5FK9C

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
216
Chain Sequence
LRKKSELQGTALGNLKQIYYYNEKAKTENKESHDHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5fk9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5fk9C01
1SE4A 1D5XC 3KLSX 5TSSA 1UUPA 4BWGB 5ELFA 1EEID 1JQYD 4NZLB 1SE3A 1JR0D 1JCKB 2R61A 1BCPC 4K6LA 1V1OA 2O2LD 2CHBD 2XRQD 1LTBD 1BCPD 1HXYD 1PZID 1D6EC 1V1PA 4O1NA 1QILA 1SXTA 2SEBD 1S5ED 5D3IB 1B44D 1FNUA 3SEBA 2Z8LA 2AQ2B 1RDPD 1LTAD 1RCVD 1RD9D 3W2DA 1SEBD 1EFID 3EFXD 1LLRD 1T5XD 4RGMA 1D5ZC 2QILA 1ET6A 5D3DA 1LT5D 2AQ3B 3BZDB 4RCOA 1KLGD 3R8BA 2NTSA 1SJHD 1YN4A 3V05A 1LT4D 2TSSA 1D5MC 1L0YB 1S5BD 1TS2A 1HTLD 1HA5A 4L6TB 1DJRD 1DYQA 1PZJD 4TSSA 1CQVA 3R2IA 1KTKA 2WV6D 1AN8A 1PTOB 3BYTB 2RDGA 5ELBA 1I4QA 1SBBB 1M4VA 1JWMD 1S5DD 1PTOF 3OWEB 2AQ1B 4RGTA 4DXGA 1PYWD 1XXGA 1FNVA 3BYYB 1TS4A 4C56C 1KLUD 1SE2A 1LO5D 2QEJC 1YN3A 1PTOD 1YN5A 5FK9C 1CT1D 3MFGA 4RFBA 2XN9C 3BVMA 4UDUC 1EU4A 1MD2D 4DXFA 1I4RA 2XRSD 1B1ZA 1XTCD 1STEA 1LTID 3DWAA 1I4PA 1GOZA 1S5CD 2XNAC 1FGBD 1I4XA 2IPKD 1LTRD 3URYA 1TS5A 5I4DA 1ESFA 1LT6D 4RHRA 1V1PB 3DWQA 1SJED 4Z9CB 4RH6A 5ELCA 1FD7D 4ZYSA 1CHPD 1FNWA 1PRTB 2RDHA 5ELDA 1PRTF 1PTOC 1ET9A 1LTGD 1TS3A 2IJ0A 1TY0A 1PTOH 1EU3A 3TSSA 4RGNA 1LT3D 1CHQD 1S5FD 3BVZA 1PRTC 3DWPA 1PRTD 1JWSD 1I4GA 3MC0B 4L63B 5ELEA 1CK1A 1G8ZD 1AW7A 4OHJA 1LTSD 3EA6A 5FKAC 2NTTA 4RHSA 1EEFD 1LTTD 1PZKD 1TY2A 2ICIA 3O13A 1RF2D 1L0XB 3R2TA 3GP7A 1ENFA 1EWCA 1HQRD 1BXTA 2G9HD 1BCPB 1F77A 2J4XA 3BVGA 3CHBD 1I4HA 1UNSA 4RGOS 1BCPF 1JWUD
chains in the Genus database with same CATH superfamily
2QF7A 2VB2X 2C5CA 3PLVA 2L0CA 3Q8AA 4POFA 3IAM1 3BDOA 1RFAA 1QE6A 2CR5A 3NHEB 1VQFA 5IGCA 1W3SA 3OHXC 3F2DA 1EY8A 4XWWA 4JI4Q 4CBVA 1ZP0B 4N9F4 2N9EB 2I46A 4PMBA 3U9OA 4C1NK 1PUTA 3I3TB 1Y1WB 1X54A 4PMWA 4IM2A 4U68A 3DVGY 2LSSA 3U4EG 3D6CA 1S72A 1JB3A 1YNJC 4BA1I 2YLMA 3CP0A 3NK9A 1H9MA 4YWMA 1F1HA 1EYDA 4DN4M 2PNHA 1HHVA 1WJ4A 1ZE3D 4CYEA 4G7HC 2JA6B 1FIQA 1OEYJ 1WFYA 2FMMA 2RGFA 5E6JA 1QG7A 4K2LA 3T8MA 4W9FA 1WGKA 1L1OB 1LT5D 3E9IA 3QR8A 3TS0A 3PUZA 2N7DA 2Y5CA 1LFDA 1WTXA 3V05A 1E8ZA 2TSSA 4XE0A 3F2BA 1WTRA 1RYJA 2B2YA 2KENA 2DYMA 4BAXA 1BF4A 1ZKHA 5E4WC 3PZDA 4LFAQ 1N5WA 3QOJA 2MRPA 4M0WB 4L5QA 4DPGA 2VQFL 1AH9A 1G6ZA 3D31A 2EQSA 3HGBA 1TR5A 1YHAA 4EQOA 3SK4A 5C3EH 3VYUA 3SK6A 3AULA 1FNVA 1K3RA 2MQHA 5FLMG 2E5LQ 3P4RB 5KGUA 3DLLA 4C3IH 4A3FB 3AE7B 1WIAA 5IAAC 5IT9c 2EZVA 1YQ4B 1YN5A 4FF2A 4JI5Q 4B3RQ 2WGSA 2XN9C 4CKCA 4GOCA 4WWPA 2IT1A 3NTIA 1OTRB 2NPTA 1E90A 2XK5B 4MDKE 3JSVB 3ULPA 3I4MH 1GPXA 2LJIA 3OYYA 3L0WB 5HHDG 1TT2A 1K8RB 2JX5A 4MSQB 3UE1A 2N9KA 1SR3A 1VQMA 1IP9A 3CCVA 1JB7A 2KANA 1TQOA 2MLBA 4A3DG 3AE5B 3AEEB 4UP9A 4L1BA 4X64L 3J81E 3VRAB 1J8CA 1E24A 1VCIA 1EZ8A 5LMNW 5IGFA 2K33A 4HIKA 5HY6A 4DR4L 3S17H 2WXKA 3AE6B 3I73A 1MJCA 1I94L 2HQEA 2MGSA 3U8ZA 2K5DA 1JICA 2A19A 3VUYA 4AP4C 2ZW1A 1DOYA 4IZ8A 3DVGX 1Q81C 4JLCA 4KZ0A 2MEKA 2MBBB 1TS3A 4KMUC 3OLMD 1WX8A 1GM5A 3GZNB 3N3KB 2Q2IA 5IP7H 4IUUA 4EUTA 1H95A 3TUOA 2MJEA 1MBYA 2DNEA 1L0VB 2YTYA 1N61A 4XIGS 3VYRA 1ZXTA 4PZ8A 1RTNA 3BS1A 2WXNA 4LF5Q 3DBHI 4BKGA 3HUIA 3AI5A 3U7DA 3RR5A 3ND9A 3A9JB 5LNK1 1R4QB 2JSOA 5BO4B 5DEHA 1MFWA 5IP4D 4C3HB 4APVA 1WJUA 1WR1A 2G1EA 1PFBA 2J0JA 1KLVA 4G57A 4L8JA 1V9JA 1X6OA 3CKIB 3AYHB 2Q8RE 1HFNA 2ZTDA 1V43A 1SE4A 1YNNC 4JBWA 2FJ2A 2V1CC 4HSPA 4XT3B 4BWGB 5K5PA 2IX3A 2VW9A 4BY1H 4R3DA 3TCAA 4H13C 2EKEC 1WMHA 1LGRA 2MCNB 4WQMA 1JCKB 3A8KE 1BCPC 5C3EG 4JPBW 3GTOB 4JI1Q 4AYBG 3MXNA 2WKCA 5ELOA 2ZZPB 4CQNA 1HR0W 2R7FA 4OL7A 1BBXC 3HK0A 5EE3A 3NWSA 4O1NA 4C3IG 1W2BA 1S5ED 3S1NH 3SHQA 2LXJA 1B44D 3WANA 1K52A 3HOYB 2LGIA 4IM0A 3OTOL 1R4NB 2NZOA 4ALPA 1XX8A 3UDIA 2UU9L 1UELA 4NJCA 2KWUB 4MGZE 3AV8A 4X62L 1L4DB 1N33L 2F0SA 4G4KA 2MPMA 3I4MG 1QUQA 2BE5D 3AB5A 4LNIA 3MTNB 4P7IA 4HXDA 3Q8BA 3RULA 2JQOA 4LF4L 2Y5BB 2JYTA 4ICUA 2JA7H 2PQAB 1S4ZA 3T16A 1Q12A 2MBQA 1GHKA 1G291 1BQQT 3G6EA 3TREA 2H89B 3R7QA 1H8CA 2RSOA 4WWMA 1J7AA 3S14H 2HQLA 1V8CA 4B3ML 2OT2A 2WP8J 2NUCA 1G2SA 5T1IA 2BQQA 1FCLA 1I4QA 3PHXB 2L1AA 1QOBA 3P7JA 4JPSA 2ZNVC 3TP8A 3APDA 1WRDB 1ZOYB 1NBWA 2EY2A 4KN7C 4NXNL 3MA2B 3ZVVA 3AU5A 3NJTA 1WJJA 2BPSA 1YNXA 2B2VC 2XEWA 3X23A 4LDTB 1A8VA 4W9CA 1P3QU 2E2DC 1VQDA 1C9OA 3VH4B 2KOLA 3ERQA 3PUWA 1IKMA 3IFDA 4BKSA 3MXPA 4LFCL 5CV5A 1DZ1A 1D8LA 2L15A 5I2XA 1N9WA 2DYOA 5E1FA 5C4JB 5CMDA 1KXLA 1WGGA 4QY7A 3DM3A 3QWNA 1IPGA 1O80A 1L2FA 4BBRH 4DUZL 1MHXA 3RUZA 1WXQA 1K8MA 2JA8H 1SE8A 4AQ7A 1MHWC 1NI3A 1CJEA 3RNEC 3PIO3 1C76A 1CHPD 1FNWA 1PRTB 5LL6S 4BOSC 1H9SB 1L7YA 1PTOC 4C7YA 2IJ0A 3P2BA 1K83H 5AJ3L 1NEKB 1SIJA 1JJ2A 2MP2B 3VR3A 4DXAB 1LT3D 1JWBD 2LZ6A 3DCGA 1STNA 3M95A 1ASZA 4KKTA 4DK3C 2N1WA 3ITPA 3Q8DA 1N63A 1I4GA 3L2PA 3D8GA 5ELEA 5IP9H 3NG0A 1KL9A 4AJWA 1NMGA 2BB5A 3EA6A 4X64Q 1TZOA 3SXHA 4DR4Q 1XT9B 2AWNA 3DVNU 1I94Q 4Y7NB 1ENFA 3I7FA 4OWWB 1BXTA 2G9HD 2JA7G 2GBJA 2M0AA 3CHBD 2O6VB 2DAFA 1KIXA 4EOYA 4HKQA 1BCPF 2SDFA 3L3OC 3V96A 1D5XC 3KLSX 2QGQA 2VXWA 5KYIA 1WGYA 2GI9A 2K50A 4CO7A 2KQ3A 4NZLB 1YOVB 