3AE1B

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae1B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae1B01
5EE0A 3FAHA 2LEKA 1TYGB 1J7CA 4YTNB 1AWDA 1FRRA 3AM9A 1ZOYB 2Y5CA 1H7XA 1DGJA 1FIQA 2WDQB 2BT6A 2WS3B 1ZUD2 1RYJA 1VDVA 3AE5B 3CWIA 3DWMA 2H89B 1J7AA 4USAA 1QT9A 2MJ3A 4FXCA 1WGKA 1JALA 5EE3A 2WU5B 1N63A 3SR6A 1DOYA 3AE2B 3AE4B 3AH7A 3PO0A 3AECB 1OFFA 1JWAD 3NVVA 5GXGB 3W5UB 1E10A 2M19A 3AE7B 3AB5A 3AEEB 3W9CB 2WQYB 1V97A 1RFKA 1FXAA 2DWQA 2E3TA 1F0ZA 1NI3A 2CJOA 1N5WA 2QJLA 4ITKA 1JRPA 2K5PA 1JROA 1NYQA 1L6UA 1B9RA 1OQQA 1PUTA 3BIID 2BS2B 2H88B 3NVWA 3CIRB 2W3SA 1DOXA 2JQRB 1GTEA 3ETRA 2WP9B 2MJEA 2PVOD 4HRSA 3SFEB 2B76B 2HTME 4US9A 4HROA 4JX1C 2CJNA 1PFDA 1TKGA 4IDIA 2EKIA 4C80A 1L6VA 4YTMB 2WDVB 1KRHA 1J7BA 2G1EA 1FFVA 4ZHOA 2K9XA 1EWYC 1RWSA 1WRIA 3B2FA 1WXQA 1A70A 4WQMA 3ABVB 4JWUC 4JWSC 5EE9A 4A9AA 3VRAB 2FBWB 1FM0D 1NVID 3HUIA 2AX5A 2WLBA 2ACZB 3P63A 3VR8B 4YT0B 3AE3B 1PDXA 1KFYB 2PIAA 2W3RA 5MPOA 1QOAA 1SF0A 1QOFA 4LTUA 1RM6C 4P6VF 2CU3A 4KX6B 1FRDA 1QOGA 1CJEA 1FFUA 3AEAB 3LB8C 3P4PB 3AEGB 3WCQA 3AE1B 4YXDB 2BS3B 1IUEA 1VJKA 5EE1A 3LXFA 1NENB 4N6EB 3B9JA 1OQRA 2JX5A 1E7PB 2DBYA 1FXIA 1FMAD 3AV8A 3FC4A 3NRZA 4C7YA 1XLOA 1TKYA 1T3QA 3P1MA 1E0ZA 3B2GA 1TKEA 1WYGA 1SIJA 2M56B 3EUB2 3HRDD 2KAJA 2K22A 1ROEA 2Q5WD 2QIEB 3AN1A 3AE8B 1UWMA 3HVZA 4YSXB 3CF4A 3DWGC 1YQ3B 1GTHA 3VRBB 1GAQB 3AMZA 3NS1A 3RPFC 1GPXA 3AEBB 1CZPA 2MJDA 2WU2B 2L83A 3P4SB 1JW9D 1KF6B 2L52A 1DOIA 1ZXIA 5AUIA 1YQ4B 1YJIA 3AEDB 4ZHPA 3SFDB 2PKOA 1FO4A 1NYRA 1JQ4A 4N59A 1XLQA 1XLNA 2KMMA 3L4PA 3NVYA 5G5GA 5H92C 5C3JB 2W55A 3P4QB 3VR9B 1ZP0B 4YSYB 1QF6A 2WDRB 3W5VB 1TJEA 4N58A 1E6EB 5AUKA 1E9MA 3NVZA 1N62A 4US8A 2W54A 5H8YE 4C7ZA 1L0VB 2PVGC 3AE9B 1VLBA 1I7HA 3KWLA 1N61A 1NEKB 1QLBB 4WWMA 1H7WA 5G5HA 2OHFA 1SB3C 1R7SA 3AEFB 1GT8A 1N60A 1L5PA 1YJJA 4ZOHC 5C2TB 3ZYYX 1WWTA 4YSZB 2MH7A 1JWBD 1QOBA 1XLPA 1AYFA 3P4RB 3AE6B 1N5XA 2N0SB 4YTPB 1XO3A 1V8CA 2BS4B
chains in the Genus database with same CATH superfamily
2JZZA 2ZVOA 3HVDA 1DGJA 4MSQB 1VZ8A 1ET6A 1QT9A 4XDDA 5EE3A 1OFFA 4TUUA 2DZJA 3DDCB 2MW5A 3AULA 3J9CA 1F9JA 3NS8A 1MJDA 1WSPA 3ETRA 4LJOB 2M1MA 3HHMA 2X38A 1L6VA 2WXKA 3UQAA 1WJ6A 3I5JC 1WRIA 3HK0A 4URKA 3UINB 1KFYB 1ZPSA 3R3MA 1QKZA 2LGYA 2HE7A 3MC0B 2JWZA 4FHKA 3LYYA 4ANVA 3NRZA 2FUHB 5TR5A 1SJHD 3TUOA 3WANA 3L17A 4WJNA 1A5RA 2QIEB 5IA7A 3AE8B 3NS1A 5DPTA 3MHZA 2AWTA 3NY5A 4G50A 4FA6A 1E7UA 1Q1OA 4ANWA 4UDUC 1YN5A 3EFUA 3OJ4B 4YSYB 1E6EB 4KIKA 2LWPA 5DPRA 4GGQA 1L0VB 4FULA 4KKIA 3H7PA 1UF0A 5C2TB 3N32A 1OEYJ 1VCBA 2N7EA 3P4RB 2N7JA 4RM9A 2HDEA 1P7EA 3GE8C 3BVMA 3C19A 4YL8A 3Q2AC 3NHEB 1WRDB 2ZW0A 1UD7A 3TEZA 1J7AA 4D2KA 2JY6A 2V9HA 3AE4B 1YNTE 2IY1B 1FXAA 2M0AA 1B1ZA 2YEPB 2CHXA 1OQQA 4BOSC 3IT4B 2H88B 2JRHA 1E8ZA 2FUG1 2MJEA 3MFGA 2YLMA 1I4XA 3RMKC 4YTMB 2G3QB 4CO7A 3E56A 2IGDA 5FK9C 4MDKE 5G2NA 4BOZB 1P98A 4MACA 2W3RA 1YIWA 4LTUA 3V6CB 1XEEA 2WXGA 2RPVA 1K53A 1AW7A 4MH8A 4MT5A 2GBKA 3PRPB 3ZDMC 3RI7C 3T9LA 3HM3A 4QAYA 1BT0A 3ZO5B 1YQ3B 1WM2A 1E8YA 5IP4D 3P4SB 4EZKA 1YQ4B 4HPMB 1WFYA 2PKOA 3L13A 3L4PA 1P7FA 1TY2A 5H92C 4IWOA 2J7QB 4KIKB 4RFBA 4EEWA 1KLUD 1P1AA 1N62A 4B0MA 2NR2A 3H7PB 2D3CA 4E74A 4CQNA 2CHWA 2DYBA 2D2QA 2IO3B 1PGAA 1VZ7A 4FLHA 4YTPB 1LGRA 2WXOA 2LI5A 3WA0A 2EMSA 1FIQA 1Z5SB 2BT6A 3IBEA 1FNWA 4TKNA 2KQSA 4W9IA 4A55A 1RRBA 1WX8A 1WF9A 4HKZE 3ZUNA 2WDTB 2WQYB 4PYUA 5E6JA 1L2NA 2FAZA 4PYZA 3OG5A 2QEJC 2KDIA 2K6DB 5CX3A 2L00B 2GMIC 2BW2A 3N1YC 1KRHA 5C23A 4JWUC 3V62A 4A90A 2QSDA 2KDFB 2LUMA 4PS7A 2KMAA 3GOEA 4LNNA 4OHJA 1QOFA 3N1ZC 1IBXB 1TT5B 5KHQA 1V9JA 5EE1A 3B9JA 1OQRA 2LJIA 1FXIA 2AYOB 2KJHB 2WXLA 3ECIA 4GLSC 2K22A 2Q5WD 3Q6BA 3RULA 2WXMA 1P9DU 1DOIA 4HLEA 3UGBB 4ICUA 3ML9A 2C7HA 2KMMA 1GUAB 2W55A 1LM8B 3W5VB 3PT2B 1Z2MA 2Y5PA 2PW9A 4US8A 1WE7A 1Q0WB 5IAAC 1EWCA 3WAPA 1I7HA 2XBBC 3RFZB 1F52A 1ESFA 2LZ6A 1AYFA 3NUHB 1R4MB 3M62B 2DHZA 1ZOYB 1YQBA 2PE6B 3DWMA 1MHHE 4CYEA 1STEA 2RDBC 1JALA 1N63A 1QZEA 4W9KA 3BVZA 4J3OD 1YMHE 4KDLB 1EU3A 3W5UB 3AEEB 2DWQA 2JSVX 4RGNA 4XZ4A 1IGDA 5AZGA 3NVWA 4OZAA 2KACA 4AS1A 3A1QA 1WY8A 3CF6E 1C77A 1I4QA 1EWYC 2MWSB 3PVLA 2W82A 2N9EB 1HTQA 4RGTA 1V5OA 3IXSA 4EE2A 2KTRA 2C5LC 3B0AA 1X1MA 2WXIA 2BWFA 5J2RA 4HVBA 1GOZA 2JT4B 2KD0A 3N30A 1XD3B 3IAS1 2SAKA 2QILA 4P1CC 4ZRQA 4DHZB 1T3QA 2Y5BB 1E0ZA 3B2GA 3U52E 4RCOA 2WU2B 2XNAC 4JGHB 5AUIA 1EUVB 4ZHPA 3Q3FA 3QA8A 4HPPA 3L16A 4KKJA 1T0QC 2KMCA 2FCMA 2WXHA 2FCNA 4EZJA 2NBVB 3BK2A 2PVGC 3GZNI 3KWLA 2N9XA 1S1QB 3PREA 5D7GA 2L76A 2OHFA 3DVNU 3PRZA 2R2QA 2MBHA 2ON8A 2J0MA 2WX0A 2LGSA 3LDZE 3UQBA 4XWWA 1RYJA 1VDVA 3C0RB 4OVUA 3RNCC 2FIDA 3ZNGC 4IC7B 5EDSA 2G4DB 1ISNA 3A9JA 2LASA 1SE2A 2VRRB 1T5XD 4EFOA 3BIID 3N9YC 3A1QB 2JQRB 1OQYA 2WNMA 2UWQA 3RNEC 3MJ5A 1ZDVA 2G1EA 4AQ7A 4MGKE 4FJZA 3SDLC 1RWSA 3UIOB 2EELA 1TGZB 5EE9A 4MGYE 3VRAB 2FBWB 1VRAB 2KTRB 4ANUA 3WIMA 4NZLB 1PDXA 1HE8A 2N9PC 4A3OA 1QOAA 3APCA 4KV2A 1RM6C 4KDIC 3ZQ4A 3AE1B 4KSKC 2IYDB 3M63B 3E9SA 4HK2A 1C76A 2NTTA 1FMAD 2J0KA 4HEA1 4BZAA 3T8MA 3P1MA 1M4VA 1WYGA 3DPDA 3BYYB 1YJ1A 2ICIA 3LJ3A 4W9FA 5BMIA 4ARIA 1EF5A 2RSUA 4KGRA 2NBUA 1JQ4A 3KW5B 4M01A 2J0JA 1Q5WB 5AEKB 4WH4A 4WJPA 2FIFA 2PEAA 3SU8X 1ZXHA 4BBNC 1NEKB 2K6QA 1E90A 1WZ0A 4II3B 3MTNB 3MJWA 4W9CA 4TQ0A 1SXTA 1WXSA 4DBGA 4B95A 3Q8EA 3I63C 1ZUD2 4XGAB 3CWIA 5KHOA 2ZNVC 3SD5A 3AE2B 5GXGB 4MJSA 3BZDB 1E10A 3A9JB 3HM6X 5C1ZA 3NOBA 3DBRB 2MBQA 1AN8A 4BVUC 3IAM1 2PVOD 2CJNA 4WAFA 1L0XB 2WDVB 5GMVA 4BKTA 3UF8A 3DBLI 4WQMA 4FADA 3TSSA 2JRIB 4B9KA 3R7QA 1ZDXA 2KN4A 4A20A 4M00A 4OZBA 4GSWA 2M0XA 1P3QU 1WGHA 3ALBA 