CHWA 1C79A 2N1VA 3BY4B 5E6PA 4DBGA 1K8RB 1YNTE 1AARA 2VH1A 1SGHA 1YN4A 3ZYYX 1JRPA 3IT6B 1E10A 2NR2A 1JWMD 1D4BA 1N5XA 2O2VA 4CHKA 1RLFA 2AEHA 1MHHE 3EECA 2Z0EB 2M19A 4HRSA 3NZSA 2HJ8A 2ZVNA 3ZNZB 3RNGC 2KX0A 4GXBA 2JF5A 3L13A 4ITKA 1J19A 2SAKA 4MGYE 2I1KA 4RH6A 4NJ6A 4FULA 5AZFA 1TKYA 3AI5A 1B9RA 3DBLB 3VTUA 2KZRA 2ZVOA 3M3JA 3ALBA 4MSQB 4A90A 2PKOA 2IPKD 3FKYA 1STEA 2MJEA 4JGHB 4LCDE 3NS8A 4S17A 2INPE 2A4ZA 3N3KB 2ZEQA 1K51A 4WQOB 4E3CA 2J7QB 3TMPB 2LRUA 1WM2A 1Q5WB 4P7IA 1EO6A 5JH5C 3GS2A 4BAXA 1GOZA 4I6PA 1Q10A 3WANA 1ENFA 2IGHA 2PE9A 3CIRB 5IKCM 4BBNC 1RFKA 1WR1A 2D3AA 3PPAA 4KZCA 2INDC 2JU6X 2WXGA 4HEA1 1L6VA 2K6DB 2NBVB 2LXCA 3QA8A 4H2AA 3NZ3A 2ZW0A 2N9PC 4RGOS 2L32A 4PYZA 3MJ5A 4MH8A 2M56B 3ML9A 2O6VD 3KLSX 2KWUB 4ZYNA 1WE7A 4J6IA 4QAYA 2HE7A 4M8MA 2LGIA 4XZ4A 4KSKC 2JRHA 1Z5SB 4M8NA 3M62B 2G9HD 3ZJVA 3PLVA 2N9XA 4YL8A 2C60A 1TZ1A 3TL5A 3EFCA 1EF5A 4OHJA 4RM9A 3Q8BA 2LGYA 1YN5A 2CR5A 4TKNA 2BT6A 3L17A 4PS7A 3LXFA 3NRZA 4RGNA 1JCKB 2JPHA 4GMVA 2LXAA 2N9KA 2D07B 4I6LB 4M01A 3CSTA 4DK5A 3Q8CA 4A20A 4EUTA 1KOTA 3U7ZA 3SHQA 4BOZB 2N9LA 4TMAB 3Q3OC 2B76B 3A33B 4HK2A 4WWMA 2DZMA 1HA5A 2QDFA 2PVOD 2E3TA 5H92C 4NY0A 1TY0A 5C3JB 2DYOA 2JZPA 1ZKHA 4TV3A 1R4MB 1WZ0A 4P16A 2KXJA 2JX5A 2KJ6A 3DHHC 2O6VA 3AEEB 3ONSA 2UYZB 3VH4B 3PZ7A 2KK8A 2WU2B 2X8XX 3ABVB 1KM7A 4JPSA 2JUOA 4F8CB 5BYQA 3ZRCA 3L0WB 4XWTA 2PEAA 3BVZA 2H88B 1BMLC 1U4AA 1WX9A 3WCQA 1N62A 1DOIA 3DWMA 2IY1B 4F7ZA 3PREA 1TKEA 3VUXA 2REXA 4II3B 1V86A 1KLUD 3DPDA 2BYVE 1I7HA 2JYTA 3IBEA 1VRAB 1XEEA 2L05A 5AZGA 2KHWB 1JWAD 1S3SG 2BS2B 4A3PA 2AX5A 4KKJA 2CS4A 1PQSA 2VZKD 4LNFA 4GLSC 5HG2A 3PGEA 2KDEB 2KQ7A 2JQRB 5J2RA 4XWWA 2KD0A 4FN2A 2IZVB 2ZPNA 3B0AA 2D3CA 4PK1A 3AE9B 3ZNHB 1MPEA 3M63B 4OZCA 1G6JA 3A9JB 4XGAB 2LGSA 2EMTA 2WHIA 3AE3B 3DHIC 4DHZE 1FRDA 4YSXB 1TT5B 2KJRA 3R7QA 1WGHA 4ZHPA 3VR8B 3ZTCA 1J7BA 1TJEA 4A9AA 2JYEA 1V81A 2V3SA 1E0ZA 4W9LA 4A8XC 4YTPB 1UGJA 3ZKJC 1L2NA 4J3OD 2FNJB 1ESFA 2QIEB 1HE8A 2MA9B 1HZ5A 4IM0A 3IAM1 4CYEA 4ARIA 2QC8A 3W2DA 2K8BA 1SBBB 3AEAB 1EU4A 2VRRB 1TS3A 3EHVA 2DHZA 4EKUA 1KRHA 1WFYA 2J4XA 3OWEB 2KWCA 4YT0B 2J52A 1R4NB 2J0JA 2JXXA 1N63A 2JY6A 3ZJUA 1Y8RC 4ICVA 3NVVA 3T9LA 5DPWA 2KKCA 2GMIC 5BMHA 4RGTA 1FEHA 1M94A 4LNOA 4EZJA 1FCLA 2V1YA 4MM3B 4ICUA 2GBMA 3VRAB 2MBHA 4B95A 1FNWA 2JRIB 2KANA 1QT9A 5I4DA 3A9KB 3EUB2 1F0ZA 3MC9A 1GB4A 4EZKA 1YMHE 2J0KA 4OVZA 2BF8B 4GDLB 3LDZE 3UQBA 2M1MA 4B0MA 3KWLA 1VDVA 3RT3B 5BO4B 1PUTA 1JALA 3KW5B 3IHPC 1L5PA 2M0XA 4ZOHC 2KACA 3TEZA 4HXDA 2BS3B 2IO0B 1UZXB 3VDZA 3ZRFA 3DVNV 4ZHOA 4DHJB 1E8YA 5GMVA 4W9GA 2OJWA 1YX5B 1QOBA 4W9JA 3Q8AA 1NVID 4WAAA 3B9JA 4ANWA 3DBLI 3AEGB 4X57B 2BBCA 3B2FA 3DQVA 4JWSC 2DZKA 3GZNI 2KT7A 2W9NA 4ZRQA 2JZ3B 5TR5A 2D5GA 3AU5A 3GOEA 3VUYA 2JWZA 2KTFA 2KDMA 5FR6A 2FCNA 2DWQA 2WXMA 1P98A 4N59A 1P1AA 3S2AA 4OZAA 3QCAA 5JXVA 1V97A 1P7EA 4YTNB 2E6XA 3MJWA 3I57A 4GGQA 4S0RA 4CQNA 1MVKA 2Y3AA 2B3AA 1MG4A 1HTOA 2N0SB 3R66C 3V62A 2QILA 4FHKA 1WI0A 1UGMA 4C00A 2BYTA 1WY8A 1P3QU 3A9JA 2MW5A 2G4DB 1WE6A 2G1EA 3VAWA 1TS5A 2FCMA 2N4FA 3KVFB 3TBLD 4US9A 2WXHA 3BWUD 1GPXA 4N58A 3VXWA 1WGYA 3QK0A 3OAWA 3Q69A 4WJQA 1FNUA 4XDCA 2ZJDA 4K81A 4RFBA 2G45B 4E74A 3NJTA 2BTEA 4ACFA 2WXJA 3NY5A 4LNNA 4EFOA 2C7NB 4IDIA 1SF0A 2JZZA 5C23A 2DNFA 1BT0A 1NEKB 2GLSA 1TS2A 3V6CB 4DHZB 4KDLB 3V6EB 3N20C 2C9WB 3W1SC 3T3NA 1FRRA 3AECB 1CZPA 4F1SA 1A70A 1IYFA 3LYYA 1E5WA 4JL9A 3L4PA 1IBXB 5KHOA 4HDQA 4ARCA 4IWPA 1LO5D 1E7PB 1QILA 2O6VB 4GB9A 1F2RC 1F77A 3E56A 3EFUA 1N6ZA 3DBHB 3PO0A 1MFWA 4K3CA 5G5GA 4BKSD 4R3DA 4MM3A 3ZNID 1WXVA 1AYFA 3RZFA 3QAQA 1VZ7A 1XCTL 2RD0A 1UWXA 3NVWA 1P7FA 2BVCA 3L10B 3A9KA 1HXYD 2RDHA 3U4EG 2WDQB 2KQ4X 4W9CA 2KC2A 4HVBA 3ZDTA 3RYTA 3DVGY 2GOWA 4OZBA 2BB5A 4GDLA 3MTNB 3AH7A 3AN1A 1YOVB 4EOYA 1M4VA 3P4PB 3X23A 1WJUA 2PIAA 4G11A 2ZCBA 2PJHA 1YQ4B 3RFZB 2R2OA 4ZRIA 3RZWC 1KFYB
chains in the Genus database with same CATH topology
