3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
1D5MC 1LTAD 1SJHD 2XRQD 1EU4A 2O2LD 2AQ1B 4RFBA 1SXTA 1I4XA 5D3IB 1ENFA 1GOZA 4BWGB 3EA6A 4C56C 1PRTC 5D3DA 1PZKD 2AQ2B 2IJ0A 3OWEB 1KLUD 1SE2A 2XN9C 2QILA 3R2IA 2TSSA 4DXFA 1PZID 1CK1A 1FNWA 1B44D 2IPKD 1LTSD 1PZJD 1S5BD 5ELCA 4RHRA 1FNUA 1L0XB 1D5XC 1S5FD 1EEFD 1CT1D 1JWSD 1UNSA 1SJED 3BYTB 4RCOA 1D6EC 1CHQD 5ELFA 5FKAC 1EU3A 1RCVD 1HTLD 1I4RA 1TS5A 2AQ3B 1XTCD 1PTOH 1ESFA 1M4VA 1PTOD 1EFID 3MC0B 4L63B 3URYA 1SE4A 3R2TA 1DYQA 1I4HA 4RGMA 2NTTA 4NZLB 1V1PB 1PYWD 1EEID 4RGTA 1FNVA 5FK9C 2RDGA 1G8ZD 3O13A 1CHPD 1TS4A 1SEBD 1XXGA 3BVZA 1I4PA 2Z8LA 4L6TB 1JQYD 3EFXD 5ELEA 3BVGA 1LT3D 2XRSD 3V05A 1CQVA 1HXYD 3BZDB 4RGNA 2SEBD 1KTKA 2R61A 2RDHA 1I4GA 1SBBB 1RDPD 1PTOF 2WV6D 2NTSA 1TY0A 1S5ED 1I4QA 5I4DA 2J4XA 1PRTD 3TSSA 4RH6A 1FGBD 1V1PA 3CHBD 3BYYB 1BCPD 1PTOC 1AW7A 5ELBA 1LT5D 1B1ZA 1STEA 4O1NA 1TY2A 2ICIA 5ELDA 4UDUC 1DJRD 2QEJC 1LT6D 1LO5D 1F77A 1V1OA 4RHSA 4Z9CB 4ZYSA 1LTGD 1LTTD 1TS2A 1PRTF 2XNAC 1QILA 1RD9D 1PTOB 1BCPB 1JR0D 3BVMA 4DXGA 1T5XD 1YN3A 1BCPF 1LTRD 2CHBD 1LT4D 1KLGD 1YN4A 1HA5A 1S5CD 4K6LA 3DWPA 3MFGA 4OHJA 1YN5A 2G9HD 3DWAA 1TS3A 1RF2D 1ET6A 1BXTA 1S5DD 1EWCA 1D5ZC 5TSSA 1SE3A 1BCPC 1MD2D 1JWMD 1HQRD 3R8BA 1UUPA 1L0YB 1LTID 4TSSA 1AN8A 1LLRD 1ET9A 3SEBA 4RGOS 1PRTB 1LTBD 1JCKB 3KLSX 1JWUD 1FD7D 3W2DA 3DWQA 3GP7A
chains in the Genus database with same CATH superfamily
2BWES 2M4NA 3EFCA 4P1BC 5AUIA 1G2SA 1WYGA 3CIRB 1F1HA 4MH8A 1YQBA 3M85A 4JC0A 3DQVA 1F2RI 1SSNA 4HEDA 2NVTB 4LNIA 4IQZA 3J7YW 3DBSA 3UQBA 4BKSD 3I73A 4M8AA 3K5LA 1IGCA 1SNDA 2N78A 1EF1A 1UH6A 1ZOYB 2JY6A 5AUKA 2Z0EB 1STYA 1D1IA 4NMZA 4FA6A 4NXNL 1ILQA 2INDC 2KDIA 3R3MA 1B44D 2IO1B 2EOTA 4KN7C 2Z59B 4IUQA 5C3EH 3J81j 1Z2MA 4RAUC 4KKIA 3M4QA 4MH0E 1NMGA 4RHRA 4PZ6A 1VQ5A 3EUB2 2B2YC 4DR7Q 4HCSA 1K53A 4W9CA 1SJED 5J22A 3GTMH 3E6ZX 2F0EA 5FLXL 3RNGC 4DUZQ 4IZ8A 3HGBA 4AJYB 1HTOA 2I5MX 3HOWH 3D31A 1FMAD 2FIFA 4A4IA 2I1JA 1YJNA 1GAQB 2PLPA 3I55A 4D2KA 2A6ED 3SK8A 2K5DA 2DGYA 2XBBC 4HLEA 2L1BA 4LFAL 4I7AA 4OL7A 4WRDA 4A3IB 3TCAA 2GA4B 2ZXPA 3PV0A 1F0ZA 1E7VA 2VNUD 2OTLA 4JLCA 5IKCM 3EFXD 3BVGA 1MHXA 2KN5A 1GUAB 4TQ1A 3ZTCA 4ZRQA 2MP2A 2I46A 3Q3MC 3PV1A 1SMYD 3U9SA 4PZ7A 1Q1EA 2V4LA 2KECA 1S5ED 2WXPA 1EUJA 1FM0D 3K5OA 4USAA 1HZCA 3J80i 5KNBA 4JBMA 3HOUH 2KC1A 2KFKB 4PMWA 3CHBD 4XC2A 3BYYB 3GTGB 1IL2A 2UU7A 1XPUA 4KKSA 2RVLA 1XMOQ 5IN7A 2E3TA 1QNUA 1DXMA 2M00A 4ZCKA 1LT6D 3QOJA 1K8OA 4OVVA 1TWCH 3NRZA 3E56A 5DPRA 2DX5B 4GIVA 1Y8NB 4IM0A 2NVYH 1OGWA 4DAVA 4TQ0A 4IM2A 4JOIC 4IO9A 3ZKJC 4QB4A 2X8XX 1KDAA 4DV1Q 1PGBA 1SF0A 1I6HH 4YSZB 2CHBD 3QIAA 3E3XA 3KBXA 5IOCA 1WTOA 1Q86C 1QT9A 2LRWA 1HA5A 4N9PA 1UEAB 4A93H 4QQBX 2NVQH 4BA2I 1YN5A 3A5ZB 1F2ZA 3RFZB 3RLNA 3T3NA 1WTHA 4JW0A 5NUCA 1T0YA 2KCTA 3FPPA 3QR8A 3M9BA 3DDCB 1H8CA 4B9WA 2F0FA 2WXJA 2N7EA 1TBEA 4NAWB 1L0YB 3C46A 2KYWA 2RGFA 2W3RA 1IUEA 2HTHA 3KF8A 2N1WA 5I2YA 3AEVA 3ECIA 3L4PA 5HI1A 3V3XA 5C1ZA 4UP7A 4DAMA 4A3EB 1AWDA 1VZ8A 3QK0A 3CQZB 2JT4B 4P1CC 2JK8A 2B2WA 3TEHB 4DR3Q 2YTXA 4ILWA 3Q8CA 3K0XA 4U673 2IO2B 2B63G 3ZW3A 2E2HB 4X3SA 1HCZA 1I50H 3NSWA 1C77A 4GKKL 2R92B 3M4YA 3KVFB 2IY5B 2OEOA 3H3VC 2D2QA 3TZDA 4G11A 4W9EA 1WGGA 1PRTC 4RA8A 3D4DA 3T53B 3M4OH 3APFA 2FUG1 1H9RA 1IYJB 4ANWA 4B3SQ 1FXIA 4M8MA 4GLXA 1AH9A 1C3TA 4L1BA 1STBA 3AEFB 3MC9A 5CHVC 2JSVX 4ZKCB 3GDEA 3QHTA 4NXML 3DWMA 2F0OA 2EY6A 2F3VA 5JHBA 2RSNA 4BXXG 2JA8B 4JIOU 3GE3C 3N1YC 4A3BB 3S15B 4DXAB 4R4IA 3RNBC 2INNE 2JEBI 2D11A 3RUZA 1IBXA 3VYSA 4C00A 1EY9A 1KJTA 1FCCC 3CCUA 1K8GA 3T4AC 4POFA 2F3WA 1N63A 2MBOA 1EOVA 1L1OA 4DV3Q 1IBKL 2A1AA 5GAHC 2N0SB 1VQ8A 4HN7A 2DZJA 1WOCA 1XQQA 3BIID 4DQOC 3S2HB 5J1ZA 2JN4A 2VQFQ 2IT1A 1SEBD 2R2OA 2B2VC 4R9WA 3J7AV 1Z7TA 4A3KG 5C4XH 3OW2A 1RWSA 4YXDB 3WANA 2JA5G 3TJPA 4EQOA 1PFNA 1MHHE 4LF5Q 1GO3E 3P4RB 2R61A 3GD7A 2Z4IA 2E5LL 1HEZE 5LMNQ 3JC66 2A5HA 2Y3AA 2DNFA 2R2QA 4LF4L 3KWVA 1QVGA 4YCVA 3N9YC 4B9XA 2IX1A 4ACFA 4BZAA 3TBIB 2NMQA 4PMCA 1V1PA 1H9KA 4FF4A 4G7OC 2PZWA 1RRBA 1IKLA 1FEHA 2PNRC 2NN6G 2WDRB 5COYA 2OJWA 2QEJC 1L6VA 2K03A 1HRJA 5C44H 3LNNA 1C9OA 2F0UA 3D32A 2QJLA 3FP9A 3PO3G 4MGIE 3S1MB 2RHSB 4A3IH 4AOFA 3AFQA 3CAMA 4R4QA 1WRDB 2WDQB 1BCPB 3G6EA 2FCNA 1PH7A 1UBIA 1T5XD 2ZXRA 2KWCA 1HPCA 1X32A 3AEBB 1LT4D 2RKSA 3ZDMC 1V97A 1PUTA 3EJIA 3W1SA 1N9WA 1JE5A 2DJGC 3OJ3A 4NJ6A 4TKNA 3KLWA 3CRKC 4XYCA 3S16B 1MKHA 2BGFA 1UE1A 3CSTA 1L4DB 1LV9A 2ZT9C 3BZKA 5IE8A 3I4MG 4HWIB 4OX9L 4KSLC 4ZUJA 3N32A 2ENBA 3A55A 2KVMA 2B8FA 5CV6A 1AARA 1JALA 3IXSA 2IX3A 4PQXA 1WM3A 1HR0W 3TEXA 5D7GA 2A74C 3BU2A 4QF4A 1TWHH 1P1AA 2IGGA 2MRPA 2IWHA 2N9LA 4LF6L 4BFRA 1NR4A 2Q2HA 3TZUA 3RN5A 2CFMA 1MJEA 4JI5Q 1T9HA 2L8JA 4C3IH 3K8AA 4I6PA 1L1OC 2L1AA 1U4MA 2EPBA 3N6RA 3PO0A 3CP0A 1I4XA 4ZHPA 4BA1I 3FKIH 1ENFA 1PH2A 5JJKA 3VUWA 1V9PA 4B3TQ 1U0LA 3Q23A 1H9MA 1IBXB 4ALPA 2M19A 3FVQA 5DEHA 1TWGH 1VQNA 2XN9C 3R2IA 1L1OB 1YJJA 5C6AA 2K0PA 3P1MA 3T1HQ 4BBSB 2GN5A 1EYAA 4RKLA 4QMGA 2GLSA 1KRSA 3FILA 1KC8C 4L5QA 4A3FB 1EFWA 5EGTA 