3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
1V1OA 2WV6D 1QILA 2R61A 4TSSA 4ZYSA 2SEBD 1JQYD 1MD2D 1PTOF 1PYWD 1SXTA 4RGMA 1V1PB 4RFBA 1RD9D 1AN8A 2NTSA 2RDHA 3BZDB 1STEA 2XRSD 3URYA 1I4PA 1FGBD 3R2IA 4DXGA 1PTOH 1L0XB 1D5XC 2NTTA 1FNUA 1SE3A 3KLSX 1XXGA 1B1ZA 1EEFD 3V05A 2CHBD 1FD7D 1F77A 4O1NA 1LTRD 1PZID 1LTBD 1TS4A 1I4GA 1TS3A 1TS2A 1D5ZC 1KTKA 3BYTB 5ELBA 2XN9C 1RF2D 1RDPD 4RGNA 1DJRD 1LT4D 4RH6A 1BXTA 3CHBD 1S5DD 1S5CD 1V1PA 4RCOA 4L63B 1I4XA 1BCPB 2QILA 1XTCD 1BCPF 3BYYB 3OWEB 5FK9C 4OHJA 1FNWA 1L0YB 1PRTD 4RGTA 1I4HA 1LTID 2AQ2B 1B44D 5D3DA 3GP7A 1LTAD 2IJ0A 1PZKD 5ELCA 1LTGD 3DWPA 1S5FD 5TSSA 1I4RA 2O2LD 1TS5A 1AW7A 3W2DA 1PTOD 2IPKD 1LT6D 2QEJC 2XNAC 3EA6A 1CHPD 5ELFA 3TSSA 1EU4A 5I4DA 1JR0D 1SE2A 3DWQA 1EU3A 4BWGB 1G8ZD 1JWMD 2TSSA 1DYQA 1SJHD 1EFID 1S5ED 2G9HD 3R2TA 4RHRA 1TY0A 2XRQD 3MC0B 1S5BD 1TY2A 1ET9A 1PZJD 1EWCA 4RHSA 1LT3D 1ET6A 1HA5A 2Z8LA 3O13A 1SEBD 1LLRD 1PTOB 1SJED 4NZLB 1D6EC 1T5XD 5ELDA 1SBBB 1CT1D 1KLGD 3BVGA 1YN4A 1UUPA 5FKAC 1RCVD 4DXFA 1LO5D 2AQ1B 1PTOC 3BVZA 1KLUD 1YN3A 3R8BA 1PRTB 1CQVA 1FNVA 1HXYD 1LT5D 1GOZA 1M4VA 4RGOS 4UDUC 3EFXD 2AQ3B 1BCPC 4L6TB 4Z9CB 1LTTD 3BVMA 1ENFA 4K6LA 3SEBA 1JCKB 1PRTF 3MFGA 3DWAA 1CK1A 1EEID 2ICIA 5ELEA 1YN5A 1BCPD 1D5MC 1ESFA 1JWSD 5D3IB 1I4QA 2RDGA 1LTSD 2J4XA 1SE4A 4C56C 1HQRD 1JWUD 1PRTC 1UNSA 1HTLD 1CHQD
chains in the Genus database with same CATH superfamily
1X3FA 2WB1E 2X6GA 2BH2A 3T1HL 1DZ1A 1HEZE 2ZTCA 1PDXA 2JRHA 3AEFB 5JVG3 4A3BH 3CKIB 3W5OA 3RN5A 1JALA 5IWAL 2PW9A 4FJZA 5COYA 2YYZA 2FCMA 5DCNA 4NQKE 3V2TA 1Q12A 4NJ6A 5JEAJ 5CTRC 1EIGA 2CKHB 1SMXA 1Q90A 4MTKA 1I6VC 3FRPB 2HJ8A 3VRBB 1YVCA 5JJKA 1SRUA 4J1MA 1D5XC 1TWHH 2N7JA 1WTRA 2NN6I 2K1FA 2KHWB 4FLHA 3H8HA 1Y1VH 3ND9A 4JBMA 4US8A 2H4OA 2G4SA 4B3RQ 3NS1A 1X32A 4JI1Q 4U68A 3IG3A 1K83H 1WCMB 1ICFB 3P1MA 4YTNB 3SFDB 4ME3A 2B2TC 3K9PB 3PUVA 4JC0A 5ELBA 3TS0A 4JOIA 3CF6E 5KYLA 2ZVOA 2ATWA 5HFYA 1YZ6A 4C1NK 2KX3A 3AE4B 4ULLA 3PREA 4LF8L 1I4XA 1O80A 1QOGA 2DYOA 5EDSA 2PZUA 2KKCA 2UUAQ 3KH0A 3KF6B 4K7UA 5HI1A 2KEDA 4DU9A 2LGSA 4A20A 3M4QA 1GKHA 4JIOU 3S14H 3SE0A 3U2SC 3X3NA 5D3DA 2NUCA 1PFDA 2LUEA 3GP7A 3H0GG 4JYAL 1ZUD2 1QNKA 1P9DU 2WX1A 3PF5A 1T0QC 3HZXA 1UWVA 4K8IA 1KQSA 1S1QB 2N4FA 4JI7Q 3IFWB 4EFOA 1KIXA 2DJGC 4L5QA 1IW7C 2SOBA 1CHPD 3TSSA 2REXA 3Q8DA 1WCMH 1V80A 1KAWA 2UUBQ 1GUOA 1NMGA 1VCIA 3DWQA 4C4VB 1VQNA 2B2YA 3M4YA 2TSSA 3T51B 1PFMA 1UE6A 2QDFA 3RNAC 3ML9A 3J7A5 1GXDC 4RM8A 1K3BC 1TWHB 5G2NA 3L54A 4HR7B 2PQEA 3PIO3 3QG1A 3HEJA 4HIOA 1Z5SB 3KOJA 1Y8RC 5AFWA 3DBRI 2WXJA 3FHWA 2PJHA 1YN4A 1VQ4A 1A70A 1YD8U 3P4QB 1GUSA 1S3OA 4XC2A 3IT6B 3A8JE 4IWPA 4PMCA 3H6NA 4XDCA 3I4OA 3FKIH 1WMHB 1QWYA 3LWEA 2JYEA 3DOWA 3VH3B 1PH8A 2GBMA 3F2DA 3IL8A 2HJ1A 5CHWA 3TJPA 2F3WA 2WXGA 2AQ3B 4B3SQ 2PW7A 2FMCA 2VRRB 3R7RA 1N32Q 4L6TB 2ZJQA 3W5VB 4CHKA 3M62B 3RLFA 3AU7A 1WXQA 5CBEE 2RGFA 2PW5A 4IOAA 3CIRB 3TBLD 3WIMA 3L0WB 2KDBA 1BQQT 1X6OA 4II3B 2HT1A 3KWLA 1QZGA 4MGKE 3DWAA 2E2JH 4Q0FA 2B3GA 1GAQB 2O2VA 3DDCB 4K0KL 1FXAA 1SIFA 1F52A 4R1JA 3NXWA 3WOFA 4PQXA 1UWXA 4PS3A 5DM73 1QE6A 4CKCA 1C1YB 1SAPA 3J9CA 3LNNA 1K9MC 4QIWB 3RULA 3SHQA 1JWUD 3M3YB 2L7RA 4OVUA 3TDQA 2RHQB 2R61A 1MHWC 1BKBA 1SYGA 2L0TA 1I35A 4YCVA 1ZYRD 4KZCA 1PGBA 3SU8X 3QOLA 1Q10A 2JK8A 1VZ6A 3NS8A 3IBEA 2WXIA 2RCFA 2VNUD 1TWCH 3RNUA 5J18A 1KOTA 2KVMA 3P1HA 1PTOH 4FDBA 2CHWA 1L1OC 4A3EH 4NXNL 5KIXA 3ND8A 3OPOA 4GLAC 3HOUG 3A9KA 1D2BA 2PKOA 4LDTB 1U4MA 2L11A 5M3FH 5EE3A 3ABVB 1HNWL 1BT0A 4JW0A 2JT4B 3AN1A 5C3EB 2EMSA 3UGBB 3W5UB 3AE2B 2L9HA 4AYBE 4AQYQ 4DAPA 2PIAA 3OMGA 3DVGY 3QK0A 5GROA 2C60A 2W9NA 3Q8EA 4HPMB 4N6EB 4DV1L 1HHVA 2KFKB 2JQRB 3KDFB 3AM9A 1VDVA 4BY7G 1E3PA 4X66L 1JOOA 1N36L 4H7BA 2GRIA 3I5JC 4DK5A 1WGGA 2INDC 1O78A 2MLBA 1B3QA 5BMGA 3BYYB 1KRTA 5C0XH 1IL2A 5KYIA 3CP0A 2HIXA 4C2MB 1WWTA 4DPGA 1VQLA 3Q3MC 2NZOA 2F0HA 3S15H 4S0RA 2R3ZA 2KUMA 1PFSA 2YTXA 4GZYC 2J53A 2BCOA 1CZGA 4LNQA 2KWDA 5A35A 2HIVA 2O2LD 5GAEC 5BYRA 1HNZL 1AW7A 2N8NA 1NR4A 4R9WA 4FXDA 3DM1A 5LHY1 1PYBA 2VUMH 3GTJH 3H9DA 4W9KA 5IP7H 4BFRA 3ENEA 2I5MX 4DUYL 1K8OA 1MKHA 3Q14C 5F2DA 2F3IA 2A5HA 4XX5A 3ML8A 1TWFH 2F0MA 1TTNA 1HR0W 1S5BD 1C9OA 3I4NB 2ZNVB 4WJOA 2JYTA 1AP0A 1LT3D 2K14A 3C19A 5IYDG 3U8ZA 4IM3A 3PGZA 2E2IB 1XLPA 4ZRZA 4JI1L 1HZ6A 2EELA 4LFAL 4HJ5A 2JEAI 3W1BA 1T6BX 2M8SA 1XX8A 3UI3A 1H9SB 2VUMB 1BNZA 1VDZA 4ZLTF 1VQ7A 4DHJB 3SK8A 3TEYA 4Y7NH 3MZ5A 5L83A 2WXHA 1A3VA 5KNCA 5I6WA 2KVRA 1YN3A 4A75A 2KTFA 3L08A 1PRTB 4KTAA 4OONA 5DNFA 4DWFA 4RGOS 2EIFA 1TIID 3M7NA 2Y5BB 3RNCC 1V86A 1YJ1A 2KLGA 4MNOA 3K5NA 1PFNA 3BVMA 3C8YA 1KDBA 4ZOHC 1IBKL 3DMUA 4MJSB 5IYBG 3RZWC 1R4QB 2ICIA 3A5ZB 2K0PA 2OJRA 2DZIA 3V60A 1L5PA 3MXPA 3ZRFA 4JI7L 3OLMD 1JWSD 1STYA 1PDQA 2F0IA 2FINB 1KDAA 4NW2A 5FO8B 5KNDA 1PH6A 3VA5A 1HR0L 2NVXH 1EY6A 2KOLA 1HTLD 3T1YQ 2N9EB 2KFKA 4DAMA 5E1FA 4GLXA 1MD2D 1IYUA 1PYWD 4OIKA 1UZXB 2V4LA 1WIAA 4C3IB 3MTNB 2ZTEA 2EY5A 2K04A 3E6ZX 4RGMA 4DR4Q 2LJIA 4WIPA 4OX9L 2XGTA 1Y8NB 4BY7H 4F8CB 1STEA 1JICA 2DENB 