5FK9C

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
216
Chain Sequence
b'LRKKSELQGTALGNLKQIYYYNEKAKTENKESHDHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5fk9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5fk9C01
1EFID 1EU3A 1TS3A 2J4XA 1JWSD 1LTTD 1S5ED 3SEBA 1EEID 1SJED 1FNUA 1HTLD 1PRTC 1S5DD 1SXTA 1TY2A 1I4XA 1LT3D 1SEBD 4TSSA 5I4DA 2XRQD 3MFGA 1SBBB 1PZJD 2NTSA 1TS4A 2Z8LA 1LLRD 1PZID 1UUPA 1PTOB 2NTTA 5FKAC 4UDUC 3BZDB 3EFXD 2CHBD 1EWCA 2XN9C 4RGMA 2O2LD 1YN4A 1AW7A 1LTRD 3BVZA 4ZYSA 1FGBD 1HQRD 1QILA 1TS2A 5FK9C 1I4RA 1G8ZD 2QEJC 3URYA 2RDHA 1LO5D 1PYWD 1SE2A 1FNWA 1BXTA 1DYQA 1JWUD 1CHQD 1JR0D 1M4VA 1DJRD 1GOZA 3GP7A 1ET6A 3MC0B 1XTCD 3R8BA 2SEBD 2AQ1B 3DWPA 1D5XC 1PTOD 1RF2D 2AQ3B 1I4QA 1ESFA 1LTBD 2XRSD 4L63B 1BCPC 1S5BD 3BVGA 1KLUD 4RH6A 1HA5A 1PRTB 1LTAD 2WV6D 1CT1D 1I4PA 4RGOS 1T5XD 4DXGA 1EEFD 1D5ZC 4RHRA 1JQYD 1EU4A 4RGTA 1LTID 2QILA 1LTGD 1RDPD 5TSSA 1V1OA 5D3IB 1XXGA 2AQ2B 5ELCA 1PRTF 1LT4D 1PTOF 1S5CD 1V1PB 3CHBD 1YN5A 1LT5D 1V1PA 1B44D 1KLGD 1UNSA 2IPKD 4DXFA 4NZLB 1SE4A 3R2IA 3DWQA 1PRTD 2XNAC 5ELBA 4RFBA 1ET9A 1ENFA 1D6EC 2IJ0A 3R2TA 3DWAA 1SJHD 1CHPD 4BWGB 1JWMD 2RDGA 4OHJA 1SE3A 2TSSA 1RCVD 5ELDA 1BCPB 3W2DA 1S5FD 4L6TB 4Z9CB 5ELEA 4O1NA 1FD7D 3EA6A 1PTOC 5ELFA 1HXYD 3KLSX 1I4HA 1CQVA 3BYYB 3V05A 1STEA 1YN3A 1BCPF 1D5MC 2R61A 4K6LA 1LT6D 1TS5A 2ICIA 1F77A 1L0YB 4RCOA 1B1ZA 1JCKB 5D3DA 1KTKA 1LTSD 4C56C 3OWEB 3TSSA 1FNVA 1RD9D 1I4GA 1PZKD 2G9HD 1CK1A 3O13A 1TY0A 1AN8A 3BVMA 1BCPD 3BYTB 1MD2D 1PTOH 4RGNA 4RHSA 1L0XB
chains in the Genus database with same CATH superfamily
3NG0A 1NY4A 5IIFA 3I73A 3GTLB 2YTVA 1KNAA 1G6ZA 4FJYA 4M01A 5LMNQ 1V9PA 5C0XI 4DHZE 1RODA 1AFPA 1SJED 5EBDA 1HTLD 4PMWA 2JWUA 1D7QA 1RFAA 2V1YA 1MI2A 4LNNA 4ZRIA 3PIO3 4QIWB 5JVH3 4A3EB 1KC8C 3I63C 1YD8U 3UDIA 1X32A 2O2VA 1NE3A 3J7YW 1SBBB 3ULJA 4HK2A 1QUQA 5K36H 3EC8A 2RMMA 3ALBA 4JIOU 1OQRA 4HKZE 4KGTA 4FULA 3TZDA 4A3EH 3B9JA 2MP2A 1TS2A 2PQAA 4DR2Q 2K5QA 2E5LL 3A7AB 3J7AV 1HNZQ 3H3VI 1TWFB 3DVGX 2VY3A 4AQYL 2NVXH 3APCA 5KYLA 2C7MB 3OSOA 3KQ4A 2SNMA 4KMUC 2BYFA 4ANXA 4DGZA 1NEKB 3S1MH 4ABNA 4MM3B 1I50B 3DWPA 5C5MA 4F7XA 3HOXG 1JJCB 3K0YA 1NR2A 5DM73 4CGYB 2D07B 2KMMA 1X3FA 2L55A 4L63B 2EYOA 2MUYA 5IKCM 2E6XA 3PHWB 4MH0E 1T5XD 5JHAA 2EYPA 5JZEB 4RHRA 4QL5A 4IM0A 3VXWA 5E4XA 4DV6Q 3AECB 1CQFA 1IBLL 4DR3Q 3SK4A 4LFAL 1DOMA 1N60A 1CFMA 2LHDA 5E6JA 3H91A 4P74A 1KRTA 3A4SC 2ZJPA 4US8A 3T1YQ 1GUGA 3IRBA 1IBMQ 1L6VA 1PTOF 2HDEA 3IFDA 1V8CA 3EROA 1EFWA 3RR5A 1LT5D 4C1NK 4ZLTF 4GOPB 2ES2A 1UNSA 2UWQA 2RQXA 1FO4A 4IPHA 3NVZA 4JI3L 1VQCA 5DPSA 3FMCA 4JBKA 1GC7A 1IGDA 3RNUA 5JPNC 3F1ZA 3HVDA 3LJ3A 3NUCA 4ZYNA 5ELNA 5JJLA 1TZOA 1V6EA 2DZIA 1QVCA 1SR3A 1P98A 1E0ZA 1II3A 2K1BA 3D0FA 3BINA 4XWWA 1SNQA 1GHJA 4ODGA 2R7ZG 5BYQA 1L7YA 4A76A 4BXXG 2FIDA 1A62A 2KLGA 3HUIA 5L37A 3VVWB 1MG4A 1FR3A 3AE9B 2MA9B 3S2AA 2EIFA 2IO3B 1O7IA 3K59A 1HXYD 2X38A 1J0GA 4POGA 1XLQA 5D14A 4C3HB 1CSQA 2K5NA 4IM3A 3FC4A 3N9YC 1NENB 3CPFA 2HE7A 1VF5C 4ACFA 3PCOB 2H1EA 2MHVA 4JBMA 4NPSA 4TUUA 5IGBA 4ALPA 2R7ZH 3MXNA 1D4BA 3GOEA 3FPUB 4DR4Q 3RZDB 2GRIA 2L15A 1YJNA 3HOZH 4BY7B 2HTHA 4F1SA 1I4GA 3L17A 2M2LA 5M3FH 3GTOH 5LMNL 3Q3MC 4NKLA 1QZGA 5AFWA 1FIQA 2PIAA 3WCQA 5M5WH 2PI2A 1WJNA 1OXUA 2MNAA 4EZJA 1KIXA 3ML9A 4DV5L 4A3MG 3QG1A 1R9TB 1E8XA 1FM0D 4IUQA 2K1FA 4FXDA 3V60A 2M00A 3GTQH 1HQMC 3CC7A 1EWYC 3UF8A 2OF1A 5D7GA 2LKVA 2J42A 2LMCB 1BUIC 1F1HA 2N9KA 3KH0A 5DEHA 1TXYA 3P4PB 1N63A 1UUPA 4DR2L 5IP7G 3I2ZA 1QOFA 2KN4A 1K8GA 3BZKA 4KKJA 4B3SQ 2N4FA 3KLWA 1CM9A 2NVYB 2WB1E 2ZJDA 3PS6A 4PS8A 1WH3A 2EZVA 4I6PA 3KUDB 4WORA 1HZ5A 2B2WA 1E7VA 4B9XA 1HR0L 1PYWD 5E1FA 2NN6I 1SYGA 3F8TA 1R4MI 3L7ZC 5FLXL 4XDDA 1M4VA 3ULPA 2QHOA 3G7LA 1Y8OB 4KZ0A 1AE2A 4NXMQ 5IP7H 2VB3X 1EL0A 2QSDA 1IW7C 2PNRC 1B9MA 4E6IA 3ML8A 5CORA 2K5HA 3DM3A 4DV6L 3HOWB 3UQAA 3CCEA 2JQRB 4NMZA 3X3MA 1H9KA 4IO9A 5JJZA 3W9CB 1LTAD 5CHWA 2E2HB 4NNJB 1B53A 3T1YL 4AYBG 4EQ5A 2EY5A 4UP7A 4YWMA 4JI2Q 4DR5Q 3S2DB 2AUJD 1XCQL 2B3AA 2KTRB 3WA0A 4DBGA 1HZCA 1AP0A 2VZKB 2R2OA 4KX6B 3RN9C 4NAWA 4J1MA 3A5UA 1PH1A 2F0HA 1I94Q 4BBRB 3VAWA 5D6JB 2JQOA 3EVQA 2G5DA 4AOFA 2VL6A 2E2HH 3AMZA 4QF4A 3NUHB 1DXMA 3SR6A 3CIRB 4ULLA 3FAHA 3C19A 4XT1B 4C7ZA 3Q8FA 2KYWA 1C4QA 5DNFA 2CU1A 1MG8A 2JXTA 2CWAA 3NVVA 2R92G 3X23A 4R8IA 3NHEB 4LAAA 3Q0AA 1FL0A 3K8AA 1RAXA 2IO0B 1PDXA 5C4XB 3FILA 3N3KB 1E22A 2WXMA 1QOBA 3VFKA 1YITA 2MEKA 2R7FA 4GSWA 1VF7A 1Y8RC 1ILPA 2L0TA 5C23A 4JC0A 2DHZA 4J3OD 1FXAA 1VZ6A 2LHEA 3KJOA 1C4PA 1CZPA 3W2DA 3PZ8A 3T1HL 1ML0D 3RFZB 4CDEC 3P1HA 1YJWA 1E9MA 3NQTA 4WJOA 2MW5A 4LF9L 3HKSA 2RA4A 2WNMA 1TKGA 3HM6X 1K8AC 2FCQA 3BYYB 4DR4L 1BDOA 3U4VA 1AYFA 1YN3A 2Y0SB 1IPGA 3S1RH 3Q8AA 1WD1A 1SF0A 2BW2A 1EY6A 1LUZA 4XDXA 1F2LA 2YLMA 3ONAB 2Z0SA 2X69A 2BYEA 2RSOA 2LXAA 1YZ6A 2A6HD 3PVLA 2IW3A 2V4LA 4R9WA 1ZE3D 2F1MA 2B63G 4DWFA 2N9PC 4RGNA 4DV3L 4DK3C 1JWAD 4IM2A 4POFA 1X3EA 4I65A 2GBRA 3I56A 1TS3A 2CKZB 3U50C 2RDBC 4KI0A 5FO8B 3W5OA 1Q81C 1S5ED 2YVCA 2WACA 3Q23A 2F4VL 3W5UB 4G11A 4JE3B 