5FK9C

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
216
Chain Sequence
LRKKSELQGTALGNLKQIYYYNEKAKTENKESHDHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5fk9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5fk9C01
1STEA 1CHQD 3W2DA 4RGNA 1PRTC 3BVZA 1FNUA 5ELEA 5ELFA 2J4XA 1ENFA 1CK1A 1JWSD 1SJED 1EU3A 1SJHD 3BZDB 3EFXD 3MC0B 1SE2A 1AN8A 5ELCA 1V1OA 5D3IB 1PTOH 1RF2D 1AW7A 1EU4A 2AQ3B 1HTLD 3GP7A 2Z8LA 3DWQA 1EWCA 4RGOS 1S5BD 1LT3D 4RCOA 3URYA 1PZJD 1I4QA 1FNVA 2ICIA 2XN9C 1LTRD 2IJ0A 2NTTA 3R8BA 1I4PA 5ELBA 1LTID 1LT5D 3BVMA 1TY2A 4L6TB 1YN3A 1HQRD 2CHBD 1JCKB 4OHJA 1DYQA 1EFID 3O13A 1D5MC 2TSSA 2XRQD 3OWEB 5FK9C 1PZKD 3TSSA 1LTTD 1LTSD 4ZYSA 1QILA 1JWUD 1JR0D 1M4VA 1S5FD 1TS3A 2QEJC 4RH6A 5FKAC 2R61A 3SEBA 1FNWA 1JWMD 1KLUD 1TS5A 3KLSX 1BCPF 2SEBD 1BCPB 2O2LD 1JQYD 1XTCD 4NZLB 3BYTB 1XXGA 2QILA 1CHPD 1LTBD 4UDUC 1ET9A 1EEFD 1SXTA 3R2TA 1SE4A 1B44D 3V05A 2AQ1B 1S5ED 2AQ2B 2RDGA 1LT6D 1D5ZC 1B1ZA 5D3DA 1PTOD 1CT1D 1T5XD 1FD7D 3EA6A 1GOZA 1LTGD 1PTOF 1L0XB 4Z9CB 1PTOB 3R2IA 5ELDA 1D5XC 1ESFA 3DWAA 1TS4A 1LO5D 1BCPD 4O1NA 4DXFA 1SE3A 2NTSA 5I4DA 1PYWD 4RFBA 3BVGA 1V1PB 4TSSA 1PRTD 1YN4A 1L0YB 1BXTA 1I4GA 1G8ZD 1PRTF 1PZID 1PRTB 1RCVD 4C56C 1CQVA 1D6EC 3BYYB 1TS2A 2XRSD 4RHSA 1F77A 3CHBD 1V1PA 1I4HA 1S5DD 1HA5A 1LT4D 2XNAC 1LTAD 1S5CD 2WV6D 1HXYD 1EEID 1I4RA 1MD2D 1YN5A 1FGBD 3DWPA 1SEBD 4DXGA 1TY0A 1KTKA 1RDPD 1PTOC 2RDHA 4L63B 1I4XA 2G9HD 4RHRA 4RGMA 1UNSA 1ET6A 4K6LA 4RGTA 1RD9D 1SBBB 2IPKD 1DJRD 3MFGA 5TSSA 1KLGD 1BCPC 1UUPA 1LLRD 4BWGB
chains in the Genus database with same CATH superfamily
1VRAB 4FXGC 3NPPA 3RNUA 3WCQA 1SNCA 3A56A 1VQKA 2LVPA 1DGSA 3KH0A 4ACFA 3GTGB 4GN5A 3EFXD 5LXIB 3U9SA 2D3AA 3NY5A 2BWFA 5ELNA 2LGYA 3RLOA 2D2CC 1V1OA 1Y8NB 3ZNZB 1MBYA 1EU4A 2VXWA 2AQ3B 4RAUC 1YNJC 4WJ4A 4HEA1 1EIFA 4PMCA 3HOVG 2REXA 1SYFA 3CC4A 3S1MB 2WU2B 3SU8X 2KOLA 2B2WC 1RIPA 1S5BD 1Z6HA 1K3RA 4PT5A 4PZ6A 4X3UA 2LUEA 1PZJD 1R7SA 3CCEA 3SR1A 2DZJA 2M0XA 2IJ0A 4G11A 1XLPA 5J17A 4YCWA 1J9OA 2OQ0A 2UU9Q 1QVCA 2LHEA 3TSSA 4DHZB 4HLEA 2C60A 4B95A 4BBRB 3AN1A 2KHSA 2MJ8A 1TWCB 4A3FB 4QAYA 4UPAA 1J7CA 2LVOA 1CZGA 3I4NG 2G4SA 2ZZPB 2AUJD 4KMUC 4N6EB 1Z47A 2ZJDA 2NZOA 1XMQQ 2VZKB 3C19A 1NMGA 1V80A 1EIHA 3ULPA 3APFA 3W1YA 1IYJB 4JW0A 4EKUA 2F3IA 2WWZA 2KJ6A 3TCAA 5KEEA 4FXKC 1J19A 2IO0B 1LABA 1OEYA 3H0GB 3TEHB 3L2PA 2LKVA 1YQBA 2Z0EB 4P16A 3KF6B 3QOLA 1WSPA 2B3AA 4PNYA 1VZ7A 2HJ8A 1VD2A 2IBIB 4NB3A 2AMCB 3HHMA 4WAFA 3SR6A 4C2MB 3I4NH 3NWSA 2BS3B 4FYDA 2LVQA 1KXLA 1MSGA 4IUPA 4HJAA 2ZXRA 1ESFA 3GV6A 4PMWA 3V96A 4YY3Q 5IWAQ 3X3MA 1N32L 1RL2A 2PQEA 5IE8A 5DLQE 1W6JA 4A3EB 4BBRG 3TDQA 1N33L 4FULA 5C4ZA 3RNCC 1SE3A 1KRSA 1SYDA 4A3FG 4BY7B 3ZNID 2D07B 4B3SQ 2JA6H 4TSSA 1X3GA 5CV6A 3T8MA 1C4QA 4JQWC 1GUOA 3TREA 3S1MH 1YD8U 2PE9A 1VQ7A 2BA0A 5HGQA 1SFOB 3NP8A 2MWSB 2QMTA 4DKAC 5M9OA 2N1WA 2CW0C 2PZUA 1GXDC 3H0GG 5JAVA 3Q0AA 2NZ1D 2IY1B 1V49A 4AUQC 1DXMA 2ZM6L 4CJ0B 5C0XH 3R7RA 1TWCH 1GPXA 4A3FH 2EYPA 4G7HC 1MI2A 2G5DA 3E0EA 3C8YA 1Q12A 4CDFC 2MRPA 1WJ6A 1FO4A 1KM7A 2DAFA 4ABNA 1DJRD 1E9MA 2K28A 2LXAA 1W3SA 2NVYB 4A3EG 2JA5B 3RLFA 4ZAIA 2HHHQ 4NJ7A 2K52A 4ZYNA 1EQVA 1E3PA 5JHBA 1H9RA 2LMCB 3ZRFA 3RFZB 1NY4A 1Q1EA 3H0GH 4BXXG 2IO2B 2WAQE 3KWVA 1P1AA 2IGGA 3BVZA 2B2VC 2DNCA 2O5JC 2KDFB 2IT1A 2F0HA 2A68C 1O7ZA 4JI1Q 1WGDA 1EYCA 2M17A 3L0WB 4B3RQ 2AX5A 2WAQB 1SNOA 2HIVA 3BZKA 2PZWA 1QZHA 1ZXTA 3LNNA 4IUNA 4C4VB 4LFBQ 3AU4A 1L0WA 2A73B 3M62B 2WDRB 5CX3A 4EVOA 2DN8A 3CKIB 5A2QE 2UUAQ 1E2VA 3A4RA 2JK8A 1EWCA 3ITPA 1SSNA 1EF5A 5EBDA 4HXDA 2C7MB 1D4BA 4RGOS 3G71A 1JWAD 1OXVA 2PYKA 4JE3B 2Y5PA 4S0RA 1WD0A 3KFUA 4YCVA 2MUYA 4GOPC 1OTCA 4BXXH 1UD7A 1XEEA 4J3OD 5I4DA 4JX1C 3J7ZC 2NVUI 5JEAJ 3HVZA 2GLSA 5DPWA 4RMFA 4JOIA 3PPAA 1HQRD 3A9KA 2A6HD 1J0GA 3I4MG 1VR9A 2I5LX 3EROA 4FBJB 1SFOH 4OO1H 1WFYA 2XRQD 2K5WA 1IKMA 2KOXA 4LNQA 1E24A 2JA5G 4ZKCB 4TMAB 2B39A 2IHEA 1I7HA 4KV2A 1G6ZA 2E8GA 2VZKD 2V1CC 1WTQA 1SE8A 5CBAE 1C7YA 1QQRA 2UUBL 3AE2B 2IO3B 1KJTA 1EUVB 4K0KQ 2LFNA 2HTME 2WAQG 5CMDA 4KGRA 1FCLA 3CMAA 3NEMA 2UU9L 1NVID 2YYZA 2L7RA 2PEAA 4XC2A 1K8RB 1HNZQ 4JI0L 3I4MH 2GMIC 2MP2B 3MTNB 2SNMA 4XDDA 3M4OH 1YBYA 2RD0A 2WS3B 4LFAL 3ZNGC 3KBGA 4NMZA 3UGBB 1VQNA 1WOCA 3DVGX 2CJNA 3J81c 2PI2E 2R3ZA 2CWAA 3KOJA 2E5LQ 4IWOA 4ZOHC 3DHIC 5DNFA 3STBC 2F0JA 1J5EL 2OTLA 3AXCA 3RZFA 3Q8AA 3KF6A 2DNEA 1BCPD 3BINA 2BKFA 2MJDA 3EGRA 3HOXG 3Q6BA 2Y0SB 1VZ6A 4P1BC 3I90A 4TKOB 4LF9L 2NN6I 3KQ4A 2MJ3A 2V4LA 2OF1A 4B0MA 5FR3A 4LF6Q 1E1OA 1OEYJ 1EUJA 1GUGA 4MGYE 2N8NA 1Y8RC 1QWYA 3PCOB 1D6EC 5J1ZA 2DHZA 2FUHB 4JYAQ 2VW9A 3J80c 1GB1A 3EVQA 3UDXA 2CFMA 5C4HA 3GTMB 3DUZA 2EIFA 4CO7A 3AE5B 3HOXH 5E6OA 1C76A 1PTOC 2G1EA 5CHFA 4L63B 1NENB 1N61A 3JAMi 4KX6B 3PLVA 4R4CA 4OIJA 3VYUA 2LFIA 4LF5L 1PQSA 1U5KA 1ZYRC 2WP8J 1KABA 2XTIA 4W9GA 4J15A 2L1AA 5JJLA 1F2ZA 1VQEA 1R4NI 4Q2JA 1QOFA 4GNXB 1LLRD 2K32A 2Y0SG 4KV6A 4JI6L 2KJXA 1SNDA 4YCUA 1E8ZA 1CHQD 1QT9A 4RGNA 4MH0E 1PRTC 1WGGA 4GDKA 4NJCA 2JF5A 4KJOA 4A3DH 4USAA 1I6VC 1VQDA 4NXNQ 3ZKJC 2RDFA 1IBLL 