5C44G 2FCQA 4WJNA 1DOLA 2D2CC 1R4MI 3T9LA 4DK0A 2R2QA 1GB4A 1EQRA 2L32A 4BZAA 2ZZPB 3KLSX 5IY0A 3AULA 1EEFD 1JRUA 3UIOB 1MIUA 1J7BA 2MQJA 3VUXA 3AEGB 3JYUA 1ONLA 2C9OA 1VLBA 3B08A 2BDOA 3WAMA 2WXPA 2ZM6L 3AEBB 3GZNB 3I3CA 3C46A 4PK1A 4F1SA 4I7ZC 5KEEA 3BYTB 3F8TA 2V3NA 3AI5A 4FO2A 3CMAA 3TRZA 2XTIA 4Q5VA 3HM6X 2J0MA 2LMCA 1KAAA 3TP5A 2BF8B 5LMNW 4A3KB 1V81A 3MP9A 2Z59B 4JI0Q 1VQFA 2JEBI 2PTLA 1IBXB 3CCVA 1RFKA 1FNWA 2Z6BA 1XMOL 1PH5A 2Z6KC 2BKRB 4RGTA 1QCBD 4ZAIA 1NMFA 1CZWA 5M3MB 4DAYA 1YX5B 3V3XA 4G7OC 4PNYA 3OIQA 3L17A 2K05A 3A56A 1WTWA 1L0VB 2IL8A 2LHEA 1L0WA 2R92H 1E0ZA 1M90C 4L23A 3DWPA 2D5DA 3CCJA 2L3ZA 2QDLA 5IOIA 3IFDA 3S24A 4AIMA 2A68D 1FRRA 1P98A 4IOIE 5G3LF 3UE0A 2MRPA 4ANWA 1PVOA 1EF1A 2GI9A 3NVVA 2BW2A 1HFGA 1P3QU 4K7SA 2V1CC 4BA1I 2QF7A 4PZ7A 3NVZA 3ZDTA 2HHHQ 1JWMD 1TWGB 5C3EG 2F0JA 3R2TA 4F7XA 3VHTC 1EWCA 3PLVA 2Z1CA 1YIJA 4MT5A 1LLRD 2JE6I 3DCGA 4NZLB 3PUXA 4NDXA 1LABA 4P72A 3Q23A 3GQBA 5FLXc 1ILQA 1ILPA 2AUKA 1MI2A 3F1ZA 5BR8Q 1Q81C 2ZCBA 1I3QB 4JPBW 2M4NA 1LV9A 4M00A 1L1OB 1Z6HA 2FXQA 3J7AF 3HUIA 4PV1C 2NVYH 3J80E 1MBYA 1SDFA 1LM8B 1DM0B 2F0SA 5EE9A 1SMYC 4K2LA 2I0QA 5CR3A 1SNOA 1TKEA 1GOZA 1ZKHA 1AFPA 3QJZA 4C4VA 2A69D 2WXNA 5J1ZA 3SFEB 1YJNA 4Q2JA 1B9RA 1EIFA 1F2RI 3PO2G 5DPRA 1VQ8A 1WGHA 1BUVT 4ZKCB 4IWOA 4N58A 4DBGA 5JHBA 3MFGA 3W1YA 3X23A 5H8YE 2B63H 1W6JA 5C23A 1GB1A 2PEAA 1IKLA 3S1NB 1XNRQ 5E6PA 3CCLA 2CFMA 4MHEA 1KJTA 3PT2B 4W9GA 2EY1A 2FFKB 2ICEC 2NVYB 1LM0A 2B2VC 3V6EB 3CU7A 3SD5A 2VUMG 4DR7L 1OFFA 2I07B 4KD4A 2W3SA 3VAWA 3H1UA 3R2IA 3RMHA 2AWOA 2DZJA 4MACA 4ZK9B 3MHSD 1U4LA 4QUCA 1RAXA 2JA8H 1MJCA 2WB1G 4IZ8A 2EYFA 3I8ZA 1H95A 2K6QA 2V3SA 3PLUA 2VQEL 4A6QA 4ID6A 5CMDA 4YWLA 1MG8A 2J7ZA 2YEPB 4JI5Q 4FF3A 1OTRB 1HNXQ 4ABNA 1FPYA 2E6XA 4X65L 3G6EA 1D5ZC 2WU2B 2OEOA 1JJGA 2HDEA 2DYBA 1RDPD 1IXRA 2EPBA 2FMMA 4DKAC 1S40A 3VR9B 1EUJA 2RPVA 4W9CA 1N8RC 1R4NI 4MM3B 2KCTA 2KDEB 4IUUA 3WAOA 2A68C 4XWTA 5E3FA 3K7AB 1TU2B 2W55A 3DUZA 4Y7NB 1VQOA 3S1RB 2EMTA 4CKBA 3ONSA 4GOCA 1C79A 3VDZA 3EUB2 1BBUA 4NKLA 1TKWB 4C3IG 2JZZA 1PH9A 1LTAD 5BYQA 4N8X1 2C7HA 5BN5A 1X1MA 4QAYA 3VA7A 1HCZA 2JP1A 2SAKA 4PG3A 3KW5B 3QAQA 2JA9A 2R93H 4AP4C 4AJYB 2A6EC 4EZJA 4UP7A 4LK1C 2ZXRA 2XVSA 1EU4A 3H7SA 2WXRA 2ES2A 1EY4A 2KVZA 3VUWA 1OGWA 5C4JH 4XGAB 1NSNS 2G9HD 1EYCA 1T0YA 4GLSC 1AE3A 4HTHA 5JEAG 3F2BA 1R9TB 1SB3C 4W9DA 4IUNA 4C1NI 3DEPA 3BK1A 1E2ZA 1XPRA 3IHPC 4TMAB 3J7ZC 4A3GH 4A3FB 2XIWA 2RA4A 4DF7A 1VQMA 3U7ZA 2AX5A 2Y0SE 3RPFC 2I2YA 2D10A 3HOYH 1PH1A 2LVPA 4A3KG 3UF8A 1QJOA 4JCVE 2UUCL 1Y1WG 3WANA 1RCVD 1X56A 4C3IH 3T53B 3NHEB 3S1QH 4KN4C 3K0YA 2ACZB 4BKSD 3M9BA 2JQOA 2Q2IA 4B3SL 1HZCA 2K8BA 4DA2A 2RKSA 4DV4L 4APVA 3NZSA 4WFN3 4JI0L 5AJ3Q 1N9WA 4FULA 5M3MG 3P20A 2LEKA 2BB6A 2CWAA 2B3AA 5LMNL 1XMOQ 4BY1B 2B29A 3AV8A 2BA1A 3UDIA 1DOMA 3PIOA 2WFWA 1RFAA 1V5OA 1CUKA 4HMJA 5EKLA 2VZKB 4L1BA 1EWIA 3FKIB 4GIVA 1JJCB 2KT7A 1KL9A 1QOFA 1ZW7A 3TS2A 4B6WA 2E2DC 3BS1A 4DV3Q 4A90A 4PYUA 3TP8A 1HJPA 3CCEA 3IFTA 1XEEA 2WQYB 1LTSD 3EECA 3V96A 1AZQA 4C56C 2IBIB 3A33B 4DR1Q 4ARCA 1BDOA 2EXDA 2B2WC 2K33A 3NSWA 2VW9A 4NY0A 1CI3M 2OWOA 2DWQA 1KFYB 1RTNA 3J81j 4X64L 2IHFA 1TWCB 4YWMA 3VQIA 4GNXA 5JHAA 1FFUA 2XWJB 3AB9A 3KQ4A 2ZPYA 3TIXA 1MG4A 4HPLB 1GHJA 1QG7A 2JXTA 1EO6A 4J6HA 4ANUA 2MUYA 2QDBA 2CHZA 1J0GA 2JVCA 4K81A 2E5LL 4HAEA 2F4IA 1SNMA 4ZQ3A 2Q2TA 2VXWA 2N9LA 2BE5D 1E8YA 1UGJA 1LTBD 4HJ7A 2DYMA 3Q69A 4LF4Q 3GV6A 1WVLA 3KWVA 1JQ4A 1QT9A 1FFVA 2BTEA 3PO2B 4DR5Q 1IP9A 4B9XA 2O6VB 3VTWA 1RF2D 2PQAA 3J81E 3GTMH 1DJRD 4PS7A 2E74C 4KKTA 3EC8A 1O7YA 4JVZA 2EJGC 2DLBA 2IO1B 2SDFA 2LFIA 3KLRA 2IO0B 2CWPA 3NQTA 3RNEC 5FK9C 1YQBA 5MPOA 4OHJA 3MJ5A 2EJMA 3M63B 4BBSG 1XNRL 4YHHL 3A8KE 3GS2A 3ZNHB 3N6RA 2V9HA 1E22A 1SSNA 1BVSA 5IT9E 3S1MB 3EROA 1LGRA 3AEDB 1PH2A 4WWPA 4B0EA 1V5TA 2F0EA 2GVBA 1I4RA 1IYFA 2JWZA 2KC1A 1P1AA 3CCSA 1LT6D 1OXTA 2I1KA 2RPQA 1Q1BA 2K1BA 3EQLC 3LGJA 4RAUC 1OQQA 2PO4A 3CC7A 2KD0A 2LWPA 2KANA 2RR9A 2PYKA 2RQXA 3PRMB 2CKZB 4BBRH 3LX0A 1DYQA 2LUMA 2N9PC 1STAA 1SYCA 1EWYC 5IP7G 4A3JH 4RHSA 1GJXA 2M2LA 1JWAD 1WGRA 2L00B 4YSYB 1NBFC 4TVAB 2OJWA 2Z9HA 1NEKB 3S1NH 1T5XD 4YTMB 4C00A 3A7LA 3RN2A 4LUVA 2KJRA 2ZW0A 1ZXIA 1E7PB 3MXNA 3AEEB 3ZNID 4PYZA 3DEOA 2PVGC 4IN3A 5IN7A 2QKIC 3CF5A 2N1WA 3HOZG 4JK1C 4CDDC 4YWGG 1HH2P 2ZW1A 1SE9A 1TYGB 2KDFB 4H0LC 3W1SA 3ZIMA 4MDKE 1HXYD 1R4NB 1XF5L 5C1ZA 1SGHA 1PMRA 5M5YB 4IJHA 4XXEA 2MCNB 5BYSA 1K8RB 1DGJA 2WXFA 5IE8A 1X54A 3MEFA 4WWMA 1EY9A 5FLXL 2JXXA 2GB1A 3P7JA 4KHPQ 2DUDA 4HJ9A 5DPWA 2WP8J 3TP7A 2UXCQ 1D5MC 4M1UB 3T16A 4WQOB 1U0LA 2KWUB 1WD0A 1XLNA 1L1OA 3RNBC 1K53A 1KRSA 2PZTA 2N7DA 4CDFC 4ZRKA 1CHQD 4G4KA 1P7EA 5FO9B 1C9FA 1YNJD 4K7WA 2KTRA 3UDFA 2Z6KA 1GM5A 2NZHA 4A3FG 4RFBA 4ILWA 1F9JA 1IPGA 4KZ0A 2NTSA 2KBNA 3T1HQ 3HOYB 1K50A 3UDGA 3SR6A 4DR6L 1Y1WB 2K39A 1NY4A 3KJOA 2GBKA 3AB5A 3NE5B 2A6HC 5HY6A 4XYCA 3NEMA 1ISNA 4JX1C 1QNUA 1G2SA 3QWNA 4J6IA 4EEWA 1A0IA 1I94L 4LF7L 3KK7A 1Q5WB 2MO1A 2WACA 4KGSA 3I4MH 4D2KA 5AJ3L 1KNAA 4JBWA 1FEHA 1YJJA 3AEAB 