2G1EA

Solution structure of ta0895
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
90
structure length
90
Chain Sequence
MVTVRYYATLRPITKKKEETFNGISKISELLERLKVEYGSEFTKQMYDGNNLFKNVIILVNGNNITSMKGLDTEIKDDDKIDLFPPVAGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of TA0895, a MoaD homologue from Thermoplasma acidophilum
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Transferase
molecule keywords hypothetical protein Ta0895
total genus 15
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2006-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2g1eA00
3AE9B 2OHFA 3P63A 1E10A 1JROA 4YTNB 4A9AA 2MJDA 3DWGC 3HRDD 1YQ3B 4N6EB 1ZP0B 1EWYC 1WYGA 2DBYA 4ITKA 2Q5WD 5G5GA 1DOYA 3AE6B 3AEDB 4KX6B 1YQ4B 2JQRB 1JRPA 1J7CA 1E9MA 1XLNA 2B76B 2MJ3A 5EE0A 2W3SA 3NRZA 1B9RA 1JALA 1V97A 3AE5B 2MJEA 3NVVA 2PVOD 3VRAB 2E3TA 1XLPA 1WGKA 1DOIA 2CU3A 2M56B 2CJOA 3W9CB 4YTPB 1VJKA 1J7BA 2K22A 3ETRA 1JWAD 1N63A 3BIID 2M19A 3P1MA 3AE2B 1YJIA 3AN1A 2K9XA 2WDQB 1ZUD2 1XLQA 5C3JB 1OQRA 3B2FA 1RM6C 1KRHA 2WQYB 3AE8B 1AWDA 3AEEB 1JW9D 3AB5A 2PVGC 3NVYA 2W54A 3DWMA 1N61A 1NENB 3P4SB 3SFEB 3AE7B 1FRDA 1RFKA 2DWQA 2QIEB 3AEBB 2PIAA 3LB8C 4US9A 4US8A 3VR8B 5EE1A 1NYQA 1AYFA 1XO3A 1ZOYB 2BS2B 1FFUA 3CWIA 3VRBB 1QT9A 4JWUC 1ROEA 1TKEA 4HRSA 1NEKB 2JX5A 1PDXA 3NVWA 1A70A 5H8YE 4YSZB 1FXAA 4ZHPA 3W5VB 1QOBA 3AECB 2KMMA 3FC4A 4C80A 1I7HA 5MPOA 3ABVB 1NVID 1NI3A 2PKOA 1E7PB 4WWMA 1NYRA 1VLBA 4C7ZA 1RWSA 1SF0A 1YJJA 2H89B 2K5PA 4FXCA 1FFVA 5C2TB 2QJLA 1F0ZA 1GPXA 1QOFA 1XLOA 2LEKA 3B9JA 2HTME 3VR9B 3P4RB 1N60A 5EE9A 5AUKA 1QLBB 1L6VA 1SIJA 2BS3B 1JQ4A 1QOAA 1DOXA 4WQMA 1T3QA 1FMAD 1DGJA 1FO4A 1PFDA 5GXGB 3SFDB 2MH7A 3AE1B 1L0VB 1ZXIA 2KAJA 1J7AA 3AMZA 1UWMA 2FBWB 3KWLA 2ACZB 2BS4B 4ZHOA 3W5UB 3RPFC 1CZPA 1GAQB 3AH7A 1E6EB 1TKGA 3AEAB 5G5HA 3ZYYX 1OQQA 1IUEA 4HROA 2L52A 3WCQA 3AV8A 1R7SA 1KF6B 1QOGA 3AM9A 4LTUA 3HUIA 3AEFB 2WDRB 5AUIA 4YTMB 1FM0D 3NVZA 2WU5B 3P4PB 4ZOHC 1FRRA 4N59A 4C7YA 4YSYB 2G1EA 2N0SB 1FIQA 1KFYB 2WDVB 3FAHA 1N62A 1WXQA 4N58A 1SB3C 2EKIA 2W3RA 5H92C 1RYJA 4IDIA 3AEGB 1L6UA 3AE4B 5EE3A 3P4QB 1VDVA 2L83A 2CJNA 4JX1C 1WRIA 3CIRB 1TJEA 2WS3B 1N5XA 1FXIA 1TKYA 2AX5A 2WLBA 3HVZA 3SR6A 1PUTA 3PO0A 2H88B 2W55A 1TYGB 1OFFA 3LXFA 1N5WA 4YXDB 3AE3B 1CJEA 4YSXB 4P6VF 1WWTA 3B2GA 1QF6A 1E0ZA 2BT6A 2WP9B 4USAA 1JWBD 1L5PA 1V8CA 3L4PA 4JWSC 3EUB2 3NS1A 4YT0B 2Y5CA 2WU2B
chains in the Genus database with same CATH superfamily
5G2NA 1E10A 2G9HD 4XC2A 4HEA1 4MM3A 3NZSA 3PGEA 2V1YA 3I3TB 4BFRA 5BMGA 3P42A 1FXTB 1VJKA 3TBLD 3PZ7A 4IM3A 2UWQA 1WMHA 1YJIA 1E7UA 3NZ3A 3N9YC 4XDCA 1V5OA 3L16A 3O65B 1PGAA 1Z5SB 2KFJA 3K9OB 3RNEC 2FE8A 2IO3B 3VTWA 3VXWA 1PDXA 3A9KA 2KJRA 2N9EB 4OVZA 1MJDA 4LDTD 4C80A 3X23A 1RRBA 3VUYA 1T0QC 1SF0A 4RNAA 2H89B 2BWFA 3GZNI 3QAQA 1ZKHA 4BKTA 1HA5A 1QLBB 1SIJA 2BKRB 2N9KA 3ALBA 2G4DB 2KDEB 3FILB 2I38A 4ASWC 4RGMA 1E6EB 1OQQA 2RDGA 2LXAA 3UF8A 5KHQA 4RCOA 4WWNA 1C4PA 3FAHA 4W9LA 2WXFA 2KN5A 4DHZB 3QWZB 2KWCA 3ENEA 2ZJDA 3ZTDA 4FJZA 2KMCA 3MC9A 2OEDA 1L2NA 1T0YA 1S1QB 4HDOA 3H1UA 2KDIA 2WXRA 4WJNA 4FBJB 3IG3A 3AE9B 1UBIA 1OQYA 2MBHA 2LFIA 1T0RC 2HE7A 1YQ4B 2UYZB 4MT5A 1WIAA 3AULA 3U30A 4HJKA 1EUVB 3UGBB 1J7BA 2KWDA 3T9LA 2J0MA 1JWMD 1TY0A 2L8JA 2KC1A 2MBBB 3AEBB 3RUIB 2BS2B 1AYFA 2ZPYA 4KZCA 4GLSC 1V2YA 2CU1A 4XZ4A 3C19A 1K53A 2FIDA 4KKJA 2FIFA 1D3ZA 4K81A 2QJLA 1IP9A 1YNTE 4W9CA 2REXA 1LQBA 5I4DA 2JYTA 3BVGA 3QX1A 5T8IA 3VUWA 2D2QA 2GBKA 2ZCCA 4ICUA 4EZLA 3WAMA 3NZUA 1EU3A 3HK0A 4MGIE 3Q6BA 2BS4B 1WE6A 2LD9A 2PW9A 5G5HA 3HHMA 4GDKB 1R7SA 1QOGA 5JHBA 1KLVA 1K51A 5LXIB 3DCGA 2WDVB 3GZNB 4IM0A 1EWCA 2SEBD 2KX0A 2DENB 3ZTCA 2J7QB 5E6PA 3HVZA 2NS5A 1ZXHA 1TYGB 2W9NA 4A8XC 1D5MC 4DXGA 2WP9B 1UD7A 4ICVA 2NPTA 4FHJA 4TUUA 2KWUB 1TS5A 1R4NB 1KH0A 1WYGA 2DBYA 1WGHA 5AEKB 3VH3B 1J7CA 1XLNA 3R7RA 1SXTA 4E74A 1C4AA 2IO2B 1WH3A 3NVVA 1T6BX 1V86A 3MJ5A 2Y5BB 1CK1A 4N9F4 4KDLB 5C3JB 3AEEB 1AWDA 4W9GA 3RNCC 4K1RB 1NENB 3CMMB 2N7DA 1JWSD 1NYQA 1VCBA 2ICIA 4JWUC 3OWEB 3V6CB 3NVWA 1FXAA 1GB4A 2CHWA 3FC4A 2WHIA 3JSVB 1L7YA 3P2BA 4R3DA 2K8HA 3A9JB 1NI3A 4WAFA 3KVFB 4FJVB 2RR9A 3B9JA 2JXXA 3AU4A 3DPDA 4ZRKA 4AUQC 2KMAA 1KLGD 1TTNA 3JW0X 3PHWB 3Q8FA 2GBMA 4ARIA 1TKGA 4ZRPA 2D3CA 2LGSA 3LYYA 2K0PA 3N32A 1EF1A 4HVBA 1AN8A 2DZMA 4N58A 2QCZA 3T3OA 3V3XA 1TJEA 2MBEA 3ECIA 3V05A 2ON8A 2X38A 1WWTA 3OLMD 4WURA 3H9DA 1V8CA 2KDMA 4PT5A 3P63A 1D5ZC 2LUEA 3BYYB 2MJDA 2DZIA 4JE3B 4II2B 3AE6B 3AEDB 4BBNF 5EE0A 2PJHA 3A1QB 3VRAB 4A6QA 1WGKA 2C7NB 2CU3A 1IBXB 1I42A 3UI3A 1UWXA 1E8ZA 4WJPA 3I9V1 1JWUD 3AE8B 4MGKE 1J19A 2KK8A 3PRPB 3SFEB 5AZFA 2PIAA 2ZW1A 3Q8AA 2RD0A 4US9A 4GMVA 2QILA 4FHKA 3M63B 3RMKC 1ISNA 3I63C 4KZ0A 1VZ7A 2JWZA 4LLGM 2KMMA 4JGHB 3RCZA 3DVGX 4A55A 1DYQA 1HXYD 1P0RA 5L95C 5JZEB 1IYFA 2L76A 4RMAA 4NNJB 3VR9B 2G45B 4HLEA 2OOBB 3SDLC 2W82A 3M3JA 4BAXA 2GMIC 2L0TA 4NZLB 1BXTA 3WANA 2AYOB 3BY4B 4DQOC 3AH7A 3TEWA 4GOCA 2O6VD 2L52A 4CHKA 3AM9A 2PPHA 1N6ZA 1IGDA 2Z59B 4C7YA 2Y5PA 3MHZA 4REZA 4LNOA 1BT0A 2XEWA 1WMHB 2LJIA 4ZRQA 1WRIA 3CIRB 3QJZA 4P7IA 1P98A 3DVNU 4M0WB 4FJYA 4FLHA 2WWZA 1M4VA 4RF1A 5E6NA 1WM2A 2VZKB 4JL9A 1YN4A 2OHFA 2JPHA 1R4MB 2IJ0A 2KQSA 1VZ8A 3PSEB 3IVFA 3URYA 3AE5B 1GB1A 3CSFA 1WI0A 4S0RA 3VTUA 2IY1B 5HG2A 4OZAA 4UDUC 3ML9A 3H7PA 2K9XA 4E71A 1SJHD 5CHFA 3A1QA 2DYBA 2BYFA 3DBHB 3EC8A 3IT6B 4ANXA 4B0EA 1ROEA 4HRSA 1H4RA 1V1PA 1Z2MA 2GBJA 5D94A 1KJTA 1QOFA 3ZJVA 4RGOS 4GGQA 4MJSA 3TMPB 2D07B 2WXPA 1DOXA 4NAWA 1TZOA 1ZXIA 3APCA 2LGIA 4MSQB 4ZHOA 4WAAA 3M95A 4AOFA 3DDCB 2MCNB 2INDC 2RPQA 5CTRC 3Q2AC 3P4PB 4A3PA 1Q10A 2KWVB 2BYTA 3NS8A 3VUXA 