5L83A

Complex of potato atg8 protein with a peptide from irish potato famine pathogen effector protein pexrd54
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
GPSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASP-TRP-GLU-ILE-VAL
publication title Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Immune system
total genus 35
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5l83A00
5AZFA 4MM3A 2WYQA 3IFWB 3LDZE 2KX0A 3KYCD 3PZDA 4HLEA 1C1YB 1VCBA 2BWES 3PT2B 3C0RB 3VTWA 4ASWC 3JVZX 5AZHA 1WXSA 5HKHA 2MBBB 3JSVA 2HJ8A 4NY0A 2K25A 2C5LC 3PVLA 4MSMB 2LGXA 3SU8X 3MHSD 3JW0X 1YIWA 3RUIB 4AJYB 3DBSA 4NAWB 2GOWA 2L3ZA 1RAXA 4EEWA 3H7SA 2M17A 3O65B 4I6NB 1KJTA 1RRBA 1KOTA 1U4AA 2CHWA 2N4FA 4IM3A 2LVQA 4GU2A 3UIPB 3RZFA 3AXCA 2D07B 2FCQA 2C7MB 4II3B 3ZVVA 3RD2A 1ZKHA 1P3QU 5J2RA 2KTFA 4E71A 3EC8A 3UQAA 1OQYA 1WX7A 3PRMB 4KSKC 4EFOA 3PTFC 1WX8A 3VHTC 4A3PA 3X0WA 2RGFA 4MGKE 4FHKA 4MSQB 1WR6E 1E7VA 2AWTA 2KMAA 2KLCA 4KDLB 2YLMA 3EHVA 2BYEA 1ZW7A 3V6EB 3VTVA 4IWPA 2MP2B 2DAFA 2XEWA 1V49A 4GDLB 3QCAA 4GXBA 2K6DB 2IY1B 2LASA 3APCA 3ZDMC 3ZLZA 2BYFA 3IG3A 4K1RB 4II2B 4URKA 2XK5B 3RULA 2LI5A 4EZLA 2JRIB 1TZ1A 3RYTA 4JQWC 3CSTA 3APDA 2IO3B 1ISNA 2NBVB 1SIFA 3AI5A 4ZRJA 2KJ6A 3BINA 2MW5A 4HWIB 3AULA 2PE6B 1WMHB 3DBLI 3EFUA 2PE9A 4IW0A 2NPTB 2DYOA 4OVUA 4EUTA 2Z59B 3DVNU 2K39A 4JIOU 2KDFB 2JVCA 4RMAA 3H7PB 2RPQA 2OJRA 3TCAA 4IM0A 2KTRB 3R3MA 3QAQA 5DPSA 2MWSB 2NBUA 3OLMD 1WI0A 4CYEA 4M0WB 1KM7A 4GN1A 2MQJA 2JY6A 3OJ3A 2V1YA 3CF6E 1WX9A 1HE8A 4W9JA 4ANUA 1C3TA 2KZRA 4AOFA 3A33B 3AU5A 4BFRA 1XQQA 2G4SA 4WWOA 4DHZB 1UZXB 2BKRB 3WAPA 4MELA 3SDLC 5L83A 4G11A 3R7QA 3WAMA 2EMSA 2QHOA 4DHJD 2MRPA 2C7NB 2BF8B 4WWNA 3VXWA 1EO6A 3KUZA 2R2OA 2JF5A 2LRUA 3TIXA 2CHZA 2N7EA 4E74A 4MGZE 4MJSB 4P7IA 3DQVA 1OEYA 1WZ0A 2A4ZA 1MG8A 4AP4C 4DHJB 3SHQA 3L54A 2J0JA 3L16A 4GOCA 5E6NA 2BYVE 1Q0WB 4E3CA 4ZRIA 2LXAA 3A9JB 2K8BA 3V61A 3ZNZB 2CU1A 2KO3A 4FLHA 2KXJA 2JZZA 4BKGA 3VUXA 4WJPA 4PS7A 2MBQA 4W9IA 5KHOA 1L7YA 3IVFA 3D32A 5IAAC 3QK0A 1J8CA 2L00B 3WALA 2LXCA 3EECA 2KWUB 3L10B 3APFA 4NAWA 4NQKE 4RM8A 1R4NI 4MGYE 4FA6A 2FUHB 2N1WA 1WGRA 4G50A 2KWCA 4K81A 1V81A 3RT3B 3UIOB 1E8YA 1YX5B 3VUWA 2DENB 3ZNID 5AEKB 1V5TA 4IWOA 4NPNA 3W1SC 2MBHA 5DPTA 1CMXB 1GG3A 3QX1A 4W9FA 3U30A 4TUUA 4BOZB 4ZRKA 4FN2A 2ZPYA 2RSUA 1WH3A 4FULA 3A1QB 2M1MA 3L13A 3PPAA 4KV2A 1WF9A 1WRDB 4BBNF 3V60A 2MP2A 2M4NA 2NBWB 4XX5A 1IYFA 3LJ3A 3L08A 3Q3JA 4W9LA 5AZGA 4CO7A 4ZYNA 3IHPC 5EDSA 4GDLA 4IUMB 3MTNB 3B08A 3N32A 4FBJB 2XK5A 3UF8A 3NZSA 2FAZA 5J17A 2MA9B 4TQ1A 4DWFA 1UBIA 2ZCBA 5CX3A 1H8CA 2LRWA 3DVGY 2J0KA 5JHAA 2KNBA 4KDIC 2ZNVB 2D11A 3X23A 2KJHB 4KVGB 4HDQA 4ANVA 4NJ6A 3ZIMA 1WMHA 2KANA 2NPTA 3PRPB 4IC7B 3R66C 2O2VB 2O6VD 1S1QB 2FCSA 4FHJA 3WAOA 1H4RA 1WFYA 3DBHI 4B95A 1E5WA 2KOXA 1WYWB 1WJ6A 3DOWA 3KUCB 3ML8A 3H7PA 4HCPB 1UH6A 4B6WA 1GC6A 3WA0A 4DBGA 4G3XB 3ALBA 2O6VB 3Q3FA 2KTRA 1AARA 3K9OB 2NVUI 4K7UA 2IO2B 2BGFA 5D2MB 2MBEA 1RFAA 4MGIE 4NQLB 2ZZPB 5L95C 1YJ1A 3HIZA 3B1LX 3M62B 4BKSD 2ZVNA 3VH4B 4BKTA 4PS8A 3PHWB 1Y8RC 2PJHA 3PGEA 3ZUNA 4DHZE 1E8ZA 2AL3A 3P2BA 2JXXA 5D6JB 3ZDTA 3AU4A 3I3TB 2PPHA 4MJSA 3CSFA 3T8MA 3RCZA 2DYMA 2ZPNA 1Q5WB 2WX1A 2D3GA 5JZEB 2GBNA 2ZVOA 4EKUA 2EMTA 3TMPB 3H6NA 2PEAA 1A5RA 1V2YA 4K7SA 2KX3A 3A9JA 2CHXA 2NS5A 2K8CA 4YL8A 2KMCA 4MH0E 1V9JA 2KVRA 1QZEA 2ZNVC 2LWPA 1NBFC 1UBQA 2N9XA 3DBRI 1K8RB 2AL6A 2DHZA 2LGYA 5GMVA 2DZMA 2KC1A 4ANXA 2CS4A 2MX2A 4XC2A 1L2NA 1WJNA 4ZDVA 4HK2A 4OVVA 5LXHA 1E90A 4BOSC 1YX6B 3ENEA 3NZUA 1M94A 3M95A 2KHWB 3QQ8B 2J0MA 3PHXB 2L8JA 2W9NA 4LJOB 4ANWA 1ZGUB 2V3SA 2FCNA 2JT4B 1XD3B 1LM8B 2MBOA 4MDKE 4PS3A 4WWPA 2FIDA 1WGYA 2XBBC 3HHMA 3A1QA 4W9GA 2BKFA 2ZJDA 4ICVA 2JPHA 3H1UA 5LXIB 1P9DU 4HPLB 1I35A 1OTRB 4HVBA 2KQ7A 2D2QA 4HCNB 4RM9A 3U7DA 1XT9B 4JGHB 3UGBB 1J19A 1S3SG 1EUVB 1LXDA 3KYDD 3H9DA 3PREA 3UINB 4XZ4A 1Z2MA 2FCMA 4I6LB 2DZKA 5CHFA 3V62A 3ZRCA 1WM3A 5DPRA 3A9KB 3PV1A 2LD9A 3KW5B 3VVWB 3GZNI 2KDBA 2WX0A 4A20A 3QC8B 3V6CB 5JHBA 4KIKB 1V5OA 3QJZA 2R2QA 3PRZA 1GUAB 2O2VA 2FNJB 1EF1A 1WJUA 5D7GA 4PYZA 1WJ4A 2IO1B 2HTHA 3TL5A 2N1VA 3WIMA 2ASQA 3ZTDA 1WE6A 4A3OA 3NOBA 1YD8U 2O6VA 3W1YA 3M63B 4WQOB 2IY0B 1EF5A 4I6PA 1P98A 2Y5BB 2KFKB 3RZWC 1WGGA 4GB9A 4N9F4 4F1SA 3ZO5B 4FJVB 2Z0EB 1OGWA 2GBRA 3UQBA 2DYBA 3DVNV 3ONSA 4KZCA 5TR5A 3VTUA 2B3AA 3OJ4B 2CKHB 4KSLC 2KFJA 2ZEQA 3QHTA 3HM3A 3ZRFA 4B9KA 2KD0A 2J7QB 3T9LA 4BKSA 4DK5A 3ZW3A 4M8NA 1I42A 1E7UA 5KHQA 4W9DA 4NJ7A 2VRRB 3QWZB 2G3QB 3S2AA 3L0WB 4GDKB 2KKCA 4J6IA 4GGQA 1V6EA 3PLVA 1G6JA 2C60A 3ZTCA 4GSWA 2IBIB 5D94A 3ZNHB 3WANA 4BVUC 3W1SA 5DCNA 1WE7A 1WGDA 3OAWA 1WZ3A 1UELA 2L0FA 2L7RA 1WR1A 2UYZB 4TKNA 1T0YA 4X57B 2HE7A 2LUEA 2WDTB 1X1MA 3NY5A 4DXAB 1UGMA 1F9JA 4FJYA 4TQ0A 2LJ5A 2REXA 2I1KA 2G4DB 3VH3B 5IA7A 2NCNA 2LVOA 2JUOA 3PSEB 3DVGX 2C7HA 3KH0A 4AWJA 2G45B 5CHVC 4FADA 1E8XA 1TBEA 3VAWA 3VDZA 1KLVA 2NR2A 2MSED 3M3JA 3JYUA 3JSVB 2HD5B 5CTRC 4HPMB 2K1FA 2D10A 2DX5B 2EKEC 1D3ZA 4LJPB 3GOEA 4WAAA 3R7RA 1WIAA 2AEHA 4G0NB 4M8MA 4W9EA 2KN5A 4EZKA 2I1JA 4TV3A 3ZKJC 5FR6A 2KDEB 2DZIA 4DDGD 5BO4B 4PYUA 5G55A 4F8CB 2KJRA 4IWQA 1P0RA 3KUDB 3U8ZA 2WWZA 4HJKA 3A9KA 2AYOB 1WM2A 1WGHA 4EZJA 2N9EB 2KDIA 3N30A 2K6QA 1JRUA 4W9CA 1IP9A 1LFDA 3ECIA 2JZ3B 3ML9A 3QIJA 2A5UA 4KIKA 2L0TA 2C9WB 2RD0A 3TBLD 2BWFA 5CHWA 2UWQA 3HK0A 5G2NA 1GNUA 2Z0DB 2KK8A 1YQBA 1FXTB 2LZ6A 2V4LA 3DCGA 4AUQC 1GC7A 3KVFB 3MJWA 5C1ZA 2L76A 4BBNC 3PLUA 4IM2A 3IBEA 5JH5C 1SGHA 2OOBB 2LGDA 1PQSA 2KFKA 1V86A 4LDTD 4EOYA 4HDOA 1NI2A 2MLBA 4DDID 4F7ZA 2GBMA 4JL9A 4WJQA 5E6OA 1WXVA 2KQSA 2YVCA 3TJPA 3N3KB 2MCNB 3NHEB 1TTNA 4NNJB 2GBKA 4LDTB 4MEMA 2DAJA 2N9PC 3PS6A 1VD2A 2JRHA 1P1AA 1LQBA 1WXMA 2M0XA 1RLFA 3NS8A 4ICUA 4KZ0A 4FJZA 3VUYA 3VFKA 3L17A 2K8HA 4CHKA 2ZCCA 3DDCB 2IYDB 3QA8A 1GJZA 3CMMB 3HM6X 1WXAA 4GMVA 1WY8A 1Q1OA 2FIFA 2GMIC 2KC2A 4WJNA 3ZNGC 1UD7A 3B0AA 4GDKA 5J18A 3A4RA 1IPGA 3DPDA 4W9HA 4LCDE 1TGZB 1NDDA 2CR5A 2DZJA 1BT0A 4AJWA 1OEYJ 2LVPA 4GIVA 1Z5SB 1E8WA 4IG7B 2IO0B 2KLGA 4JLCA 4WJOA 4HXDA 3SD5A 3A4SC 1J0GA 5C23A 1V80A 3VQIA 2JWZA 4W9KA 3BY4B 5E6PA 1SE9A 5LLIA 3QARA 2KWVB 2L05A 2GBJA 5DPWA 2BPSA 3K9PB 2M8SA 1R4MI 4K7WA 2IZVB 2N7DA 2RR9A
chains in the Genus database with same CATH superfamily
