2IO0B

Crystal structure of human senp2 in complex with presumo-2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
84
structure length
84
Chain Sequence
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVYLEHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
total genus 17
structure length 84
sequence length 84
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io0B00
3WAOA 2QHOA 1WI0A 5AZGA 1TTNA 3A9KA 2FUHB 1XT9B 2M1MA 3HHMA 4W9LA 1I35A 4M0WB 2MSED 2KFJA 3VUWA 4OVUA 2JF5A 3ZRFA 5J18A 1LM8B 2ZCBA 5GMVA 3TL5A 3IBEA 4A20A 1UD7A 3JSVB 4EUTA 1R4MI 1GG3A 2EMTA 1Z2MA 4WWNA 2N9XA 4AP4C 3NS8A 5DPTA 1SE9A 5KHOA 2Z0DB 3KH0A 3W1YA 3UIPB 3PSEB 3ZIMA 4II3B 1UELA 1F9JA 2LVOA 2ZZPB 4AWJA 1H4RA 5L83A 3QWZB 1ZKHA 4MJSB 2BKFA 3AI5A 3PTFC 2GBNA 1UBIA 4FLHA 4BKSA 4GIVA 1RFAA 4FA6A 4IWOA 2XK5A 3R7QA 1WXVA 4FJZA 2LRUA 2MBHA 5C1ZA 1NDDA 4MGYE 2JZZA 2MA9B 2ASQA 2KJRA 4ANXA 2M17A 4NQKE 1KM7A 3UQAA 3HM3A 4GOCA 4B95A 4KV2A 2JRHA 1VD2A 3MHSD 3H7PA 2NPTB 4FHJA 1UH6A 2LVQA 4KIKA 4PYUA 2N1WA 2OOBB 4KVGB 4WJOA 3PV1A 3PS6A 2LZ6A 3EC8A 3RULA 4I6PA 3B08A 4DDGD 2FCSA 1YIWA 2I1JA 1WIAA 1TZ1A 1E8XA 4OVVA 1PQSA 5G55A 2K39A 2LD9A 2JXXA 2RGFA 3K9PB 5AZFA 4W9FA 2L7RA 4EOYA 3L54A 2CU1A 2KC1A 2G45B 3VHTC 3WALA 2C7HA 2MWSB 1EO6A 2D3GA 2JY6A 3A9JA 4K81A 3RZFA 4F7ZA 1WF9A 1JRUA 2KQSA 2ZPYA 2KVRA 3R3MA 3M62B 4IM0A 1V5OA 3ZDTA 4B6WA 2IO0B 4ASWC 1OEYJ 1V86A 2KDBA 5G2NA 2G4SA 2LWPA 2MP2B 3Q3FA 3PT2B 2R2OA 4MM3A 3H6NA 2L3ZA 3IFWB 2A4ZA 1Q0WB 4DHJD 1U4AA 4GMVA 4IWPA 3SDLC 3ML8A 2CHXA 3A1QA 2N7EA 4M8MA 4HCNB 5DPWA 2BYEA 3A9JB 1QZEA 4KDIC 2MBEA 4N9F4 3DBSA 2N9EB 2KC2A 3H7SA 3ML9A 4WWOA 1UBQA 3RD2A 3APDA 2GOWA 1K8RB 1Q5WB 2UYZB 1J0GA 2BGFA 1XQQA 2PJHA 2KFKA 3JVZX 4IM3A 2DHZA 4HWIB 1G6JA 4FULA 3M3JA 4ZRIA 2ZPNA 2R2QA 4FADA 2K8CA 2IZVB 3KUDB 1WR1A 1YD8U 3QAQA 4FJVB 3QQ8B 2LXAA 2LI5A 3WANA 3ZNZB 1AARA 1C3TA 3T9LA 3I3TB 2KX0A 2N1VA 3DOWA 3A4SC 1KLVA 2G3QB 2KMAA 2I1KA 2K8HA 1IP9A 2MX2A 3JW0X 2YVCA 4GSWA 4CO7A 2KANA 3WAMA 3NZUA 3EFUA 2KHWB 1J19A 2FNJB 4W9JA 3X0WA 1YX6B 3TMPB 4E71A 4LDTB 4BKSD 4F8CB 3N32A 1YJ1A 4P7IA 2AWTA 5D94A 2L05A 1NI2A 1V2YA 2AEHA 3KYCD 2DZKA 2ZJDA 4HPLB 5AZHA 3U7DA 4K1RB 4ZDVA 1D3ZA 3NZSA 4BOSC 3ZW3A 4EZKA 2K6DB 4HDQA 1WX9A 3QCAA 2D10A 4ICUA 4NJ6A 2NS5A 3ZTDA 3V6EB 5J2RA 1P98A 3PLVA 3AU4A 1H8CA 2AYOB 1WJ6A 2FIDA 2L00B 5D6JB 5FR6A 2C7NB 3RCZA 3VUXA 2KNBA 3N3KB 3QA8A 2NBWB 4KIKB 3AU5A 1WGHA 2ZCCA 2KXJA 2MLBA 3GOEA 3D32A 3NHEB 4NQLB 4RMAA 5CTRC 5L95C 2IY1B 4ICVA 4PYZA 4ANUA 1E8ZA 2JWZA 2NBUA 2OJRA 4BOZB 1YQBA 4MELA 4HJKA 1WE6A 2AL6A 1GC6A 3L0WB 4TQ1A 4ANWA 5CHFA 3PHWB 4DWFA 4E74A 3B1LX 3PVLA 4GDKA 1RAXA 2EKEC 3ZTCA 2Z59B 2D07B 4HCPB 4AJWA 4JIOU 4HXDA 3ONSA 1HE8A 2WWZA 3QK0A 4DDID 1WXMA 4IC7B 2FCQA 1IYFA 1WMHB 2L8JA 2KK8A 4GXBA 2LGXA 4XZ4A 4MGZE 1WJ4A 3HM6X 2LXCA 4HPMB 2KD0A 3W1SA 3VTWA 1LQBA 2MP2A 2BWES 3IHPC 3DBRI 3V60A 4JLCA 4AUQC 4MEMA 3TIXA 3ZLZA 2KDEB 3GZNI 3CSFA 5LXHA 2IO1B 1TGZB 2J0JA 4W9HA 2KJHB 2L0TA 2JUOA 5TR5A 4EKUA 1WX7A 4WAAA 3ALBA 4BFRA 1R4NI 3ZRCA 3PRZA 4LJOB 1M94A 1MG8A 2XBBC 4W9EA 3APFA 3ENEA 3MTNB 3EECA 1J8CA 3DCGA 4MSMB 5DPRA 4ZYNA 1LFDA 3BY4B 1E8YA 4IM2A 1WE7A 2KFKB 2RR9A 2DYOA 1P1AA 4URKA 1WM2A 4HVBA 5J17A 1WZ0A 1WXAA 2CR5A 3K9OB 3P2BA 4GDLB 5DCNA 2G4DB 3L16A 4W9GA 3C0RB 3H7PB 4M8NA 3ZDMC 3A1QB 2KKCA 2DZMA 1WGDA 4II2B 4WJPA 4AJYB 5AEKB 2J7QB 2KMCA 2ZEQA 2IYDB 3APCA 1E7VA 3N30A 1Y8RC 1L2NA 1V6EA 2DAFA 3X23A 3UINB 4WJNA 2KDIA 3VH4B 4TQ0A 2XK5B 2PEAA 5IAAC 3OJ3A 3V6CB 5CX3A 1WGGA 2KOXA 2PE6B 4TKNA 1A5RA 2JT4B 1WJNA 1WX8A 4MDKE 4NY0A 3TCAA 4A3PA 2KZRA 4G3XB 3VDZA 2EMSA 2REXA 3PRMB 4XC2A 2MQJA 3CSTA 1I42A 1Z5SB 3ZO5B 3DDCB 2BWFA 4KSKC 2KQ7A 1EF1A 2YLMA 2ZVOA 2NBVB 4HLEA 1CMXB 2C60A 2D2QA 3DVNU 2B3AA 2K1FA 2Z0EB 3QC8B 2WX0A 4IW0A 4FJYA 2BPSA 2LASA 4IUMB 3LJ3A 3B0AA 4NNJB 5D2MB 2DZIA 1KOTA 4BVUC 3ZNID 4GU2A 1WJUA 2LVPA 2CS4A 2JRIB 2MRPA 3QJZA 4W9IA 4DHZB 3L17A 2KWVB 2KTRB 5IA7A 1EUVB 3DVGY 5E6OA 4YL8A 1V81A 2C5LC 4BBNF 2GMIC 2A5UA 4ZRKA 3UF8A 3AULA 3ZKJC 3JSVA 3DBLI 3WAPA 2FCNA 2ZNVC 1FXTB 1P3QU 3EHVA 2N7DA 2BKRB 2IO2B 2L0FA 2M0XA 4KZCA 4NJ7A 1KJTA 4ZRJA 3H9DA 4JQWC 2V3SA 4MJSA 5EDSA 2KN5A 3KYDD 2AL3A 1V49A 3PLUA 2NPTA 3UIOB 2M4NA 2IO3B 2IY0B 3RZWC 1L7YA 1WM3A 2D11A 1T0YA 2MBOA 4ANVA 2WX1A 1P0RA 3HIZA 3DVGX 1GJZA 2CHWA 2DYMA 3DPDA 1IPGA 1ISNA 3KUZA 4J6IA 3SD5A 2GBMA 2MBQA 2WYQA 4XX5A 1WYWB 2PPHA 4HK2A 4LDTD 3M95A 4LCDE 1V9JA 2JPHA 2ZNVB 3PGEA 4HDOA 2MCNB 1S3SG 3IG3A 3M63B 2MBBB 3VFKA 2IBIB 3S2AA 3OLMD 3NOBA 1YX5B 1P9DU 2V4LA 3VVWB 5LXIB 4AOFA 4RM9A 1OQYA 1XD3B 2KX3A 1GNUA 3U30A 4F1SA 2J0MA 3PREA 4NAWA 4NAWB 3V62A 3IVFA 4W9CA 4PS7A 5CHVC 2K25A 2J0KA 1V80A 3LDZE 4NPNA 1WZ3A 4K7WA 3VTVA 4DK5A 3R7RA 1NBFC 2C9WB 4FHKA 4G50A 2CKHB 4JL9A 3A9KB 1GUAB 4WJQA 1GC7A 4BKTA 4K7UA 4A3OA 3VQIA 3ZNHB 2DZJA 3VH3B 2BYVE 3A4RA 5D7GA 3PPAA 4EEWA 2KWCA 1S1QB 2O6VA 3KUCB 4I6LB 2RD0A 4EZLA 2UWQA 1ZGUB 3QIJA 4IG7B 3SU8X 3O65B 1WR6E 3VUYA 3CMMB 3Q3JA 3WA0A 5C23A 2KLGA 4EZJA 3TJPA 3L13A 2GBKA 4CYEA 5BO4B 1Q1OA 1WH3A 4DHJB 2NR2A 2ZVNA 2K8BA 2HTHA 2LRWA 3OJ4B 2KWUB 2HD5B 2KJ6A 4CHKA 3KVFB 3MJWA 3V61A 1WGRA 4TUUA 1E90A 2DENB 2FCMA 2GBRA 2O2VB 4W9KA 3TBLD 2LJ5A 2V1YA 3CF6E 3JYUA 3DBHI 4PS3A 4WQOB 3UQBA 4W9DA 3ZVVA 3QARA 3DVNV 2JVCA 3ECIA 1RRBA 2O6VD 3OAWA 5E6PA 3QX1A 2XEWA 2N9PC 3T8MA 1UGMA 3H1UA 3VAWA 4GB9A 2KO3A 2W9NA 2KLCA 1OTRB 2JZ3B 2LUEA 4KZ0A 3QHTA 2WDTB 5JHAA 5CHWA 2KDFB 4PS8A 4WWPA 1WXSA 3ZNGC 4BBNC 3PZDA 3PHXB 1OGWA 1OEYA 5JH5C 1VCBA 2FAZA 4KSLC 4GGQA 5KHQA 3KW5B 3RUIB 2VRRB 4E3CA 3VTUA 4EFOA 2HE7A 2FIFA 1WY8A 2MW5A 1WRDB 1X1MA 4MH0E 4DXAB 1C1YB 4B9KA 4K7SA 4DBGA 3SHQA 3U8ZA 2RPQA 3R66C 4G0NB 3AXCA 2N4FA 4LJPB 4KDLB 2CHZA 2LGYA 4TV3A 3VXWA 4MGIE 2BF8B 3DQVA 2M8SA 1WGYA 1E5WA 2GBJA 5DPSA 3NY5A 1UZXB 1BT0A 3ZUNA 3HK0A 1ZW7A 2NCNA 1SIFA 3PRPB 2PE9A 4MSQB 2BYFA 1TBEA 1WMHA 5JZEB 2KTFA 1WFYA 2O2VA 1E8WA 4BKGA 4GN1A 3UGBB 2DX5B 3L08A 4GDLA 4I6NB 4FN2A 5E6NA 3WIMA 3RT3B 1LXDA 4GDKB 3BINA 1SGHA 2NVUI 4RM8A 4FBJB 4X57B 4DHZE 5JHBA 3A33B 2LGDA 2L76A 1E7UA 2C7MB 2HJ8A 5HKHA 2DAJA 2K6QA 4JGHB 2Y5BB 5LLIA 2O6VB 2KTRA 3L10B 4G11A 3RYTA 2DYBA 4IWQA 1RLFA 4MGKE 3W1SC 1EF5A 2RSUA 1V5TA
chains in the Genus database with same CATH superfamily