3A55A 4K3BA 1WI0A 5CHFA 1C1YB 4YTPB 5HGTA 3ZJUA 3RI7C 1KJTA 1V1PA 3W5VB 2PZTA 3D4RA 2E2IH 3L13A 3TBLD 4Q5VA 2PMVA 2VNUD 1VLBA 3H0GB 2G9DA 1EM7A 1ZPSA 3ULJA 4AIMA 3HOXB 3R3MA 5M3MH 4LJPB 4JG2A 2INPE 3QJZA 2K39A 3GTJB 1WXVA 4W9JA 2LWPA 2D2QA 4ODGA 1BMLC 1A0IA 4DGZA 2FHTA 3S1MB 3M4OH 2G45B 3EECA 3U2SC 1NI2A 1TJEA 4OVZA 1MPEA 5H92C 4XTCS 1Y8RC 3F2CA 4IG7B 2NTSA 4ZUIA 3TN2A 5D14A 1B9MA 3DQVA 1LT4D 2OJWA 1FVIA 4BBRG 4NJ6A 1HTLD 1L2NA 2JA8G 3ONSA 4A3LG 3P75A 3KK7A 2J7QB 3B6YA 2LVOA 2UWQA 3DVNV 3IHPC 4KGRA 1IYUA 1YMHE 1KTKA 2N3SA 2WV6D 3T51B 2VQEL 5EKLA 2RDGA 2MQJA 2MO1A 2CFMA 3OOCA 3DHIC 4B9KA 2WXRA 3MEFA 4OWXB 1STYA 4X62Q 1MI2A 1ZYRC 1SE2A 1ASYA 2MHJA 1BDOA 1MJDA 1E3PA 3I4NB 4E6IA 1C4PA 2K22A 2B2TC 4IKGA 4DR5L 5FK9C 3BDLA 3AM9A 3HM6X 5IP9G 1NR4A 4IJHA 1STHA 4LF4Q 3F1ZA 2M2LA 5BMHA 2VH2A 1V5OA 4ZHOA 3NTHA 1I35A 4KGSA 3I4LA 1STEA 3CRLC 2L0FA 4I6NB 3U52E 4LDTD 1T9HA 4B3MQ 2ES2A 5JVG3 2IPKD 1LTRD 3D6WA 1SMXA 3JAML 1WGDA 2JRIB 2PVGC 5EBDA 1FMAD 2JXTA 4AS1A 4KHVA 1OEYA 3T1YL 1FO4A 4NXNQ 1J5EL 2NBVB 5C4JH 4IALA 1I6VC 2C7NB 2OF1A 2LFIA 3KYDD 3UIPB 1F2RI 1OQQA 2FBWB 2JA5B 3AE9B 4L2YA 5C1ZA 1VQEA 4ICVA 1XNRL 4DV2L 1AYFA 4A3MB 1CHQD 1VQCA 1EY9A 4RCNA 3B1LX 3HKSA 1GG3A 4FULA 1PRTD 4JWUC 3V6CB 5HFYA 1TYGB 3ML9A 4OELB 3S2DH 1H4RA 3SU8X 2CWAA 5M3MG 4XWTA 3J80i 1UE7A 2MSED 3VA7A 1IW7C 1O7LA 3P1HA 4DUZQ 4BFRA 4QMGA 1V5TA 3TEZA 4MGYE 4X3SA 1XNQL 2BYEA 5G2NA 4W9HA 2V3PA 1BKBA 3DPDA 2Z1CA 3VR8B 3A74A 2F0PA 4RF1A 2K5HA 1HPCA 2SOBA 3UINB 3RN2A 1UWXA 2L3ZA 1X56A 3NBHB 1WYWB 3M63B 2KJ6A 3RCZA 5AJ3Q 4OONA 4P2CB 4RG1A 1T0QC 2ZVOA 3WDNA 1S40A 5HURA 4HCNB 3L4PA 4LCDE 2Z0SA 2EY5A 4JBKA 3G71A 2ZNVB 1ML0D 4XYOA 1YJNA 4GN3B 4FHKA 3HOZB 4IFDJ 2DLBA 2W55A 2HDMA 4DR6L 4RAUC 3BK1A 3Q3FA 3P4PB 4V190 5D7GA 2CW0C 2BYFA 2N0SB 4PQXA 3TDQA 3Q22A 2DBYA 4LLGM 1LACA 1UH6A 1R4PB 3NUHB 1B50A 1VQHA 4TMAB 3AMUA 3IAS1 2NB0A 3LXFA 3TIXA 2WAQB 2CVRA 2NVYH 4RGMA 3HZXA 2V4DA 3L54A 2BTEA 1VQJA 1WE7A 3VAWA 4JV5L 3S2HB 2AQ3B 5IY0A 1K51A 2D07B 2RDFA 1Q1BA 4GN4B 2QHOA 2W54A 4QF4A 4R4CA 1D5MC 4OVVA 3L7ZC 3JAMc 5C4HA 1WTPA 1OXUA 2V3NA 2C35B 4ASWC 3C2PA 2NR2A 1Y8NB 4KZCA 2VUMH 1C48A 1OXTA 2LXKA 4YTNB 1PTOB 1SBBB 3ZXVA 3VHTC 3H7PB 5JH5C 2EDGA 2KCTA 4M8AA 3RMHA 1ISNA 3QG1A 2HHHL 5GAEC 2CU1A 3K9OB 3VDZA 1LTLA 2DJGC 5DNFA 2MBEA 5GXGB 3LX0A 1CT1D 5G3LF 3Q0AA 1FXAA 2D3BA 1G51A 1SMYC 3STBC 3QAQA 1ZXIA 4UDUC 1CA5A 2RBMA 1E2VA 2RCNA 4B3TL 1PGXA 1I4RA 1WTVA 2VH1A 1E6EB 3NS8A 1X3EA 1RL2A 2Q2TA 1QOAA 5K36H 4C7ZA 1DOXA 2IWHA 4IURA 3L10B 1S5CD 4CJ1B 4RKBA 2VQEQ 1N5XA 3UF8A 2IX1A 1L5PA 5IKCM 3VFKA 2EE1A 1J0GA 2IBIB 1Q8KA 4A3GB 2KWVB 1FJGL 3DWQA 5LLIA 3W5UB 2ALYB 4AWJA 1P7EA 2RDHA 1QF6A 1C3TA 4N59A 1VD2A 2QSDA 1WY8A 4ZDVA 4A20A 1CI3M 2IHFA 3ZYYX 2YV5A 4JI8L 3U50C 4DR5Q 3B2GA 3CSTA 4OVUA 1QVCA 2A69D 4NJ7A 1SSNA 3PMFA 2B63B 2CHXA 1WYDA 3ML8A 4FNFA 2R6GA 1PH8A 3CC4A 3PO2H 4RGNA 2DX5B 4K3CA 4P73A 1IYJB 1WD0A 2W3RA 2BH2A 1TT5B 2GLSA 3Q3OC 5FLXE 4M0WA 3SFDB 1TWAB 1UE1A 2BDOA 4P75A 1JMCA 4GGQA 3N30A 3VYSA 3PTFC 4TV3A 4RMAA 1D7QA 2JA5H 1TWGH 2WACA 4AUQC 3J81L 4GOPC 2PIAA 4X3KA 4YT0B 2L83A 2K8HA 3T1YQ 4A3EB 4A6QA 1GNUA 1P1AA 2KMCA 4KKIA 4X65L 1W6KA 4AH6A 5LMUL 5JPNC 4MELA 3M4QA 2B3GA 3MTSA 5J1ZA 3E56A 3KLWA 1F52A 3KWVA 3MP9A 2C9WB 4LUVA 2G5DA 1KF6B 2AYOB 1R4NI 4ZK9B 3AFPA 4TRDA 2N49A 1WJ6A 3JSVA 5GQOA 4X3UA 4RM8A 4DV2Q 2VUMG 1IYVA 1QZEA 2FE8A 3IRBA 3UE0A 4L5SA 3PIPA 1V1OA 2FXQA 1EQVA 2K04A 1JOKA 4F8CB 4ZAIA 5AZHA 2KKCA 3DHHC 2K75A 2Z4IA 3I63C 3H6NA 1S1QB 2NZHA 2WB1B 3I55A 1XNQQ 4H0LC 1HNWL 1RDPD 5E6OA 2Z0EB 3S16B 1WM2A 2UYZB 1SSOA 2KACA 2G4DB 2INCC 2ZTCA 3A9KB 4A3CG 4TUUA 2Z6KC 3WOFA 1NJIC 1PH9A 3FKYA 5K36G 2K9XA 4LTUA 3I70A 3KBGA 4PT5A 1I6HH 3VUXA 1YN4A 1NUCA 1XO3A 3ENEA 2UU7A 4IOIE 2M00A 2JT4B 4B0MA 3ZDTA 4PV1C 4KV2A 2N55A 1BOSA 4L6TB 1DYQA 1UAPA 2KNBA 3R2IA 3A9JA 4PZ6A 1IBML 3LWEA 4N9PA 1G6PA 2PQEA 2QW7A 4M8MA 5HI1A 1QNKA 3PV0A 5J22A 1GUWA 2QJLA 2EY6A 3PO3H 5KNDA 1HRJA 2LEKA 2IO2B 3E0EA 3MXUA 3HP3A 3PO2G 2YU9H 1HNZQ 1TWCB 1V2YA 1KLUD 3NPPA 2QEJC 3BU2A 2WXJA 2F0FA 1GKHA 1P8LA 1XLQA 5JXVA 1PTOD 4A3KH 2GA4B 2FIFA 2E2HB 1LXDA 4XYCA 2HDLA 1HZ9A 3O65B 4DV5L 5GAHC 1W6JA 3GTGH 1E1TA 2KEEA 2B8GA 4HAEA 3QOLA 1GO3E 2R93H 1P7FA 3PREA 1K73C 2CKHB 1XPOA 3J81c 4W9KA 3DWAA 4XXEA 5C4XB 2C7MB 5CX3A 1B9NA 2ZPYA 3OJ3A 1H9RA 2RHQB 1FEHA 5KNBA 2LXCA 1KNEA 2ZVNA 1DOMA 3M4YA 1WF9A 3S15B 5I9OA 3TJPA 2BB6A 4A3OA 3TZDA 4RH6A 2KJHB 2KT7A 3VQIA 4V0BA 2Q8IB 2HHHQ 4ZYSA 3RLNA 2FAZA 5DPWA 1HFGA 4HJ9A 4A9AA 3MJ5A 4MSMB 3DBLI 1SDFA 2A1AA 2A5HA 2EYJA 2RQXA 1D3ZA 2PQAA 1LTGD 3BZKA 1TZ1A 4KX6B 1N32L 1V8QA 3IFTA 1U4AA 1VQ9A 5CTRC 3EQLC 4KY7A 4B3TQ 5C23A 2ASQA 1A3UA 1Z7TA 2KQ4X 1PDQA 3PRZA 2V1YA 4K7SA 1UZXB 3QA8A 2MO0A 5G55A 2V9HA 1G8ZD 3RUIB 4OHJA 3HOVH 4CDCC 2J42A 5NUCA 4NQKE 4ZRIA 4RMFA 4A93G 4C3JH 5L83A 2GBRA 1FJGQ 4KVGB 2JA9A 1WOCA 2KX0A 4DR1Q 3I91A 1STAA 4IFDI 1T6BX 4JI6L 5CHVC 4LK0M 2GBKA 4ANVA 4UP7A 3TZUA 1BBWA 5M9OA 5TSSA 1VQ7A 2R7ZH 3KFUA 3RZFA 2L8JA 3P42A 3C8YA 5JJKA 4NKLA 2OCEA 5FJ8H 4ZKBB 2I2YA 2KJXA 4URKA 