2VRRB

Structure of sumo modified ubc9
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/ligase
molecule keywords SUMO-CONJUGATING ENZYME UBC9
publication title Ubc9 sumoylation regulates SUMO target discrimination.
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2vrrB00
2PEAA 2MW5A 2RR9A 3UQAA 2QHOA 1RRBA 4GIVA 2IYDB 2NVUI 2DHZA 3KUZA 2M17A 4IW0A 2FNJB 3DPDA 2KK8A 4DHZE 2PPHA 1GC7A 2DZIA 2LGXA 3NOBA 2D11A 5IA7A 3QARA 2FCQA 2XEWA 1H8CA 4CYEA 4G0NB 4FA6A 2EMSA 2JXXA 3L54A 5G2NA 2M0XA 3A4SC 5J2RA 2MA9B 2KNBA 3IBEA 3IVFA 3PV1A 1WXAA 1WZ0A 2ZVOA 3L16A 3VUWA 5JH5C 4PS8A 3PLVA 1OQYA 4G11A 3U30A 4XC2A 2JPHA 1V80A 3NY5A 3ML9A 4AOFA 4IM2A 1SE9A 2AWTA 3ZTDA 1NDDA 3DCGA 3HIZA 3R66C 1WE7A 4WJPA 4BKSA 2XK5B 1WGYA 3ENEA 1TTNA 2KD0A 5CTRC 4ZRIA 4M8MA 4GDKB 1XT9B 1F9JA 4KZCA 4AWJA 4HLEA 2IBIB 5HKHA 2C7NB 4DBGA 2N7DA 4I6LB 4DWFA 3RCZA 4BKGA 3KVFB 3CSTA 3TL5A 4KDIC 1VCBA 1J8CA 3Q3FA 1E8YA 3AXCA 4FN2A 1OTRB 1GUAB 3PSEB 1GG3A 2JZZA 4FHJA 4W9IA 2KXJA 4NY0A 4DHZB 4BBNC 3C0RB 4F7ZA 2LJ5A 4ICUA 2KQ7A 2WX0A 2XK5A 4MH0E 4K7SA 1ISNA 3Q3JA 5E6NA 1EO6A 5LXHA 2JRIB 4GDKA 4WWOA 3PT2B 4EEWA 3OAWA 3TJPA 2KLGA 3GZNI 3U7DA 3QC8B 2AYOB 4J6IA 4MSQB 3WAPA 2KMCA 4II3B 1WMHB 2Z0EB 3HK0A 2KQSA 1UD7A 3M95A 4BKSD 1P1AA 2C60A 3SD5A 3ZKJC 4E3CA 4I6NB 3VUYA 4A3PA 1LXDA 3AI5A 3V6CB 1SGHA 4TUUA 3EFUA 1SIFA 1E7VA 3UGBB 2A4ZA 2MBHA 3VTVA 3B0AA 2KJHB 4B95A 3W1SC 4EUTA 3JW0X 1Y8RC 2KN5A 1LFDA 1ZW7A 1WMHA 3QK0A 4W9DA 5LXIB 2G45B 4HWIB 4HXDA 3R7RA 3ZUNA 2DENB 2BPSA 3ZW3A 4KIKB 2WX1A 2N9EB 1Q0WB 1YD8U 4F1SA 3UQBA 4N9F4 4BFRA 1V6EA 2D10A 1WXMA 2LXCA 1H4RA 3GOEA 3KYCD 4PYUA 4BKTA 3AU4A 1A5RA 2IO0B 2J0MA 1Q5WB 3LDZE 4NPNA 3RUIB 1V5OA 5JZEB 3QQ8B 3EC8A 4EZLA 3LJ3A 4URKA 3JVZX 4M8NA 2LVOA 3DVGX 5LLIA 3H9DA 2J0KA 3QHTA 2C7HA 2KX0A 4KIKA 4PS7A 3L08A 4A20A 2IY1B 3CMMB 3APDA 4MGKE 2NBUA 4MGZE 5D94A 1J19A 3ZDTA 1I42A 2CKHB 4W9HA 3VXWA 5DPSA 1GJZA 2BWFA 2LI5A 3ECIA 3N30A 2AL3A 2FIDA 3PRPB 3VHTC 1GC6A 4FLHA 2KFKB 2M4NA 2KWVB 1WJ4A 1RAXA 2KDFB 2MLBA 1YX5B 2RSUA 4MDKE 4NQKE 4ZRJA 4RM9A 1TGZB 3A9KB 1WGDA 3TMPB 4WAAA 3VVWB 4W9KA 1P0RA 2ZVNA 4B6WA 1WJNA 1RFAA 2LVPA 3V6EB 1UELA 4HDOA 1BT0A 4MJSB 4K7UA 3VAWA 1CMXB 4TQ0A 1E8WA 2KJRA 1XQQA 4KV2A 4ANXA 2KFKA 1WE6A 3P2BA 3DBSA 5L95C 3HM3A 3ZIMA 1V86A 2K39A 3ZO5B 2AL6A 1WR6E 1R4MI 4CO7A 4NQLB 4GDLB 2UWQA 3A9KA 3DVGY 3PTFC 5JHAA 1PQSA 2G3QB 4EOYA 2I1KA 1ZKHA 3A33B 3L13A 3DVNU 1U4AA 2JF5A 2ZPYA 4PS3A 4FJZA 2IZVB 4MJSA 4P7IA 3QAQA 2YLMA 1EUVB 1WX8A 2Y5BB 3WIMA 2LZ6A 4GB9A 3R3MA 2MBEA 3M62B 2GBKA 3DQVA 1Q1OA 4OVVA 2BKRB 2KDIA 2LRUA 3K9PB 1R4NI 4K1RB 4K7WA 4GDLA 5DPTA 4BBNF 3PS6A 1I35A 2KTFA 2KLCA 3WANA 1WXSA 3ZLZA 2MCNB 2J0JA 4W9JA 2ZCBA 1WRDB 3RT3B 4KDLB 3A9JB 1AARA 2DZJA 4TQ1A 2GBRA 4BOSC 2BGFA 4EZJA 2WWZA 4GGQA 3KUCB 1NBFC 3B1LX 3MHSD 2JT4B 2NBWB 2DX5B 2RGFA 4HPLB 2JWZA 3ML8A 4B9KA 2V3SA 3PHXB 2PE9A 3TCAA 1KLVA 2AEHA 3APFA 2XBBC 3D32A 3DOWA 4E71A 2LASA 4LDTB 4ANVA 1V5TA 1K8RB 1E8XA 3U8ZA 3UF8A 1X1MA 2KDEB 2NCNA 3A9JA 2BYVE 2LD9A 4JIOU 3K9OB 2GBJA 5KHQA 4JQWC 1GNUA 2ZPNA 1WXVA 3QX1A 5TR5A 1L2NA 4I6PA 4KVGB 4W9CA 4ANUA 4W9EA 1E7UA 1LM8B 4DK5A 1EF5A 1FXTB 1WFYA 3BY4B 1OEYA 4GU2A 4MEMA 3ZTCA 3NS8A 5BO4B 3ZDMC 3QA8A 3QWZB 3SHQA 2JY6A 3OLMD 2IO2B 2KHWB 2LRWA 4JL9A 4FHKA 2CU1A 5DPRA 3QCAA 3M63B 2NBVB 4W9LA 2BWES 1WJUA 4F8CB 2BKFA 5L83A 4RMAA 2C7MB 1V81A 4RM8A 3V60A 2UYZB 4WQOB 1P3QU 4KSKC 1P9DU 3W1SA 2LXAA 3ZRCA 5CX3A 1HE8A 4NAWB 2MRPA 1ZGUB 4BOZB 4ANWA 1V9JA 2ZZPB 1IPGA 2DYMA 3X0WA 3L17A 5AZHA 5D7GA 1VD2A 4XZ4A 2GBMA 4X57B 2HE7A 3CSFA 4WJNA 1E5WA 2I1JA 2K25A 2DYBA 2KO3A 4GSWA 4HDQA 1IYFA 4IC7B 2N4FA 1YX6B 4IUMB 2R2OA 1WIAA 2L0FA 3W1YA 2K1FA 2DAJA 2FAZA 4LCDE 3VH4B 3IG3A 3V62A 4ASWC 5D2MB 5AZGA 2GOWA 2GBNA 4LDTD 4NAWA 2KC1A 5AZFA 1WX9A 3ZVVA 2L3ZA 2MX2A 2LVQA 3WAOA 2N7EA 1WJ6A 1QZEA 3H7PB 3TBLD 2NR2A 3DDCB 2YVCA 1KOTA 3WA0A 2LUEA 4ICVA 2MQJA 2L7RA 2FUHB 4FBJB 2L0TA 2CR5A 4NJ7A 4YL8A 2ZNVC 2B3AA 1S1QB 5DCNA 4KSLC 2D07B 1Z2MA 1WM2A 2L00B 4GOCA 4EZKA 3PRMB 2O6VA 2JZ3B 2FIFA 2V1YA 2MBBB 5IAAC 3PREA 3AULA 2ASQA 2HTHA 3MTNB 3H7PA 2BYEA 1NI2A 3H1UA 2WDTB 5DPWA 2KDBA 2C9WB 2KMAA 3DBHI 3EHVA 4WJQA 2JUOA 2M1MA 4DHJB 1Z5SB 2G4SA 4TKNA 1V2YA 4K81A 4IWOA 1OEYJ 3RD2A 4CHKA 4EKUA 3HM6X 3L10B 2NS5A 3AU5A 1J0GA 5C1ZA 4IWPA 2KOXA 1LQBA 1WY8A 2D2QA 4HVBA 3O65B 2OJRA 5E6PA 3ZNGC 2L05A 1XD3B 1M94A 2J7QB 3PPAA 2ZEQA 3HHMA 3H7SA 4ZYNA 3V61A 2A5UA 1WI0A 1JRUA 4M0WB 1RLFA 5CHVC 2O6VD 4WWNA 3M3JA 3H6NA 5FR6A 3NZUA 3B08A 2MSED 4JGHB 3ZRFA 4DXAB 2MWSB 1T0YA 5G55A 1WR1A 4AP4C 2KX3A 4DDID 2CS4A 2LGYA 3QJZA 3A1QB 1C3TA 1WYWB 1WM3A 2HJ8A 2KWCA 2VRRB 3QIJA 4W9FA 2LGDA 1UH6A 4LJOB 3ZNID 5KHOA 2DZKA 3KW5B 3VFKA 2LWPA 4KZ0A 1TZ1A 4MGYE 3DBLI 3T9LA 2KANA 4IM0A 5D6JB 3PLUA 4G3XB 3VH3B 1WGHA 4LJPB 4OVUA 5C23A 3VTUA 1L7YA 2FCNA 3RZWC 4MELA 1YJ1A 4E74A 3A1QA 2K8BA 2O2VB 4DHJD 3PGEA 2N1WA 4AJWA 4DDGD 1TBEA 4IWQA 4GMVA 1KJTA 3SU8X 4MSMB 2CHXA 2GMIC 3RYTA 4JLCA 4AJYB 1WF9A 2ZJDA 2BYFA 3PHWB 2JVCA 2KJ6A 1D3ZA 4GN1A 5CHWA 1MG8A 1WZ3A 3IFWB 3UINB 3ZNHB 1E8ZA 2DYOA 2IO3B 3DBRI 4NNJB 2NPTB 2G4DB 4HJKA 2KKCA 1E90A 4AUQC 2KFJA 4GXBA 2KTRB 2MBOA 2WYQA 4HCNB 4EFOA 5AEKB 3PVLA 4IG7B 2K8CA 3PZDA 2O2VA 5CHFA 4HK2A 3SDLC 3IHPC 5E6OA 3VTWA 4HCPB 1V49A 1WGRA 1YIWA 3RULA 2Z0DB 4FULA 2CHWA 2DZMA 4II2B 2FCSA 1C1YB 2L76A 3APCA 4ZRKA 2W9NA 2Z59B 1WX7A 4G50A 2NPTA 2K6QA 1KM7A 1S3SG 3OJ4B 3DVNV 2KTRA 2KVRA 2IY0B 2MBQA 4FJVB 3WALA 4FADA 3NZSA 3JSVB 2FCMA 2HD5B 4WWPA 5JHBA 1EF1A 1UBQA 1YQBA 2N9XA 3NHEB 2EMTA 2O6VB 3N3KB 2MP2B 3JYUA 4PYZA 3WAMA 4ZDVA 5EDSA 2K8HA 3KUDB 2L8JA 2PE6B 2JRHA 3VQIA 2IO1B 2N1VA 2RD0A 4BVUC 1WGGA 1UBIA 2N9PC 3L0WB 2RPQA 4W9GA 2ZNVB 2CHZA 5GMVA 2D3GA 2DAFA 4TV3A 3N32A 2K6DB 3MJWA 3EECA 3A4RA 4WJOA 2KZRA 2ZCCA 2R2QA 2M8SA 3KYDD 3JSVA 3T8MA 1UZXB 2EKEC 2KC2A 1P98A 3PRZA 3UIPB 2BF8B 2MP2A 3VUXA 3RZFA 3ALBA 4XX5A 3I3TB 2PJHA 3R7QA 4A3OA 2REXA 3BINA 1IP9A 1OGWA 2OOBB 4MM3A 3S2AA 3TIXA 3UIOB 3ZNZB 4FJYA 1UGMA 3CF6E 3OJ3A 2KWUB 2V4LA 4HPMB 5J17A 4NJ6A 5J18A 3KH0A 1WH3A 1G6JA 3ONSA 4MGIE 3X23A 3VDZA 4IM3A 2C5LC
chains in the Genus database with same CATH superfamily