4YT0B 2FUHB 3HHMA 1I35A 2KFJA 3VUWA 3U52E 3TL5A 1L4DB 1UD7A 1R4MI 2EMTA 1Z2MA 2N9XA 1SJHD 1QT9A 4A6QA 3UIPB 1F9JA 1HZ6A 1ZKHA 4MJSB 1UBIA 4FLHA 4BKSA 3R7QA 2FUG1 2JZZA 1BXTA 4YSYB 2M17A 1P7EA 1JMLA 1KM7A 3UQAA 1EU3A 1EM7A 4FXCA 1HZ5A 1FFUA 1AN8A 3RULA 4I6PA 4AQ7A 1E8XA 4P1CC 2LD9A 3OWEB 3K9PB 2X38A 2L7RA 3VHTC 2KC1A 3WALA 2AQ1B 4K81A 3RZFA 1WF9A 2M0AA 3R3MA 2KVRA 4B6WA 2J4XA 1OQQA 2IO0B 1V86A 3LXFA 3AEDB 2KDBA 2JX5A 3IFWB 3C19A 4IWPA 4XGAB 2CHXA 4HCNB 1HQRD 1MHXA 3A9JB 3ZQ4A 4KDIC 2N9EB 3ML9A 3RD2A 3APDA 4JX1C 2WXGA 2Q5WD 3M3JA 4ZRIA 2IZVB 4M00A 1C3TA 3Q69A 1MVKA 1KLVA 2KMAA 1IP9A 1QQRA 3FILB 1SEBD 3RMKC 4GSWA 1FIQA 4MM3B 1SE3A 1J19A 4W9JA 1NVID 3URYA 4E71A 4BKSD 1C4PA 1V1PA 5D94A 3BK2A 1F2RC 4HPLB 2DZKA 2ZJDA 3U7DA 5BMIA 3NZSA 4HDQA 4A8XC 1WX9A 2ACZB 2D10A 1V97A 1FNVA 3V3XA 3ABVB 3V6EB 4WURA 3RCZA 1N61A 2KNBA 3N3KB 3I9V1 3AU5A 2QC8A 1C9FA 3W9CB 3NS1A 2MLBA 5CTRC 4NQLB 4BAXA 2BB6A 5L95C 1ZXHA 2IY1B 4ANUA 1E0ZA 2OJRA 2KDMA 3RI7C 2B76B 2JQRB 4MELA 1WE6A 1GC6A 3L0WB 3PHWB 1ROEA 3N1YC 3B1LX 3AEBB 3AE1B 2EKEC 4RCOA 4WQMA 3AE5B 4KGSA 1TIFA 4RGOS 1JWMD 2EELA 1WMHB 4XZ4A 3P42A 2LXCA 4HPMB 3U7ZA 3ETRA 2MP2A 3IHPC 4ZOHC 3ZLZA 5TR5A 1TGZB 1DOXA 2KYWA 2JUOA 1GB4A 4XWTA 1WX7A 1HTQA 4BFRA 1FO4A 3ZRCA 1MG8A 3DHGC 3RNFC 1J8CA 3DCGA 1NYRA 2BYTA 1WE7A 2JYTA 3GE3C 4URKA 1J7CA 4HVBA 2WU2B 5J17A 1WZ0A 3P2BA 5DCNA 3N1ZC 3MHZA 3EA6A 3C0RB 3H7PB 3O13A 1WGDA 4AJYB 2DNFA 2KQ4X 3APCA 2K0PA 2DAFA 1IGDA 5CX3A 4OZCA 4C4VA 2JT4B 4MACA 1WX8A 4MDKE 3AE9B 1I4GA 4AS1A 4R3DA 1YN3A 2EMSA 3PRMB 3DHHC 2W3SA 3C8YA 1Z5SB 3SFEB 4XDDA 3DDCB 1YQ4B 4LNOA 1TS2A 1EF1A 3IT6B 2NBVB 4HLEA 1SBBB 2B3AA 2Z0EB 2J42A 5BYQA 2BPSA 2LASA 5D2MB 4NNJB 1KOTA 2DZIA 3ZNID 4OW0A 4W9IA 4DHZB 3L17A 2KTRB 1KRHA 4YXDB 5IA7A 4YL8A 2WXQA 2VH1A 2BKRB 2N7DA 2L0FA 3RNGC 3H9DA 4MJSA 3KYDD 4YTNB 2SAKA 3PLUA 3KWLA 2M56B 2IO3B 3RZWC 1L7YA 1WM3A 1P0RA 2DYMA 2GBMA 1TZOA 1WYWB 2PPHA 4HK2A 1V9JA 1L6UA 3PGEA 4M01A 3ZXRA 5IN7A 1QKZA 1JALA 1GNUA 4F1SA 5CHVC 3FKYA 1V80A 4DK5A 4JL9A 4WAFA 1DOYA 2WXIA 4NZLB 3VH3B 2LHDA 5D7GA 4I6LB 2RD0A 2H89B 1PYWD 3PO0A 2UWQA 2K9XA 3O65B 4US8A 2KLGA 4CYEA 3LYYA 5TSSA 1WXQA 2K8BA 2V9HA 2HTME 2LRWA 3KVFB 1KH0A 1E90A 2G1EA 2GBRA 2ON8A 2LJ5A 2V1YA 3DBHI 1TS5A 3ZVVA 3QX1A 2CJNA 1UNSA 2XEWA 2DLBA 4YTMB 3H1UA 4BZAA 2V3PA 2LUEA 2OEDA 2WDTB 3QHTA 4PS8A 4WWPA 4BBNC 3KQ4A 2K22A 3PHXB 1OEYA 2KAJA 5JH5C 2FAZA 2MJDA 1HTOA 1QOFA 1WWTA 3ZJUA 3RUIB 1FXIA 2FBWB 4EFOA 2HE7A 1WY8A 2FIFA 2MW5A 2BB5A 4DXAB 3RNBC 1SXTA 2DWQA 4DXGA 2N4FA 4KDLB 4O1NA 4TV3A 1B1ZA 2WXLA 3AEEB 4PK1A 1E5WA 2GBJA 3NY5A 1BT0A 3ZUNA 1JROA 3P4QB 1K50A 1LGRA 5JZEB 2NMQA 4BKGA 3J9CA 3N9YC 4GN1A 3UGBB 2AX5A 1XF5L 4NJCA 3KLSX 4GDKB 3AEAB 1SGHA 4K3CA 2N9KA 1L5PA 4FBJB 5JHBA 1UF0A 2LGDA 2L76A 1E7UA 2HJ8A 2K6QA 2O6VB 1K52A 2KTRA 3W1SC 5EE3A 2INDC 2QHOA 3A9KA 1F77A 3E56A 3CIRB 2MSED 4LTUA 4YSXB 5D3DA 4OVUA 5J18A 4A20A 2D3AA 3IBEA 2L1AA 3JSVB 2PKOA 1TS4A 1HA5A 4AP4C 2IPKD 3NS8A 5DPTA 1SE9A 5KHOA 1OQRA 3KH0A 3W1YA 3PSEB 1UELA 5L83A 2R61A 3QWZB 2BKFA 1SB3C 3PZ7A 4FA6A 4A55A 4MGYE 2KJRA 1JWAD 3KWVA 3HM3A 4B95A 1VD2A 3H7PA 5FKAC 2WP9B 1T0SC 4P16A 4WJOA 3PS6A 1I4XA 2AQ2B 1E6EB 3AMZA 2L52A 2KT7A 2C7HA 2MWSB 2PIAA 2JY6A 1KLGD 2KQSA 2ZPYA 1PGXA 2GRIA 2QIEB 1E10A 2G4SA 2LWPA 2MP2B 3ZXVA 4MM3A 3PT2B 2R2OA 3H6NA 1Q0WB 3RNAC 3SDLC 3A1QA 4M8MA 2IDYA 2JXTA 2WXRA 4JWSC 3DBHB 2LGSA 4WWOA 2GOWA 2UYZB 4EE2A 4ZRQA 2PJHA 3Q3MC 2KFKA 2PTLA 1R4MB 3AE6B 3BVMA 1YD8U 3WANA 3TUOA 3ZNZB 2N1VA 3DOWA 1QILA 2I1KA 2E3TA 3IXSA 3Q8CA 2KHWB 3OG5A 2FNJB 3X0WA 1YX6B 2LGIA 4P7IA 2L05A 2BS4B 5IOIA 2YEPF 2WXFA 3NVYA 4EZKA 1FEHA 2RDHA 4ICUA 3GS2A 2NS5A 3AM9A 3ZTDA 3Q14C 5J2RA 3AU4A 2AYOB 3B9JA 2E6XA 3VUXA 4HEA1 2NBWB 1KTKA 4WIPA 3Q8AA 2KXJA 3NHEB 3HUIA 1FNUA 4ICVA 4RGNA 4PYZA 1JWSD 2Y5CA 2NBUA 1YQBA 3TEYA 5CHFA 1FMAD 2VZKB 3PVLA 4GDKA 3VR9B 3P4RB 2D07B 4HCPB 4HXDA 2WXJA 2WWZA 3QK0A 1C77A 1EU4A 4QAYA 2QCZA 1IYFA 2L32A 1NEKB 4P6VF 4MGZE 3HM6X 1STEA 5HI1A 2WS3B 4EKUA 3BIID 2KJHB 1N62A 4WAAA 1HXYD 3PRZA 4W9EA 3APFA 3ENEA 3MTNB 4RF0A 4MSMB 1FRRA 1E8YA 4IM2A 1BUIC 3R8BA 2DYOA 4ZHPA 1L6VA 1T0QC 2G4DB 3ZDMC 2KWDA 4WJPA 3MFGA 2IYDB 1YJIA 3X23A 3UINB 2IGGA 4TQ0A 2WDVB 1GB1A 1E7PB 1A5RA 1WJNA 3TCAA 5GXGB 2MQJA 2BBCA 1MG4A 5EE1A 5BYSA 2BWFA 2KQ7A 2PLPA 1SE2A 2YLMA 2ZVOA 3FAHA 2D2QA 2K1FA 3Q6BA 2WX0A 4IUMB 1ZP0B 3GZNB 3B0AA 3LJ3A 3ZGZA 1D4BA 4GU2A 3QJZA 1ZXIA 1EUVB 5FK9C 4BBNF 1FCCC 2W54A 4DHJB 2FCNA 1FXTB 4A3PA 4NJ7A 4ZRJA 1KJTA 1BMLC 4JQWC 2V3SA 4KGRA 2KN5A 2M19A 3I57A 2AL3A 2NPTA 4OHJA 3UIOB 1T0YA 1SF0A 4HKZE 4J6IA 2G9HD 2MBQA 1ACCA 1WRIA 4LCDE 3M95A 2ZNVB 2ZW0A 3RNEC 4HDOA 1S3SG 4C00A 1T6BX 2QEJC 3VFKA 4YSZB 3AH7A 1YX5B 3P4PB 3NUHB 3VVWB 3DWMA 4AOFA 1XD3B 3AV8A 3U30A 2J0MA 4NAWA 1N63A 2K25A 3LDZE 4NPNA 3R7RA 2C9WB 4WJQA 4BKTA 4K7UA 2Z8LA 5H8YE 3VQIA 3ZNHB 2BYVE 3MC0B 1RYJA 3KUCB 1P7FA 3VUYA 1ZGUB 3SU8X 4IG7B 2UU7A 1UWXA 5C23A 1YOVB 2GLSA 1ENFA 4B0MA 2HTHA 2KWUB 2HD5B 2Y3AA 3MJWA 4XDCA 2K3UA 3TBLD 4W9KA 4DQOC 4PS3A 3JYUA 3Q3NC 4C4VB 3QARA 2OJWA 1UGMA 2WDQB 4XWWA 2W9NA 2QMTA 2KLCA 4KZ0A 1ZDXA 5JHAA 1N6ZA 3ZNGC 1CQVA 2MJEA 4KSLC 4YWGG 4GGQA 3ZJVA 1R7SA 2WNMA 4ARCA 3MJ5A 2VRRB 2GI9A 4E3CA 4PT5A 1X1MA 4MH0E 2I2YA 3TEXA 1C1YB 2RPQA 3R66C 3AXCA 5LNK1 2CHZA 2LGYA 5IP4D 3VXWA 1ZPSA 2M8SA 4OZAA 4M02A 1UZXB 2NCNA 1SIFA 2PE9A 4MSQB 1WMHA 1TKEA 5MPOA 1I4PA 3W2DA 2DX5B 2KMMA 3WIMA 1UWMA 5HG2A 3BINA 3BVGA 4X57B 2DAJA 3B2FA 2INPE 4WWMA 4G11A 2DYBA 3AN1A 1RLFA 2JYEA 4MGKE 4C7ZA 1WI0A 1XT9B 2M1MA 4W9LA 1YNTE 4M0WB 3TEWA 1C4AA 4D2KA 3ZRFA 1LM8B 2ZCBA 4N58A 3U2SC 1FPYA 4L2YA 1GG3A 1XXGA 1RM6C 1TT5B 2LFIA 3NVVA 3HVZA 1A70A 2LVOA 3AI5A 4MT5A 1C4CA 4JPSA 3AEFB 1MHHE 1RFAA 3Q2AC 4IWOA 4FJZA 2LRUA 5C1ZA 1D5ZC 1J7BA 2MA9B 2ASQA 4ANXA 4NQKE 4GOCA 4KV2A 2JRHA 1C76A 4ITKA 2NPTB 4FHJA 4JWUC 1UH6A 2L83A 2LVQA 2PVOD 2LZ6A 3EC8A 5AUIA 2FCSA 1YIWA 2I1JA 1WIAA 1TZ1A 2HJ1A 2WXMA 4C7YA 5G55A 4C56C 5AZFA 4W9FA 4EOYA 2CU1A 2G45B 1IGCA 2D3GA 3A9JA 1VJKA 1JRUA 2KVZA 4ARIA 3M62B 4IM0A 3SR6A 4ASWC 1QOAA 1OEYJ 5G2NA 2L3ZA 3PZ8A 1U4AA 3ML8A 1R4NB 1ZUD2 1PUTA 2MBEA 1F0ZA 2KC2A 3BYYB 3H7SA 4REZA 1UBQA 4DXFA 1GPXA 1K8RB 1Q5WB 2BGFA 2J53A 1XQQA 4IM3A 2DHZA 4HWIB 5BMHA 4US9A 5E6JA 2RMMA 1WR1A 3QQ8B 1AARA 3AE3B 1MPEA 4TMAB 3T9LA 3A4SC 3GE8C 2G3QB 2K8HA 1WGKA 2MX2A 3JW0X 2YVCA 3NVWA 2KANA 1ZE3D 2RPVA 2K5PA 3N32A 1YJ1A 3H8HA 3R2TA 4XE0A 2AEHA 1YMHE 2SEBD 4ZDVA 4LNFA 4BOSC 1N60A 1SJED 3QCAA 1YN5A 1CK1A 1I4RA 3Q8EA 3AE2B 5I4DA 1YJJA 1DYQA 1CZPA 2LUMA 2C7NB 4KIKB 3QA8A 2WXNA 1WGHA 2ZCCA 3DBRB 1D5XC 1JWUD 3D32A 3GOEA 5HFYA 4RMAA 4CQNA 4KGTA 1XLPA 4WH4A 2FE8A 2LEKA 3Q3OC 3B2GA 1VZ7A 2JWZA 3Q8FA 4HJKA 1F52A 1J7AA 2AL6A 4TQ1A 4ANWA 1RAXA 3ZTCA 1MFWA 1IBXA 4IC7B 2FCQA 4N59A 2LGXA 2KD0A 3W1SA 4OZBA 1LQBA 2BWES 1GAQB 4MEMA 1HEZE 2KDEB 3CSFA 2IO1B 2L0TA 4S17A 3ALBA 1E9MA 1M94A 1ZDVA 2JWUA 5JXVA 5DPRA 4RFBA 1LFDA 3IAS1 2W3RA 2QJLA 3EUB2 2OHFA 1WXAA 1XCTL 3K9OB 4GDLB 5EE0A 3L16A 4W9GA 3VRAB 2KKCA 1KF6B 2DBYA 4HROA 2J7QB 2KMCA 2ZEQA 3NZ3A 1L2NA 1Q10A 1V6EA 3U4EG 4WJNA 2KDIA 4LNNA 3VH4B 2XK5B 1I4QA 2BW2A 5IAAC 3V6CB 1M4VA 4UDUC 4TKNA 1VZ8A 1NYQA 1NENB 4NY0A 2ICIA 4G3XB 3VDZA 2BS3B 2REXA 1I42A 3CSTA 3ZO5B 2HDEA 1L0VB 3AEGB 3QC8B 1CMXB 2C60A 3DVNU 4IW0A 2NTTA 1JQ4A 4BVUC 2CS4A 2JRIB 2MRPA 2KN4A 1PGBA 3DWGC 2WXKA 2JSVX 5E6OA 1V81A 2V4IB 2GMIC 3AULA 1TY2A 3VR8B 3DBLI 3MC9A 3WAPA 3EHVA 2ZNVC 3BYTB 4KZCA 4M0WA 5EDSA 1IUEA 2D3CA 4HJGE 5AUKA 2WXPA 4USAA 1PDXA 2RDGA 2IY0B 2MBOA 2WX1A 1F2RI 1GJZA 2CHWA 3DPDA 3I63C 3KUZA 4JE3B 5EE9A 4LNIA 4LDTD 2N9LA 2MCNB 2IBIB 3S2AA 1P9DU 2MEKA 4RM9A 2KX3A 1V1PB 1QLBB 4H2AA 3V62A 3IVFA 4W9CA 4PS7A 2V3NA 1WZ3A 1TY0A 3VTVA 1NBFC 3A9KB 1GUAB 1OFFA 3SFDB 2DZJA 3VRBB 2KWCA 2O6VA 1JWBD 3QIJA 2LHEA 3AB5A 1WR6E 3Q3JA 1XLOA 5BO4B 1C78A 1Q1OA 4P1BC 1FFVA 1NI3A 2ZVNA 3WCQA 3OJ4B 1TYGB 2KJ6A 4CHKA 4LLGM 3V61A 1L4ZB 4TUUA 2FCMA 3T3OA 3CF6E 4WQOB 4A9AA 4W9DA 3DVNV 3ECIA 3OAWA 2IGDA 3T8MA 3VAWA 2W55A 4OVZA 5IKCM 1OTRB 3V05A 5CHWA 2H88B 3AE8B 1WXSA 3PZDA 1VCBA 5KHQA 3KW5B 5IO9A 2LMCA 3GB1A 3VTUA 1WRDB 1ET6A 1RFKA 4RGMA 5H92C 1TKGA 4IDIA 2YEPB 4B9KA 