3BZDB

Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
234
structure length
234
Chain Sequence
SQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVWWHGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T cell receptor beta chain 8.2
publication title Manipulating the coupled folding and binding process drives affinity maturation in a protein-protein complex
rcsb
source organism Mus musculus
molecule tags Toxin
total genus 56
structure length 234
sequence length 234
ec nomenclature
pdb deposition date 2008-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3bzdB02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3bzdB01
1FNWA 3BYTB 1DJRD 1ET6A 1CHPD 2NTSA 4RCOA 5FK9C 3O13A 1LT3D 1PTOB 1SE2A 1I4PA 5ELEA 4L63B 1BXTA 3R2TA 5ELCA 1CQVA 4L6TB 1EEFD 1PZKD 1SE4A 1I4GA 1AW7A 1LTTD 1LTAD 1PTOF 1ESFA 3V05A 3BYYB 2WV6D 1PZID 1TS3A 1ET9A 1F77A 1LT5D 1HQRD 1PTOH 2NTTA 1S5DD 2G9HD 1PTOC 2RDHA 4RGOS 4NZLB 4K6LA 2SEBD 2AQ2B 1JR0D 1UNSA 1JWSD 1BCPB 1CT1D 1JWMD 1XTCD 1PRTD 1HA5A 3GP7A 4UDUC 4O1NA 1PZJD 2CHBD 1FNUA 1TS4A 3BVGA 1BCPF 1RCVD 1YN5A 4BWGB 1HXYD 2IPKD 2TSSA 1D6EC 1D5ZC 5ELFA 3TSSA 1I4HA 1SE3A 1I4RA 4RH6A 1RF2D 1BCPC 4DXFA 1RD9D 3R8BA 1S5BD 1LTSD 1I4XA 5ELDA 2XRQD 4RHRA 5ELBA 1M4VA 1PRTB 1B44D 1JWUD 1PYWD 1XXGA 3MC0B 4RGTA 4TSSA 1SJED 2AQ1B 1EU3A 1SEBD 3MFGA 1EWCA 1KLUD 4OHJA 1L0XB 2Z8LA 1SJHD 1V1OA 1S5ED 1D5MC 1JQYD 1V1PA 1PRTF 1TY2A 1SBBB 1EFID 5FKAC 1TS5A 3DWPA 1D5XC 1TY0A 1QILA 3EA6A 1B1ZA 1SXTA 4Z9CB 4RGNA 3W2DA 1S5CD 1PRTC 1FD7D 1L0YB 2RDGA 2XRSD 1YN4A 2AQ3B 5D3IB 2IJ0A 1PTOD 3BVZA 3URYA 3KLSX 1LTID 2XN9C 4ZYSA 1LO5D 2J4XA 5I4DA 1I4QA 1FGBD 1KLGD 4C56C 4DXGA 1EEID 1ENFA 5TSSA 1CK1A 2ICIA 1MD2D 1HTLD 1LT6D 1UUPA 1LTBD 2R61A 1GOZA 1FNVA 1S5FD 3BVMA 1LLRD 2QEJC 1AN8A 1CHQD 3EFXD 2QILA 1BCPD 1TS2A 3SEBA 1LTGD 1V1PB 1EU4A 1KTKA 1YN3A 1RDPD 3OWEB 1LT4D 3DWQA 2O2LD 4RGMA 5D3DA 4RHSA 1STEA 2XNAC 3DWAA 1T5XD 1JCKB 4RFBA 3BZDB 3R2IA 3CHBD 1LTRD 1G8ZD 1DYQA
chains in the Genus database with same CATH superfamily
