3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
4RGMA 2RDHA 1EU3A 1PTOD 1PZID 4RGNA 1DYQA 1LTGD 5ELFA 1HXYD 1V1PB 3R2IA 1EWCA 5ELEA 1SEBD 1HQRD 1F77A 1BXTA 1CK1A 4L63B 1UNSA 1XTCD 1ENFA 2RDGA 1RF2D 1PTOC 1RDPD 1SE3A 3MC0B 1S5BD 1CQVA 3CHBD 1BCPF 3KLSX 1FNVA 3DWAA 4RCOA 1S5ED 2AQ2B 1I4QA 1BCPC 1I4PA 1G8ZD 1SXTA 1TY2A 1SBBB 4DXFA 1D5ZC 1LT4D 4RGOS 4OHJA 1V1OA 2R61A 3SEBA 4TSSA 5ELBA 1MD2D 1CHPD 2NTSA 1D5XC 4Z9CB 3W2DA 2XRQD 3DWPA 1PRTF 4RHRA 1EFID 1JCKB 3URYA 1FNUA 1PTOB 4BWGB 1PRTC 2XN9C 3TSSA 1AN8A 1GOZA 1PTOF 1UUPA 2QILA 1ESFA 2XNAC 3GP7A 1DJRD 1CHQD 1BCPB 1FGBD 4C56C 1LLRD 4O1NA 1T5XD 5TSSA 1TS5A 1RCVD 2IPKD 1YN4A 1PTOH 1PZJD 1JWSD 2XRSD 5ELCA 2O2LD 5FK9C 1LTBD 4DXGA 1LTTD 2QEJC 4RFBA 1KLGD 1D5MC 1QILA 4RH6A 3BVGA 1PRTB 3OWEB 5ELDA 1M4VA 1L0YB 1CT1D 4RGTA 1EEID 1EEFD 1FD7D 1SE4A 1ET6A 1JR0D 1S5CD 2SEBD 4K6LA 1V1PA 3EA6A 1TY0A 2WV6D 1YN3A 1XXGA 1AW7A 2NTTA 3BZDB 2CHBD 3EFXD 4NZLB 1SJHD 1PYWD 3BYTB 5D3DA 1L0XB 3O13A 1LTSD 1HA5A 1SE2A 1PZKD 1TS4A 3R2TA 1I4XA 1KLUD 1D6EC 2J4XA 1LO5D 1B44D 1LTID 4RHSA 1I4RA 1JWUD 4UDUC 1LT5D 1LTAD 2ICIA 2G9HD 5D3IB 1B1ZA 1S5DD 1ET9A 1BCPD 2AQ1B 2Z8LA 1RD9D 3BYYB 3MFGA 2AQ3B 2TSSA 5FKAC 3R8BA 1LT3D 5I4DA 4ZYSA 1YN5A 1SJED 1JQYD 1FNWA 1LT6D 3DWQA 1LTRD 1EU4A 1STEA 1I4GA 1JWMD 2IJ0A 3BVZA 4L6TB 1I4HA 1TS2A 1S5FD 1PRTD 1TS3A 3BVMA 1HTLD 3V05A 1KTKA
chains in the Genus database with same CATH superfamily
4HKQA 3ZW3A 3B2GA 2Q2IA 1FFVA 1L5PA 4RGNA 1LTGD 2A6HC 3S17H 2IY1B 4H44C 4DAMA 2BW2A 2WXFA 4BZAA 4RCNA 4A3FG 5IYCH 2RR9A 3NTKA 3HOZH 1XNQQ 1B8AA 3CF6E 2EKIA 3H7SA 2K50A 3NZUA 3M7GA 3UDXA 4LF4Q 2AUJD 1RDPD 2DNEA 1IYUA 3P63A 4JPBW 4C3IB 1HR0W 1HJPA 3JC66 1E1OA 2JP1A 2M0XA 4TKNA 1JE5A 4A6QA 1NBFC 5JVH3 1H9MA 1YVCA 1SXTA 4S0RA 2RF4A 3VYSA 1DD2A 4IURA 1JW9D 2GRIA 4WWPA 1STBA 3ZNHB 3GV3A 1OXXK 1GPXA 1CZWA 2IHEA 3DBHB 2BA1A 2K5QA 5FLXE 2H4OA 1SMYD 2N8NA 5I6YA 1ZEQX 3TZDA 3ULJA 5FLMH 4B3TL 1RLFA 2D5GA 3L16A 2K6QA 3I8ZA 1D4BA 1NY4A 2K01A 3R66C 3H7PB 4LF6Q 3T3OA 4IUPA 2JYEA 3J9CA 3EBEA 1ENCA 3DVGX 2QEXA 2X6GA 1QZEA 3UQAA 4PZ6A 3GE3C 1DONA 2JZ3B 1U4RA 1IBXB 1VQGA 4NJ6A 4LW1A 3Q2AC 5C4ZA 2L1AA 3BU2A 2WXPA 4D2KA 4DR3L 4BXXG 4R4OA 3GTOH 2WACA 5CBEE 2F3VA 4C2MB 1GG3A 1Q0WB 1V81A 5AZFA 1V2YA 5KGUA 5LLIA 3QWNA 3G7LA 3OSOA 2O4XA 4JK1C 2D0OA 2Z6BA 5T1IA 2ZJPA 3I91A 3MWYW 1FJGQ 1AP0A 5IO9A 5M3FH 3AMUA 5IOCA 4Q0FA 4X62Q 4A3JG 2E5LQ 3A8KE 3QR8A 1SNOA 2VUMH 1F2RI 4IWOA 1SYDA 4REZA 3AB5A 4W9IA 1A62A 1EQTA 2SOBA 5C0XH 2LXKA 4AUQC 3ZJTA 1KOTA 2Z9HA 1H95A 2B8FA 2EYPA 2I0QA 1TWFH 4ZHOA 1CMXB 1IP9A 4AYBB 3S1NB 4CYEA 2EOTA 1AFPA 4JBJA 5DAUA 4YWKA 3GTPB 1JQ4A 1K51A 3D4RA 4IPCA 2EIFA 1IYJB 4B3ML 4LTUA 3ZRFA 1XNRL 1MHXA 1TS4A 2W3SA 2XTIA 4A3IB 1IUEA 4YSYB 3EQLC 5LHY1 2J4XA 2OCEA 2BOSA 3PIOA 2FXQA 4KKIA 1UD7A 1XCQL 2N49A 4GOPA 1GB1A 3KF6B 1SDFA 2L9HA 1STAA 1F9JA 1A0IA 2Y0SE 4LWCA 3JVZX 3GTGH 2D07B 3FC4A 3SR6A 1IPGA 1UE5A 3K0YA 1TR5A 1WTRA 2QMTA 4MGYE 3AN1A 2LJ5A 3JAML 1Q8KA 4KHZA 5CV6A 3Q8EA 4FVMA 3STBD 2BH8A 5I4DA 1YN5A 2WNMA 1GB4A 4GU2A 2WX0A 1T0YA 1CKOA 1CZPA 1D8LA 3T1HL 3NTHA 2CQOA 3I4NB 1ZKHA 5AUIA 4B3SL 4MGIE 1K28A 2JA6H 3Q8BA 4YTNB 3U50C 1U4PA 1MHHE 2BE5D 2SAKA 4CDEC 1ZXHA 1J8CA 4P16A 3ZDTA 1L0WA 1ACCA 4A3KG 4LAAA 1TWGH 1Y8NB 4DK6C 1V1PB 1JJCB 1L6UA 1HQRD 4XC2A 1F77A 5C3XA 4IUVA 3TZUA 1F9RA 4DHJB 3CAMA 4NPSA 3I72A 3VA7A 4EGVA 1WD1A 2MJDA 1PLFA 1NAPA 2JXTA 4WORA 3KLSX 2E2JH 2ACZB 2K5HA 3N32A 3HOYG 2B3AA 3IVFA 4EEWA 3P4PB 1SBBB 3OTOQ 4Q2JA 1NCVA 1LT4D 3MXPA 4EZJA 5C4JH 1LGRA 4GDLB 4YWMA 5C4HA 2V1CC 2HTME 3MHSD 4TSSA 3SXHA 5D14A 4II3B 3BK2A 4IC7B 2QDBA 2B8GA 2LY7A 4B9WA 3PQIA 2VL6A 2VW9A 2KMCA 2PO4A 1E8YA 2KWCA 3BY4B 4KSLC 4RMAA 3U52E 3ZNID 3CMMB 3DBHI 5AUKA 2NPTA 3CCEA 4M0WB 3PTFC 3S1MB 5M3MH 2Q2UA 1DJRD 3P75A 1SR3A 5EBDA 2JU6X 3I3TB 3RT3B 4DBGA 3LGJA 3PO3H 4NY0A 2INCC 1X3QA 1GC6A 5IGCA 1FPYA 4OZAA 4IWPA 5CV9A 4XZ4A 4IN3A 2PIAA 3NWSA 4KD3A 2FBWB 4IALA 4IOIE 4NAWA 3TRZA 2CU1A 3FVQA 1C7YA 4H7BA 1EL0A 3NENA 1E8ZA 1ESRA 4I6LB 1I35A 4G11A 4DFAA 3OWEB 1V8CA 3AU7A 1N36Q 4JG2A 3S2HB 1R4MB 1WF9A 1G6PA 4HJ7A 3KK7A 2CHXA 4W9HA 1FD7D 2RBMA 4DHZE 4QGUA 2PNHA 1CUKA 2VXWA 2UXBQ 2W82A 4YTMB 3KVFB 4A3LG 1BT0A 2I07B 2KQ4X 5GQOA 3KYCD 4UHVA 3QARA 2C9OA 1F9QA 2RSOA 2VQEL 1VS0A 2E2IH 1UELA 1L6VA 2Y5PA 3Q3OC 4ANXA 3BG3A 2OWOA 3HGBA 1QOFA 4DR5Q 4ZRKA 3QO2A 3SDZA 3DBRI 1P16A 4DV2L 3OWFA 2F4IA 5KHOA 1P0RA 3BK1A 2K04A 4URKA 2F52A 5D2MB 2CJOA 2XK5A 1LT5D 3R93A 1FCCC 5C3JB 2J0KA 3D31A 1JRUA 4JI6L 5DEHA 2OQKA 2A6ED 1C3TA 3N9YC 1J9OA 3FPPA 4IKGA 3OMGA 1AE2A 3J80i 1HPCA 1Y1VB 1I7HA 2GI9A 2INPE 2OHFA 4WJOA 4I7AA 4X3UA 1BBUA 3L4PA 1ILPA 2K8CA 1UGMA 1R4PB 1SMXA 3M85A 4BOZB 3AQQA 1UWVA 2RA4A 2FUHB 2KQ7A 3GTLH 1YNNC 3CCLA 2F0SA 3NG0A 3B6YA 2H89B 3TP6A 1KQSA 1TS3A 4KKUA 4DAYA 4H13C 3HOVB 4OO1I 1YQBA 4MGKE 3VRAB 4ME5A 4XWWA 1XQQA 3TEHB 4RAUC 2W55A 1M1KC 4BKSA 4NXNQ 1PZID 5C44B 4M01A 1XWEA 2F0IA 4OX9L 4ODGA 1GAQB 1LM0A 3DBLB 3C8YA 3GB1A 3ZXRA 4CKEA 1WI0A 4W9CA 3KUDB 3A0JA 5C5LA 4LJOB 5CORA 4YSZB 1ZDVA 3DWAA 