5FK9C

Crystal structure of staphylococcal enterotoxin a f47a mutant in complex with a t cell receptor
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
216
Chain Sequence
LRKKSELQGTALGNLKQIYYYNEKAKTENKESHDHTILFKGFFTDHSWYNDLLVDFDSKDIVDKYKGKKVDLYGAYYGYQCAGPNKTACMYGGVTLHDNNRLTEEKKVPINLWLDGKQNTVPLETVKTNKKNVTVQELDLQARRYLQEKYNLYNSDVFDGKVQRGLIVFHTSTEPSVNYDLFGAQGQYSNTLLRIYRDNKTINSENMHIDIYLYTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN
publication title Two Common Structural Motifs for Tcr Recognition by Staphylococcal Enterotoxins
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 216
sequence length 222
ec nomenclature
pdb deposition date 2015-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5fk9C02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 5fk9C01
3CHBD 3EA6A 1RDPD 4K6LA 1I4RA 2XRSD 1JQYD 1KTKA 2R61A 1PZID 2RDHA 1EU3A 2QEJC 1TS5A 1SE4A 4DXFA 2Z8LA 2TSSA 1TS2A 2O2LD 1STEA 4DXGA 1DJRD 3BVZA 1B44D 2XRQD 1LT6D 4UDUC 2G9HD 1PZKD 2IPKD 5ELEA 1UUPA 1YN4A 4RHSA 1SE3A 1V1PA 4TSSA 1EFID 1SXTA 1SJED 2RDGA 1PYWD 1RCVD 3SEBA 1S5CD 1BXTA 3R2TA 2ICIA 1TS4A 2NTSA 1PTOH 1YN5A 1JWUD 1FNUA 1TY0A 4OHJA 1PRTF 2AQ2B 1JR0D 4BWGB 1D6EC 1LTID 1PRTD 1V1OA 3DWAA 4L63B 3W2DA 1HA5A 4RGTA 2J4XA 1BCPD 5ELBA 5TSSA 2SEBD 1KLUD 3BYYB 4RGOS 2XNAC 3DWQA 3KLSX 2AQ1B 4RHRA 1ET9A 1YN3A 4RFBA 1LT4D 3GP7A 1CHPD 1I4XA 4C56C 3EFXD 3BVMA 3TSSA 5D3IB 2NTTA 1HXYD 2CHBD 3OWEB 1PTOF 1EEID 1HQRD 1LT3D 1PTOD 3URYA 1LT5D 1RD9D 1I4GA 2QILA 1EWCA 1PRTC 4NZLB 1HTLD 1LTBD 1LTRD 3R8BA 4Z9CB 1FNVA 1CHQD 1F77A 4L6TB 1SJHD 3MFGA 1PRTB 5I4DA 1TS3A 1BCPF 1FGBD 1LTGD 5ELFA 5D3DA 1AW7A 4O1NA 1BCPB 1TY2A 1CK1A 1JWMD 1UNSA 3BZDB 3O13A 2IJ0A 1CQVA 1SEBD 1B1ZA 2AQ3B 3V05A 1L0YB 5FKAC 1ENFA 1MD2D 1S5DD 1S5BD 1T5XD 4ZYSA 1JWSD 1EEFD 1PTOC 4RCOA 1KLGD 1G8ZD 3R2IA 1RF2D 1V1PB 1GOZA 4RH6A 1D5MC 1LTAD 1D5ZC 1SE2A 1QILA 4RGMA 1PZJD 1EU4A 1SBBB 1I4PA 1FNWA 3BYTB 1LLRD 1PTOB 1ESFA 1LTSD 3BVGA 5FK9C 2WV6D 1FD7D 1BCPC 5ELCA 5ELDA 1XXGA 1DYQA 1D5XC 1L0XB 1ET6A 4RGNA 1AN8A 1S5FD 1JCKB 1XTCD 1CT1D 2XN9C 1I4HA 1LO5D 1I4QA 3DWPA 1LTTD 3MC0B 1S5ED 1M4VA
chains in the Genus database with same CATH superfamily
4F8MA 3TREA 3MXGA 5BR8L 1P7FA 3DQVA 2HQEA 3MEFA 2KMMA 1Q12A 3QX1A 3OSOA 3D6WA 4KMUC 4LCDE 1KHIA 4DXFA 3DBLI 2ZTCA 3I72A 3SK4A 4QIWB 4DGZA 2LASA 4E74A 1K8GA 1E2WA 2FMCA 3KF8B 3C1EA 3AE7B 3M63B 2ON8A 5G3LD 1XPRA 1WXQA 3HM3A 1HUMA 3ENEA 2A1AA 4A3KG 1WE6A 3O65B 1K3BC 1SJED 2DGYA 3J81E 1R4MI 3NZ3A 4DR4Q 4HKZE 2HD5B 4GN1A 1SYCA 4CDEC 3QG1A 4FXGC 4IUQA 2LZ6A 4TKNA 1CUKA 3D3RA 1HR0Q 4A3DH 5AZFA 2I1KA 3A8JE 3EN2A 1WOCA 1J7BA 2EE1A 2KWDA 3DWGC 1YN5A 3MEHA 1YI2A 1JWUD 1TBEA 3A4RA 1YVCA 2ALYB 3HKZE 3EBEA 2V1YA 4HN7A 3HOWG 3VYUA 2SEBD 1JORA 1QNUA 3DBRB 2F3VA 1UE7A 2FIFA 2WQYB 3P7JA 3UDGA 2UXBL 3ZDMC 1WR6E 5IGEA 4C56C 4ZKCB 3DLLA 3B2GA 2WU5B 4GSWA 5IYCG 1MVKA 1QT9A 2D07B 3JAMi 4C1NK 3ONAB 5FLMG 5C44H 2Z6KA 2R93G 1LQBA 4B3TQ 5LXHA 5AUKA 5CV9A 3SDLC 2X69A 2ZPYA 2GRIA 3QOJA 2CVRA 2C9WB 1WX8A 3K9OB 1U4MA 1WY8A 4JLCA 2K33A 1CKNB 2EDGA 2LGIA 3I90A 1MJCA 4JIOU 5I4DA 3AU7A 1Y1VB 3NELA 4OVZA 2D3CA 1TJEA 1PH7A 2IX0A 2IX3A 1HEZE 3J7AV 4BBNF 5JXVA 4ULLA 1F2YA 1EIFA 3K5MA 4DA2A 3PO3H 4CKEA 1KAAA 2RBMA 4PZ8A 5J39A 3K59A 2Z59B 1HNXL 5JJIA 2D9UA 1L4DB 3KWLA 1BO0A 2C35B 3ETRA 3A7AB 2UUAL 2OTJA 1PYBA 4FF3A 3UQBA 1S3OA 3I9V1 1JJ2A 1PGBA 2L1BA 3S14B 2XTIA 3ND9A 1GUGA 1MIUA 2EJGC 3JYUA 4LF8Q 3CCQA 3GOEA 4OELB 3TBIB 2BS3B 1CSPA 1A63A 1VJKA 4JW0A 2K3UA 5C4XH 3ULLA 4X3SA 1DGSA 1JC7A 3KOJA 4QUFA 4NPNA 3R7RA 4CO7A 1JCKB 3T1YL 2IX1A 4XXEA 3HZXA 1I4HA 2O5JC 4NAWA 1I4QA 2J42A 4N59A 2CWAA 1VF5C 4A3JH 2C7NB 3GE8C 1T3QA 3L10B 2PMZE 1AP0A 3CSTA 4OZCA 2MQJA 4LNIA 3PUWA 1C9FA 4MNOA 2R7FA 5D2MB 1WRDB 5M3MB 2HJ1A 2VH2A 3F8TA 2QEXA 1Y1VH 3PO0A 2EY6A 3ZUNA 2PQEA 1L7YA 1D1IA 1LT6D 2EOTA 4OWTB 2AYOB 2DZJA 3L13A 3QARA 5ELEA 3D0FA 1HZBA 2KVZA 4B0EA 2NYZD 2JYEA 2NUCA 4BOSC 4HKQA 3NHHA 4DR2Q 1LUZA 2W82A 3FILA 1VQ6A 4DR1Q 2RDFA 2M4NA 1SYFA 4XX5A 1QKZA 1QF6A 4FHJA 2NPTB 2VB3X 4DUZL 1TWAB 2L52A 5M9OA 3C3LA 3GTJH 1YJ9A 3K5NA 4XQNA 4YIJA 1D6EC 1AZPA 4YWKA 4QB4A 4QF4A 3I91A 2WHIA 3H1UA 4JOIA 4II2B 3Q69A 4DV6Q 2A68C 5G3LF 4DHJB 1KABA 3A8IE 3E6ZX 2HDEA 4ARIA 1I42A 2ZJRA 1HFGA 4PQXA 1ISNA 1S3SG 2K7VA 1WR1A 1TIID 3H94A 4GGQA 4J6IA 3TSSA 5DNFA 2L15A 2IY1B 3HM6X 4ID6A 2IL8A 4KY5A 1XMOL 5ISRA 2D5GA 4OIKA 3N52A 4M0WA 4ZAIA 1I4GA 4DR7Q 1WTXA 2VXWA 1VQHA 2PO4A 2B63B 5M3MH 3CC7A 5IOIA 5EE3A 1GNUA 2CQOA 4PMWA 1PH6A 2DENB 4K2KA 1BF4A 2N7JA 3T1HL 1QB5D 5J1ZA 1PRTB 4NAMA 4YSYB 3PUZA 3S15B 2ZM6Q 1HNWQ 2KVRA 3V3XA 1C3TA 1P98A 2RPQA 3BJUA 1OFFA 4X57B 3CD6A 2V3SA 3PRPB 4KV6A 4QUCA 3FP9A 2KHSA 3AFQA 1BDOA 3CMMB 4HWIB 3H7PA 4C3HH 2AKWB 3EQLC 1AE2A 2Z0DB 1ZEQX 1ZW7A 3ZNZB 3DWMA 1SE2A 4S17A 4WAAA 1EU4A 1U4RA 2K6DB 2K1BA 1V49A 3VFKA 2CH4W 3HOUB 1NR2A 3AEAB 5LMNL 2VUMH 3W5OA 2O2VB 1FD7D 1OGWA 1PFDA 1V6EA 2BE5C 2KFKB 2KEDA 5GAGC 1MHWC 4B9XA 3E9HA 3S1QH 3IRBA 2F0FA 1XJVA 1UEAB 4X65L 5MPOA 1EIYB 4A3IB 2AUJD 1IYUA 2OQ0A 3U9OA 1LO5D 1E90A 1M94A 2LJIA 2OOBB 4XDDA 1NBFC 4KHZA 1U5KA 4MGYE 3QB3A 2BGFA 4N58A 