3AE1B

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
b'PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae1B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae1B01
1XLQA 3SFDB 3P4QB 1J7BA 1JRPA 1N5XA 1ROEA 3NS1A 2W3RA 3PO0A 5C2TB 2WDRB 5H92C 1E9MA 1NYRA 1SF0A 1N5WA 3AEDB 1VLBA 3AH7A 3AEFB 1QOAA 2E3TA 1QLBB 1V8CA 3SR6A 5AUKA 2PKOA 2MJ3A 3VR8B 3VRAB 1E6EB 2G1EA 3AB5A 1AYFA 1WWTA 1FXIA 3P63A 3B2FA 1E10A 1PUTA 4USAA 1OFFA 2H89B 3NVZA 1FRDA 4LTUA 5EE0A 1GTEA 2B76B 1J7AA 5EE3A 1ZOYB 2LEKA 1FM0D 2K22A 3L4PA 3AMZA 3AE3B 3NRZA 1V97A 4C7YA 2BS2B 1KRHA 2KAJA 1GAQB 2JX5A 1EWYC 2DBYA 2EKIA 3HRDD 3SFEB 1DGJA 1CJEA 1TJEA 1RYJA 3P4SB 2W54A 2PVOD 1NEKB 1JWAD 2W55A 4YT0B 2BS4B 3CIRB 2OHFA 3P1MA 1QF6A 1L6VA 3AECB 2WS3B 1I7HA 1ZUD2 4YSYB 4N59A 3ZYYX 2DWQA 3AE7B 3HUIA 4WWMA 3HVZA 1FMAD 3AEAB 4US8A 1H7WA 4IDIA 1DOXA 1YQ3B 1XLNA 3CWIA 1XLOA 4ZHPA 3NVYA 1FFUA 1YQ4B 1CZPA 2AX5A 1SB3C 1JW9D 3VR9B 1YJIA 1WYGA 1L6UA 2Q5WD 3ABVB 1QT9A 1J7CA 3B9JA 5GXGB 1FIQA 1RWSA 1TYGB 1UWMA 1SIJA 1TKGA 1NYQA 1OQRA 2QJLA 5EE1A 3WCQA 3AE1B 1TKYA 1A70A 3W5UB 3AE8B 1QOBA 4FXCA 2WLBA 3VRBB 1PFDA 1NENB 2MH7A 3BIID 4A9AA 4YTMB 4YSXB 1QOGA 2Y5CA 4YTNB 1E7PB 4YXDB 3AEBB 1VJKA 4N6EB 3AE6B 2FBWB 1JALA 2WQYB 1IUEA 4JX1C 1XLPA 3AM9A 4ZHOA 3AEGB 1FFVA 2MJDA 1N62A 5AUIA 2ACZB 2N0SB 1N63A 1YJJA 1ZXIA 1VDVA 1F0ZA 1JQ4A 2WP9B 3RPFC 2CJNA 2L52A 1R7SA 1RFKA 3DWMA 1QOFA 5G5HA 4YSZB 1N60A 2M56B 1B9RA 3FC4A 2M19A 3LB8C 2KMMA 1JROA 1N61A 3FAHA 1DOYA 2HTME 3LXFA 1GPXA 2MJEA 1RM6C 3AE2B 1JWBD 1DOIA 3DWGC 5H8YE 1KF6B 2BT6A 4YTPB 4N58A 1FO4A 1OQQA 4JWSC 1TKEA 1FXAA 2WDVB 5MPOA 4HROA 1KFYB 1H7XA 4P6VF 1L0VB 3P4PB 3AE4B 3W9CB 4C80A 2WDQB 1AWDA 5C3JB 2CU3A 3AN1A 4KX6B 3ETRA 3AE9B 4JWUC 1NVID 1PDXA 2JQRB 3NVWA 3P4RB 1NI3A 2L83A 2W3SA 1L5PA 1WGKA 3AEEB 1WXQA 4ZOHC 5EE9A 3KWLA 1E0ZA 1WRIA 2K9XA 3W5VB 4US9A 4WQMA 1XO3A 2PVGC 2QIEB 4C7ZA 3EUB2 2WU5B 2WU2B 4ITKA 5G5GA 1GT8A 3B2GA 3NVVA 2H88B 3CF4A 1GTHA 2CJOA 4HRSA 1ZP0B 2PIAA 3AV8A 1FRRA 2BS3B 3AE5B 1T3QA 2K5PA
chains in the Genus database with same CATH superfamily
2KC2A 2EKEC 5H92C 3BZDB 3AEDB 2WX1A 1WY8A 1VLBA 3AEFB 4DXAB 3ZNGC 1FXIA 2A5UA 2L05A 3DQVA 2W9NA 2JWZA 3GS2A 1K8RB 4HKZE 4GU2A 2EELA 2KAJA 2ONQA 3QARA 1BT0A 1T0YA 1KOTA 3TEYA 5IO9A 3QQ8B 2DWQA 1TTNA 3ZKJC 4RF0A 3KVFB 1UH6A 1H7WA 1DOXA 4DDID 2AX5A 2O2VA 1SB3C 5CTRC 1JMLA 1F2RC 1L6UA 1YX6B 3NZSA 4K7WA 1MI0A 3GOEA 3APFA 2DNFA 5L95C 2AQ1B 2BPSA 4NAWB 4LJOB 1I4RA 1NENB 3BIID 2MBHA 4YSXB 1E90A 2N7JA 3BY4B 3AE6B 1JALA 1IUEA 4HDOA 4JE3B 1I42A 2C7NB 2IO0B 4IWQA 4W9EA 3RNFC 3DWMA 1WGRA 5HI1A 3U30A 3FC4A 3A1QB 3H7PA 1WXVA 4MGZE 4N58A 1MFWA 1UBQA 4UDUC 2WXRA 3TIXA 2MP2A 2WXNA 4XYCA 4XDDA 2NR2A 4A55A 1EU3A 4W9GA 3IG3A 4PYUA 1WF9A 2JRHA 4FJYA 3W5VB 3JW0X 2ICIA 4O1NA 2NBWB 1MHXA 2IGHA 4NPNA 3GE3C 2H88B 4RNAA 2IBIB 2M8SA 3ZDTA 4TV3A 3PREA 5G2NA 2KWCA 3EGRA 1WXAA 3PHWB 1N5WA 2C9WB 2KQSA 4XX5A 2KDBA 4ICUA 5J2RA 2QMTA 2KTRA 2OJRA 1HZ6A 1K53A 1DYQA 1ZW7A 4USAA 2ZW1A 2B76B 2ZNVB 1YOVB 1YMHE 3A9KA 1SE4A 2W82A 5J17A 4DDGD 2YEPF 3RZFA 3RUIB 1RYJA 2W54A 4FN2A 1HE8A 5FR6A 5CHFA 2HJ1A 3QHTA 1WM2A 2PW9A 1XD3B 3MC0B 5LNK1 3JVZX 5TR5A 1OTRB 1CZPA 1EM7A 3ZQ4A 3WA0A 3R8BA 4XZ4A 2D3CA 3W5UB 3AE8B 1EO6A 2MH7A 4YTMB 3RYTA 2MLBA 2GBRA 2Y5CA 4TQ1A 5LXIB 2WQYB 2RR9A 3I3TB 5HKHA 1N62A 2LVQA 2LRUA 3IFWB 2WGSA 1ISNA 1VD2A 1B9RA 1IGDA 1XCQL 4FBJB 4HPPA 2A4ZA 2FNJB 3ONSA 2MJEA 3APDA 3AE2B 2CHZA 4QAYA 3DPDA 1FXAA 3PLVA 4HDQA 3PRPB 4NAWA 3AULA 1D5XC 4DQOC 3W9CB 1SE2A 1HQRD 3FKYA 4KIKA 2CHXA 1QKZA 2XNAC 5D3IB 1Q1OA 3B0AA 4ZYSA 3P4RB 5LXHA 2MA9B 1WXMA 4IC7B 1UZXB 1YNTE 2AL3A 3IXSA 4RGOS 4ANWA 2GLSA 4ITKA 1TBEA 2CJOA 2N1WA 2BS3B 2W3SA 3AE5B 3UQBA 1MVKA 3N1XC 3SFDB 2N4FA 3W1YA 1P98A 1E5WA 4BVUC 1CMXB 1SSNA 3ZXVA 3P63A 5EE0A 3RT3B 4M8MA 3EHVA 3AE3B 5DPRA 5IAAC 2BS2B 1MPEA 1C1YB 3HRDD 2KJ6A 5FKAC 1Q10A 1NEKB 3DVNU 1I7HA 1UF0A 5JH5C 5CHVC 4EKUA 2BB5A 4RF1A 5HHDG 3LYYA 3NVYA 1I4GA 1WJ6A 2KC1A 5BMIA 3BVZA 3DBLB 3L08A 3DBLI 2LGYA 2I1KA 4L1BA 1ENFA 2JRIB 3Q3FA 2LXCA 2MBOA 3H9DA 1QOGA 3L16A 2VH1A 2DYBA 1B1ZA 1M4VA 1WGYA 2N7EA 1XLPA 2AWTA 2K39A 2LGIA 4LNFA 4GDLB 2LI5A 2YEPB 1UGJA 2AYOB 4WURA 4AUQC 4NQLB 3VUYA 4G3XB 4DK5A 2LJ5A 3W2DA 3IAM1 2FIDA 3VUXA 1L4ZB 1KFYB 4RM9A 5DCNA 3T3NA 1AWDA 3N9YC 1WGGA 2AQ2B 1LQBA 3PLUA 1NI3A 2Z0EB 4K7SA 1WXQA 4P1BC 3VTVA 3MFGA 2KQ7A 1GT8A 3B2GA 4C4VB 3TBLD 1JRUA 1WIAA 2WYQA 1HZ5A 1WRDB 1WGHA 3M3JA 2N9XA 2QSDA 4IM2A 1I4QA 2KVZA 1ZDVA 1QOAA 3APCA 2NBVB 2LHEA 4PS7A 1E6EB 1TY0A 2Y5BB 2J52A 3MC8A 3VVWB 4E74A 3R66C 4WIPA 3E9SA 2KO3A 2ZPNA 1KLVA 1YN3A 3AMZA 3NRZA 3A33B 2J4XA 4XGAB 4GLSC 1YQBA 5CX3A 2D3AA 4ZYNA 3UGBB 1ZDXA 2BWES 3ZO5B 5J18A 1ACCA 1C4AA 3L10B 4AQ7A 5HG2A 4KDIC 3PT2B 3DBSA 5AZGA 4HLEA 1WM3A 2BYVE 2Q5WD 3ABVB 1FNUA 1D5MC 1NYQA 4WJNA 3PGEA 1QOBA 4EZLA 4A9AA 2BKFA 3QAQA 4BBNC 4HJKA 2FBWB 2KOXA 5JHBA 1J19A 2MW5A 1YJJA 2L52A 1R7SA 1RFKA 5KHQA 3KUCB 1WX7A 2M19A 1I4HA 4EFOA 4OZAA 3Q8CA 4E3CA 4FADA 2HD5B 3IHPC 2EMTA 2LMCA 3EFCA 2R2OA 1L0XB 1OQQA 2C60A 2J0JA 4IKGA 2GBKA 5DPTA 2ZW0A 1K51A 4BOZB 3DHIC 2KHWB 2BQQA 3DBRB 2LVOA 1L5PA 2INCC 3NUHB 1R4NB 4HXDA 2JUOA 1R4NI 5G5GA 2AL6A 2KFJA 1QZEA 4JGHB 4EUTA 2IO3B 3QK0A 2W3RA 3UF8A 1IGCA 1ET6A 2XK5A 4RGTA 2MJ3A 1WH3A 4OHJA 3JSVB 5EE3A 4G50A 1FM0D 3ZTDA 4CQNA 1MG8A 2J53A 4C4VA 4ZRIA 1EUVB 2PVOD 3AU5A 1XEEA 3U2SC 2K0PA 1JCKB 2O2VB 3QX1A 2DZMA 2TSSA 3ML9A 4LNKA 2DLBA 2WXKA 4S17A 4P7IA 2CU1A 2KLGA 4TQ0A 4EZKA 1UWMA 3VHTC 3OJ4B 1SIJA 2KZRA 1OQRA 2LGXA 1TKYA 3KYDD 1PFDA 2DYMA 4CYEA 3K9PB 3WANA 4YTNB 1HEZE 3IBEA 2ASQA 4PYZA 4LLGM 2DHZA 2KQ4X 3RPFC 3H7PB 