2VRRB

Structure of sumo modified ubc9
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
79
structure length
79
Chain Sequence
MEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUMO-CONJUGATING ENZYME UBC9
publication title Ubc9 sumoylation regulates SUMO target discrimination.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cell cycle/ligase
total genus 18
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2008-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2vrrB00
1UBIA 2RGFA 4LDTB 1SE9A 2IZVB 2IYDB 3EHVA 1J19A 2LRWA 2JZZA 2L7RA 3L08A 2G4DB 3L16A 2KJHB 3ONSA 4OVUA 2MBHA 4DK5A 3HHMA 4BFRA 2MRPA 4LCDE 4MH0E 2Z0DB 3VQIA 1E8YA 2KLGA 4TKNA 2G4SA 5AEKB 1TBEA 2KFKA 4EEWA 2CHZA 1KJTA 4IW0A 3K9OB 4NAWA 1QZEA 2V1YA 1WYWB 1NBFC 1BT0A 2AL6A 1SIFA 1RFAA 1GUAB 2N4FA 3ECIA 4GDLA 4MGIE 2O6VA 4TUUA 3VDZA 2O2VA 4G11A 2LASA 1UZXB 1WXAA 3V6EB 3W1YA 2W9NA 2G3QB 2WWZA 1Q0WB 3S2AA 4GDKB 3PT2B 1UH6A 4JQWC 2CKHB 3B1LX 2Z0EB 2KTRA 2ZVOA 4LJOB 3IBEA 3SU8X 3V60A 2NBWB 2LXCA 1WRDB 2N9EB 3ENEA 4LJPB 3VUXA 4DXAB 4HCPB 1NDDA 2KLCA 4HDQA 3ZW3A 4IG7B 2LRUA 3H7PB 3Q3FA 4AUQC 4M8MA 2CR5A 3LDZE 2DZJA 3B08A 2Z59B 4ANXA 2BPSA 5AZGA 2MQJA 4MJSB 5E6OA 2BWFA 2KJRA 2PJHA 3NHEB 4GU2A 3KYDD 4W9EA 2MA9B 2K8BA 1HE8A 4AWJA 3ZRFA 1IYFA 1D3ZA 4NQKE 1KOTA 2I1JA 5LLIA 3A1QA 4K81A 4MELA 4IM0A 4WJQA 4WQOB 1E8ZA 2EMSA 2RD0A 2KN5A 2GBRA 1WGGA 2KDFB 4FULA 2HTHA 3H1UA 4FA6A 2DYBA 2XBBC 2YLMA 4BKGA 4GIVA 3KVFB 1H4RA 2KDEB 3L10B 3A9KA 2K8CA 1Y8RC 1P98A 3DBLI 5HKHA 2FNJB 5D94A 4E3CA 2RSUA 1V49A 2L0FA 2MSED 2ZPNA 1YQBA 5CTRC 5IA7A 2KKCA 4W9FA 4KIKA 3QA8A 5G2NA 3APFA 4DHZE 2GBJA 1I35A 2D3GA 2LWPA 1V5OA 3DDCB 2JT4B 3OJ3A 4DHJB 3R7RA 2IY1B 3KH0A 3WIMA 1L2NA 2BGFA 1WM3A 4I6NB 2KK8A 2I1KA 1Q5WB 2K1FA 2ZCBA 1LXDA 1G6JA 2KC2A 3GZNI 1YJ1A 4HCNB 3VVWB 3PRMB 1GG3A 3QHTA 2KFKB 3U30A 3ZO5B 1J8CA 3PGEA 3VTVA 4GMVA 1SGHA 4NAWB 5JHAA 2NBVB 3JVZX 2LZ6A 2AWTA 2OJRA 3CSFA 2M1MA 4XC2A 4EOYA 1C3TA 4WWNA 4PS3A 4WJPA 1UD7A 2C60A 1RRBA 1Z5SB 2D10A 2CU1A 2K39A 4GDLB 2KXJA 4OVVA 3X0WA 4MSMB 1J0GA 2KVRA 2FCMA 2O6VB 3R3MA 4NQLB 3PPAA 3D32A 4HPLB 2XK5A 3QAQA 4NJ6A 1WY8A 4K1RB 5TR5A 2MP2A 1WGRA 2KMCA 3VTUA 3OLMD 4FBJB 1WM2A 3ZUNA 5L95C 3L17A 2KTRB 3SD5A 1EF5A 4BKTA 2NR2A 3IG3A 4FJVB 4IM3A 1GC7A 4B95A 4X57B 1WX8A 3ML9A 3RULA 2K25A 4DDGD 2WYQA 3R7QA 2HJ8A 3L0WB 4IWQA 4DWFA 1ZW7A 2BYEA 5G55A 2K8HA 3R66C 3C0RB 3APDA 4MGYE 1FXTB 4W9IA 1YIWA 4EZKA 4DDID 4NNJB 2KMAA 2KZRA 2CHXA 1MG8A 2LUEA 3DBRI 1TTNA 1V9JA 4GGQA 2M17A 4K7SA 3CMMB 1WGYA 2LVPA 2MX2A 4IM2A 3ZTDA 3VH3B 2IO2B 2LXAA 4TV3A 3ZNID 2JXXA 1TZ1A 2JRHA 2KWUB 4IC7B 1WH3A 3EFUA 1WR6E 1GC6A 2J0KA 1S3SG 4FHKA 2L76A 4WWPA 5IAAC 3NOBA 2L0TA 2LI5A 2N9PC 3KW5B 3A9KB 1WGHA 4PYUA 3VFKA 1X1MA 1P9DU 4W9GA 4HXDA 2R2QA 2JF5A 2MBBB 1OEYJ 5CX3A 1E8WA 3HK0A 2N9XA 3ZRCA 3M95A 2MLBA 4KIKB 4PS7A 2FIDA 1RAXA 3TCAA 5L83A 3ZNHB 2WDTB 1YX5B 2PE6B 4ZRIA 2JY6A 2KDBA 2K6QA 3UIOB 3W1SC 2DYOA 2VRRB 2DHZA 5GMVA 1NI2A 4BOSC 2BKFA 1WJ6A 3SDLC 4EZLA 4KV2A 3QARA 5J2RA 1WXVA 1Q1OA 3N32A 4JGHB 5J18A 5C23A 4ICVA 1WMHA 2AYOB 2M8SA 3CF6E 2LGYA 2BYFA 3P2BA 4W9HA 2J7QB 3TBLD 1WR1A 1EUVB 1WXMA 3DVGY 2DENB 2RR9A 3H6NA 2DAFA 4W9KA 1GNUA 4M8NA 2AEHA 2HE7A 4MM3A 2C5LC 1YD8U 3VHTC 3QIJA 4A3OA 3QC8B 2FAZA 3ZVVA 3WAPA 3IVFA 2KNBA 3WALA 4N9F4 2ZZPB 3M63B 1EO6A 2NPTB 3JYUA 2XK5B 2FUHB 2IY0B 2MBEA 2V4LA 3WAOA 4KZ0A 2ZNVB 2QHOA 2ZPYA 3DOWA 3RYTA 3MHSD 3DBHI 3NZUA 2DZIA 4IUMB 4CO7A 2KWCA 2N1VA 3WAMA 3V6CB 3N30A 3EECA 2AL3A 4DBGA 4I6PA 3DVNU 2NS5A 1V5TA 2WX0A 4EFOA 3ZDTA 5E6PA 3DCGA 4J6IA 2JUOA 1WJ4A 2R2OA 3ZIMA 5BO4B 4KDIC 1OGWA 1E7VA 5DPSA 3AU5A 3QCAA 4ANVA 1C1YB 3PLUA 1E5WA 3DPDA 2MW5A 4P7IA 1WE7A 3UQAA 2JZ3B 2GBNA 1AARA 2D11A 3ZKJC 1V81A 2C7HA 2C9WB 2LD9A 4DHZB 4KVGB 2L3ZA 1T0YA 3A4RA 3DVNV 4CHKA 2KX0A 1JRUA 1P1AA 3A9JA 3APCA 2J0JA 4ZYNA 3VUYA 2G45B 1YX6B 3ZNGC 1Z2MA 2GMIC 1WJUA 2KFJA 2O2VB 1OEYA 1LFDA 2LVQA 2NBUA 4GOCA 4GSWA 1WXSA 2HD5B 3JW0X 4MJSA 3ZDMC 2DZMA 3RZFA 1S1QB 3QQ8B 1VCBA 2XEWA 1UGMA 2REXA 2KWVB 5AZHA 3PZDA 2LVOA 2LGXA 3KUZA 4ZDVA 3DVGX 4XZ4A 4G3XB 4AJWA 4HLEA 3Q3JA 2L00B 3VH4B 3IFWB 4TQ0A 4W9CA 3A4SC 1EF1A 3WANA 3KYCD 3QJZA 2Y5BB 3O65B 4I6LB 4HJKA 1F9JA 4CYEA 2B3AA 4KSKC 2FIFA 2KDIA 3L54A 2EMTA 4JIOU 1UELA 1WZ3A 4AOFA 4MGKE 3QWZB 4B9KA 5DCNA 4HPMB 2JPHA 3A1QB 3PHXB 5KHQA 3UIPB 2IO1B 1XT9B 4IWOA 3PRZA 4DHJD 4ZRKA 2FCQA 4PYZA 2LGDA 4NY0A 2FCSA 1U4AA 3PREA 5DPRA 1L7YA 4WWOA 2KANA 4B6WA 2CS4A 4WAAA 5LXHA 2MBQA 1WF9A 3M3JA 3PS6A 3NS8A 2JRIB 3ALBA 3PV1A 3EC8A 4ANWA 2BWES 3V62A 2D2QA 2ZNVC 3PTFC 4EKUA 3IHPC 4BVUC 1RLFA 2MBOA 4W9JA 1K8RB 2ASQA 2A5UA 3PHWB 3JSVA 3A33B 3QX1A 4A3PA 3CSTA 3UGBB 5CHWA 2MCNB 2N1WA 1E8XA 3RT3B 4W9LA 2C7MB 4JL9A 3HM6X 3LJ3A 2DX5B 5LXIB 2LJ5A 4WJNA 3TMPB 2KO3A 2M4NA 2O6VD 2M0XA 3BINA 4AJYB 1GJZA 2KQ7A 4E71A 3DQVA 5JZEB 1OTRB 4E74A 3K9PB 3T9LA 3ZTCA 3KUDB 2L05A 4HVBA 1E7UA 2PE9A 1KLVA 3I3TB 5D6JB 2EKEC 2V3SA 4GXBA 4GB9A 3AI5A 2A4ZA 2IO3B 5CHVC 1P3QU 2UWQA 3T8MA 4II3B 3VTWA 1V80A 1CMXB 3OJ4B 4PS8A 4W9DA 4FLHA 3RUIB 2PPHA 3VAWA 2FCNA 2IO0B 2C7NB 5FR6A 4ZRJA 2KHWB 3A9JB 2NCNA 4F7ZA 3NY5A 3TIXA 4G50A 4HK2A 3AULA 3H7SA 3WA0A 1IPGA 4MDKE 3TL5A 4LDTD 1E90A 1IP9A 1M94A 4IWPA 1ZGUB 4HDOA 5AZFA 4HWIB 3VXWA 2MP2B 5DPWA 1V86A 3ZNZB 2BKRB 2DYMA 4EZJA 2D07B 1VD2A 2GBMA 4NJ7A 3UF8A 4K7WA 3RZWC 1A5RA 1XD3B 1LQBA 4F8CB 3PLVA 3MJWA 2PEAA 3AXCA 3NZSA 1ZKHA 5D7GA 4KSLC 1OQYA 2KJ6A 4FJZA 2ZCCA 5E6NA 3ZLZA 3VUWA 3KUCB 3QK0A 4XX5A 4ANUA 2BF8B 5JH5C 4ASWC 1R4MI 3MTNB 3RCZA 4EUTA 4K7UA 3UINB 1WIAA 2JVCA 2CHWA 2KC1A 1I42A 2KOXA 1ISNA 2MWSB 2DAJA 4MGZE 4NPNA 3TJPA 3SHQA 4JLCA 2N7EA 3HIZA 2KX3A 2UYZB 4MSQB 1WX7A 2L8JA 4BOZB 2RPQA 3HM3A 1V2YA 1WJNA 4GDKA 1KM7A 1WI0A 3U8ZA 5J17A 2DZKA 5C1ZA 4M0WB 2WX1A 2KTFA 2ZEQA 1TGZB 2K6DB 1P0RA 4AP4C 4FADA 3H7PA 3H9DA 2KD0A 3PRPB 2NVUI 1PQSA 3AU4A 1WE6A 3JSVB 2KQSA 4FN2A 4MEMA 4BKSD 4URKA 4BBNC 4RM8A 4TQ1A 3V61A 2JWZA 4A20A 1R4NI 3PVLA 4F1SA 4BKSA 5EDSA 4BBNF 2YVCA 5D2MB 3PSEB 1WGDA 2ZJDA 5JHBA 4FHJA 4GN1A 1XQQA 3BY4B 2GBKA 5DPTA 3L13A 1WMHB 2NPTA 5CHFA 3N3KB 1WX9A 1H8CA 3U7DA 2IBIB 1UBQA 2ZVNA 3DBSA 3M62B 4KZCA 2GOWA 2OOBB 4YL8A 2N7DA 4II2B 4WJOA 1V6EA 4G0NB 3RD2A 3X23A 4RMAA 5KHOA 1WFYA 3UQBA 4KDLB 2J0MA 3B0AA 3OAWA 1LM8B 4FJYA 4ICUA 3W1SA 2BYVE 3ML8A 4RM9A 1WZ0A 3GOEA
chains in the Genus database with same CATH superfamily
