1P7EA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
molecule tags Immune system
molecule keywords Immunoglobulin G binding protein G
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7eA00
2IGHA 1IGCA 2KDMA 1JMLA 1MHXA 1ZXHA 2ZW1A 5BMHA 1IBXA 2LGIA 4D2KA 1QKZA 1YMHE 1P7FA 2JSVX 5JXVA 2KACA 2GI9A 4KGSA 5HG2A 1MHHE 3MP9A 1EM7A 2OEDA 1KH0A 2IGDA 5BMGA 2JXTA 2JWUA 4KGTA 2EELA 2J53A 1IBXB 1HZ6A 1XF5L 3FILB 2I2YA 4GLSC 2RPVA 1F2RI 4HJGE 1MVKA 1HZ5A 1MPEA 2QSDA 5BMIA 1GB4A 1MI0A 1HEZE 3V3XA 1K50A 3GB1A 5HFYA 2GB1A 2LHDA 5HI1A 4OZCA 4IOIE 2ON8A 1K51A 1GB1A 2KWDA 5HHDG 2LUMA 2NMQA 4OZAA 2ONQA 2KQ4X 2QMTA 1D4BA 2JU6X 2N7JA 1K52A 4MACA 4WH4A 1IGDA 1YNTE 1FCLA 4OZBA 1UWXA 2PW9A 2PTLA 2N9KA 2K0PA 2J52A 2N9LA 4HKZE 2KN4A 1F2RC 1PGAA 1K53A 2LHEA 4KGRA 1FCCC 1XCTL 2PLPA 1FD6A 4IKGA 2JZPA 1Q10A 1P7EA 1PGBA 1PGXA 2IGGA 2RMMA 2I38A 2ZW0A 1C9FA 3FILA 1XCQL 3UI3A
chains in the Genus database with same CATH superfamily
1YN4A 1HTQA 1NBFC 3KUDB 5FR3A 4P1CC 4FHJA 3T8MA 3DHIC 1HTOA 3WANA 2B76B 1QILA 1UZXB 4DDGD 1GC6A 1XLQA 1T6BX 2K6DB 3UQBA 4HPMB 3NS1A 4FLHA 2VRRB 2WXIA 4WWNA 1I4RA 2JWUA 4QAYA 2DZJA 3Q8FA 2KLCA 2CU3A 5J18A 2HTME 2W55A 3U7ZA 2ZCCA 1UBIA 4BVUC 3GB1A 2SAKA 1N5WA 2I1JA 2H89B 3NY5A 4O1NA 4XYCA 2WXKA 4DHZE 4WQMA 1WXAA 2KKCA 2N7DA 2BQQA 3RMKC 2LMCA 2LJ5A 3BWUD 2E3TA 4IUMB 4ARIA 3PHWB 3WA0A 2WXNA 2YEPF 2I1KA 1LQBA 2L7RA 2PTLA 1JCKB 2N9KA 2PPHA 3NVVA 2K0PA 2J52A 5AUKA 2MLBA 1SE9A 1PFDA 1I35A 3RZWC 4K3CA 4IKGA 3ZNGC 3HM6X 5T8IA 1SE2A 2WU2B 3ML9A 2KYWA 2XK5A 3VR8B 3I57A 4WJOA 1WSPA 1WZ3A 1YD8U 2L00B 3QJZA 5L83A 3ZKJC 1VZ6A 3N1ZC 1TJEA 3A4SC 4AWJA 2BF8B 3R7RA 4K3BA 2NTTA 3RYTA 4GDKB 2L3ZA 4DBGA 2ASQA 1WGYA 4B0EA 2N1WA 3AU4A 4LCDE 2WXGA 1KLUD 3ZIMA 4MGKE 1RM6C 4JWSC 2JUOA 4KGSA 4WJNA 3WAMA 1YX5B 5HG2A 2JQRB 2NBWB 4DHJB 2NS5A 3R7QA 1TS5A 1FO4A 1KRHA 4E74A 5BMGA 3W5UB 2O6VA 4A9AA 4HPPA 1JWAD 3BVMA 4DQOC 4F8CB 4RCOA 3TUOA 1HZ5A 2MX2A 2MJ3A 1XXGA 2IO3B 3IVFA 4LLGM 2MHJA 4W9DA 2J7QB 2LUMA 1V8CA 2NMQA 1I7HA 1FNWA 3QA8A 4YT0B 2R61A 3UF8A 1D6EC 2N4FA 3V6CB 1FCLA 2KTRB 4DHJD 1TY0A 2MA9B 1WMHA 2PE6B 2KN4A 5IN7A 3MC9A 5D3DA 2IYDB 3W2DA 1E8ZA 2V3SA 5G5GA 1CQVA 3H7PA 1Q10A 1GAQB 2Z0DB 3VTWA 1LFDA 4HCNB 1SJED 4PYUA 1E10A 2K8CA 3APDA 1SBBB 2GRIA 4JPSA 2DNFA 2QCZA 3Q8AA 4JQWC 4WIPA 3RCZA 3Q8CA 2WDTB 1NI3A 2HD5B 5BO4B 4DDID 4ARCA 2IDYA 1WJ4A 2ZVNA 3CMMB 2JZZA 4C00A 4YSYB 3QAQA 3VTVA 1TGZB 1JWUD 5JXVA 5IOIA 3VUWA 2INCC 4URKA 4MGZE 4P6VF 3CF6E 1MHHE 3ZXRA 4YTPB 3PGEA 2RR9A 3L13A 3ZJVA 1WXVA 1XLPA 1EM7A 4G3XB 1Y56A 4JLCA 3MJWA 1EU3A 4C56C 2DYOA 2WWZA 1J8CA 4DWFA 3SFEB 4NJ7A 3A9JB 3DBSA 3EFCA 3EFUA 4ASWC 2Y3AA 4F1SA 1D3ZA 1UF0A 1WX8A 1S1QB 3AE3B 3JSVB 4HJGE 3ZRFA 5BMIA 1VJKA 2IBIB 1OEYJ 3U2SC 4NJCA 4KIKA 1ZW7A 1WGHA 2GB1A 2LVOA 3GS2A 2FUG1 2C5LC 3L08A 4OZAA 4MH0E 2DHZA 4ZHOA 3DBLB 3BYTB 5DPRA 3CSFA 3ETRA 1IGDA 1SIJA 4NNJB 2Q5WD 3UQAA 1FEHA 4FULA 1J7BA 1WI0A 1ZP0B 1AN8A 1GG3A 2BW2A 2V9HA 5EE3A 4A3PA 2BS4B 4AP4C 2WU5B 2D3AA 2J42A 3K9PB 3M3JA 3B0AA 1DOYA 2INNE 2K8BA 3ZLZA 2D5GA 2MEKA 2AQ2B 1IP9A 4K7WA 4LJOB 2AWTA 5MPOA 4HVBA 4OVUA 3QCAA 1AYFA 1X1MA 4EKUA 3TEXA 4ZYNA 3DWMA 3V61A 3KYDD 1K8RB 2LRUA 2PE9A 2AYOB 1J19A 3MTNB 2DZKA 2WDVB 3V60A 2V1YA 2WLBA 2X38A 2DBYA 2DLBA 3PO0A 2KK8A 1U4AA 4JIOU 1WM2A 4ZDVA 4LJPB 1V97A 1OEYA 1WE6A 4GN1A 5DCNA 3S2AA 3ZQ4A 1V1PB 2BYTA 5IAAC 4LNNA 4ANUA 5CX3A 1F2RI 2L0FA 1C4AA 1NDDA 1CK1A 1HEZE 2QILA 4AOFA 3Q3JA 5HI1A 5CHVC 3TEWA 2Y5BB 2LXAA 3H7PB 1CJEA 1ZOYB 4DXFA 3AEAB 1KFYB 5JHBA 2JU6X 2WS3B 4GU2A 4MACA 3R2TA 2WX0A 4K7SA 5DPTA 2KTRA 3PZ8A 2WXJA 2IO1B 1A70A 1MFWA 3PLUA 3N32A 1XCTL 3VRAB 2N1VA 5D6JB 2IZVB 3O65B 3A1QA 2BYVE 3QX1A 1GOZA 2UWQA 4US9A 2WXFA 3HHMA 2PMVA 1D5MC 2KQSA 3DVNV 1TS2A 1R7SA 3CSTA 1R4NI 4XGAB 4W9CA 2G9HD 4W9JA 1KF6B 2MBEA 2M17A 2LZ6A 2Y5PA 2GOWA 4D2KA 3SR6A 2BB6A 4J3OD 3V62A 4BKGA 2A5UA 2KAJA 1T0YA 3HK0A 4RF1A 3Q2AC 1WMHB 3AM9A 1JWMD 4FBJB 2C7MB 3I63C 5TSSA 3KUZA 3TEZA 2C9WB 1SSNA 2CJNA 1TKEA 3ZUNA 1OFFA 3WIMA 1EF5A 1LGRA 2Z8LA 1ZPSA 2BS3B 3NHEB 4M8NA 2CS4A 1SEBD 3N20C 1R4NB 1XT9B 4C7ZA 1L4DB 1PYWD 2KDBA 3IT6B 3EHVA 3RFZB 1TZ1A 3N30A 2GLSA 2OJWA 4M0WA 3D32A 5HHDG 3AB5A 3SFDB 3ZNHB 1V2YA 3Q3NC 2N7JA 1WIAA 4MDKE 3HRDD 3C19A 2D3CA 3FAHA 1IUEA 3IAM1 1SB3C 3DBLI 1C78A 2BYFA 3DDCB 2MP2A 4NQLB 1FNVA 4WQOB 1PGAA 4ACFA 3PZDA 2LHEA 4II3B 3BVZA 1NYRA 4KDLB 1R4MB 4MM3B 2JZPA 3WALA 2REXA 2KO3A 1TS4A 1J0GA 2J0KA 4HXDA 4LNKA 2JVCA 2N9EB 4GXBA 4LNFA 3U52E 2BWFA 3VVWB 1DGJA 4DHZB 1EF1A 4HDOA 4HK2A 1YN3A 2QJLA 3EA6A 1XQQA 5EE0A 1GJZA 1MG4A 4X57B 1B1ZA 1Q1OA 5GXGB 4WJPA 3TSSA 1FXAA 4ANVA 1V6EA 4ZRKA 2LUEA 3E56A 2VH2A 1UWMA 2PJHA 3NOBA 3ML8A 2GBKA 3VHTC 1KLGD 2DAJA 3MP9A 1M4VA 1F77A 2PVGC 3NVWA 4TV3A 3U7DA 4M00A 2MJDA 3RN9C 4LDTB 2KT7A 3P63A 3DVGY 1QOBA 3Q6BA 1E8YA 2D3GA 3TMPB 2RPVA 3PTFC 4BBNC 2XN9C 2DWQA 3AULA 3Q69A 2WXOA 3PV1A 3PRZA 1N62A 4KV2A 3H6NA 4DXAB 1EWCA 1YIWA 2EMTA 3R2IA 3P4PB 2W3SA 4I6NB 3DHHC 2KWDA 4BKSA 4LTUA 4M02A 2MBBB 1TKYA 2FUHB 1AWDA 3A4RA 2JY6A 4FXCA 3VDZA 3VFKA 1GPXA 3VAWA 3SHQA 4MGIE 4WWMA 1UH6A 1BXTA 3RNGC 4M0WB 1KOTA 4HLEA 3BYYB 5DPSA 3UIPB 3EC8A 3L17A 2D3BA 4R3DA 1F0ZA 2M8SA 2IPKD 4H2AA 4AS1A 1PGXA 1F9JA 1SE4A 2Z0EB 4EE2A 1Q5WB 2KMAA 5KHQA 