2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
b'MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords hypothetical protein Ta0895
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
1KF6B 2MJEA 4WQMA 1PUTA 5C3JB 2MJ3A 3ABVB 1NI3A 3LXFA 4YTMB 3BIID 3AMZA 1N62A 1TKYA 2WDQB 4LTUA 1WWTA 2WU2B 2BS4B 3W5VB 1TKEA 4HRSA 1CJEA 3HRDD 3NVZA 4JWUC 2FBWB 1DOXA 1JWBD 4YSXB 1EWYC 2AX5A 1QOBA 1QOAA 1GAQB 1I7HA 4KX6B 1R7SA 1JALA 3AEDB 2JQRB 1FFUA 1ROEA 3VRAB 1NEKB 4N6EB 2M19A 3P4PB 3P4SB 2BT6A 1AWDA 1YJJA 2BS2B 1TKGA 3PO0A 2WDRB 1RM6C 1QOFA 3AE7B 1L6VA 3DWMA 1VLBA 4ZHOA 2CJOA 5G5HA 1FRRA 1DGJA 2MJDA 1NVID 2CJNA 3ETRA 1E7PB 2WDVB 3AE5B 3AH7A 3P63A 3W5UB 2K9XA 1A70A 2E3TA 4YT0B 4N59A 4C7ZA 1SIJA 3AM9A 1XLPA 2JX5A 1YQ4B 2HTME 1FM0D 2WLBA 3SR6A 2H88B 2WP9B 1VJKA 2ACZB 3AEFB 3P4RB 1KFYB 1N5WA 1T3QA 2W3RA 4IDIA 1N60A 3AE8B 3SFDB 2B76B 2M56B 3HVZA 1TJEA 1GPXA 3AE6B 1ZXIA 1WXQA 1JWAD 3RPFC 2L52A 1N63A 1ZUD2 1QF6A 3CIRB 2DWQA 1JW9D 2K22A 1PFDA 3B9JA 3DWGC 5EE9A 1E6EB 2KMMA 5MPOA 2PIAA 1DOIA 1NENB 1WYGA 2Y5CA 3ZYYX 2CU3A 2QJLA 5EE1A 1F0ZA 1FFVA 1YJIA 1RFKA 3AB5A 1J7CA 1XLOA 2L83A 5AUIA 1B9RA 3AEGB 1V8CA 2BS3B 4YSZB 3P4QB 2DBYA 1IUEA 4WWMA 1DOYA 1ZOYB 3AEBB 4YXDB 2EKIA 2W55A 3AE2B 1PDXA 4ITKA 2Q5WD 3NVYA 2PKOA 5H8YE 3NRZA 3AE1B 1JQ4A 1RWSA 2H89B 4USAA 1XLQA 3HUIA 1QOGA 3LB8C 1N61A 4JWSC 4ZHPA 1YQ3B 4C80A 1XO3A 4YTNB 3NVWA 3WCQA 1OFFA 3AEAB 1JROA 2W3SA 3AN1A 4N58A 1J7AA 2W54A 2WU5B 1E0ZA 3EUB2 1FMAD 3AE4B 5H92C 1WRIA 1FIQA 1OQQA 4HROA 1FXAA 1E10A 1FXIA 1RYJA 3VRBB 1NYRA 1N5XA 2LEKA 2N0SB 3P1MA 3W9CB 3SFEB 4FXCA 1SB3C 4US9A 2PVOD 1XLNA 5EE0A 3VR8B 4YTPB 4ZOHC 1OQRA 2PVGC 1QT9A 3CWIA 1KRHA 1QLBB 1SF0A 1WGKA 1E9MA 4US8A 2G1EA 2QIEB 2WQYB 5AUKA 4P6VF 5G5GA 5EE3A 3VR9B 1UWMA 2KAJA 1FO4A 1V97A 1VDVA 2OHFA 3FC4A 1L5PA 2WS3B 3AECB 1FRDA 1JRPA 5GXGB 3AE9B 2K5PA 3FAHA 3AE3B 1L0VB 4A9AA 1L6UA 4YSYB 1ZP0B 3AV8A 3NS1A 1AYFA 1CZPA 1J7BA 3B2FA 3L4PA 3NVVA 4JX1C 3AEEB 4C7YA 3B2GA 5C2TB 2MH7A 1NYQA 1TYGB 3KWLA
chains in the Genus database with same CATH superfamily
1J19A 3PRMB 4BAXA 2PLPA 4RF1A 2PPHA 3L54A 5IP4D 1XXGA 4XDCA 1DOXA 4PT5A 1HTQA 4XYCA 1YN5A 4B6WA 2GBKA 1C1YB 1EF5A 1K50A 3DVGX 4N6EB 4OW0A 3DWMA 2LUEA 1WM2A 2W9NA 1FRRA 5AEKB 2SEBD 3AE5B 4CQNA 3P63A 4FJVB 4N59A 1C4AA 1TZOA 4O1NA 2WXJA 3LDZE 1UWXA 1YQBA 5G55A 3ECIA 1EO6A 1T3QA 4MGKE 2WHIA 3NZUA 2B76B 4WJPA 3QARA 4IUMB 4ICUA 4FJZA 2DYBA 1SGHA 1EM7A 2W82A 5EE9A 2D3CA 2KMMA 1DOIA 2CU3A 2QJLA 3NUHB 1YJIA 3ZKJC 4WWNA 3RD2A 4HCPB 3DVNU 2DBYA 1DOYA 1PGXA 2Q5WD 4A8XC 1KLUD 1QZEA 5H8YE 3B08A 4BKTA 3NVWA 2LGIA 3N30A 3WCQA 1C4PA 5D3IB 3RT3B 3N3KB 3Q3MC 1GG3A 2WXFA 4MM3A 5L95C 2NTTA 1KTKA 1N5XA 2NVUI 2LEKA 2B3AA 3R8BA 2J0JA 3DOWA 2NBUA 2WXRA 2ZVNA 4NJ7A 1QLBB 2N1WA 3H6NA 2LVPA 2LD9A 3HM6X 4J3OD 1CQVA 3VTVA 3SEBA 1FRDA 4DXAB 5HHDG 4NZLB 2KN4A 2M8SA 1WJ4A 2GBNA 3R66C 3WAOA 3NOBA 3NVVA 3WALA 2AL3A 3P2BA 2IDYA 1LQBA 4RCOA 3BIID 4FJYA 1YN3A 3TEZA 1TZ1A 2JRIB 3VAWA 1QKZA 1Y8RC 1QOAA 1GAQB 2K8BA 1E8WA 1F2RC 3RFZB 2D5GA 5LNK1 3OLMD 3DPDA 2JRHA 2V3SA 1WGRA 5G5HA 3W1SA 3W5UB 4MGYE 2JVCA 3PS6A 5IO9A 4EZKA 1A70A 3E56A 4E74A 2VZKB 2QHOA 2WLBA 3N1XC 3RUIB 3AEFB 3RNEC 2YEPF 3RZFA 2KDMA 4HEA1 3I5JC 1QF6A 2IYDB 1KLGD 1V49A 2IY1B 1NENB 2I1JA 3N9YC 1GB1A 5AZHA 1RFKA 3AB5A 2O6VA 3RULA 2J0KA 4WWMA 1UELA 2EKIA 2KDIA 4JIOU 4YWGG 1D5MC 4KGTA 1R4NB 2VRRB 1MFWA 1JQ4A 2RPQA 4C80A 3NJTA 3PSEB 3OJ3A 1E10A 4AS1A 3ZW3A 4W9FA 3VR8B 3CWIA 2RR9A 2G1EA 4TSSA 4HK2A 5AUKA 4GU2A 4P6VF 4BKGA 1IBXB 4MGZE 4ARIA 4XZ4A 1VDVA 1OEYA 4C4VB 3D32A 3AE9B 5HI1A 2C5LC 4HPMB 4WH4A 1AYFA 1KM7A 1ZPSA 2LZ6A 1UGJA 1Z5SB 2JZZA 3L08A 5D6JB 3UGBB 4XGAB 1V1PA 2D11A 5BYSA 3Q6BA 1JCKB 1LGRA 3TEWA 3IAS1 2PW9A 4IWOA 1ROEA 3IVFA 3Q3FA 2JY6A 2AEHA 4AQ7A 1SE3A 3SHQA 1UBQA 4MDKE 3FILB 3VXWA 2E3TA 2M17A 2BYEA 1Q10A 2RDGA 1VD2A 4IM2A 4KSKC 2KACA 2LGXA 2HTME 1MI0A 2JPHA 1HQRD 3AE8B 4C00A 4PK1A 4RH6A 3Q8BA 1ZUD2 4RM9A 3CIRB 2JT4B 4XX5A 1E6EB 1HZ6A 1FD6A 1RFAA 1EF1A 1HEZE 1P7FA 3U2SC 2MHJA 2V3PA 1ZOYB 3DVNV 4DDGD 1SSNA 5J18A 3AE2B 4WAAA 2KVZA 4EZLA 3H7PB 1UUPA 3VH4B 4K7SA 3NRZA 2H89B 3NZSA 2ZW1A 1N61A 3H9DA 5BMGA 4K81A 4MGIE 4PS8A 4B0EA 3AN1A 2W54A 2L7RA 4K1RB 2Z0DB 3GE3C 3V60A 1NYRA 3W9CB 2IGDA 1KRHA 4W9JA 4NAWA 4D2KA 1ZW7A 5HFYA 1HA5A 4LJPB 4WWOA 4A9AA 2BWFA 4I6PA 1VZ7A 1RRBA 2QCZA 2WXLA 3AU5A 4LNFA 3Q2AC 2A4ZA 3U7DA 5FK9C 3PREA 3GZNI 2MJ3A 4BKSA 2R2QA 2OEDA 2AYOB 2GLSA 3A4SC 3CF6E 4ZRJA 2MW5A 3DBHI 5LLIA 4ZYNA 5DCNA 3JVZX 3IT6B 1JALA 5JHBA 2LRWA 2K6QA 1YJJA 1QQRA 2XK5A 3VH3B 1C9FA 2DNFA 1E7PB 3AH7A 2K9XA 4S17A 1L7YA 1C4CA 2BKRB 4ANUA 2KFKA 3UF8A 1N5WA 1V81A 1J0GA 1WY8A 4K7WA 1YD8U 1ZXIA 3DBLI 4IM0A 3WIMA 1ZDVA 4EE2A 1YX5B 2DLBA 2L32A 5AZGA 2LRUA 1BMLC 2KDBA 4DBGA 4B9KA 1B9RA 3OJ4B 4Q2JA 5CHFA 3BVZA 2GRIA 2KLGA 1MG4A 2UWQA 2PKOA 4HJKA 2DZMA 4HLEA 4ZHPA 2LJIA 3B0AA 2JWUA 1JROA 1T0YA 1J7AA 3CMMB 3P1MA 3ZO5B 2XEWA 1WM3A 1SF0A 2QILA 1UH6A 2V1YA 3PPAA 2WQYB 5T8IA 4GDKA 4ANVA 1WI0A 4G50A 2J52A 2PTLA 3M3JA 1SEBD 3R2IA 3FKYA 2C7HA 4XWTA 4G0NB 4KDIC 3A33B 2RGFA 2I1KA 4TQ1A 1KF6B 4MJSA 5D7GA 1N62A 4LTUA 3U7ZA 2ASQA 4F7ZA 4CHKA 3C0RB 1T0RC 1XCTL 2D10A 1T0SC 4WURA 4JQWC 2CJOA 2WXGA 2FE8A 1WE6A 3ML9A 4YT0B 4NNJB 2NPTA 3TEYA 1CK1A 2H88B 1D6EC 2L00B 2DZKA 1KFYB 2DAFA 2MP2A 3LYYA 1WRDB 1SE4A 2GOWA 1C77A 4ZDVA 4P1BC 5KHOA 2HJ1A 2PIAA 2Y5CA 3RMKC 2WXKA 2ZVOA 2K39A 1V8CA 1WFYA 2BS3B 2LI5A 1FXTB 1GUAB 3N1ZC 4DHZB 4RNAA 5GMVA 3O65B 2MA9B 1EWCA 1OGWA 2M4NA 4P7IA 3AXCA 1XO3A 3GP7A 2N7JA 2WU5B 3A4RA 1I4QA 3T9LA 3NS8A 3VUXA 2WWZA 2N0SB 3U52E 4HDQA 