3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
1HTLD 2SEBD 4OHJA 1CHQD 1PTOB 5I4DA 1PRTB 1TY0A 1LTBD 1LTTD 1PRTD 1KLGD 1TS5A 4RGNA 2AQ1B 1ET6A 2G9HD 1LT3D 2AQ2B 4ZYSA 1JR0D 1UNSA 1YN3A 1JWSD 1D5ZC 4RGOS 2XRQD 4NZLB 1D5XC 1PRTF 4C56C 1F77A 1LTRD 1LTID 1PTOF 2RDHA 1I4PA 2TSSA 1BCPB 1M4VA 3GP7A 3OWEB 4L6TB 1LT6D 3DWQA 5ELEA 1SE2A 4L63B 1B44D 4RH6A 1S5BD 1YN4A 1D6EC 4RCOA 1FNVA 3CHBD 1QILA 1AW7A 2IJ0A 1XTCD 1TS3A 2O2LD 4BWGB 1PZID 3R2TA 5D3IB 1FD7D 5D3DA 1KTKA 1SBBB 1AN8A 1LO5D 1PTOH 1D5MC 3R2IA 2XRSD 1TS4A 1S5DD 1I4GA 1CK1A 1JWUD 1UUPA 3TSSA 5ELDA 1RDPD 1S5FD 1FNWA 2WV6D 1I4XA 1V1OA 1RD9D 1S5ED 1ESFA 1ENFA 3W2DA 3EA6A 1RF2D 3DWPA 4DXFA 2ICIA 2IPKD 1T5XD 3R8BA 1S5CD 5ELCA 1SJHD 1JWMD 4UDUC 1I4QA 3EFXD 1LT4D 1BCPC 1RCVD 3MC0B 2QILA 1PZKD 4DXGA 1BCPF 1EU4A 1L0YB 4K6LA 1CQVA 1PTOD 4TSSA 3BYYB 4O1NA 1FGBD 1PZJD 3O13A 4RFBA 1V1PB 1LTGD 1LTSD 1L0XB 2R61A 5FK9C 1STEA 2XNAC 1HA5A 2QEJC 1PTOC 1GOZA 1TS2A 1HQRD 1PRTC 5ELBA 2CHBD 2XN9C 1JQYD 1SJED 1EU3A 1SEBD 5ELFA 4RHRA 2J4XA 2Z8LA 1LTAD 1G8ZD 2AQ3B 1FNUA 2NTSA 4RGTA 1BXTA 5TSSA 1PYWD 3BVGA 1EEID 1B1ZA 1MD2D 3MFGA 3BVZA 1ET9A 1BCPD 1SE3A 3BVMA 3KLSX 1YN5A 1SE4A 2RDGA 1CHPD 1KLUD 5FKAC 4RGMA 1I4RA 1HXYD 3SEBA 1DYQA 3DWAA 3V05A 2NTTA 1LT5D 1SXTA 1I4HA 1EFID 3URYA 3BYTB 4Z9CB 1EEFD 4RHSA 1EWCA 1LLRD 1TY2A 1V1PA 1DJRD 3BZDB 1JCKB 1CT1D 1XXGA
chains in the Genus database with same CATH superfamily
1CA5A 1DOYA 1ZXIA 2B63B 5GXGB 1WM3A 4HIKA 5KNDA 1VQ5A 4RM8A 4OWWB 2M1MA 3NQTA 3KQ4A 1U4MA 4O42A 1VQJA 4BKTA 3S15H 2F0JA 1CKMA 3E0EA 5IYBH 2DENB 1F77A 3PUWA 3Q6SA 4FXGC 1M4VA 3FAHA 3H9DA 2E74C 4MH0E 1SGHA 1FGUA 2HJ8A 2PKOA 2UYZB 2JX5A 2LWPA 2RR9A 4K6DA 2GB1A 1UWXA 4A3JG 1HZ6A 1D6EC 1U4LA 4KMUC 3K5MA 5D7GA 4HR7B 1HQMC 1SAPA 3Q0AA 2K6DB 2JJQA 1TTNA 4YSZB 1CM9A 2VH1A 3PZ7A 3G71A 2JA8G 3TCAA 3TS2A 4PZ8A 5C44G 3PQIA 1SNPA 3A1QB 2KHWB 3HOUG 4X57B 1HZCA 2DYBA 2O6VD 3RYTA 4EZKA 2UUBQ 3ABVB 3AECB 4W9LA 4YTNB 4NQLB 2WDVB 2QC8A 3B2FA 4JYAQ 1NR4A 2K5VA 5DAUA 1KD1C 1S5FD 1BUVT 5LL6S 1TWAH 1I4XA 3FKIH 4US8A 1RD9D 2XK5A 4LWCA 2G4SA 4IDIA 4GKJQ 2N9LA 2YV5A 4JBWA 4X3SA 3JAMi 3A4RA 1Y1VH 1GUGA 2LUEA 2WU5B 2YLMA 2YU9B 3APDA 3C0RB 4OZBA 4MTNA 5IYDH 1EZ6A 4GDLA 4IPDA 1IYJB 4JI2L 2C35B 4YXDB 2ZPNA 5JJIA 2GOWA 2OJWA 2J42A 3PRZA 1M1KC 2XWBB 2F0LA 1L7YA 1XYIA 2FXQA 1K51A 4KKIA 2O5JC 1EU4A 1EY8A 1WD0A 2NVUI 1UBQA 1JE4A 4A3DG 1JWBD 1XCQL 1Y56A 1QZHA 2VY3A 2JRIB 4MGIE 1WM2A 2CFMA 2IX3A 2J53A 2A6ED 4LFBL 5C4XB 1GUNA 3W9CB 1A0IA 3SK6A 2YTXA 4O2DA 4K2KA 1FXIA 1AEXA 1I5FA 2MBHA 3I4LA 1Y1WB 4QAYA 4XWTA 2H4OA 3ZDTA 5ELBA 1BDOA 1L2FA 4KN7C 3Q3NC 3M7NA 3CQZB 3H3VH 1QQRA 2JXMB 1MGSA 2BYFA 4JI6L 1WCMH 4QQBX 5K5PA 3KUPA 2WWZA 3DHHC 1OGWA 3H94A 4RGTA 4PNYA 3OG5A 3D6CA 1J9OA 4WJWA 5CV4A 2LVOA 1WR1A 2DAFA 3IHPC 4QY7A 4WJQA 4GOCA 1BCPD 1OO9B 1I6HB 2PW9A 1TU2B 4RKBA 4FXKC 4ODGA 4FJVB 3QIJA 4JQWC 4GN5A 1RKNA 3I56A 4DR4Q 1XO3A 4B3RL 4C7YA 2VW9A 3Q6BA 2B2WC 2JSOA 1TWGH 1YJNA 3C3LA 4PMCA 3U58A 3C1FA 4A3BB 1XQQA 4OGQC 1SYDA 2F0GA 3IFWB 3WAPA 4HMJA 3K57A 5DM63 3D4RA 3VDZA 2NB0A 3AXCA 1VQFA 4Q5VA 1UD7A 1T0SC 3DBLB 3JVZX 3GTOB 3T56B 2R7ZB 2KUMA 3K9OB 4BBRH 4HIDA 1JJ2A 3Q23A 1PRTB 2A6HD 5D94A 1HFGA 3MEHA 2KWVB 4DDID 2NBFA 5JJKA 1WTHA 4F88A 1JWSD 3PUZA 2L3ZA 4I6NB 2WINB 2A6EC 3J7AV 2K1BA 3PO2H 3CPWA 1PTOF 3AMZA 4HN7A 2QEXA 2O6VA 3HM3A 2BCOA 4LNQA 2J0TD 4JOIA 1KAWA 5IP7G 2UUAQ 3MC9A 1B50A 4NW2A 3NK9A 1Y8RC 2UXBQ 3PVLA 4OIKA 3S17B 1EQTA 3F2UA 1HEZE 1C4PA 2WXRA 1FNVA 2WXMA 1IKLA 4KY7A 3AE2B 3N1XC 1JE5A 1L1OA 3I4MB 3HS0C 4C3IG 4NB3A 4BA2I 4ANWA 2PI2E 1TKEA 1X3FA 5E6PA 3Q24A 2CQAA 1BNZA 2C60A 2QJLA 1C77A 3HOWB 4RMAA 1K8AC 1RTNA 1VJKA 4UP8A 5GAGC 2M0XA 1B2TA 2B76B 4JI2Q 2PVOD 1CK1A 4XWWA 4ANXA 3D4DA 1STBA 4P6VF 3A74A 1D1KA 1ONLA 5L83A 1B70B 1JB7A 3CXCA 2UU7A 2V9HA 3QWNA 4JV5L 2EJFC 1NBFC 2MSED 2NZOA 2E3TA 4GSWA 1JT8A 1ZUD2 1QNUA 1HZAA 3I73A 3P75A 4ZYNA 1EYDA 2ZM6Q 1SSNA 2MJ8A 3K7AH 5L37A 4W9KA 4GLVB 3DUZA 3PHXB 2MEKA 4NQKE 1BCPC 4OWXB 4JI0Q 2BBCA 2BT6A 1OXTA 3HOUB 1GUSA 2Q2TA 3Q8FA 4HPPA 2Z4HA 1EY9A 2V4DA 1O7ZA 3KDFB 1TVXA 4LJZC 4A3LH 1IPGA 1VR9A 2NPTB 4DU9A 2VH2A 4PS3A 1EIFA 1ICWA 1QUQA 4KI0A 1DGJA 1PGXA 2DUDA 2AL6A 3BYYB 4JX1C 3LNNA 4JI8L 5ELOA 1H4RA 4WQMA 3RFZB 3PIPA 1QOGA 5CV8A 1JICA 1LTSD 4LMQD 3JAML 2I38A 3TP6A 2R61A 1R4NB 3L13A 2DY8A 5FK9C 4IKGA 3TMEA 1KDAA 1VRAB 4AP4C 2INCC 5HHDG 5IODA 2WXQA 3KW5B 2D62A 4Q0FA 1YOVB 4EUTA 2Q2UA 3GZNB 1KRSA 1RFAA 3HFZB 1X65A 4P74A 1ISNA 2G3QB 4ARCA 2AQ3B 3WWVA 2L7RA 3OAWA 3WIMA 1FL0A 4J15A 4DNTB 4ZKCB 1YVCA 2B2VA 1TXYA 1E24A 4ACFA 5M9OA 2SNSA 1MHWC 1SE3A 1FEHA 3EFUA 3IL8A 3CP0A 3S15B 2N7JA 1Q10A 1CZPA 2KLGA 3IRBA 1WMHA 2AHOB 2I1JA 3MVVA 3D6WA 2B63H 4IJHA 2K03A 4NDXA 1F9JA 3KVFB 2WXJA 2GRIA 4K81A 4QCLA 2JZZA 5BYQA 1NAPA 1MSHA 4L1BA 3BZKA 3KK7A 4JI0L 2H88B 1LFDA 3CMMB 1KC8C 2INNE 5IP7H 1WD1A 1WZ3A 5IT9c 2ASQA 5I4DA 4DXAB 5JZEB 2JQOA 4AYBE 1LTTD 3A7LA 2XK5B 5LL6X 1T0YA 4WJNA 3RUZA 3NJTA 1UEBA 2MBEA 3A55A 2AX5A 2A5UA 3HVZA 1F9PA 1T9HA 4R4OA 5M3MH 3PF5A 3GP7A 3EHVA 