2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords hypothetical protein Ta0895
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
1N5XA 2MH7A 1XLPA 3BIID 4WQMA 3VRAB 3AN1A 2EKIA 2DWQA 1YJJA 4YT0B 1ZOYB 1JWAD 1KFYB 4ITKA 1DGJA 3AE6B 4JWSC 2ACZB 1PUTA 4YTPB 1PDXA 1R7SA 1NYQA 3AEFB 4HROA 1XLQA 3P4SB 1QOAA 3L4PA 4YSZB 1FRRA 1YJIA 2JX5A 4N6EB 5C2TB 3P1MA 1RFKA 4YTMB 4KX6B 3AEEB 3AEDB 4USAA 1IUEA 1N5WA 1NEKB 5H8YE 4FXCA 1A70A 1ZUD2 1I7HA 3AM9A 3DWMA 2BS2B 1KF6B 1L6UA 1OQQA 1AYFA 2L83A 1FM0D 1FXIA 1QF6A 3W9CB 1QLBB 1ZP0B 1F0ZA 2WU2B 2K22A 3B2FA 1WYGA 3LXFA 2DBYA 1NENB 3AH7A 1CZPA 2BT6A 3AECB 5AUIA 3AE9B 1JQ4A 4JWUC 5EE9A 3P4PB 2W3RA 3ABVB 4ZHOA 1J7CA 1N60A 2K5PA 2KMMA 4C7ZA 1FO4A 1VJKA 1JW9D 1TKYA 2KAJA 2OHFA 2WP9B 4JX1C 3SR6A 1KRHA 1J7BA 1RWSA 5G5GA 2E3TA 1PFDA 1QOGA 3P4QB 1FMAD 1TJEA 1XO3A 3NVWA 3VR8B 2WDRB 1WWTA 4YSXB 1E6EB 2CJOA 2L52A 2WDQB 5EE1A 3SFEB 1DOXA 3NVZA 4YXDB 4ZHPA 1FFUA 1N62A 3AE3B 3NRZA 3W5UB 3P63A 2H88B 1JRPA 2WS3B 2B76B 1QOFA 5H92C 2JQRB 1E0ZA 4WWMA 1EWYC 2LEKA 2M56B 3EUB2 5C3JB 4LTUA 1L5PA 2WLBA 1NI3A 2PVGC 1RM6C 2H89B 5MPOA 2PIAA 1XLNA 2QIEB 3ETRA 2WQYB 3AB5A 4N59A 1DOIA 2PVOD 3NVYA 3B2GA 2QJLA 1CJEA 1N61A 1L0VB 1V97A 2MJDA 3AE5B 3HVZA 3SFDB 3WCQA 4C7YA 1T3QA 2W3SA 1TKEA 4P6VF 2PKOA 1VLBA 3FAHA 1YQ4B 3AE4B 1SIJA 3LB8C 3NS1A 1XLOA 3P4RB 1FIQA 1UWMA 2WU5B 3AEAB 1JALA 5G5HA 3VRBB 1OQRA 1SF0A 2MJ3A 1RYJA 1GPXA 3KWLA 4HRSA 5EE3A 3DWGC 1JROA 1TKGA 1SB3C 4YTNB 3AEBB 2FBWB 2Q5WD 1E10A 3AMZA 3RPFC 1B9RA 1N63A 3ZYYX 3NVVA 3VR9B 3W5VB 4US9A 1FRDA 2M19A 2WDVB 1E9MA 3AE7B 3HUIA 2N0SB 4IDIA 1VDVA 4ZOHC 1J7AA 1WRIA 1QOBA 1FFVA 1OFFA 1ROEA 1L6VA 1WGKA 2BS3B 1V8CA 2G1EA 2HTME 2Y5CA 3AE1B 2W54A 3HRDD 1NYRA 2CU3A 3AE8B 4A9AA 5EE0A 3AE2B 1ZXIA 2AX5A 1FXAA 1NVID 3FC4A 5AUKA 2W55A 2CJNA 1QT9A 1WXQA 2K9XA 3AV8A 4N58A 4YSYB 1AWDA 5GXGB 4C80A 2BS4B 3AEGB 3CIRB 4US8A 1GAQB 3CWIA 1JWBD 1YQ3B 1TYGB 3B9JA 1E7PB 3PO0A 1DOYA 2MJEA
chains in the Genus database with same CATH superfamily
2MH7A 2INCC 3VTUA 2EKIA 2X8XX 1EM7A 1HQRD 1JWAD 1DGJA 3MHSD 3DBHI 4MM3B 2Z59B 1WX9A 2LD9A 3N9YC 4HXDA 5TSSA 2JUOA 2KO3A 4GDLA 1S1QB 5H8YE 1TBEA 4IM3A 3C0RB 4EE2A 3PVLA 3OWEB 2EMSA 4MGIE 3W9CB 2BWES 2K22A 3AH7A 1YOVB 2BT6A 5G55A 2WXMA 3A9KA 4GU2A 4JWUC 5AZGA 4HPMB 3SDLC 1WR6E 2KHWB 3Q3OC 4B0EA 3GZNI 4JX1C 4BZAA 5CHFA 1KRHA 3RMKC 2WXOA 1R4MB 3P4QB 1AN8A 3NG0A 2NCNA 1LM8B 3EA6A 2V3NA 4WWMA 4MJSB 3Q8FA 1YX6B 1V5TA 3ONSA 1VZ6A 2VH2A 2AEHA 3W1SC 2ZZPB 2J42A 1VZ8A 2X38A 2MJDA 1TZ1A 2JWZA 3WCQA 2JRIB 2JY6A 4IWOA 1C78A 3AE4B 4RH6A 2BKFA 2J52A 2JT4B 2EELA 3ZIMA 5HFYA 2KFJA 3Q8CA 2DAFA 3O65B 4MGKE 3TSSA 2FBWB 2DNFA 3ZUNA 3RNEC 3ZGZA 3R7RA 4W9CA 3ZXVA 2KVRA 1ROEA 2INPE 2Y5CA 3RULA 3ZW3A 4HKQA 2CJNA 4GDKA 4IG7B 4GOCA 1N5XA 3R2TA 3VRAB 4P1BC 1WXAA 1PUTA 3HVDA 2LJ5A 2KACA 1T0YA 2VZKB 3VUYA 3PS6A 2HTHA 4XWTA 2SEBD 1UH6A 1F2RC 3C19A 3NY5A 3N32A 2IGHA 2LGSA 2AQ2B 3N3KB 2DYBA 3QJZA 4I6LB 1JMLA 3TEZA 1J7CA 3M63B 1D5XC 3BWUD 5G5GA 4W9EA 1L4ZB 1XO3A 1MJDA 4FHJA 4XZ4A 5BYQA 3NHEB 1E8WA 2L52A 3JVZX 3I63C 1T5XD 1WXSA 4WWPA 3Q69A 1BMLC 4EFOA 2RDBC 2OJRA 1IGDA 4ANXA 3GB1A 2PIAA 1MFWA 4H2AA 4EUTA 5AEKB 5BMIA 2YVCA 3DPDA 2FIFA 1UWMA 3I9V1 3DWGC 1JROA 3WAMA 1F52A 2K1FA 3Q3FA 2L8JA 2NPTA 4FADA 2XNAC 1VDVA 3RD2A 1L6VA 3UIOB 1LO5D 3H8HA 2LHEA 2K25A 3L10B 3TCAA 4K81A 2D3AA 2K9XA 5DCNA 1ZDVA 3PSEB 3BIID 2KQSA 2GBNA 4YWGG 3PRPB 3N1XC 5C23A 3L08A 2VZKD 2KX0A 1FRRA 5EDSA 1YJIA 5LXHA 2Z0EB 3DWMA 4WQOB 2IO2B 3D32A 2WXPA 3GE8C 1FPYA 1NENB 4IUMB 4HEA1 1L0XB 3RI7C 3VDZA 2V9HA 4ZRKA 3UQAA 2MCNB 1F77A 2KAJA 3PZ7A 3JW0X 3FKYA 5L95C 3U7DA 4XC2A 2KWUB 3NVZA 1SE9A 3W1YA 2DYOA 2KVZA 4AJWA 4OZAA 2I2YA 2SAKA 3NUHB 3KWVA 5D2MB 3RZWC 4E71A 3DBLI 2ZVNA 3BVGA 1ZGUB 4WAAA 2K3UA 4JLCA 4DDGD 1P7EA 1Q1OA 2NMQA 3DQVA 3ZNZB 3VRBB 2RDGA 1GPXA 1ENFA 1I4RA 2WX1A 4YTNB 3AEBB 5KHOA 1LQBA 3W2DA 1X1MA 1FRDA 2ASQA 1Z5SB 2N0SB 4LNNA 3MJWA 2RMMA 2I1KA 2W55A 4ZRIA 4CHKA 1WXQA 1SSNA 3L0WB 1P3QU 2N7EA 2PW9A 1YQ3B 1E7PB 2N9PC 1TT5B 2LVOA 4MDKE 3ZO5B 4DHZB 4Q2JA 3RNCC 4YSZB 4HJKA 2WXRA 4N6EB 1RFKA 2L00B 2ZPYA 2LGIA 2CHZA 1UGJA 3AEDB 1WRDB 1PGAA 2L0FA 2UU7A 1K8RB 4RGMA 2KN4A 3LDZE 4MELA 1KLVA 1L7YA 2ZCCA 1XCTL 4AWJA 2ZVOA 2DZIA 4XE0A 4NPNA 3Q8EA 1R4MI 1TKYA 3TUOA 2OOBB 1J7BA 1C3TA 4IW0A 1FMAD 3VR8B 2D3CA 1Y56A 3ZNHB 4DXFA 2CS4A 1XCQL 4KGTA 1FFUA 1JRPA 1T0SC 3ML8A 5IAAC 5E6JA 3EUB2 2YEPB 1V5OA 1L5PA 2REXA 2K8BA 3QX1A 2V3SA 5J17A 3ETRA 5JHAA 2JWUA 2BW2A 3LYYA 3A9JA 3VVWB 1CJEA 1WGYA 2Y3AA 4KZ0A 5T8IA 3P4RB 4G11A 3DVNU 3AXCA 3SD5A 2V4LA 3ZDTA 1HE8A 5D6JB 2Q5WD 1OQYA 1N63A 2C7HA 1WZ0A 2ZEQA 3WA0A 3DHHC 1RFAA 1F2RI 4IDIA 2L3ZA 1OFFA 1YIWA 2WNMA 1TZOA 2HTME 5BMGA 2MBEA 1XD3B 4A3PA 4RGTA 1EU4A 2WX0A 3R2IA 3FC4A 2LRWA 3ENEA 4GDKB 1YD8U 1D4BA 4OHJA 4XWWA 2RDHA 4LCDE 4HLEA 1XLPA 4WQMA 5E6NA 2GOWA 4YTPB 2D11A 4GMVA 3SEBA 1HZ6A 2JPHA 1RRBA 3AEEB 3TIXA 4TMAB 4USAA 2LASA 4JQWC 1I7HA 3PPAA 1XQQA 1KOTA 1SGHA 3ZJUA 4XDCA 4F8CB 3B08A 4JE3B 2JF5A 3Q8BA 4BFRA 2FNJB 4B95A 1VD2A 3JYUA 2OHFA 1SE4A 4GGQA 3TBLD 3ECIA 2DAJA 2PEAA 3VH4B 1TS5A 4IC7B 1DOXA 4LNKA 3T3NA 2LFIA 4TUUA 2LWPA 3NRZA 4HKZE 4WWOA 2WWZA 4C4VA 2KYWA 1QOFA 2W82A 1C76A 3EC8A 3WALA 1YN4A 3BYTB 1V2YA 2LMCA 1C79A 3PZ8A 1D5ZC 2MBBB 4C7YA 1SIFA 2UYZB 1TKEA 3PTFC 2UWQA 1XLOA 5CX3A 3HM3A 1SF0A 4TKNA 3N20C 3RNGC 3SHQA 2N9LA 1WGDA 2BYVE 1HXYD 1WGHA 2ZJDA 2BYTA 4ZYSA 2LGXA 4M8MA 1TY0A 1ESFA 1UUPA 4C00A 3ZRCA 1YQBA 1ZXIA 4W9KA 3ZRFA 1K52A 1TS4A 1F1HA 1WJ6A 5BYRA 3VHTC 2I1JA 1V1OA 3UQBA 1QILA 2MJEA 1LGRA 2IO1B 1R7SA 1NYQA 2LVQA 4EZKA 2KDBA 