3EFUA 3KQ4A 1WSPA 4KDLB 1E9MA 2IPKD 4M0WB 2FCSA 3LJ3A 2N7DA 1MHHE 2CKHB 2KLCA 2LHEA 1GC7A 1YJ1A 3AECB 3IAM1 4AUQC 1P1AA 2N9XA 4CYEA 3MC8A 4KVGB 3DBHB 4RGOS 4JX1C 3B2GA 1R4NI 2M0AA 5CX3A 1BXTA 4W9GA 3ABVB 2BS4B 3A9JA 3W5VB 1TKEA 2INNE 1U4AA 4GDLA 3VTUA 1QOBA 3L17A 2REXA 4HPLB 2N4FA 2LXAA 2WDRB 4PYZA 4AJWA 2AWTA 5BYQA 4IWPA 1TTNA 5IA7A 4J6IA 3DBLB 1SIJA 4TMAB 2JF5A 3APFA 3T3OA 2WP9B 4ZYSA 2X38A 1TJEA 2E6XA 2FAZA 3HVZA 3WAMA 3ZNHB 2KYWA 2HD5B 4KIKB 3B9JA 3Q69A 3ZIMA 1WH3A 3JSVB 2MCNB 4A90A 3Q3OC 2BB5A 3UI3A 4M8MA 3PZ7A 2VH2A 3V62A 1PDXA 3AI5A 3VUYA 5KHQA 1RWSA 2V9HA 3WAPA 4K3BA 3AU4A 4RGTA 4WIPA 5IAAC 3DVGY 3KH0A 3PTFC 1OFFA 3K9OB 2KQ7A 1OQYA 2KOXA 1SE9A 1XD3B 1WXMA 1V80A 3W2DA 3BY4B 3U4EG 1L0XB 4RM8A 1RYJA 3MHSD 3VRBB 2PVOD 2BPSA 4FLHA 4YTPB 1KJTA 3KWVA 4IG7B 1PQSA 2X8XX 1V1OA 1D5ZC 2WX1A 3PV1A 1J7BA 5BMHA 1D5XC 3AEEB 1Q0WB 1T6BX 2UU7A 1NI2A 1NBFC 2KVRA 3KYDD 1ISNA 3AULA 5D2MB 5IN7A 3K9PB 2K6DB 4JWUC 3VQIA 4YSXB 5E6OA 1G6JA 4M01A 4TV3A 2BVCA 4K7UA 3WANA 2KO3A 4EKUA 1WJUA 3HVDA 3ZNZB 2QDFA 2LVOA 4W9KA 2MWSB 2V3NA 3ZNID 3NY5A 1V5OA 1OEYJ 1OTRB 5FKAC 3DWGC 1F9JA 4B95A 1SJED 1WJ6A 1XT9B 3ENEA 2KX3A 3A9KA 3AEBB 2MRPA 1EU4A 4MEMA 3NVYA 1K53A 2NBWB 2OJWA 2Y5PA 3AE1B 2PEAA 4RMAA 1F2RI 2KC2A 2D3BA 1E5WA 2BYFA 2PE9A 1I4GA 5E6PA 5CHVC 4DK5A 1TBEA 5BMIA 1XLNA 2TSSA 1I4PA 3APDA 2LASA 2INDC 2QIEB 4GN1A 2RD0A 2UYZB 3VR9B 1F52A 4DHJB 1UWMA 5J17A 3C19A 1WR6E 2KTRA 3BK2A 4EZJA 2QMTA 2MEKA 2GBMA 4BVUC 2ONQA 3GOEA 2BBCA 3IXSA 2O2VB 4KKJA 4WQMA 5C3JB 3M63B 4HRSA 3NVZA 4II2B 2FBWB 1ACCA 4LCDE 2R2OA 2O6VD 4AJYB 2BQQA 1FFUA 3VRAB 1YN4A 3EGRA 3R3MA 5FR6A 1L6VA 1DGJA 4W9HA 3L0WB 1TGZB 2OOBB 2HDEA 2KJ6A 3V05A 1E90A 1R4MB 4W9DA 1VJKA 4IDIA 2W3RA 5G2NA 4I6LB 4WQOB 5TSSA 5E6JA 3ZJUA 1JWAD 2WXHA 1SBBB 2GBRA 2BKFA 1I42A 2IO0B 3RNGC 2NBVB 3T3NA 1WYGA 3N20C 3ZYYX 3N1YC 4DQOC 3L16A 5E6NA 2LUMA 2XBBC 2DZJA 5D3DA 4DXFA 2W55A 3URYA 3EA6A 1C78A 4ICVA 3KUZA 4PS7A 1JWMD 3DHIC 3IBEA 2CHZA 2R61A 2FNJB 3DBRB 2IZVB 3AE4B 1FIQA 2K25A 3Q8EA 1FXAA 4G3XB 1STEA 1UBIA 1SXTA 2YLMA 2ZW0A 2EMTA 1ET9A 2EMSA 4F8CB 1GJZA 2EELA 3ONSA 1YIWA 1LFDA 1L0VB 2FCMA 3EC8A 4LNKA 3UIOB 4FHJA 3BVGA 1RAXA 1X1MA 3SDLC 2LGSA 3L10B 2WU2B 2KT7A 3BK1A 3PLVA 1R7SA 3BYTB 3PGEA 4EUTA 2BS2B 2L1AA 3PT2B 4B0MA 3PHWB 4PS3A 1D3ZA 2G45B 3ZRFA 5DPRA 2Z0EB 2INCC 1M94A 2IBIB 4A3OA 2VH1A 1FM0D 3RNBC 1UF0A 4NJ6A 3QWZB 2CU1A 4DHZE 1QILA 2D3AA 3AE6B 3RPFC 3R7RA 2EKEC 2ZPNA 1FNWA 1PGBA 1TS3A 4NJCA 2RMMA 3ZNGC 5LXHA 3I63C 3RCZA 1KLVA 1ENFA 2K3UA 1L2NA 3R7QA 4H2AA 2MBHA 4G11A 4EEWA 2M0XA 4FN2A 4MSQB 2IO3B 2KJHB 1E8XA 4WWPA 1YMHE 1WX7A 2AL6A 1V2YA 2HJ8A 2N1VA 2LXCA 2FCNA 4DHJD 5EE3A 2BYTA 1XEEA 3MC0B 3TUOA 5C1ZA 1JRPA 3APCA 3MJWA 4L1BA 1E7VA 1LM8B 1NDDA 2MLBA 3DDCB 3DHHC 4AWJA 4C7YA 1AN8A 3V61A 4C4VA 3GS2A 4IM3A 5TR5A 1V9JA 1NI3A 4YTMB 1TKYA 2L76A 4XWWA 1WWTA 2G4SA 3A1QA 3Q8FA 1BUIC 2C7MB 3V3XA 5JH5C 1I4RA 4MELA 2D3GA 3TMPB 1NEKB 2M19A 4GB9A 1WMHA 2DHZA 1AWDA 4IWQA 1TKGA 2JZPA 1RM6C 3V6EB 3ZTDA 1ZKHA 3ETRA 2ZPYA 2ZNVC 3FILA 4P16A 4IOIE 2MSED 4LNOA 2KNBA 3VDZA 1EU3A 2JZ3B 2A5UA 3Q14C 1GC6A 1V5TA 2J4XA 2KWDA 3UQAA 3I3TB 3Q8AA 1J8CA 1WZ3A 3P42A 4M02A 1IGDA 3AEGB 1L0YB 4KKIA 4WAFA 4HJGE 5L83A 2ZCCA 4A3PA 2G9HD 1XLQA 3IT4B 5D94A 4MM3B 1JWUD 4OVVA 2HTHA 2NS5A 3H7PA 1F1HA 3BINA 3QIJA 2C7NB 1E0ZA 1Q5WB 4HVBA 2KK8A 3SFEB 2PMVA 1QT9A 4WJQA 4US8A 1JMLA 4HXDA 5HG2A 1P7EA 1TT5B 1UNSA 2YVCA 4HPPA 1FO4A 2OHFA 4K3CA 4OZAA 2MBOA 2K5PA 4FHKA 4EFOA 4URKA 4YSYB 2WXMA 4I6NB 1I4XA 3EHVA 2BGFA 3UIPB 2MJEA 1K8RB 3RZWC 1PUTA 4NAMA 5C23A 4JL9A 2WXQA 3MC9A 3HRDD 3MJ5A 2WDTB 1UGMA 2JQRB 2WXPA 4AP4C 1HZ5A 2MBEA 3M62B 3PO0A 3AE7B 1VLBA 4NQLB 4C56C 2L0TA 4ARCA 4JE3B 2DAJA 2BTEA 2JX5A 4BFRA 2JXXA 2ACZB 1N60A 2ICIA 1GPXA 4OVUA 4TQ0A 1S1QB 3MHZA 3TCAA 4GIVA 2O6VB 2L52A 4HKZE 3E9SA 3X23A 3QAQA 2C9WB 1Q1OA 5HKHA 1J7CA 1UZXB 2YEPB 1L4ZB 2J53A 3U30A 2LWPA 1TY0A 4FA6A 1WIAA 2KWCA 3M95A 4AOFA 3H1UA 3PZ8A 1FEHA 4A20A 4YTNB 2LVQA 3TEXA 3ZGZA 2HE7A 1R4MI 4MACA 3ZXVA 3PHXB 1ESFA 4HDOA 2JUOA 4CO7A 2JSVX 4ZOHC 3ZJTA 4MT5A 4ZRIA 4UDUC 3ZRCA 1ZGUB 5G5GA 3BWUD 2K0PA 1MPEA 3QK0A 4M8NA 3R2TA 1WGYA 3VVWB 2BW2A 3DCGA 1UD7A 3NS1A 3B2FA 1V1PB 4BBNC 1NYQA 1BT0A 2I38A 3TIXA 1ET6A 3LXFA 2LFIA 1VZ6A 1VCBA 1TS4A 2G3QB 3DBRI 1IGCA 1TS5A 1V6EA 1JWBD 3L13A 4HWIB 1EWYC 3S2AA 2V4IB 2AQ3B 2RSUA 2WX0A 2MJDA 1NVID 1WGGA 5FR3A 2ZZPB 3PVLA 4IC7B 2QC8A 3AM9A 4BZAA 4ZRQA 4LNNA 3I57A 3TL5A 3ZDMC 2BWES 3SR6A 2FUG1 2KXJA 3PLUA 3SD5A 1DYQA 3HK0A 3SU8X 1WXQA 2ZNVB 3RNAC 3W1YA 1HE8A 2KDFB 2FIFA 1SIFA 3HHMA 1VZ8A 2K8HA 2L83A 5AUIA 1HTOA 1H8CA 2IO1B 2FIDA 5DPWA 4YSZB 3P4QB 3N32A 4PYUA 4ZRKA 1H4RA 2KC1A 2JXTA 5IOIA 3GE8C 1WE7A 4JWSC 4ANXA 3EECA 3MP9A 1A5RA 1MJDA 2W3SA 3MTNB 1FMAD 1WRIA 1OQQA 3ZQ4A 2RDBC 4NAWB 3ZVVA 2KJRA 2WNMA 4US9A 1WGKA 3C8YA 3JW0X 1WZ0A 2GBJA 2WXOA 3JYUA 4KZ0A 4DDID 4M0WA 4BOZB 4LDTB 2L0FA 4W9CA 3L4PA 3QC8B 2BF8B 3KUDB 2L05A 1MHXA 4A6QA 2KMCA 5EDSA 3B1LX 2AX5A 2XK5B 3TBLD 4FBJB 1AARA 2GI9A 4IKGA 3P4SB 3OG5A 4NPNA 3H8HA 1WXAA 2KFKB 4S0RA 3BZDB 4GOCA 1L4DB 2LMCA 4C7ZA 2CHXA 3ZTCA 1XLPA 3GB1A 4KGSA 4ZRPA 3U8ZA 4DXGA 3VUWA 1V86A 3Q8CA 4DWFA 1C3TA 2I2YA 4TUUA 1GOZA 2IY0B 1FNUA 3HM3A 5EE1A 3CSFA 1I4HA 2KX0A 4KIKA 1IUEA 3JSVA 2MBQA 4GLSC 3BYYB 4ITKA 2JU6X 4M00A 3KUCB 2N9LA 3VFKA 3QQ8B 1YOVB 1WF9A 2QEJC 1GB4A 3AEAB 4GXBA 5H92C 1JWSD 4NQKE 4LK0M 3A1QB 1WX9A 3IFWB 3UQBA 1FXIA 1WXVA 4GDKB 4TKNA 4RGNA 2WGSA 2WXNA 3QCAA 4E3CA 1WMHB 5CTRC 2D07B 3PRPB 4W9IA 3RNFC 3UINB 1V97A 2INPE 2WS3B 3TJPA 2KDEB 4JPSA 4WJNA 2KN5A 4MJSB 2KZRA 1CZPA 4ASWC 3QA8A 