1HNZL 3TP5A 4P74A 2NVQH 2K5NA 1N6ZA 2N7DA 5E4WC 1DONA 3O13A 3T8MA 2EJFC 3R93A 2IO2B 4ZUIA 2A5HA 5JJLA 1VQGA 4A3FB 1C7YA 3DQVA 1HNZQ 3VVWB 1IYVA 2EKEC 2WXRA 4AUQC 4DR7Q 1KIXA 1TWCB 1F9SA 4N58A 2K9XA 2F0MA 1QZHA 1V86A 2HDEA 3U52E 1KLVA 1GHJA 2UXDL 5JOBA 3MWYW 2BE5C 4DHZE 2Z0SA 1DZ1A 1NVID 2JPHA 1PZID 1L1OB 3UE0A 2D5DA 4AJWA 4DF7A 1OGWA 4EKUA 1XCQL 3AMZA 1Q1EA 4EEWA 4F8CB 3QK0A 3KVFB 1CM9A 3DBLI 1WFQA 2XK5B 2F0GA 3VA5A 4KLKA 4XDDA 1VCIA 3W1YA 5JHBA 2FIFA 1WH3A 1JWMD 2BKFA 2MX2A 5GQOA 4AYBE 3IVFA 4AP4C 5DPRA 2ZJPA 1TZ1A 5E1FA 1WR1A 4WQOB 1FVIA 3KDFA 2JU6X 1UEAB 4US9A 1EUVB 5BMHA 3WIMA 4ZKCB 3GTJH 1NJIC 2WQYB 3S2AA 3DHIC 4FLHA 1T9HA 2KVMA 1Q8IA 1X32A 3HOYH 2NS5A 4LFCQ 4DHZB 4PNYA 1D4BA 3R7QA 1LTSD 3I90A 1TJEA 1TWAH 2PIAA 3N1YC 5G3LF 1X56A 1L0VB 2LD9A 1D1IA 3AYHB 1OXTA 1U4RA 3DCGA 3TJPA 4GS3A 4L1BA 3WALA 1MJCA 1VR9A 2K8HA 4OONA 5IP9G 3JAME 2C9OA 2M0AA 5KYIA 3B6YA 2N78A 4L8JA 4AYBB 4JI3Q 3TEZA 1B1ZA 1VMPA 1YJ9A 1G51A 5H1SE 4PT5A 1HJPA 1HZ5A 2L15A 3HOWH 1EF1A 1EO6A 1WF9A 2UUCL 2J7QB 2JZPA 2PJHA 1NI2A 2WU2B 4OZAA 3DHHC 4QGUA 2IJ0A 4A3EG 1A3TA 4J8QA 1XJVA 5JJIA 3KLSX 2WNMA 5IYDH 1VQ5A 1MJEA 4FXKC 3K7AB 2R2OA 1I4QA 1EYCA 2SDFA 5JHAA 4B3TQ 2KT7A 3W3AA 2ZJDA 1UE7A 3ULPA 3OOCA 2K8BA 4K7SA 4EQNA 2EOTA 4FF3A 2FNJB 2KWCA 4BBSG 1K3BC 4LDTD 1KC8C 1K73C 1SYFA 4GLAC 5M3FB 2A19A 3M3JA 2L7RA 4YTNB 2A6HD 2KFKB 1W2BA 3UQAA 4EOYA 1CZWA 2KDMA 3S24A 3ICEA 3AE8B 2Z9HA 2K6AA 3KF8A 5CV7A 2G4DB 4FJZA 4UP9A 1TWGH 2KWVB 2L12A 1EQQA 3QOLA 4TKOB 1IYJB 3PCOB 1YJ1A 2IHEA 1LYLA 2N7EA 1RFAA 2ZNVC 1YQ3B 3ZW3A 5NUCA 2XTIA 3L10B 2JA7H 1X9NA 2GN5A 4FXDA 3K5OA 4IN3A 5C0XG 5CV8A 1VZ6A 2WAQB 2CJOA 3IFTA 3W1SA 1D8LA 4OX9Q 1EY4A 3D31A 3I73A 4XDXA 2NR2A 5AZFA 1CA6A 2JYOA 4JWSC 4DN4M 5DNFA 4A8XC 5JEAG 3JVZX 4JI2L 1RLFA 4CYEA 3A4SC 3NELA 2KUMA 3HKZG 5CHVC 3M9BA 2WB1G 1XO3A 1YQ4B 2BH8A 3EVQA 2OWOA 1IUEA 2DZMA 2ZPNA 3JYUA 1LGRA 4PZ6A 1FGUA 1KD1C 2IX1A 4TMAB 3VA7A 2BYFA 1S5DD 2L8JA 4LLGM 1TIFA 3VUXA 4BZAA 4MJSA 5I2YA 3Q2AC 1K0SA 4G3XB 4CQNA 3IL8A 1C1YB 1LFDA 1K0RA 3NBHB 3H9DA 4C1NK 4F87A 1JE5A 4ZUJA 3GTMB 4HEA1 5CTRC 4FA6A 4DR4L 5IWAQ 5JVH3 3KK7A 4LNNA 4HCPB 4A3BB 4RCNA 2RDFA 3R3OA 1YN5A 2MBEA 1U4MA 2HE7A 2FMMA 4EX5A 2TSSA 3HIZA 4DR4Q 4J6HA 4A3LG 5K36G 2L1BA 3AM9A 2KEDA 1E90A 1WGYA 1XX8A 1XPRA 4DV6L 1TWHB 1BCPC 4A3GB 4X3SA 2RSNA 2FFKB 3J81j 2AUKA 1VQPA 4GKJQ 1RYJA 1AP0A 2RQXA 2SOBA 1ILQA 1PRTB 1UBIA 3QCAA 3EROA 2UU7A 4AQYL 1YMHE 2MSED 3S17H 4EGVA 5C4XH 2MW5A 1YI2A 2DY8A 1A0IA 4DV6Q 3AE2B 3U2SC 3NENA 4DFAA 3E3XA 4MTKA 1QUQB 4MACA 3VTVA 3V62A 2VQEL 3B1LX 4K1RB 3LB8C 1EIFA 4K7UA 2XEWA 4YL8A 4BFRA 5C5MA 4AQYQ 1MG4A 3W1BA 4ANWA 1KQSA 3IHPC 1S5CD 3STBC 2KFJA 2VQEQ 3FPPA 1Z5SB 2CVRA 1XQQA 