4NAWB 5E6PA 4KGSA 4OW0A 2KDEB 4BAXA 1NEKB 3HIZA 4ANUA 2INDC 2VH1A 1OQQA 4KKIA 3EFCA 2ZPNA 1FXIA 4D2KA 1KJTA 4TQ0A 3B2FA 2ON8A 3OJ3A 4EEWA 4KV2A 5BMHA 1L2NA 1HZ5A 4BKTA 1ZPSA 4II3B 2QHOA 2Z8LA 2CJOA 4C56C 3T9LA 1H8CA 4YL8A 4AS1A 4M01A 3C8YA 1A5RA 4ZYNA 1E0ZA 2JVCA 2LEKA 3ZJVA 4XGAB 2Y5PA 1ET9A 3UGBB 4DK5A 1GNUA 2LGYA 1MVKA 2PVOD 2QJLA 1VRAB 2KDMA 3IFWB 4KGRA 3IVFA 2DYMA 1KLGD 2O2VB 2MEKA 1E7VA 5D7GA 4MSQB 4A90A 2C5LC 2NTTA 3AMZA 2ZW0A 4BKSA 1LXDA 2M1MA 4WJQA 3GE3C 1WF9A 3IXSA 2V0GA 2LXAA 2IO3B 1OTRB 1P1AA 2AX5A 4R3DA 5DPTA 1MG8A 2M4NA 1IYFA 2CHWA 1T0RC 1DOYA 2FAZA 3QQ8B 4JWSC 1KFYB 4K3CA 2KANA 3NZ3A 1QKZA 4HROA 2L05A 4P16A 5JZEB 2HJ8A 2RR9A 3J9CA 3VUXA 1JWSD 1GJZA 3ZXRA 1WMHB 1V86A 2R61A 1ET6A 2L83A 3M3JA 4A3OA 3IAM1 1ZP0B 3M62B 1GB1A 3A9KB 5HI1A 1WYGA 3AECB 1WGRA 3HM6X 3AE9B 1JQ4A 4FBJB 2AQ1B 1WXMA 2GBMA 3BK2A 2CHXA 2K5PA 2WGSA 1V49A 5IKCM 1N6ZA 2OJWA 1PFDA 3ZTCA 1NI2A 5J18A 2PMVA 4RCOA 2LZ6A 1GC6A 4M00A 2BYEA 1SEBD 5H92C 2FCQA 1PQSA 3VQIA 5KHQA 1VR9A 1TGZB 3HHMA 2PVGC 1YNTE 2E6XA 3NZSA 2WQYB 2IY0B 3AB5A 3KQ4A 5GMVA 1WH3A 3ZLZA 4HK2A 3Q3NC 2DZMA 2ZNVB 3A9JB 1T3QA 1VLBA 1JALA 4FHKA 2KD0A 4HRSA 3H1UA 2QC8A 5EE3A 2IJ0A 3QARA 3VXWA 1TKGA 3AULA 3FILA 2WHIA 2NBWB 4F1SA 5DPRA 3PRMB 4M02A 2D2QA 2A4ZA 1NDDA 3U7ZA 2W54A 3A1QA 2FUHB 3TEWA 2NS5A 4G50A 2QMTA 4K7SA 4US8A 3OLMD 1IP9A 4B0MA 1XT9B 3PHWB 1SE3A 4HJGE 3PLUA 3PZDA 4YT0B 1ZE3D 4ITKA 3AEFB 4W9HA 5FR3A 3L4PA 3WIMA 3QAQA 3ZQ4A 4RGOS 3IHPC 3MTNB 4LDTD 4FXCA 2MX2A 1RLFA 3NS8A 1UNSA 2KDFB 2KTFA 4G0NB 1F0ZA 3NJTA 4DHJB 2I38A 3N1YC 1L0YB 1JRUA 3P4PB 2CKHB 3ABVB 3BY4B 5G2NA 1JW9D 2JYTA 3ZNGC 2ZNVC 2RGFA 2JZZA 3UINB 4K3BA 4GXBA 2BTEA 1WMHA 3RFZB 2K0PA 4YXDB 4LDTB 4MACA 4ZHPA 1FXTB 2JXXA 2GMIC 3P63A 2JQRB 2G4DB 4QAYA 1IBXA 4LTUA 1NI3A 2WXNA 1XLNA 4KSLC 2JRHA 5HHDG 2KX3A 3HK0A 2LUEA 3IT6B 1WJNA 3V6CB 3FAHA 1SIJA 1G6JA 2QILA 1I4HA 3DBSA 3W5VB 3WANA 4RM9A 1I4PA 3DVGX 1FFVA 1C4PA 3DDCB 1J0GA 1KH0A 2TSSA 3T3OA 1CQVA 1NVID 1QQRA 3PV1A 4MEMA 2CR5A 1JWUD 4FN2A 4N58A 4IKGA 1WFYA 3TJPA 1BT0A 3GP7A 1F9JA 2IPKD 2EKEC 1V80A 3ZDMC 1TIFA 5HKHA 3JSVA 4K7WA 2PPHA 4FJZA 4ASWC 3P2BA 3UF8A 2BPSA 4K7UA 3GS2A 2LHDA 5FR6A 2O2VA 2MBOA 3WAOA 1TTNA 3IBEA 2KC2A 2N9XA 4FJYA 2WXFA 3Q3JA 3RNFC 2KWDA 1I35A 5EE9A 3LJ3A 3QA8A 1VJKA 3TEXA 3BVMA 2ZW1A 2LVPA 1YJ1A 2O6VB 2WDRB 2BB5A 2AL3A 3DBHB 1YN5A 1UBIA 1WGGA 1XXGA 4ZRPA 2WS3B 5JXVA 2FE8A 4NAWA 1GC7A 4MJSA 1EO6A 4PS7A 1R4NB 2QSDA 1WE6A 1L0VB 4I6PA 1P98A 2C7NB 3AEAB 1OQRA 2J0KA 3S2AA 2ZCBA 2DLBA 3P42A 3QC8B 1B9RA 2DENB 1I42A 2K6QA 3VR9B 3AU5A 2YLMA 3HUIA 2D10A 4IOIE 1E8XA 1QT9A 3E9SA 4BBNC 2PLPA 1WR1A 5LLIA 3RN9C 5IP4D 3R8BA 1WYWB 4M0WB 1M94A 2MHJA 4BBNF 2JX5A 1KM7A 1T0QC 4KDIC 5JH5C 3MC0B 4C4VB 1MI0A 4RNAA 3IT4B 1FM0D 4G3XB 3QIJA 3RNBC 2JSVX 1IGCA 2IDYA 2LI5A 1T6BX 2NBUA 4GN1A 4L23A 1GOZA 1RAXA 2J0MA 3SFEB 1AARA 1V81A 2XK5A 3A4SC 4A55A 1E7UA 3H9DA 2BF8B 2D5GA 1CMXB 3MC9A 2KLCA 2KKCA 1ZKHA 2WLBA 3I5JC 3KYCD 5IA7A 1OGWA 1GUAB 3NVYA 1WJ4A 2AL6A 4AQ7A 3MP9A 3NS1A 4NQKE 1EF5A 4DHZE 4X57B 3K9OB 3U30A 2BWFA 4JIOU 4KIKB 3AI5A 5D3DA 1E90A 1UBQA 1D3ZA 1WJUA 2LJIA 2K8CA 3FILB 3KH0A 2KWCA 1E9MA 2IZVB 3AE7B 3CMMB 1AW7A 2G1EA 1NYRA 1WM2A 2INNE 1FCCC 4YSYB 4RF0A 3V61A 3CIRB 3TL5A 2M17A 3ZJTA 4ANWA 3TMPB 1ACCA 4NQLB 2N1WA 4LK0M 1P9DU 5D3IB 1WX8A 3PRZA 4KKJA 1N5WA 1ZUD2 3AM9A 3EHVA 1J19A 3UI3A 2KK8A 4ZRQA 2DZKA 5CHVC 2WU2B 2GBRA 3N30A 4NJ7A 2PTLA 4DHJD 1E8ZA 3Q14C 2M8SA 3H7PA 2N7DA 4C7ZA 2E3TA 3URYA 1TJEA 3BVZA 4NY0A 4RF1A 2FCMA 4W9IA 4PS8A 4ARCA 4LJOB 5LNK1 4EKUA 4O1NA 3DVGY 1E8YA 4N9F4 3U52E 5C3JB 1I4QA 4KZCA 2NTSA 4PYUA 2L76A 2WDTB 2KJ6A 1Q0WB 1V97A 4HCNB 3KLSX 1K51A 2AYOB 4EZLA 4ICVA 3B0AA 1YQ4B 3RPFC 5LXIB 4WURA 1L4DB 3OAWA 2GRIA 2BVCA 1P0RA 1D5MC 1QOBA 1YMHE 1WGKA 2BS3B 4ANVA 4ARIA 3NOBA 4BVUC 1SJED 2MP2A 4WJNA 4A9AA 1FXAA 2C7MB 4M8NA 4BKGA 1ZXHA 4B9KA 4XYCA 4C80A 3JSVB 1ZW7A 2RSUA 1GAQB 2QCZA 3B9JA 4L2YA 1FNUA 2JYEA 1P7FA 2PJHA 1JWMD 2K8HA 2KQ7A 2WXQA 1DYQA 2RD0A 1WE7A 2IGGA 4KX6B 5J2RA 3PLVA 1IUEA 2BBCA 1A70A 3DHGC 3IG3A 4RM8A 4F7ZA 1QLBB 1Q10A 1UF0A 5C1ZA 4AP4C 2EMTA 4MGYE 4HPPA 2N7JA 1KLUD 4HPLB 4S0RA 3Q3MC 1RWSA 4I6NB 1QOGA 2WYQA 3O13A 2L1AA 4MH0E 3APFA 2KQ4X 2XK5B 3KUZA 4PT5A 5AZHA 2BQQA 4II2B 4WJOA 1Y8RC 4ICUA 2FCNA 1EWYC 2M56B 4W9JA 2H89B 1V9JA 4WAFA 2WXKA 1DOIA 2J4XA 4EZJA 3B2GA 3KYDD 2WXLA 4PS3A 1WY8A 2JZ3B 4P6VF 1MPEA 4B6WA 1FIQA 2C9WB 1E5WA 1V1PB 1IPGA 4RFBA 1I4GA 2WXJA 4E3CA 3MC8A 3CSTA 4HVBA 3NVVA 2NR2A 1SJHD 3U2SC 3H6NA 4ZOHC 4XDDA 3BK1A 1QZEA 2BB6A 1V8CA 4JL9A 5HG2A 2GBJA 2MWSB 3AE8B 3AE2B 1WX7A 1BUIC 1LFDA 1OEYA 5GXGB 3A4RA 5IO9A 4NJ6A 2NPTB 2R2QA 3RZFA 4AUQC 4DQOC 3DOWA 4LNFA 4OVZA 2D3BA 4W9GA 4W9LA 4WH4A 4BOZB 1XEEA 4HWIB 2QEJC 2HE7A 3RUIB 4MSMB 1UGMA 4RMAA 2M0AA 2KFKA 5E6OA 1J8CA 3H7PB 2BKRB 4DWFA 3LXFA 5AUIA 2IO0B 3ZTDA 3APDA 1WM3A 2HJ1A 3AU4A 2IYDB 2LGDA 4MM3A 3SR6A 1BXTA 4A8XC 4YSXB 4J3OD 1E6EB 1MHHE 2J7QB 2N4FA 2WDQB 5EE1A 2G9HD 1C77A 2YEPF 3VUWA 4TQ1A 2N1VA 4LNIA 5FKAC 4NAMA 4IWPA 3ZVVA 2B76B 4GLSC 1B1ZA 3IAS1 2FIDA 3Q6BA 4OZCA 3T8MA 2MW5A 2XBBC 3DBRB 2KZRA 1EUVB 2BGFA 4RGNA 5CHWA 1XF5L 1UZXB 3EGRA 3KVFB 4WJPA 3LB8C 2MLBA 5G5HA 5TR5A 5BYSA 4J6IA 2MJ3A 3N1ZC 2MP2B 2MBHA 3QWZB 2O6VA 2Y5BB 1NBFC 3W1SA 3DVNV 2KFKB 1TS3A 2WDVB 1WZ3A 3PGEA 3V60A 1KTKA 4MH8A 1WRIA 3SU8X 3HRDD 3BYYB 2G45B 2QDFA 5AUKA 3OJ4B 3AV8A 3AEGB 4PYZA 4LJPB 4DXAB 3KUCB 2MSED 1STEA 1UD7A 3PO0A 3VH3B 2KOXA 3AE6B 2KDIA 2ACZB 2WXHA 4GB9A 2KMAA 1QOAA 3L17A 4IWQA 5C2TB 2B3AA 4OZBA 2IGDA 2L0TA 4NNJB 2LXCA 4JPSA 1AYFA 1HTOA 3L16A 1FEHA 2PE6B 3H7SA 