3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
1RF2D 2XRSD 1TS5A 1DYQA 3BZDB 3DWQA 4RGOS 1D5MC 1QILA 4K6LA 5D3IB 1S5DD 3CHBD 2NTSA 3BVMA 1I4XA 5TSSA 1JWUD 4RHRA 1STEA 1MD2D 1ENFA 5ELCA 3KLSX 1LTSD 1TS2A 1JWMD 4TSSA 1V1OA 1I4GA 1RCVD 3GP7A 1EEFD 4RHSA 1BCPF 1KLUD 1JCKB 5ELEA 1TY2A 1LTTD 1PZKD 2RDHA 3BYTB 2ICIA 1EWCA 3EFXD 1PYWD 1JR0D 1UUPA 4RCOA 1FNWA 5ELDA 1EU4A 1LTID 1SE4A 4L6TB 3URYA 1YN4A 3BVZA 5I4DA 4BWGB 1M4VA 2SEBD 1JWSD 1I4PA 2NTTA 1JQYD 1LT4D 1CT1D 1PRTF 1SE3A 1T5XD 2RDGA 4RGMA 1LTGD 1HTLD 1ET9A 2QILA 4Z9CB 3BVGA 3SEBA 1F77A 1TS4A 1D5XC 3O13A 2CHBD 1XXGA 2AQ1B 5D3DA 1L0XB 1XTCD 3MFGA 1B1ZA 4DXFA 3BYYB 1S5ED 1DJRD 1PZJD 1FNVA 1AN8A 2J4XA 1BCPD 1PTOC 1SEBD 1KTKA 1EFID 1SJED 4RH6A 3R2TA 1EU3A 1TY0A 1LT5D 1CK1A 3TSSA 1B44D 1SXTA 1S5CD 1SBBB 3V05A 1AW7A 1CHQD 4ZYSA 2WV6D 1LTRD 4C56C 1S5FD 3DWPA 2IPKD 4NZLB 1HA5A 1PTOF 2XN9C 1FGBD 1L0YB 1FD7D 3MC0B 3OWEB 1G8ZD 5FK9C 1RD9D 2G9HD 1LO5D 2AQ3B 1KLGD 4L63B 2QEJC 5ELBA 1FNUA 1YN3A 2XNAC 4RGNA 1PTOB 2O2LD 1D6EC 1GOZA 1BCPB 1RDPD 3R8BA 1PRTB 1SJHD 1ET6A 1LTAD 1I4RA 2IJ0A 4DXGA 1PTOH 1LLRD 5FKAC 1EEID 2TSSA 2R61A 1I4HA 1SE2A 4O1NA 3DWAA 1CQVA 4RFBA 1PRTC 3EA6A 1LT3D 1PRTD 1HXYD 1LTBD 1S5BD 4UDUC 4RGTA 1BXTA 1I4QA 1V1PB 2AQ2B 3R2IA 1PZID 1ESFA 4OHJA 1CHPD 1UNSA 1HQRD 1D5ZC 1TS3A 5ELFA 2XRQD 1YN5A 1V1PA 1BCPC 1PTOD 2Z8LA 1LT6D 3W2DA
chains in the Genus database with same CATH superfamily
1I94Q 1QOBA 3H7PA 2M8SA 2L3ZA 1CKMA 3QB3A 3BZDB 5IP4D 1CQFA 4IALA 5FJ8H 2NTSA 3NQTA 4B3RQ 2WLBA 1WTHA 3D31A 1F2YA 3J81L 1WSPA 2QGQA 1Z2MA 4KKIA 1L2NA 4FDBA 2Z0DB 5A35A 1E7VA 2BVCA 1CZWA 2C60A 2RSUA 2MJ3A 3HRZC 2R93H 4KSLC 1J8CA 3HKSA 2ZTEA 4TKOB 4DDID 1F9RA 4K7WA 1ASZA 1V6EA 4HR7B 3PSIA 1TY2A 4XDCA 2PQAA 2RDHA 4A3IH 3PLUA 4B3TQ 3HOZG 3V62A 1EIFA 5KNCA 5HY6A 4FA6A 1VQCA 2OEOA 3CAMA 3CU7A 1WZ3A 2M0XA 3L7ZC 1OQRA 4DAPA 4LK1C 4NQKE 3DVGX 4DF7A 5IT9c 3ULLA 1OO9B 5EDSA 2KHJA 1NYRA 2QC8A 3DBLB 3NZUA 4TVAB 5C0XH 3KW5B 1YZ6A 2INPE 1H9SB 1Y8PB 2F0JA 3Q6SA 2LZ6A 3KWVA 1IKLA 4KN4C 2B63H 5BMIA 2AWTA 2I5LX 2IYDB 3VR8B 2Y0SB 2MBBB 1VRAB 4G11A 5G55A 3D3RA 1Q46A 1J7AA 3EFUA 3FPPA 5C3EH 2VQEQ 1V2YA 2KAJA 3HM3A 3S17B 3OMCA 2V3NA 3QX1A 3KJPA 2I0QA 2EMSA 1KTKA 4GMVA 4N59A 1YNNC 1E5WA 2DYOA 2HCCA 2KVZA 1IYJB 5AZHA 1OXUA 1FO4A 1KABA 1HJPA 1TWGH 2ZM6Q 4OO1G 1VJKA 2TMPA 3A4SC 1S5CD 1VLBA 4CHTB 2G45B 1CHQD 1I94L 1P3QU 3K8AA 1VQKA 2DBYA 2R3ZA 2KTFA 1RM6C 4CBVA 1FGBD 5CV6A 1E0ZA 3FMCA 1L0YB 3CCLA 2MHJA 3SDLC 3U7DA 5H1SE 2O6VA 3HOUH 1RIPA 4A6QA 4ZRQA 1LO5D 1WD1A 4MN3A 4M02A 1DGSA 1PDQA 4IQZA 2VY3A 1PTOB 4RGNA 1V49A 2IY0B 3BWUD 2LUMA 2VL6A 2O5IC 2O2LD 4KGTA 2WU5B 5BMGA 2R93B 3TQYA 1WTVA 2MCNB 1SJHD 1PGAA 4LJZC 3HKZE 5BN3A 3AE8B 1O78A 3D4RA 2K9XA 3VDZA 1UE6A 4F1SA 2WACA 5E3FA 3CCSA 4HDOA 3ZGZA 2F1MA 4OWTB 1U0LA 3VVWB 3DWAA 2RR9A 2JQOA 2X38A 3X23A 5BN5A 1VCIA 1JMLA 2FCSA 2EY2A 3A0JA 4ZUIA 4A3MG 5BN4A 1G51A 1EY9A 2ZW0A 1E22A 1HZ9A 1MIUA 5C4JH 4JI5Q 3GTKB 1G91A 1V80A 4JE3B 3IFDA 2PW7A 2JA8B 1TKWB 1X9NA 1VQGA 1VD2A 1D5ZC 2NYZD 4DHJD 2UUBL 1EWHA 1YVCA 5J2RA 1PTOD 1JJ2A 1HNWQ 4M8MA 3H0GG 2F0MA 1A2TA 1OTCA 2DYBA 1C3TA 3LNNA 3AE4B 3PIO3 1PFSA 2HD3A 1HNXL 4KHVA 1I4XA 1NY4A 4DR6L 3BINA 4B3MQ 2JXMB 2MJEA 1EO6A 1HEZE 4OX9L 4PYZA 1CI3M 2LS01 4JBWA 1V8CA 5LMUQ 4NQLB 1WI5A 2RDFA 1PVOA 1Q12A 2KHIA 1ZUD2 3OG5A 2JA5B 2BS3B 1DOLA 4DNRB 2LI5A 1FIQA 3K7AB 1VZ6A 2CCZA 2M56B 4NKLA 4NMZA 3NTIA 2RPVA 3ULJA 1EWCA 2RVLA 1IZ6A 4XGAB 3AEVA 3AV8A 1Q90A 5G3LD 2LXKA 1KXLA 4A3DG 1MG4A 2VW9A 1XCQL 1SYGA 2R92H 1HNZQ 3U7ZA 2JPHA 3C3LA 3KUZA 4N8X1 2G9DA 1EF5A 3NBHA 1HTPA 1ZW7A 1LT4D 2RDGA 3I5JC 1IL8A 4RCNA 3SEBA 3HOZB 5CYUA 2A69D 3ONAB 2YTYA 4XX5A 1M90C 2FUHB 3QQ8B 1B9RA 3W3AA 2Z6KC 1MSHA 1SYDA 4YCWA 1XO3A 1ZPSA 1YNXA 1WYGA 3DVNU 3KF8B 3DWMA 2JSVX 5IGBA 2CHXA 1XTCD 4I7AA 2ZTCA 4QF4A 1KRTA 1ACCA 1F52A 1DOMA 2LFNA 1VQMA 3VR5A 2G4SA 3MTNB 3P1HA 3G71A 1DZ1A 1N5WA 4MSQB 1KC8C 2KOLA 4LF7Q 2LHEA 5CORA 2B2WC 5C5MA 3FPUB 3I9V1 4W9IA 4ZK9B 1LXDA 4WAAA 5HURA 1PTOC 4R4OA 3KF8A 5I6WA 2JU6X 1SJED 2AMCB 1EZ8A 4MIUA 4ZKBB 4HIDA 4A3DH 3V6EB 4I65A 4X64Q 1EOVA 4DAYA 3AFPA 1H9RA 3H3VI 3HOVB 1FM0D 1TJEA 4OZAA 3R3OA 1WI0A 2EYJA 3ML9A 2M00A 4DV0Q 1S5FD 2HD5B 1X3EA 3K9PB 4YXDB 1T9HA 3L0OA 2YVCA 2MBOA 1V5OA 1UH6A 4KKJA 1KJTA 5C4ZA 2LXCA 3AECB 4RNAA 1G6ZA 4C1NK 4K3BA 5ELBA 1SB3C 5M3FG 2H88B 4LF8Q 4AYBE 4IZ8A 5LMUL 3HKZG 3APCA 1KRSA 3J80L 2Q2IA 3R8BA 4WORA 4YHHL 2BKFA 2D2QA 3SFDB 3UIOB 5EE1A 2MH7A 4C00A 1LTAD 1I4RA 2PMZE 1PTOH 2RGFA 3AI5A 1G6PA 1EUJA 2KT7A 2FCQA 2B2WA 1QOFA 4L1BA 3WALA 1I5FA 3K80C 4CKBA 4MM3A 3BK2A 3ULPA 5IYCG 2F0OA 1PYSB 5JOBA 3J80i 3IFWB 3VR2A 2K5VA 3M4YA 2PZUA 4YCUA 5AZFA 1TKYA 2K4KA 3VXWA 3ZNGC 3EBEA 4A3LG 2K01A 2LD9A 1NE3A 4EZKA 2MQJA 1TQOA 4A8XC 1JT8A 5LMNQ 3S1MB 2FXQA 4IUTA 4IM0A 3F2DA 3VAWA 1FD6A 3GQBA 2RHSB 4PZ6A 5JJZA 4PV1C 3ZRFA 3RFZB 1PFBA 1ZXTA 2QHOA 3ALBA 4LK0M 3VA5A 2GI9A 4PZ8A 5LLIA 2XIWA 4N9F4 3MXUA 2KECA 1LTSD 3NELA 1XF5L 1JWMD 1LM0A 2B8FA 3GTKH 3RNAC 2EZVA 4GZYC 3B0AA 1C4CA 3NZ3A 1KLUD 5AEKB 1E2VA 