2Y0SG 5LXHA 2VB3X 3PO3G 4S0RA 4TKNA 2CHBD 1ZEQX 3AE8B 1LTBD 2KCNA 3NWTA 1D1IA 2L4NA 4BBSH 2ZEQA 2JSVX 2KFJA 4CKEA 5J39A 5C0XJ 4DK6C 1SROA 3HM3A 2MBHA 1SNDA 4M00A 3SK5A 1YIJA 1RRBA 3SEBA 4A3KG 1H9SA 4IOAA 2BWES 4OXPA 2KLGA 2PE6B 4X65Q 5LMUQ 3GTKH 4C2MB 3GTPB 2KA7A 3S1QB 1B2TA 2RPVA 4KDIC 2UXCQ 2MP2A 1ZYRD 3EROA 5EPLA 4EKUA 2ZJRA 3AE3B 2LHDA 3SDZA 5D3DA 3MFYA 1DOKA 1TVXA 4MNOA 2WXHA 1SYEA 5C0XH 2Y3AA 4QJFA 2YTVA 2E8GA 2SNSA 1GUTA 2M0XA 1LM8B 2VRRB 5KHOA 4ACFA 1V80A 1PZJD 4TSSA 1J7BA 3MEHA 3TL5A 3I57A 3DBSA 1FXIA 4KY6A 4ILWA 1DGJA 3BYTB 1Z6HA 4YSYB 2FCSA 2QCPX 3WWVA 1HNWQ 2ONQA 4OZAA 3W1SA 2O6VA 1VMCA 1QZHA 1TWHH 3M9BA 5M5XB 2L9HA 2ID0A 2OQ0A 4YHHL 1JMLA 1SF0A 1FD6A 4OX9L 5CYUA 1SYCA 5HGQA 1FRRA 1Y1VB 3H3VI 2DZJA 3A4RA 3LDZE 3QK0A 3K7AH 1L6VA 2LMCA 1PH2A 4R1JA 3BVMA 1WXAA 3HOVG 2EIFA 1XF5L 3G6JB 2EYFA 3CQZB 2XRSD 2KO3A 4C3JG 3OG5A 4TQUS 3FKIH 4XDXA 1KM7A 1VR9A 3VTUA 1KRHA 3PQIA 1BVSA 3K59A 1IBMQ 1HUMA 1Y8OB 4F88A 2L5TA 1GUNA 1IW7D 1MG4A 2L00B 1KQSA 1PYBA 5IYCH 1C4AA 3J80E 1EYAA 2R7ZG 1D2BA 3RNAC 2A73B 4L23A 5ELCA 4TVAB 4MGIE 2PVOD 4HJGE 2RF4A 4KJNA 1JE4A 3VUWA 1F9PA 3EJIA 5LXIB 3QX1A 2HT1A 4BBSG 3TP5A 4DV5Q 2O4XA 1JWAD 2CQAA 4N6EB 1KFYB 1A2TA 3AU4A 2WP9B 3I90A 2ZTEA 4Y52H 1IBKQ 3A0JA 2GMIC 1JWSD 4J8QA 2X69A 4LFBL 1J7CA 1I7HA 5AUIA 2PCFB 3A8IE 3GTQB 1WCMH 3NQIA 5FKAC 3JW0X 3ZJVA 2YEPB 4RHSA 3PPAA 1NTGA 3K0YA 4GDLB 5KEEA 1TY2A 4ZLTF 1OXXK 2JEAI 3Q3JA 2WU2B 4M1UB 2RSUA 2B2YC 4M8NA 4XQJA 3HOWB 2A6EC 3C46A 2NVTH 2JUOA 3BJUA 2IY1B 1C79A 2A6HC 2K01A 4ANWA 4UPAA 4OIJA 1N32Q 3BDCA 1UBQA 5DLQE 3T9LA 3U7ZA 2FFKB 2AL3A 1D4BA 5CBAE 1UWMA 1K0SA 4JBJA 3X0WA 1HXYD 2HDEA 4G11A 3QIJA 1RTOA 2Q2UA 3E3XA 2OQKA 4I6PA 3W1YA 3ZLZA 2YTXA 1UGJA 4LUZA 3QHTA 1IYFA 2AQ2B 4JCVE 3CC7A 3ZGZA 4GNXB 1J6QA 3EFXD 2HCCA 1R9TB 4JI6Q 1SYBA 4YCVA 2R3ZA 1UBIA 3PS6A 2RCFA 4A3PA 1UE6A 4IOCA 5JAVA 5CR3A 4TQ0A 3FEWX 3C0RB 1ENCA 3HIZA 5C3XA 4IPGA 1SMYD 1EYCA 2ZT9C 3STBD 3IXSA 5EKIA 3MC9A 2UUBL 1HCZA 1X55A 1I50B 4NB3A 2F3VA 1F9QA 2XSCA 1ILQA 2M4NA 2N9LA 5EDSA 1TIID 1HUNA 3DWMA 4PYUA 3W5OA 1BT0A 3S1RB 5ELBA 1EOTA 4K8JA 1IGDA 1ZUD2 2BW2A 3H91A 3ABVB 1UEAB 1BBUA 1NE3A 3NBHA 4HLEA 5AUKA 2WIIB 1E22A 1ESRA 3K5LA 2A68C 3A33B 4WJNA 1P16A 2J7ZA 2FMCA 3RPFC 3WAPA 1EWHA 3NBIA 3CIRB 4CDFC 4DV1Q 1Y1WH 4W9GA 4WJPA 2EXZA 3BK2A 5BN4A 3IT6B 3PHWB 4JBMA 2BYVE 2BF8B 2ZJQA 1KRSA 1P9DU 4REZA 1YJJA 5DM63 4IUTA 4GSWA 1WCMG 2KHJA 1DOIA 3PO0A 1JJCB 2B39A 3ZO5B 4X57B 1XTCD 2A4ZA 2VZAA 3V60A 2CU3A 3PSEB 2JA6H 2QMTA 1U5KA 4LAAA 5CV6A 2IDYA 4ANUA 2ICEC 2VL6A 2QDFA 3GO5A 2V3SA 3L08A 1Y1VH 5CC4A 4B9XA 1XMOL 5EQ0A 1A5RA 3RNBC 2BT6A 3T1HL 1TWFB 1YHBA 2ZM6L 1MGSA 4GLVB 1SRUA 5JHAA 4YHHQ 1VF5C 2YYZA 4GKJL 5I9PA 5IP7G 5IA7A 2QC8A 1MI0A 2WHIA 1M90C 2D3CA 3PT2B 4PS7A 3K8AA 2I38A 1SIFA 1CSQA 4HIDA 3S9WA 1VQGA 3VTVA 5CV7A 4HIOA 4FO2A 1EU3A 5BN3A 3D3RA 4PMCA 1S3SG 2EKIA 1GUAB 3FC4A 4LF6L 2B8FA 4A4IA 1Q5WB 2K25A 1EY0A 4K2KA 2GOWA 2HE7A 3H7PA 3I5JC 4NY0A 4A3FH 3NVWA 1CK1A 1FM0D 1I3QB 2J0TD 1OTCA 3I8ZA 1LTSD 2VQFQ 1WXMA 2RD0A 2EPBA 4WJ4A 3NE5B 4R4TA 3ZJTA 4CDEC 3MJWA 1RF2D 1F9JA 3KF8B 4BY1G 1L4ZB 4BY7B 1Q3LA 1K9MC 3S2AA 3Q2AC 3ZKJC 2JP1A 1AP0A 4HCSA 5C0XI 2JVCA 5EE1A 4QUFA 1JWUD 2LVQA 1NAPA 4K81A 1E8XA 2IHEA 3SR1A 4WRDA 2KVZA 1ZDVA 4W9EA 1JR0D 2K28A 4F1SA 2GB1A 4LFBQ 3I56A 5CV4A 3CRKC 5C3WA 2MW5A 1TIFA 2KVMA 3UI2A 5FR3A 5C5MA 4HEA1 1HZAA 3HOUB 4DAPA 3QC8B 4JI3L 4EZJA 1SE9A 2LVPA 1V49A 5CORA 5BYRA 2TMPA 4NW2A 4F87A 1LTAD 1PHJA 2CCZA 2KFKB 3LJ3A 2F0IA 4S17A 2D10A 4I6LB 2BYTA 1IBXB 3RLFA 4X66L 4RF0A 4A55A 1BUIC 3HKZB 5IGGA 1MSGA 3TRZA 3F2UA 2JA6G 4A3IB 1VZ8A 1YX5B 4AQYL 4D2KA 2LHEA 5HKHA 3K5NA 4C80A 3J7AF 1NR2A 2K0PA 1S5BD 2F0NA 3OSOA 4DF7A 5IT9E 1QOHA 4QUCA 3DHGC 4C3HH 4ULLA 1DJRD 3FPPA 3KJPA 2O2VA 5MPOA 1L6UA 3Q23A 2F52A 1E5WA 3Q3MC 1KABA 2ENBA 2F0KA 1OQYA 2INNE 3AEGB 1B9RA 2KX3A 2WU5B 2R2QA 4IJLA 3SD5A 4FYDA 1I50H 1NYQA 2EJGC 4DK5A 5LMNL 3RZOB 2MJDA 1LO5D 3BWUD 5CBEE 2M9VA 3GTOH 5I2YA 2NVXB 2R2OA 1PH3A 2JK8A 4A3FG 1CZWA 4MGKE 2UUAL 4HCPB 2UUBQ 4A3JB 2K4KA 4EQNA 3HOYH 3VR2A 2K7VA 4IM3A 5IO9A 3EN2A 3OWFA 4HTHA 2ZW0A 3GTMB 1SNQA 2D3AA 2NVUI 2JZZA 3TEHB 1LV9A 3ULLA 4CGYB 4YWLA 1Q90A 2F0UA 3QWZB 1KDAA 4IUMB 1NSNS 4WAAA 3A4SC 2KTRB 3TS2A 3SFEB 2LD9A 3OTOQ 4IUNA 2LASA 2UU9Q 4L5RC 1FD7D 4DWFA 2IY0B 2KWCA 3RZDB 2EYHA 2NVQB 1U4PA 1QJOA 1Q7YC 2PEAA 2Q8TA 1PH5A 1N33Q 3AEAB 3DBRB 3NZUA 1Q86C 1S5FD 2RPQA 1WTHA 1QOGA 2QIEB 4DV3L 5E4XA 3IFWB 2RKSA 3ICEA 2NYZD 2EJMA 2K5VA 3RD4A 3N32A 4ZHPA 2F0VA 4JGHB 4LNNA 4P6VF 1XMOQ 1HR0L 3NRZA 4K5WA 4YIJA 3AEVA 3T1HQ 3T13A 3DXJC 2ZM6Q 1Q82C 3H94A 3KYHC 2WAQE 1VS0A 4GKJQ 1KHIA 3D0FA 3R2TA 2HTME 1BCPB 1F77A 2MP1A 4M02A 1HZ5A 1I4HA 3Q3NC 2D5DA 4C3HG 3PSIA 2B3AA 5L95C 1K8AC 4HJ7A 4LFCQ 3NVZA 3CMAA 4A8XC 4YSXB 5C4ZA 3UIOB 4LF6Q 4WJQA 3Q8EA 4XZ4A 4BY7H 4DAVA 2PPBC 3P63A 2B2WA 4GLAC 5EE9A 5G5HA 2DZMA 2PZWA 1QILA 3M3YB 2F0EA 3PUXA 3KQ4A 1DD2A 1XJVA 4PYZA 3LGJA 1YNJD 5AFWA 1K50A 1CKNB 2WDRB 1RCVD 4J15A 2E2JB 4OZBA 3W9CB 3ZNHB 3CW2C 3B2FA 2F0GA 4LK1C 1JROA 3HOYG 1MSHA 4IN3A 