4PS3A 4XX5A 1CJEA 4LNFA 3AEAB 3I9V1 4WQOB 1YD8U 1FPYA 3ZLZA 2BPSA 2MEKA 2LVQA 4AUQC 1SIJA 5D3IB 4RMAA 2CR5A 3DWGC 3UIPB 3M95A 3TJPA 2LMCA 4R3DA 4TMAB 5D2MB 1JW9D 1KF6B 4O1NA 2QCZA 3RNGC 4WJQA 1UH6A 1XLNA 5G5GA 2KVRA 3R7RA 1LXDA 5C3JB 3OLMD 5IOIA 1SE9A 5LNK1 2WDRB 5DPWA 4HCPB 2JZPA 3NVZA 2BKFA 3WAOA 3KUDB 1I4GA 1N61A 4WWMA 2O6VD 1KLVA 1R7SA 4ZYSA 2AQ3B 2IBIB 2J4XA 1KH0A 2NVUI 1XO3A 4G11A 4TSSA 5HG2A 4NJ6A 2PJHA 1ACCA 2MQJA 1F2RI 3CSTA 4W9EA 4MJSB 2REXA 2WU5B 3PZDA 3QX1A 3IFWB 2CS4A 2M19A 3ZNZB 1ZGUB 4WWOA 4PT5A 2K25A 2WXFA 1SE3A 3O13A 4ZRKA 2E6XA 1L4ZB 1V80A 2IY0B 4M8NA 1Y8RC 2EKIA 4NQLB 3B1LX 1WXQA 1C1YB 3ZRCA 2OJWA 4A9AA 1E7VA 2LGXA 2ACZB 4IUMB 3MP9A 1T0YA 3U7DA 2LHEA 4P16A 2J52A 2DLBA 2JPHA 4YXDB 2DYOA 1OGWA 4HDQA 1JWUD 3DBRI 1UNSA 5BMGA 1V49A 1KLGD 1F77A 5FR3A 2G4SA 2KQ7A 3RYTA 4FBJB 1G6JA 4HCNB 3EUB2 2BBCA 4C7ZA 2LHDA 4MGIE 1UGMA 4YSXB 3CF4A 3RPFC 2NTSA 3QARA 3Q8FA 4IW0A 4AJYB 4Q2JA 1FO4A 3M3JA 4OW0A 4B6WA 4N59A 4DXFA 4LJPB 4JPSA 4IM2A 1IBXA 3PPAA 1I4RA 5DPSA 2L0TA 3R2TA 1WR1A 2EKEC 2RD0A 1VLBA 2QMTA 1UWXA 4RGOS 3VTVA 4F8CB 2CU1A 1F2RC 2BYFA 1CK1A 1N5XA 2KWUB 1J0GA 1XCTL 2LEKA 1BUIC 3ZIMA 3DVNV 4JL9A 3PLVA 2ZCBA 3PLUA 4RNAA 2LFIA 2WX1A 1VR9A 1WGKA 3EC8A 2V1YA 4GIVA 3DBHI 3AECB 4I6LB 4ZRIA 4JQWC 2MRPA 3RD2A 2K3UA 1WGGA 2K5PA 2QC8A 3V3XA 1L6UA 1PUTA 2KZRA 2N4FA 3N20C 3SFEB 4JX1C 4IDIA 4C80A 2Z0EB 1WIAA 5BYQA 1SGHA 1QILA 1WXAA 2ASQA 5JZEB 1S3SG 2I2YA 4L23A 3VXWA 1D4BA 5D6JB 3DVGY 3CSFA 4GDKA 1BXTA 4P1BC 4II2B 1F1HA 1VD2A 4REZA 3AEGB 4IWPA 2FCQA 3PGEA 4MH0E 1E7PB 3SEBA 2BWES 1TS3A 2IJ0A 1TTNA 4C00A 4XWTA 3OWEB 4DQOC 2O6VA 3KYCD 2KAJA 4JLCA 4OVVA 4LDTB 1KTKA 1NDDA 2DZKA 2WXQA 2QHOA 4WIPA 3Q3OC 2PTLA 2R61A 4BKSD 1MFWA 3GZNB 1YOVB 2A5UA 1KJTA 5IN7A 3T3NA 2I1KA 3QJZA 2WHIA 2W54A 4I6NB 1IPGA 1D5MC 3VVWB 1WGRA 2MBOA 2V4LA 3ZVVA 1XT9B 3TEWA 1QQRA 4OZCA 4F1SA 5I4DA 1Q10A 5LXIB 2DYMA 4DWFA 1WR6E 1SJED 1LO5D 1HXYD 1ZXIA 3ONSA 1V8CA 1AWDA 3AM9A 4K3BA 1V1PA 4F7ZA 2Z8LA 3QIJA 1GC6A 2MP2A 2BTEA 3ZJVA 4W9JA 3IT6B 3H7SA 2IO1B 1GJZA 1NBFC 2ZNVB 3W9CB 1V97A 1F0ZA 3QQ8B 4IG7B 4ITKA 4H2AA 2XN9C 1J19A 4A3PA 3JSVA 1GG3A 4C4VA 2D3AA 2W3SA 1DOXA 1PYWD 1TS2A 1TKGA 2BF8B 2IPKD 1J7BA 3TEYA 4AP4C 3ABVB 4DDID 3A9KA 1C4CA 4NJCA 4GDKB 2ZVNA 2C60A 3DHIC 2KHWB 2K0PA 1J8CA 2FCSA 2JU6X 1PGXA 4L1BA 3PZ8A 1H8CA 4N9F4 3B08A 1WGYA 2O6VB 1XLOA 5E6NA 4B0EA 2JWUA 5HKHA 2D5GA 2LUEA 2AEHA 2MSED 4LK0M 1GAQB 1GPXA 5JXVA 2KLGA 3TEXA 5L83A 3RCZA 1V81A 4K3CA 3SFDB 2GRIA 1C4AA 4GDLA 2KKCA 2K1FA 1QF6A 3HIZA 4N58A 3L08A 2LGIA 5AUKA 2C7MB 2L8JA 2KDMA 2KJ6A 2DAFA 3ZNID 3AE9B 2NCNA 5IO9A 4E71A 4RGMA 2AQ1B 1N60A 1YJJA 2KDBA 1XF5L 2HJ8A 1QOBA 3W1SC 4XC2A 4BFRA 3NVYA 1V1OA 4NPNA 1V1PB 1UBQA 1WGDA 2LGDA 4NNJB 3X0WA 1H7XA 3RNAC 2MP2B 2RGFA 3O65B 2YEPF 2MJ3A 2JVCA 5BMHA 4GB9A 2OOBB 1SSNA 2D3BA 5LXHA 3JSVB 2IO2B 1UBIA 1UUPA 4C4VB 1NYQA 2EMTA 1B9RA 3SHQA 2BS2B 3QWZB 3DBLB 2BGFA 2BYTA 4ACFA 2I38A 3K9PB 5CHFA 5AZHA 5CTRC 1EM7A 3I3TB 3A9KB 2NS5A 3DHHC 4FHJA 2GBJA 1FM0D 4RF0A 1MI0A 4W9LA 4WURA 3ZJUA 3VR8B 1TS5A 2AL3A 4BKSA 4FJYA 2LD9A 3CMMB 4KSLC 3UI3A 4LNIA 2MLBA 1HZ5A 1WZ3A 4C56C 1E8XA 3JYUA 3FC4A 5D94A 2K8CA 3TL5A 1OTRB 2GLSA 3Q3NC 3NZ3A 1WX9A 3GE3C 1ET9A 3AMZA 2I1JA 3AEBB 4PK1A 3KH0A 2D3GA 4GDLB 2KX0A 2RDGA 2INDC 2N9KA 3A4RA 2PE9A 3ENEA 1I4PA 1M94A 3P4QB 2LRUA 4IM3A 1ZE3D 3ZDTA 1U4AA 1TBEA 2CKHB 2GOWA 4IWQA 1WI0A 3ZTCA 2J53A 4MGZE 1CMXB 4HJKA 2UU7A 1SBBB 1H4RA 4K7SA 3AEFB 3VTUA 1GB4A 5HFYA 2ONQA 2MH7A 1JWBD 1SEBD 5T8IA 2N0SB 1V86A 4GMVA 4ZRPA 3VDZA 2KLCA 1J7CA 2Y5CA 1JCKB 1OEYA 1KOTA 4KGTA 2SEBD 3KWVA 3Q3MC 3Q69A 3R8BA 2LXCA 3R66C 4BKGA 2KQ4X 4EKUA 1AARA 1D3ZA 2AL6A 2JXTA 1MG8A 4OVZA 4ARCA 3VHTC 2KO3A 4MSMB 2ZCCA 1UZXB 3CIRB 2KNBA 3DBSA 4FJVB 2WP9B 3QHTA 4US9A 2ZEQA 1PFDA 2NPTA 2K9XA 2INNE 3L10B 4WWPA 4K7WA 1HZ6A 5BYRA 2N9LA 2ZW1A 1E5WA 2WLBA 1R4NI 3FKYA 3P63A 3AE3B 2PIAA 1LFDA 1FNVA 3JW0X 4AOFA 1FRDA 3LB8C 1WJNA 3BK1A 1NENB 1HEZE 2WXRA 5DCNA 4NAMA 2Z0DB 1KM7A 2CHZA 1WJ4A 2KTFA 4HJGE 3TCAA 1K51A 3RZFA 1PQSA 2L1AA 4L2YA 1JRUA 4ZYNA 4YWGG 3Q8BA 1XLQA 2MBBB 4RF1A 5J18A 4HXDA 1V2YA 4ZRJA 2FNJB 2HJ1A 4KGSA 2JYTA 5J17A 3NZSA 1CQVA 3DOWA 3GP7A 3KVFB 1IYFA 3L54A 4I6PA 3TBLD 3S2AA 2BYVE 3U30A 1TYGB 1XCQL 4YTNB 1RAXA 3DBHB 1BMLC 3PHWB 1WXVA 3ZJTA 3W1SA 3V60A 1IP9A 1C9FA 2INPE 4W9HA 4KVGB 3AH7A 2ZPYA 2L3ZA 1MHXA 1NI3A 2JF5A 5TSSA 1WH3A 3OJ3A 3EECA 3V61A 2B76B 2HTME 2NPTB 5E6OA 1L0YB 4DDGD 3QK0A 4ZHOA 3EA6A 3KUCB 2KVZA 2BYEA 2V3NA 1NVID 2AX5A 1XXGA 5BO4B 3N1XC 5MPOA 1IGCA 2G45B 4S17A 3GS2A 3AI5A 1WJUA 1D5XC 3P4PB 2WWZA 2JYEA 2BS3B 3LXFA 4N6EB 2JX5A 3JVZX 2IO0B 3KQ4A 3AV8A 2GBRA 4XYCA 2XEWA 3HRDD 3ZGZA 1WM3A 2DENB 2KXJA 2OJRA 3BINA 5LLIA 3AEDB 1MG4A 1NYRA 2BVCA 3VR9B 3PTFC 5FR6A 1I35A 2M17A 1E9MA 1Y56A 1HA5A 3RUIB 4JIOU 2RDHA 4KZ0A 2ZZPB 5G5HA 1H7WA 1TZ1A 3URYA 1SB3C 1JMLA 2LVPA 2XK5A 1L5PA 2VZKD 1UGJA 4XE0A 2KYWA 3IHPC 3AE6B 1HTOA 3U2SC 5EE0A 3DHGC 1ZW7A 2PLPA 3WAMA 3AE5B 2K8HA 2RR9A 2HTHA 3KUZA 1GB1A 3T3OA 5D3DA 4RH6A 2O2VA 1WMHA 3AU5A 2NMQA 2AQ2B 3C8YA 2MCNB 2C7NB 3ZKJC 4HRSA 3Q8CA 4CHKA 1FCLA 1JWSD 3MC8A 2V3PA 1FFVA 3PS6A 4GN1A 3VAWA 1A70A 4A6QA 4JWSC 4DHZE 2V0GA 4DHJD 1L7YA 3PV1A 3QC8B 2KFKA 1TS4A 2NBWB 1TZOA 1V6EA 3GB1A 1VJKA 4NY0A 5CHVC 4BAXA 3RT3B 3TMPB 3V05A 2X8XX 2BKRB 1FNUA 3HVZA 1T0RC 3VRBB 1JWMD 4HPLB 2N1VA 2MJDA 1GC7A 2HD5B 1SIFA 1EO6A 1XQQA 2ZPNA 2A4ZA 3ML8A 5H8YE 2V3SA 2XK5B 1WYWB 2KJRA 4WAAA 2DZMA 2KC1A 3NG0A 2D11A 4YSZB 1XLPA 2KC2A 2N7DA 3Q3JA 1RLFA 3D32A 2C9WB 1FRRA 2KX3A 2MA9B 2WS3B 2O2VB 4FXCA 1WMHB 2INCC 2GI9A 1ENFA 1TY0A 3PO0A 3VH3B 1JWAD 2MHJA 3NVVA 