3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
b'SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
5FKAC 1HQRD 2O2LD 1PTOF 1FNUA 1SBBB 2QEJC 2QILA 1I4GA 4Z9CB 1HA5A 1KLUD 1LT6D 4DXFA 1V1OA 1EEID 3R2TA 1RD9D 1TY2A 1EU3A 2AQ2B 1B44D 1I4XA 4RHRA 3BYYB 1I4RA 2AQ1B 1S5ED 2IJ0A 2AQ3B 1F77A 2XN9C 4RGNA 1AN8A 1JQYD 3BZDB 1LLRD 3BVGA 5TSSA 5I4DA 1M4VA 1DJRD 1LT5D 1ET9A 1JWMD 4BWGB 1S5DD 3BYTB 1FGBD 4TSSA 3EA6A 1CHQD 1PZID 3BVMA 4RGMA 1TS2A 1FNVA 1JWUD 2NTSA 3R8BA 4OHJA 1PYWD 1I4PA 1XTCD 3BVZA 1I4QA 3MC0B 1PTOC 1D5ZC 3SEBA 3O13A 1FNWA 3MFGA 5FK9C 5ELBA 1EEFD 5ELFA 4O1NA 2WV6D 1BCPD 3CHBD 1BCPB 1KLGD 3DWAA 1EU4A 3OWEB 1QILA 3KLSX 4L63B 3V05A 5ELEA 1CQVA 3R2IA 1TS3A 2RDHA 4ZYSA 1LTID 1LT3D 2IPKD 2XRSD 4RH6A 1HXYD 1S5BD 1UUPA 3W2DA 4UDUC 1ENFA 4RCOA 1D5MC 1I4HA 2XRQD 5ELCA 1EWCA 4RFBA 1YN3A 2ICIA 4RGTA 1FD7D 1JCKB 3DWPA 1LTRD 1SE4A 2G9HD 1JR0D 2XNAC 1RCVD 1B1ZA 3URYA 1SE3A 1MD2D 5ELDA 3TSSA 1PRTD 1LTTD 1S5CD 1PRTB 2RDGA 1BCPF 1BXTA 1G8ZD 1LTBD 1JWSD 4C56C 1LTAD 2SEBD 1SJED 2Z8LA 1BCPC 1SJHD 4RHSA 1LT4D 1CHPD 1D6EC 1V1PB 4NZLB 2CHBD 1PTOD 1S5FD 1L0YB 1PTOB 1D5XC 1SEBD 1CT1D 3GP7A 2R61A 1DYQA 1GOZA 5D3DA 1LO5D 3DWQA 1CK1A 4K6LA 3EFXD 1STEA 2TSSA 4L6TB 1SE2A 1PZJD 1RDPD 1EFID 1LTGD 1YN4A 2J4XA 5D3IB 1UNSA 1ESFA 1SXTA 1AW7A 1ET6A 4RGOS 1KTKA 1YN5A 1PRTF 1PTOH 1T5XD 1TY0A 1PZKD 1V1PA 4DXGA 1XXGA 1HTLD 1TS5A 1L0XB 1PRTC 2NTTA 1RF2D 1TS4A 1LTSD
chains in the Genus database with same CATH superfamily
2ZCBA 2B8FA 2LD9A 3RT3B 1PTOF 3C1EA 4DKAC 4U673 4LJOB 3K81C 3R2TA 4OWWB 3B9JA 2Z1CA 4DPGA 2B3GA 3D3RA 1EY4A 2EKIA 2O6VD 3GTMB 2L3ZA 2M0XA 1FFUA 4JV5L 2G45B 2UU9Q 3QOLA 3I63C 1FFVA 3PUWA 1PFDA 2GBKA 4YSXB 3EFCA 3ZO5B 3GTQB 1X1MA 3ONAB 3WWVA 3CPWA 1TJEA 1C3TA 2A69D 3NHHA 3FPPA 4WRDA 3HOZB 5IYBH 1HA6A 1QT9A 3L0OA 1I6HB 1UE1A 1K9MC 4BKGA 4LF7L 4YHHQ 1YIWA 3CSFA 3HRZC 3Q8FA 3BU2A 4BZAA 3W5OA 5C3EH 2GBNA 1NAPA 1UE6A 4HJ8A 5AUKA 3N32A 2WXMA 4DK5A 3NVZA 1NBWA 2UU7A 1XTDA 4DR2L 4DV7L 4OO1H 4R1JA 1VR9A 4A3JG 3KDFB 3HVZA 4LNKA 2ZJPA 3AEGB 1G2SA 2B2VC 3V6EB 3CKIB 4CQNA 4MGIE 2WV6D 2KJXA 1W6JA 4IOCA 1SE9A 1R4MB 4C7ZA 3ENEA 1TIID 2JXXA 3QX1A 3N30A 2F4IA 2CU3A 4JI0L 2KDFB 4ZCKA 4JIOU 3AEFB 3T1YL 2L52A 1WTHA 2HDLA 5FJ8H 1S5BD 2VB2X 2UXDQ 1TKEA 3AE9B 1H9KA 3JAMi 3EROA 2MQJA 2KK8A 1L1OC 1HNWQ 2JA5B 2KAJA 1AARA 3E9IA 3G48A 4K3BA 4NXML 4A3OA 2F52A 1WJ4A 2V4IB 3AE1B 4AS1A 5CBAE 1G91A 4TKNA 2XNAC 3QOJA 4DK3C 1B1ZA 4C3JH 1MG4A 4DV3Q 1BBWA 3AE4B 1K0RA 2EIFA 5ELOA 4JI6L 3GTOB 3VUWA 2RGFA 1PRTD 2D11A 3NENA 2YV5A 3IG3A 1BCPF 2F4VL 5JPMC 1T9HA 2PJHA 2KN4A 2L9HA 4EZLA 2X6LA 2PI2E 4DR5L 1VQAA 2CHBD 1CUKA 2JUOA 3NOBA 3U4EG 3K58A 3GV6A 4L5TA 4JLCA 2BPSA 1ZXTA 1PTOB 2I5HA 2HQEA 3LWEA 3Q69A 3TEHB 4A93H 2K04A 4B95A 1V80A 3ZYYX 1WM2A 1T0YA 5D3DA 3RNFC 1N9WA 3OJ4B 1Y1WG 4DFAA 3N1YC 1X6OA 4RCNA 1E9MA 2N3SA 3Q0AA 2LXAA 3B08A 4PMBA 3RR5A 1ACCA 2Y0SE 2B2TC 3OYYA 2B39A 1ESFA 4S17A 1SXTA 5IYCH 4JQWC 4AYBE 1U4RA 2NB0A 3HOUH 3A54A 2Z59B 4EZJA 1YEZA 2I46A 1DM0B 3DEOA 5FO8B 3PIO3 2HTHA 2W3RA 4IDIA 2NUCA 4A3BH 2LVPA 4MT5A 2E3TA 3VXWA 4LF8Q 4GNXC 3WIMA 1U9RA 1RHPA 3A0JA 3VR5A 1EIHA 1RFAA 1J19A 4ILWA 3Q8AA 2LJ5A 2RA4A 5BR8Q 3V61A 3I91A 1LV9A 2B63B 2DUDA 1GUWA 4NNJB 3U2SC 1KLUD 2BB5A 3J81L 4EVOA 3V3XA 4IPGA 4FYDA 1Q81C 2NVTH 1CMXB 1GAQB 4A3IG 3GTJH 1B50A 5BYSA 1PFMA 1JALA 2MBHA 1F77A 2KWUB 4RGNA 4JI4L 2B2UA 4K8JA 1LLRD 1TKYA 5IN7A 1VLBA 5LMUL 5EQ0A 2WAQG 2FXQA 3R3MA 2UUBQ 3WANA 4XQNA 3TP6A 1IL2A 4G3XB 1GHJA 3PZDA 1A70A 2UUCL 4LFAL 5EGTA 4RGMA 2LKVA 2PPHA 5J18A 3J81j 2RKSA 2Y0SB 4DUZL 3VR8B 2Y5BB 1DOYA 4GDLA 4A3EB 3KDFA 3HOZG 2KCNA 2L1BA 1WI5A 1MPEA 4AYBB 4W9EA 3K57A 1D5ZC 4DR7Q 3RNBC 3ER0A 3DBHI 4RWSC 4BXXG 3MC8A 3AFQA 3MTSA 4K8IA 2MBEA 4TV3A 3RNCC 4A3CH 2OQKA 1RL2A 2F0LA 4KKUA 5BN4A 4X62Q 5C2TB 4IG7B 3VUXA 2KLGA 4ZQ3A 2N7DA 4W9HA 1PH4A 5AEKB 5CX3A 4OZAA 4XQQA 1BCPB 2DY8A 1EU4A 4A3MG 2PZWA 1V2YA 1J0GA 2FCMA 1XF5L 2ZM6Q 1E8ZA 4ZDVA 5ELEA 3T3OA 3IVFA 2MSED 4A3LG 1TS3A 4EQNA 3CCLA 3JW0X 1BO0A 1O7ZA 1VQCA 2LI5A 3TN2A 2KT7A 1BUVT 4HWIB 2C7NB 4UP7A 1IKLA 4EZKA 3W5UB 1I42A 2M17A 4TMAB 3S1RB 2JYTA 1F0ZA 4CHKA 2K4KA 2NVXB 1I4HA 2F0TA 2C35B 2GB1A 4K3CA 3J7YW 4YSZB 3CCJA 4JI5Q 1C4CA 2B2WA 3CMMB 2F03A 3HG9A 3M4OB 3HFZB 4HMJA 3VAWA 4XT3B 2ZXRA 3VQIA 2I5MX 2HHHQ 1E90A 2LJIA 3H0GB 4ZKBB 3I72A 1OTCA 3P63A 4V0BA 3PUYA 1U5KA 1G8ZD 4YCVA 1SB3C 2KBNA 4OELB 4KD4A 3KK7A 1DGSA 2SOBA 1STNA 1MKHA 2VS1A 2XTIA 3M85A 1Q82C 4MGYE 4UPAA 5IOIA 1E10A 4GU2A 4NJ7A 3K5OA 3GTPH 2IYDB 3MHBA 2K6QA 3HRDD 2UXBQ 1E8XA 4G0NB 4J3OD 2IHFA 3STBD 4IO9A 3ZQ4A 1KRHA 2FIFA 2RPQA 3KUZA 3S15H 3KUPA 1LO5D 4FXGC 4KLKA 4GOCA 3QJZA 1CKNB 4NP5A 4R4OA 3K80C 1VQNA 3DBRB 3DHHC 1HZAA 4N6EB 2EXZA 1VF5C 2J7ZA 2NPTB 2E8GA 4MTKA 3CF5A 4DK6C 5HFYA 4MGZE 1J6QA 5CGKA 3AMZA 1J9OA 1MBYA 3NSWA 4HJGE 3PRPB 3EN2A 4GZYC 1N32Q 2MX2A 1VD2A 1CSQA 2VXWA 2CFMA 2YTVA 2EXDA 2VNUD 1JT8A 4JVZA 5M5YH 1EWYC 3S14B 3TIXA 1GKHA 5D65A 1WFYA 1RODA 1AP0A 4GN1A 5C3WA 1STGA 1CJEA 4YT0B 3FILA 5FKAC 4KGRA 2NYZD 2DLBA 4ME3A 3CRKC 1Q7YC 