1WRIA 3DBHB 2IGHA 4JE3B 1L0XB 5H92C 1JMLA 1MHXA 5BYRA 3TEYA 5DPWA 1FXIA 3HM3A 1UUPA 3EGRA 1WR1A 1IBXA 1DYQA 5CTRC 4N59A 2AX5A 2N7EA 3AE6B 2ZZPB 3GE3C 1OGWA 1SF0A 3PZ7A 1ESFA 3VQIA 2KC2A 2JSVX 2GBMA 4ANXA 1V80A 4A3OA 2GI9A 4JL9A 4IM2A 2KMCA 1N60A 4YSXB 2ZNVC 3T3OA 1OQYA 2KWVB 3BK2A 1HZ6A 1ISNA 3BINA 2Z59B 3W1SC 3QWZB 4C4VA 4LK0M 4P1BC 3RZFA 4A8XC 1STEA 1ZGUB 1LM8B 2K3UA 3NG0A 2N9PC 2J4XA 1SGHA 2W82A 4FJVB 4IOIE 4FHKA 5E6NA 2ICIA 4ZHPA 2FAZA 2W3RA 1RAXA 3HUIA 3U30A 5JZEB 3HIZA 3AE4B 3ECIA 4ZRIA 1T3QA 4PS8A 5G2NA 2DZMA 2PVOD 4EOYA 1TKGA 3A33B 4HROA 2AQ3B 3SEBA 2KWUB 2JZ3B 3LJ3A 1C77A 1L2NA 5C2TB 2L83A 2PIAA 4OVVA 1UBQA 4MSQB 2XBBC 4RM9A 1T0SC 1FIQA 3IBEA 3E9SA 2WXLA 2M1MA 3PRPB 2ZNVB 2KLGA 4LNIA 4A55A 4ZOHC 4W9KA 5C3JB 1C79A 2KNBA 3VH3B 5JH5C 5HKHA 2LGIA 2JF5A 2JX5A 1YJIA 2KJ6A 2YEPB 4USAA 4WAFA 2BT6A 4EZJA 1KLVA 3AE9B 3V6EB 1DOXA 4BOSC 1D5ZC 2BGFA 1E7VA 1WYWB 2WXPA 4W9LA 2MH7A 3ZNZB 3QHTA 4KVGB 4XDDA 2IGDA 3AI5A 3DCGA 2C60A 2G1EA 1WGDA 1F52A 3MC8A 4K81A 4YWGG 2J53A 3ZGZA 4MH8A 3B2GA 2L05A 3A9KA 2OJRA 1RWSA 1MVKA 1GB4A 3APFA 4XWTA 3V3XA 1QQRA 2BB5A 3ZXVA 2B3AA 4GB9A 3AH7A 3CIRB 1GNUA 3AEFB 4GDLB 3PSEB 2ONQA 4P16A 2KOXA 2E6XA 4TQ1A 2FCMA 4RFBA 3WAOA 4DK5A 1YNTE 1RFAA 2JYTA 1L0YB 1PQSA 3H1UA 1WXQA 2NPTB 3P4QB 4F7ZA 1XLNA 2BPSA 2LGXA 1RRBA 3AEDB 3JVZX 1K53A 3L4PA 1YX6B 4I6PA 1IPGA 1V86A 4MT5A 4TKNA 3UGBB 2IJ0A 1PDXA 2KX0A 4IM3A 2KQ7A 2RMMA 2L8JA 3N1XC 2HJ1A 2JYEA 2KC1A 4K1RB 3TBLD 4REZA 2ZVOA 2NCNA 3L16A 5IA7A 3DBRI 2NBVB 3OJ3A 3N3KB 4MJSA 3L0WB 3OG5A 5FKAC 4E3CA 4K7UA 1AARA 4N6EB 4PK1A 1NVID 1CZPA 1YMHE 2J0JA 1ZDVA 3P42A 4GGQA 2WXHA 1L7YA 3KYCD 2KANA 3SU8X 4YTNB 4DXGA 4NAWB 1VRAB 2EMSA 5C1ZA 3ZDTA 2NR2A 3AECB 3DOWA 2M4NA 1N63A 3IXSA 3JW0X 2KFJA 3HVDA 1FNUA 4JX1C 2DYBA 1TS3A 4GLSC 2JPHA 5HFYA 3QARA 2EKIA 4OZCA 1K51A 2KXJA 3N1YC 1P98A 4BKSD 2LXCA 4B9KA 2LWPA 1V49A 5D94A 4HWIB 3QC8B 1ZXIA 2ZPNA 2C7HA 2K6QA 3NZ3A 1QOFA 2ZEQA 2CHWA 2RDHA 4RNAA 3KW5B 2CKHB 1QLBB 4KSKC 3U4EG 4HPLB 2EKEC 2ZCBA 2PEAA 2WX1A 2BYEA 3Q8EA 4XC2A 2LGSA 2O2VB 5EDSA 4RGOS 2N9XA 3OLMD 1HQRD 4N9F4 3BY4B 1SIFA 2M19A 1JWBD 2FNJB 2KDMA 4IWPA 2G45B 1ZXHA 1E9MA 5BMHA 4AQ7A 1FFUA 4YTMB 3RPFC 2BBCA 3VRBB 1E8WA 4G11A 1QKZA 2A4ZA 5GMVA 4NAWA 1TIFA 2RDGA 2TSSA 3IFWB 1Q0WB 1XD3B 1ZE3D 2BWES 4PS3A 1OTRB 3FKYA 4Q2JA 3ZJTA 2OEDA 1KH0A 3IT4B 5AUIA 3VR9B 5KHOA 1ZKHA 3R8BA 2KFKA 2WXMA 4EEWA 1YQBA 2LVPA 3FILB 2D2QA 2K9XA 2MWSB 2MBHA 2D10A 3AU5A 2OOBB 5E6OA 5LNK1 1JRPA 4CQNA 2V3PA 2K25A 4RMAA 2MP2B 4IW0A 1GB1A 3Q3FA 4GDKA 1N61A 3MHSD 4L2YA 4MSMB 3DHGC 5D7GA 5J2RA 3B1LX 4ZRQA 5IKCM 4A6QA 5AEKB 4WH4A 5BYQA 3R66C 2FIFA 4NPNA 1UELA 2M56B 3VUXA 3X23A 4RGTA 2K39A 2M0XA 1JROA 1F2RC 1P9DU 2KX3A 2KN5A 3MFGA 5CHFA 2RGFA 4B95A 4KSLC 1G6JA 2O6VD 1WJUA 3AV8A 3A9KB 3Q14C 1KJTA 1F1HA 2KTFA 2V4IB 3FC4A 2MW5A 3PREA 4OW0A 4BZAA 3RNBC 4IDIA 2LGYA 1WJ6A 2LRWA 4TMAB 2BTEA 2INDC 3X0WA 1M94A 1WM3A 2G3QB 3AE2B 3NS8A 2JRHA 1MG8A 3B2FA 1JRUA 1E0ZA 1D5XC 3I5JC 3SDLC 1XO3A 1EWYC 2RPQA 4ZRPA 2AEHA 1V9JA 3T9LA 2LD9A 2V4LA 5H8YE 4NAMA 3AEGB 1J7AA 2GBNA 1YJJA 3TL5A 1S3SG 1VZ8A 1BUIC 2CHZA 3VXWA 4M01A 4S0RA 1UGMA 4WURA 2DZIA 4KDIC 1SJHD 1ZUD2 2NPTA 1RYJA 1YOVB 3DVGX 4GIVA 5AZHA 3KQ4A 4FJYA 2MJEA 4ICUA 4W9IA 5LXIB 1D4BA 1LXDA 5L95C 1C1YB 3NVYA 1KTKA 2KJHB 2PW9A 1ROEA 3DWGC 4HKZE 4GSWA 3NJTA 2L76A 1WGRA 3KVFB 4TQ0A 1EUVB 2QDFA 4ZRJA 3UINB 1BMLC 2PLPA 1TZOA 4BFRA 1MJDA 2I38A 2ZJDA 1TYGB 2WNMA 1KM7A 3ALBA 1ACCA 3PT2B 3NZSA 1C9FA 4G50A 1XLOA 1P0RA 3PLVA 2KJRA 3WAPA 1EU4A 3ABVB 5G5HA 1VLBA 3TJPA 2V0GA 2PKOA 1I4XA 2WDQB 3K9OB 2HTHA 3IHPC 2VZKD 3P4SB 1FM0D 4OVZA 4ZYSA 2QEJC 2KACA 4YL8A 1FRRA 2V3NA 2CU1A 2LEKA 2MSED 2C7NB 4WAAA 3RUIB 3OAWA 2HDEA 1WGKA 4YXDB 3R3MA 1SE3A 4XE0A 3OWEB 3DVNU 2G4SA 2LI5A 2KDEB 3IG3A 1AW7A 3C8YA 3O13A 2HJ8A 2CHXA 4RGMA 1MI0A 4G0NB 2D07B 3QK0A 1K50A 3T3NA 4FADA 2IO2B 1C76A 4C4VB 2KDIA 1TTNA 2NBUA 1YJ1A 2KHWB 4RM8A 3TCAA 3L54A 4A20A 5IO9A 4RF0A 2QC8A 3RD2A 3BVGA 2BS2B 1L6VA 5FR6A 5CHWA 1E5WA 4B6WA 2Y5CA 5D2MB 1WY8A 4MEMA 4IM0A 3P4RB 3AEBB 2J0MA 3KH0A 1Z2MA 4MJSB 3C0RB 4W9GA 2O6VB 1CMXB 4EFOA 2KWCA 4P7IA 1DOIA 4HEA1 4W9FA 2N0SB 3RNEC 3NRZA 1V1PA 4WJQA 3H9DA 4MELA 3ZYYX 2BVCA 1WX7A 5I4DA 1QOAA 2RD0A 2SEBD 1FXTB 1T0RC 1WFYA 1QZEA 1C4PA 1ET9A 1VR9A 5IP4D 5AZFA 4B0MA 4LDTD 3DBRB 4ANWA 1L4ZB 3AN1A 4ITKA 4WWPA 1TBEA 4A90A 1C4CA 1NENB 1I4QA 1WGGA 3GOEA 3JSVA 1EO6A 3IAS1 1C3TA 3SD5A 1ET6A 3JYUA 4CYEA 1YQ4B 4M8MA 1E7UA 3LXFA 4W9HA 3RNFC 1QF6A 1HE8A 3NZUA 1V1OA 4GDLA 1E7PB 2DAFA 1PUTA 4US8A 4BAXA 1MPEA 1Y8RC 2K8HA 1WE7A 1WX9A 2D11A 1GUAB 2INPE 4YSZB 3PS6A 4L1BA 4UDUC 2K1FA 4MM3A 1YN5A 1FRDA 2ON8A 5LXHA 2DX5B 1Z5SB 1ENFA 2ACZB 5E6JA 4XZ4A 3KWLA 5D3IB 3EUB2 2KZRA 2VZKB 1T0QC 2G4DB 1QT9A 3AEEB 4CHKA 1WXSA 4IWOA 1I4PA 4NZLB 1VZ7A 2WHIA 2N9LA 4EZKA 3W5VB 5E6PA 4AJWA 3WCQA 1NEKB 2L1AA 3B9JA 3MC0B 3GZNB 1R4MI 4TUUA 1FD6A 3NUHB 3MHZA 3CWIA 4HDQA 4IWQA 2LFIA 5AZGA 3ZO5B 2GBRA 3GP7A 4PYZA 2KFKB 3PVLA 2FBWB 2NTSA 2W54A 2XEWA 3OJ4B 2RSUA 2UU7A 4S17A 2LVQA 2KMMA 1VD2A 5FK9C 3PRMB 2YVCA 2KD0A 1P7FA 2X8XX 4LNOA 2JWZA 1L0VB 3ZNID 3DQVA 5LLIA 3M62B 1WWTA 3H7SA 1T5XD 4NQKE 5C23A 3W1YA 1N5XA 1JWSD 4E71A 5EE9A 1YQ3B 1XF5L 3AMZA 4KX6B 2MRPA 3RI7C 2LHDA 1FMAD 