3W5VB

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQICDGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
total genus 21
structure length 96
sequence length 96
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w5vB00
3AEFB 4WWMA 1OQQA 3P4SB 3W5UB 1WRIA 3VR8B 3HUIA 3AE7B 1ZUD2 3P4QB 4YSXB 3AM9A 1JQ4A 4YXDB 2HTME 1XLOA 2AX5A 3AE9B 2PVOD 2E3TA 1FXAA 5EE3A 3ZYYX 3AECB 1L6VA 1FFUA 1QLBB 2FBWB 1YQ4B 1ZOYB 3SR6A 1DGJA 3W5VB 2WLBA 1J7AA 3NRZA 4HROA 4US9A 3AE8B 1SIJA 1GAQB 3FC4A 4YT0B 1FMAD 1NEKB 1L5PA 2CJOA 5C2TB 1WGKA 1N5XA 1QOBA 1JRPA 2W3SA 3SFDB 1DOYA 2WS3B 1NENB 4LTUA 1T3QA 3EUB2 3DWGC 1QF6A 3NS1A 3B9JA 3ETRA 1NI3A 3FAHA 5G5GA 2B76B 4IDIA 3W9CB 1YQ3B 1E10A 4HRSA 1JWBD 1FRDA 1GPXA 1NYRA 3AE4B 3CIRB 1L6UA 1NYQA 1VJKA 1QOGA 2BS2B 1TYGB 3AH7A 1DOXA 2MJDA 1FFVA 1JWAD 2PVGC 2QIEB 3NVVA 4USAA 1VDVA 3AN1A 1RM6C 1PUTA 2CU3A 2MH7A 1RWSA 1N60A 2QJLA 2BS4B 5AUKA 3BIID 4C80A 1B9RA 2K22A 1EWYC 2W55A 4YSZB 2OHFA 2M19A 1CJEA 2WP9B 1V8CA 3AMZA 3P1MA 3DWMA 1JROA 1NVID 1XLQA 4YTPB 4FXCA 3AEAB 2W3RA 1YJJA 1JW9D 2BT6A 1QOFA 2WDQB 3PO0A 1DOIA 2W54A 3HVZA 1J7BA 1N63A 1AWDA 2MJ3A 3AE6B 2WU2B 4JX1C 2G1EA 5EE9A 1KFYB 4ZHPA 3AB5A 2KAJA 4WQMA 2KMMA 2H89B 1UWMA 4KX6B 3L4PA 1OQRA 2K9XA 2WU5B 1AYFA 3LXFA 2JX5A 2WDVB 2CJNA 2BS3B 4N58A 1N61A 1RFKA 1N62A 3ABVB 3VRAB 3VR9B 3HRDD 1ZP0B 1TJEA 2H88B 3P63A 3AE2B 1V97A 3B2GA 2LEKA 4N6EB 1XLPA 3NVZA 2L83A 5AUIA 1XLNA 3CWIA 2DBYA 1TKYA 1F0ZA 1KF6B 1N5WA 3VRBB 1A70A 2WDRB 1PDXA 3AE5B 1FIQA 1E0ZA 2WQYB 1E9MA 3AE3B 1WXQA 5G5HA 2PIAA 1WYGA 2ACZB 4ZOHC 1TKGA 4YTMB 1SF0A 3NVYA 3NVWA 5H92C 1E7PB 1FO4A 2N0SB 3B2FA 1I7HA 3AV8A 3AEDB 2EKIA 3AEEB 3P4PB 1J7CA 2JQRB 5EE0A 1WWTA 4YSYB 2MJEA 2PKOA 4N59A 5H8YE 4C7ZA 4ITKA 1YJIA 1XO3A 4A9AA 1PFDA 4P6VF 1CZPA 1QT9A 4YTNB 3AE1B 3LB8C 5GXGB 3SFEB 1VLBA 5MPOA 3WCQA 1TKEA 5EE1A 1OFFA 3RPFC 1L0VB 1JALA 2K5PA 3AEGB 2M56B 4JWSC 1ROEA 3KWLA 4ZHOA 1RYJA 2DWQA 2Q5WD 3AEBB 1IUEA 1FM0D 4US8A 1FXIA 1R7SA 4JWUC 4C7YA 5C3JB 1QOAA 2Y5CA 1FRRA 1SB3C 1E6EB 1ZXIA 3P4RB 2L52A 1KRHA
chains in the Genus database with same CATH superfamily
2GI9A 1H8CA 1ZUD2 3IT4B 1V9JA 5EE3A 2WXMA 4I6NB 1J7AA 4XZ4A 1GG3A 1GAQB 4RM8A 2R2QA 4LLGM 1EU3A 1WGKA 4HXDA 4AWJA 2L0FA 4M0WB 3FAHA 1ISNA 4MT5A 3ZNGC 3ZNHB 1NYRA 3PHWB 1TS3A 1L6UA 3LJ3A 4F1SA 3NVVA 1I4GA 5CX3A 2J42A 3ZW3A 4IWOA 5JHAA 3PZDA 2JYEA 3DHGC 1V8CA 3DWMA 3JSVA 3A33B 1NDDA 2BKRB 4W9FA 4NAMA 1A5RA 1L0XB 2LUEA 1JRUA 4IUMB 1Q1OA 4LNNA 2ONQA 3LXFA 4N58A 1I42A 1T0RC 4E71A 4ASWC 3PRPB 3GP7A 4PS8A 2KC1A 4ANUA 4C00A 1V97A 3WIMA 2LEKA 2LVPA 4IW0A 4KZCA 4BVUC 2RDHA 4RF1A 1YN3A 4BFRA 4ZYNA 1UUPA 4DXFA 1FCCC 4RH6A 4OVZA 4ARCA 2JXXA 3ALBA 3AEEB 5D7GA 2O2VB 1L7YA 3P4PB 3N9YC 2MJEA 1V1OA 2WXFA 4YTNB 2K0PA 2GBNA 4MJSA 3N30A 3O65B 3PTFC 2KQ4X 3OAWA 3RZFA 2NBUA 4B6WA 1D4BA 5IP4D 3C8YA 1QOAA 4K1RB 2RDGA 4TQ0A 3Q3MC 4RF0A 3PGEA 3UF8A 3AE9B 1STEA 1SEBD 2L1AA 2ZCBA 2D11A 4P7IA 1V5OA 4LTUA 4HEA1 2JF5A 4AJYB 4IDIA 1R4NB 1XQQA 3KW5B 1JWBD 4XWWA 2WDTB 1VJKA 2BS2B 3TSSA 4X57B 2PJHA 2MJDA 3N3KB 1P7FA 2D3BA 2L32A 4GN1A 2J0JA 2K39A 1TS4A 1PGBA 1I4QA 2RGFA 1WJUA 1TIFA 3AXCA 1EF1A 3MC8A 2WDQB 1PGAA 2LUMA 3JSVB 1GJZA 5EDSA 2KXJA 4M8MA 2ZPYA 3ZDTA 1KLVA 3V3XA 5LXIB 4LNOA 3K9OB 1AYFA 3IXSA 1IYFA 1EM7A 4K3BA 4FULA 2L83A 1L4DB 3CWIA 4II2B 2WXKA 2KMCA 2WDRB 3TBLD 1T0YA 3DVNU 3EFCA 1SSNA 2KYWA 4YTMB 1SF0A 4XDCA 1HQRD 3BVZA 1NBFC 3DBLI 3A9JA 2WXLA 1EF5A 3HM3A 3QAQA 1P98A 4E3CA 1YOVB 4MELA 2M8SA 3UGBB 1C1YB 2ON8A 1L0VB 4JWSC 3DHIC 2BWES 1WGRA 4AP4C 2BTEA 2KJRA 4GDKA 4MJSB 3BWUD 4PYUA 2BF8B 5BMGA 4ANWA 4WWMA 1S1QB 3T8MA 2VH1A 2Y3AA 4WIPA 4YSXB 2MLBA 3ZYYX 1FNVA 4XDDA 1UWXA 3VTWA 2C7NB 1LFDA 5AZGA 5IO9A 3PRZA 1UELA 3QA8A 3E9SA 3FILB 4XWTA 3DPDA 4RM9A 2CHZA 4WJQA 5G5GA 3QQ8B 1WJ4A 2V1YA 2MRPA 3I63C 2INDC 3EFUA 3KH0A 4E74A 3Q69A 3UI3A 1TYGB 3W1SA 1SJHD 1F9JA 2KTRA 2MH7A 3PREA 2QJLA 4EZKA 1UNSA 2KQSA 4LJOB 3VTVA 4OZAA 1SGHA 2KLGA 1JROA 2C60A 3X0WA 5G55A 1VRAB 1NVID 3KLSX 2BT6A 1WMHB 2Z8LA 1P3QU 3HVZA 3R7RA 1GC6A 3DBHI 5D3DA 1I4HA 1UWMA 4KX6B 2FCNA 2R2OA 4YWGG 2JX5A 3VR9B 1N62A 3HRDD 4EE2A 1D5ZC 5J18A 1CK1A 3T9LA 2HD5B 2BVCA 4LK0M 3KWVA 1LXDA 4IWQA 1HEZE 3AE5B 3IT6B 1OEYJ 3NG0A 2N0SB 2C7MB 2ICIA 3N32A 1SIFA 3AEDB 2N9KA 4NAWA 4IM0A 3ZNID 1V1PA 1WF9A 3R66C 2IGDA 1CZPA 3A9JB 3RNCC 4IKGA 4S17A 5GXGB 1AARA 2V0GA 4BKSA 4FJVB 1S3SG 2W9NA 1Q10A 2CHXA 2ZW1A 1KRHA 2K8CA 4GDKB 2CHWA 2UYZB 2NS5A 1QLBB 2FBWB 2BYEA 2MBEA 2SEBD 1XD3B 3Q3FA 2V9HA 3RNBC 2DYBA 3UIOB 3AI5A 1SJED 1BMLC 2WXQA 4KVGB 4XX5A 4WWPA 3MHSD 2B76B 1QILA 4M02A 1C79A 2MWSB 2KDMA 3AULA 1MI0A 4GLSC 4MGYE 3WANA 1JWAD 2DHZA 2C7HA 4PS3A 4HPLB 2XN9C 3J9CA 1FD6A 2W55A 4YSZB 2M0XA 4URKA 3P1MA 2KTRB 2RDBC 3ZXRA 3VAWA 1N63A 3V62A 2DZMA 4JX1C 1WXVA 3NZ3A 3P42A 4GB9A 2N9PC 1WY8A 3RFZB 1ET6A 1PQSA 3VRAB 5MPOA 3Q3JA 4KSKC 1XLNA 1T0SC 3K9PB 2LVOA 2C9WB 2WXJA 1KJTA 4KDLB 2D3CA 2IO0B 5G5HA 2PIAA 3WALA 3Q2AC 1YX5B 5KHOA 2D07B 3AV8A 4FHKA 4K7UA 1HE8A 2KMAA 3ZIMA 1PFDA 4NAWB 1QT9A 5D3IB 1HA5A 3SFEB 2X38A 1PGXA 2KN5A 1OFFA 2J7QB 1UGMA 2AEHA 1RAXA 4LJPB 2OJRA 4S0RA 2JYTA 2B3AA 2ZEQA 3TEYA 3O13A 2JZPA 2N4FA 4WAFA 3RULA 2PVOD 5FR6A 4HWIB 4PYZA 1ZGUB 5D2MB 3R3MA 3ML9A 2LWPA 2AL6A 3URYA 1RLFA 3FC4A 3KUDB 2CJOA 1EU4A 1JRPA 2JY6A 1VZ8A 4N9F4 4NY0A 1HZ5A 4GDLA 3W9CB 4KIKA 1ZDXA 3CIRB 3RNFC 4A3OA 4GSWA 2NPTA 2KACA 1T6BX 3AN1A 3QIJA 4CO7A 1HTOA 1EWYC 1CJEA 2KDBA 2J53A 3ZGZA 3N1ZC 4KZ0A 4MGIE 1V80A 1IBXA 3ONSA 3CF6E 5L83A 3GZNI 3M63B 3AE6B 2KNBA 1KFYB 4NQLB 2Z0EB 2I2YA 1N61A 2HDEA 2RMMA 2GRIA 4KGSA 1XLPA 1ZDVA 2DBYA 2DX5B 3NUHB 4K81A 