3RMKC 1VCIA 2MBOA 1I4GA 1MJDA 4US9A 3E6ZX 2Q2HA 4LF7Q 1WH3A 4L2YA 3MC9A 4CGYB 2A1AA 3CWIA 1IUEA 4P71A 2NBUA 2QMTA 1GUSA 3P1HA 5HI1A 2O2VB 3M7NA 1Y8OB 3L16A 4OL7A 1L7YA 2ZJRA 2AYOB 2HTME 3PSEB 3IFWB 2L05A 1UWXA 2M00A 1GUOA 1UD7A 2FINB 3K7UC 1Y69U 3ML8A 4BY7B 3FKIG 3KQ4A 2CH4W 1QZHA 5NUCA 2WXNA 1X9NA 4I7AA 3GTKB 2D62A 1DOLA 4PYZA 2I2YA 2Q2IA 4QF4A 2MP2B 5M5XB 4CDDC 4JI0Q 3GE8C 4WQMA 2CKHB 4M8MA 4DV6L 2G5DA 2L4NA 3R8BA 3OJ3A 3PZ8A 5CYUA 1EFWA 1TWFB 3S2HH 2WLBA 3SEBA 4RKBA 2JA8H 1YX5B 2MA9B 1EEFD 4NXMQ 2NZOA 2E2JB 2J53A 4ME5A 4WWPA 3J81c 5DAUA 4PMCA 4AJWA 2Y0SG 5CHWA 3H09A 4FF2A 4GN4B 1VQLA 2D0OA 3SFEB 5FLMG 1CA5A 2OTLA 5EKLA 3RN5A 4YCUA 4G11A 2RDHA 1E2ZA 4IM3A 3QAQA 4LK1C 4JI6Q 3Q3FA 2KDEB 1HXYD 2JZPA 2F4VQ 3VR6A 4IFDI 4A3DB 4DR5Q 1YQ4B 5KHQA 3PV0A 3PZ7A 2F0IA 4N58A 4FVMA 1WZ0A 3MXUA 1LTRD 2EJMA 4D2KA 1JICA 1LTLA 1WJ6A 4HPPA 3PRMB 3VYUA 1R4NB 2DNCA 3L0WB 2BQQA 4UAIA 2VH1A 5EE1A 5FLXE 1F2ZA 3HOYH 3P4PB 2K52A 1X3EA 1YHBA 4B3SL 2R7ZG 3C1FA 4KHZA 4R8IA 1IL8A 2ZPNA 5EJWA 3S1NB 1RJTA 3RMHA 1KDBA 3SK5A 2ZTEA 4F7XA 1WWTA 3H0GG 2A5UA 3VDZA 1CKNA 2EKEC 4GXBA 5L95C 2DYBA 1IBKL 1GOZA 3P20A 4CHTB 5E6PA 4C1NI 3CCVA 1QZGA 1WMHB 1KAAA 1NMGA 1S4ZA 2RD0A 1L0VB 1X55A 1WTXA 2EOTA 2FNJB 3D6CA 4HDOA 2KDBA 1KLVA 1V49A 1WTVA 1UNSA 3TEZA 4M8NA 3HVDA 3EFUA 2Z9HA 2RVLA 5EBDA 1WVLA 4HJKA 3R93A 5FR6A 1Z6HA 1KDAA 1T5XD 1SDFA 3PHXB 2QEXA 2WXJA 2QDFA 4L1BA 2IGHA 4BBNC 4LNFA 2WACA 1YNTE 1EIGA 2XVSA 1LTSD 1QNKA 2DNEA 2NZHA 2WIIB 2I5LX 3BYYB 5EPJA 1BNZA 2JZZA 4P74A 3PT2B 4EUTA 3M4PA 1Q0WB 2V4LA 3M3JA 4LF4Q 1UF0A 1ZDVA 5C3XA 1GB4A 1XO3A 2BKRB 1WZ3A 2UUAQ 2FE8A 5LL6S 2KYWA 1FJGL 2MHVA 1O80A 4LFAQ 3Q22A 2F0EA 3H15A 3CRLC 1RWSA 4DUZQ 2JA6H 4OONA 2XSCA 1H95A 1E24A 2AQ3B 3RULA 3FHWA 2M0AA 3P2BA 4YTMB 3FAHA 1GB1A 1JQYD 1SYBA 3AU4A 1VF7A 3NY5A 4BS9A 1M4VA 2J0KA 3GD7A 1DOXA 3OPOA 3M4QA 4RG1A 1LACA 3IKJA 2LY7A 5IYDG 4DXAB 2B2YC 4HKQA 1C4AA 1HZCA 1I3QH 3K8AA 5BN3A 2NN6H 3OTOQ 5LMNW 3KBGA 1GJXA 1KFYB 4MSQB 3A4RA 2ZPYA 4W9JA 1SR3A 2FJ2A 3E9SA 5I9PA 3S16H 4FP5D 4DV4Q 5C44H 3FDTA 1I4QA 4QIWE 2QDBA 3MEHA 1ASZA 3GTQH 1FRRA 2JXTA 4I6NB 2KVRA 3PF5A 5G5GA 5L83A 3MFGA 2KMMA 4LUVA 4AQ7A 3VTUA 1PH8A 4DK0A 3GTGB 1C9OA 1I6HH 2BWES 3ZXRA 4IPDA 2ZNVB 2IO3B 1IW7C 4BXXH 2PZTA 1YMHE 2XK5A 2JRHA 1E3PA 3JVZX 4X64Q 3SXHA 5JJZA 1I50H 4GLVB 3ECIA 4BY1H 1QE6A 1NCVA 5D7GA 2JWUA 5JEAH 1EUJA 2RDBC 3I73A 5DCNA 2FCQA 2KHWB 2DYMA 3QC8B 3AM9A 4HXDA 3SDLC 5A35A 2D2CC 3ETRA 4DGZA 5C4HA 1BUIC 1D5MC 4PS8A 4WQOB 2XRQD 3TBLD 1HTQA 1EWCA 1YN3A 2R92B 1EIFA 2G9DA 4QCLA 4PYUA 2GBJA 2K25A 1JE4A 1KNAA 2VB3X 5E1FA 1PMRA 4BOSC 3PVLA 4A3DG 4K14A 3ZLZA 2LMCB 2R7FA 1TTNA 1LTTD 5CMDA 2A19A 4OVZA 1V1QA 1G291 2JA5H 4GGQA 3WA0A 1K8MA 3I3TB 4CBVA 3S2DB 5I6WA 4XYQA 4QIWB 2F0DA 2NVQH 1MI0A 2QSDA 3P1MA 1WMHA 5JJKA 2BGFA 4JI1L 1ROEA 1HRJA 2EY2A 4LF9Q 4MH8A 4KTAA 3GTOH 3BK1A 4H13C 3IT4B 3B1LX 2XIWA 2E5LL 4IUTA 1K51A 3EBEA 4RAUC 3LGJA 1CFMA 1WJJA 1LTGD 1U4PA 4I65A 2J4XA 1T0SC 3N52A 4XGAB 4IN3A 3HKZB 1W6KA 2N9KA 2K1BA 5C0XG 4ZRKA 3K5LA 4PV1C 1PRTF 1PTOH 2B29A 2YU9B 1T0QC 2MWSB 4REZA 3AQQA 2GVAA 5DM73 2QW7A 1YQBA 3N1ZC 3U30A 4JC0A 2NMQA 1E22A 1VQKA 1OXSC 4ZRQA 3ERSX 5GAHC 1EOVA 4C3HH 3U9SA 1YJ9A 2M19A 1GG3A 3KWVA 3VDYA 4YTPB 1QOGA 3PLUA 4DXFA 3V62A 4MHEA 2OT2A 1TWCB 1RD9D 3KVFB 2JA7B 2YTXA 4POGA 3SDZA 1P3QU 1Q8KA 1B3QA 2EE1A 2OF1A 3H7PA 2E76C 1STAA 2WP8J 1N60A 5JPNC 2L5TA 1ASYA 1S5ED 4DV6Q 2G3QB 2JY6A 3ITPA 3DHGC 5KHOA 2A6HC 2XGTA 5C4XB 1L4DB 3RN9C 1TVXA 2H5XA 4PK1A 2KOLA 4FNFA 3I4OA 5JJIA 1WCMH 2FBWB 4GKKL 2K8BA 1PH3A 2V9HA 1WR6E 2B63H 1HPCA 5KYLA 5TR5A 3W1GA 3I3CA 1WD0A 1PH2A 4OO1I 3DVNV 3T9LA 4FF3A 4K5XA 2WXLA 2HQLA 5GMVA 4PMWA 4HSPA 1NY4A 3A7AB 4F7ZA 1Y14B 4DF7A 3D4WA 2ZW1A 5KIXA 2WU5B 1K8OA 1WYDA 4NPNA 3KF8A 4X6AH 1WX7A 2CR5A 1F9QA 1OXVA 2BOSA 1KAWA 1CQFA 3FP9A 3AB5A 2LHEA 1XYIA 4LNQA 3VYTA 3PUXA 2KN5A 5C0XJ 3MA2B 4ZK9B 1GUTA 4WWNA 3R7QA 1UZXB 3A1QA 3ZJTA 4LFBL 1KL9A 3LX0A 3DBSA 1C7YA 1HNZQ 3HOVB 1NVID 2KHIA 2V0GA 1IHZA 2IW3A 1F9PA 5J17A 1CQVA 2HUGA 1EY5A 3JAMc 4A3EH 5EDSA 2ID0A 5HY6A 3U50C 3BG3A 3VYSA 4B3SQ 2XRSD 3KF6B 4OXPA 1HZ5A 1N6ZA 3IAS1 1E7ZA 4ZUJA 1F1HA 3HEJA 2F0WA 4BBSG 4A3JB 2JQOA 5M3FG 4A75A 1EYDA 2RSNA 2N1VA 3H94A 2QIEB 3L08A 1PFBA 5CV7A 1Y8NB 1FD6A 1NYQA 1XPRA 1ZOYB 4WJPA 2L1AA 2DJFC 2CW0C 4NW2A 2J52A 2CHXA 2LMCA 2PMZB 2A73B 1TWAB 1QNUA 2FMCA 1K50A 4A90A 4MEMA 2I1JA 1MD2D 1V9JA 4HAEA 1PRTB 2CQAA 3F8TA 4K2KA 3LWUA 1PH5A 2R92G 1PDXA 4X3UA 2INPE 2WNMA 3QB3A 2NVXH 4RHSA 2GMIC 1N33Q 1MHWC 1N8RC 4R9WA 3B2GA 3J9CA 2H88B 1FXTB 2WXPA 3BJUA 1QB5D 4YIJA 5IOCA 3M4OH 3LYYA 1MG8A 1WF9A 5BMHA 1WYWB 3D6WA 3L54A 5DM63 4IUMB 1EIYB 1ZGUB 2ACZB 5IGFA 3CPFA 2F0VA 3RLNA 5E3FA 1F2YA 3ULJA 4G7OC 2BYVE 5CV6A 5IP9G 2Q8IB 3EUB2 3NWSA 3JSVB 4W9FA 4A3GG 1ZXHA 1XMQL 1B4OA 4NJCA 2IGDA 1EY6A 4ZUIA 4APVA 2K05A 1UH6A 2OEDA 2Y5CA 4DHJB 3PO0A 2ZTCA 1HNXQ 3KLWA 2CHZA 3UIPB 4V190 4G7HC 4M02A 4DBGA 3EVQA 2OTJA 3MTNB 1TY0A 4N8X1 1L2NA 4ICUA 2IX1A 4HJ5A 1L1OB 3WCQA 2IO2B 2WAQE 4RM8A 5H1SE 1Y1WB 1SF0A 1PA6A 3RCZA 