4HK2A 3VR6A 4WH4A 1V6EA 4IC7B 4E71A 4JW0A 2K1BA 3UDXA 2N78A 5A2QE 2MBOA 3RNCC 3X3MA 5FO7B 1PLFA 4R8NA 3V2TA 2L1BA 2F0QA 4Y7NH 2E3TA 2F0JA 2AX5A 2R92B 1HZBA 4JI3Q 1KRTA 5C44B 3RNUA 2CHWA 2LGXA 4WQOB 4IWOA 1A3TA 2C60A 4DXGA 1PYWD 4FJVB 2DYBA 3HVZA 3RFZB 2F0WA 1A2UA 3UQBA 4X66Q 2EYMA 4DA2A 4YTMB 2QDLA 1E7PB 4IUVA 1MVKA 1B3AA 4S3SA 1EQTA 5IYBH 3KUZA 4AQYQ 1VQ6A 4IFDH 4FXKC 1MIUA 2F0TA 1C7YA 3TBIB 2OEOA 4FADA 3H0GH 2JZ3B 1LTID 4KIKB 4A93B 3FP9A 3FVQA 1I4PA 4I7AA 3HOXH 2K5WA 2D11A 3GE3C 1T5EA 4N9TA 3RLOA 1J8IA 3GTJH 2XGTA 2LGDA 4LNQA 1H9KA 5T1GA 2AKWB 3S1MH 4KD4A 2KDEB 1PXUA 2OTLA 4FLHA 5DAUA 4CHTB 3Q14C 5E6PA 1EUVB 1SJED 2D5GA 4H44C 5LMNQ 4YY3L 1Y69U 1B53A 3CCSA 5C5LA 3GTLB 4FF3A 2M17A 1HTOA 2YVCA 4NQLB 4ZOHC 2Y0SB 2KBNA 1QT9A 4WORA 2HJ1A 4GS3A 5GMVA 5M3FB 2A6HD 4CDDC 1N8RC 2UUAQ 1FPYA 3BINA 3PCOB 3DWPA 1WI5A 1F2LA 5EJWA 4GZYC 1V9PA 2FUG1 1R4MB 1YNTE 4HJKA 2I0QA 3GDEA 1X65A 4IWPA 3GZNI 2CJOA 1AW7A 3OIQA 2ASBA 2WB1E 3I4NH 4A3BB 2MWSB 3RNFC 3U30A 2F0OA 1LTTD 5C2TB 2QDBA 2WXGA 4QB4A 3AEBB 1XLPA 4PG3A 2J0MA 1L1OA 3N9YC 2CWPA 4POGA 4K0KL 1BNZA 3KVFB 4HRSA 3FHWA 1HQRD 3ZTDA 5JJIA 2SNMA 4ANXA 1GB4A 3K6OA 1F2RC 4RGOS 1ZKOA 3QCAA 2UXDL 1QNUA 1F9SA 3K0XA 4B08A 1PH4A 2EY1A 4MM3B 1YNND 2GVBA 1JQYD 2IW3A 1A63A 3DHQA 4OO1I 3BY4B 1C8CA 4MTKA 2EYLA 4DV3Q 3H3VH 1U4MA 2O2LD 1AZPA 3E6ZX 4KHZA 1BCPD 4YSZB 4JOIC 3CCJA 4J6HA 5CV8A 4B9WA 4JX1C 1HR0Q 3N1YC 1SXTA 1STGA 5FR6A 2CHZA 3R93A 2FUHB 1FCCC 1GC6A 1WR6E 3U4VA 5IYBG 3ALBA 3U58A 1T3QA 2CS4A 4WJOA 4NAWB 1KH0A 4A3MH 4IFDG 1NYRA 1C4CA 1UWVA 2MHVA 1AZQA 3DOWA 4ZYNA 1PH7A 5KIXA 1J5EQ 3GOEA 3DM1A 3ZUNA 3H1UA 2GRIA 2BE5C 4B0EA 5COYA 1ET6A 2JN4A 4MACA 4DUYL 4JI7L 2IZVB 5JOBA 5GAGC 2KOXA 2XK5A 3CF6E 1JT8A 2KDIA 3KF6B 1XNRQ 5G5GA 2IY5B 3B9JA 1TKEA 2ZJPA 1O78A 2Q2HA 4FVMA 1GJZA 2KD0A 1UEBA 3WALA 2PW9A 3N6RA 2OEDA 3HVDA 1E7ZA 4PZ7A 2VY3A 1ZDXA 2JEBI 1S5DD 2LY7A 2F3IA 3J7A5 1ACCA 2BBCA 4CKBA 2AQ1B 2WDVB 2EMTA 1RHPA 3AECB 4H7BA 4NDXA 1EYGA 3EHVA 1PH6A 1X3PA 4II3B 2MX2A 3T3NA 5M5WB 3HOZH 1X3GA 4FHJA 1RAXA 5D94A 4IDIA 3OW7A 2R92H 1XPRA 4WIPA 4NXML 2KHIA 4XX5A 1O7YA 1MD2D 4IUPA 3I4NG 2KDBA 2NBFA 4FXCA 1GC7A 2LUEA 1DGSA 2NMQA 5IN7A 4XDDA 3AN1A 4A3DB 1GOZA 1KDCA 2PLPA 4LNKA 4DR6Q 1I4XA 3N52A 4XQNA 4CJ2C 5JPMC 3AEDB 2ZXRA 1SYFA 2Z6BA 3BIID 4YWKA 4GNXA 2B2UA 4JWSC 3S2HH 5BR8L 4K1RB 2O5JC 3H7SA 3P4SB 4HVBA 1PGAA 2A74C 1YEZA 5IGBA 1STBA 3CU7A 2X8XX 3W3AA 1A3VA 4JV5Q 1TY0A 4JI2L 1PTOH 1KC8C 3AB9A 3P20A 4JVZA 4Q2JA 1ZW7A 4WJ3M 1GVPA 2JA5G 3VDYA 3APFA 4MT5A 4US9A 1J9OA 4LF9L 4DBGA 4R4QA 3TEYA 2AHOB 2WXMA 1EY5A 3EIVA 3B08A 4E74A 1CQFA 1HQMC 2K1FA 3MWYW 4P71A 4QGUA 3MHBA 3CD6A 2UXBL 2E5LL 4ZRJA 4YY3Q 4BKSD 2K6QA 4F7ZA 2ACZB 4F7XA 3R66C 2LRUA 2EYOA 4XQQA 4IO9A 1ZXHA 1DXMA 3KH0A 4A3BH 4JI5L 4FXDA 1UUPA 5C3EB 4GDKB 5ELFA 3C3LA 4AYBB 1LQBA 3L0OA 2FIDA 3PGZA 4A3GH 3MZ5A 4LMQD 4C3IB 1UD7A 4K5VA 4CHKA 5CGKA 5KHQA 2QEXA 3PVLA 1WXSA 2JQRB 3EUB2 1AE3A 2F1MA 5D3IB 3HOZG 2K6DB 1FNUA 1WYGA 1BO0A 2Z8LA 4EZLA 2B63H 4HCEA 2WXOA 3CAMA 3HFZB 3I4MB 1F2ZA 4OWTB 4YCUA 4K0KQ 1EIFA 1EO6A 2JF5A 2KJRA 3NZ3A 3H8HA 1YHQA 3PZ7A 4WWNA 4EFOA 3APCA 1TWAH 2X6LA 4JI8Q 3PIOA 1EF5A 5J17A 2UXDQ 2WAQG 3KWLA 1KLGD 1G91A 3FAHA 4HN7A 1EZ6A 1Y8PB 3CC2A 2F03A 1A6XA 3LYYA 2MUYA 1HZCA 4R9WA 5C3JB 1CMXB 2H1EA 4A3EH 1M8AA 4DK0A 2NS5A 1HA5A 3WA0A 3Q6SA 2ZCCA 4DKAC 2JZPA 5DPRA 1FFUA 2KMAA 3MVVA 4PK1A 3NELA 1RLFA 5ELNA 4LF5L 3KF8A 3KBXA 4Q0FA 1UE5A 3IAYA 1UGMA 3RT3B 3HEJA 2XBBC 4MJSB 3ND8A 1VQKA 2XTIA 4C1NI 3C19A 4H2AA 4LJOB 1AEXA 2R93G 3AXCA 3NVVA 3GB1A 3H09A 1YN3A 4GN1A 3TP6A 4DUYQ 4JI7Q 4QIWB 2INDC 2LRWA 1KOTA 1U4RA 5FLMH 1GJXA 1NDDA 2L32A 5DPSA 2KZRA 1EU4A 3ETRA 1C4QA 2BGFA 2K8CA 4KDLB 1D1KA 3ZJYC 1K0RA 2GVAA 1K53A 2N7JA 4HIMA 2GBNA 1QVFA 3DBRI 3GV6A 1QVGA 3OMCA 3S16H 5G3LD 3SHLA 4MEMA 1FGBD 2L76A 2PPHA 4JK1C 3EC8A 5F2DA 1TBEA 1SAPA 1TS5A 3OW2A 4EX5A 4BY1B 2KFKA 3KUPA 4EEWA 1IBXA 4TKOB 1E1OA 3CSFA 3PUVA 3A5UA 4RHRA 2OJRA 3CCUA 5FO9B 3CPFA 4DDID 2CH4W 4A3GG 4X6AH 1V81A 2IYDB 5ELDA 4HJ5A 3S1NB 1E8YA 3T3OA 4IWQA 3NOBA 4NXMQ 4NNJB 1OO9B 5JZEB 4KKSA 1B70B 4GKKL 1TU2B 3FILB 2BVCA 1KD1C 1YZ6A 1PRTC 3GV3A 4MIUA 4GOPB 4RA8A 3IL8A 2KAJA 3TEWA 2B63G 4DHJB 4DV4L 2IO0B 2XVSA 2L0TA 1TWCH 4MH0E 2OWOA 1E0BA 2BH8A 5IYDH 3QQ8B 2I5MX 3G7LA 1QQRA 1E2WA 5BR8Q 2E2HH 1TTNA 4AJYB 2N8NA 5E3FA 2JA7B 2F0HA 2KN4A 4NAWA 3V3XA 3Q8FA 3K5MA 2WFWA 2WXLA 5D6JB 1PH1A 4FA6A 1EWCA 3AFQA 1GUSA 4OEMB 5FJ8G 3S14B 3SE0A 1B4OA 5C4XH 4A3EG 3GS2A 1EFWA 1JJGA 4JI2Q 4ZRPA 2XIWA 3CCRA 2RR9A 4P16A 3S15H 4W9DA 2R61A 4DHZB 1XWEA 1MHHE 4LF9Q 3W1SC 2XRQD 2KTRA 2J53A 2WX0A 1WVLA 3DWGC 3J7YW 3LB8C 2I1KA 1SNOA 2AUKA 2CW0D 4ZKCB 1ENAA 2UXBQ 1VQ5A 1FXTB 1Q0WB 4XT1B 3ZIMA 1RODA 2PMZB 4B6WA 5C0XG 4ARIA 2KTFA 2WB1G 3OPOA 4XDCA 2HIVA 2Z4HA 3A1QB 3UDGA 3I2ZA 3D32A 3AE1B 4BBRB 2Q5WD 2EELA 4RCOA 2K5NA 4HR7B 2JA8B 1M94A 3KDFB 1YQBA 5HG2A 1WH3A 4QL5A 5BMGA 3J81j 1KAWA 1PV4A 5JHBA 1TS2A 1TKWB 1F9RA 4B95A 3KLRA 5KNCA 2LUMA 1AE2A 1PFSA 3QO2A 4HDQA 1K83B 4I65A 4JE3B 3E5SA 2K3UA 4R8IA 2WX1A 3ECIA 5GROA 2PNRC 