1UBIA 2RGFA 1T6BX 2IYDB 2LRWA 2ACZB 3ONSA 2MRPA 4MH0E 4LK0M 4TKNA 3EGRA 1F52A 4IOIE 1SEBD 3FC4A 2JSVX 2V1YA 1WYWB 1SIFA 1JALA 2WXNA 2PVGC 3Q3OC 2W9NA 1B1ZA 3PT2B 3OWEB 4YSYB 2KQ4X 3SU8X 3IBEA 1WRDB 3ENEA 2J53A 2LJIA 2MJDA 1FCCC 4IG7B 2LRUA 3Q3FA 3Q3MC 4AUQC 1J7BA 4P16A 3IAM1 2KJRA 4S0RA 3NHEB 4GU2A 2N7JA 2MA9B 3AECB 2K8BA 4RNAA 3U7ZA 4AWJA 1V1OA 4K81A 4IM0A 3FILA 2IGHA 4LNFA 4YTNB 2EMSA 2RD0A 2K22A 4NJCA 4FA6A 2DYBA 2FUG1 2JQRB 2KDEB 3L10B 2L1AA 2FNJB 1V49A 1J7AA 2KKCA 4KIKA 5G2NA 2WDRB 3APFA 4DHZE 1KTKA 2GBJA 5FR3A 4OW0A 4ACFA 3R7RA 2IY1B 1SSNA 1XEEA 1TS4A 2KK8A 2I1KA 3RI7C 2AX5A 2WQYB 2LGSA 4HCNB 3PRMB 1SIJA 3U30A 1SGHA 1C3TA 1WSPA 1TYGB 2K39A 1JMLA 2CU1A 3FKYA 3R3MA 3AE2B 3PPAA 4NJ6A 3QAQA 1WY8A 1WGRA 2KMCA 3VTUA 1L0YB 3TEZA 3NS1A 4RGMA 1EF5A 4BKTA 1N5WA 2KAJA 3VRBB 4XE0A 2K25A 3R7QA 2KVZA 3RPFC 1FD6A 1ACCA 3R66C 4R3DA 1FXTB 2ICIA 4W9IA 1YIWA 3ZXVA 4EZKA 5EE1A 3DBRI 3VR8B 4K7SA 2UU7A 5IKCM 1QOAA 4XGAB 3VH3B 2IO2B 4M0WA 1YN5A 2JXXA 2JRHA 4IC7B 3ZNID 3NOBA 2L0TA 2LI5A 3EFCA 1SJED 4A90A 2KMMA 3ZRCA 4KIKB 3ZNHB 2WDTB 2HTME 3UI3A 5IO9A 3N1XC 3KWVA 2DYOA 2VRRB 5GMVA 2BKFA 3Q8BA 1Q1OA 4ZYSA 2V9HA 4WWMA 1WMHA 3ABVB 2LGYA 1EU4A 2BYFA 4W9HA 2INDC 1SF0A 1WXMA 1F77A 2BYTA 3NRZA 2H89B 2HE7A 4MM3A 3VHTC 2FAZA 3WAPA 1DYQA 2KNBA 2N0SB 3WALA 1XLQA 3JYUA 2FUHB 1HQRD 1C78A 2V4LA 2E3TA 3RYTA 4KKIA 4BAXA 3BIID 3V6CB 4DBGA 2NS5A 2WX0A 4EFOA 5E6PA 3BZDB 1E5WA 2JXTA 2JZ3B 2DLBA 1D5XC 3RN9C 2L3ZA 1T0YA 3DVNV 2PTLA 1XCQL 4UDUC 3W2DA 1YX6B 2OHFA 2GMIC 1OEYA 1LFDA 1WXSA 4MJSA 3ZDMC 1UUPA 4P1CC 1N63A 5BYRA 3BVZA 3I5JC 2KWVB 3DVGX 4G3XB 1QOBA 4HLEA 2L00B 4W9CA 3QJZA 4HJKA 1QKZA 2KDIA 2L83A 2WU2B 2GI9A 2ON8A 1C4PA 4AOFA 3QWZB 4HPMB 4C4VA 1QT9A 4MM3B 4LNIA 3AE1B 5GXGB 1XT9B 4DHJD 1XLOA 3WCQA 1V1PA 1U4AA 4WAAA 2MBQA 1WF9A 3PS6A 3TSSA 2JRIB 4WAFA 3GP7A 4BVUC 3U4EG 2QIEB 4W9LA 2C7MB 4NAMA 2W3SA 1MHXA 3BK1A 2KO3A 3T9LA 3BVMA 3EUB2 5D6JB 3GE8C 1XO3A 3VTWA 1QILA 3BYTB 2FCNA 2IO0B 1XXGA 2C7NB 3NY5A 3AULA 3WA0A 1QLBB 3TL5A 4LDTD 1A70A 4IWPA 1YMHE 4HWIB 2QJLA 1B9RA 5DPWA 3IAS1 1V86A 2H88B 4NJ7A 2D3AA 4K7WA 3RZWC 1A5RA 2VH2A 4LNNA 2PEAA 2RPVA 5D7GA 2KJ6A 4FJZA 2ZCCA 3VUWA 3QK0A 4YXDB 2YEPB 3FAHA 1ZP0B 4K7UA 2LUMA 2CHWA 3DBLB 1I42A 3W5VB 2KWDA 4MGZE 1GAQB 2LHEA 1JROA 1OQRA 4C80A 4MSQB 1L4ZB 1V8CA 3AE9B 1HXYD 4GDKA 3R2IA 4KKJA 2DZKA 1V1PB 5D3DA 3I57A 3J9CA 2KTFA 2INNE 4AP4C 1VZ8A 2ZW1A 1YQ3B 1GOZA 2QSDA 2V3NA 1LO5D 4BKSD 3V61A 2Z8LA 4N6EB 2YVCA 5JHBA 4FHJA 4GN1A 1XQQA 3L13A 3BK2A 3U7DA 2IBIB 1PFDA 4ZHOA 2GOWA 2OOBB 2PMVA 4REZA 4WJOA 1V6EA 3X23A 4L23A 4WIPA 4KDLB 2J0MA 4C00A 3OAWA 4FJYA 4RM9A 2HJ1A 1D6EC 2IZVB 4DQOC 3EHVA 1J19A 4PT5A 2G4DB 3L16A 4OVUA 3AN1A 2Z0DB 2KLGA 1TBEA 2KFKA 4GLSC 3K9OB 2WXLA 1QZEA 2LGIA 1NBFC 1BT0A 4LNOA 4M00A 2ZW0A 4AS1A 2N4FA 4GDLA 2O6VA 2YEPF 1YOVB 4G11A 2WP9B 3MJ5A 3AE6B 1Q0WB 3S2AA 4GDKB 2INCC 2JZPA 1ZOYB 2VZKB 5HI1A 2Z0EB 2ZVOA 3V60A 1KLUD 2LXCA 1TZOA 4DXAB 4LJPB 3AMZA 4HCPB 1NDDA 2KLCA 4HDQA 4YTMB 2J52A 1WXQA 2PIAA 4ANXA 2Z59B 2BPSA 5AZGA 2MQJA 4ZRQA 1HTOA 5E6OA 2BVCA 3AE5B 3TUOA 2SEBD 2MJEA 5BMIA 1KOTA 5LLIA 3A1QA 4HRSA 4WQOB 4L1BA 1I4GA 1ZXIA 2KN5A 1T5XD 4FULA 2HTHA 3H1UA 3C19A 3DBHB 3A9KA 2K8CA 3NVWA 3DBLI 2WU5B 3GB1A 4E3CA 2WDQB 1YQBA 1ZPSA 3QA8A 1L6VA 1YJIA 1I35A 1PYWD 2AQ3B 2LWPA 3OJ3A 1FMAD 1FXAA 1NYQA 3RMKC 1FFVA 3KH0A 2BGFA 1QOFA 1YNTE 1E10A 1Q5WB 1MJDA 2V4IB 2ZCBA 3GZNI 3P4RB 1ZUD2 3QHTA 2KFKB 1J8CA 1UF0A 2C60A 1Z5SB 4GDLB 2O6VB 4NQLB 4XDCA 4K1RB 4ARIA 3ZUNA 1DGJA 2WXIA 3ZQ4A 2JX5A 1DOIA 3SD5A 4ITKA 3AEAB 2I38A 1SB3C 4IKGA 4DDGD 2WYQA 3L0WB 4DWFA 2ONQA 5G55A 2K8HA 3DBRB 3NUHB 4MGYE 4DDID 4NNJB 2KZRA 1MG8A 4MT5A 2FBWB 3CMMB 3BVGA 3MC8A 3DHGC 2LXAA 4TV3A 4N58A 1DOXA 4L2YA 1JWSD 2L76A 4FHKA 1EWCA 1HEZE 1T3QA 3A9KB 4PYUA 3VFKA 1P9DU 1AYFA 2MBBB 2R2QA 1OEYJ 1E8WA 1VR9A 3HK0A 2FIDA 1RAXA 1YX5B 2PE6B 4ZRIA 2JY6A 2K6QA 1TS3A 4RH6A 1WJ6A 3VR9B 4KV2A 3N32A 1N61A 1MVKA 4ICVA 2QC8A 1L6UA 1GB4A 3TBLD 1EUVB 3DVGY 1I4HA 4JX1C 3IVFA 1NENB 4WH4A 1C76A 3WAOA 4KZ0A 4RGTA 2OJWA 4A55A 3DBHI 5C2TB 4CO7A 1RM6C 2NMQA 2XNAC 3N30A 3EECA 2AL3A 4J6IA 1SXTA 1WWTA 2R2OA 4KDIC 1E7VA 5DPSA 3ZYYX 3QCAA 4ANVA 3PLUA 3DPDA 1HTQA 1OFFA 3MC9A 4J3OD 2D11A 1NEKB 1FNWA 2C9WB 4NZLB 1XLNA 3AEBB 4CHKA 1P1AA 3A9JA 3APCA 3Q6BA 2J0JA 2FE8A 3DWMA 1F2RI 2KFJA 1E7PB 2NBUA 4GOCA 3R2TA 3RNEC 2DZMA 1ET9A 1S1QB 1WRIA 3QQ8B 1KFYB 1C79A 5AZHA 3PZDA 4KGTA 4US8A 2LGXA 4ZDVA 4XZ4A 3P4SB 4AJWA 2PKOA 4DXFA 1T0QC 3IFWB 4TQ0A 3A4SC 1JRPA 4C7ZA 2FIFA 4K3CA 1UELA 1K52A 1STEA 4B9KA 4MH8A 3PHXB 3FILB 2IO1B 4ZRKA 3PREA 4WWOA 2KANA 3AEFB 2CS4A 5LXHA 3DHIC 4ANWA 3HUIA 2WGSA 4EKUA 3PHWB 2ASQA 3JSVA 2MCNB 1C4CA 1E8XA 1BUIC 3LJ3A 2DX5B 5LXIB 2QEJC 1GJZA 4E71A 5G5HA 3K9PB 2L05A 2V3SA 2WXOA 3ZGZA 3T8MA 3VAWA 1FM0D 4P6VF 1WGKA 2BB6A 2KHWB 3A9JB 1VLBA 3H7SA 1IPGA 1E90A 2WXJA 3EA6A 4M02A 5AZFA 2B76B 3ZNZB 2BKRB 1VD2A 2D3CA 1Y56A 1XD3B 1LQBA 2CU3A 4F8CB 3MJWA 3AXCA 2WHIA 5EE0A 1ZKHA 1OQYA 4M01A 4XX5A 5JH5C 4ZHPA 1JWMD 3MTNB 2MEKA 2AQ2B 3UINB 4JWUC 1WIAA 1F0ZA 2BW2A 2MWSB 4JLCA 2L8JA 2G1EA 2RDBC 2PVOD 2WS3B 1V2YA 1FEHA 1JCKB 1WI0A 3U8ZA 3U2SC 4M0WB 2WXKA 2WX1A 1P0RA 2E6XA 5TSSA 2KD0A 1YN3A 3JSVB 4MEMA 4FN2A 4OZCA 5D3IB 4BKSA 2IGGA 5EDSA 1ROEA 4H2AA 3PSEB 3B2FA 4TMAB 1WGDA 2ZJDA 2INPE 1WMHB 3ZJVA 2NPTA 5CHFA 3N3KB 1WX9A 1H8CA 4Q2JA 1HZ6A 2W3RA 2EELA 1T0RC 4YL8A 1FIQA 3E9SA 4II2B 4G0NB 2L32A 1WFYA 3B0AA 3W1SA 3T3NA 2BYVE 1WZ0A 3MHZA 1GB1A 4LDTB 2LMCA 2JZZA 2L7RA 1L0VB 4HKQA 3HHMA 2R61A 1EM7A 5AEKB 2CHZA 1KJTA 4IW0A 4S17A 2JYTA 3AEEB 5EE3A 2AL6A 1GUAB 5LNK1 2J4XA 4MGIE 1ZDXA 4US9A 3DHHC 2O2VA 3VDZA 3TEWA 1UZXB 1WXAA 4FXCA 3W1YA 2G3QB 2WWZA 1UH6A 4HPPA 4LJOB 2KTRA 2DNFA 3VUXA 2W55A 4HJGE 3ZW3A 1TJEA 3T3OA 2DZJA 3B08A 4MJSB 2PJHA 3Q3NC 1HE8A 2M19A 3ZRFA 1MHHE 1IYFA 1D3ZA 4NQKE 2I1JA 1GPXA 1TKGA 1V97A 2JU6X 3SFDB 1E8ZA 2GBRA 1WGGA 3NG0A 2KDFB 3SEBA 1VJKA 2XBBC 2YLMA 3N1ZC 4GIVA 3GE3C 3RFZB 1H4RA 1Y8RC 1P98A 2Y5CA 4RFBA 3NVYA 4C4VB 5HKHA 2ZPNA 3Q8EA 3TEXA 3DDCB 3V3XA 3R8BA 1WM3A 3GZNB 2JYEA 2BB5A 4A8XC 3PGEA 3VTVA 2NBVB 3JVZX 2LZ6A 2AWTA 3CSFA 2M1MA 1TS5A 2GB1A 2D10A 1RRBA 4OVVA 4MSMB 4OVZA 3D32A 4HPLB 2XK5A 2MP2A 4FBJB 5L95C 3SR6A 2KTRB 3RNCC 3ZXRA 1P7EA 3AEDB 3IG3A 4IM3A 1GC7A 3V05A 5E6JA 1WX8A 3RULA 1FNUA 4IWQA 4K3BA 2BYEA 3C0RB 3URYA 3LB8C 3KQ4A 1NVID 2SAKA 1V9JA 4GGQA 2M17A 1WGYA 2LVPA 4BZAA 1XCTL 4KGRA 1CQVA 1WH3A 1WR6E 2J0KA 1S3SG 4WWPA 2N9PC 2W54A 5HHDG 3BWUD 3Q69A 4HXDA 2JF5A 2N9XA 2KYWA 3ZJTA 2MLBA 1D5ZC 2Y5PA 2WNMA 1Q10A 1IBXA 3UIOB 2DHZA 1NI2A 4BOSC 4EZLA 3SDLC 3QARA 5J2RA 2AYOB 3CIRB 1ZXHA 2J7QB 1WR1A 2MHJA 2D5GA 1FO4A 4N59A 2DENB 3H6NA 2DAFA 4W9KA 1GNUA 2AEHA 1OQQA 2KDMA 2C5LC 4A3OA 3QC8B 1DOYA 3ZVVA 3AB5A 1F2RC 4MACA 1CZPA 1EO6A 1E9MA 2XK5B 2JWUA 3MC0B 2ZNVB 2ZPYA 4IUMB 4YSXB 1VDVA 3WAMA 2N9KA 4I6PA 4B0EA 3ZDTA 1J7CA 2JUOA 1WJ4A 3B2GA 3ZIMA 3P42A 2K3UA 5G5GA 2MW5A 4RGOS 1UWMA 1WE7A 3L4PA 1AARA 1M4VA 2VZKD 1V81A 2C7HA 2OEDA 1I4QA 4USAA 4DHZB 3A4RA 1JRUA 3VUYA 3ZNGC 2MJ3A 1Z2MA 1WJUA 2LVQA 1R4NB 2BS2B 1MI0A 1VCBA 2XEWA 1UGMA 3MFGA 1FPYA 2V3PA 4JE3B 2LVOA 2CJOA 3Q3JA 4JWSC 1PGXA 1UGJA 2B3AA 2QMTA 1JWUD 1I7HA 5C3JB 4LLGM 1PGBA 1FNVA 5JXVA 1AWDA 2JPHA 3A1QB 5HG2A 5KHQA 3HVDA 4IWOA 3PRZA 4NY0A 1L7YA 4B6WA 3P63A 1NI3A 3PV1A 4OZBA 1RWSA 3OG5A 3EC8A 5HFYA 2BWES 3PTFC 3Q8CA 3SFEB 2MBOA 4RGNA 4AQ7A 3QX1A 1C9FA 3N20C 3CSTA 2N1WA 3NZ3A 3RT3B 3MP9A 4JL9A 2L52A 1TKEA 4WJNA 3IXSA 3TMPB 3B9JA 2M4NA 2O6VD 2M0XA 4AJYB 3PZ7A 5JZEB 1HA5A 4HVBA 5IOIA 1E7UA 2PE9A 3I3TB 2EKEC 3VRAB 3HVZA 2V0GA 1LGRA 4DXGA 4II3B 1V80A 4PS8A 4W9DA 3RUIB 2PPHA 1TKYA 5FR6A 4ZRJA 2N9LA 4G50A 1N5XA 1FCLA 4MDKE 4CQNA 1M94A 1ZGUB 3VXWA 2DYMA 3IT6B 2X38A 3RNAC 1UNSA 2BS3B 3ZLZA 3AE7B 5E6NA 3KUCB 3Q2AC 2BTEA 4ANUA 1R4MI 4EUTA 3AM9A 2JVCA 1ZDVA 1ISNA 3I63C 2DAJA 3KLSX 4NPNA 3TJPA 3SHQA 3HIZA 2UYZB 1WX7A 1E6EB 2Y3AA 1WJNA 3KWLA 1MG4A 1K50A 5C1ZA 1R7SA 2ZEQA 2AQ1B 2K6DB 4FADA 3H7PA 5IP4D 3H9DA 4RF1A 2NVUI 3AU4A 1WE6A 2KQSA 4URKA 1I4RA 4A20A 1R4NI 3PVLA 4YSZB 4BBNF 2NTSA 2RDGA 