1P7EA

Gb3 solution structure obtained by refinement of x-ray structure with dipolar couplings
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MQYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin G binding protein G
publication title Evaluation of backbone proton positions and dynamics in a small protein by liquid crystal NMR spectroscopy.
pubmed doi rcsb
source organism Streptococcus sp. 'group g'
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2003-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1p7eA00
1XCQL 5HG2A 5JXVA 1FD6A 1IGDA 4OZAA 2ZW1A 2GI9A 3MP9A 2RMMA 1FCCC 2PW9A 1HZ5A 1P7FA 1Q10A 1XCTL 2RPVA 1IBXA 2LGIA 2PTLA 2N9KA 1UWXA 2KACA 2J52A 2I38A 4OZCA 2JWUA 1HEZE 1KH0A 3V3XA 2NMQA 1EM7A 1MI0A 1HZ6A 4MACA 1K52A 2KN4A 4OZBA 1F2RI 4IKGA 2GB1A 5HI1A 2IGHA 1GB1A 4KGRA 2LUMA 2JZPA 2ZW0A 2OEDA 2QSDA 1D4BA 2K0PA 2ON8A 1QKZA 1JMLA 1K50A 2ONQA 4KGSA 1IGCA 1C9FA 5HFYA 2LHDA 2JSVX 5BMGA 2QMTA 2N9LA 1PGAA 5HHDG 2IGDA 1ZXHA 2PLPA 2N7JA 1P7EA 1YMHE 2I2YA 4KGTA 2KWDA 2LHEA 2IGGA 1K53A 1XF5L 4D2KA 1MPEA 2EELA 1GB4A 2J53A 2KDMA 1PGXA 2JU6X 2JXTA 4GLSC 4HKZE 1F2RC 2KQ4X 1YNTE 1PGBA 1MHHE 1MVKA 3FILA 3GB1A 4WH4A 5BMHA 4IOIE 4HJGE 1IBXB 5BMIA 3UI3A 1FCLA 3FILB 1MHXA 1K51A
chains in the Genus database with same CATH superfamily
2ZZPB 1WSPA 1FD6A 1N5XA 1P9DU 3KVFB 3AECB 1KTKA 2ZVOA 4Q2JA 3ZVVA 3IVFA 5IA7A 3O13A 2L1AA 3MP9A 3U8ZA 1UNSA 2KMAA 4W9LA 4HXDA 1WXMA 3Q8AA 2BBCA 4EOYA 1MG8A 4W9FA 4ZRQA 2KFKB 2PVOD 1CJEA 1UUPA 1P0RA 2DYMA 2YVCA 1JW9D 5G5HA 4GGQA 1EM7A 4BKGA 1WX8A 2D10A 1ROEA 4M8NA 2PJHA 3I3TB 3L17A 2OJWA 1F2RI 3LJ3A 1AYFA 3FAHA 4MH8A 2IO0B 3V60A 5CHVC 4PK1A 2KZRA 4N59A 2KXJA 3U4EG 3VTWA 2OEDA 2QSDA 4RCOA 2CHXA 2Q5WD 2WXKA 4WWPA 1PYWD 1EO6A 1WF9A 3N32A 3ZXVA 3PZ8A 2IDYA 4AWJA 4DDID 4DXFA 1YQBA 2JY6A 3J9CA 2WYQA 3AE2B 2SAKA 4IWPA 1ZP0B 4A20A 1OGWA 1N62A 1L0XB 2KX0A 2LXCA 3UIPB 2KDMA 1MG4A 1TY0A 2KN5A 1GPXA 4NAWB 1OQQA 3VAWA 3C0RB 4KKJA 2G3QB 1VLBA 4G0NB 5I4DA 1C4PA 3B2GA 4HKQA 3EUB2 3IT4B 3UINB 1IBXB 2O6VA 2W9NA 1T0SC 3KWLA 3BVGA 1QOBA 3N1YC 1YN4A 5KHOA 5H92C 2KQSA 3QK0A 4KIKA 3IFWB 3JSVA 3RUIB 3SU8X 4MT5A 3DBHB 5JH5C 1TBEA 4PS8A 2J52A 3P63A 1D5ZC 4LK0M 4OZCA 1HEZE 2W54A 1E8WA 1E0ZA 1WJ6A 2MX2A 2WS3B 2D3AA 4OZBA 3KLSX 1JWAD 2HE7A 2C7HA 5FR6A 3NJTA 1RAXA 1WGHA 2JZPA 2V3NA 1RM6C 1AWDA 3W1SA 2WNMA 1D5MC 3NZUA 2DAJA 2HTHA 4WQMA 3DVGX 3V6CB 4KGSA 3R8BA 3H7PB 2MH7A 1GOZA 2BS3B 3ECIA 2KQ7A 3NVZA 2BS4B 1JWBD 3TBLD 1GC6A 3VXWA 5DCNA 3AEDB 1CZPA 1WR6E 2PLPA 1VCBA 2LGSA 1E7UA 5L95C 1UF0A 1GUAB 3RPFC 4JLCA 4BFRA 5BYQA 1HTQA 1PFDA 1MPEA 1TS4A 1LM8B 1WX7A 4B0MA 1C76A 2BWES 2N9PC 1YN3A 4MGKE 2FUHB 2K3UA 1H4RA 4HDOA 1VDVA 2JXTA 2DZMA 3QAQA 1F2RC 3HVZA 2NS5A 3VH3B 1V81A 2KLGA 2D3CA 1QF6A 2DENB 2KHWB 3AE8B 3V6EB 3MC0B 3I5JC 2SEBD 1J8CA 3T8MA 2VZKB 1FEHA 1FXTB 2GI9A 4P7IA 3U7DA 1FCCC 1EUVB 3NS1A 1P98A 1Q10A 1WXAA 2PTLA 2N9KA 4RM8A 1Q5WB 1FFUA 5FK9C 2I38A 2RDBC 3ZGZA 2K39A 3LDZE 2WX1A 2G45B 5AZGA 2HJ8A 4AJYB 1NBFC 1E8XA 1BT0A 2AQ2B 2CU3A 2IGHA 4NPNA 2MSED 4AUQC 3APFA 1JROA 4PYZA 1UD7A 2LUMA 1UGMA 4LNNA 1C78A 3PRZA 1D4BA 2WXRA 2AWTA 3VUYA 4X57B 2K5PA 4JIOU 1WM2A 2GLSA 2LHDA 5EE3A 2ZVNA 4II2B 2BT6A 3HM3A 3OAWA 2HTME 2JQRB 1TGZB 4CO7A 1AW7A 4GDLB 3JW0X 2BYEA 4K7SA 2XN9C 2Z8LA 3MFGA 4RF1A 1E10A 1T0YA 4JPSA 3IAM1 2INCC 1HE8A 1T3QA 3SEBA 1VRAB 1FNVA 3VFKA 3CSFA 1C77A 1T0RC 4G50A 2KQ4X 2FNJB 4JWSC 4HJKA 1WZ0A 1KLUD 4WJOA 2YLMA 3TEZA 1YJIA 5HG2A 5T8IA 5CHFA 1MJDA 1VZ8A 4DBGA 4EE2A 2L7RA 4P16A 1STEA 2NPTA 2AX5A 2KJHB 4BKSD 3U30A 4C7YA 1FRRA 2RPVA 1L0VB 3T3NA 4EZKA 3C19A 1ZDXA 5IAAC 1KM7A 1KOTA 2D07B 5G55A 3TJPA 4US8A 4FJYA 5TSSA 3KUZA 3P4SB 2X38A 5EDSA 4GU2A 3A33B 3GE8C 4OW0A 3AE1B 1R4NI 4WWOA 5AZHA 2N0SB 1QOGA 2FCSA 4LNOA 2QIEB 4P1CC 2RDGA 3TL5A 4K7UA 2MJEA 2L00B 2FBWB 5H8YE 1TKEA 3NVYA 4QAYA 1Q0WB 2ON8A 2UU7A 1WGGA 1D5XC 3VR9B 1IGCA 3NVVA 2J7QB 4R3DA 4HPPA 1D3ZA 4ZRJA 2N9LA 1FXIA 2X8XX 4II3B 2AQ3B 1B9RA 2FUG1 3EFUA 3RCZA 4N6EB 2MP2A 4MGZE 1JCKB 1BUIC 5GMVA 3ENEA 1YMHE 1L0YB 2LASA 3TUOA 3RNAC 2FCNA 4PT5A 3ZNZB 3RULA 4C4VA 3WAMA 3AV8A 2CHWA 2OJRA 2MBEA 2ZCBA 4GIVA 4DHZE 2KWUB 4DHJB 2E3TA 4DQOC 3A1QB 2Y5PA 4FULA 4KV2A 3P4QB 1A5RA 3UI3A 3VTVA 2KC1A 4EZJA 2D3BA 1YX5B 2R2OA 3PVLA 4TUUA 5D6JB 1TS3A 2CR5A 4M0WA 2WXJA 3W5VB 1VJKA 2M1MA 2VH2A 3RNFC 1FM0D 1V49A 4RNAA 2WXOA 4OVUA 3N9YC 4RF0A 2TSSA 4MM3A 2D3GA 2BYFA 1E6EB 1SE2A 2E6XA 2WWZA 3SR6A 1YOVB 2JRIB 1I4QA 3NG0A 4MACA 4GB9A 4KDIC 1KFYB 1NDDA 1ZDVA 3SDLC 2JXXA 2WXHA 2IBIB 2NVUI 3BIID 2KFKA 1TZ1A 2V3PA 2K22A 1JALA 1H8CA 1I7HA 1KLGD 2G9HD 4FHJA 4W9KA 1L2NA 4FADA 3R2IA 3OJ4B 1SJED 2ZCCA 2BYTA 4NJCA 1HQRD 3ZO5B 2JX5A 2KKCA 4TMAB 2MHJA 4DK5A 1J7AA 2LHEA 4A3OA 1QLBB 1PQSA 4YSYB 1CK1A 1F1HA 1N63A 1N6ZA 4JL9A 4LJOB 4S0RA 1V86A 2KVRA 2KAJA 2Z0EB 4B9KA 1V80A 2EKIA 2ZPYA 3APDA 4YXDB 2N1VA 1PUTA 5BMHA 3B1LX 2ZJDA 3H7SA 2M19A 2RGFA 3RT3B 3BK2A 3RD2A 1WYWB 3S2AA 2Z0DB 2DHZA 4NAWA 3ZDMC 4F1SA 3W2DA 3QJZA 4RGMA 1EU3A 2J4XA 4W9HA 1JRPA 2LJ5A 2BB6A 1S3SG 4HK2A 1IBXA 5J2RA 1JQ4A 4JE3B 4ZHPA 2D11A 2WXIA 2BF8B 1BXTA 1Z5SB 3AU4A 3QC8B 1WJUA 1V2YA 4P1BC 3AH7A 3ZW3A 3AI5A 3VH4B 2XBBC 2KNBA 3R66C 2FCQA 3U7ZA 4MJSB 2KX3A 1WZ3A 1E8YA 5BMGA 4C80A 1JRUA 3ZJVA 3N30A 5DPSA 1GAQB 4ZRPA 2JUOA 4FLHA 