1YNXA 3QX1A 1MI2A 4R4QA 3AFPA 1C79A 5IYCG 2K03A 2KN5A 2KTFA 4DK5A 2WAQE 3K58A 3AE7B 5EDSA 2IO2B 3UIPB 2M56B 4GKKQ 1TWCB 2NTSA 5BYSA 1NI3A 1I6HH 4DGZA 2ALYB 4GSWA 5CV7A 4A76A 1WRDB 4NQKE 4HMJA 4E3CA 2EYMA 1JRPA 2XVSA 1C9FA 3TQYA 2E74C 5FLXL 1QVFA 5L83A 1KAWA 2PLPA 3PHXB 3Q23A 2LVPA 4EZLA 2WP8J 3NE5B 2CHWA 4C56C 5LMNQ 2ZT9C 4C7ZA 1N5WA 3V2TA 5FLMG 4FBJB 3H0GB 4JYAL 3ERSX 1FXTB 1PH8A 5IYDH 1TS5A 4DU9A 3E9IA 3HOUB 3A9JB 1HNZQ 2LXJA 3KUPA 3J81j 3CC7A 1TU2B 3V61A 3IT6B 1J19A 4PMCA 3L2PA 2M2LA 1QZHA 4BFRA 4DV4L 2PZTA 3K7AH 3V96A 4DV5Q 2KHJA 3AE3B 5MPOA 3VR5A 3G6EA 4A20A 4XWTA 1WJJA 2PMVA 1T0SC 2R6GA 2ATWA 2YYZA 5G55A 2IX3A 4HSVA 2QKIC 4C3HB 3A8IE 2KX0A 1SE4A 3H8HA 4OVUA 3OMCA 1FFUA 2MQJA 4MJSA 3RZWC 2KWVB 1O7LA 2B29A 2D3GA 2N9LA 2N7JA 3D8GA 4BBNF 1EIFA 1SYCA 3IRBA 3PCOB 3P2BA 4IPDA 3DHIC 1R4MI 2KVZA 3NTIA 2R7ZB 2VUMG 2LGSA 2F0JA 3DLLA 1L0XB 4E6IA 3HIZA 2EPBA 3JAMc 2KJXA 4IW0A 2G4SA 4FJVB 3TP7A 2INNE 1LTSD 4DKAC 3IAYA 3M3JA 4OZBA 2BA0A 3A1QB 1GXDC 1F2LA 1LTID 4RHSA 4J6HA 2IGGA 1EYDA 3CC2A 2ZPYA 5HFYA 2LUMA 2B2TC 3GO5A 4OWXB 5HGQA 3BINA 1XLNA 4A3FB 1EY0A 1F52A 2ZTEA 2EMTA 4JI8Q 3A9KB 5G5GA 5IWAL 4XYOA 4ARCA 2K39A 4CDFC 4A93H 2N4FA 4PZ7A 4LNNA 1HRJA 1H9SB 2WYQA 5CV5A 2HD3A 1N63A 2OT2A 3S1RB 4JI7Q 2I1JA 4PK1A 4A3DH 1Y8OB 3HZXA 1RIPA 2O6VA 1XCTL 2K6AA 4KDIC 2DZJA 4ASWC 4P72A 3Q8AA 4LNQA 3U2SC 1C1YB 2N9XA 1HH2P 3BVMA 1QG7A 3H6MA 4HWIB 3SE0A 1VQHA 3QAQA 3TL5A 1EF1A 2N1WA 4ARIA 5BR8Q 5I6WA 4A8XC 4EOYA 4ZHPA 1KDAA 2GBJA 3QIAA 1WJUA 2OJRA 4K8JA 2HIXA 1YITA 1LACA 1EY7A 4P1BC 5IODA 4WWNA 5JEAH 4KV2A 1YD8U 4L63B 1N34L 4A3PA 3HKZG 2JA6G 1XTCD 2B2YC 3KW5B 1RF2D 4XYCA 3KLSA 1EIYB 1N33Q 2CU3A 3CHBD 2X8XX 3RN9C 1FNVA 3F8TA 3DBLI 1S5ED 2JE6I 2RGFA 1DM0B 3W1BA 4NXML 3OW2A 4BY7H 2JXMB 1OEYA 3AH7A 4KGSA 5BMHA 1VQPA 4ABNA 3LYYA 1VQ5A 5HGTA 2FMCA 3W5OA 3B2FA 1WE7A 2IZVB 1E2WA 2M0AA 1BKBA 1VQOA 4LF8L 4DK3C 3P7JA 1RRBA 1IGDA 3B9JA 1D5XC 2V0GA 1WTHA 2K32A 4NQLB 3PUVA 5JJKA 2WXJA 2EY5A 2IL8A 3MXGA 2JEBI 2X6LA 1L1OA 4YT0B 1DGJA 2OEDA 1XPRA 2ZEQA 1SYBA 1ESFA 2I46A 1WR6E 3K9PB 1LLRD 2LWPA 3HG9A 1LM8B 2JPHA 3EJIA 4KKJA 5EJWA 4LCDE 5KYIA 4FF2A 4XDCA 4QCLA 3RD2A 3H91A 5LMNW 1PTOH 3T1YQ 2EDGA 1I3QH 4GN5A 1RWSA 3QHTA 4KIKB 1MI0A 3AB9A 4GS3A 2BVCA 2ZNVC 4W9JA 4C4VB 1J7AA 2G45B 3NVYA 4HPLB 1QOBA 1O78A 3HS0C 1GVPA 3ML8A 1OTRB 3AEFB 2RSUA 5CHVC 2BPSA 4A3MG 3PO3G 1LTLA 1VQKA 4RGTA 1MSGA 2ENBA 1FXAA 4MGZE 4K6LA 5E4WC 3A55A 5IY0A 4J8QA 3HVDA 1DXMA 3WOEA 2WHIA 5HG2A 2NWGA 4X64Q 1WI5A 5DNFA 2OOBB 4A3JH 3PT2B 3QK0A 2ZXPA 3G4SA 3CPFA 5J1ZA 4DN4M 2R3ZA 4ZQ3A 2V4DA 1B9MA 1K3RA 2UUCQ 2ZNVB 2LFIA 1YMHE 4K1RB 3CWIA 2NVTH 4N9F4 3M9BA 2E75C 2FCSA 3RFZB 1V43A 2HQEA 1WZ0A 3M4PA 1X55A 4R9WA 2LMCA 5DLQE 2NZHA 2RPQA 3ONAB 4A3KB 4HTHA 3RD4A 1V49A 4KX6B 4UP9A 2L83A 1BCPD 3RLFA 1WTWA 3BYYB 2Y5CA 4RM8A 3GTJH 1STGA 2C5CA 2JYOA 2KCNA 5BN4A 3Q3JA 5IGGA 1HNXQ 1K50A 3ICEA 2WKCA 3R8BA 2D3BA 3J7ZC 3NELA 3HOXB 3Q6BA 4P7IA 3N30A 1BOSA 3H09A 3UE1A 4GXBA 4HN7A 2NS5A 1FNWA 2D5DA 3DWQA 1EQVA 5AZGA 2N9PC 1V5TA 2HJ1A 2A69D 1SNCA 2KVMA 2HHHL 2YU9B 2KDIA 3DOWA 5CV4A 1C76A 4HSPA 2EE1A 3V05A 2LHEA 2F0NA 1KM7A 1IBMQ 2KMMA 3ZLZA 5I9OA 2XGTA 3A7AB 4DR4Q 4ANWA 1F9PA 4EQ5A 4GOPC 2ZJDA 5IA7A 4LFBQ 2UU9Q 5GADC 1X65A 3Q0AA 3C0RB 1G291 1GO3E 3CW2C 1SNMA 1UNSA 2WFWA 1UWXA 3N20C 4DAPA 2RDGA 4FYDA 2WP9B 2JA5B 1HFGA 5M5YB 3A33B 3RMKC 2E3TA 1U9RA 3SD5A 5FLXc 1X3GA 1JORA 1SFOH 2JY6A 1NR2A 4BKSD 2KA7A 2NMQA 3NHHA 5BN3A 2AMCB 4JW0A 5CYUA 4WAAA 4GOPB 3B08A 4DR2L 2JUOA 1ZYRD 2Z0SA 4P74A 1E0BA 2DYOA 3PZDA 1UEAB 4HPMB 5LL6X 1EWIA 3HOYH 5LXIB 1PRTF 4IFDH 4DV6L 1ZGUB 2K6DB 3I63C 1PH9A 1E0ZA 1IBLQ 4GDKB 1WX9A 1O7YA 1L4DB 3MJ5A 1JALA 1GUOA 4EE2A 4FNFA 4MHEA 1GHKA 2NVYB 1K73C 1WJ4A 3GP7A 5TR5A 3KLWA 2NBVB 1JC7A 1KFYB 3AE4B 4FHJA 4W9EA 2B39A 4IUMB 3UE0A 1DOMA 1TIID 2K5VA 5TSSA 4HCEA 4L5QA 4RM9A 1EY8A 2HCIA 3RNUA 1OTCA 2PE9A 2UXCL 5FOBB 3I4MH 4CQNA 1FEHA 4DUYL 1WSPA 2JZPA 4YCWA 2O2LD 2MFIA 2UU7A 5IYBG 2WLBA 3MHZA 4JOIA 5EAYA 4RFBA 1HA6A 2LHDA 2PE6B 4MSMB 1YHAA 3AU5A 5IYDG 3MVVA 3A7LA 1PH6A 4JI3Q 3M95A 2F4VL 2NR2A 4DNIA 3EROA 4HEDA 4XQQA 1KRTA 1WCMH 4WJQA 4A3EG 4MTKA 1XMOL 1ASZA 1WWTA 3KUCB 3KWLA 2Z6KA 5DPRA 1YJJA 1VMPA 1U4LA 2DHZA 2WWZA 4FADA 4B3RL 4C80A 2CHBD 1L2NA 2MBHA 4EKUA 2B76B 4LNKA 2UWQA 1TWAH 3H6NA 2JXXA 2GN5A 3R7RA 1NUCA 4KDLB 1WMHA 4C00A 2M1MA 4A3LH 4EZKA 1YJ1A 5FJ8H 3T53B 3CF5A 2WB1G 3NHEB 4LF5L 2G9HD 3GDEA 1WGDA 3C1FA 3DMUA 2G5DA 3K5OA 2BB5A 2FCNA 4YY3L 3MAQA 1PH4A 4DR1L 2O2VA 3AEVA 1HR0L 1X3PA 3VQIA 3CD6A 4LK0M 1I5FA 4DDID 4F7XA 1EWYC 2Z59B 1VQ8A 1CJEA 3C3LA 2PJHA 2V9HA 2WXIA 3UI2A 4AS1A 1L4ZB 3WA0A 1F9SA 3WAPA 2V4IB 2E76C 3S1QH 3S17B 1HNWQ 2BQQA 4HJ5A 4KKTA 3TBLD 2KBNA 4RF1A 4U673 1PV4A 3HOZB 2EJMA 3HFZB 2WXHA 2PTLA 1FD6A 4A93G 4DV0L 1SNPA 4KGTA 2R92H 1DYQA 4A9AA 4H0LC 2A69C 2MBBB 1KDCA 1HZBA 4K81A 1QVCA 3L08A 3TMPB 4A3DG 3JSVA 1Q7YC 1FR3A 3ZO5B 2O5IC 1KRHA 3KYHC 1KC8C 1VQ7A 4ZOHC 2ZTDA 2OJWA 3VR8B 1QF6A 3B1LX 3CCSA 3I9V1 4FXGC 3MXUA 1Z47A 2QIEB 4KVGB 1NI2A 3T8MA 2KENA 1VZ6A 