3AE1B

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae1B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae1B01
1OQQA 1N62A 3ZYYX 1NVID 1E6EB 1FM0D 1NYQA 1RYJA 2L83A 2WDRB 1VJKA 3HRDD 4P6VF 2W3SA 1NENB 3AEBB 1J7CA 1FFUA 4IDIA 4WWMA 2JQRB 5EE3A 4C7YA 1FMAD 1JWBD 3SFEB 1FFVA 2KAJA 2N0SB 3EUB2 1DOYA 4JWUC 4HRSA 2MH7A 2BS2B 1L0VB 3SFDB 3AE4B 1EWYC 2DBYA 3P4QB 4YSXB 2PKOA 1DOXA 1GTHA 1L6VA 1TKYA 3AEDB 2CJOA 2G1EA 1V97A 2MJ3A 5C3JB 1FXIA 2OHFA 2H89B 3W9CB 1ZP0B 1VDVA 1XLQA 2W3RA 5H92C 2QIEB 3WCQA 1N5XA 1TJEA 1GTEA 4FXCA 2CU3A 3FC4A 1RFKA 4N58A 2WDVB 4YTNB 1L6UA 3SR6A 3AMZA 2WDQB 2MJDA 2QJLA 1J7AA 3AE1B 4C7ZA 5MPOA 3NVYA 1GPXA 4LTUA 1RWSA 3B2FA 2AX5A 1E10A 5EE1A 1H7XA 2KMMA 1QOBA 3NVVA 3AE9B 3P1MA 2BT6A 3VRBB 3CWIA 3AE6B 1NYRA 1IUEA 3NVWA 1KF6B 1V8CA 5AUIA 4C80A 1E9MA 4WQMA 3B9JA 2E3TA 3NS1A 2WS3B 3VR8B 3AM9A 3LXFA 1JROA 3DWMA 2BS3B 5G5GA 1ZXIA 2MJEA 3CIRB 1TKGA 3KWLA 1DOIA 1QT9A 1XLPA 4USAA 2K22A 4A9AA 3B2GA 1JQ4A 1ROEA 1GAQB 1UWMA 3AE2B 1XLOA 1XO3A 2FBWB 4N6EB 2PVGC 1GT8A 1YQ4B 3CF4A 1PDXA 3AEEB 1OQRA 2K5PA 3DWGC 1FRRA 1DGJA 2K9XA 1YQ3B 5G5HA 1N60A 1N61A 4US9A 2EKIA 1OFFA 2WLBA 3NRZA 4JX1C 1E0ZA 1E7PB 4YT0B 5AUKA 3P4SB 1ZOYB 2M56B 2M19A 3VRAB 3W5UB 3AEGB 1PFDA 2WU5B 2B76B 3AE7B 4YXDB 1CJEA 1H7WA 1QOGA 2Q5WD 3FAHA 3AEFB 3HVZA 4ZOHC 1T3QA 4ZHOA 1QF6A 1WGKA 1YJIA 2Y5CA 4KX6B 3L4PA 2L52A 1F0ZA 1WRIA 3AV8A 1WWTA 3P4RB 1AWDA 1L5PA 5EE9A 1CZPA 3BIID 3ABVB 3AN1A 1A70A 4YTPB 1FXAA 1XLNA 2WQYB 4N59A 1QOFA 1KFYB 1SIJA 3AE3B 3AE5B 3P4PB 1JWAD 1FIQA 1PUTA 1SB3C 1SF0A 1WXQA 2DWQA 3NVZA 1KRHA 2BS4B 3AECB 1YJJA 1TYGB 3RPFC 4ZHPA 1N63A 3PO0A 2W55A 5GXGB 1FO4A 2WU2B 2CJNA 1NI3A 5H8YE 1JRPA 2WP9B 1TKEA 3AB5A 3P63A 2LEKA 4US8A 1JW9D 3ETRA 2PVOD 2W54A 1N5WA 4JWSC 1ZUD2 1FRDA 1QLBB 2JX5A 4YSYB 3HUIA 1RM6C 4ITKA 2ACZB 2H88B 3AE8B 4YSZB 4YTMB 1AYFA 1QOAA 2HTME 1JALA 1J7BA 3AEAB 3LB8C 4HROA 1I7HA 1NEKB 3W5VB 1R7SA 5C2TB 2PIAA 1B9RA 3VR9B 1WYGA 5EE0A 3AH7A 1VLBA
chains in the Genus database with same CATH superfamily
3ZYYX 3A9JA 3UGBB 1E6EB 4TQ1A 3PTFC 4C56C 3PRZA 3N1YC 4D2KA 2GBJA 3ZJTA 2DX5B 2A4ZA 2W3RA 2BS2B 3PRPB 2KKCA 4I6LB 4J6IA 1L6VA 1KH0A 5DCNA 3JW0X 1V5TA 1QQRA 1YD8U 3BK2A 1WYWB 1GB1A 1RFKA 3AMZA 3AE1B 1ACCA 3L13A 1EU4A 2JUOA 1SGHA 3D32A 1C1YB 3S2AA 2KX3A 3ML9A 3ZO5B 4URKA 1X1MA 3RNEC 4C4VB 4DXFA 4MEMA 5HKHA 2FCNA 5G5GA 2MEKA 1QT9A 3DBHI 5DPWA 1XF5L 2PVGC 1PDXA 3U7DA 1DGJA 4EZKA 4WWOA 3X23A 1KTKA 3APDA 2QC8A 3AXCA 1PFDA 1ZPSA 4YXDB 3AE7B 2J0MA 2C9WB 3Q3NC 3BVMA 1F0ZA 2KFJA 1WRIA 4GN1A 1AWDA 2G4SA 3IVFA 1STEA 4YTPB 1D5MC 2INDC 1I4HA 1QOFA 2LGIA 4MGZE 3NVZA 3N30A 1Q1OA 5IKCM 3IHPC 4NAWB 5H8YE 1MI0A 1WGRA 3RNFC 1N5WA 4ITKA 2IY0B 3ZJVA 1JALA 1WXSA 2MBBB 2WYQA 1CMXB 4AJYB 2FIFA 2BPSA 5IO9A 3PZ7A 3QARA 4BBNC 1ISNA 2W3SA 1NENB 4XYCA 1P7EA 1OTRB 1VD2A 4WURA 4KDIC 1HTQA 4OZBA 2MH7A 1KOTA 1PGAA 1FNWA 1JWSD 2CJOA 3IBEA 1CQVA 3B08A 2BBCA 2G9HD 2KO3A 3CSFA 1MHHE 4II2B 2K8HA 4ACFA 4RGTA 1YNTE 2M0XA 2V3PA 1WX9A 1TS2A 4JGHB 3I5JC 2WX0A 1XLPA 2JXXA 4ICVA 2DZKA 3RNBC 4IC7B 1OEYJ 1E7UA 5G55A 1WH3A 3DBLB 3A9JB 3NRZA 2M19A 3AU4A 3W5VB 2MBOA 4HVBA 4LDTB 3ZXVA 3Q8EA 1EUVB 2FUHB 4TV3A 3TCAA 1AW7A 1JWAD 1FIQA 2WXJA 2V0GA 4OVUA 3VUXA 4BZAA 2QMTA 3OAWA 2RMMA 2RR9A 3GP7A 3TEWA 2LUEA 3HM6X 3V3XA 4US8A 2L8JA 4MJSA 4W9GA 3SHQA 3OLMD 3Q2AC 2NVUI 4GMVA 1J7BA 3ZDTA 3R7RA 2VZKB 1I42A 2AQ3B 3GOEA 5D94A 1I4QA 2BWES 1A5RA 3FKYA 1C3TA 2MHJA 3IAS1 5IAAC 4OZAA 2DZIA 4MGYE 1WI0A 1WJ4A 4JWUC 2KQ4X 1GUAB 3E9SA 2MJ3A 2EELA 4HXDA 3IT6B 4BOSC 2DENB 3PV1A 1GNUA 2IGGA 3KYCD 1E90A 1XEEA 5J2RA 4AUQC 1JROA 1Y8RC 3ZUNA 4RM9A 4MGKE 2K22A 5HFYA 1JQ4A 3VXWA 2HTHA 1F9JA 2WHIA 1XLOA 4E71A 1E5WA 4MT5A 1YQ3B 2JZPA 5T8IA 3I9V1 1OFFA 1E7PB 4YT0B 4TSSA 1ZOYB 4REZA 1TS3A 3AEGB 4B0MA 3AEFB 2HDEA 4JPSA 2V9HA 2C7MB 2OJWA 1R4NB 2WX1A 2Y5CA 3A1QA 2XN9C 2KC1A 2X38A 3R2IA 2WQYB 4N59A 4RGMA 2KK8A 4EKUA 3AE5B 2LI5A 1SJHD 4HCNB 4M02A 1YJJA 2LWPA 2V4LA 4KV2A 2ZCCA 1UGMA 1NI3A 3V61A 2MQJA 4HJKA 4XX5A 1TIFA 4FLHA 5D3IB 1I35A 2LEKA 4K7UA 1OEYA 2ZPNA 1TT5B 4RNAA 1C79A 3ECIA 4YSYB 2ACZB 2H88B 3AE8B 1HA5A 2N1WA 4FJZA 3RYTA 4XE0A 1KLUD 4HROA 5C2TB 1TY2A 2KQ7A 2KWCA 1V6EA 3OJ3A 3NY5A 4FA6A 2MW5A 2DYBA 2CKHB 1GJZA 4HDOA 3DHIC 2KDEB 3ZIMA 2RGFA 3AEBB 4HDQA 2INCC 2J0JA 3NS8A 1WFYA 1JWBD 2DYMA 2ZVOA 3SFDB 1L0VB 3W1SA 1TKYA 4IW0A 4IM3A 2R61A 1WE7A 1P9DU 4FXCA 2J53A 3SR6A 3VVWB 3QQ8B 1NDDA 3B2FA 3P42A 4GDLA 1WGDA 1BXTA 4J3OD 2D3CA 4MJSB 2QEJC 2ZJDA 2BS3B 1NBFC 2AL3A 3CIRB 1DOIA 1T0QC 2DAFA 4P7IA 3N3KB 2LHDA 3V05A 4DHZE 1N61A 2HE7A 4NJCA 2LD9A 5TR5A 4TKNA 4RFBA 1QOGA 2K3UA 3FAHA 1QF6A 3V6EB 1P98A 1L5PA 3ABVB 1A70A 4KIKA 3H6NA 1V1PA 4HKZE 1KM7A 2IYDB 3P4PB 1SF0A 1MG8A 1WXQA 2DWQA 3I63C 4LJPB 5JHBA 3QA8A 4ANXA 2L1AA 1FO4A 3TEYA 1B1ZA 1J19A 2A5UA 1E8WA 1C78A 4LJOB 4DHJD 1WRDB 4HPPA 3V60A 2LGDA 1FRDA 1FCLA 4E74A 1AARA 4YTMB 1AYFA 3JSVA 1WJNA 1FXTB 2GBNA 4WJQA 2Z59B 5IN7A 4ZYSA 1OQQA 3N1XC 3TIXA 3L54A 2FCSA 2SAKA 4G50A 4TUUA 3PGEA 1GB4A 1E7VA 3KWVA 2D11A 1E8YA 2OEDA 1FFVA 3A1QB 3TL5A 2GBMA 1DOXA 4YSXB 2G1EA 4EEWA 4KGTA 2OHFA 1ZP0B 4C00A 1L4ZB 1E8ZA 1G6JA 1BUIC 2K25A 1EF5A 3ZVVA 2N9LA 3P1MA 1T0RC 3PZDA 1GC6A 3ZKJC 2JSVX 1F52A 3A9KA 2JRIB 3H9DA 4KKJA 4FJVB 2L3ZA 2KTRA 3W2DA 1GT8A 2AQ2B 5AZFA 5G5HA 4KKIA 5BMHA 2K6DB 1HXYD 2LFIA 2CS4A 4LNFA 2E6XA 1KJTA 1F2RI 3L08A 2I2YA 4ZHOA 2Z0EB 3DVGX 5D7GA 1Z5SB 3AV8A 1SBBB 2KNBA 5C23A 3MC8A 3RCZA 1ESFA 3DOWA 3EFCA 2ONQA 2BS4B 2KDMA 1N63A 2X8XX 3ZW3A 1K50A 4LLGM 3ZNZB 4GDLB 3EC8A 3BZDB 1WMHA 3TEZA 1JW9D 2BKRB 1RLFA 1F2RC 1P7FA 4F8CB 4EE2A 2JWUA 2N9XA 4W9KA 3AI5A 4A90A 