3VRBB 1PDXA 4FADA 3JYUA 3HIZA 1EUVB 4CHKA 4JLCA 3L16A 1RRBA 3GB1A 4K3CA 3PVLA 4BBNF 1I7HA 2EKIA 2KWDA 2VZKB 5EE0A 2JQRB 1WWTA 1R4MI 2AWTA 4ITKA 3U8ZA 3M95A 1JWUD 4IOIE 2PE6B 3UINB 3B1LX 1XT9B 2L00B 2DWQA 4BOSC 1J8CA 3HK0A 5E6OA 4EKUA 5HG2A 2Y5CA 4W9LA 1ENFA 3P4SB 5CHVC 4YXDB 2HTME 1XLOA 2AX5A 4GMVA 4FA6A 2E3TA 2LD9A 1WIAA 2XK5B 3SR6A 3M62B 4BZAA 3AE8B 3EA6A 1XF5L 3V05A 1DOYA 3ZKJC 1DYQA 2LI5A 3NZUA 1YN5A 3GS2A 4LNKA 3SEBA 1MJDA 4LCDE 1NYQA 4W9EA 4KDIC 2LVQA 4GDLB 1YD8U 1WX7A 2D3GA 4HJKA 2NPTB 1QKZA 3APCA 4RMAA 2WX0A 4PK1A 1VD2A 1XLQA 5J2RA 4CYEA 3DBRI 2CS4A 1DOIA 2INCC 3IBEA 1TT5B 1UD7A 4JPSA 3Q6BA 4WWOA 1IBXB 1SE4A 3EC8A 1ZW7A 1C3TA 3ABVB 2I1KA 2JZ3B 2X8XX 2AQ3B 3VH4B 2SAKA 5AUIA 1EO6A 1KF6B 4OHJA 2V4IB 1WYGA 4OZBA 4Q2JA 1C77A 1GOZA 1ZPSA 5IAAC 4OZCA 4AUQC 1WX9A 4A3PA 4WH4A 2RPQA 4M01A 4MM3A 5JH5C 3NZSA 2GBKA 1YJIA 2NMQA 3WCQA 1KM7A 2M56B 3H8HA 1C4PA 5E6PA 2BB5A 4G3XB 4HLEA 4WJOA 2J0KA 4PS7A 1ZXHA 3AECB 3MJ5A 3OG5A 3H6NA 1FMAD 1NEKB 3A1QA 4W9CA 5C2TB 4DDGD 3QWZB 2A5UA 4MSQB 2KWVB 2D5GA 4BKSD 2MP2A 3ETRA 2KFJA 4RCOA 1TS5A 4HRSA 2L7RA 1KH0A 2PVGC 4HPPA 4ZRKA 2YEPF 2G9HD 3R7QA 1MG4A 3OJ3A 2QCZA 4O1NA 2W82A 5AEKB 4BKTA 1JCKB 4WJNA 1YN4A 2JU6X 3ENEA 2WXOA 3MC0B 5DPTA 2EELA 2AL3A 2BYFA 2W54A 1GC7A 3A9KA 3PS6A 3OJ4B 4ZRQA 2FNJB 2KMMA 3L4PA 3UQBA 1RFKA 4KKIA 3AE2B 5JXVA 2GBRA 1FIQA 3AE3B 2KVRA 1E5WA 1E8YA 1WSPA 1FO4A 1EWCA 5G2NA 1L0YB 3DCGA 3H7SA 4FBJB 4NJ6A 5AZHA 3DVNV 2G3QB 2G4SA 2RPVA 1HTQA 4YSYB 2INPE 5HI1A 1I4XA 2WGSA 2CR5A 4UDUC 3T3OA 2A4ZA 1V2YA 1VLBA 1TKEA 1YX6B 5BYRA 4MEMA 4C4VA 1RYJA 2Y5PA 1FXIA 4OVUA 1KLUD 2KKCA 2XNAC 2L52A 1OTRB 4NJ7A 2VZKD 1E7VA 1WRIA 4FLHA 2V4LA 3AM9A 3ZDMC 1Y56A 2FIFA 3NRZA 3DBRB 1BT0A 1F2RI 4I6PA 3LYYA 4KV2A 3NS1A 3B9JA 4GGQA 4ZYSA 2IGGA 3A1QB 3HVDA 2N9XA 5KHQA 3S2AA 1YNTE 2MP2B 2D10A 2CU3A 4HPMB 1F77A 3CMMB 2GBJA 3I57A 3H1UA 2V3NA 4NQKE 2PEAA 3U4EG 3VUXA 1MPEA 2GBMA 1IGDA 3R8BA 5TR5A 4B9KA 2BKFA 2KAJA 1YIWA 3KUCB 3BK1A 3DVGY 2QDFA 3GOEA 2WNMA 1TY2A 4I6LB 4R3DA 3TEXA 1I4RA 3ML8A 2GMIC 1SE9A 1N6ZA 2WQYB 3MHZA 2WXHA 3PSEB 5IA7A 1E8ZA 2INNE 5T8IA 5FR3A 3Q8AA 4WQOB 1PYWD 2O6VA 3APDA 3WAMA 2J0MA 1XO3A 3QJZA 1C4AA 2LFIA 2JRIB 5IOIA 2ZPNA 2I1JA 1F52A 1WI0A 3MP9A 2L05A 2GLSA 3HM6X 3U7DA 4ZHOA 4EEWA 1FM0D 1FRRA 3P4RB 2OJWA 2L8JA 2DENB 3W5UB 4HCPB 1RFAA 3OWEB 1JQ4A 2TSSA 3RN9C 3ZRCA 4FJYA 3E56A 4M00A 1HZ6A 4MDKE 1G6JA 1SE2A 2WX1A 3IAM1 1C78A 1M4VA 2WXGA 4TUUA 4JGHB 3JW0X 2WHIA 3H7PA 1QOGA 1DOXA 4JL9A 5BYQA 2MSED 2JXTA 2OEDA 2KZRA 4C80A 2OHFA 2WP9B 1T0QC 1TGZB 1XEEA 1WM2A 3W2DA 3PPAA 3D32A 1LGRA 4HDOA 2IPKD 4WQMA 4RGMA 1LO5D 2IO1B 5DPRA 1K52A 4GOCA 2MHJA 3L0WB 5JZEB 3BVMA 1A70A 1IGCA 1E0ZA 1D5MC 1Y8RC 2IY0B 4A90A 4ZOHC 1TTNA 2LASA 1WX8A 1E7PB 1JMLA 2IZVB 3DBLB 3DHHC 2XEWA 3U2SC 2KQ7A 2E6XA 1J7CA 2KN4A 2KFKA 2JWZA 1OEYA 4RFBA 3T3NA 2ZJDA 2AYOB 1WZ3A 2O6VB 2JZZA 4WWNA 1E7UA 3AEGB 4G50A 1UF0A 5FK9C 1E90A 1IUEA 3AU5A 4ARIA 4C7YA 1SB3C 2BW2A 3Q8BA 1FEHA 2ZZPB 2JSVX 3HUIA 2LGDA 4MACA 3NY5A 2YEPB 4BAXA 4HK2A 1L6VA 2NBWB 2CU1A 2CKHB 3U52E 1YQ4B 2QMTA 4K7WA 3BVGA 4FN2A 1V1PB 3BINA 4HCNB 4HKZE 2FCQA 1SXTA 4NJCA 3AE4B 4ANXA 4HKQA 1BUIC 4DQOC 1TY0A 3BIID 3RNAC 3H7PB 5LNK1 1MHHE 3L54A 2PLPA 3PLUA 1OGWA 4DXAB 5C23A 2DYMA 1QOFA 3DBHB 2LMCA 3A4RA 2IBIB 2LJ5A 5EE9A 1V5TA 4D2KA 4IWPA 4ZHPA 4ZDVA 3VDZA 4OW0A 1OQYA 3R2TA 4W9GA 3P63A 2H88B 5D6JB 1WGHA 2ZW0A 4H2AA 3ZXVA 5GMVA 5IKCM 1WXQA 1GNUA 4NZLB 1AN8A 2AQ2B 3TEWA 2DNFA 2HJ1A 4MH0E 2HTHA 2YLMA 1XCTL 2WXRA 1I35A 1WR6E 2K1FA 3N1XC 2K6QA 1YJ1A 1C76A 1P7EA 4M0WA 3RPFC 2K5PA 1D5XC 2DZJA 4A6QA 1ZKHA 4US8A 1E8WA 3EHVA 3L10B 2MX2A 2LGXA 1OQQA 2N1VA 5BMHA 3DQVA 1YMHE 1WZ0A 3BZDB 1TS2A 1YQBA 1SIJA 2LXCA 2WWZA 3R2IA 2DYOA 1M94A 4W9IA 2EMTA 1ESFA 1QOBA 2W3SA 1NENB 2JPHA 3IHPC 1TBEA 2ZVOA 2MBOA 2FIDA 1E10A 1WJNA 2D2QA 1ACCA 3AH7A 1R4NI 4USAA 4MH8A 1RM6C 4LDTD 4AOFA 2KTFA 4REZA 1P1AA 2K8BA 4FXCA 4ZRPA 3H9DA 3AEAB 2O2VA 1J7BA 2BPSA 1Q5WB 2WU2B 3I9V1 2GOWA 5E6NA 2CJNA 2PE9A 4B0MA 2NTTA 1FNWA 2MEKA 4KIKB 3KYDD 4DXGA 3GE8C 3NHEB 2M0AA 1ET9A 2NVUI 4L2YA 3KQ4A 3I5JC 3RT3B 1TKGA 3B2FA 4GU2A 4GXBA 3TJPA 4RGTA 1WGDA 4TV3A 2QSDA 1WXSA 1C9FA 4WURA 4RGNA 4FHJA 3PLVA 2BYVE 2GB1A 2EKEC 4M8NA 4HVBA 1ROEA 1VCBA 3AEBB 2PW9A 2N9EB 4JWUC 3ZJVA 4XGAB 1K8RB 4DHJB 2QHOA 1J19A 4BOZB 2LGSA 2KX0A 2VH2A 3BYYB 2O6VD 2L76A 2FUG1 2V3SA 1DGJA 2M1MA 1WYWB 4AS1A 1L5PA 3MFGA 4A20A 1QF6A 4TSSA 5BYSA 3AU4A 3VUYA 2LZ6A 3V6CB 1GPXA 5TSSA 2JRHA 2BB6A 2FE8A 1KLGD 2BYTA 1WRDB 2JVCA 1FFVA 2QIEB 4PT5A 1MVKA 1L4ZB 1XCQL 2BS4B 5AUKA 2NR2A 3EGRA 2REXA 1IPGA 2KT7A 5LLIA 4IG7B 2C5LC 3VVWB 1WJ6A 3GZNB 2W3RA 2G45B 3PO0A 4TQ1A 3KYCD 3AB5A 1WFYA 5CHWA 2WDVB 2EMSA 2RR9A 3BK2A 4LNIA 3PZ7A 1C4CA 2N1WA 3I3TB 3PZ8A 3Q3NC 2ACZB 3OLMD 3DVGX 4IC7B 3NVYA 2KLCA 4RNAA 1R4MB 3NJTA 4A55A 1T5XD 4P1CC 3FKYA 3B0AA 3MJWA 5H8YE 1VR9A 3FILA 4DDID 2MBHA 4BKGA 1JALA 5FKAC 2L3ZA 1V49A 3L17A 4W9HA 2Q5WD 2LRUA 4RGOS 2N7JA 2N7EA 3C0RB 3CSFA 1MFWA 2QEJC 3TUOA 3CSTA 1FXAA 1FFUA 3QCAA 2IGHA 3N1YC 4US9A 1WMHA 3VTUA 3TIXA 1Z2MA 2DAJA 3V60A 4MM3B 1K51A 3P2BA 1V81A 4G0NB 3EUB2 2KC2A 1WGYA 2NTSA 2NCNA 2KJ6A 1GB4A 3GE3C 1MG8A 4NPNA 1WXAA 1WE6A 2WXPA 3KUZA 4XE0A 4EZJA 1GB1A 2IDYA 1CMXB 2LJIA 4KGTA 5HHDG 3DBSA 4K7SA 2JT4B 3RNEC 2VRRB 2BS3B 1ZP0B 2MBBB 3RNGC 3ECIA 2HJ8A 2BWFA 2LHDA 3W1YA 1KTKA 1TKYA 3WAPA 3ZLZA 1N5WA 2KDEB 1E9MA 3VFKA 4G11A 4W9KA 2RSUA 3WA0A 4B95A 3Q8EA 1J0GA 3A9KB 1QZEA 5AZFA 4C7ZA 4A9AA 1UZXB 1WE7A 3AE1B 3JVZX 5DCNA 1P0RA 2J52A 1L2NA 1AW7A 2M19A 4C56C 3VR8B 3TMPB 3RZWC 3ZJUA 2IO2B 3L08A 3QX1A 4BBNC 2FCMA 1Q0WB 