2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0895
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
3W5UB 1I7HA 1XLNA 3SFEB 2WS3B 1JW9D 1XLQA 1QT9A 1FM0D 3FC4A 2PVOD 5AUIA 4C80A 1R7SA 1QF6A 3AMZA 3EUB2 1WYGA 1SB3C 2WDRB 1PDXA 2WDQB 1OQRA 3VR9B 1PUTA 1NEKB 1VDVA 4P6VF 1FRRA 2JX5A 2CJNA 2PVGC 2M56B 3AN1A 3B2GA 4A9AA 3RPFC 1RM6C 1FXAA 2MH7A 1TKGA 3AE5B 1PFDA 2N0SB 3VR8B 2JQRB 2ACZB 1V97A 1NYQA 3PO0A 4JX1C 1E0ZA 2PKOA 2BS2B 3B2FA 2BS4B 2BT6A 3AEAB 1JWAD 2WDVB 1SF0A 1TYGB 4YTNB 1CJEA 3SFDB 1N5WA 1L6UA 1TJEA 3P4SB 3AM9A 1AWDA 5C2TB 3NVWA 3P4PB 1VLBA 5EE9A 1FRDA 1YQ4B 5MPOA 3CIRB 3NVZA 2K5PA 3AEBB 3W5VB 4ZHPA 3P4RB 5G5GA 3AECB 2BS3B 4FXCA 1DOYA 1YJJA 4JWSC 4US8A 3AE9B 1L5PA 1QOFA 2DWQA 2W3RA 3AEGB 1L6VA 4WQMA 1ZXIA 3VRAB 5C3JB 2WU2B 1ZUD2 1DOIA 1OFFA 2LEKA 2MJ3A 3LB8C 2H89B 1E6EB 1DGJA 2K9XA 3DWMA 4YT0B 2CU3A 3HUIA 1J7CA 1XLOA 2WQYB 3AEEB 3NVYA 1JWBD 1QLBB 1F0ZA 4ZOHC 2DBYA 1JALA 1A70A 1ZP0B 3AE8B 1AYFA 1RWSA 2B76B 2EKIA 2WP9B 3WCQA 5H8YE 3CWIA 5EE0A 3HRDD 3ETRA 1JROA 4C7YA 1FIQA 1N5XA 1N60A 2WU5B 4WWMA 1FO4A 4N58A 2FBWB 1N63A 2PIAA 1WRIA 1NI3A 3P1MA 1FFVA 3DWGC 2H88B 2AX5A 1JRPA 1V8CA 3AV8A 3AEFB 3KWLA 1L0VB 1OQQA 4YSYB 2K22A 4ZHOA 1QOBA 1E9MA 1KRHA 2QIEB 1J7BA 2WLBA 3B9JA 4US9A 4C7ZA 1NYRA 3AE7B 4ITKA 1KFYB 1ZOYB 4N6EB 3ZYYX 3AB5A 2M19A 3P63A 3AE2B 4YTPB 5H92C 3BIID 2W54A 4YSXB 1EWYC 1XLPA 2QJLA 2Q5WD 4LTUA 1VJKA 5AUKA 1N61A 2G1EA 1RFKA 3L4PA 3NVVA 4HROA 1QOGA 1DOXA 1SIJA 5EE3A 4YSZB 1XO3A 3AE4B 1T3QA 4N59A 1GPXA 3AE6B 3VRBB 1TKYA 1WGKA 3AEDB 3P4QB 3FAHA 2KAJA 2KMMA 4IDIA 1N62A 1E10A 3W9CB 2HTME 3AH7A 2L52A 1J7AA 1IUEA 1KF6B 1RYJA 1YQ3B 2CJOA 2MJEA 4USAA 3SR6A 1E7PB 5EE1A 1FXIA 1WWTA 1CZPA 2W3SA 2Y5CA 4YXDB 3NRZA 3LXFA 4JWUC 2W55A 1UWMA 1YJIA 3HVZA 3NS1A 1WXQA 1FMAD 4KX6B 1JQ4A 1ROEA 2L83A 4YTMB 1B9RA 1FFUA 1NENB 3AE3B 1QOAA 1TKEA 1GAQB 1NVID 2E3TA 2OHFA 5G5HA 5GXGB 3AE1B 3ABVB 2MJDA 4HRSA
chains in the Genus database with same CATH superfamily
2BQQA 2LASA 4ARIA 2PVOD 2KACA 3L17A 4NNJB 5T8IA 3RUIB 3LJ3A 2CJNA 4A9AA 1K52A 3FILB 3QK0A 1SSNA 1D6EC 2G9HD 2JZZA 2KO3A 2RSUA 3DCGA 3MJ5A 4HPMB 4IWPA 1U4AA 3Q3OC 3BYYB 2INNE 4MGYE 3TSSA 3AECB 1TBEA 3BWUD 3K9OB 5BMHA 1F2RC 3ZRCA 2L76A 3DWMA 1XEEA 1GC7A 1HXYD 5LNK1 3LDZE 4HVBA 3EC8A 5H8YE 2KC2A 4PS3A 4WWMA 4NY0A 1N63A 2PIAA 1ZPSA 1C9FA 4OVVA 2GOWA 4HEA1 2V3SA 1Q5WB 4ZHOA 1TS2A 1E9MA 1KRHA 2DX5B 4KGSA 1J0GA 2DYBA 3DBSA 2C9WB 2G1EA 3GE3C 1QOGA 4A8XC 1E8XA 3QCAA 4RMAA 3H7SA 5E6JA 3WAPA 4W9JA 4GDKA 2N7JA 1V1PA 4LNIA 1KF6B 1WGDA 1RYJA 1UZXB 3URYA 1NBFC 1FXIA 4MSMB 3AXCA 3RNCC 3H1UA 1GB1A 4P1CC 2LJ5A 1WXSA 3VH4B 3VQIA 2MJDA 4K3CA 4H2AA 2M0AA 4CQNA 2QMTA 5GMVA 3UINB 4B9KA 1WM3A 5I4DA 4DK5A 2QHOA 3H8HA 2ACZB 2J0JA 2PKOA 3PHWB 2Y5BB 2QSDA 2V1YA 3RZWC 4ASWC 4ZRJA 3NVZA 4BZAA 3P4RB 4MH0E 4REZA 5C23A 5BYRA 2CKHB 3DHHC 2EMSA 4I6PA 2DLBA 2RDGA 5AZFA 2XK5A 3AEEB 3ZXVA 1MPEA 4JQWC 1ZP0B 2JT4B 4NJ6A 4A3OA 2BF8B 2C7NB 1FIQA 2FCNA 2RD0A 4LNKA 1I4HA 2BYTA 4IW0A 2REXA 1TS5A 3KWLA 1GC6A 3TEWA 2MX2A 1ZOYB 4GDLB 2KANA 4ZRQA 3VUYA 1EWYC 3RNAC 2INPE 4IM3A 4XWWA 3MC0B 2KDIA 2K8CA 4MSQB 3U7ZA 3M63B 3BK1A 2KMMA 2X8XX 4D2KA 2LVQA 2OEDA 4PS8A 3JVZX 2JUOA 1MHHE 1WX9A 1TZOA 4WQOB 1E7PB 1VZ8A 2LUEA 4YXDB 4KX6B 5J18A 5IOIA 1SXTA 3IBEA 2WX0A 1XLNA 4PYZA 3DHIC 4LK0M 3AE5B 2ZW0A 1K53A 5D7GA 4YTNB 4RCOA 3SFDB 4KIKA 2MCNB 3Q3FA 5EE9A 2LD9A 1JWUD 3ALBA 2K8HA 1WX7A 3VDZA 2LI5A 4L2YA 3NG0A 3AEGB 3ZTCA 4BOZB 1H8CA 1OFFA 2GMIC 1UGMA 1ET9A 1SE9A 3D32A 1GOZA 2IO1B 2ZVNA 4ZOHC 4KDIC 4ANVA 2KWDA 3IAM1 2IBIB 3GB1A 1JROA 1QKZA 3Q3MC 1HA5A 3VHTC 1JRPA 2G45B 4WWOA 2D3AA 1XQQA 4US9A 2LHDA 3TEXA 2KDMA 4JIOU 3DOWA 2NR2A 2QJLA 3IT4B 3L08A 1T5XD 2KN5A 3AE4B 4DQOC 4MGIE 3S2AA 1HE8A 3RYTA 3PV1A 2PEAA 4A55A 3P42A 4MGZE 4FULA 2CHXA 2W3SA 1CZPA 3HHMA 1I4RA 3RT3B 4ZRIA 1NENB 2GRIA 4A20A 3ZNZB 3QHTA 3SD5A 4TV3A 4JE3B 3RN9C 1EF1A 4W9CA 2ZCCA 2FCMA 2O6VD 3VR9B 2JRHA 2WYQA 1E7VA 2MLBA 4NJCA 3LYYA 1TYGB 2L00B 2DENB 1R4NI 3IHPC 2QDFA 4RF0A 4W9FA 1YQ4B 2K5PA 4LCDE 4YWGG 2WXFA 1TIFA 4US8A 1L7YA 5TR5A 1QOFA 2LXCA 1WM2A 3VUWA 3RNGC 3NUHB 1DOIA 5L83A 2MJ3A 4GN1A 1RRBA 2DZIA 2QEJC 4IM0A 3SEBA 1WGRA 3AE8B 4OZBA 3HRDD 1C76A 2JWZA 4G0NB 2W82A 1FNWA 2W9NA 3NJTA 2WXGA 4HWIB 2BB6A 2MWSB 1L0XB 3KUDB 2KTRB 2WXIA 3P63A 3BK2A 4FBJB 1C4CA 4XC2A 4XZ4A 3Q8EA 1WSPA 3RCZA 3R66C 4LNOA 1JCKB 3I5JC 2JU6X 4AJYB 1YQ3B 2NTTA 1WWTA 2L0FA 2KOXA 3Q3JA 2W55A 3NZSA 2L83A 1B9RA 2RPQA 3N30A 3AE1B 1C3TA 2WS3B 3VFKA 2N7EA 3EFCA 4DDID 1QF6A 1V86A 2JF5A 1GJZA 2HJ1A 3ZTDA 1E90A 4P6VF 2JX5A 1WJNA 1WXVA 3PZ8A 1FXAA 1YX5B 2OOBB 1PFDA 1F2RI 4AQ7A 1PQSA 2NBUA 2NPTA 2LZ6A 2Y3AA 1SF0A 2K0PA 2WX1A 2R2QA 3NVWA 3KYDD 1FRDA 1BXTA 3ECIA 2VZKD 3V60A 4AJWA 2KN4A 1M4VA 1WYWB 5D94A 3R7QA 4DBGA 4II3B 1OTRB 1ZXIA 2RGFA 3MFGA 4WH4A 4HK2A 1YX6B 1ZKHA 5BO4B 4CO7A 1FCCC 1DGJA 2VRRB 2KJRA 3U2SC 1JMLA 1WF9A 2JYTA 2KQ7A 2M4NA 2IY0B 1EF5A 1JALA 1A70A 3NZUA 2WXPA 2YLMA 4FHKA 2GBRA 3DVNV 4HDQA 1C78A 1NI3A 4PYUA 1ZE3D 2IY1B 1T0RC 2KK8A 2K25A 4IWOA 2X38A 2BWFA 4ICUA 2LGYA 4HPPA 3EECA 2DYMA 3H9DA 3OJ4B 1VR9A 4HROA 4XGAB 1D5XC 1WJUA 1I4PA 4TQ0A 1SE4A 5G55A 3R2TA 4JLCA 4L1BA 2BTEA 3L54A 1E10A 2WXQA 3P4QB 2GBNA 3R7RA 2MJEA 2PE9A 3ENEA 3EFUA 1KJTA 3DPDA 2RPVA 1HZ6A 3Q2AC 1QOAA 2JVCA 3ABVB 3MC8A 1T6BX 3SFEB 1XLQA 2CHWA 2MBEA 3MJWA 4ZDVA 1OQRA 3CF6E 4KGTA 4MJSB 4RGTA 2UYZB 4MT5A 1NEKB 1WXMA 3W2DA 1ZDVA 2MH7A 4S17A 2JQRB 4OVZA 4JX1C 2M0XA 3B1LX 1JWAD 4GDLA 1C4PA 1N5WA 1D3ZA 4ICVA 3A9KB 1AWDA 3VUXA 1WR1A 1MVKA 3ZIMA 2J4XA 1WR6E 3UGBB 3AEBB 5G2NA 1YJJA 3AE9B 2DWQA 