3DBHI 2BBCA 3MP9A 1TWAB 4C3IB 3IT4B 2FMCA 4A90A 4P2CB 3A1QB 1J7AA 4FYDA 3PGEA 1G6JA 2PE6B 3I3CA 4HPPA 5LL6X 3HKZE 5C44G 5HHDG 4DR7L 1N6ZA 3RN2A 1EIHA 3CCLA 4QAYA 1ENCA 2DJFC 1L4ZB 1EWCA 1SNOA 3E56A 4YL8A 3CAMA 3S17H 4X64L 4GOPC 1NI2A 2W54A 5C0XH 4H7BA 1QILA 2O6VD 3NRZA 5EPLA 1AZPA 1XJVA 5IT9E 4HVBA 2O5IC 4X3SA 2AWNA 3U58A 4M02A 2F0EA 2KDMA 2KLCA 2CW0C 1OQQA 1W6KA 1WTRA 1UZXB 3KDFB 1X3GA 4IFDI 3RNEC 1Q8IA 4DXAB 4QCLA 2MSED 1XTCD 2DGYA 4Y7NB 3VR2A 2XK5B 2ZCCA 1PXUA 3A8KE 2VNUD 1VQMA 3DWMA 4MM3A 4NJ7A 4DQOC 2ATWA 2W3SA 3H0GG 1P9DU 1IYUA 3BVGA 1UELA 3L0WB 3VHTC 2RSNA 2WFWA 1J8IA 1WGHA 2J7QB 2A68C 5C4JH 3LXFA 3P4SB 1EU4A 1I94L 3DEOA 1EZ8A 1LTGD 2KCMA 1FJGQ 3H3VH 1C76A 4FXGC 4OONA 3HVZA 3PO0A 4CDFC 2L83A 1RTOA 3K6OA 3P1MA 3V6EB 3Q22A 5D3IB 4K6DA 2EJMA 4L5RC 3IAYA 5C0XJ 4YTNB 1VQAA 5IGDA 1S5CD 4FHJA 3SHQA 4F88A 3I90A 3S16B 1Q12A 2CU3A 1PFMA 5FLXc 1KLGD 1NYRA 2IPKD 4ID6A 2IX1A 2FINB 1G291 4GOPA 4M0WB 4XC2A 2E2JH 5HURA 1DD2A 2HCIA 2FE8A 2F0JA 2MHJA 3AE8B 4MN3A 4E3CA 1CA5A 3DHIC 3L2PA 1K8RB 4WWOA 3NENA 5D65A 1MBYA 3NQIA 3MJWA 3I70A 2MRPA 2WGSA 4I6NB 4GLAC 3S15B 3TEZA 3ZJTA 2WX1A 5J1ZA 2Q2TA 5BR8L 5COYA 2ZNVB 3VYRA 4JPBW 2KX0A 3ETRA 3H7PA 5ELEA 2F0SA 4ZRQA 2K7VA 3TUOA 1CSPA 3GQBA 3QK0A 1XPOA 4JI7L 2RSUA 3S15H 2KCNA 2L5TA 4X3UA 5CMDA 2F3VA 3IKJA 1CQVA 4QIWE 2FFKB 3F2BA 4A3LG 1TT2A 1FEHA 2CHZA 3CMAA 4IOIE 4MGIE 4EOYA 3OJ4B 1GVPA 2ZM6Q 2IX0A 3TS2A 4KVGB 4D2KA 1JT8A 1JE5A 1DOXA 3M3YB 1KRSA 1LV9A 2ALYB 2B2YC 2N49A 1SROA 1KDAA 2OTJA 2PMVA 1WI5A 1HZ9A 1X54A 3SXHA 2KFJA 3DBRI 3ZTDA 1NMFA 1PTOH 2AEHA 1EOTA 3HRDD 2WDVB 3SK6A 2MO1A 2WP8J 3SGIA 3ICEA 3ZJVA 4GLVB 1WGYA 5E3FA 4ILWA 4L1BA 1WGGA 3NTKA 1ZP0B 3MVVA 3TBLD 2HD3A 3U8ZA 3D6WA 4QB4A 5T1IA 2X8XX 4NAMA 2R93G 4AUQC 5I4DA 3MHBA 3MFGA 3FKIH 1QLBB 4UAIA 2JZ3B 3U52E 1SRUA 2EE1A 1EY7A 5IO9A 1L0VB 2CR5A 2VQEQ 3CD6A 4DV7Q 4FF1A 2NCNA 5FKAC 1KOTA 1X3QA 2CHBD 1XNQL 1V5OA 3BVZA 4N6EB 2JZZA 1DOLA 4IUVA 3M95A 3R7QA 4DAYB 4EKUA 1KD1C 4KN4C 3SD5A 5HFYA 4RCNA 3K7UC 1T0QC 2CHXA 2LGYA 3Q8BA 3RYTA 2E3TA 2R93H 1H8CA 1EYGA 3PUWA 3TP8A 1FNWA 1XLOA 3RNAC 3RNBC 4K2KA 3AB9A 2L12A 1BQQT 1STBA 2G1EA 2JXXA 3EFCA 2QA4A 1PVOA 2KMCA 4JI1L 2QW7A 1WY8A 1PMRA 1ZXHA 4KSKC 2CVRA 1EQQA 5FR3A 4AJYB 1HZBA 1MKHA 4OWWB 2CQOA 2B2UC 4FXKC 4ANWA 2FHTA 2EMTA 1I35A 4N9F4 4GLXA 1VDVA 4JG2A 4URKA 3BG3A 3ER0A 2LVQA 2UU7A 4GB9A 2HUGA 2J52A 4TKNA 3WOFA 4BOZB 4RNAA 4OVUA 4BOSC 3V2TA 2UUAL 2EXZA 1F9PA 3DBLI 2VZAA 2KQ4X 2XSCA 4QMGA 1RFKA 1WGRA 4APVA 2N3SA 1TWCH 1KXLA 1L2NA 4W9IA 1NCVA 2F0NA 1Y1WB 1L6UA 3ZUNA 3Q3JA 1PFSA 3I4MG 4GGQA 2EYLA 3WALA 1AWDA 3V62A 2KUMA 1WJ6A 1GUOA 4LNQA 2KWVB 4IPCA 4LWCA 3GE8C 1VCIA 4P72A 5KHQA 2M9VA 1M94A 2JRIB 4HXDA 2F0MA 4KDIC 3TZUA 1NSNS 3C0RB 5EE0A 1E1TA 1YNXA 4H2AA 4ASWC 2IGDA 1Q8KA 2INCC 2KHIA 4HWIB 1YQ3B 2PTLA 4II3B 4PZ6A 2BKRB 3MJ5A 4HPLB 2IL8A 3R93A 1WE6A 5EGTA 3AE4B 4JX1C 2VB2X 4HDQA 2B2UA 2K8CA 2KN5A 4AIMA 1A15A 4ZHPA 1EIYB 3NJTA 3N6RA 4MNOA 5EDSA 1I5FA 2WB1G 2XEWA 3HOUG 3I4MH 3S1NH 1I4HA 2X6LA 3K81C 1V86A 3PRPB 4K14A 2ZTDA 2OT2A 2WP9B 2EJGC 2DZMA 2NVTH 4A3FB 3T4AC 1LT6D 4IKGA 3TCAA 3HOVB 3Q8CA 4KJNA 4YSZB 1NAPA 2IWHA 3E9SA 1UAPA 1KTKA 5BN4A 4DV0Q 3HG9A 1PLFA 5GROA 5LL6S 2LRUA 3TSSA 3QOLA 1PFBA 3H6MA 5IYDG 4FF2A 1SB3C 3AM9A 2EY2A 4FP5D 4K7UA 2PZUA 1NYQA 3BVMA 2UU9Q 4FJZA 4GDLB 3TEYA 2IT1A 1WYGA 1XX8A 2I07B 1QVGA 2O6VB 3GZNI 1DCZA 3BU2A 3HOUH 1LTTD 1JOKA 1UEBA 4YCUA 5IT9L 4X57B 1EQVA 4GXBA 1HR0W 4KV6A 4DV7L 3S14B 1TY2A 2KWDA 1GC6A 1LT3D 1JALA 2GBNA 2JWZA 2QC8A 1ROEA 3A1QA 4A3BB 4A20A 4IOAA 4ZRJA 5IYDH 3BY4B 4CJ2C 4B9WA 4RGMA 2ENBA 4KY5A 2K5WA 3Q3FA 4HROA 5L95C 4F8CB 2PW5A 4EQNA 2GVAA 1WTOA 2MFIA 4EVOA 2PVGC 3UGBB 2J0KA 2CS4A 2KCTA 5C5LA 5IOCA 3A4RA 5AUIA 2E2IH 2QEJC 1CTMA 4REZA 2PJHA 2VH2A 4LNOA 2DWQA 4UP9A 3AEBB 5HGQA 3NHHA 3MXGA 2L76A 4IFDG 5IODA 3B08A 1DJRD 4RKBA 1F2MA 4JYAQ 3TS0A 5JHBA 4A3DB 4PYZA 5M5YH 4JK1C 4FO2A 4DR6Q 1C77A 3D4DA 4PZ7A 1NBFC 1ZW7A 2ZNVC 3GV6A 4C3JG 3OTOL 4Y52H 1I4PA 4RA8A 4K1RB 4HJKA 1EYDA 2KKCA 4RGTA 2KO3A 4KHVA 1RDPD 3A8IE 2IY5B 2OXPA 2NZOA 4GNXA 4YHHQ 1NI3A 2M56B 3J81E 1VQ4A 2JA8B 4NPNA 4ZDVA 2WDRB 4IFDH 3S1QH 1XXGA 1VQ6A 1GB1A 3CHBD 2PQEA 1VQ9A 3EQLC 1C4AA 3EGRA 4W9JA 2VUMH 1FCCC 2IO1B 3IVFA 4C3JH 2Q2HA 4PZ8A 1Y1VG 3MAQA 3BDOA 3CCQA 2OCEA 2OJWA 1SN8A 4NZLB 4ARCA 3M4OH 2J53A 1YNNC 1XWEA 3N52A 1MJEA 3ND8A 1MPEA 2Y0SE 1XQQA 3FP9A 4B3RL 1TWGH 1XO3A 1WTXA 3S2HB 2DZJA 1LABA 4WJWA 4LUVA 1WX7A 3CCUA 2YEPB 4DUYQ 3HKZG 3B2GA 4IG7B 2JA6H 3BIID 2TSSA 2KQ3A 5EBCA 3AEVA 2IDYA 4LCDE 1F0ZA 3RI7C 1C8CA 2QDBA 2L32A 1PDQA 5FLXE 5CBEE 1GNUA 4MJSB 1Y1VH 4A6QA 4IFDJ 2B76B 4B3ML 2K6DB 3BDCA 3T9LA 1F2RC 2Z6BA 2LD9A 1B70B 1HFGA 1KAAA 5F2DA 1STEA 4JI6Q 2N0SB 4NY0A 5AZFA 1TS5A 2UUCQ 1L0YB 4QUFA 4X65L 1DGJA 3DOWA 4YIJA 4RAUC 2UU9L 2KK8A 2DNFA 2ZEQA 4HIDA 2C60A 3A7LA 4XIGS 4S0RA 1YVCA 2L0CA 3VR5A 2PO4A 4LF6L 3KWLA 2F0PA 1U4RA 4R3DA 5C3EB 2I38A 4JWUC 3N20C 1ZUD2 3A74A 2YV5A 1YNTE 3L54A 2OJRA 4L5SA 3PO3G 4BY1H 3I4NB 2QDFA 1WZ3A 1K83B 3PTFC 5CV4A 3TBIB 5CGKA 4JQWC 1H9SB 1SYFA 4TSSA 