3AE7B 3AB5A 2L7RA 1I4HA 1RFKA 2E3TA 2MX2A 4S0RA 1N5WA 4J6IA 1JRPA 2G9HD 1GTEA 4LLGM 2VH1A 1FCCC 1I42A 2VH2A 1FEHA 4XDCA 4EOYA 2M4NA 5IKCM 3DQVA 5L95C 4M0WA 5HI1A 2ZJDA 4DXGA 2KFKB 1P0RA 3ZRFA 3H6NA 4AWJA 3VFKA 4P6VF 4LNOA 3DCGA 2PPHA 1DYQA 3RZWC 1TIFA 2K8BA 2IDYA 2DBYA 1YX6B 2LJ5A 4TQ1A 3V6EB 3KYDD 2N1WA 3MHSD 1K50A 2R2OA 1ROEA 1VZ6A 3AN1A 1D5ZC 3EGRA 3PRMB 2WXJA 1CZPA 4JE3B 2L0FA 2D10A 1T6BX 1MVKA 1N6ZA 3RNFC 3IG3A 2K39A 4LNKA 4RM8A 1ZP0B 2WYQA 2DNFA 3NJTA 4EZLA 3P2BA 1PGBA 3ZNHB 2LXAA 2RMMA 1C78A 4KZCA 1QLBB 3VQIA 2BB5A 3ZYYX 1WE6A 1WWTA 2DAJA 2M8SA 4DXAB 2IGGA 2IGHA 3U4EG 3U8ZA 1MPEA 1C4PA 2L05A 2WDQB 3H9DA 3BYTB 3I57A 4K1RB 2H89B 3Q14C 2V4IB 1DOYA 4G3XB 4HDOA 4AJWA 4MM3A 2CJOA 4DK5A 4IKGA 3R2IA 1JROA 4NAWA 5G55A 3APFA 4NJ7A 3W1YA 3NZUA 2YVCA 3QAQA 1GNUA 3VH4B 3IVFA 3U7ZA 3AXCA 2J42A 1R4NB 4MELA 4E3CA 3B2FA 4M0WB 4K81A 3HUIA 3K9OB 4NQKE 4IM0A 3PSEB 4MEMA 2B3AA 4P7IA 3PHXB 1QOGA 1FFUA 1WXMA 3TIXA 4GU2A 3FILA 4IOIE 4C7YA 1SE4A 3H8HA 4W9DA 1FD6A 1EF1A 2VZKB 2WXPA 2L32A 5JHAA 1GTHA 4ZDVA 3L0WB 2KOXA 2JUOA 2WXNA 4TV3A 1YJIA 4A8XC 2DX5B 2Z59B 1K52A 5BYSA 2PMVA 2D07B 4ICVA 1TJEA 1RFAA 2KK8A 4ASWC 1WX7A 1C3TA 3Q8AA 1L4DB 4EUTA 2KANA 2JZ3B 2GB1A 1GT8A 3W2DA 2W9NA 3APDA 2TSSA 2DZIA 4ZOHC 3FAHA 3RNBC 2BB6A 2BQQA 5JH5C 1R4MI 3BY4B 1C79A 4DHJB 4USAA 3A4SC 3VUXA 4GOCA 3SR6A 2UYZB 4MM3B 4X57B 4NAWB 1HQRD 2KWDA 2QJLA 1UELA 3PZ7A 2QDFA 4WJOA 1YN3A 2RPQA 2KT7A 3H1UA 3AU4A 4HKQA 1EU4A 2KWVB 4HROA 1ZKHA 4HWIB 3VUWA 1V5TA 4ANXA 5FKAC 2WGSA 4YT0B 1YN4A 1SF0A 4FN2A 3WALA 2CU3A 4KX6B 2JXXA 1K8RB 3ZTDA 3WCQA 1IUEA 4PS8A 3FILB 2KWCA 5AZFA 3DVGX 1E8WA 3RN9C 4M8MA 3A33B 2LRWA 5HHDG 1TKYA 3N3KB 3ZW3A 2IZVB 1TKEA 2M56B 2OEDA 3EHVA 3KLSX 3OAWA 3ZXRA 4WWNA 1UWMA 3X23A 1NI2A 2GBNA 2LVOA 3VUYA 2L83A 2L52A 1FXTB 2KN5A 1T0SC 4LDTD 3P42A 1D6EC 3MC9A 3QCAA 4G0NB 3BVGA 1YX5B 2GBMA 5CHWA 3VTWA 4BBNF 5JHBA 2Y3AA 1LQBA 3ZXVA 4K7UA 4W9GA 3EFCA 4LCDE 4M02A 2KDEB 5E6PA 2MBEA 3BWUD 2KFJA 4GXBA 2FE8A 2BS4B
chains in the Genus database with same CATH topology
5EE0A 1AWDA 3AM9A 4XWWA 3HVDA 1DGJA 2PLPA 1V1PA 1RYJA 1VDVA 3AE5B 2Z8LA 1VZ8A 3T3OA 1GB1A 1ET6A 1QT9A 4XDDA 5D3DA 5EE3A 3ZJVA 2BTEA 3IT6B 4RH6A 1OFFA 3W9CB 1V97A 1F0ZA 2NMQA 2AQ2B 4ITKA 3C8YA 4H2AA 1SE2A 2XN9C 3J9CA 1T5XD 3BIID 1WSPA 1DOXA 2W3SA 3N9YC 2JQRB 3ETRA 1PYWD 4HRSA 3Q8CA 1TS2A 2WNMA 1FCLA 1JWSD 1TKGA 2X38A 3MJ5A 2V3PA 1L6VA 1ZDVA 2IPKD 2G1EA 1J7BA 2WXKA 1FFVA 3TEYA 4AQ7A 3U2SC 1RWSA 1WRIA 1A70A 3ABVB 4A6QA 4JWSC 2EELA 2V0GA 5EE9A 3VRAB 2FBWB 1C4CA 1VRAB 4NJCA 4GDKB 4NZLB 1PDXA 1KFYB 2K0PA 1ZPSA 1QOAA 1QKZA 1RM6C 2JU6X 3MC0B 1TS4A 1TZOA 1PGXA 3GB1A 3LYYA 4L1BA 3ZQ4A 3AE1B 1VJKA 3PZ8A 3E9SA 1C76A 2NTTA 1FMAD 3NRZA 4HEA1 1XLOA 4B0EA 2JWUA 2D5GA 1SJHD 3V05A 3P1MA 3TUOA 1M4VA 1WYGA 1FNUA 3HVZA 2QIEB 4LK0M 3AE8B 3NS1A 3VRBB 1GAQB 1JWMD 3BYYB 1GPXA 5JXVA 3MHZA 3TEXA 2MJDA 2ICIA 5BMIA 4ARIA 3SFDB 2GRIA 1C4AA 4KGRA 4UDUC 1JQ4A 1YN5A 4YSYB 1QF6A 4N58A 4WH4A 1E6EB 2LGIA 5AUKA 2KDMA 1ZXHA 5H8YE 1L0VB 3AE9B 1NEKB 4KKIA 4RGMA 2AQ1B 1N60A 1YJJA 5C2TB 4YSZB 1XF5L 1QOBA 1XLPA 4TQ0A 3P4RB 1SXTA 2N7JA 2HDEA 1P7EA 3NVYA 1V1OA 1V1PB 3BVMA 1FRRA 3Q8EA 1H7XA 2WS3B 1ZUD2 2ZW0A 3CWIA 2YEPF 3TEZA 1J7AA 4D2KA 2MJ3A 5BMHA 4FXCA 2GI9A 1ENFA 1SSNA 3AE2B 3AE4B 1TY0A 1YNTE 3PO0A 1JWAD 3NVVA 5GXGB 3BZDB 1E10A 3AE7B 3AB5A 2E3TA 1I4HA 1FXAA 1RFKA 1N5WA 1UUPA 2M0AA 1B1ZA 1JRPA 1NYQA 2YEPB 1B9RA 1AN8A 2G9HD 1OQQA 3IT4B 2BS2B 2H88B 3IAM1 2FUG1 1GTEA 2MJEA 2PVOD 3MFGA 2BYTA 4LLGM 2I38A 2CJNA 1FCCC 1I4XA 1FEHA 4XDCA 4WAFA 1EM7A 4YTMB 2WDVB 1L0XB 4WQMA 3TSSA 3E56A 2IGDA 5FK9C 1FM0D 1ZDXA 4RF0A 1MI0A 4M0WA 4MACA 2KN4A 4WURA 5HI1A 3ZJUA 3VR8B 2W3RA 1TS5A 4DXGA 4OZBA 4LTUA 4P6VF 1XEEA 1CJEA 3UI3A 3AEAB 2WXGA 3I9V1 1DYQA 1HZ5A 4C56C 2RPVA 1K53A 1AW7A 2IDYA 2DBYA 4MH8A 4MT5A 3FC4A 4TQ1A 2MEKA 1SIJA 3NZ3A 5D3IB 1K50A 1ROEA 1VZ6A 3AN1A 1D5ZC 1ET9A 3DWGC 1YQ3B 3AMZA 3EGRA 2WXJA 3AEBB 1CZPA 2LMCA 4R3DA 4TMAB 3P4SB 4GDLB 1JW9D 1KF6B 4JE3B 4O1NA 1YQ4B 1T6BX 1MVKA 2RDGA 2N9KA 2PKOA 1XLNA 5G5GA 3L4PA 1I4PA 1P7FA 1TY2A 5H92C 5C3JB 3P4QB 1ZP0B 5LNK1 2WDRB 4RFBA 1ZE3D 2JZPA 3NVZA 1KLUD 1N62A 4B0MA 1PGBA 2J53A 1I4GA 1C78A 2RMMA 1N61A 1QLBB 4WWMA 1SBBB 4CQNA 3VQIA 2BB5A 1R7SA 3AEFB 4ZYSA 3ZYYX 2AQ3B 2J4XA 1GB4A 5HFYA 1WWTA 2ONQA 1PGAA 2MH7A 1JWBD 2IGGA 1KH0A 2IGHA 1SEBD 1VZ7A 5T8IA 3U4EG 2N0SB 4YTPB 1XO3A 2WXOA 1MPEA 4ZRPA 4TSSA 5HG2A 1J7CA 2Y5CA 1C4PA 1JCKB 1FIQA 2WDQB 2BT6A 4KGTA 2SEBD 3KWVA 3BYTB 1ACCA 3I57A 3Q69A 3R8BA 2H89B 1F2RI 1FNWA 2WU5B 2V4IB 1DOYA 2KQ4X 4A55A 2JXTA 4HKZE 4OVZA 2M19A 2WQYB 4ARCA 2CJOA 4PT5A 4IKGA 3R2IA 1JROA 2WXFA 1SE3A 5E6JA 3O13A 2E6XA 3CIRB 1L4ZB 2QEJC 2WP9B 4US9A 2BW2A 1PFDA 3U7ZA 2EKIA 2J42A 1KRHA 2K9XA 3B2FA 2INNE 1WXQA 4JWUC 4A90A 2QSDA 1HZ6A 5BYRA 4A9AA 2N9LA 3HUIA 2ZW1A 2LUMA 2WLBA 2ACZB 3P63A 3AE3B 2PIAA 3MP9A 4OHJA 1QOFA 2LHEA 4P16A 1FNVA 1IBXB 2J52A 1FRDA 1QOGA 1FFUA 2DLBA 3LB8C 4YXDB 5EE1A 2DYOA 3BK1A 1NENB 1HEZE 3B9JA 1JWUD 1OQRA 2WXRA 2LJIA 1FXIA 1UNSA 4NAMA 5BMGA 3FILA 4IOIE 4C7YA 1KLGD 1F77A 1SE4A 3H8HA 1FD6A 5FR3A 2WXLA 2VZKB 3EUB2 2BBCA 4C7ZA 2K22A 2LHDA 2Q5WD 2WXPA 4GLSC 2L32A 4YSXB 3CF4A 3RPFC 1GTHA 2NTSA 4HJGE 1K51A 3Q8FA 2WXMA 1DOIA 2L1AA 2WXNA 4L2YA 1YJIA 4A8XC 4Q2JA 1FO4A 4YWGG 4OW0A 3Q8BA 4N59A 1XLQA 2KMMA 4DXFA 1K52A 4RF1A 2W55A 5BYSA 2PMVA 4JPSA 1IBXA 3W5VB 1I4RA 1TJEA 3R2TA 4KGSA 2JYTA 2Y5PA 2PW9A 4US8A 1EWCA 1VLBA 2QMTA 1I7HA 1UWXA 3RFZB 1CQVA 3Q8AA 4RGOS 3GP7A 1L4DB 2GB1A 1GT8A 1ESFA 3W2DA 1F2RC 1AYFA 1CK1A 3NUHB 2TSSA 1N5XA 4ZOHC 1XCTL 3FAHA 2LEKA 1TYGB 1BUIC 1XCQL 2BB6A 4YTNB 