4I7AA 2K28A 3OPOA 2RKSA 3X3NA 4XQNA 1E7ZA 4C3HH 1I94L 1SNDA 1JOQA 2AX5A 2J4XA 4CHKA 3K5MA 4C3IG 2C7HA 4MSQB 1F9QA 3OJ4B 4OZCA 1SB3C 2JYTA 1KAWA 1PYSB 5BYQA 1OEYA 1K8RB 1P0RA 1VLBA 2K5DA 1I94Q 1P1AA 5D7GA 1MD2D 1GC7A 2R61A 4IM3A 5M3MG 2PLPA 3HK0A 5KNCA 3P2BA 4P1BC 2PCFB 5HGQA 3P4PB 3I8ZA 5EPLA 2I2YA 1OQRA 5D2MB 2RSOA 3V60A 4QL5A 1EFWA 4IUUA 2P5ZX 3DWQA 1IPGA 1IGCA 4NJCA 3LJ3A 3FHWA 3K9PB 3ERSX 3CIRB 3SE0A 3I4NB 1IBML 3NXWA 3H7PB 3W9CB 2LMCB 3R2IA 1PFMA 3J80E 3B2FA 2L5TA 3CCMA 1YJNA 4WJ4A 1YNJD 3L16A 1DYQA 3S1NB 1MHHE 4J1MA 3DXJC 1NDDA 4F88A 1IYUA 1D2BA 4EUTA 5CGKA 2PMZE 1JRPA 3J80L 3ND9A 3M4OH 3RLNA 4XIGS 1R9TH 3C0RB 4HPLB 3H1UA 5C1ZA 5ELEA 2V3NA 5BR8L 2NN6I 3A7LA 4L63B 5AFWA 3R2TA 1GUAB 2Y5BB 4LNFA 3RD2A 2KACA 1EOTA 3RZDB 3B0AA 3JAMc 3KBXA 1OXVA 2CQOA 4OXPA 4V0BA 5M5WH 1E7PB 4ZRJA 3S1RB 4HMIA 1NYRA 4A3MG 5BR8Q 1OFFA 3DBSA 3NEMA 3PGZA 1ACCA 2WV6D 2FUHB 3BDOA 1VF5C 2L0CA 1STHA 1AFPA 1PTOH 5EE0A 1QKZA 3RPFC 4HJ7A 4B3RQ 2VZKB 4NAWA 2W3SA 2Q2TA 1ZUD2 4OVUA 1EIYB 4F8MA 3X23A 4K6LA 5CMDA 1CKMA 4DA2A 3S1QH 1WGKA 4HDQA 1JMLA 4F7XA 3UQBA 1CKNA 5C6AA 3A1QA 2EJMA 2PMZB 3GP7A 4LFAQ 3MAQA 3ZGZA 1KABA 3C3LA 3FRPB 1H9MA 3GE8C 3PGEA 1T3QA 1GC6A 1WR6E 1FNUA 1K83H 2WXNA 2ATWA 3HOYG 1X54A 3VH4B 1QJOA 2C35B 4YT0B 3HRDD 2KJXA 2FBWB 1UE1A 2V4LA 4ZHPA 1OXUA 4R4TA 2VB3X 3JAMi 1V8CA 4LNKA 3CKIB 3OMGA 1LXDA 4GOPA 1WXSA 3U4VA 3DVGX 1HQMC 2IDYA 4LF7Q 1HZ6A 4QJFA 3PO2G 2JYEA 1ZOYB 2LGYA 4IG7B 1M4VA 2FUG1 2JA5H 3AEFB 3MC0B 3PUXA 1RFKA 4JI7Q 1IZ6A 3MFGA 1OQYA 2CJNA 3H3VI 1A8VA 4K6DA 1N63A 4W9FA 2ZVOA 4ANXA 2EYOA 4DV7L 2E2JH 3NOBA 4BKTA 5C3XA 3F8TA 3AEGB 2JA6H 1B2TA 2RGFA 3RLOA 5IYDG 2IX3A 1P3QU 1WCMH 4RMFA 3AECB 1UWMA 1DOYA 2HDMA 1I42A 3KLSA 3H7SA 2WXKA 4DV7Q 1QVFA 1FMAD 4MNOA 2CCZA 4DV4Q 4A3DH 4KIKA 5FR3A 4ARIA 4C3JH 1G6PA 4J3OD 3VR6A 5HY6A 3LWUA 1SE8A 2XN9C 3GTOB 1HEZE 1X55A 1LACA 2UYZB 3SR6A 1Q1OA 4BBRH 1UELA 2N49A 5IP7H 2JT4B 1O7IA 4II2B 4KZCA 3ZXVA 1EEID 2A68C 4B9KA 1GPXA 2A1AA 3U8ZA 3ZVVA 2KBNA 4HVBA 2ICIA 3WDNA 4NMZA 3CXCA 2H4OA 2MP1A 1NBWA 2KDBA 2LGDA 1XLOA 3HP3A 5H92C 1ZYRD 4OGQC 3SHLA 1B9RA 2QSDA 1E24A 1N33L 5CBAE 1NMFA 2FINB 2QEJC 1CHQD 2YVCA 2R7ZB 4KKIA 2QILA 1FXAA 4ZDVA 5I2XA 1OEYJ 1EIGA 2C9WB 2JA7G 3Q6SA 2NMQA 2QDLA 1V97A 4H7BA 4WJ3M 1K52A 2MHJA 1E8XA 1N33Q 1V43A 5J18A 1XD3B 4IO9A 4RGMA 2HQLA 3AEEB 1J9OA 4FXCA 4I6PA 4QUCA 4LDTB 3CHBD 1Z7TA 