4K6DA 2QDLA 2N9KA 2CH4A 4OW0A 3UINB 1TIFA 5FO9B 2LMCA 2Q2TA 5IT9L 1MIUA 3GTJB 2ZW0A 4OVUA 4JBWA 1QG7A 1ZDVA 2SOBA 2D0OA 4F8CB 4R8IA 1ILPA 2PNHA 3UE0A 3TS0A 1F1HA 4LNIA 5G5GA 1LT3D 2H5XA 2CQAA 2CU1A 2W9NA 1VQ5A 1F2MA 2B2TA 1JJCB 1EZ6A 1HFNA 2KENA 4KKJA 1D5MC 4ME3A 1LTTD 2KUMA 3C3LA 3DHGC 4E74A 1PYSB 3HOWB 4JIOU 1SMXA 2QEJC 4ODGA 1XCQL 1XO3A 2K8BA 3CMMB 3GTMH 1EWIA 2R7ZB 3A33B 5E4XA 3PT2B 4N58A 5EJWA 2SDFA 1IUEA 2X6GA 1XF5L 3Q8FA 5FR6A 1G51A 4DK3C 4RF1A 5BR8L 1PH9A 3CQZB 4DN4M 5JPNC 3KWLA 1FXIA 1WTHA 3N1ZC 3Q6SA 5CBEE 1S72A 1TXYA 4JK1C 1XNQQ 3AMUA 3UQAA 3S14H 2B63B 1A8VA 3R2TA 2EJFC 2FMMA 5C3JB 2MBBB 2WX0A 4G4KA 5BMIA 1WR1A 1FD7D 3AE4B 2NZHA 4APVA 4Z9CB 3ALBA 1BBUA 1CFMA 1D5XC 2MP2A 1L1OB 3HOUH 2HE7A 2ENBA 3W5UB 2JEBI 4C00A 4MH8A 5AZFA 3KYHC 3QCAA 3RUIB 1QVFA 4XIGS 3SE0A 1NMFA 3GTJH 2CKZB 1JRPA 3HOWG 3PS6A 5C0XJ 2HJ1A 4GSWA 2ZVOA 5C4XH 1TR5A 1RHPA 3UI2A 1XPRA 2X8XX 1H9JA 2R7ZG 3WWVA 5K36G 2WYQA 1ISNA 1M8AA 4RMAA 1HA6A 2B2YC 2RQXA 2RKSA 2PI2A 3HM6X 3B6YA 3BU2A 1CQVA 1FYCA 2XGTA 3TEZA 4DUZQ 4KHPQ 4IFDG 3RULA 4US8A 1KAWA 2OJWA 2AHOB 1LTAD 2F0SA 3D4WA 2K22A 2SAKA 4A6QA 2WXQA 2PO4A 1C9OA 2CHXA 4NP5A 2WXMA 3PUXA 5IGFA 3HOWH 1K8OA 2KK8A 4X64Q 2BE5C 2WDTB 2YTYA 4DV6Q 2A6ED 2C9OA 5LMUL 4IW0A 2R7ZH 3GTQH 2PJHA 1NTGA 3TZDA 5K36H 1RD9D 4RWSC 3ERQA 3CCLA 5C3XA 2Z6BA 1K9MC 3AV8A 4KZCA 1KDBA 4X57B 4LJOB 2KMCA 5C23A 3CQZH 1UUPA 2F0MA 4UY8C 1N5WA 1HEZE 1BBXC 4IFDH 3U4VA 5DPRA 2QF7A 4BBNC 5NUCA 4CKBA 3W2DA 3R3OA 3FILA 1UAPA 2B2UC 3TN2A 3ULJA 1GUNA 4ARCA 1ENFA 3W5OA 5C6AA 2YTXA 3Q8DA 4A3BB 3A8JE 1Q82C 3K57A 1SE2A 4EX5A 1S3SG 2KNBA 3FAHA 4KLKA 3A55A 3BDLA 2YTVA 1R4QB 5BN4A 3AEFB 1JJGA 4O42A 2KO3A 3FKIB 1UELA 3T1YQ 3RZDB 1WI0A 1WX9A 3LYYA 1ZPSA 2EYMA 1WTWA 3M3YB 3A0JA 2IO1B 1ZXHA 3RD2A 3HK0A 3AEBB 1IL2A 2WHIA 1QZGA 3PHWB 5E4WC 4GOCA 1S4ZA 2JSVX 3VRBB 1NI2A 3NTKA 2DENB 1P16A 3L17A 3OW2A 2HQEA 4US9A 3CRKC 3HKZB 1Y69U 4HPMB 2NN6G 3I4OA 3U2SC 3VQIA 1QILA 2D0PA 3IBEA 1Y14B 5HHDG 4YSXB 4RKBA 3H9DA 5HY6A 5COYA 1GD7A 1X3FA 2K6AA 1S40A 4XQNA 3A4SC 3D6CA 3D4DA 4A3BG 3M7GA 2ON8A 4PYUA 3L3OC 1IBMQ 1H9KA 1STYA 1VMCA 2LUMA 1YHQA 2WXOA 1PUTA 2BPSA 4LFCQ 4HROA 4IWPA 2WP9B 4MSMB 4NZLB 1XXGA 4PZ7A 4C3HB 4QUFA 4X65Q 4XDCA 4QQBX 1B70B 4DV3L 1C4AA 2JA8G 3EECA 4POFA 2R2OA 5H92C 3SVMA 1SNMA 2NN6H 4R4QA 2RDGA 1UBIA 1LT6D 1KDAA 3FKIG 2KDIA 4K3BA 4L5RC 1SIFA 3STBD 1LM0A 2M1MA 1KFYB 1GOZA 1LTGD 5CV4A 1MI0A 2CJOA 2ZPNA 1EY9A 4HIOA 4PMBA 1YI2A 4JWSC 4A3BH 3M63B 4MGZE 1QNUA 5IO9A 1HZBA 3FPPA 2B76B 3HKZG 1DOIA 1IGCA 1R4MB 4EQPA 1BUIC 4IPCA 1WR6E 3Q3JA 4LNKA 3CPWA 1WTPA 5IIFA 2DAJA 3QK0A 4QJFA 2KFJA 2JA8H 1TWHB 1H9SB 1BUVT 3OHXC 5JVH3 3DBHI 2ZXPA 4DUYL 1BF4A 1T9HA 3U4EG 1L1OA 1PZID 1Y8PB 4OGQC 3FKIH 3DBRB 4P72A 4YHHQ 4N8FA 4PQXA 3UDGA 2C7NB 2KN5A 2KTFA 2N4FA 5ISRA 3M3YH 4C56C 3P63A 2BYTA 1GO3E 1TS2A 2KVZA 4H44C 4C3HG 3EBEA 4RHSA 4A3KH 1R9TB 3NZSA 1T5EA 1PVOA 3HP3A 4HJ7A 3N30A 3VXWA 3Q2AC 1IYUA 2EVBA 3IL8A 4JPSA 4DXAB 2QKIC 4DXGA 1QLBB 4EOYA 2D5GA 1YJNA 3KBXA 1J8IA 1ENCA 2L5TA 3J81L 3RT3B 4IJHA 4RGMA 4DR6L 1UNSA 4RGTA 2RBMA 4XDXA 5C5LA 4B3ML 1B9MA 4JBJA 1RFAA 4EE2A 1F9JA 4BFRA 1SRUA 1TT2A 1VDZA 4JBMA 1NBFC 4C3HH 3WAMA 5FO7B 3TP6A 1AARA 4BKSA 3G6JB 5J22A 4DV2L 2RDBC 2IGDA 4RG1A 1CKMA 1RTNA 3PMFA 1T0SC 2C5LC 4AQYL 3U58A 1AFPA 1HQMC 1E2ZA 3RMHA 1TWAB 3MP9A 1EU3A 3MC0B 4BY1B 2E2JB 3PO0A 4DDGD 1VQOA 2Q2UA 4K5WA 4A4IA 2EOTA 1M94A 4BAXA 3SHLA 3NENA 1H95A 2H88B 2OJRA 2K7VA 2B8FA 4K8IA 5M3MH 2UXDL 5C44B 3RNBC 2F1MA 3M3JA 1TWFB 1C79A 4CJ1B 3PZ8A 4HIMA 1I5FA 5KYLA 5BN5A 3J80E 2MPMA 1DOLA 1VZ8A 3VA7A 2XK5B 2G9DA 3ERSX 3AULA 1G291 3CAMA 3N32A 3DEPA 2IX1A 4M0WB 3O13A 1ONLA 3CF6E 2KJHB 5HI1A 4A8XC 4QL5A 3I57A 4GS3A 1R9TH 1TYGB 4BS9A 4WJNA 2QA4A 1GHKA 4KY5A 1C4PA 2DBYA 5C3EB 2Z6KC 4LF4Q 1M90C 1TZ1A 1EF1A 2L3ZA 1J8CA 3SEBA 1L2NA 4HCNB 1A3UA 4JWUC 4W9EA 3LB8C 2GBJA 3IT6B 4JGHB 1KLUD 2KAJA 2JXTA 2LXJA 1JRUA 1PDQA 4BY1G 4R1JA 3V60A 1JQ4A 5AZGA 2KECA 4U68A 4XGAB 3PLUA 5L95C 1TKEA 5JJZA 2K01A 3QQ8B 2JJQA 3H3VI 1WGHA 5C44G 2V3PA 2GBRA 3ND9A 5IY0A 3NBIA 1WRIA 1PFNA 4G0NB 4TQ0A 3DWGC 4KGTA 1EWYC 3OTOL 4WWMA 5IP7G 1STNA 2LXKA 1Q5WB 3EA6A 3FHWA 3H15A 1CUKA 2Z0DB 3CCQA 3ML9A 1L0XB 2PE6B 2A6HC 3D31A 1TWAH 3S9WA 4DV4L 4BY1H 1V6EA 2E2JH 2RR9A 2OOBB 1PGBA 1Q1BA 2E2HH 1PH8A 4B9XA 3JSVA 2LGXA 4ARIA 1MGSA 2JRIB 5C3EG 4RFBA 1WIAA 2HUGA 1OXXK 4TKNA 2IW3A 5C44H 1X6OA 3GV3A 1F52A 2KWCA 3HZXA 4HIDA 3PRPB 1N32Q 5GADC 3OIQA 2F0VA 1N33Q 2BOSA 5IP7H 1DOKA 3GTKB 4NQLB 2EY6A 2F0IA 2K04A 2L15A 2NVTB 2E3TA 3V2TA 1JOQA 2KKCA 1HA5A 4IFDJ 1C3TA 5A35A 2OCEA 3C46A 3HOYH 1YN5A 3TIXA 4GN3B 2EPBA 4NPSA 2OQKA 3PUZA 1RDPD 5E7NA 2PW5A 4NKLA 1QUQB 1NR2A 2G9HD 2EDGA 2QGQA 1AH9A 3QIJA 1TKGA 4GZYC 2PKOA 4DHJB 2M00A 3AB5A 3RLNA 2ZM6Q 4DV1L 1SGHA 1OTRB 1F9QA 1BCPC 5H1SE 1HE8A 3P4PB 4BWGB 4YWMA 5LL6X 4ZRZA 2KYWA 4NXML 2RSUA 4DK1A 3FEWX 3AYHB 1Q1OA 3W1SA 3P75A 1EY6A 2DZKA 1E7UA 3KUCB 4BA2I 4E6IA 2LHDA 2WLBA 4DFAA 4IOIE 3WOEA 5D6JB 2MO0A 1SB3C 1WI5A 2RPQA 3QX1A 1N62A 1IYVA 2B29A 1IL8A 3E6ZX 2BGFA 4D2KA 1YVCA 2RHSB 