3GZNI 1WXMA 4NJ6A 2KQ4X 3DBHI 2FCSA 3KUCB 1K52A 4MGYE 2MCNB 1UNSA 2MQJA 4OZBA 1E8XA 2M0AA 1XEEA 3LDZE 1E90A 1N6ZA 1WR6E 2XNAC 4WWOA 4FJZA 4KGRA 1GC7A 3URYA 3W9CB 1FCCC 1LO5D 3B08A 1P7EA 4HJKA 3AE5B 1L5PA 1OQQA 3EECA 1JALA 1WRDB 1ZDXA 2JXXA 2LJIA 2MBOA 1JW9D 3QQ8B 2O2VA 3ZTDA 1B9RA 2DENB 3PHXB 4GMVA 3APCA 3AXCA 3LYYA 4AUQC 2L32A 4FA6A 2H88B 2AQ1B 2HE7A 1NYQA 1VCBA 3ZW3A 2BKRB 3VUYA 2FCQA 2GMIC 2MBQA 1V81A 3ZVVA 2QHOA 4IC7B 3J9CA 4CO7A 2GBJA 2K22A 4BOZB 3KWVA 2R2OA 1BT0A 1P1AA 4RGNA 1UD7A 1WH3A 2JXTA 2WQYB 2KDFB 2AL6A 1IBXB 2JRIB 1P3QU 2R2QA 3ONSA 2XK5B 1JQ4A 4PS7A 3AE1B 3P1MA 2BKFA 4HRSA 2WDRB 3RT3B 4J6IA 2L0TA 1H8CA 1L6UA 3ZJUA 2WXQA 1I42A 3RNCC 3LB8C 4GOCA 1V5TA 1TY2A 1UWXA 3MJ5A 4KZCA 2QIEB 3PPAA 1J7CA 1FPYA 2IY0B 1UGJA 4KZ0A 2WYQA 2RDBC 1QOGA 5TR5A 3U8ZA 3Q8BA 3L10B 5G55A 4RH6A 2FCNA 3DPDA 1NI2A 3VH4B 3ZDMC 2VH1A 2K5PA 1I4HA 2OHFA 3FILA 1HXYD 1OQRA 4HCPB 3BZDB 4XWWA 1A5RA 4BKTA 1IGCA 3ENEA 3M63B 2FIDA 3N9YC 2JT4B 2LASA 3TIXA 2ZW1A 4C80A 3BK1A 4PT5A 3VTUA 2WP9B 1VDVA 3M95A 5J17A 2CR5A 1TT5B 1FFVA 3RNAC 4NY0A 3GE8C 3AE7B 3AE8B 4XDCA 4HKQA 1RLFA 4N58A 4ICVA 5BYSA 4KIKB 4EUTA 4BBNF 2YLMA 4JGHB 2DYMA 4KKIA 4KKJA 1I4GA 2CJOA 4AJYB 4JWUC 3W1SA 3V05A 4KGTA 2EELA 4OHJA 2FE8A 3Q3MC 4FN2A 2I2YA 1E6EB 2QSDA 3HVZA 1HA5A 3I3TB 2UYZB 3Q3OC 1WF9A 4TSSA 4W9EA 2NVUI 4EZLA 1V5OA 1WJNA 3BIID 2IY1B 3QIJA 3A1QB 3KLSX 1IYFA 3I9V1 2L52A 2QMTA 2ZPYA 3ZRCA 4IG7B 2IO0B 4I6LB 2WGSA 3H8HA 2LGDA 5JHAA 1WYGA 3ZTCA 1WZ0A 4L23A 2WXRA 3UIOB 5EE1A 4C7YA 2KVRA 3NVZA 2AL3A 1H4RA 1PGBA 4II2B 2IGGA 3RULA 4XX5A 3A9JA 1SXTA 2ZW0A 2W9NA 1RFKA 2KVZA 3P2BA 1XCQL 3UI3A
chains in the Genus database with same CATH topology
1TS2A 1C4PA 1R7SA 1ET9A 1YN4A 4REZA 1VR9A 5FR3A 4B0MA 1L4ZB 2G9HD 3AN1A 4ITKA 1KF6B 4A90A 1C4CA 1NENB 2Y5PA 1I4QA 5FKAC 4D2KA 2B76B 3SR6A 4N6EB 1QILA 1NVID 1CZPA 1YMHE 2BB6A 4J3OD 1XLQA 1ZDVA 3IAS1 1T6BX 3P42A 2KAJA 4RF1A 2WXHA 4DXGA 1ET6A 4YTNB 4NAWB 3AM9A 1JWMD 1YQ4B 1VRAB 5TSSA 3TEZA 3NS1A 1SSNA 2CJNA 1TKEA 1OFFA 3AECB 2Z8LA 1ZPSA 3LXFA 2WXIA 1QF6A 2BS3B 1I4RA 1V1OA 1N63A 2JWUA 1SEBD 3IXSA 1E7PB 3HVDA 1FNUA 1PUTA 3Q8FA 4JX1C 4US8A 2CU3A 4C7ZA 1TS3A 2HTME 4GLSC 2W55A 1L4DB 1MPEA 3U7ZA 1PYWD 3IT6B 3GB1A 4YSZB 2INPE 2SAKA 1N5WA 5HFYA 2H89B 3RFZB 4L1BA 4O1NA 4UDUC 2EKIA 2WXKA 4OZCA 4WQMA 4M0WA 1YN5A 1FRDA 2ON8A 1K51A 5HHDG 2LMCA 1ENFA 3AB5A 3SFDB 2ACZB 3BWUD 2E3TA 5E6JA 3KWLA 5D3IB 3EUB2 4ARIA 2N7JA 2VZKB 3HRDD 2WXNA 1ZXIA 3FAHA 1IUEA 2YEPF 1QT9A 3IAM1 3AEEB 3NZ3A 1QOFA 1SB3C 1I4PA 2PTLA 1JCKB 4NZLB 1C78A 1VZ7A 2N9KA 3NVVA 2K0PA 2RDHA 2N9LA 2J52A 5AUKA 1FNVA 4RNAA 3W5VB 1QLBB 3WCQA 1PFDA 1NEKB 1PGAA 2L1AA 2LHEA 3B9JA 3U4EG 3MC0B 3BVZA 1NYRA 4MM3B 1FD6A 4IKGA 2JZPA 3NUHB 5T8IA 1SE2A 1TS4A 3MHZA 2WU2B 3CWIA 2LFIA 3VR8B 3I57A 3U52E 1WSPA 3GP7A 1DGJA 3Q8EA 4RGOS 1HQRD 2FBWB 2NTSA 1VZ6A 1YN3A 2QJLA 2W54A 3EA6A 2M19A 1JWBD 1TJEA 5EE0A 2KDMA 1B1ZA 1ZXHA 1E9MA 5GXGB 5BMHA 4AQ7A 3TSSA 1FFUA 1FXAA 4YTMB 3RPFC 2NTTA 4GDKB 4B0EA 2BBCA 2KMMA 3VRBB 1QKZA 2WXGA 1KLUD 2RDGA 2TSSA 5FK9C 3E56A 1P7FA 1UWMA 1RM6C 4JWSC 1ZE3D 4KGSA 1KLGD 1L0VB 5HG2A 3MP9A 1M4VA 2JQRB 1F77A 4Q2JA 3ZJTA 2PVGC 2OEDA 1TS5A 3NVWA 1FO4A 1WWTA 1KRHA 1KH0A 2MJDA 1T5XD 3IT4B 5AUIA 3VR9B 5BMGA 3W5UB 4A9AA 1JWAD 3BVMA 1N5XA 1JWSD 3R8BA 4DQOC 3P63A 4RCOA 2WXMA 5EE9A 1YQ3B 1QOBA 1XF5L 3AMZA 3FILB 4KX6B 3TUOA 2RPVA 2K9XA 1HZ5A 2XN9C 2DWQA 2MJ3A 3Q69A 2WXOA 1N62A 1EWCA 1XXGA 5LNK1 2LHDA 1JRPA 3R2IA 4LLGM 4CQNA 2V3PA 3P4PB 2W3SA 1FMAD 1GB1A 2KWDA 2LUMA 1V8CA 1N61A 4LTUA 4L2YA 2NMQA 1I7HA 1FNWA 5D7GA 2KQ4X 4ZRQA 1TKYA 1K52A 4A6QA 4YT0B 2R61A 4WH4A 5BYQA 1AWDA 4FXCA 1UNSA 1D6EC 2M56B 1GPXA 1FCLA 4RGTA 4OZBA 1TY0A 2M0AA 1XEEA 4WWMA 1BXTA 2XNAC 2KN4A 5D3DA 1JROA 1F2RC 3BYYB 3MFGA 4KGRA 3URYA 3W9CB 3W2DA 1FCCC 4R3DA 1F0ZA 5G5GA 1CQVA 1LO5D 1Q10A 2IPKD 1P7EA 1GAQB 3AV8A 4H2AA 4AS1A 1PGXA 3AE5B 1L5PA 1SE4A 1SJED 4EE2A 1E10A 1OQQA 2V4IB 1JALA 3FC4A 1ZDXA 2LJIA 1SBBB 2GRIA 1WRIA 4JPSA 1JW9D 4OW0A 3Q8AA 4IDIA 2IGHA 4WIPA 1B9RA 4JE3B 3Q8CA 1L0XB 5H92C 1NI3A 1JMLA 1MHXA 4TMAB 5BYRA 3TEYA 2BTEA 3LYYA 1FXIA 2L32A 4ARCA 1UUPA 2H88B 2IDYA 3EGRA 2AQ1B 1DYQA 3AE2B 1IBXA 4N59A 1E0ZA 3B2FA 2AX5A 1NYQA 3AE6B 4YSYB 1SF0A 3PZ7A 1ESFA 1JWUD 3VQIA 1D5XC 2JSVX 5JXVA 1XO3A 1EWYC 2GI9A 4ZRPA 4P6VF 3ZJVA 1MHHE 4YTPB 3J9CA 1N60A 1XLPA 4YSXB 5H8YE 1EM7A 2K22A 3AEGB 3KWVA 4NAMA 1J7AA 1Y56A 4RGNA 1EU3A 4C56C 3T3OA 2DYOA 2JXTA 2WQYB 1YJJA 3SFEB 3BK2A 1VZ8A 2Y3AA 1IBXB 1BUIC 1HZ6A 3AE3B 4HJGE 1JQ4A 4LK0M 1VJKA 5BMIA 4WURA 4A8XC 3U2SC 1STEA 3AE1B 4NJCA 3P1MA 4HRSA 2WDRB 2K3UA 1SJHD 1ZUD2 2GB1A 2J4XA 2W82A 1L6UA 3GS2A 4IOIE 2ICIA 2FUG1 1RYJA 4ZHPA 3ZJUA 2WXQA 2W3RA 3HUIA 3KQ4A 4OZAA 4ZHOA 2MJEA 3BYTB 1D4BA 3AE4B 3LB8C 3ETRA 1IGDA 3NVYA 1T3QA 1SIJA 2Q5WD 1FEHA 2PVOD 1KTKA 1TKGA 1TY2A 1UWXA 2PW9A 3MJ5A 4HROA 1J7BA 2QIEB 1ROEA 3DWGC 2AQ3B 1ZP0B 4HKZE 1J7CA 3SEBA 1UGJA 4TQ0A 1AN8A 1C77A 2BW2A 1BMLC 5EE3A 2PLPA 2BS4B 5C2TB 1QOGA 2L83A 2WU5B 2PIAA 3Q8BA 2J42A 4RH6A 1TZOA 2I38A 1TYGB 1DOYA 2INNE 2WNMA 1FIQA 2K5PA 1ACCA 1I4HA 2OHFA 3E9SA 3FILA 1HXYD 2WXLA 1OQRA 2D5GA 1C9FA 1XLOA 3BZDB 4XWWA 4A55A 1IGCA 2MEKA 3N9YC 2AQ2B 1EU4A 4ZOHC 3ABVB 5C3JB 2ZW1A 1VLBA 5G5HA 4C80A 5MPOA 