4EUTA 2VZKB 3LB8C 1WJ4A 4XX5A 3PLVA 4S0RA 1IPGA 4GOCA 4K3BA 4B95A 2DBYA 3ZNHB 3HK0A 3A1QB 5CTRC 5AEKB 4G11A 4TMAB 3NOBA 2GBMA 4R3DA 2KMCA 3NZ3A 3P1MA 2FIDA 4KZCA 2DHZA 1QOBA 4WIPA 3L13A 4NAWB 4I6LB 4AOFA 3PTFC 2MBQA 1V81A 3I63C 1KTKA 4EZKA 3WAOA 4E74A 2EKEC 3VXWA 1I35A 2DYOA 3KH0A 4LDTD 4MACA 4KSLC 5E6PA 2HJ8A 4NPNA 1XCTL 1P7EA 3W1SC 3W9CB 3QWZB 2V4IB 2SEBD 3TUOA 5E6NA 1ZGUB 5FR6A 4ANXA 2NPTB 2Y5CA 5IO9A 2ZVOA 2KTFA 2C7MB 1I42A 5G5HA 1NVID 4IOIE 5GXGB 2WXNA 2LXAA 5DPTA 3OJ3A 4HPLB 4M01A 4K7UA 1YD8U 2PTLA 4RGOS 2PVGC 3T3NA 2M56B 3NY5A 1L2NA 1JQ4A 3GOEA 3BVMA 2ASQA 4J6IA 3CSTA 1SJHD 1BMLC 1WIAA 4KSKC 2NCNA 2LRUA 2WU2B 1KLGD 2AEHA 5IN7A 3RI7C 4YT0B 5FK9C 3HUIA 4DXFA 2KT7A 3WCQA 4ZYSA 1R4NB 2G3QB 1MG4A 2J0MA 2G4SA 4DHZE 1UUPA 1QQRA 2AL3A 3ZKJC 3DDCB 1FFVA 3RNEC 5IAAC 1V8CA 2WXKA 1F52A 2J0KA 2OJRA 2IO3B 3B9JA 1ET6A 1NYRA 2L05A 3J9CA 1EUVB 2JSVX 2BW2A 3B0AA 4IC7B 1GG3A 4HJGE 4NAMA 3ZXRA 3ONSA 2IPKD 4LTUA 4ZRPA 5D3IB 2FIFA 4WURA 1SIJA 4OZAA 4NQLB 1WE7A 3VRBB 4AWJA 2KMAA 4XE0A 1IGDA 1YN4A 2LJIA 1IUEA 4KV2A 2KX3A 2UU7A 1LM8B 1RFAA 2XN9C 3HVZA 2DAFA 1TY0A 3V61A 3GE8C 1E5WA 4GU2A 4IUMB 3FC4A 4C80A 2DZKA 4BBNC 1R4MI 4B0EA 1VZ7A 1FPYA 3L16A 2N9LA 1OEYJ 2WXMA 2J53A 3PREA 2N0SB 3QAQA 1E0ZA 2QILA 2KTRA 3WA0A 3L0WB 3DBLI 3T8MA 3TJPA 2IO0B 2NS5A 2LGDA 3V6CB 2BKFA 4GGQA 2FUHB 3A4SC 2J42A 2FNJB 3Q8BA 4TKNA 1DOYA 1B1ZA 4CYEA 3UQAA 1L6VA 3EHVA 3R3MA 3X0WA 1UGJA 2JY6A 2L8JA 3GZNI 1ESFA 2CU3A 1SBBB 1HEZE 1F0ZA 4XWTA 2NTSA 2EKIA 2QCZA 2OJWA 4C7YA 4MGKE 3RFZB 5HG2A 2BGFA 3DWGC 1SE3A 3AV8A 3AEFB 1J7BA 3N20C 3ZNID 4OHJA 3Q8CA 5H92C 1YOVB 1XLPA 2O6VA 1MHXA 1MG8A 3NVVA 1FEHA 2IZVB 3IG3A 3RZFA 1TKYA 1F1HA 1JRUA 2LVOA 3ZVVA 2I1JA 3Q3NC 3A4RA 3KUCB 2CJOA 3WANA 1N6ZA 1P3QU 3ZNGC 3PPAA 1TS4A 4N9F4 1EO6A 4JWUC 1V5TA 4KKJA 4ACFA 1TKEA 3A9JB 2QC8A 3DVGX 2N1VA 3PRZA 1V9JA 2WDQB 1GB4A 3SU8X 1ZXHA 1PGXA 2I2YA 4W9EA 5CX3A 4KGRA 3M95A 1P0RA 3DBHI 4PS7A 4RM8A 1SIFA 1F77A 4K1RB 3M3JA 4WJNA 2K1FA 1WRDB 3APCA 2BVCA 2KX0A 3X23A 2C60A 4RM9A 1K50A 4FXCA 1WX8A 4WQMA 1VZ6A 1IP9A 3U52E 1E6EB 3NS8A 3UQBA 1XT9B 2KD0A 2IO2B 3T9LA 1VCBA 3HM6X 4FN2A 2KC1A 1EU4A 4FA6A 5CHVC 2N9EB 1L4DB 1WRIA 2C7HA 1HTOA 1G6JA 1KH0A 1TZ1A 3BYTB 2MBBB 2WWZA 4MJSA 1NDDA 2L1AA 3APDA 3RNFC 3AE2B 4BKSD 3ZJVA 1WGGA 1V2YA 1RFKA 2SAKA 1S3SG 3QA8A 4HLEA 3ZQ4A 3A9KA 3ZW3A 1ACCA 3AEDB 3Q14C 2MA9B 3I9V1 1LGRA 2VH2A 3TCAA 2FUG1 1IYFA 4F8CB 2E6XA 3QJZA 1UBIA 4RF1A 5EDSA 1H4RA 2D2QA 5BYSA 1WXQA 4FJZA 5JZEB 1FNUA 1Y56A 2E3TA 4DXGA 2BYFA 3MHZA 3A1QA 1JW9D 2LHEA 4J3OD 3AMZA 4KZ0A 2N7DA 3UIOB 2JRIB 2DAJA 1VDVA 3B08A 3ML9A 1RM6C 1TKGA 3OLMD 4NAWA 5FKAC 2BS4B 3Q6BA 1X1MA 4UDUC 3P4SB 2MBOA 3MHSD 1KLVA 2D3CA 1KM7A 3TEYA 3IAS1 4DWFA 1L5PA 4HKQA 3N3KB 1ZUD2 1TS3A 4W9GA 2H89B 3P2BA 5J17A 1LXDA 1SJED 2O6VB 3VTWA 2MSED 1TGZB 4OW0A 3KW5B 4M0WB 4IG7B 3CWIA 5EE0A 4JPSA 3U7DA 4NQKE 4YL8A 2LMCA 2C5LC 5BYQA 1QILA 2QIEB 2KKCA 3ZO5B 4C7ZA 4LJPB 2WGSA 4GMVA 3BIID 1XD3B 4M8NA 1YQBA 5IKCM 2LGXA 2A5UA 5EE3A 1XO3A 1WGYA 2V4LA 1TT5B 3AE6B 2N9XA 3KLSX 4L23A 3Q8AA 2WNMA 1NI2A 3KVFB 2L52A 2LGSA 1FCLA 1FXTB 1C1YB 1E8WA 1V80A 3N32A 3OWEB 2CS4A 3AE3B 1FNVA 1SE2A 2LWPA 2OHFA 2PMVA 2NVUI 2ZZPB 3ZJUA 2JZ3B 3AI5A 2HTHA 3W1YA 1UWXA 1FRRA 2NBWB 3B2GA 4W9IA 5DPSA 1E8ZA 5AZHA 3A33B 3VR8B 3PO0A 1VRAB 4FLHA 2LRWA 2BS2B 2BT6A 2K8BA 4MEMA 1CJEA 2FE8A 4M8MA 1K51A 1V49A 4HDOA 4HCNB 1V5OA 2KVRA 4MM3A 4OZCA 4GXBA 3TL5A 3R2IA 4ZHPA 2KFJA 1Q1OA 3IXSA 2FCSA 2D5GA 2W3RA 3V05A 3GS2A 1R4MB 4XYCA 4MELA 4JGHB 2IJ0A 1P9DU 1HTQA 2O2VA 1YIWA 3NVYA 2KLCA 2LVPA 4DHJD 4EFOA 3UI3A 2XNAC 2N9KA 3AU5A 3DBLB 4DHZB 1SEBD 1ZDXA 1N60A 1WMHB 1BT0A 2BBCA 5CHFA 4NZLB 1OGWA 1IBXB 2JZPA 1YNTE 2K22A 2KHWB 4BFRA 1KFYB 4F1SA 3AB5A 2JWUA 1KOTA 1HQRD 3GZNB 1N61A 2MW5A 5DPWA 2B3AA 4GB9A 4YSZB 2D3BA 1EWCA 1C79A 4N59A 3GP7A 2KAJA 4HKZE 3H6NA 3E56A 2A4ZA 5LLIA 1A5RA 2PW9A 3NRZA 2NMQA 4EEWA 2KDFB 2IYDB 1J19A 1WZ3A 1V6EA 3OAWA 4EKUA 4C56C 2MEKA 4BKTA 1WJ6A 3EGRA 1PDXA 1WH3A 3MP9A 3VVWB 1PUTA 4TSSA 4ANWA 2KNBA 3AN1A 3RPFC 1AN8A 2ZJDA 1VD2A 4GLSC 3K9PB 3W1SA 4QAYA 1SGHA 4KKIA 1L6UA 2WDTB 1PGAA 2YEPB 5TSSA 4I6NB 3EA6A 3T3OA 2WXHA 1JWSD 3BINA 5IA7A 2WXLA 1MI0A 4W9LA 4LLGM 1XCQL 2MQJA 3DHGC 2K6DB 2MP2B 4OVUA 5DPRA 3H7PB 3DBHB 1WFYA 2FAZA 1ZW7A 1J7CA 2UWQA 2VH1A 3JYUA 4LNFA 4ARCA 4WWNA 1RWSA 3A9JA 1N5XA 4DHJB 2AX5A 2G4DB 3BVGA 3RNBC 2WLBA 2JXTA 1OQYA 2LFIA 3AE7B 1LQBA 4G3XB 3VTUA 2KZRA 5LXIB 2GBJA 3V3XA 2DZJA 5BMIA 4P7IA 1J8CA 2K39A 4ANUA 2L7RA 3MTNB 3DBRI 4B0MA 3HM3A 3FAHA 1RLFA 2IDYA 2L0TA 4FJVB 2ZNVC 3IVFA 4G50A 2AWTA 1MJDA 1UH6A 4FJYA 4RH6A 4JL9A 2R61A 2RMMA 1UWMA 3WAMA 4MDKE 2RR9A 3Q8FA 2IGHA 4P1BC 4MM3B 3HIZA 2ICIA 1QT9A 1FM0D 3N1ZC 2AL6A 1XXGA 5LXHA 3EUB2 4LDTB 1SB3C 1EU3A 1S1QB 1PYWD 1C77A 2KYWA 4KDLB 1V97A 1NYQA 1XF5L 2O2VB 4WJQA 1KLUD 1M94A 4NJ7A 4RNAA 1YMHE 1WXAA 5CHWA 3UF8A 1TJEA 2JXXA 1Q10A 2KVZA 3P4PB 5MPOA 3TEZA 4HJKA 2N9PC 2BYVE 3ZLZA 1FD6A 4K81A 1UBQA 2BS3B 1Z2MA 2PJHA 2IGDA 3RULA 2ONQA 3QIJA 2KFKB 1E7UA 2V9HA 3FKYA 4AS1A 4KVGB 2RDHA 2Z8LA 3QQ8B 4LJOB 1DYQA 3QARA 2ZEQA 2KJHB 2WQYB 5HHDG 4BKGA 5HI1A 4EE2A 2B76B 1TTNA 3JSVA 4GSWA 1I4QA 2BYEA 4BBNF 4E3CA 5C1ZA 3PRMB 4C00A 2H88B 2TSSA 2WXOA 3TIXA 1L0VB 4HXDA 1D4BA 4B6WA 2DZMA 3E9SA 2L3ZA 1Y8RC 3ZRFA 2D07B 3ZDMC 2EMTA 4RGMA 2I38A 2V3PA 3PZ7A 2KDEB 3KYCD 4USAA 1K8RB 2KQ4X 1OEYA 3LXFA 4BOSC 1L0YB 1ROEA 3PLUA 2CHZA 3U4EG 2WHIA 1TY2A 4ZYNA 1YN5A 4M0WA 3QC8B 5AUIA 2XEWA 2M17A 4IWQA 4BAXA 2WDRB 1I4GA 2INDC 2K6QA 3NHEB 3QX1A 1UD7A 2WXRA 3DQVA 4DDGD 2MHJA 2WDVB 4A6QA 3O13A 3C8YA 4URKA 3I57A 