2IJ0A 1TYGB 2WDQB 3RN9C 1CMXB 2IGGA 1CJEA 5BYRA 2SAKA 4LJOB 2GB1A 4XDDA 1Z2MA 3OAWA 2KFJA 2BT6A 4RFBA 1KH0A 3BVMA 1M4VA 1VR9A 1C79A 2G4DB 2NPTB 4P1CC 2CJNA 1P98A 2MBBB 2MP2B 3W1SC 3O13A 2RPVA 2BYVE 2J0MA 5IKCM 1E8ZA 3NZ3A 1WGDA 5DPTA 2M56B 4NY0A 1WR1A 4GGQA 2DWQA 3DHGC 2K22A 4KSLC 1PFDA 3KW5B 2V0GA 4OHJA 2D2QA 1F0ZA 3DBSA 1ZXHA 3CSTA 2JWZA 2AQ1B 4JGHB 1HXYD 1TY2A 1F77A 1XQQA 2RDHA 4L23A 2IO2B 1FNVA 4USAA 1YQ3B 2CS4A 2KD0A 1MG8A 3RNCC 4KGRA 2JYEA 1ZDXA 4II3B 2XN9C 1YX6B 5LXIB 3WA0A 1SB3C 1WXSA 2KMAA 1T0QC 4OVZA 3T8MA 1P0RA 2N7EA 3H7SA 2L3ZA 3V6CB 2C60A 3FC4A 3Q3NC 5GXGB 1JRUA 2WXIA 3FAHA 3AE3B 4BKSD 4LDTD 1ZP0B 4GSWA 1FCLA 3PRZA 3HIZA 3A9JB 4XE0A 2KQSA 4ANWA 2PJHA 2V4LA 4GDLB 2VZKD 3AMZA 3ZXRA 2ZEQA 1AW7A 2J7QB 1FCCC 2O2VA 1KOTA 1XF5L 5JXVA 2NMQA 1I7HA 3Q3JA 1RLFA 3AEDB 3ALBA 2DZIA 2NTSA 1LO5D 2CR5A 2OJRA 2N9EB 1IBXA 1N6ZA 2WYQA 3QHTA 2ZCBA 4MH8A 3DQVA 3J9CA 3IG3A 4BOSC 1XCQL 3MFGA 2Z8LA 2IGHA 2AQ2B 4HCNB 1TS2A 1K51A 3X0WA 3NG0A 1N63A 2QSDA 2ON8A 5MPOA 2KQ4X 4E71A 1XLOA 4LLGM 2FCQA 4L2YA 4WJOA 2L8JA 3IHPC 3RYTA 4IW0A 3QJZA 3VHTC 5DPSA 1IYFA 3OWEB 1VRAB 2NR2A 1Y56A 2MX2A 2FUHB 3HUIA 1QOGA 1GNUA 1PGAA 3ZUNA 4REZA 1EUVB 3EUB2 4BBNF 4HROA 1SE2A 2KTFA 1PYWD 2N9PC 4FXCA 5EE0A 1IP9A 2LHDA 2J42A 4X57B 1WYWB 1WX8A 2DYMA 2XNAC 1IPGA 4OZBA 4MSMB 4GMVA 4RF0A 1C76A 2Y3AA 2KANA 4YL8A 2MQJA 2LJ5A 2KHWB 2GMIC 1WJNA 4HKQA 4W9EA 5C2TB 1L6UA 3KWLA 4N9F4 2DX5B 1P9DU 4KZCA 2KKCA 4FADA 5BO4B 1I35A 2BB6A 3RI7C 4KX6B 5AZFA 3P4PB 1QOFA 1LXDA 2K1FA 4ZHOA 2WDVB 1YNTE 5JZEB 4A55A 2JYTA 2DENB 1WGHA 2Y5BB 3VTWA 1YQ4B 5JHAA 1SJHD 3P4RB 3SFDB 1B1ZA 2LGYA 2M1MA 3KYCD 4JLCA 1JW9D 3A9KB 2K8CA 1FFVA 4ACFA 3ZLZA 2KWVB 4YXDB 2ZJDA 3NHEB 4XC2A 2LGDA 2DYOA 4OZCA 2Z59B 1S3SG 5CHWA 3EFCA 3GZNB 1FPYA 3LB8C 3QX1A 1E8YA 5J2RA 2PE6B 4FULA 4W9LA 2CHWA 3ZJVA 1E7UA 4N58A 1P3QU 4EOYA 3KLSX 4MH0E 4LNIA 1T5XD 4F1SA 3KVFB 4RGMA 3I9V1 2NCNA 1OQRA 2PVGC 3PZDA 1ZE3D 4R3DA 2KTRB 3ZDTA 4KV2A 1TIFA 1MVKA 3ML8A 2KAJA 1K52A 1L5PA 3TSSA 2KWUB 3AV8A 2N9KA 4QAYA 5I4DA 2MH7A 1D4BA
chains in the Genus database with same CATH topology
1KF6B 1MHXA 4A6QA 2PLPA 4RF1A 5D7GA 1N62A 1XXGA 4LTUA 3U7ZA 2WU2B 4XDCA 1DOXA 4PT5A 3BK1A 1YN5A 1XCTL 2AX5A 1R7SA 3BYTB 2GI9A 1K50A 4N6EB 4IKGA 4WURA 3P4SB 2BS2B 2L1AA 4B0MA 3H8HA 4OW0A 3DWMA 2CJOA 1FRRA 2WXGA 2FE8A 2SEBD 3AE5B 4CQNA 3P63A 3BZDB 4YT0B 1L4DB 1C4AA 1TZOA 2LMCA 4N59A 4C7ZA 1XLPA 2WXJA 4O1NA 3TEYA 1UWXA 3GB1A 1FM0D 1CK1A 4KGSA 2H88B 1D6EC 4ZRPA 1KFYB 1T3QA 4DXGA 3Q8CA 2B76B 3LYYA 1SE4A 2I2YA 1QILA 3AE6B 3RPFC 1GOZA 1C77A 1EM7A 2W82A 1FNWA 5EE9A 2KMMA 2PIAA 1DOIA 1FNUA 1PGBA 2Y5CA 1TS3A 2CU3A 2QJLA 2RMMA 1YJIA 2WXKA 3NUHB 1I4HA 4NJCA 5EE1A 1V8CA 2BS3B 2DBYA 1IUEA 1DOYA 1PGXA 1ENFA 4RNAA 2K3UA 4GLSC 3BYYB 4ITKA 2Q5WD 2JU6X 4A8XC 1KLUD 1EWCA 5H8YE 4H2AA 2N9LA 2QEJC 1XO3A 3GP7A 3NVWA 2LGIA 1GB4A 3WCQA 3AEAB 1C4PA 2N7JA 5D3IB 2WU5B 5H92C 1JWSD 4LK0M 1I4QA 2WXFA 1FXIA 2NTTA 1KTKA 1N5XA 1YMHE 2LEKA 4GDKB 2N0SB 3U52E 3R8BA 4RGNA 2WXRA 3KQ4A 2WXNA 1WSPA 1QLBB 1E9MA 2IPKD 5EE3A 2BYTA 1MHHE 4J3OD 1XEEA 1CQVA 1V97A 3MC0B 2INPE 2WS3B 3TUOA 3SEBA 2LHEA 3AECB 1FRDA 1JRPA 3IAM1 4NZLB 5HHDG 2KN4A 4JPSA 4L1BA 4RGOS 1CZPA 4C7YA 4JX1C 1AN8A 3NVVA 2IJ0A 3B2GA 3GS2A 1TYGB 2M0AA 1BXTA 3ABVB 2IDYA 1NI3A 4YTMB 4RCOA 3BIID 1TKYA 2WDQB 4XWWA 1WWTA 1YN3A 2BS4B 3W5VB 3Q8FA 1TKEA 2IGGA 1CJEA 1BUIC 2INNE 3V3XA 3TEZA 1I4RA 5BYRA 1QKZA 1QOBA 1QOAA 2SAKA 1GAQB 2GB1A 4XDDA 1F2RC 1NEKB 3RFZB 2M19A 2D5GA 5LNK1 2BT6A 4RFBA 1AWDA 1TKGA 2JZPA 2WDRB 1KH0A 1RM6C 3BVMA 1M4VA 1VR9A 1C79A 5G5HA 5BYQA 2CJNA 3ETRA 3W1SA 3W5UB 1A70A 3E56A 3FILA 4P16A 4IOIE 1SIJA 3O13A 4TMAB 2VZKB 3T3OA 2WLBA 2RPVA 2WP9B 3AEFB 1EU3A 4ZYSA 3NZ3A 2M56B 2YEPF 2X38A 1TJEA 2E6XA 3HVZA 2KDMA 4HEA1 2J4XA 2KWDA 1QF6A 2DWQA 2K22A 1PFDA 3B9JA 3Q69A 2V0GA 3Q8AA 1KLGD 4OHJA 1NENB 3P42A 3N9YC 4A90A 1F0ZA 1GB1A 1RFKA 3AB5A 1IGDA 2BB5A 1ZXHA 3AEGB 3UI3A 1L0YB 2AQ1B 3PZ7A 4KKIA 4WAFA 4WWMA 4HJGE 2EKIA 1HXYD 1TY2A 1PDXA 1F77A 2RDHA 4YWGG 1D5MC 4KGTA 2G9HD 4L23A 1JQ4A 1RWSA 1FNVA 1XLQA 4USAA 4RGTA 3IT4B 4WIPA 1YQ3B 4C80A 4MM3B 1JWUD 1OFFA 4KGRA 1E0ZA 2JYEA 1ZDXA 3W2DA 2XN9C 3U4EG 1L0XB 1E10A 4AS1A 1RYJA 3VRBB 3SFEB 1SB3C 2PVOD 2PMVA 3VR8B 4YTPB 3CWIA 1QT9A 4OVZA 4US8A 2G1EA 1JMLA 5HG2A 1P7EA 4TSSA 5AUKA 4P6VF 1IBXB 4ARIA 1UNSA 3KWVA 1FO4A 1VDVA 2OHFA 3FC4A 4OZAA 5GXGB 3AE9B 2K5PA 1V1OA 2WXIA 3FAHA 3AE3B 5HI1A 1D5ZC 4YSYB 2WXMA 1ZP0B 4WH4A 1I4XA 1AYFA 1FCLA 1J7BA 5BMHA 1D5XC 3AEEB 1ZPSA 1UGJA 4XE0A 1T6BX 2MJEA 1PUTA 4NAMA 4GDLB 2VZKD 3AMZA 2WXQA 1AW7A 1V1PA 5BYSA 3HRDD 1FCCC 3MJ5A 4JWUC 3VQIA 4YSXB 1JCKB 1XF5L 5JXVA 2NMQA 3TEWA 1I7HA 3IAS1 2PW9A 3AEDB 2JQRB 2WXPA 1ROEA 2NTSA 1HZ5A 1LO5D 4AQ7A 1SE3A 3PO0A 1IBXA 3FILB 3AE7B 1VLBA 4MH8A 3J9CA 4C56C 2E3TA 1Q10A 2RDGA 4ARCA 4JE3B 2KACA 2BTEA 3HVDA 2JX5A 2HTME 1XCQL 3MFGA 2Z8LA 1MI0A 2ACZB 1HQRD 1N60A 2IGHA 2V3NA 2AQ2B 3AE8B 1TS2A 1K51A 2ICIA 1GPXA 4TQ0A 3MHZA 4RH6A 2L52A 4HKZE 3E9SA 1N63A 1ZUD2 2QSDA 3Q8BA 3CIRB 2ON8A 5FKAC 5MPOA 2KQ4X 3DWGC 1E6EB 1D4BA 1HZ6A 1SJED 1FD6A 1J7CA 1XLOA 2YEPB 4LLGM 4L2YA 1L4ZB 2J53A 1HEZE 1P7FA 3U2SC 2V3PA 1ZOYB 3AEBB 1SSNA 1TY0A 3AE2B 1EU4A 3NVYA 1K53A 1UUPA 1VRAB 2Y5PA 3OWEB 3NRZA 1Y56A 3AE1B 2H89B 3HUIA 1QOGA 2ZW1A 1N61A 3PZ8A 1FEHA 5BMGA 1PGAA 4REZA 4YTNB 4B0EA 3AN1A 1F2RI 3TEXA 2W54A 3ZGZA 3EUB2 4MACA 4HROA 1I4GA 1NYRA 1SE2A 1ESFA 1PYWD 3W9CB 2IGDA 4FXCA 5BMIA 1XLNA 2JSVX 5EE0A 2LHDA 4ZOHC 2J42A 2TSSA 4MT5A 3ZJTA 1I4PA 1KRHA 4D2KA 4UDUC 2QIEB 5HFYA 2DYMA 2XNAC 4OZBA 5G5GA 3VR9B 3BWUD 4RF0A 1HA5A 2K0PA 