4HPLB 2D62A 4RGTA 1IL2A 2K5QA 3ZTCA 4K6DA 2D9UA 1TS4A 2QKIC 2E6XA 2IX0A 4HDOA 4W9IA 4DQOC 3CMEA 3Q8CA 4XC2A 4A76A 4QAYA 2EOTA 3C1FA 1E7VA 1VZ6A 2K5PA 1PFNA 1O7ZA 3FKIG 2H5XA 2N88A 4IPDA 4OIKA 3W1GA 3PIP3 2B29A 5A2QL 3CXCA 4F8MA 3AH7A 4WAFA 1EY6A 3KUCB 2EVBA 4IPCA 4X3TA 5IYDG 3NHHA 4HPPA 2OHFA 1B1ZA 2DNCA 3N1XC 2H88B 1K8GA 4FF1A 5IYCG 4HMIA 4C2MH 3GTPH 4ZUJA 3S1QH 1V86A 1KAAA 1I5FA 1WZ3A 3M4PA 2KMMA 1MG8A 1CKNA 2XNAC 2PYKA 3KYCD 2JYEA 1EOVA 5CV9A 2CJNA 3URYA 1VF7A 3VR4A 5C4XG 4FJZA 2KK8A 3M7NA 5H8YE 1R4MI 3R3OA 4A90A 4EQPA 1PA6A 2RSNA 4DDGD 3K80C 3MAQA 2E2IB 2KN5A 1PRTF 2A69C 4OGQC 2EXDA 2DENB 3H3VC 1IKLA 1WWTA 3IT4B 4C4VB 1SYDA 2DAJA 1E2ZA 2QA4A 2DHZA 2KHSA 3PGEA 5BYSA 2NN6H 3CF5A 1RWSA 2V0GA 3BVZA 5M3MB 1DOLA 2FCQA 2B2VA 3I9V1 3CCEA 1QKZA 5M5XH 1SB3C 3RYTA 3TMPB 3M4OB 2KEDA 3L9AX 2F4VL 2HUGA 1J19A 2LI5A 1JRUA 3U9SA 1RIPA 4DAYB 2ON8A 3EBEA 1E9MA 2ICIA 2ZXPA 1P98A 3HRDD 4DHJD 3CQZH 4HROA 3QB3A 4FDBA 3HKZE 1PVOA 2PTLA 4OX9Q 3BVGA 2DGYA 1DONA 1XCTL 4K7WA 3RD2A 2JWZA 1YIWA 3HRZC 5IWAL 4GKKQ 4DV0L 4KIKA 1EEID 5EPKA 5I6YA 3RZWC 4KI0A 1V97A 1XD3B 4K6LA 4DV4Q 3CCQA 2K14A 1N34L 1H9JA 1D6EC 2BDNA 1JC7A 2SAKA 4WJWA 4GMVA 4JYAL 1MKHA 1CKOA 2WQYB 2RMMA 2WXQA 2NWGA 2M19A 3K9PB 2BOSA 2M1MA 1X1MA 2NCNA 4PNYA 3OMGA 2HD3A 1GHJA 1II3A 4BKTA 3L17A 4ABNA 3IBEA 2PJHA 4G3XB 4N58A 1NBFC 2QILA 3CMMB 5GADC 5EE0A 5IIFA 3NENA 3GTQH 4JL9A 2MFIA 3DEPA 1PQSA 2L52A 2X38A 1SJHD 1LYLA 4EVOA 1YX6B 3JVZX 3SGIA 1N36L 2L11A 5FLXL 4O2DA 3NY5A 3VH3B 1OQRA 1WTWA 1FYCA 3HOWH 1Y56A 1WX7A 2M56B 5AZFA 4DV6L 4EGVA 2QCZA 2EMSA 3WCQA 1F2YA 1Y1WG 4A3LH 3GE8C 2K6AA 2LFNA 1XXGA 1RFKA 3DDCB 4G7OC 1WZ0A 3S2DB 2NN6G 1T0SC 1HJPA 1K3BC 4NP5A 1NVID 4MM3A 5T8IA 1EUJA 1WSPA 1B3QA 3D4WA 4RFBA 3WAOA 2F3WA 4MH8A 3EFCA 2JXXA 4I7ZC 4DXFA 5KYLA 3IKJA 1Y1VG 4R4OA 4LF8L 2F4IA 1PDXA 1YITA 2WINB 2WNMA 1VQ8A 2FINB 2IL8A 1SN8A 3AE4B 3VTWA 2KDMA 4DR2L 1HZ6A 3VRBB 3JAMi 3DMUA 4FP5D 4O42A 3I72A 1R9TH 3QJYA 1YVCA 4OO1H 3A7AB 3RN5A 2HTHA 3CWIA 3ZDMC 3DBLB 1C0AA 1EWIA 5I6WA 3AU7A 4FBJB 4FXGC 4DFAA 4K8IA 5TR5A 1K8OA 1CZGA 1PMRA 2Z9HA 4G0NB 5E6NA 1PYSB 1HNXL 2C9OA 3KF6A 4DAMA 2MNAA 4BA2I 1ET9A 1TGZB 4IPHA 4HSVA 3S1RH 2JJQA 2D3GA 2KLCA 2G4SA 3TSSA 1X3FA 3EFUA 4IW0A 2KYWA 5C6AA 2IGGA 3RMKC 4E3CA 2LMCB 4JI0L 2NVYB 1TXYA 4LW1A 3ZXRA 2B2TA 2PO4A 3DEOA 2BS4B 2KWDA 3NQTA 2RVLA 3UDFA 2KECA 4B3SL 2MJ8A 1VQPA 1UF0A 4K14A 2NTTA 1VJKA 1PZKD 1XMQL 1CFMA 2W3SA 2WXPA 3A9KA 2JWUA 2RHSB 1L0XB 3ERSX 1KNAA 2CH4A 3OIPA 5JJLA 1ONLA 2VUMB 3PZ8A 2J4XA 4P74A 1XYIA 5FLXc 2AEHA 3K5OA 3HHMA 3FDTA 4ZRQA 4LF7L 1SNMA 3HOWG 3ZQ4A 2PZUA 3VA5A 1TWFH 3PV1A 4P1BC 2KC1A 4EZKA 4WURA 2L55A 2Z59B 4UP8A 4PS3A 3ZNID 4BBNC 2F4VQ 5D65A 2NPTB 3I3CA 4YWGG 4K5XA 1YD8U 2UUCL 2LXAA 3NZSA 2PI2A 5IOIA 1VQOA 4ZRKA 3JC66 4UHVA 2AMCB 4GN5A 4KLKA 1Z9FA 2KQSA 1RJTA 1RD9D 1HTPA 2WXFA 1FR3A 1IBLL 4LJZC 1IGCA 1LLRD 3A7LA 2B76B 3ER0A 2N9PC 2CKZB 1JE5A 4ZCKA 1QB5D 2F0LA 4BOZB 4PS8A 4P72A 3MHSD 1F2MA 1OFFA 4TQ1A 2A5UA 4G50A 3R8BA 1I3QH 5IWAQ 4DV0Q 4OO1G 1E7UA 1YBYA 1YJWA 1TKYA 1IXRA 4ID6A 2KVRA 1L0YB 4ARCA 3EVQA 2ZPNA 3ZRFA 1LUZA 1OXSC 1N34Q 3UQAA 2EJFC 1CZPA 2N7EA 4JYAQ 3J7ZC 1A62A 2K32A 4DV7L 1RKNA 3PO2B 1PTOF 1Q46A 1X32A 1JQ4A 1JALA 1SLJA 1AFPA 1VZ7A 3BYYB 2N4FA 2Y5PA 1A15A 4KN4C 1EQQA 4GDKA 1SGHA 2Y0SE 1Z47A 1WE6A 3V62A 2JPHA 2NN6I 1TWGB 4R4IA 1EL0A 4M01A 1EF1A 3MFGA 2D0PA 3HOUH 1HEZE 4BZAA 1VMPA 1WX9A 1GD7A 3M3JA 2E76C 5LL6X 2W82A 4GB9A 1MJEA 1N62A 1N36Q 3GQBA 3W1BA 1HTQA 3KJOA 4XGAB 2ZJDA 1NNXA 1WMHB 4W9LA 4ITKA 2AWOA 3D4DA 4QCLA 4QQBX 4KTAA 5LHY1 4DV6Q 1NENB 3MXNB 4HMJA 4ME3A 4A3IH 3K57A 1EWYC 3UI3A 2D0OA 2X6GA 1FRDA 2WYQA 1XCQL 1V1QA 2F0MA 2DZIA 2HIXA 5J18A 2PW7A 4ZQ3A 2I1JA 3E0JA 4GIVA 2KC2A 2NBWB 1SFOB 3NS1A 2WS3B 2B2WC 1VCBA 4HPMB 1Q8IA 1Z2MA 2ZXOA 4DK1A 4LF8Q 3Q69A 3SDLC 2RA4A 5FO8B 5DCNA 1CSPA 1QUQB 3VR9B 4EE2A 2XWJB 3C1EA 2JYOA 2N9XA 3R7RA 2O6VD 2G3QB 3MHZA 5J3BA 4DR2Q 3RZOH 1JORA 3KUDB 2NZ1D 4BXXH 3J81i 3H15A 1NY4A 3CPWA 2NVXH 3IVFA 1I6HB 1XLOA 4LNOA 3DUZA 4MJSA 2KCCA 3WOEA 4IUQA 3SVMA 4NPNA 2BCOA 3NEMA 3K81C 4DR3L 3QARA 3SR6A 1EEFD 3H6MA 4AOFA 3O13A 3F8TA 3JYUA 5EGTA 4A3JH 2DWQA 1HNZL 5ISRA 2DZKA 3P1MA 2PW5A 1HNXQ 2GBMA 1QOFA 3KLSA 1IHZA 1X9NA 3GTMH 1UNSA 2A6ED 2L05A 2K05A 4BY7G 3TQYA 3PO3B 4DR7L 5AEKB 1ICFB 4BBNF 1K28A 4KY5A 4WWOA 4FF4A 3DBHB 2YU9B 4JI0Q 1AARA 3TP7A 5JEAJ 3AEFB 4WFN3 5FOBB 3NXWA 3P4QB 4J6IA 1T0YA 4A3KB 2DN8A 5EAYA 3E9HA 1QCBD 3RZDH 3NVYA 1CM9A 1E0ZA 2NVQH 4B3SQ 2ATWA 3PF4A 3GTGB 2R93B 2DNFA 1WJNA 2EYPA 2DJFC 1XMQQ 5H1SE 3J80L 4FN2A 4JOIA 1WTOA 1N60A 3HOUG 2K52A 3B0AA 1SEBD 1U9RA 1EFID 2FNJB 3VYTA 1O7IA 3FILA 3HS0C 2GN5A 5JEAH 3J9CA 4GOPA 4GU2A 2BA1A 4LF7Q 4IQZA 2OXPA 3HKZG 1SYGA 3CCMA 3MXGA 3M7GA 4KD3A 3Q24A 4MZ9A 4HJ8A 5AZGA 4A3IG 4A3CH 1WGHA 4KJOA 2KQ7A 2V4LA 4OW0A 5J2RA 1A70A 5M5YB 4NMZA 2UUCQ 3J7AV 1JW9D 1EQRA 3T53B 1JWMD 3AQQA 3NSWA 5EBCA 1YI2A 1YJ9A 4KHPL 1C78A 1RM6C 3CCLA 2VZKB 2E74C 2PI2E 2L12A 4DR1L 1M1KC 2J52A 2H4OA 1Q10A 5IOCA 4KKJA 1IBLQ 2K8BA 1E8WA 3VVWB 2A68D 3HOVB 5IGEA 1YJ1A 2WKDA 