3DVGX 1TS3A 3HOZH 3JSVB 3PZ8A 3QJYA 3DQVA 1DOXA 3PCOB 3PRZA 3IKJA 3E3XA 1AE2A 1EZ8A 2FJ2A 4PMWA 4IFDG 1VJKA 2R93B 4OGQC 1B53A 1XCTL 3OAWA 2NCNA 3EFUA 2OQKA 1A5RA 2K50A 2K8CA 1VQAA 4FNFA 3W1SC 1G51A 4OWXB 4R4CA 4HVBA 4W9JA 1K8AC 4IJLA 1YNJC 3MHZA 4FJYA 3TBIB 2AKWB 3AQQA 4G3XB 4K2KA 3CC4A 2JPHA 1MGSA 1WTOA 2NBUA 4TV3A 2NR2A 1EY7A 3W3AA 4QCLA 1CZPA 1FRDA 3IXSA 4GMVA 1A15A 1YEZA 3J80L 3C1FA 3HRZC 3HKZB 5FJ8H 2O5JC 5IP9G 3IAM1 3MJWA 1PFBA 4XYQA 1FVIA 2UWQA 3U52E 5TSSA 2LKVA 3T3OA 4KSLC 1UF0A 1F9PA 1A2TA 4JYAQ 3C0RB 4LWCA 1I3QH 2MQHA 1AYFA 1MPEA 2INNE 4KGTA 1VQHA 1SSOA 4X62Q 2OTLA 1IYVA 1YNND 2IGHA 3CAMA 1A63A 1KF6B 1SJHD 3HOXB 4JI4L 1E7UA 1GC6A 2FHTA 4MSQB 2KNBA 3HP3A 2DZMA 2L8JA 2WXMA 4GU2A 4A3IH 2QGQA 4TQUS 4OO1H 2SNSA 1UELA 1EZ6A 1K8GA 4IUTA 2PNHA 4DV5L 3BWUD 2ZJDA 4EOYA 1XNQL 2JUOA 1L7YA 4OWTB 1T3QA 3VR4A 4FP5D 4YSXB 3I73A 5C0XG 5FLXE 4LF6Q 1M4VA 3T56B 2XWBB 4YHHQ 1EOTA 2KQ7A 1BMLC 3JAMc 3U9OA 1Q46A 5CV8A 4WJ4A 2MJDA 4WWNA 3OTOL 4P71A 3RUIB 2Z4HA 3PO2H 1VQKA 4LJOB 4P1BC 2KECA 2EYMA 1L2NA 2JWUA 2KA7A 5FJ8G 3IRBA 4G0NB 2IYDB 2WIIB 2E2IH 2LXAA 3JSVA 4LFBL 5NUCA 2EZVA 4K0KQ 3AECB 3HGBA 3SDZA 4CGYB 3PO3B 2WX0A 3ONAB 4JI2L 3LWUA 4TSSA 1I6HH 4A93G 1FIQA 4GSWA 4K5WA 1LFDA 2L55A 2HUGA 3CRKC 3E0EA 4JWSC 3OG5A 4TRDA 5IKCM 4KY7A 1XMQL 2AL6A 4TKNA 2GA4B 2MH7A 2Q8TA 1FGBD 4B0MA 1T0RC 4WWOA 1FGUA 1ENCA 2RVLA 4B3ML 4HLEA 5HGQA 3I55A 2M56B 3ZYYX 3JAMi 4O1NA 5C3XA 1E0BA 1BR9A 4IWQA 1WYWB 2WXLA 2L0CA 3AFQA 1Y8PB 5T1GA 2GLSA 4KVGB 3X3MA 4O0AA 3ECIA 1GC7A 3H15A 4RKBA 2SNMA 1C4QA 3WWVA 4KDLB 3BIID 1JORA 1KABA 4AQYL 3B2GA 1TIFA 3C3LA 2KCMA 2R92B 3PIP3 1S5DD 2DNFA 4IM0A 2OQ0A 3MC9A 2JA7H 2MFIA 2K5PA 4KIKB 3E9IA 4X3KA 3J80i 2UXCL 1LQBA 3UQAA 5E7NA 4DR3Q 2R2OA 2XBBC 1I4HA 3NOBA 2MBQA 4ME5A 1C48A 1LACA 1BBWA 3HOWH 4KKSA 5ELCA 3CMMB 1SYFA 1WTPA 1XLQA 1JJ2A 2NWGA 4G7ZC 3CQZH 4LF9Q 5IYBH 2OXPA 1TS5A 3GTQH 1HA6A 1E2VA 3W2DA 5C44H 2O4XA 4U673 2JN4A 2Y0SG 4DR6Q 5IGBA 2BA0A 2D07B 4NXML 3I9V1 1GJZA 1L4ZB 4N9PA 4A3JG 4GGQA 4JPSA 1N33L 2NPTA 1DONA 5IWAQ 2WNMA 2L1AA 3K0XA 1ET6A 1R4MB 3ZUNA 3EFCA 1UGMA 2B2UA 3GTPH 1SF0A 1II3A 2D3BA 3AE3B 3APDA 1Y1VG 4BOZB 3CQZB 3K6OA 2PI2A 3RZOH 2BQQA 3QOJA 4GKKQ 2RCNA 2M1MA 2PI2E 3HVDA 1WD1A 2K5HA 4BY7B 3P4RB 2BDNA 3LYYA 1A8VA 3PHXB 4LTUA 1D3ZA 4A3DB 1LO5D 4UAIA 3IAYA 2M17A 4LFAQ 2EKIA 2K5WA 2MX2A 1WE7A 1UD7A 3Q3FA 4K8JA 3OMCA 4A3LG 2IY0B 1SYEA 4DUZL 1F1HA 1WM2A 2N55A 3K9OB 4GN4B 4S3SA 3S2DH 1B50A 2LVOA 4A3BG 2YTVA 4LNIA 1HTQA 2JA7B 1BCPC 2RMMA 1B70B 4TUUA 3HKSA 3D6CA 2O6VD 3DVNV 2I46A 2NVQH 1G2TA 2KMAA 3N3KB 5E6OA 2N78A 1WYGA 2ZEQA 3N1YC 4KD3A 3D4RA 2OEDA 2ZT9C 1QB5D 1E8WA 2UUAL 3P75A 4MN3A 2RD0A 2BPSA 3BZKA 2WWZA 3I3TB 1SE4A 3S2DB 1YQ4B 1FCCC 3TUOA 1PRTC 1PA6A 4B3TL 3I4NG 2JJQA 3J81L 1N5WA 3AXCA 3GTKH 2EXZA 4BBSH 1EL0A 4EE2A 2M9VA 1ROEA 1ZXHA 2FCSA 4YSZB 2K75A 1SN8A 2KDMA 2WDTB 3D8GA 3ZTDA 4NPSA 3B2FA 3T1YL 1OXUA 3FMCA 5DAUA 1RD9D 3BZDB 3STBC 5C4ZA 1PH3A 1XLOA 4KDIC 5J3BA 3T4AC 3HOVB 2BWES 3AEVA 2Q8RE 1I6HB 1BO0A 3L0OA 3GTPB 3NQIA 2WKCA 4DV5Q 1B9NA 1CKNA 2A19A 3VYRA 4LF4L 2ASBA 3DWMA 5D94A 2KX0A 4R4TA 1FD7D 1TWFB 1WOCA 1TXYA 3PV0A 1JB3A 4LW1A 5EKIA 3L13A 1JWBD 1TGZB 4IALA 4CJ0B 1WE6A 2KJ6A 2YVCA 4RKLA 5LL6X 3N20C 2LSSA 1NR2A 5EQ0A 1U4RA 3KYHC 3S2HH 1E7VA 4TQ1A 4JGHB 3N52A 3CPWA 2N9XA 4CO7A 4XDXA 3VR2A 2W54A 2ZM6Q 4QB4A 3DBSA 3PGEA 3H91A 4IPDA 1OEYA 3CHBD 5E6NA 2F0NA 1L6UA 2QW7A 4IUQA 3G4SA 2KQ4X 2UXDQ 1EYGA 4LJPB 1A6XA 1NNXA 2EOTA 4GDKA 1CMXB 3GE3C 1L0YB 1VR9A 1Q86C 2D11A 3E56A 4S17A 2MP1A 2VB3X 4EGVA 2MBOA 2N49A 5JH5C 4H02A 2A73B 2F0DA 4HEDA 1AARA 2KK8A 2N9KA 1H9SA 5LLIA 5FR3A 2J0TD 3HRDD 3TL5A 2H89B 3V61A 5D14A 4RG1A 1IZ6A 4C3JG 1HUNA 5JAVA 3KUDB 1S5FD 4HRSA 3TCAA 2PVOD 4W9EA 5C2TB 2AUJD 3T3NA 2A6ED 5ISRA 4OWWB 2N7EA 2QIEB 2JA5B 1XMQQ 2RDFA 2PMZB 3IT4B 3KFUA 1JB7A 4G11A 1Q82C 2CU3A 2MBEA 2F4VQ 4ASWC 3ZJYC 3FPUB 5I4DA 5EBCA 4BWGB 3J81c 2V1YA 2Y5CA 1U4PA 2G5DA 2WYQA 1ET9A 3OJ3A 1SMYD 3RZFA 3LB8C 4LNKA 2AHOB 1CA6A 4JLCA 4ZYNA 1KDCA 2QEXA 2L83A 3F2UA 2A5UA 4CYEA 3HKZE 3BVGA 2UU9Q 5JJLA 1N6ZA 2MJ3A 2X6LA 4FF4A 3AU4A 2DGYA 2KYWA 2BS3B 3QQ8B 2N88A 4IPHA 4UP8A 3S16B 1KXLA 1QZHA 4AYBB 2X8XX 4FF1A 2NZ1D 3QR8A 1WTVA 1CKMA 3OOCA 4A3OA 1CM9A 2I5HA 4HCNB 4A3KH 3RNFC 3R66C 2DBYA 3V6CB 5AZFA 3VXWA 1KHIA 1IKMA 4IUMB 1FMAD 2NMQA 4K6LA 4P74A 4P2CB 3J81i 4G7HC 1QKZA 3GZNI 5J2RA 1TT5B 3WDNA 1BBXC 2DHZA 2HD3A 4KLKA 2LMCB 3DBHB 3KUCB 2KQ3A 4NP5A 4HJ8A 1WZ0A 3GE8C 3WCQA 3SGIA 1P7FA 2PNRC 4A3JB 3OW7A 3GTLB 2K3UA 4NXMQ 5ELNA 4BBRB 3I70A 2SEBD 5ELOA 4EQNA 2MSED 1N33Q 1Y1WH 1Y1VB 3W1GA 1WJNA 2HDLA 4LDTD 2TMPA 3S17B 1NE3A 2J52A 2JA8B 4UP9A 3DLLA 1PYSB 2ON8A 1SNQA 2XRSD 1J5EQ 4A3DG 2LRUA 3DBLI 4GDKB 5HHDG 3UIPB 3HVZA 4X3SA 4IQZA 4R4IA 3K58A 4IDIA 4KV2A 1FNUA 3EBEA 5C5LA 1H9MA 1XXGA 1VQBA 3C2PA 2M19A 3H0GH 2F52A 2YU9B 2A74C 1U5KA 4K6DA 4A3BB 2JA7G 3R7QA 3PPAA 2R7ZH 2X38A 1F0ZA 1OXVA 3MHBA 2L12A 1YITA 3NZ3A 2G1EA 1NUCA 2VY3A 3OJ4B 3P4PB 1A3TA 2JSOA 4O42A 3I7FA 1YJIA 2RSOA 3GTOB 2IX1A 2B63G 1QVGA 2DAJA 