2WXPA 5MPOA 5H92C 3M62B 2ZVNA 4KZCA 2WXFA 4XWWA 1SJHD 2TSSA 3Q8AA 1E0ZA 4QAYA 4TSSA 5KHOA 3AE3B 2WLBA 4B0MA 3UQBA 1LM8B 4ICUA 3ML8A 3DBSA 3N1YC 1UBQA 1SE9A 1EWYC 3L08A 3P4PB 2KJHB 1TY2A 3CWIA 1P7FA 2MBHA 1EU3A 4DK5A 2BS4B 4BFRA 4LCDE 2DWQA 3VQIA 1E8YA 2G4SA 4EEWA 4XYCA 4D2KA 4NAWA 2RDHA 1RFAA 3ECIA 1TS2A 4TUUA 2LASA 3V6EB 2CJNA 1VZ7A 2WXGA 4JQWC 2CKHB 2IJ0A 3B1LX 2IGDA 2NBWB 3AE8B 2N9EB 2KT7A 5BMGA 3H7PB 4M8MA 2K0PA 2CR5A 3LDZE 5AUKA 4ZRPA 2G9HD 1PDXA 4HKZE 2BWFA 1KH0A 3KYDD 4W9EA 1K51A 5BYQA 2QCZA 3U52E 4MELA 4WJQA 3C8YA 2IDYA 2DBYA 4BKGA 3KVFB 1YQ4B 5AUIA 1HZ5A 5D94A 2RSUA 2L0FA 2MSED 5CTRC 5IA7A 4W9FA 1QQRA 1JW9D 2WXQA 2D3GA 1V5OA 2JT4B 1XLPA 4DHJB 1C4AA 3WIMA 5IN7A 1L2NA 2J42A 4I6NB 1KRHA 3NJTA 3I9V1 2K1FA 1LXDA 1G6JA 2KC2A 1YJ1A 3VVWB 1GG3A 1D4BA 1N62A 3ZO5B 4GMVA 4NAWB 4PK1A 5JHAA 1QF6A 2OJRA 4XC2A 4EOYA 1ESFA 4WWNA 1NYRA 1ZE3D 4PS3A 4WJPA 1UD7A 4C56C 3X0WA 1J0GA 2KXJA 2KVRA 2FCMA 1KLGD 5TR5A 4P1BC 3RNFC 3OLMD 1L0XB 1K53A 1WM2A 3L17A 3RNBC 2NR2A 4FJVB 3W5UB 3H8HA 4B95A 4X57B 3ML9A 1JWAD 3RNGC 1ET6A 2HJ8A 4ARCA 1ZW7A 3APDA 2KMAA 1PGAA 2CHXA 2LUEA 1TTNA 4IM2A 2MX2A 3ZTDA 4A9AA 4LNKA 4O1NA 5BYSA 1TZ1A 2KWUB 3AEGB 5FKAC 3EFUA 1GC6A 5IAAC 3KW5B 2HDEA 1WGHA 1X1MA 4W9GA 2PW9A 5CX3A 1UWXA 1WYGA 3M95A 3TCAA 4PS7A 5L83A 2PLPA 3AE4B 3AH7A 2KDBA 1N6ZA 3W1SC 3LYYA 1WXVA 4JGHB 5J18A 5C23A 2M8SA 3CF6E 3P2BA 1C77A 2KACA 3ETRA 2RR9A 2VH1A 5EE9A 4M8NA 1YD8U 3P4QB 3QIJA 2NTTA 2RMMA 1TT5B 3BYYB 4N9F4 2ZZPB 1MFWA 3M63B 4HEA1 2NPTB 2IY0B 2MBEA 1FRDA 2QHOA 3DOWA 1BXTA 3MHSD 2WXMA 3NZUA 2DZIA 2KWCA 2N1VA 2D3BA 2I2YA 3DVNU 1V5TA 2WDVB 3DCGA 5BO4B 1OGWA 3AU5A 1T0SC 5T8IA 1C1YB 2X8XX 4P7IA 4C7YA 3UQAA 2GBNA 1MPEA 3ZKJC 1SE2A 1YN4A 2LD9A 1AN8A 4KVGB 1CK1A 3TEYA 2KX0A 4ZYNA 2G45B 1PUTA 2O2VB 4GSWA 3NVVA 1CJEA 2HD5B 3JW0X 3RZFA 1N60A 2Q5WD 4RF0A 2REXA 1D5MC 3KUZA 3VH4B 4YWGG 1XF5L 1IUEA 1EF1A 2LEKA 3WANA 3KYCD 2Y5BB 3O65B 3AV8A 4I6LB 1F9JA 4CYEA 1F1HA 3O13A 4KSKC 3L54A 2EMTA 4JIOU 2M0AA 1WZ3A 4MGKE 3N9YC 5I4DA 1I4XA 5DCNA 3Q8FA 2K9XA 3HRDD 3UIPB 2FCQA 4PYZA 2LGDA 2FCSA 2XN9C 5DPRA 2GRIA 3NVZA 4WQMA 3M3JA 4YTPB 3NS8A 4EE2A 3ALBA 3DWGC 1FFUA 3V62A 2D2QA 2ZNVC 5FK9C 3IHPC 1RLFA 4W9JA 1K8RB 2A5UA 3A33B 2BT6A 1RFKA 2MH7A 4A3PA 5BMHA 1FRRA 3UGBB 4KX6B 5CHWA 3HM6X 2LJ5A 2GLSA 4KGSA 3BINA 2KQ7A 3DQVA 1OTRB 4E74A 3ZTCA 3KUDB 1YJJA 1KLVA 1IGDA 4GXBA 4GB9A 2LHDA 3AI5A 1VRAB 1BMLC 2A4ZA 2IO3B 4WURA 5CHVC 1P3QU 2UWQA 1CMXB 3OJ4B 2BQQA 4FLHA 1JQ4A 1VZ6A 3GS2A 2NCNA 4F7ZA 3TIXA 4HK2A 1L4DB 2K5PA 4XWTA 1IP9A 5H8YE 4HDOA 2MP2B 1KF6B 4YT0B 4EZJA 2D07B 2GBMA 3UF8A 3W9CB 4OZAA 3PLVA 1AW7A 3NZSA 4KSLC 3PZ8A 1R4MB 1QOGA 2BF8B 2M56B 2QILA 4ASWC 3IT4B 3RCZA 2KC1A 1L5PA 2KOXA 1TY0A 4XDDA 3PO0A 2N7EA 2KX3A 2WXRA 4BOZB 2RPQA 3HM3A 1KM7A 2QDFA 5J17A 3LXFA 4HROA 1TGZB 4IDIA 2EKIA 3E56A 1SBBB 1ENFA 3PRPB 1PQSA 4BBNC 3ZJUA 4RM8A 4TQ1A 2JWZA 2WXHA 3Q14C 4F1SA 2W82A 1IBXB 1I4PA 1SE3A 5D2MB 4A6QA 1RYJA 4JPSA 1IGCA 3BY4B 1SE4A 2GBKA 5DPTA 4OHJA 1JWBD 2IPKD 2KN4A 1FXIA 4ZOHC 4LTUA 2N7DA 3P1MA 3RD2A 4RMAA 1TIFA 2LFIA 2BBCA 4RCOA 3GOEA
chains in the Genus database with same CATH topology
1UBIA 2RGFA 4LDTB 1SE9A 2IZVB 2IYDB 3EHVA 1J19A 2LRWA 2JZZA 2L7RA 3L08A 2G4DB 3L16A 2KJHB 3ONSA 4OVUA 2MBHA 4DK5A 3HHMA 4BFRA 2MRPA 4LCDE 4MH0E 2Z0DB 3VQIA 1E8YA 2KLGA 4TKNA 2G4SA 5AEKB 1TBEA 2KFKA 4EEWA 2CHZA 1KJTA 4IW0A 3K9OB 4NAWA 1QZEA 2V1YA 1WYWB 1NBFC 1BT0A 2AL6A 1SIFA 1RFAA 1GUAB 2N4FA 3ECIA 4GDLA 4MGIE 2O6VA 4TUUA 3VDZA 2O2VA 4G11A 2LASA 1UZXB 1WXAA 3V6EB 3W1YA 2W9NA 2G3QB 2WWZA 1Q0WB 3S2AA 4GDKB 3PT2B 1UH6A 4JQWC 2CKHB 3B1LX 2Z0EB 2KTRA 2ZVOA 4LJOB 3IBEA 3SU8X 3V60A 2NBWB 2LXCA 1WRDB 2N9EB 3ENEA 4LJPB 3VUXA 4DXAB 4HCPB 1NDDA 2KLCA 4HDQA 3ZW3A 4IG7B 2LRUA 3H7PB 3Q3FA 4AUQC 4M8MA 2CR5A 3LDZE 2DZJA 3B08A 2Z59B 4ANXA 2BPSA 5AZGA 2MQJA 4MJSB 5E6OA 2BWFA 2KJRA 2PJHA 3NHEB 4GU2A 3KYDD 4W9EA 2MA9B 2K8BA 1HE8A 4AWJA 3ZRFA 1IYFA 1D3ZA 4NQKE 1KOTA 2I1JA 5LLIA 3A1QA 4K81A 4MELA 4IM0A 4WJQA 4WQOB 1E8ZA 2EMSA 2RD0A 2KN5A 2GBRA 1WGGA 2KDFB 4FULA 2HTHA 3H1UA 4FA6A 2DYBA 2XBBC 2YLMA 4BKGA 4GIVA 3KVFB 1H4RA 2KDEB 3L10B 3A9KA 2K8CA 1Y8RC 1P98A 3DBLI 5HKHA 2FNJB 5D94A 4E3CA 2RSUA 1V49A 2L0FA 2MSED 2ZPNA 1YQBA 5CTRC 5IA7A 2KKCA 4W9FA 4KIKA 3QA8A 5G2NA 3APFA 4DHZE 2GBJA 1I35A 2D3GA 2LWPA 1V5OA 3DDCB 2JT4B 3OJ3A 4DHJB 3R7RA 2IY1B 3KH0A 3WIMA 1L2NA 2BGFA 1WM3A 4I6NB 2KK8A 2I1KA 1Q5WB 2K1FA 2ZCBA 1LXDA 1G6JA 2KC2A 3GZNI 1YJ1A 4HCNB 3VVWB 3PRMB 1GG3A 3QHTA 2KFKB 3U30A 3ZO5B 1J8CA 3PGEA 3VTVA 4GMVA 1SGHA 4NAWB 5JHAA 2NBVB 3JVZX 2LZ6A 2AWTA 2OJRA 3CSFA 2M1MA 4XC2A 4EOYA 1C3TA 4WWNA 4PS3A 4WJPA 1UD7A 2C60A 1RRBA 1Z5SB 2D10A 2CU1A 2K39A 4GDLB 2KXJA 4OVVA 3X0WA 4MSMB 1J0GA 2KVRA 2FCMA 2O6VB 3R3MA 4NQLB 3PPAA 3D32A 4HPLB 2XK5A 3QAQA 4NJ6A 1WY8A 4K1RB 5TR5A 2MP2A 1WGRA 2KMCA 3VTUA 3OLMD 4FBJB 1WM2A 3ZUNA 5L95C 3L17A 2KTRB 3SD5A 1EF5A 4BKTA 2NR2A 3IG3A 4FJVB 4IM3A 1GC7A 4B95A 4X57B 1WX8A 3ML9A 3RULA 2K25A 4DDGD 2WYQA 3R7QA 2HJ8A 3L0WB 4IWQA 4DWFA 1ZW7A 2BYEA 5G55A 2K8HA 3R66C 3C0RB 3APDA 4MGYE 1FXTB 4W9IA 1YIWA 4EZKA 4DDID 4NNJB 2KMAA 2KZRA 2CHXA 1MG8A 2LUEA 3DBRI 1TTNA 1V9JA 4GGQA 2M17A 4K7SA 3CMMB 1WGYA 2LVPA 2MX2A 4IM2A 3ZTDA 3VH3B 2IO2B 2LXAA 4TV3A 3ZNID 2JXXA 1TZ1A 2JRHA 2KWUB 4IC7B 1WH3A 3EFUA 1WR6E 1GC6A 2J0KA 1S3SG 4FHKA 2L76A 4WWPA 5IAAC 3NOBA 2L0TA 2LI5A 2N9PC 3KW5B 3A9KB 1WGHA 4PYUA 3VFKA 1X1MA 1P9DU 4W9GA 4HXDA 2R2QA 2JF5A 2MBBB 1OEYJ 5CX3A 1E8WA 3HK0A 2N9XA 3ZRCA 3M95A 2MLBA 4KIKB 4PS7A 2FIDA 1RAXA 3TCAA 5L83A 3ZNHB 2WDTB 1YX5B 2PE6B 4ZRIA 2JY6A 2KDBA 2K6QA 3UIOB 3W1SC 2DYOA 2VRRB 2DHZA 5GMVA 1NI2A 4BOSC 2BKFA 1WJ6A 3SDLC 4EZLA 4KV2A 3QARA 5J2RA 1WXVA 1Q1OA 3N32A 4JGHB 5J18A 5C23A 4ICVA 1WMHA 2AYOB 2M8SA 3CF6E 2LGYA 2BYFA 3P2BA 4W9HA 2J7QB 3TBLD 1WR1A 1EUVB 1WXMA 3DVGY 2DENB 2RR9A 3H6NA 2DAFA 4W9KA 1GNUA 4M8NA 2AEHA 2HE7A 4MM3A 2C5LC 1YD8U 3VHTC 3QIJA 4A3OA 3QC8B 2FAZA 3ZVVA 3WAPA 3IVFA 2KNBA 3WALA 4N9F4 2ZZPB 3M63B 1EO6A 2NPTB 3JYUA 2XK5B 2FUHB 2IY0B 2MBEA 2V4LA 3WAOA 4KZ0A 2ZNVB 2QHOA 2ZPYA 3DOWA 3RYTA 3MHSD 3DBHI 3NZUA 2DZIA 4IUMB 4CO7A 2KWCA 2N1VA 3WAMA 3V6CB 3N30A 3EECA 2AL3A 4DBGA 4I6PA 3DVNU 2NS5A 1V5TA 2WX0A 4EFOA 3ZDTA 5E6PA 3DCGA 4J6IA 2JUOA 1WJ4A 2R2OA 3ZIMA 5BO4B 4KDIC 1OGWA 1E7VA 5DPSA 3AU5A 3QCAA 4ANVA 1C1YB 3PLUA 1E5WA 3DPDA 2MW5A 4P7IA 1WE7A 3UQAA 2JZ3B 2GBNA 1AARA 2D11A 3ZKJC 1V81A 2C7HA 2C9WB 2LD9A 4DHZB 4KVGB 2L3ZA 1T0YA 3A4RA 3DVNV 4CHKA 2KX0A 1JRUA 1P1AA 3A9JA 3APCA 2J0JA 4ZYNA 3VUYA 2G45B 1YX6B 3ZNGC 1Z2MA 2GMIC 1WJUA 2KFJA 2O2VB 1OEYA 1LFDA 2LVQA 2NBUA 4GOCA 4GSWA 1WXSA 2HD5B 3JW0X 4MJSA 3ZDMC 2DZMA 3RZFA 1S1QB 3QQ8B 1VCBA 2XEWA 1UGMA 2REXA 2KWVB 5AZHA 3PZDA 2LVOA 2LGXA 3KUZA 4ZDVA 3DVGX 4XZ4A 4G3XB 4AJWA 4HLEA 3Q3JA 2L00B 3VH4B 3IFWB 4TQ0A 4W9CA 3A4SC 1EF1A 3WANA 3KYCD 3QJZA 2Y5BB 3O65B 4I6LB 4HJKA 1F9JA 4CYEA 2B3AA 4KSKC 2FIFA 2KDIA 3L54A 2EMTA 4JIOU 1UELA 1WZ3A 4AOFA 4MGKE 3QWZB 4B9KA 5DCNA 4HPMB 2JPHA 3A1QB 3PHXB 5KHQA 3UIPB 2IO1B 1XT9B 4IWOA 3PRZA 4DHJD 4ZRKA 2FCQA 4PYZA 2LGDA 4NY0A 2FCSA 1U4AA 3PREA 5DPRA 1L7YA 4WWOA 2KANA 4B6WA 2CS4A 4WAAA 5LXHA 2MBQA 1WF9A 3M3JA 3PS6A 3NS8A 2JRIB 3ALBA 3PV1A 3EC8A 4ANWA 2BWES 3V62A 2D2QA 2ZNVC 3PTFC 