3SXHA 2HE7A 1JWBD 5C3XA 2B63H 4FLHA 4DQOC 1SNCA 4V190 1L2FA 3KFUA 2WP9B 3JSVA 2TSSA 1J7CA 2IBIB 4RF0A 2MP2B 1DM0B 3VYSA 4B95A 4DHJD 3S15H 1GHJA 3J7A5 3M4QA 2J0TD 4NJ6A 1N9WA 2GMIC 3KVFB 1CTMA 4IPHA 4MIUA 2ASBA 1YN4A 4JQWC 4CKBA 3TMEA 2BWES 2YEPB 2BTEA 2WWZA 1A5RA 2VZAA 1LV9A 2W55A 1ESRA 4A3EB 1HNZQ 2ICIA 3DHQA 3ALBA 4ZUJA 3K9PB 3HOUH 2K22A 1L0WA 1D7QA 1VQ8A 3VR4A 1PRTD 2MQHA 1ACCA 4BKSA 4LNKA 4FADA 1DOMA 1CZPA 2N7DA 1WJNA 4A90A 2N49A 1JW9D 4RGTA 1I50B 4A3BH 4LFBL 2L83A 3W9CB 5CR3A 3P1HA 5FJ8H 3RZOH 2CJNA 1H9SA 2A6ED 2H88B 2M56B 2V3PA 2XNAC 4LJPB 3ML8A 1YITA 1KQSA 2N7EA 2JJQA 2NVTB 3HEJA 4A3IH 1YN3A 3GV6A 1E3PA 3JAMc 2DUDA 5E7NA 2F1MA 4FXDA 1MHHE 3GTOB 2H5XA 4TQ1A 1KF6B 2JY6A 2F4IA 4ICUA 2N8NA 2KQ4X 3P42A 2FUG1 4FP5D 1Z47A 2B63G 2HT1A 1PTOF 1E22A 1OXUA 4AH6A 1SF0A 1WJUA 4NZLB 4I7AA 1MPEA 4LK1C 4KN4C 1LTBD 1RTNA 4NP5A 2F0IA 3I4MB 4IWOA 4HVBA 3VVWB 1F77A 5G2NA 3B9JA 1SRUA 5ELFA 3RNCC 2D3GA 1HZCA 3KLSA 3SK6A 1V9JA 3Q24A 1SSNA 5FO9B 1F9PA 1NUCA 1HZ6A 1GUAB 2RHSB 1SR3A 2PNHA 4LAAA 2QA4A 3GTMH 4FN2A 2MRPA 2W9NA 4XC2A 3RNEC 3GTKB 4IURA 1QOGA 1SEBD 4WJ4A 4DK5A 4A3EH 2MWSB 4LFCQ 2PYKA 4L5QA 5D14A 3SHQA 4YHHQ 1T0QC 3J7YW 2B2YA 3B08A 1A15A 3BDCA 5IP9G 4BAXA 1MBYA 2BA0A 2VNUD 4N6EB 4C80A 1EYAA 1I50H 1PYSB 1N63A 2DN8A 5IA7A 1KD1C 3JW0X 5IE8A 2EYLA 1EQRA 4AQYQ 3ZJUA 1IBKQ 2NVTH 3MXPA 5C4JB 3RN2A 3KYCD 1W6JA 4HXDA 3IFDA 4POFA 2I07B 1HR0W 1WX7A 4M8NA 4HIKA 3T53B 1WTQA 3GTOH 1SYDA 1QNKA 3KDFA 4DAYA 4LF8L 1QVFA 3K8AA 1MKHA 2PNRC 2WXRA 2K8HA 1GJZA 4IJLA 3CHBD 3CC4A 1TKGA 1BR9A 2F3WA 1SYGA 2IY5B 5HG2A 3NWTA 3QHTA 1HUNA 2PQAB 4JYAL 5CTRC 1CKMA 1X56A 2IGHA 2KDBA 3K5LA 2QCZA 4M8MA 2FINB 1KLVA 5C0XJ 1IGCA 1KC8C 1SFOB 2C60A 2CCZA 2A8VA 4QMGA 1L1OC 1E7PB 3U7DA 2CKHB 1OXTA 4HK2A 2K28A 2NVQB 3HKZB 3A56A 3STBD 4KGSA 4OZBA 3CRLC 1PFNA 3M4YA 2PCFB 3A4SC 1WX9A 5C6AA 5CX3A 4K6DA 1K73C 5EQ0A 2MEKA 1BXTA 3FPUB 1H8CA 2A69C 3VRAB 2C5LC 4DV0Q 1O7IA 3H7PB 5EE1A 1QVGA 1SMXA 4NB3A 5IGBA 4L8JA 3V61A 2AQ2B 4G7OC 2NS5A 4A3PA 4POGA 1SN8A 4RCNA 1F2RI 4MM3A 2UUCQ 5E6NA 3ZQ4A 1RM6C 3ERQA 1MG4A 2J4XA 4GDLA 2XK5B 3AE2B 4K5VA 3UGBB 2ENBA 1LACA 3SD5A 1GVPA 5C4JH 4OIJA 3Q2AC 1XEEA 3DVNU 1F9QA 3CCSA 2DYMA 4RWSC 1YHBA 1SMYC 1YNNC 1WTOA 2WXIA 4TQUS 2GVBA 2D62A 3IAS1 4IM0A 3S17H 4IUMB 2E2DC 4RMFA 3A0JA 4KJNA 3I4MG 4BZAA 2LY7A 3CCEA 1YQ3B 1Y14B 1LT5D 3MHZA 2NZHA 2DNEA 5D65A 1OQYA 4YWGG 4C3IB 4PYUA 1I7HA 4XYOA 2KDFB 3ND8A 4CJ1B 2Y5CA 5BMHA 5T1IA 1Q90A 5E4XA 4FXKC 1EIHA 2DZIA 4WWPA 3F2UA 4DR7L 3VTUA 1U0LA 4LF7L 1E24A 1UE5A 3JSVB 4M1UB 3CPWA 4NPSA 1JWMD 1XNQL 1YX5B 5E1FA 3DVNV 2KCTA 4R4TA 3N1ZC 1DOYA 4HSVA 5LL6S 2CU1A 1HFNA 4YSZB 3TS0A 1MD2D 3W5VB 1G8ZD 2A5HA 1SYEA 2ZJPA 2ZM6L 2YU9B 1U9RA 3H3VH 3TS2A 2R6GA 3A74A 3S1MB 1HNWL 3TCAA 3S2AA 1TTNA 4W9CA 1WI0A 3KF8A 1LLRD 1O78A 3HK0A 3TMPB 2NZ1D 2E5LQ 2HD3A 5FK9C 3NOBA 3TBLD 3I3TB 3ULPA 1R4NB 2NWGA 1DD2A 2FE8A 3H09A 3OJ3A 4IFDJ 2JYOA 5LL6X 2N9EB 4MHEA 1EY0A 2IT1A 5C0XI 3HVZA 3RNFC 1HTQA 4LJZC 2IHEA 2LGYA 1HJPA 2B2WC 4JWUC 2WS3B 5CV6A 3RR5A 1VQKA 4KIKB 3R3OA 3CWIA 4K1RB 4HR7B 4KZCA 1OO9B 3FEWX 3UQAA 3CF5A 1XLOA 1VQAA 2MGSA 2Z0SA 5C0XH 3I56A 2R92B 3GDEA 2WXJA 5JOBA 3ZRFA 2B2UA 4GDKB 4JPSA 1SLJA 4C3IH 4AIMA 3R7QA 5AEKB 4J15A 5FLXc 3AEGB 4M02A 4WJOA 1TS5A 5IIFA 3VRBB 3CCUA 3AXCA 4EE2A 2ZXOA 1JICA 1XLNA 3Q8FA 1K0RA 2F0PA 2ID0A 2WXFA 3GTPH 4JPBW 1STEA 2KO3A 5M3FB 2H1EA 2FCNA 1B44D 1NY4A 3IVFA 4C00A 3HKZG 2FFKB 1TYGB 2N9PC 1K8MA 1BUIC 3ZW3A 4AQ7A 3QAQA 2EJFC 3W1YA 4OWXB 2YEPF 1JT8A 2D3AA 5A35A 1ZYRC 3A5ZB 1C77A 4PZ6A 4DV2Q 1DGJA 4ZK9B 1MHXA 1R4NI 4NJ7A 3A1QA 1EY7A 2V4IB 2ZCBA 2DZMA 1N32Q 2V9HA 2YLMA 3W1BA 3QOLA 2YU9H 3S1MH 2MX2A 4OX9L 3TZDA 1Q1EA 1TS4A 2K25A 4HDQA 3TN2A 3G6EA 3EHVA 2QIEB 1I94L 3H7SA 4XGAB 5DCNA 1J8IA 3HOYB 5TR5A 1RJTA 2AWTA 3VYTA 3RI7C 4AOFA 3E5SA 2PZTA 2DLBA 1DOXA 2INPE 4JI7Q 1V8QA 2G9DA 5ELBA 2BBCA 4DNRB 5FR6A 3WIMA 3MC8A 5D7GA 1EIGA 2M0XA 1WFQA 1IYJB 4KGTA 3TUOA 5IP4D 4H02A 5DM73 1GG3A 4S3SA 3UIOB 3LJ3A 3Q8CA 4CDCC 5M5YB 4R4QA 4BBRB 1I4XA 4LF6L 2KCCA 2EPBA 3F1ZA 4IUNA 1Y8RC 2WDRB 5I2XA 3M4PA 3EFUA 4EZJA 5CORA 2R92H 2GBMA 2KJXA 3ZNID 1XYIA 4PMCA 3FVQA 3I57A 3Q8EA 2WAQE 3RFZB 1VDVA 4K5WA 5EKLA 2PTLA 1TZ1A 1XNRQ 3S24A 2A74C 2ES2A 1QCBD 3KDFB 3T9LA 4DAYB 1F52A 3APFA 4R4IA 3M62B 4JX1C 1VQDA 3HFZB 2HIXA 1K9MC 4YCWA 3RZDB 4L6TB 2E3TA 1SJHD 1F9SA 5M3FH 3Q0AA 3QWZB 4CKCA 4IFDI 3MAQA 2BKRB 2W3RA 4LDTB 3LB8C 4FBJB 1QZGA 1VLBA 1R9TB 4N9F4 1VRAB 1LYLA 5IP7G 2CFMA 2JA9A 3HOWB 4DR3Q 3RNGC 3GO5A 3M4OH 1IBMQ 4GKKQ 2EYFA 3M85A 5COYA 1CJEA 4K7SA 3AB5A 1OXSC 5IO9A 4IFDH 1W2BA 1STHA 2YTYA 1EM7A 4UY8C 2F4VL 2QJLA 2L0TA 4UP8A 1FNWA 4JI0L 2R93B 5IT9E 1Y69U 4MZ9A 2KCNA 4IN3A 1VQ5A 4A3MG 3HOYH 2C7MB 4NMZA 3VR5A 4GOPB 5ELCA 1Q1OA 1CI3M 4P74A 5IKCM 1YMHE 2F0VA 3M95A 2ZVOA 2K5WA 5IT9L 1GO3E 3NVZA 3E56A 2Z4HA 5M5YH 1RLFA 4HSPA 3B1LX 4DV7L 1K8RB 4TV3A 2MBEA 4DWFA 2ZTEA 2ZJQA 4GDLB 4JI5L 4B3SQ 2OJWA 2F0WA 3W3AA 4L2YA 1FXIA 2GBKA 2GBJA 1WE7A 4AQYL 1UWXA 1I4RA 4HJ9A 1VCIA 2B2VA 5HURA 2KANA 2N3SA 3IKJA 2HHHL 3DPDA 3NHEB 3VH3B 2DY8A 5I6WA 5KNBA 1SE4A 2DAJA 4FF4A 2CHWA 3RZDH 1V86A 1WSPA 3AE1B 2J7QB 2N1VA 