3AE1B

Crystal structure of porcine heart mitochondrial complex ii bound with n-phenyl-2-(trifluoromethyl)-benzamide
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
239
structure length
239
Chain Sequence
PRIKKFAIYRWDPDKTGDKPHMQTYEIDLNNCGPMVLDALIKIKNEIDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLDKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTGTCPKGLNPGKAIAEIKKMMATYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of porcine heart mitochondrial complex II bound with N-Phenyl-2-(trifluoromethyl)-benzamide
rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Succinate dehydrogenase [ubiquinone] flavoprotein subunit, m
total genus 61
structure length 239
sequence length 239
ec nomenclature ec 1.3.5.1: Succinate dehydrogenase (quinone).
pdb deposition date 2010-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3ae1B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3ae1B01
1AWDA 1NVID 2JX5A 4USAA 3DWMA 1L5PA 4JWSC 2WDRB 3ABVB 1TJEA 3ETRA 2CJOA 1FRDA 1DGJA 3LB8C 4HROA 2PVOD 3AM9A 3RPFC 1N5WA 3PO0A 3KWLA 2WP9B 1TKGA 2KMMA 3NVZA 2E3TA 3HVZA 5H8YE 5H92C 1FXAA 1NYQA 3B2FA 4A9AA 1A70A 1JALA 1KF6B 1JWBD 1L6UA 3ZYYX 1E10A 2B76B 2K9XA 1FFUA 1KRHA 1YQ4B 2Y5CA 1WGKA 1NEKB 2JQRB 3AE4B 2QIEB 1YJIA 1CJEA 2FBWB 4ITKA 3P4QB 1N62A 1PDXA 4IDIA 2BT6A 1TKEA 2L83A 3NRZA 1T3QA 2HTME 5EE3A 1GT8A 2EKIA 2KAJA 1OQQA 1NYRA 4N59A 3AECB 1E7PB 2WDVB 1JROA 1TKYA 3VRBB 1QT9A 2K5PA 1N5XA 2G1EA 3LXFA 1FFVA 3AE2B 3B9JA 3P63A 1CZPA 5EE1A 1GPXA 1B9RA 1KFYB 1XLOA 1J7BA 1FM0D 3P4PB 1QLBB 2PVGC 1V8CA 1GTHA 2WS3B 4YTPB 1SIJA 3EUB2 4N58A 1XLPA 5EE9A 4C7YA 1N61A 2ACZB 4YT0B 4HRSA 4YSXB 2DBYA 2M56B 5AUIA 1EWYC 3HRDD 1V97A 3NVYA 1DOYA 1FIQA 1XLNA 1XO3A 1QOBA 3NVVA 4WQMA 1JW9D 1I7HA 5EE0A 1DOXA 1UWMA 3FC4A 1OFFA 4FXCA 2N0SB 1E0ZA 4P6VF 1JQ4A 3AE1B 3NVWA 2WU5B 1L0VB 3AH7A 2MJDA 3AEAB 2W54A 1ROEA 1H7XA 4YSYB 3AV8A 1JRPA 2H89B 4C7ZA 2W55A 1GAQB 4JX1C 1YJJA 3P1MA 1WWTA 3VR9B 3AEEB 2Q5WD 4LTUA 1TYGB 4US9A 3W9CB 1NENB 3AE6B 4YTNB 2WQYB 3CIRB 1FRRA 3CF4A 3AEBB 2CJNA 3HUIA 5C3JB 4ZHPA 4ZOHC 2BS3B 3CWIA 1E9MA 3SR6A 1ZOYB 1SB3C 3SFEB 1ZUD2 4YSZB 1YQ3B 2LEKA 5G5HA 2H88B 2WDQB 1QF6A 1QOGA 1GTEA 1ZXIA 1DOIA 1FXIA 2CU3A 1J7CA 3AEDB 1OQRA 2QJLA 4YXDB 2W3RA 1RM6C 1RFKA 1PUTA 1WXQA 4JWUC 3AE9B 4C80A 3AMZA 3P4SB 1N63A 1RYJA 3AEFB 3AE5B 3P4RB 1XLQA 2PIAA 2PKOA 3B2GA 1RWSA 3FAHA 1NI3A 4N6EB 2WU2B 1PFDA 3BIID 1QOAA 2AX5A 4ZHOA 3AN1A 1L6VA 1N60A 1VJKA 3AEGB 1JWAD 5AUKA 2OHFA 3WCQA 5GXGB 5G5GA 2MJ3A 2BS4B 1H7WA 3AE8B 3VRAB 2L52A 2MH7A 1WYGA 2M19A 3SFDB 1FMAD 4YTMB 4WWMA 2BS2B 2W3SA 3DWGC 2MJEA 1VLBA 2K22A 1AYFA 3L4PA 3VR8B 1R7SA 3W5VB 1E6EB 3NS1A 3AE3B 1VDVA 1FO4A 4US8A 1J7AA 1QOFA 3AB5A 2DWQA 2WLBA 1ZP0B 1F0ZA 4KX6B 1IUEA 1WRIA 3AE7B 1SF0A 3W5UB 5MPOA 5C2TB
chains in the Genus database with same CATH superfamily
1NVID 3L17A 2IGHA 3DBHB 4OZCA 2G45B 2LJIA 3NVZA 4R3DA 1SSNA 1L4ZB 2BGFA 3ZYYX 3R7RA 4GDLA 3M3JA 3AE4B 2K3UA 1KH0A 1K51A 4XGAB 4MGZE 1V1OA 4RM8A 2D3BA 3MJWA 2MBEA 1F2RC 4HPPA 1GUAB 2FAZA 3P63A 3V05A 1OTRB 1QLBB 1XLPA 3A9JA 3N30A 2FCQA 3HRDD 3Q3JA 2PEAA 3T3OA 4WURA 3NG0A 1T0YA 4NAWB 4KZCA 2CHXA 3AEAB 3X23A 2IY0B 3VHTC 1V86A 2VH1A 1TYGB 4AS1A 1IBXB 3CWIA 1ZOYB 1TT5B 3ZKJC 2WXFA 5AEKB 1FXIA 2CS4A 2O2VB 3WAOA 5G55A 3VH4B 1RYJA 3VQIA 4BKTA 3OJ4B 4RGOS 2TSSA 4N6EB 4PK1A 2WXPA 2L1AA 1WH3A 2HJ8A 4WWMA 2WXGA 1WRDB 2BVCA 1NBFC 2C60A 2MW5A 4WAFA 1XQQA 3WAMA 4CYEA 2NPTB 2KKCA 3Q3MC 3RZWC 1VRAB 3PTFC 3RYTA 1R4MI 4DHZE 2L0FA 2WXHA 4P16A 4TMAB 3PO0A 1P9DU 3RNCC 4LDTB 1JALA 3BYYB 4RNAA 1KF6B 2N1WA 4KDIC 2REXA 3NRZA 4GSWA 3NY5A 1OQQA 4N59A 3U7ZA 1VZ8A 2D3GA 3B9JA 1GPXA 4WWOA 4L2YA 2WS3B 2K25A 2WDTB 3HIZA 2M56B 3Q8AA 2IO1B 3MHZA 4W9CA 4WQMA 3BVMA 3V61A 3M62B 1EF5A 4DXGA 3AH7A 3QIJA 1ROEA 4P7IA 4X57B 1SE4A 3RD2A 4RM9A 2IO2B 4RH6A 1C79A 3RNGC 1WE7A 1TBEA 5C3JB 4A3OA 2RPVA 4E3CA 1QOGA 3IT6B 1DOIA 1J0GA 1YMHE 4F1SA 3EFUA 3BVGA 3B2GA 4I6NB 2QDFA 4FHKA 3TEWA 1V6EA 3NS8A 5BMGA 4MJSA 2MH7A 3VRAB 3SFDB 3QX1A 2EMTA 1VLBA 4F8CB 4L1BA 2AQ3B 1HZ6A 1CMXB 3QA8A 1QOFA 4NAWA 2KYWA 1GB1A 3W1YA 4JPSA 2JSVX 1C9FA 3DWMA 4EOYA 3A1QA 4G11A 1FRDA 3LB8C 4FJVB 4B6WA 4IWQA 1I4PA 1TKGA 3B2FA 4GIVA 1WGHA 2Y5CA 1YQ4B 1JWMD 4I6PA 4J6IA 1YJIA 3H1UA 3P4QB 1N62A 3A4RA 4PS8A 1NYRA 3AECB 2N9PC 5CHVC 3DBLB 4GDLB 1ACCA 1D3ZA 2DAFA 1IBXA 5EE1A 2FE8A 2FIFA 1ET9A 3IT4B 1WR6E 3PZ8A 1EUVB 1V49A 4WWPA 2L00B 3LDZE 3DVNV 3I9V1 5LLIA 4W9FA 3SHQA 1I7HA 1X1MA 3W1SA 1UWMA 1KTKA 1CQVA 2JU6X 2JWZA 3A9JB 1GAQB 4NJ7A 3J9CA 1WWTA 3WANA 4LTUA 2J0KA 3VTVA 1R4NI 2MBHA 2JVCA 2LHDA 4M0WB 1Z5SB 2IO0B 4NZLB 1ZUD2 4FJYA 4C4VB 4NY0A 3U30A 4GN1A 3VTUA 2RGFA 2WXNA 1K52A 4ANXA 2KDIA 3QHTA 4BBNC 1N63A 3FAHA 4BKSA 5E6NA 5IKCM 3BIID 1UWXA 4A55A 5AUKA 3Q3FA 2LGYA 1LM8B 4HLEA 3ZJVA 2IBIB 2IYDB 2IO3B 2AL6A 1VZ7A 3ECIA 1WRIA 5FR6A 2NS5A 1YD8U 2R2QA 1SGHA 4S17A 1T0QC 4NPNA 2MP2A 1N6ZA 3QWZB 4ZYSA 1QZEA 1YIWA 4AJYB 2MHJA 4PS3A 2GBKA 4ZRPA 1L6UA 4HCNB 1E10A 2J53A 4RF1A 1KRHA 1XF5L 3QAQA 2C5LC 2WGSA 4KGRA 2K6DB 4BBNF 4II3B 3VRBB 3OJ3A 1WFYA 3N1ZC 1WE6A 2NBWB 2C9WB 1ZDVA 3TJPA 4YT0B 4YSXB 2LWPA 3FKYA 3RNAC 2QMTA 2ZW0A 2DX5B 2XEWA 2NTTA 1SBBB 2RDGA 4FN2A 4P6VF 3AE1B 2JZ3B 3VAWA 4C7ZA 1V1PA 3AV8A 2LRWA 2JF5A 1L0XB 3GOEA 1STEA 2KX3A 2KN4A 4GMVA 4IW0A 4OZBA 1T6BX 3UIOB 2XK5A 5DPWA 3DQVA 5G5HA 1JMLA 3EFCA 3T3NA 1L7YA 2HJ1A 4KKIA 2BKRB 1GC7A 4GB9A 3RUIB 2DZIA 2PIAA 4J3OD 2MBOA 1FNWA 1NI3A 3KYCD 2AX5A 2CHZA 2OHFA 2MA9B 2KD0A 3KUDB 1HA5A 3AE8B 1H7WA 3EA6A 2NBVB 1FMAD 4REZA 2BB5A 2E6XA 4K7UA 3PGEA 1NI2A 4US8A 2KN5A 3BY4B 5IA7A 4MGIE 3QARA 3JW0X 1A5RA 3RNFC 3RPFC 4DBGA 2LASA 2ZPYA 2KACA 4W9EA 1NYQA 1GC6A 3IVFA 1YX5B 4HEA1 3Q8CA 