2IX0A 2DENB 1KNAA 3PZ7A 1D7QA 2AX5A 1ZPSA 2H5XA 4PS7A 4YTPB 2XK5B 3VTWA 1K83H 1MFWA 4MM3A 1CHPD 1SSOA 3I70A 2MCNB 1NR4A 5E1FA 4JV5L 3DWPA 4IM2A 2C7HA 1J5EL 5KYLA 4BY7G 3N6RA 1Z9FA 3GTOB 2DJFC 1ICWA 1FVIA 1X56A 1ZYRC 1WJ6A 2B63G 2QILA 4POGA 4IUNA 2PQAA 3MZ5A 5M3FB 1AWDA 2VUMB 1EY4A 3GS2A 3L17A 4M8MA 2UUBL 2DBYA 3RUIB 1H9RA 4JL9A 3L13A 2SNMA 3MTSA 4CKCA 1YJNA 3J7A5 3Q3MC 2VQFL 2F0QA 1TWFB 4EQOA 4LF9Q 1Q5WB 2JZZA 4FHKA 3PV0A 4GN3B 1U4AA 1V80A 2WXNA 4X57B 3K0XA 3KLRA 2BYVE 2L00B 3AE5B 5GAHC 2W3RA 2BYTA 1OXSC 3TEYA 2NVXH 1EIHA 3C46A 1NMFA 1Q1BA 1IBKQ 4LFAL 2KTRA 5KNBA 4KN7C 1RM6C 4F1SA 1JJ2A 1A15A 4K5XA 4KHVA 1YN3A 4WJ4A 3L10B 1AW7A 5I2XA 2OTLA 1UF0A 2WXLA 3WOFA 3AFQA 3FAHA 3DVNU 3J81E 2V3PA 2A8VA 4M00A 3RZDH 3TIXA 1NENB 2Z4HA 5EKKA 2KHWB 1WJNA 2MWSB 5I2YA 3GTGB 4KHPL 4J3OD 1KLUD 2K5WA 4DXAB 5CC4A 4A3GH 2IGDA 4K3BA 3K81C 4W9FA 4TKOB 3EIVA 3V3XA 1EY9A 5JHAA 1GUNA 2NUCA 4OXPA 3PF5A 3PO2H 1SYEA 4CJ2C 2JT4B 1Y1WH 4BVUC 4HIDA 2NB0A 2EQSA 3S16H 3U58A 4DPGA 1XNQL 1CTMA 3MXNA 2B2VA 3HKZB 2JA6B 3SK6A 4LF4L 3TBIB 2VH1A 2WXMA 4LMQD 1YZ6A 4AH6A 1MPEA 2WXRA 4K6DA 1EF5A 3Q3FA 5JZEB 1D1KA 1FL0A 1TWGB 2PMZE 4J6IA 2I1KA 3FPUB 4HDQA 4TQ1A 2ZM6Q 1P1AA 1STNA 2F3WA 1QVGA 1O7IA 1TS2A 1S5FD 4NDXA 2NVQH 2KOLA 2DX5B 2IO1B 4U68A 4IUQA 1PH7A 1GKHA 2DJGC 2RSNA 2KVRA 3APFA 3EFUA 4X65Q 1K0RA 2E2JB 1RAXA 1KH0A 3TUOA 4FF1A 4S3SA 1QKZA 4LF6L 1K8OA 1M94A 1CKNB 3DQVA 4ZRPA 1HTOA 4FA6A 2J0MA 2K9XA 4QF4A 5C4JB 3PZ8A 1YNJD 1V6EA 3MC0B 4RKBA 2WQYB 3HUIA 1BR9A 1RTNA 4JI0Q 5KHQA 3Q24A 3OJ3A 1I4PA 2EY1A 2KKCA 3RZFA 3UINB 1R9TH 2VRRB 1V8QA 4B08A 4BS9A 4K0KQ 4UP8A 1FJGL 4IFDI 2D3AA 1E8WA 3TMEA 1OQYA 3SR1A 4IO9A 1MD2D 2QDLA 5M3MB 4JI1Q 4X62L 1Q46A 2E5LL 2M19A 1B3QA 3PF4A 5HKHA 2JSOA 2ES2A 3BDOA 4KV6A 5ELNA 1KD1C 4DV1Q 3VYRA 1QZGA 3PO3B 5JJLA 2GVBA 1DOYA 2A1AA 1TIFA 3HRDD 1PRTC 5A35A 1Y56A 2E6XA 5HI1A 2F0VA 1A2UA 4GZYC 3NBIA 2WIIB 2VB2X 1E1TA 3FILA 1QUQA 1SRUA 3EGRA 1HTQA 1Q81C 2O6VB 3IFWB 3PUZA 4O1NA 3DPDA 4YCUA 2GMIC 3ENEA 1UAPA 2KN4A 2GOWA 3KOJA 2LD9A 4DWFA 1PZJD 1F2YA 1SE8A 1SYGA 5C5MA 1P9DU 3PHWB 1B50A 4YL8A 5D6JB 3AULA 3S2AA 2QEJC 4BBRH 5C0XI 3HK0A 4DAVA 1S72A 1T0RC 1B9NA 1HZCA 1PRTB 4ZRZA 1VJKA 2E2IB 4W9LA 3A5ZB 1ONLA 3RPFC 1L1OC 3I4MG 3BZKA 4F8MA 1PGAA 2EXDA 2SEBD 1NBWA 4NW2A 2JWZA 3NEMA 1JMCA 5C4XH 2F0PA 1XPUA 2LASA 1GUAB 1TKWB 2JF5A 1SMYC 4H2AA 3MFYA 3VR4A 1SIJA 4KZ0A 4LNFA 4JQWC 2LGXA 2CVRA 5FO8B 2MO0A 4G7HC 4APVA 1ROEA 4A3MH 1B2TA 3IBEA 3RLOA 4TVAB 4KK7A 2JEAI 1G2SA 1WCMG 1WGKA 1I50H 5IE8A 2KANA 5JXVA 2V3SA 1NSNS 2KCCA 5CBAE 2HDLA 2XIWA 4X3TA 3RZOH 2YTYA 4CDCC 3L0WB 3K6OA 3KYDD 1L1OB 2XSCA 2AHOB 2Q5WD 1A63A 3NOBA 1HFNA 1TWHH 3JAMi 2E2HH 3QCAA 4K5VA 3UGBB 1E24A 4OIKA 2Z8LA 2Q8TA 3GTLB 3ZJVA 5EPKA 3M4OB 2LI5A 1KRSA 1YQ4B 5AEKB 3ZTCA 2PNRC 1I6VC 5EKLA 2BT6A 4LFCQ 5NUCA 4AQYQ 4ZYSA 4N8FA 4ZAIA 5FJ8G 3W1SA 1LT6D 3RNAC 2F0DA 1GUSA 4C1NI 5LMUQ 4M8NA 3S2DB 3OTOL 2WS3B 1HQMC 3KDFA 1N32Q 2MEKA 3TN2A 1YNTE 3ZJUA 4RGMA 4JI4Q 3KWVA 2K7VA 1PTOD 1CI3M 1DZ1A 1EM7A 5IT9E 1SAPA 2V1YA 2OEOA 3ZXVA 1B9RA 2KEDA 4P73A 1WXQA 5T8IA 2JA7G 1VQIA 1KDBA 1VQAA 3I55A 2KFKA 4ZCKA 4GNXA 4W9KA 3SFDB 3WIMA 1SE3A 3KF8A 1TQOA 3QA8A 4A3BH 1W3SA 1PH5A 2R92G 2AWTA 3M3YH 4ILWA 1I6HB 1RYJA 1G8ZD 3F2BA 4EVOA 2W54A 1WGRA 3J7AV 2KYWA 3VAWA 1YNJC 3S1MH 1LXDA 3UIOB 2DGYA 4AIMA 1V1OA 2KHIA 2R61A 3E9HA 3STBC 1XEEA 3I3CA 4CJ0B 2EY2A 2L4NA 2AL6A 1WX8A 3TCAA 2FFKB 3ZNZB 1JICA 1N36L 1EFID 3AYHB 1BVSA 2CKZB 4II2B 3RR5A 3URYA 1Q3LA 2F0MA 3N1XC 3APCA 4JWUC 2UXBL 2BE5C 2RKSA 3NBHA 3S15H 1WFYA 3Q14C 4O42A 2REXA 3K7AB 3Q8CA 4R3DA 3GV6A 4HJAA 2NN6H 1J0GA 3M4YA 3DVGY 3EUB2 2IY0B 4WWOA 4IUUA 1IW7D 4DUZQ 3SDLC 1Q1OA 2PW5A 2DWQA 4DR5L 1T0QC 3PO0A 1PGBA 1WTOA 1VQMA 5LXHA 4KKSA 5COYA 5FK9C 3PRZA 3WAOA 3RNCC 4IUTA 3SK5A 4K14A 1O80A 4OWTB 4NB3A 5ISRA 1VRAB 3AV8A 1J7BA 2ON8A 3MP9A 1II3A 4C7YA 1ZUD2 2WB1B 4P2CB 4BKGA 3OHXC 1I94Q 2TMPA 4KTAA 1WVLA 2JRHA 1CQFA 1VCBA 1EQRA 3PUYA 5IYBH 2MJEA 3IL8A 1LV9A 1XXGA 3RUZA 5CR3A 4DF7A 2I5MX 5E4XA 1GUGA 5LL6S 2YVCA 3RNEC 1IBXA 3I73A 4DV7Q 2Q2TA 2A68D 4KN4C 4LJPB 1AZQA 2HUGA 3L9AX 1YJ9A 2K1FA 4JI2Q 1XYIA 3ETRA 4A3EH 1G2TA 3J81L 3RYTA 1XMQQ 1WR1A 4HJGE 3VDYA 4JOIC 5G2NA 1LO5D 2J7ZA 1WTVA 3V6CB 1E5WA 4HCPB 1B7YB 4A93B 2L5TA 4NXNL 1ZP0B 4L5RC 2BH2A 3HOWH 2L0FA 1PDQA 1S40A 3AEBB 5DPTA 1S5DD 2B3GA 1XLQA 3QQ8B 3LWUA 4JIOU 1RD9D 3LNNA 1P8LA 2NBFA 3F2CA 3P4RB 2QDFA 1ICFB 5M5XH 1VZ8A 2Z6KC 5JPNC 1VQLA 3K5MA 5FKAC 2EY6A 2ASBA 1C4PA 1F1HA 4A3GG 3T4AC 1LFDA 2X69A 1V9PA 3RULA 1JQYD 5ELOA 3PO2G 2B2UA 1EU4A 2HQLA 4F88A 3GTKH 2GA4B 1Y1WG 3BWUD 2IJ0A 3P1MA 4GB9A 5H8YE 4JBMA 3E6ZX 4BOSC 4IPHA 5G3LF 3EN2A 3FRPB 2LGIA 2WXQA 1C4CA 4GKKL 5D94A 1EU3A 1A2TA 1YBYA 2K5DA 4DNTB 1EZ8A 3E3XA 1NDDA 4DR7Q 3ZRCA 3FHWA 3P1HA 4KY6A 3HEJA 2RPVA 1K8RB 3V60A 3MEHA 4I6NB 1IYFA 1ENFA 4DDGD 2BTEA 1PTOC 1VMCA 1AEXA 5M5WH 2ZJRA 1BCPF 5LMNL 3RN5A 2X38A 2EYFA 2LVQA 2LKVA 4CGYB 1BO0A 1I4QA 2AUKA 5EBCA 2DZIA 1SF0A 2A6EC 1HNZL 3RN2A 4G3XB 1WMHB 2Y3AA 2I38A 1GUTA 2BYEA 4DR6Q 3DUZA 1TKEA 