4IQZA 1I4PA 4DK5A 3PV0A 1GC7A 2PQAB 2J0JA 3SD5A 1QOHA 2J7QB 4KV6A 4MN3A 3VA7A 3L16A 2LXJA 3M63B 3H7SA 1QG7A 3CHBD 1XMOQ 4DV0Q 4J8QA 3PO2B 3LX0A 2JZPA 4IZ8A 2Q5WD 1O7IA 3R2TA 3I63C 5C4HA 3MJWA 2AMCB 1WTWA 2UXDL 1KRTA 4RF0A 2M19A 4NXNQ 2WB1B 3DBSA 3SFDB 3D31A 2KFKA 2L0TA 2V3SA 4DR3L 4JW0A 1QCBD 2R7ZH 2J0KA 3VTWA 4JI1L 2Q8TA 4OZAA 3NSWA 4AUQC 2B39A 3V3XA 2GBNA 2DWQA 4HDQA 1Z6HA 1H9JA 1PFDA 5LXIB 4W9JA 1IYFA 4JK1C 2FHTA 1A6XA 4FO2A 2B2VC 2Z6KA 5LLIA 1EM7A 4PK1A 1C76A 4DNRB 3K0XA 2VS1A 2VUMG 2NN6H 4KTAA 2D11A 5CHVC 2CQOA 5G3LD 3OPOA 1J7AA 2WDQB 1A2TA 2J7ZA 4UAIA 4J6IA 3A9KA 3OOCA 5C3JB 2L00B 4EOYA 4XT3B 1YIJA 1GUWA 2RA4A 3G6JB 3MXUA 1NE3A 1E8ZA 3S14B 1SLJA 3KUZA 4HSPA 2L15A 1JOQA 2N1WA 2ASBA 4KK7A 2E2HH 1TZOA 3NZ3A 2G1EA 3NS8A 3QG1A 1WGGA 3K8AA 1RHPA 2IHEA 3MEFA 2KKCA 2EVBA 2HJ1A 1N62A 4L5QA 4J1MA 3OMCA 3DOWA 3E9IA 4CHTB 3PGZA 3Q8DA 2BKFA 5IP4D 3T4AC 4PG3A 3I4NG 2LRWA 4P71A 2LY7A 2VB2X 1L4ZB 4DFAA 3JC66 4R4TA 3ERSX 4B0EA 2KO3A 4WRDA 1K52A 3J80L 2JPHA 1XCTL 3LDZE 2IY0B 3SU8X 2UU9Q 3VVWB 2WAQG 3M7GA 1L0VB 2LS01 1I94L 4M8NA 4BY1G 4ZRJA 3NBIA 3EJIA 4POFA 4N8FA 5CBAE 4FF4A 1RJTA 1I4RA 5HFYA 2PZTA 4A3EB 2EPBA 2LSSA 2NTTA 3CF6E 3S1MB 1SXTA 3TBLD 3X0WA 1WJ6A 3HKZG 5JXVA 3AE4B 2BPSA 1MI2A 1DCZA 4LF8L 2JA5B 2CJNA 2MJEA 3K5OA 3J7A5 3DBHB 1TGZB 1TY2A 4C3HG 1N63A 5IGBA 2NZ1D 1HR0Q 1UE6A 5IE8A 4DR5Q 2HQEA 2KC1A 3A54A 3PUXA 5JEAG 2JVCA 1J7CA 3ECIA 2R92H 3B2GA 3T16A 1PGAA 1CHQD 2GI9A 2L11A 3P1MA 3GTQH 4LNKA 4M00A 3X3MA 4MTKA 2LXCA 2Z6BA 2MBOA 3D0FA 2EELA 2ZNVB 1FM0D 4IPGA 1K73C 2ON8A 5C3WA 3CCEA 1Z9FA 4A3GG 4RA8A 1ZXTA 2ZXPA 2DGYA 4E6IA 3CC7A 1TWCB 3H8HA 1VQBA 4DBGA 4X66Q 3NXWA 2MP2B 3DCGA 4CJ2C 1IYUA 4LNOA 2VQEL 4FF2A 2JRHA 2NPTA 3ZJUA 3H0GG 2NN6G 2D9UA 2CHWA 1V9PA 4YWLA 2J0MA 3FILA 3QARA 1QT9A 2O2LD 1II3A 3M3YH 5AJ3Q 4HSVA 3VTUA 1FCCC 4W9EA 4CDDC 3CC2A 3H7PB 3CCQA 3A7AB 1LO5D 2GLSA 1VQ9A 3A8IE 1ENCA 1WWTA 3R2IA 2EZVA 4OELB 3CCSA 4DV6Q 3E56A 4IOIE 2CU1A 5TR5A 3VUWA 1H95A 2MBBB 2JSVX 2MJ3A 3TDQA 3M85A 4P1CC 1SNDA 1W6KA 3ZXRA 4E3CA 3K5LA 1JQ4A 1L6VA 3W2DA 2ALYB 4ZQ3A 4X65Q 2DX5B 3F2DA 3KBGA 1U4PA 4WH4A 3J80c 2IO0B 3SDZA 1STGA 3DM1A 1K50A 2CS4A 3P7JA 3J81i 4IOCA 3PLUA 3HRDD 1TWFH 4KIKA 2FUG1 4MSMB 3KH0A 4LF8Q 3S16H 1BQQT 1BCPF 3GD7A 1SFOB 1WMHB 2ONQA 3VUXA 3DBRI 4GMVA 4MGKE 4RM9A 4LK1C 5IYCG 5CORA 4TSSA 3GV3A 4O1NA 4GB9A 1PZJD 4ANUA 5KIXA 1EYGA 5FLXE 3V96A 4FF1A 3FEWX 1K9MC 3MHZA 1A70A 2IDYA 1LACA 3BDCA 1C4CA 3GDEA 4FVMA 2UUCQ 1N32L 1WX8A 1WXVA 3V6CB 4B95A 1E8YA 2AL3A 3P4SB 1I3QB 3ZKJC 5M3FG 2UXDQ 1OTRB 1VZ8A 1GKHA 1X1MA 3KLRA 2BB5A 4G0NB 2MJDA 5ELFA 3V61A 2Z8LA 1N33Q 4ZAIA 2W54A 3AFQA 3FRPB 1HRJA 4A3FB 3CMAA 2N9EB 1CFMA 1XMOL 1U4RA 1E7VA 2PQAA 1KAAA 3MFGA 5J22A 1R9TH 1FXTB 2BS2B 5C6AA 2RDGA 2RCNA 2ZW1A 3WAOA 1UGJA 4JI7Q 1UELA 4RGMA 3KF6B 5T8IA 1QZGA 2R92G 5EE9A 4C80A 2CJOA 4ZRZA 3PO3H 4DHJD 3OWFA 2PNHA 3L17A 4DA2A 4IWQA 5EKIA 2ZCBA 4A3BH 4EQ5A 1SN8A 1WGKA 1SYBA 4DV4Q 1TT5B 2LJ5A 3PO0A 1V1PA 2IO3B 4NJCA 2ZW0A 4PS8A 5IYBG 2A69D 2KFJA 2HDMA 1XXGA 3ZTCA 2DHZA 3OTOL 4CYEA 5LHY1 3ZNZB 2L55A 1Q1EA 2OQ0A 5IO9A 3ZNID 4BAXA 1F2YA 4MNOA 2RBMA 3M3YB 3WANA 1LT3D 4HCSA 3UQAA 3AFPA 3NRZA 3A8JE 2B2YC 2KHJA 1F2ZA 2KVZA 1MJCA 4DQOC 4G4KA 2LEKA 4GN3B 3H3VC 1WGDA 2FCNA 4TQ1A 2Z6KC 3NVZA 4IWPA 4B0MA 3A9KB 2JA6H 4NAMA 4LF6Q 2M8SA 2RKSA 2WB1G 1Q1BA 1UWMA 1LXDA 4OEMB 5E4WC 5C44H 1TWHH 1MIUA 2F0TA 4WJ3M 1U4AA 2GBRA 2IGGA 4PYZA 4DAMA 2LMCA 2YVCA 1N33L 4LF4Q 1GG3A 4BBNC 3PO2G 1TS3A 1WI0A 2K39A 2LXKA 5FJ8H 1E0BA 3PTFC 1JOKA 1Q90A 4IFDI 4CJ1B 4P2CB 2WHIA 2BWFA 1PH1A 2JA6G 4MSQB 3WAMA 4DV3L 1RFKA 2KVMA 4GNXC 1FXAA 1FRDA 1BR9A 2IBIB 3ZXVA 3O65B 1VF5C 2RSNA 2WAQB 3FDTA 4KKUA 4BBRG 1IYVA 4UHVA 2KDEB 5LMNQ 2KEEA 2L76A 2UU9L 4IM2A 3TSSA 4HMIA 4LF9Q 2LI5A 1DGSA 3HHMA 2ZVNA 1V5TA 1I6VC 1VMPA 5I2XA 1WTXA 1WXQA 2K5WA 3WOEA 5T1GA 4DR2L 5E4XA 3ENEA 1MPEA 1KRHA 4A3DB 1T5XD 3VYSA 4DV7L 4BBSG 3TBIB 1UWVA 2CKZB 4MM3A 3WOFA 1IL2A 2EYLA 4AJYB 2CKHB 3VYRA 5GAEC 3HOXB 1QLBB 4HJGE 3U7DA 3DLLA 3CCRA 2JQRB 4KZCA 1IBKL 1I7HA 2L32A 3LYYA 2F1MA 4OVUA 2A6HC 2DZMA 4JBMA 4JGHB 2D07B 1J7BA 2NS5A 4NAWA 3GTLB 5LMUL 2LASA 3OTOQ 1O7YA 1IHZA 4S0RA 5BYSA 2KX3A 4RFBA 3B6YA 1HTQA 1BBWA 5E7NA 3MXNA 3U52E 1EZ8A 3HOZG 2N9PC 3VYTA 3DQVA 5C3EG 2YYZA 3AB9A 1PTOC 4GDKB 2X8XX 2E5LL 4CHKA 2GMIC 1QNKA 5JVH3 1UBIA 1I94Q 2EYOA 1JC7A 1CJEA 3NG0A 2EMTA 2JF5A 5GROA 4HKZE 2KQ4X 2L0FA 3J9CA 5I2YA 1TT2A 1LTAD 1K0SA 5ISRA 3V60A 1HH2P 4DKAC 5LNK1 3Q8AA 4FULA 1MBYA 3BVGA 1MG8A 2ZTDA 2FUHB 3QHTA 1ET9A 4NXNL 2F4VQ 3GE8C 3KYHC 4H02A 4A3FG 1IBML 2MHJA 2ZPYA 1YNXA 4LFAL 3NEMA 4L5RC 3OYYA 4ZRPA 4PMBA 1EFID 1TWGB 2K4KA 1TJEA 5DM73 2KC2A 2OQKA 2VZKD 3DMUA 1EEFD 5FJ8G 4XIGS 2Y5CA 4K0KQ 3S2DB 1LQBA 1VQ8A 3L10B 3TP5A 1PV4A 1VQ6A 4PZ6A 5M5XH 3GTJB 3RZOH 2IY5B 1A2UA 3Q22A 3HOXH 4MT5A 4U68A 2C7HA 3AYHB 2OCEA 4BKSA 4P1BC 2K5DA 3KOJA 5G2NA 1WOCA 1UE7A 2BVCA 5A2QL 3RNCC 5COYA 1GO3E 4N8X1 3G7LA 4IO9A 2TMPA 1FFVA 2FIDA 2XBBC 1Z47A 4DHZB 1JR0D 1UNSA 1VQHA 3HOYB 2KJ6A 2KAJA 2HDEA 4ARIA 1J0GA 3DXJC 4C56C 