3W5VB

Cross-linked complex between ferredoxin and ferredoxin-nadp+ reductase
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
ATYNVKLITPEGEVELQVPDDVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQICDGWVLTCHAYPTSDVVIETHKEEELT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Concentration-dependent oligomerization of cross-linked complexes between ferredoxin and ferredoxin-NADP(+) reductase
pubmed doi rcsb
source organism Zea mays
molecule tags Electron transport
total genus 21
structure length 96
sequence length 96
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3w5vB00
2BS3B 1E9MA 2Q5WD 1GPXA 5EE0A 4C7ZA 4YSYB 2K22A 1DGJA 1N5XA 3ABVB 2L83A 1FMAD 3FAHA 4ITKA 1QT9A 1RWSA 3AE5B 5H92C 1N62A 5G5HA 2H89B 4USAA 4YXDB 4P6VF 1NENB 2CU3A 2Y5CA 2WDQB 1KFYB 3AEDB 3B2FA 3AE9B 3AM9A 4C80A 1SF0A 2MJDA 2W3SA 3DWMA 4YTPB 1FO4A 1NVID 1OFFA 2M19A 2DBYA 3DWGC 1FIQA 2G1EA 2K5PA 1R7SA 3AE6B 3BIID 4C7YA 3HUIA 2KAJA 3NRZA 2W54A 4ZHOA 3VR9B 1TJEA 4US9A 1ZXIA 5MPOA 1E10A 1AWDA 1KRHA 1WRIA 2AX5A 3AEFB 3ZYYX 2WU5B 2BS2B 3CIRB 5AUIA 1YQ4B 4LTUA 3P4QB 3P4PB 1RM6C 1VJKA 3NVWA 2E3TA 1JW9D 3P63A 2ACZB 4ZOHC 2HTME 1N5WA 3VRBB 5C2TB 1RYJA 1FM0D 1PDXA 1JRPA 4N59A 1QOAA 1B9RA 5EE3A 2BS4B 4A9AA 3LXFA 3FC4A 1PUTA 3B9JA 3AE8B 1XLPA 4ZHPA 3P4RB 1N61A 3AE2B 2H88B 3NS1A 1CJEA 1DOIA 1L6UA 2WQYB 1DOXA 3NVVA 2PVGC 1JALA 1ZP0B 2QIEB 3AEBB 1J7BA 1VDVA 1YJIA 1NI3A 1FXIA 1L0VB 1N60A 2QJLA 3AN1A 1T3QA 3HVZA 5EE9A 1JQ4A 1RFKA 1GAQB 2WDRB 2W55A 1AYFA 1NEKB 4HROA 1OQRA 4WWMA 2WS3B 1NYQA 4HRSA 1L5PA 1J7AA 1VLBA 1ROEA 1A70A 3VR8B 1IUEA 1CZPA 3PO0A 3AECB 3RPFC 1L6VA 1TKEA 5GXGB 1J7CA 2MH7A 5H8YE 3CWIA 1QOFA 2MJEA 3AE7B 3P4SB 2N0SB 3ETRA 4IDIA 1I7HA 1XLNA 2L52A 1EWYC 3W5UB 1SIJA 3W5VB 2BT6A 3AEEB 3B2GA 3AE3B 3WCQA 1QOBA 3AEAB 1ZUD2 2FBWB 1QOGA 2LEKA 1SB3C 1FRRA 2B76B 1DOYA 1TKYA 5G5GA 4JWSC 1OQQA 4N58A 2PKOA 3SR6A 2PIAA 1E7PB 4N6EB 3AH7A 1V97A 3EUB2 1TKGA 3KWLA 4JWUC 4YSXB 1FFVA 1XLQA 2W3RA 1NYRA 1F0ZA 3HRDD 3NVYA 1YQ3B 5AUKA 1FXAA 1FRDA 2JX5A 1QF6A 2PVOD 2EKIA 3NVZA 1QLBB 3AEGB 3LB8C 1WWTA 3VRAB 3AMZA 4FXCA 3P1MA 1E0ZA 1TYGB 3AB5A 3AV8A 1YJJA 4YTNB 2M56B 4YT0B 1N63A 1V8CA 1XLOA 1PFDA 4YSZB 2DWQA 3AE4B 2JQRB 4WQMA 2MJ3A 2WP9B 2KMMA 1JROA 2OHFA 4YTMB 2CJNA 3SFEB 1ZOYB 3L4PA 4US8A 1KF6B 1UWMA 1WXQA 1XO3A 1WGKA 3AE1B 2CJOA 1JWAD 5EE1A 5C3JB 1FFUA 2WLBA 1E6EB 4JX1C 2WDVB 1WYGA 2WU2B 1JWBD 3SFDB 3W9CB 2K9XA 4KX6B
chains in the Genus database with same CATH superfamily
1FCLA 2ZW0A 1V1OA 2VZKD 5G5HA 5G2NA 4M0WB 1D4BA 4DHZB 5D94A 1F77A 1IBXB 1FO4A 3AE6B 5HI1A 1V80A 1LXDA 4HPLB 3O13A 4KGTA 2KHWB 2DX5B 4XE0A 2N1WA 4A6QA 3NVWA 3T3OA 2C7NB 2DAJA 3UINB 1RYJA 1EM7A 3DHIC 1P0RA 1PUTA 3B9JA 4HLEA 4ARCA 4DDID 2QCZA 2LGYA 2D2QA 3DVGY 3BVGA 3ZTDA 2BBCA 3AN1A 1TS3A 1GAQB 2SEBD 4MM3B 2WXOA 2JUOA 3M3JA 1TZOA 2N9PC 2V3NA 2EMSA 3T8MA 4KV2A 3CWIA 4FHJA 3KVFB 2RDBC 3ECIA 3R2IA 2KDIA 1WYWB 2DNFA 4RFBA 2N1VA 1WE6A 3I9V1 2XEWA 2RPVA 3L10B 4FLHA 2KLGA 1Q10A 1OEYJ 3T3NA 4W9HA 4YT0B 4HK2A 4A20A 2CJNA 1V9JA 1LFDA 2LRWA 5HFYA 4IUMB 2J0JA 5HKHA 3NUHB 3VQIA 2ONQA 2MA9B 4L2YA 1ZGUB 3EA6A 3IAS1 4YXDB 3AEDB 3AE9B 2M19A 3LJ3A 1MHXA 5AZHA 1SEBD 2WXMA 5BMHA 2L05A 3CSTA 1WF9A 3DCGA 3QHTA 2KJRA 1UUPA 2KX3A 2MRPA 2KDEB 4C4VB 4N59A 1R4MI 2BWES 4CYEA 1AN8A 4B95A 1CMXB 4XZ4A 4IKGA 3WIMA 1JWUD 1QQRA 2YLMA 3RN9C 5DPWA 4HROA 2WS3B 2KACA 4RNAA 1J7AA 3VUXA 2NR2A 1QOFA 3VH4B 2N0SB 2R61A 1L7YA 3JYUA 3DVGX 2RMMA 1L4ZB 1K53A 2FIDA 3AH7A 3NY5A 1ZE3D 2FCQA 3NVYA 1YQ3B 5AUKA 1K52A 4JIOU 3ZRFA 3SU8X 4G50A 1TYGB 2KMAA 1YJJA 2N7DA 4YTNB 3N9YC 1N63A 2I1KA 2IBIB 2WXPA 3Q8AA 3PGEA 2KANA 2PTLA 3N3KB 3SFEB 2GBMA 3IXSA 2KWCA 3GE3C 1WXAA 1XO3A 2WXNA 4PS7A 4JL9A 2FUHB 2WLBA 3Q3OC 1JWBD 2KOXA 5BMGA 1WX9A 1DGJA 2D5GA 1FNWA 3S2AA 3FAHA 3ZDMC 4ARIA 1F2RC 2INNE 2SAKA 4BVUC 5DPSA 2GMIC 5I4DA 1J0GA 1T6BX 4HWIB 2DBYA 3BIID 2KYWA 3A33B 4GDLA 2K25A 4WH4A 4AWJA 1FXTB 1TS2A 3IT6B 2I38A 3ZYYX 2IO1B 1WXMA 3TSSA 3PRMB 1V5OA 4RGOS 3ZKJC 4URKA 3NZSA 2JXXA 1RRBA 2MP2B 4XGAB 4K7WA 3I63C 4II3B 1MFWA 1K50A 4BKSD 3ZRCA 2G9HD 1UWXA 1DOXA 3SHQA 1RLFA 2PVGC 3H7PB 1UZXB 3ZUNA 2K8BA 1VZ6A 1UGJA 4W9FA 4HRSA 1L5PA 2C5LC 4KSKC 1VD2A 3IBEA 1SIJA 4NQLB 3B2GA 2Y5BB 4YWGG 2RDGA 3R66C 1YIWA 3DHGC 3AXCA 2JRHA 5FKAC 1ZDVA 2KXJA 4F1SA 3HRDD 3APCA 4LK0M 5D3DA 1VZ8A 3MC8A 4K3CA 2MQJA 4AQ7A 1K8RB 1HZ6A 2MX2A 1PFDA 2OEDA 1FCCC 1I4XA 4WQMA 3I5JC 3O65B 5IOIA 4S17A 2BQQA 4XDCA 4ZDVA 3PT2B 4MJSA 2OJRA 3MC9A 1T0QC 4C7ZA 4YSYB 1N5XA 2M8SA 3H6NA 4IW0A 2NMQA 4HKZE 4BOSC 1WE7A 1QT9A 1N62A 4FULA 3FKYA 1WJUA 1KFYB 3A9KA 4MGYE 2LMCA 2W3SA 1WJ6A 1NDDA 3ZVVA 4M02A 2X38A 4B0MA 1E8YA 2PW9A 4OZAA 1I4QA 2Y3AA 4LTUA 3TEYA 1TY0A 2E3TA 3P63A 2G3QB 2L3ZA 4KVGB 3RFZB 2WGSA 2FUG1 1GC6A 2IO3B 3TEWA 1TT5B 3AE2B 2CS4A 1DOIA 1ZDXA 1ISNA 1JALA 3AEBB 2QIEB 1VDVA 2QJLA 4GN1A 3N1ZC 4WWMA 3UGBB 2PMVA 3RT3B 2W82A 3KYCD 1HEZE 2DZJA 1D6EC 3RZWC 5H8YE 3BVMA 2AQ2B 2BYTA 2D3GA 3QIJA 5D7GA 2WNMA 1XXGA 1SB3C 4WIPA 4NZLB 1OQQA 4N58A 4WJNA 2PE9A 2XN9C 1V97A 2CR5A 1HE8A 4I6NB 1QF6A 4O1NA 4OW0A 3P1MA 3Q3MC 4WWOA 2INPE 2C7HA 2NPTA 2FNJB 2LFIA 1V81A 3ALBA 2KMMA 1H8CA 3UQBA 4KDLB 4HEA1 1WXQA 5FR3A 4A90A 1VR9A 2NVUI 2WXLA 1HZ5A 1OQYA 1D5ZC 3ABVB 2LI5A 2D10A 3LYYA 1R4NI 5FK9C 1SJED 1V5TA 1P7FA 3RMKC 2GOWA 3VH3B 4NJCA 3BY4B 4ZRPA 1V6EA 1R7SA 4P1CC 2ZCCA 4WJOA 1CQVA 1ZXIA 5T8IA 1FNUA 1KRHA 2KJHB 4MSQB 2K3UA 1KH0A 3VRBB 3PRPB 2YVCA 1EUVB 2KC2A 2GB1A 4A9AA 2D3AA 4L1BA 3PLVA 3HVDA 1L6UA 2O6VB 1ZP0B 4AJYB 1NI3A 1L0VB 5EE9A 1IP9A 1T3QA 1LQBA 2XBBC 3ZQ4A 1MI0A 2JT4B 2KFJA 1F2RI 5GXGB 1SE3A 3P4SB 3ETRA 1TS4A 1S3SG 2KTRA 4KGSA 