4XYQA 4ULLA 1RRBA 3UF8A 2P5ZX 1VMPA 2KWUB 2M1MA 5M5WB 2YV5A 1WRIA 3A1QB 1YJ9A 2BA0A 5IYDH 1GB4A 3CC7A 2PE9A 5CHWA 4MTNA 2X6LA 2MP1A 4WJWA 4A3KB 3BVZA 5C44G 1GAQB 4AJYB 3UQBA 3CIRB 1S40A 3IBEA 4FLHA 2WYQA 4QB4A 3BIID 5EE9A 4ME3A 1B53A 2H5XA 4EUTA 1WCMB 1CM9A 1QCBD 3NWTA 3PVLA 2KQ3A 4QCLA 3VTVA 5MPOA 2EYLA 1D3ZA 4U68A 4CJ2C 5KEEA 4PS3A 2Z1CA 2JUOA 4F88A 2DENB 2DNFA 1WXVA 4G3XB 1JC7A 3LWEA 5C44B 3E9SA 5KRUA 4BY7H 5J39A 3CXCA 4S17A 1N61A 4IN3A 2INNE 4GN4B 4IFDG 1CZPA 1A8VA 3EHVA 1AN8A 3EC8A 3LDZE 4ILWA 3J7A5 1XJVA 2A5HA 4DDGD 3WA0A 2QDBA 3RD2A 2EYPA 3TDQA 3TSSA 4PQXA 4JGHB 1RJTA 1D1IA 3PO3H 1SBBB 2V3PA 3P4PB 3T13A 4ZYSA 5LMNL 3IAYA 1LTRD 2L83A 3KFUA 3E6ZX 1DGJA 4DR5L 4Y52H 3PHWB 3X3MA 1JALA 4F7ZA 4N58A 2XN9C 4LCDE 3AEGB 2UXDQ 1L0VB 3I4MH 2IO2B 5IA7A 4POGA 1GUTA 1JQ4A 2I1KA 2N7EA 4CQNA 5COYA 5EPKA 1D1KA 3L2PA 3AE3B 3S1QB 2M17A 1STGA 1XX8A 4JBJA 3HOXB 4LFCL 1VQBA 3G6JB 2BWES 2GBJA 2OCEA 1RAXA 4NP5A 3FKIG 2IJ0A 4HROA 4JQWC 1Z6HA 2GMIC 4J6HA 4RM9A 2D3CA 4TRDA 1WGYA 1GXDC 1V97A 1UAPA 2D9UA 3GOEA 3GE8C 2JJQA 3M85A 1XPUA 3NWSA 3W1BA 2Z6BA 1ZKHA 3LJ3A 2R6GA 1R4QB 3OIQA 1Q82C 2BTEA 1ESFA 3I72A 2IGGA 1WWTA 4B3ML 1SGHA 1EM7A 1HQRD 3VH4B 1WCMH 4N9TA 2PW9A 1V1PA 1MJCA 5AZGA 2IWHA 2A8VA 5LMNW 4C3JH 3K5LA 1TWFB 2JXTA 4HIMA 2K3UA 1YIJA 3MC9A 5F2DA 1H4RA 1EY0A 1QUQA 3EN2A 1FFUA 4BKTA 3MTSA 4HMJA 2WP8J 2KX3A 2RSNA 4W9KA 2OQKA 1SSOA 3H3VH 3DOWA 3S2HB 3HUIA 1V9PA 3SU8X 2N0SB 1TS2A 1HNZL 4DNIA 1A0IA 3SD5A 1V1OA 1DOKA 3T51B 4WWOA 5TR5A 2IHEA 3E5SA 5C4XH 1PZKD 4LF5Q 3AE1B 1O7IA 5FO8B 2PE6B 2DN8A 2ICIA 1EQVA 3PRZA 2LKVA 4KHPQ 3DBHB 3QWNA 4DAYB 2CJOA 3DM3A 5JHBA 1TT2A 4L5SA 1CA6A 4ANXA 1FRRA 3GTMB 2INCC 4XQQA 1KDBA 1M4VA 2M9VA 2Z0SA 4C3JG 1Y69U 2KQSA 1JQYD 2IBIB 3C8YA 1H95A 4DV5L 3K9OB 4DR4Q 3RZFA 5IP9H 5GAEC 5A2QE 5M5WH 1NMGA 2CH4A 2IX0A 3SR1A 2F0QA 1UBIA 2VQFQ 2IY1B 5IE8A 3MHZA 4A9AA 4HJGE 3FP9A 2WIIB 1VQJA 2BDOA 1MKHA 2DY7A 3I90A 3GD7A 3O13A 3SHQA 2AQ1B 4N9PA 5EPLA 5JAVA 4DV1Q 4LDTB 3Q8FA 3S15B 4JK1C 3PO2B 2A73B 2JZPA 2N4FA 3NK9A 3I7FA 4JC0A 3I3CA 3ZW3A 2ZJQA 3N52A 3NBIA 5G2NA 4WWNA 5LXIB 2NVXB 5C4XG 2VUMH 3HZXA 1DXMA 2E6XA 4XYCA 1BCPD 2FAZA 2PI2E 3M4QA 3CPFA 5C4JB 3W1SC 4DGZA 4FP5D 3QJZA 1HTOA 4AP4C 3NEMA 2PLPA 1BBXC 1K0SA 1DCZA 1OEYA 1XPOA 3H09A 4AJWA 3LYYA 3LB8C 4DWFA 1QT9A 5IP9G 3Q8CA 4G0NB 4EFOA 4X65L 3GTPH 2NZ1D 3HM6X 4O42A 5CV9A 1TKGA 3KUDB 4C7YA 1FD7D 3A56A 4B9WA 4JI7L 2LSSA 3Q3MC 4WH4A 4C4VA 1SMYC 4FJYA 2IL8A 4A3FB 3NENA 4OGQC 5M3MG 3CCRA 1L6UA 2L12A 2G3QB 4WWPA 2EJGC 3G4SA 1EYCA 5D7GA 1LQBA 2K28A 1XQQA 5J22A 1C78A 1O7YA 2W55A 1XPRA 2KJHB 1UD7A 4AS1A 3ZUNA 4ANVA 2FMMA 3LX0A 1K83H 2E2JB 2NBVB 1S3SG 2K1BA 3I4LA 4HAEA 1EQQA 3S1NB 1M94A 3U4EG 3ZJTA 4K5VA 4C3IH 5IGDA 2JYEA 3M7GA 1UE7A 4BKGA 4XTCS 4WJNA 4P73A 5CBAE 4C7ZA 5HKHA 3M7NA 3FEWX 1LTBD 1N32L 4ODGA 2Q8IB 3ZTCA 1ML0D 5DNFA 5DPWA 3J7YW 2F4VL 4E3CA 2PO4A 4MNOA 1I6VC 5EKLA 4FO2A 4K3CA 2R7ZH 3VYSA 1S72A 2K04A 4YY3L 3RYTA 4YTPB 1CKOA 1VQLA 4B0MA 4PMBA 5EBDA 1YIWA 3DBRB 3PSEB 4HCPB 4JBKA 1S4ZA 4K7UA 1AEXA 3AE5B 2RCNA 1Q5WB 3EQLC 1LACA 1K28A 5IYCH 1MPEA 1RFKA 1WOCA 2ATWA 1PDXA 4OZCA 1S5DD 1C4QA 5G5HA 3ZNZB 2BA1A 3RCZA 2CW0C 4KI0A 1Z9FA 3KLSX 1DOIA 1JOOA 1VZ7A 3B2FA 5LL6X 1RYJA 3L17A 3LGJA 2FMCA 3A7LA 4R9WA 3GTQB 2VB2X 1HUNA 2SNMA 3N32A 1HR0W 5ELEA 3Q69A 4RKBA 4M8AA 2BYFA 3CW2C 1FXTB 1YX5B 2C7NB 4IUPA 3RZOH 2DHZA 2GOWA 2YLMA 2KDFB 3JSVB 4A3BH 4X65Q 1AP0A 1TKEA 2PNHA 1XNQQ 1XT9B 4A3IB 2VZKD 2XEWA 3T8MA 3I55A 2C7MB 3PGEA 1FGUA 2JRHA 1YN4A 3OAWA 4TUUA 3P4SB 1BKBA 1P0RA 4R8NA 2MX2A 3RNCC 4WQMA 1JWSD 4OELB 1QWYA 1SE3A 4P16A 1I35A 5FLXE 2F0NA 5JEAH 1J7CA 3ONSA 1HTLD 3I56A 4II2B 3OMGA 5BMHA 3E56A 5IKCM 4KD4A 5C3WA 3RLNA 3HOVH 3A9JB 3VHTC 1G2TA 4M0WB 1CMXB 2QJLA 2JA5H 1T0YA 1XXGA 3MVVA 1QF6A 2KDIA 3FRPB 3FVQA 2BYVE 2F3VA 3PZ8A 3UIPB 1BO0A 4A4IA 2OQ0A 1V81A 1I3QH 2LY7A 1GVPA 4LF9L 2F0LA 3IRBA 3VR6A 1K51A 4MGYE 1X55A 3SHLA 1E8ZA 5CC4A 4ZYNA 2O4XA 3C1FA 3FAHA 4DR5Q 1N32Q 1FNVA 2JYOA 1BOSA 1D8LA 4P1BC 1S3OA 5T1IA 2UXDL 3NHHA 3KBGA 3WANA 1N36Q 3TEXA 4LNIA 3PUXA 1IBLL 2E5LQ 4ZLTF 1F2RI 3T3NA 1E10A 3J81i 4DXAB 3H91A 2M19A 4DHZE 3J80c 1QZHA 4AQYQ 1UGJA 2PPHA 2ZCCA 1B7YB 3NS1A 3V05A 1W6KA 4DV4L 3VA7A 4OO1H 1J6QA 2YEPF 2N3SA 4ARCA 2VZAA 2L55A 3E0JA 3P7JA 1VDZA 3PIP3 2CQOA 3H6MA 3K0YA 2K8BA 1RTNA 1R9TH 4E6IA 1X54A 2NB0A 1V5TA 1QOGA 3S2AA 4IJHA 1Q86C 1XNRQ 2LRUA 2VRRB 1YD8U 1KLGD 2H1EA 5J3BA 2F4IA 3AEBB 3PIOA 4CO7A 2HDEA 3N6RA 3Q8EA 2AUKA 2K5NA 1BCPB 4BA2I 1PFMA 3GTQH 4JW0A 3I4MB 1BBUA 3RMHA 2KVMA 3DMUA 1N33Q 3KLSA 2K75A 4APVA 2TSSA 3J81E 1JMCA 4A3GG 3S14B 1NSNS 4LFBQ 2JY6A 2KFJA 2UU9L 2D11A 4OO1I 5FR6A 4HJKA 2KEDA 2EE1A 4A93H 1EWYC 1D7QA 1G6JA 1AWDA 2BS4B 1G2SA 3TP5A 2E74C 1OTRB 2LXJA 3VTUA 1SDFA 4ABNA 5J1ZA 2EMTA 2D5GA 1SNCA 1F2RC 2IO3B 1CHPD 3V96A 1X65A 2J0TD 2FCMA 3QOJA 3I4NB 4IFDI 1JB3A 2OOBB 2MO1A 1VQOA 2CR5A 2DZKA 2QSDA 3N1XC 4RWSC 3T1HQ 4KIKB 1GC7A 2VZKB 5C44H 3CQZB 3AE6B 1FXIA 4HRSA 3S9WA 1GUNA 1MHHE 3U4ZA 1Y1VB 4IUVA 1PLFA 4K6LA 5D3IB 4JI6L 1J8IA 2K33A 4K0KQ 