5FK9C

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
216
Chain Sequence
LRKKSELQGTALGNLKQIYYYNEKAKTENKESHDHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN
total genus 35
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5fk9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5fk9C01
1EEFD 2Z8LA 1ESFA 1D5MC 1ENFA 4RH6A 1HXYD 2J4XA 3DWPA 5FKAC 1XXGA 1BCPC 1KLUD 1EWCA 1SXTA 2XRSD 5ELDA 4RCOA 1T5XD 1S5BD 1XTCD 3BZDB 1FNUA 1HA5A 1SJHD 1AN8A 5ELBA 1QILA 3BVZA 1MD2D 1B44D 1PRTD 1PRTB 1CHQD 3BVMA 2CHBD 4DXGA 1I4QA 1FD7D 5ELEA 1D5XC 1PZID 1CT1D 1FNVA 1DJRD 3O13A 2O2LD 1RCVD 4RGTA 1TS3A 4UDUC 1LTAD 1STEA 1CHPD 1TS5A 1PYWD 1S5FD 1EFID 1JQYD 1PZJD 3DWAA 5I4DA 1S5ED 1D5ZC 3EFXD 1LTGD 3R2TA 1SEBD 2SEBD 2WV6D 1DYQA 4L6TB 4K6LA 1V1PA 1FGBD 1PTOD 1ET9A 1CQVA 1KLGD 1PTOB 1YN4A 4RGNA 1TS4A 2G9HD 4DXFA 1I4RA 5ELCA 3TSSA 1HQRD 2RDHA 1SBBB 1JR0D 2AQ3B 2ICIA 1JWUD 2NTSA 4L63B 4RHRA 4BWGB 4C56C 5D3DA 1L0YB 3R2IA 1TY2A 1LT4D 1LTRD 5D3IB 1JCKB 1LTBD 3CHBD 1BCPF 2XRQD 1JWMD 1PZKD 1UNSA 1PTOF 2QILA 1TS2A 2XN9C 1BXTA 1EEID 4RGMA 1CK1A 1YN3A 1D6EC 1B1ZA 1ET6A 1SE3A 1I4GA 1RF2D 1M4VA 1S5DD 1I4PA 3BYYB 4O1NA 4OHJA 3EA6A 4TSSA 1LTSD 2QEJC 3BVGA 1SJED 1I4XA 1RDPD 1FNWA 1L0XB 2AQ1B 1EU3A 1TY0A 1LO5D 3R8BA 2AQ2B 1BCPD 1BCPB 1LLRD 1LT6D 1PTOH 1LTID 4ZYSA 3W2DA 1V1PB 5ELFA 5FK9C 1AW7A 1SE2A 1HTLD 1PRTF 1LT3D 3OWEB 1PTOC 1I4HA 1PRTC 4RGOS 3DWQA 5TSSA 2R61A 3BYTB 1V1OA 1SE4A 1F77A 4Z9CB 2IJ0A 2XNAC 3SEBA 4NZLB 4RHSA 2TSSA 1S5CD 1LTTD 3MFGA 3URYA 1YN5A 3KLSX 1GOZA 1KTKA 2RDGA 1JWSD 2NTTA 1EU4A 3MC0B 4RFBA 1G8ZD 3V05A 1LT5D 3GP7A 1UUPA 1RD9D 2IPKD
chains in the Genus database with same CATH superfamily
2OJWA 4KN4C 2WB1B 2JWZA 2K6QA 5C4HA 3CCLA 1HRJA 3D8GA 3KJOA 2XRSD 1IBMQ 3X0WA 3GTMB 4K7UA 3R7QA 4GMVA 2ZNVC 2G4DB 4I65A 3TBIB 2MLBA 4BKGA 3EROA 1G6ZA 3HVDA 2LMCA 4A76A 2HCCA 1R4NI 3HOWG 4A3DB 4QF4A 1LACA 4RF1A 2KJHB 1E2VA 1LV9A 1Q86C 5IYCG 3S16H 4A3LG 2I2YA 1STGA 4IUNA 1XTDA 1I94L 1YQ4B 4LNNA 1G291 4ZCKA 2RA4A 3QIJA 4RGTA 5G3LD 4X64L 1T9HA 4KIKB 5CHVC 1HFGA 1UBQA 3OJ3A 1S5ED 1QOAA 4Q5VA 4YT0B 1GUSA 1PH3A 2MJEA 1RLFA 2N9KA 2O2VB 1PFSA 1V1PA 1MG4A 4LJPB 3WCQA 2DY8A 4IOCA 4GNXB 1ZP0B 2XGTA 1YN4A 4ZRQA 1A2UA 4LFAQ 5JJKA 5ELCA 1DOYA 4IFDI 1L2FA 3VYTA 1YNJD 4LJZC 4WWPA 3T3NA 3DM3A 3PGZA 1OTRB 1F9QA 4PMWA 4NQKE 3BDCA 2NPTA 2MH7A 3P75A 1HFNA 5DAUA 1U4PA 1AE3A 4GLXA 3M4OH 2MJ3A 2VUMH 4RNAA 1YJ1A 1IBXA 2EPBA 4DF7A 3KW5B 1LTRD 3L13A 4B95A 3VUXA 5E1FA 1KRSA 1EYCA 3CQZH 3F2DA 2K3UA 5C0XH 3PLUA 4E3CA 4WQOB 1RHPA 1VMCA 1QOBA 4QL5A 1N32Q 1IUEA 1SROA 3STBC 4PS8A 3CW2C 1B1ZA 4YWKA 3DBRB 3SXHA 4R4TA 1IPGA 2EY2A 2KCCA 1E8XA 1FO4A 3RMHA 3KDFA 2RGFA 1WZ0A 2D5DA 3K5MA 4R9WA 2GBRA 5DM73 4BBNC 1LM8B 2KWVB 2KECA 4A3BG 3TDQA 1QWYA 2DNFA 2EELA 1FNWA 4KD4A 1MI0A 3T53B 4HWIB 1TY0A 4A3KH 3HKZE 1EYDA 5D7GA 1GB4A 4EZKA 1NBFC 3FVQA 1RFKA 2K1FA 3PHWB 1J5EL 5FK9C 2QSDA 3N52A 1EY7A 1TWFH 4NXNL 4Y7NH 1SR3A 5EQ0A 4CJ1B 2XK5B 1L4DB 4HJAA 3B2FA 4US9A 4RGOS 2B39A 5K36G 1YMHE 3P4SB 1V1OA 2GBMA 1C4CA 3KBGA 2D10A 3S1NH 2J0MA 2LHEA 3X23A 3H7PA 1NAPA 4K3CA 3K7AB 1XQQA 3ULLA 4B0MA 1CKNB 2UUBL 3JAML 1E5WA 2Q2TA 3CIRB 1L0VB 1X3QA 2LSSA 2GN5A 4A3FG 5G55A 3MC0B 1I5FA 4KY7A 1C76A 4C00A 1G8ZD 4G7OC 4FF1A 4GN3B 2DZMA 4I6NB 3SD5A 4P1CC 4A3JH 2OQKA 1ENFA 1L6VA 3RN5A 5L37A 2JF5A 2GB1A 2PZTA 4F8MA 4IKGA 1C4QA 2NN6H 2K39A 4UP8A 4UPAA 3X3MA 1UBIA 1FIQA 4DR5Q 1K83B 2LGSA 4KTAA 1CA5A 2L1AA 3S15H 3IXSA 3H94A 1CHQD 4U68A 2CHBD 3AEAB 4CJ0B 4XGAB 1DCZA 2I38A 5IGDA 1YIJA 2KDFB 3JAMc 2KWUB 1RFAA 2KWDA 4NXML 1CSQA 4BXXG 1QQRA 1BR9A 1CFMA 1VQFA 5IGEA 3HOUH 3O13A 2ZCCA 1QNUA 2JY6A 5IT9c 1GB1A 4W9LA 1TZOA 2AX5A 3CMMB 1L4ZB 2LVQA 3I72A 4LW1A 5IKCM 1QF6A 3PRPB 3S1NB 4A3CG 1CHPD 2NVUI 4LLGM 2KENA 2WB1G 1V81A 1PYWD 1RJTA 4GDKB 2XSCA 4XX5A 2CH4A 3EFUA 4OVZA 2VQEQ 1UH6A 3DEOA 3B6YA 3HKSA 3H1UA 4NQLB 3H7PB 2GBJA 2WIIB 3RI7C 1KLGD 3UIPB 2BDNA 4C3JH 2G9HD 4DXFA 1I6HB 2N3SA 2B2VC 3I63C 3MTNB 2WAQE 2YV5A 4C80A 2RKSA 1WTQA 5LNK1 2F0IA 2B63B 3L54A 1VQPA 1N34Q 2KQ7A 3HIZA 2QKIC 5IGFA 2E3TA 3TN2A 1LFDA 1X3GA 3N30A 1D7QA 1QZGA 1WGYA 3NE5B 4CYEA 4HN7A 2KHIA 5CYUA 4AQ7A 3QA8A 2MHVA 1X1MA 2CW0C 4KKIA 1JT8A 1V49A 3AE9B 4LAAA 2L05A 5M3FH 3D6CA 2Z59B 4QCLA 1FPYA 1GO3E 1S4ZA 2R3ZA 1NYRA 4L23A 4AS1A 4P73A 3GO5A 1HPCA 2O4XA 1S72A 1HNWQ 4XYCA 2K28A 3ULPA 1BXTA 1D6EC 3T4AC 3NSWA 3EGRA 2N9PC 4DV4L 4K3BA 2BF8B 4FA6A 4HVBA 3CPWA 4OHJA 3KOJA 2KAJA 2I5LX 3OAWA 4YTPB 2NN6G 1KJTA 2QEJC 5J39A 4LFBL 1K8OA 3DVNU 5IYDH 2V4DA 4ZHPA 1JMLA 1L1OA 2MO1A 2NVQH 2REXA 3WAMA 2BOSA 2I5MX 4A3PA 5AZGA 2EY6A 4YCWA 1R7SA 3R8BA 3AMZA 4X3UA 3S1RH 4M8AA 4C2MH 2JP1A 2ZW1A 2CVRA 2CHZA 3AEDB 2ZW0A 2K6DB 4HPLB 4PG3A 3TL5A 3ALBA 2DYOA 1TWCB 3UDFA 1DONA 4DNTB 1SE9A 1YIWA 2WU2B 3N1ZC 1HZ5A 3ML8A 2R61A 3I4LA 4A3KB 5C3EG 3HGBA 4N8X1 4HJGE 1YHAA 4PK1A 4B3SL 3U7DA 1EY5A 3W1BA 1EIGA 4GKKQ 2GMIC 2EVBA 4ZRKA 1WZ3A 3A74A 1V43A 5CV4A 3M7GA 2VZKB 3GTQH 4DU9A 2PMVA 2KVZA 2F0WA 5IA7A 1PV4A 2L55A 4IN3A 2LFNA 2J7QB 2DAFA 4KX6B 1DGJA 2BCOA 4RFBA 3UIOB 1HA6A 2BWES 4ILWA 1F1HA 