4EKUA 3IHPC 4BVUC 1RLFA 2MBOA 4W9JA 1K8RB 2ASQA 2A5UA 3PHWB 3JSVA 3A33B 3QX1A 4A3PA 3CSTA 3UGBB 5CHWA 2MCNB 2N1WA 1E8XA 3RT3B 4W9LA 2C7MB 4JL9A 3HM6X 3LJ3A 2DX5B 5LXIB 2LJ5A 4WJNA 3TMPB 2KO3A 2M4NA 2O6VD 2M0XA 3BINA 4AJYB 1GJZA 2KQ7A 4E71A 3DQVA 5JZEB 1OTRB 4E74A 3K9PB 3T9LA 3ZTCA 3KUDB 2L05A 4HVBA 1E7UA 2PE9A 1KLVA 3I3TB 5D6JB 2EKEC 2V3SA 4GXBA 4GB9A 3AI5A 2A4ZA 2IO3B 5CHVC 1P3QU 2UWQA 3T8MA 4II3B 3VTWA 1V80A 1CMXB 3OJ4B 4PS8A 4W9DA 4FLHA 3RUIB 2PPHA 3VAWA 2FCNA 2IO0B 2C7NB 5FR6A 4ZRJA 2KHWB 3A9JB 2NCNA 4F7ZA 3NY5A 3TIXA 4G50A 4HK2A 3AULA 3H7SA 3WA0A 1IPGA 4MDKE 3TL5A 4LDTD 1E90A 1IP9A 1M94A 4IWPA 1ZGUB 4HDOA 5AZFA 4HWIB 3VXWA 2MP2B 5DPWA 1V86A 3ZNZB 2BKRB 2DYMA 4EZJA 2D07B 1VD2A 2GBMA 4NJ7A 3UF8A 4K7WA 3RZWC 1A5RA 1XD3B 1LQBA 4F8CB 3PLVA 3MJWA 2PEAA 3AXCA 3NZSA 1ZKHA 5D7GA 4KSLC 1OQYA 2KJ6A 4FJZA 2ZCCA 5E6NA 3ZLZA 3VUWA 3KUCB 3QK0A 4XX5A 4ANUA 2BF8B 5JH5C 4ASWC 1R4MI 3MTNB 3RCZA 4EUTA 4K7UA 3UINB 1WIAA 2JVCA 2CHWA 2KC1A 1I42A 2KOXA 1ISNA 2MWSB 2DAJA 4MGZE 4NPNA 3TJPA 3SHQA 4JLCA 2N7EA 3HIZA 2KX3A 2UYZB 4MSQB 1WX7A 2L8JA 4BOZB 2RPQA 3HM3A 1V2YA 1WJNA 4GDKA 1KM7A 1WI0A 3U8ZA 5J17A 2DZKA 5C1ZA 4M0WB 2WX1A 2KTFA 2ZEQA 1TGZB 2K6DB 1P0RA 4AP4C 4FADA 3H7PA 3H9DA 2KD0A 3PRPB 2NVUI 1PQSA 3AU4A 1WE6A 3JSVB 2KQSA 4FN2A 4MEMA 4BKSD 4URKA 4BBNC 4RM8A 4TQ1A 3V61A 2JWZA 4A20A 1R4NI 3PVLA 4F1SA 4BKSA 5EDSA 4BBNF 2YVCA 5D2MB 3PSEB 1WGDA 2ZJDA 5JHBA 4FHJA 4GN1A 1XQQA 3BY4B 2GBKA 5DPTA 3L13A 1WMHB 2NPTA 5CHFA 3N3KB 1WX9A 1H8CA 3U7DA 2IBIB 1UBQA 2ZVNA 3DBSA 3M62B 4KZCA 2GOWA 2OOBB 4YL8A 2N7DA 4II2B 4WJOA 1V6EA 4G0NB 3RD2A 3X23A 4RMAA 5KHOA 1WFYA 3UQBA 4KDLB 2J0MA 3B0AA 3OAWA 1LM8B 4FJYA 4ICUA 3W1SA 2BYVE 3ML8A 4RM9A 1WZ0A 3GOEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBI A;  2RGF A;  4LDT B;  1SE9 A;  2IZV B;  2IYD B;  3EHV A;  1J19 A;  2LRW A;  2JZZ A;  2L7R A;  3L08 A;  2G4D B;  3L16 A;  2KJH B;  3ONS A;  4OVU A;  2MBH A;  4DK5 A;  3HHM A;  4BFR A;  2MRP A;  4LCD E;  4MH0 E;  2Z0D B;  3VQI A;  1E8Y A;  2KLG A;  4TKN A;  2G4S A;  5AEK B;  1TBE A;  2KFK A;  4EEW A;  2CHZ A;  1KJT A;  4IW0 A;  3K9O B;  4NAW A;  1QZE A;  2V1Y A;  1WYW B;  1NBF C;  1BT0 A;  2AL6 A;  1SIF A;  1RFA A;  1GUA B;  2N4F A;  3ECI A;  4GDL A;  4MGI E;  2O6V A;  4TUU A;  3VDZ A;  2O2V A;  4G11 A;  2LAS A;  1UZX B;  1WXA A;  3V6E B;  3W1Y A;  2W9N A;  2G3Q B;  2WWZ A;  1Q0W B;  3S2A A;  4GDK B;  3PT2 B;  1UH6 A;  4JQW C;  2CKH B;  3B1L X;  2Z0E B;  2KTR A;  2ZVO A;  4LJO B;  3IBE A;  3SU8 X;  3V60 A;  2NBW B;  2LXC A;  1WRD B;  2N9E B;  3ENE A;  4LJP B;  3VUX A;  4DXA B;  4HCP B;  1NDD A;  2KLC A;  4HDQ A;  3ZW3 A;  4IG7 B;  2LRU A;  3H7P B;  3Q3F A;  4AUQ C;  4M8M A;  2CR5 A;  3LDZ E;  2DZJ A;  3B08 A;  2Z59 B;  4ANX A;  2BPS A;  5AZG A;  2MQJ A;  4MJS B;  5E6O A;  2BWF A;  2KJR A;  2PJH A;  3NHE B;  4GU2 A;  3KYD D;  4W9E A;  2MA9 B;  2K8B A;  1HE8 A;  4AWJ A;  3ZRF A;  1IYF A;  1D3Z A;  4NQK E;  1KOT A;  2I1J A;  5LLI A;  3A1Q A;  4K81 A;  4MEL A;  4IM0 A;  4WJQ A;  4WQO B;  1E8Z A;  2EMS A;  2RD0 A;  2KN5 A;  2GBR A;  1WGG A;  2KDF B;  4FUL A;  2HTH A;  3H1U A;  4FA6 A;  2DYB A;  2XBB C;  2YLM A;  4BKG A;  4GIV A;  3KVF B;  1H4R A;  2KDE B;  3L10 B;  3A9K A;  2K8C A;  1Y8R C;  1P98 A;  3DBL I;  5HKH A;  2FNJ B;  5D94 A;  4E3C A;  2RSU A;  1V49 A;  2L0F A;  2MSE D;  2ZPN A;  1YQB A;  5CTR C;  5IA7 A;  2KKC A;  4W9F A;  4KIK A;  3QA8 A;  5G2N A;  3APF A;  4DHZ E;  2GBJ A;  1I35 A;  2D3G A;  2LWP A;  1V5O A;  3DDC B;  2JT4 B;  3OJ3 A;  4DHJ B;  3R7R A;  2IY1 B;  3KH0 A;  3WIM A;  1L2N A;  2BGF A;  1WM3 A;  4I6N B;  2KK8 A;  2I1K A;  1Q5W B;  2K1F A;  2ZCB A;  1LXD A;  1G6J A;  2KC2 A;  3GZN I;  1YJ1 A;  4HCN B;  3VVW B;  3PRM B;  1GG3 A;  3QHT A;  2KFK B;  3U30 A;  3ZO5 B;  1J8C A;  3PGE A;  3VTV A;  4GMV A;  1SGH A;  4NAW B;  5JHA A;  2NBV B;  3JVZ X;  2LZ6 A;  2AWT A;  2OJR A;  3CSF A;  2M1M A;  4XC2 A;  4EOY A;  1C3T A;  4WWN A;  4PS3 A;  4WJP A;  1UD7 A;  2C60 A;  1RRB A;  1Z5S B;  2D10 A;  2CU1 A;  2K39 A;  4GDL B;  2KXJ A;  4OVV A;  3X0W A;  4MSM B;  1J0G A;  2KVR A;  2FCM A;  2O6V B;  3R3M A;  4NQL B;  3PPA A;  3D32 A;  4HPL B;  2XK5 A;  3QAQ A;  4NJ6 A;  1WY8 A;  4K1R B;  5TR5 A;  2MP2 A;  1WGR A;  2KMC A;  3VTU A;  3OLM D;  4FBJ B;  1WM2 A;  3ZUN A;  5L95 C;  3L17 A;  2KTR B;  3SD5 A;  1EF5 A;  4BKT A;  2NR2 A;  3IG3 A;  4FJV B;  4IM3 A;  1GC7 A;  4B95 A;  4X57 B;  1WX8 A;  3ML9 A;  3RUL A;  2K25 A;  4DDG D;  2WYQ A;  3R7Q A;  2HJ8 A;  3L0W B;  4IWQ A;  4DWF A;  1ZW7 A;  2BYE A;  5G55 A;  2K8H A;  3R66 C;  3C0R B;  3APD A;  4MGY E;  1FXT B;  4W9I A;  1YIW A;  4EZK A;  4DDI D;  4NNJ B;  2KMA A;  2KZR A;  2CHX A;  1MG8 A;  2LUE A;  3DBR I;  1TTN A;  1V9J A;  4GGQ A;  2M17 A;  4K7S A;  3CMM B;  1WGY A;  2LVP A;  2MX2 A;  4IM2 A;  3ZTD A;  3VH3 B;  2IO2 B;  2LXA A;  4TV3 A;  3ZNI D;  2JXX A;  1TZ1 A;  2JRH A;  2KWU B;  4IC7 B;  1WH3 A;  3EFU A;  1WR6 E;  1GC6 A;  2J0K A;  1S3S G;  4FHK A;  2L76 A;  4WWP A;  5IAA C;  3NOB A;  2L0T A;  2LI5 A;  2N9P C;  3KW5 B;  3A9K B;  1WGH A;  4PYU A;  3VFK A;  1X1M A;  1P9D U;  4W9G A;  4HXD A;  2R2Q A;  2JF5 A;  2MBB B;  1OEY J;  5CX3 A;  1E8W A;  3HK0 A;  2N9X A;  3ZRC A;  3M95 A;  2MLB A;  4KIK B;  4PS7 A;  2FID A;  1RAX A;  3TCA A;  5L83 A;  3ZNH B;  2WDT B;  1YX5 B;  2PE6 B;  4ZRI A;  2JY6 A;  2KDB A;  2K6Q A;  3UIO B;  3W1S C;  2DYO A;  2VRR B;  2DHZ A;  5GMV A;  1NI2 A;  4BOS C;  2BKF A;  1WJ6 A;  3SDL C;  4EZL A;  4KV2 A;  3QAR A;  5J2R A;  1WXV A;  1Q1O A;  3N32 A;  4JGH B;  5J18 A;  5C23 A;  4ICV A;  1WMH A;  2AYO B;  2M8S A;  3CF6 E;  2LGY A;  2BYF A;  3P2B A;  4W9H A;  2J7Q B;  3TBL D;  1WR1 A;  1EUV B;  1WXM A;  3DVG Y;  2DEN B;  2RR9 A;  3H6N A;  2DAF A;  4W9K A;  1GNU A;  4M8N A;  2AEH A;  2HE7 A;  4MM3 A;  2C5L C;  1YD8 U;  3VHT C;  3QIJ A;  4A3O A;  3QC8 B;  2FAZ A;  3ZVV A;  3WAP A;  3IVF A;  2KNB A;  3WAL A;  4N9F 4;  2ZZP B;  3M63 B;  1EO6 A;  2NPT B;  3JYU A;  2XK5 B;  2FUH B;  2IY0 B;  2MBE A;  2V4L A;  3WAO A;  4KZ0 A;  2ZNV B;  2QHO A;  2ZPY A;  3DOW A;  3RYT A;  3MHS D;  3DBH I;  3NZU A;  2DZI A;  4IUM B;  4CO7 A;  2KWC A;  2N1V A;  3WAM A;  3V6C B;  3N30 A;  3EEC A;  2AL3 A;  4DBG A;  4I6P A;  3DVN U;  2NS5 A;  1V5T A;  2WX0 A;  4EFO A;  3ZDT A;  5E6P A;  3DCG A;  4J6I A;  2JUO A;  1WJ4 A;  2R2O A;  3ZIM A;  5BO4 B;  4KDI C;  1OGW A;  1E7V A;  5DPS A;  3AU5 A;  3QCA A;  4ANV A;  1C1Y B;  3PLU A;  1E5W A;  3DPD A;  2MW5 A;  4P7I A;  1WE7 A;  3UQA A;  2JZ3 B;  2GBN A;  1AAR A;  2D11 A;  3ZKJ C;  1V81 A;  2C7H A;  2C9W B;  2LD9 A;  4DHZ B;  4KVG B;  2L3Z A;  1T0Y A;  3A4R A;  3DVN V;  4CHK A;  2KX0 A;  1JRU A;  1P1A A;  3A9J A;  3APC A;  2J0J A;  4ZYN A;  3VUY A;  2G45 B;  1YX6 B;  3ZNG C;  1Z2M A;  2GMI C;  1WJU A;  2KFJ A;  2O2V B;  1OEY A;  1LFD A;  2LVQ A;  2NBU A;  4GOC A;  4GSW A;  1WXS A;  2HD5 B;  3JW0 X;  4MJS A;  3ZDM C;  2DZM A;  3RZF A;  1S1Q B;  3QQ8 B;  1VCB A;  2XEW A;  1UGM A;  2REX A;  2KWV B;  5AZH A;  3PZD A;  2LVO A;  2LGX A;  3KUZ A;  4ZDV A;  3DVG X;  4XZ4 A;  4G3X B;  4AJW A;  4HLE A;  3Q3J A;  2L00 B;  3VH4 B;  3IFW B;  4TQ0 