2MW5A 4GIVA 1DOYA 2NVUI 3KUZA 2M17A 1T0SC 2KK8A 3NOBA 2DZIA 2FCQA 4XDDA 4RF0A 2EMSA 2QCZA 2BVCA 4RGNA 2KNBA 3IBEA 5IOIA 4TMAB 3PLVA 4G11A 3TUOA 4RGOS 1V80A 3NY5A 3ZTDA 1B9RA 2W3SA 1NDDA 4WJPA 1N5WA 3ENEA 2FBWB 4M8MA 1XT9B 1VR9A 5HKHA 1J7CA 3OWEB 1E8YA 1HQRD 4FHJA 4L23A 5D3IB 4W9IA 4NY0A 3C0RB 4NAMA 2KQ7A 2WX0A 2XK5A 1XLOA 1XCTL 3ZXRA 3PT2B 2NMQA 3OAWA 2YEPB 3QC8B 4MSQB 4II3B 4ZHPA 1UD7A 3M95A 3SD5A 4I6NB 1TKYA 1LXDA 3AI5A 3V6CB 1AWDA 1FIQA 5FK9C 3UGBB 1MHHE 3VTVA 3B0AA 4RNAA 1JWAD 3O13A 3W1SC 3JW0X 1ZW7A 1WMHA 2BPSA 3ZW3A 4PT5A 3WCQA 4F1SA 2D10A 2LXCA 3IAM1 2LMCA 2J0MA 1LGRA 3RUIB 3VR8B 3EC8A 2BT6A 4URKA 3NVVA 1SBBB 5IP4D 2CU3A 4M8NA 3NVYA 5LLIA 4PS7A 2C7HA 1ZDXA 4P1CC 1VZ6A 1J19A 3NG0A 1I42A 2CKHB 1RFKA 1ET6A 2LI5A 4N6EB 3ECIA 2D3CA 1ET9A 2AL3A 3PRPB 1GC6A 2KFKB 4NQKE 1YX5B 5BMHA 4LNNA 3A9KB 2WDRB 3VVWB 1P0RA 4N58A 1UELA 3VAWA 3SR6A 1LO5D 1CMXB 4DXFA 4ANXA 3AEFB 1RYJA 1V8CA 1WE6A 1I4GA 1YMHE 3HM3A 1V1PA 3Q6BA 2K39A 3PTFC 5JHAA 2G3QB 2ICIA 1ZKHA 3L13A 3QAQA 2R61A 1WX8A 2GB1A 1T3QA 3HUIA 1JWSD 2BKRB 2KDIA 2I2YA 1XXGA 2H88B 4GDLA 4BBNF 4ARIA 2INNE 2JYTA 3PS6A 1I35A 3EFCA 1WRDB 4KDLB 3A9JB 1AARA 1RWSA 4TQ1A 1L4DB 1NBFC 3B1LX 3GS2A 2JT4B 3ZJVA 2NBWB 3U2SC 2DX5B 3C8YA 2RGFA 2JWZA 3MFGA 2V3SA 3PHXB 4KKJA 1KLVA 1V5TA 2PLPA 2NCNA 4OZCA 2L52A 1F2RC 3Q14C 4JIOU 4AQ7A 1GNUA 2PIAA 2ZPNA 1UWMA 4ANUA 2X38A 3BY4B 1OEYA 1VDVA 3ZTCA 3NS8A 4USAA 2JY6A 2IO2B 4FHKA 5DPRA 3MC0B 3M63B 1T5XD 1TJEA 2BWES 2C7MB 4RM8A 4WQOB 4BOZB 5HI1A 2MRPA 1ZGUB 1K50A 2ZZPB 1IPGA 2JXTA 5C2TB 1MG4A 4YT0B 2HE7A 4LK0M 2KO3A 1UNSA 2N4FA 2R2OA 3W1YA 2WHIA 2FAZA 5EE3A 3NZ3A 5D2MB 1I4RA 2GOWA 2GBNA 4NAWA 2MX2A 1FNVA 1QOAA 1KOTA 3VRAB 2LUEA 3ETRA 4YL8A 2RDGA 4KSLC 1ZDVA 3FAHA 3DHIC 3AE2B 2JZ3B 3N20C 3AULA 2KDMA 4OZBA 2LGSA 3H7PA 2BYEA 2WLBA 3H1UA 1BMLC 3P4RB 2Q5WD 4DHJB 1L6VA 1JROA 4XE0A 1CZPA 1C4PA 4JX1C 5GXGB 4A90A 5C1ZA 3GB1A 3GZNB 1WY8A 3IXSA 2LEKA 3MC9A 3ZNGC 2L05A 1M94A 2G9HD 1UGJA 3V61A 5LNK1 5BYQA 1NEKB 2RDBC 4JWUC 3M3JA 2HDEA 4NJCA 2MWSB 5I4DA 1JWBD 1WR1A 1ROEA 3BVGA 2CS4A 1DOIA 2OJWA 2HJ8A 3QIJA 4RCOA 2LGDA 3ZNID 3RNCC 3KW5B 3H8HA 1TZ1A 3AV8A 3DBLI 4S17A 2KANA 2WDQB 4G3XB 2FE8A 3VH3B 1V1OA 4OVUA 1L7YA 2GRIA 3A1QA 1VRAB 2QILA 2HJ1A 2N1WA 4MSMB 2UU7A 2NTTA 2CHXA 4AJYB 2ZJDA 4GN1A 1WZ3A 3UINB 1L4ZB 2DYOA 2NPTB 2WXQA 2PTLA 4GXBA 4KKIA 1WGKA 1N62A 1N5XA 2INPE 3PZDA 1YJIA 4HK2A 3IHPC 5E6OA 3HVDA 1KTKA 1V49A 1WGRA 2KVZA 1YQ3B 3V05A 4KX6B 2Z59B 1EU4A 1WX7A 5BMIA 2K6QA 1FXIA 4FADA 2KMMA 3Q8FA 1UBQA 5EDSA 2M56B 3JYUA 4PYZA 2K8HA 1UWXA 1WGGA 1UBIA 3L0WB 2RPQA 2XNAC 1IGDA 3MJWA 2KZRA 3ZJUA 2XN9C 1FRDA 1QLBB 2R2QA 4RFBA 3B9JA 2MP2A 3R2TA 4D2KA 3R7QA 3AE3B 1OQRA 3ZNZB 3S2AA 3TIXA 1UGMA 3OJ3A 2KWUB 2V4LA 4WH4A 3EA6A 5J18A 1WH3A 3ONSA 4MGIE 3X23A 3ZYYX 2NTSA 2C5LC 2LUMA 1CJEA 4EE2A 2QHOA 2WXOA 1SSNA 4IW0A 2FNJB 3DPDA 2ZW1A 2PPHA 1GC7A 2V3PA 2Y5PA 1TY2A 1IUEA 2XEWA 3L4PA 4A9AA 4DXGA 1HXYD 4FA6A 3L54A 3A4SC 5J2RA 3PV1A 4XGAB 3VUWA 5JH5C 1C76A 4ZOHC 2JPHA 3ML9A 4Q2JA 1PUTA 4UDUC 4HROA 1JWUD 3HIZA 1J7AA 3R66C 1WE7A 3FC4A 4BKSA 3U4EG 2D3BA 1GPXA 4GDKB 5HFYA 4AWJA 4HLEA 2C7NB 4BKGA 1I4XA 1VCBA 3Q3FA 3AXCA 1GUAB 1GG3A 2JZZA 2MJ3A 4DHZB 2MHJA 1EU3A 1PGXA 2LJ5A 4ICUA 1KLUD 2KAJA 4K7SA 1ISNA 1C79A 1KRHA 2LGIA 2YEPF 4WWOA 1FCLA 4EEWA 3GZNI 3Q3NC 2AYOB 2QEJC 3WAPA 1Y56A 2Z0EB 4BKSD 1P1AA 3ZKJC 1BXTA 5EE1A 3DHGC 1SIFA 1TKGA 2KWDA 5IO9A 1NVID 4W9DA 2G45B 3Q69A 4HXDA 4YTMB 3Q2AC 5TSSA 2N9EB 1Q0WB 1YD8U 3DBHB 4P6VF 3UQBA 1V6EA 3GOEA 3KYCD 4PYUA 1F2RI 2IO0B 2J4XA 1TIFA 3U52E 1BUIC 1Q5WB 4P1BC 3LDZE 3QQ8B 2G1EA 4EZLA 3QHTA 2BTEA 3L08A 2VH2A 2IY1B 3CMMB 2J42A 4MGKE 2IGGA 2FUG1 3ZDTA 4C4VB 2FIDA 4YTNB 2LJIA 1FEHA 1P7EA 4MDKE 1I4PA 4C80A 3TMPB 4WAAA 3NJTA 4W9KA 3FKYA 4B6WA 1WJNA 2LVPA 3V6EB 4HDOA 1E8WA 2KJRA 4KV2A 4P16A 2KFKA 3DBSA 3I5JC 5L95C 2ACZB 2AL6A 4NQLB 3A9KA 1PQSA 4EOYA 2I1KA 2BB6A 3A33B 2QJLA 2JF5A 4FJZA 2IZVB 2YLMA 3WIMA 2LZ6A 3R3MA 1Q1OA 2JSVX 3TEWA 4WQMA 3AMZA 2LRUA 1L0YB 2KLCA 3ZLZA 2MCNB 2ZCBA 4NZLB 2N9KA 3MHSD 2W54A 1QF6A 1FNWA 2PE9A 3TCAA 1CQVA 3APFA 3DOWA 2LASA 4PK1A 1VJKA 1JQ4A 3A9JA 1P7FA 2BYVE 3K9OB 5KHQA 2MEKA 5TR5A 4I6PA 4W9CA 4XYCA 4HPPA 4DK5A 1EF5A 4H2AA 1KFYB 1TT5B 4M02A 3QWZB 4FXCA 3OLMD 1F0ZA 3BYTB 1AYFA 1MVKA 4JL9A 4YWGG 3QCAA 2NBVB 3AEDB 2WP9B 4F8CB 5L83A 4RMAA 3C19A 1VZ8A 1P3QU 4KSKC 1P9DU 3W1SA 1YN5A 3BK2A 3L17A 5AZHA 2M19A 1VD2A 4XZ4A 2GBMA 3AE4B 2V3NA 2RMMA 1WWTA 4X57B 2I1JA 1IYFA 3AE5B 1WYGA 4WURA 3UI3A 2KACA 4GLSC 4YSYB 3T3NA 2GLSA 1R4MB 3IG3A 3ZVVA 5FKAC 2N7JA 3TBLD 2NR2A 1K51A 2YVCA 1QILA 2ZNVC 2B3AA 1S1QB 3W5UB 2D07B 4M01A 1Z2MA 4EZKA 3B2FA 3AEGB 1K53A 3BVZA 2C9WB 1FD6A 3DBHI 2JQRB 3P1MA 2G4SA 4K81A 4LLGM 4LNFA 1L0XB 5HHDG 2OJRA 3AEAB 5E6PA 4TSSA 3HHMA 3H7SA 2A5UA 2E3TA 4M0WB 1F77A 1JWMD 2TSSA 1T0YA 1UF0A 2KX3A 2Z8LA 1C78A 1C3TA 3NRZA 4LNOA 3I63C 2LHEA 4LJOB 5KHOA 2DZKA 4HRSA 1PFDA 2LWPA 3N9YC 1TY0A 2FCNA 3RZWC 4DHJD 1VZ7A 5EE0A 1KJTA 3SU8X 4A8XC 3RPFC 1WF9A 3I57A 2OHFA 3IFWB 1XEEA 1E8ZA 2IO3B 2KKCA 4B0EA 2K8CA 3SDLC 1FNUA 2Z0DB 2CHWA 2FCSA 1SJED 1ZUD2 2V4IB 2NPTA 1KM7A 2KVRA 4YSZB 2IY0B 2MBQA 2HTME 2FCMA 1C9FA 2WXNA 1YQBA 4BKTA 3MJ5A 3VQIA 2JRHA 1GB1A 2IO1B 2RD0A 4BVUC 4MT5A 3W2DA 3P42A 4K3BA 2ZNVB 4YTPB 2D3GA 2DAFA 4TV3A 3N32A 3RNGC 5H8YE 1RM6C 3T8MA 2EKEC 2KC2A 1P98A 3PRZA 5MPOA 3UIPB 3VUXA 4XX5A 3I3TB 1KF6B 4A3OA 1QOBA 1IP9A 2OOBB 3UIOB 2PVGC 3ZGZA 4L1BA 3BWUD 3VDZA 3Q8EA 2PKOA 5E6JA 2RR9A 2IYDB 2VH1A 4DHZE 2LGXA 1ENFA 3Q3MC 5IA7A 3QARA 1H8CA 4G0NB 3AE6B 3NVWA 1C4CA 3P63A 1WXAA 1WZ0A 5BYSA 3U30A 1OQYA 1PGBA 2IGDA 2D5GA 2LFIA 4RGTA 4IM2A 1OQQA 2AWTA 3DCGA 3DBRB 1TTNA 3TEYA 5CTRC 2WXMA 3W5VB 3NS1A 4KZCA 1K52A 4I6LB 3CSTA 3TL5A 1J8CA 1FM0D 3DWGC 2KXJA 5G5HA 2L83A 1FXAA 1FPYA 3B2GA 5LXHA 4GDKA 2I38A 1TYGB 3TJPA 2KLGA 4J6IA 3J9CA 1HZ6A 3HK0A 4N59A 4E3CA 2MJEA 1NYRA 3VUYA 1SGHA 4TUUA 3EFUA 1E7VA 2A4ZA 2MBHA 4B95A 4EUTA 5LXIB 1LFDA 3QK0A 1VLBA 4BAXA 3R7RA 3ZUNA 4KIKB 3BK1A 4A55A 2W82A 5BYRA 4HKZE 1A5RA 1FRRA 3AU4A 1GB4A 5JZEB 3LJ3A 4HEA1 2LVOA 2L32A 3DVGX 3H9DA 2J0KA 1YN4A 1WRIA 2KQ4X 2N0SB 2NBUA 4OW0A 1HTOA 3VXWA 5DPSA 1GJZA 3AE8B 2BS2B 2IGHA 1WJ4A 2KDFB 2RSUA 3BIID 1PYWD 4DQOC 2JYEA 2ON8A 1TGZB 2ZVNA 3P4SB 1RFAA 4MJSB 1PGAA 4K7UA 4C4VA 4TQ0A 1XQQA 3P2BA 2DNFA 3ZIMA 1V86A 2QIEB 1WR6E 4CO7A 1IGCA 5H92C 4JPSA 3DVNU 1U4AA 2ZPYA 3DHHC 2WXPA 3RMKC 2Y5BB 3M62B 2GBKA 4US9A 1A70A 2BYTA 4OVZA 3E9SA 3HRDD 2DZJA 4EZJA 2WWZA 4GGQA 2K22A 1ZXIA 3KUCB 1STEA 1M4VA 3ML8A 4B9KA 2SAKA 3VRBB 4E71A 4LDTB 5G5GA 1GAQB 2JU6X 3U8ZA 1X1MA 2KDEB 1TS2A 5BMGA 1WXVA 1XLNA 1L2NA 5JXVA 4W9EA 1LM8B 4GU2A 1TS5A 1QKZA 3QA8A 1GOZA 3SHQA 3AN1A 2LRWA 1L0VB 1QOFA 4ZYSA 1WJUA 2X8XX 2BKFA 3RNEC 4C7YA 2UYZB 2WU5B 5T8IA 3ZRCA 1HE8A 2WXJA 2DYMA 1EM7A 5D7GA 3ZJTA 3CSFA 4GSWA 4ACFA 1SE4A 4ARCA 3BVMA 3N1YC 4ASWC 5AZGA 1AN8A 1N63A 2KC1A 3N1ZC 2L3ZA 3WAOA 2LVQA 1QZEA 1C77A 3DDCB 4ICVA 4S0RA 2L7RA 2FUHB 4FBJB 2V9HA 4XDCA 2WXFA 4NJ7A 1E0ZA 1SE3A 3SFDB 2L00B 3PRMB 1DGJA 2FIFA 2V1YA 3CWIA 1I4HA 2KN4A 1KLGD 4REZA 1FFVA 2HTHA 3MTNB 1NI2A 2WDTB 3FILB 2KMAA 2PMVA 3EHVA 2JUOA 2M1MA 1Z5SB 1V2YA 1YOVB 1OEYJ 4EKUA 4IKGA 2NS5A 3AU5A 1J0GA 4IWPA 1LQBA 4YXDB 2D2QA 3O65B 3P4PB 1XD3B 1T0QC 1D5XC 3AM9A 3PPAA 1WI0A 1N61A 1I4QA 1RLFA 4CQNA 4XWTA 3NZUA 2WXGA 4JGHB 3ZRFA 4B0MA 3MHZA 4DDID 3EGRA 3AECB 3QJZA 3U7ZA 1XLQA 2KWCA 2VRRB 4WWMA 2WQYB 4M0WA 3VFKA 4KZ0A 4MGYE 1R7SA 4C56C 2EELA 1I7HA 3T9LA 1MI0A 4IM0A 3PLUA 3IAS1 4LJPB 3VTUA 1MFWA 3KWVA 1YJ1A 4OZAA 2O2VB 3PGEA 1XCQL 3ZQ4A 4AJWA 4IWQA 4GMVA 4WIPA 1NENB 2PVOD 3RYTA 4JLCA 1PDXA 5AUKA 2BYFA 1D3ZA 2KJ6A 5CHWA 2W55A 1MG8A 2BBCA 2G4DB 1JMLA 1E90A 2WXRA 2KFJA 2KTRB 2WYQA 4HCNB 4EFOA 5AEKB 1IBXB 3PVLA 1JALA 4IG7B 1L5PA 3Q8BA 1YIWA 3RULA 2DZMA 3EUB2 1C1YB 3APCA 4ZRKA 3BZDB 2W9NA 3Q8CA 3MC8A 1NYQA 2RDHA 4C7ZA 3DVNV 4HJGE 4FJVB 2MJDA 2ONQA 3NZSA 3JSVB 2HD5B 4WWPA 4XWWA 1EF1A 3NHEB 2EMTA 4ZDVA 3N3KB 5D3DA 1V97A 3PZ8A 2PE6B 2N1VA 5IKCM 2N9PC 4MM3B 5GMVA 3TEZA 3EECA 1MHXA 2IJ0A 2ZCCA 3RN9C 4YSXB 1ESFA 3AE7B 1R4NB 3RZFA 1ZOYB 2V0GA 3RNBC 1OGWA 1WSPA 1N60A 4FJYA 4HPMB 3ZXVA 3KH0A 1G6JA 3W9CB 1HEZE 2WXLA 1XO3A 2BW2A 2PEAA 3RNAC 3UQAA 1RRBA 2DHZA 3DBLB 4QAYA 2D11A 4CYEA 2JXXA 5G2NA 