2PW9A 2C60A 4DV5L 3U7ZA 3Q8DA 3PIP3 1Q86C 5JVG3 4MTNA 2VY3A 1PGXA 1S4ZA 2R2OA 1KF6B 4X3KA 2O2VB 1QNUA 4FN2A 2I2YA 2FHTA 4HCSA 1PTOB 2XN9C 1I3QB 3MA2B 2F0EA 2MRPA 3T9LA 4XXEA 4LJZC 1SE9A 1FGBD 4XT1B 3KUZA 1TBEA 1WM3A 3MC8A 1OXVA 4KD4A 1TKGA 3NQTA 1P98A 1MJCA 3BIID 2DYBA 3RNGC 3HKZE 4MZ9A 1LUZA 3VR2A 1XLPA 3QJZA 3A8JE 4AYBE 2N88A 1OQRA 2BGFA 2C7MB 1UE6A 2B63H 4A3CH 2BKRB 2BS4B 3F2UA 2WXOA 3JSVB 3Q3NC 1IW7C 4HIKA 5JPMC 4A3JB 2DZMA 3I5JC 4KSKC 2KACA 4XIGS 2R93H 5T1GA 1KHIA 4C3JH 3OAWA 1QNKA 1G91A 1HZ5A 4ALPA 1TJEA 3R3OA 2NVTB 3HM6X 3TEZA 1DOLA 4JI8L 1JJGA 3T56B 1YHBA 4BBRG 3BZDB 2DAFA 2MJ3A 2P5ZX 4R8NA 1NYQA 2UUAQ 2CKHB 4GLXA 2W9NA 4I7ZC 2INDC 1SGHA 3I2ZA 5IIFA 3L3OC 3SK4A 4MELA 4JI7L 4XYQA 3ULLA 1JROA 3IXSA 2EYJA 4JC0A 4MN3A 2H1EA 3UDIA 3GTJB 1Q8IA 3DHHC 4MM3B 4OZCA 2CS4A 5C4XG 3VTVA 3K59A 3GTQH 2KC2A 3CCVA 3CQZH 3CMEA 2F0FA 2A5HA 1EQQA 1PH1A 2ICEC 1OGWA 5BR8L 1KJTA 2ZCCA 2Z0EB 2A68C 4GKJQ 5E6PA 1G6JA 4JI5Q 2EXZA 2LUEA 4EUTA 4LDTD 4RG1A 2JSVX 2IGHA 1R4QB 2PQAB 5G5HA 2HDEA 1SYFA 2L11A 2VS1A 5IN7A 1N33L 5L95C 1MGSA 1M90C 1G6ZA 3PMFA 1SJED 4HK2A 3I4NG 4OONA 3N3KB 3NS1A 1OFFA 1I4GA 1UBIA 2ZVOA 2KDFB 2RHSB 3BVZA 1VQDA 1A5RA 4BA1I 3LX0A 4Y7NH 1YOVB 5K5PA 1RKNA 3CKIB 1FGUA 4OWWB 3ZUNA 1J7CA 1SFOB 1RFAA 4A3OA 1HUMA 3LJ3A 4ID6A 1BXTA 4G57A 3IFTA 3A56A 3SHQA 1X3EA 5C3EH 1K9MC 3OJ4B 3R7QA 1VLBA 5IT9L 2LSSA 1YIWA 1S5BD 2N7DA 4B9KA 1JWBD 1P3QU 3PS6A 4F8CB 1ILQA 3W5VB 3CRLC 5C1ZA 4IFDJ 4TMAB 2R7FA 5EKIA 3HOYB 2N9EB 2DZKA 1FM0D 3T1YL 2IBIB 1XX8A 3M4QA 5KEEA 2JQRB 4RGOS 4YXDB 4GLAC 4FLHA 2OF1A 3H3VH 2ZZPB 2IW3A 1WD0A 4L1BA 2CW0D 3W2DA 4A3BG 5EE0A 1MJEA 2DNFA 4HIMA 4ITKA 3Q6SA 1PFMA 5IGFA 1YHQA 2OQ0A 4BBSH 1WYWB 2KXJA 3DCGA 4YSXB 1IZ6A 3CC4A 3I4MB 2DUDA 2CHZA 1K0SA 1WTPA 2VB3X 5DCNA 1IKMA 2PZUA 2XNAC 4X64L 3CMAA 2VH2A 1FCLA 4FXCA 1BMLC 2L0TA 3AE8B 1QOAA 4BY1H 3QOLA 4MH0E 2EYOA 3DXJC 2K0PA 3QIJA 2N9KA 2K28A 1FXIA 4PYZA 2UUCL 3NVVA 3NQIA 1R4NB 2XRSD 5C0XJ 2WDQB 4NNJB 4DV3Q 1WCMB 3I7FA 1IYVA 2G9DA 1PUTA 1VQ6A 2KDEB 3BDLA 3S14H 4CHTB 2LRUA 1W6JA 1WZ3A 3OG5A 1D5MC 2NN6G 5FO9B 1JOQA 4Y52H 3GOEA 3J81c 1VZ7A 4DA2A 4FULA 2MW5A 3W9CB 3P20A 4UPAA 2L05A 4G50A 4PMBA 1TWAB 4YWGG 3FKIH 4W9DA 3ZIMA 1VR9A 1E10A 4YHHQ 2E8GA 3EA6A 1TY0A 4I65A 1HNXL 1F2ZA 2GLSA 3VXWA 3VR9B 2C35B 2WV6D 2JQOA 3EFXD 3BYTB 2A6HD 3ZQ4A 2WU2B 2MBEA 2KK8A 1Z7TA 2CH4A 4FO2A 2FIFA 1LABA 3A5UA 1PFDA 3ZYYX 5AJ3Q 2Y5BB 2MGSA 1NTGA 2M00A 1I4XA 2QHOA 4LF7Q 4M1UB 4WAFA 2AKWB 3EVQA 2N1VA 4WQMA 4JCVE 4QAYA 1IBML 1OQQA 2EYHA 1K52A 5D7GA 4DR4L 2KAJA 2J0TD 4NP5A 1LTAD 2MP2A 3DDCB 4LFBL 1PA6A 1HUNA 4L5TA 5DM63 2UU9L 1EY5A 2KNBA 5IP4D 3S1QB 5FR3A 1B53A 1Y1VG 3MFGA 2QCPX 1UGJA 1V86A 3FILB 3AU4A 3L54A 4ZRQA 1QUQB 2JVCA 1KIXA 3FEWX 2AYOB 2PI2A 5IAAC 2KX3A 2L0CA 1WYGA 2ID0A 1TT5B 1A6XA 4IM3A 1X9NA 3HOWG 4X66Q 2R92B 4POFA 2ASQA 2BDNA 1MG8A 4OVVA 3E0JA 1HCZA 1TKYA 1IL8A 1EWHA 4US8A 5C3WA 1S3SG 3NPPA 4MSQB 1PQSA 4K2LA 3SK8A 1HZAA 4QUFA 1C9OA 1WXAA 2WGSA 5KRUA 2YEPB 5KNDA 1TVXA 2CWPA 1E2VA 1SEBD 1Q12A 4QL5A 4QUCA 1IBLL 2NPTB 4NPNA 3K7UC 3A74A 2G4DB 1E7UA 3PRMB 2D3CA 4GIVA 3NUCA 4R1JA 4CBVA 1K8MA 1VQ9A 4RNAA 2UXDQ 1K83B 3A9KA 3K5LA 2CCZA 3VR3A 2WB1E 2NYZD 2WU5B 3AXCA 3W1SC 1Y8PB 4A75A 1BCPC 1J6QA 2D2CC 4L8JA 1YIJA 4N8X1 4WRDA 3W3AA 3KJPA 1WE6A 4NAWB 2RQXA 2VZKD 5E6NA 1J8IA 2JA7H 3QWZB 4OHJA 4AJYB 3V6EB 2PVGC 1B70B 3CCQA 1XO3A 3HM3A 3C2PA 3U7DA 1NNXA 4EQNA 3ND8A 1D1IA 3OW7A 3CPWA 4JI3L 1YJIA 3RLNA 5E6OA 2L7RA 2WXGA 4ZUJA 1Y69U 2NBUA 5JH5C 1K53A 2KZRA 4TQ0A 1AN8A 2EVBA 4B0MA 1UUPA 5J18A 2CW0C 4GNXC 2BBCA 4OW0A 2KECA 1BNZA 3H0GG 1BCPB 1IL2A 1E90A 3HOUG 4AQ7A 1NE3A 3P4SB 3D4WA 3OIPA 5DPWA 1S1QB 2K14A 3AI5A 3KDFB 2L12A 2NVXB 2LGDA 4ANUA 5HY6A 3IAS1 3VYTA 4F87A 5J22A 4M8AA 2KJ6A 1E7PB 2L3ZA 3VUXA 1IKLA 3DHQA 3Q22A 1Q82C 1X6OA 4B3TQ 1R4NI 4L5SA 1NVID 3EHVA 4XT3B 3WALA 3RZDB 1EFWA 3CIRB 3EFCA 4GNXB 4TQUS 2CR5A 4DQOC 4UAIA 5HURA 1JR0D 3KF8B 4UP7A 4KLKA 4J1MA 4JBKA 2QW7A 1TZOA 5HHDG 3NZ3A 2RCFA 1TTNA 4HXDA 5BN5A 2R7ZG 2KT7A 4A3CG 1WTQA 3ALBA 4BA2I 1YEZA 1A3VA 3ND9A 4A3GB 1OEYJ 5D3DA 4ZUIA 4DR3Q 1ZDXA 1XF5L 3AECB 3JYUA 3PO2B 1HNWL 2MJ8A 2R93G 4DAYB 1Y1WB 1KXLA 1RJTA 4C3JG 1QE6A 3U9SA 1HEZE 4KJNA 3S16B 4O2DA 2JA8H 1BQQT 1HE8A 2HJ8A 1DGSA 1DOXA 1B44D 4C4VA 3SHLA 2FNJB 1I4RA 3J7AF 2KLCA 4UDUC 3FKYA 5CHWA 3ITPA 3NBHB 2RDFA 4JE3B 3TEWA 3ML9A 2MLBA 1EOTA 1BBXC 1WGGA 1T5EA 2NVQB 3PPAA 1LYLA 1RL2A 3N52A 1CA5A 1SSNA 1ZW7A 2RCNA 2KQSA 5IT9c 4B3MQ 1X1MA 3D0FA 4P75A 4V0BA 1YQ3B 2CJNA 2XBBC 3KH0A 4ZYNA 1XNRQ 4N59A 1SB3C 1PH2A 1K8AC 1VQJA 4B95A 4LK1C 3ZTDA 1BDOA 3U4VA 2L1BA 1N5XA 3RMHA 2MNAA 2FINB 3CXCA 1HXYD 1B3AA 2KWUB 5ELEA 1EWCA 1XT9B 2D11A 1BF4A 2J0JA 2LRWA 3D6CA 2Z4IA 1UWMA 2N7EA 2N55A 4QIWB 4JVZA 1R9TB 3I90A 3MEFA 1Z6HA 2H88B 1T9HA 4XDDA 2AQ2B 3AEDB 2B2UC 3T1HQ 3PIPA 2NZ1D 1P7EA 4B3SQ 1N9WA 5C3EG 2KEEA 4GLSC 3BS1A 4C3IH 1E6EB 3CSTA 5ELBA 1XTDA 4LF9L 2IO3B 5GROA 2KWDA 3NJTA 3N1ZC 4G0NB 4OIJA 1N8RC 2AEHA 1JCKB 3DEOA 3PLUA 1FNUA 4MJSB 4WJPA 2K25A 1IBKL 2F3IA 1PTOF 4WIPA 3DBRB 1GC7A 