1MJCA 1KFYB 3T51B 3GS2A 3IHPC 4J6IA 4L23A 1VQDA 4LMQD 1N61A 1H9RA 1B3AA 3MA2B 3LWEA 3H9DA 4OO1G 2XN9C 3B6YA 3MXUA 2OQKA 1T0SC 3N1YC 1WX9A 2K25A 3K80C 4WJ4A 1GJZA 1U5KA 3VRAB 1SFOH 3Q6BA 2K28A 1VQ5A 3TDQA 2Z6KA 4FLHA 3MWYW 4DAYA 1WR6E 5EKKA 4JYAL 2BWFA 4KY6A 1E8YA 3VR4A 2XBBC 4LNFA 5IT9c 1HHVA 2M17A 2FIFA 1C3TA 4HSPA 2BGFA 2ZT9C 3ERQA 4DN4M 3AFQA 2A6HC 3E9HA 5GAGC 3G48A 5IGEA 1B8AA 1D5XC 3R3OA 1QE6A 1L0WA 1RF2D 4OO1H 1DONA 2B2VC 2G4DB 1X9NA 1ZDXA 2GI9A 5E6OA 4YHHL 1DZ1A 1STYA 5IE8A 3T53B 5EKLA 1EWHA 2HT1A 4FBJB 3D8GA 2UUBL 1TJEA 1EEFD 2KOLA 2NS5A 3DHGC 1E24A 2DUDA 5C2TB 2NVXB 1QKZA 3ZXVA 4NB3A 3MTNB 1CZWA 3Q8DA 3S1MB 4IUMB 4X66Q 2KFKA 1SYCA 3FEWX 2KDIA 4CKCA 1EIFA 1N36Q 3L08A 3IAM1 1KM7A 1GUTA 3TQYA 1YN5A 2WXQA 2ID0A 2F0QA 2RHQB 1SGHA 1K0RA 2JSVX 1UGJA 1J8CA 1PH6A 1BUVT 4HEDA 4K7WA 3JAME 4JW0A 2VRRB 1WTWA 1QNKA 4A3GG 2DNCA 5IY0A 4DNIA 2B29A 3M7NA 3AEEB 2LI5A 5C4ZA 1WCMG 3I7FA 1Y69U 1DOIA 1VLBA 1F9SA 1N5WA 3AE1B 2JYTA 2BA1A 5I6WA 3RD4A 1XLNA 2KECA 3CWIA 5KIXA 3KJPA 4NW2A 4PQXA 1ASZA 2GOWA 4JGHB 4JI6L 2WHIA 5DM63 4WQMA 5IOIA 5IWAQ 1HNXQ 3HOXH 2WXJA 1DOKA 1SIFA 2BH2A 2ASBA 3EHVA 2ZXRA 1V8QA 4IPDA 1V5TA 3V05A 2JYEA 1WCMH 3ZVVA 4K6LA 5C3XA 4RCOA 5GMVA 5T8IA 3JC66 5E4WC 2SDFA 1PUTA 5BMHA 2KJXA 3HOYG 3T3NA 1BF4A 4PYUA 1L1OB 2BE5D 1N32L 2N7DA 4HMJA 4MHEA 4IDIA 4EZKA 1IBKQ 3O13A 2EKEC 3CCRA 4LUZA 2K9XA 1SNDA 2L1AA 1ESRA 1MD2D 1IYVA 3MC8A 3P4QB 4RHSA 2DN8A 2HCCA 1ZKHA 4GDLA 2BPSA 1PA6A 1K51A 1EFID 1ZEQX 1OQYA 3KUZA 4PS7A 4H02A 1JJGA 1RM6C 1EQRA 5C6AA 3A56A 1CI3M 1A3VA 4IJHA 2L3ZA 2BVCA 4A3CG 2R7ZB 2EYJA 2J0JA 4KGRA 3HZXA 3A9KA 3HOZB 2D9UA 1MVKA 4BA2I 3GZNB 2BS2B 5H1SE 1TS4A 5M3FB 3HOYH 3GTOB 2DYMA 2FMMA 5M5WB 3V3XA 3BDLA 3DHHC 4Q2JA 2I46A 2VQFQ 1UH6A 1B9NA 2A6ED 3NY5A 1Z9FA 4G4KA 4BXXH 3H1UA 5CV5A 4HDOA 2N88A 4BKSA 2SNSA 2WDTB 3GTQB 3SDZA 1I4RA 2EMSA 2F03A 2WYQA 3J81L 2Z9HA 4N59A 4UPAA 1RYJA 3MXPA 2BH8A 4YT0B 2N55A 1R7SA 4W9LA 3A9JB 4BY7G 1E3PA 1T5EA 1S3SG 1XT9B 3DLLA 4AH6A 4LK1C 3E6ZX 4BBNC 2KVZA 3DPDA 1PTOD 1GB4A 1ESFA 3WDNA 1VZ7A 1YOVB 1WF9A 4QQBX 2WV6D 3GE3C 4RGOS 4I7AA 2KX3A 3BK2A 3U7DA 5DAUA 3SK5A 2JJQA 2OWOA 5C3WA 1HNZL 2GMIC 1Q82C 5CHFA 1DOYA 4BKGA 4A3MH 4KIKA 1HEZE 4GDKA 2N9XA 4IWQA 4DNRB 2JZPA 4XZ4A 1X1MA 3M63B 5ELCA 3RLOA 2L11A 5IAAC 5TR5A 4A3KG 1STGA 3ECIA 1K28A 1YIJA 1J7BA 3U4ZA 1SIJA 1SYEA 4MT5A 4P16A 1PGAA 2KD0A 5BMIA 1OEYJ 3H15A 4RM8A 3VR6A 4DXFA 1WTHA 4C00A 3CF6E 4K7SA 3D4WA 3NZ3A 2C7HA 1GPXA 3NE5B 1GD7A 2IJ0A 2I1JA 4DK5A 4AS1A 4DR3L 2JVCA 4BWGB 2WQYB 1LACA 3S24A 2PKOA 1IBML 2J0MA 4A3KH 1YX6B 4JI4Q 2JPHA 2ZPYA 5I2YA 4OELB 1HNXL 3M4QA 1HZ6A 4CYEA 2Q8RE 2F0WA 3HOWG 2LGSA 4CQNA 4XQNA 3A33B 4O1NA 2KC1A 1S72A 4HJ7A 1Q7YC 3KWVA 4C80A 1R4NI 5E7NA 1YJ1A 2CH4A 2JRHA 5G2NA 3ITPA 2K8BA 4WH4A 2F0VA 3IT6B 1FFVA 2CFMA 4G57A 1A0IA 1JC7A 1IBKL 4LF4Q 1AH9A 1VCBA 3HGBA 2K0PA 1KH0A 1D8LA 3VYSA 2PEAA 5ELOA 2KXJA 3T3OA 1VQOA 3ZNGC 2UYZB 2RPVA 1PZKD 4P6VF 3CMMB 2B2TC 4CBVA 3KLSA 4LF5Q 5DPRA 1L0XB 5C1ZA 5C4XG 1YHQA 3NBHB 3S1RB 1WI0A 4EE2A 3W1SC 3ZQ4A 3LDZE 2R92H 1WM2A 4CO7A 4IUPA 1CKOA 2KJHB 5M5XH 4XTCS 1XMOQ 3JSVA 2NTTA 5IN7A 2KTFA 2WXGA 4R4IA 1FGUA 5EE9A 1FXIA 3RLFA 4BKTA 4ZYSA 3I4OA 3ZRFA 2WKCA 4GN5A 1IBXA 1IYFA 1I3QH 4O42A 1G8ZD 3QIAA 1EQTA 3AULA 1P1AA 1A63A 1ZXIA 4KV2A 5JH5C 2A5HA 2WAQG 4LF8Q 4X6AH 1QOAA 1BXTA 3KBGA 4CDDC 1BMLC 4TMAB 1GOZA 4RWSC 1ET6A 1JMCA 3SHLA 3QHTA 3S9WA 1QNUA 1IL8A 1VDZA 1VQHA 3AQQA 3PUVA 4OGQC 4RMFA 1V2YA 2L52A 2ZVOA 3S17B 5H8YE 1G6PA 1TKEA 1WM3A 1RTNA 3A8JE 2CCZA 4LFCQ 1T0RC 3JAML 2KACA 3DQVA 1KLUD 4B3SL 1RJTA 1ZOYB 3P42A 1C0AA 1SNPA 3MHZA 2B8GA 2WIIB 2E75C 1K3BC 1TR5A 3ZJYC 2B63H 1LM8B 4BZAA 1AE3A 1GXDC 1Q46A 1QF6A 4XT3B 1ENAA 1NDDA 4A4IA 1Q5WB 1PFNA 4FVMA 3QARA 4EUTA 4BBSG 3N30A 4L5TA 2RR9A 1D1IA 5G3LF 3J81c 2DLBA 1E90A 3QQ8B 4JI8Q 2I5MX 4NXML 2D3GA 1SE9A 3D31A 3I8ZA 1OTCA 1L1OC 5C44H 3SVMA 3UINB 5C4JB 2NZ1D 4KLKA 1W2BA 3PSEB 2H5XA 3R2IA 2JY6A 3R3MA 1FCLA 3CPWA 4TQUS 3VA7A 4DR5L 4JI2L 4JI4L 1LGRA 5C3JB 5GQOA 2NVUI 3C8YA 2BB5A 2QIEB 2LY7A 3J80E 4OX9Q 4BBSH 1LFDA 1EUVB 3J81i 4DV4Q 1U4LA 3QIJA 3ZRCA 1FRRA 4G7HC 4GLSC 2WDQB 2WU2B 2E2JB 1S5FD 4L6TB 3GTGH 1PH4A 1WYWB 2C5LC 3U4EG 2NWGA 2MLBA 4QUCA 1GAQB 2YEPF 3VDZA 2F0TA 2LXCA 2IYDB 3Q24A 1JQ4A 1PYSB 2DJGC 3H0GH 4ZUIA 3W5VB 4JBWA 1HPCA 1XPRA 3E0JA 4NXNQ 3DM1A 1STHA 2CJNA 1TIFA 3ND9A 4XXEA 5BN5A 3TJPA 1VQNA 1V1QA 2K33A 1WJ4A 5JEAG 3NVYA 4ME3A 3K5LA 1C9OA 4HEA1 4MSQB 3U9SA 4J15A 1L1OA 3RZWC 2D5DA 1N9WA 3PV1A 2RDFA 4W9KA 1W3SA 2DX5B 1GO3E 3ZNZB 3SEBA 3K9PB 2WXLA 3UDGA 3K5OA 5CTRC 2W9NA 4XGAB 3GTKH 2L0FA 4HIMA 1XMOL 1UF0A 4G3XB 2F4IA 4KKUA 4MTNA 3DHQA 3PF5A 4ZOHC 3NTHA 2KDBA 5NUCA 2JA7G 1EM7A 1K8MA 1XCTL 4K0KQ 3L13A 4G0NB 1C4CA 4W9CA 4DHJD 1HTQA 5C4HA 2LS01 1WMHB 2K50A 1PTOB 2ZTEA 4OXPA 2G3QB 3EFXD 2ZW0A 1UD7A 2O2LD 2MP1A 4ZQ3A 4M8NA 1N62A 3UIOB 1FGBD 3C3LA 1JMLA 3VYTA 1HQRD 2H88B 2YTXA 5FK9C 3VRBB 1ZPSA 4LNIA 3BK1A 3J9CA 4JOIC 2EJFC 1WJJA 2RDHA 3FKIB 2HJ8A 4WIPA 2DY8A 2PMZB 3HRZC 1HUNA 4HCPB 1I6HH 2HDLA 2KHJA 4ZKCB 2JA7H 1JR0D 4YY3Q 4A3LH 