2M0XA 2MA9B 3IVFA 1E9MA 3L16A 2ZVOA 4PS8A 3GP7A 4XC2A 1QQRA 4AOFA 4IOIE 1SE9A 3Q3OC 1D4BA 3AEBB 2XK5B 1WGYA 2WXHA 2KD0A 4ZRIA 3IT6B 1F9JA 2IBIB 4LNKA 4DBGA 2N7DA 1TZOA 4DWFA 1WXQA 3RCZA 3KVFB 4KDIC 4FN2A 1OTRB 3PSEB 3BYYB 4BBNC 3AE1B 4F7ZA 2W3RA 4MH0E 1D5ZC 1E6EB 3Q3JA 5E6NA 1EO6A 2JRIB 2JWUA 1ZXHA 3R8BA 1JCKB 3U7DA 2KMCA 1SF0A 1WMHB 1DOXA 2PW9A 2KQSA 2WXIA 2C60A 4A3PA 2WGSA 2LHDA 2K0PA 1XLPA 2KJHB 1FMAD 1Y8RC 2KN5A 4HWIB 2DENB 4K3CA 3DWMA 2WX1A 1T0RC 4N9F4 1SXTA 4BFRA 1WXMA 1H4RA 5HG2A 4NPNA 2IDYA 4AS1A 1V5OA 1YQ4B 1NI3A 3AE9B 2VZKD 3JVZX 2IPKD 1ZPSA 2CJOA 4KIKA 1YNTE 2KX0A 4LTUA 4A20A 4R3DA 3APDA 1YN3A 2M0AA 4MGZE 5D94A 4W9HA 2BWFA 3N30A 3VHTC 4FLHA 3SFEB 2M4NA 2KWVB 1V1PB 1RAXA 2MLBA 4ZRJA 1SEBD 2QSDA 4RM9A 1QOGA 3Q8AA 4WAFA 1WGDA 4L2YA 2JZPA 1BT0A 4RF1A 2BQQA 1B1ZA 1TKEA 3ZO5B 3VR9B 1R4MI 2E6XA 4GDLB 2UWQA 3DVGY 3R2IA 2AX5A 4PS3A 3N1XC 4MJSA 4P7IA 2L1AA 1EUVB 4GB9A 2MBEA 2WS3B 3LYYA 3DQVA 4OVVA 3KWLA 3HVZA 3K9PB 1R4NI 4K1RB 4K7WA 5DPTA 2KTFA 3WANA 1SJHD 1WXSA 2J0JA 4W9JA 1FO4A 3RT3B 1TS3A 2GBRA 4BOSC 2BGFA 2VZKB 1F52A 3CIRB 2BB5A 4HPLB 3SEBA 4JE3B 2N9LA 1XF5L 2AEHA 2XBBC 3D32A 4ZRPA 3TEXA 3RFZB 4ANVA 3AH7A 1K8RB 1E8XA 1HA5A 3UF8A 2LD9A 2GBJA 4JQWC 3URYA 3QX1A 2SEBD 4KVGB 4M00A 4ZRQA 1E7UA 3P4QB 1FFUA 1E7PB 1FXTB 1WFYA 3NVZA 4MEMA 1DYQA 3AB5A 5BO4B 2QDFA 3ZDMC 2MH7A 2KHWB 1MJDA 4KGSA 2CU1A 5IN7A 4W9LA 4BZAA 2OEDA 1V81A 1C4AA 3V60A 1N6ZA 2LXAA 4ANWA 5CX3A 4NAWB 1V9JA 1HZ5A 1JRPA 3X0WA 1FCCC 2CJNA 2JX5A 4WJNA 1E5WA 2WDVB 2K25A 2DYBA 1JW9D 4HDQA 4J3OD 4IC7B 2ZW0A 1YX6B 4IUMB 4RH6A 2WU2B 1WIAA 2L0FA 1SB3C 2K1FA 2DAJA 4LCDE 3ABVB 3RI7C 3VH4B 3V62A 3KLSX 3PO0A 5AZFA 4LDTD 1CK1A 1WX9A 2N7EA 1WJ6A 1HTQA 3H7PB 2DBYA 3WA0A 2QMTA 2MQJA 2L0TA 1YJJA 2D3AA 2CR5A 4RGMA 4C00A 2J53A 5DCNA 2Y5CA 1WM2A 2K5PA 4GOCA 2O6VA 4JWSC 1SE2A 3OG5A 2MBBB 5IAAC 3PREA 1ACCA 2ASQA 1D6EC 2WXKA 5DPWA 2KDBA 2BS4B 4HKQA 1EWCA 4WJQA 4TKNA 1ZE3D 2INCC 4IWOA 2DLBA 3MP9A 3RD2A 4CHKA 3T3OA 3E56A 3HM6X 3L10B 2DWQA 4MH8A 1Q10A 3LB8C 2KOXA 3GE8C 4HVBA 3RNFC 2KYWA 2BS3B 1KH0A 1MPEA 3FILA 2J7QB 2ZEQA 4ZYNA 2WNMA 1JRUA 5CHVC 2O6VD 4KGRA 4WWNA 3H6NA 5FR6A 3B08A 2MSED 2Y3AA 1T6BX 4DXAB 1UUPA 5G55A 4AP4C 4LNIA 2LGYA 3A1QB 1WYWB 1WM3A 4W9FA 1QT9A 1UH6A 2INDC 5D6JB 1WGHA 5C23A 2KT7A 4A6QA 4MELA 3PZ7A 4E74A 2K8BA 1OFFA 4DDGD 1TBEA 1ZP0B 2GMIC 3PHWB 2JVCA 2K3UA 3ZNHB 3DBRI 2EKIA 3I9V1 3IT4B 4NNJB 4HJKA 3AEEB 2AQ3B 2B76B 4O1NA 2MBOA 5AUIA 3TSSA 4AUQC 1E10A 2O2VA 5CHFA 1L6UA 2J52A 3VTWA 4HCPB 2RPVA 1EWYC 4FULA 2K9XA 5C3JB 4II2B 2L76A 4OHJA 2AQ1B 4G50A 5FR3A 1S3SG 3OJ4B 1AW7A 1F1HA 2KTRA 1IBXA 3WALA 4IDIA 2QC8A 5JHBA 4MACA 2N9XA 3V3XA 2O6VB 2MP2B 4ITKA 3WAMA 4KGTA 3KUDB 2L8JA 5EE9A 1D5MC 4W9GA 2CHZA 2K6DB 1SIJA 3A4RA 4ZHOA 4WJOA 3GE3C 1J7BA 2M8SA 2GI9A 3KYDD 3JSVA 1UZXB 2AQ2B 2BF8B 3LXFA 3NUHB 3ALBA 2H89B 2PJHA 1TS4A 2REXA 3BINA 4MM3A 3CF6E 5J17A 3KQ4A 4US8A 4NJ6A 4IM3A
chains in the Genus database with same CATH topology
2PEAA 2MW5A 2RR9A 3UQAA 2QHOA 1RRBA 4GIVA 2IYDB 2NVUI 2DHZA 3KUZA 2M17A 4IW0A 2FNJB 3DPDA 2KK8A 4DHZE 2PPHA 1GC7A 2DZIA 2LGXA 3NOBA 2D11A 5IA7A 3QARA 2FCQA 2XEWA 1H8CA 4CYEA 4G0NB 4FA6A 2EMSA 2JXXA 3L54A 5G2NA 2M0XA 3A4SC 5J2RA 2MA9B 2KNBA 3IBEA 3IVFA 3PV1A 1WXAA 1WZ0A 2ZVOA 3L16A 3VUWA 5JH5C 4PS8A 3PLVA 1OQYA 4G11A 3U30A 4XC2A 2JPHA 1V80A 3NY5A 3ML9A 4AOFA 4IM2A 1SE9A 2AWTA 3ZTDA 1NDDA 3DCGA 3HIZA 3R66C 1WE7A 4WJPA 4BKSA 2XK5B 1WGYA 3ENEA 1TTNA 2KD0A 5CTRC 4ZRIA 4M8MA 4GDKB 1XT9B 1F9JA 4KZCA 4AWJA 4HLEA 2IBIB 5HKHA 2C7NB 4DBGA 2N7DA 4I6LB 4DWFA 3RCZA 4BKGA 3KVFB 3CSTA 3TL5A 4KDIC 1VCBA 1J8CA 3Q3FA 1E8YA 3AXCA 4FN2A 1OTRB 1GUAB 3PSEB 1GG3A 2JZZA 4FHJA 4W9IA 2KXJA 4NY0A 4DHZB 4BBNC 3C0RB 4F7ZA 2LJ5A 4ICUA 2KQ7A 2WX0A 2XK5A 4MH0E 4K7SA 1ISNA 3Q3JA 5E6NA 1EO6A 5LXHA 2JRIB 4GDKA 4WWOA 3PT2B 4EEWA 3OAWA 3TJPA 2KLGA 3GZNI 3U7DA 3QC8B 2AYOB 4J6IA 4MSQB 3WAPA 2KMCA 4II3B 1WMHB 2Z0EB 3HK0A 2KQSA 1UD7A 3M95A 4BKSD 1P1AA 2C60A 3SD5A 3ZKJC 4E3CA 4I6NB 3VUYA 4A3PA 1LXDA 3AI5A 3V6CB 1SGHA 4TUUA 3EFUA 1SIFA 1E7VA 3UGBB 2A4ZA 2MBHA 3VTVA 3B0AA 2KJHB 4B95A 3W1SC 4EUTA 3JW0X 1Y8RC 2KN5A 1LFDA 1ZW7A 1WMHA 3QK0A 4W9DA 5LXIB 2G45B 4HWIB 4HXDA 3R7RA 3ZUNA 2DENB 2BPSA 3ZW3A 4KIKB 2WX1A 2N9EB 1Q0WB 1YD8U 4F1SA 3UQBA 4N9F4 4BFRA 1V6EA 2D10A 1WXMA 2LXCA 1H4RA 3GOEA 3KYCD 4PYUA 4BKTA 3AU4A 1A5RA 2IO0B 2J0MA 1Q5WB 3LDZE 4NPNA 3RUIB 1V5OA 5JZEB 3QQ8B 3EC8A 4EZLA 3LJ3A 4URKA 3JVZX 4M8NA 2LVOA 3DVGX 5LLIA 3H9DA 2J0KA 3QHTA 2C7HA 2KX0A 4KIKA 4PS7A 3L08A 4A20A 2IY1B 3CMMB 3APDA 4MGKE 2NBUA 4MGZE 5D94A 1J19A 3ZDTA 1I42A 2CKHB 4W9HA 3VXWA 5DPSA 1GJZA 2BWFA 2LI5A 3ECIA 3N30A 2AL3A 2FIDA 3PRPB 3VHTC 1GC6A 4FLHA 2KFKB 2M4NA 2KWVB 1WJ4A 1RAXA 2KDFB 2MLBA 1YX5B 2RSUA 4MDKE 4NQKE 4ZRJA 4RM9A 1TGZB 3A9KB 1WGDA 3TMPB 4WAAA 3VVWB 4W9KA 1P0RA 2ZVNA 4B6WA 1WJNA 1RFAA 2LVPA 3V6EB 1UELA 4HDOA 1BT0A 4MJSB 4K7UA 3VAWA 1CMXB 4TQ0A 1E8WA 2KJRA 1XQQA 4KV2A 4ANXA 2KFKA 1WE6A 3P2BA 3DBSA 5L95C 3HM3A 3ZIMA 1V86A 2K39A 3ZO5B 2AL6A 1WR6E 1R4MI 4CO7A 4NQLB 4GDLB 2UWQA 3A9KA 3DVGY 3PTFC 5JHAA 1PQSA 2G3QB 4EOYA 2I1KA 1ZKHA 3A33B 3L13A 3DVNU 1U4AA 2JF5A 2ZPYA 4PS3A 4FJZA 2IZVB 4MJSA 4P7IA 3QAQA 2YLMA 1EUVB 1WX8A 2Y5BB 3WIMA 2LZ6A 4GB9A 3R3MA 2MBEA 3M62B 2GBKA 3DQVA 1Q1OA 4OVVA 2BKRB 2KDIA 2LRUA 3K9PB 1R4NI 4K1RB 4K7WA 4GDLA 5DPTA 4BBNF 3PS6A 1I35A 2KTFA 2KLCA 3WANA 1WXSA 3ZLZA 2MCNB 2J0JA 4W9JA 2ZCBA 1WRDB 3RT3B 4KDLB 3A9JB 1AARA 2DZJA 4TQ1A 2GBRA 4BOSC 2BGFA 4EZJA 2WWZA 4GGQA 3KUCB 1NBFC 3B1LX 3MHSD 2JT4B 2NBWB 2DX5B 2RGFA 4HPLB 2JWZA 3ML8A 4B9KA 2V3SA 3PHXB 2PE9A 3TCAA 1KLVA 2AEHA 3APFA 2XBBC 3D32A 3DOWA 4E71A 2LASA 4LDTB 4ANVA 1V5TA 1K8RB 1E8XA 3U8ZA 3UF8A 1X1MA 2KDEB 2NCNA 3A9JA 2BYVE 2LD9A 4JIOU 3K9OB 2GBJA 5KHQA 4JQWC 1GNUA 2ZPNA 1WXVA 3QX1A 5TR5A 1L2NA 4I6PA 4KVGB 4W9CA 4ANUA 4W9EA 1E7UA 1LM8B 4DK5A 1EF5A 1FXTB 1WFYA 3BY4B 1OEYA 4GU2A 4MEMA 3ZTCA 3NS8A 5BO4B 3ZDMC 3QA8A 3QWZB 3SHQA 2JY6A 3OLMD 2IO2B 2KHWB 2LRWA 4JL9A 4FHKA 2CU1A 5DPRA 3QCAA 3M63B 2NBVB 4W9LA 2BWES 1WJUA 4F8CB 2BKFA 5L83A 4RMAA 2C7MB 1V81A 4RM8A 3V60A 2UYZB 4WQOB 1P3QU 4KSKC 1P9DU 3W1SA 2LXAA 3ZRCA 5CX3A 1HE8A 4NAWB 2MRPA 1ZGUB 4BOZB 4ANWA 1V9JA 2ZZPB 1IPGA 2DYMA 3X0WA 3L17A 5AZHA 5D7GA 1VD2A 4XZ4A 2GBMA 4X57B 2HE7A 3CSFA 4WJNA 1E5WA 2I1JA 2K25A 2DYBA 2KO3A 4GSWA 4HDQA 1IYFA 4IC7B 2N4FA 1YX6B 4IUMB 2R2OA 1WIAA 2L0FA 3W1YA 2K1FA 2DAJA 2FAZA 4LCDE 3VH4B 3IG3A 3V62A 4ASWC 5D2MB 5AZGA 2GOWA 2GBNA 4LDTD 4NAWA 2KC1A 5AZFA 1WX9A 3ZVVA 2L3ZA 2MX2A 2LVQA 3WAOA 2N7EA 1WJ6A 1QZEA 3H7PB 3TBLD 2NR2A 3DDCB 2YVCA 1KOTA 3WA0A 2LUEA 4ICVA 2MQJA 2L7RA 2FUHB 4FBJB 2L0TA 2CR5A 4NJ7A 4YL8A 2ZNVC 2B3AA 1S1QB 5DCNA 4KSLC 2D07B 1Z2MA 1WM2A 2L00B 4GOCA 4EZKA 3PRMB 2O6VA 2JZ3B 2FIFA 2V1YA 2MBBB 5IAAC 3PREA 3AULA 2ASQA 2HTHA 3MTNB 3H7PA 2BYEA 1NI2A 3H1UA 2WDTB 5DPWA 2KDBA 2C9WB 2KMAA 3DBHI 3EHVA 4WJQA 2JUOA 2M1MA 4DHJB 1Z5SB 2G4SA 4TKNA 1V2YA 4K81A 4IWOA 1OEYJ 3RD2A 4CHKA 4EKUA 3HM6X 3L10B 2NS5A 3AU5A 1J0GA 5C1ZA 4IWPA 2KOXA 1LQBA 1WY8A 2D2QA 4HVBA 3O65B 2OJRA 5E6PA 3ZNGC 2L05A 1XD3B 1M94A 2J7QB 3PPAA 2ZEQA 3HHMA 3H7SA 4ZYNA 3V61A 2A5UA 1WI0A 1JRUA 4M0WB 1RLFA 5CHVC 2O6VD 4WWNA 3M3JA 3H6NA 5FR6A 