2KDFB 2JZZA 2LXAA 1N62A 2EMTA 4LK0M 4XWWA 4YL8A 4P6VF 2KD0A 3QIJA 1TGZB 2N7JA 4BFRA 4W9EA 1UBIA 2IZVB 1YN3A 3AEDB 3M63B 4KIKB 2MLBA 3HK0A 1UUPA 1V1PB 3DDCB 1TJEA 5BYQA 1WGYA 4YTNB 1WX8A 3UF8A 1HQRD 1E10A 2KMMA 4KZ0A 3SDLC 1NYRA 3IT4B 4EFOA 3K9OB 1EF1A 3DWMA 3MFGA 4KVGB 2NPTA 1GAQB 2BF8B 3JSVB 4NPNA 5DPTA 1OQRA 2K5PA 1EM7A 1LXDA 1D5XC 5TSSA 2Y5PA 4LNIA 2C7HA 4W9JA 1OQYA 3MTNB 3WIMA 5CTRC 4K81A 2WXOA 2KWDA 3PT2B 4EZLA 5EDSA 1UBQA 3WA0A 2LMCA 4KX6B 1VZ7A 1NI2A 3DCGA 4HKQA 1MFWA 3B1LX 3AN1A 3W1SC 3H1UA 4FULA 3I3TB 2DHZA 1VRAB 2BB5A 3VUYA 3RPFC 5GXGB 3VFKA 1TBEA 2IBIB 4YWGG 5FKAC 3ETRA 1K52A 1QLBB 3A9KB 4XZ4A 4II3B 2FAZA 1V2YA 2KTRB 1RFAA 1MJDA 4JIOU 1UD7A 2KX0A 2NBVB 1PYWD 1WYGA 2WXPA 1C76A 2KJHB 1RYJA 3HRDD 5J17A 1T5XD 2WDRB 1ENFA 3TJPA 1WY8A 2VH1A 3C8YA 4OW0A 2IO0B 4W9FA 4HJGE 3AE4B 3P4QB 1FD6A 2H89B 3FC4A 4N58A 3UI3A 4OZCA 3A4SC 4KZCA 3RT3B 4C7ZA 3MC9A 1GPXA 4PYUA 2KMCA 2DNFA 3PLUA 5E6OA 2L32A 1WMHB 3GZNB 1T0YA 4IUMB 3EGRA 1GC7A 2NTSA 4Q2JA 4A9AA 4NJ6A 4DHZB 2Y3AA 1P0RA 4M0WA 2KOXA 4FHJA 4ANVA 2RDGA 3BYTB 2PLPA 4WIPA 3K9PB 4NZLB 5J18A 2B76B 2WXFA 2MA9B 4WWPA 5AZGA 2WXNA 2KYWA 2WXQA 1MVKA 3BIID 5JXVA 2KVZA 1XLNA 3R66C 2C60A 3AECB 3VH4B 4BKSD 3JVZX 5CHWA 2WXKA 1PQSA 2WXMA 2M0AA 4BKTA 4KGRA 2BVCA 3KH0A 2D10A 1JRUA 2NPTB 1I7HA 2JY6A 3SU8X 1R7SA 1ZDXA 2K1FA 1YN4A 1EO6A 3CSTA 2M4NA 1VJKA 2L05A 5BYRA 2BGFA 2WWZA 5EE3A 4DQOC 4ZRKA 3U8ZA 1WXMA 2O2VA 4KSKC 5DPRA 3URYA 1J7AA 1FNUA 1PGBA 2FIDA 2LGXA 2KWVB 1L7YA 4DWFA 3BINA 3LXFA 1WR1A 1WJ6A 2DLBA 2K8CA 4H2AA 1TKGA 2R2OA 4L23A 4USAA 3M62B 4HLEA 1Y56A 2C7NB 1XCQL 2IY1B 2J52A 4AS1A 2FCMA 2WLBA 4JX1C 3DBLI 1BMLC 5LXHA 3BYYB 1LM8B 3DPDA 2WXIA 2WU5B 2D5GA 3Q8BA 2QDFA 3VQIA 5HG2A 1QILA 2HJ8A 2KMAA 2LZ6A 2IPKD 4GIVA 4ARIA 1WWTA 4IM2A 2Z0DB 1UF0A 1K53A 2RPQA 1EWCA 5KHOA 3AE3B 1SB3C 2MBEA 3BK1A 1UH6A 4FHKA 1KRHA 1TYGB 1IPGA 2KC2A 4G0NB 4AJWA 3P63A 4LCDE 1ZDVA 5LLIA 5KHQA 4YSZB 5AZHA 1SE2A 4FN2A 4MSMB 2BYVE 4M0WB 1SJED 1YX5B 4B6WA 3J9CA 2LVQA 4K3CA 4AP4C 4NQKE 4GU2A 1XXGA 2KDBA 4BOZB 3Q3FA 3ZNGC 2KHWB 4GLSC 4O1NA 3NZUA 2MCNB 3PSEB 2FUG1 3MJ5A 1FXIA 2BW2A 1VDVA 3NUHB 2QIEB 3DVNU 3OWEB 3KW5B 2WDVB 3N1ZC 3Q6BA 4RH6A 4L1BA 5HI1A 3PVLA 3KQ4A 2MBHA 1V1OA 4NJ7A 2NBUA 2WXGA 5CHFA 3VRBB 4A8XC 4C80A 1E9MA 1SIFA 4XDDA 3VTUA 3HM3A 2E3TA 2CHWA 3KWLA 2ICIA 3ZNHB 4B9KA 2AWTA 2LGSA 1WGHA 2FBWB 2BYEA 4W9DA 3EECA 1YQ4B 4M8MA 4PS7A 2GRIA 2QSDA 2V1YA 3Q8FA 3ZNID 3RFZB 3IXSA 1D6EC 3RNGC 3EUB2 1SSNA 2Q5WD 2PW9A 1LGRA 1L2NA 4EZJA 1R4NI 1YIWA 5DPSA 4QAYA 4CQNA 3P4RB 2BWFA 2IDYA 2LHEA 2I38A 4ZRIA 1LO5D 2O2VB 2J7QB 4ANUA 4HPLB 1GG3A 4ZRJA 2KN5A 2JPHA 2KANA 1Z2MA 1SE4A 2TSSA 1WZ0A 2PEAA 2WXLA 1TS4A 3ZLZA 4CO7A 2BB6A 2WDTB 1TZ1A 2JX5A 3RUIB 2KLCA 2HTME 3T9LA 1LQBA 3V6CB 1NEKB 2PIAA 5C1ZA 1TTNA 4RMAA 3WALA 2FNJB 4M8NA 1NYQA 2D3BA 3HVDA 4IDIA 1YOVB 4X57B 1FMAD 2MP2A 2KAJA 1FPYA 3RNAC 1SEBD 3PRMB 2HD5B 2ZVNA 2N4FA 3BY4B 1V97A 5H92C 4BAXA 2DZMA 2CU3A 2PMVA 3C0RB 3Q3MC 1U4AA 2DZJA 3NVYA 2WGSA 2NR2A 1QOBA 2GB1A 4IM0A 1YQBA 3L0WB 2MSED 1Q0WB 3B2GA 3QHTA 2VRRB 2RD0A 2D3AA 5BO4B 1IBXA 1UWMA 1XO3A 3LJ3A 2LJIA 4WAAA 4MM3A 2GOWA 1UELA 2KJRA 4JLCA 1V80A 3Q3JA 3WAMA 3TBLD 2KWUB 1C77A 2D3GA 3DBRB 4MDKE 2OJRA 2NTTA 3T3NA 4ZRPA 1P3QU 2KZRA 5AEKB 2I1KA 1CZPA 4N9F4 2ZZPB 3IG3A 2LJ5A 4AQ7A 3VTVA 4BKGA 3HHMA 3B0AA 1R4MB 1WE6A 1SXTA 2W55A 4B95A 5JHAA 4K1RB 3RNCC 1V49A 4NQLB 3AULA 1K8RB 2O6VA 3HUIA 1GOZA 5E6PA 3DVGY 3L17A 1K51A 2ZCBA 4DHJB 4DXAB 3AEAB 1ET9A 1D4BA 3N32A 3RD2A 5FR3A 2GI9A 4LNKA 1FNVA 2L83A 5JH5C 1AN8A 3RZWC 3H8HA 3GS2A 4W9LA 4MSQB 3N20C 1WZ3A 4HCPB 3IAM1 2AL6A 4ZYNA 4P1BC 3ALBA 4HRSA 1VZ8A 4M00A 3ZRCA 3W9CB 1V9JA 2KACA 4W9CA 2LVPA 3O65B 4RGOS 2IO3B 1ZGUB 3APCA 3NVVA 2OOBB 5IP4D 3NZ3A 1YJ1A 1ZW7A 3Q14C 1I4XA 3RULA 3DBHB 1IP9A 3CF4A 3DWGC 2JZ3B 1FRRA 4W9IA 3UQAA 2CU1A 1KLVA 2O6VD 1WIAA 1T3QA 2AQ1B 2BYFA 4ZRQA 2MP2B 2D2QA 4PS8A 4DDID 3EHVA 4ZDVA 3L10B 4RF0A 1FEHA 4ARCA 2PPHA 1PUTA 1UNSA 3ZTDA 3P2BA 4RM8A 4A3PA 5D2MB 2WU2B 4XGAB 2KFKA 3AB5A 2RPVA 4PK1A 2L76A 2ZW0A 3ZDMC 3LB8C 2IGDA 2M17A 2XNAC 1IBXB 4NY0A 4G3XB 4A6QA 4MM3B 4BVUC 1JCKB 4GDKA 2AEHA 1PGXA 4WWMA 2UWQA 4MELA 2KJ6A 4DBGA 3GE3C 4A3OA 2WNMA 2DBYA 1GTHA 4MGIE 1IGCA 5MPOA 4HK2A 5C3JB 3VAWA 2LRWA 3MHSD 2IJ0A 2L0FA 2RDHA 2GLSA 2KTFA 2V3NA 2MJDA 2G3QB 3ZJUA 1T0SC 2CHZA 2BT6A 3PHWB 2KLGA 1V8CA 3U2SC 3R3MA 2NS5A 1I4GA 4BKSA 2O6VB 2XEWA 2MWSB 4FBJB 2YEPB 2XK5A 3MHZA 3BWUD 4LDTD 2EKIA 4ICUA 2ZW1A 4TMAB 1HZ5A 3VRAB 3W5UB 3RMKC 4GXBA 3KLSX 1YJIA 3RN9C 3GE8C 1HE8A 4AOFA 1WXAA 4I6PA 3JYUA 5D6JB 4OVZA 5LXIB 3ZXRA 1XT9B 1WM2A 2YVCA 2K39A 2CJNA 2MX2A 2K8BA 3NOBA 3M95A 1TKEA 4JL9A 1QKZA 2PVOD 4P16A 4CHKA 5E6JA 1XQQA 4JWSC 1ZUD2 1IGDA 3QC8B 1ZE3D 2PTLA 2VZKD 3ML8A 3OG5A 2D07B 2EKEC 1B9RA 2N1VA 2IO1B 1VLBA 1UGJA 3E56A 1RAXA 1NVID 1FM0D 2N9PC 3DBSA 4BBNF 4IWPA 4KDLB 4ASWC 2J42A 4C7YA 2JVCA 3SFEB 1QZEA 3NJTA 2M8SA 3N9YC 3PPAA 4AWJA 1F77A 4CYEA 3U52E 1XLQA 1N5XA 3MJWA 4OHJA 1GTEA 2BTEA 3TSSA 5BMGA 2V4IB 3KVFB 4HEA1 1J0GA 3PREA 4NAMA 2R2QA 2KFKB 4IG7B 2HJ1A 3GZNI 2QHOA 3NS1A 2WS3B 3NG0A 3SD5A 3RI7C 2YLMA 1ZXIA 3SEBA 1WM3A 3ZGZA 2KQSA 1SE3A 4N6EB 4WJNA 1WGGA 3WAOA 3VDZA 4GDKB 3DHGC 3QWZB 2QILA 2IGHA 1SE9A 2N7EA 4L2YA 2WXRA 1J8CA 5I4DA 2RSUA 2N9KA 2LGYA 4XC2A 2GMIC 3HIZA 3ZRFA 1MHXA 2GBKA 2Y5BB 4K7SA 3TEXA 1TS5A 1WR6E 2YEPF 3OJ4B 2WP9B 1JWUD 2J0KA 4K7WA 1T6BX 4HPMB 2JRHA 4ANWA 5BMIA 4KSLC 3A4RA 1D3ZA 1C4PA 3H7PA 3I57A 3TMPB 2KVRA 2XK5B 3H7SA 3VR9B 2L00B 2MBQA 4IWQA 3AH7A 3Q3OC 4DDGD 4S17A 4A55A 1J7CA 4JE3B 3T8MA 3QAQA 1DYQA 2JF5A 2N0SB 2ZNVB 2INNE 1EWYC 2W82A 5L83A 1ZXHA 3VTWA 