3BK1A 1C79A 4PT5A 2V0GA 2PKOA 1I4XA 2WDQB 1AYFA 2WP9B 1VDVA 2LGIA 3TEXA 2JX5A 3DWMA 1FFVA 1YJIA 2YEPB 4USAA 2VZKD 3AE7B 1FM0D 2BT6A 3P4SB 4OVZA 4WAFA 4ZYSA 2QEJC 2KACA 3AE8B 4XDCA 1FRRA 4HKQA 2V3NA 2LEKA 2WDVB 4N58A 3AE9B 1DOXA 5BYSA 2WLBA 1D5ZC 2WXPA 2X38A 2MH7A 2HDEA 1WGKA 2DYMA 2DBYA 4KKIA 4YXDB 4KKJA 1I4GA 1SE3A 2CJOA 4XDDA 2IGDA 2DLBA 3PO0A 4JWUC 2G1EA 3OWEB 4XE0A 3W1SA 3V05A 1V97A 4KGTA 4YWGG 2EELA 2J53A 4OHJA 2FE8A 3ZQ4A 1V1PB 2BYTA 2I2YA 3ZGZA 1AW7A 4MH8A 3C8YA 3B2GA 3O13A 1F2RI 1RWSA 1C4AA 1MVKA 1E6EB 2QSDA 3HVZA 1MI0A 4RGMA 1HA5A 1GB4A 1CK1A 1HEZE 4XWTA 2QILA 3V3XA 3T3NA 1K50A 1C76A 1QQRA 2BB5A 4TSSA 5HI1A 3TEWA 3AH7A 3CIRB 3BIID 1CJEA 1ZOYB 3AEFB 4DXFA 4GDLB 3AEAB 2ONQA 3KLSX 3I9V1 4P16A 4RF0A 2E6XA 2L52A 2QMTA 1KFYB 4TQ1A 2JU6X 2WS3B 3BVGA 4RFBA 2BS2B 4MACA 1L6VA 3R2TA 1YNTE 3H8HA 2JYTA 2Y5CA 3PZ8A 2WXJA 1WYGA 1L0YB 1WXQA 3P4RB 3AEBB 1A70A 3P4QB 1XLNA 3AEDB 4L23A 1K53A 3L4PA 2WXRA 1DOIA 4HEA1 1XCTL 4MT5A 3VRAB 2N0SB 5EE1A 4C7YA 2IJ0A 1PDXA 3NVZA 3NRZA 1PGBA 1V1PA 2IGGA 2RMMA 3ZYYX 1GOZA 1SXTA 5I4DA 2ZW0A 2JYEA 4US9A 2WXFA 1QOAA 2PMVA 1RFKA 2SEBD 1D5MC 1XCQL 3UI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGH A;  1IGC A;  2KDM A;  1JML A;  1MHX A;  1ZXH A;  2ZW1 A;  5BMH A;  1IBX A;  2LGI A;  4D2K A;  1QKZ A;  1YMH E;  1P7F A;  2JSV X;  5JXV A;  2KAC A;  2GI9 A;  4KGS A;  5HG2 A;  1MHH E;  3MP9 A;  1EM7 A;  2OED A;  1KH0 A;  2IGD A;  5BMG A;  2JXT A;  2JWU A;  4KGT A;  2EEL A;  2J53 A;  1IBX B;  1HZ6 A;  1XF5 L;  3FIL B;  2I2Y A;  4GLS C;  2RPV A;  1F2R I;  4HJG E;  1MVK A;  1HZ5 A;  1MPE A;  2QSD A;  5BMI A;  1GB4 A;  1MI0 A;  1HEZ E;  3V3X A;  1K50 A;  3GB1 A;  5HFY A;  2GB1 A;  2LHD A;  5HI1 A;  4OZC A;  4IOI E;  2ON8 A;  1K51 A;  1GB1 A;  2KWD A;  5HHD G;  2LUM A;  2NMQ A;  4OZA A;  2ONQ A;  2KQ4 X;  2QMT A;  1D4B A;  2JU6 X;  2N7J A;  1K52 A;  4MAC A;  4WH4 A;  1IGD A;  1YNT E;  1FCL A;  4OZB A;  1UWX A;  2PW9 A;  2PTL A;  2N9K A;  2K0P A;  2J52 A;  2N9L A;  4HKZ E;  2KN4 A;  1F2R C;  1PGA A;  1K53 A;  2LHE A;  4KGR A;  1FCC C;  1XCT L;  2PLP A;  1FD6 A;  4IKG A;  2JZP A;  1Q10 A;  1P7E A;  1PGB A;  1PGX A;  2IGG A;  2RMM A;  2I38 A;  2ZW0 A;  1C9F A;  3FIL A;  1XCQ L;  3UI3 A; 
#chains in the Genus database with same CATH topology
 1YN4 A;  1HTQ A;  1NBF C;  3KUD B;  5FR3 A;  4P1C C;  4FHJ A;  3T8M A;  3DHI C;  1HTO A;  3WAN A;  2B76 B;  1QIL A;  1UZX B;  4DDG D;  1GC6 A;  1XLQ A;  1T6B X;  2K6D B;  3UQB A;  4HPM B;  3NS1 A;  4FLH A;  2VRR B;  2WXI A;  4WWN A;  1I4R A;  2JWU A;  4QAY A;  2DZJ A;  3Q8F A;  2KLC A;  2CU3 A;  5J18 A;  2HTM E;  2W55 A;  3U7Z A;  2ZCC A;  1UBI A;  4BVU C;  3GB1 A;  2SAK A;  1N5W A;  2I1J A;  2H89 B;  3NY5 A;  4O1N A;  4XYC A;  2WXK A;  4DHZ E;  4WQM A;  1WXA A;  2KKC A;  2N7D A;  2BQQ A;  3RMK C;  2LMC A;  2LJ5 A;  3BWU D;  2E3T A;  4IUM B;  4ARI A;  3PHW B;  3WA0 A;  2WXN A;  2YEP F;  2I1K A;  1LQB A;  2L7R A;  2PTL A;  1JCK B;  2N9K A;  2PPH A;  3NVV A;  2K0P A;  2J52 A;  5AUK A;  2MLB A;  1SE9 A;  1PFD A;  1I35 A;  3RZW C;  4K3C A;  4IKG A;  3ZNG C;  3HM6 X;  5T8I A;  1SE2 A;  2WU2 B;  3ML9 A;  2KYW A;  2XK5 A;  3VR8 B;  3I57 A;  4WJO A;  1WSP A;  1WZ3 A;  1YD8 U;  2L00 B;  3QJZ A;  5L83 A;  3ZKJ C;  1VZ6 A;  3N1Z C;  1TJE A;  3A4S C;  4AWJ A;  2BF8 B;  3R7R A;  4K3B A;  2NTT A;  3RYT A;  4GDK B;  2L3Z A;  4DBG A;  2ASQ A;  1WGY A;  4B0E A;  2N1W A;  3AU4 A;  4LCD E;  2WXG A;  1KLU D;  3ZIM A;  4MGK E;  1RM6 C;  4JWS C;  2JUO A;  4KGS A;  4WJN A;  3WAM A;  1YX5 B;  5HG2 A;  2JQR B;  2NBW B;  4DHJ B;  2NS5 A;  3R7Q A;  1TS5 A;  1FO4 A;  1KRH A;  4E74 A;  5BMG A;  3W5U B;  2O6V A;  4A9A A;  4HPP A;  1JWA D;  3BVM A;  4DQO C;  4F8C B;  4RCO A;  3TUO A;  1HZ5 A;  2MX2 A;  2MJ3 A;  1XXG A;  2IO3 B;  3IVF A;  4LLG M;  2MHJ A;  4W9D A;  2J7Q B;  2LUM A;  1V8C A;  2NMQ A;  1I7H A;  1FNW A;  3QA8 A;  4YT0 B;  2R61 A;  3UF8 A;  1D6E C;  2N4F A;  3V6C B;  1FCL A;  2KTR B;  4DHJ D;  1TY0 A;  2MA9 B;  1WMH A;  2PE6 B;  2KN4 A;  5IN7 A;  3MC9 A;  5D3D A;  2IYD B;  3W2D A;  1E8Z A;  2V3S A;  5G5G A;  1CQV A;  3H7P A;  1Q10 A;  1GAQ B;  2Z0D B;  3VTW A;  1LFD A;  4HCN B;  1SJE D;  4PYU A;  1E10 A;  2K8C A;  3APD A;  1SBB B;  2GRI A;  4JPS A;  2DNF A;  2QCZ A;  3Q8A A;  4JQW C;  4WIP A;  3RCZ A;  3Q8C A;  2WDT B;  1NI3 A;  2HD5 B;  5BO4 B;  4DDI D;  4ARC A;  2IDY A;  1WJ4 A;  2ZVN A;  3CMM B;  2JZZ A;  4C00 A;  4YSY B;  3QAQ A;  3VTV A;  1TGZ B;  1JWU D;  5JXV A;  5IOI A;  3VUW A;  2INC C;  4URK A;  4MGZ E;  4P6V F;  3CF6 E;  1MHH E;  3ZXR A;  4YTP B;  3PGE A;  2RR9 A;  3L13 A;  3ZJV A;  1WXV A;  1XLP A;  1EM7 A;  4G3X B;  1Y56 A;  4JLC A;  3MJW A;  1EU3 A;  4C56 C;  2DYO A;  2WWZ A;  1J8C A;  4DWF A;  3SFE B;  4NJ7 A;  3A9J B;  3DBS A;  3EFC A;  3EFU A;  4ASW C;  2Y3A A;  4F1S A;  1D3Z A;  1UF0 A;  1WX8 A;  1S1Q B;  3AE3 B;  3JSV B;  4HJG E;  3ZRF A;  5BMI A;  1VJK A;  2IBI B;  1OEY J;  3U2S C;  4NJC A;  4KIK A;  1ZW7 A;  1WGH A;  2GB1 A;  2LVO A;  3GS2 A;  2FUG 1;  2C5L C;  3L08 A;  4OZA A;  4MH0 E;  2DHZ A;  4ZHO A;  3DBL B;  3BYT B;  5DPR A;  3CSF A;  3ETR A;  1IGD A;  1SIJ A;  4NNJ B;  2Q5W D;  3UQA A;  1FEH A;  