3NBIA 3M3YH 1KRHA 3AQQA 2DLBA 5DPSA 4ANVA 1QB5D 1EQVA 3BZCA 1HXYD 4X57B 1E10A 5FKAC 3CCSA 1ZDVA 1H9MA 3QQ8B 4AOFA 5AUKA 3JSVB 1AN8A 1WVLA 3DXJC 2AKWB 5CORA 5IYBH 1G2TA 4IOIE 4KY5A 3R7RA 3B2GA 2CJNA 2VUMB 1DXMA 2UUAL 2ZZPB 1B44D 1E3PA 4ICUA 1PH4A 2LD9A 4C4VB 1V5OA 3RLOA 1PFMA 4LUZA 3BWUD 2X6LA 3G7LA 2NZ1D 1AYFA 3I56A 3C0RB 1FRDA 1CKNA 4USAA 5C1ZA 4FXCA 3Q23A 1U4LA 2NVXB 1G6PA 2V3SA 4IWQA 4YSZB 2LEKA 2I0QA 1STEA 1YNND 4KJNA 3MP9A 2ZTCA 2LZ6A 4E74A 1P3QU 4EE2A 4C3IH 1WE7A 2LWPA 4JV5L 2JK8A 1Y8OB 1GC7A 2XK5A 1N36L 1OO9B 3FPUB 3FEWX 2YTVA 3G48A 5EE0A 2CR5A 3X3NA 1TWGH 2N9EB 3Q8DA 5FJ8H 5AJ3L 3OIPA 1HTQA 1AP0A 2N8NA 5CV6A 1SIFA 2F0EA 3U4VA 5BMHA 1U9RA 2QW7A 1EUJA 3A55A 1PFNA 1HNZL 5BR8Q 1T0RC 3A8IE 2SNSA 5G5GA 2BBCA 1XWEA 1UGJA 1PXUA 4JYAL 3LYYA 1K52A 1EIHA 2KMMA 4HKQA 4HCNB 3Q0AA 3HZXA 4MZ9A 4Y52H 3KDFB 4CKEA 1IXRA 4KDLB 4JWSC 5J1ZA 1KIXA 1KD1C 3I73A 1TY2A 4HTHA 5C4ZA 5FLXc 1E8WA 2BB6A 3ZDTA 2F4IA 3D32A 5JZEB 2MJ8A 4KZ0A 2WFWA 4IFDG 3V3XA 1NR4A 5KRUA 5A35A 1UNSA 3HM3A 2ZTEA 4NB3A 2Q2UA 3JC66 3G6JB 3IVFA 1NVID 2PKOA 3N1XC 4A93H 3AEGB 2OWOA 4DFAA 4DR2L 1K0SA 1I7HA 1M4VA 1VLBA 4KHPL 2WWZA 3EA6A 3NUCA 1XNQQ 1HZ6A 3TEXA 4X65L 2F0FA 4GNXC 4GU2A 2EYHA 4WJ4A 3V61A 2B29A 3HOXH 3MHBA 2KDMA 5I6YA 1SNPA 3MXGA 2JA7G 3H7SA 4NAMA 3VFKA 5BYQA 2KCTA 1V1PB 4L5RC 1FJGQ 3RZDH 4IUPA 1QVFA 4HIOA 3OW7A 1QOFA 2FMMA 3CU7A 1IW7D 4OX9L 3JYUA 1GUGA 2JXTA 5DPRA 3EQLC 4O42A 4ZRIA 5BMIA 3VR8B 2CW0D 3K9OB 1SE4A 3TMEA 1E24A 4YY3Q 2KJ6A 1TYGB 1X55A 2I1KA 2BTEA 3D4DA 1LTTD 2VH1A 4LF4L 4JOIA 1H95A 4OVVA 3KF8B 1SN8A 3L9AX 3RFZB 3NBHA 5FLXE 2ASBA 2NZHA 3S1MB 3PZ7A 2E5LQ 1B70B 2J0JA 4X62Q 1WTVA 2KC1A 3VA5A 2ZJQA 4O0AA 3EVQA 2BQQA 1UUPA 3D4RA 3KVFB 1STNA 4YY3L 4DGZA 2E2IB 5BMGA 2B76B 4BBSB 2J4XA 1YJ9A 4WORA 2R7FA 2CH4W 1KLUD 4A3IG 2K8HA 3BIID 4KZCA 1S5BD 1RTNA 2HUGA 4HJ8A 1U4RA 2LXJA 3PF4A 3MEFA 1OXVA 3A5UA 2YVCA 4GGQA 1WRIA 4DHZE 4GS3A 3N9YC 4CHTB 4KHVA 1ACCA 3MC8A 4JK1C 4R4IA 4W9CA 1VQAA 1HHVA 5LL6X 3AFQA 3J9CA 2E2DC 4A3JB 1B8AA 1FFVA 5E6OA 3ZNZB 1K9MC 3PVLA 1TS3A 3O65B 2VL6A 5AZHA 2JSVX 5IYDG 4YSYB 1SMYC 4IPCA 4OEMB 4JYAQ 2QCPX 2D3BA 3FDTA 3IAYA 2ZT9C 4YWLA 4II2B 4IG7B 4OXPA 2B2TC 3JVZX 1EWHA 3NS8A 1G2SA 1OXSC 2JXXA 4JC0A 1LTGD 1F2RC 3VH4B 3U9SA 1DYQA 2AL6A 2CJOA 4K6LA 1N33L 1SNQA 1V86A 2IZVB 3JW0X 3Q14C 3RUIB 3SR6A 2NUCA 1CQVA 3IAS1 3VUYA 1AZQA 2Y5PA 3ZXRA 5EBDA 2H88B 4EOYA 5C3EB 5I2XA 2NBVB 1ASZA 1UE7A 1S1QB 4DA2A 1EF1A 4ZKCB 1N60A 2N9XA 2B2UC 5JH5C 1ZOYB 1F52A 1EOVA 3CRKC 3WOFA 2ZTDA 4X6AH 5LL6S 5HY6A 1EZ8A 3DWMA 2D3GA 5FO7B 2A68D 2KHWB 2EYMA 2UXBQ 1U4MA 4DV3L 3HM6X 2MBOA 3VVWB 2JPHA 1VZ6A 4M8MA 1BCPF 2FIDA 4BBRG 4IDIA 2XRQD 2KK8A 1B7YB 1Q7YC 3GOEA 2UU7A 1VQLA 3IFWB 3BDLA 2JYTA 1OXTA 4RGMA 1CK1A 2JA8H 2VH2A 3AXCA 1C4AA 3WA0A 3K57A 5IOIA 1WXVA 2PW9A 4AYBG 1XT9B 3ML9A 1TZ1A 1EYGA 1HUMA 1V1QA 4JOIC 4GN5A 3L16A 1J6QA 4EQPA 5LMUQ 4TV3A 4DR5L 3SVMA 1PFBA 4ZKBB 3AU7A 3CCMA 4II3B 2F52A 1L0WA 1Q46A 1TWHB 4KLKA 1YZ6A 1IYJB 4LNOA 1D4BA 3NK9A 5EE1A 1YNXA 3TCAA 3BK2A 5KIXA 4ZQ3A 3S2HH 5LMNQ 3BU2A 2WXMA 4DHJD 4KKTA 2ZCBA 4ANUA 1KNEA 1B2TA 1I4HA 3BJUA 4DUZL 4JI4L 4R4CA 1XX8A 2SNMA 3R93A 3RR5A 4B08A 1XPOA 4ZYNA 2F0GA 2JA7H 2B2UA 2ZPNA 3A1QA 2GOWA 2LGIA 2LI5A 2L83A 4IUMB 2GVAA 2JE6I 3H9DA 4A3JG 2RDGA 3K6OA 3LGJA 3T1HL 4C1NI 4OO1I 1HCZA 2V4IB 2WXGA 1OEYA 2K04A 4GOCA 4P1BC 2R93H 1DOLA 4DV7L 3KWLA 4TKOB 4PZ6A 1YN3A 2IPKD 1RWSA 4YSXB 2E2JH 1VDZA 3D0FA 3UQAA 1ICWA 2MHJA 1BCPC 1CI3M 2EYJA 4JPSA 3SK8A 1VQ4A 1QZEA 2AMCB 1TWAB 3AB5A 3HVZA 4GXBA 4K1RB 1X3PA 3H6MA 4PS7A 2K01A 4JI7L 5M3MG 3KQ4A 1HNWL 1RM6C 4H13C 3AFPA 2J0KA 4MGYE 3VDYA 5HURA 2J53A 1D5XC 2UUCL 3GTMH 1VD2A 3A56A 3UDGA 3NZSA 3PUXA 3RNCC 2A69C 2IX3A 5LXHA 4XDXA 3DHIC 1O7IA 4MTNA 2YU9B 2WP9B 2K05A 3I70A 3T13A 3AU5A 3DBLI 4KKJA 2HDLA 3PO0A 1B3AA 1RYJA 1BUVT 1S5FD 1E8ZA 2EIFA 3KH0A 2C9OA 3DHQA 5CX3A 3NVZA 1BBWA 3VR3A 2K03A 3E0JA 5IP9H 1R4MB 4PV1C 1AH9A 1FGBD 1PTOB 5E3FA 1EL0A 3HOWH 2FAZA 4WJNA 4A3CH 2R92G 3NWTA 3Q24A 1VRAB 4ANXA 3P20A 4EFOA 3TSSA 3V96A 3K7UC 3P7JA 1WM2A 3PT2B 5ELNA 2KACA 1JWUD 4B3TL 4C2MB 3J7ZC 1V9PA 4PMCA 2F0UA 4Q2JA 5TR5A 3OG5A 1ILQA 4NP5A 2RR9A 1VQ9A 4PNYA 2EXZA 5FLXL 3RNBC 1SNOA 3ZJVA 2HIXA 3QB3A 2A8VA 2K7VA 5D14A 5D3IB 3J80c 4GKJQ 2PQAA 1JCKB 2AL3A 5JVG3 4JI8Q 1SYFA 4ALPA 1M90C 4XDCA 2RVLA 4A3IH 4LCDE 3H3VH 1MSHA 2I46A 1ML0D 3L0OA 3AEBB 1XEEA 1LXDA 4HLEA 2JU6X 1O7ZA 2JA5G 1SF0A 2N7EA 2X8XX 4DV0Q 3Q6BA 4X65Q 1HZAA 3T1YL 1WX7A 2RPQA 1J8IA 2DWQA 4NXMQ 4ARIA 1QUQB 1M1KC 1TBEA 4JL9A 5IOCA 1XMOL 1L0XB 2DX5B 4CO7A 1HZCA 4W9HA 3GTKH 5IGCA 4RF0A 1Y1VH 3I7FA 1AE2A 2N1WA 3AE5B 5BO4B 5K36H 5L95C 5C0XI 2VQFQ 2B3AA 3I90A 3Q69A 5H1SE 1XCTL 3AB9A 3N6RA 3DWQA 2R2QA 3QWZB 1F77A 3A54A 1SFOH 4F1SA 2IJ0A 4GOPB 3S1MH 1BBUA 1QOHA 4HSVA 2O5IC 2CU1A 3K59A 1FVIA 4UHVA 1TT5B 2LVOA 3ENEA 4NY0A 3M4PA 3FILB 4NAWB 2NBUA 3J7A5 2L0FA 3V6CB 3H6NA 4LTUA 2OF1A 1J19A 4HEA1 1ZKHA 3TP5A 3U4ZA 3GTPH 2Z4IA 2MA9B 1ISNA 2KZRA 4GDLB 3FC4A 4XQJA 1TU2B 5FOBB 3VR6A 4C3HH 1TKYA 3PUVA 2RCNA 1HZ9A 2LJ5A 1X56A 5C4XB 5IN7A 3Q3FA 4RCOA 