5L83A

Complex of potato atg8 protein with a peptide from irish potato famine pathogen effector protein pexrd54
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
112
structure length
112
Chain Sequence
GPSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords ASP-TRP-GLU-ILE-VAL
publication title Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 35
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5l83A00
1E7UA 3QWZB 2OJRA 4GSWA 3GOEA 4KIKB 3JSVA 1P0RA 2JVCA 4LDTB 2D2QA 4NAWB 5E6PA 4M8NA 2KC1A 1SIFA 3X0WA 3QQ8B 2ZNVC 3VAWA 3IFWB 2DAJA 3W1YA 3PGEA 5DPTA 1S1QB 2AL3A 1C3TA 2L8JA 2KJHB 4ANUA 2G4DB 4IW0A 4DBGA 5JH5C 3PHWB 1A5RA 3SDLC 2Z59B 2IY1B 1YX5B 3CF6E 2KQ7A 3ZDMC 2JZ3B 2K8HA 4I6LB 4WWNA 3H7PA 1RLFA 2YLMA 2C7HA 2MBOA 2O2VA 1WY8A 4BKGA 2WDTB 4AP4C 4W9FA 2ZZPB 1XT9B 2N1VA 4MSMB 2NPTB 2KQSA 4AOFA 2NS5A 5C1ZA 3R7QA 1GG3A 3QC8B 1RFAA 2AYOB 1P9DU 4HWIB 2ZEQA 1GC7A 2NBWB 2KJRA 1WXAA 3DCGA 3NS8A 3T9LA 2G4SA 4GGQA 2KTFA 2C5LC 2GMIC 2GOWA 2JXXA 1WJ4A 2O6VB 4HPMB 4A20A 3TBLD 2PE9A 2N9EB 2L3ZA 1UD7A 1V80A 2NBVB 3AU4A 3WANA 3PTFC 4G50A 1NDDA 2JZZA 1H4RA 3EFUA 3R7RA 3A9JB 4PS7A 3A33B 3PPAA 2DYBA 2K39A 1Q1OA 5LLIA 2AL6A 4KZCA 2A5UA 2BWES 4IC7B 2KKCA 3EHVA 4ANVA 2MBQA 2LASA 1WXMA 2N7EA 4AJWA 5D7GA 4EZLA 4W9HA 5DPWA 2GBMA 3P2BA 1P98A 4K7UA 4K81A 4HCNB 2XBBC 1YX6B 2KD0A 3D32A 2KDBA 3PRZA 4NNJB 3JYUA 5CHWA 1VCBA 4CYEA 2AEHA 2NR2A 4GDLB 4WQOB 3RZWC 3A4RA 4GDKB 3OLMD 3VFKA 2LRUA 3TJPA 3ZO5B 4CHKA 2MBHA 4KV2A 4N9F4 1CMXB 4HVBA 2NCNA 2LVQA 2IO3B 3VUYA 3NZSA 3DBRI 1JRUA 2DZMA 2FNJB 2VRRB 3S2AA 5J17A 4XX5A 2ZPNA 2N9PC 4I6NB 3KYCD 4BBNC 2L7RA 1UZXB 2HD5B 3QIJA 4GB9A 5D2MB 4FJZA 1I42A 4HPLB 2RD0A 4FN2A 1UELA 2XK5B 3PHXB 4WWPA 5AZGA 3DOWA 3UIPB 4NJ6A 2I1JA 2KN5A 2N4FA 3PLUA 3QK0A 4G11A 3B08A 2MX2A 1MG8A 3V6EB 3K9OB 2MCNB 3ENEA 2N9XA 4BKSA 2DYOA 2N1WA 1J0GA 4BKTA 4F1SA 2LVOA 2LWPA 3VH3B 1FXTB 3QAQA 2QHOA 4DHJB 4F8CB 3A1QB 5CHVC 1OGWA 1XD3B 2BYFA 2JY6A 3H7SA 3M63B 3OJ4B 2KZRA 4W9GA 2IO1B 3HK0A 2WYQA 2KMCA 3VTWA 1Q5WB 2KHWB 2MRPA 2GBNA 3VVWB 3NZUA 4B6WA 3UQBA 3R66C 4IM2A 2IY0B 5CTRC 5CHFA 4W9LA 5KHQA 3UIOB 2DAFA 4IUMB 3V62A 2GBKA 2L76A 4WJOA 3VTUA 2W9NA 4FHKA 4WJPA 1S3SG 3MHSD 3RT3B 2REXA 3A4SC 4DDID 4TV3A 3CSFA 1IP9A 5JHAA 4MJSB 1NBFC 3QX1A 3VH4B 2Y5BB 5J2RA 1QZEA 1WM3A 2MP2A 3MJWA 3ZNGC 4A3PA 3EECA 1KJTA 4JGHB 1XQQA 4K7SA 3RULA 2HE7A 3U8ZA 4NPNA 1WX9A 5AZHA 4AWJA 4ZYNA 4BFRA 2ASQA 4GOCA 4MH0E 1UBQA 1V2YA 1V5OA 4EFOA 1WGGA 2LD9A 2BKFA 2LGXA 1V81A 2NBUA 5E6OA 1WI0A 1LXDA 1EF1A 1V6EA 1Z5SB 1YJ1A 2KLGA 2KWCA 2A4ZA 2NVUI 5GMVA 4EEWA 1KOTA 1NI2A 3KH0A 1LQBA 5E6NA 3AU5A 3ZRCA 4FADA 2D07B 2WX1A 4NQKE 4IM3A 3ZKJC 1WMHB 3APCA 1E8ZA 3PV1A 3JW0X 4KIKA 4MJSA 1RAXA 3C0RB 5LXIB 3M95A 3ZNZB 2M17A 1K8RB 4WJNA 4NAWA 3ML8A 4EOYA 2LZ6A 2IYDB 3DVGX 4E74A 3KYDD 2MLBA 1GC6A 5LXHA 3ZDTA 2MWSB 1E5WA 5HKHA 3DDCB 2BYVE 4K7WA 1EUVB 3N30A 2LRWA 3I3TB 3V61A 3KVFB 1OQYA 2KWVB 4MDKE 5AEKB 2M1MA 2KDIA 3L54A 2I1KA 4PS8A 3UGBB 2CKHB 3K9PB 3KUZA 2V3SA 4URKA 3A9KB 1UH6A 2ZCBA 3ALBA 3ML9A 2M8SA 2L00B 4G3XB 2V4LA 3PREA 4HJKA 3VXWA 4TQ0A 3WAOA 5JHBA 5KHOA 2D11A 4FJYA 3ZNID 1M94A 3ECIA 1WGDA 4HLEA 1WGRA 5DPSA 2NPTA 2MSED 3BY4B 3QARA 5D94A 3ZIMA 4M0WB 3QCAA 4B9KA 2HJ8A 4WWOA 4MGIE 1HE8A 2EKEC 4II3B 1YD8U 3PRMB 3O65B 2KFJA 3V60A 2KX0A 1SE9A 4GN1A 2BYEA 3WALA 4ASWC 4E71A 2KJ6A 5G2NA 1OEYJ 2O6VA 1RRBA 4MM3A 1E7VA 3PRPB 1WH3A 2C60A 4EKUA 1E90A 1GJZA 3AXCA 1L2NA 4IG7B 4DK5A 5FR6A 1TGZB 3HM3A 3PT2B 4BKSD 2KDEB 4BOZB 1EF5A 3A9JA 4DDGD 2JPHA 4JQWC 2JWZA 4PYUA 3X23A 4LJPB 1G6JA 2ZCCA 1IPGA 3PLVA 4DWFA 3IHPC 1T0YA 1Z2MA 4ZRJA 1Y8RC 1V9JA 1VD2A 1WJUA 2KFKB 3ZW3A 2B3AA 3LJ3A 3ONSA 3Q3JA 2DYMA 2FAZA 2R2QA 2R2OA 3DQVA 3TMPB 5EDSA 5G55A 4M8MA 4OVVA 3RCZA 2KX3A 3VHTC 4ANWA 2ZNVB 1WJNA 2PPHA 4AJYB 4W9IA 2J0KA 2LUEA 1F9JA 3U30A 3RZFA 3TIXA 2M0XA 3KW5B 3LDZE 4GDLA 4J6IA 4GU2A 2BWFA 2CHZA 4GDKA 2MBBB 1SGHA 3VDZA 2ZJDA 3WIMA 2KTRB 3SHQA 2DENB 2DZJA 3N32A 4EZJA 2M4NA 2OOBB 1WXVA 4TQ1A 4ANXA 4KVGB 2DZIA 5D6JB 4DHZB 2ZPYA 2FCSA 4TUUA 3DBLI 3NY5A 2XK5A 1GNUA 4RM8A 3RYTA 4FHJA 4FULA 4MELA 4XZ4A 4ICUA 2LGYA 2PE6B 3JSVB 2GBJA 2LGDA 1WGHA 2DX5B 3DBSA 1WXSA 1WR1A 3NOBA 1YQBA 3QA8A 4TKNA 2D10A 1TTNA 3A1QA 4DXAB 4LJOB 4P7IA 1AARA 2FIFA 2LVPA 3B0AA 4NY0A 1D3ZA 4GXBA 1E8XA 2KTRA 3T8MA 3ZTCA 4FBJB 2G3QB 2KMAA 2LXAA 2K6QA 3L13A 3W1SA 4LDTD 3BINA 3H7PB 3QJZA 2O2VB 5IA7A 3PS6A 3DBHI 1YIWA 1V49A 1PQSA 2FUHB 3R3MA 2KNBA 4RM9A 4FA6A 3EC8A 5J18A 3N3KB 3CMMB 2YVCA 3IBEA 1TBEA 1P1AA 4IWPA 4PS3A 2XEWA 5L95C 2BGFA 2FIDA 4JLCA 3UF8A 3APDA 1L7YA 5CX3A 3SU8X 2PJHA 3AI5A 5AZFA 2J0JA 4IM0A 2BKRB 4KZ0A 4ICVA 4MGZE 1IYFA 2BPSA 3QHTA 3HM6X 2MW5A 2KOXA 3TCAA 3H6NA 1ZW7A 2V1YA 4BVUC 3WA0A 2EMSA 2FCQA 2J0MA 4FJVB 1X1MA 2IBIB 2KK8A 4IWQA 5BO4B 4AUQC 4NJ7A 3L10B 3ZVVA 4I6PA 3VUXA 4E3CA 2N7DA 2C7NB 1WZ0A 1ISNA 1U4AA 1TZ1A 4OVUA 4CO7A 3ZLZA 2WWZA 2LJ5A 1WIAA 2KO3A 3L0WB 4JL9A 4X57B 4ZRIA 2CS4A 3W1SC 3L17A 2BF8B 2K25A 2IO0B 2KANA 3B1LX 3L16A 1WFYA 2JF5A 4PYZA 4W9KA 4YL8A 3V6CB 1WX8A 2L0FA 4G0NB 4K1RB 1J8CA 3M62B 2O6VD 1WMHA 5C23A 2JRIB 2UYZB 3RD2A 1WR6E 4W9DA 2G45B 4XC2A 2JUOA 2DHZA 2K8BA 2D3GA 2IO2B 1UGMA 1WGYA 2MA9B 1P3QU 1J19A 2LI5A 3DPDA 4EUTA 2CHXA 4HDOA 1WZ3A 1V5TA 3HIZA 1Q0WB 3GZNI 1KLVA 4II2B 2ZVOA 3CSTA 4W9JA 1E8YA 2C9WB 4GMVA 4WAAA 3A9KA 4ZRKA 1LM8B 2KVRA 3UINB 3IG3A 4FLHA 4F7ZA 4MGKE 1BT0A 3KUCB 1C1YB 4LCDE 2GBRA 1WRDB 2FCNA 4KSKC 2MQJA 5IAAC 4HDQA 1H8CA 3VQIA 2DZKA 3HHMA 3M3JA 3RUIB 2CR5A 1OEYA 1I35A 1WJ6A 2K8CA 2KC2A 3DVNV 2JT4B 4HCPB 2RR9A 3WAMA 2LXCA 2MBEA 1UBIA 2CHWA 2Z0DB 4KDLB 3ZTDA 4W9CA 5JZEB 3Q3FA 3OAWA 2C7MB 3ZUNA 4B95A 5DPRA 3DVGY 4MSQB 3VUWA 2AWTA 4GIVA 4IWOA 3OJ3A 5DCNA 1EO6A 1ZKHA 2KXJA 2L05A 2CU1A 2HTHA 2K1FA 1WF9A 3H1UA 1WM2A 3MTNB 2ZVNA 3VTVA 2KDFB 1OTRB 2RGFA 3DVNU 4KDIC 4KSLC 1ZGUB 3L08A 3WAPA 4DHJD 3IVFA 3ZRFA 2KWUB 1R4MI 3SD5A 3KUDB 3PZDA 4A3OA 3H9DA 3ZNHB 2KFKA 2EMTA 1R4NI 4MEMA 4DHZE 2WX0A 4HXDA 1WE7A 2PEAA 2RPQA 2MP2B 2IZVB 2FCMA 3JVZX 5TR5A 3U7DA 1GUAB 3UQAA 5L83A 4MGYE 2J7QB 2Z0EB 1E8WA 4EZKA 3PSEB 2UWQA 3PVLA 1WX7A 1LFDA 3TL5A 1V86A 4ZDVA 3AULA 2KLCA 3APFA 1KM7A 4JIOU 3NHEB 4W9EA 2K6DB 2L0TA 4HK2A 4RMAA 4WJQA 4NQLB 4BBNF 1WYWB 1WE6A 2RSUA 2JRHA 4BOSC
chains in the Genus database with same CATH superfamily