3RD2A 1SB3C 1DOIA 5JHAA 5I6WA 3NUCA 4R8NA 3S1QB 1LM0A 3QX1A 3Q24A 2DAFA 3H9DA 1BO0A 2CKHB 1PH9A 1N5WA 3S24A 2M0AA 5M5YB 1J9OA 4JI1L 2G9DA 3J80L 1WTRA 3TP7A 5M3FH 2B76B 1E2VA 3TP8A 3PGEA 4JYAQ 3KYHC 3WWVA 2HHHL 2GOWA 4NZLB 1V1PB 3HOYB 1TYGB 4BY7B 2PYKA 4RMAA 2R93G 4QGUA 3S1NH 4IFDH 1XLNA 4IWPA 1WCMB 1TZOA 1NI3A 3NXWA 1OQRA 1PLFA 1GHJA 2WHIA 1SNOA 5L37A 3K9OB 4YSYB 4JI6Q 4A3DH 4CO7A 5EE1A 4REZA 3DM1A 3RMHA 2K28A 3DPDA 3PS6A 3AE6B 3H3VH 5KGUA 2CHZA 4F8MA 5LMUQ 1WMHA 2I38A 1Z9FA 3I90A 2JA8H 4MIUA 4DK3C 3R3OA 3TSSA 1QKZA 4RH6A 2FE8A 1RLFA 1KAWA 2LUEA 2DLBA 2G45B 2N7DA 4FJVB 1JC7A 3GTQH 4LFCQ 3V6CB 2NYZD 1CSQA 2XWBB 3E9IA 5L83A 2ZXOA 3T16A 4HCNB 2UUCQ 1PDQA 4MJSA 2WKDA 3TS0A 4A76A 1SNPA 5IGGA 1PMRA 2WXFA 3B6YA 1RKNA 2E75C 1HQMC 4U68A 5IGFA 2RSUA 2GBMA 3S2HH 4XT1B 5HURA 3EROA 3GQBA 3VTVA 2BE5D 4HSVA 4TMAB 3ZDTA 1PH4A 2ES2A 3LB8C 1B9MA 1E3PA 4B6WA 1BCPF 5C3EG 1KLGD 2FJ2A 2E2JH 2MPMA 3NBHA 2IGHA 2BDOA 4Y7NH 5C2TB 4N8X1 5CGKA 5M5WB 4GXBA 2F0MA 3I91A 3GTOB 2WKCA 1RTNA 2UXBL 4KX6B 1KAAA 1JWMD 5EDSA 3TRZA 3HOWG 1I7HA 1ZYRD 2JYOA 4IURA 2WGSA 3DHGC 1VJKA 1RL2A 4MZ9A 1I94Q 1AN8A 2GVAA 2KDMA 4GMVA 3PUWA 1B50A 1E6EB 4HKQA 5KHQA 1I4GA 5BR8Q 1FD7D 3Q3OC 2WNMA 4IUMB 4JI4L 4N8FA 3ND8A 3ERQA 1VQ7A 3FILB 3Q6SA 2BE5C 1P9DU 2N1VA 1EY0A 2NVUI 1EWHA 3J81c 1WX9A 3DBRI 1DOXA 1WXAA 4JQWC 1HZ5A 1ROEA 1QCBD 2KDEB 3FRPB 3VFKA 1UBQA 2IBIB 1PVOA 2L76A 4LLGM 1K28A 4X6AH 3GZNI 3RZWC 4IOCA 2C5CA 1SYCA 3KDFA 3KLRA 3PO2B 5J18A 4LTUA 1KLUD 4XYQA 3JAMi 1O7IA 3NQIA 5LNK1 3CU7A 2LASA 4WAFA 4A3MG 3AYHB 1ZYRC 3HOUG 4DV6Q 3UI3A 3VQIA 1ZGUB 1VZ7A 3OJ4B 4AQYQ 3ZXVA 3U7DA 3U50C 3ULPA 1JMLA 4JI2Q 4X3UA 3UDIA 5AZHA 4XQNA 1QQRA 1ILPA 3KQ4A 1A3TA 4DDGD 2F0NA 4AWJA 1SFOB 1E7UA 3UQAA 4JBKA 3ETRA 4DR7L 3AI5A 3CMAA 2UU9Q 3M63B 3PUXA 3A9JA 4DUZL 2W54A 1MPEA 1AE2A 3RNEC 1OXXK 3VDYA 4PT5A 2LGDA 3L54A 4WJPA 1CHPD 4G57A 5CMDA 2N55A 3V61A 1HNWL 2AHOB 4G4KA 2QC8A 4MJSB 4JE3B 5BMHA 2B2UA 4ZKBB 1HXYD 5FLXE 1F9PA 2JEAI 1MVKA 4URKA 4KLKA 1WJJA 2SEBD 5JVG3 4YHHQ 4BBSH 4C3JH 3WDNA 1WJNA 1XNQQ 4GB9A 2LZ6A 1JJCB 1I4QA 4P75A 3U4ZA 5FR3A 1Q1OA 1OEYA 5M3MB 1K73C 1SYBA 3S1QH 1R4NB 4DGZA 4EQ5A 2FAZA 3NBHB 2EY2A 1WI5A 1WXMA 4RM9A 4A20A 1E10A 2W9NA 1GVPA 1B4OA 3JYUA 2FBWB 4HMIA 3IVFA 2R3ZA 5M5YH 5MPOA 1YHBA 4K8IA 3WCQA 3DVNU 2MX2A 3D6WA 4Z9CB 4LNFA 1L4ZB 1DZ1A 1I3QB 1V5TA 2WYQA 4BY7H 3W9CB 2YVCA 4A3OA 3DMUA 1XMOL 1K52A 3UINB 1PFSA 4MDKE 4K5XA 3J81E 3RZDB 3S14B 3A7AB 4GLVB 1YX5B 2K5PA 2AKWB 2KJHB 3H8HA 4GDKB 1E2ZA 2AWOA 1X3GA 2MQHA 5T8IA 4X62Q 3HZXA 1LM8B 4CHTB 3E0EA 2K75A 1WVLA 4WJ4A 3CSFA 2CQAA 2G9HD 2I07B 1XTDA 5DPTA 4DV1L 1TU2B 1TWAH 3W5OA 4ZHOA 3BS1A 4JBWA 4IPCA 4ZRIA 5I9PA 3VR8B 3R8BA 3QC8B 2D3CA 2PZUA 1TT2A 3OYYA 1VF5C 4JVZA 1SMXA 1PA6A 1CZWA 3MHBA 2IO0B 1WYDA 1CZPA 2UUBQ 5C4JH 2ZJPA 3M3YH 4GOCA 1SYFA 4W9IA 1M8AA 1WTPA 1P3QU 2NB0A 4JI0Q 3A7LA 1A63A 2B8GA 3DBLB 1R4MB 5JPNC 4GN4B 4HK2A 3VYTA 1I35A 3BK1A 2YEPF 1TXYA 3L08A 4CDDC 1DM0B 2E2IH 2O2LD 5C4XG 1LTLA 4YCWA 2YU9H 2D5DA 2WX0A 3IKJA 4LWCA 3DVNV 4DR3L 3QJZA 3NS1A 4K1RB 5JPMC 3S9WA 5F2DA 2VY3A 2R7ZB 5EKIA 1E0ZA 1D1KA 5C3WA 2AMCB 1KLVA 2YYZA 1JRPA 2YTVA 1NDDA 3HRZC 5D94A 1FNWA 1WFYA 3A9JB 2NZ1D 1SYGA 4IUVA 4ZQ3A 1ZXHA 1I5FA 1N33Q 4CDFC 2N49A 4FF3A 2V9HA 2OCEA 4JBJA 2P5ZX 4HJ7A 1OXTA 3B9JA 3P20A 3EECA 1L0XB 2I5LX 2HIVA 1NR2A 1S5FD 4DV4Q 4BY1B 3I3TB 1A5RA 1T0QC 4KVGB 1V2YA 3V2TA 3CRLC 3VTUA 1EU3A 3Q3JA 2IY1B 2ICEC 3OOCA 5L95C 4HXDA 4A3IG 4LFBQ 1RM6C 1X3PA 2A6HD 3HRDD 1O80A 2KFJA 2NR2A 1KH0A 2Z9HA 1OEYJ 2BYEA 1VDVA 4BVUC 4K6DA 1NBWA 5BN3A 4GGQA 1IBML 4HPPA 3VH4B 2G3QB 4JV5Q 3VHTC 4X66Q 1A15A 1S3OA 1VQBA 5FK9C 3UIOB 3K58A 1WRIA 3EN2A 1EIFA 3PUZA 2I0QA 2H88B 2WDVB 4DBGA 1XXGA 3D0FA 1IKMA 3PO2H 4FDBA 2KT7A 4DV3L 4N58A 2XVSA 4EZJA 4LF8Q 3K7AH 4C80A 2EXZA 2L0CA 1E9MA 1PGXA 2VQFL 3S17H 1TIFA 1PTOF 1VLBA 4MM3A 1SRUA 5IGEA 4X64Q 4I6LB 2Z1CA 2O4XA 3F2BA 1MGSA 2QCZA 2A6HC 2K50A 4IPHA 4X3KA 3DBHI 4DAPA 3E9HA 4GDLB 5G5GA 4W9GA 3PVLA 4DV0Q 4C3IG 2MHJA 2AUKA 2KLCA 3A74A 2WP9B 2M2LA 2ZPNA 1G6JA 4HJ8A 3O65B 3DEOA 3FKIG 2A69D 3OTOQ 4EQPA 1Y1WB 2MBHA 2Y5CA 1P16A 4IUUA 1LTTD 4CJ2C 1PH3A 2KACA 1MSHA 4KY5A 1QG7A 4TQUS 3WIMA 2HCIA 1DOYA 3C3LA 1Q1BA 3PSIA 2D9UA 3E5SA 4A8XC 1TKWB 2D3BA 2GB1A 2LKVA 1QNKA 3VR2A 4HJ5A 2EZVA 1PH8A 2WXQA 3ZJVA 3UDXA 2KHIA 2K52A 3S1RH 2NBUA 1LACA 1SE3A 4K7WA 1K83H 1BNZA 1V6EA 2LGXA 2VUMH 4F87A 1YIJA 2N88A 3I5JC 2Z6KA 2MFIA 3HOZH 1XYIA 5DPSA 3J7A5 4K8JA 2MLBA 4JI7L 2A69C 2Y0SE 5M3FG 2R92G 2CJOA 4WWOA 4OXPA 1N32L 4ANVA 1IW7D 4XX5A 3UGBB 2J52A 2JA6B 1J5EL 1WXQA 3W2DA 4LF7Q 4IFDG 1PV4A 3DOWA 1LTAD 2D3GA 4A55A 4FXDA 2BT6A 2LVQA 4DNRB 4RWSC 2SDFA 2V1CC 4JWSC 4NB3A 1AZPA 1UE6A 3S14H 3RZDH 4A3DG 3AULA 1JJGA 2BA0A 3EQLC 2WWZA 2MNAA 1BUIC 1X1MA 1PZKD 1N61A 2A68D 4KY6A 2ASQA 2WQYB 2PQAA 2J0TD 2JA8G 4DR4L 3L0OA 2N4FA 4ZYNA 2QILA 3A56A 2I5HA 2KWUB 1WF9A 4AH6A 1WYWB 3ENEA 4B3TL 3WAOA 1FYCA 3AU4A 1RIPA 4ME3A 1IW7C 4BOZB 1WH3A 4B9KA 1CT1D 1YQ3B 5CV7A 1YJ9A 1PH6A 4RCOA 4DK5A 4L8JA 5BMIA 4R1JA 3T1HL 3KLSA 1K0SA 4YT0B 