1UWMA 1MPEA 1C76A 2Y3AA 3R2TA 3BK2A 2MEKA 2QMTA 1VZ7A 4A9AA 2BW2A 2ONQA 2WXLA 3NS1A 3B2FA 4HKQA 1V1PB 2BBCA 5C2TB 1NYQA 3IXSA 1L6UA 3KWLA 2I38A 5FK9C 4KKJA 4WQMA 5C3JB 2MJ3A 1ET6A 3LXFA 2LFIA 1VZ6A 2OEDA 1TS4A 4HRSA 3NVZA 1IGCA 2FBWB 1TS5A 1ACCA 1JWBD 1EWYC 2BB6A 3IT6B 4KX6B 1JALA 2V4IB 1FFUA 3VRAB 1YN4A 3EGRA 2AQ3B 3P4PB 1YJJA 1QQRA 1QOFA 1L6VA 1C9FA 4ZHOA 1DGJA 2MJDA 1NVID 5FR3A 1E7PB 2WDVB 1YNTE 3AH7A 4A55A 2K9XA 2HDEA 2JYTA 3AM9A 4ZRQA 3I57A 1C4CA 3V05A 1YQ4B 3SR6A 2FUG1 1VJKA 1SJHD 1N5WA 3P4RB 4IDIA 2W3RA 3SFDB 1DYQA 5TSSA 1B1ZA 5E6JA 3ZJUA 1ZXIA 1WXQA 1JWAD 2WXHA 1SBBB 1ZDVA 1JW9D 4EE2A 3T3NA 2DLBA 1WYGA 2L32A 3ZYYX 4DQOC 1FFVA 1BMLC 2LUMA 1VZ8A 2L83A 5AUIA 1B9RA 5D3DA 4DXFA 4Q2JA 4YSZB 3BVZA 3P4QB 2GRIA 4YXDB 2W55A 3URYA 2DYOA 3EA6A 4OZCA 2JXTA 1C78A 2PKOA 1JWMD 4JWSC 3LB8C 4ZHPA 2LJIA 3MP9A 2R61A 2JWUA 3ZJVA 1JROA 2W3SA 4N58A 1J7AA 1FMAD 3AE4B 1WRIA 1FIQA 1OQQA 3KLSX 3ZQ4A 3Q8EA 1FXAA 4NAWB 1T5XD 3P1MA 1STEA 4RGMA 1SXTA 2WNMA 4US9A 3I9V1 1OQRA 2PVGC 1ZE3D 1SF0A 1WGKA 2QILA 3C8YA 4R3DA 2ZW0A 2WQYB 5T8IA 2WXOA 1MVKA 2J52A 1ET9A 2KAJA 2EELA 1K52A 1L5PA 3TSSA 2PTLA 3R2IA 1SEBD 4M0WA 1L0VB 4XWTA 3AV8A 2N9KA 5I4DA 3L4PA 3BVGA 2MH7A 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KF6 B;  2MJE A;  4WQM A;  1PUT A;  5C3J B;  2MJ3 A;  3ABV B;  1NI3 A;  3LXF A;  4YTM B;  3BII D;  3AMZ A;  1N62 A;  1TKY A;  2WDQ B;  4LTU A;  1WWT A;  2WU2 B;  2BS4 B;  3W5V B;  1TKE A;  4HRS A;  1CJE A;  3HRD D;  3NVZ A;  4JWU C;  2FBW B;  1DOX A;  1JWB D;  4YSX B;  1EWY C;  2AX5 A;  1QOB A;  1QOA A;  1GAQ B;  1I7H A;  4KX6 B;  1R7S A;  1JAL A;  3AED B;  2JQR B;  1FFU A;  1ROE A;  3VRA B;  1NEK B;  4N6E B;  2M19 A;  3P4P B;  3P4S B;  2BT6 A;  1AWD A;  1YJJ A;  2BS2 B;  1TKG A;  3PO0 A;  2WDR B;  1RM6 C;  1QOF A;  3AE7 B;  1L6V A;  3DWM A;  1VLB A;  4ZHO A;  2CJO A;  5G5H A;  1FRR A;  1DGJ A;  2MJD A;  1NVI D;  2CJN A;  3ETR A;  1E7P B;  2WDV B;  3AE5 B;  3AH7 A;  3P63 A;  3W5U B;  2K9X A;  1A70 A;  2E3T A;  4YT0 B;  4N59 A;  4C7Z A;  1SIJ A;  3AM9 A;  1XLP A;  2JX5 A;  1YQ4 B;  2HTM E;  1FM0 D;  2WLB A;  3SR6 A;  2H88 B;  2WP9 B;  1VJK A;  2ACZ B;  3AEF B;  3P4R B;  1KFY B;  1N5W A;  1T3Q A;  2W3R A;  4IDI A;  1N60 A;  3AE8 B;  3SFD B;  2B76 B;  2M56 B;  3HVZ A;  1TJE A;  1GPX A;  3AE6 B;  1ZXI A;  1WXQ A;  1JWA D;  3RPF C;  2L52 A;  1N63 A;  1ZUD 2;  1QF6 A;  3CIR B;  2DWQ A;  1JW9 D;  2K22 A;  1PFD A;  3B9J A;  3DWG C;  5EE9 A;  1E6E B;  2KMM A;  5MPO A;  2PIA A;  1DOI A;  1NEN B;  1WYG A;  2Y5C A;  3ZYY X;  2CU3 A;  2QJL A;  5EE1 A;  1F0Z A;  1FFV A;  1YJI A;  1RFK A;  3AB5 A;  1J7C A;  1XLO A;  2L83 A;  5AUI A;  1B9R A;  3AEG B;  1V8C A;  2BS3 B;  4YSZ B;  3P4Q B;  2DBY A;  1IUE A;  4WWM A;  1DOY A;  1ZOY B;  3AEB B;  4YXD B;  2EKI A;  2W55 A;  3AE2 B;  1PDX A;  4ITK A;  2Q5W D;  3NVY A;  2PKO A;  5H8Y E;  3NRZ A;  3AE1 B;  1JQ4 A;  1RWS A;  2H89 B;  4USA A;  1XLQ A;  3HUI A;  1QOG A;  3LB8 C;  1N61 A;  4JWS C;  4ZHP A;  1YQ3 B;  4C80 A;  1XO3 A;  4YTN B;  3NVW A;  3WCQ A;  1OFF A;  3AEA B;  1JRO A;  2W3S A;  3AN1 A;  4N58 A;  1J7A A;  2W54 A;  2WU5 B;  1E0Z A;  3EUB 2;  1FMA D;  3AE4 B;  5H92 C;  1WRI A;  1FIQ A;  1OQQ A;  4HRO A;  1FXA A;  1E10 A;  1FXI A;  1RYJ A;  3VRB B;  1NYR A;  1N5X A;  2LEK A;  2N0S B;  3P1M A;  3W9C B;  3SFE B;  4FXC A;  1SB3 C;  4US9 A;  2PVO D;  1XLN A;  5EE0 A;  3VR8 B;  4YTP B;  4ZOH C;  1OQR A;  2PVG C;  1QT9 A;  3CWI A;  1KRH A;  1QLB B;  1SF0 A;  1WGK A;  1E9M A;  4US8 A;  2G1E A;  2QIE B;  2WQY B;  5AUK A;  4P6V F;  5G5G A;  5EE3 A;  3VR9 B;  1UWM A;  2KAJ A;  1FO4 A;  1V97 A;  1VDV A;  2OHF A;  3FC4 A;  1L5P A;  2WS3 B;  3AEC B;  1FRD A;  1JRP A;  5GXG B;  3AE9 B;  2K5P A;  3FAH A;  3AE3 B;  1L0V B;  4A9A A;  1L6U A;  4YSY B;  1ZP0 B;  3AV8 A;  3NS1 A;  1AYF A;  1CZP A;  1J7B A;  3B2F A;  3L4P A;  3NVV A;  4JX1 C;  3AEE B;  4C7Y A;  3B2G A;  5C2T B;  2MH7 A;  1NYQ A;  1TYG B;  3KWL A; 
#chains in the Genus database with same CATH topology
 1J19 A;  3PRM B;  4BAX A;  2PLP A;  4RF1 A;  2PPH A;  3L54 A;  5IP4 D;  1XXG A;  4XDC A;  1DOX A;  4PT5 A;  1HTQ A;  4XYC A;  1YN5 A;  4B6W A;  2GBK A;  1C1Y B;  1EF5 A;  1K50 A;  3DVG X;  4N6E B;  4OW0 A;  3DWM A;  2LUE A;  1WM2 A;  2W9N A;  1FRR A;  5AEK B;  2SEB D;  3AE5 B;  4CQN A;  3P63 A;  4FJV B;  4N59 A;  1C4A A;  1TZO A;  4O1N A;  2WXJ A;  3LDZ E;  1UWX A;  1YQB A;  5G55 A;  3ECI A;  1EO6 A;  1T3Q A;  4MGK E;  2WHI A;  3NZU A;  2B76 B;  4WJP A;  3QAR A;  4IUM B;  4ICU A;  4FJZ A;  2DYB A;  1SGH A;  1EM7 A;  2W82 A;  5EE9 A;  2D3C A;  2KMM A;  1DOI A;  2CU3 A;  2QJL A;  3NUH B;  1YJI A;  3ZKJ C;  4WWN A;  3RD2 A;  4HCP B;  3DVN U;  2DBY A;  1DOY A;  1PGX A;  2Q5W D;  4A8X C;  1KLU D;  1QZE A;  5H8Y E;  3B08 A;  4BKT A;  3NVW A;  2LGI A;  3N30 A;  3WCQ A;  1C4P A;  5D3I B;  3RT3 B;  3N3K B;  3Q3M C;  1GG3 A;  2WXF A;  4MM3 A;  5L95 C;  2NTT A;  1KTK A;  1N5X A;  2NVU I;  2LEK A;  2B3A A;  3R8B A;  2J0J A;  3DOW A;  2NBU A;  2WXR A;  2ZVN A;  4NJ7 A;  1QLB B;  2N1W A;  3H6N A;  2LVP A;  2LD9 A;  3HM6 X;  4J3O D;  1CQV A;  3VTV A;  3SEB A;  1FRD A;  4DXA B;  5HHD G;  4NZL B;  2KN4 A;  2M8S A;  1WJ4 A;  2GBN A;  3R66 C;  3WAO A;  3NOB A;  3NVV A;  3WAL A;  2AL3 A;  3P2B A;  2IDY A;  1LQB A;  4RCO A;  3BII D;  4FJY A;  1YN3 A;  3TEZ A;  1TZ1 A;  2JRI B;  3VAW A;  1QKZ A;  1Y8R C;  1QOA A;  1GAQ B;  2K8B A;  1E8W A;  1F2R C;  3RFZ B;  2D5G A;  5LNK 1;  3OLM D;  3DPD A;  2JRH A;  2V3S A;  1WGR A;  5G5H A;  3W1S A;  