1WRDB 1JOOA 2WXKA 4L6TB 4LF7L 5IOCA 1HPCA 1NI2A 4JLCA 1LT6D 2B8GA 2QCZA 1WZ0A 4DV3Q 2PE6B 4CBVA 4LJPB 2IO2B 5G5GA 4NXML 5M3MB 3BZCA 2ZJDA 3NBHB 1ENAA 1H9SB 3NTIA 3SR1A 3BWUD 2IX1A 1XTCD 1ZW7A 2IT1A 1Q86C 4A3KH 3TEHB 1A63A 4YTPB 2A19A 1PZID 4J6HA 2A74C 1KTKA 5D3DA 1SNCA 3LGJA 1AN8A 4K7SA 1PTOH 3RNFC 1PH3A 4B3SQ 1LYLA 3IT4B 4OVVA 1L5PA 1P1AA 1F9RA 1MKHA 3NENA 3N1YC 3Q3MC 3GTMH 2BYVE 2JUOA 1YX6B 1ZKOA 1U9RA 3S1NH 5CC4A 3UDGA 3R7QA 3ERQA 1EIHA 4XYOA 3I3TB 1YITA 2OOBB 1NI3A 2E2IB 2IPKD 2L8JA 4W9IA 2F0FA 4K7WA 3C46A 3NY5A 2UXCL 2P5ZX 1WJNA 2E75C 4X62Q 4TKNA 1UE1A 1RL2A 2PPHA 4GOPC 3QJYA 2KMAA 2D3BA 1E5WA 3MC0B 3K9PB 3L3OC 4JV5Q 1PH7A 1M90C 1HUMA 2MX2A 3EBEA 4NKLA 2JU6X 1WYDA 3FKYA 4G3XB 5DEHA 1OFFA 4HROA 3A0JA 1PGBA 1Y8OB 1E1OA 2B29A 4K3BA 1XNRQ 3W1SA 1IP9A 1ZGUB 2LGDA 1NDDA 2B3AA 1WVLA 1C7YA 4FN2A 3KDFA 1GHJA 2AYOB 3RLNA 4C4VB 1C3TA 1Y14B 1GOZA 1QUQB 2VNUD 4YWKA 1PRTC 5E6JA 3KFUA 1VZ7A 1JWAD 4A75A 3M9BA 4P16A 4DAYB 5T1IA 3N3KB 1IKMA 4DK0A 2HUGA 1WGYA 3VR2A 1Z5SB 3KWVA 5HKHA 4BXXG 2LKVA 1M94A 1B1ZA 1F9QA 1P7FA 4B3SL 1MJDA 4PQXA 3CKIB 4G11A 2B2TA 2JWUA 4XT1B 2WIIB 2XEWA 3GTKB 5KHOA 1BOSA 2B8FA 2BTEA 3PMFA 3DEOA 4A3MH 4C3IB 2LMCB 3AU7A 5C4XG 1WX7A 2NBVB 4P73A 3APFA 3GTJH 5M5XB 4BY7G 4LFAQ 1P7EA 1C78A 3S2DH 4ANVA 5CHFA 4HPMB 5C5MA 3OSOA 4QF4A 1RRBA 1E8XA 4HCPB 3J80E 4A3MB 1KM7A 3TIXA 1U5KA 2EYFA 3S1RH 4CJ0B 1RLFA 1JCKB 4FF3A 2RPVA 5JHBA 1P3QU 2WLBA 2VB3X 3NUCA 3JSVB 4IOAA 3RZWC 2QW7A 4JI8Q 3SHQA 2A73B 3IXSA 1PXUA 1VCIA 4P75A 2KWUB 4V190 3QB3A 2R7FA 3ML8A 2W3RA 4GXBA 3PRPB 3ZNHB 3STBC 3WA0A 4CGYB 1NYRA 2QDBA 2L9HA 4NPSA 1XEEA 3ICEA 2F0IA 4M8AA 2R7ZG 5JJLA 1EF1A 2N1VA 4LJOB 2KOLA 4OX9L 4CDEC 1T5EA 1YJ1A 3A9JB 4A76A 4AQ7A 2QGQA 2PJHA 1YX5B 1F52A 2ACZB 3U7ZA 1C8CA 1WYGA 4N59A 2LVQA 1VQ7A 3B9JA 2B2UC 1AW7A 1UE5A 2I5HA 3PO3G 2IJ0A 1KJTA 2PE9A 5C44B 4KVGB 4EZJA 1NMGA 2CW0C 3T9LA 3PPAA 2HTHA 5IN7A 3M95A 5BR8Q 3U4ZA 4C1NK 1HJPA 2KCMA 1OEYJ 2MO1A 2WXHA 2KEDA 3UQBA 2OWOA 5EE3A 1EOVA 1SRUA 2IY1B 1E10A 3EN2A 1S5DD 3KF8B 1I4GA 1V5OA 2KQSA 3I5JC 1UUPA 1EQVA 1QZEA 1FNWA 4S17A 2WXGA 1V1OA 1EY0A 1KHIA 3PSEB 2E2IH 1ENFA 2BS4B 2BWES 1IBXB 3H6MA 2F4VL 1BKBA 2PZWA 1J5EQ 2ICEC 3TS0A 2ICIA 2R93G 4AIMA 3DEPA 4K8JA 1PH5A 2JA7B 3P63A 1E1TA 2ZNVC 2Z0SA 4MGZE 1K8GA 3C2PA 4YHHQ 1C1YB 3F1ZA 4UDUC 5EGTA 1IGDA 3RNBC 1M8AA 3M4OH 2JY6A 2NVTH 4A3JH 1PVOA 2CU3A 2V1YA 4CDCC 1EFWA 2K25A 1ZE3D 2K22A 3BINA 3RUIB 4LW1A 4L5SA 4IN3A 5JVG3 5EDSA 4BY7H 2PTLA 2BE5C 1N9WA 1T6BX 1YJJA 4QJFA 1K8OA 1V49A 2SAKA 1Q5WB 1KLVA 2N7DA 5IGDA 5C4JH 2XVSA 2BQQA 4EE2A 2XNAC 5G55A 4JWSC 3S2AA 3TP7A 1Q81C 5C2TB 4BVUC 5I9PA 3G6EA 3V6EB 2CHBD 1K53A 4IFDJ 3PZDA 1WXMA 3H91A 4LCDE 2MWSB 5J2RA 1IZ6A 1SEBD 1X54A 4KHPL 2LRUA 2RGFA 2YEPF 2F0PA 4DR3Q 3N52A 2OXPA 4JI6Q 4HDOA 1CKNB 3UINB 1VQKA 3RD4A 3NPPA 3TN2A 4K7UA 1PYWD 3ALBA 3L9AX 2NVTB 1TQOA 1SR3A 2KJXA 5ELNA 3K59A 4CO7A 1HR0W 1T0RC 3ONSA 5KNCA 1D8LA 1A3UA 4YL8A 3CRKC 1G51A 3NBHA 4OW0A 2EJGC 3OJ4B 4DK1A 2HDLA 5M5YB 3DHGC 2L52A 1LT5D 3ZRFA 1LABA 3OIQA 3URYA 1VDVA 4TRDA 3CPFA 2F52A 3TRZA 3P4PB 1DM0B 2K01A 2LFIA 1EYCA 5AZGA 3RZOB 3UIOB 1XMQL 2AKWB 3ZO5B 1DJRD 2PCFB 3I2ZA 1I35A 4REZA 4DV2Q 4HJAA 1VQLA 1FIQA 2IX0A 2WB1E 4JPBW 2N9KA 4EQOA 5L95C 1BBUA 1XJVA 4KY5A 5KNBA 1DXMA 1KABA 1LTBD 2Z4IA 2Z0DB 3VDYA 1HNXQ 4IUPA 4FYDA 2PVGC 2F0KA 1XD3B 2Y5BB 1C79A 2K50A 2F0EA 4F8MA 3MTNB 1SMYD 4A3FH 3RLFA 4DR7Q 3ZJVA 4BY1H 1WTOA 3RMKC 3R8BA 2BYTA 1CMXB 3STBD 2HHHQ 4IUTA 1YHAA 4IPCA 4A4IA 1GHKA 2IO1B 3IT6B 2G5DA 3DWQA 1NEKB 4USAA 3VH3B 2BA1A 3QOJA 2IYDB 4RH6A 3L7ZC 4DR1Q 3HKZB 3P20A 1YIWA 5AUIA 3UIPB 1BT0A 2FE8A 3IKJA 4LNFA 5MPOA 2BOSA 3MHBA 3M3JA 3JW0X 1SNQA 3AE5B 4JI4Q 3UI2A 3TZUA 1FRRA 3EIVA 2SDFA 2RHQB 3WDNA 4LLGM 1P0RA 4B3RQ 1FYCA 1KDBA 2HD5B 1GUTA 2WXPA 4MHEA 1X55A 3M4QA 2F3WA 2PQEA 4YCUA 4A3MG 3S1RB 2ZJQA 2K52A 4RWSC 3CCMA 1TKGA 4KSKC 3PSIA 1PFMA 2XSCA 3J7ZC 2LVPA 2NBWB 3MJ5A 2EOTA 1A62A 2K7VA 4BY7B 2MA9B 5IT9E 1E0ZA 1MI0A 3MXGA 1CSQA 3SHLA 2KTRB 1S5CD 2N3SA 4JBKA 4MH8A 2NVXH 2I0QA 1E6EB 3VTVA 1E2WA 2KOXA 4HCEA 1V9JA 3LXFA 1PFBA 5BMGA 4K6LA 4GS3A 4N9TA 4M0WA 4KIKB 2LGIA 3P1HA 2L5TA 3R93A 1TR5A 3CRLC 3VA5A 4X66L 4A3KG 3IG3A 3IFDA 3CSFA 3BG3A 1NNXA 1GJXA 1LTGD 2K0PA 2ZEQA 1F0ZA 2E76C 2SOBA 3NZSA 4I6LB 1EYAA 1H9KA 5EJWA 3QAQA 4G50A 1STEA 3PCOB 1PHJA 1S3OA 2FBWB 5AZFA 3QJZA 5IOIA 3VR8B 1Z2MA 5GMVA 3UDFA 4A3BG 1AE3A 2RCFA 2WNMA 1VQMA 2F0UA 3PLVA 3RN5A 1YQ3B 2NCNA 1EWYC 1WGHA 1TWHB 2DNCA 3RNEC 1G8ZD 4EX5A 4HCNB 2WKCA 2J52A 1YQ4B 1LUZA 2V4LA 2K6AA 3MXPA 2PI2A 1STYA 2MP2A 3ML9A 4LDTD 2EYMA 1ACCA 2ES2A 5BN5A 4OO1G 1DOKA 5FKAC 4AJWA 4YSXB 1DYQA 3V05A 1NYQA 2F0QA 3DBHI 2F0DA 5A35A 1N6ZA 3RZFA 2D3GA 3J7AF 3DVNU 3DWMA 4E71A 1K83B 2PMZE 4Z9CB 4FA6A 3PIO3 2EXDA 2JA5H 4TMAB 1B4OA 2K9XA 1YBYA 4JL9A 4DV1L 4BFRA 4JI7L 3H0GB 4YCVA 3KF8A 4OXPA 4RG1A 4WWNA 4A3EH 1RM6C 1WFQA 5FOBB 2D3CA 3U9SA 3EECA 1PTOB 4PV1C 2NWGA 2PYKA 3C1EA 5C3EB 1MSGA 1IBXA 1D3ZA 4RKLA 4A3GB 4IPHA 4AYBG 4MZ9A 4EQNA 3W1YA 1XLNA 2ZXOA 1Q12A 1P16A 5LMNW 3RCZA 5CBEE 