3KLSA 2GRIA 4I7ZC 5D6JB 2MCNB 5D94A 1XX8A 2CW0D 2E2HB 2DBYA 4LTUA 3W1SC 1ENCA 1RFKA 1UAPA 2GBMA 4IJLA 3DBHB 4DWFA 2O6VA 1EEID 4K0KL 1SGHA 1E2VA 3NXWA 1MSGA 1PH7A 4KHVA 5JHAA 2PNRC 1JOQA 3SK4A 3PIP3 5DPSA 5HG2A 4WAFA 1NSNS 5CV4A 3S14H 2WXIA 1A15A 2F0HA 5E4XA 1X3FA 5LMNL 1E8WA 2V3PA 2PNHA 4TUUA 5M5WB 3BVGA 3H6MA 3NVWA 1VDZA 2P5ZX 3JC66 2KCMA 4M01A 5FR3A 2PW7A 4GN5A 1S5DD 1J7AA 5IP7G 1N63A 2MUYA 4YWLA 1E7UA 5JZEB 1HUNA 2D9UA 3HOWH 3WAMA 4JBJA 1KIXA 3AE2B 5AUIA 2K5PA 2LGYA 4KJOA 2CJOA 2N9LA 1WXMA 3O13A 2MRPA 3T56B 3A33B 4HPMB 1C0AA 4BY7H 4DQOC 1D3ZA 2PMVA 4EKUA 3UGBB 1W3SA 2K5NA 5ELFA 3K7AH 1WXVA 2WAQB 2DHZA 3PCOB 3ALBA 4NY0A 1M90C 1Y8PB 1DONA 3RI7C 2KC1A 3AFPA 1Q12A 5M5XH 4GNXB 2MH7A 1AZQA 3PHWB 2D3BA 3PREA 1AYFA 5CR3A 4TQ0A 2PKOA 5M3MH 4DV5L 4KKIA 1CI3M 2Z4HA 3I4NB 4YWKA 4C3IH 3ZTCA 4HTHA 4R4TA 2BH2A 4RCOA 1YNJD 2E2JH 3HOVG 3AE3B 4MACA 1TGZB 2CU1A 1IXRA 4A3MB 3DMUA 4JI1Q 1WI0A 2DJGC 4FF4A 2RMMA 3NELA 3P7JA 4J8QA 4MN3A 3C46A 3KW5B 2BB6A 3Q23A 4P6VF 1K8GA 3CP0A 3LNNA 3A7LA 5IGCA 4XYOA 3OG5A 3CQZH 1QG7A 3GV3A 4GLAC 4CDEC 2IWHA 1VMPA 4IOAA 5COYA 2D5DA 1V8CA 2L0TA 4HDQA 4B0MA 2PYKA 4DDGD 4K81A 2ZTDA 4Y52H 1QVGA 4A3KG 5D14A 1YX6B 4ANUA 4HSVA 3B0AA 3L4PA 4B9WA 3IFDA 1NUCA 2LFNA 4FXKC 1YNNC 3TS0A 2E2IH 1MHXA 4XDXA 4B3TL 2JPHA 1QKZA 1XEEA 2SAKA 1XNRL 2EMSA 2F3IA 5KNCA 2HE7A 2LASA 2WXHA 4WWMA 3IHPC 4AUQC 4QJFA 1ZW7A 3ZNGC 5DNFA 4PZ7A 3QWZB 1II3A 4YSYB 3I4MG 1KTKA 2F3VA 4LUOA 2WS3B 5BMIA 5C23A 1V1PA 4HEDA 4WORA 2N4FA 4N8FA 1A5RA 1H9RA 1TS5A 3T4AC 1RF2D 4J15A 3AE5B 5K36H 3K5NA 2GBRA 5M9OA 1HQRD 1C8CA 3PO3H 4GKKQ 4IUPA 3T13A 2KNBA 1HCZA 4GOPA 4YWMA 5E6OA 1NI3A 3D0FA 3T53B 5GQOA 4XIGS 3QO2A 1CZGA 3L13A 1RM6C 3GDEA 2WQYB 3J81E 2AQ1B 2K5QA 1RAXA 3NBIA 3M62B 1L0WA 4GDKB 3C2PA 3VA5A 3J7AV 1MGSA 4KGSA 2XN9C 4HVBA 3MHSD 4DHJD 1QWYA 1TT2A 5TSSA 3DVGX 4P75A 1DJRD 1KDCA 1ET9A 3UDIA 1EQQA 1FRDA 2VQEQ 5H92C 4LFBQ 2V3SA 2VY3A 2PEAA 4TSSA 3EA6A 3VH4B 4ANXA 4KDIC 4ARIA 2W3SA 3PIPA 3MAQA 1FNVA 3PF4A 2ENBA 2EQSA 2PZUA 3FPUB 4IUVA 4N9TA 1IKMA 1OQRA 1WGKA 1WXAA 3A4SC 4BBRH 2KECA 2HIXA 5HURA 1WGGA 1ZPSA 3KYCD 3FKIB 4HCPB 1A62A 2BT6A 4GNXA 4O1NA 1JJ2A 2ZZPB 4JCVE 3EC8A 2F0JA 3TZUA 3CHBD 3OWEB 2H89B 1LQBA 1EYAA 2LRUA 1A63A 5IO9A 1Q10A 1WOCA 5DLQE 1EQVA 3QG1A 5IP4D 2IPKD 1Z2MA 1PGXA 3I4LA 2QCZA 4JL9A 3ND8A 5LNK1 2B2UC 3UI3A 4M0WB 4KGTA 3RNAC 2QA4A 1B2TA 3GS2A 2KA7A 1WIAA 4RFBA 2GOWA 1QZEA 2JRIB 4WAAA 4PT5A 1N5XA 3C0RB 2JE6I 3I4NG 2Q5WD 1SE4A 2G1EA 2LUEA 1RCVD 4KIKB 1NNXA 2JK8A 3L7ZC 2DX5B 3MJWA 2M9VA 3AB9A 2RDGA 4EX5A 2F0OA 1LTBD 4MH0E 5I9OA 4W9DA 1I6VC 4F8MA 4HIMA 1LT4D 3CXCA 3D4DA 1A8VA 4KZ0A 2D3CA 1C76A 1MSHA 2VQFL 2LXCA 3TL5A 3MEFA 1QOHA 3OWFA 1E0ZA 2EPBA 2JQRB 2FAZA 4LMQD 4CDCC 1X3GA 3BZKA 2WXQA 2R7ZB 2DZMA 5JAVA 2MQHA 5C4JB 1OQYA 1WM3A 2L83A 1AH9A 2DN8A 1RDPD 4DAVA 2EY1A 2BS3B 1G2TA 1NTGA 4K0KQ 4NXNL 2XEWA 2Q8RE 2C60A 3UIOB 2PO4A 1E1OA 1PFSA 4JI3L 1ILPA 5BMGA 5LXIB 1HE8A 2CJNA 3AU7A 3T1HQ 2B2WC 1B9RA 1WTRA 2K22A 2M4NA 4XDDA 1NDDA 3NK9A 1YJIA 1QOAA 4KMUC 2F0UA 3EJIA 5LMNQ 2LRWA 4MSMB 2FUHB 2RCNA 1A3UA 1GC7A 1Z7TA 1GO3E 2JSOA 4L23A 1ILQA 2BW2A 4HKZE 1MHHE 4XZ4A 4JYAL 2KKCA 5IIFA 1HA5A 2NZ1D 5GADC 5LLIA 2G4SA 3VHTC 4A20A 5IT9c 1IGCA 2AQ2B 1I4XA 4GDKA 2YU9H 2WDQB 3OW7A 4L5QA 1GM5A 3RZOB 1STHA 2NN6I 1B3AA 3CCSA 1WGHA 3APCA 4S3SA 2ON8A 1FXIA 5G5HA 2KMAA 1A3TA 2JP1A 1YJNA 3TS2A 3Q6SA 4OW0A 1N36L 1WJNA 3DBLI 1JOKA 4C1NK 3ZJYC 5E4WC 4B3RL 1V6EA 2L12A 5CTRC 3TMEA 3WAPA 3S1MH 4GIVA 2NVYB 3MXPA 4JV5Q 1FIQA 2VUMB 4FJZA 1TWCH 5G3LD 2JA7H 2Q2UA 2F0QA 3VR4A 1VQ4A 1MJEA 3S1QB 1ICFB 1CHQD 4US8A 4DUYL 3NG0A 2EYHA 3J7ZC 5C4XH 1IGDA 4DV5Q 4CKBA 3RZDB 5J3BA 4BKTA 3AE8B 4KN7C 2KEDA 2PI2A 4B9XA 3I2ZA 2E74C 5J1ZA 2WDRB 2WB1E 1JB7A 5FK9C 4IFDG 3WDNA 5LXHA 1JC7A 3BIID 4WFN3 4UP9A 3TEYA 5ISRA 3RZWC 1EF1A 3M4YA 1XPUA 4DR2Q 4DV7Q 3I55A 3H91A 1C79A 4B08A 3R2IA 2EJGC 1RLFA 3DLLA 2BVCA 1U4AA 2L7RA 2XWJB 1E2WA 2KMCA 1LT3D 4X3KA 4KKJA 2VW9A 1VQ8A 4P2CB 1AEXA 1ENFA 5IY0A 2JZ3B 4HLEA 3QJYA 1ZYRC 1K83B 4GSWA 3A5UA 2R93B 4A76A 1NMFA 5CV9A 1JMCA 3T1YQ 3HUIA 1ZUD2 4A8XC 1UGJA 3DVGY 3P75A 3G6EA 4OVUA 1PUTA 2KDMA 3ZDMC 5AZHA 1I5FA 2INNE 3DM3A 3UE0A 1K8RB 4B3TQ 1ZKHA 3KUDB 1PFNA 2M2LA 5AZGA 3NEMA 4A3JH 3CCQA 3NVYA 4AIMA 2KTFA 4P16A 4DV2L 4GMVA 3W1YA 3ZGZA 4DNRB 1X54A 3J80i 1F9SA 3KYHC 1E0BA 4RKLA 4GLXA 1BCPC 4DR4L 1AE2A 3H8HA 5C1ZA 5I2YA 2QGQA 3RYTA 1UE7A 2AX5A 2WB1B 3LDZE 3NS1A 5CHFA 1K0SA 1H4RA 1TWAH 1JE5A 2BDNA 1M8AA 2AUJD 1ENAA 4JX1C 2EYJA 1N34L 1SFOB 3SU8X 2CQOA 2LVOA 3ZNHB 4IFDJ 4KJNA 1PH6A 3PTFC 2TSSA 1KF6B 2EYLA 1H9SB 1LM0A 3VR3A 2BBCA 5D3IB 4K7UA 3R3OA 1GD7A 1H9JA 4JI2L 3KUCB 4LUZA 4K1RB 1JQ4A 2E75C 3AEAB 3UDXA 3LXFA 4KHPL 1EWIA 3X3MA 5LHY1 2HJ1A 2IGGA 3IL8A 1VQMA 3RNGC 1P1AA 4I6LB 3U7DA 2RR9A 3A56A 1BMLC 1VQPA 2KJRA 2MEKA 2LEKA 4P7IA 3RD2A 3FC4A 1V97A 4FF1A 1UBIA 4MGKE 2AL6A 1ESRA 4GKJL 2D5GA 3E0JA 2L32A 3NBHB 1GC6A 5GAGC 4EGVA 1KHIA 2NPTA 3SD5A 2WFWA 1GUGA 4HIKA 4NKLA 4QMGA 1TWHB 2CCZA 2O4XA 1EO6A 1FGUA 4OEMB 1XD3B 2D3AA 4BKSD 1Y1WH 4K7WA 2L11A 