2CS4A 2WXQA 4B95A 4YTNB 1VR9A 5JHBA 4OVVA 3KH0A 2IO3B 3H7PA 2L05A 2DWQA 4XDCA 4ASWC 4GDKB 3LYYA 3LXFA 1TKYA 3DOWA 2KFJA 2WDVB 4XWTA 3DWGC 2MBQA 1VD2A 2LGDA 3ZUNA 3EGRA 2MCNB 1CMXB 1MVKA 3Q8EA 2LI5A 1X1MA 3DBLB 4REZA 2ZPNA 4CQNA 2KJ6A 3Q8BA 5BMIA 5AUKA 2V4LA 3MC9A 2OHFA 1NVID 3B2FA 3R3MA 2MJDA 2D2QA 4RM9A 3W1SC 4DXGA 2W55A 3PRMB 2PMVA 4TV3A 3PZ7A 1PDXA 4W9JA 4IM3A 4CHKA 4HLEA 4AS1A 3PHXB 3IXSA 3AE7B 1WIAA 2JWUA 4ZRIA 3ZLZA 3WIMA 1KLVA 2KO3A 3ZRCA 4AOFA 3MJWA 4IKGA 2K8CA 3O65B 3QA8A 2KDIA 3TCAA 4M8MA 4HEA1 3CF6E 4BKSA 3C8YA 3A4RA 1WRDB 4LNFA 2MW5A 2K0PA 2NR2A 1JMLA 1HXYD 3M62B 2KLCA 3RZFA 3LB8C 3B08A 3DVNU 3ZIMA 5E6NA 2L0TA 1F77A 5JZEB 2BKRB 3OWEB 3PO0A 4TSSA 5E6PA 1NENB 3P1MA 3EFCA 3AE6B 4JQWC 4RGNA 1YD8U 4KVGB 1XF5L 4LCDE 2I1JA 1VZ6A 2LEKA 3VTUA 4AP4C 2IJ0A 2JZ3B 3L10B 1YJ1A 4US9A 3AXCA 4IDIA 3VDZA 4L23A 1E7VA 2JU6X 4GDLA 4HKZE 1XD3B 3VR8B 2KK8A 2PPHA 3SD5A 3V05A 1FRDA 4IOIE 3NOBA 5D3IB 1NYRA 1SXTA 4EFOA 4KX6B 2NBWB 1F0ZA 3K9PB 5JXVA 3AB5A 4IG7B 4WJQA 1EWYC 2MWSB 2WXLA 2WU5B 3RMKC 3ZYYX 2PW9A 3HRDD 2H89B 3BK1A 1XCTL 1HTOA 2WQYB 3ZRFA 3SFEB 4NAMA 3UIOB 2EKEC 1LQBA 2VRRB 3WCQA 4HDQA 2L3ZA 1SB3C 4NJ7A 1G6JA 1B1ZA 1K52A 4WIPA 2LWPA 1C79A 4LNKA 1IUEA 2BPSA 2FE8A 1Z2MA 4MELA 3CSTA 3Q2AC 2VH1A 4KSLC 3VQIA 2WXNA 2KDEB 3L13A 2I1KA 1QKZA 2WLBA 3N1ZC 2MBBB 3ABVB 1JWUD 2OOBB 1AN8A 2MQJA 2C7MB 3AEGB 1YQ4B 3ZDTA 2BW2A 3Q8CA 3MHZA 4EZLA 1GC7A 1V1PB 2KD0A 3ZQ4A 2RD0A 4IWOA 1ET9A 5C23A 2PE9A 1EU4A 3KYCD 3URYA 2GBKA 4FN2A 2GOWA 4GXBA 3ZTCA 5AZFA 1J7CA 2FCMA 5J18A 3KW5B 2L0FA 2AQ1B 2WXGA 2YEPB 2M0AA 3Q3JA 3ZNGC 5G2NA 1WXQA 1YNTE 2LD9A 4I6LB 5EE0A 3FILA 4WH4A 4L1BA 3D32A 2MRPA 2QHOA 4H2AA 5D2MB 5FKAC 3DBLI 4NJ6A 1S1QB 2N9EB 1GG3A 1WGKA 1DOXA 1FPYA 3ML9A 3A1QA 3R7QA 5JHAA 4YL8A 3V61A 2REXA 1WFYA 1J19A 4KDLB 2L8JA 1AARA 2DAFA 4ICUA 4XE0A 4EKUA 2KC2A 1UELA 1UWXA 1K8RB 2M17A 2UWQA 2BYVE 3MJ5A 1YX6B 4NQKE 2LUEA 2NMQA 4RMAA 3PLUA 3OJ3A 2IPKD 3OG5A 1XLQA 4PS7A 4JWUC 3IHPC 2N9XA 2DYOA 4HWIB 1SE3A 2UYZB 2BWFA 2CHZA 3BVMA 1FIQA 1FNWA 2AL3A 3DBHI 4ZOHC 1EF1A 4ZDVA 3KWVA 2JZZA 2DZJA 1OEYJ 4J6IA 2JRHA 3AMZA 1FXAA 4XZ4A 3DHHC 3QX1A 3ZJTA 2D5GA 1XT9B 2KWDA 3BVZA 1L7YA 1XO3A 1T0QC 1KF6B 3DWMA 4MGYE 1WGYA 2MLBA 2XEWA 2R61A 3N20C 3VUXA 5CX3A 1JWMD 1GJZA 2R2QA 4LDTB 4WURA 1UBIA 3VVWB 2ASQA 2YEPF 3VUWA 1TKGA 3JVZX 1RRBA 2V3SA 1VZ7A 3NZSA 4AQ7A 1N61A 4WWMA 4WJNA 4W9DA 2DNFA 4HJGE 1I4XA 5LXIB 3FILB 1MHXA 4KZCA 2LFIA 2C60A 3NZ3A 3Q6BA 4NZLB 4BAXA 1SIFA 1WJ4A 4UDUC 4ARCA 1HZ5A 1P7FA 3A9KB 2FIFA 4A90A 2JWZA 2NBVB 3TEYA 5C1ZA 4CYEA 3PREA 2QEJC 4M02A 4FBJB 2M0XA 4HROA 1KH0A 4IWQA 2WU2B 4MSQB 3HVDA 5FR3A 4FXCA 1WYGA 3QARA 4BOZB 1F52A 3E9SA 2K9XA 2LVQA 5G5GA 4TQ0A 3VRBB 2ZNVB 4W9IA 1UBQA 2JPHA 2ZW0A 3B0AA 2WGSA 4ANVA 2O2VB 2KT7A 1Y56A 1BMLC 4N58A 3ZTDA 2EMSA 2DYBA 1SE9A 3BZDB 3U2SC 1RFKA 4MDKE 2IGDA 2KTRB 4OVZA 2K8HA 5E6JA 2L83A 1ZUD2 2WXMA 2XNAC 1XXGA 2MA9B 2BKFA 2KWCA 1WXVA 4MJSA 1WY8A 4LDTD 4FJZA 3AE9B 1L6UA 3GP7A 3H1UA 2DBYA 3DVGY 1L4DB 4IC7B 2NBUA 3HHMA 3ZKJC 2J0JA 1L5PA 2DZKA 3T3OA 1OEYA 4WWNA 1V1OA 4JGHB 2Z59B 2J0MA 1YQ3B 3QWZB 4IUMB 1WJNA 3EHVA 3L54A 4GDKA 1I35A 1QQRA 4XGAB 1ZW7A 1GNUA 3EA6A 2KMMA 2PEAA 4E3CA 3ETRA 4YSXB 3RFZB 1C4AA 1NI3A 1DGJA 3BYTB 4YT0B 2ACZB 2RMMA 4W9CA 5BO4B 3NS8A 3ONSA 2QCZA 1DOIA 2ICIA 3HM6X 1YJJA 1E7PB 2RSUA 4LJPB 2K6QA 2KYWA 4KSKC 2MEKA 1ZKHA 4DWFA 3X23A 4L2YA 3PT2B 4PS3A 4F7ZA 5EE9A 2M56B 4IM0A 4B0EA 1WMHB 1TIFA 4E74A 5IOIA 1XLOA 4XC2A 3K9OB 1WGDA 1ET6A 1TY2A 2NCNA 3W5UB 1Y8RC 1TS2A 4W9GA 3I63C 3AEBB 4K3BA 4JX1C 2INPE 2V4IB 3AULA 4ACFA 3KQ4A 3TMPB 2PKOA 2KANA 2C7NB 1TT5B 5DPTA 1ISNA 2GBNA 3WALA 1QOFA 2K25A 2IO2B 3NHEB 3FC4A 4KGTA 3GZNB 2AEHA 2KDFB 3AN1A 1P1AA 4XYCA 1V97A 2KWVB 4URKA 3RNGC 4GLSC 3AM9A 3PGEA 3RZWC 1ACCA 2W3RA 2HDEA 4A55A 2B3AA 2QILA 1V9JA 3DHIC 1ZE3D 2L52A 3VRAB 1XCQL 3IBEA 3A9JB 1SIJA 2IY1B 2WDRB 3AE3B 4EEWA 1F9JA 1A70A 4YTMB 1MFWA 4USAA 1KJTA 3L4PA 3PV1A 2G4SA 1I4HA 3BINA 1SGHA 2RDHA 1ZXIA 1Q1OA 2GBJA 4GN1A 3Q8FA 2GB1A 4ANXA 2GBRA 4WJPA 2DX5B 3QIJA 2BQQA 5AUIA 3NRZA 2DLBA 5TR5A 4NQLB 1N5WA 3PRPB 3Q3NC 4BBNF 3WAPA 2INNE 2QC8A 4EUTA 5DPWA 3TEWA 1WM3A 4TQ1A 2WDQB 3GE3C 2C5LC 1WR1A 2XK5B 4LLGM 3Q69A 4C56C 1ZOYB 3DPDA 4WAAA 3MHSD 3IT6B 4A8XC 3WANA 1XQQA 4HCNB 3KUCB 1J7BA 2MJ3A 2PIAA 3RNCC 2LMCA 5IP4D 3BY4B 1LXDA 3RNEC 3L16A 1YN5A 3RYTA 1FFVA 3TSSA 3DBSA 1V1PA 4WQOB 5HKHA 3DDCB 3EECA 2B76B 2DZIA 2WXFA 3L0WB 1UH6A 3JYUA 4MGIE 1LFDA 2NTTA 3QQ8B 1FCLA 1R4MB 3UF8A 3ML8A 1IGDA 1XLNA 5EE1A 1R4NB 4FJVB 3V62A 1SJHD 1L4ZB 2GMIC 3X0WA 3B9JA 4GSWA 4ICVA 3P2BA 1E8ZA 1SEBD 2IO1B 2J42A 1OQRA 3I57A 3NVWA 4KZ0A 3TEXA 3EC8A 1N60A 4HCPB 2JYTA 3N1XC 2RR9A 1R7SA 2KACA 3PS6A 1RYJA 4C7ZA 1E90A 4YSZB 1SBBB 1NEKB 4NY0A 4OHJA 2LGYA 3P4RB 2M8SA 4GMVA 2W3SA 1WXSA 3QCAA 2ONQA 3ZXRA 3WAOA 1TTNA 3N3KB 3SFDB 3ALBA 3H8HA 3HK0A 3M63B 2FAZA 2N7JA 3MTNB 1NI2A 5C2TB 1WX9A 1XEEA 4XWWA 1XLPA 3IG3A 4RGTA 4DHZB 1WH3A 1WE6A 1HA5A 3TIXA 3AU5A 2N7EA 3GZNI 1QZEA 2O6VB 3NUHB 1QILA 3IAS1 5CTRC 3AE4B 4I6PA 1WI0A 2IZVB 2BS2B 3RI7C 1SSNA 2LRWA 4KIKB 3JSVB 5D94A 1KRHA 2LGXA 1TJEA 1UGJA 2A4ZA 3M95A 1QOAA 2KDBA 4XDDA 4LNIA 2CJNA 4FHKA 5E6OA 4M01A 2QDFA 1T6BX 1K51A 2ZNVC 2V0GA 4OZAA 5LXHA 2PE6B 4N9F4 1M4VA 3T9LA 2K8BA 3AE5B 3DBRB 2PVGC 3DVNV 2KMCA 