2JRHA 3GE8C 2G9HD 1WMHB 1R4NB 4JLCA 2FNJB 1TY0A 3MFGA 3O13A 1ZKHA 2KTRB 2ZNVB 4ZYNA 3PZ7A 3C19A 4FA6A 4A6QA 1KLUD 1YNTE 2LJ5A 2DYOA 3N32A 1MG8A 1E8XA 1FIQA 1QOBA 4ZRQA 3TEYA 1P1AA 3CMMB 2ONQA 3DOWA 4AQ7A 3KH0A 4XWTA 4LDTD 2JZPA 2OJRA 1VD2A 4MSQB 1WI0A 4KDLB 2HTHA 2CJNA 3FILA 1YX6B 3SFEB 2IGGA 1YQ3B 4LNNA 4A8XC 2OOBB 2JT4B 4WJQA 1FD6A 4D2KA 2W3RA 1RM6C 4C80A 3P4SB 3H9DA 3U7DA 2R2OA 1YN4A 3DDCB 3H8HA 1TS3A 3WCQA 2ZEQA 4RGNA 2L7RA 3PSEB 2MJ3A 1M4VA 4ANUA 2KVRA 4JL9A 3UIPB 3AU5A 3IG3A 5HKHA 2N9EB 2GBJA 2MBQA 3Q14C 4HPLB 4FLHA 4RGTA 2N9LA 1AWDA 3VTWA 2KLGA 4OW0A 4TSSA 2PVOD 1YQBA 4WQOB 1GB4A 1LXDA 3KWLA 4KVGB 2E3TA 4S0RA 3RNBC 1C76A 3MC9A 2K9XA 1F77A 4C4VA 2D07B 2ZVOA 4TQ1A 4N9F4 3S2AA 3Q8BA 4ITKA 4PYUA 1K53A 4ANWA 2QHOA 3U8ZA 4G0NB 4L23A 3W2DA 2XK5B 4BKGA 3IHPC 3SU8X 3AXCA 2BWES 2RPQA 2A4ZA 1FPYA 4O1NA 3NZ3A 4ZRKA 1V8CA 4YTPB 4HRSA 2KOXA 3MC0B 3ZQ4A 2PE6B 2ZPNA 2I2YA 5HG2A 3DVNU 3BZDB 3NVWA 3I57A 4KIKA 3VR9B 4K7SA 1H4RA 3CIRB 2M0AA 3H7PA 3VVWB 4ZHPA 1EU3A 2KWVB 3E9SA 3R3MA 4MJSB 5TR5A 2D5GA 5BYSA 1ZGUB 3AU4A 1HEZE 2DZJA 3I5JC 1YOVB 3AEGB 1T5XD 2L0TA 3TUOA 4H2AA 1ISNA 2K1FA 1IGCA 4EZKA 2HE7A 3PPAA 5E6OA 2WXMA 3AE3B 3GZNB 3L10B 2WLBA 1P7FA 1WXMA 1I4GA 5MPOA 4USAA 3QQ8B 3C8YA 2KMCA 3L54A 2WHIA 1BT0A 5CHFA 1LFDA 2EMSA 4KSLC 5H92C 1LQBA 3ZXRA 4RCOA 4FHJA 2WNMA 4IWPA 1UZXB 5EDSA 2IZVB 2KQ4X 3TIXA 4ICUA 1TKEA 3SD5A 3JYUA 1C77A 4P1BC 2G4DB 1E7PB 1RFAA 2D3CA 2K5PA 4W9KA 4C00A 3IFWB 5CX3A 3U4EG 4GDKA 1KLGD 3EUB2 2Z0DB 1EWYC 1P0RA 3NVVA 3L0WB 3CF6E 2PTLA 3FC4A 1I35A 2MJDA 1Y56A 2FCSA 1HE8A 3Q8EA 2ON8A 2Q5WD 2NBUA 5IAAC 4CO7A 2LGXA 2WX1A 5HFYA 3Q2AC 5HI1A 2MSED 2LGDA 1BMLC 2ASQA 3W1SC 4EFOA 2KT7A 1UBQA 2LEKA 3PHXB 2N7EA 1SXTA 1J7CA 1OQRA 3OWEB 3ZRCA 3R2TA 1RAXA 3E56A 2N7JA 2JXXA 4TUUA 3V3XA 2XBBC 3DCGA 1C4PA 1FCLA 4YTMB 3ML8A 3ZUNA 3T9LA 2DWQA 2DYMA 1F0ZA 2NR2A 2ZVNA 2L83A 2ZZPB 4WIPA 3D32A 2LD9A 2WDRB 3ABVB 1L4DB 5DPRA 1EU4A 2CJOA 1ESFA 5TSSA 2KFKA 1WJ6A 4PT5A 1A70A 5L83A 2INPE 4GDKB 2KQSA 3DBHI 3IXSA 2FBWB 3GS2A 3R2IA 1E90A 2V4IB 4B0EA 4K7WA 1QT9A 3KQ4A 5E6JA 3C0RB 2N9KA 1M94A 2XNAC 3P4PB 3PHWB 4IOIE 3X0WA 1BXTA 2L8JA 1XLNA 2FCMA 2LMCA 4AWJA 3ZJUA 4M02A 3APDA 4XE0A 4AP4C 2JYTA 2W54A 5J18A 2IDYA 1WX7A 4HJGE 2WQYB 4TKNA 5IN7A 5BO4B 4GXBA 5J2RA 1ET6A 4DHJD 2PW9A 2D3AA 3MP9A 4NJ6A 1GTEA 3WIMA 2MWSB 1I4QA 4IG7B 4YXDB 1WXQA 4KKJA 1I4XA 3P4RB 1FNVA 2KLCA 1RWSA 2R61A 4W9GA 3NUHB 3RN9C 2ICIA 2L52A 4DK5A 2M19A 5FK9C 3V6CB 5FR3A 1G6JA 3VXWA 4IUMB 1L0YB 2LVOA 3BVZA 1WM2A 3NS1A 4GGQA 2AQ2B 1OEYA 4WJPA 2NTSA 2KDFB 1IUEA 2G4SA 3IAM1 1SF0A 1FXTB 2C7MB 5JZEB 2KK8A 1WJNA 3URYA 4LNFA 2WXQA 1OGWA 2K8HA 4LNKA 2LUEA 1C4CA 4LNIA 1UGMA 2MRPA 2Y3AA 1PDXA 2KTRA 1JWUD 4LLGM 2GBRA 3H7PB 4PS7A 3R7QA 3BK2A 4GU2A 2Y5BB 4MEMA 4KIKB 3ENEA 3LXFA 2GMIC 1FM0D 1HXYD 1R4MB 3H7SA 1SJHD 4AUQC 3BK1A 2KQ7A 1RRBA 4TV3A 1DOYA 3KUZA 2JXTA 4DXFA 4CQNA 2ZNVC 2VRRB 1GNUA 2LI5A 5I4DA 1WSPA 3H6NA 4IWOA 4IM2A 3AEBB 1NDDA 1WXAA 2BS3B 2BYVE 1SB3C 2L3ZA 3TEZA 1QKZA 1TS4A 1QF6A 4NNJB 1ZXIA 3P42A 2QSDA 3IBEA 3I63C 5IOIA 2UYZB 5BMHA 1TS5A 4Q2JA 3A9KB 2HD5B 2W9NA 3DWGC 2KDEB 3HVDA 1J7AA 3MC8A 1VR9A 2EELA 1SJED 3N20C 2O6VA 4JWSC 4HROA 4MM3A 5LXHA 3ZTDA 4OZAA 4HKQA 5C23A 2N9XA 1FXAA 1LGRA 3NJTA 1FFUA 1WGKA 2JQRB 3APFA 4JE3B 1WJ4A 1E7UA 3FILB 4A3PA 1J8CA 5KHOA 3KVFB 2D2QA 2KJHB 3Q3NC 2G1EA 2W82A 4WH4A 1B9RA 1WGYA 1GTHA 4MM3B 2CU1A 4AJWA 4HCPB 1V97A 3HHMA 2C7HA 2NMQA 1GOZA 1JW9D 4JGHB 1I4RA 1MI0A 1E0ZA 2M8SA 2I38A 5DCNA 4YSYB 3LYYA 3Q3OC 3W9CB 3MTNB 2NCNA 4K3CA 3A9KA 1MHHE 4I6LB 4KSKC 1YJ1A 3DBRI 3ALBA 4HDQA 2DENB 2KC2A 4RF0A 3ZVVA 3PLUA 3L16A 5D2MB 1PYWD 2LFIA 3PZDA 2X8XX 2LVPA 3R66C 3VFKA 2KFJA 3NOBA 2BWFA 1UF0A 3GE3C 1CK1A 1EM7A 3ZJTA 2WU2B 1PFDA 2JPHA 2LRUA 2J0JA 4M00A 4BVUC 4EKUA 2K39A 4M0WA 3TSSA 3ML9A 1PGAA 2HDEA 3PS6A 1AN8A 1WF9A 2PE9A 5LXIB 2DNFA 2UWQA 3VUXA 4DHJB 1WGDA 4IM0A 3KWVA 3V60A 4G3XB 2K8CA 3WALA 3AM9A 2PPHA 2D11A 2KMMA 2CKHB 4EZJA 5D6JB 2KZRA 2BYFA 4NAMA 1KJTA 2Z0EB 4ACFA 2Z59B 5EE3A 3M63B 2V4LA 1XEEA 2BF8B 1WIAA 1V1PB 3T8MA 3WA0A 1E7VA 2V3PA 1YN3A 2BW2A 1TY2A 4F7ZA 2I1JA 2BBCA 2L32A 4WWNA 1DOXA 1KM7A 3B1LX 2FUG1 1F9JA 4RGMA 2WU5B 2IPKD 2KDBA 4M8MA 1P3QU 3AEEB 1Q0WB 2M1MA 1J19A 1TTNA 2WX0A 1NENB 4XWWA 4KV2A 4HDOA 3DHGC 3GB1A 3NZSA 1XD3B 3AI5A 3EGRA 2CHWA 4JQWC 2M4NA 1PUTA 4MELA 2AL3A 2RD0A 2GOWA 2MP2B 1UH6A 4ZHOA 1EWCA 1WX9A 2KO3A 3CSTA 4W9IA 1TZOA 1DYQA 2GBMA 1WYWB 1VDVA 1FO4A 2N4FA 2IJ0A 2V3SA 3ZTCA 2KVZA 2BKFA 3GP7A 3UQAA 5C2TB 5L95C 1C1YB 2X38A 1XXGA 2MX2A 3Q69A 2BYEA 5H8YE 1YN5A 1PQSA 4EEWA 3ZDMC 3NZUA 3PREA 4MACA 3V62A 4IDIA 2LXCA 3QJZA 4LCDE 4NQLB 4LK0M 2KAJA 4XYCA 3RFZB 1FCCC 1V9JA 2WDVB 1ZXHA 5FKAC 1TGZB 3ZIMA 3BWUD 2K8BA 2MQJA 2KFKB 1D5XC 3KYDD 3K9OB 3PLVA 5G2NA 4W9DA 4ZDVA 4YWGG 2AQ1B 5D3DA 4K1RB 5BYQA 1XCTL 4ASWC 1MVKA 3B08A 1H8CA 2NPTA 1L0VB 2V9HA 4BKSD 1V5OA 4JX1C 2LGIA 2GB1A 2AWTA 3UQBA 3B0AA 3HUIA 3L08A 2LHEA 2LVQA 1JCKB 1F2RI 4PYZA 2O2VA 2SAKA 1WX8A 3PRPB 2WXJA 4JWUC 3AEFB 3ZNGC 4LNOA 2WXKA 3A1QB 1C78A 2DAJA 1PGXA 1UD7A 2DLBA 1QOAA 1EO6A 4XX5A 2GBNA 1XT9B 1UELA 5GXGB 2QEJC 1D4BA 1E8ZA 5G5GA 1ZDXA 1SE3A 3DVGY 1B1ZA 3VR8B 4HWIB 1R7SA 1E6EB 3APCA 3AB5A 5E6PA 3AE7B 4KGSA 4OHJA 1T0RC 4ZRJA 3VH3B 4BAXA 1MFWA 1ZPSA 1FNUA 2C7NB 2WP9B 4XDDA 5JXVA 5D94A 4UDUC 4MGKE 1F52A 1IP9A 1EF1A 1JWBD 5LNK1 4IKGA 5J17A 5HHDG 4DQOC 3ZNHB 4AOFA 3TEXA 1CJEA 3R8BA 2N1VA 1D5ZC 3V6EB 5DPTA 4KGTA 3QK0A 2JZZA 3RULA 1GT8A 2DYBA 2VZKB 4II2B 1HZ5A 4WJNA 1N5XA 2WXLA 1FFVA 1MJDA 3DBSA 1KFYB 1XLOA 4BOZB 2AYOB 1E8WA 5EE9A 1MHXA 3N9YC 4B95A 5AUIA 2FCNA 3NVYA 1QQRA 1WM3A 4RFBA 1V2YA 2DZKA 3KW5B 3A4SC 4FXCA 3PRZA 1OQYA 1JRPA 2INDC 2W55A 3UI3A 1Y8RC 4W9HA 2ZCBA 2KJ6A 1LO5D 4HPMB 