1SNDA 2RSOA 4LNOA 1XNQL 1VQGA 2LGXA 3IAYA 4EOYA 1EOTA 3SK8A 2E2HH 4PQXA 4G7ZC 2PVGC 2L8JA 4EE2A 4C3JB 1ZKOA 1WJUA 2LGSA 3TP5A 3TMPB 4JI4Q 2GVBA 2ICEC 3S17H 3OAWA 3RLOA 1NENB 3HM3A 5LMUQ 2MJ8A 4F87A 1GPXA 3AMUA 3BVZA 2O2VA 4RMAA 1TU2B 3MC0B 4YY3L 3TP7A 2TMPA 2VUMG 3QIJA 1LUZA 2UUCQ 4A93B 2KWVB 3CCEA 3T8MA 1EWHA 3OSOA 4OIKA 2HD3A 3JAML 1WX8A 4A3IH 3A9KB 1XCQL 4JI7L 4I6PA 2KHJA 1WE7A 1KNEA 3T51B 3C3LA 2WWZA 4N59A 4IKGA 2MP2A 3OIPA 2FMMA 3AULA 2N78A 5IGBA 4C4VB 3GO5A 5EKIA 2KFKB 3VRBB 4DR1L 3GTMH 4A3BB 1IPGA 3N3KB 1MFWA 4XC2A 2VQFQ 4XT1B 2OWOA 3OMGA 3K9OB 1ZDXA 3I57A 4HR7B 3M3YB 1SNPA 4W9LA 4Q0FA 1P7EA 3HOZH 4A3PA 1DOIA 2JEBI 3DPDA 1G51A 1O78A 1BF4A 2R93G 4BBSB 2NVTB 4NAWB 5M3FB 1WTPA 3HKSA 3BS1A 2IL8A 1IBXB 4M1UB 4NXNQ 3SR6A 3VTWA 3FRPB 2K28A 4TVAB 3K59A 4JI3Q 4A3MH 4NB3A 2ASBA 2REXA 4IM2A 1QOFA 1FCLA 1T3QA 3L10B 4A3LH 2AWTA 2LVQA 2HCIA 1Y8RC 2LZ6A 3F2CA 1DYQA 2OJWA 3PV1A 4FJYA 1H9SA 1IZ6A 2W82A 5FO9B 1OXTA 1Y1VB 4QB4A 3EFXD 3OW2A 1C77A 2VZAA 4R4QA 3DBRI 2WB1G 1TYGB 1PGBA 1EFID 1QUQB 4UY8C 1PH1A 4L5SA 3PPAA 3EECA 5IYBG 3D32A 4TKOB 3H3VH 1B9NA 1SNMA 3WALA 2WXRA 3I7FA 3A74A 1C48A 2DZJA 2IY5B 2RQXA 4UP8A 3KFUA 3OMCA 4EQPA 1AZPA 3J7A5 1A0IA 4RF0A 1N36Q 2DYOA 3NBHA 4B3RQ 3VVWB 2EMTA 4A3GB 1GVPA 2O2LD 4LK0M 5BO4B 1FNUA 2MPMA 4OO1G 3VA7A 1PVOA 2LFIA 5H8YE 2QCPX 2F0PA 3FVQA 4A9AA 1V1OA 2F0MA 3O65B 3QCAA 1TY2A 1EU3A 4BVUC 4FADA 1J7BA 5J2RA 1IW7D 2NCNA 4DUYQ 1EY0A 1U4LA 3A8JE 1ZXIA 2GN5A 3VUYA 3D8GA 1HUMA 1L2FA 1EYCA 1PYBA 4LJPB 1PXUA 4BA2I 2QF7A 2PW5A 1JWBD 4DAPA 5FJ8G 1WSPA 2WGSA 4MDKE 3NTKA 3OHXC 5I4DA 5A2QE 1JRPA 4ALPA 1SNOA 2INCC 2N55A 4LCDE 4YWGG 4IPCA 1JROA 2JXMB 4KY5A 5CHVC 1VQ7A 1GNUA 2VH2A 3S2AA 3HS0C 2EYPA 1A2UA 3FKYA 1PZID 1X56A 2C5LC 3KLRA 5BN5A 1HFGA 1QCBD 4C3JG 5EPKA 4CKEA 2ASQA 4ZHOA 2Z6KA 1DCZA 1LYLA 1FNWA 1YNXA 4HIOA 1BT0A 4H02A 3A9KA 4WJOA 1DGJA 2EELA 2DY7A 3ZKJC 5KGUA 4A55A 3HK0A 1XWEA 5A2QL 2RHQB 1QILA 4FXDA 3MFYA 1D8LA 1FEHA 1SYEA 4PS3A 2EZVA 2JT4B 1YVCA 1LFDA 1K28A 2JSVX 3SVMA 5JHBA 4H0LC 4ODGA 1RTOA 3N6RA 4A93G 1JMLA 3JYUA 1K3BC 4DNTB 3NQIA 4LAAA 2Z0DB 3Q8EA 2ZW0A 3HM6X 5G55A 3GTLB 3FKIH 4QY7A 4DR4Q 1SE8A 2EYOA 2N8NA 2RSUA 3TDQA 5M5YB 2BF8B 2KCTA 4JWSC 1P8LA 1WRDB 2PVOD 2X69A 5IE8A 3HOXB 3FEWX 4DK1A 5IYCG 3K6OA 3PMFA 4XYCA 3ZIMA 4NAWA 2R2OA 1N34Q 1WRIA 1XPOA 2BA1A 4K7SA 3URYA 4JBKA 1T6BX 2KENA 3I9V1 4A3BG 1SYDA 3AE6B 1Q8IA 1HHVA 5FLXc 1S5CD 1TBEA 3ML9A 1FL0A 3ND9A 3HP3A 2ZNVC 4EEWA 1JWSD 4KV6A 3S24A 1KRSA 3BK2A 3VTVA 3Q3MC 3R66C 4JI2Q 4CYEA 1OGWA 2N9XA 4KX6B 1JOOA 2FCNA 4IALA 5FLMH 4KHPQ 5ELNA 1KQSA 1JJCB 1N61A 4LLGM 1K8AC 3E3XA 1WY8A 1D5XC 4JBMA 3I8ZA 2A5HA 2PE6B 1CKMA 4M00A 3NE5B 2KOXA 3OOCA 4WJNA 1HEZE 1LM8B 1PYSB 1QUQA 2HD5B 2KJHB 3PS6A 2A6HD 1STEA 4TQUS 1PZJD 2K9XA 4LW1A 3NZUA 4A3KB 1FPYA 2JJQA 1IBKQ 2OXPA 3KWLA 5C5MA 3NHEB 2L55A 1AW7A 1RIPA 2ZXPA 4E71A 1Y1VG 2K8HA 3S1RH 3IT6B 1VZ8A 3G71A 2NTTA 2R7ZH 1XNQQ 4AH6A 2BYEA 1TS4A 1JWAD 2IHEA 3DDCB 4B3ML 3T16A 4DHZE 2BTEA 1SBBB 1ONLA 2QEJC 2C9WB 2DZIA 4Z9CB 3PLVA 4A3CG 1WTWA 4DU9A 3I4MB 1HR0W 3AECB 3HHMA 3H0GH 4RHRA 1I4RA 3CF6E 2FFKB 3CC4A 4MJSB 3CD6A 3ICEA 1EM7A 2F0KA 1XQQA 5IGGA 2ATWA 3M63B 2UUBL 1TWGB 1HZ9A 2KCCA 3Q8DA 1CA6A 1EF5A 1I94L 1FJGQ 4O0AA 1XT9B 4F8CB 1T0RC 4NQLB 4MIUA 2WXFA 3CW2C 5E6JA 4FHKA 3PQIA 1OXUA 4FXCA 4JI7Q 2W54A 3V2TA 3EIVA 3ERQA 4HN7A 2DWQA 2QHOA 3PUVA 2ALYB 4HCEA 1EUVB 4X66L 2MHJA 3ZVVA 1JWUD 3TP8A 4OHJA 1PYWD 4XE0A 1JJGA 1IYJB 3QR8A 1CKOA 1XTCD 2K6DB 2C5CA 3DEPA 2HCCA 2C9OA 3S9WA 4DR1Q 2LGDA 4KV2A 1SMXA 4ID6A 3PRZA 1FYCA 4IPHA 4LNNA 3U4VA 3AN1A 4FBJB 1X32A 2LXKA 4EQOA 4ANWA 4POFA 4ABNA 5IGEA 2N7JA 1PDQA 2WKCA 2YTYA 1BBUA 4DHZB 4KSLC 4KZCA 3RZDH 3UDFA 2K1FA 1MI2A 2Q2TA 2DAJA 4FHJA 4XXEA 3DQVA 3I90A 5G3LF 2CH4A 2QKIC 2SNMA 3MWYW 3G4SA 5EBCA 2F1MA 4RA8A 4UDUC 4FJVB 4C7YA 5IYDH 1XLPA 4UHVA 2HJ8A 2HDMA 2AKWB 1GXDC 3UDGA 1EQTA 4PNYA 2HHHL 3MXNB 1YI2A 3J7AF 1FD7D 1K53A 3P4QB 4J6HA 5DEHA 3SHQA 3TUOA 1IP9A 4JW0A 1CM9A 1JR0D 3DM1A 3EQLC 4JK1C 5KYIA 3V6CB 4DR3L 4KSKC 4QQBX 3L3OC 4IUUA 4JOIA 4LWCA 2D0PA 4LF6L 3WOFA 2DENB 3KH0A 3GTKH 4IC7B 1Q1EA 4JI8L 1SROA 3NUCA 3HOXG 2JA6B 1S3SG 3KF6A 5JJLA 2Z8LA 1SJHD 1K3RA 3K0YA 1D6EC 1FVIA 3U9OA 5I2XA 3F2BA 5CC4A 1QVFA 4HK2A 2DZKA 2WYQA 1TWFH 1V8QA 2KUMA 1S5FD 1QOBA 2E2DC 3TJPA 5IT9E 3A9JB 1JRUA 1UBQA 2CHWA 3EHVA 2BYTA 4IQZA 2K33A 1I3QB 1R4QB 4TRDA 2IX3A 2WU2B 2EY5A 2F0GA 1PH9A 1N32L 4QAYA 1DZ1A 1E7PB 3UQAA 4XX5A 4HEA1 2EDGA 1C4PA 1VZ7A 1KD1C 1SSNA 1ZP0B 2NBVB 3DBLB 3S16B 2J0MA 3SFDB 3H6NA 1A6XA 1KABA 5C44B 4WWOA 1TXYA 1Q3LA 4DAYB 2E5LQ 1RRBA 3OLMD 1YJWA 1QQRA 3IAM1 2PPBC 2L0FA 3SR1A 2R6GA 4WJWA 1SFOH 1L0XB 4A3DH 3ZUNA 1PRTC 3CSTA 2L00B 3AE7B 3U7ZA 3TEWA 2ES2A 1GHKA 4KDLB 4WIPA 3CMAA 4DV1L 2O5JC 5IT9L 2KZRA 2B2VA 1I50B 1KM7A 4BY1B 2JA8G 1E6EB 4TQ1A 3BY4B 4JPBW 1O7YA 4MJSA 3JSVA 1BBXC 1I7HA 2ZJDA 4F1SA 4GDLB 5IAAC 5DPWA 1N62A 3LB8C 1OO9B 3DXJC 1B53A 1Z9FA 2KTRB 1Q86C 3W3AA 3SK6A 1IYFA 4K2LA 3S1NH 1QLBB 2J0JA 3AXCA 1VDVA 5E6NA 3GZNI 1R9TB 3F2DA 1G6PA 3BZDB 1TZ1A 5HGTA 