3T3OA 1JROA 4AS1A 2NPTA 1E8YA 2UYZB 1J0GA 3OJ3A 1K50A 2MP2B 1LGRA 3PSEB 4HPLB 1PYWD 4II2B 1P7EA 4WWOA 4JWUC 1NVID 3SDLC 2JYTA 2JVCA 2IY0B 2K9XA 2WU2B 3IT6B 2RDGA 3ML8A 3AV8A 2J42A 2PE9A 3PO0A 2G9HD 4MSQB 2JF5A 1NYRA 3B1LX 2INPE 3KUZA 1Z5SB 1V8CA 3MJWA 2KTRB 2L76A 3R3MA 5HFYA 2DZJA 5C23A 3EC8A 4KV2A 2LXAA 4LTUA 1XQQA 2IYDB 3A9KB 2KK8A 2KDIA 3K9OB 2SEBD 4HK2A 2JX5A 4XE0A 2EKIA 2KX0A 5D3DA 1JWAD 2KFKB 4W9HA 4N59A 1ET9A 3ZJUA 4RCOA 4IDIA 3R2IA 1XLNA 1UGMA 3ZNHB 3ZIMA 5DPSA 3ZJTA 2V9HA 3JSVA 1V1PB 2KDFB 3QJZA 2MX2A 1UBIA 2LFIA 2KYWA 1VRAB 1PGBA 1C4CA 4BOSC 5T8IA 4BKSD 2O6VB 4MM3A 4LDTB 4YXDB 3AEBB 1VZ8A 3MP9A 3Q8AA 3B08A 1GUAB 4A6QA 4I6PA 4W9IA 2N0SB 2LASA 1F0ZA 2V0GA 1WI0A 4YSZB 3Q3OC 1N61A 5JZEB 1DOYA 2GRIA 4M01A 3L54A 5MPOA 3Q69A 4E71A 4P6VF 1ZXHA 3WAOA 3ZUNA 2D11A 4G0NB 4KIKB 3AN1A 1GB1A 3NVWA 1RAXA 2BKRB 4L23A 4FLHA 4WQMA 5FK9C 3CMMB 3Q8EA 2DYOA 2QDFA 4MH0E 1XCTL 5BO4B 1XLQA 3Q6BA 1N5XA 3DHGC 3NS1A 1KM7A 2ZEQA 3L0WB 3UI3A 4JQWC 2FCMA 2JZZA 2DAFA 1V80A 3ZDMC 3Q8BA 1MJDA 1FRDA 3RNEC 2V4IB 2JWUA 3R2TA 1WMHB 1TJEA 1G6JA 1TIFA 4A8XC 4YT0B 4MEMA 3CIRB 3H6NA 3P1MA 1L6VA 4F7ZA 2BWFA 4RH6A 1P3QU 3HVZA 1EWCA 2KKCA 3TL5A 3QWZB 3VR9B 1C4PA 2N9KA 2DX5B 2K1FA 1J7CA 2IGGA 2KJRA 3M63B 4A90A 2NS5A 2MHJA 2JZPA 4WWNA 3TJPA 3Q3NC 2LRWA 2OEDA 5E6JA 2R61A 4I6NB 3VH3B 2KFKA 4KSLC 4WJOA 1TS5A 1LFDA 1SEBD 3KH0A 4M00A 3RN9C 1OEYJ 1ZXIA 2IO1B 3HVDA 4B0MA 1N60A 4B0EA 2D3BA 1V1PA 2RD0A 2WXJA 1F1HA 2C5LC 3AE4B 2O6VA 1E8ZA 2WDQB 3PZDA 3BYYB 2KT7A 3PPAA 2PTLA 1GC6A 4GDKA 4KKIA 1JWUD 2HJ8A 2FCQA 2JZ3B 3MHSD 1WX9A 1SE3A 4LCDE 1Z2MA 4HCNB 4M8NA 4PT5A 4FJZA 3KUDB 5G55A 2E3TA 2PLPA 4BKGA 3RFZB 3A4SC 3B2FA 4A3OA 3NS8A 1E10A 4GXBA 1JWSD 4C7YA 3V6EB 4KGTA 2FCNA 1C9FA 3SFEB 1YX5B 1D4BA 3ECIA 4WJQA 1RLFA 5IOIA 1C78A 3WAPA 3PHXB 2BVCA 2WXPA 2CS4A 4LJPB 1E7VA 3Q14C 4LDTD 2L00B 2EMSA 3GE8C 3ENEA 1EF5A 2OJWA 4DHZE 4FXCA 2ZZPB 3PV1A 3LDZE 1WMHA 4OVZA 2YVCA 3I57A 3RCZA 5E6OA 1E7PB 4AP4C 4MELA 4W9DA 2WDTB 4RFBA 2LHDA 1WJNA 2M56B 1TT5B 1TZ1A 3DOWA 5H8YE 2BT6A 4JWSC 1FD6A 3OAWA 3P4PB 1V1OA 4K3CA 2KMAA 2V1YA 3NZUA 5C3JB 3ETRA 4RMAA 4NQKE 4JPSA 4B9KA 1WGKA 3AEEB 1YIWA 2FAZA 2IZVB 2YLMA 3U7ZA 1C79A 2ZCBA 1LO5D 1R4MB 1R4MI 1UD7A 4HRSA 4FA6A 1JRPA 4DXFA 2XK5B 3ZW3A 2HTHA 2PEAA 3Q8FA 4BFRA 5E6NA 2PKOA 3VR8B 2G1EA 2Y3AA 2KDMA 2QCZA 2L0TA 2N1VA 1EU4A 4IM3A 2C7MB 1KRHA 1FEHA 1GAQB 2MCNB 1F2RI 4GMVA 3P4SB 3J9CA 2RPVA 2K6DB 1D5ZC 2KWUB 2K8CA 1V86A 1MHHE 2I2YA 2D07B 4OVVA 2J0MA 4NJCA 3I63C 1T5XD 4OZCA 2WXGA 1WYGA 5IKCM 2D10A 4FJVB 1Q5WB 4ZRPA 3A4RA 1TYGB 3DVNV 4XDCA 3UIPB 1L7YA 3AE1B 1PQSA 3BK2A 3QA8A 2WLBA 3QC8B 1SGHA 1GC7A 4KGRA 2NCNA 5I4DA 1L4DB 5AUIA 1KLUD 5JXVA 1WYWB 3NOBA 3ZTCA 3HM6X 4K7UA 2BGFA 2RGFA 4AJWA 1UNSA 2ZPYA 3KW5B 2NPTB 4WWPA 1L0VB 1RRBA 1WXSA 4GIVA 4HWIB 3VH4B 1KTKA 5IP4D 2JPHA 1WZ3A 4LK0M 1F52A 1SE9A 3KWLA 3RZWC 2I38A 1STEA 4LNNA 1HTOA 2JXTA 2SAKA 2IPKD 1OGWA 1A5RA 2KNBA 2GI9A 1V6EA 4EE2A 3W1SC 3VFKA 3M95A 3PRZA 2NTTA 3R7RA 1J7BA 2VRRB 4ACFA 2KMCA 2VZKB 5AUKA 3U7DA 2M1MA 1WWTA 4HCPB 1PUTA 3D32A 4MT5A 4W9KA 3DBRI 2M0XA 3DVGY 1GTEA 4DXGA 1TZOA 4J3OD 1E7UA 1WJ4A 4GOCA 1F9JA 2K22A 3MHZA 2KN5A 1JWMD 3TUOA 1I4XA 1VZ6A 3QCAA 2CHWA 3RI7C 2W55A 4JLCA 2INNE 3FILA 1E8XA 1TS3A 4TSSA 1BUIC 4ZRJA 2ZNVC 2XN9C 3C19A 3TMPB 4S0RA 4YWGG 2BF8B 2L3ZA 5D94A 3VTUA 3NY5A 1TS4A 1V5OA 2Z8LA 1P9DU 2BYTA 1N6ZA 4W9FA 4MM3B 2WXOA 5EDSA 2NTSA 3SD5A 4C00A 1T0SC 4IG7B 2KJHB 1ZE3D 4A3PA 1KJTA 2JU6X 2CJNA 1UELA 1NI2A 5AZFA 2N9EB 4ANVA 3V61A 3IAS1 3URYA 3TEZA 4NNJB 1V9JA 3Q2AC 4HEA1 3TCAA 4C80A 2CU3A 3RNAC 1PGAA 4W9LA 2K8BA 4TKNA 2X38A 2FUHB 2INDC 2IGDA 3U52E 1AW7A 2KDEB 2IY1B 3EA6A 3DDCB 3TEXA 3CF4A 1AARA 2NMQA 2PIAA 1FNVA 3P4QB 3LJ3A 2G45B 2XEWA 3WAMA 3C8YA 3H8HA 2QHOA 4IM0A 3N32A 1GG3A 2KVRA 2GBJA 1AYFA 2DAJA 3NVZA 2FCSA 1J7AA 3ZLZA 3ALBA 2JSVX 3P2BA 1V97A 2C7HA 2L1AA 2FE8A 2N9PC 3BVMA 2DBYA 1CJEA 1E8WA 2UU7A 3O65B 4ASWC 2BS4B 1WE6A 1YN4A 1WFYA 4NJ6A 1C76A 3AEAB 5D7GA 2BYEA 2UWQA 4FHJA 2L32A 2MRPA 3NJTA 4Q2JA 1YJIA 4K1RB 3DHHC 4XWTA 5GXGB 1RWSA 1T0RC 5IN7A 2BBCA 2QJLA 3I5JC 3AI5A 3WCQA 3HK0A 3O13A 1WE7A 1WR1A 3HHMA 3TEWA 1XXGA 1BMLC 5BMGA 3DVGX 1RFAA 4URKA 2WHIA 2G4DB 4NJ7A 1TY2A 2ACZB 4FULA 4MGKE 1J8CA 5G5HA 2DENB 2XBBC 2R2QA 4DBGA 2HTME 1GPXA 2V3NA 1KF6B 1TKEA 2CKHB 1H7XA 1WZ0A 2NBUA 1UUPA 4NAMA 3NHEB 1EF1A 1TGZB 2KACA 3OG5A 1XO3A 4C7ZA 3EUB2 4GDKB 1OQYA 3RNGC 4HVBA 2G3QB 4GGQA 3ZRFA 1PGXA 1V81A 2VZKD 4M0WA 1ROEA 4X57B 3L13A 1SBBB 4H2AA 3PZ7A 3KYCD 2G4SA 3VRAB 3AB5A 1HXYD 3DCGA 5BYRA 2J0KA 2GB1A 4HJGE 1SIFA 3L4PA 4XC2A 2KWVB 3VTWA 1CQVA 1YD8U 3BK1A 3U4EG 1Y8RC 3AXCA 1IBXB 1GNUA 1DGJA 4MJSA 3X0WA 4LNOA 3RD2A 4TUUA 3A9JA 2LJIA 1S3SG 3N1YC 1YQ3B 3VDZA 2JYEA 2HE7A 1P1AA 2LGSA 1HTQA 2LD9A 2CR5A 2Y5PA 2ZVOA 3KLSX 2K3UA 2RDHA 5D2MB 4KZCA 5EE1A 4YL8A 1A70A 2N7DA 1HA5A 3RNBC 3N20C 1LXDA 4JX1C 1IP9A 4PS3A 1ESFA 2L7RA 2M0AA 3MC9A 4WAFA 3EECA 2KTFA 4L2YA 1YN5A 5CHWA 4EOYA 5L83A 4FHKA 1RM6C 4II3B 1L0YB 1DOIA 2WXFA 3DWGC 3T8MA 3E56A 3SHQA 4HROA 3UIOB 4MGYE 4J6IA 3WALA 2IJ0A 3AE9B 4TMAB 1S1QB 3ZNID 2B3AA 5KHOA 2QIEB 1XF5L 4CHKA 2BB6A 2IO2B 3NVVA 3PZ8A 4CO7A 1H8CA 2REXA 1T3QA 4WWMA 2MBBB 2K5PA 5GMVA 4B95A 2WDRB 4IWOA 3T9LA 4P16A 1FCLA 3VQIA 1OFFA 3IVFA 4JL9A 1ZOYB 4RGMA 2BYFA 4IOIE 2DZIA 1WSPA 2GBMA 4K81A 2D2QA 3Q3JA 2OHFA 4DHJB 3U8ZA 1ZUD2 4PK1A 2PE6B 3L17A 1ZPSA 3TSSA 4ANUA 4RM8A 2J7QB 2X8XX 2E6XA 1FCCC 1FNWA 2IDYA 3ZGZA 1FIQA 2ZJDA 1TKGA 1D3ZA 4IUMB 4WH4A 1IBXA 2D5GA 2RSUA 1H4RA 4ZHOA 3R7QA 4ARIA 1N63A 4JIOU 1VDVA 1SXTA 3BVGA 4AJYB 1VR9A 2K8HA 1XT9B 2O6VD 1GOZA 3H7SA 3FAHA 3A1QA 3LXFA 3H1UA 