3MJ5A 1JRUA 3CF4A 2J4XA 2VZKD 2H88B 5AZGA 3AEDB 2QJLA 2WXOA 4BFRA 2K6QA 3TCAA 3AE9B 2A5UA 1FEHA 4HVBA 3ZGZA 1XLQA 3AE5B 2WYQA 4ANVA 4E74A 2PKOA 3UF8A 3AN1A 2YEPF 2MCNB 1Q5WB 2CR5A 4CHKA 2YVCA 1HTQA 2BS4B 1WYGA 5JHBA 4DWFA 1GG3A 2W3SA 2JUOA 2K22A 3ZDTA 2XN9C 3W5VB 3SDLC 4MSMB 1WZ0A 3N1YC 4W9JA 3W5UB 1K50A 1F1HA 3N1XC 1L5PA 3L13A 4XDCA 2JYEA 4WJOA 4WAAA 1TJEA 2KANA 1ENFA 2RDHA 1WGRA 3Q6BA 2SEBD 2NVUI 3RMKC 1E5WA 4OVZA 1C4AA 4HJKA 1T0SC 4A20A 3EHVA 1T3QA 2HTME 4K3BA 4BZAA 2KWDA 2KC1A 2G3QB 4DHZB 3A33B 3PV1A 1TKYA 1VCBA 3IAS1 1SE9A 4QAYA 2WXRA 4MDKE 4EUTA 1V81A 2PVGC 1VZ6A 1U4AA 1SIJA 3U2SC 4B0MA 4C7YA 1N61A 3O65B 5CHWA 3RI7C 5D3IB 4E71A 5C1ZA 3EECA 4HXDA 4MT5A 2MLBA 5BYRA 1OFFA 3VUYA 3TMPB 3RNEC 3OLMD 3RCZA 2H89B 3U52E 1YJJA 2L05A 1P98A 3P1MA 2MBBB 4US9A 3DBRB 4GLSC 4NJCA 3TL5A 2MEKA 4ICVA 4M01A 4ZOHC 4ARCA 3SR6A 4HKZE 4YSZB 4XZ4A 2OJWA 2KTFA 4URKA 3DPDA 2LGSA 2YEPB 4FADA 2KNBA 4JIOU 1RFKA 4EZLA 1S1QB 4IC7B 3OG5A 3ONSA 2FUHB 2BPSA 1N60A 1JWAD 2AEHA 2J42A 2KWUB 2BTEA 4FBJB 4RMAA 2LZ6A 1XCQL 2KHWB 1PGBA 2MJEA 1AYFA 2M17A 2O6VD 4MGYE 3ZLZA 3EC8A 1WGGA 1ZP0B 1D6EC 2KWCA 1AARA 3LJ3A 4DDGD 1I42A 1WXSA 2BQQA 3UGBB 1WXVA 2JRIB 1SE2A 2ZW1A 3JSVB 3HVZA 2WXIA 1Q1OA 4G50A 2QC8A 1ZE3D 2QIEB 1IYFA 1MG4A 4BOSC 1BUIC 5AZHA 2EKIA 3JVZX 1WMHA 1JROA 2IGDA 2GLSA 2FIDA 3AULA 5CTRC 2M0XA 3AE2B 1CZPA 3I3TB 3DBLI 1Z2MA 4FULA 1J7BA 1OEYJ 3KUCB 1WY8A 5JHAA 4ZRIA 1TZ1A 2JY6A 2YLMA 4FJZA 4GOCA 3HK0A 1XO3A 3ZRFA 2ZCCA 3ZNID 1I4HA 4NQKE 2N0SB 2ZJDA 3VDZA 3DVGX 4K81A 1GJZA 1UGJA 2O6VB 1H7XA 2J52A 2VH2A 1Q10A 2V3NA 2J0MA 4MH8A 2UU7A 3SEBA 3WAPA 3DHIC 4EE2A 1UUPA 4ARIA 3RT3B 2Z8LA 1AW7A 2WDQB 4B9KA 2JWUA 3OAWA 3TBLD 2RDBC 4C56C 1K8RB 1E8YA 2INCC 1UBIA 3VUWA 3GZNI 3M95A 4XC2A 2KX0A 2INNE 2PLPA 3N3KB 1JWSD 2BS2B 4IM3A 2RMMA 2K0PA 3PRMB 1TIFA 1ZW7A 4TQ0A 1HQRD 3BINA 4KX6B 3CSFA 1WZ3A 2BB6A 1D5MC 2JX5A 4OVUA 2DHZA 2IY1B 2RR9A 4LJPB 3ETRA 1DGJA 1RLFA 2KXJA 1N5WA 5IO9A 1P7EA 1UNSA 4A90A 3K9PB 2LUMA 3KLSX 1SIFA 4A9AA 3ZW3A 3Q8FA 5AZFA 2B76B 4MH0E 2DZMA 1S3SG 1C3TA 1NEKB 1V5TA 1IGDA 3BYTB 5DPSA 2BT6A 2J7QB 2PMVA 3MHSD 1KOTA 3P2BA 2RSUA 3QCAA 1L2NA 4DDID 2L76A 3PVLA 2BYTA 4N58A 3UINB 2ACZB 2DBYA 1WJUA 4W9LA 4M8NA 4KZ0A 3DHHC 5EE0A 3ZXVA 1JQ4A 1MPEA 2PJHA 3HM3A 3NHEB 5T8IA 1WR1A 3HM6X 1SEBD 2V1YA 5JH5C 3AE6B 4YTNB 2KMAA 1FRRA 2OEDA 1QILA 3ZNZB 1E9MA 4P1CC 2EKEC 4YL8A 5GMVA 2KJRA 2V0GA 2CU3A 2WWZA 4HK2A 1TS2A 3JSVA 4DXAB 5IP4D 5BMIA 2GI9A 3AMZA 2B3AA 1IPGA 1L6VA 1VJKA 2D10A 1KLVA 2LXAA 2Y5PA 2QCZA 3L4PA 3PT2B 2GRIA 2N7DA 2QILA 5KHQA 3QC8B 3RZFA 2KDMA 3ZO5B 2I1KA 5D7GA 1HTOA 1V80A 4LJOB 4OVVA
chains in the Genus database with same CATH topology
1NVID 2IGHA 3URYA 2WXQA 4OZCA 3RPFC 1ZPSA 2LJIA 1FNUA 2WP9B 4XDDA 2KACA 5JXVA 3NVZA 4R3DA 4UDUC 1NYQA 1SSNA 4HEA1 1L4ZB 1JWBD 3ZYYX 5LNK1 1C4CA 4IKGA 3Q8CA 5HHDG 2G9HD 4DQOC 2Y3AA 3AE4B 2K3UA 3TEXA 1CJEA 3R8BA 1PDXA 1KH0A 1K51A 1D5ZC 1JWUD 1TY0A 1V1OA 3MFGA 3O13A 4KGTA 4LLGM 3BK2A 1GT8A 3PZ7A 1F2RC 2VZKB 1HZ5A 1N5XA 2WXLA 3LXFA 1FFVA 3P63A 3V05A 4A6QA 1KFYB 1XLOA 1FM0D 1QLBB 1HXYD 1KLUD 1YNTE 5EE9A 1MHXA 3N9YC 1XLPA 1SJHD 2DYOA 5AUIA 3BK1A 3HRDD 3NVYA 1DOYA 1FIQA 1QQRA 1QOBA 3T3OA 4ZRQA 4RFBA 4WURA 3TEYA 2JXTA 4NAWB 4DXFA 4FXCA 4CQNA 2ONQA 4AQ7A 3AEAB 5I4DA 1JRPA 2W55A 3UI3A 4XWTA 2JZPA 1LO5D 1TYGB 1WSPA 3MJ5A 3CF4A 4AS1A 1IBXB 3AEBB 2J4XA 2CJNA 3FILA 2BS3B 2VZKD 3CWIA 1ZOYB 1SB3C 3SFEB 2IGGA 1YQ3B 2WXFA 4A8XC 3TEZA 1QKZA 2H88B 1TS4A 1QF6A 1ZXIA 1FXIA 3AEDB 2QJLA 2WXOA 1FD6A 4D2KA 3P42A 2QSDA 2W3RA 1RM6C 3AE9B 4C80A 1FEHA 3P4SB 1RYJA 3VQIA 3ZGZA 1XLQA 3AE5B 2PKOA 4RGOS 2TSSA 5BMHA 4N6EB 1YN4A 1TS5A 3AN1A 1TS3A 2WXPA 2YEPF 3H8HA 4Q2JA 3WCQA 2L1AA 4RGNA 2MJ3A 2BS4B 1WYGA 1M4VA 4WWMA 2WXGA 2W3SA 3DWGC 3HVDA 2K22A 4WAFA 2XN9C 3W5VB 1J7AA 1VR9A 1VRAB 3W5UB 2EELA 1K50A 4RGTA 2N9LA 1AWDA 1SJED 1L5PA 4JWSC 4XDCA 2JYEA 1TJEA 1ENFA 4OW0A 2RDHA 4TSSA 4HROA 2PVOD 2WXHA 4P16A 4TMAB 4OZAA 1GB4A 3PO0A 2SEBD 3KWLA 4HKQA 2E3TA 1FXAA 1JALA 3BYYB 4RNAA 1KF6B 1C76A 2K9XA 1F77A 1FFUA 1WGKA 4TQ1A 4OVZA 2JQRB 4JE3B 3Q8BA 4ITKA 1C4AA 1K53A 3FILB 3NRZA 1T3QA 2HTME 4L23A 3W2DA 2KWDA 1OQQA 4N59A 3U7ZA 1TKYA 1VZ8A 3IAS1 2WXRA 2G1EA 3B9JA 1GPXA 2W82A 4O1NA 4WH4A 1B9RA 3NZ3A 2PVGC 1VZ6A 4L2YA 1V8CA 1GTHA 2WS3B 4YTPB 1SIJA 4MM3B 3U2SC 4B0MA 4C7YA 1N61A 4HRSA 2M56B 3MC0B 3Q8AA 3ZQ4A 1V97A 3MHZA 2NMQA 5D3IB 1GOZA 4WQMA 1JW9D 1I4RA 4MT5A 2I2YA 5HG2A 1MI0A 3BVMA 5BYRA 1OFFA 1E0ZA 3BZDB 3NVWA 4DXGA 3I57A 3AH7A 2I38A 1ROEA 4YSYB 2H89B 3U52E 3LYYA 1YJJA 3P1MA 1SE4A 3VR9B 3W9CB 4US9A 4GLSC 3CIRB 4NJCA 4RH6A 1C79A 1MHHE 2M0AA 2MEKA 4ZHPA 5C3JB 4ZOHC 1EU3A 4ARCA 3SR6A 4HKZE 4YSZB 4RF0A 2RPVA 3E9SA 1QOGA 3IT6B 1PYWD 1DOIA 2YEPB 1YMHE 2LFIA 1RFKA 2D5GA 5BYSA 3BVGA 3B2GA 1CK1A 1EM7A 3ZJTA 2WU2B 1PFDA 3TEWA 1HEZE 3TUOA 1N60A 3AEGB 1JWAD 1T5XD 4H2AA 5BMGA 4M0WA 2J42A 2BTEA 2MH7A 3VRAB 3TSSA 3SFDB 1XCQL 1PGBA 1IGCA 2MJEA 1VLBA 1AYFA 1PGAA 4L1BA 2HDEA 2WXMA 2AQ3B 3AE3B 1HZ6A 1QOFA 1AN8A 2WLBA 1ZP0B 1D6EC 1GB1A 1P7FA 5MPOA 1I4GA 4JPSA 2JSVX 1C9FA 4USAA 3DWMA 3C8YA 3KWVA 1FRDA 3LB8C 3AM9A 1SE2A 1I4PA 2ZW1A 1TKGA 2KMMA 5H92C 3HVZA 2WXIA 3B2FA 4RCOA 1ZE3D 2WNMA 2Y5CA 1YQ4B 1JWMD 4NAMA 2KQ4X 2QIEB 1YJIA 3P4QB 1N62A 1TKEA 1BUIC 5EE3A 1C77A 2EKIA 1XEEA 1NYRA 3AECB 1E7PB 1JROA 4GDLB 1ACCA 2IGDA 1V1PB 2K5PA 3AE2B 1IBXA 1CZPA 5EE1A 2FE8A 3U4EG 2V3PA 1J7BA 1ET9A 3IT4B 3PZ8A 1YN3A 1KLGD 3EUB2 2BW2A 3I9V1 1EWYC 1TY2A 1XO3A 3NVVA 1I4HA 2BBCA 2L32A 1I7HA 3W1SA 1UWMA 2PTLA 3FC4A 1DOXA 2FUG1 2N0SB 4RGMA 1KTKA 2WU5B 2MJDA 1CQVA 1Y56A 1UGJA 1H7XA 2J52A 2JU6X 2IPKD 1GAQB 3Q8EA 3J9CA 2ON8A 1WWTA 1Q10A 3AEEB 2Q5WD 2V3NA 4LTUA 4MH8A 1NENB 4XWWA 3SEBA 2LHDA 5HFYA 3GB1A 