2IO0B

Crystal structure of human senp2 in complex with presumo-2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io0B00
3PRPB 3ZDMC 2D11A 2DZIA 2MSED 3M62B 4JGHB 2LJ5A 2CU1A 2NPTB 2KJHB 3JSVB 2J0MA 4GDLA 5E6PA 2C60A 2ASQA 1XT9B 5AZGA 1NI2A 2BKFA 3H7SA 3NZSA 4F1SA 1EF1A 1Q0WB 4RM9A 4FLHA 4TKNA 2REXA 3UGBB 4DWFA 3PS6A 4DBGA 1IPGA 2BWES 4ANUA 3AXCA 2QHOA 4A20A 1WX8A 2C5LC 2L0FA 3RT3B 4MH0E 4F7ZA 5E6OA 4W9JA 3ZKJC 2DAJA 3QIJA 2KN5A 1WH3A 4I6NB 3DDCB 3DVGX 5AZHA 4BOSC 2C7MB 1P1AA 1WXSA 3HM3A 3T9LA 3U7DA 3L10B 2GBRA 2ZCBA 4EZLA 1OEYJ 5DPWA 4PYUA 1KJTA 4II2B 1Y8RC 1YX5B 3PHWB 4I6PA 1A5RA 1WJNA 2KQ7A 3RCZA 1TBEA 4HWIB 1OTRB 2DZMA 4KIKA 4TUUA 3PHXB 2KC1A 1WXVA 3ML8A 1WXAA 5IA7A 2KANA 3H7PA 1WE6A 2JXXA 4LDTD 1RRBA 4PS7A 3K9PB 3QQ8B 4BKSD 2KNBA 3H7PB 4IUMB 4KSKC 1V5TA 3Q3FA 2N1WA 4BVUC 1P98A 4NNJB 1P3QU 3VVWB 4AWJA 2LGYA 2KFKA 3UQAA 5CHVC 4G0NB 2RSUA 3ZVVA 2KFKB 2MBHA 3K9OB 5LLIA 2MP2A 2JZ3B 3U8ZA 2KFJA 1H8CA 5J18A 4MJSB 2DENB 3ZIMA 3BINA 2OOBB 4WWNA 4EZJA 4B95A 1C3TA 2MP2B 3A9KB 1NDDA 2FAZA 2LRWA 4MM3A 2DHZA 5DPTA 2JRIB 4KDLB 3H1UA 5J2RA 1WM2A 3TMPB 3PV1A 3R7RA 4CYEA 2KDFB 2I1JA 1EO6A 2PPHA 3B0AA 5EDSA 3APDA 3TJPA 2C9WB 1ISNA 4DHZE 2C7HA 1WI0A 1KOTA 1H4RA 1WR1A 2BYEA 2K6QA 2K25A 3DCGA 2KLGA 1WGRA 4CO7A 1V5OA 3L16A 3KUZA 4WWOA 3VTUA 1IYFA 4II3B 2Y5BB 2CHXA 3UIOB 2LVOA 2GMIC 4E71A 2HJ8A 4AUQC 3KUCB 3QHTA 4ZRJA 5DCNA 4BBNF 3A33B 4J6IA 4KDIC 3VFKA 1E8WA 5DPSA 2N7EA 3L13A 1MG8A 2CHZA 2YVCA 3RUIB 2N4FA 3W1YA 2CKHB 3QC8B 3DVNV 4GMVA 3IFWB 2M17A 1KLVA 1YD8U 3JVZX 2KJRA 1PQSA 4NQLB 3X23A 2K6DB 1V49A 4GSWA 4AOFA 3RZFA 4HCNB 2JZZA 3BY4B 2KWVB 4GGQA 2DYOA 3R3MA 3T8MA 2WX1A 3AULA 3DVNU 1WGHA 5C23A 4NJ7A 3M3JA 4FJVB 4EZKA 2NBUA 5D6JB 3WANA 5KHQA 2BWFA 4GOCA 3ZUNA 1WGGA 2KLCA 2G4DB 2FNJB 2ZCCA 4JQWC 2IZVB 1T0YA 3NS8A 2LGDA 1R4MI 1SGHA 1U4AA 1WJ4A 1XD3B 2B3AA 2IO1B 2J0KA 2W9NA 3CSTA 3KYDD 4HPLB 4BOZB 3AU5A 2BF8B 4HJKA 2LVPA 4WAAA 2M1MA 4RMAA 2GOWA 2MA9B 1UGMA 1WZ0A 3DBRI 1GC7A 2KO3A 3JSVA 4GN1A 2Z0DB 2WYQA 4TQ1A 4W9EA 1VCBA 1GC6A 2LUEA 2NPTA 4XX5A 3OJ4B 2XK5B 3RULA 4IM0A 4PS3A 3P2BA 1WX9A 3ZRCA 1LFDA 3X0WA 3WA0A 2NBVB 4HCPB 3WAPA 2LVQA 3IVFA 3AI5A 3ZRFA 1SIFA 5L95C 4TV3A 4EEWA 1XQQA 1Z2MA 3I3TB 2A5UA 3DVGY 3TIXA 2KWCA 5GMVA 4FBJB 3VHTC 3PRZA 2M0XA 2NS5A 3QCAA 4KVGB 2FCQA 4MSQB 3V60A 3W1SC 4JL9A 3W1SA 1E5WA 3A4SC 1CMXB 2N9XA 3KH0A 3PT2B 4IWQA 4K7SA 3PTFC 2MRPA 2PE9A 1K8RB 4OVVA 4XZ4A 1L7YA 3QK0A 1YIWA 5BO4B 5CTRC 4KV2A 4BBNC 1V86A 3AU4A 2AWTA 3ZW3A 1LXDA 1V80A 1WYWB 3LJ3A 4TQ0A 5LXHA 4P7IA 3GOEA 1WF9A 4WQOB 2ZJDA 3PLUA 4AJYB 4HVBA 2AEHA 4G50A 4JLCA 2K8CA 1WXMA 4NJ6A 2BYVE 2G3QB 2K1FA 3IBEA 2MCNB 2NVUI 2Z0EB 2KXJA 2RD0A 4FJYA 2BKRB 4G11A 4BKGA 3UIPB 3CF6E 4JIOU 4IC7B 3EECA 2PEAA 3PRMB 2D2QA 4EFOA 3DPDA 4DHJD 4MJSA 2KHWB 1GUAB 2CS4A 3ZNHB 2DZKA 1YX6B 4PYZA 5C1ZA 1P9DU 3A9KA 4HPMB 4EKUA 1J0GA 3HHMA 1TZ1A 3KUDB 2PE6B 2FIDA 1WGYA 2KMCA 3V6EB 1ZGUB 4EOYA 3ENEA 2O6VA 3NHEB 3DOWA 2IY1B 4DDGD 2DX5B 2I1KA 4F8CB 3ML9A 2N9PC 3VAWA 5D7GA 1Z5SB 2O6VB 3HIZA 3PREA 2KJ6A 2GBJA 1UD7A 2JPHA 3ONSA 4GDKB 2IO0B 3M95A 5DPRA 4HK2A 3V6CB 2EMSA 2D3GA 2IY0B 2RGFA 2IO2B 1P0RA 1FXTB 2MW5A 2LXAA 3CSFA 3DBLI 3ZTCA 4GIVA 1BT0A 4NY0A 4LDTB 1I42A 1L2NA 1J19A 2CR5A 3HM6X 3TL5A 5CHWA 1IP9A 3O65B 2JWZA 3PLVA 5JH5C 3DBHI 2FCNA 1LQBA 4W9KA 3QA8A 2EMTA 1WM3A 1WJUA 2BYFA 1QZEA 2LASA 2NCNA 1OEYA 4W9IA 2DYBA 3JW0X 3L54A 4EUTA 2DAFA 4FHJA 5IAAC 4KZCA 3SU8X 2M8SA 2LRUA 3R7QA 2GBNA 1LM8B 4LJOB 2G4SA 3GZNI 2ZPYA 3PVLA 2WX0A 3WIMA 4GB9A 3MHSD 1HE8A 3APFA 1I35A 5L83A 2N1VA 2JY6A 4B6WA 1GJZA 1J8CA 2ZVNA 2BGFA 2ZNVC 2PJHA 1TGZB 2KC2A 4K7WA 3D32A 4MGYE 1YJ1A 4ICUA 3CMMB 2AL3A 2K8BA 2V4LA 3KYCD 3B08A 3VH4B 2ZNVB 3NY5A 4ANXA 1EF5A 2L76A 4XC2A 2K8HA 1OGWA 3UINB 4OVUA 2FUHB 4BFRA 5G2NA 2LWPA 1ZW7A 2JF5A 3PSEB 2MBBB 4IM2A 2XK5A 2KDEB 5CHFA 4M8MA 3N3KB 4X57B 4NPNA 2KK8A 4MGKE 3WALA 2IBIB 3EHVA 4GU2A 3LDZE 4LCDE 1WR6E 4NAWA 5JHBA 2V1YA 1WGDA 4ANVA 2K39A 3WAMA 3ZTDA 4WJOA 2NBWB 2IYDB 4NAWB 3N30A 2KX0A 2KTFA 5G55A 4HXDA 4KZ0A 4NQKE 1VD2A 2IO3B 2MBEA 2MWSB 1Q1OA 2N9EB 2RR9A 3NOBA 4K7UA 4W9DA 1GNUA 4BKTA 2MLBA 4FHKA 1M94A 2UWQA 3SD5A 3VH3B 3UF8A 3V61A 3MJWA 2KTRA 3KW5B 2GBMA 5E6NA 2KDBA 2MBQA 3VUWA 4MGIE 1S1QB 1WY8A 1GG3A 2KWUB 3R66C 2Z59B 3SDLC 2KTRB 4ASWC 4GDLB 4FJZA 1WMHA 4IG7B 4A3OA 2R2QA 2L0TA 4W9HA 1NBFC 2ZVOA 1TTNA 1WMHB 3APCA 2HE7A 1WE7A 2J7QB 1E90A 1V9JA 4W9GA 3UQBA 5D94A 2JUOA 3ECIA 4K1RB 3A1QA 4IW0A 3L0WB 1UH6A 2LD9A 1D3ZA 2AL6A 3ZDTA 2WDTB 4LJPB 2L3ZA 4GXBA 3L17A 3ZNGC 4HDQA 3A1QB 5AZFA 4K81A 2O6VD 5FR6A 1RLFA 3NZUA 4I6LB 1KM7A 4IWPA 1RAXA 4DXAB 2ZEQA 5HKHA 3RYTA 2DYMA 1UELA 1R4NI 4ANWA 4DHZB 4W9FA 1F9JA 4RM8A 4ZYNA 2ZZPB 1UBIA 4KIKB 3H9DA 1E7VA 3VQIA 2L8JA 2UYZB 4GDKA 5JZEB 3QAQA 2MBOA 3A4RA 3VTVA 2JT4B 2OJRA 3N32A 1EUVB 3PGEA 2JRHA 4YL8A 3ZNID 5JHAA 1S3SG 2L05A 2LZ6A 3M63B 1X1MA 4W9LA 1AARA 2XEWA 1WIAA 3VXWA 4BKSA 3KVFB 1E8YA 2XBBC 3TCAA 2HD5B 1WX7A 1JRUA 4DDID 3IHPC 3C0RB 2LI5A 1C1YB 4WWPA 2MX2A 2AYOB 4ZRKA 4ZRIA 3WAOA 2C7NB 3MTNB 1RFAA 2N7DA 3ZO5B 3Q3JA 4DK5A 1SE9A 2WWZA 4M8NA 4CHKA 4DHJB 4URKA 4B9KA 2KZRA 3DBSA 4A3PA 2KDIA 2KQSA 2KKCA 1WFYA 5D2MB 3VUXA 3VUYA 4IM3A 1OQYA 2GBKA 4HDOA 3SHQA 3B1LX 2FIFA 2KX3A 3S2AA 4MDKE 4WJQA 4MGZE 3ZNZB 4M0WB 4G3XB 3OLMD 2A4ZA 1WZ3A 3IG3A 2EKEC 2FCMA 4MSMB 4FADA 2CHWA 3TBLD 2HTHA 4E74A 3PPAA 2M4NA 2J0JA 1V6EA 2NR2A 3EC8A 4HLEA 2L00B 3ZLZA 3VDZA 5LXIB 3L08A 3U30A 2O2VA 4E3CA 2DZJA 5J17A 2ZPNA 2JVCA 2KOXA 3QX1A 4MELA 2O2VB 2R2OA 4W9CA 4ICVA 3RZWC 4FA6A 3OAWA 3A9JA 1E8XA 2L7RA 2YLMA 2VRRB 1V81A 3DQVA 2MQJA 4AJWA 2LGXA 1ZKHA 2RPQA 3A9JB 4FN2A 4IWOA 2G45B 3QARA 2D10A 2D07B 2KMAA 4KSLC 4PS8A 5CX3A 1E7UA 1UBQA 1G6JA 3V62A 4WJNA 3JYUA 3QWZB 2KVRA 1WRDB 2V3SA 3H6NA 5TR5A 1E8ZA 4N9F4 5KHOA 1UZXB 3OJ3A 3HK0A 5AEKB 2BPSA 4FULA 3QJZA 3ALBA 3PZDA 3VTWA 1WJ6A 4ZDVA 3EFUA 1Q5WB 4MEMA 1V2YA 2LXCA 3RD2A 4AP4C 2FCSA 1YQBA 2KD0A 4WJPA
chains in the Genus database with same CATH superfamily
2DZIA 4JGHB 5E6PA 1XT9B 1DOXA 2BKFA 2XNAC 1I7HA 1EF1A 1M4VA 4P6VF 2L52A 1ET6A 4TKNA 2REXA 2DLBA 4DBGA 1IPGA 2FUG1 2JU6X 4A20A 2L0FA 3QIJA 3MJ5A 5BYSA 2QEJC 5AZHA 2C7MB 2WU2B 2ZCBA 4EZLA 1MG4A 4PYUA 1KJTA 2KACA 1A5RA 2WXPA 1P7EA 2FE8A 3RCZA 1TBEA 3BVZA 2DZMA 2MHJA 3ML8A 2JXXA 1RRBA 5AUIA 3ZJTA 2KNBA 1TYGB 1YNTE 3DBLB 4BVUC 4NNJB 4AWJA 4OZBA 5CHVC 3AN1A 3RNBC 2EELA 1TJEA 2KFKB 4AS1A 2MBHA 3IT4B 3K9OB 5LLIA 1KF6B 5J18A 4EZJA 1C3TA 3LB8C 2LRWA 4MM3A 2DHZA 3RFZB 2JRIB 3H1UA 5J2RA 4CYEA 3B0AA 1OFFA 1L4DB 1N63A 1H4RA 2K6QA 4M0WA 4YSZB 4CO7A 3KUZA 3VTUA 3P1MA 4II3B 3MC9A 2GMIC 4E71A 3KUCB 4ZRJA 3GE8C 1R4MB 1HZ6A 3VFKA 3NUHB 2WXIA 1ZE3D 3I5JC 4ARIA 4FXCA 4REZA 4GMVA 4A9AA 3JVZX 2KJRA 1TS4A 2YEPF 2K6DB 4AOFA 4GGQA 3R3MA 2WX1A 3M3JA 4FJVB 3WANA 4GOCA 2KLCA 2G4DB 4XGAB 1HZ5A 4AQ7A 1WJ4A 1SGHA 2W9NA 4DXGA 2J0KA 4HPLB 4M00A 4HJKA 2LVPA 2M1MA 3MHZA 2J42A 1UGMA 1WZ0A 1Y56A 2N7JA 4IKGA 1I4RA 2KO3A 5IP4D 1C4PA 1VCBA 1GC6A 2LUEA 4XX5A 2BBCA 3MP9A 3BVMA 1LFDA 2K22A 3X0WA 2NBVB 3AI5A 1SIFA 2CJOA 2WNMA 1XQQA 1Z2MA 4L23A 2KWCA 4FBJB 2M0XA 2NS5A 3B2GA 3BWUD 3W1SA 1DOIA 3R8BA 3PT2B 3DWMA 4N59A 2PE9A 2IGDA 5BO4B 1QQRA 1UUPA 