2KJ6A 3AM9A 2I1KA 2BKRB 1GNUA 3SHQA 1WZ0A 4GDKB 1V1PB 2J52A 1D5MC 5G5GA 4BKSA 5JHAA 1D5ZC 3N1YC 2XBBC 3TMPB 2YVCA 2INCC 3AU4A 1F9JA 2AYOB 1MFWA 4DXAB 1XLOA 2JYEA 2PPHA 1AW7A 1T0SC 1AYFA 2J7QB 5FR3A 1C4AA 2EELA 1FO4A 3O65B 2CR5A 4TUUA 1STEA 2KDBA 4TQ1A 2R2OA 4AUQC 4E71A 2HD5B 2L32A 1P1AA 1RAXA 2GI9A 2ZNVB 3L10B 4ZRKA 2Q5WD 2BB5A 1QZEA 2V0GA 4WJOA 1GPXA 2D3GA 1UF0A 1N62A 2Z0EB 4WWPA 3AH7A 2PE6B 2D10A 3UIPB 2XK5B 4MH8A 1FMAD 3ZUNA 1Q0WB 1GAQB 3AULA 2N4FA 3N9YC 4HRSA 3W5UB 4C4VA 2KLGA 4EOYA 4M00A 1WMHA 1WYGA 3C0RB 1P7FA 2V3NA 2ON8A 1IBXA 4W9DA 1CMXB 3JW0X 5J2RA 4AP4C 1E8YA 4X57B 4IKGA 2JPHA 3ZJTA 3JSVB 3N1XC 2ZPYA 3R8BA 1VLBA 3WIMA 2AQ1B 2AQ3B 3HVDA 4FHJA 3M62B 1V1OA 3PT2B 2MBHA 3C19A 2IGGA 5C3JB 4XDDA 4W9KA 1WI0A 2LEKA 2RDBC 2Z0DB 5HKHA 5L95C 3APFA 2K9XA 5JXVA 3FILA 1L4ZB 1JWBD 2BWES 3ML8A 5IP4D 2WP9B 2K3UA 3ETRA 5BMGA 2WU5B 3KWVA 1I4XA 2KQSA 3DVNU 4Q2JA 1UELA 4M02A 4O1NA 1OQQA 2LGIA 4ITKA 2ZW1A 4XDCA 3ZYYX 4CHKA 3ZDTA 2M19A 5KHOA 4YSXB 4KIKB 1CK1A 4HCPB 1EM7A 4LNNA 2ZPNA 5AUKA 1YJ1A 3L4PA 4A3PA 4K7WA 3U30A 4EZLA 2NBVB 1T3QA 5D2MB 3BVZA 4IM2A 3RMKC 1WGKA 4IDIA 4WAAA 3VH3B 1J7AA 3SR6A 1ENFA 2BPSA 1CQVA 2D11A 5D3DA 2YEPF 3CMMB 4A90A 5DCNA 1AARA 3NS1A 2MP2A 3PS6A 4PT5A 1LFDA 4II2B 4YTMB 1FFUA 3H7PA 5EE1A 1UNSA 1IGCA 2M1MA 1I7HA 2FCQA 3KUZA 1R7SA 2LUMA 1YN3A 2KWCA 3DBRB 3V6EB 4EZJA 5JHBA 1ISNA 5E6OA 3TBLD 5HFYA 2PLPA 3B2FA 4F7ZA 3AEAB 4FADA 5JH5C 3IFWB 3BZDB 2GBKA 2GLSA 3PSEB 1WY8A 5C2TB 3U8ZA 1WGHA 3CIRB 3Q69A 1P98A 2M8SA 3RD2A 3W5VB 4JWSC 2DNFA 3WALA 1GUAB 3V62A 3VRAB 3PVLA 2Y5PA 2KXJA 3VAWA 1QLBB 5AZGA 3KQ4A 1HZ5A 4WJPA 3PZDA 4N58A 2FBWB 4RGNA 1PGBA 2HE7A 3I3TB 5KHQA 2HDEA 4YSYB 3PGEA 3BY4B 2ZCBA 3DVGY 2MRPA 4N6EB 1T0YA 4YTPB 2KWVB 2W54A 4PK1A 2KWUB 3IT6B 1VJKA 4K7SA 4BVUC 1LO5D 4C4VB 2GB1A 1DOXA 4WAFA 4P16A 2WXJA 3ZGZA 2N1WA 2HTME 3OG5A 3VTVA 2KFKA 1BUIC 1JWMD 4GIVA 2CU1A 2Z59B 1WE6A 1YJIA 1Z5SB 3PRPB 5D6JB 3MC9A 1T0QC 4W9HA 2AQ2B 3SDLC 4RFBA 3PHXB 3CSFA
chains in the Genus database with same CATH topology
2WS3B 4ARIA 1QT9A 1FM0D 2PVOD 1XXGA 2KACA 5T8IA 1QF6A 3EUB2 1SB3C 1EU3A 2WDQB 1GB4A 1PYWD 1ZXHA 1PGXA 2I2YA 4P6VF 1C77A 2CJNA 2JX5A 4KGRA 4A9AA 3PZ8A 1FXAA 1K52A 3FILB 1PFDA 1V97A 1F2RI 1NYQA 1F77A 1SSNA 1XF5L 4AQ7A 1KLUD 1D6EC 2G9HD 2Y3AA 4RNAA 1SF0A 2K0PA 1YMHE 3MJ5A 1TJEA 3BYYB 1Q10A 3NVWA 3P4PB 1FRDA 2INNE 1BXTA 5MPOA 3TEZA 2VZKD 3TSSA 1FD6A 1K50A 2KN4A 1M4VA 2BS3B 3AECB 4FXCA 2IGDA 3BWUD 2ONQA 4WQMA 1ZXIA 4AS1A 5BMHA 1F2RC 3MFGA 4WH4A 1VZ6A 2RDHA 1FCCC 1E6EB 1DGJA 2Z8LA 3U52E 1DYQA 3DWMA 1XEEA 3U2SC 1JMLA 2JYTA 2WQYB 1HXYD 5HHDG 5LNK1 5HI1A 1JALA 1A70A 4EE2A 2B76B 5H8YE 2WXPA 1EU4A 1I4QA 4WWMA 1L4DB 1N63A 1C78A 2PIAA 1WRIA 1NI3A 1ZPSA 1C9FA 1ZE3D 1KH0A 2H88B 3BYTB 2TSSA 4HEA1 2WXOA 4ZHOA 1L0VB 1TS2A 1E9MA 1KRHA 1D4BA 2X38A 2L1AA 3E9SA 3AE2B 2DYMA 4KGSA 3ZJVA 1VR9A 2G1EA 1RFKA 2SAKA 1D5XC 4HROA 3ZQ4A 1I4PA 1QOGA 4RGMA 2I38A 4TQ0A 2V3PA 1SE4A 3PZ7A 3R2TA 4A8XC 4L1BA 5E6JA 2BTEA 1ACCA 3AEDB 2WXQA 3P4QB 1E10A 2N7JA 1V1PA 3I9V1 1KF6B 2FUG1 1RYJA 2MJEA 4USAA 3URYA 2E6XA 1FXIA 4RF1A 2KQ4X 3LXFA 2RPVA 5BYSA 1WXQA 1L0YB 1ROEA 1GB1A 1HZ6A 1FNUA 1QOAA 3U4EG 3VQIA 1Y56A 2E3TA 1TY2A 4DXGA 3ABVB 2MJDA 1YN5A 3MHZA 4M0WA 1T6BX 2M0AA 4H2AA 3SFEB 1JW9D 1XLQA 5AUIA 4CQNA 2LHEA 2QMTA 4J3OD 3AMZA 2WDRB 1OQRA 4KGTA 4RGTA 1I4GA 4MT5A 1NEKB 5I4DA 1VDVA 3W2DA 1RM6C 1ZDVA 2WXRA 2MH7A 1TKGA 3H8HA 2JQRB 2ACZB 4OVZA 5FKAC 4JX1C 2PKOA 2BS4B 1JWAD 2WDVB 4A6QA 3O13A 1C4PA 3C8YA 1N5WA 4UDUC 2QSDA 3P4SB 3I57A 3AM9A 1AWDA 1MVKA 2J4XA 3NVZA 3AEBB 4GDKB 3TEYA 1V1PB 2J52A 3P4RB 1D5MC 5G5GA 1D5ZC 1YJJA 3IAS1 4REZA 3AE9B 1L5PA 2DWQA 5BYRA 4HKQA 2VZKB 1ZUD2 1TS3A 3LB8C 2H89B 2DLBA 2RDGA 1SJED 1XLOA 2JYEA 3AEEB 4OW0A 1MPEA 2DBYA 1AW7A 1ZP0B 1AYFA 5FR3A 1C4AA 2EELA 3CWIA 5EE0A 4TMAB 4JPSA 1FIQA 1FO4A 1I4HA 2BYTA 4R3DA 1TS5A 3NZ3A 3P1MA 2LMCA 1STEA 4TQ1A 5BYQA 1QILA 3KWLA 1QOBA 4WIPA 2QIEB 2L32A 4NAWB 4C7ZA 3TEWA 1ZOYB 4GDLB 2GI9A 1KTKA 3BIID 4ZRQA 1EWYC 2Q5WD 2BB5A 2DYOA 2INPE 4XWWA 4MACA 3MC0B 5EE3A 1XO3A 3U7ZA 2V0GA 1GPXA 3AE6B 1XCTL 1P7EA 3BK1A 2KMMA 1N62A 3KLSX 3W9CB 4L23A 4D2KA 3Q8AA 2OEDA 2V4IB 2WNMA 2SEBD 3AH7A 3TUOA 2L52A 1MHHE 1FCLA 1TZOA 1E7PB 1VZ8A 2Y5CA 4YXDB 4KX6B 4MH8A 1FMAD 3OWEB 1SXTA 1FNVA 3AE3B 5G5HA 1GAQB 1NVID 1SE2A 2OHFA 4IOIE 5GXGB 2PMVA 3N9YC 2WXNA 4HRSA 3W5UB 1XLNA 3ZJUA 1WYGA 1P7FA 2PTLA 2V3NA 4RGOS 2ON8A 1UWXA 1FRRA 2PVGC 1IBXA 3T3NA 2M56B 3B2GA 4LK0M 3AE5B 3VR8B 1JQ4A 2ZW0A 3PO0A 1K53A 1VRAB 2BS2B 5D7GA 2BT6A 4YTNB 4RCOA 1CJEA 2FE8A 4IKGA 3SFDB 1K51A 3BVMA 3ZJTA 3R8BA 1VLBA 5EE9A 2AQ1B 1JWUD 4OZCA 2AQ3B 3HVDA 1SJHD 3R2IA 4ZHPA 1BMLC 1V1OA 3IXSA 4L2YA 2D5GA 2W3RA 3AEGB 3V05A 2IGGA 5C3JB 2WU2B 3GS2A 4XDDA 1KLGD 1OFFA 2LEKA 1ET9A 2K9XA 5JXVA 3FILA 2IJ0A 4YT0B 1L4ZB 1GOZA 5FK9C 3HUIA 3NVYA 1JWBD 4ZOHC 3UI3A 2KWDA 4DXFA 2XNAC 2WP9B 2N9KA 3IAM1 3WCQA 3GB1A 4ZYSA 2K3UA 1SEBD 3ETRA 1JROA 5BMGA 1ZDXA 2WU5B 1N60A 1UUPA 1QQRA 1I4XA 1QKZA 3KWVA 1HA5A 2BBCA 1FFVA 4NZLB 1IBXB 4Q2JA 1JRPA 1V8CA 2WXKA 2JZPA 4O1NA 1YNTE 1OQQA 2K22A 2LGIA 4US9A 2LHDA 3B9JA 3TEXA 1ET6A 1NYRA 2KDMA 2ZW1A 1KFYB 4ITKA 4XDCA 3ZYYX 3AB5A 2JWUA 2M19A 3J9CA 2JSVX 2BW2A 4YSXB 1CK1A 4HJGE 4NAMA 1EM7A 1HQRD 2QJLA 4LTUA 2IPKD 5AUKA 1N61A 4ZRPA 5D3IB 3L4PA 3IT4B 1T5XD 4WURA 1SIJA 4OZAA 4YSZB 3AE4B 4DQOC 1EWCA 1C79A 1T3QA 3BVZA 4N59A 3VRBB 3GP7A 1WGKA 2KAJA 4HKZE 4IDIA 3E56A 4XE0A 1IGDA 1YN4A 4A55A 2LJIA 1J7AA 1IUEA 3P42A 3SR6A 1ENFA 1CQVA 5D3DA 2W3SA 1CZPA 2YEPF 4A90A 2PW9A 3NRZA 2XN9C 3HVZA 1I4RA 2NMQA 3NS1A 1TY0A 4PT5A 