2ZVNA 1ZGUB 2HTME 2J0TD 2AQ1B 2Z59B 2HIVA 3PPAA 4RM9A 1QWYA 4ME5A 1JROA 2BS4B 2LVOA 4XYQA 2TMPA 1S5BD 5IP9G 2LMCA 4XE0A 5HI1A 4IN3A 4N58A 3ZIMA 4OO1I 3V6CB 1L5PA 5TSSA 2AUKA 2R93B 3TMPB 1C7YA 2FXQA 1PFDA 1VJKA 4M1UB 2XWBB 4DV1Q 3OAWA 2KENA 2CKHB 4XX5A 1LYLA 1QJOA 4U673 1GUWA 2LEKA 2JA9A 3ZLZA 1M90C 4K5WA 5IYCG 2JSOA 3FVQA 5KNDA 1F9RA 1K0SA 2KCCA 1ICFB 1G91A 1C1YB 5IP9H 2B2YA 4WQOB 1HCZA 4N9PA 2KA7A 5K5PA 4R8NA 2X6GA 3GV3A 1Q1EA 3HP3A 4JOIA 5FOBB 4EGVA 1FJGL 2HIXA 1R4MB 2MWSB 4AP4C 1S1QB 3JAMc 4R1JA 3A55A 1EWIA 1VQBA 2LASA 3Q6SA 4A3JG 1TKYA 1BO0A 3CU7A 3CCSA 2D11A 5A35A 2KTRA 4I7ZC 2R6GA 1WOCA 4KD3A 4DV2Q 3RD2A 1TWCB 3ZO5B 1A5RA 2ZCBA 1XNRQ 2F0GA 5JJIA 4DUZQ 3K5NA 2INDC 2ZXPA 4OW0A 3T13A 4RF0A 2Q2UA 4M8MA 4BAXA 1C9FA 1J5EQ 4MZ9A 2NPTB 1QUQB 4W9FA 2UXBQ 1RWSA 2MJ3A 3SE0A 5I6YA 3JAMi 3PO2G 1D5MC 3NK9A 2A5UA 2ICIA 5I2XA 3GTJH 2O4XA 2UXDQ 2F52A 3EIVA 3K58A 5LMUQ 3IG3A 2OTLA 1VMCA 2H4OA 2MP2B 2KWCA 3OWEB 4HJAA 3E3XA 2DENB 4PV1C 3I4MB 3S1NB 1XPUA 1SLJA 4J8QA 2LJIA 2WXKA 1U0LA 5LMNW 1WRDB 5EPJA 2F0FA 2NVTB 2J7ZA 3HK0A 2K3UA 4GIVA 4W9DA 2RPQA 3AV8A 3PO2H 4C2MH 4K0KL 2H89B 4M00A 1ZXTA 2CWPA 2AX5A 1NR4A 1PH9A 1SXTA 3F2DA 1QG7A 2ZM6L 4KDLB 2RKSA 1PH3A 2KQSA 4IUNA 3NS8A 2NVQH 3SDLC 1GUAB 1E8ZA 1E7PB 5FO7B 1EY5A 1HE8A 1TZ1A 1ZDVA 3RPFC 1HTOA 3C1FA 3GD7A 3HOUB 2QDLA 1NVID 4KZCA 5EQ0A 1G51A 1O80A 2CQAA 1TU2B 4LJPB 1YQ4B 4EFOA 3H3VC 1ILQA 5FLMG 5GAHC 3HOVG 1WRIA 1WX8A 1FFUA 4GN3B 5JAVA 3QJYA 1SE2A 2JX5A 3M62B 1JWUD 2RHSB 4IUTA 3PLVA 4XWTA 5J22A 4ZRKA 2VQEL 4S17A 3AE6B 5M3MG 3NOBA 2BE5C 1MHWC 4U68A 4GU2A 2B3GA 1X55A 3NELA 3WAPA 2UXCQ 3ZGZA 4A3IG 3R7RA 3RCZA 2V4DA 4RH6A 1YJJA 2M1MA 3DBHB 2E2IB 3NZSA 2WS3B 1UE7A 4DV1L 2MO0A 3RZOH 2M8SA 2AMCB 3QOJA 1JJ2A 4ICVA 3NVWA 1EYAA 2BDNA 4JL9A 3J80L 2GLSA 5T1GA 1HFNA 4N9TA 4G50A 5E6NA 2GA4B 2IGHA 2NBWB 4B9KA 2VW9A 1KQSA 3LGJA 3EN2A 3A0JA 5M5YB 2EYHA 5M3MH 5IA7A 4HJGE 2KOXA 4BS9A 4GKJQ 3Q69A 4O0AA 4JVZA 2EQSA 5FO9B 4A3IH 2A1AA 3KDFA 2NBVB 2A6EC 2C5CA 1J9OA 4P7IA 3L4PA 5JPMC 3MXNB 1PRTD 4LNKA 1FPYA 2G9DA 2XK5A 4A55A 1ET9A 1PQSA 1XMQQ 1SE8A 1ENFA 4V190 1P7FA 2MBEA 2LZ6A 3S1QB 5LLIA 4DV2L 2ICEC 5KGUA 3NP8A 1XNRL 4KKIA 1NUCA 1PGXA 4A3DG 2VUMB 1K3RA 3I55A 4C3JB 1TIID 4A93G 3VTUA 2DAJA 2UXBL 1RLFA 1HA6A 1JB7A 3M4OB 1H4RA 3DDCB 1PTOC 1Y14B 3QA8A 3BZCA 2B39A 3T16A 3U9OA 1TWGB 4RKLA 5LMUL 1LQBA 4WRDA 2JA8G 3ZNID 5AEKB 1T9HA 1YEZA 4M0WA 3E9IA 2JA6B 3ZNHB 4OIKA 4DHJB 1EOVA 1GG3A 5BO4B 2N7JA 5J39A 1WIAA 3OWFA 2JXMB 1RD9D 4K8IA 3B2FA 4A93H 4ANVA 1Y1VB 1CJEA 4K5VA 1CK1A 4K2LA 1LXDA 2N9LA 3TMEA 4ARIA 1BCPD 3UDXA 1IXRA 4ZKBB 4R4OA 1BR9A 1A6XA 2Z1CA 2QCPX 2RF4A 3IFTA 4OIJA 2E5LQ 1L2FA 1VRAB 3M3JA 2MJEA 3NWTA 3DCGA 3AB5A 3VR3A 4DK0A 1STAA 2C35B 3KVFB 4AQYQ 3RULA 1I4XA 2LSSA 3U30A 4HR7B 1B9RA 1C48A 4RG1A 3ULLA 3SFDB 4WFN3 1I6VC 1PZJD 1SMXA 2NTSA 3OOCA 4DV0L 3DVNV 3STBD 4K8JA 4DF7A 2AWOA 2N8NA 1V43A 4MDKE 2JN4A 1K73C 1WMHA 4F8MA 2V4IB 4RF1A 5G5HA 1IZ6A 2M0AA 4HRSA 1XTDA 4AJWA 4BY1B 4NAWB 5HG2A 3VR8B 2NBFA 1H9MA 3URYA 2LXJA 1LO5D 1IBLQ 1WE7A 4LFAQ 2DYBA 3NXWA 3G6EA 1IHZA 1VQLA 2JA5G 2IY1B 3GP7A 2V9HA 3DBRB 3MC0B 4ZAIA 4YCVA 2A4ZA 4LDTD 4C4VB 2PPBC 1S40A 4HPMB 3J7ZC 1JWBD 3WIMA 3GTMH 5C3EG 5BYSA 1SFOB 2AQ3B 1I4QA 2K14A 3KF6B 3L3OC 1UGMA 4HN7A 4KIKB 4JLCA 3FHWA 1Y56A 4JPSA 1PHJA 3EBEA 2PPHA 1TQOA 1VQFA 2IGGA 4OZBA 4A3PA 1BVSA 3PQIA 5HY6A 2L7RA 4MGKE 4E74A 3ERSX 2AL3A 1VS0A 3PO3H 2WINB 4HJ9A 3RNFC 4GKJL 2D2CC 1QZHA 1T0YA 2JA5H 2MBOA 3NS1A 3DUZA 3TP6A 2GBMA 1P7EA 4IW0A 2EVBA 5KNBA 4ZHOA 1R4QB 3CXCA 2L9HA 3GTPH 4TVAB 3K7AH 3OPOA 3CRKC 4DR6L 1XMQL 3H7SA 1XLPA 2BF8B 4UP8A 4LLGM 1EF5A 2KHWB 2A73B 3K9OB 3RUZA 4RFBA 2D3AA 1SSNA 5CYUA 2K03A 3CQZB 3TL5A 3I4LA 1O78A 3K57A 2JYOA 4JWSC 2HDMA 1JWMD 4ZRZA 3OLMD 3MEFA 5KRUA 2YTYA 2F0DA 5BN3A 4A3EG 1GM5A 1ZYRD 2A8VA 4E71A 3J80c 2KT7A 4RMAA 4N8FA 2EOTA 2W55A 3CQZH 2RCFA 1KJTA 3AI5A 1FD7D 3LB8C 1A3TA 4XYOA 2RCNA 3QC8B 4O2DA 4DV5Q 2KJ6A 2F0IA 2GBJA 5KHOA 1U9RA 5EJWA 2I2YA 2KMAA 3GTLH 3ABVB 1WYDA 2NPTA 2K4KA 2BWES 5JVG3 4B95A 1VMPA 2MX2A 2AL6A 2Z4HA 1MHHE 3DBLB 5CV7A 3IL8A 4DUYL 2MH7A 4HAEA 3G4SA 2NUCA 1JB3A 2L8JA 1B2TA 5CHVC 2RD0A 2NB0A 3J80i 1H9JA 5IYBG 2QEXA 3Q2AC 2PE9A 2GB1A 1TY0A 1CZGA 2Q5WD 4MH8A 2SAKA 3HOXB 1E2WA 1EY9A 4IJLA 4DFAA 2JT4B 4A3GB 4OVVA 1AEXA 2J4XA 2INPE 4OEMB 3I91A 1WCMB 2B2VA 1LM0A 1VQJA 4PT5A 3RNCC 1PH2A 2ZJQA 2FCMA 4J6HA 2WXNA 1BOSA 2PMZE 3I3TB 4L8JA 1S5DD 1XYIA 3KF8B 1HR0Q 2UUCL 4GKKQ 4ANUA 4A3GH 4FNFA 2I5LX 1TWFH 2XRQD 1KDCA 3M4PA 1ASYA 1GUNA 2EY6A 1NBWA 4B3TQ 3LWUA 1FRDA 1MI0A 5IYBH 1HNWQ 2KDEB 2F3WA 5IGGA 2E76C 4NP5A 2WXIA 1C78A 1LTLA 5DCNA 4P1CC 1VQPA 3ZW3A 1I50H 1LTRD 3PSIA 3HM3A 3ENEA 4G7ZC 2WKDA 4DDGD 3RLNA 2C9OA 3OMCA 3QWNA 1UBQA 2R2QA 1VQIA 2OOBB 1P0RA 3J81j 3W3AA 5KYIA 3IXSA 4CJ0B 3HOYB 2O6VA 3P4RB 2KANA 2K6QA 5IGCA 4II2B 1CHQD 3QB3A 3UDFA 2V3NA 1YQBA 1I42A 1D3ZA 2PW9A 2JP1A 3KYCD 4WJQA 4TV3A 3HHMA 3PT2B 2K5DA 3EUB2 2N7EA 1FYCA 2D3CA 3TIXA 4CHKA 3AEFB 2KWUB 4OL7A 1PRTB 4NDXA 2LGXA 5DPTA 2IO2B 4QGUA 3VUWA 3V61A 3A5ZB 2K8HA 1JQYD 3OW2A 