1C4AA 2K5WA 1STEA 2B76B 2N7JA 5DM63 2EVBA 4DAVA 5JJIA 3HK0A 4OWXB 4WFN3 3TRZA 1N36L 2DX5B 4W9LA 3AMZA 1HR0Q 4H44C 4DV5Q 3N30A 4BBNC 1A5RA 2WAQE 3NOBA 4IFDH 4W9GA 4L5TA 1XLPA 1JR0D 2M4NA 1Q1EA 1FNWA 3URYA 1EU4A 2EY6A 3STBD 2DAJA 4ZRKA 5I4DA 3Q3OC 1XNRL 2ONQA 1I4PA 3CMEA 5EBCA 2WXKA 4HDQA 4X3KA 1Z7TA 3NVZA 1KM7A 1PYBA 4JX1C 4GOPA 4YWMA 3BDLA 2WNMA 1AZPA 2KWDA 3NHEB 5KNDA 2CHBD 2AWOA 1KF6B 1ONLA 1M8AA 2B39A 1N33L 2NBFA 4A3CG 1WM2A 3JYUA 4DK3C 3HOYH 3S1RB 1EY6A 2BCOA 4OVVA 1GHJA 4NPNA 2BYEA 2L11A 2N9KA 3QG1A 1E8XA 1SIJA 4LUVA 2PKOA 4MJSA 2Z0EB 4MGZE 4IFDJ 5IT9L 2JQRB 1ZYRC 4EQOA 1Q0WB 2J42A 2WKCA 2F0UA 4K14A 3FKIH 5C0XJ 3N9YC 4YSYB 1E2WA 2JWZA 2CQAA 3SE0A 3C1EA 2JX5A 1C77A 2KCNA 4KTAA 1AW7A 1EIGA 3RN2A 3TUOA 5M5YH 3CKIB 2MFIA 3HOXG 4A3OA 1J5EL 5C4HA 2G1EA 2RD0A 3W1YA 1WGDA 1T0RC 3NVVA 4PK1A 2A6HC 2N9PC 2E75C 2LEKA 1E7PB 5C2TB 2Y3AA 4DV7Q 1S1QB 1HZCA 4ZAIA 2LGXA 4KZCA 1V43A 1PH1A 1RDPD 2ON8A 3A9KA 5CX3A 3ZVVA 1PRTB 2HDLA 3J7AV 4DXGA 3DCGA 1QVFA 4XDXA 3WDNA 5FKAC 1WR1A 3AN1A 2RF4A 3OTOQ 4X6AH 3AE2B 2WWZA 4LJOB 2F3WA 5CHFA 1QOAA 2E76C 4BKSA 5KHOA 3ITPA 1R9TB 3B2GA 3CF6E 1E8YA 1WGKA 5I2XA 2DZJA 4GKJL 2WXPA 2AQ2B 2M2LA 2WXFA 2KUMA 2WB1G 2XVSA 1BVSA 2ZJDA 3J80E 2JA7G 2QIEB 2B2YC 2PZTA 2I46A 3RPFC 1VMCA 3TEZA 4AYBB 1TS5A 3ABVB 4K7SA 3S1RH 5FOBB 4H13C 1U5KA 4RGOS 1ISNA 3AU5A 4W9CA 2WXJA 3QC8B 3VYUA 1R4MB 1KHIA 2KOXA 5IGCA 3W5VB 4RA8A 2N1WA 4MT5A 4JG2A 3TMPB 4UHVA 2MWSB 4POFA 1MJEA 2BPSA 1YHQA 2N7DA 1X1MA 2SNSA 3DLLA 1ILPA 2BE5C 1F9JA 4MACA 3BJUA 1IBMQ 2MNAA 1JE4A 4BS9A 2HQLA 2EY5A 5DEHA 3CWIA 2QMTA 3H9DA 2OXPA 1A62A 4F8MA 2BT6A 2N9XA 4GU2A 1EIHA 1Z5SB 3ZNHB 1EY5A 2EYFA 2K52A 2IDYA 2JN4A 3IKJA 2ASQA 2CU3A 1SNQA 3NP8A 4J6IA 2NUCA 2EOTA 1SE4A 3H6NA 4FJVB 3GO5A 4UP9A 1L6VA 5JHAA 2UXBL 2SEBD 2MSED 4IUMB 2F0WA 1X56A 3C46A 3ZDMC 1BT0A 1E0BA 4KV6A 2GVBA 3QJYA 3GTJH 1FCCC 1F77A 3A55A 2MHVA 2NMQA 4DR3Q 4FXDA 2KTRA 2REXA 2R2OA 1HNWL 1FRDA 4C3HB 5I6YA 2EKIA 3S17H 1Y1VG 3HS0C 2KZRA 3ZDTA 3GV3A 3CCJA 2GLSA 1WTRA 4A55A 1PH8A 3EFCA 2JF5A 1PH2A 3PREA 2NVUI 4A90A 4BY7B 1HZBA 4ZUJA 5JPNC 1V1QA 1K9MC 3I4NH 1SEBD 2JA8H 2K8CA 2L00B 5C23A 2RKSA 1EFID 2NN6I 4NXMQ 2EIFA 4DAMA 3BG3A 2L0FA 4CYEA 3KH0A 1CKNA 4YSXB 2RHQB 4JWUC 3SK4A 5C0XI 3B1LX 2J0MA 2WV6D 4JI3L 3RMKC 1F0ZA 3PUYA 2PEAA 3R7QA 2ZEQA 5AJ3L 3GTMH 3DHGC 2MQHA 3M3YB 1AARA 1HUMA 3PUVA 3TP8A 3TREA 4LFBL 1V9JA 4IWPA 4XDDA 3OWEB 1WGRA 1L1OB 4K5WA 1RTOA 4KK7A 1Y14B 4K8JA 3HOWB 2K50A 2N88A 3DBLI 2AQ3B 3NVWA 4KKTA 1J9OA 2R7ZG 4IPDA 2XNAC 4MSMB 2BYTA 4J3OD 4MHEA 3STBC 4HCEA 3WOEA 1OEYJ 2X6GA 1EL0A 3A8JE 5D6JB 2KENA 5E4XA 3J81c 2KK8A 2JA8G 2GN5A 3W1GA 2R92B 3PV1A 4X57B 4PZ7A 4WURA 4B6WA 1UF0A 2K14A 3FILA 3HOWH 2K6AA 3H0GB 4AWJA 2KA7A 4A3BB 1ILQA 2DYMA 3DDCB 5CBEE 1D2BA 4X62L 4A75A 4N8FA 2E2IB 3HRDD 5C1ZA 1BXTA 3DHQA 3A7AB 4ZRIA 1H9MA 2OEDA 4B9XA 2OTLA 1KFYB 5DM73 4R4TA 1V86A 3L16A 3MJ5A 3GTJB 1C79A 3W1SA 2EPBA 3ZJVA 2XWJB 2AKWB 5ELFA 1R4MI 3QIAA 3U2SC 4BZAA 1F1HA 3T56B 1B4OA 2IW3A 4RMFA 4DNTB 2UYZB 4DV0L 4A3JH 3KJOA 1PH5A 2ACZB 3P2BA 3UDGA 1QZGA 4AIMA 4DV2L 1F9PA 4HSVA 4UP8A 4I6NB 4YSZB 3APDA 3A9JA 3NQIA 1D5MC 1K8RB 2W54A 1WRDB 4HSPA 4LF4Q 5IWAL 1IKMA 2B2TC 2YU9H 2IT1A 1K50A 3PZDA 4TQUS 4PNYA 2LWPA 1MVKA 3KF6A 5FJ8G 4JI0Q 2FE8A 3NRZA 2W82A 1XWEA 2NPTB 3ZRCA 3BZKA 3FC4A 4HIOA 1NR2A 5CV7A 4HJ5A 1PFDA 2EKEC 3I91A 2MJDA 1SROA 3CD6A 1QNUA 4L23A 1UUPA 3D6CA 5DPTA 1LTID 3M3YH 1E1TA 1NNXA 3BZCA 1EF1A 3SR6A 1SYEA 1X3FA 5CV5A 4A3JG 2IO0B 2PMZB 1LTGD 3MP9A 2WB1B 3RNGC 2GB1A 3U9SA 4FXKC 2LASA 2K6DB 4A3FH 2ASBA 2LJIA 2G4DB 3WAOA 5LHY1 1FL0A 1JOKA 5I9OA 1E90A 1MFWA 3GV6A 1XLQA 2EJFC 4K2LA 1TIFA 1WIAA 4WJPA 4A3PA 1WM3A 4JBMA 4A3JB 1B50A 3ZTDA 4LAAA 1S5ED 2JA6G 3M4PA 3RN9C 1DJRD 1PXUA 4GN3B 4W9DA 3GTOB 5J18A 5T1GA 2B2TA 4JI1Q 4GLAC 3J7ZC 1A6XA 4HIKA 2K5DA 3KOJA 1K8OA 3TL5A 1HHVA 4DV7L 2OHFA 2N8NA 3SK8A 1VQIA 2ZJPA 3CCUA 2NVXH 3CPWA 2WQYB 3MHSD 3KLRA 4QIWB 4UP7A 2KJ6A 4II3B 1U4AA 5GROA 2O2VB 3HIZA 2E2DC 4K8IA 1TT5B 4DQOC 5KNBA 3AEDB 1AE3A 1R4NB 1JWBD 4GLSC 1LGRA 2DWQA 1FPYA 1EY7A 2NWGA 3KBXA 3MXNA 4IUQA 5M3MH 1ZOYB 2I38A 2O6VD 3M62B 3QA8A 4FXCA 1EZ6A 3OPOA 5HG2A 1IL2A 3ND9A 4GOPC 4BBSH 4ARIA 3HOXH 2Y5CA 1MI2A 4QL5A 4EQNA 3N1YC 2B3GA 1SE2A 1HH2P 3BS1A 4JI4L 2KQ4X 4GNXB 4JPBW 2RMMA 4BY1H 2QA4A 2K8HA 5EPJA 2WXRA 3QHTA 1S5BD 4IC7B 3A33B 1XLNA 1SRUA 5E6OA 3RUZA 1Z47A 2A74C 2QW7A 1KD1C 3S1MH 2VH1A 2WDVB 3K0XA 3DQVA 4DPGA 4B3RL 3H3VC 4OHJA 1BQQT 1UNSA 2KNBA 4DR7L 2MBHA 1PH7A 2A5UA 2PQAB 2L52A 2K0PA 4XQNA 1CFMA 4I6LB 3IFTA 3X0WA 1YJJA 1VQHA 1IBML 5GAGC 1I6HB 2Z6KA 3D6WA 5A2QL 2JXXA 4NAWB 1B3QA 1GNUA 5NUCA 1O7ZA 1L2FA 4TMAB 1GUSA 1ASYA 1I6HH 2A19A 3H0GH 4K81A 1KLVA 4DV3L 4OVZA 2QCZA 1WJUA 1A15A 4ZKCB 1JWUD 2PCFB 1GC6A 4BBRB 5C6AA 3R3MA 2JVCA 2HT1A 1BUIC 4KJOA 4QQBX 4LFCQ 3SK5A 4A3CH 4RHSA 5IYBH 2PI2A 1JWAD 1VZ8A 4WWMA 1WGHA 5DAUA 4MH8A 5DCNA 3M4OB 3MEHA 1JROA 3MEFA 2KDEB 3DWGC 4IUNA 2JEBI 1PYWD 2ZT9C 3DVGY 3KYHC 4ZRPA 3OJ3A 4NAWA 5CR3A 2D2CC 3Q22A 4RGMA 4M8NA 3PIPA 3PO2G 2OWOA 1CZGA 