3W1SA 4YTPB 4GN1A 2N9LA 2BW2A 1KLGD 3RMKC 3IT4B 2LZ6A 2JQRB 4AOFA 3ZJVA 4W9JA 3VAWA 1VCBA 2GOWA 2KD0A 2LUEA 4MSMB 4US9A 4I6LB 3PS6A 1Q0WB 2HDEA 3MTNB 1GTHA 1Y56A 4DHZB 4ZRQA 3V6CB 3KWVA 3V05A 1I35A 4KSKC 2LVPA 1WGDA 1E9MA 5BYQA 2QILA 1SJED 1V49A 1QLBB 4WQOB 2H89B 3M62B 1NBFC 4WJPA 4PS8A 2KANA 4W9CA 3X23A 4G11A 4K3BA 1T6BX 1M94A 5TSSA 3ZXRA 3HUIA 3FILB 4IW0A 2RMMA 1FMAD 3NZ3A 3VXWA 3CWIA 4ZHPA 1YQ4B 1JW9D 2JY6A 1ZGUB 4MDKE 4RGNA 3BINA 3RULA 2KXJA 2MBEA 3VUWA 1KH0A 4BZAA 1VJKA 4GB9A 3AEGB 1FFVA 2V4LA 4DWFA 1JQ4A 2L8JA 1WR6E 2PMVA 4P1CC 2KMMA 2K6QA 2WXQA 2Z59B 3I9V1 3OWEB 1T0QC 4ICVA 1K52A 4NZLB 4EEWA 4KVGB 3GP7A 4KX6B 1F77A 4OVUA 2D3GA 1IPGA 3ZVVA 1QILA 4ZOHC 5EE9A 4KDLB 2K25A 1WRIA 3V60A 5LLIA 2FIFA 4MACA 3ZRCA 2DZKA 2KWDA 1I4PA 2GMIC 5C2TB 3ZNZB 1SF0A 4F1SA 2KN4A 3PVLA 5DPWA 1FXTB 4KZ0A 2QEJC 3HM3A 2JXXA 5FR3A 3GZNB 1BXTA 2LGDA 2AEHA 3GZNI 1C77A 2KX3A 1FPYA 4DHJD 2NVUI 2MWSB 1ZKHA 3CSFA 4KKJA 4M02A 1QF6A 2WNMA 5JHAA 3ZYYX 2MSED 2M17A 3KQ4A 4US8A 4NY0A 3N1ZC 4MGIE 3NG0A 2L0FA 3AU4A 3Q3MC 3UQAA 1OEYA 5C1ZA 1LM8B 2KLCA 1AN8A 3VRBB 4ARCA 4ANXA 2ZCCA 1D6EC 2RDBC 4N6EB 4HKQA 1NDDA 2Z0DB 3AM9A 2MJDA 3RNCC 4KGSA 2JT4B 3DBHB 1VZ7A 4GDLA 3DBHI 1IYFA 3N30A 1V5TA 1WJUA 1U4AA 1TS2A 1JWBD 3BYTB 1FO4A 1QQRA 2V3SA 2WDVB 1CK1A 2LUMA 3HIZA 4R3DA 2V3PA 4OZBA 3PTFC 2L83A 3CSTA 1E0ZA 2RPQA 4HPMB 5D6JB 2BTEA 2MEKA 1ZP0B 1FRRA 2PVGC 4M0WB 3S2AA 3CF6E 2ZVNA 1X1MA 2WXMA 3V62A 3GB1A 1P7FA 3AH7A 3SR6A 2WXIA 1L2NA 4A20A 1C3TA 3EFUA 3P42A 2LEKA 4LNIA 4BBNF 2VH2A 2FUG1 4IWPA 1EWYC 2PJHA 2WXLA 4REZA 4MJSB 4BKTA 1UWXA 2I1JA 3AECB 3A9JB 2WS3B 3QIJA 4WAAA 4YSYB 3AE7B 4F8CB 4XWWA 1XLOA 3N3KB 1FFUA 4ZRKA 2GBNA 3C0RB 1WX8A 2QC8A 2PPHA 1SJHD 1QT9A 3B9JA 3V3XA 3SEBA 3SU8X 4D2KA 4OW0A 2OOBB 2ON8A 1GB4A 3MJ5A 3JYUA 1GJZA 3UINB 2LWPA 3OLMD 2WX0A 1P0RA 4BKSA 2WP9B 5E6PA 1V2YA 1QOFA 5BYSA 5IA7A 2MQJA 1MG4A 4AWJA 3PRMB 3LB8C 4MH8A 4ZDVA 2WXHA 4GSWA 2WWZA 5AEKB 4EZJA 5AZHA 1PDXA 1YJ1A 2AQ3B 2M4NA 4N9F4 3WIMA 3BWUD 4BAXA 4C56C 5BMHA 2WU5B 2MBQA 4B6WA
chains in the Genus database with same CATH topology
1JRPA 2W3RA 4DXFA 2WDRB 5H92C 1IGCA 1ET6A 3BZDB 3Q8FA 3AEDB 1VLBA 3AEFB 4P16A 2PKOA 2MJ3A 4RGTA 3VR8B 2G1EA 1FCLA 2Y3AA 3VQIA 1FXIA 2KDMA 1OFFA 4OHJA 5EE3A 1ZOYB 4RGMA 1EU4A 1FM0D 4IOIE 4CQNA 3GS2A 1KRHA 4HKZE 2EELA 2KAJA 1FEHA 2ONQA 1GAQB 1WSPA 1F2RI 2J53A 3TEYA 3P4SB 2PVOD 3J9CA 2OHFA 2RPVA 1XEEA 1ZUD2 1D5ZC 3U2SC 2DWQA 4RF0A 2K0PA 1MHHE 1H7WA 2I2YA 1DOXA 1ZPSA 3TSSA 1JCKB 2AX5A 4NJCA 1T5XD 1SB3C 2E6XA 4OZCA 1FCCC 1JMLA 1F2RC 1WYGA 2TSSA 1L6UA 2DLBA 2WXKA 2WXGA 1FNWA 4ZRPA 2IDYA 4TQ0A 3ZGZA 1FIQA 1MI0A 1TYGB 1UWMA 1SIJA 4XDCA 2AQ1B 1TKGA 1OQRA 4NAWB 3AE1B 1TKYA 3BK2A 4WH4A 2WLBA 1IBXA 1I4RA 1PFDA 1NENB 2D5GA 2DYMA 3BIID 4YSXB 4KGRA 4YTNB 1HEZE 2N7JA 5I4DA 3AE6B 1JALA 1IUEA 1L4DB 4ZHOA 5AUIA 4JE3B 4LLGM 1KLUD 2KQ4X 4ARIA 1N63A 5JXVA 1VDVA 1SXTA 3RPFC 3BVGA 3DWMA 1VR9A 5HI1A 3FC4A 3T3OA 1JROA 1GOZA 3FAHA 3LXFA 1UNSA 3W1SA 4N58A 4YTPB 4UDUC 4AS1A 1K50A 2WXRA 1L0VB 2N9LA 2WXNA 1PYWD 2BW2A 1P7EA 4XDDA 1KLGD 1EU3A 4A55A 3IT4B 4JWUC 1KTKA 1NVID 2JQRB 3ZJVA 2JYTA 4LK0M 3KWLA 3W5VB 2K9XA 2I38A 4US9A 1STEA 2ICIA 2JXTA 2SAKA 4O1NA 2IPKD 2WU2B 2GI9A 1MHXA 2IGHA 4EE2A 2HDEA 2H88B 3IT6B 1GTHA 2RDGA 4RNAA 3AV8A 2J42A 1Y56A 2NTTA 4ZRQA 1J7BA 3KWVA 3V05A 3PO0A 2G9HD 1E9MA 1NYRA 3EGRA 2QILA 5BYQA 1N5WA 1SJED 2INPE 1QLBB 1V8CA 2VZKB 5AUKA 2QMTA 5HFYA 1HZ6A 1K53A 1WWTA 1DYQA 1PUTA 4MT5A 4USAA 2H89B 4LTUA 2ZW1A 1GTEA 2B76B 4DXGA 1TZOA 4J3OD 2K22A 1YMHE 3MHZA 1SE4A 1JWMD 2SEBD 2W82A 3TUOA 2JX5A 1I4XA 4XE0A 1VZ6A 2YEPF 2EKIA 5D3DA 1T6BX 5TSSA 1RYJA 2W54A 1JWAD 2W55A 4N59A 1ET9A 2PW9A 3HUIA 3FILB 2RMMA 1FMAD 2INNE 3FILA 3MC0B 3NZ3A 4RCOA 4IDIA 1TS3A 4TSSA 5LNK1 1BUIC 3R2IA 1XLNA 3CWIA 4ZHPA 1YQ4B 1CZPA 1EM7A 1JW9D 3ZJTA 3ZJUA 2XN9C 3ZQ4A 1V1PB 4YWGG 4RGNA 2LFIA 3R8BA 1VRAB 1PGBA 1TS4A 1C4CA 2Z8LA 5T8IA 3W5UB 2BYTA 3AE8B 4MM3B 2WXOA 2MH7A 1KH0A 2NTSA 4YTMB 2Y5CA 4TQ1A 1VJKA 4YXDB 3AEBB 1VZ8A 3MP9A 3Q8AA 2WQYB 3AEGB 1FFVA 1ZE3D 1N62A 4A6QA 2N0SB 1F0ZA 1JQ4A 2JU6X 2CJNA 2V0GA 4YSZB 1B9RA 1IGDA 1XCQL 2PMVA 2KMMA 1N61A 1DOYA 2GRIA 2WXQA 2MJEA 3AE2B 3I9V1 3IAS1 3OWEB 3URYA 3TEZA 5MPOA 1FXAA 3Q69A 1K52A 4P6VF 4NZLB 1D5XC 1ZXHA 4DQOC 4HEA1 3GP7A 3W9CB 1SE2A 4C80A 1HQRD 2CU3A 3AN1A 4KX6B 1F77A 1GB1A 2XNAC 1QKZA 5D3IB 1PGAA 3NVWA 4ZYSA 3P4RB 1QILA 4L23A 2X38A 4ZOHC 5EE9A 1WRIA 2IGDA 3U52E 1AW7A 4WQMA 5FK9C 1YNTE 3IXSA 4RGOS 3Q8EA 3EA6A 4ITKA 4MACA 2DYOA 3TEXA 3CF4A 2CJOA 2KWDA 2NMQA 1XCTL 2PIAA 2BS3B 2W3SA 3AE5B 1MVKA 1XLQA 1FNVA 3SFDB 3P4QB 1N5XA 3NS1A 1I4PA 5C2TB 3C8YA 3UI3A 3H8HA 1SF0A 2KN4A 1SSNA 1AYFA 3P63A 2QEJC 3Q8BA 3NVZA 1FRDA 5EE0A 5FR3A 1J7AA 2V4IB 1BXTA 3AE3B 2JSVX 1C77A 1V97A 2BS2B 1MPEA 2JWUA 2L1AA 3R2TA 2FE8A 3BVMA 2DBYA 3HRDD 4KKJA 5FKAC 1CJEA 1TJEA 1Q10A 1NEKB 4A8XC 4YT0B 2BS4B 3CIRB 1QF6A 3P1MA 1L6VA 2WNMA 1YN4A 1I7HA 3ZYYX 4RH6A 1C76A 3HVZA 3KQ4A 3AEAB 1EWCA 2BB5A 4RF1A 5D7GA 4US8A 5HHDG 2L32A 3LYYA 3NVYA 4Q2JA 1I4GA 3VR9B 1C4PA 1YJIA 2N9KA 5BMIA 3BVZA 1J7CA 4XWTA 5GXGB 1RWSA 2IGGA 4A90A 4L1BA 1ENFA 2BBCA 2QJLA 3WCQA 2JZPA 3O13A 1AN8A 3VRBB 3TEWA 1XXGA 1BMLC 1QOGA 2OEDA 5E6JA 5BMGA 4ARCA 2R61A 1D6EC 1B1ZA 4N6EB 4HKQA 1M4VA 1TS5A 1XLPA 3AM9A 1SEBD 1TY2A 2MJDA 2ACZB 1ZXIA 4KGSA 2LGIA 4GDLB 3HVDA 2YEPB 1VZ7A 5G5HA 4B0MA 1N60A 1UGJA 4WURA 4B0EA 2HTME 1V1PA 1GPXA 2WXJA 1TS2A 1JWBD 2V3NA 3BYTB 1KF6B 1FO4A 1QQRA 3W2DA 1TKEA 3IAM1 2WDVB 1CK1A 1L4ZB 1KFYB 1H7XA 2LUMA 3AE4B 3T3NA 2WDQB 1AWDA 4R3DA 1UUPA 3N9YC 4NAMA 3BYYB 2V3PA 2AQ2B 4OZBA 1NI3A 2L83A 1WXQA 2KACA 1E0ZA 2PTLA 