A;  4W9C A;  3A4S C;  1EF1 A;  3WAN A;  3KYC D;  3QJZ A;  2Y5B B;  3O65 B;  4I6L B;  4HJK A;  1F9J A;  4CYE A;  2B3A A;  4KSK C;  2FIF A;  2KDI A;  3L54 A;  2EMT A;  4JIO U;  1UEL A;  1WZ3 A;  4AOF A;  4MGK E;  3QWZ B;  4B9K A;  5DCN A;  4HPM B;  2JPH A;  3A1Q B;  3PHX B;  5KHQ A;  3UIP B;  2IO1 B;  1XT9 B;  4IWO A;  3PRZ A;  4DHJ D;  4ZRK A;  2FCQ A;  4PYZ A;  2LGD A;  4NY0 A;  2FCS A;  1U4A A;  3PRE A;  5DPR A;  1L7Y A;  4WWO A;  2KAN A;  4B6W A;  2CS4 A;  4WAA A;  5LXH A;  2MBQ A;  1WF9 A;  3M3J A;  3PS6 A;  3NS8 A;  2JRI B;  3ALB A;  3PV1 A;  3EC8 A;  4ANW A;  2BWE S;  3V62 A;  2D2Q A;  2ZNV C;  3PTF C;  4EKU A;  3IHP C;  4BVU C;  1RLF A;  2MBO A;  4W9J A;  1K8R B;  2ASQ A;  2A5U A;  3PHW B;  3JSV A;  3A33 B;  3QX1 A;  4A3P A;  3CST A;  3UGB B;  5CHW A;  2MCN B;  2N1W A;  1E8X A;  3RT3 B;  4W9L A;  2C7M B;  4JL9 A;  3HM6 X;  3LJ3 A;  2DX5 B;  5LXI B;  2LJ5 A;  4WJN A;  3TMP B;  2KO3 A;  2M4N A;  2O6V D;  2M0X A;  3BIN A;  4AJY B;  1GJZ A;  2KQ7 A;  4E71 A;  3DQV A;  5JZE B;  1OTR B;  4E74 A;  3K9P B;  3T9L A;  3ZTC A;  3KUD B;  2L05 A;  4HVB A;  1E7U A;  2PE9 A;  1KLV A;  3I3T B;  5D6J B;  2EKE C;  2V3S A;  4GXB A;  4GB9 A;  3AI5 A;  2A4Z A;  2IO3 B;  5CHV C;  1P3Q U;  2UWQ A;  3T8M A;  4II3 B;  3VTW A;  1V80 A;  1CMX B;  3OJ4 B;  4PS8 A;  4W9D A;  4FLH A;  3RUI B;  2PPH A;  3VAW A;  2FCN A;  2IO0 B;  2C7N B;  5FR6 A;  4ZRJ A;  2KHW B;  3A9J B;  2NCN A;  4F7Z A;  3NY5 A;  3TIX A;  4G50 A;  4HK2 A;  3AUL A;  3H7S A;  3WA0 A;  1IPG A;  4MDK E;  3TL5 A;  4LDT D;  1E90 A;  1IP9 A;  1M94 A;  4IWP A;  1ZGU B;  4HDO A;  5AZF A;  4HWI B;  3VXW A;  2MP2 B;  5DPW A;  1V86 A;  3ZNZ B;  2BKR B;  2DYM A;  4EZJ A;  2D07 B;  1VD2 A;  2GBM A;  4NJ7 A;  3UF8 A;  4K7W A;  3RZW C;  1A5R A;  1XD3 B;  1LQB A;  4F8C B;  3PLV A;  3MJW A;  2PEA A;  3AXC A;  3NZS A;  1ZKH A;  5D7G A;  4KSL C;  1OQY A;  2KJ6 A;  4FJZ A;  2ZCC A;  5E6N A;  3ZLZ A;  3VUW A;  3KUC B;  3QK0 A;  4XX5 A;  4ANU A;  2BF8 B;  5JH5 C;  4ASW C;  1R4M I;  3MTN B;  3RCZ A;  4EUT A;  4K7U A;  3UIN B;  1WIA A;  2JVC A;  2CHW A;  2KC1 A;  1I42 A;  2KOX A;  1ISN A;  2MWS B;  2DAJ A;  4MGZ E;  4NPN A;  3TJP A;  3SHQ A;  4JLC A;  2N7E A;  3HIZ A;  2KX3 A;  2UYZ B;  4MSQ B;  1WX7 A;  2L8J A;  4BOZ B;  2RPQ A;  3HM3 A;  1V2Y A;  1WJN A;  4GDK A;  1KM7 A;  1WI0 A;  3U8Z A;  5J17 A;  2DZK A;  5C1Z A;  4M0W B;  2WX1 A;  2KTF A;  2ZEQ A;  1TGZ B;  2K6D B;  1P0R A;  4AP4 C;  4FAD A;  3H7P A;  3H9D A;  2KD0 A;  3PRP B;  2NVU I;  1PQS A;  3AU4 A;  1WE6 A;  3JSV B;  2KQS A;  4FN2 A;  4MEM A;  4BKS D;  4URK A;  4BBN C;  4RM8 A;  4TQ1 A;  3V61 A;  2JWZ A;  4A20 A;  1R4N I;  3PVL A;  4F1S A;  4BKS A;  5EDS A;  4BBN F;  2YVC A;  5D2M B;  3PSE B;  1WGD A;  2ZJD A;  5JHB A;  4FHJ A;  4GN1 A;  1XQQ A;  3BY4 B;  2GBK A;  5DPT A;  3L13 A;  1WMH B;  2NPT A;  5CHF A;  3N3K B;  1WX9 A;  1H8C A;  3U7D A;  2IBI B;  1UBQ A;  2ZVN A;  3DBS A;  3M62 B;  4KZC A;  2GOW A;  2OOB B;  4YL8 A;  2N7D A;  4II2 B;  4WJO A;  1V6E A;  4G0N B;  3RD2 A;  3X23 A;  4RMA A;  5KHO A;  1WFY A;  3UQB A;  4KDL B;  2J0M A;  3B0A A;  3OAW A;  1LM8 B;  4FJY A;  4ICU A;  3W1S A;  2BYV E;  3ML8 A;  4RM9 A;  1WZ0 A;  3GOE A; 
#chains in the Genus database with same CATH topology
 1UBI A;  2RGF A;  1T6B X;  2IYD B;  2LRW A;  2ACZ B;  3ONS A;  2MRP A;  4MH0 E;  4LK0 M;  4TKN A;  3EGR A;  1F52 A;  4IOI E;  1SEB D;  3FC4 A;  2JSV X;  2V1Y A;  1WYW B;  1SIF A;  1JAL A;  2WXN A;  2PVG C;  3Q3O C;  2W9N A;  1B1Z A;  3PT2 B;  3OWE B;  4YSY B;  2KQ4 X;  3SU8 X;  3IBE A;  1WRD B;  3ENE A;  2J53 A;  2LJI A;  2MJD A;  1FCC C;  4IG7 B;  2LRU A;  3Q3F A;  3Q3M C;  4AUQ C;  1J7B A;  4P16 A;  3IAM 1;  2KJR A;  4S0R A;  3NHE B;  4GU2 A;  2N7J A;  2MA9 B;  3AEC B;  2K8B A;  4RNA A;  3U7Z A;  4AWJ A;  1V1O A;  4K81 A;  4IM0 A;  3FIL A;  2IGH A;  4LNF A;  4YTN B;  2EMS A;  2RD0 A;  2K22 A;  4NJC A;  4FA6 A;  2DYB A;  2FUG 1;  2JQR B;  2KDE B;  3L10 B;  2L1A A;  2FNJ B;  1V49 A;  1J7A A;  2KKC A;  4KIK A;  5G2N A;  2WDR B;  3APF A;  4DHZ E;  1KTK A;  2GBJ A;  5FR3 A;  4OW0 A;  4ACF A;  3R7R A;  2IY1 B;  1SSN A;  1XEE A;  1TS4 A;  2KK8 A;  2I1K A;  3RI7 C;  2AX5 A;  2WQY B;  2LGS A;  4HCN B;  3PRM B;  1SIJ A;  3U30 A;  1SGH A;  1C3T A;  1WSP A;  1TYG B;  2K39 A;  1JML A;  2CU1 A;  3FKY A;  3R3M A;  3AE2 B;  3PPA A;  4NJ6 A;  3QAQ A;  1WY8 A;  1WGR A;  2KMC A;  3VTU A;  1L0Y B;  3TEZ A;  3NS1 A;  4RGM A;  1EF5 A;  4BKT A;  1N5W A;  2KAJ A;  3VRB B;  4XE0 A;  2K25 A;  3R7Q A;  2KVZ A;  3RPF C;  1FD6 A;  1ACC A;  3R66 C;  4R3D A;  1FXT B;  2ICI A;  4W9I A;  1YIW A;  3ZXV A;  4EZK A;  5EE1 A;  3DBR I;  3VR8 B;  4K7S A;  2UU7 A;  5IKC M;  1QOA A;  4XGA B;  3VH3 B;  2IO2 B;  4M0W A;  1YN5 A;  2JXX A;  2JRH A;  4IC7 B;  3ZNI D;  3NOB A;  2L0T A;  2LI5 A;  3EFC A;  1SJE D;  4A90 A;  2KMM A;  3ZRC A;  4KIK B;  3ZNH B;  2WDT B;  2HTM E;  3UI3 A;  5IO9 A;  3N1X C;  3KWV A;  2DYO A;  2VRR B;  5GMV A;  2BKF A;  3Q8B A;  1Q1O A;  4ZYS A;  2V9H A;  4WWM A;  1WMH A;  3ABV B;  2LGY A;  1EU4 A;  2BYF A;  4W9H A;  2IND C;  1SF0 A;  1WXM A;  1F77 A;  2BYT A;  3NRZ A;  2H89 B;  2HE7 A;  4MM3 A;  3VHT C;  2FAZ A;  3WAP A;  1DYQ A;  2KNB A;  2N0S B;  3WAL A;  1XLQ A;  3JYU A;  2FUH B;  1HQR D;  1C78 A;  2V4L A;  2E3T A;  3RYT A;  4KKI A;  4BAX A;  3BII D;  3V6C B;  4DBG A;  2NS5 A;  2WX0 A;  4EFO A;  5E6P A;  3BZD B;  1E5W A;  2JXT A;  2JZ3 B;  2DLB A;  1D5X C;  3RN9 C;  2L3Z A;  1T0Y A;  3DVN V;  2PTL A;  1XCQ L;  4UDU C;  3W2D A;  1YX6 B;  2OHF A;  2GMI C;  1OEY A;  1LFD A;  1WXS A;  4MJS A;  3ZDM C;  1UUP A;  4P1C C;  1N63 A;  5BYR A;  3BVZ A;  3I5J C;  2KWV B;  3DVG X;  4G3X B;  1QOB A;  4HLE A;  2L00 B;  4W9C A;  3QJZ A;  4HJK A;  1QKZ A;  2KDI A;  2L83 A;  2WU2 B;  2GI9 A;  2ON8 A;  1C4P A;  4AOF A;  3QWZ B;  4HPM B;  4C4V A;  1QT9 A;  4MM3 B;  4LNI A;  3AE1 B;  5GXG B;  1XT9 B;  4DHJ D;  1XLO A;  3WCQ A;  1V1P A;  1U4A A;  4WAA A;  2MBQ A;  1WF9 A;  3PS6 A;  3TSS A;  2JRI B;  4WAF A;  3GP7 A;  4BVU C;  3U4E G;  2QIE B;  4W9L A;  2C7M B;  4NAM A;  2W3S A;  1MHX A;  3BK1 A;  2KO3 A;  3T9L A;  3BVM A;  3EUB 2;  5D6J B;  3GE8 C;  1XO3 A;  3VTW A;  1QIL A;  3BYT B;  2FCN A;  2IO0 B;  1XXG A;  2C7N B;  3NY5 A;  3AUL A;  3WA0 A;  1QLB B;  3TL5 A;  4LDT D;  1A70 A;  4IWP A;  1YMH E;  4HWI B;  2QJL A;  1B9R A;  5DPW A;  3IAS 1;  1V86 A;  2H88 B;  4NJ7 A;  2D3A A;  4K7W A;  3RZW C;  1A5R A;  2VH2 A;  4LNN A;  2PEA A;  2RPV A;  5D7G A;  2KJ6 A;  4FJZ A;  2ZCC A;  3VUW A;  3QK0 A;  4YXD B;  2YEP B;  3FAH A;  1ZP0 B;  4K7U A;  2LUM A;  2CHW A;  3DBL B;  1I42 A;  3W5V B;  2KWD A;  4MGZ E;  1GAQ B;  2LHE A;  1JRO A;  1OQR A;  4C80 A;  4MSQ B;  1L4Z B;  1V8C A;  3AE9 B;  1HXY D;  4GDK A;  3R2I A;  4KKJ A;  2DZK A;  1V1P B;  5D3D A;  3I57 A;  3J9C A;  2KTF A;  2INN E;  4AP4 C;  1VZ8 A;  2ZW1 A;  1YQ3 B;  1GOZ A;  2QSD A;  2V3N A;  1LO5 D;  4BKS D;  3V61 A;  2Z8L A;  4N6E B;  2YVC A;  5JHB A;  4FHJ A;  4GN1 A;  1XQQ A;  3L13 A;  3BK2 A;  3U7D A;  2IBI B;  1PFD A;  4ZHO A;  2GOW A;  2OOB B;  2PMV A;  4REZ A;  4WJO A;  1V6E A;  3X23 A;  