3FEWX 1N36L 4NXNQ 1PUTA 3ZNGC 3HOUH 3G7LA 2G4SA 3G71A 5J1ZA 4WIPA 2IT1A 2A73B 3T13A 3QWNA 3X3MA 3BYTB 2OTJA 2MJEA 4F7ZA 2RR9A 1HNXL 4DR5L 2UXBL 1K8GA 1LM8B 1S72A 1VQOA 1N36Q 1TKYA 2B2TA 1QOHA 4RA8A 1ZXTA 2ASBA 1JE4A 3NVZA 2YEPF 5MPOA 4X66L 1Y8RC 1HNXQ 4DV5L 4DR5Q 2UXBQ 3I3TB 2KA7A 3M62B 1GO3E 1UE5A 3A5UA 3J7AF 3BZCA 1BUVT 3TEXA 1PH6A 1YHAA 3AH7A 1ZXHA 2KKCA 2PPBC 4DV5Q 4HJAA 3A54A 1ZDVA 2INDC 3GS2A 3U7DA 2LRUA 1QZEA 4LF8Q 2L3ZA 4FVMA 4H13C 4KDLB 4ME3A 2B2TC 3S2DB 5FOBB 1V9PA 2F3WA 3A7AB 1WI0A 1E9MA 3N3KB 2B76B 2FCSA 1L1OC 1Q12A 4JBKA 3NPPA 4LF5L 3QG1A 3K57A 3D32A 5IGFA 1SLJA 4A3KB 1E1TA 1BCPF 4ICVA 1EUJA 2YYZA 3KQ4A 3MXGA 2UUAQ 1FYCA 1Q3LA 1J6QA 5C4XG 1I4HA 2JWUA 2E75C 4LJPB 4LF5Q 4DXFA 3Q3FA 4GU2A 4DK1A 2OT2A 2ZZPB 3CMMB 1HCZA 2B2UA 2JXMB 3VR5A 3DOWA 1QVGA 3GTPB 2BWES 1VF7A 3DEPA 3SDZA 1V8QA 4J15A 2NN6H 1EU3A 2D0OA 3T1YQ 2WHIA 4XC2A 1L0XB 3RT3B 1SJHD 1X6OA 2WX0A 3V61A 4YSZB 5A2QE 4CKBA 1KAAA 5IY0A 3J80c 4ZRPA 4MJSB 2Z6KA 3CQZB 4KY6A 1F2MA 3Q3OC 4TV3A 1YNTE 4C3HG 5BYRA 1FD7D 1WTPA 4Q2JA 1F9JA 4UAIA 3GZNI 5LXHA 5JVG3 3AE9B 4K8JA 4HIDA 1GJZA 4K7WA 2NCNA 2JF5A 4MDKE 2CHZA 3ABVB 2CWAA 3ZKJC 2EYHA 3ML8A 5DPTA 4P16A 1TWFH 2YLMA 3ERQA 3Q8AA 4HIOA 5IO9A 1JQ4A 3PSIA 1V49A 5G2NA 4XE0A 5EKKA 2R2QA 1I6HB 4GNXB 4DDID 1BQQT 4HLEA 5M5YB 1C9OA 2QCZA 3AE7B 4DDGD 2BDNA 1WMHA 4BKSA 3QQ8B 1Y1VG 3CP0A 1J19A 1TKWB 1R4NI 3N9YC 3NS1A 1XMQQ 2WB1E 3I2ZA 5BYSA 1EWYC 3ULJA 2ZXRA 5IP9H 4A93B 3G6EA 2H5XA 4J6IA 3HM6X 3T53B 2KDFB 1CKOA 1PV4A 3WAMA 4LNQA 2K05A 4OW0A 2BB5A 3CSFA 3AU7A 4P73A 4YIJA 5G3LD 1P16A 3HVZA 1M1KC 5C3EH 1HA6A 3H15A 2FJ2A 3SVMA 3WANA 4HIMA 1PH4A 4A3EH 1U5KA 3TBIB 3WCQA 3DBRB 5IE8A 1BDOA 1WE6A 4TQ0A 3CCLA 1LTLA 5E4XA 5C44H 5LXIB 3CW2C 4A4IA 2G9DA 4JG2A 2M00A 2QC8A 3T56B 3L13A 3HOZH 1RTNA 4FO2A 1ZXIA 3KUCB 4L23A 3TBLD 3AULA 1PZKD 3K8AA 3S15H 2WB1B 2D5GA 2VH1A 3PIPA 4BBSH 2ZTDA 3GTQH 2Y0SB 4AS1A 2MBQA 5CV9A 1TZOA 1KOTA 4CDEC 2OCEA 4XTCS 2MP2B 2KCTA 4RWSC 4H02A 4AIMA 2ZTCA 1YJIA 1Y14B 4AJYB 1UAPA 1KNEA 4CKEA 1ENCA 1SROA 2LASA 3O65B 2DX5B 1EQTA 2NVXH 5IN7A 5LL6S 5C4ZA 4I6LB 4MGKE 2V3PA 4MGIE 3E5SA 2DN8A 5G5GA 5IP4D 1R4MB 4LNIA 3DUZA 4GKKL 1TS4A 4IJLA 1OTCA 2RBMA 2JA9A 5FO8B 1AARA 2KLGA 3Q14C 2MQJA 2VZAA 2B2YA 5J2RA 5JPNC 1Q5WB 3S14H 1D5ZC 1SE3A 2N1WA 1VQIA 4B3SQ 2OXPA 4GKKQ 2EY1A 1QUQA 1EWHA 1WYWB 2GBJA 5JJKA 1IHZA 2YV5A 1SAPA 2WP8J 2DYMA 