2HDEA 1DOXA 4ZRPA 1L0VB 2B76B 1WYGA 5HI1A 1MI0A 1SEBD 3RPFC 2K5PA 4KGTA 4WWMA 3MC0B 1XF5L 1VLBA 4GDKB 3P4RB 1HA5A 2PVOD 3N9YC 2E3TA 5H92C 1TY0A 3SFDB 5C3JB 1FIQA 4YSYB 4B0EA 1PYWD 2DYOA 1FMAD 2Q5WD 2JZPA 3NUHB 2K22A 3GP7A 4WURA 1B1ZA 4P16A 2PTLA 4IKGA 1N61A 2R61A 2WXFA 2JX5A 4HKZE 3HVDA 5BYRA 3AEEB 2WP9B 3W1SA 3PZ7A 2WU2B 2WXPA 5D7GA 3ABVB 4JPSA 1PGXA 3FC4A 4LK0M 4D2KA 5BYQA 1QOGA 2JWUA 2J53A 4XWTA 3BVZA 2H88B 1BMLC 3WCQA 2LHDA 3BYTB 1N62A 1DOIA 3DWMA 2ONQA 2HTME 4WAFA 1TKEA 1YJJA 4JWUC 1I4HA 1XLQA 2V0GA 3IAS1 1NENB 2J42A 2LUMA 5AUKA 5BMIA 1UNSA 4NAWB 1KLUD 2CJOA 2TSSA 4HKQA 1GB1A 1J7AA 3AB5A 1SIJA 2LMCA 4WQMA 1I7HA 2JYTA 1VRAB 1FFVA 1XEEA 4RF1A 1JWAD 2W3SA 5MPOA 2BS2B 1AW7A 1KLGD 2WNMA 1I4QA 2AX5A 4KKJA 1BXTA 3AEDB 2VZKB 2VZKD 3BVMA 5TSSA 2WXNA 2ICIA 3BK1A 4Q2JA 3TEWA 4XDDA 4GLSC 2EELA 5HG2A 4USAA 3URYA 2WLBA 3AE1B 3AE5B 1JROA 2JQRB 2DYMA 4YSZB 1ZOYB 1SE4A 4XWWA 3AE6B 1NI3A 2ON8A 2RPVA 5G5HA 3O13A 2OHFA 2W82A 3FILB 1I4XA 3AE9B 4KGSA 1MPEA 1PFDA 4YXDB 1K52A 2MJDA 3AE4B 4WH4A 4P6VF 1E6EB 4OZCA 1ET6A 1JW9D 4YTMB 1YN3A 2K0PA 2INNE 3BZDB 1Y56A 2NTSA 1JWBD 3AE3B 4RCOA 2K3UA 1FRDA 2WQYB 1R7SA 1C78A 1EWYC 4YSXB 3U52E 2GRIA 1SJED 2GI9A 1HQRD 1TYGB 2L83A 3AMZA 2RMMA 4ZHPA 2W54A 2FUG1 3VR8B 3H8HA 1J7BA 3IT4B 1C9FA 1TJEA 4A9AA 2Y5PA 1SJHD 3NS1A 2JYEA 3MFGA 1E0ZA 2WS3B 1D5XC 3FAHA 4A8XC 4YTPB 4TQ0A 3NVZA 1FXAA 1UGJA 4US8A 4J3OD 1JMLA 1ESFA 2QIEB 1HZ5A 4YWGG 4EE2A 3IAM1 2IDYA 4ARIA 4N6EB 3W2DA 1V1PB 1JQ4A 3MP9A 4RNAA 1FCCC 1SBBB 1WWTA 1RWSA 3AEAB 4C7ZA 2QSDA 5EE1A 1EU4A 2WXLA 1BUIC 1TS3A 5AUIA 2KWDA 1KRHA 5D3DA 1ACCA 3AE7B 2J4XA 1SB3C 5D3IB 5FR3A 1IGCA 1IBXA 3OWEB 1ZPSA 3GB1A 3AEFB 2J52A 4YT0B 3P4SB 4JE3B 1ZUD2 1N63A 2ZW1A 1I4GA 1MHXA 3ZJUA 4DQOC 3ZGZA 1VZ6A 1XLOA 4NAMA 3E9SA 2QEJC 3HVZA 3NVVA 1XO3A 4PT5A 1WSPA 1OQRA 1ZE3D 2I38A 4RGTA 5BMHA 2WXIA 1C76A 1XCQL 3KQ4A 1FEHA 1ZDXA 2AQ2B 1FXIA 3NVYA 1FFUA 1EU3A 2X38A 5BYSA 3P4QB 4KKIA 1RYJA 1FCLA 1VR9A 2OEDA 4MM3B 1HEZE 1QOAA 1K50A 1SE3A 2QMTA 3VRAB 3T3OA 2IGGA 2KN4A 2MH7A 2PMVA 1FNWA 5T8IA 1T5XD 1ZDVA 3EGRA 2NMQA 1QT9A 1KTKA 1PGAA 5I4DA 1L4ZB 3V05A 2WDVB 3EUB2 1F0ZA 1GB4A 1D5ZC 1KF6B 2WXQA 3J9CA 1EM7A 1D6EC 1YMHE 1DGJA 1F2RI 4OVZA 1C4CA 1TY2A 2MJ3A 4GDLB 5BMGA 1SSNA 3R8BA 1L0YB 3SEBA 5GXGB 1FM0D 4JX1C 2ACZB 2YEPF 5LNK1 1VZ8A 5EE0A 3KWLA 4B0MA 1VDVA 4DXFA 3VQIA 4A6QA 3TEXA 1PGBA 4LTUA 1ROEA 1QLBB 2XN9C 1PUTA 4AQ7A 1PDXA 1JALA 2KAJA 1V1OA 1FO4A 1L5PA 1UUPA 5HHDG 4ZOHC 1OFFA 3SR6A 3B2GA 2KACA 3TEZA 2BS3B 2AQ3B 4IOIE 3P63A 4NJCA 2IJ0A 4ZHOA 2EKIA 1ET9A 3BK2A 1C77A 3MHZA 4A55A 1AN8A 3U2SC 2I2YA 3W9CB 1TS4A 1WGKA 2N7JA 3DWGC 2CJNA 1QOBA 2GB1A 4L23A 2W55A 3Q8AA 1NVID 1TZOA 2W3RA 4HROA 4HJGE 3B9JA 2XNAC 3R2IA 3AV8A 4REZA 4DXGA 2MEKA 1YJIA 4TQ1A 3AEGB 2AQ1B 3R2TA 1C79A 3VR9B 2BBCA 3B2FA 5E6JA 4JWSC 1NYQA 4L2YA 3AE2B 2LEKA 5EE9A 1YNTE 1JWSD 3ZQ4A 3AEBB 1OQQA 1ZXIA 1N60A 1ZP0B 3IXSA 3Q8EA 2V3PA 4ZRQA 1YN4A 3ZYYX 2D5GA 3BIID 3TSSA 5HFYA 1JRPA 2JSVX 3IT6B 2KMMA 1E10A 4WIPA 1DYQA 1VJKA 1JWMD 2KDMA 1D4BA 2DWQA 1N5XA 2WXMA 3TEYA 3SFEB 3PZ8A 3V3XA 4N59A 3TUOA 1FNVA 1MHHE 3ETRA 4OZAA 3P42A 5JXVA 2Z8LA 4C56C 1T6BX 2M19A 1RM6C 1V97A 1P7EA 4YTNB 4HRSA 2DLBA 2E6XA 1GAQB 3EA6A 3LB8C 4LLGM 3I57A 3VRBB 1V8CA 3C8YA 4CQNA 1SXTA 2LFIA 3W5VB 4ITKA 3ZJTA 1MVKA 4OW0A 2Y3AA 4MT5A 2SAKA 1XXGA 3FILA 4MACA 1T3QA 4RH6A 4TSSA 2N0SB 2V3NA 2QILA 1TKYA 1B9RA 2BYTA 1I4PA 1HZ6A 2PW9A 1N5WA 1CJEA 4A90A 2PKOA 1J7CA 2IPKD 4KGRA 1ZXHA 2G1EA 5EE3A 1TS5A 4NZLB 4US9A 1STEA 2NTTA 2MJEA 2WXHA 3BWUD 1GPXA 4N58A 2DBYA 4KX6B 2INPE 5FKAC 3W5UB 4FXCA 1D5MC 2L52A 3AE8B 1K51A 2RDGA 2WXOA 1XLPA 3GS2A 1KH0A 4C7YA 3Q69A 1GOZA 1SE2A 1FNUA 1Q10A 4XDCA 1ENFA 4AS1A 2IGHA 2WXRA 4RFBA 1E9MA 4ZYSA 2QJLA 2BS4B 3CIRB 2CU3A 3AM9A 2BTEA 1RFKA 2WXJA 1K53A 1V1PA 2WXKA 3P1MA 2FBWB 1C4PA 2JU6X 3BVGA 1SF0A 4IDIA 5FK9C 2V4IB 1EWCA 1L6UA 2WXGA 4TMAB 4HEA1 5C2TB 1NYRA 1L6VA 2LHEA 1NEKB 3BYYB 4H2AA 3NZ3A 3HUIA 3UI3A 2SEBD 2ZW0A 1TS2A 4M0WA 4RGOS 2L32A 3T3NA 5H8YE 3HRDD 1FRRA 3AECB 1CZPA 1QQRA 1A70A 2Y5CA 3LYYA 1IUEA 3L4PA 3MJ5A 1IBXB 4MH8A 4ARCA 1I4RA 1LO5D 2FE8A 1E7PB 1JWUD 2M56B 1QILA 1UWMA 2L1AA 3KLSX 1F2RC 2WU5B 1F77A 1XLNA 3E56A 3CWIA 1QOFA 1CK1A 3PO0A 3Q8FA 5G5GA 2LGIA 1C4AA 4R3DA 1AYFA 2G9HD 3ZJVA 3I9V1 1VZ7A 1IGDA 1WXQA 2M0AA 2LJIA 1XCTL 1UWXA 1QF6A 3NVWA 4OHJA 3Q8BA 1L0XB 1P7FA 1YQ3B 4O1NA 1AWDA 2BW2A 1FD6A 1CQVA 2H89B 1TKGA 1HXYD 1YN5A 2RDHA 3U4EG 2WDQB 2WDRB 4C80A 4UDUC 2KQ4X 2BT6A 1DOYA 4L1BA 2K9XA 2IGDA 4RGNA 1QKZA 3LXFA 3NRZA 1JCKB 4RF0A 4OZBA 3KWVA 2JXTA 2BB6A 2BB5A 2N9KA 3AH7A 3AN1A 2YEPB 1WRIA 4RGMA 1M4VA 2PLPA 3Q8CA 3P4PB 1L4DB 2PIAA 2PVGC 3U7ZA 1YQ4B 4XE0A 3RFZB 2N9LA 1KFYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LTU A;  2DBY A;  1ROE A;  4KX6 B;  1QLB B;  4N58 A;  1DOX A;  1L0V B;  2B76 B;  1PUT A;  1WYG A;  3RPF C;  1PDX A;  1JAL A;  2K5P A;  3W5U