1L1OA 1V86A 5HKHA 3PGEA 3ZRFA 3Q3NC 1UE5A 4ULLA 4BWGB 2JYEA 4WJ3M 4L8JA 5C0XH 3BYTB 1IBML 3B2FA 2W55A 1NJIC 3GE3C 1FGBD 5CV8A 1OEYJ 4YL8A 2QDLA 1XLOA 1TWHH 4II3B 4GB9A 2WX0A 4NAMA 2G4DB 4FA6A 1OQQA 3PO2B 4FLHA 1VQ9A 2NVQB 3N9YC 5CBEE 4EQ5A 2JX5A 2NBFA 1S40A 3HOYG 3DHIC 3Q8CA 2LS01 1YIJA 2OJRA 3WOEA 5I6YA 2Y3AA 2V1CC 4NPSA 4GOPC 5L37A 1F52A 3RN2A 2WDVB 1F2LA 2JN4A 1KLGD 4PS7A 1HJPA 2RPVA 4URKA 3IBEA 3AYHB 2KLCA 2K5WA 2PTLA 2SNSA 4A4IA 2EY6A 4AQYL 4ZYSA 5F2DA 1CSPA 1R7SA 1YNND 2INDC 4B9KA 5GAEC 1UUPA 2ZVNA 3W2DA 5HGQA 3MXNA 3K0XA 2X6GA 4AP4C 1VCBA 2KQ7A 4GN3B 1AE3A 2PQAB 2RF4A 2B2TA 3N20C 4M8AA 1QJOA 2UXCL 2MO0A 4IWQA 3APFA 4KY6A 4RMFA 4C3HB 4IM0A 1CZPA 4E74A 2WKDA 2KQ3A 5EKKA 3J80c 5ELDA 3M9BA 1XLNA 3AH7A 3DWMA 3K5MA 3ZXVA 3SGIA 1MIUA 1K73C 4XWWA 4NZLB 3A9JA 2QJLA 1E8YA 1MVKA 3E0EA 3M3YH 2WXOA 1DXMA 1WCMB 1NYRA 2A74C 1FO4A 2CWPA 2L15A 3TEXA 3CIRB 3GTGH 2M1MA 1S72A 3FILB 1VQOA 3CC2A 2JA6G 2KC2A 4ZRIA 3P4RB 1CZWA 4G4KA 4BBSH 2AL3A 5M3FH 2X38A 4B3MQ 2KQSA 4X57B 1SE2A 2CVRA 3HGBA 3QIAA 3DOWA 2BS2B 3MXGA 4DAYA 4ZKCB 4CJ0B 4FDBA 4MZ9A 1YN4A 4USAA 3E9HA 1JB3A 2D10A 4ZYNA 2AMCB 1P9DU 1SN8A 2AWNA 1ET6A 1S1QB 4A3FB 1EY7A 4II2B 2NN6G 2Q8TA 5MPOA 1XMQQ 4BBNF 4LF4L 1D1IA 1HR0L 3SE0A 2UUAL 1EZ6A 2H4OA 1I94Q 5T1IA 1Y1VH 2R92H 5GXGB 1I35A 1KOTA 5C44G 3CMEA 3UQBA 2JYOA 1SYGA 1VJKA 5JH5C 2BCOA 3H3VC 4CJ2C 2Z0EB 5C3JB 1A2TA 1LT6D 1NR4A 2B8GA 2EYMA 3TRZA 2KTRA 4X65L 4ARCA 1TQOA 4GS3A 3STBC 2A8VA 1B9MA 5JVH3 4OVVA 5AJ3L 4X66Q 1OTRB 2OQ0A 1E1TA 5E7NA 3TQYA 3UF8A 4FULA 3S2DH 4BY1G 5IP9H 5JEAG 1G6JA 3OTOL 4A3GH 1Q90A 3D4RA 3VFKA 2WDTB 2BH8A 2ZCCA 3I56A 2FHTA 2KVZA 1LT5D 2UWQA 1F9RA 3V60A 1YITA 4DV4L 1X3QA 2FCSA 4HIDA 4MNOA 5D2MB 3A8IE 2QC8A 1VRAB 2MJEA 3NUHB 3E5SA 2N9EB 2L76A 2A4ZA 2NTSA 1HTPA 5KEEA 2K8CA 2N1WA 3BDCA 3H7SA 3TREA 2IO1B 2ZEQA 1HH2P 4CJ1B 1PTOC 1HFNA 3N1XC 1ML0D 2BE5C 1SYFA 4X64L 1QF6A 4N9F4 2XBBC 2KACA 2F3WA 2JA5G 1YOVB 1WXQA 1VS0A 2C7MB 2GA4B 4Q2JA 3MVVA 1KH0A 4XQJA 2K5HA 3PO2G 1J8IA 3DWAA 4R4CA 4J1MA 4DAMA 4C2MB 4R3DA 1C1YB 3VR9B 3VH3B 1EYGA 4L63B 1IYVA 2BS4B 1PHJA 4DR3Q 3CC7A 2K03A 3SHLA 4LF6Q 3QQ8B 1FCCC 2LWPA 1BQQT 2PQAA 4Y7NB 4IOIE 2RBMA 4OZBA 4YCWA 1P98A 4JI8Q 3LJ3A 1IYUA 2KVMA 3A8KE 1P16A 3HZXA 3PGZA 2K7VA 1J7CA 4H2AA 3UI2A 5IP7H 2K5DA 3CCMA 4RGTA 4OWTB 2GLSA 3BINA 4JBWA 5AZFA 4WJQA 1PQSA 4DR6L 2NR2A 2ZT9C 5JEAJ 2J0TD 3G6JB 2KD0A 3VRAB 5EPLA 3T3NA 1F2MA 3GTLH 4XWTA 1SAPA 1WFQA 1STBA 4ZRZA 4IUNA 4C56C 4C3HG 1R4MI 4W9GA 4LF9L 4ZRPA 1YD8U 4B6WA 1HZBA 3NTIA 1STYA 3MZ5A 4M0WA 3HOXH 1C4QA 1PTOD 3H3VI 1DD2A 1NR2A 2BE5D 4H44C 4DV1Q 2VL6A 4KIKA 4O42A 3TCAA 2XWBB 4K6LA 2JWZA 3HOVH 4K5WA 1Q1OA 1J5EL 3HOWB 1XLQA 4L5RC 3PIOA 3KYDD 1HTOA 4HCNB 1WCMG 4P1CC 3ABVB 2B63G 2IY1B 4NJ6A 2AUKA 5C5LA 3V96A 2N7EA 3VR2A 2IZVB 1IBLL 1M94A 3RZFA 2JA9A 1XNRQ 2EVBA 3L17A 1G6ZA 2WINB 4JWUC 1XXGA 3K7AB 3RNUA 1S3OA 3APDA 4PZ6A 3ZNID 1TT5B 2R3ZA 5K5PA 1YHAA 2L0CA 1B8AA 4A3FG 4A3KH 2F0FA 5AFWA 1XCTL 1IBMQ 2ONQA 5M3MB 1TR5A 2KANA 2R2QA 2WX1A 4CDFC 1FM0D 1R4PB 4C3IB 2ZVOA 2F0NA 4BKSA 2NBWB 1XMOL 4HMIA 1D2BA 3NZ3A 3ONSA 4MELA 5T1GA 3BZCA 4F88A 3G7LA 3CCRA 2OHFA 4GLSC 5C3EB 2C7HA 2IBIB 3ZRCA 1KC8C 1VQJA 4A3EG 4P73A 1BDOA 2PLPA 3B6YA 4AYBG 4J6IA 3CCUA 4IWOA 2MP1A 2KHSA 2B3AA 3RLFA 2XK5B 1H9MA 2RCFA 4R8NA 2K3UA 1JWMD 4ZHPA 2CKZB 2VRRB 1MJCA 2MBQA 2D2QA 1V43A 4X3TA 1ZYRD 3CQZB 3I4MH 2JVCA 5G2NA 1A3VA 2K39A 1BKBA 1VQEA 4AQYQ 4IZ8A 5EE9A 1EL0A 1WX9A 1N5WA 4KI0A 3KOJA 3TZDA 1TWGH 1D1KA 1I4PA 1VZ6A 3UE1A 4WURA 2K32A 1HNZL 1V9PA 4OZCA 3A55A 2E2IB 3PSIA 3E56A 2BYFA 2UXCQ 4W9IA 2YEPF 1SLJA 2LGIA 1BCPD 4KN4C 2LSSA 1WYGA 3MP9A 4DDID 1EY9A 3JAME 1LXDA 1KJTA 1QVCA 4W9CA 4OX9L 2A68C 3U58A 1KXLA 4BAXA 3NPPA 1KRTA 1NI2A 1T5EA 4E3CA 3NQTA 5CORA 2D3GA 3X0WA 4FO2A 2K01A 1C9FA 3DUZA 5KNDA 4JGHB 2KX3A 3AEDB 4MM3B 3OIQA 2K50A 3C19A 2F0SA 4BOZB 3UINB 1VQ6A 1WGRA 2KX0A 1DOKA 5M5WH 4G50A 3PO3B 5FLXL 2KDIA 1CTMA 4PZ8A 3NP8A 3BWUD 2IX0A 1N33L 1VQFA 1SE3A 1UGMA 2DGYA 3KJOA 2A6EC 5KNBA 2V1YA 5J22A 1UWVA 1UWMA 4YTNB 4A6QA 1YBYA 3H9DA 2SEBD 2W9NA 1O7LA 4IW0A 1CHPD 4NMZA 4DV0L 1ZEQX 4LDTB 3HOUB 2HDEA 1SEBD 3F1ZA 3GP7A 2ZJQA 1Y56A 4WH4A 1HR0Q 1B7YB 2R61A 2DAFA 3NVVA 2ZXOA 2I0QA 2KQ4X 2KXJA 1HNXL 2V4DA 1F9JA 2I38A 2Z6BA 4HJAA 2IT1A 3H7PB 2B2YA 4IURA 2NWGA 4X65Q 2A68D 4BFRA 3U52E 3I4NH 4BBRB 5C4ZA 1ZE3D 4RGOS 4LFCL 5AJ3Q 4E6IA 1YN5A 3P42A 4NDXA 4AOFA 3GTJB 2Y5PA 3Q2AC 3IXSA 3HOWG 1OXXK 4DN4M 3Q8BA 4OIJA 1V5OA 2BWFA 3PUZA 2HT1A 3RNEC 3KJPA 4PG3A 4LF5L 1GJZA 2EJFC 3BDOA 3TBIB 4BY7G 2KWCA 1L4ZB 2DNFA 5IGDA 3AI5A 3QK0A 1JW9D 1BOSA 4QUFA 1EY8A 5IWAL 2OOBB 5FO7B 2A6ED 1SYCA 3KF8B 1Z5SB 2YYZA 4JYAQ 1SMYC 1PV4A 4CO7A 2YEPB 2FIDA 1H8CA 1SNCA 2LXJA 5M3MG 1AN8A 2PQEA 3AV8A 4C3IG 2PIAA 2MJ3A 1SRUA 3A1QB 4NQKE 4JPSA 4IUQA 4KKSA 3KBXA 3HKZE 2N49A 5GROA 5C3EG 2KWDA 1BVSA 5KRUA 4ZOHC 2I1KA 3W9CB 1PLFA 3W5VB 1VQ5A 1WR1A 4WJ4A 1TKGA 1OFFA 2UU9L 4ASWC 1R9TH 2J7QB 3MHZA 2WP9B 2B76B 2NS5A 3U8ZA 4ZAIA 2Z4IA 2BDOA 1L6VA 3ZNZB 3ZTDA 5JVG3 2D07B 4AJYB 1V5TA 2SDFA 3K9PB 4KVGB 3DVNU 