3CIRB 4ZYSA 2CJOA 1L6UA 5MPOA 3IFWB 1K51A 1TKEA 3KYCD 4WQMA 3NRZA 3C0RB 4ASWC 2J42A 3JSVA 1MHXA 2HJ8A 4NY0A 2K25A 4MSMB 4AJYB 2KWDA 4EEWA 1TZOA 2M17A 2AQ1B 1RRBA 1T3QA 4IM3A 1AN8A 2LVQA 3DHGC 3UIPB 3RZFA 3VR8B 2W54A 3EGRA 1N6ZA 4E71A 3EC8A 3UQAA 3BWUD 4EFOA 4FHKA 5BYRA 1QQRA 2JU6X 1XLOA 1FXAA 1C4CA 2XEWA 3URYA 4KKIA 3HVZA 3ZLZA 1YQ4B 3IG3A 4RGMA 2L32A 2XK5B 3RULA 3RYTA 3CSTA 1DOXA 3MFGA 4ZRJA 2WGSA 2Y5PA 4UDUC 1CJEA 3BINA 2MW5A 2GB1A 4HEA1 1WMHB 3BYYB 2PE9A 4OVUA 1T0QC 5G5HA 3B9JA 3HVDA 2JVCA 4AQ7A 2WU2B 3H7PB 3BK2A 3TCAA 4A9AA 3QAQA 2NBUA 3AB5A 4M0WB 3GP7A 1HZ5A 2WXRA 2JY6A 1WX9A 1HE8A 1GB1A 1TJEA 1C3TA 3AU5A 2WXHA 3R7QA 4A90A 1C76A 2R2OA 1V97A 2LRUA 3TIXA 4E74A 4MGZE 4P7IA 3DQVA 1OEYA 1WZ0A 1JMLA 2WXFA 4AP4C 1NVID 3SHQA 1TKYA 3TEZA 4E3CA 2G9HD 3W5UB 3V61A 2CU1A 2KO3A 2IJ0A 2MBQA 4W9IA 4RH6A 1P7FA 3U4EG 2KWUB 5C2TB 4OZAA 3APFA 2W55A 2OHFA 1VZ7A 1D5XC 4K81A 1V81A 1N63A 3UIOB 1E8YA 3VUWA 2DENB 3B2GA 1YJJA 1JCKB 5DPTA 1CMXB 3AE7B 4BOZB 3IT4B 2V9HA 1WH3A 3ZQ4A 4US8A 3L13A 4KV2A 1WF9A 1V1PA 4BBNF 1JWAD 2NBWB 1TS3A 1IYFA 4W9LA 5D3DA 4CO7A 4GDLA 3MTNB 1PYWD 1ESFA 2GLSA 2B76B 2MA9B 1UBIA 1YN3A 1H8CA 2ZNVB 1XCQL 2NPTA 2O6VD 2FCSA 3WAOA 1H4RA 5BMGA 1WFYA 3DWMA 1SBBB 4B95A 4HCPB 2D3BA 4JX1C 1UH6A 1ACCA 2EELA 2WQYB 4P6VF 2NVUI 4RF1A 2MEKA 5BYQA 2ZZPB 3LYYA 2H89B 3B1LX 2R61A 4XWTA 3VH4B 4YTPB 4XE0A 2PJHA 1E8ZA 2AL3A 3ZDTA 3T8MA 4ZOHC 2DYMA 2ZPNA 1Q5WB 1JRPA 2WX1A 2D3GA 2FUG1 2IPKD 3NUHB 3RI7C 2KX3A 2N9KA 2K8CA 4MH0E 4C00A 1V9JA 3E9SA 2HDEA 1VR9A 2NTTA 2ZNVC 2LGYA 3IAS1 2DZMA 4FXCA 4WAFA 3RMKC 3RNBC 4BOSC 3TUOA 2KHWB 2J0MA 2L8JA 2J4XA 1L4DB 1ZGUB 2V3SA 3I63C 2JT4B 1XD3B 1LM8B 2MBOA 4MDKE 4YTMB 4C7YA 3HHMA 3A1QA 4LK0M 2BKFA 1ZE3D 2ZJDA 2JPHA 4LTUA 1L0VB 4LNNA 4HCNB 4RM9A 4S17A 1K52A 3KYDD 3UINB 3V62A 5DPRA 3A9KB 1J7BA 3KW5B 2JZPA 5HHDG 3GZNI 2KDBA 2V0GA 4US9A 3QJZA 2KT7A 2PTLA 3PRZA 1GUAB 2YEPB 2INPE 2N1VA 4RGOS 1AW7A 3AE3B 2IY0B 3AEEB 1P98A 1YNTE 1DYQA 2KFKB 4WH4A 4F1SA 4FJVB 2Z0EB 1OGWA 2DYBA 4KZCA 3VTUA 2B3AA 2CKHB 2XN9C 4KSLC 2KFJA 3QHTA 2D5GA 3BYTB 3DBHB 3T9LA 4BKSA 3ZW3A 4W9DA 1PUTA 2G3QB 3S2AA 4GDKB 2KKCA 3ZTCA 2WDVB 1YOVB 5DCNA 1WE7A 1WGDA 1WZ3A 2L0FA 2J53A 4ARCA 5FK9C 2WDTB 3C8YA 3Q3OC 2DWQA 1QT9A 2LJ5A 2H88B 2I1KA 1FFUA 2M56B 5EE3A 5IA7A 1E0ZA 5CHVC 5E6JA 1WXQA 3JSVB 1EM7A 4HPMB 2D10A 4G0NB 4M8MA 4W9EA 1EWCA 2LMCA 3DBRB 1FXIA 2I1JA 2KDEB 3W2DA 5G55A 3IXSA 1T0RC 1TS2A 4HJKA 2AYOB 2N9EB 4A6QA 1D6EC 3ECIA 3EA6A 1V1OA 3HK0A 1JWSD 5AUIA 3DCGA 3P4RB 1GC7A 2EKIA 3MC9A 3KVFB 1QOBA 2L76A 2QCZA 2RDBC 4JE3B 5JH5C 2OOBB 4REZA 4LDTD 2MLBA 4WJQA 1WXVA 2KQSA 3TJPA 3N3KB 1I4HA 5T8IA 4DXFA 1HEZE 2INCC 3PS6A 4RGNA 1KF6B 4ICUA 1WXMA 2V4IB 4ZDVA 4GMVA 2DLBA 4TSSA 1T6BX 4LCDE 3FKYA 2E6XA 1YMHE 3NVYA 2LVPA 4GIVA 3VR9B 4IG7B 2IO0B 3SD5A 1TIFA 3A4SC 2K22A 3BY4B 3QARA 3ZJUA 5AUKA 4M01A 2M8SA 4K7WA 5AZFA 4ACFA 3BVZA 4HLEA 3MHZA 1C1YB 1FCCC 2BWES 3PT2B 3VTWA 1VJKA 1WXSA 3N1ZC 2C5LC 2LGXA 1E9MA 3JW0X 1YIWA 3DBSA 1QOAA 2L3ZA 2MJ3A 3P4SB 3H7SA 4YWGG 1U4AA 2CHWA 2N4FA 4GU2A 4MACA 1NYQA 2FCQA 2C7MB 4II3B 3ZVVA 3U2SC 1P3QU 2KTFA 1WX7A 3AN1A 3VHTC 2INDC 4A3PA 4USAA 2KMAA 3MC0B 3RPFC 3DWGC 3NS1A 4HROA 2BYEA 1V1PB 4IDIA 4GDLB 3QCAA 3ZDMC 2IY1B 3BVGA 1Y56A 3P42A 2VH1A 4URKA 3APDA 2IO3B 3HRDD 3AI5A 4HWIB 2DNFA 3AULA 3EFUA 4XDDA 4IW0A 2NPTB 2WDQB 4EUTA 4P1CC 2Z59B 2K39A 1JQ4A 1ET6A 4DQOC 4RMAA 2RPQA 4IM0A 4GLSC 2MWSB 1ZDVA 3OLMD 2W3SA 2MQJA 4GN1A 4ANUA 4AOFA 4LLGM 3NVZA 2BKRB 3SDLC 2YEPF 3WAMA 2QHOA 4DHJD 2MRPA 3VXWA 1EO6A 3KUZA 5IKCM 2JF5A 2CHZA 2SEBD 2W3RA 1E6EB 3AMZA 2A4ZA 1MG8A 1TS4A 1E7PB 2J0JA 3ABVB 1T5XD 3T3NA 3L16A 1SE3A 3SEBA 2LXAA 2K8BA 4LNIA 3VUXA 5KHOA 3IVFA 5IAAC 1GB4A 2ACZB 1MVKA 2L00B 2HTME 1HA5A 4S0RA 3LXFA 1R4NI 4FA6A 1R4MB 2FUHB 1B1ZA 2N1WA 2ONQA 1WGRA 3RT3B 1YX5B 3ZNID 1FCLA 2MBHA 3QX1A 1MJDA 4FN2A 1MHHE 3A1QB 4HPPA 1JROA 3LB8C 1MPEA 2MP2A 2M4NA 4XX5A 3L08A 5EDSA 3IHPC 1RWSA 2BS2B 4LNOA 2X38A 3ZJVA 5J17A 1FPYA 1UF0A 2ZCBA 2LRWA 5JHAA 3V05A 3X23A 4EE2A 2KJHB 2KANA 1TY0A 1XO3A 2QJLA 1S1QB 1BMLC 2V3PA 4CQNA 2BQQA 3ML8A 4XYCA 1WJ6A 4G3XB 3ALBA 1AARA 4NAMA 2Y5CA 5LNK1 3Q3MC 5D2MB 2MBEA 1RFAA 3PO0A 4MGIE 3V3XA 4WIPA 1YJ1A 3HIZA 2AQ3B 3GE8C 1LGRA 2N0SB 1Y8RC 3DBLB 3PGEA 3GS2A 2JXXA 2PPHA 3CSFA 1SXTA 1UNSA 2K5PA 1XLNA 5JZEB 2D3CA 2ZVOA 1CQVA 2PEAA 2WXQA 1V2YA 2TSSA 3A9JA 5FR3A 2IGGA 1UBQA 2DHZA 5GMVA 2KC1A 1L2NA 3AEFB 2RDHA 2PW9A 4MH8A 1KLUD 5LXHA 1E90A 1C78A 4Q2JA 4O1NA 1ZOYB 1YX6B 3NZUA 3M95A 3QQ8B 2LUMA 3I5JC 3OG5A 4ANWA 4PT5A 1RFKA 4PS3A 4K3CA 2XBBC 4W9GA 4L23A 1EU3A 4ICVA 5BMIA 1I35A 4HVBA 1L5PA 1XT9B 4JGHB 4D2KA 1S3SG 1EUVB 3CWIA 4M02A 3DHIC 1Z2MA 2FCMA 5CHFA 2LD9A 2UU7A 4JWSC 4A20A 3B2FA 1FNWA 2R2QA 1SSNA 2ON8A 1WJUA 2JX5A 1WJ4A 5GXGB 2MJEA 1KFYB 4A3OA 5C3JB 2O6VA 3RZWC 1WGGA 4GB9A 4N9F4 4AS1A 3RN9C 3ZO5B 1C79A 2N9LA 3UQBA 1TT5B 3OJ4B 3HM3A 1GPXA 2BB5A 4DK5A 1FFVA 2VRRB 1XCTL 2MH7A 3N1XC 4KGSA 3BVMA 1FM0D 2IBIB 2BBCA 4C56C 2FBWB 3OAWA 1FO4A 2WXLA 4X57B 1T0YA 3BK1A 4P16A 2BVCA 3TEWA 1KRHA 1X1MA 2WXMA 3E56A 1UGMA 4FJYA 2G4DB 3VH3B 2WXNA 3T3OA 2C7HA 3KH0A 3N9YC 4AWJA 1FRRA 2G45B 2CU3A 1TBEA 1SJHD 2HD5B 2K1FA 1D3ZA 4LJPB 4WAAA 2ZW0A 3R7RA 1WIAA 3AV8A 4XWWA 2KN5A 4EZKA 2AQ2B 3FILA 4PYUA 2KJRA 4HKQA 1UWMA 4IWQA 2VZKD 1N5XA 2QC8A 4LNKA 1WGHA 3FC4A 1K53A 2K6QA 1JRUA 4W9CA 1IP9A 3ML9A 1J7CA 3Q8CA 2C9WB 3AE9B 5G2NA 3Q3NC 5IP4D 1GNUA 5IN7A 2Z0DB 5C1ZA 1OQQA 2L83A 2LGDA 4HDOA 3AM9A 4DDID 3AEGB 3KWLA 1UWXA 5HI1A 2KDMA 4NNJB 2Q5WD 4MEMA 1VD2A 1P1AA 4KZ0A 1RLFA 3VFKA 3L17A 4IKGA 2ZCCA 2IYDB 3GB1A 3ZNGC 1WY8A 2GMIC 1UD7A 2MHJA 2QSDA 1TS5A 2OEDA 4QAYA 1EWYC 1OEYJ 4AJWA 1Z5SB 3UI3A 1J0GA 5C23A 1SE2A 4W9KA 1D5ZC 1SE9A 5LLIA 2L05A 2GBJA 4ZHOA 3NJTA 4YSYB 4OVZA 2N7DA 1ENFA 4MM3A 5H92C 5HFYA 3R2TA 3LDZE 2KX0A 3PZDA 2W82A 1KLGD 1NYRA 3JVZX 5AZHA 5HKHA 2MBBB 5EE1A 4ZHPA 3PVLA 3RUIB 1IUEA 3O65B 4I6NB 1KOTA 2D07B 3ETRA 1ZKHA 5J2RA 3I9V1 3PRMB 3PTFC 3X0WA 4MSQB 1E7VA 4OHJA 2YLMA 3EHVA 3IAM1 1PGXA 3V6EB 4PK1A 1NENB 2MP2B 1TY2A 1V49A 3HUIA 4GXBA 5JXVA 2IGDA 3APCA 4II2B 2LI5A 1TZ1A 4JQWC 2MJDA 2IGHA 4RGTA 1ISNA 4LNFA 3VRAB 3P4PB 4C4VA 1IBXA 2PE6B 3NZ3A 3P4QB 1WWTA 1VLBA 2RDGA 1MFWA 2KDFB 3AE4B 2PVOD 3NG0A 3TEXA 3RNGC 3R3MA 3FAHA 5DPSA 4NJCA 1WI0A 1KM7A 5FKAC 2V1YA 3RFZB 3PZ7A 3A33B 1XQQA 1GAQB 3WAPA 4MELA 1VDVA 4G11A 4JWUC 3NVVA 1SJED 2C7NB 2BF8B 3H8HA 4C80A 2JYEA 3L54A 3R2IA 2E3TA 4ZRIA 3A9JB 4RCOA 3ZNZB 2KXJA 2JZZA 4BKGA 4PS7A 1L7YA 3D32A 4P1BC 1J8CA 3WALA 2LXCA 3EECA 2WXKA 3L10B 4NAWA 1MI0A 4RM8A 3AE1B 4G50A 4IWOA 4KKJA 3J9CA 2PKOA 3AE8B 2ZW1A 2ZPYA 2RSUA 3Q8FA 4FULA 2WDRB 1WRDB 1JWBD 3IT6B 1XLPA 3LJ3A 1D4BA 4ZYNA 1F2RC 3R8BA 2J0KA 2K0PA 2KNBA 4KDIC 4JPSA 3MJ5A 2QDFA 4ANVA 4NJ6A 3ZIMA 3PRPB 3R66C 3DBHI 2KOXA 1WYWB 3KUCB 1TKGA 4N58A 3WA0A 1PFDA 4DBGA 2O6VB 2KTRA 4K7UA 2IO2B 3Q69A 1BUIC 2V3NA 4OZBA 2ZVNA 3PHWB 4XDCA 3AH7A 3ZUNA 4DHZE 4OW0A 1BXTA 4MJSA 2KYWA 1JWMD 3C19A 3RCZA 1CK1A 3AEBB 2KVZA 2LEKA 2GBNA 2KAJA 4EKUA 4TMAB 2CHXA 2NS5A 4YL8A 1WSPA 2KMCA 1HTOA 4BAXA 2KVRA 4N6EB 2LGSA 3VRBB 1QZEA 4ZRPA 3DBRI 2AL6A 4ANXA 2CS4A 4XC2A 1WJNA 1XLQA 2L52A 4A8XC 1KTKA 1DOIA 3ENEA 1XF5L 1M94A 3PHXB 3AEDB 4LJOB 4A55A 1HQRD 4XGAB 2FIDA 1WGYA 2D3AA 1JALA 1I4RA 3H1UA 5LXIB 4HPLB 1YN4A 1OTRB 2KQ7A 3U7DA 3EFCA 1L6VA 3FILB 4I6LB 1ZUD2 3PV1A 1QKZA 3VVWB 2OJWA 2WX0A 3QC8B 1LO5D 3V6CB 3OWEB 2O2VA 2FNJB 1EF1A 4PYZA 3N1YC 4J3OD 1STEA 1PGAA 1SF0A 2ASQA 3WIMA 1WE6A 3ZTDA 4WQOB 1EF5A 2Y5BB 1L4ZB 3I57A 4HRSA 2GBRA 3DVNV 3ONSA 5TR5A 1SB3C 1M4VA 1UGJA 1MG4A 1GOZA 2J7QB 1KH0A 3MC8A 1I42A 5KHQA 1UUPA 1L0YB 1V6EA 2WU5B 5D94A 2K3UA 5BMHA 4BVUC 4TKNA 2HE7A 5IOIA 2WP9B 3NY5A 1J7AA 1I4PA 1F9JA 3Q2AC 4TQ0A 4MM3B 4YSXB 4ARIA 3ZYYX 1N5WA 2NCNA 2LVOA 3PSEB 2WXIA 3DVGX 1OQRA 1DGJA 1YQ3B 1E8XA 3VAWA 1V8CA 2BW2A 3VDZA 3KQ4A 1KLVA 2QEJC 1OFFA 3JYUA 3O13A 1WGKA 5CTRC 1R7SA 3GOEA 2AEHA 2DZIA 4DDGD 4WURA 4F8CB 4YTNB 2J52A 2RMMA 2BS3B 2KDIA 3SFDB 5IO9A 3RNAC 3RNFC 2WXPA 2A5UA 4KIKA 2Y3AA 3ZGZA 3AECB 3MP9A 1FNVA 5CHWA 1ET9A 2UWQA 2FE8A 1N62A 4AUQC 2KK8A 1YQBA 1FXTB 2LZ6A 2V4LA 5H8YE 4IM2A 1YJIA 3IBEA 1RYJA 1F0ZA 3RNEC 