4K7SA 3ZJTA 2BS2B 4LJPB 2J52A 3NVZA 2CJOA 1VRAB 4MGIE 1VLBA 2BF8B 3DQVA 2WQYB 2WXHA 1ZW7A 1VDVA 3PRPB 1TBEA 2D3BA 2KTFA 1WFYA 1E8WA 1DOIA 4GDLA 5E6NA 4FN2A 4ZYSA 3BK1A 2NVUI 4RM8A 1TKYA 3T3NA 3A33B 2V0GA 1Y56A 2C7MB 2WGSA 4RNAA 2Y5BB 5D3IB 5LLIA 2AQ3B 4IWQA 1EF5A 2RSUA 1V5TA 3WAOA 1L0XB 5AZGA 1TTNA 2MHJA 2JF5A 5GMVA 4EUTA 2N7JA 4KKIA 4WWNA 1D5MC 2Z0DB 3ZIMA 1EWYC 4GLSC 1N5XA 2ZZPB 4II3B 4A90A 4AWJA 1H4RA 5G5GA 3PTFC 2GBNA 4GIVA 2XK5A 1WXVA 2MBHA 1NDDA 1AWDA 3L4PA 3P1MA 3MHSD 3HVDA 1YQ3B 3LB8C 4KIKA 2WXOA 4PYUA 2N1WA 2OOBB 4KVGB 1ESFA 3PV1A 2BT6A 1K53A 3B08A 4DDGD 5HHDG 4OVVA 1PQSA 2INNE 2K39A 2JXXA 2RGFA 1FCLA 4HKQA 3L54A 1EO6A 4F7ZA 3EFCA 3DBLB 3ZDTA 1TJEA 1V5OA 1QF6A 3Q3FA 4B0EA 1LO5D 2A4ZA 4DHJD 4NAMA 4GMVA 2I38A 4RH6A 2N7EA 5DPWA 2BYEA 3CWIA 1QZEA 4N9F4 1IBXB 3DBSA 1DGJA 3W5UB 1J0GA 3SEBA 1FXAA 3JVZX 2ZW1A 1G6JA 4FULA 2ZPNA 2R2QA 4FADA 2K8CA 4ACFA 1F1HA 3KUDB 3QAQA 4FJVB 2LXAA 2LI5A 2PVGC 3I3TB 2KX0A 1QOGA 2BTEA 4L23A 3AE7B 1ET9A 4IOIE 4CO7A 3WAMA 5G5HA 3NZUA 3EFUA 1UGJA 1SIJA 3TMPB 4LDTB 3NJTA 4F8CB 3NRZA 2AWTA 3I5JC 1NI2A 1V2YA 2QILA 2X8XX 3KYCD 1D3ZA 5AZHA 3MC8A 4K1RB 3ZW3A 1L0YB 2K6DB 1XLNA 3AE4B 5C3JB 4NJ6A 1FRDA 1P98A 3PLVA 1H8CA 1WJ6A 2FIDA 2L00B 4TSSA 5D6JB 4HRSA 5FR6A 3UI3A 1TS3A 3RNCC 2XNAC 3P4SB 4ZRPA 5T8IA 1XO3A 1T3QA 2IJ0A 1E8ZA 1AYFA 4BOZB 4DWFA 3TSSA 4E74A 2Z59B 4AJWA 4JIOU 3ONSA 1HE8A 4LK0M 4DDID 1WXMA 2L8JA 2KK8A 1I4HA 4GXBA 3P63A 1WJ4A 2XN9C 1T0RC 3VTWA 2VZKD 3DBRI 2Y5PA 3V60A 4JLCA 4AUQC 3TIXA 3GZNI 5LXHA 2J0JA 3W5VB 4W9HA 1R4NI 4LJOB 2XBBC 3EECA 3RFZB 4ZYNA 1MI0A 1UUPA 1XLQA 3BY4B 2KFKB 1XCQL 2RR9A 1P1AA 3N1XC 1WM2A 2PMVA 3N20C 2MH7A 1GOZA 2CR5A 1FD6A 4M8NA 1PGAA 1SE4A 3A1QB 4II2B 2DZMA 5AEKB 1RWSA 1E7VA 3N30A 1Y8RC 2D5GA 1AW7A 3BZDB 2PEAA 3OJ3A 1WGGA 2KOXA 2PE6B 2TSSA 1V1OA 1WSPA 1ZOYB 2KZRA 5BYRA 5FR3A 2W82A 4XC2A 2WU5B 4XYCA 4KSKC 4N6EB 4FJYA 4YTPB 1V8CA 1WJUA 2LVPA 3IT4B 2KWVB 1T5XD 3DVGY 2C5LC 2A5UA 4ZRKA 3UF8A 3ZKJC 3JSVA 2ONQA 1P3QU 2IO2B 1YN4A 2M0XA 2N0SB 1V49A 2M4NA 3FILA 3FC4A 2D11A 3BWUD 4ANVA 1N5WA 3DVGX 3HIZA 3NG0A 1QOBA 1IPGA 1ISNA 1CJEA 3SD5A 2WYQA 2BVCA 4XX5A 4KKJA 1JRPA 2JPHA 4KX6B 2MJ3A 3MP9A 3IG3A 3M63B 2MBBB 3GP7A 5BMGA 3OLMD 3NOBA 4C80A 1KFYB 2V4LA 5LXIB 1OQYA 3PREA 4NAWB 2NTSA 2J0KA 2JZPA 4K7WA 4FHKA 4G50A 2CKHB 2CU3A 3EGRA 1GC7A 4A3OA 3A4RA 4EEWA 3PPAA 1S1QB 1MJDA 4EZLA 1FM0D 3CMMB 3WA0A 1XEEA 3TEZA 4EZJA 3TJPA 3L13A 2GBKA 3R2IA 1WH3A 4IKGA 2NR2A 1WYGA 2WDRB 4L1BA 2RDBC 2VH2A 1WGRA 2EKIA 3RPFC 2DENB 2O2VB 2WHIA 3UQBA 2JVCA 5E6PA 1RRBA 2O6VD 3IAM1 3Q8BA 1JW9D 2N9PC 1KLUD 3HRDD 2KO3A 4GB9A 4LNKA 2WLBA 2JZ3B 3RN9C 2KDFB 2LJIA 4K3BA 2INCC 4ZHOA 1OGWA 1VZ6A 4MH8A 1EWCA 1B9RA 2KACA 1SSNA 4RF1A 3BVZA 4DBGA 3SHQA 3U8ZA 4G0NB 4RGTA 1D6EC 3DHIC 4HPPA 3ZYYX 2PW9A 4S0RA 1FNWA 2QDFA 1I7HA 2IGHA 3AECB 1WGYA 1PFDA 5DPSA 3HK0A 2QSDA 1C79A 2BYFA 2JU6X 3E9SA 2O2VA 4J3OD 3L08A 4I6NB 1JCKB 3RT3B 1LXDA 1VR9A 2BQQA 2GB1A 1K51A 4Q2JA 4DHZE 5HKHA 5C2TB 4JGHB 3L10B 3RYTA
chains in the Genus database with same CATH topology
3WAOA 2QHOA 1WI0A 5AZGA 1TTNA 3A9KA 2FUHB 1XT9B 2M1MA 3HHMA 4W9LA 1I35A 4M0WB 2MSED 2KFJA 3VUWA 4OVUA 2JF5A 3ZRFA 5J18A 1LM8B 2ZCBA 5GMVA 3TL5A 3IBEA 4A20A 1UD7A 3JSVB 4EUTA 1R4MI 1GG3A 2EMTA 1Z2MA 4WWNA 2N9XA 4AP4C 3NS8A 5DPTA 1SE9A 5KHOA 2Z0DB 3KH0A 3W1YA 3UIPB 3PSEB 3ZIMA 4II3B 1UELA 1F9JA 2LVOA 2ZZPB 4AWJA 1H4RA 5L83A 3QWZB 1ZKHA 4MJSB 2BKFA 3AI5A 3PTFC 2GBNA 1UBIA 4FLHA 4BKSA 4GIVA 1RFAA 4FA6A 4IWOA 2XK5A 3R7QA 1WXVA 4FJZA 2LRUA 2MBHA 5C1ZA 1NDDA 4MGYE 2JZZA 2MA9B 2ASQA 2KJRA 4ANXA 2M17A 4NQKE 1KM7A 3UQAA 3HM3A 4GOCA 4B95A 4KV2A 2JRHA 1VD2A 3MHSD 3H7PA 2NPTB 4FHJA 1UH6A 2LVQA 4KIKA 4PYUA 2N1WA 2OOBB 4KVGB 4WJOA 3PV1A 3PS6A 2LZ6A 3EC8A 3RULA 4I6PA 3B08A 4DDGD 2FCSA 1YIWA 2I1JA 1WIAA 1TZ1A 1E8XA 4OVVA 1PQSA 5G55A 2K39A 2LD9A 2JXXA 2RGFA 3K9PB 5AZFA 4W9FA 2L7RA 4EOYA 3L54A 2CU1A 2KC1A 2G45B 3VHTC 3WALA 2C7HA 2MWSB 1EO6A 2D3GA 2JY6A 3A9JA 4K81A 3RZFA 4F7ZA 1WF9A 1JRUA 2KQSA 2ZPYA 2KVRA 3R3MA 3M62B 4IM0A 1V5OA 3ZDTA 4B6WA 2IO0B 4ASWC 1OEYJ 1V86A 2KDBA 5G2NA 2G4SA 2LWPA 2MP2B 3Q3FA 3PT2B 2R2OA 4MM3A 3H6NA 2L3ZA 3IFWB 2A4ZA 1Q0WB 4DHJD 1U4AA 4GMVA 4IWPA 3SDLC 3ML8A 2CHXA 3A1QA 2N7EA 4M8MA 4HCNB 5DPWA 2BYEA 3A9JB 1QZEA 4KDIC 2MBEA 4N9F4 3DBSA 2N9EB 2KC2A 3H7SA 3ML9A 4WWOA 1UBQA 3RD2A 3APDA 2GOWA 1K8RB 1Q5WB 2UYZB 1J0GA 2BGFA 1XQQA 2PJHA 2KFKA 3JVZX 4IM3A 2DHZA 4HWIB 1G6JA 4FULA 3M3JA 4ZRIA 2ZPNA 2R2QA 4FADA 2K8CA 2IZVB 3KUDB 1WR1A 1YD8U 3QAQA 4FJVB 3QQ8B 2LXAA 2LI5A 3WANA 3ZNZB 1AARA 1C3TA 3T9LA 3I3TB 2KX0A 2N1VA 3DOWA 3A4SC 1KLVA 2G3QB 2KMAA 2I1KA 2K8HA 1IP9A 2MX2A 3JW0X 2YVCA 4GSWA 4CO7A 2KANA 3WAMA 3NZUA 3EFUA 2KHWB 1J19A 2FNJB 4W9JA 3X0WA 1YX6B 3TMPB 4E71A 4LDTB 4BKSD 4F8CB 3N32A 1YJ1A 4P7IA 2AWTA 5D94A 2L05A 1NI2A 1V2YA 2AEHA 3KYCD 2DZKA 2ZJDA 4HPLB 5AZHA 3U7DA 4K1RB 4ZDVA 1D3ZA 3NZSA 4BOSC 3ZW3A 4EZKA 2K6DB 4HDQA 1WX9A 3QCAA 2D10A 4ICUA 4NJ6A 2NS5A 3ZTDA 3V6EB 5J2RA 1P98A 3PLVA 3AU4A 1H8CA 2AYOB 1WJ6A 2FIDA 2L00B 5D6JB 5FR6A 2C7NB 3RCZA 3VUXA 2KNBA 3N3KB 3QA8A 2NBWB 4KIKB 3AU5A 1WGHA 2ZCCA 2KXJA 2MLBA 3GOEA 3D32A 3NHEB 4NQLB 4RMAA 5CTRC 5L95C 2IY1B 4ICVA 4PYZA 4ANUA 1E8ZA 2JWZA 2NBUA 2OJRA 4BOZB 1YQBA 4MELA 4HJKA 1WE6A 2AL6A 1GC6A 3L0WB 4TQ1A 4ANWA 5CHFA 3PHWB 4DWFA 4E74A 3B1LX 3PVLA 4GDKA 1RAXA 2EKEC 3ZTCA 2Z59B 2D07B 4HCPB 4AJWA 4JIOU 4HXDA 3ONSA 1HE8A 2WWZA 3QK0A 4DDID 1WXMA 4IC7B 2FCQA 1IYFA 1WMHB 2L8JA 2KK8A 4GXBA 2LGXA 4XZ4A 4MGZE 1WJ4A 3HM6X 2LXCA 4HPMB 2KD0A 3W1SA 3VTWA 1LQBA 2MP2A 2BWES 3IHPC 3DBRI 3V60A 4JLCA 4AUQC 4MEMA 3TIXA 3ZLZA 2KDEB 3GZNI 3CSFA 5LXHA 2IO1B 1TGZB 2J0JA 4W9HA 2KJHB 2L0TA 2JUOA 5TR5A 4EKUA 1WX7A 4WAAA 3ALBA 4BFRA 1R4NI 3ZRCA 3PRZA 4LJOB 1M94A 1MG8A 2XBBC 4W9EA 3APFA 3ENEA 3MTNB 3EECA 1J8CA 3DCGA 4MSMB 5DPRA 4ZYNA 1LFDA 3BY4B 1E8YA 4IM2A 1WE7A 2KFKB 2RR9A 2DYOA 1P1AA 4URKA 1WM2A 4HVBA 5J17A 1WZ0A 1WXAA 2CR5A 3K9OB 3P2BA 4GDLB 5DCNA 2G4DB 3L16A 4W9GA 3C0RB 3H7PB 4M8NA 3ZDMC 3A1QB 2KKCA 2DZMA 1WGDA 4II2B 4WJPA 4AJYB 5AEKB 2J7QB 2KMCA 2ZEQA 2IYDB 3APCA 1E7VA 3N30A 1Y8RC 1L2NA 1V6EA 2DAFA 3X23A 3UINB 4WJNA 2KDIA 3VH4B 4TQ0A 2XK5B 2PEAA 5IAAC 3OJ3A 3V6CB 5CX3A 1WGGA 2KOXA 2PE6B 4TKNA 1A5RA 2JT4B 1WJNA 1WX8A 4MDKE 4NY0A 3TCAA 4A3PA 2KZRA 4G3XB 3VDZA 2EMSA 2REXA 3PRMB 4XC2A 2MQJA 3CSTA 1I42A 1Z5SB 3ZO5B 3DDCB 2BWFA 4KSKC 2KQ7A 1EF1A 2YLMA 2ZVOA 2NBVB 4HLEA 1CMXB 2C60A 2D2QA 3DVNU 2B3AA 2K1FA 2Z0EB 3QC8B 2WX0A 4IW0A 4FJYA 2BPSA 2LASA 4IUMB 3LJ3A 3B0AA 4NNJB 5D2MB 2DZIA 1KOTA 4BVUC 3ZNID 4GU2A 1WJUA 2LVPA 2CS4A 2JRIB 2MRPA 3QJZA 4W9IA 4DHZB 3L17A 2KWVB 2KTRB 5IA7A 1EUVB 3DVGY 5E6OA 4YL8A 1V81A 2C5LC 4BBNF 2GMIC 2A5UA 4ZRKA 3UF8A 3AULA 3ZKJC 3JSVA 3DBLI 3WAPA 2FCNA 2ZNVC 1FXTB 1P3QU 3EHVA 2N7DA 2BKRB 2IO2B 2L0FA 2M0XA 4KZCA 4NJ7A 1KJTA 4ZRJA 3H9DA 4JQWC 2V3SA 4MJSA 5EDSA 2KN5A 3KYDD 2AL3A 1V49A 3PLUA 2NPTA 3UIOB 2M4NA 2IO3B 2IY0B 3RZWC 1L7YA 1WM3A 2D11A 1T0YA 2MBOA 4ANVA 2WX1A 1P0RA 3HIZA 3DVGX 1GJZA 2CHWA 2DYMA 3DPDA 1IPGA 1ISNA 3KUZA 4J6IA 3SD5A 2GBMA 2MBQA 2WYQA 4XX5A 1WYWB 2PPHA 4HK2A 4LDTD 3M95A 4LCDE 1V9JA 2JPHA 2ZNVB 3PGEA 4HDOA 2MCNB 1S3SG 3IG3A 3M63B 2MBBB 3VFKA 2IBIB 3S2AA 3OLMD 3NOBA 