4RCOA 2IO2B 1C4AA 1H8CA 4EOYA 2WDQB 1RWSA 4HWIB 4W9HA 3ZQ4A 1TZOA 3CWIA 3KUZA 1VZ6A 4I6NB 4FADA 1JWMD 3AM9A 2N7DA 2PJHA 4GGQA 2GBRA 2C5LC 4GOCA 3U30A 1FCCC 3GB1A 1WF9A 3FILA 5AUIA 3Q8AA 2K9XA 3IFWB 4PT5A 2UU7A 3PS6A 1E0ZA 3EA6A 3NZSA 2M56B 1EU3A 4ZOHC 1H7WA 1L0XB 3BVGA 4G11A 3UINB 2N9EB 3MC0B 1F1HA 3EFUA 3PLVA 4DK5A 1I4RA 1KFYB 3QJZA 4WAFA 3KYDD 1UZXB 1YMHE 1H4RA 2ZEQA 4ZHPA 1WX7A 3MP9A 1CK1A 3X0WA 1WSPA 5FK9C 2W54A 2DYOA 1QOAA 3DVNV 1KLGD 3LDZE 2PE6B 4UDUC 1S1QB 1RRBA 5EE0A 2JWZA 2NBWB 3T3OA 2EMSA 3CF6E 1JMLA 3UIOB 2JQRB 2JU6X 2L0TA 3M3JA 3QX1A 2RDBC 1LFDA 1DOYA 2LRUA 2LUMA 2PKOA 4WJPA 2ZNVC 4MH8A 2L7RA 4XWTA 3LYYA 4P1CC 2I1JA 3U7ZA 3WCQA 5BYSA 1L6UA 1TY0A 4OVVA 4LTUA 1ET6A 2AX5A 3O13A 4IWOA 3AE9B 3AE6B 1IUEA 4K3BA 1C4CA 3AU5A 1L4DB 2QCZA 4F7ZA 1MPEA 3ONSA 3H7PB 1L0YB 3AE2B 3Q8CA 2UYZB 3R2TA 3KUDB 3AEEB 1XD3B 5G2NA 4US9A 4WQOB 2PE9A 5CX3A 2DAJA 4KGSA 2Z8LA 2J4XA 3VH3B 3U4EG 4GSWA 2KDIA 2REXA 2M1MA 4NNJB 1OGWA 3Q69A 4E3CA 3C19A 3L4PA 2L52A 2NCNA 1E8XA 2MRPA 2W9NA 5E6NA 1FXAA 2CR5A 5GMVA 1SIJA 3DQVA 3V62A 1HTOA 3RZFA 4R3DA 1JRPA 3ENEA 4RGNA 2WXHA 3VHTC 2FE8A 4C4VA 1D5ZC 2KT7A 2KN4A 1MG4A 5HHDG 4LNNA 3R7QA 3APFA 4WJOA 1IYFA 1XCTL 3FILB 1YX6B 2B3AA 2ASQA 3A33B 1BT0A 3WAPA 1M94A 1WJUA 4XDCA 1FFUA 1Q5WB 2LXCA 4WWNA 3PHXB 2BKFA 4DXGA 2SEBD 2ON8A 4LNOA 2LASA 5D3DA 1VCBA 1VR9A 2NMQA 2XBBC 4RF1A 2VH2A 2QJLA 5IOIA 3CMMB 1V86A 4NAWA 5JZEB 4IOIE 5EE1A 3NHEB 1H7XA 4FJYA 4PS3A 2K0PA 3UIPB 2LVOA 2FCQA 4PYZA 3NVWA 1KF6B 4M01A 2BYTA 4WQMA 3B9JA 5LNK1 3VR8B 1C9FA 3R8BA 3QCAA 2MJEA 4JQWC 4EUTA 2JXTA 5IA7A 1ROEA 1WXVA 1ZKHA 1S3SG 3DHHC 1P1AA 1UWXA 4WH4A 1N60A 2K6QA 5CHVC 4F1SA 3PZ8A 5AUKA 3P4SB 1YN5A 1CJEA 3DBRI 1N6ZA 3HVZA 2JYEA 2ZPYA 3L16A 2CHXA 4TQ0A 1WGKA 4IKGA 1Q10A 1HEZE 1V5OA 2V3SA 4MH0E 5EE9A 4GB9A 3W1YA 5L95C 4B0EA 2BQQA 1V81A 2G4DB 2JT4B 2KXJA 3UQBA 1R4MI 4S0RA 3PO0A 1I4PA 4MACA 3TUOA 2G45B 3QK0A 1RM6C 3KUCB 4A20A 2JYTA 2AYOB 2INPE 3WANA 3BVZA 5FR6A 1M4VA 3VUWA 1HZ6A 3ZTCA
chains in the Genus database with same CATH topology
1UGJA 3E56A 1OQQA 3J9CA 4ZYSA 3ZYYX 1NVID 1E6EB 1FM0D 4TQ1A 4C56C 2SAKA 1GB4A 4D2KA 3KWVA 1XXGA 2J42A 3ZJTA 4C7YA 4GLSC 4O1NA 2OEDA 3SFEB 1FFVA 3N9YC 2W3RA 2BS2B 2FUG1 1DOXA 4YSXB 1F77A 1L6VA 3MJ5A 1KH0A 2G1EA 3U52E 1FXIA 4KGTA 2OHFA 1QQRA 1ZP0B 2BW2A 1XLQA 1VDVA 3BK2A 2QIEB 3NUHB 1N5XA 1GB1A 2BTEA 1L4ZB 1GTEA 3OWEB 4OHJA 3TSSA 1RFKA 2WDVB 1BUIC 3AMZA 5BMGA 2V4IB 4RH6A 3AE1B 4L1BA 1ACCA 5HI1A 2N9LA 1EU4A 3KQ4A 4HEA1 1V1OA 3P1MA 4NAMA 2WXGA 3VRBB 4A8XC 4C80A 1E9MA 4XDDA 4DXFA 2E3TA 3NS1A 2WS3B 2JSVX 5G5GA 1ZXIA 2MEKA 3KWLA 3SEBA 1QT9A 2ICIA 3ZGZA 4KKJA 3W2DA 1SE3A 1XF5L 4N6EB 2FBWB 2PVGC 1GT8A 1YQ4B 1PDXA 2AQ2B 5G5HA 4KKIA 1DGJA 4GDKB 5BMHA 2GRIA 2QSDA 1HXYD 2QILA 3Q8FA 2IGHA 1KTKA 3RFZB 2LFIA 3IXSA 1D6EC 4L2YA 1PFDA 1ZPSA 1SSNA 4YXDB 3AE7B 2E6XA 2PW9A 2Q5WD 1F2RI 2WXRA 5I4DA 2I2YA 4ZHOA 3BVMA 5D7GA 2N9KA 1F0ZA 1WRIA 3AV8A 4CQNA 1SBBB 3P4RB 1AWDA 1STEA 2IDYA 4YTPB 1D5MC 2I38A 1MHXA 2LHEA 1LO5D 1I4HA 1QOFA 1ESFA 2LGIA 3NVZA 3TEXA 2ONQA 1TS5A 2BS4B 2KDMA 2YEPF 1N63A 1K50A 4LLGM 1SE4A 2TSSA 2WXLA 4GDLB 4NAWB 1TS4A 3BZDB 5H8YE 2WP9B 1MI0A 1JWUD 3TEZA 2BB6A 1JW9D 1T6BX 1N5WA 1F2RC 2JX5A 1P7FA 4ITKA 2HTME 5BMIA 3ZJVA 1JALA 4EE2A 1C4PA 1NEKB 2JWUA 3I57A 2PIAA 4A90A 3VR9B 3AH7A 3PZ7A 1N62A 1NYQA 4LK0M 4XWWA 4P6VF 3HVDA 4A55A 2W3SA 1NENB 1J7CA 1P7EA 4JE3B 4IDIA 4WURA 1DYQA 1FMAD 2N7JA 2N0SB 2KAJA 4OZBA 2INNE 2MH7A 1EWYC 2W82A 1SEBD 1PGAA 1FNWA 1JWSD 1YN3A 3AEDB 1ZXHA 2CJOA 1V97A 1UUPA 1CQVA 5H92C 1V1PB 4RCOA 1TJEA 5BYQA 1C4AA 2CU3A 2BBCA 2PMVA 4YTNB 2G9HD 2WDQB 1HQRD 3NVYA 1RWSA 1MHHE 1E10A 2KMMA 1QOBA 3ZQ4A 1TZOA 2GB1A 3CWIA 1NYRA 1VZ6A 1YNTE 3IT4B 2V3PA 4RGTA 1JWMD 1TS2A 3AM9A 3DWMA 3MFGA 1XLPA 3B2GA 1FCCC 3GB1A 1GAQB 1IBXA 1UWMA 1XO3A 2LJIA 3FILA 5AUIA 1OQRA 2K5PA 1EM7A 3Q8AA 2K9XA 1D5XC 5TSSA 4PT5A 3NRZA 2Y5PA 1E0ZA 3EA6A 1C77A 1EU3A 2M19A 2M56B 3W5VB 4ZOHC 1H7WA 2WXOA 2KWDA 2NTTA 3T3NA 4ZRPA 1L0XB 3BVGA 2LMCA 3Q8EA 4KX6B 1VZ7A 4HKQA 3MC0B 1CZPA 3AN1A 1I4RA 1AW7A 1KFYB 4AQ7A 1JWAD 4WAFA 1FIQA 1VRAB 2BB5A 2WXJA 1YMHE 3RPFC 4ZHPA 1SXTA 5GXGB 2W55A 2V0GA 2QMTA 3MP9A 1CK1A 1WSPA 2RMMA 3GP7A 3TEWA 5FK9C 4YWGG 3V3XA 4US8A 5FKAC 3ETRA 2W54A 1K52A 2DYOA 1QLBB 3HUIA 1GOZA 1QOAA 1KLGD 1K51A 1J7BA 3AEAB 4UDUC 1ET9A 1D4BA 5FR3A 1PYWD 2GI9A 1WYGA 2WXPA 1C76A 5EE0A 2VZKB 2AQ3B 3T3OA 1FNVA 1RYJA 2L83A 1T5XD 2WDRB 1ENFA 3HRDD 1I4QA 1AN8A 1JMLA 3GS2A 3H8HA 3IAS1 3C8YA 2JQRB 2JU6X 4OZAA 4OW0A 3IAM1 3EUB2 1DOYA 4JWUC 4HRSA 4HJGE 3AE4B 2LUMA 2PKOA 3P4QB 2KQ4X 4MH8A 1VZ8A 4XWTA 1FD6A 3E9SA 2MJ3A 3LYYA 2EELA 3IT6B 2H89B 3U7ZA 2KACA 3W9CB 3WCQA 5BYSA 3FC4A 4N58A 1L6UA 1TY0A 3UI3A 4OZCA 4RGOS 4C7ZA 1GPXA 2IGGA 4LTUA 1ET6A 2AX5A 3O13A 3NVVA 3AE9B 2L32A 3AE6B 1XEEA 1IUEA 1C4CA 3NZ3A 3EGRA 1L4DB 2NTSA 1JROA 1I4XA 4Q2JA 1MPEA 4A9AA 2K22A 2Y3AA 5HFYA 1JQ4A 1HZ6A 4M0WA 1L0YB 3AE2B 1XLOA 3Q8CA 3R2TA 2RDGA 3CF4A 3DWGC 3AEEB 1FRRA 4MT5A 1YQ3B 2JZPA 3BYTB 5T8IA 3I9V1 4US9A 1OFFA 2PLPA 4WIPA 1E7PB 4KGSA 4YT0B 4TSSA 2Z8LA 1ZOYB 4NZLB 2J4XA 4REZA 1TS3A 3AEGB 3U4EG 4B0MA 2B76B 2WXFA 3AEFB 2HDEA 4JPSA 1T3QA 3Q69A 2AQ1B 4ZRQA 2Y5CA 3L4PA 2WXNA 2L52A 2XN9C 2X38A 2WXQA 1MVKA 3BIID 4RF0A 1FEHA 5JXVA 4ARCA 1FXAA 3R2IA 1XLNA 2WQYB 4N59A 4RGMA 1SIJA 3AE5B 1PUTA 1UNSA 1SJHD 3AECB 1YJJA 2WU2B 4R3DA 1NI3A 1JRPA 2WXKA 2WXMA 4RGNA 2WXHA 5D3IB 3AB5A 2RPVA 2LEKA 2FE8A 2M0AA 4RNAA 1C79A 1D5ZC 4YSYB 2KN4A 4KGRA 2ACZB 2H88B 3AE8B 1HA5A 5HHDG 4XE0A 2ZW0A 1KLUD 3LB8C 2IGDA 1I7HA 4HROA 2XNAC 1R7SA 5C2TB 1ZDXA 1TY2A 1IBXB 1XCTL 4A6QA 3FILB 1YN4A 4MM3B 