1ZUD2 3U4EG 1V49A 2Z59B 2JZPA 3RNFC 3SR6A 2VRRB 4PK1A 1P3QU 2DZMA 4GDKA 1F0ZA 1S1QB 2C9WB 2PVOD 4LDTB 3AV8A 1JMLA 4W9IA 5DPRA 3J9CA 1T0SC 2QMTA 3AE4B 1T0YA 3N1YC 4TUUA 3N30A 2MLBA 3VUYA 4F7ZA 4EZJA 2I1JA 5C3JB 1I35A 4AJWA 1E9MA 1YOVB 4DWFA 2LJIA 2KJ6A 1E7VA 3V61A 2WXRA 4M8MA 1M94A 4JLCA 2H89B 3R2TA 2W9NA 1HTOA 2Y5CA 1KJTA 1XEEA 2V3SA 2EKEC 3FILB 1OFFA 3DWGC 2G1EA 2K5PA 1T0RC 3MHZA 3WAMA 1SIFA 5MPOA 1UELA 1AARA 1YQ4B 1IGCA 4GDLB 2ZPNA 4W9JA 5D3IB 1MJDA 3RNAC 4LJOB 1ENFA 4RCOA 3QAQA 2UU7A 3VTUA 2IGHA 3EECA 2XK5B 3M95A 1WR6E 5J17A 4A3OA 3QARA 1AYFA 2LRUA 3VXWA 1RFAA 1EWYC 2J7QB 2KMCA 3DQVA 5KHQA 3RUIB 2KX0A 1P7EA 1E7PB 3IG3A 2KDFB 2BYEA 3B1LX 4HDOA 2JX5A 1YN4A 2DYOA 4NNJB 2K39A 5CX3A 1VZ7A 2MW5A 1R4MB 2J0KA 1STEA 2GBJA 4MT5A 4TSSA 2MJ3A 3V60A 4BKSA 1KF6B 2KDMA 3TL5A 1JWAD 3OAWA 2WDVB 2J53A 1I4PA 2IY1B 3ZNZB 3U7DA 3AULA 4R3DA 4UDUC 4WJQA 1B1ZA 3W1YA 1GPXA 2LXAA 2JZ3B 4D2KA 4EEWA 1MG4A 2NBUA 3OJ3A 3VAWA 4F8CB 4P6VF 4KSLC 1WMHB 5DPTA 1NVID 2LHEA 4BBNC 4GGQA 3A9KB 1HXYD 4PS3A 3W2DA 2AX5A 4ANXA 2BS2B 1MVKA 1PGAA 2KN4A 2LUEA 3R7RA 2LVOA 1JRPA 1QOAA 3UIOB 2O2VA 1TGZB 2X8XX 1UBIA 3Q3FA 4MGKE 4NQKE 2JPHA 4ZHPA 1N61A 4W9KA 2ZNVC 2RD0A 4NAWA 1FXIA 1LO5D 4WAAA 3A4RA 1MPEA 3HK0A 4IWOA 4ANWA 5JZEB 3N20C 5BYRA 4JGHB 4HCPB 3W5UB 1RAXA 2WYQA 4XC2A 1XCQL 2PKOA 5C1ZA 3D32A 3PSEB 1FRDA 1ZPSA 1BMLC 4XYCA 2KNBA 3AMZA 3AB5A 4A3PA 2A5UA 1P98A 2HD5B 2KVRA 1OEYA 4AUQC 1EU4A 1Z2MA 2AEHA 2AL6A 1ZW7A 2MBEA 4M00A 1TY2A 1UWMA 2KO3A 5EE1A 2IO2B 5J18A 2ZVNA 1WYGA 3RNBC 4GLSC 2L0FA 4KX6B 3DVNU 5BYSA 5EE0A 4IWPA 4K1RB 1RWSA 3AE5B 1E7UA 2HTHA 2KZRA 2Y5PA 1WIAA 3OJ4B 4C80A 3NJTA 2JZZA 3A1QA 2AWTA 1YJ1A 2NBVB 3MTNB 2MBHA 4HXDA 5E6NA 3EGRA 3KWVA 3M62B 3ZO5B 4YL8A 3VDZA 3IAM1 2HDEA 4WWPA 4IM3A 5CHWA 1N5WA 1C3TA 4TQ0A 3EFUA 2BS4B 3V05A 4JE3B 1WXSA 4OZCA 4RGTA 1J8CA 4H2AA 2MBOA 1VRAB 2JY6A 4NAMA 1WY8A 2A4ZA 2EMTA 2AL3A 5CTRC 1VCBA 3UQAA 4PYUA 4G3XB 2KWDA 2LXCA 2J4XA 3VR8B 3AECB 1L6VA 1UGMA 4REZA 2MJEA 4W9DA 4RH6A 4L23A 1T5XD 4CHKA 3P42A 2ZZPB 2BWFA 1NYRA 1JCKB 1IYFA 3RNEC 4GMVA 1KM7A 2M56B 2KT7A 3KUCB 1AW7A 4P1BC 4GDKB 4GIVA 1EU3A 1YD8U 2ON8A 1WGDA 4WAFA 1FFUA 2KK8A 4MSMB 1NBFC 5E6PA 2N7EA 4IG7B 2IDYA 2K22A 3ZTCA 2MEKA 2K0PA 4W9CA 1V1PA 1TTNA 1HA5A 4USAA 1I4HA 2DHZA 2PPHA 1M4VA 3B2FA 3DBHI 1ET6A 2WXIA 3ZIMA 2MJDA 3KUDB 4KKJA 1WSPA 1KOTA 4MM3A 2KD0A 4C7YA 2LGXA 2G4SA 2ZNVB 4ZHOA 3QJZA 4BKTA 2IPKD 4PYZA 4I6LB 3AEFB 4II2B 2IZVB 2D3CA 4S0RA 2IGGA 3APDA 4AOFA 4ZOHC 3V6EB 3VFKA 3ZJTA 5C2TB 1FM0D 2IJ0A 3R3MA 2K8HA 1F9JA 3LXFA 3L16A 3P4RB 5CHFA 1KLGD 5BMIA 2I2YA 2NBWB 4KDIC 4HCNB 1WFYA 5TR5A 3WCQA 4K81A 1ACCA 3R8BA 1Q5WB 4KZ0A 1R4NB 2JYTA 2O6VD 1TS5A 4WWNA 2R2QA 1XLNA 2V3PA 1Z5SB 2RR9A 1WX8A 4MACA 2OJWA 4BKGA 2CKHB 1PQSA 1LM8B 5TSSA 2WWZA 4B6WA 2W3RA 4EUTA 3TCAA 2HJ8A 2Z0EB 3AEGB 3VRAB 4RGMA 2RGFA 4BBNF 2WXFA 3Q2AC 3L17A 5IAAC 4LJPB 2DZIA 3QK0A 4LDTD 1E8XA 3JVZX 2DZKA 1SE4A 3PTFC 1EF5A 2WU2B 4C4VA 2HJ1A 4EZLA 3W9CB 2J52A 1C76A 2OOBB 5EDSA 2KWVB 4BOZB 1G6JA 4AS1A 2L83A 2GLSA 2DLBA 3HIZA 4GOCA 1GC7A 1ZXHA 3AM9A 3PVLA 1A5RA 2M17A 1HTQA 1GNUA 1YN3A 2LWPA 1NI2A 3KQ4A 3JW0X 3URYA 2QILA 4NPNA 3Q6BA 2PLPA 4KIKA 4RF0A 2Z0DB 3DBLB 2ZW1A 2IY0B 1VJKA 2QDFA 5BYQA 3TEXA 4PT5A 5EE3A 2GRIA 5GMVA 4EZKA 3E56A 4FN2A 3FC4A 3PHWB 4EKUA 4BZAA 3A9JA 4EOYA 3MC0B 3U52E 1WH3A 2WQYB 1SE2A 2O2VB 3NRZA 1J7BA 1N60A 3NG0A 2K1FA 3GS2A 1NEKB 3TJPA 3C19A 2JWUA 1I42A 5L95C 1XCTL 4NAWB 4FA6A 3BINA 4B0EA 4DHZE 2K6QA 4EFOA 2V1YA 2N9KA 4W9EA 5IA7A 3CMMB 3TEZA 2BT6A 1I4RA 2LHDA 3GZNB 2B76B 1TKYA 5G5GA 4N6EB 4JWUC 3KH0A 5CHVC 1E90A 1FXAA 2IGDA 3LB8C 2ASQA 2FE8A 2C7MB 4FBJB 3NOBA 2WHIA 4XWWA 2DWQA 1JROA 1I4GA 1ZOYB 2KLCA 2G4DB 3AE1B 2LD9A 5IO9A 2BKRB 4KGRA 3BK1A 4BAXA 1UD7A 1WZ3A 2PEAA 3ONSA 2BB6A 3DBLI 4ANUA 2B3AA 3MJ5A 2MSED 5AZFA 2WDQB 4HPMB 3WALA 1MG8A 2WXKA 2WXHA 3NHEB 2KKCA 1TJEA 4MGIE 1AWDA 3AU4A 1WM3A 3A1QB 2PE6B 3P4PB 1RM6C 4HPPA 2ACZB 5LXHA 2TSSA 3RCZA 2GBRA 3NS8A 1K51A 1CK1A 3H1UA 2FCSA 1CJEA 1Y56A 2IYDB 3GZNI 3NVVA 1UH6A 3K9OB 1WGGA 2KFKA 1BXTA 2M1MA 1P1AA 2AQ1B 2WXJA 1YQBA 1OQRA 3R7QA 4MDKE 3L13A 2V4IB 1VLBA 1JWSD 2KC1A 4XWTA 3SD5A 5IP4D 2N9EB 1J7CA 1WX7A 1I7HA 2D07B 3DOWA 2DYMA 1X1MA 4MEMA 1GUAB 3BWUD 2FCNA 2KQ4X 4ZRQA 4RMAA 1GJZA 5JHAA 5E6OA 4M01A 4N9F4 4NJ6A 5DCNA 2D3BA 3NVZA 4FXCA 3DDCB 2NTTA 2N9XA 4FJZA 3UI3A 4P7IA 2RDHA 4ZRKA 2OHFA 1WJ4A 1YMHE 2ZCBA 4EE2A 4US8A 4MH8A 1YNTE 1L2NA 2L8JA 2JU6X 4E3CA 4K7SA 1FMAD 3ZNGC 2WXQA 3EFCA 2N4FA 5E6JA 1F1HA 1SF0A 4ICVA 1TIFA 4CQNA 1XQQA 1V1PB 1HQRD 3ZJVA 1GG3A 2FCMA 2G45B 4FADA 1L0YB 3CSFA 1WRIA 3DPDA 5LXIB 4DHJB 1YX5B 1ESFA 3BK2A 2MBQA 4JPSA 1U4AA 4MH0E 5IN7A 3TBLD 3H8HA 4BFRA 3Q3NC 4MJSB 3DBRI 3UIPB 2H88B 3L08A 4K7UA 4TMAB 2ICIA 2JYEA 1IPGA 1WGYA 2WDRB 2BW2A 4MGZE 2L76A 3V62A 1ROEA 1A70A 1CZPA 3BYYB 3KYDD 3WANA 2J0MA 1D3ZA 4IDIA 1OGWA 2L52A 3W5VB 2RPQA 4IC7B 3AE3B 5AEKB 2LEKA 3HHMA 4LNKA 4HVBA 3PZ8A 4JQWC 1DOYA 4DXGA 4P16A 2PIAA 3RI7C 4Q2JA 1D5XC 1XLQA 3GB1A 1TZ1A 1C77A 4G0NB 4NJ7A 1QLBB 2INCC 3ZDTA 4MELA 2WX0A 1ET9A 2DYBA 4FHKA 4ZRJA 4RM9A 3EC8A 4CO7A 2LZ6A 2PJHA 1E5WA 2L7RA 3A4SC 1SBBB 2VZKB 1WGKA 5L83A 4ZRIA 4K3BA 3MFGA 2N9LA 2BS3B 1IGDA 3U2SC 2KQ7A 3CF6E 4ZYSA 4X57B 4ITKA 2V4LA 1C79A 2R2OA 3IT4B 2LJ5A 3IHPC 4WQOB 2O6VA 1V2YA 4LNFA 3GP7A 2MWSB 2BKFA 1PYWD 2RSUA 3DWMA 2VH1A 1BUIC 3UF8A 2J42A 2KAJA 4DXAB 4A8XC 3VHTC 3W1SA 2NPTB 1GB4A 1L0XB 2WX1A 2V9HA 3EHVA 3RNGC 2HE7A 3P2BA 4FJYA 3BZDB 1WRDB 2LUMA 2Z8LA 5HG2A 2QEJC 3I3TB 4KIKB 3RZFA 1ZKHA 1E8ZA 1UF0A 2UYZB 4RGNA 4AP4C 1YJIA 3TUOA 4XX5A 3QWZB 3L0WB 4J3OD 4DQOC 4KZCA 3A9JB 3Q14C 4FJVB 3V3XA 1NYQA 3WAPA 2VH2A 4B9KA 