5IO9A 3DHGC 4WAFA 1I4RA 1WRIA 1I42A 1FO4A 3H9DA 1YIWA 2M4NA 2KVZA 1TS5A 3P42A 3ZNHB 5MPOA 1MI0A 3HUIA 2CKHB 3A9KA 2N7DA 2KJRA 4IW0A 2J0KA 4A6QA 1U4AA 3QHTA 3AEFB 2L76A 3UQBA 2EMTA 5IN7A 3CIRB 2CU1A 2LJIA 5GXGB 4NNJB 1ZPSA 4M00A 5HHDG 1WGRA 4GOCA 1QT9A 1J0GA 4DXAB 2O2VA 2I2YA 2O6VD 2VZKD 3NY5A 1ZGUB 2AL6A 2LZ6A 1D6EC 4KKIA 3ZNID 2KTRA 4K81A 5L83A 2NTSA 2HD5B 2LVOA 2QJLA 3R2TA 3Q3OC 5KHQA 4K1RB 1PGBA 1MHHE 3AEAB 2IYDB 2G1EA 3GB1A 4FA6A 2Y5BB 3SHQA 5J17A 3BYYB 2JT4B 2GRIA 4C00A 4K7WA 2ZW1A 3W9CB 1R4MI 1RWSA 1M94A 2K6DB 1NYQA 4TKNA 3PZDA 2A5UA 1E9MA 3Q14C 4BBNC 1OFFA 2W82A 2LGIA 1C1YB 1I4GA 3FKYA 3APCA 5C3JB 2WXPA 4ZYNA 3A4SC 1P3QU 2WX0A 4AJWA 1LGRA 2KN4A 3WA0A 5HI1A 4J3OD 5LLIA 4E71A 1FNUA 3KYDD 4HPLB 1DOYA 5BYSA 3UGBB 4ZRKA 3HIZA 3W1YA 3H6NA 4K3CA 1WMHA 2ZEQA 1C9FA 1CQVA 3P4PB 5HFYA 1V5OA 2LXAA 3PPAA 1IYFA 1TYGB 2BVCA 2MBOA 3RNBC 3PLVA 3RN9C 4ARIA 3CWIA 2N4FA 3PTFC 1OTRB 4DDGD 1ZXHA 3PHWB 3PSEB 1P7EA 4P6VF 2Y3AA 2IGGA 4I6NB 4BKTA 4W9EA 1K53A 2GBMA 3U52E 2KTFA 2EELA 3VHTC 1WWTA 2JYEA 3E56A 5BYRA 1RFAA 4BOSC 3BWUD 4MH0E 2NPTB 3AEEB 3MC8A 4ANWA 2CJOA 1TZOA 3DQVA 3UQAA 1FMAD 1DYQA 2G4DB 4RFBA 2WP9B 4HPMB 3KUDB 1I4PA 1V5TA 3Q3FA 2MBHA 1C4CA 1UWMA 5LNK1 1LO5D 1SE4A 3I9V1 4IM2A 5D3DA 4PYUA 2HJ1A 4RGOS 3DBRI 2KOXA 4LTUA 4G3XB 5DPRA 1OQYA 4XX5A 3ZJUA 3A9JA 5D7GA 4RH6A 1T5XD 1V6EA 3V3XA 2BB5A 4HVBA 1HZ6A 3Q3MC 2JVCA 1UZXB 2Y5CA 2FIDA 2H88B 4ZYSA 4YWGG 1IPGA 4B6WA 1GB1A 2BGFA 4KGRA 4A3PA 2MP2B 4ITKA 2V1YA 2IY0B 1WE7A 2L32A 1RLFA 1K50A 4DHJD 1V8CA 4YTPB 4BVUC 4C4VB 2JSVX 2C9WB 5CHWA 2QMTA 2WHIA 3CMMB 1EWCA 3GS2A 5AEKB 1PGAA 3GOEA 3DCGA 3OLMD 2V9HA 4HRSA 4ANUA 1L6VA 4G11A 4D2KA 4BZAA 1IP9A 1GB4A 1SF0A 2J53A 1ESFA 1PGXA 4S17A 2XK5A 1ENFA 2JF5A 1C3TA 1EF5A 4MSMB 4MEMA 2LRUA 3R7RA 2K1FA 2BTEA 4M0WB 1E5WA 2RPQA 4F8CB 2INDC 2AYOB 3M3JA 5IKCM 4A9AA 2WDTB 4ZHOA 3L08A 4O1NA 1JWSD 4MM3B 2N1WA 2LVPA
chains in the Genus database with same CATH topology
1WSPA 1FD6A 1IGDA 1XLNA 1N5XA 5EE1A 3UI3A 3AECB 1TS3A 1WGKA 1KTKA 4Q2JA 4M0WA 1DOXA 1SJHD 1L4ZB 2WXJA 2L1AA 3O13A 3MP9A 3W5VB 1UNSA 1VJKA 3B9JA 3Q8AA 1FM0D 2BBCA 4RNAA 2WXOA 3N9YC 4RF0A 1SEBD 2J42A 2TSSA 1OQRA 3I57A 4ZRQA 3NVWA 4XE0A 2PVOD 1CJEA 3TEXA 1UUPA 1E6EB 1N60A 1UWXA 2JYTA 1SE2A 2E6XA 3MJ5A 2DYMA 1R7SA 2KACA 1JW9D 3SR6A 5G5HA 1RYJA 4C7ZA 4YSZB 2NMQA 1EM7A 1SBBB 1NEKB 1I4QA 1ROEA 4MACA 1KFYB 4OHJA 1F2RI 1ZDVA 2IPKD 3P4RB 1AYFA 3FAHA 2WXHA 1XLQA 4MH8A 4JWUC 3BIID 2DYOA 2V3PA 1E0ZA 1SE3A 2K22A 2W3SA 4N59A 3U4EG 2OEDA 2QSDA 4RCOA 1JALA 1I7HA 1KLGD 2G9HD 2Q5WD 1FIQA 3BVMA 1FNWA 2WXKA 2ONQA 1PYWD 4ZOHC 3R2IA 1SJED 3KWVA 2BYTA 4NJCA 1HQRD 3SFDB 2JX5A 3PZ8A 2IDYA 4TMAB 3H8HA 4DXFA 1J7AA 3AMZA 1FXAA 2N7JA 3ZJTA 3J9CA 2D5GA 2KWDA 3BVZA 5C2TB 3AE2B 2LHEA 2SAKA 1ZP0B 1QLBB 1XEEA 4XWWA 1XLPA 1XO3A 4YSYB 1CK1A 1N63A 4RGTA 1N62A 1HA5A 1L0XB 1KF6B 3DWMA 2R61A 2KDMA 1JWMD 3NUHB 1QILA 1TY0A 3IAS1 4WURA 3AE4B 1GPXA 2BS2B 2KAJA 2YEPF 1TKGA 4NAWB 1OQQA 4KKJA 1SSNA 1VLBA 5I4DA 1C4PA 3B2GA 1VZ7A 1KRHA 1TJEA 2EKIA 4AQ7A 4HKQA 1N61A 1UGJA 4YXDB 3EUB2 1PUTA 4WWMA 1QOAA 5BMHA 4XDDA 2M19A 3IT4B 2CJNA 4HJGE 1I4XA 1IBXB 3BK2A 3FILB 1MHXA 1T6BX 3KWLA 1K51A 2LFIA 3BVGA 3NZ3A 2V0GA 4OZAA 1QOBA 1YN4A 4NZLB 1M4VA 3W2DA 5H92C 3AE5B 4RGMA 1EU3A 2J4XA 1JRPA 4UDUC 4ARCA 1HZ5A 1P7FA 2PVGC 2BB6A 4A90A 3TEYA 1IBXA 4WAFA 4MT5A 2QEJC 1JQ4A 1I4RA 1WRIA 4JE3B 1FO4A 2J52A 3P63A 1D5ZC 4LK0M 4OZCA 4HROA 1HEZE 1KH0A 2W54A 2WU2B 1TS5A 3HVDA 3P42A 4ZHPA 1MI0A 5FR3A 2WS3B 3HUIA 4FXCA 5MPOA 1WYGA 2WXIA 3E9SA 4OZBA 1BXTA 3KLSX 2K9XA 1JWAD 5G5GA 4TQ0A 3VRBB 4A6QA 3AH7A 2V3NA 2JZPA 1RM6C 1AWDA 3W1SA 2ZW0A 3AEFB 2WNMA 1D5MC 1Y56A 1BMLC 4WQMA 4N58A 3CIRB 3U7ZA 2LJIA 4KGSA 5GXGB 3R8BA 2MH7A 1GOZA 2BS3B 5BMGA 1ZPSA 3NVZA 3BZDB 3U2SC 4C80A 2BS4B 3ZJVA 1JWBD 1RFKA 1GAQB 5HHDG 2IGDA 4OVZA 4ZRPA 3AEDB 1CZPA 5E6JA 2L83A 1ZUD2 2PLPA 1QT9A 2WXQA 2WXMA 2XNAC 1XXGA 2I2YA 2VZKD 4YTNB 3RPFC 1VR9A 5BYQA 1PFDA 2DWQA 1L6UA 1MPEA 3AE9B 4XDCA 3GP7A 4GDKB 3LYYA 1TS4A 3LXFA 1TKYA 4B0MA 2DBYA 1D6EC 1C76A 1L4DB 1YN3A 4KKIA 2K3UA 1VDVA 2WDVB 1L5PA 4XWTA 2JXTA 2NTSA 3DWGC 2QJLA 3R2TA 3T3OA 1F2RC 3HVZA 1V1OA 1PGBA 1MHHE 1YQ3B 3AEAB 3EGRA 1QF6A 1MVKA 3Q8EA 2G1EA 3GB1A 4REZA 4CQNA 3Q8BA 1QQRA 5BMIA 3AE8B 3BYYB 3EA6A 2KMMA 3RFZB 2GRIA 3ETRA 4YSXB 5AUKA 3MC0B 2SEBD 2ZW1A 1C4AA 3W9CB 2OHFA 2VZKB 1NI3A 1NVID 1FEHA 3B2FA 2GI9A 1DGJA 1RWSA 2MJDA 1NYQA 3BYTB 4YT0B 2ACZB 1FCCC 2RMMA 4DXGA 2W55A 1DOIA 3NS1A 1E9MA 2PMVA 1OFFA 2ICIA 1Q10A 1YJJA 1E7PB 2W82A 2LGIA 2PTLA 3PZ7A 1PDXA 2N9KA 1I4GA 4AS1A 3IXSA 1FFUA 3AE7B 2MEKA 5FK9C 2I38A 2JWUA 5C3JB 2WXPA 4L2YA 3ZGZA 5EE9A 2M56B 4B0EA 2KN4A 2AQ2B 2CU3A 4IKGA 5HI1A 4J3OD 1XLOA 2IGHA 1FNUA 1ET6A 1JROA 1TY2A 3W5UB 1TS2A 4HEA1 2LUMA 3C8YA 1C78A 1DOYA 5BYSA 1D4BA 3AEBB 2K0PA 2WXRA 1JMLA 4JX1C 1HXYD 2INPE 2K5PA 1C9FA 1CQVA 3P4PB 2LHDA 5HFYA 5EE3A 2V4IB 3LB8C 3KQ4A 1TYGB 2BT6A 4ARIA 3CWIA 2PKOA 2HTME 2JQRB 1F77A 1ZXHA 1AW7A 3OWEB 3PO0A 4TSSA 1NENB 4GDLB 3P1MA 1QOFA 3AE6B 1P7EA 4P6VF 2XN9C 2Y3AA 3FC4A 4KGTA 2Z8LA 4RGNA 3MFGA 2IGGA 4RF1A 1E10A 1K53A 1XF5L 4JPSA 1VZ6A 3IAM1 3U52E 2LEKA 3AN1A 1T3QA 2EELA 3SEBA 1V97A 2IJ0A 1VRAB 1WWTA 4US9A 1FNVA 4IDIA 2JYEA 3E56A 4L23A 5BYRA 2JU6X 4GLSC 3AM9A 4HKZE 1C77A 3BWUD 1ACCA 2W3RA 2HDEA 