1ZOYB 1BMLC 4RNAA 3ZJTA 2LFIA 3W1SA 1C79A 1C9FA 1VR9A 3DWMA 4USAA 1MHHE 2INPE 1STEA 1WGKA 1JALA 1N63A 3SR6A 3BVZA 3AH7A 4J3OD 4MM3B 3AECB 1YMHE 1EU3A 3W5UB 3AEEB 2DWQA 2JSVX 4NAWB 1HQRD 1MHXA 1NI3A 2KWDA 2K3UA 5TSSA 2QJLA 2K5PA 3PZ7A 4RGNA 1L6UA 3V3XA 1PUTA 1IGDA 1YN3A 3NVWA 4OZAA 4HKQA 1EU4A 2KACA 3SFEB 4AS1A 2B76B 2HTME 4HROA 4JX1C 4IDIA 1L0YB 4C80A 1C77A 1I4QA 4ZHOA 3EA6A 1EWYC 5BYQA 1QILA 2V3NA 2W82A 1NVID 2I2YA 2AX5A 4L23A 5FKAC 4RGTA 1XXGA 1D4BA 4YT0B 1YN4A 5MPOA 1IGCA 3IXSA 4EE2A 1SF0A 1BXTA 3GS2A 2WXIA 2CU3A 4KX6B 4REZA 1D5XC 3P4PB 2JYEA 3AEGB 3WCQA 1IUEA 1GOZA 2BS3B 3FILB 3LXFA 4N6EB 2JX5A 1E7PB 3SEBA 3IAS1 3KQ4A 3AV8A 1TS3A 2IJ0A 2SAKA 5HHDG 2QILA 4ZRQA 1TKYA 1T3QA 4XWTA 3OWEB 1E0ZA 3B2GA 1TKEA 2M56B 4DQOC 3HRDD 2KAJA 2OEDA 3KLSX 3U52E 1UWMA 3ZGZA 4RCOA 1KTKA 2WU2B 2L83A 2XNAC 2WXQA 2L52A 4WIPA 5AUIA 2PTLA 4ZHPA 3AEDB 2R61A 3P42A 1NYRA 1D6EC 3BVGA 2Y3AA 3VR9B 4KKJA 3T3NA 2WXHA 1E9MA 1Y56A 1HA5A 2RDHA 2W54A 3BK2A 1D5MC 2PVGC 3KWLA 5D7GA 5G5HA 1H7WA 3URYA 3TEWA 1QQRA 4OZCA 2OHFA 5I4DA 1Q10A 1SB3C 1JMLA 2DYMA 1L5PA 2VZKD 1UGJA 4XE0A 1SJED 1LO5D 1HXYD 3AE6B 3BWUD 2ON8A 1ZXIA 2FE8A 1V8CA 2BS4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE0 A;  3FAH A;  2LEK A;  1TYG B;  1J7C A;  4YTN B;  1AWD A;  1FRR A;  3AM9 A;  1ZOY B;  2Y5C A;  1H7X A;  1DGJ A;  1FIQ A;  2WDQ B;  2BT6 A;  2WS3 B;  1ZUD 2;  1RYJ A;  1VDV A;  3AE5 B;  3CWI A;  3DWM A;  2H89 B;  1J7A A;  4USA A;  1QT9 A;  2MJ3 A;  4FXC A;  1WGK A;  1JAL A;  5EE3 A;  2WU5 B;  1N63 A;  3SR6 A;  1DOY A;  3AE2 B;  3AE4 B;  3AH7 A;  3PO0 A;  3AEC B;  1OFF A;  1JWA D;  3NVV A;  5GXG B;  3W5U B;  1E10 A;  2M19 A;  3AE7 B;  3AB5 A;  3AEE B;  3W9C B;  2WQY B;  1V97 A;  1RFK A;  1FXA A;  2DWQ A;  2E3T A;  1F0Z A;  1NI3 A;  2CJO A;  1N5W A;  2QJL A;  4ITK A;  1JRP A;  2K5P A;  1JRO A;  1NYQ A;  1L6U A;  1B9R A;  1OQQ A;  1PUT A;  3BII D;  2BS2 B;  2H88 B;  3NVW A;  3CIR B;  2W3S A;  1DOX A;  2JQR B;  1GTE A;  3ETR A;  2WP9 B;  2MJE A;  2PVO D;  4HRS A;  3SFE B;  2B76 B;  2HTM E;  4US9 A;  4HRO A;  4JX1 C;  2CJN A;  1PFD A;  1TKG A;  4IDI A;  2EKI A;  4C80 A;  1L6V A;  4YTM B;  2WDV B;  1KRH A;  1J7B A;  2G1E A;  1FFV A;  4ZHO A;  2K9X A;  1EWY C;  1RWS A;  1WRI A;  3B2F A;  1WXQ A;  1A70 A;  4WQM A;  3ABV B;  4JWU C;  4JWS C;  5EE9 A;  4A9A A;  3VRA B;  2FBW B;  1FM0 D;  1NVI D;  3HUI A;  2AX5 A;  2WLB A;  2ACZ B;  3P63 A;  3VR8 B;  4YT0 B;  3AE3 B;  1PDX A;  1KFY B;  2PIA A;  2W3R A;  5MPO A;  1QOA A;  1SF0 A;  1QOF A;  4LTU A;  1RM6 C;  4P6V F;  2CU3 A;  4KX6 B;  1FRD A;  1QOG A;  1CJE A;  1FFU A;  3AEA B;  3LB8 C;  3P4P B;  3AEG B;  3WCQ A;  3AE1 B;  4YXD B;  2BS3 B;  1IUE A;  1VJK A;  5EE1 A;  3LXF A;  1NEN B;  4N6E B;  3B9J A;  1OQR A;  2JX5 A;  1E7P B;  2DBY A;  1FXI A;  1FMA D;  3AV8 A;  3FC4 A;  3NRZ A;  4C7Y A;  1XLO A;  1TKY A;  1T3Q A;  3P1M A;  1E0Z A;  3B2G A;  1TKE A;  1WYG A;  1SIJ A;  2M56 B;  3EUB 2;  3HRD D;  2KAJ A;  2K22 A;  1ROE A;  2Q5W D;  2QIE B;  3AN1 A;  3AE8 B;  1UWM A;  3HVZ A;  4YSX B;  3CF4 A;  3DWG C;  1YQ3 B;  1GTH A;  3VRB B;  1GAQ B;  3AMZ A;  3NS1 A;  3RPF C;  1GPX A;  3AEB B;  1CZP A;  2MJD A;  2WU2 B;  2L83 A;  3P4S B;  1JW9 D;  1KF6 B;  2L52 A;  1DOI A;  1ZXI A;  5AUI A;  1YQ4 B;  1YJI A;  3AED B;  4ZHP A;  3SFD B;  2PKO A;  1FO4 A;  1NYR A;  1JQ4 A;  4N59 A;  1XLQ A;  1XLN A;  2KMM A;  3L4P A;  3NVY A;  5G5G A;  5H92 C;  5C3J B;  2W55 A;  3P4Q B;  3VR9 B;  1ZP0 B;  4YSY B;  1QF6 A;  2WDR B;  3W5V B;  1TJE A;  4N58 A;  1E6E B;  5AUK A;  1E9M A;  3NVZ A;  1N62 A;  4US8 A;  2W54 A;  5H8Y E;  4C7Z A;  1L0V B;  2PVG C;  3AE9 B;  1VLB A;  1I7H A;  3KWL A;  1N61 A;  1NEK B;  1QLB B;  4WWM A;  1H7W A;  5G5H A;  2OHF A;  1SB3 C;  1R7S A;  3AEF B;  1GT8 A;  1N60 A;  1L5P A;  1YJJ A;  4ZOH C;  5C2T B;  3ZYY X;  1WWT A;  4YSZ B;  2MH7 A;  1JWB D;  1QOB A;  1XLP A;  1AYF A;  3P4R B;  3AE6 B;  1N5X A;  2N0S B;  4YTP B;  1XO3 A;  1V8C A;  2BS4 B; 
#chains in the Genus database with same CATH topology
 2JZZ A;  2ZVO A;  3HVD A;  1DGJ A;  4MSQ B;  1VZ8 A;  1ET6 A;  1QT9 A;  4XDD A;  5EE3 A;  1OFF A;  4TUU A;  2DZJ A;  3DDC B;  2MW5 A;  3AUL A;  3J9C A;  1F9J A;  3NS8 A;  1MJD A;  1WSP A;  3ETR A;  4LJO B;  2M1M A;  3HHM A;  2X38 A;  1L6V A;  2WXK A;  3UQA A;  1WJ6 A;  3I5J C;  1WRI A;  3HK0 A;  4URK A;  3UIN B;  1KFY B;  1ZPS A;  3R3M A;  1QKZ A;  2LGY A;  2HE7 A;  3MC0 B;  2JWZ A;  4FHK A;  3LYY A;  4ANV A;  3NRZ A;  2FUH B;  5TR5 A;  1SJH D;  3TUO A;  3WAN A;  3L17 A;  4WJN A;  1A5R A;  2QIE B;  5IA7 A;  3AE8 B;  3NS1 A;  5DPT A;  3MHZ A;  2AWT A;  3NY5 A;  4G50 A;  4FA6 A;  1E7U A;  1Q1O A;  4ANW A;  4UDU C;  1YN5 A;  3EFU A;  3OJ4 B;  4YSY B;  1E6E B;  4KIK A;  2LWP A;  5DPR A;  4GGQ A;  1L0V B;  4FUL A;  4KKI A;  3H7P A;  1UF0 A;  5C2T B;  3N32 A;  1OEY J;  1VCB A;  2N7E A;  3P4R B;  2N7J A;  4RM9 A;  2HDE A;  1P7E A;  3GE8 C;  3BVM A;  3C19 A;  4YL8 A;  3Q2A C;  3NHE B;  1WRD B;  2ZW0 A;  1UD7 A;  3TEZ A;  1J7A A;  4D2K A;  2JY6 A;  2V9H A;  3AE4 B;  1YNT E;  2IY1 B;  1FXA A;  2M0A A;  1B1Z A;  2YEP B;  2CHX A;  1OQQ A;  4BOS C;  3IT4 B;  2H88 B;  2JRH A;  1E8Z A;  2FUG 1;  2MJE A;  3MFG A;  2YLM A;  1I4X A;  3RMK C;  4YTM B;  2G3Q B;  4CO7 A;  3E56 A;  2IGD A;  5FK9 C;  4MDK E;  5G2N A;  4BOZ B;  1P98 A;  4MAC A;  2W3R A;  1YIW A;  4LTU A;  3V6C B;  1XEE A;  2WXG A;  2RPV A;  1K53 A;  1AW7 A;  4MH8 A;  4MT5 A;  2GBK A;  3PRP B;  3ZDM C;  3RI7 C;  3T9L A;  3HM3 A;  4QAY A;  1BT0 A;  3ZO5 B;  1YQ3 B;  1WM2 A;  1E8Y A;  