1YX5B 1P9DU 2V4LA 3VVWB 5LXIB 4AOFA 4RM9A 1OQYA 1XD3B 2KX3A 1GNUA 3U30A 4F1SA 2J0MA 3PREA 4NAWA 4NAWB 3V62A 3IVFA 4W9CA 4PS7A 5CHVC 2K25A 2J0KA 1V80A 3LDZE 4NPNA 1WZ3A 4K7WA 3VTVA 4DK5A 3R7RA 1NBFC 2C9WB 4FHKA 4G50A 2CKHB 4JL9A 3A9KB 1GUAB 4WJQA 1GC7A 4BKTA 4K7UA 4A3OA 3VQIA 3ZNHB 2DZJA 3VH3B 2BYVE 3A4RA 5D7GA 3PPAA 4EEWA 2KWCA 1S1QB 2O6VA 3KUCB 4I6LB 2RD0A 4EZLA 2UWQA 1ZGUB 3QIJA 4IG7B 3SU8X 3O65B 1WR6E 3VUYA 3CMMB 3Q3JA 3WA0A 5C23A 2KLGA 4EZJA 3TJPA 3L13A 2GBKA 4CYEA 5BO4B 1Q1OA 1WH3A 4DHJB 2NR2A 2ZVNA 2K8BA 2HTHA 2LRWA 3OJ4B 2KWUB 2HD5B 2KJ6A 4CHKA 3KVFB 3MJWA 3V61A 1WGRA 4TUUA 1E90A 2DENB 2FCMA 2GBRA 2O2VB 4W9KA 3TBLD 2LJ5A 2V1YA 3CF6E 3JYUA 3DBHI 4PS3A 4WQOB 3UQBA 4W9DA 3ZVVA 3QARA 3DVNV 2JVCA 3ECIA 1RRBA 2O6VD 3OAWA 5E6PA 3QX1A 2XEWA 2N9PC 3T8MA 1UGMA 3H1UA 3VAWA 4GB9A 2KO3A 2W9NA 2KLCA 1OTRB 2JZ3B 2LUEA 4KZ0A 3QHTA 2WDTB 5JHAA 5CHWA 2KDFB 4PS8A 4WWPA 1WXSA 3ZNGC 4BBNC 3PZDA 3PHXB 1OGWA 1OEYA 5JH5C 1VCBA 2FAZA 4KSLC 4GGQA 5KHQA 3KW5B 3RUIB 2VRRB 4E3CA 3VTUA 4EFOA 2HE7A 2FIFA 1WY8A 2MW5A 1WRDB 1X1MA 4MH0E 4DXAB 1C1YB 4B9KA 4K7SA 4DBGA 3SHQA 3U8ZA 2RPQA 3R66C 4G0NB 3AXCA 2N4FA 4LJPB 4KDLB 2CHZA 2LGYA 4TV3A 3VXWA 4MGIE 2BF8B 3DQVA 2M8SA 1WGYA 1E5WA 2GBJA 5DPSA 3NY5A 1UZXB 1BT0A 3ZUNA 3HK0A 1ZW7A 2NCNA 1SIFA 3PRPB 2PE9A 4MSQB 2BYFA 1TBEA 1WMHA 5JZEB 2KTFA 1WFYA 2O2VA 1E8WA 4BKGA 4GN1A 3UGBB 2DX5B 3L08A 4GDLA 4I6NB 4FN2A 5E6NA 3WIMA 3RT3B 1LXDA 4GDKB 3BINA 1SGHA 2NVUI 4RM8A 4FBJB 4X57B 4DHZE 5JHBA 3A33B 2LGDA 2L76A 1E7UA 2C7MB 2HJ8A 5HKHA 2DAJA 2K6QA 4JGHB 2Y5BB 5LLIA 2O6VB 2KTRA 3L10B 4G11A 3RYTA 2DYBA 4IWQA 1RLFA 4MGKE 3W1SC 1EF5A 2RSUA 1V5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WAO A;  2QHO A;  1WI0 A;  5AZG A;  1TTN A;  3A9K A;  2FUH B;  1XT9 B;  2M1M A;  3HHM A;  4W9L A;  1I35 A;  4M0W B;  2MSE D;  2KFJ A;  3VUW A;  4OVU A;  2JF5 A;  3ZRF A;  5J18 A;  1LM8 B;  2ZCB A;  5GMV A;  3TL5 A;  3IBE A;  4A20 A;  1UD7 A;  3JSV B;  4EUT A;  1R4M I;  1GG3 A;  2EMT A;  1Z2M A;  4WWN A;  2N9X A;  4AP4 C;  3NS8 A;  5DPT A;  1SE9 A;  5KHO A;  2Z0D B;  3KH0 A;  3W1Y A;  3UIP B;  3PSE B;  3ZIM A;  4II3 B;  1UEL A;  1F9J A;  2LVO A;  2ZZP B;  4AWJ A;  1H4R A;  5L83 A;  3QWZ B;  1ZKH A;  4MJS B;  2BKF A;  3AI5 A;  3PTF C;  2GBN A;  1UBI A;  4FLH A;  4BKS A;  4GIV A;  1RFA A;  4FA6 A;  4IWO A;  2XK5 A;  3R7Q A;  1WXV A;  4FJZ A;  2LRU A;  2MBH A;  5C1Z A;  1NDD A;  4MGY E;  2JZZ A;  2MA9 B;  2ASQ A;  2KJR A;  4ANX A;  2M17 A;  4NQK E;  1KM7 A;  3UQA A;  3HM3 A;  4GOC A;  4B95 A;  4KV2 A;  2JRH A;  1VD2 A;  3MHS D;  3H7P A;  2NPT B;  4FHJ A;  1UH6 A;  2LVQ A;  4KIK A;  4PYU A;  2N1W A;  2OOB B;  4KVG B;  4WJO A;  3PV1 A;  3PS6 A;  2LZ6 A;  3EC8 A;  3RUL A;  4I6P A;  3B08 A;  4DDG D;  2FCS A;  1YIW A;  2I1J A;  1WIA A;  1TZ1 A;  1E8X A;  4OVV A;  1PQS A;  5G55 A;  2K39 A;  2LD9 A;  2JXX A;  2RGF A;  3K9P B;  5AZF A;  4W9F A;  2L7R A;  4EOY A;  3L54 A;  2CU1 A;  2KC1 A;  2G45 B;  3VHT C;  3WAL A;  2C7H A;  2MWS B;  1EO6 A;  2D3G A;  2JY6 A;  3A9J A;  4K81 A;  3RZF A;  4F7Z A;  1WF9 A;  1JRU A;  2KQS A;  2ZPY A;  2KVR A;  3R3M A;  3M62 B;  4IM0 A;  1V5O A;  3ZDT A;  4B6W A;  2IO0 B;  4ASW C;  1OEY J;  1V86 A;  2KDB A;  5G2N A;  2G4S A;  2LWP A;  2MP2 B;  3Q3F A;  3PT2 B;  2R2O A;  4MM3 A;  3H6N A;  2L3Z A;  3IFW B;  2A4Z A;  1Q0W B;  4DHJ D;  1U4A A;  4GMV A;  4IWP A;  3SDL C;  3ML8 A;  2CHX A;  3A1Q A;  2N7E A;  4M8M A;  4HCN B;  5DPW A;  2BYE A;  3A9J B;  1QZE A;  4KDI C;  2MBE A;  4N9F 4;  3DBS A;  2N9E B;  2KC2 A;  3H7S A;  3ML9 A;  4WWO A;  1UBQ A;  3RD2 A;  3APD A;  2GOW A;  1K8R B;  1Q5W B;  2UYZ B;  1J0G A;  2BGF A;  1XQQ A;  2PJH A;  2KFK A;  3JVZ X;  4IM3 A;  2DHZ A;  4HWI B;  1G6J A;  4FUL A;  3M3J A;  4ZRI A;  2ZPN A;  2R2Q A;  4FAD A;  2K8C A;  2IZV B;  3KUD B;  1WR1 A;  1YD8 U;  3QAQ A;  4FJV B;  3QQ8 B;  2LXA A;  2LI5 A;  3WAN A;  3ZNZ B;  1AAR A;  1C3T A;  3T9L A;  3I3T B;  2KX0 A;  2N1V A;  3DOW A;  3A4S C;  1KLV A;  2G3Q B;  2KMA A;  2I1K A;  2K8H A;  1IP9 A;  2MX2 A;  3JW0 X;  2YVC A;  4GSW A;  4CO7 A;  2KAN A;  3WAM A;  3NZU A;  3EFU A;  2KHW B;  1J19 A;  2FNJ B;  4W9J A;  3X0W A;  1YX6 B;  3TMP B;  4E71 A;  4LDT B;  4BKS D;  4F8C B;  3N32 A;  1YJ1 A;  4P7I A;  2AWT A;  5D94 A;  2L05 A;  1NI2 A;  1V2Y A;  2AEH A;  3KYC D;  2DZK A;  2ZJD A;  4HPL B;  5AZH A;  3U7D A;  4K1R B;  4ZDV A;  1D3Z A;  3NZS A;  4BOS C;  3ZW3 A;  4EZK A;  2K6D B;  4HDQ A;  1WX9 A;  3QCA A;  2D10 A;  4ICU A;  4NJ6 A;  2NS5 A;  3ZTD A;  3V6E B;  5J2R A;  1P98 A;  3PLV A;  3AU4 A;  1H8C A;  2AYO B;  1WJ6 A;  2FID A;  2L00 B;  5D6J B;  5FR6 A;  2C7N B;  3RCZ A;  3VUX A;  2KNB A;  3N3K B;  3QA8 A;  2NBW B;  4KIK B;  3AU5 A;  1WGH A;  2ZCC A;  2KXJ A;  2MLB A;  3GOE A;  3D32 A;  3NHE B;  4NQL B;  4RMA A;  5CTR C;  5L95 C;  2IY1 B;  4ICV A;  4PYZ A;  4ANU A;  1E8Z A;  2JWZ A;  2NBU A;  2OJR A;  4BOZ B;  1YQB A;  4MEL A;  4HJK A;  1WE6 A;  2AL6 A;  1GC6 A;  3L0W B;  4TQ1 A;  4ANW A;  5CHF A;  3PHW B;  4DWF A;  4E74 A;  3B1L X;  3PVL A;  4GDK A;  1RAX A;  2EKE C;  3ZTC A;  2Z59 B;  2D07 B;  4HCP B;  4AJW A;  4JIO U;  4HXD A;  3ONS A;  1HE8 A;  2WWZ A;  3QK0 A;  4DDI D;  1WXM A;  4IC7 B;  2FCQ A;  1IYF A;  1WMH B;  2L8J A;  2KK8 A;  4GXB A;  2LGX A;  4XZ4 A;  4MGZ E;  1WJ4 A;  3HM6 X;  2LXC A;  4HPM B;  2KD0 A;  3W1S A;  3VTW A;  1LQB A;  2MP2 A;  2BWE S;  3IHP C;  3DBR I;  3V60 A;  4JLC A;  4AUQ C;  4MEM A;  3TIX A;  3ZLZ A;  2KDE B;  3GZN I;  3CSF A;  5LXH A;  2IO1 B;  1TGZ B;  2J0J A;  4W9H A;  2KJH B;  2L0T A;  2JUO A;  5TR5 A;  4EKU A;  1WX7 A;  4WAA A;  3ALB A;  4BFR A;  1R4N I;  3ZRC A;  3PRZ A;  4LJO B;  1M94 A;  1MG8 A;  2XBB C;  4W9E A;  3APF A;  3ENE A;  3MTN B;  3EEC A;  1J8C A;  3DCG A;  4MSM B;  5DPR A;  4ZYN A;  1LFD A;  3BY4 B;  1E8Y A;  4IM2 A;  1WE7 A;  2KFK B;  2RR9 A;  2DYO A;  1P1A A;  4URK A;  1WM2 A;  4HVB A;  5J17 A;  1WZ0 A;  1WXA A;  2CR5 A;  3K9O B;  3P2B A;  4GDL B;  5DCN A;  2G4D B;  3L16 A;  4W9G A;  3C0R B;  3H7P B;  4M8N A;  3ZDM C;  3A1Q B;  2KKC A;  2DZM A;  1WGD A;  4II2 B;  4WJP A;  4AJY B;  5AEK B;  2J7Q B;  2KMC A;  2ZEQ A;  2IYD B;  3APC A;  1E7V A;  3N30 A;  1Y8R C;  1L2N A;  1V6E A;  2DAF A;  3X23 A;  3UIN B;  4WJN A;  2KDI A;  3VH4 B;  4TQ0 A;  2XK5 B;  2PEA A;  5IAA C;  3OJ3 A;  3V6C B;  5CX3 A;  1WGG A;  2KOX A;  2PE6 B;  4TKN A;  1A5R A;  2JT4 B;  1WJN A;  1WX8 A;  4MDK E;  4NY0 A;  3TCA A;  4A3P A;  2KZR A;  4G3X B;  3VDZ A;  2EMS A;  2REX A;  3PRM B;  4XC2 A;  2MQJ A;  3CST A;  1I42 A;  1Z5S B;  3ZO5 B;  3DDC B;  2BWF A;  4KSK C;  2KQ7 A;  1EF1 A;  2YLM A;  2ZVO A;  2NBV B;  4HLE A;  1CMX B;  2C60 A;  2D2Q A;  3DVN U;  2B3A A;  2K1F A;  2Z0E B;  3QC8 B;  2WX0 A;  4IW0 A;  4FJY A;  2BPS A;  2LAS A;  4IUM B;  3LJ3 A;  3B0A A;  4NNJ B;  5D2M B;  2DZI A;  1KOT A;  4BVU C;  3ZNI D;  4GU2 A;  1WJU A;  2LVP A;  2CS4 A;  2JRI B;  2MRP A;  3QJZ A;  4W9I A;  4DHZ B;  3L17 A;  2KWV B;  2KTR B;  5IA7 A;  1EUV B;  3DVG Y;  5E6O A;  4YL8 A;  1V81 A;  2C5L C;  4BBN F;  2GMI C;  2A5U A;  4ZRK A;  3UF8 A;  3AUL A;  3ZKJ C;  3JSV A;  3DBL I;  3WAP A;  2FCN