1YJWA 1WTXA 3GTMH 1CHQD 2QCZA 5CTRC 4BBRB 3H15A 5C23A 5C2TB 3PRPB 1EIGA 3ZKJC 4AWJA 4BAXA 3GQBA 1KL9A 2XWBB 3SFEB 4BBSG 2Y0SG 1JWSD 5JJZA 2LJIA 5H92C 2ZTCA 3OOCA 4KGRA 1LTTD 5C4XB 3ZGZA 1VQBA 4WURA 1KLGD 4NJCA 2L55A 2VZKB 4O0AA 5AFWA 1GM5A 4BY1G 5ELDA 4C2MH 1KAAA 1L0YB 3E56A 2FCQA 4BKTA 4A3MB 4FJYA 1ET6A 2I5LX 1YNND 1KABA 4LUVA 5JJIA 1C77A 1I50B 4GDKA 2DY8A 3G71A 1MIUA 1NYRA 2NTTA 3RZOB 2J52A 3HHMA 4XE0A 4FXDA 2YTVA 5H1SE 1XJVA 1Y8RC 4NJ7A 1MVKA 1LQBA 2RDBC 3WWVA 1TWHB 2E2HB 1E7ZA 3O13A 4IG7B 2ZM6L 3FKIG 1HA5A 2A74C 1C48A 1SE2A 4GOCA 4MDKE 4XGAB 1D6EC 5GAGC 3S1NH 3BZCA 4FF4A 2G1EA 3GTPH 3NY5A 4PQXA 4HIOA 1JWUD 4X65L 2JX5A 4M02A 2K75A 1E22A 3UQBA 3GTMB 1C0AA 4TUUA 1FRRA 2ZPNA 4C1NK 4A3IH 4S17A 2ZXOA 4PNYA 2IWHA 4HJ8A 2N3SA 3HOXG 3QG1A 4N9PA 1EZ6A 4RF0A 3V62A 2WXKA 1WXMA 2KD0A 2PPBC 2VQEQ 4JI0L 4R4TA 3J80L 2Z1CA 2ZXRA 1LTRD 1STEA 2F03A 2BS3B 3NS8A 4P6VF 1A3TA 5EPLA 3UDFA 1AH9A 2CFMA 5JEAJ 4K0KL 4DV2Q 3M63B 1KTKA 1YX6B 3H1UA 3DWGC 4HROA 4JX1C 2YV5A 4JI1L 3WDNA 3ULPA 4OO1H 3DBSA 4A3BB 5FO7B 2DYMA 1VF5C 5E3FA 3I4NH 4JI6Q 4DV1L 3M3YB 2NCNA 3BJUA 4HRSA 4DHJD 3LB8C 4NMZA 1CK1A 2PYKA 3VDZA 2JA5G 4ZKBB 2FMMA 1GHJA 1Z2MA 5EPJA 2HTHA 4ICVA 5CMDA 3IFDA 2FJ2A 4FDBA 3AEAB 2A19A 3VR6A 1OO9B 5BYRA 2MSED 3S9WA 4MT5A 1D5ZC 1VQNA 1CZGA 5KNCA 4LUOA 3PGEA 4B6WA 3OIQA 1ZOYB 3ECIA 4US9A 4AOFA 3VH4B 1PVOA 3HVZA 1TXYA 3NRZA 3S15B 3SEBA 3EC8A 5E6JA 4Z9CB 3FDTA 2BWES 2B2WA 2D10A 4RHRA 2DY7A 3U4ZA 4OX9Q 4GGQA 1PDXA 4K7UA 2Q8IB 3HKSA 3W1GA 2MUYA 4B0EA 5DPSA 1E7VA 4LNOA 4IJLA 4KJOA 1R7SA 2M4NA 3CSFA 2N0SB 1G51A 2KCMA 1XLOA 3TP5A 3C19A 1L2FA 3K80C 4ZRIA 4HEA1 4X6AH 2JJQA 4L23A 1E9MA 4HKZE 1T3QA 5ELCA 2IT1A 2LMCB 2BKFA 1VQEA 4IOAA 4Q5VA 2C9WB 4HPPA 5CHFA 4GLVB 1B4OA 3L0OA 4N9TA 2MH7A 2K8HA 2FCMA 1EEID 2F0UA 1STHA 1SLJA 1H4RA 1WGYA 4RKLA 1WY8A 3A4RA 5J17A 2A4ZA 4NKLA 3GD7A 3DWMA 5I9PA 4A3EB 4FJZA 4LFCL 3L7ZC 4AQYL 3ZJYC 1VCIA 2PZWA 3AE9B 4JYAQ 2DAJA 3GZNB 1RTOA 3S2HH 3X3MA 1ZE3D 2D2QA 2LGYA 2NZOA 3HOWB 3NVWA 3M4OH 2E2DC 5LMUL 1GJXA 4ACFA 1DCZA 3SVMA 3F2DA 4DV4Q 2EKEC 1N60A 1N32L 4PS3A 3X0WA 5M5XB 3J7YW 2Z0DB 5A2QE 2KLGA 4JI4L 1Q10A 1V9JA 2MBQA 2KDMA 4HVBA 3S2DH 1WRIA 3G48A 4W9GA 5D3IB 4WJWA 3D32A 5F2DA 4R4IA 5IGEA 3GTKB 2IY5B 2ZJQA 1UBQA 3ABVB 3H7PA 4ANVA 2JA8G 1JB3A 2DN8A 2F1MA 2WAQG 1LT3D 3LXFA 4USAA 1EOVA 2GB1A 3RCZA 2ONQA 3W5UB 5EGTA 5AZHA 3WANA 3FP9A 4HR7B 3MHBA 3VYUA 1WXSA 2AL3A 1O7ZA 3VA5A 3HOZG 5CX3A 1Y1VH 3SGIA 1W6KA 2G3QB 1VDVA 1QOHA 4BWGB 1SIFA 2EELA 2Q8RE 1YI2A 2RDHA 5EE3A 1W2BA 5M5WB 1ASYA 2YEPF 3OLMD 1JT8A 1MG4A 2AWOA 5KIXA 4A3DB 1EO6A 1PYBA 1GUWA 3HOVH 3CU7A 2K4KA 2IHFA 2QF7A 1L0VB 2KJRA 2WDRB 4MH8A 1PXUA 3CCUA 5IWAQ 4IDIA 3RNBC 1E2ZA 4IFDG 2CH4W 3AE1B 5C44H 3UI3A 2UYZB 2FAZA 4KY5A 2ZVNA 1TY2A 4DUZL 5K36H 3NUHB 2CQAA 1YX5B 4MACA 1N61A 2EJGC 2K1BA 3CP0A 4E71A 1ML0D 2GBNA 3T3NA 2MP2B 2L15A 4L2YA 2LS01 4DK0A 3TEXA 4OEMB 2XRQD 1ZXIA 2L8JA 3W1YA 4MNOA 1SN8A 4CJ1B 1UH6A 2RVLA 1I94L 1JE4A 2DNCA 3H94A 2XEWA 4BY7B 3D4DA 3KF6A 4CHKA 3TSSA 1X32A 1N34Q 3A4SC 1FIQA 5CGKA 4WJ3M 1CKNA 2NN6I 1BUVT 4N58A 5M3FG 2MPMA 1TWCH 3NP8A 4C3IG 3D3RA 4IWQA 2B63B 3G6JB 2JYTA 1T5XD 2K3UA 2IX1A 2KJHB 5C0XG 3I57A 4NXMQ 4DV7L 2WDTB 2RD0A 4MEMA 4A4IA 4FF3A 1YN4A 3A54A 1E3PA 1MSHA 2R93B 4JI2L 2LXCA 3H9DA 4C3JB 3D6WA 1EUVB 2CWAA 3KFUA 1XMQL 3M7NA 4LF8Q 1EY6A 3H0GH 2R2QA 1QILA 3HOUH 5BYQA 2EYLA 5IP9H 1N62A 2K5PA 3ZDMC 2SDFA 4RMFA 2GBKA 3NSWA 2LZ6A 3QC8B 1V1PA 2V3NA 4IM0A 4X3SA 4TV3A 4YIJA 4P71A 1QT9A 3Q8FA 1QOGA 2K5NA 4YCVA 3QOJA 3GTQB 2BYFA 4OL7A 3QB3A 2YTXA 3CQZB 1WYDA 3VHTC 3J81i 3TP8A 4HLEA 3C1EA 5D65A 4C3HH 2KO3A 5J39A 4QIWE 4HMIA 3SU8X 3VUYA 3PREA 3I56A 3J80c 1D3ZA 1ZXTA 5EQ0A 3GZNI 5IP7H 2SNSA 1PFNA 4DNRB 2R7ZH 1TGZB 3PV1A 4K8IA 1P7FA 2WKDA 4GDLA 2HIVA 2QSDA 3Q69A 1UE7A 4F7ZA 2F0GA 2L32A 1MKHA 4PYUA 4DR7L 1ET9A 3JW0X 2PCFB 4XTCS 3PIO3 4JGHB 4OELB 4QQBX 3M62B 3PSEB 4AYBG 1WH3A 4ULLA 2TSSA 4FXKC 4IZ8A 4Y7NB 5JOBA 4M0WA 4RA8A 3LWEA 3H3VC 1HHVA 1NMGA 1AZPA 4XQNA 3IKJA 4A3FH 4ZRJA 4H02A 1I4HA 4WFN3 1WIAA 4A3IG 4DR6L 3AEEB 4N6EB 5C3EB 1WGHA 2C7NB 4HJKA 4JLCA 3NVZA 3UDGA 1PMRA 1WOCA 3S1RH 4A90A 3P4QB 3R2IA 4UY8C 1T6BX 4A55A 2KOXA 1X54A 2PMZB 2KCTA 4V190 2FUG1 3IHPC 2ZW1A 1CQVA 4IQZA 1STYA 2F0HA 4OO1G 1K8GA 1VQFA 1CKMA 1DOKA 3PGZA 3PUWA 2HE7A 5IOIA 2LFNA 1QWYA 1CSPA 4DXFA 4AP4C 4BBSB 2HHHQ 2RMMA 3O65B 3ONSA 2Y0SB 3E0EA 3N1YC 3WCQA 4MIUA 5M3MG 1UZXB 1IGCA 4LNIA 5LNK1 2MP1A 4JWSC 4K3CA 1GNUA 2VNUD 1FRDA 3TREA 1V97A 3X23A 3I4LA 1TZ1A 4QY7A 4BXXH 1CSQA 4BY1B 2FE8A 2KTRB 3IT4B 1PFBA 1QJOA 2HD5B 3DVNV 3U4EG 4CO7A 1EYCA 3PVLA 1F0ZA 1U5KA 1TT2A 1GOZA 3K57A 3AEGB 2BS2B 2PPHA 3CCRA 3CCJA 2B2VC 5G3LD 3S14B 2R7DA 4G7OC 1EUJA 2D9UA 4XDXA 2UUAL 2QA4A 1WXVA 2DLBA 4GN1A 3NK9A 2IO0B 1I42A 2IPKD 3ERQA 5JAVA 4EFOA 4QB4A 3U8ZA 1S3OA 2J42A 1VD2A 1NEKB 3FKIB 2HT1A 2KDBA 2MHVA 3VH3B 1LTBD 2BCOA 3NWTA 4OGQC 4DR2Q 3TS0A 1SROA 3PSIA 5DM73 4P1CC 2MO1A 1EYAA 3X3NA 3DEPA 3ER0A 1QLBB 4ZK9B 4RH6A 4GKJL 2M8SA 1K3BC 1BBWA 1H9JA 3CRKC 3I4OA 4JI5L 1CM9A 4DV6Q 4HJ9A 