2GBKA 4RAUC 1T3QA 2LGXA 5BR8L 1VQPA 1HHVA 2OHFA 1YD8U 3NZUA 1ZDVA 3DHQA 3L2PA 1HNXL 2KT7A 3R66C 1PDQA 4YIJA 1V6EA 3RD2A 1B53A 1E2VA 2KENA 3S24A 3GO5A 3ZJYC 4K2LA 2KJRA 3EUB2 2BW2A 1G6ZA 3S9WA 3HOYH 4WFN3 3M4YA 2JYTA 3AQQA 1XLQA 3KUCB 3T1HL 1NSNS 4B3TL 2EYJA 1S4ZA 4I7AA 4ZUIA 4I7ZC 1MHXA 1Q0WB 3Q8CA 2DY7A 1Y69U 5JJZA 2XRSD 4JIOU 4BBRB 2A69C 3H3VI 4BY1B 3VHTC 5ELDA 4N58A 2KJHB 1LGRA 3VRAB 2JA8B 1GUAB 1SYCA 5LMNL 3Q3FA 1KNEA 1I50B 4JI1Q 4DGZA 3NTHA 5I9OA 2DYOA 3JAME 1OXXK 5J3BA 1V43A 5IWAQ 2PPBC 2K75A 1TWFB 3LB8C 1EIGA 2CH4A 4PZ7A 2HTME 4V0BA 4W9FA 4K5VA 4JI5L 1S3SG 2QSDA 3UGBB 1TZ1A 1JMLA 2NVYH 2K32A 4ZRIA 4WURA 4JOIC 3TP8A 1A3VA 4ME3A 1JRPA 2HQLA 3RPFC 1VD2A 5EAYA 1WJ4A 2Z9HA 3X3NA 3ZVVA 5FLMH 4IC7B 3G48A 1E22A 3IAYA 3IVFA 1PYBA 3O13A 3RN9C 1V1PB 2FAZA 1RAXA 5D14A 1FPYA 4YT0B 5H8YE 3W5UB 4OX9Q 4PT5A 2KHSA 1R4MB 2QEJC 4DUZL 1S40A 2ZCCA 3FVQA 4HEDA 3L0OA 3APCA 1ESRA 3AE8B 2KDFB 4DR7L 3I8ZA 5JOBA 1NUCA 1EY5A 3F8TA 2HHHL 2LHDA 4XX5A 4OVZA 2J4XA 2KCCA 4DWFA 2MUYA 2R93H 2WFWA 2RDFA 4W9DA 5FO7B 3L54A 3VR6A 4II3B 2HCCA 1MFWA 3UDXA 3TEZA 2UUBL 1B9RA 1D1IA 1EEID 2O4XA 4DK6C 4B3ML 1VS0A 2QF7A 1DOLA 2MH7A 2MHVA 4L8JA 2CWAA 4RMFA 2L0CA 2D5DA 1LV9A 3X23A 3VR5A 1VQ4A 4KDLB 1WE7A 2A68D 4LDTB 3H09A 5IYCH 4BKGA 3T3NA 2JN4A 3NWSA 4A90A 4CKCA 4KHVA 3CIRB 4BBSH 3S1MH 3P4RB 1BVSA 3ETRA 1Y1VB 1R4QB 2MPMA 2PMZB 4GNXB 3I55A 1CTMA 1NTGA 4XYQA 4PS7A 5HURA 5FR6A 1KL9A 4TQUS 3CF5A 1WTVA 5F2DA 1RYJA 3AE3B 3HOVG 1SYFA 1E90A 3NVYA 4A9AA 3CMEA 4LF7Q 1J19A 1JB3A 3AEVA 4E74A 1HZ9A 2G9DA 4BOZB 2JEBI 2F03A 1G2SA 1SIJA 1N8RC 3GQBA 2K8BA 3FPUB 3ZTDA 2WP8J 4W9CA 1F9SA 2C7MB 2AQ2B 3RNUA 1GNUA 5K36G 1D5ZC 1V2YA 2B2YA 2KTRA 4NZLB 3FP9A 1H9RA 2KTFA 5IP9G 3OW7A 4L2YA 4K1RB 1PDXA 2VUMH 2NR2A 4IFDG 5HY6A 3PS6A 1PMRA 4I6PA 4HVBA 3ZGZA 2DAJA 4NXMQ 1B44D 2PNRC 1LTLA 1DOMA 2F3IA 2PMVA 5C23A 4RCOA 3N20C 3QA8A 5EQ0A 1VQCA 2XTIA 4QUFA 3E9SA 3S17H 5C0XG 2C7NB 4KKJA 1V8QA 2RDBC 4B6WA 4IFDH 2E6XA 2G4DB 4N9F4 2H5XA 3SGIA 3U4VA 1JJGA 4GDKA 5CV6A 4HEA1 1H9SA 4FBJB 4MELA 1YEZA 1YI2A 1XT9B 1PYSB 4DHZE 2CWPA 1OXVA 5H1SE 3A5UA 2M4NA 1SNOA 4IUUA 2K5PA 2RHSB 2F0WA 3OMGA 3UE1A 2GBMA 4AS1A 2KFKB 3GV6A 1ZDXA 4WWOA 2I5LX 3RNGC 3LJ3A 3TQYA 1FFUA 3R7RA 4HTHA 2OTJA 2CW0D 3EFXD 3U9OA 4WQOB 3ULLA 3CCLA 3P2BA 1L0YB 2V3NA 4IUVA 2F0OA 4K3CA 2K5QA 4R4CA 4DN4M 4ZLTF 2D2QA 2ZVOA 1X32A 4NNJB 1X3GA 1TIFA 1I3QH 3AE1B 2EIFA 3SFEB 1XNRL 3ZLZA 1G6JA 1AFPA 3QOLA 5FO8B 3W3AA 1YMHE 4MJSA 3HZXA 4IM0A 1CKOA 3HOXG 3RN2A 2UWQA 1MHHE 2E2JH 3HOYG 3PGEA 4C3HB 3CAMA 1EOTA 3ZYYX 1WFYA 1N34L 2FIFA 2WXNA 4POGA 2K8CA 2KNBA 2KZRA 5HG2A 4RNAA 2SNMA 5C4JB 4B9KA 2VXWA 3S16B 4LNIA 3BVZA 1E3PA 2BS3B 1FR3A 1N60A 2DNEA 1SE4A 4CKBA 3U2SC 4EKUA 3CCUA 4JWUC 3UDIA 5BYRA 3PUYA 2JK8A 5E3FA 2A4ZA 3HOWG 1I4HA 3AU4A 1RODA 3RR5A 3ZDMC 2HIVA 1SSOA 1N36L 2BH8A 1XPOA 2HIXA 1ZYRD 1S72A 2PLPA 4G7ZC 2KQ3A 2KVRA 1JMCA 2IGDA 1ZPSA 2RQXA 3KJOA 1P98A 5IKCM 3T3OA 2SEBD 4OHJA 3DHIC 1KNAA 2IW3A 2O6VB 3EQLC 1PRTD 2UXBL 1ASYA 1KLGD 5IY0A 1CI3M 1WJJA 4NJ6A 5C3XA 4FXDA 2WQYB 4CKEA 3PO3B 1WJUA 1DOXA 4LFBQ 1JROA 1GXDC 1BO0A 1IXRA 3NWTA 5DPWA 1F2MA 3KWLA 4ULLA 3PUVA 5AFWA 5I6WA 3HOZB 1QOBA 2EKIA 2WX0A 4KY6A 2F0MA 1S5BD 2RSOA 1QILA 1E7ZA 1STNA 5CV9A 4XQNA 4A3KB 2CHZA 1LM0A 4ICVA 2K5NA 3A9JA 3MP9A 2N8NA 1EUJA 1O80A 2V0GA 2F0VA 1C4QA 1SYGA 2YTYA 4JVZA 3RI7C 2MNAA 2KX0A 3P42A 4KN4C 4FLHA 3HG9A 4C4VA 4QIWB 3QR8A 1XPRA 2M9VA 2R92B 4GLXA 3U4EG 3D3RA 4EZLA 1TS4A 2RPQA 3QC8B 5KEEA 2M56B 4BKSD 1STAA 4JG2A 5C0XI 4MDKE 3L0WB 4K5WA 3H7PA 4WAFA 1GB1A 4KGRA 3RT3B 4DAYA 4LF9L 2DZKA 2JXXA 1NENB 1T0QC 5C0XJ 3EA6A 1STHA 3AULA 5E6OA 3FPPA 2JP1A 2RVLA 2M17A 3TJPA 2NVXB 4FJYA 4DV1Q 1HTOA 2QDFA 3I72A 4JCVE 4GZYC 1RTOA 4G7OC 3AM9A 3KYCD 4XXEA 1F1HA 4DXGA 1Y1WG 1VQAA 3K7UC 4LAAA 1UGMA 3HIZA 3OIPA 1FJGL 2JEAI 3I3CA 1YZ6A 1AWDA 2K14A 4ID6A 3AE7B 3FHWA 4GNXA 2AWTA 2VQEQ 3NHHA 5CV5A 4XDXA 2W9NA 3JSVA 2NVQB 3N1ZC 5J18A 3IAM1 4J3OD 4KD3A 1HQRD 2KA7A 3I4MH 3KJPA 2XN9C 1L4DB 1JQYD 2FMMA 1IUEA 1VLBA 2DNFA 5FLXL 3L4PA 4L5TA 3I7FA 1KIXA 1YNNC 3SXHA 1B7YB 4IUMB 3CC4A 1R4NI 4JI4L 3DVGX 3GTPB 1N5WA 1KOTA 1HNZQ 4ZK9B 2N88A 3PF4A 2MO0A 2C9WB 3A4SC 4DV4L 4LUVA 3GTOH 3KLSX 2JYOA 2DZIA 4ZDVA 3TUOA 2IGHA 5CV7A 3PHWB 2NVYB 1YNND 4DV7Q 3QO2A 3ULPA 2KXJA 1GPXA 2N49A 1V1QA 1KXLA 3AE6B 2WS3B 3S2HB 1B8AA 2FCSA 3A5ZB 2LJIA 1Z7TA 3V62A 1UH6A 1Y8PB 3Q3OC 3Q3JA 5EKLA 1EY7A 4C00A 3B0AA 5DLQE 3KF6A 2KWDA 3T8MA 4CDFC 1WGRA 4UP9A 1IBMQ 1EQQA 3AEBB 4KV2A 3ZQ4A 3H1UA 5DPTA 1K28A 5C5LA 2K3UA 2K6QA 2LHEA 1HZBA 2W82A 1WTPA 2L83A 2UUAL 1SMXA 2BB6A 4DAPA 2AUKA 3E3XA 2NMQA 4A3DH 1WR6E 2VRRB 3GTPH 1ZP0B 2QMTA 3VAWA 3E6ZX 4CQNA 1WCMB 3EFCA 3TL5A 2RF4A 2JE6I 2NN6I 5M3FB 4HK2A 4H13C 2OT2A 1Q1OA 2NZHA 4YY3Q 5DNFA 1MG4A 2WDTB 1XLPA 1LTRD 4IUQA 2Q8RE 1UAPA 5G5HA 3J81L 2Y0SE 2A68C 4KDIC 2N4FA 1HFNA 3PRMB 3VQIA 4DHJB 5KHQA 4U673 1WXSA 2EXZA 3I91A 2QHOA 4FXCA 3T1YQ 2LXAA 2JA5G 3K5NA 2BH2A 2R6GA 2K28A 4OL7A 4UPAA 2L1AA 4IURA 3ZJTA 5D3IB 2MQJA 5H92C 4AWJA 4K8IA 1A5RA 1NCVA 1SB3C 1D5MC 1KF6B 