4OZBA 1Q1OA 4W9GA 1JWMD 3DBHB 3MHSD 4HDQA 1J19A 1QOBA 1OTRB 1FRRA 4RF1A 1WXVA 2N7JA 3DBSA 4YSXB 3NZ3A 1WZ0A 1TBEA 3N32A 3FILA 4C56C 4IM0A 2BYFA 1C4CA 1XF5L 1LGRA 5JH5C 1XLOA 3PZ7A 3ML8A 2JQRB 3JSVA 4LNIA 2LVPA 1WGRA 5JHBA 1E6EB 4M0WA 2MBBB 3SFDB 3U30A 2K9XA 2Q5WD 2KTRB 1IBXA 3I57A 4G11A 5H92C 2XK5A 1FD6A 1FPYA 3C0RB 4LCDE 3Q8EA 4OHJA 2M4NA 4YTPB 1BT0A 3X23A 1EWCA 3Q8FA 2ZVOA 1E10A 3RNCC 1YN5A 4KKIA 3KUZA 3P4QB 2XNAC 2JXTA 3L54A 3WA0A 3HM6X 1C4PA 2E6XA 2CHZA 1B9RA 4TV3A 4DDGD 2MHJA 3TMPB 4GB9A 1N6ZA 1XLPA 3NS1A 2CHWA 3ML9A 3DVNV 4HJKA 3SEBA 2K8CA 2FAZA 3W1SC 4WJPA 2KFKB 3GE8C 2DAFA 5D6JB 1XD3B 3ZW3A 4NY0A 4LNOA 2YEPB 4TQ1A 1PGBA 3AEAB 2FBWB 4DBGA 1KTKA 1YX6B 4JWSC 4XDDA 3PHXB 1GOZA 3LDZE 1WMHA 3NZUA 4TKNA 2EKIA 2LGSA 2ZJDA 1E0ZA 2LGDA 3C8YA 3T9LA 2V0GA 1C78A 4YTMB 2WP9B 3U7ZA 2BF8B 4OVZA 2L0TA 4ANVA 2JSVX 3QCAA 3BYTB 3VVWB 3N1XC 1C9FA 4HJGE 1SE9A 2QC8A 4QAYA 3HM3A 1P9DU 5AZGA 3ZNHB 1C4AA 4PS8A 3OWEB 3ZNID 1WGHA 4WURA 2M0AA 1NENB 3E9SA 2CU3A 2ZEQA 1Y8RC 1UNSA 2L00B 2BGFA 3H9DA 3HUIA 2W54A 3PZDA 4US9A 4W9LA 2JF5A 1UBQA 4LLGM 4M8NA 3CIRB 1Q0WB 1JW9D 3Q3JA 2CU1A 5HHDG 1L4DB 3X0WA 2AQ3B 3TIXA 5IKCM 5G55A 5BO4B 2NS5A 3QA8A 3AE8B 2EELA 2GBKA 3WAOA 2YEPF 3SDLC 4ASWC 4LNNA 4GXBA 4A55A 2W55A 1SGHA 3OG5A 3PV1A 2NCNA 2KVZA 4ICUA 4J6IA 4IWQA 5FR6A 1IUEA 3RD2A 1PGXA 3RYTA 3PO0A 3PPAA 3RPFC 4GSWA 2UWQA 3AE7B 2LASA 3VUWA 1XT9B 1WR1A 1QKZA 4OVUA 3IVFA 3B08A 1GB1A 1E8WA 3AI5A 3PS6A 2C60A 3EUB2 1V86A 4I6PA 3DHHC 2JVCA 1EF1A 1QZEA 2L32A 3APFA 4C00A 1WM2A 4GU2A 2BVCA 2LVQA 4OVVA 1SSNA 4YSZB 2QSDA 4ACFA 1QILA 2GI9A 2BPSA 3L4PA 2GBNA 3Q8CA 2CJOA 3IFWB 1JRUA 3VTVA 1MHHE 2KWUB 2KTFA 2BYVE 2JRIB 4E71A 3B0AA 5JXVA 2REXA 1FNVA 3RULA 3AU5A 1FIQA 3ZJUA 2MCNB 3ZXRA 2BB5A 3ZGZA 3VR9B 3ZLZA 2M0XA 2MP2A 4HKQA 1WI0A 2K6DB 2WU5B 5AUIA 2INDC 2HTME 2QHOA 5LLIA 3Q69A 1PDXA 3PLUA 1WJNA 5LNK1 2L1AA 1FEHA 3ZXVA 3GOEA 3H7PA 2WXGA 3OLMD 1SJHD 1D5MC 2NTSA 4DHJD 1F52A 1DYQA 1H4RA 2IO0B 1EO6A 3HVZA 3VTWA 1JQ4A 2AYOB 2DENB 2WDTB 3U8ZA 4ZYNA 1RFKA 3M63B 3KW5B 4IM2A 3PREA 4RM8A 1TKEA 2MH7A 5KHOA 2KN5A 2ZPYA 3ENEA 2BTEA 3Q8BA 1C1YB 4IOIE 2FIFA 3AEEB 1KLVA 1QOGA 1KLUD 3K9PB 2CHXA 3KWLA 1TKGA 3MJWA 1FFVA 2KDBA 3KLSX 5D2MB 3QX1A 3BVZA 3MP9A 1WWTA 2D11A 3H7SA 2LGIA 1V8CA 2JWZA 4DK5A 5C23A 3DBRB 3QC8B 5J2RA 4E74A 1SXTA 2KQSA 3PRZA 4JX1C 3V6CB 4DXFA 3JSVB 3QQ8B
chains in the Genus database with same CATH topology
2BS3B 1IGDA 1D5ZC 2IDYA 2K22A 3U2SC 1FCLA 3ABVB 2ZW0A 2MEKA 4ZYSA 4ITKA 2K0PA 1V1OA 1V1PA 1C79A 2VZKD 1HA5A 3IT4B 5G5HA 4USAA 3LYYA 5FK9C 1D4BA 3GP7A 1SJED 1I4HA 1P7FA 1M4VA 3B2FA 4NJCA 1F77A 1ET6A 2WXIA 1PYWD 1IBXB 2MJDA 3DWMA 4KKJA 1WSPA 1BUIC 4ZRPA 1FO4A 1R7SA 3AE6B 5HI1A 4C7YA 2J42A 2KAJA 4ZHOA 4A8XC 2IPKD 3O13A 3W1SA 4KGTA 1CQVA 1ZXIA 5T8IA 1GB4A 1L0XB 1FNUA 1KRHA 3AEFB 4XE0A 2IGGA 4A6QA 3NVWA 3T3OA 2K3UA 3BZDB 1KH0A 4ZOHC 3VRBB 3ZJTA 5C2TB 2LUMA 1RYJA 1FM0D 2IJ0A 2Z8LA 5HG2A 2QEJC 1EM7A 2GB1A 4A9AA 3LXFA 4L1BA 1PUTA 3B9JA 3P4RB 4RGNA 4ARCA 1KLGD 5BMIA 3HVDA 2I2YA 1L6UA 3BVGA 1ZP0B 2BBCA 3WCQA 1YJIA 1NI3A 3TUOA 1L0VB 5EE9A 3AN1A 1T3QA 4J3OD 4DQOC 1ACCA 3R8BA 1TS3A 3ZQ4A 1GAQB 2SEBD 3V3XA 4MM3B 1MI0A 2WXOA 1NYQA 1TZOA 2V3NA 2JYTA 1F2RI 5GXGB 1TS5A 4OZBA 1SE3A 3CWIA 3P4SB 1JWMD 3ETRA 1TS4A 1XLNA 2V3PA 3R2IA 4KGSA 4RFBA 1QOBA 4MACA 1ZUD2 3U4EG 1FRRA 4RF1A 3I9V1 2JZPA 3SR6A 2N7JA 4YSXB 5TSSA 3NZ3A 2W3RA 1F0ZA 2RPVA 3FILA 2PVOD 4C56C 3AEGB 3VRAB 1C4CA 1Q10A 1XF5L 4RGMA 3T3NA 3AV8A 1JMLA 4YT0B 2WXFA 1XLOA 3J9CA 3PZ7A 2QMTA 3AE4B 2JQRB 2CJNA 5HFYA 5C3JB 1E6EB 1SE4A 2WU2B 4M0WA 3SFDB 3W9CB 2K9XA 3NUHB 3VQIA 2J52A 1C76A 2ONQA 1E9MA 2Q5WD 2LJIA 4L2YA 4AS1A 1IBXA 2L83A 3I57A 2DLBA 2WXRA 5H92C 2H89B 3R2TA 1FD6A 3EA6A 1ZXHA 3IAS1 4YXDB 2Y5CA 3Q8EA 4OHJA 3AEDB 1XEEA 3AE9B 3AM9A 3FILB 4YTPB 1OFFA 2M19A 3DWGC 2G1EA 2K5PA 1MHXA 1EWCA 1SEBD 1YN3A 2WXMA 3MHZA 5BMHA 3Q8FA 3KQ4A 5MPOA 3URYA 1E10A 2QILA 2PLPA 1YN5A 4KKIA 4RF0A 1YQ4B 3P4QB 1IGCA 1UUPA 2ZW1A 4GDLB 1VJKA 2XNAC 2JXTA 5BYQA 3TEXA 1C4PA 2E6XA 5D3IB 4N59A 1B9RA 4PT5A 5EE3A 2GRIA 1ENFA 4RCOA 3E56A 3FC4A 1AN8A 2IGHA 1XLPA 3MC0B 3NS1A 3U52E 4IKGA 2WQYB 1SE2A 3NRZA 1J7BA 1N60A 1JWUD 1QQRA 3GS2A 4HROA 1AYFA 1NEKB 2WS3B 2KACA 4RNAA 2JWUA 3SEBA 1J7AA 1XCTL 4NAWB 4B0EA 1QOFA 2N0SB 2R61A 2N9KA 1EWYC 2YEPB 4TQ1A 1PGBA 2RMMA 3TEZA 2BT6A 1I4RA 2LHDA 3AEAB 2FBWB 2B76B 1KTKA 1L4ZB 1TKYA 1K53A 4JWSC 4XDDA 5G5GA 1P7EA 1E7PB 4N6EB 3AH7A 1GOZA 4JWUC 1ZE3D 3NVYA 1YQ3B 5AUKA 1K52A 1FXAA 2JX5A 1YN4A 2DYOA 2EKIA 2IGDA 3LB8C 1VZ7A 1E0ZA 1TYGB 3C8YA 2FE8A 1YJJA 4YTNB 3N9YC 1N63A 2WXPA 3Q8AA 4XWWA 2V0GA 1C78A 1STEA 4MT5A 2DWQA 2PTLA 4TSSA 2MJ3A 2WP9B 4YTMB 1JROA 3U7ZA 1I4GA 3SFEB 1ZOYB 3IXSA 4OVZA 1KF6B 2KDMA 1XO3A 2WXNA 3AE1B 1JWAD 2WLBA 2WDVB 2J53A 1I4PA 1JWBD 5BMGA 4KGRA 2JSVX 3BK1A 4R3DA 4UDUC 3BYTB 1GPXA 1B1ZA 1C9FA 1DGJA 2D5GA 4HJGE 1FNWA 3FAHA 4D2KA 2BB6A 1F2RC 4ARIA 2INNE 2SAKA 1C4AA 3MJ5A 3OWEB 4P6VF 4WURA 2M0AA 1NENB 3E9SA 2CU3A 2WDQB 5I4DA 1T6BX 1NVID 2DBYA 1UNSA 3BIID 2WXKA 3HUIA 2LHEA 2W54A 2WXHA 4WH4A 1TJEA 4US9A 1HXYD 1TS2A 3W2DA 1AWDA 3IT6B 2AX5A 2I38A 4LLGM 3ZYYX 2BS2B 3CIRB 1MVKA 1PGAA 2KN4A 1RM6C 3P4PB 3TSSA 1JW9D 4RGOS 2ACZB 2TSSA 5HHDG 1JRPA 1L4DB 1QOAA 1K51A 2AQ3B 1CK1A 1K50A 3AE8B 4ZHPA 1N61A 2G9HD 1CJEA 1Y56A 1UWXA 2EELA 1DOXA 3NVVA 2PVGC 1FXIA 1BXTA 1LO5D 2YEPF 2AQ1B 4A55A 2WXJA 1VZ6A 2W55A 1OQRA 1UGJA 1MPEA 2V4IB 1L5PA 4HRSA 1VLBA 1JWSD 4XWTA 1IUEA 1PGXA 3PO0A 3RPFC 1J7CA 3AE7B 5BYRA 1I7HA 2DYMA 1SIJA 3W5UB 3B2GA 1QKZA 4YWGG 3BWUD 2RDGA 1GB1A 2KQ4X 1XCQL 2PKOA 4ZRQA 5FKAC 3EUB2 1ZDVA 3HRDD 2L32A 1FRDA 1ZPSA 4LK0M 5D3DA 1VZ8A 