2KQ4X 3VR8B 4JWSC 4A55A 2QILA 3AEEB 3V05A 2CJOA 1TZOA 1ZE3D 1KLUD 1FRDA 2L52A 4IOIE 5D3IB 3VRAB 3TEZA 1FMAD 1SXTA 4KX6B 1DYQA 4RFBA 1XCQL 1YJIA 2WP9B 5HG2A 5JXVA 1F0ZA 5T8IA 3AB5A 1SIJA 1I4PA 1VZ8A 2WDRB 1EWYC 1C4CA 2WXLA 4EE2A 1UWMA 2WU5B 3AE3B 4P16A 1STEA 3ZYYX 2AX5A 5LNK1 1LO5D 1SE4A 2PW9A 3HRDD 3I9V1 5D3DA 4C7YA 2H89B 3BK1A 1A70A 4RGOS 1XCTL 1FRRA 2RPVA 4LTUA 4YTMB 1L0VB 3T3NA 4USAA 2WQYB 3L4PA 3SFEB 1ZDXA 4NAMA 3ZJUA 5D7GA 1I4HA 4RH6A 1T5XD 2RDHA 3V3XA 4US8A 1ZXIA 2BB5A 5TSSA 3P4SB 3WCQA 1HZ6A 2X38A 1SB3C 4OW0A 1B1ZA 1K52A 3Q8FA 2Y5CA 3AE1B 4WIPA 1C79A 2N0SB 1QOGA 2GB1A 2H88B 2QIEB 1IUEA 4ZYSA 2RDGA 4YWGG 2FE8A 1GB1A 2MJEA 4KGRA 2FBWB 5H8YE 5AUIA 1TKEA 4ITKA 3VQIA 2WXNA 3NVYA 3NRZA 2DLBA 2ON8A 1QKZA 2WLBA 1N5WA 2L32A 1D5XC 1K50A 3ABVB 1V8CA 1IGCA 1JWUD 4YTPB 3NVVA 3VR9B 4R3DA 1AN8A 2JSVX 2INNE 3AEGB 2QMTA 3TEWA 2N9LA 1FXIA 1YQ4B 1EWCA 2AQ3B 3GS2A 4TQ1A 1PGAA 2BW2A 2WDQB 3Q8CA 2FUG1 1B9RA 3MHZA 4LLGM 4N6EB 3Q69A 4C56C 1JCKB 1V1PB 1BUIC 1ZOYB 3ZQ4A 4HRSA 1ET9A 1YMHE 1L0YB 3TUOA 3IT6B 1L6VA 4A8XC 1EU4A 4PT5A 3URYA 1J7BA 4D2KA 2MJ3A 2PIAA 2LMCA 1GB4A 3AV8A 2J53A 1SF0A 1ESFA 1PGXA 1J7CA 1ENFA 1YN5A 1FFVA 3TSSA 1V1PA 2AQ1B 2WXGA 2YEPB 2M0AA 2BTEA 1WXQA 1YNTE 2B76B 2E3TA 2WXFA 4DQOC 2Y5PA 5EE0A 3FILA 4WH4A 4A9AA 4L1BA 4ZHOA 2NTTA 3P4QB 4H2AA 5FKAC 4O1NA 1JWSD 1FCLA 4MM3B 1NYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCQ L;  5HG2 A;  5JXV A;  1FD6 A;  1IGD A;  4OZA A;  2ZW1 A;  2GI9 A;  3MP9 A;  2RMM A;  1FCC C;  2PW9 A;  1HZ5 A;  1P7F A;  1Q10 A;  1XCT L;  2RPV A;  1IBX A;  2LGI A;  2PTL A;  2N9K A;  1UWX A;  2KAC A;  2J52 A;  2I38 A;  4OZC A;  2JWU A;  1HEZ E;  1KH0 A;  3V3X A;  2NMQ A;  1EM7 A;  1MI0 A;  1HZ6 A;  4MAC A;  1K52 A;  2KN4 A;  4OZB A;  1F2R I;  4IKG A;  2GB1 A;  5HI1 A;  2IGH A;  1GB1 A;  4KGR A;  2LUM A;  2JZP A;  2ZW0 A;  2OED A;  2QSD A;  1D4B A;  2K0P A;  2ON8 A;  1QKZ A;  1JML A;  1K50 A;  2ONQ A;  4KGS A;  1IGC A;  1C9F A;  5HFY A;  2LHD A;  2JSV X;  5BMG A;  2QMT A;  2N9L A;  1PGA A;  5HHD G;  2IGD A;  1ZXH A;  2PLP A;  2N7J A;  1P7E A;  1YMH E;  2I2Y A;  4KGT A;  2KWD A;  2LHE A;  2IGG A;  1K53 A;  1XF5 L;  4D2K A;  1MPE A;  2EEL A;  1GB4 A;  2J53 A;  2KDM A;  1PGX A;  2JU6 X;  2JXT A;  4GLS C;  4HKZ E;  1F2R C;  2KQ4 X;  1YNT E;  1PGB A;  1MHH E;  1MVK A;  3FIL A;  3GB1 A;  4WH4 A;  5BMH A;  4IOI E;  4HJG E;  1IBX B;  5BMI A;  3UI3 A;  1FCL A;  3FIL B;  1MHX A;  1K51 A; 
#chains in the Genus database with same CATH topology
 2ZZP B;  1WSP A;  1FD6 A;  1N5X A;  1P9D U;  3KVF B;  3AEC B;  1KTK A;  2ZVO A;  4Q2J A;  3ZVV A;  3IVF A;  5IA7 A;  3O13 A;  2L1A A;  3MP9 A;  3U8Z A;  1UNS A;  2KMA A;  4W9L A;  4HXD A;  1WXM A;  3Q8A A;  2BBC A;  4EOY A;  1MG8 A;  4W9F A;  4ZRQ A;  2KFK B;  2PVO D;  1CJE A;  1UUP A;  1P0R A;  2DYM A;  2YVC A;  1JW9 D;  5G5H A;  4GGQ A;  1EM7 A;  4BKG A;  1WX8 A;  2D10 A;  1ROE A;  4M8N A;  2PJH A;  3I3T B;  3L17 A;  2OJW A;  1F2R I;  3LJ3 A;  1AYF A;  3FAH A;  4MH8 A;  2IO0 B;  3V60 A;  5CHV C;  4PK1 A;  2KZR A;  4N59 A;  2KXJ A;  3U4E G;  3VTW A;  2OED A;  2QSD A;  4RCO A;  2CHX A;  2Q5W D;  2WXK A;  4WWP A;  1PYW D;  1EO6 A;  1WF9 A;  3N32 A;  3ZXV A;  3PZ8 A;  2IDY A;  4AWJ A;  4DDI D;  4DXF A;  1YQB A;  2JY6 A;  3J9C A;  2WYQ A;  3AE2 B;  2SAK A;  4IWP A;  1ZP0 B;  4A20 A;  1OGW A;  1N62 A;  1L0X B;  2KX0 A;  2LXC A;  3UIP B;  2KDM A;  1MG4 A;  1TY0 A;  2KN5 A;  1GPX A;  4NAW B;  1OQQ A;  3VAW A;  3C0R B;  4KKJ A;  2G3Q B;  1VLB A;  4G0N B;  5I4D A;  1C4P A;  3B2G A;  4HKQ A;  3EUB 2;  3IT4 B;  3UIN B;  1IBX B;  2O6V A;  2W9N A;  1T0S C;  3KWL A;  3BVG A;  1QOB A;  3N1Y C;  1YN4 A;  5KHO A;  5H92 C;  2KQS A;  3QK0 A;  4KIK A;  3IFW B;  3JSV A;  3RUI B;  3SU8 X;  4MT5 A;  3DBH B;  5JH5 C;  1TBE A;  4PS8 A;  2J52 A;  3P63 A;  1D5Z C;  4LK0 M;  4OZC A;  1HEZ E;  2W54 A;  1E8W A;  1E0Z A;  1WJ6 A;  2MX2 A;  2WS3 B;  2D3A A;  4OZB A;  3KLS X;  1JWA D;  2HE7 A;  2C7H A;  5FR6 A;  3NJT A;  1RAX A;  1WGH A;  2JZP A;  2V3N A;  1RM6 C;  1AWD A;  3W1S A;  2WNM A;  1D5M C;  3NZU A;  2DAJ A;  2HTH A;  4WQM A;  3DVG X;  3V6C B;  4KGS A;  3R8B A;  3H7P B;  2MH7 A;  1GOZ A;  2BS3 B;  3ECI A;  2KQ7 A;  3NVZ A;  2BS4 B;  1JWB D;  3TBL D;  1GC6 A;  3VXW A;  5DCN A;  3AED B;  1CZP A;  1WR6 E;  2PLP A;  1VCB A;  2LGS A;  1E7U A;  5L95 C;  1UF0 A;  1GUA B;  3RPF C;  4JLC A;  4BFR A;  5BYQ A;  1HTQ A;  1PFD A;  1MPE A;  1TS4 A;  1LM8 B;  1WX7 A;  4B0M A;  1C76 A;  2BWE S;  2N9P C;  1YN3 A;  4MGK E;  2FUH B;  2K3U A;  1H4R A;  4HDO A;  1VDV A;  2JXT A;  2DZM A;  3QAQ A;  1F2R C;  3HVZ A;  2NS5 A;  3VH3 B;  1V81 A;  2KLG A;  2D3C A;  1QF6 A;  2DEN B;  2KHW B;  3AE8 B;  3V6E B;  3MC0 B;  3I5J C;  2SEB D;  1J8C A;  3T8M A;  2VZK B;  1FEH A;  1FXT B;  2GI9 A;  4P7I A;  3U7D A;  1FCC C;  1EUV B;  3NS1 A;  1P98 A;  1Q10 A;  1WXA A;  2PTL A;  2N9K A;  4RM8 A;  1Q5W B;  1FFU A;  5FK9 C;  2I38 A;  2RDB C;  3ZGZ A;  2K39 A;  3LDZ E;  2WX1 A;  2G45 B;  5AZG A;  2HJ8 A;  4AJY B;  1NBF C;  1E8X A;  1BT0 A;  2AQ2 B;  2CU3 A;  2IGH A;  4NPN A;  2MSE D;  4AUQ C;  3APF A;  1JRO A;  4PYZ A;  1UD7 A;  2LUM A;  1UGM A;  4LNN A;  1C78 A;  3PRZ A;  1D4B A;  2WXR A;  2AWT A;  3VUY