2W9NA 3DCGA 1H4RA 2DX5B 3BZDB 4CYEA 1V1PA 4XX5A 2DZJA 2WP9B 4P7IA 2M0XA 2KMCA 3MHZA 1MHXA 1EF1A 3E56A 3EFUA 3R7QA 4EOYA 3NVWA 1Q5WB 1WWTA 4K1RB 2KWVB 5IOIA 4WIPA 2VRRB 3DHIC 1PGBA 1UWXA 5DPWA 3AE3B 3RCZA 3W5UB 4FA6A 1EWCA 2AWTA 2WXGA 1FNVA 3RT3B 3UIPB 3WAPA 3MFGA 1WI0A 1WIAA 3U8ZA 5MPOA 4CQNA 1K50A 2GI9A 2KTRA 1N61A 1K53A 2J0JA 4REZA 3SFDB 2MQJA 3V05A 5JHBA 2W3SA 4GDLB 1IBXB 2PKOA 1SXTA 2IBIB 3X0WA 4P1CC 4OVUA 4GIVA 1RYJA 4HDOA 3KWLA 5IN7A 3MJ5A 2V4IB 1VZ7A 2CU1A 4L1BA 2ONQA 4BOSC 3ZYYX 4MGZE 2O6VD 2PE9A 4PK1A 1PYWD 1MG4A 2CU3A 2DHZA 1ZDXA 5D94A 4URKA 3L54A 3NZUA 4FJVB 1FCLA 4IM0A 1TS2A 3CWIA 1JWBD 2KN5A 2KC1A 1GB4A 1JCKB 5FK9C 2DWQA 1HEZE 2HDEA 1VCBA 1M4VA 3BINA 1TY2A 3I3TB 3GZNB 4GSWA 2KJRA 4YTMB 4NZLB 3R66C 1CK1A 4IM2A 3DBLB 2BS2B 3CSFA 2NBVB 4W9DA 2D07B 2DBYA 3Q8AA 2J53A 4HCPB 5L83A 2W3RA 4ZHOA 1FO4A 1OEYJ 3ZKJC 4AJYB 3CF6E 4ZRJA 2MA9B 3R3MA 5AZFA 4A20A 2L7RA 2V1YA 2L32A 2N9KA 5CTRC 2KLGA 2KNBA 1RM6C 1Z2MA 2QIEB 4M0WA 3A33B 3ML9A 1SBBB 3PREA 3AE5B 3OG5A 1U4AA 2WU5B 1C1YB 1WSPA 2BYFA 1HTQA 4A6QA 1ISNA 4KVGB 1FNWA 1SB3C 1UELA 1E10A 3RNAC 3DBRI 2XN9C 4WWNA 1EU3A 2M19A 2A5UA 4FULA 4AOFA 2ICIA 1I4XA 3QK0A 3AE1B 4HDQA 2FCSA 5EE0A 4KSKC 2R2OA 2V3PA 2N9EB 3KW5B 3VAWA 1AWDA 3VFKA 4W9FA 1S3SG 4TV3A 4MT5A 2GBKA 2C60A 1TYGB 4ACFA 3PHXB 4CO7A 4BKSD 4LNOA 3K9PB 2XEWA 3AN1A 2Z0DB 1YJJA 1ZOYB 1FD6A 2D3GA 1PDXA 3GOEA 3APCA 1SE2A 1XLQA 3P4SB 2LRUA 3P1MA 3X23A 4FLHA 1C4CA 2IY1B 4DBGA 3U4EG 2KT7A 1KF6B 1L6UA 3M95A 3QCAA 3V6EB 3VTWA 1PGXA 2JZPA 2GB1A 4KIKA 3V62A 1CZPA 2JU6X 3B1LX 1N60A 2KMMA 2MRPA 1YN3A 4NJCA 3QHTA 4E74A 2KJHB 1GG3A 4OVVA 2HD5B 1V6EA 1N62A 2K39A 4DDID 2G4SA 4DXGA 1D6EC 2H88B 4TSSA 3RYTA 2GLSA 2K6DB 3V3XA 3PT2B 4UDUC 2KXJA 2MBQA 2AQ3B 4N59A 3EECA 3HVZA 2LUMA 5I4DA 2JXTA 2OEDA 2FUG1 1C9FA 3A1QB 3ALBA 5BO4B 2RPVA 3L13A 3TEYA 3KUDB 3Q2AC 4US9A 1HA5A 1J7AA 2RPQA 2G3QB 1C4AA 1QF6A 4JGHB 4S17A 4ZDVA 5DPSA 3ZNID 1YX5B 3VTVA 4LLGM 2WXIA 3I57A 1WXVA 2BS4B 2NVUI 1R4NI 2KTRB 4KDLB
chains in the Genus database with same CATH topology
2MH7A 1XLPA 2IPKD 4WQMA 2EKIA 1EM7A 1HQRD 1JWAD 4DQOC 1DGJA 4YTPB 4MM3B 3SEBA 1HZ6A 4OVZA 3N9YC 3GS2A 4WH4A 5TSSA 2LHDA 1XEEA 2QEJC 3AEEB 4TMAB 4USAA 5H8YE 1I7HA 4EE2A 2M0AA 3OWEB 3ZJUA 4XDCA 3W9CB 2K22A 3LXFA 5AUIA 3AH7A 2WXFA 2BT6A 2KWDA 4JE3B 2WXMA 4JWUC 5EE9A 3Q8BA 1VJKA 3TEXA 4B0EA 3BVMA 2OHFA 1SE4A 4JX1C 2ZW1A 3SR6A 1KRHA 2WXOA 3P4QB 1BXTA 1AN8A 4A8XC 1TS5A 2WDRB 4J3OD 2BB5A 1E6EB 1MHHE 2WDQB 5EE1A 4YSXB 1DOXA 2G9HD 1C77A 3EA6A 1YN5A 2YEPF 3T3NA 4TQ1A 2LFIA 3NRZA 5FKAC 4HKZE 4NAMA 2V3NA 1XXGA 4ZRPA 2WS3B 5JXVA 2FE8A 2B76B 1QOFA 2W82A 4GLSC 1B1ZA 1C76A 4WWMA 3IAS1 3Q8FA 4OZCA 1YN4A 3BYTB 2LMCA 2QSDA 1C79A 3PZ8A 1VZ6A 1D5ZC 4RGNA 2J42A 1VZ8A 2X38A 1XF5L 1L0VB 2MJDA 3WCQA 4C7YA 3EGRA 1TKEA 1C78A 3AE4B 3LB8C 4RH6A 1XLOA 3AEAB 5G5HA 2J52A 2EELA 1OQRA 5BYSA 1SF0A 2MJ3A 5HFYA 2DLBA 2N9LA 3Q8CA 3P42A 3TSSA 2FBWB 1HXYD 3ZGZA 1B9RA 2BYTA 4ZYSA 3W1SA 3VR9B 1TS3A 2WDVB 3HUIA 1TY0A 1KTKA 4MH8A 1WRIA 1ESFA 1ROEA 2INPE 1UUPA 2Y5CA 3HRDD 3BYYB 4IOIE 1ZXIA 5AUKA 4HKQA 2CJNA 1K52A 1TS4A 1QT9A 3AV8A 3E9SA 5BYRA 2PLPA 3AEGB 1V1OA 1STEA 3PO0A 1QILA 2MJEA 1N5XA 3R2TA 3VRAB 3R8BA 3AE6B 2ACZB 1PUTA 2WXHA 1R7SA 3HVDA 1NYQA 2KACA 1QOAA 2VZKB 2JX5A 5C2TB 4NAWB 4KGSA 4OW0A 3MC0B 4XWTA 2SEBD 1MI0A 1F2RC 4OZBA 1NEKB 4RNAA 3IT4B 2IGDA 1OQQA 4KKIA 4JPSA 1AYFA 2IGHA 1FM0D 1FXIA 2AQ2B 1FEHA 4D2KA 4TQ0A 3B2FA 2JSVX 1IGCA 2ON8A 3BZDB 1JMLA 1V1PA 3TEZA 2IDYA 1J7CA 5BMHA 1T6BX 1D5XC 1HZ5A 2WP9B 3BWUD 4L23A 1GOZA 5G5GA 1ZPSA 3MHZA 1MHXA 2Z8LA 3E56A 1L4ZB 1XO3A 3NVWA 1WWTA 5BYQA 3SFEB 2CJOA 2L52A 4C56C 4WIPA 4A55A 4AS1A 1PGBA 1T5XD 1UWXA 3AE3B 3C8YA 3Q69A 1BMLC 3W5UB 1EWCA 2WXGA 2D5GA 1FNVA 1E0ZA 1IGDA 2LEKA 3GB1A 3ZJVA 3MFGA 2Y5PA 1ET9A 2WLBA 5MPOA 2PIAA 4CQNA 1MVKA 1K50A 2PVOD 3NVYA 4H2AA 2GI9A 2QJLA 1VRAB 1N61A 1K53A 2KDMA 4REZA 3SFDB 3V05A 5BMIA 4KGRA 4AQ7A 2DYMA 1KLGD 2W3SA 4GDLB 1IBXB 3MP9A 2PKOA 3NS1A 2MEKA 1SXTA 1UWMA 3I9V1 5D7GA 4A90A 1RYJA 3KWLA 3DWGC 1JROA 2V4IB 3MJ5A 2NTTA 1VZ7A 4L1BA 5D3DA 2ONQA 3AMZA 2ZW0A 3ZYYX 2LJIA 3FILB 1E9MA 3AE7B 1AW7A 2XNAC 1VDVA 1L6VA 2G1EA 3IXSA 2V0GA 1LO5D 1NYRA 1PYWD 2CU3A 1ZDXA 2LHEA 3H8HA 2AX5A 4R3DA 2INNE 1FCCC 1FCLA 2K9XA 4YSYB 4RF0A 3CIRB 1TS2A 3CWIA 1JWBD 3ZJTA 1ZDVA 1DOYA 3BIID 1ACCA 1JCKB 5FK9C 1GB4A 2DWQA 4JWSC 1KFYB 4YWGG 1HEZE 2HDEA 3NZ3A 1QKZA 4HROA 4P16A 2VZKD 3J9CA 1M4VA 1FRRA 4LK0M 1YJIA 5D3IB 1TY2A 4YTMB 1JWSD 4NZLB 4KKJA 1CK1A 1N5WA 1ZUD2 3AM9A 3DWMA 2BS2B 3UI3A 4ZRQA 2R61A 1ET6A 2L83A 3IAM1 2WXPA 1ZP0B 2WU2B 1GB1A 5HI1A 1WYGA 2DBYA 1NENB 3Q8AA 3AECB 2J53A 4HEA1 3AE9B 1L0XB 1JQ4A 2AQ1B 2PTLA 2W3RA 3BK2A 4ZHOA 1FO4A 2K5PA 4C7ZA 1F77A 2KAJA 3PZ7A 2E3TA 1PFDA 3URYA 1TJEA 2PMVA 3BVZA 4RCOA 4RF1A 3NVZA 2DYOA 4ARCA 1SEBD 4OZAA 2L32A 2SAKA 5H92C 2I2YA 5LNK1 2N9KA 3NUHB 3KWVA 4O1NA 5C3JB 3U52E 3VQIA 1VR9A 1I4QA 3BVGA 2PVGC 1RM6C 1YNTE 2E6XA 2QIEB 4M0WA 2WQYB 3AB5A 3KQ4A 2NTSA 2K3UA 1SBBB 1V97A 3AE5B 3KLSX 1P7EA 1K51A 1T3QA 1VLBA 1YQ4B 2NMQA 3VRBB 2RDGA 2WU5B 1JALA 1WSPA 1GPXA 4HRSA 5EE3A 4A6QA 1FNWA 1ENFA 1I4RA 2IJ0A 1TKGA 1SB3C 4YTNB 3AEBB 1E10A 3FILA 3RPFC 2XN9C 3W2DA 4WURA 1L4DB 1EU3A 1FRDA 2M19A 2ICIA 2N0SB 1I4XA 2GRIA 1YMHE 1D5MC 1QOBA 1WGKA 2BS3B 2RMMA 4ARIA 3AE1B 3U7ZA 2W54A 1SJED 4A9AA 5EE0A 2V3PA 1FXAA 3TEWA 1ZXHA 2W55A 1WXQA 4C80A 2QMTA 1AWDA 1SSNA 4US8A 2PW9A 1GAQB 1YQ3B 4MT5A 4B0MA 1TYGB 3B9JA 1E7PB 4L2YA 1FNUA 1SE3A 2JYEA 3AN1A 4HJGE 1P7FA 1YJJA 4YT0B 1ZOYB 1ZE3D 4ITKA 1FD6A 1JWMD 1PDXA 3AEFB 4Q2JA 1SE2A 1XLQA 5FR3A 