4YTMB 1FFUA 1NENB 2GRIA 5EE1A 1UNSA 4C56C 1IGCA 1I7HA 2MEKA 3FC4A 4C80A 4JE3B 1R7SA 2LUMA 3EGRA 4B0EA 1PDXA 3MP9A 3VR9B 1PUTA 1VZ7A 4TSSA 1YN3A 2N9LA 3AN1A 3RPFC 1AN8A 2WXMA 2J53A 2N0SB 4GLSC 5HFYA 4NJCA 1E0ZA 2PLPA 3W1SA 3B2FA 2QILA 3AEAB 3LYYA 1TYGB 4KKIA 3BZDB 1L6UA 5C2TB 4RF0A 1PGAA 1YQ4B 3CIRB 3Q69A 2K5PA 2YEPB 2J42A 3W5VB 5TSSA 3Q8BA 3EA6A 4YWGG 3T3OA 2WXHA 1JWSD 2WXFA 1DOYA 1B1ZA 4JWSC 4US8A 2WXLA 1MI0A 1QOFA 3VRAB 1L6VA 4LLGM 1XCQL 3NUHB 1DOIA 1UGJA 2MJ3A 2Y5PA 1ESFA 2QEJC 2CU3A 1SBBB 1J7CA 1HEZE 3SEBA 1QLBB 4XWTA 1F0ZA 4ARCA 3AE8B 2NTSA 3KQ4A 1RWSA 2EKIA 4OZBA 3HRDD 1HZ5A 4C7YA 1C76A 1N5XA 3RFZB 4N58A 2FBWB 5HG2A 4RGNA 2W82A 1FNWA 1PGBA 3DWGC 1SE3A 2AX5A 2WXGA 2HDEA 3AV8A 3AEFB 3BVGA 4YSYB 2BB6A 2WLBA 2JXTA 1J7BA 2LFIA 1L0XB 3AE7B 4OHJA 4N6EB 2WXIA 3Q8CA 3P63A 4YTPB 5H92C 3BK2A 2W54A 1C4CA 1XLPA 3IT6B 1VJKA 1MHXA 3NVVA 1FEHA 1LO5D 3V3XA 3Q8EA 1DOXA 2GB1A 5BMIA 1WSPA 4WAFA 4P16A 2WXJA 3ZGZA 1JCKB 4B0MA 1TKYA 3FAHA 2IDYA 2HTME 2JU6X 2CJOA 1YQ3B 2NTTA 1BUIC 1JWMD 1WWTA 4RH6A 1TS4A 2R61A 4JWUC 2RMMA 2W55A 1UWMA 1YJIA 2L83A 1B9RA 4KKJA 3Q8FA 1TKEA 2AQ2B 2IGHA 4RFBA 3AE1B 4MM3B 2ICIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W5U B;  1I7H A;  1XLN A;  3SFE B;  2WS3 B;  1JW9 D;  1XLQ A;  1QT9 A;  1FM0 D;  3FC4 A;  2PVO D;  5AUI A;  4C80 A;  1R7S A;  1QF6 A;  3AMZ A;  3EUB 2;  1WYG A;  1SB3 C;  2WDR B;  1PDX A;  2WDQ B;  1OQR A;  3VR9 B;  1PUT A;  1NEK B;  1VDV A;  4P6V F;  1FRR A;  2JX5 A;  2CJN A;  2PVG C;  2M56 B;  3AN1 A;  3B2G A;  4A9A A;  3RPF C;  1RM6 C;  1FXA A;  2MH7 A;  1TKG A;  3AE5 B;  1PFD A;  2N0S B;  3VR8 B;  2JQR B;  2ACZ B;  1V97 A;  1NYQ A;  3PO0 A;  4JX1 C;  1E0Z A;  2PKO A;  2BS2 B;  3B2F A;  2BS4 B;  2BT6 A;  3AEA B;  1JWA D;  2WDV B;  1SF0 A;  1TYG B;  4YTN B;  1CJE A;  3SFD B;  1N5W A;  1L6U A;  1TJE A;  3P4S B;  3AM9 A;  1AWD A;  5C2T B;  3NVW A;  3P4P B;  1VLB A;  5EE9 A;  1FRD A;  1YQ4 B;  5MPO A;  3CIR B;  3NVZ A;  2K5P A;  3AEB B;  3W5V B;  4ZHP A;  3P4R B;  5G5G A;  3AEC B;  2BS3 B;  4FXC A;  1DOY A;  1YJJ A;  4JWS C;  4US8 A;  3AE9 B;  1L5P A;  1QOF A;  2DWQ A;  2W3R A;  3AEG B;  1L6V A;  4WQM A;  1ZXI A;  3VRA B;  5C3J B;  2WU2 B;  1ZUD 2;  1DOI A;  1OFF A;  2LEK A;  2MJ3 A;  3LB8 C;  2H89 B;  1E6E B;  1DGJ A;  2K9X A;  3DWM A;  4YT0 B;  2CU3 A;  3HUI A;  1J7C A;  1XLO A;  2WQY B;  3AEE B;  3NVY A;  1JWB D;  1QLB B;  1F0Z A;  4ZOH C;  2DBY A;  1JAL A;  1A70 A;  1ZP0 B;  3AE8 B;  1AYF A;  1RWS A;  2B76 B;  2EKI A;  2WP9 B;  3WCQ A;  5H8Y E;  3CWI A;  5EE0 A;  3HRD D;  3ETR A;  1JRO A;  4C7Y A;  1FIQ A;  1N5X A;  1N60 A;  2WU5 B;  4WWM A;  1FO4 A;  4N58 A;  2FBW B;  1N63 A;  2PIA A;  1WRI A;  1NI3 A;  3P1M A;  1FFV A;  3DWG C;  2H88 B;  2AX5 A;  1JRP A;  1V8C A;  3AV8 A;  3AEF B;  3KWL A;  1L0V B;  1OQQ A;  4YSY B;  2K22 A;  4ZHO A;  1QOB A;  1E9M A;  1KRH A;  2QIE B;  1J7B A;  2WLB A;  3B9J A;  4US9 A;  4C7Z A;  1NYR A;  3AE7 B;  4ITK A;  1KFY B;  1ZOY B;  4N6E B;  3ZYY X;  3AB5 A;  2M19 A;  3P63 A;  3AE2 B;  4YTP B;  5H92 C;  3BII D;  2W54 A;  4YSX B;  1EWY C;  1XLP A;  2QJL A;  2Q5W D;  4LTU A;  1VJK A;  5AUK A;  1N61 A;  2G1E A;  1RFK A;  3L4P A;  3NVV A;  4HRO A;  1QOG A;  1DOX A;  1SIJ A;  5EE3 A;  4YSZ B;  1XO3 A;  3AE4 B;  1T3Q A;  4N59 A;  1GPX A;  3AE6 B;  3VRB B;  1TKY A;  1WGK A;  3AED B;  3P4Q B;  3FAH A;  2KAJ A;  2KMM A;  4IDI A;  1N62 A;  1E10 A;  3W9C B;  2HTM E;  3AH7 A;  2L52 A;  1J7A A;  1IUE A;  1KF6 B;  1RYJ A;  1YQ3 B;  2CJO A;  2MJE A;  4USA A;  3SR6 A;  1E7P B;  5EE1 A;  1FXI A;  1WWT A;  1CZP A;  2W3S A;  2Y5C A;  4YXD B;  3NRZ A;  3LXF A;  4JWU C;  2W55 A;  1UWM A;  1YJI A;  3HVZ A;  3NS1 A;  1WXQ A;  1FMA D;  4KX6 B;  1JQ4 A;  1ROE A;  2L83 A;  4YTM B;  1B9R A;  1FFU A;  1NEN B;  3AE3 B;  1QOA A;  1TKE A;  1GAQ B;  1NVI D;  2E3T A;  2OHF A;  5G5H A;  5GXG B;  3AE1 B;  3ABV B;  2MJD A;  4HRS A; 
#chains in the Genus database with same CATH topology
 2BQQ A;  2LAS A;  4ARI A;  2PVO D;  2KAC A;  3L17 A;  4NNJ B;  5T8I A;  3RUI B;  3LJ3 A;  2CJN A;  4A9A A;  1K52 A;  3FIL B;  3QK0 A;  1SSN A;  1D6E C;  2G9H D;  2JZZ A;  2KO3 A;  2RSU A;  3DCG A;  3MJ5 A;  4HPM B;  4IWP A;  1U4A A;  3Q3O C;  3BYY B;  2INN E;  4MGY E;  3TSS A;  3AEC B;  1TBE A;  3BWU D;  3K9O B;  5BMH A;  1F2R C;  3ZRC A;  2L76 A;  3DWM A;  1XEE A;  1GC7 A;  1HXY D;  5LNK 1;  3LDZ E;  4HVB A;  3EC8 A;  5H8Y E;  2KC2 A;  4PS3 A;  4WWM A;  4NY0 A;  1N63 A;  2PIA A;  1ZPS A;  1C9F A;  4OVV A;  2GOW A;  4HEA 1;  2V3S A;  1Q5W B;  4ZHO A;  1TS2 A;  1E9M A;  1KRH A;  2DX5 B;  4KGS A;  1J0G A;  2DYB A;  3DBS A;  2C9W B;  2G1E A;  3GE3 C;  1QOG A;  4A8X C;  1E8X A;  3QCA A;  4RMA A;  3H7S A;  5E6J A;  3WAP A;  4W9J A;  4GDK A;  2N7J A;  1V1P A;  4LNI A;  1KF6 B;  1WGD A;  1RYJ A;  1UZX B;  3URY A;  1NBF C;  1FXI A;  4MSM B;  3AXC A;  3RNC C;  3H1U A;  1GB1 A;  4P1C C;  2LJ5 A;  1WXS A;  3VH4 B;  3VQI A;  2MJD A;  4K3C A;  4H2A A;  2M0A A;  4CQN A;  2QMT A;  5GMV A;  3UIN B;  4B9K A;  1WM3 A;  5I4D A;  4DK5 A;  2QHO A;  3H8H A;  2ACZ B;  2J0J A;  2PKO A;  3PHW B;  2Y5B B;  2QSD A;  2V1Y A;  3RZW C;  4ASW C;  4ZRJ A;  3NVZ A;  4BZA A;  3P4R B;  4MH0 E;  4REZ A;  5C23 A;  5BYR A;  2CKH B;  3DHH C;  2EMS A;  4I6P A;  2DLB A;  2RDG A;  5AZF A;  2XK5 A;  3AEE B;  3ZXV A;  1MPE A;  4JQW C;  1ZP0 B;  2JT4 B;  4NJ6 A;  4A3O A;  2BF8 B;  2C7N B;  1FIQ A;  2FCN A;  2RD0 A;  4LNK A;  1I4H A;  2BYT A;  4IW0 A;  2REX A;  1TS5 A;  3KWL A;  1GC6 A;  3TEW A;  2MX2 