3NVZA 1BMLC 3AMZA 4FXCA 3AB5A 4AQ7A 2NTTA 1HZ6A 1SSNA 1PFDA 4YSZB 3UI3A 1EU4A 2OEDA 2QSDA 1FCCC 1I4XA 2RDHA 4WQMA 1QILA 2GI9A 2OHFA 1YMHE 3L4PA 1TY2A 4EE2A 4US8A 1UWMA 3Q8CA 2CJOA 4MH8A 5EE1A 1YNTE 1WYGA 4XDCA 4GLSC 4KX6B 2JU6X 1MHHE 5BYSA 5EE0A 4C7ZA 4YSYB 1N5XA 1FMAD 2NMQA 4HKZE 1QT9A 1RWSA 3AE5B 5JXVA 1N62A 2WXQA 5E6JA 2Y5PA 1FNVA 1KFYB 4C80A 2LMCA 1SF0A 2W3SA 4CQNA 1FIQA 1V1PB 1HQRD 3ZJVA 3ZJUA 2BB5A 3ZGZA 3VR9B 2X38A 1L0YB 4B0MA 3EGRA 2PW9A 3KWVA 4OZAA 1I4QA 1WRIA 4HKQA 2WU5B 3IAM1 5AUIA 2Y3AA 2HDEA 4LTUA 3TEYA 1TY0A 1ESFA 3BK2A 2E3TA 3P63A 4JPSA 2HTME 1N5WA 3H8HA 3Q69A 3RFZB 1PDXA 4TQ0A 5LNK1 2L1AA 1FEHA 2BS4B 3V05A 2FUG1 2WXGA 4JE3B 1SJHD 4OZCA 4RGTA 1D5MC 2NTSA 3TEWA 4H2AA 3AE2B 1DYQA 2H88B 1VRAB 1DOIA 1ZDXA 4NAMA 4TMAB 2ICIA 1JALA 3AEBB 2QIEB 1VDVA 3HVZA 2QJLA 1JQ4A 1RFKA 2JYEA 2WDRB 4WWMA 2BW2A 2PMVA 2KWDA 1ROEA 1A70A 2J4XA 2W82A 1CZPA 3VR8B 3BYYB 1HEZE 3AECB 1L6VA 1TKEA 1D6EC 2MH7A 5H8YE 3BVMA 4REZA 2MJEA 2AQ2B 4IDIA 2BYTA 5D7GA 2L52A 2WNMA 2BTEA 1XXGA 3Q8BA 4IOIE 3W5VB 3AEEB 3AE3B 4RH6A 4L23A 1T5XD 2LEKA 1QOGA 1SB3C 4WIPA 3P42A 3PZ8A 1DOYA 1KLUD 4NZLB 1OQQA 4N58A 4DXGA 4P16A 2PIAA 2XN9C 3KWLA 1V97A 1TKGA 4Q2JA 1D5XC 1FFVA 1XLQA 3GB1A 1NYRA 1C77A 1JCKB 3KLSX 1QF6A 4O1NA 3BVZA 1QLBB 3MP9A 1WWTA 4OW0A 1ET9A 3P1MA 2LGIA 2M56B 1V8CA 2INPE 1AW7A 4GDKB 2LFIA 1EU3A 2ON8A 2KMMA 1SXTA 4HEA1 1SBBB 1WXQA 2VZKB 4WAFA 1WGKA 5FR3A 4A90A 1VR9A 1FFUA 4JX1C 3MFGA 4DXFA 2WXLA 1HZ5A 2N9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BS3 B;  1E9M A;  2Q5W D;  1GPX A;  5EE0 A;  4C7Z A;  4YSY B;  2K22 A;  1DGJ A;  1N5X A;  3ABV B;  2L83 A;  1FMA D;  3FAH A;  4ITK A;  1QT9 A;  1RWS A;  3AE5 B;  5H92 C;  1N62 A;  5G5H A;  2H89 B;  4USA A;  4YXD B;  4P6V F;  1NEN B;  2CU3 A;  2Y5C A;  2WDQ B;  1KFY B;  3AED B;  3B2F A;  3AE9 B;  3AM9 A;  4C80 A;  1SF0 A;  2MJD A;  2W3S A;  3DWM A;  4YTP B;  1FO4 A;  1NVI D;  1OFF A;  2M19 A;  2DBY A;  3DWG C;  1FIQ A;  2G1E A;  2K5P A;  1R7S A;  3AE6 B;  3BII D;  4C7Y A;  3HUI A;  2KAJ A;  3NRZ A;  2W54 A;  4ZHO A;  3VR9 B;  1TJE A;  4US9 A;  1ZXI A;  5MPO A;  1E10 A;  1AWD A;  1KRH A;  1WRI A;  2AX5 A;  3AEF B;  3ZYY X;  2WU5 B;  2BS2 B;  3CIR B;  5AUI A;  1YQ4 B;  4LTU A;  3P4Q B;  3P4P B;  1RM6 C;  1VJK A;  3NVW A;  2E3T A;  1JW9 D;  3P63 A;  2ACZ B;  4ZOH C;  2HTM E;  1N5W A;  3VRB B;  5C2T B;  1RYJ A;  1FM0 D;  1PDX A;  1JRP A;  4N59 A;  1QOA A;  1B9R A;  5EE3 A;  2BS4 B;  4A9A A;  3LXF A;  3FC4 A;  1PUT A;  3B9J A;  3AE8 B;  1XLP A;  4ZHP A;  3P4R B;  1N61 A;  3AE2 B;  2H88 B;  3NS1 A;  1CJE A;  1DOI A;  1L6U A;  2WQY B;  1DOX A;  3NVV A;  2PVG C;  1JAL A;  1ZP0 B;  2QIE B;  3AEB B;  1J7B A;  1VDV A;  1YJI A;  1NI3 A;  1FXI A;  1L0V B;  1N60 A;  2QJL A;  3AN1 A;  1T3Q A;  3HVZ A;  5EE9 A;  1JQ4 A;  1RFK A;  1GAQ B;  2WDR B;  2W55 A;  1AYF A;  1NEK B;  4HRO A;  1OQR A;  4WWM A;  2WS3 B;  1NYQ A;  4HRS A;  1L5P A;  1J7A A;  1VLB A;  1ROE A;  1A70 A;  3VR8 B;  1IUE A;  1CZP A;  3PO0 A;  3AEC B;  3RPF C;  1L6V A;  1TKE A;  5GXG B;  1J7C A;  2MH7 A;  5H8Y E;  3CWI A;  1QOF A;  2MJE A;  3AE7 B;  3P4S B;  2N0S B;  3ETR A;  4IDI A;  1I7H A;  1XLN A;  2L52 A;  1EWY C;  3W5U B;  1SIJ A;  3W5V B;  2BT6 A;  3AEE B;  3B2G A;  3AE3 B;  3WCQ A;  1QOB A;  3AEA B;  1ZUD 2;  2FBW B;  1QOG A;  2LEK A;  1SB3 C;  1FRR A;  2B76 B;  1DOY A;  1TKY A;  5G5G A;  4JWS C;  1OQQ A;  4N58 A;  2PKO A;  3SR6 A;  2PIA A;  1E7P B;  4N6E B;  3AH7 A;  1V97 A;  3EUB 2;  1TKG A;  3KWL A;  4JWU C;  4YSX B;  1FFV A;  1XLQ A;  2W3R A;  1NYR A;  1F0Z A;  3HRD D;  3NVY A;  1YQ3 B;  5AUK A;  1FXA A;  1FRD A;  2JX5 A;  1QF6 A;  2PVO D;  2EKI A;  3NVZ A;  1QLB B;  3AEG B;  3LB8 C;  1WWT A;  3VRA B;  3AMZ A;  4FXC A;  3P1M A;  1E0Z A;  1TYG B;  3AB5 A;  3AV8 A;  1YJJ A;  4YTN B;  2M56 B;  4YT0 B;  1N63 A;  1V8C A;  1XLO A;  1PFD A;  4YSZ B;  2DWQ A;  3AE4 B;  2JQR B;  4WQM A;  2MJ3 A;  2WP9 B;  2KMM A;  1JRO A;  2OHF A;  4YTM B;  2CJN A;  3SFE B;  1ZOY B;  3L4P A;  4US8 A;  1KF6 B;  1UWM A;  1WXQ A;  1XO3 A;  1WGK A;  3AE1 B;  2CJO A;  1JWA D;  5EE1 A;  5C3J B;  1FFU A;  2WLB A;  1E6E B;  4JX1 C;  2WDV B;  1WYG A;  2WU2 B;  1JWB D;  3SFD B;  3W9C B;  2K9X A;  4KX6 B; 
#chains in the Genus database with same CATH topology
 1FCL A;  2ZW0 A;  1V1O A;  2VZK D;  5G5H A;  5G2N A;  4M0W B;  1D4B A;  4DHZ B;  5D94 A;  1F77 A;  1IBX B;  1FO4 A;  3AE6 B;  5HI1 A;  1V80 A;  1LXD A;  4HPL B;  3O13 A;  4KGT A;  2KHW B;  2DX5 B;  4XE0 A;  2N1W A;  4A6Q A;  3NVW A;  3T3O A;  2C7N B;  2DAJ A;  3UIN B;  1RYJ A;  1EM7 A;  3DHI C;  1P0R A;  1PUT A;  3B9J A;  4HLE A;  4ARC A;  4DDI D;  2QCZ A;  2LGY A;  2D2Q A;  3DVG Y;  3BVG A;  3ZTD A;  2BBC A;  3AN1 A;  1TS3 A;  1GAQ B;  2SEB D;  4MM3 B;  2WXO A;  2JUO A;  3M3J A;  1TZO A;  2N9P C;  2V3N A;  2EMS A;  3T8M A;  4KV2 A;  3CWI A;  4FHJ A;  3KVF B;  2RDB C;  3ECI A;  3R2I A;  2KDI A;  1WYW B;  2DNF A;  4RFB A;  2N1V A;  1WE6 A;  3I9V 1;  2XEW A;  2RPV A;  3L10 B;  4FLH A;  2KLG A;  1Q10 A;  1OEY J;  3T3N A;  4W9H A;  4YT0 B;  4HK2 A;  4A20 A;  2CJN A;  1V9J A;  1LFD A;  2LRW A;  5HFY A;  4IUM B;  2J0J A;  5HKH A;  3NUH B;  3VQI A;  2ONQ A;  2MA9 B;  4L2Y A;  1ZGU B;  3EA6 A;  3IAS 1;  4YXD B;  3AED B;  3AE9 B;  2M19 A;  3LJ3 A;  1MHX A;  5AZH A;  1SEB D;  2WXM A;  5BMH A;  2L05 A;  3CST A;  1WF9 A;  3DCG A;  3QHT A;  2KJR A;  1UUP A;  2KX3 A;  2MRP A;  2KDE B;  4C4V B;  4N59 A;  1R4M I;  2BWE S;  4CYE A;  1AN8 A;  4B95 A;  1CMX B;  4XZ4 A;  4IKG A;  3WIM A;  1JWU D;  1QQR A;  2YLM A;  3RN9 C;  5DPW A;  4HRO A;  