4TKNA 2K6DB 2KHWB 2FUHB 5BMIA 1H4RA 1Z5SB 2WS3B 2KJHB 3DWGC 3PV1A 3RYTA 2QC8A 4DHJD 4XC2A 2AQ1B 1MHXA 4C4VB 3Q8FA 4EZLA 4HJGE 3RI7C 1U4AA 2KD0A 1UBIA 4LDTB 2G4DB 2K22A 2MW5A 1B1ZA 3RUIB 3AMZA 1SBBB 2KOXA 1FXTB 4QAYA 4MGZE 1YJJA 5E6JA 3ZVVA 3ZQ4A 1E8XA 2FCSA 1WR1A 2LHEA 1UH6A 3NVZA 2K9XA 2WU5B 2PTLA 1LQBA 2JWUA 2N9LA 3Q8CA 1F0ZA 2DAFA 2MA9B 3PRMB 4ZRIA 2DLBA 4A8XC 2FAZA 3EECA 4HDQA 1QQRA 2KDFB 2RD0A 3TL5A 4LNFA 4DK5A 2V3PA 4CQNA 1LM8B 2BQQA 2LGYA 2PKOA 4N59A 1WGGA 4IM2A 3ZO5B 3WAOA 1ZE3D 4L1BA 3U30A 2M4NA 2DZIA 2UU7A 4DHZB 5J17A 2K8HA 4MSMB 1BXTA 1R7SA 1WXMA 2IYDB 3NOBA 2PPHA 4P1BC 1VZ7A 3QC8B 1FNUA 3UQAA 3VXWA 2KWUB 2IY1B 2KX3A 1ZOYB 3W5VB 2Y5BB 5HKHA 2WLBA 1K53A 1D6EC 2LXAA 4YT0B 2L0TA 3PHXB 1I4PA 3SFDB 3ZJTA 1T3QA 3UIPB 1UBQA 5C1ZA 1WH3A 3W1SC 1FCLA 1IP9A 1FRDA 4W9DA 3ZNZB 4FJZA 1VDVA 3KVFB 1RWSA 1N60A 1JWSD 2ZCCA 3Q3OC 2Z0DB 4NNJB 2WYQA 2J4XA 4EOYA 3SHQA 4GIVA 5BO4B 3DDCB 4YTPB 3APFA 1F2RC 4OVVA 1JW9D 4TMAB 1SE3A 2MJ3A 4ICVA 4DWFA 4IM3A 4JIOU 2UWQA 2N7DA 2NBVB 5HFYA 1V86A 3LDZE 3B2GA 3BY4B 3NS8A 3QK0A 1KOTA 4ICUA 4AQ7A 2PMVA 3IG3A 1CQVA 4WAAA 3ZTCA 4KGRA 1V6EA 1XXGA 3NVWA 3MC9A 2I38A 2XK5A 3MTNB 3B08A 3VQIA 1FPYA 2MCNB 2MQJA 3IFWB 1VZ6A 3PT2B 4KSLC 4P6VF 2M17A 3RMKC 3C19A 4ANVA 3IAS1 3KWLA 3DOWA 3M3JA 3L13A 1E6EB 3AEFB 2YVCA 2ZNVB 1HXYD 1F1HA 3RD2A 3AE7B 3P4QB 3HHMA 5D94A 4XYCA 2XBBC 2WXIA 2JUOA 3VUWA 2ASQA 2BGFA 3VHTC 4HROA 1TZOA 1WM3A 2K3UA 2KDIA 2KFKB 3VH3B 4F8CB 3V61A 1N5XA 4F7ZA 3IVFA 5DPWA 2R61A 1P9DU 3SDLC 1NI3A 2KK8A 2WXNA 2LGIA 2QILA 4J3OD 1YQ3B 2OOBB 2KVZA 3ZTDA 4J6IA 3BYTB 3RCZA 1PUTA 4WJPA 4W9JA 2KO3A 5DPSA 2ZNVC 2KWCA 1B9RA 2IJ0A 4EUTA 5JHBA 1JWMD 4DBGA 3QHTA 4L23A 2HE7A 1K50A 1AWDA 3ZUNA 4II3B 2G1EA 3U7ZA 2H89B 1UGJA 4ACFA 1OQRA 5LXHA 4B0EA 4ZRJA 1TJEA 5IN7A 4N6EB 2IO3B 4AJWA 5CHFA 2MBQA 3TCAA 4JE3B 4MGKE 1NI2A 4KKJA 3A4SC 3SU8X 4EFOA 2LRWA 2KANA 1D3ZA 5H92C 5CTRC 5L95C 3QARA 1TZ1A 4JQWC 3N20C 3TEZA 5I4DA 4P16A 2Z59B 4YL8A 3ZRFA 3LB8C 3SD5A 3Q14C 2D3AA 5EE1A 1GUAB 3X23A 2BBCA 1X1MA 5C3JB 2DZKA 3V6EB 2ZVNA 4DHZE 1ZXIA 2K25A
chains in the Genus database with same CATH topology
3O13A 2GI9A 3W5UB 2QEJC 2JZPA 3TUOA 1ZUD2 3IT4B 4WAFA 3OWEB 1JQ4A 2PVOD 1FXAA 5EE3A 2TSSA 1FFUA 2WXMA 2IGHA 3E56A 1HZ6A 4US9A 1J7AA 1SE2A 3URYA 1GAQB 3FC4A 1K51A 4MM3B 4LLGM 1EU3A 2CJOA 1WGKA 1EU4A 1JRPA 3IAM1 1VZ8A 1C78A 3EUB2 3FAHA 2NTSA 4MT5A 1HZ5A 1GB4A 1M4VA 2WXGA 3W9CB 1ZDXA 1NYRA 3CIRB 1TS3A 1L6UA 1QOGA 1DOXA 2KACA 3NVVA 1T6BX 5BYQA 3AN1A 1I4GA 2WXPA 2J42A 2JXTA 2OEDA 4C80A 1EWYC 4XE0A 2OHFA 1CJEA 2JYEA 1V8CA 2WP9B 2J53A 3DWMA 1GB1A 2IDYA 3ZGZA 4KGTA 2LJIA 5HHDG 1XEEA 1IBXA 4NAMA 3W2DA 1L0XB 2IPKD 3AE6B 1KFYB 4WQMA 2ONQA 4RGMA 1LO5D 2I2YA 3LXFA 4N58A 2BS3B 1N61A 3GP7A 1ZP0B 2HDEA 1K52A 2RMMA 1V97A 2GRIA 2LEKA 4KGSA 1XLPA 2LHDA 1ZDVA 2DBYA 1KTKA 1TKYA 3BVMA 3NUHB 3VRBB 1N5WA 1A70A 1IGCA 2RDHA 1PDXA 4RF1A 1E0ZA 1YN3A 1D5MC 1E9MA 1UUPA 4A90A 4ZOHC 4DXFA 1FCCC 4RH6A 1E7PB 4OVZA 1JMLA 3GB1A 4ARCA 1I7HA 3U2SC 2EKIA 3AEEB 2E6XA 2KWDA 5D7GA 3P4PB 2VZKB 1J7CA 2JQRB 5EE0A 2KN4A 1WWTA 3N9YC 2MJEA 3Q8EA 4RFBA 4C7ZA 3T3NA 4ITKA 4A9AA 1V1OA 2WXFA 4YTNB 3AE1B 2K0PA 1JWUD 4IOIE 3AEGB 2KQ4X 2J52A 5FK9C 2DWQA 1D4BA 1IUEA 4ARIA 4C7YA 3C8YA 5HG2A 1AW7A 1QOAA 2Y5CA 1SB3C 2RDGA 2M19A 2BW2A 4C56C 1ENFA 3P4SB 3Q8BA 1FEHA 3VR8B 4TQ0A 2JSVX 3HUIA 4RF0A 4MACA 4YXDB 2HTME 1XLOA 2AX5A 2YEPB 3AE9B 3ZJUA 2E3TA 1STEA 1L6VA 1SEBD 3U52E 1YQ4B 2QMTA 3SR6A 2L1AA 3AE8B 3BVGA 3EA6A 1V1PB 1XF5L 3V05A 5BMIA 1DOYA 2WS3B 4LTUA 1DYQA 3DWGC 4HEA1 4HKZE 1YN5A 3GS2A 3SEBA 4IDIA 1SXTA 4NJCA 1JWBD 2AQ1B 3AE4B 4XWWA 4HKQA 1MHXA 1NYQA 1VJKA 2BS2B 3TSSA 1BUIC 3Q8FA 2MJDA 4HJGE 4GDLB 4DQOC 1TY0A 1P7FA 3BIID 2L32A 5LNK1 2K22A 1B1ZA 1TS4A 1MHHE 1QKZA 3AMZA 1PGBA 1SBBB 1I4QA 1XLQA 2PLPA 1YJJA 2DYMA 2WDQB 1QOFA 1PGAA 2LUMA 1DOIA 5E6JA 2LMCA 3ZQ4A 4JPSA 5EE9A 4D2KA 4ZHPA 3V3XA 1IBXB 2LHEA 1SE4A 3NVZA 2K9XA 2WU5B 1AYFA 3IXSA 4OW0A 1EM7A 3R2TA 3ABVB 2PTLA 2H88B 3P63A 2AQ3B 2JWUA 2L83A 2N9LA 2SAKA 1L4DB 2ZW0A 3CWIA 3Q8CA 5AUIA 4H2AA 1F0ZA 2WXKA 1KF6B 4OHJA 2WDRB 2DLBA 1WXQA 2V4IB 1SSNA 1WYGA 4OZBA 4A8XC 4YTMB 4NZLB 1SF0A 1AN8A 2AQ2B 4Q2JA 3TEWA 4XDCA 1C77A 1QQRA 1HQRD 1GOZA 3BVZA 1ZPSA 4OZCA 2WXLA 1XCTL 2V3PA 2WXRA 4CQNA 4WH4A 2PKOA 4N59A 1YJIA 2NMQA 1C76A 1P7EA 1ZE3D 2ON8A 4M0WA 3WCQA 4L1BA 3RPFC 1L0VB 2K5PA 1D5XC 2M56B 4JWSC 4A6QA 3H8HA 2BTEA 1C4PA 4US8A 1BXTA 2BB5A 1R7SA 3BWUD 5BMGA 4WWMA 1OQQA 2Y3AA 5BMHA 4WIPA 4YSXB 1VZ7A 1FNUA 1YMHE 1ZXHA 3ZYYX 3AECB 1FNVA 3MJ5A 4XDDA 1UWXA 1ZOYB 3BZDB 3W5VB 2WLBA 1K53A 1D6EC 1TS2A 1SIJA 3R2IA 4YT0B 1FMAD 1NEKB 2DYOA 5C2TB 1ESFA 1I4PA 3SFDB 1QOBA 2W3SA 3ZJTA 1NENB 1T3QA 3E9SA 3FILB 4XWTA 2D5GA 3ETRA 5G5GA 1FCLA 4RCOA 1TS5A 1E10A 4HRSA 1FRDA 1ACCA 3Q69A 3AH7A 3UI3A 1TYGB 3W1SA 1SJHD 1KH0A 4USAA 2PVGC 1VDVA 2YEPF 1RM6C 2MH7A 2G9HD 4MH8A 1RWSA 1N60A 2QJLA 1JWSD 1UNSA 4OZAA 2J4XA 4O1NA 2W82A 4REZA 1JCKB 1JROA 1YN4A 2JU6X 1VRAB 1NVID 2WXOA 3MC0B 4YTPB 4FXCA 2EELA 4ZRPA 3AEAB 3KLSX 1F2RC 1JW9D 2BT6A 2Z8LA 2W54A 3HVZA 4TMAB 1J7BA 1SE3A 2MJ3A 2WU2B 4ZRQA 3I9V1 5D3DA 2KMMA 1I4HA 1UWMA 4KX6B 4YWGG 3L4PA 2JX5A 3VR9B 2CJNA 5HFYA 1RFKA 1N62A 4KKIA 4B0MA 3HRDD 2NTTA 4EE2A 1FNWA 1D5ZC 2MEKA 3AE2B 5JXVA 3B2GA 1CK1A 4DXGA 4AQ7A 4LK0M 3KWVA 2M0AA 2PMVA 1ET9A 1CQVA 1HEZE 3AE5B 4L2YA 1FIQA 3KQ4A 4KGRA 3IT6B 3AE3B 1TKGA 1XXGA 3NVWA 1WSPA 1FO4A 1EWCA 1L0YB 2N0SB 2I38A 3B2FA 2ICIA 3AEDB 2RPVA 4RGTA 2N9KA 3VQIA 2QSDA 4YSYB 1V1PA 2INPE 1C9FA 1VZ6A 4WURA 2IGDA 5HI1A 1I4XA 4RGNA 4P6VF 1CZPA 4UDUC 3T3OA 4IKGA 5GXGB 1VLBA 2GB1A 1TKEA 