1YX5B 2PMZB 1X3QA 3ICEA 2V4IB 1CJEA 1VQIA 3LXFA 5L83A 2E2DC 4KY7A 5ELBA 2K1BA 3I2ZA 3S2HH 4FN2A 2N7JA 1JB3A 2JXXA 4F8MA 1RLFA 2JQOA 1GUWA 4MGKE 3GTKH 3I4NB 1MJCA 1F2RC 2W54A 2NVTH 4DR2L 3JVZX 4EZLA 3RNEC 3DOWA 1EM7A 1KRTA 3EIVA 2XK5A 1PXUA 3T1HL 1BKBA 3NHHA 4M0WA 4OELB 3KLSX 2YVCA 3QB3A 4DAYB 4FVMA 5CORA 2FIFA 3A9KB 2JA6B 5TR5A 2B2TC 4JI3L 2B8GA 3HUIA 5EKLA 1STAA 2L11A 3D0FA 3TZUA 2UUBQ 3S17H 3R66C 2Q8TA 1Q90A 5G2NA 1EYGA 1WXSA 5IOCA 1V5OA 1VCIA 2WQYB 2EKIA 3V05A 1B44D 4LF4L 2ZPYA 2XVSA 2N9XA 4FF3A 1T5XD 5J18A 4JI0Q 1I94L 2EXDA 3MC8A 4FHJA 4MZ9A 1YJWA 4PS3A 2CS4A 4WURA 1EOVA 1ZXIA 2EXZA 2A4ZA 1WH3A 3DWAA 4C3IB 1CKNB 2ASQA 1X3EA 5EQ0A 4LFAQ 2WDVB 3MJ5A 4RA8A 4KIKA 2FUG1 3Q8BA 2F0PA 4ZKBB 3ZTCA 1JT8A 4WH4A 1K8AC 1J5EQ 3K7UC 3AEEB 1I4GA 3NVZA 1CZPA 3MVVA 4DNRB 3K59A 1PH3A 1MFWA 1UGJA 4ZRIA 2JA6G 3V6CB 1E2WA 4DF7A 2D9UA 3NBHA 1Y56A 2J7QB 1X65A 4WAAA 2MP1A 5M5XB 2EE1A 3LX0A 3S1RB 4LF9Q 4DR4L 5BYSA 1VDVA 4AYBE 1WYGA 1OQRA 3D3RA 2HDMA 4M8NA 1LV9A 4HJGE 4XT1B 5HG2A 3KF8B 2L8JA 4HWIB 4PS8A 3DWPA 1SEBD 3A1QB 4NAMA 4J1MA 5HGTA 4AYBB 2WXGA 3DBLI 3ZJTA 3T56B 4NDXA 1L6UA 3RYTA 4DHJD 1EOTA 3P4SB 3HVDA 3CMEA 2WFWA 2K05A 1O7YA 5C0XG 3AMZA 4YSZB 3NELA 1RODA 4E3CA 4OZBA 3SK4A 4KDLB 2HDLA 4C3IG 1ZDXA 1IW7D 2UXBL 3FP9A 2JVCA 1QUQA 4I6NB 4LF5Q 3Q22A 3AQQA 2WXKA 4KZ0A 5CHWA 3MTSA 2IGHA 3NVYA 4A9AA 1SJED 1N34L 2Y5BB 4ZRPA 3Q14C 4ANUA 2VQEL 3VDYA 2FINB 3HRZC 3VYRA 2E74C 4JI6Q 5ELCA 2KMMA 3NJTA 1VQLA 2RPVA 1KHIA 3HS0C 1SYGA 1A6XA 2LEKA 2WB1E 4RM9A 2E76C 1FJGL 4C3IH 4TVAB 2YV5A 5FLXL 1TGZB 1IBLQ 4JI4L 2JUOA 1HZ5A 4OONA 5BMGA 3F2CA 3IFDA 4FADA 4GMVA 4GDKB 2IY0B 4KSKC 3SGIA 3I4MB 2QJLA 1U4LA 5IP4D 4AYBG 2N7DA 3AE9B 3AH7A 1N36L 2A6EC 1LTRD 1E6EB 2VRRB 4HPPA 2KBNA 3M4OB 3P20A 4ITKA 2CH4W 1D8LA 2BH8A 2WDQB 4P73A 1IBKL 2KQ7A 4GNXC 2LJ5A 3H3VH 3NVVA 3BK2A 2JA7G 1E7ZA 4OVVA 4EEWA 1UE1A 2RSOA 4ZYSA 5KNCA 5KYIA 3ZXRA 5M5XH 3S1RH 1JJ2A 1X1MA 2JN4A 4OO1G 1VMPA 3TUOA 1PV4A 4B0EA 1JE5A 1PA6A 1J6QA 3QO2A 2EY5A 4V0BA 2K25A 2QCZA 2KWVB 4IOCA 4FHKA 4WJPA 3ZXVA 1NEKB 2F3WA 1OXTA 2K4KA 2JE6I 1MHWC 4DR7L 4DK6C 1XTCD 4EUTA 1LYLA 3K5OA 1HUNA 1C8CA 4BA1I 1AE3A 1ML0D 2JA7H 1GC7A 1SIJA 4DAYA 5BR8Q 2Z4IA 1BDOA 2VUMG 2WB1G 3E9HA 1BMLC 2NR2A 3MAQA 1CT1D 2MBEA 4X3TA 5CGKA 2MHJA 4UHVA 3HOXB 2JYTA 4JI8L 2LD9A 5ELDA 3AE1B 3J9CA 1K3BC 3VTWA 1TKYA 1GKHA 5D14A 1IBXB 2PNRC 4ZUIA 4LW1A 1LO5D 2BS2B 3B1LX 1OFFA 3PGZA 3VR4A 4KKIA 1A15A 1WYDA 3IAS1 3S1QH 5AFWA 1O78A 2V4DA 1EIYB 1YJ1A 2CWPA 4A3CG 1DZ1A 1YN4A 1IGDA 4HCSA 4LUOA 5EGTA 2WKCA 2BYFA 2VUMH 1CKNA 5CV9A 2C9WB 2J7ZA 2WU5B 4WWPA 3KDFA 4A3DB 1C4CA 2K5DA 1WJJA 1OXSC 1I4HA 2LS01 2DY8A 2WXLA 3U9OA 3GS2A 4GN1A 3ONSA 1PH7A 5D94A 2VQFL 2GN5A 1VQBA 3B08A 3FC4A 3Q8CA 4A3CH 2WXHA 4F7XA 1GG3A 1ET6A 1BBWA 1UE6A 3HOZB 3S2AA 1SBBB 1DOXA 3KF8A 2ZEQA 5C3WA 3K5NA 1WTOA 1JE4A 4LF7L 2PTLA 1FRDA 3A1QA 2KZRA 4LLGM 4OZCA 1KNEA 5J2RA 5LMUQ 4K7SA 1B7YB 2IY5B 1KD1C 3I3TB 5H8YE 1SMYD 2NYZD 1B9NA 3F2BA 1XNRL 2KLCA 5ELFA 5G5HA 4ZQ3A 3F1ZA 1CK1A 3PO2H 5IGEA 1GAQB 1TJEA 4K5XA 3NZUA 2VH1A 3FRPB 3TP8A 4PV1C 3RNAC 5D3IB 5FLMG 4A3DG 2NUCA 3GOEA 4I7ZC 2JWUA 1LUZA 4GXBA 1UEBA 4G57A 4QGUA 1KL9A 2L55A 1FM0D 2Z1CA 4WJ3M 3QWZB 2L76A 3FILB 1JW9D 4OIKA 3CCSA 2JT4B 3ZJUA 1CTMA 2KTRB 4DPGA 3S14B 1B9RA 3Q3OC 4L5TA 4ZCKA 1I4PA 2UU7A 2XIWA 4B3TL 1TY2A 3HOZG 1YN3A 2CHBD 1JCKB 1WCMG 3DHQA 4TQ1A 4YTPB 4ANVA 1PH2A 5C1ZA 3A5ZB 1M1KC 4K3CA 1GVPA 3RN9C 3E5SA 4QUCA 1HPCA 1HUMA 5FLMH 3WAPA 4XT3B 1JWUD 3P4QB 2AWNA 1WZ0A 3HOUB 1S5FD 3T9LA 1CA6A 4L2YA 1FXAA 4M8MA 2RHQB 4XQQA 2ASBA 1WJ4A 4HMJA 4EQNA 2YU9B 3NZ3A 5C4XB 2F0KA 2O2LD 2CQOA 1WXQA 2NVQB 4KKTA 1NE3A 4HKQA 2NS5A 2V1YA 3HOZH 4A55A 1SNPA 2DNFA 2GOWA 3OIPA 1WCMH 5IT9E 2PZTA 1K73C 2N49A 3TEWA 2MEKA 1SXTA 4YWKA 3VH4B 3W9CB 3T3NA 2VNUD 2L1BA 5M5YB 5E6PA 3VYTA 2KQ3A 2L0TA 3KYCD 3DM3A 4IALA 4DV3Q 2Z59B 4ZRKA 4DV7L 1SNQA 2EQSA 1EO6A 2O6VB 2AYOB 4CBVA 1V86A 3K6OA 2K5NA 4DU9A 1QOHA 3KVFB 3UI3A 3GTQB 4B9KA 1OQQA 2OTJA 5DCNA 2FBWB 3KYDD 4ZHPA 3CSTA 3FMCA 2M0AA 2GVAA 1YNXA 3HOUG 4E71A 1EZ8A 1WGYA 4XYOA 1F2YA 3WALA 3KJPA 3X23A 2LRUA 2B2WA 5C4XG 2KD0A 4DBGA 4N9F4 3T51B 1H4RA 2MBHA 2XRSD 5CR3A 3AE3B 1IZ6A 1LM8B 4DUYQ 3DDCB 3KLSA 4FLHA 5GAHC 2XNAC 1B8AA 3AU7A 1EEID 1I4RA 2KT7A 4R8NA 1WJNA 2BA1A 4JPBW 3L13A 4XX5A 3QA8A 4BVUC 3E9IA 4Y7NH 3Q8EA 2BYVE 3CCVA 2Q2HA 2YU9H 1A2UA 3VHTC 4A3GG 1CMXB 2Q8RE 1FFVA 1Q86C 3L9AX 2EJMA 3T3OA 4OEMB 1R4PB 2NVQH 3AE6B 4KY6A 4ANXA 2JA9A 4EZKA 3Q3FA 2FJ2A 4DR6Q 1VQJA 1LACA 4B3MQ 4GDLA 2K0PA 4A90A 1N5XA 3I3CA 1T0QC 1SYCA 5M5YH 1N8RC 3V6EB 4GLXA 2FMCA 4LMQD 4C3JB 5IYDG 2WXNA 3NOBA 4WFN3 4R4IA 4DV2Q 1P3QU 2IYDB 2M56B 1ZP0B 4DR5L 1DOMA 4A75A 4A3GH 2W82A 5M5WB 4AQYQ 4J6HA 2HTHA 3NRZA 2IX0A 1SLJA 1XWEA 1SF0A 2A74C 3PIOA 1AE2A 4GKJL 3MEFA 3TS2A 3PVLA 4KHZA 3NK9A 2INCC 3U7ZA 2INPE 2HD3A 2UXDQ 5ELOA 1RTOA 1DYQA 2D5DA 3P7JA 2E75C 1N9WA 5IYDH 2FNJB 3DQVA 2JZ3B 1A3TA 2KTRA 1XD3B 3GO5A 3A9JA 3NHEB 4PS7A 4KI0A 3UDFA 3JAML 3C1FA 1XTDA 4DAMA 4LNNA 1WGKA 4JG2A 2JX5A 1I42A 3J80i 5KGUA 4AIMA 2OT2A 2JA8B 4X3KA 4C3JG 