A;  4X57 B;  2K5P A;  4JIO U;  1WM2 A;  2GLS A;  2LHD A;  5EE3 A;  2ZVN A;  4II2 B;  2BT6 A;  3HM3 A;  3OAW A;  2HTM E;  2JQR B;  1TGZ B;  4CO7 A;  1AW7 A;  4GDL B;  3JW0 X;  2BYE A;  4K7S A;  2XN9 C;  2Z8L A;  3MFG A;  4RF1 A;  1E10 A;  1T0Y A;  4JPS A;  3IAM 1;  2INC C;  1HE8 A;  1T3Q A;  3SEB A;  1VRA B;  1FNV A;  3VFK A;  3CSF A;  1C77 A;  1T0R C;  4G50 A;  2KQ4 X;  2FNJ B;  4JWS C;  4HJK A;  1WZ0 A;  1KLU D;  4WJO A;  2YLM A;  3TEZ A;  1YJI A;  5HG2 A;  5T8I A;  5CHF A;  1MJD A;  1VZ8 A;  4DBG A;  4EE2 A;  2L7R A;  4P16 A;  1STE A;  2NPT A;  2AX5 A;  2KJH B;  4BKS D;  3U30 A;  4C7Y A;  1FRR A;  2RPV A;  1L0V B;  3T3N A;  4EZK A;  3C19 A;  1ZDX A;  5IAA C;  1KM7 A;  1KOT A;  2D07 B;  5G55 A;  3TJP A;  4US8 A;  4FJY A;  5TSS A;  3KUZ A;  3P4S B;  2X38 A;  5EDS A;  4GU2 A;  3A33 B;  3GE8 C;  4OW0 A;  3AE1 B;  1R4N I;  4WWO A;  5AZH A;  2N0S B;  1QOG A;  2FCS A;  4LNO A;  2QIE B;  4P1C C;  2RDG A;  3TL5 A;  4K7U A;  2MJE A;  2L00 B;  2FBW B;  5H8Y E;  1TKE A;  3NVY A;  4QAY A;  1Q0W B;  2ON8 A;  2UU7 A;  1WGG A;  1D5X C;  3VR9 B;  1IGC A;  3NVV A;  2J7Q B;  4R3D A;  4HPP A;  1D3Z A;  4ZRJ A;  2N9L A;  1FXI A;  2X8X X;  4II3 B;  2AQ3 B;  1B9R A;  2FUG 1;  3EFU A;  3RCZ A;  4N6E B;  2MP2 A;  4MGZ E;  1JCK B;  1BUI C;  5GMV A;  3ENE A;  1YMH E;  1L0Y B;  2LAS A;  3TUO A;  3RNA C;  2FCN A;  4PT5 A;  3ZNZ B;  3RUL A;  4C4V A;  3WAM A;  3AV8 A;  2CHW A;  2OJR A;  2MBE A;  2ZCB A;  4GIV A;  4DHZ E;  2KWU B;  4DHJ B;  2E3T A;  4DQO C;  3A1Q B;  2Y5P A;  4FUL A;  4KV2 A;  3P4Q B;  1A5R A;  3UI3 A;  3VTV A;  2KC1 A;  4EZJ A;  2D3B A;  1YX5 B;  2R2O A;  3PVL A;  4TUU A;  5D6J B;  1TS3 A;  2CR5 A;  4M0W A;  2WXJ A;  3W5V B;  1VJK A;  2M1M A;  2VH2 A;  3RNF C;  1FM0 D;  1V49 A;  4RNA A;  2WXO A;  4OVU A;  3N9Y C;  4RF0 A;  2TSS A;  4MM3 A;  2D3G A;  2BYF A;  1E6E B;  1SE2 A;  2E6X A;  2WWZ A;  3SR6 A;  1YOV B;  2JRI B;  1I4Q A;  3NG0 A;  4MAC A;  4GB9 A;  4KDI C;  1KFY B;  1NDD A;  1ZDV A;  3SDL C;  2JXX A;  2WXH A;  2IBI B;  2NVU I;  3BII D;  2KFK A;  1TZ1 A;  2V3P A;  2K22 A;  1JAL A;  1H8C A;  1I7H A;  1KLG D;  2G9H D;  4FHJ A;  4W9K A;  1L2N A;  4FAD A;  3R2I A;  3OJ4 B;  1SJE D;  2ZCC A;  2BYT A;  4NJC A;  1HQR D;  3ZO5 B;  2JX5 A;  2KKC A;  4TMA B;  2MHJ A;  4DK5 A;  1J7A A;  2LHE A;  4A3O A;  1QLB B;  1PQS A;  4YSY B;  1CK1 A;  1F1H A;  1N63 A;  1N6Z A;  4JL9 A;  4LJO B;  4S0R A;  1V86 A;  2KVR A;  2KAJ A;  2Z0E B;  4B9K A;  1V80 A;  2EKI A;  2ZPY A;  3APD A;  4YXD B;  2N1V A;  1PUT A;  5BMH A;  3B1L X;  2ZJD A;  3H7S A;  2M19 A;  2RGF A;  3RT3 B;  3BK2 A;  3RD2 A;  1WYW B;  3S2A A;  2Z0D B;  2DHZ A;  4NAW A;  3ZDM C;  4F1S A;  3W2D A;  3QJZ A;  4RGM A;  1EU3 A;  2J4X A;  4W9H A;  1JRP A;  2LJ5 A;  2BB6 A;  1S3S G;  4HK2 A;  1IBX A;  5J2R A;  1JQ4 A;  4JE3 B;  4ZHP A;  2D11 A;  2WXI A;  2BF8 B;  1BXT A;  1Z5S B;  3AU4 A;  3QC8 B;  1WJU A;  1V2Y A;  4P1B C;  3AH7 A;  3ZW3 A;  3AI5 A;  3VH4 B;  2XBB C;  2KNB A;  3R66 C;  2FCQ A;  3U7Z A;  4MJS B;  2KX3 A;  1WZ3 A;  1E8Y A;  5BMG A;  4C80 A;  1JRU A;  3ZJV A;  3N30 A;  5DPS A;  1GAQ B;  4ZRP A;  2JUO A;  4FLH A;  2CS4 A;  2WXQ A;  4B95 A;  4YTN B;  1VR9 A;  5JHB A;  4OVV A;  3KH0 A;  2IO3 B;  3H7P A;  2L05 A;  2DWQ A;  4XDC A;  4ASW C;  4GDK B;  3LYY A;  3LXF A;  1TKY A;  3DOW A;  2KFJ A;  2WDV B;  4XWT A;  3DWG C;  2MBQ A;  1VD2 A;  2LGD A;  3ZUN A;  3EGR A;  2MCN B;  1CMX B;  1MVK A;  3Q8E A;  2LI5 A;  1X1M A;  3DBL B;  4REZ A;  2ZPN A;  4CQN A;  2KJ6 A;  3Q8B A;  5BMI A;  5AUK A;  2V4L A;  3MC9 A;  2OHF A;  1NVI D;  3B2F A;  3R3M A;  2MJD A;  2D2Q A;  4RM9 A;  3W1S C;  4DXG A;  2W55 A;  3PRM B;  2PMV A;  4TV3 A;  3PZ7 A;  1PDX A;  4W9J A;  4IM3 A;  4CHK A;  4HLE A;  4AS1 A;  3PHX B;  3IXS A;  3AE7 B;  1WIA A;  2JWU A;  4ZRI A;  3ZLZ A;  3WIM A;  1KLV A;  2KO3 A;  3ZRC A;  4AOF A;  3MJW A;  4IKG A;  2K8C A;  3O65 B;  3QA8 A;  2KDI A;  3TCA A;  4M8M A;  4HEA 1;  3CF6 E;  4BKS A;  3C8Y A;  3A4R A;  1WRD B;  4LNF A;  2MW5 A;  2K0P A;  2NR2 A;  1JML A;  1HXY D;  3M62 B;  2KLC A;  3RZF A;  3LB8 C;  3B08 A;  3DVN U;  3ZIM A;  5E6N A;  2L0T A;  1F77 A;  5JZE B;  2BKR B;  3OWE B;  3PO0 A;  4TSS A;  5E6P A;  1NEN B;  3P1M A;  3EFC A;  3AE6 B;  4JQW C;  4RGN A;  1YD8 U;  4KVG B;  1XF5 L;  4LCD E;  2I1J A;  1VZ6 A;  2LEK A;  3VTU A;  4AP4 C;  2IJ0 A;  2JZ3 B;  3L10 B;  1YJ1 A;  4US9 A;  3AXC A;  4IDI A;  3VDZ A;  4L23 A;  1E7V A;  2JU6 X;  4GDL A;  4HKZ E;  1XD3 B;  3VR8 B;  2KK8 A;  2PPH A;  3SD5 A;  3V05 A;  1FRD A;  4IOI E;  3NOB A;  5D3I B;  1NYR A;  1SXT A;  4EFO A;  4KX6 B;  2NBW B;  1F0Z A;  3K9P B;  5JXV A;  3AB5 A;  4IG7 B;  4WJQ A;  1EWY C;  2MWS B;  2WXL A;  2WU5 B;  3RMK C;  3ZYY X;  2PW9 A;  3HRD D;  2H89 B;  3BK1 A;  1XCT L;  1HTO A;  2WQY B;  3ZRF A;  3SFE B;  4NAM A;  3UIO B;  2EKE C;  1LQB A;  2VRR B;  3WCQ A;  4HDQ A;  2L3Z A;  1SB3 C;  4NJ7 A;  1G6J A;  1B1Z A;  1K52 A;  4WIP A;  2LWP A;  1C79 A;  4LNK A;  1IUE A;  2BPS A;  2FE8 A;  1Z2M A;  4MEL A;  3CST A;  3Q2A C;  2VH1 A;  4KSL C;  3VQI A;  2WXN A;  2KDE B;  3L13 A;  2I1K A;  1QKZ A;  2WLB A;  3N1Z C;  2MBB B;  3ABV B;  1JWU D;  2OOB B;  1AN8 A;  2MQJ A;  2C7M B;  3AEG B;  1YQ4 B;  3ZDT