4FUL A;  1J7B A;  1WI0 A;  1ZP0 B;  1AN8 A;  1GG3 A;  2BW2 A;  2V9H A;  5EE3 A;  4A3P A;  2BS4 B;  4AP4 C;  2WU5 B;  2D3A A;  2J42 A;  3K9P B;  3M3J A;  3B0A A;  1DOY A;  2INN E;  2K8B A;  3ZLZ A;  2D5G A;  2MEK A;  2AQ2 B;  1IP9 A;  4K7W A;  4LJO B;  2AWT A;  5MPO A;  4HVB A;  4OVU A;  3QCA A;  1AYF A;  1X1M A;  4EKU A;  3TEX A;  4ZYN A;  3DWM A;  3V61 A;  3KYD D;  1K8R B;  2LRU A;  2PE9 A;  2AYO B;  1J19 A;  3MTN B;  2DZK A;  2WDV B;  3V60 A;  2V1Y A;  2WLB A;  2X38 A;  2DBY A;  2DLB A;  3PO0 A;  2KK8 A;  1U4A A;  4JIO U;  1WM2 A;  4ZDV A;  4LJP B;  1V97 A;  1OEY A;  1WE6 A;  4GN1 A;  5DCN A;  3S2A A;  3ZQ4 A;  1V1P B;  2BYT A;  5IAA C;  4LNN A;  4ANU A;  5CX3 A;  1F2R I;  2L0F A;  1C4A A;  1NDD A;  1CK1 A;  1HEZ E;  2QIL A;  4AOF A;  3Q3J A;  5HI1 A;  5CHV C;  3TEW A;  2Y5B B;  2LXA A;  3H7P B;  1CJE A;  1ZOY B;  4DXF A;  3AEA B;  1KFY B;  5JHB A;  2JU6 X;  2WS3 B;  4GU2 A;  4MAC A;  3R2T A;  2WX0 A;  4K7S A;  5DPT A;  2KTR A;  3PZ8 A;  2WXJ A;  2IO1 B;  1A70 A;  1MFW A;  3PLU A;  3N32 A;  1XCT L;  3VRA B;  2N1V A;  5D6J B;  2IZV B;  3O65 B;  3A1Q A;  2BYV E;  3QX1 A;  1GOZ A;  2UWQ A;  4US9 A;  2WXF A;  3HHM A;  2PMV A;  1D5M C;  2KQS A;  3DVN V;  1TS2 A;  1R7S A;  3CST A;  1R4N I;  4XGA B;  4W9C A;  2G9H D;  4W9J A;  1KF6 B;  2MBE A;  2M17 A;  2LZ6 A;  2Y5P A;  2GOW A;  4D2K A;  3SR6 A;  2BB6 A;  4J3O D;  3V62 A;  4BKG A;  2A5U A;  2KAJ A;  1T0Y A;  3HK0 A;  4RF1 A;  3Q2A C;  1WMH B;  3AM9 A;  1JWM D;  4FBJ B;  2C7M B;  3I63 C;  5TSS A;  3KUZ A;  3TEZ A;  2C9W B;  1SSN A;  2CJN A;  1TKE A;  3ZUN A;  1OFF A;  3WIM A;  1EF5 A;  1LGR A;  2Z8L A;  1ZPS A;  2BS3 B;  3NHE B;  4M8N A;  2CS4 A;  1SEB D;  3N20 C;  1R4N B;  1XT9 B;  4C7Z A;  1L4D B;  1PYW D;  2KDB A;  3IT6 B;  3EHV A;  3RFZ B;  1TZ1 A;  3N30 A;  2GLS A;  2OJW A;  4M0W A;  3D32 A;  5HHD G;  3AB5 A;  3SFD B;  3ZNH B;  1V2Y A;  3Q3N C;  2N7J A;  1WIA A;  4MDK E;  3HRD D;  3C19 A;  2D3C A;  3FAH A;  1IUE A;  3IAM 1;  1SB3 C;  3DBL I;  1C78 A;  2BYF A;  3DDC B;  2MP2 A;  4NQL B;  1FNV A;  4WQO B;  1PGA A;  4ACF A;  3PZD A;  2LHE A;  4II3 B;  3BVZ A;  1NYR A;  4KDL B;  1R4M B;  4MM3 B;  2JZP A;  3WAL A;  2REX A;  2KO3 A;  1TS4 A;  1J0G A;  2J0K A;  4HXD A;  4LNK A;  2JVC A;  2N9E B;  4GXB A;  4LNF A;  3U52 E;  2BWF A;  3VVW B;  1DGJ A;  4DHZ B;  1EF1 A;  4HDO A;  4HK2 A;  1YN3 A;  2QJL A;  3EA6 A;  1XQQ A;  5EE0 A;  1GJZ A;  1MG4 A;  4X57 B;  1B1Z A;  1Q1O A;  5GXG B;  4WJP A;  3TSS A;  1FXA A;  4ANV A;  1V6E A;  4ZRK A;  2LUE A;  3E56 A;  2VH2 A;  1UWM A;  2PJH A;  3NOB A;  3ML8 A;  2GBK A;  3VHT C;  1KLG D;  2DAJ A;  3MP9 A;  1M4V A;  1F77 A;  2PVG C;  3NVW A;  4TV3 A;  3U7D A;  4M00 A;  2MJD A;  3RN9 C;  4LDT B;  2KT7 A;  3P63 A;  3DVG Y;  1QOB A;  3Q6B A;  1E8Y A;  2D3G A;  3TMP B;  2RPV A;  3PTF C;  4BBN C;  2XN9 C;  2DWQ A;  3AUL A;  3Q69 A;  2WXO A;  3PV1 A;  3PRZ A;  1N62 A;  4KV2 A;  3H6N A;  4DXA B;  1EWC A;  1YIW A;  2EMT A;  3R2I A;  3P4P B;  2W3S A;  4I6N B;  3DHH C;  2KWD A;  4BKS A;  4LTU A;  4M02 A;  2MBB B;  1TKY A;  2FUH B;  1AWD A;  3A4R A;  2JY6 A;  4FXC A;  3VDZ A;  3VFK A;  1GPX A;  3VAW A;  3SHQ A;  4MGI E;  4WWM A;  1UH6 A;  1BXT A;  3RNG C;  4M0W B;  1KOT A;  4HLE A;  3BYY B;  5DPS A;  3UIP B;  3EC8 A;  3L17 A;  2D3B A;  4R3D A;  1F0Z A;  2M8S A;  2IPK D;  4H2A A;  4AS1 A;  1PGX A;  1F9J A;  1SE4 A;  2Z0E B;  4EE2 A;  1Q5W B;  2KMA A;  5KHQ A;  1WRI A;  3DBH B;  2IGH A;  4JE3 B;  1L0X B;  5H92 C;  1JML A;  1MHX A;  5BYR A;  3TEY A;  5DPW A;  1FXI A;  3HM3 A;  1UUP A;  3EGR A;  1WR1 A;  1IBX A;  1DYQ A;  5CTR C;  4N59 A;  2AX5 A;  2N7E A;  3AE6 B;  2ZZP B;  3GE3 C;  1OGW A;  1SF0 A;  3PZ7 A;  1ESF A;  3VQI A;  2KC2 A;  2JSV X;  2GBM A;  4ANX A;  1V80 A;  4A3O A;  2GI9 A;  4JL9 A;  4IM2 A;  2KMC A;  1N60 A;  4YSX B;  2ZNV C;  3T3O A;  1OQY A;  2KWV B;  3BK2 A;  1HZ6 A;  1ISN A;  3BIN A;  2Z59 B;  3W1S C;  3QWZ B;  4C4V A;  4LK0 M;  4P1B C;  3RZF A;  4A8X C;  1STE A;  1ZGU B;  1LM8 B;  2K3U A;  3NG0 A;  2N9P C;  2J4X A;  1SGH A;  2W82 A;  4FJV B;  4IOI E;  4FHK A;  5E6N A;  2ICI A;  4ZHP A;  2FAZ A;  2W3R A;  1RAX A;  3HUI A;  3U30 A;  5JZE B;  3HIZ A;  3AE4 B;  3ECI A;  4ZRI A;  1T3Q A;  4PS8 A;  5G2N A;  2DZM A;  2PVO D;  4EOY A;  1TKG A;  3A33 B;  4HRO A;  2AQ3 B;  3SEB A;  2KWU B;  2JZ3 B;  3LJ3 A;  1C77 A;  1L2N A;  5C2T B;  2L83 A;  2PIA A;  4OVV A;  1UBQ A;  4MSQ B;  2XBB C;  4RM9 A;  1T0S C;  1FIQ A;  3IBE A;  3E9S A;  2WXL A;  2M1M A;  3PRP B;  2ZNV B;  2KLG A;  4LNI A;  4A55 A;  4ZOH C;  4W9K A;  5C3J B;  1C79 A;  2KNB A;  3VH3 B;  5JH5 C;  5HKH A;  2LGI A;  2JF5 A;  2JX5 A;  1YJI A;  2KJ6 A;  2YEP B;  4USA A;  4WAF A;  2BT6 A;  4EZJ A;  1KLV A;  3AE9 B;  3V6E B;  1DOX A;  4BOS C;  1D5Z C;  2BGF A;  1E7V A;  1WYW B;  2WXP A;  4W9L A;  2MH7 A;  3ZNZ B;  3QHT A;  4KVG B;  4XDD A;  2IGD A;  3AI5 A;  3DCG A;  2C60 A;  2G1E A;  1WGD A;  1F52 A;  3MC8 A;  4K81 A;  4YWG G;  2J53 A;  3ZGZ A;  4MH8 A;  3B2G A;  2L05 A;  3A9K A;  2OJR A;  1RWS A;  1MVK A;  1GB4 A;  3APF A;  4XWT A;  3V3X A;  1QQR A;  2BB5 A;  3ZXV A;  2B3A A;  4GB9 A;  3AH7 A;  3CIR B;  1GNU A;  3AEF B;  4GDL