A;  1ZOY B;  4GDL B;  2KAN A;  4ZRQ A;  3VUY A;  1EWY C;  3RNA C;  2INP E;  4IM3 A;  4XWW A;  3MC0 B;  2KDI A;  2K8C A;  4MSQ B;  3U7Z A;  3M63 B;  3BK1 A;  2KMM A;  2X8X X;  4D2K A;  2LVQ A;  2OED A;  4PS8 A;  3JVZ X;  2JUO A;  1MHH E;  1WX9 A;  1TZO A;  4WQO B;  1E7P B;  1VZ8 A;  2LUE A;  4YXD B;  4KX6 B;  5J18 A;  5IOI A;  1SXT A;  3IBE A;  2WX0 A;  1XLN A;  4PYZ A;  3DHI C;  4LK0 M;  3AE5 B;  2ZW0 A;  1K53 A;  5D7G A;  4YTN B;  4RCO A;  3SFD B;  4KIK A;  2MCN B;  3Q3F A;  5EE9 A;  2LD9 A;  1JWU D;  3ALB A;  2K8H A;  1WX7 A;  3VDZ A;  2LI5 A;  4L2Y A;  3NG0 A;  3AEG B;  3ZTC A;  4BOZ B;  1H8C A;  1OFF A;  2GMI C;  1UGM A;  1ET9 A;  1SE9 A;  3D32 A;  1GOZ A;  2IO1 B;  2ZVN A;  4ZOH C;  4KDI C;  4ANV A;  2KWD A;  3IAM 1;  2IBI B;  3GB1 A;  1JRO A;  1QKZ A;  3Q3M C;  1HA5 A;  3VHT C;  1JRP A;  2G45 B;  4WWO A;  2D3A A;  1XQQ A;  4US9 A;  2LHD A;  3TEX A;  2KDM A;  4JIO U;  3DOW A;  2NR2 A;  2QJL A;  3IT4 B;  3L08 A;  1T5X D;  2KN5 A;  3AE4 B;  4DQO C;  4MGI E;  3S2A A;  1HE8 A;  3RYT A;  3PV1 A;  2PEA A;  4A55 A;  3P42 A;  4MGZ E;  4FUL A;  2CHX A;  2W3S A;  1CZP A;  3HHM A;  1I4R A;  3RT3 B;  4ZRI A;  1NEN B;  2GRI A;  4A20 A;  3ZNZ B;  3QHT A;  3SD5 A;  4TV3 A;  4JE3 B;  3RN9 C;  1EF1 A;  4W9C A;  2ZCC A;  2FCM A;  2O6V D;  3VR9 B;  2JRH A;  2WYQ A;  1E7V A;  2MLB A;  4NJC A;  3LYY A;  1TYG B;  2L00 B;  2DEN B;  1R4N I;  3IHP C;  2QDF A;  4RF0 A;  4W9F A;  1YQ4 B;  2K5P A;  4LCD E;  4YWG G;  2WXF A;  1TIF A;  4US8 A;  1L7Y A;  5TR5 A;  1QOF A;  2LXC A;  1WM2 A;  3VUW A;  3RNG C;  3NUH B;  1DOI A;  5L83 A;  2MJ3 A;  4GN1 A;  1RRB A;  2DZI A;  2QEJ C;  4IM0 A;  3SEB A;  1WGR A;  3AE8 B;  4OZB A;  3HRD D;  1C76 A;  2JWZ A;  4G0N B;  2W82 A;  1FNW A;  2W9N A;  3NJT A;  2WXG A;  4HWI B;  2BB6 A;  2MWS B;  1L0X B;  3KUD B;  2KTR B;  2WXI A;  3P63 A;  3BK2 A;  4FBJ B;  1C4C A;  4XC2 A;  4XZ4 A;  3Q8E A;  1WSP A;  3RCZ A;  3R66 C;  4LNO A;  1JCK B;  3I5J C;  2JU6 X;  4AJY B;  1YQ3 B;  2NTT A;  1WWT A;  2L0F A;  2KOX A;  3Q3J A;  2W55 A;  3NZS A;  2L83 A;  1B9R A;  2RPQ A;  3N30 A;  3AE1 B;  1C3T A;  2WS3 B;  3VFK A;  2N7E A;  3EFC A;  4DDI D;  1QF6 A;  1V86 A;  2JF5 A;  1GJZ A;  2HJ1 A;  3ZTD A;  1E90 A;  4P6V F;  2JX5 A;  1WJN A;  1WXV A;  3PZ8 A;  1FXA A;  1YX5 B;  2OOB B;  1PFD A;  1F2R I;  4AQ7 A;  1PQS A;  2NBU A;  2NPT A;  2LZ6 A;  2Y3A A;  1SF0 A;  2K0P A;  2WX1 A;  2R2Q A;  3NVW A;  3KYD D;  1FRD A;  1BXT A;  3ECI A;  2VZK D;  3V60 A;  4AJW A;  2KN4 A;  1M4V A;  1WYW B;  5D94 A;  3R7Q A;  4DBG A;  4II3 B;  1OTR B;  1ZXI A;  2RGF A;  3MFG A;  4WH4 A;  4HK2 A;  1YX6 B;  1ZKH A;  5BO4 B;  4CO7 A;  1FCC C;  1DGJ A;  2VRR B;  2KJR A;  3U2S C;  1JML A;  1WF9 A;  2JYT A;  2KQ7 A;  2M4N A;  2IY0 B;  1EF5 A;  1JAL A;  1A70 A;  3NZU A;  2WXP A;  2YLM A;  4FHK A;  2GBR A;  3DVN V;  4HDQ A;  1C78 A;  1NI3 A;  4PYU A;  1ZE3 D;  2IY1 B;  1T0R C;  2KK8 A;  2K25 A;  4IWO A;  2X38 A;  2BWF A;  4ICU A;  2LGY A;  4HPP A;  3EEC A;  2DYM A;  3H9D A;  3OJ4 B;  1VR9 A;  4HRO A;  4XGA B;  1D5X C;  1WJU A;  1I4P A;  4TQ0 A;  1SE4 A;  5G55 A;  3R2T A;  4JLC A;  4L1B A;  2BTE A;  3L54 A;  1E10 A;  2WXQ A;  3P4Q B;  2GBN A;  3R7R A;  2MJE A;  2PE9 A;  3ENE A;  3EFU A;  1KJT A;  3DPD A;  2RPV A;  1HZ6 A;  3Q2A C;  1QOA A;  2JVC A;  3ABV B;  3MC8 A;  1T6B X;  3SFE B;  1XLQ A;  2CHW A;  2MBE A;  3MJW A;  4ZDV A;  1OQR A;  3CF6 E;  4KGT A;  4MJS B;  4RGT A;  2UYZ B;  4MT5 A;  1NEK B;  1WXM A;  3W2D A;  1ZDV A;  2MH7 A;  4S17 A;  2JQR B;  4OVZ A;  4JX1 C;  2M0X A;  3B1L X;  1JWA D;  4GDL A;  1C4P A;  1N5W A;  1D3Z A;  4ICV A;  3A9K B;  1AWD A;  3VUX A;  1WR1 A;  1MVK A;  3ZIM A;  2J4X A;  1WR6 E;  3UGB B;  3AEB B;  5G2N A;  1YJJ A;  3AE9 B;  2DWQ A;  4EUT A;  2VZK B;  3LB8 C;  1WJ4 A;  4XX5 A;  3PLV A;  4S0R A;  1IPG A;  4GOC A;  4K3B A;  4B95 A;  2DBY A;  3ZNH B;  3HK0 A;  3A1Q B;  5CTR C;  5AEK B;  4G11 A;  4TMA B;  3NOB A;  2GBM A;  4R3D A;  2KMC A;  3NZ3 A;  3P1M A;  2FID A;  4KZC A;  2DHZ A;  1QOB A;  4WIP A;  3L13 A;  4NAW B;  4I6L B;  4AOF A;  3PTF C;  2MBQ A;  1V81 A;  3I63 C;  1KTK A;  4EZK A;  3WAO A;  4E74 A;  2EKE C;  3VXW A;  1I35 A;  2DYO A;  3KH0 A;  4LDT D;  4MAC A;  4KSL C;  5E6P A;  2HJ8 A;  4NPN A;  1XCT L;  1P7E A;  3W1S C;  3W9C B;  3QWZ B;  2V4I B;  2SEB D;  3TUO A;  5E6N A;  1ZGU B;  5FR6 A;  4ANX A;  2NPT B;  2Y5C A;  5IO9 A;  2ZVO A;  2KTF A;  2C7M B;  1I42 A;  5G5H A;  1NVI D;  4IOI E;  5GXG B;  2WXN A;  2LXA A;  5DPT A;  3OJ3 A;  4HPL B;  4M01 A;  4K7U A;  1YD8 U;  2PTL A;  4RGO S;  2PVG C;  3T3N A;  2M56 B;  3NY5 A;  1L2N A;  1JQ4 A;  3GOE A;  3BVM A;  2ASQ A;  4J6I A;  3CST A;  1SJH D;  1BML C;  1WIA A;  4KSK C;  2NCN A;  2LRU A;  2WU2 B;  1KLG D;  2AEH A;  5IN7 A;  3RI7 C;  4YT0 B;  5FK9 C;  3HUI A;  4DXF A;  2KT7 A;  3WCQ A;  4ZYS A;  1R4N B;  2G3Q B;  1MG4 A;  2J0M A;  2G4S A;  4DHZ E;  1UUP A;  1QQR A;  2AL3 A;  3ZKJ C;  3DDC B;  1FFV A;  3RNE C;  5IAA C;  1V8C A;  2WXK A;  1F52 A;  2J0K A;  2OJR A;  2IO3 B;  3B9J A;  1ET6 A;  1NYR A;  2L05 A;  3J9C A;  1EUV B;  2JSV X;  2BW2 A;  3B0A A;  4IC7 B;  1GG3 A;  4HJG E;  4NAM A;  3ZXR A;  3ONS A;  2IPK D;  4LTU A;  4ZRP A;  5D3I B;  2FIF A;  4WUR A;  1SIJ A;  4OZA A;  4NQL B;  1WE7 A;  3VRB B;  4AWJ A;  2KMA A;  4XE0 A;  1IGD A;  1YN4 A;  2LJI A;  1IUE A;  4KV2 A;  2KX3 A;  2UU7 A;  1LM8 B;  1RFA A;  2XN9 C;  3HVZ A;  2DAF A;  1TY0 A;  3V61 A;  3GE8 C;  1E5W A;  4GU2 A;  4IUM B;  3FC4 A;  4C80 A;  2DZK A;  4BBN C;  1R4M