1RWSA 3MWYW 4P72A 1HE8A 5JAVA 3OJ3A 2NBUA 1JWUD 2B2TC 2JA7G 1RDPD 2M00A 4HJ5A 2WV6D 1IBKQ 5DPRA 4DR4L 4PYUA 1PA6A 1S5ED 1AZQA 2BDOA 4A3JB 5D2MB 3K6OA 3SK5A 2INDC 1K3RA 1YNTE 1K83H 1LM8B 4PMWA 1YNJC 5EBCA 3N32A 2F0NA 4UP7A 1QB5D 2UXCQ 1JRUA 2JA7H 3AMUA 4Y7NB 1F2RC 4JI5Q 1RCVD 4OONA 2QILA 3VYUA 2Y0SG 4MACA 1KFYB 3HEJA 5EE1A 2XGTA 1G291 4AH6A 3C8YA 4HKQA 1VZ6A 2Z59B 2A1AA 5JPMC 3HRZC 2BKRB 4FNFA 1WTQA 1UF0A 2V4IB 4C7ZA 2C5CA 2FMCA 3N30A 2ENBA 2KMMA 2WYQA 4GU2A 3VXWA 1NJIC 1V86A 2Q8IB 3A56A 2H1EA 5LMUQ 3SK8A 3AE9B 3RZDH 2JZ3B 5IA7A 3CCVA 2KCTA 4ZCKA 2VUMB 1CZGA 2FNJB 3B08A 4WWPA 5AEKB 4RHRA 4A93G 1B9MA 3I4NH 4G57A 2EMSA 1Q8KA 2VL6A 1NVID 4H44C 1TBEA 4KX6B 3S1QH 1BXTA 3U50C 2DYMA 4M02A 3HOUH 4GKKQ 2FFKB 4EGVA 1X9NA 2ATWA 4EVOA 4Y7NH 1YN5A 1YQBA 3AU5A 1EUVB 2KN5A 2Y5PA 3NVVA 5GADC 1WI5A 3UI3A 4FHKA 3J7YW 1V80A 4F87A 4DNIA 4DR6Q 2FJ2A 1EY6A 3W1BA 5FLMG 1VQNA 4ALPA 4F1SA 3KLWA 3I70A 1HA6A 4KD4A 5AUKA 5JHAA 3M62B 4A3EG 2MP1A 3BDOA 2E8GA 3ZNGC 3BZDB 1G91A 2PIAA 3I57A 4W9HA 3Q69A 4ZRKA 1KH0A 1DD2A 1VMCA 4BS9A 2V1CC 3B1LX 3DPDA 4HJKA 1X56A 1X3EA 3AEAB 1CA6A 1PQSA 5E1FA 2AQ1B 1ET6A 3CW2C 1JJCB 4ZYSA 3FKIG 1E8WA 2Y3AA 1FO4A 3SVMA 3MAQA 2QA4A 2MGSA 1Q82C 1P9DU 3EGRA 2KECA 1CUKA 2TSSA 2BA0A 2N78A 3BK1A 2GVBA 5J17A 5J39A 1QVCA 4R4IA 5ELEA 3N9YC 2EY6A 5BMHA 4N6EB 2XIWA 2OF1A 3DDCB 4YSYB 3C19A 3Q14C 3S1QB 2K04A 2ID0A 2MQHA 5M3FH 4A3IB 3L08A 5C1ZA 3J81c 3QWZB 3DBLI 4GN1A 4A3OA 3A8KE 5KYIA 1SBBB 2PW5A 2JA9A 3V2TA 4R8NA 2A8VA 3NQIA 2F4IA 1N61A 1IL8A 1O78A 4GDLB 4DV5Q 3T1YL 4K0KL 4M01A 4B9WA 1NR2A 5HGTA 3F2BA 1W2BA 1GUOA 4A3IG 2K8HA 1TIID 2K33A 2G45B 4URKA 2HE7A 4DXFA 3GTQB 1EIYB 1XLOA 2JWZA 4P7IA 1UZXB 1SDFA 1J5EL 2BF8B 5A2QE 4QUCA 4R1JA 3H6NA 1SJHD 3MA2B 2VQFL 1K8RB 1VCBA 2N9XA 4NP5A 3A33B 2B2UA 3GS2A 1XTDA 4W9GA 3K7AB 3BS1A 2WAQE 2AUJD 2ZTCA 1D2BA 3NUHB 4QIWE 4RCNA 3UE0A 2K5HA 1BUIC 3R3OA 1L1OB 2AWOA 2ZTEA 1OQYA 2R7DA 4EQPA 5M3MG 1PFNA 3MZ5A 2KDIA 3CQZH 4B9XA 1R9TB 4R4QA 4C2MH 3OHXC 5E6NA 3NTKA 5G3LF 1Y1WH 4TQ0A 4M1UB 1C0AA 5D65A 2DLBA 3PV1A 5JPNC 4DR1L 1ML0D 1EU3A 4WORA 5FLXc 1GD7A 4HPLB 1F2LA 1FNUA 4A20A 3EVQA 2NTSA 3MFYA 3F2CA 4A6QA 4K5XA 3PZ8A 2WXOA 2CR5A 2KHIA 2PW7A 1MD2D 4A3GH 3PIOA 2EJMA 4HLEA 1ZEQX 3BVMA 4HIMA 1JALA 1S1QB 2KYWA 4KGTA 4NJ7A 3CSTA 4GIVA 1YNJD 1A3TA 2CCZA 4C2MB 2LUMA 4XZ4A 5CTRC 2KN4A 4B08A 4MEMA 1ZYRC 1R4PB 1YHQA 1DONA 3H0GH 2WX1A 2EY2A 3ND8A 3GTGH 1SFOH 1XNQL 3S14H 2N0SB 4GKJL 4DV6L 2F3VA 1GM5A 3BYTB 1Q8IA 4FHJA 3RULA 3I4MG 1ILPA 1A8VA 2REXA 2RSUA 3D8GA 1D4BA 3DWGC 3KLSA 2R3ZA 4WJPA 4OO1I 4FDBA 1EY4A 1VQGA 4KSLC 4C3JG 4DK3C 3I4OA 1CT1D 5IP9H 1HTLD 2EYPA 4WJOA 5EPLA 1SIFA 4BA1I 1PLFA 3VRBB 3PT2B 1OXSC 2HCIA 5K36H 3AB5A 2YTVA 1MJEA 4AOFA 1HUNA 1B9NA 5CHWA 4TVAB 5IGGA 2GA4B 4H2AA 5LXHA 3ER0A 5IT9L 1HNWL 2N7EA 1YN3A 3MTSA 4DDGD 4N9PA 3E9HA 1WF9A 4RGOS 1X3PA 1PUTA 2INPE 3VR4A 1EL0A 4ZHOA 2PEAA 3WCQA 1AARA 1K3BC 2RDHA 2W3SA 1QKZA 1IBLL 3GB1A 5DCNA 1SE2A 5EE0A 5C0XH 2KACA 1C9FA 3ZRCA 2FCQA 1TYGB 2KDBA 3Q8EA 5D6JB 4LK0M 3GZNI 1WYWB 4S3SA 1V81A 4UY8C 1Y8NB 2DBYA 1QWYA 2KD0A 5GAHC 1TWCH 1ICFB 4BOSC 5J1ZA 4LF5Q 4JYAL 2OEOA 1NBWA 1IGCA 1OQRA 2VZAA 2JYEA 5FR3A 3VUYA 4FJZA 3E5SA 1BMLC 3FC4A 1QVFA 3NVWA 4II2B 4IWOA 3VH4B 2IWHA 2X69A 1FVIA 1X3QA 2X38A 1Q46A 1CSPA 4LFCQ 1C9OA 1IW7D 2DZJA 1G6PA 4XDDA 3D32A 5JEAJ 5CGKA 4IW0A 4YTMB 4F7ZA 5ELCA 3U30A 2MBQA 5JEAH 1I4QA 4KKSA 3H15A 1V8CA 3MC8A 1LT4D 2BE5D 4MIUA 1VQEA 3DM3A 4QMGA 3T53B 3IFTA 1PZKD 2KLCA 3GTKH 3HGBA 1QOFA 2KK8A 2L05A 4TV3A 3D4WA 4QL5A 1ZOYB 2I1KA 1EO6A 2V3PA 1P8LA 1TWAB 3FKIB 1EQRA 4ZUJA 4JI3Q 1WX9A 3NP8A 3SDLC 3I4NB 1SE8A 2HD3A 2YEPB 1XWEA 2PZUA 4FP5D 2UUCL 1N32Q 2VZKB 3WALA 1HA5A 4Y52H 1YJIA 4GKKL 5BO4B 2RD0A 3N6RA 2A5HA 3HOVH 1OEYA 2EDGA 2WGSA 2Z1CA 4ILWA 3TREA 1H8CA 3SK4A 5EPKA 4DR6L 1XX8A 1B3AA 1WRIA 3HP3A 4GOPB 2BDNA 5TSSA 1SYEA 5C3EH 1PH2A 4MJSB 5GQOA 3HVDA 1ROEA 2O2VB 1HZ5A 2B2WA 1WXAA 4IJLA 1KDCA 2L1BA 2WKDA 1WTRA 1K0RA 1C48A 3W1GA 4DAVA 1VQDA 2NUCA 3Q8BA 1HXYD 3RMHA 1R7SA 1CKNA 2I2YA 1VF7A 1EWIA 4YHHL 1PH8A 2IZVB 4JE3B 2M0AA 3OW2A 2KDMA 2QKIC 2JXTA 4XTCS 4DV2L 4GLSC 4ZRQA 3TEXA 3GTGB 1AYFA 4XGAB 2WP9B 4G7HC 5M5YH 4DR2Q 2WXFA 2GN5A 3K0YA 1AZPA 3BY4B 1SF0A 2H89B 4ZKBB 1TKWB 1X6OA 4QB4A 1N36Q 1TS5A 2VQFQ 3NELA 2G9HD 4EFOA 3R3MA 1E2ZA 2XRQD 1WY8A 1D5XC 2CHXA 2KMCA 2ZJPA 1PRTF 2I07B 3CCJA 4DV0L 3HK0A 3QCAA 5JH5C 4GLAC 1RIPA 4ZOHC 1CZWA 3J80i 1BCPB 2Y0SB 1WIAA 2GBJA 4L23A 2E2DC 2F0HA 1QVGA 5BN3A 5KYLA 1Y1VG 4KHZA 2D0PA 2B63G 4L63B 3HOWH 3TEYA 3AV8A 4C3JB 4LF4L 1D7QA 1G2TA 1XF5L 3J81E 4RF1A 4X3TA 1UEAB 2GVAA 3ZW3A 1J8IA 2QDLA 2E5LQ 1U0LA 1GB4A 2QIEB 3AN1A 4BBNF 5AZHA 3HM6X 3NE5B 2WU2B 1GVPA 4ITKA 4OZCA 1XNQQ 1YJ9A 4R3DA 4XDCA 1HNZL 2JT4B 4GGQA 2O5IC 2KANA 2OTLA 4A93B 4X64Q 5IGFA 1ESFA 2BGFA 5EBDA 3GOEA 1RF2D 2MFIA 3DWPA 3ZUNA 4R9WA 3NOBA 4NMZA 5KRUA 1BBXC 1XMQQ 4HJ8A 3ONAB 2Q2IA 3ZIMA 3HKSA 2X6LA 4JC0A 4MGYE 2EY1A 1ZXHA 2KBNA 1DOIA 1HCZA 3QX1A 2LD9A 5CYUA 2R93B 1CQVA 1PTOD 3JYUA 1OTCA 2ZZPB 1FGBD 3FILB 1HNWQ 4KZ0A 1WCMG 3QK0A 