3W5U B;  4MGY E;  2JVC A;  3PS6 A;  5IO9 A;  4EZK A;  1A70 A;  3E56 A;  4E74 A;  2VZK B;  2QHO A;  2WLB A;  3N1X C;  3RUI B;  3AEF B;  3RNE C;  2YEP F;  3RZF A;  2KDM A;  4HEA 1;  3I5J C;  1QF6 A;  2IYD B;  1KLG D;  1V49 A;  2IY1 B;  1NEN B;  2I1J A;  3N9Y C;  1GB1 A;  5AZH A;  1RFK A;  3AB5 A;  2O6V A;  3RUL A;  2J0K A;  4WWM A;  1UEL A;  2EKI A;  2KDI A;  4JIO U;  4YWG G;  1D5M C;  4KGT A;  1R4N B;  2VRR B;  1MFW A;  1JQ4 A;  2RPQ A;  4C80 A;  3NJT A;  3PSE B;  3OJ3 A;  1E10 A;  4AS1 A;  3ZW3 A;  4W9F A;  3VR8 B;  3CWI A;  2RR9 A;  2G1E A;  4TSS A;  4HK2 A;  5AUK A;  4GU2 A;  4P6V F;  4BKG A;  1IBX B;  4MGZ E;  4ARI A;  4XZ4 A;  1VDV A;  1OEY A;  4C4V B;  3D32 A;  3AE9 B;  5HI1 A;  2C5L C;  4HPM B;  4WH4 A;  1AYF A;  1KM7 A;  1ZPS A;  2LZ6 A;  1UGJ A;  1Z5S B;  2JZZ A;  3L08 A;  5D6J B;  3UGB B;  4XGA B;  1V1P A;  2D11 A;  5BYS A;  3Q6B A;  1JCK B;  1LGR A;  3TEW A;  3IAS 1;  2PW9 A;  4IWO A;  1ROE A;  3IVF A;  3Q3F A;  2JY6 A;  2AEH A;  4AQ7 A;  1SE3 A;  3SHQ A;  1UBQ A;  4MDK E;  3FIL B;  3VXW A;  2E3T A;  2M17 A;  2BYE A;  1Q10 A;  2RDG A;  1VD2 A;  4IM2 A;  4KSK C;  2KAC A;  2LGX A;  2HTM E;  1MI0 A;  2JPH A;  1HQR D;  3AE8 B;  4C00 A;  4PK1 A;  4RH6 A;  3Q8B A;  1ZUD 2;  4RM9 A;  3CIR B;  2JT4 B;  4XX5 A;  1E6E B;  1HZ6 A;  1FD6 A;  1RFA A;  1EF1 A;  1HEZ E;  1P7F A;  3U2S C;  2MHJ A;  2V3P A;  1ZOY B;  3DVN V;  4DDG D;  1SSN A;  5J18 A;  3AE2 B;  4WAA A;  2KVZ A;  4EZL A;  3H7P B;  1UUP A;  3VH4 B;  4K7S A;  3NRZ A;  2H89 B;  3NZS A;  2ZW1 A;  1N61 A;  3H9D A;  5BMG A;  4K81 A;  4MGI E;  4PS8 A;  4B0E A;  3AN1 A;  2W54 A;  2L7R A;  4K1R B;  2Z0D B;  3GE3 C;  3V60 A;  1NYR A;  3W9C B;  2IGD A;  1KRH A;  4W9J A;  4NAW A;  4D2K A;  1ZW7 A;  5HFY A;  1HA5 A;  4LJP B;  4WWO A;  4A9A A;  2BWF A;  4I6P A;  1VZ7 A;  1RRB A;  2QCZ A;  2WXL A;  3AU5 A;  4LNF A;  3Q2A C;  2A4Z A;  3U7D A;  5FK9 C;  3PRE A;  3GZN I;  2MJ3 A;  4BKS A;  2R2Q A;  2OED A;  2AYO B;  2GLS A;  3A4S C;  3CF6 E;  4ZRJ A;  2MW5 A;  3DBH I;  5LLI A;  4ZYN A;  5DCN A;  3JVZ X;  3IT6 B;  1JAL A;  5JHB A;  2LRW A;  2K6Q A;  1YJJ A;  1QQR A;  2XK5 A;  3VH3 B;  1C9F A;  2DNF A;  1E7P B;  3AH7 A;  2K9X A;  4S17 A;  1L7Y A;  1C4C A;  2BKR B;  4ANU A;  2KFK A;  3UF8 A;  1N5W A;  1V81 A;  1J0G A;  1WY8 A;  4K7W A;  1YD8 U;  1ZXI A;  3DBL I;  4IM0 A;  3WIM A;  1ZDV A;  4EE2 A;  1YX5 B;  2DLB A;  2L32 A;  5AZG A;  2LRU A;  1BML C;  2KDB A;  4DBG A;  4B9K A;  1B9R A;  3OJ4 B;  4Q2J A;  5CHF A;  3BVZ A;  2GRI A;  2KLG A;  1MG4 A;  2UWQ A;  2PKO A;  4HJK A;  2DZM A;  4HLE A;  4ZHP A;  2LJI A;  3B0A A;  2JWU A;  1JRO A;  1T0Y A;  1J7A A;  3CMM B;  3P1M A;  3ZO5 B;  2XEW A;  1WM3 A;  1SF0 A;  2QIL A;  1UH6 A;  2V1Y A;  3PPA A;  2WQY B;  5T8I A;  4GDK A;  4ANV A;  1WI0 A;  4G50 A;  2J52 A;  2PTL A;  3M3J A;  1SEB D;  3R2I A;  3FKY A;  2C7H A;  4XWT A;  4G0N B;  4KDI C;  3A33 B;  2RGF A;  2I1K A;  4TQ1 A;  1KF6 B;  4MJS A;  5D7G A;  1N62 A;  4LTU A;  3U7Z A;  2ASQ A;  4F7Z A;  4CHK A;  3C0R B;  1T0R C;  1XCT L;  2D10 A;  1T0S C;  4WUR A;  4JQW C;  2CJO A;  2WXG A;  2FE8 A;  1WE6 A;  3ML9 A;  4YT0 B;  4NNJ B;  2NPT A;  3TEY A;  1CK1 A;  2H88 B;  1D6E C;  2L00 B;  2DZK A;  1KFY B;  2DAF A;  2MP2 A;  3LYY A;  1WRD B;  1SE4 A;  2GOW A;  1C77 A;  4ZDV A;  4P1B C;  5KHO A;  2HJ1 A;  2PIA A;  2Y5C A;  3RMK C;  2WXK A;  2ZVO A;  2K39 A;  1V8C A;  1WFY A;  2BS3 B;  2LI5 A;  1FXT B;  1GUA B;  3N1Z C;  4DHZ B;  4RNA A;  5GMV A;  3O65 B;  2MA9 B;  1EWC A;  1OGW A;  2M4N A;  4P7I A;  3AXC A;  1XO3 A;  3GP7 A;  2N7J A;  2WU5 B;  3A4R A;  1I4Q A;  3T9L A;  3NS8 A;  3VUX A;  2WWZ A;  2N0S B;  3U52 E;  4HDQ A;  3EFU A;  3KQ4 A;  1WSP A;  4KDL B;  1E9M A;  2IPK D;  4M0W B;  2FCS A;  3LJ3 A;  2N7D A;  1MHH E;  2CKH B;  2KLC A;  2LHE A;  1GC7 A;  1YJ1 A;  3AEC B;  3IAM 1;  4AUQ C;  1P1A A;  2N9X A;  4CYE A;  3MC8 A;  4KVG B;  3DBH B;  4RGO S;  4JX1 C;  3B2G A;  1R4N I;  2M0A A;  5CX3 A;  1BXT A;  4W9G A;  3ABV B;  2BS4 B;  3A9J A;  3W5V B;  1TKE A;  2INN E;  1U4A A;  4GDL A;  3VTU A;  1QOB A;  3L17 A;  2REX A;  4HPL B;  2N4F A;  2LXA A;  2WDR B;  4PYZ A;  4AJW A;  2AWT A;  5BYQ A;  4IWP A;  1TTN A;  5IA7 A;  4J6I A;  3DBL B;  1SIJ A;  4TMA B;  2JF5 A;  3APF A;  3T3O A;  2WP9 B;  4ZYS A;  2X38 A;  1TJE A;  2E6X A;  2FAZ A;  3HVZ A;  3WAM A;  3ZNH B;  2KYW A;  2HD5 B;  4KIK B;  3B9J A;  3Q69 A;  3ZIM A;  1WH3 A;  3JSV B;  2MCN B;  4A90 A;  3Q3O C;  2BB5 A;  3UI3 A;  4M8M A;  3PZ7 A;  2VH2 A;  3V62 A;  1PDX A;  3AI5 A;  3VUY A;  5KHQ A;  1RWS A;  2V9H A;  3WAP A;  4K3B A;  3AU4 A;  4RGT A;  4WIP A;  5IAA C;  3DVG Y;  3KH0 A;  3PTF C;  1OFF A;  3K9O B;  2KQ7 A;  1OQY A;  2KOX A;  1SE9 A;  1XD3 B;  1WXM A;  1V80 A;  3W2D A;  3BY4 B;  3U4E G;  1L0X B;  4RM8 A;  1RYJ A;  3MHS D;  3VRB B;  2PVO D;  2BPS A;  4FLH A;  4YTP B;  1KJT A;  3KWV A;  4IG7 B;  1PQS A;  2X8X X;  1V1O A;  1D5Z C;  2WX1 A;  3PV1 A;  1J7B A;  5BMH A;  1D5X C;  3AEE B;  1Q0W B;  1T6B X;  2UU7 A;  1NI2 A;  1NBF C;  2KVR A;  3KYD D;  1ISN A;  3AUL A;  5D2M B;  5IN7 A;  3K9P B;  2K6D B;  4JWU C;  3VQI A;  4YSX B;  5E6O A;  1G6J A;  4M01 A;  4TV3 A;  2BVC A;  4K7U A;  3WAN A;  2KO3 A;  4EKU A;  1WJU A;  3HVD A;  3ZNZ B;  2QDF A;  2LVO A;  4W9K A;  2MWS B;  2V3N A;  3ZNI D;  3NY5 A;  1V5O A;  1OEY J;  1OTR B;  5FKA C;  3DWG C;  1F9J A;  4B95 A;  1SJE D;  1WJ6 A;  1XT9 B;  3ENE A;  2KX3 A;  3A9K A;  3AEB B;  2MRP A;  1EU4 A;  4MEM A;  3NVY A;  1K53 A;  2NBW B;  2OJW A;  2Y5P A;  3AE1 