3AE2B 2J7QB 4R8IA 1Z5SB 3MXNB 3KBXA 1S5CD 4PV1C 1C78A 3B0AA 2PVOD 5FR6A 2K33A 2OTJA 3MC9A 4HDOA 2HDMA 2K05A 1A3UA 4WH4A 1GJZA 3MJWA 1PYWD 3OYYA 4AJWA 1X3FA 4ZDVA 1KNEA 2UXCQ 4CDDC 1CA6A 1ZKOA 5C6AA 4DUYQ 5J2RA 1C4QA 1PZKD 3OPOA 1N6ZA 2AWNA 5GXGB 1Y14B 3QJYA 1JMLA 3WAMA 3P42A 1H8CA 2N78A 4KMUC 2D0PA 3HP3A 1MJDA 2BDOA 3K5NA 4IOCA 1DOIA 3MTNB 2ICIA 3JAME 1B1ZA 2F4VQ 3FMCA 3IG3A 4WQOB 2AQ1B 3UF8A 4QJFA 2A73B 2NBWB 5A2QL 1XMOQ 2AQ3B 3VRBB 3PLVA 2V4LA 1A8VA 2OXPA 1VF7A 1JOOA 4IJHA 3GE8C 4WWMA 4B3RQ 2KUMA 1PYSB 1JB7A 4A3KH 3AMZA 1RFKA 4KI0A 1EYGA 2PKOA 2HCCA 3NXWA 2KC1A 3KBGA 1HZ6A 3F1ZA 3VTUA 1WFQA 3A9JA 1U4MA 3KJOA 4DHZB 1HTLD 2WX1A 1AYFA 4JBWA 2VZAA 2F0TA 4LUZA 3HOXH 1WX7A 2IYDB 1Q90A 2JN4A 2F0OA 2M9VA 3HRZC 4G4KA 2MX2A 3E5SA 5ELFA 1BUIC 4LF5Q 1KLVA 4ZLTF 2MBOA 1PH3A 3IAM1 3BDCA 2YU9H 4YY3Q 1V1QA 2F0WA 4DR1Q 3AE6B 1HR0Q 4K7SA 1RODA 2F0LA 2KQ3A 4J15A 3J80E 2MHJA 4I6PA 5BMIA 2PW7A 2JA7B 4KY7A 1V5OA 2F0KA 2K8BA 4XX5A 1GD7A 2KHSA 4RCOA 2L52A 1HTPA 1D2BA 2LVOA 3DM1A 2L76A 3RI7C 1FO4A 3H3VI 5JHBA 1H9KA 3U9OA 1QB5D 1NJIC 4DV3L 1PFSA 2NVUI 2GVAA 3HOVG 3R3MA 3RNFC 2JA5H 3NZSA 1F2RC 2BWFA 5M5YH 1TYGB 2D62A 3A1QA 4ME3A 5C44G 4DV0Q 4R4CA 4FP5D 1U0LA 2ZCBA 4NZLB 1RHPA 4DK1A 1VQ4A 5K36G 5L37A 2JRIB 2LEKA 3EECA 2BB6A 3TJPA 4QMGA 1QCBD 2PQEA 4YHHL 3T16A 2KMAA 1JOKA 1IHZA 1VQCA 3VVWB 3KQ4A 1M8AA 5J3BA 3LDZE 4BBNC 2KFJA 4LDTB 3VUWA 1Q1EA 3E9SA 3VFKA 1RCVD 1AARA 1CFMA 5IGDA 1H9SA 2MA9B 4PT5A 3TDQA 5AJ3L 2NVYH 1A70A 2M17A 4LF7L 4DXGA 4OVZA 1MBYA 4LLGM 2WDVB 4HCNB 2MQHA 3DM3A 1PHJA 2FIDA 2PEAA 4PMWA 4RWSC 4JV5Q 2J53A 3BVGA 4ZKCB 1C4AA 2B2WC 1J5EQ 1FYCA 1M4VA 5CV8A 1CT1D 2EZVA 2Q2HA 4GMVA 2K22A 4GN4B 2B2TA 2GBRA 1EEFD 2JA9A 3APDA 1MHWC 4K2KA 3K9OB 5BMGA 1UE1A 3PUXA 4CKBA 1L7YA 3T13A 2JA8B 1UEBA 2JK8A 4WJNA 2WAQB 1VDZA 1JWAD 5EE9A 1AE3A 4NAMA 1IXRA 1SJHD 2EMSA 5GMVA 3ZVVA 4PZ8A 1ENAA 1OXUA 1F2MA 4X66L 5IP9G 4E74A 2UUBQ 4YWLA 2LXAA 2WINB 1HZ9A 3T51B 4XQJA 1QQRA 3R2TA 2RHQB 1XPOA 2QC8A 4ICUA 1ISNA 3S24A 4K5WA 4EQPA 2VQFQ 4PG3A 1SNDA 1SNQA 5E7NA 4K7WA 4EX5A 2C5LC 4TRDA 1WM2A 4C3HG 2IDYA 5M9OA 2KFKB 3AM9A 2O6VD 4LFAQ 2GBMA 1C8CA 2I5HA 1FMAD 2A5UA 2B2YA 1OXTA 5IGBA 3CCMA 5IP7G 2UXDL 4B9XA 4HAEA 5BO4B 2JWUA 1E8XA 5GAEC 2K52A 2ZW0A 3TS2A 2BF8B 2PI2E 3DHGC 5JEAG 5EE1A 2XWJB 1JWMD 2EJFC 4JPSA 3K8AA 4L6TB 2QGQA 2YLMA 3ZNGC 4KHPQ 4PS8A 1PRTD 2QJLA 5IKCM 4G7ZC 3U30A 2O5JC 4IPGA 4KIKA 1XD3B 4KZCA
chains in the Genus database with same CATH topology
4HKQA 3B2GA 1FFVA 1L5PA 4RGNA 1LTGD 2A6HC 4H44C 2BW2A 2WXFA 4RCNA 3NTKA 2EKIA 3M7GA 2AUJD 1RDPD 2DNEA 1IYUA 3P63A 4C3IB 2JP1A 4A6QA 5JVH3 1H9MA 1SXTA 3VYSA 1DD2A 2GRIA 4IURA 1JW9D 1STBA 3GV3A 1OXXK 1GPXA 1CZWA 2BA1A 2K5QA 5FLXE 2H4OA 1SMYD 5I6YA 3GTMB 1ZEQX 3TZDA 4IFDH 2D5GA 3I8ZA 1D4BA 2K01A 3T3OA 4IUPA 2JYEA 3J9CA 1ENCA 2X6GA 1DONA 1U4RA 1IBXB 5C4ZA 2L1AA 2WXPA 4D2KA 2WACA 5CBEE 2F3VA 4C2MB 5KGUA 3QWNA 3G7LA 3OSOA 2O4XA 4JK1C 5T1IA 3I91A 3MWYW 1AP0A 3AMUA 5IOCA 4Q0FA 3A8KE 1F2RI 1SNOA 1SYDA 4REZA 3AB5A 2SOBA 1EQTA 5C0XH 3ZJTA 2B8FA 2EYPA 4ZHOA 4AYBB 3S1NB 2EOTA 1AFPA 5DAUA 3GTPB 1K51A 3D4RA 4LTUA 1MHXA 1TS4A 2W3SA 1IUEA 4A3IB 4YSYB 3EQLC 5LHY1 2J4XA 2BOSA 4KKIA 1XCQL 1GB1A 1SDFA 2L9HA 1STAA 3FC4A 3SR6A 3K0YA 1TR5A 1WTRA 2QMTA 3AN1A 3JAML 4KHZA 5CV6A 3Q8EA 4FVMA 5I4DA 1YN5A 1GB4A 2WNMA 1CZPA 3I4NB 3NTHA 5AUIA 3Q8BA 4YTNB 1U4PA 1MHHE 2BE5D 2SAKA 1ZXHA 4P16A 1ACCA 4LAAA 1Y8NB 1V1PB 1L6UA 1HQRD 1F77A 5C3XA 4IUVA 3TZUA 1F9RA 3VA7A 2MJDA 3I72A 4EGVA 1WD1A 1PLFA 1NAPA 2JXTA 4WORA 3KLSX 2ACZB 3P4PB 1SBBB 4Q2JA 1NCVA 1LT4D 3MXPA 4GDLB 5C4HA 2HTME 4TSSA 3SXHA 5D14A 3BK2A 2QDBA 2B8GA 2LY7A 4B9WA 3U52E 2PO4A 5AUKA 3S1MB 1DJRD 3P75A 5EBDA 2JU6X 1X3QA 5IGCA 4OZAA 5CV9A 4IN3A 2PIAA 3NWSA 4KD3A 2FBWB 4IALA 4IOIE 3FVQA 4H7BA 1EL0A 1ESRA 4DFAA 3OWEB 1V8CA 3AU7A 3S2HB 3KK7A 1FD7D 2RBMA 2VXWA 2W82A 4YTMB 2I07B 2KQ4X 2C9OA 1F9QA 2RSOA 1L6VA 2Y5PA 3BG3A 3HGBA 1QOFA 3QO2A 3SDZA 3OWFA 2F4IA 3BK1A 2K04A 2CJOA 1LT5D 3R93A 1FCCC 5C3JB 3D31A 5DEHA 2A6ED 3N9YC 1J9OA 3FPPA 4IKGA 3OMGA 1HPCA 1Y1VB 1I7HA 2GI9A 2INPE 2OHFA 4X3UA 3L4PA 1ILPA 1R4PB 3M85A 2RA4A 1YNNC 2F0SA 2H89B 3TP6A 1TS3A 4KKUA 4DAYA 4H13C 3HOVB 4OO1I 3VRAB 4ME5A 4XWWA 4RAUC 2W55A 1PZID 5C44B 1XWEA 2F0IA 4ODGA 1GAQB 3C8YA 3GB1A 4CKEA 5C5LA 5CORA 4YSZB 1ZDVA 3DWAA 1MI2A 1C79A 2K03A 3K58A 3AE7B 2M56B 1TWCB 2NTSA 5BYSA 1NI3A 4DGZA 5CV7A 4HMJA 2EYMA 1JRPA 2XVSA 1C9FA 2E74C 5FLXL 2PLPA 3Q23A 2WP8J 3NE5B 4C56C 2ZT9C 4C7ZA 1N5WA 3V2TA 3H0GB 1TS5A 4DU9A 3HOUB 3KUPA 1TU2B 3IT6B 4PMCA 2M2LA 2PZTA 3V96A 3AE3B 5MPOA 3VR5A 4XWTA 2PMVA 2R6GA 2YYZA 2IX3A 4HSVA 2QKIC 4C3HB 3A8IE 3H8HA 1SE4A 3OMCA 1FFUA 2N9LA 1O7LA 2N7JA 3D8GA 1SYCA 3NTIA 2R7ZB 2F0JA 1L0XB 4E6IA 2EPBA 2KJXA 3TP7A 2INNE 1LTSD 3IAYA 4OZBA 2BA0A 1GXDC 1F2LA 1LTID 4RHSA 4J6HA 2IGGA 1EYDA 5HFYA 2LUMA 2B2TC 3GO5A 1XLNA 4A3FB 1EY0A 5G5GA 4ARCA 4XYOA 1HRJA 1H9SB 5CV5A 1N63A 2OT2A 3S1RB 1Y8OB 3HZXA 1XCTL 2K6AA 3U2SC 3Q8AA 3BVMA 1QG7A 3H6MA 3SE0A 4ARIA 4ZHPA 5I6WA 4A8XC 1KDAA 3QIAA 4K8JA 1LACA 