4LTUA 4A3PA 2CVRA 2D10A 1VQIA 4KKTA 3A1QA 1SMYC 4A3CG 2K1FA 4DF7A 4XQJA 1TKYA 3DVGY 1TS2A 2N55A 4M0WB 4TUUA 4WWMA 4LF6L 4XQQA 5IIFA 2Z0EB 1CQFA 4H7BA 3K80C 2Q2HA 2NVQH 3QIAA 4Q2JA 3VFKA 4ICUA 2K05A 5C4ZA 5IYDG 4HJ9A 5AJ3L 2AWNA 1XPUA 2RMMA 1NMFA 4GN4B 1VDZA 3T13A 2L12A 2EY5A 5KGUA 4HJ7A 1AE2A 1J8CA 3GTLH 1FD6A 2HT1A 4AQYQ 3DBRB 4D2KA 2ZXRA 1QJOA 3HUIA 4M8MA 2MCNB 3BDLA 3SE0A 1PH9A 4LFCL 1KLUD 4OWTB 4HRSA 3W5OA 2FINB 1W6JA 3SEBA 4DV5L 4LF5L 4X62L 3AEFB 1IW7C 3K58A 1YJWA 4XE0A 2B3GA 1K8MA 3TZDA 4APVA 2W55A 2ZM6L 2R2OA 4XYCA 1H9MA 1HTPA 1PH4A 2JA8H 3PIP3 2D5GA 4HWIB 4WIPA 2EQSA 4X3KA 3CWIA 3I9V1 5HI1A 3TEWA 1AH9A 3Q2AC 2AEHA 3DVNV 3RLOA 2C5LC 3KYDD 3PREA 3CU7A 3TMPB 1DZ1A 4JPSA 3MHSD 3P4QB 4KGSA 4ASWC 4ABNA 5CMDA 1AP0A 1TY0A 1MVKA 2MW5A 3BK2A 2YU9H 4BBSB 2KWCA 4RGNA 4K14A 2IHFA 2DN8A 1SNMA 1FJGQ 4A8XC 1VQOA 3AI5A 5HGQA 3EROA 2ZT9C 1IBLQ 4C3JH 4JI3L 4F7XA 2QCPX 2OJRA 2I5MX 1LTID 5IAAC 4WJ4A 1I42A 3OWEB 1EF5A 1SROA 4OIJA 4IM3A 4DPGA 4F8CB 3RZDB 4XC2A 4IUNA 4C1NI 1YHBA 4YWMA 1YN4A 2IL8A 3LWUA 2PO4A 2JA6B 1QOAA 4BZAA 2D3AA 3GE3C 2X6GA 2D2CC 3T1HQ 4B3TQ 5CR3A 1L2NA 4YCWA 4BWGB 3U8ZA 1FD7D 4H0LC 1V97A 4A3LG 2NYZD 4KJNA 3JAMc 3HOZH 1Q7YC 3CD6A 3W1SC 4A55A 4A3CH 3RNAC 2C9OA 5BMIA 3M4OB 2E2HB 1ASZA 4FADA 4HXDA 1FCLA 3OLMD 3G4SA 4DUYQ 1OXUA 1GAQB 2EE1A 1WH3A 4X6AH 4B3MQ 1ILQA 4X64L 4GOPA 4ME5A 2OEDA 4IG7B 2F0SA 4JBJA 1J6QA 2LFNA 4X65L 3ULJA 3J81j 2WDRB 2O2VA 4KJOA 1QF6A 2KQ7A 4EEWA 1PFSA 1JWMD 2ZJRA 2LGSA 1HR0L 3S1NB 4QGUA 2MRPA 3K81C 3NHEB 2D0OA 5BN4A 3GTMB 2WXIA 4ZHPA 4OO1H 1EWHA 3LWEA 3SR6A 1JW9D 5NUCA 3M4PA 3AEEB 4DUZQ 2EKEC 1R4MI 2MLBA 3KUDB 1PH6A 3E0JA 5IWAL 4NPNA 3IBEA 2KCNA 1Q3LA 1I50H 4A93H 2L4NA 1I6HH 4NY0A 3AEDB 2DJFC 4LUOA 4R8IA 3HOVB 2WXLA 1L0XB 2WACA 1JORA 3AEGB 4YY3L 4C3HH 4IALA 4HIOA 5CX3A 3VR9B 1E7UA 1GJZA 2CH4W 5FO9B 3HKZE 1KQSA 1OQQA 1SE9A 4HAEA 1SJED 4X3UA 4A3IH 1L0WA 4KLKA 1GC6A 2I46A 3EC8A 1F2RI 1ZKHA 1B3QA 3W5VB 5M5WB 5M5WH 4YWGG 2XWJB 2FCMA 5EPJA 4WAAA 2E2JB 4LUZA 1WE6A 2DJGC 1FMAD 2LGYA 4O0AA 4MM3B 3ITPA 1O7LA 3KBXA 3T51B 1QE6A 5C4XH 5DPSA 5IGCA 4US9A 1CHPD 3BU2A 3I90A 1BF4A 4KHPQ 3FMCA 2EYHA 4DUYL 2LZ6A 2R2QA 3IAS1 3DWAA 4TKOB 1N34Q 1W3SA 3ND9A 3QQ8B 3UF8A 5IGEA 2M2LA 1C4AA 4BXXH 4NAWB 3NS1A 4LNNA 5EKKA 5I6YA 4I65A 4AYBB 1E9MA 1E7PB 1L6UA 1N5XA 4RHSA 4DR5L 4AQYL 1WSPA 1L1OC 1EWCA 1LLRD 4C3IH 2BYEA 3MXNB 3AH7A 3S2HH 3BIID 1A15A 1NY4A 3VR3A 3BJUA
chains in the Genus database with same CATH topology
1CA5A 1DOYA 1ZXIA 2B63B 5GXGB 5KNDA 3NQTA 3KQ4A 1U4MA 4O42A 2F0JA 1F77A 3PUWA 3Q6SA 4FXGC 1M4VA 3FAHA 2E74C 2PKOA 2JX5A 4K6DA 2GB1A 1UWXA 1HZ6A 5D7GA 1D6EC 1U4LA 4KMUC 3K5MA 4HR7B 1HQMC 1SAPA 3Q0AA 4YSZB 1CM9A 3PZ7A 1SNPA 3ABVB 3AECB 4YTNB 2WDVB 3B2FA 1NR4A 5DAUA 1S5FD 1BUVT 5LL6S 1I4XA 4US8A 1RD9D 4IDIA 2N9LA 4JBWA 4X3SA 1GUGA 2WU5B 2YU9B 4OZBA 1EZ6A 4YXDB 2J42A 2XWBB 2F0LA 1XYIA 1K51A 4KKIA 2O5JC 1EU4A 1EY8A 1WD0A 1JE4A 1JWBD 1XCQL 1Y56A 2IX3A 2J53A 2A6ED 5C4XB 1GUNA 3W9CB 3SK6A 4K2KA 1FXIA 1AEXA 3I4LA 1Y1WB 4XWTA 2H4OA 5ELBA 1BDOA 4KN7C 3M7NA 3CQZB 1QQRA 2JXMB 1MGSA 5K5PA 3KUPA 3H94A 4RGTA 4PNYA 3D6CA 1J9OA 4WJWA 5CV4A 1BCPD 1OO9B 1I6HB 2PW9A 1TU2B 4RKBA 4FXKC 4ODGA 1XO3A 1RKNA 4C7YA 2B2WC 2JSOA 3C3LA 4PMCA 3C1FA 4A3BB 4OGQC 1SYDA 2F0GA 4HMJA 3K57A 5DM63 3D4RA 2NB0A 4Q5VA 3GTOB 3T56B 2R7ZB 2KUMA 3Q23A 1PRTB 2A6HD 1HFGA 3MEHA 2NBFA 4F88A 1JWSD 3PUZA 2WINB 2A6EC 3J7AV 2K1BA 1PTOF 3AMZA 4HN7A 2BCOA 2J0TD 1B50A 4NW2A 3NK9A 4OIKA 3S17B 1EQTA 3F2UA 1HEZE 1C4PA 2WXRA 1FNVA 2WXMA 1IKLA 4KY7A 3AE2B 3I4MB 3HS0C 4C3IG 4BA2I 1TKEA 3Q24A 2CQAA 1BNZA 2QJLA 1C77A 3HOWB 1RTNA 1VJKA 1B2TA 2B76B 2PVOD 1CK1A 4XWWA 3D4DA 1STBA 4P6VF 1D1KA 1ONLA 3QWNA 2EJFC 2E3TA 1ZUD2 1QNUA 3I73A 3P75A 1EYDA 1SSNA 2MJ8A 3DUZA 2MEKA 1BCPC 2BBCA 2BYTA 2BT6A 1OXTA 3HOUB 1GUSA 3Q8FA 2Z4HA 1EY9A 2V4DA 1O7ZA 1TVXA 4LJZC 1VR9A 4DU9A 1ICWA 4KI0A 1DGJA 1PGXA 3BYYB 4JX1C 3LNNA 4WQMA 3RFZB 1QOGA 5CV8A 1JICA 1LTSD 4LMQD 3JAML 2I38A 3TP6A 2R61A 2DY8A 5FK9C 4IKGA 3TMEA 1KDAA 1VRAB 5HHDG 5IODA 2WXQA 2D62A 4Q0FA 4ARCA 2AQ3B 4DNTB 4ZKCB 2B2VA 5M9OA 2SNSA 1SE3A 1FEHA 3IL8A 3S15B 2N7JA 1Q10A 1CZPA 3MVVA 3D6WA 2K03A 4NDXA 2WXJA 2GRIA 4QCLA 5BYQA 1NAPA 1MSHA 4L1BA 3KK7A 2H88B 2INNE 1WD1A 5I4DA 1LTTD 3A7LA 5LL6X 3RUZA 3A55A 2AX5A 3HVZA 1F9PA 3GP7A 1I4PA 4IQZA 3PV0A 1QOHA 4KV6A 4MN3A 3VA7A 1QG7A 3CHBD 4J8QA 3PO2B 3LX0A 2JZPA 4IZ8A 2Q5WD 3R2TA 5C4HA 1WTWA 4RF0A 2M19A 2WB1B 3SFDB 3D31A 1QCBD 2Q8TA 4OZAA 3NSWA 2B39A 3V3XA 2DWQA 1Z6HA 1H9JA 1PFDA 2FHTA 4JK1C 1A6XA 4FO2A 2B2VC 1EM7A 1C76A 4DNRB 2NN6H 4KTAA 5G3LD 3OPOA 1J7AA 2WDQB 1A2TA 2J7ZA 4UAIA 3OOCA 5C3JB 4XT3B 1GUWA 2RA4A 3G6JB 3MXUA 3S14B 4HSPA 1JOQA 4KK7A 3NZ3A 1TZOA 2G1EA 3QG1A 1RHPA 2EVBA 1N62A 4J1MA 3OMCA 4CHTB 3T4AC 2LY7A 2VB2X 1L4ZB 4DFAA 4B0EA 4WRDA 1K52A 3J80L 1XCTL 3M7GA 1L0VB 2LS01 3NBIA 4FF4A 3EJIA 5CBAE 5HFYA 1RJTA 1I4RA 2PZTA 4A3EB 2EPBA 2NTTA 3S1MB 1SXTA 5JXVA 3AE4B 1MI2A 1DCZA 2JA5B 2CJNA 2MJEA 3K5OA 1TY2A 4C3HG 1N63A 5IGBA 2NZ1D 2HQEA 3A54A 3PUXA 5JEAG 1J7CA 