4DN4M 2KQSA 4EVOA 5IYCH 3FILB 3MXGA 1QUQB 2JRIB 1E5WA 2HTHA 3DHQA 1TZOA 3M7GA 4PZ8A 4C3HH 3UDXA 1F2RC 3ZRCA 5LNK1 5IT9c 1SLJA 3A9KB 2F0WA 1NI2A 4QIWE 3IAS1 4IURA 2FUG1 1VQPA 1V43A 1V9PA 1Y56A 4QGUA 4HK2A 4A8XC 3ZLZA 2B39A 2WS3B 2ONQA 2JZ3B 1VMPA 4YL8A 3R93A 4X62L 1Q3LA 1NYQA 2DNCA 4DV2L 2BT6A 4EUTA 4EZLA 1HR0Q 3I4NH 1C4AA 1RKNA 5IGEA 4LNNA 1WX9A 4WORA 3SVMA 4A3PA 3VR5A 3BZCA 5EBDA 3QIAA 2IHEA 1F2MA 5DLQE 2DY7A 2OTJA 3CCMA 4F87A 1TY0A 2MPMA 3GTJB 4XWWA 4WJPA 2LZ6A 2MBHA 5DM63 2VL6A 1E8XA 3O13A 1ZEQX 2HCIA 4R4QA 1CKOA 1XNQQ 2JZPA 2KWCA 2UU7A 1GNUA 3ZXRA 1W2BA 1S4ZA 2KN4A 4GKJQ 3A4RA 4KIKA 1VQ5A 2JA5H 1EUVB 5LMUQ 1K52A 2DJFC 1VCBA 4BKTA 4FXKC 2E75C 1N61A 1EYDA 2VQFQ 1PTOC 2F0GA 4LF6L 3Q8CA 3A74A 1VD2A 2JSVX 1VQ9A 2D5GA 4CJ1B 1STHA 3PS6A 2NYZD 5EKKA 1QF6A 3AMUA 1WR1A 1T0SC 3CWIA 2MJ8A 1IBMQ 1YQ3B 1ZE3D 3ZNZB 2Q2UA 2QA4A 4DR2Q 3VUYA 2JYOA 1BOSA 4C3JB 1WM3A 2Y3AA 3BU2A 2F0QA 2AMCB 4KJNA 4A3DH 2MWSB 3ZXVA 4RM9A 4REZA 2F0KA 1X9NA 3A5UA 4LFBQ 4OEMB 3NBHB 1XYIA 3K57A 5M5XB 2B76B 1I4QA 2F3VA 2G9DA 3J7YW 1WF9A 2NPTB 3H6MA 2FIDA 5KGUA 1PV4A 1UNSA 3NK9A 5AEKB 4DV6Q 3EVQA 4GB9A 3PHWB 3D4DA 1PTOF 1IHZA 1SXTA 4R4OA 4K14A 5HURA 4DR1L 4GN3B 5GAHC 2D3GA 4LCDE 3SK5A 3KLSA 2NN6H 5KRUA 2RDHA 2Z0SA 2PCFB 4IG7B 1WH3A 2VZAA 1WXSA 4B3MQ 3J7AV 3GTQB 4DXGA 4X3UA 4YTPB 3KF6A 4POGA 3ZKJC 3J80c 2NTTA 1MSHA 2PMVA 4AYBG 5D6JB 4A93H 1QLBB 3ULJA 1RIPA 1Y69U 3FC4A 1XPOA 3UI2A 3S1RH 1H4RA 1WX8A 4B08A 2HD5B 3AE7B 4KKUA 1KTKA 2E2JB 1FXTB 3GOEA 4V0BA 1M1KC 4O2DA 4WJQA 1EY5A 4RGNA 4QUFA 3PUYA 3NELA 1CSQA 2B2YC 2DN8A 2LFNA 1FO4A 4RCOA 3H7PB 5JOBA 2V0GA 1ZYRC 1RJTA 2KJHB 4CDEC 2QILA 3OWEB 4A4IA 5KHOA 3I2ZA 4BS9A 5IGCA 4MELA 3ZGZA 2K4KA 4PMBA 3L4PA 4FN2A 2EYHA 3DVNU 1LTID 1VF5C 3S1QB 2AQ2B 2C35B 4LF9L 1LYLA 3Q8BA 4OIJA 2IX3A 5JVH3 4XE0A 2K6DB 1SNPA 1Q1EA 4A3FH 2B8GA 1H8CA 2JX5A 2FNJB 5D7GA 3Q8FA 4A3MB 2IPKD 3EA6A 3S2HB 1WXVA 1FR3A 2RF4A 1FJGQ 1GO3E 2QJLA 3SR1A 4A3CH 4ZUIA 4K3CA 2FCNA 2LXJA 1J8IA 1EU3A 1V6EA 4ZRIA 4NAWA 1E8ZA 1EFID 1NI3A 1HTPA 4RHRA 3PO3H 4JI3Q 1BUIC 4HJGE 3AYHB 2O6VA 3QO2A 3BDOA 1SR3A 3M85A 1LUZA 5M9OA 3I4MG 3VR6A 3QA8A 3ZW3A 2WKDA 5G5GA 2W3RA 4DAYB 2K25A 4H2AA 1RWSA 2NVUI 2B63B 4ZRJA 5LXIB 2J7QB 1CT1D 4KJOA 5L37A 4USAA 5EAYA 5C0XI 4F88A 4IM2A 4UY8C 2AQ1B 3JVZX 4FBJB 5M5WH 4BBSB 2KDIA 4C3HB 4LF8Q 4PS8A 1HNXL 3RCZA 3RD2A 2FAZA 2K32A 2O5IC 4X65Q 2EJFC 4GNXB 2FBWB 2LASA 3JAME 1Q7YC 1UH6A 1FL0A 5JPMC 4LNOA 3GV3A 2IY1B 4A3CG 1YI2A 1B4OA 3E9HA 3GTOH 3I56A 4XT1B 3A1QB 5IYCG 3APCA 4IFDH 1I50B 2EY2A 3I72A 2GN5A 5CBAE 4H44C 4BKSA 1BCPD 4IW0A 3F2CA 4B3TQ 3MEHA 5EE1A 3TN2A 1WTHA 4DV2Q 4A3IB 2WINB 4ZCKA 2RDGA 4EQPA 4L5TA 4KHPL 3QCAA 1B8AA 1TS2A 1E2WA 2E2HH 2UUBL 1I42A 2R7ZG 4BKGA 2WV6D 1VF7A 1TWGH 4JG2A 1XD3B 3BY4B 4FF2A 3WALA 1EIYB 5D2MB 4E3CA 4POFA 5M3FB 3TEWA 4W9LA 3OIPA 3BG3A 2L76A 4L8JA 4I65A 4LMQD 3S17H 2EYJA 4ICUA 1WSPA 2BWFA 4WRDA 3Q3OC 1I4PA 5C3WA 2FUHB 5TR5A 2NVTH 2ALYB 1L0XB 4K5XA 2GOWA 1EM7A 1CQFA 1RRBA 1ZKOA 2Q2HA 5E4XA 3NUHB 2VQFL 3ZNGC 3K59A 4MTNA 3WOEA 1IBLQ 2D3AA 2I1JA 2BYTA 2MJEA 1ZXTA 1C7YA 2PMZE 2DY8A 4I7AA 1PZID 3FPPA 5C4JB 4CKEA 4L5RC 2WU5B 2KN5A 1I4GA 1IBML 4HJAA 2EYLA 4A3EG 1N63A 4DNIA 3HHMA 4YIJA 5G3LD 4KY5A 1N32L 2UXDL 5C6AA 2BH8A 4NMZA 4FHJA 3U4EG 1EIHA 1LT4D 5C4HA 1S5CD 4HCSA 3FAHA 5EPLA 2XSCA 2WGSA 3NVYA 3KBGA 1XTCD 3MXNB 3K5OA 4XQJA 2JA6G 1U4AA 5CV5A 4HDQA 2KJXA 1O7IA 4M02A 1V97A 4W9HA 1EF5A 2KAJA 2KTRB 3VYSA 2MBBB 2OHFA 1VQEA 3VYUA 3NG0A 2WAQG 4NPNA 1Q8KA 1JT8A 3ETRA 3TP6A 1N60A 4MIUA 4MH0E 2KACA 1UEAB 3HOYG 1NDDA 5IGFA 4DV3L 1MFWA 2K8HA 1VQJA 3E0JA 4LUOA 3N1XC 4FXCA 2DNEA 4V190 4E74A 3NY5A 2MA9B 1MJDA 5GAGC 2NBVB 1KD1C 4AUQC 1VQCA 1XWEA 2KFJA 2LI5A 3DHGC 3ZJVA 3K5MA 1KM7A 3MAQA 4TQ0A 2JXMB 1YHAA 3PMFA 2F0VA 4J8QA 2UU9L 4W9IA 4HIDA 2EKEC 2HDMA 1CTMA 2K6AA 3KF8B 3B6YA 1TWAB 5ELDA 4JI4Q 2L4NA 2R93G 3DBHI 3PV1A 1F9QA 1K3RA 3G6JB 2E5LQ 3JAML 4HJKA 3T8MA 2E8GA 4E6IA 4DK6C 4MEMA 4BOSC 4K5VA 5M3MH 3BDCA 2LS01 5I9OA 2QCPX 1STBA 1KC8C 5FO7B 2BGFA 4RCNA 1CA5A 2QCZA 3D6WA 4GNXC 3K5LA 1STGA 5CV6A 4OO1I 4UDUC 4KGRA 3EFXD 4DK1A 1Q8IA 3A7AB 2LJ5A 1YNXA 1EYAA 1WCMG 3HKZG 1LTTD 2N3SA 3LJ3A 5M5WB 2LGDA 4MZ9A 4QJFA 4IKGA 4UHVA 1YHQA 2CU1A 2ZCCA 4DV0Q 1ICWA 4FADA 3NJTA 4AJWA 4K1RB 1EEID 1DD2A 1Z47A 3OTOQ 4C7ZA 2ZPNA 5J39A 2CJNA 5D3IB 4WJWA 1MVKA 3CRLC 4ZRPA 3L16A 1SROA 3K81C 1VS0A 3HOXG 1FXIA 3I90A 2IO2B 3QX1A 2IW3A 1B7YB 5CORA 1AWDA 1WXAA 2FE8A 3VYTA 1EFWA 4AOFA 1W3SA 3I4MB 3RR5A 4JI3L 2KHIA 1J5EL 1P0RA 1E90A 3A8IE 3H0GB 1V1PB 2X69A 4KMUC 2YU9H 1QOBA 1E1TA 5AZGA 2CW0D 3MTSA 4JI2Q 4A3LH 2D9UA 4X6AH 4FYDA 2KZRA 4P73A 1IBXA 1GVPA 1TT2A 1UE5A 2LRWA 1OTCA 4P7IA 3BINA 5AUIA 1J9OA 2K5NA 3K80C 5BN4A 4KY6A 4HN7A 3GTKB 1KRHA 1EY0A 1SE3A 2XK5A 2YLMA 1TVXA 4KKJA 4DFAA 3PUZA 5I2XA 3QWZB 1YNNC 3HG9A 1K51A 3AE8B 5HKHA 2QHOA 3K7UC 1VQIA 4XYOA 2MW5A 4JI8L 4IUPA 2I38A 1RYJA 1JOKA 3ICEA 5JXVA 1R7SA 2CS4A 1NYRA 4BXXH 2J0JA 3UINB 4B9KA 4EZKA 3RMKC 2BE5C 1TKGA 2ZNVC 1EQQA 2CQAA 3OSOA 4KX6B 4LK0M 2VZKD 1X3GA 4A3IG 3AE1B 2A8VA 