3H0GG 1WTQA 1XLNA 2NBUA 4KGTA 1WFQA 4USAA 3V6EB 4C3JB 3FRPB 3HOXG 2D2CC 4BXXG 3M3YH 1HH2P 3NUCA 2AL6A 1CA6A 4LWCA 1P0RA 3FPUB 1ZGUB 2E2JH 2IO1B 2Z6KA 1L0WA 1L1OC 4A3JG 1ROEA 2VS1A 4GDLA 2R7ZB 2AWTA 5L37A 1JRPA 4DV7Q 2O2VB 2DY7A 2KDFB 3RN9C 1ESFA 4US8A 3NP8A 3T56B 1ILPA 1ICWA 3A1QA 1V1PB 4KSKC 3HG9A 4Z9CB 3OJ4B 4BVUC 1VDZA 2PKOA 1IZ6A 2UXCL 4BBSB 1FL0A 3U4ZA 1FGUA 3TEXA 3KDFA 3UGBB 1JOOA 4KSLC 4H02A 2WXIA 4AYBE 4G7ZC 2IO3B 2KUMA 1BUVT 3GTKB 5C44H 3G4SA 3VR5A 3NTKA 3T4AC 3ONAB 3ZNGC 4JI4L 3J80c 1GUGA 1QLBB 2AUJD 3MC0B 3E9SA 4JIOU 4JQWC 1OXVA 3LNNA 1SFOH 2REXA 3SK8A 5JEAG 4ME5A 2N1VA 3A8JE 2BKRB 4MTNA 3AE2B 2FCNA 3GP7A 4HWIB 3AMZA 3ZNZB 4KKUA 1NCVA 4ZRZA 4A93H 4P1CC 5IE8A 1Y14B 2RDBC 3ZW3A 3MC8A 5E7NA 1GUOA 4HEDA 4O0AA 1X3QA 4J1MA 4UAIA 2BKFA 1XTDA 1TWHB 4KK7A 1SE3A 5EKKA 4LNFA 1E10A 4NPSA 5BMIA 4CJ0B 1GB1A 1CUKA 1XPUA 1G6JA 1PZID 4GLXA 4A3MG 3GTLH 4OZCA 5CHWA 1EIGA 3K7AB 4LFAL 4DNTB 1Q1OA 2SEBD 3PLUA 4DR3Q 5M3FH 3PF5A 3M85A 1PGBA 1AWDA 1XEEA 2M8SA 1CKMA 3FKIB 3A54A 5BN5A 3BZCA 2OOBB 3QIAA 3W2DA 1LABA 4C4VA 2LKVA 5D2MB 4NAMA 1YJIA 1T5XD 1TKGA 2C5LC 1D5ZC 2MJ3A 4QIWE 4U673 2I5HA 4YCWA 1XQQA 3BZDB 4DR7Q 1VRAB 5KRUA 4B3RL 1S3OA 2LGSA 5BYQA 1VQAA 2DUDA 4MHEA 4GNXC 2B2UC 2KXJA 1IBKL 1N6ZA 1IL8A 4EQ5A 2WDTB 1EY4A 3PRMB 2I5LX 3A56A 4DAYA 1HE8A 2IGDA 2LJ5A 4RNAA 4RWSC 4L5TA 4XYQA 1LM0A 1CQVA 2JXMB 1VQLA 1VQBA 3RNGC 1AN8A 2BA0A 2LS01 2IGHA 1M4VA 3JAME 4A75A 1IUEA 3TMEA 1YQ3B 2J0KA 2JY6A 2XWBB 3KOJA 3OWEB 1G2TA 2L7RA 5DPTA 2R92G 2MA9B 4C56C 5C44G 1BR9A 1WRIA 3FMCA 1B8AA 2F0DA 3N1ZC 3VXWA 4HKZE 4C00A 2WLBA 2Z0DB 5M5YH 1WCMB 1I42A 3WAMA 1SNPA 4DNRB 2CQOA 1U4LA 1C9FA 1EIHA 1VQ4A 2VZKD 2JE6I 3S17B 2HCIA 3KW5B 1DM0B 4HJAA 1F0ZA 3I4OA 2NVTB 3L16A 4II2B 5IGDA 3X3NA 2OTJA 1DCZA 4DNIA 1QZGA 4J3OD 3V61A 4LUOA 1GXDC 1WM3A 2C7HA 3IG3A 2DY8A 1HA6A 5I4DA 5IODA 1CTMA 3H9DA 2PE9A 4KHPQ 4BS9A 1LT6D 2WWZA 1VQNA 3OAWA 3PRPB 1VQIA 5JVH3 2FCMA 4FJYA 1NMFA 4N8FA 1T0RC 2A8VA 2W9NA 3LWUA 1PFDA 1QWYA 3K58A 2MH7A 3K7UC 2JRHA 4MN3A 3M62B 3N20C 1Z5SB 4KV6A 2KHWB 4GXBA 1R7SA 1WD1A 3G48A 2BS3B 2LGYA 2I07B 3A5ZB 1OGWA 3ZRCA 1EIYB 2E75C 1GAQB 2KCMA 4DHZE 1FFVA 4RM9A 5M3FG 4YL8A 5IT9L 1SNCA 4K7UA 3PUYA 2R7DA 4JI1L 5JJZA 3BG3A 2O5IC 2BWFA 4GLSC 4L63B 1JOQA 3WIMA 2K03A 5M5WH 2HJ8A 2P5ZX 4N8X1 1VDVA 2WDQB 1B7YB 3GD7A 4JC0A 2HD5B 2ZCBA 5EPJA 2PMZE 4UY8C 2BS2B 4RKLA 4A3BG 5A35A 2JU6X 3S24A 2YEPF 1KDBA 3EGRA 4YXDB 5DM73 1PFMA 3Q6BA 1EY7A 1C77A 4DV1L 1WGRA 4DU9A 4A3DH 1Q1EA 1U0LA 2V4IB
chains in the Genus database with same CATH topology
2QF7A 2VB2X 2C5CA 2L0CA 3Q8AA 3IAM1 3BDOA 1QE6A 5IGCA 3OHXC 4XWWA 1EY8A 4CBVA 1ZP0B 2I46A 4PMBA 3U9OA 4C1NK 1PUTA 1Y1WB 4PMWA 4U68A 3U4EG 3D6CA 1JB3A 1YNJC 4BA1I 3NK9A 1H9MA 1EYDA 4DN4M 1HHVA 1ZE3D 4G7HC 2JA6B 1FIQA 2FMMA 5E6JA 1QG7A 4K2LA 1WGKA 1LT5D 3PUZA 2Y5CA 1WTXA 3V05A 4XE0A 2TSSA 1WTRA 1RYJA 2DYMA 2B2YA 1BF4A 5E4WC 1N5WA 3QOJA 1G6ZA 3D31A 3HGBA 1TR5A 4EQOA 3SK4A 3VYUA 3SK6A 1FNVA 3P4RB 5KGUA 4A3FB 3AE7B 1YQ4B 2EZVA 1YN5A 4FF2A 2XN9C 4CKCA 2IT1A 3NTIA 1GPXA 2LJIA 5HHDG 1TT2A 2JX5A 2N9KA 1TQOA 3AE5B 3AEEB 4L1BA 3VRAB 3J81E 1VCIA 1EZ8A 5IGFA 2K33A 2WXKA 3AE6B 3I73A 2HQEA 2MGSA 2K5DA 1JICA 2ZW1A 1DOYA 4IZ8A 2MEKA 1TS3A 4KMUC 4IUUA 3TUOA 2MJEA 1MBYA 2DNEA 1L0VB 1N61A 4XIGS 3VYRA 1ZXTA 1RTNA 3BS1A 2WXNA 3HUIA 3ND9A 5LNK1 1R4QB 2JSOA 5DEHA 4C3HB 2G1EA 1PFBA 4G57A 4L8JA 3CKIB 2Q8RE 1HFNA 1V43A 1SE4A 1YNNC 4JBWA 2FJ2A 4BWGB 4HSPA 4XT3B 5K5PA 2IX3A 4R3DA 4H13C 1JCKB 3A8KE 1BCPC 3GTOB 3MXNA 2WKCA 4CQNA 4OL7A 1BBXC 5EE3A 3NWSA 4O1NA 4C3IG 1S5ED 1B44D 1K52A 3HOYB 2LGIA 1XX8A 4NJCA 3AV8A 1L4DB 2F0SA 4G4KA 2MPMA 3AB5A 2BE5D 3Q8BA 2JYTA 1S4ZA 3T16A 1Q12A 1GHKA 1G291 1BQQT 2H89B 2RSOA 4WWMA 1J7AA 1V8CA 2OT2A 2WP8J 2NUCA 1G2SA 5T1IA 1FCLA 1I4QA 2L1AA 1QOBA 3P7JA 4JPSA 3TP8A 1ZOYB 2EY2A 4KN7C 3MA2B 2B2VC 2E2DC 2KOLA 3ERQA 3PUWA 1IKMA 3IFDA 3MXPA 5CV5A 1DZ1A 5I2XA 2DYOA 5E1FA 5C4JB 5CMDA 3QWNA 1O80A 1MHXA 1WXQA 3RUZA 1K8MA 4AQ7A 1NI3A 1CJEA 3PIO3 1C76A 1CHPD 1FNWA 1PRTB 5LL6S 1H9SB 1PTOC 4C7YA 2IJ0A 1NEKB 1SIJA 3VR3A 1LT3D 1JWBD 1STNA 4KKTA 3ITPA 1N63A 1I4GA 3D8GA 5ELEA 2BB5A 3EA6A 1TZOA 3SXHA 2AWNA 4Y7NB 1ENFA 1BXTA 2G9HD 2M0AA 3CHBD 4HKQA 1BCPF 2SDFA 3L3OC 3V96A 1D5XC 3KLSX 5KYIA 2VXWA 2GI9A 2KQ3A 4NZLB 3A55A 4YTPB 5HGTA 3ZJUA 1V1PA 3W5VB 2PZTA 3D4RA 4Q5VA 2PMVA 2VNUD 1VLBA 3H0GB 2G9DA 1EM7A 1ZPSA 3HOXB 2INPE 3GTJB 4ODGA 1BMLC 4DGZA 2FHTA 3S1MB 3U2SC 1TJEA 4OVZA 1MPEA 5H92C 4XTCS 2NTSA 4ZUIA 3TN2A 5D14A 1B9MA 1LT4D 1HTLD 3P75A 3KK7A 4KGRA 1IYUA 1YMHE 1KTKA 2WV6D 3T51B 5EKLA 2RDGA 3OOCA 2WXRA 1STYA 1MI2A 1ZYRC 1SE2A 1BDOA 3I4NB 4E6IA 1C4PA 2K22A 2B2TC 4IKGA 5FK9C 3BDLA 3AM9A 1NR4A 1STHA 2M2LA 5BMHA 4ZHOA 3NTHA 4KGSA 3I4LA 1STEA 3CRLC 3U52E 5JVG3 2IPKD 1LTRD 3D6WA 3JAML 2PVGC 5EBDA 1FMAD 2JXTA 4AS1A 4KHVA 1FO4A 4IALA 1I6VC 2OF1A 2LFIA 1F2RI 1OQQA 2FBWB 2JA5B 3AE9B 4L2YA 1AYFA 4A3MB 1CHQD 1EY9A 4RCNA 5HFYA 4JWUC 1PRTD 1TYGB 4XWTA 3VA7A 1IW7C 1O7LA 3P1HA 4QMGA 3TEZA 4X3SA 2V3PA 2Z1CA 3VR8B 2F0PA 4RF1A 1HPCA 2SOBA 1UWXA 4P2CB 