1K50A 1V86A 1SEBD 1NI2A 4F7ZA 4JL9A 3GZNB 5E6OA 3GE3C 3U7ZA 4C4VB 1IBXB 2MCNB 4OZCA 4LDTB 2DAJA 2N9PC 2KMMA 2PMVA 1LQBA 1QF6A 2M0XA 3WCQA 4FJZA 2VH2A 1XXGA 1IGCA 2M0AA 2CJNA 3QA8A 1WXAA 2FIFA 2LHEA 1Q10A 1ZXHA 3A4RA 3DPDA 1IPGA 1TGZB 2CR5A 4YSZB 1E10A 1BT0A 4NZLB 4RF0A 2KLGA 4WJOA 4HXDA 3VQIA 4L2YA 2KWVB 4YT0B 2BPSA 3K9PB 1R4MI 2M1MA 2WYQA 2X8XX 1VCBA 1A70A 2M19A 3SU8X 3MHSD 4M00A 4MT5A 2NMQA 4NAWB 2GOWA 1RAXA 4ITKA 1WRIA 3Q6BA 3EUB2 1KJTA 3AXCA 1NEKB 3ZJTA 3U52E 3RD2A 2Z8LA 2WNMA 1OQYA 4KSKC 1WX8A 2PIAA 2QIEB 2RGFA 4MGKE 1WR6E 2AWTA 2KLCA 4KDLB 1ZW7A 4ZRQA 4IWPA 3ZXRA 1JW9D 2DAFA 4DXGA 2K6DB 2LASA 2BYFA 4K1RB 4EZLA 2JRIB 4BZAA 2NBVB 1SIFA 2KJ6A 3PZ8A 4R3DA 3DBLI 2DYOA 2L1AA 3DVNU 4JIOU 1TYGB 2OJRA 2KACA 4H2AA 2KTRB 1T0SC 2QMTA 3OJ3A 3CF6E 4W9JA 2KZRA 1CZPA 4BFRA 2G4SA 4DHZB 4WWOA 4RNAA 1UZXB 5L83A 4RFBA 2EMSA 4WWNA 1HZ6A 2N7EA 3Q8AA 3AEAB 4MJSB 1QILA 1SIJA 3SR6A 1F1HA 2NTSA 4DHJB 2BYTA 3N20C 2RPVA 1C4AA 1FRDA 4GOCA 5E6NA 2BYVE 1Q0WB 3Q14C 1ROEA 4FLHA 2JWUA 2WS3B 4WJPA 4B0MA 3QK0A 2INNE 4NQKE 4MGYE 1VZ6A 2KWCA 4KGRA 3AE2B 5AEKB 1V5TA 3W1SC 4NPNA 3BZDB 2BB6A 1GG3A 4W9FA 3U30A 4TUUA 4B0EA 4ZRKA 4C7ZA 2WXGA 1N61A 3PPAA 3V60A 2DBYA 3Q3JA 5AZGA 3P1MA 4IUMB 3N32A 3B08A 5EE9A 4FBJB 1D5MC 1FD6A 2XK5A 3UF8A 3NZSA 2FAZA 4TQ1A 4DWFA 1PGBA 5CX3A 3DVGY 2D11A 5EE0A 4KVGB 4HDQA 1WMHA 2JYTA 4IC7B 2O2VB 4FHJA 1E5WA 3DOWA 1QOFA 3H7PA 4B6WA 1NI3A 1GC6A 1QLBB 3Q3FA 3K9OB 1I7HA 2BGFA 4M0WA 2WXJA 1DOYA 4NQLB 5L95C 2N7JA 3M62B 4BKSD 4BKTA 4PS8A 1I4QA 2WXOA 2JXTA 3P2BA 5D6JB 3AU4A 3I3TB 4L1BA 2EMTA 3TMPB 3H6NA 1A5RA 2I2YA 4K7SA 1AWDA 2LGIA 1HXYD 2LWPA 1NBFC 3TEYA 5G5GA 2N9XA 1K8RB 2KN4A 2MX2A 4HK2A 4OVVA 1FIQA 1I4XA 1C77A 4KX6B 2LJIA 3KLSX 2W9NA 4YXDB 2FCNA 5HG2A 4WWPA 5I4DA 3Q8BA 1N60A 1P9DU 1L0XB 2D2QA 2LHDA 1R4NB 3UGBB 1J19A 3BIID 1LXDA 3PREA 3DHHC 3H9DA 4XZ4A 2DZKA 3ZRCA 2WHIA 1WM3A 3TSSA 3L4PA 2SAKA 5JHBA 4KIKB 1FEHA 2GRIA 1V5OA 5D7GA 2G1EA 2IO1B 3NVWA 2HTHA 3TL5A 3NOBA 1EU4A 1IGDA 1YD8U 1ZDXA 2BTEA 3W1YA 3M63B 4I6PA 1F52A 2K9XA 1SE4A 1HTQA 1AYFA 1ZXIA 4K3BA 1YN5A 2ZEQA 3ZRFA 4B9KA 2WLBA 2BT6A 2KD0A 4M8NA 1E7UA 4NJ7A 3QWZB 3L0WB 2LFIA 4J6IA 4GGQA 3PLVA 1G6JA 2C60A 4GSWA 3ZNHB 3WANA 3W1SA 4CYEA 2L7RA 1UELA 2UYZB 1WR1A 4N59A 2LUEA 3RNCC 4DXAB 1WYGA 1JWUD 5D3IB 2REXA 2JQRB 5TSSA 2JUOA 3ZXVA 2ICIA 2JSVX 1F77A 4FADA 3AE5B 2NR2A 2MSED 3KWVA 3M3JA 2QILA 2HJ1A 3SFEB 2DX5B 2EKEC 4HKZE 1QOGA 4TV3A 3ZKJC 5FR6A 5BO4B 1P0RA 1XEEA 3KUDB 3U8ZA 2GI9A 2WWZA 3A9KA 1WM2A 2PVGC 3W5VB 4EZJA 1FMAD 1RM6C 3N30A 2BS4B 2VZKB 1VRAB 1LFDA 2JZ3B 3QIJA 2KQ4X 2L0TA 2RD0A 3TBLD 1I4GA 2BWFA 2XNAC 3Q8EA 3MJWA 4WWMA 4BBNC 3PLUA 5BYSA 1ZP0B 1SGHA 1PQSA 2KFKA 3W9CB 4EOYA 2GBMA 2YVCA 2PLPA 1PDXA 3NHEB 1P7EA 1TTNA 2GBKA 2IDYA 4IOIE 3NS8A 2JRHA 1ZPSA 1C4PA 3VUYA 2K8HA 2I38A 4CHKA 3DDCB 1GJZA 3CMMB 3HM6X 1F2RI 1Q1OA 4WJNA 5J18A 2KC2A 3B0AA 4GDKA 4W9HA 2AX5A 2DZJA 1NDDA 1C9FA 4KGTA 3AE6B 1E8WA 1VZ8A 4JLCA 1B9RA 1V80A 1FNUA 2JWZA 5E6PA 4HJGE 3P63A 5DPWA 3VTVA 2IZVB 2RR9A
chains in the Genus database with same CATH topology
5AZFA 4MM3A 2WYQA 3IFWB 3LDZE 2KX0A 3KYCD 3PZDA 4HLEA 1C1YB 1VCBA 2BWES 3PT2B 3C0RB 3VTWA 4ASWC 3JVZX 5AZHA 1WXSA 5HKHA 2MBBB 3JSVA 2HJ8A 4NY0A 2K25A 2C5LC 3PVLA 4MSMB 2LGXA 3SU8X 3MHSD 3JW0X 1YIWA 3RUIB 4AJYB 3DBSA 4NAWB 2GOWA 2L3ZA 1RAXA 4EEWA 3H7SA 2M17A 3O65B 4I6NB 1KJTA 1RRBA 1KOTA 1U4AA 2CHWA 2N4FA 4IM3A 2LVQA 4GU2A 3UIPB 3RZFA 3AXCA 2D07B 2FCQA 2C7MB 4II3B 3ZVVA 3RD2A 1ZKHA 1P3QU 5J2RA 2KTFA 4E71A 3EC8A 3UQAA 1OQYA 1WX7A 3PRMB 4KSKC 4EFOA 3PTFC 1WX8A 3VHTC 4A3PA 3X0WA 2RGFA 4MGKE 4FHKA 4MSQB 1WR6E 1E7VA 2AWTA 2KMAA 2KLCA 4KDLB 2YLMA 3EHVA 2BYEA 1ZW7A 3V6EB 3VTVA 4IWPA 2MP2B 2DAFA 2XEWA 1V49A 4GDLB 3QCAA 4GXBA 2K6DB 2IY1B 2LASA 3APCA 3ZDMC 3ZLZA 2BYFA 3IG3A 4K1RB 4II2B 4URKA 2XK5B 3RULA 2LI5A 4EZLA 2JRIB 1TZ1A 3RYTA 4JQWC 3CSTA 3APDA 2IO3B 1ISNA 2NBVB 1SIFA 3AI5A 4ZRJA 2KJ6A 3BINA 2MW5A 4HWIB 3AULA 2PE6B 1WMHB 3DBLI 3EFUA 2PE9A 4IW0A 2NPTB 2DYOA 4OVUA 4EUTA 2Z59B 3DVNU 2K39A 4JIOU 2KDFB 2JVCA 4RMAA 3H7PB 2RPQA 2OJRA 3TCAA 4IM0A 2KTRB 3R3MA 3QAQA 5DPSA 2MWSB 2NBUA 3OLMD 1WI0A 4CYEA 4M0WB 1KM7A 4GN1A 2MQJA 2JY6A 3OJ3A 2V1YA 3CF6E 1WX9A 1HE8A 4W9JA 4ANUA 1C3TA 2KZRA 4AOFA 3A33B 3AU5A 4BFRA 1XQQA 2G4SA 4WWOA 4DHZB 1UZXB 2BKRB 3WAPA 4MELA 3SDLC 5L83A 4G11A 3R7QA 3WAMA 2EMSA 2QHOA 4DHJD 2MRPA 2C7NB 2BF8B 4WWNA 3VXWA 1EO6A 3KUZA 2R2OA 2JF5A 2LRUA 3TIXA 2CHZA 2N7EA 4E74A 4MGZE 4MJSB 4P7IA 3DQVA 1OEYA 1WZ0A 2A4ZA 1MG8A 4AP4C 4DHJB 3SHQA 3L54A 2J0JA 3L16A 4GOCA 5E6NA 2BYVE 1Q0WB 4E3CA 4ZRIA 2LXAA 3A9JB 2K8BA 3V61A 3ZNZB 2CU1A 2KO3A 4FLHA 2KXJA 2JZZA 4BKGA 3VUXA 4WJPA 4PS7A 2MBQA 4W9IA 5KHOA 1L7YA 3IVFA 3D32A 5IAAC 3QK0A 1J8CA 2L00B 3WALA 2LXCA 3EECA 2KWUB 3L10B 3APFA 4NAWA 4NQKE 4RM8A 1R4NI 4MGYE 4FA6A 2FUHB 2N1WA 1WGRA 4G50A 2KWCA 4K81A 1V81A 3RT3B 3UIOB 1E8YA 1YX5B 3VUWA 2DENB 3ZNID 5AEKB 1V5TA 4IWOA 4NPNA 3W1SC 2MBHA 5DPTA 1CMXB 1GG3A 3QX1A 4W9FA 3U30A 4TUUA 4BOZB 4ZRKA 4FN2A 2ZPYA 2RSUA 1WH3A 4FULA 3A1QB 2M1MA 3L13A 3PPAA 4KV2A 1WF9A 1WRDB 4BBNF 3V60A 2MP2A 2M4NA 2NBWB 4XX5A 1IYFA 3LJ3A 3L08A 3Q3JA 4W9LA 5AZGA 4CO7A 4ZYNA 3IHPC 5EDSA 4GDLA 4IUMB 3MTNB 3B08A 3N32A 4FBJB 2XK5A 3UF8A 3NZSA 2FAZA 5J17A 2MA9B 4TQ1A 4DWFA 1UBIA 2ZCBA 5CX3A 1H8CA 2LRWA 3DVGY 2J0KA 5JHAA 2KNBA 4KDIC 2ZNVB 2D11A 3X23A 2KJHB 4KVGB 4HDQA 4ANVA 4NJ6A 3ZIMA 1WMHA 2KANA 2NPTA 3PRPB 4IC7B 3R66C 2O2VB 2O6VD 1S1QB 2FCSA 4FHJA 3WAOA 1H4RA 1WFYA 3DBHI 4B95A 1E5WA 2KOXA 1WYWB 1WJ6A 3DOWA 3KUCB 3ML8A 3H7PA 4HCPB 1UH6A 4B6WA 1GC6A 3WA0A 4DBGA 4G3XB 3ALBA 2O6VB 3Q3FA 2KTRA 1AARA 3K9OB 2NVUI 4K7UA 2IO2B 2BGFA 5D2MB 2MBEA 1RFAA 4MGIE 4NQLB 2ZZPB 5L95C 1YJ1A 3HIZA 3B1LX 3M62B 4BKSD 2ZVNA 3VH4B 4BKTA 4PS8A 3PHWB 1Y8RC 2PJHA 3PGEA 3ZUNA 4DHZE 1E8ZA 2AL3A 3P2BA 2JXXA 5D6JB 3ZDTA 3AU4A 3I3TB 2PPHA 4MJSA 3CSFA 3T8MA 3RCZA 2DYMA 2ZPNA 1Q5WB 2WX1A 2D3GA 5JZEB 2GBNA 2ZVOA 4EKUA 2EMTA 3TMPB 3H6NA 2PEAA 1A5RA 1V2YA 4K7SA 2KX3A 3A9JA 2CHXA 2NS5A 2K8CA 4YL8A 2KMCA 4MH0E 1V9JA 2KVRA 1QZEA 2ZNVC 2LWPA 1NBFC 1UBQA 2N9XA 3DBRI 1K8RB 2AL6A 2DHZA 2LGYA 5GMVA 2DZMA 2KC1A 4ANXA 2CS4A 2MX2A 4XC2A 1L2NA 1WJNA 4ZDVA 4HK2A 4OVVA 5LXHA 1E90A 4BOSC 1YX6B 3ENEA 3NZUA 1M94A 3M95A 2KHWB 3QQ8B 2J0MA 3PHXB 2L8JA 2W9NA 4LJOB 4ANWA 1ZGUB 2V3SA 2FCNA 2JT4B 1XD3B 1LM8B 2MBOA 4MDKE 4PS3A 4WWPA 2FIDA 1WGYA 2XBBC 3HHMA 3A1QA 4W9GA 2BKFA 2ZJDA 4ICVA 2JPHA 3H1UA 5LXIB 1P9DU 4HPLB 1I35A 1OTRB 4HVBA 2KQ7A 2D2QA 4HCNB 4RM9A 3U7DA 1XT9B 4JGHB 3UGBB 1J19A 1S3SG 1EUVB 1LXDA 3KYDD 3H9DA 3PREA 3UINB 4XZ4A 1Z2MA 2FCMA 4I6LB 2DZKA 5CHFA 3V62A 3ZRCA 1WM3A 5DPRA 3A9KB 3PV1A 2LD9A 3KW5B 3VVWB 3GZNI 2KDBA 2WX0A 4A20A 3QC8B 3V6CB 5JHBA 4KIKB 1V5OA 3QJZA 2R2QA 3PRZA 1GUAB 2O2VA 2FNJB 1EF1A 1WJUA 5D7GA 4PYZA 1WJ4A 2IO1B 2HTHA 3TL5A 2N1VA 3WIMA 2ASQA 3ZTDA 1WE6A 4A3OA 3NOBA 1YD8U 2O6VA 3W1YA 3M63B 4WQOB 2IY0B 1EF5A 4I6PA 1P98A 2Y5BB 2KFKB 3RZWC 1WGGA 4GB9A 4N9F4 4F1SA 3ZO5B 4FJVB 2Z0EB 1OGWA 2GBRA 3UQBA 2DYBA 3DVNV 3ONSA 4KZCA 5TR5A 3VTUA 2B3AA 3OJ4B 2CKHB 4KSLC 2KFJA 2ZEQA 3QHTA 3HM3A 3ZRFA 4B9KA 2KD0A 2J7QB 3T9LA 4BKSA 4DK5A 3ZW3A 4M8NA 1I42A 1E7UA 5KHQA 4W9DA 4NJ7A 2VRRB 3QWZB 2G3QB 3S2AA 3L0WB 4GDKB 