4J15A 1EQTA 4JV5L 4HCPB 2KEEA 2GVAA 2GBNA 2ZTDA 2WLBA 1E1OA 2MGSA 3PO3G 1NENB 3RFZB 1YOVB 5C3EH 3HIZA 5IOCA 4A93B 2Z0DB 4DR3L 1PZKD 5M3FG 1TZ1A 2NBWB 3HOUH 3HS0C 5DPTA 3SXHA 4DR4L 1B9MA 2C5LC 4WAFA 3BJUA 4OX9Q 1PH7A 2F0UA 1DOIA 4YXDB 4GS3A 2PQAB 1J7CA 1ZOYB 2C7NB 3KUPA 2IZVB 4W9FA 3QIJA 5I6YA 3A9JB 4ALPA 3ZQ4A 1DGSA 2BVCA 4DHZB 2G45B 3TQYA 4WURA 1A3UA 3TMEA 1SFOB 2UXBQ 2GBJA 2IO3B 1TY2A 3M3YH 4P6VF 3AE9B 1HA5A 4GKJL 2Z8LA 4X57B 1RODA 3KDFA 4KHVA 4ZDVA 2K03A 1F2YA 3VR3A 3CCUA 2L05A 2VH2A 3M3JA 1C8CA 4ZKBB 2K7VA 3DHIC 4B9WA 2R92G 2NN6G 1ZP0B 3Q2AC 3NRZA 3Q3NC 4NJ7A 2Y5PA 2K5VA 4ZHPA 1I5FA 1WRIA 4DHJD 1KLUD 1RL2A 1LXDA 4JE3B 4DQOC 1SYDA 4R3DA 2E2HB 2B2VA 5FOBB 4BY1H 2NVXB 4NNJB 5HG2A 2D0OA 4AWJA 3RD4A 1UEBA 4HIMA 2D3CA 4KV6A 3KJPA 4HDOA 1ML0D 3Q24A 2AYOB 4OVZA 4HMIA 3AU5A 3TMPB 2D0PA 1I50H 2XK5B 4HSPA 1SIJA 4DDID 3B9JA 4HWIB 4QL5A 1X65A 2Y0SB 5ELEA 4M8AA 3MVVA 4JBKA 3RN9C 4LFCL 3D4WA 2BKFA 1D1IA 1Q1OA 3AH7A 3N32A 3DBRB 4RA8A 2LHDA 4II2B 2YTYA 2B2UC 2J0KA 3M4OB 2MNAA 3B0AA 1SFOH 3JC66 1ZDXA 2D2QA 3I91A 2HHHL 4A55A 3C1EA 5I2YA 3RLNA 4WH4A 4DV7L 1GUWA 4ACFA 2R6GA 1J7AA 1RTOA 4NXNQ 3DXJC 2PZWA 4ICVA 1MI0A 4AH6A 4JOIC 3NWTA 5BR8L 3A1QA 4BBNF 3FEWX 5JJIA 2C7MB 3VTVA 3UQBA 5LXHA 1X55A 5BMHA 3BDLA 2CCZA 1F77A 3A0JA 1EQVA 5IODA 4I6LB 4KKIA 1TS4A 4XIGS 4IO9A 1ENAA 3N9YC 2KHSA 3CD6A 1N36Q 3ITPA 4X66Q 2H88B 2F1MA 4A3MH 2EY6A 3NENA 3M4PA 5IAAC 5IA7A 5H1SE 4L63B 1WJUA 3OYYA 3V62A 3S15B 3OW2A 3MA2B 4P16A 1K83B 4FJVB 1VQ6A 1WFQA 1P8LA 2RHSB 3NP8A 1K73C 4Y52H 2BYVE 3EHVA 2AEHA 4GXBA 4P1CC 1XT9B 4UPAA 1FJGL 1V2YA 4HKQA 3R3MA 1DCZA 3S2AA 2YEPF 5CHFA 5L95C 3GTMB 4RF1A 4DUYQ 3HOVG 1PXUA 1QQRA 3U4ZA 5AZHA 2QEJC 3L3OC 2XNAC 3GDEA 5CV4A 1WI0A 1ZDVA 2F03A 1ZPSA 3MC8A 3TEZA 1L2FA 4GOPC 4OO1G 3HOXH 1HQMC 4A3GB 1VRAB 4MGYE 2HTME 3AMZA 1G8ZD 2KHJA 5EE0A 1D4BA 1JE4A 4EQ5A 3MC0B 2VQEQ 1D8LA 4H13C 3G48A 5D65A 1WFYA 1SEBD 4JI8Q 1PTOB 2ID0A 1MSGA 2IT1A 2A69C 2ENBA 2F0FA 2IY5B 1NVID 2QSDA 2EVBA 2C9WB 5LL6S 4BA2I 3ULPA 2LXCA 5C44B 2MHJA 3HFZB 3DWGC 3UE1A 4EX5A 3MFYA 1D7QA 3OHXC 4OVVA 3U7DA 3HK0A 4XDDA 2JY6A 5IGGA 4YWKA 2FIFA 4GN1A 4JV5Q 1CKNB 1LT5D 2KCCA 4LF5L 2KWVB 4FVMA 1M8AA 2WP9B 3P4SB 1Y14B 3X0WA 3D3RA 3S16H 5H92C 2D62A 2K9XA 4ITKA 4DNRB 1ENFA 3PF4A 2WXOA 1E24A 3L9AX 3SEBA 1JCKB 1WGKA 1AEXA 3Q22A 4LLGM 4XQQA 1G6JA 1C4PA 2JA5G 1T9HA 1S72A 1YN5A 2JF5A 4KSKC 5J22A 4CQNA 5IO9A 1WTQA 1OEYJ 5AUKA 1Y8OB 3A55A 1K8MA 3PIPA 1NJIC 4CJ2C 1N34L 1DXMA 1EOVA 5I9PA 5A2QL 3SHLA 1L6VA 1V1OA 1QILA 1IUEA 2K5QA 1E7ZA 1JQYD 5FLMH 3H3VI 1KLVA 2WDRB 2UXBL 2G3QB 2HCCA 2F0TA 3CPFA 2PPHA 1PQSA 1AN8A 1IYJB 4GOPA 1IGDA 3PSEB 1JRPA 3RI7C 4M0WB 1IBLL 1YHBA 4A9AA 1OQRA 2A6HD 4BXXG 1STNA 2VS1A 5JEAH 2RSUA 3U30A 2KENA 2BYEA 2Z0EB 3R3OA 3CSTA 2CW0C 1RM6C 2PE6B 1C0AA 2ZVNA 2HQEA 4GDLB 2PE9A 4WAAA 3G71A 5J17A 1SYBA 3N30A 5C5MA 5IYDH 2BBCA 1A2UA 2EDGA 3E5SA 4YCUA 3DPDA 4GKKL 2H1EA 5LMNQ 3VH4B 3D0FA 3RZDB 3ERSX 4IUVA 4WJ3M 5KHQA 4B3RL 1HZAA 3BK2A 3CMEA 4BAXA 3B1LX 4RH6A 2RBMA 1BXTA 2K28A 2WXKA 3KF8A 1SNCA 1V1PA 5EPKA 5M5YH 1GPXA 4NB3A 4DUZQ 3NZUA 1BCPB 2M0XA 1CJEA 1NTGA 4DGZA 4XTCS 2N0SB 4IFDI 1WGYA 2IGDA 5JZEB 5T1IA 3Q8AA 4JI6Q 4L5SA 1B2TA 1PRTD 3K7AH 4OELB 1GHKA 4HIKA 2JA6H 4BBRG 3A54A 4FXGC 5E6JA 1PGAA 1UBIA 4XZ4A 3FP9A 1F2LA 2KMMA 3P63A 1K0SA 3PZDA 2CHXA 1P16A 1LTGD 1JROA 5K5PA 1UAPA 2JA8G 2B2TA 4HROA 2NVTB 2LD9A 4GN5A 1V8QA 1H9KA 2Z4IA 4DV7Q 3RT3B 3GO5A 5FLMG 1FM0D 5IGDA 2LGYA 1PUTA 1MHXA 3EN2A 1NBWA 4ANVA 3PO0A 3PRPB 1PHJA 1YX6B 1EY8A 1TWAH 2WAQE 5CV7A 1SE2A 1X3EA 5K36H 3ZJTA 2KOXA 1S5ED 1E9MA 1TBEA 2XRQD 5BMIA 1HPCA 4YY3L 4ANXA 3RYTA 1V8CA 1A62A 5GQOA 1HTOA 4BBNC 1D6EC 4DR5L 3CSFA 3JW0X 4CDCC 1UUPA 1H9JA 1M94A 2ZXPA 1OXSC 1TR5A 4TKOB 4CBVA 1WRDB 1WI5A 1ZGUB 4I6NB 1UWMA 2E76C 2WB1B 1N5XA 5LMUL 4HEA1 1CSPA 3TEXA 4F7ZA 3GTLH 4JBJA 2CH4W 3U50C 4MGZE 3P2BA 2F0PA 2R7FA 3ER0A 3NBIA 5EJWA 3CC2A 4X3TA 2HE7A 2LGIA 3GTGB 1L4DB 3I63C 4G50A 3VR8B 3VVWB 2L15A 4Z9CB 2P5ZX 1TKYA 2BB5A 4M0WA 2GMIC 1JE5A 3K8AA 1C77A 1LTLA 5CV9A 1PRTF 2G4DB 4DR2L 1K0RA 3TREA 2EYOA 1CK1A 2WXQA 5HGTA 5IP9H 3NTIA 1WZ3A 4GDLA 3FKYA 3HM3A 4A3GG 1HZ9A 2J4XA 2KC2A 1VQDA 1WJ6A 3AFPA 3CXCA 4IPGA 4MM3A 1HQRD 1QUQA 2ZXOA 3RLOA 1WGDA 4DR7Q 1VZ7A 2KXJA 4M8MA 1NCVA 3HOVH 3NVWA 2LGXA 4R8IA 4E71A 2CQOA 3H09A 3Q0AA 4DV6L 3S9WA 3I4LA 5DEHA 3I57A 4JWUC 2CH4A 1RHPA 3VRAB 1IW7D 3G7LA 2J42A 2F4VL 2H5XA 2A1AA 2L1BA 1JMLA 4DXAB 4XT3B 1Z9FA 4JI5L 3M4OH 2N1VA 3HOWB 3QARA 5CHVC 3WAPA 4OZCA 3L10B 3A9JA 5KNBA 5C4XG 1YNTE 4I6PA 1VMCA 1WR6E 2UYZB 3QC8B 5FR6A 1FCLA 3MWYW 5GMVA 1PLFA 2MO0A 3RUZA 1WY8A 1DOKA 1OXXK 3EIVA 2QMTA 4LUZA 1X3PA 4KI0A 4YCWA 2NVQB 3ERQA 4C7YA 1GUNA 4EKUA 2MEKA 1V1QA 4DV1Q 5CGKA 3U58A 2E3TA 4NAMA 1BCPF 5G55A 1AH9A 3DM3A 1E6EB 3PZ7A 2JU6X 1J19A 1HE8A 1HRJA 2V4IB 1K28A 2MHVA 2AL3A 4FHKA 1N34Q 3E9SA 1C3TA 4BY1G 4KN7C 1W6KA 4IFDJ 2IJ0A 3QB3A 2KMCA 1T5EA 2BS4B 2K5DA 3FKIG 1HZ5A 1IL8A 2KLCA 2KO3A 1WMHA 5GXGB 4L2YA 2RSNA 1G6PA 2CJOA 4DAVA 1Z2MA 2IWHA 3SDLC 1JC7A 3TZDA 5ELFA 3TZUA 1R9TH 1CFMA 