4DUZQ 2CU3A 2LUEA 2IO3B 1EOTA 3I3CA 3OWFA 4IOAA 4BBSH 4FVMA 2UU9L 2AWOA 3HOXB 1XCQL 1F9JA 4GKJL 4IURA 4DAYA 1HR0L 3VR5A 2R93B 2DNCA 4FDBA 1E6EB 2IO0B 2IO2B 4NPSA 1KC8C 4JI0Q 1A3TA 1Q1EA 1MJCA 1ZW7A 4L1BA 3M85A 3ZJUA 1C3TA 3SDZA 4A3EB 5IAAC 4JI4Q 3IRBA 2E2HH 3RLFA 2KT7A 4P75A 2IW3A 3WANA 1G51A 2ID0A 3L08A 3M3JA 5DEHA 2GA4B 4DK5A 2CFMA 5EKIA 1GUWA 3I4MB 3TZDA 2MP2B 4OZAA 3DHGC 4FLHA 5CMDA 4KSLC 3VYUA 2UXBL 1YQ3B 2F1MA 4DV5L 5F2DA 1NJIC 1HQRD 2MBQA 4XZ4A 1E2ZA 2A6HC 2R93G 1JR0D 2WDQB 1DOMA 2D11A 4K7WA 3PGEA 2EZVA 5E4XA 1T5EA 4Q0FA 4ZLTF 1ROEA 3VHTC 1YD8U 3NUHB 4BWGB 2OEDA 2K5HA 1U0LA 4WJ3M 2N0SB 1IW7C 4N9TA 5EE3A 3MVVA 5D3DA 2R92H 4OO1G 1L0YB 5I9OA 1Q5WB 1IZ6A 4DV0L 1LT4D 2JA8B 1TKEA 1YNNC 3J7AV 2W54A 3AU4A 4K0KL 1CZPA 4GDLA 2F0KA 1LTBD 4JX1C 4DV3Q 5C4JH 1Y14B 1UWVA 2VY3A 2ZVOA 1C8CA 2OT2A 1JWMD 2M9VA 5E6PA 1WI5A 1YOVB 3ZQ4A 4BA1I 2YTYA 1ZGUB 4HDQA 4XWWA 2VQFL 1JORA 1YEZA 4DV2Q 1Y69U 1CKMA 4BY1G 3SK6A 1BNZA 2PJHA 4A3MB 1I4GA 3W3AA 1GM5A 4DR4L 3EFCA 2A5UA 1WYGA 1LGRA 1K8AC 2KLGA 3K58A 4DAYB 1C0AA 3APCA 2KXJA 1UE5A 2GVBA 5A2QE 2AYOB 1X6OA 2AQ1B 4BVUC 2M56B 2ZNVB 4DN4M 3CCQA 3HG9A 2KJRA 1HR0W 4IC7B 2FINB 1DGSA 4ZYSA 3CCRA 3NXWA 4IFDJ 1J7BA 2BKRB 5FO9B 2HD5B 4CDEC 1T3QA 4DHJB 1WTWA 4QAYA 1NCVA 1GJZA 3OWEB 2B2WC 4WAFA 2V3NA 1GD7A 4FXDA 4MEMA 3ZTDA 2PW5A 3L7ZC 5EGTA 1IGDA 1NEKB 3BYTB 1L7YA 2K8CA 4XT1B 1XNRQ 2M8SA 3PHXB 5IP7H 4LNKA 1WYDA 2CWPA 2XNAC 3A8JE 4GNXA 1TGZB 3V6EB 1RIPA 1QCBD 3ZRCA 3B9JA 2IDYA 1VQEA 3GTGH 2JA6H 3T16A 3VYSA 4M01A 1F2RI 3WAOA 3P63A 1NTGA 4U673 1X3FA 4ZHOA 1J7AA 1KLVA 3N20C 3C1EA 3PMFA 4YCVA 2DGYA 3LXFA 3VTWA 4GIVA 4B9KA 5J18A 4JI0L 2Z8LA 2INNE 1FCCC 4R3DA 1SRUA 1XXGA 1HJPA 3OLMD 3NBHB 4IALA 2WX0A 2WYQA 3AULA 1XTCD 5IO9A 2HHHL 2B63H 5J2RA 1R9TH 4JI7Q 4G7HC 3T1YQ 3LB8C 3FRPB 1SSOA 5C44H 3BVZA 2A19A 3PZ8A 2M2LA 3PO3B 1JOQA 4UY8C 1YNJC 4WAAA 1E90A 2LFIA 2N88A 5DNFA 5C0XJ 2DN8A 4W9KA 1FNVA 1UE1A 4DV7Q 2KJXA 3LJ3A 1WGKA 2E76C 2PPBC 3EBEA 3F8TA 4ME3A 3CC2A 4A3GG 1B9MA 2MRPA 3HOVH 4X3TA 3ZRFA 2KLCA 4HCSA 4K81A 3IG3A 1EFID 3MAQA 4JBJA 2DJGC 1BBXC 4AP4C 2K8BA 3EFXD 2F3WA 3ZNGC 1WFQA 3TS2A 1C77A 2INDC 1RAXA 2WP8J 3M63B 1ET9A 4F7ZA 4HEDA 5IY0A 4FNFA 4O2DA 1Z6HA 4A3OA 2F3VA 3CC7A 2LXCA 4TVAB 1TT2A 4MIUA 3WDNA 4XYOA 2NVQB 4LF6Q 1VQDA 2M1MA 3AE7B 2R7ZH 3C1FA 3I4MG 3E9SA 2L15A 4EEWA 4C7YA 4BY7B 4GN4B 2N1VA 4NNJB 5FR3A 1VS0A 2BH2A 1WRDB 3PO2H 4NPNA 1QJOA 4YTMB 2JA9A 2BE5C 3JAME 4WURA 3I91A 1MHHE 3KJPA 4M8NA 1CM9A 1RRBA 3R3OA 1U5KA 3AYHB 4LNQA 3I2ZA 3UDIA 2FCQA 4IM3A 1GXDC 1L2NA 2KUMA 1WMHA 1PZKD 5CV8A 3ZW3A 1PH9A 2LGYA 5JPNC 2WGSA 3UI3A 3NG0A 4MJSB 1IYFA 4KKSA 1WJ6A 1E0BA 4GN1A 2K25A 1UD7A 4IO9A 1RF2D 2KQ3A 4BA2I 2LXAA 2VZAA 3BYYB 1Q12A 1EIYB 3CQZB 5C4JB 2WQYB 2HQEA 3K0XA 2ZXRA 4MN3A 4OELB 4ZUJA 3BS1A 4FYDA 5J17A 4MHEA 1SLJA 4UP9A 5M5YB 5JVH3 4JBMA 2KD0A 3M95A 2VB3X 4YWGG 3HOUG 2PE9A 4POGA 3DLLA 1N5XA 2WS3B 2PYKA 5AFWA 2N7DA 1YJIA 2NR2A 2K9XA 1SE2A 2L3ZA 1JOOA 3K5OA 4H02A 1AFPA 4G3XB 4X3KA 2L00B 4MSMB 5HG2A 1J0GA 5KNCA 1TXYA 2WXRA 1YI2A 2E2HB 2WXJA 4MDKE 4J1MA 1SYBA 2C5CA 1SNMA 4L2YA 3S2DB 2KOLA 4ZOHC 2KTRA 2YU9H 5FO8B 2NVXH 3DPDA 1VQ8A 3ZLZA 4JI3L 1PMRA 2A69D 2K5DA 2XWJB 5C0XG 1MJDA 2D2QA 2O6VB 2A6HD 2BYEA 3ZNHB 3OPOA 3S2DH 4C3HG 3I9V1 4LFAL 4RM9A 3GP7A 2GBNA 1PH7A 1II3A 1RD9D 5KNDA 4DV1Q 3SGIA 1PH5A 3TP6A 3DDCB 4AUQC 3S15B 1CTMA 1P98A 1KABA 3DWPA 3H8HA 3TBLD 1JOKA 1SXTA 3MWYW 1BKBA 3L3OC 2ALYB 1T5XD 1SE8A 1X32A 1EQQA 1GJXA 2PTLA 4EVOA 3P1MA 4YL8A 3EJIA 1VDVA 1VQKA 5M5YH 1S3OA 1PRTD 4KGSA 4KK7A 3M3YB 1T0SC 4P2CB 1NBWA 2JQRB 3OTOQ 2RSOA 3KUDB 3ZJYC 1MGSA 2K32A 2WKDA 4A75A 1N5WA 2F0DA 2DZIA 3PIP3 4X62L 3J7YW 4TRDA 4K2KA 2KCNA 2RF4A 1PLFA 2N55A 3SE0A 1UE6A 4HJ5A 2K33A 1SIJA 3RN9C 1SFOB 3U9OA 3SK5A 4A3BH 2NPTB 4HPMB 1JE4A 2LASA 3MXNA 2L5TA 3SFDB 3DWAA 2MFIA 3H09A 5GQOA 2HD3A 1R4NB 1BUIC 1QLBB 2YEPF 1JICA 1R4PB 3QIAA 1XMQQ 3CD6A 4RA8A 3PUZA 1N62A 4C3IG 4BFRA 3HKZB 2PQEA 1ZXHA 3TRZA 4BY1B 1HQMC 2FFKB 5IT9L 2IY0B 4XQNA 2HTHA 4FHKA 2ICIA 1IYVA 4M0WB 4WQMA 4X66Q 1I50B 2D07B 1WI0A 3QC8B 2AWNA 2ZPYA 4N8FA 3AM9A 4QUCA 2QJLA 4K2LA 1Y1WB 2B2TA 1XPUA 3RNGC 5HFYA 1WR6E 3GZNB 4WJOA 2OHFA 2FUHB 5HGTA 3AE4B 4QIWE 3C46A 4HR7B 3U7ZA 4K7SA 4XDDA 1B4OA 2ZXOA 4A3FH 2Z4HA 4FJYA 4AJYB 1VQOA 3I4NB 4PQXA 2DENB 5CR3A 2EE1A 5CV5A 1FYCA 3KBXA 2F4VL 4A3MH 2YLMA 3L4PA 2JUOA 2QILA 4DWFA 3HOVB 3I4NH 1EEID 4HAEA 5EKKA 3ITPA 2AHOB 3K80C 1AARA 3TEHB 1WTRA 3M4OB 2WXLA 3ONSA 3ZNID 4OGQC 4TKNA 4X66L 1SDFA 4JPBW 1KF6B 3QX1A 1WX8A 1WWTA 3KF6A 2PO4A 1SJED 1XD3B 2GI9A 1EUVB 3UE0A 3WWVA 2B2YA 3PO3H 3E56A 2N4FA 2WXKA 1XMOQ 5JJZA 1HEZE 5DCNA 4BY1H 5C3EH 4LF9L 2RSNA 1LT6D 2K5NA 3BK1A 1PTOH 4W9DA 4DR6Q 1LTID 1F2YA 2E8GA 3NENA 5ELFA 1WXSA 3CPFA 1O7LA 4AWJA 1V8QA 3G71A 3LWUA 1IKMA 4ITKA 2IX1A 2W82A 1PRTF 3DHHC 3AEVA 2WXHA 3MXNB 4JBWA 1N6ZA 3CWIA 1ONLA 3RZOB 4Z9CB 2FCSA 4YXDB 5BN5A 4B6WA 3QJZA 2F0LA 1XNQL 1MI2A 1SMYD 2HHHQ 1H9SB 2ACZB 4LDTD 2K5WA 2N7JA 3J80E 3Q3JA 1PHJA 2K75A 3R3MA 2OQ0A 3M4QA 1KHIA 3CMAA 4M02A 3KYHC 5KGUA 5BR8L 3NZ3A 3SHQA 2HE7A 5I2YA 1V9JA 