5IP4 D;  3P4S B;  4EZK A;  1YQ4 B;  4HPM B;  1WFY A;  2PKO A;  3L13 A;  3L4P A;  1P7F A;  1TY2 A;  5H92 C;  4IWO A;  2J7Q B;  4KIK B;  4RFB A;  4EEW A;  1KLU D;  1P1A A;  1N62 A;  4B0M A;  2NR2 A;  3H7P B;  2D3C A;  4E74 A;  4CQN A;  2CHW A;  2DYB A;  2D2Q A;  2IO3 B;  1PGA A;  1VZ7 A;  4FLH A;  4YTP B;  1LGR A;  2WXO A;  2LI5 A;  3WA0 A;  2EMS A;  1FIQ A;  1Z5S B;  2BT6 A;  3IBE A;  1FNW A;  4TKN A;  2KQS A;  4W9I A;  4A55 A;  1RRB A;  1WX8 A;  1WF9 A;  4HKZ E;  3ZUN A;  2WDT B;  2WQY B;  4PYU A;  5E6J A;  1L2N A;  2FAZ A;  4PYZ A;  3OG5 A;  2QEJ C;  2KDI A;  2K6D B;  5CX3 A;  2L00 B;  2GMI C;  2BW2 A;  3N1Y C;  1KRH A;  5C23 A;  4JWU C;  3V62 A;  4A90 A;  2QSD A;  2KDF B;  2LUM A;  4PS7 A;  2KMA A;  3GOE A;  4LNN A;  4OHJ A;  1QOF A;  3N1Z C;  1IBX B;  1TT5 B;  5KHQ A;  1V9J A;  5EE1 A;  3B9J A;  1OQR A;  2LJI A;  1FXI A;  2AYO B;  2KJH B;  2WXL A;  3ECI A;  4GLS C;  2K22 A;  2Q5W D;  3Q6B A;  3RUL A;  2WXM A;  1P9D U;  1DOI A;  4HLE A;  3UGB B;  4ICU A;  3ML9 A;  2C7H A;  2KMM A;  1GUA B;  2W55 A;  1LM8 B;  3W5V B;  3PT2 B;  1Z2M A;  2Y5P A;  2PW9 A;  4US8 A;  1WE7 A;  1Q0W B;  5IAA C;  1EWC A;  3WAP A;  1I7H A;  2XBB C;  3RFZ B;  1F52 A;  1ESF A;  2LZ6 A;  1AYF A;  3NUH B;  1R4M B;  3M62 B;  2DHZ A;  1ZOY B;  1YQB A;  2PE6 B;  3DWM A;  1MHH E;  4CYE A;  1STE A;  2RDB C;  1JAL A;  1N63 A;  1QZE A;  4W9K A;  3BVZ A;  4J3O D;  1YMH E;  4KDL B;  1EU3 A;  3W5U B;  3AEE B;  2DWQ A;  2JSV X;  4RGN A;  4XZ4 A;  1IGD A;  5AZG A;  3NVW A;  4OZA A;  2KAC A;  4AS1 A;  3A1Q A;  1WY8 A;  3CF6 E;  1C77 A;  1I4Q A;  1EWY C;  2MWS B;  3PVL A;  2W82 A;  2N9E B;  1HTQ A;  4RGT A;  1V5O A;  3IXS A;  4EE2 A;  2KTR A;  2C5L C;  3B0A A;  1X1M A;  2WXI A;  2BWF A;  5J2R A;  4HVB A;  1GOZ A;  2JT4 B;  2KD0 A;  3N30 A;  1XD3 B;  3IAS 1;  2SAK A;  2QIL A;  4P1C C;  4ZRQ A;  4DHZ B;  1T3Q A;  2Y5B B;  1E0Z A;  3B2G A;  3U52 E;  4RCO A;  2WU2 B;  2XNA C;  4JGH B;  5AUI A;  1EUV B;  4ZHP A;  3Q3F A;  3QA8 A;  4HPP A;  3L16 A;  4KKJ A;  1T0Q C;  2KMC A;  2FCM A;  2WXH A;  2FCN A;  4EZJ A;  2NBV B;  3BK2 A;  2PVG C;  3GZN I;  3KWL A;  2N9X A;  1S1Q B;  3PRE A;  5D7G A;  2L76 A;  2OHF A;  3DVN U;  3PRZ A;  2R2Q A;  2MBH A;  2ON8 A;  2J0M A;  2WX0 A;  2LGS A;  3LDZ E;  3UQB A;  4XWW A;  1RYJ A;  1VDV A;  3C0R B;  4OVU A;  3RNC C;  2FID A;  3ZNG C;  4IC7 B;  5EDS A;  2G4D B;  1ISN A;  3A9J A;  2LAS A;  1SE2 A;  2VRR B;  1T5X D;  4EFO A;  3BII D;  3N9Y C;  3A1Q B;  2JQR B;  1OQY A;  2WNM A;  2UWQ A;  3RNE C;  3MJ5 A;  1ZDV A;  2G1E A;  4AQ7 A;  4MGK E;  4FJZ A;  3SDL C;  1RWS A;  3UIO B;  2EEL A;  1TGZ B;  5EE9 A;  4MGY E;  3VRA B;  2FBW B;  1VRA B;  2KTR B;  4ANU A;  3WIM A;  4NZL B;  1PDX A;  1HE8 A;  2N9P C;  4A3O A;  1QOA A;  3APC A;  4KV2 A;  1RM6 C;  4KDI C;  3ZQ4 A;  3AE1 B;  4KSK C;  2IYD B;  3M63 B;  3E9S A;  4HK2 A;  1C76 A;  2NTT A;  1FMA D;  2J0K A;  4HEA 1;  4BZA A;  3T8M A;  3P1M A;  1M4V A;  1WYG A;  3DPD A;  3BYY B;  1YJ1 A;  2ICI A;  3LJ3 A;  4W9F A;  5BMI A;  4ARI A;  1EF5 A;  2RSU A;  4KGR A;  2NBU A;  1JQ4 A;  3KW5 B;  4M01 A;  2J0J A;  1Q5W B;  5AEK B;  4WH4 A;  4WJP A;  2FIF A;  2PEA A;  3SU8 X;  1ZXH A;  4BBN C;  1NEK B;  2K6Q A;  1E90 A;  1WZ0 A;  4II3 B;  3MTN B;  3MJW A;  4W9C A;  4TQ0 A;  1SXT A;  1WXS A;  4DBG A;  4B95 A;  3Q8E A;  3I63 C;  1ZUD 2;  4XGA B;  3CWI A;  5KHO A;  2ZNV C;  3SD5 A;  3AE2 B;  5GXG B;  4MJS A;  3BZD B;  1E10 A;  3A9J B;  3HM6 X;  5C1Z A;  3NOB A;  3DBR B;  2MBQ A;  1AN8 A;  4BVU C;  3IAM 1;  2PVO D;  2CJN A;  4WAF A;  1L0X B;  2WDV B;  5GMV A;  4BKT A;  3UF8 A;  3DBL I;  4WQM A;  4FAD A;  3TSS A;  2JRI B;  4B9K A;  3R7Q A;  1ZDX A;  2KN4 A;  4A20 A;  4M00 A;  4OZB A;  4GSW A;  2M0X A;  1P3Q U;  1WGH A;  3ALB A;  4PS3 A;  4XX5 A;  1CJE A;  4LNF A;  3AEA B;  3I9V 1;  4WQO B;  1YD8 U;  1FPY A;  3ZLZ A;  2BPS A;  2MEK A;  2LVQ A;  4AUQ C;  1SIJ A;  5D3I B;  4RMA A;  2CR5 A;  3DWG C;  3UIP B;  3M95 A;  3TJP A;  2LMC A;  4R3D A;  4TMA B;  5D2M B;  1JW9 D;  1KF6 B;  4O1N A;  2QCZ A;  3RNG C;  4WJQ A;  1UH6 A;  1XLN A;  5G5G A;  2KVR A;  3R7R A;  1LXD A;  5C3J B;  3OLM D;  5IOI A;  1SE9 A;  5LNK 1;  2WDR B;  5DPW A;  4HCP B;  2JZP A;  3NVZ A;  2BKF A;  3WAO A;  3KUD B;  1I4G A;  1N61 A;  4WWM A;  2O6V D;  1KLV A;  1R7S A;  4ZYS A;  2AQ3 B;  2IBI B;  2J4X A;  1KH0 A;  2NVU I;  1XO3 A;  4G11 A;  4TSS A;  5HG2 A;  4NJ6 A;  2PJH A;  1ACC A;  2MQJ A;  1F2R I;  3CST A;  4W9E A;  4MJS B;  2REX A;  2WU5 B;  3PZD A;  3QX1 A;  3IFW B;  2CS4 A;  2M19 A;  3ZNZ B;  1ZGU B;  4WWO A;  4PT5 A;  2K25 A;  2WXF A;  1SE3 A;  3O13 A;  4ZRK A;  2E6X A;  1L4Z B;  1V80 A;  2IY0 B;  4M8N A;  1Y8R C;  2EKI A;  4NQL B;  3B1L X;  1WXQ A;  1C1Y B;  3ZRC A;  2OJW A;  4A9A A;  1E7V A;  2LGX A;  2ACZ B;  4IUM B;  3MP9 A;  1T0Y A;  3U7D A;  2LHE A;  4P16 A;  2J52 A;  2DLB A;  2JPH A;  4YXD B;  2DYO A;  1OGW A;  4HDQ A;  1JWU D;  3DBR I;  1UNS A;  5BMG A;  1V49 A;  1KLG D;  1F77 A;  5FR3 A;  2G4S A;  2KQ7 A;  3RYT A;  4FBJ B;  1G6J A;  4HCN B;  3EUB 2;  2BBC A;  4C7Z A;  2LHD A;  4MGI E;  1UGM A;  4YSX B;  3CF4 A;  3RPF C;  2NTS A;  3QAR A;  3Q8F A;  4IW0 A;  4AJY B;  4Q2J A;  1FO4 A;  3M3J A;  4OW0 A;  4B6W A;  4N59 A;  4DXF A;  4LJP B;  4JPS A;  4IM2 A;  1IBX A;  3PPA A;  1I4R A;  5DPS A;  2L0T A;  3R2T A;  1WR1 A;  2EKE C;  2RD0 A;  1VLB A;  2QMT A;  1UWX A;  4RGO S;  3VTV A;  4F8C B;  2CU1 A;  1F2R C;  2BYF A;  1CK1 A;  1N5X A;  2KWU B;  1J0G A;  1XCT L;  2LEK A;  1BUI C;  3ZIM A;  3DVN V;  4JL9 A;  3PLV A;  2ZCB A;  