1V8CA 1SROA 2HCIA 4N8X1 4WORA 4FA6A 4PK1A 1U4PA 1PH1A 1EWHA 3CCUA 1A2TA 4IO9A 1R4NB 1Z9FA 1SSOA 3NXWA 4DR3L 1SE4A 3H09A 4A3KB 1UWMA 4PG3A 2K3UA 3CWIA 1D5ZC 3CCMA 2KX3A 1MKHA 1B1ZA 2K14A 2F0UA 3F8TA 1ZE3D 4HPLB 3N3KB 2D3GA 2KFKA 1NR4A 4LJPB 1OO9B 4KKSA 3N52A 2I46A 2B2VA 2RA4A 3CP0A 3EC8A 4ICUA 2D3BA 3SXHA 2H89B 3RPFC 4C3JH 1E8YA 1TS4A 4H7BA 1DONA 4UAIA 1JMLA 3OTOQ 2NPTA 4OZAA 2XSCA 4YTNB 4IM0A 2BKRB 1F2LA 5F2DA 1E0ZA 2DWQA 3MHBA 3G6EA 5M5WH 4MGIE 2Z0SA 1S3OA 4IZ8A 4DV4Q 2I1KA 2O6VA 3D32A 2O5IC 1ZKHA 4A3MH 5LMNW 4YWGG 1EQQA 5CYUA 3AM9A 1CKOA 2R2QA 3A8IE 1MG8A 4M02A 1VF5C 2MFIA 4HIKA 1BVSA 5GROA 3VR2A 2E2IB 3DMUA 5C5MA 4B08A 5LMNL 3L54A 3CHBD 1AZQA 4IN3A 2N0SB 4ICVA 2DZIA 3JSVB 1F9RA 4YWLA 2ZJRA 3IRBA 2GB1A 2W55A 4GLSC 1S5CD 4LF8L 4IUUA 1C9FA 2WKDA 5IAAC 4A3KG 2FXQA 4FF1A 2ALYB 3ZRCA 1TY0A 4DV5L 2DJGC 4XTCS 2A19A 5M3MB 3CPFA 1XMOL 2EY1A 1XJVA 1OQYA 3IAYA 4HK2A 3M95A 4W9JA 4Q0FA 4K6LA 5AZHA 3APCA 1TQOA 1B3QA 2EZVA 3OYYA 3ETRA 1YZ6A 1HZCA 1KLVA 1XLQA 3D4RA 1UGMA 2X69A 2FIDA 3F2DA 4JI5L 3HKSA 2KC1A 3IHPC 3NQTA 1BR9A 2EYLA 3IXSA 3U8ZA 3I5JC 4DQOC 2M19A 4P7IA 5FOBB 1ASZA 4XWWA 2IX3A 4DV1Q 2ZCCA 4M00A 5I6YA 3WIMA 4DNTB 4X62L 1K52A 1WM2A 1PFMA 2B3GA 1STHA 4W9DA 3PF4A 5E6NA 3AFQA 1CZWA 4NXMQ 4OWTB 1NYQA 4BKSD 5FLXc 2F0FA 4K8JA 2VY3A 2K5QA 3DLLA 1V5TA 4W9LA 2PPHA 2A1AA 4Y52H 5CC4A 2L4NA 4YIJA 1FXTB 2MX2A 4L1BA 3URYA 2D3CA 4II2B 5JVG3 1YJJA 4UP9A 2XN9C 5M3MG 1YIJA 3VH3B 5EKIA 3LDZE 2BDOA 2KHJA 1LTID 2ZJPA 4XYCA 3MZ5A 3J81E 3H1UA 3UIOB 3G48A 1T6BX 3ZO5B 4A3OA 1GUAB 2EYOA 2JQRB 1IW7C 1A70A 3A8KE 4MELA 4L5SA 2E2IH 1AWDA 1AYFA 4IUMB 2NBVB 1QB5D 4IPHA 2WGSA 1P7EA 2J0KA 1Z7TA 1BO0A 1XT9B 3GB1A 2BB6A 1QF6A 2E2HB 1NSNS 1GJZA 4AJWA 1TS5A 4MNOA 1Q7YC 2SEBD 1K50A 1ZW7A 4DR2Q 3NG0A 3VR6A 1Q46A 1NDDA 2WACA 4LDTB 3BYTB 4FP5D 5EPLA 1K28A 3E0JA 3T1HQ 2KQ4X 1CHPD 1LTBD 3ND8A 1HNWL 2J53A 1X3PA 3JC66 4KN7C 1EEFD 2KLGA 5IOIA 3HFZB 2SNSA 3K8AA 2UUCL 1FEHA 3R7QA 1XLNA 3ZNHB 1LGRA 3T13A 3HRDD 4JCVE 4JI3Q 3ONAB 3RR5A 2KXJA 4DDID 5D3DA 1O7IA 1UBQA 3BG3A 2AWOA 2BW2A 4X6AH 2L00B 2KANA 4WQMA 3W5VB 4HSPA 3HOYB 1II3A 3K0YA 3PIP3 1K83B 2N55A 1PMRA 2QDBA 1XX8A 4IUQA 3K7AB 5IGCA 4IKGA 1MVKA 2FCMA 2FHTA 4JI2L 4TQUS 3BK1A 4HN7A 4KSLC 2JPHA 5IP9G 2K5VA 4DXFA 3O65B 4I6LB 4YL8A 1I94Q 2M4NA 2G45B 4FJVB 3IKJA 2KCMA 3BZCA 1GM5A 2AL3A 3QAQA 3ZQ4A 3ZGZA 2HCCA 5M3FB 3N1YC 3BVGA 1AEXA 3L08A 4JOIC 3VTUA 2DLBA 4B6WA 2J0JA 2VH2A 2K5HA 2PCFB 2EYHA 1A63A 3QJZA 4CJ2C 2A69C 5JJKA 1HHVA 2F3VA 1MJDA 1PYBA 3BYYB 3K9PB 3PZDA 1YQ3B 4WIPA 3FKYA 3NS8A 4RF0A 5DEHA 3V62A 2MSED 4WQOB 1DM0B 3R3MA 4QIWE 4KIKB 2MQHA 3PQIA 2K5PA 2CU3A 5CV5A 1HFGA 2W3SA 1K8GA 2IL8A 4W9CA 3SHQA 3VAWA 2KX0A 1MD2D 4K2KA 1EY7A 5IP9H 1G6JA 2R7DA 4QIWB 3S15B 3CSFA 2F0WA 1HR0W 3TQYA 4DR4Q 3UE1A 4AP4C 2N9EB 1EQTA 3HOYG 2EYFA 3M4PA 3NBHB 2F03A 1HR0L 3TMEA 2H1EA 1C1YB 1YX6B 2HDEA 3S2HB 4G50A 1KIXA 3HIZA 4HR7B 4YTMB 3AB9A 3KK7A 3UIPB 3SK6A 1TZOA 1MSHA 1KDCA 5M3FG 4HJ5A 2DYMA 4W9KA 4AS1A 5IA7A 3BJUA 1EQRA 3FVQA 1E90A 2UXBQ 4GLAC 1L0VB 1P7FA 3PO3B 4HCPB 3T4AC 4NJ6A 4V190 3ML8A 1K83H 2W3RA 4EZJA 3RNFC 4ZRJA 2KEEA 2WX1A 4M01A 3K7AH 2GBMA 4AWJA 4C7YA 1HTLD 1FPYA 4FJYA 1IP9A 2C35B 4BOZB 4IM3A 3PUVA 4AH6A 1C0AA 1N34Q 4DWFA 4S3SA 3RUZA 1S1QB 2VQEQ 4HDQA 3S17B 1DD2A 2BS4B 2K03A 4HSVA 5M3FH 4IC7B 4OX9L 2NTTA 3J7AV 1TBEA 2FCSA 4L6TB 1HNXL 3BVMA 3DBHB 1FJGQ 3PRZA 5IODA 5BYQA 4JI4Q 1JORA 2RMMA 1EFID 4K14A 3WA0A 3J7AF 3OWEB 3NUCA 1PZKD 2B2YA 2O2VA 4ZHOA 1XPUA 3J7A5 4MM3B 4NQKE 1N36Q 5EAYA 4QCLA 5IYBH 4IPGA 3RN5A 5HURA 1SMYC 3OLMD 5I9PA 1IBKQ 1WMHB 1FNWA 1FRRA 2VL6A 3A7LA 3NE5B 3VUYA 3I9V1 1JICA 1WY8A 4DV0L 3S15H 1DCZA 1GC6A 4MJSA 1L2FA 3WOFA 3PV1A 3PO3G 1RFKA 3I7FA 3L7ZC 4ZK9B 1KF6B 1K51A 1JOOA 3AEAB 5I9OA 2KDMA 3HM3A 5G55A 1F2RI 1X54A 1UZXB 1HZ6A 1NYRA 2OEOA 2GBKA 3RCZA 3ABVB 2A5UA 3TBIB 4DR7Q 1S5ED 3DBSA 5LL6S 1QZEA 2DZMA 2QSDA 4JC0A 2H4OA 2V9HA 2CCZA 2I0QA 2F4IA 4ME5A 1E5WA 2FCNA 2INNE 2VS1A 2KC2A 3RD4A 3CRLC 1W2BA 4EFOA 3U50C 2ATWA 1Q8KA 1ZUD2 1VLBA 3BIID 3APDA 2MO1A 4R4OA 3PO3H 3KUDB 1NNXA 2YEPF 2MGSA 4CHTB 3QHTA 1GHJA 3DVGY 2YEPB 1NAPA 4JI8Q 2Z9HA 1UE7A 3WDNA 1WD1A 1L0YB 2AEHA 1WWTA 2F0DA 5AUIA 1YHBA 3QWNA 3QARA 1ZKOA 3AI5A 3BS1A 4IUVA 2ZTDA 5IKCM 1KC8C 1VQHA 1S5DD 4MIUA 2UXCL 3X3NA 4XXEA 3OJ3A 2ZTEA 1G2TA 2E6XA 5EE9A 2F4VL 3MEHA 3G7LA 1RJTA 1EFWA 1EY5A 4JV5L 3D8GA 2LGSA 4REZA 2GA4B 1TIID 2BVCA 1Z5SB 3WAOA 2ZNVB 1WFQA 2N88A 1B2TA 4FDBA 3TEYA 3KDFB 2QEXA 2F0OA 4QB4A 1YOVB 2WXIA 1SE9A 3ZYYX 1Y1WB 1RAXA 1TT5B 2VQFQ 1WZ3A 1LQBA 3KW5B 2YLMA 3RMKC 4DHZE 5EBCA 1ZEQX 3ZDTA 3LJ3A 5C4JH 1CA5A 4GKKL 3E56A 3U30A 3PSIA 1N6ZA 1WX8A 5T1IA 2JZPA 1WE6A 2OHFA 4I65A 4JI7L 4ULLA 1J7BA 3ZUNA 1XPOA 2GBNA 2L05A 4LF7Q 4ZDVA 4LJZC 1P9DU 3UF8A 1KRHA 1VF7A 1I50B 3I72A 3HOVH 2L83A 1UF0A 1LTLA 2LASA 1LXDA 4I6PA 1N63A 1XNRQ 1YNND 1L7YA 1HZAA 4MDKE 2QCPX 2N9PC 4DAVA 4HTHA 1F0ZA 1ENAA 4F88A 3H6NA 1VQCA 2UWQA 4LUVA 1QOGA 1VS0A 3NWTA 1HZ9A 2JA7B 2F52A 4IUTA 3T16A 2AL6A 4CYEA 3PREA 2EYJA 4P74A 4OHJA 3VR8B 3GZNI 1Y1WG 3AE7B 4G7ZC 3JAMc 5LLIA 3MXUA 1FD6A 3VR9B 4DA2A 3MFYA 5G3LF 4C7ZA 4B3TQ 3GTGH 1JR0D 2K9XA 4BKTA 2ZJQA 2DJFC 3AEGB 4ZLTF 2V3SA 1E22A 1IPGA 1JWMD 3NUHB 1BCPF 5DM73 2ZCBA 3ECIA 4GU2A 1VQ4A 2PW9A 5JXVA 3S1QB 1BCPB 3QG1A 2IDYA 2MBOA 4MM3A 5E6JA 2N3SA 4WJQA 3TL5A 2WXRA 2CHWA 5JZEB 3FDTA 1STGA 2VUMB 2DX5B 4JVZA 2WB1B 3PIO3 1EL0A 1WMHA 5AJ3Q 1WE7A 3KLRA 4H0LC 4DNIA 1Y1WH 1Q3LA 4A3LG 1D7QA 3S16B 4JLCA 3H7PA 1D2BA 5FLXE 4LK0M 4XE0A 1PGXA 1AP0A 3DEOA 2JP1A 1W6KA 4F1SA 4AJYB 3PIPA 1FVIA 4BBRH 2KHIA 5LNK1 2BTEA 1X56A 3R2IA 3VTVA 3U52E 1FL0A 4GGQA 5EKKA 3ZIMA 3NQIA 1IHZA 2V3NA 1I50H 4FJZA 5IYCG 2I1JA 1JALA 2A69D 4DV7Q 1V1PB 3VRAB 1T0YA 4A3LH 5GXGB 2FE8A 2MBQA 1H9MA 3WANA 3S1NB 1I35A 3BY4B 1HCZA 3I73A 3KUZA 4DR1L 1IYFA 4XYQA 4BY7G 1UWXA 1NCVA 3IG3A 1RCVD 1C48A 1EYDA 1TWGB 4L8JA 3CCRA 2LZ6A 2PLPA 2JZZA 2M9VA 3SD5A 2FAZA 5JJIA 5A2QL 1I3QB 2KACA 1F77A 3OMCA 3PO2B 3CCJA 4X66L 1I6HB 2CKHB 3MHSD 4ILWA 2WV6D 4C2MH 1VQFA 1FGBD 5IYCH 4FF2A 3TBLD 1BQQT 1YNTE 1STBA 2KCNA 1D1KA 1PFBA 4A76A 2Z6KA 4RHRA 3CC7A 4A3EH 2NVXB 4RNAA 4IOAA 1F9PA 4IFDI 3SK5A 4ZUJA 4BY7H 3H91A 5J39A 2CHZA 2RVLA 1Y1VB 5KIXA 4OWXB 1KLGD 2RCFA 4A3JB 2RGFA 3N20C 4DK5A 4MEMA 4N59A 5KHOA 2D62A 1SDFA 3EQLC 1YIWA 3EN2A 1QNKA 2L0FA 3VUXA 2JEAI 5IGDA 3S16H 1YJ9A 4HRSA 1VQGA 2N9LA 3LWUA 2KVMA 4X3SA 3TJPA 1QCBD 3I91A 1NJIC 1CSPA 3AEDB 3ER0A 2JXMB 3A5UA 1B50A 2KVRA 2PVGC 4MTNA 3PO2G 1U9RA 3Q3MC 1P0RA 4NY0A 3KJOA 1L1OC 4GDLB 4WJOA 3PV0A 5HKHA 1PLFA 2KCTA 4KK7A 1K0SA 1X32A 1WCMB 2MJEA 4HVBA 4DR5Q 4P6VF 1E0BA 1I4QA 2WINB 2K1FA 2WXJA 2NVYH 2JA5H 2KA7A 2Q8IB 5CHVC 3S1NH 3GE3C 5GMVA 4GN4B 3M4YA 4C1NK 2BB5A 4IG7B 1CSQA 3I4LA 2TSSA 1A3VA 1E8WA 1TWGH 1Y1VG 5FK9C 4OXPA 4A3JG 1XMQL 5GAGC 4GKJQ 1QOBA 5D65A 3JW0X 5G3LD 5IGBA 3P2BA 1I3QH 1VQ8A 3CW2C 2JU6X 1GJXA 5CV8A 1TS3A 2A8VA 2Y0SE 3GTOB 1I6HH 3Q69A 2R61A 4AQ7A 5JHAA 2I07B 4TRDA 2F0QA 1V43A 2AKWB 4RCNA 3G4SA 3DBLB 1CQFA 2ONQA 5T1GA 3OMGA 4FXDA 3K5LA 4P1CC 2F0TA 3GD7A 1JQYD 2Z4HA 2NVXH 4JBKA 2KN4A 1WYWB 3NS1A 4KKUA 3CXCA 2QILA 1ET9A 1IBXA 3W1GA 3A9JB 1Y1VH 4A3JH 3AE8B 1K8MA 3AFPA 4KJNA 4YY3L 5IWAL 3B9JA 2J0TD 1VQMA 4F7ZA 4K7UA 2KEDA 3GZNB 3U7DA 1FCCC 1MG4A 2WNMA 2R93B 1VQAA 5CTRC 3ZW3A 4B3SL 1Q81C 4IPDA 4KD4A 1DGJA 1YJIA 1PH6A 4DR3Q 2GI9A 2P5ZX 1XQQA 3M9BA 2MCNB 5DPTA 4Y7NB 1FIQA 3MJWA 3X0WA 5AUKA 5AJ3L 1FFUA 4LNOA 2M8SA 1PYWD 4XWTA 2K6DB 3DPDA 4H02A 1PHJA 1JMCA 2K8HA 4P71A 4TUUA 3OOCA 2KFKB 1G8ZD 3QJYA 4URKA 1NUCA 4XQJA 2Q5WD 1EY0A 2Y3AA 1X55A 2CVRA 2J0MA 2NPTB 3L0OA 2MA9B 2GVBA 1V1PA 3VR5A 3NSWA 3ZLZA 1LT4D 1YNJD 2MLBA 1ROEA 1YITA 4C1NI 1JC7A 4KTAA 2IWHA 5L37A 5T8IA 3ZDMC 1ASYA 1V2YA 4A3GB 1YEZA 2MQJA 4YXDB 5LMNQ 2RDHA 2WIIB 2HHHL 3GTOH 2R93G 2KWDA 2M2LA 2HQLA 2VB2X 1OGWA 4GOPB 2PMVA 1V8QA 4LF8Q 2IPKD 3EFCA 2NCNA 3PHXB 3PZ7A 4O0AA 1OXUA 2ZTCA 4C4VA 2EJGC 4JI1L 5I2XA 3OPOA 4DV5Q 1C77A 2L0CA 1XMOQ 4B3RL 2JY6A 2ES2A 2NBWB 3PGEA 3GDEA 1C78A 1VCBA 1J7AA 1MPEA 2VB3X 4LFBL 3DXJC 5DM63 2UUAL 2JYOA 5JOBA 2KMAA 4YSYB 4JI5Q 3BZDB 3NTIA 1FMAD 1ESRA 4R4TA 1R4MI 4BKGA 2R93H 2X6LA 2N1VA 4BOSC 3AU5A 4LK1C 3TP5A 1RF2D 4LNFA 3GTPB 4A20A 1AW7A 1HH2P 4M8AA 3E3XA 4CDEC 3AECB 4F87A 2KDBA 5BO4B 4X62Q 3I56A 4TV3A 2ZVNA 4MSQB 3DBRI 1JB7A 4K7WA 1JROA 2BF8B 3IFWB 4AOFA 1F9SA 2KCCA 1FNVA 1FR3A 2ICIA 3EUB2 3P1MA 4B9WA 4NW2A 1ICWA 2C5CA 2LXCA 3L10B 4WWNA 3DCGA 1HTQA 3IT4B 5HFYA 2BWES 3CF5A 1E7PB 3I55A 1MHXA 4K0KL 4A3PA 3ZVVA 1QOAA 1K0RA 1RM6C 1M4VA 4II3B 3LWEA 3KLWA 3R93A 3GTLB 1HNZL 1EY4A 1AZPA 2KHWB 3F2UA 5E3FA 4IWQA 4K81A 1WTXA 5GQOA 1B3AA 2L12A 1ZOYB 3HEJA 3BWUD 5I6WA 4GB9A 1VJKA 2PQAB 1EY8A 3J81i 1CM9A 1D1IA 4A3MB 4GIVA 3TP7A 3PUYA 2CW0D 3DM1A 3W1SC 1N60A 1KOTA 2E5LL 4W9FA 5C2TB 1PH4A 5D7GA 2LSSA 2AQ2B 2NB0A 3C2PA 2JRHA 1QKZA 4CDCC 2J52A 2GRIA 3SFEB 4P75A 4NAWB 1HNWQ 1PTOF 2B63G 2V0GA 4HJ8A 1QJOA 2Q2IA 1PTOB 2UUCQ 3Q24A 4IQZA 4XZ4A 5BN3A 2R92B 4LF6L 4OVZA 3OSOA 2DYOA 2DYBA 2AUKA 4JL9A 3L16A 3GTPH 4KDIC 3K81C 4JYAL 1U0LA 3JAME 5KNBA 4PYZA 4K5VA 2TMPA 1PRTF 5IN7A 4JI2Q 1GB4A 2A68D 3W1BA 4EQOA 2WXFA 1PRTB 2K6QA 5AEKB 2VZAA 2B63H 1EYAA 1IKLA 5K5PA 4ANWA 1Y8OB 1WRDB 5MPOA 4A3MG 3TMPB 3T53B 3EJIA 3VR3A 3VUWA 2MH7A 3SDLC 3ZTDA 4DK0A 2O6VD 1RYJA 3A7AB 4GNXA 1HXYD 3HG9A 2D11A 3DVNU 3IVFA 1BT0A 4NPNA 2ZXOA 3OAWA 3RNGC 1E8XA 3S2DB 4CQNA 4QF4A 3DHHC 1ILQA 3PF5A 3Q3NC 1Q10A 3B2FA 3MWYW 2JYEA 1Z2MA 3GTLH 3QC8B 3RI7C 1WXAA 2AWTA 4M1UB 3OW7A 2F0LA 4HJ9A 3V3XA 2DUDA 3MFGA 1X9NA 2R92G 1U4AA 3B2GA 1WTRA 1NBWA 4NXNL 3HKZE 4P2CB 1HTPA 1JOKA 2Y5CA 3K9OB 2BYEA 3ZJVA 1STEA 4IJLA 1HR0Q 3TRZA 3AEVA 5EPJA 4GOPA 4MN3A 2ID0A 4H13C 1XCTL 1FNUA 5ELEA 2EMTA 1V9PA 4ZRQA 4LCDE 1JWSD 2L9HA 1SJHD 4O2DA 2HT1A 1ACCA 1ICFB 1U4MA 1K53A 3MXPA 1T3QA 4BBSB 2N78A 2F0GA 4HMIA 1PTOH 2RCNA 1KAAA 1PGAA 1LFDA 4LUZA 5EE0A 4L5QA 2R92H 2K75A 3DWQA 1KQSA 3H6MA 1UE5A 2G3QB 2K33A 2BH2A 5BYRA 5I2YA 3N9YC 1MHHE 4MHEA 2EMSA 2XEWA 3R8BA 2LRWA 2IZVB 3VDZA 2FCQA 2XWBB 1VQ9A 5LXHA 4U673 1WM3A 3RZWC 1TTNA 5BMHA 4KHVA 4OX9Q 1PFSA 1BOSA 1EIGA 3MXNB 1HNXQ 1IXRA 2R6GA 2G4DB 3EFUA 5FKAC 4WJWA 3SFDB 3JYUA 4C80A 5KHQA 1XNQL 3S2DH 4HCEA 