2KTFA 4DV4Q 2EMSA 4BKSD 3TJPA 3VRAB 3KYCD 3VDZA 2NZOA 3A4RA 3W9CB 2EY5A 2BVCA 1QILA 1IHZA 3FILA 2OXPA 3DEPA 4FXKC 4AYBB 2XIWA 2Q8TA 4G7ZC 1SYGA 1OQQA 2HJ8A 4H0LC 2MGSA 2KMCA 2WXOA 1OFFA 3M9BA 2L52A 4N9F4 4BBNF 2MBEA 4PYZA 1TWGB 2N78A 1JC7A 1BMLC 5IODA 1F9PA 4MGZE 4DDGD 1I35A 1HE8A 4ZAIA 1AZPA 4UDUC 2WDVB 3DOWA 3CF6E 3Q8AA 4KI0A 4DNRB 3NQIA 5I6WA 1BVSA 3VYRA 3OIQA 3GTPB 1WIAA 4RKLA 1NSNS 1N36Q 2L12A 4R1JA 3UE1A 5IGBA 1JALA 2WV6D 2RMMA 3GTJB 3PIOA 4AJWA 1V97A 3U58A 4BOZB 1RKNA 2PPHA 2LKVA 3MZ5A 2M4NA 2MP1A 1HNZQ 2NCNA 3FKYA 2RPVA 1E1TA 1ENCA 2INPE 4MM3B 5KEEA 4QY7A 3J81j 1TWHH 3WALA 2A5HA 3S1QH 1JQ4A 1UAPA 3GTLH 3S1RB 1OXXK 3ZGZA 2TMPA 1IL8A 2PZWA 1QVCA 4HCPB 2SOBA 4HMIA 1IP9A 4GKKL 2B8FA 3RD4A 3OW2A 3AV8A 1H9RA 3H0GB 2KHSA 4LUVA 4KHPQ 1YJWA 3PRMB 5C2TB 1E2WA 1A70A 1JW9D 4KKUA 3LDZE 3APFA 1PTOF 1IL2A 3GV6A 5GMVA 2Q2HA 4DR1Q 1IBLL 3TUOA 3MHZA 4A3EH 2IBIB 1Z47A 2R92B 3I5JC 3U50C 4DUYQ 1SE3A 2ZEQA 4R8NA 4O1NA 1KL9A 2ZVNA 1PGBA 2C7NB 4GLVB 4K5XA 1NMGA 3J81i 1JB7A 3DBLB 3CCJA 1RDPD 3MJWA 1OQYA 4RAUC 4YWMA 5MPOA 3EC8A 5NUCA 2YYZA 5CV9A 2A6EC 4LF4Q 2M0XA 2WHIA 1LLRD 5FLMG 1VQ5A 1AW7A 1W3SA 1HTLD 3K5NA 3AI5A 1PTOC 2L11A 3UGBB 1GC6A 1EY8A 4WRDA 2JZ3B 2NBWB 3TEYA 4X64Q 1GVPA 5K5PA 1F9SA 2LHDA 2UU9Q 4JV5Q 4NZLB 3F2CA 1R4MI 1WOCA 4K14A 2FUG1 3VTUA 4PZ7A 2G45B 1HH2P 3K0YA 5GADC 3GZNI 2EOTA 4IWOA 5E6NA 4JI3Q 2JWUA 1JWSD 2NTTA 1L5PA 2HQLA 4DNIA 3Q8EA 1VQ7A 4WIPA 5BN3A 4H44C 3L2PA 3N3KB 3Q8FA 3V62A 1JJCB 1ESFA 2B2WA 5BYSA 1GUAB 5JOBA 2PCFB 4W9FA 2GBKA 4MELA 4BOSC 3A1QB 4W9GA 1LUZA 2QDBA 2ZXPA 4A3EG 4HPPA 4TMAB 3T56B 4LF7L 4MH8A 3J81L 1JRUA 1B53A 2K5QA 3NP8A 1SB3C 2KMAA 4C7ZA 1PZID 4WWNA 5LXIB 4AYBE 3ABVB 3RYTA 4DR6L 2GLSA 3FP9A 5T1GA 4FXGC 2B2VA 1A0IA 4GDKA 2JYEA 3P4QB 5D6JB 4IUUA 2M0AA 2ONQA 3NS1A 3W5VB 3UI2A 1KAAA 4JBKA 1T0QC 3GE8C 2IGHA 3CAMA 1PGAA 1STBA 2V0GA 1KOTA 4JW0A 1QVGA 2AEHA 1H9JA 1NI3A 4N9PA 1SEBD 4IM2A 1V5TA 4APVA 1H9KA 5AJ3Q 3A5ZB 1ASYA 2IHFA 1Y1WH 4OZBA 1SNCA 1J5EQ 1PDXA 3GE3C 2MUYA 4FF2A 1EFWA 2BGFA 2JZPA 4OWXB 1SMXA 2KCMA 1KXLA 1YX5B 2N9LA 4JI8L 3SU8X 2G3QB 3H3VC 1MG8A 1ZXIA 4B0EA 5M3MB 4PT5A 3U30A 3HOWB 4A3DG 4KY6A 2QIEB 3VQIA 4A93B 3R2IA 3D3RA 2BW2A 4ZRPA 1HTPA 1GUNA 2D2CC 3I4OA 4IJHA 4TUUA 2MNAA 1YJJA 2JA5B 5EDSA 2GRIA 3ZKJC 4F7XA 3V2TA 1S40A 2XN9C 3MFYA 3APDA 3DWGC 3TMPB 1JROA 2CKHB 4B3MQ 4DAPA 2VRRB 2K5VA 1CJEA 2C35B 3PREA 3N1YC 5FJ8G 3VRBB 4MT5A 2F0OA 3U52E 1MVKA 4EUTA 2KDBA 2J52A 1WCMH 3VUWA 3SR1A 3ICEA 2I1JA 5JPMC 1WTHA 3GS2A 4BZAA 2L1BA 3CSTA 1DZ1A 2WX1A 4LK0M 5D65A 1SGHA 4LUOA 4C1NK 4LNFA 3NQTA 2DY7A 5G3LF 5HGQA 1QUQA 4DR2Q 2MP2A 4N59A 1QG7A 4ME5A 2JA6G 3PRZA 4JI1Q 1WM3A 2E2JB 5H92C 2K22A 2KFKA 1WTXA 1BF4A 2QCZA 2KEDA 4DV6L 1BT0A 4DV2L 5IP7G 1X9NA 3A8KE 2Z0SA 3UDXA 4NW2A 3PTFC 2X69A 3J80i 4LDTB 1FFUA 4S17A 3FKIG 1E8YA 1PQSA 1GHKA 3NY5A 1KTKA 1Q8KA 4F88A 4HJ9A 1LTLA 2NVYH 3V05A 1LTAD 1LT5D 2IWHA 3PO3G 1WTPA 1WGHA 1WJUA 4W9IA 3Q8BA 2PMZE 5DM63 1T0YA 2CCZA 5LMNW 3N32A 1ZXTA 1A63A 3ZVVA 2Z0DB 1SJHD 3RZWC 2VNUD 2INCC 3PSIA 4JI5Q 1HUNA 2VB2X 3BDOA 3CP0A 1P16A 3W1SA 2RDFA 2KN4A 3A4SC 4IPDA 4P7IA 4A3GB 3AECB 3BVMA 4DXAB 4TQ0A 3PPAA 3NVVA 2RHSB 5BYRA 4XQQA 1I42A 4K0KQ 1YQBA 3VTVA 1XO3A 5EPKA 2KNBA 4FBJB 2O2VA 2HDMA 1HTOA 1KDAA 1TKWB 1JJGA 2B8GA 1UWMA 2WNMA 3SHLA 1M94A 2RD0A 2OJRA 1ENAA 3PO2G 4A93G 4DUYL 1C1YB 1GPXA 3RZOH 2JA7B 1GKHA 3HP3A 2KBNA 2RHQB 1JQYD 1PYBA 5I4DA 1E0ZA 3GTQB 3R2TA 5JJLA 2K50A 3GTLB 2E74C 2YTXA 2SEBD 4JI5L 2B63G 4DV6Q 2WAQG 5JHAA 1IBXB 1PTOD 2ZM6L 1H8CA 3PO2B 4OIKA 1JJ2A 1C7YA 2I07B 1QT9A 1I4RA 3QR8A 1PH1A 1F9RA 1I94Q 1K3RA 1WXQA 3GDEA 3F2UA 3GTJH 2MW5A 5LLIA 3PS6A 3CMEA 5M5WB 3RZDB 3I4MH 5CBEE 2PI2A 2MBHA 4OVUA 2HJ1A 3IT4B 2B3GA 2BYTA 3FHWA 4RMFA 4ARCA 1VJKA 1FGUA 3QCAA 1NUCA 1P7FA 2IO1B 4GLSC 4CJ2C 3KUZA 2EXDA 4ZUIA 2LGXA 2VXWA 2FMCA 1G6JA 2OOBB 3FKIH 1SYEA 2AUJD 1JE5A 1E1OA 2D9UA 1DD2A 1FD6A 4B3ML 3OJ4B 2WINB 4JI6L 2ON8A 1X65A 2B2YC 2K52A 2K1BA 3F2BA 3S24A 1YNTE 4CKBA 4QB4A 2MQHA 2PMZB 4IZ8A 2BS2B 3HK0A 4DK3C 2KEEA 3ZIMA 2H5XA 3HOZH 1JB3A 1A8VA 2F3IA 1I4XA 3RNAC 1VQIA 2KTRB 3ULJA 2BWFA 2V9HA 3VAWA 2H4OA 4A3KG 1LO5D 4DR7L 3IHPC 2HCIA 1PH2A 4HXDA 2AQ2B 1BCPD 1XJVA 4ASWC 1J8CA 4YHHQ 3RZFA 2DYMA 2K5PA 1GAQB 2Z1CA 3E5SA 4I7AA 4RG1A 4B9WA 4FJZA 1F0ZA 1J9OA 4P71A 4ZRZA 5G2NA 2DYBA 3W5OA 4G57A 1LT3D 3I8ZA 3A7AB 1I6HH 3P42A 1PRTC 2L4NA 3ZTCA 2MX2A 5TSSA 3HFZB 2JXMB 2IL8A 2A73B 1LYLA 4HCEA 4NDXA 1FCLA 3VR4A 4C4VA 2R2OA 3J81c 4LF7Q 3QK0A 2LGDA 3ZYYX 4F8CB 1Q0WB 1N61A 3MFGA 1MHXA 1YN5A 3CRLC 1SNDA 1GOZA 1F2ZA 3D4WA 2QA4A 3GTOB 1A3VA 1ZE3D 3HOXG 1D2BA 3AE1B 3NRZA 2Z9HA 1WFYA 3B08A 4FHJA 3I4NG 3RT3B 2Y0SB 1ILPA 2IYDB 3PUYA 1TVXA 1FMAD 1I6VC 4POFA 1O7YA 2L8JA 2NS5A 4L5TA 4ODGA 3QHTA 1EF5A 5CHFA 1XNRL 2K14A 4L5QA 1HZBA 5CC4A 2DZJA 4RCNA 4I7ZC 2E2IH 2F0JA 3NWSA 2Q5WD 3KFUA 2DUDA 1C9FA 5KYIA 2LY7A 4LFCQ 4LF9Q 1NYQA 1FD7D 4A3IB 1E7VA 3ZO5B 2EKIA 1Z9FA 2C7HA 3KLSA 5AZFA 4L8JA 3S9WA 3HKZG 1VQ6A 1A15A 1AEXA 1CSPA 1FR3A 3EUB2 1OTCA 3A33B 2C60A 5DLQE 1WCMG 2BA0A 3QWNA 3PUWA 4WJPA 3Q3OC 3NPPA 3RPFC 