B;  2PEA A;  4RMA A;  1F2R I;  2KC2 A;  2D3B A;  1E5W A;  2BYF A;  2PE9 A;  1I4G A;  5E6P A;  5CHV C;  4DK5 A;  1TBE A;  5BMI A;  1XLN A;  2TSS A;  1I4P A;  3APD A;  2LAS A;  2IND C;  2QIE B;  4GN1 A;  2RD0 A;  2UYZ B;  3VR9 B;  1F52 A;  4DHJ B;  1UWM A;  5J17 A;  3C19 A;  1WR6 E;  2KTR A;  3BK2 A;  4EZJ A;  2QMT A;  2MEK A;  2GBM A;  4BVU C;  2ONQ A;  3GOE A;  2BBC A;  3IXS A;  2O2V B;  4KKJ A;  4WQM A;  5C3J B;  3M63 B;  4HRS A;  3NVZ A;  4II2 B;  2FBW B;  1ACC A;  4LCD E;  2R2O A;  2O6V D;  4AJY B;  2BQQ A;  1FFU A;  3VRA B;  1YN4 A;  3EGR A;  3R3M A;  5FR6 A;  1L6V A;  1DGJ A;  4W9H A;  3L0W B;  1TGZ B;  2OOB B;  2HDE A;  2KJ6 A;  3V05 A;  1E90 A;  1R4M B;  4W9D A;  1VJK A;  4IDI A;  2W3R A;  5G2N A;  4I6L B;  4WQO B;  5TSS A;  5E6J A;  3ZJU A;  1JWA D;  2WXH A;  1SBB B;  2GBR A;  2BKF A;  1I42 A;  2IO0 B;  3RNG C;  2NBV B;  3T3N A;  1WYG A;  3N20 C;  3ZYY X;  3N1Y C;  4DQO C;  3L16 A;  5E6N A;  2LUM A;  2XBB C;  2DZJ A;  5D3D A;  4DXF A;  2W55 A;  3URY A;  3EA6 A;  1C78 A;  4ICV A;  3KUZ A;  4PS7 A;  1JWM D;  3DHI C;  3IBE A;  2CHZ A;  2R61 A;  2FNJ B;  3DBR B;  2IZV B;  3AE4 B;  1FIQ A;  2K25 A;  3Q8E A;  1FXA A;  4G3X B;  1STE A;  1UBI A;  1SXT A;  2YLM A;  2ZW0 A;  2EMT A;  1ET9 A;  2EMS A;  4F8C B;  1GJZ A;  2EEL A;  3ONS A;  1YIW A;  1LFD A;  1L0V B;  2FCM A;  3EC8 A;  4LNK A;  3UIO B;  4FHJ A;  3BVG A;  1RAX A;  1X1M A;  3SDL C;  2LGS A;  3L10 B;  2WU2 B;  2KT7 A;  3BK1 A;  3PLV A;  1R7S A;  3BYT B;  3PGE A;  4EUT A;  2BS2 B;  2L1A A;  3PT2 B;  4B0M A;  3PHW B;  4PS3 A;  1D3Z A;  2G45 B;  3ZRF A;  5DPR A;  2Z0E B;  2INC C;  1M94 A;  2IBI B;  4A3O A;  2VH1 A;  1FM0 D;  3RNB C;  1UF0 A;  4NJ6 A;  3QWZ B;  2CU1 A;  4DHZ E;  1QIL A;  2D3A A;  3AE6 B;  3RPF C;  3R7R A;  2EKE C;  2ZPN A;  1FNW A;  1PGB A;  1TS3 A;  4NJC A;  2RMM A;  3ZNG C;  5LXH A;  3I63 C;  3RCZ A;  1KLV A;  1ENF A;  2K3U A;  1L2N A;  3R7Q A;  4H2A A;  2MBH A;  4G11 A;  4EEW A;  2M0X A;  4FN2 A;  4MSQ B;  2IO3 B;  2KJH B;  1E8X A;  4WWP A;  1YMH E;  1WX7 A;  2AL6 A;  1V2Y A;  2HJ8 A;  2N1V A;  2LXC A;  2FCN A;  4DHJ D;  5EE3 A;  2BYT A;  1XEE A;  3MC0 B;  3TUO A;  5C1Z A;  1JRP A;  3APC A;  3MJW A;  4L1B A;  1E7V A;  1LM8 B;  1NDD A;  2MLB A;  3DDC B;  3DHH C;  4AWJ A;  4C7Y A;  1AN8 A;  3V61 A;  4C4V A;  3GS2 A;  4IM3 A;  5TR5 A;  1V9J A;  1NI3 A;  4YTM B;  1TKY A;  2L76 A;  4XWW A;  1WWT A;  2G4S A;  3A1Q A;  3Q8F A;  1BUI C;  2C7M B;  3V3X A;  5JH5 C;  1I4R A;  4MEL A;  2D3G A;  3TMP B;  1NEK B;  2M19 A;  4GB9 A;  1WMH A;  2DHZ A;  1AWD A;  4IWQ A;  1TKG A;  2JZP A;  1RM6 C;  3V6E B;  3ZTD A;  1ZKH A;  3ETR A;  2ZPY A;  2ZNV C;  3FIL A;  4P16 A;  4IOI E;  2MSE D;  4LNO A;  2KNB A;  3VDZ A;  1EU3 A;  2JZ3 B;  2A5U A;  3Q14 C;  1GC6 A;  1V5T A;  2J4X A;  2KWD A;  3UQA A;  3I3T B;  3Q8A A;  1J8C A;  1WZ3 A;  3P42 A;  4M02 A;  1IGD A;  3AEG B;  1L0Y B;  4KKI A;  4WAF A;  4HJG E;  5L83 A;  2ZCC A;  4A3P A;  2G9H D;  1XLQ A;  3IT4 B;  5D94 A;  4MM3 B;  1JWU D;  4OVV A;  2HTH A;  2NS5 A;  3H7P A;  1F1H A;  3BIN A;  3QIJ A;  2C7N B;  1E0Z A;  1Q5W B;  4HVB A;  2KK8 A;  3SFE B;  2PMV A;  1QT9 A;  4WJQ A;  4US8 A;  1JML A;  4HXD A;  5HG2 A;  1P7E A;  1TT5 B;  1UNS A;  2YVC A;  4HPP A;  1FO4 A;  2OHF A;  4K3C A;  4OZA A;  2MBO A;  2K5P A;  4FHK A;  4EFO A;  4URK A;  4YSY B;  2WXM A;  4I6N B;  1I4X A;  3EHV A;  2BGF A;  3UIP B;  2MJE A;  1K8R B;  3RZW C;  1PUT A;  4NAM A;  5C23 A;  4JL9 A;  2WXQ A;  3MC9 A;  3HRD D;  3MJ5 A;  2WDT B;  1UGM A;  2JQR B;  2WXP A;  4AP4 C;  1HZ5 A;  2MBE A;  3M62 B;  3PO0 A;  3AE7 B;  1VLB A;  4NQL B;  4C56 C;  2L0T A;  4ARC A;  4JE3 B;  2DAJ A;  2BTE A;  2JX5 A;  4BFR A;  2JXX A;  2ACZ B;  1N60 A;  2ICI A;  1GPX A;  4OVU A;  4TQ0 A;  1S1Q B;  3MHZ A;  3TCA A;  4GIV A;  2O6V B;  2L52 A;  4HKZ E;  3E9S A;  3X23 A;  3QAQ A;  2C9W B;  1Q1O A;  5HKH A;  1J7C A;  1UZX B;  2YEP B;  1L4Z B;  2J53 A;  3U30 A;  2LWP A;  1TY0 A;  4FA6 A;  1WIA A;  2KWC A;  3M95 A;  4AOF A;  3H1U A;  3PZ8 A;  1FEH A;  4A20 A;  4YTN B;  2LVQ A;  3TEX A;  3ZGZ A;  2HE7 A;  1R4M I;  4MAC A;  3ZXV A;  3PHX B;  1ESF A;  4HDO A;  2JUO A;  4CO7 A;  2JSV X;  4ZOH C;  3ZJT A;  4MT5 A;  4ZRI A;  4UDU C;  3ZRC A;  1ZGU B;  5G5G A;  3BWU D;  2K0P A;  1MPE A;  3QK0 A;  4M8N A;  3R2T A;  1WGY A;  3VVW B;  2BW2 A;  3DCG A;  1UD7 A;  3NS1 A;  3B2F A;  1V1P B;  4BBN C;  1NYQ A;  1BT0 A;  2I38 A;  3TIX A;  1ET6 A;  3LXF A;  2LFI A;  1VZ6 A;  1VCB A;  1TS4 A;  2G3Q B;  3DBR I;  1IGC A;  1TS5 A;  1V6E A;  1JWB D;  3L13 A;  4HWI B;  1EWY C;  3S2A A;  2V4I B;  2AQ3 B;  2RSU A;  2WX0 A;  2MJD A;  1NVI D;  1WGG A;  5FR3 A;  2ZZP B;  3PVL A;  4IC7 B;  2QC8 A;  3AM9 A;  4BZA A;  4ZRQ A;  4LNN A;  3I57 A;  3TL5 A;  3ZDM C;  2BWE S;  3SR6 A;  2FUG 1;  2KXJ A;  3PLU A;  3SD5 A;  1DYQ A;  3HK0 A;  3SU8 X;  1WXQ A;  2ZNV B;  3RNA C;  3W1Y A;  1HE8 A;  2KDF B;  2FIF A;  1SIF A;  3HHM A;  1VZ8 A;  2K8H A;  2L83 A;  5AUI A;  1HTO A;  1H8C A;  2IO1 B;  2FID A;  5DPW A;  4YSZ B;  3P4Q B;  3N32 A;  4PYU A;  4ZRK A;  1H4R A;  2KC1 A;  2JXT A;  5IOI A;  3GE8 C;  1WE7 A;  4JWS C;  4ANX A;  3EEC A;  3MP9 A;  1A5R A;  1MJD A;  2W3S A;  3MTN B;  1FMA D;  1WRI A;  1OQQ A;  3ZQ4 A;  2RDB C;  4NAW B;  3ZVV A;  2KJR A;  2WNM A;  4US9 A;  1WGK A;  3C8Y A;  3JW0 X;  1WZ0 A;  2GBJ A;  2WXO A;  3JYU A;  4KZ0 A;  4DDI D;  4M0W A;  4BOZ B;  4LDT B;  2L0F A;  4W9C A;  3L4P A;  3QC8 B;  2BF8 B;  3KUD B;  2L05 A;  1MHX A;  4A6Q A;  2KMC A;  5EDS A;  3B1L X;  2AX5 