A;  2ZNV C;  1FXT B;  1P3Q U;  3EHV A;  2N7D A;  2BKR B;  2IO2 B;  2L0F A;  2M0X A;  4KZC A;  4NJ7 A;  1KJT A;  4ZRJ A;  3H9D A;  4JQW C;  2V3S A;  4MJS A;  5EDS A;  2KN5 A;  3KYD D;  2AL3 A;  1V49 A;  3PLU A;  2NPT A;  3UIO B;  2M4N A;  2IO3 B;  2IY0 B;  3RZW C;  1L7Y A;  1WM3 A;  2D11 A;  1T0Y A;  2MBO A;  4ANV A;  2WX1 A;  1P0R A;  3HIZ A;  3DVG X;  1GJZ A;  2CHW A;  2DYM A;  3DPD A;  1IPG A;  1ISN A;  3KUZ A;  4J6I A;  3SD5 A;  2GBM A;  2MBQ A;  2WYQ A;  4XX5 A;  1WYW B;  2PPH A;  4HK2 A;  4LDT D;  3M95 A;  4LCD E;  1V9J A;  2JPH A;  2ZNV B;  3PGE A;  4HDO A;  2MCN B;  1S3S G;  3IG3 A;  3M63 B;  2MBB B;  3VFK A;  2IBI B;  3S2A A;  3OLM D;  3NOB A;  1YX5 B;  1P9D U;  2V4L A;  3VVW B;  5LXI B;  4AOF A;  4RM9 A;  1OQY A;  1XD3 B;  2KX3 A;  1GNU A;  3U30 A;  4F1S A;  2J0M A;  3PRE A;  4NAW A;  4NAW B;  3V62 A;  3IVF A;  4W9C A;  4PS7 A;  5CHV C;  2K25 A;  2J0K A;  1V80 A;  3LDZ E;  4NPN A;  1WZ3 A;  4K7W A;  3VTV A;  4DK5 A;  3R7R A;  1NBF C;  2C9W B;  4FHK A;  4G50 A;  2CKH B;  4JL9 A;  3A9K B;  1GUA B;  4WJQ A;  1GC7 A;  4BKT A;  4K7U A;  4A3O A;  3VQI A;  3ZNH B;  2DZJ A;  3VH3 B;  2BYV E;  3A4R A;  5D7G A;  3PPA A;  4EEW A;  2KWC A;  1S1Q B;  2O6V A;  3KUC B;  4I6L B;  2RD0 A;  4EZL A;  2UWQ A;  1ZGU B;  3QIJ A;  4IG7 B;  3SU8 X;  3O65 B;  1WR6 E;  3VUY A;  3CMM B;  3Q3J A;  3WA0 A;  5C23 A;  2KLG A;  4EZJ A;  3TJP A;  3L13 A;  2GBK A;  4CYE A;  5BO4 B;  1Q1O A;  1WH3 A;  4DHJ B;  2NR2 A;  2ZVN A;  2K8B A;  2HTH A;  2LRW A;  3OJ4 B;  2KWU B;  2HD5 B;  2KJ6 A;  4CHK A;  3KVF B;  3MJW A;  3V61 A;  1WGR A;  4TUU A;  1E90 A;  2DEN B;  2FCM A;  2GBR A;  2O2V B;  4W9K A;  3TBL D;  2LJ5 A;  2V1Y A;  3CF6 E;  3JYU A;  3DBH I;  4PS3 A;  4WQO B;  3UQB A;  4W9D A;  3ZVV A;  3QAR A;  3DVN V;  2JVC A;  3ECI A;  1RRB A;  2O6V D;  3OAW A;  5E6P A;  3QX1 A;  2XEW A;  2N9P C;  3T8M A;  1UGM A;  3H1U A;  3VAW A;  4GB9 A;  2KO3 A;  2W9N A;  2KLC A;  1OTR B;  2JZ3 B;  2LUE A;  4KZ0 A;  3QHT A;  2WDT B;  5JHA A;  5CHW A;  2KDF B;  4PS8 A;  4WWP A;  1WXS A;  3ZNG C;  4BBN C;  3PZD A;  3PHX B;  1OGW A;  1OEY A;  5JH5 C;  1VCB A;  2FAZ A;  4KSL C;  4GGQ A;  5KHQ A;  3KW5 B;  3RUI B;  2VRR B;  4E3C A;  3VTU A;  4EFO A;  2HE7 A;  2FIF A;  1WY8 A;  2MW5 A;  1WRD B;  1X1M A;  4MH0 E;  4DXA B;  1C1Y B;  4B9K A;  4K7S A;  4DBG A;  3SHQ A;  3U8Z A;  2RPQ A;  3R66 C;  4G0N B;  3AXC A;  2N4F A;  4LJP B;  4KDL B;  2CHZ A;  2LGY A;  4TV3 A;  3VXW A;  4MGI E;  2BF8 B;  3DQV A;  2M8S A;  1WGY A;  1E5W A;  2GBJ A;  5DPS A;  3NY5 A;  1UZX B;  1BT0 A;  3ZUN A;  3HK0 A;  1ZW7 A;  2NCN A;  1SIF A;  3PRP B;  2PE9 A;  4MSQ B;  2BYF A;  1TBE A;  1WMH A;  5JZE B;  2KTF A;  1WFY A;  2O2V A;  1E8W A;  4BKG A;  4GN1 A;  3UGB B;  2DX5 B;  3L08 A;  4GDL A;  4I6N B;  4FN2 A;  5E6N A;  3WIM A;  3RT3 B;  1LXD A;  4GDK B;  3BIN A;  1SGH A;  2NVU I;  4RM8 A;  4FBJ B;  4X57 B;  4DHZ E;  5JHB A;  3A33 B;  2LGD A;  2L76 A;  1E7U A;  2C7M B;  2HJ8 A;  5HKH A;  2DAJ A;  2K6Q A;  4JGH B;  2Y5B B;  5LLI A;  2O6V B;  2KTR A;  3L10 B;  4G11 A;  3RYT A;  2DYB A;  4IWQ A;  1RLF A;  4MGK E;  3W1S C;  1EF5 A;  2RSU A;  1V5T A; 
#chains in the Genus database with same CATH topology
 4YT0 B;  2FUH B;  3HHM A;  1I35 A;  2KFJ A;  3VUW A;  3U52 E;  3TL5 A;  1L4D B;  1UD7 A;  1R4M I;  2EMT A;  1Z2M A;  2N9X A;  1SJH D;  1QT9 A;  4A6Q A;  3UIP B;  1F9J A;  1HZ6 A;  1ZKH A;  4MJS B;  1UBI A;  4FLH A;  4BKS A;  3R7Q A;  2FUG 1;  2JZZ A;  1BXT A;  4YSY B;  2M17 A;  1P7E A;  1JML A;  1KM7 A;  3UQA A;  1EU3 A;  1EM7 A;  4FXC A;  1HZ5 A;  1FFU A;  1AN8 A;  3RUL A;  4I6P A;  4AQ7 A;  1E8X A;  4P1C C;  2LD9 A;  3OWE B;  3K9P B;  2X38 A;  2L7R A;  3VHT C;  2KC1 A;  3WAL A;  2AQ1 B;  4K81 A;  3RZF A;  1WF9 A;  2M0A A;  3R3M A;  2KVR A;  4B6W A;  2J4X A;  1OQQ A;  2IO0 B;  1V86 A;  3LXF A;  3AED B;  2KDB A;  2JX5 A;  3IFW B;  3C19 A;  4IWP A;  4XGA B;  2CHX A;  4HCN B;  1HQR D;  1MHX A;  3A9J B;  3ZQ4 A;  4KDI C;  2N9E B;  3ML9 A;  3RD2 A;  3APD A;  4JX1 C;  2WXG A;  2Q5W D;  3M3J A;  4ZRI A;  2IZV B;  4M00 A;  1C3T A;  3Q69 A;  1MVK A;  1KLV A;  2KMA A;  1IP9 A;  1QQR A;  3FIL B;  1SEB D;  3RMK C;  4GSW A;  1FIQ A;  4MM3 B;  1SE3 A;  1J19 A;  4W9J A;  1NVI D;  3URY A;  4E71 A;  4BKS D;  1C4P A;  1V1P A;  5D94 A;  3BK2 A;  1F2R C;  4HPL B;  2DZK A;  2ZJD A;  3U7D A;  5BMI A;  3NZS A;  4HDQ A;  4A8X C;  1WX9 A;  2ACZ B;  2D10 A;  1V97 A;  1FNV A;  3V3X A;  3ABV B;  3V6E B;  4WUR A;  3RCZ A;  1N61 A;  2KNB A;  3N3K B;  3I9V 1;  3AU5 A;  2QC8 A;  1C9F A;  3W9C B;  3NS1 A;  2MLB A;  5CTR C;  4NQL B;  4BAX A;  2BB6 A;  5L95 C;  1ZXH A;  2IY1 B;  4ANU A;  1E0Z A;  2OJR A;  2KDM A;  3RI7 C;  2B76 B;  2JQR B;  4MEL A;  1WE6 A;  1GC6 A;  3L0W B;  3PHW B;  1ROE A;  3N1Y C;  3B1L X;  3AEB B;  3AE1 B;  2EKE C;  4RCO A;  4WQM A;  3AE5 B;  4KGS A;  1TIF A;  4RGO S;  1JWM D;  2EEL A;  1WMH B;  4XZ4 A;  3P42 A;  2LXC A;  4HPM B;  3U7Z A;  3ETR A;  2MP2 A;  3IHP C;  4ZOH C;  3ZLZ A;  5TR5 A;  1TGZ B;  1DOX A;  2KYW A;  2JUO A;  1GB4 A;  4XWT A;  1WX7 A;  1HTQ A;  4BFR A;  1FO4 A;  3ZRC A;  1MG8 A;  3DHG C;  3RNF C;  1J8C A;  3DCG A;  1NYR A;  2BYT A;  1WE7 A;  2JYT A;  3GE3 C;  4URK A;  1J7C A;  4HVB A;  2WU2 B;  5J17 A;  1WZ0 A;  3P2B A;  5DCN A;  3N1Z C;  3MHZ A;  3EA6 A;  3C0R B;  3H7P B;  3O13 A;  1WGD A;  4AJY B;  2DNF A;  2KQ4 X;  3APC A;  2K0P A;  2DAF A;  1IGD A;  5CX3 A;  4OZC A;  4C4V A;  2JT4 B;  4MAC A;  1WX8 A;  4MDK E;  3AE9 B;  1I4G A;  4AS1 A;  4R3D A;  1YN3 A;  2EMS A;  3PRM B;  3DHH C;  2W3S A;  3C8Y A;  1Z5S B;  3SFE B;  4XDD A;  3DDC B;  1YQ4 B;  4LNO A;  1TS2 A;  1EF1 A;  3IT6 B;  2NBV B;  4HLE A;  1SBB B;  2B3A A;  2Z0E B;  2J42 A;  5BYQ A;  2BPS A;  2LAS A;  5D2M B;  4NNJ B;  1KOT A;  2DZI A;  3ZNI D;  4OW0 A;  4W9I A;  4DHZ B;  3L17 A;  2KTR B;  1KRH A;  4YXD B;  5IA7 A;  4YL8 A;  2WXQ A;  2VH1 A;  2BKR B;  2N7D A;  2L0F A;  3RNG C;  3H9D A;  4MJS A;  3KYD D;  4YTN B;  2SAK A;  3PLU A;  3KWL A;  2M56 B;  2IO3 B;  3RZW C;  1L7Y A;  1WM3 A;  1P0R A;  2DYM A;  2GBM A;  1TZO A;  1WYW B;  2PPH A;  4HK2 A;  1V9J A;  1L6U A;  3PGE A;  4M01 A;  3ZXR A;  5IN7 A;  1QKZ A;  1JAL A;  1GNU A;  4F1S A;  5CHV C;  3FKY A;  1V80 A;  4DK5 A;  4JL9 A;  4WAF A;  1DOY A;  2WXI A;  4NZL B;  3VH3 B;  2LHD A;  5D7G A;  4I6L B;  2RD0 A;  2H89 B;  1PYW D;  3PO0 A;  2UWQ A;  2K9X A;  3O65 B;  4US8 A;  2KLG A;  4CYE A;  3LYY A;  5TSS A;  1WXQ A;  2K8B A;  2V9H A;  2HTM E;  2LRW A;  3KVF B;  1KH0 A;  1E90 A;  2G1E A;  2GBR A;  2ON8 A;  2LJ5 A;  2V1Y A;  3DBH I;  1TS5 A;  3ZVV A;  3QX1 A;  2CJN A;  1UNS A;  2XEW A;  2DLB A;  4YTM B;  3H1U A;  4BZA A;  2V3P A;  2LUE A;  2OED A;  2WDT B;  3QHT A;  4PS8 A;  4WWP A;  4BBN C;  3KQ4 A;  2K22 A;  3PHX B;  1OEY A;  2KAJ A;  5JH5 C;  2FAZ A;  2MJD A;  1HTO A;  1QOF A;  1WWT A;  3ZJU A;  3RUI B;  1FXI A;  2FBW B;  4EFO A;  2HE7 A;  1WY8 A;  2FIF A;  2MW5 A;  2BB5 A;  4DXA B;  3RNB C;  1SXT A;  2DWQ A;  4DXG A;  2N4F A;  4KDL B;  4O1N A;  4TV3 A;  1B1Z A;  2WXL A;  3AEE B;  4PK1 A;  1E5W A;  2GBJ A;  3NY5 A;  1BT0 A;  3ZUN