2N9KA 4A55A 2ICIA 4KIKB 4WIPA 4A90A 1P0RA 1T5XD 4C00A 1ACCA 3P4SB 2QCZA 5E6PA 2KC1A 4XYCA 2SAKA 2WHIA 1NI3A 4H2AA 4GLSC 1I4PA 4ANUA 4O1NA 4IW0A 3PHWB 3SDLC 3MFGA 2IY1B 1YX5B 3ZDMC 2K8HA 2D3AA 1RLFA 2C7HA 3Q8CA 2M0AA 4BKGA 4W9FA 2N1VA 1LGRA 3W9CB 2NPTB 2KQSA 1GG3A 2JXTA 2AYOB 1L6VA 2WXGA 1ENFA 1GC7A 2NBWB 2WXKA 3DCGA 4KKIA 3ZYYX 2GMIC 3KWLA 3BK1A 5EE1A 1GOZA 2JZZA 3EFUA 3RNBC 3A33B 3PPAA 2K39A 5LLIA 4WQMA 3I9V1 2KKCA 3EHVA 2MBQA 1AWDA 3AE7B 5IN7A 1KLUD 4W9HA 5DPWA 1P98A 4K81A 5G5GA 2KDBA 4NNJB 4OW0A 1VCBA 4IDIA 3A4RA 3OLMD 3TJPA 3NG0A 2LVQA 3VUYA 2FNJB 4XX5A 2ZPNA 5AUIA 4GB9A 2JX5A 2RD0A 5AZGA 4NJ6A 3PLUA 3I63C 3NRZA 3B08A 3V6EB 4BKSA 3SR6A 1IBXA 2LWPA 3VH3B 3ZXRA 3FILB 1OGWA 1XD3B 1SF0A 4JE3B 1F77A 1GAQB 2KMCA 1FRRA 3VVWB 3EGRA 4K3CA 3Q3MC 2W82A 4IUMB 2GBKA 2L76A 1S3SG 2KQ4X 3MHZA 4DDID 4WWMA 3CSFA 5JHAA 1NBFC 1UWMA 5J2RA 2MP2A 3ZNGC 4A3PA 4PK1A 4OZAA 1XQQA 3NVWA 3RULA 2HE7A 1QF6A 4AWJA 3N1XC 2PIAA 1J7CA 1NENB 2R61A 1UBQA 3Q69A 1WGGA 2WDQB 1V81A 4KGTA 2KWCA 4KX6B 4UDUC 2GRIA 4C80A 4FADA 2WX1A 4MACA 4MT5A 4IM3A 3ZKJC 1WMHB 3EFCA 3PV1A 4KIKA 1RAXA 3C0RB 5LXIB 3U7ZA 2RDBC 3LXFA 3ML8A 4EOYA 3KYDD 3AM9A 2E3TA 4K7WA 3Q8FA 3U2SC 1R7SA 3N30A 3I3TB 1N5XA 2KWVB 2DLBA 5AEKB 2CKHB 2WXPA 3KUZA 3KQ4A 4Q2JA 3A9KB 4N58A 3ALBA 3H8HA 4TQ0A 3WAOA 2N7JA 5HFYA 5KHOA 3ZNID 1DOYA 3N1YC 1EWYC 1M94A 1TKGA 2KMMA 2NPTA 1I4RA 4M0WB 4XDCA 2EKEC 4II3B 3PRMB 4RCOA 1ET6A 2Y5PA 5EE3A 3V60A 5C2TB 3WALA 4ASWC 4E71A 1OQRA 5G2NA 2JSVX 4HEA1 1N60A 1AW7A 1SXTA 2GI9A 3DHGC 3DWGC 5FR6A 1EF5A 4DDGD 5TSSA 4JQWC 4PYUA 2ZCCA 3Q8BA 3PLVA 1HTQA 3IHPC 2N9LA 1V9JA 1WJUA 3LJ3A 3O13A 3P4QB 2R2OA 3TMPB 3DWMA 4L1BA 5BYSA 1WJNA 4AJYB 1F9JA 1D6EC 2EELA 2QIEB 3TEXA 2MBBB 1ZOYB 3MJ5A 2KTRB 2MJ3A 5D6JB 4TUUA 2MJEA 2LUMA 3SFDB 3N1ZC 2JQRB 3V05A 1WGHA 2OEDA 1WXSA 3QA8A 1ET9A 3AE9B 3FILA 5IO9A 3R2IA 4LJOB 3B0AA 1KTKA 3B9JA 4GXBA 2WU5B 3ZTCA 2KMAA 5I4DA 5MPOA 3L13A 1PDXA 2WP9B 2NMQA 5IA7A 4ZOHC 1SSNA 3CMMB 4IWPA 1P1AA 3AE5B 3HVZA 1YN3A 4JLCA 3UF8A 3PZ8A 1NVID 5AZFA 2I2YA 1TS5A 4WURA 2INDC 3WA0A 2J0MA 4FJVB 2IBIB 1KFYB 5BO4B 4IWQA 4B0EA 3KWVA 1WXQA 2J52A 4I6PA 4E3CA 1U4AA 1WZ0A 1TZ1A 2JF5A 1J8CA 1WX8A 2L0FA 2O6VD 3AEFB 1WMHA 1YN4A 1WWTA 1WR6E 1FRDA 5D3IB 4XC2A 1ZP0B 2DHZA 2D3GA 1STEA 3DPDA 2CHXA 3BVMA 1UWXA 2NTTA 3TSSA 3HIZA 3BYYB 3R2TA 2ZVOA 3CSTA 3PO0A 4W9JA 2C9WB 3A9KA 2KVRA 1TY2A 3KUCB 4YTNB 1H8CA 1VZ8A 3HHMA 3NVVA 1JWSD 2AQ1B 1YMHE 2K8CA 4M0WA 3VRAB 3E56A 2JT4B 2I38A 1UBIA 3ZTDA 5JZEB 1RFKA 1K51A 2BQQA 1UNSA 2AWTA 4IWOA 1ZKHA 2L05A 2HTHA 2ZVNA 3VTVA 2RGFA 4LNFA 4DHJD 2LFIA 3NS1A 3KUDB 1MHHE 1R4NI 1C76A 2IZVB 2FCMA 1GUAB 3UQAA 2Z0EB 3EUB2 1WGKA 1WX7A 1EWCA 3TL5A 2KLCA 1XCQL 3NHEB 4W9EA 4BOSC 4GSWA 3GOEA 2IGHA 2MH7A 4DQOC 5BYQA 2KVZA 3V3XA 3DBHB 2BW2A 3X0WA 1SE3A 3QQ8B 1N5WA 4JX1C 2DAJA 3W1YA 3PGEA 2L8JA 2KJHB 2G4DB 3CF6E 1T3QA 2JZ3B 4WWNA 3LB8C 4AP4C 4AOFA 2NS5A 3R7QA 1P9DU 2ZEQA 3AECB 1L0XB 3T9LA 5GXGB 4XDDA 2GOWA 1XCTL 2JXXA 4QAYA 3TBLD 2N9EB 1UD7A 1V80A 3WANA 1QKZA 4PS7A 2LGIA 2DYBA 2AL6A 4KZCA 2BWES 4IC7B 5T8IA 3GZNB 2PVGC 1WXMA 2N7EA 4AJWA 4YWGG 4EZLA 3P42A 1T0QC 4HCNB 1CZPA 3I57A 5CHWA 4KGSA 2NR2A 2L32A 3CIRB 4HJGE 1JCKB 4P1CC 1JRPA 3ZO5B 4KV2A 1CMXB 2K9XA 1ZE3D 3AV8A 3IAM1 2IO3B 3DBRI 4US9A 2DZMA 5J17A 2N9PC 4I6NB 3KYCD 1P7EA 2PMVA 1F2RI 2KN5A 1TIFA 3RPFC 3QK0A 4G11A 1MG8A 4OVZA 1VZ6A 2MCNB 2N9XA 2DYOA 2N1WA 4J3OD 1TYGB 2LVOA 1WYGA 3QAQA 4KKJA 2WLBA 4F8CB 5CHVC 3RN9C 3M63B 3H7SA 4ARCA 4W9GA 3N20C 3T3OA 3NVYA 4B6WA 1HZ6A 1MVKA 2DAFA 1FO4A 1C4CA 3VTUA 2W9NA 1E0ZA 3SEBA 3MHSD 3RT3B 4TMAB 3A4SC 1IP9A 2EKIA 1D5MC 3W5UB 3QX1A 3ABVB 2Y5BB 1KJTA 3BWUD 2D3BA 2IGDA 4NPNA 1IUEA 3B2GA 4LK0M 4EFOA 2V0GA 2NBUA 2RMMA 1EF1A 1Z5SB 3W2DA 3KH0A 3AU5A 1SJHD 1C4AA 4B0MA 3JW0X 4MJSA 1FEHA 2LJIA 3TEZA 1RYJA 3ZNZB 2M17A 1K8RB 2G9HD 3ZJVA 5BMIA 1HTOA 2LZ6A 2IYDB 1GC6A 5LXHA 3ZDTA 1D4BA 1EUVB 4USAA 2LRWA 1JROA 3KVFB 1OQYA 2PW9A 2KDIA 4PS8A 2I1KA 1K53A 2PVOD 3K9PB 1ZPSA 2V3SA 4ANVA 2RPVA 3ETRA 2M8SA 2V4LA 5JHBA 2D11A 4FJYA 1EM7A 3U52E 1HA5A 3ECIA 4LLGM 3BY4B 3ZIMA 5D94A 3QCAA 4WWOA 3URYA 1UGJA 1HE8A 1YD8U 2KFJA 3PZ7A 1FFVA 2KAJA 4RNAA 3PRPB 4EKUA 1E90A 1GJZA 4IG7B 4DK5A 2QILA 1TGZB 4BOZB 2JPHA 2NTSA 4LJPB 1Z2MA 1Y8RC 1ROEA 3AE4B 4LNIA 2DYMA 1B1ZA 4WH4A 5G55A 4M8MA 4W9IA 2J0KA 4ZYSA 2LUEA 3U30A 2BTEA 2BWFA 2CHZA 3P4RB 1TKYA 3GS2A 3VDZA 2ZJDA 3SHQA 3N32A 2M4NA 4TQ1A 2DZIA 2FCSA 1QILA 2KN4A 2B76B 4RM8A 3BIID 4FHJA 4MELA 2E6XA 4XZ4A 2FBWB 2PE6B 3AN1A 3NOBA 1YQBA 4TKNA 2D10A 3AEBB 1NYQA 4NY0A 4OHJA 2G3QB 1E7PB 4LDTD 2KACA 2W54A 5IKCM 2KNBA 1F1HA 3EC8A 4FA6A 3N3KB 4YXDB 4N6EB 1F2RC 2RDHA 2XEWA 5L95C 2BGFA 1I4HA 1N6ZA 5CX3A 2PJHA 3AI5A 5IOIA 4KZ0A 2MHJA 4ICVA 3RNFC 1IYFA 3TCAA 2KOXA 1ZW7A 2V1YA 2FCQA 1X1MA 4AUQC 2BT6A 3L10B 3ZVVA 2N7DA 4OVUA 4CO7A 2WWZA 4FXCA 3CWIA 3L0WB 4ZRIA 5BMGA 2K25A 2IO0B 3V6CB 4G0NB 4C4VB 5BMHA 2CJNA 2JUOA 5FK9C 3LYYA 1UGMA 2MA9B 1P3QU 1E10A 2LHEA 1HEZE 5H8YE 2WXQA 1KLVA 4II2B 3B2FA 1E8YA 3FKYA 3IG3A 4F7ZA 1WRDB 4KSKC 1C9FA 2WS3B 1JW9D 5IAAC 4HDQA 5IP4D 1LO5D 3VQIA 2DZKA 5JXVA 3RUIB 3KLSX 3MC9A 2YEPB 1I35A 1WJ6A 2BYTA 1FNUA 4HCPB 3WAMA 1JQ4A 2CHWA 4W9CA 3ZUNA 1MPEA 5DPRA 4GIVA 3OJ3A 3AB5A 1FM0D 2WXIA 2KDFB 2Y5CA 3IVFA 3ZRFA 2KWUB 3SD5A 3PZDA 1TKEA 2WX0A 3DBLB 2TSSA 2RDGA 2PEAA 1ESFA 5TR5A 4LNKA 3MC8A 1E8WA 2WGSA 3PVLA 1AN8A 4JIOU 2AQ3B 2L0TA 4WJQA 4NQLB 4MH8A 5CHFA 3QWZB 2WXMA 1T0SC 1ZXIA 3AEAB 4NAWB 4M01A 3L4PA 3ZJTA 1SE4A 1F52A 3VAWA 4WAFA 5DPTA 1S1QB 2AL3A 1C3TA 1XEEA 1A5RA 4DBGA 2Z59B 1N62A 2LEKA 1DYQA 2YLMA 4DXFA 2WDTB 2ZZPB 1XT9B 4MSMB 1GPXA 3QC8B 4RGNA 3NS8A 1WXAA 2G4SA 1L6UA 2C5LC 1VJKA 2KWDA 2O6VB 2PE9A 3RNAC 3PTFC 4G50A 4XWWA 4NZLB 3R7RA 1PUTA 5H92C 1Q1OA 3UI3A 1V1OA 1BMLC 2V4IB 5D7GA 2GBMA 4K7UA 4C4VA 1YX6B 1TY0A 1I7HA 2KD0A 3FC4A 3Q6BA 4CYEA 2AEHA 4GDLB 4WQOB 5G5HA 4GDKB 4R3DA 1V1PB 2LHDA 3Q3NC 4CHKA 4HVBA 1IGDA 1AYFA 3NZSA 3S2AA 2VRRB 4BBNC 2L7RA 1UZXB 2GLSA 3QIJA 5D2MB 2J4XA 3DBRB 1UELA 2XK5B 3P1MA 3TUOA 1MI0A 4AQ7A 2N4FA 4PT5A 3P63A 2MX2A 4JWUC 3K9OB 3Q8AA 3ENEA 1YOVB 2W55A 1J0GA 2BBCA 1R4MB 1FXTB 4DHJB 1PGAA 2QHOA 2JY6A 5D3DA 2KDMA 2KZRA 3OJ4B 1Q5WB 2KHWB 2MRPA 2K3UA 4RGOS 3IT6B 3NZUA 4A6QA 1TS2A 1PYWD 2INPE 5CTRC 2WXOA 4W9LA 1BUIC 5KHQA 3UIOB 1B9RA 3V62A 1C77A 4WJOA 3FAHA 2REXA 4MJSB 3EA6A 1QOGA 1QZEA 2HJ1A 3MJWA 4RGTA 3EECA 4JGHB 1XLQA 1WX9A 5AZHA 4ZYNA 1QOFA 2QSDA 3SFEB 2LGXA 5E6OA 1CJEA 1LXDA 1V6EA 2ON8A 1YJ1A 2KLGA 2KYWA 2NVUI 2ZW0A 1KOTA 2PTLA 3ZRCA 1LQBA 4NQKE 2LGSA 1XF5L 1E8ZA 1QQRA 2BB5A 2L1AA 4DXGA 4NAWA 3DVGX 1YQ3B 1E5WA 5HKHA 3DDCB 3RNCC 1XLOA 1PGBA 2M1MA 1D5ZC 3UGBB 1PGXA 3AH7A 1FIQA 1UH6A 2ZCBA 3ML9A 2L00B 2QC8A 3DHIC 1OFFA 4RF1A 2WNMA 1WGDA 1WGRA 5DPSA 2MSED 2MEKA 3QARA 4B9KA 2DNFA 2KX0A 2BYEA 2KJ6A 3Q14C 2JZPA 1OEYJ 2O6VA 1RRBA 4MM3A 2IDYA 5FKAC 1E7VA 2V9HA 3AXCA 1L2NA 3RI7C 2L83A 3HM3A 4BKSD 3X23A 1G6JA 2JWZA 4DWFA 2BS4B 1T0YA 4ZRJA 3AE2B 5C3JB 2KFKB 2B3AA 3ONSA 2FAZA 2R2QA 3DQVA 4XE0A 5EDSA 4OVVA 2KX3A 2PPHA 1ZUD2 3ZGZA 2D3CA 2H88B 1TZOA 2M0XA 3LDZE 4GDLA 4GDKA 1V1PA 1DGJA 4OZBA 1SGHA 4TSSA 2DZJA 1C4PA 2VH2A 2OOBB 1WXVA 4ANXA 1YN5A 1L0VB 4KVGB 1HQRD 4L23A 4DHZB 2ZPYA 3OWEB 2XK5A 1GNUA 3RYTA 1XLNA 2D5GA 4FULA 1GB4A 2AX5A 2L52A 3JSVB 3AE1B 2DBYA 2LGDA 4ZRQA 3T3NA 2DX5B 2V3PA 1WR1A 1KH0A 4DXAB 5HG2A 1AARA 2FIFA 2LVPA 2J42A 3HRDD 2X38A 1D3ZA 1E8XA 4C7ZA 1UUPA 3T8MA 2WXJA 4FBJB 2LXAA 2IPKD 4IKGA 3BINA 3H7PB 4YSXB 3QJZA 2O2VB 3PS6A 3DBHI 1V49A 2ZW1A 1JALA 4RM9A 5J18A 1RM6C 4YSYB 2HTME 5EE9A 2YVCA 3IBEA 1TBEA 4RF0A 5E6JA 4PS3A 3APDA 1L7YA 4P6VF 2WXFA 1Y56A 4MGZE 2M19A 2BPSA 3QHTA 2MW5A 3H6NA 1T6BX 4BVUC 2BVCA 2EMSA 4S0RA 1SE2A 3E9SA 2ACZB 4RGMA 3WCQA 1ISNA 1FCCC 1FPYA 4YT0B 2LJ5A 4KGRA 4JL9A 3W1SC 1V97A 3L17A 4W9KA 1I4GA 4CQNA 5HI1A 2H89B 4K1RB 4LNNA 2INCC 3NZ3A 5C23A 4JWSC 2K22A 2UYZB 1MHXA 4W9DA 2G45B 2IO2B 1WGYA 1P7FA 2X8XX 1J19A 2LI5A 1YNTE 1UF0A 1WZ3A 1V5TA 1OQQA 1Q0WB 4YTPB 3GZNI 1QOBA 4WAAA 4N59A 4ZRKA 1N63A 3UINB 2INNE 4FLHA 4MGKE 1BT0A 4IOIE 1C1YB 4LCDE 4ZRPA 2FCNA 3M3JA 2CR5A 1OEYA 2ONQA 1ZDXA 2KC2A 3DVNV 2RR9A 1L5PA 2LXCA 4KDLB 