4EE2A 1UUPA 5HI1A 1BMLC 4NZLB 4ARIA 1ZUD2 2Z8LA 2LEKA 3EGRA 1AW7A 2WDQB 1SXTA 2JWUA 1J7CA 1OQRA 2WXNA 3OWEB 1K52A 1PUTA 1N63A 4C56C 3FAHA 3R2TA 3BIID 1UWXA 3E56A 4A55A 2N7JA 4ZHOA 1EWCA 5AUKA 3V3XA 2INNE 2PLPA 1C4PA 1TZOA 1DYQA 1JWSD 1FCLA 4YTMB 2BS2B 2RMMA 3ZJVA 2K0PA 1VDVA 4TQ0A 1HQRD 1FO4A 2DWQA 2IJ0A 2DYMA 1F0ZA 4KX6B 1VZ7A 1WRIA 3GP7A 2BB6A 5C2TB 1D5MC 2JX5A 2L83A 4WIPA 2WDRB 3ABVB 1L4DB 3ETRA 1EU4A 2CJOA 1DGJA 4ZYSA 2X38A 1XXGA 1N5WA 1ESFA 5TSSA 1P7EA 1UNSA 4A90A 2LUMA 3KLSX 3Q69A 4PT5A 5H8YE 4A9AA 1YN5A 1A70A 4ZRPA 3Q8FA 1L6UA 1E10A 2INPE 2B76B 2J53A 4GDKB 1KRHA 1XF5L 4RF1A 1NEKB 1IGDA 3BYTB 4MACA 3IXSA 2FBWB 3GS2A 4IDIA 2BT6A 3R2IA 4LK0M 2V4IB 2PMVA 2KAJA 4KGRA 4B0EA 3RFZB 1FCCC 2WDVB 3VRBB 1QT9A 3KQ4A 1ZXHA 5E6JA 5FKAC 3BWUD 2N9KA 2XNAC 3P4PB 1D5XC 2BYTA 1ZDVA 4IOIE 4N58A 2ACZB 4YT0B 1BXTA 4YSXB 2DBYA 1XLNA 2QMTA 2ZW0A 4YWGG 2AQ1B 2LMCA 5D3DA 5EE0A 2NTTA 1XCTL 5BYQA 1SBBB 2RDGA 4P6VF 3ZJUA 1JQ4A 1MPEA 3AE1B 1MVKA 4XE0A 1L0VB 2JYTA 2W54A 4C7ZA 1V1PA 3AV8A 2IDYA 4JX1C 5T8IA 2LGIA 1L0XB 2GB1A 1STEA 1SEBD 4HJGE 3AE6B 4YTNB 2WQYB 1FRRA 2KN4A 2OEDA 1QILA 3HUIA 4OZBA 1E9MA 1T6BX 2LHEA 1ET6A 5G5HA 1JCKB 1F2RI 1JMLA 2PW9A 3MP9A 3T3NA 1GTEA 2V0GA 2CU3A 1TS2A 1I4QA 4KKIA 4YXDB 2SAKA 5BMIA 2WXJA 1WXQA 4JWUC 2GI9A 4KKJA 3AMZA 3AEFB 3P4RB 1I4XA 1FNVA 2PIAA 4J3OD 2WXKA 1RWSA 2R61A 1FNWA 1C78A 1NI3A 1PGXA 2DLBA 1QOAA 2AX5A 3NUHB 1L6VA 1VJKA 2OHFA 1D4BA 5GXGB 2QEJC 2ICIA 5G5GA 1HA5A 3AE8B 1H7WA 1ZDXA 2L52A 2Y5PA 3EA6A 2M19A 5FK9C 1FMAD 1SE3A 4REZA 1B1ZA 2BB5A 2E6XA 5FR3A 1L0YB 3BVZA 3L4PA 3VR8B 1R7SA 2GRIA 1E6EB 2QILA 3NS1A 2AQ2B 4US8A 3AB5A 2KDMA 2NTSA 1IUEA 5D7GA 3IAM1 3AE7B 1SF0A 4KGSA 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWD A;  1NVI D;  2JX5 A;  4USA A;  3DWM A;  1L5P A;  4JWS C;  2WDR B;  3ABV B;  1TJE A;  3ETR A;  2CJO A;  1FRD A;  1DGJ A;  3LB8 C;  4HRO A;  2PVO D;  3AM9 A;  3RPF C;  1N5W A;  3PO0 A;  3KWL A;  2WP9 B;  1TKG A;  2KMM A;  3NVZ A;  2E3T A;  3HVZ A;  5H8Y E;  5H92 C;  1FXA A;  1NYQ A;  3B2F A;  4A9A A;  1A70 A;  1JAL A;  1KF6 B;  1JWB D;  1L6U A;  3ZYY X;  1E10 A;  2B76 B;  2K9X A;  1FFU A;  1KRH A;  1YQ4 B;  2Y5C A;  1WGK A;  1NEK B;  2JQR B;  3AE4 B;  2QIE B;  1YJI A;  1CJE A;  2FBW B;  4ITK A;  3P4Q B;  1N62 A;  1PDX A;  4IDI A;  2BT6 A;  1TKE A;  2L83 A;  3NRZ A;  1T3Q A;  2HTM E;  5EE3 A;  1GT8 A;  2EKI A;  2KAJ A;  1OQQ A;  1NYR A;  4N59 A;  3AEC B;  1E7P B;  2WDV B;  1JRO A;  1TKY A;  3VRB B;  1QT9 A;  2K5P A;  1N5X A;  2G1E A;  3LXF A;  1FFV A;  3AE2 B;  3B9J A;  3P63 A;  1CZP A;  5EE1 A;  1GPX A;  1B9R A;  1KFY B;  1XLO A;  1J7B A;  1FM0 D;  3P4P B;  1QLB B;  2PVG C;  1V8C A;  1GTH A;  2WS3 B;  4YTP B;  1SIJ A;  3EUB 2;  4N58 A;  1XLP A;  5EE9 A;  4C7Y A;  1N61 A;  2ACZ B;  4YT0 B;  4HRS A;  4YSX B;  2DBY A;  2M56 B;  5AUI A;  1EWY C;  3HRD D;  1V97 A;  3NVY A;  1DOY A;  1FIQ A;  1XLN A;  1XO3 A;  1QOB A;  3NVV A;  4WQM A;  1JW9 D;  1I7H A;  5EE0 A;  1DOX A;  1UWM A;  3FC4 A;  1OFF A;  4FXC A;  2N0S B;  1E0Z A;  4P6V F;  1JQ4 A;  3AE1 B;  3NVW A;  2WU5 B;  1L0V B;  3AH7 A;  2MJD A;  3AEA B;  2W54 A;  1ROE A;  1H7X A;  4YSY B;  3AV8 A;  1JRP A;  2H89 B;  4C7Z A;  2W55 A;  1GAQ B;  4JX1 C;  1YJJ A;  3P1M A;  1WWT A;  3VR9 B;  3AEE B;  2Q5W D;  4LTU A;  1TYG B;  4US9 A;  3W9C B;  1NEN B;  3AE6 B;  4YTN B;  2WQY B;  3CIR B;  1FRR A;  3CF4 A;  3AEB B;  2CJN A;  3HUI A;  5C3J B;  4ZHP A;  4ZOH C;  2BS3 B;  3CWI A;  1E9M A;  3SR6 A;  1ZOY B;  1SB3 C;  3SFE B;  1ZUD 2;  4YSZ B;  1YQ3 B;  2LEK A;  5G5H A;  2H88 B;  2WDQ B;  1QF6 A;  1QOG A;  1GTE A;  1ZXI A;  1DOI A;  1FXI A;  2CU3 A;  1J7C A;  3AED B;  1OQR A;  2QJL A;  4YXD B;  2W3R A;  1RM6 C;  1RFK A;  1PUT A;  1WXQ A;  4JWU C;  3AE9 B;  4C80 A;  3AMZ A;  3P4S B;  1N63 A;  1RYJ A;  3AEF B;  3AE5 B;  3P4R B;  1XLQ A;  2PIA A;  2PKO A;  3B2G A;  1RWS A;  3FAH A;  1NI3 A;  4N6E B;  2WU2 B;  1PFD A;  3BII D;  1QOA A;  2AX5 A;  4ZHO A;  3AN1 A;  1L6V A;  1N60 A;  1VJK A;  3AEG B;  1JWA D;  5AUK A;  2OHF A;  3WCQ A;  5GXG B;  5G5G A;  2MJ3 A;  2BS4 B;  1H7W A;  3AE8 B;  3VRA B;  2L52 A;  2MH7 A;  1WYG A;  2M19 A;  3SFD B;  1FMA D;  4YTM B;  4WWM A;  2BS2 B;  2W3S A;  3DWG C;  2MJE A;  1VLB A;  2K22 A;  1AYF A;  3L4P A;  3VR8 B;  1R7S A;  3W5V B;  1E6E B;  3NS1 A;  3AE3 B;  1VDV A;  1FO4 A;  4US8 A;  1J7A A;  1QOF A;  3AB5 A;  2DWQ A;  2WLB A;  1ZP0 B;  1F0Z A;  4KX6 B;  1IUE A;  1WRI A;  3AE7 B;  1SF0 A;  3W5U B;  5MPO A;  5C2T B; 
#chains in the Genus database with same CATH topology
 1NVI D;  3L17 A;  2IGH A;  3DBH B;  4OZC A;  2G45 B;  2LJI A;  3NVZ A;  4R3D A;  1SSN A;  1L4Z B;  2BGF A;  3ZYY X;  3R7R A;  4GDL A;  3M3J A;  3AE4 B;  2K3U A;  1KH0 A;  1K51 A;  4XGA B;  4MGZ E;  1V1O A;  4RM8 A;  2D3B A;  3MJW A;  2MBE A;  1F2R C;  4HPP A;  1GUA B;  2FAZ A;  3P63 A;  3V05 A;  1OTR B;  1QLB B;  1XLP A;  3A9J A;  3N30 A;  2FCQ A;  3HRD D;  3Q3J A;  2PEA A;  3T3O A;  4WUR A;  3NG0 A;  1T0Y A;  4NAW B;  4KZC A;  2CHX A;  3AEA B;  3X23 A;  2IY0 B;  3VHT C;  1V86 A;  2VH1 A;  1TYG B;  4AS1 A;  1IBX B;  3CWI A;  1ZOY B;  1TT5 B;  3ZKJ C;  2WXF A;  5AEK B;  1FXI A;  2CS4 A;  2O2V B;  3WAO A;  5G55 A;  3VH4 B;  1RYJ A;  3VQI A;  4BKT A;  3OJ4 B;  4RGO S;  2TSS A;  4N6E B;  4PK1 A;  2WXP A;  2L1A A;  1WH3 A;  2HJ8 A;  4WWM A;  2WXG A;  1WRD B;  2BVC A;  1NBF C;  2C60 A;  2MW5 A;  4WAF A;  1XQQ A;  3WAM A;  4CYE A;  2NPT B;  2KKC A;  3Q3M C;  3RZW C;  1VRA B;  3PTF C;  3RYT A;  1R4M I;  4DHZ E;  2L0F A;  2WXH A;  4P16 A;  4TMA B;  3PO0 A;  1P9D U;  3RNC C;  4LDT B;  1JAL A;  3BYY B;  4RNA A;  1KF6 B;  2N1W A;  4KDI C;  2REX A;  