1EY7A 5IODA 5JEAH 4L63B 1XTCD 2B2YC 1RF2D 3KLSA 2CU3A 3CHBD 1FNVA 1S5ED 2JE6I 1DM0B 4KGSA 5BMHA 2JXMB 3AH7A 4ABNA 3LYYA 5HGTA 2FMCA 3B2FA 1E2WA 2M0AA 3P7JA 1IGDA 3B9JA 1D5XC 2V0GA 2K32A 3PUVA 2WXJA 2EY5A 2IL8A 3MXGA 2JEBI 2X6LA 1DGJA 2OEDA 1SYBA 1ESFA 2I46A 1LLRD 3HG9A 3EJIA 4KKJA 5EJWA 5KYIA 4FF2A 4XDCA 4QCLA 3H91A 1PTOH 2EDGA 1RWSA 1MI0A 3AB9A 1J7AA 3NVYA 1QOBA 1O78A 3HS0C 3AEFB 4RGTA 1MSGA 2ENBA 1FXAA 4K6LA 5E4WC 3A55A 4J8QA 1DXMA 3WOEA 5HG2A 2NWGA 5DNFA 2ZXPA 5J1ZA 4DN4M 2R3ZA 4ZQ3A 2V4DA 1B9MA 2LFIA 1YMHE 3CWIA 2E75C 3RFZB 1V43A 2HQEA 4R9WA 2LMCA 3ONAB 4A3KB 4HTHA 3RD4A 4KX6B 2L83A 1BCPD 3RLFA 1WTWA 3BYYB 2Y5CA 1STGA 2C5CA 2JYOA 2KCNA 5BN4A 5IGGA 1K50A 2WKCA 3R8BA 3HOXB 1BOSA 3H09A 4HN7A 1FNWA 2D5DA 3DWQA 1EQVA 2A69D 1SNCA 2KVMA 2YU9B 5CV4A 1C76A 4HSPA 2EE1A 3V05A 2LHEA 2F0NA 2KMMA 5I9OA 3A7AB 1F9PA 3Q0AA 1G291 1SNMA 1UNSA 1UWXA 4DAPA 2RDGA 4FYDA 2WP9B 2JA5B 1HFGA 5M5YB 2E3TA 1U9RA 1JORA 1NR2A 2KA7A 2NMQA 3NHHA 5BN3A 5CYUA 1ZYRD 1E0BA 2DYOA 1UEAB 5LL6X 1E0ZA 1PRTF 4GDKB 1O7YA 1L4DB 3MJ5A 1JALA 1GUOA 4EE2A 4FNFA 4MHEA 1GHKA 2NVYB 3GP7A 1JC7A 1KFYB 3AE4B 2B39A 1DOMA 1TIID 5TSSA 4HCEA 1EY8A 2HCIA 5FOBB 4CQNA 1FEHA 1WSPA 2JZPA 2O2LD 2WLBA 3MHZA 4RFBA 1HA6A 2LHDA 3MVVA 3A7LA 3EROA 4HEDA 4XQQA 3KWLA 1WWTA 1YJJA 1VMPA 1U4LA 4C80A 2CHBD 2B76B 1NUCA 3T53B 2G9HD 3C1FA 3DMUA 3K5OA 2BB5A 3MAQA 1X3PA 3VQIA 4LK0M 4F7XA 1EWYC 1CJEA 3C3LA 2WXIA 3UI2A 4AS1A 1L4ZB 1F9SA 2V4IB 2E76C 3S17B 4KKTA 4RF1A 4U673 3HOZB 2EJMA 2WXHA 2PTLA 1FD6A 1SNPA 4KGTA 1DYQA 4A9AA 4H0LC 2A69C 1KDCA 1FR3A 2O5IC 1KRHA 4ZOHC 3VR8B 1QF6A 3I9V1 4FXGC 3MXUA 1Z47A 2QIEB 1VZ6A 2IX0A 3PZ7A 1KNAA 2AX5A 1ZPSA 4YTPB 1CHPD 1SSOA 3I70A 1NR4A 5E1FA 3DWPA 5KYLA 3N6RA 3GTOB 1ICWA 1ZYRC 2QILA 4IUNA 3MZ5A 5M3FB 1AWDA 2VUMB 1EY4A 3GS2A 2DBYA 1H9RA 2SNMA 3MTSA 4CKCA 2F0QA 1TWFB 4EQOA 3PV0A 2WXNA 3KLRA 3AE5B 2W3RA 2BYTA 1OXSC 3TEYA 1EIHA 3C46A 1Q1BA 5KNBA 4KN7C 1RM6C 1A15A 4K5XA 4KHVA 1YN3A 4NZLB 1AW7A 5I2XA 2WXLA 3FAHA 3WOFA 3J81E 2V3PA 1NENB 2Z4HA 5EKKA 5I2YA 3GTGB 4J3OD 1KLUD 2K5WA 5CC4A 2IGDA 3V3XA 4TKOB 1EY9A 1GUNA 2NUCA 1SYEA 4CJ2C 2NB0A 1CTMA 3MXNA 2B2VA 3HKZB 2JA6B 3SK6A 3TBIB 2WXMA 4LMQD 1MPEA 2WXRA 4K6DA 1D1KA 1TWGB 4TQ1A 3FPUB 1STNA 2F3WA 4NDXA 1TS2A 1S5FD 2KOLA 4U68A 4IUQA 2RSNA 2E2JB 1KH0A 3TUOA 4FF1A 4S3SA 1QKZA 1K8OA 4ZRPA 2K9XA 4QF4A 5C4JB 3PZ8A 1YNJD 2WQYB 3MC0B 4RKBA 3HUIA 1BR9A 1RTNA 3Q24A 1I4PA 2EY1A 1V8QA 4B08A 4BS9A 4IFDI 3TMEA 3SR1A 1MD2D 5M3MB 2M19A 2JSOA 3BDOA 4KV6A 1DOYA 3VYRA 3PO3B 3HRDD 1PRTC 5A35A 1Y56A 2E6XA 5HI1A 2F0VA 1A2UA 4GZYC 2WIIB 3NBIA 2VB2X 3FILA 3EGRA 3PUZA 4O1NA 1UAPA 2KN4A 1PZJD 1F2YA 1SYGA 5C5MA 1B50A 2QEJC 5C0XI 4DAVA 1B9NA 1PRTB 4ZRZA 1VJKA 2E2IB 1ONLA 3RPFC 4F8MA 1PGAA 2SEBD 4NW2A 2F0PA 1TKWB 1SMYC 4H2AA 3MFYA 3VR4A 1SIJA 2CVRA 5FO8B 4G7HC 1ROEA 1B2TA 4KK7A 2JEAI 1G2SA 1WGKA 5JXVA 1NSNS 2KCCA 5CBAE 2HDLA 2XIWA 4X3TA 3K6OA 2XSCA 2Q5WD 1HFNA 4K5VA 4OIKA 2Z8LA 2Q8TA 3GTLB 3ZJVA 5EPKA 3M4OB 1YQ4B 2PNRC 1I6VC 5EKLA 2BT6A 5NUCA 4ZYSA 4ZAIA 3W1SA 1LT6D 2F0DA 1GUSA 4C1NI 3S2DB 2WS3B 1HQMC 2MEKA 3TN2A 1YNTE 3ZJUA 4RGMA 3KWVA 2K7VA 1PTOD 1CI3M 1DZ1A 1EM7A 5IT9E 1SAPA 2OEOA 1B9RA 2KEDA 1WXQA 5T8IA 1KDBA 3SFDB 1SE3A 3KF8A 1TQOA 4ILWA 1I6HB 1RYJA 1G8ZD 4EVOA 2W54A 3J7AV 1YNJC 1V1OA 2R61A 1XEEA 3I3CA 4CJ0B 2EY2A 2L4NA 2FFKB 1JICA 1EFID 3URYA 1Q3LA 2F0MA 2BE5C 2RKSA 3NBHA 4O42A 3K7AB 3Q8CA 4R3DA 3GV6A 2NN6H 3M4YA 3EUB2 4IUUA 1IW7D 2DWQA 2PW5A 3PO0A 1PGBA 1WTOA 4KKSA 5COYA 5FK9C 4IUTA 3SK5A 4K14A 1O80A 5ISRA 1VRAB 3AV8A 1J7BA 2ON8A 3MP9A 1II3A 4C7YA 1ZUD2 2WB1B 4P2CB 3OHXC 2TMPA 4KTAA 1WVLA 1CQFA 3PUYA 2MJEA 3IL8A 1LV9A 1XXGA 3RUZA 5CR3A 4DF7A 5E4XA 1GUGA 5LL6S 1IBXA 3I73A 2A68D 4KN4C 1AZQA 2HUGA 3L9AX 1XYIA 3ETRA 1G2TA 3J81L 4HJGE 1LO5D 2J7ZA 1WTVA 4A93B 2L5TA 1ZP0B 1PDQA 3AEBB 1S5DD 1XLQA 3LWUA 1RD9D 3LNNA 2NBFA 3P4RB 1VZ8A 5JPNC 3K5MA 5FKAC 2EY6A 1C4PA 3T4AC 2X69A 1JQYD 2B2UA 1EU4A 3BWUD 4F88A 3P1MA 2GA4B 5H8YE 2IJ0A 3E6ZX 5G3LF 3FRPB 2LGIA 2WXQA 1C4CA 1EU3A 1A2TA 2K5DA 4DNTB 1EZ8A 3P1HA 4KY6A 3HEJA 2RPVA 3MEHA 1ENFA 2BTEA 1PTOC 1VMCA 1AEXA 2X38A 1BCPF 2EYFA 2LKVA 4CGYB 1BO0A 1I4QA 2AUKA 5EBCA 1SF0A 2A6EC 2Y3AA 2I38A 1GUTA 3DUZA 1TKEA 2PW9A 3U7ZA 3PIP3 5JVG3 1PGXA 1S4ZA 1KF6B 4X3KA 1QNUA 2I2YA 2FHTA 4HCSA 1PTOB 2XN9C 1I3QB 3MA2B 2F0EA 4XXEA 4LJZC 1FGBD 4XT1B 1OXVA 4KD4A 1TKGA 3NQTA 3BIID 3VR2A 1XLPA 3A8JE 1OQRA 2N88A 2BS4B 3F2UA 2WXOA 1IW7C 5JPMC 4A3JB 2KACA 4XIGS 5T1GA 1JQ4A 1QNKA 1G91A 1HZ5A 1TJEA 3R3OA 2NVTB 3TEZA 1DOLA 3T56B 3BZDB 2MJ3A 1NYQA 4R8NA 4I7ZC 5IIFA 3L3OC 3SK4A 4XYQA 1JROA 3IXSA 2EYJA 4MM3B 4MN3A 2H1EA 3GTJB 4OZCA 1Q8IA 4YT0B 3K59A 2F0FA 2A5HA 3W9CB 2ICEC 2A68C 2EXZA 2JSVX 2IGHA 1R4QB 5G5HA 2HDEA 1SYFA 2L11A 1MGSA 1G6ZA 3PMFA 1SJED 3NS1A 1OFFA 1I4GA 3BVZA 4BA1I 3LX0A 5K5PA 1RKNA 3CKIB 1J7CA 1SFOB 1HUMA 4ID6A 1BXTA 4G57A 3IFTA 3A56A 1VLBA 5IT9L 1S5BD 1JWBD 1ILQA 3W5VB 3CRLC 4IFDJ 4TMAB 5EKIA 3HOYB 1FM0D 1XX8A 5KEEA 2JQRB 4RGOS 4YXDB 2OF1A 2IW3A 1WD0A 4L1BA 2CW0D 3W2DA 5EE0A 4ITKA 