1XO3A 4C7ZA 3EUB2 3MFGA 4GDKB 1GT8A 1JWUD 2MEKA 3B2GA 4KKIA 2BTEA 1ZP0B 1FRRA 1PGXA 2PVGC 2VZKD 1HZ5A 4M0WA 1ROEA 1SE3A 1SBBB 4H2AA 2QSDA 3PZ7A 4PT5A 2WXMA 1I4QA 1ZDVA 1P7FA 3GB1A 3AH7A 1QOAA 2E3TA 2WXIA 2LHEA 2PLPA 3SR6A 3VRAB 1E6EB 1TY0A 3AB5A 1HXYD 2J52A 3RFZB 3B2FA 1E10A 5BYRA 4WIPA 3P42A 3E9SA 2GB1A 4HJGE 2LEKA 3L4PA 1YN3A 3AMZA 3NRZA 1JWSD 4C7YA 1CQVA 2J4XA 2FUG1 3BK1A 3U4EG 4KGTA 4GLSC 1EWYC 2WXLA 4REZA 1C9FA 1IBXB 3SFEB 1DGJA 1D4BA 1ZDXA 1UWXA 3AECB 2WS3B 4YSYB 3AE7B 1ACCA 4WWMA 2LJIA 1C4AA 1C78A 1YQ3B 4XWWA 4AQ7A 1XLOA 1FFUA 2JYEA 5HG2A 2WXPA 2Q5WD 1SJHD 3ABVB 1QT9A 1FNUA 3B9JA 3V3XA 2Y5PA 1D5MC 3KLSX 2K3UA 3SEBA 2RDHA 1NYQA 5EE1A 4D2KA 4OW0A 1A70A 1QOBA 4FXCA 2ON8A 1GB4A 3MJ5A 4A9AA 4OVZA 1HA5A 3I57A 1E7PB 2FBWB 4JX1C 1ESFA 4RFBA 2M0AA 1YJJA 2WP9B 2LHDA 2L52A 4WAFA 1R7SA 1RFKA 1QOFA 5BYSA 2M56B 4L2YA 2M19A 3LB8C 1I4HA 1YN5A 4MH8A 3Q8CA 4OZAA 2WXHA 1RM6C 1L0YB 1DOIA 2LMCA 2WXFA 3DWGC 2BT6A 5H8YE 1L0XB 1OQQA 4JWSC 4IKGA 3E56A 4HROA 1FD6A 3P4PB 1V1OA 2IJ0A 2ZW0A 5C3JB 1K51A 3ETRA 3AE9B 1PDXA 4TMAB 4JPSA 1L5PA 1WGKA 3AEEB 2AQ3B 3BWUD 3NUHB 3U7ZA 4C56C 1C79A 2QIEB 5BMHA 1LO5D 1XF5L 2WU5B 5G5GA 2BB6A 3NVVA 3PZ8A 4HRSA 1T3QA 2K5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XLQ A;  3SFD B;  3P4Q B;  1J7B A;  1JRP A;  1N5X A;  1ROE A;  3NS1 A;  2W3R A;  3PO0 A;  5C2T B;  2WDR B;  5H92 C;  1E9M A;  1NYR A;  1SF0 A;  1N5W A;  3AED B;  1VLB A;  3AH7 A;  3AEF B;  1QOA A;  2E3T A;  1QLB B;  1V8C A;  3SR6 A;  5AUK A;  2PKO A;  2MJ3 A;  3VR8 B;  3VRA B;  1E6E B;  2G1E A;  3AB5 A;  1AYF A;  1WWT A;  1FXI A;  3P63 A;  3B2F A;  1E10 A;  1PUT A;  4USA A;  1OFF A;  2H89 B;  3NVZ A;  1FRD A;  4LTU A;  5EE0 A;  1GTE A;  2B76 B;  1J7A A;  5EE3 A;  1ZOY B;  2LEK A;  1FM0 D;  2K22 A;  3L4P A;  3AMZ A;  3AE3 B;  3NRZ A;  1V97 A;  4C7Y A;  2BS2 B;  1KRH A;  2KAJ A;  1GAQ B;  2JX5 A;  1EWY C;  2DBY A;  2EKI A;  3HRD D;  3SFE B;  1DGJ A;  1CJE A;  1TJE A;  1RYJ A;  3P4S B;  2W54 A;  2PVO D;  1NEK B;  1JWA D;  2W55 A;  4YT0 B;  2BS4 B;  3CIR B;  2OHF A;  3P1M A;  1QF6 A;  1L6V A;  3AEC B;  2WS3 B;  1I7H A;  1ZUD 2;  4YSY B;  4N59 A;  3ZYY X;  2DWQ A;  3AE7 B;  3HUI A;  4WWM A;  3HVZ A;  1FMA D;  3AEA B;  4US8 A;  1H7W A;  4IDI A;  1DOX A;  1YQ3 B;  1XLN A;  3CWI A;  1XLO A;  4ZHP A;  3NVY A;  1FFU A;  1YQ4 B;  1CZP A;  2AX5 A;  1SB3 C;  1JW9 D;  3VR9 B;  1YJI A;  1WYG A;  1L6U A;  2Q5W D;  3ABV B;  1QT9 A;  1J7C A;  3B9J A;  5GXG B;  1FIQ A;  1RWS A;  1TYG B;  1UWM A;  1SIJ A;  1TKG A;  1NYQ A;  1OQR A;  2QJL A;  5EE1 A;  3WCQ A;  3AE1 B;  1TKY A;  1A70 A;  3W5U B;  3AE8 B;  1QOB A;  4FXC A;  2WLB A;  3VRB B;  1PFD A;  1NEN B;  2MH7 A;  3BII D;  4A9A A;  4YTM B;  4YSX B;  1QOG A;  2Y5C A;  4YTN B;  1E7P B;  4YXD B;  3AEB B;  1VJK A;  4N6E B;  3AE6 B;  2FBW B;  1JAL A;  2WQY B;  1IUE A;  4JX1 C;  1XLP A;  3AM9 A;  4ZHO A;  3AEG B;  1FFV A;  2MJD A;  1N62 A;  5AUI A;  2ACZ B;  2N0S B;  1N63 A;  1YJJ A;  1ZXI A;  1VDV A;  1F0Z A;  1JQ4 A;  2WP9 B;  3RPF C;  2CJN A;  2L52 A;  1R7S A;  1RFK A;  3DWM A;  1QOF A;  5G5H A;  4YSZ B;  1N60 A;  2M56 B;  1B9R A;  3FC4 A;  2M19 A;  3LB8 C;  2KMM A;  1JRO A;  1N61 A;  3FAH A;  1DOY A;  2HTM E;  3LXF A;  1GPX A;  2MJE A;  1RM6 C;  3AE2 B;  1JWB D;  1DOI A;  3DWG C;  5H8Y E;  1KF6 B;  2BT6 A;  4YTP B;  4N58 A;  1FO4 A;  1OQQ A;  4JWS C;  1TKE A;  1FXA A;  2WDV B;  5MPO A;  4HRO A;  1KFY B;  1H7X A;  4P6V F;  1L0V B;  3P4P B;  3AE4 B;  3W9C B;  4C80 A;  2WDQ B;  1AWD A;  5C3J B;  2CU3 A;  3AN1 A;  4KX6 B;  3ETR A;  3AE9 B;  4JWU C;  1NVI D;  1PDX A;  2JQR B;  3NVW A;  3P4R B;  1NI3 A;  2L83 A;  2W3S A;  1L5P A;  1WGK A;  3AEE B;  1WXQ A;  4ZOH C;  5EE9 A;  3KWL A;  1E0Z A;  1WRI A;  2K9X A;  3W5V B;  4US9 A;  4WQM A;  1XO3 A;  2PVG C;  2QIE B;  4C7Z A;  3EUB 2;  2WU5 B;  2WU2 B;  4ITK A;  5G5G A;  1GT8 A;  3B2G A;  3NVV A;  2H88 B;  3CF4 A;  1GTH A;  2CJO A;  4HRS A;  1ZP0 B;  2PIA A;  3AV8 A;  1FRR A;  2BS3 B;  3AE5 B;  1T3Q A;  2K5P A; 
#chains in the Genus database with same CATH topology
 2KC2 A;  2EKE C;  5H92 C;  3BZD B;  3AED B;  2WX1 A;  1WY8 A;  1VLB A;  3AEF B;  4DXA B;  3ZNG C;  1FXI A;  2A5U A;  2L05 A;  3DQV A;  2W9N A;  2JWZ A;  3GS2 A;  1K8R B;  4HKZ E;  4GU2 A;  2EEL A;  2KAJ A;  2ONQ A;  3QAR A;  1BT0 A;  1T0Y A;  1KOT A;  3TEY A;  5IO9 A;  3QQ8 B;  2DWQ A;  1TTN A;  3ZKJ C;  4RF0 A;  3KVF B;  1UH6 A;  1H7W A;  1DOX A;  4DDI D;  2AX5 A;  2O2V A;  1SB3 C;  5CTR C;  1JML A;  1F2R C;  1L6U A;  1YX6 B;  3NZS A;  4K7W A;  1MI0 A;  3GOE A;  3APF A;  2DNF A;  5L95 C;  2AQ1 B;  2BPS A;  4NAW B;  4LJO B;  1I4R A;  1NEN B;  3BII D;  2MBH A;  4YSX B;  1E90 A;  2N7J A;  3BY4 B;  3AE6 B;  1JAL A;  1IUE A;  4HDO A;  4JE3 B;  1I42 A;  2C7N B;  2IO0 B;  4IWQ A;  4W9E A;  3RNF C;  3DWM A;  1WGR A;  5HI1 A;  3U30 A;  3FC4 A;  3A1Q B;  3H7P A;  1WXV A;  4MGZ E;  4N58 A;  1MFW A;  1UBQ A;  4UDU C;  2WXR A;  3TIX A;  2MP2 A;  2WXN A;  4XYC A;  4XDD A;  2NR2 A;  4A55 A;  1EU3 A;  4W9G A;  3IG3 A;  4PYU A;  1WF9 A;  2JRH A;  4FJY A;  3W5V B;  3JW0 X;  2ICI A;  4O1N A;  2NBW B;  1MHX A;  2IGH A;  4NPN A;  3GE3 C;  2H88 B;  4RNA A;  2IBI B;  2M8S A;  3ZDT A;  4TV3 A;  3PRE A;  5G2N A;  2KWC A;  3EGR A;  1WXA A;  3PHW B;  1N5W A;  2C9W B;  2KQS A;  4XX5 A;  2KDB A;  4ICU A;  5J2R A;  2QMT A;  2KTR A;  2OJR A;  1HZ6 A;  1K53 A;  1DYQ A;  1ZW7 A;  4USA A;  2ZW1 A;  2B76 B;  2ZNV B;  1YOV B;  1YMH E;  3A9K A;  1SE4 A;  2W82 A;  5J17 A;  4DDG D;  2YEP F;  3RZF A;  3RUI B;  1RYJ A;  2W54 A;  4FN2 A;  