1RYJA 4IDIA 2GLSA 2J52A 3P4QB 2BB6A 4A3OA 5HI1A 1XEEA 3L54A 1IPGA 3KYDD 1WZ3A 3U7ZA 3KW5B 1F1HA 2Y5CA 1I4GA 2FAZA 4KIKB 4AJYB 4RF0A 1E9MA 2MA9B 5TSSA 5C1ZA 2JU6X 2ZEQA 2D3BA 4IWQA 4P16A 5IN7A 1WY8A 3PZDA 4ZDVA 2JF5A 3AE2B 4F8CB 3ZNID 3MC0B 1TS3A 2N7JA 3NG0A 3QARA 4PYUA 1UH6A 4NJ6A 1LGRA 2BVCA 3U8ZA 4G50A 4US8A 2KTRA 1FFUA 5LNK1 4XX5A 2QDFA 4BKGA 4OW0A 1MPEA 4PYZA 3APFA 1S3SG 3KWVA 4KGRA 1I7HA 3PV1A 2KOXA 4W9HA 4WWMA 1VLBA 1RWSA 3PLVA 2AEHA 1E8XA 4MSMB 1GPXA 4YL8A 5C23A 3KYCD 2R61A 1ESFA 3N20C 3KUDB 1FEHA 2ZVOA 2N1VA 3SEBA 4QAYA 1UWMA 2UU7A 1T0SC 4I6PA 1I4PA 3NJTA 3BWUD 4HROA 3RNAC 3QCAA 2WU5B 1HEZE 3ZRFA 2G3QB 1TGZB 3ML8A 1OEYA 1YIWA 3PRMB 4NJCA 3PHXB 5D3DA 1L6UA 2K25A 3QK0A 1IBXA 3D32A 1F52A 1FXIA 2WX1A 2VRRB 4MEMA 4W9IA 2LUMA 2W55A 3PREA 2KFKA 3GE3C 2IGHA 1QF6A 4LJOB 1P7FA 1ACCA 1ET6A 3OG5A 1UGMA 2Z0EB 2EKEC 2N9LA 4KV2A 3IBEA 1ZP0B 3JVZX 5JH5C 2KLCA 3GP7A 2CS4A 3MP9A 1PGXA 1NDDA 5J2RA 2LVQA 1JCKB 2V3SA 2NR2A 2MQJA 5CX3A 4NAWB 3AN1A 2M4NA 2WXLA 3RNGC 3KUZA 1XT9B 4AWJA 3DQVA 2VH2A 3PZ8A 1WXSA 2RGFA 4W9DA 3VR8B 1XO3A 2MEKA 1ET9A 3ZDMC 2J0JA 2NTSA 4LJPB 5LLIA 2JX5A 2RPVA 1GUAB 4B6WA 1CMXB 4M00A 3ABVB 1NVID 4ZYNA 4K3BA 4DK5A 1HTOA 1E7PB 2EELA 3MC8A 5KHOA 2WXKA 3I57A 2V3NA 1FNUA 2NVUI 1HQRD 4WQMA 3AE1B 2FBWB 4B9KA 3RPFC 5L83A 3AEAB 3N3KB 1RAXA 3VH4B 2M17A 4I6LB 5CHVC 4YTMB 2D3AA 4DBGA 3ONSA 1MFWA 1HZ5A 2QHOA 1WYWB 2DNFA 1HTQA 4BOZB 3HIZA 3WIMA 2V3PA 5J17A 2ZVNA 4BOSC 2DAFA 5DPRA 2JZZA 3C8YA 2VZKD 1C77A 2J4XA 4YSXB 4CQNA 1L5PA 4IC7B 2I1KA 5D2MB 2LGYA 2Y3AA 1PYWD 3L10B 1QZEA 2JQRB 1LXDA 1FCLA 1YMHE 2W3SA 3NRZA 2LXCA 3K9PB 3Q8EA 3IXSA 1SJED 2WX0A 3RI7C 1MHXA 2BTEA 2KZRA 5AZGA 3PVLA 2DX5B 5EDSA 3W2DA 4K3CA 4C4VB 4L1BA 2KACA 1XLQA 4F7ZA 5DPSA 4M0WA 1VZ6A 3KH0A 4DDID 3BYTB 1ENFA 1RFKA 4ANUA 3A4RA 1C4CA 3IT4B 1QT9A 5GMVA 5D7GA 1AARA 1I4XA 3R2TA 2INCC 4NY0A 2FCSA 3ZNGC 2JZPA 1ZDXA 2PKOA 4ZRJA 2FUG1 2L0FA 2R2OA 1XLOA 2HTME 4B0MA 1F2RI 3P4RB 1E7VA 4EE2A 1G6JA 1T3QA 1IGCA 3MFGA 1J7AA 3DHGC 1WX9A 2GOWA 1C9FA 2AQ3B 1WSPA 4IW0A 3WCQA 3TL5A 1KF6B 2AL6A 4NAMA 2V4IB 2KX3A 2XBBC 4ZOHC 2QSDA 4LNFA 4YSYB 4GN1A 1WGDA 2N0SB 4HKQA 3SHQA 3H7PB 3DVNV 2K3UA 2YEPB 4M8MA 2L83A 1V5TA 4XYCA 3U2SC 3M62B 1N5XA 3V62A 2WLBA 3SR6A 3PO0A 1NBFC 1OFFA 3GB1A 3HVDA 1GOZA 1WJUA 5IO9A 3L4PA 3TCAA 2GBNA 4XWTA 4LNKA 4C56C 3B08A 3DBRB 1YQ3B 4N6EB 1T5XD 2KFKB 4URKA 2DHZA 2D3GA 3H8HA 1WX8A 1ZPSA 3HM6X 1GJZA 3V60A 2KANA 1BMLC 1C3TA 2K1FA 4YTPB 5DPTA 3ZGZA 1WRDB 1YOVB 2D5GA 3BIID 5HFYA 3VAWA 1KRHA 3RD2A 1LFDA 2PVGC 1SSNA 2CHXA 3DWMA 2YLMA 3ZNZB 3OJ3A 1QQRA 1LO5D 2GBRA 2IBIB 2K39A 2IY0B 3NHEB 1TKEA 4GIVA 1WX7A 2ONQA 4GXBA 3ZIMA 2QC8A 3VQIA 3APDA 5JHAA 2WNMA 3EGRA 2WDTB 2AL3A 2E6XA 3RULA 2L1AA 3IHPC 1FMAD 1FO4A 4II3B 5FK9C 4MGZE 1ZDVA 2NPTB 3JYUA 2KTRB 2ACZB 4EEWA 1P9DU 2M1MA 3AV8A 4LTUA 3A33B 2NMQA 2C9WB 1N62A 1R4NI 4BBNC 4BKSA 1L0YB 3R3MA 3EHVA 1ZGUB 2N9XA 2ZCBA 2LASA 4S17A 2LHEA 2NCNA 4MM3B 3B2GA 5BYRA 1UBQA 1M94A 1YN3A 3CF6E 3KQ4A 2TSSA 1KM7A 1P3QU 3DWGC 3HRDD 5BMIA 1EWYC 1WR6E 2PE6B 2B76B 4HWIB 2JZ3B 4MDKE 5E6OA 1V97A 4OZBA 2E3TA 1XLPA 4RFBA 3PPAA 3ZW3A 3ETRA 1JWAD 3Q3NC 3P1MA 4IKGA 3TEXA 3VVWB 4BKSD 1D6EC 3EFCA 1TIFA 1A5RA 1MI0A 4E3CA 3DBRI 3H7SA 3TIXA 1R4MI 2SAKA 1F2RC 3TUOA 5FKAC 1A70A 2JXTA 4CYEA 4EFOA 3AECB 2PTLA 3QA8A 2KD0A 2FNJB 5MPOA 4P1BC 4WWPA 1E90A 2OJWA 1NI2A 1GC6A 5HHDG 2XK5A 1H8CA 4PS8A 3U4EG 4PS3A 1WJ4A 2BF8B 1UELA 2C60A 4TMAB 2LHDA 2BW2A 1MVKA 5E6JA 2K6DB 2KLGA 2KJ6A 2FUHB 4TQ0A 1XQQA 2KQ4X 3WAOA 4HKZE 3VFKA 1V81A 2L32A 4ACFA 2IPKD 1EF5A 2MP2A 2JRHA 2MW5A 1FRRA 4N59A 1XD3B 1KFYB 5AZHA 1SB3C 2EKIA 1U4AA 3AEGB 4KSLC 3AE4B 4IWPA 4JX1C 2WS3B 2JY6A 1PUTA 4HXDA 3J9CA 4YXDB 4OVUA 1WGRA 2DYOA 2JRIB 1HZ6A 1EM7A 4USAA 1FD6A 2I1JA 2DZJA 2IZVB 2FCNA 1AW7A 4DHJD 3KLSX 1RFAA 1JRPA 4EZKA 3PTFC 1YX5B 1YJ1A 3RN9C 2DZKA 2K22A 3MHSD 3PT2B 1TZ1A 2WDQB 1QILA 1JW9D 3WAPA 3ZJTA 2V9HA 4NPNA 1FRDA 2MBOA 3DHHC 2INPE 4NJ7A 3U52E 3VRBB 2MHJA 3MJWA 3A9KB 1WGYA 5H8YE 4DHJB 4ZHPA 2G4SA 2LMCA 1FCCC 1C79A 4YWGG 4LDTB 3WA0A 1WFYA 4IM2A 4XGAB 3O13A 4FXCA 1UNSA 5C2TB 3PLUA 1FFVA 2LEKA 2KDFB 3FILA 1YX6B 2BKFA 2BS3B 3E56A 1E5WA 2I2YA 1PFDA 3SU8X 4KGTA 3SFDB 1P1AA 1L0VB 3ZNHB 5IP4D 1FNWA 4G3XB 5CHWA 1QKZA 1GAQB 4MJSB 2V0GA 3W1SC 2JSVX 4K7SA 4DWFA 2WDRB 4L2YA 4TQ1A 3FKYA 2NBVB 4LNIA 3Q8BA 2BB5A 2QMTA 2AQ1B 1V1PB 4RH6A 1LM8B 1V49A 2W3RA 3BK2A 5IA7A 5EE3A 2MBQA 3TJPA 3R8BA 3ZVVA 3UQAA 4K7UA 4DDGD 2L00B 4DXFA 5FR3A 3LXFA 4IUMB 2PLPA 1CJEA 4DHZE 1TBEA 4B95A 2K8BA 4GDLA 4FN2A 3LDZE 4C00A 4ZYSA 1VD2A 4ITKA 1DOYA 2J53A 2PMVA 2Q5WD 3WALA 4JIOU 3B1LX 2LGDA 4MH8A 3LJ3A 1UGJA 3VTVA 2WXGA 4BVUC 3DVGY 1TY2A 3W9CB 4RGTA 4Q2JA 5IOIA 2MLBA 2PE9A 4NQLB 3QC8B 5IAAC 1Q5WB 3TSSA 3RYTA 1SBBB 3RNFC 1OQRA 3B2FA 2WQYB 1MG4A 4X57B 4BZAA 2D10A 4RGNA 4M01A 5IKCM 1WXMA 2ZNVC 3A4SC 3AE7B 3ZQ4A 2PEAA 2KO3A 1WGGA 1EO6A 1WF9A 1XCQL 2QIEB 2M8SA 3LB8C 1UF0A 1ZOYB 2JUOA 1MHHE 3RNBC 4TKNA 2JYEA 2IDYA 1PQSA 3UQBA 2DLBA 2BPSA 2NBUA 2BWES 1I4RA 1TT5B 5BYQA 2K5PA 4ANWA 2X8XX 4HPPA 2LRWA 1WJNA 4F1SA 1JQ4A 1BUIC 2WXHA 1GG3A 3OAWA 3H6NA 1Q0WB 3NVZA 2MRPA 2IGDA 4MGYE 3X0WA 3EFUA 2KN4A 3PRZA 5J18A 4XE0A 1VDVA 2GRIA 2WXOA 2IO0B 1SEBD 1V9JA 3DOWA 4J3OD 2HTHA 2KNBA 2BYEA 2WXQA 3RFZB 3Q3MC 2C7MB 1F77A 1VRAB 1FNVA 2KHWB 2ZPNA 4JWSC 1ZE3D 4HCNB 3R2IA 4WWOA 5D3IB 3AU5A 2A5UA 5G5GA 2HD5B 2WXNA 2B3AA 2MX2A 2ZZPB 1JALA 2RMMA 2MJEA 2CKHB 4KGSA 3SD5A 3T3NA 2RSUA 2D11A 1V80A 3QIJA 2MWSB 2KVRA 2WXMA 1ZUD2 1STEA 2LWPA 1XCTL 4GDLB 3IFWB 2K6QA 3NVYA 4WH4A 2BYVE 2DWQA 1OTRB 2J0KA 3Q3OC 3L0WB 3VDZA 3DBLB 4OZCA 3RT3B 3TEYA 4I6NB 1SE2A 2HDEA 3VHTC 1NYRA 