3Q6SA 1PFMA 5IGFA 4YSXB 3I4MB 1WTPA 2VB3X 1IKMA 2PZUA 2XNAC 1FCLA 4FXCA 1BMLC 3AE8B 1QOAA 3QOLA 2EYOA 3DXJC 2K0PA 2N9KA 2K28A 1FXIA 3NVVA 3NQIA 2XRSD 5C0XJ 2WDQB 1WCMB 1IYVA 2G9DA 1PUTA 3BDLA 4CHTB 1W6JA 1D5MC 2NN6G 5FO9B 1JOQA 1VZ7A 4DA2A 3P20A 4PMBA 1TWAB 4YWGG 1VR9A 1E10A 3EA6A 1TY0A 4I65A 1F2ZA 3VR9B 2WV6D 3EFXD 3BYTB 2A6HD 3ZQ4A 2WU2B 1Z7TA 4FO2A 1LABA 1PFDA 3ZYYX 2MGSA 2M00A 1I4XA 4M1UB 4WAFA 3EVQA 4WQMA 1OQQA 2EYHA 1K52A 5D7GA 2KAJA 2J0TD 4NP5A 1LTAD 1HUNA 5DM63 1EY5A 3S1QB 5FR3A 1B53A 3MFGA 1UGJA 2QCPX 3FILB 4ZRQA 3FEWX 2L0CA 1WYGA 2ID0A 1A6XA 2R92B 2BDNA 3E0JA 1HCZA 1TKYA 1IL8A 1EWHA 4US8A 5C3WA 3NPPA 4K2LA 3SK8A 4QUFA 2YEPB 5KRUA 5KNDA 1TVXA 1E2VA 1SEBD 1Q12A 4QUCA 3NUCA 4CBVA 1K8MA 4RNAA 1K83B 3K5LA 3VR3A 2NYZD 2WU5B 1Y8PB 1BCPC 2D2CC 4L8JA 4WRDA 3W3AA 4NAWB 2RQXA 2VZKD 1J8IA 4OHJA 2PVGC 1XO3A 3C2PA 4EQNA 3ND8A 1D1IA 3OW7A 1YJIA 2WXGA 4ZUJA 1Y69U 1K53A 4TQ0A 1AN8A 2EVBA 4B0MA 1UUPA 2CW0C 2BBCA 4OW0A 2KECA 1BNZA 1BCPB 4AQ7A 3P4SB 3D4WA 3OIPA 2L12A 2NVXB 3IAS1 3VYTA 4F87A 5J22A 4M8AA 1E7PB 1IKLA 3DHQA 3Q22A 1NVID 4XT3B 3RZDB 3CIRB 4TQUS 4DQOC 4UAIA 5HURA 1JR0D 1TZOA 4J1MA 5HHDG 3NZ3A 5BN5A 1WTQA 4BA2I 1A3VA 3ND9A 4A3GB 5D3DA 4ZUIA 1ZDXA 3AECB 1XF5L 3PO2B 2MJ8A 1Y1WB 4C3JG 1RJTA 1QE6A 3U9SA 1HEZE 4KJNA 3S16B 1BQQT 1DOXA 1B44D 3SHLA 1I4RA 3J7AF 4UDUC 3ITPA 2RDFA 4JE3B 3TEWA 1EOTA 1BBXC 1T5EA 2NVQB 3N52A 1CA5A 1SSNA 4V0BA 1YQ3B 4N59A 1SB3C 4LK1C 1BDOA 2L1BA 1N5XA 3RMHA 2FINB 1HXYD 1B3AA 5ELEA 1EWCA 1BF4A 3D6CA 2Z4IA 1UWMA 2N55A 4QIWB 1R9TB 3I90A 1Z6HA 2H88B 4XDDA 2AQ2B 3AEDB 2B2UC 2NZ1D 1P7EA 2KEEA 4GLSC 3BS1A 1E6EB 5ELBA 2KWDA 4OIJA 1JCKB 3DEOA 1FNUA 1PTOF 4WIPA 1WTXA 1CHQD 4BBRB 5C2TB 1EIGA 3GQBA 2XWBB 3SFEB 1JWSD 5JJZA 2LJIA 5H92C 3OOCA 4KGRA 1LTTD 5C4XB 3ZGZA 4WURA 1KLGD 4NJCA 2L55A 2VZKB 5AFWA 5ELDA 1KAAA 1L0YB 3E56A 4A3MB 1ET6A 1C77A 1YNND 1KABA 1I50B 2DY8A 1NYRA 2NTTA 3RZOB 2J52A 4XE0A 4FXDA 1MVKA 1TWHB 2E2HB 3O13A 1HA5A 2A74C 1C48A 1SE2A 1D6EC 2G1EA 4FF4A 4PQXA 1JWUD 2JX5A 1FRRA 4C1NK 2ZXOA 4PNYA 2IWHA 3QG1A 4N9PA 1EZ6A 4RF0A 2WXKA 2PPBC 3J80L 2Z1CA 1LTRD 1STEA 2ZXRA 2F03A 2BS3B 4P6VF 1A3TA 5EPLA 5JEAJ 1KTKA 3DWGC 4HROA 4JX1C 3WDNA 4OO1H 4A3BB 5FO7B 2DYMA 1VF5C 5E3FA 3M3YB 4HRSA 3LB8C 4NMZA 1CK1A 2PYKA 4ZKBB 2FMMA 1GHJA 5EPJA 5CMDA 3IFDA 2FJ2A 3AEAB 3VR6A 1OO9B 5BYRA 3S9WA 4MT5A 1D5ZC 1CZGA 5KNCA 3OIQA 1ZOYB 4US9A 3HVZA 3NRZA 3S15B 3SEBA 5E6JA 4Z9CB 3FDTA 2B2WA 4RHRA 2DY7A 1PDXA 2Q8IB 2MUYA 4B0EA 4KJOA 1R7SA 2N0SB 1XLOA 3TP5A 4HEA1 4L23A 1E9MA 4HKZE 1T3QA 5ELCA 2IT1A 2LMCB 4Q5VA 1B4OA 4N9TA 2MH7A 1EEID 2F0UA 1STHA 4RKLA 4NKLA 3GD7A 3DWMA 5I9PA 4A3EB 3L7ZC 1VCIA 2PZWA 3AE9B 1RTOA 3X3MA 1ZE3D 3HOWB 3NVWA 2E2DC 1GJXA 1DCZA 3SVMA 1N60A 5M5XB 3J7YW 5A2QE 1Q10A 2KDMA 1WRIA 5D3IB 4WJWA 5F2DA 5IGEA 3GTKB 3ABVB 1JB3A 2DN8A 2F1MA 1LT3D 3LXFA 4USAA 2GB1A 2ONQA 3W5UB 5EGTA 4HR7B 3MHBA 3VYUA 1O7ZA 3VA5A 1W6KA 1VDVA 1QOHA 4BWGB 2EELA 2Q8RE 2RDHA 5EE3A 5M5WB 2YEPF 2AWOA 5KIXA 4A3DB 1GUWA 1L0VB 4JWUC 3CU7A 2QF7A 4MH8A 2WDRB 1PXUA 4IDIA 1E2ZA 4IFDG 3AE1B 3UI3A 4KY5A 1TY2A 5K36H 3NUHB 2CQAA 4MACA 1N61A 2EJGC 2K1BA 1ML0D 3T3NA 4L2YA 2LS01 4DK0A 3TEXA 2XRQD 1ZXIA 4CJ1B 2RVLA 1JE4A 2DNCA 3H94A 4BY7B 3D4DA 3TSSA 1X32A 1FIQA 5CGKA 2NN6I 1BUVT 4N58A 2MPMA 3NP8A 4C3IG 3D3RA 2B63B 3G6JB 2JYTA 1T5XD 2K3UA 2IX1A 5C0XG 3I57A 4FF3A 1YN4A 3A54A 1MSHA 2R93B 4C3JB 3D6WA 3M7NA 1EY6A 1QILA 5BYQA 2EYLA 1N62A 2K5PA 2SDFA 3NSWA 1V1PA 2V3NA 4X3SA 4YIJA 1QT9A 3Q8FA 1QOGA 3GTQB 3QOJA 4OL7A 3CQZB 3QB3A 3TP8A 3C1EA 5D65A 5J39A 4HMIA 1ZXTA 5EQ0A 2SNSA 1PFNA 4DNRB 4K8IA 1P7FA 2WKDA 3Q69A 2QSDA 2F0GA 2L32A 1ET9A 2PCFB 4XTCS 3PIO3 4ULLA 2TSSA 4FXKC 4IZ8A 4Y7NB 5JOBA 4M0WA 4RA8A 3LWEA 3H3VC 1HHVA 1AZPA 4XQNA 3IKJA 1I4HA 4WFN3 4N6EB 3AEEB 5C3EB 3NVZA 1PMRA 4A90A 3P4QB 3R2IA 1T6BX 4A55A 2PMZB 4V190 2FUG1 2ZW1A 1CQVA 4IQZA 1STYA 2F0HA 4OO1G 1DOKA 3PUWA 2LFNA 1QWYA 4DXFA 4BBSB 2RMMA 2Y0SB 3WCQA 4MIUA 5LNK1 1IGCA 2MP1A 4JWSC 2VNUD 1FRDA 1V97A 3I4LA 4BY1B 2FE8A 3IT4B 1PFBA 1QJOA 3U4EG 1EYCA 1F0ZA 1TT2A 1GOZA 3K57A 3AEGB 2BS2B 2B2VC 5G3LD 3S14B 4G7OC 2D9UA 4XDXA 2DLBA 3NK9A 2IPKD 3ERQA 5JAVA 4QB4A 2J42A 1NEKB 3FKIB 2MHVA 1LTBD 2BCOA 3NWTA 4OGQC 5DM73 1EYAA 3X3NA 3DEPA 1QLBB 4ZK9B 4RH6A 3HVDA 1H9JA 3CRKC 1CM9A 3AE2B 4R8IA 3KBXA 1S5CD 4PV1C 1C78A 2PVOD 2K33A 2HDMA 2K05A 1A3UA 4WH4A 1PYWD 1KNEA 1CA6A 1ZKOA 5C6AA 1C4QA 1PZKD 3OPOA 5GXGB 2AWNA 3QJYA 1JMLA 3P42A 4KMUC 3HP3A 2BDOA 3K5NA 1DOIA 2ICIA 3JAME 1B1ZA 3FMCA 2AQ1B 2A73B 5A2QL 2AQ3B 3VRBB 4WWMA 2OXPA 1VF7A 1JOOA 2KUMA 3AMZA 1RFKA 4KI0A 2PKOA 2HCCA 3NXWA 3KBGA 1HZ6A 1U4MA 1HTLD 1AYFA 4JBWA 2F0TA 1Q90A 2F0OA 2M9VA 3HRZC 4G4KA 3E5SA 5ELFA 1BUIC 4ZLTF 3IAM1 3BDCA 2F0WA 3AE6B 1RODA 2F0LA 2KQ3A 3J80E 5BMIA 2PW7A 2JA7B 4KY7A 2F0KA 2KHSA 4RCOA 2L52A 1HTPA 1D2BA 1FO4A 3DM1A 1H9KA 3U9OA 1QB5D 1F2RC 1TYGB 2D62A 4FP5D 1RHPA 4DK1A 5K36G 2LEKA 2BB6A 4QMGA 1QCBD 2PQEA 3T16A 1JOKA 1IHZA 3KQ4A 1M8AA 1Q1EA 3E9SA 1RCVD 1CFMA 5IGDA 1H9SA 4PT5A 3TDQA 1A70A 4DXGA 4OVZA 1MBYA 4LLGM 2WDVB