2WS3 B;  2KAC A;  4RNA A;  1J7A A;  3VUX A;  2NR2 A;  1QOF A;  3VH4 B;  2N0S B;  2R61 A;  1L7Y A;  3JYU A;  3DVG X;  2RMM A;  1L4Z B;  1K53 A;  2FID A;  3AH7 A;  3NY5 A;  1ZE3 D;  2FCQ A;  3NVY A;  1YQ3 B;  5AUK A;  1K52 A;  4JIO U;  3ZRF A;  3SU8 X;  4G50 A;  1TYG B;  2KMA A;  1YJJ A;  2N7D A;  4YTN B;  3N9Y C;  1N63 A;  2I1K A;  2IBI B;  2WXP A;  3Q8A A;  3PGE A;  2KAN A;  2PTL A;  3N3K B;  3SFE B;  2GBM A;  3IXS A;  2KWC A;  3GE3 C;  1WXA A;  1XO3 A;  2WXN A;  4PS7 A;  4JL9 A;  2FUH B;  2WLB A;  3Q3O C;  1JWB D;  2KOX A;  5BMG A;  1WX9 A;  1DGJ A;  2D5G A;  1FNW A;  3S2A A;  3FAH A;  3ZDM C;  4ARI A;  1F2R C;  2INN E;  2SAK A;  4BVU C;  5DPS A;  2GMI C;  5I4D A;  1J0G A;  1T6B X;  4HWI B;  2DBY A;  3BII D;  2KYW A;  3A33 B;  4GDL A;  2K25 A;  4WH4 A;  4AWJ A;  1FXT B;  1TS2 A;  3IT6 B;  2I38 A;  3ZYY X;  2IO1 B;  1WXM A;  3TSS A;  3PRM B;  1V5O A;  4RGO S;  3ZKJ C;  4URK A;  3NZS A;  2JXX A;  1RRB A;  2MP2 B;  4XGA B;  4K7W A;  3I63 C;  4II3 B;  1MFW A;  1K50 A;  4BKS D;  3ZRC A;  2G9H D;  1UWX A;  1DOX A;  3SHQ A;  1RLF A;  2PVG C;  3H7P B;  1UZX B;  3ZUN A;  2K8B A;  1VZ6 A;  1UGJ A;  4W9F A;  4HRS A;  1L5P A;  2C5L C;  4KSK C;  1VD2 A;  3IBE A;  1SIJ A;  4NQL B;  3B2G A;  2Y5B B;  4YWG G;  2RDG A;  3R66 C;  1YIW A;  3DHG C;  3AXC A;  2JRH A;  5FKA C;  1ZDV A;  2KXJ A;  4F1S A;  3HRD D;  3APC A;  4LK0 M;  5D3D A;  1VZ8 A;  3MC8 A;  4K3C A;  2MQJ A;  4AQ7 A;  1K8R B;  1HZ6 A;  2MX2 A;  1PFD A;  2OED A;  1FCC C;  1I4X A;  4WQM A;  3I5J C;  3O65 B;  5IOI A;  4S17 A;  2BQQ A;  4XDC A;  4ZDV A;  3PT2 B;  4MJS A;  2OJR A;  3MC9 A;  1T0Q C;  4C7Z A;  4YSY B;  1N5X A;  2M8S A;  3H6N A;  4IW0 A;  2NMQ A;  4HKZ E;  4BOS C;  1WE7 A;  1QT9 A;  1N62 A;  4FUL A;  3FKY A;  1WJU A;  1KFY B;  3A9K A;  4MGY E;  2LMC A;  2W3S A;  1WJ6 A;  1NDD A;  3ZVV A;  4M02 A;  2X38 A;  4B0M A;  1E8Y A;  2PW9 A;  4OZA A;  1I4Q A;  2Y3A A;  4LTU A;  3TEY A;  1TY0 A;  2E3T A;  3P63 A;  2G3Q B;  2L3Z A;  4KVG B;  3RFZ B;  2WGS A;  2FUG 1;  1GC6 A;  2IO3 B;  3TEW A;  1TT5 B;  3AE2 B;  2CS4 A;  1DOI A;  1ZDX A;  1ISN A;  1JAL A;  3AEB B;  2QIE B;  1VDV A;  2QJL A;  4GN1 A;  3N1Z C;  4WWM A;  3UGB B;  2PMV A;  3RT3 B;  2W82 A;  3KYC D;  1HEZ E;  2DZJ A;  1D6E C;  3RZW C;  5H8Y E;  3BVM A;  2AQ2 B;  2BYT A;  2D3G A;  3QIJ A;  5D7G A;  2WNM A;  1XXG A;  1SB3 C;  4WIP A;  4NZL B;  1OQQ A;  4N58 A;  4WJN A;  2PE9 A;  2XN9 C;  1V97 A;  2CR5 A;  1HE8 A;  4I6N B;  1QF6 A;  4O1N A;  4OW0 A;  3P1M A;  3Q3M C;  4WWO A;  2INP E;  2C7H A;  2NPT A;  2FNJ B;  2LFI A;  1V81 A;  3ALB A;  2KMM A;  1H8C A;  3UQB A;  4KDL B;  4HEA 1;  1WXQ A;  5FR3 A;  4A90 A;  1VR9 A;  2NVU I;  2WXL A;  1HZ5 A;  1OQY A;  1D5Z C;  3ABV B;  2LI5 A;  2D10 A;  3LYY A;  1R4N I;  5FK9 C;  1SJE D;  1V5T A;  1P7F A;  3RMK C;  2GOW A;  3VH3 B;  4NJC A;  3BY4 B;  4ZRP A;  1V6E A;  1R7S A;  4P1C C;  2ZCC A;  4WJO A;  1CQV A;  1ZXI A;  5T8I A;  1FNU A;  1KRH A;  2KJH B;  4MSQ B;  2K3U A;  1KH0 A;  3VRB B;  3PRP B;  2YVC A;  1EUV B;  2KC2 A;  2GB1 A;  4A9A A;  2D3A A;  4L1B A;  3PLV A;  3HVD A;  1L6U A;  2O6V B;  1ZP0 B;  4AJY B;  1NI3 A;  1L0V B;  5EE9 A;  1IP9 A;  1T3Q A;  1LQB A;  2XBB C;  3ZQ4 A;  1MI0 A;  2JT4 B;  2KFJ A;  1F2R I;  5GXG B;  1SE3 A;  3P4S B;  3ETR A;  1TS4 A;  1S3S G;  2KTR A;  4KGS A;  1ZUD 2;  3U4E G;  1V49 A;  2Z59 B;  2JZP A;  3RNF C;  3SR6 A;  2VRR B;  4PK1 A;  1P3Q U;  2DZM A;  4GDK A;  1F0Z A;  1S1Q B;  2C9W B;  2PVO D;  4LDT B;  3AV8 A;  1JML A;  4W9I A;  5DPR A;  3J9C A;  1T0S C;  2QMT A;  3AE4 B;  1T0Y A;  3N1Y C;  4TUU A;  3N30 A;  2MLB A;  3VUY A;  4F7Z A;  4EZJ A;  2I1J A;  5C3J B;  1I35 A;  4AJW A;  1E9M A;  1YOV B;  4DWF A;  2LJI A;  2KJ6 A;  1E7V A;  3V61 A;  2WXR A;  4M8M A;  1M94 A;  4JLC A;  2H89 B;  3R2T A;  2W9N A;  1HTO A;  2Y5C A;  1KJT A;  1XEE A;  2V3S A;  2EKE C;  3FIL B;  1OFF A;  3DWG C;  2G1E A;  2K5P A;  1T0R C;  3MHZ A;  3WAM A;  1SIF A;  5MPO A;  1UEL A;  1AAR A;  1YQ4 B;  1IGC A;  4GDL B;  2ZPN A;  4W9J A;  5D3I B;  1MJD A;  3RNA C;  4LJO B;  1ENF A;  4RCO A;  3QAQ A;  2UU7 A;  3VTU A;  2IGH A;  3EEC A;  2XK5 B;  3M95 A;  1WR6 E;  5J17 A;  4A3O A;  3QAR A;  1AYF A;  2LRU A;  3VXW A;  1RFA A;  1EWY C;  2J7Q B;  2KMC A;  3DQV A;  5KHQ A;  3RUI B;  2KX0 A;  1P7E A;  1E7P B;  3IG3 A;  2KDF B;  2BYE A;  3B1L X;  4HDO A;  2JX5 A;  1YN4 A;  2DYO A;  4NNJ B;  2K39 A;  5CX3 A;  1VZ7 A;  2MW5 A;  1R4M B;  2J0K A;  1STE A;  2GBJ A;  4MT5 A;  4TSS A;  2MJ3 A;  3V60 A;  4BKS A;  1KF6 B;  2KDM A;  3TL5 A;  1JWA D;  3OAW A;  2WDV B;  2J53 A;  1I4P A;  2IY1 B;  3ZNZ B;  3U7D A;  3AUL A;  4R3D A;  4UDU C;  4WJQ A;  1B1Z A;  3W1Y A;  1GPX A;  2LXA A;  2JZ3 B;  4D2K A;  4EEW A;  1MG4 A;  2NBU A;  3OJ3 A;  3VAW A;  4F8C B;  4P6V F;  4KSL C;  1WMH B;  5DPT A;  1NVI D;  2LHE A;  4BBN C;  4GGQ A;  3A9K B;  1HXY D;  4PS3 A;  3W2D A;  2AX5 A;  4ANX A;  2BS2 B;  1MVK A;  1PGA A;  2KN4 A;  2LUE A;  3R7R A;  2LVO A;  1JRP A;  1QOA A;  3UIO B;  2O2V A;  1TGZ B;  2X8X X;  1UBI A;  3Q3F A;  4MGK E;  4NQK E;  2JPH A;  4ZHP A;  1N61 A;  4W9K A;  2ZNV C;  2RD0 A;  4NAW A;  1FXI A;  1LO5 D;  4WAA A;  3A4R A;  1MPE A;  3HK0 A;  4IWO A;  4ANW A;  5JZE B;  3N20 C;  5BYR A;  4JGH B;  4HCP B;  3W5U B;  1RAX A;  2WYQ A;  4XC2 A;  1XCQ L;  2PKO A;  5C1Z A;  3D32 A;  3PSE B;  1FRD A;  1ZPS A;  1BML C;  4XYC A;  2KNB A;  3AMZ A;  3AB5 A;  4A3P A;  2A5U A;  1P98 A;  2HD5 B;  2KVR A;  1OEY A;  4AUQ C;  1EU4 A;  1Z2M A;  2AEH A;  2AL6 A;  1ZW7 A;  2MBE A;  4M00 A;  1TY2 A;  1UWM A;  2KO3 A;  5EE1 