2LJIA 3OMGA 1DOXA 1C9OA 4HKZE 4LNIA 2O6VA 4CHKA 3K7AH 4DDID 1JWAD 2JYOA 3K5LA 4IQZA 1Y1WG 1PH6A 1UEAB 5C6AA 2LXKA 4GOPC 3TEZA 2E6XA 3QG1A 1TS4A 1IBLQ 4XTCS 3TS0A 2K0PA 3MJ5A 3H3VI 3RD2A 5JEAJ 4L63B 2G1EA 4AH6A 4HMJA 4YTNB 1OGWA 3CKIB 1A3UA 5GAGC 1P9DU 1TIID 5C23A 3RULA 4GLAC 1K51A 3A9JB 3QOLA 4ICVA 1WX9A 4X3SA 1LABA 3JSVA 3CHBD 4XT3B 1UGMA 2V3PA 4LF8Q 3KF8A 4MSQB 3E9IA 2BH8A 5EBCA 3TP8A 4A3LH 2MPMA 2HTME 4HK2A 4P16A 4BKSA 4H7BA 1STAA 3RUZA 1ET6A 4EGVA 2KVRA 2RBMA 5IYBG 1Y1VG 4CDFC 1V80A 3AE6B 1B9RA 1IGCA 3NTHA 2F0NA 1F2MA 5JEAG 5IWAL 2M17A 1I4PA 1TJEA 1LTSD 5IT9E 4OWWB 2KN5A 2L7RA 1CUKA 1TWAH 5ELOA 1EY4A 3HRZC 2QF7A 4K6DA 1XLOA 2LRUA 2WXQA 4G0NB 4M0WA 3SDLC 2SAKA 2PZUA 3T1HQ 1MIUA 4J15A 1B9NA 3L17A 2WB1E 2IGDA 1FM0D 2WXFA 4DK0A 1MBYA 4DK6C 3HOYG 3A0JA 1MSGA 1A2TA 4B3RL 3AE3B 4LF8L 4REZA 1I50H 4BY7G 1PVOA 5IE8A 5EPLA 1FRRA 4RMAA 3HRDD 2KKCA 2D0PA 1QOGA 4C3HB 4RWSC 3WIMA 2PNHA 1AWDA 2FJ2A 1WE6A 3S14B 3QO2A 4E6IA 4DAVA 3TIXA 2UUAQ 3F1ZA 4ID6A 1YITA 1WCMB 5KYLA 1PH8A 2VW9A 2HT1A 3AE8B 4MNOA 1N8RC 2RDBC 3RNFC 1R4QB 3LNNA 1TWFB 3S14H 4RM8A 2OTJA 3KYDD 2A68C 2CQOA 1B3QA 5LHY1 3AMUA 4RH6A 3HOUB 2EQSA 4LF6L 3HOYB 4ZDVA 4PS3A 2WXNA 4JI1L 4OONA 3H15A 1FXAA 3I57A 3EN2A 5ELDA 2PNRC 1Q10A 1VR9A 4KGRA 4PYUA 3BZDB 1FNUA 1HA5A 3STBD 4MH0E 4FJVB 3ND9A 3A9KA 1VQJA 5IGGA 2XWBB 1WF9A 1CQFA 2X38A 4G11A 1XLQA 3NTKA 1I4QA 1E7UA 3IAM1 1ZPSA 4BBRH 5EKLA 3UQBA 1OXUA 1DJRD 1ZYRC 2EY1A 3PIPA 2EDGA 2JA5H 5BN4A 4K5WA 3RN2A 2DAJA 2JEAI 4AQYL 1VCIA 3A9JA 2WDRB 2PLPA 3FPPA 3AEEB 2KANA 3V60A 2EYOA 4CGYB 4V190 1TIFA 3GB1A 1IKLA 2WLBA 4G4KA 2A6ED 4WJWA 3GV3A 5M3MH 1RODA 4LFBQ 1J7CA 2BT6A 3IT6B 3DM1A 1D5ZC 1QZHA 2V1YA 3NZUA 3AEFB 3ERQA 3DBHI 1PUTA 3U2SC 3CCUA 4RKBA 2N49A 3EHVA 2FNJB 4LJOB 3D31A 1L1OC 2F0VA 1Y1VB 5JAVA 3CCVA 2JN4A 3BINA 4HRSA 1EQTA 2RDHA 1EO6A 3MEHA 1UEBA 2Q8RE 1WXAA 3HHMA 1VZ7A 4KJOA 2NWGA 4P72A 4NJ6A 2LVPA 1ZYRD 4HROA 4A55A 3KUCB 1NY4A 3AN1A 4C3JG 1EY6A 5C44B 2MEKA 1CZGA 1YHBA 3DVNV 3JAMi 2BPSA 1K28A 5M5XB 2NB0A 5DPTA 2NVTH 2FE8A 3EECA 3KWVA 4JE3B 3T3OA 2LRWA 5C4XG 1VF7A 5JXVA 4ZK9B 1SYCA 2QC8A 4E71A 2FBWB 4IJLA 2EYFA 4BS9A 3S17H 2BB5A 2BYFA 2EMTA 4A4IA 5ISRA 5M9OA 3MA2B 4DR3L 2L76A 1S5DD 4URKA 2OEOA 1IBKL 3OHXC 4ULLA 1FXTB 1V8CA 3LWEA 2F0SA 3FAHA 3BVGA 4A3FB 2C9WB 1UF0A 4Y7NB 1WGDA 1Z7TA 2XVSA 2QMTA 5IYCH 3C8YA 1XLNA 4LF5L 1NENB 1VQHA 4KIKA 1ZUD2 4TQUS 3A7LA 1Y56A 2VS1A 2Y0SG 1BCPB 1Z2MA 2UWQA 4KGTA 5LMNL 1NNXA 1Q8IA 2CHXA 2KYWA 1WY8A 3DVGY 4DR4Q 1DOKA 2E75C 1P7EA 2F03A 4QJFA 1A6XA 3PZDA 2D3AA 1K50A 2F0HA 1RTOA 2D0OA 2NYZD 3GTOH 3KUPA 2UXDQ 1WSPA 5IIFA 2D62A 3W1YA 2XBBC 3CF5A 1EWYC 2O6VD 4DHZB 1STHA 1MFWA 1HNXL 5GROA 4JI2Q 4CQNA 1F2LA 2MO0A 2W3SA 4JQWC 3W1SC 3Q6SA 3ETRA 2J7ZA 3L10B 2KFKB 2UUCQ 2WDTB 4QQBX 5GAHC 2ZJPA 2JA8G 3PV1A 2KFJA 1GNUA 1EWCA 3Q2AC 3CXCA 5JJIA 1M8AA 4NKLA 2KDEB 2JT4B 4DR1L 4LK1C 2PQAB 4YIJA 4MGIE 2DHZA 2AWTA 2F0TA 3H0GH 3RCZA 1W6KA 3K8AA 1K8GA 1MD2D 1PRTB 1NR2A 1GHJA 4ACFA 4MJSA 1C78A 1N63A 2CKZB 3RNEC 4A3MG 4IWPA 5KNBA 1X3EA 4A8XC 1EY0A 2F0QA 3NVYA 1CT1D 1KM7A 4IFDH 4XIGS 2ES2A 2MWSB 2X6GA 3HOYH 4EZLA 4EX5A 1LM0A 2UXCL 4OWTB 3DBHB 2Y5BB 4OO1H 3NVWA 4TQ1A 4K5VA 1QKZA 4JLCA 3QJYA 1ICFB 5D2MB 5LMUL 1PDQA 3ER0A 3D6WA 3BG3A 4V0BA 4DAMA 1OEYJ 1WR1A 1PYSB 2AUKA 4HSPA 1WTOA 2M00A 5C3XA 4WWMA 4BAXA 1Q81C 4CDDC 3G4SA 2W3RA 2KQ4X 2UXCQ 5AUIA 3VR2A 4EQNA 2ASQA 2JRIB 2QDFA 1DM0B 5T1IA 4FP5D 3GTKB 3KLWA 1D3ZA 3C2PA 3E0EA 4DV1L 3BZKA 4EZJA 1SBBB 2AQ3B 1EQRA 4H2AA 2Z0EB 5JHBA 2NTSA 2PW7A 4CDCC 4DKAC 4AQYQ 1JMCA 4NMZA 3ERSX 1GUTA 2JJQA 4C56C 5C3JB 2EJFC 3QOJA 1WD1A 5T8IA 2G5DA 4IUVA 4GZYC 4A9AA 3ZDMC 2QEXA 3KLRA 1YX6B 2KVMA 1XF5L 4XE0A 1FL0A 1ZDXA 4HJKA 2OCEA 5C3WA 3AE2B 3ZJTA 1WGRA 1TS2A 5M3FB 2SDFA 3VR9B 1K0RA 4D2KA 1Y8RC 2RQXA 1EY9A 3PSEB 5CTRC 3PLVA 4MACA 4OZCA 4LMQD 1Z5SB 1CA6A 3OOCA 4KV2A 1ZKOA 4JIOU 4NJCA 2IY1B 2WAQB 3E3XA 5M5XH 4WJQA 3PIO3 2L0TA 2C5LC 3OSOA 2R6GA 1K8MA 3IL8A 5JEAH 3M62B 5FR6A 4C3JB 1HR0Q 5E7NA 1KDCA 1SYDA 1TWCH 3J81E 3W2DA 2R7ZB 3W5UB 3E6ZX 3TQYA 1PA6A 2A74C 1FJGL 1KNAA 4JI2L 2ZJDA 4HJ7A 2H1EA 3IBEA 3R66C 2EJGC 2IHEA 4G50A 1RL2A 3ND8A 4MM3A 2PVGC 4JG2A 1Q1OA 1ZEQX 2CQAA 4EQOA 1D8LA 1JRPA 2G9DA 1GUOA 3C3LA 2M19A 2R7DA 1S5CD 4R4OA 4IUQA 2Z6BA 1WYWB 5G5HA 1K8RB 1C79A 2Z6KC 4M1UB 4GB9A 4DK1A 3WAPA 4R4QA 1XPRA 3CCEA 2NN6I 3J80L 2NVTB 2UYZB 2CWAA 2E5LL 3IFTA 4IPHA 3GQBA 4J8QA 2PVOD 3IFDA 1EEFD 1GG3A 2YEPB 4EQ5A 4XC2A 1D5MC 1N9WA 1V2YA 2C7MB 4N6EB 2A4ZA 4BBRB 5EPJA 2FHTA 3TZUA 4B9XA 1N34L 4FF3A 2R7ZG 4BY7H 3HS0C 4JGHB 5ELBA 2G4SA 4OW0A 4US8A 3UF8A 1QNKA 3CC4A 4XYQA 1FEHA 1VCBA 4QGUA 3WOEA 3T8MA 2KX0A 4DR7Q 2Q2IA 2UUBQ 5ELEA 5H8YE 3HEJA 2VQEL 5CGKA 1XYIA 1TQOA 4NAWA 4K8JA 3W1GA 4J3OD 5EAYA 2L9HA 1RCVD 3S17B 1MHWC 1YVCA 2KC2A 4DPGA 1MJEA 1D1KA 2VUMG 4GOPA 2MBBB 4WWOA 2EYPA 2JQOA 1TS5A 3L0WB 3S2AA 3TP7A 2V4LA 1BOSA 1EWIA 2CS4A 4NXNQ 2RSUA 4A20A 5IP9G 2UXDL 1PZJD 4F87A 2JA6B 2BS4B 1NDDA 1H9SA 1VF5C 1Q90A 4KMUC 4L6TB 1CMXB 3T9LA 4KSKC 2KQSA 1K73C 2D5GA 1XMQL 4OX9Q 5COYA 4P6VF 2IX0A 2D3CA 3FMCA 2ZJRA 3NEMA 