1V86A 3ZW3A 4TQ0A 1LXDA 1WYWB 2QCZA 4WQOB 1EU4A 3PLUA 4AJYB 4G50A 3W5UB 2RD0A 2BKRB 1FNWA 4HROA 3DWGC 5D3IB 2K5PA 4RFBA 2KHWB 1ZDXA 1YX6B 5C1ZA 1J0GA 2OJWA 1F2RI 1WGYA 2JYTA 1L6UA 2O6VA 1VLBA 3N1ZC 4DDGD 2DX5B 3MFGA 4F8CB 3ML9A 4YTMB 1JWBD 1XEEA 2GBJA 2CU3A 1ZUD2 3U7ZA 1K52A 2MJDA 2EMSA 2RGFA 1FXTB 4NY0A 1I42A 1AYFA 3HM6X 5CHWA 1NEKB 3AECB 2EMTA 1QZEA 4W9IA 1HA5A 2VH2A 2G1EA 1GB4A 1P7FA 3JW0X 3TEWA 3TUOA 2LRUA 4A6QA 4JWUC 1ROEA 2PLPA 2ZPYA 3GS2A 1HE8A 3APFA 4BAXA 1GJZA 2JSVX 4A55A 1TGZB 1C4CA 2UU7A 4ANXA 1EF5A 2JYEA 4XC2A 4OVUA 1QOAA 4BFRA 2LWPA 2ZW0A 1F1HA 4IM2A 2MBBB 5CHFA 3AEEB 4KGSA 4RGTA 4X57B 4MGKE 4LCDE 3HVZA 4NAWA 2HDEA 2L83A 3PO0A 2NBWB 2IYDB 3N30A 2LUMA 5G55A 2WLBA 1XLQA 1ZOYB 2RR9A 2V0GA 1V97A 2IGGA 1JW9D 1GNUA 1ZDVA 2LFIA 1M94A 1AW7A 3VH3B 3UF8A 3KW5B 4N6EB 5E6NA 2KDBA 1C76A 5G5GA 4P16A 1GG3A 1WMHA 4WH4A 2R2QA 4YTNB 2ZVOA 4RF0A 1WE7A 1V9JA 5D94A 2JUOA 4K1RB 4IW0A 2JQRB 1UF0A 3ZNGC 3L17A 4K81A 4I6LB 1N60A 2NMQA 4C7ZA 1FEHA 2DYMA 2RPVA 4DHZB 1YJIA 3FKYA 1F9JA 2ACZB 2ZZPB 4RH6A 5FK9C 3VQIA 5JZEB 2BS4B 1L0YB 3VTVA 4NAMA 1PGAA 5JHAA 4C4VA 4QAYA 3AEAB 1WIAA 4NJCA 3KVFB 1RM6C 3OG5A 1ZP0B 1JRUA 5C2TB 1L0VB 2MX2A 2JXTA 3Q3MC 3MTNB 1RFAA 2FBWB 2W82A 1SXTA 3AE6B 3DBSA 4RNAA 1WFYA 3C8YA 3E56A 4IM3A 2WXKA 2GBKA 3KLSX 3SHQA 2FIFA 2KX3A 3ZNZB 4WIPA 3ZJVA 3OLMD 2A4ZA 1FPYA 3TBLD 1IGCA 2M4NA 2NR2A 1V6EA 1SEBD 1I4XA 3EC8A 1GPXA 3L08A 3U30A 2WGSA 2DZJA 3NZ3A 3QX1A 4MELA 2R2OA 4OZAA 4W9CA 3OAWA 2VRRB 4JX1C 2MQJA 2LGXA 1VZ6A 3A9JB 4IWOA 4S17A 1HXYD 4KSLC 5CX3A 1UBQA 3Q3OC 3QWZB 4P1CC 5TR5A 2EKIA 1UZXB 3IXSA 2BPSA 3QJZA 4ZDVA 4MEMA 2N9LA 1KFYB 3M62B 4YT0B 2WHIA 4HJGE 2KJHB 5HFYA 3JSVB 3MC8A 4ITKA 4UDUC 3VR8B 4LNIA 1IGDA 5EE1A 1Q0WB 4RM9A 4L2YA 3PS6A 2WDQB 2GRIA 4ANUA 1WX8A 2C5LC 5E6OA 4W9JA 2KN5A 1WH3A 3AE4B 3DDCB 2K3UA 3IT6B 3T9LA 3L10B 4R3DA 4JPSA 1OEYJ 1Y8RC 1YX5B 3PHWB 4I6PA 2WU5B 2INCC 2KQ7A 1FFUA 2ONQA 4RCOA 4LDTD 3K9PB 3QQ8B 1SF0A 3AMZA 3H7PB 4IUMB 4KSKC 1V5TA 2N1WA 1SJED 1JCKB 2LGYA 2KFKA 3UQAA 4G0NB 2RSUA 3Q69A 3U8ZA 2KFJA 4MJSB 4WWNA 3A9KB 5TSSA 2FAZA 5DPTA 1YN5A 4KDLB 2HJ1A 1WM2A 4LNKA 3PV1A 1T0RC 1EO6A 1N62A 5EDSA 2IPKD 3TJPA 2C7HA 1WI0A 1KOTA 3RNCC 3AE9B 1WR1A 2BYEA 1XF5L 3DCGA 4NZLB 4LTUA 3L16A 4WWOA 1E0ZA 1WXQA 3UIOB 1F52A 4XDCA 4A90A 4AUQC 1KRHA 2B76B 3QHTA 3DHGC 2N7EA 2QDFA 1MG8A 2CHZA 1DYQA 3DBRB 3W1YA 1N5XA 2MJEA 3RPFC 1I4GA 1V1OA 3AE3B 1PYWD 1IBXB 3RZFA 4HCNB 3T8MA 1CK1A 1ET9A 2BVCA 3AULA 1ZXIA 5C23A 4EZKA 1MHXA 5KHQA 1WGGA 3HRDD 3KWLA 3UI3A 2SAKA 4JQWC 3PZ7A 1R4MI 3IAM1 3P42A 4WAAA 2KMMA 1GC7A 3TEXA 2H89B 4YXDB 2XK5B 4PS3A 2WDRB 2AQ1B 4HCPB 1PGBA 3WAPA 3ZGZA 2M56B 3PZ8A 3ZRFA 4C00A 2A5UA 3TIXA 1JALA 3PRZA 1JWMD 4MSQB 3W1SC 1F2RC 3N1YC 3KH0A 4IWQA 4K7SA 3PTFC 2MRPA 5I4DA 1TZOA 1L7YA 2BS2B 1K50A 4BBNC 4KV2A 2Y3AA 2AWTA 1V80A 1TS2A 4P7IA 1D5MC 3EFCA 4KKJA 1FNVA 2Y5CA 4JLCA 2K8CA 3EGRA 4NJ6A 2WXFA 2K1FA 3IBEA 2MCNB 3Q8AA 4FJYA 4JIOU 1FRRA 1SB3C 3OWEB 2YEPB 4EFOA 1YQ4B 1P9DU 2M0AA 2PE6B 2KMCA 3V6EB 2K0PA 3ENEA 3DOWA 1FO4A 5BMGA 1C4AA 3HIZA 3PREA 2WXRA 1GOZA 2JPHA 3ONSA 2IO0B 5DPRA 2PW9A 4ARCA 3GZNB 2IO2B 1P0RA 4WAFA 3VRBB 1L0XB 3CSFA 3ZTCA 1J19A 2CR5A 1IP9A 4OHJA 3DBHI 1LQBA 4W9KA 2VZKB 3BYYB 1FFVA 4FHJA 2XN9C 2KN4A 2GBNA 1LM8B 2G4SA 3DHHC 3PVLA 2WX0A 4GB9A 1L4ZB 2ZNVC 3W2DA 2PJHA 4RGOS 3D32A 4MGYE 3CMMB 1XLNA 2K8BA 3KYCD 2E6XA 1VDVA 1OGWA 1GB1A 3UINB 2FUHB 5G2NA 4ZRPA 3VRAB 1ZW7A 1JWUD 3PSEB 4KGRA 3ZXRA 1JROA 4NPNA 3NVYA 4GU2A 1WR6E 2V1YA 1WGDA 3SFDB 1WGKA 4ANVA 1NENB 3MC0B 2KTFA 1EU3A 4NQKE 1VD2A 2MWSB 1Q1OA 3NOBA 4W9DA 1BMLC 4BKTA 4GLSC 4FHKA 1PFDA 1XO3A 2UWQA 3EUB2 1C79A 2GBMA 3VUWA 1R4NB 2AX5A 1WY8A 3R66C 3SDLC 2Z59B 3NJTA 3Q8FA 4IG7B 4KGTA 2L0TA 4W9HA 2IDYA 1E90A 4HRSA 3ECIA 5BMHA 2DBYA 1T0QC 2AL6A 3ZDTA 4US8A 4LJPB 4GXBA 1F0ZA 3A1QB 1C77A 5IN7A 2GB1A 1AN8A 1RAXA 4DXAB 3AEBB 2ZEQA 2K9XA 1UELA 2G9HD 4RM8A 3H9DA 2INNE 4GDKA 2UYZB 4ZOHC 2OJRA 5T8IA 1EUVB 4KKIA 2PKOA 2L05A 4W9LA 2VZKD 2LGSA 3VXWA 2INDC 1WX7A 2LI5A 3CIRB 3SFEB 3ZO5B 1LO5D 2N7DA 2BTEA 4DK5A 1SE9A 1TKYA 4DHJB 4A3PA 3VUXA 2KKCA 5D2MB 1ZXHA 1I4PA 1SJHD 3AV8A 4IDIA 3S2AA 4LNNA 2AQ3B 3TEYA 4MGZE 4M0WB 1WZ3A 3IG3A 2EKEC 2FCMA 4FADA 3Q2AC 1QT9A 2L00B 3ZLZA 1J7AA 1RFKA 4HPPA 3VDZA 1FCLA 3U2SC 3R2IA 5J17A 2O2VB 4ICVA 4B0EA 3A9JA 1E8XA 1HQRD 2L7RA 1V81A 3DQVA 2RMMA 1E6EB 3CWIA 1QLBB 1VJKA 1G6JA 3V62A 1CZPA 1UWMA 3NVWA 4N9F4 2V3PA 4M02A 1TY0A 4FULA 3ALBA 1JWSD 2J53A 3AEDB 3EFUA 2LXCA 1PUTA 4AP4C 4LNFA 4C80A 3RI7C 3PRPB 2MSED 2LJ5A 1BUIC 2NPTB 4GDLA 2ASQA 5AZGA 1I4HA 4FLHA 1HTOA 2BWES 1NYQA 4P1BC 4F7ZA 3RT3B 2KVZA 4MH0E 4WWMA 3ZKJC 2DAJA 1JRPA 1P1AA 3TEZA 3U7DA 4M01A 3FILB 5BYRA 4II2B 1N6ZA 3P4PB 1WJNA 1V1PA 4KIKA 2BS3B 3PHXB 5BMIA 1WXAA 3H7PA 1WE6A 4PS7A 1XXGA 1FMAD 1YOVB 3Q3FA 1P98A 2KDMA 1SIJA 2W54A 5JXVA 5G5HA 2H88B 3ZVVA 1H8CA 3ZIMA 3BINA 2OOBB 3ZQ4A 4B95A 2MP2B 1NDDA 3TMPB 2KDFB 2LEKA 3NS1A 3WCQA 1TT5B 2HTME 3APDA 1ISNA 4ZRQA 2KLGA 1WGRA 2Y5BB 3BVGA 1R7SA 2LVOA 5IOIA 2HJ8A 4KX6B 3AEFB 4BBNF 4J6IA 4KDIC 1E8WA 2WXLA 5DPSA 3L13A 1FM0D 2BB6A 3RUIB 2CKHB 3QC8B 1WYGA 2M17A 1YD8U 1PQSA 4GSWA 2JZZA 2KWVB 4YSYB 3DVNU 3BIID 5D6JB 2BWFA 2FNJB 1KH0A 2IZVB 1E7PB 1T0YA 2LGDA 1U4AA 2IO1B 1B1ZA 4B0MA 4RMAA 2MA9B 2D5GA 3DBRI 5C3JB 2Z0DB 2WYQA 2LHDA 3Q8CA 5AUKA 2J4XA 4C7YA 3P2BA 1OQRA 3W9CB 1WX9A 1QOBA 3WA0A 2LVQA 3RN9C 3IVFA 4TV3A 3H8HA 3I3TB 1HEZE 5GMVA 3QCAA 3V60A 2FCQA 4HEA1 2LGIA 2N9KA 2BQQA 1CMXB 3ABVB 2R61A 3HVDA 1K8RB 2D3BA 1XCQL 3J9CA 3AU4A 1FD6A 5LXHA 3GOEA 1I4QA 4WQMA 5IKCM 2ZJDA 4HVBA 1YN3A 2AEHA 4PT5A 4DXFA 1CQVA 1WXMA 2BYVE 5HI1A 2Z0EB 4BKGA 1YQ3B 3EECA 3PRMB 2D2QA 2QSDA 3DPDA 4BZAA 1GUAB 2CS4A 3SEBA 3ZNHB 2DZKA 4PYZA 4HPMB 2ZW1A 3HHMA 3KUDB 1D4BA 2WXNA 1ZGUB 4EOYA 2TSSA 1NVID 2IY1B 1UGJA 2I1KA 3VAWA 5D7GA 2NTTA 4XWTA 1LGRA 3B2FA 3V6CB 2IY0B 4XDDA 3BZDB 2LXAA 3DBLI 4GIVA 2JWZA 3PLVA 5JH5C 2FCNA 1WM3A 2JWUA 2BYFA 3N20C 3ZYYX 1OEYA 5FR3A 2DYBA 3TSSA 3AE1B 5MPOA 2MEKA 4EUTA 5IAAC 4KZCA 1T6BX 2N0SB 4LJOB 1QKZA 3GZNI 5L83A 2JY6A 3N1XC 4B6WA 2ZVNA 2KC2A 1YJ1A 1NYRA 2AL3A 1SE4A 3B08A 3VH4B 1E9MA 3NY5A 3T3NA 3P63A 1WRIA 1FXAA 2I2YA 4OZCA 4LK0M 4HKQA 3RNAC 2KDEB 2W55A 4M8MA 3NVZA 3N3KB 3ZJUA 1J7CA 3EHVA 2WXJA 3LDZE 4DQOC 1V8CA 5JHBA 3ZTDA 1FNUA 2KX0A 4KZ0A 2JZPA 2N9EB 4K7UA 3I57A 3P4QB 2MLBA 3SD5A 4EE2A 3V61A 1QOGA 2MBQA 4MGIE 2KWUB 2KTRB 2LMCA 3AE2B 4XYCA 1YMHE 2QILA 1NBFC 1TKEA 2HE7A 2J7QB 1FIQA 2BW2A 3UQBA 3Q3NC 4LLGM 3A1QA 3L0WB 1UH6A 2LD9A 1FXIA 2L3ZA 2PMVA 4ACFA 4IWPA 4WURA 1ACCA 3RYTA 1R4NI 4ANWA 4ZYNA 4O1NA 2KQ4X 1UBIA 1E7VA 3GP7A 2L8JA 2MBOA 5HHDG 2JRHA 4YL8A 4MT5A 2CJNA 3NG0A 3ZNID 4RF1A 3W5VB 2XEWA 2AQ2B 1E8YA 2XBBC 3AB5A 3IHPC 1SE3A 1C1YB 2AYOB 1WWTA 2C7NB 1ENFA 3BK2A 2WWZA 2KZRA 3BK1A 2KDIA 2KQSA 3AE5B 1OQYA 4HDOA 1J7BA 4WJQA 1CJEA 4G3XB 3Q8EA 2KT7A 4MSMB 2CHWA 4E74A 3PPAA 1QILA 3P4RB 5LXIB 3AEGB 4IOIE 2O2VA 1XLOA 2ZPNA 2JVCA 2IGHA 1B9RA 5LNK1 4ZHOA 2KAJA 2M19A 5E6JA 2YLMA 4AJWA 1ZKHA 2RPQA 4FN2A 1FCCC 4J3OD 3L4PA 2D07B 4PS8A 1UWXA 3SR6A 1OQQA 1WRDB 2VH1A 3H6NA 2BYTA 5KHOA 3OJ3A 2GLSA 3RNEC 3EA6A 5AEKB 4LNOA 4XE0A 1V2YA 2SEBD 3RD2A 1YQBA 2NPTA 2KD0A 1D6EC 4WJPA 