5EE1A 3NEMA 3FDTA 2MJDA 3SU8X 1PH5A 4C3HG 3HOZG 3H7PB 4MSMB 1V1OA 5M3FG 1SNMA 4HMIA 4IZ8A 4GOCA 5IGFA 2AQ2B 1SDFA 1KF6B 2PCFB 4MEMA 1BBWA 4XQJA 4A3CH 2Z0EB 2ONQA 3OG5A 1YNJD 3CW2C 4HSVA 1B44D 3PMFA 3D3RA 1NMGA 4KN7C 3T1HQ 1P16A 1KLVA 2WLBA 4YWGG 4LF9Q 3K0XA 1IGCA 3DWGC 2B2WC 2XIWA 2M0XA 2WXPA 3RUIB 4A3MB 2K01A 2Q8IB 2PW7A 3FRPB 4DR1Q 4C3HH 3PGZA 1WTVA 5A2QL 3H6NA 2ZJRA 3LX0A 1OFFA 2ZW1A 3DEPA 2A74C 3KBXA 4X66L 1VQEA 2Q2IA 2RDGA 1HRJA 4OVZA 1O7LA 3VDYA 1N36L 1V97A 3P75A 2KZRA 5CX3A 4X3TA 3VTVA 1BCPB 1M1KC 1WXMA 3RZDH 4Z9CB 4JV5Q 4BY7H 2K6AA 2IZVB 3HEJA 3VUYA 4DV3Q 5HKHA 1VQ8A 3ONSA 4KK7A 3I57A 3B1LX 4IQZA 1F2RI 3EFUA 2FJ2A 2F4VQ 1R9TH 3QWZB 2PZTA 2JK8A 4MELA 4B08A 2PNHA 4A3KB 5AZGA 1K52A 1U4PA 3CRLC 1QOGA 4TRDA 5D3DA 4HJ8A 2CJOA 5J17A 3KLRA 4C56C 4MIUA 5GAEC 4DR7Q 1WSPA 2SOBA 4WWNA 1YNND 4M8AA 2HD5B 5EAYA 3PV0A 3F2CA 3WAMA 4DA2A 1NNXA 1TBEA 4KHZA 1EY0A 1E7UA 1A2TA 2BS3B 2LRWA 3A54A 5IWAL 4X64Q 4GKKL 1EU3A 5AJ3Q 4GZYC 1JWSD 1B50A 4PG3A 2K05A 3RT3B 2MBBB 1EEID 3C1EA 2NVYH 3M4YA 4B3TL 3CCMA 3IFWB 1TVXA 4AYBB 4MJSA 2JF5A 4W9HA 1HNWL 4R4TA 3RN5A 1HUMA 2KJRA 3J7AF 1TYGB 3PZDA 1MSHA 4LDTB 2NBUA 1YHAA 4FDBA 2Y5CA 3APFA 4FN2A 2MPMA 1SMYD 4BBRG 4CKEA 3JYUA 3ZDTA 2CH4W 4GS3A 2ON8A 3MHSD 2KVRA 4W9GA 2WU5B 4LJOB 3L9AX 4WWPA 4A75A 1JW9D 3HOWH 3WOEA 1TKWB 3KFUA 2W3RA 3TP5A 2R92B 2KAJA 3K5MA 2K39A 2JU6X 1JORA 2G4SA 2INNE 4YSXB 5CR3A 1B7YB 3S2DH 5M5XB 4FA6A 2AYOB 3W1YA 1J19A 4ICUA 3R8BA 2SEBD 2XGTA 4BBRH 4X62Q 4IALA 4JI5Q 4C4VA 4IPGA 1H9SA 2VQFL 3F2UA 5CV6A 4DU9A 1E8WA 1J7CA 1I3QB 3AXCA 3KF6A 1KHIA 1OXSC 3UQBA 4PMBA 1WVLA 4HCEA 2QILA 2EYFA 1P3QU 3LYYA 2DBYA 2PI2E 2DNEA 5C4XH 2L05A 3X3NA 1AZQA 3QAQA 3P2BA 1C79A 4BA1I 2Y0SG 4X3KA 1V49A 1Z6HA 1TT5B 2E74C 5LNK1 4A3OA 2KVMA 1V1PB 3DVGY 5BR8Q 1A2UA 2WXFA 1KL9A 4FADA 4HKQA 4OWTB 2PYKA 4K5XA 4DK6C 2A69D 1PV4A 4DR1L 1OGWA 2B63B 1SE4A 2Z0DB 2QJLA 3W1GA 3TEWA 2HQEA 2B2TA 1WD0A 4JI7Q 3Q3NC 2MQHA 2KC2A 3T8MA 2WAQB 2C9WB 3N1XC 5G5GA 4TKOB 2K32A 3DWAA 4DAMA 1YBYA 4JI0Q 3VA5A 3HS0C 4JV5L 4OHJA 3VQIA 4C3IG 1EF1A 3AN1A 1RL2A 5C44B 4NJCA 4CKBA 1WFYA 5C0XG 1BNZA 3CC4A 5JXVA 1ONLA 3C46A 3ZTCA 2N78A 4JBJA 3NPPA 1MHXA 2E8GA 1WTQA 1EZ6A 1JOOA 3QR8A 3CSTA 4DAPA 4MTKA 5L83A 3NTIA 4LTUA 1WXVA 4BBSB 1SNCA 5FR6A 4EQOA 3JW0X 5CV9A 1TWAH 4C3IH 4HCSA 3SK8A 3TN2A 1UWMA 4S3SA 1WZ0A 1FNVA 3GTGB 3VYUA 3CCJA 5AJ3L 2MBQA 1UWVA 3APDA 3AU4A 1CMXB 1YJIA 2KQ7A 3W1SA 1CUKA 4H44C 3BYTB 1VQ7A 2D5GA 2M4NA 4C7YA 1XNQQ 1T3QA 3C2PA 2JEAI 1Q0WB 3TRZA 1E0BA 2K04A 3H0GB 4DNTB 4OZAA 1N5XA 1KAWA 2HHHQ 1SYDA 1STNA 1WFQA 5KNCA 3PIPA 1FNUA 1PRTC 1CKNB 2QKIC 2I0QA 1X3PA 4FF4A 4LF4L 2BCOA 2Q8TA 2FUG1 3V96A 3OIPA 2BYTA 3AYHB 3KF8A 1KRHA 1F52A 1JE4A 4HCNB 1GKHA 4BBNF 3KK7A 1P8LA 4A9AA 2QMTA 1KDBA 4BKSD 3PUZA 3D32A 4JI1Q 4LF7Q 4Q0FA 2IHFA 3DMUA 4IUUA 5I9PA 4Y7NH 1Y8PB 4GNXB 4LF5L 1AW7A 1YN4A 2WXRA 3EECA 4V0BA 3PHXB 1RIPA 2A19A 1DM0B 1FMAD 2HQLA 1CA6A 4ITKA 4EZLA 1MIUA 2Y3AA 1JRUA 2C7NB 2FUHB 2G45B 3X0WA 3GTKB 2RGFA 4DHZB 3QX1A 3OW7A 3ZYYX 2EELA 1SSOA 2KEDA 3G6JB 4X62L 4JI5L 1MGSA 4YCWA 3UI3A 1DYQA 3E0EA 2K5VA 3I72A 3BJUA 2N9EB 2UUAQ 1V80A 1AARA 4R4QA 4L2YA 3E5SA 5G3LD 3W1BA 2XVSA 5JEAH 3M85A 1IUEA 3Q3OC 4P1BC 2F3IA 1FVIA 3TEHB 3S16H 1K50A 1BCPC 1S4ZA 2V1CC 3M9BA 4DXGA 1HA5A 1YJ9A 1CT1D 1E7ZA 3AE2B 1NTGA 1OEYA 4WAAA 4DK1A 2O5JC 4C1NI 1I6HB 2JA7B 4ZUJA 4LF8L 1JOQA 3ZKJC 3MTSA 3N1ZC 1TWHB 2MBHA 1U4MA 4YSYB 4EEWA 2BYVE 1N34Q 3CF5A 3STBC 2I1KA 5J18A 2VS1A 1OO9B 3TEXA 4EQPA 3CP0A 1VQGA 1XEEA 3HIZA 4W9EA 3QCAA 1K53A 4LFCL 4YXDB 3A9JA 1TWHH 4IC7B 3RMKC 2F0KA 2EXDA 2V3PA 1PYBA 4JI0L 3DWQA 1ACCA 2WX0A 2I5HA 5ELBA 2REXA 1RHPA 1G2SA 3FKIG 3CKIB 5J2RA 1E2VA 2QGQA 5JEAJ 2ASQA 4PK1A 5MPOA 2KDFB 3AE5B 3I9V1 1OTRB 5LXIB 5DLQE 1KNEA 3VTWA 4PS3A 3UIPB 5JJKA 1EUJA 3KOJA 4JI8L 1Z7TA 3M3YH 4F7ZA 1BBUA 2M19A 2F0UA 1V9JA 1UE5A 1A70A 3CCVA 1W6JA 1V81A 3WANA 1Z47A 2BTEA 1D1KA 1E6EB 1HH2P 1QOHA 3KLSX 4HIKA 1VR9A 1B3QA 2QCZA 5CV8A 3KYDD 2R61A 4KTAA 1VQKA 2PZWA 1M8AA 4OX9L 5BMGA 1QCBD 1UBIA 1JCKB 2IX3A 1FXTB 4FXCA 2RBMA 4DV4L 5DPWA 1TTNA 1H95A 4H13C 2R7DA 3N32A 2D2QA 1IW7D 2Z4IA 1ZKOA 1T6BX 2BT6A 4USAA 2HHHL 4JCVE 4NJ6A 5EE3A 4BVUC 2F0LA 3OYYA 5JOBA 1WGKA 5IYCH 3ZDMC 3DVNU 3D4RA 3WWVA 2LFNA 1QZEA 5AUKA 2D10A 1G2TA 2NN6G 4XQQA 3H94A 4IOCA 4YTMB 2LXKA 3GTJB 4A3JB 1N33Q 4NXNL 1BBXC 2BB6A 2O2VB 4IWOA 1GUSA 1WJUA 4MGZE 4LF7L 2YYZA 5D2MB 4KJOA 2B8FA 1F9QA 4KKTA 3PIP3 1WXQA 3JVZX 4EX5A 2D62A 3NSWA 3P7JA 1R4PB 3CC2A 5GADC 2HJ1A 3IAS1 1F2YA 3PLUA 5H92C 1LLRD 1PZID 1ZYRC 1XD3B 4A3JH 1R4NB 1K8OA 1WWTA 2EKIA 3NZUA 2AHOB 2PQAB 5M9OA 3OTOQ 3G71A 1EY4A 3OJ3A 5G55A 2NN6H 2KFKB 3PO2B 4C2MB 3L0OA 1QVFA 3MZ5A 1BKBA 4KHPQ 2BA0A 4WWMA 4KGSA 1Y1WG 3QO2A 2W82A 2NVQB 3MFYA 2OQ0A 4GN4B 1B4OA 5D94A 3Q14C 3NBHA 1RRBA 4DPGA 4HIOA 1S3OA 4LJZC 2K52A 2F0OA 2XRSD 3RMHA 1D2BA 3ZJUA 1DGSA 2ZPNA 2GBKA 4WJPA 4L5QA 2K5PA 2V3SA 5CC4A 2GVBA 1D5ZC 2V0GA 1X6OA 2WB1B 1LTID 5EKIA 3L10B 2WWZA 3L16A 4PMCA 1IKMA 1OXXK 1Y1WH 4B3RQ 3H09A 1IYJB 1SYBA 4ZK9B 1N34L 1IL2A 1Z5SB 1HZAA 2D3BA 1ISNA 1MFWA 