1Q82C 1CZWA 1VQGA 1UZXB 2WU5B 4HIDA 2LMCB 1I3QB 1P8LA 3UINB 5HKHA 2P5ZX 4N58A 4RHRA 4A6QA 4JVZA 1X54A 4B3TQ 3PF5A 3MXUA 4MTKA 2F0MA 2V1CC 1FXIA 2KOXA 2DBYA 4A3GH 1P0RA 1EZ6A 4IUTA 1TKGA 1IBKQ 2QHOA 2BA1A 1W6JA 4LFCL 3OTOL 2KHJA 4KV6A 4FN2A 4GSWA 5CBAE 2Y5CA 1L6UA 4FO2A 1KQSA 4BXXH 2JRHA 2KA7A 3NJTA 3J7AF 2BDOA 3MXPA 3GTGB 3CSFA 1BO0A 5C44G 3P2BA 4HDOA 1E9MA 3Q3NC 2LUMA 2L32A 1EM7A 3H0GG 1LQBA 2BYVE 3VA7A 5J22A 2XEWA 2PEAA 2Z6KA 1VQMA 2Y3AA 4KHZA 2J42A 3NHHA 2L0CA 3HOZG 5FLMH 3HOVG 4UAIA 2Q8IB 3DMUA 1HNXQ 2JX5A 1EU3A 2J0TD 1WJNA 3A9KB 1QE6A 5IP4D 1VQCA 1YHQA 1G91A 4R8IA 4DV5Q 1SAPA 1ESRA 3B1LX 3I55A 4EKUA 5M5WH 4IW0A 5DPWA 4HIMA 4QUFA 4CKCA 1K3BC 3SFEB 4DQOC 4KN7C 2BS3B 3LX0A 3P4RB 4NJ7A 2OTLA 4C3IB 2A1AA 3SEBA 5C5MA 1EYAA 3M7NA 1W2BA 4RHSA 2NBFA 2IGGA 1E7ZA 4L5SA 1UWXA 3DUZA 1U4AA 3U4EG 3Q22A 1Y8NB 2DZKA 4JCVE 4LF5Q 3PCOB 1C4PA 5CHWA 1EU4A 3RNUA 4MGKE 5HHDG 4QMGA 4YCUA 1NE3A 1Y8PB 2WACA 3P1HA 1EIFA 4OL7A 1T6BX 5E6JA 3TEWA 4DR3Q 2JVCA 4BKTA 3MHSD 2EYLA 4ZRJA 2ATWA 4PZ8A 1TR5A 1P1AA 1BDOA 3MTSA 3C19A 1JWBD 2K4KA 5E4WC 3B0AA 1N32L 2CHWA 5KHQA 5KHOA 5M3FG 5L83A 1PGXA 4S3SA 5CV7A 3IKJA 2WXIA 3MC9A 3VXWA 2ICEC 3T51B 4DXGA 4FADA 2NVYB 3RLNA 3SK4A 3KF6B 4IM0A 2JEBI 3P4PB 4LWCA 5C4XH 4B3RQ 1WGGA 3NELA 3G6EA 3PQIA 4PMBA 1IYUA 3Q8CA 1NMFA 2O2LD 4W9JA 2Y0SE 4P74A 3OMCA 1A5RA 3ZXVA 2XTIA 4OIJA 1VMPA 2KDIA 2MSED 4WFN3 5EJWA 3NHEB 4B3SQ 1CKOA 1VQBA 1KRTA 4A90A 1BQQT 4UP7A 2IY5B 1MPEA 3DQVA 1A62A 3PV0A 1V6EA 3ECIA 4RGNA 3ZUNA 3E9HA 4W9EA 3NTIA 2WKCA 3M4YA 1KAWA 4AIMA 2BKFA 2BE5D 3U8ZA 3S2HB 1WD0A 1KFYB 2WXPA 1IBML 1WXMA 2H89B 2DJFC 3GD7A 2KO3A 4FF4A 3S16B 3NOBA 1WJJA 5J3BA 1KH0A 1Q1BA 1YJNA 4A3DH 3H91A 4J6HA 4IPGA 1D1IA 5IWAQ 2JZZA 4I6LB 1R9TB 4BBSG 2HDEA 2W55A 2IT1A 1UELA 3AH7A 5EE9A 4XXEA 2KX3A 2DNEA 4K8IA 5A2QL 1N33Q 2KWCA 1S3SG 1H4RA 3DVGX 3QAQA 3VH3B 2QDLA 1STYA 5HI1A 2LS01 4ABNA 5GAEC 3Q3MC 4KD3A 4CBVA 4YHHL 1B50A 5D94A 2PIAA 3RMKC 5AEKB 4XWTA 2JSOA 2K6AA 4TSSA 4HIKA 1WH3A 1WMHB 3FKIB 2FIFA 3I3TB 4QIWB 1E7PB 1YBYA 2FCMA 4KVGB 1E22A 2O5JC 2FXQA 3BY4B 2I5HA 5I9PA 1WJ4A 3DBRI 3S1QB 1DOIA 2HIVA 1NI2A 1I3QH 2QGQA 1VZ8A 2FCNA 1VQNA 2RCFA 1K83H 2MCNB 2PE6B 2F4VQ 3KK7A 3OYYA 3DCGA 2EJMA 3EIVA 3HOZB 2EKEC 4S0RA 2ZM6Q 4ANWA 1XLPA 4JWUC 3TREA 3K9PB 4I6PA 2ENBA 1KDBA 1PFDA 1O80A 1SSNA 4FULA 2MJDA 2TSSA 1L1OB 1TTNA 2NMQA 4KDIC 1C48A 3QARA 5GXGB 1OQRA 4DBGA 3URYA 2VZKD 3HUIA 4J6IA 2F0PA 3DBSA 3KLSX 4WH4A 4A3BB 3ONAB 1O78A 1Q3LA 1MKHA 2PI2E 1K53A 5C5LA 2W9NA 2MQJA 4JI6Q 4M00A 3K81C
chains in the Genus database with same CATH topology
4KN4C 2WB1B 5C4HA 1HRJA 3D8GA 2XRSD 3GTMB 4I65A 3TBIB 3EROA 1G6ZA 3HVDA 2LMCA 2HCCA 4A3DB 4QF4A 1LACA 4RF1A 1E2VA 1LV9A 2I2YA 1STGA 4IUNA 1YQ4B 1G291 2RA4A 4RGTA 5G3LD 1HFGA 1S5ED 1QOAA 4Q5VA 4YT0B 1GUSA 2MJEA 2N9KA 1V1PA 3WCQA 2DY8A 1ZP0B 4ZRQA 1YN4A 1A2UA 5ELCA 1DOYA 4IFDI 3VYTA 1YNJD 4LJZC 3T3NA 1F9QA 4PMWA 3BDCA 2MH7A 3P75A 1HFNA 5DAUA 1U4PA 2MJ3A 4RNAA 1IBXA 2EPBA 4DF7A 1LTRD 5E1FA 1EYCA 2K3UA 5C0XH 1RHPA 1VMCA 1QOBA 1IUEA 1B1ZA 1FO4A 3SXHA 2EY2A 2KCCA 3RMHA 2D5DA 3K5MA 4R9WA 5DM73 2KECA 3TDQA 1QWYA 2EELA 1FNWA 4KD4A 1MI0A 3T53B 1TY0A 1EYDA 5D7GA 1GB4A 3FVQA 1RFKA 5FK9C 2QSDA 3N52A 1EY7A 5EQ0A 4CJ1B 1L4DB 3B2FA 4US9A 4RGOS 2B39A 5K36G 1YMHE 3P4SB 1V1OA 1C4CA 3KBGA 2LHEA 1NAPA 3K7AB 4B0MA 3JAML 3CIRB 1L0VB 1X3QA 3MC0B 1C76A 4KY7A 1G8ZD 4G7OC 4FF1A 1ENFA 1L6VA 2GB1A 2PZTA 4F8MA 4IKGA 1C4QA 2NN6H 3X3MA 1FIQA 1K83B 4KTAA 1CA5A 2L1AA 3IXSA 3H94A 1CHQD 4U68A 2CHBD 3AEAB 4CJ0B 1DCZA 2I38A 5IGDA 2KWDA 1QQRA 1BR9A 1CFMA 5IGEA 3O13A 1QNUA 1GB1A 1TZOA 2AX5A 1L4ZB 3I72A 1QF6A 3S1NB 1CHPD 4LLGM 1PYWD 1RJTA 4GDKB 2XSCA 4OVZA 3DEOA 2WIIB 1KLGD 2BDNA 2G9HD 4DXFA 1I6HB 2B2VC 4C80A 5LNK1 2RKSA 1WTQA 2F0IA 2B63B 2QKIC 5IGFA 2E3TA 3TN2A 4AQ7A 3NE5B 4HN7A 5CYUA 2MHVA 2CW0C 4KKIA 3AE9B 4LAAA 3D6CA 4QCLA 1NYRA 1S4ZA 2R3ZA 4L23A 4AS1A 3GO5A 1HPCA 2O4XA 2K28A 1BXTA 1D6EC 3T4AC 3NSWA 3EGRA 4OHJA 2KAJA 4YTPB 2NN6G 2QEJC 5J39A 1K8OA 2V4DA 4ZHPA 1JMLA 2BOSA 2EY6A 1R7SA 3R8BA 3AMZA 4X3UA 4M8AA 2JP1A 2ZW1A 2CVRA 3AEDB 2ZW0A 2DYOA 1TWCB 1DONA 4DNTB 2WU2B 1HZ5A 2R61A 3I4LA 4A3KB 4HJGE 3HGBA 1EY5A 1EIGA 2EVBA 5CV4A 1V43A 3M7GA 2VZKB 4DU9A 2PMVA 2F0WA 2L55A 4IN3A 2LFNA 4KX6B 1DGJA 2BCOA 4RFBA 1HA6A 4ILWA 3NBIA 1KRHA 2DLBA 1QB5D 1EQVA 1HXYD 1E10A 5FKAC 1ZDVA 1H9MA 5AUKA 1AN8A 1WVLA 3DXJC 5CORA 1G2TA 4IOIE 4KY5A 3B2GA 2CJNA 2VUMB 1DXMA 1B44D 1PFMA 3BWUD 2X6LA 3G7LA 2NZ1D 1AYFA 1FRDA 4USAA 4FXCA 3Q23A 1U4LA 2NVXB 4YSZB 2LEKA 1STEA 1YNND 4KJNA 3MP9A 4EE2A 1Y8OB 1OO9B 3FPUB 3FEWX 5EE0A 3X3NA 3OIPA 1AP0A 5CV6A 2F0EA 5BMHA 1U9RA 3A55A 1PFNA 3A8IE 2SNSA 5G5GA 2BBCA 1XWEA 1UGJA 1PXUA 3LYYA 1K52A 1EIHA 2KMMA 4HKQA 3Q0AA 3HZXA 4CKEA 4JWSC 5J1ZA 3I73A 1TY2A 4HTHA 5C4ZA 2BB6A 2F4IA 2MJ8A 4IFDG 3V3XA 1NR4A 5KRUA 5A35A 1UNSA 3G6JB 1NVID 2PKOA 3AEGB 4DFAA 1I7HA 1M4VA 1VLBA 3EA6A 3NUCA 1HZ6A 3TEXA 2F0FA 2EYHA 3MHBA 2KDMA 5I6YA 1SNPA 3MXGA 4NAMA 5BYQA 1V1PB 4IUPA 3OW7A 1QOFA 2FMMA 3CU7A 1IW7D 1GUGA 2JXTA 3EQLC 4O42A 5BMIA 3VR8B 2CW0D 1SE4A 3TMEA 