3PLU A;  4RNA A;  2LFI A;  2WX1 A;  1VR9 A;  1WGK A;  3EC8 A;  2V1Y A;  4GIV A;  3DBH I;  3AEC B;  4I6L B;  4ZRI A;  4JQW C;  2MRP A;  3RD2 A;  2K3U A;  1WGG A;  2K5P A;  2QC8 A;  3V3X A;  1L6U A;  1PUT A;  2KZR A;  2N4F A;  3N20 C;  3SFE B;  4JX1 C;  4IDI A;  4C80 A;  2Z0E B;  1WIA A;  5BYQ A;  1SGH A;  1QIL A;  1WXA A;  2ASQ A;  5JZE B;  1S3S G;  2I2Y A;  4L23 A;  3VXW A;  1D4B A;  5D6J B;  3DVG Y;  3CSF A;  4GDK A;  1BXT A;  4P1B C;  4II2 B;  1F1H A;  1VD2 A;  4REZ A;  3AEG B;  4IWP A;  2FCQ A;  3PGE A;  4MH0 E;  1E7P B;  3SEB A;  2BWE S;  1TS3 A;  2IJ0 A;  1TTN A;  4C00 A;  4XWT A;  3OWE B;  4DQO C;  2O6V A;  3KYC D;  2KAJ A;  4JLC A;  4OVV A;  4LDT B;  1KTK A;  1NDD A;  2DZK A;  2WXQ A;  2QHO A;  4WIP A;  3Q3O C;  2PTL A;  2R61 A;  4BKS D;  1MFW A;  3GZN B;  1YOV B;  2A5U A;  1KJT A;  5IN7 A;  3T3N A;  2I1K A;  3QJZ A;  2WHI A;  2W54 A;  4I6N B;  1IPG A;  1D5M C;  3VVW B;  1WGR A;  2MBO A;  2V4L A;  3ZVV A;  1XT9 B;  3TEW A;  1QQR A;  4OZC A;  4F1S A;  5I4D A;  1Q10 A;  5LXI B;  2DYM A;  4DWF A;  1WR6 E;  1SJE D;  1LO5 D;  1HXY D;  1ZXI A;  3ONS A;  1V8C A;  1AWD A;  3AM9 A;  4K3B A;  1V1P A;  4F7Z A;  2Z8L A;  3QIJ A;  1GC6 A;  2MP2 A;  2BTE A;  3ZJV A;  4W9J A;  3IT6 B;  3H7S A;  2IO1 B;  1GJZ A;  1NBF C;  2ZNV B;  3W9C B;  1V97 A;  1F0Z A;  3QQ8 B;  4IG7 B;  4ITK A;  4H2A A;  2XN9 C;  1J19 A;  4A3P A;  3JSV A;  1GG3 A;  4C4V A;  2D3A A;  2W3S A;  1DOX A;  1PYW D;  1TS2 A;  1TKG A;  2BF8 B;  2IPK D;  1J7B A;  3TEY A;  4AP4 C;  3ABV B;  4DDI D;  3A9K A;  1C4C A;  4NJC A;  4GDK B;  2ZVN A;  2C60 A;  3DHI C;  2KHW B;  2K0P A;  1J8C A;  2FCS A;  2JU6 X;  1PGX A;  4L1B A;  3PZ8 A;  1H8C A;  4N9F 4;  3B08 A;  1WGY A;  2O6V B;  1XLO A;  5E6N A;  4B0E A;  2JWU A;  5HKH A;  2D5G A;  2LUE A;  2AEH A;  2MSE D;  4LK0 M;  1GAQ B;  1GPX A;  5JXV A;  2KLG A;  3TEX A;  5L83 A;  3RCZ A;  1V81 A;  4K3C A;  3SFD B;  2GRI A;  1C4A A;  4GDL A;  2KKC A;  2K1F A;  1QF6 A;  3HIZ A;  4N58 A;  3L08 A;  2LGI A;  5AUK A;  2C7M B;  2L8J A;  2KDM A;  2KJ6 A;  2DAF A;  3ZNI D;  3AE9 B;  2NCN A;  5IO9 A;  4E71 A;  4RGM A;  2AQ1 B;  1N60 A;  1YJJ A;  2KDB A;  1XF5 L;  2HJ8 A;  1QOB A;  3W1S C;  4XC2 A;  4BFR A;  3NVY A;  1V1O A;  4NPN A;  1V1P B;  1UBQ A;  1WGD A;  2LGD A;  4NNJ B;  3X0W A;  1H7X A;  3RNA C;  2MP2 B;  2RGF A;  3O65 B;  2YEP F;  2MJ3 A;  2JVC A;  5BMH A;  4GB9 A;  2OOB B;  1SSN A;  2D3B A;  5LXH A;  3JSV B;  2IO2 B;  1UBI A;  1UUP A;  4C4V B;  1NYQ A;  2EMT A;  1B9R A;  3SHQ A;  2BS2 B;  3QWZ B;  3DBL B;  2BGF A;  2BYT A;  4ACF A;  2I38 A;  3K9P B;  5CHF A;  5AZH A;  5CTR C;  1EM7 A;  3I3T B;  3A9K B;  2NS5 A;  3DHH C;  4FHJ A;  2GBJ A;  1FM0 D;  4RF0 A;  1MI0 A;  4W9L A;  4WUR A;  3ZJU A;  3VR8 B;  1TS5 A;  2AL3 A;  4BKS A;  4FJY A;  2LD9 A;  3CMM B;  4KSL C;  3UI3 A;  4LNI A;  2MLB A;  1HZ5 A;  1WZ3 A;  4C56 C;  1E8X A;  3JYU A;  3FC4 A;  5D94 A;  2K8C A;  3TL5 A;  1OTR B;  2GLS A;  3Q3N C;  3NZ3 A;  1WX9 A;  3GE3 C;  1ET9 A;  3AMZ A;  2I1J A;  3AEB B;  4PK1 A;  3KH0 A;  2D3G A;  4GDL B;  2KX0 A;  2RDG A;  2IND C;  2N9K A;  3A4R A;  2PE9 A;  3ENE A;  1I4P A;  1M94 A;  3P4Q B;  2LRU A;  4IM3 A;  1ZE3 D;  3ZDT A;  1U4A A;  1TBE A;  2CKH B;  2GOW A;  4IWQ A;  1WI0 A;  3ZTC A;  2J53 A;  4MGZ E;  1CMX B;  4HJK A;  2UU7 A;  1SBB B;  1H4R A;  4K7S A;  3AEF B;  3VTU A;  1GB4 A;  5HFY A;  2ONQ A;  2MH7 A;  1JWB D;  1SEB D;  5T8I A;  2N0S B;  1V86 A;  4GMV A;  4ZRP A;  3VDZ A;  2KLC A;  1J7C A;  2Y5C A;  1JCK B;  1OEY A;  1KOT A;  4KGT A;  2SEB D;  3KWV A;  3Q3M C;  3Q69 A;  3R8B A;  2LXC A;  3R66 C;  4BKG A;  2KQ4 X;  4EKU A;  1AAR A;  1D3Z A;  2AL6 A;  2JXT A;  1MG8 A;  4OVZ A;  4ARC A;  3VHT C;  2KO3 A;  4MSM B;  2ZCC A;  1UZX B;  3CIR B;  2KNB A;  3DBS A;  4FJV B;  2WP9 B;  3QHT A;  4US9 A;  2ZEQ A;  1PFD A;  2NPT A;  2K9X A;  2INN E;  3L10 B;  4WWP A;  4K7W A;  1HZ6 A;  5BYR A;  2N9L A;  2ZW1 A;  1E5W A;  2WLB A;  1R4N I;  3FKY A;  3P63 A;  3AE3 B;  2PIA A;  1LFD A;  1FNV A;  3JW0 X;  4AOF A;  1FRD A;  3LB8 C;  1WJN A;  3BK1 A;  1NEN B;  1HEZ E;  2WXR A;  5DCN A;  4NAM A;  2Z0D B;  1KM7 A;  2CHZ A;  1WJ4 A;  2KTF A;  4HJG E;  3TCA A;  1K51 A;  3RZF A;  1PQS A;  2L1A A;  4L2Y A;  1JRU A;  4ZYN A;  4YWG G;  3Q8B A;  1XLQ A;  2MBB B;  4RF1 A;  5J18 A;  4HXD A;  1V2Y A;  4ZRJ A;  2FNJ B;  2HJ1 A;  4KGS A;  2JYT A;  5J17 A;  3NZS A;  1CQV A;  3DOW A;  3GP7 A;  3KVF B;  1IYF A;  3L54 A;  4I6P A;  3TBL D;  3S2A A;  2BYV E;  3U30 A;  1TYG B;  1XCQ L;  4YTN B;  1RAX A;  3DBH B;  1BML C;  3PHW B;  1WXV A;  3ZJT A;  3W1S A;  3V60 A;  1IP9 A;  1C9F A;  2INP E;  4W9H A;  4KVG B;  3AH7 A;  2ZPY A;  2L3Z A;  1MHX A;  1NI3 A;  2JF5 A;  5TSS A;  1WH3 A;  3OJ3 A;  3EEC A;  3V61 A;  2B76 B;  2HTM E;  2NPT B;  5E6O A;  1L0Y B;  4DDG D;  3QK0 A;  4ZHO A;  3EA6 A;  3KUC B;  2KVZ A;  2BYE A;  2V3N A;  1NVI D;  2AX5 A;  1XXG A;  5BO4 B;  3N1X C;  5MPO A;  1IGC A;  2G45 B;  4S17 A;  3GS2 A;  3AI5 A;  1WJU A;  1D5X C;  3P4P B;  2WWZ A;  2JYE A;  2BS3 B;  3LXF A;  4N6E B;  2JX5 A;  3JVZ X;  2IO0 B;  3KQ4 A;  3AV8 A;  2GBR A;  4XYC A;  2XEW A;  3HRD D;  3ZGZ A;  1WM3 A;  2DEN B;  2KXJ A;  2OJR A;  3BIN A;  5LLI A;  3AED B;  1MG4 A;  1NYR A;  2BVC A;  3VR9 B;  3PTF C;  5FR6 A;  1I35 A;  2M17 A;  1E9M A;  1Y56 A;  1HA5 A;  3RUI B;  4JIO U;  2RDH A;  4KZ0 A;  2ZZP B;  5G5H A;  1H7W A;  1TZ1 A;  3URY A;  1SB3 C;  1JML A;  2LVP A;  2XK5 A;  1L5P A;  2VZK D;  1UGJ A;  4XE0 A;  2KYW A;  3IHP C;  3AE6 B;  1HTO A;  3U2S C;  5EE0 A;  3DHG C;  1ZW7 