1HE8 A;  5FR6 A;  5CHF A;  2HJ1 A;  3QHT A;  1WM2 A;  2PW9 A;  1XD3 B;  3MC0 B;  5LNK 1;  3JVZ X;  5TR5 A;  1OTR B;  1CZP A;  1EM7 A;  3ZQ4 A;  3WA0 A;  3R8B A;  4XZ4 A;  2D3C A;  3W5U B;  3AE8 B;  1EO6 A;  2MH7 A;  4YTM B;  3RYT A;  2MLB A;  2GBR A;  2Y5C A;  4TQ1 A;  5LXI B;  2WQY B;  2RR9 A;  3I3T B;  5HKH A;  1N62 A;  2LVQ A;  2LRU A;  3IFW B;  2WGS A;  1ISN A;  1VD2 A;  1B9R A;  1IGD A;  1XCQ L;  4FBJ B;  4HPP A;  2A4Z A;  2FNJ B;  3ONS A;  2MJE A;  3APD A;  3AE2 B;  2CHZ A;  4QAY A;  3DPD A;  1FXA A;  3PLV A;  4HDQ A;  3PRP B;  4NAW A;  3AUL A;  1D5X C;  4DQO C;  3W9C B;  1SE2 A;  1HQR D;  3FKY A;  4KIK A;  2CHX A;  1QKZ A;  2XNA C;  5D3I B;  1Q1O A;  3B0A A;  4ZYS A;  3P4R B;  5LXH A;  2MA9 B;  1WXM A;  4IC7 B;  1UZX B;  1YNT E;  2AL3 A;  3IXS A;  4RGO S;  4ANW A;  2GLS A;  4ITK A;  1TBE A;  2CJO A;  2N1W A;  2BS3 B;  2W3S A;  3AE5 B;  3UQB A;  1MVK A;  3N1X C;  3SFD B;  2N4F A;  3W1Y A;  1P98 A;  1E5W A;  4BVU C;  1CMX B;  1SSN A;  3ZXV A;  3P63 A;  5EE0 A;  3RT3 B;  4M8M A;  3EHV A;  3AE3 B;  5DPR A;  5IAA C;  2BS2 B;  1MPE A;  1C1Y B;  3HRD D;  2KJ6 A;  5FKA C;  1Q10 A;  1NEK B;  3DVN U;  1I7H A;  1UF0 A;  5JH5 C;  5CHV C;  4EKU A;  2BB5 A;  4RF1 A;  5HHD G;  3LYY A;  3NVY A;  1I4G A;  1WJ6 A;  2KC1 A;  5BMI A;  3BVZ A;  3DBL B;  3L08 A;  3DBL I;  2LGY A;  2I1K A;  4L1B A;  1ENF A;  2JRI B;  3Q3F A;  2LXC A;  2MBO A;  3H9D A;  1QOG A;  3L16 A;  2VH1 A;  2DYB A;  1B1Z A;  1M4V A;  1WGY A;  2N7E A;  1XLP A;  2AWT A;  2K39 A;  2LGI A;  4LNF A;  4GDL B;  2LI5 A;  2YEP B;  1UGJ A;  2AYO B;  4WUR A;  4AUQ C;  4NQL B;  3VUY A;  4G3X B;  4DK5 A;  2LJ5 A;  3W2D A;  3IAM 1;  2FID A;  3VUX A;  1L4Z B;  1KFY B;  4RM9 A;  5DCN A;  3T3N A;  1AWD A;  3N9Y C;  1WGG A;  2AQ2 B;  1LQB A;  3PLU A;  1NI3 A;  2Z0E B;  4K7S A;  1WXQ A;  4P1B C;  3VTV A;  3MFG A;  2KQ7 A;  1GT8 A;  3B2G A;  4C4V B;  3TBL D;  1JRU A;  1WIA A;  2WYQ A;  1HZ5 A;  1WRD B;  1WGH A;  3M3J A;  2N9X A;  2QSD A;  4IM2 A;  1I4Q A;  2KVZ A;  1ZDV A;  1QOA A;  3APC A;  2NBV B;  2LHE A;  4PS7 A;  1E6E B;  1TY0 A;  2Y5B B;  2J52 A;  3MC8 A;  3VVW B;  4E74 A;  3R66 C;  4WIP A;  3E9S A;  2KO3 A;  2ZPN A;  1KLV A;  1YN3 A;  3AMZ A;  3NRZ A;  3A33 B;  2J4X A;  4XGA B;  4GLS C;  1YQB A;  5CX3 A;  2D3A A;  4ZYN A;  3UGB B;  1ZDX A;  2BWE S;  3ZO5 B;  5J18 A;  1ACC A;  1C4A A;  3L10 B;  4AQ7 A;  5HG2 A;  4KDI C;  3PT2 B;  3DBS A;  5AZG A;  4HLE A;  1WM3 A;  2BYV E;  2Q5W D;  3ABV B;  1FNU A;  1D5M C;  1NYQ A;  4WJN A;  3PGE A;  1QOB A;  4EZL A;  4A9A A;  2BKF A;  3QAQ A;  4BBN C;  4HJK A;  2FBW B;  2KOX A;  5JHB A;  1J19 A;  2MW5 A;  1YJJ A;  2L52 A;  1R7S A;  1RFK A;  5KHQ A;  3KUC B;  1WX7 A;  2M19 A;  1I4H A;  4EFO A;  4OZA A;  3Q8C A;  4E3C A;  4FAD A;  2HD5 B;  3IHP C;  2EMT A;  2LMC A;  3EFC A;  2R2O A;  1L0X B;  1OQQ A;  2C60 A;  2J0J A;  4IKG A;  2GBK A;  5DPT A;  2ZW0 A;  1K51 A;  4BOZ B;  3DHI C;  2KHW B;  2BQQ A;  3DBR B;  2LVO A;  1L5P A;  2INC C;  3NUH B;  1R4N B;  4HXD A;  2JUO A;  1R4N I;  5G5G A;  2AL6 A;  2KFJ A;  1QZE A;  4JGH B;  4EUT A;  2IO3 B;  3QK0 A;  2W3R A;  3UF8 A;  1IGC A;  1ET6 A;  2XK5 A;  4RGT A;  2MJ3 A;  1WH3 A;  4OHJ A;  3JSV B;  5EE3 A;  4G50 A;  1FM0 D;  3ZTD A;  4CQN A;  1MG8 A;  2J53 A;  4C4V A;  4ZRI A;  1EUV B;  2PVO D;  3AU5 A;  1XEE A;  3U2S C;  2K0P A;  1JCK B;  2O2V B;  3QX1 A;  2DZM A;  2TSS A;  3ML9 A;  4LNK A;  2DLB A;  2WXK A;  4S17 A;  4P7I A;  2CU1 A;  2KLG A;  4TQ0 A;  4EZK A;  1UWM A;  3VHT C;  3OJ4 B;  1SIJ A;  2KZR A;  1OQR A;  2LGX A;  1TKY A;  3KYD D;  1PFD A;  2DYM A;  4CYE A;  3K9P B;  3WAN A;  4YTN B;  1HEZ E;  3IBE A;  2ASQ A;  4PYZ A;  4LLG M;  2DHZ A;  2KQ4 X;  3RPF C;  3H7P B;  3T3O A;  1JRO A;  4AS1 A;  2NPT A;  1E8Y A;  2UYZ B;  1J0G A;  3OJ3 A;  1K50 A;  2MP2 B;  1LGR A;  3PSE B;  4HPL B;  1PYW D;  4II2 B;  1P7E A;  4WWO A;  4JWU C;  1NVI D;  3SDL C;  2JYT A;  2JVC A;  2IY0 B;  2K9X A;  2WU2 B;  3IT6 B;  2RDG A;  3ML8 A;  3AV8 A;  2J42 A;  2PE9 A;  3PO0 A;  2G9H D;  4MSQ B;  2JF5 A;  1NYR A;  3B1L X;  2INP E;  3KUZ A;  1Z5S B;  1V8C A;  3MJW A;  2KTR B;  2L76 A;  3R3M A;  5HFY A;  2DZJ A;  5C23 A;  3EC8 A;  4KV2 A;  2LXA A;  4LTU A;  1XQQ A;  2IYD B;  3A9K B;  2KK8 A;  2KDI A;  3K9O B;  2SEB D;  4HK2 A;  2JX5 A;  4XE0 A;  2EKI A;  2KX0 A;  5D3D A;  1JWA D;  2KFK B;  4W9H A;  4N59 A;  1ET9 A;  3ZJU A;  4RCO A;  4IDI A;  3R2I A;  1XLN A;  1UGM A;  3ZNH B;  3ZIM A;  5DPS A;  3ZJT A;  2V9H A;  3JSV A;  1V1P B;  2KDF B;  3QJZ A;  2MX2 A;  1UBI A;  2LFI A;  2KYW A;  1VRA B;  1PGB A;  1C4C A;  4BOS C;  5T8I A;  4BKS D;  2O6V B;  4MM3 A;  4LDT B;  4YXD B;  3AEB B;  1VZ8 A;  3MP9 A;  3Q8A A;  3B08 A;  1GUA B;  4A6Q A;  4I6P A;  4W9I A;  2N0S B;  2LAS A;  1F0Z A;  2V0G A;  1WI0 A;  4YSZ B;  3Q3O C;  1N61 A;  5JZE B;  1DOY A;  2GRI A;  4M01 A;  3L54 A;  5MPO A;  3Q69 A;  4E71 A;  4P6V F;  1ZXH A;  3WAO A;  3ZUN A;  2D11 A;  4G0N B;  4KIK B;  3AN1 A;  1GB1 A;  3NVW A;  1RAX A;  2BKR B;  4L23 A;  4FLH A;  4WQM A;  5FK9 C;  3CMM B;  3Q8E A;  2DYO A;  2QDF A;  4MH0 E;  1XCT L;  5BO4 B;  1XLQ A;  3Q6B A;  1N5X A;  3DHG C;  3NS1 A;  1KM7 A;  2ZEQ A;  3L0W B;  3UI3 A;  4JQW C;  2FCM A;  2JZZ A;  2DAF A;  1V80 A;  3ZDM C;  3Q8B A;  1MJD A;  1FRD A;  3RNE C;  2V4I B;  2JWU A;  3R2T A;  1WMH B;  1TJE A;  1G6J A;  1TIF A;  4A8X C;  4YT0 B;  4MEM A;  3CIR B;  3H6N A;  3P1M A;  1L6V A;  4F7Z A;  2BWF A;  4RH6 A;  1P3Q U;  3HVZ A;  1EWC A;  2KKC A;  3TL5 A;  3QWZ B;  3VR9 B;  1C4P A;  2N9K A;  2DX5 B;  2K1F A;  1J7C