2WXQA 3L4PA 3P4SB 4YSZB 2WXRA 1DYQA 4N6EB 3P1MA 1RFKA 3ZQ4A 2LGIA 2IGGA 1UGJA 4RGOS 4KX6B 1C4CA 3AEDB 1IUEA 2BBCA 4FXCA 1A70A 3U4EG 1PGAA 1KF6B 1L6UA 1PGXA 1UNSA 2JZPA 4RGMA 1QLBB 2GB1A 2KN4A 1F0ZA 1CZPA 2I38A 1XCTL 1Q10A 1L0YB 2JU6X 3P4PB 3ABVB 1N60A 2KMMA 4XE0A 1YN3A 3Q8EA 1JW9D 2JYTA 1TKYA 2N7JA 1KLUD 4NJCA 3TUOA 1J7BA 1RWSA 1QOGA 1FMAD 3VR8B 3O13A 1Y56A 4DXFA 2L1AA 2BTEA 1XCQL 3RFZB 2K0PA 4YXDB 4KGTA 4MACA 1FFUA 1N62A 4ZHPA 2KQ4X 3P63A 4DXGA 1D6EC 2H88B 4PT5A 4TSSA 1JRPA 2JQRB 1EWYC 5E6JA 2M56B 3EUB2 3V3XA 2YEPB 4LTUA 4UDUC 1IBXA 1L5PA 2AQ3B 1NI3A 2WXNA 2H89B 1XLNA 3ETRA 4WAFA 4N59A 2JWUA 5HHDG 2WXKA 2BW2A 1DOIA 2J4XA 3LYYA 3B2GA 1CJEA 3HVZA 3IT6B 2WXLA 2Y3AA 2LUMA 5I4DA 2JXTA 2OEDA 1MPEA 2FUG1 4P6VF 3FAHA 5T8IA 1SIJA 3P4RB 1C9FA 1FIQA 1V1PB 2RPVA 3TEYA 4RFBA 2QILA 1I4GA 2WXJA 2Q5WD 1I4HA 1N63A 3NVVA 3W5VB 1SJHD 4US9A 3U2SC 1HA5A 1F2RI 4IDIA 4ZOHC 1I4PA 1J7AA 3BK1A 4XDDA 1FFVA 1C4PA 1OFFA 2WNMA 2BB6A 1C4AA 2HTME 1TZOA 1V8CA 1KH0A 5HG2A 5BMGA 2TSSA 3AE8B 1QF6A 3AE2B 3T3OA 4RGTA 1CQVA 1BUIC 1EU4A 1NVID 1QQRA 3FC4A 3R2IA 4LLGM 4GDKB 1JWUD 2WXIA 3I57A 4N58A 5GXGB 2BS4B 4IKGA 4OHJA 1D4BA 4XWWA 2RDHA 3GP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N5X A;  2MH7 A;  1XLP A;  3BII D;  4WQM A;  3VRA B;  3AN1 A;  2EKI A;  2DWQ A;  1YJJ A;  4YT0 B;  1ZOY B;  1JWA D;  1KFY B;  4ITK A;  1DGJ A;  3AE6 B;  4JWS C;  2ACZ B;  1PUT A;  4YTP B;  1PDX A;  1R7S A;  1NYQ A;  3AEF B;  4HRO A;  1XLQ A;  3P4S B;  1QOA A;  3L4P A;  4YSZ B;  1FRR A;  1YJI A;  2JX5 A;  4N6E B;  5C2T B;  3P1M A;  1RFK A;  4YTM B;  4KX6 B;  3AEE B;  3AED B;  4USA A;  1IUE A;  1N5W A;  1NEK B;  5H8Y E;  4FXC A;  1A70 A;  1ZUD 2;  1I7H A;  3AM9 A;  3DWM A;  2BS2 B;  1KF6 B;  1L6U A;  1OQQ A;  1AYF A;  2L83 A;  1FM0 D;  1FXI A;  1QF6 A;  3W9C B;  1QLB B;  1ZP0 B;  1F0Z A;  2WU2 B;  2K22 A;  3B2F A;  1WYG A;  3LXF A;  2DBY A;  1NEN B;  3AH7 A;  1CZP A;  2BT6 A;  3AEC B;  5AUI A;  3AE9 B;  1JQ4 A;  4JWU C;  5EE9 A;  3P4P B;  2W3R A;  3ABV B;  4ZHO A;  1J7C A;  1N60 A;  2K5P A;  2KMM A;  4C7Z A;  1FO4 A;  1VJK A;  1JW9 D;  1TKY A;  2KAJ A;  2OHF A;  2WP9 B;  4JX1 C;  3SR6 A;  1KRH A;  1J7B A;  1RWS A;  5G5G A;  2E3T A;  1PFD A;  1QOG A;  3P4Q B;  1FMA D;  1TJE A;  1XO3 A;  3NVW A;  3VR8 B;  2WDR B;  1WWT A;  4YSX B;  1E6E B;  2CJO A;  2L52 A;  2WDQ B;  5EE1 A;  3SFE B;  1DOX A;  3NVZ A;  4YXD B;  4ZHP A;  1FFU A;  1N62 A;  3AE3 B;  3NRZ A;  3W5U B;  3P63 A;  2H88 B;  1JRP A;  2WS3 B;  2B76 B;  1QOF A;  5H92 C;  2JQR B;  1E0Z A;  4WWM A;  1EWY C;  2LEK A;  2M56 B;  3EUB 2;  5C3J B;  4LTU A;  1L5P A;  2WLB A;  1NI3 A;  2PVG C;  1RM6 C;  2H89 B;  5MPO A;  2PIA A;  1XLN A;  2QIE B;  3ETR A;  2WQY B;  3AB5 A;  4N59 A;  1DOI A;  2PVO D;  3NVY A;  3B2G A;  2QJL A;  1CJE A;  1N61 A;  1L0V B;  1V97 A;  2MJD A;  3AE5 B;  3HVZ A;  3SFD B;  3WCQ A;  4C7Y A;  1T3Q A;  2W3S A;  1TKE A;  4P6V F;  2PKO A;  1VLB A;  3FAH A;  1YQ4 B;  3AE4 B;  1SIJ A;  3LB8 C;  3NS1 A;  1XLO A;  3P4R B;  1FIQ A;  1UWM A;  2WU5 B;  3AEA B;  1JAL A;  5G5H A;  3VRB B;  1OQR A;  1SF0 A;  2MJ3 A;  1RYJ A;  1GPX A;  3KWL A;  4HRS A;  5EE3 A;  3DWG C;  1JRO A;  1TKG A;  1SB3 C;  4YTN B;  3AEB B;  2FBW B;  2Q5W D;  1E10 A;  3AMZ A;  3RPF C;  1B9R A;  1N63 A;  3ZYY X;  3NVV A;  3VR9 B;  3W5V B;  4US9 A;  1FRD A;  2M19 A;  2WDV B;  1E9M A;  3AE7 B;  3HUI A;  2N0S B;  4IDI A;  1VDV A;  4ZOH C;  1J7A A;  1WRI A;  1QOB A;  1FFV A;  1OFF A;  1ROE A;  1L6V A;  1WGK A;  2BS3 B;  1V8C A;  2G1E A;  2HTM E;  2Y5C A;  3AE1 B;  2W54 A;  3HRD D;  1NYR A;  2CU3 A;  3AE8 B;  4A9A A;  5EE0 A;  3AE2 B;  1ZXI A;  2AX5 A;  1FXA A;  1NVI D;  3FC4 A;  5AUK A;  2W55 A;  2CJN A;  1QT9 A;  1WXQ A;  2K9X A;  3AV8 A;  4N58 A;  4YSY B;  1AWD A;  5GXG B;  4C80 A;  2BS4 B;  3AEG B;  3CIR B;  4US8 A;  1GAQ B;  3CWI A;  1JWB D;  1YQ3 B;  1TYG B;  3B9J A;  1E7P B;  3PO0 A;  1DOY A;  2MJE A; 
#chains in the Genus database with same CATH topology
 2MH7 A;  2INC C;  3VTU A;  2EKI A;  2X8X X;  1EM7 A;  1HQR D;  1JWA D;  1DGJ A;  3MHS D;  3DBH I;  4MM3 B;  2Z59 B;  1WX9 A;  2LD9 A;  3N9Y C;  4HXD A;  5TSS A;  2JUO A;  2KO3 A;  4GDL A;  1S1Q B;  5H8Y E;  1TBE A;  4IM3 A;  3C0R B;  4EE2 A;  3PVL A;  3OWE B;  2EMS A;  4MGI E;  3W9C B;  2BWE S;  2K22 A;  3AH7 A;  1YOV B;  2BT6 A;  5G55 A;  2WXM A;  3A9K A;  4GU2 A;  4JWU C;  5AZG A;  4HPM B;  3SDL C;  1WR6 E;  2KHW B;  3Q3O C;  4B0E A;  3GZN I;  4JX1 C;  4BZA A;  5CHF A;  1KRH A;  3RMK C;  2WXO A;  1R4M B;  3P4Q B;  1AN8 A;  3NG0 A;  2NCN A;  1LM8 B;  3EA6 A;  2V3N A;  4WWM A;  4MJS B;  3Q8F A;  1YX6 B;  1V5T A;  3ONS A;  1VZ6 A;  2VH2 A;  2AEH A;  3W1S C;  2ZZP B;  2J42 A;  1VZ8 A;  2X38 A;  2MJD A;  1TZ1 A;  2JWZ A;  3WCQ A;  2JRI B;  2JY6 A;  4IWO A;  1C78 A;  3AE4 B;  4RH6 A;  2BKF A;  2J52 A;  2JT4 B;  2EEL A;  3ZIM A;  5HFY A;  2KFJ A;  3Q8C A;  2DAF A;  3O65 B;  4MGK E;  3TSS A;  2FBW B;  2DNF A;  3ZUN A;  3RNE C;  3ZGZ A;  3R7R A;  4W9C A;  3ZXV A;  2KVR A;  1ROE A;  2INP E;  2Y5C A;  3RUL A;  3ZW3 A;  4HKQ A;  2CJN A;  4GDK A;  4IG7 B;  4GOC A;  1N5X A;  3R2T A;  3VRA B;  4P1B C;  1WXA A;  1PUT A;  3HVD A;  2LJ5 A;  2KAC A;  1T0Y A;  2VZK B;  3VUY A;  3PS6 A;  2HTH A;  4XWT A;  2SEB D;  1UH6 A;  1F2R C;  3C19 A;  3NY5 A;  3N32 A;  2IGH A;  2LGS A;  2AQ2 B;  3N3K B;  2DYB A;  3QJZ A;  4I6L B;  1JML A;  3TEZ A;  1J7C A;  3M63 B;  1D5X C;  3BWU D;  5G5G A;  4W9E A;  1L4Z B;  1XO3 A;  1MJD A;  4FHJ A;  4XZ4 A;  5BYQ A;  3NHE B;  1E8W A;  