A;  1JRO A;  3P4Q B;  1K50 A;  1LGR A;  5JZE B;  2NMQ A;  4BKG A;  3J9C A;  3N9Y C;  4GN1 A;  3UGB B;  2AX5 A;  1XF5 L;  4NJC A;  3KLS X;  4GDK B;  3AEA B;  1SGH A;  4K3C A;  2N9K A;  1L5P A;  4FBJ B;  5JHB A;  1UF0 A;  2LGD A;  2L76 A;  1E7U A;  2HJ8 A;  2K6Q A;  2O6V B;  1K52 A;  2KTR A;  3W1S C;  5EE3 A;  2IND C;  2QHO A;  3A9K A;  1F77 A;  3E56 A;  3CIR B;  2MSE D;  4LTU A;  4YSX B;  5D3D A;  4OVU A;  5J18 A;  4A20 A;  2D3A A;  3IBE A;  2L1A A;  3JSV B;  2PKO A;  1TS4 A;  1HA5 A;  4AP4 C;  2IPK D;  3NS8 A;  5DPT A;  1SE9 A;  5KHO A;  1OQR A;  3KH0 A;  3W1Y A;  3PSE B;  1UEL A;  5L83 A;  2R61 A;  3QWZ B;  2BKF A;  1SB3 C;  3PZ7 A;  4FA6 A;  4A55 A;  4MGY E;  2KJR A;  1JWA D;  3KWV A;  3HM3 A;  4B95 A;  1VD2 A;  3H7P A;  5FKA C;  2WP9 B;  1T0S C;  4P16 A;  4WJO A;  3PS6 A;  1I4X A;  2AQ2 B;  1E6E B;  3AMZ A;  2L52 A;  2KT7 A;  2C7H A;  2MWS B;  2PIA A;  2JY6 A;  1KLG D;  2KQS A;  2ZPY A;  1PGX A;  2GRI A;  2QIE B;  1E10 A;  2G4S A;  2LWP A;  2MP2 B;  3ZXV A;  4MM3 A;  3PT2 B;  2R2O A;  3H6N A;  1Q0W B;  3RNA C;  3SDL C;  3A1Q A;  4M8M A;  2IDY A;  2JXT A;  2WXR A;  4JWS C;  3DBH B;  2LGS A;  4WWO A;  2GOW A;  2UYZ B;  4EE2 A;  4ZRQ A;  2PJH A;  3Q3M C;  2KFK A;  2PTL A;  1R4M B;  3AE6 B;  3BVM A;  1YD8 U;  3WAN A;  3TUO A;  3ZNZ B;  2N1V A;  3DOW A;  1QIL A;  2I1K A;  2E3T A;  3IXS A;  3Q8C A;  2KHW B;  3OG5 A;  2FNJ B;  3X0W A;  1YX6 B;  2LGI A;  4P7I A;  2L05 A;  2BS4 B;  5IOI A;  2YEP F;  2WXF A;  3NVY A;  4EZK A;  1FEH A;  2RDH A;  4ICU A;  3GS2 A;  2NS5 A;  3AM9 A;  3ZTD A;  3Q14 C;  5J2R A;  3AU4 A;  2AYO B;  3B9J A;  2E6X A;  3VUX A;  4HEA 1;  2NBW B;  1KTK A;  4WIP A;  3Q8A A;  2KXJ A;  3NHE B;  3HUI A;  1FNU A;  4ICV A;  4RGN A;  4PYZ A;  1JWS D;  2Y5C A;  2NBU A;  1YQB A;  3TEY A;  5CHF A;  1FMA D;  2VZK B;  3PVL A;  4GDK A;  3VR9 B;  3P4R B;  2D07 B;  4HCP B;  4HXD A;  2WXJ A;  2WWZ A;  3QK0 A;  1C77 A;  1EU4 A;  4QAY A;  2QCZ A;  1IYF A;  2L32 A;  1NEK B;  4P6V F;  4MGZ E;  3HM6 X;  1STE A;  5HI1 A;  2WS3 B;  4EKU A;  3BII D;  2KJH B;  1N62 A;  4WAA A;  1HXY D;  3PRZ A;  4W9E A;  3APF A;  3ENE A;  3MTN B;  4RF0 A;  4MSM B;  1FRR A;  1E8Y A;  4IM2 A;  1BUI C;  3R8B A;  2DYO A;  4ZHP A;  1L6V A;  1T0Q C;  2G4D B;  3ZDM C;  2KWD A;  4WJP A;  3MFG A;  2IYD B;  1YJI A;  3X23 A;  3UIN B;  2IGG A;  4TQ0 A;  2WDV B;  1GB1 A;  1E7P B;  1A5R A;  1WJN A;  3TCA A;  5GXG B;  2MQJ A;  2BBC A;  1MG4 A;  5EE1 A;  5BYS A;  2BWF A;  2KQ7 A;  2PLP A;  1SE2 A;  2YLM A;  2ZVO A;  3FAH A;  2D2Q A;  2K1F A;  3Q6B A;  2WX0 A;  4IUM B;  1ZP0 B;  3GZN B;  3B0A A;  3LJ3 A;  3ZGZ A;  1D4B A;  4GU2 A;  3QJZ A;  1ZXI A;  1EUV B;  5FK9 C;  4BBN F;  1FCC C;  2W54 A;  4DHJ B;  2FCN A;  1FXT B;  4A3P A;  4NJ7 A;  4ZRJ A;  1KJT A;  1BML C;  4JQW C;  2V3S A;  4KGR A;  2KN5 A;  2M19 A;  3I57 A;  2AL3 A;  2NPT A;  4OHJ A;  3UIO B;  1T0Y A;  1SF0 A;  4HKZ E;  4J6I A;  2G9H D;  2MBQ A;  1ACC A;  1WRI A;  4LCD E;  3M95 A;  2ZNV B;  2ZW0 A;  3RNE C;  4HDO A;  1S3S G;  4C00 A;  1T6B X;  2QEJ C;  3VFK A;  4YSZ B;  3AH7 A;  1YX5 B;  3P4P B;  3NUH B;  3VVW B;  3DWM A;  4AOF A;  1XD3 B;  3AV8 A;  3U30 A;  2J0M A;  4NAW A;  1N63 A;  2K25 A;  3LDZ E;  4NPN A;  3R7R A;  2C9W B;  4WJQ A;  4BKT A;  4K7U A;  2Z8L A;  5H8Y E;  3VQI A;  3ZNH B;  2BYV E;  3MC0 B;  1RYJ A;  3KUC B;  1P7F A;  3VUY A;  1ZGU B;  3SU8 X;  4IG7 B;  2UU7 A;  1UWX A;  5C23 A;  1YOV B;  2GLS A;  1ENF A;  4B0M A;  2HTH A;  2KWU B;  2HD5 B;  2Y3A A;  3MJW A;  4XDC A;  2K3U A;  3TBL D;  4W9K A;  4DQO C;  4PS3 A;  3JYU A;  3Q3N C;  4C4V B;  3QAR A;  2OJW A;  1UGM A;  2WDQ B;  4XWW A;  2W9N A;  2QMT A;  2KLC A;  4KZ0 A;  1ZDX A;  5JHA A;  1N6Z A;  3ZNG C;  1CQV A;  2MJE A;  4KSL C;  4YWG G;  4GGQ A;  3ZJV A;  1R7S A;  2WNM A;  4ARC A;  3MJ5 A;  2VRR B;  2GI9 A;  4E3C A;  4PT5 A;  1X1M A;  4MH0 E;  2I2Y A;  3TEX A;  1C1Y B;  2RPQ A;  3R66 C;  3AXC A;  5LNK 1;  2CHZ A;  2LGY A;  5IP4 D;  3VXW A;  1ZPS A;  2M8S A;  4OZA A;  4M02 A;  1UZX B;  2NCN A;  1SIF A;  2PE9 A;  4MSQ B;  1WMH A;  1TKE A;  5MPO A;  1I4P A;  3W2D A;  2DX5 B;  2KMM A;  3WIM A;  1UWM A;  5HG2 A;  3BIN A;  3BVG A;  4X57 B;  2DAJ A;  3B2F A;  2INP E;  4WWM A;  4G11 A;  2DYB A;  3AN1 A;  1RLF A;  2JYE A;  4MGK E;  4C7Z A;  1WI0 A;  1XT9 B;  2M1M A;  4W9L A;  1YNT E;  4M0W B;  3TEW A;  1C4A A;  4D2K A;  3ZRF A;  1LM8 B;  2ZCB A;  4N58 A;  3U2S C;  1FPY A;  4L2Y A;  1GG3 A;  1XXG A;  1RM6 C;  1TT5 B;  2LFI A;  3NVV A;  3HVZ A;  1A70 A;  2LVO A;  3AI5 A;  4MT5 A;  1C4C A;  4JPS A;  3AEF B;  1MHH E;  1RFA A;  3Q2A C;  4IWO A;  4FJZ A;  2LRU A;  5C1Z A;  1D5Z C;  1J7B A;  2MA9 B;  2ASQ A;  4ANX A;  4NQK E;  4GOC A;  4KV2 A;  2JRH A;  1C76 A;  4ITK A;  2NPT B;  4FHJ A;  4JWU C;  1UH6 A;  2L83 A;  2LVQ A;  2PVO D;  2LZ6 A;  3EC8 A;  5AUI A;  2FCS A;  1YIW A;  2I1J A;  1WIA A;  1TZ1 A;  2HJ1 A;  2WXM A;  4C7Y A;  5G55 A;  4C56 C;  5AZF A;  4W9F A;  4EOY A;  2CU1 A;  2G45 B;  1IGC A;  2D3G A;  3A9J A;  1VJK A;  1JRU A;  2KVZ A;  4ARI A;  3M62 B;  4IM0 A;  3SR6 A;  4ASW C;  1QOA A;  1OEY J;  5G2N A;  2L3Z A;  3PZ8 A;  1U4A A;  3ML8 A;  1R4N B;  1ZUD 2;  1PUT A;  2MBE A;  1F0Z A;  2KC2 A;  3BYY B;  3H7S A;  4REZ A;  1UBQ A;  4DXF A;  1GPX A;  1K8R B;  1Q5W B;  2BGF A;  2J53 A;  1XQQ A;  4IM3 A;  2DHZ A;  4HWI B;  5BMH A;  4US9 A;  5E6J A;  2RMM A;  1WR1 A;  3QQ8 B;  1AAR A;  3AE3 B;  1MPE A;  4TMA B;  3T9L A;  3A4S C;  3GE8 C;  2G3Q B;  2K8H A;  1WGK A;  2MX2 A;  3JW0 X;  2YVC A;  3NVW A;  2KAN A;  1ZE3 D;  2RPV A;  2K5P A;  3N32 A;  1YJ1 A;  3H8H A;  3R2T A;  4XE0 A;  2AEH A;  1YMH E;  2SEB D;  4ZDV A;  4LNF A;  4BOS C;  1N60 A;  1SJE D;  3QCA A;  1YN5 A;  1CK1 A;  1I4R A;  3Q8E A;  3AE2 B;  5I4D A;  1YJJ A;  1DYQ A;  1CZP A;  2LUM A;  2C7N B;  4KIK B;  3QA8 A;  2WXN A;  1WGH A;  2ZCC A;  3DBR B;  1D5X C;  1JWU D;  3D32 A;  3GOE A;  5HFY A;  4RMA A;  4CQN A;  4KGT A;  1XLP A;  4WH4 A;  2FE8 A;  2LEK A;  3Q3O C;  3B2G A;  1VZ7 A;  2JWZ A;  3Q8F A;  4HJK A;  1F52 A;  1J7A A;  2AL6 A;  4TQ1 A;  4ANW A;  1RAX A;  3ZTC A;  1MFW A;  1IBX A;  4IC7 B;  2FCQ A;  4N59 A;  2LGX A;  2KD0 A;  3W1S A;  4OZB A;  1LQB A;  2BWE S;  1GAQ B;  4MEM A;  1HEZ E;  2KDE B;  3CSF A;  2IO1 B;  2L0T A;  4S17 A;  3ALB A;  1E9M A;  1M94 A;  1ZDV A;  2JWU A;  5JXV A;  5DPR A;  4RFB A;  1LFD A;  3IAS 1;  2W3R A;  2QJL A;  3EUB 2;  2OHF A;  1WXA A;  1XCT L;  3K9O B;  4GDL B;  5EE0 A;  3L16 A;  4W9G A;  3VRA B;  2KKC A;  1KF6 B;  2DBY A;  4HRO A;  2J7Q B;  2KMC A;  2ZEQ A;  3NZ3 A;  1L2N A;  1Q10 A;  1V6E A;  3U4E G;  4WJN A;  2KDI A;  4LNN A;  3VH4 B;  2XK5 B;  1I4Q A;  2BW2 A;  5IAA C;  3V6C B;  1M4V A;  4UDU C;  4TKN A;  1VZ8 A;  1NYQ A;  1NEN B;  4NY0 A;  2ICI A;  4G3X B;  3VDZ A;  2BS3 B;  2REX A;  1I42 A;  3CST A;  3ZO5 B;  2HDE A;  1L0V B;  3AEG B;  3QC8 B;  1CMX B;  2C60 A;  3DVN U;  4IW0 A;  2NTT A;  1JQ4 A;  4BVU C;  2CS4 A;  2JRI B;  2MRP A;  2KN4 A;  1PGB A;  3DWG C;  2WXK A;  2JSV X;  5E6O A;  1V81 A;  2V4I B;  2GMI C;  3AUL A;  1TY2 A;  3VR8 B;  3DBL I;  3MC9 A;  3WAP A;  3EHV A;  2ZNV C;  3BYT B;  