3Q3FA 1NEKB 4P1BC 4AS1A 3DVGY 4MSQB 3VUWA 1EO6A 2KXJA 2LMCA 3AE3B 2DWQA 2WDRB 2K1FA 2SEBD 3H1UA 2OJWA 1ZGUB 2PKOA 3L08A 3WAPA 1L4DB 1JWBD 3H9DA 2JWUA 3ZNHB 2KFKA 1SIJA 3NUHB 2J53A 1WE7A 2RPQA 1Q10A 1FNWA 1KLGD 3U7DA 1YJJA 4MGYE 2J7QB 1I4QA 4EZKA 4C56C 2UWQA 1FD6A 3BK2A 3TEYA 1V86A 4ZDVA 3MC0B 3AULA 1XLPA 4HKQA 2WXLA 4A9AA 1L0YB 2NCNA 2BS2B 1E7UA 2FUG1 2OJRA 3JSVA 2MJDA 2JVCA 4LDTB 2D2QA 3BYTB 4HKZE 4M8NA 1SIFA 2ZNVC 3IFWB 1EU4A 1SBBB 3AMZA 2QJLA 2M56B 5JH5C 3AEDB 2KQ7A 4I6LB 1GB1A 3GE8C 3H7PA 2MBOA 2O2VA 1NYRA 1WY8A 2K0PA 3RNGC 1RFAA 4HWIB 2KJRA 4GGQA 2KTFA 2YEPF 1WJ4A 1DOIA 4A20A 4HPMB 4LTUA 2L3ZA 5EE0A 4K3BA 2NBVB 3AU4A 1NDDA 1DOXA 1H4RA 3A9JB 3J9CA 2GB1A 2A5UA 1QLBB 2WXHA 2LASA 3IT4B 3OG5A 1FCLA 3GE3C 3P2BA 1E6EB 2XBBC 2IJ0A 2FE8A 3RNEC 3D32A 4C7YA 3PRZA 4RH6A 1VDVA 3JYUA 3RZWC 3VFKA 2LRUA 4BZAA 2MBHA 4N9F4 1YJIA 1JRUA 4ZHOA 2QEJC 5HHDG 2HD5B 4FJZA 1I42A 4HPLB 4FN2A 3PHXB 4WWPA 3DOWA 3UIPB 2I1JA 3AEGB 1QT9A 1FMAD 3AE6B 4BKTA 4F1SA 1HZ5A 3A1QB 2BYFA 1KF6B 1R4NB 1E9MA 1MFWA 1CQVA 3VR8B 2IO1B 3AE8B 2WYQA 3HK0A 3VTWA 1L4ZB 2V3NA 2GBNA 1K50A 3NJTA 4XGAB 1VR9A 3UQBA 3R66C 4IM2A 2IY0B 1JWMD 3U4EG 2Y3AA 3ZQ4A 4FHKA 4M02A 4WJPA 3MP9A 4TV3A 1EU3A 2CU3A 3VH4B 5LNK1 3AEEB 2PLPA 1WM3A 2OHFA 3HUIA 4K7SA 3U8ZA 4YSZB 1HXYD 1V8CA 1QOAA 4BFRA 2ASQA 4GOCA 4MH0E 1V2YA 1V5OA 2XN9C 2LD9A 2BKFA 4HROA 1WI0A 1WSPA 1MG4A 2A4ZA 5GMVA 4EEWA 1NI2A 5E6NA 4US8A 2D07B 3HVDA 3APCA 3M95A 1VRAB 1BXTA 3Q2AC 4WJNA 4E74A 1ZDVA 3R8BA 2MLBA 1MJDA 3GB1A 2XNAC 2MWSB 2BYVE 4HPPA 3V61A 4MDKE 4MM3B 3L54A 1T0RC 4URKA 4G3XB 5C1ZA 4HJKA 3PREA 3VXWA 4LNOA 2HDEA 1TT5B 4HLEA 3W5VB 2HJ8A 4MGIE 4L2YA 1SJED 3O65B 3RMKC 1F0ZA 1FXAA 3IAS1 4GN1A 1SE9A 3P4PB 1VLBA 1WH3A 2C60A 2JYEA 4P16A 1IGCA 3PT2B 2KDEB 4ACFA 3A9JA 4JPSA 1YQ4B 1IPGA 3Q8EA 3I5JC 2BS3B 2JYTA 1VD2A 2JU6X 3ZW3A 3C8YA 3Q3JA 2QDFA 1M4VA 3Q3OC 3RCZA 4ANWA 3VHTC 2ZNVB 5AUKA 3RZFA 3TIXA 3KW5B 4J6IA 4GU2A 2BB6A 2UU7A 3WIMA 2W3RA 2DENB 4EZJA 4ZHPA 3ZXVA 1N61A 4NAMA 3DBLI 3NY5A 1RWSA 2WQYB 1J7AA 4ICUA 2LGYA 2GBJA 2AQ2B 3DBSA 2W3SA 1TTNA 1C78A 3A1QA 1KRHA 4P7IA 2KTRA 2N0SB 4YTMB 3TEWA 4S17A 3VRBB 2WU2B 2K6QA 3W1SA 3BVGA 4REZA 1C79A 1YIWA 1PQSA 2FUHB 3R3MA 1FNVA 2VZKD 2FIDA 1SB3C 1FFUA 1CK1A 3SU8X 2J0JA 4IM0A 2BKRB 3BZDB 2WXNA 3HM6X 2VZKB 2KK8A 3GP7A 4NJ7A 3VUXA 2C7NB 3BVZA 2Q5WD 3ZLZA 1I4XA 2WDVB 1WIAA 2KO3A 4X57B 2CS4A 1SEBD 2IGGA 2BF8B 3B1LX 2KANA 3L16A 4PYZA 1WFYA 1JWUD 4ARIA 4YL8A 1PFDA 4OZCA 3M62B 1TJEA 3C19A 2JRIB 3RD2A 3ZJUA 2K8BA 4A8XC 4EUTA 1JMLA 4HDOA 2KT7A 4BAXA 4GMVA 1LM8B 1FXIA 4D2KA 5FR3A 1D5XC 2GBRA 4NJCA 2MQJA 3IXSA 3VR9B 2VH1A 4RFBA 2K5PA 1IBXB 1XO3A 3DHHC 4HRSA 4M00A 1TS3A 2MBEA 2Z0DB 3OAWA 2C7MB 1TS4A 4B95A 3RFZB 5DCNA 3NVZA 4ITKA 3N9YC 2CU1A 4EE2A 1WF9A 1WRIA 1WM2A 2CJOA 3MTNB 1A70A 4A3OA 1OTRB 3DVNU 4KDIC 4KSLC 2Z8LA 1JWAD 5BYRA 1R4MI 2EMTA 4DHZE 4MEMA 4HXDA 2MP2B 3JVZX 1ZXHA 5L83A 2G1EA 1J7BA 3PSEB 1XXGA 1LFDA 1K52A 2WXRA 1VZ7A 3APFA 1KM7A 4XWTA 2QMTA 2K6DB 4HK2A 4RMAA 4BBNF 1WYWB 1WE6A 2RSUA 2JRHA
chains in the Genus database with same CATH topology
1E7UA 3QWZB 2OJRA 4GSWA 3GOEA 4KIKB 3JSVA 1P0RA 2JVCA 4LDTB 2D2QA 4NAWB 5E6PA 4M8NA 2KC1A 1SIFA 3X0WA 3QQ8B 2ZNVC 3VAWA 3IFWB 2DAJA 3W1YA 3PGEA 5DPTA 1S1QB 2AL3A 1C3TA 2L8JA 2KJHB 4ANUA 2G4DB 4IW0A 4DBGA 5JH5C 3PHWB 1A5RA 3SDLC 2Z59B 2IY1B 1YX5B 3CF6E 2KQ7A 3ZDMC 2JZ3B 2K8HA 4I6LB 4WWNA 3H7PA 1RLFA 2YLMA 2C7HA 2MBOA 2O2VA 1WY8A 4BKGA 2WDTB 4AP4C 4W9FA 2ZZPB 1XT9B 2N1VA 4MSMB 2NPTB 2KQSA 4AOFA 2NS5A 5C1ZA 3R7QA 1GG3A 3QC8B 1RFAA 2AYOB 1P9DU 4HWIB 2ZEQA 1GC7A 2NBWB 2KJRA 1WXAA 3DCGA 3NS8A 3T9LA 2G4SA 4GGQA 2KTFA 2C5LC 2GMIC 2GOWA 2JXXA 1WJ4A 2O6VB 4HPMB 4A20A 3TBLD 2PE9A 2N9EB 2L3ZA 1UD7A 1V80A 2NBVB 3AU4A 3WANA 3PTFC 4G50A 1NDDA 2JZZA 1H4RA 3EFUA 3R7RA 3A9JB 4PS7A 3A33B 3PPAA 2DYBA 2K39A 1Q1OA 5LLIA 2AL6A 4KZCA 2A5UA 2BWES 4IC7B 2KKCA 3EHVA 4ANVA 2MBQA 2LASA 1WXMA 2N7EA 4AJWA 5D7GA 4EZLA 4W9HA 5DPWA 2GBMA 3P2BA 1P98A 4K7UA 4K81A 4HCNB 2XBBC 1YX6B 2KD0A 3D32A 2KDBA 3PRZA 4NNJB 3JYUA 5CHWA 1VCBA 4CYEA 2AEHA 2NR2A 4GDLB 4WQOB 3RZWC 3A4RA 4GDKB 3OLMD 3VFKA 2LRUA 3TJPA 3ZO5B 4CHKA 2MBHA 4KV2A 4N9F4 1CMXB 4HVBA 2NCNA 2LVQA 2IO3B 3VUYA 3NZSA 3DBRI 1JRUA 2DZMA 2FNJB 2VRRB 3S2AA 5J17A 4XX5A 2ZPNA 2N9PC 4I6NB 3KYCD 4BBNC 2L7RA 1UZXB 2HD5B 3QIJA 4GB9A 5D2MB 4FJZA 1I42A 4HPLB 2RD0A 4FN2A 1UELA 2XK5B 3PHXB 4WWPA 5AZGA 3DOWA 3UIPB 4NJ6A 2I1JA 2KN5A 2N4FA 3PLUA 3QK0A 4G11A 3B08A 2MX2A 1MG8A 3V6EB 3K9OB 2MCNB 3ENEA 2N9XA 4BKSA 2DYOA 2N1WA 1J0GA 4BKTA 4F1SA 2LVOA 2LWPA 3VH3B 1FXTB 3QAQA 2QHOA 4DHJB 4F8CB 3A1QB 5CHVC 1OGWA 1XD3B 2BYFA 2JY6A 3H7SA 3M63B 3OJ4B 2KZRA 4W9GA 2IO1B 3HK0A 2WYQA 2KMCA 3VTWA 1Q5WB 2KHWB 2MRPA 2GBNA 3VVWB 3NZUA 4B6WA 3UQBA 3R66C 4IM2A 2IY0B 5CTRC 5CHFA 4W9LA 5KHQA 3UIOB 2DAFA 4IUMB 3V62A 2GBKA 2L76A 4WJOA 3VTUA 2W9NA 4FHKA 4WJPA 1S3SG 3MHSD 3RT3B 2REXA 3A4SC 4DDID 4TV3A 3CSFA 1IP9A 5JHAA 4MJSB 1NBFC 3QX1A 3VH4B 2Y5BB 5J2RA 1QZEA 1WM3A 2MP2A 3MJWA 3ZNGC 4A3PA 3EECA 1KJTA 4JGHB 1XQQA 4K7SA 3RULA 2HE7A 3U8ZA 4NPNA 1WX9A 5AZHA 4AWJA 4ZYNA 4BFRA 2ASQA 4GOCA 4MH0E 1UBQA 1V2YA 1V5OA 4EFOA 1WGGA 2LD9A 2BKFA 2LGXA 1V81A 2NBUA 5E6OA 1WI0A 1LXDA 1EF1A 1V6EA 1Z5SB 1YJ1A 2KLGA 2KWCA 2A4ZA 2NVUI 5GMVA 4EEWA 1KOTA 1NI2A 3KH0A 1LQBA 5E6NA 3AU5A 3ZRCA 4FADA 2D07B 2WX1A 4NQKE 4IM3A 3ZKJC 1WMHB 3APCA 1E8ZA 3PV1A 3JW0X 4KIKA 4MJSA 1RAXA 3C0RB 5LXIB 3M95A 3ZNZB 2M17A 1K8RB 4WJNA 4NAWA 3ML8A 4EOYA 2LZ6A 2IYDB 3DVGX 4E74A 3KYDD 2MLBA 1GC6A 5LXHA 3ZDTA 2MWSB 1E5WA 5HKHA 3DDCB 2BYVE 4K7WA 1EUVB 3N30A 2LRWA 3I3TB 3V61A 3KVFB 1OQYA 2KWVB 4MDKE 5AEKB 2M1MA 2KDIA 3L54A 2I1KA 4PS8A 3UGBB 2CKHB 3K9PB 3KUZA 2V3SA 4URKA 3A9KB 1UH6A 2ZCBA 3ALBA 3ML9A 2M8SA 2L00B 4G3XB 2V4LA 3PREA 4HJKA 3VXWA 4TQ0A 3WAOA 5JHBA 5KHOA 2D11A 4FJYA 3ZNID 1M94A 3ECIA 1WGDA 4HLEA 1WGRA 5DPSA 2NPTA 2MSED 3BY4B 3QARA 5D94A 3ZIMA 4M0WB 3QCAA 4B9KA 2HJ8A 4WWOA 4MGIE 1HE8A 2EKEC 4II3B 1YD8U 3PRMB 3O65B 2KFJA 3V60A 2KX0A 1SE9A 4GN1A 2BYEA 3WALA 4ASWC 4E71A 2KJ6A 5G2NA 1OEYJ 2O6VA 1RRBA 4MM3A 1E7VA 3PRPB 1WH3A 2C60A 4EKUA 1E90A 1GJZA 3AXCA 1L2NA 4IG7B 4DK5A 5FR6A 1TGZB 3HM3A 3PT2B 4BKSD 2KDEB 4BOZB 1EF5A 3A9JA 4DDGD 2JPHA 4JQWC 2JWZA 4PYUA 3X23A 4LJPB 1G6JA 2ZCCA 1IPGA 3PLVA 4DWFA 3IHPC 1T0YA 1Z2MA 4ZRJA 1Y8RC 1V9JA 1VD2A 1WJUA 2KFKB 3ZW3A 2B3AA 3LJ3A 3ONSA 3Q3JA 2DYMA 2FAZA 2R2QA 2R2OA 3DQVA 3TMPB 5EDSA 5G55A 4M8MA 4OVVA 3RCZA 2KX3A 3VHTC 4ANWA 2ZNVB 1WJNA 2PPHA 4AJYB 4W9IA 2J0KA 2LUEA 1F9JA 3U30A 3RZFA 3TIXA 2M0XA 3KW5B 3LDZE 4GDLA 4J6IA 4GU2A 2BWFA 2CHZA 4GDKA 2MBBB 1SGHA 3VDZA 2ZJDA 3WIMA 2KTRB 3SHQA 2DENB 2DZJA 3N32A 4EZJA 2M4NA 2OOBB 1WXVA 4TQ1A 4ANXA 4KVGB 2DZIA 5D6JB 4DHZB 2ZPYA 2FCSA 4TUUA 3DBLI 3NY5A 2XK5A 1GNUA 4RM8A 3RYTA 4FHJA 4FULA 4MELA 4XZ4A 4ICUA 2LGYA 2PE6B 3JSVB 2GBJA 2LGDA 1WGHA 2DX5B 3DBSA 1WXSA 1WR1A 3NOBA 1YQBA 3QA8A 4TKNA 2D10A 1TTNA 3A1QA 4DXAB 4LJOB 4P7IA 1AARA 2FIFA 2LVPA 3B0AA 4NY0A 1D3ZA 4GXBA 1E8XA 2KTRA 3T8MA 3ZTCA 4FBJB 2G3QB 2KMAA 2LXAA 2K6QA 3L13A 3W1SA 4LDTD 3BINA 3H7PB 3QJZA 2O2VB 5IA7A 3PS6A 3DBHI 1YIWA 1V49A 1PQSA 2FUHB 3R3MA 2KNBA 4RM9A 4FA6A 3EC8A 5J18A 3N3KB 3CMMB 2YVCA 3IBEA 1TBEA 1P1AA 4IWPA 4PS3A 2XEWA 5L95C 