1MJCA 5IT9L 2D62A 4IJLA 2KAJA 3A9KA 3AEGB 4MM3B 4BBRB 5E6JA 3K81C 4L63B 1MBYA 4C2MH 1UF0A 1Y1VB 5JEAH 2BWFA 5GMVA 4CGYB 1WFQA 2N9XA 2A68C 3I4NB 1WE7A 4RGTA 3DHHC 5CV5A 1TS4A 3HM3A 4R8IA 2BDNA 1WY8A 2CH4A 2KHWB 2EY1A 1IL8A 1IYVA 3NUHB 1JOQA 4E71A 2OOBB 2JQOA 4X65Q 2A4ZA 5KYIA 1QWYA 2WV6D 2NTSA 4TRDA 2CH4W 2INPE 1XPOA 2BPSA 1NI2A 3LWEA 4FXGC 1C79A 3PRMB 5T1IA 3X0WA 3J80E 1T0RC 4ZRJA 4MNOA 2Z6KC 1PFMA 4DDID 4HPLB 1YVCA 1O7ZA 3OIQA 5LMUL 2MUYA 2UUAL 2A8VA 1S1QB 1KDCA 1R9TB 2Y0SB 2C7NB 1NNXA 1TWFB 1CKNA 1MI2A 1NVID 4XQQA 4FBJB 3QG1A 3I63C 5IOIA 4DR5L 3K6OA 1V1QA 2KDBA 4RF1A 1G51A 1KFYB 3IBEA 1J0GA 1FO4A 1HNXL 2MJDA 4GU2A 4C1NK 1G6PA 4X57B 3SXHA 3VAWA 3V60A 1W6KA 5IODA 2F0KA 1N36Q 2UUCL 4HJAA 4KGSA 3FDTA 4B95A 4BBNF 1EZ6A 2D0OA 2MQJA 1SR3A 4Y52H 1EUVB 2CS4A 1TKGA 3VR5A 2V1YA 5BYQA 4A3MH 2L05A 2WAQB 1ZDVA 3L10B 1ET6A 1VRAB 1U5KA 2RA4A 2K7VA 1JWBD 2ASBA 2JA7B 1FJGQ 1I6VC 4GNXA 1Q10A 2A6EC 1AFPA 3VRBB 3GTPH 3D4RA 3FKYA 2PQAB 3EBEA 3EVQA 1XLQA 1L5PA 1LLRD 2KCMA 1YI2A 1ZDXA 5I2XA 4A3JH 1TR5A 3BY4B 1JCKB 3KLSX 1JWUD 3HOVH 3R7RA 5C4HA 1Y1WH 2H5XA 1E8WA 4R4OA 4KSKC 1I94L 1C7YA 1HTQA 4DUYQ 1WGDA 1SMYC 4DR6L 1KL9A 2FXQA 3VR3A 1SXTA 1KM7A 5KNDA 2JXTA 1R4PB 2BTEA 4NQLB 1QUQA 1STNA 3OHXC 4C3JG 4BBSG 2AQ2B 3UIPB 4GS3A 1GPXA 1CA5A 3A9KB 4QUFA 2DY7A 4HJ9A 2OTJA 4EE2A 4YIJA 3EFUA 2F0VA 2QIEB 4WFN3 4DR2Q 5EBDA 3VVWB 5CHFA 2PZTA 5G55A 3AM9A 4JI8Q 2IZVB 3N20C 3E0JA 3NQTA 4M1UB 5C0XI 2M1MA 4DV6L 3PMFA 2X6LA 1UGJA 4PNYA 2LGIA 5EE9A 1P7FA 4DK6C 4AQYL 3T51B 2JA6H 3P4SB 4BY7G 4NAMA 4JI2L 3TL5A 1FXTB 5HGQA 2A73B 2K05A 1HNZQ 3GB1A 1M4VA 3MC0B 1SSOA 1JROA 4HRSA 4II2B 1JMCA 2GI9A 2PJHA 1X6OA 5K5PA 4FJYA 4K14A 4AIMA 3R7QA 3SHQA 4CYEA 4F7ZA 4E74A 1RHPA 2MBQA 1D3ZA 5IYDH 2K33A 2RDGA 1K0RA 3I2ZA 4ZK9B 2V3SA 2VZKD 1CKNB 1WSPA 1WX8A 3OMCA 3HOXB 5M5XB 2K39A 2IGDA 4XQJA 2WS3B 2XRSD 4A3CH 1UE7A 3NTIA 4C3HH 2K6AA 1IBLQ 2JXMB 3APCA 4YL8A 3LXFA 1EIGA 5HY6A 3M3JA 1UE5A 1VCIA 2KHSA 3MJWA 1HZ9A 2MP2B 4GNXC 5I4DA 3NVYA 4ID6A 2KWDA 4CBVA 4XT3B 2LXKA 4CKEA 2WX1A 2MO1A 1GUTA 4YHHL 1XCQL 2L0FA 5ELOA 1A2TA 2HT1A 1BCPD 4XDCA 3UI2A 5HGTA 2OQKA 4XDXA 1GC6A 3C1EA 1NENB 4JI3Q 5BN5A 3PRZA 1E7ZA 4A3GB 4BBRH 1SNCA 2PW5A 5ELDA 3SDZA 3NTKA 2Q2TA 2NVTH 4UDUC 4A90A 3PIO3 1Y1VH 4A75A 4GNXB 3IAS1 4LCDE 4K0KQ 3TIXA 1UEBA 2WXKA 2R7DA 5KRUA 1PYSB 3NENA 5CHWA 3MXNA 3Q6BA 3DVGX 1RD9D 1N6ZA 3PLUA 4OZCA 1Y56A 4K5WA 4DNIA 4QCLA 1NYQA 4KV2A 2DBYA 1EY6A 3MA2B 1Q81C 4KHPQ 5IP7H 3RN9C 2WU2B 2VZKB 2UXCQ 3LWUA 1O78A 3TP6A 1X9NA 4MT5A 1L2NA 5C0XH 2FCQA 2HTME 3AU7A 3JSVA 1X56A 3L13A 3RCZA 5C5LA 1BXTA 2NVXB 1Q12A 1BCPC 1QUQB 4IDIA 4X62L 3PF5A 4US9A 1F52A 2B2WC 5IGDA 1UWXA 4JK1C 1C9FA 5ISRA 4KGRA 2OXPA 1N8RC 3ZJYC 3JVZX 4GLAC 1X65A 1NTGA 1JOOA 1EZ8A 1X3QA 1DOLA 1LQBA 3RNUA 2LUMA 2BF8B 4XE0A 1TKEA 1IYFA 1S4ZA 2EY5A 4IPGA 3KF8B 2BCOA 5ELCA 2KMCA 4YY3Q 1WGHA 3TBLD 1J7AA 4H02A 2UUBL 2X6GA 3PO2G 3M62B 3N3KB 1C1YB 1FL0A 1PXUA 3OSOA 2K9XA 2M9VA 4JI0L 4ARCA 3K5MA 2G5DA 4IFDI 2IJ0A 3J9CA 1XNRL 1QOBA 2REXA 4WJOA 2J7ZA 5EAYA 1WXSA 1JB7A 4OWTB 1B9RA 3NVWA 4ZAIA 3H3VI 3RLFA 2PNHA 3GTGH 2MP1A 1T0SC 3AH7A 2IL8A 4WJNA 3V96A 3K9PB 1RODA 2DY8A 4FO2A 4LNOA 4E3CA 5DCNA 1OTCA 1XD3B 1EWIA 1WTVA 3RULA 1SE8A 1N33L 3QO2A 5IYBH 4AQ7A 1NBFC 4F88A 4UHVA 1Q0WB 2NBWB 3T8MA 3NPPA 4HPMB 1Q8IA 4UY8C 2RDFA 1SGHA 3IAYA 4POGA 2M8SA 2B29A 1MG8A 3RD4A 2L00B 1NUCA 3JAMc 3O13A 2RQXA 1L6UA 3Q14C 1B53A 4M02A 1NEKB 2KTRA 2L32A 4YWLA 3GTKB 2GBJA 1V8QA 5K36H 1EIHA 1V86A 2JZ3B 1YHQA 3RN2A 3BZDB 2VUMG 1HFGA 1KOTA 2Z4HA 4NP5A 4TUUA 3HOZG 2K01A 3MAQA 2KKCA 4K2KA 2L9HA 4UPAA 4IC7B 1UAPA 4A3EH 1YHAA 2KBNA 1KRHA 3CQZH 4O2DA 1VQKA 3M4PA 2KOXA 2LMCA 5CYUA 2JXXA 1P98A 2E2HH 2LXCA 4PYUA 4A9AA 4A3LH 2R92H 5JOBA 4X64L 1B1ZA 1G91A 1CQFA 2W3SA 3JSVB 3IHPC 1TY2A 2QGQA 2OHFA 2JWUA 4P74A 3U7ZA 2B3GA 2RCNA 3SHLA 1SN8A 3BDCA 4DV0L 3WA0A 1QOGA 2IHFA 2JRHA 4JGHB 1HZ6A 1XMQQ 4H2AA 1YNTE 1PRTF 4ULLA 3W1SC 4B3ML 1EY8A 4GKJL 1P8LA 4UP9A 1OXUA 1YOVB 2PIAA 4DFAA 3ULJA 1RFKA 5M5XH 3AEAB 1VZ6A 2RR9A 4K3CA 5LMNW 1N34Q 5ELNA 1CKOA 2LFNA 5HHDG 2K8BA 3M7NA 1VMCA 2E74C 2VB2X 4A3BH 2IO3B 2LJIA 2N9KA 2K04A 3S15H 1XF5L 1RFAA 3QQ8B 2OWOA 4HJKA 2B63B 3PUYA 1QB5D 1TIID 1VQFA 1MD2D 1WR1A 3OMGA 5AJ3L 3VR9B 3C19A 4HIKA 1FRRA 2KCNA 3F8TA 5E4WC 3ULLA 1Q82C 1TT5B 2CJNA 1EOTA 1QOHA 3ALBA 2EYLA 3LGJA 5JEAG 4AUQC 5IY0A 3MZ5A 3RYTA 3K57A 4LUVA 1PZID 1EQVA 2PPBC 3D6CA 4JWUC 2DENB 5FLXc 2R7ZG 2EIFA 3A33B 1Q90A 2LGYA 4NW2A 3EIVA 2KMMA 1H95A 4MSQB 2QMTA 1EIYB 1IYUA 1UD7A 4LF7L 4WWNA 2G4SA 3T1YL 3G71A 3ZRFA 1EYDA 2JPHA 4LMQD 2INCC 1CM9A 5KNCA 3JAME 1J8IA 3GTJB 3PQIA 2FMCA 3JW0X 3H94A 2NVXH 3LJ3A 2C7MB 1EF5A 4ICVA 1T5EA 4NY0A 3CF5A 3ML8A 2BVCA 2UWQA 2VB3X 5DPWA 2AUJD 2KTRB 1D5XC 1Q5WB 4ARIA 2KCCA 3KJPA 5EQ0A 4ANXA 2YEPB 3V62A 1VQAA 3VA5A 1BR9A 1UWMA 5CC4A 4QL5A 4A3KB 2UYZB 3S1MH 2JA5B 4RCNA 2M56B 3VDZA 4K7UA 4N59A 1SIFA 1PTOD 2BH8A 1U9RA 2LSSA 5E4XA 1LGRA 2K14A 1EY5A 1GUOA 5C5MA 2LMCB 4MGKE 4MGYE 1FVIA 2JJQA 4J8QA 1GUGA 1F2MA 2F0SA 5DLQE 3KFUA 3H7SA 3A1QA 2HJ8A 