5HHDG 1WTOA 2IY0B 1D7QA 4K6DA 4YHHL 3X3NA 3J81i 3NS8A 3CAMA 4DR6Q 3DWGC 2IO0B 1U4MA 2N88A 3PO2H 2JU6X 2VZKB 4MM3A 3NRZA 4B0EA 1LTID 4RH6A 1ICWA 2MNAA 5DPRA 4CKCA 5IODA 3M7GA 2BA0A 2K5VA 4KY7A 4DA2A 2WXGA 2AEHA 1P0RA 3WAOA 4K5VA 3NJTA 1SMYD 4MTNA 3NTHA 1UELA 2J42A 3Q3OC 1SNQA 1W2BA 3GTPB 4OGQC 1JORA 2WXKA 3M95A 2CWAA 2MW5A 4XTCS 4ZLTF 3GQBA 3S15B 3TSSA 2M56B 1YJJA 4IFDH 2UXDL 1J5EQ 2KJ6A 2Z6KC 5K36G 1LGRA 2IDYA 2JF5A 3PO3G 3AU5A 1SJED 1HNWL 4O2DA 4C4VA 1BR9A 2KFKA 3EGRA 1DOMA 1IBLQ 2MBBB 3QWNA 3QARA 2YLMA 1L0YB 4DV2Q 4QUCA 4XDCA 1CT1D 3S1MB 2FUG1 3DCGA 1YZ6A 2KFJA 1RTNA 3VYRA 4DV3L 3RPFC 3P4SB 4AWJA 5J39A 1Q5WB 5CV5A 1CK1A 3L9AX 2M8SA 4L6TB 2O6VB 2K75A 3HOUG 3GZNB 5T8IA 3NZSA 2N9PC 4HROA 2AHOB 3U4ZA 2RDFA 4HJ7A 3HIZA 4LNIA 1GUAB 4P72A 4IWPA 1R4NI 1XMOQ 1YQ3B 1IBXA 1C78A 5JOBA 1YHQA 2PMZE 4R4IA 1WGDA 1PGAA 3R7RA 4ACFA 4OWXB 3MJ5A 1B70B 1HTLD 4P1BC 3RFZB 4KD3A 4H7BA 3ULLA 1SIFA 1L5PA 1EZ8A 1Q46A 2MFIA 3A5ZB 4LDTD 1ISNA 4BBRG 5DPTA 4S0RA 2MLBA 1WGYA 2QILA 5JXVA 3ZJUA 4HJ9A 2O5IC 5EAYA 2BKFA 1B44D 3RD4A 4A3FH 4RM9A 5C0XI 1TKWB 4C80A 3IFTA 4W9KA 4YXDB 4GKJQ 2K6AA 2IJ0A 3QHTA 1F2RC 4Q5VA 2VQEL 1NE3A 1J8CA 3F2UA 1VQDA 1VQBA 4LF8L 1Q1BA 2KO3A 2I07B 3S2HB 3Q14C 3FMCA 2JA8B 2GI9A 2Z0SA 5BR8L 4ICVA 4QGUA 1AFPA 1RYJA 4IJHA 1AWDA 3ULPA 5C4JH 2WHIA 1WE6A 4HRSA 3BVMA 5EE0A 4OX9Q 1TS2A 4KKTA 4C00A 4G57A 3AEVA 3H1UA 1SIJA 1V81A 3IRBA 2LUMA 5ELBA 3J80E 1K52A 2CS4A 1O7IA 4JG2A 3AEBB 1Z47A 3Q3JA 2AWOA 2YVCA 4YY3Q 1U0LA 1VQIA 4DNIA 1FXAA 1VQHA 3AEEB 5C6AA 4ITKA 3KLSX 3V05A 3C8YA 1D4BA 4N9PA 2K14A 1L6UA 4EFOA 1WD1A 5FOBB 3HOYB 4HPLB 5IA7A 4DR7L 1HQMC 1E7VA 3RZOH 2PE9A 3I5JC 4FN2A 1M1KC 1NBFC 1X3PA 4X62L 5ELCA 3GOEA 4DV0Q 2ICIA 2R7DA 5BYRA 1JCKB 3DWPA 1WXSA 4C2MH 3J80L 1GUNA 3X23A 1TIFA 2G9HD 4QL5A 5LL6X 1E5WA 2KEEA 3Q24A 2ZM6L 3I70A 2V3NA 2NVYH 4RF1A 3NWTA 2VUMH 1UEBA 2EYFA 4BA1I 4Y7NH 2RHSB 1TZOA 3GB1A 2H1EA 3ZDTA 5IKCM 3DHQA 1BXTA 3W1SA 2LHDA 2MO1A 3S1QH 3W1BA 5EE3A 2MGSA 2OCEA 1LTAD 2HIVA 3ZW3A 3L2PA 4LJZC 1V1PB 1FR3A 3HKZG 2VZKD 2OEOA 4LFCQ 1XJVA 4JI5L 3D31A 1HZ6A 2A69C 3RUZA 1FMAD 3ZJVA 4X3SA 4ZRJA 2E6XA 2PCFB 2X8XX 4U68A 3Q6BA 3RUIB 1EQRA 4HCSA 1P7FA 1RKNA 2JEAI 5BYQA 3DWQA 1WTQA 4GOPB 2N0SB 1SSOA 1YNJC 1YJ1A 3QA8A 3S17B 1VMCA 3T1HL 4LF5Q 4ANVA 1F2RI 1OEYA 1X65A 4RNAA 2K0PA 5IWAQ 1NEKB 2PW9A 1LABA 2JA7G 4DXGA 1PZKD 2NVUI 1UEAB 2UXBL 3BDLA 1K83H 4KK7A 2MJDA 2R93H 3CU7A 4JE3B 5C4XG 4A3IB 2UYZB 4JOIC
chains in the Genus database with same CATH topology
2B8FA 1PTOF 3C1EA 4U673 3R2TA 3B9JA 2Z1CA 3D3RA 1EY4A 2EKIA 3GTMB 1FFUA 3QOLA 1FFVA 3PUWA 1PFDA 4YSXB 3GTQB 3ONAB 1TJEA 2A69D 3NHHA 3FPPA 4WRDA 3HOZB 1HA6A 1QT9A 1I6HB 3HRZC 3Q8FA 1NAPA 5AUKA 2WXMA 3NVZA 4OO1H 1VR9A 3HVZA 3AEGB 1G2SA 2B2VC 3CKIB 4CQNA 2WV6D 2KJXA 1W6JA 4C7ZA 1TIID 2F4IA 2CU3A 3AEFB 2L52A 2HDLA 1S5BD 2VB2X 1TKEA 3AE9B 1H9KA 3EROA 2KAJA 2JA5B 2V4IB 3AE1B 4AS1A 5CBAE 1G91A 2XNAC 3QOJA 1B1ZA 3AE4B 3GTOB 1PRTD 1BCPF 5JPMC 2KN4A 2L9HA 2X6LA 2CHBD 3U4EG 3K58A 3GV6A 1ZXTA 1PTOB 2HQEA 3LWEA 3Q69A 2K04A 3ZYYX 5D3DA 4DFAA 4RCNA 1E9MA 3Q0AA 4PMBA 1ACCA 2B2TC 2B39A 1ESFA 1SXTA 1U4RA 2NB0A 3A54A 2I46A 1DM0B 3DEOA 5FO8B 3PIO3 2W3RA 4IDIA 2NUCA 4MT5A 2E3TA 1U9RA 1RHPA 1EIHA 3VR5A 3Q8AA 4ILWA 2RA4A 3I91A 1LV9A 2B63B 1GUWA 3U2SC 1KLUD 2BB5A 3J81L 4EVOA 3V3XA 4FYDA 1GAQB 1B50A 5BYSA 1PFMA 1JALA 1F77A 4RGNA 2B2UA 4K8JA 1LLRD 1TKYA 1VLBA 5EQ0A 4XQNA 3TP6A 1GHJA 1A70A 5EGTA 4RGMA 2LKVA 2RKSA 2Y0SB 3VR8B 1DOYA 4A3EB 2KCNA 2L1BA 1MPEA 4AYBB 3K57A 1D5ZC 4RWSC 3MTSA 4K8IA 2F0LA 4KKUA 5BN4A 5C2TB 4ZQ3A 4OZAA 4XQQA 1BCPB 2DY8A 1EU4A 2PZWA 1XF5L 5ELEA 3T3OA 1TS3A 4EQNA 1BO0A 1O7ZA 3TN2A 1BUVT 1IKLA 3W5UB 4TMAB 3S1RB 2JYTA 1F0ZA 2NVXB 1I4HA 2F0TA 2GB1A 3J7YW 4YSZB 1C4CA 2B2WA 2F03A 3HG9A 3M4OB 4HMJA 4XT3B 2ZXRA 3VQIA 2LJIA 3H0GB 4ZKBB 3I72A 3P63A 4V0BA 3PUYA 1G8ZD 1SB3C 4KD4A 3KK7A 2SOBA 1STNA 3M85A 1E10A 3K5OA 3MHBA 3HRDD 4J3OD 3ZQ4A 1KRHA 3KUPA 1LO5D 4FXGC 4NP5A 4N6EB 2EXZA 1VF5C 2J7ZA 5HFYA 5CGKA 3AMZA 1J9OA 1MBYA 3NSWA 4HJGE 4GZYC 2VXWA 2VNUD 1EWYC 3S14B 5D65A 1RODA 1AP0A 5C3WA 1STGA 1CJEA 4YT0B 3FILA 5FKAC 4KGRA 2NYZD 2DLBA 3CRKC 1VCIA 1I4GA 4US9A 3E6ZX 4L2YA 4CGYB 3CWIA 1IUEA 2QMTA 1GUSA 3P1HA 5HI1A 3M7NA 1Y8OB 4OL7A 2HTME 1UWXA 2M00A 1GUOA 2FINB 1Y69U 4BY7B 3KQ4A 5NUCA 2WXNA 3GTKB 2D62A 1DOLA 2I2YA 4QF4A 5M5XB 4WQMA 2L4NA 3R8BA 3PZ8A 5CYUA 1TWFB 2WLBA 3SEBA 4RKBA 1EEFD 2E2JB 2J53A 4ME5A 5DAUA 4PMCA 3H09A 4FF2A 3SFEB 1CA5A 5EKLA 2RDHA 1E2ZA 4LK1C 1HXYD 2JZPA 3VR6A 4IFDI 4A3DB 1YQ4B 3PV0A 3PZ7A 2F0IA 4N58A 4FVMA 3MXUA 1LTRD 2EJMA 4D2KA 1JICA 3VYUA 2DNCA 4UAIA 5EE1A 5FLXE 1F2ZA 3P4PB 3C1FA 4KHZA 4R8IA 1IL8A 5EJWA 3S1NB 1RJTA 3RMHA 1KDBA 3SK5A 4F7XA 1WWTA 1GOZA 3P20A 4CHTB 4C1NI 1KAAA 1S4ZA 1L0VB 1WTXA 2EOTA 3D6CA 1WTVA 1UNSA 3TEZA 3HVDA 5EBDA 2RVLA 1WVLA 3R93A 1Z6HA 1KDAA 1T5XD 1SDFA 2WXJA 4L1BA 2IGHA 2WACA 1YNTE 1EIGA 2XVSA 1LTSD 1QNKA 2DNEA 3BYYB 2WIIB 5EPJA 1BNZA 3AECB 1ZDVA 5C3XA 1GB4A 1XO3A 2FE8A 5LL6S 2MHVA 1O80A 3Q22A 2F0EA 1RWSA 3CRLC 2XSCA 2AQ3B 2M0AA 