2LRUA 3ZO5B 1UUPA 4XWWA 4HDQA 2LVPA 3ZKJC 1OEYJ 3W1YA 5AUKA 4FA6A 4H2AA 4O1NA 1D5XC 2N7EA 3NUHB 2C5LC 2ZNVB 3N1YC 4KKIA 3W5UB 2JVCA 3EA6A 1FPYA 3Q69A 3R66C 2J42A 1YN5A 2G1EA 1FIQA 4HK2A 2Z8LA 2O2VB 2INNE 1WJ6A 2H88B 1JMLA 3RZWC 3BINA 3TEZA 4P6VF 1VR9A 4RM9A 1JWBD 4JPSA 5D6JB 3NS1A 1TS4A 4GU2A 1V6EA 4FADA 2WU2B 3GOEA 4YTNB 2V4LA 4LK0M 4KX6B 2MJ3A 4AP4C 1B1ZA 1B9RA 2R2QA 1WR1A 2HJ1A 2L05A 2M56B 2IGGA 2CJOA 3NOBA 3ZLZA 2KDBA 1J0GA 1PGBA 3BK1A 1N63A 1V1OA 2KJHB 4TSSA 1L0XB 3L17A 2KQ7A 1C1YB 3IAS1 2CHZA 3AB5A 1K52A 1SE9A 2YVCA 1KOTA 3A9JA 3CWIA 3W1SA 3BZDB 4LCDE 4GSWA 4YSZB 2BBCA 4EKUA 5DCNA 2WXIA 4A90A 4EZJA 3BVZA 2MP2B 4TV3A 2GB1A 3E9SA 4L23A 4M02A 2L7RA 4PS7A 4HCPB 2O6VA 1QOAA 4JQWC 1YQBA 4HPMB 2MSED 3DBLI 1TS2A 3ZXVA 4KSKC 3ZYYX 2WYQA 1P7EA 2QEJC 1K50A 1SE4A 3MTNB 4AS1A 4ZRIA 4IWOA 4G0NB 1FM0D 1MG8A 4KIKA 2KVZA 1UZXB 3ZXRA 4WIPA 2NBWB 2A4ZA 2CJNA 3PS6A 2BGFA 1TKYA 4D2KA 1K8RB 1F9JA 3AE3B 1E0ZA 1EU4A 3ZJUA 2BQQA 4IOIE 4EOYA 1JROA 1C76A 4OHJA 2LZ6A 4GB9A 1SIFA 2NTTA 4XDDA 4KDIC 3GS2A 1DOIA 4MACA 4W9KA 4A20A 2M19A 3Q3FA 2RDHA 1RLFA 2LJ5A 5TR5A 2N9PC 2GI9A 4RM8A 3P4SB 3IAM1 2FCQA 5EE1A 4FULA 2LI5A 3UIPB 1NEKB 2DYMA 4C4VA 2N4FA 2KKCA 4M8NA 4ARCA 3OJ4B 2KYWA 3L08A 4MELA 4ANVA 2DAJA 4C7ZA 1Y8RC 5HKHA 3U7DA 2KXJA 1WXAA 1F0ZA 2JWUA 4P1CC 5EE9A 1N60A 2VH1A 1L6VA 2FCMA 3EECA 1DGJA 3B0AA 2MH7A 3QHTA 4W9FA 3Q8CA 1WZ0A 3KWLA 2YEPF 1KLUD 3UINB 1CZPA 1GNUA 1IUEA 1WE7A 3HUIA 1HE8A 3AEFB 3NY5A 4IG7B 3CSTA 3QQ8B 3KUCB 1WM3A 2O6VB 1WXVA 2JT4B 5H92C 4K7WA 4MH0E 4WJQA 4PK1A 2AX5A 1X1MA 1YD8U 2M0XA 2ZW0A 3AXCA 4LNNA 1KTKA 3N1XC 4EUTA 3ZUNA 3JSVA 2BT6A 2KC2A 3Q14C 1D4BA 3EUB2 4DXAB 1J8CA 3R7QA 1SGHA 4A9AA 4NQKE 4JLCA 2EMSA 3DBHI 5BYSA 2LGXA 1XF5L 1L4DB 3ZRCA 4CO7A 1CQVA 2PVOD 2AWTA 1Y56A 2KT7A 1I35A 2AQ2B 3Q3JA 1C78A 3N1ZC 2Z0DB 1RM6C 2CR5A 2W54A 1N61A 2XN9C 3N30A 5LXHA 3UIOB 2WXJA 3AI5A 5BO4B 2LVOA 2C7HA 4GDKA 1JRUA 3I5JC 2M0AA 3V61A 5G55A 1L4ZB 3W5VB 1QOBA 4WJOA 1SE3A 2L3ZA 3RZFA 5DPWA 3V6EB 2IO1B 1YJJA 3S2AA 4W9JA 2XK5B 3C0RB 2O2VA 1GC7A 5JXVA 2RDBC 1E8YA 1I4HA 5GXGB 2EMTA 5FR6A 2KAJA 3AMZA 3DHIC 4G11A 2IYDB 4KVGB 3BVMA 2K8CA 2KTFA 3GE8C 5AUIA 5BMHA 4AJWA 1Q1OA 4AQ7A 2ASQA 1WXQA 1XXGA 1I4QA 2WGSA 3ZDTA 4J6IA 2HJ8A 4OVVA 4HJGE 1ZW7A 2XNAC 3L13A 2N1WA 3HM3A 1N5WA 4HPLB 1OGWA 1E8WA 2OJRA 4W9EA 4YT0B 3DBSA 3T8MA 4WQOB
chains in the Genus database with same CATH topology
1YN4A 2OHFA 3R2IA 4XWTA 4C56C 1E10A 5D3IB 2G9HD 1YQ3B 4HEA1 4N6EB 5G5GA 1T5XD 2WXNA 2IJ0A 1VZ8A 3H8HA 1ZPSA 1JALA 2RMMA 3URYA 3AE5B 2MJEA 1GB1A 1BMLC 4KGSA 3T3NA 5BMGA 3P42A 4YTPB 5HG2A 1VJKA 4OZAA 3ZGZA 4UDUC 3PZ7A 2D5GA 3BIID 5HFYA 1YJIA 2K9XA 2WXMA 1SJHD 1ZUD2 3NZ3A 1STEA 1KRHA 1XCTL 3N9YC 4XDCA 4GDLB 2PVGC 1PGAA 1SSNA 3NVYA 4WH4A 3DWMA 2DWQA 2FE8A 3IT6B 1QQRA 1LO5D 4B0EA 1ROEA 1TKEA 4HRSA 4OZCA 1PDXA 3TEYA 4OVZA 2ONQA 1V1PA 3VQIA 4C80A 1SE2A 2HDEA 1NYRA 2WNMA 1UUPA 3EGRA 4XWWA 1SF0A 4RNAA 2H89B 2E6XA 1QOFA 3ZJVA 4RGOS 2L1AA 5AUKA 1HA5A 1QLBB 4H2AA 1SIJA 2WXPA 1DOXA 2N9KA 1FMAD 4O1NA 1FO4A 1D5XC 3NUHB 5FK9C 3FILB 1ZDVA 2I38A 1TZOA 1ZXIA 2LGIA 4ZHOA 2ACZB 4RGMA 4KKIA 3W5UB 1E6EB 1OQQA 2RDGA 3AV8A 3EA6A 4LTUA 3Q69A 2NMQA 3P4PB 4RCOA 1Q10A 2J42A 1YN5A 1C4PA 2G1EA 1FIQA 2BYTA 3FAHA 1N62A 2WXFA 2Z8LA 1L0YB 1RYJA 4IDIA 2J52A 3P4QB 2BB6A 5HI1A 1XEEA 2INNE 2H88B 1JMLA 2OEDA 2LHEA 4MM3B 3U7ZA 3TEZA 4P6VF 3B2GA 5BYRA 1VR9A 1YN3A 1JWBD 2WXRA 4JPSA 3KQ4A 2TSSA 3NS1A 1TS4A 2Y5CA 2WU2B 1I4GA 3AE9B 4YTNB 3DWGC 3HRDD 5BMIA 1EWYC 2LFIA 4LK0M 4KX6B 1YQ4B 4RF0A 1E9MA 5TSSA 2MJ3A 2B76B 1B1ZA 2JU6X 1B9RA 1V97A 4OZBA 4MT5A 2E3TA 1XLPA 2M56B 4RFBA 2IGGA 2CJOA 4P16A 1J7BA 3ETRA 1PGBA 1JWAD 3BK1A 1N63A 2KWDA 1V1OA 3P1MA 3AE2B 4IKGA 4TSSA 3TEXA 1L0XB 3MC0B 1TS3A 2N7JA 1D6EC 3IAS1 1JWMD 1TY0A 3AB5A 1MI0A 1K52A 3AEBB 2SAKA 4US8A 2BS2B 1AYFA 3CWIA 1FFUA 5LNK1 3W1SA 3BZDB 1F2RC 3TUOA 4GLSC 4OW0A 5FKAC 1MPEA 1A70A 4YSZB 2BBCA 2JXTA 3AECB 2PTLA 1K53A 3KWVA 4KGRA 2WXIA 1I7HA 5MPOA 4A90A 3BVZA 4WWMA 1VLBA 1RWSA 2GB1A 4KKJA 5HHDG 3E9SA 4L23A 3U4EG 2QJLA 1GPXA 1YNTE 5I4DA 2JYTA 1ESFA 2R61A 3BVGA 5T8IA 1QOAA 1FEHA 3SEBA 4TMAB 2LHDA 2BW2A 1MVKA 1TS2A 5E6JA 1EU3A 1UWMA 4TQ0A 2BS4B 2PW9A 2KQ4X 5G5HA 3ZYYX 1P7EA 1I4PA 3BWUD 4HKZE 4GDKB 4HROA 2QEJC 1R7SA 1QOGA 1K50A 1SE4A 2L32A 4AS1A 2IPKD 1FM0D 1K51A 2WU5B 1HEZE 1FRRA 4N59A 1KFYB 2WDVB 4WIPA 1EWCA 1SB3C 2EKIA 2SEBD 4NJCA 5D3DA 3AEGB 1L6UA 3AE4B 2CJNA 1IBXA 4JX1C 2WS3B 1FXIA 1TKYA 3HVZA 4D2KA 1PUTA 1ZXHA 2LUMA 2W55A 1TYGB 3J9CA 4A8XC 4YXDB 3AE3B 2IGHA 1QF6A 1D5MC 4DXGA 2WP9B 1E0ZA 2DYOA 1EU4A 1HZ6A 1EM7A 1P7FA 1ACCA 1ET6A 4USAA 3ZJUA 1FD6A 2N9LA 4IOIE 1JROA 1C76A 1TS5A 1KH0A 1ZP0B 1WYGA 2DBYA 4OHJA 1AW7A 3KLSX 3GP7A 1JRPA 1J7CA 1XLNA 1SXTA 1C4AA 2NTTA 4XDDA 3GS2A 3MP9A 3NVVA 1DOIA 1PGXA 4MACA 1T6BX 3MJ5A 1JCKB 2K22A 2M19A 4NAWB 2RDHA 3AN1A 1CK1A 2WDQB 5C3JB 2WXLA 3AEEB 1QILA 1AWDA 1JW9D 2GI9A 3ZJTA 1NENB 3P4SB 1FRDA 3IAM1 2INPE 3PZ8A 1JWSD 3VR8B 3U52E 5EE1A 1NYQA 1XO3A 3VRBB 2MEKA 2ICIA 4JWUC 1ET9A 3OWEB 2NTSA 1NEKB 2JX5A 2RPVA 3NVWA 5H8YE 1FXAA 2DYMA 4ZHPA 1GB4A 3FC4A 4ARCA 2LMCA 1FCCC 4R3DA 1C79A 3ABVB 1NVID 1NI3A 4YWGG 1E7PB 2EELA 4C7ZA 4WAFA 3O13A 1UNSA 2WXKA 4FXCA 5C2TB 1FFVA 3I57A 2V3NA 1F0ZA 2LEKA 3B9JA 2JWUA 5EE9A 1FNUA 1N60A 1L6VA 3FILA 2BS3B 1HQRD 1KLGD 3E56A 4WQMA 1DGJA 2I2YA 1PFDA 4KGTA 3SFDB 2MH7A 3AE1B 1L0VB 3Q8CA 1FNWA 2FBWB 3KWLA 1QKZA 2YEPF 1KLUD 3RPFC 1CZPA 1GAQB 3Q8FA 4ARIA 1TKGA 3AEAB 2V0GA 1IUEA 2JSVX 4ZRPA 3HUIA 3AEFB 2WDRB 3LYYA 2K0PA 4L2YA 4YTMB 4TQ1A 3Q8BA 2BB5A 2QMTA 1AN8A 1HZ5A 2AQ1B 1V1PB 4RH6A 4N58A 3T3OA 2W3RA 5H92C 3BK2A 5EE3A 2V3PA 3V3XA 