B;  2KAJ A;  4FXC A;  1L5P A;  4WWM A;  1FO4 A;  1VLB A;  2L52 A;  1TYG B;  2L83 A;  1OFF A;  3AE8 B;  3AMZ A;  3P4R B;  4ZOH C;  3B2G A;  2W54 A;  2PVO D;  1XLP A;  3SR6 A;  3VR8 B;  4ZHP A;  2E3T A;  5H92 C;  2BS3 B;  1J7B A;  4C7Y A;  1TJE A;  3SFD B;  4A9A A;  5C3J B;  1FIQ A;  4YSY B;  3NS1 A;  3P63 A;  1FMA D;  2Q5W D;  2WS3 B;  1E0Z A;  2K22 A;  4ZHO A;  2EKI A;  1E9M A;  3FAH A;  4YTP B;  2QJL A;  3NVZ A;  2BS4 B;  3W9C B;  1WGK A;  3CIR B;  3DWG C;  2CU3 A;  1FXA A;  3AM9 A;  2CJN A;  1QOB A;  4US8 A;  1N61 A;  2QIE B;  1RFK A;  2JX5 A;  2W55 A;  1NVI D;  2W3R A;  3P1M A;  4HRO A;  2FBW B;  3B9J A;  3AEE B;  4N6E B;  2WP9 B;  3AV8 A;  1JQ4 A;  4IDI A;  1SF0 A;  1L6U A;  5C2T B;  1YJI A;  2WU2 B;  3AEG B;  1WWT A;  1NYR A;  1L6V A;  1RWS A;  3ABV B;  3AEA B;  4C7Z A;  3VR9 B;  1NEK B;  3FC4 A;  5EE1 A;  3B2F A;  3HUI A;  3KWL A;  1QOG A;  4JWS C;  1NYQ A;  3AE2 B;  2LEK A;  5EE9 A;  5AUI A;  2H88 B;  5H8Y E;  1KRH A;  1OQQ A;  1FRR A;  1N60 A;  1ZP0 B;  1ZXI A;  3AEB B;  3AEC B;  1N62 A;  3HRD D;  3AE7 B;  1CZP A;  1DOI A;  3DWM A;  1A70 A;  1SB3 C;  2HTM E;  2Y5C A;  1IUE A;  1TKE A;  1YJJ A;  4JWU C;  1XLQ A;  3ZYY X;  3BII D;  1NEN B;  3L4P A;  1JRP A;  3WCQ A;  1E10 A;  2KMM A;  3AEF B;  4YT0 B;  5AUK A;  3P4S B;  1VJK A;  1ZUD 2;  1N63 A;  2CJO A;  1E7P B;  2M56 B;  2DWQ A;  1UWM A;  1J7A A;  3AB5 A;  1SIJ A;  1XLO A;  1N5X A;  3NVV A;  3HVZ A;  1I7H A;  2WU5 B;  4WQM A;  1XLN A;  3SFE B;  1XO3 A;  3CWI A;  1FFV A;  4N59 A;  1OQR A;  1JWA D;  1QOF A;  2W3S A;  3ETR A;  5MPO A;  2BS2 B;  3PO0 A;  2AX5 A;  1FXI A;  3NVY A;  5G5G A;  1FFU A;  2M19 A;  1RM6 C;  1V97 A;  3AED B;  4YTN B;  4HRS A;  1GAQ B;  3LB8 C;  3P4Q B;  1AYF A;  1RYJ A;  3VRB B;  1QOA A;  1V8C A;  1WXQ A;  2WQY B;  4USA A;  1QF6 A;  2WLB A;  3W5V B;  4ITK A;  3AE1 B;  3AE5 B;  3NVW A;  1JRO A;  2JQR B;  3VRA B;  4YSZ B;  1YQ3 B;  1ZOY B;  1AWD A;  2MH7 A;  3AE6 B;  1NI3 A;  2H89 B;  1TKG A;  5G5H A;  1QT9 A;  2OHF A;  2MJE A;  4C80 A;  2WDQ B;  2WDR B;  1T3Q A;  1DOY A;  2BT6 A;  2WDV B;  3EUB 2;  3AE9 B;  1F0Z A;  2K9X A;  1PFD A;  2N0S B;  4YXD B;  2MJD A;  1TKY A;  3LXF A;  3NRZ A;  3AE4 B;  4YSX B;  1B9R A;  1KF6 B;  4P6V F;  1E6E B;  1VDV A;  1JW9 D;  4YTM B;  1DGJ A;  1N5W A;  3AH7 A;  3AN1 A;  1CJE A;  1WRI A;  2MJ3 A;  3P4P B;  2PKO A;  2PIA A;  1J7C A;  5GXG B;  1FM0 D;  2G1E A;  5EE3 A;  1JWB D;  2PVG C;  4JX1 C;  3AE3 B;  1YQ4 B;  2ACZ B;  4US9 A;  5EE0 A;  1FRD A;  1R7S A;  1EWY C;  1GPX A;  1KFY B; 
#chains in the Genus database with same CATH topology
 3WIM A;  1TIF A;  1L0V B;  3MC0 B;  1XF5 L;  3DBR B;  4GDK B;  3K9O B;  3P4R B;  5DPR A;  1PYW D;  2KDI A;  3NUH B;  3ML8 A;  4WUR A;  1B1Z A;  1WX8 A;  2IO2 B;  2IO3 B;  2R61 A;  3V60 A;  3HVD A;  3M95 A;  2KMA A;  3W1S A;  5DCN A;  3JVZ X;  3QAR A;  4BKS A;  2MRP A;  3FC4 A;  4D2K A;  2KDF B;  2J53 A;  1OQY A;  5G55 A;  3R7R A;  2ONQ A;  1YJJ A;  1XLQ A;  2V0G A;  1NI2 A;  2WX0 A;  3SD5 A;  5BMI A;  4BKG A;  4NAW B;  3BIN A;  2NVU I;  4M02 A;  4RF1 A;  3ZVV A;  2G4S A;  5MPO A;  4AJY B;  1BXT A;  3D32 A;  2VZK B;  3Q14 C;  2WXN A;  3X0W A;  4XDD A;  4IUM B;  3AE5 B;  2ON8 A;  3O13 A;  4WJO A;  2NCN A;  2IBI B;  1WMH B;  3OLM D;  4KGS A;  3L16 A;  5C1Z A;  2LJ5 A;  2MJD A;  2AYO B;  4WH4 A;  1E6E B;  3ECI A;  4OVV A;  2K0P A;  5JHA A;  1RRB A;  3BZD B;  1R4N I;  1Y56 A;  4K7W A;  3SDL C;  5J17 A;  4RCO A;  2K3U A;  2ZPY A;  1EWY C;  4PYU A;  2C5L C;  1SJE D;  2GI9 A;  5IAA C;  1TYG B;  2L83 A;  2RMM A;  2W54 A;  2L7R A;  1I35 A;  1C9F A;  4B9K A;  2Y5P A;  2MSE D;  2WS3 B;  1D5X C;  2MCN B;  2BQQ A;  3FAH A;  2NS5 A;  3NVZ A;  4K1R B;  3WA0 A;  1V9J A;  1V2Y A;  2IDY A;  4N6E B;  2KFJ A;  2V9H A;  3MHS D;  1RWS A;  4C7Z A;  3UIO B;  5EE1 A;  4M0W B;  4NQK E;  1ACC A;  3AE7 B;  3UQA A;  1GNU A;  1IGC A;  1IBX A;  3CSF A;  3ZNG C;  3AEF B;  4JE3 B;  1ZUD 2;  1MHX A;  4DQO C;  5CHV C;  1XLO A;  3E9S A;  3HVZ A;  4II2 B;  2J0M A;  1WSP A;  1ZE3 D;  1Q0W B;  2WXI A;  1FXI A;  3NVY A;  3APD A;  1C1Y B;  1EU3 A;  2X38 A;  3P4Q B;  1RYJ A;  4MJS B;  3Q6B A;  1QOA A;  2QMT A;  1WJN A;  3AXC A;  2IGG A;  2KN4 A;  2M17 A;  2MH7 A;  1LM8 B;  2PMV A;  1ZDV A;  3EGR A;  4RM8 A;  4ZRK A;  2KO3 A;  2LI5 A;  1L4Z B;  3PRP B;  3V05 A;  3VFK A;  1P9D U;  4MDK E;  1D5Z