2W3SA 3FC4A 3ZDMC 4CQNA 2D11A 3GB1A 2BT6A 2CU1A 4MACA 1E10A 2J0MA 2C60A 2RDHA 1MHHE 1NI2A 5D3DA 3H7SA 3NZSA 4F1SA 2MJ3A 1SE2A 3UGBB 4DWFA 2PVGC 2NTSA 3AXCA 4RGNA 2QHOA 3BYTB 3DHIC 4I6NB 3DVGX 4BOSC 1WXSA 3FILA 3HM3A 1TS5A 1N61A 2GBRA 3IAS1 5DPWA 2WQYB 5EE9A 3V05A 4HWIB 1OTRB 4TUUA 2KWDA 2KC1A 1JMLA 1WXVA 1L6VA 5IA7A 2KANA 3ETRA 2PIAA 4BKSD 3U52E 1P3QU 3VVWB 3DBHB 2KYWA 2MP2A 2JZ3B 1L5PA 2DENB 1TIFA 4ZHPA 5H8YE 1UNSA 1MFWA 5IO9A 2WXOA 3R7RA 4MM3B 2I1JA 2PPHA 3AE8B 2C9WB 4DHZE 2LJIA 2WDVB 2K25A 1IYFA 1V5OA 2DWQA 1VRAB 2CHXA 1EWYC 1PGXA 5H92C 2WXMA 4A8XC 3T3OA 5DCNA 1D5XC 3A33B 2RDBC 1AWDA 2YVCA 2N4FA 4C56C 3DVNV 3Q8BA 3KWVA 3IFWB 1KLVA 4NQLB 5HG2A 3X23A 1V49A 2I38A 1VR9A 3BY4B 2DYOA 1WGHA 4NJ7A 3HUIA 2NBUA 3GE3C 3ZUNA 2Y5PA 1YN4A 1HTQA 2ZCCA 3NS8A 3P4SB 4ZRIA 1XD3B 2B3AA 1K51A 4BOZB 3CSTA 3KYDD 3AU5A 2BF8B 2E3TA 2D3AA 3KQ4A 2GOWA 1TY2A 3JSVA 4GN1A 4TQ1A 4W9EA 1T5XD 3ZXVA 3OJ4B 3RULA 2W3RA 3AH7A 4IM0A 3RMKC 3ZRCA 2GI9A 1STEA 4OVZA 5L95C 4EEWA 3DVGY 4D2KA 3VHTC 4K3BA 3LXFA 1EWCA 1TS3A 4KVGB 3B9JA 3NVVA 2V4IB 4JL9A 4OW0A 1JQ4A 1MI0A 1E5WA 3A4SC 2N9XA 2WXQA 4OVVA 4XZ4A 3QK0A 1YIWA 4N58A 5CTRC 3LJ3A 1MJDA 1TKGA 1WF9A 3VR9B 1BXTA 1KLUD 2G3QB 2NVUI 1NI3A 1MPEA 2KXJA 4G11A 3UIPB 3CF6E 2OEDA 4IC7B 2RDGA 2PEAA 4DHJD 3AM9A 4MJSA 5FKAC 3A9KA 4EKUA 1TZ1A 1DOYA 2FIDA 2JX5A 2ICIA 3NHEB 1N5WA 1YJJA 2N9PC 1Z5SB 2O6VB 2ON8A 2KJ6A 1UD7A 2WS3B 4GDKB 3M95A 4HK2A 2D3GA 3LYYA 2MW5A 1JWAD 1BT0A 4LDTB 1L2NA 3TL5A 4USAA 3O65B 1KLGD 3QA8A 1WJUA 2LASA 2NCNA 2QMTA 1QF6A 3N9YC 3L54A 2DAFA 1IBXA 3SU8X 2M8SA 3R7QA 2Q5WD 2LHEA 1C78A 1F77A 1D5ZC 4H2AA 3WIMA 3MHSD 1XLPA 1ZPSA 1I35A 2N1VA 1J8CA 2BGFA 4K7WA 4ICUA 2V4LA 2ZNVB 2MH7A 2L76A 2K8HA 2L32A 3RNFC 4MH8A 1RYJA 2JF5A 2XK5A 4TMAB 3RNGC 2KK8A 3WALA 2IBIB 2WP9B 4L1BA 2OHFA 4JWSC 5EE0A 2K39A 3WAMA 4WJOA 4NAWB 5BYQA 1DGJA 4HXDA 1PDXA 2IO3B 2MBEA 4S0RA 4ZYSA 3NRZA 5GXGB 3MJWA 2KTRA 4US9A 1RWSA 1S1QB 4ASWC 1QOFA 4GDLB 3E9SA 4FJZA 1T0SC 1T3QA 4A3OA 1TTNA 1WMHB 3O13A 1SSNA 2V9HA 3APCA 4W9GA 1D3ZA 2WXHA 3I9V1 2WDTB 4HDQA 5AZFA 1ESFA 2O6VD 5FR6A 1RLFA 3NZUA 1KM7A 5HKHA 3U4EG 3Q6BA 4W9FA 1V1PB 2WXGA 1VZ8A 2X8XX 4KIKB 3URYA 3I63C 2D3CA 3QAQA 3A4RA 2JT4B 3N32A 3PGEA 4YWGG 4YTPB 1S3SG 2LZ6A 3M63B 1X1MA 1AARA 1MVKA 4HKZE 4C4VB 2Z8LA 4BKSA 1KTKA 4RGMA 1C9FA 3TCAA 2HD5B 1IUEA 4DDID 3C0RB 3C19A 4WWPA 4ZRKA 1FRDA 2BB5A 3WAOA 2V3NA 3Q3JA 1EM7A 4CHKA 4M8NA 4URKA 4B9KA 4K3CA 3VUYA 1GAQB 2QIEB 4PK1A 3B1LX 3Q14C 2PVOD 4MDKE 2L1AA 2DNFA 4XWWA 1WSPA 2HTHA 1SBBB 2X38A 4YSXB 2J0JA 1Q10A 4HLEA 2QC8A 1K53A 3R2TA 4E3CA 2INPE 2KOXA 1XCTL 3RZWC 4TSSA 4FA6A 2QJLA 2J52A 3V3XA 5EE3A 2PTLA 2G45B 3QARA 2D10A 2KMAA 1E7UA 2IJ0A 4WJNA 3JYUA 4Q2JA 2KVRA 2V3SA 1E8ZA 3HK0A 1VZ7A 3PZDA 3VTWA 1WJ6A 4JE3B 1Q5WB 3AE7B 3FAHA 1A70A 2FCSA
chains in the Genus database with same CATH topology
3PRPB 3ZDMC 2D11A 2DZIA 2MSED 3M62B 4JGHB 2LJ5A 2CU1A 2NPTB 2KJHB 3JSVB 2J0MA 4GDLA 5E6PA 2C60A 2ASQA 1XT9B 5AZGA 1NI2A 2BKFA 3H7SA 3NZSA 4F1SA 1EF1A 1Q0WB 4RM9A 4FLHA 4TKNA 2REXA 3UGBB 4DWFA 3PS6A 4DBGA 1IPGA 2BWES 4ANUA 3AXCA 2QHOA 4A20A 1WX8A 2C5LC 2L0FA 3RT3B 4MH0E 4F7ZA 5E6OA 4W9JA 3ZKJC 2DAJA 3QIJA 2KN5A 1WH3A 4I6NB 3DDCB 3DVGX 5AZHA 4BOSC 2C7MB 1P1AA 1WXSA 3HM3A 3T9LA 3U7DA 3L10B 2GBRA 2ZCBA 4EZLA 1OEYJ 5DPWA 4PYUA 1KJTA 4II2B 1Y8RC 1YX5B 3PHWB 4I6PA 1A5RA 1WJNA 2KQ7A 3RCZA 1TBEA 4HWIB 1OTRB 2DZMA 4KIKA 4TUUA 3PHXB 2KC1A 1WXVA 3ML8A 1WXAA 5IA7A 2KANA 3H7PA 1WE6A 2JXXA 4LDTD 1RRBA 4PS7A 3K9PB 3QQ8B 4BKSD 2KNBA 3H7PB 4IUMB 4KSKC 1V5TA 3Q3FA 2N1WA 4BVUC 1P98A 4NNJB 1P3QU 3VVWB 4AWJA 2LGYA 2KFKA 3UQAA 5CHVC 4G0NB 2RSUA 3ZVVA 2KFKB 2MBHA 3K9OB 5LLIA 2MP2A 2JZ3B 3U8ZA 2KFJA 1H8CA 5J18A 4MJSB 2DENB 3ZIMA 3BINA 2OOBB 4WWNA 4EZJA 4B95A 1C3TA 2MP2B 3A9KB 1NDDA 2FAZA 2LRWA 4MM3A 2DHZA 5DPTA 2JRIB 4KDLB 3H1UA 5J2RA 1WM2A 3TMPB 3PV1A 3R7RA 4CYEA 2KDFB 2I1JA 1EO6A 2PPHA 3B0AA 5EDSA 3APDA 3TJPA 2C9WB 1ISNA 4DHZE 2C7HA 1WI0A 1KOTA 1H4RA 1WR1A 2BYEA 2K6QA 2K25A 3DCGA 2KLGA 1WGRA 4CO7A 1V5OA 3L16A 3KUZA 4WWOA 3VTUA 1IYFA 4II3B 2Y5BB 2CHXA 3UIOB 2LVOA 2GMIC 4E71A 2HJ8A 4AUQC 3KUCB 3QHTA 4ZRJA 5DCNA 4BBNF 3A33B 4J6IA 4KDIC 3VFKA 1E8WA 5DPSA 2N7EA 3L13A 1MG8A 2CHZA 2YVCA 3RUIB 2N4FA 3W1YA 2CKHB 3QC8B 3DVNV 4GMVA 3IFWB 2M17A 1KLVA 1YD8U 3JVZX 2KJRA 1PQSA 4NQLB 3X23A 2K6DB 1V49A 4GSWA 4AOFA 3RZFA 4HCNB 2JZZA 3BY4B 2KWVB 4GGQA 2DYOA 3R3MA 3T8MA 2WX1A 3AULA 3DVNU 1WGHA 5C23A 4NJ7A 3M3JA 4FJVB 4EZKA 2NBUA 5D6JB 3WANA 5KHQA 2BWFA 4GOCA 3ZUNA 1WGGA 2KLCA 2G4DB 2FNJB 2ZCCA 4JQWC 2IZVB 1T0YA 3NS8A 2LGDA 1R4MI 1SGHA 1U4AA 1WJ4A 1XD3B 2B3AA 2IO1B 2J0KA 2W9NA 3CSTA 3KYDD 4HPLB 4BOZB 3AU5A 2BF8B 4HJKA 2LVPA 4WAAA 2M1MA 4RMAA 2GOWA 2MA9B 1UGMA 1WZ0A 3DBRI 1GC7A 2KO3A 3JSVA 4GN1A 2Z0DB 2WYQA 4TQ1A 4W9EA 1VCBA 1GC6A 2LUEA 2NPTA 4XX5A 3OJ4B 2XK5B 3RULA 4IM0A 4PS3A 3P2BA 1WX9A 3ZRCA 1LFDA 3X0WA 3WA0A 2NBVB 4HCPB 3WAPA 2LVQA 3IVFA 3AI5A 3ZRFA 1SIFA 5L95C 4TV3A 4EEWA 1XQQA 1Z2MA 3I3TB 2A5UA 3DVGY 3TIXA 2KWCA 5GMVA 4FBJB 3VHTC 3PRZA 2M0XA 2NS5A 3QCAA 4KVGB 2FCQA 4MSQB 3V60A 3W1SC 4JL9A 3W1SA 1E5WA 3A4SC 1CMXB 2N9XA 3KH0A 3PT2B 4IWQA 4K7SA 3PTFC 2MRPA 2PE9A 1K8RB 4OVVA 4XZ4A 1L7YA 3QK0A 1YIWA 5BO4B 5CTRC 4KV2A 4BBNC 1V86A 3AU4A 2AWTA 3ZW3A 1LXDA 1V80A 1WYWB 3LJ3A 4TQ0A 5LXHA 4P7IA 3GOEA 1WF9A 4WQOB 2ZJDA 3PLUA 4AJYB 4HVBA 2AEHA 4G50A 4JLCA 2K8CA 1WXMA 4NJ6A 2BYVE 2G3QB 2K1FA 3IBEA 2MCNB 2NVUI 2Z0EB 2KXJA 2RD0A 4FJYA 2BKRB 4G11A 4BKGA 3UIPB 3CF6E 4JIOU 4IC7B 3EECA 2PEAA 3PRMB 2D2QA 4EFOA 3DPDA 4DHJD 4MJSA 2KHWB 1GUAB 2CS4A 3ZNHB 2DZKA 1YX6B 4PYZA 5C1ZA 1P9DU 3A9KA 4HPMB 4EKUA 1J0GA 3HHMA 1TZ1A 3KUDB 2PE6B 2FIDA 1WGYA 2KMCA 3V6EB 1ZGUB 4EOYA 3ENEA 2O6VA 3NHEB 3DOWA 2IY1B 4DDGD 2DX5B 2I1KA 4F8CB 3ML9A 2N9PC 3VAWA 5D7GA 1Z5SB 2O6VB 3HIZA 3PREA 2KJ6A 2GBJA 1UD7A 2JPHA 3ONSA 4GDKB 2IO0B 3M95A 5DPRA 4HK2A 3V6CB 2EMSA 2D3GA 2IY0B 2RGFA 2IO2B 1P0RA 1FXTB 2MW5A 2LXAA 3CSFA 3DBLI 3ZTCA 4GIVA 1BT0A 4NY0A 4LDTB 1I42A 1L2NA 1J19A 2CR5A 3HM6X 3TL5A 5CHWA 1IP9A 3O65B 2JWZA 3PLVA 5JH5C 3DBHI 2FCNA 1LQBA 4W9KA 3QA8A 2EMTA 1WM3A 1WJUA 2BYFA 1QZEA 2LASA 2NCNA 1OEYA 4W9IA 2DYBA 3JW0X 3L54A 4EUTA 2DAFA 4FHJA 5IAAC 4KZCA 3SU8X 2M8SA 2LRUA 3R7QA 2GBNA 1LM8B 4LJOB 2G4SA 3GZNI 2ZPYA 3PVLA 2WX0A 3WIMA 4GB9A 3MHSD 1HE8A 3APFA 1I35A 5L83A 2N1VA 2JY6A 4B6WA 1GJZA 1J8CA 2ZVNA 2BGFA 2ZNVC 2PJHA 1TGZB 2KC2A 4K7WA 3D32A 4MGYE 1YJ1A 4ICUA 3CMMB 2AL3A 2K8BA 2V4LA 3KYCD 3B08A 3VH4B 2ZNVB 3NY5A 4ANXA 1EF5A 2L76A 4XC2A 2K8HA 1OGWA 3UINB 4OVUA 2FUHB 4BFRA 5G2NA 2LWPA 1ZW7A 2JF5A 3PSEB 2MBBB 4IM2A 2XK5A 2KDEB 5CHFA 4M8MA 3N3KB 4X57B 4NPNA 2KK8A 4MGKE 3WALA 2IBIB 3EHVA 4GU2A 3LDZE 4LCDE 1WR6E 4NAWA 5JHBA 2V1YA 1WGDA 4ANVA 2K39A 3WAMA 3ZTDA 4WJOA 2NBWB 2IYDB 4NAWB 3N30A 2KX0A 2KTFA 5G55A 4HXDA 4KZ0A 4NQKE 1VD2A 2IO3B 2MBEA 2MWSB 1Q1OA 2N9EB 2RR9A 3NOBA 4K7UA 4W9DA 1GNUA 4BKTA 2MLBA 4FHKA 1M94A 2UWQA 3SD5A 3VH3B 3UF8A 3V61A 3MJWA 2KTRA 3KW5B 2GBMA 5E6NA 2KDBA 2MBQA 3VUWA 4MGIE 1S1QB 1WY8A 1GG3A 2KWUB 3R66C 2Z59B 3SDLC 2KTRB 4ASWC 4GDLB 4FJZA 1WMHA 4IG7B 4A3OA 2R2QA 2L0TA 4W9HA 1NBFC 2ZVOA 1TTNA 1WMHB 3APCA 2HE7A 1WE7A 2J7QB 1E90A 1V9JA 4W9GA 3UQBA 5D94A 