1TJEA 3R8BA 2AX5A 2ZW0A 4DXFA 1KTKA 3V05A 3C8YA 5FR3A 2ON8A 2VZKD 2X38A 3LXFA 1C77A 2PLPA 1CJEA 2J4XA 4YSXB 1WWTA 4CQNA 2BT6A 4WURA 1D4BA 1L5PA 1V8CA 2KDMA 3EUB2 4PT5A 3P63A 1D5ZC 4ZYSA 2Y3AA 4A9AA 3BYYB 2MJDA 4JE3B 1PYWD 4ITKA 5BYSA 2J53A 2PMVA 2Q5WD 3AE6B 3AEDB 1DOYA 2JQRB 1XF5L 1L4DB 5EE0A 1FCLA 1YMHE 2W3SA 3NRZA 4MH8A 1CQVA 1UGJA 3Q8EA 2PVOD 2WXGA 1SJED 3IXSA 1WGKA 3VRAB 2CU3A 1TY2A 4A6QA 1MHXA 2BTEA 1IBXB 3W9CB 4RGTA 4Q2JA 3W2DA 1Y56A 4L1BA 1UWXA 3UI3A 2KACA 2AQ2B 3I9V1 1C78A 3TSSA 1XLQA 1JWUD 1SBBB 1OQRA 3B2FA 1RM6C 2WQYB 3AE8B 4RGNA 2W54A 1N61A 1VZ6A 2XN9C 4M0WA 3SFEB 3AE7B 3ZQ4A 3BYTB 1ENFA 1RFKA 2QIEB 1XCQL 2WXJA 2PIAA 2ZW1A 3Q8AA 3LB8C 4US9A 1ZOYB 1C4CA 2QILA 3IT4B 2M0AA 1MHHE 1QT9A 5D7GA 1VZ7A 1I4XA 1L4ZB 2IDYA 1QOBA 2JYEA 3R2TA 4LLGM 2DLBA 3W5VB 2KMMA 4A55A 1DYQA 1I4RA 2JZPA 1ZDXA 2PKOA 1HXYD 1SE3A 2FUG1 5BYQA 1YJJA 2K5PA 1XLOA 3VR9B 2HTME 4B0MA 1F2RI 3P4RB 5JXVA 4EE2A 1JQ4A 2W82A 1BUIC 1I4HA 1T3QA 5GXGB 2WXHA 4NZLB 1BXTA 1IGCA 3MFGA 2KAJA 1J7AA 3AMZA 1C9FA 2AQ3B 3BVMA 4DQOC 1WSPA 3AH7A 3TEWA 3WCQA 2L52A 1KF6B 5AUIA 3AM9A 5BMHA 4NAMA 2V4IB 3NVZA 1IGDA 2IGDA 4ZOHC 2QSDA 4C7YA 4AQ7A 4YSYB 2N0SB 1WXQA 2Y5PA 3MHZA 4REZA 1XXGA 2KN4A 4HKQA 2K3UA 2LJIA 1VDVA 2GRIA 2L83A 1I4QA 2WXOA 2YEPB 4XE0A 1WRIA 4ZRQA 3CIRB 3U2SC 1N5XA 1SEBD 2WLBA 3SR6A 4HJGE 4J3OD 3PO0A 2XNAC 1OFFA 2WXQA 3GB1A 3HVDA 1N5WA 3RFZB 1GOZA 1M4VA 4RF1A 1F77A 1VRAB 1FNVA 3L4PA 4JWSC 4YT0B 1ZE3D 2VZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE9 B;  2OHF A;  3P63 A;  1E10 A;  1JRO A;  4YTN B;  4A9A A;  2MJD A;  3DWG C;  3HRD D;  1YQ3 B;  4N6E B;  1ZP0 B;  1EWY C;  1WYG A;  2DBY A;  4ITK A;  2Q5W D;  5G5G A;  1DOY A;  3AE6 B;  3AED B;  4KX6 B;  1YQ4 B;  2JQR B;  1JRP A;  1J7C A;  1E9M A;  1XLN A;  2B76 B;  2MJ3 A;  5EE0 A;  2W3S A;  3NRZ A;  1B9R A;  1JAL A;  1V97 A;  3AE5 B;  2MJE A;  3NVV A;  2PVO D;  3VRA B;  2E3T A;  1XLP A;  1WGK A;  1DOI A;  2CU3 A;  2M56 B;  2CJO A;  3W9C B;  4YTP B;  1VJK A;  1J7B A;  2K22 A;  3ETR A;  1JWA D;  1N63 A;  3BII D;  2M19 A;  3P1M A;  3AE2 B;  1YJI A;  3AN1 A;  2K9X A;  2WDQ B;  1ZUD 2;  1XLQ A;  5C3J B;  1OQR A;  3B2F A;  1RM6 C;  1KRH A;  2WQY B;  3AE8 B;  1AWD A;  3AEE B;  1JW9 D;  3AB5 A;  2PVG C;  3NVY A;  2W54 A;  3DWM A;  1N61 A;  1NEN B;  3P4S B;  3SFE B;  3AE7 B;  1FRD A;  1RFK A;  2DWQ A;  2QIE B;  3AEB B;  2PIA A;  3LB8 C;  4US9 A;  4US8 A;  3VR8 B;  5EE1 A;  1NYQ A;  1AYF A;  1XO3 A;  1ZOY B;  2BS2 B;  1FFU A;  3CWI A;  3VRB B;  1QT9 A;  4JWU C;  1ROE A;  1TKE A;  4HRS A;  1NEK B;  2JX5 A;  1PDX A;  3NVW A;  1A70 A;  5H8Y E;  4YSZ B;  1FXA A;  4ZHP A;  3W5V B;  1QOB A;  3AEC B;  2KMM A;  3FC4 A;  4C80 A;  1I7H A;  5MPO A;  3ABV B;  1NVI D;  1NI3 A;  2PKO A;  1E7P B;  4WWM A;  1NYR A;  1VLB A;  4C7Z A;  1RWS A;  1SF0 A;  1YJJ A;  2H89 B;  2K5P A;  4FXC A;  1FFV A;  5C2T B;  2QJL A;  1F0Z A;  1GPX A;  1QOF A;  1XLO A;  2LEK A;  3B9J A;  2HTM E;  3VR9 B;  3P4R B;  1N60 A;  5EE9 A;  5AUK A;  1QLB B;  1L6V A;  1SIJ A;  2BS3 B;  1JQ4 A;  1QOA A;  1DOX A;  4WQM A;  1T3Q A;  1FMA D;  1DGJ A;  1FO4 A;  1PFD A;  5GXG B;  3SFD B;  2MH7 A;  3AE1 B;  1L0V B;  1ZXI A;  2KAJ A;  1J7A A;  3AMZ A;  1UWM A;  2FBW B;  3KWL A;  2ACZ B;  2BS4 B;  4ZHO A;  3W5U B;  3RPF C;  1CZP A;  1GAQ B;  3AH7 A;  1E6E B;  1TKG A;  3AEA B;  5G5H A;  3ZYY X;  1OQQ A;  1IUE A;  4HRO A;  2L52 A;  3WCQ A;  3AV8 A;  1R7S A;  1KF6 B;  1QOG A;  3AM9 A;  4LTU A;  3HUI A;  3AEF B;  2WDR B;  5AUI A;  4YTM B;  1FM0 D;  3NVZ A;  2WU5 B;  3P4P B;  4ZOH C;  1FRR A;  4N59 A;  4C7Y A;  4YSY B;  2G1E A;  2N0S B;  1FIQ A;  1KFY B;  2WDV B;  3FAH A;  1N62 A;  1WXQ A;  4N58 A;  1SB3 C;  2EKI A;  2W3R A;  5H92 C;  1RYJ A;  4IDI A;  3AEG B;  1L6U A;  3AE4 B;  5EE3 A;  3P4Q B;  1VDV A;  2L83 A;  2CJN A;  4JX1 C;  1WRI A;  3CIR B;  1TJE A;  2WS3 B;  1N5X A;  1FXI A;  1TKY A;  2AX5 A;  2WLB A;  3HVZ A;  3SR6 A;  1PUT A;  3PO0 A;  2H88 B;  2W55 A;  1TYG B;  1OFF A;  3LXF A;  1N5W A;  4YXD B;  3AE3 B;  1CJE A;  4YSX B;  4P6V F;  1WWT A;  3B2G A;  1QF6 A;  1E0Z A;  2BT6 A;  2WP9 B;  4USA A;  1JWB D;  1L5P A;  1V8C A;  3L4P A;  4JWS C;  3EUB 2;  3NS1 A;  4YT0 B;  2Y5C A;  2WU2 B; 
#chains in the Genus database with same CATH topology
 5G2N A;  1E10 A;  2G9H D;  4XC2 A;  4HEA 1;  4MM3 A;  3NZS A;  3PGE A;  2V1Y A;  3I3T B;  4BFR A;  5BMG A;  3P42 A;  1FXT B;  1VJK A;  3TBL D;  3PZ7 A;  4IM3 A;  2UWQ A;  1WMH A;  1YJI A;  1E7U A;  3NZ3 A;  3N9Y C;  4XDC A;  1V5O A;  3L16 A;  3O65 B;  1PGA A;  1Z5S B;  2KFJ A;  3K9O B;  3RNE C;  2FE8 A;  2IO3 B;  3VTW A;  3VXW A;  1PDX A;  3A9K A;  2KJR A;  2N9E B;  4OVZ A;  1MJD A;  4LDT D;  4C80 A;  3X23 A;  1RRB A;  3VUY A;  1T0Q C;  1SF0 A;  4RNA A;  2H89 B;  2BWF A;  3GZN I;  3QAQ A;  1ZKH A;  4BKT A;  1HA5 A;  1QLB B;  1SIJ A;  2BKR B;  2N9K A;  3ALB A;  2G4D B;  2KDE B;  3FIL B;  2I38 A;  4ASW C;  4RGM A;  1E6E B;  1OQQ A;  2RDG A;  2LXA A;  3UF8 A;  5KHQ A;  4RCO A;  4WWN A;  1C4P A;  3FAH A;  4W9L A;  2WXF A;  2KN5 A;  4DHZ B;  3QWZ B;  2KWC A;  3ENE A;  2ZJD A;  3ZTD A;  4FJZ A;  2KMC A;  3MC9 A;  2OED A;  1L2N A;  1T0Y A;  1S1Q B;  4HDO A;  3H1U A;  2KDI A;  2WXR A;  4WJN A;  4FBJ B;  3IG3 A;  3AE9 B;  1UBI A;  1OQY A;  2MBH A;  2LFI A;  1T0R C;  2HE7 A;  1YQ4 B;  2UYZ B;  4MT5 A;  1WIA A;  3AUL A;  3U30 A;  4HJK A;  1EUV B;  3UGB B;  1J7B A;  2KWD A;  3T9L A;  2J0M A;  1JWM D;  1TY0 A;  2L8J A;  2KC1 A;  2MBB B;  3AEB B;  3RUI B;  2BS2 B;  1AYF A;  2ZPY A;  4KZC A;  4GLS C;  1V2Y A;  2CU1 A;  4XZ4 A;  3C19 A;  1K53 A;  