B;  3PSE B;  2ONQ A;  4P16 A;  2KOX A;  2E6X A;  4TQ1 A;  2FCM A;  4RFB A;  3WAO A;  4DK5 A;  1YNT E;  1RFA A;  2JYT A;  1L0Y B;  1PQS A;  3H1U A;  1WXQ A;  2NPT B;  3P4Q B;  4F7Z A;  1XLN A;  2BPS A;  2LGX A;  1RRB A;  3AED B;  3JVZ X;  1K53 A;  3L4P A;  1YX6 B;  4I6P A;  1IPG A;  1V86 A;  4MT5 A;  4TKN A;  3UGB B;  2IJ0 A;  1PDX A;  2KX0 A;  4IM3 A;  2KQ7 A;  2RMM A;  2L8J A;  3N1X C;  2HJ1 A;  2JYE A;  2KC1 A;  4K1R B;  3TBL D;  4REZ A;  2ZVO A;  2NCN A;  3L16 A;  5IA7 A;  3DBR I;  2NBV B;  3OJ3 A;  3N3K B;  4MJS A;  3L0W B;  3OG5 A;  5FKA C;  4E3C A;  4K7U A;  1AAR A;  4N6E B;  4PK1 A;  1NVI D;  1CZP A;  1YMH E;  2J0J A;  1ZDV A;  3P42 A;  4GGQ A;  2WXH A;  1L7Y A;  3KYC D;  2KAN A;  3SU8 X;  4YTN B;  4DXG A;  4NAW B;  1VRA B;  2EMS A;  5C1Z A;  3ZDT A;  2NR2 A;  3AEC B;  3DOW A;  2M4N A;  1N63 A;  3IXS A;  3JW0 X;  2KFJ A;  3HVD A;  1FNU A;  4JX1 C;  2DYB A;  1TS3 A;  4GLS C;  2JPH A;  5HFY A;  3QAR A;  2EKI A;  4OZC A;  1K51 A;  2KXJ A;  3N1Y C;  1P98 A;  4BKS D;  2LXC A;  4B9K A;  2LWP A;  1V49 A;  5D94 A;  4HWI B;  3QC8 B;  1ZXI A;  2ZPN A;  2C7H A;  2K6Q A;  3NZ3 A;  1QOF A;  2ZEQ A;  2CHW A;  2RDH A;  4RNA A;  3KW5 B;  2CKH B;  1QLB B;  4KSK C;  3U4E G;  4HPL B;  2EKE C;  2ZCB A;  2PEA A;  2WX1 A;  2BYE A;  3Q8E A;  4XC2 A;  2LGS A;  2O2V B;  5EDS A;  4RGO S;  2N9X A;  3OLM D;  1HQR D;  4N9F 4;  3BY4 B;  1SIF A;  2M19 A;  1JWB D;  2FNJ B;  2KDM A;  4IWP A;  2G45 B;  1ZXH A;  1E9M A;  5BMH A;  4AQ7 A;  1FFU A;  4YTM B;  3RPF C;  2BBC A;  3VRB B;  1E8W A;  4G11 A;  1QKZ A;  2A4Z A;  5GMV A;  4NAW A;  1TIF A;  2RDG A;  2TSS A;  3IFW B;  1Q0W B;  1XD3 B;  1ZE3 D;  2BWE S;  4PS3 A;  1OTR B;  3FKY A;  4Q2J A;  3ZJT A;  2OED A;  1KH0 A;  3IT4 B;  5AUI A;  3VR9 B;  5KHO A;  1ZKH A;  3R8B A;  2KFK A;  2WXM A;  4EEW A;  1YQB A;  2LVP A;  3FIL B;  2D2Q A;  2K9X A;  2MWS B;  2MBH A;  2D10 A;  3AU5 A;  2OOB B;  5E6O A;  5LNK 1;  1JRP A;  4CQN A;  2V3P A;  2K25 A;  4RMA A;  2MP2 B;  4IW0 A;  1GB1 A;  3Q3F A;  4GDK A;  1N61 A;  3MHS D;  4L2Y A;  4MSM B;  3DHG C;  5D7G A;  5J2R A;  3B1L X;  4ZRQ A;  5IKC M;  4A6Q A;  5AEK B;  4WH4 A;  5BYQ A;  3R66 C;  2FIF A;  4NPN A;  1UEL A;  2M56 B;  3VUX A;  3X23 A;  4RGT A;  2K39 A;  2M0X A;  1JRO A;  1F2R C;  1P9D U;  2KX3 A;  2KN5 A;  3MFG A;  5CHF A;  2RGF A;  4B95 A;  4KSL C;  1G6J A;  2O6V D;  1WJU A;  3AV8 A;  3A9K B;  3Q14 C;  1KJT A;  1F1H A;  2KTF A;  2V4I B;  3FC4 A;  2MW5 A;  3PRE A;  4OW0 A;  4BZA A;  3RNB C;  4IDI A;  2LGY A;  1WJ6 A;  2LRW A;  4TMA B;  2BTE A;  2IND C;  3X0W A;  1M94 A;  1WM3 A;  2G3Q B;  3AE2 B;  3NS8 A;  2JRH A;  1MG8 A;  3B2F A;  1JRU A;  1E0Z A;  1D5X C;  3I5J C;  3SDL C;  1XO3 A;  1EWY C;  2RPQ A;  4ZRP A;  2AEH A;  1V9J A;  3T9L A;  2LD9 A;  2V4L A;  5H8Y E;  4NAM A;  3AEG B;  1J7A A;  2GBN A;  1YJJ A;  3TL5 A;  1S3S G;  1VZ8 A;  1BUI C;  2CHZ A;  3VXW A;  4M01 A;  4S0R A;  1UGM A;  4WUR A;  2DZI A;  4KDI C;  1SJH D;  1ZUD 2;  2NPT A;  1RYJ A;  1YOV B;  3DVG X;  4GIV A;  5AZH A;  3KQ4 A;  4FJY A;  2MJE A;  4ICU A;  4W9I A;  5LXI B;  1D4B A;  1LXD A;  5L95 C;  1C1Y B;  3NVY A;  1KTK A;  2KJH B;  2PW9 A;  1ROE A;  3DWG C;  4HKZ E;  4GSW A;  3NJT A;  2L76 A;  1WGR A;  3KVF B;  4TQ0 A;  1EUV B;  2QDF A;  4ZRJ A;  3UIN B;  1BML C;  2PLP A;  1TZO A;  4BFR A;  1MJD A;  2I38 A;  2ZJD A;  1TYG B;  2WNM A;  1KM7 A;  3ALB A;  1ACC A;  3PT2 B;  3NZS A;  1C9F A;  4G50 A;  1XLO A;  1P0R A;  3PLV A;  2KJR A;  3WAP A;  1EU4 A;  3ABV B;  5G5H A;  1VLB A;  3TJP A;  2V0G A;  2PKO A;  1I4X A;  2WDQ B;  3K9O B;  2HTH A;  3IHP C;  2VZK D;  3P4S B;  1FM0 D;  4OVZ A;  4ZYS A;  2QEJ C;  2KAC A;  4YL8 A;  1FRR A;  2V3N A;  2CU1 A;  2LEK A;  2MSE D;  2C7N B;  4WAA A;  3RUI B;  3OAW A;  2HDE A;  1WGK A;  4YXD B;  3R3M A;  1SE3 A;  4XE0 A;  3OWE B;  3DVN U;  2G4S A;  2LI5 A;  2KDE B;  3IG3 A;  1AW7 A;  3C8Y A;  3O13 A;  2HJ8 A;  2CHX A;  4RGM A;  1MI0 A;  4G0N B;  2D07 B;  3QK0 A;  1K50 A;  3T3N A;  4FAD A;  2IO2 B;  1C76 A;  4C4V B;  2KDI A;  1TTN A;  2NBU A;  1YJ1 A;  2KHW B;  4RM8 A;  3TCA A;  3L54 A;  4A20 A;  5IO9 A;  4RF0 A;  2QC8 A;  3RD2 A;  3BVG A;  2BS2 B;  1L6V A;  5FR6 A;  5CHW A;  1E5W A;  4B6W A;  2Y5C A;  5D2M B;  1WY8 A;  4MEM A;  4IM0 A;  3P4R B;  3AEB B;  2J0M A;  3KH0 A;  1Z2M A;  4MJS B;  3C0R B;  4W9G A;  2O6V B;  1CMX B;  4EFO A;  2KWC A;  4P7I A;  1DOI A;  4HEA 1;  4W9F A;  2N0S B;  3RNE C;  3NRZ A;  1V1P A;  4WJQ A;  3H9D A;  4MEL A;  3ZYY X;  2BVC A;  1WX7 A;  5I4D A;  1QOA A;  2RD0 A;  2SEB D;  1FXT B;  1T0R C;  1WFY A;  1QZE A;  1C4P A;  1ET9 A;  1VR9 A;  5IP4 D;  5AZF A;  4B0M A;  4LDT D;  3DBR B;  4ANW A;  1L4Z B;  3AN1 A;  4ITK A;  4WWP A;  1TBE A;  4A90 A;  1C4C A;  1NEN B;  1I4Q A;  1WGG A;  3GOE A;  3JSV A;  1EO6 A;  3IAS 1;  1C3T A;  3SD5 A;  1ET6 A;  3JYU A;  4CYE A;  1YQ4 B;  4M8M A;  1E7U A;  3LXF A;  4W9H A;  3RNF C;  1QF6 A;  1HE8 A;  3NZU A;  1V1O A;  4GDL A;  1E7P B;  2DAF A;  1PUT A;  4US8 A;  4BAX A;  1MPE A;  1Y8R C;  2K8H A;  1WE7 A;  1WX9 A;  2D11 A;  1GUA B;  2INP E;  4YSZ B;  3PS6 A;  4L1B A;  4UDU C;  2K1F A;  4MM3 A;  1YN5 A;  1FRD A;  2ON8 A;  5LXH A;  2DX5 