2JUOA 3ECIA 4K1RB 3A1QA 4IW0A 3L0WB 1UH6A 2LD9A 1D3ZA 2AL6A 3ZDTA 2WDTB 4LJPB 2L3ZA 4GXBA 3L17A 3ZNGC 4HDQA 3A1QB 5AZFA 4K81A 2O6VD 5FR6A 1RLFA 3NZUA 4I6LB 1KM7A 4IWPA 1RAXA 4DXAB 2ZEQA 5HKHA 3RYTA 2DYMA 1UELA 1R4NI 4ANWA 4DHZB 4W9FA 1F9JA 4RM8A 4ZYNA 2ZZPB 1UBIA 4KIKB 3H9DA 1E7VA 3VQIA 2L8JA 2UYZB 4GDKA 5JZEB 3QAQA 2MBOA 3A4RA 3VTVA 2JT4B 2OJRA 3N32A 1EUVB 3PGEA 2JRHA 4YL8A 3ZNID 5JHAA 1S3SG 2L05A 2LZ6A 3M63B 1X1MA 4W9LA 1AARA 2XEWA 1WIAA 3VXWA 4BKSA 3KVFB 1E8YA 2XBBC 3TCAA 2HD5B 1WX7A 1JRUA 4DDID 3IHPC 3C0RB 2LI5A 1C1YB 4WWPA 2MX2A 2AYOB 4ZRKA 4ZRIA 3WAOA 2C7NB 3MTNB 1RFAA 2N7DA 3ZO5B 3Q3JA 4DK5A 1SE9A 2WWZA 4M8NA 4CHKA 4DHJB 4URKA 4B9KA 2KZRA 3DBSA 4A3PA 2KDIA 2KQSA 2KKCA 1WFYA 5D2MB 3VUXA 3VUYA 4IM3A 1OQYA 2GBKA 4HDOA 3SHQA 3B1LX 2FIFA 2KX3A 3S2AA 4MDKE 4WJQA 4MGZE 3ZNZB 4M0WB 4G3XB 3OLMD 2A4ZA 1WZ3A 3IG3A 2EKEC 2FCMA 4MSMB 4FADA 2CHWA 3TBLD 2HTHA 4E74A 3PPAA 2M4NA 2J0JA 1V6EA 2NR2A 3EC8A 4HLEA 2L00B 3ZLZA 3VDZA 5LXIB 3L08A 3U30A 2O2VA 4E3CA 2DZJA 5J17A 2ZPNA 2JVCA 2KOXA 3QX1A 4MELA 2O2VB 2R2OA 4W9CA 4ICVA 3RZWC 4FA6A 3OAWA 3A9JA 1E8XA 2L7RA 2YLMA 2VRRB 1V81A 3DQVA 2MQJA 4AJWA 2LGXA 1ZKHA 2RPQA 3A9JB 4FN2A 4IWOA 2G45B 3QARA 2D10A 2D07B 2KMAA 4KSLC 4PS8A 5CX3A 1E7UA 1UBQA 1G6JA 3V62A 4WJNA 3JYUA 3QWZB 2KVRA 1WRDB 2V3SA 3H6NA 5TR5A 1E8ZA 4N9F4 5KHOA 1UZXB 3OJ3A 3HK0A 5AEKB 2BPSA 4FULA 3QJZA 3ALBA 3PZDA 3VTWA 1WJ6A 4ZDVA 3EFUA 1Q5WB 4MEMA 1V2YA 2LXCA 3RD2A 4AP4C 2FCSA 1YQBA 2KD0A 4WJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PRP B;  3ZDM C;  2D11 A;  2DZI A;  2MSE D;  3M62 B;  4JGH B;  2LJ5 A;  2CU1 A;  2NPT B;  2KJH B;  3JSV B;  2J0M A;  4GDL A;  5E6P A;  2C60 A;  2ASQ A;  1XT9 B;  5AZG A;  1NI2 A;  2BKF A;  3H7S A;  3NZS A;  4F1S A;  1EF1 A;  1Q0W B;  4RM9 A;  4FLH A;  4TKN A;  2REX A;  3UGB B;  4DWF A;  3PS6 A;  4DBG A;  1IPG A;  2BWE S;  4ANU A;  3AXC A;  2QHO A;  4A20 A;  1WX8 A;  2C5L C;  2L0F A;  3RT3 B;  4MH0 E;  4F7Z A;  5E6O A;  4W9J A;  3ZKJ C;  2DAJ A;  3QIJ A;  2KN5 A;  1WH3 A;  4I6N B;  3DDC B;  3DVG X;  5AZH A;  4BOS C;  2C7M B;  1P1A A;  1WXS A;  3HM3 A;  3T9L A;  3U7D A;  3L10 B;  2GBR A;  2ZCB A;  4EZL A;  1OEY J;  5DPW A;  4PYU A;  1KJT A;  4II2 B;  1Y8R C;  1YX5 B;  3PHW B;  4I6P A;  1A5R A;  1WJN A;  2KQ7 A;  3RCZ A;  1TBE A;  4HWI B;  1OTR B;  2DZM A;  4KIK A;  4TUU A;  3PHX B;  2KC1 A;  1WXV A;  3ML8 A;  1WXA A;  5IA7 A;  2KAN A;  3H7P A;  1WE6 A;  2JXX A;  4LDT D;  1RRB A;  4PS7 A;  3K9P B;  3QQ8 B;  4BKS D;  2KNB A;  3H7P B;  4IUM B;  4KSK C;  1V5T A;  3Q3F A;  2N1W A;  4BVU C;  1P98 A;  4NNJ B;  1P3Q U;  3VVW B;  4AWJ A;  2LGY A;  2KFK A;  3UQA A;  5CHV C;  4G0N B;  2RSU A;  3ZVV A;  2KFK B;  2MBH A;  3K9O B;  5LLI A;  2MP2 A;  2JZ3 B;  3U8Z A;  2KFJ A;  1H8C A;  5J18 A;  4MJS B;  2DEN B;  3ZIM A;  3BIN A;  2OOB B;  4WWN A;  4EZJ A;  4B95 A;  1C3T A;  2MP2 B;  3A9K B;  1NDD A;  2FAZ A;  2LRW A;  4MM3 A;  2DHZ A;  5DPT A;  2JRI B;  4KDL B;  3H1U A;  5J2R A;  1WM2 A;  3TMP B;  3PV1 A;  3R7R A;  4CYE A;  2KDF B;  2I1J A;  1EO6 A;  2PPH A;  3B0A A;  5EDS A;  3APD A;  3TJP A;  2C9W B;  1ISN A;  4DHZ E;  2C7H A;  1WI0 A;  1KOT A;  1H4R A;  1WR1 A;  2BYE A;  2K6Q A;  2K25 A;  3DCG A;  2KLG A;  1WGR A;  4CO7 A;  1V5O A;  3L16 A;  3KUZ A;  4WWO A;  3VTU A;  1IYF A;  4II3 B;  2Y5B B;  2CHX A;  3UIO B;  2LVO A;  2GMI C;  4E71 A;  2HJ8 A;  4AUQ C;  3KUC B;  3QHT A;  4ZRJ A;  5DCN A;  4BBN F;  3A33 B;  4J6I A;  4KDI C;  3VFK A;  1E8W A;  5DPS A;  2N7E A;  3L13 A;  1MG8 A;  2CHZ A;  2YVC A;  3RUI B;  2N4F A;  3W1Y A;  2CKH B;  3QC8 B;  3DVN V;  4GMV A;  3IFW B;  2M17 A;  1KLV A;  1YD8 U;  3JVZ X;  2KJR A;  1PQS A;  4NQL B;  3X23 A;  2K6D B;  1V49 A;  4GSW A;  4AOF A;  3RZF A;  4HCN B;  2JZZ A;  3BY4 B;  2KWV B;  4GGQ A;  2DYO A;  3R3M A;  3T8M A;  2WX1 A;  3AUL A;  3DVN U;  1WGH A;  5C23 A;  4NJ7 A;  3M3J A;  4FJV B;  4EZK A;  2NBU A;  5D6J B;  3WAN A;  5KHQ A;  2BWF A;  4GOC A;  3ZUN A;  1WGG A;  2KLC A;  2G4D B;  2FNJ B;  2ZCC A;  4JQW C;  2IZV B;  1T0Y A;  3NS8 A;  2LGD A;  1R4M I;  1SGH A;  1U4A A;  1WJ4 A;  1XD3 B;  2B3A A;  2IO1 B;  2J0K A;  2W9N A;  3CST A;  3KYD D;  4HPL B;  4BOZ B;  3AU5 A;  2BF8 B;  4HJK A;  2LVP A;  4WAA A;  2M1M A;  4RMA A;  2GOW A;  2MA9 B;  1UGM A;  1WZ0 A;  3DBR I;  1GC7 A;  2KO3 A;  3JSV A;  4GN1 A;  2Z0D B;  2WYQ A;  4TQ1 A;  4W9E A;  1VCB A;  1GC6 A;  2LUE A;  2NPT A;  4XX5 A;  3OJ4 B;  2XK5 B;  3RUL A;  4IM0 A;  4PS3 A;  3P2B A;  1WX9 A;  3ZRC A;  1LFD A;  3X0W A;  3WA0 A;  2NBV B;  4HCP B;  3WAP A;  2LVQ A;  3IVF A;  3AI5 A;  3ZRF A;  1SIF A;  5L95 C;  4TV3 A;  4EEW A;  1XQQ A;  1Z2M A;  3I3T B;  2A5U A;  3DVG Y;  3TIX A;  2KWC A;  5GMV A;  4FBJ B;  3VHT C;  3PRZ A;  2M0X A;  2NS5 A;  3QCA A;  4KVG B;  2FCQ A;  4MSQ B;  3V60 A;  3W1S C;  4JL9 A;  3W1S A;  1E5W A;  3A4S C;  1CMX B;  2N9X A;  3KH0 A;  3PT2 B;  4IWQ A;  4K7S A;  3PTF C;  2MRP A;  2PE9 A;  1K8R B;  4OVV A;  4XZ4 A;  1L7Y A;  3QK0 A;  1YIW A;  5BO4 B;  5CTR C;  4KV2 A;  4BBN C;  1V86 A;  3AU4 A;  2AWT A;  3ZW3 A;  1LXD A;  1V80 A;  1WYW B;  3LJ3 A;  4TQ0 A;  5LXH A;  4P7I A;  3GOE A;  1WF9 A;  4WQO B;  2ZJD A;  3PLU A;  4AJY B;  4HVB A;  2AEH A;  4G50 A;  4JLC A;  2K8C A;  1WXM A;  4NJ6 A;  2BYV E;  2G3Q B;  2K1F A;  3IBE A;  2MCN B;  2NVU I;  2Z0E B;  2KXJ A;  2RD0 A;  4FJY A;  2BKR B;  4G11 A;  4BKG A;  3UIP B;  3CF6 E;  4JIO U;  4IC7 B;  3EEC A;  2PEA A;  3PRM B;  2D2Q A;  4EFO A;  3DPD A;  4DHJ D;  4MJS A;  2KHW B;  1GUA B;  2CS4 A;  3ZNH B;  2DZK A;  1YX6 B;  4PYZ A;  5C1Z A;  1P9D U;  3A9K A;  4HPM B;  4EKU A;  1J0G A;  3HHM A;  1TZ1 A;  3KUD B;  2PE6 B;  2FID A;  1WGY A;  2KMC A;  3V6E B;  1ZGU B;  4EOY A;  3ENE A;  2O6V A;  3NHE B;  3DOW A;  2IY1 B;  4DDG D;  2DX5 B;  2I1K A;  4F8C B;  3ML9 A;  2N9P C;  3VAW A;  5D7G A;  1Z5S B;  2O6V B;  3HIZ A;  3PRE A;  2KJ6 A;  2GBJ A;  1UD7 A;  2JPH A;  3ONS A;  4GDK B;  2IO0 B;  3M95 A;  5DPR A;  4HK2 A;  3V6C B;  2EMS A;  2D3G A;  2IY0 B;  2RGF A;  2IO2 B;  1P0R A;  1FXT B;  2MW5 A;  2LXA A;  3CSF A;  3DBL I;  3ZTC A;  4GIV A;  1BT0 A;  4NY0 A;  4LDT B;  1I42 A;  1L2N A;  1J19 A;  2CR5 A;  3HM6 X;  3TL5 A;  5CHW A;  1IP9 A;  3O65 B;  2JWZ A;  3PLV A;  5JH5 C;  3DBH I;  2FCN A;  1LQB A;  4W9K A;  3QA8 A;  2EMT A;  1WM3 A;  1WJU A;  2BYF A;  1QZE A;  2LAS A;  2NCN A;  1OEY A;  4W9I A;  2DYB A;  3JW0 X;  3L54 A;  4EUT A;  2DAF A;  4FHJ A;  5IAA C;  4KZC A;  3SU8 X;  2M8S A;  2LRU A;  3R7Q A;  2GBN A;  1LM8 B;  4LJO B;  2G4S A;  3GZN I;  2ZPY A;  3PVL A;  2WX0 A;  3WIM A;  4GB9 A;  3MHS D;  1HE8 A;  3APF A;  1I35 A;  5L83 A;  2N1V A;  2JY6 A;  4B6W A;  1GJZ A;  1J8C A;  2ZVN A;  2BGF A;  2ZNV C;  2PJH A;  1TGZ B;  2KC2 A;  4K7W A;  3D32 A;  4MGY E;  1YJ1 A;  4ICU A;  3CMM B;  2AL3 A;  2K8B A;  2V4L A;  3KYC D;  3B08 A;  3VH4 B;  2ZNV B;  3NY5 A;  4ANX A;  1EF5 A;  2L76 A;  4XC2 A;  2K8H A;  1OGW A;  3UIN B;  4OVU A;  2FUH B;  4BFR A;  5G2N A;  2LWP A;  1ZW7 A;  2JF5 A;  3PSE B;  2MBB B;  4IM2 A;  2XK5 A;  2KDE B;  5CHF A;  4M8M A;  3N3K B;  4X57 B;  4NPN A;  2KK8 A;  