A;  2IO2 B;  5J18 A;  2ZVN A;  1WYG A;  3RNB C;  4GLS C;  2L0F A;  4KX6 B;  3DVN U;  5BYS A;  5EE0 A;  4IWP A;  4K1R B;  1RWS A;  3AE5 B;  1E7U A;  2HTH A;  2KZR A;  2Y5P A;  1WIA A;  3OJ4 B;  4C80 A;  3NJT A;  2JZZ A;  3A1Q A;  2AWT A;  1YJ1 A;  2NBV B;  3MTN B;  2MBH A;  4HXD A;  5E6N A;  3EGR A;  3KWV A;  3M62 B;  3ZO5 B;  4YL8 A;  3VDZ A;  3IAM 1;  2HDE A;  4WWP A;  4IM3 A;  5CHW A;  1N5W A;  1C3T A;  4TQ0 A;  3EFU A;  2BS4 B;  3V05 A;  4JE3 B;  1WXS A;  4OZC A;  4RGT A;  1J8C A;  4H2A A;  2MBO A;  1VRA B;  2JY6 A;  4NAM A;  1WY8 A;  2A4Z A;  2EMT A;  2AL3 A;  5CTR C;  1VCB A;  3UQA A;  4PYU A;  4G3X B;  2KWD A;  2LXC A;  2J4X A;  3VR8 B;  3AEC B;  1L6V A;  1UGM A;  4REZ A;  2MJE A;  4W9D A;  4RH6 A;  4L23 A;  1T5X D;  4CHK A;  3P42 A;  2ZZP B;  2BWF A;  1NYR A;  1JCK B;  1IYF A;  3RNE C;  4GMV A;  1KM7 A;  2M56 B;  2KT7 A;  3KUC B;  1AW7 A;  4P1B C;  4GDK B;  4GIV A;  1EU3 A;  1YD8 U;  2ON8 A;  1WGD A;  4WAF A;  1FFU A;  2KK8 A;  4MSM B;  1NBF C;  5E6P A;  2N7E A;  4IG7 B;  2IDY A;  2K22 A;  3ZTC A;  2MEK A;  2K0P A;  4W9C A;  1V1P A;  1TTN A;  1HA5 A;  4USA A;  1I4H A;  2DHZ A;  2PPH A;  1M4V A;  3B2F A;  3DBH I;  1ET6 A;  2WXI A;  3ZIM A;  2MJD A;  3KUD B;  4KKJ A;  1WSP A;  1KOT A;  4MM3 A;  2KD0 A;  4C7Y A;  2LGX A;  2G4S A;  2ZNV B;  4ZHO A;  3QJZ A;  4BKT A;  2IPK D;  4PYZ A;  4I6L B;  3AEF B;  4II2 B;  2IZV B;  2D3C A;  4S0R A;  2IGG A;  3APD A;  4AOF A;  4ZOH C;  3V6E B;  3VFK A;  3ZJT A;  5C2T B;  1FM0 D;  2IJ0 A;  3R3M A;  2K8H A;  1F9J A;  3LXF A;  3L16 A;  3P4R B;  5CHF A;  1KLG D;  5BMI A;  2I2Y A;  2NBW B;  4KDI C;  4HCN B;  1WFY A;  5TR5 A;  3WCQ A;  4K81 A;  1ACC A;  3R8B A;  1Q5W B;  4KZ0 A;  1R4N B;  2JYT A;  2O6V D;  1TS5 A;  4WWN A;  2R2Q A;  1XLN A;  2V3P A;  1Z5S B;  2RR9 A;  1WX8 A;  4MAC A;  2OJW A;  4BKG A;  2CKH B;  1PQS A;  1LM8 B;  5TSS A;  2WWZ A;  4B6W A;  2W3R A;  4EUT A;  3TCA A;  2HJ8 A;  2Z0E B;  3AEG B;  3VRA B;  4RGM A;  2RGF A;  4BBN F;  2WXF A;  3Q2A C;  3L17 A;  5IAA C;  4LJP B;  2DZI A;  3QK0 A;  4LDT D;  1E8X A;  3JVZ X;  2DZK A;  1SE4 A;  3PTF C;  1EF5 A;  2WU2 B;  4C4V A;  2HJ1 A;  4EZL A;  3W9C B;  2J52 A;  1C76 A;  2OOB B;  5EDS A;  2KWV B;  4BOZ B;  1G6J A;  4AS1 A;  2L83 A;  2GLS A;  2DLB A;  3HIZ A;  4GOC A;  1GC7 A;  1ZXH A;  3AM9 A;  3PVL A;  1A5R A;  2M17 A;  1HTQ A;  1GNU A;  1YN3 A;  2LWP A;  1NI2 A;  3KQ4 A;  3JW0 X;  3URY A;  2QIL A;  4NPN A;  3Q6B A;  2PLP A;  4KIK A;  4RF0 A;  2Z0D B;  3DBL B;  2ZW1 A;  2IY0 B;  1VJK A;  2QDF A;  5BYQ A;  3TEX A;  4PT5 A;  5EE3 A;  2GRI A;  5GMV A;  4EZK A;  3E56 A;  4FN2 A;  3FC4 A;  3PHW B;  4EKU A;  4BZA A;  3A9J A;  4EOY A;  3MC0 B;  3U52 E;  1WH3 A;  2WQY B;  1SE2 A;  2O2V B;  3NRZ A;  1J7B A;  1N60 A;  3NG0 A;  2K1F A;  3GS2 A;  1NEK B;  3TJP A;  3C19 A;  2JWU A;  1I42 A;  5L95 C;  1XCT L;  4NAW B;  4FA6 A;  3BIN A;  4B0E A;  4DHZ E;  2K6Q A;  4EFO A;  2V1Y A;  2N9K A;  4W9E A;  5IA7 A;  3CMM B;  3TEZ A;  2BT6 A;  1I4R A;  2LHD A;  3GZN B;  2B76 B;  1TKY A;  5G5G A;  4N6E B;  4JWU C;  3KH0 A;  5CHV C;  1E90 A;  1FXA A;  2IGD A;  3LB8 C;  2ASQ A;  2FE8 A;  2C7M B;  4FBJ B;  3NOB A;  2WHI A;  4XWW A;  2DWQ A;  1JRO A;  1I4G A;  1ZOY B;  2KLC A;  2G4D B;  3AE1 B;  2LD9 A;  5IO9 A;  2BKR B;  4KGR A;  3BK1 A;  4BAX A;  1UD7 A;  1WZ3 A;  2PEA A;  3ONS A;  2BB6 A;  3DBL I;  4ANU A;  2B3A A;  3MJ5 A;  2MSE D;  5AZF A;  2WDQ B;  4HPM B;  3WAL A;  1MG8 A;  2WXK A;  2WXH A;  3NHE B;  2KKC A;  1TJE A;  4MGI E;  1AWD A;  3AU4 A;  1WM3 A;  3A1Q B;  2PE6 B;  3P4P B;  1RM6 C;  4HPP A;  2ACZ B;  5LXH A;  2TSS A;  3RCZ A;  2GBR A;  3NS8 A;  1K51 A;  1CK1 A;  3H1U A;  2FCS A;  1CJE A;  1Y56 A;  2IYD B;  3GZN I;  3NVV A;  1UH6 A;  3K9O B;  1WGG A;  2KFK A;  1BXT A;  2M1M A;  1P1A A;  2AQ1 B;  2WXJ A;  1YQB A;  1OQR A;  3R7Q A;  4MDK E;  3L13 A;  2V4I B;  1VLB A;  1JWS D;  2KC1 A;  4XWT A;  3SD5 A;  5IP4 D;  2N9E B;  1J7C A;  1WX7 A;  1I7H A;  2D07 B;  3DOW A;  2DYM A;  1X1M A;  4MEM A;  1GUA B;  3BWU D;  2FCN A;  2KQ4 X;  4ZRQ A;  4RMA A;  1GJZ A;  5JHA A;  5E6O A;  4M01 A;  4N9F 4;  4NJ6 A;  5DCN A;  2D3B A;  3NVZ A;  4FXC A;  3DDC B;  2NTT A;  2N9X A;  4FJZ A;  3UI3 A;  4P7I A;  2RDH A;  4ZRK A;  2OHF A;  1WJ4 A;  1YMH E;  2ZCB A;  4EE2 A;  4US8 A;  4MH8 A;  1YNT E;  1L2N A;  2L8J A;  2JU6 X;  4E3C A;  4K7S A;  1FMA D;  3ZNG C;  2WXQ A;  3EFC A;  2N4F A;  5E6J A;  1F1H A;  1SF0 A;  4ICV A;  1TIF A;  4CQN A;  1XQQ A;  1V1P B;  1HQR D;  3ZJV A;  1GG3 A;  2FCM A;  2G45 B;  4FAD A;  1L0Y B;  3CSF A;  1WRI A;  3DPD A;  5LXI B;  4DHJ B;  1YX5 B;  1ESF A;  3BK2 A;  2MBQ A;  4JPS A;  1U4A A;  4MH0 E;  5IN7 A;  3TBL D;  3H8H A;  4BFR A;  3Q3N C;  4MJS B;  3DBR I;  3UIP B;  2H88 B;  3L08 A;  4K7U A;  4TMA B;  2ICI A;  2JYE A;  1IPG A;  1WGY A;  2WDR B;  2BW2 A;  4MGZ E;  2L76 A;  3V62 A;  1ROE A;  1A70 A;  1CZP A;  3BYY B;  3KYD D;  3WAN A;  2J0M A;  1D3Z A;  4IDI A;  1OGW A;  2L52 A;  3W5V B;  2RPQ A;  4IC7 B;  3AE3 B;  5AEK B;  2LEK A;  3HHM A;  4LNK A;  4HVB A;  3PZ8 A;  4JQW C;  1DOY A;  4DXG A;  4P16 A;  2PIA A;  3RI7 C;  4Q2J A;  1D5X C;  1XLQ A;  3GB1 A;  1TZ1 A;  1C77 A;  4G0N B;  4NJ7 A;  1QLB B;  2INC C;  3ZDT A;  4MEL A;  2WX0 A;  1ET9 A;  2DYB A;  4FHK A;  4ZRJ A;  4RM9 A;  3EC8 A;  4CO7 A;  2LZ6 A;  2PJH A;  1E5W A;  2L7R A;  3A4S C;  1SBB B;  2VZK B;  1WGK A;  5L83 A;  4ZRI A;  4K3B A;  3MFG A;  2N9L A;  2BS3 B;  1IGD A;  3U2S C;  2KQ7 A;  3CF6 E;  4ZYS A;  4X57 B;  4ITK A;  2V4L A;  1C79 A;  2R2O A;  3IT4 B;  2LJ5 A;  3IHP C;  4WQO