2KKCA 4J6IA 4GGQA 1V6EA 3PLVA 1G6JA 2C60A 3ZTCA 4GSWA 2IBIB 5D94A 3ZNHB 3WANA 4BVUC 3W1SA 5DCNA 1WE7A 1WGDA 3OAWA 1WZ3A 1UELA 2L0FA 2L7RA 1WR1A 2UYZB 4TKNA 1T0YA 4X57B 2HE7A 2LUEA 2WDTB 1X1MA 3NY5A 4DXAB 1UGMA 1F9JA 4FJYA 4TQ0A 2LJ5A 2REXA 2I1KA 2G4DB 3VH3B 5IA7A 2NCNA 2LVOA 2JUOA 3PSEB 3DVGX 2C7HA 3KH0A 4AWJA 2G45B 5CHVC 4FADA 1E8XA 1TBEA 3VAWA 3VDZA 1KLVA 2NR2A 2MSED 3M3JA 3JYUA 3JSVB 2HD5B 5CTRC 4HPMB 2K1FA 2D10A 2DX5B 2EKEC 1D3ZA 4LJPB 3GOEA 4WAAA 3R7RA 1WIAA 2AEHA 4G0NB 4M8MA 4W9EA 2KN5A 4EZKA 2I1JA 4TV3A 3ZKJC 5FR6A 2KDEB 2DZIA 4DDGD 5BO4B 4PYUA 5G55A 4F8CB 2KJRA 4IWQA 1P0RA 3KUDB 3U8ZA 2WWZA 4HJKA 3A9KA 2AYOB 1WM2A 1WGHA 4EZJA 2N9EB 2KDIA 3N30A 2K6QA 1JRUA 4W9CA 1IP9A 1LFDA 3ECIA 2JZ3B 3ML9A 3QIJA 2A5UA 4KIKA 2L0TA 2C9WB 2RD0A 3TBLD 2BWFA 5CHWA 2UWQA 3HK0A 5G2NA 1GNUA 2Z0DB 2KK8A 1YQBA 1FXTB 2LZ6A 2V4LA 3DCGA 4AUQC 1GC7A 3KVFB 3MJWA 5C1ZA 2L76A 4BBNC 3PLUA 4IM2A 3IBEA 5JH5C 1SGHA 2OOBB 2LGDA 1PQSA 2KFKA 1V86A 4LDTD 4EOYA 4HDOA 1NI2A 2MLBA 4DDID 4F7ZA 2GBMA 4JL9A 4WJQA 5E6OA 1WXVA 2KQSA 2YVCA 3TJPA 3N3KB 2MCNB 3NHEB 1TTNA 4NNJB 2GBKA 4LDTB 4MEMA 2DAJA 2N9PC 3PS6A 1VD2A 2JRHA 1P1AA 1LQBA 1WXMA 2M0XA 1RLFA 3NS8A 4ICUA 4KZ0A 4FJZA 3VUYA 3VFKA 3L17A 2K8HA 4CHKA 2ZCCA 3DDCB 2IYDB 3QA8A 1GJZA 3CMMB 3HM6X 1WXAA 4GMVA 1WY8A 1Q1OA 2FIFA 2GMIC 2KC2A 4WJNA 3ZNGC 1UD7A 3B0AA 4GDKA 5J18A 3A4RA 1IPGA 3DPDA 4W9HA 4LCDE 1TGZB 1NDDA 2CR5A 2DZJA 1BT0A 4AJWA 1OEYJ 2LVPA 4GIVA 1Z5SB 1E8WA 4IG7B 2IO0B 2KLGA 4JLCA 4WJOA 4HXDA 3SD5A 3A4SC 1J0GA 5C23A 1V80A 3VQIA 2JWZA 4W9KA 3BY4B 5E6PA 1SE9A 5LLIA 3QARA 2KWVB 2L05A 2GBJA 5DPWA 2BPSA 3K9PB 2M8SA 1R4MI 4K7WA 2IZVB 2N7DA 2RR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AZF A;  4MM3 A;  2WYQ A;  3IFW B;  3LDZ E;  2KX0 A;  3KYC D;  3PZD A;  4HLE A;  1C1Y B;  1VCB A;  2BWE S;  3PT2 B;  3C0R B;  3VTW A;  4ASW C;  3JVZ X;  5AZH A;  1WXS A;  5HKH A;  2MBB B;  3JSV A;  2HJ8 A;  4NY0 A;  2K25 A;  2C5L C;  3PVL A;  4MSM B;  2LGX A;  3SU8 X;  3MHS D;  3JW0 X;  1YIW A;  3RUI B;  4AJY B;  3DBS A;  4NAW B;  2GOW A;  2L3Z A;  1RAX A;  4EEW A;  3H7S A;  2M17 A;  3O65 B;  4I6N B;  1KJT A;  1RRB A;  1KOT A;  1U4A A;  2CHW A;  2N4F A;  4IM3 A;  2LVQ A;  4GU2 A;  3UIP B;  3RZF A;  3AXC A;  2D07 B;  2FCQ A;  2C7M B;  4II3 B;  3ZVV A;  3RD2 A;  1ZKH A;  1P3Q U;  5J2R A;  2KTF A;  4E71 A;  3EC8 A;  3UQA A;  1OQY A;  1WX7 A;  3PRM B;  4KSK C;  4EFO A;  3PTF C;  1WX8 A;  3VHT C;  4A3P A;  3X0W A;  2RGF A;  4MGK E;  4FHK A;  4MSQ B;  1WR6 E;  1E7V A;  2AWT A;  2KMA A;  2KLC A;  4KDL B;  2YLM A;  3EHV A;  2BYE A;  1ZW7 A;  3V6E B;  3VTV A;  4IWP A;  2MP2 B;  2DAF A;  2XEW A;  1V49 A;  4GDL B;  3QCA A;  4GXB A;  2K6D B;  2IY1 B;  2LAS A;  3APC A;  3ZDM C;  3ZLZ A;  2BYF A;  3IG3 A;  4K1R B;  4II2 B;  4URK A;  2XK5 B;  3RUL A;  2LI5 A;  4EZL A;  2JRI B;  1TZ1 A;  3RYT A;  4JQW C;  3CST A;  3APD A;  2IO3 B;  1ISN A;  2NBV B;  1SIF A;  3AI5 A;  4ZRJ A;  2KJ6 A;  3BIN A;  2MW5 A;  4HWI B;  3AUL A;  2PE6 B;  1WMH B;  3DBL I;  3EFU A;  2PE9 A;  4IW0 A;  2NPT B;  2DYO A;  4OVU A;  4EUT A;  2Z59 B;  3DVN U;  2K39 A;  4JIO U;  2KDF B;  2JVC A;  4RMA A;  3H7P B;  2RPQ A;  2OJR A;  3TCA A;  4IM0 A;  2KTR B;  3R3M A;  3QAQ A;  5DPS A;  2MWS B;  2NBU A;  3OLM D;  1WI0 A;  4CYE A;  4M0W B;  1KM7 A;  4GN1 A;  2MQJ A;  2JY6 A;  3OJ3 A;  2V1Y A;  3CF6 E;  1WX9 A;  1HE8 A;  4W9J A;  4ANU A;  1C3T A;  2KZR A;  4AOF A;  3A33 B;  3AU5 A;  4BFR A;  1XQQ A;  2G4S A;  4WWO A;  4DHZ B;  1UZX B;  2BKR B;  3WAP A;  4MEL A;  3SDL C;  5L83 A;  4G11 A;  3R7Q A;  3WAM A;  2EMS A;  2QHO A;  4DHJ D;  2MRP A;  2C7N B;  2BF8 B;  4WWN A;  3VXW A;  1EO6 A;  3KUZ A;  2R2O A;  2JF5 A;  2LRU A;  3TIX A;  2CHZ A;  2N7E A;  4E74 A;  4MGZ E;  4MJS B;  4P7I A;  3DQV A;  1OEY A;  1WZ0 A;  2A4Z A;  1MG8 A;  4AP4 C;  4DHJ B;  3SHQ A;  3L54 A;  2J0J A;  3L16 A;  4GOC A;  5E6N A;  2BYV E;  1Q0W B;  4E3C A;  4ZRI A;  2LXA A;  3A9J B;  2K8B A;  3V61 A;  3ZNZ B;  2CU1 A;  2KO3 A;  4FLH A;  2KXJ A;  2JZZ A;  4BKG A;  3VUX A;  4WJP A;  4PS7 A;  2MBQ A;  4W9I A;  5KHO A;  1L7Y A;  3IVF A;  3D32 A;  5IAA C;  3QK0 A;  1J8C A;  2L00 B;  3WAL A;  2LXC A;  3EEC A;  2KWU B;  3L10 B;  3APF A;  4NAW A;  4NQK E;  4RM8 A;  1R4N I;  4MGY E;  4FA6 A;  2FUH B;  2N1W A;  1WGR A;  4G50 A;  2KWC A;  4K81 A;  1V81 A;  3RT3 B;  3UIO B;  1E8Y A;  1YX5 B;  3VUW A;  2DEN B;  3ZNI D;  5AEK B;  1V5T A;  4IWO A;  4NPN A;  3W1S C;  2MBH A;  5DPT A;  1CMX B;  1GG3 A;  3QX1 A;  4W9F A;  3U30 A;  4TUU A;  4BOZ B;  4ZRK A;  4FN2 A;  2ZPY A;  2RSU A;  1WH3 A;  4FUL A;  3A1Q B;  2M1M A;  3L13 A;  3PPA A;  4KV2 A;  1WF9 A;  1WRD B;  4BBN F;  3V60 A;  2MP2 A;  2M4N A;  2NBW B;  4XX5 A;  1IYF A;  3LJ3 A;  3L08 A;  3Q3J A;  4W9L A;  5AZG A;  4CO7 A;  4ZYN A;  3IHP C;  5EDS A;  4GDL A;  4IUM B;  3MTN B;  3B08 A;  3N32 A;  4FBJ B;  2XK5 A;  3UF8 A;  3NZS A;  2FAZ A;  5J17 A;  2MA9 B;  4TQ1 A;  4DWF A;  1UBI A;  2ZCB A;  5CX3 A;  1H8C A;  2LRW A;  3DVG Y;  2J0K A;  5JHA A;  2KNB A;  4KDI C;  2ZNV B;  2D11 A;  3X23 A;  2KJH B;  4KVG B;  4HDQ A;  4ANV A;  4NJ6 A;  3ZIM A;  1WMH A;  2KAN A;  2NPT A;  3PRP B;  4IC7 B;  3R66 C;  2O2V B;  2O6V D;  1S1Q B;  2FCS A;  4FHJ A;  3WAO A;  1H4R A;  1WFY A;  3DBH I;  4B95 A;  1E5W A;  2KOX A;  1WYW B;  1WJ6 A;  3DOW A;  3KUC B;  3ML8 A;  3H7P A;  4HCP B;  1UH6 A;  4B6W A;  1GC6 A;  3WA0 A;  4DBG A;  4G3X B;  3ALB A;  2O6V B;  3Q3F A;  2KTR A;  1AAR A;  3K9O B;  2NVU I;  4K7U A;  2IO2 B;  2BGF A;  5D2M B;  2MBE A;  1RFA A;  4MGI E;  4NQL B;  2ZZP B;  5L95 C;  1YJ1 A;  3HIZ A;  3B1L X;  3M62 B;  4BKS D;  2ZVN A;  3VH4 B;  4BKT A;  4PS8 A;  3PHW B;  1Y8R C;  2PJH A;  3PGE A;  3ZUN A;  4DHZ E;  1E8Z A;  2AL3 A;  3P2B A;  2JXX A;  5D6J B;  3ZDT A;  3AU4 A;  3I3T B;  2PPH A;  4MJS A;  3CSF A;  3T8M A;  3RCZ A;  2DYM A;  2ZPN A;  1Q5W B;  2WX1 A;  2D3G A;  5JZE B;  2GBN A;  2ZVO A;  4EKU A;  2EMT A;  3TMP B;  3H6N A;  2PEA A;  1A5R A;  1V2Y A;  4K7S A;  2KX3 A;  3A9J A;  2CHX A;  2NS5 A;  2K8C A;  4YL8 A;  2KMC A;  4MH0 E;  1V9J A;  2KVR A;  1QZE A;  2ZNV C;  2LWP A;  1NBF C;  1UBQ A;  2N9X A;  3DBR I;  1K8R B;  2AL6 A;  2DHZ A;  2LGY A;  5GMV A;  2DZM A;  2KC1 A;  4ANX A;  2CS4 A;  2MX2 A;  4XC2 A;  1L2N A;  1WJN A;  4ZDV A;  4HK2 A;  4OVV A;  5LXH A;  1E90 A;  4BOS C;  1YX6 B;  3ENE A;  3NZU A;  1M94 A;  3M95 A;  2KHW B;  3QQ8 B;  2J0M A;  3PHX B;  2L8J A;  2W9N A;  4LJO B;  4ANW A;  1ZGU B;  2V3S A;  2FCN A;  2JT4 B;  1XD3 B;  1LM8 B;  2MBO A;  4MDK E;  4PS3 A;  4WWP A;  2FID A;  1WGY A;  2XBB C;  3HHM A;  3A1Q A;  4W9G A;  2BKF A;  2ZJD A;  4ICV A;  2JPH A;  3H1U A;  5LXI B;  1P9D U;  4HPL B;  1I35 A;  1OTR B;  4HVB A;  2KQ7 A;  2D2Q A;  4HCN B;  4RM9 A;  3U7D A;  1XT9 B;  4JGH B;  3UGB B;  1J19 A;  1S3S G;  1EUV B;  1LXD A;  3KYD D;  3H9D A;  3PRE A;  3UIN B;  4XZ4 A;  1Z2M A;  2FCM A;  4I6L B;  2DZK A;  5CHF A;  3V62 A;  3ZRC A;  1WM3 A;  5DPR A;  3A9K B;  3PV1 A;  2LD9 A;  3KW5 B;  3VVW B;  3GZN I;  2KDB A;  2WX0 A;  4A20 A;  3QC8 B;  3V6C B;  5JHB A;  4KIK B;  1V5O A;  3QJZ A;  2R2Q A;  3PRZ A;  1GUA B;  2O2V