1C78A 4AS1A 4LAAA 4KHZA 5BN3A 2O2VB 1HNZQ 3NWSA 3NTKA 4US9A 3NBHA 1PGXA 1F9SA 3VTUA 3L2PA 4C80A 3ZTCA 1SE8A 2WDVB 2OF1A 1XTDA 3H94A 3PSIA 4LJZC 1I94Q 4LF7Q 1ACCA 3ZJUA 1QOAA 1V49A 1BF4A 2DAFA 1ASZA 2XEWA 3AE5B 5JPNC 3LDZE 4HPPA 2UUCQ 3P42A 3ZO5B 3ULLA 4DK3C 3PQIA 2CR5A 4HCEA 5CC4A 2VH1A 5DPSA 1IGCA 4RMFA 3LXFA 3QHTA 4DV4Q 1JMCA 4DXFA 2VB2X 2F0LA 2YV5A 1XPUA 1R4PB 4GLVB 3D32A 1Z7TA 4ODGA 3DHHC 3Q3JA 4MGIE 5C3JB 1J8CA 3S1MH 3R8BA 4R8NA 3NHHA 2Q5WD 1CQVA 3CCQA 1FNVA 2B8FA 4URKA 1OQYA 2BS2B 3SK4A 3STBD 3OWFA 4JI6L 3SK6A 4C2MH 2OCEA 1YJWA 4NJCA 1GD7A 1WJJA 2B2WA 2NBFA 1N62A 4N9F4 4PT5A 4LFCQ 1YJ9A 3L7ZC 3AE6B 4A3MG 1PH4A 1H9RA 1WJ4A 4N9TA 2AWNA 4K3BA 1IBKQ 2PLPA 4G57A 2L0FA 4NAWB 4QY7A 2EQSA 2I5LX 1VQGA 1HUMA 1HZBA 1GUGA 4A76A 4X64Q 1QVCA 1JOQA 2GBRA 4HKZE 1G91A 5CYUA 1MJEA 4ZYSA 4ZUJA 4B95A 5BO4B 4YY3Q 3H7PA 4RF0A 5IP4D 2AWTA 2LY7A 1O7ZA 2ASQA 1F9RA 4OZAA 1XJVA 4MSMB 4WQMA 2RDBC 2W82A 4M8NA 3RZOB 3URYA 3W9CB 3FDTA 3H3VH 3DBLB 4LNFA 3TEHB 2CVRA 1F2ZA 2L5TA 3VDYA 3VFKA 1DOYA 4C3HG 4RNAA 2EE1A 5G5HA 1B1ZA 2IX0A 2CHBD 3V05A 5IT9L 4XQNA 2LXKA 4IC7B 3U9SA 3ZVVA 1LTRD 5JJZA 2IDYA 1E10A 2OOBB 1WYDA 3N1ZC 4CHTB 2MP2B 3KBXA 4IOCA 2EYPA 4OZBA 4M01A 2XN9C 2K22A 5M5XH 1OO9B 4DDGD 1Q0WB 3GTGH 2INCC 1WX7A 4PZ6A 2NS5A 2ZJRA 3WA0A 2R7DA 3EJIA 3KYCD 3HOZB 3KYDD 2M00A 1U9RA 1NAPA 1TQOA 2R7ZB 1C76A 1UBQA 4NQLB 5CX3A 5T8IA 3CW2C 1O7LA 4EQOA 5C0XJ 1B44D 5K36G 4IPCA 4GOPB 1UE1A 4JQWC 2L52A 4OW0A 3H3VC 4ZRQA 3PVLA 5EPJA 2M0AA 1PTOD 4J3OD 2K52A 1D1KA 3FVQA 4DHZE 4HSVA 3HOWG 3APFA 2INPE 1JR0D 1MHHE 4MH8A 4JL9A 1YBYA 3U4VA 2KCNA 2WHIA 3FILA 3KLWA 5C4XB 3IVFA 3D31A 1JW9D 3ZDMC 1PZJD 1WTXA 4HXDA 5GADC 4MJSA 4KK7A 3GD7A 2V4DA 4A3EB 1QZEA 1GUTA 4ARIA 2DX5B 3Q6SA 1EWHA 3Q6BA 1SJED 3O65B 1I7HA 1SNDA 4YT0B 2IGGA 3RNGC 1SBBB 1YMHE 1TJEA 1KLGD 5FKAC 1YIWA 2K01A 5A2QE 4N59A 4ZHOA 3NPPA 3PUWA 1V9JA 3BVZA 2A4ZA 1HNWQ 4LF5Q 4OXPA 1FYCA 4N8FA 2JA6B 4QF4A 1XO3A 3PTFC 3HOUB 1G291 2ZJPA 1GUAB 2V3PA 1FD6A 1X3QA 3MXUA 2Q8IB 4F8MA 2WAQB 2PPBC 3M95A 4BVUC 2OT2A 1C4CA 3S14B 2NB0A 1B3AA 3KUZA 4OL7A 2HQLA 3A4SC 1UE7A 2F0OA 1RLFA 4DNTB 1J6QA 1AZPA 1S3SG 2C5CA 1QOHA 3ALBA 2LVQA 3EGRA 3KVFB 3RZDH 4QQBX 3GB1A 1KH0A 3CCRA 1XCQL 4C3JH 3T13A 5IIFA 1G6ZA 2BYFA 3NUCA 4QMGA 1VZ8A 1ESFA 5E4WC 4DV0L 1ESRA 1GG3A 1KNEA 1XQQA 2DZKA 2QC8A 1ASYA 3NTHA 2WDQB 4RMAA 4AQ7A 5EGTA 1WXMA 4RWSC 1HFNA 1QVFA 2MP2A 4P75A 2BOSA 4FA6A 5C4XH
chains in the Genus database with same CATH topology
2X6GA 3AEFB 1DZ1A 1HEZE 1PDXA 5JVG3 3CKIB 1JALA 2PW9A 5COYA 2YYZA 3V2TA 1Q12A 5JEAJ 1EIGA 1Q90A 1I6VC 3FRPB 3VRBB 4J1MA 1D5XC 2N7JA 1WTRA 2NN6I 3H8HA 3ND9A 4US8A 2H4OA 3NS1A 1X32A 4YTNB 4U68A 3P1MA 3SFDB 1WCMB 2B2TC 3PUVA 5ELBA 5KYLA 5HFYA 4C1NK 3AE4B 4ULLA 1I4XA 1O80A 1QOGA 2DYOA 2PZUA 5HI1A 2KEDA 4DU9A 3SE0A 3U2SC 3X3NA 5D3DA 2NUCA 1PFDA 3GP7A 1ZUD2 1QNKA 3HZXA 4K8IA 3TSSA 1IW7C 2SOBA 1CHPD 1GUOA 1VCIA 3DWQA 2B2YA 3M4YA 2TSSA 3T51B 1PFMA 1GXDC 1TWHB 4HR7B 2PQEA 3PIO3 3QG1A 3HEJA 5AFWA 2WXJA 1YN4A 1A70A 3P4QB 1GUSA 3IT6B 3A8JE 4PMCA 4XDCA 2JYEA 1QWYA 3LWEA 3IL8A 2F3WA 2WXGA 2AQ3B 2PW7A 2FMCA 3W5VB 4L6TB 3RLFA 3AU7A 1WXQA 5CBEE 3CIRB 2PW5A 1BQQT 3KWLA 3DWAA 4Q0FA 1GAQB 1FXAA 3NXWA 3WOFA 4PQXA 1UWXA 5DM73 1QE6A 4CKCA 3J9CA 1SAPA 3LNNA 4QIWB 1JWUD 3M3YB 3TDQA 2R61A 1SYGA 1ZYRD 1PGBA 3QOLA 1Q10A 1VZ6A 2WXIA 2VNUD 2KVMA 3P1HA 1PTOH 5KIXA 3ND8A 3OPOA 1D2BA 2PKOA 5EE3A 1U4MA 2L11A 3ABVB 3AN1A 3W5UB 5C3EB 3AE2B 2L9HA 4DAPA 2PIAA 3OMGA 3Q8EA 4N6EB 1HHVA 2JQRB 3AM9A 1VDVA 2GRIA 1JOOA 4H7BA 1O78A 5BMGA 3BYYB 5C0XH 5KYIA 4C2MB 1WWTA 2F0HA 2R3ZA 2KUMA 4GZYC 2J53A 2BCOA 1CZGA 2KWDA 5A35A 5BYRA 2O2LD 1AW7A 1NR4A 4R9WA 4FXDA 3DM1A 5LHY1 1K8OA 5F2DA 2A5HA 2F0MA 1S5BD 3I4NB 2JYTA 1AP0A 1LT3D 1XLPA 2E2IB 4ZRZA 1HZ6A 2EELA 3UI3A 2JEAI 1T6BX 1XX8A 1H9SB 2VUMB 1BNZA 1VDZA 4ZLTF 3SK8A 3TEYA 3MZ5A 2WXHA 1A3VA 5KNCA 5I6WA 1YN3A 1PRTB 4KTAA 5DNFA 4RGOS 1TIID 3M7NA 3K5NA 1PFNA 3BVMA 3C8YA 1KDBA 4ZOHC 3DMUA 1R4QB 2ICIA 2K0PA 1L5PA 3MXPA 1JWSD 1STYA 1PDQA 2F0IA 2FINB 1KDAA 4NW2A 5FO8B 5KNDA 3VA5A 1EY6A 2KOLA 1HTLD 5E1FA 1MD2D 1IYUA 1PYWD 4OIKA 4C3IB 2EY5A 2K04A 3E6ZX 4RGMA 2LJIA 4WIPA 1Y8NB 1STEA 1JICA 1DOLA 2D2CC 4DK0A 1GB4A 2L32A 3KLSX 1EEFD 1J7BA 3AEGB 1ONLA 2C9OA 1VLBA 2BDOA 2WXPA 3AEBB 3I3CA 3C46A 4I7ZC 5KEEA 3BYTB 2V3NA 4FO2A 4Q5VA 2LMCA 1KAAA 3TP5A 4A3KB 3MP9A 2JEBI 2PTLA 1IBXB 1RFKA 1FNWA 4RGTA 1QCBD 4ZAIA 1CZWA 5M3MB 4DAYA 3V3XA 4G7OC 4PNYA 3OIQA 2K05A 3A56A 1WTWA 1L0VB 2IL8A 2LHEA 1E0ZA 4L23A 3DWPA 2D5DA 3IFDA 1FRRA 4IOIE 2A68D 5G3LF 2GI9A 3NVVA 2BW2A 1HFGA 4BA1I 2QF7A 3NVZA 1JWMD 1TWGB 2F0JA 3R2TA 4F7XA 1EWCA 2Z1CA 4MT5A 1LLRD 2JE6I 4NZLB 3PUXA 4NDXA 1LABA 3Q23A 3GQBA 1ILPA 1ILQA 2AUKA 1MI2A 1I3QB 1LV9A 3J7AF 1Z6HA 3HUIA 4PV1C 3J80E 1MBYA 1SDFA 1DM0B 2F0SA 5EE9A 1SMYC 4K2LA 5CR3A 1SNOA 1TKEA 1GOZA 1AFPA 2A69D 2WXNA 5J1ZA 3SFEB 4Q2JA 1B9RA 1F2RI 1BUVT 4ZKCB 4N58A 3MFGA 5H8YE 1GB1A 1W6JA 1IKLA 3S1NB 4MHEA 2EY1A 2FFKB 2ICEC 2NVYB 2B2VC 3CU7A 1OFFA 2I07B 4KD4A 2W3SA 3R2IA 3RMHA 2AWOA 4MACA 