4MGK E;  3WAL A;  2IBI B;  3EHV A;  4GU2 A;  3LDZ E;  4LCD E;  1WR6 E;  4NAW A;  5JHB A;  2V1Y A;  1WGD A;  4ANV A;  2K39 A;  3WAM A;  3ZTD A;  4WJO A;  2NBW B;  2IYD B;  4NAW B;  3N30 A;  2KX0 A;  2KTF A;  5G55 A;  4HXD A;  4KZ0 A;  4NQK E;  1VD2 A;  2IO3 B;  2MBE A;  2MWS B;  1Q1O A;  2N9E B;  2RR9 A;  3NOB A;  4K7U A;  4W9D A;  1GNU A;  4BKT A;  2MLB A;  4FHK A;  1M94 A;  2UWQ A;  3SD5 A;  3VH3 B;  3UF8 A;  3V61 A;  3MJW A;  2KTR A;  3KW5 B;  2GBM A;  5E6N A;  2KDB A;  2MBQ A;  3VUW A;  4MGI E;  1S1Q B;  1WY8 A;  1GG3 A;  2KWU B;  3R66 C;  2Z59 B;  3SDL C;  2KTR B;  4ASW C;  4GDL B;  4FJZ A;  1WMH A;  4IG7 B;  4A3O A;  2R2Q A;  2L0T A;  4W9H A;  1NBF C;  2ZVO A;  1TTN A;  1WMH B;  3APC A;  2HE7 A;  1WE7 A;  2J7Q B;  1E90 A;  1V9J A;  4W9G A;  3UQB A;  5D94 A;  2JUO A;  3ECI A;  4K1R B;  3A1Q A;  4IW0 A;  3L0W B;  1UH6 A;  2LD9 A;  1D3Z A;  2AL6 A;  3ZDT A;  2WDT B;  4LJP B;  2L3Z A;  4GXB A;  3L17 A;  3ZNG C;  4HDQ A;  3A1Q B;  5AZF A;  4K81 A;  2O6V D;  5FR6 A;  1RLF A;  3NZU A;  4I6L B;  1KM7 A;  4IWP A;  1RAX A;  4DXA B;  2ZEQ A;  5HKH A;  3RYT A;  2DYM A;  1UEL A;  1R4N I;  4ANW A;  4DHZ B;  4W9F A;  1F9J A;  4RM8 A;  4ZYN A;  2ZZP B;  1UBI A;  4KIK B;  3H9D A;  1E7V A;  3VQI A;  2L8J A;  2UYZ B;  4GDK A;  5JZE B;  3QAQ A;  2MBO A;  3A4R A;  3VTV A;  2JT4 B;  2OJR A;  3N32 A;  1EUV B;  3PGE A;  2JRH A;  4YL8 A;  3ZNI D;  5JHA A;  1S3S G;  2L05 A;  2LZ6 A;  3M63 B;  1X1M A;  4W9L A;  1AAR A;  2XEW A;  1WIA A;  3VXW A;  4BKS A;  3KVF B;  1E8Y A;  2XBB C;  3TCA A;  2HD5 B;  1WX7 A;  1JRU A;  4DDI D;  3IHP C;  3C0R B;  2LI5 A;  1C1Y B;  4WWP A;  2MX2 A;  2AYO B;  4ZRK A;  4ZRI A;  3WAO A;  2C7N B;  3MTN B;  1RFA A;  2N7D A;  3ZO5 B;  3Q3J A;  4DK5 A;  1SE9 A;  2WWZ A;  4M8N A;  4CHK A;  4DHJ B;  4URK A;  4B9K A;  2KZR A;  3DBS A;  4A3P A;  2KDI A;  2KQS A;  2KKC A;  1WFY A;  5D2M B;  3VUX A;  3VUY A;  4IM3 A;  1OQY A;  2GBK A;  4HDO A;  3SHQ A;  3B1L X;  2FIF A;  2KX3 A;  3S2A A;  4MDK E;  4WJQ A;  4MGZ E;  3ZNZ B;  4M0W B;  4G3X B;  3OLM D;  2A4Z A;  1WZ3 A;  3IG3 A;  2EKE C;  2FCM A;  4MSM B;  4FAD A;  2CHW A;  3TBL D;  2HTH A;  4E74 A;  3PPA A;  2M4N A;  2J0J A;  1V6E A;  2NR2 A;  3EC8 A;  4HLE A;  2L00 B;  3ZLZ A;  3VDZ A;  5LXI B;  3L08 A;  3U30 A;  2O2V A;  4E3C A;  2DZJ A;  5J17 A;  2ZPN A;  2JVC A;  2KOX A;  3QX1 A;  4MEL A;  2O2V B;  2R2O A;  4W9C A;  4ICV A;  3RZW C;  4FA6 A;  3OAW A;  3A9J A;  1E8X A;  2L7R A;  2YLM A;  2VRR B;  1V81 A;  3DQV A;  2MQJ A;  4AJW A;  2LGX A;  1ZKH A;  2RPQ A;  3A9J B;  4FN2 A;  4IWO A;  2G45 B;  3QAR A;  2D10 A;  2D07 B;  2KMA A;  4KSL C;  4PS8 A;  5CX3 A;  1E7U A;  1UBQ A;  1G6J A;  3V62 A;  4WJN A;  3JYU A;  3QWZ B;  2KVR A;  1WRD B;  2V3S A;  3H6N A;  5TR5 A;  1E8Z A;  4N9F 4;  5KHO A;  1UZX B;  3OJ3 A;  3HK0 A;  5AEK B;  2BPS A;  4FUL A;  3QJZ A;  3ALB A;  3PZD A;  3VTW A;  1WJ6 A;  4ZDV A;  3EFU A;  1Q5W B;  4MEM A;  1V2Y A;  2LXC A;  3RD2 A;  4AP4 C;  2FCS A;  1YQB A;  2KD0 A;  4WJP A; 
#chains in the Genus database with same CATH topology
 2DZI A;  4JGH B;  5E6P A;  1XT9 B;  1DOX A;  2BKF A;  2XNA C;  1I7H A;  1EF1 A;  1M4V A;  4P6V F;  2L52 A;  1ET6 A;  4TKN A;  2REX A;  2DLB A;  4DBG A;  1IPG A;  2FUG 1;  2JU6 X;  4A20 A;  2L0F A;  3QIJ A;  3MJ5 A;  5BYS A;  2QEJ C;  5AZH A;  2C7M B;  2WU2 B;  2ZCB A;  4EZL A;  1MG4 A;  4PYU A;  1KJT A;  2KAC A;  1A5R A;  2WXP A;  1P7E A;  2FE8 A;  3RCZ A;  1TBE A;  3BVZ A;  2DZM A;  2MHJ A;  3ML8 A;  2JXX A;  1RRB A;  5AUI A;  3ZJT A;  2KNB A;  1TYG B;  1YNT E;  3DBL B;  4BVU C;  4NNJ B;  4AWJ A;  4OZB A;  5CHV C;  3AN1 A;  3RNB C;  2EEL A;  1TJE A;  2KFK B;  4AS1 A;  2MBH A;  3IT4 B;  3K9O B;  5LLI A;  1KF6 B;  5J18 A;  4EZJ A;  1C3T A;  3LB8 C;  2LRW A;  4MM3 A;  2DHZ A;  3RFZ B;  2JRI B;  3H1U A;  5J2R A;  4CYE A;  3B0A A;  1OFF A;  1L4D B;  1N63 A;  1H4R A;  2K6Q A;  4M0W A;  4YSZ B;  4CO7 A;  3KUZ A;  3VTU A;  3P1M A;  4II3 B;  3MC9 A;  2GMI C;  4E71 A;  3KUC B;  4ZRJ A;  3GE8 C;  1R4M B;  1HZ6 A;  3VFK A;  3NUH B;  2WXI A;  1ZE3 D;  3I5J C;  4ARI A;  4FXC A;  4REZ A;  4GMV A;  4A9A A;  3JVZ X;  2KJR A;  1TS4 A;  2YEP F;  2K6D B;  4AOF A;  4GGQ A;  3R3M A;  2WX1 A;  3M3J A;  4FJV B;  3WAN A;  4GOC A;  2KLC A;  2G4D B;  4XGA B;  1HZ5 A;  4AQ7 A;  1WJ4 A;  1SGH A;  2W9N A;  4DXG A;  2J0K A;  4HPL B;  4M00 A;  4HJK A;  2LVP A;  2M1M A;  3MHZ A;  2J42 A;  1UGM A;  1WZ0 A;  1Y56 A;  2N7J A;  4IKG A;  1I4R A;  2KO3 A;  5IP4 D;  1C4P A;  1VCB A;  1GC6 A;  2LUE A;  4XX5 A;  2BBC A;  3MP9 A;  3BVM A;  1LFD A;  2K22 A;  3X0W A;  2NBV B;  3AI5 A;  1SIF A;  2CJO A;  2WNM A;  1XQQ A;  1Z2M A;  4L23 A;  2KWC A;  4FBJ B;  2M0X A;  2NS5 A;  3B2G A;  3BWU D;  3W1S A;  1DOI A;  3R8B A;  3PT2 B;  3DWM A;  4N59 A;  2PE9 A;  2IGD A;  5BO4 B;  1QQR A;  1UUP A;  1V86 A;  3ZW3 A;  4TQ0 A;  1LXD A;  1WYW B;  2QCZ A;  4WQO B;  1EU4 A;  3PLU A;  4AJY B;  4G50 A;  3W5U B;  2RD0 A;  2BKR B;  1FNW A;  4HRO A;  3DWG C;  5D3I B;  2K5P A;  4RFB A;  2KHW B;  1ZDX A;  1YX6 B;  5C1Z A;  1J0G A;  2OJW A;  1F2R I;  1WGY A;  2JYT A;  1L6U A;  2O6V A;  1VLB A;  3N1Z C;  4DDG D;  2DX5 B;  3MFG A;  4F8C B;  3ML9 A;  4YTM B;  1JWB D;  1XEE A;  2GBJ A;  2CU3 A;  1ZUD 2;  3U7Z A;  1K52 A;  2MJD A;  2EMS A;  2RGF A;  1FXT B;  4NY0 A;  1I42 A;  1AYF A;  3HM6 X;  5CHW A;  1NEK B;  3AEC B;  2EMT A;  1QZE A;  4W9I A;  1HA5 A;  2VH2 A;  2G1E A;  1GB4 A;  1P7F A;  3JW0 X;  3TEW A;  3TUO A;  2LRU A;  4A6Q A;  4JWU C;  1ROE A;  2PLP A;  2ZPY A;  3GS2 A;  1HE8 A;  3APF A;  4BAX A;  1GJZ A;  2JSV X;  4A55 A;  1TGZ B;  1C4C A;  2UU7 A;  4ANX A;  1EF5 A;  2JYE A;  4XC2 A;  4OVU A;  1QOA A;  4BFR A;  2LWP A;  2ZW0 A;  1F1H A;  4IM2 A;  2MBB B;  5CHF A;  3AEE B;  4KGS A;  4RGT A;  4X57 B;  4MGK E;  4LCD E;  3HVZ A;  4NAW A;  2HDE A;  2L83 A;  3PO0 A;  2NBW B;  2IYD B;  3N30 A;  2LUM A;  5G55 A;  2WLB A;  1XLQ A;  1ZOY B;  2RR9 A;  2V0G A;  1V97 A;  2IGG A;  1JW9 D;  1GNU A;  1ZDV A;  2LFI A;  1M94 A;  1AW7 A;  3VH3 B;  3UF8 A;  3KW5 B;  4N6E B;  5E6N A;  2KDB A;  1C76 A;  5G5G A;  4P16 A;  1GG3 A;  1WMH A;  4WH4 A;  2R2Q A;  4YTN B;  2ZVO A;  4RF0 A;  1WE7 A;  1V9J A;  5D94 A;  2JUO A;  4K1R B;  4IW0 A;  2JQR B;  1UF0 A;  3ZNG C;  3L17 A;  4K81 A;  4I6L B;  1N60 A;  2NMQ A;  4C7Z A;  1FEH A;  2DYM A;  2RPV A;  4DHZ B;  1YJI A;  3FKY A;  1F9J A;  2ACZ B;  2ZZP B;  4RH6 A;  5FK9 C;  3VQI A;  5JZE B;  2BS4 B;  1L0Y B;  3VTV A;  4NAM A;  1PGA A;  5JHA A;  4C4V A;  4QAY A;  3AEA B;  1WIA A;  4NJC A;  3KVF B;  1RM6 C;  3OG5 A;  1ZP0 B;  1JRU A;  5C2T B;  1L0V B;  2MX2 A;  2JXT A;  3Q3M C;  3MTN B;  1RFA A;  2FBW B;  2W82 A;  1SXT A;  3AE6 B;  3DBS A;  4RNA A;  1WFY A;  3C8Y A;  3E56 A;  4IM3 A;  2WXK A;  2GBK A;  3KLS X;  3SHQ A;  2FIF A;  2KX3 A;  3ZNZ B;  4WIP A;  3ZJV A;  3OLM D;  2A4Z A;  1FPY A;  3TBL D;  1IGC A;  2M4N A;  2NR2 A;  1V6E A;  1SEB D;  1I4X A;  3EC8 A;  1GPX A;  3L08 A;  3U30 A;  2WGS A;  2DZJ A;  3NZ3 A;  3QX1 A;  4MEL A;  2R2O A;  4OZA A;  4W9C A;  3OAW A;  2VRR B;  4JX1 C;  2MQJ A;  2LGX A;  1VZ6 A;  3A9J B;  4IWO A;  4S17 A;  1HXY D;  4KSL C;  5CX3 A;  1UBQ A;  3Q3O C;  3QWZ B;  4P1C C;  5TR5 A;  2EKI A;  1UZX B;  3IXS A;  2BPS A;  3QJZ A;  4ZDV A;  4MEM A;  2N9L A;  1KFY B;  3M62 B;  4YT0 B;  2WHI A;  4HJG E;  2KJH B;  5HFY A;  3JSV B;  3MC8 A;  4ITK A;  4UDU C;  3VR8 B;  4LNI A;  1IGD A;  5EE1 A;  1Q0W B;  4RM9 A;  4L2Y A;  3PS6 A;  2WDQ B;  2GRI A;  4ANU A;  1WX8 A;  2C5L C;  5E6O A;  4W9J A;  2KN5 A;  1WH3 A;  3AE4 B;  3DDC B;  2K3U A;  3IT6 B;  3T9L A;  3L10 B;  4R3D A;  4JPS A;  1OEY J;  1Y8R C;  1YX5 B;  3PHW B;  4I6P A;  2WU5 B;  2INC C;  2KQ7 A;  1FFU A;  2ONQ A;  4RCO A;  4LDT D;  3K9P B;  3QQ8 B;  1SF0 A;  3AMZ A;  3H7P B;  4IUM B;  4KSK C;  1V5T A;  2N1W A;  1SJE D;  1JCK B;  2LGY A;  2KFK A;  3UQA A;  4G0N B;  2RSU A;  3Q69 A;  3U8Z A;  2KFJ A;  4MJS B;  4WWN A;  3A9K B;  5TSS A;  2FAZ A;  5DPT A;  1YN5 A;  4KDL B;  2HJ1 A;  1WM2 A;  4LNK A;  3PV1 A;  1T0R C;  1EO6 A;  1N62 A;  5EDS A;  2IPK D;  3TJP A;  2C7H A;  1WI0 A;  1KOT A;  3RNC C;  3AE9 B;  1WR1 A;  2BYE A;  1XF5 L;  3DCG A;  4NZL B;  4LTU A;  3L16 A;  4WWO A;  1E0Z A;  1WXQ A;  3UIO B;  1F52 A;  4XDC A;  4A90 A;  4AUQ C;  1KRH A;  2B76 B;  3QHT A;  3DHG C;  2N7E A;  2QDF A;  1MG8 A;  2CHZ A;  1DYQ A;  3DBR B;  3W1Y A;  1N5X A;  2MJE A;  3RPF C;  1I4G A;  1V1O A;  3AE3 B;  1PYW D;  1IBX B;  3RZF A;  4HCN B;  3T8M A;  1CK1 A;  1ET9 A;  2BVC A;  3AUL A;  1ZXI A;  5C23 A;  4EZK A;  1MHX A;  5KHQ A;  1WGG A;  3HRD D;  3KWL A;  3UI3 A;  2SAK A;  4JQW C;  3PZ7 A;  1R4M I;  3IAM 1;  3P42 A;  4WAA A;  2KMM A;  1GC7 A;  3TEX A;  2H89 B;  4YXD B;  2XK5 B;  4PS3 A;  2WDR B;  2AQ1 B;  4HCP B;  1PGB A;  3WAP A;  3ZGZ A;  2M56 B;  3PZ8 A;  3ZRF A;  4C00 A;  2A5U A;  3TIX A;  1JAL A;  3PRZ A;  1JWM D;  4MSQ B;  3W1S C;  1F2R C;  3N1Y C;  3KH0 A;  4IWQ A;  4K7S A;  3PTF C;  2MRP A;  5I4D A;  1TZO A;  1L7Y A;  2BS2 B;  1K50 A;  4BBN C;  4KV2 A;  2Y3A A;  2AWT A;  1V80 A;  1TS2 A;  4P7I A;  1D5M C;  3EFC A;  4KKJ A;  1FNV A;  2Y5C A;  4JLC A;  2K8C A;  3EGR A;  4NJ6 A;  2WXF A;  2K1F A;  3IBE A;  2MCN B;  3Q8A A;  4FJY A;  4JIO U;  1FRR A;  1SB3 C;  3OWE B;  2YEP B;  4EFO A;  1YQ4 B;  1P9D U;  2M0A A;  2PE6 B;  2KMC A;  3V6E B;  2K0P A;  3ENE A;  3DOW A;  1FO4 A;  5BMG A;  1C4A A;  3HIZ A;  3PRE A;  2WXR A;  1GOZ A;  2JPH A;  3ONS A;  2IO0 B;  5DPR A;  2PW9 A;  4ARC A;  3GZN B;  2IO2 B;  1P0R A;  4WAF A;  3VRB B;  1L0X B;  3CSF A;  3ZTC A;  1J19 A;  2CR5 A;  1IP9 A;  4OHJ A;  3DBH I;  1LQB A;  4W9K A;  2VZK B;  3BYY B;  1FFV A;  4FHJ A;  2XN9 C;  2KN4 A;  2GBN A;  1LM8 B;  2G4S A;  3DHH C;  3PVL A;  2WX0 A;  4GB9 A;  1L4Z B;  2ZNV C;  3W2D A;  2PJH A;  4RGO S;  3D32 A;  4MGY E;  3CMM B;  1XLN A;  2K8B A;  3KYC D;  2E6X A;  1VDV A;  1OGW A;  1GB1 A;  3UIN B;  2FUH B;  5G2N A;  4ZRP A;  3VRA B;  1ZW7 A;  1JWU D;  3PSE B;  4KGR A;  3ZXR A;  1JRO A;  4NPN A;  3NVY A;  4GU2 A;  1WR6 E;  2V1Y A;  1WGD A;  3SFD B;  1WGK A;  4ANV A;  1NEN B;  3MC0 B;  2KTF A;  1EU3 A;  4NQK E;  1VD2 A;  2MWS B;  1Q1O A;  3NOB A;  4W9D A;  1BML C;  4BKT A;  4GLS C;  4FHK A;  1PFD A;  1XO3 A;  2UWQ A;  3EUB 2;  1C79 A;  2GBM A;  3VUW A;  1R4N B;  2AX5 A;  1WY8 A;  3R66 C;  3SDL C;  2Z59 B;  3NJT A;  3Q8F A;  4IG7 B;  4KGT A;  2L0T A;  4W9H A;  2IDY A;  1E90 A;  4HRS A;  3ECI A;  5BMH A;  2DBY A;  1T0Q C;  2AL6 A;  3ZDT A;  4US8 A;  4LJP B;  4GXB A;  1F0Z A;  3A1Q B;  1C77 A;  5IN7 A;  2GB1 A;  1AN8 A;  1RAX A;  4DXA B;  3AEB B;  2ZEQ A;  2K9X A;  1UEL A;  2G9H D;  4RM8 A;  3H9D A;  2INN E;  4GDK A;  2UYZ B;  4ZOH C;  2OJR A;  5T8I A;  1EUV B;  4KKI A;  2PKO A;  2L05 A;  4W9L A;  2VZK D;  2LGS A;  3VXW A;  2IND C;  1WX7 A;  2LI5 A;  3CIR B;  3SFE B;  3ZO5 B;  1LO5 D;  2N7D A;  2BTE A;  4DK5 A;  1SE9 A;  1TKY A;  4DHJ B;  4A3P A;  3VUX A;  2KKC A;  5D2M B;  1ZXH A;  1I4P A;  1SJH D;  3AV8 A;  4IDI A;  3S2A A;  4LNN A;  2AQ3 B;  3TEY A;  4MGZ E;  4M0W B;  1WZ3 A;  3IG3 A;  2EKE C;  2FCM A;  4FAD A;  3Q2A C;  1QT9 A;  2L00 B;  3ZLZ A;  1J7A A;  1RFK A;  4HPP A;  3VDZ A;  1FCL A;  3U2S C;  3R2I A;  5J17 A;  2O2V B;  4ICV A;  4B0E A;  3A9J A;  1E8X A;  1HQR D;  2L7R A;  1V81 A;  3DQV A;  2RMM A;  1E6E B;  3CWI A;  1QLB B;  1VJK A;  1G6J A;  3V62 A;  1CZP A;  1UWM A;  3NVW A;  4N9F 4;  2V3P A;  4M02 A;  1TY0 A;  4FUL A;  3ALB A;  1JWS D;  2J53 A;  3AED B;  3EFU A;  2LXC A;  1PUT A;  4AP4 C;  4LNF A;  4C80 A;  3RI7 C;  3PRP B;  2MSE D;  2LJ5 A;  1BUI C;  2NPT B;  4GDL A;  2ASQ A;  5AZG A;  1I4H A;  4FLH A;  1HTO A;  2BWE S;  1NYQ A;  4P1B C;  4F7Z A;  3RT3 B;  2KVZ A;  4MH0 E;  4WWM A;  3ZKJ C;  2DAJ A;  1JRP A;  1P1A A;  3TEZ A;  3U7D A;  4M01 A;  3FIL B;  5BYR A;  4II2 B;  1N6Z A;  3P4P B;  1WJN A;  1V1P A;  4KIK A;  2BS3 B;  3PHX B;  5BMI A;  1WXA A;  3H7P A;  1WE6 A;  4PS7 A;  1XXG A;  1FMA D;  1YOV B;  3Q3F A;  1P98 A;  2KDM A;  1SIJ A;  2W54 A;  5JXV A;  5G5H A;  2H88 B;  3ZVV A;  1H8C A;  3ZIM A;  3BIN A;  2OOB B;  3ZQ4 A;  4B95 A;  2MP2 B;  1NDD A;  3TMP B;  2KDF B;  2LEK A;  3NS1 A;  3WCQ A;  1TT5 B;  2HTM E;  3APD A;  1ISN A;  4ZRQ A;  2KLG A;  1WGR A;  2Y5B B;  3BVG A;  1R7S A;  2LVO A;  5IOI A;  2HJ8 A;  4KX6 B;  3AEF B;  4BBN F;  4J6I A;  4KDI C;  1E8W A;  2WXL A;  5DPS A;  3L13 A;  1FM0 D;  2BB6 A;  3RUI B;  2CKH B;  3QC8 B;  1WYG A;  2M17 A;  1YD8 U;  1PQS A;  4GSW A;  2JZZ A;  2KWV B;  4YSY B;  3DVN U;  3BII D;  5D6J B;  2BWF A;  2FNJ B;  1KH0 A;  2IZV B;  1E7P B;  1T0Y A;  2LGD A;  1U4A A;  2IO1 B;  1B1Z A;  4B0M A;  4RMA A;  2MA9 B;  2D5G A;  3DBR I;  5C3J B;  2Z0D B;  2WYQ A;  2LHD A;  3Q8C A;  5AUK A;  2J4X A;  4C7Y A;  3P2B A;  1OQR A;  3W9C B;  1WX9 A;  1QOB A;  3WA0 A;  2LVQ A;  3RN9 C;  3IVF A;  4TV3 A;  3H8H A;  3I3T B;  1HEZ E;  5GMV A;  3QCA A;  3V60 A;  2FCQ A;  4HEA 1;  2LGI A;  2N9K A;  2BQQ A;  1CMX B;  3ABV B;  2R61 A;  3HVD A;  1K8R B;  2D3B A;  1XCQ L;  3J9C A;  3AU4 A;  1FD6 A;  5LXH A;  3GOE A;  1I4Q A;  4WQM A;  5IKC M;  2ZJD A;  4HVB A;  1YN3 A;  2AEH A;  4PT5 A;  4DXF A;  1CQV A;  1WXM A;  2BYV E;  5HI1 A;  2Z0E B;  4BKG A;  1YQ3 B;  3EEC A;  3PRM B;  2D2Q A;  2QSD A;  3DPD A;  4BZA A;  1GUA B;  2CS4 A;  3SEB A;  3ZNH B;  2DZK A;  4PYZ A;  4HPM B;  2ZW1 A;  3HHM A;  3KUD B;  1D4B A;  2WXN A;  1ZGU B;  4EOY A;  2TSS A;  1NVI D;  2IY1 B;  1UGJ A;  2I1K A;  3VAW A;  5D7G A;  2NTT A;  4XWT A;  1LGR A;  3B2F A;  3V6C B;  2IY0 B;  4XDD A;  3BZD B;  2LXA A;  3DBL I;  4GIV A;  2JWZ A;  3PLV A;  5JH5 C;  2FCN A;  1WM3 A;  2JWU A;  2BYF A;  3N20 C;  3ZYY X;  1OEY A;  5FR3 A;  2DYB A;  3TSS A;  3AE1 B;  5MPO A;  2MEK A;  4EUT A;  5IAA C;  4KZC A;  1T6B X;  2N0S B;  4LJO B;  1QKZ A;  3GZN I;  5L83 A;  2JY6 A;  3N1X C;  4B6W A;  2ZVN A;  2KC2 A;  1YJ1 A;  1NYR A;  2AL3 A;  1SE4 A;  3B08 A;  3VH4 B;  1E9M A;  3NY5 A;  3T3N A;  3P63 A;  1WRI A;  1FXA A;  2I2Y A;  4OZC A;  4LK0 M;  4HKQ A;  3RNA C;  2KDE B;  2W55 A;  4M8M A;  3NVZ A;  3N3K B;  3ZJU A;  1J7C A;  3EHV A;  2WXJ A;  3LDZ E;  4DQO C;  1V8C A;  5JHB A;  3ZTD A;  1FNU A;  2KX0 A;  4KZ0 A;  2JZP A;  