5BYRA 2V0GA 1ROEA 3IAS1 3KWLA 1Q10A 1RYJA 3AEBB 2PW9A 2Y5PA 1FXIA 4JWUC 1KLUD 3ZJVA 1E6EB 2XNAC 2L52A 2ZW1A 1KRHA 3AEFB 1HXYD 2VZKD 1WRIA 4GDKB 3AE7B 3P4QB 3AM9A 3BYYB 1QLBB 1Y56A 2FUG1 2FBWB 2WXIA 1DGJA 2SEBD 3NRZA 4HROA 1TZOA 2K3UA 4AS1A 1F2RI 1L5PA 1N5XA 1SJED 3MFGA 2R61A 3LYYA 1BMLC 1QF6A 3NS1A 2WXQA 4TSSA 3B9JA 5BYSA 1NI3A 4ZYSA 2IGGA 2WXNA 2B76B 3HVDA 2LGIA 2QILA 4J3OD 1QILA 1YQ3B 1GPXA 1C79A 5TSSA 1YNTE 2KDMA 1MI0A 2BB6A 2FE8A 1KLGD 4GLSC 2BYTA 1FFVA 1JWAD 2QIEB 4PT5A 3BYTB 2CU3A 1MVKA 1PUTA 1L4ZB 2XN9C 1XCQL 2BS4B 3J9CA 5AUKA 1FD6A 1F77A 1B9RA 2W55A 2IJ0A 3EGRA 4YSZB 3I57A 3P1MA 1JWMD 2V3NA 3U4EG 1MPEA 2W3RA 4L23A 1IGDA 3PO0A 1K50A 4TQ1A 3R8BA 1N63A 1AWDA 4JX1C 2G1EA 3U7ZA 3AB5A 2KAJA 3NZ3A 2H89B 3P42A 1UGJA 1OQRA 3RFZB 1ET6A 2WDVB 3BK1A 3VRAB 5MPOA 4B0EA 1TJEA 2WNMA 1TY2A 4N6EB 4R3DA 3TEXA 1XLNA 3BK2A 2WXJA 1I4RA 4JE3B 3PZ7A 1C4CA 3MHZA 2WQYB 4KKJA 3PZ8A 2WXHA 2PIAA 5G5HA 2ACZB 3NVYA 5H92C 2INNE 3AV8A 4RNAA 5T8IA 5FR3A 3Q8AA 4A55A 1PYWD 1T5XD 3TEZA 5I4DA 4P16A 5H8YE 1XO3A 1C4AA 1PFDA 2LFIA 4NAWB 1QT9A 1VR9A 5D3IB 3FILA 1HA5A 3LB8C 3SFEB 2X38A 1PGXA 5EE1A 1OFFA 1JALA 5FKAC 3MP9A 2BBCA 4ZHOA 2Q5WD 5C3JB 1FM0D 4RGOS 2N7JA 2JYTA 1FRRA 3TEYA 1ZXIA 3P4RB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEF B;  4WWM A;  1OQQ A;  3P4S B;  3W5U B;  1WRI A;  3VR8 B;  3HUI A;  3AE7 B;  1ZUD 2;  3P4Q B;  4YSX B;  3AM9 A;  1JQ4 A;  4YXD B;  2HTM E;  1XLO A;  2AX5 A;  3AE9 B;  2PVO D;  2E3T A;  1FXA A;  5EE3 A;  3ZYY X;  3AEC B;  1L6V A;  1FFU A;  1QLB B;  2FBW B;  1YQ4 B;  1ZOY B;  3SR6 A;  1DGJ A;  3W5V B;  2WLB A;  1J7A A;  3NRZ A;  4HRO A;  4US9 A;  3AE8 B;  1SIJ A;  1GAQ B;  3FC4 A;  4YT0 B;  1FMA D;  1NEK B;  1L5P A;  2CJO A;  5C2T B;  1WGK A;  1N5X A;  1QOB A;  1JRP A;  2W3S A;  3SFD B;  1DOY A;  2WS3 B;  1NEN B;  4LTU A;  1T3Q A;  3EUB 2;  3DWG C;  1QF6 A;  3NS1 A;  3B9J A;  3ETR A;  1NI3 A;  3FAH A;  5G5G A;  2B76 B;  4IDI A;  3W9C B;  1YQ3 B;  1E10 A;  4HRS A;  1JWB D;  1FRD A;  1GPX A;  1NYR A;  3AE4 B;  3CIR B;  1L6U A;  1NYQ A;  1VJK A;  1QOG A;  2BS2 B;  1TYG B;  3AH7 A;  1DOX A;  2MJD A;  1FFV A;  1JWA D;  2PVG C;  2QIE B;  3NVV A;  4USA A;  1VDV A;  3AN1 A;  1RM6 C;  1PUT A;  2CU3 A;  2MH7 A;  1RWS A;  1N60 A;  2QJL A;  2BS4 B;  5AUK A;  3BII D;  4C80 A;  1B9R A;  2K22 A;  1EWY C;  2W55 A;  4YSZ B;  2OHF A;  2M19 A;  1CJE A;  2WP9 B;  1V8C A;  3AMZ A;  3P1M A;  3DWM A;  1JRO A;  1NVI D;  1XLQ A;  4YTP B;  4FXC A;  3AEA B;  2W3R A;  1YJJ A;  1JW9 D;  2BT6 A;  1QOF A;  2WDQ B;  3PO0 A;  1DOI A;  2W54 A;  3HVZ A;  1J7B A;  1N63 A;  1AWD A;  2MJ3 A;  3AE6 B;  2WU2 B;  4JX1 C;  2G1E A;  5EE9 A;  1KFY B;  4ZHP A;  3AB5 A;  2KAJ A;  4WQM A;  2KMM A;  2H89 B;  1UWM A;  4KX6 B;  3L4P A;  1OQR A;  2K9X A;  2WU5 B;  1AYF A;  3LXF A;  2JX5 A;  2WDV B;  2CJN A;  2BS3 B;  4N58 A;  1N61 A;  1RFK A;  1N62 A;  3ABV B;  3VRA B;  3VR9 B;  3HRD D;  1ZP0 B;  1TJE A;  2H88 B;  3P63 A;  3AE2 B;  1V97 A;  3B2G A;  2LEK A;  4N6E B;  1XLP A;  3NVZ A;  2L83 A;  5AUI A;  1XLN A;  3CWI A;  2DBY A;  1TKY A;  1F0Z A;  1KF6 B;  1N5W A;  3VRB B;  1A70 A;  2WDR B;  1PDX A;  3AE5 B;  1FIQ A;  1E0Z A;  2WQY B;  1E9M A;  3AE3 B;  1WXQ A;  5G5H A;  2PIA A;  1WYG A;  2ACZ B;  4ZOH C;  1TKG A;  4YTM B;  1SF0 A;  3NVY A;  3NVW A;  5H92 C;  1E7P B;  1FO4 A;  2N0S B;  3B2F A;  1I7H A;  3AV8 A;  3AED B;  2EKI A;  3AEE B;  3P4P B;  1J7C A;  2JQR B;  5EE0 A;  1WWT A;  4YSY B;  2MJE A;  2PKO A;  4N59 A;  5H8Y E;  4C7Z A;  4ITK A;  1YJI A;  1XO3 A;  4A9A A;  1PFD A;  4P6V F;  1CZP A;  1QT9 A;  4YTN B;  3AE1 B;  3LB8 C;  5GXG B;  3SFE B;  1VLB A;  5MPO A;  3WCQ A;  1TKE A;  5EE1 A;  1OFF A;  3RPF C;  1L0V B;  1JAL A;  2K5P A;  3AEG B;  2M56 B;  4JWS C;  1ROE A;  3KWL A;  4ZHO A;  1RYJ A;  2DWQ A;  2Q5W D;  3AEB B;  1IUE A;  1FM0 D;  4US8 A;  1FXI A;  1R7S A;  4JWU C;  4C7Y A;  5C3J B;  1QOA A;  2Y5C A;  1FRR A;  1SB3 C;  1E6E B;  1ZXI A;  3P4R B;  2L52 A;  1KRH A; 
#chains in the Genus database with same CATH topology
 2GI9 A;  1H8C A;  1ZUD 2;  3IT4 B;  1V9J A;  5EE3 A;  2WXM A;  4I6N B;  1J7A A;  4XZ4 A;  1GG3 A;  1GAQ B;  4RM8 A;  2R2Q A;  4LLG M;  1EU3 A;  1WGK A;  4HXD A;  4AWJ A;  2L0F A;  4M0W B;  3FAH A;  1ISN A;  4MT5 A;  3ZNG C;  3ZNH B;  1NYR A;  3PHW B;  1TS3 A;  1L6U A;  3LJ3 A;  4F1S A;  3NVV A;  1I4G A;  5CX3 A;  2J42 A;  3ZW3 A;  4IWO A;  5JHA A;  3PZD A;  2JYE A;  3DHG C;  1V8C A;  3DWM A;  3JSV A;  3A33 B;  1NDD A;  2BKR B;  4W9F A;  4NAM A;  1A5R A;  1L0X B;  2LUE A;  1JRU A;  4IUM B;  1Q1O A;  4LNN A;  2ONQ A;  3LXF A;  4N58 A;  1I42 A;  1T0R C;  4E71 A;  4ASW C;  3PRP B;  3GP7 A;  4PS8 A;  2KC1 A;  4ANU A;  4C00 A;  1V97 A;  3WIM A;  2LEK A;  2LVP A;  4IW0 A;  4KZC A;  4BVU C;  2RDH A;  4RF1 A;  1YN3 A;  4BFR A;  4ZYN A;  1UUP A;  4DXF A;  1FCC C;  4RH6 A;  4OVZ A;  4ARC A;  2JXX A;  3ALB A;  3AEE B;  5D7G A;  2O2V B;  1L7Y A;  3P4P B;  3N9Y C;  2MJE A;  1V1O A;  2WXF A;  4YTN B;  2K0P A;  2GBN A;  4MJS A;  3N30 A;  3O65 B;  3PTF C;  2KQ4 X;  3OAW A;  3RZF A;  2NBU A;  4B6W A;  1D4B A;  5IP4 D;  3C8Y A;  1QOA A;  4K1R B;  2RDG A;  4TQ0 A;  3Q3M C;  4RF0 A;  3PGE A;  3UF8 A;  3AE9 B;  1STE A;  1SEB D;  2L1A A;  2ZCB A;  2D11 A;  4P7I A;  1V5O A;  4LTU A;  4HEA 1;  2JF5 A;  4AJY B;  4IDI A;  1R4N B;  1XQQ A;  3KW5 B;  1JWB D;  4XWW A;  2WDT B;  1VJK A;  2BS2 B;  3TSS A;  4X57 B;  2PJH A;  2MJD A;  3N3K B;  1P7F A;  2D3B A;  2L32 A;  4GN1 A;  2J0J A;  2K39 A;  1TS4 A;  1PGB A;  1I4Q A;  2RGF A;  