C;  1KF6 B;  2WXQ A;  4XYC A;  1DGJ A;  1F2R I;  1EUV B;  4EZL A;  1C4C A;  2MJ3 A;  3Q3N C;  4KSL C;  5BMG A;  1L0Y B;  3OJ4 B;  4BFR A;  2LUE A;  3GE8 C;  3H1U A;  2BWF A;  2L8J A;  1VZ8 A;  4DDG D;  5D6J B;  1QLB B;  2XN9 C;  4AQ7 A;  4GDK A;  1UUP A;  2XBB C;  1OFF A;  3SR6 A;  2LVO A;  2OOB B;  4MH0 E;  1WXA A;  2M8S A;  1WJ4 A;  1OEY A;  3P63 A;  4NJC A;  1ET9 A;  1C77 A;  4A55 A;  3OG5 A;  3W9C B;  1TS4 A;  1WGK A;  2Z0D B;  1YIW A;  2W55 A;  2A5U A;  4HRO A;  3R2I A;  3AV8 A;  2D3B A;  4WWN A;  2FCQ A;  2MEK A;  3R2T A;  4W9E A;  5E6J A;  2RGF A;  1P0R A;  1NYQ A;  2LRW A;  3AE2 B;  4L2Y A;  4NQL B;  5EE9 A;  1JWS D;  3H9D A;  3RUI B;  3AEB B;  1OQQ A;  1ZXI A;  1N60 A;  1ZP0 B;  2FID A;  3IXS A;  3Q8E A;  4MGI E;  5CHF A;  3VTV A;  3V61 A;  3QHT A;  2I1J A;  3TSS A;  5HFY A;  2JSV X;  4NAW A;  1DYQ A;  2C7M B;  1VJK A;  5IOI A;  3KYD D;  3RUL A;  4MGZ E;  3TEY A;  3SFE B;  3PZ8 A;  2GBR A;  1GC7 A;  3TUO A;  1FNV A;  3P42 A;  2KJH B;  2Z8L A;  3A1Q A;  2PPH A;  5HKH A;  3EA6 A;  3LB8 C;  2RDB C;  3C8Y A;  1SXT A;  2LFI A;  4HJK A;  4MT5 A;  1XXG A;  1WMH A;  1WGD A;  4MAC A;  4P1C C;  3N1X C;  1I4P A;  3AU4 A;  5D94 A;  2NPT B;  1CJE A;  5JHB A;  1J7C A;  3L54 A;  4LNK A;  5EE3 A;  4MEL A;  3PSE B;  2NTT A;  4KX6 B;  3W5U B;  3DBH I;  1D5M C;  1WM3 A;  2WXO A;  1KH0 A;  2RPQ A;  5IN7 A;  1SE2 A;  4JQW C;  1E9M A;  2AL6 A;  4ZYS A;  2QJL A;  2BS4 B;  4BZA A;  1SIF A;  3AM9 A;  2WYQ A;  2WXK A;  3P1M A;  2FBW B;  4K3B A;  1C4P A;  3QC8 B;  5FK9 C;  2V4I B;  5C2T B;  1NYR A;  4K7S A;  5LLI A;  3BYY B;  3HUI A;  3UI3 A;  1KJT A;  2SEB D;  5LXH A;  4M0W A;  4XX5 A;  3KYC D;  2CU1 A;  2IY0 B;  1QQR A;  4AP4 C;  1IUE A;  3DBR I;  4A3O A;  1UWM A;  2KVR A;  3NHE B;  2GBJ A;  1T0Q C;  3CF6 E;  2G3Q B;  2QCZ A;  1CK1 A;  4GIV A;  2QHO A;  4MJS A;  3PHX B;  2WGS A;  3I9V 1;  2M0A A;  4AWJ A;  3IFW B;  1AWD A;  4FA6 A;  1X1M A;  2H89 B;  1TKG A;  2L0F A;  3T8M A;  4C80 A;  3B08 A;  1DOY A;  4L1B A;  2K9X A;  5CTR C;  4M00 A;  1QKZ A;  3ENE A;  4RF0 A;  2MHJ A;  3KWV A;  1KLV A;  2BB6 A;  1WRI A;  4RGM A;  4IWQ A;  1L4D B;  4LJP B;  2EMS A;  2D3G A;  2PVG C;  4XE0 A;  2YVC A;  1DOX A;  4HCN B;  1WYG A;  5HI1 A;  5L83 A;  1MI0 A;  1SEB D;  1F52 A;  2K5P A;  2MBE A;  1VLB A;  2BGF A;  3I5J C;  4NJ7 A;  3SFD B;  4C4V B;  1FIQ A;  4YSY B;  4B0E A;  1FMA D;  2Q5W D;  2K22 A;  5E6O A;  2LWP A;  2HD5 B;  3DOW A;  2C7H A;  3ZTD A;  3P2B A;  3APF A;  1N61 A;  4IKG A;  1WH3 A;  4HKZ E;  5BYR A;  4FBJ B;  2WP9 B;  3Q3M C;  5D7G A;  2N9E B;  3RI7 C;  2INC C;  4LK0 M;  1E8W A;  2K6Q A;  2JWU A;  2Y5B B;  2LZ6 A;  2LHD A;  1V6E A;  3Q2A C;  4LNI A;  3ZO5 B;  2HTM E;  1H8C A;  1I4H A;  3IAS 1;  1NEN B;  1XD3 B;  1Z2M A;  2J42 A;  2LUM A;  3W1Y A;  4NPN A;  1UNS A;  4ZDV A;  4HKQ A;  2CJO A;  2TSS A;  4HPM B;  1GB1 A;  1J7A A;  1IPG A;  1SIJ A;  4TUU A;  4WQM A;  4ANX A;  4XC2 A;  2W3S A;  1LQB A;  4N9F 4;  2RR9 A;  3HK0 A;  4MEM A;  5TSS A;  2D2Q A;  3BK1 A;  4Q2J A;  1YQB A;  4W9K A;  3URY A;  3AE1 B;  2MBO A;  2DYM A;  1ZOY B;  2KDB A;  2RPV A;  5G5H A;  5G2N A;  2OHF A;  2BKF A;  2W82 A;  3FIL B;  3RD2 A;  2DZI A;  1PFD A;  3N32 A;  1R4M I;  3AE4 B;  2NPT A;  1ET6 A;  4YTM B;  3NZU A;  5J18 A;  1ZGU B;  2MBB B;  4AOF A;  1JWB D;  4MSM B;  1R7S A;  1C78 A;  3U52 E;  1IP9 A;  3CMM B;  2GRI A;  1HQR D;  1D3Z A;  3HIZ A;  1WF9 A;  2FUG 1;  3H8H A;  1JRU A;  3IT4 B;  3NS1 A;  3MFG A;  1V80 A;  1J8C A;  3TJP A;  1FXT B;  1UBQ A;  1FXA A;  1UF0 A;  4EE2 A;  3UF8 A;  1V1P B;  1JQ4 A;  2V4L A;  2ASQ A;  3MP9 A;  4RNA A;  1WZ3 A;  1GC6 A;  1RFA A;  1F1H A;  2QSD A;  2WXL A;  1BUI C;  1ISN A;  1E8Z A;  1LXD A;  4I6N B;  5AUI A;  3IG3 A;  1TTN A;  4B6W A;  2ZNV B;  4JIO U;  5D3D A;  3UIN B;  3U7D A;  4DWF A;  1A5R A;  3DBS A;  4MGK E;  1ZPS A;  3ZIM A;  4W9D A;  4G3X B;  4JLC A;  2ZW1 A;  5DPT A;  3GE3 C;  3H6N A;  2N7E A;  4PT5 A;  2I38 A;  1OQR A;  2R2Q A;  3N1Z C;  1C76 A;  1XCQ L;  1ZDX A;  2AQ2 B;  3PRM B;  5BYS A;  4KKI A;  4FJV B;  1VR9 A;  3JW0 X;  4GU2 A;  3GZN B;  2DZJ A;  1K50 A;  3JSV B;  3QIJ A;  3DVN U;  5T8I A;  1WX7 A;  1GUA B;  3C0R B;  4GN1 A;  1KTK A;  1PGA A;  1I42 A;  3IVF A;  1EF1 A;  4IW0 A;  3J9C A;  4GOC A;  1WRD B;  1D6E C;  2M4N A;  2KMC A;  1TY2 A;  3R8B A;  3A1Q B;  3SEB A;  5GXG B;  1FM0 D;  