A;  2IGG A;  2KJR A;  3M63 B;  4A90 A;  2NS5 A;  2MHJ A;  2JZP A;  4WWN A;  3TJP A;  3Q3N C;  2LRW A;  2OED A;  5E6J A;  2R61 A;  4I6N B;  3VH3 B;  2KFK A;  4KSL C;  4WJO A;  1TS5 A;  1LFD A;  1SEB D;  3KH0 A;  4M00 A;  3RN9 C;  1OEY J;  1ZXI A;  2IO1 B;  3HVD A;  4B0M A;  1N60 A;  4B0E A;  2D3B A;  1V1P A;  2RD0 A;  2WXJ A;  1F1H A;  2C5L C;  3AE4 B;  2O6V A;  1E8Z A;  2WDQ B;  3PZD A;  3BYY B;  2KT7 A;  3PPA A;  2PTL A;  1GC6 A;  4GDK A;  4KKI A;  1JWU D;  2HJ8 A;  2FCQ A;  2JZ3 B;  3MHS D;  1WX9 A;  1SE3 A;  4LCD E;  1Z2M A;  4HCN B;  4M8N A;  4PT5 A;  4FJZ A;  3KUD B;  5G55 A;  2E3T A;  2PLP A;  4BKG A;  3RFZ B;  3A4S C;  3B2F A;  4A3O A;  3NS8 A;  1E10 A;  4GXB A;  1JWS D;  4C7Y A;  3V6E B;  4KGT A;  2FCN A;  1C9F A;  3SFE B;  1YX5 B;  1D4B A;  3ECI A;  4WJQ A;  1RLF A;  5IOI A;  1C78 A;  3WAP A;  3PHX B;  2BVC A;  2WXP A;  2CS4 A;  4LJP B;  1E7V A;  3Q14 C;  4LDT D;  2L00 B;  2EMS A;  3GE8 C;  3ENE A;  1EF5 A;  2OJW A;  4DHZ E;  4FXC A;  2ZZP B;  3PV1 A;  3LDZ E;  1WMH A;  4OVZ A;  2YVC A;  3I57 A;  3RCZ A;  5E6O A;  1E7P B;  4AP4 C;  4MEL A;  4W9D A;  2WDT B;  4RFB A;  2LHD A;  1WJN A;  2M56 B;  1TT5 B;  1TZ1 A;  3DOW A;  5H8Y E;  2BT6 A;  4JWS C;  1FD6 A;  3OAW A;  3P4P B;  1V1O A;  4K3C A;  2KMA A;  2V1Y A;  3NZU A;  5C3J B;  3ETR A;  4RMA A;  4NQK E;  4JPS A;  4B9K A;  1WGK A;  3AEE B;  1YIW A;  2FAZ A;  2IZV B;  2YLM A;  3U7Z A;  1C79 A;  2ZCB A;  1LO5 D;  1R4M B;  1R4M I;  1UD7 A;  4HRS A;  4FA6 A;  1JRP A;  4DXF A;  2XK5 B;  3ZW3 A;  2HTH A;  2PEA A;  3Q8F A;  4BFR A;  5E6N A;  2PKO A;  3VR8 B;  2G1E A;  2Y3A A;  2KDM A;  2QCZ A;  2L0T A;  2N1V A;  1EU4 A;  4IM3 A;  2C7M B;  1KRH A;  1FEH A;  1GAQ B;  2MCN B;  1F2R I;  4GMV A;  3P4S B;  3J9C A;  2RPV A;  2K6D B;  1D5Z C;  2KWU B;  2K8C A;  1V86 A;  1MHH E;  2I2Y A;  2D07 B;  4OVV A;  2J0M A;  4NJC A;  3I63 C;  1T5X D;  4OZC A;  2WXG A;  1WYG A;  5IKC M;  2D10 A;  4FJV B;  1Q5W B;  4ZRP A;  3A4R A;  1TYG B;  3DVN V;  4XDC A;  3UIP B;  1L7Y A;  3AE1 B;  1PQS A;  3BK2 A;  3QA8 A;  2WLB A;  3QC8 B;  1SGH A;  1GC7 A;  4KGR A;  2NCN A;  5I4D A;  1L4D B;  5AUI A;  1KLU D;  5JXV A;  1WYW B;  3NOB A;  3ZTC A;  3HM6 X;  4K7U A;  2BGF A;  2RGF A;  4AJW A;  1UNS A;  2ZPY A;  3KW5 B;  2NPT B;  4WWP A;  1L0V B;  1RRB A;  1WXS A;  4GIV A;  4HWI B;  3VH4 B;  1KTK A;  5IP4 D;  2JPH A;  1WZ3 A;  4LK0 M;  1F52 A;  1SE9 A;  3KWL A;  3RZW C;  2I38 A;  1STE A;  4LNN A;  1HTO A;  2JXT A;  2SAK A;  2IPK D;  1OGW A;  1A5R A;  2KNB A;  2GI9 A;  1V6E A;  4EE2 A;  3W1S C;  3VFK A;  3M95 A;  3PRZ A;  2NTT A;  3R7R A;  1J7B A;  2VRR B;  4ACF A;  2KMC A;  2VZK B;  5AUK A;  3U7D A;  2M1M A;  1WWT A;  4HCP B;  1PUT A;  3D32 A;  4MT5 A;  4W9K A;  3DBR I;  2M0X A;  3DVG Y;  1GTE A;  4DXG A;  1TZO A;  4J3O D;  1E7U A;  1WJ4 A;  4GOC A;  1F9J A;  2K22 A;  3MHZ A;  2KN5 A;  1JWM D;  3TUO A;  1I4X A;  1VZ6 A;  3QCA A;  2CHW A;  3RI7 C;  2W55 A;  4JLC A;  2INN E;  3FIL A;  1E8X A;  1TS3 A;  4TSS A;  1BUI C;  4ZRJ A;  2ZNV C;  2XN9 C;  3C19 A;  3TMP B;  4S0R A;  4YWG G;  2BF8 B;  2L3Z A;  5D94 A;  3VTU A;  3NY5 A;  1TS4 A;  1V5O A;  2Z8L A;  1P9D U;  2BYT A;  1N6Z A;  4W9F A;  4MM3 B;  2WXO A;  5EDS A;  2NTS A;  3SD5 A;  4C00 A;  1T0S C;  4IG7 B;  2KJH B;  1ZE3 D;  4A3P A;  1KJT A;  2JU6 X;  2CJN A;  1UEL A;  1NI2 A;  5AZF A;  2N9E B;  4ANV A;  3V61 A;  3IAS 1;  3URY A;  3TEZ A;  4NNJ B;  1V9J A;  3Q2A C;  4HEA 1;  3TCA A;  4C80 A;  2CU3 A;  3RNA C;  1PGA A;  4W9L A;  2K8B A;  4TKN A;  2X38 A;  2FUH B;  2IND C;  2IGD A;  3U52 E;  1AW7 A;  2KDE B;  2IY1 B;  3EA6 A;  3DDC B;  3TEX A;  3CF4 A;  1AAR A;  2NMQ A;  2PIA A;  1FNV A;  3P4Q B;  3LJ3 A;  2G45 B;  2XEW A;  3WAM A;  3C8Y A;  3H8H A;  2QHO A;  4IM0 A;  3N32 A;  1GG3 A;  2KVR A;  2GBJ A;  1AYF A;  2DAJ A;  3NVZ A;  2FCS A;  1J7A A;  3ZLZ A;  3ALB A;  2JSV X;  3P2B A;  1V97 A;  2C7H A;  2L1A A;  2FE8 A;  2N9P C;  3BVM A;  2DBY A;  1CJE A;  1E8W A;  2UU7 A;  3O65 B;  4ASW C;  2BS4 B;  1WE6 A;  1YN4 A;  1WFY A;  4NJ6 A;  1C76 A;  3AEA B;  5D7G A;  2BYE A;  2UWQ A;  4FHJ A;  2L32 A;  2MRP A;  3NJT A;  4Q2J A;  1YJI A;  4K1R B;  3DHH C;  4XWT A;  5GXG B;  1RWS A;  1T0R C;  5IN7 A;  2BBC A;  2QJL A;  3I5J C;  3AI5 A;  3WCQ A;  3HK0 A;  3O13 A;  1WE7 A;  1WR1 A;  3HHM A;  3TEW A;  1XXG A;  1BML C;  5BMG A;  3DVG X;  1RFA A;  4URK A;  2WHI A;  2G4D B;  4NJ7 A;  1TY2 A;  2ACZ B;  4FUL A;  4MGK E;  1J8C A;  5G5H A;  2DEN B;  2XBB C;  2R2Q A;  4DBG A;  2HTM E;  1GPX A;  2V3N A;  1KF6 B;  1TKE A;  2CKH B;  1H7X A;  1WZ0 A;  2NBU A;  1UUP A;  4NAM A;  3NHE B;  1EF1 A;  1TGZ B;  2KAC A;  3OG5 A;  1XO3 A;  4C7Z A;  3EUB 2;  4GDK B;  1OQY A;  3RNG C;  4HVB A;  2G3Q B;  4GGQ A;  3ZRF A;  1PGX A;  1V81 A;  2VZK D;  4M0W A;  1ROE A;  4X57 B;  3L13 A;  1SBB B;  4H2A A;  3PZ7 A;  3KYC D;  2G4S A;  3VRA B;  3AB5 A;  1HXY D;  3DCG A;  5BYR A;  2J0K A;  2GB1 A;  4HJG E;  1SIF A;  3L4P A;  4XC2 A;  2KWV B;  3VTW A;  1CQV A;  1YD8 U;  3BK1 A;  3U4E G;  1Y8R C;  3AXC A;  1IBX B;  1GNU A;  1DGJ A;  4MJS A;  3X0W A;  4LNO A;  3RD2 A;  4TUU A;  3A9J A;  2LJI A;  1S3S G;  3N1Y C;  1YQ3 B;  3VDZ A;  2JYE A;  2HE7 A;  1P1A A;  2LGS A;  1HTQ A;  2LD9 A;  2CR5 A;  2Y5P A;  2ZVO A;  3KLS X;  2K3U A;  2RDH A;  5D2M B;  4KZC A;  5EE1 A;  4YL8 A;  1A70 A;  2N7D A;  1HA5 A;  3RNB C;  3N20 C;  1LXD A;  4JX1 C;  1IP9 A;  4PS3 A;  1ESF A;  2L7R A;  2M0A A;  3MC9 A;  4WAF A;  3EEC A;  2KTF A;  4L2Y A;  1YN5 A;  5CHW A;  4EOY A;  5L83 A;  4FHK A;  1RM6 C;  4II3 B;  1L0Y B;  