4ZK9B 4QUCA 1U4LA 3I8ZA 2EYFA 4IZ8A 4A6QA 4ID6A 5CMDA 2J7ZA 2YEPB 4FF3A 4ABNA 2E6XA 1D5ZC 2WU2B 2OEOA 2HDEA 1RDPD 2EPBA 2FMMA 3VR9B 2RPVA 4MM3B 4IUUA 2A68C 4XWTA 5E3FA 3K7AB 1TU2B 2W55A 3DUZA 4Y7NB 3S1RB 4CKBA 1C79A 3EUB2 4NKLA 1TKWB 4C3IG 5BYQA 1LTAD 5BN5A 3VA7A 1HCZA 2JP1A 2SAKA 2A6EC 4LK1C 2ZXRA 2XVSA 1EU4A 2WXRA 1EY4A 1NSNS 2G9HD 1EYCA 4GLSC 4HTHA 5JEAG 1R9TB 1SB3C 4IUNA 4C1NI 3DEPA 1E2ZA 4TMAB 4A3FB 2XIWA 2RA4A 4DF7A 3U7ZA 2AX5A 3RPFC 2I2YA 1QJOA 1RCVD 3T53B 4KN4C 3K0YA 2ACZB 4DA2A 2RKSA 4WFN3 3P20A 2LEKA 2BB6A 4BY1B 3AV8A 2BA1A 1DOMA 4HMJA 5EKLA 2VZKB 4L1BA 3FKIB 1QOFA 2E2DC 3BS1A 4A90A 3TP8A 3IFTA 1XEEA 2WQYB 1LTSD 3V96A 1AZQA 4C56C 4ARCA 1BDOA 2B2WC 2K33A 3NSWA 1CI3M 2DWQA 1KFYB 1RTNA 1TWCB 3VQIA 1FFUA 2XWJB 3AB9A 3KQ4A 1GHJA 1QG7A 2JXTA 4J6HA 2MUYA 2QDBA 4HAEA 2F4IA 1SNMA 4ZQ3A 2VXWA 2N9LA 2BE5D 1UGJA 1LTBD 2DYMA 3Q69A 3GV6A 1WVLA 3KWVA 1JQ4A 1QT9A 1FFVA 2BTEA 3PO2B 4B9XA 1RF2D 3J81E 1DJRD 2E74C 4KKTA 1O7YA 2EJGC 2DLBA 2SDFA 2LFIA 3KLRA 3NQTA 5FK9C 5MPOA 4OHJA 3MJ5A 2EJMA 3A8KE 3GS2A 3N6RA 1SSNA 5IT9E 3S1MB 3EROA 3AEDB 4B0EA 2F0EA 1I4RA 1LT6D 1OXTA 1Q1BA 2K1BA 3EQLC 4RAUC 1OQQA 2PO4A 2PYKA 2RQXA 3LX0A 1DYQA 2LUMA 1STAA 1SYCA 1EWYC 1GJXA 4RHSA 1JWAD 2M2LA 4YSYB 1NEKB 1T5XD 4YTMB 3A7LA 2ZW0A 1ZXIA 1E7PB 3MXNA 3AEEB 3DEOA 2PVGC 4IN3A 2QKIC 4JK1C 4YWGG 2ZW1A 1TYGB 4H0LC 3W1SA 1HXYD 1XF5L 1PMRA 5M5YB 4XXEA 5BYSA 1DGJA 2WXFA 4WWMA 1EY9A 5FLXL 2GB1A 3P7JA 2WP8J 3TP7A 1D5MC 4M1UB 3T16A 1WD0A 1XLNA 1K53A 2PZTA 1CHQD 4G4KA 1P7EA 5FO9B 1C9FA 1YNJD 4RFBA 4ILWA 2NTSA 3HOYB 1K50A 3SR6A 1Y1WB 3AB5A 3NE5B 2A6HC 4JX1C 1QNUA 1G2SA 3QWNA 3KK7A 2WACA 4KGSA 4D2KA 1FEHA 1KNAA 4JBWA 1YJJA 3AEAB 3PZ8A 1TS3A 1DOXA 3QJYA 3IKJA 1EZ8A 2FJ2A 4PMWA 4IFDG 1VJKA 2R93B 4OGQC 1B53A 1XCTL 4FNFA 1YNJC 3MHZA 3TBIB 4K2KA 1MGSA 1WTOA 1EY7A 3W3AA 4QCLA 1CZPA 1FRDA 3IXSA 1A15A 3J80L 3C1FA 3HRZC 3HKZB 2O5JC 3IAM1 3U52E 1PFBA 4XYQA 3T3OA 5TSSA 2LKVA 1F9PA 1A2TA 1AYFA 1MPEA 2INNE 4KGTA 1SSOA 1IYVA 1YNND 2IGHA 1KF6B 1SJHD 3HOXB 2FHTA 3HP3A 2WXMA 4TQUS 4OO1H 2SNSA 1EZ6A 4IUTA 3BWUD 1T3QA 3VR4A 4FP5D 4YSXB 3I73A 5C0XG 5FLXE 1M4VA 3T56B 2XWBB 1EOTA 1BMLC 3U9OA 2MJDA 5CV8A 2Z4HA 2KECA 2EYMA 2JWUA 2KA7A 2WIIB 5NUCA 2EZVA 3AECB 3HGBA 3SDZA 4CGYB 3PO3B 3ONAB 3LWUA 4TSSA 1FIQA 4K5WA 2L55A 2HUGA 3CRKC 4JWSC 4TRDA 4KY7A 2GA4B 2MH7A 2Q8TA 1FGBD 4B0MA 1ENCA 2RVLA 2M56B 3ZYYX 4O1NA 5C3XA 1E0BA 1BR9A 2WXLA 2L0CA 1Y8PB 5T1GA 3X3MA 4RKBA 2SNMA 1C4QA 3BIID 1JORA 1KABA 3B2GA 3C3LA 2R92B 3PIP3 1S5DD 2K5PA 4X3KA 1I4HA 4ME5A 1C48A 1LACA 4KKSA 5ELCA 1SYFA 1WTPA 1XLQA 2NWGA 4G7ZC 1HA6A 2OXPA 1TS5A 1E2VA 3W2DA 2O4XA 4U673 5IGBA 2BA0A 3I9V1 1L4ZB 4N9PA 4JPSA 1DONA 2WNMA 2L1AA 1ET6A 2B2UA 1SF0A 3AE3B 1II3A 3CQZB 3K6OA 3QOJA 3HVDA 3P4RB 1WD1A 4BY7B 2BDNA 3LYYA 4LTUA 4A3DB 3IAYA 1LO5D 4UAIA 2EKIA 2K5WA 4K8JA 3OMCA 1SYEA 2N55A 4S3SA 1B50A 2JA7B 1BCPC 2RMMA 3D6CA 2I46A 1G2TA 1WYGA 4KD3A 3D4RA 2OEDA 2ZT9C 1QB5D 3P75A 4MN3A 1SE4A 3S2DB 1YQ4B 1FCCC 3TUOA 1PRTC 3J81L 1N5WA 4EE2A 1EL0A 2EXZA 2M9VA 1ROEA 1ZXHA 4YSZB 2KDMA 3D8GA 3B2FA 1XLOA 1OXUA 3FMCA 5C4ZA 1RD9D 3BZDB 5DAUA 3HOVB 3T4AC 2Q8RE 1I6HB 1BO0A 3GTPB 3NQIA 2WKCA 1B9NA 3VYRA 3DWMA 1FD7D 1TWFB 3PV0A 1JB3A 5EKIA 1JWBD 4IALA 4CJ0B 4RKLA 5LL6X 1NR2A 5EQ0A 1U4RA 4TQ1A 3N52A 4XDXA 3VR2A 2W54A 4QB4A 3H91A 3CHBD 2F0NA 1L6UA 4IUQA 2KQ4X 1A6XA 2EOTA 1L0YB 1VR9A 3E56A 2MP1A 2VB3X 4EGVA 2A73B 2F0DA 4HEDA 2N9KA 1H9SA 5FR3A 2J0TD 3HRDD 2H89B 5D14A 4C3JG 1HUNA 5JAVA 1S5FD 4HRSA 2PVOD 5C2TB 3T3NA 2AUJD 2A6ED 5ISRA 2QIEB 2JA5B 2RDFA 2PMZB 3IT4B 2CU3A 5I4DA 3FPUB 5EBCA 4BWGB 2Y5CA 1U4PA 1ET9A 1SMYD 3LB8C 1CA6A 1KDCA 2L83A 3F2UA 3BVGA 2MJ3A 2X6LA 4FF4A 2BS3B 2N88A 3S16B 4AYBB 4FF1A 2NZ1D 1WTVA 3OOCA 1CM9A 2DBYA 1IKMA 1FMAD 2NMQA 4K6LA 4P2CB 4G7HC 1QKZA 3WDNA 1BBXC 2LMCB 2KQ3A 4NP5A 3WCQA 1P7FA 2PNRC 4A3JB 3OW7A 3GTLB 2K3UA 4BBRB 3I70A 2SEBD 4EQNA 1Y1VB 2HDLA 2TMPA 3S17B 2J52A 2JA8B 2ON8A 1SNQA 2XRSD 5HHDG 4GDKB 3HVZA 4X3SA 4IQZA 3K58A 4IDIA 1FNUA 5C5LA 1H9MA 1XXGA 3C2PA 2M19A 2YU9B 2A74C 4K6DA 4A3BB 2X38A 1F0ZA 1OXVA 3MHBA 2L12A 3NZ3A 2G1EA 1NUCA 3P4PB 1A3TA 2JSOA 4O42A 1YJIA 2RSOA 3GTOB 2IX1A 4DN4M 4EVOA 3FILB 3MXGA 3DHQA 1TZOA 3M7GA 5LNK1 1F2RC 2F0WA 3IAS1 4IURA 2FUG1 1V43A 1Y56A 4A8XC 2B39A 2WS3B 2ONQA 1VMPA 3R93A 1Q3LA 1NYQA 2DNCA 2BT6A 1C4AA 1RKNA 5IGEA 4WORA 3SVMA 3VR5A 5EBDA 3QIAA 1F2MA 2DY7A 4F87A 1TY0A 2MPMA 3GTJB 4XWWA 5DM63 3O13A 1ZEQX 2HCIA 2JZPA 1S4ZA 2KN4A 1K52A 4FXKC 2E75C 1N61A 1EYDA 1PTOC 2F0GA 3Q8CA 2JSVX 2D5GA 4CJ1B 1STHA 1QF6A 2NYZD 5EKKA 3AMUA 3CWIA 2MJ8A 1YQ3B 1ZE3D 2JYOA 1BOSA 4C3JB 2Y3AA 2F0QA 4KJNA 4REZA 2F0KA 1XYIA 3K57A 5M5XB 2B76B 1I4QA 2F3VA 2G9DA 3H6MA 5KGUA 1UNSA 3NK9A 3EVQA 3D4DA 1PTOF 1IHZA 1SXTA 5HURA 4K14A 1G6ZA 3SK5A 3KLSA 2NN6H 5KRUA 2RDHA 2PCFB 3J7AV 3GTQB 4DXGA 4X3UA 4YTPB 2NTTA 1MSHA 2PMVA 1QLBB 1Y69U 3FC4A 3UI2A 4B08A 3AE7B 4KKUA 1KTKA 2E2JB 4V0BA 1EY5A 4RGNA 4QUFA 3PUYA 1FO4A 2B2YC 2DN8A 2LFNA 4RCOA 5JOBA 2V0GA 1ZYRC 1RJTA 2QILA 3OWEB 4BS9A 5IGCA 3ZGZA 4PMBA 