4OIKA 5M3MB 4A3DB 5GMVA 5I9PA 1H9KA 1N9WA 4B3TL 1MGSA 1P8LA 2A4ZA 3D4DA 5D3DA 3JAML 3S2DH 4JI8L 2WXQA 1RHPA 2ZPYA 4IWQA 3AB5A 3NUCA 1UGMA 3RULA 1MBYA 1K8MA 2KBNA 2ZM6L 2PQEA 3GTLB 3Q8AA 3CC4A 2KDBA 1GG3A 3EJIA 3AB9A 4A3EB 2UUCQ 3GTLH 3E9IA 5FLXc 2N78A 5AJ3Q 4O2DA 1MJDA 3S14H 3OLMD 4M00A 4ZRJA 1EY4A 2PIAA 4C3HH 2LUEA 3PTFC 4RAUC 3ZLZA 5IT9E 3NY5A 2B2VC 1EOTA 4TQ1A 4HLEA 1GO3E 2L0TA 2SAKA 2FNJB 4IWOA 4Y7NB 4PS7A 4GXBA 1VQ8A 5HI1A 4NJCA 4DV6L 1TU2B 2KJXA 5C3JB 2IPKD 4JLCA 2WFWA 4KHPL 1X3QA 1MSGA 1TR5A 3TZUA 2RPQA 1SMXA 3VR3A 4EOYA 1GB1A 1WR6E 1GUGA 1IYFA 2E2JH 2DNCA 5ELNA 3NUHB 4KZ0A 1WE6A 4B0EA 3UDFA 2WXGA 2HHHL 1Y56A 3E9HA 4L63B 1PGBA 1YN3A 2EYHA 3K7AH 4A20A 2GBRA 4IW0A 3PT2B 2NPTA 1FMAD 2EXDA 2BWFA 2WXOA 3Q3NC 1GOZA 3QK0A 4NDXA 3ML8A 4KY6A 3N20C 1VF7A 2F0SA 4DV1L 1A63A 3M63B 4YTNB 1EEID 3A4RA 5LNK1 3L9AX 2C9WB 5M3FB 4H7BA 3GTPB 2UUBQ 3T3OA 1VF5C 2MP2A 5D65A 1DM0B 4XZ4A 4RFBA 2BDNA 1EYAA 4LDTD 1N5XA 2L9HA 2XGTA 2JA7B 1K52A 1QB5D 3WIMA 4QIWE 2DNEA 2QDLA 4JOIC 4S0RA 3VRAB 4C2MB 1PH3A 2ZZPB 4GOCA 4FF1A 4DR1L 3FKIB 4W9EA 5IWAQ 2FINB 2L1BA 1GPXA 4IG7B 1WTPA 3HOVG 5DPSA 4KY7A 2XRQD 1B9MA 2KDMA 1QE6A 4JI8Q 1UELA 2ZNVC 4ME5A 2WGSA 1RODA 2R7DA 2LXAA 1HZ5A 4GDLB 4K2KA 2J52A 4XWTA 3PQIA 1OQQA 3RN5A 4E71A 3I8ZA 1FXAA 3KF6B 2BGFA 2L15A 2LVQA 3I4OA 4FHJA 3SDZA 3GTGB 4MH0E 3DUZA 3Q3JA 2QDFA 1GHKA 1WTXA 1H9JA 2NZHA 2VS1A 2V4DA 1WD0A 1C9FA 4H0LC 4REZA 3CP0A 1T5EA 2HE7A 1UWMA 4QUFA 4N6EB 2ZVNA 1TXYA 2MW5A 4LMQD 2WXHA 5AFWA 4DV6Q 1IGDA 1K53A 3TBLD 4G57A 2PVGC 4X66Q 3S24A 2CFMA 4P2CB 1U4RA 4IUUA 4JOIA 5T8IA 5ELDA 3TMEA 3GZNB 2HJ1A 3A74A 5L37A 2MA9B 4BWGB 1VQNA 3ICEA 1WYDA 4Q5VA 1WX7A 2A69C 4NPSA 1XCTL 3KK7A 2R7ZB 5BYQA 3UQAA 4LW1A 4Z9CB 4QJFA 4LF7L 3ETRA 3UE0A 1MHWC 2IGDA 3QIJA 4KGSA 3T53B 3L08A 4BXXG 2K1FA 1SSNA 4HXDA 3PRMB 3GTOH 2XK5A 3GE3C 1K3BC 1E2ZA 1RFAA 3PGZA 4C3JB 4DR2Q 1YNTE 2LVPA 1EYGA 3O65B 1IBXA 3KUCB 1M1KC 4A93G 4FADA 2LVOA 4HKZE 4ZOHC 2WU2B 4FXGC 1SNMA 1SNOA 4R4IA 4F87A 1K83B 1WJJA 1YNND 3TBIB 3GZNI 1G291 2AHOB 3S2DB 3F1ZA 2VNUD 1WXAA 1YX6B 4XIGS 2GVAA 4OWWB 3R2TA 4A3FG 4IKGA 3PLVA 2Q2HA 1TYGB 3CCVA 3OOCA 3HOWG 3KDFB 4LNQA 2NVTB 2MEKA 4YHHQ 3L0WB 1Y8OB 1U4MA 2GA4B 2K05A 2O5JC 1Q1BA 2OJRA 1UE5A 3T16A 3UGBB 1HE8A 5L83A 2F0VA 2R93G 1WZ0A 4LUZA 2LRWA 4ACFA 2G9HD 2AUJD 4ITKA 1ZDXA 2AL3A 3T9LA 4KGRA 1FNUA 2F52A 4CJ0B 4K1RB 4DK6C 2KHSA 3GTGH 3TP6A 2PYKA 3NSWA 4DHJB 2WDRB 2C35B 1N6ZA 1BDOA 5IP7H 4GNXC 1PMRA 1STNA 5FLMG 1NVID 2X69A 4KV2A 3VUYA 1NDDA 5LL6S 2NBWB 4LJPB 1E9MA 2SOBA 2SDFA 2I5HA 2K5HA 5ELOA 2J7QB 1L5PA 1ICWA 2Q2UA 1C9OA 4O1NA 4WRDA 5CGKA 1CQVA 4LWCA 2GBNA 4PT5A 3OIPA 1WXSA 1UE1A 2C5CA 1L4ZB 2KO3A 2A68C 2MO0A 5C5LA 3PMFA 2KCMA 2ZXRA 4RGTA 2IHFA 4IJLA 2IY5B 4B08A 2KACA 5JZEB 1PZID 4M0WA 2D3AA 1KNAA 1Q8IA 4DA2A 1IBLQ 4FF2A 4IOAA 1WF9A 3D32A 2YYZA 3JW0X 2EELA 4KN7C 4P72A 4HMIA 1SIFA 2K5PA 1CSQA 4A3GH 2OF1A 1WJ6A 2B29A 2N9LA 3HOYG 1K3RA 3HEJA 2HTME 2VH2A 3KQ4A 4H2AA 2INDC 3SK6A 1F2ZA 2FBWB 1SYBA 3EVQA 4IM2A 2B2UC 5K36H 4EQPA 4R1JA 4RHRA 1WFQA 3EGRA 4I7ZC 1E24A 5ELCA 3UI2A 5HGTA 2CWAA 3VQIA 2IX3A 2K03A 4TSSA 1I4GA 4QUCA 3GP7A 1QUQB 3Q24A 4PYUA 4GS3A 1JCKB 3JAMc 2L76A 1VCBA 1SFOH 4U673 1SMYD 4OONA 1F9SA 2JA6H 4B3SL 3ZKJC 3I73A 4LF6Q 1U9RA 4RCOA 1JOQA 2L5TA 5CTRC 4Y7NH 1K0RA 2R2QA 4XE0A 1SNDA 2K6QA 2MJ8A 2LFIA 4NNJB 2I1JA 5IY0A 2UUCL 3Q0AA 4HJ9A 1R7SA 5EAYA 1FEHA 1D5XC 4A3EH 1DOYA 1CTMA 2BOSA 4YWKA 1HA6A 3HGBA 3JAMi 2L1AA 3K5MA 3EECA 2XBBC 3MFGA 4JV5Q 3CC2A 2RBMA 1HZ6A 4DXFA 3DHHC 3AH7A 2KX0A 3PHXB 1NCVA 1UEBA 1NYQA 3CRLC 3PO2H 3TCAA 3V3XA 4NB3A 1GKHA 3OSOA 3F8TA 4MEMA 2LMCA 3PF5A 1VQDA 3RR5A 3PRPB 2WXIA 3NTHA 1C8CA 3VUWA 3DXJC 1BMLC 2NR2A 1SE8A 2VUMG 4ZCKA 3KVFB 4P6VF 3H7SA 4KKUA 1IBKL 2IX1A 2JA7H 1T0SC 3CRKC 2RCFA 4DU9A 1E7UA 2F0GA 3Q23A 5GXGB 1YEZA 3V6CB 4NJ6A 1PTOF 3MC0B 1G8ZD 2L7RA 3AYHB 2RSOA 2B63B 2CWPA 2EY1A 2Z4IA 2NVQB 1QKZA 3VTWA 4EZJA 3QOLA 4LLGM 1JRPA 4A3BG 1WX8A 2WXNA 3UDXA 2L4NA 1KAAA 2QEJC 1C48A 4B9KA 2D10A 1U4PA 1I50H 2K7VA 1D4BA 4IPCA 1ET6A 4DR1Q 5IO9A 1H9SA 1II3A 3TS0A 2UXCQ 4G7ZC 1F9QA 1PH4A 1HRJA 2KC2A 4YT0B 1L0WA 3S1QH 2KJRA 2YEPB 4LF6L 4WJ4A 1N60A 2HJ8A 2L8JA 1TZOA 1UWVA 3RNBC 1YHBA 3I2ZA 1PRTD 2J0JA 1P1AA 1QG7A 4KSKC 2KLGA 3K5OA 1OFFA 3CSTA 3DBSA 1ZXIA 1KNEA 2Y5PA 4I6PA 3LWUA 2HTHA 3VDYA 3E0EA 3A8KE 5H8YE 5E6PA 2I5MX 1YN5A 2HIVA 1MG8A 1BCPC 2Z8LA 4HN7A 5GADC 2XK5B 2RDBC 4E74A 1OXTA 4GIVA 1KAWA 3KUPA 1Y1VH 3K59A 3AE7B 4BOSC 1I3QB 2ENBA 1J5EQ 3F2CA 3KWLA 3FDTA 2AL6A 1DD2A 2CVRA 1TWCH 1U4LA 3PS6A 2KEEA 5BO4B 4JWSC 2UUAQ 2QCPX 4KX6B 2A1AA 4IOCA 2ALYB 1YQBA 2DY8A 3W9CB 5J17A 4XQJA 4FF4A 2F0IA 4LNOA 2BS2B 1BNZA 2Z9HA 4XYOA 3V2TA 2NN6H 3I57A 1YNJD 4TV3A 3OTOL 1T6BX 3IVFA 4WJQA 4EEWA 3BYTB 3RD4A 3CSFA 4C80A 1WE7A 2F03A 1FR3A 1TWAH 4LNFA 4URKA 3NVYA 3VR4A 2MBEA 1AE2A 2B8GA 1OGWA 1XTDA 4G4KA 3KYDD 2AWNA 1E1OA 2NTTA 4DR2L 4X3SA 3WAPA 3FILB 2JZZA 4LF5L 1LABA 1Y8NB 1AYFA 4BY7G 2DZMA 1NEKB 4ZQ3A 1PV4A 2O6VB 4P1CC 4XC2A 4LUOA 2I2YA 5JVG3 2UXCL 2ICEC 4IPGA 1IXRA 5FO9B 3MC8A 1GUAB 