1WJU A;  1TIF A;  3AXC A;  1EF1 A;  3MC8 A;  2WDQ B;  1PGA A;  2LUM A;  3JSV B;  1GJZ A;  5EDS A;  2KXJ A;  4M8M A;  2ZPY A;  3ZDT A;  1KLV A;  3V3X A;  5LXI B;  4LNO A;  3K9O B;  1AYF A;  3IXS A;  1IYF A;  1EM7 A;  4K3B A;  4FUL A;  2L83 A;  1L4D B;  3CWI A;  4II2 B;  2WXK A;  2KMC A;  2WDR B;  3TBL D;  1T0Y A;  3DVN U;  3EFC A;  1SSN A;  2KYW A;  4YTM B;  1SF0 A;  4XDC A;  1HQR D;  3BVZ A;  1NBF C;  3DBL I;  3A9J A;  2WXL A;  1EF5 A;  3HM3 A;  3QAQ A;  1P98 A;  4E3C A;  1YOV B;  4MEL A;  2M8S A;  3UGB B;  1C1Y B;  2ON8 A;  1L0V B;  4JWS C;  3DHI C;  2BWE S;  1WGR A;  4AP4 C;  2BTE A;  2KJR A;  4GDK A;  4MJS B;  3BWU D;  4PYU A;  2BF8 B;  5BMG A;  4ANW A;  4WWM A;  1S1Q B;  3T8M A;  2VH1 A;  2Y3A A;  4WIP A;  4YSX B;  2MLB A;  3ZYY X;  1FNV A;  4XDD A;  1UWX A;  3VTW A;  2C7N B;  1LFD A;  5AZG A;  5IO9 A;  3PRZ A;  1UEL A;  3QA8 A;  3E9S A;  3FIL B;  4XWT A;  3DPD A;  4RM9 A;  2CHZ A;  4WJQ A;  5G5G A;  3QQ8 B;  1WJ4 A;  2V1Y A;  2MRP A;  3I63 C;  2IND C;  3EFU A;  3KH0 A;  4E74 A;  3Q69 A;  3UI3 A;  1TYG B;  3W1S A;  1SJH D;  1F9J A;  2KTR A;  2MH7 A;  3PRE A;  2QJL A;  4EZK A;  1UNS A;  2KQS A;  4LJO B;  3VTV A;  4OZA A;  1SGH A;  2KLG A;  1JRO A;  2C60 A;  3X0W A;  5G55 A;  1VRA B;  1NVI D;  3KLS X;  2BT6 A;  1WMH B;  2Z8L A;  1P3Q U;  3HVZ A;  3R7R A;  1GC6 A;  3DBH I;  5D3D A;  1I4H A;  1UWM A;  4KX6 B;  2FCN A;  2R2O A;  4YWG G;  2JX5 A;  3VR9 B;  1N62 A;  3HRD D;  4EE2 A;  1D5Z C;  5J18 A;  1CK1 A;  3T9L A;  2HD5 B;  2BVC A;  4LK0 M;  3KWV A;  1LXD A;  4IWQ A;  1HEZ E;  3AE5 B;  3IT6 B;  1OEY J;  3NG0 A;  2N0S B;  2C7M B;  2ICI A;  3N32 A;  1SIF A;  3AED B;  2N9K A;  4NAW A;  4IM0 A;  3ZNI D;  1V1P A;  1WF9 A;  3R66 C;  2IGD A;  1CZP A;  3A9J B;  3RNC C;  4IKG A;  4S17 A;  5GXG B;  1AAR A;  2V0G A;  4BKS A;  4FJV B;  1S3S G;  2W9N A;  1Q10 A;  2CHX A;  2ZW1 A;  1KRH A;  2K8C A;  4GDK B;  2CHW A;  2UYZ B;  2NS5 A;  1QLB B;  2FBW B;  2BYE A;  2MBE A;  2SEB D;  1XD3 B;  3Q3F A;  2V9H A;  3RNB C;  2DYB A;  3UIO B;  3AI5 A;  1SJE D;  1BML C;  2WXQ A;  4KVG B;  4XX5 A;  4WWP A;  3MHS D;  2B76 B;  1QIL A;  4M02 A;  1C79 A;  2MWS B;  2KDM A;  3AUL A;  1MI0 A;  4GLS C;  4MGY E;  3WAN A;  1JWA D;  2DHZ A;  2C7H A;  4PS3 A;  4HPL B;  2XN9 C;  3J9C A;  1FD6 A;  2W55 A;  4YSZ B;  2M0X A;  4URK A;  3P1M A;  2KTR B;  2RDB C;  3ZXR A;  3VAW A;  1N63 A;  3V62 A;  2DZM A;  4JX1 C;  1WXV A;  3NZ3 A;  3P42 A;  4GB9 A;  2N9P C;  1WY8 A;  3RFZ B;  1ET6 A;  1PQS A;  3VRA B;  5MPO A;  3Q3J A;  4KSK C;  1XLN A;  1T0S C;  3K9P B;  2LVO A;  2C9W B;  2WXJ A;  1KJT A;  4KDL B;  2D3C A;  2IO0 B;  5G5H A;  2PIA A;  3WAL A;  3Q2A C;  1YX5 B;  5KHO A;  2D07 B;  3AV8 A;  4FHK A;  4K7U A;  1HE8 A;  2KMA A;  3ZIM A;  1PFD A;  4NAW B;  1QT9 A;  5D3I B;  1HA5 A;  3SFE B;  2X38 A;  1PGX A;  2KN5 A;  1OFF A;  2J7Q B;  1UGM A;  2AEH A;  1RAX A;  4LJP B;  2OJR A;  4S0R A;  2JYT A;  2B3A A;  2ZEQ A;  3TEY A;  3O13 A;  2JZP A;  2N4F A;  4WAF A;  3RUL A;  2PVO D;  5FR6 A;  4HWI B;  4PYZ A;  1ZGU B;  5D2M B;  3R3M A;  3ML9 A;  2LWP A;  2AL6 A;  3URY A;  1RLF A;  3FC4 A;  3KUD B;  2CJO A;  1EU4 A;  1JRP A;  2JY6 A;  1VZ8 A;  4N9F 4;  4NY0 A;  1HZ5 A;  4GDL A;  3W9C B;  4KIK A;  1ZDX A;  3CIR B;  3RNF C;  4A3O A;  4GSW A;  2NPT A;  2KAC A;  1T6B X;  3AN1 A;  3QIJ A;  4CO7 A;  1HTO A;  1EWY C;  1CJE A;  2KDB A;  2J53 A;  3ZGZ A;  3N1Z C;  4KZ0 A;  4MGI E;  1V80 A;  1IBX A;  3ONS A;  3CF6 E;  5L83 A;  3GZN I;  3M63 B;  3AE6 B;  2KNB A;  1KFY B;  4NQL B;  2Z0E B;  2I2Y A;  1N61 A;  2HDE A;  2RMM A;  2GRI A;  4KGS A;  1XLP A;  1ZDV A;  2DBY A;  2DX5 B;  3NUH B;  4K81 A;  3VRB B;  1PDX A;  4FAD A;  3JYU A;  3HIZ A;  1EUV B;  4CHK A;  4JLC A;  3L16 A;  1RRB A;  3GB1 A;  4K3C A;  3PVL A;  4BBN F;  1I7H A;  2EKI A;  2KWD A;  2VZK B;  5EE0 A;  2JQR B;  1WWT A;  1R4M I;  2AWT A;  4ITK A;  3U8Z A;  3M95 A;  1JWU D;  4IOI E;  2PE6 B;  3UIN B;  3B1L X;  1XT9 B;  2L00 B;  2DWQ A;  4BOS C;  1J8C A;  3HK0 A;  5E6O A;  4EKU A;  5HG2 A;  2Y5C A;  4W9L A;  1ENF A;  3P4S B;  5CHV C;  4YXD B;  2HTM E;  1XLO A;  2AX5 A;  4GMV A;  4FA6 A;  2E3T A;  2LD9 A;  1WIA A;  2XK5 B;  3SR6 A;  3M62 B;  4BZA A;  3AE8 B;  3EA6 A;  1XF5 L;  3V05 A;  1DOY A;  3ZKJ C;  1DYQ A;  2LI5 A;  3NZU A;  1YN5 A;  3GS2 A;  4LNK A;  3SEB A;  1MJD A;  4LCD E;  1NYQ A;  4W9E A;  4KDI C;  2LVQ A;  4GDL B;  1YD8 U;  1WX7 A;  2D3G A;  4HJK A;  2NPT B;  1QKZ A;  3APC A;  4RMA A;  2WX0 A;  4PK1 A;  1VD2 A;  1XLQ A;  5J2R A;  4CYE A;  3DBR I;  2CS4 A;  1DOI A;  2INC C;  3IBE A;  1TT5 B;  1UD7 A;  4JPS A;  3Q6B A;  4WWO A;  1IBX B;  1SE4 A;  3EC8 A;  1ZW7 A;  1C3T A;  3ABV B;  2I1K A;  2JZ3 B;  2X8X X;  2AQ3 B;  3VH4 B;  2SAK A;  5AUI A;  1EO6 A;  1KF6 B;  4OHJ A;  2V4I B;  1WYG A;  4OZB A;  4Q2J A;  1C77 A;  1GOZ A;  1ZPS A;  5IAA C;  4OZC A;  4AUQ C;  1WX9 A;  4A3P A;  4WH4 A;  2RPQ A;  4M01 A;  4MM3 A;  5JH5 C;  3NZS A;  2GBK A;  1YJI A;  2NMQ A;  3WCQ A;  1KM7 A;  2M56 B;  3H8H A;  1C4P A;  5E6P A;  2BB5 A;  4G3X B;  4HLE A;  4WJO A;  2J0K A;  4PS7 A;  1ZXH A;  3AEC B;  3MJ5 A;  3OG5 A;  3H6N A;  1FMA D;  1NEK B;  3A1Q A;  4W9C A;  5C2T B;  4DDG D;  3QWZ B;  2A5U A;  4MSQ B;  2KWV B;  2D5G A;  4BKS D;  2MP2 A;  3ETR A;  2KFJ A;  4RCO A;  1TS5 A;  4HRS A;  2L7R A;  1KH0 A;  2PVG C;  4HPP A;  4ZRK A;  2YEP F;  2G9H D;  3R7Q A;  1MG4 A;  3OJ3 A;  2QCZ A;  4O1N A;  2W82 A;  5AEK B;  4BKT A;  1JCK B;  4WJN A;  1YN4 A;  2JU6 X;  3ENE A;  2WXO A;  3MC0 B;  5DPT A;  2EEL A;  2AL3 