3L4PA 2EYHA 1LTID 1VF5C 3S1QB 2AQ2B 3Q8BA 4OIJA 2IX3A 5JVH3 4XE0A 1SNPA 1Q1EA 2B8GA 2JX5A 5D7GA 3Q8FA 4A3MB 2IPKD 3EA6A 3S2HB 1FR3A 2QJLA 3SR1A 4ZUIA 1J8IA 1EU3A 1EFID 1NI3A 1HTPA 4RHRA 1BUIC 4HJGE 3QO2A 3BDOA 3M85A 5M9OA 3VR6A 2WKDA 5G5GA 2W3RA 4H2AA 1RWSA 2B63B 1CT1D 4KJOA 4USAA 5C0XI 4F88A 2AQ1B 4BBSB 4C3HB 2K32A 2O5IC 2EJFC 2FBWB 3JAME 5JPMC 3GV3A 1B4OA 4XT1B 4IFDH 1I50B 2EY2A 3I72A 5CBAE 4H44C 1BCPD 5EE1A 3MEHA 3TN2A 4A3IB 2WINB 4EQPA 2RDGA 1TS2A 1E2WA 2WV6D 1VF7A 4FF2A 3TEWA 5M3FB 3BG3A 3OIPA 4L8JA 4I65A 4LMQD 2EYJA 1WSPA 4WRDA 1I4PA 5C3WA 4K5XA 1L0XB 1EM7A 1CQFA 1ZKOA 5E4XA 3NUHB 3K59A 3WOEA 2BYTA 2MJEA 1ZXTA 2DY8A 5C4JB 1PZID 3FPPA 4CKEA 2WU5B 1I4GA 2EYLA 1N63A 4YIJA 5G3LD 4KY5A 5C6AA 3U4EG 4NMZA 1EIHA 1LT4D 5C4HA 1S5CD 4HCSA 3FAHA 5EPLA 2XSCA 3NVYA 3KBGA 1XTCD 3K5OA 4XQJA 5CV5A 2KJXA 1V97A 2KAJA 3VYSA 2OHFA 3VYUA 3ETRA 1N60A 4MIUA 2KACA 1UEAB 5IGFA 3E0JA 4FXCA 2DNEA 4V190 1XWEA 3ZJVA 3K5MA 3MAQA 4TQ0A 2JXMB 3PMFA 2F0VA 4J8QA 2HDMA 1CTMA 2K6AA 1TWAB 5ELDA 2L4NA 1F9QA 3G6JB 3JAML 4E6IA 4K5VA 3BDCA 2LS01 5I9OA 2QCPX 1STBA 5FO7B 4RCNA 1CA5A 3D6WA 3K5LA 1STGA 5CV6A 4OO1I 4UDUC 4KGRA 3EFXD 4DK1A 1Q8IA 3A7AB 1EYAA 1LTTD 5M5WB 4IKGA 1ICWA 1EEID 1DD2A 1Z47A 4C7ZA 5J39A 2CJNA 5D3IB 4WJWA 1MVKA 3CRLC 4ZRPA 1FXIA 3I90A 2IW3A 5CORA 1AWDA 2FE8A 3VYTA 3I4MB 3A8IE 3H0GB 1V1PB 2X69A 4KMUC 1QOBA 2CW0D 3MTSA 2D9UA 4FYDA 1IBXA 1TT2A 5AUIA 1J9OA 5BN4A 1KRHA 4KY6A 3GTKB 4HN7A 1EY0A 1SE3A 1TVXA 4KKJA 4DFAA 3PUZA 5I2XA 1YNNC 3HG9A 1K51A 3AE8B 4XYOA 4IUPA 2I38A 1RYJA 1JOKA 5JXVA 1R7SA 1NYRA 2BE5C 1TKGA 4LK0M 4KX6B 2CQAA 3OSOA 2VZKD 3AE1B 1EQTA 2KEEA 2WLBA 1NENB 2MGSA 3RFZB 5IOCA 4A93B 1PZKD 3HS0C 3SXHA 4WAFA 1B9MA 2F0UA 1DOIA 4YXDB 1J7CA 1ZOYB 3KUPA 5I6YA 3ZQ4A 4WURA 1A3UA 3TMEA 1SFOB 4P6VF 1TY2A 3AE9B 1HA5A 2Z8LA 1RODA 4KHVA 2K03A 1F2YA 3VR3A 1C8CA 4ZKBB 2K7VA 4B9WA 2NN6G 1ZP0B 3NRZA 2Y5PA 4ZHPA 1WRIA 1KLUD 4JE3B 4DQOC 1SYDA 4R3DA 2E2HB 2B2VA 5FOBB 2NVXB 5HG2A 3RD4A 4KV6A 1ML0D 3Q24A 4OVZA 4HMIA 4HSPA 1SIJA 3B9JA 5ELEA 2Y0SB 4M8AA 3MVVA 3D4WA 1D1IA 3AH7A 4RA8A 2LHDA 2B2UC 3M4OB 1ZDXA 3I91A 4A55A 3C1EA 5I2YA 4WH4A 1GUWA 2R6GA 1J7AA 1RTOA 3DXJC 2PZWA 1MI0A 3NWTA 3FEWX 5BMHA 3BDLA 1F77A 1EQVA 5IODA 4KKIA 1TS4A 4XIGS 1ENAA 3N9YC 2KHSA 2H88B 3ITPA 2F1MA 2EY6A 4L63B 3S15B 3MA2B 4P16A 1K83B 3NP8A 4HKQA 1DCZA 2YEPF 3GTMB 4RF1A 1QQRA 1PXUA 2QEJC 3L3OC 2XNAC 1ZPSA 5CV4A 1ZDVA 2F03A 3TEZA 4OO1G 1HQMC 4A3GB 1VRAB 2HTME 3AMZA 1G8ZD 5EE0A 1D4BA 1JE4A 3MC0B 4H13C 5D65A 1SEBD 1PTOB 2ID0A 1MSGA 2IT1A 2A69C 2ENBA 2F0FA 1NVID 2QSDA 2EVBA 5LL6S 4BA2I 5C44B 3DWGC 3MFYA 3OHXC 4XDDA 5IGGA 2KCCA 1LT5D 4FVMA 1M8AA 2WP9B 3P4SB 3D3RA 5H92C 2D62A 2K9XA 4ITKA 4DNRB 1ENFA 2WXOA 3L9AX 1WGKA 3SEBA 1JCKB 1AEXA 3Q22A 4LLGM 4XQQA 1C4PA 1YN5A 5J22A 4CQNA 1WTQA 5AUKA 1Y8OB 3A55A 1K8MA 4CJ2C 1DXMA 5I9PA 5A2QL 3SHLA 1L6VA 1V1OA 1QILA 1IUEA 2K5QA 1JQYD 2WDRB 2HCCA 2F0TA 1AN8A 1IGDA 1JRPA 4A9AA 1OQRA 2A6HD 1STNA 5JEAH 3R3OA 2CW0C 1RM6C 2HQEA 4GDLB 1SYBA 5C5MA 2BBCA 1A2UA 2EDGA 3E5SA 2H1EA 3RZDB 4IUVA 3BK2A 4RH6A 2RBMA 1BXTA 2K28A 2WXKA 3KF8A 1SNCA 1V1PA 5EPKA 1GPXA 1BCPB 1CJEA 4DGZA 4XTCS 2N0SB 4IFDI 2IGDA 5T1IA 3Q8AA 1B2TA 1PRTD 1GHKA 5E6JA 3A54A 4FXGC 1PGAA 1F2LA 2KMMA 3P63A 1LTGD 1JROA 5K5PA 1UAPA 2B2TA 4HROA 2NVTB 1V8QA 1H9KA 2Z4IA 3GO5A 1FM0D 5IGDA 1PUTA 1MHXA 3PO0A 1EY8A 5CV7A 3ZJTA 1SE2A 5K36H 1S5ED 1E9MA 2XRQD 5BMIA 1HPCA 1V8CA 1D6EC 1UUPA 1H9JA 2ZXPA 1OXSC 1TR5A 4TKOB 4CBVA 1UWMA 2E76C 2WB1B 1N5XA 4HEA1 3TEXA 2F0PA 2LGIA 3NBIA 5EJWA 4X3TA 3GTGB 1L4DB 3VR8B 4Z9CB 2BB5A 4M0WA 1TKYA 1C77A 5CV9A 1PRTF 2EYOA 1CK1A 2WXQA 5HGTA 3NTIA 2J4XA 1HQRD 2ZXOA 1VZ7A 1NCVA 3NVWA 4R8IA 3H09A 3Q0AA 3S9WA 3I4LA 5DEHA 3I57A 4JWUC 1RHPA 3VRAB 1IW7D 3G7LA 2J42A 2L1BA 1JMLA 4XT3B 3HOWB 4OZCA 5KNBA 1YNTE 1VMCA 1FCLA 3MWYW 1PLFA 3RUZA 1DOKA 1OXXK 2QMTA 1X3PA 4KI0A 2NVQB 3ERQA 4C7YA 1GUNA 2MEKA 5CGKA 4NAMA 2E3TA 1BCPF 1E6EB 3PZ7A 2JU6X 1HRJA 2V4IB 2MHVA 3E9SA 4KN7C 1W6KA 4IFDJ 2IJ0A 3QB3A 1T5EA 2BS4B 2K5DA 1HZ5A 1IL8A 5GXGB 4L2YA 2RSNA 2CJOA 4DAVA 2IWHA 1JC7A 3TZDA 5ELFA 3TZUA 1CFMA 1C78A 4AS1A 4LAAA 4KHZA 5BN3A 3NWSA 3NTKA 4US9A 3NBHA 1PGXA 1F9SA 4C80A 2WDVB 2OF1A 3H94A 4LJZC 1ACCA 3ZJUA 1QOAA 1BF4A 3AE5B 5JPNC 3P42A 4HCEA 5CC4A 1IGCA 3LXFA 4DXFA 2VB2X 2F0LA 1R4PB 1Z7TA 4ODGA 5C3JB 3R8BA 4R8NA 3NHHA 2Q5WD 1CQVA 1FNVA 2B8FA 2BS2B 3SK4A 3OWFA 3SK6A 4NJCA 2B2WA 2NBFA 1N62A 4PT5A 3L7ZC 3AE6B 1H9RA 4N9TA 2AWNA 2PLPA 4G57A 4NAWB 1HUMA 1GUGA 1JOQA 4HKZE 1G91A 5CYUA 4ZYSA 4ZUJA 4RF0A 2LY7A 1O7ZA 4OZAA 1F9RA 4WQMA 2W82A 3RZOB 3URYA 3W9CB 3FDTA 2CVRA 1F2ZA 2L5TA 1DOYA 4C3HG 4RNAA 2EE1A 5G5HA 1B1ZA 2IX0A 2CHBD 3V05A 5IT9L 4XQNA 3U9SA 1LTRD 5JJZA 2IDYA 1E10A 4CHTB 3KBXA 2EYPA 4OZBA 2XN9C 2K22A 1OO9B 3EJIA 3HOZB 2M00A 1U9RA 1NAPA 1TQOA 2R7ZB 1C76A 5T8IA 1O7LA 4EQOA 5C0XJ 1B44D 5K36G 2L52A 4OW0A 3H3VC 4ZRQA 5EPJA 2M0AA 1PTOD 4J3OD 1D1KA 3FVQA 4HSVA 2INPE 1JR0D 1MHHE 4MH8A 2KCNA 3FILA 5C4XB 3D31A 1JW9D 1PZJD 1WTXA 3GD7A 4KK7A 2V4DA 4A3EB 1GUTA 4ARIA 3Q6SA 1EWHA