1TYGB 2BTEA 3D4DA 1LTTD 3L9AX 3RFZB 3NBHA 5FLXE 3S1MB 3PZ7A 1WTVA 3VA5A 3EVQA 1UUPA 3D4RA 1STNA 4DGZA 2E2IB 5BMGA 2B76B 4BBSB 2J4XA 4WORA 1KLUD 3BIID 1S5BD 1RTNA 2HUGA 1U4RA 1OXVA 1WRIA 3N9YC 4CHTB 4KHVA 1ACCA 4JK1C 1HHVA 5LL6X 3J9CA 2E2DC 4A3JB 1FFVA 1TS3A 2JSVX 4YSYB 1SMYC 2QCPX 3FDTA 3IAYA 2ZT9C 2B2TC 1EWHA 1G2SA 1OXSC 1LTGD 1F2RC 3U9SA 1DYQA 2CJOA 3SR6A 4K6LA 1SNQA 2NUCA 1CQVA 3IAS1 1AZQA 2Y5PA 5EBDA 2H88B 5C3EB 5I2XA 4DA2A 4ZKCB 1N60A 2B2UC 1ZOYB 3CRKC 3WOFA 5LL6S 1EZ8A 3DWMA 5FO7B 2A68D 2EYMA 1U4MA 1VZ6A 1BCPF 4IDIA 2XRQD 3BDLA 2JYTA 1OXTA 4RGMA 1CK1A 1C4AA 3K57A 2PW9A 1HUMA 4EQPA 3SVMA 1PFBA 4ZKBB 3AU7A 1TWHB 1D4BA 3NK9A 5EE1A 3BK2A 5KIXA 4ZQ3A 2WXMA 4KKTA 1KNEA 1B2TA 1I4HA 1XX8A 2SNMA 3R93A 4B08A 2F0GA 2B2UA 2LGIA 2L83A 2JE6I 2WXGA 2RDGA 3K6OA 2V4IB 4C1NI 4OO1I 1HCZA 2K04A 1DOLA 3KWLA 4TKOB 1YN3A 2IPKD 1RWSA 4YSXB 1VDZA 1ICWA 1BCPC 1CI3M 2EYJA 4JPSA 3SK8A 1TWAB 3AB5A 3HVZA 1X3PA 3H6MA 2K01A 3KQ4A 1RM6C 4H13C 5HURA 2J53A 1D5XC 3A56A 3PUXA 2A69C 2IX3A 4XDXA 2YU9B 2WP9B 2K05A 3I70A 3T13A 4KKJA 2HDLA 3PO0A 1B3AA 1RYJA 1BUVT 1S5FD 2C9OA 3DHQA 3NVZA 3VR3A 2K03A 3E0JA 4PV1C 1FGBD 1PTOB 5E3FA 1EL0A 3NWTA 3Q24A 1VRAB 3P20A 3TSSA 3V96A 3P7JA 2KACA 1JWUD 4C2MB 4PMCA 2F0UA 4Q2JA 1ILQA 4NP5A 4PNYA 2EXZA 5FLXL 1SNOA 3ZJVA 3QB3A 2K7VA 5D14A 5D3IB 1JCKB 5JVG3 1SYFA 4XDCA 2RVLA 1MSHA 2I46A 1ML0D 3AEBB 1XEEA 2JU6X 1O7ZA 1SF0A 1J8IA 2DWQA 4ARIA 5IOCA 1L0XB 5IGCA 4RF0A 3AE5B 5K36H 5C0XI 3I90A 3Q69A 1XCTL 3AB9A 3N6RA 3DWQA 1F77A 3A54A 2IJ0A 1QOHA 4HSVA 2O5IC 4TMAB 3K59A 3FILB 4NAWB 4LTUA 2OF1A 4HEA1 3TP5A 2Z4IA 4GDLB 3FC4A 4XQJA 1TU2B 5FOBB 3VR6A 1TKYA 3PUVA 5C4XB 4RCOA 2CU3A 1EOTA 3I3CA 3OWFA 4FVMA 2AWOA 3HOXB 1XCQL 4IURA 4DAYA 2R93B 3VR5A 1E6EB 2DNCA 1A3TA 1Q1EA 4L1BA 3M85A 3ZJUA 3SDZA 4A3EB 3RLFA 2IW3A 2ID0A 5DEHA 2GA4B 5EKIA 1GUWA 3I4MB 3TZDA 4OZAA 5CMDA 3VYUA 1YQ3B 2F1MA 5F2DA 1HQRD 1E2ZA 2A6HC 1JR0D 2WDQB 1DOMA 2EZVA 5E4XA 1T5EA 4Q0FA 4ZLTF 1ROEA 3NUHB 4BWGB 2OEDA 2N0SB 1IW7C 4N9TA 5EE3A 3MVVA 5D3DA 4OO1G 1L0YB 5I9OA 1LT4D 2JA8B 1TKEA 1YNNC 3J7AV 2W54A 1CZPA 2F0KA 1LTBD 4JX1C 1C8CA 2OT2A 1JWMD 2M9VA 3ZQ4A 4BA1I 4XWWA 1JORA 1Y69U 3SK6A 1BNZA 4A3MB 1I4GA 3W3AA 1WYGA 3K58A 5A2QE 2AQ1B 2M56B 4DN4M 3HG9A 2FINB 4ZYSA 4IFDJ 3NXWA 1J7BA 5FO9B 1T3QA 1WTWA 1NCVA 3OWEB 2B2WC 4WAFA 2V3NA 4FXDA 2PW5A 3L7ZC 5EGTA 1IGDA 1NEKB 3BYTB 4XT1B 2XNAC 3A8JE 1QCBD 3B9JA 2IDYA 3T16A 3VYSA 1F2RI 3P63A 4U673 4ZHOA 1J7AA 3C1EA 3PMFA 3LXFA 2Z8LA 2INNE 1FCCC 4R3DA 1XXGA 4IALA 1XTCD 3LB8C 4G7HC 3FRPB 1SSOA 3BVZA 3PZ8A 2M2LA 3PO3B 1JOQA 1YNJC 2LFIA 2N88A 5DNFA 5C0XJ 2DN8A 1FNVA 2KJXA 1WGKA 2E76C 2PPBC 1B9MA 4X3TA 4HCSA 1EFID 3MAQA 1BBXC 2F3WA 3EFXD 1C77A 2WP8J 1ET9A 4HEDA 4FNFA 1Z6HA 2F3VA 1TT2A 4MIUA 3WDNA 4XYOA 2NVQB 3AE7B 4C7YA 3E9SA 3C1FA 4BY7B 5FR3A 1QJOA 4YTMB 2BE5C 3JAME 4WURA 3I91A 1MHHE 1CM9A 3R3OA 1GXDC 2KUMA 1PZKD 5CV8A 5JPNC 3UI3A 4KKSA 1E0BA 1RF2D 2KQ3A 4BA2I 3BYYB 1Q12A 3CQZB 5C4JB 2WQYB 2HQEA 2ZXRA 4MN3A 4ZUJA 3BS1A 4FYDA 4MHEA 5M5YB 5JVH3 2VB3X 4YWGG 2WS3B 1N5XA 2PYKA 5AFWA 1YJIA 2K9XA 1SE2A 1JOOA 3K5OA 1AFPA 4X3KA 5HG2A 5KNCA 2WXRA 2E2HB 2WXJA 4J1MA 1SYBA 2C5CA 1SNMA 4L2YA 3S2DB 2KOLA 4ZOHC 5FO8B 1PMRA 2A69D 2K5DA 2XWJB 5C0XG 2A6HD 3OPOA 4C3HG 3I9V1 3GP7A 1II3A 1RD9D 5KNDA 3TP6A 3S15B 1CTMA 3H8HA 1KABA 3DWPA 1JOKA 1SXTA 3MWYW 3L3OC 3P1MA 1T5XD 1X32A 1GJXA 2PTLA 4EVOA 3EJIA 1VDVA 1PRTD 4KGSA 4KK7A 3M3YB 4P2CB 2JQRB 2RSOA 1MGSA 2K32A 2WKDA 1N5WA 2F0DA 3PIP3 3J7YW 4TRDA 2KCNA 4K2KA 1PLFA 2N55A 3SE0A 2K33A 1SIJA 1SFOB 3U9OA 3SK5A 1JE4A 3MXNA 2L5TA 3SFDB 3DWAA 3H09A 1BUIC 1QLBB 2YEPF 1JICA 1R4PB 3QIAA 4RA8A 3PUZA 1N62A 4C3IG 3HKZB 2PQEA 1ZXHA 4BY1B 1HQMC 2FFKB 5IT9L 4XQNA 2ICIA 1IYVA 4WQMA 1I50B 2AWNA 3AM9A 4QUCA 2QJLA 4K2LA 1Y1WB 2B2TA 5HFYA 2OHFA 5HGTA 3AE4B 3C46A 4HR7B 3U7ZA 4XDDA 1B4OA 2ZXOA 2Z4HA 3I4NB 4PQXA 5CR3A 2EE1A 5CV5A 1FYCA 3KBXA 3L4PA 2QILA 3HOVB 1EEID 4HAEA 5EKKA 3ITPA 1WTRA 3M4OB 2WXLA 4OGQC 1SDFA 1KF6B 1WWTA 2PO4A 1SJED 2GI9A 3E56A 2B2YA 2WXKA 5JJZA 1HEZE 2RSNA 1LT6D 3BK1A 1PTOH 1LTID 1F2YA 5ELFA 1O7LA 1V8QA 1IKMA 3LWUA 4ITKA 2IX1A 2W82A 1PRTF 2WXHA 4JBWA 3CWIA 1ONLA 3RZOB 4Z9CB 4YXDB 5BN5A 2F0LA 1MI2A 1SMYD 1H9SB 2ACZB 2K5WA 2N7JA 3J80E 5KGUA 3NZ3A 5I2YA 3VRAB 3W9CB 2EY5A 1QILA 1IHZA 3FILA 2OXPA 3DEPA 4FXKC 4AYBB 2XIWA 2Q8TA 4G7ZC 1SYGA 1OQQA 4H0LC 2MGSA 2WXOA 1OFFA 2L52A 1TWGB 1JC7A 1BMLC 5IODA 1F9PA 4ZAIA 1AZPA 4UDUC 2WDVB 3Q8AA 4KI0A 4DNRB 3NQIA 5I6WA 3VYRA 3OIQA 3GTPB 4RKLA 1NSNS 2L12A 5IGBA 1JALA 2WV6D 2RMMA 3GTJB 1V97A 1RKNA 2LKVA 3MZ5A 2MP1A 2RPVA 1ENCA 2INPE 4MM3B 5KEEA 1JQ4A 2A5HA 1UAPA 3S1RB 1OXXK 3ZGZA 2TMPA 1IL8A 2PZWA 2SOBA 4HMIA 2B8FA 3RD4A 3AV8A 1H9RA 3H0GB 2KHSA 5C2TB 1E2WA 1A70A 1JW9D 4KKUA 1PTOF 3GV6A 3TUOA 3MHZA 1Z47A 2R92B 1SE3A 4R8NA 4O1NA 1PGBA 4K5XA 1RDPD 4RAUC 5MPOA 5NUCA 2YYZA 5CV9A 2A6EC 1LLRD 1AW7A 1HTLD 3K5NA 1PTOC 2L11A 3TEYA 1EY8A 4WRDA 5K5PA 1F9SA 2LHDA 4NZLB 4K14A 2FUG1 3K0YA 2EOTA 2JWUA 1JWSD 2NTTA 1L5PA 3Q8EA 4WIPA 5BN3A 4H44C 3Q8FA 1ESFA 2B2WA 5BYSA 5JOBA 2PCFB 2QDBA 2ZXPA 