A;  2FNJ B;  1EF1 A;  1WJU A;  5D7G A;  4PYZ A;  1WJ4 A;  2IO1 B;  2HTH A;  3TL5 A;  2N1V A;  3WIM A;  2ASQ A;  3ZTD A;  1WE6 A;  4A3O A;  3NOB A;  1YD8 U;  2O6V A;  3W1Y A;  3M63 B;  4WQO B;  2IY0 B;  1EF5 A;  4I6P A;  1P98 A;  2Y5B B;  2KFK B;  3RZW C;  1WGG A;  4GB9 A;  4N9F 4;  4F1S A;  3ZO5 B;  4FJV B;  2Z0E B;  1OGW A;  2GBR A;  3UQB A;  2DYB A;  3DVN V;  3ONS A;  4KZC A;  5TR5 A;  3VTU A;  2B3A A;  3OJ4 B;  2CKH B;  4KSL C;  2KFJ A;  2ZEQ A;  3QHT A;  3HM3 A;  3ZRF A;  4B9K A;  2KD0 A;  2J7Q B;  3T9L A;  4BKS A;  4DK5 A;  3ZW3 A;  4M8N A;  1I42 A;  1E7U A;  5KHQ A;  4W9D A;  4NJ7 A;  2VRR B;  3QWZ B;  2G3Q B;  3S2A A;  3L0W B;  4GDK B;  2KKC A;  4J6I A;  4GGQ A;  1V6E A;  3PLV A;  1G6J A;  2C60 A;  3ZTC A;  4GSW A;  2IBI B;  5D94 A;  3ZNH B;  3WAN A;  4BVU C;  3W1S A;  5DCN A;  1WE7 A;  1WGD A;  3OAW A;  1WZ3 A;  1UEL A;  2L0F A;  2L7R A;  1WR1 A;  2UYZ B;  4TKN A;  1T0Y A;  4X57 B;  2HE7 A;  2LUE A;  2WDT B;  1X1M A;  3NY5 A;  4DXA B;  1UGM A;  1F9J A;  4FJY A;  4TQ0 A;  2LJ5 A;  2REX A;  2I1K A;  2G4D B;  3VH3 B;  5IA7 A;  2NCN A;  2LVO A;  2JUO A;  3PSE B;  3DVG X;  2C7H A;  3KH0 A;  4AWJ A;  2G45 B;  5CHV C;  4FAD A;  1E8X A;  1TBE A;  3VAW A;  3VDZ A;  1KLV A;  2NR2 A;  2MSE D;  3M3J A;  3JYU A;  3JSV B;  2HD5 B;  5CTR C;  4HPM B;  2K1F A;  2D10 A;  2DX5 B;  2EKE C;  1D3Z A;  4LJP B;  3GOE A;  4WAA A;  3R7R A;  1WIA A;  2AEH A;  4G0N B;  4M8M A;  4W9E A;  2KN5 A;  4EZK A;  2I1J A;  4TV3 A;  3ZKJ C;  5FR6 A;  2KDE B;  2DZI A;  4DDG D;  5BO4 B;  4PYU A;  5G55 A;  4F8C B;  2KJR A;  4IWQ A;  1P0R A;  3KUD B;  3U8Z A;  2WWZ A;  4HJK A;  3A9K A;  2AYO B;  1WM2 A;  1WGH A;  4EZJ A;  2N9E B;  2KDI A;  3N30 A;  2K6Q A;  1JRU A;  4W9C A;  1IP9 A;  1LFD A;  3ECI A;  2JZ3 B;  3ML9 A;  3QIJ A;  2A5U A;  4KIK A;  2L0T A;  2C9W B;  2RD0 A;  3TBL D;  2BWF A;  5CHW A;  2UWQ A;  3HK0 A;  5G2N A;  1GNU A;  2Z0D B;  2KK8 A;  1YQB A;  1FXT B;  2LZ6 A;  2V4L A;  3DCG A;  4AUQ C;  1GC7 A;  3KVF B;  3MJW A;  5C1Z A;  2L76 A;  4BBN C;  3PLU A;  4IM2 A;  3IBE A;  5JH5 C;  1SGH A;  2OOB B;  2LGD A;  1PQS A;  2KFK A;  1V86 A;  4LDT D;  4EOY A;  4HDO A;  1NI2 A;  2MLB A;  4DDI D;  4F7Z A;  2GBM A;  4JL9 A;  4WJQ A;  5E6O A;  1WXV A;  2KQS A;  2YVC A;  3TJP A;  3N3K B;  2MCN B;  3NHE B;  1TTN A;  4NNJ B;  2GBK A;  4LDT B;  4MEM A;  2DAJ A;  2N9P C;  3PS6 A;  1VD2 A;  2JRH A;  1P1A A;  1LQB A;  1WXM A;  2M0X A;  1RLF A;  3NS8 A;  4ICU A;  4KZ0 A;  4FJZ A;  3VUY A;  3VFK A;  3L17 A;  2K8H A;  4CHK A;  2ZCC A;  3DDC B;  2IYD B;  3QA8 A;  1GJZ A;  3CMM B;  3HM6 X;  1WXA A;  4GMV A;  1WY8 A;  1Q1O A;  2FIF A;  2GMI C;  2KC2 A;  4WJN A;  3ZNG C;  1UD7 A;  3B0A A;  4GDK A;  5J18 A;  3A4R A;  1IPG A;  3DPD A;  4W9H A;  4LCD E;  1TGZ B;  1NDD A;  2CR5 A;  2DZJ A;  1BT0 A;  4AJW A;  1OEY J;  2LVP A;  4GIV A;  1Z5S B;  1E8W A;  4IG7 B;  2IO0 B;  2KLG A;  4JLC A;  4WJO A;  4HXD A;  3SD5 A;  3A4S C;  1J0G A;  5C23 A;  1V80 A;  3VQI A;  2JWZ A;  4W9K A;  3BY4 B;  5E6P A;  1SE9 A;  5LLI A;  3QAR A;  2KWV B;  2L05 A;  2GBJ A;  5DPW A;  2BPS A;  3K9P B;  2M8S A;  1R4M I;  4K7W A;  2IZV B;  2N7D A;  2RR9 A; 
#chains in the Genus database with same CATH topology
 3CIR B;  4ZYS A;  2CJO A;  1L6U A;  5MPO A;  3IFW B;  1K51 A;  1TKE A;  3KYC D;  4WQM A;  3NRZ A;  3C0R B;  4ASW C;  2J42 A;  3JSV A;  1MHX A;  2HJ8 A;  4NY0 A;  2K25 A;  4MSM B;  4AJY B;  2KWD A;  4EEW A;  1TZO A;  2M17 A;  2AQ1 B;  1RRB A;  1T3Q A;  4IM3 A;  1AN8 A;  2LVQ A;  3DHG C;  3UIP B;  3RZF A;  3VR8 B;  2W54 A;  3EGR A;  1N6Z A;  4E71 A;  3EC8 A;  3UQA A;  3BWU D;  4EFO A;  4FHK A;  5BYR A;  1QQR A;  2JU6 X;  1XLO A;  1FXA A;  1C4C A;  2XEW A;  3URY A;  4KKI A;  3HVZ A;  3ZLZ A;  1YQ4 B;  3IG3 A;  4RGM A;  2L32 A;  2XK5 B;  3RUL A;  3RYT A;  3CST A;  1DOX A;  3MFG A;  4ZRJ A;  2WGS A;  2Y5P A;  4UDU C;  1CJE A;  3BIN A;  2MW5 A;  2GB1 A;  4HEA 1;  1WMH B;  3BYY B;  2PE9 A;  4OVU A;  1T0Q C;  5G5H A;  3B9J A;  3HVD A;  2JVC A;  4AQ7 A;  2WU2 B;  3H7P B;  3BK2 A;  3TCA A;  4A9A A;  3QAQ A;  2NBU A;  3AB5 A;  4M0W B;  3GP7 A;  1HZ5 A;  2WXR A;  2JY6 A;  1WX9 A;  1HE8 A;  1GB1 A;  1TJE A;  1C3T A;  3AU5 A;  2WXH A;  3R7Q A;  4A90 A;  1C76 A;  2R2O A;  1V97 A;  2LRU A;  3TIX A;  4E74 A;  4MGZ E;  4P7I A;  3DQV A;  1OEY A;  1WZ0 A;  1JML A;  2WXF A;  4AP4 C;  1NVI D;  3SHQ A;  1TKY A;  3TEZ A;  4E3C A;  2G9H D;  3W5U B;  3V61 A;  2CU1 A;  2KO3 A;  2IJ0 A;  2MBQ A;  4W9I A;  4RH6 A;  1P7F A;  3U4E G;  2KWU B;  5C2T B;  4OZA A;  3APF A;  2W55 A;  2OHF A;  1VZ7 A;  1D5X C;  4K81 A;  1V81 A;  1N63 A;  3UIO B;  1E8Y A;  3VUW A;  2DEN B;  3B2G A;  1YJJ A;  1JCK B;  5DPT A;  1CMX B;  3AE7 B;  4BOZ B;  3IT4 B;  2V9H A;  1WH3 A;  3ZQ4 A;  4US8 A;  3L13 A;  4KV2 A;  1WF9 A;  1V1P A;  4BBN F;  1JWA D;  2NBW B;  1TS3 A;  1IYF A;  4W9L A;  5D3D A;  4CO7 A;  4GDL A;  3MTN B;  1PYW D;  1ESF A;  2GLS A;  2B76 B;  2MA9 B;  1UBI A;  1YN3 A;  1H8C A;  2ZNV B;  1XCQ L;  2NPT A;  2O6V D;  2FCS A;  3WAO A;  1H4R A;  5BMG A;  1WFY A;  3DWM A;  1SBB B;  4B95 A;  4HCP B;  2D3B A;  4JX1 C;  1UH6 A;  1ACC A;  2EEL A;  2WQY B;  4P6V F;  2NVU I;  4RF1 A;  2MEK A;  5BYQ A;  2ZZP B;  3LYY A;  2H89 B;  3B1L X;  2R61 A;  4XWT A;  3VH4 B;  4YTP B;  4XE0 A;  2PJH A;  1E8Z A;  2AL3 A;  3ZDT A;  3T8M A;  4ZOH C;  2DYM A;  2ZPN A;  1Q5W B;  1JRP A;  2WX1 A;  2D3G A;  2FUG 1;  2IPK D;  3NUH B;  3RI7 C;  2KX3 A;  2N9K A;  2K8C A;  4MH0 E;  4C00 A;  1V9J A;  3E9S A;  2HDE A;  1VR9 A;  2NTT A;  2ZNV C;  2LGY A;  3IAS 1;  2DZM A;  4FXC A;  4WAF A;  3RMK C;  3RNB C;  4BOS C;  3TUO A;  2KHW B;  2J0M A;  2L8J A;  2J4X A;  1L4D B;  1ZGU B;  2V3S A;  3I63 C;  2JT4 B;  1XD3 B;  1LM8 B;  2MBO A;  4MDK E;  4YTM B;  4C7Y A;  3HHM A;  3A1Q A;  4LK0 M;  2BKF A;  1ZE3 D;  2ZJD A;  2JPH A;  4LTU A;  1L0V B;  4LNN A;  4HCN B;  4RM9 A;  4S17 A;  1K52 A;  3KYD D;  3UIN B;  3V62 A;  5DPR A;  3A9K B;  1J7B A;  3KW5 B;  2JZP A;  5HHD G;  3GZN I;  2KDB A;  2V0G A;  4US9 A;  3QJZ A;  2KT7 A;  2PTL A;  3PRZ A;  1GUA B;  2YEP B;  2INP E;  2N1V A;  4RGO S;  1AW7 A;  3AE3 B;  2IY0 B;  3AEE B;  1P98 A;  1YNT E;  1DYQ A;  2KFK B;  4WH4 A;  4F1S A;  4FJV B;  2Z0E B;  1OGW A;  2DYB A;  4KZC A;  3VTU A;  2B3A A;  2CKH B;  2XN9 C;  4KSL C;  2KFJ A;  3QHT A;  2D5G A;  3BYT B;  3DBH B;  3T9L A;  4BKS A;  3ZW3 A;  4W9D A;  1PUT A;  2G3Q B;  3S2A A;  4GDK B;  2KKC A;  3ZTC A;  2WDV B;  1YOV B;  5DCN A;  1WE7 A;  1WGD A;  1WZ3 A;  2L0F A;  2J53 A;  4ARC A;  5FK9 C;  2WDT B;  3C8Y A;  3Q3O C;  2DWQ A;  1QT9 A;  2LJ5 A;  2H88 B;  2I1K A;  1FFU A;  2M56 B;  5EE3 A;  5IA7 A;  1E0Z A;  5CHV C;  5E6J A;  1WXQ A;  3JSV B;  1EM7 A;  4HPM B;  2D10 A;  4G0N B;  4M8M A;  4W9E A;  1EWC A;  2LMC A;  3DBR B;  1FXI A;  2I1J A;  2KDE B;  3W2D A;  5G55 A;  3IXS A;  1T0R C;  1TS2 A;  4HJK A;  2AYO B;  2N9E B;  4A6Q A;  1D6E C;  3ECI A;  3EA6 A;  1V1O A;  3HK0 A;  1JWS D;  5AUI A;  3DCG A;  3P4R B;  1GC7 A;  2EKI A;  3MC9 A;  3KVF B;  1QOB A;  2L76 A;  2QCZ A;  2RDB C;  4JE3 B;  5JH5 C;  2OOB B;  4REZ A;  4LDT D;  2MLB A;  4WJQ A;  