4H7BA 2ZEQA 3NZSA 3S2AA 3S16H 2MCNB 4L6TB 1VQMA 2CHWA 1FFVA 4ZRKA 4F7XA 2MBEA 1WJUA 1QOAA 2QSDA 2PMVA 2MH7A 1KXLA 4EFOA 3NY5A 5M9OA 3NVZA 3HKZE 2CR5A 2RDHA 1SBBB 2D07B 2QA4A 3ABVB 2L12A 4IW0A 2MSED 4WH4A 1OQYA 3PO3B 3ZRCA 4FXKC 4P2CB 3MXGA 4KKUA 4A3JG 4IUPA 2ACZB 2X69A 2EYMA 1J7BA 3HOVG 4X65L 1TTNA 1WMHB 3Q8DA 1Y1WG 1WTQA 2A5UA 2D5GA 1FXAA 3X23A 2WDTB 1E22A 4WQMA 1PTOC 3CCSA 4HDQA 1SROA 2ZPYA 1STEA 3KUDB 2H4OA 4ZLTF 3AU5A 3CMEA 3FEWX 1DD2A 4YSXB 2AWTA 1L2FA 4ZYSA 2K1FA 3H6NA 1YITA 5EKKA 2BQQA 2JQRB 3TUOA 3K80C 2N3SA 3GV6A 3I4MB 1MIUA 1PTOB 1TVXA 3R66C 2Q8IB 3SU8X 3UE0A 2ZCCA 1YN3A 3CKIB 2KDFB 4WJQA 4B08A 2JF5A 2O6VA 3K7UC 4A3FH 3ZNHB 1HZAA 2NCNA 3DLLA 1X3FA 1U4PA 5H8YE 4OVUA 5LXIB 3I7FA 1F9SA 1ZXTA 3RR5A 3IT4B 3APDA 4GOPA 1Y8OB 2NPTA 3K59A 5TSSA 2BKRB 4FLHA 2JA6G 1D4BA 5E1FA 2KVRA 4KDLB 2WXHA 1AEXA 1XX8A 2GRIA 2DZMA 2L7RA 1FJGL 5G3LF 3HOYH 1LTBD 3P4QB 3PIP3 5IYDG 4YCUA 4OWWB 2IW3A 3CMMB 5J17A 5HG2A 5IGBA 1B9NA 1WCMH 1VQLA 4AYBE 1YQ4B 4EEWA 2EQSA 1IBKQ 4US8A 1EU4A 4N9F4 2ZVOA 5DAUA 2N7JA 1F2YA 4YTPB 4C4VA 4RFBA 3J7AF 1EWYC 3A8KE 4A3CG 3MTSA 2BB6A 4C3HG 2ZJRA 1GOZA 1WZ3A 2ZTEA 4W9HA 3OPOA 4IUTA 3ZO5B 2BS3B 4YWMA 1Q46A 4KD4A 5DM73 1X3EA 3PT2B 4NJCA 2K32A 2ZNVB 1XWEA 3KF6A 4LJZC 1PDXA 3AMZA 3HKZB 2NUCA 2BH2A 4DV7Q 2EMTA 2FUHB 1MI0A 5J3BA 2DYMA 3FC4A 2IPKD 3KDFB 1CA6A 1KIXA 3D8GA 4LF4Q 2EVBA 3A1QB 1X55A 5JJLA 3HM6X 4BBRG 2MJ8A 1QVCA 1ASYA 2R93B 3N52A 3Q8AA 3W1BA 4M0WA 1Y1VG 1CHQD 2EJFC 1V8CA 5DNFA 5H92C 2NBVB 1RCVD 4DR2L 2F4VQ 3IT6B 4XWTA 1GJZA 3QA8A 2RSOA 1TS5A 2AEHA 1A3UA 3RPFC 3ZQ4A 4UP8A 3SK6A 1WTXA 2AQ3B 4NQKE 4JI8L 4ZRPA 1VQPA 2MHVA 1F9JA 3AQQA 4NPSA 4OO1H 5D2MB 1EFID 3HS0C 2G1EA 5KHOA 3VUYA 1DYQA 3RZOB 5IP7G 4ANUA 3I57A 5E6NA 3FPUB 4EKUA 1EEID 2B2UC 5M5WH 5C0XG 1HNZL 2D0PA 3C2PA 2QKIC 4MN3A 1RAXA 2V4IB 4V0BA 3GTOH 3F1ZA 4J1MA 3AEEB 5I6YA 4B3SL 1KTKA 2Q5WD 5JEAJ 3BJUA 5C4ZA 1GC7A 3KWLA 4HIDA 3AE4B 5D14A 3TMEA 2V0GA 3C0RB 3MEHA 4OX9Q 1EM7A 3W1GA 1FPYA 1IBLL 3MXPA 1R4NI 3CCMA 1S3SG 2XK5A 2N9EB 3P1HA 1FGBD 2PCFB 1KRTA 4HROA 2KMAA 2K8CA 2MW5A 3BK2A 2KNBA 4KY7A 5C3EB 1NSNS 3CCEA 2F0PA 4EZKA 3KOJA 1Q7YC 4IM3A 4XWWA 2Z6BA 4EQNA 4KZ0A 4GOPB 4Q2JA 5G5HA 2NPTB 2K6DB 1V1OA 3GTMB 4AYBB 2F0JA 2WB1E 2KQ7A 2XIWA 5J39A 3BWUD 4P6VF 3SR6A 2BYVE 3MJ5A 3HIZA 3HOWB 1GXDC 4HAEA 4P16A 2B2TA 1JR0D 2RHQB 3G4SA 4RG1A 3DHQA 1JORA 1N5XA 2BB5A 1V5OA 4K81A 2Y5BB 3K0YA 3ER0A 3F2UA 4K0KL 2JUOA 2E2DC 1KQSA 4FADA 5JJIA 4K6LA 4OHJA 5GROA 5G2NA 4C4VB 4LF5L 1TS3A 4JPBW 3OLMD 4H44C 2PVOD 1SFOH 2HDEA 2V3NA 2VS1A 5LMNL 5IYBG 4KHPL 3V6EB 4ODGA 4GN5A 2PVGC 4XXEA 1F2RC 5JH5C 1GUSA 3L17A 3A8IE 5GXGB 3KF6B 1K51A 1ET9A 4KHZA 3SEBA 3ZYYX 1GUNA 3H7PA 1S40A 1MG4A 1M94A 3DWQA 1R4MI 1GKHA 3HOUB 4L23A 1D5MC 5JXVA 3CCJA 1P7EA 1ZPSA 2HHHQ 5FJ8H 3VA7A 5K36G 3NVVA 1E8ZA 2DYBA 3OG5A 2XEWA 1JICA 4OEMB 2WXIA 2XWJB 1F2LA 5JJZA 1LUZA 3TQYA 5D3DA 3B2FA 1TWCB 3J80c 4ICUA 1VQDA 4A3EG 2NZHA 2L83A 2NVYB 1G6ZA 5M3MH 4DK0A 2RDBC 4OIKA 5AZFA 3N1ZC 3B0AA 3A8JE 2LFIA 1I6HB 4CKCA 1S5BD 4A3LG 3A4RA 4HIOA 1JE4A 2CU3A 2MJ3A 1VQ4A 4XGAB 4EUTA 4A93B 1WXVA 2NVQB 3ZUNA 3CCQA 1U4RA 3BYTB 3AB9A 1E1OA 1ENCA 3T3OA 2QEXA 4WQOB 2EXDA 1C4CA 1I3QH 3TMPB 2B2YA 3EGRA 1NJIC 3J7ZC 1ESFA 3HOXG 2KHJA 1C76A 1EYCA 2IY0B 1ZXIA 3VR4A 4LF9Q 1SE4A 4JI5L 1VQ9A 2KEEA 4IOAA 2WB1B 1L0VB 4MTNA 4IUNA 4APVA 4B3RQ 5IWAQ 2WXLA 1JB3A 3MEFA 1RYJA 2LXAA 2XK5B 1A3VA 3U4VA 2WXMA 3Q69A 1NAPA 3Q0AA 4A3BG 3K5NA 3P63A 1BKBA 1K9MC 4BKSA 4WAAA 2DUDA 2Z8LA 2WAQE 1FD6A 4KZCA 1I50B 1LT3D 1GG3A 3V05A 3T56B 1A6XA 4BAXA 1RDPD 2VW9A 4GZYC 2UXDQ 2KFKA 1LFDA 3L2PA 3M4OB 2UXBQ 4MACA 4HSPA 2LRUA 1C4QA 2LHEA 3RMKC 2K5VA 1QZHA 2PQEA 2V3PA 2VZAA 2PMZE 4NPNA 4WIPA 2CVRA 2SNSA 1WM2A 4JX1C 2OEDA 1J6QA 3NJTA 1YEZA 3A54A 2WXNA 2K1BA 4O0AA 3RNAC 2FIDA 1K8AC 4O1NA 4JI4Q 1JQ4A 4PK1A 2KC2A 2LGSA 5EKLA 4Q0FA 3NZUA 1ZP0B 1DOKA 1LTGD 2K5QA 2IHEA 4QY7A 2R7ZH 4UAIA 5CV9A 4NNJB 1GB1A 3AB5A 5GAGC 3W1YA 4JYAL 1VCBA 1ZEQX 1UELA 1ASZA 3AECB 3H7PB 1JT8A 1LTRD 4DKAC 4RNAA 4P72A 1T3QA 3IL8A 4PV1C 1XMQL 4BY1H 4DR1Q 4JOIA 4JI6L 2WU5B 5FO9B 2R6GA 5CR3A 3MHZA 3W5UB 4EOYA 3PUVA 3SK5A 1WGYA 2W82A 3IFWB 3EHVA 2L0TA 4NAWA 2K5NA 3VRAB 2KLGA 1N34L 5C4XB 1VS0A 1FGUA 4GSWA 1UUPA 3UF8A 1CUKA 4HR7B 2CW0D 3LYYA 1E8YA 3HEJA 3CC4A 2KX3A 4K7SA 1ZKOA 5AFWA 3F2CA 2Q8RE 1E0BA 4LFCL 5C0XJ 3TEYA 3GP7A 4LK0M 2ZM6Q 3M7GA 3KJOA 2EYOA 5CX3A 1SJHD 1JRUA 3W5VB 2PTLA 2ZCBA 4KDIC 1FCLA 3I70A 2EE1A 3HG9A 3EA6A 1WTWA 1HNWQ 4N9TA 1CFMA 4B0EA 3QAQA 4CQNA 5C44B 4KV6A 2KXJA 3I9V1 1K3BC 2KA7A 2HQLA 2HDLA 3CCRA 1W2BA 4WWMA 2JSOA 4FYDA 2TSSA 1KHIA 1CK1A 4K2LA 1VQOA 1PH1A 3RI7C 2CW0C 1ZW7A 1E8XA 4MGZE 2CWAA 2DZKA 1YIWA 1XT9B 2DAJA 3MP9A 1FNUA 2KO3A 2VQEQ 2PMZB 4J6HA 2L5TA 3AE9B 3TEWA 5CBAE 5IP9G 1A62A 5ELFA 3G7LA 4OIJA 3J81L 2CKZB 4RM8A 4S0RA 2EYHA 4E6IA 1FFUA 3N30A 1XTCD 2SOBA 4GN3B 2MA9B 5BR8L 2EJGC 2VXWA 3Q3NC 4W9FA 3BDLA 2C35B 3KUZA 1G291 2JE6I 3PHWB 4A6QA 4EGVA 1QZEA 4BOSC 1Y14B 1C4AA 4A3FG 1PYWD 1TWHB 2LVPA 1LABA 2C7HA 2QF7A 3ZIMA 3QARA 3RNFC 2HJ1A 4JG2A 