3RN2A 1DOYA 1RKNA 4BBSG 4MT5A 3M7NA 2O2VB 1B53A 3VFKA 1YNNC 3RZDH 2PW7A 3CC2A 1GUSA 4UP7A 4DV0Q 4OWWB 2MW5A 3CIRB 2AQ1B 4R9WA 2LI5A 3A74A 4ALPA 3PSEB 1PTOD 2PQAA 1WXMA 1SR3A 2INDC 4MJSB 1WXVA 3PRMB 1A0IA 1P98A 1ZYRD 4ASWC 3N6RA 5EPKA 4DAPA 3K58A 3OJ4B 4BBSH 5DAUA 1L6VA 1WX7A 2MNAA 1V9JA 2NTSA 1E1TA 3S24A 4NAWA 4PZ8A 4CKEA 4LAAA 1KH0A 1SAPA 4BBNF 3L4PA 4DUZL 4KHPL 1GNUA 1PRTD 2BT6A 2D2QA 3OWFA 2PIAA 1A5RA 2QIEB 4HJKA 1WTVA 3GQBA 4DGZA 3C1EA 4X64L 3P4RB 4RM8A 1U4RA 4DV6L 4HAEA 2RF4A 4J8QA 2LWPA 4OL7A 2EELA 4FO2A 2XWJB 3QOJA 1MJEA 1VQ6A 2DGYA 3GE8C 1L5PA 4EGVA 1SYBA 3J80L 1WJUA 4W9IA 3KUPA 1PFDA 1G2SA 2OEDA 1I4XA 1FGUA 2K50A 5KNDA 2IHFA 3CD6A 1YMHE 2ACZB 2UXCQ 2C7HA 3DWMA 5JPMC 2BCOA 2BDNA 2KDEB 2I5HA 1UWVA 3K5MA 2F4VQ 4IM2A 1HJPA 4JV5Q 3HGBA 3K80C 2F0NA 3RZOB 1TWHH 3NVWA 4LTUA 4FF4A 1L4DB 3MXGA 3IFTA 4I7AA 2L52A 2QDFA 5IGGA 4Q5VA 2NBUA 5J3BA 3QR8A 1GUTA 1KNAA 3LGJA 4N9TA 5C0XI 2J4XA 4K1RB 2PPBC 2NWGA 5GAEC 1G6PA 1PH5A 4J6IA 4G7OC 3VA5A 2UYZB 1JWBD 1SYEA 1AN8A 4GKKQ 4KVGB 2ZW1A 4CDDC 3T1YL 2KJRA 4CGYB 1V81A 5KRUA 5FJ8G 4BZAA 1BNZA 4JI7Q 2HD5B 4G3XB 3GP7A 2Z8LA 4L23A 3K0XA 4A93B 1XYIA 5EDSA 3P42A 5JH5C 1A62A 2LJIA 3MHZA 1D3ZA 2ZNVC 4A3IB 2PVOD 4RCOA 2KWUB 1E10A 3H94A 2K39A 2J42A 5JEAG 3M4QA 3SDZA 1LT5D 4EQ5A 1G91A 4QMGA 5CV7A 1Q8IA 2BBCA 2EKEC 2KQSA 3U4ZA 1T0RC 3B0AA 2A5HA 1LTSD 4K2LA 4KN4C 1IBML 3H3VC 2JWZA 3EHVA 3TEXA 4CHKA 2DY7A 3CU7A 4LFCL 5FJ8H 4X65L 4RH6A 1VQPA 2CR5A 2K8CA 2JSOA 3ULLA 1O80A 2EY2A 2ICEC 3VVWB 5IYBG 4KD3A 1V1QA 5JEAH 4HEDA 1E7VA 1L4ZB 5LHY1 3IAM1 4H2AA 1WF9A 1TWFH 3MXNA 2LGIA 4HKZE 4UDUC 4OO1I 4WRDA 4IDIA 5DPSA 2R7FA 3RZOH 4A93G 1SN8A 3N1XC 2LY7A 4A3IG 5EE1A 1H9SA 2RSNA 3QIAA 5E1FA 2OWOA 1Q0WB 5EE3A 2BE5D 2ZT9C 3A54A 2FFKB 1RWSA 1TKWB 1TVXA 3C0RB 3UQBA 3PTFC 1WVLA 1WGRA 4N9PA 5C3EH 2I2YA 4MTKA 1H8CA 3MC9A 4CKCA 3VYSA 4O1NA 4YHHL 2QC8A 3I70A 3I8ZA 4QY7A 3E9SA 4LDTD 3H7PB 2QW7A 2HIXA 4FNFA 4IURA 2L32A 3W3AA 1QVGA 3FPUB 4A93H 2I38A 2NMQA 3H8HA 4RKLA 1YHAA 4YT0B 1BXTA 2F0EA 2X38A 1O7LA 5C4JB 3DVNV 2NBFA 4GLVB 4A3IH 1NI3A 2QHOA 4R3DA 3H7SA 1PDXA 1QE6A 2MHVA 1HRJA 4LWCA 4MACA 1YQ4B 1V97A 4FXCA 3UDIA 4S17A 4WWOA 2OXPA 5IT9c 1XLOA 4ID6A 3BDCA 3P1HA 4DR1Q 3V61A 4POGA 3PUWA 3ENEA 3HOVB 1B4OA 1ZGUB 2O4XA 2B2UA 3Q23A 3BDOA 3OG5A 5FO8B 2PMZE 1CI3M 1KTKA 1HTOA 1RRBA 4NNJB 5D2MB 2N7EA 3ZJYC 4W9HA 4X66Q 3I63C 2XBBC 1UEAB 4HDOA 1P8LA 2D10A 2BQQA 4UP8A 3SK8A 5TSSA 1TU2B 2I5MX 3J7YW 3M85A 3J81j 1UH6A 2WXPA 3D6WA 2LGDA 3NTHA 4KGSA 3MA2B
chains in the Genus database with same CATH topology
1VRAB 4FXGC 3NPPA 3WCQA 1SNCA 3A56A 3GTGB 3EFXD 3U9SA 2D2CC 1V1OA 1Y8NB 1MBYA 1EU4A 2VXWA 2AQ3B 4RAUC 1YNJC 4HEA1 4PMCA 1SYFA 3S1MB 2WU2B 2KOLA 2B2WC 1S5BD 1Z6HA 4PT5A 4X3UA 1PZJD 1R7SA 3SR1A 2IJ0A 1XLPA 1J9OA 2LHEA 3TSSA 4BBRB 3AN1A 2KHSA 2MJ8A 1TWCB 4A3FB 1J7CA 1CZGA 2AUJD 4KMUC 4N6EB 1Z47A 2VZKB 1EIHA 5KEEA 4FXKC 1LABA 3H0GB 2LKVA 4P16A 3QOLA 1WSPA 4PNYA 1VZ7A 3SR6A 4WAFA 4C2MB 3NWSA 2BS3B 4FYDA 1MSGA 4IUPA 2ZXRA 1ESFA 3GV6A 4PMWA 3V96A 1IBXB 3X3MA 2PQEA 4A3EB 1W6JA 3TDQA 5C4ZA 1SE3A 1SYDA 4BY7B 4TSSA 5CV6A 1C4QA 1GUOA 2BA0A 1SFOB 3NP8A 2QMTA 5M9OA 2CW0C 2PZUA 1GXDC 5JAVA 3Q0AA 2NZ1D 1DXMA 4CJ0B 5C0XH 1GPXA 2EYPA 4G7HC 1MI2A 3C8YA 1Q12A 1FO4A 4ABNA 1DJRD 1E9MA 2K28A 2NVYB 2JA5B 3RLFA 4ZAIA 1EQVA 1H9RA 2LMCB 3RFZB 1Q1EA 3KWVA 2IGGA 3BVZA 2B2VC 2DNCA 2O5JC 2IT1A 2F0HA 2A68C 1O7ZA 1EYCA 2AX5A 2WAQB 1SNOA 2PZWA 1ZXTA 3LNNA 4IUNA 2A73B 2WDRB 4EVOA 2DN8A 3CKIB 5A2QE 1E2VA 1EWCA 3ITPA 1SSNA 5EBDA 1D4BA 4RGOS 1JWAD 1OXVA 2PYKA 4JE3B 2Y5PA 1WD0A 2MUYA 4JX1C 1XEEA 4J3OD 5I4DA 5JEAJ 3HVZA 1HQRD 2A6HD 1VR9A 3EROA 4OO1H 2XRQD 2K5WA 1IKMA 4ZKCB 4TMAB 2B39A 1I7HA 1G6ZA 2VZKD 1WTQA 1QQRA 5CBAE 3AE2B 2LFNA 2HTME 5CMDA 4KGRA 1FCLA 1NVID 2YYZA 2SNMA 4XDDA 2WS3B 3KBGA 4NMZA 2CJNA 2R3ZA 4ZOHC 5DNFA 2F0JA 3Q8AA 2DNEA 1BCPD 2MJDA 3EGRA 2Y0SB 1VZ6A 3I90A 4TKOB 2NN6I 3KQ4A 2MJ3A 4B0MA 2OF1A 5FR3A 1GUGA 1QWYA 1D6EC 5J1ZA 1GB1A 3EVQA 5C4HA 3GTMB 3DUZA 3AE5B 1C76A 1PTOC 2G1EA 4L63B 1NENB 1N61A 4KX6B 2LFIA 4OIJA 3VYUA 1ZYRC 2WP8J 1KABA 2L1AA 1F2ZA 4Q2JA 1QOFA 1LLRD 2K32A 4KV6A 2KJXA 1SNDA 1QT9A 1CHQD 4RGNA 1PRTC 4NJCA 4KJOA 4USAA 1I6VC 2RDFA 4K6DA 2N9KA 4OW0A 5FO9B 2LMCA 5IT9L 3GTJB 2ZW0A 4JBWA 1QG7A 1ZDVA 2SOBA 4R8IA 1ILPA 5G5GA 1LT3D 2CQAA 1F2MA 2B2TA 1EZ6A 1HFNA 4KKJA 1D5MC 1LTTD 2KUMA 3C3LA 3HOWB 2QEJC 4ODGA 1XCQL 1XO3A 2R7ZB 4N58A 5E4XA 5EJWA 2SDFA 1IUEA 2X6GA 1XF5L 3Q8FA 4RF1A 3CQZB 4DN4M 5JPNC 3KWLA 1FXIA 3Q6SA 5CBEE 3AMUA 4JK1C 2B63B 3R2TA 2EJFC 2FMMA 4G4KA 5BMIA 1FD7D 3AE4B 4Z9CB 1CFMA 1D5XC 3W5UB 2ENBA 2JEBI 4MH8A 4XIGS 3SE0A 1JRPA 5C0XJ 1TR5A 1RHPA 3UI2A 1H9JA 5K36G 1M8AA 1HA6A 2B2YC 2RQXA 2RKSA 1CQVA 1FYCA 3TEZA 4US8A 4IFDG 2F0SA 1LTAD 3D4WA 2K22A 2SAKA 4A6QA 2WXQA 2PO4A 4NP5A 2WXMA 3PUXA 5IGFA 1K8OA 2BE5C 2A6ED 2C9OA 3TZDA 5K36H 1RD9D 4RWSC 3ERQA 5C3XA 3AV8A 1KDBA 1N5WA 1UUPA 2F0MA 1HEZE 1BBXC 4IFDH 2QF7A 5NUCA 4CKBA 3W2DA 3R3OA 3FILA 1UAPA 2B2UC 3TN2A 4ARCA 1GUNA 1ENFA 5C6AA 4A3BB 3A8JE 3K57A 1SE2A 3FAHA 3A55A 3BDLA 1R4QB 5BN4A 3AEFB 4O42A 3FKIB 3RZDB 3LYYA 1ZPSA 2EYMA 1WTWA 3M3YB 1ZXHA 3AEBB 5E4WC 1S4ZA 2JSVX 3VRBB 3NTKA 2HQEA 4US9A 3CRKC 3HKZB 1Y69U 3U2SC 2NN6G 3VQIA 1QILA 5HHDG 4YSXB 4RKBA 5COYA 2K6AA 4XQNA 3D6CA 3D4DA 3M7GA 2ON8A 3L3OC 1H9KA 1STYA 1VMCA 2LUMA 2WXOA 1PUTA 4HROA 4NZLB 2WP9B 1XXGA 4C3HB 4QUFA 4XDCA 1C4AA 5H92C 3SVMA 1SNMA 2NN6H 2RDGA 1LT6D 1KDAA 1KFYB 1GOZA 1LTGD 5CV4A 1MI0A 2CJOA 1EY9A 4JWSC 4PMBA 1QNUA 3FPPA 2B76B 1DOIA 1IGCA 4EQPA 1BUIC 1WTPA 5IIFA 1TWHB 1H9SB 1BUVT 3OHXC 5JVH3 2ZXPA 1BF4A 3U4EG 1PZID 1Y8PB 4OGQC 4PQXA 5ISRA 3P63A 4C56C 2BYTA 1TS2A 4H44C 4C3HG 1R9TB 4RHSA 1T5EA 3HP3A 1IYUA 2EVBA 3IL8A 4JPSA 2QKIC 4DXGA 1QLBB 2D5GA 3KBXA 1J8IA 1ENCA 2L5TA 3J81L 4RGMA 1UNSA 4RGTA 2RBMA 4XDXA 5C5LA 1B9MA 4EE2A 1TT2A 1VDZA 3TP6A 5FO7B 3G6JB 5J22A 2IGDA 1RTNA 3PMFA 1AFPA 1HQMC 1E2ZA 3RMHA 1TWAB 3MP9A 1EU3A 3MC0B 4BY1B 2E2JB 3PO0A 4K5WA 2EOTA 3SHLA 2H88B 2K7VA 2B8FA 4K8IA 5C44B 2F1MA 1TWFB 1C79A 4CJ1B 3PZ8A 5KYLA 5BN5A 3J80E 2MPMA 1DOLA 1VZ8A 3VA7A 2G9DA 1G291 3DEPA 2IX1A 3O13A 1ONLA 5HI1A 4A8XC 3I57A 1TYGB 4BS9A 1GHKA 4KY5A 1C4PA 2DBYA 5C3EB 3SEBA 1A3UA 4JWUC 3LB8C 3IT6B 1KLUD 2KAJA 2JXTA 1PDQA 1JQ4A 2KECA 4U68A 1TKEA 5JJZA 2K01A 2V3PA 3ND9A 3NBIA 1WRIA 1PFNA 4TQ0A 3DWGC 4KGTA 1EWYC 4WWMA 1STNA 3EA6A 1L0XB 2A6HC 3D31A 3S9WA 1PGBA 1Q1BA 4B9XA 4ARIA 1MGSA 4RFBA 2HUGA 1OXXK 2IW3A 3GV3A 3HZXA 3OIQA 2F0VA 2BOSA 1DOKA 3GTKB 2EY6A 2F0IA 2K04A 2NVTB 2E3TA 3V2TA 1JOQA 1HA5A 4IFDJ 5A35A 3C46A 1YN5A 2EPBA 3PUZA 1RDPD 2PW5A 4NKLA 1NR2A 2G9HD 2EDGA 1TKGA 4GZYC 2PKOA 2M00A 3AB5A 1F9QA 1BCPC 3P4PB 4BWGB 5LL6X 4ZRZA 4DK1A 3FEWX 3W1SA 3P75A 1EY6A 4BA2I 4E6IA 2LHDA 2WLBA 4DFAA 4IOIE 3WOEA 1SB3C 1N62A 1IYVA 1IL8A 3E6ZX 4D2KA 2PMZB 1X3QA 3LXFA 2V4IB 1CJEA 2E2DC 4KY7A 5ELBA 2K1BA 2N7JA 1JB3A 4F8MA 1GUWA 3I4NB 1F2RC 2W54A 1EM7A 1PXUA 3NHHA 4M0WA 3KLSX 3QB3A 4FVMA 5CORA 2JA6B 2B2TC 2B8GA 3HUIA 5EKLA 1STAA 2L11A 3TZUA 2Q8TA 1Q90A 5IOCA 2WQYB 1VCIA 2EKIA 3V05A 1B44D 2XVSA 4FF3A 1T5XD 4WURA 1ZXIA 2EXZA 3DWAA 4C3IB 5EQ0A 2WDVB 3MJ5A 4RA8A 2FUG1 3Q8BA 2F0PA 4ZKBB 4WH4A 3AEEB 3NVZA 1I4GA 1CZPA 3MVVA 4DNRB 3K59A 1UGJA 1E2WA 4DF7A 2D9UA 3NBHA 1Y56A 2MP1A 5M5XB 2EE1A 3LX0A 3S1RB 5BYSA 1VDVA 1WYGA 1OQRA 3D3RA 2HDMA 1LV9A 4HJGE 4XT1B 5HG2A 3DWPA 1SEBD 4NAMA 4J1MA 5HGTA 4AYBB 2WXGA 3ZJTA 3T56B 4NDXA 1L6UA 1EOTA 3P4SB 3HVDA 2K05A 1O7YA 5C0XG 3AMZA 4YSZB 1RODA 4OZBA 3SK4A 2HDLA 4C3IG 1ZDXA 1IW7D 3Q22A 2WXKA 3MTSA 2IGHA 3NVYA 4A9AA 1SJED 4ZRPA 2FINB 3HRZC 3VYRA 2E74C 5ELCA 2KMMA 2RPVA 2LEKA 3HS0C 1SYGA 1A6XA 2E76C 5BMGA 5FLXL 1HZ5A 3IFDA 4GDKB 3I4MB 2QJLA 1U4LA 3AE9B 3AH7A 2A6EC 1LTRD 1E6EB 3M4OB 4ITKA 3P20A 2WDQB 3NVVA 3BK2A 2RSOA 5KNCA 4ZYSA 5KYIA 4OO1G 1VMPA 3TUOA 4B0EA 3QO2A 2EY5A 4V0BA 1NEKB 2F3WA 1OXTA 2JE6I 1XTCD 3K5OA 1HUNA 1C8CA 4BA1I 1ML0D 1SIJA 4DAYA 2Z4IA 1BDOA 1BMLC 3MAQA 1CT1D 4X3TA 5CGKA 3HOXB 2JYTA 3AE1B 5ELDA 3J9CA 1TKYA 5D14A 2PNRC 4ZUIA 2BS2B 1LO5D 1OFFA 3VR4A 4KKIA 1A15A 3IAS1 5AFWA 1O78A 2V4DA 1DZ1A 1YN4A 1IGDA 4HCSA 5EGTA 2WKCA 5CV9A 2J7ZA 2WU5B 4A3DB 1C4CA 2K5DA 1OXSC 1I4HA 2LS01 2DY8A 2WXLA 3U9OA 3GS2A 3FC4A 3Q8CA 2WXHA 4F7XA 1ET6A 3HOZB 1DOXA 1SBBB 3KF8A 5C3WA 3K5NA 1WTOA 1JE4A 2PTLA 4LLGM 1FRDA 4OZCA 1KNEA 5H8YE 1SMYD 2NYZD 1B9NA 5ELFA 5G5HA 4ZQ3A 1CK1A 1GAQB 5IGEA 1TJEA 4K5XA 3FRPB 3TP8A 4PV1C 5D3IB 2NUCA 4I7ZC 2JWUA 4G57A 1FM0D 2L55A 2Z1CA 3FILB 1JW9D 4OIKA 3ZJUA 1CTMA 3S14B 1B9RA 1I4PA 2XIWA 1TY2A 1YN3A 2CHBD 1JCKB 3DHQA 4TQ1A 4YTPB 3E5SA 4QUCA 1HPCA 1HUMA 4XT3B 1JWUD 3P4QB 2AWNA 3HOUB 1S5FD 1CA6A 4L2YA 1FXAA 4XQQA 4HMJA 4EQNA 2YU9B 3NZ3A 5C4XB 2F0KA 2O2LD 1WXQA 2NVQB 4KKTA 4HKQA 4A55A 1SNPA 3OIPA 5IT9E 2PZTA 3TEWA 2MEKA 1SXTA 3W9CB 3T3NA 2VNUD 2L1BA 5M5YB 3VYTA 2KQ3A 4IALA 1SNQA 4CBVA 3K6OA 4DU9A 3UI3A 1QOHA 3GTQB 1OQQA 2FBWB 4ZHPA 3FMCA 2M0AA 1EZ8A 4XYOA 1F2YA 2B2WA 3T51B 2XRSD 5CR3A 3AE3B 3KLSA 2XNAC 3AU7A 1EEID 1I4RA 4R8NA 2BA1A 3Q8EA 1A2UA 2Q8RE 1FFVA 3L9AX 2EJMA 3T3OA 1R4PB 3AE6B 4KY6A 2FJ2A 1LACA 2K0PA 4A90A 1N5XA 3I3CA 1SYCA 2FMCA 4LMQD 4C3JB 2WXNA 4WFN3 2M56B 1ZP0B 1DOMA 2W82A 5M5WB 4J6HA 3NRZA 2IX0A 1XWEA 1SF0A 2A74C 4KHZA 3NK9A 3U7ZA 2INPE 1RTOA 1DYQA 2D5DA 3P7JA 2E75C 1A3TA 3GO5A 4KI0A 3JAML 3C1FA 1WGKA 2JX5A 5KGUA 2OT2A 2JA8B 4X3KA 4C3JG 1V8CA 2HCIA 4WORA 1U4PA 1EWHA 1A2TA 1SSOA 3NXWA 1SE4A 3H09A 4A3KB 1UWMA 2K3UA 3CWIA 1D5ZC 1B1ZA 2F0UA 1ZE3D 1NR4A 1OO9B 4KKSA 3N52A 2I46A 2B2VA 2RA4A 3RPFC 3SXHA 2H89B 1TS4A 4H7BA 1DONA 4UAIA 1JMLA 4OZAA 4YTNB 2XSCA 1E0ZA 1F2LA 5F2DA 2DWQA 3MHBA 4IZ8A 2O5IC 4YWGG 5CYUA 3AM9A 3A8IE 1VF5C 3VR2A 2E2IB 3DMUA 5C5MA 4B08A 3CHBD 1AZQA 4IN3A 2N0SB 1F9RA 2GB1A 2W55A 4GLSC 1S5CD 1C9FA 4IUUA 2WKDA 4FF1A 1TY0A 4XTCS 5M3MB 2EY1A 3IAYA 4Q0FA 4K6LA 1TQOA 2EZVA 3ETRA 1XLQA 3D4RA 2X69A 3IXSA 3NQTA 1BR9A 2EYLA 4DQOC 2M19A 5FOBB 4XWWA 2IX3A 5I6YA 4DNTB 1K52A 1PFMA 1STHA 1CZWA 1NYQA 2F0FA 4K8JA 2K5QA 5CC4A 2L4NA 4YIJA 4L1BA 3URYA 5JVG3 1YJJA 2XN9C 5EKIA 2BDOA 1LTID 3MZ5A 3J81E 1T6BX 2JQRB 2EYOA 1IW7C 1A70A 3A8KE 1AWDA 1AYFA 1QB5D 1P7EA 1Z7TA 1BO0A 3GB1A 2BB6A 1QF6A 2E2HB 1NSNS 