I;  4B0E A;  1VZ7 A;  1FPY A;  3L16 A;  2N9L A;  1OEY J;  2WXM A;  2J53 A;  3PRE A;  2N0S B;  3QAQ A;  1E0Z A;  2QIL A;  2KTR A;  3WA0 A;  3L0W B;  3DBL I;  3T8M A;  3TJP A;  2IO0 B;  2NS5 A;  2LGD A;  3V6C B;  2BKF A;  4GGQ A;  2FUH B;  3A4S C;  2J42 A;  2FNJ B;  3Q8B A;  4TKN A;  1DOY A;  1B1Z A;  4CYE A;  3UQA A;  1L6V A;  3EHV A;  3R3M A;  3X0W A;  1UGJ A;  2JY6 A;  2L8J A;  3GZN I;  1ESF A;  2CU3 A;  1SBB B;  1HEZ E;  1F0Z A;  4XWT A;  2NTS A;  2EKI A;  2QCZ A;  2OJW A;  4C7Y A;  4MGK E;  3RFZ B;  5HG2 A;  2BGF A;  3DWG C;  1SE3 A;  3AV8 A;  3AEF B;  1J7B A;  3N20 C;  3ZNI D;  4OHJ A;  3Q8C A;  5H92 C;  1YOV B;  1XLP A;  2O6V A;  1MHX A;  1MG8 A;  3NVV A;  1FEH A;  2IZV B;  3IG3 A;  3RZF A;  1TKY A;  1F1H A;  1JRU A;  2LVO A;  3ZVV A;  2I1J A;  3Q3N C;  3A4R A;  3KUC B;  2CJO A;  3WAN A;  1N6Z A;  1P3Q U;  3ZNG C;  3PPA A;  1TS4 A;  4N9F 4;  1EO6 A;  4JWU C;  1V5T A;  4KKJ A;  4ACF A;  1TKE A;  3A9J B;  2QC8 A;  3DVG X;  2N1V A;  3PRZ A;  1V9J A;  2WDQ B;  1GB4 A;  3SU8 X;  1ZXH A;  1PGX A;  2I2Y A;  4W9E A;  5CX3 A;  4KGR A;  3M95 A;  1P0R A;  3DBH I;  4PS7 A;  4RM8 A;  1SIF A;  1F77 A;  4K1R B;  3M3J A;  4WJN A;  2K1F A;  1WRD B;  3APC A;  2BVC A;  2KX0 A;  3X23 A;  2C60 A;  4RM9 A;  1K50 A;  4FXC A;  1WX8 A;  4WQM A;  1VZ6 A;  1IP9 A;  3U52 E;  1E6E B;  3NS8 A;  3UQB A;  1XT9 B;  2KD0 A;  2IO2 B;  3T9L A;  1VCB A;  3HM6 X;  4FN2 A;  2KC1 A;  1EU4 A;  4FA6 A;  5CHV C;  2N9E B;  1L4D B;  1WRI A;  2C7H A;  1HTO A;  1G6J A;  1KH0 A;  1TZ1 A;  3BYT B;  2MBB B;  2WWZ A;  4MJS A;  1NDD A;  2L1A A;  3APD A;  3RNF C;  3AE2 B;  4BKS D;  3ZJV A;  1WGG A;  1V2Y A;  1RFK A;  2SAK A;  1S3S G;  3QA8 A;  4HLE A;  3ZQ4 A;  3A9K A;  3ZW3 A;  1ACC A;  3AED B;  3Q14 C;  2MA9 B;  3I9V 1;  1LGR A;  2VH2 A;  3TCA A;  2FUG 1;  1IYF A;  4F8C B;  2E6X A;  3QJZ A;  1UBI A;  4RF1 A;  5EDS A;  1H4R A;  2D2Q A;  5BYS A;  1WXQ A;  4FJZ A;  5JZE B;  1FNU A;  1Y56 A;  2E3T A;  4DXG A;  2BYF A;  3MHZ A;  3A1Q A;  1JW9 D;  2LHE A;  4J3O D;  3AMZ A;  4KZ0 A;  2N7D A;  3UIO B;  2JRI B;  2DAJ A;  1VDV A;  3B08 A;  3ML9 A;  1RM6 C;  1TKG A;  3OLM D;  4NAW A;  5FKA C;  2BS4 B;  3Q6B A;  1X1M A;  4UDU C;  3P4S B;  2MBO A;  3MHS D;  1KLV A;  2D3C A;  1KM7 A;  3TEY A;  3IAS 1;  4DWF A;  1L5P A;  4HKQ A;  3N3K B;  1ZUD 2;  1TS3 A;  4W9G A;  2H89 B;  3P2B A;  5J17 A;  1LXD A;  1SJE D;  2O6V B;  3VTW A;  2MSE D;  1TGZ B;  4OW0 A;  3KW5 B;  4M0W B;  4IG7 B;  3CWI A;  5EE0 A;  4JPS A;  3U7D A;  4NQK E;  4YL8 A;  2LMC A;  2C5L C;  5BYQ A;  1QIL A;  2QIE B;  2KKC A;  3ZO5 B;  4C7Z A;  4LJP B;  2WGS A;  4GMV A;  3BII D;  1XD3 B;  4M8N A;  1YQB A;  5IKC M;  2LGX A;  2A5U A;  5EE3 A;  1XO3 A;  1WGY A;  2V4L A;  1TT5 B;  3AE6 B;  2N9X A;  3KLS X;  4L23 A;  3Q8A A;  2WNM A;  1NI2 A;  3KVF B;  2L52 A;  2LGS A;  1FCL A;  1FXT B;  1C1Y B;  1E8W A;  1V80 A;  3N32 A;  3OWE B;  2CS4 A;  3AE3 B;  1FNV A;  1SE2 A;  2LWP A;  2OHF A;  2PMV A;  2NVU I;  2ZZP B;  3ZJU A;  2JZ3 B;  3AI5 A;  2HTH A;  3W1Y A;  1UWX A;  1FRR A;  2NBW B;  3B2G A;  4W9I A;  5DPS A;  1E8Z A;  5AZH A;  3A33 B;  3VR8 B;  3PO0 A;  1VRA B;  4FLH A;  2LRW A;  2BS2 B;  2BT6 A;  2K8B A;  4MEM A;  1CJE A;  2FE8 A;  4M8M A;  1K51 A;  1V49 A;  4HDO A;  4HCN B;  1V5O A;  2KVR A;  4MM3 A;  4OZC A;  4GXB A;  3TL5 A;  3R2I A;  4ZHP A;  2KFJ A;  1Q1O A;  3IXS A;  2FCS A;  2D5G A;  2W3R A;  3V05 A;  3GS2 A;  1R4M B;  4XYC A;  4MEL A;  4JGH B;  2IJ0 A;  1P9D U;  1HTQ A;  2O2V A;  1YIW A;  3NVY A;  2KLC A;  2LVP A;  4DHJ D;  4EFO A;  3UI3 A;  2XNA C;  2N9K A;  3AU5 A;  3DBL B;  4DHZ B;  1SEB D;  1ZDX A;  1N60 A;  1WMH B;  1BT0 A;  2BBC A;  5CHF A;  4NZL B;  1OGW A;  1IBX B;  2JZP A;  1YNT E;  2K22 A;  2KHW B;  4BFR A;  1KFY B;  4F1S A;  3AB5 A;  2JWU A;  1KOT A;  1HQR D;  3GZN B;  1N61 A;  2MW5 A;  5DPW A;  2B3A A;  4GB9 A;  4YSZ B;  2D3B A;  1EWC A;  1C79 A;  4N59 A;  3GP7 A;  2KAJ A;  4HKZ E;  3H6N A;  3E56 A;  2A4Z A;  5LLI A;  1A5R A;  2PW9 A;  3NRZ A;  2NMQ A;  4EEW A;  2KDF B;  2IYD B;  1J19 A;  1WZ3 A;  1V6E A;  3OAW A;  4EKU A;  4C56 C;  2MEK A;  4BKT A;  1WJ6 A;  3EGR A;  1PDX A;  1WH3 A;  3MP9 A;  3VVW B;  1PUT A;  4TSS A;  4ANW A;  2KNB A;  3AN1 A;  3RPF C;  1AN8 A;  2ZJD A;  1VD2 A;  4GLS C;  3K9P B;  3W1S A;  4QAY A;  1SGH A;  4KKI A;  1L6U A;  2WDT B;  1PGA A;  2YEP B;  5TSS A;  4I6N B;  3EA6 A;  3T3O A;  2WXH A;  1JWS D;  3BIN A;  5IA7 A;  2WXL A;  1MI0 A;  4W9L A;  4LLG M;  1XCQ L;  2MQJ A;  3DHG C;  2K6D B;  2MP2 B;  4OVU A;  5DPR A;  3H7P B;  3DBH B;  1WFY A;  2FAZ A;  1ZW7 A;  1J7C A;  2UWQ A;  2VH1 A;  3JYU A;  4LNF A;  4ARC A;  4WWN A;  1RWS A;  3A9J A;  1N5X A;  4DHJ B;  2AX5 A;  2G4D B;  3BVG A;  3RNB C;  2WLB A;  2JXT A;  1OQY A;  2LFI A;  3AE7 B;  1LQB A;  4G3X B;  3VTU A;  2KZR A;  5LXI B;  2GBJ A;  3V3X A;  2DZJ A;  5BMI A;  4P7I A;  1J8C A;  2K39 A;  4ANU A;  2L7R A;  3MTN B;  3DBR I;  4B0M A;  3HM3 A;  3FAH A;  1RLF A;  2IDY A;  2L0T A;  4FJV B;  2ZNV C;  3IVF A;  4G50 A;  2AWT A;  1MJD A;  1UH6 A;  4FJY A;  4RH6 A;  4JL9 A;  2R61 A;  2RMM A;  1UWM A;  3WAM A;  4MDK E;  2RR9 A;  3Q8F A;  2IGH A;  4P1B C;  4MM3 B;  3HIZ A;  2ICI A;  1QT9 A;  1FM0 D;  3N1Z C;  2AL6 A;  1XXG A;  5LXH A;  3EUB 2;  4LDT B;  1SB3 C;  1EU3 A;  1S1Q B;  1PYW D;  1C77 A;  2KYW A;  4KDL B;  1V97 A;  1NYQ A;  1XF5 L;  2O2V B;  4WJQ A;  1KLU D;  1M94 A;  4NJ7 A;  4RNA A;  1YMH E;  1WXA A;  5CHW A;  3UF8 A;  1TJE A;  2JXX A;  1Q10 A;  2KVZ A;  3P4P B;  5MPO A;  