3NRZ A;  4GSW A;  3NY5 A;  1OQQ A;  4N59 A;  3U7Z A;  1VZ8 A;  2D3G A;  3B9J A;  1GPX A;  4WWO A;  4L2Y A;  2WS3 B;  2K25 A;  2WDT B;  3HIZ A;  2M56 B;  3Q8A A;  2IO1 B;  3MHZ A;  4W9C A;  4WQM A;  3BVM A;  3V61 A;  3M62 B;  1EF5 A;  4DXG A;  3AH7 A;  3QIJ A;  1ROE A;  4P7I A;  4X57 B;  1SE4 A;  3RD2 A;  4RM9 A;  2IO2 B;  4RH6 A;  1C79 A;  3RNG C;  1WE7 A;  1TBE A;  5C3J B;  4A3O A;  2RPV A;  4E3C A;  1QOG A;  3IT6 B;  1DOI A;  1J0G A;  1YMH E;  4F1S A;  3EFU A;  3BVG A;  3B2G A;  4I6N B;  2QDF A;  4FHK A;  3TEW A;  1V6E A;  3NS8 A;  5BMG A;  4MJS A;  2MH7 A;  3VRA B;  3SFD B;  3QX1 A;  2EMT A;  1VLB A;  4F8C B;  4L1B A;  2AQ3 B;  1HZ6 A;  1CMX B;  3QA8 A;  1QOF A;  4NAW A;  2KYW A;  1GB1 A;  3W1Y A;  4JPS A;  2JSV X;  1C9F A;  3DWM A;  4EOY A;  3A1Q A;  4G11 A;  1FRD A;  3LB8 C;  4FJV B;  4B6W A;  4IWQ A;  1I4P A;  1TKG A;  3B2F A;  4GIV A;  1WGH A;  2Y5C A;  1YQ4 B;  1JWM D;  4I6P A;  4J6I A;  1YJI A;  3H1U A;  3P4Q B;  1N62 A;  3A4R A;  4PS8 A;  1NYR A;  3AEC B;  2N9P C;  5CHV C;  3DBL B;  4GDL B;  1ACC A;  1D3Z A;  2DAF A;  1IBX A;  5EE1 A;  2FE8 A;  2FIF A;  1ET9 A;  3IT4 B;  1WR6 E;  3PZ8 A;  1EUV B;  1V49 A;  4WWP A;  2L00 B;  3LDZ E;  3DVN V;  3I9V 1;  5LLI A;  4W9F A;  3SHQ A;  1I7H A;  1X1M A;  3W1S A;  1UWM A;  1KTK A;  1CQV A;  2JU6 X;  2JWZ A;  3A9J B;  1GAQ B;  4NJ7 A;  3J9C A;  1WWT A;  3WAN A;  4LTU A;  2J0K A;  3VTV A;  1R4N I;  2MBH A;  2JVC A;  2LHD A;  4M0W B;  1Z5S B;  2IO0 B;  4NZL B;  1ZUD 2;  4FJY A;  4C4V B;  4NY0 A;  3U30 A;  4GN1 A;  3VTU A;  2RGF A;  2WXN A;  1K52 A;  4ANX A;  2KDI A;  3QHT A;  4BBN C;  1N63 A;  3FAH A;  4BKS A;  5E6N A;  5IKC M;  3BII D;  1UWX A;  4A55 A;  5AUK A;  3Q3F A;  2LGY A;  1LM8 B;  4HLE A;  3ZJV A;  2IBI B;  2IYD B;  2IO3 B;  2AL6 A;  1VZ7 A;  3ECI A;  1WRI A;  5FR6 A;  2NS5 A;  1YD8 U;  2R2Q A;  1SGH A;  4S17 A;  1T0Q C;  4NPN A;  2MP2 A;  1N6Z A;  3QWZ B;  4ZYS A;  1QZE A;  1YIW A;  4AJY B;  2MHJ A;  4PS3 A;  2GBK A;  4ZRP A;  1L6U A;  4HCN B;  1E10 A;  2J53 A;  4RF1 A;  1KRH A;  1XF5 L;  3QAQ A;  2C5L C;  2WGS A;  4KGR A;  2K6D B;  4BBN F;  4II3 B;  3VRB B;  3OJ3 A;  1WFY A;  3N1Z C;  1WE6 A;  2NBW B;  2C9W B;  1ZDV A;  3TJP A;  4YT0 B;  4YSX B;  2LWP A;  3FKY A;  3RNA C;  2QMT A;  2ZW0 A;  2DX5 B;  2XEW A;  2NTT A;  1SBB B;  2RDG A;  4FN2 A;  4P6V F;  3AE1 B;  2JZ3 B;  3VAW A;  4C7Z A;  1V1P A;  3AV8 A;  2LRW A;  2JF5 A;  1L0X B;  3GOE A;  1STE A;  2KX3 A;  2KN4 A;  4GMV A;  4IW0 A;  4OZB A;  1T6B X;  3UIO B;  2XK5 A;  5DPW A;  3DQV A;  5G5H A;  1JML A;  3EFC A;  3T3N A;  1L7Y A;  2HJ1 A;  4KKI A;  2BKR B;  1GC7 A;  4GB9 A;  3RUI B;  2DZI A;  2PIA A;  4J3O D;  2MBO A;  1FNW A;  1NI3 A;  3KYC D;  2AX5 A;  2CHZ A;  2OHF A;  2MA9 B;  2KD0 A;  3KUD B;  1HA5 A;  3AE8 B;  1H7W A;  3EA6 A;  2NBV B;  1FMA D;  4REZ A;  2BB5 A;  2E6X A;  4K7U A;  3PGE A;  1NI2 A;  4US8 A;  2KN5 A;  3BY4 B;  5IA7 A;  4MGI E;  3QAR A;  3JW0 X;  1A5R A;  3RNF C;  3RPF C;  4DBG A;  2LAS A;  2ZPY A;  2KAC A;  4W9E A;  1NYQ A;  1GC6 A;  3IVF A;  1YX5 B;  4HEA 1;  3Q8C A;  2JRH A;  3GE8 C;  2G9H D;  1WMH B;  1R4N B;  4JLC A;  2FNJ B;  1TY0 A;  3MFG A;  3O13 A;  1ZKH A;  2KTR B;  2ZNV B;  4ZYN A;  3PZ7 A;  3C19 A;  4FA6 A;  4A6Q A;  1KLU D;  1YNT E;  2LJ5 A;  2DYO A;  3N32 A;  1MG8 A;  1E8X A;  1FIQ A;  1QOB A;  4ZRQ A;  3TEY A;  1P1A A;  3CMM B;  2ONQ A;  3DOW A;  4AQ7 A;  3KH0 A;  4XWT A;  4LDT D;  2JZP A;  2OJR A;  1VD2 A;  4MSQ B;  1WI0 A;  4KDL B;  2HTH A;  2CJN A;  3FIL A;  1YX6 B;  3SFE B;  2IGG A;  1YQ3 B;  4LNN A;  4A8X C;  2OOB B;  2JT4 B;  4WJQ A;  1FD6 A;  4D2K A;  2W3R A;  1RM6 C;  4C80 A;  3P4S B;  3H9D A;  3U7D A;  2R2O A;  1YN4 A;  3DDC B;  3H8H A;  1TS3 A;  3WCQ A;  2ZEQ A;  4RGN A;  2L7R A;  3PSE B;  2MJ3 A;  1M4V A;  4ANU A;  2KVR A;  4JL9 A;  3UIP B;  3AU5 A;  3IG3 A;  5HKH A;  2N9E B;  2GBJ A;  2MBQ A;  3Q14 C;  4HPL B;  4FLH A;  4RGT A;  2N9L A;  1AWD A;  3VTW A;  2KLG A;  4OW0 A;  4TSS A;  2PVO D;  1YQB A;  4WQO B;  1GB4 A;  1LXD A;  3KWL A;  4KVG B;  2E3T A;  4S0R A;  3RNB C;  1C76 A;  3MC9 A;  2K9X A;  1F77 A;  4C4V A;  2D07 B;  2ZVO A;  4TQ1 A;  4N9F 4;  3S2A A;  3Q8B A;  4ITK A;  4PYU A;  1K53 A;  4ANW A;  2QHO A;  3U8Z A;  4G0N B;  4L23 A;  3W2D A;  2XK5 B;  4BKG A;  3IHP C;  3SU8 X;  3AXC A;  2BWE S;  2RPQ A;  2A4Z A;  1FPY A;  4O1N A;  3NZ3 A;  4ZRK A;  1V8C A;  4YTP B;  4HRS A;  2KOX A;  3MC0 B;  3ZQ4 A;  2PE6 B;  2ZPN A;  2I2Y A;  5HG2 A;  3DVN U;  3BZD B;  3NVW A;  3I57 A;  4KIK A;  3VR9 B;  4K7S A;  1H4R A;  3CIR B;  2M0A A;  3H7P A;  3VVW B;  4ZHP A;  1EU3 A;  2KWV B;  3E9S A;  3R3M A;  4MJS B;  5TR5 A;  2D5G A;  5BYS A;  1ZGU B;  3AU4 A;  1HEZ E;  2DZJ A;  3I5J C;  1YOV B;  3AEG B;  1T5X D;  2L0T A;  3TUO A;  4H2A A;  1ISN A;  2K1F A;  1IGC A;  4EZK A;  2HE7 A;  3PPA A;  5E6O A;  2WXM A;  3AE3 B;  3GZN B;  3L10 B;  2WLB A;  1P7F A;  1WXM A;  1I4G A;  5MPO A;  4USA A;  3QQ8 B;  3C8Y A;  2KMC A;  3L54 A;  2WHI A;  1BT0 A;  5CHF A;  1LFD A;  2EMS A;  4KSL C;  5H92 C;  1LQB A;  3ZXR A;  4RCO A;  4FHJ A;  2WNM A;  4IWP A;  1UZX B;  5EDS A;  2IZV B;  2KQ4 X;  3TIX A;  4ICU A;  1TKE A;  3SD5 A;  3JYU A;  1C77 A;  4P1B C;  2G4D B;  1E7P B;  1RFA A;  2D3C A;  2K5P A;  4W9K A;  4C00 A;  3IFW B;  5CX3 A;  3U4E G;  4GDK A;  1KLG D;  3EUB 2;  2Z0D B;  1EWY C;  1P0R A;  3NVV A;  3L0W B;  3CF6 E;  2PTL A;  3FC4 A;  1I35 A;  2MJD A;  1Y56 A;  2FCS A;  1HE8 A;  3Q8E A;  2ON8 A;  2Q5W D;  2NBU A;  5IAA C;  4CO7 A;  2LGX A;  2WX1 A;  5HFY A;  3Q2A C;  5HI1 A;  2MSE D;  2LGD A;  1BML C;  2ASQ A;  3W1S C;  4EFO A;  2KT7 A;  1UBQ A;  2LEK A;  3PHX B;  2N7E