2L52 A;  3JVZ X;  3I63 C;  1T5X D;  1WXS A;  4WWP A;  3Q69 A;  1BML C;  4EFO A;  2RDB C;  2OJR A;  1IGD A;  4ANX A;  3GB1 A;  2PIA A;  1MFW A;  4H2A A;  4EUT A;  5AEK B;  5BMI A;  2YVC A;  3DPD A;  2FIF A;  1UWM A;  3I9V 1;  3DWG C;  1JRO A;  3WAM A;  1F52 A;  2K1F A;  3Q3F A;  2L8J A;  2NPT A;  4FAD A;  2XNA C;  1VDV A;  3RD2 A;  1L6V A;  3UIO B;  1LO5 D;  3H8H A;  2LHE A;  2K25 A;  3L10 B;  3TCA A;  4K81 A;  2D3A A;  2K9X A;  5DCN A;  1ZDV A;  3PSE B;  3BII D;  2KQS A;  2GBN A;  4YWG G;  3PRP B;  3N1X C;  5C23 A;  3L08 A;  2VZK D;  2KX0 A;  1FRR A;  5EDS A;  1YJI A;  5LXH A;  2Z0E B;  3DWM A;  4WQO B;  2IO2 B;  3D32 A;  2WXP A;  3GE8 C;  1FPY A;  1NEN B;  4IUM B;  4HEA 1;  1L0X B;  3RI7 C;  3VDZ A;  2V9H A;  4ZRK A;  3UQA A;  2MCN B;  1F77 A;  2KAJ A;  3PZ7 A;  3JW0 X;  3FKY A;  5L95 C;  3U7D A;  4XC2 A;  2KWU B;  3NVZ A;  1SE9 A;  3W1Y A;  2DYO A;  2KVZ A;  4AJW A;  4OZA A;  2I2Y A;  2SAK A;  3NUH B;  3KWV A;  5D2M B;  3RZW C;  4E71 A;  3DBL I;  2ZVN A;  3BVG A;  1ZGU B;  4WAA A;  2K3U A;  4JLC A;  4DDG D;  1P7E A;  1Q1O A;  2NMQ A;  3DQV A;  3ZNZ B;  3VRB B;  2RDG A;  1GPX A;  1ENF A;  1I4R A;  2WX1 A;  4YTN B;  3AEB B;  5KHO A;  1LQB A;  3W2D A;  1X1M A;  1FRD A;  2ASQ A;  1Z5S B;  2N0S B;  4LNN A;  3MJW A;  2RMM A;  2I1K A;  2W55 A;  4ZRI A;  4CHK A;  1WXQ A;  1SSN A;  3L0W B;  1P3Q U;  2N7E A;  2PW9 A;  1YQ3 B;  1E7P B;  2N9P C;  1TT5 B;  2LVO A;  4MDK E;  3ZO5 B;  4DHZ B;  4Q2J A;  3RNC C;  4YSZ B;  4HJK A;  2WXR A;  4N6E B;  1RFK A;  2L00 B;  2ZPY A;  2LGI A;  2CHZ A;  1UGJ A;  3AED B;  1WRD B;  1PGA A;  2L0F A;  2UU7 A;  1K8R B;  4RGM A;  2KN4 A;  3LDZ E;  4MEL A;  1KLV A;  1L7Y A;  2ZCC A;  1XCT L;  4AWJ A;  2ZVO A;  2DZI A;  4XE0 A;  4NPN A;  3Q8E A;  1R4M I;  1TKY A;  3TUO A;  2OOB B;  1J7B A;  1C3T A;  4IW0 A;  1FMA D;  3VR8 B;  2D3C A;  1Y56 A;  3ZNH B;  4DXF A;  2CS4 A;  1XCQ L;  4KGT A;  1FFU A;  1JRP A;  1T0S C;  3ML8 A;  5IAA C;  5E6J A;  3EUB 2;  2YEP B;  1V5O A;  1L5P A;  2REX A;  2K8B A;  3QX1 A;  2V3S A;  5J17 A;  3ETR A;  5JHA A;  2JWU A;  2BW2 A;  3LYY A;  3A9J A;  3VVW B;  1CJE A;  1WGY A;  2Y3A A;  4KZ0 A;  5T8I A;  3P4R B;  4G11 A;  3DVN U;  3AXC A;  3SD5 A;  2V4L A;  3ZDT A;  1HE8 A;  5D6J B;  2Q5W D;  1OQY A;  1N63 A;  2C7H A;  1WZ0 A;  2ZEQ A;  3WA0 A;  3DHH C;  1RFA A;  1F2R I;  4IDI A;  2L3Z A;  1OFF A;  1YIW A;  2WNM A;  1TZO A;  2HTM E;  5BMG A;  2MBE A;  1XD3 B;  4A3P A;  4RGT A;  1EU4 A;  2WX0 A;  3R2I A;  3FC4 A;  2LRW A;  3ENE A;  4GDK B;  1YD8 U;  1D4B A;  4OHJ A;  4XWW A;  2RDH A;  4LCD E;  4HLE A;  1XLP A;  4WQM A;  5E6N A;  2GOW A;  4YTP B;  2D11 A;  4GMV A;  3SEB A;  1HZ6 A;  2JPH A;  1RRB A;  3AEE B;  3TIX A;  4TMA B;  4USA A;  2LAS A;  4JQW C;  1I7H A;  3PPA A;  1XQQ A;  1KOT A;  1SGH A;  3ZJU A;  4XDC A;  4F8C B;  3B08 A;  4JE3 B;  2JF5 A;  3Q8B A;  4BFR A;  2FNJ B;  4B95 A;  1VD2 A;  3JYU A;  2OHF A;  1SE4 A;  4GGQ A;  3TBL D;  3ECI A;  2DAJ A;  2PEA A;  3VH4 B;  1TS5 A;  4IC7 B;  1DOX A;  4LNK A;  3T3N A;  2LFI A;  4TUU A;  2LWP A;  3NRZ A;  4HKZ E;  4WWO A;  2WWZ A;  4C4V A;  2KYW A;  1QOF A;  2W82 A;  1C76 A;  3EC8 A;  3WAL A;  1YN4 A;  3BYT B;  1V2Y A;  2LMC A;  1C79 A;  3PZ8 A;  1D5Z C;  2MBB B;  4C7Y A;  1SIF A;  2UYZ B;  1TKE A;  3PTF C;  2UWQ A;  1XLO A;  5CX3 A;  3HM3 A;  1SF0 A;  4TKN A;  3N20 C;  3RNG C;  3SHQ A;  2N9L A;  1WGD A;  2BYV E;  1HXY D;  1WGH A;  2ZJD A;  2BYT A;  4ZYS A;  2LGX A;  4M8M A;  1TY0 A;  1ESF A;  1UUP A;  4C00 A;  3ZRC A;  1YQB A;  1ZXI A;  4W9K A;  3ZRF A;  1K52 A;  1TS4 A;  1F1H A;  1WJ6 A;  5BYR A;  3VHT C;  2I1J A;  1V1O A;  3UQB A;  1QIL A;  2MJE A;  1LGR A;  2IO1 B;  1R7S A;  1NYQ A;  2LVQ A;  4EZK A;  2KDB A;  4NAW B;  5E6P A;  4KGS A;  4OW0 A;  2KDE B;  4BAX A;  1NEK B;  3HIZ A;  4ANU A;  2IND C;  2VH1 A;  1OQQ A;  4KKI A;  3EFC A;  2ZPN A;  1FXI A;  4D2K A;  1KJT A;  4TQ0 A;  3B2F A;  2ON8 A;  3OJ3 A;  4EEW A;  4KV2 A;  5BMH A;  1L2N A;  1HZ5 A;  4BKT A;  1ZPS A;  4II3 B;  2QHO A;  2Z8L A;  2CJO A;  4C56 C;  3T9L A;  1H8C A;  4YL8 A;  4AS1 A;  4M01 A;  3C8Y A;  1A5R A;  4ZYN A;  1E0Z A;  2JVC A;  2LEK A;  3ZJV A;  4XGA B;  2Y5P A;  1ET9 A;  3UGB B;  4DK5 A;  1GNU A;  2LGY A;  1MVK A;  2PVO D;  2QJL A;  1VRA B;  2KDM A;  3IFW B;  4KGR A;  3IVF A;  2DYM A;  1KLG D;  2O2V B;  2MEK A;  1E7V A;  5D7G A;  4MSQ B;  4A90 A;  2C5L C;  2NTT A;  3AMZ A;  2ZW0 A;  4BKS A;  1LXD A;  2M1M A;  4WJQ A;  3GE3 C;  1WF9 A;  3IXS A;  2V0G A;  2LXA A;  2IO3 B;  1OTR B;  1P1A A;  2AX5 A;  4R3D A;  5DPT A;  1MG8 A;  2M4N A;  1IYF A;  2CHW A;  1T0R C;  1DOY A;  2FAZ A;  3QQ8 B;  4JWS C;  1KFY B;  4K3C A;  2KAN A;  3NZ3 A;  1QKZ A;  4HRO A;  2L05 A;  4P16 A;  5JZE B;  2HJ8 A;  2RR9 A;  3J9C A;  3VUX A;  1JWS D;  1GJZ A;  3ZXR A;  1WMH B;  1V86 A;  2R61 A;  1ET6 A;  2L83 A;  3M3J A;  4A3O A;  3IAM 1;  1ZP0 B;  3M62 B;  1GB1 A;  3A9K B;  5HI1 A;  1WYG A;  3AEC B;  1WGR A;  3HM6 X;  3AE9 B;  1JQ4 A;  4FBJ B;  2AQ1 B;  1WXM A;  2GBM A;  3BK2 A;  2CHX A;  2K5P A;  2WGS A;  1V49 A;  5IKC M;  1N6Z A;  2OJW A;  1PFD A;  3ZTC A;  1NI2 A;  5J18 A;  2PMV A;  4RCO A;  2LZ6 A;  1GC6 A;  4M00 A;  2BYE A;  1SEB D;  5H92 C;  2FCQ A;  1PQS A;  3VQI A;  5KHQ A;  1VR9 A;  1TGZ B;  3HHM A;  2PVG C;  1YNT E;  2E6X A;  3NZS A;  2WQY B;  2IY0 B;  3AB5 A;  3KQ4 A;  5GMV A;  1WH3 A;  3ZLZ A;  4HK2 A;  3Q3N C;  2DZM A;  2ZNV B;  3A9J B;  1T3Q A;  1VLB A;  1JAL A;  4FHK A;  2KD0 A;  4HRS A;  3H1U A;  2QC8 A;  5EE3 A;  2IJ0 A;  3QAR