2FID A;  4KKJ A;  2FIF A;  1D3Z A;  4K81 A;  2QJL A;  1IP9 A;  1YNT E;  4W9C A;  2REX A;  1LQB A;  5I4D A;  2JYT A;  3BVG A;  3QX1 A;  5T8I A;  3VUW A;  2D2Q A;  2GBK A;  2ZCC A;  4ICU A;  4EZL A;  3WAM A;  3NZU A;  1EU3 A;  3HK0 A;  4MGI E;  3Q6B A;  2BS4 B;  1WE6 A;  2LD9 A;  2PW9 A;  5G5H A;  3HHM A;  4GDK B;  1R7S A;  1QOG A;  5JHB A;  1KLV A;  1K51 A;  5LXI B;  3DCG A;  2WDV B;  3GZN B;  4IM0 A;  1EWC A;  2SEB D;  2KX0 A;  2DEN B;  3ZTC A;  2J7Q B;  5E6P A;  3HVZ A;  2NS5 A;  1ZXH A;  1TYG B;  2W9N A;  4A8X C;  1D5M C;  4DXG A;  2WP9 B;  1UD7 A;  4ICV A;  2NPT A;  4FHJ A;  4TUU A;  2KWU B;  1TS5 A;  1R4N B;  1KH0 A;  1WYG A;  2DBY A;  1WGH A;  5AEK B;  3VH3 B;  1J7C A;  1XLN A;  3R7R A;  1SXT A;  4E74 A;  1C4A A;  2IO2 B;  1WH3 A;  3NVV A;  1T6B X;  1V86 A;  3MJ5 A;  2Y5B B;  1CK1 A;  4N9F 4;  4KDL B;  5C3J B;  3AEE B;  1AWD A;  4W9G A;  3RNC C;  4K1R B;  1NEN B;  3CMM B;  2N7D A;  1JWS D;  1NYQ A;  1VCB A;  2ICI A;  4JWU C;  3OWE B;  3V6C B;  3NVW A;  1FXA A;  1GB4 A;  2CHW A;  3FC4 A;  2WHI A;  3JSV B;  1L7Y A;  3P2B A;  4R3D A;  2K8H A;  3A9J B;  1NI3 A;  4WAF A;  3KVF B;  4FJV B;  2RR9 A;  3B9J A;  2JXX A;  3AU4 A;  3DPD A;  4ZRK A;  4AUQ C;  2KMA A;  1KLG D;  1TTN A;  3JW0 X;  3PHW B;  3Q8F A;  2GBM A;  4ARI A;  1TKG A;  4ZRP A;  2D3C A;  2LGS A;  3LYY A;  2K0P A;  3N32 A;  1EF1 A;  4HVB A;  1AN8 A;  2DZM A;  4N58 A;  2QCZ A;  3T3O A;  3V3X A;  1TJE A;  2MBE A;  3ECI A;  3V05 A;  2ON8 A;  2X38 A;  1WWT A;  3OLM D;  4WUR A;  3H9D A;  1V8C A;  2KDM A;  4PT5 A;  3P63 A;  1D5Z C;  2LUE A;  3BYY B;  2MJD A;  2DZI A;  4JE3 B;  4II2 B;  3AE6 B;  3AED B;  4BBN F;  5EE0 A;  2PJH A;  3A1Q B;  3VRA B;  4A6Q A;  1WGK A;  2C7N B;  2CU3 A;  1IBX B;  1I42 A;  3UI3 A;  1UWX A;  1E8Z A;  4WJP A;  3I9V 1;  1JWU D;  3AE8 B;  4MGK E;  1J19 A;  2KK8 A;  3PRP B;  3SFE B;  5AZF A;  2PIA A;  2ZW1 A;  3Q8A A;  2RD0 A;  4US9 A;  4GMV A;  2QIL A;  4FHK A;  3M63 B;  3RMK C;  1ISN A;  3I63 C;  4KZ0 A;  1VZ7 A;  2JWZ A;  4LLG M;  2KMM A;  4JGH B;  3RCZ A;  3DVG X;  4A55 A;  1DYQ A;  1HXY D;  1P0R A;  5L95 C;  5JZE B;  1IYF A;  2L76 A;  4RMA A;  4NNJ B;  3VR9 B;  2G45 B;  4HLE A;  2OOB B;  3SDL C;  2W82 A;  3M3J A;  4BAX A;  2GMI C;  2L0T A;  4NZL B;  1BXT A;  3WAN A;  2AYO B;  3BY4 B;  4DQO C;  3AH7 A;  3TEW A;  4GOC A;  2O6V D;  2L52 A;  4CHK A;  3AM9 A;  2PPH A;  1N6Z A;  1IGD A;  2Z59 B;  4C7Y A;  2Y5P A;  3MHZ A;  4REZ A;  4LNO A;  1BT0 A;  2XEW A;  1WMH B;  2LJI A;  4ZRQ A;  1WRI A;  3CIR B;  3QJZ A;  4P7I A;  1P98 A;  3DVN U;  4M0W B;  4FJY A;  4FLH A;  2WWZ A;  1M4V A;  4RF1 A;  5E6N A;  1WM2 A;  2VZK B;  4JL9 A;  1YN4 A;  2OHF A;  2JPH A;  1R4M B;  2IJ0 A;  2KQS A;  1VZ8 A;  3PSE B;  3IVF A;  3URY A;  3AE5 B;  1GB1 A;  3CSF A;  1WI0 A;  4S0R A;  3VTU A;  2IY1 B;  5HG2 A;  4OZA A;  4UDU C;  3ML9 A;  3H7P A;  2K9X A;  4E71 A;  1SJH D;  5CHF A;  3A1Q A;  2DYB A;  2BYF A;  3DBH B;  3EC8 A;  3IT6 B;  4ANX A;  4B0E A;  1ROE A;  4HRS A;  1H4R A;  1V1P A;  1Z2M A;  2GBJ A;  5D94 A;  1KJT A;  1QOF A;  3ZJV A;  4RGO S;  4GGQ A;  4MJS A;  3TMP B;  2D07 B;  2WXP A;  1DOX A;  4NAW A;  1TZO A;  1ZXI A;  3APC A;  2LGI A;  4MSQ B;  4ZHO A;  4WAA A;  3M95 A;  4AOF A;  3DDC B;  2MCN B;  2IND C;  2RPQ A;  5CTR C;  3Q2A C;  3P4P B;  4A3P A;  1Q10 A;  2KWV B;  2BYT A;  3NS8 A;  3VUX A;  1RYJ A;  4IDI A;  2GLS A;  2J52 A;  3P4Q B;  2BB6 A;  4A3O A;  5HI1 A;  1XEE A;  3L54 A;  1IPG A;  3KYD D;  1WZ3 A;  3U7Z A;  3KW5 B;  1F1H A;  2Y5C A;  1I4G A;  2FAZ A;  4KIK B;  4AJY B;  4RF0 A;  1E9M A;  2MA9 B;  5TSS A;  5C1Z A;  2JU6 X;  2ZEQ A;  2D3B A;  4IWQ A;  4P16 A;  5IN7 A;  1WY8 A;  3PZD A;  4ZDV A;  2JF5 A;  3AE2 B;  4F8C B;  3ZNI D;  3MC0 B;  1TS3 A;  2N7J A;  3NG0 A;  3QAR A;  4PYU A;  1UH6 A;  4NJ6 A;  1LGR A;  2BVC A;  3U8Z A;  4G50 A;  4US8 A;  2KTR A;  1FFU A;  5LNK 1;  4XX5 A;  2QDF A;  4BKG A;  4OW0 A;  1MPE A;  4PYZ A;  3APF A;  1S3S G;  3KWV A;  4KGR A;  1I7H A;  3PV1 A;  2KOX A;  4W9H A;  4WWM A;  1VLB A;  1RWS A;  3PLV A;  2AEH A;  1E8X A;  4MSM B;  1GPX A;  4YL8 A;  5C23 A;  3KYC D;  2R61 A;  1ESF A;  3N20 C;  3KUD B;  1FEH A;  2ZVO A;  2N1V A;  3SEB A;  4QAY A;  1UWM A;  2UU7 A;  1T0S C;  4I6P A;  1I4P A;  3NJT A;  3BWU D;  4HRO A;  3RNA C;  3QCA A;  2WU5 B;  1HEZ E;  3ZRF A;  2G3Q B;  1TGZ B;  3ML8 A;  1OEY A;  1YIW A;  3PRM B;  4NJC A;  3PHX B;  5D3D A;  1L6U A;  2K25 A;  3QK0 A;  1IBX A;  3D32 A;  1F52 A;  1FXI A;  2WX1 A;  2VRR B;  4MEM A;  4W9I A;  2LUM A;  2W55 A;  3PRE A;  2KFK A;  3GE3 C;  2IGH A;  1QF6 A;  4LJO B;  1P7F A;  1ACC A;  1ET6 A;  3OG5 A;  1UGM A;  2Z0E B;  2EKE C;  2N9L A;  4KV2 A;  3IBE A;  1ZP0 B;  3JVZ X;  5JH5 C;  2KLC A;  3GP7 A;  2CS4 A;  3MP9 A;  1PGX A;  1NDD A;  5J2R A;  2LVQ A;  1JCK B;  2V3S A;  2NR2 A;  2MQJ A;  5CX3 A;  4NAW B;  3AN1 A;  2M4N A;  2WXL A;  3RNG C;  3KUZ A;  1XT9 B;  4AWJ A;  3DQV A;  2VH2 A;  3PZ8 A;  1WXS A;  2RGF A;  4W9D A;  3VR8 B;  1XO3 A;  2MEK A;  1ET9 A;  3ZDM C;  2J0J A;  2NTS A;  4LJP B;  5LLI A;  2JX5 A;  2RPV A;  1GUA B;  4B6W A;  1CMX B;  4M00 A;  3ABV B;  1NVI D;  4ZYN A;  4K3B A;  4DK5 A;  1HTO A;  1E7P B;  2EEL A;  3MC8 A;  5KHO A;  2WXK A;  3I57 A;  2V3N A;  1FNU A;  2NVU I;  1HQR D;  4WQM A;  3AE1 B;  2FBW B;  4B9K A;  3RPF C;  5L83 A;  3AEA B;  3N3K B;  1RAX A;  3VH4 B;  2M17 A;  4I6L B;  5CHV C;  4YTM B;  2D3A A;  4DBG A;  3ONS A;  1MFW A;  1HZ5 A;  2QHO A;  1WYW B;  2DNF A;  1HTQ A;  4BOZ B;  3HIZ A;  3WIM A;  2V3P A;  5J17 A;  2ZVN A;  4BOS C;  2DAF A;  5DPR A;  2JZZ A;  3C8Y