3B2GA 3T16A 1PGAA 1CHQD 2GI9A 2L11A 3P1MA 3X3MA 2EELA 1FM0D 2ON8A 5C3WA 4RA8A 1ZXTA 2ZXPA 4E6IA 1TWCB 3H8HA 3NXWA 4CJ2C 1IYUA 4FF2A 3ZJUA 2NN6G 2D9UA 3FILA 1QT9A 2O2LD 1II3A 4HSVA 1FCCC 3A7AB 1LO5D 3A8IE 1ENCA 1WWTA 3R2IA 2EZVA 3E56A 4IOIE 2JSVX 2MJ3A 3TDQA 3M85A 1SNDA 1W6KA 3K5LA 1JQ4A 1L6VA 3W2DA 4ZQ3A 3KBGA 1U4PA 4WH4A 3SDZA 1STGA 3DM1A 1K50A 3P7JA 3HRDD 2FUG1 1BQQT 1BCPF 3GD7A 1SFOB 2ONQA 4LK1C 5CORA 4TSSA 3GV3A 4O1NA 1PZJD 5KIXA 5FLXE 3V96A 4FF1A 3FEWX 3MHZA 1A70A 2IDYA 1LACA 3BDCA 1C4CA 4FVMA 3P4SB 1I3QB 1VZ8A 3KLRA 2BB5A 2MJDA 5ELFA 2Z8LA 4ZAIA 2W54A 3FRPB 1HRJA 4A3FB 1CFMA 1U4RA 1KAAA 5J22A 3MFGA 2BS2B 5C6AA 2RDGA 2ZW1A 1UGJA 4RGMA 5T8IA 5EE9A 4C80A 2CJOA 4ZRZA 3OWFA 4DA2A 5EKIA 3PO0A 1WGKA 1SYBA 1V1PA 4NJCA 2ZW0A 2A69D 2HDMA 1XXGA 5LHY1 2L55A 1Q1EA 1F2YA 2RBMA 3M3YB 1LT3D 4HCSA 3NRZA 3A8JE 2B2YC 1F2ZA 4DQOC 4G4KA 2LEKA 3H3VC 4TQ1A 3NVZA 4B0MA 4NAMA 2RKSA 1Q1BA 1UWMA 5E4WC 2F0TA 2IGGA 2LMCA 1TS3A 1E0BA 1JOKA 1Q90A 4IFDI 4CJ1B 4P2CB 1RFKA 2KVMA 1FXAA 1FRDA 1BR9A 1VF5C 2RSNA 2WAQB 3FDTA 4KKUA 1IYVA 3FC4A 2KEEA 3TSSA 4HMIA 5I2XA 1I6VC 1VMPA 1WTXA 1WXQA 2K5WA 3WOEA 5T1GA 5E4XA 1MPEA 1KRHA 4A3DB 1T5XD 3VYSA 3TBIB 3WOFA 2EYLA 3VYRA 3HOXB 1QLBB 4HJGE 2JQRB 1I7HA 2L32A 3LYYA 2F1MA 2A6HC 1J7BA 3GTLB 1O7YA 1IHZA 5BYSA 4RFBA 3MXNA 3U52E 1EZ8A 3VYTA 2YYZA 3AB9A 1PTOC 4GDKB 1QNKA 5JVH3 2EYOA 1JC7A 1CJEA 4HKZE 2KQ4X 3J9CA 5I2YA 1TT2A 1LTAD 5ISRA 5LNK1 3Q8AA 1MBYA 3BVGA 1ET9A 4ZRPA 4PMBA 1EFID 1TWGB 1TJEA 5DM73 2Y5CA 2VZKD 3DMUA 1EEFD 4XIGS 3S2DB 3TP5A 3GTJB 1A2UA 3Q22A 4MT5A 4U68A 2K5DA 5A2QL 5COYA 3G7LA 1FFVA 2TMPA 1Z47A 3HOYB 1JR0D 1UNSA 2KAJA 2HDEA 4ARIA 3DXJC 4C56C 1JOOA 2WXKA 4L6TB 5IOCA 1HPCA 1LT6D 2B8GA 4CBVA 5G5GA 5M3MB 1ENAA 1H9SB 3NTIA 3SR1A 3BWUD 2IX1A 1XTCD 2IT1A 4YTPB 1PZID 4J6HA 2A74C 1KTKA 5D3DA 1SNCA 1AN8A 1PTOH 3IT4B 1L5PA 1F9RA 1ZKOA 1U9RA 5CC4A 3ERQA 1EIHA 4XYOA 1NI3A 2E2IB 2IPKD 2F0FA 3C46A 2E75C 3QJYA 3MC0B 3L3OC 1HUMA 4NKLA 2JU6X 5DEHA 1OFFA 4HROA 1PGBA 1Y8OB 3W1SA 1WVLA 1GHJA 1GOZA 2VNUD 1PRTC 5E6JA 1VZ7A 1JWAD 4P16A 5T1IA 1IKMA 4DK0A 2HUGA 3KWVA 3VR2A 2LKVA 1P7FA 1B1ZA 1F9QA 4PQXA 3CKIB 2B2TA 2JWUA 4XT1B 2WIIB 3GTKB 1BOSA 2B8FA 2BTEA 3PMFA 3DEOA 4C3IB 2LMCB 3AU7A 5M5XB 1P7EA 1C78A 5C5MA 3OSOA 4QF4A 3J80E 4A3MB 2EYFA 4CJ0B 2RPVA 1JCKB 4FF3A 2WLBA 2VB3X 3NUCA 2A73B 3IXSA 1PXUA 1VCIA 4V190 3QB3A 2W3RA 4CGYB 1NYRA 2QDBA 2L9HA 1XEEA 2F0IA 4M8AA 2KOLA 1T5EA 4AQ7A 2ACZB 3U7ZA 1C8CA 1WYGA 4N59A 3B9JA 2B2UC 1AW7A 2IJ0A 5C44B 2CW0C 4C1NK 2WXHA 2KEDA 5EE3A 1E10A 1S5DD 1I4GA 1UUPA 1EQVA 1FNWA 2WXGA 1V1OA 1EY0A 1IBXB 1ENFA 2BS4B 3H6MA 2PZWA 2ICEC 2ICIA 3DEPA 4K8JA 2JA7B 3P63A 3C2PA 4UDUC 5EGTA 1IGDA 1M8AA 2CU3A 1ZE3D 2K22A 4IN3A 5JVG3 2PTLA 2BE5C 1T6BX 1YJJA 1K8OA 2SAKA 5IGDA 4EE2A 2XVSA 2XNAC 4JWSC 3TP7A 5C2TB 5I9PA 2CHBD 1K53A 4IFDJ 3H91A 1SEBD 2YEPF 2F0PA 3N52A 2OXPA 3RD4A 3NPPA 3TN2A 1PYWD 3L9AX 2NVTB 1TQOA 2KJXA 3K59A 5KNCA 1A3UA 3CRKC 3NBHA 4OW0A 2EJGC 4DK1A 2HDLA 5M5YB 2L52A 1LT5D 1LABA 3OIQA 3URYA 1VDVA 4TRDA 3P4PB 1DM0B 2K01A 2LFIA 1EYCA 3RZOB 1DJRD 2PCFB 4REZA 1FIQA 2IX0A 2N9KA 4EQOA 4KY5A 5KNBA 1DXMA 1KABA 1LTBD 2Z4IA 4IUPA 4FYDA 2PVGC 2F0KA 1C79A 2F0EA 4F8MA 1SMYD 3RLFA 3ZJVA 1WTOA 3R8BA 4IUTA 1GHKA 3IT6B 4USAA 3DWQA 1NEKB 2BA1A 3QOJA 4RH6A 3L7ZC 3HKZB 3P20A 5AUIA 2FE8A 3IKJA 5MPOA 2BOSA 3MHBA 1SNQA 3AE5B 3UI2A 3TZUA 1FRRA 2SDFA 3WDNA 4LLGM 1FYCA 1KDBA 1GUTA 2WXPA 4MHEA 2F3WA 2PQEA 3S1RB 4RWSC 1TKGA 1PFMA 2XSCA 3MJ5A 2EOTA 2K7VA 4BY7B 1E0ZA 5IT9E 1MI0A 3MXGA 3SHLA 1S5CD 4MH8A 1E6EB 1E2WA 4HCEA 3LXFA 1PFBA 5BMGA 4K6LA 4N9TA 4M0WA 2LGIA 3P1HA 2L5TA 3R93A 1TR5A 3CRLC 3VA5A 3IFDA 3BG3A 2K0PA 1GJXA 1LTGD 1F0ZA 2E76C 2SOBA 1EYAA 1H9KA 5EJWA 1STEA 2FBWB 3VR8B 2WNMA 2F0UA 1YQ3B 1EWYC 1TWHB 2DNCA 1G8ZD 2WKCA 2J52A 1YQ4B 2K6AA 3MXPA 1STYA 2EYMA 1ACCA 4OO1G 5BN5A 1DOKA 5FKAC 4YSXB 1DYQA 3V05A 1NYQA 2F0QA 2F0DA 5A35A 3J7AF 3DWMA 1K83B 4Z9CB 3PIO3 4TMAB 1B4OA 2K9XA 3H0GB 3KF8A 1RM6C 5FOBB 3U9SA 1PTOB 4PV1C 2NWGA 2PYKA 3C1EA 5C3EB 1MSGA 1IBXA 4RKLA 4A3GB 4EQNA 1XLNA 2ZXOA 1Q12A 5CBEE 4RAUC 1T3QA 2OHFA 1HHVA 1ZDVA 3DHQA 1PDQA 4YIJA 1B53A 1E2VA 3GO5A 4K2LA 3EUB2 2BW2A 1G6ZA 3S9WA 4WFN3 3M4YA 2JYTA 1XLQA 1NSNS 2EYJA 1S4ZA 4ZUIA 4I7ZC 1MHXA 3Q8CA 2DY7A 1Y69U 5JJZA 2XRSD 4BBRB 2A69C 4BY1B 5ELDA 4N58A 3VRAB 2JA8B 1SYCA 1KNEA 1I50B 4DGZA 3NTHA 5I9OA 2DYOA 3JAME 1OXXK 1V43A 2PPBC 1TWFB 3LB8C 1EIGA 2HTME 4V0BA 4K5VA 2QSDA 1JMLA 2K32A 4WURA 3TP8A 1A3VA 1JRPA 3RPFC 3X3NA 3IAYA 3O13A 1V1PB 5D14A 4YT0B 5H8YE 3W5UB 4PT5A 2KHSA 2QEJC 3FVQA 4HEDA 1ESRA 3AE8B 3I8ZA 5JOBA 1NUCA 1EY5A 2LHDA 4OVZA 2J4XA 2KCCA 2MUYA 2RDFA 5FO7B 3VR6A 3TEZA 2HCCA 1B9RA 1D1IA 1EEID 2O4XA 2MH7A 2QF7A 1DOLA 2MHVA 4L8JA 2L0CA 2D5DA 1LV9A 3VR5A 2A68D 3H09A 3T3NA 3NWSA 4A90A 4CKCA 4KHVA 3P4RB 3ETRA 1Y1VB 1R4QB 2MPMA 2PMZB 1CTMA 4XYQA 5HURA 4TQUS 1WTVA 4A9AA 1RYJA 5F2DA 3AE3B 3NVYA 1SYFA 1JB3A 2G9DA 2JEBI 2F03A 1G2SA 1SIJA 3GQBA 3FPUB 2WP8J 1F9SA 2AQ2B 5K36G 1D5ZC 4NZLB 2B2YA 1H9RA 3OW7A 4L2YA 1PDXA 3ZGZA 4IFDG 