4KZC A;  4M0W A;  5EDS A;  1IUE A;  2D3C A;  4HJG E;  5AUK A;  2WXP A;  4USA A;  1PDX A;  2RDG A;  2IY0 B;  2MBO A;  2WX1 A;  1F2R I;  1GJZ A;  2CHW A;  3DPD A;  3I63 C;  3KUZ A;  4JE3 B;  5EE9 A;  4LNI A;  4LDT D;  2N9L A;  2MCN B;  2IBI B;  3S2A A;  1P9D U;  2MEK A;  4RM9 A;  2KX3 A;  1V1P B;  1QLB B;  4H2A A;  3V62 A;  3IVF A;  4W9C A;  4PS7 A;  2V3N A;  1WZ3 A;  1TY0 A;  3VTV A;  1NBF C;  3A9K B;  1GUA B;  1OFF A;  3SFD B;  2DZJ A;  3VRB B;  2KWC A;  2O6V A;  1JWB D;  3QIJ A;  2LHE A;  3AB5 A;  1WR6 E;  3Q3J A;  1XLO A;  5BO4 B;  1C78 A;  1Q1O A;  4P1B C;  1FFV A;  1NI3 A;  2ZVN A;  3WCQ A;  3OJ4 B;  1TYG B;  2KJ6 A;  4CHK A;  4LLG M;  3V61 A;  1L4Z B;  4TUU A;  2FCM A;  3T3O A;  3CF6 E;  4WQO B;  4A9A A;  4W9D A;  3DVN V;  3ECI A;  3OAW A;  2IGD A;  3T8M A;  3VAW A;  2W55 A;  4OVZ A;  5IKC M;  1OTR B;  3V05 A;  5CHW A;  2H88 B;  3AE8 B;  1WXS A;  3PZD A;  1VCB A;  5KHQ A;  3KW5 B;  5IO9 A;  2LMC A;  3GB1 A;  3VTU A;  1WRD B;  1ET6 A;  1RFK A;  4RGM A;  5H92 C;  1TKG A;  4IDI A;  2YEP B;  4B9K A;  4K7S A;  3ZJT A;  2BS2 B;  4LJP B;  2J52 A;  3NVZ A;  2CJO A;  1VRA B;  4MGI E;  1VLB A;  2BF8 B;  3DQV A;  2WQY B;  2WXH A;  1ZW7 A;  1VDV A;  3PRP B;  1TBE A;  2D3B A;  2KTF A;  1WFY A;  1E8W A;  1DOI A;  4GDL A;  5E6N A;  4FN2 A;  4ZYS A;  3BK1 A;  2NVU I;  4RM8 A;  1TKY A;  3T3N A;  3A33 B;  2V0G A;  1Y56 A;  2C7M B;  2WGS A;  4RNA A;  2Y5B B;  5D3I B;  5LLI A;  2AQ3 B;  4IWQ A;  1EF5 A;  2RSU A;  1V5T A;  3WAO A;  1L0X B;  5AZG A;  1TTN A;  2MHJ A;  2JF5 A;  5GMV A;  4EUT A;  2N7J A;  4KKI A;  4WWN A;  1D5M C;  2Z0D B;  3ZIM A;  1EWY C;  4GLS C;  1N5X A;  2ZZP B;  4II3 B;  4A90 A;  4AWJ A;  1H4R A;  5G5G A;  3PTF C;  2GBN A;  4GIV A;  2XK5 A;  1WXV A;  2MBH A;  1NDD A;  1AWD A;  3L4P A;  3P1M A;  3MHS D;  3HVD A;  1YQ3 B;  3LB8 C;  4KIK A;  2WXO A;  4PYU A;  2N1W A;  2OOB B;  4KVG B;  1ESF A;  3PV1 A;  2BT6 A;  1K53 A;  3B08 A;  4DDG D;  5HHD G;  4OVV A;  1PQS A;  2INN E;  2K39 A;  2JXX A;  2RGF A;  1FCL A;  4HKQ A;  3L54 A;  1EO6 A;  4F7Z A;  3EFC A;  3DBL B;  3ZDT A;  1TJE A;  1V5O A;  1QF6 A;  3Q3F A;  4B0E A;  1LO5 D;  2A4Z A;  4DHJ D;  4NAM A;  4GMV A;  2I38 A;  4RH6 A;  2N7E A;  5DPW A;  2BYE A;  3CWI A;  1QZE A;  4N9F 4;  1IBX B;  3DBS A;  1DGJ A;  3W5U B;  1J0G A;  3SEB A;  1FXA A;  3JVZ X;  2ZW1 A;  1G6J A;  4FUL A;  2ZPN A;  2R2Q A;  4FAD A;  2K8C A;  4ACF A;  1F1H A;  3KUD B;  3QAQ A;  4FJV B;  2LXA A;  2LI5 A;  2PVG C;  3I3T B;  2KX0 A;  1QOG A;  2BTE A;  4L23 A;  3AE7 B;  1ET9 A;  4IOI E;  4CO7 A;  3WAM A;  5G5H A;  3NZU A;  3EFU A;  1UGJ A;  1SIJ A;  3TMP B;  4LDT B;  3NJT A;  4F8C B;  3NRZ A;  2AWT A;  3I5J C;  1NI2 A;  1V2Y A;  2QIL A;  2X8X X;  3KYC D;  1D3Z A;  5AZH A;  3MC8 A;  4K1R B;  3ZW3 A;  1L0Y B;  2K6D B;  1XLN A;  3AE4 B;  5C3J B;  4NJ6 A;  1FRD A;  1P98 A;  3PLV A;  1H8C A;  1WJ6 A;  2FID A;  2L00 B;  4TSS A;  5D6J B;  4HRS A;  5FR6 A;  3UI3 A;  1TS3 A;  3RNC C;  2XNA C;  3P4S B;  4ZRP A;  5T8I A;  1XO3 A;  1T3Q A;  2IJ0 A;  1E8Z A;  1AYF A;  4BOZ B;  4DWF A;  3TSS A;  4E74 A;  2Z59 B;  4AJW A;  4JIO U;  3ONS A;  1HE8 A;  4LK0 M;  4DDI D;  1WXM A;  2L8J A;  2KK8 A;  1I4H A;  4GXB A;  3P63 A;  1WJ4 A;  2XN9 C;  1T0R C;  3VTW A;  2VZK D;  3DBR I;  2Y5P A;  3V60 A;  4JLC A;  4AUQ C;  3TIX A;  3GZN I;  5LXH A;  2J0J A;  3W5V B;  4W9H A;  1R4N I;  4LJO B;  2XBB C;  3EEC A;  3RFZ B;  4ZYN A;  1MI0 A;  1UUP A;  1XLQ A;  3BY4 B;  2KFK B;  1XCQ L;  2RR9 A;  1P1A A;  3N1X C;  1WM2 A;  2PMV A;  3N20 C;  2MH7 A;  1GOZ A;  2CR5 A;  1FD6 A;  4M8N A;  1PGA A;  1SE4 A;  3A1Q B;  4II2 B;  2DZM A;  5AEK B;  1RWS A;  1E7V A;  3N30 A;  1Y8R C;  2D5G A;  1AW7 A;  3BZD B;  2PEA A;  3OJ3 A;  1WGG A;  2KOX A;  2PE6 B;  2TSS A;  1V1O A;  1WSP A;  1ZOY B;  2KZR A;  5BYR A;  5FR3 A;  2W82 A;  4XC2 A;  2WU5 B;  4XYC A;  4KSK C;  4N6E B;  4FJY A;  4YTP B;  1V8C A;  1WJU A;  2LVP A;  3IT4 B;  2KWV B;  1T5X D;  3DVG Y;  2C5L C;  2A5U A;  4ZRK A;  3UF8 A;  3ZKJ C;  3JSV A;  2ONQ A;  1P3Q U;  2IO2 B;  1YN4 A;  2M0X A;  2N0S B;  1V49 A;  2M4N A;  3FIL A;  3FC4 A;  2D11 A;  3BWU D;  4ANV A;  1N5W A;  3DVG X;  3HIZ A;  3NG0 A;  1QOB A;  1IPG A;  1ISN A;  1CJE A;  3SD5 A;  2WYQ A;  2BVC A;  4XX5 A;  4KKJ A;  1JRP A;  2JPH A;  4KX6 B;  2MJ3 A;  3MP9 A;  3IG3 A;  3M63 B;  2MBB B;  3GP7 A;  5BMG A;  3OLM D;  3NOB A;  4C80 A;  1KFY B;  2V4L A;  5LXI B;  1OQY A;  3PRE A;  4NAW B;  2NTS A;  2J0K A;  2JZP A;  4K7W A;  4FHK A;  4G50 A;  2CKH B;  2CU3 A;  3EGR A;  1GC7 A;  4A3O A;  3A4R A;  4EEW A;  3PPA A;  1S1Q B;  1MJD A;  4EZL A;  1FM0 D;  3CMM B;  3WA0 A;  1XEE A;  3TEZ A;  4EZJ A;  3TJP A;  3L13 A;  2GBK A;  3R2I A;  1WH3 A;  4IKG A;  2NR2 A;  1WYG A;  2WDR B;  4L1B A;  2RDB C;  2VH2 A;  1WGR A;  2EKI A;  3RPF C;  2DEN B;  2O2V B;  2WHI A;  3UQB A;  2JVC A;  5E6P A;  1RRB A;  2O6V D;  3IAM 1;  3Q8B A;  1JW9 D;  2N9P C;  1KLU D;  3HRD D;  2KO3 A;  4GB9 A;  4LNK A;  2WLB A;  2JZ3 B;  3RN9 C;  2KDF B;  2LJI A;  4K3B A;  2INC C;  4ZHO A;  1OGW A;  1VZ6 A;  4MH8 A;  1EWC A;  1B9R A;  2KAC A;  1SSN A;  4RF1 A;  3BVZ A;  4DBG A;  3SHQ A;  3U8Z A;  4G0N B;  4RGT A;  1D6E C;  3DHI C;  4HPP A;  3ZYY X;  2PW9 A;  4S0R A;  1FNW A;  2QDF A;  1I7H A;  2IGH A;  3AEC B;  1WGY A;  1PFD A;  5DPS A;  3HK0 A;  2QSD A;  1C79 A;  2BYF A;  2JU6 X;  3E9S A;  2O2V A;  4J3O D;  3L08 A;  4I6N B;  1JCK B;  3RT3 B;  1LXD A;  1VR9 A;  2BQQ A;  2GB1 A;  1K51 A;  4Q2J A;  4DHZ E;  5HKH A;  5C2T B;  4JGH B;  3L10 B;  3RYT A; 
#chains in the Genus database with same CATH homology
 3WAO A;  2QHO A;  1WI0 A;  5AZG A;  1TTN A;  3A9K A;  2FUH B;  1XT9 B;  2M1M A;  3HHM A;  4W9L A;  1I35 A;  4M0W B;  2MSE D;  2KFJ A;  3VUW A;  4OVU A;  2JF5 A;  3ZRF A;  5J18 A;  1LM8 B;  2ZCB A;  5GMV A;  3TL5 A;  3IBE A;  4A20 A;  1UD7 A;  3JSV B;  4EUT A;  1R4M I;  1GG3 A;  2EMT A;  1Z2M A;  4WWN A;  2N9X A;  4AP4 C;  3NS8 A;  5DPT A;  1SE9 A;  5KHO A;  2Z0D B;  3KH0 A;  3W1Y A;  3UIP B;  3PSE B;  3ZIM A;  4II3 B;  1UEL A;  1F9J A;  2LVO A;  2ZZP B;  4AWJ A;  1H4R A;  5L83 A;  3QWZ B;  1ZKH A;  4MJS B;  2BKF A;  3AI5 A;  3PTF C;  2GBN A;  1UBI A;  4FLH A;  4BKS A;  4GIV A;  1RFA A;  4FA6 A;  4IWO A;  2XK5 A;  3R7Q A;  1WXV A;  4FJZ A;  2LRU A;  2MBH A;  5C1Z A;  1NDD A;  4MGY E;  2JZZ A;  2MA9 B;  2ASQ A;  2KJR A;  4ANX A;  2M17 A;  4NQK E;  1KM7 A;  3UQA A;  3HM3 A;  4GOC A;  4B95 A;  4KV2 A;  2JRH A;  1VD2 A;  3MHS D;  3H7P A;  2NPT B;  4FHJ A;  1UH6 A;  2LVQ A;  4KIK A;  4PYU A;  2N1W A;  2OOB B;  4KVG B;  4WJO A;  3PV1 A;  3PS6 A;  2LZ6 A;  3EC8 A;  3RUL A;  4I6P A;  3B08 A;  4DDG D;  2FCS A;  1YIW A;  2I1J A;  1WIA A;  1TZ1 A;  1E8X A;  4OVV A;  1PQS A;  5G55 A;  2K39 A;  2LD9 A;  2JXX A;  2RGF A;  3K9P B;  5AZF A;  4W9F A;  2L7R A;  4EOY A;  3L54 A;  2CU1 A;  2KC1 A;  2G45 B;  3VHT C;  3WAL A;  2C7H A;  2MWS B;  1EO6 A;  2D3G A;  2JY6 A;  3A9J A;  4K81 A;  3RZF A;  4F7Z A;  1WF9 A;  1JRU A;  2KQS A;  2ZPY A;  2KVR A;  3R3M A;  3M62 B;  4IM0 A;  1V5O A;  3ZDT A;  4B6W A;  2IO0 B;  4ASW C;  1OEY J;  1V86 A;  2KDB A;  