4WRDA 4LF9Q 1X3FA 2JQOA 1G291 3PIOA 2JA6G 2B2VA 2EJGC 2BB6A 3C19A 2NUCA 2KWDA 1XNRQ 2B39A 4V190 3A74A 3JSVA 4W9HA 3BJUA 4PQXA 4G7OC 3J81i 3C8YA 3DWPA 3EJIA 3K59A 3PHWB 5J17A 1YNNC 4NAWB 2F0LA 4C3JG 3KWLA 3P63A 1E2ZA 1V81A 2B2YC 1PRTC 4IDIA 1WRIA 1J8IA 3K0XA 2ID0A 4BBRG 5FLXc 4G7ZC 2E2IH 2XBBC 5IP7G 4II3B 2RHQB 2PO4A 2BA1A 3LYYA 4BVUC 3VDZA 2JP1A 4C2MH 3ML9A 1PFBA 2NPTB 2ACZB 4TQUS 2MQHA 2YU9H 3OTOL 2B2VC 3SK8A 2M19A 5EGTA 3PRMB 2QIEB 3CCEA 2PZUA 3VRBB 4BXXH 3PRPB 4YSXB 1Y69U 2F0KA 3M7NA 4KV2A 5CV4A 1KH0A 4GOPB 2BWFA 1UF0A 2CR5A 4DV0Q 2L55A 3OTOQ 2LVQA 2WXLA 4HJ5A 3EBEA 4NXML 1YJJA 3ZIMA 5HHDG 3FKIB 1FNVA 1NYQA 4Y52H 2KVZA 1MGSA 2F0VA 3EFXD 4Q0FA 4BY7B 1PQSA 2MWSB 3SEBA 2BPSA 3TEWA 1HZCA 1FPYA 4CDFC 1BMLC 2A6ED 2NVQB 1KTKA 4LUZA 4NXMQ 1F2RC 2LMCA 2MBHA 4GN3B 2KWUB 3K9OB 4M8AA 1JOKA 4HK2A 2K5WA 1SFOH 1PH5A 3MXNA 3GV3A 2N8NA 4O2DA 4CO7A 4BAXA 1BBXC 2EMSA 3TIXA 1O7YA 3ZQ4A 2MEKA 4GDKA 2I5HA 3P1MA 1G8ZD 2KX3A 1SMXA 1PXUA 2EYPA 2L05A 4KIKB 3PREA 4IPGA 1ET6A 1IL2A 2UXCL 3VYTA 3U7ZA 3PO3B 4MM3B 4OELB 1G6ZA 3KW5B 4XT1B 1JWBD 4C3IH 4H0LC 2BKRB 2PQAA 4ANVA 4FBJB 3EQLC 4OIKA 3OJ3A 2IWHA 1AW7A 5D14A 3AU5A 2B8FA 1ONLA 1JJ2A 1RJTA 1L2FA 3H09A 5T1GA 1IP9A 3A8JE 4R9WA 1RAXA 3M63B 3VHTC 1ASZA 4X65L 1I3QH 4JOIA 4P71A 5K5PA 2J0MA 1ENAA 5EE9A 3F2UA 3OHXC 2DNEA 3L0WB 2O6VD 1UEBA 2R7DA 3V2TA 4JPSA 3GTJB 1RM6C 1UWXA 3PZDA 2KOXA 2RF4A 2NVTH 1XTCD 4DV3L 4X65Q 4DR7L 4JC0A 1HA5A 3HOYB 4NJ6A 4IFDG 5ELNA 2BOSA 3M4PA 3MEFA 1TWAB 2VB2X 4PG3A 3WA0A 3TEYA 3NTKA 1N60A 4BOSC 4HTHA 3SK6A 3PQIA 2E6XA 3N32A 2WLBA 2GLSA 2BH2A 4DV3Q 1Q10A 2LY7A 3P20A 4JLCA 1GNUA 3KUDB 2NN6G 4OEMB 2DJFC 4CJ2C 1F2LA 2MJ8A 2DENB 3SDLC 1S5BD 3EN2A 4EZLA 4FYDA 1CUKA 4JOIC 4KTAA 2NVYH 3NQTA 3GTGH 2LUEA 4ULLA 1TT2A 2A4ZA 2YTYA 1IW7D 2VW9A 3HOWB 1YNXA 3UINB 5JZEB 4K5VA 3D6WA 4A3MH 1NSNS 3FILB 2BYTA 2MNAA 1D5MC 1JQYD 1FIQA 4GN1A 1E8ZA 3M95A 3MHZA 3RULA 1J7BA 1DOLA 1WJNA 2M0XA 2WDTB 3IBEA 2Z4IA 5GADC 1OO9B 2BE5D 5J39A 3Q8CA 5TR5A 4E74A 2XRSD 4LFCL 2L9HA 2KDEB 2LJIA 3K5NA 5KYLA 2KN5A 3JW0X 3UDFA 1WZ3A 4TQ1A 4LW1A 1JORA 4ZAIA 3J7A5 1H9KA 1GB4A 4PS3A 4NP5A 5J22A 4K3BA 3QO2A 4B0EA 3PHXB 2PVOD 2CFMA 2F0NA 4JI3L 2RCFA 1SYBA 1TWGB 4BY1G 4WAAA 4P7IA 2D9UA 3P4QB 3V96A 1LTBD 3MZ5A 3PO2H 2AYOB 1STBA 1SYGA 3VR4A 1B7YB 3QAQA 5CV5A 2JA7B 4M00A 2PVGC 2KJ6A 1LTGD 2OQ0A 1F2YA 3BDCA 5C3EG 4OVZA 2KMCA 4B3TL 2INCC 4MT5A 4RMAA 2PMVA 3CMAA 4NDXA 2ALYB 1EOVA 1EQRA 4QY7A 3L9AX 3SK5A 5C44G 4ZKBB 1JJGA 4DQOC 3T9LA 3HOZG 2R6GA 1SNMA 1NR4A 2BYVE 4R3DA 2FIDA 2EY5A 1FFVA 1HTOA 2WDRB 1RWSA 1Y56A 2NTSA 2Y3AA 1E7UA 2HJ8A 2QGQA 4R8IA 2VS1A 3D3RA 3N20C 2CQAA 4R4QA 3B2GA 1SE9A 2HQEA 2HIVA 3L3OC 4HJ8A 1II3A 5JPMC 4OO1I 4L6TB 3QIJA 2L0FA 3RNGC 2A6HC 1BBWA 3VUWA 1LTAD 1FO4A 1WMHB 1PYBA 3SR1A 2NB0A 2RPQA 4PYZA 2OJWA 2LGSA 1ET9A 1VQHA 2L52A 3L08A 2KEEA 1U9RA 1PFDA 3ZLZA 2K33A 1B4OA 4OX9L 2IGGA 2F0IA 2F0WA 2LKVA 2JRHA 4X3UA 4X57B 3TZUA 3U9OA 4X64L 4M0WB 4RNAA 4XQQA 2K25A 4MEMA 1Y1WH 1UD7A 1EIHA 4KX6B 2NZOA 4KGSA 1FR3A 3AE6B 1A62A 2NBFA 2SNSA 4NW2A 2O6VB 1XEEA 1HFGA 3D4DA 3S17B 1OQQA 5C4XB 4X64Q 3BDLA 1K8AC 3ZYYX 3MFYA 1YD8U 3RN2A 1YOVB 5DPWA 1NUCA 4B9WA 2IO3B 4XT3B 5ELFA 1NR2A 1FCCC 2J53A 4RM9A 3CPWA 5IOIA 1E7VA 2B29A 1NAPA 3C1EA 1VQEA 1I4XA 5ELDA 5IYBH 1PH9A 3NRZA 1XXGA 3WAPA 2K5QA 1O78A 1SYCA 5IWAL 3CWIA 3OYYA 2CH4A 1B9MA 2Z6BA 4DXAB 3K80C 2BS4B 2BTEA 1UZXB 3RNFC 3W1SC 1PRTF 1TY2A 2WWZA 3AFQA 3Q69A 2JWZA 1AE2A 3UI2A 2HCIA 2KHSA 1N5WA 1W6KA 1WOCA 3M7GA 1MPEA 2RDGA 5CV6A 4ZRZA 3NVWA 3Q6BA 5KEEA 3D4WA 2L0TA 1OTRB 4GKJL 3Q3JA 1I50H 3CC2A 2ZM6Q 2LXAA 4BXXG 3ZO5B 2R92H 4I65A 5AJ3Q 2DJGC 3M4QA 1EY7A 4W9EA 3CCUA 1STNA 2F0DA 4GNXA 1R7SA 4MH8A 3HOXH 3UIOB 4ABNA 3RMHA 2F0HA 1A70A 1ENFA 1VQ6A 2IBIB 2SAKA 5EPKA 1C8CA 1KFYB 3NVYA 1VQDA 2PYKA 1C4PA 3I63C 3EUB2 4TUUA 3ZNHB 2QDFA 3MHBA 2HD3A 4R4CA 3E56A 4XWTA 1JOOA 3TZDA 1GOZA 2ZXPA 1PGXA 3BVMA 1NCVA 1Y8NB 3CRLC 3RCZA 1QVCA 1STAA 3RI7C 4EZJA 1E0ZA 1L0WA 1BCPD 1TS2A 4XYOA 3L4PA 2R93G 4ICUA 5HI1A 2F0OA 4S3SA 2FCNA 3JSVB 4TRDA 4W9GA 2GMIC 5E6OA 1X3GA 3HUIA 2WINB 4DNRB 3I55A 2AL6A 1AZPA 4OWXB 2KK8A 4GNXC 2WDVB 4WJNA 4MH0E 3M4OB 1R9TB 2XNAC 4KN7C 2JK8A 1T5XD 4RG1A 3TRZA 2INPE 3BZDB 1N5XA 1S40A 2FXQA 4YY3L 1VQFA 4LAAA 1T0RC 3GOEA 4DUYQ 5M5WB 1WTVA 3F2DA 3AEDB 1X3EA 5L95C 3ALBA 2C60A 4PK1A 4HROA 2I5MX 1V6EA 4IUMB 4REZA 1QOAA 4F1SA 2QDBA 4HSVA 2EYJA 2CW0D 3PF5A 4YY3Q 4C00A 1CZPA 1PTOB 1SE2A 5T1IA 2VXWA 3H91A 4MN3A 2AWTA 1A3UA 2MP2A 3GE3C 3HHMA 1SNQA 3MTNB 1ZE3D 3S1QB 1CA5A 1YEZA 1KDAA 4K14A 4R4IA 1PA6A 3HM3A 2UUBQ 2KYWA 2REXA 2KQ4X 5COYA 1Y1VH 1TS3A 1VMCA 2WXJA 2Q8IB 1BT0A 3K58A 1K83B 4UPAA 2D10A 3CSTA 1RHPA 2D62A 1EF5A 3AN1A 4B95A 4S17A 2BQQA 3QWZB 4IFDI 4QIWE 1IBLL 3WAOA 1YNJC 3MXNB 3J9CA 1LUZA 3M3YH 2WXQA 5IOCA 3Q0AA 