1PMRA 1B44D 2PNRC 1DOMA 2PMVA 4RCOA 5EQ0A 4QUFA 3E9SA 5C0XG 4KKJA 1V8QA 4IFDH 2E6XA 5CV6A 4HEA1 1H9SA 1OXVA 1SNOA 4IUUA 2K5PA 2F0WA 3OMGA 4AS1A 3GV6A 1ZDXA 1FFUA 4HTHA 2CW0D 3EFXD 3U9OA 1L0YB 2V3NA 4IUVA 2F0OA 2K5QA 4ZLTF 4DN4M 1X32A 3AE1B 3SFEB 1AFPA 3QOLA 5FO8B 3W3AA 1YMHE 3HZXA 1MHHE 4C3HB 1EOTA 3ZYYX 2WXNA 5HG2A 4RNAA 2SNMA 5C4JB 2VXWA 3S16B 3BVZA 2BS3B 1FR3A 1N60A 2DNEA 1SE4A 4CKBA 3U2SC 4JWUC 5BYRA 3PUYA 5E3FA 1I4HA 1RODA 1SSOA 1ZYRD 2PLPA 4G7ZC 2KQ3A 2IGDA 1ZPSA 2RQXA 3T3OA 2SEBD 4OHJA 1KNAA 2IW3A 3EQLC 1PRTD 1KLGD 1CI3M 5C3XA 4FXDA 2WQYB 4CKEA 3PO3B 1DOXA 1JROA 1GXDC 1BO0A 3NWTA 1F2MA 3KWLA 4ULLA 3PUVA 5AFWA 5I6WA 3HOZB 1QOBA 2EKIA 4KY6A 2F0MA 1S5BD 2RSOA 1QILA 5CV9A 4A3KB 1STNA 4XQNA 3MP9A 1O80A 2V0GA 2F0VA 1C4QA 1SYGA 3P42A 4KN4C 3HG9A 4QIWB 3U4EG 2M9VA 2R92B 3D3RA 1TS4A 5KEEA 2M56B 1STAA 5C0XI 4K5WA 4WAFA 1GB1A 4KGRA 4DAYA 1NENB 5C0XJ 3EA6A 1STHA 3FPPA 2JP1A 2RVLA 2NVXB 3I72A 4GZYC 3AM9A 1RTOA 4G7OC 4XXEA 4DXGA 4LAAA 3OIPA 2JEAI 3I3CA 1AWDA 4ID6A 3AE7B 3NHHA 5CV5A 4XDXA 2NVQB 3IAM1 4J3OD 4KD3A 1HQRD 2KA7A 1L4DB 3L4PA 2XN9C 1VLBA 1JQYD 2FMMA 1IUEA 5FLXL 1YNNC 3SXHA 3GTPB 1N5WA 4ZK9B 2N88A 3KLSX 2JYOA 3TUOA 2IGHA 5CV7A 2NVYB 1YNND 3QO2A 1GPXA 3AE6B 2WS3B 3S2HB 2LJIA 1Z7TA 1Y8PB 5EKLA 1EY7A 2KWDA 3AEBB 3ZQ4A 5C5LA 2K3UA 2LHEA 2W82A 1WTPA 2L83A 2BB6A 4DAPA 2AUKA 2NMQA 2QMTA 1ZP0B 4CQNA 3E6ZX 1WCMB 2JE6I 2NN6I 5M3FB 4H13C 2OT2A 5DNFA 1XLPA 1LTRD 4IUQA 2Q8RE 1UAPA 5G5HA 3J81L 2A68C 1HFNA 3VQIA 4U673 2EXZA 3I91A 4FXCA 3K5NA 3ZJTA 2R6GA 2K28A 4OL7A 2L1AA 4IURA 5D3IB 5H92C 4K8IA 1NCVA 1SB3C 1D5MC 1KF6B 1RWSA 3MWYW 5JAVA 1JWUD 2B2TC 1RDPD 2M00A 2WV6D 1S5ED 1AZQA 2BDOA 4A3JB 3K6OA 3SK5A 1YNTE 4PMWA 1YNJC 5EBCA 2F0NA 1QB5D 3AMUA 4Y7NB 1F2RC 1RCVD 2QILA 3VYUA 4MACA 1KFYB 3HEJA 5EE1A 1G291 3C8YA 4HKQA 1VZ6A 5JPMC 3HRZC 4FNFA 1WTQA 2V4IB 4C7ZA 2C5CA 2FMCA 2ENBA 2KMMA 2Q8IB 3A56A 2H1EA 3SK8A 3AE9B 2VUMB 1CZGA 4RHRA 1B9MA 4G57A 4KX6B 1NVID 4H44C 1BXTA 2DYMA 2FFKB 4EGVA 4EVOA 1YN5A 2Y5PA 3NVVA 3UI3A 3J7YW 4F87A 2FJ2A 1EY6A 3I70A 1HA6A 4KD4A 5AUKA 2MP1A 3BDOA 3BZDB 1G91A 2PIAA 3I57A 3Q69A 1KH0A 1DD2A 1VMCA 4BS9A 3AEAB 1CA6A 5E1FA 2AQ1B 1ET6A 4ZYSA 2Y3AA 1FO4A 3SVMA 3MAQA 2MGSA 3EGRA 2KECA 2TSSA 2BA0A 3BK1A 5J39A 3N9YC 5ELEA 5BMHA 2EY6A 4N6EB 2XIWA 2OF1A 4YSYB 3S1QB 2K04A 2ID0A 4A3IB 3A8KE 5KYIA 1SBBB 2PW5A 3V2TA 4R8NA 3NQIA 2F4IA 1N61A 1IL8A 1O78A 4GDLB 4B9WA 1NR2A 5HGTA 1GUOA 1TIID 2K33A 4DXFA 3GTQB 1XLOA 1SDFA 5A2QE 4QUCA 1SJHD 3MA2B 4NP5A 2B2UA 3GS2A 3K7AB 3BS1A 2AUJD 1D2BA 3NUHB 4RCNA 1BUIC 3R3OA 2AWOA 4EQPA 1PFNA 3MZ5A 4B9XA 1R9TB 3OHXC 3NTKA 5G3LF 4TQ0A 4M1UB 2DLBA 5D65A 5JPNC 1ML0D 1EU3A 4WORA 1F2LA 1FNUA 3EVQA 2NTSA 3MFYA 4A6QA 4K5XA 3PZ8A 2WXOA 2PW7A 1MD2D 2EJMA 1ZEQX 3BVMA 1JALA 4KGTA 1YNJD 1A3TA 4C2MB 2LUMA 2KN4A 4B08A 1ZYRC 1R4PB 1DONA 2EY2A 3ND8A 2N0SB 2F3VA 3BYTB 1Q8IA 1ILPA 3D8GA 1D4BA 3DWGC 3KLSA 2R3ZA 4OO1I 1EY4A 4C3JG 1CT1D 1HTLD 2EYPA 5EPLA 3VRBB 4BA1I 1PLFA 1OXSC 2HCIA 5K36H 3AB5A 1HUNA 1B9NA 5IGGA 2GA4B 4H2AA 5IT9L 1YN3A 3MTSA 4N9PA 2INPE 4RGOS 1X3PA 1PUTA 3VR4A 1EL0A 4ZHOA 3WCQA 2RDHA 2W3SA 1QKZA 3GB1A 1SE2A 5EE0A 5C0XH 2KACA 1C9FA 1TYGB 3Q8EA 4LK0M 4S3SA 1Y8NB 2DBYA 1QWYA 5J1ZA 2OEOA 1IGCA 1OQRA 5FR3A 2JYEA 3E5SA 1BMLC 3NVWA 2IWHA 2X69A 1X3QA 2X38A 1IW7D 4XDDA 5JEAJ 5CGKA 4YTMB 5ELCA 5JEAH 1I4QA 4KKSA 1V8CA 1LT4D 2BE5D 4MIUA 4QMGA 3T53B 3IFTA 1PZKD 1QOFA 3HGBA 3D4WA 1ZOYB 2V3PA 1TWAB 3FKIB 4ZUJA 3NP8A 3I4NB 2YEPB 1XWEA 2PZUA 4FP5D 2VZKB 1HA5A 1YJIA 3N6RA 2A5HA 2EDGA 2Z1CA 4ILWA 3SK4A 5EPKA 1XX8A 1B3AA 1WRIA 3HP3A 2BDNA 5TSSA 1SYEA 3HVDA 1ROEA 1HZ5A 2B2WA 1KDCA 2L1BA 2WKDA 1WTRA 1C48A 4DAVA 2NUCA 3Q8BA 1HXYD 3RMHA 1R7SA 2I2YA 1VF7A 4JE3B 2M0AA 2KDMA 2QKIC 2JXTA 4XTCS 4GLSC 4ZRQA 3TEXA 3GTGB 1AYFA 2WP9B 4G7HC 2WXFA 3K0YA 1AZPA 1SF0A 2H89B 4ZKBB 1TKWB 4QB4A 1TS5A 2G9HD 1E2ZA 2XRQD 1D5XC 1PRTF 2I07B 4ZOHC 1CZWA 1BCPB 2Y0SB 4L23A 2E2DC 2F0HA 5BN3A 5KYLA 4KHZA 4L63B 3TEYA 3AV8A 4C3JB 1G2TA 1XF5L 3J81E 4RF1A 4X3TA 1UEAB 1J8IA 1GB4A 2QIEB 3AN1A 3NE5B 2WU2B 4ITKA 4OZCA 4XDCA 4R3DA 2O5IC 4A93B 5IGFA 1ESFA 5EBDA 1RF2D 3DWPA 4R9WA 4NMZA 5KRUA 1BBXC 3ONAB 2X6LA 2EY1A 1ZXHA 1DOIA 1HCZA 5CYUA 2R93B 1CQVA 1PTOD 1FGBD 3FILB 4LTUA 2CVRA 4KKTA 1SMYC 4DF7A 4XQJA 1TKYA 1TS2A 2N55A 4WWMA 4XQQA 5IIFA 1CQFA 4H7BA 3QIAA 4Q2JA 2K05A 5C4ZA 2AWNA 2RMMA 3T13A 1VDZA 2L12A 2EY5A 5KGUA 1FD6A 4D2KA 2ZXRA 1QJOA 3HUIA 3BDLA 3SE0A 4HRSA 1KLUD 2FINB 1W6JA 3SEBA 3AEFB 1IW7C 3K58A 4XE0A 1K8MA 3TZDA 2W55A 1H9MA 1HTPA 2D5GA 3PIP3 4WIPA 4X3KA 3CWIA 3I9V1 5HI1A 3TEWA 3CU7A 1DZ1A 4JPSA 3P4QB 4KGSA 4ABNA 5CMDA 1AP0A 1TY0A 1MVKA 3BK2A 4BBSB 4RGNA 4K14A 2DN8A 1SNMA 4A8XC 3EROA 2ZT9C 4F7XA 2QCPX 1LTID 3OWEB 4OIJA 3RZDB 4IUNA 4C1NI 1YN4A 2IL8A 3LWUA 2PO4A 2JA6B 1QOAA 2X6GA 2D2CC 5CR3A 4BWGB 1FD7D 4H0LC 1V97A 2NYZD 4KJNA 4A55A 5BMIA 2C9OA 3M4OB 2E2HB 1FCLA 1OXUA 1GAQB 2EE1A 1ILQA 4ME5A 2OEDA 2F0SA 2LFNA 2WDRB 1QF6A 4KJOA 1JWMD 3S1NB 2WXIA 5BN4A 3GTMB 4ZHPA 4OO1H 1EWHA 3LWEA 3SR6A 1JW9D 5NUCA 3AEEB 3E0JA 2KCNA