1UD7A 5JJKA 2QMTA 1YIWA 2LGXA 1R9TH 2IGDA 2IPKD 1XTDA 4DN4M 2FXQA 1YZ6A 4HCSA 3HOWH 4MH0E 1B53A 4TRDA 4IOAA 3TDQA 1KIXA 3IT4B 4ZYNA 4GXBA 1ASZA 3VQIA 3GTQH 4YWLA 1GPXA 1JE4A 4KTAA 4NJCA 4KV2A 1C9OA 1EL0A 3AE6B 1QWYA 5JVG3 2BF8B 3RLNA 5IYCH 2FCQA 1O80A 2JUOA 3HOYG 5FLMH 3GTGB 2R93H 4BFRA 3TQYA 3ABVB 3H6MA 4RMAA 3BZCA 1SNPA 4FJYA 4CDFC 3W1SA 3IL8A 1QQRA 4EGVA 3W2DA 2Y0SB 1N36Q 2BH8A 3FKIG 3I7FA 4LDTD 3CSFA 3GV3A 3EFCA 1O7LA 2NVYH 3D31A 2J0MA 4ACFA 4RGOS 4FJVB 1M8AA 2KUMA 4BBRG 2HQLA 1UWVA 4DF7A 4ZRJA 4KHPQ 2CQAA 1L2NA 4GN5A 3NENA 1TU2B 3H91A 2AEHA 1Q86C 1Z6HA 2EXDA 2UUCL 4A93G 4BOZB 3H9DA 2KMAA 3GS2A 3Q8AA 3OWEB 2AL6A 5I9OA 4EUTA 4DV5L 1HCZA 1NMFA 4C3JB 2O2VA 3I2ZA 4W9LA 2KFKA 3IAYA 3OW2A 3PGZA 3JAML 3QC8B 2OJRA 2BA1A 2PW9A 3IG3A 2EYJA 2IW3A 4UPAA 3MWYW 3VTVA 5KHQA 2Q2IA 2MP1A 2FUHB 5CBEE 2IO1B 3AEEB 1EZ6A 3PVLA 1L0VB 2DHZA 4G3XB 1WXVA 4GNXB 1ONLA 3O13A 1NAPA 2JZ3B 1KRSA 1ENFA 2Z1CA 1YJWA 1O7YA 3X3MA 2Z6KC 1OQQA 3M9BA 1PH3A 4LNQA 1D3ZA 3Q8BA 1R7SA 1D5MC 2MP2A 4P71A 2MNAA 4QQBX 1LFDA 3B2FA 3V96A 2A69D 5L83A 3A1QB 3U58A 3B0AA 1PTOB 1FCLA 2IHFA 2B76B 4ME3A 1PH8A 1NENB 1VQPA 1XPOA 2O6VA 1NR4A 2CR5A 2GN5A 1Y8PB 1PH4A 2X38A 2LUMA 1E2ZA 2K0PA 4LF5L 2D0PA 5ELNA 1EY8A 4GKJL 4MGIE 5LMUL 4DV1L 1SROA 3LNNA 5BO4B 5C3WA 1OTCA 3J81i 2RSNA 1X3PA 2E5LL 2L11A 3P20A 4MTNA 3D32A 4PV1C 2MCNB 1B70B 1SMYD 1YNND 1HZAA 2CHZA 4DPGA 3HKSA 2DBYA 4IALA 3BU2A 4C3JH 2IGGA 2A73B 2LUEA 1WJJA 3DBRI 4URKA 2JZPA 3VR6A 4JI6L 1IL2A 3TJPA 2F0OA 5AZHA 5G5HA 5J3BA 3WAOA 2NR2A 2A6HC 2HTHA 1DOIA 2FAZA 1ASYA 2O4XA 3BZKA 1GC6A 1SDFA 3ZJVA 1B50A 2M8SA 2K5NA 3A9JA 4KGRA 4QL5A 2XRQD 5JHAA 4K8JA 2ZW1A 3NUHB 1UUPA 2YTVA 1ENCA 1NMGA 4KKUA 4TSSA 2L7RA 1WF9A 1N34Q 3N30A 3KJOA 2BYVE 1STNA 4ZRKA 2K04A 3VR9B 2N4FA 2BDOA 5E6PA 1YD8U 3J80i 2N88A 3HOVG 1E8ZA 1V97A 1J0GA 1C0AA 4BBSB 1A62A 1MG8A 1N62A 2PVGC 3OAWA 2D2CC 2FIDA 1PTOH 2Y0SG 4IOCA 2KQ7A 4ARCA 2VQFQ 4DV4L 3PGEA 3UE0A 3NZSA 1E0ZA 3DWAA 1S40A 2KLGA 1N32L 4MGKE 1JE5A 1LGRA 1YQBA 1VQCA 3E3XA 4LNOA 1DZ1A 3U4VA 3J9CA 4G0NB 3J81j 3T3NA 1HQMC 2I0QA 3N9YC 2UU9Q 2WDQB 1KNEA 1FPYA 1WXSA 3HG9A 3RZWC 3BWUD 2KEEA 1N8RC 1C8CA 2BWFA 1LT4D 3GP7A 5C2TB 2A4ZA 1J9OA 5E3FA 4LWCA 1JOOA 4C3JG 1RFAA 2RQXA 1EUJA 3PSEB 4PT5A 4YTNB 5EE9A 3ZIMA 1B3QA 1X54A 4B08A 2VQEL 3AEDB 2NZOA 4JK1C 2GB1A 2YV5A 1V5TA 4E6IA 4BY1B 1PTOD 4DHZE 1PDQA 1QG7A 4KD3A 1Q46A 1SYBA 3S14H 2LRWA 5IODA 1CA6A 1N33Q 1VQBA 2PMVA 1YJJA 3AE5B 4LLGM 2H4OA 2KWUB 1UGMA 1F2RC 3HOZB 2OHFA 1WYDA 1BVSA 5D6JB 2DNFA 1RODA 4DU9A 4OVVA 1A6XA 4ZRIA 4DAPA 5KNCA 1RIPA 1N5WA 1AYFA 4IDIA 1AWDA 1E1OA 5IGCA 4A3FG 1B7YB 1S5BD 4R9WA 1OEYJ 1JMCA 2PQAA 3MXNA 4B3MQ 2JN4A 2KK8A 1P9DU 1YNJC 5LNK1 4LFAQ 4BBSH 4DAMA 2GLSA 3LDZE 4IM3A 4IWPA 4WWOA 3S1NB 2KYWA 4OONA 2N9LA 1IP9A 3V6CB 2M0AA 1IBML 2F0JA 5JEAJ 2KMCA 1QZHA 4ANWA 3M3JA 2JPHA 5JJLA 1BCPC 4FDBA 4DK0A 1IYFA 1NI2A 2EJMA 3DEOA 3I4LA 1TWHB 2OWOA 3PLUA 4ZRPA 1AN8A 4CHTB 5EAYA 3UI2A 2IZVB 1SE8A 1XTCD 3HOXB 4ZRZA 2R7ZG 1EOTA 1PUTA 1EYCA 4JI3L 4P7IA 2PI2E 1BUVT 1FFUA 3NQTA 4K8IA 2WX1A 1EOVA 1LTTD 1FRRA 1S5ED 4WFN3 4II3B 1Z7TA 3CW2C 3C19A 4K6LA 3EA6A 2M00A 2UXCQ 4YTMB 4HJAA 1TWAH 1EF1A 2XK5A 2Q2TA 4FF2A 1IPGA 3ZNGC 5CBAE 2CS4A 4B3SL 3RYTA 1Z5SB 3V6EB 2C5CA 1C4QA 2L0CA 1ML0D 4BKGA 1H4RA 1PZKD 5EBDA 1SE3A 5FLXL 4KKJA 3W5UB 1TWCB 5IN7A 3FAHA 1GD7A 1V2YA 3NWSA 4IUUA 4FXCA 4BBSG 2Q2UA 1PDXA 4LUZA 4K0KQ 4JI1L 2W3SA 5JHBA 3PF5A 5AZGA 4G7ZC 1EYDA 2B3AA 5FO8B 3S1NH 1WZ3A 3KF6B 1UE6A 4DR6Q 3RD2A 1XO3A 1X1MA 2EYPA 3CPFA 3S16B 1EF5A 1FMAD 1RFKA 2B2TA 2CWPA 1PGXA 1WMHA 3R93A 5GAEC 3LWEA 3I3CA 1S72A 1V1OA 3WOEA 1VQNA 2WAQB 3Q8DA 3GZNB 2XBBC 4DAVA 1G6JA 2XSCA 1VCBA 2AUKA 1W6KA 1WD0A 1J5EQ 1EWYC 2AQ1B 1K8AC 1GC7A 4CHKA 2O6VB 1SAPA 5K36G 4YCUA 3RNBC 3OJ4B 1KDBA 3PZ7A 1N36L 3QQ8B 2NBWB 5DPSA 1EY9A 4BY1G 2DNCA 1X3FA 1GUOA 1EQQA 4A3OA 4XWTA 2Q8RE 2F0TA 5IY0A 4REZA 3M7NA 4JBJA 1EEID 3AMUA 2X6GA 3CC2A 1IW7C 1IBLQ 2JWZA 1RRBA 2PPBC 1V8CA 4TUUA 1I35A 1ZDVA 2KN5A 2DYOA 4DR4L 1FNVA 3VA7A 3EECA 1HTPA 3WCQA 1CHQD 3HOZG 4Y7NB 2AHOB 3DBHB 2M9VA 4ZOHC 2K75A 1JWAD 1PFSA 1HR0L 3P4QB 1TWGB 5IP9H 4KIKA 4BBNC 3RNUA 2KC1A 4NW2A 1TWFB 3D4RA 3OMGA 1SE9A 1SSOA 2KTRB 4HPLB 1GKHA 2CH4A 1PV4A 2Y5PA 2EYMA 4JI2Q 3A9JB 4GDKA 3ULJA 4QY7A 2AQ3B 2OT2A 4RAUC 4X6AH 1HHVA 3H6NA 4K3BA 4DXAB 3MJWA 4TMAB 2IO0B 3RD4A 2M1MA 2Y0SE 5L95C 3NBHB 3V2TA 1RWSA 1LTAD 3K6OA 3AE9B 4W9IA 1AFPA 1E8YA 3ZXVA 2JXMB 3AULA 1MSHA 2LD9A 1LTSD 4EZKA 5JPNC 4IQZA 1UEBA 4BA2I 2RDBC 3AI5A 5BMGA 3F2BA 2F0LA 1T0RC 1ZOYB 4X64Q 1ZKOA 4NQLB 1TKEA 4H44C 1ZXTA 4B3TL 3HOXG 2DJFC 1WTPA 3VYRA 3J81c 4DUYQ 4XWWA 1S5FD 3N32A 2SOBA 3UDIA 2KD0A 4BKTA 1A3TA 1TKWB 1Q81C 3DBHI 2KDIA 4HLEA 3DWPA 1HTOA 1J6QA 1HH2P 1PGAA 4LF9Q 2EMSA 2PZWA 3WWVA 4OL7A 2WXKA 4X3KA 3TEHB 4A76A 5IGDA 2B2YC 1GM5A 3F2CA 4G50A 4WJNA 2RDHA 1EO6A 2FCMA 2MBHA 4XYQA 3DDCB 2BB5A 4K7UA 5KYLA 3HUIA 4Y7NH 2WXLA 3E0EA 1MI0A 2XGTA 4W9EA 1QLBB 4P72A 4U673 3CIRB 3BVZA 5KNDA 1Q1BA 2PLPA 1TWFH 1P7EA 3DHIC 2G9HD 1NBWA 2O6VD 4CJ0B 1L6VA 2E2JB 1S1QB 1VZ8A 5JEAG 2CHXA 1VMCA 2KT7A 4ZQ3A 1WWTA 1BBXC 3NZUA 4IWQA 1WGDA 4X62Q 1ICWA 2FJ2A 1K83B 