A;  1SXT A;  1J7C A;  1OQR A;  3OWE B;  3ZRC A;  3R2T A;  1RAX A;  3E56 A;  2N7J A;  2JXX A;  4TUU A;  3V3X A;  2XBB C;  3DCG A;  1C4P A;  1FCL A;  4YTM B;  3ML8 A;  3ZUN A;  3T9L A;  2DWQ A;  2DYM A;  1F0Z A;  2NR2 A;  2ZVN A;  2L83 A;  2ZZP B;  4WIP A;  3D32 A;  2LD9 A;  2WDR B;  3ABV B;  1L4D B;  5DPR A;  1EU4 A;  2CJO A;  1ESF A;  5TSS A;  2KFK A;  1WJ6 A;  4PT5 A;  1A70 A;  5L83 A;  2INP E;  4GDK B;  2KQS A;  3DBH I;  3IXS A;  2FBW B;  3GS2 A;  3R2I A;  1E90 A;  2V4I B;  4B0E A;  4K7W A;  1QT9 A;  3KQ4 A;  5E6J A;  3C0R B;  2N9K A;  1M94 A;  2XNA C;  3P4P B;  3PHW B;  4IOI E;  3X0W A;  1BXT A;  2L8J A;  1XLN A;  2FCM A;  2LMC A;  4AWJ A;  3ZJU A;  4M02 A;  3APD A;  4XE0 A;  4AP4 C;  2JYT A;  2W54 A;  5J18 A;  2IDY A;  1WX7 A;  4HJG E;  2WQY B;  4TKN A;  5IN7 A;  5BO4 B;  4GXB A;  5J2R A;  1ET6 A;  4DHJ D;  2PW9 A;  2D3A A;  3MP9 A;  4NJ6 A;  1GTE A;  3WIM A;  2MWS B;  1I4Q A;  4IG7 B;  4YXD B;  1WXQ A;  4KKJ A;  1I4X A;  3P4R B;  1FNV A;  2KLC A;  1RWS A;  2R61 A;  4W9G A;  3NUH B;  3RN9 C;  2ICI A;  2L52 A;  4DK5 A;  2M19 A;  5FK9 C;  3V6C B;  5FR3 A;  1G6J A;  3VXW A;  4IUM B;  1L0Y B;  2LVO A;  3BVZ A;  1WM2 A;  3NS1 A;  4GGQ A;  2AQ2 B;  1OEY A;  4WJP A;  2NTS A;  2KDF B;  1IUE A;  2G4S A;  3IAM 1;  1SF0 A;  1FXT B;  2C7M B;  5JZE B;  2KK8 A;  1WJN A;  3URY A;  4LNF A;  2WXQ A;  1OGW A;  2K8H A;  4LNK A;  2LUE A;  1C4C A;  4LNI A;  1UGM A;  2MRP A;  2Y3A A;  1PDX A;  2KTR A;  1JWU D;  4LLG M;  2GBR A;  3H7P B;  4PS7 A;  3R7Q A;  3BK2 A;  4GU2 A;  2Y5B B;  4MEM A;  4KIK B;  3ENE A;  3LXF A;  2GMI C;  1FM0 D;  1HXY D;  1R4M B;  3H7S A;  1SJH D;  4AUQ C;  3BK1 A;  2KQ7 A;  1RRB A;  4TV3 A;  1DOY A;  3KUZ A;  2JXT A;  4DXF A;  4CQN A;  2ZNV C;  2VRR B;  1GNU A;  2LI5 A;  5I4D A;  1WSP A;  3H6N A;  4IWO A;  4IM2 A;  3AEB B;  1NDD A;  1WXA A;  2BS3 B;  2BYV E;  1SB3 C;  2L3Z A;  3TEZ A;  1QKZ A;  1TS4 A;  1QF6 A;  4NNJ B;  1ZXI A;  3P42 A;  2QSD A;  3IBE A;  3I63 C;  5IOI A;  2UYZ B;  5BMH A;  1TS5 A;  4Q2J A;  3A9K B;  2HD5 B;  2W9N A;  3DWG C;  2KDE B;  3HVD A;  1J7A A;  3MC8 A;  1VR9 A;  2EEL A;  1SJE D;  3N20 C;  2O6V A;  4JWS C;  4HRO A;  4MM3 A;  5LXH A;  3ZTD A;  4OZA A;  4HKQ A;  5C23 A;  2N9X A;  1FXA A;  1LGR A;  3NJT A;  1FFU A;  1WGK A;  2JQR B;  3APF A;  4JE3 B;  1WJ4 A;  1E7U A;  3FIL B;  4A3P A;  1J8C A;  5KHO A;  3KVF B;  2D2Q A;  2KJH B;  3Q3N C;  2G1E A;  2W82 A;  4WH4 A;  1B9R A;  1WGY A;  1GTH A;  4MM3 B;  2CU1 A;  4AJW A;  4HCP B;  1V97 A;  3HHM A;  2C7H A;  2NMQ A;  1GOZ A;  1JW9 D;  4JGH B;  1I4R A;  1MI0 A;  1E0Z A;  2M8S A;  2I38 A;  5DCN A;  4YSY B;  3LYY A;  3Q3O C;  3W9C B;  3MTN B;  2NCN A;  4K3C A;  3A9K A;  1MHH E;  4I6L B;  4KSK C;  1YJ1 A;  3DBR I;  3ALB A;  4HDQ A;  2DEN B;  2KC2 A;  4RF0 A;  3ZVV A;  3PLU A;  3L16 A;  5D2M B;  1PYW D;  2LFI A;  3PZD A;  2X8X X;  2LVP A;  3R66 C;  3VFK A;  2KFJ A;  3NOB A;  2BWF A;  1UF0 A;  3GE3 C;  1CK1 A;  1EM7 A;  3ZJT A;  2WU2 B;  1PFD A;  2JPH A;  2LRU A;  2J0J A;  4M00 A;  4BVU C;  4EKU A;  2K39 A;  4M0W A;  3TSS A;  3ML9 A;  1PGA A;  2HDE A;  3PS6 A;  1AN8 A;  1WF9 A;  2PE9 A;  5LXI B;  2DNF A;  2UWQ A;  3VUX A;  4DHJ B;  1WGD A;  4IM0 A;  3KWV A;  3V60 A;  4G3X B;  2K8C A;  3WAL A;  3AM9 A;  2PPH A;  2D11 A;  2KMM A;  2CKH B;  4EZJ A;  5D6J B;  2KZR A;  2BYF A;  4NAM A;  1KJT A;  2Z0E B;  4ACF A;  2Z59 B;  5EE3 A;  3M63 B;  2V4L A;  1XEE A;  2BF8 B;  1WIA A;  1V1P B;  3T8M A;  3WA0 A;  1E7V A;  2V3P A;  1YN3 A;  2BW2 A;  1TY2 A;  4F7Z A;  2I1J A;  2BBC A;  2L32 A;  4WWN A;  1DOX A;  1KM7 A;  3B1L X;  2FUG 1;  1F9J A;  4RGM A;  2WU5 B;  2IPK D;  2KDB A;  4M8M A;  1P3Q U;  3AEE B;  1Q0W B;  2M1M A;  1J19 A;  1TTN A;  2WX0 A;  1NEN B;  4XWW A;  4KV2 A;  4HDO A;  3DHG C;  3GB1 A;  3NZS A;  1XD3 B;  3AI5 A;  3EGR A;  2CHW A;  4JQW C;  2M4N A;  1PUT A;  4MEL A;  2AL3 A;  2RD0 A;  2GOW A;  2MP2 B;  1UH6 A;  4ZHO A;  1EWC A;  1WX9 A;  2KO3 A;  3CST A;  4W9I A;  1TZO A;  1DYQ A;  2GBM A;  1WYW B;  1VDV A;  1FO4 A;  2N4F A;  2IJ0 A;  2V3S A;  3ZTC A;  2KVZ A;  2BKF A;  3GP7 A;  3UQA A;  5C2T B;  5L95 C;  1C1Y B;  2X38 A;  1XXG A;  2MX2 A;  3Q69 A;  2BYE A;  5H8Y E;  1YN5 A;  1PQS A;  4EEW A;  3ZDM C;  3NZU A;  3PRE A;  4MAC A;  3V62 A;  4IDI A;  2LXC A;  3QJZ A;  4LCD E;  4NQL B;  4LK0 M;  2KAJ A;  4XYC A;  3RFZ B;  1FCC C;  1V9J A;  2WDV B;  1ZXH A;  5FKA C;  1TGZ B;  3ZIM A;  3BWU D;  2K8B A;  2MQJ A;  2KFK B;  1D5X C;  3KYD D;  3K9O B;  3PLV A;  5G2N A;  4W9D A;  4ZDV A;  4YWG G;  2AQ1 B;  5D3D A;  4K1R B;  5BYQ A;  1XCT L;  4ASW C;  1MVK A;  3B08 A;  1H8C A;  2NPT A;  1L0V B;  2V9H A;  4BKS D;  1V5O A;  4JX1 C;  2LGI A;  2GB1 A;  2AWT A;  3UQB A;  3B0A A;  3HUI A;  3L08 A;  2LHE A;  2LVQ A;  1JCK B;  1F2R I;  4PYZ A;  2O2V A;  2SAK A;  1WX8 A;  3PRP B;  2WXJ A;  4JWU C;  3AEF B;  3ZNG C;  4LNO A;  2WXK A;  3A1Q B;  1C78 A;  2DAJ A;  1PGX A;  1UD7 A;  2DLB A;  1QOA A;  1EO6 A;  4XX5 A;  2GBN A;  1XT9 B;  1UEL A;  5GXG B;  2QEJ C;  1D4B A;  1E8Z A;  5G5G A;  1ZDX A;  1SE3 A;  3DVG Y;  1B1Z A;  3VR8 B;  4HWI B;  1R7S A;  1E6E B;  3APC A;  3AB5 A;  5E6P A;  3AE7 B;  4KGS A;  4OHJ A;  1T0R C;  4ZRJ A;  3VH3 B;  4BAX A;  1MFW A;  1ZPS A;  1FNU A;  2C7N B;  2WP9 B;  4XDD A;  5JXV A;  5D94 A;  4UDU C;  4MGK E;  1F52 A;  1IP9 A;  1EF1 A;  1JWB D;  5LNK 1;  4IKG A;  5J17 A;  5HHD G;  4DQO C;  3ZNH B;  4AOF A;  3TEX A;  1CJE A;  3R8B A;  2N1V A;  1D5Z C;  3V6E B;  5DPT A;  4KGT A;  3QK0 A;  2JZZ A;  3RUL A;  1GT8 A;  2DYB A;  2VZK B;  4II2 B;  1HZ5 A;  4WJN A;  1N5X A;  2WXL A;  1FFV A;  1MJD A;  3DBS A;  1KFY B;  1XLO A;  4BOZ B;  