A;  2BYF A;  2W54 A;  1GC7 A;  3A9K A;  3PS6 A;  3OJ4 B;  4ZRQ A;  2FNJ B;  2KMM A;  3L4P A;  3UQB A;  1RFK A;  4KKI A;  3AE2 B;  5JXV A;  2GBR A;  1FIQ A;  3AE3 B;  2KVR A;  1E5W A;  1E8Y A;  1WSP A;  1FO4 A;  1EWC A;  5G2N A;  1L0Y B;  3DCG A;  3H7S A;  4FBJ B;  4NJ6 A;  5AZH A;  3DVN V;  2G3Q B;  2G4S A;  2RPV A;  1HTQ A;  4YSY B;  2INP E;  5HI1 A;  1I4X A;  2WGS A;  2CR5 A;  4UDU C;  3T3O A;  2A4Z A;  1V2Y A;  1VLB A;  1TKE A;  1YX6 B;  5BYR A;  4MEM A;  4C4V A;  1RYJ A;  2Y5P A;  1FXI A;  4OVU A;  1KLU D;  2KKC A;  2XNA C;  2L52 A;  1OTR B;  4NJ7 A;  2VZK D;  1E7V A;  1WRI A;  4FLH A;  2V4L A;  3AM9 A;  3ZDM C;  1Y56 A;  2FIF A;  3NRZ A;  3DBR B;  1BT0 A;  1F2R I;  4I6P A;  3LYY A;  4KV2 A;  3NS1 A;  3B9J A;  4GGQ A;  4ZYS A;  2IGG A;  3A1Q B;  3HVD A;  2N9X A;  5KHQ A;  3S2A A;  1YNT E;  2MP2 B;  2D10 A;  2CU3 A;  4HPM B;  1F77 A;  3CMM B;  2GBJ A;  3I57 A;  3H1U A;  2V3N A;  4NQK E;  2PEA A;  3U4E G;  3VUX A;  1MPE A;  2GBM A;  1IGD A;  3R8B A;  5TR5 A;  4B9K A;  2BKF A;  2KAJ A;  1YIW A;  3KUC B;  3BK1 A;  3DVG Y;  2QDF A;  3GOE A;  2WNM A;  1TY2 A;  4I6L B;  4R3D A;  3TEX A;  1I4R A;  3ML8 A;  2GMI C;  1SE9 A;  1N6Z A;  2WQY B;  3MHZ A;  2WXH A;  3PSE B;  5IA7 A;  1E8Z A;  2INN E;  5T8I A;  5FR3 A;  3Q8A A;  4WQO B;  1PYW D;  2O6V A;  3APD A;  3WAM A;  2J0M A;  1XO3 A;  3QJZ A;  1C4A A;  2LFI A;  2JRI B;  5IOI A;  2ZPN A;  2I1J A;  1F52 A;  1WI0 A;  3MP9 A;  2L05 A;  2GLS A;  3HM6 X;  3U7D A;  4ZHO A;  4EEW A;  1FM0 D;  1FRR A;  3P4R B;  2OJW A;  2L8J A;  2DEN B;  3W5U B;  4HCP B;  1RFA A;  3OWE B;  1JQ4 A;  2TSS A;  3RN9 C;  3ZRC A;  4FJY A;  3E56 A;  4M00 A;  1HZ6 A;  4MDK E;  1G6J A;  1SE2 A;  2WX1 A;  3IAM 1;  1C78 A;  1M4V A;  2WXG A;  4TUU A;  4JGH B;  3JW0 X;  2WHI A;  3H7P A;  1QOG A;  1DOX A;  4JL9 A;  5BYQ A;  2MSE D;  2JXT A;  2OED A;  2KZR A;  4C80 A;  2OHF A;  2WP9 B;  1T0Q C;  1TGZ B;  1XEE A;  1WM2 A;  3W2D A;  3PPA A;  3D32 A;  1LGR A;  4HDO A;  2IPK D;  4WQM A;  4RGM A;  1LO5 D;  2IO1 B;  5DPR A;  1K52 A;  4GOC A;  2MHJ A;  3L0W B;  5JZE B;  3BVM A;  1A70 A;  1IGC A;  1E0Z A;  1D5M C;  1Y8R C;  2IY0 B;  4A90 A;  4ZOH C;  1TTN A;  2LAS A;  1WX8 A;  1E7P B;  1JML A;  2IZV B;  3DBL B;  3DHH C;  2XEW A;  3U2S C;  2KQ7 A;  2E6X A;  1J7C A;  2KN4 A;  2KFK A;  2JWZ A;  1OEY A;  4RFB A;  3T3N A;  2ZJD A;  2AYO B;  1WZ3 A;  2O6V B;  2JZZ A;  4WWN A;  1E7U A;  3AEG B;  4G50 A;  1UF0 A;  5FK9 C;  1E90 A;  1IUE A;  3AU5 A;  4ARI A;  4C7Y A;  1SB3 C;  2BW2 A;  3Q8B A;  1FEH A;  2ZZP B;  2JSV X;  3HUI A;  2LGD A;  4MAC A;  3NY5 A;  2YEP B;  4BAX A;  4HK2 A;  1L6V A;  2NBW B;  2CU1 A;  2CKH B;  3U52 E;  1YQ4 B;  2QMT A;  4K7W A;  3BVG A;  4FN2 A;  1V1P B;  3BIN A;  4HCN B;  4HKZ E;  2FCQ A;  1SXT A;  4NJC A;  3AE4 B;  4ANX A;  4HKQ A;  1BUI C;  4DQO C;  1TY0 A;  3BII D;  3RNA C;  3H7P B;  5LNK 1;  1MHH E;  3L54 A;  2PLP A;  3PLU A;  1OGW A;  4DXA B;  5C23 A;  2DYM A;  1QOF A;  3DBH B;  2LMC A;  3A4R A;  2IBI B;  2LJ5 A;  5EE9 A;  1V5T A;  4D2K A;  4IWP A;  4ZHP A;  4ZDV A;  3VDZ A;  4OW0 A;  1OQY A;  3R2T A;  4W9G A;  3P63 A;  2H88 B;  5D6J B;  1WGH A;  2ZW0 A;  4H2A A;  3ZXV A;  5GMV A;  5IKC M;  1WXQ A;  1GNU A;  4NZL B;  1AN8 A;  2AQ2 B;  3TEW A;  2DNF A;  2HJ1 A;  4MH0 E;  2HTH A;  2YLM A;  1XCT L;  2WXR A;  1I35 A;  1WR6 E;  2K1F A;  3N1X C;  2K6Q A;  1YJ1 A;  1C76 A;  1P7E A;  4M0W A;  3RPF C;  2K5P A;  1D5X C;  2DZJ A;  4A6Q A;  1ZKH A;  4US8 A;  1E8W A;  3EHV A;  3L10 B;  2MX2 A;  2LGX A;  1OQQ A;  2N1V A;  5BMH A;  3DQV A;  1YMH E;  1WZ0 A;  3BZD B;  1TS2 A;  1YQB A;  1SIJ A;  2LXC A;  2WWZ A;  3R2I A;  2DYO A;  1M94 A;  4W9I A;  2EMT A;  1ESF A;  1QOB A;  2W3S A;  1NEN B;  2JPH A;  3IHP C;  1TBE A;  2ZVO A;  2MBO A;  2FID A;  1E10 A;  1WJN A;  2D2Q A;  1ACC A;  3AH7 A;  1R4N I;  4USA A;  4MH8 A;  1RM6 C;  4LDT D;  4AOF A;  2KTF A;  4REZ A;  1P1A A;  2K8B A;  4FXC A;  4ZRP A;  3H9D A;  3AEA B;  2O2V A;  1J7B A;  2BPS A;  1Q5W B;  2WU2 B;  3I9V 1;  2GOW A;  5E6N A;  2CJN A;  2PE9 A;  4B0M A;  2NTT A;  1FNW A;  2MEK A;  4KIK B;  3KYD D;  4DXG A;  3GE8 C;  3NHE B;  2M0A A;  1ET9 A;  2NVU I;  4L2Y A;  3KQ4 A;  3I5J C;  3RT3 B;  1TKG A;  3B2F A;  4GU2 A;  4GXB A;  3TJP A;  4RGT A;  1WGD A;  4TV3 A;  2QSD A;  1WXS A;  1C9F A;  4WUR A;  4RGN A;  4FHJ A;  3PLV A;  2BYV E;  2GB1 A;  2EKE C;  4M8N A;  4HVB A;  1ROE A;  1VCB A;  3AEB B;  2PW9 A;  2N9E B;  4JWU C;  3ZJV A;  4XGA B;  1K8R B;  4DHJ B;  2QHO A;  1J19 A;  4BOZ B;  2LGS A;  2KX0 A;  2VH2 A;  3BYY B;  2O6V D;  2L76 A;  2FUG 1;  2V3S A;  1DGJ A;  2M1M A;  1WYW B;  4AS1 A;  1L5P A;  3MFG A;  4A20 A;  1QF6 A;  4TSS A;  5BYS A;  3AU4 A;  3VUY A;  2LZ6 A;  3V6C B;  1GPX A;  5TSS A;  2JRH A;  2BB6 A;  2FE8 A;  1KLG D;  2BYT A;  1WRD B;  2JVC A;  1FFV A;  2QIE B;  4PT5 A;  1MVK A;  1L4Z B;  1XCQ L;  2BS4 B;  5AUK A;  2NR2 A;  3EGR A;  2REX A;  1IPG A;  2KT7 A;  5LLI A;  4IG7 B;  2C5L C;  3VVW B;  1WJ6 A;  3GZN B;  2W3R A;  2G45 B;  3PO0 A;  4TQ1 A;  3KYC D;  3AB5 A;  1WFY A;  5CHW A;  2WDV B;  2EMS A;  2RR9 A;  3BK2 A;  4LNI A;  3PZ7 A;  1C4C A;  2N1W A;  3I3T B;  3PZ8 A;  3Q3N C;  2ACZ B;  3OLM D;  3DVG X;  4IC7 B;  3NVY A;  2KLC A;  4RNA A;  1R4M B;  3NJT A;  4A55 A;  1T5X D;  4P1C C;  3FKY A;  3B0A A;  3MJW A;  5H8Y E;  1VR9 A;  3FIL A;  4DDI D;  2MBH A;  4BKG A;  1JAL A;  5FKA C;  2L3Z A;  1V49 A;  3L17 A;  4W9H A;  2Q5W D;  2LRU A;  4RGO S;  2N7J A;  2N7E A;  3C0R B;  3CSF A;  1MFW A;  2QEJ C;  3TUO A;  3CST A;  