3J80c 4JBMA 2DZKA 2LMCB 4D2KA 1N61A 4LK0M 2J7ZA 1CMXB 2NTSA 1PH5A 2WAQG 4WJ3M 2HJ8A 2K5DA 2JF5A 3I4MH 2JA5G 4IW0A 3GD7A 3MXNB 1X3EA 4HEDA 2O5IC 4MEMA 1JB7A 3FPPA 2C7HA 2EY2A 1E5WA 3X23A 1F9JA 2D5DA 4UAIA 4XDCA 4ODGA 4P16A 2MUYA 1YNXA 3BIID 3NTHA 2INDC 3ZTCA 4RHRA 2VQFL 1NE3A 1JB3A 2VB2X 1CHPD 3LWUA 3OTOQ 3GTKH 4BXXG 1U4LA 1BMLC 2K52A 1AH9A 2MBBB 2VZKB 2AL3A 2CHBD 3AFPA 4UP7A 2G4DB 4GOPA 2E2HB 2UU9L 2KWCA 5EE0A 1HQRD 3URYA 4BVUC 4RF1A 1E7VA 3FMCA 4LW1A 1SNMA 4GLSC 2UU7A 1P8LA 4DNIA 1G2TA 1WFYA 3NUCA 4LUVA 4DR2L 4R3DA 3KK7A 2NBVB 4AYBB 2HDLA 2A6HD 4DR1L 2RD0A 2PE6B 2JA8G 1Q0WB 2E2JH 3I5JC 2L8JA 4MT5A 1BCPB 2GI9A 3TEYA 4PS3A 4FNFA 5FOBB 1TY2A 4KLKA 1YEZA 3R66C 3V62A 1UNSA 2KOLA 4DK6C 2IJ0A 1K83H 1A2TA 3PLVA 1L0YB 1B8AA 1E0BA 1EWHA 4JI8Q 2KAJA 3TEZA 1G91A 1F2MA 3OWFA 3UE1A 1Q5WB 3VR8B 4DV6L 3K7AB 4G4KA 1QILA 5CC4A 4JL9A 3BYTB 2SNSA 4EVOA 3ERSX 1J7AA 4GZYC 2RPVA 4LF4Q 5CV8A 5BN4A 2UYZB 3KW5B 2BPSA 1B3AA 4B3ML 3NXWA 1SFOH 2LJ5A 4LFAL 1XXGA 3BG3A 3NPPA 2XVSA 4HAEA 2WYQA 3APDA 4E3CA 4PK1A 4E71A 5EPKA 3H3VI 1TIFA 1WGYA 2K03A 1WMHB 2WGSA 2K01A 4DFAA 1YQ4B 3A7LA 3FRPB 1H9KA 2NVQH 1SIJA 3DCGA 4G11A 4I6LB 4KSKC 4YL8A 2NCNA 2BCOA 3CF6E 1EFWA 4HJGE 2DAFA 3QA8A 3VUYA 2PW7A 4HCEA 3ER0A 2JXTA 2ZW0A 5J17A 3LGJA 2SNMA 3CMAA 3P4PB 2WACA 3EGRA 5BYRA 2QEJC 3DXJC 3UDFA 4R4CA 2RMMA 2DX5B 1TS2A 5HY6A 2E2IB 2BYTA 1WGRA 2EXZA 2JA6B 4FYDA 1ZP0B 1R4PB 1EZ8A 3VR3A 1K3RA 4UDUC 2Q2HA 4A3MB 1RYJA 2G4SA 2EYOA 1EWIA 1XX8A 4C7YA 3HVDA 3VUXA 2A68D 2RDGA 1GUTA 2E8GA 2M2LA 4P2CB 3QK0A 2ZPNA 1VQ9A 4P1BC 2VZKD 1CSQA 4I6NB 2HIVA 1FO4A 1PXUA 2KLCA 2KHWB 2KQSA 3MTNB 4OGQC 5AFWA 3K7AH 2B2UC 2RF4A 2NVXB 4RA8A 2CW0C 3IAM1 1N5XA 4J8QA 3NS8A 1CA5A 2UXDQ 2Q8TA 4BWGB 3AE8B 1GUNA 1HNXQ 2BS4B 3QIJA 2NMQA 4MGZE 1JOKA 3MA2B 5JAVA 4GNXA 1BCPD 2ZNVC 2B2WA 4DHZB 1MJDA 3ITPA 4FULA 4DR6L 2JVCA 2N1WA 3NRZA 4ITKA 1E7ZA 5BN3A 3QIAA 4DDGD 1ET9A 1EYGA 4ALPA 3IFWB 2X6LA 4ZHPA 3QR8A 4RFBA 2KDMA 3T51B 2BT6A 3P2BA 2EY1A 2BVCA 3H0GB 5IP7H 4KY7A 5IGFA 4X3UA 5D3IB 2G1EA 3TZUA 1J5EL 3RNAC 2JX5A 1I3QB 4N8X1 1RD9D 1DOKA 3CU7A 4AYBG 5J22A 2XWJB 3AEVA 4S0RA 1LTRD 3WOFA 2E2IH 3AE3B 5EKKA 3K80C 2KJRA 4F7ZA 4NNJB 4JV5Q 3ZDTA 1F2ZA 3PSIA 1TS3A 2XIWA 2EKEC 4A3MH 5JH5C 2YTXA 4GLXA 4X3TA 2NN6G 2JU6X 2BE5D 5IYDG 1HNZL 4KX6B 1GB4A 2MJEA 2E76C 4G7HC 3FKIB 3OPOA 5KGUA 2FMMA 5LXIB 1ZUD2 4DV3Q 3P1MA 2K6QA 4EQNA 3I4NG 1NNXA 1GOZA 2JK8A 4RH6A 2NVXH 1GAQB 3FKYA 5KHOA 2GVAA 4A93B 4NKLA 4RGMA 2INCC 3PZDA 2I5LX 4JI2L 5BMIA 5F2DA 4O2DA 1QE6A 1BNZA 1ZE3D 1RHPA 4KI0A 3M3YB 1DYQA 4ZLTF 1K51A 2Z9HA 3QWNA 3Q22A 1X65A 3QJYA 3UI3A 1UAPA 1STBA 2LKVA 3BK2A 2K4KA 1WYGA 2G3QB 4GB9A 3H0GH 1S4ZA 4J1MA 1VQLA 5LHY1 3BINA 5G55A 1A8VA 3N3KB 2RSUA 2MHJA 4B9KA 2LVPA 5T8IA 2MA9B 4YCVA 3PCOB 1JQYD 3G71A 2R61A 2HDMA 2R2OA 1IL8A 3P4RB 3DEPA 2F0EA 2JA6G 3APCA 3S1RB 1Q7YC 5JVH3 1JJCB 2WNMA 5M5WB 1WM2A 4CQNA 1C4CA 1UE1A 3L3OC 4LF9L 4IPGA 1WCMB 4OO1H 1XPUA 2E74C 5FO7B 1XMOQ 4LFCL 4NY0A 1KOTA 2Z4IA 5AJ3Q 1BOSA 2L0FA 1T5EA 3FKIH 4A3GG 4YHHL 1FD6A 3PRZA 4DK1A 3AH7A 2UUBQ 4JG2A 1ZXIA 1C48A 1YNTE 2KZRA 3FDTA 4BBRH 3RUIB 1L1OB 1T0SC 3BS1A 4Y52H 4EX5A 2KXJA 3U50C 3NP8A 3CCLA 4GLAC 2JA7B 3Q3OC 3RCZA 4H13C 4EQ5A 2RKSA 1T9HA 2EVBA 1IGDA 3KQ4A 4A93H 4IOIE 4MACA 5DEHA 1IBKL 5EPLA 3NTKA 1Y1WG 1TY0A 1YJNA 4OHJA 2I5HA 2MO0A 2IO3B 2R2QA 4L63B 3M3YH 4P1CC 1XLQA 3TRZA 4M00A 3AEBB 4H7BA 3NVYA 1WRIA 2ZEQA 3CMEA 3X3NA 4HIDA 3BK1A 1ILPA 1IUEA 2MLBA 5IYBG 3H0GG 2MW5A 1WGGA 1M90C 4YT0B 2ONQA 5LMNQ 1IYVA 4K5XA 4WRDA 1E9MA 4IJHA 1EUVB 4JC0A 3OLMD 5GXGB 1ILQA 4P73A 3SDZA 1SNDA 3SK8A 4GN4B 1YHQA 2A5UA 4HJ5A 4HEA1 4ZRQA 3U52E 4YSXB 2BW2A 4NDXA 3AYHB 4BA1I 4PNYA 4X65Q 1PRTC 4ZCKA 1FL0A 3CQZB 3S1RH 1L5PA 1CFMA 2N9KA 1X3QA 2A19A 4ABNA 5M5WH 3HOVB 4IPCA 4IUVA 3NS1A 3WALA 4OO1G 4M8AA 3T56B 4JGHB 2CU3A 3RULA 3ECIA 2V3NA 1BCPF 1FGBD 4DR5Q 4YTPB 3U4ZA 5D94A 1VDZA 5D3DA 2KFJA 1WTWA 4DV0L 2KJ6A 4EFOA 2PW5A 2K9XA 2OEOA 1NVID 3DBSA 5CMDA 4MELA 1ZKHA 2J0KA 1GB1A 1MGSA 2JA7H 3KUZA 4IM2A 3RT3B 4FO2A 3TIXA 5GADC 4WORA 3JAME 1T5XD 5C44B 4W9DA 1JWSD 3VDZA 5GMVA 3U4EG 4TKOB 1PHJA 3ZYYX 1C78A 2LGSA 4KJOA 4WJWA 2F0QA 2OQKA 4WQMA 1OEYA 2ZJDA 1B9RA 4OEMB 2M19A 1E2VA 2FHTA 4HPPA 1H9JA 3KBGA 5ELDA 4H2AA 4JI8L 4F87A 3PRMB 3CP0A 1I5FA 2EQSA 3OW7A 3FHWA 5CYUA 2KN4A 2V4DA 1FM0D 4USAA 1ET6A 4JVZA 1HA6A 3TP7A 4IKGA 1WVLA 1UH6A 1K50A 2LI5A 4LF4L 1WXMA 2K39A 4NXNQ 2B39A 3KF6A 3PO3B 2L1AA 1G2SA 4L1BA 5CHWA 2J53A 4ILWA 3MXUA 4LFBQ 3D6CA 3OHXC 3CCMA 4EQPA 2WU2B 4AYBE 1NTGA 4XIGS 3J81L 2KC2A 1UWMA 4IUTA 1NJIC 3GTGH 2KKCA 3EIVA 3CQZH 3DM3A 4A3FB 2E75C 3HOVH 2BQQA 1KJTA 1WJ6A 1WCMG 5E4WC 3PF4A 3PO2G 4LNNA 3U30A 3TEWA 2OCEA 2HCCA 2TMPA 4WQOB 2QDBA 2B3GA 3T4AC 2KDEB 5K5PA 2BYEA 4KD4A 4LTUA 1QVCA 4XQJA 3ZNHB 2L5TA 2MHVA 5LLIA 3Q3JA 1U4PA 1VF7A 4RHSA 5C4XB 2ZNVB 3TL5A 3K81C 5EPJA 2JA7G 1LM0A 4NQKE 5M5XB 4WIPA 2KJHB 4FA6A 1BQQT 2VS1A 2RA4A 4W9FA 3SEBA 4L5RC 2NBUA 5C4ZA 4XDXA 3EUB2 4A3JB 1S5CD 3J80E 2R7ZB 1YX6B 3DVGX 1CZGA 4EZLA 1QOBA 2F0MA 1VZ7A 1V9PA 4J3OD 3MP9A 1ENAA 1KDAA 2I38A 2N9XA 3PMFA 4K7WA 5HKHA 2KTRA 1HE8A 3J80L 1HA5A 5C1ZA 1CQFA 1TZOA 1ZPSA 2BKFA 