4YTMB 3FAHA 1GB1A 1JQYD 1SYBA 1VF7A 4BS9A 1M4VA 3GD7A 1DOXA 3OPOA 1LACA 3IKJA 2LY7A 2B2YC 4HKQA 1C4AA 5BN3A 2NN6H 3KBGA 1GJXA 1KFYB 2FJ2A 3E9SA 5I9PA 4FP5D 3FDTA 1I4QA 2JXTA 2QDBA 3MEHA 1FRRA 5G5GA 4AQ7A 3MFGA 2KMMA 4DK0A 3GTGB 1IW7C 2PZTA 1YMHE 3SXHA 5JJZA 1QE6A 1NCVA 5D7GA 2JWUA 5JEAH 3I73A 2DYMA 3AM9A 5A35A 2D2CC 3ETRA 4DGZA 5C4HA 1BUIC 1D5MC 2XRQD 1EWCA 1YN3A 2R92B 2G9DA 4QCLA 1JE4A 1KNAA 2VB3X 5E1FA 1PMRA 4K14A 2LMCB 1LTTD 5CMDA 4OVZA 1G291 1K8MA 4CBVA 3S2DB 5I6WA 4XYQA 4QIWB 2F0DA 1MI0A 2QSDA 3P1MA 1ROEA 1HRJA 2EY2A 4MH8A 4KTAA 3BK1A 4H13C 3IT4B 2XIWA 4IUTA 1K51A 4RAUC 1CFMA 1LTGD 1U4PA 4I65A 2J4XA 3N52A 4IN3A 3HKZB 1W6KA 2N9KA 2K1BA 5C0XG 3K5LA 4PV1C 1PRTF 1PTOH 2YU9B 4REZA 5DM73 2NMQA 1OXSC 4ZRQA 3U9SA 2M19A 3KWVA 4YTPB 1QOGA 4DXFA 4MHEA 2OT2A 1TWCB 1RD9D 2JA7B 3SDZA 2EE1A 2OF1A 2E76C 1STAA 2WP8J 1N60A 5JPNC 2L5TA 1S5ED 3ITPA 2A6HC 5C4XB 1L4DB 1TVXA 2KOLA 4FNFA 2FBWB 1HPCA 5KYLA 3I3CA 1WD0A 4OO1I 4FF3A 4K5XA 2WXLA 4PMWA 4HSPA 3A7AB 4DF7A 3D4WA 2ZW1A 5KIXA 2WU5B 1K8OA 3KF8A 1F9QA 1OXVA 2BOSA 1CQFA 3AB5A 2LHEA 1XYIA 3VYTA 3PUXA 5C0XJ 3MA2B 4ZK9B 1GUTA 3ZJTA 3LX0A 3HOVB 1NVID 2V0GA 1IHZA 2IW3A 1F9PA 1CQVA 2HUGA 1EY5A 2ID0A 3BG3A 3VYSA 1HZ5A 2XRSD 3IAS1 4ZUJA 3HEJA 2F0WA 4A3JB 1EYDA 2RSNA 3H94A 2QIEB 1PFBA 5CV7A 1Y8NB 1FD6A 1NYQA 1ZOYB 2L1AA 2CW0C 4NW2A 2J52A 2LMCA 2PMZB 2A73B 1TWAB 1QNUA 2FMCA 1K50A 4A90A 1MD2D 4HAEA 1PRTB 2CQAA 4K2KA 3LWUA 1PDXA 4X3UA 2INPE 2WNMA 3QB3A 4RHSA 3J9CA 4R9WA 3B2GA 2H88B 2WXPA 4YIJA 1QB5D 5IOCA 3LYYA 5BMHA 3D6WA 5DM63 2ACZB 5IGFA 2F0VA 5E3FA 1F2YA 4G7OC 5CV6A 2Q8IB 3EUB2 3NWSA 1ZXHA 1B4OA 4NJCA 2IGDA 1EY6A 4ZUIA 2OEDA 2K05A 2Y5CA 3PO0A 4V190 4G7HC 3EVQA 1TY0A 2IX1A 3WCQA 1Y1WB 1SF0A 3KLSA 2GRIA 4I7ZC 1XX8A 2CW0D 2E2HB 2DBYA 4LTUA 1ENCA 1RFKA 1UAPA 1EEID 1E2VA 3NXWA 1MSGA 4KHVA 2PNRC 1JOQA 3SK4A 3PIP3 5HG2A 4WAFA 1NSNS 5CV4A 2WXIA 1A15A 2F0HA 5E4XA 2V3PA 5M5WB 3BVGA 3H6MA 3NVWA 1VDZA 5FR3A 2PW7A 1S5DD 1J7AA 1N63A 2MUYA 1HUNA 2D9UA 3AE2B 5AUIA 2K5PA 4KJOA 2CJOA 2N9LA 3O13A 3T56B 4DQOC 2PMVA 5ELFA 2WAQB 1Y8PB 1DONA 1Q12A 2MH7A 1AZQA 1AYFA 5CR3A 4TQ0A 2PKOA 4KKIA 1CI3M 2Z4HA 3I4NB 4HTHA 4RCOA 1YNJD 3AE3B 4MACA 4A3MB 3DMUA 4FF4A 2RMMA 3P7JA 4J8QA 3C46A 4MN3A 4P6VF 2BB6A 3Q23A 3LNNA 3A7LA 5IGCA 4XYOA 1QG7A 3GV3A 2IWHA 1VMPA 4B0MA 5COYA 2D5DA 1V8CA 2PYKA 5D14A 4HSVA 3L4PA 4B9WA 3IFDA 1NUCA 2LFNA 4FXKC 1YNNC 1MHXA 4XDXA 1QKZA 1XEEA 2SAKA 5KNCA 2WXHA 4WWMA 5DNFA 1II3A 4YSYB 1KTKA 2F3VA 2WS3B 5BMIA 1V1PA 4HEDA 4WORA 1H9RA 1TS5A 3T4AC 1RF2D 3AE5B 5K36H 3K5NA 5M9OA 1HQRD 1C8CA 4IUPA 3T13A 1HCZA 1NI3A 3T53B 4XIGS 3QO2A 1CZGA 1RM6C 2WQYB 3J81E 2AQ1B 2K5QA 3NBIA 4GDKB 3C2PA 3VA5A 3J7AV 1MGSA 4KGSA 2XN9C 1QWYA 1TT2A 5TSSA 1DJRD 1KDCA 1ET9A 1FRDA 5H92C 4TSSA 3EA6A 4ARIA 2W3SA 3MAQA 1FNVA 1WGKA 2ENBA 2PZUA 3FPUB 4IUVA 4N9TA 1IKMA 1OQRA 2KECA 5HURA 1ZPSA 3FKIB 2BT6A 4O1NA 2F0JA 3TZUA 3CHBD 3OWEB 2H89B 1EYAA 1Q10A 1EQVA 3QG1A 2IPKD 1PGXA 3I4LA 3ND8A 5LNK1 2B2UC 3UI3A 4KGTA 1B2TA 3GS2A 2KA7A 4RFBA 4PT5A 1N5XA 2JE6I 2Q5WD 1SE4A 2G1EA 1RCVD 3L7ZC 2M9VA 3AB9A 2RDGA 2F0OA 1LTBD 5I9OA 1I6VC 4F8MA 1LT4D 3D4DA 1C76A 1MSHA 1QOHA 3OWFA 1E0ZA 2EPBA 2JQRB 4LMQD 2WXQA 2R7ZB 5JAVA 2L83A 5C4JB 2DN8A 1RDPD 4DAVA 2EY1A 2BS3B 1G2TA 2Q8RE 2PO4A 1ILPA 5BMGA 2CJNA 3AU7A 2B2WC 1B9RA 1WTRA 2K22A 4XDDA 3NK9A 1YJIA 1QOAA 4KMUC 2F0UA 3EJIA 1A3UA 1Z7TA 2JSOA 4L23A 1ILQA 2BW2A 4HKZE 1MHHE 5IIFA 1HA5A 2NZ1D 1IGCA 2AQ2B 1I4XA 2WDQB 3OW7A 3RZOB 1STHA 2NN6I 1B3AA 4S3SA 2ON8A 1FXIA 5G5HA 1A3TA 2JP1A 4OW0A 3Q6SA 1JOKA 4C1NK 5E4WC 2L12A 3TMEA 2NVYB 3MXPA 1FIQA 2VUMB 5G3LD 2F0QA 3VR4A 3S1QB 1CHQD 4US8A 2EYHA 1IGDA 3RZDB 4CKBA 3AE8B 4KN7C 2KEDA 4B9XA 2E74C 5J1ZA 2WDRB 5FK9C 4IFDG 3WDNA 1JC7A 3BIID 4WFN3 3TEYA 5ISRA 3M4YA 3H91A 1C79A 4B08A 3R2IA 2EJGC 2XWJB 1E2WA 4KKJA 1LT3D 4X3KA 4P2CB 1AEXA 1ENFA 3QJYA 1ZYRC 1K83B 2R93B 5CV9A 3HUIA 1ZUD2 4A8XC 1UGJA 3P75A 1PUTA 2KDMA 2INNE 1PFNA 2M2LA 3NVYA 4P16A 3ZGZA 4DNRB 1F9SA 1E0BA 4RKLA 1BCPC 3H8HA 5I2YA 2AX5A 2WB1B 3NS1A 2BDNA 1M8AA 2AUJD 1ENAA 4JX1C 2EYJA 1SFOB 4IFDJ 4KJNA 2TSSA 1KF6B 2EYLA 1H9SB 3VR3A 2BBCA 5D3IB 3R3OA 1H9JA 1JQ4A 2E75C 3AEAB 3LXFA 3X3MA 5LHY1 2IGGA 3IL8A 3A56A 1BMLC 2MEKA 2LEKA 3FC4A 1V97A 4FF1A 2L32A 1ESRA 2D5GA 3E0JA 4EGVA 1GUGA 4NKLA 4QMGA 1TWHB 2O4XA 2L11A 1SNDA 2RSOA 3IAYA 1EOTA 3SK8A 2PVGC 4PQXA 4G7ZC 4EE2A 4C3JB 1ZKOA 3TP5A 2ICEC 1NENB 1GPXA 2MJ8A 4F87A 3AMUA 3BVZA 1TU2B 3MC0B 3TP7A 2TMPA 4A93B 1EWHA 3OSOA 4OIKA 3JAML 1XCQL 1KNEA 3T51B 3C3LA 4N59A 4IKGA 3OIPA 2FMMA 5IGBA 3GO5A 5EKIA 3VRBB 4A3BB 4XT1B 3OMGA 1ZDXA 3I57A 4HR7B 3M3YB 1SNPA 4Q0FA 1P7EA 1DOIA 2JEBI 1O78A 1BF4A 4BBSB 2NVTB 4NAWB 5M3FB 1WTPA 3BS1A 2IL8A 1IBXB 4M1UB 3SR6A 3FRPB 2K28A 3K59A 1QOFA 1FCLA 1T3QA 2HCIA 1DYQA 1H9SA 2W82A 5FO9B 1OXTA 1Y1VB 4QB4A 3EFXD 1C77A 1TYGB 1PGBA 1EFID 4TKOB 1B9NA 1SNMA 2WXRA 1C48A 2RQXA 3OMCA 4EQPA 1AZPA 4RF0A 2DYOA 3NBHA 4A3GB 2O2LD 4LK0M 1FNUA 2MPMA 4OO1G 3VA7A 2LFIA 4A9AA 5H8YE 2QCPX 2F0PA 3FVQA 1V1OA 2F0MA 1TY2A 1EU3A 1J7BA 1IW7D 1EY0A 1U4LA 