2BGFA 2FIDA 4JLCA 3UF8A 3APDA 1L7YA 5CX3A 3SU8X 2PJHA 3AI5A 5AZFA 2J0JA 4IM0A 2BKRB 4KZ0A 4ICVA 4MGZE 1IYFA 2BPSA 3QHTA 3HM6X 2MW5A 2KOXA 3TCAA 3H6NA 1ZW7A 2V1YA 4BVUC 3WA0A 2EMSA 2FCQA 2J0MA 4FJVB 1X1MA 2IBIB 2KK8A 4IWQA 5BO4B 4AUQC 4NJ7A 3L10B 3ZVVA 4I6PA 3VUXA 4E3CA 2N7DA 2C7NB 1WZ0A 1ISNA 1U4AA 1TZ1A 4OVUA 4CO7A 3ZLZA 2WWZA 2LJ5A 1WIAA 2KO3A 3L0WB 4JL9A 4X57B 4ZRIA 2CS4A 3W1SC 3L17A 2BF8B 2K25A 2IO0B 2KANA 3B1LX 3L16A 1WFYA 2JF5A 4PYZA 4W9KA 4YL8A 3V6CB 1WX8A 2L0FA 4G0NB 4K1RB 1J8CA 3M62B 2O6VD 1WMHA 5C23A 2JRIB 2UYZB 3RD2A 1WR6E 4W9DA 2G45B 4XC2A 2JUOA 2DHZA 2K8BA 2D3GA 2IO2B 1UGMA 1WGYA 2MA9B 1P3QU 1J19A 2LI5A 3DPDA 4EUTA 2CHXA 4HDOA 1WZ3A 1V5TA 3HIZA 1Q0WB 3GZNI 1KLVA 4II2B 2ZVOA 3CSTA 4W9JA 1E8YA 2C9WB 4GMVA 4WAAA 3A9KA 4ZRKA 1LM8B 2KVRA 3UINB 3IG3A 4FLHA 4F7ZA 4MGKE 1BT0A 3KUCB 1C1YB 4LCDE 2GBRA 1WRDB 2FCNA 4KSKC 2MQJA 5IAAC 4HDQA 1H8CA 3VQIA 2DZKA 3HHMA 3M3JA 3RUIB 2CR5A 1OEYA 1I35A 1WJ6A 2K8CA 2KC2A 3DVNV 2JT4B 4HCPB 2RR9A 3WAMA 2LXCA 2MBEA 1UBIA 2CHWA 2Z0DB 4KDLB 3ZTDA 4W9CA 5JZEB 3Q3FA 3OAWA 2C7MB 3ZUNA 4B95A 5DPRA 3DVGY 4MSQB 3VUWA 2AWTA 4GIVA 4IWOA 3OJ3A 5DCNA 1EO6A 1ZKHA 2KXJA 2L05A 2CU1A 2HTHA 2K1FA 1WF9A 3H1UA 1WM2A 3MTNB 2ZVNA 3VTVA 2KDFB 1OTRB 2RGFA 3DVNU 4KDIC 4KSLC 1ZGUB 3L08A 3WAPA 4DHJD 3IVFA 3ZRFA 2KWUB 1R4MI 3SD5A 3KUDB 3PZDA 4A3OA 3H9DA 3ZNHB 2KFKA 2EMTA 1R4NI 4MEMA 4DHZE 2WX0A 4HXDA 1WE7A 2PEAA 2RPQA 2MP2B 2IZVB 2FCMA 3JVZX 5TR5A 3U7DA 1GUAB 3UQAA 5L83A 4MGYE 2J7QB 2Z0EB 1E8WA 4EZKA 3PSEB 2UWQA 3PVLA 1WX7A 1LFDA 3TL5A 1V86A 4ZDVA 3AULA 2KLCA 3APFA 1KM7A 4JIOU 3NHEB 4W9EA 2K6DB 2L0TA 4HK2A 4RMAA 4WJQA 4NQLB 4BBNF 1WYWB 1WE6A 2RSUA 2JRHA 4BOSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7U A;  3QWZ B;  2OJR A;  4GSW A;  3GOE A;  4KIK B;  3JSV A;  1P0R A;  2JVC A;  4LDT B;  2D2Q A;  4NAW B;  5E6P A;  4M8N A;  2KC1 A;  1SIF A;  3X0W A;  3QQ8 B;  2ZNV C;  3VAW A;  3IFW B;  2DAJ A;  3W1Y A;  3PGE A;  5DPT A;  1S1Q B;  2AL3 A;  1C3T A;  2L8J A;  2KJH B;  4ANU A;  2G4D B;  4IW0 A;  4DBG A;  5JH5 C;  3PHW B;  1A5R A;  3SDL C;  2Z59 B;  2IY1 B;  1YX5 B;  3CF6 E;  2KQ7 A;  3ZDM C;  2JZ3 B;  2K8H A;  4I6L B;  4WWN A;  3H7P A;  1RLF A;  2YLM A;  2C7H A;  2MBO A;  2O2V A;  1WY8 A;  4BKG A;  2WDT B;  4AP4 C;  4W9F A;  2ZZP B;  1XT9 B;  2N1V A;  4MSM B;  2NPT B;  2KQS A;  4AOF A;  2NS5 A;  5C1Z A;  3R7Q A;  1GG3 A;  3QC8 B;  1RFA A;  2AYO B;  1P9D U;  4HWI B;  2ZEQ A;  1GC7 A;  2NBW B;  2KJR A;  1WXA A;  3DCG A;  3NS8 A;  3T9L A;  2G4S A;  4GGQ A;  2KTF A;  2C5L C;  2GMI C;  2GOW A;  2JXX A;  1WJ4 A;  2O6V B;  4HPM B;  4A20 A;  3TBL D;  2PE9 A;  2N9E B;  2L3Z A;  1UD7 A;  1V80 A;  2NBV B;  3AU4 A;  3WAN A;  3PTF C;  4G50 A;  1NDD A;  2JZZ A;  1H4R A;  3EFU A;  3R7R A;  3A9J B;  4PS7 A;  3A33 B;  3PPA A;  2DYB A;  2K39 A;  1Q1O A;  5LLI A;  2AL6 A;  4KZC A;  2A5U A;  2BWE S;  4IC7 B;  2KKC A;  3EHV A;  4ANV A;  2MBQ A;  2LAS A;  1WXM A;  2N7E A;  4AJW A;  5D7G A;  4EZL A;  4W9H A;  5DPW A;  2GBM A;  3P2B A;  1P98 A;  4K7U A;  4K81 A;  4HCN B;  2XBB C;  1YX6 B;  2KD0 A;  3D32 A;  2KDB A;  3PRZ A;  4NNJ B;  3JYU A;  5CHW A;  1VCB A;  4CYE A;  2AEH A;  2NR2 A;  4GDL B;  4WQO B;  3RZW C;  3A4R A;  4GDK B;  3OLM D;  3VFK A;  2LRU A;  3TJP A;  3ZO5 B;  4CHK A;  2MBH A;  4KV2 A;  4N9F 4;  1CMX B;  4HVB A;  2NCN A;  2LVQ A;  2IO3 B;  3VUY A;  3NZS A;  3DBR I;  1JRU A;  2DZM A;  2FNJ B;  2VRR B;  3S2A A;  5J17 A;  4XX5 A;  2ZPN A;  2N9P C;  4I6N B;  3KYC D;  4BBN C;  2L7R A;  1UZX B;  2HD5 B;  3QIJ A;  4GB9 A;  5D2M B;  4FJZ A;  1I42 A;  4HPL B;  2RD0 A;  4FN2 A;  1UEL A;  2XK5 B;  3PHX B;  4WWP A;  5AZG A;  3DOW A;  3UIP B;  4NJ6 A;  2I1J A;  2KN5 A;  2N4F A;  3PLU A;  3QK0 A;  4G11 A;  3B08 A;  2MX2 A;  1MG8 A;  3V6E B;  3K9O B;  2MCN B;  3ENE A;  2N9X A;  4BKS A;  2DYO A;  2N1W A;  1J0G A;  4BKT A;  4F1S A;  2LVO A;  2LWP A;  3VH3 B;  1FXT B;  3QAQ A;  2QHO A;  4DHJ B;  4F8C B;  3A1Q B;  5CHV C;  1OGW A;  1XD3 B;  2BYF A;  2JY6 A;  3H7S A;  3M63 B;  3OJ4 B;  2KZR A;  4W9G A;  2IO1 B;  3HK0 A;  2WYQ A;  2KMC A;  3VTW A;  1Q5W B;  2KHW B;  2MRP A;  2GBN A;  3VVW B;  3NZU A;  4B6W A;  3UQB A;  3R66 C;  4IM2 A;  2IY0 B;  5CTR C;  5CHF A;  4W9L A;  5KHQ A;  3UIO B;  2DAF A;  4IUM B;  3V62 A;  2GBK A;  2L76 A;  4WJO A;  3VTU A;  2W9N A;  4FHK A;  4WJP A;  1S3S G;  3MHS D;  3RT3 B;  2REX A;  3A4S C;  4DDI D;  4TV3 A;  3CSF A;  1IP9 A;  5JHA A;  4MJS B;  1NBF C;  3QX1 A;  3VH4 B;  2Y5B B;  5J2R A;  1QZE A;  1WM3 A;  2MP2 A;  3MJW A;  3ZNG C;  4A3P A;  3EEC A;  1KJT A;  4JGH B;  1XQQ A;  4K7S A;  3RUL A;  2HE7 A;  3U8Z A;  4NPN A;  1WX9 A;  5AZH A;  4AWJ A;  4ZYN A;  4BFR A;  2ASQ A;  4GOC A;  4MH0 E;  1UBQ A;  1V2Y A;  1V5O A;  4EFO A;  1WGG A;  2LD9 A;  2BKF A;  2LGX A;  1V81 A;  2NBU A;  5E6O A;  1WI0 A;  1LXD A;  1EF1 A;  1V6E A;  1Z5S B;  1YJ1 A;  2KLG A;  2KWC A;  2A4Z A;  2NVU I;  5GMV A;  4EEW A;  1KOT A;  1NI2 A;  3KH0 A;  1LQB A;  5E6N A;  3AU5 A;  3ZRC A;  4FAD A;  2D07 B;  2WX1 A;  4NQK E;  4IM3 A;  3ZKJ C;  1WMH B;  3APC A;  1E8Z A;  3PV1 A;  3JW0 X;  4KIK A;  4MJS A;  1RAX A;  3C0R B;  5LXI B;  3M95 A;  3ZNZ B;  2M17 A;  1K8R B;  4WJN A;  4NAW A;  3ML8 A;  4EOY A;  2LZ6 A;  2IYD B;  3DVG X;  4E74 A;  3KYD D;  2MLB A;  1GC6 A;  5LXH A;  3ZDT A;  2MWS B;  1E5W A;  5HKH A;  3DDC B;  2BYV E;  4K7W A;  1EUV B;  3N30 A;  2LRW A;  3I3T B;  3V61 A;  3KVF B;  1OQY A;  2KWV B;  4MDK E;  5AEK B;  2M1M A;  2KDI A;  3L54 A;  2I1K A;  4PS8 A;  3UGB B;  2CKH B;  3K9P B;  3KUZ A;  2V3S A;  4URK A;  3A9K B;  1UH6 A;  2ZCB A;  3ALB A;  3ML9 A;  2M8S A;  2L00 B;  4G3X B;  2V4L A;  3PRE A;  4HJK A;  3VXW A;  4TQ0 A;  3WAO A;  5JHB A;  5KHO A;  2D11 A;  4FJY A;  3ZNI D;  1M94 A;  3ECI A;  1WGD A;  4HLE A;  1WGR A;  5DPS A;  2NPT A;  2MSE D;  3BY4 B;  3QAR A;  5D94 A;  3ZIM A;  4M0W B;  3QCA A;  4B9K A;  2HJ8 A;  4WWO A;  4MGI E;  1HE8 A;  2EKE C;  4II3 B;  1YD8 U;  3PRM B;  3O65 B;  2KFJ A;  3V60 A;  2KX0 A;  1SE9 A;  4GN1 A;  2BYE A;  3WAL A;  4ASW C;  4E71 A;  2KJ6 A;  5G2N A;  1OEY J;  2O6V A;  1RRB A;  4MM3 A;  1E7V A;  3PRP B;  1WH3 A;  2C60 A;  4EKU A;  1E90 A;  1GJZ A;  3AXC A;  1L2N A;  4IG7 B;  4DK5 A;  5FR6 A;  1TGZ B;  3HM3 A;  3PT2 B;  4BKS D;  2KDE B;  4BOZ B;  1EF5 A;  3A9J A;  4DDG D;  2JPH A;  4JQW C;  2JWZ A;  4PYU A;  3X23 A;  4LJP B;  1G6J A;  2ZCC A;  1IPG A;  3PLV A;  4DWF A;  3IHP C;  1T0Y A;  1Z2M A;  4ZRJ A;  1Y8R C;  1V9J A;  1VD2 A;  1WJU A;  2KFK B;  3ZW3 A;  2B3A A;  3LJ3 A;  3ONS A;  3Q3J A;  2DYM A;  2FAZ A;  2R2Q A;  2R2O A;  3DQV A;  3TMP B;  5EDS A;  5G55 A;  4M8M A;  4OVV A;  3RCZ A;  2KX3 A;  3VHT C;  4ANW A;  2ZNV B;  1WJN A;  2PPH A;  4AJY B;  4W9I A;  2J0K A;  2LUE A;  1F9J A;  3U30 A;  3RZF A;  3TIX A;  2M0X A;  3KW5 B;  3LDZ E;  4GDL A;  4J6I A;  4GU2 A;  2BWF A;  2CHZ A;  4GDK A;  2MBB B;  1SGH A;  3VDZ A;  2ZJD A;  3WIM A;  2KTR B;  3SHQ A;  2DEN B;  2DZJ A;  3N32 A;  4EZJ A;  2M4N A;  2OOB B;  1WXV A;  4TQ1 A;  4ANX A;  4KVG B;  2DZI A;  5D6J B;  4DHZ B;  2ZPY A;  2FCS A;  4TUU A;  3DBL I;  3NY5 A;  2XK5 A;  1GNU A;  4RM8 A;  3RYT