4GN1A 1B1ZA 4OZBA 3NXWA 4JI2Q 2KWVB 3RT3B 3BY4B 3A8IE 4DR4L 3BYYB 3TN2A 2D3GA 5KYLA 2KKCA 3DEPA 4A3LH 1W6JA 2NN6G 5E1FA 2JEAI 3HOUG 1GJZA 1ZEQX 3NPPA 2Y0SE 1Q10A 4YWLA 1XLOA 4JI5L 4K5XA 1KQSA 4MDKE 2JT4B 4R8IA 2BB5A 2JYTA 1L1OC 2DLBA 3MXNB 4A3IG 1OXVA 2KXJA 3H94A 1HFGA 3T1YL 1STHA 3A54A 1XMQL 2D5DA 1WMHB 5IGGA 2LGIA 4A3KH 1TIID 5ISRA 1HNXQ 1GM5A 2KN5A 4HVBA 5G5GA 5KIXA 4DHZB 5FK9C 4A3MH 2KTRB 3VUXA 2LGSA 2UUAL 1PH9A 3K57A 5EQ0A 3B08A 2AYOB 3IG3A 3BDCA 3MXGA 2YU9B 3P4RB 1D6EC 4AOFA 4LTUA 1SYCA 5E6JA 2B63G 1F2MA 4HPMB 2A6ED 4EQ5A 3RZDB 2IZVB 4JI7Q 2CHWA 3B6YA 5HGQA 4GB9A 3W5UB 2D62A 3ER0A 3Q2AC 1PRTC 4C1NI 1NI3A 3HHMA 2Q5WD 2D0OA 5DLQE 3HKZB 4GLXA 1A70A 3CMMB 3P42A 4MJSB 2WXLA 4XWWA 3TIXA 4BBRG 1RLFA 2VUMB 2JRIB 1UEAB 3TEYA 1P16A 2FFKB 4YL8A 3DVNV 4HKQA 4GSWA 1E7ZA 3CMAA 1BBWA 1LT6D 4P71A 1WXQA 4Q2JA 3MAQA 1HZAA 2CKZB 1EFWA 2Y5BB 4ICVA 4USAA 1ZYRD 1FFVA 1IUEA 1ENCA 1YQ4B 2G5DA 2WS3B 3AEEB 1J0GA 4YWGG 2YTXA 4A93B 2F4VQ 3MJWA 3BVMA 1XMOL 3QWZB 4IM3A 4DBGA 1GJXA 1P7EA 1JJGA 3JSVA 2F0TA 2FHTA 2B2VA 1YJ1A 3PO3G 4US9A 3TJPA 4GNXA 1LM8B 5JH5C 5E7NA 2EYOA 1V8QA 2BE5D 4MZ9A 1PFNA 5KGUA 4HJAA 4EGVA 2CW0D 3WCQA 1K8GA 2W9NA 2KCTA 4GDLA 1RCVD 2JK8A 3PV0A 2DJGC 3A5ZB 3J81j 4BFRA 2RQXA 1T3QA 1UWXA 3RLFA 3HOZH 3K81C 3PF4A 2NVQH 2IGHA 1O7LA 1XMQQ 4HEA1 4CDEC 4YIJA 3M4OH 1Q8KA 3RNUA 1UZXB 4CKEA 4YCVA 1EY8A 4LF9Q 4NY0A 2WAQB 5CV8A 4W9JA 1STBA 2VB3X 1VQFA 1IW7D 2K22A 3BU2A 2M0AA 4ZDVA 2J0KA 4CGYB 2QILA 5C0XG 2KANA 4G7HC 3J9CA 2MUYA 3NTKA 5IIFA 5AUIA 3KLWA 4BBSG 2ES2A 5I2YA 3OW7A 2KHWB 4DV2Q 3RNEC 1A3VA 3NZSA 1IBKQ 3M95A 3SVMA 5C3EG 2KC1A 2E3TA 1WCMG 2PJHA 4LF4L 3R93A 2PPBC 5D94A 4UAIA 3L3OC 4JYAL 1MHXA 2N1VA 2PZWA 1SN8A 3QAQA 4G50A 1EQRA 2PW5A 4C3HG 1A2UA 1LT5D 2LMCB 1AH9A 3PPAA 1NUCA 1SXTA 3ZQ4A 2E2IH 1WXMA 1TWAB 1PQSA 3N1ZC 2JSOA 4C56C 3RUIB 3JC66 4NZLB 5D2MB 3PCOB 1TBEA 1HA5A 2Z59B 1E3PA 1HCZA 2WHIA 4WJOA 2R92G 4DFAA 1VQAA 3PUWA 1YNJC 1XMOQ 3PO0A 2UU9Q 1RD9D 3MHBA 3K7UC 3ND8A 4FJZA 1T0QC 4ASWC 3WAMA 4GDKB 3Q6BA 1KOTA 3KDFA 2A6HD 4X3UA 4AQYL 1L7YA 4J15A 1STAA 4DV4Q 3IXSA 1QVGA 4BOZB 3LXFA 4K6DA 3ZYYX 4NXNQ 1YI2A 5IYBG 1J19A 1W3SA 1PH6A 2PMVA 2C5LC 2L32A 3PZ7A 5EKIA 4KHZA 3QR8A 2LGDA 4QAYA 3H15A 2C9OA 1P9DU 4HPPA 3VH3B 3HOUB 4WQOB 3IL8A 2F0KA 4HJ7A 3L54A 4X3TA 1OXXK 2F0FA 1FCLA 4EX5A 2V0GA 1N63A 3AULA 1WY8A 3APFA 1JB7A 1QOHA 3R66C 1V1PB 4K0KL 4JI1L 4JCVE 1A3UA 4DK5A 1VQ6A 4FULA 5IODA 2F3IA 1C4PA 1SR3A 1XYIA 4F7XA 1NTGA 1CKNB 1OXSC 1IP9A 1FJGQ 2MGSA 2ZXOA 1RF2D 2XRSD 2ZJRA 1JRUA 4HK2A 3ZO5B 2AX5A 5HFYA 3U9OA 3P4QB 4HCNB 4ALPA 4OW0A 1NENB 4BY1G 1I50B 2X8XX 4P75A 4DUZQ 4FN2A 2HIXA 5M3FH 5BR8L 3OWFA 4JYAQ 4AYBG 1A3TA 1I42A 4BA1I 1IHZA 2C7HA 3NS8A 2CKHB 4F8CB 3OW2A 4RMAA 2ZXPA 4TKNA 1JICA 1ZDVA 1LYLA 4ZHPA 4B95A 4IDIA 5GAHC 2ZCBA 2E8GA 4Q0FA 2OT2A 3EROA 3EFXD 1CA5A 4L5RC 2KMMA 4M01A 2ZNVB 4BBNF 1ZP0B 5CHVC 4PG3A 2KCCA 4L6TB 2PTLA 3NJTA 4CHKA 2KVRA 1NAPA 3K6OA 1WVLA 2NVTH 4JI2L 1RWSA 2JA5G 2DJFC 1HR0L 3GS2A 3NG0A 2FIDA 4CDCC 1VQ9A 2EJMA 2K32A 4LNNA 1IBXB 4FBJB 4JIOU 4DR7Q 5CMDA 3S16H 4PS8A 4ANWA 4C3IG 5GQOA 3M3JA 2EXZA 3I3TB 1QJOA 2N49A 2WX0A 1L0XB 2D0PA 3P75A 2E2HH 2WDTB 4EVOA 5EE0A 1B3AA 5JPMC 1NBFC 1N34L 3ZXRA 3MXPA 2DGYA 3UE1A 4IURA 1QZEA 1X3GA 2KFKB 3T1YQ 2KMCA 1PZJD 3S16B 5JXVA 2J4XA 3DBRI 3S15H 3HFZB 4NAMA 3AEAB 4R4QA 2FJ2A 4J1MA 3U4VA 4C2MH 3BK1A 5FR3A 1EIYB 4V0BA 1LTLA 3I4NG 1SE9A 1B44D 3NE5B 2OJWA 3T4AC 1YBYA 2Q8RE 4J8QA 1VDVA 2FCNA 4EZLA 3IAM1 1CSPA 4MTKA 4GLVB 1YQ3B 3DWPA 2JA6B 2ZW1A 3CCMA 1KRHA 2CS4A 1WH3A 1WYWB 3UI3A 4ANUA 2WAQG 1PHJA 2JWUA 3GB1A 1SAPA 5E4WC 1EWIA 2E2HB 4HPLB 5LXHA 3MZ5A 4DUYQ 3PUZA 4DUZL 2F0DA 2VXWA 3OYYA 1NMFA 2KFKA 1ICFB 5M5XH 2F0HA 1BF4A 1NBWA 2F0PA 3DBHI 4GKKQ 1JW9D 4C4VB 2B2UA 2EDGA 1WGGA 4BBSB 5M5XB 2JZ3B 1K73C 5IP7G 1WFYA 1LLRD 5FLMH 1Y1WB 1P98A 5IGEA 1BUVT 2WB1E 3CQZH 2ZPNA 5IGFA 1Q81C 4H02A 3ERQA 5IAAC 1TWCB 4GOPB 1HFNA 4OL7A 1SLJA 4O0AA 4DK1A 1SFOB 4KKSA 4WJ3M 2MLBA 1JORA 4XT1B 1Y8RC 3TEHB 4LFAL 5IOIA 3Q8BA 3IAS1 5JVH3 2KN4A 2GBKA 2VQFL 3TP7A 2WXMA 2O2VA 3AEFB 3C19A 3V60A 3HVZA 3A1QA 4AH6A 1XEEA 2LHDA 3OJ4B 3MA2B 3SFEB 3H8HA 1QVCA 3M9BA 3W2DA 2MPMA 4L8JA 4KVGB 5E6NA 3SGIA 1HTQA 2XWBB 3P20A 1F2LA 1N8RC 1N34Q 1EYDA 2DZIA 1KH0A 3N3KB 4CDDC 1QILA 4G7OC 3CHBD 4GKJQ 4EE2A 4KDIC 2JE6I 5DPRA 5TSSA 2BBCA 1R4NI 1CUKA 3ZJYC 4GGQA 2HHHQ 5K36G 1ENFA 4ID6A 1BR9A 1E8WA 4QGUA 4FHKA 2MP2B 1P7FA 2EYMA 3P63A 2FIFA 2JP1A 1EEFD 2NCNA 1BCPF 1LTTD 2NVYB 5IYDG 4ZHOA 3WOFA 1JJCB 1R4PB 2BQQA 4V190 4ICUA 1W2BA 2A6EC 1VQPA 1CJEA 2CJNA 4AUQC 5KHQA 3RZWC 2D07B 4DUYL 3VR9B 3RLOA 3AFQA 1CT1D 4NJ7A 2KYWA 4GKKL 1IW7C 2CH4W 1WMHA 1WTQA 1TS4A 1WJNA 3HP3A 1Q3LA 1YJWA 2V1YA 2DUDA 4NXML 2NBUA 5JJLA 3VYRA 3WWVA 4CKCA 4OEMB 2L0CA 4US8A 4MGIE 2UXBQ 2EQSA 4DK0A 1YOVB 1YMHE 2MRPA 4C3IB 4JI3Q 1O80A 3QARA 1FYCA 3VFKA 3S1NH 3G7LA 3AE9B 2ZTDA 5EKKA 3OHXC 3IT6B 3B9JA 3Q3FA 4DR3L 1TWHH 4IOIE 1GD7A 1ESRA 1YJNA 1ROEA 2H4OA 1SF0A 2CHZA 3R7RA 1C0AA 1EU3A 3ZXVA 2RA4A 1VQ5A 4BXXH 4YY3Q 3QO2A 3VYTA 2AEHA 2V1CC 3EIVA 