2N9E B;  4K7U A;  3I57 A;  3P4Q B;  2MLB A;  3SD5 A;  4EE2 A;  3V61 A;  1QOG A;  2MBQ A;  4MGI E;  2KWU B;  2KTR B;  2LMC A;  3AE2 B;  4XYC A;  1YMH E;  2QIL A;  1NBF C;  1TKE A;  2HE7 A;  2J7Q B;  1FIQ A;  2BW2 A;  3UQB A;  3Q3N C;  4LLG M;  3A1Q A;  3L0W B;  1UH6 A;  2LD9 A;  1FXI A;  2L3Z A;  2PMV A;  4ACF A;  4IWP A;  4WUR A;  1ACC A;  3RYT A;  1R4N I;  4ANW A;  4ZYN A;  4O1N A;  2KQ4 X;  1UBI A;  1E7V A;  3GP7 A;  2L8J A;  2MBO A;  5HHD G;  2JRH A;  4YL8 A;  4MT5 A;  2CJN A;  3NG0 A;  3ZNI D;  4RF1 A;  3W5V B;  2XEW A;  2AQ2 B;  1E8Y A;  2XBB C;  3AB5 A;  3IHP C;  1SE3 A;  1C1Y B;  2AYO B;  1WWT A;  2C7N B;  1ENF A;  3BK2 A;  2WWZ A;  2KZR A;  3BK1 A;  2KDI A;  2KQS A;  3AE5 B;  1OQY A;  4HDO A;  1J7B A;  4WJQ A;  1CJE A;  4G3X B;  3Q8E A;  2KT7 A;  4MSM B;  2CHW A;  4E74 A;  3PPA A;  1QIL A;  3P4R B;  5LXI B;  3AEG B;  4IOI E;  2O2V A;  1XLO A;  2ZPN A;  2JVC A;  2IGH A;  1B9R A;  5LNK 1;  4ZHO A;  2KAJ A;  2M19 A;  5E6J A;  2YLM A;  4AJW A;  1ZKH A;  2RPQ A;  4FN2 A;  1FCC C;  4J3O D;  3L4P A;  2D07 B;  4PS8 A;  1UWX A;  3SR6 A;  1OQQ A;  1WRD B;  2VH1 A;  3H6N A;  2BYT A;  5KHO A;  3OJ3 A;  2GLS A;  3RNE C;  3EA6 A;  5AEK B;  4LNO A;  4XE0 A;  1V2Y A;  2SEB D;  3RD2 A;  1YQB A;  2NPT A;  2KD0 A;  1D6E C;  4WJP A;  2W3S A;  3FC4 A;  3ZDM C;  4CQN A;  2D11 A;  3GB1 A;  2BT6 A;  2CU1 A;  4MAC A;  1E10 A;  2J0M A;  2C60 A;  2RDH A;  1MHH E;  1NI2 A;  5D3D A;  3H7S A;  3NZS A;  4F1S A;  2MJ3 A;  1SE2 A;  3UGB B;  4DWF A;  2PVG C;  2NTS A;  3AXC A;  4RGN A;  2QHO A;  3BYT B;  3DHI C;  4I6N B;  3DVG X;  4BOS C;  1WXS A;  3FIL A;  3HM3 A;  1TS5 A;  1N61 A;  2GBR A;  3IAS 1;  5DPW A;  2WQY B;  5EE9 A;  3V05 A;  4HWI B;  1OTR B;  4TUU A;  2KWD A;  2KC1 A;  1JML A;  1WXV A;  1L6V A;  5IA7 A;  2KAN A;  3ETR A;  2PIA A;  4BKS D;  3U52 E;  1P3Q U;  3VVW B;  3DBH B;  2KYW A;  2MP2 A;  2JZ3 B;  1L5P A;  2DEN B;  1TIF A;  4ZHP A;  5H8Y E;  1UNS A;  1MFW A;  5IO9 A;  2WXO A;  3R7R A;  4MM3 B;  2I1J A;  2PPH A;  3AE8 B;  2C9W B;  4DHZ E;  2LJI A;  2WDV B;  2K25 A;  1IYF A;  1V5O A;  2DWQ A;  1VRA B;  2CHX A;  1EWY C;  1PGX A;  5H92 C;  2WXM A;  4A8X C;  3T3O A;  5DCN A;  1D5X C;  3A33 B;  2RDB C;  1AWD A;  2YVC A;  2N4F A;  4C56 C;  3DVN V;  3Q8B A;  3KWV A;  3IFW B;  1KLV A;  4NQL B;  5HG2 A;  3X23 A;  1V49 A;  2I38 A;  1VR9 A;  3BY4 B;  2DYO A;  1WGH A;  4NJ7 A;  3HUI A;  2NBU A;  3GE3 C;  3ZUN A;  2Y5P A;  1YN4 A;  1HTQ A;  2ZCC A;  3NS8 A;  3P4S B;  4ZRI A;  1XD3 B;  2B3A A;  1K51 A;  4BOZ B;  3CST A;  3KYD D;  3AU5 A;  2BF8 B;  2E3T A;  2D3A A;  3KQ4 A;  2GOW A;  1TY2 A;  3JSV A;  4GN1 A;  4TQ1 A;  4W9E A;  1T5X D;  3ZXV A;  3OJ4 B;  3RUL A;  2W3R A;  3AH7 A;  4IM0 A;  3RMK C;  3ZRC A;  2GI9 A;  1STE A;  4OVZ A;  5L95 C;  4EEW A;  3DVG Y;  4D2K A;  3VHT C;  4K3B A;  3LXF A;  1EWC A;  1TS3 A;  4KVG B;  3B9J A;  3NVV A;  2V4I B;  4JL9 A;  4OW0 A;  1JQ4 A;  1MI0 A;  1E5W A;  3A4S C;  2N9X A;  2WXQ A;  4OVV A;  4XZ4 A;  3QK0 A;  1YIW A;  4N58 A;  5CTR C;  3LJ3 A;  1MJD A;  1TKG A;  1WF9 A;  3VR9 B;  1BXT A;  1KLU D;  2G3Q B;  2NVU I;  1NI3 A;  1MPE A;  2KXJ A;  4G11 A;  3UIP B;  3CF6 E;  2OED A;  4IC7 B;  2RDG A;  2PEA A;  4DHJ D;  3AM9 A;  4MJS A;  5FKA C;  3A9K A;  4EKU A;  1TZ1 A;  1DOY A;  2FID A;  2JX5 A;  2ICI A;  3NHE B;  1N5W A;  1YJJ A;  2N9P C;  1Z5S B;  2O6V B;  2ON8 A;  2KJ6 A;  1UD7 A;  2WS3 B;  4GDK B;  3M95 A;  4HK2 A;  2D3G A;  3LYY A;  2MW5 A;  1JWA D;  1BT0 A;  4LDT B;  1L2N A;  3TL5 A;  4USA A;  3O65 B;  1KLG D;  3QA8 A;  1WJU A;  2LAS A;  2NCN A;  2QMT A;  1QF6 A;  3N9Y C;  3L54 A;  2DAF A;  1IBX A;  3SU8 X;  2M8S A;  3R7Q A;  2Q5W D;  2LHE A;  1C78 A;  1F77 A;  1D5Z C;  4H2A A;  3WIM A;  3MHS D;  1XLP A;  1ZPS A;  1I35 A;  2N1V A;  1J8C A;  2BGF A;  4K7W A;  4ICU A;  2V4L A;  2ZNV B;  2MH7 A;  2L76 A;  2K8H A;  2L32 A;  3RNF C;  4MH8 A;  1RYJ A;  2JF5 A;  2XK5 A;  4TMA B;  3RNG C;  2KK8 A;  3WAL A;  2IBI B;  2WP9 B;  4L1B A;  2OHF A;  4JWS C;  5EE0 A;  2K39 A;  3WAM A;  4WJO A;  4NAW B;  5BYQ A;  1DGJ A;  4HXD A;  1PDX A;  2IO3 B;  2MBE A;  4S0R A;  4ZYS A;  3NRZ A;  5GXG B;  3MJW A;  2KTR A;  4US9 A;  1RWS A;  1S1Q B;  4ASW C;  1QOF A;  4GDL B;  3E9S A;  4FJZ A;  1T0S C;  1T3Q A;  4A3O A;  1TTN A;  1WMH B;  3O13 A;  1SSN A;  2V9H A;  3APC A;  4W9G A;  1D3Z A;  2WXH A;  3I9V 1;  2WDT B;  4HDQ A;  5AZF A;  1ESF A;  2O6V D;  5FR6 A;  1RLF A;  3NZU A;  1KM7 A;  5HKH A;  3U4E G;  3Q6B A;  4W9F A;  1V1P B;  2WXG A;  1VZ8 A;  2X8X X;  4KIK B;  3URY A;  3I63 C;  2D3C A;  3QAQ A;  3A4R A;  2JT4 B;  3N32 A;  3PGE A;  4YWG G;  4YTP B;  1S3S G;  2LZ6 A;  3M63 B;  1X1M A;  1AAR A;  1MVK A;  4HKZ E;  4C4V B;  2Z8L A;  4BKS A;  1KTK A;  4RGM A;  1C9F A;  3TCA A;  2HD5 B;  1IUE A;  4DDI D;  3C0R B;  3C19 A;  4WWP A;  4ZRK A;  1FRD A;  2BB5 A;  3WAO A;  2V3N A;  3Q3J A;  1EM7 A;  4CHK A;  4M8N A;  4URK A;  4B9K A;  4K3C A;  3VUY A;  1GAQ B;  2QIE B;  4PK1 A;  3B1L X;  3Q14 C;  2PVO D;  4MDK E;  2L1A A;  2DNF A;  4XWW A;  1WSP A;  2HTH A;  1SBB B;  2X38 A;  4YSX B;  2J0J A;  1Q10 A;  4HLE A;  2QC8 A;  1K53 A;  3R2T A;  4E3C A;  2INP E;  2KOX A;  1XCT L;  3RZW C;  4TSS A;  4FA6 A;  2QJL A;  2J52 A;  3V3X A;  5EE3 A;  2PTL A;  2G45 B;  3QAR A;  2D10 A;  2KMA A;  1E7U A;  2IJ0 A;  4WJN A;  3JYU A;  4Q2J A;  2KVR A;  2V3S A;  1E8Z A;  3HK0 A;  1VZ7 A;  3PZD A;  3VTW A;  1WJ6 A;  4JE3 B;  1Q5W B;  3AE7 B;  3FAH A;  1A70 A;  2FCS A; 
#chains in the Genus database with same CATH homology
 3PRP B;  3ZDM C;  2D11 A;  2DZI A;  2MSE D;  3M62 B;  4JGH B;  2LJ5 A;  2CU1 A;  2NPT B;  2KJH B;  3JSV B;  2J0M A;  4GDL A;  5E6P A;  2C60 A;  2ASQ A;  1XT9 B;  5AZG A;  1NI2 A;  2BKF A;  3H7S A;  3NZS A;  4F1S A;  1EF1 A;  1Q0W B;  4RM9 A;  4FLH A;  4TKN A;  2REX A;  3UGB B;  4DWF A;  3PS6 A;  4DBG A;  1IPG A;  2BWE S;  4ANU A;  3AXC A;  2QHO A;  4A20 A;  1WX8 A;  2C5L C;  2L0F A;  3RT3 B;  4MH0 E;  4F7Z A;  5E6O A;  4W9J A;  3ZKJ C;  2DAJ A;  3QIJ A;  2KN5 A;  1WH3 A;  4I6N B;  3DDC B;  3DVG X;  5AZH A;  4BOS C;  2C7M B;  1P1A A;  1WXS A;  3HM3 A;  3T9L A;  3U7D A;  3L10 B;  2GBR A;  2ZCB A;  4EZL A;  1OEY J;  5DPW A;  4PYU A;  1KJT A;  4II2 B;  1Y8R C;  1YX5 B;  3PHW B;  4I6P A;  1A5R A;  1WJN A;  2KQ7 A;  3RCZ A;  1TBE A;  4HWI B;  1OTR B;  2DZM A;  4KIK A;  4TUU A;  3PHX B;  2KC1 A;  1WXV A;  3ML8 A;  1WXA A;  5IA7 A;  2KAN A;  3H7P A;  1WE6 A;  2JXX A;  4LDT D;  1RRB A;  4PS7 A;  3K9P B;  3QQ8 B;  4BKS D;  2KNB A;  3H7P B;  4IUM B;  4KSK C;  1V5T A;  3Q3F A;  2N1W A;  4BVU C;  1P98 A;  4NNJ B;  1P3Q U;  3VVW B;  4AWJ A;  2LGY A;  2KFK A;  3UQA A;  5CHV C;  4G0N B;  2RSU A;  3ZVV A;  2KFK B;  2MBH A;  3K9O B;  5LLI A;  2MP2 A;  2JZ3 B;  3U8Z A;  2KFJ A;  1H8C A;  5J18 A;  4MJS B;  2DEN B;  3ZIM A;  3BIN A;  2OOB B;  4WWN A;  4EZJ A;  4B95 A;  1C3T A;  2MP2 B;  3A9K B;  1NDD A;  2FAZ A;  2LRW A;  4MM3 A;  2DHZ A;  5DPT A;  2JRI B;  4KDL B;  3H1U A;  5J2R A;  1WM2 A;  3TMP B;  3PV1 A;  3R7R A;  4CYE A;  2KDF B;  2I1J A;  1EO6 A;  2PPH A;  3B0A A;  5EDS A;  