3NZUA 3B08A 2MSED 4JGHB 3ZRFA 4DXAB 2MWSB 1T0YA 5G55A 1WR1A 4AP4C 2KX3A 4DDID 2CS4A 2LGYA 3QJZA 3A1QB 1C3TA 1WYWB 1WM3A 2HJ8A 2KWCA 2VRRB 3QIJA 4W9FA 2LGDA 1UH6A 4LJOB 3ZNID 5KHOA 2DZKA 3KW5B 3VFKA 2LWPA 4KZ0A 1TZ1A 4MGYE 3DBLI 3T9LA 2KANA 4IM0A 5D6JB 3PLUA 4G3XB 3VH3B 1WGHA 4LJPB 4OVUA 5C23A 3VTUA 1L7YA 2FCNA 3RZWC 4MELA 1YJ1A 4E74A 3A1QA 2K8BA 2O2VB 4DHJD 3PGEA 2N1WA 4AJWA 4DDGD 1TBEA 4IWQA 4GMVA 1KJTA 3SU8X 4MSMB 2CHXA 2GMIC 3RYTA 4JLCA 4AJYB 1WF9A 2ZJDA 2BYFA 3PHWB 2JVCA 2KJ6A 1D3ZA 4GN1A 5CHWA 1MG8A 1WZ3A 3IFWB 3UINB 3ZNHB 1E8ZA 2DYOA 2IO3B 3DBRI 4NNJB 2NPTB 2G4DB 4HJKA 2KKCA 1E90A 4AUQC 2KFJA 4GXBA 2KTRB 2MBOA 2WYQA 4HCNB 4EFOA 5AEKB 3PVLA 4IG7B 2K8CA 3PZDA 2O2VA 5CHFA 4HK2A 3SDLC 3IHPC 5E6OA 3VTWA 4HCPB 1V49A 1WGRA 1YIWA 3RULA 2Z0DB 4FULA 2CHWA 2DZMA 4II2B 2FCSA 1C1YB 2L76A 3APCA 4ZRKA 2W9NA 2Z59B 1WX7A 4G50A 2NPTA 2K6QA 1KM7A 1S3SG 3OJ4B 3DVNV 2KTRA 2KVRA 2IY0B 2MBQA 4FJVB 3WALA 4FADA 3NZSA 3JSVB 2FCMA 2HD5B 4WWPA 5JHBA 1EF1A 1UBQA 1YQBA 2N9XA 3NHEB 2EMTA 2O6VB 3N3KB 2MP2B 3JYUA 4PYZA 3WAMA 4ZDVA 5EDSA 2K8HA 3KUDB 2L8JA 2PE6B 2JRHA 3VQIA 2IO1B 2N1VA 2RD0A 4BVUC 1WGGA 1UBIA 2N9PC 3L0WB 2RPQA 4W9GA 2ZNVB 2CHZA 5GMVA 2D3GA 2DAFA 4TV3A 3N32A 2K6DB 3MJWA 3EECA 3A4RA 4WJOA 2KZRA 2ZCCA 2R2QA 2M8SA 3KYDD 3JSVA 3T8MA 1UZXB 2EKEC 2KC2A 1P98A 3PRZA 3UIPB 2BF8B 2MP2A 3VUXA 3RZFA 3ALBA 4XX5A 3I3TB 2PJHA 3R7QA 4A3OA 2REXA 3BINA 1IP9A 1OGWA 2OOBB 4MM3A 3S2AA 3TIXA 3UIOB 3ZNZB 4FJYA 1UGMA 3CF6E 3OJ3A 2KWUB 2V4LA 4HPMB 5J17A 4NJ6A 5J18A 3KH0A 1WH3A 1G6JA 3ONSA 4MGIE 3X23A 3VDZA 4IM3A 2C5LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEA A;  2MW5 A;  2RR9 A;  3UQA A;  2QHO A;  1RRB A;  4GIV A;  2IYD B;  2NVU I;  2DHZ A;  3KUZ A;  2M17 A;  4IW0 A;  2FNJ B;  3DPD A;  2KK8 A;  4DHZ E;  2PPH A;  1GC7 A;  2DZI A;  2LGX A;  3NOB A;  2D11 A;  5IA7 A;  3QAR A;  2FCQ A;  2XEW A;  1H8C A;  4CYE A;  4G0N B;  4FA6 A;  2EMS A;  2JXX A;  3L54 A;  5G2N A;  2M0X A;  3A4S C;  5J2R A;  2MA9 B;  2KNB A;  3IBE A;  3IVF A;  3PV1 A;  1WXA A;  1WZ0 A;  2ZVO A;  3L16 A;  3VUW A;  5JH5 C;  4PS8 A;  3PLV A;  1OQY A;  4G11 A;  3U30 A;  4XC2 A;  2JPH A;  1V80 A;  3NY5 A;  3ML9 A;  4AOF A;  4IM2 A;  1SE9 A;  2AWT A;  3ZTD A;  1NDD A;  3DCG A;  3HIZ A;  3R66 C;  1WE7 A;  4WJP A;  4BKS A;  2XK5 B;  1WGY A;  3ENE A;  1TTN A;  2KD0 A;  5CTR C;  4ZRI A;  4M8M A;  4GDK B;  1XT9 B;  1F9J A;  4KZC A;  4AWJ A;  4HLE A;  2IBI B;  5HKH A;  2C7N B;  4DBG A;  2N7D A;  4I6L B;  4DWF A;  3RCZ A;  4BKG A;  3KVF B;  3CST A;  3TL5 A;  4KDI C;  1VCB A;  1J8C A;  3Q3F A;  1E8Y A;  3AXC A;  4FN2 A;  1OTR B;  1GUA B;  3PSE B;  1GG3 A;  2JZZ A;  4FHJ A;  4W9I A;  2KXJ A;  4NY0 A;  4DHZ B;  4BBN C;  3C0R B;  4F7Z A;  2LJ5 A;  4ICU A;  2KQ7 A;  2WX0 A;  2XK5 A;  4MH0 E;  4K7S A;  1ISN A;  3Q3J A;  5E6N A;  1EO6 A;  5LXH A;  2JRI B;  4GDK A;  4WWO A;  3PT2 B;  4EEW A;  3OAW A;  3TJP A;  2KLG A;  3GZN I;  3U7D A;  3QC8 B;  2AYO B;  4J6I A;  4MSQ B;  3WAP A;  2KMC A;  4II3 B;  1WMH B;  2Z0E B;  3HK0 A;  2KQS A;  1UD7 A;  3M95 A;  4BKS D;  1P1A A;  2C60 A;  3SD5 A;  3ZKJ C;  4E3C A;  4I6N B;  3VUY A;  4A3P A;  1LXD A;  3AI5 A;  3V6C B;  1SGH A;  4TUU A;  3EFU A;  1SIF A;  1E7V A;  3UGB B;  2A4Z A;  2MBH A;  3VTV A;  3B0A A;  2KJH B;  4B95 A;  3W1S C;  4EUT A;  3JW0 X;  1Y8R C;  2KN5 A;  1LFD A;  1ZW7 A;  1WMH A;  3QK0 A;  4W9D A;  5LXI B;  2G45 B;  4HWI B;  4HXD A;  3R7R A;  3ZUN A;  2DEN B;  2BPS A;  3ZW3 A;  4KIK B;  2WX1 A;  2N9E B;  1Q0W B;  1YD8 U;  4F1S A;  3UQB A;  4N9F 4;  4BFR A;  1V6E A;  2D10 A;  1WXM A;  2LXC A;  1H4R A;  3GOE A;  3KYC D;  4PYU A;  4BKT A;  3AU4 A;  1A5R A;  2IO0 B;  2J0M A;  1Q5W B;  3LDZ E;  4NPN A;  3RUI B;  1V5O A;  5JZE B;  3QQ8 B;  3EC8 A;  4EZL A;  3LJ3 A;  4URK A;  3JVZ X;  4M8N A;  2LVO A;  3DVG X;  5LLI A;  3H9D A;  2J0K A;  3QHT A;  2C7H A;  2KX0 A;  4KIK A;  4PS7 A;  3L08 A;  4A20 A;  2IY1 B;  3CMM B;  3APD A;  4MGK E;  2NBU A;  4MGZ E;  5D94 A;  1J19 A;  3ZDT A;  1I42 A;  2CKH B;  4W9H A;  3VXW A;  5DPS A;  1GJZ A;  2BWF A;  2LI5 A;  3ECI A;  3N30 A;  2AL3 A;  2FID A;  3PRP B;  3VHT C;  1GC6 A;  4FLH A;  2KFK B;  2M4N A;  2KWV B;  1WJ4 A;  1RAX A;  2KDF B;  2MLB A;  1YX5 B;  2RSU A;  4MDK E;  4NQK E;  4ZRJ A;  4RM9 A;  1TGZ B;  3A9K B;  1WGD A;  3TMP B;  4WAA A;  3VVW B;  4W9K A;  1P0R A;  2ZVN A;  4B6W A;  1WJN A;  1RFA A;  2LVP A;  3V6E B;  1UEL A;  4HDO A;  1BT0 A;  4MJS B;  4K7U A;  3VAW A;  1CMX B;  4TQ0 A;  1E8W A;  2KJR A;  1XQQ A;  4KV2 A;  4ANX A;  2KFK A;  1WE6 A;  3P2B A;  3DBS A;  5L95 C;  3HM3 A;  3ZIM A;  1V86 A;  2K39 A;  3ZO5 B;  2AL6 A;  1WR6 E;  1R4M I;  4CO7 A;  4NQL B;  4GDL B;  2UWQ A;  3A9K A;  3DVG Y;  3PTF C;  5JHA A;  1PQS A;  2G3Q B;  4EOY A;  2I1K A;  1ZKH A;  3A33 B;  3L13 A;  3DVN U;  1U4A A;  2JF5 A;  2ZPY A;  4PS3 A;  4FJZ A;  2IZV B;  4MJS A;  4P7I A;  3QAQ A;  2YLM A;  1EUV B;  1WX8 A;  2Y5B B;  3WIM A;  2LZ6 A;  4GB9 A;  3R3M A;  2MBE A;  3M62 B;  2GBK A;  3DQV A;  1Q1O A;  4OVV A;  2BKR B;  2KDI A;  2LRU A;  3K9P B;  1R4N I;  4K1R B;  4K7W A;  4GDL A;  5DPT A;  4BBN F;  3PS6 A;  1I35 A;  2KTF A;  2KLC A;  3WAN A;  1WXS A;  3ZLZ A;  2MCN B;  2J0J A;  4W9J A;  2ZCB A;  1WRD B;  3RT3 B;  4KDL B;  3A9J B;  1AAR A;  2DZJ A;  4TQ1 A;  2GBR A;  4BOS C;  2BGF A;  4EZJ A;  2WWZ A;  4GGQ A;  3KUC B;  1NBF C;  3B1L X;  3MHS D;  2JT4 B;  2NBW B;  2DX5 B;  2RGF A;  4HPL B;  2JWZ A;  3ML8 A;  4B9K A;  2V3S A;  3PHX B;  2PE9 A;  3TCA A;  1KLV A;  2AEH A;  3APF A;  2XBB C;  3D32 A;  3DOW A;  4E71 A;  2LAS A;  4LDT B;  4ANV A;  1V5T A;  1K8R B;  1E8X A;  3U8Z A;  3UF8 A;  1X1M A;  2KDE B;  2NCN A;  3A9J A;  2BYV E;  2LD9 A;  4JIO U;  3K9O B;  2GBJ A;  5KHQ A;  4JQW C;  1GNU A;  2ZPN A;  1WXV A;  3QX1 A;  5TR5 A;  1L2N A;  4I6P A;  4KVG B;  4W9C A;  4ANU A;  4W9E A;  1E7U A;  1LM8 B;  4DK5 A;  1EF5 A;  1FXT B;  1WFY A;  3BY4 B;  1OEY A;  4GU2 A;  4MEM A;  3ZTC A;  3NS8 A;  5BO4 B;  3ZDM C;  3QA8 A;  3QWZ B;  3SHQ A;  2JY6 A;  3OLM D;  2IO2 B;  2KHW B;  2LRW A;  4JL9 A;  4FHK A;  2CU1 A;  5DPR A;  3QCA A;  3M63 B;  2NBV B;  4W9L A;  2BWE S;  1WJU A;  4F8C B;  2BKF A;  5L83 A;  4RMA A;  2C7M B;  1V81 A;  4RM8 A;  3V60 A;  2UYZ B;  4WQO B;  1P3Q U;  4KSK C;  1P9D U;  3W1S A;  2LXA A;  3ZRC A;  5CX3 A;  1HE8 A;  4NAW B;  2MRP A;  1ZGU B;  4BOZ B;  4ANW A;  1V9J A;  2ZZP B;  1IPG A;  2DYM A;  3X0W A;  3L17 A;  5AZH A;  5D7G A;  1VD2 A;  4XZ4 A;  2GBM A;  4X57 B;  2HE7 A;  3CSF A;  4WJN A;  1E5W A;  2I1J A;  2K25 A;  2DYB A;  2KO3 A;  4GSW A;  4HDQ A;  1IYF A;  4IC7 B;  2N4F A;  1YX6 B;  4IUM B;  2R2O A;  1WIA A;  2L0F A;  3W1Y A;  2K1F A;  2DAJ A;  2FAZ A;  4LCD E;  3VH4 B;  3IG3 A;  3V62 A;  4ASW C;  5D2M B;  5AZG A;  2GOW A;  2GBN A;  4LDT D;  4NAW A;  2KC1 A;  5AZF A;  1WX9 A;  3ZVV A;  2L3Z A;  2MX2 A;  2LVQ A;  3WAO A;  2N7E A;  1WJ6 A;  1QZE A;  3H7P B;  3TBL D;  2NR2 A;  3DDC B;  2YVC A;  1KOT A;  3WA0 A;  2LUE A;  4ICV A;  2MQJ A;  2L7R A;  2FUH B;  4FBJ B;  2L0T A;  2CR5 A;  4NJ7 A;  4YL8 A;  2ZNV C;  2B3A A;  1S1Q B;  5DCN A;  4KSL C;  2D07 B;  