4L23 A;  4WIP A;  4KDL B;  2J0M A;  4C00 A;  3OAW A;  4FJY A;  4RM9 A;  2HJ1 A;  1D6E C;  2IZV B;  4DQO C;  3EHV A;  1J19 A;  4PT5 A;  2G4D B;  3L16 A;  4OVU A;  3AN1 A;  2Z0D B;  2KLG A;  1TBE A;  2KFK A;  4GLS C;  3K9O B;  2WXL A;  1QZE A;  2LGI A;  1NBF C;  1BT0 A;  4LNO A;  4M00 A;  2ZW0 A;  4AS1 A;  2N4F A;  4GDL A;  2O6V A;  2YEP F;  1YOV B;  4G11 A;  2WP9 B;  3MJ5 A;  3AE6 B;  1Q0W B;  3S2A A;  4GDK B;  2INC C;  2JZP A;  1ZOY B;  2VZK B;  5HI1 A;  2Z0E B;  2ZVO A;  3V60 A;  1KLU D;  2LXC A;  1TZO A;  4DXA B;  4LJP B;  3AMZ A;  4HCP B;  1NDD A;  2KLC A;  4HDQ A;  4YTM B;  2J52 A;  1WXQ A;  2PIA A;  4ANX A;  2Z59 B;  2BPS A;  5AZG A;  2MQJ A;  4ZRQ A;  1HTO A;  5E6O A;  2BVC A;  3AE5 B;  3TUO A;  2SEB D;  2MJE A;  5BMI A;  1KOT A;  5LLI A;  3A1Q A;  4HRS A;  4WQO B;  4L1B A;  1I4G A;  1ZXI A;  2KN5 A;  1T5X D;  4FUL A;  2HTH A;  3H1U A;  3C19 A;  3DBH B;  3A9K A;  2K8C A;  3NVW A;  3DBL I;  2WU5 B;  3GB1 A;  4E3C A;  2WDQ B;  1YQB A;  1ZPS A;  3QA8 A;  1L6V A;  1YJI A;  1I35 A;  1PYW D;  2AQ3 B;  2LWP A;  3OJ3 A;  1FMA D;  1FXA A;  1NYQ A;  3RMK C;  1FFV A;  3KH0 A;  2BGF A;  1QOF A;  1YNT E;  1E10 A;  1Q5W B;  1MJD A;  2V4I B;  2ZCB A;  3GZN I;  3P4R B;  1ZUD 2;  3QHT A;  2KFK B;  1J8C A;  1UF0 A;  2C60 A;  1Z5S B;  4GDL B;  2O6V B;  4NQL B;  4XDC A;  4K1R B;  4ARI A;  3ZUN A;  1DGJ A;  2WXI A;  3ZQ4 A;  2JX5 A;  1DOI A;  3SD5 A;  4ITK A;  3AEA B;  2I38 A;  1SB3 C;  4IKG A;  4DDG D;  2WYQ A;  3L0W B;  4DWF A;  2ONQ A;  5G55 A;  2K8H A;  3DBR B;  3NUH B;  4MGY E;  4DDI D;  4NNJ B;  2KZR A;  1MG8 A;  4MT5 A;  2FBW B;  3CMM B;  3BVG A;  3MC8 A;  3DHG C;  2LXA A;  4TV3 A;  4N58 A;  1DOX A;  4L2Y A;  1JWS D;  2L76 A;  4FHK A;  1EWC A;  1HEZ E;  1T3Q A;  3A9K B;  4PYU A;  3VFK A;  1P9D U;  1AYF A;  2MBB B;  2R2Q A;  1OEY J;  1E8W A;  1VR9 A;  3HK0 A;  2FID A;  1RAX A;  1YX5 B;  2PE6 B;  4ZRI A;  2JY6 A;  2K6Q A;  1TS3 A;  4RH6 A;  1WJ6 A;  3VR9 B;  4KV2 A;  3N32 A;  1N61 A;  1MVK A;  4ICV A;  2QC8 A;  1L6U A;  1GB4 A;  3TBL D;  1EUV B;  3DVG Y;  1I4H A;  4JX1 C;  3IVF A;  1NEN B;  4WH4 A;  1C76 A;  3WAO A;  4KZ0 A;  4RGT A;  2OJW A;  4A55 A;  3DBH I;  5C2T B;  4CO7 A;  1RM6 C;  2NMQ A;  2XNA C;  3N30 A;  3EEC A;  2AL3 A;  4J6I A;  1SXT A;  1WWT A;  2R2O A;  4KDI C;  1E7V A;  5DPS A;  3ZYY X;  3QCA A;  4ANV A;  3PLU A;  3DPD A;  1HTQ A;  1OFF A;  3MC9 A;  4J3O D;  2D11 A;  1NEK B;  1FNW A;  2C9W B;  4NZL B;  1XLN A;  3AEB B;  4CHK A;  1P1A A;  3A9J A;  3APC A;  3Q6B A;  2J0J A;  2FE8 A;  3DWM A;  1F2R I;  2KFJ A;  1E7P B;  2NBU A;  4GOC A;  3R2T A;  3RNE C;  2DZM A;  1ET9 A;  1S1Q B;  1WRI A;  3QQ8 B;  1KFY B;  1C79 A;  5AZH A;  3PZD A;  4KGT A;  4US8 A;  2LGX A;  4ZDV A;  4XZ4 A;  3P4S B;  4AJW A;  2PKO A;  4DXF A;  1T0Q C;  3IFW B;  4TQ0 A;  3A4S C;  1JRP A;  4C7Z A;  2FIF A;  4K3C A;  1UEL A;  1K52 A;  1STE A;  4B9K A;  4MH8 A;  3PHX B;  3FIL B;  2IO1 B;  4ZRK A;  3PRE A;  4WWO A;  2KAN A;  3AEF B;  2CS4 A;  5LXH A;  3DHI C;  4ANW A;  3HUI A;  2WGS A;  4EKU A;  3PHW B;  2ASQ A;  3JSV A;  2MCN B;  1C4C A;  1E8X A;  1BUI C;  3LJ3 A;  2DX5 B;  5LXI B;  2QEJ C;  1GJZ A;  4E71 A;  5G5H A;  3K9P B;  2L05 A;  2V3S A;  2WXO A;  3ZGZ A;  3T8M A;  3VAW A;  1FM0 D;  4P6V F;  1WGK A;  2BB6 A;  2KHW B;  3A9J B;  1VLB A;  3H7S A;  1IPG A;  1E90 A;  2WXJ A;  3EA6 A;  4M02 A;  5AZF A;  2B76 B;  3ZNZ B;  2BKR B;  1VD2 A;  2D3C A;  1Y56 A;  1XD3 B;  1LQB A;  2CU3 A;  4F8C B;  3MJW A;  3AXC A;  2WHI A;  5EE0 A;  1ZKH A;  1OQY A;  4M01 A;  4XX5 A;  5JH5 C;  4ZHP A;  1JWM D;  3MTN B;  2MEK A;  2AQ2 B;  3UIN B;  4JWU C;  1WIA A;  1F0Z A;  2BW2 A;  2MWS B;  4JLC A;  2L8J A;  2G1E A;  2RDB C;  2PVO D;  2WS3 B;  1V2Y A;  1FEH A;  1JCK B;  1WI0 A;  3U8Z A;  3U2S C;  4M0W B;  2WXK A;  2WX1 A;  1P0R A;  2E6X A;  5TSS A;  2KD0 A;  1YN3 A;  3JSV B;  4MEM A;  4FN2 A;  4OZC A;  5D3I B;  4BKS A;  2IGG A;  5EDS A;  1ROE A;  4H2A A;  3PSE B;  3B2F A;  4TMA B;  1WGD A;  2ZJD A;  2INP E;  1WMH B;  3ZJV A;  2NPT A;  5CHF A;  3N3K B;  1WX9 A;  1H8C A;  4Q2J A;  1HZ6 A;  2W3R A;  2EEL A;  1T0R C;  4YL8 A;  1FIQ A;  3E9S A;  4II2 B;  4G0N B;  2L32 A;  1WFY A;  3B0A A;  3W1S A;  3T3N A;  2BYV E;  1WZ0 A;  3MHZ A;  1GB1 A;  4LDT B;  2LMC A;  2JZZ A;  2L7R A;  1L0V B;  4HKQ A;  3HHM A;  2R61 A;  1EM7 A;  5AEK B;  2CHZ A;  1KJT A;  4IW0 A;  4S17 A;  2JYT A;  3AEE B;  5EE3 A;  2AL6 A;  1GUA B;  5LNK 1;  2J4X A;  4MGI E;  1ZDX A;  4US9 A;  3DHH C;  2O2V A;  3VDZ A;  3TEW A;  1UZX B;  1WXA A;  4FXC A;  3W1Y A;  2G3Q B;  2WWZ A;  1UH6 A;  4HPP A;  4LJO B;  2KTR A;  2DNF A;  3VUX A;  2W55 A;  4HJG E;  3ZW3 A;  1TJE A;  3T3O A;  2DZJ A;  3B08 A;  4MJS B;  2PJH A;  3Q3N C;  1HE8 A;  2M19 A;  3ZRF A;  1MHH E;  1IYF A;  1D3Z A;  4NQK E;  2I1J A;  1GPX A;  1TKG A;  1V97 A;  2JU6 X;  3SFD B;  1E8Z A;  2GBR A;  1WGG A;  3NG0 A;  2KDF B;  3SEB A;  1VJK A;  2XBB C;  2YLM A;  3N1Z C;  4GIV A;  3GE3 C;  3RFZ B;  1H4R A;  1Y8R C;  1P98 A;  2Y5C A;  4RFB A;  3NVY A;  4C4V B;  5HKH A;  2ZPN A;  3Q8E A;  3TEX A;  3DDC B;  3V3X A;  3R8B A;  1WM3 A;  3GZN B;  2JYE A;  2BB5 A;  4A8X C;  3PGE A;  3VTV A;  2NBV B;  3JVZ X;  2LZ6 A;  2AWT A;  3CSF A;  2M1M A;  1TS5 A;  2GB1 A;  2D10 A;  1RRB A;  4OVV A;  4MSM B;  4OVZ A;  3D32 A;  4HPL B;  2XK5 A;  2MP2 A;  4FBJ B;  5L95 C;  3SR6 A;  2KTR B;  3RNC C;  3ZXR A;  1P7E A;  3AED B;  3IG3 A;  4IM3 A;  1GC7 A;  3V05 A;  5E6J A;  1WX8 A;  3RUL A;  1FNU A;  4IWQ A;  4K3B A;  2BYE A;  3C0R B;  3URY A;  3LB8 C;  3KQ4 A;  1NVI D;  2SAK A;  1V9J A;  4GGQ A;  2M17 A;  1WGY A;  2LVP A;  4BZA A;  1XCT L;  4KGR A;  1CQV A;  1WH3 A;  1WR6 E;  2J0K A;  1S3S G;  4WWP A;  2N9P C;  2W54 A;  5HHD G;  3BWU D;  3Q69 A;  4HXD A;  2JF5 A;  2N9X A;  2KYW A;  3ZJT A;  2MLB A;  1D5Z C;  2Y5P A;  2WNM A;  1Q10 A;  1IBX A;  3UIO B;  2DHZ A;  1NI2 A;  4BOS C;  4EZL A;  3SDL C;  3QAR A;  5J2R A;  2AYO B;  3CIR B;  1ZXH A;  2J7Q B;  1WR1 A;  2MHJ A;  2D5G A;  1FO4 A;  4N59 A;  2DEN B;  3H6N A;  2DAF A;  4W9K A;  1GNU A;  2AEH A;  1OQQ A;  2KDM A;  2C5L C;  4A3O A;  3QC8 B;  1DOY A;  3ZVV A;  3AB5 A;  1F2R C;  4MAC A;  1CZP A;  1EO6 A;  1E9M A;  2XK5 B;  2JWU A;  3MC0 B;  2ZNV B;  2ZPY A;  4IUM B;  4YSX B;  1VDV A;  3WAM A;  2N9K A;  4I6P A;  4B0E A;  3ZDT A;  1J7C A;  2JUO A;  1WJ4 A;  3B2G A;  3ZIM A;  3P42 A;  2K3U A;  5G5G A;  2MW5 A;  4RGO S;  1UWM A;  1WE7 A;  3L4P A;  1AAR A;  1M4V A;  2VZK D;  1V81 A;  2C7H A;  2OED A;  1I4Q A;  4USA A;  4DHZ B;  3A4R A;  1JRU A;  3VUY A;  3ZNG C;  2MJ3 A;  1Z2M A;  1WJU A;  2LVQ A;  1R4N B;  2BS2 B;  1MI0 A;  1VCB A;  2XEW A;  1UGM A;  3MFG A;  1FPY A;  2V3P A;  4JE3 B;  2LVO A;  2CJO A;  3Q3J A;  4JWS C;  1PGX A;  1UGJ A;  2B3A A;  2QMT A;  1JWU D;  1I7H A;  5C3J B;  4LLG M;  1PGB A;  1FNV A;  5JXV A;  1AWD A;  2JPH A;  3A1Q B;  5HG2 A;  5KHQ A;  3HVD A;  4IWO A;  3PRZ A;  4NY0 A;  1L7Y A;  4B6W A;  3P63 A;  1NI3 A;  3PV1 A;  4OZB A;  1RWS A;  3OG5 A;  3EC8 A;  5HFY A;  2BWE S;  3PTF C;  3Q8C A;  3SFE B;  2MBO A;  4RGN A;  4AQ7 A;  3QX1 A;  1C9F A;  3N20 C;  3CST A;  2N1W A;  3NZ3 A;  