A;  2VZK D;  1C77 A;  2J4X A;  4YSX B;  4CQN A;  1L5P A;  4IC7 B;  2I1K A;  5D2M B;  2LGY A;  2Y3A A;  1PYW D;  3L10 B;  1QZE A;  2JQR B;  1LXD A;  1FCL A;  1YMH E;  2W3S A;  3NRZ A;  2LXC A;  3K9P B;  3Q8E A;  3IXS A;  1SJE D;  2WX0 A;  3RI7 C;  1MHX A;  2BTE A;  2KZR A;  5AZG A;  3PVL A;  2DX5 B;  5EDS A;  3W2D A;  4K3C A;  4C4V B;  4L1B A;  2KAC A;  1XLQ A;  4F7Z A;  5DPS A;  4M0W A;  1VZ6 A;  3KH0 A;  4DDI D;  3BYT B;  1ENF A;  1RFK A;  4ANU A;  3A4R A;  1C4C A;  3IT4 B;  1QT9 A;  5GMV A;  5D7G A;  1AAR A;  1I4X A;  3R2T A;  2INC C;  4NY0 A;  2FCS A;  3ZNG C;  2JZP A;  1ZDX A;  2PKO A;  4ZRJ A;  2FUG 1;  2L0F A;  2R2O A;  1XLO A;  2HTM E;  4B0M A;  1F2R I;  3P4R B;  1E7V A;  4EE2 A;  1G6J A;  1T3Q A;  1IGC A;  3MFG A;  1J7A A;  3DHG C;  1WX9 A;  2GOW A;  1C9F A;  2AQ3 B;  1WSP A;  4IW0 A;  3WCQ A;  3TL5 A;  1KF6 B;  2AL6 A;  4NAM A;  2V4I B;  2KX3 A;  2XBB C;  4ZOH C;  2QSD A;  4LNF A;  4YSY B;  4GN1 A;  1WGD A;  2N0S B;  4HKQ A;  3SHQ A;  3H7P B;  3DVN V;  2K3U A;  2YEP B;  4M8M A;  2L83 A;  1V5T A;  4XYC A;  3U2S C;  3M62 B;  1N5X A;  3V62 A;  2WLB A;  3SR6 A;  3PO0 A;  1NBF C;  1OFF A;  3GB1 A;  3HVD A;  1GOZ A;  1WJU A;  5IO9 A;  3L4P A;  3TCA A;  2GBN A;  4XWT A;  4LNK A;  4C56 C;  3B08 A;  3DBR B;  1YQ3 B;  4N6E B;  1T5X D;  2KFK B;  4URK A;  2DHZ A;  2D3G A;  3H8H A;  1WX8 A;  1ZPS A;  3HM6 X;  1GJZ A;  3V60 A;  2KAN A;  1BML C;  1C3T A;  2K1F A;  4YTP B;  5DPT A;  3ZGZ A;  1WRD B;  1YOV B;  2D5G A;  3BII D;  5HFY A;  3VAW A;  1KRH A;  3RD2 A;  1LFD A;  2PVG C;  1SSN A;  2CHX A;  3DWM A;  2YLM A;  3ZNZ B;  3OJ3 A;  1QQR A;  1LO5 D;  2GBR A;  2IBI B;  2K39 A;  2IY0 B;  3NHE B;  1TKE A;  4GIV A;  1WX7 A;  2ONQ A;  4GXB A;  3ZIM A;  2QC8 A;  3VQI A;  3APD A;  5JHA A;  2WNM A;  3EGR A;  2WDT B;  2AL3 A;  2E6X A;  3RUL A;  2L1A A;  3IHP C;  1FMA D;  1FO4 A;  4II3 B;  5FK9 C;  4MGZ E;  1ZDV A;  2NPT B;  3JYU A;  2KTR B;  2ACZ B;  4EEW A;  1P9D U;  2M1M A;  3AV8 A;  4LTU A;  3A33 B;  2NMQ A;  2C9W B;  1N62 A;  1R4N I;  4BBN C;  4BKS A;  1L0Y B;  3R3M A;  3EHV A;  1ZGU B;  2N9X A;  2ZCB A;  2LAS A;  4S17 A;  2LHE A;  2NCN A;  4MM3 B;  3B2G A;  5BYR A;  1UBQ A;  1M94 A;  1YN3 A;  3CF6 E;  3KQ4 A;  2TSS A;  1KM7 A;  1P3Q U;  3DWG C;  3HRD D;  5BMI A;  1EWY C;  1WR6 E;  2PE6 B;  2B76 B;  4HWI B;  2JZ3 B;  4MDK E;  5E6O A;  1V97 A;  4OZB A;  2E3T A;  1XLP A;  4RFB A;  3PPA A;  3ZW3 A;  3ETR A;  1JWA D;  3Q3N C;  3P1M A;  4IKG A;  3TEX A;  3VVW B;  4BKS D;  1D6E C;  3EFC A;  1TIF A;  1A5R A;  1MI0 A;  4E3C A;  3DBR I;  3H7S A;  3TIX A;  1R4M I;  2SAK A;  1F2R C;  3TUO A;  5FKA C;  1A70 A;  2JXT A;  4CYE A;  4EFO A;  3AEC B;  2PTL A;  3QA8 A;  2KD0 A;  2FNJ B;  5MPO A;  4P1B C;  4WWP A;  1E90 A;  2OJW A;  1NI2 A;  1GC6 A;  5HHD G;  2XK5 A;  1H8C A;  4PS8 A;  3U4E G;  4PS3 A;  1WJ4 A;  2BF8 B;  1UEL A;  2C60 A;  4TMA B;  2LHD A;  2BW2 A;  1MVK A;  5E6J A;  2K6D B;  2KLG A;  2KJ6 A;  2FUH B;  4TQ0 A;  1XQQ A;  2KQ4 X;  3WAO A;  4HKZ E;  3VFK A;  1V81 A;  2L32 A;  4ACF A;  2IPK D;  1EF5 A;  2MP2 A;  2JRH A;  2MW5 A;  1FRR A;  4N59 A;  1XD3 B;  1KFY B;  5AZH A;  1SB3 C;  2EKI A;  1U4A A;  3AEG B;  4KSL C;  3AE4 B;  4IWP A;  4JX1 C;  2WS3 B;  2JY6 A;  1PUT A;  4HXD A;  3J9C A;  4YXD B;  4OVU A;  1WGR A;  2DYO A;  2JRI B;  1HZ6 A;  1EM7 A;  4USA A;  1FD6 A;  2I1J A;  2DZJ A;  2IZV B;  2FCN A;  1AW7 A;  4DHJ D;  3KLS X;  1RFA A;  1JRP A;  4EZK A;  3PTF C;  1YX5 B;  1YJ1 A;  3RN9 C;  2DZK A;  2K22 A;  3MHS D;  3PT2 B;  1TZ1 A;  2WDQ B;  1QIL A;  1JW9 D;  3WAP A;  3ZJT A;  2V9H A;  4NPN A;  1FRD A;  2MBO A;  3DHH C;  2INP E;  4NJ7 A;  3U52 E;  3VRB B;  2MHJ A;  3MJW A;  3A9K B;  1WGY A;  5H8Y E;  4DHJ B;  4ZHP A;  2G4S A;  2LMC A;  1FCC C;  1C79 A;  4YWG G;  4LDT B;  3WA0 A;  1WFY A;  4IM2 A;  4XGA B;  3O13 A;  4FXC A;  1UNS A;  5C2T B;  3PLU A;  1FFV A;  2LEK A;  2KDF B;  3FIL A;  1YX6 B;  2BKF A;  2BS3 B;  3E56 A;  1E5W A;  2I2Y A;  1PFD A;  3SU8 X;  4KGT A;  3SFD B;  1P1A A;  1L0V B;  3ZNH B;  5IP4 D;  1FNW A;  4G3X B;  5CHW A;  1QKZ A;  1GAQ B;  4MJS B;  2V0G A;  3W1S C;  2JSV X;  4K7S A;  4DWF A;  2WDR B;  4L2Y A;  4TQ1 A;  3FKY A;  2NBV B;  4LNI A;  3Q8B A;  2BB5 A;  2QMT A;  2AQ1 B;  1V1P B;  4RH6 A;  1LM8 B;  1V49 A;  2W3R A;  3BK2 A;  5IA7 A;  5EE3 A;  2MBQ A;  3TJP A;  3R8B A;  3ZVV A;  3UQA A;  4K7U A;  4DDG D;  2L00 B;  4DXF A;  5FR3 A;  3LXF A;  4IUM B;  2PLP A;  1CJE A;  4DHZ E;  1TBE A;  4B95 A;  2K8B A;  4GDL A;  4FN2 A;  3LDZ E;  4C00 A;  4ZYS A;  1VD2 A;  4ITK A;  1DOY A;  2J53 A;  2PMV A;  2Q5W D;  3WAL A;  4JIO U;  3B1L X;  2LGD A;  4MH8 A;  3LJ3 A;  1UGJ A;  3VTV A;  2WXG A;  4BVU C;  3DVG Y;  1TY2 A;  3W9C B;  4RGT A;  4Q2J A;  5IOI A;  2MLB A;  2PE9 A;  4NQL B;  3QC8 B;  5IAA C;  1Q5W B;  3TSS A;  3RYT A;  1SBB B;  3RNF C;  1OQR A;  3B2F A;  2WQY B;  1MG4 A;  4X57 B;  4BZA A;  2D10 A;  4RGN A;  4M01 A;  5IKC M;  1WXM A;  2ZNV C;  3A4S C;  3AE7 B;  3ZQ4 A;  2PEA A;  2KO3 A;  1WGG A;  1EO6 A;  1WF9 A;  1XCQ L;  2QIE B;  2M8S A;  3LB8 C;  1UF0 A;  1ZOY B;  2JUO A;  1MHH E;  3RNB C;  4TKN A;  2JYE A;  2IDY A;  1PQS A;  3UQB A;  2DLB A;  2BPS A;  2NBU A;  2BWE S;  1I4R A;  1TT5 B;  5BYQ A;  2K5P A;  4ANW A;  2X8X X;  4HPP A;  2LRW A;  1WJN A;  4F1S A;  1JQ4 A;  1BUI C;  2WXH A;  1GG3 A;  3OAW A;  3H6N A;  1Q0W B;  3NVZ A;  2MRP A;  2IGD A;  4MGY E;  3X0W A;  3EFU A;  2KN4 A;  3PRZ A;  5J18 A;  4XE0 A;  1VDV A;  2GRI A;  2WXO A;  2IO0 B;  1SEB D;  1V9J A;  3DOW A;  4J3O D;  2HTH A;  2KNB A;  2BYE A;  2WXQ A;  3RFZ B;  3Q3M C;  2C7M B;  1F77 A;  1VRA B;  1FNV A;  2KHW B;  2ZPN A;  4JWS C;  1ZE3 D;  4HCN B;  3R2I A;  4WWO A;  5D3I B;  3AU5 A;  2A5U A;  5G5G A;  2HD5 B;  2WXN A;  2B3A A;  2MX2 A;  2ZZP B;  1JAL A;  2RMM A;  2MJE A;  2CKH B;  4KGS A;  3SD5 A;  3T3N A;  2RSU A;  2D11 A;  1V80 A;  3QIJ A;  2MWS B;  2KVR A;  2WXM A;  1ZUD 2;  1STE A;  2LWP A;  1XCT L;  4GDL B;  3IFW B;  2K6Q A;  3NVY A;  4WH4 A;  2BYV E;  2DWQ A;  1OTR B;  2J0K A;  3Q3O C;  3L0W B;  3VDZ A;  3DBL B;  4OZC A;  3RT3 B;  3TEY A;  4I6N B;  1SE2 A;  2HDE A;  3VHT C;  1NYR A;  2LRU A;  3ZO5 B;  1UUP A;  4XWW A;  4HDQ A;  2LVP A;  3ZKJ C;  1OEY J;  3W1Y A;  5AUK A;  4FA6 A;  4H2A A;  4O1N A;  1D5X C;  2N7E A;  3NUH B;  2C5L C;  2ZNV B;  3N1Y C;  4KKI A;  3W5U B;  2JVC A;  3EA6 A;  1FPY A;  3Q69 A;  3R66 C;  2J42 A;  1YN5 A;  2G1E A;  1FIQ A;  4HK2 A;  2Z8L A;  2O2V B;  2INN E;  1WJ6 A;  2H88 B;  1JML A;  3RZW C;  3BIN A;  3TEZ A;  4P6V F;  1VR9 A;  4RM9 A;  1JWB D;  4JPS A;  5D6J B;  3NS1 A;  1TS4 A;  4GU2 A;  1V6E A;  4FAD A;  2WU2 B;  3GOE A;  4YTN B;  2V4L A;  4LK0 M;  4KX6 B;  2MJ3 A;  4AP4 C;  1B1Z A;  1B9R A;  2R2Q A;  1WR1 A;  2HJ1 A;  2L05 A;  2M56 B;  2IGG A;  2CJO A;  3NOB A;  3ZLZ A;  2KDB A;  1J0G A;  1PGB A;  3BK1 A;  1N63 A;  1V1O A;  2KJH B;  4TSS A;  1L0X B;  3L17 A;  2KQ7 A;  1C1Y B;  3IAS 1;  2CHZ A;  3AB5 A;  1K52 A;  1SE9 A;  2YVC A;  1KOT A;  3A9J A;  3CWI A;  3W1S A;  3BZD B;  4LCD E;  4GSW A;  4YSZ B;  2BBC A;  4EKU A;  5DCN A;  2WXI A;  4A90 A;  4EZJ A;  3BVZ A;  2MP2 B;  4TV3 A;  2GB1 A;  3E9S A;  4L23 A;  4M02 A;  2L7R A;  4PS7 A;  4HCP B;  2O6V A;  1QOA A;  4JQW C;  1YQB A;  4HPM B;  2MSE D;  3DBL I;  1TS2 A;  3ZXV A;  4KSK C;  3ZYY X;  2WYQ A;  1P7E A;  2QEJ C;  1K50 A;  1SE4 A;  3MTN B;  4AS1 A;  4ZRI A;  4IWO A;  4G0N B;  1FM0 D;  1MG8 A;  4KIK A;  2KVZ A;  1UZX B;  3ZXR A;  4WIP A;  2NBW B;  2A4Z A;  2CJN A;  3PS6 A;  2BGF A;  1TKY A;  4D2K A;  1K8R B;  1F9J A;  3AE3 B;  1E0Z A;  1EU4 A;  3ZJU A;  2BQQ A;  4IOI E;  4EOY A;  1JRO A;  1C76 A;  4OHJ A;  2LZ6 A;  4GB9 A;  1SIF A;  2NTT A;  4XDD A;  4KDI C;  3GS2 A;  1DOI A;  4MAC A;  4W9K A;  4A20 A;  2M19 A;  3Q3F A;  2RDH A;  1RLF A;  2LJ5 A;  5TR5 A;  2N9P C;  2GI9 A;  4RM8 A;  3P4S B;  3IAM 1;  2FCQ A;  5EE1 A;  4FUL A;  2LI5 A;  3UIP B;  1NEK B;  2DYM A;  4C4V A;  2N4F A;  2KKC A;  4M8N A;  4ARC A;  3OJ4 B;  2KYW A;  3L08 A;  4MEL A;  4ANV A;  2DAJ A;  4C7Z A;  1Y8R C;  5HKH A;  3U7D A;  2KXJ A;  1WXA A;  1F0Z A;  2JWU A;  4P1C C;  5EE9 A;  1N60 A;  2VH1 A;  1L6V A;  2FCM A;  3EEC A;  1DGJ A;  3B0A A;  2MH7 A;  3QHT A;  4W9F A;  3Q8C A;  1WZ0 A;  3KWL A;  2YEP F;  1KLU D;  3UIN B;  1CZP A;  1GNU A;  1IUE A;  1WE7 A;  3HUI A;  1HE8 A;  3AEF B;  3NY5 A;  4IG7 B;  3CST A;  3QQ8 B;  3KUC B;  1WM3 A;  2O6V B;  1WXV A;  2JT4 B;  5H92 C;  4K7W A;  4MH0 E;  4WJQ A;  4PK1 A;  2AX5 A;  1X1M A;  1YD8 U;  2M0X A;  2ZW0 A;  3AXC A;  4LNN A;  1KTK A;  3N1X C;  4EUT A;  3ZUN A;  3JSV A;  2BT6 A;  2KC2 A;  3Q14 C;  1D4B A;  3EUB 2;  4DXA B;  1J8C A;  3R7Q A;  1SGH A;  4A9A A;  4NQK E;  4JLC A;  2EMS A;  3DBH I;  5BYS A;  2LGX A;  1XF5 L;  1L4D B;  3ZRC A;  4CO7 A;  1CQV A;  2PVO D;  2AWT A;  1Y56 A;  2KT7 A;  1I35 A;  2AQ2 B;  3Q3J A;  1C78 A;  3N1Z C;  2Z0D B;  1RM6 C;  2CR5 A;  2W54 A;  1N61 A;  2XN9 C;  3N30 A;  5LXH A;  3UIO B;  2WXJ A;  3AI5 A;  5BO4 B;  2LVO A;  2C7H A;  4GDK A;  1JRU A;  3I5J C;  2M0A A;  3V61 A;  5G55 A;  1L4Z B;  3W5V B;  1QOB A;  4WJO A;  1SE3 A;  2L3Z A;  3RZF A;  5DPW A;  3V6E B;  2IO1 B;  1YJJ A;  3S2A A;  4W9J A;  2XK5 B;  3C0R B;  2O2V A;  1GC7 A;  5JXV A;  2RDB C;  1E8Y A;  1I4H A;  5GXG B;  2EMT A;  5FR6 A;  2KAJ A;  3AMZ A;  3DHI C;  4G11 A;  2IYD B;  4KVG B;  3BVM A;  2K8C A;  2KTF A;  3GE8 C;  5AUI A;  5BMH A;  4AJW A;  1Q1O A;  4AQ7 A;  2ASQ A;  1WXQ A;  1XXG A;  1I4Q A;  2WGS A;  3ZDT A;  4J6I A;  2HJ8 A;  4OVV A;  4HJG E;  1ZW7 A;  2XNA C;  3L13 A;  2N1W A;  3HM3 A;  1N5W A;  4HPL B;  1OGW A;  1E8W A;  2OJR A;  4W9E A;  4YT0 B;  3DBS A;  3T8M A;  4WQO B; 
#chains in the Genus database with same CATH homology
 1YN4 A;  2OHF A;  3R2I A;  4XWT A;  4C56 C;  1E10 A;  5D3I B;  2G9H D;  1YQ3 B;  4HEA 1;  4N6E B;  5G5G A;  1T5X D;  2WXN A;  2IJ0 A;  1VZ8 A;  3H8H A;  1ZPS A;  1JAL A;  2RMM A;  3URY A;  3AE5 B;  2MJE A;  1GB1 A;  1BML C;  4KGS A;  3T3N A;  5BMG A;  3P42 A;  4YTP B;  5HG2 A;  1VJK A;  4OZA A;  3ZGZ A;  4UDU C;  3PZ7 A;  2D5G A;  3BII D;  5HFY A;  1YJI A;  2K9X A;  2WXM A;  1SJH D;  1ZUD 2;  3NZ3 A;  1STE A;  1KRH A;  1XCT L;  3N9Y C;  4XDC A;  4GDL B;  2PVG C;  1PGA A;  1SSN A;  3NVY A;  4WH4 A;  3DWM A;  2DWQ A;  2FE8 A;  3IT6 B;  1QQR A;  1LO5 D;  4B0E A;  1ROE A;  1TKE A;  4HRS A;  4OZC A;  1PDX A;  3TEY A;  4OVZ A;  2ONQ A;  1V1P A;  3VQI A;  4C80 A;  1SE2 A;  2HDE A;  1NYR A;  2WNM A;  1UUP A;  3EGR A;  4XWW A;  1SF0 A;  4RNA A;  2H89 B;  2E6X A;  1QOF A;  3ZJV A;  4RGO S;  2L1A A;  5AUK A;  1HA5 A;  1QLB B;  4H2A A;  1SIJ A;  2WXP A;  1DOX A;  2N9K A;  1FMA D;  4O1N A;  1FO4 A;  1D5X C;  3NUH B;  5FK9 C;  3FIL B;  1ZDV A;  2I38 A;  1TZO A;  1ZXI A;  2LGI A;  4ZHO A;  2ACZ B;  4RGM A;  4KKI A;  3W5U B;  1E6E B;  1OQQ A;  2RDG A;  3AV8 A;  3EA6 A;  4LTU A;  3Q69 A;  2NMQ A;  3P4P B;  4RCO A;  1Q10 A;  2J42 A;  1YN5 A;  1C4P A;  2G1E A;  1FIQ A;  2BYT A;  3FAH A;  1N62 A;  2WXF A;  2Z8L A;  1L0Y B;  1RYJ A;  4IDI A;  2J52 A;  3P4Q B;  2BB6 A;  5HI1 A;  1XEE A;  2INN E;  2H88 B;  1JML A;  2OED A;  2LHE A;  4MM3 B;  3U7Z A;  3TEZ A;  4P6V F;  3B2G