4XZ4A 4WURA 4US8A 3I4OA 4W9JA 2H89B 3BYYB 1TXYA 3OIPA 3U7ZA 5EBCA 3KLRA 3STBC 1STGA 4LNFA 1G51A 2G5DA 2OEDA 4R8NA 3AEFB 2LRUA 1P16A 2UXDL 3NBHA 4A3DG 1WGHA 2WDTB 1PH9A 3CCRA 4A20A 1IZ6A 3AMZA 2OTLA 3BDOA 3NG0A 5IWAQ 1Y56A 4LJOB 1JMLA 1TT5B 3ZXRA 3RLFA 4A3FH 2LXAA 2L55A 3CAMA 3NQIA 1HTLD 3GTJB 3GTLB 4RG1A 5T1GA 3S9WA 4DV2L 5I2YA 1UELA 3RZFA 2DYBA 3PHWB 4FHKA 3A54A 2WB1E 5JZEB 3ZGZA 4N9TA 1L4ZB 3K0XA 3J7ZC 1AW7A 1FGUA 3F2DA 4EQOA 1UBIA 2LXJA 3PPAA 5M5XH 5C44G 1D8LA 3I8ZA 5CGKA 4JYAQ 1V81A 4MJSA 3CRKC 3RMHA 4ZKBB 4JI4Q 1B1ZA 4JV5L 3V05A 1V5OA 3OMCA 2BYFA 4JI7L 2R7ZH 1VQFA 1KRTA 4ANUA 2K14A 4IC7B 1DOLA 1KDCA 3TP8A 1GXDC 4OWWB 4GN3B 1SBBB 1I4PA 1STYA 5CV7A 1DONA 2CW0D 2BB6A 1V1QA 3SVMA 2JRIB 5NUCA 2REXA 2ZCCA 3ZJYC 3I55A 3BVGA 3IXSA 4DV3L 3KUDB 4HRSA 4CYEA 3U2SC 4ICVA 3UINB 2DY7A 4EOYA 5C5MA 1L0XB 5CV5A 3AQQA 2L76A 4KKIA 4JOIC 2L9HA 3PO3G 1WXAA 4W9HA 2V0GA 2F0DA 1XNRL 2LMCA 4WAFA 3OOCA 4I6PA 2F52A 4C3HB 3IBEA 1ZYRD 1EQVA 4FJZA 4OVUA 3MTSA 1JROA 1RDPD 2ICEC 2XRSD 3HS0C 4KKSA 1KTKA 1IKLA 4O42A 2JQRB 1KM7A 2WXMA 3GTLH 3N6RA 3KWVA 4DR3L 4QGUA 2R7DA 5J18A 1D4BA 2ZXRA 3KUPA 1FFVA 4GKKL 2VUMB 5H92C 3K0YA 1PFMA 1X55A 4A3LH 1FCCC 2KECA 2KBNA 4DXGA 4CBVA 2LS01 5KIXA 5C4XG 3L4PA 5G5GA 3X0WA 3HGBA 3S1QB 3N1YC 4ZUIA 4AUQC 3W1GA 5KYIA 4B3RQ 4JBWA 1E8XA 1EFID 2PEAA 1GHKA 1PYWD 1RCVD 4A3JG 3H3VC 2LVQA 3VTWA 2QHOA 1SNOA 1WYWB 1CKOA 5K36H 3TP6A 3PT2B 2WP8J 1XCTL 3Q6SA 3RN5A 4HJKA 5AJ3L 4W9GA 3I73A 5EDSA 3HP3A 1PH2A 3KYHC 4P75A 4BY1H 4LF7Q 4XT1B 2UUBL 2RGFA 2JQOA 1XWEA 5FR3A 1VQOA 3DVGY 4X66Q 3VR2A 1Y1VG 1XNQQ 1YOVB 3PV0A 2Y3AA 4LMQD 3SE0A 1JR0D 1ZXHA 3JVZX 4AJWA 1X6OA 2KA7A 5FLXE 2GBRA 4NXMQ 3PREA 4W9KA 4A8XC 2RCNA 4R8IA 1OQRA 1EY4A 1PMRA 1QJOA 2LFNA 1KLUD 1C79A 2CJOA 2VW9A 3Q23A 4DNTB 3HOZH 3AM9A 3DWQA 1VQMA 1HZ9A 2IYDB 3CCJA 3LYYA 3AB9A 4UP9A 3SR1A 2Z6BA 4JBKA 2RSOA 4HCPB 3D4WA 1KXLA 1E6EB 1Y8NB 1HXYD 2L4NA 5EJWA 4HJ8A 5C23A 1K52A 3M7GA 3NK9A 4Q2JA 3MZ5A 5IT9c 2K5PA 2YVCA 2CKZB 4A3CH 2QILA 5GAHC 4HPMB 1BKBA 4A3LG 2WXPA 2WLBA 2LWPA 2B2TC 4GLVB 1WJ4A 2D3BA 1STAA 1M1KC 2WXHA 1XLPA 2KQ3A 4FVMA 1E1TA 1I6VC 4HROA 3U9SA 3MC9A 4A3BB 3T13A 1LTGD 3RZOB 4XYCA 3VUWA 1TWHH 1WI5A 2JA5B 4O1NA 3T16A 5EGTA 2G45B 3CKIB 1F0ZA 1CK1A 3HOXH 4MSMB 3BZDB 2BS2B 4CGYB 2D11A 2D10A 1MSGA 2WXNA 3TEXA 1CQVA 2K5QA 1TVXA 3SHLA 1KH0A 3Q6BA 4Q5VA 4YXDB 4DR5L 1WGKA 1MI2A 1XT9B 1MFWA 1EY6A 3AECB 5M3MG 4HMJA 2XEWA 4O0AA 3KJPA 5H8YE 2VL6A 4EKUA 3HRDD 3EROA 1BBUA 3T3OA 2Q5WD 1N60A 1E7UA 4KHPL 1G291 3EC8A 3DHHC 3WANA 2D0OA 2WV6D 4F7XA 2PIAA 1L6UA 2KVMA 1OTRB 2LGDA 2ZZPB 2K6AA 2ZT9C 1WTVA 5I9PA 3ZVVA 2K50A 4OX9Q 1NYQA 2AX5A 1K0SA 1VD2A 3Q3NC 3QCAA 4I7ZC 1TWCH 3MVVA 4C3HG 3RPFC 3PTFC 5HFYA 1I94Q 3DM1A 3GTMB 2WFWA 2JA8B 3SK5A 1E8WA 5JEAH 3DUZA 2K1FA 3GZNI 4CDDC 5JPMC 3L0WB 1YHAA 1XMQQ 4WWNA 4A3CG 1A3VA 4IO9A 1Q3LA 2KHIA 2VUMG 1FEHA 1EY5A 4IUPA 3PS6A 4XT3B 3NVWA 1V80A 3S16H 2YYZA 4HCNB 1PLFA 4NXNL 4LF6Q 2QDFA 1BBWA 2AWNA 3FC4A 3GQBA 4U68A 2MJDA 2L00B 2QDLA 4WJPA 4GIVA 3J7AF 1DJRD 2JA5H 5DAUA 5IOCA 5LMNW 3ZLZA 1JALA 2Q8IB 1VQ4A 2JYTA 1WTHA 1NCVA 1A70A 3P75A 1W3SA 2ZXPA 1SXTA 2MBOA 4AP4C 2SDFA 4HTHA 3PIO3 4FF1A 1H95A 4C1NI 2PPHA 2WXGA 1DXMA 3QO2A 4C2MB 4QIWE 4BXXH 3R2TA 4NAWB 1QUQA 3DOWA 2N55A 3K5OA 2WKCA 1KRHA 3ML9A 4MJSB 4OW0A 1TGZB 1A3UA 4RM9A 3D8GA 3P4SB 5CHVC 5IAAC 2GA4B 4R4OA 2JT4B 1IXRA 3GE3C 3SFEB 1UBQA 1TWGH 3C2PA 3A5UA 2F4VQ 1KNAA 4G57A 1DCZA 3CCVA 1WH3A 2JSVX 2M17A 5BYQA 2SAKA 1FJGQ 2ATWA 2K32A 2WINB 3E0JA 4LUOA 4JI0Q 3L9AX 5KEEA 2EMTA 3V60A 2JA8H 4A9AA 2MH7A 3KH0A 2EY5A 3BVMA 4C7ZA 2PI2A 2MBQA 3ZO5B 1GUSA 2NTTA 2ZTDA 2I1JA 2MSED 2OXPA 1K8OA 3HOUG 4K81A 5C3JB 5E6OA 1QOFA 3WAPA 2FBWB 3FILB 3ONSA 2K8CA 2J52A 3MJ5A 2BH2A 4QJFA 2QC8A 4DV7Q 4A3BG 4Z9CB 1X32A 1N34L 1I6HB 3IT6B 5FJ8G 1PH1A 4I65A 4JI5Q 2J0JA 2MJ8A 3OYYA 3MFGA 1FXAA 2QKIC 1ZGUB 4QCLA 2JXXA 1YIJA 4RKLA 2RCFA 5IWAL 4A3IG 4EEWA 4KY6A 3PIOA 2LSSA 1WD1A 3L2PA 4QAYA 4DKAC 2HHHQ 4APVA 4WH4A 4YY3Q 2PJHA 1FVIA 1V43A 3C0RB 1IBXA 4KZ0A 3WAMA 4C2MH 3LXFA 5FKAC 4ZYSA 1PA6A 3G6JB 4PMBA 2LVOA 4OZAA 1EEFD 3S17B 1KLGD 1YJIA 1RF2D 4P6VF 4WJQA 4GOPC 3WA0A 3GB1A 3MFYA 1IHZA 1PZJD 5E6JA 2IDYA 2BDNA 3A8KE 5GROA 1FRDA 3OG5A 4JI4L 1VS0A 3EJIA 1GUWA 2JZZA 2K8BA 4M0WB 3VXWA 2LFIA 1C4AA 2IY0B 2VY3A 1L1OA 1CM9A 1FYCA 1D5XC 4MTKA 3NBIA 2LHDA 3P63A 2GBNA 5BR8Q 1LXDA 2JWUA 4RGNA 2QF7A 5DPWA 4GS3A 4BS9A 5C3EB 4A3EG 3B6YA 3S2HB 1TKYA 3R3MA 2VH1A 3ZJTA 2ZVNA 1N33L 4A4IA 3AV8A 3C1FA 2OF1A 1SB3C 4V0BA 1M4VA 2W54A 3ZKJC 3RLOA 1J19A 5DPRA 4B0MA 2B8FA 4AWJA 1H9MA 1I6HH 3I4NB 1EU3A 1HZ5A 5C4HA 5H1SE 1U4AA 4KSLC 1ROEA 2HUGA 1R4QB 4DBGA 2Z8LA 4F1SA 3L7ZC 1LABA 1C7YA 1KAWA 4HIOA 4L5SA 2WDVB 4XQQA 4DV5Q 2F0NA 2WIIB 2PVOD 4ZDVA 1X3GA 3E9IA 1WIAA 1XD3B 1V1PA 3QJZA 2NBFA 3PHXB 3SFDB 3VHTC 4J6HA 1G6PA 1XF5L 2KTFA 4MDKE 4KDLB 4B9WA 4IPDA 2PKOA 2HCIA 3NE5B 1RAXA 3I63C 2E2HH 4RNAA 3CXCA 4B3RL 2EYHA 4H0LC 4KKTA 3RUZA 2K5HA 1NI3A 2KNBA 3L08A 2UXBQ 3A9KA 5EKIA 3VH4B 3NY5A 1PRTF 2C9OA 2NN6I 4JCVE 4A75A 3H15A 1WTRA 3KLWA 1P3QU 1T6BX 1QOAA 2LHEA 4MSQB 1UF0A 3VDYA 5HHDG 3GTPB 4F8CB 5TSSA 2I46A 5J2RA 4ANXA 1ICFB 