1JCKB 1VJKA 1PGXA 5BYRA 3AEBB 4XDCA 1FFUA 4WWMA 5EE3A 4DQOC 4DXGA 2SEBD 1JWBD 2DYMA 2ON8A 2WNMA 5D3DA 3SFDB 1L0VB 2DBYA 3W1SA 1GTHA 1VR9A 1TKYA 1IGCA 5MPOA 2R61A 5C3JB 2NMQA 4FXCA 2IJ0A 2J53A 2RDHA 3SR6A 4RF1A 3URYA 2V3NA 2MJDA 2QJLA 1J7AA 3ZJUA 1FNUA 1PGBA 3B2FA 3P42A 4IOIE 5EE1A 1H7XA 2K0PA 1BXTA 2BT6A 4J3OD 3NVWA 1KF6B 1V8CA 3U2SC 2BYTA 4WQMA 3B9JA 1I4GA 5LNK1 3VR8B 2QEJC 3LXFA 1C9FA 3R8BA 2BS3B 2DLBA 2MJEA 3CIRB 4H2AA 1TKGA 1DOIA 4L23A 4USAA 2JXTA 1ROEA 1Y56A 1XCQL 2YEPB 2J52A 2LHDA 3V05A 4AS1A 1UWXA 3MHZA 3BWUD 4WH4A 1N60A 1N61A 4NJCA 2EKIA 2WLBA 4JX1C 1BMLC 2ZW1A 3BYYB 3PZ8A 5AUKA 4TMAB 3P4SB 2WXIA 1HZ5A 3VRAB 1YN5A 4RFBA 3W5UB 2WU5B 2D5GA 1CJEA 1QOGA 2K3UA 2JYEA 3FAHA 3HVZA 3Q8BA 3VQIA 3KLSX 1QILA 5HG2A 4TQ0A 1QF6A 1WGKA 1YJIA 1Q10A 2IPKD 4IKGA 1HEZE 4ARIA 1WWTA 1L5PA 5EE9A 3ABVB 1A70A 1K53A 1V1PA 4HKZE 4OVZA 1EWCA 4B0EA 3AE3B 3P4PB 1SF0A 1WXQA 1SB3C 2DWQA 3BK1A 1KRHA 2L1AA 1TYGB 3PO0A 1FO4A 1I4PA 1B1ZA 4MACA 3TEYA 2CJNA 3TUOA 1C78A 1TKEA 3P63A 1QKZA 2PVOD 4P16A 1ZDVA 5E6JA 4JWSC 1ZUD2 1FRDA 1IGDA 1FCLA 1RM6C 4YSZB 4YTMB 1AYFA 1SE2A 1ZE3D 2JYTA 2PTLA 2VZKD 2INPE 3BVZA 1M4VA 1B9RA 1SJED 1VLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQQ A;  1N62 A;  3ZYY X;  1NVI D;  1E6E B;  1FM0 D;  1NYQ A;  1RYJ A;  2L83 A;  2WDR B;  1VJK A;  3HRD D;  4P6V F;  2W3S A;  1NEN B;  3AEB B;  1J7C A;  1FFU A;  4IDI A;  4WWM A;  2JQR B;  5EE3 A;  4C7Y A;  1FMA D;  1JWB D;  3SFE B;  1FFV A;  2KAJ A;  2N0S B;  3EUB 2;  1DOY A;  4JWU C;  4HRS A;  2MH7 A;  2BS2 B;  1L0V B;  3SFD B;  3AE4 B;  1EWY C;  2DBY A;  3P4Q B;  4YSX B;  2PKO A;  1DOX A;  1GTH A;  1L6V A;  1TKY A;  3AED B;  2CJO A;  2G1E A;  1V97 A;  2MJ3 A;  5C3J B;  1FXI A;  2OHF A;  2H89 B;  3W9C B;  1ZP0 B;  1VDV A;  1XLQ A;  2W3R A;  5H92 C;  2QIE B;  3WCQ A;  1N5X A;  1TJE A;  1GTE A;  4FXC A;  2CU3 A;  3FC4 A;  1RFK A;  4N58 A;  2WDV B;  4YTN B;  1L6U A;  3SR6 A;  3AMZ A;  2WDQ B;  2MJD A;  2QJL A;  1J7A A;  3AE1 B;  4C7Z A;  5MPO A;  3NVY A;  1GPX A;  4LTU A;  1RWS A;  3B2F A;  2AX5 A;  1E10 A;  5EE1 A;  1H7X A;  2KMM A;  1QOB A;  3NVV A;  3AE9 B;  3P1M A;  2BT6 A;  3VRB B;  3CWI A;  3AE6 B;  1NYR A;  1IUE A;  3NVW A;  1KF6 B;  1V8C A;  5AUI A;  4C80 A;  1E9M A;  4WQM A;  3B9J A;  2E3T A;  3NS1 A;  2WS3 B;  3VR8 B;  3AM9 A;  3LXF A;  1JRO A;  3DWM A;  2BS3 B;  5G5G A;  1ZXI A;  2MJE A;  3CIR B;  1TKG A;  3KWL A;  1DOI A;  1QT9 A;  1XLP A;  4USA A;  2K22 A;  4A9A A;  3B2G A;  1JQ4 A;  1ROE A;  1GAQ B;  1UWM A;  3AE2 B;  1XLO A;  1XO3 A;  2FBW B;  4N6E B;  2PVG C;  1GT8 A;  1YQ4 B;  3CF4 A;  1PDX A;  3AEE B;  1OQR A;  2K5P A;  3DWG C;  1FRR A;  1DGJ A;  2K9X A;  1YQ3 B;  5G5H A;  1N60 A;  1N61 A;  4US9 A;  2EKI A;  1OFF A;  2WLB A;  3NRZ A;  4JX1 C;  1E0Z A;  1E7P B;  4YT0 B;  5AUK A;  3P4S B;  1ZOY B;  2M56 B;  2M19 A;  3VRA B;  3W5U B;  3AEG B;  1PFD A;  2WU5 B;  2B76 B;  3AE7 B;  4YXD B;  1CJE A;  1H7W A;  1QOG A;  2Q5W D;  3FAH A;  3AEF B;  3HVZ A;  4ZOH C;  1T3Q A;  4ZHO A;  1QF6 A;  1WGK A;  1YJI A;  2Y5C A;  4KX6 B;  3L4P A;  2L52 A;  1F0Z A;  1WRI A;  3AV8 A;  1WWT A;  3P4R B;  1AWD A;  1L5P A;  5EE9 A;  1CZP A;  3BII D;  3ABV B;  3AN1 A;  1A70 A;  4YTP B;  1FXA A;  1XLN A;  2WQY B;  4N59 A;  1QOF A;  1KFY B;  1SIJ A;  3AE3 B;  3AE5 B;  3P4P B;  1JWA D;  1FIQ A;  1PUT A;  1SB3 C;  1SF0 A;  1WXQ A;  2DWQ A;  3NVZ A;  1KRH A;  2BS4 B;  3AEC B;  1YJJ A;  1TYG B;  3RPF C;  4ZHP A;  1N63 A;  3PO0 A;  2W55 A;  5GXG B;  1FO4 A;  2WU2 B;  2CJN A;  1NI3 A;  5H8Y E;  1JRP A;  2WP9 B;  1TKE A;  3AB5 A;  3P63 A;  2LEK A;  4US8 A;  1JW9 D;  3ETR A;  2PVO D;  2W54 A;  1N5W A;  4JWS C;  1ZUD 2;  1FRD A;  1QLB B;  2JX5 A;  4YSY B;  3HUI A;  1RM6 C;  4ITK A;  2ACZ B;  2H88 B;  3AE8 B;  4YSZ B;  4YTM B;  1AYF A;  1QOA A;  2HTM E;  1JAL A;  1J7B A;  3AEA B;  3LB8 C;  4HRO A;  1I7H A;  1NEK B;  3W5V B;  1R7S A;  5C2T B;  2PIA A;  1B9R A;  3VR9 B;  1WYG A;  5EE0 A;  3AH7 A;  1VLB A; 
#chains in the Genus database with same CATH topology
 3ZYY X;  3A9J A;  3UGB B;  1E6E B;  4TQ1 A;  3PTF C;  4C56 C;  3PRZ A;  3N1Y C;  4D2K A;  2GBJ A;  3ZJT A;  2DX5 B;  2A4Z A;  2W3R A;  2BS2 B;  3PRP B;  2KKC A;  4I6L B;  4J6I A;  1L6V A;  1KH0 A;  5DCN A;  3JW0 X;  1V5T A;  1QQR A;  1YD8 U;  3BK2 A;  1WYW B;  1GB1 A;  1RFK A;  3AMZ A;  3AE1 B;  1ACC A;  3L13 A;  1EU4 A;  2JUO A;  1SGH A;  3D32 A;  1C1Y B;  3S2A A;  2KX3 A;  3ML9 A;  3ZO5 B;  4URK A;  1X1M A;  3RNE C;  4C4V B;  4DXF A;  4MEM A;  5HKH A;  2FCN A;  5G5G A;  2MEK A;  1QT9 A;  3DBH I;  5DPW A;  1XF5 L;  2PVG C;  1PDX A;  3U7D A;  1DGJ A;  4EZK A;  4WWO A;  3X23 A;  1KTK A;  3APD A;  2QC8 A;  3AXC A;  1PFD A;  1ZPS A;  4YXD B;  3AE7 B;  2J0M A;  2C9W B;  3Q3N C;  3BVM A;  1F0Z A;  2KFJ A;  1WRI A;  4GN1 A;  1AWD A;  2G4S A;  3IVF A;  1STE A;  4YTP B;  1D5M C;  2IND C;  1I4H A;  1QOF A;  2LGI A;  4MGZ E;  3NVZ A;  3N30 A;  1Q1O A;  5IKC M;  3IHP C;  4NAW B;  5H8Y E;  1MI0 A;  1WGR A;  3RNF C;  1N5W A;  4ITK A;  2IY0 B;  3ZJV A;  1JAL A;  1WXS A;  2MBB B;  2WYQ A;  1CMX B;  4AJY B;  2FIF A;  2BPS A;  5IO9 A;  3PZ7 A;  3QAR A;  4BBN C;  1ISN A;  2W3S A;  1NEN B;  4XYC A;  1P7E A;  1OTR B;  1VD2 A;  4WUR A;  4KDI C;  1HTQ A;  4OZB A;  2MH7 A;  1KOT A;  1PGA A;  1FNW A;  1JWS D;  2CJO A;  3IBE A;  1CQV A;  3B08 A;  2BBC A;  2G9H D;  2KO3 A;  3CSF A;  1MHH E;  4II2 B;  2K8H A;  4ACF A;  4RGT A;  1YNT E;  2M0X A;  2V3P A;  1WX9 A;  1TS2 A;  4JGH B;  3I5J C;  2WX0 A;  1XLP A;  2JXX A;  4ICV A;  2DZK A;  3RNB C;  4IC7 B;  