A;  2BW2 A;  3Q8C A;  3MHZ A;  4EZL A;  1GC7 A;  1V1P B;  2KD0 A;  3ZQ4 A;  2RD0 A;  4IWO A;  1ET9 A;  5C23 A;  2PE9 A;  1EU4 A;  3KYC D;  3URY A;  2GBK A;  4FN2 A;  2GOW A;  4GXB A;  3ZTC A;  5AZF A;  1J7C A;  2FCM A;  5J18 A;  3KW5 B;  2L0F A;  2AQ1 B;  2WXG A;  2YEP B;  2M0A A;  3Q3J A;  3ZNG C;  5G2N A;  1WXQ A;  1YNT E;  2LD9 A;  4I6L B;  5EE0 A;  3FIL A;  4WH4 A;  4L1B A;  3D32 A;  2MRP A;  2QHO A;  4H2A A;  5D2M B;  5FKA C;  3DBL I;  4NJ6 A;  1S1Q B;  2N9E B;  1GG3 A;  1WGK A;  1DOX A;  1FPY A;  3ML9 A;  3A1Q A;  3R7Q A;  5JHA A;  4YL8 A;  3V61 A;  2REX A;  1WFY A;  1J19 A;  4KDL B;  2L8J A;  1AAR A;  2DAF A;  4ICU A;  4XE0 A;  4EKU A;  2KC2 A;  1UEL A;  1UWX A;  1K8R B;  2M17 A;  2UWQ A;  2BYV E;  3MJ5 A;  1YX6 B;  4NQK E;  2LUE A;  2NMQ A;  4RMA A;  3PLU A;  3OJ3 A;  2IPK D;  3OG5 A;  1XLQ A;  4PS7 A;  4JWU C;  3IHP C;  2N9X A;  2DYO A;  4HWI B;  1SE3 A;  2UYZ B;  2BWF A;  2CHZ A;  3BVM A;  1FIQ A;  1FNW A;  2AL3 A;  3DBH I;  4ZOH C;  1EF1 A;  4ZDV A;  3KWV A;  2JZZ A;  2DZJ A;  1OEY J;  4J6I A;  2JRH A;  3AMZ A;  1FXA A;  4XZ4 A;  3DHH C;  3QX1 A;  3ZJT A;  2D5G A;  1XT9 B;  2KWD A;  3BVZ A;  1L7Y A;  1XO3 A;  1T0Q C;  1KF6 B;  3DWM A;  4MGY E;  1WGY A;  2MLB A;  2XEW A;  2R61 A;  3N20 C;  3VUX A;  5CX3 A;  1JWM D;  1GJZ A;  2R2Q A;  4LDT B;  4WUR A;  1UBI A;  3VVW B;  2ASQ A;  2YEP F;  3VUW A;  1TKG A;  3JVZ X;  1RRB A;  2V3S A;  1VZ7 A;  3NZS A;  4AQ7 A;  1N61 A;  4WWM A;  4WJN A;  4W9D A;  2DNF A;  4HJG E;  1I4X A;  5LXI B;  3FIL B;  1MHX A;  4KZC A;  2LFI A;  2C60 A;  3NZ3 A;  3Q6B A;  4NZL B;  4BAX A;  1SIF A;  1WJ4 A;  4UDU C;  4ARC A;  1HZ5 A;  1P7F A;  3A9K B;  2FIF A;  4A90 A;  2JWZ A;  2NBV B;  3TEY A;  5C1Z A;  4CYE A;  3PRE A;  2QEJ C;  4M02 A;  4FBJ B;  2M0X A;  4HRO A;  1KH0 A;  4IWQ A;  2WU2 B;  4MSQ B;  3HVD A;  5FR3 A;  4FXC A;  1WYG A;  3QAR A;  4BOZ B;  1F52 A;  3E9S A;  2K9X A;  2LVQ A;  5G5G A;  4TQ0 A;  3VRB B;  2ZNV B;  4W9I A;  1UBQ A;  2JPH A;  2ZW0 A;  3B0A A;  2WGS A;  4ANV A;  2O2V B;  2KT7 A;  1Y56 A;  1BML C;  4N58 A;  3ZTD A;  2EMS A;  2DYB A;  1SE9 A;  3BZD B;  3U2S C;  1RFK A;  4MDK E;  2IGD A;  2KTR B;  4OVZ A;  2K8H A;  5E6J A;  2L83 A;  1ZUD 2;  2WXM A;  2XNA C;  1XXG A;  2MA9 B;  2BKF A;  2KWC A;  1WXV A;  4MJS A;  1WY8 A;  4LDT D;  4FJZ A;  3AE9 B;  1L6U A;  3GP7 A;  3H1U A;  2DBY A;  3DVG Y;  1L4D B;  4IC7 B;  2NBU A;  3HHM A;  3ZKJ C;  2J0J A;  1L5P A;  2DZK A;  3T3O A;  1OEY A;  4WWN A;  1V1O A;  4JGH B;  2Z59 B;  2J0M A;  1YQ3 B;  3QWZ B;  4IUM B;  1WJN A;  3EHV A;  3L54 A;  4GDK A;  1I35 A;  1QQR A;  4XGA B;  1ZW7 A;  1GNU A;  3EA6 A;  2KMM A;  2PEA A;  4E3C A;  3ETR A;  4YSX B;  3RFZ B;  1C4A A;  1NI3 A;  1DGJ A;  3BYT B;  4YT0 B;  2ACZ B;  2RMM A;  4W9C A;  5BO4 B;  3NS8 A;  3ONS A;  2QCZ A;  1DOI A;  2ICI A;  3HM6 X;  1YJJ A;  1E7P B;  2RSU A;  4LJP B;  2K6Q A;  2KYW A;  4KSK C;  2MEK A;  1ZKH A;  4DWF A;  3X23 A;  4L2Y A;  3PT2 B;  4PS3 A;  4F7Z A;  5EE9 A;  2M56 B;  4IM0 A;  4B0E A;  1WMH B;  1TIF A;  4E74 A;  5IOI A;  1XLO A;  4XC2 A;  3K9O B;  1WGD A;  1ET6 A;  1TY2 A;  2NCN A;  3W5U B;  1Y8R C;  1TS2 A;  4W9G A;  3I63 C;  3AEB B;  4K3B A;  4JX1 C;  2INP E;  2V4I B;  3AUL A;  4ACF A;  3KQ4 A;  3TMP B;  2PKO A;  2KAN A;  2C7N B;  1TT5 B;  5DPT A;  1ISN A;  2GBN A;  3WAL A;  1QOF A;  2K25 A;  2IO2 B;  3NHE B;  3FC4 A;  4KGT A;  3GZN B;  2AEH A;  2KDF B;  3AN1 A;  1P1A A;  4XYC A;  1V97 A;  2KWV B;  4URK A;  3RNG C;  4GLS C;  3AM9 A;  3PGE A;  3RZW C;  1ACC A;  2W3R A;  2HDE A;  4A55 A;  2B3A A;  2QIL A;  1V9J A;  3DHI C;  1ZE3 D;  2L52 A;  3VRA B;  1XCQ L;  3IBE A;  3A9J B;  1SIJ A;  2IY1 B;  2WDR B;  3AE3 B;  4EEW A;  1F9J A;  1A70 A;  4YTM B;  1MFW A;  4USA A;  1KJT A;  3L4P A;  3PV1 A;  2G4S A;  1I4H A;  3BIN A;  1SGH A;  2RDH A;  1ZXI A;  1Q1O A;  2GBJ A;  4GN1 A;  3Q8F A;  2GB1 A;  4ANX A;  2GBR A;  4WJP A;  2DX5 B;  3QIJ A;  2BQQ A;  5AUI A;  3NRZ A;  2DLB A;  5TR5 A;  4NQL B;  1N5W A;  3PRP B;  3Q3N C;  4BBN F;  3WAP A;  2INN E;  2QC8 A;  4EUT A;  5DPW A;  3TEW A;  1WM3 A;  4TQ1 A;  2WDQ B;  3GE3 C;  2C5L C;  1WR1 A;  2XK5 B;  4LLG M;  3Q69 A;  4C56 C;  1ZOY B;  3DPD A;  4WAA A;  3MHS D;  3IT6 B;  4A8X C;  3WAN A;  1XQQ A;  4HCN B;  3KUC B;  1J7B A;  2MJ3 A;  2PIA A;  3RNC C;  2LMC A;  5IP4 D;  3BY4 B;  1LXD A;  3RNE C;  3L16 A;  1YN5 A;  3RYT A;  1FFV A;  3TSS A;  3DBS A;  1V1P A;  4WQO B;  5HKH A;  3DDC B;  3EEC A;  2B76 B;  2DZI A;  2WXF A;  3L0W B;  1UH6 A;  3JYU A;  4MGI E;  1LFD A;  2NTT A;  3QQ8 B;  1FCL A;  1R4M B;  3UF8 A;  3ML8 A;  1IGD A;  1XLN A;  5EE1 A;  1R4N B;  4FJV B;  3V62 A;  1SJH D;  1L4Z B;  2GMI C;  3X0W A;  3B9J A;  4GSW A;  4ICV A;  3P2B A;  1E8Z A;  1SEB D;  2IO1 B;  2J42 A;  1OQR A;  3I57 A;  3NVW A;  4KZ0 A;  3TEX A;  3EC8 A;  1N60 A;  4HCP B;  2JYT A;  3N1X C;  2RR9 A;  1R7S A;  2KAC A;  3PS6 A;  1RYJ A;  4C7Z A;  1E90 A;  4YSZ B;  1SBB B;  1NEK B;  4NY0 A;  4OHJ A;  2LGY A;  3P4R B;  2M8S A;  4GMV A;  2W3S A;  1WXS A;  3QCA A;  2ONQ A;  3ZXR A;  3WAO A;  1TTN A;  3N3K B;  3SFD B;  3ALB A;  3H8H A;  3HK0 A;  3M63 B;  2FAZ A;  2N7J A;  3MTN B;  1NI2 A;  5C2T B;  1WX9 A;  1XEE A;  4XWW A;  1XLP A;  3IG3 