4A3IG 4GDKB 2O5JC 4KKTA 3VUYA 4ARCA 2HHHL 2JA5B 1KF6B 1XPOA 3PZ8A 1IBLQ 2N9PC 3PUVA 1SNCA 3IAYA 1SNPA 3I4MH 4B3RL 2EIFA 4X3TA 1RF2D 2RMMA 4C7ZA 2N4FA 2PQAB 2HHHQ 4CHTB 2JA6B 4L2YA 2Z4HA 2O4XA 2Z59B 1Q82C 2MPMA 5ELBA 1FEHA 2VUMH 1WCMB 1GHKA 5IGGA 4DNIA 2M17A 1TR5A 4TSSA 3AI5A 4YWGG 4LFAL 1I35A 4OO1H 2KVRA 1HNWQ 1VRAB 2RSUA 2Z8LA 1S3OA 1NTGA 1WIAA 1V1PA 1K9MC 4A3DB 2N9XA 4QIWB 4C3JB 5BMIA 4FULA 1TS5A 4IOCA 4JWUC 1QILA 1DOKA 4R4OA 4BBRB 1PH7A 4KD4A 5T8IA 2EZVA 2NPTA 4A3JG 3HOVH 1F0ZA 1V2YA 1SR3A 3HKSA 2QCPX 3LGJA 1MKHA 2R3ZA 4LF7L 2AQ3B 3GTKH 2F4IA 2KHWB 3URYA 4JI7L 2ZTEA 2DAJA 3QOJA 3A8KE 1YIJA 3ZJUA 1P7FA 4NKLA 4PZ7A 1MI0A 1FGBD 4DXGA 1M8AA 4USAA 5ELOA 4IPHA 3LDZE 1TIID 1B53A 4OL7A 2HJ1A 2RVLA 1SMYD 1H8CA 2AWNA 5EJWA 3EC8A 1FJGQ 1X3PA 2PQEA 1A15A 4DV2Q 2BGFA 3B9JA 4ZHOA 2EMTA 3E0EA 4LF4L 1H9RA 2WKDA 3PV1A 3GTLH 4DV4L 3APCA 2KTRB 1P8LA 4KKUA 1MJDA 4WAFA 4A3FG 3HOUB 5C2TB 2M2LA 1ISNA 3VR8B 5KIXA 4LF4Q 2QJLA 4GOPC 2ICEC 3L2PA 1EY9A 1XF5L 1H9SB 1F9RA 1JCKB 1WD1A 4MM3A 1AEXA 4BKGA 1WXAA 5GXGB 3ZJTA 2D2QA 1WY8A 5IAAC 4PS7A 1LTID 5C0XJ 2DYOA 2ON8A 2EPBA 1U4AA 2V4DA 4C7YA 4C80A 1KM7A 1Z6HA 5FK9C 4P2CB 5IT9L 4CKCA 2FCMA 3LX0A 1IBXB 4PMWA 4HPPA 5JEAJ 2G45B 4EZKA 4N9F4 3HG9A 5F2DA 1ZYRC 3APFA 2LXKA 3P75A 3S16B 4B08A 5LMUQ 2BYEA 3PLUA 1ZDXA 1IGDA 4NXNL 3CD6A 4WURA 3TEHB 2A68D 5C3JB 3V05A 3Q3NC 1E8WA 1Y1WG 4DR2L 3PUWA 3OMCA 4RGOS 5CR3A 5D6JB 3MVVA 1KDCA 4TVAB 4HJ9A 1N62A 1E10A 4NZLB 4KJOA 4Y7NH 1DOIA 4FJVB 4HJKA 2ZW0A 3PRZA 4B0MA 2MO1A 2NBUA 4WWNA 5I6YA 3FMCA 4DR2Q 4XWWA 2RHSB 2JN4A 3IXSA 3K5LA 1XNQQ 1C78A 3OIQA 1NBFC 4L5TA 4QF4A 3WWVA 5IYBG 3KLRA 4HCEA 2E2DC 1HXYD 4PYUA 2E8GA 4D2KA 1E8YA 4DGZA 3ZJVA 3NTHA 4HRSA 2A8VA 4LF8L 5KGUA 2DGYA 3FILA 3TMPB 4YCUA 1YHBA 1QF6A 2WFWA 2E5LQ 2N1VA 2INNE 1QOBA 3NUHB 1Z47A 3MXPA 1FL0A 4JI8L 3BK1A 2KLCA 2M9VA 1S5ED 3OW7A 2PPHA 1TBEA 5FKAC 2BCOA 2KZRA 1DXMA 2K32A 1QNUA 1ASYA 2KHJA 4U68A 2UUAL 2R92G 1BUIC 2C7MB 4A3PA 3U9SA 3TN2A 1SXTA 1TWFB 4JI8Q 2HUGA 1YHQA 3RN9C 3HOXG 3FC4A 2ZJQA 2V9HA 3U4EG 3KUZA 1VQLA 5KHOA 2F0FA 2L4NA 4IFDH 5CC4A 3T1YL 1XCTL 2BS2B 3NK9A 1PVOA 1C4AA 3BG3A 4GLVB 4JVZA 2KECA 2FMCA 3AFPA 1GG3A 3R3MA 4IC7B 1OXXK 2D0PA 5DCNA 1VQ4A 5EKLA 1CK1A 1YX6B 4YCWA 2EE1A 5AEKB 4CDDC 4XGAB 2I5LX 2WAQG 4DK0A 5IGBA 4WFN3 4KN4C 3LXFA 4O42A 1X1MA 4DK5A 2MJDA 5C3EB 1KRSA 2KN4A 4LUOA 4BA1I 4WQMA 3AB5A 3LWEA 