3TEZ A;  4HJK A;  2N9P C;  2BYV E;  3ZLZ A;  1FD6 A;  4K81 A;  1UBQ A;  2BS3 B;  1Z2M A;  2PJH A;  2IGD A;  3RUL A;  2ONQ A;  3QIJ A;  2KFK B;  1E7U A;  2V9H A;  3FKY A;  4AS1 A;  4KVG B;  2RDH A;  2Z8L A;  3QQ8 B;  4LJO B;  1DYQ A;  3QAR A;  2ZEQ A;  2KJH B;  2WQY B;  5HHD G;  4BKG A;  5HI1 A;  4EE2 A;  2B76 B;  1TTN A;  3JSV A;  4GSW A;  1I4Q A;  2BYE A;  4BBN F;  4E3C A;  5C1Z A;  3PRM B;  4C00 A;  2H88 B;  2TSS A;  2WXO A;  3TIX A;  1L0V B;  4HXD A;  1D4B A;  4B6W A;  2DZM A;  3E9S A;  2L3Z A;  1Y8R C;  3ZRF A;  2D07 B;  3ZDM C;  2EMT A;  4RGM A;  2I38 A;  2V3P A;  3PZ7 A;  2KDE B;  3KYC D;  4USA A;  1K8R B;  2KQ4 X;  1OEY A;  3LXF A;  4BOS C;  1L0Y B;  1ROE A;  3PLU A;  2CHZ A;  3U4E G;  2WHI A;  1TY2 A;  4ZYN A;  1YN5 A;  4M0W A;  3QC8 B;  5AUI A;  2XEW A;  2M17 A;  4IWQ A;  4BAX A;  2WDR B;  1I4G A;  2IND C;  2K6Q A;  3NHE B;  3QX1 A;  1UD7 A;  2WXR A;  3DQV A;  4DDG D;  2MHJ A;  2WDV B;  4A6Q A;  3O13 A;  3C8Y A;  4URK A;  3I57 A;  2KJ6 A;  3AM9 A;  2I1K A;  2BKR B;  1GNU A;  3SHQ A;  1WZ0 A;  4GDK B;  1V1P B;  2J52 A;  1D5M C;  5G5G A;  4BKS A;  5JHA A;  1D5Z C;  3N1Y C;  2XBB C;  3TMP B;  2YVC A;  2INC C;  3AU4 A;  1F9J A;  2AYO B;  1MFW A;  4DXA B;  1XLO A;  2JYE A;  2PPH A;  1AW7 A;  1T0S C;  1AYF A;  2J7Q B;  5FR3 A;  1C4A A;  2EEL A;  1FO4 A;  3O65 B;  2CR5 A;  4TUU A;  1STE A;  2KDB A;  4TQ1 A;  2R2O A;  4AUQ C;  4E71 A;  2HD5 B;  2L32 A;  1P1A A;  1RAX A;  2GI9 A;  2ZNV B;  3L10 B;  4ZRK A;  2Q5W D;  2BB5 A;  1QZE A;  2V0G A;  4WJO A;  1GPX A;  2D3G A;  1UF0 A;  1N62 A;  2Z0E B;  4WWP A;  3AH7 A;  2PE6 B;  2D10 A;  3UIP B;  2XK5 B;  4MH8 A;  1FMA D;  3ZUN A;  1Q0W B;  1GAQ B;  3AUL A;  2N4F A;  3N9Y C;  4HRS A;  3W5U B;  4C4V A;  2KLG A;  4EOY A;  4M00 A;  1WMH A;  1WYG A;  3C0R B;  1P7F A;  2V3N A;  2ON8 A;  1IBX A;  4W9D A;  1CMX B;  3JW0 X;  5J2R A;  4AP4 C;  1E8Y A;  4X57 B;  4IKG A;  2JPH A;  3ZJT A;  3JSV B;  3N1X C;  2ZPY A;  3R8B A;  1VLB A;  3WIM A;  2AQ1 B;  2AQ3 B;  3HVD A;  4FHJ A;  3M62 B;  1V1O A;  3PT2 B;  2MBH A;  3C19 A;  2IGG A;  5C3J B;  4XDD A;  4W9K A;  1WI0 A;  2LEK A;  2RDB C;  2Z0D B;  5HKH A;  5L95 C;  3APF A;  2K9X A;  5JXV A;  3FIL A;  1L4Z B;  1JWB D;  2BWE S;  3ML8 A;  5IP4 D;  2WP9 B;  2K3U A;  3ETR A;  5BMG A;  2WU5 B;  3KWV A;  1I4X A;  2KQS A;  3DVN U;  4Q2J A;  1UEL A;  4M02 A;  4O1N A;  1OQQ A;  2LGI A;  4ITK A;  2ZW1 A;  4XDC A;  3ZYY X;  4CHK A;  3ZDT A;  2M19 A;  5KHO A;  4YSX B;  4KIK B;  1CK1 A;  4HCP B;  1EM7 A;  4LNN A;  2ZPN A;  5AUK A;  1YJ1 A;  3L4P A;  4A3P A;  4K7W A;  3U30 A;  4EZL A;  2NBV B;  1T3Q A;  5D2M B;  3BVZ A;  4IM2 A;  3RMK C;  1WGK A;  4IDI A;  4WAA A;  3VH3 B;  1J7A A;  3SR6 A;  1ENF A;  2BPS A;  1CQV A;  2D11 A;  5D3D A;  2YEP F;  3CMM B;  4A90 A;  5DCN A;  1AAR A;  3NS1 A;  2MP2 A;  3PS6 A;  4PT5 A;  1LFD A;  4II2 B;  4YTM B;  1FFU A;  3H7P A;  5EE1 A;  1UNS A;  1IGC A;  2M1M A;  1I7H A;  2FCQ A;  3KUZ A;  1R7S A;  2LUM A;  1YN3 A;  2KWC A;  3DBR B;  3V6E B;  4EZJ A;  5JHB A;  1ISN A;  5E6O A;  3TBL D;  5HFY A;  2PLP A;  3B2F A;  4F7Z A;  3AEA B;  4FAD A;  5JH5 C;  3IFW B;  3BZD B;  2GBK A;  2GLS A;  3PSE B;  1WY8 A;  5C2T B;  3U8Z A;  1WGH A;  3CIR B;  3Q69 A;  1P98 A;  2M8S A;  3RD2 A;  3W5V B;  4JWS C;  2DNF A;  3WAL A;  1GUA B;  3V62 A;  3VRA B;  3PVL A;  2Y5P A;  2KXJ A;  3VAW A;  1QLB B;  5AZG A;  3KQ4 A;  1HZ5 A;  4WJP A;  3PZD A;  4N58 A;  2FBW B;  4RGN A;  1PGB A;  2HE7 A;  3I3T B;  5KHQ A;  2HDE A;  4YSY B;  3PGE A;  3BY4 B;  2ZCB A;  3DVG Y;  2MRP A;  4N6E B;  1T0Y A;  4YTP B;  2KWV B;  2W54 A;  4PK1 A;  2KWU B;  3IT6 B;  1VJK A;  4K7S A;  4BVU C;  1LO5 D;  4C4V B;  2GB1 A;  1DOX A;  4WAF A;  4P16 A;  2WXJ A;  3ZGZ A;  2N1W A;  2HTM E;  3OG5 A;  3VTV A;  2KFK A;  1BUI C;  1JWM D;  4GIV A;  2CU1 A;  2Z59 B;  1WE6 A;  1YJI A;  1Z5S B;  3PRP B;  5D6J B;  3MC9 A;  1T0Q C;  4W9H A;  2AQ2 B;  3SDL C;  4RFB A;  3PHX B;  3CSF A; 
#chains in the Genus database with same CATH homology
 2WS3 B;  4ARI A;  1QT9 A;  1FM0 D;  2PVO D;  1XXG A;  2KAC A;  5T8I A;  1QF6 A;  3EUB 2;  1SB3 C;  1EU3 A;  2WDQ B;  1GB4 A;  1PYW D;  1ZXH A;  1PGX A;  2I2Y A;  4P6V F;  1C77 A;  2CJN A;  2JX5 A;  4KGR A;  4A9A A;  3PZ8 A;  1FXA A;  1K52 A;  3FIL B;  1PFD A;  1V97 A;  1F2R I;  1NYQ A;  1F77 A;  1SSN A;  1XF5 L;  4AQ7 A;  1KLU D;  1D6E C;  2G9H D;  2Y3A A;  4RNA A;  1SF0 A;  2K0P A;  1YMH E;  3MJ5 A;  1TJE A;  3BYY B;  1Q10 A;  3NVW A;  3P4P B;  1FRD A;  2INN E;  1BXT A;  5MPO A;  3TEZ A;  2VZK D;  3TSS A;  1FD6 A;  1K50 A;  2KN4 A;  1M4V A;  2BS3 B;  3AEC B;  4FXC A;  2IGD A;  3BWU D;  2ONQ A;  4WQM A;  1ZXI A;  4AS1 A;  5BMH A;  1F2R C;  3MFG A;  4WH4 A;  1VZ6 A;  2RDH A;  1FCC C;  1E6E B;  1DGJ A;  2Z8L A;  3U52 E;  1DYQ A;  3DWM A;  1XEE A;  3U2S C;  1JML A;  2JYT A;  2WQY B;  1HXY D;  5HHD G;  5LNK 1;  5HI1 A;  1JAL A;  1A70 A;  4EE2 A;  2B76 B;  5H8Y E;  2WXP A;  1EU4 A;  1I4Q A;  4WWM A;  1L4D B;  1N63 A;  1C78 A;  2PIA A;  1WRI A;  1NI3 A;  1ZPS A;  1C9F A;  1ZE3 D;  1KH0 A;  2H88 B;  3BYT B;  2TSS A;  4HEA 1;  2WXO A;  4ZHO A;  1L0V B;  1TS2 A;  1E9M A;  1KRH A;  1D4B A;  2X38 A;  2L1A A;  3E9S A;  3AE2 B;  2DYM A;  4KGS A;  3ZJV A;  1VR9 A;  2G1E A;  1RFK A;  2SAK A;  1D5X C;  4HRO A;  3ZQ4 A;  1I4P A;  1QOG A;  4RGM A;  2I38 A;  4TQ0 A;  2V3P A;  1SE4 A;  3PZ7 A;  3R2T A;  4A8X C;  4L1B A;  5E6J A;  2BTE A;  1ACC A;  3AED B;  2WXQ A;  3P4Q B;  1E10 A;  2N7J A;  1V1P A;  3I9V 1;  1KF6 B;  2FUG 1;  