2F0GA 5BYSA 2UXCL 2RVLA 3KLSX 4K2LA 4C4VA 2B8GA 5I6YA 2AWOA 2IWHA 2FNJB 1QOHA 4X66L 5C3EH 3S2HH 4BY7B 3UDXA 3AU4A 2NN6H 2LXCA 1AE3A 2RR9A 5IYDH 2HTME 2WB1B 3DMUA 3EFXD 4NXML 3UF8A 4A3GB 4CJ2C 1A2UA 1Y8OB 1D2BA 3C46A 2KHJA 2AMCB 3S2DB 3E9SA 4LF5Q 4A6QA 2BOSA 4GKJQ 5LMUQ 4DV1Q 1BT0A 1YNJD 2LXKA 1EWCA 3PIP3 3I4NH 3Q3MC 2ASQA 2WKDA 3N1XC 1SNQA 3G4SA 4F88A 2F0KA 1VQGA 2PMZB 5AUIA 3NVVA 3G48A 2JRHA 2KOXA 4K0KL 1Y1WB 2PZUA 1II3A 4GNXC 4HDOA 2UUAQ 4TQ0A 3BDLA 1JQ4A 3KBXA 2PE9A 5C5LA 1VZ6A 4JI6Q 4K14A 3ZTDA 1K28A 4IZ8A 4B6WA 2I2YA 1RL2A 5CHFA 3TP5A 3RN9C 1H9SB 1XQQA 3PZ8A 1WM3A 1N6ZA 1JJGA 1Q8KA 2FCSA 1LTLA 1S5DD 2B29A 1PTOC 4RCOA 1X9NA 1PVOA 3A33B 1TQOA 2JSOA 1GJXA 2INNE 4MH8A 1D5ZC 1ZDXA 4M01A 2VRRB 1Z2MA 3VAWA 2EIFA 2JEBI 3KUCB 1ESFA 3T1YQ 3L54A 2IO2B 5CV4A 3OIQA 2JA6H 1QUQB 1C76A 2L32A 2RHQB 1G6ZA 1NSNS 4N9PA 1NYRA 4ANVA 5C3EG 2EELA 3ZRCA 4KVGB 4BY7H 4RM8A 2X8XX 1IBLL 4DV4Q 1CT1D 3M4OB 2XN9C 1JOQA 2KACA 4A3GH 3PUYA 3HRZC 1H9RA 3PQIA 1TT2A 3PIPA 3S2DH 1CKNA 3MC0B 2MJ3A 4PS7A 2V1CC 3BY4B 1RTOA 3T8MA 1K53A 4PZ7A 2F0HA 1UGJA 1PZID 1PQSA 3SR6A 3K58A 3Q14C 1A0IA 1VQEA 4XE0A 4PG3A 1NDDA 1Y1WH 2O2LD 1XMQL 4KHVA 2V4LA 2VQEQ 4Q0FA 1HRJA 3DHGC 2UWQA 2K5VA 4DUZQ 4IG7B 3H8HA 1Q10A 2F3IA 1B4OA 1TR5A 4KK7A 3LX0A 3AN1A 5C0XG 3RMKC 3NSWA 1C4PA 1SGHA 3K7UC 3NEMA 3IHPC 4AS1A 1FIQA 2D2QA 5IYBH 1JRPA 3MHSD 2KWVB 2L12A 4A3KB 2JP1A 4X64L 3Q3FA 4C3IG 1CZWA 4A55A 2MPMA 1P1AA 1YJ1A 4OO1I 1I3QH 1XCQL 4DUYL 1D1KA 1IBXB 2QSDA 4HJ7A 3C8YA 1EQTA 1FNUA 4K3CA 1IW7D 2F0SA 3MHBA 4GOCA 1F1HA 1LTID 1P0RA 2WXOA 1MJEA 3AU5A 1RKNA 1Q82C 1QZEA 4BY7G 2JE6I 3L16A 4US9A 3AE4B 4BKSD 3PO2B 2QW7A 1T0YA 3PUXA 1Q8IA 2WB1G 3PV1A 3HHMA 5GQOA 2QGQA 1B9MA 4RKBA 3L17A 3K57A 2N0SB 3GTQB 3N20C 4GU2A 3T1HQ 1PFBA 5BN5A 2Y5BB 4DDID 3PUVA 4ZHOA 1KL9A 1FJGL 3SU8X 1LT3D 1O7ZA 3A55A 4UHVA 4OXPA 2L3ZA 3L0OA 1FR3A 1VQIA 2B2VC 4L5TA 4WWMA 3R8BA 3EVQA 4N8FA 3SGIA 3WDNA 4JI3Q 2P5ZX 3JC66 2Z0EB 3UIPB 4X62L 2EZVA 4JWSC 1AARA 1C1YB 1F9RA 1HPCA 5ELOA 2NVYB 2GOWA 5HGTA 3IFTA 4HMIA 2MO1A 3G7LA 4MM3B 2NPTA 5KRUA 1FXTB 2KENA 2KCMA 2R92G 2LEKA 3NJTA 5DM63 4PYZA 2DJGC 1F2LA 2WXQA 1B2TA 4A3KH 1OXXK 2JEAI 5L37A 4HIMA 3DBLB 3VA5A 1AZQA 2WX0A 2K05A 4TVAB 3ICEA 2EKIA 2L05A 4ASWC 2E6XA 3R2IA 1V1PB 1Z9FA 4DK3C 4A3DB 1E10A 1SIFA 4JE3B 3U8ZA 4KN7C 1YBYA 5DLQE 1AEXA 5HGQA 2F0UA 3D4DA 4R1JA 4YY3L 5M3FG 5IGGA 1WZ0A 2R3ZA 1B9NA 1VQ7A 1VMPA 1R4MB 3OTOL 2KX0A 4GMVA 2ACZB 4PS8A 2XWBB 2N78A 3W1SC 3I70A 4YWMA 1J8CA 4JI1Q 3NTIA 2A6EC 2F03A 2NVUI 1WCMH 1UZXB 2NB0A 3PO2H 1LM8B 3A9KB 1OXVA 3KYDD 2QCPX 4ME5A 5A2QE 2DWQA 4MN3A 1JRUA 1KFYB 5HI1A 4KDIC 4AJYB 2MFIA 4IFDG 1VR9A 3HIZA 4L23A 1VQJA 5JJZA 1NEKB 1IKMA 5DPTA 4XTCS 2I5MX 2KX3A 4C4VB 5A2QL
chains in the Genus database with same CATH topology
4F8MA 1P7FA 3MXGA 2HQEA 2KMMA 1Q12A 3OSOA 3D6WA 4KMUC 4DXFA 3I72A 3SK4A 4QIWB 4DGZA 1E2WA 2FMCA 3C1EA 3AE7B 2ON8A 5G3LD 1WXQA 1HUMA 1SJED 3J81E 3NZ3A 4HKZE 1SYCA 3QG1A 4FXGC 4IUQA 3D3RA 3A8JE 1J7BA 2EE1A 2KWDA 3DWGC 1YN5A 3MEHA 1JWUD 4HN7A 3VYUA 2SEBD 1JORA 1QNUA 2F3VA 2WQYB 3P7JA 5IGEA 4ZKCB 4C56C 3B2GA 2WU5B 1MVKA 1QT9A 4C1NK 3ONAB 5AUKA 5CV9A 2X69A 2GRIA 3QOJA 2CVRA 1U4MA 2K33A 2EDGA 2LGIA 3I90A 5I4DA 3AU7A 1Y1VB 4OVZA 1TJEA 2IX0A 2IX3A 1HEZE 3J7AV 5JXVA 4ULLA 1F2YA 3K5MA 4DA2A 4CKEA 1KAAA 2RBMA 5J39A 3K59A 2D9UA 1L4DB 3KWLA 1BO0A 3ETRA 3A7AB 4FF3A 3I9V1 1PGBA 2L1BA 3S14B 3ND9A 1GUGA 2EJGC 3TBIB 2BS3B 1VJKA 2K3UA 4X3SA 1JC7A 4QUFA 1JCKB 2IX1A 4XXEA 3HZXA 1I4HA 2O5JC 1I4QA 2J42A 4N59A 1VF5C 4OZCA 1T3QA 1AP0A 3PUWA 1C9FA 5M3MB 3PO0A 2EY6A 2PQEA 4KGSA 1D1IA 1LT6D 2EOTA 5ELEA 4B0EA 2NYZD 2JYEA 2NUCA 4HKQA 3NHHA 2W82A 3FILA 2RDFA 1SYFA 1QKZA 1QF6A 2VB3X 1TWAB 2L52A 5M9OA 3C3LA 3K5NA 4XQNA 4YIJA 1D6EC 1AZPA 4QB4A 4QF4A 3I91A 3Q69A 2A68C 5G3LF 1KABA 3A8IE 3E6ZX 2HDEA 4ARIA 1HFGA 4PQXA 2K7VA 1TIID 3H94A 3TSSA 5DNFA 4ID6A 2IL8A 4KY5A 5ISRA 2D5GA 4OIKA 3N52A 4M0WA 4ZAIA 1I4GA 1WTXA 2VXWA 2PO4A 2B63B 5EE3A 4PMWA 4K2KA 1BF4A 2N7JA 1QB5D 5J1ZA 1PRTB 4NAMA 4YSYB 3PUZA 3S15B 3V3XA 1OFFA 4KV6A 4QUCA 2KHSA 1BDOA 3EQLC 1ZEQX 3DWMA 1SE2A 1EU4A 1U4RA 2K1BA 3HOUB 1NR2A 3AEAB 1FD7D 1PFDA 2BE5C 2KEDA 4B9XA 2F0FA 1UEAB 5MPOA 4A3IB 2AUJD 1IYUA 3U9OA 1LO5D 2LJIA 4XDDA 4KHZA 3QB3A 4N58A 3SXHA 1JWBD 5C3XA 4DQOC 1SNCA 4V190 2WP9B 2TSSA 1J7CA 4RF0A 1DM0B 3VYSA 1GHJA 2J0TD 1CTMA 4MIUA 1YN4A 4CKBA 3TMEA 2YEPB 2BTEA 1LV9A 2W55A 1ESRA 4A3EB 2ICIA 3DHQA 4ZUJA 2K22A 3VR4A 1PRTD 1ACCA 1DOMA 1CZPA 4A90A 1JW9D 4RGTA 1I50B 2L83A 3W9CB 5CR3A 3P1HA 2H88B 2CJNA 1H9SA 2A6ED 2M56B 2V3PA 2XNAC 2NVTB 3HEJA 1YN3A 3GV6A 2F1MA 4FXDA 1MHHE 3GTOB 4TQ1A 1KF6B 2F4IA 3P42A 2KQ4X 2FUG1 4FP5D 1Z47A 1PTOF 1OXUA 1SF0A 4NZLB 1MPEA 4LK1C 4KN4C 1LTBD 1RTNA 4NP5A 2F0IA 3I4MB 1F77A 3B9JA 5ELFA 3KLSA 3SK6A 3Q24A 1SSNA 5FO9B 1F9PA 1NUCA 1HZ6A 4LAAA 3GTKB 4IURA 1QOGA 1SEBD 2PYKA 5D14A 3J7YW 2B2YA 1A15A 3BDCA 1MBYA 2BA0A 2VNUD 4N6EB 4C80A 1EYAA 1N63A 2DN8A 2EYLA 3ZJUA 3MXPA 5C4JB 1W6JA 3IFDA 2I07B 3T53B 1WTQA 1SYDA 1QNKA 4DAYA 2PNRC 2WXRA 3CHBD 1TKGA 1BR9A 2F3WA 1SYGA 5HG2A 3NWTA 1HUNA 2IGHA 3K5LA 2FINB 5C0XJ 1IGCA 1SFOB 4QMGA 1E7PB 1OXTA 