A;  4FHJ A;  4FUL A;  4MEL A;  4XZ4 A;  4ICU A;  2LGY A;  2PE6 B;  3JSV B;  2GBJ A;  2LGD A;  1WGH A;  2DX5 B;  3DBS A;  1WXS A;  1WR1 A;  3NOB A;  1YQB A;  3QA8 A;  4TKN A;  2D10 A;  1TTN A;  3A1Q A;  4DXA B;  4LJO B;  4P7I A;  1AAR A;  2FIF A;  2LVP A;  3B0A A;  4NY0 A;  1D3Z A;  4GXB A;  1E8X A;  2KTR A;  3T8M A;  3ZTC A;  4FBJ B;  2G3Q B;  2KMA A;  2LXA A;  2K6Q A;  3L13 A;  3W1S A;  4LDT D;  3BIN A;  3H7P B;  3QJZ A;  2O2V B;  5IA7 A;  3PS6 A;  3DBH I;  1YIW A;  1V49 A;  1PQS A;  2FUH B;  3R3M A;  2KNB A;  4RM9 A;  4FA6 A;  3EC8 A;  5J18 A;  3N3K B;  3CMM B;  2YVC A;  3IBE A;  1TBE A;  1P1A A;  4IWP A;  4PS3 A;  2XEW A;  5L95 C;  2BGF A;  2FID A;  4JLC A;  3UF8 A;  3APD A;  1L7Y A;  5CX3 A;  3SU8 X;  2PJH A;  3AI5 A;  5AZF A;  2J0J A;  4IM0 A;  2BKR B;  4KZ0 A;  4ICV A;  4MGZ E;  1IYF A;  2BPS A;  3QHT A;  3HM6 X;  2MW5 A;  2KOX A;  3TCA A;  3H6N A;  1ZW7 A;  2V1Y A;  4BVU C;  3WA0 A;  2EMS A;  2FCQ A;  2J0M A;  4FJV B;  1X1M A;  2IBI B;  2KK8 A;  4IWQ A;  5BO4 B;  4AUQ C;  4NJ7 A;  3L10 B;  3ZVV A;  4I6P A;  3VUX A;  4E3C A;  2N7D A;  2C7N B;  1WZ0 A;  1ISN A;  1U4A A;  1TZ1 A;  4OVU A;  4CO7 A;  3ZLZ A;  2WWZ A;  2LJ5 A;  1WIA A;  2KO3 A;  3L0W B;  4JL9 A;  4X57 B;  4ZRI A;  2CS4 A;  3W1S C;  3L17 A;  2BF8 B;  2K25 A;  2IO0 B;  2KAN A;  3B1L X;  3L16 A;  1WFY A;  2JF5 A;  4PYZ A;  4W9K A;  4YL8 A;  3V6C B;  1WX8 A;  2L0F A;  4G0N B;  4K1R B;  1J8C A;  3M62 B;  2O6V D;  1WMH A;  5C23 A;  2JRI B;  2UYZ B;  3RD2 A;  1WR6 E;  4W9D A;  2G45 B;  4XC2 A;  2JUO A;  2DHZ A;  2K8B A;  2D3G A;  2IO2 B;  1UGM A;  1WGY A;  2MA9 B;  1P3Q U;  1J19 A;  2LI5 A;  3DPD A;  4EUT A;  2CHX A;  4HDO A;  1WZ3 A;  1V5T A;  3HIZ A;  1Q0W B;  3GZN I;  1KLV A;  4II2 B;  2ZVO A;  3CST A;  4W9J A;  1E8Y A;  2C9W B;  4GMV A;  4WAA A;  3A9K A;  4ZRK A;  1LM8 B;  2KVR A;  3UIN B;  3IG3 A;  4FLH A;  4F7Z A;  4MGK E;  1BT0 A;  3KUC B;  1C1Y B;  4LCD E;  2GBR A;  1WRD B;  2FCN A;  4KSK C;  2MQJ A;  5IAA C;  4HDQ A;  1H8C A;  3VQI A;  2DZK A;  3HHM A;  3M3J A;  3RUI B;  2CR5 A;  1OEY A;  1I35 A;  1WJ6 A;  2K8C A;  2KC2 A;  3DVN V;  2JT4 B;  4HCP B;  2RR9 A;  3WAM A;  2LXC A;  2MBE A;  1UBI A;  2CHW A;  2Z0D B;  4KDL B;  3ZTD A;  4W9C A;  5JZE B;  3Q3F A;  3OAW A;  2C7M B;  3ZUN A;  4B95 A;  5DPR A;  3DVG Y;  4MSQ B;  3VUW A;  2AWT A;  4GIV A;  4IWO A;  3OJ3 A;  5DCN A;  1EO6 A;  1ZKH A;  2KXJ A;  2L05 A;  2CU1 A;  2HTH A;  2K1F A;  1WF9 A;  3H1U A;  1WM2 A;  3MTN B;  2ZVN A;  3VTV A;  2KDF B;  1OTR B;  2RGF A;  3DVN U;  4KDI C;  4KSL C;  1ZGU B;  3L08 A;  3WAP A;  4DHJ D;  3IVF A;  3ZRF A;  2KWU B;  1R4M I;  3SD5 A;  3KUD B;  3PZD A;  4A3O A;  3H9D A;  3ZNH B;  2KFK A;  2EMT A;  1R4N I;  4MEM A;  4DHZ E;  2WX0 A;  4HXD A;  1WE7 A;  2PEA A;  2RPQ A;  2MP2 B;  2IZV B;  2FCM A;  3JVZ X;  5TR5 A;  3U7D A;  1GUA B;  3UQA A;  5L83 A;  4MGY E;  2J7Q B;  2Z0E B;  1E8W A;  4EZK A;  3PSE B;  2UWQ A;  3PVL A;  1WX7 A;  1LFD A;  3TL5 A;  1V86 A;  4ZDV A;  3AUL A;  2KLC A;  3APF A;  1KM7 A;  4JIO U;  3NHE B;  4W9E A;  2K6D B;  2L0T A;  4HK2 A;  4RMA A;  4WJQ A;  4NQL B;  4BBN F;  1WYW B;  1WE6 A;  2RSU A;  2JRH A;  4BOS C; 
#chains in the Genus database with same CATH topology
 2N9K A;  4A55 A;  2ICI A;  4KIK B;  4WIP A;  4A90 A;  1P0R A;  1T5X D;  4C00 A;  1ACC A;  3P4S B;  2QCZ A;  5E6P A;  2KC1 A;  4XYC A;  2SAK A;  2WHI A;  1NI3 A;  4H2A A;  4GLS C;  1I4P A;  4ANU A;  4O1N A;  4IW0 A;  3PHW B;  3SDL C;  3MFG A;  2IY1 B;  1YX5 B;  3ZDM C;  2K8H A;  2D3A A;  1RLF A;  2C7H A;  3Q8C A;  2M0A A;  4BKG A;  4W9F A;  2N1V A;  1LGR A;  3W9C B;  2NPT B;  2KQS A;  1GG3 A;  2JXT A;  2AYO B;  1L6V A;  2WXG A;  1ENF A;  1GC7 A;  2NBW B;  2WXK A;  3DCG A;  4KKI A;  3ZYY X;  2GMI C;  3KWL A;  3BK1 A;  5EE1 A;  1GOZ A;  2JZZ A;  3EFU A;  3RNB C;  3A33 B;  3PPA A;  2K39 A;  5LLI A;  4WQM A;  3I9V 1;  2KKC A;  3EHV A;  2MBQ A;  1AWD A;  3AE7 B;  5IN7 A;  1KLU D;  4W9H A;  5DPW A;  1P98 A;  4K81 A;  5G5G A;  2KDB A;  4NNJ B;  4OW0 A;  1VCB A;  4IDI A;  3A4R A;  3OLM D;  3TJP A;  3NG0 A;  2LVQ A;  3VUY A;  2FNJ B;  4XX5 A;  2ZPN A;  5AUI A;  4GB9 A;  2JX5 A;  2RD0 A;  5AZG A;  4NJ6 A;  3PLU A;  3I63 C;  3NRZ A;  3B08 A;  3V6E B;  4BKS A;  3SR6 A;  1IBX A;  2LWP A;  3VH3 B;  3ZXR A;  3FIL B;  1OGW A;  1XD3 B;  1SF0 A;  4JE3 B;  1F77 A;  1GAQ B;  2KMC A;  1FRR A;  3VVW B;  3EGR A;  4K3C A;  3Q3M C;  2W82 A;  4IUM B;  2GBK A;  2L76 A;  1S3S G;  2KQ4 X;  3MHZ A;  4DDI D;  4WWM A;  3CSF A;  5JHA A;  1NBF C;  1UWM A;  5J2R A;  2MP2 A;  3ZNG C;  4A3P A;  4PK1 A;  4OZA A;  1XQQ A;  3NVW A;  3RUL A;  2HE7 A;  1QF6 A;  4AWJ A;  3N1X C;  2PIA A;  1J7C A;  1NEN B;  2R61 A;  1UBQ A;  3Q69 A;  1WGG A;  2WDQ B;  1V81 A;  4KGT A;  2KWC A;  4KX6 B;  4UDU C;  2GRI A;  4C80 A;  4FAD A;  2WX1 A;  4MAC A;  4MT5 A;  4IM3 A;  3ZKJ C;  1WMH B;  3EFC A;  3PV1 A;  4KIK A;  1RAX A;  3C0R B;  5LXI B;  3U7Z A;  2RDB C;  3LXF A;  3ML8 A;  4EOY A;  3KYD D;  3AM9 A;  2E3T A;  4K7W A;  3Q8F A;  3U2S C;  1R7S A;  3N30 A;  3I3T B;  1N5X A;  2KWV B;  2DLB A;  5AEK B;  2CKH B;  2WXP A;  3KUZ A;  3KQ4 A;  4Q2J A;  3A9K B;  4N58 A;  3ALB A;  3H8H A;  4TQ0 A;  3WAO A;  2N7J A;  5HFY A;  5KHO A;  3ZNI D;  1DOY A;  3N1Y C;  1EWY C;  1M94 A;  1TKG A;  2KMM A;  2NPT A;  1I4R A;  4M0W B;  4XDC A;  2EKE C;  4II3 B;  3PRM B;  4RCO A;  1ET6 A;  2Y5P A;  5EE3 A;  3V60 A;  5C2T B;  3WAL A;  4ASW C;  4E71 A;  1OQR A;  5G2N A;  2JSV X;  4HEA 1;  1N60 A;  1AW7 A;  1SXT A;  2GI9 A;  3DHG C;  3DWG C;  5FR6 A;  1EF5 A;  4DDG D;  5TSS A;  4JQW C;  4PYU A;  2ZCC A;  3Q8B A;  3PLV A;  1HTQ A;  3IHP C;  2N9L A;  1V9J A;  1WJU A;  3LJ3 A;  3O13 A;  3P4Q B;  2R2O A;  3TMP B;  3DWM A;  4L1B A;  5BYS A;  1WJN A;  4AJY B;  1F9J A;  1D6E C;  2EEL A;  2QIE B;  3TEX A;  2MBB B;  1ZOY B;  3MJ5 A;  2KTR B;  2MJ3 A;  5D6J B;  4TUU A;  2MJE A;  2LUM A;  3SFD B;  3N1Z C;  2JQR B;  3V05 A;  1WGH A;  2OED A;  1WXS A;  3QA8 A;  1ET9 A;  3AE9 B;  3FIL A;  5IO9 A;  3R2I A;  4LJO B;  3B0A A;  1KTK A;  3B9J A;  4GXB A;  2WU5 B;  3ZTC A;  2KMA A;  5I4D A;  5MPO A;  3L13 A;  1PDX A;  2WP9 B;  2NMQ A;  5IA7 A;  4ZOH C;  1SSN A;  3CMM B;  4IWP A;  1P1A A;  3AE5 B;  3HVZ A;  1YN3 A;  4JLC A;  3UF8 A;  3PZ8 A;  1NVI D;  5AZF A;  2I2Y A;  1TS5 A;  4WUR A;  2IND C;  3WA0 A;  2J0M A;  4FJV B;  2IBI B;  1KFY B;  5BO4 B;  4IWQ A;  4B0E A;  3KWV A;  1WXQ A;  2J52 A;  4I6P A;  4E3C A;  1U4A A;  1WZ0 A;  1TZ1 A;  2JF5 A;  1J8C A;  1WX8 A;  2L0F A;  2O6V D;  3AEF B;  1WMH A;  1YN4 A;  1WWT A;  1WR6 E;  1FRD A;  5D3I B;  4XC2 A;  1ZP0 B;  2DHZ A;  2D3G A;  1STE A;  3DPD A;  2CHX A;  3BVM A;  1UWX A;  2NTT A;  3TSS A;  3HIZ A;  3BYY B;  3R2T A;  2ZVO A;  3CST A;  3PO0 A;  4W9J A;  2C9W B;  3A9K A;  2KVR A;  1TY2 A;  3KUC B;  4YTN B;  1H8C A;  1VZ8 A;  3HHM A;  3NVV A;  1JWS D;  2AQ1 B;  1YMH E;  2K8C A;  4M0W A;  3VRA B;  3E56 A;  2JT4 B;  2I38 A;  1UBI A;  3ZTD A;  5JZE B;  1RFK A;  1K51 A;  2BQQ A;  1UNS A;  2AWT A;  4IWO A;  1ZKH A;  2L05 A;  2HTH A;  2ZVN A;  3VTV A;  2RGF A;  4LNF A;  4DHJ D;  2LFI A;  3NS1 A;  