1OEY J;  1E7U A;  5G55 A;  1WH3 A;  3DBL B;  3A9J B;  3NRZ A;  2M19 A;  3AU4 A;  3W5V B;  2MBO A;  4HVB A;  4LDT B;  3ZXV A;  3Q8E A;  1EUV B;  2FUH B;  4TV3 A;  3TCA A;  1AW7 A;  1JWA D;  1FIQ A;  2WXJ A;  2V0G A;  4OVU A;  3VUX A;  4BZA A;  2QMT A;  3OAW A;  2RMM A;  2RR9 A;  3GP7 A;  3TEW A;  2LUE A;  3HM6 X;  3V3X A;  4US8 A;  2L8J A;  4MJS A;  4W9G A;  3SHQ A;  3OLM D;  3Q2A C;  2NVU I;  4GMV A;  1J7B A;  3ZDT A;  3R7R A;  2VZK B;  1I42 A;  2AQ3 B;  3GOE A;  5D94 A;  1I4Q A;  2BWE S;  1A5R A;  3FKY A;  1C3T A;  2MHJ A;  3IAS 1;  5IAA C;  4OZA A;  2DZI A;  4MGY E;  1WI0 A;  1WJ4 A;  4JWU C;  2KQ4 X;  1GUA B;  3E9S A;  2MJ3 A;  2EEL A;  4HXD A;  3IT6 B;  4BOS C;  2DEN B;  3PV1 A;  1GNU A;  2IGG A;  3KYC D;  1E90 A;  1XEE A;  5J2R A;  4AUQ C;  1JRO A;  1Y8R C;  3ZUN A;  4RM9 A;  4MGK E;  2K22 A;  5HFY A;  1JQ4 A;  3VXW A;  2HTH A;  1F9J A;  2WHI A;  1XLO A;  4E71 A;  1E5W A;  4MT5 A;  1YQ3 B;  2JZP A;  5T8I A;  3I9V 1;  1OFF A;  1E7P B;  4YT0 B;  4TSS A;  1ZOY B;  4REZ A;  1TS3 A;  3AEG B;  4B0M A;  3AEF B;  2HDE A;  4JPS A;  2V9H A;  2C7M B;  2OJW A;  1R4N B;  2WX1 A;  2Y5C A;  3A1Q A;  2XN9 C;  2KC1 A;  2X38 A;  3R2I A;  2WQY B;  4N59 A;  4RGM A;  2KK8 A;  4EKU A;  3AE5 B;  2LI5 A;  1SJH D;  4HCN B;  4M02 A;  1YJJ A;  2LWP A;  2V4L A;  4KV2 A;  2ZCC A;  1UGM A;  1NI3 A;  3V61 A;  2MQJ A;  4HJK A;  4XX5 A;  1TIF A;  4FLH A;  5D3I B;  1I35 A;  2LEK A;  4K7U A;  1OEY A;  2ZPN A;  1TT5 B;  4RNA A;  1C79 A;  3ECI A;  4YSY B;  2ACZ B;  2H88 B;  3AE8 B;  1HA5 A;  2N1W A;  4FJZ A;  3RYT A;  4XE0 A;  1KLU D;  4HRO A;  5C2T B;  1TY2 A;  2KQ7 A;  2KWC A;  1V6E A;  3OJ3 A;  3NY5 A;  4FA6 A;  2MW5 A;  2DYB A;  2CKH B;  1GJZ A;  4HDO A;  3DHI C;  2KDE B;  3ZIM A;  2RGF A;  3AEB B;  4HDQ A;  2INC C;  2J0J A;  3NS8 A;  1WFY A;  1JWB D;  2DYM A;  2ZVO A;  3SFD B;  1L0V B;  3W1S A;  1TKY A;  4IW0 A;  4IM3 A;  2R61 A;  1WE7 A;  1P9D U;  4FXC A;  2J53 A;  3SR6 A;  3VVW B;  3QQ8 B;  1NDD A;  3B2F A;  3P42 A;  4GDL A;  1WGD A;  1BXT A;  4J3O D;  2D3C A;  4MJS B;  2QEJ C;  2ZJD A;  2BS3 B;  1NBF C;  2AL3 A;  3CIR B;  1DOI A;  1T0Q C;  2DAF A;  4P7I A;  3N3K B;  2LHD A;  3V05 A;  4DHZ E;  1N61 A;  2HE7 A;  4NJC A;  2LD9 A;  5TR5 A;  4TKN A;  4RFB A;  1QOG A;  2K3U A;  3FAH A;  1QF6 A;  3V6E B;  1P98 A;  1L5P A;  3ABV B;  1A70 A;  4KIK A;  3H6N A;  1V1P A;  4HKZ E;  1KM7 A;  2IYD B;  3P4P B;  1SF0 A;  1MG8 A;  1WXQ A;  2DWQ A;  3I63 C;  4LJP B;  5JHB A;  3QA8 A;  4ANX A;  2L1A A;  1FO4 A;  3TEY A;  1B1Z A;  1J19 A;  2A5U A;  1E8W A;  1C78 A;  4LJO B;  4DHJ D;  1WRD B;  4HPP A;  3V60 A;  2LGD A;  1FRD A;  1FCL A;  4E74 A;  1AAR A;  4YTM B;  1AYF A;  3JSV A;  1WJN A;  1FXT B;  2GBN A;  4WJQ A;  2Z59 B;  5IN7 A;  4ZYS A;  1OQQ A;  3N1X C;  3TIX A;  3L54 A;  2FCS A;  2SAK A;  4G50 A;  4TUU A;  3PGE A;  1GB4 A;  1E7V A;  3KWV A;  2D11 A;  1E8Y A;  2OED A;  1FFV A;  3A1Q B;  3TL5 A;  2GBM A;  1DOX A;  4YSX B;  2G1E A;  4EEW A;  4KGT A;  2OHF A;  1ZP0 B;  4C00 A;  1L4Z B;  1E8Z A;  1G6J A;  1BUI C;  2K25 A;  1EF5 A;  3ZVV A;  2N9L A;  3P1M A;  1T0R C;  3PZD A;  1GC6 A;  3ZKJ C;  2JSV X;  1F52 A;  3A9K A;  2JRI B;  3H9D A;  4KKJ A;  4FJV B;  2L3Z A;  2KTR A;  3W2D A;  1GT8 A;  2AQ2 B;  5AZF A;  5G5H A;  4KKI A;  5BMH A;  2K6D B;  1HXY D;  2LFI A;  2CS4 A;  4LNF A;  2E6X A;  1KJT A;  1F2R I;  3L08 A;  2I2Y A;  4ZHO A;  2Z0E B;  3DVG X;  5D7G A;  1Z5S B;  3AV8 A;  1SBB B;  2KNB A;  5C23 A;  3MC8 A;  3RCZ A;  1ESF A;  3DOW A;  3EFC A;  2ONQ A;  2BS4 B;  2KDM A;  1N63 A;  2X8X X;  3ZW3 A;  1K50 A;  4LLG M;  3ZNZ B;  4GDL B;  3EC8 A;  3BZD B;  1WMH A;  3TEZ A;  1JW9 D;  2BKR B;  1RLF A;  1F2R C;  1P7F A;  4F8C B;  4EE2 A;  2JWU A;  2N9X A;  4W9K A;  3AI5 A;  4A90 A;  2KDF B;  2JZZ A;  2LXA A;  1N62 A;  2EMT A;  4LK0 M;  4XWW A;  4YL8 A;  4P6V F;  2KD0 A;  3QIJ A;  1TGZ B;  2N7J A;  4BFR A;  4W9E A;  1UBI A;  2IZV B;  1YN3 A;  3AED B;  3M63 B;  4KIK B;  2MLB A;  3HK0 A;  1UUP A;  1V1P B;  3DDC B;  1TJE A;  5BYQ A;  1WGY A;  4YTN B;  1WX8 A;  3UF8 A;  1HQR D;  1E10 A;  2KMM A;  4KZ0 A;  3SDL C;  1NYR A;  3IT4 B;  4EFO A;  3K9O B;  1EF1 A;  3DWM A;  3MFG A;  4KVG B;  2NPT A;  1GAQ B;  2BF8 B;  3JSV B;  4NPN A;  5DPT A;  1OQR A;  2K5P A;  1EM7 A;  1LXD A;  1D5X C;  5TSS A;  2Y5P A;  4LNI A;  2C7H A;  4W9J A;  1OQY A;  3MTN B;  3WIM A;  5CTR C;  4K81 A;  2WXO A;  2KWD A;  3PT2 B;  4EZL A;  5EDS A;  1UBQ A;  3WA0 A;  2LMC A;  4KX6 B;  1VZ7 A;  1NI2 A;  3DCG A;  4HKQ A;  1MFW A;  3B1L X;  3AN1 A;  3W1S C;  3H1U A;  4FUL A;  3I3T B;  2DHZ A;  1VRA B;  2BB5 A;  3VUY A;  3RPF C;  5GXG B;  3VFK A;  1TBE A;  2IBI B;  4YWG G;  5FKA C;  3ETR A;  1K52 A;  1QLB B;  3A9K B;  4XZ4 A;  4II3 B;  2FAZ A;  1V2Y A;  2KTR B;  1RFA A;  1MJD A;  4JIO U;  1UD7 A;  2KX0 A;  2NBV B;  1PYW D;  1WYG A;  2WXP A;  1C76 A;  2KJH B;  1RYJ A;  3HRD D;  5J17 A;  1T5X D;  2WDR B;  1ENF A;  3TJP A;  1WY8 A;  2VH1 A;  3C8Y A;  4OW0 A;  2IO0 B;  4W9F A;  4HJG E;  3AE4 B;  3P4Q B;  1FD6 A;  2H89 B;  3FC4 A;  4N58 A;  3UI3 A;  4OZC A;  3A4S C;  4KZC A;  3RT3 B;  4C7Z A;  3MC9 A;  1GPX A;  4PYU A;  2KMC A;  2DNF A;  3PLU A;  5E6O A;  2L32 A;  1WMH B;  3GZN B;  1T0Y A;  4IUM B;  3EGR A;  1GC7 A;  2NTS A;  4Q2J A;  4A9A A;  4NJ6 A;  4DHZ B;  2Y3A A;  1P0R A;  4M0W A;  2KOX A;  4FHJ A;  4ANV A;  2RDG A;  3BYT B;  2PLP A;  4WIP A;  3K9P B;  4NZL B;  5J18 A;  2B76 B;  2WXF A;  2MA9 B;  4WWP A;  5AZG A;  2WXN A;  2KYW A;  2WXQ A;  1MVK A;  3BII D;  5JXV A;  2KVZ A;  1XLN A;  3R66 C;  