2K28A 2NVQB 3HKZB 3A56A 4OZBA 3CRLC 1PFNA 3M4YA 2PCFB 5C6AA 4K6DA 5EQ0A 2MEKA 1BXTA 3FPUB 2A69C 3VRAB 5EE1A 5IGBA 4L8JA 2AQ2B 4G7OC 4RCNA 1F2RI 3ZQ4A 1RM6C 3ERQA 2J4XA 3AE2B 4K5VA 2ENBA 1LACA 4OIJA 1XEEA 1F9QA 2DYMA 4RWSC 1SMYC 1YNNC 1WTOA 2WXIA 4TQUS 2D62A 3IAS1 2E2DC 4KJNA 2LY7A 1YQ3B 1LT5D 3MHZA 2DNEA 5D65A 4YWGG 4C3IB 1I7HA 4XYOA 3ND8A 4CJ1B 2Y5CA 5BMHA 5T1IA 1Q90A 5E4XA 4FXKC 1EIHA 3F2UA 4M1UB 1JWMD 5E1FA 1DOYA 4HSVA 5LL6S 1HFNA 4YSZB 1MD2D 3W5VB 1G8ZD 2A5HA 1SYEA 2YU9B 3S1MB 1U9RA 2R6GA 3KF8A 1LLRD 1O78A 2NZ1D 5FK9C 2NWGA 1DD2A 2FE8A 3H09A 4IFDJ 2JYOA 5LL6X 4MHEA 1EY0A 2IT1A 5C0XI 3HVZA 4LJZC 2B2WC 4JWUC 2WS3B 5CV6A 3R3OA 3CWIA 4HR7B 1OO9B 3FEWX 1XLOA 2MGSA 5C0XH 2R92B 2WXJA 5JOBA 2B2UA 4GDKB 4JPSA 3AEGB 3VRBB 1TS5A 5IIFA 4EE2A 2ZXOA 1JICA 1XLNA 3Q8FA 2F0PA 2ID0A 2WXFA 1STEA 5M3FB 2H1EA 1B44D 2FFKB 1TYGB 4AQ7A 1K8MA 1BUIC 2EJFC 2YEPF 5A35A 1ZYRC 1C77A 1DGJA 4ZK9B 1MHXA 1EY7A 2V4IB 3QOLA 3TZDA 1Q1EA 1TS4A 3TN2A 2QIEB 1J8IA 3HOYB 1RJTA 3VYTA 3E5SA 2PZTA 2DLBA 2INPE 1V8QA 2G9DA 5ELBA 2BBCA 4DNRB 5D7GA 1EIGA 4KGTA 3TUOA 5DM73 4S3SA 3Q8CA 5M5YB 4BBRB 1I4XA 2KCCA 2EPBA 4IUNA 2WDRB 5I2XA 5CORA 2KJXA 1XYIA 4PMCA 3FVQA 3I57A 3Q8EA 3RFZB 1VDVA 4K5WA 5EKLA 2PTLA 2A74C 1QCBD 4JX1C 3RZDB 4L6TB 2E3TA 1SJHD 1F9SA 3Q0AA 4CKCA 4IFDI 3MAQA 2W3RA 3LB8C 1VLBA 1R9TB 1VRAB 3HOWB 3GO5A 2EYFA 3M85A 5COYA 1CJEA 3AB5A 1OXSC 4IFDH 1STHA 1EM7A 2QJLA 1FNWA 2R93B 5IT9E 1Y69U 2KCNA 4IN3A 4NMZA 3VR5A 5ELCA 1CI3M 1YMHE 2F0VA 2K5WA 5IT9L 3NVZA 3E56A 2Z4HA 4HSPA 4GDLB 2F0WA 3W3AA 4L2YA 1FXIA 1UWXA 1I4RA 1VCIA 2B2VA 5HURA 3IKJA 2DY8A 5I6WA 5KNBA 1SE4A 4FF4A 1WSPA 3AE1B 2QMTA 2IGDA 2IPKD 4DN4M 4HCSA 1B53A 4TRDA 3TDQA 3IT4B 3VQIA 1GPXA 1JE4A 4KTAA 4NJCA 1EL0A 3AE6B 1QWYA 5JVG3 1O80A 3GTGB 3ABVB 3H6MA 1SNPA 3W1SA 3IL8A 1QQRA 4EGVA 3W2DA 2Y0SB 3GV3A 1O7LA 3D31A 4RGOS 1M8AA 2KUMA 4DF7A 2CQAA 1TU2B 3H91A 1Z6HA 3GS2A 3Q8AA 3OWEB 5I9OA 1HCZA 4C3JB 3IAYA 3JAML 2BA1A 2PW9A 2EYJA 2IW3A 3MWYW 2MP1A 3AEEB 5CBEE 1EZ6A 1L0VB 1ONLA 3O13A 1NAPA 1ENFA 2Z1CA 1O7YA 3X3MA 1OQQA 3Q8BA 1R7SA 1D5MC 3B2FA 3V96A 2A69D 1FCLA 1PTOB 2B76B 1NENB 1NR4A 1Y8PB 2X38A 2LUMA 1E2ZA 2K0PA 1EY8A 3LNNA 5C3WA 2RSNA 1X3PA 2L11A 3P20A 4PV1C 1SMYD 1YNND 2DBYA 4IALA 2IGGA 2A73B 2JZPA 3VR6A 2F0OA 5G5HA 2A6HC 1DOIA 2O4XA 1SDFA 3ZJVA 1B50A 4KGRA 2XRQD 4K8JA 2ZW1A 3NUHB 1UUPA 1ENCA 4KKUA 4TSSA 1STNA 2K04A 3VR9B 2BDOA 2N88A 1V97A 4BBSB 2PVGC 1N62A 2D2CC 1PTOH 4ARCA 1E0ZA 3DWAA 1DZ1A 3J9CA 1HQMC 3N9YC 2WDQB 1KNEA 3HG9A 3BWUD 2KEEA 1C8CA 1LT4D 3GP7A 5C2TB 1J9OA 5E3FA 4C3JG 1JOOA 2RQXA 4PT5A 4YTNB 5EE9A 4B08A 3AEDB 4JK1C 2GB1A 4E6IA 4BY1B 1PTOD 1PDQA 1QG7A 4KD3A 1SYBA 5IODA 1CA6A 2PMVA 1YJJA 3AE5B 4LLGM 2H4OA 1F2RC 3HOZB 2OHFA 1RODA 4DU9A 1A6XA 4DAPA 5KNCA 4IDIA 1N5WA 1AYFA 1AWDA 5IGCA 1S5BD 4R9WA 3MXNA 1YNJC 5LNK1 3S1NB 2N9LA 2M0AA 2F0JA 5JEAJ 1BCPC 4DK0A 2EJMA 3DEOA 3I4LA 1TWHB 4ZRPA 1AN8A 4CHTB 3UI2A 3HOXB 1XTCD 4ZRZA 1EOTA 1PUTA 1EYCA 1BUVT 1FFUA 3NQTA 4K8IA 1LTTD 1FRRA 1S5ED 4WFN3 1Z7TA 4K6LA 3EA6A 2M00A 4YTMB 4FF2A 5CBAE 2C5CA 1C4QA 2L0CA 1ML0D 1PZKD 5EBDA 1SE3A 5FLXL 4KKJA 3W5UB 1TWCB 3FAHA 3NWSA 4IUUA 4FXCA 1PDXA 2W3SA 4G7ZC 1EYDA 5FO8B 1XO3A 2EYPA 1RFKA 3S16B 1FMAD 2B2TA 1PGXA 3R93A 3LWEA 3I3CA 1V1OA 3WOEA 2WAQB 4DAVA 2XSCA 2AUKA 1W6KA 1WD0A 1EWYC 2AQ1B 1SAPA 5K36G 1KDBA 3PZ7A 1EY9A 2DNCA 1GUOA 4XWTA 2Q8RE 2F0TA 4REZA 3M7NA 1EEID 3AMUA 2X6GA 1IW7C 2PPBC 1V8CA 1ZDVA 2DYOA 1FNVA 3VA7A 3WCQA 1HTPA 1CHQD 4Y7NB 2M9VA 4ZOHC 1JWAD 3P4QB 1TWGB 4NW2A 1TWFB 3D4RA 3OMGA 1SSOA 2Y5PA 2EYMA 1HHVA 2AQ3B 2OT2A 4RAUC 4TMAB 3RD4A 3V2TA 1RWSA 1LTAD 3K6OA 3AE9B 1AFPA 2JXMB 1MSHA 1LTSD 5JPNC 4IQZA 4BA2I 5BMGA 1ZOYB 2F0LA 1ZKOA 1TKEA 4H44C 1ZXTA 1WTPA 3VYRA 4XWWA 1S5FD 2SOBA 1A3TA 1TKWB 3DWPA 1PGAA 2PZWA 2WXKA 4OL7A 4X3KA 5IGDA 2B2YC 2RDHA 4XYQA 2BB5A 5KYLA 3HUIA 2WXLA 1MI0A 1QLBB 4U673 3CIRB 3BVZA 5KNDA 1Q1BA 2PLPA 1P7EA 2G9HD 4CJ0B 1L6VA 2E2JB 1VZ8A 5JEAG 1VMCA 4ZQ3A 1WWTA 1BBXC 1ICWA 2FJ2A 1K83B 2LMCB 4D2KA 1N61A 4LK0M 2J7ZA 2NTSA 2K5DA 3GD7A 4HEDA 2O5IC 3FPPA 2EY2A 2D5DA 4UAIA 4XDCA 4ODGA 4P16A 2MUYA 3BIID 3NTHA 4RHRA 1JB3A 2VB2X 1CHPD 3LWUA 1U4LA 1BMLC 2VZKB 2CHBD 2E2HB 5EE0A 1HQRD 3URYA 4RF1A 3FMCA 1SNMA 4GLSC 1G2TA 3NUCA 4R3DA 3KK7A 4AYBB 2HDLA 2A6HD 4MT5A 3TEYA 1BCPB 2GI9A 4FNFA 5FOBB 1TY2A 1UNSA 2KOLA 2IJ0A 1A2TA 1L0YB 1E0BA 1EWHA 2KAJA 3TEZA 1G91A 1F2MA 3OWFA 3VR8B 3K7AB 4G4KA 1QILA 5CC4A 3BYTB 2SNSA 4EVOA 1J7AA 4GZYC 2RPVA 5CV8A 5BN4A 1B3AA 3NXWA 1XXGA 3BG3A 3NPPA 2XVSA 4HAEA 5EPKA 2K03A 1DOXA 2K01A 4DFAA 1YQ4B 3A7LA 3FRPB 1H9KA 1SIJA 3T3NA 2BCOA 4HJGE 2PW7A 4HCEA 2JXTA 2ZW0A 2SNMA 3P4PB 2WACA 3EGRA 5BYRA 2QEJC 3DXJC 2RMMA 1TS2A 2E2IB 2BYTA 2EXZA 2JA6B 4FYDA 1ZP0B 1R4PB 1EZ8A 3VR3A 1RYJA 4UDUC 4A3MB 2EYOA 1XX8A 4C7YA 3HVDA 2A68D 2RDGA 1GUTA 4P2CB 2M2LA 2VZKD 1FO4A 1PXUA 4OGQC 5AFWA 2B2UC 2NVXB 4RA8A 2CW0C 3IAM1 1N5XA 4J8QA 1CA5A 2Q8TA 4BWGB 3AE8B 1GUNA 2BS4B 2NMQA 1JOKA 3MA2B 5JAVA 1BCPD 2B2WA 3ITPA 3NRZA 4ITKA 5BN3A 3QIAA 1ET9A 4ZHPA 2X6LA 4RFBA 2KDMA 3T51B 2BT6A 2EY1A 3H0GB 4KY7A 5IGFA 4X3UA 5D3IB 2G1EA 3TZUA 2JX5A 1I3QB 1RD9D 1DOKA 3CU7A 