3KUD B;  1MHH E;  1R4N I;  1C76 A;  2IZV B;  2FCM A;  1GUA B;  3UQA A;  2Z0E B;  3EUB 2;  1WGK A;  1WX7 A;  1EWC A;  3TL5 A;  2KLC A;  1XCQ L;  3NHE B;  4W9E A;  4BOS C;  4GSW A;  3GOE A;  2IGH A;  2MH7 A;  4DQO C;  5BYQ A;  2KVZ A;  3V3X A;  3DBH B;  2BW2 A;  3X0W A;  1SE3 A;  3QQ8 B;  1N5W A;  4JX1 C;  2DAJ A;  3W1Y A;  3PGE A;  2L8J A;  2KJH B;  2G4D B;  3CF6 E;  1T3Q A;  2JZ3 B;  4WWN A;  3LB8 C;  4AP4 C;  4AOF A;  2NS5 A;  3R7Q A;  1P9D U;  2ZEQ A;  3AEC B;  1L0X B;  3T9L A;  5GXG B;  4XDD A;  2GOW A;  1XCT L;  2JXX A;  4QAY A;  3TBL D;  2N9E B;  1UD7 A;  1V80 A;  3WAN A;  1QKZ A;  4PS7 A;  2LGI A;  2DYB A;  2AL6 A;  4KZC A;  2BWE S;  4IC7 B;  5T8I A;  3GZN B;  2PVG C;  1WXM A;  2N7E A;  4AJW A;  4YWG G;  4EZL A;  3P42 A;  1T0Q C;  4HCN B;  1CZP A;  3I57 A;  5CHW A;  4KGS A;  2NR2 A;  2L32 A;  3CIR B;  4HJG E;  1JCK B;  4P1C C;  1JRP A;  3ZO5 B;  4KV2 A;  1CMX B;  2K9X A;  1ZE3 D;  3AV8 A;  3IAM 1;  2IO3 B;  3DBR I;  4US9 A;  2DZM A;  5J17 A;  2N9P C;  4I6N B;  3KYC D;  1P7E A;  2PMV A;  1F2R I;  2KN5 A;  1TIF A;  3RPF C;  3QK0 A;  4G11 A;  1MG8 A;  4OVZ A;  1VZ6 A;  2MCN B;  2N9X A;  2DYO A;  2N1W A;  4J3O D;  1TYG B;  2LVO A;  1WYG A;  3QAQ A;  4KKJ A;  2WLB A;  4F8C B;  5CHV C;  3RN9 C;  3M63 B;  3H7S A;  4ARC A;  4W9G A;  3N20 C;  3T3O A;  3NVY A;  4B6W A;  1HZ6 A;  1MVK A;  2DAF A;  1FO4 A;  1C4C A;  3VTU A;  2W9N A;  1E0Z A;  3SEB A;  3MHS D;  3RT3 B;  4TMA B;  3A4S C;  1IP9 A;  2EKI A;  1D5M C;  3W5U B;  3QX1 A;  3ABV B;  2Y5B B;  1KJT A;  3BWU D;  2D3B A;  2IGD A;  4NPN A;  1IUE A;  3B2G A;  4LK0 M;  4EFO A;  2V0G A;  2NBU A;  2RMM A;  1EF1 A;  1Z5S B;  3W2D A;  3KH0 A;  3AU5 A;  1SJH D;  1C4A A;  4B0M A;  3JW0 X;  4MJS A;  1FEH A;  2LJI A;  3TEZ A;  1RYJ A;  3ZNZ B;  2M17 A;  1K8R B;  2G9H D;  3ZJV A;  5BMI A;  1HTO A;  2LZ6 A;  2IYD B;  1GC6 A;  5LXH A;  3ZDT A;  1D4B A;  1EUV B;  4USA A;  2LRW A;  1JRO A;  3KVF B;  1OQY A;  2PW9 A;  2KDI A;  4PS8 A;  2I1K A;  1K53 A;  2PVO D;  3K9P B;  1ZPS A;  2V3S A;  4ANV A;  2RPV A;  3ETR A;  2M8S A;  2V4L A;  5JHB A;  2D11 A;  4FJY A;  1EM7 A;  3U52 E;  1HA5 A;  3ECI A;  4LLG M;  3BY4 B;  3ZIM A;  5D94 A;  3QCA A;  4WWO A;  3URY A;  1UGJ A;  1HE8 A;  1YD8 U;  2KFJ A;  3PZ7 A;  1FFV A;  2KAJ A;  4RNA A;  3PRP B;  4EKU A;  1E90 A;  1GJZ A;  4IG7 B;  4DK5 A;  2QIL A;  1TGZ B;  4BOZ B;  2JPH A;  2NTS A;  4LJP B;  1Z2M A;  1Y8R C;  1ROE A;  3AE4 B;  4LNI A;  2DYM A;  1B1Z A;  4WH4 A;  5G55 A;  4M8M A;  4W9I A;  2J0K A;  4ZYS A;  2LUE A;  3U30 A;  2BTE A;  2BWF A;  2CHZ A;  3P4R B;  1TKY A;  3GS2 A;  3VDZ A;  2ZJD A;  3SHQ A;  3N32 A;  2M4N A;  4TQ1 A;  2DZI A;  2FCS A;  1QIL A;  2KN4 A;  2B76 B;  4RM8 A;  3BII D;  4FHJ A;  4MEL A;  2E6X A;  4XZ4 A;  2FBW B;  2PE6 B;  3AN1 A;  3NOB A;  1YQB A;  4TKN A;  2D10 A;  3AEB B;  1NYQ A;  4NY0 A;  4OHJ A;  2G3Q B;  1E7P B;  4LDT D;  2KAC A;  2W54 A;  5IKC M;  2KNB A;  1F1H A;  3EC8 A;  4FA6 A;  3N3K B;  4YXD B;  4N6E B;  1F2R C;  2RDH A;  2XEW A;  5L95 C;  2BGF A;  1I4H A;  1N6Z A;  5CX3 A;  2PJH A;  3AI5 A;  5IOI A;  4KZ0 A;  2MHJ A;  4ICV A;  3RNF C;  1IYF A;  3TCA A;  2KOX A;  1ZW7 A;  2V1Y A;  2FCQ A;  1X1M A;  4AUQ C;  2BT6 A;  3L10 B;  3ZVV A;  2N7D A;  4OVU A;  4CO7 A;  2WWZ A;  4FXC A;  3CWI A;  3L0W B;  4ZRI A;  5BMG A;  2K25 A;  2IO0 B;  3V6C B;  4G0N B;  4C4V B;  5BMH A;  2CJN A;  2JUO A;  5FK9 C;  3LYY A;  1UGM A;  2MA9 B;  1P3Q U;  1E10 A;  2LHE A;  1HEZ E;  5H8Y E;  2WXQ A;  1KLV A;  4II2 B;  3B2F A;  1E8Y A;  3FKY A;  3IG3 A;  4F7Z A;  1WRD B;  4KSK C;  1C9F A;  2WS3 B;  1JW9 D;  5IAA C;  4HDQ A;  5IP4 D;  1LO5 D;  3VQI A;  2DZK A;  5JXV A;  3RUI B;  3KLS X;  3MC9 A;  2YEP B;  1I35 A;  1WJ6 A;  2BYT A;  1FNU A;  4HCP B;  3WAM A;  1JQ4 A;  2CHW A;  4W9C A;  3ZUN A;  1MPE A;  5DPR A;  4GIV A;  3OJ3 A;  3AB5 A;  1FM0 D;  2WXI A;  2KDF B;  2Y5C A;  3IVF A;  3ZRF A;  2KWU B;  3SD5 A;  3PZD A;  1TKE A;  2WX0 A;  3DBL B;  2TSS A;  2RDG A;  2PEA A;  1ESF A;  5TR5 A;  4LNK A;  3MC8 A;  1E8W A;  2WGS A;  3PVL A;  1AN8 A;  4JIO U;  2AQ3 B;  2L0T A;  4WJQ A;  4NQL B;  4MH8 A;  5CHF A;  3QWZ B;  2WXM A;  1T0S C;  1ZXI A;  3AEA B;  4NAW B;  4M01 A;  3L4P A;  3ZJT A;  1SE4 A;  1F52 A;  3VAW A;  4WAF A;  5DPT A;  1S1Q B;  2AL3 A;  1C3T A;  1XEE A;  1A5R A;  4DBG A;  2Z59 B;  1N62 A;  2LEK A;  1DYQ A;  2YLM A;  4DXF A;  2WDT B;  2ZZP B;  1XT9 B;  4MSM B;  1GPX A;  3QC8 B;  4RGN A;  3NS8 A;  1WXA A;  2G4S A;  1L6U A;  2C5L C;  1VJK A;  2KWD A;  2O6V B;  2PE9 A;  3RNA C;  3PTF C;  4G50 A;  4XWW A;  4NZL B;  3R7R A;  1PUT A;  5H92 C;  1Q1O A;  3UI3 A;  1V1O A;  1BML C;  2V4I B;  5D7G A;  2GBM A;  4K7U A;  4C4V A;  1YX6 B;  1TY0 A;  1I7H A;  2KD0 A;  3FC4 A;  3Q6B A;  4CYE A;  2AEH A;  4GDL B;  4WQO B;  5G5H A;  4GDK B;  4R3D A;  1V1P B;  2LHD A;  3Q3N C;  4CHK A;  4HVB A;  1IGD A;  1AYF A;  3NZS A;  3S2A A;  2VRR B;  4BBN C;  2L7R A;  1UZX B;  2GLS A;  3QIJ A;  5D2M B;  2J4X A;  3DBR B;  1UEL A;  2XK5 B;  3P1M A;  3TUO A;  1MI0 A;  4AQ7 A;  2N4F A;  4PT5 A;  3P63 A;  2MX2 A;  4JWU C;  3K9O B;  3Q8A A;  3ENE A;  1YOV B;  2W55 A;  1J0G A;  2BBC A;  1R4M B;  1FXT B;  4DHJ B;  1PGA A;  2QHO A;  2JY6 A;  5D3D A;  2KDM A;  2KZR A;  3OJ4 B;  1Q5W B;  2KHW B;  2MRP A;  2K3U A;  4RGO S;  3IT6 B;  3NZU A;  4A6Q A;  1TS2 A;  1PYW D;  2INP E;  5CTR C;  2WXO A;  4W9L A;  1BUI C;  5KHQ A;  3UIO B;  1B9R A;  3V62 A;  1C77 A;  4WJO A;  3FAH A;  2REX A;  4MJS B;  3EA6 A;  1QOG A;  1QZE A;  2HJ1 A;  3MJW A;  4RGT A;  3EEC A;  4JGH B;  1XLQ A;  1WX9 A;  5AZH A;  4ZYN A;  1QOF A;  2QSD A;  3SFE B;  2LGX A;  5E6O A;  1CJE A;  1LXD A;  1V6E A;  2ON8 A;  1YJ1 A;  2KLG A;  2KYW A;  2NVU I;  2ZW0 A;  1KOT A;  2PTL A;  3ZRC A;  1LQB A;  4NQK E;  2LGS A;  1XF5 L;  1E8Z A;  1QQR A;  2BB5 A;  2L1A A;  4DXG A;  4NAW A;  3DVG X;  1YQ3 B;  1E5W A;  5HKH A;  3DDC B;  3RNC C;  1XLO A;  1PGB A;  2M1M A;  1D5Z C;  3UGB B;  1PGX A;  3AH7 A;  1FIQ A;  1UH6 A;  2ZCB A;  3ML9 A;  2L00 B;  2QC8 A;  3DHI C;  1OFF A;  4RF1 A;  2WNM A;  1WGD A;  1WGR A;  5DPS A;  2MSE D;  2MEK A;  3QAR A;  4B9K A;  2DNF A;  2KX0 A;  2BYE A;  2KJ6 A;  3Q14 C;  2JZP A;  1OEY J;  2O6V A;  1RRB A;  4MM3 A;  2IDY A;  5FKA C;  1E7V A;  2V9H A;  3AXC A;  1L2N A;  3RI7 C;  2L83 A;  3HM3 A;  4BKS D;  3X23 A;  1G6J A;  2JWZ A;  4DWF A;  2BS4 B;  1T0Y A;  4ZRJ A;  3AE2 B;  5C3J B;  2KFK B;  2B3A A;  3ONS A;  2FAZ A;  2R2Q A;  3DQV A;  4XE0 A;  5EDS A;  4OVV A;  2KX3 A;  2PPH A;  1ZUD 2;  3ZGZ A;  2D3C A;  2H88 B;  1TZO A;  2M0X A;  3LDZ E;  4GDL A;  4GDK A;  1V1P A;  1DGJ A;  4OZB A;  1SGH A;  4TSS A;  2DZJ A;  1C4P A;  2VH2 A;  2OOB B;  1WXV A;  4ANX A;  1YN5 A;  1L0V B;  4KVG B;  1HQR D;  4L23 A;  4DHZ B;  2ZPY A;  3OWE B;  2XK5 A;  1GNU A;  3RYT A;  1XLN A;  2D5G A;  4FUL A;  1GB4 A;  2AX5 A;  2L52 A;  3JSV B;  3AE1 B;  2DBY A;  2LGD A;  4ZRQ A;  3T3N A;  2DX5 B;  2V3P A;  1WR1 A;  1KH0 A;  4DXA B;  5HG2 A;  1AAR A;  2FIF A;  2LVP A;  2J42 A;  3HRD D;  2X38 A;  1D3Z A;  1E8X A;  4C7Z A;  1UUP A;  3T8M A;  2WXJ A;  4FBJ B;  2LXA A;  2IPK D;  4IKG A;  