A;  3VXW A;  1TKG A;  3AUL A;  3FIL A;  2WHI A;  2NBW B;  4F1S A;  5DPR A;  3PRM B;  4M02 A;  2D2Q A;  2A4Z A;  1NDD A;  3U7Z A;  2W54 A;  3A1Q A;  2FUH B;  3TEW A;  2NS5 A;  4G50 A;  2QMT A;  4K7S A;  4US8 A;  3OLM D;  1IP9 A;  4B0M A;  1XT9 B;  3PHW B;  1SE3 A;  4HJG E;  3PLU A;  3PZD A;  4YT0 B;  1ZE3 D;  4ITK A;  3AEF B;  4W9H A;  5FR3 A;  3L4P A;  3WIM A;  3QAQ A;  3ZQ4 A;  4RGO S;  3IHP C;  3MTN B;  4LDT D;  4FXC A;  2MX2 A;  1RLF A;  3NS8 A;  1UNS A;  2KDF B;  2KTF A;  4G0N B;  1F0Z A;  3NJT A;  4DHJ B;  2I38 A;  3N1Y C;  1L0Y B;  1JRU A;  3P4P B;  2CKH B;  3ABV B;  3BY4 B;  5G2N A;  1JW9 D;  2JYT A;  3ZNG C;  2ZNV C;  2RGF A;  2JZZ A;  3UIN B;  4K3B A;  4GXB A;  2BTE A;  1WMH A;  3RFZ B;  2K0P A;  4YXD B;  4LDT B;  4MAC A;  4ZHP A;  1FXT B;  2JXX A;  2GMI C;  3P63 A;  2JQR B;  2G4D B;  4QAY A;  1IBX A;  4LTU A;  1NI3 A;  2WXN A;  1XLN A;  4KSL C;  2JRH A;  5HHD G;  2KX3 A;  3HK0 A;  2LUE A;  3IT6 B;  1WJN A;  3V6C B;  3FAH A;  1SIJ A;  1G6J A;  2QIL A;  1I4H A;  3DBS A;  3W5V B;  3WAN A;  4RM9 A;  1I4P A;  3DVG X;  1FFV A;  1C4P A;  3DDC B;  1J0G A;  1KH0 A;  2TSS A;  3T3O A;  1CQV A;  1NVI D;  1QQR A;  3PV1 A;  4MEM A;  2CR5 A;  1JWU D;  4FN2 A;  4N58 A;  4IKG A;  1WFY A;  3TJP A;  1BT0 A;  3GP7 A;  1F9J A;  2IPK D;  2EKE C;  1V80 A;  3ZDM C;  1TIF A;  5HKH A;  3JSV A;  4K7W A;  2PPH A;  4FJZ A;  4ASW C;  3P2B A;  3UF8 A;  2BPS A;  4K7U A;  3GS2 A;  2LHD A;  5FR6 A;  2O2V A;  2MBO A;  3WAO A;  1TTN A;  3IBE A;  2KC2 A;  2N9X A;  4FJY A;  2WXF A;  3Q3J A;  3RNF C;  2KWD A;  1I35 A;  5EE9 A;  3LJ3 A;  3QA8 A;  1VJK A;  3TEX A;  3BVM A;  2ZW1 A;  2LVP A;  1YJ1 A;  2O6V B;  2WDR B;  2BB5 A;  2AL3 A;  3DBH B;  1YN5 A;  1UBI A;  1WGG A;  1XXG A;  4ZRP A;  2WS3 B;  5JXV A;  2FE8 A;  4NAW A;  1GC7 A;  4MJS A;  1EO6 A;  4PS7 A;  1R4N B;  2QSD A;  1WE6 A;  1L0V B;  4I6P A;  1P98 A;  2C7N B;  3AEA B;  1OQR A;  2J0K A;  3S2A A;  2ZCB A;  2DLB A;  3P42 A;  3QC8 B;  1B9R A;  2DEN B;  1I42 A;  2K6Q A;  3VR9 B;  3AU5 A;  2YLM A;  3HUI A;  2D10 A;  4IOI E;  1E8X A;  1QT9 A;  3E9S A;  4BBN C;  2PLP A;  1WR1 A;  5LLI A;  3RN9 C;  5IP4 D;  3R8B A;  1WYW B;  4M0W B;  1M94 A;  2MHJ A;  4BBN F;  2JX5 A;  1KM7 A;  1T0Q C;  4KDI C;  5JH5 C;  3MC0 B;  4C4V B;  1MI0 A;  4RNA A;  3IT4 B;  1FM0 D;  4G3X B;  3QIJ A;  3RNB C;  2JSV X;  1IGC A;  2IDY A;  2LI5 A;  1T6B X;  2NBU A;  4GN1 A;  4L23 A;  1GOZ A;  1RAX A;  2J0M A;  3SFE B;  1AAR A;  1V81 A;  2XK5 A;  3A4S C;  4A55 A;  1E7U A;  3H9D A;  2BF8 B;  2D5G A;  1CMX B;  3MC9 A;  2KLC A;  2KKC A;  1ZKH A;  2WLB A;  3I5J C;  3KYC D;  5IA7 A;  1OGW A;  1GUA B;  3NVY A;  1WJ4 A;  2AL6 A;  4AQ7 A;  3MP9 A;  3NS1 A;  4NQK E;  1EF5 A;  4DHZ E;  4X57 B;  3K9O B;  3U30 A;  2BWF A;  4JIO U;  4KIK B;  3AI5 A;  5D3D A;  1E90 A;  1UBQ A;  1D3Z A;  1WJU A;  2LJI A;  2K8C A;  3FIL B;  3KH0 A;  2KWC A;  1E9M A;  2IZV B;  3AE7 B;  3CMM B;  1AW7 A;  2G1E A;  1NYR A;  1WM2 A;  2INN E;  1FCC C;  4YSY B;  4RF0 A;  3V61 A;  3CIR B;  3TL5 A;  2M17 A;  3ZJT A;  4ANW A;  3TMP B;  1ACC A;  4NQL B;  2N1W A;  4LK0 M;  1P9D U;  5D3I B;  1WX8 A;  3PRZ A;  4KKJ A;  1N5W A;  1ZUD 2;  3AM9 A;  3EHV A;  1J19 A;  3UI3 A;  2KK8 A;  4ZRQ A;  2DZK A;  5CHV C;  2WU2 B;  2GBR A;  3N30 A;  4NJ7 A;  2PTL A;  4DHJ D;  1E8Z A;  3Q14 C;  2M8S A;  3H7P A;  2N7D A;  4C7Z A;  2E3T A;  3URY A;  1TJE A;  3BVZ A;  4NY0 A;  4RF1 A;  2FCM A;  4W9I A;  4PS8 A;  4ARC A;  4LJO B;  5LNK 1;  4EKU A;  4O1N A;  3DVG Y;  1E8Y A;  4N9F 4;  3U52 E;  5C3J B;  1I4Q A;  4KZC A;  2NTS A;  4PYU A;  2L76 A;  2WDT B;  2KJ6 A;  1Q0W B;  1V97 A;  4HCN B;  3KLS X;  1K51 A;  2AYO B;  4EZL A;  4ICV A;  3B0A A;  1YQ4 B;  3RPF C;  5LXI B;  4WUR A;  1L4D B;  3OAW A;  2GRI A;  2BVC A;  1P0R A;  1D5M C;  1QOB A;  1YMH E;  1WGK A;  2BS3 B;  4ANV A;  4ARI A;  3NOB A;  4BVU C;  1SJE D;  2MP2 A;  4WJN A;  4A9A A;  1FXA A;  2C7M B;  4M8N A;  4BKG A;  1ZXH A;  4B9K A;  4XYC A;  4C80 A;  3JSV B;  1ZW7 A;  2RSU A;  1GAQ B;  2QCZ A;  3B9J A;  4L2Y A;  1FNU A;  2JYE A;  1P7F A;  2PJH A;  1JWM D;  2K8H A;  2KQ7 A;  2WXQ A;  1DYQ A;  2RD0 A;  1WE7 A;  2IGG A;  4KX6 B;  5J2R A;  3PLV A;  1IUE A;  2BBC A;  1A70 A;  3DHG C;  3IG3 A;  4RM8 A;  4F7Z A;  1QLB B;  1Q10 A;  1UF0 A;  5C1Z A;  4AP4 C;  2EMT A;  4MGY E;  4HPP A;  2N7J A;  1KLU D;  4HPL B;  4S0R A;  3Q3M C;  1RWS A;  4I6N B;  1QOG A;  2WYQ A;  3O13 A;  2L1A A;  4MH0 E;  3APF A;  2KQ4 X;  2XK5 B;  3KUZ A;  4PT5 A;  5AZH A;  2BQQ A;  4II2 B;  4WJO A;  1Y8R C;  4ICU A;  2FCN A;  1EWY C;  2M56 B;  4W9J A;  2H89 B;  1V9J A;  4WAF A;  2WXK A;  1DOI A;  2J4X A;  4EZJ A;  3B2G A;  3KYD D;  2WXL A;  4PS3 A;  1WY8 A;  2JZ3 B;  4P6V F;  1MPE A;  4B6W A;  1FIQ A;  2C9W B;  1E5W A;  1V1P B;  1IPG A;  4RFB A;  1I4G A;  2WXJ A;  4E3C A;  3MC8 A;  3CST A;  4HVB A;  3NVV A;  2NR2 A;  1SJH D;  3U2S C;  3H6N A;  4ZOH C;  4XDD A;  3BK1 A;  1QZE A;  2BB6 A;  1V8C A;  4JL9 A;  5HG2 A;  2GBJ A;  2MWS B;  3AE8 B;  3AE2 B;  1WX7 A;  1BUI C;  1LFD A;  1OEY A;  5GXG B;  3A4R A;  5IO9 A;  4NJ6 A;  2NPT B;  2R2Q A;  3RZF A;  4AUQ C;  4DQO C;  3DOW A;  4LNF A;  4OVZ A;  2D3B A;  4W9G A;  4W9L A;  4WH4 A;  4BOZ B;  1XEE A;  4HWI B;  2QEJ C;  2HE7 A;  3RUI B;  4MSM B;  1UGM A;  4RMA A;  2M0A A;  2KFK A;  5E6O A;  1J8C A;  3H7P B;  2BKR B;  4DWF A;  3LXF A;  5AUI A;  2IO0 B;  3ZTD A;  3APD A;  1WM3 A;  2HJ1 A;  3AU4 A;  2IYD B;  2LGD A;  4MM3 A;  3SR6 A;  1BXT A;  4A8X C;  4YSX B;  4J3O D;  1E6E B;  1MHH