1RYJ A;  2MJE A;  4USA A;  3URY A;  2E6X A;  1FXI A;  4RF1 A;  2KQ4 X;  3LXF A;  2RPV A;  5BYS A;  1WXQ A;  1L0Y B;  1ROE A;  1GB1 A;  1HZ6 A;  1FNU A;  1QOA A;  3U4E G;  3VQI A;  1Y56 A;  2E3T A;  1TY2 A;  4DXG A;  3ABV B;  2MJD A;  1YN5 A;  3MHZ A;  4M0W A;  1T6B X;  2M0A A;  4H2A A;  3SFE B;  1JW9 D;  1XLQ A;  5AUI A;  4CQN A;  2LHE A;  2QMT A;  4J3O D;  3AMZ A;  2WDR B;  1OQR A;  4KGT A;  4RGT A;  1I4G A;  4MT5 A;  1NEK B;  5I4D A;  1VDV A;  3W2D A;  1RM6 C;  1ZDV A;  2WXR A;  2MH7 A;  1TKG A;  3H8H A;  2JQR B;  2ACZ B;  4OVZ A;  5FKA C;  4JX1 C;  2PKO A;  2BS4 B;  1JWA D;  2WDV B;  4A6Q A;  3O13 A;  1C4P A;  3C8Y A;  1N5W A;  4UDU C;  2QSD A;  3P4S B;  3I57 A;  3AM9 A;  1AWD A;  1MVK A;  2J4X A;  3NVZ A;  3AEB B;  4GDK B;  3TEY A;  1V1P B;  2J52 A;  3P4R B;  1D5M C;  5G5G A;  1D5Z C;  1YJJ A;  3IAS 1;  4REZ A;  3AE9 B;  1L5P A;  2DWQ A;  5BYR A;  4HKQ A;  2VZK B;  1ZUD 2;  1TS3 A;  3LB8 C;  2H89 B;  2DLB A;  2RDG A;  1SJE D;  1XLO A;  2JYE A;  3AEE B;  4OW0 A;  1MPE A;  2DBY A;  1AW7 A;  1ZP0 B;  1AYF A;  5FR3 A;  1C4A A;  2EEL A;  3CWI A;  5EE0 A;  4TMA B;  4JPS A;  1FIQ A;  1FO4 A;  1I4H A;  2BYT A;  4R3D A;  1TS5 A;  3NZ3 A;  3P1M A;  2LMC A;  1STE A;  4TQ1 A;  5BYQ A;  1QIL A;  3KWL A;  1QOB A;  4WIP A;  2QIE B;  2L32 A;  4NAW B;  4C7Z A;  3TEW A;  1ZOY B;  4GDL B;  2GI9 A;  1KTK A;  3BII D;  4ZRQ A;  1EWY C;  2Q5W D;  2BB5 A;  2DYO A;  2INP E;  4XWW A;  4MAC A;  3MC0 B;  5EE3 A;  1XO3 A;  3U7Z A;  2V0G A;  1GPX A;  3AE6 B;  1XCT L;  1P7E A;  3BK1 A;  2KMM A;  1N62 A;  3KLS X;  3W9C B;  4L23 A;  4D2K A;  3Q8A A;  2OED A;  2V4I B;  2WNM A;  2SEB D;  3AH7 A;  3TUO A;  2L52 A;  1MHH E;  1FCL A;  1TZO A;  1E7P B;  1VZ8 A;  2Y5C A;  4YXD B;  4KX6 B;  4MH8 A;  1FMA D;  3OWE B;  1SXT A;  1FNV A;  3AE3 B;  5G5H A;  1GAQ B;  1NVI D;  1SE2 A;  2OHF A;  4IOI E;  5GXG B;  2PMV A;  3N9Y C;  2WXN A;  4HRS A;  3W5U B;  1XLN A;  3ZJU A;  1WYG A;  1P7F A;  2PTL A;  2V3N A;  4RGO S;  2ON8 A;  1UWX A;  1FRR A;  2PVG C;  1IBX A;  3T3N A;  2M56 B;  3B2G A;  4LK0 M;  3AE5 B;  3VR8 B;  1JQ4 A;  2ZW0 A;  3PO0 A;  1K53 A;  1VRA B;  2BS2 B;  5D7G A;  2BT6 A;  4YTN B;  4RCO A;  1CJE A;  2FE8 A;  4IKG A;  3SFD B;  1K51 A;  3BVM A;  3ZJT A;  3R8B A;  1VLB A;  5EE9 A;  2AQ1 B;  1JWU D;  4OZC A;  2AQ3 B;  3HVD A;  1SJH D;  3R2I A;  4ZHP A;  1BML C;  1V1O A;  3IXS A;  4L2Y A;  2D5G A;  2W3R A;  3AEG B;  3V05 A;  2IGG A;  5C3J B;  2WU2 B;  3GS2 A;  4XDD A;  1KLG D;  1OFF A;  2LEK A;  1ET9 A;  2K9X A;  5JXV A;  3FIL A;  2IJ0 A;  4YT0 B;  1L4Z B;  1GOZ A;  5FK9 C;  3HUI A;  3NVY A;  1JWB D;  4ZOH C;  3UI3 A;  2KWD A;  4DXF A;  2XNA C;  2WP9 B;  2N9K A;  3IAM 1;  3WCQ A;  3GB1 A;  4ZYS A;  2K3U A;  1SEB D;  3ETR A;  1JRO A;  5BMG A;  1ZDX A;  2WU5 B;  1N60 A;  1UUP A;  1QQR A;  1I4X A;  1QKZ A;  3KWV A;  1HA5 A;  2BBC A;  1FFV A;  4NZL B;  1IBX B;  4Q2J A;  1JRP A;  1V8C A;  2WXK A;  2JZP A;  4O1N A;  1YNT E;  1OQQ A;  2K22 A;  2LGI A;  4US9 A;  2LHD A;  3B9J A;  3TEX A;  1ET6 A;  1NYR A;  2KDM A;  2ZW1 A;  1KFY B;  4ITK A;  4XDC A;  3ZYY X;  3AB5 A;  2JWU A;  2M19 A;  3J9C A;  2JSV X;  2BW2 A;  4YSX B;  1CK1 A;  4HJG E;  4NAM A;  1EM7 A;  1HQR D;  2QJL A;  4LTU A;  2IPK D;  5AUK A;  1N61 A;  4ZRP A;  5D3I B;  3L4P A;  3IT4 B;  1T5X D;  4WUR A;  1SIJ A;  4OZA A;  4YSZ B;  3AE4 B;  4DQO C;  1EWC A;  1C79 A;  1T3Q A;  3BVZ A;  4N59 A;  3VRB B;  3GP7 A;  1WGK A;  2KAJ A;  4HKZ E;  4IDI A;  3E56 A;  4XE0 A;  1IGD A;  1YN4 A;  4A55 A;  2LJI A;  1J7A A;  1IUE A;  3P42 A;  3SR6 A;  1ENF A;  1CQV A;  5D3D A;  2W3S A;  1CZP A;  2YEP F;  4A90 A;  2PW9 A;  3NRZ A;  2XN9 C;  3HVZ A;  1I4R A;  2NMQ A;  3NS1 A;  1TY0 A;  4PT5 A;  4YTM B;  1FFU A;  1NEN B;  2GRI A;  5EE1 A;  1UNS A;  4C56 C;  1IGC A;  1I7H A;  2MEK A;  3FC4 A;  4C80 A;  4JE3 B;  1R7S A;  2LUM A;  3EGR A;  4B0E A;  1PDX A;  3MP9 A;  3VR9 B;  1PUT A;  1VZ7 A;  4TSS A;  1YN3 A;  2N9L A;  3AN1 A;  3RPF C;  1AN8 A;  2WXM A;  2J53 A;  2N0S B;  4GLS C;  5HFY A;  4NJC A;  1E0Z A;  2PLP A;  3W1S A;  3B2F A;  2QIL A;  3AEA B;  3LYY A;  1TYG B;  4KKI A;  3BZD B;  1L6U A;  5C2T B;  4RF0 A;  1PGA A;  1YQ4 B;  3CIR B;  3Q69 A;  2K5P A;  2YEP B;  2J42 A;  3W5V B;  5TSS A;  3Q8B A;  3EA6 A;  4YWG G;  3T3O A;  2WXH A;  1JWS D;  2WXF A;  1DOY A;  1B1Z A;  4JWS C;  4US8 A;  2WXL A;  1MI0 A;  1QOF A;  3VRA B;  1L6V A;  4LLG M;  1XCQ L;  3NUH B;  1DOI A;  1UGJ A;  2MJ3 A;  2Y5P A;  1ESF A;  2QEJ C;  2CU3 A;  1SBB B;  1J7C A;  1HEZ E;  3SEB A;  1QLB B;  4XWT A;  1F0Z A;  4ARC A;  3AE8 B;  2NTS A;  3KQ4 A;  1RWS A;  2EKI A;  4OZB A;  3HRD D;  1HZ5 A;  4C7Y A;  1C76 A;  1N5X A;  3RFZ B;  4N58 A;  2FBW B;  5HG2 A;  4RGN A;  2W82 A;  1FNW A;  1PGB A;  3DWG C;  1SE3 A;  2AX5 A;  2WXG A;  2HDE A;  3AV8 A;  3AEF B;  3BVG A;  4YSY B;  2BB6 A;  2WLB A;  2JXT A;  1J7B A;  2LFI A;  1L0X B;  3AE7 B;  4OHJ A;  4N6E B;  2WXI A;  3Q8C A;  3P63 A;  4YTP B;  5H92 C;  3BK2 A;  2W54 A;  1C4C A;  1XLP A;  3IT6 B;  1VJK A;  1MHX A;  3NVV A;  1FEH A;  1LO5 D;  3V3X A;  3Q8E A;  1DOX A;  2GB1 A;  5BMI A;  1WSP A;  4WAF A;  4P16 A;  2WXJ A;  3ZGZ A;  1JCK B;  4B0M A;  1TKY A;  3FAH A;  2IDY A;  2HTM E;  2JU6 X;  2CJO A;  1YQ3 B;  2NTT A;  1BUI C;  1JWM D;  1WWT A;  4RH6 A;  1TS4 A;  2R61 A;  4JWU C;  2RMM A;  2W55 A;  1UWM A;  1YJI A;  2L83 A;  1B9R A;  4KKJ A;  3Q8F A;  1TKE A;  2AQ2 B;  2IGH A;  4RFB A;  3AE1 B;  4MM3 B;  2ICI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...