5IYCH 4C3IB 1JQYD 4R4CA 2WXOA 4C7ZA 1R7SA 3PIOA 3QIJA 1UZXB 1HFNA 1XCTL 1Q3LA 3B2GA 3DHIC 3P4PB 3FKIB 4XDDA 4DV2Q 4RMFA 2B2VA 2BW2A 2JZPA 3B1LX 2ZTCA 4G7ZC 3Q3FA 2BYFA 2F0IA 3LX0A 1TWGB 1PRTD 3HOYG 3TS2A 4XYOA 4OVZA 1VQJA 3PF4A 1WCMG 1VQ6A 5ELBA 2F52A 1Y8RC 4CKBA 3X3NA 4DF7A 3AV8A 1AE3A 4LJPB 3CF6E 4OWXB 2JWZA 2QDFA 1GD7A 2HD3A 3VR6A 2UU9L 1HR0Q 3T9LA 4EZLA 4JPSA 1STHA 4HCEA 3HHMA 2KJRA 3NS8A 4PMBA 1D2BA 1WE6A 4L5RC 1OXVA 2E76C 1WJ4A 2RF4A 1CZGA 3BVMA 2IYDB 2C9WB 2JZZA 5BO4B 3AN1A 1EQQA 5M3FB 2GBRA 3PGZA 1YN4A 1XEEA 3L16A 1HHVA 2F1MA 1MHWC 4IN3A 4IFDJ 4LUZA 4QIWE 3S1NB 2FHTA 3I4OA 4L2YA 2JVCA 4KMUC 4DN4M 1EWCA 1D5ZC 3H0GB 3TREA 3U2SC 1XNQL 2NS5A 2I1KA 4A3DB 4AJWA 3ZJUA 4V190 2OT2A 2K5HA 4H13C 2VRRB 1XLPA 2TMPA 3CPWA 4KD3A 4OO1G 1K50A 1CI3M 1B3AA 4CJ0B 2FNJB 3QCAA 4A3PA 3AE5B 2HQEA 3L3OC 1PRTB 1YNJD 3I4NH 3QOLA 3EC8A 2B3AA 1GB4A 2PKOA 5GQOA 4QJFA 4RKBA 5FO8B 4WURA 1IBMQ 2BS2B 4QAYA 4B0MA 1HH2P 3NBIA 3H1UA 3GTQB 4MHEA 4K5VA 1CSPA 2YV5A 4DK1A 2MBBB 5D3IB 2D3AA 4C1NI 2RPQA 1PGAA 1NCVA 2ONQA 2EKEC 3SE0A 1SYEA 1IPGA 2J53A 3OWEB 2ATWA 2H1EA 2CWPA 4W9LA 4ME5A 2KZRA 4DV5Q 1ICFB 4IWOA 3OW7A 1R9TH 1AP0A 1PZJD 1TWFH 2DJFC 4J15A 1AYFA 1V81A 2E2JB 2JYEA 2MEKA 5IAAC 3RNCC 1LXDA 4Y7NB 4OZBA 1YNJC 3L9AX 2KQ4X 4DV7L 3SFDB 1LYLA 2WFWA 3AMUA 5FKAC 4RF0A 5DM63 1X54A 1K3RA 3I8ZA 2KN4A 1SNQA 2Y5PA 2EJMA 5IIFA 3ZNGC 2BYTA 4OELB 5A2QL 3BDOA 1CMXB 1FRDA 4QUCA 3S2DB 2KEDA 1DGSA 1WZ0A 2HCCA 3URYA 4EVOA 2F4VL 5C3JB 2J0KA 4J6IA 4ASWC 4KJNA 2BS4B 1BBUA 2E8GA 1OO9B 2EYFA 1OXSC 2YLMA 1VF7A 2N9PC 1B7YB 1I4PA 3BVZA 4H0LC 3CC2A 4YWGG 1IZ6A 2JA7H 2GBNA 3NWSA 3CC7A 2EYJA 4QIWB 2EMSA 5E6PA 1ACCA 1H4RA 5FLMH 2LI5A 2HDMA 3Q8BA 3WALA 2JA9A 5EPLA 2KK8A 1NMFA 3PZDA 2KJ6A 1PHJA 3VH3B 4FP5D 1BDOA 3HVDA 2J4XA 3KH0A 1S72A 3MVVA 1V49A 3VXWA 4FHJA 2M17A 4DV4L 4JI7Q 1OQQA 1VQCA 1N32Q 1K8MA 1EQRA 1BUVT 1PFBA 1LT5D 5FJ8G 1DGJA 3FAHA 2PE6B 2YTYA 1J5EQ 4DA2A 4DHZE 1HZBA 2K6QA 1Q8KA 1A2UA 2ICIA 3AE2B 3GTLB 4LFBL 4LJOB 1TQOA 4RHSA 2F0LA 3Q8EA 1A70A 4J3OD 1F9RA 2OF1A 4IG7B 3KK7A 5M3MG 4JV5L 4X66L 1SIJA 1FR3A 3P42A 4WWPA 1J8CA 1HUMA 1UWVA 4DR4Q 3UDFA 2NZOA 3MXNB 4XIGS 5G3LD 4DU9A 5LL6X 5D6JB 2F0HA 4LF8L 3VUXA 4MELA 3DWAA 3L7ZC 4N6EB 1RF2D 4FF2A 2QW7A 2K22A 2PO4A 4L5SA 1CKMA 3NOBA 1H9JA 1IHZA 1ISNA 3ML9A 3ZNZB 3IAM1 5IO9A 2CCZA 4CDEC 2PW9A 4OGQC 4C3JB 2PEAA 3ZNID 3WAMA 4RGOS 5GAEC 1XLOA 4GLSC 1E90A 1KF6B 1L0WA 1G2TA 1YJ1A 1BBXC 2SNMA 3GO5A 3NK9A 3CW2C 4I6NB 3HOXH 4ABNA 3OTOL 5HKHA 5JAVA 5IT9c 1E24A 2DWQA 3DBRB 4FN2A 3H6MA 4W9JA 3HKZG 2BA1A 4NXNQ 2LXJA 2CU1A 2F0GA 2B39A 2Z0SA 4BWGB 4C56C 4G7HC 1VD2A 2H89B 1GUWA 3GZNB 2QHOA 4I7ZC 1MJDA 1SE2A 1JW9D 4DXFA 4HEA1 3IRBA 4AP4C 4K3BA 3ZXRA 4FF1A 1VQGA 3H0GH 3FMCA 2ZJDA 2N8NA 2K25A 1J19A 3UE1A 2MJEA 4A3GH 2MWSB 2UUAQ 1UNSA 5E7NA 3HKSA 1D6EC 2EDGA 3T13A 1JWAD 1TWAB 3ZTDA 1H9SA 3NEMA 2Q2IA 2XGTA 5KEEA 1HTLD 4LFAQ 4DR5Q 1WR6E 2ZW1A 4DHZB 3WOFA 3P75A 4BS9A 2EKIA 5LLIA 4L5TA 2KX0A 2W55A 4LW1A 1HNXQ 1FIQA 5C4JB 3M3YB 4IALA 3R2TA 5A35A 1I4HA 3AE1B 3MTNB 2NTTA 4HDOA 4MSMB 5IA7A 5BYSA 2KTFA 4BY1G 3A5UA 1FNVA 4XTCS 5BYRA 1QE6A 2WACA 2WIIB 3HP3A 4KJOA 2RD0A 4IPDA 4OONA 1DCZA 3H09A 4LF9L 2RBMA 4X3TA 2L3ZA 3PREA 4G50A 2E2IB 3WAPA 4B3RL 1EL0A 1VMPA 5IWAL 3HUIA 3WOEA 2YU9B 1EY4A 2PE9A 1T6BX 4W9KA 3D4WA 3I3CA 4NDXA 1IXRA 1TY0A 2FINB 5FOBB 3DCGA 5JVH3 3OIPA 2XTIA 2KJXA 2KANA 4S3SA 1O7LA 1B70B 4AYBG 1M1KC 1GM5A 1M90C 2J42A 4HJGE 3U58A 5AEKB 2UXDL 2FFKB 1AW7A 1F9QA 1GJXA 2KVZA 3TDQA 2MO0A 2HIXA 1WI0A 2NBFA 2OJRA 2GBKA 3PSEB 2F0DA 1WIAA 5CBEE 3S2DH 1YD8U 1DJRD 3RZFA 3SDLC 1LO5D 2AX5A 1QVFA 4DR6Q 3NTHA 3I56A 4M8NA 4GDKA 3W3AA 4EX5A 1SLJA 1XJVA 2GMIC 3P2BA 2K8HA 2X38A 1KNEA 3QB3A 4CJ1B 2JRIB 2L52A 1RJTA 3QJYA 2K3UA 1WX7A 3SR1A 4KI0A 3PIPA 5IT9E 1PYBA 2ID0A 3STBD 1KABA 2R7FA 1YX6B 4II3B 2ZW0A 4CHKA 3KUCB 5H1SE 3DWPA 1ZKHA 5I9OA 2JP1A 4G0NB 3H91A 1XO3A 2DHZA 3DXJC 2EELA 5IP4D 2L15A 2J7QB 2D10A 3SFEB 3U8ZA 1HQRD 3K7AB 2HE7A 3U30A 4DR1L 3MWYW 2A19A 1MFWA 3S17B 2RMMA 4TSSA 5E3FA 3AXCA 2EYPA 4G3XB 4NJ7A 5IP9H 1NYRA 3IG3A 4GKKQ 3CWIA 3Q22A 3GTLH 4FXCA 4YWKA 3SVMA 3CD6A 4OW0A 1ONLA 4OO1I 5IYCG 3GTKH 3STBC 3AE7B 2AQ1B 3A0JA 2DZIA 3IFDA 4F1SA 3NHHA 1H9SB 4KHVA 5EBCA 1VQIA 2ZM6L 1JOKA 1N36L 2KQSA 4NXMQ 3RUIB 2WP8J 1R4QB 1A0IA 1VDZA 3QWNA 3AE3B 2C9OA 2KOLA 4LDTD 4HVBA 5HFYA 3A4SC 4A93G 3G48A 1HUNA 5CV8A 1ENAA 3DM3A 4JL9A 4IJHA 2WXRA 1QZGA 5LL6S 4WJ3M 1BMLC 3KYDD 1LTSD 1Z47A 3MC8A 2O5IC 4PS3A 4P7IA 3GE8C 3NWTA 1E2WA 4KTAA 3PCOB 3CCVA 1EEFD 1PQSA 2FCMA 1JWSD 2LVOA 2CHXA 4ITKA 2WB1G 2ALYB 3S1RB 2ZNVC 3X3MA 3SD5A 3DUZA 1TZ1A 4HCPB 2I2YA 1I4RA 1D8LA 1K83B 1STAA 3RLOA 2VUMB 4DAYA 1E5WA 1UGMA 2VQEL 2C5LC 1BQQT 2F4IA 3HOZB 1TJEA 2LJ5A 1HJPA 3QWZB 1P0RA 4DWFA 3U52E 4R4TA 1HA6A 4MEMA 4DUYL 2IDYA 3U4EG 4ZRZA 5IGCA 3OAWA 1VQHA 2BKFA 3BG3A 3SK4A 1E7PB 5FO7B 1SDFA 3NZ3A 3ZVVA 3ONSA 2E5LQ 3ITPA 1DONA 5D65A 2B63H 1YBYA 1C0AA 5ELEA 5EE3A 3CCLA 1W3SA 1WJ6A 1C48A 2O6VD 2WXGA 3MFYA 1CQVA 5J2RA 4IOIE 2NN6I 4RGNA 5KIXA 1GHKA 2IX0A 3GV3A 1TGZB 3HK0A 