4LDT D;  4JX1 C;  4BVU C;  2ACZ B;  2YEP F;  5LNK 1;  5EE0 A;  4EEW A;  4A6Q A;  1PGB A;  1WYW B;  1MJD A;  3NOB A;  4LTU A;  1YD8 U;  1PDX A;  2KAJ A;  1V1O A;  1WXS A;  1FO4 A;  4KIK B;  3B2G A;  3H7P A;  1LGR A;  4C4V A;  4BOS C;  4IM3 A;  2L3Z A;  3R3M A;  2AQ3 B;  4IOI E;  4KV2 A;  5AEK B;  2IJ0 A;  4FJY A;  3MHZ A;  3U2S C;  3RN9 C;  3PV1 A;  3DWG C;  3PVL A;  4L23 A;  2HTH A;  1WR6 E;  1TZO A;  3VH3 B;  3DHG C;  4REZ A;  4DXG A;  1YJI A;  3UIP B;  3VR9 B;  1E8X A;  3PHW B;  3PS6 A;  2K8C A;  2LEK A;  2LVP A;  3ZQ4 A;  3ZXR A;  4W9H A;  1QZE A;  3WAM A;  2KQS A;  2KLG A;  2V3P A;  1UD7 A;  3RNA C;  1E90 A;  1XT9 B;  3BII D;  2KMM A;  4WIP A;  5L95 C;  2ZNV C;  2NBW B;  1J0G A;  3ZDM C;  3KUC B;  3V3X A;  3ETR A;  4OVU A;  3N30 A;  4C56 C;  3VHT C;  5IP4 D;  1T6B X;  2K39 A;  1RM6 C;  1UH6 A;  2MP2 A;  2DLB A;  1GAQ B;  2N7D A;  4LLG M;  3VRB B;  1CMX B;  1V8C A;  1TBE A;  2KTR B;  3W5V B;  3ZJT A;  5CX3 A;  3FIL A;  5IO9 A;  4FAD A;  1T3Q A;  4TSS A;  1OTR B;  2V3N A;  4FLH A;  2XK5 A;  1HZ6 A;  4W9I A;  2PW9 A;  1N5W A;  3HHM A;  3Q3F A;  4KGR A;  1ZXH A;  2DEN B;  2VH2 A;  4NZL B;  2L76 A;  3WAO A;  2DBY A;  2KVZ A;  5FKA C;  4WWO A;  4FXC A;  2L52 A;  3AE8 B;  2RDG A;  1XLP A;  2L0T A;  3PTF C;  4FJZ A;  4C7Y A;  2KC1 A;  2YLM A;  4AS1 A;  1C3T A;  2L00 B;  1Q1O A;  2WXR A;  3VVW B;  2K25 A;  2CU3 A;  1WGR A;  1K53 A;  2BYF A;  1V1P A;  4E71 A;  1SE9 A;  1WJ6 A;  3BVG A;  1EWC A;  1L6U A;  2MX2 A;  1XQQ A;  2LHE A;  1NBF C;  5KHQ A;  4IG7 B;  2KN5 A;  5H8Y E;  3HRD D;  2PE6 B;  5AZH A;  2Y5C A;  3APC A;  2BPS A;  3I63 C;  2NBU A;  2CKH B;  5D2M B;  3RCZ A;  1I4R A;  2FE8 A;  2MQJ A;  3NG0 A;  1JWU D;  3A4S C;  2L1A A;  2KFK B;  2WU5 B;  1XLN A;  4BKT A;  3CWI A;  4HDO A;  1QOF A;  3HM6 X;  3Q8F A;  4HPP A;  1S1Q B;  1C4A A;  3JSV A;  1IGD A;  1WXQ A;  2LJI A;  1QF6 A;  1L0X B;  1YQ3 B;  4O1N A;  1FD6 A;  4CO7 A;  2BW2 A;  4DXA B;  1WXM A;  1CQV A;  3LJ3 A;  1UBI A;  2WDR B;  1FPY A;  4UDU C;  2IGD A;  1F9J A;  3DDC B;  5JZE B;  4DDI D;  3ZLZ A;  2JXT A;  2N1W A;  4IM2 A;  4HLE A;  2HJ1 A;  2KWV B;  1WIA A;  2YEP B;  1MG8 A;  2KX3 A;  2PLP A;  2DAF A;  3QWZ B;  2KNB A;  3WAP A;  2D10 A;  4OW0 A;  2HDE A;  4ZRP A;  3RPF C;  3ZUN A;  4KGT A;  2DAJ A;  4KIK A;  2IYD B;  3N9Y C;  2BWE S;  2K1F A;  4ZRJ A;  2FCS A;  3N1Y C;  2MWS B;  3GP7 A;  4PS3 A;  4BBN F;  4ANU A;  2XEW A;  2PTL A;  4NNJ B;  2WXF A;  2CHZ A;  4PS8 A;  2EKE C;  3QQ8 B;  2DYB A;  3DVG X;  2WXP A;  1TGZ B;  1PGX A;  5IA7 A;  2AWT A;  3PZD A;  1QOG A;  2JVC A;  3WAL A;  3Q3J A;  2FUH B;  3BYT B;  3EC8 A;  3PLU A;  4WAF A;  4JWU C;  1LFD A;  3H7S A;  5AUK A;  3SU8 X;  2GBN A;  3U8Z A;  1E7U A;  3AB5 A;  2LMC A;  3KUD B;  4RMA A;  1FFV A;  2O2V B;  5LXI B;  1AW7 A;  1KLG D;  2WNM A;  1I4Q A;  2UU7 A;  4AUQ C;  3AED B;  4KDI C;  3DCG A;  3BVM A;  3TCA A;  2WDT B;  2BKR B;  2ICI A;  2BYE A;  2KTR A;  3TEW A;  2EEL A;  3RNB C;  4USA A;  2WLB A;  1JRO A;  4YSZ B;  2AL3 A;  1SE4 A;  3QX1 A;  3AE6 B;  1NI3 A;  1V5T A;  1I4X A;  1YJ1 A;  2Z59 B;  3PT2 B;  4YXD B;  1K52 A;  3VTW A;  2JT4 B;  1ZW7 A;  4G0N B;  4P6V F;  1JW9 D;  1T0Y A;  2CHX A;  1YN3 A;  2INN E;  3B1L X;  4FHJ A;  1OGW A;  3TIX A;  2NTS A;  4LJO B;  2WQY B;  2WX1 A;  2K8H A;  3L08 A;  2ZZP B;  2LGX A;  3AMZ A;  5EDS A;  3RNC C;  2UWQ A;  1SJH D;  1V49 A;  3C19 A;  4TQ0 A;  2IO1 B;  1T0R C;  4US8 A;  1JML A;  4YWG G;  3O65 B;  4WJN A;  3RNE C;  3RNF C;  1L7Y A;  3QJZ A;  1FCC C;  3PRZ A;  2MLB A;  1WWT A;  4KVG B;  2WWZ A;  3H7P B;  1RAX A;  4P1B C;  2LD9 A;  2KWD A;  3MC8 A;  4W9F A;  2D11 A;  2KLC A;  4HCP B;  4ANV A;  4GSW A;  1SB3 C;  5D3I B;  5FR3 A;  3VUW A;  1V5O A;  1GJZ A;  3GB1 A;  3P4S B;  2RSU A;  2KFK A;  1I4G A;  3ZXV A;  3ZGZ A;  1VZ6 A;  1WGG A;  4NAM A;  2QEJ C;  1XO3 A;  2LVQ A;  3I3T B;  3JYU A;  2LAS A;  3KQ4 A;  4IWO A;  2OJR A;  2LGD A;  1FFU A;  4ASW C;  4IC7 B;  2OED A;  1HEZ E;  2KYW A;  4WJP A;  5DPS A;  2GBK A;  2CHW A;  1SE3 A;  3RMK C;  1H4R A;  3T3O A;  4K7U A;  1T5X D;  2NMQ A;  3HM3 A;  3ZW3 A;  1NDD A;  2MBQ A;  1OEY J;  2WDV B;  4WWP A;  2KOX A;  4URK A;  3AUL A;  1VCB A;  4KZ0 A;  4G50 A;  1EM7 A;  2FIF A;  1VD2 A;  5E6N A;  1GG3 A;  4AJW A;  3UGB B;  4HPL B;  1SSN A;  3KUZ A;  2MP2 B;  4LDT B;  2DX5 B;  3U30 A;  4DXF A;  3VQI A;  3TEX