E;  2J7Q B;  2N4F A;  2WDQ B;  5EE1 A;  2G9H D;  1C77 A;  2YEP F;  3VUW A;  4TQ1 A;  2N1V A;  4LNI A;  5FKA C;  4NAM A;  4IWP A;  3ZVV A;  2B76 B;  4GLS C;  1B1Z A;  3IAS 1;  2FID A;  3Q6B A;  4OZC A;  3T8M A;  2MW5 A;  2XBB C;  3DBR B;  2KZR A;  1EUV B;  2BGF A;  4RGN A;  5CHW A;  1XF5 L;  1UZX B;  3EGR A;  3KVF B;  4WJP A;  3LB8 C;  2MLB A;  5G5H A;  5TR5 A;  5BYS A;  4J6I A;  2MJ3 A;  3N1Z C;  2MP2 B;  2MBH A;  3QWZ B;  2O6V A;  2Y5B B;  1NBF C;  3W1S A;  3DVN V;  2KFK B;  1TS3 A;  2WDV B;  1WZ3 A;  3PGE A;  3V60 A;  1KTK A;  4MH8 A;  1WRI A;  3SU8 X;  3HRD D;  3BYY B;  2G45 B;  2QDF A;  5AUK A;  3OJ4 B;  3AV8 A;  3AEG B;  4PYZ A;  4LJP B;  4DXA B;  3KUC B;  2MSE D;  1STE A;  1UD7 A;  3PO0 A;  3VH3 B;  2KOX A;  3AE6 B;  2KDI A;  2ACZ B;  2WXH A;  4GB9 A;  2KMA A;  1QOA A;  3L17 A;  4IWQ A;  5C2T B;  2B3A A;  4OZB A;  2IGD A;  2L0T A;  4NNJ B;  2LXC A;  4JPS A;  1AYF A;  1HTO A;  3L16 A;  1FEH A;  2PE6 B;  3H7S A;  2W9N A;  3DCG A;  1H4R A;  2DX5 B;  3BZD B;  4CYE A;  1V1P A;  4XX5 A;  2DZJ A;  2WP9 B;  4P7I A;  2M0X A;  2KMC A;  3MHZ A;  1MHX A;  1EF1 A;  3E56 A;  3EFU A;  3R7Q A;  4EOY A;  3NVW A;  1Q5W B;  1WWT A;  4K1R B;  2KWV B;  5IOI A;  4WIP A;  2VRR B;  3DHI C;  1PGB A;  1UWX A;  5DPW A;  3AE3 B;  3RCZ A;  3W5U B;  4FA6 A;  1EWC A;  2AWT A;  2WXG A;  1FNV A;  3RT3 B;  3UIP B;  3WAP A;  3MFG A;  1WI0 A;  1WIA A;  3U8Z A;  5MPO A;  4CQN A;  1K50 A;  2GI9 A;  2KTR A;  1N61 A;  1K53 A;  2J0J A;  4REZ A;  3SFD B;  2MQJ A;  3V05 A;  5JHB A;  2W3S A;  4GDL B;  1IBX B;  2PKO A;  1SXT A;  2IBI B;  3X0W A;  4P1C C;  4OVU A;  4GIV A;  1RYJ A;  4HDO A;  3KWL A;  5IN7 A;  3MJ5 A;  2V4I B;  1VZ7 A;  2CU1 A;  4L1B A;  2ONQ A;  4BOS C;  3ZYY X;  4MGZ E;  2O6V D;  2PE9 A;  4PK1 A;  1PYW D;  1MG4 A;  2CU3 A;  2DHZ A;  1ZDX A;  5D94 A;  4URK A;  3L54 A;  3NZU A;  4FJV B;  1FCL A;  4IM0 A;  1TS2 A;  3CWI A;  1JWB D;  2KN5 A;  2KC1 A;  1GB4 A;  1JCK B;  5FK9 C;  2DWQ A;  1HEZ E;  2HDE A;  1VCB A;  1M4V A;  3BIN A;  1TY2 A;  3I3T B;  3GZN B;  4GSW A;  2KJR A;  4YTM B;  4NZL B;  3R66 C;  1CK1 A;  4IM2 A;  3DBL B;  2BS2 B;  3CSF A;  2NBV B;  4W9D A;  2D07 B;  2DBY A;  3Q8A A;  2J53 A;  4HCP B;  5L83 A;  2W3R A;  4ZHO A;  1FO4 A;  1OEY J;  3ZKJ C;  4AJY B;  3CF6 E;  4ZRJ A;  2MA9 B;  3R3M A;  5AZF A;  4A20 A;  2L7R A;  2V1Y A;  2L32 A;  2N9K A;  5CTR C;  2KLG A;  2KNB A;  1RM6 C;  1Z2M A;  2QIE B;  4M0W A;  3A33 B;  3ML9 A;  1SBB B;  3PRE A;  3AE5 B;  3OG5 A;  1U4A A;  2WU5 B;  1C1Y B;  1WSP A;  2BYF A;  1HTQ A;  4A6Q A;  1ISN A;  4KVG B;  1FNW A;  1SB3 C;  1UEL A;  1E10 A;  3RNA C;  3DBR I;  2XN9 C;  4WWN A;  1EU3 A;  2M19 A;  2A5U A;  4FUL A;  4AOF A;  2ICI A;  1I4X A;  3QK0 A;  3AE1 B;  4HDQ A;  2FCS A;  5EE0 A;  4KSK C;  2R2O A;  2V3P A;  2N9E B;  3KW5 B;  3VAW A;  1AWD A;  3VFK A;  4W9F A;  1S3S G;  4TV3 A;  4MT5 A;  2GBK A;  2C60 A;  1TYG B;  4ACF A;  3PHX B;  4CO7 A;  4BKS D;  4LNO A;  3K9P B;  2XEW A;  3AN1 A;  2Z0D B;  1YJJ A;  1ZOY B;  1FD6 A;  2D3G A;  1PDX A;  3GOE A;  3APC A;  1SE2 A;  1XLQ A;  3P4S B;  2LRU A;  3P1M A;  3X23 A;  4FLH A;  1C4C A;  2IY1 B;  4DBG A;  3U4E G;  2KT7 A;  1KF6 B;  1L6U A;  3M95 A;  3QCA A;  3V6E B;  3VTW A;  1PGX A;  2JZP A;  2GB1 A;  4KIK A;  3V62 A;  1CZP A;  2JU6 X;  3B1L X;  1N60 A;  2KMM A;  2MRP A;  1YN3 A;  4NJC A;  3QHT A;  4E74 A;  2KJH B;  1GG3 A;  4OVV A;  2HD5 B;  1V6E A;  1N62 A;  2K39 A;  4DDI D;  2G4S A;  4DXG A;  1D6E C;  2H88 B;  4TSS A;  3RYT A;  2GLS A;  2K6D B;  3V3X A;  3PT2 B;  4UDU C;  2KXJ A;  2MBQ A;  2AQ3 B;  4N59 A;  3EEC A;  3HVZ A;  2LUM A;  5I4D A;  2JXT A;  2OED A;  2FUG 1;  1C9F A;  3A1Q B;  3ALB A;  5BO4 B;  2RPV A;  3L13 A;  3TEY A;  3KUD B;  3Q2A C;  4US9 A;  1HA5 A;  1J7A A;  2RPQ A;  2G3Q B;  1C4A A;  1QF6 A;  4JGH B;  4S17 A;  4ZDV A;  5DPS A;  3ZNI D;  1YX5 B;  3VTV A;  4LLG M;  2WXI A;  3I57 A;  1WXV A;  2BS4 B;  2NVU I;  1R4N I;  2KTR B;  4KDL B; 
#chains in the Genus database with same CATH homology
 2MH7 A;  1XLP A;  2IPK D;  4WQM A;  2EKI A;  1EM7 A;  1HQR D;  1JWA D;  4DQO C;  1DGJ A;  4YTP B;  4MM3 B;  3SEB A;  1HZ6 A;  4OVZ A;  3N9Y C;  3GS2 A;  4WH4 A;  5TSS A;  2LHD A;  1XEE A;  2QEJ C;  3AEE B;  4TMA B;  4USA A;  5H8Y E;  1I7H A;  4EE2 A;  2M0A A;  3OWE B;  3ZJU A;  4XDC A;  3W9C B;  2K22 A;  3LXF A;  5AUI A;  3AH7 A;  2WXF A;  2BT6 A;  2KWD A;  4JE3 B;  2WXM A;  4JWU C;  5EE9 A;  3Q8B A;  1VJK A;  3TEX A;  4B0E A;  3BVM A;  2OHF A;  1SE4 A;  4JX1 C;  2ZW1 A;  3SR6 A;  1KRH A;  2WXO A;  3P4Q B;  1BXT A;  1AN8 A;  4A8X C;  1TS5 A;  2WDR B;  4J3O D;  2BB5 A;  1E6E B;  1MHH E;  2WDQ B;  5EE1 A;  4YSX B;  1DOX A;  2G9H D;  1C77 A;  3EA6 A;  1YN5 A;  2YEP F;  3T3N A;  4TQ1 A;  2LFI A;  3NRZ A;  5FKA C;  4HKZ E;  4NAM A;  2V3N A;  1XXG A;  4ZRP A;  2WS3 B;  5JXV A;  2FE8 A;  2B76 B;  1QOF A;  2W82 A;  4GLS C;  1B1Z A;  1C76 A;  4WWM A;  3IAS 1;  3Q8F A;  4OZC A;  1YN4 A;  3BYT B;  2LMC A;  2QSD A;  1C79 A;  3PZ8 A;  1VZ6 A;  1D5Z C;  4RGN A;  2J42 A;  1VZ8 A;  2X38 A;  1XF5 L;  1L0V B;  2MJD A;  3WCQ A;  4C7Y A;  3EGR A;  1TKE A;  1C78 A;  3AE4 B;  3LB8 C;  4RH6 A;  1XLO A;  3AEA B;  5G5H A;  2J52 A;  2EEL A;  1OQR A;  5BYS A;  1SF0 A;  2MJ3 A;  5HFY A;  2DLB A;  2N9L A;  3Q8C A;  3P42 A;  3TSS A;  2FBW B;  1HXY D;  3ZGZ A;  1B9R A;  2BYT A;  4ZYS A;  3W1S A;  3VR9 B;  1TS3 A;  2WDV B;  3HUI A;  1TY0 A;  1KTK A;  4MH8 A;  1WRI A;  1ESF A;  1ROE A;  2INP E;  1UUP A;  2Y5C A;  3HRD D;  3BYY B;  4IOI