A;  2PLP A;  3WAM A;  3AE5 B;  2K8H A;  2RR9 A;  2HTH A;  3KUZ A;  1GB1 A;  3T3O A;  5D3D A;  4RH6 A;  2O2V A;  1WMH A;  3AU5 A;  2NMQ A;  2AQ2 B;  3C8Y A;  2MCN B;  2C7N B;  3ZKJ C;  4HRS A;  3Q8C A;  4CHK A;  1FCL A;  1JWS D;  3MC8 A;  2V3P A;  1FFV A;  3PS6 A;  4GN1 A;  3VAW A;  1A70 A;  4A6Q A;  4JWS C;  4DHZ E;  2V0G A;  4DHJ D;  1L7Y A;  3PV1 A;  3QC8 B;  2KFK A;  1TS4 A;  2NBW B;  1TZO A;  1V6E A;  3GB1 A;  1VJK A;  4NY0 A;  5CHV C;  4BAX A;  3RT3 B;  3TMP B;  3V05 A;  2X8X X;  2BKR B;  1FNU A;  3HVZ A;  1T0R C;  3VRB B;  1JWM D;  4HPL B;  2N1V A;  2MJD A;  1GC7 A;  2HD5 B;  1SIF A;  1EO6 A;  1XQQ A;  2ZPN A;  2A4Z A;  3ML8 A;  5H8Y E;  2V3S A;  2XK5 B;  1WYW B;  2KJR A;  4WAA A;  2DZM A;  2KC1 A;  3NG0 A;  2D11 A;  4YSZ B;  1XLP A;  2KC2 A;  2N7D A;  3Q3J A;  1RLF A;  3D32 A;  2C9W B;  1FRR A;  2KX3 A;  2MA9 B;  2WS3 B;  2O2V B;  4FXC A;  1WMH B;  2INC C;  2GI9 A;  1ENF A;  1TY0 A;  3PO0 A;  3VH3 B;  1JWA D;  2MHJ A;  3NVV A;  3AE7 B;  3AB5 A;  2L7R A;  1I4H A;  1RFK A;  2E3T A;  2MX2 A;  4S0R A;  1N5W A;  4J6I A;  1JRP A;  2G9H D;  1GTE A;  4LLG M;  2VH1 A;  1FCC C;  1I42 A;  2VH2 A;  1FEH A;  4XDC A;  4EOY A;  2M4N A;  5IKC M;  3DQV A;  5L95 C;  4M0W A;  5HI1 A;  2ZJD A;  4DXG A;  2KFK B;  1P0R A;  3ZRF A;  3H6N A;  4AWJ A;  3VFK A;  4P6V F;  4LNO A;  3DCG A;  2PPH A;  1DYQ A;  3RZW C;  1TIF A;  2K8B A;  2IDY A;  2DBY A;  1YX6 B;  2LJ5 A;  4TQ1 A;  3V6E B;  3KYD D;  2N1W A;  3MHS D;  1K50 A;  2R2O A;  1ROE A;  1VZ6 A;  3AN1 A;  1D5Z C;  3EGR A;  3PRM B;  2WXJ A;  1CZP A;  4JE3 B;  2L0F A;  2D10 A;  1T6B X;  1MVK A;  1N6Z A;  3RNF C;  3IG3 A;  2K39 A;  4LNK A;  4RM8 A;  1ZP0 B;  2WYQ A;  2DNF A;  3NJT A;  4EZL A;  3P2B A;  1PGB A;  3ZNH B;  2LXA A;  2RMM A;  1C78 A;  4KZC A;  1QLB B;  3VQI A;  2BB5 A;  3ZYY X;  1WE6 A;  1WWT A;  2DAJ A;  2M8S A;  4DXA B;  2IGG A;  2IGH A;  3U4E G;  3U8Z A;  1MPE A;  1C4P A;  2L05 A;  2WDQ B;  3H9D A;  3BYT B;  3I57 A;  4K1R B;  2H89 B;  3Q14 C;  2V4I B;  1DOY A;  4G3X B;  4HDO A;  4AJW A;  4MM3 A;  2CJO A;  4DK5 A;  4IKG A;  3R2I A;  1JRO A;  4NAW A;  5G55 A;  3APF A;  4NJ7 A;  3W1Y A;  3NZU A;  2YVC A;  3QAQ A;  1GNU A;  3VH4 B;  3IVF A;  3U7Z A;  3AXC A;  2J42 A;  1R4N B;  4MEL A;  4E3C A;  3B2F A;  4M0W B;  4K81 A;  3HUI A;  3K9O B;  4NQK E;  4IM0 A;  3PSE B;  4MEM A;  2B3A A;  4P7I A;  3PHX B;  1QOG A;  1FFU A;  1WXM A;  3TIX A;  4GU2 A;  3FIL A;  4IOI E;  4C7Y A;  1SE4 A;  3H8H A;  4W9D A;  1FD6 A;  1EF1 A;  2VZK B;  2WXP A;  2L32 A;  5JHA A;  1GTH A;  4ZDV A;  3L0W B;  2KOX A;  2JUO A;  2WXN A;  4TV3 A;  1YJI A;  4A8X C;  2DX5 B;  2Z59 B;  1K52 A;  5BYS A;  2PMV A;  2D07 B;  4ICV A;  1TJE A;  1RFA A;  2KK8 A;  4ASW C;  1WX7 A;  1C3T A;  3Q8A A;  1L4D B;  4EUT A;  2KAN A;  2JZ3 B;  2GB1 A;  1GT8 A;  3W2D A;  2W9N A;  3APD A;  2TSS A;  2DZI A;  4ZOH C;  3FAH A;  3RNB C;  2BB6 A;  2BQQ A;  5JH5 C;  1R4M I;  3BY4 B;  1C79 A;  4DHJ B;  4USA A;  3A4S C;  3VUX A;  4GOC A;  3SR6 A;  2UYZ B;  4MM3 B;  4X57 B;  4NAW B;  1HQR D;  2KWD A;  2QJL A;  1UEL A;  3PZ7 A;  2QDF A;  4WJO A;  1YN3 A;  2RPQ A;  2KT7 A;  3H1U A;  3AU4 A;  4HKQ A;  1EU4 A;  2KWV B;  4HRO A;  1ZKH A;  4HWI B;  3VUW A;  1V5T A;  4ANX A;  5FKA C;  2WGS A;  4YT0 B;  1YN4 A;  1SF0 A;  4FN2 A;  3WAL A;  2CU3 A;  4KX6 B;  2JXX A;  1K8R B;  3ZTD A;  3WCQ A;  1IUE A;  4PS8 A;  3FIL B;  2KWC A;  5AZF A;  3DVG X;  1E8W A;  3RN9 C;  4M8M A;  3A33 B;  2LRW A;  5HHD G;  1TKY A;  3N3K B;  3ZW3 A;  2IZV B;  1TKE A;  2M56 B;  2OED A;  3EHV A;  3KLS X;  3OAW A;  3ZXR A;  4WWN A;  1UWM A;  3X23 A;  1NI2 A;  2GBN A;  2LVO A;  3VUY A;  2L83 A;  2L52 A;  1FXT B;  2KN5 A;  1T0S C;  4LDT D;  3P42 A;  1D6E C;  3MC9 A;  3QCA A;  4G0N B;  3BVG A;  1YX5 B;  2GBM A;  5CHW A;  3VTW A;  4BBN F;  5JHB A;  2Y3A A;  1LQB A;  3ZXV A;  4K7U A;  4W9G A;  3EFC A;  4LCD E;  4M02 A;  2KDE B;  5E6P A;  2MBE A;  3BWU D;  2KFJ A;  4GXB A;  2FE8 A;  2BS4 B; 
#chains in the Genus database with same CATH homology
 5EE0 A;  1AWD A;  3AM9 A;  4XWW A;  3HVD A;  1DGJ A;  2PLP A;  1V1P A;  1RYJ A;  1VDV A;  3AE5 B;  2Z8L A;  1VZ8 A;  3T3O A;  1GB1 A;  1ET6 A;  1QT9 A;  4XDD A;  5D3D A;  5EE3 A;  3ZJV A;  2BTE A;  3IT6 B;  4RH6 A;  1OFF A;  3W9C B;  1V97 A;  1F0Z A;  2NMQ A;  2AQ2 B;  4ITK A;  3C8Y A;  4H2A A;  1SE2 A;  2XN9 C;  3J9C A;  1T5X D;  3BII D;  1WSP A;  1DOX A;  2W3S A;  3N9Y C;  2JQR B;  3ETR A;  1PYW D;  4HRS A;  3Q8C A;  1TS2 A;  2WNM A;  1FCL A;  1JWS D;  1TKG A;  2X38 A;  3MJ5 A;  2V3P A;  1L6V A;  1ZDV A;  2IPK D;  2G1E A;  1J7B A;  2WXK A;  1FFV A;  3TEY A;  4AQ7 A;  3U2S C;  1RWS A;  1WRI A;  1A70 A;  3ABV B;  4A6Q A;  4JWS C;  2EEL A;  2V0G A;  5EE9 A;  3VRA B;  2FBW B;  1C4C A;  1VRA B;  4NJC A;  4GDK B;  4NZL B;  1PDX A;  1KFY B;  2K0P A;  1ZPS A;  1QOA A;  1QKZ A;  1RM6 C;  2JU6 X;  3MC0 B;  1TS4 A;  1TZO A;  1PGX A;  3GB1 A;  3LYY A;  4L1B A;  3ZQ4 A;  3AE1 B;  1VJK A;  3PZ8 A;  3E9S A;  1C76 A;  2NTT A;  1FMA D;  3NRZ A;  4HEA 1;  1XLO A;  4B0E A;  2JWU A;  2D5G A;  1SJH D;  3V05 A;  3P1M A;  3TUO A;  1M4V A;  1WYG A;  1FNU A;  3HVZ A;  2QIE B;  4LK0 M;  3AE8 B;  3NS1 A;  3VRB B;  1GAQ B;  1JWM D;  3BYY B;  1GPX A;  5JXV A;  3MHZ A;  3TEX A;  2MJD A;  2ICI A;  5BMI A;  4ARI A;  3SFD B;  2GRI A;  1C4A A;  4KGR A;  4UDU C;  1JQ4 A;  1YN5 A;  4YSY B;  1QF6 A;  4N58 A;  4WH4 A;  1E6E B;  2LGI A;  5AUK A;  2KDM A;  1ZXH A;  5H8Y E;  1L0V B;  3AE9 B;  1NEK B;  4KKI A;  4RGM A;  2AQ1 B;  1N60 A;  1YJJ A;  5C2T B;  4YSZ B;  