3T56B 4MH8A 3J81L 1B53A 2K5QA 3NP8A 1SB3C 4C7ZA 1PZID 3ABVB 5T1GA 4FXGC 2B2VA 2JYEA 3P4QB 4IUUA 2M0AA 2ONQA 3NS1A 3W5VB 3UI2A 1KAAA 2IGHA 1PGAA 2V0GA 1STBA 1H9JA 1NI3A 4N9PA 1SEBD 1H9KA 4OZBA 1SNCA 1PDXA 2MUYA 4FF2A 2JZPA 2N9LA 3H3VC 1ZXIA 4B0EA 5M3MB 4PT5A 3HOWB 4KY6A 2QIEB 3VQIA 4A93B 3R2IA 3D3RA 2BW2A 4ZRPA 1HTPA 1GUNA 2D2CC 1YJJA 2JA5B 2GRIA 4F7XA 3V2TA 2XN9C 3MFYA 3DWGC 1JROA 4DAPA 1CJEA 3VRBB 4MT5A 2F0OA 3U52E 1MVKA 2J52A 3SR1A 5JPMC 3GS2A 2L1BA 1DZ1A 4LK0M 5D65A 4C1NK 3NQTA 2DY7A 5G3LF 4N59A 1QG7A 4ME5A 5H92C 2E2JB 2K22A 1WTXA 1BF4A 2KEDA 3A8KE 4NW2A 2X69A 1FFUA 1GHKA 1KTKA 4F88A 3V05A 1LTAD 1LT5D 2IWHA 1WTPA 3Q8BA 5DM63 1ZXTA 1SJHD 2VNUD 1HUNA 2VB2X 3BDOA 3W1SA 2RDFA 2KN4A 4TQ0A 4A3GB 3AECB 3BVMA 3NVVA 5BYRA 4XQQA 1XO3A 5EPKA 2HDMA 1KDAA 1TKWB 2B8GA 1UWMA 2WNMA 3SHLA 1ENAA 1GPXA 2JA7B 3HP3A 1JQYD 1E0ZA 5I4DA 3GTQB 3R2TA 3GTLB 2E74C 2SEBD 1IBXB 1PTOD 3PO2B 4OIKA 2I07B 1QT9A 1I4RA 1F9RA 1WXQA 3F2UA 3RZDB 5M5WB 5CBEE 3IT4B 2BYTA 4ARCA 1VJKA 1NUCA 1P7FA 4GLSC 4CJ2C 4ZUIA 2VXWA 2FMCA 1SYEA 2AUJD 1DD2A 2D9UA 1FD6A 2WINB 2ON8A 2B2YC 2K1BA 1YNTE 4CKBA 4QB4A 2PMZB 4IZ8A 2BS2B 2KEEA 1JB3A 1I4XA 2H4OA 1LO5D 2HCIA 2AQ2B 1BCPD 2DYMA 2K5PA 1GAQB 2Z1CA 3E5SA 4B9WA 1F0ZA 1J9OA 4ZRZA 4G57A 1LT3D 3I8ZA 3A7AB 3P42A 1PRTC 2L4NA 5TSSA 2JXMB 2IL8A 2A73B 4NDXA 4HCEA 1FCLA 3VR4A 3ZYYX 1N61A 3MFGA 1MHXA 1YN5A 3CRLC 1SNDA 1GOZA 1F2ZA 3D4WA 3GTOB 1A3VA 1ZE3D 3AE1B 1D2BA 3NRZA 2Y0SB 1ILPA 3PUYA 1TVXA 1FMAD 1I6VC 1O7YA 4ODGA 5CC4A 4RCNA 4I7ZC 2F0JA 3NWSA 2Q5WD 1C9FA 5KYIA 2LY7A 1NYQA 1FD7D 4A3IB 2EKIA 3KLSA 4L8JA 3S9WA 1A15A 1AEXA 1FR3A 3EUB2 2BA0A 3QWNA 3PUWA 3NPPA 3RPFC 2LJIA 3OMGA 1DOXA 4HKZE 1JWAD 2JYOA 3K5LA 4IQZA 1UEAB 5C6AA 3TEZA 2E6XA 3QG1A 1TS4A 4XTCS 2K0PA 3MJ5A 5JEAJ 4L63B 2G1EA 4HMJA 4YTNB 3CKIB 1A3UA 1TIID 1K51A 3QOLA 4X3SA 1LABA 3CHBD 4XT3B 2V3PA 3KF8A 5EBCA 2HTME 3TP8A 4P16A 2MPMA 4H7BA 1STAA 3RUZA 1ET6A 4EGVA 1B9RA 2RBMA 3AE6B 1IGCA 3NTHA 2F0NA 1F2MA 5JEAG 1I4PA 1TJEA 1LTSD 5IT9E 1EY4A 3HRZC 2QF7A 4K6DA 1XLOA 4M0WA 2WXQA 2SAKA 2PZUA 1B9NA 2IGDA 1FM0D 2WXFA 4DK0A 1MBYA 1MSGA 1A2TA 3AE3B 4REZA 5EPLA 1FRRA 3HRDD 1QOGA 4C3HB 4RWSC 1AWDA 2FJ2A 3S14B 3QO2A 4E6IA 4DAVA 4ID6A 1WCMB 5KYLA 3AE8B 1R4QB 3LNNA 1TWFB 2A68C 5LHY1 3AMUA 4RH6A 3HOUB 3HOYB 2WXNA 1FXAA 3I57A 1Q10A 5ELDA 2PNRC 1VR9A 4KGRA 3BZDB 1FNUA 1HA5A 3ND9A 5IGGA 2XWBB 1CQFA 2X38A 1XLQA 3NTKA 1I4QA 3IAM1 1ZPSA 5EKLA 1OXUA 1DJRD 1ZYRC 2EY1A 2EDGA 5BN4A 4K5WA 2JEAI 1VCIA 2WDRB 2PLPA 3FPPA 3AEEB 2EYOA 4CGYB 4V190 3GB1A 1IKLA 2WLBA 4G4KA 2A6ED 4WJWA 3GV3A 1J7CA 1RODA 2BT6A 3IT6B 3DM1A 1D5ZC 3AEFB 3ERQA 1PUTA 3U2SC 4RKBA 3D31A 2F0VA 1Y1VB 5JAVA 4HRSA 1EQTA 2RDHA 3MEHA 2Q8RE 1VZ7A 4KJOA 2NWGA 4HROA 1ZYRD 4A55A 3AN1A 4C3JG 1EY6A 5C44B 2MEKA 1CZGA 5M5XB 2NB0A 2FE8A 3KWVA 4JE3B 3T3OA 5JXVA 1VF7A 4ZK9B 1SYCA 2FBWB 4BS9A 2EYFA 2BB5A 5ISRA 5M9OA 3MA2B 1S5DD 2OEOA 3OHXC 4ULLA 1V8CA 3LWEA 2F0SA 3FAHA 3BVGA 4A3FB 4Y7NB 1Z7TA 2XVSA 2QMTA 3C8YA 1XLNA 1NENB 1ZUD2 4TQUS 3A7LA 1Y56A 1BCPB 4KGTA 1Q8IA 1DOKA 2E75C 1P7EA 2F03A 1A6XA 1K50A 2F0HA 1RTOA 2NYZD 3KUPA 1WSPA 5IIFA 2D62A 1EWYC 1STHA 1F2LA 2W3SA 3Q6SA 3ETRA 2J7ZA 1EWCA 1M8AA 4NKLA 4LK1C 4YIJA 2F0TA 1W6KA 1MD2D 1PRTB 1NR2A 1GHJA 1C78A 1N63A 5KNBA 4A8XC 1EY0A 2F0QA 3NVYA 1CT1D 4IFDH 4XIGS 2X6GA 4OO1H 3NVWA 4TQ1A 4K5VA 1QKZA 3QJYA 1PDQA 3D6WA 3BG3A 4V0BA 2AUKA 4HSPA 1WTOA 2M00A 5C3XA 4WWMA 2W3RA 2KQ4X 5AUIA 3VR2A 4EQNA 1DM0B 5T1IA 4FP5D 3GTKB 3C2PA 1SBBB 2AQ3B 4H2AA 2NTSA 2PW7A 4NMZA 1GUTA 4C56C 5C3JB 2EJFC 3QOJA 1WD1A 5T8IA 4IUVA 4GZYC 4A9AA 3KLRA 2KVMA 1XF5L 4XE0A 1ZDXA 5C3WA 3AE2B 3ZJTA 1TS2A 5M3FB 2SDFA 3VR9B 4D2KA 2RQXA 1EY9A 4MACA 4OZCA 4LMQD 1CA6A 3OOCA 1ZKOA 4NJCA 2WAQB 3PIO3 3OSOA 2R6GA 1K8MA 3IL8A 5JEAH 4C3JB 1KDCA 1SYDA 3J81E 3W2DA 2R7ZB 3W5UB 3E6ZX 2A74C 1KNAA 2H1EA 2EJGC 3ND8A 2PVGC 1ZEQX 2CQAA 4EQOA 1JRPA 2G9DA 1GUOA 3C3LA 2M19A 1S5CD 4IUQA 5G5HA 1C79A 4M1UB 4DK1A 2NN6I 3J80L 2NVTB 3IFTA 3GQBA 4J8QA 2PVOD 3IFDA 1EEFD 2YEPB 1D5MC 4N6EB 4BBRB 5EPJA 2FHTA 3TZUA 4B9XA 4FF3A 3HS0C 5ELBA 4OW0A 4US8A 1QNKA 4XYQA 1FEHA 3WOEA 5ELEA 5H8YE 3HEJA 5CGKA 1XYIA 1TQOA 4K8JA 4J3OD 2L9HA 1RCVD 3S17B 1D1KA 2EYPA 1TS5A 3TP7A 1BOSA 1PZJD 4F87A 2JA6B 2BS4B 1H9SA 1VF5C 1Q90A 4KMUC 4L6TB 2D5GA 5COYA 4P6VF 2IX0A 3FMCA 1CZWA 2WU5B 2LMCB 1I3QB 4N58A 4RHRA 4A6QA 3MXUA 2F0MA 1FXIA 2DBYA 1EZ6A 4IUTA 1TKGA 2BA1A 1W6JA 4KV6A 5CBAE 2Y5CA 1L6UA 4FO2A 2KA7A 3J7AF 2BDOA 3MXPA 3GTGB 1BO0A 1E9MA 2LUMA 2L32A 1EM7A 3VA7A 5J22A 2Y3AA 4KHZA 2J42A 3NHHA 2L0CA 4UAIA 2Q8IB 3DMUA 2JX5A 1EU3A 2J0TD 1QE6A 1G91A 4R8IA 1SAPA 1ESRA 4QUFA 4CKCA 3SFEB 4DQOC 4KN7C 2BS3B 3LX0A 3P4RB 4C3IB 3SEBA 5C5MA 1EYAA 3M7NA 4RHSA 2NBFA 2IGGA 1UWXA 3DUZA 3U4EG 3Q22A 1Y8NB 1C4PA 1EU4A 5HHDG 4QMGA 1Y8PB 2WACA 3P1HA 4OL7A 1T6BX 5E6JA 3TEWA 2EYLA 1TR5A 1BDOA 3MTSA 1JWBD 5E4WC 1PGXA 4S3SA 5CV7A 3IKJA 2WXIA 2ICEC 3T51B 4DXGA 2NVYB 3SK4A 2JEBI 3P4PB 4PMBA 1IYUA 3Q8CA 2O2LD 3OMCA 4OIJA 1VMPA 4WFN3 5EJWA 4A90A 1BQQT 1MPEA 3PV0A 4RGNA 3NTIA 2WKCA 3M4YA 2BE5D 3S2HB 1WD0A 1KFYB 2WXPA 2H89B