A;  2XK5 B;  3TBL D;  4FBJ B;  1AAR A;  2GI9 A;  4IKG A;  3P4S B;  3OG5 A;  4NPN A;  3H8H A;  1WXA A;  2KFK B;  4S0R A;  3BZD B;  4GOC A;  1L4D B;  2LMC A;  4C7Z A;  2CHX A;  3ZTC A;  1XLP A;  3GB1 A;  4KGS A;  4ZRP A;  3U8Z A;  4DXG A;  3VUW A;  1V86 A;  3Q8C A;  4DWF A;  1C3T A;  2I2Y A;  4TUU A;  1GOZ A;  2IY0 B;  1FNU A;  3HM3 A;  5EE1 A;  3CSF A;  1I4H A;  2KX0 A;  4KIK A;  1IUE A;  3JSV A;  2MBQ A;  4GLS C;  3BYY B;  4ITK A;  2JU6 X;  4M00 A;  3KUC B;  2N9L A;  3VFK A;  3QQ8 B;  1YOV B;  1WF9 A;  2QEJ C;  1GB4 A;  3AEA B;  4GXB A;  5H92 C;  1JWS D;  4NQK E;  4LK0 M;  3A1Q B;  1WX9 A;  3IFW B;  3UQB A;  1FXI A;  1WXV A;  4GDK B;  4TKN A;  4RGN A;  2WGS A;  2WXN A;  3QCA A;  4E3C A;  1WMH B;  5CTR C;  2D07 B;  3PRP B;  4W9I A;  3RNF C;  3UIN B;  1V97 A;  2INP E;  2WS3 B;  3TJP A;  2KDE B;  4JPS A;  4WJN A;  2KN5 A;  4MJS B;  2KZR A;  1CZP A;  4ASW C;  3QA8 A;  2IJ0 A;  1TYG B;  2WDQ B;  3RN9 C;  1CMX B;  2IGG A;  1CJE A;  5BYR A;  2SAK A;  4LJO B;  2GB1 A;  4XDD A;  1Z2M A;  3OAW A;  2KFJ A;  2BT6 A;  4RFB A;  1KH0 A;  3BVM A;  1M4V A;  1VR9 A;  1C79 A;  2G4D B;  2NPT B;  4P1C C;  2CJN A;  1P98 A;  2MBB B;  2MP2 B;  3W1S C;  3O13 A;  2RPV A;  2BYV E;  2J0M A;  5IKC M;  1E8Z A;  3NZ3 A;  1WGD A;  5DPT A;  2M56 B;  4NY0 A;  1WR1 A;  4GGQ A;  2DWQ A;  3DHG C;  2K22 A;  4KSL C;  1PFD A;  3KW5 B;  2V0G A;  4OHJ A;  2D2Q A;  1F0Z A;  3DBS A;  1ZXH A;  3CST A;  2JWZ A;  2AQ1 B;  4JGH B;  1HXY D;  1TY2 A;  1F77 A;  1XQQ A;  2RDH A;  4L23 A;  2IO2 B;  1FNV A;  4USA A;  1YQ3 B;  2CS4 A;  2KD0 A;  1MG8 A;  3RNC C;  4KGR A;  2JYE A;  1ZDX A;  4II3 B;  2XN9 C;  1YX6 B;  5LXI B;  3WA0 A;  1SB3 C;  1WXS A;  2KMA A;  1T0Q C;  4OVZ A;  3T8M A;  1P0R A;  2N7E A;  3H7S A;  2L3Z A;  3V6C B;  2C60 A;  3FC4 A;  3Q3N C;  5GXG B;  1JRU A;  2WXI A;  3FAH A;  3AE3 B;  4BKS D;  4LDT D;  1ZP0 B;  4GSW A;  1FCL A;  3PRZ A;  3HIZ A;  3A9J B;  4XE0 A;  2KQS A;  4ANW A;  2PJH A;  2V4L A;  4GDL B;  2VZK D;  3AMZ A;  3ZXR A;  2ZEQ A;  1AW7 A;  2J7Q B;  1FCC C;  2O2V A;  1KOT A;  1XF5 L;  5JXV A;  2NMQ A;  1I7H A;  3Q3J A;  1RLF A;  3AED B;  3ALB A;  2DZI A;  2NTS A;  1LO5 D;  2CR5 A;  2OJR A;  2N9E B;  1IBX A;  1N6Z A;  2WYQ A;  3QHT A;  2ZCB A;  4MH8 A;  3DQV A;  3J9C A;  3IG3 A;  4BOS C;  1XCQ L;  3MFG A;  2Z8L A;  2IGH A;  2AQ2 B;  4HCN B;  1TS2 A;  1K51 A;  3X0W A;  3NG0 A;  1N63 A;  2QSD A;  2ON8 A;  5MPO A;  2KQ4 X;  4E71 A;  1XLO A;  4LLG M;  2FCQ A;  4L2Y A;  4WJO A;  2L8J A;  3IHP C;  3RYT A;  4IW0 A;  3QJZ A;  3VHT C;  5DPS A;  1IYF A;  3OWE B;  1VRA B;  2NR2 A;  1Y56 A;  2MX2 A;  2FUH B;  3HUI A;  1QOG A;  1GNU A;  1PGA A;  3ZUN A;  4REZ A;  1EUV B;  3EUB 2;  4BBN F;  4HRO A;  1SE2 A;  2KTF A;  1PYW D;  2N9P C;  4FXC A;  5EE0 A;  1IP9 A;  2LHD A;  2J42 A;  4X57 B;  1WYW B;  1WX8 A;  2DYM A;  2XNA C;  1IPG A;  4OZB A;  4MSM B;  4GMV A;  4RF0 A;  1C76 A;  2Y3A A;  2KAN A;  4YL8 A;  2MQJ A;  2LJ5 A;  2KHW B;  2GMI C;  1WJN A;  4HKQ A;  4W9E A;  5C2T B;  1L6U A;  3KWL A;  4N9F 4;  2DX5 B;  1P9D U;  4KZC A;  2KKC A;  4FAD A;  5BO4 B;  1I35 A;  2BB6 A;  3RI7 C;  4KX6 B;  5AZF A;  3P4P B;  1QOF A;  1LXD A;  2K1F A;  4ZHO A;  2WDV B;  1YNT E;  5JZE B;  4A55 A;  2JYT A;  2DEN B;  1WGH A;  2Y5B B;  3VTW A;  1YQ4 B;  5JHA A;  1SJH D;  3P4R B;  3SFD B;  1B1Z A;  2LGY A;  2M1M A;  3KYC D;  4JLC A;  1JW9 D;  3A9K B;  2K8C A;  1FFV A;  4ACF A;  3ZLZ A;  2KWV B;  4YXD B;  2ZJD A;  3NHE B;  4XC2 A;  2LGD A;  2DYO A;  4OZC A;  2Z59 B;  1S3S G;  5CHW A;  3EFC A;  3GZN B;  1FPY A;  3LB8 C;  3QX1 A;  1E8Y A;  5J2R A;  2PE6 B;  4FUL A;  4W9L A;  2CHW A;  3ZJV A;  1E7U A;  4N58 A;  1P3Q U;  4EOY A;  3KLS X;  4MH0 E;  4LNI A;  1T5X D;  4F1S A;  3KVF B;  4RGM A;  3I9V 1;  2NCN A;  1OQR A;  2PVG C;  3PZD A;  1ZE3 D;  4R3D A;  2KTR B;  3ZDT A;  4KV2 A;  1TIF A;  1MVK A;  3ML8 A;  2KAJ A;  1K52 A;  1L5P A;  3TSS A;  2KWU B;  3AV8 A;  2N9K A;  4QAY A;  5I4D A;  2MH7 A;  1D4B A; 
#chains in the Genus database with same CATH homology
 1KF6 B;  1MHX A;  4A6Q A;  2PLP A;  4RF1 A;  5D7G A;  1N62 A;  1XXG A;  4LTU A;  3U7Z A;  2WU2 B;  4XDC A;  1DOX A;  4PT5 A;  3BK1 A;  1YN5 A;  1XCT L;  2AX5 A;  1R7S A;  3BYT B;  2GI9 A;  1K50 A;  4N6E B;  4IKG A;  4WUR A;  3P4S B;  2BS2 B;  2L1A A;  4B0M A;  3H8H A;  4OW0 A;  3DWM A;  2CJO A;  1FRR A;  2WXG A;  2FE8 A;  2SEB D;  3AE5 B;  4CQN A;  3P63 A;  3BZD B;  4YT0 B;  1L4D B;  1C4A A;  1TZO A;  2LMC A;  4N59 A;  4C7Z A;  1XLP A;  2WXJ A;  4O1N A;  3TEY A;  1UWX A;  3GB1 A;  1FM0 D;  1CK1 A;  4KGS A;  2H88 B;  1D6E C;  4ZRP A;  1KFY B;  1T3Q A;  4DXG A;  3Q8C A;  2B76 B;  3LYY A;  1SE4 A;  2I2Y A;  1QIL A;  3AE6 B;  3RPF C;  1GOZ A;  1C77 A;  1EM7 A;  2W82 A;  1FNW A;  5EE9 A;  2KMM A;  2PIA A;  1DOI A;  1FNU A;  1PGB A;  2Y5C A;  1TS3 A;  2CU3 A;  2QJL A;  2RMM A;  1YJI A;  2WXK A;  3NUH B;  1I4H A;  4NJC A;  5EE1 A;  1V8C A;  2BS3 B;  2DBY A;  1IUE A;  1DOY A;  1PGX A;  1ENF A;  4RNA A;  2K3U A;  4GLS C;  3BYY B;  4ITK A;  2Q5W D;  2JU6 X;  4A8X C;  1KLU D;  1EWC A;  5H8Y E;  4H2A A;  2N9L A;  2QEJ C;  1XO3 A;  3GP7 A;  3NVW A;  2LGI A;  1GB4 A;  3WCQ A;  3AEA B;  1C4P A;  2N7J A;  5D3I B;  2WU5 B;  5H92 C;  1JWS D;  4LK0 M;  1I4Q A;  2WXF A;  1FXI A;  2NTT A;  1KTK A;  1N5X A;  1YMH E;  2LEK A;  4GDK B;  2N0S B;  3U52 E;  3R8B A;  4RGN A;  2WXR A;  3KQ4 A;  2WXN A;  1WSP A;  1QLB B;  1E9M A;  2IPK D;  5EE3 A;  2BYT A;  1MHH E;  4J3O D;  1XEE A;  1CQV A;  1V97 A;  3MC0 B;  2INP E;  