1JE5A 1RKNA 1B70B 3NBHB 1TGZB 1ZKOA 3U50C 4W9FA 2J7ZA 4X66L 4NXNL 4HCSA 3G6EA 1GUOA 1KDCA 2V3SA 3I4MG 5D14A 2B2YA 4R3DA 1N62A 1AFPA 5EGTA 4MELA 4EKUA 1HPCA 5M9OA 3HVDA 2QF7A 2HCIA 2GRIA 5G3LF 2KD0A 3ECIA 2XTIA 3ZNID 1X3PA 1OQYA 1GUWA 3D0FA 4TQ0A 3G48A 3MWYW 3EUB2 2ID0A 4CDFC 2LJ5A 4BKSD 4GDKA 4PMCA 1KL9A 4RKLA 1QQRA 1TZ1A 2KQ7A 1C1YB 1HQMC 3I70A 2F0EA 4A76A 1UBQA 5EJWA 2KMAA 3S2HH 2UU7A 2R61A 2D3BA 3FKYA 4KY5A 3CF5A 1XNQL 2Q8TA 1FJGL 2JA9A 1LT3D 4FVMA 1LFDA 4CJ1B 1TWGB 2V9HA 4UDUC 1Q1OA 1I4QA 2UWQA 1L1OA 2R7FA 1K8AC 2NZOA 5L95C 5JJKA 3K58A 1X6OA 4M1UB 4RG1A 4JPSA 2LGYA 5BR8Q 4KIKA 3E3XA 3JAME 2BB6A 1NI2A 4JI0L 1YHAA 1B2TA 1ENAA 3FHWA 3GDEA 2GBMA 4JVZA 5K5PA 4X62Q 2Y0SG 1DYQA 4WAFA 3D4WA 1B9NA 3DWQA 3ERSX 4UPAA 1LUZA 3A5UA 1RL2A 3X3NA 2WDQB 1NR4A 3AXCA 4R4CA 1KIXA 1J7BA 1WX9A 4YTMB 4S3SA 3AQQA 1ZGUB 1MD2D 1NJIC 3KYCD 4MGKE 5JEAG 4KLKA 1QNKA 3U8ZA 3TS2A 5JEAJ 3AU7A 2E5LL 4IPHA 4D2KA 4P74A 2FUG1 4XXEA 1DOXA 2YTVA 4KMUC 1Y1WG 1VQ4A 3Q8DA 3DHIC 3MFYA 2Q2TA 2Z4HA 4KD3A 4DR6Q 1H8CA 4IO9A 2PNRC 1VS0A 2K5QA 5C3XA 4P7IA 3D8GA 4OX9Q 3CCQA 3RZOB 1IGCA 1E6EB 2K25A 3U52E 3K5NA 1I7HA 3U30A 2I07B 2BH2A 1EQTA 4UY8C 1PRTF 1T5XD 2PVOD 4XT3B 3C2PA 1ET9A 2NVYH 2ZVOA 3BVGA 3UDIA 3AM9A 5IN7A 5C3EB 1YJIA 2HUGA 1ZE3D 1WTOA 2OTJA 1TTNA 4BAXA 1TWHB 4HEDA 1STYA 4QY7A 3P1MA 4OIJA 3SXHA 2N55A 2WKDA 2QEXA 4FNFA 2KWCA 1AZQA 3AU4A 2WP9B 4RF0A 2MBQA 5H92C 4OXPA 3F2BA 3L10B 3RNFC 3TEWA 1TVXA 2HQEA 2K39A 4JL9A 4DKAC 3AMUA 1PA6A 5AUKA 1Y1WH 2L05A 3L4PA 3I63C 4NW2A 4PMWA 5CV4A 1Q7YC 3CCEA 4OVUA 2CU1A 3DEOA 4RH6A 4HWIB 4MM3B 1LV9A 3C0RB 4WIPA 1IYUA 1TY0A 1CK1A 4RM8A 4A3EG 3TZDA 1IPGA 2HDMA 4HJ8A 3IT4B 2H89B 2V4IB 3T1HL 3H1UA 3F2UA 3JVZX 4LNKA 1VQ7A 3QCAA 3ZIMA 4B3SQ 2BF8B 5C4XB 3ZJUA 1C7YA 5BYSA 5EE3A 4KJNA 5FO7B 4JI6Q 1FVIA 4A3KG 3RZDH 1YITA 2DAFA 1EUVB 4FF3A 3ENEA 3V61A 1VR9A 4FYDA 2BW2A 3A9KB 4X64L 1DONA 3Q14C 3VRBB 2WINB 1PUTA 2WX1A 5IOCA 3J7AF 3DPDA 1B8AA 1WTWA 2N9EB 4LFAQ 5KYIA 2W3SA 4L2YA 1WJ4A 4W9HA 2B3AA 4A3MB 4BVUC 4L5QA 5FLXL 1KDAA 1L4DB 4HTHA 3RI7C 4AQ7A 3W5OA 3IHPC 1XD3B 2W3RA 4KDLB 1TWFH 4JV5L 1I4HA 1PGXA 5HHDG 1SNPA 2NS5A 1VQEA 2BH8A 3DM1A 3HG9A 3U58A 2A68D 3EA6A 1ZXHA 1QLBB 2IO1B 2V4LA 1MI0A 3L13A 4RF1A 4LF8L 3HOYB 1HXYD 4DN4M 4GN5A 2VQEL 3H7PB 3UINB 2J53A 2BKRB 4A3GB 5M5YB 1C76A 4DV3Q 3R2IA 2QKIC 3PO3B 1SYFA 2XSCA 3BDOA 4ZRZA 4BY1B 1TS3A 1IYVA 2KLCA 4BBRH 5BYRA 4QMGA 4JI4Q 1X32A
chains in the Genus database with same CATH topology
1QOBA 3QB3A 3BZDB 1CQFA 4IALA 2NTSA 3NQTA 2WLBA 3D31A 1F2YA 3J81L 1WSPA 4KKIA 5A35A 1CZWA 2MJ3A 3HRZC 4TKOB 1F9RA 4HR7B 1TY2A 4XDCA 2RDHA 5KNCA 2OEOA 3CU7A 3L7ZC 1OQRA 4DAPA 4LK1C 4DF7A 1OO9B 1NYRA 5C0XH 2INPE 1H9SB 1Y8PB 2F0JA 3Q6SA 3KWVA 1IKLA 4KN4C 5BMIA 3VR8B 2Y0SB 1VRAB 3D3RA 1J7AA 3FPPA 2KAJA 3S17B 3OMCA 2V3NA 1KTKA 4N59A 1YNNC 2DYOA 2HCCA 1OXUA 1FO4A 1KABA 4OO1G 1VJKA 2TMPA 1S5CD 1VLBA 4CHTB 1CHQD 2DBYA 2R3ZA 1RM6C 4CBVA 1FGBD 5CV6A 1E0ZA 3FMCA 1L0YB 4A6QA 4ZRQA 1LO5D 1WD1A 4MN3A 4IQZA 1PDQA 4RGNA 1PTOB 3BWUD 2LUMA 2O5IC 2O2LD 4KGTA 2WU5B 5BMGA 2R93B 1WTVA 1SJHD 1PGAA 4LJZC 5BN3A 3AE8B 1O78A 3D4RA 2K9XA 2WACA 5E3FA 3ZGZA 2F1MA 3DWAA 2X38A 5BN5A 1VCIA 1JMLA 2EY2A 4ZUIA 5BN4A 1EY9A 2ZW0A 1G91A 3GTKB 4JE3B 3IFDA 2PW7A 2JA8B 1TKWB 1D5ZC 2NYZD 1EWHA 1PTOD 2F0MA 1A2TA 3LNNA 3AE4B 3PIO3 4KHVA 1I4XA 2MJEA 2JXMB 1HEZE 1CI3M 2LS01 4JBWA 1V8CA 2RDFA 1Q12A 1ZUD2 2JA5B 2BS3B 1DOLA 4DNRB 2M56B 1FIQA 3K7AB 1VZ6A 4NKLA 4NMZA 3NTIA 2RPVA 1EWCA 2RVLA 3AV8A 1Q90A 5G3LD 1XCQL 1SYGA 3U7ZA 3C3LA 2G9DA 3NBHA 1HTPA 1LT4D 2RDGA 1IL8A 4RCNA 3SEBA 3HOZB 5CYUA 2A69D 3ONAB 1B9RA 3W3AA 1ZPSA 1MSHA 1SYDA 1XO3A 1WYGA 3DWMA 2JSVX 5IGBA 1XTCD 2W82A 4QF4A 1ACCA 1DOMA 2LFNA 3VR5A 3P1HA 1DZ1A 1N5WA 2LHEA 2KOLA 3I9V1 5CORA 2B2WC 5C5MA 3FPUB 4ZK9B 5HURA 1PTOC 5I6WA 3KF8A 2JU6X 1SJED 4MIUA 1EZ8A 4ZKBB 4I65A 4DAYA 3HOVB 1H9RA 1FM0D 1TJEA 4OZAA 3R3OA 2EYJA 2M00A 1S5FD 4YXDB 4KKJA 5C4ZA 3AECB 4RNAA 1G6ZA 4C1NK 5ELBA 1SB3C 2H88B 4IZ8A 3J80L 3R8BA 4WORA 3SFDB 5EE1A 2MH7A 1LTAD 1I4RA 1PTOH 2B2WA 1QOFA 4L1BA 4CKBA 3BK2A 2F0OA 5JOBA 3VR2A 3M4YA 2PZUA 1TKYA 2K01A 1TQOA 4A8XC 3S1MB 4IUTA 1FD6A 3GQBA 5JJZA 4PV1C 3RFZB 1PFBA 1ZXTA 4LK0M 3VA5A 2XIWA 3MXUA 2KECA 1LTSD 1XF5L 1JWMD 2B8FA 2EZVA 4GZYC 1C4CA 3NZ3A 1KLUD 1E2VA 4XYQA 4ULLA 1VMPA 5M5WB 1WRIA 2BA0A 1GB4A 2X6LA 2MP1A 4WJWA 4A3KB 3BVZA 1GAQB 3CIRB 4QB4A 3BIID 5EE9A 1B53A 1WCMB 1CM9A 1QCBD 3NWTA 2KQ3A 4QCLA 5MPOA 2EYLA 4U68A 4CJ2C 5KEEA 2Z1CA 4F88A 1JC7A 3LWEA 5C44B 3E9SA 5KRUA 5J39A 1N61A 4IN3A 2INNE 4IFDG 1CZPA 1AN8A 4ILWA 2A5HA 2QDBA 2EYPA 3TDQA 3TSSA 4PQXA 1RJTA 1D1IA 1SBBB 2V3PA 3P4PB 3T13A 4ZYSA 3IAYA 2L83A 1LTRD 3E6ZX 1DGJA 3X3MA 1JALA 4N58A 2XN9C 3AEGB 1L0VB 1GUTA 1JQ4A 4CQNA 5COYA 5EPKA 1D1KA 3AE3B 3S1QB 1STGA 1XX8A 3HOXB 3G6JB 4NP5A 4HROA 2IJ0A 1Z6HA 4J6HA 4TRDA 1GXDC 1V97A 1UAPA 2D9UA 3M85A 3NWSA 2R6GA 1R4QB 3OIQA 2BTEA 1ESFA 3I72A 2IGGA 1WWTA 1EM7A 1HQRD 4N9TA 2PW9A 1V1PA 2IWHA 3K5LA 1TWFB 2JXTA 2K3UA 5F2DA 1EY0A 1FFUA 3MTSA 4HMJA 2WP8J 2RSNA 1SSOA 