5CBAE 2NYZD 2MJ8A 1QQRA 4YY3L 4A3FG 1PRTF 4HJ5A 1I7HA 3FPPA 4PNYA 2BOSA 2ZZPB 2OEDA 3AE3B 4H0LC 5LXHA 3GB1A 1V1PA 2EPBA 1YHBA 2FCSA 3VR9B 1O7ZA 2P5ZX 1Q1BA 1O7YA 2JE6I 2EDGA 4LW1A 3RZOB 1Q10A 1YX5B 4MACA 4AWJA 4ZCKA 2LVPA 4B3MQ 3R66C 1QT9A 2XNAC 3H8HA 1QB5D 4KKSA 2PVOD 3ZXRA 4CDCC 1GHKA 3R2TA 1L4DB 1J6QA 3AMUA 4X65Q 1RKNA 5M3MB 3FKYA 4A3FH 5FLMH 3HOVH 2ZTCA 3M7GA 1NJIC 3KUCB 5J3BA 4A3IB 3Q8EA 2K22A 4FJVB 3SFEB 4A3BG 3RZFA 2Y5BB 1YMHE 1N8RC 4LF6Q 2IBIB 5GXGB 1Q3LA 2VXWA 4LFBQ 4B0EA 4WJ3M 1E2ZA 3DBSA 3A9KB 4K81A 1GJXA 4GNXC 1E5WA 4I6LB 3VUXA 3P20A 2ZXOA 4HTHA 3GDEA 4XYCA 4CHTB 1FD6A 3AU7A 3PUYA 4AYBE 1VD2A 4US9A 1JRPA 3NWSA 2CW0D 1BCPF 3UE1A 4ZRPA 1EY8A 2KEEA 4B6WA 1F77A 4MGYE 1ICWA 2DZKA 4P73A 4YWLA 2Y5PA 3S14H 3AH7A 2K75A 1YIWA 1YI2A 4DDID 1IP9A 4IURA 3TP7A 4TQ1A 4A3BH 5BYRA 2LGDA 2WXOA 1MJDA 1YNJC 4DUZL 4DAVA 1XF5L 2AKWB 4K3CA 1N33L 4OZCA 2XWJB 2A68D 3PIOA 5E6PA 1J5EL 3HFZB 2JUOA 4A8XC 1IKLA 1X65A 4WJNA 2D0PA 3QJZA 3PRZA 1CKNA 1SEBD 1UEAB 3WAOA 2UXDL 3MC9A 4P75A 2IHEA 2VUMG 2Z8LA 4A93B 2KHSA 2DY7A 1WGDA 5HGTA 1TGZB 1SAPA 3U2SC 2FBWB 2L00B 5A2QE 3J7A5 4Q5VA 3AEDB 4UDUC 3BZDB 3PUXA 1UE6A 3UI2A 4KHPL 1F2ZA 1E10A 4OWXB 4A3DH 2BDOA 2MCNB 4N8X1 4GDKB 4F87A 2BQQA 4UHVA 2UUBQ 1PGBA 4WAFA 3GO5A 2PLPA 1EIGA 1UE1A 3EJIA 2JA6G 2N1WA 1E1OA 1WXAA 1KABA 2FNJB 4TQ0A 2JA8H 4XDCA 3HKZB 3MEHA 4KSLC 2LUEA 4LUOA 2LGIA 2OEOA 2VH1A 4IWPA 1LTBD 5IP4D 5ISRA 2N1VA 2WAQE 3CMEA 2KNBA 3NBIA 4KD4A 1HJPA 2DAFA 1MSGA 2L4NA 5I9OA 1HTPA 1WXSA 4WURA 1EO6A 1VZ8A 3PREA 2RVLA 3VH3B 2XTIA 1Q86C 1JICA 5EPKA 1WR1A 3AEGB 3I5JC 1OXTA 4LK0M 1Q90A 3AU5A 3S2HH 2L1BA 3KYHC 4GN1A 4AQ7A 2EYMA 1LT4D 3GTMB 2LJ5A 2LUMA 3DXJC 3AEAB 1Q1OA 4G7OC 3KUPA 3PF4A 4HLEA 4FF3A 3BS1A 1SMYC 2UXCL 3O65B 4BY1G 3PRMB 2Z6KC 4UY8C 1A3UA 4YWKA 2BKFA 3AE7B 4B0MA 3B0AA 2D0OA 1BT0A 3FILB 3CSFA 5KEEA 3U7ZA 1WTPA 3VH4B 2EY1A 3PO3B 2WXHA 1CKMA 1D6EC 4GMVA 4JI3Q 2JA5B 1SJHD 3TREA 1CHPD 3I4NG 2NZHA 2QF7A 1F9JA 1A8VA 1PH7A 2VZKD 2CHWA 2AWTA 3P63A 4LFBL 1SE3A 3GTPB 2E2DC 1RCVD 5ELDA 4CJ1B 3K7AB 1N32Q 3PZ7A 3AFPA 5LHY1 2IY0B 3BWUD 1EYCA 3LNNA 2GN5A 3UE0A 2FAZA 3OHXC 5FJ8G 1PH8A 3EA6A 2FCNA 3T56B 2LFIA 3IBEA 4YTPB 1OXVA 2JEBI 5ELFA 2MGSA 4QY7A 4QJFA 4NQLB 5AZHA 5C3EH 4K3BA 3JSVB 2YU9B 3OMGA 3I4NH 1UWXA 2KBNA 3D6CA 2LWPA 4NQKE 1K83H 1B1ZA 2DYOA 1Z2MA 2ACZB 1LTSD 4FHKA 3KW5B 1K9MC 2NR2A 1Y8NB 3SR1A 4DKAC 5K36G 2MQJA 2OHFA 1IBXB 1U4AA 2G9HD 2YU9H 2NMQA 1AN8A 4P71A 5FJ8H 4KY7A 1X56A 2R3ZA 3RNGC 3OIQA 4BFRA 2A69C 4R4CA
chains in the Genus database with same CATH topology
5IIFA 3GTLB 3I73A 1G6ZA 4A8XC 1KNAA 5C0XI 1RODA 1AFPA 1SJED 5EBDA 1HTLD 4PMWA 2JWUA 1MI2A 3PIO3 4QIWB 5JVH3 4A3EB 1X32A 3J7YW 1SBBB 5K36H 2RMMA 1OQRA 4HKZE 4KGTA 3TZDA 3B9JA 1TS2A 2K5QA 3A7AB 3J7AV 1TWFB 5KYLA 3OSOA 3KQ4A 2SNMA 4KMUC 4DGZA 1NEKB 4ABNA 4MM3B 1I50B 3DWPA 5C5MA 4F7XA 3K0YA 1NR2A 5DM73 4CGYB 2KMMA 2L55A 4L63B 2EYOA 2MUYA 2E6XA 1T5XD 2EYPA 4RHRA 5E4XA 3AECB 1CQFA 3SK4A 1DOMA 1N60A 1CFMA 2LHDA 5E6JA 3H91A 4US8A 1GUGA 1L6VA 1PTOF 2HDEA 3IFDA 1V8CA 3EROA 1LT5D 4C1NK 4ZLTF 1UNSA 2RQXA 1FO4A 3NVZA 3FMCA 1IGDA 5JPNC 3HVDA 3NUCA 1TZOA 1E0ZA 1II3A 2K1BA 4XWWA 1SNQA 1GHJA 4ODGA 5BYQA 3HUIA 1FR3A 3AE9B 3K59A 1HXYD 2X38A 1XLQA 5D14A 4C3HB 3FC4A 3N9YC 1NENB 1VF5C 2H1EA 2MHVA 5IGBA 1D4BA 3MXNA 3FPUB 3RZDB 2GRIA 4BY7B 1I4GA 2M2LA 4NKLA 1FIQA 5AFWA 2PIAA 3WCQA 1OXUA 3QG1A 1R9TB 1FM0D 4IUQA 4FXDA 2M00A 1HQMC 1EWYC 2OF1A 5D7GA 2LKVA 2J42A 2LMCB 1BUIC 2N9KA 5DEHA 3P4PB 1N63A 1UUPA 1QOFA 2KN4A 4KKJA 1CM9A 2NVYB 2EZVA 4WORA 1HZ5A 2B2WA 4B9XA 1PYWD 5E1FA 2NN6I 1SYGA 3L7ZC 5FLXL 4XDDA 1M4VA 3G7LA 1Y8OB 1EL0A 2VB3X 2QSDA 1IW7C 2PNRC 1B9MA 4E6IA 5CORA 3HOWB 2JQRB 4NMZA 3X3MA 1H9KA 3W9CB 5JJZA 1LTAD 2E2HB 1B53A 2EY5A 1XCQL 3S2DB 2AUJD 1AP0A 2VZKB 4KX6B 4J1MA 2F0HA 4BBRB 3EVQA 3AMZA 4QF4A 3NUHB 1DXMA 3SR6A 3CIRB 4ULLA 3FAHA 4XT1B 4C7ZA 3Q8FA 1C4QA 5DNFA 2JXTA 3NVVA 4R8IA 4LAAA 3Q0AA 1PDXA 5C4XB 3FILA 2WXMA 1QOBA 2MEKA 1VF7A 1ILPA 4J3OD 1FXAA 1VZ6A 2LHEA 1C4PA 1CZPA 3W2DA 3PZ8A 1ML0D 3RFZB 3P1HA 1E9MA 3NQTA 2RA4A 2WNMA 1TKGA 3BYYB 1BDOA 1YN3A 1AYFA 2Y0SB 3Q8AA 1WD1A 1SF0A 2BW2A 1EY6A 4XDXA 1F2LA 3ONAB 2X69A 2RSOA 2A6HD 2IW3A 4R9WA 1ZE3D 2F1MA 4RGNA 1JWAD 4I65A 1TS3A 5FO8B 4KI0A 1S5ED 2WACA 3Q23A 3W5UB 4JE3B 2BBCA 3MP9A 1TWAB 4C3IB 3IT4B 2FMCA 4A90A 4P2CB 1J7AA 4FYDA 3I3CA 5LL6X 5HHDG 1EIHA 1ENCA 1L4ZB 3E56A 1EWCA 1SNOA 2W54A 5C0XH 4H7BA 1QILA 3NRZA 5EPLA 1AZPA 5IT9E 2O5IC 4X3SA 2AWNA 2F0EA 2KDMA 2CW0C 1OQQA 1W6KA 1WTRA 4IFDI 1Q8IA 4QCLA 1XTCD 4Y7NB 3VR2A 1PXUA 3A8KE 2VNUD 3DWMA 4DQOC 2W3SA 1IYUA 3BVGA 2RSNA 1J8IA 2A68C 3LXFA 3P4SB 1EU4A 3DEOA 1EZ8A 1LTGD 1C76A 4FXGC 3HVZA 3PO0A 2L83A 1RTOA 3K6OA 3P1MA 3Q22A 5D3IB 4K6DA 2EJMA 3IAYA 5C0XJ 4YTNB 5IGDA 1S5CD 4F88A 3I90A 3S16B 1Q12A 2CU3A 1PFMA 1KLGD 1NYRA 2IPKD 4ID6A 2IX1A 2FINB 1G291 5HURA 1DD2A 2HCIA 2FE8A 2F0JA 3AE8B 4MN3A 1CA5A 5D65A 1MBYA 3NQIA 3I70A 3S15B 3ZJTA 3TEZA 5J1ZA 5COYA 3VYRA 3ETRA 5ELEA 2F0SA 4ZRQA 2K7VA 3TUOA 3GQBA 2KCNA 2L5TA 4X3UA 5CMDA 2F3VA 3IKJA 1CQVA 2FFKB 