1DOI A;  2WXF A;  3DWG C;  3T8M A;  3E56 A;  3SHQ A;  4HRO A;  3UIO B;  4MGY E;  4J6I A;  3WAL A;  2IJ0 A;  3AE9 B;  4TMA B;  1S1Q B;  3ZNI D;  2B3A A;  5KHO A;  2QIE B;  1XF5 L;  4CHK A;  2BB6 A;  2IO2 B;  3NVV A;  3PZ8 A;  4CO7 A;  1H8C A;  2REX A;  1T3Q A;  4WWM A;  2MBB B;  2K5P A;  5GMV A;  4B95 A;  2WDR B;  4IWO A;  3T9L A;  4P16 A;  1FCL A;  3VQI A;  1OFF A;  3IVF A;  4JL9 A;  1ZOY B;  4RGM A;  2BYF A;  4IOI E;  2DZI A;  1WSP A;  2GBM A;  4K81 A;  2D2Q A;  3Q3J A;  2OHF A;  4DHJ B;  3U8Z A;  1ZUD 2;  4PK1 A;  2PE6 B;  3L17 A;  1ZPS A;  3TSS A;  4ANU A;  4RM8 A;  2J7Q B;  2X8X X;  2E6X A;  1FCC C;  1FNW A;  2IDY A;  3ZGZ A;  1FIQ A;  2ZJD A;  1TKG A;  1D3Z A;  4IUM B;  4WH4 A;  1IBX A;  2D5G A;  2RSU A;  1H4R A;  4ZHO A;  3R7Q A;  4ARI A;  1N63 A;  4JIO U;  1VDV A;  1SXT A;  3BVG A;  4AJY B;  1VR9 A;  2K8H A;  1XT9 B;  2O6V D;  1GOZ A;  3H7S A;  3FAH A;  3A1Q A;  3LXF A;  3H1U A;  3W1S A;  4YTP B;  4GN1 A;  2N9L A;  2BW2 A;  1KLG D;  3RMK C;  3IT4 B;  2LZ6 A;  2JQR B;  4AOF A;  3ZJV A;  4W9J A;  3VAW A;  1VCB A;  2GOW A;  2KD0 A;  2LUE A;  4MSM B;  4US9 A;  4I6L B;  3PS6 A;  1Q0W B;  2HDE A;  3MTN B;  1GTH A;  1Y56 A;  4DHZ B;  4ZRQ A;  3V6C B;  3KWV A;  3V05 A;  1I35 A;  4KSK C;  2LVP A;  1WGD A;  1E9M A;  5BYQ A;  2QIL A;  1SJE D;  1V49 A;  1QLB B;  4WQO B;  2H89 B;  3M62 B;  1NBF C;  4WJP A;  4PS8 A;  2KAN A;  4W9C A;  3X23 A;  4G11 A;  4K3B A;  1T6B X;  1M94 A;  5TSS A;  3ZXR A;  3HUI A;  3FIL B;  4IW0 A;  2RMM A;  1FMA D;  3NZ3 A;  3VXW A;  3CWI A;  4ZHP A;  1YQ4 B;  1JW9 D;  2JY6 A;  1ZGU B;  4MDK E;  4RGN A;  3BIN A;  3RUL A;  2KXJ A;  2MBE A;  3VUW A;  1KH0 A;  4BZA A;  1VJK A;  4GB9 A;  3AEG B;  1FFV A;  2V4L A;  4DWF A;  1JQ4 A;  2L8J A;  1WR6 E;  2PMV A;  4P1C C;  2KMM A;  2K6Q A;  2WXQ A;  2Z59 B;  3I9V 1;  3OWE B;  1T0Q C;  4ICV A;  1K52 A;  4NZL B;  4EEW A;  4KVG B;  3GP7 A;  4KX6 B;  1F77 A;  4OVU A;  2D3G A;  1IPG A;  3ZVV A;  1QIL A;  4ZOH C;  5EE9 A;  4KDL B;  2K25 A;  1WRI A;  3V60 A;  5LLI A;  2FIF A;  4MAC A;  3ZRC A;  2DZK A;  2KWD A;  1I4P A;  2GMI C;  5C2T B;  3ZNZ B;  1SF0 A;  4F1S A;  2KN4 A;  3PVL A;  5DPW A;  1FXT B;  4KZ0 A;  2QEJ C;  3HM3 A;  2JXX A;  5FR3 A;  3GZN B;  1BXT A;  2LGD A;  2AEH A;  3GZN I;  1C77 A;  2KX3 A;  1FPY A;  4DHJ D;  2NVU I;  2MWS B;  1ZKH A;  3CSF A;  4KKJ A;  4M02 A;  1QF6 A;  2WNM A;  5JHA A;  3ZYY X;  2MSE D;  2M17 A;  3KQ4 A;  4US8 A;  4NY0 A;  3N1Z C;  4MGI E;  3NG0 A;  2L0F A;  3AU4 A;  3Q3M C;  3UQA A;  1OEY A;  5C1Z A;  1LM8 B;  2KLC A;  1AN8 A;  3VRB B;  4ARC A;  4ANX A;  2ZCC A;  1D6E C;  2RDB C;  4N6E B;  4HKQ A;  1NDD A;  2Z0D B;  3AM9 A;  2MJD A;  3RNC C;  4KGS A;  2JT4 B;  3DBH B;  1VZ7 A;  4GDL A;  3DBH I;  1IYF A;  3N30 A;  1V5T A;  1WJU A;  1U4A A;  1TS2 A;  1JWB D;  3BYT B;  1FO4 A;  1QQR A;  2V3S A;  2WDV B;  1CK1 A;  2LUM A;  3HIZ A;  4R3D A;  2V3P A;  4OZB A;  3PTF C;  2L83 A;  3CST A;  1E0Z A;  2RPQ A;  4HPM B;  5D6J B;  2BTE A;  2MEK A;  1ZP0 B;  1FRR A;  2PVG C;  4M0W B;  3S2A A;  3CF6 E;  2ZVN A;  1X1M A;  2WXM A;  3V62 A;  3GB1 A;  1P7F A;  3AH7 A;  3SR6 A;  2WXI A;  1L2N A;  4A20 A;  1C3T A;  3EFU A;  3P42 A;  2LEK A;  4LNI A;  4BBN F;  2VH2 A;  2FUG 1;  4IWP A;  1EWY C;  2PJH A;  2WXL A;  4REZ A;  4MJS B;  4BKT A;  1UWX A;  2I1J A;  3AEC B;  3A9J B;  2WS3 B;  3QIJ A;  4WAA A;  4YSY B;  3AE7 B;  4F8C B;  4XWW A;  1XLO A;  3N3K B;  1FFU A;  4ZRK A;  2GBN A;  3C0R B;  1WX8 A;  2QC8 A;  2PPH A;  1SJH D;  1QT9 A;  3B9J A;  3V3X A;  3SEB A;  3SU8 X;  4D2K A;  4OW0 A;  2OOB B;  2ON8 A;  1GB4 A;  3MJ5 A;  3JYU A;  1GJZ A;  3UIN B;  2LWP A;  3OLM D;  2WX0 A;  1P0R A;  4BKS A;  2WP9 B;  5E6P A;  1V2Y A;  1QOF A;  5BYS A;  5IA7 A;  2MQJ A;  1MG4 A;  4AWJ A;  3PRM B;  3LB8 C;  4MH8 A;  4ZDV A;  2WXH A;  4GSW A;  2WWZ A;  5AEK B;  4EZJ A;  5AZH A;  1PDX A;  1YJ1 A;  2AQ3 B;  2M4N A;  4N9F 4;  3WIM A;  3BWU D;  4BAX A;  4C56 C;  5BMH A;  2WU5 B;  2MBQ A;  4B6W A; 
#chains in the Genus database with same CATH homology
 1JRP A;  2W3R A;  4DXF A;  2WDR B;  5H92 C;  1IGC A;  1ET6 A;  3BZD B;  3Q8F A;  3AED B;  1VLB A;  3AEF B;  4P16 A;  2PKO A;  2MJ3 A;  4RGT A;  3VR8 B;  2G1E A;  1FCL A;  2Y3A A;  3VQI A;  1FXI A;  2KDM A;  1OFF A;  4OHJ A;  5EE3 A;  1ZOY B;  4RGM A;  1EU4 A;  1FM0 D;  4IOI E;  4CQN A;  3GS2 A;  1KRH A;  4HKZ E;  2EEL A;  2KAJ A;  1FEH A;  2ONQ A;  1GAQ B;  1WSP A;  1F2R I;  2J53 A;  3TEY A;  3P4S B;  2PVO D;  3J9C A;  2OHF A;  2RPV A;  1XEE A;  1ZUD 2;  1D5Z C;  3U2S C;  2DWQ A;  4RF0 A;  2K0P A;  1MHH E;  1H7W A;  2I2Y A;  1DOX A;  1ZPS A;  3TSS A;  1JCK B;  2AX5 A;  4NJC A;  1T5X D;  1SB3 C;  2E6X A;  4OZC A;  1FCC C;  1JML A;  1F2R C;  1WYG A;  2TSS A;  1L6U A;  2DLB A;  2WXK A;  2WXG A;  1FNW A;  4ZRP A;  2IDY A;  4TQ0 A;  3ZGZ A;  1FIQ A;  1MI0 A;  1TYG B;  1UWM A;  1SIJ A;  4XDC A;  2AQ1 B;  1TKG A;  1OQR A;  4NAW B;  3AE1 B;  1TKY A;  3BK2 A;  4WH4 A;  2WLB A;  1IBX A;  1I4R A;  1PFD A;  1NEN B;  2D5G A;  2DYM A;  3BII D;  4YSX B;  4KGR A;  4YTN B;  1HEZ E;  2N7J A;  5I4D A;  3AE6 B;  1JAL A;  1IUE A;  1L4D B;  4ZHO A;  5AUI A;  4JE3 B;  4LLG M;  1KLU D;  2KQ4 X;  4ARI A;  1N63 A;  5JXV A;  1VDV A;  1SXT A;  3RPF C;  3BVG A;  3DWM A;  1VR9 A;  5HI1 A;  3FC4 A;  3T3O A;  1JRO A;  1GOZ A;  3FAH A;  3LXF A;  1UNS A;  3W1S A;  4N58 A;  4YTP B;  4UDU C;  4AS1 A;  1K50 A;  2WXR A;  1L0V B;  2N9L A;  2WXN A;  1PYW D;  2BW2 A;  1P7E A;  4XDD A;  1KLG D;  1EU3 A;  4A55 A;  3IT4 B;  4JWU C;  1KTK A;  1NVI D;  2JQR B;  