5G2N A;  2G4S A;  2LWP A;  2MP2 B;  3Q3F A;  3PT2 B;  2R2O A;  4MM3 A;  3H6N A;  2L3Z A;  3IFW B;  2A4Z A;  1Q0W B;  4DHJ D;  1U4A A;  4GMV A;  4IWP A;  3SDL C;  3ML8 A;  2CHX A;  3A1Q A;  2N7E A;  4M8M A;  4HCN B;  5DPW A;  2BYE A;  3A9J B;  1QZE A;  4KDI C;  2MBE A;  4N9F 4;  3DBS A;  2N9E B;  2KC2 A;  3H7S A;  3ML9 A;  4WWO A;  1UBQ A;  3RD2 A;  3APD A;  2GOW A;  1K8R B;  1Q5W B;  2UYZ B;  1J0G A;  2BGF A;  1XQQ A;  2PJH A;  2KFK A;  3JVZ X;  4IM3 A;  2DHZ A;  4HWI B;  1G6J A;  4FUL A;  3M3J A;  4ZRI A;  2ZPN A;  2R2Q A;  4FAD A;  2K8C A;  2IZV B;  3KUD B;  1WR1 A;  1YD8 U;  3QAQ A;  4FJV B;  3QQ8 B;  2LXA A;  2LI5 A;  3WAN A;  3ZNZ B;  1AAR A;  1C3T A;  3T9L A;  3I3T B;  2KX0 A;  2N1V A;  3DOW A;  3A4S C;  1KLV A;  2G3Q B;  2KMA A;  2I1K A;  2K8H A;  1IP9 A;  2MX2 A;  3JW0 X;  2YVC A;  4GSW A;  4CO7 A;  2KAN A;  3WAM A;  3NZU A;  3EFU A;  2KHW B;  1J19 A;  2FNJ B;  4W9J A;  3X0W A;  1YX6 B;  3TMP B;  4E71 A;  4LDT B;  4BKS D;  4F8C B;  3N32 A;  1YJ1 A;  4P7I A;  2AWT A;  5D94 A;  2L05 A;  1NI2 A;  1V2Y A;  2AEH A;  3KYC D;  2DZK A;  2ZJD A;  4HPL B;  5AZH A;  3U7D A;  4K1R B;  4ZDV A;  1D3Z A;  3NZS A;  4BOS C;  3ZW3 A;  4EZK A;  2K6D B;  4HDQ A;  1WX9 A;  3QCA A;  2D10 A;  4ICU A;  4NJ6 A;  2NS5 A;  3ZTD A;  3V6E B;  5J2R A;  1P98 A;  3PLV A;  3AU4 A;  1H8C A;  2AYO B;  1WJ6 A;  2FID A;  2L00 B;  5D6J B;  5FR6 A;  2C7N B;  3RCZ A;  3VUX A;  2KNB A;  3N3K B;  3QA8 A;  2NBW B;  4KIK B;  3AU5 A;  1WGH A;  2ZCC A;  2KXJ A;  2MLB A;  3GOE A;  3D32 A;  3NHE B;  4NQL B;  4RMA A;  5CTR C;  5L95 C;  2IY1 B;  4ICV A;  4PYZ A;  4ANU A;  1E8Z A;  2JWZ A;  2NBU A;  2OJR A;  4BOZ B;  1YQB A;  4MEL A;  4HJK A;  1WE6 A;  2AL6 A;  1GC6 A;  3L0W B;  4TQ1 A;  4ANW A;  5CHF A;  3PHW B;  4DWF A;  4E74 A;  3B1L X;  3PVL A;  4GDK A;  1RAX A;  2EKE C;  3ZTC A;  2Z59 B;  2D07 B;  4HCP B;  4AJW A;  4JIO U;  4HXD A;  3ONS A;  1HE8 A;  2WWZ A;  3QK0 A;  4DDI D;  1WXM A;  4IC7 B;  2FCQ A;  1IYF A;  1WMH B;  2L8J A;  2KK8 A;  4GXB A;  2LGX A;  4XZ4 A;  4MGZ E;  1WJ4 A;  3HM6 X;  2LXC A;  4HPM B;  2KD0 A;  3W1S A;  3VTW A;  1LQB A;  2MP2 A;  2BWE S;  3IHP C;  3DBR I;  3V60 A;  4JLC A;  4AUQ C;  4MEM A;  3TIX A;  3ZLZ A;  2KDE B;  3GZN I;  3CSF A;  5LXH A;  2IO1 B;  1TGZ B;  2J0J A;  4W9H A;  2KJH B;  2L0T A;  2JUO A;  5TR5 A;  4EKU A;  1WX7 A;  4WAA A;  3ALB A;  4BFR A;  1R4N I;  3ZRC A;  3PRZ A;  4LJO B;  1M94 A;  1MG8 A;  2XBB C;  4W9E A;  3APF A;  3ENE A;  3MTN B;  3EEC A;  1J8C A;  3DCG A;  4MSM B;  5DPR A;  4ZYN A;  1LFD A;  3BY4 B;  1E8Y A;  4IM2 A;  1WE7 A;  2KFK B;  2RR9 A;  2DYO A;  1P1A A;  4URK A;  1WM2 A;  4HVB A;  5J17 A;  1WZ0 A;  1WXA A;  2CR5 A;  3K9O B;  3P2B A;  4GDL B;  5DCN A;  2G4D B;  3L16 A;  4W9G A;  3C0R B;  3H7P B;  4M8N A;  3ZDM C;  3A1Q B;  2KKC A;  2DZM A;  1WGD A;  4II2 B;  4WJP A;  4AJY B;  5AEK B;  2J7Q B;  2KMC A;  2ZEQ A;  2IYD B;  3APC A;  1E7V A;  3N30 A;  1Y8R C;  1L2N A;  1V6E A;  2DAF A;  3X23 A;  3UIN B;  4WJN A;  2KDI A;  3VH4 B;  4TQ0 A;  2XK5 B;  2PEA A;  5IAA C;  3OJ3 A;  3V6C B;  5CX3 A;  1WGG A;  2KOX A;  2PE6 B;  4TKN A;  1A5R A;  2JT4 B;  1WJN A;  1WX8 A;  4MDK E;  4NY0 A;  3TCA A;  4A3P A;  2KZR A;  4G3X B;  3VDZ A;  2EMS A;  2REX A;  3PRM B;  4XC2 A;  2MQJ A;  3CST A;  1I42 A;  1Z5S B;  3ZO5 B;  3DDC B;  2BWF A;  4KSK C;  2KQ7 A;  1EF1 A;  2YLM A;  2ZVO A;  2NBV B;  4HLE A;  1CMX B;  2C60 A;  2D2Q A;  3DVN U;  2B3A A;  2K1F A;  2Z0E B;  3QC8 B;  2WX0 A;  4IW0 A;  4FJY A;  2BPS A;  2LAS A;  4IUM B;  3LJ3 A;  3B0A A;  4NNJ B;  5D2M B;  2DZI A;  1KOT A;  4BVU C;  3ZNI D;  4GU2 A;  1WJU A;  2LVP A;  2CS4 A;  2JRI B;  2MRP A;  3QJZ A;  4W9I A;  4DHZ B;  3L17 A;  2KWV B;  2KTR B;  5IA7 A;  1EUV B;  3DVG Y;  5E6O A;  4YL8 A;  1V81 A;  2C5L C;  4BBN F;  2GMI C;  2A5U A;  4ZRK A;  3UF8 A;  3AUL A;  3ZKJ C;  3JSV A;  3DBL I;  3WAP A;  2FCN A;  2ZNV C;  1FXT B;  1P3Q U;  3EHV A;  2N7D A;  2BKR B;  2IO2 B;  2L0F A;  2M0X A;  4KZC A;  4NJ7 A;  1KJT A;  4ZRJ A;  3H9D A;  4JQW C;  2V3S A;  4MJS A;  5EDS A;  2KN5 A;  3KYD D;  2AL3 A;  1V49 A;  3PLU A;  2NPT A;  3UIO B;  2M4N A;  2IO3 B;  2IY0 B;  3RZW C;  1L7Y A;  1WM3 A;  2D11 A;  1T0Y A;  2MBO A;  4ANV A;  2WX1 A;  1P0R A;  3HIZ A;  3DVG X;  1GJZ A;  2CHW A;  2DYM A;  3DPD A;  1IPG A;  1ISN A;  3KUZ A;  4J6I A;  3SD5 A;  2GBM A;  2MBQ A;  2WYQ A;  4XX5 A;  1WYW B;  2PPH A;  4HK2 A;  4LDT D;  3M95 A;  4LCD E;  1V9J A;  2JPH A;  2ZNV B;  3PGE A;  4HDO A;  2MCN B;  1S3S G;  3IG3 A;  3M63 B;  2MBB B;  3VFK A;  2IBI B;  3S2A A;  3OLM D;  3NOB A;  1YX5 B;  1P9D U;  2V4L A;  3VVW B;  5LXI B;  4AOF A;  4RM9 A;  1OQY A;  1XD3 B;  2KX3 A;  1GNU A;  3U30 A;  4F1S A;  2J0M A;  3PRE A;  4NAW A;  4NAW B;  3V62 A;  3IVF A;  4W9C A;  4PS7 A;  5CHV C;  2K25 A;  2J0K A;  1V80 A;  3LDZ E;  4NPN A;  1WZ3 A;  4K7W A;  3VTV A;  4DK5 A;  3R7R A;  1NBF C;  2C9W B;  4FHK A;  4G50 A;  2CKH B;  4JL9 A;  3A9K B;  1GUA B;  4WJQ A;  1GC7 A;  4BKT A;  4K7U A;  4A3O A;  3VQI A;  3ZNH B;  2DZJ A;  3VH3 B;  2BYV E;  3A4R A;  5D7G A;  3PPA A;  4EEW A;  2KWC A;  1S1Q B;  2O6V A;  3KUC B;  4I6L B;  2RD0 A;  4EZL A;  2UWQ A;  1ZGU B;  3QIJ A;  4IG7 B;  3SU8 X;  3O65 B;  1WR6 E;  3VUY A;  3CMM B;  3Q3J A;  3WA0 A;  5C23 A;  2KLG A;  4EZJ A;  3TJP A;  3L13 A;  2GBK A;  4CYE A;  5BO4 B;  1Q1O A;  1WH3 A;  4DHJ B;  2NR2 A;  2ZVN A;  2K8B A;  2HTH A;  2LRW A;  3OJ4 B;  2KWU B;  2HD5 B;  2KJ6 A;  4CHK A;  3KVF B;  3MJW A;  3V61 A;  1WGR A;  4TUU A;  1E90 A;  2DEN B;  2FCM A;  2GBR A;  2O2V B;  4W9K A;  3TBL D;  2LJ5 A;  2V1Y A;  3CF6 E;  3JYU A;  3DBH I;  4PS3 A;  4WQO B;  3UQB A;  4W9D A;  3ZVV A;  3QAR A;  3DVN V;  2JVC A;  3ECI A;  1RRB A;  2O6V D;  3OAW A;  5E6P A;  3QX1 A;  2XEW A;  2N9P C;  3T8M A;  1UGM A;  3H1U A;  3VAW A;  4GB9 A;  2KO3 A;  2W9N A;  2KLC A;  1OTR B;  2JZ3 B;  2LUE A;  4KZ0 A;  3QHT A;  2WDT B;  5JHA A;  5CHW A;  2KDF B;  4PS8 A;  4WWP A;  1WXS A;  3ZNG C;  4BBN C;  3PZD A;  3PHX B;  1OGW A;  1OEY A;  5JH5 C;  1VCB A;  2FAZ A;  4KSL C;  4GGQ A;  5KHQ A;  3KW5 B;  3RUI B;  2VRR B;  4E3C A;  3VTU A;  4EFO A;  2HE7 A;  2FIF A;  1WY8 A;  2MW5 A;  1WRD B;  1X1M A;  4MH0 E;  4DXA B;  1C1Y B;  4B9K A;  4K7S A;  4DBG A;  3SHQ A;  3U8Z A;  2RPQ A;  3R66 C;  4G0N B;  3AXC A;  2N4F A;  4LJP B;  4KDL B;  2CHZ A;  2LGY A;  4TV3 A;  3VXW A;  4MGI E;  2BF8 B;  3DQV A;  2M8S A;  1WGY A;  1E5W A;  2GBJ A;  5DPS A;  3NY5 A;  1UZX B;  1BT0 A;  3ZUN A;  3HK0 A;  1ZW7 A;  2NCN A;  1SIF A;  3PRP B;  2PE9 A;  4MSQ B;  2BYF A;  1TBE A;  1WMH A;  5JZE B;  2KTF A;  1WFY A;  2O2V A;  1E8W A;  4BKG A;  4GN1 A;  3UGB B;  2DX5 B;  3L08 A;  4GDL A;  4I6N B;  4FN2 A;  5E6N A;  3WIM A;  3RT3 B;  1LXD A;  4GDK B;  3BIN A;  1SGH A;  2NVU I;  4RM8 A;  4FBJ B;  4X57 B;  4DHZ E;  5JHB A;  3A33 B;  2LGD A;  2L76 A;  1E7U A;  2C7M B;  2HJ8 A;  5HKH A;  2DAJ A;  2K6Q A;  4JGH B;  2Y5B B;  5LLI A;  2O6V B;  2KTR A;  3L10 B;  4G11 A;  3RYT A;  2DYB A;  4IWQ A;  1RLF A;  4MGK E;  3W1S C;  1EF5 A;  2RSU A;  1V5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...