1TS5A 2SEBD 1K50A 3VR6A 2WACA 3BYTB 4FP5D 5EPLA 3E0JA 2KQ4X 1CHPD 1LTBD 3ND8A 2J53A 1X3PA 4KN7C 1EEFD 2SNSA 1FEHA 1XLNA 3T13A 3HRDD 3ONAB 5D3DA 5C3JB 3BG3A 2AWOA 2BW2A 4WQMA 3W5VB 4HSPA 3HOYB 1II3A 3K0YA 3PIP3 1K83B 2N55A 1PMRA 2QDBA 1XX8A 4IUQA 3K7AB 5IGCA 4IKGA 1MVKA 2FHTA 3BK1A 4TQUS 4HN7A 4DXFA 3ZQ4A 3IKJA 3ZGZA 2HCCA 5M3FB 3BVGA 1AEXA 2DLBA 2PCFB 2EYHA 4CJ2C 2A69C 1HHVA 2F3VA 3BYYB 4WIPA 1YQ3B 4RF0A 5DEHA 1DM0B 2K5PA 2CU3A 5CV5A 1HFGA 2W3SA 2IL8A 1MD2D 4K2KA 1EY7A 4QIWB 3S15B 2F0WA 1EQTA 2EYFA 2F03A 3TMEA 2H1EA 2HDEA 3S2HB 4YTMB 4HR7B 3AB9A 3KK7A 3SK6A 1TZOA 1MSHA 1KDCA 4AS1A 2DYMA 3FVQA 1L0VB 1P7FA 3PO3B 3T4AC 4V190 2W3RA 2KEEA 4C7YA 1HTLD 3PUVA 4S3SA 3RUZA 3S17B 1DD2A 2BS4B 2K03A 4HSVA 2NTTA 3J7AV 4L6TB 5BYQA 3BVMA 5IODA 1JORA 2RMMA 1EFID 4K14A 3J7AF 3OWEB 3NUCA 1PZKD 2B2YA 4ZHOA 4MM3B 4QCLA 5HURA 1SMYC 5I9PA 1FNWA 1FRRA 3A7LA 3NE5B 3I9V1 1JICA 1DCZA 3WOFA 1RFKA 4ZK9B 3L7ZC 1KF6B 1K51A 1JOOA 3AEAB 5I9OA 2KDMA 1F2RI 1HZ6A 1NYRA 2OEOA 3ABVB 3TBIB 1S5ED 5LL6S 2QSDA 2H4OA 2INNE 2F4IA 4ME5A 3RD4A 3CRLC 1ZUD2 1VLBA 3BIID 2YEPF 2MGSA 4CHTB 1GHJA 2YEPB 1NAPA 1WD1A 3WDNA 1L0YB 1WWTA 2F0DA 5AUIA 3QWNA 1ZKOA 3BS1A 4IUVA 1S5DD 4MIUA 3X3NA 4XXEA 1G2TA 2E6XA 5EE9A 3MEHA 3G7LA 1RJTA 1EY5A 3D8GA 4REZA 2GA4B 1TIID 2N88A 1B2TA 3TEYA 2F0OA 4QB4A 2WXIA 3ZYYX 1Y1WB 5EBCA 1ZEQX 3E56A 1CA5A 2JZPA 5T1IA 2OHFA 4I65A 4ULLA 1J7BA 4LJZC 1KRHA 1VF7A 1I50B 3I72A 2L83A 1N63A 1YNND 2QCPX 4DAVA 4HTHA 1F0ZA 1ENAA 4F88A 1QOGA 3NWTA 2JA7B 4IUTA 3T16A 2EYJA 4OHJA 3VR8B 3AE7B 4G7ZC 3MXUA 1FD6A 3VR9B 4DA2A 3MFYA 5G3LF 4C7ZA 2K9XA 1JR0D 3AEGB 4ZLTF 1JWMD 3NUHB 1BCPF 5DM73 2PW9A 5JXVA 3S1QB 1BCPB 3QG1A 2IDYA 5E6JA 2WXRA 3FDTA 1STGA 2VUMB 2WB1B 3PIO3 1EL0A 3KLRA 4H0LC 1Q3LA 3S16B 1D2BA 5FLXE 4LK0M 4XE0A 1PGXA 1AP0A 3DEOA 2JP1A 1W6KA 5LNK1 2BTEA 3R2IA 3U52E 5EKKA 3NQIA 1IHZA 2V3NA 1JALA 2A69D 1V1PB 3VRAB 5GXGB 2FE8A 1H9MA 3S1NB 1HCZA 3I73A 4XYQA 1UWXA 1NCVA 1RCVD 1C48A 1EYDA 1TWGB 4L8JA 2PLPA 2M9VA 5A2QL 1I3QB 2KACA 1F77A 3OMCA 3PO2B 1I6HB 4ILWA 2WV6D 1FGBD 4FF2A 1BQQT 1YNTE 1STBA 2KCNA 1D1KA 1PFBA 4RHRA 2NVXB 4RNAA 1F9PA 4IFDI 3SK5A 4ZUJA 3H91A 5J39A 2RVLA 1Y1VB 5KIXA 4A3JB 1KLGD 4N59A 2D62A 1SDFA 3EQLC 1QNKA 2JEAI 5IGDA 4HRSA 2N9LA 3LWUA 2KVMA 4X3SA 1QCBD 3I91A 3AEDB 2JXMB 1B50A 2PVGC 1U9RA 4GDLB 3PV0A 1PLFA 2MJEA 4KK7A 1X32A 1WCMB 4P6VF 1E0BA 1I4QA 2WINB 2WXJA 2KA7A 2Q8IB 3M4YA 4C1NK 2BB5A 3I4LA 2TSSA 1A3VA 5FK9C 1QOBA 5D65A 5G3LD 5IGBA 2JU6X 1GJXA 5CV8A 1TS3A 3GTOB 3Q69A 2R61A 4AQ7A 2I07B 4TRDA 2F0QA 1V43A 4RCNA 1CQFA 2ONQA 5T1GA 3OMGA 4FXDA 3K5LA 2F0TA 3GD7A 1JQYD 2Z4HA 2KN4A 3NS1A 4KKUA 2QILA 1ET9A 1IBXA 3AE8B 1K8MA 4KJNA 3B9JA 2J0TD 2KEDA 1FCCC 2WNMA 2R93B 1DGJA 4KD4A 1YJIA 2GI9A 4Y7NB 1FIQA 5AUKA 1FFUA 1PYWD 4XWTA 3OOCA 1G8ZD 3QJYA 1NUCA 4XQJA 2Q5WD 1EY0A 2Y3AA 2CVRA 1V1PA 3VR5A 3NSWA 1LT4D 1YNJD 1ROEA 4C1NI 1JC7A 4KTAA 2IWHA 5T8IA 4A3GB 4YXDB 2RDHA 2WIIB 2KWDA 2M2LA 2VB2X 2PMVA 1V8QA 2IPKD 3PZ7A 1OXUA 2EJGC 5I2XA 1C77A 3OPOA 2L0CA 1C78A 1J7AA 1MPEA 2VB3X 3DXJC 5DM63 2JYOA 5JOBA 4YSYB 3BZDB 3NTIA 1FMAD 1ESRA 2X6LA 4LK1C 3TP5A 1RF2D 3GTPB 1AW7A 4M8AA 3AECB 4F87A 1JROA 1F9SA 2KCCA 1FNVA 1FR3A 2ICIA 3EUB2 3P1MA 4B9WA 4NW2A 1ICWA 2C5CA 3IT4B 5HFYA 1E7PB 1MHXA 1QOAA 1RM6C 1M4VA 3LWEA 3R93A 3GTLB 1EY4A 1AZPA 3F2UA 5E3FA 1WTXA 1B3AA 2L12A 1ZOYB 3HEJA 3BWUD 5I6WA 1VJKA 1EY8A 1CM9A 1D1IA 4A3MB 3TP7A 3PUYA 2CW0D 3DM1A 1N60A 5C2TB 5D7GA 2NB0A 2AQ2B 3C2PA 1QKZA 2J52A 2GRIA 3SFEB 4NAWB 1PTOF 2V0GA 1QJOA 1PTOB 3Q24A 4IQZA 5BN3A 2R92B 4OVZA 3OSOA 2DYOA 2AUKA 3JAME 5KNBA 1GB4A 4K5VA 2TMPA 1PRTF 2A68D 4EQOA 2WXFA 1PRTB 1EYAA 1IKLA 5K5PA 1Y8OB 5MPOA 3T53B 3EJIA 3VR3A 2MH7A 4DK0A 1RYJA 3A7AB 1HXYD 3HG9A 4CQNA 2ZXOA 3S2DB 4QF4A 1ILQA 1Q10A 3B2FA 3MWYW 2JYEA 4M1UB 3OW7A 2F0LA 3V3XA 3MFGA 3B2GA 1WTRA 4P2CB 1HTPA 1JOKA 2Y5CA 3ZJVA 1STEA 5EPJA 1XCTL 4MN3A 2ID0A 4H13C 1FNUA 5ELEA 4ZRQA 1JWSD 2L9HA 1SJHD 1ACCA 1U4MA 1K53A 3MXPA 1T3QA 4BBSB 2F0GA 4HMIA 1PTOH 1PGAA 1KAAA 5EE0A 3DWQA 3H6MA 2K33A 5BYRA 5I2YA 3N9YC 1MHHE 4MHEA 3R8BA 2XWBB 4U673 5BMHA 4KHVA 1BOSA 1EIGA 2R6GA 5FKAC 4WJWA 3SFDB 4C80A 4HCEA 1DOYA 1RKNA 4MT5A 3M7NA 1B53A 1YNNC 2PW7A 1GUSA 3CIRB 2AQ1B 4R9WA 1PTOD 1ZYRD 3N6RA 5EPKA 4DAPA 3K58A 5DAUA 1L6VA 2NTSA 4CKEA 4LAAA 1KH0A 1SAPA 3L4PA 2BT6A 1PRTD 3OWFA 2PIAA 2QIEB 1WTVA 3GQBA 4DGZA 3C1EA 3P4RB 1U4RA 4HAEA 4J8QA 4OL7A 2EELA 4FO2A 2XWJB 3QOJA 1L5PA 4EGVA 1SYBA 3J80L 3KUPA 1PFDA 1G2SA 2OEDA 1I4XA 5KNDA 1YMHE 2ACZB 3DWMA 5JPMC 2BCOA 2BDNA 3K5MA 3HGBA 2F0NA 3RZOB 3NVWA 4LTUA 4FF4A 1L4DB 3MXGA 3IFTA 2L52A 5IGGA 4Q5VA 1GUTA 1KNAA 4N9TA 5C0XI 2J4XA 2PPBC 2NWGA 4G7OC 3VA5A 1JWBD 1SYEA 1AN8A 2ZW1A 4CGYB 5KRUA 1BNZA 3GP7A 2Z8LA 4L23A 4A93B 1XYIA 3P42A 3MHZA 2LJIA 1E10A 4A3IB 2PVOD 4RCOA 3H94A 2J42A 5JEAG 3SDZA 1LT5D 1G91A 4QMGA 5CV7A 1Q8IA 2BBCA 2A5HA 1LTSD 4K2LA 4KN4C 3H3VC 3TEXA 2DY7A 3CU7A 4RH6A 2JSOA 1O80A 2EY2A 2ICEC 4KD3A 5JEAH 4HEDA 1L4ZB 5LHY1 3IAM1 4H2AA 3MXNA 2LGIA 4HKZE 4UDUC 4OO1I 4WRDA 4IDIA 2LY7A 5EE1A 1H9SA 2RSNA 3QIAA 5E1FA 5EE3A