B;  1Z5S B;  1ENF A;  2ACZ B;  5E6J A;  4XZ4 A;  3KWL A;  5D3I B;  3EUB 2;  2KZR A;  2VZK B;  1T0Q C;  2G4D B;  1QT9 A;  3AEE B;  4CHK A;  1WXS A;  4IWO A;  1I4P A;  4NZL B;  1VZ7 A;  2WHI A;  2N9L A;  4EZK A;  3W5V B;  5E6P A;  4AJW A;  3WCQ A;  1NEK B;  2L1A A;  3B9J A;  3MC0 B;  3GZN B;  1R4M I;  4TUU A;  1FD6 A;  3NUH B;  3MHZ A;  3CWI A;  4HDQ A;  4IWQ A;  2LFI A;  5AZG A;  3ZO5 B;  2GBR A;  3GP7 A;  4PYZ A;  2KFK B;  3PVL A;  2FBW B;  2NTS A;  2W54 A;  2XEW A;  3OJ4 B;  2RSU A;  2UU7 A;  4S17 A;  2LVQ A;  2KMM A;  1VD2 A;  5FK9 C;  3PRM B;  2YVC A;  2KD0 A;  1P7F A;  2X8X X;  4LNO A;  2JWZ A;  1L0V B;  3ZNI D;  3DQV A;  5LLI A;  3M62 B;  1WWT A;  3H7S A;  1T5X D;  4NQK E;  5C23 A;  3W1Y A;  1N5X A;  1JWS D;  4E71 A;  5EE9 A;  1YQ3 B;  1XF5 L;  3AMZ A;  4KX6 B;  2MRP A;  3RI7 C;  2LHD A;  1FMA D;  3GZN I;  1WXM A;  4NJ6 A;  2KQ4 X;  3DBH I;  2FCS A;  3KUC B;  1K52 A;  4MGY E;  2MCN B;  1UNS A;  2MQJ A;  4OZB A;  1E8X A;  2M0A A;  1XEE A;  3LDZ E;  1E90 A;  1N6Z A;  1WR6 E;  2XNA C;  4WWO A;  4FJZ A;  4KGR A;  1GC7 A;  3URY A;  3W9C B;  1FCC C;  1LO5 D;  3B08 A;  1P7E A;  4HJK A;  3AE5 B;  1L5P A;  1OQQ A;  3EEC A;  1JAL A;  1WRD B;  1ZDX A;  2JXX A;  2LJI A;  2MBO A;  1JW9 D;  3QQ8 B;  2O2V A;  3ZTD A;  1B9R A;  2DEN B;  3PHX B;  4GMV A;  3APC A;  3AXC A;  3LYY A;  4AUQ C;  2L32 A;  4FA6 A;  2H88 B;  2AQ1 B;  2HE7 A;  1NYQ A;  1VCB A;  3ZW3 A;  2BKR B;  3VUY A;  2FCQ A;  2GMI C;  2MBQ A;  1V81 A;  3ZVV A;  2QHO A;  4IC7 B;  3J9C A;  4CO7 A;  2GBJ A;  2K22 A;  4BOZ B;  3KWV A;  2R2O A;  1BT0 A;  1P1A A;  4RGN A;  1UD7 A;  1WH3 A;  2JXT A;  2WQY B;  2KDF B;  2AL6 A;  1IBX B;  2JRI B;  1P3Q U;  2R2Q A;  3ONS A;  2XK5 B;  1JQ4 A;  4PS7 A;  3AE1 B;  3P1M A;  2BKF A;  4HRS A;  2WDR B;  3RT3 B;  4J6I A;  2L0T A;  1H8C A;  1L6U A;  3ZJU A;  2WXQ A;  1I42 A;  3RNC C;  3LB8 C;  4GOC A;  1V5T A;  1TY2 A;  1UWX A;  3MJ5 A;  4KZC A;  2QIE B;  3PPA A;  1J7C A;  1FPY A;  2IY0 B;  1UGJ A;  4KZ0 A;  2WYQ A;  2RDB C;  1QOG A;  5TR5 A;  3U8Z A;  3Q8B A;  3L10 B;  5G55 A;  4RH6 A;  2FCN A;  3DPD A;  1NI2 A;  3VH4 B;  3ZDM C;  2VH1 A;  2K5P A;  1I4H A;  2OHF A;  3FIL A;  1HXY D;  1OQR A;  4HCP B;  3BZD B;  4XWW A;  1A5R A;  4BKT A;  1IGC A;  3ENE A;  3M63 B;  2FID A;  3N9Y C;  2JT4 B;  2LAS A;  3TIX A;  2ZW1 A;  4C80 A;  3BK1 A;  4PT5 A;  3VTU A;  2WP9 B;  1VDV A;  3M95 A;  5J17 A;  2CR5 A;  1TT5 B;  1FFV A;  3RNA C;  4NY0 A;  3GE8 C;  3AE7 B;  3AE8 B;  4XDC A;  4HKQ A;  1RLF A;  4N58 A;  4ICV A;  5BYS A;  4KIK B;  4EUT A;  4BBN F;  2YLM A;  4JGH B;  2DYM A;  4KKI A;  4KKJ A;  1I4G A;  2CJO A;  4AJY B;  4JWU C;  3W1S A;  3V05 A;  4KGT A;  2EEL A;  4OHJ A;  2FE8 A;  3Q3M C;  4FN2 A;  2I2Y A;  1E6E B;  2QSD A;  3HVZ A;  1HA5 A;  3I3T B;  2UYZ B;  3Q3O C;  1WF9 A;  4TSS A;  4W9E A;  2NVU I;  4EZL A;  1V5O A;  1WJN A;  3BII D;  2IY1 B;  3QIJ A;  3A1Q B;  3KLS X;  1IYF A;  3I9V 1;  2L52 A;  2QMT A;  2ZPY A;  3ZRC A;  4IG7 B;  2IO0 B;  4I6L B;  2WGS A;  3H8H A;  2LGD A;  5JHA A;  1WYG A;  3ZTC A;  1WZ0 A;  4L23 A;  2WXR A;  3UIO B;  5EE1 A;  4C7Y A;  2KVR A;  3NVZ A;  2AL3 A;  1H4R A;  1PGB A;  4II2 B;  2IGG A;  3RUL A;  4XX5 A;  3A9J A;  1SXT A;  2ZW0 A;  2W9N A;  1RFK A;  2KVZ A;  3P2B A;  1XCQ L;  3UI3 A; 
#chains in the Genus database with same CATH homology
 1TS2 A;  1C4P A;  1R7S A;  1ET9 A;  1YN4 A;  4REZ A;  1VR9 A;  5FR3 A;  4B0M A;  1L4Z B;  2G9H D;  3AN1 A;  4ITK A;  1KF6 B;  4A90 A;  1C4C A;  1NEN B;  2Y5P A;  1I4Q A;  5FKA C;  4D2K A;  2B76 B;  3SR6 A;  4N6E B;  1QIL A;  1NVI D;  1CZP A;  1YMH E;  2BB6 A;  4J3O D;  1XLQ A;  1ZDV A;  3IAS 1;  1T6B X;  3P42 A;  2KAJ A;  4RF1 A;  2WXH A;  4DXG A;  1ET6 A;  4YTN B;  4NAW B;  3AM9 A;  1JWM D;  1YQ4 B;  1VRA B;  5TSS A;  3TEZ A;  3NS1 A;  1SSN A;  2CJN A;  1TKE A;  1OFF A;  3AEC B;  2Z8L A;  1ZPS A;  3LXF A;  2WXI A;  1QF6 A;  2BS3 B;  1I4R A;  1V1O A;  1N63 A;  2JWU A;  1SEB D;  3IXS A;  1E7P B;  3HVD A;  1FNU A;  1PUT A;  3Q8F A;  4JX1 C;  4US8 A;  2CU3 A;  4C7Z A;  1TS3 A;  2HTM E;  4GLS C;  2W55 A;  1L4D B;  1MPE A;  3U7Z A;  1PYW D;  3IT6 B;  3GB1 A;  4YSZ B;  2INP E;  2SAK A;  1N5W A;  5HFY A;  2H89 B;  3RFZ B;  4L1B A;  4O1N A;  4UDU C;  2EKI A;  2WXK A;  4OZC A;  4WQM A;  4M0W A;  1YN5 A;  1FRD A;  2ON8 A;  1K51 A;  5HHD G;  2LMC A;  1ENF A;  3AB5 A;  3SFD B;  2ACZ B;  3BWU D;  2E3T A;  5E6J A;  3KWL A;  5D3I B;  3EUB 2;  4ARI A;  2N7J A;  2VZK B;  3HRD D;  2WXN A;  1ZXI A;  3FAH A;  1IUE A;  2YEP F;  1QT9 A;  3IAM 1;  3AEE B;  3NZ3 A;  1QOF A;  1SB3 C;  1I4P A;  2PTL A;  1JCK B;  4NZL B;  1C78 A;  1VZ7 A;  2N9K A;  3NVV A;  2K0P A;  2RDH A;  2N9L A;  2J52 A;  5AUK A;  1FNV A;  4RNA A;  3W5V B;  1QLB B;  3WCQ A;  1PFD A;  1NEK B;  1PGA A;  2L1A A;  2LHE A;  3B9J A;  3U4E G;  3MC0 B;  3BVZ A;  1NYR A;  4MM3 B;  1FD6 A;  4IKG A;  2JZP A;  3NUH B;  5T8I A;  1SE2 A;  1TS4 A;  3MHZ A;  2WU2 B;  3CWI A;  2LFI A;  3VR8 B;  3I57 A;  3U52 E;  1WSP A;  3GP7 A;  1DGJ A;  3Q8E A;  4RGO S;  1HQR D;  2FBW B;  2NTS A;  1VZ6 A;  1YN3 A;  2QJL A;  2W54 A;  3EA6 A;  2M19 A;  1JWB D;  1TJE A;  5EE0 A;  2KDM A;  1B1Z A;  1ZXH A;  