3RT3 B;  3MP9 A;  4JL9 A;  2L52 A;  1TKE A;  4WJN A;  3IXS A;  3TMP B;  3B9J A;  2M4N A;  2O6V D;  2M0X A;  4AJY B;  3PZ7 A;  5JZE B;  1HA5 A;  4HVB A;  5IOI A;  1E7U A;  2PE9 A;  3I3T B;  2EKE C;  3VRA B;  3HVZ A;  2V0G A;  1LGR A;  4DXG A;  4II3 B;  1V80 A;  4PS8 A;  4W9D A;  3RUI B;  2PPH A;  1TKY A;  5FR6 A;  4ZRJ A;  2N9L A;  4G50 A;  1N5X A;  1FCL A;  4MDK E;  4CQN A;  1M94 A;  1ZGU B;  3VXW A;  2DYM A;  3IT6 B;  2X38 A;  3RNA C;  1UNS A;  2BS3 B;  3ZLZ A;  3AE7 B;  5E6N A;  3KUC B;  3Q2A C;  2BTE A;  4ANU A;  1R4M I;  4EUT A;  3AM9 A;  2JVC A;  1ZDV A;  1ISN A;  3I63 C;  2DAJ A;  3KLS X;  4NPN A;  3TJP A;  3SHQ A;  3HIZ A;  2UYZ B;  1WX7 A;  1E6E B;  2Y3A A;  1WJN A;  3KWL A;  1MG4 A;  1K50 A;  5C1Z A;  1R7S A;  2ZEQ A;  2AQ1 B;  2K6D B;  4FAD A;  3H7P A;  5IP4 D;  3H9D A;  4RF1 A;  2NVU I;  3AU4 A;  1WE6 A;  2KQS A;  4URK A;  1I4R A;  4A20 A;  1R4N I;  3PVL A;  4YSZ B;  4BBN F;  2NTS A;  2RDG A;  2WXP A;  5MPO A;  5H92 C;  3M62 B;  2ZVN A;  4KZC A;  2WXF A;  4XWW A;  1SJH D;  2TSS A;  3Q8A A;  1E0Z A;  4QAY A;  4TSS A;  5KHO A;  3AE3 B;  2WLB A;  4B0M A;  3UQB A;  1LM8 B;  4ICU A;  3ML8 A;  3DBS A;  3N1Y C;  1UBQ A;  1SE9 A;  1EWY C;  3L08 A;  3P4P B;  2KJH B;  1TY2 A;  3CWI A;  1P7F A;  2MBH A;  1EU3 A;  4DK5 A;  2BS4 B;  4BFR A;  4LCD E;  2DWQ A;  3VQI A;  1E8Y A;  2G4S A;  4EEW A;  4XYC A;  4D2K A;  4NAW A;  2RDH A;  1RFA A;  3ECI A;  1TS2 A;  4TUU A;  2LAS A;  3V6E B;  2CJN A;  1VZ7 A;  2WXG A;  4JQW C;  2CKH B;  2IJ0 A;  3B1L X;  2IGD A;  2NBW B;  3AE8 B;  2N9E B;  2KT7 A;  5BMG A;  3H7P B;  4M8M A;  2K0P A;  2CR5 A;  3LDZ E;  5AUK A;  4ZRP A;  2G9H D;  1PDX A;  4HKZ E;  2BWF A;  1KH0 A;  3KYD D;  4W9E A;  1K51 A;  5BYQ A;  2QCZ A;  3U52 E;  4MEL A;  4WJQ A;  3C8Y A;  2IDY A;  2DBY A;  4BKG A;  3KVF B;  1YQ4 B;  5AUI A;  1HZ5 A;  5D94 A;  2RSU A;  2L0F A;  2MSE D;  5CTR C;  5IA7 A;  4W9F A;  1QQR A;  1JW9 D;  2WXQ A;  2D3G A;  1V5O A;  2JT4 B;  1XLP A;  4DHJ B;  1C4A A;  3WIM A;  5IN7 A;  1L2N A;  2J42 A;  4I6N B;  1KRH A;  3NJT A;  3I9V 1;  2K1F A;  1LXD A;  1G6J A;  2KC2 A;  1YJ1 A;  3VVW B;  1GG3 A;  1D4B A;  1N62 A;  3ZO5 B;  4GMV A;  4NAW B;  4PK1 A;  5JHA A;  1QF6 A;  2OJR A;  4XC2 A;  4EOY A;  1ESF A;  4WWN A;  1NYR A;  1ZE3 D;  4PS3 A;  4WJP A;  1UD7 A;  4C56 C;  3X0W A;  1J0G A;  2KXJ A;  2KVR A;  2FCM A;  1KLG D;  5TR5 A;  4P1B C;  3RNF C;  3OLM D;  1L0X B;  1K53 A;  1WM2 A;  3L17 A;  3RNB C;  2NR2 A;  4FJV B;  3W5U B;  3H8H A;  4B95 A;  4X57 B;  3ML9 A;  1JWA D;  3RNG C;  1ET6 A;  2HJ8 A;  4ARC A;  1ZW7 A;  3APD A;  2KMA A;  1PGA A;  2CHX A;  2LUE A;  1TTN A;  4IM2 A;  2MX2 A;  3ZTD A;  4A9A A;  4LNK A;  4O1N A;  5BYS A;  1TZ1 A;  2KWU B;  3AEG B;  5FKA C;  3EFU A;  1GC6 A;  5IAA C;  3KW5 B;  2HDE A;  1WGH A;  1X1M A;  4W9G A;  2PW9 A;  5CX3 A;  1UWX A;  1WYG A;  3M95 A;  3TCA A;  4PS7 A;  5L83 A;  2PLP A;  3AE4 B;  3AH7 A;  2KDB A;  1N6Z A;  3W1S C;  3LYY A;  1WXV A;  4JGH B;  5J18 A;  5C23 A;  2M8S A;  3CF6 E;  3P2B A;  1C77 A;  2KAC A;  3ETR A;  2RR9 A;  2VH1 A;  5EE9 A;  4M8N A;  1YD8 U;  3P4Q B;  3QIJ A;  2NTT A;  2RMM A;  1TT5 B;  3BYY B;  4N9F 4;  2ZZP B;  1MFW A;  3M63 B;  4HEA 1;  2NPT B;  2IY0 B;  2MBE A;  1FRD A;  2QHO A;  3DOW A;  1BXT A;  3MHS D;  2WXM A;  3NZU A;  2DZI A;  2KWC A;  2N1V A;  2D3B A;  2I2Y A;  3DVN U;  1V5T A;  2WDV B;  3DCG A;  5BO4 B;  1OGW A;  3AU5 A;  1T0S C;  5T8I A;  1C1Y B;  2X8X X;  4P7I A;  4C7Y A;  3UQA A;  2GBN A;  1MPE A;  3ZKJ C;  1SE2 A;  1YN4 A;  2LD9 A;  1AN8 A;  4KVG B;  1CK1 A;  3TEY A;  2KX0 A;  4ZYN A;  2G45 B;  1PUT A;  2O2V B;  4GSW A;  3NVV A;  1CJE A;  2HD5 B;  3JW0 X;  3RZF A;  1N60 A;  2Q5W D;  4RF0 A;  2REX A;  1D5M C;  3KUZ A;  3VH4 B;  4YWG G;  1XF5 L;  1IUE A;  1EF1 A;  2LEK A;  3WAN A;  3KYC D;  2Y5B B;  3O65 B;  3AV8 A;  4I6L B;  1F9J A;  4CYE A;  1F1H A;  3O13 A;  4KSK C;  3L54 A;  2EMT A;  4JIO U;  2M0A A;  1WZ3 A;  4MGK E;  3N9Y C;  5I4D A;  1I4X A;  5DCN A;  3Q8F A;  2K9X A;  3HRD D;  3UIP B;  2FCQ A;  4PYZ A;  2LGD A;  2FCS A;  2XN9 C;  5DPR A;  2GRI A;  3NVZ A;  4WQM A;  3M3J A;  4YTP B;  3NS8 A;  4EE2 A;  3ALB A;  3DWG C;  1FFU A;  3V62 A;  2D2Q A;  2ZNV C;  5FK9 C;  3IHP C;  1RLF A;  4W9J A;  1K8R B;  2A5U A;  3A33 B;  2BT6 A;  1RFK A;  2MH7 A;  4A3P A;  5BMH A;  1FRR A;  3UGB B;  4KX6 B;  5CHW A;  3HM6 X;  2LJ5 A;  2GLS A;  4KGS A;  3BIN A;  2KQ7 A;  3DQV A;  1OTR B;  4E74 A;  3ZTC A;  3KUD B;  1YJJ A;  1KLV A;  1IGD A;  4GXB A;  4GB9 A;  2LHD A;  3AI5 A;  1VRA B;  1BML C;  2A4Z A;  2IO3 B;  4WUR A;  5CHV C;  1P3Q U;  2UWQ A;  1CMX B;  3OJ4 B;  2BQQ A;  4FLH A;  1JQ4 A;  1VZ6 A;  3GS2 A;  2NCN A;  4F7Z A;  3TIX A;  4HK2 A;  1L4D B;  2K5P A;  4XWT A;  1IP9 A;  5H8Y E;  4HDO A;  2MP2 B;  1KF6 B;  4YT0 B;  4EZJ A;  2D07 B;  2GBM A;  3UF8 A;  3W9C B;  4OZA A;  3PLV A;  1AW7 A;  3NZS A;  4KSL C;  3PZ8 A;  1R4M B;  1QOG A;  2BF8 B;  2M56 B;  2QIL A;  4ASW C;  3IT4 B;  3RCZ A;  2KC1 A;  1L5P A;  2KOX A;  1TY0 A;  4XDD A;  3PO0 A;  2N7E A;  2KX3 A;  2WXR A;  4BOZ B;  2RPQ A;  3HM3 A;  1KM7 A;  2QDF A;  5J17 A;  3LXF A;  4HRO A;  1TGZ B;  4IDI A;  2EKI A;  3E56 A;  1SBB B;  1ENF A;  3PRP B;  1PQS A;  4BBN C;  3ZJU A;  4RM8 A;  4TQ1 A;  2JWZ A;  2WXH A;  3Q14 C;  4F1S A;  2W82 A;  1IBX B;  1I4P A;  1SE3 A;  5D2M B;  4A6Q A;  1RYJ A;  4JPS A;  1IGC A;  3BY4 B;  1SE4 A;  2GBK A;  5DPT A;  4OHJ A;  1JWB D;  2IPK D;  2KN4 A;  1FXI A;  4ZOH C;  4LTU A;  2N7D A;  3P1M A;  3RD2 A;  4RMA A;  1TIF A;  2LFI A;  2BBC A;  4RCO A;  3GOE A; 
#chains in the Genus database with same CATH homology
 1UBI A;  2RGF A;  4LDT B;  1SE9 A;  2IZV B;  2IYD B;  3EHV A;  1J19 A;  2LRW A;  2JZZ A;  2L7R A;  3L08 A;  2G4D B;  3L16 A;  2KJH B;  3ONS A;  4OVU A;  2MBH A;  4DK5 A;  3HHM A;  4BFR A;  2MRP A;  4LCD E;  4MH0 E;  2Z0D B;  3VQI A;  1E8Y A;  2KLG A;  4TKN A;  2G4S A;  5AEK B;  1TBE A;  2KFK A;  4EEW A;  2CHZ A;  1KJT A;  4IW0 A;  3K9O B;  4NAW A;  1QZE A;  2V1Y A;  1WYW B;  1NBF C;  1BT0 A;  2AL6 A;  1SIF A;  1RFA A;  1GUA B;  2N4F A;  3ECI A;  4GDL A;  4MGI E;  2O6V A;  4TUU A;  3VDZ A;  2O2V A;  4G11 A;  2LAS A;  1UZX B;  1WXA A;  3V6E B;  3W1Y A;  2W9N A;  2G3Q B;  2WWZ A;  1Q0W B;  3S2A A;  4GDK B;  3PT2 B;  1UH6 A;  4JQW C;  2CKH B;  3B1L X;  2Z0E B;  2KTR A;  2ZVO A;  4LJO B;  3IBE A;  3SU8 X;  3V60 A;  2NBW B;  2LXC A;  1WRD B;  2N9E B;  3ENE A;  4LJP B;  3VUX A;  4DXA B;  4HCP B;  1NDD A;  2KLC A;  4HDQ A;  3ZW3 A;  4IG7 B;  2LRU A;  3H7P B;  3Q3F A;  4AUQ C;  4M8M A;  2CR5 A;  3LDZ E;  2DZJ A;  3B08 A;  2Z59 B;  4ANX A;  2BPS A;  5AZG A;  2MQJ A;  4MJS B;  5E6O A;  2BWF A;  2KJR A;  2PJH A;  3NHE B;  4GU2 A;  3KYD D;  4W9E A;  2MA9 B;  2K8B A;  1HE8 A;  4AWJ A;  3ZRF A;  1IYF A;  1D3Z A;  4NQK E;  1KOT A;  2I1J A;  5LLI A;  3A1Q A;  4K81 A;  4MEL A;  4IM0 A;  4WJQ A;  4WQO B;  1E8Z A;  2EMS A;  2RD0 A;  2KN5 A;  2GBR A;  1WGG A;  2KDF B;  4FUL A;  2HTH A;  3H1U A;  4FA6 A;  2DYB A;  2XBB C;  2YLM A;  4BKG A;  4GIV A;  3KVF B;  1H4R A;  2KDE B;  3L10 B;  3A9K A;  2K8C A;  1Y8R C;  1P98 A;  3DBL I;  5HKH A;  