1TT2A 1FEHA 4IOIE 2IX0A 4D2KA 1DOXA 3M3YB 1LV9A 2B2YC 2PMVA 3U4EG 1KDAA 3SXHA 1PTOH 1EOTA 3HRDD 2WDVB 3SK6A 2WP8J 3ZJVA 5E3FA 4ILWA 4L1BA 3NTKA 1ZP0B 3MVVA 3D6WA 4QB4A 5T1IA 4NAMA 5I4DA 3MHBA 3MFGA 1QLBB 3U52E 4UAIA 2EE1A 1EY7A 1L0VB 4FF1A 5FKAC 1X3QA 2CHBD 4N6EB 3BVZA 1DOLA 4IUVA 4KN4C 5HFYA 4RCNA 3Q8BA 2E3TA 3PUWA 3TP8A 1FNWA 1XLOA 4K2KA 3AB9A 2L12A 1BQQT 1STBA 2G1EA 1PMRA 1ZXHA 2CVRA 2B2UC 4FXKC 2FHTA 1VDVA 3BG3A 2HUGA 2J52A 3WOFA 4RNAA 3V2TA 2EXZA 1F9PA 2KQ4X 2XSCA 4QMGA 1RFKA 1NCVA 2F0NA 1Y1WB 1L6UA 2EYLA 1AWDA 2KUMA 1GUOA 1VCIA 2M9VA 2F0MA 5EE0A 3TZUA 1NSNS 4H2AA 2IGDA 1YQ3B 2PTLA 3MJ5A 2IL8A 3R93A 5EGTA 3AE4B 4JX1C 2VB2X 2B2UA 4ZHPA 1A15A 3N6RA 1I4HA 2X6LA 4K14A 2OT2A 2WP9B 2EJGC 4A3FB 3T4AC 1LT6D 4IKGA 3HOVB 3Q8CA 4KJNA 4YSZB 1NAPA 2IWHA 3E9SA 1UAPA 1KTKA 5BN4A 3HG9A 1PLFA 5LL6S 3TSSA 3QOLA 1PFBA 3H6MA 4FF2A 1SB3C 3AM9A 2EY2A 4FP5D 2PZUA 1NYQA 3BVMA 3TEYA 4GDLB 2IT1A 1WYGA 1XX8A 2I07B 1DCZA 1LTTD 1JOKA 5IT9L 1EQVA 4KV6A 3S14B 2KWDA 1TY2A 3W1SA 1LT3D 1JALA 1ROEA 4A3BB 4CJ2C 4B9WA 4RGMA 2ENBA 4KY5A 2K5WA 4HROA 2PW5A 4EQNA 1WTOA 4EVOA 2PVGC 5C5LA 5IOCA 5AUIA 2QEJC 1CTMA 4REZA 2DWQA 3AEBB 3NHHA 3MXGA 4IFDG 5IODA 1DJRD 4RKBA 1F2MA 4A3DB 4JK1C 4FO2A 1C77A 3D4DA 3GV6A 4C3JG 1I4PA 4RA8A 1EYDA 4RGTA 4KHVA 1RDPD 3A8IE 1NI3A 2OXPA 2M56B 3J81E 2JA8B 2WDRB 4IFDH 1XXGA 1GB1A 3CHBD 2PQEA 3EQLC 1C4AA 3EGRA 1FCCC 3MAQA 4NZLB 3BDOA 4ARCA 2J53A 1YNNC 1XWEA 3N52A 3ND8A 1MPEA 1XO3A 1WTXA 3S2HB 1LABA 4WJWA 2YEPB 3B2GA 3BIID 2TSSA 2KQ3A 5EBCA 1F0ZA 2IDYA 1C8CA 2QDBA 2L32A 1PDQA 5FLXE 5CBEE 4A6QA 4IFDJ 2B76B 3BDCA 1F2RC 5FR3A 1HFGA 1KAAA 5F2DA 2N0SB 1STEA 1TS5A 1L0YB 4QUFA 1DGJA 4YIJA 4RAUC 3A7LA 4XIGS 2L0CA 3KWLA 3VR5A 2PO4A 2F0PA 1U4RA 4R3DA 5C3EB 2I38A 4JWUC 1ZUD2 1YNTE 3I4NB 1K83B 5CV4A 3TBIB 5CGKA 1H9SB 1SYFA 4TSSA 1KFYB 3T51B 3GS2A 4L23A 4LMQD 1N61A 1H9RA 1B3AA 3MA2B 3LWEA 4OO1G 2XN9C 3MXUA 3VRAB 2K28A 3TDQA 3MWYW 4DAYA 5EKKA 4KY6A 3VR4A 1HHVA 4HSPA 2ZT9C 3ERQA 4DN4M 2A6HC 5IGEA 1DONA 1D5XC 3R3OA 4OO1H 1QE6A 2GI9A 1RF2D 2B2VC 1ZDXA 1DZ1A 1STYA 3T53B 5EKLA 1EWHA 3D8GA 5C2TB 1TJEA 1EEFD 2KOLA 2NVXB 1QKZA 1CZWA 3S1MB 1SYCA 3FEWX 4CKCA 3IAM1 1GUTA 1YN5A 2WXQA 2ID0A 2F0QA 2JSVX 1UGJA 1BUVT 4HEDA 3JAME 1WTWA 1QNKA 2DNCA 3M7NA 3AEEB 5C4ZA 1Y69U 1DOIA 1VLBA 1F9SA 1N5WA 3AE1B 2JYTA 2BA1A 5I6WA 3RD4A 1XLNA 2KECA 3CWIA 5KIXA 4NW2A 4PQXA 5DM63 4WQMA 2WXJA 1DOKA 2ZXRA 1V8QA 3V05A 2JYEA 4K6LA 5C3XA 4RCOA 5T8IA 5E4WC 2SDFA 1PUTA 5BMHA 2KJXA 3T3NA 1BF4A 2BE5D 4HMJA 4MHEA 4IDIA 3O13A 2K9XA 2L1AA 1SNDA 3P4QB 1ESRA 1MD2D 1IYVA 4RHSA 2DN8A 2HCCA 1K51A 1EFID 1ZEQX 1RM6C 5C6AA 3A56A 1CI3M 1A3VA 2R7ZB 2EYJA 4KGRA 3HZXA 3HOZB 2D9UA 1MVKA 4BA2I 2BS2B 1TS4A 5M3FB 3GTOB 2DYMA 2FMMA 5M5WB 3V3XA 3BDLA 4Q2JA 2I46A 1B9NA 2A6ED 4G4KA 5CV5A 2N88A 2SNSA 3GTQB 3SDZA 1I4RA 2F03A 3J81L 4N59A 1RYJA 3MXPA 4YT0B 2N55A 1R7SA 1T5EA 4LK1C 3E6ZX 1PTOD 1GB4A 1ESFA 3WDNA 1VZ7A 2WV6D 4RGOS 3BK2A 5DAUA 3SK5A 5C3WA 1DOYA 1HEZE 4DNRB 2JZPA 5ELCA 2L11A 1STGA 4MT5A 1SIJA 1J7BA 1SYEA 4P16A 1PGAA 5BMIA 3VR6A 4DXFA 3D4WA 3NZ3A 1GPXA 3NE5B 2IJ0A 4AS1A 4BWGB 2WQYB 1LACA 2PKOA 5I2YA 1HZ6A 2Q8RE 2F0WA 4CQNA 4XQNA 4O1NA 4C80A 3KWVA 3ITPA 4WH4A 2F0VA 3IT6B 1FFVA 4G57A 1JC7A 2K0PA 3HGBA 1KH0A 3VYSA 3T3OA 2RPVA 1PZKD 4P6VF 2B2TC 4CBVA 3KLSA 1L0XB 3S1RB 4EE2A 3ZQ4A 4IUPA 4XTCS 2NTTA 2WXGA 5EE9A 1FXIA 3RLFA 4ZYSA 2WKCA 1IBXA 4O42A 1G8ZD 3QIAA 1EQTA 1ZXIA 2A5HA 1QOAA 1BXTA 3KBGA 1BMLC 4TMAB 1GOZA 4RWSC 1ET6A 3SHLA 3S9WA 1QNUA 1IL8A 1VDZA 3PUVA 4OGQC 2L52A 3S17B 5H8YE 1TKEA 1RTNA 3A8JE 2KACA 3JAML 1KLUD 1RJTA 1ZOYB 3P42A 1SNPA 3MHZA 2B8GA 2E75C 2WIIB 1TR5A 1GXDC 1QF6A 4XT3B 1ENAA 1PFNA 4FVMA 1D1IA 5G3LF 2DLBA 3D31A 3I8ZA 3SVMA 5C4JB 2NZ1D 3R2IA 1FCLA 4TQUS 3VA7A 5C3JB 3C8YA 2BB5A 2QIEB 2LY7A 3J80E 1U4LA 1FRRA 4G7HC 4GLSC 2WDQB 2WU2B 2E2JB 1S5FD 4L6TB 2NWGA 4QUCA 1GAQB 2YEPF 2F0TA 3Q24A 1JQ4A 4ZUIA 3W5VB 4JBWA 1HPCA 3E0JA 3DM1A 1STHA 2CJNA 3ND9A 4XXEA 5BN5A 2K33A 5JEAG 3NVYA 3K5LA 4HEA1 3U9SA 2D5DA 2RDFA 3SEBA 2WXLA 3K5OA 2F4IA 4KKUA 3DHQA 4ZOHC 3NTHA 5NUCA 1EM7A 1K8MA 1XCTL 1C4CA 5C4HA 2LS01 1PTOB 3EFXD 2ZW0A 2O2LD 2MP1A 4ZQ3A 1N62A 1FGBD 3C3LA 1JMLA 3VYTA 1HQRD 2H88B 5FK9C 3VRBB 1ZPSA 3BK1A 3J9CA 2EJFC 2RDHA 3FKIB 4WIPA 2DY8A 2PMZB 3HRZC 1HUNA 2HDLA 4ZKCB 1JR0D 2HTME 2J0TD 2AQ1B 1QWYA 4ME5A 1JROA 2BS4B 4XYQA 2TMPA 1S5BD 2LMCA 4XE0A 5HI1A 4IN3A 4OO1I 1L5PA 5TSSA 2AUKA 2R93B 1PFDA 1VJKA 4M1UB 2XWBB 1QJOA 2LEKA 4U673 1GUWA 4K5WA 2JSOA 3FVQA 5KNDA 1F9RA 2KCCA 1G91A 2B2YA 1HCZA 4N9PA 2KA7A 5K5PA 4R8NA 2X6GA 3GV3A 1Q1EA 3HP3A 5FOBB 4EGVA 3A55A 3Q6SA 1TKYA 1BO0A 3CU7A 5A35A 4I7ZC 2R6GA 4KD3A 1TWCB 2F0GA 3K5NA 4RF0A 2ZXPA 4OW0A 3T13A 1C9FA 1RWSA 2MJ3A 3SE0A 5I6YA 1D5MC 3NK9A 2ICIA 5I2XA 2O4XA 3K58A 1VMCA 2H4OA 3OWEB 4PV1C 3I4MB 3S1NB 4J8QA 2LJIA 2WXKA 5EPJA 2F0FA 2NVTB 2J7ZA 2K3UA 3AV8A 2H89B 1ZXTA 2AX5A 1NR4A 1SXTA 1QG7A 2RKSA 4IUNA 1E7PB 5FO7B 1EY5A 1ZDVA 3RPFC 3C1FA 3GD7A 3HOUB 1NVID 5EQ0A 1O80A 2CQAA 1TU2B 1YQ4B 3H3VC 1ILQA 1WRIA 1FFUA 5JAVA 3QJYA 1SE2A 2JX5A 4XWTA 1JWUD 