1XF5 L;  1QOB A;  1XLP A;  4TQ0 A;  3P4R B;  1SXT A;  2N7J A;  2HDE A;  1P7E A;  3NVY A;  1V1O A;  1V1P B;  3BVM A;  1FRR A;  3Q8E A;  1H7X A;  2WS3 B;  1ZUD 2;  2ZW0 A;  3CWI A;  2YEP F;  3TEZ A;  1J7A A;  4D2K A;  2MJ3 A;  5BMH A;  4FXC A;  2GI9 A;  1ENF A;  1SSN A;  3AE2 B;  3AE4 B;  1TY0 A;  1YNT E;  3PO0 A;  1JWA D;  3NVV A;  5GXG B;  3BZD B;  1E10 A;  3AE7 B;  3AB5 A;  2E3T A;  1I4H A;  1FXA A;  1RFK A;  1N5W A;  1UUP A;  2M0A A;  1B1Z A;  1JRP A;  1NYQ A;  2YEP B;  1B9R A;  1AN8 A;  2G9H D;  1OQQ A;  3IT4 B;  2BS2 B;  2H88 B;  3IAM 1;  2FUG 1;  1GTE A;  2MJE A;  2PVO D;  3MFG A;  2BYT A;  4LLG M;  2I38 A;  2CJN A;  1FCC C;  1I4X A;  1FEH A;  4XDC A;  4WAF A;  1EM7 A;  4YTM B;  2WDV B;  1L0X B;  4WQM A;  3TSS A;  3E56 A;  2IGD A;  5FK9 C;  1FM0 D;  1ZDX A;  4RF0 A;  1MI0 A;  4M0W A;  4MAC A;  2KN4 A;  4WUR A;  5HI1 A;  3ZJU A;  3VR8 B;  2W3R A;  1TS5 A;  4DXG A;  4OZB A;  4LTU A;  4P6V F;  1XEE A;  1CJE A;  3UI3 A;  3AEA B;  2WXG A;  3I9V 1;  1DYQ A;  1HZ5 A;  4C56 C;  2RPV A;  1K53 A;  1AW7 A;  2IDY A;  2DBY A;  4MH8 A;  4MT5 A;  3FC4 A;  4TQ1 A;  2MEK A;  1SIJ A;  3NZ3 A;  5D3I B;  1K50 A;  1ROE A;  1VZ6 A;  3AN1 A;  1D5Z C;  1ET9 A;  3DWG C;  1YQ3 B;  3AMZ A;  3EGR A;  2WXJ A;  3AEB B;  1CZP A;  2LMC A;  4R3D A;  4TMA B;  3P4S B;  4GDL B;  1JW9 D;  1KF6 B;  4JE3 B;  4O1N A;  1YQ4 B;  1T6B X;  1MVK A;  2RDG A;  2N9K A;  2PKO A;  1XLN A;  5G5G A;  3L4P A;  1I4P A;  1P7F A;  1TY2 A;  5H92 C;  5C3J B;  3P4Q B;  1ZP0 B;  5LNK 1;  2WDR B;  4RFB A;  1ZE3 D;  2JZP A;  3NVZ A;  1KLU D;  1N62 A;  4B0M A;  1PGB A;  2J53 A;  1I4G A;  1C78 A;  2RMM A;  1N61 A;  1QLB B;  4WWM A;  1SBB B;  4CQN A;  3VQI A;  2BB5 A;  1R7S A;  3AEF B;  4ZYS A;  3ZYY X;  2AQ3 B;  2J4X A;  1GB4 A;  5HFY A;  1WWT A;  2ONQ A;  1PGA A;  2MH7 A;  1JWB D;  2IGG A;  1KH0 A;  2IGH A;  1SEB D;  1VZ7 A;  5T8I A;  3U4E G;  2N0S B;  4YTP B;  1XO3 A;  2WXO A;  1MPE A;  4ZRP A;  4TSS A;  5HG2 A;  1J7C A;  2Y5C A;  1C4P A;  1JCK B;  1FIQ A;  2WDQ B;  2BT6 A;  4KGT A;  2SEB D;  3KWV A;  3BYT B;  1ACC A;  3I57 A;  3Q69 A;  3R8B A;  2H89 B;  1F2R I;  1FNW A;  2WU5 B;  2V4I B;  1DOY A;  2KQ4 X;  4A55 A;  2JXT A;  4HKZ E;  4OVZ A;  2M19 A;  2WQY B;  4ARC A;  2CJO A;  4PT5 A;  4IKG A;  3R2I A;  1JRO A;  2WXF A;  1SE3 A;  5E6J A;  3O13 A;  2E6X A;  3CIR B;  1L4Z B;  2QEJ C;  2WP9 B;  4US9 A;  2BW2 A;  1PFD A;  3U7Z A;  2EKI A;  2J42 A;  1KRH A;  2K9X A;  3B2F A;  2INN E;  1WXQ A;  4JWU C;  4A90 A;  2QSD A;  1HZ6 A;  5BYR A;  4A9A A;  2N9L A;  3HUI A;  2ZW1 A;  2LUM A;  2WLB A;  2ACZ B;  3P63 A;  3AE3 B;  2PIA A;  3MP9 A;  4OHJ A;  1QOF A;  2LHE A;  4P16 A;  1FNV A;  1IBX B;  2J52 A;  1FRD A;  1QOG A;  1FFU A;  2DLB A;  3LB8 C;  4YXD B;  5EE1 A;  2DYO A;  3BK1 A;  1NEN B;  1HEZ E;  3B9J A;  1JWU D;  1OQR A;  2WXR A;  2LJI A;  1FXI A;  1UNS A;  4NAM A;  5BMG A;  3FIL A;  4IOI E;  4C7Y A;  1KLG D;  1F77 A;  1SE4 A;  3H8H A;  1FD6 A;  5FR3 A;  2WXL A;  2VZK B;  3EUB 2;  2BBC A;  4C7Z A;  2K22 A;  2LHD A;  2Q5W D;  2WXP A;  4GLS C;  2L32 A;  4YSX B;  3CF4 A;  3RPF C;  1GTH A;  2NTS A;  4HJG E;  1K51 A;  3Q8F A;  2WXM A;  1DOI A;  2L1A A;  2WXN A;  4L2Y A;  1YJI A;  4A8X C;  4Q2J A;  1FO4 A;  4YWG G;  4OW0 A;  3Q8B A;  4N59 A;  1XLQ A;  2KMM A;  4DXF A;  1K52 A;  4RF1 A;  2W55 A;  5BYS A;  2PMV A;  4JPS A;  1IBX A;  3W5V B;  1I4R A;  1TJE A;  3R2T A;  4KGS A;  2JYT A;  2Y5P A;  2PW9 A;  4US8 A;  1EWC A;  1VLB A;  2QMT A;  1I7H A;  1UWX A;  3RFZ B;  1CQV A;  3Q8A A;  4RGO S;  3GP7 A;  1L4D B;  2GB1 A;  1GT8 A;  1ESF A;  3W2D A;  1F2R C;  1AYF A;  1CK1 A;  3NUH B;  2TSS A;  1N5X A;  4ZOH C;  1XCT L;  3FAH A;  2LEK A;  1TYG B;  1BUI C;  1XCQ L;  2BB6 A;  4YTN B;  1ZOY B;  1BML C;  4RNA A;  3ZJT A;  2LFI A;  3W1S A;  1C79 A;  1C9F A;  1VR9 A;  3DWM A;  4USA A;  1MHH E;  2INP E;  1STE A;  1WGK A;  1JAL A;  1N63 A;  3SR6 A;  3BVZ A;  3AH7 A;  4J3O D;  4MM3 B;  3AEC B;  1YMH E;  1EU3 A;  3W5U B;  3AEE B;  2DWQ A;  2JSV X;  4NAW B;  1HQR D;  1MHX A;  1NI3 A;  2KWD A;  2K3U A;  5TSS A;  2QJL A;  2K5P A;  3PZ7 A;  4RGN A;  1L6U A;  3V3X A;  1PUT A;  1IGD A;  1YN3 A;  3NVW A;  4OZA A;  4HKQ A;  1EU4 A;  2KAC A;  3SFE B;  4AS1 A;  2B76 B;  2HTM E;  4HRO A;  4JX1 C;  4IDI A;  1L0Y B;  4C80 A;  1C77 A;  1I4Q A;  4ZHO A;  3EA6 A;  1EWY C;  5BYQ A;  1QIL A;  2V3N A;  2W82 A;  1NVI D;  2I2Y A;  2AX5 A;  4L23 A;  5FKA C;  4RGT A;  1XXG A;  1D4B A;  4YT0 B;  1YN4 A;  5MPO A;  1IGC A;  3IXS A;  4EE2 A;  1SF0 A;  1BXT A;  3GS2 A;  2WXI A;  2CU3 A;  4KX6 B;  4REZ A;  1D5X C;  3P4P B;  2JYE A;  3AEG B;  3WCQ A;  1IUE A;  1GOZ A;  2BS3 B;  3FIL B;  3LXF A;  4N6E B;  2JX5 A;  1E7P B;  3SEB A;  3IAS 1;  3KQ4 A;  3AV8 A;  1TS3 A;  2IJ0 A;  2SAK A;  5HHD G;  2QIL A;  4ZRQ A;  1TKY A;  1T3Q A;  4XWT A;  3OWE B;  1E0Z A;  3B2G A;  1TKE A;  2M56 B;  4DQO C;  3HRD D;  2KAJ A;  2OED A;  3KLS X;  3U52 E;  1UWM A;  3ZGZ A;  4RCO A;  1KTK A;  2WU2 B;  2L83 A;  2XNA C;  2WXQ A;  2L52 A;  4WIP A;  5AUI A;  2PTL A;  4ZHP A;  3AED B;  2R61 A;  3P42 A;  1NYR A;  1D6E C;  3BVG A;  2Y3A A;  3VR9 B;  4KKJ A;  3T3N A;  2WXH A;  1E9M A;  1Y56 A;  1HA5 A;  2RDH A;  2W54 A;  3BK2 A;  1D5M C;  2PVG C;  3KWL A;  5D7G A;  5G5H A;  1H7W A;  3URY A;  3TEW A;  1QQR A;  4OZC A;  2OHF A;  5I4D A;  1Q10 A;  1SB3 C;  1JML A;  2DYM A;  1L5P A;  2VZK D;  1UGJ A;  4XE0 A;  1SJE D;  1LO5 D;  1HXY D;  3AE6 B;  3BWU D;  2ON8 A;  1ZXI A;  2FE8 A;  1V8C A;  2BS4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...