2AYO B;  1E8W A;  5EE9 A;  1MHX A;  3N9Y C;  4B95 A;  5AUI A;  2FCN A;  3NVY A;  1QQR A;  1WM3 A;  4RFB A;  1V2Y A;  2DZK A;  3KW5 B;  3A4S C;  4FXC A;  3PRZ A;  1OQY A;  1JRP A;  2IND C;  2W55 A;  3UI3 A;  1Y8R C;  4W9H A;  2ZCB A;  2KJ6 A;  1LO5 D;  4HPM B;  3MJ5 A;  1JRU A;  3CF4 A;  2J4X A;  2VZK D;  2H88 B;  5AZG A;  3AED B;  2QJL A;  2WXO A;  4BFR A;  2K6Q A;  3TCA A;  3AE9 B;  2A5U A;  1FEH A;  4HVB A;  3ZGZ A;  1XLQ A;  3AE5 B;  2WYQ A;  4ANV A;  4E74 A;  2PKO A;  3UF8 A;  3AN1 A;  2YEP F;  2MCN B;  1Q5W B;  2CR5 A;  4CHK A;  2YVC A;  1HTQ A;  2BS4 B;  1WYG A;  5JHB A;  4DWF A;  1GG3 A;  2W3S A;  2JUO A;  2K22 A;  3ZDT A;  2XN9 C;  3W5V B;  3SDL C;  4MSM B;  1WZ0 A;  3N1Y C;  4W9J A;  3W5U B;  1K50 A;  1F1H A;  3N1X C;  1L5P A;  3L13 A;  4XDC A;  2JYE A;  4WJO A;  4WAA A;  1TJE A;  2KAN A;  1ENF A;  2RDH A;  1WGR A;  3Q6B A;  2SEB D;  2NVU I;  3RMK C;  1E5W A;  4OVZ A;  1C4A A;  4HJK A;  1T0S C;  4A20 A;  3EHV A;  1T3Q A;  2HTM E;  4K3B A;  4BZA A;  2KWD A;  2KC1 A;  2G3Q B;  4DHZ B;  3A33 B;  3PV1 A;  1TKY A;  1VCB A;  3IAS 1;  1SE9 A;  4QAY A;  2WXR A;  4MDK E;  4EUT A;  1V81 A;  2PVG C;  1VZ6 A;  1U4A A;  1SIJ A;  3U2S C;  4B0M A;  4C7Y A;  1N61 A;  3O65 B;  5CHW A;  3RI7 C;  5D3I B;  4E71 A;  5C1Z A;  3EEC A;  4HXD A;  4MT5 A;  2MLB A;  5BYR A;  1OFF A;  3VUY A;  3TMP B;  3RNE C;  3OLM D;  3RCZ A;  2H89 B;  3U52 E;  1YJJ A;  2L05 A;  1P98 A;  3P1M A;  2MBB B;  4US9 A;  3DBR B;  4GLS C;  4NJC A;  3TL5 A;  2MEK A;  4ICV A;  4M01 A;  4ZOH C;  4ARC A;  3SR6 A;  4HKZ E;  4YSZ B;  4XZ4 A;  2OJW A;  2KTF A;  4URK A;  3DPD A;  2LGS A;  2YEP B;  4FAD A;  2KNB A;  4JIO U;  1RFK A;  4EZL A;  1S1Q B;  4IC7 B;  3OG5 A;  3ONS A;  2FUH B;  2BPS A;  1N60 A;  1JWA D;  2AEH A;  2J42 A;  2KWU B;  2BTE A;  4FBJ B;  4RMA A;  2LZ6 A;  1XCQ L;  2KHW B;  1PGB A;  2MJE A;  1AYF A;  2M17 A;  2O6V D;  4MGY E;  3ZLZ A;  3EC8 A;  1WGG A;  1ZP0 B;  1D6E C;  2KWC A;  1AAR A;  3LJ3 A;  4DDG D;  1I42 A;  1WXS A;  2BQQ A;  3UGB B;  1WXV A;  2JRI B;  1SE2 A;  2ZW1 A;  3JSV B;  3HVZ A;  2WXI A;  1Q1O A;  4G50 A;  2QC8 A;  1ZE3 D;  2QIE B;  1IYF A;  1MG4 A;  4BOS C;  1BUI C;  5AZH A;  2EKI A;  3JVZ X;  1WMH A;  1JRO A;  2IGD A;  2GLS A;  2FID A;  3AUL A;  5CTR C;  2M0X A;  3AE2 B;  1CZP A;  3I3T B;  3DBL I;  1Z2M A;  4FUL A;  1J7B A;  1OEY J;  3KUC B;  1WY8 A;  5JHA A;  4ZRI A;  1TZ1 A;  2JY6 A;  2YLM A;  4FJZ A;  4GOC A;  3HK0 A;  1XO3 A;  3ZRF A;  2ZCC A;  3ZNI D;  1I4H A;  4NQK E;  2N0S B;  2ZJD A;  3VDZ A;  3DVG X;  4K81 A;  1GJZ A;  1UGJ A;  2O6V B;  1H7X A;  2J52 A;  2VH2 A;  1Q10 A;  2V3N A;  2J0M A;  4MH8 A;  2UU7 A;  3SEB A;  3WAP A;  3DHI C;  4EE2 A;  1UUP A;  4ARI A;  3RT3 B;  2Z8L A;  1AW7 A;  2WDQ B;  4B9K A;  2JWU A;  3OAW A;  3TBL D;  2RDB C;  4C56 C;  1K8R B;  1E8Y A;  2INC C;  1UBI A;  3VUW A;  3GZN I;  3M95 A;  4XC2 A;  2KX0 A;  2INN E;  2PLP A;  3N3K B;  1JWS D;  2BS2 B;  4IM3 A;  2RMM A;  2K0P A;  3PRM B;  1TIF A;  1ZW7 A;  4TQ0 A;  1HQR D;  3BIN A;  4KX6 B;  3CSF A;  1WZ3 A;  2BB6 A;  1D5M C;  2JX5 A;  4OVU A;  2DHZ A;  2IY1 B;  2RR9 A;  4LJP B;  3ETR A;  1DGJ A;  1RLF A;  2KXJ A;  1N5W A;  5IO9 A;  1P7E A;  1UNS A;  4A90 A;  3K9P B;  2LUM A;  3KLS X;  1SIF A;  4A9A A;  3ZW3 A;  3Q8F A;  5AZF A;  2B76 B;  4MH0 E;  2DZM A;  1S3S G;  1C3T A;  1NEK B;  1V5T A;  1IGD A;  3BYT B;  5DPS A;  2BT6 A;  2J7Q B;  2PMV A;  3MHS D;  1KOT A;  3P2B A;  2RSU A;  3QCA A;  1L2N A;  4DDI D;  2L76 A;  3PVL A;  2BYT A;  4N58 A;  3UIN B;  2ACZ B;  2DBY A;  1WJU A;  4W9L A;  4M8N A;  4KZ0 A;  3DHH C;  5EE0 A;  3ZXV A;  1JQ4 A;  1MPE A;  2PJH A;  3HM3 A;  3NHE B;  5T8I A;  1WR1 A;  3HM6 X;  1SEB D;  2V1Y A;  5JH5 C;  3AE6 B;  4YTN B;  2KMA A;  1FRR A;  2OED A;  1QIL A;  3ZNZ B;  1E9M A;  4P1C C;  2EKE C;  4YL8 A;  5GMV A;  2KJR A;  2V0G A;  2CU3 A;  2WWZ A;  4HK2 A;  1TS2 A;  3JSV A;  4DXA B;  5IP4 D;  5BMI A;  2GI9 A;  3AMZ A;  2B3A A;  1IPG A;  1L6V A;  1VJK A;  2D10 A;  1KLV A;  2LXA A;  2Y5P A;  2QCZ A;  3L4P A;  3PT2 B;  2GRI A;  2N7D A;  2QIL A;  5KHQ A;  3QC8 B;  3RZF A;  2KDM A;  3ZO5 B;  2I1K A;  5D7G A;  1HTO A;  1V80 A;  4LJO B;  4OVV A; 
#chains in the Genus database with same CATH homology
 1NVI D;  2IGH A;  3URY A;  2WXQ A;  4OZC A;  3RPF C;  1ZPS A;  2LJI A;  1FNU A;  2WP9 B;  4XDD A;  2KAC A;  5JXV A;  3NVZ A;  4R3D A;  4UDU C;  1NYQ A;  1SSN A;  4HEA 1;  1L4Z B;  1JWB D;  3ZYY X;  5LNK 1;  1C4C A;  4IKG A;  3Q8C A;  5HHD G;  2G9H D;  4DQO C;  2Y3A A;  3AE4 B;  2K3U A;  3TEX A;  1CJE A;  3R8B A;  1PDX A;  1KH0 A;  1K51 A;  1D5Z C;  1JWU D;  1TY0 A;  1V1O A;  3MFG A;  3O13 A;  4KGT A;  4LLG M;  3BK2 A;  1GT8 A;  3PZ7 A;  1F2R C;  2VZK B;  1HZ5 A;  1N5X A;  2WXL A;  3LXF A;  1FFV A;  3P63 A;  3V05 A;  4A6Q A;  1KFY B;  1XLO A;  1FM0 D;  1QLB B;  1HXY D;  1KLU D;  1YNT E;  5EE9 A;  1MHX A;  3N9Y C;  1XLP A;  1SJH D;  2DYO A;  5AUI A;  3BK1 A;  3HRD D;  3NVY A;  1DOY A;  1FIQ A;  1QQR A;  1QOB A;  3T3O A;  4ZRQ A;  4RFB A;  4WUR A;  3TEY A;  2JXT A;  4NAW B;  4DXF A;  4FXC A;  4CQN A;  2ONQ A;  4AQ7 A;  3AEA B;  5I4D A;  1JRP A;  2W55 A;  3UI3 A;  4XWT A;  2JZP A;  1LO5 D;  1TYG B;  1WSP A;  3MJ5 A;  3CF4 A;  4AS1 A;  1IBX B;  3AEB B;  2J4X A;  2CJN A;  3FIL A;  2BS3 B;  2VZK D;  3CWI A;  1ZOY B;  1SB3 C;  3SFE B;  2IGG A;  1YQ3 B;  2WXF A;  4A8X C;  3TEZ A;  1QKZ A;  2H88 B;  1TS4 A;  1QF6 A;  1ZXI A;  1FXI A;  3AED B;  2QJL A;  2WXO A;  1FD6 A;  4D2K A;  3P42 A;  2QSD A;  2W3R A;  1RM6 C;  3AE9 B;  4C80 A;  1FEH A;  3P4S B;  1RYJ A;  3VQI A;  3ZGZ A;  1XLQ A;  3AE5 B;  2PKO A;  4RGO S;  2TSS A;  5BMH A;  4N6E