2WS3 B;  3TUO A;  3SEB A;  2LHE A;  3AEC B;  1FRD A;  1JRP A;  3IAM 1;  4NZL B;  5HHD G;  2KN4 A;  4JPS A;  4L1B A;  4RGO S;  1CZP A;  4C7Y A;  4JX1 C;  1AN8 A;  3NVV A;  2IJ0 A;  3B2G A;  3GS2 A;  1TYG B;  2M0A A;  1BXT A;  3ABV B;  2IDY A;  1NI3 A;  4YTM B;  4RCO A;  3BII D;  1TKY A;  2WDQ B;  4XWW A;  1WWT A;  1YN3 A;  2BS4 B;  3W5V B;  3Q8F A;  1TKE A;  2IGG A;  1CJE A;  1BUI C;  2INN E;  3V3X A;  3TEZ A;  1I4R A;  5BYR A;  1QKZ A;  1QOB A;  1QOA A;  2SAK A;  1GAQ B;  2GB1 A;  4XDD A;  1F2R C;  1NEK B;  3RFZ B;  2M19 A;  2D5G A;  5LNK 1;  2BT6 A;  4RFB A;  1AWD A;  1TKG A;  2JZP A;  2WDR B;  1KH0 A;  1RM6 C;  3BVM A;  1M4V A;  1VR9 A;  1C79 A;  5G5H A;  5BYQ A;  2CJN A;  3ETR A;  3W1S A;  3W5U B;  1A70 A;  3E56 A;  3FIL A;  4P16 A;  4IOI E;  1SIJ A;  3O13 A;  4TMA B;  2VZK B;  3T3O A;  2WLB A;  2RPV A;  2WP9 B;  3AEF B;  1EU3 A;  4ZYS A;  3NZ3 A;  2M56 B;  2YEP F;  2X38 A;  1TJE A;  2E6X A;  3HVZ A;  2KDM A;  4HEA 1;  2J4X A;  2KWD A;  1QF6 A;  2DWQ A;  2K22 A;  1PFD A;  3B9J A;  3Q69 A;  2V0G A;  3Q8A A;  1KLG D;  4OHJ A;  1NEN B;  3P42 A;  3N9Y C;  4A90 A;  1F0Z A;  1GB1 A;  1RFK A;  3AB5 A;  1IGD A;  2BB5 A;  1ZXH A;  3AEG B;  3UI3 A;  1L0Y B;  2AQ1 B;  3PZ7 A;  4KKI A;  4WAF A;  4WWM A;  4HJG E;  2EKI A;  1HXY D;  1TY2 A;  1PDX A;  1F77 A;  2RDH A;  4YWG G;  1D5M C;  4KGT A;  2G9H D;  4L23 A;  1JQ4 A;  1RWS A;  1FNV A;  1XLQ A;  4USA A;  4RGT A;  3IT4 B;  4WIP A;  1YQ3 B;  4C80 A;  4MM3 B;  1JWU D;  1OFF A;  4KGR A;  1E0Z A;  2JYE A;  1ZDX A;  3W2D A;  2XN9 C;  3U4E G;  1L0X B;  1E10 A;  4AS1 A;  1RYJ A;  3VRB B;  3SFE B;  1SB3 C;  2PVO D;  2PMV A;  3VR8 B;  4YTP B;  3CWI A;  1QT9 A;  4OVZ A;  4US8 A;  2G1E A;  1JML A;  5HG2 A;  1P7E A;  4TSS A;  5AUK A;  4P6V F;  1IBX B;  4ARI A;  1UNS A;  3KWV A;  1FO4 A;  1VDV A;  2OHF A;  3FC4 A;  4OZA A;  5GXG B;  3AE9 B;  2K5P A;  1V1O A;  2WXI A;  3FAH A;  3AE3 B;  5HI1 A;  1D5Z C;  4YSY B;  2WXM A;  1ZP0 B;  4WH4 A;  1I4X A;  1AYF A;  1FCL A;  1J7B A;  5BMH A;  1D5X C;  3AEE B;  1ZPS A;  1UGJ A;  4XE0 A;  1T6B X;  2MJE A;  1PUT A;  4NAM A;  4GDL B;  2VZK D;  3AMZ A;  2WXQ A;  1AW7 A;  1V1P A;  5BYS A;  3HRD D;  1FCC C;  3MJ5 A;  4JWU C;  3VQI A;  4YSX B;  1JCK B;  1XF5 L;  5JXV A;  2NMQ A;  3TEW A;  1I7H A;  3IAS 1;  2PW9 A;  3AED B;  2JQR B;  2WXP A;  1ROE A;  2NTS A;  1HZ5 A;  1LO5 D;  4AQ7 A;  1SE3 A;  3PO0 A;  1IBX A;  3FIL B;  3AE7 B;  1VLB A;  4MH8 A;  3J9C A;  4C56 C;  2E3T A;  1Q10 A;  2RDG A;  4ARC A;  4JE3 B;  2KAC A;  2BTE A;  3HVD A;  2JX5 A;  2HTM E;  1XCQ L;  3MFG A;  2Z8L A;  1MI0 A;  2ACZ B;  1HQR D;  1N60 A;  2IGH A;  2V3N A;  2AQ2 B;  3AE8 B;  1TS2 A;  1K51 A;  2ICI A;  1GPX A;  4TQ0 A;  3MHZ A;  4RH6 A;  2L52 A;  4HKZ E;  3E9S A;  1N63 A;  1ZUD 2;  2QSD A;  3Q8B A;  3CIR B;  2ON8 A;  5FKA C;  5MPO A;  2KQ4 X;  3DWG C;  1E6E B;  1D4B A;  1HZ6 A;  1SJE D;  1FD6 A;  1J7C A;  1XLO A;  2YEP B;  4LLG M;  4L2Y A;  1L4Z B;  2J53 A;  1HEZ E;  1P7F A;  3U2S C;  2V3P A;  1ZOY B;  3AEB B;  1SSN A;  1TY0 A;  3AE2 B;  1EU4 A;  3NVY A;  1K53 A;  1UUP A;  1VRA B;  2Y5P A;  3OWE B;  3NRZ A;  1Y56 A;  3AE1 B;  2H89 B;  3HUI A;  1QOG A;  2ZW1 A;  1N61 A;  3PZ8 A;  1FEH A;  5BMG A;  1PGA A;  4REZ A;  4YTN B;  4B0E A;  3AN1 A;  1F2R I;  3TEX A;  2W54 A;  3ZGZ A;  3EUB 2;  4MAC A;  4HRO A;  1I4G A;  1NYR A;  1SE2 A;  1ESF A;  1PYW D;  3W9C B;  2IGD A;  4FXC A;  5BMI A;  1XLN A;  2JSV X;  5EE0 A;  2LHD A;  4ZOH C;  2J42 A;  2TSS A;  4MT5 A;  3ZJT A;  1I4P A;  1KRH A;  4D2K A;  4UDU C;  2QIE B;  5HFY A;  2DYM A;  2XNA C;  4OZB A;  5G5G A;  3VR9 B;  3BWU D;  4RF0 A;  1HA5 A;  2K0P A;  1UWM A;  1MPE A;  1C76 A;  2Y3A A;  3R2T A;  3BK2 A;  2MEK A;  2QMT A;  1VZ7 A;  4A9A A;  2BW2 A;  2ONQ A;  2WXL A;  3NS1 A;  3B2F A;  4HKQ A;  1V1P B;  2BBC A;  5C2T B;  1NYQ A;  3IXS A;  1L6U A;  3KWL A;  2I38 A;  5FK9 C;  4KKJ A;  4WQM A;  5C3J B;  2MJ3 A;  1ET6 A;  3LXF A;  2LFI A;  1VZ6 A;  2OED A;  1TS4 A;  4HRS A;  3NVZ A;  1IGC A;  2FBW B;  1TS5 A;  1ACC A;  1JWB D;  1EWY C;  2BB6 A;  3IT6 B;  4KX6 B;  1JAL A;  2V4I B;  1FFU A;  3VRA B;  1YN4 A;  3EGR A;  2AQ3 B;  3P4P B;  1YJJ A;  1QQR A;  1QOF A;  1L6V A;  1C9F A;  4ZHO A;  1DGJ A;  2MJD A;  1NVI D;  5FR3 A;  1E7P B;  2WDV B;  1YNT E;  3AH7 A;  4A55 A;  2K9X A;  2HDE A;  2JYT A;  3AM9 A;  4ZRQ A;  3I57 A;  1C4C A;  3V05 A;  1YQ4 B;  3SR6 A;  2FUG 1;  1VJK A;  1SJH D;  1N5W A;  3P4R B;  4IDI A;  2W3R A;  3SFD B;  1DYQ A;  5TSS A;  1B1Z A;  5E6J A;  3ZJU A;  1ZXI A;  1WXQ A;  1JWA D;  2WXH A;  1SBB B;  1ZDV A;  1JW9 D;  4EE2 A;  3T3N A;  2DLB A;  1WYG A;  2L32 A;  3ZYY X;  4DQO C;  1FFV A;  1BML C;  2LUM A;  1VZ8 A;  2L83 A;  5AUI A;  1B9R A;  5D3D A;  4DXF A;  4Q2J A;  4YSZ B;  3BVZ A;  3P4Q B;  2GRI A;  4YXD B;  2W55 A;  3URY A;  2DYO A;  3EA6 A;  4OZC A;  2JXT A;  1C78 A;  2PKO A;  1JWM D;  4JWS C;  3LB8 C;  4ZHP A;  2LJI A;  3MP9 A;  2R61 A;  2JWU A;  3ZJV A;  1JRO A;  2W3S A;  4N58 A;  1J7A A;  1FMA D;  3AE4 B;  1WRI A;  1FIQ A;  1OQQ A;  3KLS X;  3ZQ4 A;  3Q8E A;  1FXA A;  4NAW B;  1T5X D;  3P1M A;  1STE A;  4RGM A;  1SXT A;  2WNM A;  4US9 A;  3I9V 1;  1OQR A;  2PVG C;  1ZE3 D;  1SF0 A;  1WGK A;  2QIL A;  3C8Y A;  4R3D A;  2ZW0 A;  2WQY B;  5T8I A;  2WXO A;  1MVK A;  2J52 A;  1ET9 A;  2KAJ A;  2EEL A;  1K52 A;  1L5P A;  3TSS A;  2PTL A;  3R2I A;  1SEB D;  4M0W A;  1L0V B;  4XWT A;  3AV8 A;  2N9K A;  5I4D A;  3L4P A;  3BVG A;  2MH7 A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...