1Z2M A;  1WM2 A;  2L00 B;  4GOC A;  4EZK A;  3PRM B;  2O6V A;  2JZ3 B;  2FIF A;  2V1Y A;  2MBB B;  5IAA C;  3PRE A;  3AUL A;  2ASQ A;  2HTH A;  3MTN B;  3H7P A;  2BYE A;  1NI2 A;  3H1U A;  2WDT B;  5DPW A;  2KDB A;  2C9W B;  2KMA A;  3DBH I;  3EHV A;  4WJQ A;  2JUO A;  2M1M A;  4DHJ B;  1Z5S B;  2G4S A;  4TKN A;  1V2Y A;  4K81 A;  4IWO A;  1OEY J;  3RD2 A;  4CHK A;  4EKU A;  3HM6 X;  3L10 B;  2NS5 A;  3AU5 A;  1J0G A;  5C1Z A;  4IWP A;  2KOX A;  1LQB A;  1WY8 A;  2D2Q A;  4HVB A;  3O65 B;  2OJR A;  5E6P A;  3ZNG C;  2L05 A;  1XD3 B;  1M94 A;  2J7Q B;  3PPA A;  2ZEQ A;  3HHM A;  3H7S A;  4ZYN A;  3V61 A;  2A5U A;  1WI0 A;  1JRU A;  4M0W B;  1RLF A;  5CHV C;  2O6V D;  4WWN A;  3M3J A;  3H6N A;  5FR6 A;  3NZU A;  3B08 A;  2MSE D;  4JGH B;  3ZRF A;  4DXA B;  2MWS B;  1T0Y A;  5G55 A;  1WR1 A;  4AP4 C;  2KX3 A;  4DDI D;  2CS4 A;  2LGY A;  3QJZ A;  3A1Q B;  1C3T A;  1WYW B;  1WM3 A;  2HJ8 A;  2KWC A;  2VRR B;  3QIJ A;  4W9F A;  2LGD A;  1UH6 A;  4LJO B;  3ZNI D;  5KHO A;  2DZK A;  3KW5 B;  3VFK A;  2LWP A;  4KZ0 A;  1TZ1 A;  4MGY E;  3DBL I;  3T9L A;  2KAN A;  4IM0 A;  5D6J B;  3PLU A;  4G3X B;  3VH3 B;  1WGH A;  4LJP B;  4OVU A;  5C23 A;  3VTU A;  1L7Y A;  2FCN A;  3RZW C;  4MEL A;  1YJ1 A;  4E74 A;  3A1Q A;  2K8B A;  2O2V B;  4DHJ D;  3PGE A;  2N1W A;  4AJW A;  4DDG D;  1TBE A;  4IWQ A;  4GMV A;  1KJT A;  3SU8 X;  4MSM B;  2CHX A;  2GMI C;  3RYT A;  4JLC A;  4AJY B;  1WF9 A;  2ZJD A;  2BYF A;  3PHW B;  2JVC A;  2KJ6 A;  1D3Z A;  4GN1 A;  5CHW A;  1MG8 A;  1WZ3 A;  3IFW B;  3UIN B;  3ZNH B;  1E8Z A;  2DYO A;  2IO3 B;  3DBR I;  4NNJ B;  2NPT B;  2G4D B;  4HJK A;  2KKC A;  1E90 A;  4AUQ C;  2KFJ A;  4GXB A;  2KTR B;  2MBO A;  2WYQ A;  4HCN B;  4EFO A;  5AEK B;  3PVL A;  4IG7 B;  2K8C A;  3PZD A;  2O2V A;  5CHF A;  4HK2 A;  3SDL C;  3IHP C;  5E6O A;  3VTW A;  4HCP B;  1V49 A;  1WGR A;  1YIW A;  3RUL A;  2Z0D B;  4FUL A;  2CHW A;  2DZM A;  4II2 B;  2FCS A;  1C1Y B;  2L76 A;  3APC A;  4ZRK A;  2W9N A;  2Z59 B;  1WX7 A;  4G50 A;  2NPT A;  2K6Q A;  1KM7 A;  1S3S G;  3OJ4 B;  3DVN V;  2KTR A;  2KVR A;  2IY0 B;  2MBQ A;  4FJV B;  3WAL A;  4FAD A;  3NZS A;  3JSV B;  2FCM A;  2HD5 B;  4WWP A;  5JHB A;  1EF1 A;  1UBQ A;  1YQB A;  2N9X A;  3NHE B;  2EMT A;  2O6V B;  3N3K B;  2MP2 B;  3JYU A;  4PYZ A;  3WAM A;  4ZDV A;  5EDS A;  2K8H A;  3KUD B;  2L8J A;  2PE6 B;  2JRH A;  3VQI A;  2IO1 B;  2N1V A;  2RD0 A;  4BVU C;  1WGG A;  1UBI A;  2N9P C;  3L0W B;  2RPQ A;  4W9G A;  2ZNV B;  2CHZ A;  5GMV A;  2D3G A;  2DAF A;  4TV3 A;  3N32 A;  2K6D B;  3MJW A;  3EEC A;  3A4R A;  4WJO A;  2KZR A;  2ZCC A;  2R2Q A;  2M8S A;  3KYD D;  3JSV A;  3T8M A;  1UZX B;  2EKE C;  2KC2 A;  1P98 A;  3PRZ A;  3UIP B;  2BF8 B;  2MP2 A;  3VUX A;  3RZF A;  3ALB A;  4XX5 A;  3I3T B;  2PJH A;  3R7Q A;  4A3O A;  2REX A;  3BIN A;  1IP9 A;  1OGW A;  2OOB B;  4MM3 A;  3S2A A;  3TIX A;  3UIO B;  3ZNZ B;  4FJY A;  1UGM A;  3CF6 E;  3OJ3 A;  2KWU B;  2V4L A;  4HPM B;  5J17 A;  4NJ6 A;  5J18 A;  3KH0 A;  1WH3 A;  1G6J A;  3ONS A;  4MGI E;  3X23 A;  3VDZ A;  4IM3 A;  2C5L C; 
#chains in the Genus database with same CATH topology
 2MW5 A;  4GIV A;  1DOY A;  2NVU I;  3KUZ A;  2M17 A;  1T0S C;  2KK8 A;  3NOB A;  2DZI A;  2FCQ A;  4XDD A;  4RF0 A;  2EMS A;  2QCZ A;  2BVC A;  4RGN A;  2KNB A;  3IBE A;  5IOI A;  4TMA B;  3PLV A;  4G11 A;  3TUO A;  4RGO S;  1V80 A;  3NY5 A;  3ZTD A;  1B9R A;  2W3S A;  1NDD A;  4WJP A;  1N5W A;  3ENE A;  2FBW B;  4M8M A;  1XT9 B;  1VR9 A;  5HKH A;  1J7C A;  3OWE B;  1E8Y A;  1HQR D;  4FHJ A;  4L23 A;  5D3I B;  4W9I A;  4NY0 A;  3C0R B;  4NAM A;  2KQ7 A;  2WX0 A;  2XK5 A;  1XLO A;  1XCT L;  3ZXR A;  3PT2 B;  2NMQ A;  3OAW A;  2YEP B;  3QC8 B;  4MSQ B;  4II3 B;  4ZHP A;  1UD7 A;  3M95 A;  3SD5 A;  4I6N B;  1TKY A;  1LXD A;  3AI5 A;  3V6C B;  1AWD A;  1FIQ A;  5FK9 C;  3UGB B;  1MHH E;  3VTV A;  3B0A A;  4RNA A;  1JWA D;  3O13 A;  3W1S C;  3JW0 X;  1ZW7 A;  1WMH A;  2BPS A;  3ZW3 A;  4PT5 A;  3WCQ A;  4F1S A;  2D10 A;  2LXC A;  3IAM 1;  2LMC A;  2J0M A;  1LGR A;  3RUI B;  3VR8 B;  3EC8 A;  2BT6 A;  4URK A;  3NVV A;  1SBB B;  5IP4 D;  2CU3 A;  4M8N A;  3NVY A;  5LLI A;  4PS7 A;  2C7H A;  1ZDX A;  4P1C C;  1VZ6 A;  1J19 A;  3NG0 A;  1I42 A;  2CKH B;  1RFK A;  1ET6 A;  2LI5 A;  4N6E B;  3ECI A;  2D3C A;  1ET9 A;  2AL3 A;  3PRP B;  1GC6 A;  2KFK B;  4NQK E;  1YX5 B;  5BMH A;  4LNN A;  3A9K B;  2WDR B;  3VVW B;  1P0R A;  4N58 A;  1UEL A;  3VAW A;  3SR6 A;  1LO5 D;  1CMX B;  4DXF A;  4ANX A;  3AEF B;  1RYJ A;  1V8C A;  1WE6 A;  1I4G A;  1YMH E;  3HM3 A;  1V1P A;  3Q6B A;  2K39 A;  3PTF C;  5JHA A;  2G3Q B;  2ICI A;  1ZKH A;  3L13 A;  3QAQ A;  2R61 A;  1WX8 A;  2GB1 A;  1T3Q A;  3HUI A;  1JWS D;  2BKR B;  2KDI A;  2I2Y A;  1XXG A;  2H88 B;  4GDL A;  4BBN F;  4ARI A;  2INN E;  2JYT A;  3PS6 A;  1I35 A;  3EFC A;  1WRD B;  4KDL B;  3A9J B;  1AAR A;  1RWS A;  4TQ1 A;  1L4D B;  1NBF C;  3B1L X;  3GS2 A;  2JT4 B;  3ZJV A;  2NBW B;  3U2S C;  2DX5 B;  3C8Y A;  2RGF A;  2JWZ A;  3MFG A;  2V3S A;  3PHX B;  4KKJ A;  1KLV A;  1V5T A;  2PLP A;  2NCN A;  4OZC A;  2L52 A;  1F2R C;  3Q14 C;  4JIO U;  4AQ7 A;  1GNU A;  2PIA A;  2ZPN A;  1UWM A;  4ANU A;  2X38 A;  3BY4 B;  1OEY A;  1VDV A;  3ZTC A;  3NS8 A;  4USA A;  2JY6 A;  2IO2 B;  4FHK A;  5DPR A;  3MC0 B;  3M63 B;  1T5X D;  1TJE A;  2BWE S;  2C7M B;  4RM8 A;  4WQO B;  4BOZ B;  5HI1 A;  2MRP A;  1ZGU B;  1K50 A;  2ZZP B;  1IPG A;  2JXT A;  5C2T B;  1MG4 A;  4YT0 B;  2HE7 A;  4LK0 M;  2KO3 A;  1UNS A;  2N4F A;  2R2O A;  3W1Y A;  2WHI A;  2FAZ A;  5EE3 A;  3NZ3 A;  5D2M B;  1I4R A;  2GOW A;  2GBN A;  4NAW A;  2MX2 A;  1FNV A;  1QOA A;  1KOT A;  3VRA B;  2LUE A;  3ETR A;  4YL8 A;  2RDG A;  4KSL C;  1ZDV A;  3FAH A;  3DHI C;  3AE2 B;  2JZ3 B;  3N20 C;  3AUL A;  2KDM A;  4OZB A;  2LGS A;  3H7P A;  2BYE A;  2WLB A;  3H1U A;  1BML C;  3P4R B;  2Q5W D;  4DHJ B;  1L6V A;  1JRO A;  4XE0 A;  1CZP A;  1C4P A;  4JX1 C;  5GXG B;  4A90 A;  5C1Z A;  3GB1 A;  3GZN B;  1WY8 A;  3IXS A;  2LEK A;  3MC9 A;  3ZNG C;  2L05 A;  1M94 A;  2G9H D;  1UGJ A;  3V61 A;  5LNK 1;  5BYQ A;  1NEK B;  2RDB C;  4JWU C;  3M3J A;  2HDE A;  4NJC A;  2MWS B;  5I4D A;  1JWB D;  1WR1 A;  1ROE A;  3BVG A;  2CS4 A;  1DOI A;  2OJW A;  2HJ8 A;  3QIJ A;  4RCO A;  2LGD A;  3ZNI D;  3RNC C;  3KW5 B;  3H8H A;  1TZ1 A;  3AV8 A;  3DBL I;  4S17 A;  2KAN A;  2WDQ B;  4G3X B;  2FE8 A;  3VH3 B;  1V1O A;  4OVU A;  1L7Y A;  2GRI A;  3A1Q A;  1VRA B;  2QIL A;  2HJ1 A;  2N1W A;  4MSM B;  2UU7 A;  2NTT A;  2CHX A;  4AJY B;  2ZJD A;  4GN1 A;  1WZ3 A;  3UIN B;  1L4Z B;  2DYO A;  2NPT B;  2WXQ A;  2PTL A;  4GXB A;  4KKI A;  1WGK A;  1N62 A;  1N5X A;  2INP E;  3PZD A;  1YJI A;  4HK2 A;  3IHP C;  5E6O A;  3HVD A;  1KTK A;  1V49 A;  1WGR A;  2KVZ A;  1YQ3 B;  3V05 A;  4KX6 B;  2Z59 B;  1EU4 A;  1WX7 A;  5BMI A;  2K6Q A;  1FXI A;  4FAD A;  2KMM A;  3Q8F A;  1UBQ A;  5EDS A;  2M56 B;  3JYU A;  4PYZ A;  2K8H A;  1UWX A;  1WGG A;  1UBI A;  3L0W B;  2RPQ A;  2XNA C;  1IGD A;  3MJW A;  2KZR A;  3ZJU A;  2XN9 C;  1FRD A;  1QLB B;  