4IUTA 5J22A 3AE6B 2BE5C 4U68A 3ZGZA 2V4DA 4RH6A 1YJJA 2E2IB 2WS3B 3QOJA 3NVWA 1EYAA 2BDNA 3J80L 5T1GA 1HFNA 4N9TA 2GA4B 2IGHA 5M5YB 2EYHA 4HJGE 4BS9A 3Q69A 5FO9B 2A6EC 2C5CA 1J9OA 3L4PA 5JPMC 4A55A 1PRTD 2G9DA 1ET9A 1ENFA 4V190 1P7FA 3S1QB 2ICEC 5KGUA 3NP8A 4KKIA 1NUCA 1PGXA 2VUMB 4C3JB 1TIID 1HA6A 3M4OB 1PTOC 3U9OA 2B39A 3T16A 1TWGB 4RKLA 4WRDA 4M0WA 2JA6B 4OIKA 2N7JA 5J39A 3OWFA 2JXMB 1RD9D 4K8IA 3B2FA 1Y1VB 1CJEA 4K5VA 1CK1A 4K2LA 2N9LA 3TMEA 4ARIA 1BCPD 4ZKBB 1BR9A 1A6XA 2Z1CA 2QCPX 4OIJA 3IFTA 1VRAB 4N58A 2MJEA 3NWTA 3AB5A 3VR3A 4DK0A 1STAA 1B9RA 1I4XA 4HR7B 1C48A 3SFDB 4WFN3 1I6VC 1PZJD 2NTSA 3OOCA 4K8JA 4DF7A 2AWOA 1V43A 4F8MA 2V4IB 4RF1A 5G5HA 2M0AA 4HRSA 4BY1B 4NAWB 5HG2A 3VR8B 2NBFA 1H9MA 3URYA 1LO5D 3NXWA 1IHZA 3GP7A 3MC0B 4ZAIA 2PPBC 1JWBD 5BYSA 1SFOB 2AQ3B 1I4QA 3L3OC 4HN7A 1Y56A 4JPSA 1TQOA 2IGGA 4OZBA 2WINB 2D2CC 3NS1A 3DUZA 3TP6A 1P7EA 2EVBA 5KNBA 4ZHOA 1R4QB 2L9HA 3OPOA 3CRKC 1XLPA 4LLGM 2A73B 3RUZA 4RFBA 1SSNA 5CYUA 2K03A 3CQZB 3I4LA 1O78A 3K57A 2JYOA 4JWSC 2HDMA 1JWMD 4ZRZA 5KRUA 5BN3A 2F0DA 1ZYRD 2EOTA 2W55A 1FD7D 3LB8C 1A3TA 4XYOA 2F0IA 1U9RA 5EJWA 2I2YA 3ABVB 5JVG3 1VMPA 2Z4HA 1MHHE 5CV7A 3IL8A 2MH7A 4HAEA 2NUCA 1JB3A 1B2TA 2NB0A 1H9JA 2GB1A 1TY0A 1CZGA 2Q5WD 4MH8A 2SAKA 3HOXB 1E2WA 1EY9A 4DFAA 4A3GB 1AEXA 2J4XA 2INPE 3I91A 1WCMB 2B2VA 4PT5A 4J6HA 2WXNA 1BOSA 4L8JA 1S5DD 1XYIA 4FNFA 2XRQD 1KDCA 1GUNA 2EY6A 3LWUA 1FRDA 1MI0A 2F3WA 5IGGA 2E76C 4NP5A 2WXIA 1C78A 1LTRD 4G7ZC 2WKDA 2C9OA 3OMCA 3QWNA 3W3AA 5KYIA 3IXSA 4CJ0B 3HOYB 3P4RB 5IGCA 1CHQD 3QB3A 2V3NA 2PW9A 2JP1A 2K5DA 3EUB2 1FYCA 3AEFB 4OL7A 1PRTB 4NDXA 5EE1A 1JQYD 3FDTA 2MJDA 4C3HG 1V1OA 1SNMA 4HMIA 4IZ8A 5IGFA 2AQ2B 1SDFA 1KF6B 2PCFB 4XQJA 2ONQA 1YNJD 4HSVA 1B44D 3PMFA 3D3RA 4KN7C 2WLBA 4YWGG 1IGCA 3DWGC 2B2WC 2XIWA 2WXPA 4A3MB 2K01A 2Q8IB 2PW7A 3FRPB 1WTVA 5A2QL 3LX0A 1OFFA 2ZW1A 3DEPA 2A74C 3KBXA 2RDGA 1HRJA 4OVZA 1O7LA 1V97A 3P75A 4X3TA 1BCPB 4Z9CB 2K6AA 3HEJA 4KK7A 3I57A 4IQZA 1F2RI 2FJ2A 2PZTA 4B08A 4A3KB 1K52A 1U4PA 3CRLC 1QOGA 4TRDA 5D3DA 2CJOA 4C56C 3KLRA 4MIUA 1WSPA 2SOBA 1YNND 4M8AA 3PV0A 4DA2A 2BS3B 4KHZA 1EY0A 1A2TA 3A54A 1EU3A 4GZYC 1JWSD 1B50A 2K05A 1EEID 3C1EA 3M4YA 1TVXA 4AYBB 1HUMA 3J7AF 1TYGB 1MSHA 2Y5CA 2MPMA 1SMYD 4CKEA 2ON8A 2WU5B 3L9AX 1JW9D 3WOEA 1TKWB 2W3RA 3TP5A 2R92B 2KAJA 3K5MA 2JU6X 1JORA 2INNE 4YSXB 5CR3A 5M5XB 3R8BA 2SEBD 4IALA 1H9SA 3F2UA 5CV6A 4DU9A 1J7CA 1I3QB 1OXSC 4PMBA 1WVLA 4HCEA 2QILA 2EYFA 3LYYA 2DBYA 2DNEA 3X3NA 1AZQA 1C79A 4BA1I 4X3KA 1Z6HA 5LNK1 2E74C 2KVMA 1V1PB 1A2UA 2WXFA 4HKQA 2PYKA 4K5XA 2A69D 2B63B 1SE4A 2QJLA 3TEWA 2HQEA 2B2TA 1WD0A 2WAQB 5G5GA 4TKOB 2K32A 3DWAA 3VA5A 3HS0C 4OHJA 3VQIA 4C3IG 3AN1A 4NJCA 5C44B 4CKBA 5C0XG 1BNZA 5JXVA 1ONLA 3C46A 1MHXA 3NPPA 1WTQA 1EZ6A 1JOOA 4DAPA 3NTIA 4LTUA 4BBSB 1SNCA 4EQOA 5CV9A 4HCSA 3SK8A 3TN2A 1UWMA 4S3SA 1FNVA 3GTGB 3VYUA 1YJIA 4H44C 3BYTB 2D5GA 4C7YA 1T3QA 3C2PA 2JEAI 1E0BA 2K04A 3H0GB 4DNTB 4OZAA 1N5XA 1SYDA 1STNA 5KNCA 1FNUA 1PRTC 2QKIC 1X3PA 4FF4A 2FUG1 2BCOA 2Q8TA 3V96A 3OIPA 2BYTA 1KRHA 3KF8A 1JE4A 3KK7A 4A9AA 2QMTA 1KDBA 3PUZA 4Q0FA 3DMUA 5I9PA 4IUUA 1YN4A 1Y8PB 2WXRA 1AW7A 4V0BA 1DM0B 1FMAD 1CA6A 4ITKA 2Y3AA 3GTKB 3OW7A 3ZYYX 2EELA 1SSOA 2KEDA 3G6JB 1MGSA 3UI3A 1DYQA 3I72A 4L2YA 3E5SA 5G3LD 1IUEA 2XVSA 5JEAH 3M85A 1K50A 1BCPC 1S4ZA 4DXGA 1HA5A 1CT1D 3AE2B 4DK1A 2O5JC 4C1NI 1I6HB 2JA7B 4ZUJA 1JOQA 3MTSA 1TWHB 1U4MA 4YSYB 1OO9B 3TEXA 4EQPA 1XEEA 1K53A 4YXDB 2F0KA 2V3PA 1ACCA 3DWQA 5ELBA 1RHPA 1G2SA 3CKIB 1E2VA 5MPOA 5JEAJ 3AE5B 3I9V1 1KNEA 1Z7TA 2M19A 2F0UA 1A70A 1W6JA 1Z47A 2BTEA 1D1KA 1E6EB 1QOHA 3KLSX 1VR9A 5CV8A 2R61A 4KTAA 2PZWA 1M8AA 5BMGA 1QCBD 1JCKB 2IX3A 4FXCA 2RBMA 4H13C 1IW7D 2Z4IA 1ZKOA 1T6BX 2BT6A 4USAA 5EE3A 2F0LA 5JOBA 1WGKA 3D4RA 2LFNA 5AUKA 1G2TA 2NN6G 4XQQA 3H94A 4YTMB 3GTJB 4A3JB 1BBXC 2BB6A 1GUSA 2YYZA 4KJOA 2B8FA 1F9QA 4KKTA 3PIP3 1WXQA 2D62A 3NSWA 3P7JA 1R4PB 3IAS1 5H92C 1F2YA 1LLRD 1PZID 1ZYRC 1K8OA 1WWTA 2EKIA 5M9OA 1EY4A 2NN6H 3PO2B 4C2MB 3MZ5A 2BA0A 4WWMA 4KGSA 3QO2A 2W82A 2NVQB 3MFYA 1B4OA 3NBHA 4LJZC 2F0OA 2XRSD 3RMHA 1D2BA 3ZJUA 2K5PA 5CC4A 1D5ZC 2V0GA 2WB1B 1LTID 5EKIA 4PMCA 1IKMA 1OXXK 3H09A 1SYBA 4ZK9B 5CBAE 2NYZD 2MJ8A 1QQRA 1PRTF 1I7HA 3FPPA 4PNYA 2BOSA 2OEDA 3AE3B 4H0LC 3GB1A 1V1PA 2EPBA 3VR9B 1O7ZA 1Q1BA 1O7YA 2JE6I 2EDGA 3RZOB 1Q10A 4MACA 1QT9A 2XNAC 3H8HA 1QB5D 4KKSA 2PVOD 1GHKA 3R2TA 1L4DB 3AMUA 1RKNA 5M3MB 3M7GA 4A3IB 3Q8EA 2K22A 3SFEB 1YMHE 5GXGB 1Q3LA 2VXWA 4B0EA 1E2ZA 1GJXA 3P20A 2ZXOA 4HTHA 1FD6A 4CHTB 3AU7A 3PUYA 4US9A 1JRPA 3NWSA 2CW0D 1BCPF 4ZRPA 1EY8A 2KEEA 1F77A 1ICWA 2Y5PA 3AH7A 4IURA 3TP7A 4TQ1A 5BYRA 2WXOA 1YNJC 4DAVA 1XF5L 4OZCA 2XWJB 2A68D 1IKLA 1SEBD 1UEAB 2Z8LA 4A93B 2KHSA 2DY7A 5HGTA 1SAPA 3U2SC 2FBWB 5A2QE 4Q5VA 3AEDB 4UDUC 3BZDB 3PUXA 3UI2A 1F2ZA 1E10A 2BDOA 4GDKB 4F87A 4WAFA 1PGBA 3GO5A 2PLPA 1EIGA 3EJIA 1KABA 4TQ0A 4XDCA 3HKZB 3MEHA 2LGIA 2OEOA 1LTBD 5ISRA 3NBIA 4KD4A 1MSGA 2L4NA 5I9OA 1HTPA 4WURA 1VZ8A 2RVLA 1JICA 5EPKA 3AEGB 4LK0M 1OXTA 1Q90A 2L1BA 4AQ7A 2EYMA