3APD A;  3TJP A;  2C9W B;  1ISN A;  4DHZ E;  2C7H A;  1WI0 A;  1KOT A;  1H4R A;  1WR1 A;  2BYE A;  2K6Q A;  2K25 A;  3DCG A;  2KLG A;  1WGR A;  4CO7 A;  1V5O A;  3L16 A;  3KUZ A;  4WWO A;  3VTU A;  1IYF A;  4II3 B;  2Y5B B;  2CHX A;  3UIO B;  2LVO A;  2GMI C;  4E71 A;  2HJ8 A;  4AUQ C;  3KUC B;  3QHT A;  4ZRJ A;  5DCN A;  4BBN F;  3A33 B;  4J6I A;  4KDI C;  3VFK A;  1E8W A;  5DPS A;  2N7E A;  3L13 A;  1MG8 A;  2CHZ A;  2YVC A;  3RUI B;  2N4F A;  3W1Y A;  2CKH B;  3QC8 B;  3DVN V;  4GMV A;  3IFW B;  2M17 A;  1KLV A;  1YD8 U;  3JVZ X;  2KJR A;  1PQS A;  4NQL B;  3X23 A;  2K6D B;  1V49 A;  4GSW A;  4AOF A;  3RZF A;  4HCN B;  2JZZ A;  3BY4 B;  2KWV B;  4GGQ A;  2DYO A;  3R3M A;  3T8M A;  2WX1 A;  3AUL A;  3DVN U;  1WGH A;  5C23 A;  4NJ7 A;  3M3J A;  4FJV B;  4EZK A;  2NBU A;  5D6J B;  3WAN A;  5KHQ A;  2BWF A;  4GOC A;  3ZUN A;  1WGG A;  2KLC A;  2G4D B;  2FNJ B;  2ZCC A;  4JQW C;  2IZV B;  1T0Y A;  3NS8 A;  2LGD A;  1R4M I;  1SGH A;  1U4A A;  1WJ4 A;  1XD3 B;  2B3A A;  2IO1 B;  2J0K A;  2W9N A;  3CST A;  3KYD D;  4HPL B;  4BOZ B;  3AU5 A;  2BF8 B;  4HJK A;  2LVP A;  4WAA A;  2M1M A;  4RMA A;  2GOW A;  2MA9 B;  1UGM A;  1WZ0 A;  3DBR I;  1GC7 A;  2KO3 A;  3JSV A;  4GN1 A;  2Z0D B;  2WYQ A;  4TQ1 A;  4W9E A;  1VCB A;  1GC6 A;  2LUE A;  2NPT A;  4XX5 A;  3OJ4 B;  2XK5 B;  3RUL A;  4IM0 A;  4PS3 A;  3P2B A;  1WX9 A;  3ZRC A;  1LFD A;  3X0W A;  3WA0 A;  2NBV B;  4HCP B;  3WAP A;  2LVQ A;  3IVF A;  3AI5 A;  3ZRF A;  1SIF A;  5L95 C;  4TV3 A;  4EEW A;  1XQQ A;  1Z2M A;  3I3T B;  2A5U A;  3DVG Y;  3TIX A;  2KWC A;  5GMV A;  4FBJ B;  3VHT C;  3PRZ A;  2M0X A;  2NS5 A;  3QCA A;  4KVG B;  2FCQ A;  4MSQ B;  3V60 A;  3W1S C;  4JL9 A;  3W1S A;  1E5W A;  3A4S C;  1CMX B;  2N9X A;  3KH0 A;  3PT2 B;  4IWQ A;  4K7S A;  3PTF C;  2MRP A;  2PE9 A;  1K8R B;  4OVV A;  4XZ4 A;  1L7Y A;  3QK0 A;  1YIW A;  5BO4 B;  5CTR C;  4KV2 A;  4BBN C;  1V86 A;  3AU4 A;  2AWT A;  3ZW3 A;  1LXD A;  1V80 A;  1WYW B;  3LJ3 A;  4TQ0 A;  5LXH A;  4P7I A;  3GOE A;  1WF9 A;  4WQO B;  2ZJD A;  3PLU A;  4AJY B;  4HVB A;  2AEH A;  4G50 A;  4JLC A;  2K8C A;  1WXM A;  4NJ6 A;  2BYV E;  2G3Q B;  2K1F A;  3IBE A;  2MCN B;  2NVU I;  2Z0E B;  2KXJ A;  2RD0 A;  4FJY A;  2BKR B;  4G11 A;  4BKG A;  3UIP B;  3CF6 E;  4JIO U;  4IC7 B;  3EEC A;  2PEA A;  3PRM B;  2D2Q A;  4EFO A;  3DPD A;  4DHJ D;  4MJS A;  2KHW B;  1GUA B;  2CS4 A;  3ZNH B;  2DZK A;  1YX6 B;  4PYZ A;  5C1Z A;  1P9D U;  3A9K A;  4HPM B;  4EKU A;  1J0G A;  3HHM A;  1TZ1 A;  3KUD B;  2PE6 B;  2FID A;  1WGY A;  2KMC A;  3V6E B;  1ZGU B;  4EOY A;  3ENE A;  2O6V A;  3NHE B;  3DOW A;  2IY1 B;  4DDG D;  2DX5 B;  2I1K A;  4F8C B;  3ML9 A;  2N9P C;  3VAW A;  5D7G A;  1Z5S B;  2O6V B;  3HIZ A;  3PRE A;  2KJ6 A;  2GBJ A;  1UD7 A;  2JPH A;  3ONS A;  4GDK B;  2IO0 B;  3M95 A;  5DPR A;  4HK2 A;  3V6C B;  2EMS A;  2D3G A;  2IY0 B;  2RGF A;  2IO2 B;  1P0R A;  1FXT B;  2MW5 A;  2LXA A;  3CSF A;  3DBL I;  3ZTC A;  4GIV A;  1BT0 A;  4NY0 A;  4LDT B;  1I42 A;  1L2N A;  1J19 A;  2CR5 A;  3HM6 X;  3TL5 A;  5CHW A;  1IP9 A;  3O65 B;  2JWZ A;  3PLV A;  5JH5 C;  3DBH I;  2FCN A;  1LQB A;  4W9K A;  3QA8 A;  2EMT A;  1WM3 A;  1WJU A;  2BYF A;  1QZE A;  2LAS A;  2NCN A;  1OEY A;  4W9I A;  2DYB A;  3JW0 X;  3L54 A;  4EUT A;  2DAF A;  4FHJ A;  5IAA C;  4KZC A;  3SU8 X;  2M8S A;  2LRU A;  3R7Q A;  2GBN A;  1LM8 B;  4LJO B;  2G4S A;  3GZN I;  2ZPY A;  3PVL A;  2WX0 A;  3WIM A;  4GB9 A;  3MHS D;  1HE8 A;  3APF A;  1I35 A;  5L83 A;  2N1V A;  2JY6 A;  4B6W A;  1GJZ A;  1J8C A;  2ZVN A;  2BGF A;  2ZNV C;  2PJH A;  1TGZ B;  2KC2 A;  4K7W A;  3D32 A;  4MGY E;  1YJ1 A;  4ICU A;  3CMM B;  2AL3 A;  2K8B A;  2V4L A;  3KYC D;  3B08 A;  3VH4 B;  2ZNV B;  3NY5 A;  4ANX A;  1EF5 A;  2L76 A;  4XC2 A;  2K8H A;  1OGW A;  3UIN B;  4OVU A;  2FUH B;  4BFR A;  5G2N A;  2LWP A;  1ZW7 A;  2JF5 A;  3PSE B;  2MBB B;  4IM2 A;  2XK5 A;  2KDE B;  5CHF A;  4M8M A;  3N3K B;  4X57 B;  4NPN A;  2KK8 A;  4MGK E;  3WAL A;  2IBI B;  3EHV A;  4GU2 A;  3LDZ E;  4LCD E;  1WR6 E;  4NAW A;  5JHB A;  2V1Y A;  1WGD A;  4ANV A;  2K39 A;  3WAM A;  3ZTD A;  4WJO A;  2NBW B;  2IYD B;  4NAW B;  3N30 A;  2KX0 A;  2KTF A;  5G55 A;  4HXD A;  4KZ0 A;  4NQK E;  1VD2 A;  2IO3 B;  2MBE A;  2MWS B;  1Q1O A;  2N9E B;  2RR9 A;  3NOB A;  4K7U A;  4W9D A;  1GNU A;  4BKT A;  2MLB A;  4FHK A;  1M94 A;  2UWQ A;  3SD5 A;  3VH3 B;  3UF8 A;  3V61 A;  3MJW A;  2KTR A;  3KW5 B;  2GBM A;  5E6N A;  2KDB A;  2MBQ A;  3VUW A;  4MGI E;  1S1Q B;  1WY8 A;  1GG3 A;  2KWU B;  3R66 C;  2Z59 B;  3SDL C;  2KTR B;  4ASW C;  4GDL B;  4FJZ A;  1WMH A;  4IG7 B;  4A3O A;  2R2Q A;  2L0T A;  4W9H A;  1NBF C;  2ZVO A;  1TTN A;  1WMH B;  3APC A;  2HE7 A;  1WE7 A;  2J7Q B;  1E90 A;  1V9J A;  4W9G A;  3UQB A;  5D94 A;  2JUO A;  3ECI A;  4K1R B;  3A1Q A;  4IW0 A;  3L0W B;  1UH6 A;  2LD9 A;  1D3Z A;  2AL6 A;  3ZDT A;  2WDT B;  4LJP B;  2L3Z A;  4GXB A;  3L17 A;  3ZNG C;  4HDQ A;  3A1Q B;  5AZF A;  4K81 A;  2O6V D;  5FR6 A;  1RLF A;  3NZU A;  4I6L B;  1KM7 A;  4IWP A;  1RAX A;  4DXA B;  2ZEQ A;  5HKH A;  3RYT A;  2DYM A;  1UEL A;  1R4N I;  4ANW A;  4DHZ B;  4W9F A;  1F9J A;  4RM8 A;  4ZYN A;  2ZZP B;  1UBI A;  4KIK B;  3H9D A;  1E7V A;  3VQI A;  2L8J A;  2UYZ B;  4GDK A;  5JZE B;  3QAQ A;  2MBO A;  3A4R A;  3VTV A;  2JT4 B;  2OJR A;  3N32 A;  1EUV B;  3PGE A;  2JRH A;  4YL8 A;  3ZNI D;  5JHA A;  1S3S G;  2L05 A;  2LZ6 A;  3M63 B;  1X1M A;  4W9L A;  1AAR A;  2XEW A;  1WIA A;  3VXW A;  4BKS A;  3KVF B;  1E8Y A;  2XBB C;  3TCA A;  2HD5 B;  1WX7 A;  1JRU A;  4DDI D;  3IHP C;  3C0R B;  2LI5 A;  1C1Y B;  4WWP A;  2MX2 A;  2AYO B;  4ZRK A;  4ZRI A;  3WAO A;  2C7N B;  3MTN B;  1RFA A;  2N7D A;  3ZO5 B;  3Q3J A;  4DK5 A;  1SE9 A;  2WWZ A;  4M8N A;  4CHK A;  4DHJ B;  4URK A;  4B9K A;  2KZR A;  3DBS A;  4A3P A;  2KDI A;  2KQS A;  2KKC A;  1WFY A;  5D2M B;  3VUX A;  3VUY A;  4IM3 A;  1OQY A;  2GBK A;  4HDO A;  3SHQ A;  3B1L X;  2FIF A;  2KX3 A;  3S2A A;  4MDK E;  4WJQ A;  4MGZ E;  3ZNZ B;  4M0W B;  4G3X B;  3OLM D;  2A4Z A;  1WZ3 A;  3IG3 A;  2EKE C;  2FCM A;  4MSM B;  4FAD A;  2CHW A;  3TBL D;  2HTH A;  4E74 A;  3PPA A;  2M4N A;  2J0J A;  1V6E A;  2NR2 A;  3EC8 A;  4HLE A;  2L00 B;  3ZLZ A;  3VDZ A;  5LXI B;  3L08 A;  3U30 A;  2O2V A;  4E3C A;  2DZJ A;  5J17 A;  2ZPN A;  2JVC A;  2KOX A;  3QX1 A;  4MEL A;  2O2V B;  2R2O A;  4W9C A;  4ICV A;  3RZW C;  4FA6 A;  3OAW A;  3A9J A;  1E8X A;  2L7R A;  2YLM A;  2VRR B;  1V81 A;  3DQV A;  2MQJ A;  4AJW A;  2LGX A;  1ZKH A;  2RPQ A;  3A9J B;  4FN2 A;  4IWO A;  2G45 B;  3QAR A;  2D10 A;  2D07 B;  2KMA A;  4KSL C;  4PS8 A;  5CX3 A;  1E7U A;  1UBQ A;  1G6J A;  3V62 A;  4WJN A;  3JYU A;  3QWZ B;  2KVR A;  1WRD B;  2V3S A;  3H6N A;  5TR5 A;  1E8Z A;  4N9F 4;  5KHO A;  1UZX B;  3OJ3 A;  3HK0 A;  5AEK B;  2BPS A;  4FUL A;  3QJZ A;  3ALB A;  3PZD A;  3VTW A;  1WJ6 A;  4ZDV A;  3EFU A;  1Q5W B;  4MEM A;  1V2Y A;  2LXC A;  3RD2 A;  4AP4 C;  2FCS A;  1YQB A;  2KD0 A;  4WJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...