A;  1ROE A;  1T0S C;  5HHD G;  1E7V A;  1HTQ A;  2FAZ A;  2EKI A;  4DHJ D;  3BK2 A;  2XK5 B;  4HWI B;  3OJ3 A;  1AN8 A;  2I2Y A;  3KH0 A;  2N7J A;  2CJN A;  2GB1 A;  2ZCC A;  3K9P B;  2W3R A;  4HJG E;  1UEL A;  2XNA C;  1YX6 B;  4TQ1 A;  2AQ1 B;  3A4R A;  5CHW A;  1C79 A;  2N1V A;  3BY4 B;  5E6P A;  4DBG A;  1K8R B;  1YNT E;  1AAR A;  2VH1 A;  1SGH A;  1YN4 A;  3ZYY X;  1JRP A;  3IT6 B;  1E10 A;  2NR2 A;  1JWM D;  1D4B A;  1N5X A;  2O2V A;  4CHK A;  1RLF A;  2AEH A;  1MHH E;  3EEC A;  2Z0E B;  2M19 A;  4HRS A;  3NZS A;  2HJ8 A;  2ZVN A;  3ZNZ B;  3RNG C;  2KX0 A;  4GXB A;  2JF5 A;  3L13 A;  4ITK A;  1J19 A;  2SAK A;  4MGY E;  2I1K A;  4RH6 A;  4NJ6 A;  4FUL A;  5AZF A;  1TKY A;  3AI5 A;  1B9R A;  3DBL B;  3VTU A;  2KZR A;  2ZVO A;  3M3J A;  3ALB A;  4MSQ B;  4A90 A;  2PKO A;  2IPK D;  3FKY A;  1STE A;  2MJE A;  4JGH B;  4LCD E;  3NS8 A;  4S17 A;  2INP E;  2A4Z A;  3N3K B;  2ZEQ A;  1K51 A;  4WQO B;  4E3C A;  2J7Q B;  3TMP B;  2LRU A;  1WM2 A;  1Q5W B;  4P7I A;  1EO6 A;  5JH5 C;  3GS2 A;  4BAX A;  1GOZ A;  4I6P A;  1Q10 A;  3WAN A;  1ENF A;  2IGH A;  2PE9 A;  3CIR B;  5IKC M;  4BBN C;  1RFK A;  1WR1 A;  2D3A A;  3PPA A;  4KZC A;  2IND C;  2JU6 X;  2WXG A;  4HEA 1;  1L6V A;  2K6D B;  2NBV B;  2LXC A;  3QA8 A;  4H2A A;  3NZ3 A;  2ZW0 A;  2N9P C;  4RGO S;  2L32 A;  4PYZ A;  3MJ5 A;  4MH8 A;  2M56 B;  3ML9 A;  2O6V D;  3KLS X;  2KWU B;  4ZYN A;  1WE7 A;  4J6I A;  4QAY A;  2HE7 A;  4M8M A;  2LGI A;  4XZ4 A;  4KSK C;  2JRH A;  1Z5S B;  4M8N A;  3M62 B;  2G9H D;  3ZJV A;  3PLV A;  2N9X A;  4YL8 A;  2C60 A;  1TZ1 A;  3TL5 A;  3EFC A;  1EF5 A;  4OHJ A;  4RM9 A;  3Q8B A;  2LGY A;  1YN5 A;  2CR5 A;  4TKN A;  2BT6 A;  3L17 A;  4PS7 A;  3LXF A;  3NRZ A;  4RGN A;  1JCK B;  2JPH A;  4GMV A;  2LXA A;  2N9K A;  2D07 B;  4I6L B;  4M01 A;  3CST A;  4DK5 A;  3Q8C A;  4A20 A;  4EUT A;  1KOT A;  3U7Z A;  3SHQ A;  4BOZ B;  2N9L A;  4TMA B;  3Q3O C;  2B76 B;  3A33 B;  4HK2 A;  4WWM A;  2DZM A;  1HA5 A;  2QDF A;  2PVO D;  2E3T A;  5H92 C;  4NY0 A;  1TY0 A;  5C3J B;  2DYO A;  2JZP A;  1ZKH A;  4TV3 A;  1R4M B;  1WZ0 A;  4P16 A;  2KXJ A;  2JX5 A;  2KJ6 A;  3DHH C;  2O6V A;  3AEE B;  3ONS A;  2UYZ B;  3VH4 B;  3PZ7 A;  2KK8 A;  2WU2 B;  2X8X X;  3ABV B;  1KM7 A;  4JPS A;  2JUO A;  4F8C B;  5BYQ A;  3ZRC A;  3L0W B;  4XWT A;  2PEA A;  3BVZ A;  2H88 B;  1BML C;  1U4A A;  1WX9 A;  3WCQ A;  1N62 A;  1DOI A;  3DWM A;  2IY1 B;  4F7Z A;  3PRE A;  1TKE A;  3VUX A;  2REX A;  4II3 B;  1V86 A;  1KLU D;  3DPD A;  2BYV E;  1I7H A;  2JYT A;  3IBE A;  1VRA B;  1XEE A;  2L05 A;  5AZG A;  2KHW B;  1JWA D;  1S3S G;  2BS2 B;  4A3P A;  2AX5 A;  4KKJ A;  2CS4 A;  1PQS A;  2VZK D;  4LNF A;  4GLS C;  5HG2 A;  3PGE A;  2KDE B;  2KQ7 A;  2JQR B;  5J2R A;  4XWW A;  2KD0 A;  4FN2 A;  2IZV B;  2ZPN A;  3B0A A;  2D3C A;  4PK1 A;  3AE9 B;  3ZNH B;  1MPE A;  3M63 B;  4OZC A;  1G6J A;  3A9J B;  4XGA B;  2LGS A;  2EMT A;  2WHI A;  3AE3 B;  3DHI C;  4DHZ E;  1FRD A;  4YSX B;  1TT5 B;  2KJR A;  3R7Q A;  1WGH A;  4ZHP A;  3VR8 B;  3ZTC A;  1J7B A;  1TJE A;  4A9A A;  2JYE A;  1V81 A;  2V3S A;  1E0Z A;  4W9L A;  4A8X C;  4YTP B;  1UGJ A;  3ZKJ C;  1L2N A;  4J3O D;  2FNJ B;  1ESF A;  2QIE B;  1HE8 A;  2MA9 B;  1HZ5 A;  4IM0 A;  3IAM 1;  4CYE A;  4ARI A;  2QC8 A;  3W2D A;  2K8B A;  1SBB B;  3AEA B;  1EU4 A;  2VRR B;  1TS3 A;  3EHV A;  2DHZ A;  4EKU A;  1KRH A;  1WFY A;  2J4X A;  3OWE B;  2KWC A;  4YT0 B;  2J52 A;  1R4N B;  2J0J A;  2JXX A;  1N63 A;  2JY6 A;  3ZJU A;  1Y8R C;  4ICV A;  3NVV A;  3T9L A;  5DPW A;  2KKC A;  2GMI C;  5BMH A;  4RGT A;  1FEH A;  1M94 A;  4LNO A;  4EZJ A;  1FCL A;  2V1Y A;  4MM3 B;  4ICU A;  2GBM A;  3VRA B;  2MBH A;  4B95 A;  1FNW A;  2JRI B;  2KAN A;  1QT9 A;  5I4D A;  3A9K B;  3EUB 2;  1F0Z A;  3MC9 A;  1GB4 A;  4EZK A;  1YMH E;  2J0K A;  4OVZ A;  2BF8 B;  4GDL B;  3LDZ E;  3UQB A;  2M1M A;  4B0M A;  3KWL A;  1VDV A;  3RT3 B;  5BO4 B;  1PUT A;  1JAL A;  3KW5 B;  3IHP C;  1L5P A;  2M0X A;  4ZOH C;  2KAC A;  3TEZ A;  4HXD A;  2BS3 B;  2IO0 B;  1UZX B;  3VDZ A;  3ZRF A;  3DVN V;  4ZHO A;  4DHJ B;  1E8Y A;  5GMV A;  4W9G A;  2OJW A;  1YX5 B;  1QOB A;  4W9J A;  3Q8A A;  1NVI D;  4WAA A;  3B9J A;  4ANW A;  3DBL I;  3AEG B;  4X57 B;  2BBC A;  3B2F A;  3DQV A;  4JWS C;  2DZK A;  3GZN I;  2KT7 A;  2W9N A;  4ZRQ A;  2JZ3 B;  5TR5 A;  2D5G A;  