2R2Q A;  4RFB A;  3B9J A;  2MP2 A;  3R2T A;  4D2K A;  3R7Q A;  3AE3 B;  1OQR A;  3ZNZ B;  3S2A A;  3TIX A;  1UGM A;  3OJ3 A;  2KWU B;  2V4L A;  4WH4 A;  3EA6 A;  5J18 A;  1WH3 A;  3ONS A;  4MGI E;  3X23 A;  3ZYY X;  2NTS A;  2C5L C;  2LUM A;  1CJE A;  4EE2 A;  2QHO A;  2WXO A;  1SSN A;  4IW0 A;  2FNJ B;  3DPD A;  2ZW1 A;  2PPH A;  1GC7 A;  2V3P A;  2Y5P A;  1TY2 A;  1IUE A;  2XEW A;  3L4P A;  4A9A A;  4DXG A;  1HXY D;  4FA6 A;  3L54 A;  3A4S C;  5J2R A;  3PV1 A;  4XGA B;  3VUW A;  5JH5 C;  1C76 A;  4ZOH C;  2JPH A;  3ML9 A;  4Q2J A;  1PUT A;  4UDU C;  4HRO A;  1JWU D;  3HIZ A;  1J7A A;  3R66 C;  1WE7 A;  3FC4 A;  4BKS A;  3U4E G;  2D3B A;  1GPX A;  4GDK B;  5HFY A;  4AWJ A;  4HLE A;  2C7N B;  4BKG A;  1I4X A;  1VCB A;  3Q3F A;  3AXC A;  1GUA B;  1GG3 A;  2JZZ A;  2MJ3 A;  4DHZ B;  2MHJ A;  1EU3 A;  1PGX A;  2LJ5 A;  4ICU A;  1KLU D;  2KAJ A;  4K7S A;  1ISN A;  1C79 A;  1KRH A;  2LGI A;  2YEP F;  4WWO A;  1FCL A;  4EEW A;  3GZN I;  3Q3N C;  2AYO B;  2QEJ C;  3WAP A;  1Y56 A;  2Z0E B;  4BKS D;  1P1A A;  3ZKJ C;  1BXT A;  5EE1 A;  3DHG C;  1SIF A;  1TKG A;  2KWD A;  5IO9 A;  1NVI D;  4W9D A;  2G45 B;  3Q69 A;  4HXD A;  4YTM B;  3Q2A C;  5TSS A;  2N9E B;  1Q0W B;  1YD8 U;  3DBH B;  4P6V F;  3UQB A;  1V6E A;  3GOE A;  3KYC D;  4PYU A;  1F2R I;  2IO0 B;  2J4X A;  1TIF A;  3U52 E;  1BUI C;  1Q5W B;  4P1B C;  3LDZ E;  3QQ8 B;  2G1E A;  4EZL A;  3QHT A;  2BTE A;  3L08 A;  2VH2 A;  2IY1 B;  3CMM B;  2J42 A;  4MGK E;  2IGG A;  2FUG 1;  3ZDT A;  4C4V B;  2FID A;  4YTN B;  2LJI A;  1FEH A;  1P7E A;  4MDK E;  1I4P A;  4C80 A;  3TMP B;  4WAA A;  3NJT A;  4W9K A;  3FKY A;  4B6W A;  1WJN A;  2LVP A;  3V6E B;  4HDO A;  1E8W A;  2KJR A;  4KV2 A;  4P16 A;  2KFK A;  3DBS A;  3I5J C;  5L95 C;  2ACZ B;  2AL6 A;  4NQL B;  3A9K A;  1PQS A;  4EOY A;  2I1K A;  2BB6 A;  3A33 B;  2QJL A;  2JF5 A;  4FJZ A;  2IZV B;  2YLM A;  3WIM A;  2LZ6 A;  3R3M A;  1Q1O A;  2JSV X;  3TEW A;  4WQM A;  3AMZ A;  2LRU A;  1L0Y B;  2KLC A;  3ZLZ A;  2MCN B;  2ZCB A;  4NZL B;  2N9K A;  3MHS D;  2W54 A;  1QF6 A;  1FNW A;  2PE9 A;  3TCA A;  1CQV A;  3APF A;  3DOW A;  2LAS A;  4PK1 A;  1VJK A;  1JQ4 A;  3A9J A;  1P7F A;  2BYV E;  3K9O B;  5KHQ A;  2MEK A;  5TR5 A;  4I6P A;  4W9C A;  4XYC A;  4HPP A;  4DK5 A;  1EF5 A;  4H2A A;  1KFY B;  1TT5 B;  4M02 A;  3QWZ B;  4FXC A;  3OLM D;  1F0Z A;  3BYT B;  1AYF A;  1MVK A;  4JL9 A;  4YWG G;  3QCA A;  2NBV B;  3AED B;  2WP9 B;  4F8C B;  5L83 A;  4RMA A;  3C19 A;  1VZ8 A;  1P3Q U;  4KSK C;  1P9D U;  3W1S A;  1YN5 A;  3BK2 A;  3L17 A;  5AZH A;  2M19 A;  1VD2 A;  4XZ4 A;  2GBM A;  3AE4 B;  2V3N A;  2RMM A;  1WWT A;  4X57 B;  2I1J A;  1IYF A;  3AE5 B;  1WYG A;  4WUR A;  3UI3 A;  2KAC A;  4GLS C;  4YSY B;  3T3N A;  2GLS A;  1R4M B;  3IG3 A;  3ZVV A;  5FKA C;  2N7J A;  3TBL D;  2NR2 A;  1K51 A;  2YVC A;  1QIL A;  2ZNV C;  2B3A A;  1S1Q B;  3W5U B;  2D07 B;  4M01 A;  1Z2M A;  4EZK A;  3B2F A;  3AEG B;  1K53 A;  3BVZ A;  2C9W B;  1FD6 A;  3DBH I;  2JQR B;  3P1M A;  2G4S A;  4K81 A;  4LLG M;  4LNF A;  1L0X B;  5HHD G;  2OJR A;  3AEA B;  5E6P A;  4TSS A;  3HHM A;  3H7S A;  2A5U A;  2E3T A;  4M0W B;  1F77 A;  1JWM D;  2TSS A;  1T0Y A;  1UF0 A;  2KX3 A;  2Z8L A;  1C78 A;  1C3T A;  3NRZ A;  4LNO A;  3I63 C;  2LHE A;  4LJO B;  5KHO A;  2DZK A;  4HRS A;  1PFD A;  2LWP A;  3N9Y C;  1TY0 A;  2FCN A;  3RZW C;  4DHJ D;  1VZ7 A;  5EE0 A;  1KJT A;  3SU8 X;  4A8X C;  3RPF C;  1WF9 A;  3I57 A;  2OHF A;  3IFW B;  1XEE A;  1E8Z A;  2IO3 B;  2KKC A;  4B0E A;  2K8C A;  3SDL C;  1FNU A;  2Z0D B;  2CHW A;  2FCS A;  1SJE D;  1ZUD 2;  2V4I B;  2NPT A;  1KM7 A;  2KVR A;  4YSZ B;  2IY0 B;  2MBQ A;  2HTM E;  2FCM A;  1C9F A;  2WXN A;  1YQB A;  4BKT A;  3MJ5 A;  3VQI A;  2JRH A;  1GB1 A;  2IO1 B;  2RD0 A;  4BVU C;  4MT5 A;  3W2D A;  3P42 A;  4K3B A;  2ZNV B;  4YTP B;  2D3G A;  2DAF A;  4TV3 A;  3N32 A;  3RNG C;  5H8Y E;  1RM6 C;  3T8M A;  2EKE C;  2KC2 A;  1P98 A;  3PRZ A;  5MPO A;  3UIP B;  3VUX A;  4XX5 A;  3I3T B;  1KF6 B;  4A3O A;  1QOB A;  1IP9 A;  2OOB B;  3UIO B;  2PVG C;  3ZGZ A;  4L1B A;  3BWU D;  3VDZ A;  3Q8E A;  2PKO A;  5E6J A;  2RR9 A;  2IYD B;  2VH1 A;  4DHZ E;  2LGX A;  1ENF A;  3Q3M C;  5IA7 A;  3QAR A;  1H8C A;  4G0N B;  3AE6 B;  3NVW A;  1C4C A;  3P63 A;  1WXA A;  1WZ0 A;  5BYS A;  3U30 A;  1OQY A;  1PGB A;  2IGD A;  2D5G A;  2LFI A;  4RGT A;  4IM2 A;  1OQQ A;  2AWT A;  3DCG A;  3DBR B;  1TTN A;  3TEY A;  5CTR C;  2WXM A;  3W5V B;  3NS1 A;  4KZC A;  1K52 A;  4I6L B;  3CST A;  3TL5 A;  1J8C A;  1FM0 D;  3DWG C;  2KXJ A;  5G5H A;  2L83 A;  1FXA A;  1FPY A;  3B2G A;  5LXH A;  4GDK A;  2I38 A;  1TYG B;  3TJP A;  2KLG A;  4J6I A;  3J9C A;  1HZ6 A;  3HK0 A;  4N59 A;  4E3C A;  2MJE A;  1NYR A;  3VUY A;  1SGH A;  4TUU A;  3EFU A;  1E7V A;  2A4Z A;  2MBH A;  4B95 A;  4EUT A;  5LXI B;  1LFD A;  3QK0 A;  1VLB A;  4BAX A;  3R7R A;  3ZUN A;  4KIK B;  3BK1 A;  4A55 A;  2W82 A;  5BYR A;  4HKZ E;  1A5R A;  1FRR A;  3AU4 A;  1GB4 A;  5JZE B;  3LJ3 A;  4HEA 1;  2LVO A;  2L32 A;  3DVG X;  3H9D A;  2J0K A;  1YN4 A;  1WRI A;  2KQ4 X;  2N0S B;  2NBU A;  4OW0 A;  1HTO A;  3VXW A;  5DPS A;  1GJZ A;  3AE8 B;  2BS2 B;  2IGH A;  1WJ4 A;  2KDF B;  2RSU A;  3BII D;  1PYW D;  4DQO C;  2JYE A;  2ON8 A;  1TGZ B;  2ZVN A;  3P4S B;  1RFA A;  4MJS B;  1PGA A;  4K7U A;  4C4V A;  4TQ0 A;  1XQQ A;  3P2B A;  2DNF A;  3ZIM A;  1V86 A;  2QIE B;  1WR6 E;  4CO7 A;  1IGC A;  5H92 C;  4JPS A;  3DVN U;  1U4A A;  2ZPY A;  3DHH C;  2WXP A;  3RMK C;  2Y5B B;  3M62 B;  2GBK A;  4US9 A;  1A70 A;  2BYT A;  4OVZ A;  3E9S A;  3HRD D;  2DZJ A;  4EZJ A;  2WWZ A;  4GGQ A;  2K22 A;  1ZXI A;  3KUC B;  1STE A;  1M4V A;  3ML8 A;  4B9K A;  2SAK A;  3VRB B;  4E71 A;  4LDT B;  5G5G A;  1GAQ B;  2JU6 X;  3U8Z A;  1X1M A;  2KDE B;  1TS2 A;  5BMG A;  1WXV A;  1XLN A;  1L2N A;  5JXV A;  4W9E A;  1LM8 B;  4GU2 A;  1TS5 A;  1QKZ A;  3QA8 A;  1GOZ A;  3SHQ A;  3AN1 A;  2LRW A;  1L0V B;  1QOF A;  4ZYS A;  1WJU A;  2X8X X;  2BKF A;  3RNE C;  4C7Y A;  2UYZ B;  2WU5 B;  5T8I A;  3ZRC A;  1HE8 A;  2WXJ A;  2DYM A;  1EM7 A;  5D7G A;  3ZJT A;  3CSF A;  4GSW A;  4ACF A;  1SE4 A;  4ARC A;  3BVM A;  3N1Y C;  4ASW C;  5AZG A;  1AN8 A;  1N63 A;  2KC1 A;  3N1Z C;  2L3Z A;  3WAO A;  2LVQ A;  1QZE A;  1C77 A;  3DDC B;  4ICV A;  4S0R A;  2L7R A;  2FUH B;  4FBJ B;  2V9H A;  4XDC A;  2WXF A;  4NJ7 A;  1E0Z A;  1SE3 A;  3SFD B;  2L00 B;  3PRM B;  1DGJ A;  2FIF A;  2V1Y A;  3CWI A;  1I4H A;  2KN4 A;  1KLG D;  4REZ A;  1FFV A;  2HTH A;  3MTN B;  1NI2 A;  2WDT B;  3FIL B;  2KMA A;  2PMV A;  3EHV A;  2JUO A;  2M1M A;  1Z5S B;  1V2Y A;  1YOV B;  1OEY J;  4EKU A;  4IKG A;  2NS5 A;  3AU5 A;  1J0G A;  4IWP A;  1LQB A;  4YXD B;  2D2Q A;  3O65 B;  3P4P B;  1XD3 B;  1T0Q C;  1D5X C;  3AM9 A;  3PPA A;  1WI0 A;  1N61 A;  1I4Q A;  1RLF A;  4CQN A;  4XWT A;  3NZU A;  2WXG A;  4JGH B;  3ZRF A;  4B0M A;  3MHZ A;  4DDI D;  3EGR A;  3AEC B;  3QJZ A;  3U7Z A;  1XLQ A;  2KWC A;  2VRR B;  4WWM A;  2WQY B;  4M0W A;  3VFK A;  4KZ0 A;  4MGY E;  1R7S A;  4C56 C;  2EEL A;  1I7H A;  3T9L A;  