3WDNA 5HURA 3L4PA 2EY5A 1ML0D 4XYOA 3HOZB 4IFDJ 2DLBA 2W55A 2HDMA 3BK1A 4RAUC 3P4PB 4V190 5D7GA 2CW0C 2N0SB 4PQXA 3TDQA 3Q22A 2DBYA 4LLGM 1LACA 1R4PB 3NUHB 1B50A 4TMAB 3AMUA 3IAS1 2NB0A 3LXFA 2WAQB 2CVRA 4RGMA 3HZXA 2V4DA 2BTEA 3S2HB 2AQ3B 1K51A 2RDFA 1Q1BA 2W54A 4QF4A 1D5MC 3L7ZC 5C4HA 1WTPA 1OXUA 2V3NA 3C2PA 1Y8NB 1C48A 1OXTA 4YTNB 1PTOB 1SBBB 2EDGA 4M8AA 3RMHA 3QG1A 5DNFA 5GXGB 3LX0A 1CT1D 5G3LF 3Q0AA 1FXAA 1SMYC 1ZXIA 4UDUC 1CA5A 2RBMA 1E2VA 1PGXA 1I4RA 1WTVA 1E6EB 1QOAA 5K36H 4C7ZA 1DOXA 2IWHA 4IURA 1S5CD 4CJ1B 4RKBA 1N5XA 2IX1A 1L5PA 2EE1A 4A3GB 3DWQA 3W5UB 1P7EA 2RDHA 1QF6A 4N59A 2QSDA 1CI3M 3ZYYX 3B2GA 2A69D 1SSNA 3PMFA 2B63B 4FNFA 2R6GA 4RGNA 1WD0A 2W3RA 5FLXE 4M0WA 3SFDB 1TWAB 2BDOA 3VYSA 2WACA 3J81L 2PIAA 4X3KA 4YT0B 2L83A 4A6QA 4A3EB 4KKIA 1W6KA 5JPNC 5J1ZA 3MTSA 3E56A 3MP9A 3KWVA 1KF6B 4ZK9B 4TRDA 4X3UA 1IYVA 2FE8A 1V1OA 1EQVA 2K04A 1JOKA 4ZAIA 2Z4IA 2WB1B 4H0LC 1RDPD 3S16B 1SSOA 2KACA 3WOFA 5K36G 2K9XA 4LTUA 3I70A 3KBGA 4PT5A 1YN4A 1NUCA 1XO3A 4IOIE 2M00A 4B0MA 4PV1C 2N55A 1BOSA 4L6TB 1DYQA 1UAPA 3R2IA 3LWEA 4N9PA 2PQEA 5HI1A 1QNKA 3PV0A 5J22A 1GUWA 2QJLA 2EY6A 5KNDA 1HRJA 2LEKA 3MXUA 3HP3A 1TWCB 1KLUD 3NPPA 2QEJC 2WXJA 2F0FA 1XLQA 5JXVA 1PTOD 2GA4B 2E2HB 2HDLA 1W6JA 2KEEA 1P7FA 2B8GA 4HAEA 3QOLA 3DWAA 4XXEA 5C4XB 1B9NA 1H9RA 1FEHA 5KNBA 1KNEA 1DOMA 3M4YA 3S15B 5I9OA 2BB6A 3TZDA 4RH6A 3VQIA 2Q8IB 4V0BA 4ZYSA 1HFGA 4A9AA 3MJ5A 1SDFA 2EYJA 2A5HA 2RQXA 1LTGD 4KX6B 1V8QA 3IFTA 3EQLC 4KY7A 1A3UA 1Z7TA 2KQ4X 1PDQA 1G8ZD 4OHJA 2J42A 5NUCA 3I91A 1STAA 4IFDI 1T6BX 4LK0M 3TZUA 5M9OA 5TSSA 3P42A 3C8YA 4NKLA 4ZKBB 2I2YA 2KJXA 2VB3X 2CHBD 1ZEQX 3AE8B 1LTBD 2KCNA 3NWTA 1D1IA 2L4NA 2JSVX 4CKEA 5J39A 5C0XJ 1SNDA 3SK5A 3SEBA 1H9SA 2RPVA 4C2MB 3GTPB 2KA7A 3S1QB 1B2TA 1ZYRD 3EROA 5EPLA 3AE3B 2LHDA 3SDZA 5D3DA 3MFYA 1DOKA 1TVXA 2WXHA 1SYEA 5C0XH 2Y3AA 2SNSA 1GUTA 1PZJD 4TSSA 1J7BA 3MEHA 3I57A 1FXIA 4KY6A 4ILWA 1DGJA 3BYTB 1Z6HA 4YSYB 2QCPX 2ONQA 4OZAA 3W1SA 1VMCA 5M5XB 2L9HA 2ID0A 1FD6A 1JMLA 1SF0A 5CYUA 1SYCA 1FRRA 1Y1VB 1L6VA 2LMCA 3BVMA 1XF5L 3G6JB 2EYFA 3CQZB 2XRSD 4C3JG 4TQUS 4XDXA 1VR9A 1KRHA 3K59A 1HUMA 1Y8OB 4F88A 2L5TA 1GUNA 1IW7D 1C4AA 3J80E 1EYAA 1D2BA 2A73B 4L23A 5ELCA 2PVOD 4HJGE 4KJNA 1JE4A 1F9PA 3EJIA 3TP5A 2O4XA 1JWAD 2CQAA 4N6EB 1KFYB 1A2TA 2WP9B 3I90A 1JWSD 4J8QA 2X69A 1J7CA 1I7HA 5AUIA 2PCFB 3A8IE 3GTQB 3NQIA 5FKAC 3ZJVA 2YEPB 4RHSA 3K0YA 4GDLB 5KEEA 1TY2A 4ZLTF 1OXXK 2JEAI 2WU2B 4M1UB 2B2YC 4XQJA 3HOWB 2A6EC 3C46A 1C79A 2A6HC 2K01A 4OIJA 3BDCA 3U7ZA 2FFKB 1D4BA 5CBAE 1UWMA 1HXYD 2HDEA 1RTOA 1UGJA 2AQ2B 3ZGZA 3EFXD 2HCCA 1R9TB 1SYBA 2R3ZA 5JAVA 5CR3A 4TQ0A 3FEWX 1ENCA 5C3XA 1SMYD 1EYCA 2ZT9C 3IXSA 5EKIA 1HCZA 1I50B 2F3VA 1F9QA 2XSCA 1ILQA 2N9LA 1TIID 1HUNA 3DWMA 3S1RB 5ELBA 1EOTA 4K8JA 1IGDA 1ZUD2 2BW2A 3H91A 3ABVB 1UEAB 3NBHA 5AUKA 2WIIB 1ESRA 3K5LA 2A68C 2J7ZA 2FMCA 3RPFC 1EWHA 3NBIA 3CIRB 2EXZA 3BK2A 5BN4A 3IT6B 4REZA 1YJJA 5DM63 4IUTA 1DOIA 3PO0A 2B39A 1XTCD 2CU3A 2QMTA 2IDYA 4LAAA 5CV6A 2ICEC 3GO5A 5CC4A 4B9XA 5EQ0A 2BT6A 1TWFB 1MGSA 1VF5C 2YYZA 5I9PA 1MI0A 2I38A 3S9WA 5CV7A 4FO2A 1EU3A 5BN3A 3D3RA 4PMCA 2EKIA 3FC4A 2B8FA 1EY0A 4K2KA 3NVWA 1CK1A 1FM0D 1I3QB 2J0TD 3I8ZA 1LTSD 2EPBA 3NE5B 3ZJTA 1RF2D 1L4ZB 4BY7B 1Q3LA 2JP1A 1AP0A 4HCSA 5C0XI 5EE1A 4QUFA 1JWUD 1NAPA 3SR1A 4WRDA 1ZDVA 1JR0D 2K28A 2GB1A 5CV4A 3CRKC 5C3WA 2KVMA 3UI2A 5FR3A 5C5MA 4HEA1 3HOUB 4DAPA 5CORA 5BYRA 2TMPA 4NW2A 4F87A 1LTAD 2F0IA 1IBXB 2BYTA 3RLFA 4RF0A 4A55A 1BUIC 3HKZB 5IGGA 1MSGA 3F2UA 4A3IB 1VZ8A 4D2KA 2LHEA 3K5NA 4C80A 3J7AF 1NR2A 2K0PA 1S5BD 2F0NA 3OSOA 4DF7A 5IT9E 1QOHA 4QUCA 5MPOA 4ULLA 1DJRD 3FPPA 1L6UA 3Q23A 1KABA 2ENBA 2F0KA 2INNE 3AEGB 1B9RA 2WU5B 4FYDA 1NYQA 2EJGC 3RZOB 2MJDA 1LO5D 3BWUD 5CBEE 2M9VA 5I2YA 2NVXB 1CZWA 4A3JB 4EQNA 3VR2A 2K7VA 3OWFA 4HTHA 2ZW0A 3GTMB 1SNQA 1LV9A 4CGYB 1Q90A 2F0UA 1KDAA 1NSNS 3SFEB 4IUNA 1FD7D 3RZDB 2EYHA 2NVQB 1U4PA 1QJOA 2Q8TA 3AEAB 1S5FD 1QOGA 2QIEB 5E4XA 2RKSA 2NYZD 2EJMA 3RD4A 4ZHPA 2F0VA 4P6VF 3NRZA 4K5WA 4YIJA 3T13A 3DXJC 3H94A 3R2TA 2HTME 1BCPB 1F77A 2MP1A 1HZ5A 1I4HA 2D5DA 4C3HG 3NVZA 4A8XC 4YSXB 5C4ZA 3Q8EA 4DAVA 2PPBC 3P63A 2B2WA 5EE9A 5G5HA 2PZWA 1QILA 3M3YB 2F0EA 3PUXA 3KQ4A 1DD2A 1K50A 1YNJD 5AFWA 2WDRB 1RCVD 2E2JB 4OZBA 3W9CB 3B2FA 2F0GA 4LK1C 1JROA 1MSHA 4IN3A 3VR6A 4WH4A 2K1BA 5A2QE 3X3MA 5FO7B 1PLFA 4R8NA 3V2TA 2L1BA 2F0QA 2E3TA 2F0JA 2AX5A 2R92B 5C44B 1A3TA 4DXGA 1PYWD 3HVZA 3RFZB 2F0WA 1A2UA 2EYMA 4DA2A 4YTMB 1E7PB 4IUVA 1MVKA 1B3AA 4S3SA 1EQTA 4IFDH 4FXKC 2F0TA 3TBIB 2OEOA 1LTID 4A93B 3FVQA 1I4PA 2K5WA 1T5EA 4N9TA 1J8IA 1H9KA 5T1GA 4KD4A 1PXUA 5DAUA 4CHTB 1SJED 2D5GA 4H44C 1Y69U 1B53A 5C5LA 3GTLB 4FF3A 4ZOHC 2Y0SB 1QT9A 4WORA 5M3FB 2A6HD 3DWPA 1F2LA 5EJWA 4GZYC 2FUG1 1YNTE 2CJOA 1AW7A 3OIQA 4A3BB 2F0OA 1LTTD 5C2TB 2QDBA 2WXGA 4QB4A 3AEBB 1XLPA 3N9YC 1BNZA 4HRSA 1HQRD 2SNMA 1GB4A 3K6OA 1F2RC 4RGOS 1ZKOA 1QNUA 1F9SA 4B08A 2EY1A 4MM3B 1YNND 1JQYD 2IW3A 3DHQA 4OO1I 1C8CA 2EYLA 1U4MA 2O2LD 1AZPA 3E6ZX 4KHZA 1BCPD 4YSZB 4J6HA 5CV8A 4B9WA 4JX1C 1SXTA 