3AU5 A;  3GOE A;  3VUY A;  2JWZ A;  2KTF A;  2KDM A;  5FR6 A;  2FCN A;  2DWQ A;  2WXM A;  1P98 A;  4N59 A;  1P1A A;  3S2A A;  4OZA A;  3QCA A;  5JXV A;  1V97 A;  1P7E A;  4YTN B;  2E6X A;  3MJW A;  3I57 A;  4GGQ A;  4S0R A;  4CQN A;  1MVK A;  2Y3A A;  2B3A A;  1MG4 A;  1HTO A;  2N0S B;  3R66 C;  3V62 A;  2QIL A;  4FHK A;  1WI0 A;  1UGM A;  4C00 A;  2BYT A;  1WY8 A;  1P3Q U;  3A9J A;  2MW5 A;  2G4D B;  1WE6 A;  2G1E A;  3VAW A;  1TS5 A;  2FCM A;  2N4F A;  3KVF B;  3TBL D;  4US9 A;  2WXH A;  3BWU D;  1GPX A;  4N58 A;  3VXW A;  1WGY A;  3QK0 A;  3OAW A;  3Q69 A;  4WJQ A;  1FNU A;  4XDC A;  2ZJD A;  4K81 A;  4RFB A;  2G45 B;  4E74 A;  3NJT A;  2BTE A;  4ACF A;  2WXJ A;  3NY5 A;  4LNN A;  4EFO A;  2C7N B;  4IDI A;  1SF0 A;  2JZZ A;  5C23 A;  2DNF A;  1BT0 A;  1NEK B;  2GLS A;  1TS2 A;  3V6C B;  4DHZ B;  4KDL B;  3V6E B;  3N20 C;  2C9W B;  3W1S C;  3T3N A;  1FRR A;  3AEC B;  1CZP A;  4F1S A;  1A70 A;  1IYF A;  3LYY A;  1E5W A;  4JL9 A;  3L4P A;  1IBX B;  5KHO A;  4HDQ A;  4ARC A;  4IWP A;  1LO5 D;  1E7P B;  1QIL A;  2O6V B;  4GB9 A;  1F2R C;  1F77 A;  3E56 A;  3EFU A;  1N6Z A;  3DBH B;  3PO0 A;  1MFW A;  4K3C A;  5G5G A;  4BKS D;  4R3D A;  4MM3 A;  3ZNI D;  1WXV A;  1AYF A;  3RZF A;  3QAQ A;  1VZ7 A;  1XCT L;  2RD0 A;  1UWX A;  3NVW A;  1P7F A;  2BVC A;  3L10 B;  3A9K A;  1HXY D;  2RDH A;  3U4E G;  2WDQ B;  2KQ4 X;  4W9C A;  2KC2 A;  4HVB A;  3ZDT A;  3RYT A;  3DVG Y;  2GOW A;  4OZB A;  2BB5 A;  4GDL A;  3MTN B;  3AH7 A;  3AN1 A;  1YOV B;  4EOY A;  1M4V A;  3P4P B;  3X23 A;  1WJU A;  2PIA A;  4G11 A;  2ZCB A;  2PJH A;  1YQ4 B;  3RFZ B;  2R2O A;  4ZRI A;  3RZW C;  1KFY B; 
#chains in the Genus database with same CATH homology
 2HDE A;  1DOX A;  4ZRP A;  1L0V B;  2B76 B;  1WYG A;  5HI1 A;  1MI0 A;  1SEB D;  3RPF C;  2K5P A;  4KGT A;  4WWM A;  3MC0 B;  1XF5 L;  1VLB A;  4GDK B;  3P4R B;  1HA5 A;  2PVO D;  3N9Y C;  2E3T A;  5H92 C;  1TY0 A;  3SFD B;  5C3J B;  1FIQ A;  4YSY B;  4B0E A;  1PYW D;  2DYO A;  1FMA D;  2Q5W D;  2JZP A;  3NUH B;  2K22 A;  3GP7 A;  4WUR A;  1B1Z A;  4P16 A;  2PTL A;  4IKG A;  1N61 A;  2R61 A;  2WXF A;  2JX5 A;  4HKZ E;  3HVD A;  5BYR A;  3AEE B;  2WP9 B;  3W1S A;  3PZ7 A;  2WU2 B;  2WXP A;  5D7G A;  3ABV B;  4JPS A;  1PGX A;  3FC4 A;  4LK0 M;  4D2K A;  5BYQ A;  1QOG A;  2JWU A;  2J53 A;  4XWT A;  3BVZ A;  2H88 B;  1BML C;  3WCQ A;  2LHD A;  3BYT B;  1N62 A;  1DOI A;  3DWM A;  2ONQ A;  2HTM E;  4WAF A;  1TKE A;  1YJJ A;  4JWU C;  1I4H A;  1XLQ A;  2V0G A;  3IAS 1;  1NEN B;  2J42 A;  2LUM A;  5AUK A;  5BMI A;  1UNS A;  4NAW B;  1KLU D;  2CJO A;  2TSS A;  4HKQ A;  1GB1 A;  1J7A A;  3AB5 A;  1SIJ A;  2LMC A;  4WQM A;  1I7H A;  2JYT A;  1VRA B;  1FFV A;  1XEE A;  4RF1 A;  1JWA D;  2W3S A;  5MPO A;  2BS2 B;  1AW7 A;  1KLG D;  2WNM A;  1I4Q A;  2AX5 A;  4KKJ A;  1BXT A;  3AED B;  2VZK B;  2VZK D;  3BVM A;  5TSS A;  2WXN A;  2ICI A;  3BK1 A;  4Q2J A;  3TEW A;  4XDD A;  4GLS C;  2EEL A;  5HG2 A;  4USA A;  3URY A;  2WLB A;  3AE1 B;  3AE5 B;  1JRO A;  2JQR B;  2DYM A;  4YSZ B;  1ZOY B;  1SE4 A;  4XWW A;  3AE6 B;  1NI3 A;  2ON8 A;  2RPV A;  5G5H A;  3O13 A;  2OHF A;  2W82 A;  3FIL B;  1I4X A;  3AE9 B;  4KGS A;  1MPE A;  1PFD A;  4YXD B;  1K52 A;  2MJD A;  3AE4 B;  4WH4 A;  4P6V F;  1E6E B;  4OZC A;  1ET6 A;  1JW9 D;  4YTM B;  1YN3 A;  2K0P A;  2INN E;  3BZD B;  1Y56 A;  2NTS A;  1JWB D;  3AE3 B;  4RCO A;  2K3U A;  1FRD A;  2WQY B;  1R7S A;  1C78 A;  1EWY C;  4YSX B;  3U52 E;  2GRI A;  1SJE D;  2GI9 A;  1HQR D;  1TYG B;  2L83 A;  3AMZ A;  2RMM A;  4ZHP A;  2W54 A;  2FUG 1;  3VR8 B;  3H8H A;  1J7B A;  3IT4 B;  1C9F A;  1TJE A;  4A9A A;  2Y5P A;  1SJH D;  3NS1 A;  2JYE A;  3MFG A;  1E0Z A;  2WS3 B;  1D5X C;  3FAH A;  4A8X C;  4YTP B;  4TQ0 A;  3NVZ A;  1FXA A;  1UGJ A;  4US8 A;  4J3O D;  1JML A;  1ESF A;  2QIE B;  1HZ5 A;  4YWG G;  4EE2 A;  3IAM 1;  2IDY A;  4ARI A;  4N6E B;  3W2D A;  1V1P B;  1JQ4 A;  3MP9 A;  4RNA A;  1FCC C;  1SBB B;  1WWT A;  1RWS A;  3AEA B;  4C7Z A;  2QSD A;  5EE1 A;  1EU4 A;  2WXL A;  1BUI C;  1TS3 A;  5AUI A;  2KWD A;  1KRH A;  5D3D A;  1ACC A;  3AE7 B;  2J4X A;  1SB3 C;  5D3I B;  5FR3 A;  1IGC A;  1IBX A;  3OWE B;  1ZPS A;  3GB1 A;  3AEF B;  2J52 A;  4YT0 B;  3P4S B;  4JE3 B;  1ZUD 2;  1N63 A;  2ZW1 A;  1I4G A;  1MHX A;  3ZJU A;  4DQO C;  3ZGZ A;  1VZ6 A;  1XLO A;  