3ZJV A;  2JYT A;  4LK0 M;  3KWL A;  3W5V B;  2K9X A;  2I38 A;  4US9 A;  1STE A;  2ICI A;  2JXT A;  2SAK A;  4O1N A;  2IPK D;  2WU2 B;  2GI9 A;  1MHX A;  2IGH A;  4EE2 A;  2HDE A;  2H88 B;  3IT6 B;  1GTH A;  2RDG A;  4RNA A;  3AV8 A;  2J42 A;  1Y56 A;  2NTT A;  4ZRQ A;  1J7B A;  3KWV A;  3V05 A;  3PO0 A;  2G9H D;  1E9M A;  1NYR A;  3EGR A;  2QIL A;  5BYQ A;  1N5W A;  1SJE D;  2INP E;  1QLB B;  1V8C A;  2VZK B;  5AUK A;  2QMT A;  5HFY A;  1HZ6 A;  1K53 A;  1WWT A;  1DYQ A;  1PUT A;  4MT5 A;  4USA A;  2H89 B;  4LTU A;  2ZW1 A;  1GTE A;  2B76 B;  4DXG A;  1TZO A;  4J3O D;  2K22 A;  1YMH E;  3MHZ A;  1SE4 A;  1JWM D;  2SEB D;  2W82 A;  3TUO A;  2JX5 A;  1I4X A;  4XE0 A;  1VZ6 A;  2YEP F;  2EKI A;  5D3D A;  1T6B X;  5TSS A;  1RYJ A;  2W54 A;  1JWA D;  2W55 A;  4N59 A;  1ET9 A;  2PW9 A;  3HUI A;  3FIL B;  2RMM A;  1FMA D;  2INN E;  3FIL A;  3MC0 B;  3NZ3 A;  4RCO A;  4IDI A;  1TS3 A;  4TSS A;  5LNK 1;  1BUI C;  3R2I A;  1XLN A;  3CWI A;  4ZHP A;  1YQ4 B;  1CZP A;  1EM7 A;  1JW9 D;  3ZJT A;  3ZJU A;  2XN9 C;  3ZQ4 A;  1V1P B;  4YWG G;  4RGN A;  2LFI A;  3R8B A;  1VRA B;  1PGB A;  1TS4 A;  1C4C A;  2Z8L A;  5T8I A;  3W5U B;  2BYT A;  3AE8 B;  4MM3 B;  2WXO A;  2MH7 A;  1KH0 A;  2NTS A;  4YTM B;  2Y5C A;  4TQ1 A;  1VJK A;  4YXD B;  3AEB B;  1VZ8 A;  3MP9 A;  3Q8A A;  2WQY B;  3AEG B;  1FFV A;  1ZE3 D;  1N62 A;  4A6Q A;  2N0S B;  1F0Z A;  1JQ4 A;  2JU6 X;  2CJN A;  2V0G A;  4YSZ B;  1B9R A;  1IGD A;  1XCQ L;  2PMV A;  2KMM A;  1N61 A;  1DOY A;  2GRI A;  2WXQ A;  2MJE A;  3AE2 B;  3I9V 1;  3IAS 1;  3OWE B;  3URY A;  3TEZ A;  5MPO A;  1FXA A;  3Q69 A;  1K52 A;  4P6V F;  4NZL B;  1D5X C;  1ZXH A;  4DQO C;  4HEA 1;  3GP7 A;  3W9C B;  1SE2 A;  4C80 A;  1HQR D;  2CU3 A;  3AN1 A;  4KX6 B;  1F77 A;  1GB1 A;  2XNA C;  1QKZ A;  5D3I B;  1PGA A;  3NVW A;  4ZYS A;  3P4R B;  1QIL A;  4L23 A;  2X38 A;  4ZOH C;  5EE9 A;  1WRI A;  2IGD A;  3U52 E;  1AW7 A;  4WQM A;  5FK9 C;  1YNT E;  3IXS A;  4RGO S;  3Q8E A;  3EA6 A;  4ITK A;  4MAC A;  2DYO A;  3TEX A;  3CF4 A;  2CJO A;  2KWD A;  2NMQ A;  1XCT L;  2PIA A;  2BS3 B;  2W3S A;  3AE5 B;  1MVK A;  1XLQ A;  1FNV A;  3SFD B;  3P4Q B;  1N5X A;  3NS1 A;  1I4P A;  5C2T B;  3C8Y A;  3UI3 A;  3H8H A;  1SF0 A;  2KN4 A;  1SSN A;  1AYF A;  3P63 A;  2QEJ C;  3Q8B A;  3NVZ A;  1FRD A;  5EE0 A;  5FR3 A;  1J7A A;  2V4I B;  1BXT A;  3AE3 B;  2JSV X;  1C77 A;  1V97 A;  2BS2 B;  1MPE A;  2JWU A;  2L1A A;  3R2T A;  2FE8 A;  3BVM A;  2DBY A;  3HRD D;  4KKJ A;  5FKA C;  1CJE A;  1TJE A;  1Q10 A;  1NEK B;  4A8X C;  4YT0 B;  2BS4 B;  3CIR B;  1QF6 A;  3P1M A;  1L6V A;  2WNM A;  1YN4 A;  1I7H A;  3ZYY X;  4RH6 A;  1C76 A;  3HVZ A;  3KQ4 A;  3AEA B;  1EWC A;  2BB5 A;  4RF1 A;  5D7G A;  4US8 A;  5HHD G;  2L32 A;  3LYY A;  3NVY A;  4Q2J A;  1I4G A;  3VR9 B;  1C4P A;  1YJI A;  2N9K A;  5BMI A;  3BVZ A;  1J7C A;  4XWT A;  5GXG B;  1RWS A;  2IGG A;  4A90 A;  4L1B A;  1ENF A;  2BBC A;  2QJL A;  3WCQ A;  2JZP A;  3O13 A;  1AN8 A;  3VRB B;  3TEW A;  1XXG A;  1BML C;  1QOG A;  2OED A;  5E6J A;  5BMG A;  4ARC A;  2R61 A;  1D6E C;  1B1Z A;  4N6E B;  4HKQ A;  1M4V A;  1TS5 A;  1XLP A;  3AM9 A;  1SEB D;  1TY2 A;  2MJD A;  2ACZ B;  1ZXI A;  4KGS A;  2LGI A;  4GDL B;  3HVD A;  2YEP B;  1VZ7 A;  5G5H A;  4B0M A;  1N60 A;  1UGJ A;  4WUR A;  4B0E A;  2HTM E;  1V1P A;  1GPX A;  2WXJ A;  1TS2 A;  1JWB D;  2V3N A;  3BYT B;  1KF6 B;  1FO4 A;  1QQR A;  3W2D A;  1TKE A;  3IAM 1;  2WDV B;  1CK1 A;  1L4Z B;  1KFY B;  1H7X A;  2LUM A;  3AE4 B;  3T3N A;  2WDQ B;  1AWD A;  4R3D A;  1UUP A;  3N9Y C;  4NAM A;  3BYY B;  2V3P A;  2AQ2 B;  4OZB A;  1NI3 A;  2L83 A;  1WXQ A;  2KAC A;  1E0Z A;  2PTL A;  1XO3 A;  4C7Z A;  3EUB 2;  3MFG A;  4GDK B;  1GT8 A;  1JWU D;  2MEK A;  3B2G A;  4KKI A;  2BTE A;  1ZP0 B;  1FRR A;  1PGX A;  2PVG C;  2VZK D;  1HZ5 A;  4M0W A;  1ROE A;  1SE3 A;  1SBB B;  4H2A A;  2QSD A;  3PZ7 A;  4PT5 A;  2WXM A;  1I4Q A;  1ZDV A;  1P7F A;  3GB1 A;  3AH7 A;  1QOA A;  2E3T A;  2WXI A;  2LHE A;  2PLP A;  3SR6 A;  3VRA B;  1E6E B;  1TY0 A;  3AB5 A;  1HXY D;  2J52 A;  3RFZ B;  3B2F A;  1E10 A;  5BYR A;  4WIP A;  3P42 A;  3E9S A;  2GB1 A;  4HJG E;  2LEK A;  3L4P A;  1YN3 A;  3AMZ A;  3NRZ A;  1JWS D;  4C7Y A;  1CQV A;  2J4X A;  2FUG 1;  3BK1 A;  3U4E G;  4KGT A;  4GLS C;  1EWY C;  2WXL A;  4REZ A;  1C9F A;  1IBX B;  3SFE B;  1DGJ A;  1D4B A;  1ZDX A;  1UWX A;  3AEC B;  2WS3 B;  4YSY B;  3AE7 B;  1ACC A;  4WWM A;  2LJI A;  1C4A A;  1C78 A;  1YQ3 B;  4XWW A;  4AQ7 A;  1XLO A;  1FFU A;  2JYE A;  5HG2 A;  2WXP A;  2Q5W D;  1SJH D;  3ABV B;  1QT9 A;  1FNU A;  3B9J A;  3V3X A;  2Y5P A;  1D5M C;  3KLS X;  2K3U A;  3SEB A;  2RDH A;  1NYQ A;  5EE1 A;  4D2K A;  4OW0 A;  1A70 A;  1QOB A;  4FXC A;  2ON8 A;  1GB4 A;  3MJ5 A;  4A9A A;  4OVZ A;  1HA5 A;  3I57 A;  1E7P B;  2FBW B;  4JX1 C;  1ESF A;  4RFB A;  2M0A A;  1YJJ A;  2WP9 B;  2LHD A;  2L52 A;  4WAF A;  1R7S A;  1RFK A;  1QOF A;  5BYS A;  2M56 B;  4L2Y A;  2M19 A;  3LB8 C;  1I4H A;  1YN5 A;  4MH8 A;  3Q8C A;  4OZA A;  2WXH A;  1RM6 C;  1L0Y B;  1DOI A;  2LMC A;  2WXF A;  3DWG C;  2BT6 A;  5H8Y E;  1L0X B;  1OQQ A;  4JWS C;  4IKG A;  3E56 A;  4HRO A;  1FD6 A;  3P4P B;  1V1O A;  2IJ0 A;  2ZW0 A;  5C3J B;  1K51 A;  3ETR A;  3AE9 B;  1PDX A;  4TMA B;  4JPS A;  1L5P A;  1WGK A;  3AEE B;  2AQ3 B;  3BWU D;  3NUH B;  3U7Z A;  4C56 C;  1C79 A;  2QIE B;  5BMH A;  1LO5 D;  1XF5 L;  2WU5 B;  5G5G A;  2BB6 A;  3NVV A;  3PZ8 A;  4HRS A;  1T3Q A;  2K5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...