A;  4RGT A;  4DHZ B;  1WH3 A;  1WE6 A;  1HA5 A;  3TIX A;  3AU5 A;  2N7E A;  3GZN I;  1QZE A;  2O6V B;  3NUH B;  1QIL A;  3IAS 1;  5CTR C;  3AE4 B;  4I6P A;  1WI0 A;  2IZV B;  2BS2 B;  3RI7 C;  1SSN A;  2LRW A;  4KIK B;  3JSV B;  5D94 A;  1KRH A;  2LGX A;  1TJE A;  1UGJ A;  2A4Z A;  3M95 A;  1QOA A;  2KDB A;  4XDD A;  4LNI A;  2CJN A;  4FHK A;  5E6O A;  4M01 A;  2QDF A;  1T6B X;  1K51 A;  2ZNV C;  2V0G A;  4OZA A;  5LXH A;  2PE6 B;  4N9F 4;  1M4V A;  3T9L A;  2K8B A;  3AE5 B;  3DBR B;  2PVG C;  3DVN V;  2KMC A;  5IO9 A;  3DHG C;  4WAF A;  1I4R A;  1WRI A;  1I42 A;  1FO4 A;  3H9D A;  1YIW A;  2M4N A;  2KVZ A;  1TS5 A;  3P42 A;  3ZNH B;  5MPO A;  1MI0 A;  3HUI A;  2CKH B;  3A9K A;  2N7D A;  2KJR A;  4IW0 A;  2J0K A;  4A6Q A;  1U4A A;  3QHT A;  3AEF B;  2L76 A;  3UQB A;  2EMT A;  5IN7 A;  3CIR B;  2CU1 A;  2LJI A;  5GXG B;  4NNJ B;  1ZPS A;  4M00 A;  5HHD G;  1WGR A;  4GOC A;  1QT9 A;  1J0G A;  4DXA B;  2O2V A;  2I2Y A;  2O6V D;  2VZK D;  3NY5 A;  1ZGU B;  2AL6 A;  2LZ6 A;  1D6E C;  4KKI A;  3ZNI D;  2KTR A;  4K81 A;  5L83 A;  2NTS A;  2HD5 B;  2LVO A;  2QJL A;  3R2T A;  3Q3O C;  5KHQ A;  4K1R B;  1PGB A;  1MHH E;  3AEA B;  2IYD B;  2G1E A;  3GB1 A;  4FA6 A;  2Y5B B;  3SHQ A;  5J17 A;  3BYY B;  2JT4 B;  2GRI A;  4C00 A;  4K7W A;  2ZW1 A;  3W9C B;  1R4M I;  1RWS A;  1M94 A;  2K6D B;  1NYQ A;  4TKN A;  3PZD A;  2A5U A;  1E9M A;  3Q14 C;  4BBN C;  1OFF A;  2W82 A;  2LGI A;  1C1Y B;  1I4G A;  3FKY A;  3APC A;  5C3J B;  2WXP A;  4ZYN A;  3A4S C;  1P3Q U;  2WX0 A;  4AJW A;  1LGR A;  2KN4 A;  3WA0 A;  5HI1 A;  4J3O D;  5LLI A;  4E71 A;  1FNU A;  3KYD D;  4HPL B;  1DOY A;  5BYS A;  3UGB B;  4ZRK A;  3HIZ A;  3W1Y A;  3H6N A;  4K3C A;  1WMH A;  2ZEQ A;  1C9F A;  1CQV A;  3P4P B;  5HFY A;  1V5O A;  2LXA A;  3PPA A;  1IYF A;  1TYG B;  2BVC A;  2MBO A;  3RNB C;  3PLV A;  3RN9 C;  4ARI A;  3CWI A;  2N4F A;  3PTF C;  1OTR B;  4DDG D;  1ZXH A;  3PHW B;  3PSE B;  1P7E A;  4P6V F;  2Y3A A;  2IGG A;  4I6N B;  4BKT A;  4W9E A;  1K53 A;  2GBM A;  3U52 E;  2KTF A;  2EEL A;  3VHT C;  1WWT A;  2JYE A;  3E56 A;  5BYR A;  1RFA A;  4BOS C;  3BWU D;  4MH0 E;  2NPT B;  3AEE B;  3MC8 A;  4ANW A;  2CJO A;  1TZO A;  3DQV A;  3UQA A;  1FMA D;  1DYQ A;  2G4D B;  4RFB A;  2WP9 B;  4HPM B;  3KUD B;  1I4P A;  1V5T A;  3Q3F A;  2MBH A;  1C4C A;  1UWM A;  5LNK 1;  1LO5 D;  1SE4 A;  3I9V 1;  4IM2 A;  5D3D A;  4PYU A;  2HJ1 A;  4RGO S;  3DBR I;  2KOX A;  4LTU A;  4G3X B;  5DPR A;  1OQY A;  4XX5 A;  3ZJU A;  3A9J A;  5D7G A;  4RH6 A;  1T5X D;  1V6E A;  3V3X A;  2BB5 A;  4HVB A;  1HZ6 A;  3Q3M C;  2JVC A;  1UZX B;  2Y5C A;  2FID A;  2H88 B;  4ZYS A;  4YWG G;  1IPG A;  4B6W A;  1GB1 A;  2BGF A;  4KGR A;  4A3P A;  2MP2 B;  4ITK A;  2V1Y A;  2IY0 B;  1WE7 A;  2L32 A;  1RLF A;  1K50 A;  4DHJ D;  1V8C A;  4YTP B;  4BVU C;  4C4V B;  2JSV X;  2C9W B;  5CHW A;  2QMT A;  2WHI A;  3CMM B;  1EWC A;  3GS2 A;  5AEK B;  1PGA A;  3GOE A;  3DCG A;  3OLM D;  2V9H A;  4HRS A;  4ANU A;  1L6V A;  4G11 A;  4D2K A;  4BZA A;  1IP9 A;  1GB4 A;  1SF0 A;  2J53 A;  1ESF A;  1PGX A;  4S17 A;  2XK5 A;  1ENF A;  2JF5 A;  1C3T A;  1EF5 A;  4MSM B;  4MEM A;  2LRU A;  3R7R A;  2K1F A;  2BTE A;  4M0W B;  1E5W A;  2RPQ A;  4F8C B;  2IND C;  2AYO B;  3M3J A;  5IKC M;  4A9A A;  2WDT B;  4ZHO A;  3L08 A;  4O1N A;  1JWS D;  4MM3 B;  2N1W A;  2LVP A; 
#chains in the Genus database with same CATH homology
 1WSP A;  1FD6 A;  1IGD A;  1XLN A;  1N5X A;  5EE1 A;  3UI3 A;  3AEC B;  1TS3 A;  1WGK A;  1KTK A;  4Q2J A;  4M0W A;  1DOX A;  1SJH D;  1L4Z B;  2WXJ A;  2L1A A;  3O13 A;  3MP9 A;  3W5V B;  1UNS A;  1VJK A;  3B9J A;  3Q8A A;  1FM0 D;  2BBC A;  4RNA A;  2WXO A;  3N9Y C;  4RF0 A;  1SEB D;  2J42 A;  2TSS A;  1OQR A;  3I57 A;  4ZRQ A;  3NVW A;  4XE0 A;  2PVO D;  1CJE A;  3TEX A;  1UUP A;  1E6E B;  1N60 A;  1UWX A;  2JYT A;  1SE2 A;  2E6X A;  3MJ5 A;  2DYM A;  1R7S A;  2KAC A;  1JW9 D;  3SR6 A;  5G5H A;  1RYJ A;  4C7Z A;  4YSZ B;  2NMQ A;  1EM7 A;  1SBB B;  1NEK B;  1I4Q A;  1ROE A;  4MAC A;  1KFY B;  4OHJ A;  1F2R I;  1ZDV A;  2IPK D;  3P4R B;  1AYF A;  3FAH A;  2WXH A;  1XLQ A;  4MH8 A;  4JWU C;  3BII D;  2DYO A;  2V3P A;  1E0Z A;  1SE3 A;  2K22 A;  2W3S A;  4N59 A;  3U4E G;  2OED A;  2QSD A;  4RCO A;  1JAL A;  1I7H A;  1KLG D;  2G9H D;  2Q5W D;  1FIQ A;  3BVM A;  1FNW A;  2WXK A;  2ONQ A;  1PYW D;  4ZOH C;  3R2I A;  1SJE D;  3KWV A;  2BYT A;  4NJC A;  1HQR D;  3SFD B;  2JX5 A;  3PZ8 A;  2IDY A;  4TMA B;  3H8H A;  4DXF A;  1J7A A;  3AMZ A;  1FXA A;  2N7J A;  3ZJT A;  3J9C A;  2D5G A;  2KWD A;  3BVZ A;  5C2T B;  3AE2 B;  2LHE A;  2SAK A;  1ZP0 B;  1QLB B;  1XEE A;  4XWW A;  1XLP A;  1XO3 A;  4YSY B;  1CK1 A;  1N63 A;  4RGT A;  1N62 A;  1HA5 A;  1L0X B;  1KF6 B;  3DWM A;  2R61 A;  2KDM A;  1JWM D;  3NUH B;  1QIL A;  1TY0 A;  3IAS 1;  4WUR A;  3AE4 B;  1GPX A;  2BS2 B;  2KAJ A;  2YEP F;  1TKG A;  4NAW B;  1OQQ A;  4KKJ A;  1SSN A;  1VLB A;  5I4D A;  1C4P A;  3B2G A;  1VZ7 A;  1KRH A;  1TJE A;  2EKI A;  4AQ7 A;  4HKQ A;  1N61 A;  1UGJ A;  4YXD B;  3EUB 2;  1PUT A;  4WWM A;  1QOA A;  5BMH A;  4XDD A;  2M19 A;  3IT4 B;  2CJN A;  4HJG E;  1I4X A;  1IBX B;  3BK2 A;  3FIL B;  1MHX A;  1T6B