5J22A 2XWJB 1LTRD 3WOFA 3AE3B 5EKKA 1F2ZA 1TS3A 2XIWA 4X3TA 2NN6G 2JU6X 2BE5D 4KX6B 1GB4A 2MJEA 2E76C 4G7HC 3FKIB 3OPOA 5KGUA 2FMMA 1ZUD2 3P1MA 4EQNA 1GOZA 4RH6A 1GAQB 4A93B 4NKLA 4RGMA 5BMIA 5F2DA 1QE6A 1BNZA 1ZE3D 1RHPA 4KI0A 3M3YB 1DYQA 4ZLTF 1K51A 3UI3A 3QWNA 3Q22A 3QJYA 1UAPA 1STBA 2LKVA 3BK2A 1WYGA 1S4ZA 4J1MA 5LHY1 5T8IA 1JQYD 2R61A 2HDMA 3P4RB 1IL8A 3DEPA 2F0EA 3S1RB 5JVH3 2WNMA 5M5WB 4CQNA 1C4CA 3L3OC 1WCMB 4OO1H 2E74C 5FO7B 2Z4IA 1BOSA 1T5EA 1FD6A 4DK1A 3AH7A 1ZXIA 1C48A 1YNTE 3FDTA 3BS1A 3NP8A 2JA7B 4H13C 2RKSA 2EVBA 1IGDA 3KQ4A 4IOIE 4MACA 5DEHA 5EPLA 3NTKA 1TY0A 4OHJA 4L63B 1XLQA 3AEBB 4H7BA 3NVYA 1WRIA 3BK1A 3X3NA 1ILPA 1IUEA 4YT0B 2ONQA 1IYVA 4K5XA 4WRDA 1E9MA 5GXGB 1ILQA 3SDZA 3SK8A 1SNDA 4ZRQA 4HEA1 4YSXB 3U52E 2BW2A 4NDXA 4BA1I 4PNYA 1L5PA 1PRTC 3CQZB 2N9KA 1CFMA 1X3QA 4ABNA 3HOVB 4IUVA 3NS1A 4OO1G 4M8AA 3T56B 2CU3A 2V3NA 1BCPF 1FGBD 4YTPB 1VDZA 5D3DA 1WTWA 2PW5A 2K9XA 2OEOA 1NVID 5CMDA 1GB1A 1MGSA 4FO2A 5C44B 4WORA 3JAME 1T5XD 1JWSD 3U4EG 4TKOB 3ZYYX 1C78A 4KJOA 4WJWA 2F0QA 4WQMA 1B9RA 2M19A 1E2VA 2FHTA 1H9JA 3KBGA 5ELDA 4H2AA 4F87A 5CYUA 3OW7A 2KN4A 2V4DA 1FM0D 4USAA 1ET6A 1HA6A 3TP7A 4IKGA 1WVLA 1K50A 2L1AA 2B39A 3PO3B 4L1BA 1G2SA 2J53A 4ILWA 3MXUA 3D6CA 3OHXC 4EQPA 2WU2B 4XIGS 3J81L 1UWMA 4IUTA 4A3FB 2E75C 5E4WC 3TEWA 2TMPA 2HCCA 2QDBA 3T4AC 5K5PA 4KD4A 4LTUA 4XQJA 2L5TA 2MHVA 1U4PA 1VF7A 4RHSA 5C4XB 5EPJA 5M5XB 4WIPA 1BQQT 2RA4A 3SEBA 5C4ZA 4XDXA 3EUB2 4A3JB 1S5CD 3J80E 2R7ZB 1CZGA 1QOBA 2F0MA 1VZ7A 4J3OD 3MP9A 1ENAA 1KDAA 2I38A 3PMFA 3J80L 1HA5A 1CQFA 1TZOA 1ZPSA 4WURA 4US8A 2H89B 3BYYB 3U7ZA 3OIPA 5EBCA 3KLRA 1STGA 2OEDA 4R8NA 3AEFB 3NBHA 3AMZA 3BDOA 1Y56A 1JMLA 3RLFA 2L55A 3NQIA 1HTLD 3GTJB 3GTLB 5T1GA 3S9WA 5I2YA 3A54A 3ZGZA 4N9TA 1L4ZB 1AW7A 4EQOA 3I8ZA 5CGKA 3CRKC 3RMHA 4ZKBB 1B1ZA 3V05A 3OMCA 1DOLA 1KDCA 3TP8A 1GXDC 5CV7A 1SBBB 1I4PA 1STYA 1DONA 2CW0D 2BB6A 3SVMA 3IXSA 5NUCA 3BVGA 4HRSA 3U2SC 2DY7A 5C5MA 1L0XB 5CV5A 4KKIA 2L9HA 2V0GA 2F0DA 2LMCA 4WAFA 3OOCA 4C3HB 1ZYRD 1EQVA 3MTSA 1JROA 1RDPD 2ICEC 2XRSD 3HS0C 4KKSA 1KTKA 1IKLA 4O42A 2JQRB 2WXMA 3N6RA 3KWVA 1D4BA 2ZXRA 3KUPA 1FFVA 2VUMB 5H92C 3K0YA 1PFMA 1FCCC 2KECA 4DXGA 4CBVA 2LS01 5KIXA 3L4PA 5G5GA 3HGBA 3S1QB 4ZUIA 5KYIA 4JBWA 1EFID 1GHKA 1PYWD 1RCVD 3H3VC 1SNOA 5K36H 3TP6A 2WP8J 1XCTL 3Q6SA 3I73A 3HP3A 4XT1B 1XWEA 5FR3A 3VR2A 3PV0A 2Y3AA 4LMQD 3SE0A 1JR0D 1ZXHA 2KA7A 5FLXE 4A8XC 4R8IA 1OQRA 1EY4A 1PMRA 1QJOA 2LFNA 1KLUD 1C79A 2CJOA 3Q23A 4DNTB 3AM9A 3DWQA 3LYYA 3AB9A 3SR1A 2RSOA 3D4WA 1E6EB 1Y8NB 1HXYD 2L4NA 5EJWA 1K52A 3M7GA 3NK9A 4Q2JA 3MZ5A 2K5PA 2QILA 2WXPA 2WLBA 2B2TC 1STAA 2WXHA 1XLPA 2KQ3A 4FVMA 4HROA 1I6VC 3U9SA 4A3BB 3T13A 1LTGD 3RZOB 2JA5B 4O1NA 3T16A 5EGTA 3CKIB 1F0ZA 1CK1A 3BZDB 2BS2B 4CGYB 3TEXA 2WXNA 1MSGA 1CQVA 2K5QA 1TVXA 3SHLA 1KH0A 4YXDB 4Q5VA 1WGKA 1MI2A 1EY6A 3AECB 4HMJA 5H8YE 3T3OA 3HRDD 3EROA 2Q5WD 1N60A 1G291 2WV6D 4F7XA 2PIAA 1L6UA 2KVMA 2K6AA 2ZT9C 1WTVA 5I9PA 1NYQA 2AX5A 4I7ZC 4C3HG 3MVVA 3RPFC 5HFYA 3DM1A 3GTMB 2JA8B 3SK5A 5JEAH 3DUZA 5JPMC 1A3VA 1Q3LA 1FEHA 1EY5A 4IUPA 4XT3B 3NVWA 2YYZA 1PLFA 2AWNA 3FC4A 3GQBA 4U68A 2MJDA 3J7AF 1DJRD 5DAUA 5IOCA 1JALA 2Q8IB 2JYTA 1NCVA 1A70A 3P75A 2ZXPA 1SXTA 2SDFA 4HTHA 3PIO3 4FF1A 4C1NI 2WXGA 1DXMA 3QO2A 4C2MB 3R2TA 4NAWB 2N55A 3K5OA 2WKCA 1KRHA 4OW0A 1A3UA 3D8GA 3P4SB 2GA4B 3SFEB 3C2PA 5BYQA 1KNAA 4G57A 1DCZA 2JSVX 2SAKA 2K32A 2WINB 3E0JA 3L9AX 5KEEA 4A9AA 2MH7A 2EY5A 3BVMA 4C7ZA 1GUSA 2NTTA 2OXPA 1K8OA 5C3JB 1QOFA 2FBWB 3FILB 2J52A 3MJ5A 3IT6B 1I6HB 4Z9CB 1X32A 4I65A 2MJ8A 3MFGA 1FXAA 2QKIC 4QCLA 4RKLA 4KY6A 1WD1A 4WH4A 1V43A 1IBXA 3LXFA 5FKAC 4ZYSA 3G6JB 4PMBA 4OZAA 1EEFD 3S17B 1KLGD 1YJIA 1RF2D 4P6VF 3GB1A 3MFYA 1IHZA 1PZJD 5E6JA 2IDYA 2BDNA 3A8KE 1FRDA 3EJIA 1GUWA 2LFIA 1C4AA 1CM9A 1FYCA 1D5XC 2LHDA 3NBIA 3P63A 2JWUA 4RGNA 2QF7A 4BS9A 3S2HB 5C3EB 1TKYA 3ZJTA 3AV8A 3C1FA 2OF1A 1SB3C 4V0BA 1M4VA 2W54A 4B0MA 2B8FA 1H9MA 3I4NB 1EU3A 1HZ5A 5C4HA 1ROEA 2HUGA 1R4QB 2Z8LA 3L7ZC 1LABA 2WDVB 4XQQA 2PVOD 2F0NA 2WIIB 1V1PA 2NBFA 3SFDB 4J6HA 1XF5L 4B9WA 2PKOA 2HCIA 3NE5B 4RNAA 2EYHA 4H0LC 4KKTA 3RUZA 1NI3A 5EKIA 1PRTF 2C9OA 2NN6I 1T6BX 1WTRA 2LHEA 1QOAA 5HHDG 3GTPB 5TSSA 2I46A 5BYSA 2F0GA 2RVLA 3KLSX 4K2LA 2B8GA 5I6YA 2AWOA 2IWHA 1QOHA 4BY7B 2NN6H 2HTME 2WB1B 3DMUA 3EFXD 4A3GB 4CJ2C 1A2UA 1Y8OB 1D2BA 3C46A 3S2DB 3E9SA 4A6QA 2BOSA 1YNJD 1EWCA 3PIP3 2WKDA 1SNQA 4F88A 2F0KA 2PMZB 5AUIA 3NVVA 1Y1WB 2PZUA 1II3A 4TQ0A 3BDLA 1JQ4A 3KBXA 5C5LA 1VZ6A 4K14A 4IZ8A 2I2YA 3TP5A 1H9SB 3PZ8A 1S5DD 1PTOC 4RCOA 1TQOA 2JSOA 1GJXA 2INNE 4MH8A 1D5ZC 1ZDXA 2JEBI 1ESFA 5CV4A 3OIQA 1C76A 2L32A 1G6ZA 1NYRA 1NSNS 4N9PA 2EELA 3M4OB 1CT1D 2XN9C 1JOQA 2KACA 3PUYA 3HRZC 1H9RA 1TT2A 3MC0B 2MJ3A 1RTOA 1K53A 2F0HA 1UGJA 1PZID 3SR6A 3K58A 4XE0A 2O2LD 4KHVA 4Q0FA 1HRJA 3H8HA 1Q10A 1B4OA 1TR5A 4KK7A 3LX0A 3AN1A 5C0XG 3NSWA 1C4PA 4AS1A 1FIQA 1JRPA 2L12A 4A3KB 2JP1A 4C3IG 1CZWA 4A55A 2MPMA 4OO1I 1XCQL 1D1KA 1IBXB 2QSDA 3C8YA 1EQTA 1FNUA 1IW7D 2F0SA 3MHBA 1LTID 2WXOA 1RKNA 2JE6I 4US9A 3AE4B 3PO2B 3PUXA 1Q8IA 1B9MA 4RKBA 3K57A 2N0SB 3GTQB 1PFBA 5BN5A 3PUVA 4ZHOA