2WINB 4KIKA 3ZJTA 2RPVA 4GDLA 4LDTB 3I4LA 3NP8A 1PFDA 1YJIA 2D2CC 3KUPA 2KD0A 1DOMA 3I4NG 3C8YA 4S17A 1VQEA 3MHSD 3ZGZA 3VYUA 1YNND 1VR9A 2FMMA 4DV2L 1WWTA 3RT3B 3DBHB 2AWNA 3NHEB 1ZUD2 1N60A 2LEKA 2BOSA 2PI2A 4TV3A 1PH5A 3AFPA 2F0TA 2QDBA 4BXXH 4PZ8A 5BN4A 3PHXB 3IFTA 5EE0A 1F77A 4HIMA 1GNUA 1IGDA 1B2TA 2F0WA 4PG3A 3MXUA 3TN2A 2DN8A 1SE9A 4FNFA 2ZTDA 2QDLA 5CTRC 3GTJH 1SNMA 1ZE3D 2KENA 4Q5VA 2VH1A 2G4DB 2PI2E 3J81i 4TKOB 5KYLA 3DVGY 4FHKA 1U4AA 1XNRQ 3G6JB 4C2MB 2LWPA 2Y0SG 1EO6A 1E1TA 4GOPC 1HR0L 2LY7A 3PRPB 3Q2AC 4BKGA 4AS1A 1BVSA 3P7JA 1S5CD 3MFGA 1MSGA 2HUGA 1QJOA 1YNNC 4ZUIA 2O6VB 1S5DD 2O5JC 1NE3A 3PLVA 4A3KH 1OTRB 1STGA 2JA5H 4PS8A 1WD1A 3KW5B 1C8CA 4LNQA 4LF6Q 4NKLA 2JX5A 3VTWA 1LTID 1Z6HA 1V9JA 4MTKA 2J0JA 3M95A 1WGKA 3HFZB 4YTNB 5EPKA 1YJWA 1EQTA 2J0MA 4M00A 1KDBA 2F3IA 1K8RB 2Q8TA 1SAPA 4LAAA 2HD5B 5T1GA 3H15A 4JI3L 2DNCA 5C3XA 4DPGA 1BF4A 3ND9A 2VH2A 1II3A 1SYDA 3C1FA 5C44G 1QOFA 3E9SA 2WAQG 2XRQD 2KWVB 4R3DA 1BT0A 4F8CB 4KN4C 3BINA 2E6XA 2DNEA 2JA7G 1I42A 3F2DA 2OQ0A 4LUOA 3PPAA 2NN6H 5EJWA 4IKGA 3PZ7A 2AYOB 1YNXA 2MGSA 2QCPX 5FLMG 1L7YA 3NE5B 4DAYB 2L55A 4CDCC 4M01A 3PO3H 4BBNC 2Z0DB 1HE8A 4KKJA 2UXCL 2K5WA 3GS2A 1XPRA 1C78A 2O2VA 1Y69U 2DYOA 2KQ3A 3ONAB 1TKYA 3D3RA 3LDZE 4FJZA 4TVAB 4JCVE 4DV5L 4WORA 4JI1Q 3DBLI 4XZ4A 4A3MB 1D7QA 1W6JA 4C7YA 5LHY1 1QLBB 4KIKB 4M0WB 1ML0D 3I4MH 1IP9A 1PTOH 4FVMA 3GTPB 3KBGA 5CV4A 4I65A 2ZJQA 1AZQA 4YY3L 3ICEA 3N1XC 4DHJD 4DNTB 3ERSX 1CTMA 4O42A 2GVBA 2K4KA 4RGMA 1BOSA 2F03A 4A3JB 4B3MQ 1ESRA 4GKJQ 3R93A 5C23A 1G8ZD 3HOVB 3DEPA 4HTHA 3TEZA 4ZOHC 3PZ8A 3ZLZA 2V4DA 3AEDB 2ZZPB 2AL6A 4OZAA 4PS7A 4LK1C 2L11A 2WLBA 1OFFA 5LXHA 1JJ2A 5GADC 2M0XA 1C4PA 2LD9A 5A2QE 1RTOA 4W9DA 5AJ3Q 2PW7A 4KKTA 1J7CA 3AE8B 3NG0A 4HMJA 1KD1C 4P71A 1B3QA 3GOEA 2VL6A 1YZ6A 3VYRA 4BKTA 3FHWA 4HKZE 1A8VA 1ICWA 1V43A 2LS01 3U9OA 3UDGA 3OWFA 3HVZA 4YTMB 4P73A 4LNKA 3JAML 2L4NA 1N62A 1V80A 2FCSA 3Q8FA 2B2TC 2KUMA 1Z5SB 4LNNA 5E6OA 4KGTA 5JZEB 2AL3A 3KYCD 1O7YA 3CPFA 2BBCA 1EYGA 1TS2A 3CXCA 1B8AA 1EY7A 2RCFA 2XNAC 1QILA 3T1YQ 3BZCA 4DHJB 4DXGA 2ZVNA 4WJWA 4FULA 4GN1A 1U4LA 3H0GG 5AZGA 3SGIA 3DWGC 3TP5A 4A3GG 1Y8PB 4KK7A 2R93H 1BBWA 2F0QA 2C60A 1NY4A 2JU6X 5TR5A 1WGRA 1YMHE 2LHDA 1WD0A 1CJEA 2NWGA 3L0WB 2CQOA 5CORA 5BMGA 1HTPA 5EPJA 4C3HB 3I72A 2SAKA 1QF6A 2JYTA 2XSCA 2ON8A 5FR6A 4IWQA 4ZDVA 3B08A 2Q2UA 3PTFC 1KNAA 3RZOH 2PPHA 4PYZA 2O2VB 3NELA
chains in the Genus database with same CATH topology
5AUIA 1G2SA 1WYGA 3CIRB 4MH8A 3M85A 1F2RI 1SSNA 4HEDA 2NVTB 4IQZA 3J7YW 3I73A 4M8AA 3K5LA 1IGCA 1SNDA 1ZOYB 5AUKA 1STYA 1D1IA 4NMZA 1ILQA 1B44D 2EOTA 4KN7C 4IUQA 4RAUC 4KKIA 4RHRA 3EUB2 2B2YC 1K53A 4HCSA 1SJED 5J22A 3E6ZX 2F0EA 5FLXL 4IZ8A 3HGBA 3D31A 1FMAD 1GAQB 2PLPA 4D2KA 2A6ED 3SK8A 2K5DA 2L1BA 4OL7A 4WRDA 4A3IB 2GA4B 2ZXPA 3PV0A 1F0ZA 2VNUD 3EFXD 3BVGA 1MHXA 4TQ1A 4ZRQA 2I46A 1SMYD 3U9SA 1Q1EA 2KECA 1S5ED 2WXPA 1FM0D 3K5OA 4USAA 5KNBA 4PMWA 3CHBD 3BYYB 3GTGB 4KKSA 2RVLA 2E3TA 1QNUA 1DXMA 2M00A 1LT6D 3QOJA 1K8OA 3NRZA 3E56A 1Y8NB 4DAVA 4TQ0A 4QB4A 1KDAA 1PGBA 1SF0A 4YSZB 2CHBD 3QIAA 3KBXA 5IOCA 1WTOA 1QT9A 1HA5A 4N9PA 1UEAB 4BA2I 1YN5A 1F2ZA 3RFZB 3T3NA 5NUCA 3FPPA 4B9WA 2F0FA 2WXJA 4NAWB 1L0YB 3C46A 2W3RA 1IUEA 3KF8A 5I2YA 3L4PA 5HI1A 3V3XA 4A3EB 1AWDA 1VZ8A 3CQZB 2B2WA 3Q8CA 4ILWA 4U673 2E2HB 4X3SA 1HCZA 3NSWA 1C77A 2R92B 3M4YA 2OEOA 3H3VC 3TZDA 1PRTC 4RA8A 3D4DA 3T53B 2FUG1 1H9RA 1FXIA 4L1BA 1STBA 3AEFB 2JSVX 4ZKCB 3DWMA 2F0OA 2EY6A 2F3VA 2RSNA 2JA8B 4A3BB 3S15B 2INNE 2JEBI 3RUZA 1IBXA 3VYSA 1EY9A 1FCCC 3T4AC 2F3WA 1N63A 2N0SB 4HN7A 3BIID 4DQOC 3S2HB 5J1ZA 2IT1A 1SEBD 2B2VC 4R9WA 3J7AV 1Z7TA 1RWSA 4YXDB 4EQOA 1PFNA 1MHHE 3P4RB 2R61A 3GD7A 2Z4IA 1HEZE 2A5HA 2Y3AA 3KWVA 3N9YC 4B9XA 2IX1A 3TBIB 2NMQA 4PMCA 1V1PA 1H9KA 4FF4A 4G7OC 2PZWA 1IKLA 1FEHA 2PNRC 2NN6G 2WDRB 5COYA 2QEJC 1L6VA 2K03A 1HRJA 3LNNA 2F0UA 2QJLA 3S1MB 2WDQB 1BCPB 1T5XD 2ZXRA 1HPCA 1X32A 3AEBB 1LT4D 2RKSA 1V97A 1PUTA 3EJIA 3W1SA 3CRKC 3S16B 1L4DB 1LV9A 2ZT9C 4ZUJA 2ENBA 3A55A 2KVMA 2B8FA 5CV6A 1JALA 3IXSA 2IX3A 4PQXA 3TEXA 5D7GA 2A74C 4QF4A 2IGGA 2IWHA 2N9LA 1NR4A 3TZUA 2L1AA 1U4MA 2EPBA 3N6RA 3PO0A 1I4XA 4ZHPA 4BA1I 1ENFA 3Q23A 1H9MA 1IBXB 2M19A 3FVQA 5DEHA 2XN9C 3R2IA 1YJJA 5C6AA 2K0PA 3P1MA 4BBSB 1EYAA 4RKLA 4QMGA 3FILA 4A3FB 5EGTA 1SB3C 1DOIA 5I6WA 3NUCA 4R8NA 3S1QB 3Q24A 1BO0A 1N5WA 2M0AA 5M5YB 1J9OA 2G9DA 3J80L 1WTRA 3TP7A 2B76B 1E2VA 3TP8A 4NZLB 1V1PB 3HOYB 1TYGB 4BY7B 2PYKA 1XLNA 4IFDH 1WCMB 1TZOA 1NI3A 3NXWA 1OQRA 1PLFA 1GHJA 1SNOA 4YSYB 5EE1A 4REZA 3DM1A 3RMHA 2K28A 3AE6B 5KGUA 4F8MA 2I38A 3I90A 4MIUA 3R3OA 3TSSA 1QKZA 4RH6A 2FE8A 2DLBA 1JC7A 2NYZD 2XWBB 2ZXOA 3T16A 1PDQA 2WKDA 1SNPA 5IGGA 1PMRA 2WXFA 1RKNA 2E75C 1HQMC 4U68A 5IGFA 4XT1B 5HURA 3EROA 3GQBA 2BE5D 4HSVA 4TMAB 3LB8C 1B9MA 1BCPF 1KLGD 2FJ2A 2MPMA 3NBHA 2IGHA 2BDOA 5C2TB 5CGKA 5M5WB 2F0MA 3I91A 3GTOB 2WKCA 1RTNA 4KX6B 1KAAA 1JWMD 1I7HA 1ZYRD 2JYOA 4IURA 1VJKA 1AN8A 2KDMA 3PUWA 1B50A 1E6EB 4HKQA 1I4GA 1FD7D 2WNMA 3ND8A 3ERQA 3FILB 