A;  5BYR A;  1VR9 A;  1YN3 A;  1JWB D;  2WXR A;  4JPS A;  3KQ4 A;  2TSS A;  3NS1 A;  1TS4 A;  2Y5C A;  2WU2 B;  1I4G A;  3AE9 B;  4YTN B;  3DWG C;  3HRD D;  5BMI A;  1EWY C;  2LFI A;  4LK0 M;  4KX6 B;  1YQ4 B;  4RF0 A;  1E9M A;  5TSS A;  2MJ3 A;  2B76 B;  1B1Z A;  2JU6 X;  1B9R A;  1V97 A;  4OZB A;  4MT5 A;  2E3T A;  1XLP A;  2M56 B;  4RFB A;  2IGG A;  2CJO A;  4P16 A;  1J7B A;  3ETR A;  1PGB A;  1JWA D;  3BK1 A;  1N63 A;  2KWD A;  1V1O A;  3P1M A;  3AE2 B;  4IKG A;  4TSS A;  3TEX A;  1L0X B;  3MC0 B;  1TS3 A;  2N7J A;  1D6E C;  3IAS 1;  1JWM D;  1TY0 A;  3AB5 A;  1MI0 A;  1K52 A;  3AEB B;  2SAK A;  4US8 A;  2BS2 B;  1AYF A;  3CWI A;  1FFU A;  5LNK 1;  3W1S A;  3BZD B;  1F2R C;  3TUO A;  4GLS C;  4OW0 A;  5FKA C;  1MPE A;  1A70 A;  4YSZ B;  2BBC A;  2JXT A;  3AEC B;  2PTL A;  1K53 A;  3KWV A;  4KGR A;  2WXI A;  1I7H A;  5MPO A;  4A90 A;  3BVZ A;  4WWM A;  1VLB A;  1RWS A;  2GB1 A;  4KKJ A;  5HHD G;  3E9S A;  4L23 A;  3U4E G;  2QJL A;  1GPX A;  1YNT E;  5I4D A;  2JYT A;  1ESF A;  2R61 A;  3BVG A;  5T8I A;  1QOA A;  1FEH A;  3SEB A;  4TMA B;  2LHD A;  2BW2 A;  1MVK A;  1TS2 A;  5E6J A;  1EU3 A;  1UWM A;  4TQ0 A;  2BS4 B;  2PW9 A;  2KQ4 X;  5G5H A;  3ZYY X;  1P7E A;  1I4P A;  3BWU D;  4HKZ E;  4GDK B;  4HRO A;  2QEJ C;  1R7S A;  1QOG A;  1K50 A;  1SE4 A;  2L32 A;  4AS1 A;  2IPK D;  1FM0 D;  1K51 A;  2WU5 B;  1HEZ E;  1FRR A;  4N59 A;  1KFY B;  2WDV B;  4WIP A;  1EWC A;  1SB3 C;  2EKI A;  2SEB D;  4NJC A;  5D3D A;  3AEG B;  1L6U A;  3AE4 B;  2CJN A;  1IBX A;  4JX1 C;  2WS3 B;  1FXI A;  1TKY A;  3HVZ A;  4D2K A;  1PUT A;  1ZXH A;  2LUM A;  2W55 A;  1TYG B;  3J9C A;  4A8X C;  4YXD B;  3AE3 B;  2IGH A;  1QF6 A;  1D5M C;  4DXG A;  2WP9 B;  1E0Z A;  2DYO A;  1EU4 A;  1HZ6 A;  1EM7 A;  1P7F A;  1ACC A;  1ET6 A;  4USA A;  3ZJU A;  1FD6 A;  2N9L A;  4IOI E;  1JRO A;  1C76 A;  1TS5 A;  1KH0 A;  1ZP0 B;  1WYG A;  2DBY A;  4OHJ A;  1AW7 A;  3KLS X;  3GP7 A;  1JRP A;  1J7C A;  1XLN A;  1SXT A;  1C4A A;  2NTT A;  4XDD A;  3GS2 A;  3MP9 A;  3NVV A;  1DOI A;  1PGX A;  4MAC A;  1T6B X;  3MJ5 A;  1JCK B;  2K22 A;  2M19 A;  4NAW B;  2RDH A;  3AN1 A;  1CK1 A;  2WDQ B;  5C3J B;  2WXL A;  3AEE B;  1QIL A;  1AWD A;  1JW9 D;  2GI9 A;  3ZJT A;  1NEN B;  3P4S B;  1FRD A;  3IAM 1;  2INP E;  3PZ8 A;  1JWS D;  3VR8 B;  3U52 E;  5EE1 A;  1NYQ A;  1XO3 A;  3VRB B;  2MEK A;  2ICI A;  4JWU C;  1ET9 A;  3OWE B;  2NTS A;  1NEK B;  2JX5 A;  2RPV A;  3NVW A;  5H8Y E;  1FXA A;  2DYM A;  4ZHP A;  1GB4 A;  3FC4 A;  4ARC A;  2LMC A;  1FCC C;  4R3D A;  1C79 A;  3ABV B;  1NVI D;  1NI3 A;  4YWG G;  1E7P B;  2EEL A;  4C7Z A;  4WAF A;  3O13 A;  1UNS A;  2WXK A;  4FXC A;  5C2T B;  1FFV A;  3I57 A;  2V3N A;  1F0Z A;  2LEK A;  3B9J A;  2JWU A;  5EE9 A;  1FNU A;  1N60 A;  1L6V A;  3FIL A;  2BS3 B;  1HQR D;  1KLG D;  3E56 A;  4WQM A;  1DGJ A;  2I2Y A;  1PFD A;  4KGT A;  3SFD B;  2MH7 A;  3AE1 B;  1L0V B;  3Q8C A;  1FNW A;  2FBW B;  3KWL A;  1QKZ A;  2YEP F;  1KLU D;  3RPF C;  1CZP A;  1GAQ B;  3Q8F A;  4ARI A;  1TKG A;  3AEA B;  2V0G A;  1IUE A;  2JSV X;  4ZRP A;  3HUI A;  3AEF B;  2WDR B;  3LYY A;  2K0P A;  4L2Y A;  4YTM B;  4TQ1 A;  3Q8B A;  2BB5 A;  2QMT A;  1AN8 A;  1HZ5 A;  2AQ1 B;  1V1P B;  4RH6 A;  4N58 A;  3T3O A;  2W3R A;  5H92 C;  3BK2 A;  5EE3 A;  2V3P A;  3V3X A;  1TJE A;  3R8B A;  2AX5 A;  2ZW0 A;  4DXF A;  1KTK A;  3V05 A;  3C8Y A;  5FR3 A;  2ON8 A;  2VZK D;  2X38 A;  3LXF A;  1C77 A;  2PLP A;  1CJE A;  2J4X A;  4YSX B;  1WWT A;  4CQN A;  2BT6 A;  4WUR A;  1D4B A;  1L5P A;  1V8C A;  2KDM A;  3EUB 2;  4PT5 A;  3P63 A;  1D5Z C;  4ZYS A;  2Y3A A;  4A9A A;  3BYY B;  2MJD A;  4JE3 B;  1PYW D;  4ITK A;  5BYS A;  2J53 A;  2PMV A;  2Q5W D;  3AE6 B;  3AED B;  1DOY A;  2JQR B;  1XF5 L;  1L4D B;  5EE0 A;  1FCL A;  1YMH E;  2W3S A;  3NRZ A;  4MH8 A;  1CQV A;  1UGJ A;  3Q8E A;  2PVO D;  2WXG A;  1SJE D;  3IXS A;  1WGK A;  3VRA B;  2CU3 A;  1TY2 A;  4A6Q A;  1MHX A;  2BTE A;  1IBX B;  3W9C B;  4RGT A;  4Q2J A;  3W2D A;  1Y56 A;  4L1B A;  1UWX A;  3UI3 A;  2KAC A;  2AQ2 B;  3I9V 1;  1C78 A;  3TSS A;  1XLQ A;  1JWU D;  1SBB B;  1OQR A;  3B2F A;  1RM6 C;  2WQY B;  3AE8 B;  4RGN A;  2W54 A;  1N61 A;  1VZ6 A;  2XN9 C;  4M0W A;  3SFE B;  3AE7 B;  3ZQ4 A;  3BYT B;  1ENF A;  1RFK A;  2QIE B;  1XCQ L;  2WXJ A;  2PIA A;  2ZW1 A;  3Q8A A;  3LB8 C;  4US9 A;  1ZOY B;  1C4C A;  2QIL A;  3IT4 B;  2M0A A;  1MHH E;  1QT9 A;  5D7G A;  1VZ7 A;  1I4X A;  1L4Z B;  2IDY A;  1QOB A;  2JYE A;  3R2T A;  4LLG M;  2DLB A;  3W5V B;  2KMM A;  4A55 A;  1DYQ A;  1I4R A;  2JZP A;  1ZDX A;  2PKO A;  1HXY D;  1SE3 A;  2FUG 1;  5BYQ A;  1YJJ A;  2K5P A;  1XLO A;  3VR9 B;  2HTM E;  4B0M A;  1F2R I;  3P4R B;  5JXV A;  4EE2 A;  1JQ4 A;  2W82 A;  1BUI C;  1I4H A;  1T3Q A;  5GXG B;  2WXH A;  4NZL B;  1BXT A;  1IGC A;  3MFG A;  2KAJ A;  1J7A A;  3AMZ A;  1C9F A;  2AQ3 B;  3BVM A;  4DQO C;  1WSP A;  3AH7 A;  3TEW A;  3WCQ A;  2L52 A;  1KF6 B;  5AUI A;  3AM9 A;  5BMH A;  4NAM A;  2V4I B;  3NVZ A;  1IGD A;  2IGD A;  4ZOH C;  2QSD A;  4C7Y A;  4AQ7 A;  4YSY B;  2N0S B;  1WXQ A;  2Y5P A;  3MHZ A;  4REZ A;  1XXG A;  2KN4 A;  4HKQ A;  2K3U A;  2LJI A;  1VDV A;  2GRI A;  2L83 A;  1I4Q A;  2WXO A;  2YEP B;  4XE0 A;  1WRI A;  4ZRQ A;  3CIR B;  3U2S C;  1N5X A;  1SEB D;  2WLB A;  3SR6 A;  4HJG E;  4J3O D;  3PO0 A;  2XNA C;  1OFF A;  2WXQ A;  3GB1 A;  3HVD A;  1N5W A;  3RFZ B;  1GOZ A;  1M4V A;  4RF1 A;  1F77 A;  1VRA B;  1FNV A;  3L4P A;  4JWS C;  4YT0 B;  1ZE3 D;  2VZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...