1STGA 3R93A 1FCCC 1T3QA 4NAWB 1KH0A 4IFDG 1NYRA 1C4CA 1AZQA 2MHVA 5KIXA 3DM1A 2GRIA 2BE5C 4B0EA 5COYA 1ET6A 4MACA 5JOBA 5G5GA 3B9JA 1TKEA 1O78A 4FVMA 2PW9A 3N6RA 2OEDA 3HVDA 1ZDXA 2JEBI 1S5DD 2LY7A 1ACCA 2BBCA 4CKBA 2AQ1B 2WDVB 1RHPA 3AECB 4H7BA 4NDXA 1X3PA 3T3NA 5M5WB 4IDIA 3OW7A 4WIPA 1O7YA 1MD2D 4IUPA 2NBFA 4FXCA 2NMQA 4XDDA 3AN1A 4A3DB 1GOZA 1KDCA 2PLPA 1I4XA 3N52A 4XQNA 4CJ2C 5JPMC 3AEDB 2ZXRA 1SYFA 3BIID 4JWSC 2B2UA 2O5JC 3P4SB 1PGAA 2A74C 5IGBA 1STBA 3CU7A 3W3AA 1A3VA 1TY0A 1PTOH 3AB9A 3P20A 4Q2JA 4MT5A 4US9A 1J9OA 3TEYA 2WXMA 1EY5A 1CQFA 1HQMC 3MWYW 3MHBA 2ACZB 4F7XA 2EYOA 4XQQA 1ZXHA 1DXMA 4FXDA 1UUPA 5C3EB 4GDKB 5ELFA 3C3LA 4AYBB 3MZ5A 4LMQD 4C3IB 4K5VA 5CGKA 2JQRB 3EUB2 2F1MA 5D3IB 1FNUA 1WYGA 1BO0A 2Z8LA 4HCEA 2WXOA 3I4MB 1F2ZA 3PZ7A 3NZ3A 3H8HA 2X6LA 3KWLA 1KLGD 1G91A 3FAHA 4HN7A 1EZ6A 1Y8PB 2F03A 1A6XA 3LYYA 2MUYA 5C3JB 4R9WA 2H1EA 1M8AA 4DK0A 1HA5A 3Q6SA 2JZPA 1FFUA 3MVVA 3KF8A 3KBXA 4Q0FA 3IAYA 3HEJA 3ND8A 4C1NI 4H2AA 1AEXA 3NVVA 3GB1A 3H09A 1YN3A 3TP6A 4QIWB 1U4RA 1GJXA 2L32A 1EU4A 3ETRA 1C4QA 1D1KA 1K53A 2N7JA 3GV6A 3OMCA 5G3LD 3SHLA 1FGBD 4JK1C 5F2DA 1SAPA 1TS5A 4BY1B 1IBXA 3KUPA 4TKOB 3PUVA 4RHRA 5FO9B 5ELDA 3S1NB 3T3OA 1OO9B 4KKSA 1TU2B 3FILB 3GV3A 1PRTC 4MIUA 4RA8A 3IL8A 2KAJA 3TEWA 2XVSA 1E0BA 1QQRA 3G7LA 1E2WA 3V3XA 5E3FA 2JA7B 2F0HA 2KN4A 3Q8FA 3K5MA 2WXLA 1EWCA 3S14B 1GUSA 3SE0A 1B4OA 3GS2A 4ZRPA 2XIWA 4P16A 2R61A 1XWEA 1MHHE 2XRQD 2J53A 1WVLA 3DWGC 3J7YW 3LB8C 1SNOA 2AUKA 2CW0D 4ZKCB 1ENAA 4XT1B 1RODA 2PMZB 5C0XG 4ARIA 4XDCA 3OPOA 2Z4HA 3AE1B 4BBRB 2Q5WD 2EELA 4RCOA 4HR7B 2JA8B 5HG2A 5BMGA 1TS2A 1TKWB 1F9RA 3KLRA 5KNCA 2LUMA 3QO2A 1K83B 4I65A 4JE3B 3E5SA 2K3UA 4R8IA 2PNRC 2D62A 4RGTA 2K5QA 4K6DA 2D9UA 1TS4A 2QKIC 2E6XA 2IX0A 4DQOC 3Q8CA 2EOTA 3C1FA 1VZ6A 2K5PA 1PFNA 1O7ZA 4OIKA 2N88A 3PIP3 3AH7A 5A2QL 4WAFA 4F8MA 1EY6A 2EVBA 4X3TA 3NHHA 2OHFA 1B1ZA 2DNCA 2H88B 4FF1A 4HMIA 4ZUJA 1KAAA 2KMMA 2XNAC 2PYKA 2JYEA 5CV9A 2CJNA 3URYA 1VF7A 3VR4A 3M7NA 5H8YE 3R3OA 4A90A 4EQPA 2RSNA 3MAQA 2E2IB 1PRTF 2A69C 4OGQC 3H3VC 1IKLA 1WWTA 3IT4B 1SYDA 1E2ZA 2KHSA 5BYSA 2V0GA 2NN6H 1RWSA 3BVZA 5M3MB 1DOLA 2B2VA 3I9V1 1QKZA 1SB3C 3M4OB 2KEDA 3L9AX 2HUGA 3U9SA 2ON8A 1E9MA 2ICIA 2ZXPA 3HRDD 4HROA 3QB3A 2PTLA 3BVGA 1DONA 1XCTL 3HRZC 1EEID 5EPKA 5I6YA 4KI0A 1V97A 4K6LA 1H9JA 1D6EC 2BDNA 1JC7A 2SAKA 4WJWA 2WQYB 2RMMA 2WXQA 2NWGA 2M19A 2BOSA 4PNYA 3OMGA 1GHJA 1II3A 4ABNA 4N58A 2QILA 5EE0A 5IIFA 2L52A 3DEPA 2X38A 1SJHD 4EVOA 2L11A 5FLXL 1OQRA 1WTWA 1FYCA 1Y56A 2M56B 4EGVA 3WCQA 1F2YA 2K6AA 2LFNA 1XXGA 1RFKA 4G7OC 3S2DB 2NN6G 4NP5A 1NVID 5T8IA 1WSPA 3D4WA 4RFBA 2F3WA 4MH8A 4WQMA 4I7ZC 4DXFA 5KYLA 3IKJA 1PDXA 2F4IA 2WINB 2WNMA 2FINB 2IL8A 3AE4B 2KDMA 1HZ6A 3VRBB 4OO1H 3DMUA 4FP5D 4O42A 3I72A 3QJYA 3CWIA 3A7AB 5I6WA 3AU7A 4FXGC 4DFAA 4K8IA 1K8OA 1CZGA 1PMRA 2C9OA 4BA2I 1ET9A 4HSVA 3TSSA 5C6AA 2IGGA 2LMCB 2NVYB 2B2TA 2PO4A 3DEOA 2BS4B 2KWDA 3NQTA 2RVLA 2KECA 2MJ8A 4K14A 2NTTA 1VJKA 1PZKD 1CFMA 2W3SA 2WXPA 2JWUA 1L0XB 1KNAA 3OIPA 1ONLA 2VUMB 3PZ8A 2J4XA 1XYIA 3K5OA 3FDTA 4ZRQA 1SNMA 3ZQ4A 2PZUA 3VA5A 4WURA 2L55A 5D65A 4YWGG 3I3CA 4K5XA 1RJTA 1RD9D 1HTPA 2WXFA 1FR3A 4LJZC 1IGCA 1LLRD 3A7LA 2B76B 1QB5D 2F0LA 1F2MA 1OFFA 4TQ1A 3R8BA 4OO1G 1TKYA 4ID6A 1L0YB 4ARCA 3EVQA 1OXSC 2EJFC 1CZPA 2K32A 1RKNA 3PO2B 1PTOF 1X32A 1JQ4A 1JALA 1AFPA 1VZ7A 3BYYB 2Y5PA 1A15A 4KN4C 1Z47A 2NN6I 1TWGB 1EL0A 3MFGA 1HEZE 1VMPA 2E76C 5LL6X 2W82A 1N62A 3GQBA 4ITKA 2AWOA 3D4DA 4QCLA 1NENB 4KTAA 5LHY1 4HMJA 3K57A 1EWYC 3UI3A 2X6GA 1FRDA 1XCQL 2F0MA 2PW7A 4ZQ3A 3E0JA 1SFOB 3NS1A 2WS3B 2B2WC 1Q8IA 2ZXOA 4DK1A 3Q69A 2RA4A 5FO8B 3VR9B 4EE2A 2XWJB 3C1EA 2JYOA 3MHZA 1JORA 2NZ1D 1I6HB 1XLOA 3DUZA 2KCCA 3WOEA 4IUQA 3SVMA 2BCOA 3SR6A 1EEFD 3H6MA 3O13A 5EGTA 2DWQA 5ISRA 3P1MA 2PW5A 1QOFA 3KLSA 1IHZA 1UNSA 2A6ED 2K05A 3PO3B 4KY5A 4FF4A 2YU9B 3TP7A 5JEAJ 3AEFB 4WFN3 5FOBB 3NXWA 3P4QB 4A3KB 2DN8A 3NVYA 1QCBD 1E0ZA 1CM9A 3GTGB 2R93B 2EYPA 3J80L 1WTOA 1N60A 1SEBD 1U9RA 1EFID 3VYTA 3FILA 3HS0C 5JEAH 3J9CA 2BA1A 4IQZA 2OXPA 1SYGA 3M7GA 3MXGA 4KD3A 3Q24A 4KJOA 4OW0A 1A70A 5M5YB 4NMZA 3J7AV 1JW9D 3T53B 1JWMD 3NSWA 5EBCA 1C78A 1RM6C 2VZKB 2E74C 2J52A 2L12A 4KKJA 2H4OA 1Q10A 5IOCA 2A68D 3HOVB 5IGEA 2WKDA 1WTQA 1XLNA 4USAA 4KGTA 4C3JB 3FRPB 2D2CC 3NUCA 1CA6A 3FPUB 1ROEA 2R7ZB 1JRPA 2DY7A 1ESFA 4US8A 3NP8A 3T56B 1ILPA 1ICWA 1V1PB 3HG9A 4Z9CB 1VDZA 2PKOA 4BBSB 3TEXA 1JOOA 2WXIA 4G7ZC 2KUMA 1BUVT 3GTKB 3VR5A 3NTKA 3T4AC 3ONAB 1GUGA 1QLBB 2AUJD 3MC0B 3E9SA 1OXVA 3LNNA 3SK8A 5JEAG 4ME5A 3A8JE 3AE2B 3GP7A 3AMZA 4KKUA 1NCVA 4ZRZA 1GUOA 4HEDA 4UAIA 1X3QA 4J1MA 1TWHB 4KK7A 1SE3A 5EKKA 1E10A 5BMIA 1GB1A 4CJ0B 1PZID 4OZCA 1EIGA 3K7AB 4DNTB 2SEBD 3M85A 1PGBA 1AWDA 1XEEA 3FKIB 3A54A 5BN5A 3QIAA 3W2DA 1LABA 2LKVA 4NAMA 1YJIA 1T5XD 1TKGA 1D5ZC 2MJ3A 4U673 3BZDB 1VRAB 5KRUA 5BYQA 4MHEA 2B2UC 1IL8A 1EY4A 2IGDA 3A56A 4DAYA 4RNAA 4RWSC 4XYQA 1CQVA 2JXMB 1AN8A 2BA0A 2LS01 2IGHA 1M4VA 3JAME 1YQ3B 1IUEA 3TMEA 3EGRA 2XWBB 3OWEB 1G2TA 4C56C 1BR9A 1WRIA 3FMCA 2F0DA 4HKZE 2WLBA