2C60 A;  3AEC B;  3VH4 B;  4BKS D;  3JVZ X;  5CHW A;  2WXK A;  1PQS A;  2WXM A;  2M0A A;  4BKT A;  4KGR A;  2BVC A;  3KH0 A;  2D10 A;  1JRU A;  2NPT B;  1I7H A;  2JY6 A;  3SU8 X;  1R7S A;  1ZDX A;  2K1F A;  1YN4 A;  1EO6 A;  3CST A;  2M4N A;  1VJK A;  2L05 A;  5BYR A;  2BGF A;  2WWZ A;  5EE3 A;  4DQO C;  4ZRK A;  3U8Z A;  1WXM A;  2O2V A;  4KSK C;  5DPR A;  3URY A;  1J7A A;  1FNU A;  1PGB A;  2FID A;  2LGX A;  2KWV B;  1L7Y A;  4DWF A;  3BIN A;  3LXF A;  1WR1 A;  1WJ6 A;  2DLB A;  2K8C A;  4H2A A;  1TKG A;  2R2O A;  4L23 A;  4USA A;  3M62 B;  4HLE A;  1Y56 A;  2C7N B;  1XCQ L;  2IY1 B;  2J52 A;  4AS1 A;  2FCM A;  2WLB A;  4JX1 C;  3DBL I;  1BML C;  5LXH A;  3BYY B;  1LM8 B;  3DPD A;  2WXI A;  2WU5 B;  2D5G A;  3Q8B A;  2QDF A;  3VQI A;  5HG2 A;  1QIL A;  2HJ8 A;  2KMA A;  2LZ6 A;  2IPK D;  4GIV A;  4ARI A;  1WWT A;  4IM2 A;  2Z0D B;  1UF0 A;  1K53 A;  2RPQ A;  1EWC A;  5KHO A;  3AE3 B;  1SB3 C;  2MBE A;  3BK1 A;  1UH6 A;  4FHK A;  1KRH A;  1TYG B;  1IPG A;  2KC2 A;  4G0N B;  4AJW A;  3P63 A;  4LCD E;  1ZDV A;  5LLI A;  5KHQ A;  4YSZ B;  5AZH A;  1SE2 A;  4FN2 A;  4MSM B;  2BYV E;  4M0W B;  1SJE D;  1YX5 B;  4B6W A;  3J9C A;  2LVQ A;  4K3C A;  4AP4 C;  4NQK E;  4GU2 A;  1XXG A;  2KDB A;  4BOZ B;  3Q3F A;  3ZNG C;  2KHW B;  4GLS C;  4O1N A;  3NZU A;  2MCN B;  3PSE B;  2FUG 1;  3MJ5 A;  1FXI A;  2BW2 A;  1VDV A;  3NUH B;  2QIE B;  3DVN U;  3OWE B;  3KW5 B;  2WDV B;  3N1Z C;  3Q6B A;  4RH6 A;  4L1B A;  5HI1 A;  3PVL A;  3KQ4 A;  2MBH A;  1V1O A;  4NJ7 A;  2NBU A;  2WXG A;  5CHF A;  3VRB B;  4A8X C;  4C80 A;  1E9M A;  1SIF A;  4XDD A;  3VTU A;  3HM3 A;  2E3T A;  2CHW A;  3KWL A;  2ICI A;  3ZNH B;  4B9K A;  2AWT A;  2LGS A;  1WGH A;  2FBW B;  2BYE A;  4W9D A;  3EEC A;  1YQ4 B;  4M8M A;  4PS7 A;  2GRI A;  2QSD A;  2V1Y A;  3Q8F A;  3ZNI D;  3RFZ B;  3IXS A;  1D6E C;  3RNG C;  3EUB 2;  1SSN A;  2Q5W D;  2PW9 A;  1LGR A;  1L2N A;  4EZJ A;  1R4N I;  1YIW A;  5DPS A;  4QAY A;  4CQN A;  3P4R B;  2BWF A;  2IDY A;  2LHE A;  2I38 A;  4ZRI A;  1LO5 D;  2O2V B;  2J7Q B;  4ANU A;  4HPL B;  1GG3 A;  4ZRJ A;  2KN5 A;  2JPH A;  2KAN A;  1Z2M A;  1SE4 A;  2TSS A;  1WZ0 A;  2PEA A;  2WXL A;  1TS4 A;  3ZLZ A;  4CO7 A;  2BB6 A;  2WDT B;  1TZ1 A;  2JX5 A;  3RUI B;  2KLC A;  2HTM E;  3T9L A;  1LQB A;  3V6C B;  1NEK B;  2PIA A;  5C1Z A;  1TTN A;  4RMA A;  3WAL A;  2FNJ B;  4M8N A;  1NYQ A;  2D3B A;  3HVD A;  4IDI A;  1YOV B;  4X57 B;  1FMA D;  2MP2 A;  2KAJ A;  1FPY A;  3RNA C;  1SEB D;  3PRM B;  2HD5 B;  2ZVN A;  2N4F A;  3BY4 B;  1V97 A;  5H92 C;  4BAX A;  2DZM A;  2CU3 A;  2PMV A;  3C0R B;  3Q3M C;  1U4A A;  2DZJ A;  3NVY A;  2WGS A;  2NR2 A;  1QOB A;  2GB1 A;  4IM0 A;  1YQB A;  3L0W B;  2MSE D;  1Q0W B;  3B2G A;  3QHT A;  2VRR B;  2RD0 A;  2D3A A;  5BO4 B;  1IBX A;  1UWM A;  1XO3 A;  3LJ3 A;  2LJI A;  4WAA A;  4MM3 A;  2GOW A;  1UEL A;  2KJR A;  4JLC A;  1V80 A;  3Q3J A;  3WAM A;  3TBL D;  2KWU B;  1C77 A;  2D3G A;  3DBR B;  4MDK E;  2OJR A;  2NTT A;  3T3N A;  4ZRP A;  1P3Q U;  2KZR A;  5AEK B;  2I1K A;  1CZP A;  4N9F 4;  2ZZP B;  3IG3 A;  2LJ5 A;  4AQ7 A;  3VTV A;  4BKG A;  3HHM A;  3B0A A;  1R4M B;  1WE6 A;  1SXT A;  2W55 A;  4B95 A;  5JHA A;  4K1R B;  3RNC C;  1V49 A;  4NQL B;  3AUL A;  1K8R B;  2O6V A;  3HUI A;  1GOZ A;  5E6P A;  3DVG Y;  3L17 A;  1K51 A;  2ZCB A;  4DHJ B;  4DXA B;  3AEA B;  1ET9 A;  1D4B A;  3N32 A;  3RD2 A;  5FR3 A;  2GI9 A;  4LNK A;  1FNV A;  2L83 A;  5JH5 C;  1AN8 A;  3RZW C;  3H8H A;  3GS2 A;  4W9L A;  4MSQ B;  3N20 C;  1WZ3 A;  4HCP B;  3IAM 1;  2AL6 A;  4ZYN A;  4P1B C;  3ALB A;  4HRS A;  1VZ8 A;  4M00 A;  3ZRC A;  3W9C B;  1V9J A;  2KAC A;  4W9C A;  2LVP A;  3O65 B;  4RGO S;  2IO3 B;  1ZGU B;  3APC A;  3NVV A;  2OOB B;  5IP4 D;  3NZ3 A;  1YJ1 A;  1ZW7 A;  3Q14 C;  1I4X A;  3RUL A;  3DBH B;  1IP9 A;  3CF4 A;  3DWG C;  2JZ3 B;  1FRR A;  4W9I A;  3UQA A;  2CU1 A;  1KLV A;  2O6V D;  1WIA A;  1T3Q A;  2AQ1 B;  2BYF A;  4ZRQ A;  2MP2 B;  2D2Q A;  4PS8 A;  4DDI D;  3EHV A;  4ZDV A;  3L10 B;  4RF0 A;  1FEH A;  4ARC A;  2PPH A;  1PUT A;  1UNS A;  3ZTD A;  3P2B A;  4RM8 A;  4A3P A;  5D2M B;  2WU2 B;  4XGA B;  2KFK A;  3AB5 A;  2RPV A;  4PK1 A;  2L76 A;  2ZW0 A;  3ZDM C;  3LB8 C;  2IGD A;  2M17 A;  2XNA C;  1IBX B;  4NY0 A;  4G3X B;  4A6Q A;  4MM3 B;  4BVU C;  1JCK B;  4GDK A;  2AEH A;  1PGX A;  4WWM A;  2UWQ A;  4MEL A;  2KJ6 A;  4DBG A;  3GE3 C;  4A3O A;  2WNM A;  2DBY A;  1GTH A;  4MGI E;  1IGC A;  5MPO A;  4HK2 A;  5C3J B;  3VAW A;  2LRW A;  3MHS D;  2IJ0 A;  2L0F A;  2RDH A;  2GLS A;  2KTF A;  2V3N A;  2MJD A;  2G3Q B;  3ZJU A;  1T0S C;  2CHZ A;  2BT6 A;  3PHW B;  2KLG A;  1V8C A;  3U2S C;  3R3M A;  2NS5 A;  1I4G A;  4BKS A;  2O6V B;  2XEW A;  2MWS B;  4FBJ B;  2YEP B;  2XK5 A;  3MHZ A;  3BWU D;  4LDT D;  2EKI A;  4ICU A;  2ZW1 A;  4TMA B;  1HZ5 A;  3VRA B;  3W5U B;  3RMK C;  4GXB A;  3KLS X;  1YJI A;  3RN9 C;  3GE8 C;  1HE8 A;  4AOF A;  1WXA A;  4I6P A;  3JYU A;  5D6J B;  4OVZ A;  5LXI B;  3ZXR A;  1XT9 B;  1WM2 A;  2YVC A;  2K39 A;  2CJN A;  2MX2 A;  2K8B A;  3NOB A;  3M95 A;  1TKE A;  4JL9 A;  1QKZ A;  2PVO D;  4P16 A;  4CHK A;  5E6J A;  1XQQ A;  4JWS C;  1ZUD 2;  1IGD A;  3QC8 B;  1ZE3 D;  2PTL A;  2VZK D;  3ML8 A;  3OG5 A;  2D07 B;  2EKE C;  1B9R A;  2N1V A;  2IO1 B;  1VLB A;  1UGJ A;  3E56 A;  1RAX A;  1NVI D;  1FM0 D;  2N9P C;  3DBS A;  4BBN F;  4IWP A;  4KDL B;  4ASW C;  2J42 A;  4C7Y A;  2JVC A;  3SFE B;  1QZE A;  3NJT A;  2M8S A;  3N9Y C;  3PPA A;  4AWJ A;  1F77 A;  4CYE A;  3U52 E;  1XLQ A;  1N5X A;  3MJW A;  4OHJ A;  1GTE A;  2BTE A;  3TSS A;  5BMG A;  2V4I B;  3KVF B;  4HEA 1;  1J0G A;  3PRE A;  4NAM A;  2R2Q A;  2KFK B;  4IG7 B;  2HJ1 A;  3GZN I;  2QHO A;  3NS1 A;  2WS3 B;  3NG0 A;  3SD5 A;  3RI7 C;  2YLM A;  1ZXI A;  3SEB A;  1WM3 A;  3ZGZ A;  2KQS A;  1SE3 A;  4N6E B;  4WJN A;  1WGG A;  3WAO A;  3VDZ A;  4GDK B;  3DHG C;  3QWZ B;  2QIL A;  2IGH A;  1SE9 A;  2N7E A;  4L2Y A;  2WXR A;  1J8C A;  5I4D A;  2RSU A;  2N9K A;  2LGY A;  4XC2 A;  2GMI C;  3HIZ A;  3ZRF A;  1MHX A;  2GBK A;  2Y5B B;  4K7S A;  3TEX A;  1TS5 A;  1WR6 E;  2YEP F;  3OJ4 B;  2WP9 B;  1JWU D;  2J0K A;  4K7W A;  1T6B X;  4HPM B;  2JRH A;  4ANW A;  5BMI A;  4KSL C;  3A4R A;  1D3Z A;  1C4P A;  3H7P A;  3I57 A;  3TMP B;  2KVR A;  2XK5 B;  3H7S A;  3VR9 B;  2L00 B;  2MBQ A;  4IWQ A;  3AH7 A;  3Q3O C;  4DDG D;  4S17 A;  4A55 A;  1J7C A;  4JE3 B;  3T8M A;  3QAQ A;  1DYQ A;  2JF5 A;  2N0S B;  2ZNV B;  2INN E;  1EWY C;  2W82 A;  5L83 A;  1ZXH A;  3VTW A;  4RCO A;  2IO2 B;  1C4A A;  1H8C A;  4EOY A;  2WDQ B;  1RWS A;  4HWI B;  4W9H A;  3ZQ4 A;  1TZO A;  3CWI A;  3KUZ A;  1VZ6 A;  4I6N B;  4FAD A;  1JWM D;  3AM9 A;  2N7D A;  2PJH A;  4GGQ A;  2GBR A;  2C5L C;  4GOC A;  3U30 A;  1FCC C;  3GB1 A;  1WF9 A;  3FIL A;  5AUI A;  3Q8A A;  2K9X A;  3IFW B;  4PT5 A;  2UU7 A;  3PS6 A;  1E0Z A;  3EA6 A;  3NZS A;  2M56 B;  1EU3 A;  4ZOH C;  1H7W A;  1L0X B;  3BVG A;  4G11 A;  3UIN B;  2N9E B;  3MC0 B;  1F1H A;  3EFU A;  3PLV A;  4DK5 A;  1I4R A;  1KFY B;  3QJZ A;  4WAF A;  3KYD D;  1UZX B;  1YMH E;  1H4R A;  2ZEQ A;  4ZHP A;  1WX7 A;  3MP9 A;  1CK1 A;  3X0W A;  1WSP A;  5FK9 C;  2W54 A;  2DYO A;  1QOA A;  3DVN V;  1KLG D;  3LDZ E;  2PE6 B;  4UDU C;  1S1Q B;  1RRB A;  5EE0 A;  2JWZ A;  2NBW B;  3T3O A;  2EMS A;  3CF6 E;  1JML A;  3UIO B;  2JQR B;  2JU6 X;  2L0T A;  3M3J A;  3QX1 A;  2RDB C;  1LFD A;  1DOY A;  2LRU A;  2LUM A;  2PKO A;  4WJP A;  2ZNV C;  4MH8 A;  2L7R A;  4XWT A;  3LYY A;  4P1C C;  2I1J A;  3U7Z A;  3WCQ A;  5BYS A;  1L6U A;  1TY0 A;  4OVV A;  4LTU A;  1ET6 A;  2AX5 A;  3O13 A;  4IWO A;  3AE9 B;  3AE6 B;  1IUE A;  4K3B A;  1C4C A;  3AU5 A;  1L4D B;  2QCZ A;  4F7Z A;  1MPE A;  3ONS A;  3H7P B;  1L0Y B;  3AE2 B;  3Q8C A;  2UYZ B;  3R2T A;  3KUD B;  3AEE B;  1XD3 B;  5G2N A;  4US9 A;  4WQO B;  2PE9 A;  5CX3 A;  2DAJ A;  4KGS A;  2Z8L A;  2J4X A;  3VH3 B;  3U4E G;  4GSW A;  2KDI A;  2REX A;  2M1M A;  4NNJ B;  1OGW A;  3Q69 A;  4E3C A;  3C19 A;  3L4P A;  2L52 A;  2NCN A;  1E8X A;  2MRP A;  2W9N A;  5E6N A;  1FXA A;  2CR5 A;  5GMV A;  1SIJ A;  3DQV A;  3V62 A;  1HTO A;  3RZF A;  4R3D A;  1JRP A;  3ENE A;  4RGN A;  2WXH A;  3VHT C;  2FE8 A;  4C4V A;  1D5Z C;  2KT7 A;  2KN4 A;  1MG4 A;  5HHD G;  4LNN A;  3R7Q A;  3APF A;  4WJO A;  1IYF A;  1XCT L;  3FIL B;  1YX6 B;  2B3A A;  2ASQ A;  3A33 B;  1BT0 A;  3WAP A;  1M94 A;  1WJU A;  4XDC A;  1FFU A;  1Q5W B;  2LXC A;  4WWN A;  3PHX B;  2BKF A;  4DXG A;  2SEB D;  2ON8 A;  4LNO A;  2LAS A;  5D3D A;  1VCB A;  1VR9 A;  2NMQ A;  2XBB C;  4RF1 A;  2VH2 A;  2QJL A;  5IOI A;  3CMM B;  1V86 A;  4NAW A;  5JZE B;  4IOI E;  5EE1 A;  3NHE B;  1H7X A;  4FJY A;  4PS3 A;  2K0P A;  3UIP B;  2LVO A;  2FCQ A;  4PYZ A;  3NVW A;  1KF6 B;  4M01 A;  2BYT A;  4WQM A;  3B9J A;  5LNK 1;  3VR8 B;  1C9F A;  3R8B A;  3QCA A;  2MJE A;  4JQW C;  4EUT A;  2JXT A;  5IA7 A;  1ROE A;  1WXV A;  1ZKH A;  1S3S G;  3DHH C;  1P1A A;  1UWX A;  4WH4 A;  1N60 A;  2K6Q A;  5CHV C;  4F1S A;  3PZ8 A;  5AUK A;  3P4S B;  1YN5 A;  1CJE A;  3DBR I;  1N6Z A;  3HVZ A;  2JYE A;  2ZPY A;  3L16 A;  2CHX A;  4TQ0 A;  1WGK A;  4IKG A;  1Q10 A;  1HEZ E;  1V5O A;  2V3S A;  4MH0 E;  5EE9 A;  4GB9 A;  3W1Y A;  5L95 C;  4B0E A;  2BQQ A;  1V81 A;  2G4D B;  2JT4 B;  2KXJ A;  3UQB A;  1R4M I;  4S0R A;  3PO0 A;  1I4P A;  4MAC A;  3TUO A;  2G45 B;  3QK0 A;  1RM6 C;  3KUC B;  4A20 A;  2JYT A;  2AYO B;  2INP E;  3WAN A;  3BVZ A;  5FR6 A;  1M4V A;  3VUW A;  1HZ6 A;  3ZTC A; 
#chains in the Genus database with same CATH homology
 1UGJ A;  3E56 A;  1OQQ A;  3J9C A;  4ZYS A;  3ZYY X;  1NVI D;  1E6E B;  1FM0 D;  4TQ1 A;  4C56 C;  2SAK A;  1GB4 A;  4D2K A;  3KWV A;  1XXG A;  2J42 A;  3ZJT A;  4C7Y A;  4GLS C;  4O1N A;  2OED A;  3SFE B;  1FFV A;  3N9Y C;  2W3R A;  2BS2 B;  2FUG 1;  1DOX A;  4YSX B;  1F77 A;  1L6V A;  3MJ5 A;  1KH0 A;  2G1E A;  3U52 E;  1FXI A;  4KGT A;  2OHF A;  1QQR A;  1ZP0 B;  2BW2 A;  1XLQ A;  1VDV A;  3BK2 A;  2QIE B;  3NUH B;  1N5X A;  1GB1 A;  2BTE A;  1L4Z B;  1GTE A;  3OWE B;  4OHJ A;  3TSS A;  1RFK A;  2WDV B;  1BUI C;  3AMZ A;  5BMG A;  2V4I B;  4RH6 A;  3AE1 B;  4L1B A;  1ACC A;  5HI1 A;  2N9L A;  1EU4 A;  3KQ4 A;  4HEA 1;  1V1O A;  3P1M A;  4NAM A;  2WXG A;  3VRB B;  4A8X C;  4C80 A;  1E9M A;  4XDD A;  4DXF A;  2E3T A;  3NS1 A;  2WS3 B;  2JSV X;  5G5G A;  1ZXI A;  2MEK A;  3KWL A;  3SEB A;  1QT9 A;  2ICI A;  3ZGZ A;  4KKJ A;  3W2D A;  1SE3 A;  1XF5 L;  4N6E B;  2FBW B;  2PVG C;  1GT8 A;  1YQ4 B;  1PDX A;  2AQ2 B;  5G5H A;  4KKI A;  1DGJ A;  4GDK B;  5BMH A;  2GRI A;  2QSD A;  1HXY D;  2QIL A;  3Q8F A;  2IGH A;  1KTK A;  3RFZ B;  2LFI A;  3IXS A;  1D6E C;  4L2Y A;  1PFD A;  1ZPS A;  1SSN A;  4YXD B;  3AE7 B;  2E6X A;  2PW9 A;  2Q5W D;  1F2R I;  2WXR A;  5I4D A;  2I2Y A;  4ZHO A;  3BVM A;  5D7G A;  2N9K A;  1F0Z A;  1WRI A;  3AV8 A;  4CQN A;  1SBB B;  3P4R B;  1AWD A;  1STE A;  2IDY A;  4YTP B;  1D5M C;  2I38 A;  1MHX A;  2LHE A;  1LO5 D;  1I4H A;  1QOF A;  1ESF A;  2LGI A;  3NVZ A;  3TEX A;  2ONQ A;  1TS5 A;  2BS4 B;  2KDM A;  