1E9M A;  5GXG B;  5BMH A;  4AQ7 A;  3TSS A;  1FFU A;  1FXA A;  4YTM B;  3RPF C;  2NTT A;  4GDK B;  4B0E A;  2BBC A;  2KMM A;  3VRB B;  1QKZ A;  2WXG A;  1KLU D;  2RDG A;  2TSS A;  5FK9 C;  3E56 A;  1P7F A;  1UWM A;  1RM6 C;  4JWS C;  1ZE3 D;  4KGS A;  1KLG D;  1L0V B;  5HG2 A;  3MP9 A;  1M4V A;  2JQR B;  1F77 A;  4Q2J A;  3ZJT A;  2PVG C;  2OED A;  1TS5 A;  3NVW A;  1FO4 A;  1WWT A;  1KRH A;  1KH0 A;  2MJD A;  1T5X D;  3IT4 B;  5AUI A;  3VR9 B;  5BMG A;  3W5U B;  4A9A A;  1JWA D;  3BVM A;  1N5X A;  1JWS D;  3R8B A;  4DQO C;  3P63 A;  4RCO A;  2WXM A;  5EE9 A;  1YQ3 B;  1QOB A;  1XF5 L;  3AMZ A;  3FIL B;  4KX6 B;  3TUO A;  2RPV A;  2K9X A;  1HZ5 A;  2XN9 C;  2DWQ A;  2MJ3 A;  3Q69 A;  2WXO A;  1N62 A;  1EWC A;  1XXG A;  5LNK 1;  2LHD A;  1JRP A;  3R2I A;  4LLG M;  4CQN A;  2V3P A;  3P4P B;  2W3S A;  1FMA D;  1GB1 A;  2KWD A;  2LUM A;  1V8C A;  1N61 A;  4LTU A;  4L2Y A;  2NMQ A;  1I7H A;  1FNW A;  5D7G A;  2KQ4 X;  4ZRQ A;  1TKY A;  1K52 A;  4A6Q A;  4YT0 B;  2R61 A;  4WH4 A;  5BYQ A;  1AWD A;  4FXC A;  1UNS A;  1D6E C;  2M56 B;  1GPX A;  1FCL A;  4RGT A;  4OZB A;  1TY0 A;  2M0A A;  1XEE A;  4WWM A;  1BXT A;  2XNA C;  2KN4 A;  5D3D A;  1JRO A;  1F2R C;  3BYY B;  3MFG A;  4KGR A;  3URY A;  3W9C B;  3W2D A;  1FCC C;  4R3D A;  1F0Z A;  5G5G A;  1CQV A;  1LO5 D;  1Q10 A;  2IPK D;  1P7E A;  1GAQ B;  3AV8 A;  4H2A A;  4AS1 A;  1PGX A;  3AE5 B;  1L5P A;  1SE4 A;  1SJE D;  4EE2 A;  1E10 A;  1OQQ A;  2V4I B;  1JAL A;  3FC4 A;  1ZDX A;  2LJI A;  1SBB B;  2GRI A;  1WRI A;  4JPS A;  1JW9 D;  4OW0 A;  3Q8A A;  4IDI A;  2IGH A;  4WIP A;  1B9R A;  4JE3 B;  3Q8C A;  1L0X B;  5H92 C;  1NI3 A;  1JML A;  1MHX A;  4TMA B;  5BYR A;  3TEY A;  2BTE A;  3LYY A;  1FXI A;  2L32 A;  4ARC A;  1UUP A;  2H88 B;  2IDY A;  3EGR A;  2AQ1 B;  1DYQ A;  3AE2 B;  1IBX A;  4N59 A;  1E0Z A;  3B2F A;  2AX5 A;  1NYQ A;  3AE6 B;  4YSY B;  1SF0 A;  3PZ7 A;  1ESF A;  1JWU D;  3VQI A;  1D5X C;  2JSV X;  5JXV A;  1XO3 A;  1EWY C;  2GI9 A;  4ZRP A;  4P6V F;  3ZJV A;  1MHH E;  4YTP B;  3J9C A;  1N60 A;  1XLP A;  4YSX B;  5H8Y E;  1EM7 A;  2K22 A;  3AEG B;  3KWV A;  4NAM A;  1J7A A;  1Y56 A;  4RGN A;  1EU3 A;  4C56 C;  3T3O A;  2DYO A;  2JXT A;  2WQY B;  1YJJ A;  3SFE B;  3BK2 A;  1VZ8 A;  2Y3A A;  1IBX B;  1BUI C;  1HZ6 A;  3AE3 B;  4HJG E;  1JQ4 A;  4LK0 M;  1VJK A;  5BMI A;  4WUR A;  4A8X C;  3U2S C;  1STE A;  3AE1 B;  4NJC A;  3P1M A;  4HRS A;  2WDR B;  2K3U A;  1SJH D;  1ZUD 2;  2GB1 A;  2J4X A;  2W82 A;  1L6U A;  3GS2 A;  4IOI E;  2ICI A;  2FUG 1;  1RYJ A;  4ZHP A;  3ZJU A;  2WXQ A;  2W3R A;  3HUI A;  3KQ4 A;  4OZA A;  4ZHO A;  2MJE A;  3BYT B;  1D4B A;  3AE4 B;  3LB8 C;  3ETR A;  1IGD A;  3NVY A;  1T3Q A;  1SIJ A;  2Q5W D;  1FEH A;  2PVO D;  1KTK A;  1TKG A;  1TY2 A;  1UWX A;  2PW9 A;  3MJ5 A;  4HRO A;  1J7B A;  2QIE B;  1ROE A;  3DWG C;  2AQ3 B;  1ZP0 B;  4HKZ E;  1J7C A;  3SEB A;  1UGJ A;  4TQ0 A;  1AN8 A;  1C77 A;  2BW2 A;  1BML C;  5EE3 A;  2PLP A;  2BS4 B;  5C2T B;  1QOG A;  2L83 A;  2WU5 B;  2PIA A;  3Q8B A;  2J42 A;  4RH6 A;  1TZO A;  2I38 A;  1TYG B;  1DOY A;  2INN E;  2WNM A;  1FIQ A;  2K5P A;  1ACC A;  1I4H A;  2OHF A;  3E9S A;  3FIL A;  1HXY D;  2WXL A;  1OQR A;  2D5G A;  1C9F A;  1XLO A;  3BZD B;  4XWW A;  4A55 A;  1IGC A;  2MEK A;  3N9Y C;  2AQ2 B;  1EU4 A;  4ZOH C;  3ABV B;  5C3J B;  2ZW1 A;  1VLB A;  5G5H A;  4C80 A;  5MPO A;  3BK1 A;  1C79 A;  4PT5 A;  2V0G A;  2PKO A;  1I4X A;  2WDQ B;  1AYF A;  2WP9 B;  1VDV A;  2LGI A;  3TEX A;  2JX5 A;  3DWM A;  1FFV A;  1YJI A;  2YEP B;  4USA A;  2VZK D;  3AE7 B;  1FM0 D;  2BT6 A;  3P4S B;  4OVZ A;  4WAF A;  4ZYS A;  2QEJ C;  2KAC A;  3AE8 B;  4XDC A;  1FRR A;  4HKQ A;  2V3N A;  2LEK A;  2WDV B;  4N58 A;  3AE9 B;  1DOX A;  5BYS A;  2WLB A;  1D5Z C;  2WXP A;  2X38 A;  2MH7 A;  2HDE A;  1WGK A;  2DYM A;  2DBY A;  4KKI A;  4YXD B;  4KKJ A;  1I4G A;  1SE3 A;  2CJO A;  4XDD A;  2IGD A;  2DLB A;  3PO0 A;  4JWU C;  2G1E A;  3OWE B;  4XE0 A;  3W1S A;  3V05 A;  1V97 A;  4KGT A;  4YWG G;  2EEL A;  2J53 A;  4OHJ A;  2FE8 A;  3ZQ4 A;  1V1P B;  2BYT A;  2I2Y A;  3ZGZ A;  1AW7 A;  4MH8 A;  3C8Y A;  3B2G A;  3O13 A;  1F2R I;  1RWS A;  1C4A A;  1MVK A;  1E6E B;  2QSD A;  3HVZ A;  1MI0 A;  4RGM A;  1HA5 A;  1GB4 A;  1CK1 A;  1HEZ E;  4XWT A;  2QIL A;  3V3X A;  3T3N A;  1K50 A;  1C76 A;  1QQR A;  2BB5 A;  4TSS A;  5HI1 A;  3TEW A;  3AH7 A;  3CIR B;  3BII D;  1CJE A;  1ZOY B;  3AEF B;  4DXF A;  4GDL B;  3AEA B;  2ONQ A;  3KLS X;  3I9V 1;  4P16 A;  4RF0 A;  2E6X A;  2L52 A;  2QMT A;  1KFY B;  4TQ1 A;  2JU6 X;  2WS3 B;  3BVG A;  4RFB A;  2BS2 B;  4MAC A;  1L6V A;  3R2T A;  1YNT E;  3H8H A;  2JYT A;  2Y5C A;  3PZ8 A;  2WXJ A;  1WYG A;  1L0Y B;  1WXQ A;  3P4R B;  3AEB B;  1A70 A;  3P4Q B;  1XLN A;  3AED B;  4L23 A;  1K53 A;  3L4P A;  2WXR A;  1DOI A;  4HEA 1;  1XCT L;  4MT5 A;  3VRA B;  2N0S B;  5EE1 A;  4C7Y A;  2IJ0 A;  1PDX A;  3NVZ A;  3NRZ A;  1PGB A;  1V1P A;  2IGG A;  2RMM A;  3ZYY X;  1GOZ A;  1SXT A;  5I4D A;  2ZW0 A;  2JYE A;  4US9 A;  2WXF A;  1QOA A;  2PMV A;  1RFK A;  2SEB D;  1D5M C;  1XCQ L;  3UI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...