X;  3KWL A;  1K51 A;  2LFI A;  3BVG A;  3NZ3 A;  2V0G A;  4OZA A;  1QOB A;  1YN4 A;  4NZL B;  1M4V A;  3W2D A;  5H92 C;  3AE5 B;  4RGM A;  1EU3 A;  2J4X A;  1JRP A;  4UDU C;  4ARC A;  1HZ5 A;  1P7F A;  2PVG C;  2BB6 A;  4A90 A;  3TEY A;  1IBX A;  4WAF A;  4MT5 A;  2QEJ C;  1JQ4 A;  1I4R A;  1WRI A;  4JE3 B;  1FO4 A;  2J52 A;  3P63 A;  1D5Z C;  4LK0 M;  4OZC A;  4HRO A;  1HEZ E;  1KH0 A;  2W54 A;  2WU2 B;  1TS5 A;  3HVD A;  3P42 A;  4ZHP A;  1MI0 A;  5FR3 A;  2WS3 B;  3HUI A;  4FXC A;  5MPO A;  1WYG A;  2WXI A;  3E9S A;  4OZB A;  1BXT A;  3KLS X;  2K9X A;  1JWA D;  5G5G A;  4TQ0 A;  3VRB B;  4A6Q A;  3AH7 A;  2V3N A;  2JZP A;  1RM6 C;  1AWD A;  3W1S A;  2ZW0 A;  3AEF B;  2WNM A;  1D5M C;  1Y56 A;  1BML C;  4WQM A;  4N58 A;  3CIR B;  3U7Z A;  2LJI A;  4KGS A;  5GXG B;  3R8B A;  2MH7 A;  1GOZ A;  2BS3 B;  5BMG A;  1ZPS A;  3NVZ A;  3BZD B;  3U2S C;  4C80 A;  2BS4 B;  3ZJV A;  1JWB D;  1RFK A;  1GAQ B;  5HHD G;  2IGD A;  4OVZ A;  4ZRP A;  3AED B;  1CZP A;  5E6J A;  2L83 A;  1ZUD 2;  2PLP A;  1QT9 A;  2WXQ A;  2WXM A;  2XNA C;  1XXG A;  2I2Y A;  2VZK D;  4YTN B;  3RPF C;  1VR9 A;  5BYQ A;  1PFD A;  2DWQ A;  1L6U A;  1MPE A;  3AE9 B;  4XDC A;  3GP7 A;  4GDK B;  3LYY A;  1TS4 A;  3LXF A;  1TKY A;  4B0M A;  2DBY A;  1D6E C;  1C76 A;  1L4D B;  1YN3 A;  4KKI A;  2K3U A;  1VDV A;  2WDV B;  1L5P A;  4XWT A;  2JXT A;  2NTS A;  3DWG C;  2QJL A;  3R2T A;  3T3O A;  1F2R C;  3HVZ A;  1V1O A;  1PGB A;  1MHH E;  1YQ3 B;  3AEA B;  3EGR A;  1QF6 A;  1MVK A;  3Q8E A;  2G1E A;  3GB1 A;  4REZ A;  4CQN A;  3Q8B A;  1QQR A;  5BMI A;  3AE8 B;  3BYY B;  3EA6 A;  2KMM A;  3RFZ B;  2GRI A;  3ETR A;  4YSX B;  5AUK A;  3MC0 B;  2SEB D;  2ZW1 A;  1C4A A;  3W9C B;  2OHF A;  2VZK B;  1NI3 A;  1NVI D;  1FEH A;  3B2F A;  2GI9 A;  1DGJ A;  1RWS A;  2MJD A;  1NYQ A;  3BYT B;  4YT0 B;  2ACZ B;  1FCC C;  2RMM A;  4DXG A;  2W55 A;  1DOI A;  3NS1 A;  1E9M A;  2PMV A;  1OFF A;  2ICI A;  1Q10 A;  1YJJ A;  1E7P B;  2W82 A;  2LGI A;  2PTL A;  3PZ7 A;  1PDX A;  2N9K A;  1I4G A;  4AS1 A;  3IXS A;  1FFU A;  3AE7 B;  2MEK A;  5FK9 C;  2I38 A;  2JWU A;  5C3J B;  2WXP A;  4L2Y A;  3ZGZ A;  5EE9 A;  2M56 B;  4B0E A;  2KN4 A;  2AQ2 B;  2CU3 A;  4IKG A;  5HI1 A;  4J3O D;  1XLO A;  2IGH A;  1FNU A;  1ET6 A;  1JRO A;  1TY2 A;  3W5U B;  1TS2 A;  4HEA 1;  2LUM A;  3C8Y A;  1C78 A;  1DOY A;  5BYS A;  1D4B A;  3AEB B;  2K0P A;  2WXR A;  1JML A;  4JX1 C;  1HXY D;  2INP E;  2K5P A;  1C9F A;  1CQV A;  3P4P B;  2LHD A;  5HFY A;  5EE3 A;  2V4I B;  3LB8 C;  3KQ4 A;  1TYG B;  2BT6 A;  4ARI A;  3CWI A;  2PKO A;  2HTM E;  2JQR B;  1F77 A;  1ZXH A;  1AW7 A;  3OWE B;  3PO0 A;  4TSS A;  1NEN B;  4GDL B;  3P1M A;  1QOF A;  3AE6 B;  1P7E A;  4P6V F;  2XN9 C;  2Y3A A;  3FC4 A;  4KGT A;  2Z8L A;  4RGN A;  3MFG A;  2IGG A;  4RF1 A;  1E10 A;  1K53 A;  1XF5 L;  4JPS A;  1VZ6 A;  3IAM 1;  3U52 E;  2LEK A;  3AN1 A;  1T3Q A;  2EEL A;  3SEB A;  1V97 A;  2IJ0 A;  1VRA B;  1WWT A;  4US9 A;  1FNV A;  4IDI A;  2JYE A;  3E56 A;  4L23 A;  5BYR A;  2JU6 X;  4GLS C;  3AM9 A;  4HKZ E;  1C77 A;  3BWU D;  1ACC A;  2W3R A;  2HDE A;  2KQ4 X;  3VR8 B;  4JWS C;  4A55 A;  2QIL A;  3AEE B;  3V05 A;  2CJO A;  1TZO A;  1ZE3 D;  1KLU D;  1FRD A;  2L52 A;  4IOI E;  5D3I B;  3VRA B;  3TEZ A;  1FMA D;  1SXT A;  4KX6 B;  1DYQ A;  4RFB A;  1XCQ L;  1YJI A;  2WP9 B;  5HG2 A;  5JXV A;  1F0Z A;  5T8I A;  3AB5 A;  1SIJ A;  1I4P A;  1VZ8 A;  2WDR B;  1EWY C;  1C4C A;  2WXL A;  4EE2 A;  1UWM A;  2WU5 B;  3AE3 B;  4P16 A;  1STE A;  3ZYY X;  2AX5 A;  5LNK 1;  1LO5 D;  1SE4 A;  2PW9 A;  3HRD D;  3I9V 1;  5D3D A;  4C7Y A;  2H89 B;  3BK1 A;  1A70 A;  4RGO S;  1XCT L;  1FRR A;  2RPV A;  4LTU A;  4YTM B;  1L0V B;  3T3N A;  4USA A;  2WQY B;  3L4P A;  3SFE B;  1ZDX A;  4NAM A;  3ZJU A;  5D7G A;  1I4H A;  4RH6 A;  1T5X D;  2RDH A;  3V3X A;  4US8 A;  1ZXI A;  2BB5 A;  5TSS A;  3P4S B;  3WCQ A;  1HZ6 A;  2X38 A;  1SB3 C;  4OW0 A;  1B1Z A;  1K52 A;  3Q8F A;  2Y5C A;  3AE1 B;  4WIP A;  1C79 A;  2N0S B;  1QOG A;  2GB1 A;  2H88 B;  2QIE B;  1IUE A;  4ZYS A;  2RDG A;  4YWG G;  2FE8 A;  1GB1 A;  2MJE A;  4KGR A;  2FBW B;  5H8Y E;  5AUI A;  1TKE A;  4ITK A;  3VQI A;  2WXN A;  3NVY A;  3NRZ A;  2DLB A;  2ON8 A;  1QKZ A;  2WLB A;  1N5W A;  2L32 A;  1D5X C;  1K50 A;  3ABV B;  1V8C A;  1IGC A;  1JWU D;  4YTP B;  3NVV A;  3VR9 B;  4R3D A;  1AN8 A;  2JSV X;  2INN E;  3AEG B;  2QMT A;  3TEW A;  2N9L A;  1FXI A;  1YQ4 B;  1EWC A;  2AQ3 B;  3GS2 A;  4TQ1 A;  1PGA A;  2BW2 A;  2WDQ B;  3Q8C A;  2FUG 1;  1B9R A;  3MHZ A;  4LLG M;  4N6E B;  3Q69 A;  4C56 C;  1JCK B;  1V1P B;  1BUI C;  1ZOY B;  3ZQ4 A;  4HRS A;  1ET9 A;  1YMH E;  1L0Y B;  3TUO A;  3IT6 B;  1L6V A;  4A8X C;  1EU4 A;  4PT5 A;  3URY A;  1J7B A;  4D2K A;  2MJ3 A;  2PIA A;  2LMC A;  1GB4 A;  3AV8 A;  2J53 A;  1SF0 A;  1ESF A;  1PGX A;  1J7C A;  1ENF A;  1YN5 A;  1FFV A;  3TSS A;  1V1P A;  2AQ1 B;  2WXG A;  2YEP B;  2M0A A;  2BTE A;  1WXQ A;  1YNT E;  2B76 B;  2E3T A;  2WXF A;  4DQO C;  2Y5P A;  5EE0 A;  3FIL A;  4WH4 A;  4A9A A;  4L1B A;  4ZHO A;  2NTT A;  3P4Q B;  4H2A A;  5FKA C;  4O1N A;  1JWS D;  1FCL A;  4MM3 B;  1NYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...