3Q6SA 2BE5C 1EY0A 1EWHA 1DOXA 1HZ5A 1ROEA 1QCBD 3FRPB 4LLGM 2C5CA 1SYCA 3KLRA 3PO2B 4LTUA 1KLUD 4XYQA 3NQIA 5LNK1 3CU7A 4WAFA 1ZYRC 3UI3A 1VZ7A 1JMLA 4X3UA 4XQNA 1QQRA 1ILPA 3KQ4A 1A3TA 2F0NA 1SFOB 3ETRA 3PUXA 2W54A 1MPEA 1OXXK 4PT5A 1CHPD 4G57A 5CMDA 2N55A 4G4KA 4JE3B 5BMHA 2B2UA 4ZKBB 1HXYD 5FLXE 1F9PA 2JEAI 1MVKA 2SEBD 5JVG3 3WDNA 5FR3A 1I4QA 5M3MB 1SYBA 4DGZA 2EY2A 1E10A 1B4OA 2FBWB 4HMIA 2R3ZA 5MPOA 4K8IA 3WCQA 3D6WA 4Z9CB 1L4ZB 1DZ1A 1I3QB 3W9CB 3DMUA 1K52A 4K5XA 3J81E 3RZDB 3S14B 3A7AB 3AEGB 2K5PA 3H8HA 4GDKB 1E2ZA 2AWOA 5T8IA 3HZXA 4CHTB 1WVLA 2CQAA 2G9HD 2I07B 1TU2B 4ZHOA 3BS1A 4JBWA 5I9PA 3VR8B 3R8BA 2PZUA 1TT2A 1VF5C 1CZWA 3MHBA 1CZPA 1SYFA 1M8AA 1WTPA 2NB0A 3A7LA 2B8GA 5JPNC 3VYTA 3BK1A 2YEPF 1DM0B 2O2LD 2D5DA 3IKJA 3NS1A 5JPMC 3S9WA 5F2DA 2R7ZB 5EKIA 1E0ZA 1D1KA 5C3WA 2YYZA 1JRPA 3HRZC 1FNWA 2NZ1D 1SYGA 4IUVA 4ZQ3A 1ZXHA 4FF3A 1OXTA 3B9JA 3P20A 1L0XB 4BY1B 1NR2A 1S5FD 3V2TA 3CRLC 1EU3A 2ICEC 3OOCA 1RM6C 1X3PA 2A6HD 3HRDD 1O80A 1KH0A 1VDVA 4K6DA 5BN3A 1A15A 5FK9C 3K58A 1WRIA 3PUZA 2WDVB 2H88B 1XXGA 1IKMA 4N58A 2XVSA 4C80A 2EXZA 2L0CA 1E9MA 1PGXA 1PTOF 1VLBA 5IGEA 2Z1CA 2O4XA 1MGSA 2A6HC 4GDLB 4X3KA 5G5GA 4DAPA 4C3IG 2AUKA 2WP9B 2M2LA 3DEOA 2A69D 4EQPA 1Y1WB 2Y5CA 4IUUA 1LTTD 4CJ2C 2KACA 1MSHA 4KY5A 1QG7A 4TQUS 2HCIA 1DOYA 3C3LA 1Q1BA 2D9UA 3E5SA 4A8XC 1TKWB 2GB1A 2LKVA 1QNKA 3VR2A 2EZVA 2WXQA 3ZJVA 1LACA 1SE3A 1BNZA 4F87A 2N88A 1XYIA 4K8JA 2A69C 2CJOA 1IW7D 2J52A 2JA6B 1WXQA 3W2DA 4IFDG 1LTAD 4A55A 4FXDA 2BT6A 4DNRB 4RWSC 2SDFA 4JWSC 1AZPA 2BA0A 3EQLC 1BUIC 1PZKD 1N61A 2A68D 4KY6A 2WQYB 2J0TD 2QILA 3A56A 1FYCA 1IW7C 1CT1D 1YQ3B 5CV7A 4RCOA 4L8JA 5BMIA 4YT0B 3KLSA 5IT9L 2D62A 2KAJA 4MM3B 4BBRB 5E6JA 4L63B 1MBYA 1Y1VB 5JEAH 4CGYB 2A68C 3I4NB 4RGTA 5CV5A 1TS4A 4R8IA 2BDNA 2EY1A 1IL8A 1IYVA 3NUHB 1JOQA 5KYIA 1QWYA 2WV6D 2NTSA 4TRDA 2INPE 3LWEA 4FXGC 1C79A 5T1IA 3J80E 1PFMA 1O7ZA 3OIQA 3GS2A 2MUYA 3VQIA 1KDCA 1R9TB 2Y0SB 1TWFB 1NVID 1MI2A 4XQQA 3QG1A 3K6OA 4RF1A 1KFYB 1FO4A 2MJDA 4C1NK 3SXHA 1W6KA 5IODA 2F0KA 4KGSA 3FDTA 1EZ6A 1TKGA 3VR5A 5BYQA 2WAQB 1ZDVA 1ET6A 1VRAB 2RA4A 2K7VA 1JWBD 2JA7B 1I6VC 1Q10A 2A6EC 1AFPA 3VRBB 3D4RA 3EVQA 1XLQA 1L5PA 1LLRD 1ZDXA 5I2XA 1TR5A 1JCKB 3KLSX 1JWUD 5C4HA 1SMYC 3VR3A 1SXTA 2JXTA 5KNDA 1R4PB 2BTEA 1STNA 3OHXC 4C3JG 2AQ2B 1GPXA 1CA5A 4QUFA 2DY7A 4EE2A 4YIJA 2F0VA 2QIEB 4WFN3 5EBDA 2PZTA 3AM9A 3E0JA 3NQTA 4M1UB 5C0XI 3PMFA 2X6LA 1UGJA 4PNYA 2LGIA 5EE9A 1P7FA 3T51B 3P4SB 4NAMA 2A73B 2K05A 3GB1A 1M4VA 3MC0B 1SSOA 1JROA 4HRSA 2GI9A 5K5PA 4K14A 1RHPA 2K33A 2RDGA 4ZK9B 2VZKD 1WSPA 3OMCA 3HOXB 5M5XB 2IGDA 4XQJA 2WS3B 2XRSD 3NTIA 2K6AA 2JXMB 3LXFA 1EIGA 1VCIA 2KHSA 5I4DA 3NVYA 4ID6A 2KWDA 4CBVA 4XT3B 4CKEA 1GUTA 1XCQL 1A2TA 1BCPD 4XDCA 3UI2A 5HGTA 1NENB 4XDXA 3W5UB 3C1EA 5BN5A 4A3GB 1SNCA 2PW5A 5ELDA 3SDZA 3NTKA 4UDUC 4A90A 3PIO3 3IAS1 2WXKA 5KRUA 3MXNA 1RD9D 4OZCA 1Y56A 4K5WA 4QCLA 1NYQA 2DBYA 1EY6A 3MA2B 2WU2B 2VZKB 3LWUA 3TP6A 1O78A 4MT5A 5C0XH 2HTME 3AU7A 5C5LA 1BXTA 2NVXB 1Q12A 1BCPC 4IDIA 4US9A 2B2WC 5IGDA 1UWXA 4JK1C 1C9FA 5ISRA 4KGRA 2OXPA 1JOOA 1EZ8A 1X3QA 1DOLA 2LUMA 4XE0A 1TKEA 1S4ZA 2EY5A 2BCOA 5ELCA 1J7AA 2X6GA 1PXUA 3OSOA 2M9VA 4ARCA 3K5MA 4IFDI 2IJ0A 3J9CA 1QOBA 2J7ZA 1B9RA 3NVWA 4ZAIA 3RLFA 2MP1A 3AH7A 2IL8A 3V96A 1RODA 2DY8A 4FO2A 1WTVA 3QO2A 4AQ7A 4F88A 3NPPA 1Q8IA 2RDFA 3IAYA 3RD4A 1NUCA 3O13A 2RQXA 1L6UA 1B53A 1NEKB 2L32A 3GTKB 1V8QA 5K36H 1EIHA 3BZDB 1HFGA 2Z4HA 4NP5A 2K01A 3MAQA 4K2KA 2L9HA 1UAPA 1KRHA 2LMCA 5CYUA 4A9AA 5JOBA 1G91A 1B1ZA 1CQFA 2W3SA 1TY2A 2OHFA 2JWUA 3U7ZA 3SHLA 3BDCA 1QOGA 1HZ6A 4H2AA 1YNTE 1PRTF 4ULLA 2PIAA 1EY8A 1OXUA 4DFAA 1RFKA 3AEAB 1VZ6A 2LFNA 5HHDG 2LJIA 3M7NA 1VMCA 2E74C 2VB2X 2N9KA 2K04A 1XF5L 2B63B 3PUYA 1QB5D 1TIID 1MD2D 3OMGA 3VR9B 1FRRA 2CJNA 2KCNA 5E4WC 1EOTA 1QOHA 2EYLA 5JEAG 3MZ5A 3K57A 1PZID 1EQVA 2PPBC 3D6CA 4JWUC 1Q90A 4NW2A 2KMMA 2QMTA 1IYUA 1EYDA 4LMQD 1CM9A 5KNCA 3JAME 1J8IA 3GTJB 2FMCA 3H94A 1T5EA 2VB3X 2AUJD 4ARIA 1D5XC 2KCCA 5EQ0A 2YEPB 3VA5A 1BR9A 1UWMA 5CC4A 4A3KB 2JA5B 4RCNA 2M56B 4N59A 1PTOD 1U9RA 5E4XA 1EY5A 1GUOA 5C5MA 2LMCB 4J8QA 1GUGA 1F2MA 2F0SA 4H7BA 4L6TB 1FFVA 4F7XA 1QOAA 2QSDA 2PMVA 2MH7A 5M9OA 3NVZA 2RDHA 1SBBB 3ABVB 2L12A 4WH4A 3PO3B 4FXKC 4P2CB 3MXGA 4KKUA 4IUPA 2ACZB 2X69A 2EYMA 1J7BA 1WTQA 2D5GA 1FXAA 4WQMA 1PTOC 1STEA 2H4OA 4ZLTF 3FEWX 1DD2A 4YSXB 4ZYSA 5EKKA 2JQRB 3TUOA 3GV6A 3I4MB 1PTOB 1TVXA 2Q8IB 1YN3A 3CKIB 4B08A 1U4PA 5H8YE 1F9SA 1ZXTA 3IT4B 1Y8OB 3K59A 5TSSA 1D4BA 5E1FA 2WXHA 1AEXA 1XX8A 2GRIA 5G3LF 1LTBD 3P4QB 3PIP3 2IW3A 5HG2A 5IGBA 1B9NA 1YQ4B 4US8A 1EU4A 5DAUA 2N7JA 1F2YA 4YTPB 4RFBA 3J7AF 1EWYC 3A8KE 3MTSA 2BB6A 4C3HG 1GOZA 3OPOA 4IUTA 2BS3B 4KD4A 5DM73 4NJCA 2K32A 1XWEA 4LJZC 1PDXA 3HKZB 2NUCA 1MI0A 3FC4A 2DYMA 2IPKD 1CA6A 3D8GA 2EVBA 2MJ8A 2R93B 4M0WA 3N52A 3Q8AA 1CHQD 2EJFC 1V8CA 5DNFA 5H92C 3IT6B 1RCVD 4XWTA 2RSOA 1TS5A 3RPFC 1A3UA 3ZQ4A 3SK6A 1WTXA 2AQ3B 4ZRPA 2MHVA 4OO1H 1EFID 3HS0C 2G1EA 1DYQA 3RZOB 3I57A 3FPUB 1EEID 2B2UC 5C0XG 3C2PA 