1FXA A;  1FFU A;  3QCA A;  2IGH A;  3N1Y C;  4US9 A;  1WMH A;  3VTU A;  3TIX A;  1Z2M A;  2DAJ A;  3V60 A;  4MM3 B;  1K51 A;  3P2B A;  1V81 A;  4G0N B;  3EUB 2;  2KC2 A;  1WGY A;  2NTS A;  2NCN A;  2KJ6 A;  1GB4 A;  3GE3 C;  1MG8 A;  4NPN A;  1WXA A;  1WE6 A;  2WXP A;  3KUZ A;  4XE0 A;  4EZJ A;  1GB1 A;  2IDY A;  1CMX B;  2LJI A;  4KGT A;  5HHD G;  3DBS A;  4K7S A;  2JT4 B;  3RNE C;  2VRR B;  2BS3 B;  1ZP0 B;  2MBB B;  3RNG C;  3ECI A;  2HJ8 A;  2BWF A;  2LHD A;  3W1Y A;  1KTK A;  1TKY A;  3WAP A;  3ZLZ A;  1N5W A;  2KDE B;  1E9M A;  3VFK A;  4G11 A;  4W9K A;  2RSU A;  3WA0 A;  4B95 A;  3Q8E A;  1J0G A;  3A9K B;  1QZE A;  5AZF A;  4C7Z A;  4A9A A;  1UZX B;  1WE7 A;  3AE1 B;  3JVZ X;  5DCN A;  1P0R A;  2J52 A;  1L2N A;  1AW7 A;  2M19 A;  4C56 C;  3VR8 B;  3TMP B;  3RZW C;  3ZJU A;  2IO2 B;  3L08 A;  3QX1 A;  4BBN C;  2FCM A;  1Q0W B;  4TKN A;  2K6D B;  2KHW B;  2FUH B;  5BMI A;  1H4R A;  1Z5S B;  2WS3 B;  2KJH B;  3DWG C;  3PV1 A;  3RYT A;  2QC8 A;  4DHJ D;  4XC2 A;  2AQ1 B;  1MHX A;  4C4V B;  3Q8F A;  4EZL A;  4HJG E;  3RI7 C;  1U4A A;  2KD0 A;  1UBI A;  4LDT B;  2G4D B;  2K22 A;  2MW5 A;  1B1Z A;  3RUI B;  3AMZ A;  1SBB B;  2KOX A;  1FXT B;  4QAY A;  4MGZ E;  1YJJ A;  5E6J A;  3ZVV A;  3ZQ4 A;  1E8X A;  2FCS A;  1WR1 A;  2LHE A;  1UH6 A;  3NVZ A;  2K9X A;  2WU5 B;  2PTL A;  1LQB A;  2JWU A;  2N9L A;  3Q8C A;  1F0Z A;  2DAF A;  2MA9 B;  3PRM B;  4ZRI A;  2DLB A;  4A8X C;  2FAZ A;  3EEC A;  4HDQ A;  1QQR A;  2KDF B;  2RD0 A;  3TL5 A;  4LNF A;  4DK5 A;  2V3P A;  4CQN A;  1LM8 B;  2BQQ A;  2LGY A;  2PKO A;  4N59 A;  1WGG A;  4IM2 A;  3ZO5 B;  3WAO A;  1ZE3 D;  4L1B A;  3U30 A;  2M4N A;  2DZI A;  2UU7 A;  4DHZ B;  5J17 A;  2K8H A;  4MSM B;  1BXT A;  1R7S A;  1WXM A;  2IYD B;  3NOB A;  2PPH A;  4P1B C;  1VZ7 A;  3QC8 B;  1FNU A;  3UQA A;  3VXW A;  2KWU B;  2IY1 B;  2KX3 A;  1ZOY B;  3W5V B;  2Y5B B;  5HKH A;  2WLB A;  1K53 A;  1D6E C;  2LXA A;  4YT0 B;  2L0T A;  3PHX B;  1I4P A;  3SFD B;  3ZJT A;  1T3Q A;  3UIP B;  1UBQ A;  5C1Z A;  1WH3 A;  3W1S C;  1FCL A;  1IP9 A;  1FRD A;  4W9D A;  3ZNZ B;  4FJZ A;  1VDV A;  3KVF B;  1RWS A;  1N60 A;  1JWS D;  2ZCC A;  3Q3O C;  2Z0D B;  4NNJ B;  2WYQ A;  2J4X A;  4EOY A;  3SHQ A;  4GIV A;  5BO4 B;  3DDC B;  4YTP B;  3APF A;  1F2R C;  4OVV A;  1JW9 D;  4TMA B;  1SE3 A;  2MJ3 A;  4ICV A;  4DWF A;  4IM3 A;  4JIO U;  2UWQ A;  2N7D A;  2NBV B;  5HFY A;  1V86 A;  3LDZ E;  3B2G A;  3BY4 B;  3NS8 A;  3QK0 A;  1KOT A;  4ICU A;  4AQ7 A;  2PMV A;  3IG3 A;  1CQV A;  4WAA A;  3ZTC A;  4KGR A;  1V6E A;  1XXG A;  3NVW A;  3MC9 A;  2I38 A;  2XK5 A;  3MTN B;  3B08 A;  3VQI A;  1FPY A;  2MCN B;  2MQJ A;  3IFW B;  1VZ6 A;  3PT2 B;  4KSL C;  4P6V F;  2M17 A;  3RMK C;  3C19 A;  4ANV A;  3IAS 1;  3KWL A;  3DOW A;  3M3J A;  3L13 A;  1E6E B;  3AEF B;  2YVC A;  2ZNV B;  1HXY D;  1F1H A;  3RD2 A;  3AE7 B;  3P4Q B;  3HHM A;  5D94 A;  4XYC A;  2XBB C;  2WXI A;  2JUO A;  3VUW A;  2ASQ A;  2BGF A;  3VHT C;  4HRO A;  1TZO A;  1WM3 A;  2K3U A;  2KDI A;  2KFK B;  3VH3 B;  4F8C B;  3V61 A;  1N5X A;  4F7Z A;  3IVF A;  5DPW A;  2R61 A;  1P9D U;  3SDL C;  1NI3 A;  2KK8 A;  2WXN A;  2LGI A;  2QIL A;  4J3O D;  1YQ3 B;  2OOB B;  2KVZ A;  3ZTD A;  4J6I A;  3BYT B;  3RCZ A;  1PUT A;  4WJP A;  4W9J A;  2KO3 A;  5DPS A;  2ZNV C;  2KWC A;  1B9R A;  2IJ0 A;  4EUT A;  5JHB A;  1JWM D;  4DBG A;  3QHT A;  4L23 A;  2HE7 A;  1K50 A;  1AWD A;  3ZUN A;  4II3 B;  2G1E A;  3U7Z A;  2H89 B;  1UGJ A;  4ACF A;  1OQR A;  5LXH A;  4B0E A;  4ZRJ A;  1TJE A;  5IN7 A;  4N6E B;  2IO3 B;  4AJW A;  5CHF A;  2MBQ A;  3TCA A;  4JE3 B;  4MGK E;  1NI2 A;  4KKJ A;  3A4S C;  3SU8 X;  4EFO A;  2LRW A;  2KAN A;  1D3Z A;  5H92 C;  5CTR C;  5L95 C;  3QAR A;  1TZ1 A;  4JQW C;  3N20 C;  3TEZ A;  5I4D A;  4P16 A;  2Z59 B;  4YL8 A;  3ZRF A;  3LB8 C;  3SD5 A;  3Q14 C;  2D3A A;  5EE1 A;  1GUA B;  3X23 A;  2BBC A;  1X1M A;  5C3J B;  2DZK A;  3V6E B;  2ZVN A;  4DHZ E;  1ZXI A;  2K25 A; 
#chains in the Genus database with same CATH homology
 3O13 A;  2GI9 A;  3W5U B;  2QEJ C;  2JZP A;  3TUO A;  1ZUD 2;  3IT4 B;  4WAF A;  3OWE B;  1JQ4 A;  2PVO D;  1FXA A;  5EE3 A;  2TSS A;  1FFU A;  2WXM A;  2IGH A;  3E56 A;  1HZ6 A;  4US9 A;  1J7A A;  1SE2 A;  3URY A;  1GAQ B;  3FC4 A;  1K51 A;  4MM3 B;  4LLG M;  1EU3 A;  2CJO A;  1WGK A;  1EU4 A;  1JRP A;  3IAM 1;  1VZ8 A;  1C78 A;  3EUB 2;  3FAH A;  2NTS A;  4MT5 A;  1HZ5 A;  1GB4 A;  1M4V A;  2WXG A;  3W9C B;  1ZDX A;  1NYR A;  3CIR B;  1TS3 A;  1L6U A;  1QOG A;  1DOX A;  2KAC A;  3NVV A;  1T6B X;  5BYQ A;  3AN1 A;  1I4G A;  2WXP A;  2J42 A;  2JXT A;  2OED A;  4C80 A;  1EWY C;  4XE0 A;  2OHF A;  1CJE A;  2JYE A;  1V8C A;  2WP9 B;  2J53 A;  3DWM A;  1GB1 A;  2IDY A;  3ZGZ A;  4KGT A;  2LJI A;  5HHD G;  1XEE A;  1IBX A;  4NAM A;  3W2D A;  1L0X B;  2IPK D;  3AE6 B;  1KFY B;  4WQM A;  2ONQ A;  4RGM A;  1LO5 D;  2I2Y A;  3LXF A;  4N58 A;  2BS3 B;  1N61 A;  3GP7 A;  1ZP0 B;  2HDE A;  1K52 A;  2RMM A;  1V97 A;  2GRI A;  2LEK A;  4KGS A;  1XLP A;  2LHD A;  1ZDV A;  2DBY A;  1KTK A;  1TKY A;  3BVM A;  3NUH B;  3VRB B;  1N5W A;  1A70 A;  1IGC A;  2RDH A;  1PDX A;  4RF1 A;  1E0Z A;  1YN3 A;  1D5M C;  1E9M A;  1UUP A;  4A90 A;  4ZOH C;  4DXF A;  1FCC C;  4RH6 A;  1E7P B;  4OVZ A;  1JML A;  3GB1 A;  4ARC A;  1I7H A;  3U2S C;  2EKI A;  3AEE B;  2E6X A;  2KWD A;  5D7G A;  3P4P B;  2VZK B;  1J7C A;  2JQR B;  5EE0 A;  2KN4 A;  1WWT A;  3N9Y C;  2MJE A;  3Q8E A;  4RFB A;  4C7Z A;  3T3N A;  4ITK A;  4A9A A;  1V1O