1WXV A;  2KQS A;  3TJP A;  3N3K B;  1I4H A;  5T8I A;  4DXF A;  1HEZ E;  2INC C;  3PS6 A;  4RGN A;  1KF6 B;  4ICU A;  1WXM A;  2V4I B;  4ZDV A;  4GMV A;  2DLB A;  4TSS A;  1T6B X;  4LCD E;  3FKY A;  2E6X A;  1YMH E;  3NVY A;  2LVP A;  4GIV A;  3VR9 B;  4IG7 B;  2IO0 B;  3SD5 A;  1TIF A;  3A4S C;  2K22 A;  3BY4 B;  3QAR A;  3ZJU A;  5AUK A;  4M01 A;  2M8S A;  4K7W A;  5AZF A;  4ACF A;  3BVZ A;  4HLE A;  3MHZ A;  1C1Y B;  1FCC C;  2BWE S;  3PT2 B;  3VTW A;  1VJK A;  1WXS A;  3N1Z C;  2C5L C;  2LGX A;  1E9M A;  3JW0 X;  1YIW A;  3DBS A;  1QOA A;  2L3Z A;  2MJ3 A;  3P4S B;  3H7S A;  4YWG G;  1U4A A;  2CHW A;  2N4F A;  4GU2 A;  4MAC A;  1NYQ A;  2FCQ A;  2C7M B;  4II3 B;  3ZVV A;  3U2S C;  1P3Q U;  2KTF A;  1WX7 A;  3AN1 A;  3VHT C;  2IND C;  4A3P A;  4USA A;  2KMA A;  3MC0 B;  3RPF C;  3DWG C;  3NS1 A;  4HRO A;  2BYE A;  1V1P B;  4IDI A;  4GDL B;  3QCA A;  3ZDM C;  2IY1 B;  3BVG A;  1Y56 A;  3P42 A;  2VH1 A;  4URK A;  3APD A;  2IO3 B;  3HRD D;  3AI5 A;  4HWI B;  2DNF A;  3AUL A;  3EFU A;  4XDD A;  4IW0 A;  2NPT B;  2WDQ B;  4EUT A;  4P1C C;  2Z59 B;  2K39 A;  1JQ4 A;  1ET6 A;  4DQO C;  4RMA A;  2RPQ A;  4IM0 A;  4GLS C;  2MWS B;  1ZDV A;  3OLM D;  2W3S A;  2MQJ A;  4GN1 A;  4ANU A;  4AOF A;  4LLG M;  3NVZ A;  2BKR B;  3SDL C;  2YEP F;  3WAM A;  2QHO A;  4DHJ D;  2MRP A;  3VXW A;  1EO6 A;  3KUZ A;  5IKC M;  2JF5 A;  2CHZ A;  2SEB D;  2W3R A;  1E6E B;  3AMZ A;  2A4Z A;  1MG8 A;  1TS4 A;  1E7P B;  2J0J A;  3ABV B;  1T5X D;  3T3N A;  3L16 A;  1SE3 A;  3SEB A;  2LXA A;  2K8B A;  4LNI A;  3VUX A;  5KHO A;  3IVF A;  5IAA C;  1GB4 A;  2ACZ B;  1MVK A;  2L00 B;  2HTM E;  1HA5 A;  4S0R A;  3LXF A;  1R4N I;  4FA6 A;  1R4M B;  2FUH B;  1B1Z A;  2N1W A;  2ONQ A;  1WGR A;  3RT3 B;  1YX5 B;  3ZNI D;  1FCL A;  2MBH A;  3QX1 A;  1MJD A;  4FN2 A;  1MHH E;  3A1Q B;  4HPP A;  1JRO A;  3LB8 C;  1MPE A;  2MP2 A;  2M4N A;  4XX5 A;  3L08 A;  5EDS A;  3IHP C;  1RWS A;  2BS2 B;  4LNO A;  2X38 A;  3ZJV A;  5J17 A;  1FPY A;  1UF0 A;  2ZCB A;  2LRW A;  5JHA A;  3V05 A;  3X23 A;  4EE2 A;  2KJH B;  2KAN A;  1TY0 A;  1XO3 A;  2QJL A;  1S1Q B;  1BML C;  2V3P A;  4CQN A;  2BQQ A;  3ML8 A;  4XYC A;  1WJ6 A;  4G3X B;  3ALB A;  1AAR A;  4NAM A;  2Y5C A;  5LNK 1;  3Q3M C;  5D2M B;  2MBE A;  1RFA A;  3PO0 A;  4MGI E;  3V3X A;  4WIP A;  1YJ1 A;  3HIZ A;  2AQ3 B;  3GE8 C;  1LGR A;  2N0S B;  1Y8R C;  3DBL B;  3PGE A;  3GS2 A;  2JXX A;  2PPH A;  3CSF A;  1SXT A;  1UNS A;  2K5P A;  1XLN A;  5JZE B;  2D3C A;  2ZVO A;  1CQV A;  2PEA A;  2WXQ A;  1V2Y A;  2TSS A;  3A9J A;  5FR3 A;  2IGG A;  1UBQ A;  2DHZ A;  5GMV A;  2KC1 A;  1L2N A;  3AEF B;  2RDH A;  2PW9 A;  4MH8 A;  1KLU D;  5LXH A;  1E90 A;  1C78 A;  4Q2J A;  4O1N A;  1ZOY B;  1YX6 B;  3NZU A;  3M95 A;  3QQ8 B;  2LUM A;  3I5J C;  3OG5 A;  4ANW A;  4PT5 A;  1RFK A;  4PS3 A;  4K3C A;  2XBB C;  4W9G A;  4L23 A;  1EU3 A;  4ICV A;  5BMI A;  1I35 A;  4HVB A;  1L5P A;  1XT9 B;  4JGH B;  4D2K A;  1S3S G;  1EUV B;  3CWI A;  4M02 A;  3DHI C;  1Z2M A;  2FCM A;  5CHF A;  2LD9 A;  2UU7 A;  4JWS C;  4A20 A;  3B2F A;  1FNW A;  2R2Q A;  1SSN A;  2ON8 A;  1WJU A;  2JX5 A;  1WJ4 A;  5GXG B;  2MJE A;  1KFY B;  4A3O A;  5C3J B;  2O6V A;  3RZW C;  1WGG A;  4GB9 A;  4N9F 4;  4AS1 A;  3RN9 C;  3ZO5 B;  1C79 A;  2N9L A;  3UQB A;  1TT5 B;  3OJ4 B;  3HM3 A;  1GPX A;  2BB5 A;  4DK5 A;  1FFV A;  2VRR B;  1XCT L;  2MH7 A;  3N1X C;  4KGS A;  3BVM A;  1FM0 D;  2IBI B;  2BBC A;  4C56 C;  2FBW B;  3OAW A;  1FO4 A;  2WXL A;  4X57 B;  1T0Y A;  3BK1 A;  4P16 A;  2BVC A;  3TEW A;  1KRH A;  1X1M A;  2WXM A;  3E56 A;  1UGM A;  4FJY A;  2G4D B;  3VH3 B;  2WXN A;  3T3O A;  2C7H A;  3KH0 A;  3N9Y C;  4AWJ A;  1FRR A;  2G45 B;  2CU3 A;  1TBE A;  1SJH D;  2HD5 B;  2K1F A;  1D3Z A;  4LJP B;  4WAA A;  2ZW0 A;  3R7R A;  1WIA A;  3AV8 A;  4XWW A;  2KN5 A;  4EZK A;  2AQ2 B;  3FIL A;  4PYU A;  2KJR A;  4HKQ A;  1UWM A;  4IWQ A;  2VZK D;  1N5X A;  2QC8 A;  4LNK A;  1WGH A;  3FC4 A;  1K53 A;  2K6Q A;  1JRU A;  4W9C A;  1IP9 A;  3ML9 A;  1J7C A;  3Q8C A;  2C9W B;  3AE9 B;  5G2N A;  3Q3N C;  5IP4 D;  1GNU A;  5IN7 A;  2Z0D B;  5C1Z A;  1OQQ A;  2L83 A;  2LGD A;  4HDO A;  3AM9 A;  4DDI D;  3AEG B;  3KWL A;  1UWX A;  5HI1 A;  2KDM A;  4NNJ B;  2Q5W D;  4MEM A;  1VD2 A;  1P1A A;  4KZ0 A;  1RLF A;  3VFK A;  3L17 A;  4IKG A;  2ZCC A;  2IYD B;  3GB1 A;  3ZNG C;  1WY8 A;  2GMI C;  1UD7 A;  2MHJ A;  2QSD A;  1TS5 A;  2OED A;  4QAY A;  1EWY C;  1OEY J;  4AJW A;  1Z5S B;  3UI3 A;  1J0G A;  5C23 A;  1SE2 A;  4W9K A;  1D5Z C;  1SE9 A;  5LLI A;  2L05 A;  2GBJ A;  4ZHO A;  3NJT A;  4YSY B;  4OVZ A;  2N7D A;  1ENF A;  4MM3 A;  5H92 C;  5HFY A;  3R2T A;  3LDZ E;  2KX0 A;  3PZD A;  2W82 A;  1KLG D;  1NYR A;  3JVZ X;  5AZH A;  5HKH A;  2MBB B;  5EE1 A;  4ZHP A;  3PVL A;  3RUI B;  1IUE A;  3O65 B;  4I6N B;  1KOT A;  2D07 B;  3ETR A;  1ZKH A;  5J2R A;  3I9V 1;  3PRM B;  3PTF C;  3X0W A;  4MSQ B;  1E7V A;  4OHJ A;  2YLM A;  3EHV A;  3IAM 1;  1PGX A;  3V6E B;  4PK1 A;  1NEN B;  2MP2 B;  1TY2 A;  1V49 A;  3HUI A;  4GXB A;  5JXV A;  2IGD A;  3APC A;  4II2 B;  2LI5 A;  1TZ1 A;  4JQW C;  2MJD A;  2IGH A;  4RGT A;  1ISN A;  4LNF A;  3VRA B;  3P4P B;  4C4V A;  1IBX A;  2PE6 B;  3NZ3 A;  3P4Q B;  1WWT A;  1VLB A;  2RDG A;  1MFW A;  2KDF B;  3AE4 B;  2PVO D;  3NG0 A;  3TEX A;  3RNG C;  3R3M A;  3FAH A;  5DPS A;  4NJC A;  1WI0 A;  1KM7 A;  5FKA C;  2V1Y A;  3RFZ B;  3PZ7 A;  3A33 B;  1XQQ A;  1GAQ B;  3WAP A;  4MEL A;  1VDV A;  4G11 A;  4JWU C;  3NVV A;  1SJE D;  2C7N B;  2BF8 B;  3H8H A;  4C80 A;  2JYE A;  3L54 A;  3R2I A;  2E3T A;  4ZRI A;  3A9J B;  4RCO A;  3ZNZ B;  2KXJ A;  2JZZ A;  4BKG A;  4PS7 A;  1L7Y A;  3D32 A;  4P1B C;  1J8C A;  3WAL A;  2LXC A;  3EEC A;  2WXK A;  3L10 B;  4NAW A;  1MI0 A;  4RM8 A;  3AE1 B;  4G50 A;  4IWO A;  4KKJ A;  3J9C A;  2PKO A;  3AE8 B;  2ZW1 A;  2ZPY A;  2RSU A;  3Q8F A;  4FUL A;  2WDR B;  1WRD B;  1JWB D;  3IT6 B;  1XLP A;  3LJ3 A;  1D4B A;  4ZYN A;  1F2R C;  3R8B A;  2J0K A;  2K0P A;  2KNB A;  4KDI C;  4JPS A;  3MJ5 A;  2QDF A;  4ANV A;  4NJ6 A;  3ZIM A;  3PRP B;  3R66 C;  3DBH I;  2KOX A;  1WYW B;  3KUC B;  1TKG A;  4N58 A;  3WA0 A;  1PFD A;  4DBG A;  2O6V B;  2KTR A;  4K7U A;  2IO2 B;  3Q69 A;  1BUI C;  2V3N A;  4OZB A;  2ZVN A;  3PHW B;  4XDC A;  3AH7 A;  3ZUN A;  4DHZ E;  4OW0 A;  1BXT A;  4MJS A;  2KYW A;  1JWM D;  3C19 A;  3RCZ A;  1CK1 A;  3AEB B;  2KVZ A;  2LEK A;  2GBN A;  2KAJ A;  4EKU A;  4TMA B;  2CHX A;  2NS5 A;  4YL8 A;  1WSP A;  2KMC A;  1HTO A;  4BAX A;  2KVR A;  4N6E B;  2LGS A;  3VRB B;  1QZE A;  4ZRP A;  3DBR I;  2AL6 A;  4ANX A;  2CS4 A;  4XC2 A;  1WJN A;  1XLQ A;  2L52 A;  4A8X C;  1KTK A;  1DOI A;  3ENE A;  1XF5 L;  1M94 A;  3PHX B;  3AED B;  4LJO B;  4A55 A;  1HQR D;  4XGA B;  2FID A;  1WGY A;  2D3A A;  1JAL A;  1I4R A;  3H1U A;  5LXI B;  4HPL B;  1YN4 A;  1OTR B;  2KQ7 A;  3U7D A;  3EFC A;  1L6V A;  3FIL B;  4I6L B;  1ZUD 2;  3PV1 A;  1QKZ A;  3VVW B;  2OJW A;  2WX0 A;  3QC8 B;  1LO5 D;  3V6C B;  3OWE B;  2O2V A;  2FNJ B;  1EF1 A;  4PYZ A;  3N1Y C;  4J3O D;  1STE A;  1PGA A;  1SF0 