4NAM A;  3E9S A;  2QEJ C;  3HVZ A;  3NVV A;  1XO3 A;  4PT5 A;  1WSP A;  1OQR A;  1ZE3 D;  2I38 A;  4RGT A;  5BMH A;  2WXI A;  1C76 A;  1XCQ L;  3KQ4 A;  1FEH A;  1ZDX A;  2AQ2 B;  1FXI A;  3NVY A;  1FFU A;  1EU3 A;  2X38 A;  5BYS A;  3P4Q B;  4KKI A;  1RYJ A;  1FCL A;  1VR9 A;  2OED A;  4MM3 B;  1HEZ E;  1QOA A;  1K50 A;  1SE3 A;  2QMT A;  3VRA B;  3T3O A;  2IGG A;  2KN4 A;  2MH7 A;  2PMV A;  1FNW A;  5T8I A;  1T5X D;  1ZDV A;  3EGR A;  2NMQ A;  1QT9 A;  1KTK A;  1PGA A;  5I4D A;  1L4Z B;  3V05 A;  2WDV B;  3EUB 2;  1F0Z A;  1GB4 A;  1D5Z C;  1KF6 B;  2WXQ A;  3J9C A;  1EM7 A;  1D6E C;  1YMH E;  1DGJ A;  1F2R I;  4OVZ A;  1C4C A;  1TY2 A;  2MJ3 A;  4GDL B;  5BMG A;  1SSN A;  3R8B A;  1L0Y B;  3SEB A;  5GXG B;  1FM0 D;  4JX1 C;  2ACZ B;  2YEP F;  5LNK 1;  1VZ8 A;  5EE0 A;  3KWL A;  4B0M A;  1VDV A;  4DXF A;  3VQI A;  4A6Q A;  3TEX A;  1PGB A;  4LTU A;  1ROE A;  1QLB B;  2XN9 C;  1PUT A;  4AQ7 A;  1PDX A;  1JAL A;  2KAJ A;  1V1O A;  1FO4 A;  1L5P A;  1UUP A;  5HHD G;  4ZOH C;  1OFF A;  3SR6 A;  3B2G A;  2KAC A;  3TEZ A;  2BS3 B;  2AQ3 B;  4IOI E;  3P63 A;  4NJC A;  2IJ0 A;  4ZHO A;  2EKI A;  1ET9 A;  3BK2 A;  1C77 A;  3MHZ A;  4A55 A;  1AN8 A;  3U2S C;  2I2Y A;  3W9C B;  1TS4 A;  1WGK A;  2N7J A;  3DWG C;  2CJN A;  1QOB A;  2GB1 A;  4L23 A;  2W55 A;  3Q8A A;  1NVI D;  1TZO A;  2W3R A;  4HRO A;  4HJG E;  3B9J A;  2XNA C;  3R2I A;  3AV8 A;  4REZ A;  4DXG A;  2MEK A;  1YJI A;  4TQ1 A;  3AEG B;  2AQ1 B;  3R2T A;  1C79 A;  3VR9 B;  2BBC A;  3B2F A;  5E6J A;  4JWS C;  1NYQ A;  4L2Y A;  3AE2 B;  2LEK A;  5EE9 A;  1YNT E;  1JWS D;  3ZQ4 A;  3AEB B;  1OQQ A;  1ZXI A;  1N60 A;  1ZP0 B;  3IXS A;  3Q8E A;  2V3P A;  4ZRQ A;  1YN4 A;  3ZYY X;  2D5G A;  3BII D;  3TSS A;  5HFY A;  1JRP A;  2JSV X;  3IT6 B;  2KMM A;  1E10 A;  4WIP A;  1DYQ A;  1VJK A;  1JWM D;  2KDM A;  1D4B A;  2DWQ A;  1N5X A;  2WXM A;  3TEY A;  3SFE B;  3PZ8 A;  3V3X A;  4N59 A;  3TUO A;  1FNV A;  1MHH E;  3ETR A;  4OZA A;  3P42 A;  5JXV A;  2Z8L A;  4C56 C;  1T6B X;  2M19 A;  1RM6 C;  1V97 A;  1P7E A;  4YTN B;  4HRS A;  2DLB A;  2E6X A;  1GAQ B;  3EA6 A;  3LB8 C;  4LLG M;  3I57 A;  3VRB B;  1V8C A;  3C8Y A;  4CQN A;  1SXT A;  2LFI A;  3W5V B;  4ITK A;  3ZJT A;  1MVK A;  4OW0 A;  2Y3A A;  4MT5 A;  2SAK A;  1XXG A;  3FIL A;  4MAC A;  1T3Q A;  4RH6 A;  4TSS A;  2N0S B;  2V3N A;  2QIL A;  1TKY A;  1B9R A;  2BYT A;  1I4P A;  1HZ6 A;  2PW9 A;  1N5W A;  1CJE A;  4A90 A;  2PKO A;  1J7C A;  2IPK D;  4KGR A;  1ZXH A;  2G1E A;  5EE3 A;  1TS5 A;  4NZL B;  4US9 A;  1STE A;  2NTT A;  2MJE A;  2WXH A;  3BWU D;  1GPX A;  4N58 A;  2DBY A;  4KX6 B;  2INP E;  5FKA C;  3W5U B;  4FXC A;  1D5M C;  2L52 A;  3AE8 B;  1K51 A;  2RDG A;  2WXO A;  1XLP A;  3GS2 A;  1KH0 A;  4C7Y A;  3Q69 A;  1GOZ A;  1SE2 A;  1FNU A;  1Q10 A;  4XDC A;  1ENF A;  4AS1 A;  2IGH A;  2WXR A;  4RFB A;  1E9M A;  4ZYS A;  2QJL A;  2BS4 B;  3CIR B;  2CU3 A;  3AM9 A;  2BTE A;  1RFK A;  2WXJ A;  1K53 A;  1V1P A;  2WXK A;  3P1M A;  2FBW B;  1C4P A;  2JU6 X;  3BVG A;  1SF0 A;  4IDI A;  5FK9 C;  2V4I B;  1EWC A;  1L6U A;  2WXG A;  4TMA B;  4HEA 1;  5C2T B;  1NYR A;  1L6V A;  2LHE A;  1NEK B;  3BYY B;  4H2A A;  3NZ3 A;  3HUI A;  3UI3 A;  2SEB D;  2ZW0 A;  1TS2 A;  4M0W A;  4RGO S;  2L32 A;  3T3N A;  5H8Y E;  3HRD D;  1FRR A;  3AEC B;  1CZP A;  1QQR A;  1A70 A;  2Y5C A;  3LYY A;  1IUE A;  3L4P A;  3MJ5 A;  1IBX B;  4MH8 A;  4ARC A;  1I4R A;  1LO5 D;  2FE8 A;  1E7P B;  1JWU D;  2M56 B;  1QIL A;  1UWM A;  2L1A A;  3KLS X;  1F2R C;  2WU5 B;  1F77 A;  1XLN A;  3E56 A;  3CWI A;  1QOF A;  1CK1 A;  3PO0 A;  3Q8F A;  5G5G A;  2LGI A;  1C4A A;  4R3D A;  1AYF A;  2G9H D;  3ZJV A;  3I9V 1;  1VZ7 A;  1IGD A;  1WXQ A;  2M0A A;  2LJI A;  1XCT L;  1UWX A;  1QF6 A;  3NVW A;  4OHJ A;  3Q8B A;  1L0X B;  1P7F A;  1YQ3 B;  4O1N A;  1AWD A;  2BW2 A;  1FD6 A;  1CQV A;  2H89 B;  1TKG A;  1HXY D;  1YN5 A;  2RDH A;  3U4E G;  2WDQ B;  2WDR B;  4C80 A;  4UDU C;  2KQ4 X;  2BT6 A;  1DOY A;  4L1B A;  2K9X A;  2IGD A;  4RGN A;  1QKZ A;  3LXF A;  3NRZ A;  1JCK B;  4RF0 A;  4OZB A;  3KWV A;  2JXT A;  2BB6 A;  2BB5 A;  2N9K A;  3AH7 A;  3AN1 A;  2YEP B;  1WRI A;  4RGM A;  1M4V A;  2PLP A;  3Q8C A;  3P4P B;  1L4D B;  2PIA A;  2PVG C;  3U7Z A;  1YQ4 B;  4XE0 A;  3RFZ B;  2N9L A;  1KFY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...