3BIN A;  3H7P B;  4YSX B;  3QJZ A;  2O2V B;  3PS6 A;  3DBH I;  1V49 A;  2ZW1 A;  1JAL A;  4RM9 A;  5J18 A;  1RM6 C;  4YSY B;  2HTM E;  5EE9 A;  2YVC A;  3IBE A;  1TBE A;  4RF0 A;  5E6J A;  4PS3 A;  3APD A;  1L7Y A;  4P6V F;  2WXF A;  1Y56 A;  4MGZ E;  2M19 A;  2BPS A;  3QHT A;  2MW5 A;  3H6N A;  1T6B X;  4BVU C;  2BVC A;  2EMS A;  4S0R A;  1SE2 A;  3E9S A;  2ACZ B;  4RGM A;  3WCQ A;  1ISN A;  1FCC C;  1FPY A;  4YT0 B;  2LJ5 A;  4KGR A;  4JL9 A;  3W1S C;  1V97 A;  3L17 A;  4W9K A;  1I4G A;  4CQN A;  5HI1 A;  2H89 B;  4K1R B;  4LNN A;  2INC C;  3NZ3 A;  5C23 A;  4JWS C;  2K22 A;  2UYZ B;  1MHX A;  4W9D A;  2G45 B;  2IO2 B;  1WGY A;  1P7F A;  2X8X X;  1J19 A;  2LI5 A;  1YNT E;  1UF0 A;  1WZ3 A;  1V5T A;  1OQQ A;  1Q0W B;  4YTP B;  3GZN I;  1QOB A;  4WAA A;  4N59 A;  4ZRK A;  1N63 A;  3UIN B;  2INN E;  4FLH A;  4MGK E;  1BT0 A;  4IOI E;  1C1Y B;  4LCD E;  4ZRP A;  2FCN A;  3M3J A;  2CR5 A;  1OEY A;  2ONQ A;  1ZDX A;  2KC2 A;  3DVN V;  2RR9 A;  1L5P A;  2LXC A;  4KDL B;  3Q3F A;  1NEK B;  4P1B C;  4AS1 A;  3DVG Y;  4MSQ B;  3VUW A;  1EO6 A;  2KXJ A;  2LMC A;  3AE3 B;  2DWQ A;  2WDR B;  2K1F A;  2SEB D;  3H1U A;  2OJW A;  1ZGU B;  2PKO A;  3L08 A;  3WAP A;  1L4D B;  1JWB D;  3H9D A;  2JWU A;  3ZNH B;  2KFK A;  1SIJ A;  3NUH B;  2J53 A;  1WE7 A;  2RPQ A;  1Q10 A;  1FNW A;  1KLG D;  3U7D A;  1YJJ A;  4MGY E;  2J7Q B;  1I4Q A;  4EZK A;  4C56 C;  2UWQ A;  1FD6 A;  3BK2 A;  3TEY A;  1V86 A;  4ZDV A;  3MC0 B;  3AUL A;  1XLP A;  4HKQ A;  2WXL A;  4A9A A;  1L0Y B;  2NCN A;  2BS2 B;  1E7U A;  2FUG 1;  2OJR A;  3JSV A;  2MJD A;  2JVC A;  4LDT B;  2D2Q A;  3BYT B;  4HKZ E;  4M8N A;  1SIF A;  2ZNV C;  3IFW B;  1EU4 A;  1SBB B;  3AMZ A;  2QJL A;  2M56 B;  5JH5 C;  3AED B;  2KQ7 A;  4I6L B;  1GB1 A;  3GE8 C;  3H7P A;  2MBO A;  2O2V A;  1NYR A;  1WY8 A;  2K0P A;  3RNG C;  1RFA A;  4HWI B;  2KJR A;  4GGQ A;  2KTF A;  2YEP F;  1WJ4 A;  1DOI A;  4A20 A;  4HPM B;  4LTU A;  2L3Z A;  5EE0 A;  4K3B A;  2NBV B;  3AU4 A;  1NDD A;  1DOX A;  1H4R A;  3A9J B;  3J9C A;  2GB1 A;  2A5U A;  1QLB B;  2WXH A;  2LAS A;  3IT4 B;  3OG5 A;  1FCL A;  3GE3 C;  3P2B A;  1E6E B;  2XBB C;  2IJ0 A;  2FE8 A;  3RNE C;  3D32 A;  4C7Y A;  3PRZ A;  4RH6 A;  1VDV A;  3JYU A;  3RZW C;  3VFK A;  2LRU A;  4BZA A;  2MBH A;  4N9F 4;  1YJI A;  1JRU A;  4ZHO A;  2QEJ C;  5HHD G;  2HD5 B;  4FJZ A;  1I42 A;  4HPL B;  4FN2 A;  3PHX B;  4WWP A;  3DOW A;  3UIP B;  2I1J A;  3AEG B;  1QT9 A;  1FMA D;  3AE6 B;  4BKT A;  4F1S A;  1HZ5 A;  3A1Q B;  2BYF A;  1KF6 B;  1R4N B;  1E9M A;  1MFW A;  1CQV A;  3VR8 B;  2IO1 B;  3AE8 B;  2WYQ A;  3HK0 A;  3VTW A;  1L4Z B;  2V3N A;  2GBN A;  1K50 A;  3NJT A;  4XGA B;  1VR9 A;  3UQB A;  3R66 C;  4IM2 A;  2IY0 B;  1JWM D;  3U4E G;  2Y3A A;  3ZQ4 A;  4FHK A;  4M02 A;  4WJP A;  3MP9 A;  4TV3 A;  1EU3 A;  2CU3 A;  3VH4 B;  5LNK 1;  3AEE B;  2PLP A;  1WM3 A;  2OHF A;  3HUI A;  4K7S A;  3U8Z A;  4YSZ B;  1HXY D;  1V8C A;  1QOA A;  4BFR A;  2ASQ A;  4GOC A;  4MH0 E;  1V2Y A;  1V5O A;  2XN9 C;  2LD9 A;  2BKF A;  4HRO A;  1WI0 A;  1WSP A;  1MG4 A;  2A4Z A;  5GMV A;  4EEW A;  1NI2 A;  5E6N A;  4US8 A;  2D07 B;  3HVD A;  3APC A;  3M95 A;  1VRA B;  1BXT A;  3Q2A C;  4WJN A;  4E74 A;  1ZDV A;  3R8B A;  2MLB A;  1MJD A;  3GB1 A;  2XNA C;  2MWS B;  2BYV E;  4HPP A;  3V61 A;  4MDK E;  4MM3 B;  3L54 A;  1T0R C;  4URK A;  4G3X B;  5C1Z A;  4HJK A;  3PRE A;  3VXW A;  4LNO A;  2HDE A;  1TT5 B;  4HLE A;  3W5V B;  2HJ8 A;  4MGI E;  4L2Y A;  1SJE D;  3O65 B;  3RMK C;  1F0Z A;  1FXA A;  3IAS 1;  4GN1 A;  1SE9 A;  3P4P B;  1VLB A;  1WH3 A;  2C60 A;  2JYE A;  4P16 A;  1IGC A;  3PT2 B;  2KDE B;  4ACF A;  3A9J A;  4JPS A;  1YQ4 B;  1IPG A;  3Q8E A;  3I5J C;  2BS3 B;  2JYT A;  1VD2 A;  2JU6 X;  3ZW3 A;  3C8Y A;  3Q3J A;  2QDF A;  1M4V A;  3Q3O C;  3RCZ A;  4ANW A;  3VHT C;  2ZNV B;  5AUK A;  3RZF A;  3TIX A;  3KW5 B;  4J6I A;  4GU2 A;  2BB6 A;  2UU7 A;  3WIM A;  2W3R A;  2DEN B;  4EZJ A;  4ZHP A;  3ZXV A;  1N61 A;  4NAM A;  3DBL I;  3NY5 A;  1RWS A;  2WQY B;  1J7A A;  4ICU A;  2LGY A;  2GBJ A;  2AQ2 B;  3DBS A;  2W3S A;  1TTN A;  1C78 A;  3A1Q A;  1KRH A;  4P7I A;  2KTR A;  2N0S B;  4YTM B;  3TEW A;  4S17 A;  3VRB B;  2WU2 B;  2K6Q A;  3W1S A;  3BVG A;  4REZ A;  1C79 A;  1YIW A;  1PQS A;  2FUH B;  3R3M A;  1FNV A;  2VZK D;  2FID A;  1SB3 C;  1FFU A;  1CK1 A;  3SU8 X;  2J0J A;  4IM0 A;  2BKR B;  3BZD B;  2WXN A;  3HM6 X;  2VZK B;  2KK8 A;  3GP7 A;  4NJ7 A;  3VUX A;  2C7N B;  3BVZ A;  2Q5W D;  3ZLZ A;  1I4X A;  2WDV B;  1WIA A;  2KO3 A;  4X57 B;  2CS4 A;  1SEB D;  2IGG A;  2BF8 B;  3B1L X;  2KAN A;  3L16 A;  4PYZ A;  1WFY A;  1JWU D;  4ARI A;  4YL8 A;  1PFD A;  4OZC A;  3M62 B;  1TJE A;  3C19 A;  2JRI B;  3RD2 A;  3ZJU A;  2K8B A;  4A8X C;  4EUT A;  1JML A;  4HDO A;  2KT7 A;  4BAX A;  4GMV A;  1LM8 B;  1FXI A;  4D2K A;  5FR3 A;  1D5X C;  2GBR A;  4NJC A;  2MQJ A;  3IXS A;  3VR9 B;  2VH1 A;  4RFB A;  2K5P A;  1IBX B;  1XO3 A;  3DHH C;  4HRS A;  4M00 A;  1TS3 A;  2MBE A;  2Z0D B;  3OAW A;  2C7M B;  1TS4 A;  4B95 A;  3RFZ B;  5DCN A;  3NVZ A;  4ITK A;  3N9Y C;  2CU1 A;  4EE2 A;  1WF9 A;  1WRI A;  1WM2 A;  2CJO A;  3MTN B;  1A70 A;  4A3O A;  1OTR B;  3DVN U;  4KDI C;  4KSL C;  2Z8L A;  1JWA D;  5BYR A;  1R4M I;  2EMT A;  4DHZ E;  4MEM A;  4HXD A;  2MP2 B;  3JVZ X;  1ZXH A;  5L83 A;  2G1E A;  1J7B A;  3PSE B;  1XXG A;  1LFD A;  1K52 A;  2WXR A;  1VZ7 A;  3APF A;  1KM7 A;  4XWT A;  2QMT A;  2K6D B;  4HK2 A;  4RMA A;  4BBN F;  1WYW B;  1WE6 A;  2RSU A;  2JRH A; 
#chains in the Genus database with same CATH homology
 1E7U A;  3QWZ B;  2OJR A;  4GSW A;  3GOE A;  4KIK B;  3JSV A;  1P0R A;  2JVC A;  4LDT B;  2D2Q A;  4NAW B;  5E6P A;  4M8N A;  2KC1 A;  1SIF A;  3X0W A;  3QQ8 B;  2ZNV C;  3VAW A;  3IFW B;  2DAJ A;  3W1Y A;  3PGE A;  5DPT A;  1S1Q B;  2AL3 A;  1C3T A;  2L8J A;  2KJH B;  4ANU A;  2G4D B;  4IW0 A;  4DBG A;  5JH5 C;  3PHW B;  1A5R A;  3SDL C;  2Z59 B;  2IY1 B;  1YX5 B;  3CF6 E;  2KQ7 A;  3ZDM C;  2JZ3 B;  2K8H A;  4I6L B;  4WWN A;  3H7P A;  1RLF A;  2YLM A;  2C7H A;  2MBO A;  2O2V A;  1WY8 A;  4BKG A;  2WDT B;  4AP4 C;  4W9F A;  2ZZP B;  1XT9 B;  2N1V A;  4MSM B;  2NPT B;  2KQS A;  4AOF A;  2NS5 A;  5C1Z A;  3R7Q A;  1GG3 A;  3QC8 B;  1RFA A;  2AYO B;  1P9D U;  4HWI B;  2ZEQ A;  1GC7 A;  2NBW B;  2KJR A;  1WXA A;  3DCG A;  3NS8 A;  3T9L A;  2G4S A;  4GGQ A;  2KTF A;  2C5L C;  2GMI C;  2GOW A;  2JXX A;  1WJ4 A;  2O6V B;  4HPM B;  4A20 A;  3TBL D;  2PE9 A;  2N9E B;  2L3Z A;  1UD7 A;  1V80 A;  2NBV B;  3AU4 A;  3WAN A;  3PTF C;  4G50 A;  1NDD A;  2JZZ A;  1H4R A;  3EFU A;  3R7R A;  3A9J B;  4PS7 A;  3A33 B;  3PPA A;  2DYB A;  2K39 A;  1Q1O A;  5LLI A;  2AL6 A;  4KZC A;  2A5U A;  2BWE S;  4IC7 B;  2KKC A;  3EHV A;  4ANV A;  2MBQ A;  2LAS A;  1WXM A;  2N7E A;  4AJW A;  5D7G A;  4EZL A;  4W9H A;  5DPW A;  2GBM A;  3P2B A;  1P98 A;  4K7U A;  4K81 A;  4HCN B;  2XBB C;  1YX6 B;  2KD0 A;  3D32 A;  2KDB A;  3PRZ A;  4NNJ B;  3JYU A;  5CHW A;  1VCB A;  4CYE A;  2AEH A;  2NR2 A;  4GDL B;  4WQO B;  3RZW C;  3A4R A;  4GDK B;  3OLM D;  3VFK A;  