E;  1ZXI A;  5AUK A;  4HKQ A;  2CJN A;  1K52 A;  1TS4 A;  1QT9 A;  3AV8 A;  3E9S A;  5BYR A;  2PLP A;  3AEG B;  1V1O A;  1STE A;  3PO0 A;  1QIL A;  2MJE A;  1N5X A;  3R2T A;  3VRA B;  3R8B A;  3AE6 B;  2ACZ B;  1PUT A;  2WXH A;  1R7S A;  3HVD A;  1NYQ A;  2KAC A;  1QOA A;  2VZK B;  2JX5 A;  5C2T B;  4NAW B;  4KGS A;  4OW0 A;  3MC0 B;  4XWT A;  2SEB D;  1MI0 A;  1F2R C;  4OZB A;  1NEK B;  4RNA A;  3IT4 B;  2IGD A;  1OQQ A;  4KKI A;  4JPS A;  1AYF A;  2IGH A;  1FM0 D;  1FXI A;  2AQ2 B;  1FEH A;  4D2K A;  4TQ0 A;  3B2F A;  2JSV X;  1IGC A;  2ON8 A;  3BZD B;  1JML A;  1V1P A;  3TEZ A;  2IDY A;  1J7C A;  5BMH A;  1T6B X;  1D5X C;  1HZ5 A;  2WP9 B;  3BWU D;  4L23 A;  1GOZ A;  5G5G A;  1ZPS A;  3MHZ A;  1MHX A;  2Z8L A;  3E56 A;  1L4Z B;  1XO3 A;  3NVW A;  1WWT A;  5BYQ A;  3SFE B;  2CJO A;  2L52 A;  4C56 C;  4WIP A;  4A55 A;  4AS1 A;  1PGB A;  1T5X D;  1UWX A;  3AE3 B;  3C8Y A;  3Q69 A;  1BML C;  3W5U B;  1EWC A;  2WXG A;  2D5G A;  1FNV A;  1E0Z A;  1IGD A;  2LEK A;  3GB1 A;  3ZJV A;  3MFG A;  2Y5P A;  1ET9 A;  2WLB A;  5MPO A;  2PIA A;  4CQN A;  1MVK A;  1K50 A;  2PVO D;  3NVY A;  4H2A A;  2GI9 A;  2QJL A;  1VRA B;  1N61 A;  1K53 A;  2KDM A;  4REZ A;  3SFD B;  3V05 A;  5BMI A;  4KGR A;  4AQ7 A;  2DYM A;  1KLG D;  2W3S A;  4GDL B;  1IBX B;  3MP9 A;  2PKO A;  3NS1 A;  2MEK A;  1SXT A;  1UWM A;  3I9V 1;  5D7G A;  4A90 A;  1RYJ A;  3KWL A;  3DWG C;  1JRO A;  2V4I B;  3MJ5 A;  2NTT A;  1VZ7 A;  4L1B A;  5D3D A;  2ONQ A;  3AMZ A;  2ZW0 A;  3ZYY X;  2LJI A;  3FIL B;  1E9M A;  3AE7 B;  1AW7 A;  2XNA C;  1VDV A;  1L6V A;  2G1E A;  3IXS A;  2V0G A;  1LO5 D;  1NYR A;  1PYW D;  2CU3 A;  1ZDX A;  2LHE A;  3H8H A;  2AX5 A;  4R3D A;  2INN E;  1FCC C;  1FCL A;  2K9X A;  4YSY B;  4RF0 A;  3CIR B;  1TS2 A;  3CWI A;  1JWB D;  3ZJT A;  1ZDV A;  1DOY A;  3BII D;  1ACC A;  1JCK B;  5FK9 C;  1GB4 A;  2DWQ A;  4JWS C;  1KFY B;  4YWG G;  1HEZ E;  2HDE A;  3NZ3 A;  1QKZ A;  4HRO A;  4P16 A;  2VZK D;  3J9C A;  1M4V A;  1FRR A;  4LK0 M;  1YJI A;  5D3I B;  1TY2 A;  4YTM B;  1JWS D;  4NZL B;  4KKJ A;  1CK1 A;  1N5W A;  1ZUD 2;  3AM9 A;  3DWM A;  2BS2 B;  3UI3 A;  4ZRQ A;  2R61 A;  1ET6 A;  2L83 A;  3IAM 1;  2WXP A;  1ZP0 B;  2WU2 B;  1GB1 A;  5HI1 A;  1WYG A;  2DBY A;  1NEN B;  3Q8A A;  3AEC B;  2J53 A;  4HEA 1;  3AE9 B;  1L0X B;  1JQ4 A;  2AQ1 B;  2PTL A;  2W3R A;  3BK2 A;  4ZHO A;  1FO4 A;  2K5P A;  4C7Z A;  1F77 A;  2KAJ A;  3PZ7 A;  2E3T A;  1PFD A;  3URY A;  1TJE A;  2PMV A;  3BVZ A;  4RCO A;  4RF1 A;  3NVZ A;  2DYO A;  4ARC A;  1SEB D;  4OZA A;  2L32 A;  2SAK A;  5H92 C;  2I2Y A;  5LNK 1;  2N9K A;  3NUH B;  3KWV A;  4O1N A;  5C3J B;  3U52 E;  3VQI A;  1VR9 A;  1I4Q A;  3BVG A;  2PVG C;  1RM6 C;  1YNT E;  2E6X A;  2QIE B;  4M0W A;  2WQY B;  3AB5 A;  3KQ4 A;  2NTS A;  2K3U A;  1SBB B;  1V97 A;  3AE5 B;  3KLS X;  1P7E A;  1K51 A;  1T3Q A;  1VLB A;  1YQ4 B;  2NMQ A;  3VRB B;  2RDG A;  2WU5 B;  1JAL A;  1WSP A;  1GPX A;  4HRS A;  5EE3 A;  4A6Q A;  1FNW A;  1ENF A;  1I4R A;  2IJ0 A;  1TKG A;  1SB3 C;  4YTN B;  3AEB B;  1E10 A;  3FIL A;  3RPF C;  2XN9 C;  3W2D A;  4WUR A;  1L4D B;  1EU3 A;  1FRD A;  2M19 A;  2ICI A;  2N0S B;  1I4X A;  2GRI A;  1YMH E;  1D5M C;  1QOB A;  1WGK A;  2BS3 B;  2RMM A;  4ARI A;  3AE1 B;  3U7Z A;  2W54 A;  1SJE D;  4A9A A;  5EE0 A;  2V3P A;  1FXA A;  3TEW A;  1ZXH A;  2W55 A;  1WXQ A;  4C80 A;  2QMT A;  1AWD A;  1SSN A;  4US8 A;  2PW9 A;  1GAQ B;  1YQ3 B;  4MT5 A;  4B0M A;  1TYG B;  3B9J A;  1E7P B;  4L2Y A;  1FNU A;  1SE3 A;  2JYE A;  3AN1 A;  4HJG E;  1P7F A;  1YJJ A;  4YT0 B;  1ZOY B;  1ZE3 D;  4ITK A;  1FD6 A;  1JWM D;  1PDX A;  3AEF B;  4Q2J A;  1SE2 A;  1XLQ A;  5FR3 A;  2WXQ A;  3L4P A;  3P4S B;  4YSZ B;  2WXR A;  1DYQ A;  4N6E B;  3P1M A;  1RFK A;  3ZQ4 A;  2LGI A;  2IGG A;  1UGJ A;  4RGO S;  4KX6 B;  1C4C A;  3AED B;  1IUE A;  2BBC A;  4FXC A;  1A70 A;  3U4E G;  1PGA A;  1KF6 B;  1L6U A;  1PGX A;  1UNS A;  2JZP A;  4RGM A;  1QLB B;  2GB1 A;  2KN4 A;  1F0Z A;  1CZP A;  2I38 A;  1XCT L;  1Q10 A;  1L0Y B;  2JU6 X;  3P4P B;  3ABV B;  1N60 A;  2KMM A;  4XE0 A;  1YN3 A;  3Q8E A;  1JW9 D;  2JYT A;  1TKY A;  2N7J A;  1KLU D;  4NJC A;  3TUO A;  1J7B A;  1RWS A;  1QOG A;  1FMA D;  3VR8 B;  3O13 A;  1Y56 A;  4DXF A;  2L1A A;  2BTE A;  1XCQ L;  3RFZ B;  2K0P A;  4YXD B;  4KGT A;  4MAC A;  1FFU A;  1N62 A;  4ZHP A;  2KQ4 X;  3P63 A;  4DXG A;  1D6E C;  2H88 B;  4PT5 A;  4TSS A;  1JRP A;  2JQR B;  1EWY C;  5E6J A;  2M56 B;  3EUB 2;  3V3X A;  2YEP B;  4LTU A;  4UDU C;  1IBX A;  1L5P A;  2AQ3 B;  1NI3 A;  2WXN A;  2H89 B;  1XLN A;  3ETR A;  4WAF A;  4N59 A;  2JWU A;  5HHD G;  2WXK A;  2BW2 A;  1DOI A;  2J4X A;  3LYY A;  3B2G A;  1CJE A;  3HVZ A;  3IT6 B;  2WXL A;  2Y3A A;  2LUM A;  5I4D A;  2JXT A;  2OED A;  1MPE A;  2FUG 1;  4P6V F;  3FAH A;  5T8I A;  1SIJ A;  3P4R B;  1C9F A;  1FIQ A;  1V1P B;  2RPV A;  3TEY A;  4RFB A;  2QIL A;  1I4G A;  2WXJ A;  2Q5W D;  1I4H A;  1N63 A;  3NVV A;  3W5V B;  1SJH D;  4US9 A;  3U2S C;  1HA5 A;  1F2R I;  4IDI A;  4ZOH C;  1I4P A;  1J7A A;  3BK1 A;  4XDD A;  1FFV A;  1C4P A;  1OFF A;  2WNM A;  2BB6 A;  1C4A A;  2HTM E;  1TZO A;  1V8C A;  1KH0 A;  5HG2 A;  5BMG A;  2TSS A;  3AE8 B;  1QF6 A;  3AE2 B;  3T3O A;  4RGT A;  1CQV A;  1BUI C;  1EU4 A;  1NVI D;  1QQR A;  3FC4 A;  3R2I A;  4LLG M;  4GDK B;  1JWU D;  2WXI A;  3I57 A;  4N58 A;  5GXG B;  2BS4 B;  4IKG A;  4OHJ A;  1D4B A;  4XWW A;  2RDH A;  3GP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...