1MI0 A;  4IM0 A;  3PLU A;  3IAS 1;  4LJP B;  3VTU A;  1MFW A;  3KWV A;  1YJ1 A;  4OZA A;  2O2V B;  3PGE A;  1XCQ L;  3ZQ4 A;  4AJW A;  4IWQ A;  4GMV A;  4WIP A;  1NEN B;  2PVO D;  3RYT A;  4JLC A;  1PDX A;  5AUK A;  2BYF A;  1D3Z A;  2KJ6 A;  5CHW A;  2W55 A;  1MG8 A;  2BBC A;  2G4D B;  1JML A;  1E90 A;  2WXR A;  2KFJ A;  2KTR B;  2WYQ A;  4HCN B;  4EFO A;  5AEK B;  1IBX B;  3PVL A;  1JAL A;  4IG7 B;  1L5P A;  3Q8B A;  1YIW A;  3RUL A;  2DZM A;  3EUB 2;  1C1Y B;  3APC A;  4ZRK A;  3BZD B;  2W9N A;  3Q8C A;  3MC8 A;  1NYQ A;  2RDH A;  4C7Z A;  3DVN V;  4HJG E;  4FJV B;  2MJD A;  2ONQ A;  3NZS A;  3JSV B;  2HD5 B;  4WWP A;  4XWW A;  1EF1 A;  3NHE B;  2EMT A;  4ZDV A;  3N3K B;  5D3D A;  1V97 A;  3PZ8 A;  2PE6 B;  2N1V A;  5IKC M;  2N9P C;  4MM3 B;  5GMV A;  3TEZ A;  3EEC A;  1MHX A;  2IJ0 A;  2ZCC A;  3RN9 C;  4YSX B;  1ESF A;  3AE7 B;  1R4N B;  3RZF A;  1ZOY B;  2V0G A;  3RNB C;  1OGW A;  1WSP A;  1N60 A;  4FJY A;  4HPM B;  3ZXV A;  3KH0 A;  1G6J A;  3W9C B;  1HEZ E;  2WXL A;  1XO3 A;  2BW2 A;  2PEA A;  3RNA C;  3UQA A;  1RRB A;  2DHZ A;  3DBL B;  4QAY A;  2D11 A;  4CYE A;  2JXX A;  5G2N A;  2M0X A;  2MA9 B;  3IVF A;  1E9M A;  3L16 A;  2ZVO A;  4PS8 A;  3GP7 A;  4XC2 A;  1QQR A;  4AOF A;  4IOI E;  1SE9 A;  3Q3O C;  1D4B A;  3AEB B;  2XK5 B;  1WGY A;  2WXH A;  2KD0 A;  4ZRI A;  3IT6 B;  1F9J A;  2IBI B;  4LNK A;  4DBG A;  2N7D A;  1TZO A;  4DWF A;  1WXQ A;  3RCZ A;  3KVF B;  4KDI C;  4FN2 A;  1OTR B;  3PSE B;  3BYY B;  4BBN C;  3AE1 B;  4F7Z A;  2W3R A;  4MH0 E;  1D5Z C;  1E6E B;  3Q3J A;  5E6N A;  1EO6 A;  2JRI B;  2JWU A;  1ZXH A;  3R8B A;  1JCK B;  3U7D A;  2KMC A;  1SF0 A;  1WMH B;  1DOX A;  2PW9 A;  2KQS A;  2WXI A;  2C60 A;  4A3P A;  2WGS A;  2LHD A;  2K0P A;  1XLP A;  2KJH B;  1FMA D;  1Y8R C;  2KN5 A;  4HWI B;  2DEN B;  4K3C A;  3DWM A;  2WX1 A;  1T0R C;  4N9F 4;  1SXT A;  4BFR A;  1WXM A;  1H4R A;  5HG2 A;  4NPN A;  2IDY A;  4AS1 A;  1V5O A;  1YQ4 B;  1NI3 A;  3AE9 B;  2VZK D;  3JVZ X;  2IPK D;  1ZPS A;  2CJO A;  4KIK A;  1YNT E;  2KX0 A;  4LTU A;  4A20 A;  4R3D A;  3APD A;  1YN3 A;  2M0A A;  4MGZ E;  5D94 A;  4W9H A;  2BWF A;  3N30 A;  3VHT C;  4FLH A;  3SFE B;  2M4N A;  2KWV B;  1V1P B;  1RAX A;  2MLB A;  4ZRJ A;  1SEB D;  2QSD A;  4RM9 A;  1QOG A;  3Q8A A;  4WAF A;  1WGD A;  4L2Y A;  2JZP A;  1BT0 A;  4RF1 A;  2BQQ A;  1B1Z A;  1TKE A;  3ZO5 B;  3VR9 B;  1R4M I;  2E6X A;  4GDL B;  2UWQ A;  3DVG Y;  3R2I A;  2AX5 A;  4PS3 A;  3N1X C;  4MJS A;  4P7I A;  2L1A A;  1EUV B;  4GB9 A;  2MBE A;  2WS3 B;  3LYY A;  3DQV A;  4OVV A;  3KWL A;  3HVZ A;  3K9P B;  1R4N I;  4K1R B;  4K7W A;  5DPT A;  2KTF A;  3WAN A;  1SJH D;  1WXS A;  2J0J A;  4W9J A;  1FO4 A;  3RT3 B;  1TS3 A;  2GBR A;  4BOS C;  2BGF A;  2VZK B;  1F52 A;  3CIR B;  2BB5 A;  4HPL B;  3SEB A;  4JE3 B;  2N9L A;  1XF5 L;  2AEH A;  2XBB C;  3D32 A;  4ZRP A;  3TEX A;  3RFZ B;  4ANV A;  3AH7 A;  1K8R B;  1E8X A;  1HA5 A;  3UF8 A;  2LD9 A;  2GBJ A;  4JQW C;  3URY A;  3QX1 A;  2SEB D;  4KVG B;  4M00 A;  4ZRQ A;  1E7U A;  3P4Q B;  1FFU A;  1E7P B;  1FXT B;  1WFY A;  3NVZ A;  4MEM A;  1DYQ A;  3AB5 A;  5BO4 B;  2QDF A;  3ZDM C;  2MH7 A;  2KHW B;  1MJD A;  4KGS A;  2CU1 A;  5IN7 A;  4W9L A;  4BZA A;  2OED A;  1V81 A;  1C4A A;  3V60 A;  1N6Z A;  2LXA A;  4ANW A;  5CX3 A;  4NAW B;  1V9J A;  1HZ5 A;  1JRP A;  3X0W A;  1FCC C;  2CJN A;  2JX5 A;  4WJN A;  1E5W A;  2WDV B;  2K25 A;  2DYB A;  1JW9 D;  4HDQ A;  4J3O D;  4IC7 B;  2ZW0 A;  1YX6 B;  4IUM B;  4RH6 A;  2WU2 B;  1WIA A;  2L0F A;  1SB3 C;  2K1F A;  2DAJ A;  4LCD E;  3ABV B;  3RI7 C;  3VH4 B;  3V62 A;  3KLS X;  3PO0 A;  5AZF A;  4LDT D;  1CK1 A;  1WX9 A;  2N7E A;  1WJ6 A;  1HTQ A;  3H7P B;  2DBY A;  3WA0 A;  2QMT A;  2MQJ A;  2L0T A;  1YJJ A;  2D3A A;  2CR5 A;  4RGM A;  4C00 A;  2J53 A;  5DCN A;  2Y5C A;  1WM2 A;  2K5P A;  4GOC A;  2O6V A;  4JWS C;  1SE2 A;  3OG5 A;  2MBB B;  5IAA C;  3PRE A;  1ACC A;  2ASQ A;  1D6E C;  2WXK A;  5DPW A;  2KDB A;  2BS4 B;  4HKQ A;  1EWC A;  4WJQ A;  4TKN A;  1ZE3 D;  2INC C;  4IWO A;  2DLB A;  3MP9 A;  3RD2 A;  4CHK A;  3T3O A;  3E56 A;  3HM6 X;  3L10 B;  2DWQ A;  4MH8 A;  1Q10 A;  3LB8 C;  2KOX A;  3GE8 C;  4HVB A;  3RNF C;  2KYW A;  2BS3 B;  1KH0 A;  1MPE A;  3FIL A;  2J7Q B;  2ZEQ A;  4ZYN A;  2WNM A;  1JRU A;  5CHV C;  2O6V D;  4KGR A;  4WWN A;  3H6N A;  5FR6 A;  3B08 A;  2MSE D;  2Y3A A;  1T6B X;  4DXA B;  1UUP A;  5G55 A;  4AP4 C;  4LNI A;  2LGY A;  3A1Q B;  1WYW B;  1WM3 A;  4W9F A;  1QT9 A;  1UH6 A;  2IND C;  5D6J B;  1WGH A;  5C23 A;  2KT7 A;  4A6Q A;  4MEL A;  3PZ7 A;  4E74 A;  2K8B A;  1OFF A;  4DDG D;  1TBE A;  1ZP0 B;  2GMI C;  3PHW B;  2JVC A;  2K3U A;  3ZNH B;  3DBR I;  2EKI A;  3I9V 1;  3IT4 B;  4NNJ B;  4HJK A;  3AEE B;  2AQ3 B;  2B76 B;  4O1N A;  2MBO A;  5AUI A;  3TSS A;  4AUQ C;  1E10 A;  2O2V A;  5CHF A;  1L6U A;  2J52 A;  3VTW A;  4HCP B;  2RPV A;  1EWY C;  4FUL A;  2K9X A;  5C3J B;  4II2 B;  2L76 A;  4OHJ A;  2AQ1 B;  4G50 A;  5FR3 A;  1S3S G;  3OJ4 B;  1AW7 A;  1F1H A;  2KTR A;  1IBX A;  3WAL A;  4IDI A;  2QC8 A;  5JHB A;  4MAC A;  2N9X A;  3V3X A;  2O6V B;  2MP2 B;  4ITK A;  3WAM A;  4KGT A;  3KUD B;  2L8J A;  5EE9 A;  1D5M C;  4W9G A;  2CHZ A;  2K6D B;  1SIJ A;  3A4R A;  4ZHO A;  4WJO A;  3GE3 C;  1J7B A;  2M8S A;  2GI9 A;  3KYD D;  3JSV A;  1UZX B;  2AQ2 B;  2BF8 B;  3LXF A;  3NUH B;  3ALB A;  2H89 B;  2PJH A;  1TS4 A;  2REX A;  3BIN A;  4MM3 A;  3CF6 E;  5J17 A;  3KQ4 A;  4US8 A;  4NJ6 A;  4IM3 A; 
#chains in the Genus database with same CATH homology
 2PEA A;  2MW5 A;  2RR9 A;  3UQA A;  2QHO A;  1RRB A;  4GIV A;  2IYD B;  2NVU I;  2DHZ A;  3KUZ A;  2M17 A;  4IW0 A;  2FNJ B;  3DPD A;  2KK8 A;  4DHZ E;  2PPH A;  1GC7 A;  2DZI A;  2LGX A;  3NOB A;  2D11 A;  5IA7 A;  3QAR A;  2FCQ A;  2XEW A;  1H8C A;  4CYE A;  4G0N B;  4FA6 A;  2EMS A;  2JXX A;  3L54 A;  5G2N A;  2M0X A;  3A4S C;  5J2R A;  2MA9 B;  2KNB A;  3IBE A;  3IVF A;  3PV1 A;  1WXA A;  1WZ0 A;  2ZVO A;  3L16 A;  3VUW A;  5JH5 C;  4PS8 A;  3PLV A;  1OQY A;  4G11 A;  3U30 A;  4XC2 A;  2JPH A;  1V80 A;  3NY5 A;  3ML9 A;  4AOF A;  4IM2 A;  1SE9 A;  2AWT A;  3ZTD A;  1NDD A;  3DCG A;  3HIZ A;  3R66 C;  1WE7 A;  4WJP A;  4BKS A;  2XK5 B;  1WGY A;  3ENE A;  1TTN A;  2KD0 A;  5CTR C;  4ZRI A;  4M8M A;  4GDK B;  1XT9 B;  1F9J A;  4KZC A;  4AWJ A;  4HLE A;  2IBI B;  5HKH A;  2C7N B;  4DBG A;  2N7D A;  4I6L B;  4DWF A;  3RCZ A;  4BKG A;  3KVF B;  3CST A;  3TL5 A;  4KDI C;  1VCB A;  1J8C A;  3Q3F A;  1E8Y A;  3AXC A;  4FN2 A;  1OTR B;  1GUA B;  3PSE B;  1GG3 A;  2JZZ A;  4FHJ A;  4W9I A;  2KXJ A;  4NY0 A;  4DHZ B;  4BBN C;  3C0R B;  4F7Z A;  2LJ5 A;  4ICU A;  2KQ7 A;  2WX0 A;  2XK5 A;  4MH0 E;  4K7S A;  1ISN A;  3Q3J A;  5E6N A;  1EO6 A;  5LXH A;  2JRI B;  4GDK A;  4WWO A;  3PT2 B;  4EEW A;  3OAW A;  3TJP A;  2KLG A;  3GZN I;  3U7D A;  3QC8 B;  2AYO B;  4J6I A;  4MSQ B;  3WAP A;  2KMC A;  4II3 B;  1WMH B;  2Z0E B;  3HK0 A;  2KQS A;  1UD7 A;  3M95 A;  4BKS D;  1P1A A;  2C60 A;  3SD5 A;  3ZKJ C;  4E3C A;  4I6N B;  3VUY A;  4A3P A;  1LXD A;  3AI5 