B;  2O6V A;  1V2Y A;  4LNF A;  3GP7 A;  2MWS B;  2BKF A;  1PYW D;  2RSU A;  3DWM A;  2VH1 A;  1BUI C;  3UF8 A;  2J42 A;  2KAJ A;  4DXA B;  4A8X C;  3VHT C;  3W1S A;  2NPT B;  1GB4 A;  1L0X B;  2WX1 A;  2V9H A;  3EHV A;  3RNG C;  2HE7 A;  3P2B A;  4FJY A;  3BZD B;  1WRD B;  2LUM A;  2Z8L A;  5HG2 A;  2QEJ C;  3I3T B;  4KIK B;  3RZF A;  1ZKH A;  1E8Z A;  1UF0 A;  2UYZ B;  4RGN A;  4AP4 C;  1YJI A;  3TUO A;  4XX5 A;  3QWZ B;  3L0W B;  4J3O D;  4DQO C;  4KZC A;  3A9J B;  3Q14 C;  4FJV B;  3V3X A;  1NYQ A;  3WAP A;  2VH2 A;  4B9K A;  4OZB A;  1Q1O A;  4W9G A;  1JWM D;  3DBH B;  3MHS D;  4HDQ A;  1J19 A;  1QOB A;  1OTR B;  1FRR A;  4RF1 A;  1WXV A;  2N7J A;  3DBS A;  4YSX B;  3NZ3 A;  1WZ0 A;  1TBE A;  3N32 A;  3FIL A;  4C56 C;  4IM0 A;  2BYF A;  1C4C A;  1XF5 L;  1LGR A;  5JH5 C;  1XLO A;  3PZ7 A;  3ML8 A;  2JQR B;  3JSV A;  4LNI A;  2LVP A;  1WGR A;  5JHB A;  1E6E B;  4M0W A;  2MBB B;  3SFD B;  3U30 A;  2K9X A;  2Q5W D;  2KTR B;  1IBX A;  3I57 A;  4G11 A;  5H92 C;  2XK5 A;  1FD6 A;  1FPY A;  3C0R B;  4LCD E;  3Q8E A;  4OHJ A;  2M4N A;  4YTP B;  1BT0 A;  3X23 A;  1EWC A;  3Q8F A;  2ZVO A;  1E10 A;  3RNC C;  1YN5 A;  4KKI A;  3KUZ A;  3P4Q B;  2XNA C;  2JXT A;  3L54 A;  3WA0 A;  3HM6 X;  1C4P A;  2E6X A;  2CHZ A;  1B9R A;  4TV3 A;  4DDG D;  2MHJ A;  3TMP B;  4GB9 A;  1N6Z A;  1XLP A;  3NS1 A;  2CHW A;  3ML9 A;  3DVN V;  4HJK A;  3SEB A;  2K8C A;  2FAZ A;  3W1S C;  4WJP A;  2KFK B;  3GE8 C;  2DAF A;  5D6J B;  1XD3 B;  3ZW3 A;  4NY0 A;  4LNO A;  2YEP B;  4TQ1 A;  1PGB A;  3AEA B;  2FBW B;  4DBG A;  1KTK A;  1YX6 B;  4JWS C;  4XDD A;  3PHX B;  1GOZ A;  3LDZ E;  1WMH A;  3NZU A;  4TKN A;  2EKI A;  2LGS A;  2ZJD A;  1E0Z A;  2LGD A;  3C8Y A;  3T9L A;  2V0G A;  1C78 A;  4YTM B;  2WP9 B;  3U7Z A;  2BF8 B;  4OVZ A;  2L0T A;  4ANV A;  2JSV X;  3QCA A;  3BYT B;  3VVW B;  3N1X C;  1C9F A;  4HJG E;  1SE9 A;  2QC8 A;  4QAY A;  3HM3 A;  1P9D U;  5AZG A;  3ZNH B;  1C4A A;  4PS8 A;  3OWE B;  3ZNI D;  1WGH A;  4WUR A;  2M0A A;  1NEN B;  3E9S A;  2CU3 A;  2ZEQ A;  1Y8R C;  1UNS A;  2L00 B;  2BGF A;  3H9D A;  3HUI A;  2W54 A;  3PZD A;  4US9 A;  4W9L A;  2JF5 A;  1UBQ A;  4LLG M;  4M8N A;  3CIR B;  1Q0W B;  1JW9 D;  3Q3J A;  2CU1 A;  5HHD G;  1L4D B;  3X0W A;  2AQ3 B;  3TIX A;  5IKC M;  5G55 A;  5BO4 B;  2NS5 A;  3QA8 A;  3AE8 B;  2EEL A;  2GBK A;  3WAO A;  2YEP F;  3SDL C;  4ASW C;  4LNN A;  4GXB A;  4A55 A;  2W55 A;  1SGH A;  3OG5 A;  3PV1 A;  2NCN A;  2KVZ A;  4ICU A;  4J6I A;  4IWQ A;  5FR6 A;  1IUE A;  3RD2 A;  1PGX A;  3RYT A;  3PO0 A;  3PPA A;  3RPF C;  4GSW A;  2UWQ A;  3AE7 B;  2LAS A;  3VUW A;  1XT9 B;  1WR1 A;  1QKZ A;  4OVU A;  3IVF A;  3B08 A;  1GB1 A;  1E8W A;  3AI5 A;  3PS6 A;  2C60 A;  3EUB 2;  1V86 A;  4I6P A;  3DHH C;  2JVC A;  1EF1 A;  1QZE A;  2L32 A;  3APF A;  4C00 A;  1WM2 A;  4GU2 A;  2BVC A;  2LVQ A;  4OVV A;  1SSN A;  4YSZ B;  2QSD A;  4ACF A;  1QIL A;  2GI9 A;  2BPS A;  3L4P A;  2GBN A;  3Q8C A;  2CJO A;  3IFW B;  1JRU A;  3VTV A;  1MHH E;  2KWU B;  2KTF A;  2BYV E;  2JRI B;  4E71 A;  3B0A A;  5JXV A;  2REX A;  1FNV A;  3RUL A;  3AU5 A;  1FIQ A;  3ZJU A;  2MCN B;  3ZXR A;  2BB5 A;  3ZGZ A;  3VR9 B;  3ZLZ A;  2M0X A;  2MP2 A;  4HKQ A;  1WI0 A;  2K6D B;  2WU5 B;  5AUI A;  2IND C;  2HTM E;  2QHO A;  5LLI A;  3Q69 A;  1PDX A;  3PLU A;  1WJN A;  5LNK 1;  2L1A A;  1FEH A;  3ZXV A;  3GOE A;  3H7P A;  2WXG A;  3OLM D;  1SJH D;  1D5M C;  2NTS A;  4DHJ D;  1F52 A;  1DYQ A;  1H4R A;  2IO0 B;  1EO6 A;  3HVZ A;  3VTW A;  1JQ4 A;  2AYO B;  2DEN B;  2WDT B;  3U8Z A;  4ZYN A;  1RFK A;  3M63 B;  3KW5 B;  4IM2 A;  3PRE A;  4RM8 A;  1TKE A;  2MH7 A;  5KHO A;  2KN5 A;  2ZPY A;  3ENE A;  2BTE A;  3Q8B A;  1C1Y B;  4IOI E;  2FIF A;  3AEE B;  1KLV A;  1QOG A;  1KLU D;  3K9P B;  2CHX A;  3KWL A;  1TKG A;  3MJW A;  1FFV A;  2KDB A;  3KLS X;  5D2M B;  3QX1 A;  3BVZ A;  3MP9 A;  1WWT A;  2D11 A;  3H7S A;  2LGI A;  1V8C A;  2JWZ A;  4DK5 A;  5C23 A;  3DBR B;  3QC8 B;  5J2R A;  4E74 A;  1SXT A;  2KQS A;  3PRZ A;  4JX1 C;  3V6C B;  4DXF A;  3JSV B;  3QQ8 B; 
#chains in the Genus database with same CATH homology
 2BS3 B;  1IGD A;  1D5Z C;  2IDY A;  2K22 A;  3U2S C;  1FCL A;  3ABV B;  2ZW0 A;  2MEK A;  4ZYS A;  4ITK A;  2K0P A;  1V1O A;  1V1P A;  1C79 A;  2VZK D;  1HA5 A;  3IT4 B;  5G5H A;  4USA A;  3LYY A;  5FK9 C;  1D4B A;  3GP7 A;  1SJE D;  1I4H A;  1P7F A;  1M4V A;  3B2F A;  4NJC A;  1F77 A;  1ET6 A;  2WXI A;  1PYW D;  1IBX B;  2MJD A;  3DWM A;  4KKJ A;  1WSP A;  1BUI C;  4ZRP A;  1FO4 A;  1R7S A;  3AE6 B;  5HI1 A;  4C7Y A;  2J42 A;  2KAJ A;  4ZHO A;  4A8X C;  2IPK D;  3O13 A;  3W1S A;  4KGT A;  1CQV A;  1ZXI A;  5T8I A;  1GB4 A;  1L0X B;  1FNU A;  1KRH A;  3AEF B;  4XE0 A;  2IGG A;  4A6Q A;  3NVW A;  3T3O A;  2K3U A;  3BZD B;  1KH0 A;  4ZOH C;  3VRB B;  3ZJT A;  5C2T B;  2LUM A;  1RYJ A;  1FM0 D;  2IJ0 A;  2Z8L A;  5HG2 A;  2QEJ C;  1EM7 A;  2GB1 A;  4A9A A;  3LXF A;  4L1B A;  1PUT A;  3B9J A;  3P4R B;  4RGN A;  4ARC A;  1KLG D;  5BMI A;  3HVD A;  2I2Y A;  1L6U A;  3BVG A;  1ZP0 B;  2BBC A;  3WCQ A;  1YJI A;  1NI3 A;  3TUO A;  1L0V B;  5EE9 A;  3AN1 A;  1T3Q A;  4J3O D;  4DQO C;  1ACC A;  3R8B A;  1TS3 A;  3ZQ4 A;  1GAQ B;  2SEB D;  3V3X A;  4MM3 B;  1MI0 A;  2WXO A;  1NYQ A;  1TZO A;  2V3N A;  2JYT A;  1F2R I;  5GXG B;  1TS5 A;  4OZB A;  1SE3 A;  3CWI A;  3P4S B;  1JWM D;  3ETR A;  1TS4 A;  1XLN A;  2V3P A;  3R2I A;  4KGS A;  4RFB A;  1QOB A;  4MAC A;  1ZUD 2;  3U4E G;  1FRR A;  4RF1 A;  3I9V 1;  2JZP A;  3SR6 A;  2N7J A;  4YSX B;  5TSS A;  3NZ3 A;  