2FNJ B;  5D94 A;  4E3C A;  2RSU A;  1V49 A;  2L0F A;  2MSE D;  2ZPN A;  1YQB A;  5CTR C;  5IA7 A;  2KKC A;  4W9F A;  4KIK A;  3QA8 A;  5G2N A;  3APF A;  4DHZ E;  2GBJ A;  1I35 A;  2D3G A;  2LWP A;  1V5O A;  3DDC B;  2JT4 B;  3OJ3 A;  4DHJ B;  3R7R A;  2IY1 B;  3KH0 A;  3WIM A;  1L2N A;  2BGF A;  1WM3 A;  4I6N B;  2KK8 A;  2I1K A;  1Q5W B;  2K1F A;  2ZCB A;  1LXD A;  1G6J A;  2KC2 A;  3GZN I;  1YJ1 A;  4HCN B;  3VVW B;  3PRM B;  1GG3 A;  3QHT A;  2KFK B;  3U30 A;  3ZO5 B;  1J8C A;  3PGE A;  3VTV A;  4GMV A;  1SGH A;  4NAW B;  5JHA A;  2NBV B;  3JVZ X;  2LZ6 A;  2AWT A;  2OJR A;  3CSF A;  2M1M A;  4XC2 A;  4EOY A;  1C3T A;  4WWN A;  4PS3 A;  4WJP A;  1UD7 A;  2C60 A;  1RRB A;  1Z5S B;  2D10 A;  2CU1 A;  2K39 A;  4GDL B;  2KXJ A;  4OVV A;  3X0W A;  4MSM B;  1J0G A;  2KVR A;  2FCM A;  2O6V B;  3R3M A;  4NQL B;  3PPA A;  3D32 A;  4HPL B;  2XK5 A;  3QAQ A;  4NJ6 A;  1WY8 A;  4K1R B;  5TR5 A;  2MP2 A;  1WGR A;  2KMC A;  3VTU A;  3OLM D;  4FBJ B;  1WM2 A;  3ZUN A;  5L95 C;  3L17 A;  2KTR B;  3SD5 A;  1EF5 A;  4BKT A;  2NR2 A;  3IG3 A;  4FJV B;  4IM3 A;  1GC7 A;  4B95 A;  4X57 B;  1WX8 A;  3ML9 A;  3RUL A;  2K25 A;  4DDG D;  2WYQ A;  3R7Q A;  2HJ8 A;  3L0W B;  4IWQ A;  4DWF A;  1ZW7 A;  2BYE A;  5G55 A;  2K8H A;  3R66 C;  3C0R B;  3APD A;  4MGY E;  1FXT B;  4W9I A;  1YIW A;  4EZK A;  4DDI D;  4NNJ B;  2KMA A;  2KZR A;  2CHX A;  1MG8 A;  2LUE A;  3DBR I;  1TTN A;  1V9J A;  4GGQ A;  2M17 A;  4K7S A;  3CMM B;  1WGY A;  2LVP A;  2MX2 A;  4IM2 A;  3ZTD A;  3VH3 B;  2IO2 B;  2LXA A;  4TV3 A;  3ZNI D;  2JXX A;  1TZ1 A;  2JRH A;  2KWU B;  4IC7 B;  1WH3 A;  3EFU A;  1WR6 E;  1GC6 A;  2J0K A;  1S3S G;  4FHK A;  2L76 A;  4WWP A;  5IAA C;  3NOB A;  2L0T A;  2LI5 A;  2N9P C;  3KW5 B;  3A9K B;  1WGH A;  4PYU A;  3VFK A;  1X1M A;  1P9D U;  4W9G A;  4HXD A;  2R2Q A;  2JF5 A;  2MBB B;  1OEY J;  5CX3 A;  1E8W A;  3HK0 A;  2N9X A;  3ZRC A;  3M95 A;  2MLB A;  4KIK B;  4PS7 A;  2FID A;  1RAX A;  3TCA A;  5L83 A;  3ZNH B;  2WDT B;  1YX5 B;  2PE6 B;  4ZRI A;  2JY6 A;  2KDB A;  2K6Q A;  3UIO B;  3W1S C;  2DYO A;  2VRR B;  2DHZ A;  5GMV A;  1NI2 A;  4BOS C;  2BKF A;  1WJ6 A;  3SDL C;  4EZL A;  4KV2 A;  3QAR A;  5J2R A;  1WXV A;  1Q1O A;  3N32 A;  4JGH B;  5J18 A;  5C23 A;  4ICV A;  1WMH A;  2AYO B;  2M8S A;  3CF6 E;  2LGY A;  2BYF A;  3P2B A;  4W9H A;  2J7Q B;  3TBL D;  1WR1 A;  1EUV B;  1WXM A;  3DVG Y;  2DEN B;  2RR9 A;  3H6N A;  2DAF A;  4W9K A;  1GNU A;  4M8N A;  2AEH A;  2HE7 A;  4MM3 A;  2C5L C;  1YD8 U;  3VHT C;  3QIJ A;  4A3O A;  3QC8 B;  2FAZ A;  3ZVV A;  3WAP A;  3IVF A;  2KNB A;  3WAL A;  4N9F 4;  2ZZP B;  3M63 B;  1EO6 A;  2NPT B;  3JYU A;  2XK5 B;  2FUH B;  2IY0 B;  2MBE A;  2V4L A;  3WAO A;  4KZ0 A;  2ZNV B;  2QHO A;  2ZPY A;  3DOW A;  3RYT A;  3MHS D;  3DBH I;  3NZU A;  2DZI A;  4IUM B;  4CO7 A;  2KWC A;  2N1V A;  3WAM A;  3V6C B;  3N30 A;  3EEC A;  2AL3 A;  4DBG A;  4I6P A;  3DVN U;  2NS5 A;  1V5T A;  2WX0 A;  4EFO A;  3ZDT A;  5E6P A;  3DCG A;  4J6I A;  2JUO A;  1WJ4 A;  2R2O A;  3ZIM A;  5BO4 B;  4KDI C;  1OGW A;  1E7V A;  5DPS A;  3AU5 A;  3QCA A;  4ANV A;  1C1Y B;  3PLU A;  1E5W A;  3DPD A;  2MW5 A;  4P7I A;  1WE7 A;  3UQA A;  2JZ3 B;  2GBN A;  1AAR A;  2D11 A;  3ZKJ C;  1V81 A;  2C7H A;  2C9W B;  2LD9 A;  4DHZ B;  4KVG B;  2L3Z A;  1T0Y A;  3A4R A;  3DVN V;  4CHK A;  2KX0 A;  1JRU A;  1P1A A;  3A9J A;  3APC A;  2J0J A;  4ZYN A;  3VUY A;  2G45 B;  1YX6 B;  3ZNG C;  1Z2M A;  2GMI C;  1WJU A;  2KFJ A;  2O2V B;  1OEY A;  1LFD A;  2LVQ A;  2NBU A;  4GOC A;  4GSW A;  1WXS A;  2HD5 B;  3JW0 X;  4MJS A;  3ZDM C;  2DZM A;  3RZF A;  1S1Q B;  3QQ8 B;  1VCB A;  2XEW A;  1UGM A;  2REX A;  2KWV B;  5AZH A;  3PZD A;  2LVO A;  2LGX A;  3KUZ A;  4ZDV A;  3DVG X;  4XZ4 A;  4G3X B;  4AJW A;  4HLE A;  3Q3J A;  2L00 B;  3VH4 B;  3IFW B;  4TQ0 A;  4W9C A;  3A4S C;  1EF1 A;  3WAN A;  3KYC D;  3QJZ A;  2Y5B B;  3O65 B;  4I6L B;  4HJK A;  1F9J A;  4CYE A;  2B3A A;  4KSK C;  2FIF A;  2KDI A;  3L54 A;  2EMT A;  4JIO U;  1UEL A;  1WZ3 A;  4AOF A;  4MGK E;  3QWZ B;  4B9K A;  5DCN A;  4HPM B;  2JPH A;  3A1Q B;  3PHX B;  5KHQ A;  3UIP B;  2IO1 B;  1XT9 B;  4IWO A;  3PRZ A;  4DHJ D;  4ZRK A;  2FCQ A;  4PYZ A;  2LGD A;  4NY0 A;  2FCS A;  1U4A A;  3PRE A;  5DPR A;  1L7Y A;  4WWO A;  2KAN A;  4B6W A;  2CS4 A;  4WAA A;  5LXH A;  2MBQ A;  1WF9 A;  3M3J A;  3PS6 A;  3NS8 A;  2JRI B;  3ALB A;  3PV1 A;  3EC8 A;  4ANW A;  2BWE S;  3V62 A;  2D2Q A;  2ZNV C;  3PTF C;  4EKU A;  3IHP C;  4BVU C;  1RLF A;  2MBO A;  4W9J A;  1K8R B;  2ASQ A;  2A5U A;  3PHW B;  3JSV A;  3A33 B;  3QX1 A;  4A3P A;  3CST A;  3UGB B;  5CHW A;  2MCN B;  2N1W A;  1E8X A;  3RT3 B;  4W9L A;  2C7M B;  4JL9 A;  3HM6 X;  3LJ3 A;  2DX5 B;  5LXI B;  2LJ5 A;  4WJN A;  3TMP B;  2KO3 A;  2M4N A;  2O6V D;  2M0X A;  3BIN A;  4AJY B;  1GJZ A;  2KQ7 A;  4E71 A;  3DQV A;  5JZE B;  1OTR B;  4E74 A;  3K9P B;  3T9L A;  3ZTC A;  3KUD B;  2L05 A;  4HVB A;  1E7U A;  2PE9 A;  1KLV A;  3I3T B;  5D6J B;  2EKE C;  2V3S A;  4GXB A;  4GB9 A;  3AI5 A;  2A4Z A;  2IO3 B;  5CHV C;  1P3Q U;  2UWQ A;  3T8M A;  4II3 B;  3VTW A;  1V80 A;  1CMX B;  3OJ4 B;  4PS8 A;  4W9D A;  4FLH A;  3RUI B;  2PPH A;  3VAW A;  2FCN A;  2IO0 B;  2C7N B;  5FR6 A;  4ZRJ A;  2KHW B;  3A9J B;  2NCN A;  4F7Z A;  3NY5 A;  3TIX A;  4G50 A;  4HK2 A;  3AUL A;  3H7S A;  3WA0 A;  1IPG A;  4MDK E;  3TL5 A;  4LDT D;  1E90 A;  1IP9 A;  1M94 A;  4IWP A;  1ZGU B;  4HDO A;  5AZF A;  4HWI B;  3VXW A;  2MP2 B;  5DPW A;  1V86 A;  3ZNZ B;  2BKR B;  2DYM A;  4EZJ A;  2D07 B;  1VD2 A;  2GBM A;  4NJ7 A;  3UF8 A;  4K7W A;  3RZW C;  1A5R A;  1XD3 B;  1LQB A;  4F8C B;  3PLV A;  3MJW A;  2PEA A;  3AXC A;  3NZS A;  1ZKH A;  5D7G A;  4KSL C;  1OQY A;  2KJ6 A;  4FJZ A;  2ZCC A;  5E6N A;  3ZLZ A;  3VUW A;  3KUC B;  3QK0 A;  4XX5 A;  4ANU A;  2BF8 B;  5JH5 C;  4ASW C;  1R4M I;  3MTN B;  3RCZ A;  4EUT A;  4K7U A;  3UIN B;  1WIA A;  2JVC A;  2CHW A;  2KC1 A;  1I42 A;  2KOX A;  1ISN A;  2MWS B;  2DAJ A;  4MGZ E;  4NPN A;  3TJP A;  3SHQ A;  4JLC A;  2N7E A;  3HIZ A;  2KX3 A;  2UYZ B;  4MSQ B;  1WX7 A;  2L8J A;  4BOZ B;  2RPQ A;  3HM3 A;  1V2Y A;  1WJN A;  4GDK A;  1KM7 A;  1WI0 A;  3U8Z A;  5J17 A;  2DZK A;  5C1Z A;  4M0W B;  2WX1 A;  2KTF A;  2ZEQ A;  1TGZ B;  2K6D B;  1P0R A;  4AP4 C;  4FAD A;  3H7P A;  3H9D A;  2KD0 A;  3PRP B;  2NVU I;  1PQS A;  3AU4 A;  1WE6 A;  3JSV B;  2KQS A;  4FN2 A;  4MEM A;  4BKS D;  4URK A;  4BBN C;  4RM8 A;  4TQ1 A;  3V61 A;  2JWZ A;  4A20 A;  1R4N I;  3PVL A;  4F1S A;  4BKS A;  5EDS A;  4BBN F;  2YVC A;  5D2M B;  3PSE B;  1WGD A;  2ZJD A;  5JHB A;  4FHJ A;  4GN1 A;  1XQQ A;  3BY4 B;  2GBK A;  5DPT A;  3L13 A;  1WMH B;  2NPT A;  5CHF A;  3N3K B;  1WX9 A;  1H8C A;  3U7D A;  2IBI B;  1UBQ A;  2ZVN A;  3DBS A;  3M62 B;  4KZC A;  2GOW A;  2OOB B;  4YL8 A;  2N7D A;  4II2 B;  4WJO A;  1V6E A;  4G0N B;  3RD2 A;  3X23 A;  4RMA A;  5KHO A;  1WFY A;  3UQB A;  4KDL B;  2J0M A;  3B0A A;  3OAW A;  1LM8 B;  4FJY A;  4ICU A;  3W1S A;  2BYV E;  3ML8 A;  4RM9 A;  1WZ0 A;  3GOE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...