2QKIC 4MN3A 2V4IB 4V0BA 4J1MA 3AEEB 5I6YA 1KTKA 2Q5WD 5JEAJ 5C4ZA 3KWLA 3AE4B 5D14A 3TMEA 2V0GA 3MEHA 1EM7A 3MXPA 3P1HA 1FGBD 2PCFB 4HROA 3BK2A 4KY7A 5C3EB 1NSNS 2F0PA 4XWWA 4EQNA 4Q2JA 5G5HA 1V1OA 3GTMB 4AYBB 2F0JA 2XIWA 5J39A 3BWUD 4P6VF 3SR6A 3MJ5A 3HOWB 1GXDC 4HAEA 4P16A 2B2TA 1JR0D 1N5XA 2BB5A 3DHQA 1JORA 3F2UA 3K0YA 2E2DC 4K6LA 4OHJA 1TS3A 4H44C 2PVOD 2HDEA 2V3NA 4ODGA 2PVGC 4XXEA 1F2RC 1GUSA 3A8IE 5GXGB 1K51A 1ET9A 4KHZA 3SEBA 3ZYYX 1GUNA 3DWQA 3HOUB 4L23A 1D5MC 5JXVA 1P7EA 1ZPSA 3VA7A 5K36G 3NVVA 1JICA 2WXIA 2XWJB 1F2LA 5JJZA 5D3DA 3B2FA 1TWCB 2L83A 2NVYB 1G6ZA 4DK0A 4OIKA 3A8JE 2LFIA 1I6HB 4CKCA 1S5BD 1JE4A 2CU3A 2MJ3A 4A93B 2NVQB 1U4RA 3BYTB 3AB9A 1ENCA 3T3OA 1C4CA 2B2YA 3EGRA 1ESFA 1C76A 2K9XA 1EYCA 1ZXIA 3VR4A 1L0VB 1SE4A 2KEEA 3AMZA 2WB1B 4IUNA 2WXLA 1JB3A 1RYJA 1A3VA 2WXMA 3Q69A 1NAPA 3Q0AA 3P63A 3K5NA 2Z8LA 1FD6A 1I50B 1LT3D 3V05A 3T56B 1A6XA 1RDPD 4GZYC 4MACA 3M4OB 4HSPA 1C4QA 2LHEA 2PQEA 2V3PA 4WIPA 2CVRA 2SNSA 4JX1C 2OEDA 3A54A 2WXNA 2K1BA 4O1NA 1JQ4A 5EKLA 4Q0FA 1ZP0B 1DOKA 1LTGD 2K5QA 4UAIA 5CV9A 1GB1A 3AB5A 1ZEQX 3AECB 1LTRD 4RNAA 1T3QA 3IL8A 4PV1C 3MHZA 2WU5B 5FO9B 2R6GA 5CR3A 3PUVA 3SK5A 2W82A 3VRAB 5C4XB 1UUPA 4HR7B 2CW0D 3LYYA 3HEJA 1ZKOA 5AFWA 2Q8RE 1E0BA 5C0XJ 3TEYA 3GP7A 4LK0M 3M7GA 2EYOA 1SJHD 3W5VB 2PTLA 1FCLA 3I70A 2EE1A 3HG9A 3EA6A 1WTWA 4N9TA 1CFMA 4B0EA 4CQNA 5C44B 4KV6A 3I9V1 2KA7A 2HDLA 4WWMA 2JSOA 4FYDA 2TSSA 1CK1A 4K2LA 2CW0C 3MP9A 1FNUA 2PMZB 4J6HA 2L5TA 3AE9B 3TEWA 5CBAE 5ELFA 3G7LA 4OIJA 3J81L 2EYHA 4E6IA 1FFUA 1XTCD 2SOBA 2EJGC 2VXWA 3BDLA 4A6QA 1G291 2JE6I 4EGVA 1C4AA 1PYWD 1TWHB 1LABA 2QF7A 2WXOA 4C3IB 1JQYD 4C7ZA 1R7SA 1HFNA 1XCTL 1Q3LA 3B2GA 3P4PB 3FKIB 4XDDA 2B2VA 2BW2A 2JZPA 4G7ZC 2F0IA 3LX0A 1TWGB 1PRTD 4XYOA 4OVZA 5ELBA 4CKBA 3X3NA 4DF7A 3AV8A 3VR6A 4JPSA 1STHA 4HCEA 4PMBA 1D2BA 1OXVA 2E76C 1CZGA 3BVMA 3AN1A 5M3FB 1YN4A 1XEEA 1HHVA 2F1MA 4IN3A 4IFDJ 3S1NB 2FHTA 4L2YA 4KMUC 4DN4M 1EWCA 1D5ZC 3H0GB 3U2SC 4A3DB 3ZJUA 4V190 2OT2A 4H13C 1XLPA 2TMPA 1K50A 4KD3A 4OO1G 1CI3M 1B3AA 4CJ0B 3AE5B 2HQEA 3L3OC 1PRTB 1YNJD 3QOLA 1GB4A 2PKOA 5FO8B 4RKBA 4WURA 2BS2B 4B0MA 3NBIA 3GTQB 4MHEA 4K5VA 4DK1A 5D3IB 4C1NI 1PGAA 1NCVA 2ONQA 3SE0A 1SYEA 2J53A 3OWEB 2H1EA 4ME5A 3OW7A 1AP0A 1AYFA 1PZJD 2JYEA 2MEKA 2E2JB 4Y7NB 4OZBA 1YNJC 3L9AX 2KQ4X 3SFDB 3AMUA 5FKAC 4RF0A 5DM63 2Y5PA 3I8ZA 2KN4A 1SNQA 2BYTA 2EJMA 5IIFA 5A2QL 3BDOA 1FRDA 4QUCA 3S2DB 2KEDA 2HCCA 3URYA 4EVOA 5C3JB 4KJNA 2BS4B 2EYFA 1OO9B 1OXSC 1VF7A 3BVZA 1I4PA 4H0LC 4YWGG 3NWSA 2EYJA 4QIWB 1ACCA 3Q8BA 2HDMA 5EPLA 4FP5D 1BDOA 3HVDA 2J4XA 3MVVA 1OQQA 1K8MA 1PFBA 1BUVT 1DGJA 1LT5D 3FAHA 4DA2A 3AE2B 1A2UA 2ICIA 3GTLB 1TQOA 4RHSA 2F0LA 3Q8EA 1A70A 4J3OD 1F9RA 2OF1A 3KK7A 1SIJA 1FR3A 3P42A 1HUMA 4XIGS 5G3LD 4DU9A 5LL6X 2F0HA 3DWAA 3L7ZC 4N6EB 1RF2D 4FF2A 2K22A 2PO4A 1H9JA 1IHZA 3IAM1 2PW9A 4OGQC 4C3JB 4RGOS 1XLOA 4GLSC 1KF6B 1G2TA 1BBXC 2SNMA 3GO5A 3NK9A 4ABNA 5JAVA 2DWQA 3H6MA 2BA1A 2F0GA 2B39A 4BWGB 4C56C 4G7HC 2H89B 1GUWA 4I7ZC 1SE2A 1JW9D 4DXFA 4HEA1 4FF1A 3FMCA 2MJEA 1UNSA 1D6EC 2EDGA 3T13A 1JWAD 1TWAB 1H9SA 5KEEA 1HTLD 2ZW1A 3WOFA 3P75A 4BS9A 2EKIA 2W55A 1FIQA 5C4JB 3M3YB 4IALA 3R2TA 5A35A 1I4HA 3AE1B 2NTTA 5BYSA 5BYRA 1FNVA 4XTCS 1QE6A 2WACA 2WIIB 3HP3A 4KJOA 1DCZA 3H09A 2RBMA 4X3TA 2E2IB 1EL0A 1VMPA 3HUIA 3WOEA 2YU9B 1EY4A 1T6BX 3D4WA 3I3CA 4NDXA 1TY0A 2FINB 5FOBB 5JVH3 3OIPA 2KJXA 4S3SA 1O7LA 2J42A 4HJGE 2FFKB 1AW7A 1F9QA 1GJXA 3TDQA 2NBFA 2F0DA 5CBEE 1DJRD 1LO5D 2AX5A 3NTHA 3W3AA 2X38A 1KNEA 3QB3A 4CJ1B 2L52A 1RJTA 3QJYA 2K3UA 3SR1A 4KI0A 5IT9E 2ID0A 1KABA 2ZW0A 3DWPA 5I9OA 2JP1A 3H91A 1XO3A 3DXJC 2EELA 3SFEB 1HQRD 3K7AB 3MWYW 3S17B 2RMMA 4TSSA 5E3FA 2EYPA 1NYRA 3CWIA 3Q22A 4FXCA 3SVMA 4OW0A 1ONLA 4OO1I 3AE7B 2AQ1B 3IFDA 3NHHA 1H9SB 4KHVA 5EBCA 1JOKA 2WP8J 1R4QB 1VDZA 3QWNA 3AE3B 2C9OA 2KOLA 5HFYA 1HUNA 5CV8A 1ENAA 2WXRA 5LL6S 1BMLC 1LTSD 1Z47A 2O5IC 3NWTA 1E2WA 4KTAA 1EEFD 1JWSD 4ITKA 3S1RB 3X3MA 3DUZA 2I2YA 1I4RA 1STAA 1K83B 2VUMB 4DAYA 1BQQT 2F4IA 3HOZB 1TJEA 3U52E 1HA6A 2IDYA 3U4EG 4ZRZA 5IGCA 3BG3A 3SK4A 1E7PB 5FO7B 1SDFA 3NZ3A 1DONA 3ITPA 5D65A 5ELEA 5EE3A 1C48A 2WXGA 3MFYA 1CQVA 4IOIE 2NN6I 4RGNA 5KIXA 1GHKA 2IX0A 3GV3A 2WINB 3ZJTA 2RPVA 3I4LA 3NP8A 1PFDA 1YJIA 2D2CC 3KUPA 1DOMA 3C8YA 3ZGZA 3VYUA 1YNND 1VR9A 2FMMA 1WWTA 2AWNA 1ZUD2 1N60A 2LEKA 2BOSA 2F0TA 2QDBA 5BN4A 3IFTA 5EE0A 1F77A 1IGDA 1B2TA 2F0WA 3TN2A 3MXUA 2DN8A 4FNFA 1SNMA 1ZE3D 4Q5VA 4TKOB 5KYLA 3G6JB 4C2MB 4AS1A 2LY7A 3P7JA 1S5CD 3MFGA 1MSGA 2HUGA 1QJOA 1YNNC 4ZUIA 1S5DD 2O5JC 1STGA 1WD1A 1C8CA 4NKLA 2JX5A 1LTID 1Z6HA 1WGKA 4YTNB 5EPKA 1EQTA 1KDBA 2Q8TA 1SAPA 4LAAA 5T1GA 5C3XA 2DNCA 1BF4A 3ND9A 1SYDA 1II3A 3C1FA 1QOFA 3E9SA 2XRQD 4R3DA 4KN4C 2E6XA 2DNEA 2NN6H 5EJWA 4IKGA 3PZ7A 2QCPX 2MGSA 3NE5B 2L55A 4KKJA 2K5WA 1C78A 1Y69U 2DYOA 2KQ3A 3ONAB 1TKYA 3D3RA 4WORA 4A3MB 1W6JA 4C7YA 5LHY1 1QLBB 1ML0D 1PTOH 4FVMA 3GTPB 3KBGA 5CV4A 4I65A 1AZQA 4DNTB 1CTMA 4O42A 4RGMA 1BOSA 2F03A 4A3JB 1ESRA 3R93A 1G8ZD 3HOVB 3DEPA 4HTHA 3TEZA <