A;  3V6C B;  1SGH A;  4TUU A;  3EFU A;  1SIF A;  1E7V A;  3UGB B;  2A4Z A;  2MBH A;  3VTV A;  3B0A A;  2KJH B;  4B95 A;  3W1S C;  4EUT A;  3JW0 X;  1Y8R C;  2KN5 A;  1LFD A;  1ZW7 A;  1WMH A;  3QK0 A;  4W9D A;  5LXI B;  2G45 B;  4HWI B;  4HXD A;  3R7R A;  3ZUN A;  2DEN B;  2BPS A;  3ZW3 A;  4KIK B;  2WX1 A;  2N9E B;  1Q0W B;  1YD8 U;  4F1S A;  3UQB A;  4N9F 4;  4BFR A;  1V6E A;  2D10 A;  1WXM A;  2LXC A;  1H4R A;  3GOE A;  3KYC D;  4PYU A;  4BKT A;  3AU4 A;  1A5R A;  2IO0 B;  2J0M A;  1Q5W B;  3LDZ E;  4NPN A;  3RUI B;  1V5O A;  5JZE B;  3QQ8 B;  3EC8 A;  4EZL A;  3LJ3 A;  4URK A;  3JVZ X;  4M8N A;  2LVO A;  3DVG X;  5LLI A;  3H9D A;  2J0K A;  3QHT A;  2C7H A;  2KX0 A;  4KIK A;  4PS7 A;  3L08 A;  4A20 A;  2IY1 B;  3CMM B;  3APD A;  4MGK E;  2NBU A;  4MGZ E;  5D94 A;  1J19 A;  3ZDT A;  1I42 A;  2CKH B;  4W9H A;  3VXW A;  5DPS A;  1GJZ A;  2BWF A;  2LI5 A;  3ECI A;  3N30 A;  2AL3 A;  2FID A;  3PRP B;  3VHT C;  1GC6 A;  4FLH A;  2KFK B;  2M4N A;  2KWV B;  1WJ4 A;  1RAX A;  2KDF B;  2MLB A;  1YX5 B;  2RSU A;  4MDK E;  4NQK E;  4ZRJ A;  4RM9 A;  1TGZ B;  3A9K B;  1WGD A;  3TMP B;  4WAA A;  3VVW B;  4W9K A;  1P0R A;  2ZVN A;  4B6W A;  1WJN A;  1RFA A;  2LVP A;  3V6E B;  1UEL A;  4HDO A;  1BT0 A;  4MJS B;  4K7U A;  3VAW A;  1CMX B;  4TQ0 A;  1E8W A;  2KJR A;  1XQQ A;  4KV2 A;  4ANX A;  2KFK A;  1WE6 A;  3P2B A;  3DBS A;  5L95 C;  3HM3 A;  3ZIM A;  1V86 A;  2K39 A;  3ZO5 B;  2AL6 A;  1WR6 E;  1R4M I;  4CO7 A;  4NQL B;  4GDL B;  2UWQ A;  3A9K A;  3DVG Y;  3PTF C;  5JHA A;  1PQS A;  2G3Q B;  4EOY A;  2I1K A;  1ZKH A;  3A33 B;  3L13 A;  3DVN U;  1U4A A;  2JF5 A;  2ZPY A;  4PS3 A;  4FJZ A;  2IZV B;  4MJS A;  4P7I A;  3QAQ A;  2YLM A;  1EUV B;  1WX8 A;  2Y5B B;  3WIM A;  2LZ6 A;  4GB9 A;  3R3M A;  2MBE A;  3M62 B;  2GBK A;  3DQV A;  1Q1O A;  4OVV A;  2BKR B;  2KDI A;  2LRU A;  3K9P B;  1R4N I;  4K1R B;  4K7W A;  4GDL A;  5DPT A;  4BBN F;  3PS6 A;  1I35 A;  2KTF A;  2KLC A;  3WAN A;  1WXS A;  3ZLZ A;  2MCN B;  2J0J A;  4W9J A;  2ZCB A;  1WRD B;  3RT3 B;  4KDL B;  3A9J B;  1AAR A;  2DZJ A;  4TQ1 A;  2GBR A;  4BOS C;  2BGF A;  4EZJ A;  2WWZ A;  4GGQ A;  3KUC B;  1NBF C;  3B1L X;  3MHS D;  2JT4 B;  2NBW B;  2DX5 B;  2RGF A;  4HPL B;  2JWZ A;  3ML8 A;  4B9K A;  2V3S A;  3PHX B;  2PE9 A;  3TCA A;  1KLV A;  2AEH A;  3APF A;  2XBB C;  3D32 A;  3DOW A;  4E71 A;  2LAS A;  4LDT B;  4ANV A;  1V5T A;  1K8R B;  1E8X A;  3U8Z A;  3UF8 A;  1X1M A;  2KDE B;  2NCN A;  3A9J A;  2BYV E;  2LD9 A;  4JIO U;  3K9O B;  2GBJ A;  5KHQ A;  4JQW C;  1GNU A;  2ZPN A;  1WXV A;  3QX1 A;  5TR5 A;  1L2N A;  4I6P A;  4KVG B;  4W9C A;  4ANU A;  4W9E A;  1E7U A;  1LM8 B;  4DK5 A;  1EF5 A;  1FXT B;  1WFY A;  3BY4 B;  1OEY A;  4GU2 A;  4MEM A;  3ZTC A;  3NS8 A;  5BO4 B;  3ZDM C;  3QA8 A;  3QWZ B;  3SHQ A;  2JY6 A;  3OLM D;  2IO2 B;  2KHW B;  2LRW A;  4JL9 A;  4FHK A;  2CU1 A;  5DPR A;  3QCA A;  3M63 B;  2NBV B;  4W9L A;  2BWE S;  1WJU A;  4F8C B;  2BKF A;  5L83 A;  4RMA A;  2C7M B;  1V81 A;  4RM8 A;  3V60 A;  2UYZ B;  4WQO B;  1P3Q U;  4KSK C;  1P9D U;  3W1S A;  2LXA A;  3ZRC A;  5CX3 A;  1HE8 A;  4NAW B;  2MRP A;  1ZGU B;  4BOZ B;  4ANW A;  1V9J A;  2ZZP B;  1IPG A;  2DYM A;  3X0W A;  3L17 A;  5AZH A;  5D7G A;  1VD2 A;  4XZ4 A;  2GBM A;  4X57 B;  2HE7 A;  3CSF A;  4WJN A;  1E5W A;  2I1J A;  2K25 A;  2DYB A;  2KO3 A;  4GSW A;  4HDQ A;  1IYF A;  4IC7 B;  2N4F A;  1YX6 B;  4IUM B;  2R2O A;  1WIA A;  2L0F A;  3W1Y A;  2K1F A;  2DAJ A;  2FAZ A;  4LCD E;  3VH4 B;  3IG3 A;  3V62 A;  4ASW C;  5D2M B;  5AZG A;  2GOW A;  2GBN A;  4LDT D;  4NAW A;  2KC1 A;  5AZF A;  1WX9 A;  3ZVV A;  2L3Z A;  2MX2 A;  2LVQ A;  3WAO A;  2N7E A;  1WJ6 A;  1QZE A;  3H7P B;  3TBL D;  2NR2 A;  3DDC B;  2YVC A;  1KOT A;  3WA0 A;  2LUE A;  4ICV A;  2MQJ A;  2L7R A;  2FUH B;  4FBJ B;  2L0T A;  2CR5 A;  4NJ7 A;  4YL8 A;  2ZNV C;  2B3A A;  1S1Q B;  5DCN A;  4KSL C;  2D07 B;  1Z2M A;  1WM2 A;  2L00 B;  4GOC A;  4EZK A;  3PRM B;  2O6V A;  2JZ3 B;  2FIF A;  2V1Y A;  2MBB B;  5IAA C;  3PRE A;  3AUL A;  2ASQ A;  2HTH A;  3MTN B;  3H7P A;  2BYE A;  1NI2 A;  3H1U A;  2WDT B;  5DPW A;  2KDB A;  2C9W B;  2KMA A;  3DBH I;  3EHV A;  4WJQ A;  2JUO A;  2M1M A;  4DHJ B;  1Z5S B;  2G4S A;  4TKN A;  1V2Y A;  4K81 A;  4IWO A;  1OEY J;  3RD2 A;  4CHK A;  4EKU A;  3HM6 X;  3L10 B;  2NS5 A;  3AU5 A;  1J0G A;  5C1Z A;  4IWP A;  2KOX A;  1LQB A;  1WY8 A;  2D2Q A;  4HVB A;  3O65 B;  2OJR A;  5E6P A;  3ZNG C;  2L05 A;  1XD3 B;  1M94 A;  2J7Q B;  3PPA A;  2ZEQ A;  3HHM A;  3H7S A;  4ZYN A;  3V61 A;  2A5U A;  1WI0 A;  1JRU A;  4M0W B;  1RLF A;  5CHV C;  2O6V D;  4WWN A;  3M3J A;  3H6N A;  5FR6 A;  3NZU A;  3B08 A;  2MSE D;  4JGH B;  3ZRF A;  4DXA B;  2MWS B;  1T0Y A;  5G55 A;  1WR1 A;  4AP4 C;  2KX3 A;  4DDI D;  2CS4 A;  2LGY A;  3QJZ A;  3A1Q B;  1C3T A;  1WYW B;  1WM3 A;  2HJ8 A;  2KWC A;  2VRR B;  3QIJ A;  4W9F A;  2LGD A;  1UH6 A;  4LJO B;  3ZNI D;  5KHO A;  2DZK A;  3KW5 B;  3VFK A;  2LWP A;  4KZ0 A;  1TZ1 A;  4MGY E;  3DBL I;  3T9L A;  2KAN A;  4IM0 A;  5D6J B;  3PLU A;  4G3X B;  3VH3 B;  1WGH A;  4LJP B;  4OVU A;  5C23 A;  3VTU A;  1L7Y A;  2FCN A;  3RZW C;  4MEL A;  1YJ1 A;  4E74 A;  3A1Q A;  2K8B A;  2O2V B;  4DHJ D;  3PGE A;  2N1W A;  4AJW A;  4DDG D;  1TBE A;  4IWQ A;  4GMV A;  1KJT A;  3SU8 X;  4MSM B;  2CHX A;  2GMI C;  3RYT A;  4JLC A;  4AJY B;  1WF9 A;  2ZJD A;  2BYF A;  3PHW B;  2JVC A;  2KJ6 A;  1D3Z A;  4GN1 A;  5CHW A;  1MG8 A;  1WZ3 A;  3IFW B;  3UIN B;  3ZNH B;  1E8Z A;  2DYO A;  2IO3 B;  3DBR I;  4NNJ B;  2NPT B;  2G4D B;  4HJK A;  2KKC A;  1E90 A;  4AUQ C;  2KFJ A;  4GXB A;  2KTR B;  2MBO A;  2WYQ A;  4HCN B;  4EFO A;  5AEK B;  3PVL A;  4IG7 B;  2K8C A;  3PZD A;  2O2V A;  5CHF A;  4HK2 A;  3SDL C;  3IHP C;  5E6O A;  3VTW A;  4HCP B;  1V49 A;  1WGR A;  1YIW A;  3RUL A;  2Z0D B;  4FUL A;  2CHW A;  2DZM A;  4II2 B;  2FCS A;  1C1Y B;  2L76 A;  3APC A;  4ZRK A;  2W9N A;  2Z59 B;  1WX7 A;  4G50 A;  2NPT A;  2K6Q A;  1KM7 A;  1S3S G;  3OJ4 B;  3DVN V;  2KTR A;  2KVR A;  2IY0 B;  2MBQ A;  4FJV B;  3WAL A;  4FAD A;  3NZS A;  3JSV B;  2FCM A;  2HD5 B;  4WWP A;  5JHB A;  1EF1 A;  1UBQ A;  1YQB A;  2N9X A;  3NHE B;  2EMT A;  2O6V B;  3N3K B;  2MP2 B;  3JYU A;  4PYZ A;  3WAM A;  4ZDV A;  5EDS A;  2K8H A;  3KUD B;  2L8J A;  2PE6 B;  2JRH A;  3VQI A;  2IO1 B;  2N1V A;  2RD0 A;  4BVU C;  1WGG A;  1UBI A;  2N9P C;  3L0W B;  2RPQ A;  4W9G A;  2ZNV B;  2CHZ A;  5GMV A;  2D3G A;  2DAF A;  4TV3 A;  3N32 A;  2K6D B;  3MJW A;  3EEC A;  3A4R A;  4WJO A;  2KZR A;  2ZCC A;  2R2Q A;  2M8S A;  3KYD D;  3JSV A;  3T8M A;  1UZX B;  2EKE C;  2KC2 A;  1P98 A;  3PRZ A;  3UIP B;  2BF8 B;  2MP2 A;  3VUX A;  3RZF A;  3ALB A;  4XX5 A;  3I3T B;  2PJH A;  3R7Q A;  4A3O A;  2REX A;  3BIN A;  1IP9 A;  1OGW A;  2OOB B;  4MM3 A;  3S2A A;  3TIX A;  3UIO B;  3ZNZ B;  4FJY A;  1UGM A;  3CF6 E;  3OJ3 A;  2KWU B;  2V4L A;  4HPM B;  5J17 A;  4NJ6 A;  5J18 A;  3KH0 A;  1WH3 A;  1G6J A;  3ONS A;  4MGI E;  3X23 A;  3VDZ A;  4IM3 A;  2C5L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...