B;  1YN4 A;  1TS5 A;  3AN1 A;  1TS3 A;  2WXP A;  2YEP F;  3H8H A;  4Q2J A;  3WCQ A;  2L1A A;  4RGN A;  2MJ3 A;  2BS4 B;  1WYG A;  1M4V A;  4WWM A;  2WXG A;  2W3S A;  3DWG C;  3HVD A;  2K22 A;  4WAF A;  2XN9 C;  3W5V B;  1J7A A;  1VR9 A;  1VRA B;  3W5U B;  2EEL A;  1K50 A;  4RGT A;  2N9L A;  1AWD A;  1SJE D;  1L5P A;  4JWS C;  4XDC A;  2JYE A;  1TJE A;  1ENF A;  4OW0 A;  2RDH A;  4TSS A;  4HRO A;  2PVO D;  2WXH A;  4P16 A;  4TMA B;  4OZA A;  1GB4 A;  3PO0 A;  2SEB D;  3KWL A;  4HKQ A;  2E3T A;  1FXA A;  1JAL A;  3BYY B;  4RNA A;  1KF6 B;  1C76 A;  2K9X A;  1F77 A;  1FFU A;  1WGK A;  4TQ1 A;  4OVZ A;  2JQR B;  4JE3 B;  3Q8B A;  4ITK A;  1C4A A;  1K53 A;  3FIL B;  3NRZ A;  1T3Q A;  2HTM E;  4L23 A;  3W2D A;  2KWD A;  1OQQ A;  4N59 A;  3U7Z A;  1TKY A;  1VZ8 A;  3IAS 1;  2WXR A;  2G1E A;  3B9J A;  1GPX A;  2W82 A;  4O1N A;  4WH4 A;  1B9R A;  3NZ3 A;  2PVG C;  1VZ6 A;  4L2Y A;  1V8C A;  1GTH A;  2WS3 B;  4YTP B;  1SIJ A;  4MM3 B;  3U2S C;  4B0M A;  4C7Y A;  1N61 A;  4HRS A;  2M56 B;  3MC0 B;  3Q8A A;  3ZQ4 A;  1V97 A;  3MHZ A;  2NMQ A;  5D3I B;  1GOZ A;  4WQM A;  1JW9 D;  1I4R A;  4MT5 A;  2I2Y A;  5HG2 A;  1MI0 A;  3BVM A;  5BYR A;  1OFF A;  1E0Z A;  3BZD B;  3NVW A;  4DXG A;  3I57 A;  3AH7 A;  2I38 A;  1ROE A;  4YSY B;  2H89 B;  3U52 E;  3LYY A;  1YJJ A;  3P1M A;  1SE4 A;  3VR9 B;  3W9C B;  4US9 A;  4GLS C;  3CIR B;  4NJC A;  4RH6 A;  1C79 A;  1MHH E;  2M0A A;  2MEK A;  4ZHP A;  5C3J B;  4ZOH C;  1EU3 A;  4ARC A;  3SR6 A;  4HKZ E;  4YSZ B;  4RF0 A;  2RPV A;  3E9S A;  1QOG A;  3IT6 B;  1PYW D;  1DOI A;  2YEP B;  1YMH E;  2LFI A;  1RFK A;  2D5G A;  5BYS A;  3BVG A;  3B2G A;  1CK1 A;  1EM7 A;  3ZJT A;  2WU2 B;  1PFD A;  3TEW A;  1HEZ E;  3TUO A;  1N60 A;  3AEG B;  1JWA D;  1T5X D;  4H2A A;  5BMG A;  4M0W A;  2J42 A;  2BTE A;  2MH7 A;  3VRA B;  3TSS A;  3SFD B;  1XCQ L;  1PGB A;  1IGC A;  2MJE A;  1VLB A;  1AYF A;  1PGA A;  4L1B A;  2HDE A;  2WXM A;  2AQ3 B;  3AE3 B;  1HZ6 A;  1QOF A;  1AN8 A;  2WLB A;  1ZP0 B;  1D6E C;  1GB1 A;  1P7F A;  5MPO A;  1I4G A;  4JPS A;  2JSV X;  1C9F A;  4USA A;  3DWM A;  3C8Y A;  3KWV A;  1FRD A;  3LB8 C;  3AM9 A;  1SE2 A;  1I4P A;  2ZW1 A;  1TKG A;  2KMM A;  5H92 C;  3HVZ A;  2WXI A;  3B2F A;  4RCO A;  1ZE3 D;  2WNM A;  2Y5C A;  1YQ4 B;  1JWM D;  4NAM A;  2KQ4 X;  2QIE B;  1YJI A;  3P4Q B;  1N62 A;  1TKE A;  1BUI C;  5EE3 A;  1C77 A;  2EKI A;  1XEE A;  1NYR A;  3AEC B;  1E7P B;  1JRO A;  4GDL B;  1ACC A;  2IGD A;  1V1P B;  2K5P A;  3AE2 B;  1IBX A;  1CZP A;  5EE1 A;  2FE8 A;  3U4E G;  2V3P A;  1J7B A;  1ET9 A;  3IT4 B;  3PZ8 A;  1YN3 A;  1KLG D;  3EUB 2;  2BW2 A;  3I9V 1;  1EWY C;  1TY2 A;  1XO3 A;  3NVV A;  1I4H A;  2BBC A;  2L32 A;  1I7H A;  3W1S A;  1UWM A;  2PTL A;  3FC4 A;  1DOX A;  2FUG 1;  2N0S B;  4RGM A;  1KTK A;  2WU5 B;  2MJD A;  1CQV A;  1Y56 A;  1UGJ A;  1H7X A;  2J52 A;  2JU6 X;  2IPK D;  1GAQ B;  3Q8E A;  3J9C A;  2ON8 A;  1WWT A;  1Q10 A;  3AEE B;  2Q5W D;  2V3N A;  4LTU A;  4MH8 A;  1NEN B;  4XWW A;  3SEB A;  2LHD A;  5HFY A;  3GB1 A;  4EE2 A;  1UUP A;  5HI1 A;  1BML C;  4NZL B;  4ARI A;  1ZUD 2;  2Z8L A;  2LEK A;  3EGR A;  1AW7 A;  2WDQ B;  1SXT A;  2JWU A;  1J7C A;  1OQR A;  2WXN A;  3OWE B;  1K52 A;  1PUT A;  1N63 A;  4C56 C;  3FAH A;  3R2T A;  3BII D;  1UWX A;  3E56 A;  4A55 A;  2N7J A;  4ZHO A;  1EWC A;  5AUK A;  3V3X A;  2INN E;  2PLP A;  1C4P A;  1TZO A;  1DYQ A;  1JWS D;  1FCL A;  4YTM B;  2BS2 B;  2RMM A;  3ZJV A;  2K0P A;  1VDV A;  4TQ0 A;  1HQR D;  1FO4 A;  2DWQ A;  2IJ0 A;  2DYM A;  1F0Z A;  4KX6 B;  1VZ7 A;  1WRI A;  3GP7 A;  2BB6 A;  5C2T B;  1D5M C;  2JX5 A;  2L83 A;  4WIP A;  2WDR B;  3ABV B;  1L4D B;  3ETR A;  1EU4 A;  2CJO A;  1DGJ A;  4ZYS A;  2X38 A;  1XXG A;  1N5W A;  1ESF A;  5TSS A;  1P7E A;  1UNS A;  4A90 A;  2LUM A;  3KLS X;  3Q69 A;  4PT5 A;  5H8Y E;  4A9A A;  1YN5 A;  1A70 A;  4ZRP A;  3Q8F A;  1L6U A;  1E10 A;  2INP E;  2B76 B;  2J53 A;  4GDK B;  1KRH A;  1XF5 L;  4RF1 A;  1NEK B;  1IGD A;  3BYT B;  4MAC A;  3IXS A;  2FBW B;  3GS2 A;  4IDI A;  2BT6 A;  3R2I A;  4LK0 M;  2V4I B;  2PMV A;  2KAJ A;  4KGR A;  4B0E A;  3RFZ B;  1FCC C;  2WDV B;  3VRB B;  1QT9 A;  3KQ4 A;  1ZXH A;  5E6J A;  5FKA C;  3BWU D;  2N9K A;  2XNA C;  3P4P B;  1D5X C;  2BYT A;  1ZDV A;  4IOI E;  4N58 A;  2ACZ B;  4YT0 B;  1BXT A;  4YSX B;  2DBY A;  1XLN A;  2QMT A;  2ZW0 A;  4YWG G;  2AQ1 B;  2LMC A;  5D3D A;  5EE0 A;  2NTT A;  1XCT L;  5BYQ A;  1SBB B;  2RDG A;  4P6V F;  3ZJU A;  1JQ4 A;  1MPE A;  3AE1 B;  1MVK A;  4XE0 A;  1L0V B;  2JYT A;  2W54 A;  4C7Z A;  1V1P A;  3AV8 A;  2IDY A;  4JX1 C;  5T8I A;  2LGI A;  1L0X B;  2GB1 A;  1STE A;  1SEB D;  4HJG E;  3AE6 B;  4YTN B;  2WQY B;  1FRR A;  2KN4 A;  2OED A;  1QIL A;  3HUI A;  4OZB A;  1E9M A;  1T6B X;  2LHE A;  1ET6 A;  5G5H A;  1JCK B;  1F2R I;  1JML A;  2PW9 A;  3MP9 A;  3T3N A;  1GTE A;  2V0G A;  2CU3 A;  1TS2 A;  1I4Q A;  4KKI A;  4YXD B;  2SAK A;  5BMI A;  2WXJ A;  1WXQ A;  4JWU C;  2GI9 A;  4KKJ A;  3AMZ A;  3AEF B;  3P4R B;  1I4X A;  1FNV A;  2PIA A;  4J3O D;  2WXK A;  1RWS A;  2R61 A;  1FNW A;  1C78 A;  1NI3 A;  1PGX A;  2DLB A;  1QOA A;  2AX5 A;  3NUH B;  1L6V A;  1VJK A;  2OHF A;  1D4B A;  5GXG B;  2QEJ C;  2ICI A;  5G5G A;  1HA5 A;  3AE8 B;  1H7W A;  1ZDX A;  2L52 A;  2Y5P A;  3EA6 A;  2M19 A;  5FK9 C;  1FMA D;  1SE3 A;  4REZ A;  1B1Z A;  2BB5 A;  2E6X A;  5FR3 A;  1L0Y B;  3BVZ A;  3L4P A;  3VR8 B;  1R7S A;  2GRI A;  1E6E B;  2QIL A;  3NS1 A;  2AQ2 B;  4US8 A;  3AB5 A;  2KDM A;  2NTS A;  1IUE A;  5D7G A;  3IAM 1;  3AE7 B;  1SF0 A;  4KGS A;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...