2LRU A;  3TJP A;  3ZO5 B;  4CHK A;  2MBH A;  4KV2 A;  4N9F 4;  1CMX B;  4HVB A;  2NCN A;  2LVQ A;  2IO3 B;  3VUY A;  3NZS A;  3DBR I;  1JRU A;  2DZM A;  2FNJ B;  2VRR B;  3S2A A;  5J17 A;  4XX5 A;  2ZPN A;  2N9P C;  4I6N B;  3KYC D;  4BBN C;  2L7R A;  1UZX B;  2HD5 B;  3QIJ A;  4GB9 A;  5D2M B;  4FJZ A;  1I42 A;  4HPL B;  2RD0 A;  4FN2 A;  1UEL A;  2XK5 B;  3PHX B;  4WWP A;  5AZG A;  3DOW A;  3UIP B;  4NJ6 A;  2I1J A;  2KN5 A;  2N4F A;  3PLU A;  3QK0 A;  4G11 A;  3B08 A;  2MX2 A;  1MG8 A;  3V6E B;  3K9O B;  2MCN B;  3ENE A;  2N9X A;  4BKS A;  2DYO A;  2N1W A;  1J0G A;  4BKT A;  4F1S A;  2LVO A;  2LWP A;  3VH3 B;  1FXT B;  3QAQ A;  2QHO A;  4DHJ B;  4F8C B;  3A1Q B;  5CHV C;  1OGW A;  1XD3 B;  2BYF A;  2JY6 A;  3H7S A;  3M63 B;  3OJ4 B;  2KZR A;  4W9G A;  2IO1 B;  3HK0 A;  2WYQ A;  2KMC A;  3VTW A;  1Q5W B;  2KHW B;  2MRP A;  2GBN A;  3VVW B;  3NZU A;  4B6W A;  3UQB A;  3R66 C;  4IM2 A;  2IY0 B;  5CTR C;  5CHF A;  4W9L A;  5KHQ A;  3UIO B;  2DAF A;  4IUM B;  3V62 A;  2GBK A;  2L76 A;  4WJO A;  3VTU A;  2W9N A;  4FHK A;  4WJP A;  1S3S G;  3MHS D;  3RT3 B;  2REX A;  3A4S C;  4DDI D;  4TV3 A;  3CSF A;  1IP9 A;  5JHA A;  4MJS B;  1NBF C;  3QX1 A;  3VH4 B;  2Y5B B;  5J2R A;  1QZE A;  1WM3 A;  2MP2 A;  3MJW A;  3ZNG C;  4A3P A;  3EEC A;  1KJT A;  4JGH B;  1XQQ A;  4K7S A;  3RUL A;  2HE7 A;  3U8Z A;  4NPN A;  1WX9 A;  5AZH A;  4AWJ A;  4ZYN A;  4BFR A;  2ASQ A;  4GOC A;  4MH0 E;  1UBQ A;  1V2Y A;  1V5O A;  4EFO A;  1WGG A;  2LD9 A;  2BKF A;  2LGX A;  1V81 A;  2NBU A;  5E6O A;  1WI0 A;  1LXD A;  1EF1 A;  1V6E A;  1Z5S B;  1YJ1 A;  2KLG A;  2KWC A;  2A4Z A;  2NVU I;  5GMV A;  4EEW A;  1KOT A;  1NI2 A;  3KH0 A;  1LQB A;  5E6N A;  3AU5 A;  3ZRC A;  4FAD A;  2D07 B;  2WX1 A;  4NQK E;  4IM3 A;  3ZKJ C;  1WMH B;  3APC A;  1E8Z A;  3PV1 A;  3JW0 X;  4KIK A;  4MJS A;  1RAX A;  3C0R B;  5LXI B;  3M95 A;  3ZNZ B;  2M17 A;  1K8R B;  4WJN A;  4NAW A;  3ML8 A;  4EOY A;  2LZ6 A;  2IYD B;  3DVG X;  4E74 A;  3KYD D;  2MLB A;  1GC6 A;  5LXH A;  3ZDT A;  2MWS B;  1E5W A;  5HKH A;  3DDC B;  2BYV E;  4K7W A;  1EUV B;  3N30 A;  2LRW A;  3I3T B;  3V61 A;  3KVF B;  1OQY A;  2KWV B;  4MDK E;  5AEK B;  2M1M A;  2KDI A;  3L54 A;  2I1K A;  4PS8 A;  3UGB B;  2CKH B;  3K9P B;  3KUZ A;  2V3S A;  4URK A;  3A9K B;  1UH6 A;  2ZCB A;  3ALB A;  3ML9 A;  2M8S A;  2L00 B;  4G3X B;  2V4L A;  3PRE A;  4HJK A;  3VXW A;  4TQ0 A;  3WAO A;  5JHB A;  5KHO A;  2D11 A;  4FJY A;  3ZNI D;  1M94 A;  3ECI A;  1WGD A;  4HLE A;  1WGR A;  5DPS A;  2NPT A;  2MSE D;  3BY4 B;  3QAR A;  5D94 A;  3ZIM A;  4M0W B;  3QCA A;  4B9K A;  2HJ8 A;  4WWO A;  4MGI E;  1HE8 A;  2EKE C;  4II3 B;  1YD8 U;  3PRM B;  3O65 B;  2KFJ A;  3V60 A;  2KX0 A;  1SE9 A;  4GN1 A;  2BYE A;  3WAL A;  4ASW C;  4E71 A;  2KJ6 A;  5G2N A;  1OEY J;  2O6V A;  1RRB A;  4MM3 A;  1E7V A;  3PRP B;  1WH3 A;  2C60 A;  4EKU A;  1E90 A;  1GJZ A;  3AXC A;  1L2N A;  4IG7 B;  4DK5 A;  5FR6 A;  1TGZ B;  3HM3 A;  3PT2 B;  4BKS D;  2KDE B;  4BOZ B;  1EF5 A;  3A9J A;  4DDG D;  2JPH A;  4JQW C;  2JWZ A;  4PYU A;  3X23 A;  4LJP B;  1G6J A;  2ZCC A;  1IPG A;  3PLV A;  4DWF A;  3IHP C;  1T0Y A;  1Z2M A;  4ZRJ A;  1Y8R C;  1V9J A;  1VD2 A;  1WJU A;  2KFK B;  3ZW3 A;  2B3A A;  3LJ3 A;  3ONS A;  3Q3J A;  2DYM A;  2FAZ A;  2R2Q A;  2R2O A;  3DQV A;  3TMP B;  5EDS A;  5G55 A;  4M8M A;  4OVV A;  3RCZ A;  2KX3 A;  3VHT C;  4ANW A;  2ZNV B;  1WJN A;  2PPH A;  4AJY B;  4W9I A;  2J0K A;  2LUE A;  1F9J A;  3U30 A;  3RZF A;  3TIX A;  2M0X A;  3KW5 B;  3LDZ E;  4GDL A;  4J6I A;  4GU2 A;  2BWF A;  2CHZ A;  4GDK A;  2MBB B;  1SGH A;  3VDZ A;  2ZJD A;  3WIM A;  2KTR B;  3SHQ A;  2DEN B;  2DZJ A;  3N32 A;  4EZJ A;  2M4N A;  2OOB B;  1WXV A;  4TQ1 A;  4ANX A;  4KVG B;  2DZI A;  5D6J B;  4DHZ B;  2ZPY A;  2FCS A;  4TUU A;  3DBL I;  3NY5 A;  2XK5 A;  1GNU A;  4RM8 A;  3RYT A;  4FHJ A;  4FUL A;  4MEL A;  4XZ4 A;  4ICU A;  2LGY A;  2PE6 B;  3JSV B;  2GBJ A;  2LGD A;  1WGH A;  2DX5 B;  3DBS A;  1WXS A;  1WR1 A;  3NOB A;  1YQB A;  3QA8 A;  4TKN A;  2D10 A;  1TTN A;  3A1Q A;  4DXA B;  4LJO B;  4P7I A;  1AAR A;  2FIF A;  2LVP A;  3B0A A;  4NY0 A;  1D3Z A;  4GXB A;  1E8X A;  2KTR A;  3T8M A;  3ZTC A;  4FBJ B;  2G3Q B;  2KMA A;  2LXA A;  2K6Q A;  3L13 A;  3W1S A;  4LDT D;  3BIN A;  3H7P B;  3QJZ A;  2O2V B;  5IA7 A;  3PS6 A;  3DBH I;  1YIW A;  1V49 A;  1PQS A;  2FUH B;  3R3M A;  2KNB A;  4RM9 A;  4FA6 A;  3EC8 A;  5J18 A;  3N3K B;  3CMM B;  2YVC A;  3IBE A;  1TBE A;  1P1A A;  4IWP A;  4PS3 A;  2XEW A;  5L95 C;  2BGF A;  2FID A;  4JLC A;  3UF8 A;  3APD A;  1L7Y A;  5CX3 A;  3SU8 X;  2PJH A;  3AI5 A;  5AZF A;  2J0J A;  4IM0 A;  2BKR B;  4KZ0 A;  4ICV A;  4MGZ E;  1IYF A;  2BPS A;  3QHT A;  3HM6 X;  2MW5 A;  2KOX A;  3TCA A;  3H6N A;  1ZW7 A;  2V1Y A;  4BVU C;  3WA0 A;  2EMS A;  2FCQ A;  2J0M A;  4FJV B;  1X1M A;  2IBI B;  2KK8 A;  4IWQ A;  5BO4 B;  4AUQ C;  4NJ7 A;  3L10 B;  3ZVV A;  4I6P A;  3VUX A;  4E3C A;  2N7D A;  2C7N B;  1WZ0 A;  1ISN A;  1U4A A;  1TZ1 A;  4OVU A;  4CO7 A;  3ZLZ A;  2WWZ A;  2LJ5 A;  1WIA A;  2KO3 A;  3L0W B;  4JL9 A;  4X57 B;  4ZRI A;  2CS4 A;  3W1S C;  3L17 A;  2BF8 B;  2K25 A;  2IO0 B;  2KAN A;  3B1L X;  3L16 A;  1WFY A;  2JF5 A;  4PYZ A;  4W9K A;  4YL8 A;  3V6C B;  1WX8 A;  2L0F A;  4G0N B;  4K1R B;  1J8C A;  3M62 B;  2O6V D;  1WMH A;  5C23 A;  2JRI B;  2UYZ B;  3RD2 A;  1WR6 E;  4W9D A;  2G45 B;  4XC2 A;  2JUO A;  2DHZ A;  2K8B A;  2D3G A;  2IO2 B;  1UGM A;  1WGY A;  2MA9 B;  1P3Q U;  1J19 A;  2LI5 A;  3DPD A;  4EUT A;  2CHX A;  4HDO A;  1WZ3 A;  1V5T A;  3HIZ A;  1Q0W B;  3GZN I;  1KLV A;  4II2 B;  2ZVO A;  3CST A;  4W9J A;  1E8Y A;  2C9W B;  4GMV A;  4WAA A;  3A9K A;  4ZRK A;  1LM8 B;  2KVR A;  3UIN B;  3IG3 A;  4FLH A;  4F7Z A;  4MGK E;  1BT0 A;  3KUC B;  1C1Y B;  4LCD E;  2GBR A;  1WRD B;  2FCN A;  4KSK C;  2MQJ A;  5IAA C;  4HDQ A;  1H8C A;  3VQI A;  2DZK A;  3HHM A;  3M3J A;  3RUI B;  2CR5 A;  1OEY A;  1I35 A;  1WJ6 A;  2K8C A;  2KC2 A;  3DVN V;  2JT4 B;  4HCP B;  2RR9 A;  3WAM A;  2LXC A;  2MBE A;  1UBI A;  2CHW A;  2Z0D B;  4KDL B;  3ZTD A;  4W9C A;  5JZE B;  3Q3F A;  3OAW A;  2C7M B;  3ZUN A;  4B95 A;  5DPR A;  3DVG Y;  4MSQ B;  3VUW A;  2AWT A;  4GIV A;  4IWO A;  3OJ3 A;  5DCN A;  1EO6 A;  1ZKH A;  2KXJ A;  2L05 A;  2CU1 A;  2HTH A;  2K1F A;  1WF9 A;  3H1U A;  1WM2 A;  3MTN B;  2ZVN A;  3VTV A;  2KDF B;  1OTR B;  2RGF A;  3DVN U;  4KDI C;  4KSL C;  1ZGU B;  3L08 A;  3WAP A;  4DHJ D;  3IVF A;  3ZRF A;  2KWU B;  1R4M I;  3SD5 A;  3KUD B;  3PZD A;  4A3O A;  3H9D A;  3ZNH B;  2KFK A;  2EMT A;  1R4N I;  4MEM A;  4DHZ E;  2WX0 A;  4HXD A;  1WE7 A;  2PEA A;  2RPQ A;  2MP2 B;  2IZV B;  2FCM A;  3JVZ X;  5TR5 A;  3U7D A;  1GUA B;  3UQA A;  5L83 A;  4MGY E;  2J7Q B;  2Z0E B;  1E8W A;  4EZK A;  3PSE B;  2UWQ A;  3PVL A;  1WX7 A;  1LFD A;  3TL5 A;  1V86 A;  4ZDV A;  3AUL A;  2KLC A;  3APF A;  1KM7 A;  4JIO U;  3NHE B;  4W9E A;  2K6D B;  2L0T A;  4HK2 A;  4RMA A;  4WJQ A;  4NQL B;  4BBN F;  1WYW B;  1WE6 A;  2RSU A;  2JRH A;  4BOS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...