A;  2ASQ A;  3WIM A;  1WE6 A;  3ZTD A;  4WQO B;  1EF5 A;  2Y5B B;  1L4Z B;  3I57 A;  4HRS A;  2GBR A;  3DVN V;  3ONS A;  5TR5 A;  1SB3 C;  1M4V A;  1UGJ A;  1MG4 A;  1GOZ A;  2J7Q B;  1KH0 A;  3MC8 A;  1I42 A;  5KHQ A;  1UUP A;  1L0Y B;  1V6E A;  2WU5 B;  5D94 A;  2K3U A;  5BMH A;  4BVU C;  4TKN A;  2HE7 A;  5IOI A;  2WP9 B;  3NY5 A;  1J7A A;  1I4P A;  1F9J A;  3Q2A C;  4TQ0 A;  4MM3 B;  4YSX B;  4ARI A;  3ZYY X;  1N5W A;  2NCN A;  2LVO A;  3PSE B;  2WXI A;  3DVG X;  1OQR A;  1DGJ A;  1YQ3 B;  1E8X A;  3VAW A;  1V8C A;  2BW2 A;  3VDZ A;  3KQ4 A;  1KLV A;  2QEJ C;  1OFF A;  3JYU A;  3O13 A;  1WGK A;  5CTR C;  1R7S A;  3GOE A;  2AEH A;  2DZI A;  4DDG D;  4WUR A;  4F8C B;  4YTN B;  2J52 A;  2RMM A;  2BS3 B;  2KDI A;  3SFD B;  5IO9 A;  3RNA C;  3RNF C;  2WXP A;  2A5U A;  4KIK A;  2Y3A A;  3ZGZ A;  3AEC B;  3MP9 A;  1FNV A;  5CHW A;  1ET9 A;  2UWQ A;  2FE8 A;  1N62 A;  4AUQ C;  2KK8 A;  1YQB A;  1FXT B;  2LZ6 A;  2V4L A;  5H8Y E;  4IM2 A;  1YJI A;  3IBE A;  1RYJ A;  1F0Z A;  3RNE C;  1K50 A;  1V86 A;  1SEB D;  1NI2 A;  4F7Z A;  4JL9 A;  3GZN B;  5E6O A;  3GE3 C;  3U7Z A;  4C4V B;  1IBX B;  2MCN B;  4OZC A;  4LDT B;  2DAJ A;  2N9P C;  2KMM A;  2PMV A;  1LQB A;  1QF6 A;  2M0X A;  3WCQ A;  4FJZ A;  2VH2 A;  1XXG A;  1IGC A;  2M0A A;  2CJN A;  3QA8 A;  1WXA A;  2FIF A;  2LHE A;  1Q10 A;  1ZXH A;  3A4R A;  3DPD A;  1IPG A;  1TGZ B;  2CR5 A;  4YSZ B;  1E10 A;  1BT0 A;  4NZL B;  4RF0 A;  2KLG A;  4WJO A;  4HXD A;  3VQI A;  4L2Y A;  2KWV B;  4YT0 B;  2BPS A;  3K9P B;  1R4M I;  2M1M A;  2WYQ A;  2X8X X;  1VCB A;  1A70 A;  2M19 A;  3SU8 X;  3MHS D;  4M00 A;  4MT5 A;  2NMQ A;  4NAW B;  2GOW A;  1RAX A;  4ITK A;  1WRI A;  3Q6B A;  3EUB 2;  1KJT A;  3AXC A;  1NEK B;  3ZJT A;  3U52 E;  3RD2 A;  2Z8L A;  2WNM A;  1OQY A;  4KSK C;  1WX8 A;  2PIA A;  2QIE B;  2RGF A;  4MGK E;  1WR6 E;  2AWT A;  2KLC A;  4KDL B;  1ZW7 A;  4ZRQ A;  4IWP A;  3ZXR A;  1JW9 D;  2DAF A;  4DXG A;  2K6D B;  2LAS A;  2BYF A;  4K1R B;  4EZL A;  2JRI B;  4BZA A;  2NBV B;  1SIF A;  2KJ6 A;  3PZ8 A;  4R3D A;  3DBL I;  2DYO A;  2L1A A;  3DVN U;  4JIO U;  1TYG B;  2OJR A;  2KAC A;  4H2A A;  2KTR B;  1T0S C;  2QMT A;  3OJ3 A;  3CF6 E;  4W9J A;  2KZR A;  1CZP A;  4BFR A;  2G4S A;  4DHZ B;  4WWO A;  4RNA A;  1UZX B;  5L83 A;  4RFB A;  2EMS A;  4WWN A;  1HZ6 A;  2N7E A;  3Q8A A;  3AEA B;  4MJS B;  1QIL A;  1SIJ A;  3SR6 A;  1F1H A;  2NTS A;  4DHJ B;  2BYT A;  3N20 C;  2RPV A;  1C4A A;  1FRD A;  4GOC A;  5E6N A;  2BYV E;  1Q0W B;  3Q14 C;  1ROE A;  4FLH A;  2JWU A;  2WS3 B;  4WJP A;  4B0M A;  3QK0 A;  2INN E;  4NQK E;  4MGY E;  1VZ6 A;  2KWC A;  4KGR A;  3AE2 B;  5AEK B;  1V5T A;  3W1S C;  4NPN A;  3BZD B;  2BB6 A;  1GG3 A;  4W9F A;  3U30 A;  4TUU A;  4B0E A;  4ZRK A;  4C7Z A;  2WXG A;  1N61 A;  3PPA A;  3V60 A;  2DBY A;  3Q3J A;  5AZG A;  3P1M A;  4IUM B;  3N32 A;  3B08 A;  5EE9 A;  4FBJ B;  1D5M C;  1FD6 A;  2XK5 A;  3UF8 A;  3NZS A;  2FAZ A;  4TQ1 A;  4DWF A;  1PGB A;  5CX3 A;  3DVG Y;  2D11 A;  5EE0 A;  4KVG B;  4HDQ A;  1WMH A;  2JYT A;  4IC7 B;  2O2V B;  4FHJ A;  1E5W A;  3DOW A;  1QOF A;  3H7P A;  4B6W A;  1NI3 A;  1GC6 A;  1QLB B;  3Q3F A;  3K9O B;  1I7H A;  2BGF A;  4M0W A;  2WXJ A;  1DOY A;  4NQL B;  5L95 C;  2N7J A;  3M62 B;  4BKS D;  4BKT A;  4PS8 A;  1I4Q A;  2WXO A;  2JXT A;  3P2B A;  5D6J B;  3AU4 A;  3I3T B;  4L1B A;  2EMT A;  3TMP B;  3H6N A;  1A5R A;  2I2Y A;  4K7S A;  1AWD A;  2LGI A;  1HXY D;  2LWP A;  1NBF C;  3TEY A;  5G5G A;  2N9X A;  1K8R B;  2KN4 A;  2MX2 A;  4HK2 A;  4OVV A;  1FIQ A;  1I4X A;  1C77 A;  4KX6 B;  2LJI A;  3KLS X;  2W9N A;  4YXD B;  2FCN A;  5HG2 A;  4WWP A;  5I4D A;  3Q8B A;  1N60 A;  1P9D U;  1L0X B;  2D2Q A;  2LHD A;  1R4N B;  3UGB B;  1J19 A;  3BII D;  1LXD A;  3PRE A;  3DHH C;  3H9D A;  4XZ4 A;  2DZK A;  3ZRC A;  2WHI A;  1WM3 A;  3TSS A;  3L4P A;  2SAK A;  5JHB A;  4KIK B;  1FEH A;  2GRI A;  1V5O A;  5D7G A;  2G1E A;  2IO1 B;  3NVW A;  2HTH A;  3TL5 A;  3NOB A;  1EU4 A;  1IGD A;  1YD8 U;  1ZDX A;  2BTE A;  3W1Y A;  3M63 B;  4I6P A;  1F52 A;  2K9X A;  1SE4 A;  1HTQ A;  1AYF A;  1ZXI A;  4K3B A;  1YN5 A;  2ZEQ A;  3ZRF A;  4B9K A;  2WLB A;  2BT6 A;  2KD0 A;  4M8N A;  1E7U A;  4NJ7 A;  3QWZ B;  3L0W B;  2LFI A;  4J6I A;  4GGQ A;  3PLV A;  1G6J A;  2C60 A;  4GSW A;  3ZNH B;  3WAN A;  3W1S A;  4CYE A;  2L7R A;  1UEL A;  2UYZ B;  1WR1 A;  4N59 A;  2LUE A;  3RNC C;  4DXA B;  1WYG A;  1JWU D;  5D3I B;  2REX A;  2JQR B;  5TSS A;  2JUO A;  3ZXV A;  2ICI A;  2JSV X;  1F77 A;  4FAD A;  3AE5 B;  2NR2 A;  2MSE D;  3KWV A;  3M3J A;  2QIL A;  2HJ1 A;  3SFE B;  2DX5 B;  2EKE C;  4HKZ E;  1QOG A;  4TV3 A;  3ZKJ C;  5FR6 A;  5BO4 B;  1P0R A;  1XEE A;  3KUD B;  3U8Z A;  2GI9 A;  2WWZ A;  3A9K A;  1WM2 A;  2PVG C;  3W5V B;  4EZJ A;  1FMA D;  1RM6 C;  3N30 A;  2BS4 B;  2VZK B;  1VRA B;  1LFD A;  2JZ3 B;  3QIJ A;  2KQ4 X;  2L0T A;  2RD0 A;  3TBL D;  1I4G A;  2BWF A;  2XNA C;  3Q8E A;  3MJW A;  4WWM A;  4BBN C;  3PLU A;  5BYS A;  1ZP0 B;  1SGH A;  1PQS A;  2KFK A;  3W9C B;  4EOY A;  2GBM A;  2YVC A;  2PLP A;  1PDX A;  3NHE B;  1P7E A;  1TTN A;  2GBK A;  2IDY A;  4IOI E;  3NS8 A;  2JRH A;  1ZPS A;  1C4P A;  3VUY A;  2K8H A;  2I38 A;  4CHK A;  3DDC B;  1GJZ A;  3CMM B;  3HM6 X;  1F2R I;  1Q1O A;  4WJN A;  5J18 A;  2KC2 A;  3B0A A;  4GDK A;  4W9H A;  2AX5 A;  2DZJ A;  1NDD A;  1C9F A;  4KGT A;  3AE6 B;  1E8W A;  1VZ8 A;  4JLC A;  1B9R A;  1V80 A;  1FNU A;  2JWZ A;  5E6P A;  4HJG E;  3P63 A;  5DPW A;  3VTV A;  2IZV B;  2RR9 A; 
#chains in the Genus database with same CATH homology
 5AZF A;  4MM3 A;  2WYQ A;  3IFW B;  3LDZ E;  2KX0 A;  3KYC D;  3PZD A;  4HLE A;  1C1Y B;  1VCB A;  2BWE S;  3PT2 B;  3C0R B;  3VTW A;  4ASW C;  3JVZ X;  5AZH A;  1WXS A;  5HKH A;  2MBB B;  3JSV A;  2HJ8 A;  4NY0 A;  2K25 A;  2C5L C;  3PVL A;  4MSM B;  2LGX A;  3SU8 X;  3MHS D;  3JW0 X;  1YIW A;  3RUI B;  4AJY B;  3DBS A;  4NAW B;  2GOW A;  2L3Z A;  1RAX A;  4EEW A;  3H7S A;  2M17 A;  3O65 B;  4I6N B;  1KJT A;  1RRB A;  1KOT A;  1U4A A;  2CHW A;  2N4F A;  4IM3 A;  2LVQ A;  4GU2 A;  3UIP B;  3RZF A;  3AXC A;  2D07 B;  2FCQ A;  2C7M B;  4II3 B;  3ZVV A;  3RD2 A;  1ZKH A;  1P3Q U;  5J2R A;  2KTF A;  4E71 A;  3EC8 A;  3UQA A;  1OQY A;  1WX7 A;  3PRM B;  4KSK C;  4EFO A;  3PTF C;  1WX8 A;  3VHT C;  4A3P A;  3X0W A;  2RGF A;  4MGK E;  4FHK A;  4MSQ B;  1WR6 E;  1E7V A;  2AWT A;  2KMA A;  2KLC A;  4KDL B;  2YLM A;  3EHV A;  2BYE A;  1ZW7 A;  3V6E B;  3VTV A;  4IWP A;  2MP2 B;  2DAF A;  2XEW A;  1V49 A;  4GDL B;  3QCA A;  4GXB A;  2K6D B;  2IY1 B;  2LAS A;  3APC A;  3ZDM C;  3ZLZ A;  2BYF A;  3IG3 A;  4K1R B;  4II2 B;  4URK A;  2XK5 B;  3RUL A;  2LI5 A;  4EZL A;  2JRI B;  1TZ1 A;  3RYT A;  4JQW C;  3CST A;  3APD A;  2IO3 B;  1ISN A;  2NBV B;  1SIF A;  3AI5 A;  4ZRJ A;  2KJ6 A;  3BIN A;  2MW5 A;  4HWI B;  3AUL A;  2PE6 B;  1WMH B;  3DBL I;  3EFU A;  2PE9 A;  4IW0 A;  2NPT B;  2DYO A;  4OVU A;  4EUT A;  2Z59 B;  3DVN U;  2K39 A;  4JIO U;  2KDF B;  2JVC A;  4RMA A;  3H7P B;  2RPQ A;  2OJR A;  3TCA A;  4IM0 A;  2KTR B;  3R3M A;  3QAQ A;  