2YEP F;  1N63 A;  1K50 A;  4LLG M;  1SE4 A;  2TSS A;  2WXL A;  4GDL B;  4NAW B;  1TS4 A;  3BZD B;  5H8Y E;  2WP9 B;  1MI0 A;  1JWU D;  3TEZ A;  2BB6 A;  1JW9 D;  1T6B X;  1N5W A;  1F2R C;  2JX5 A;  1P7F A;  4ITK A;  2HTM E;  5BMI A;  3ZJV A;  1JAL A;  4EE2 A;  1C4P A;  1NEK B;  2JWU A;  3I57 A;  2PIA A;  4A90 A;  3VR9 B;  3AH7 A;  3PZ7 A;  1N62 A;  1NYQ A;  4LK0 M;  4XWW A;  4P6V F;  3HVD A;  4A55 A;  2W3S A;  1NEN B;  1J7C A;  1P7E A;  4JE3 B;  4IDI A;  4WUR A;  1DYQ A;  1FMA D;  2N7J A;  2N0S B;  2KAJ A;  4OZB A;  2INN E;  2MH7 A;  1EWY C;  2W82 A;  1SEB D;  1PGA A;  1FNW A;  1JWS D;  1YN3 A;  3AED B;  1ZXH A;  2CJO A;  1V97 A;  1UUP A;  1CQV A;  5H92 C;  1V1P B;  4RCO A;  1TJE A;  5BYQ A;  1C4A A;  2CU3 A;  2BBC A;  2PMV A;  4YTN B;  2G9H D;  2WDQ B;  1HQR D;  3NVY A;  1RWS A;  1MHH E;  1E10 A;  2KMM A;  1QOB A;  3ZQ4 A;  1TZO A;  2GB1 A;  3CWI A;  1NYR A;  1VZ6 A;  1YNT E;  3IT4 B;  2V3P A;  4RGT A;  1JWM D;  1TS2 A;  3AM9 A;  3DWM A;  3MFG A;  1XLP A;  3B2G A;  1FCC C;  3GB1 A;  1GAQ B;  1IBX A;  1UWM A;  1XO3 A;  2LJI A;  3FIL A;  5AUI A;  1OQR A;  2K5P A;  1EM7 A;  3Q8A A;  2K9X A;  1D5X C;  5TSS A;  4PT5 A;  3NRZ A;  2Y5P A;  1E0Z A;  3EA6 A;  1C77 A;  1EU3 A;  2M19 A;  2M56 B;  3W5V B;  4ZOH C;  1H7W A;  2WXO A;  2KWD A;  2NTT A;  3T3N A;  4ZRP A;  1L0X B;  3BVG A;  2LMC A;  3Q8E A;  4KX6 B;  1VZ7 A;  4HKQ A;  3MC0 B;  1CZP A;  3AN1 A;  1I4R A;  1AW7 A;  1KFY B;  4AQ7 A;  1JWA D;  4WAF A;  1FIQ A;  1VRA B;  2BB5 A;  2WXJ A;  1YMH E;  3RPF C;  4ZHP A;  1SXT A;  5GXG B;  2W55 A;  2V0G A;  2QMT A;  3MP9 A;  1CK1 A;  1WSP A;  2RMM A;  3GP7 A;  3TEW A;  5FK9 C;  4YWG G;  3V3X A;  4US8 A;  5FKA C;  3ETR A;  2W54 A;  1K52 A;  2DYO A;  1QLB B;  3HUI A;  1GOZ A;  1QOA A;  1KLG D;  1K51 A;  1J7B A;  3AEA B;  4UDU C;  1ET9 A;  1D4B A;  5FR3 A;  1PYW D;  2GI9 A;  1WYG A;  2WXP A;  1C76 A;  5EE0 A;  2VZK B;  2AQ3 B;  3T3O A;  1FNV A;  1RYJ A;  2L83 A;  1T5X D;  2WDR B;  1ENF A;  3HRD D;  1I4Q A;  1AN8 A;  1JML A;  3GS2 A;  3H8H A;  3IAS 1;  3C8Y A;  2JQR B;  2JU6 X;  4OZA A;  4OW0 A;  3IAM 1;  3EUB 2;  1DOY A;  4JWU C;  4HRS A;  4HJG E;  3AE4 B;  2LUM A;  2PKO A;  3P4Q B;  2KQ4 X;  4MH8 A;  1VZ8 A;  4XWT A;  1FD6 A;  3E9S A;  2MJ3 A;  3LYY A;  2EEL A;  3IT6 B;  2H89 B;  3U7Z A;  2KAC A;  3W9C B;  3WCQ A;  5BYS A;  3FC4 A;  4N58 A;  1L6U A;  1TY0 A;  3UI3 A;  4OZC A;  4RGO S;  4C7Z A;  1GPX A;  2IGG A;  4LTU A;  1ET6 A;  2AX5 A;  3O13 A;  3NVV A;  3AE9 B;  2L32 A;  3AE6 B;  1XEE A;  1IUE A;  1C4C A;  3NZ3 A;  3EGR A;  1L4D B;  2NTS A;  1JRO A;  1I4X A;  4Q2J A;  1MPE A;  4A9A A;  2K22 A;  2Y3A A;  5HFY A;  1JQ4 A;  1HZ6 A;  4M0W A;  1L0Y B;  3AE2 B;  1XLO A;  3Q8C A;  3R2T A;  2RDG A;  3CF4 A;  3DWG C;  3AEE B;  1FRR A;  4MT5 A;  1YQ3 B;  2JZP A;  3BYT B;  5T8I A;  3I9V 1;  4US9 A;  1OFF A;  2PLP A;  4WIP A;  1E7P B;  4KGS A;  4YT0 B;  4TSS A;  2Z8L A;  1ZOY B;  4NZL B;  2J4X A;  4REZ A;  1TS3 A;  3AEG B;  3U4E G;  4B0M A;  2B76 B;  2WXF A;  3AEF B;  2HDE A;  4JPS A;  1T3Q A;  3Q69 A;  2AQ1 B;  4ZRQ A;  2Y5C A;  3L4P A;  2WXN A;  2L52 A;  2XN9 C;  2X38 A;  2WXQ A;  1MVK A;  3BII D;  4RF0 A;  1FEH A;  5JXV A;  4ARC A;  1FXA A;  3R2I A;  1XLN A;  2WQY B;  4N59 A;  4RGM A;  1SIJ A;  3AE5 B;  1PUT A;  1UNS A;  1SJH D;  3AEC B;  1YJJ A;  2WU2 B;  4R3D A;  1NI3 A;  1JRP A;  2WXK A;  2WXM A;  4RGN A;  2WXH A;  5D3I B;  3AB5 A;  2RPV A;  2LEK A;  2FE8 A;  2M0A A;  4RNA A;  1C79 A;  1D5Z C;  4YSY B;  2KN4 A;  4KGR A;  2ACZ B;  2H88 B;  3AE8 B;  1HA5 A;  5HHD G;  4XE0 A;  2ZW0 A;  1KLU D;  3LB8 C;  2IGD A;  1I7H A;  4HRO A;  2XNA C;  1R7S A;  5C2T B;  1ZDX A;  1TY2 A;  1IBX B;  1XCT L;  4A6Q A;  3FIL B;  1YN4 A;  4MM3 B;  1JCK B;  1VJK A;  1PGX A;  5BYR A;  3AEB B;  4XDC A;  1FFU A;  4WWM A;  5EE3 A;  4DQO C;  4DXG A;  2SEB D;  1JWB D;  2DYM A;  2ON8 A;  2WNM A;  5D3D A;  3SFD B;  1L0V B;  2DBY A;  3W1S A;  1GTH A;  1VR9 A;  1TKY A;  1IGC A;  5MPO A;  2R61 A;  5C3J B;  2NMQ A;  4FXC A;  2IJ0 A;  2J53 A;  2RDH A;  3SR6 A;  4RF1 A;  3URY A;  2V3N A;  2MJD A;  2QJL A;  1J7A A;  3ZJU A;  1FNU A;  1PGB A;  3B2F A;  3P42 A;  4IOI E;  5EE1 A;  1H7X A;  2K0P A;  1BXT A;  2BT6 A;  4J3O D;  3NVW A;  1KF6 B;  1V8C A;  3U2S C;  2BYT A;  4WQM A;  3B9J A;  1I4G A;  5LNK 1;  3VR8 B;  2QEJ C;  3LXF A;  1C9F A;  3R8B A;  2BS3 B;  2DLB A;  2MJE A;  3CIR B;  4H2A A;  1TKG A;  1DOI A;  4L23 A;  4USA A;  2JXT A;  1ROE A;  1Y56 A;  1XCQ L;  2YEP B;  2J52 A;  2LHD A;  3V05 A;  4AS1 A;  1UWX A;  3MHZ A;  3BWU D;  4WH4 A;  1N60 A;  1N61 A;  4NJC A;  2EKI A;  2WLB A;  4JX1 C;  1BML C;  2ZW1 A;  3BYY B;  3PZ8 A;  5AUK A;  4TMA B;  3P4S B;  2WXI A;  1HZ5 A;  3VRA B;  1YN5 A;  4RFB A;  3W5U B;  2WU5 B;  2D5G A;  1CJE A;  1QOG A;  2K3U A;  2JYE A;  3FAH A;  3HVZ A;  3Q8B A;  3VQI A;  3KLS X;  1QIL A;  5HG2 A;  4TQ0 A;  1QF6 A;  1WGK A;  1YJI A;  1Q10 A;  2IPK D;  4IKG A;  1HEZ E;  4ARI A;  1WWT A;  1L5P A;  5EE9 A;  3ABV B;  1A70 A;  1K53 A;  1V1P A;  4HKZ E;  4OVZ A;  1EWC A;  4B0E A;  3AE3 B;  3P4P B;  1SF0 A;  1WXQ A;  1SB3 C;  2DWQ A;  3BK1 A;  1KRH A;  2L1A A;  1TYG B;  3PO0 A;  1FO4 A;  1I4P A;  1B1Z A;  4MAC A;  3TEY A;  2CJN A;  3TUO A;  1C78 A;  1TKE A;  3P63 A;  1QKZ A;  2PVO D;  4P16 A;  1ZDV A;  5E6J A;  4JWS C;  1ZUD 2;  1FRD A;  1IGD A;  1FCL A;  1RM6 C;  4YSZ B;  4YTM B;  1AYF A;  1SE2 A;  1ZE3 D;  2JYT A;  2PTL A;  2VZK D;  2INP E;  3BVZ A;  1M4V A;  1B9R A;  1SJE D;  1VLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...