3S2HB 3HUIA 2N0SB 1TS2A 1V1OA 1DOKA 3T51B 3E5SA 1PZKD 3AE1B 5FO8B 2DN8A 2ICIA 1EQVA 2LKVA 3QWNA 2CJOA 1TT2A 1CA6A 1FRRA 3GTMB 4XQQA 1KDBA 1M4VA 2M9VA 1Y69U 4C3JG 3C8YA 1JQYD 5A2QE 2IX0A 3SR1A 2F0QA 3MHZA 4A9AA 4HJGE 2WIIB 2BDOA 3I90A 2DY7A 3O13A 3GD7A 2AQ1B 4N9PA 5EPLA 5JAVA 3Q8FA 3S15B 4JK1C 3PO2B 2A73B 2JZPA 3NK9A 3I3CA 3N52A 3NBIA 2NVXB 3HZXA 1DXMA 2E6XA 1BCPD 5C4JB 4DGZA 4FP5D 2PLPA 1BBXC 1DCZA 3H09A 3LYYA 3LB8C 1QT9A 3Q8CA 2NZ1D 4O42A 5CV9A 1TKGA 4C7YA 1FD7D 3A56A 4B9WA 4WH4A 1SMYC 2IL8A 4A3FB 1L6UA 4OGQC 2L12A 2EJGC 1EYCA 5D7GA 2K28A 5J22A 1C78A 1O7YA 2W55A 4AS1A 2FMMA 3LX0A 2E2JB 2K1BA 3I4LA 4HAEA 3U4EG 3S1NB 4K5VA 5IGDA 2JYEA 3M7GA 4XTCS 5CBAE 4C7ZA 3M7NA 3FEWX 1LTBD 4ODGA 2Q8IB 1ML0D 5DNFA 3J7YW 2PO4A 1I6VC 5EKLA 4FO2A 3VYSA 2K04A 4YTPB 4B0MA 4PMBA 5EBDA 1S4ZA 1AEXA 3AE5B 3EQLC 1LACA 4OZCA 1MPEA 1RFKA 1PDXA 1S5DD 1C4QA 5G5HA 2BA1A 2CW0C 4KI0A 3KLSX 3B2FA 1DOIA 1JOOA 1VZ7A 5LL6X 1RYJA 2FMCA 3A7LA 4R9WA 3GTQB 2VB2X 1HUNA 2SNMA 5ELEA 3Q69A 4RKBA 4M8AA 4IUPA 1AP0A 1TKEA 4A3IB 2VZKD 1YN4A 3P4SB 4R8NA 4WQMA 1JWSD 1QWYA 1SE3A 4P16A 5FLXE 2F0NA 5JEAH 1J7CA 1HTLD 3OMGA 5BMHA 3E56A 4KD4A 5C3WA 1G2TA 2QJLA 1XXGA 3MVVA 1QF6A 3FRPB 3FVQA 3PZ8A 2F3VA 1BO0A 2LY7A 2F0LA 3VR6A 1K51A 3SHLA 5CC4A 2O4XA 3C1FA 3FAHA 1FNVA 2JYOA 1BOSA 5T1IA 3NHHA 3KBGA 3TEXA 1E10A 3PUXA 4ZLTF 1F2RI 3T3NA 3H91A 2M19A 1UGJA 3NS1A 3V05A 1W6KA 3VA7A 4OO1H 4ARCA 2L55A 3E0JA 3P7JA 1VDZA 3PIP3 3H6MA 3K0YA 1RTNA 4E6IA 2NB0A 1QOGA 1KLGD 2H1EA 2F4IA 3AEBB 2HDEA 3N6RA 3Q8EA 2AUKA 1BCPB 4BA2I 1PFMA 3I4MB 3RMHA 2KVMA 3DMUA 3KLSA 3S14B 2TSSA 3J81E 1NSNS 4OO1I 2KEDA 2EE1A 1EWYC 1AWDA 2BS4B 1G2SA 3TP5A 2E74C 1SDFA 4ABNA 5J1ZA 2D5GA 1SNCA 1F2RC 1CHPD 3V96A 2J0TD 3QOJA 3I4NB 4IFDI 1JB3A 2QSDA 4RWSC 2VZKB 3CQZB 3AE6B 1FXIA 4HRSA 3S9WA 1GUNA 1MHHE 1Y1VB 4IUVA 1PLFA 4K6LA 5D3IB 1J8IA 1C4AA 2K33A 2K5WA 1STEA 2B76B 2N7JA 5DM63 2EVBA 4DAVA 4WFN3 3AMZA 4H44C 4IFDH 1XLPA 1JR0D 1Q1EA 1FNWA 3URYA 1EU4A 2EY6A 5I4DA 2ONQA 1I4PA 5EBCA 2WXKA 4X3KA 1Z7TA 3NVZA 4JX1C 3BDLA 2WNMA 1AZPA 2KWDA 5KNDA 2CHBD 2AWOA 1KF6B 1ONLA 1M8AA 2B39A 2NBFA 3S1RB 1EY6A 2BCOA 1GHJA 2L11A 2N9KA 3QG1A 1SIJA 2PKOA 4IFDJ 5IT9L 2JQRB 1ZYRC 4EQOA 2J42A 2WKCA 2F0UA 4K14A 5C0XJ 3N9YC 4YSYB 1E2WA 2CQAA 3SE0A 3C1EA 2JX5A 1C77A 2KCNA 4KTAA 1AW7A 1EIGA 3TUOA 3CKIB 5C4HA 2G1EA 3NVVA 2A6HC 2E75C 2LEKA 1E7PB 5C2TB 2Y3AA 4ZAIA 1V43A 2ON8A 1RDPD 1PRTB 2HDLA 3J7AV 4DXGA 3AN1A 4XDXA 3WDNA 5FKAC 3AE2B 2F3WA 1QOAA 2E76C 3ITPA 1R9TB 3B2GA 1WGKA 5I2XA 2WXPA 2AQ2B 2M2LA 2WXFA 2KUMA 2XVSA 3J80E 2QIEB 2B2YC 2PZTA 2I46A 3RPFC 1VMCA 3TEZA 4AYBB 1TS5A 3ABVB 5FOBB 4H13C 4RGOS 2WXJA 3VYUA 5IGCA 3W5VB 4RA8A 4MT5A 2SNSA 1ILPA 2BE5C 4MACA 1JE4A 4BS9A 2EY5A 5DEHA 3CWIA 2QMTA 2OXPA 4F8MA 2BT6A 1EIHA 1EY5A 2EYFA 2IDYA 3IKJA 2CU3A 1SNQA 3NP8A 2NUCA 2EOTA 1SE4A 3GO5A 1L6VA 2SEBD 2F0WA 3C46A 1E0BA 4KV6A 3QJYA 1FCCC 1F77A 3A55A 2MHVA 2NMQA 4FXDA 1FRDA 4C3HB 5I6YA 2EKIA 3HS0C 3GV3A 1WTRA 4A55A 4A90A 4BY7B 4ZUJA 5JPNC 1SEBD 2RKSA 1EFID 2NN6I 3BG3A 4YSXB 4JWUC 3SK4A 5C0XI 2WV6D 1F0ZA 3PUYA 3M3YB 1HUMA 3PUVA 3TP8A 4XDDA 3OWEB 4K5WA 1RTOA 4KK7A 4K8JA 3HOWB 2N88A 2AQ3B 3NVWA 1J9OA 4KKTA 2XNAC 2BYTA 4J3OD 4MHEA 3WOEA 4HCEA 2X6GA 1EL0A 3A8JE 5E4XA 2R92B 4WURA 3FILA 2K6AA 3H0GB 2KA7A 4A3BB 1ILQA 2DYMA 5CBEE 1D2BA 2E2IB 3HRDD 1BXTA 3DHQA 3A7AB 1H9MA 2OEDA 4B9XA 1KFYB 5DM73 3MJ5A 3GTJB 1C79A 3W1SA 2EPBA 3ZJVA 2XWJB 5ELFA 3QIAA 3U2SC 3T56B 1B4OA 2IW3A 4DNTB 2ACZB 1F9PA 4HSVA 4YSZB 3NQIA 1D5MC 2W54A 4HSPA 1IKMA 2B2TC 2IT1A 1K50A 4TQUS 4PNYA 1MVKA 2FE8A 3NRZA 1XWEA 3FC4A 1NR2A 5CV7A 1PFDA 3I91A 2MJDA 1QNUA 4L23A 1UUPA 3D6CA 1LTID 3SR6A 1SYEA 5CV5A 2PMZB 1LTGD 3MP9A 2WB1B 2GB1A 3U9SA 4FXKC 2LJIA 5LHY1 1JOKA 5I9OA 3GV6A 1XLQA 2EJFC 4K2LA 4A3JB 1B50A 4LAAA 1S5ED 1DJRD 1PXUA 3GTOB 5T1GA 2B2TA 1A6XA 2K5DA 1K8OA 1HHVA 2OHFA 3SK8A 2WQYB 3KLRA 4QIWB 2E2DC 4K8IA 4DQOC 5KNBA 3AEDB 1JWBD 4GLSC 2DWQA 1EY7A 2NWGA 3KBXA 3MXNA 4IUQA 1ZOYB 3ZJTA 2I38A 4FXCA 1EZ6A 3OPOA 5HG2A 3ND9A 4ARIA 2Y5CA 1MI2A 4EQNA 1SE2A 3BS1A 2KQ4X 2RMMA 2WXRA 5EPJA 1S5BD 1XLNA 3RUZA 1Z47A 2A74C 2WDVB 3H3VC 4OHJA 1BQQT 1UNSA 2L52A 2K0PA 4XQNA 1CFMA 3IFTA 1YJJA 1I6HB 5A2QL 3D6WA 4NAWB 5NUCA 1O7ZA 4TMAB 1GUSA 4OVZA 1A15A 4ZKCB 1JWUD 2PCFB 4BBRB 5C6AA 1BUIC 4KJOA 3SK5A 4RHSA 1JWAD 1VZ8A 4WWMA 5DAUA 4MH8A 3M4OB 3MEHA 1JROA 3DWGC 4IUNA 2JEBI 1PYWD 2ZT9C 4ZRPA 5CR3A 2D2CC 3Q22A 4RGMA 1CZGA 4OIKA 5M3MB 4A3DB 5I9PA 1H9KA 2GI9A 2YEPF 1MGSA 3D4DA 5D3DA 3JAML 2WXQA 1RHPA 3AB5A 3NUCA 1MBYA 1K8MA 2PQEA 3GTLB 3Q8AA 3EJIA 3AB9A 4A3EB 1EY4A 2PIAA 4RAUC 5IT9E 2B2VC 1EOTA 4TQ1A 2SAKA 4Y7NB 5HI1A 4NJCA 1TU2B 2KJXA 5C3JB 2IPKD 1X3QA 1MSGA 1TR5A 3TZUA 1GB1A 3VR3A 1GUGA 2DNCA 3NUHB 4B0EA 2WXGA 1Y56A 4L63B 1PGBA 1YN3A 2EYHA 1FMAD 2WXOA 1GOZA 4NDXA 4KY6A 1VF7A 2F0SA 4YTNB 1EEID 5LNK1 3L9AX 5M3FB 4H7BA 3GTPB 3T3OA 1VF5C 5D65A 1DM0B 4RFBA 2BDNA 1EYAA 1N5XA 2L9HA 2JA7B 1K52A 1QB5D 2DNEA 3VRAB 4C2MB 4FF1A 3FKIB 2FINB 2L1BA 1GPXA 1WTPA 4KY7A 2XRQD 1B9MA 2KDMA 1QE6A 4ME5A 1RODA 