5DPS A;  2MWS B;  2NBU A;  3OLM D;  1WI0 A;  4CYE A;  4M0W B;  1KM7 A;  4GN1 A;  2MQJ A;  2JY6 A;  3OJ3 A;  2V1Y A;  3CF6 E;  1WX9 A;  1HE8 A;  4W9J A;  4ANU A;  1C3T A;  2KZR A;  4AOF A;  3A33 B;  3AU5 A;  4BFR A;  1XQQ A;  2G4S A;  4WWO A;  4DHZ B;  1UZX B;  2BKR B;  3WAP A;  4MEL A;  3SDL C;  5L83 A;  4G11 A;  3R7Q A;  3WAM A;  2EMS A;  2QHO A;  4DHJ D;  2MRP A;  2C7N B;  2BF8 B;  4WWN A;  3VXW A;  1EO6 A;  3KUZ A;  2R2O A;  2JF5 A;  2LRU A;  3TIX A;  2CHZ A;  2N7E A;  4E74 A;  4MGZ E;  4MJS B;  4P7I A;  3DQV A;  1OEY A;  1WZ0 A;  2A4Z A;  1MG8 A;  4AP4 C;  4DHJ B;  3SHQ A;  3L54 A;  2J0J A;  3L16 A;  4GOC A;  5E6N A;  2BYV E;  1Q0W B;  4E3C A;  4ZRI A;  2LXA A;  3A9J B;  2K8B A;  3V61 A;  3ZNZ B;  2CU1 A;  2KO3 A;  4FLH A;  2KXJ A;  2JZZ A;  4BKG A;  3VUX A;  4WJP A;  4PS7 A;  2MBQ A;  4W9I A;  5KHO A;  1L7Y A;  3IVF A;  3D32 A;  5IAA C;  3QK0 A;  1J8C A;  2L00 B;  3WAL A;  2LXC A;  3EEC A;  2KWU B;  3L10 B;  3APF A;  4NAW A;  4NQK E;  4RM8 A;  1R4N I;  4MGY E;  4FA6 A;  2FUH B;  2N1W A;  1WGR A;  4G50 A;  2KWC A;  4K81 A;  1V81 A;  3RT3 B;  3UIO B;  1E8Y A;  1YX5 B;  3VUW A;  2DEN B;  3ZNI D;  5AEK B;  1V5T A;  4IWO A;  4NPN A;  3W1S C;  2MBH A;  5DPT A;  1CMX B;  1GG3 A;  3QX1 A;  4W9F A;  3U30 A;  4TUU A;  4BOZ B;  4ZRK A;  4FN2 A;  2ZPY A;  2RSU A;  1WH3 A;  4FUL A;  3A1Q B;  2M1M A;  3L13 A;  3PPA A;  4KV2 A;  1WF9 A;  1WRD B;  4BBN F;  3V60 A;  2MP2 A;  2M4N A;  2NBW B;  4XX5 A;  1IYF A;  3LJ3 A;  3L08 A;  3Q3J A;  4W9L A;  5AZG A;  4CO7 A;  4ZYN A;  3IHP C;  5EDS A;  4GDL A;  4IUM B;  3MTN B;  3B08 A;  3N32 A;  4FBJ B;  2XK5 A;  3UF8 A;  3NZS A;  2FAZ A;  5J17 A;  2MA9 B;  4TQ1 A;  4DWF A;  1UBI A;  2ZCB A;  5CX3 A;  1H8C A;  2LRW A;  3DVG Y;  2J0K A;  5JHA A;  2KNB A;  4KDI C;  2ZNV B;  2D11 A;  3X23 A;  2KJH B;  4KVG B;  4HDQ A;  4ANV A;  4NJ6 A;  3ZIM A;  1WMH A;  2KAN A;  2NPT A;  3PRP B;  4IC7 B;  3R66 C;  2O2V B;  2O6V D;  1S1Q B;  2FCS A;  4FHJ A;  3WAO A;  1H4R A;  1WFY A;  3DBH I;  4B95 A;  1E5W A;  2KOX A;  1WYW B;  1WJ6 A;  3DOW A;  3KUC B;  3ML8 A;  3H7P A;  4HCP B;  1UH6 A;  4B6W A;  1GC6 A;  3WA0 A;  4DBG A;  4G3X B;  3ALB A;  2O6V B;  3Q3F A;  2KTR A;  1AAR A;  3K9O B;  2NVU I;  4K7U A;  2IO2 B;  2BGF A;  5D2M B;  2MBE A;  1RFA A;  4MGI E;  4NQL B;  2ZZP B;  5L95 C;  1YJ1 A;  3HIZ A;  3B1L X;  3M62 B;  4BKS D;  2ZVN A;  3VH4 B;  4BKT A;  4PS8 A;  3PHW B;  1Y8R C;  2PJH A;  3PGE A;  3ZUN A;  4DHZ E;  1E8Z A;  2AL3 A;  3P2B A;  2JXX A;  5D6J B;  3ZDT A;  3AU4 A;  3I3T B;  2PPH A;  4MJS A;  3CSF A;  3T8M A;  3RCZ A;  2DYM A;  2ZPN A;  1Q5W B;  2WX1 A;  2D3G A;  5JZE B;  2GBN A;  2ZVO A;  4EKU A;  2EMT A;  3TMP B;  3H6N A;  2PEA A;  1A5R A;  1V2Y A;  4K7S A;  2KX3 A;  3A9J A;  2CHX A;  2NS5 A;  2K8C A;  4YL8 A;  2KMC A;  4MH0 E;  1V9J A;  2KVR A;  1QZE A;  2ZNV C;  2LWP A;  1NBF C;  1UBQ A;  2N9X A;  3DBR I;  1K8R B;  2AL6 A;  2DHZ A;  2LGY A;  5GMV A;  2DZM A;  2KC1 A;  4ANX A;  2CS4 A;  2MX2 A;  4XC2 A;  1L2N A;  1WJN A;  4ZDV A;  4HK2 A;  4OVV A;  5LXH A;  1E90 A;  4BOS C;  1YX6 B;  3ENE A;  3NZU A;  1M94 A;  3M95 A;  2KHW B;  3QQ8 B;  2J0M A;  3PHX B;  2L8J A;  2W9N A;  4LJO B;  4ANW A;  1ZGU B;  2V3S A;  2FCN A;  2JT4 B;  1XD3 B;  1LM8 B;  2MBO A;  4MDK E;  4PS3 A;  4WWP A;  2FID A;  1WGY A;  2XBB C;  3HHM A;  3A1Q A;  4W9G A;  2BKF A;  2ZJD A;  4ICV A;  2JPH A;  3H1U A;  5LXI B;  1P9D U;  4HPL B;  1I35 A;  1OTR B;  4HVB A;  2KQ7 A;  2D2Q A;  4HCN B;  4RM9 A;  3U7D A;  1XT9 B;  4JGH B;  3UGB B;  1J19 A;  1S3S G;  1EUV B;  1LXD A;  3KYD D;  3H9D A;  3PRE A;  3UIN B;  4XZ4 A;  1Z2M A;  2FCM A;  4I6L B;  2DZK A;  5CHF A;  3V62 A;  3ZRC A;  1WM3 A;  5DPR A;  3A9K B;  3PV1 A;  2LD9 A;  3KW5 B;  3VVW B;  3GZN I;  2KDB A;  2WX0 A;  4A20 A;  3QC8 B;  3V6C B;  5JHB A;  4KIK B;  1V5O A;  3QJZ A;  2R2Q A;  3PRZ A;  1GUA B;  2O2V A;  2FNJ B;  1EF1 A;  1WJU A;  5D7G A;  4PYZ A;  1WJ4 A;  2IO1 B;  2HTH A;  3TL5 A;  2N1V A;  3WIM A;  2ASQ A;  3ZTD A;  1WE6 A;  4A3O A;  3NOB A;  1YD8 U;  2O6V A;  3W1Y A;  3M63 B;  4WQO B;  2IY0 B;  1EF5 A;  4I6P A;  1P98 A;  2Y5B B;  2KFK B;  3RZW C;  1WGG A;  4GB9 A;  4N9F 4;  4F1S A;  3ZO5 B;  4FJV B;  2Z0E B;  1OGW A;  2GBR A;  3UQB A;  2DYB A;  3DVN V;  3ONS A;  4KZC A;  5TR5 A;  3VTU A;  2B3A A;  3OJ4 B;  2CKH B;  4KSL C;  2KFJ A;  2ZEQ A;  3QHT A;  3HM3 A;  3ZRF A;  4B9K A;  2KD0 A;  2J7Q B;  3T9L A;  4BKS A;  4DK5 A;  3ZW3 A;  4M8N A;  1I42 A;  1E7U A;  5KHQ A;  4W9D A;  4NJ7 A;  2VRR B;  3QWZ B;  2G3Q B;  3S2A A;  3L0W B;  4GDK B;  2KKC A;  4J6I A;  4GGQ A;  1V6E A;  3PLV A;  1G6J A;  2C60 A;  3ZTC A;  4GSW A;  2IBI B;  5D94 A;  3ZNH B;  3WAN A;  4BVU C;  3W1S A;  5DCN A;  1WE7 A;  1WGD A;  3OAW A;  1WZ3 A;  1UEL A;  2L0F A;  2L7R A;  1WR1 A;  2UYZ B;  4TKN A;  1T0Y A;  4X57 B;  2HE7 A;  2LUE A;  2WDT B;  1X1M A;  3NY5 A;  4DXA B;  1UGM A;  1F9J A;  4FJY A;  4TQ0 A;  2LJ5 A;  2REX A;  2I1K A;  2G4D B;  3VH3 B;  5IA7 A;  2NCN A;  2LVO A;  2JUO A;  3PSE B;  3DVG X;  2C7H A;  3KH0 A;  4AWJ A;  2G45 B;  5CHV C;  4FAD A;  1E8X A;  1TBE A;  3VAW A;  3VDZ A;  1KLV A;  2NR2 A;  2MSE D;  3M3J A;  3JYU A;  3JSV B;  2HD5 B;  5CTR C;  4HPM B;  2K1F A;  2D10 A;  2DX5 B;  2EKE C;  1D3Z A;  4LJP B;  3GOE A;  4WAA A;  3R7R A;  1WIA A;  2AEH A;  4G0N B;  4M8M A;  4W9E A;  2KN5 A;  4EZK A;  2I1J A;  4TV3 A;  3ZKJ C;  5FR6 A;  2KDE B;  2DZI A;  4DDG D;  5BO4 B;  4PYU A;  5G55 A;  4F8C B;  2KJR A;  4IWQ A;  1P0R A;  3KUD B;  3U8Z A;  2WWZ A;  4HJK A;  3A9K A;  2AYO B;  1WM2 A;  1WGH A;  4EZJ A;  2N9E B;  2KDI A;  3N30 A;  2K6Q A;  1JRU A;  4W9C A;  1IP9 A;  1LFD A;  3ECI A;  2JZ3 B;  3ML9 A;  3QIJ A;  2A5U A;  4KIK A;  2L0T A;  2C9W B;  2RD0 A;  3TBL D;  2BWF A;  5CHW A;  2UWQ A;  3HK0 A;  5G2N A;  1GNU A;  2Z0D B;  2KK8 A;  1YQB A;  1FXT B;  2LZ6 A;  2V4L A;  3DCG A;  4AUQ C;  1GC7 A;  3KVF B;  3MJW A;  5C1Z A;  2L76 A;  4BBN C;  3PLU A;  4IM2 A;  3IBE A;  5JH5 C;  1SGH A;  2OOB B;  2LGD A;  1PQS A;  2KFK A;  1V86 A;  4LDT D;  4EOY A;  4HDO A;  1NI2 A;  2MLB A;  4DDI D;  4F7Z A;  2GBM A;  4JL9 A;  4WJQ A;  5E6O A;  1WXV A;  2KQS A;  2YVC A;  3TJP A;  3N3K B;  2MCN B;  3NHE B;  1TTN A;  4NNJ B;  2GBK A;  4LDT B;  4MEM A;  2DAJ A;  2N9P C;  3PS6 A;  1VD2 A;  2JRH A;  1P1A A;  1LQB A;  1WXM A;  2M0X A;  1RLF A;  3NS8 A;  4ICU A;  4KZ0 A;  4FJZ A;  3VUY A;  3VFK A;  3L17 A;  2K8H A;  4CHK A;  2ZCC A;  3DDC B;  2IYD B;  3QA8 A;  1GJZ A;  3CMM B;  3HM6 X;  1WXA A;  4GMV A;  1WY8 A;  1Q1O A;  2FIF A;  2GMI C;  2KC2 A;  4WJN A;  3ZNG C;  1UD7 A;  3B0A A;  4GDK A;  5J18 A;  3A4R A;  1IPG A;  3DPD A;  4W9H A;  4LCD E;  1TGZ B;  1NDD A;  2CR5 A;  2DZJ A;  1BT0 A;  4AJW A;  1OEY J;  2LVP A;  4GIV A;  1Z5S B;  1E8W A;  4IG7 B;  2IO0 B;  2KLG A;  4JLC A;  4WJO A;  4HXD A;  3SD5 A;  3A4S C;  1J0G A;  5C23 A;  1V80 A;  3VQI A;  2JWZ A;  4W9K A;  3BY4 B;  5E6P A;  1SE9 A;  5LLI A;  3QAR A;  2KWV B;  2L05 A;  2GBJ A;  5DPW A;  2BPS A;  3K9P B;  2M8S A;  1R4M I;  4K7W A;  2IZV B;  2N7D A;  2RR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...