A;  2WXF A;  4YTN B;  3AE1 B;  2K0P A;  1JWU D;  4IOI E;  3AEG B;  2KQ4 X;  2J52 A;  5FK9 C;  2DWQ A;  1D4B A;  1IUE A;  4ARI A;  4C7Y A;  3C8Y A;  5HG2 A;  1AW7 A;  1QOA A;  2Y5C A;  1SB3 C;  2RDG A;  2M19 A;  2BW2 A;  4C56 C;  1ENF A;  3P4S B;  3Q8B A;  1FEH A;  3VR8 B;  4TQ0 A;  2JSV X;  3HUI A;  4RF0 A;  4MAC A;  4YXD B;  2HTM E;  1XLO A;  2AX5 A;  2YEP B;  3AE9 B;  3ZJU A;  2E3T A;  1STE A;  1L6V A;  1SEB D;  3U52 E;  1YQ4 B;  2QMT A;  3SR6 A;  2L1A A;  3AE8 B;  3BVG A;  3EA6 A;  1V1P B;  1XF5 L;  3V05 A;  5BMI A;  1DOY A;  2WS3 B;  4LTU A;  1DYQ A;  3DWG C;  4HEA 1;  4HKZ E;  1YN5 A;  3GS2 A;  3SEB A;  4IDI A;  1SXT A;  4NJC A;  1JWB D;  2AQ1 B;  3AE4 B;  4XWW A;  4HKQ A;  1MHX A;  1NYQ A;  1VJK A;  2BS2 B;  3TSS A;  1BUI C;  3Q8F A;  2MJD A;  4HJG E;  4GDL B;  4DQO C;  1TY0 A;  1P7F A;  3BII D;  2L32 A;  5LNK 1;  2K22 A;  1B1Z A;  1TS4 A;  1MHH E;  1QKZ A;  3AMZ A;  1PGB A;  1SBB B;  1I4Q A;  1XLQ A;  2PLP A;  1YJJ A;  2DYM A;  2WDQ B;  1QOF A;  1PGA A;  2LUM A;  1DOI A;  5E6J A;  2LMC A;  3ZQ4 A;  4JPS A;  5EE9 A;  4D2K A;  4ZHP A;  3V3X A;  1IBX B;  2LHE A;  1SE4 A;  3NVZ A;  2K9X A;  2WU5 B;  1AYF A;  3IXS A;  4OW0 A;  1EM7 A;  3R2T A;  3ABV B;  2PTL A;  2H88 B;  3P63 A;  2AQ3 B;  2JWU A;  2L83 A;  2N9L A;  2SAK A;  1L4D B;  2ZW0 A;  3CWI A;  3Q8C A;  5AUI A;  4H2A A;  1F0Z A;  2WXK A;  1KF6 B;  4OHJ A;  2WDR B;  2DLB A;  1WXQ A;  2V4I B;  1SSN A;  1WYG A;  4OZB A;  4A8X C;  4YTM B;  4NZL B;  1SF0 A;  1AN8 A;  2AQ2 B;  4Q2J A;  3TEW A;  4XDC A;  1C77 A;  1QQR A;  1HQR D;  1GOZ A;  3BVZ A;  1ZPS A;  4OZC A;  2WXL A;  1XCT L;  2V3P A;  2WXR A;  4CQN A;  4WH4 A;  2PKO A;  4N59 A;  1YJI A;  2NMQ A;  1C76 A;  1P7E A;  1ZE3 D;  2ON8 A;  4M0W A;  3WCQ A;  4L1B A;  3RPF C;  1L0V B;  2K5P A;  1D5X C;  2M56 B;  4JWS C;  4A6Q A;  3H8H A;  2BTE A;  1C4P A;  4US8 A;  1BXT A;  2BB5 A;  1R7S A;  3BWU D;  5BMG A;  4WWM A;  1OQQ A;  2Y3A A;  5BMH A;  4WIP A;  4YSX B;  1VZ7 A;  1FNU A;  1YMH E;  1ZXH A;  3ZYY X;  3AEC B;  1FNV A;  3MJ5 A;  4XDD A;  1UWX A;  1ZOY B;  3BZD B;  3W5V B;  2WLB A;  1K53 A;  1D6E C;  1TS2 A;  1SIJ A;  3R2I A;  4YT0 B;  1FMA D;  1NEK B;  2DYO A;  5C2T B;  1ESF A;  1I4P A;  3SFD B;  1QOB A;  2W3S A;  3ZJT A;  1NEN B;  1T3Q A;  3E9S A;  3FIL B;  4XWT A;  2D5G A;  3ETR A;  5G5G A;  1FCL A;  4RCO A;  1TS5 A;  1E10 A;  4HRS A;  1FRD A;  1ACC A;  3Q69 A;  3AH7 A;  3UI3 A;  1TYG B;  3W1S A;  1SJH D;  1KH0 A;  4USA A;  2PVG C;  1VDV A;  2YEP F;  1RM6 C;  2MH7 A;  2G9H D;  4MH8 A;  1RWS A;  1N60 A;  2QJL A;  1JWS D;  1UNS A;  4OZA A;  2J4X A;  4O1N A;  2W82 A;  4REZ A;  1JCK B;  1JRO A;  1YN4 A;  2JU6 X;  1VRA B;  1NVI D;  2WXO A;  3MC0 B;  4YTP B;  4FXC A;  2EEL A;  4ZRP A;  3AEA B;  3KLS X;  1F2R C;  1JW9 D;  2BT6 A;  2Z8L A;  2W54 A;  3HVZ A;  4TMA B;  1J7B A;  1SE3 A;  2MJ3 A;  2WU2 B;  4ZRQ A;  3I9V 1;  5D3D A;  2KMM A;  1I4H A;  1UWM A;  4KX6 B;  4YWG G;  3L4P A;  2JX5 A;  3VR9 B;  2CJN A;  5HFY A;  1RFK A;  1N62 A;  4KKI A;  4B0M A;  3HRD D;  2NTT A;  4EE2 A;  1FNW A;  1D5Z C;  2MEK A;  3AE2 B;  5JXV A;  3B2G A;  1CK1 A;  4DXG A;  4AQ7 A;  4LK0 M;  3KWV A;  2M0A A;  2PMV A;  1ET9 A;  1CQV A;  1HEZ E;  3AE5 B;  4L2Y A;  1FIQ A;  3KQ4 A;  4KGR A;  3IT6 B;  3AE3 B;  1TKG A;  1XXG A;  3NVW A;  1WSP A;  1FO4 A;  1EWC A;  1L0Y B;  2N0S B;  2I38 A;  3B2F A;  2ICI A;  3AED B;  2RPV A;  4RGT A;  2N9K A;  3VQI A;  2QSD A;  4YSY B;  1V1P A;  2INP E;  1C9F A;  1VZ6 A;  4WUR A;  2IGD A;  5HI1 A;  1I4X A;  4RGN A;  4P6V F;  1CZP A;  4UDU C;  3T3O A;  4IKG A;  5GXG B;  1VLB A;  2GB1 A;  1TKE A;  5BYR A;  2V0G A;  1ROE A;  3IAS 1;  3KWL A;  1Q10 A;  1RYJ A;  3AEB B;  2PW9 A;  2Y5P A;  1FXI A;  4JWU C;  1KLU D;  3ZJV A;  1E6E B;  2XNA C;  2L52 A;  2ZW1 A;  1KRH A;  3AEF B;  1HXY D;  2VZK D;  1WRI A;  4GDK B;  3AE7 B;  3P4Q B;  3AM9 A;  3BYY B;  1QLB B;  1Y56 A;  2FUG 1;  2FBW B;  2WXI A;  1DGJ A;  2SEB D;  3NRZ A;  4HRO A;  1TZO A;  2K3U A;  4AS1 A;  1F2R I;  1L5P A;  1N5X A;  1SJE D;  3MFG A;  2R61 A;  3LYY A;  1BML C;  1QF6 A;  3NS1 A;  2WXQ A;  4TSS A;  3B9J A;  5BYS A;  1NI3 A;  4ZYS A;  2IGG A;  2WXN A;  2B76 B;  3HVD A;  2LGI A;  2QIL A;  4J3O D;  1QIL A;  1YQ3 B;  1GPX A;  1C79 A;  5TSS A;  1YNT E;  2KDM A;  1MI0 A;  2BB6 A;  2FE8 A;  1KLG D;  4GLS C;  2BYT A;  1FFV A;  1JWA D;  2QIE B;  4PT5 A;  3BYT B;  2CU3 A;  1MVK A;  1PUT A;  1L4Z B;  2XN9 C;  1XCQ L;  2BS4 B;  3J9C A;  5AUK A;  1FD6 A;  1F77 A;  1B9R A;  2W55 A;  2IJ0 A;  3EGR A;  4YSZ B;  3I57 A;  3P1M A;  1JWM D;  2V3N A;  3U4E G;  1MPE A;  2W3R A;  4L23 A;  1IGD A;  3PO0 A;  1K50 A;  4TQ1 A;  3R8B A;  1N63 A;  1AWD A;  4JX1 C;  2G1E A;  3U7Z A;  3AB5 A;  2KAJ A;  3NZ3 A;  2H89 B;  3P42 A;  1UGJ A;  1OQR A;  3RFZ B;  1ET6 A;  2WDV B;  3BK1 A;  3VRA B;  5MPO A;  4B0E A;  1TJE A;  2WNM A;  1TY2 A;  4N6E B;  4R3D A;  3TEX A;  1XLN A;  3BK2 A;  2WXJ A;  1I4R A;  4JE3 B;  3PZ7 A;  1C4C A;  3MHZ A;  2WQY B;  4KKJ A;  3PZ8 A;  2WXH A;  2PIA A;  5G5H A;  2ACZ B;  3NVY A;  5H92 C;  2INN E;  3AV8 A;  4RNA A;  5T8I A;  5FR3 A;  3Q8A A;  4A55 A;  1PYW D;  1T5X D;  3TEZ A;  5I4D A;  4P16 A;  5H8Y E;  1XO3 A;  1C4A A;  1PFD A;  2LFI A;  4NAW B;  1QT9 A;  1VR9 A;  5D3I B;  3FIL A;  1HA5 A;  3LB8 C;  3SFE B;  2X38 A;  1PGX A;  5EE1 A;  1OFF A;  1JAL A;  5FKA C;  3MP9 A;  2BBC A;  4ZHO A;  2Q5W D;  5C3J B;  1FM0 D;  4RGO S;  2N7J A;  2JYT A;  1FRR A;  3TEY A;  1ZXI A;  3P4R B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...