2W3R A;  1F0Z A;  2RPV A;  3FIL A;  2PVO D;  4C56 C;  3AEG B;  3VRA B;  1C4C A;  1Q10 A;  1XF5 L;  4RGM A;  3T3N A;  3AV8 A;  1JML A;  4YT0 B;  2WXF A;  1XLO A;  3J9C A;  3PZ7 A;  2QMT A;  3AE4 B;  2JQR B;  2CJN A;  5HFY A;  5C3J B;  1E6E B;  1SE4 A;  2WU2 B;  4M0W A;  3SFD B;  3W9C B;  2K9X A;  3NUH B;  3VQI A;  2J52 A;  1C76 A;  2ONQ A;  1E9M A;  2Q5W D;  2LJI A;  4L2Y A;  4AS1 A;  1IBX A;  2L83 A;  3I57 A;  2DLB A;  2WXR A;  5H92 C;  2H89 B;  3R2T A;  1FD6 A;  3EA6 A;  1ZXH A;  3IAS 1;  4YXD B;  2Y5C A;  3Q8E A;  4OHJ A;  3AED B;  1XEE A;  3AE9 B;  3AM9 A;  3FIL B;  4YTP B;  1OFF A;  2M19 A;  3DWG C;  2G1E A;  2K5P A;  1MHX A;  1EWC A;  1SEB D;  1YN3 A;  2WXM A;  3MHZ A;  5BMH A;  3Q8F A;  3KQ4 A;  5MPO A;  3URY A;  1E10 A;  2QIL A;  2PLP A;  1YN5 A;  4KKI A;  4RF0 A;  1YQ4 B;  3P4Q B;  1IGC A;  1UUP A;  2ZW1 A;  4GDL B;  1VJK A;  2XNA C;  2JXT A;  5BYQ A;  3TEX A;  1C4P A;  2E6X A;  5D3I B;  4N59 A;  1B9R A;  4PT5 A;  5EE3 A;  2GRI A;  1ENF A;  4RCO A;  3E56 A;  3FC4 A;  1AN8 A;  2IGH A;  1XLP A;  3MC0 B;  3NS1 A;  3U52 E;  4IKG A;  2WQY B;  1SE2 A;  3NRZ A;  1J7B A;  1N60 A;  1JWU D;  1QQR A;  3GS2 A;  4HRO A;  1AYF A;  1NEK B;  2WS3 B;  2KAC A;  4RNA A;  2JWU A;  3SEB A;  1J7A A;  1XCT L;  4NAW B;  4B0E A;  1QOF A;  2N0S B;  2R61 A;  2N9K A;  1EWY C;  2YEP B;  4TQ1 A;  1PGB A;  2RMM A;  3TEZ A;  2BT6 A;  1I4R A;  2LHD A;  3AEA B;  2FBW B;  2B76 B;  1KTK A;  1L4Z B;  1TKY A;  1K53 A;  4JWS C;  4XDD A;  5G5G A;  1P7E A;  1E7P B;  4N6E B;  3AH7 A;  1GOZ A;  4JWU C;  1ZE3 D;  3NVY A;  1YQ3 B;  5AUK A;  1K52 A;  1FXA A;  2JX5 A;  1YN4 A;  2DYO A;  2EKI A;  2IGD A;  3LB8 C;  1VZ7 A;  1E0Z A;  1TYG B;  3C8Y A;  2FE8 A;  1YJJ A;  4YTN B;  3N9Y C;  1N63 A;  2WXP A;  3Q8A A;  4XWW A;  2V0G A;  1C78 A;  1STE A;  4MT5 A;  2DWQ A;  2PTL A;  4TSS A;  2MJ3 A;  2WP9 B;  4YTM B;  1JRO A;  3U7Z A;  1I4G A;  3SFE B;  1ZOY B;  3IXS A;  4OVZ A;  1KF6 B;  2KDM A;  1XO3 A;  2WXN A;  3AE1 B;  1JWA D;  2WLB A;  2WDV B;  2J53 A;  1I4P A;  1JWB D;  5BMG A;  4KGR A;  2JSV X;  3BK1 A;  4R3D A;  4UDU C;  3BYT B;  1GPX A;  1B1Z A;  1C9F A;  1DGJ A;  2D5G A;  4HJG E;  1FNW A;  3FAH A;  4D2K A;  2BB6 A;  1F2R C;  4ARI A;  2INN E;  2SAK A;  1C4A A;  3MJ5 A;  3OWE B;  4P6V F;  4WUR A;  2M0A A;  1NEN B;  3E9S A;  2CU3 A;  2WDQ B;  5I4D A;  1T6B X;  1NVI D;  2DBY A;  1UNS A;  3BII D;  2WXK A;  3HUI A;  2LHE A;  2W54 A;  2WXH A;  4WH4 A;  1TJE A;  4US9 A;  1HXY D;  1TS2 A;  3W2D A;  1AWD A;  3IT6 B;  2AX5 A;  2I38 A;  4LLG M;  3ZYY X;  2BS2 B;  3CIR B;  1MVK A;  1PGA A;  2KN4 A;  1RM6 C;  3P4P B;  3TSS A;  1JW9 D;  4RGO S;  2ACZ B;  2TSS A;  5HHD G;  1JRP A;  1L4D B;  1QOA A;  1K51 A;  2AQ3 B;  1CK1 A;  1K50 A;  3AE8 B;  4ZHP A;  1N61 A;  2G9H D;  1CJE A;  1Y56 A;  1UWX A;  2EEL A;  1DOX A;  3NVV A;  2PVG C;  1FXI A;  1BXT A;  1LO5 D;  2YEP F;  2AQ1 B;  4A55 A;  2WXJ A;  1VZ6 A;  2W55 A;  1OQR A;  1UGJ A;  1MPE A;  2V4I B;  1L5P A;  4HRS A;  1VLB A;  1JWS D;  4XWT A;  1IUE A;  1PGX A;  3PO0 A;  3RPF C;  1J7C A;  3AE7 B;  5BYR A;  1I7H A;  2DYM A;  1SIJ A;  3W5U B;  3B2G A;  1QKZ A;  4YWG G;  3BWU D;  2RDG A;  1GB1 A;  2KQ4 X;  1XCQ L;  2PKO A;  4ZRQ A;  5FKA C;  3EUB 2;  1ZDV A;  3HRD D;  2L32 A;  1FRD A;  1ZPS A;  4LK0 M;  5D3D A;  1VZ8 A;  3NVZ A;  1BML C;  3AMZ A;  4FXC A;  3AB5 A;  4AQ7 A;  2NTT A;  1HZ6 A;  1SSN A;  1PFD A;  4YSZ B;  3UI3 A;  1EU4 A;  2OED A;  2QSD A;  1FCC C;  1I4X A;  2RDH A;  4WQM A;  1QIL A;  2GI9 A;  2OHF A;  1YMH E;  3L4P A;  1TY2 A;  4EE2 A;  4US8 A;  1UWM A;  3Q8C A;  2CJO A;  4MH8 A;  5EE1 A;  1YNT E;  1WYG A;  4XDC A;  4GLS C;  4KX6 B;  2JU6 X;  1MHH E;  5BYS A;  5EE0 A;  4C7Z A;  4YSY B;  1N5X A;  1FMA D;  2NMQ A;  4HKZ E;  1QT9 A;  1RWS A;  3AE5 B;  5JXV A;  1N62 A;  2WXQ A;  5E6J A;  2Y5P A;  1FNV A;  1KFY B;  4C80 A;  2LMC A;  1SF0 A;  2W3S A;  4CQN A;  1FIQ A;  1V1P B;  1HQR D;  3ZJV A;  3ZJU A;  2BB5 A;  3ZGZ A;  3VR9 B;  2X38 A;  1L0Y B;  4B0M A;  3EGR A;  2PW9 A;  3KWV A;  4OZA A;  1I4Q A;  1WRI A;  4HKQ A;  2WU5 B;  3IAM 1;  5AUI A;  2Y3A A;  2HDE A;  4LTU A;  3TEY A;  1TY0 A;  1ESF A;  3BK2 A;  2E3T A;  3P63 A;  4JPS A;  2HTM E;  1N5W A;  3H8H A;  3Q69 A;  3RFZ B;  1PDX A;  4TQ0 A;  5LNK 1;  2L1A A;  1FEH A;  2BS4 B;  3V05 A;  2FUG 1;  2WXG A;  4JE3 B;  1SJH D;  4OZC A;  4RGT A;  1D5M C;  2NTS A;  3TEW A;  4H2A A;  3AE2 B;  1DYQ A;  2H88 B;  1VRA B;  1DOI A;  1ZDX A;  4NAM A;  4TMA B;  2ICI A;  1JAL A;  3AEB B;  2QIE B;  1VDV A;  3HVZ A;  2QJL A;  1JQ4 A;  1RFK A;  2JYE A;  2WDR B;  4WWM A;  2BW2 A;  2PMV A;  2KWD A;  1ROE A;  1A70 A;  2J4X A;  2W82 A;  1CZP A;  3VR8 B;  3BYY B;  1HEZ E;  3AEC B;  1L6V A;  1TKE A;  1D6E C;  2MH7 A;  5H8Y E;  3BVM A;  4REZ A;  2MJE A;  2AQ2 B;  4IDI A;  2BYT A;  5D7G A;  2L52 A;  2WNM A;  2BTE A;  1XXG A;  3Q8B A;  4IOI E;  3W5V B;  3AEE B;  3AE3 B;  4RH6 A;  4L23 A;  1T5X D;  2LEK A;  1QOG A;  1SB3 C;  4WIP A;  3P42 A;  3PZ8 A;  1DOY A;  1KLU D;  4NZL B;  1OQQ A;  4N58 A;  4DXG A;  4P16 A;  2PIA A;  2XN9 C;  3KWL A;  1V97 A;  1TKG A;  4Q2J A;  1D5X C;  1FFV A;  1XLQ A;  3GB1 A;  1NYR A;  1C77 A;  1JCK B;  3KLS X;  1QF6 A;  4O1N A;  3BVZ A;  1QLB B;  3MP9 A;  1WWT A;  4OW0 A;  1ET9 A;  3P1M A;  2LGI A;  2M56 B;  1V8C A;  2INP E;  1AW7 A;  4GDK B;  2LFI A;  1EU3 A;  2ON8 A;  2KMM A;  1SXT A;  4HEA 1;  1SBB B;  1WXQ A;  2VZK B;  4WAF A;  1WGK A;  5FR3 A;  4A90 A;  1VR9 A;  1FFU A;  4JX1 C;  3MFG A;  4DXF A;  2WXL A;  1HZ5 A;  2N9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...