1HZ5A 4GDLB 4K2KA 2J52A 4XWTA 1OQQA 3I8ZA 1FXAA 3SDZA 3GTGB 3DUZA 1GHKA 1WTXA 1H9JA 2V4DA 1WD0A 1C9FA 4H0LC 4REZA 1T5EA 1UWMA 4QUFA 4N6EB 4LMQD 2WXHA 5AFWA 1IGDA 1K53A 4G57A 2PVGC 4P2CB 1U4RA 4IUUA 5T8IA 5ELDA 3TMEA 4BWGB 4Q5VA 2A69C 1XCTL 3KK7A 2R7ZB 5BYQA 4Z9CB 3ETRA 2IGDA 4KGSA 3T53B 1SSNA 1E2ZA 4C3JB 1YNTE 1IBXA 4HKZE 4ZOHC 2WU2B 4FXGC 1SNMA 1SNOA 4F87A 1K83B 1YNND 3TBIB 1G291 3S2DB 2VNUD 4XIGS 3R2TA 4IKGA 1TYGB 3OOCA 2NVTB 2MEKA 1Y8OB 1U4MA 2GA4B 2K05A 2O5JC 1Q1BA 3T16A 2F0VA 2G9HD 2AUJD 4ITKA 1ZDXA 4KGRA 1FNUA 4CJ0B 2KHSA 3TP6A 2PYKA 3NSWA 2WDRB 1NVID 1BDOA 1PMRA 1STNA 2X69A 5LL6S 1E9MA 2SOBA 2SDFA 1L5PA 1ICWA 4O1NA 4WRDA 5CGKA 1CQVA 4PT5A 3OIPA 2C5CA 1L4ZB 2A68C 5C5LA 3PMFA 2ZXRA 4RGTA 4B08A 2KACA 1PZID 4M0WA 1KNAA 1Q8IA 4DA2A 4FF2A 2YYZA 2EELA 4KN7C 2K5PA 4HMIA 2OF1A 2N9LA 2HTME 3HEJA 3KQ4A 4H2AA 3SK6A 1F2ZA 2FBWB 1SYBA 3EVQA 2B2UC 5K36H 4EQPA 4RHRA 3EGRA 4I7ZC 5ELCA 3UI2A 3VQIA 5HGTA 2IX3A 2K03A 4TSSA 1I4GA 4QUCA 3GP7A 3Q24A 1JCKB 4U673 1SMYD 1F9SA 3I73A 1U9RA 4RCOA 1JOQA 2L5TA 4XE0A 1SNDA 2LFIA 2MJ8A 3Q0AA 1R7SA 1FEHA 1D5XC 1DOYA 1CTMA 2BOSA 1HA6A 3HGBA 2L1AA 3K5MA 3MFGA 2RBMA 1HZ6A 4DXFA 3AH7A 1NCVA 1NYQA 3CRLC 3V3XA 3OSOA 2LMCA 2WXIA 3NTHA 1C8CA 3DXJC 1BMLC 4P6VF 4KKUA 2IX1A 3CRKC 4DU9A 2F0GA 3Q23A 5GXGB 1PTOF 3MC0B 1G8ZD 2RSOA 2B63B 2EY1A 2NVQB 2Z4IA 1QKZA 3QOLA 4LLGM 1JRPA 2WXNA 2L4NA 1KAAA 2QEJC 1C48A 1U4PA 2K7VA 1D4BA 1ET6A 1H9SA 1II3A 4YT0B 4G7ZC 1F9QA 1HRJA 2YEPB 1N60A 1TZOA 1PRTD 1QG7A 3K5OA 1OFFA 1ZXIA 1KNEA 2Y5PA 3LWUA 3A8KE 5H8YE 1YN5A 1BCPC 2Z8LA 4HN7A 1OXTA 3KUPA 3K59A 3AE7B 1I3QB 2ENBA 3KWLA 3FDTA 1DD2A 2CVRA 1U4LA 2KEEA 4JWSC 2QCPX 4KX6B 2DY8A 3W9CB 4XQJA 4FF4A 2F0IA 2BS2B 1BNZA 4XYOA 3V2TA 2NN6H 3I57A 1YNJD 1T6BX 3BYTB 3RD4A 4C80A 2F03A 1FR3A 3NVYA 3VR4A 2B8GA 4G4KA 2AWNA 2NTTA 4X3SA 3FILB 1LABA 1Y8NB 1AYFA 1NEKB 4ZQ3A 2I2YA 5JVG3 2ICEC 5FO9B 1B1ZA 4OZBA 3NXWA 3A8IE 3BYYB 3TN2A 5KYLA 3DEPA 1W6JA 2NN6G 5E1FA 2JEAI 1ZEQX 3NPPA 1Q10A 1XLOA 4K5XA 4R8IA 2BB5A 2JYTA 2DLBA 1OXVA 3H94A 1HFGA 1STHA 3A54A 2D5DA 5IGGA 2LGIA 1TIID 5ISRA 5G5GA 5KIXA 5FK9C 3K57A 5EQ0A 3BDCA 3MXGA 2YU9B 3P4RB 1D6EC 4LTUA 1SYCA 5E6JA 1F2MA 2A6ED 3RZDB 3W5UB 2D62A 1PRTC 4C1NI 1NI3A 2Q5WD 1A70A 3HKZB 3P42A 2WXLA 4XWWA 2VUMB 1UEAB 3TEYA 2FFKB 4HKQA 1LT6D 1WXQA 4Q2JA 3MAQA 4USAA 1ZYRD 1FFVA 1IUEA 1ENCA 1YQ4B 2WS3B 3AEEB 4YWGG 4A93B 3BVMA 1GJXA 1P7EA 2F0TA 2FHTA 2B2VA 4US9A 2EYOA 1V8QA 2BE5D 5KGUA 1PFNA 3WCQA 4EGVA 2CW0D 1RCVD 3PV0A 2RQXA 1T3QA 1UWXA 3RLFA 2IGHA 1O7LA 4HEA1 4YIJA 4CKEA 1EY8A 2WAQB 5CV8A 1STBA 2VB3X 2K22A 1IW7D 2M0AA 4CGYB 2QILA 5C0XG 4G7HC 3J9CA 2MUYA 3NTKA 5IIFA 5AUIA 5I2YA 3OW7A 1A3VA 3SVMA 2E3TA 3R93A 2PPBC 4UAIA 3L3OC 1MHXA 2PZWA 2PW5A 4C3HG 1A2UA 1LT5D 2LMCB 1NUCA 1SXTA 3ZQ4A 1TWAB 2JSOA 4C56C 4NZLB 1HA5A 1HCZA 4DFAA 3PUWA 1YNJC 3PO0A 1RD9D 3MHBA 3ND8A 4GDKB 2A6HD 4X3UA 1STAA 3IXSA 3LXFA 4K6DA 3ZYYX 2PMVA 3PZ7A 2L32A 5EKIA 4KHZA 2C9OA 3HOUB 3IL8A 2F0KA 4X3TA 1OXXK 2F0FA 1FCLA 2V0GA 1N63A 1QOHA 1V1PB 1A3UA 5IODA 1C4PA 1XYIA 4F7XA 1OXSC 2MGSA 2ZXOA 1RF2D 2XRSD 2AX5A 5HFYA 3U9OA 3P4QB 4OW0A 1NENB 1I50B 3OWFA 1A3TA 4BA1I 1IHZA 2ZXPA 1JICA 1ZDVA 4ZHPA 4IDIA 4Q0FA 2OT2A 3EROA 3EFXD 1CA5A 2KMMA 1ZP0B 2KCCA 4L6TB 2PTLA 1NAPA 3K6OA 1WVLA 1RWSA 3GS2A 2EJMA 2K32A 1IBXB 5CMDA 4C3IG 2EXZA 1QJOA 1L0XB 3P75A 4EVOA 5EE0A 1B3AA 5JPMC 3MXPA 4IURA 1PZJD 3S16B 5JXVA 2J4XA 4NAMA 3AEAB 2FJ2A 4J1MA 5FR3A 3BK1A 4V0BA 1B44D 3NE5B 3T4AC 4J8QA 2Q8RE 1VDVA 3IAM1 1YQ3B 3DWPA 2JA6B 2ZW1A 1KRHA 3UI3A 2JWUA 3GB1A 1SAPA 5E4WC 2E2HB 3MZ5A 3PUZA 2F0DA 2VXWA 2F0HA 1BF4A 2F0PA 1JW9D 2B2UA 2EDGA 4BBSB 5M5XB 1LLRD 1Y1WB 5IGEA 1BUVT 5IGFA 3ERQA 1TWCB 1HFNA 4OL7A 4DK1A 1SFOB 4KKSA 1JORA 4XT1B 3Q8BA 3IAS1 5JVH3 2KN4A 3TP7A 2WXMA 3AEFB 3HVZA 2LHDA 1XEEA 3MA2B 3SFEB 3H8HA 3W2DA 2MPMA 4L8JA 2XWBB 3P20A 1F2LA 1EYDA 1KH0A 4G7OC 1QILA 3CHBD 4EE2A 2JE6I 5TSSA 2BBCA 5K36G 1ENFA 4ID6A 1BR9A 1P7FA 2EYMA 3P63A 2JP1A 1EEFD 1BCPF 1LTTD 2NVYB 4ZHOA 3WOFA 1R4PB 4V190 2A6EC 1CJEA 2CJNA 3VR9B 1CT1D 1IW7C 1WTQA 1TS4A 3HP3A 1Q3LA 3VYRA 4CKCA 4US8A 2L0CA 4DK0A 1YMHE 4C3IB 1O80A 1FYCA 3G7LA 3AE9B 5EKKA 3OHXC 3IT6B 3B9JA 4IOIE 1ESRA 1ROEA 1SF0A 2H4OA 1EU3A 2RA4A 3QO2A 3VYTA 1RKNA 1ZKOA 2J7ZA 4HCSA 1GUOA 1KDCA 4R3DA 5D14A 2B2YA 1N62A 1AFPA 5EGTA 1HPCA 5M9OA 3HVDA 2QF7A 2HCIA 2GRIA 5G3LF 1X3PA 1GUWA 4TQ0A 3MWYW 3EUB2 2ID0A 4PMCA 4RKLA 1QQRA 1HQMC 3I70A 2F0EA 5EJWA 2R61A 4KY5A 2Q8TA 4FVMA 1LT3D 4CJ1B 1TWGB 4UDUC 1I4QA 3K58A 4M1UB 4JPSA 3JAME 2BB6A 1B2TA 1ENAA 5K5PA 1DYQA 4WAFA 3D4WA 1B9NA 3DWQA 3X3NA 2WDQB 1NR4A 1J7BA 4YTMB 4S3SA 1MD2D 5JEAG 1QNKA 5JEAJ 3AU7A 4D2KA 2FUG1 4XXEA 1DOXA 4KMUC 3MFYA 2Z4HA 4KD3A 2PNRC 2K5QA 5C3XA 3D8GA 3RZOB 3U52E 1IGCA 1E6EB 3K5NA 1I7HA 2I07B 1EQTA 1PRTF 1T5XD 2PVOD 4XT3B 3C2PA 1ET9A 3AM9A 3BVGA 5C3EB 1YJIA 2HUGA 1ZE3D 1WTOA 1TWHB 4HEDA 1STYA 3P1MA 4OIJA 3SXHA 2N55A 2WKDA 4FNFA 1AZQA 2WP9B 4RF0A 5H92C 3TEWA 1TVXA 2HQEA 5AUKA 3AMUA 3L4PA 4NW2A 4PMWA 5CV4A 3DEOA 4RH6A 4MM3B 1LV9A 4WIPA 1IYUA 1TY0A 1CK1A