3A8JE 1ZXIA 3D8GA 1HUMA 1EYCA 1PXUA 4BA2I 2QF7A 2PW5A 1JWBD 4DAPA 1WSPA 3NTKA 3OHXC 5I4DA 5A2QE 1JRPA 1SNOA 2N55A 4YWGG 1JROA 2JXMB 4KY5A 3HS0C 2EYPA 1A2UA 1PZID 3KLRA 5BN5A 1HFGA 1QCBD 4C3JG 5EPKA 4CKEA 4ZHOA 1DCZA 1FNWA 1DGJA 2EELA 2DY7A 5KGUA 4A55A 1XWEA 5A2QL 1QILA 4FXDA 3MFYA 1FEHA 1SYEA 2EZVA 2JSVX 3SVMA 4H0LC 4ODGA 1RTOA 3N6RA 1JMLA 4DNTB 3NQIA 4LAAA 3Q8EA 2ZW0A 3GTLB 2EYOA 3TDQA 5M5YB 4JWSC 2PVOD 2X69A 3HOXB 3FEWX 4DK1A 3K6OA 3PMFA 1WRIA 2BA1A 3URYA 1T6BX 3I9V1 1SYDA 3AE6B 1Q8IA 1HHVA 1S5CD 3ND9A 3HP3A 1JWSD 4KV6A 3BK2A 4KX6B 1JOOA 4IALA 4LLGM 1N61A 1D5XC 3I8ZA 2A5HA 3NE5B 3OOCA 1HEZE 2A6HD 1STEA 4TQUS 1PZJD 2K9XA 4A3KB 2OXPA 3KWLA 5C5MA 2L55A 1AW7A 2ZXPA 3IT6B 1VZ8A 2NTTA 1TS4A 1JWAD 3T16A 2BTEA 1SBBB 1ONLA 2QEJC 4Z9CB 1WTWA 4DU9A 3I4MB 4RHRA 1I4RA 2FFKB 1EM7A 2F0KA 5IGGA 1TWGB 1CA6A 2KCCA 4MIUA 2WXFA 5E6JA 1OXUA 4FXCA 2W54A 3V2TA 3ERQA 4HN7A 2DWQA 3PUVA 4HCEA 1JWUD 3TP8A 4OHJA 1PYWD 4XE0A 1XTCD 2C5CA 3DEPA 2HCCA 2C9OA 3S9WA 4ID6A 1FYCA 3AN1A 1X32A 4EQOA 4ABNA 5IGEA 2N7JA 1PDQA 2WKCA 1MI2A 4XXEA 3I90A 5G3LF 2QKIC 2SNMA 3MWYW 5EBCA 2F1MA 4RA8A 4UDUC 4C7YA 1XLPA 2HDMA 1GXDC 1EQTA 4PNYA 3P4QB 3J7AF 1FD7D 1K53A 4J6HA 5DEHA 3TUOA 1CM9A 1JR0D 3DM1A 3EQLC 4JK1C 5KYIA 3L3OC 4IUUA 3WOFA 1Q1EA 3NUCA 2JA6B 2Z8LA 1SJHD 3K0YA 1D6EC 3U9OA 5I2XA 5CC4A 2KUMA 1V8QA 1QOBA 1S5FD 2E2DC 5IT9E 2BYTA 4IQZA 2K33A 1I3QB 1R4QB 4TRDA 2IX3A 2WU2B 2EY5A 2F0GA 1DZ1A 1E7PB 4HEA1 2EDGA 1C4PA 1VZ7A 1ZP0B 1SSNA 3S16B 3SFDB 1A6XA 1KABA 5C44B 1Q3LA 1QQRA 3IAM1 2PPBC 3SR1A 2R6GA 4WJWA 1L0XB 1PRTC 3AE7B 3U7ZA 3TEWA 1GHKA 4WIPA 2O5JC 5IT9L 2B2VA 1I50B 4BY1B 4TQ1A 1E6EB 1O7YA 1BBXC 1I7HA 4GDLB 1N62A 3LB8C 1OO9B 3DXJC 1B53A 3W3AA 3SK6A 4K2LA 1QLBB 1VDVA 1R9TB 3BZDB 5HGTA 4ULLA 4BWGB 2JYEA 3B2FA 4L8JA 5C0XH 3BYTB 2W55A 1FGBD 5CV8A 1XLOA 4NAMA 1OQQA 3PO2B 2NVQB 3N9YC 5CBEE 2JX5A 2NBFA 3Q8CA 2LS01 3WOEA 5I6YA 2Y3AA 2WDVB 1F2LA 1KLGD 2RPVA 2K5WA 2PTLA 2SNSA 2EY6A 4ZYSA 5F2DA 1R7SA 1YNND 1UUPA 3W2DA 3MXNA 2X6GA 2B2TA 4M8AA 1QJOA 4KY6A 4C3HB 1CZPA 2WKDA 2KQ3A 5EKKA 5ELDA 1XLNA 3AH7A 3DWMA 3K5MA 4XWWA 4NZLB 2QJLA 1MVKA 2WXOA 1DXMA 1WCMB 1NYRA 2A74C 1FO4A 3TEXA 3CIRB 3FILB 3P4RB 1CZWA 4G4KA 2X38A 1SE2A 2CVRA 3HGBA 3QIAA 2BS2B 3MXGA 4DAYA 4CJ0B 4ZKCB 1YN4A 4USAA 1JB3A 2AWNA 1ET6A 4A3FB 1EY7A 2NN6G 2Q8TA 5MPOA 1D1IA 3SE0A 1EZ6A 2H4OA 5GXGB 5T1IA 2JYOA 1SYGA 1VJKA 2BCOA 3H3VC 4CJ2C 5C3JB 1A2TA 1LT6D 1NR4A 2B8GA 2EYMA 4ARCA 1TQOA 1B9MA 5JVH3 5JEAG 1Q90A 3D4RA 2FHTA 1LT5D 1F9RA 1X3QA 3A8IE 1VRAB 2MJEA 3NUHB 3E5SA 2NTSA 1HTPA 5KEEA 3BDCA 4CJ1B 1PTOC 1HFNA 1ML0D 2BE5C 1SYFA 1QF6A 2KACA 2F3WA 1WXQA 2GA4B 4Q2JA 3MVVA 1KH0A 4XQJA 1J8IA 3DWAA 4J1MA 4R3DA 4C2MB 3VR9B 4L63B 1IYVA 2BS4B 2K03A 3SHLA 1FCCC 1BQQT 4Y7NB 4IOIE 4OZBA 2RBMA 1IYUA 2KVMA 3A8KE 3HZXA 1J7CA 2K7VA 4H2AA 3UI2A 2K5DA 4RGTA 4JBWA 2ZT9C 5JEAJ 2J0TD 3G6JB 3VRAB 5EPLA 3T3NA 1F2MA 4XWTA 1SAPA 4ZRZA 1STBA 4IUNA 4C56C 4C3HG 4ZRPA 3NTIA 1STYA 3MZ5A 4M0WA 1C4QA 1PTOD 1DD2A 1NR2A 2BE5D 4H44C 4O42A 2XWBB 4K6LA 4K5WA 1XLQA 3HOWB 3ABVB 2AUKA 5C5LA 3V96A 3VR2A 2EVBA 1G6ZA 2WINB 4JWUC 1XXGA 3K7AB 2R3ZA 5K5PA 2L0CA 2F0FA 5AFWA 1XCTL 2ONQA 5M3MB 1TR5A 1FM0D 1R4PB 4C3IB 2F0NA 3NZ3A 4HMIA 1D2BA 5T1GA 4F88A 3G7LA 4GLSC 2OHFA 5C3EB 1BDOA 2PLPA 2MP1A 2KHSA 3RLFA 1H9MA 4R8NA 2K3UA 1JWMD 4ZHPA 1V43A 4X3TA 1ZYRD 3CQZB 1A3VA 4IZ8A 5EE9A 1EL0A 1N5WA 4KI0A 3TZDA 1D1KA 1I4PA 1VZ6A 4WURA 2K32A 4OZCA 3A55A 2E2IB 3E56A 2YEPF 2LGIA 1BCPD 4KN4C 3MP9A 1WYGA 1EY9A 3JAME 2A68C 3NPPA 1T5EA 3NQTA 5CORA 1C9FA 4FO2A 2K01A 3DUZA 5KNDA 3AEDB 4MM3B 3OIQA 2F0SA 1DOKA 3PO3B 5FLXL 1CTMA 3BWUD 3NP8A 2IX0A 1SE3A 5KNBA 2A6EC 5J22A 4A6QA 1UWMA 4YTNB 2SEBD 1O7LA 1CHPD 4NMZA 1ZEQX 3HOUB 2HDEA 1SEBD 4WH4A 3GP7A 1Y56A 2R61A 3NVVA 2ZXOA 2KQ4X 2V4DA 2I38A 2IT1A 2B2YA 4IURA 2NWGA 2A68D 3U52E 4BBRB 5C4ZA 1ZE3D 4RGOS 1YN5A 4E6IA 3P42A 4NDXA 3GTJB 2Y5PA 3IXSA 1OXXK 4DN4M 3Q8BA 4OIJA 3PUZA 2EJFC 3BDOA 3TBIB 1L4ZB 5IGDA 1JW9D 1BOSA 4QUFA 1EY8A 5FO7B 2A6ED 1SYCA 2YYZA 1SMYC 2YEPB 1SNCA 1AN8A 2PQEA 3AV8A 4C3IG 2PIAA 2MJ3A 4JPSA 4IUQA 4KKSA 3KBXA 2KWDA 5KRUA 4ZOHC 3W9CB 1PLFA 3W5VB 1TKGA 1OFFA 3MHZA 2WP9B 2B76B 4ZAIA 2Z4IA 2BDOA 1L6VA 5JVG3 2SDFA 5HHDG 1WTOA 4K6DA 3X3NA 3DWGC 1U4MA 2N88A 2JU6X 2VZKB 3NRZA 4B0EA 1LTID 4RH6A 1ICWA 4CKCA 5IODA 3M7GA 2BA0A 4KY7A 4DA2A 2WXGA 4K5VA 1SMYD 3NTHA 2J42A 1SNQA 3GTPB 4OGQC 1JORA 2WXKA 4XTCS 4ZLTF 3GQBA 3S15B 3TSSA 2M56B 1YJJA 4IFDH 5K36G 2IDYA 1SJED 1BR9A 3EGRA 1DOMA 3QWNA 1L0YB 4QUCA 4XDCA 1CT1D 3S1MB 2FUG1 1RTNA 3VYRA 3RPFC 3P4SB 5J39A 5CV5A 1CK1A 3L9AX 4L6TB 5T8IA 4HROA 2RDFA 1YQ3B 1IBXA 1C78A 5JOBA 1PGAA 3RFZB 3MJ5A 1HTLD 4KD3A 4H7BA 1L5PA 1EZ8A 2QILA 5JXVA 3ZJUA 2O5IC 1B44D 3RD4A 5C0XI 1TKWB 4C80A 3IFTA 4YXDB 2K6AA 2IJ0A 1F2RC 4Q5VA 3F2UA 1Q1BA 2I07B 3S2HB 3FMCA 2JA8B 2GI9A 1AFPA 1RYJA 1AWDA 4HRSA 3BVMA 5EE0A 1TS2A 4KKTA 4G57A 1SIJA 2LUMA 5ELBA 3J80E 1K52A 3AEBB 1Z47A 2AWOA 1FXAA 3AEEB 5C6AA 4ITKA 3KLSX 3V05A 3C8YA 1D4BA 4N9PA 1L6UA 1WD1A 5FOBB 3HOYB 1HQMC 1X3PA 5ELCA 2ICIA 5BYRA 1JCKB</