4A3EB 1WXMA 2JRIB 1GVPA 5GROA 1UE6A 4IURA 1C48A 5C44B 5FR6A 2KENA 5A35A 3EGRA 2B2UC 5E3FA 1MHXA 1E0BA 4KD3A 2XWBB 3ULLA 3HOZB 3PT2B 1QQRA 2TMPA 3A56A 3ZRCA 3PV0A 4LNOA 3S15B 5JH5C 1PFSA 1FD6A 1HFNA 1MVKA 3NP8A 2K6QA 3R66C 4BBSB 4JQWC 2K50A 1XMQL 4N8FA 3T4AC 2KHIA 2F0JA 3S2HH 1GJXA 3PS6A 1HH2P 1DOXA 1B8AA 2Z6KC 3NWSA 4BA2I 1I4PA 2QW7A 4QMGA 3J80i 1K8MA 3RZOH 4GOCA 5ELCA 1DOMA 1VQBA 3HKZE 4A3BG 3BY4B 1SE4A 5M5XH 1WVLA 2Q2UA 2ASQA 1I4GA 2NVXB 3N1XC 4BY1H 4FHJA 1WI5A 4IM2A 4KGRA 4US8A 3AXCA 3VRAB 1SSOA 4HXDA 2KQ3A 2OHFA 3H3VH 2LFIA 4NB3A 1EL0A 4RF0A 4A3GG 2V4IB 1F77A 4M0WA 1CI3M 4WJQA 1XLNA 1E1OA 2LHEA 1YBYA 4IZ8A 2PZWA 1MSHA 1ESRA 4CGYB 4HN7A 2DAFA 5HKHA 4ID6A 2B2WA 2Q2HA 1JB7A 3S14B 3VXWA 4BS9A 2K03A 1J7AA 4BBNC 4DUZL 1K50A 5IIFA 3I4MG 1J8CA 1PZJD 2CHBD 2B63H 2DWQA 2X69A 5CYUA 3KJOA 1GAQB 4L5RC 2J0KA 3DVNU 4E3CA 1SSNA 4ANUA 3HKZB 2A69D 2VUMG 4DUZQ 4XYQA 2Z1CA 2EQSA 3I91A 3WOFA 2N0SB 2O2VB 1EY0A 3CCVA 4OO1G 2LXJA 2R7FA 2KX0A 1RD9D 3R8BA 2KCMA 1D1KA 3NQIA 3SXHA 3JC66 1A6XA 1V5TA 2WXMA 4RHRA 3NZSA 2F03A 5EDSA 1B44D 1L6UA 1Q0WB 1L5PA 3QJYA 1ICWA 5EBDA 1J5EL 2B2WC 2F0UA 2E2IB 1L4ZB 1WWTA 3HOVG 2KAJA 2WU5B 3KH0A 3N30A 4A3CH 2ZT9C 4C2MB 3NVVA 1VS0A 1FXTB 2WXOA 2LJ5A 5AUIA 1GKHA 1D5XC 2YU9B 3CMEA 1TY0A 2GVBA 1GUNA 1J5EQ 5DLQE 3S9WA 2LUMA 2E2HB 2NVUI 4HKQA 4B3SL 4G7HC 1L0YB 2F0PA 1PH1A 2JA8H 3A9KA 4LF9L 3VQIA 3NWTA 5FLMG 2KANA 1HUMA 3NE5B 1WXVA 3NHEB 1HZAA 3MC8A 2IY5B 5DEHA 1LO5D 1XNRL 4YSYB 4NQLB 4C56C 4JIOU 1DM0B 1XWEA 5C4JH 4UY8C 4MGZE 1VQNA 2X38A 1Q86C 2DUDA 4KY5A 4MGYE 1LM0A 3PVLA 2LVPA 1QZGA 1HTLD 1AH9A 2EY6A 2V1YA 3QX1A 1SFOB 1L6VA 2AUJD 4GIVA 1B3QA 1LLRD 2MFIA 4HPMB 1SGHA 3AEBB 4K81A 4ODGA 1AN8A 1NNXA 2KO3A 4GN4B 3OG5A 4NY0A 1V1PB 3PO0A 4BOZB 1VQ7A 3GZNB 1HZBA 3QA8A 1Q90A 4KKSA 3N6RA 2K75A 1K53A 4IUNA 1O7ZA 4C3IB 1B50A 2QA4A 3CF6E 2H88B 4LTUA 1Q46A 2GA4B 4DV0L 3U58A 5CHWA 1GB1A 4DR1Q 2MRPA 4EQ5A 4KMUC 3V6EB 1QB5D 3DMUA 4YTMB 3H0GH 3APDA 5M3MB 2ENBA 1YITA 2EKIA 3UI3A 5I6WA 3C2PA 2RD0A 4GXBA 2DY7A 1I3QB 1CQVA 1VQ8A 1R4NB 1STYA 2EDGA 2BT6A 4ITKA 1WTRA 2KTFA 4HAEA 4JI0L 3A9JB 4AQ7A 1E2WA 2MH7A 4JYAQ 2NVTB 2K8CA 2AHOB 1WFYA 1NMGA 1LT5D 2M8SA 2UWQA 3V6CB 4ALPA 3C1FA 2IW3A 4DAYB 1PTOC 2R93H 4JI0Q 4MSMB 5GAEC 3EHVA 1TQOA 1S4ZA 3AEAB 1CZGA 2FAZA 4N9TA 3P7JA 2PE9A 2MO0A 1NENB 1WXQA 2G3QB 4YXDB 4UDUC 5BN4A 4WWMA 2JEAI 4M8MA 5CX3A 3I7FA 2NVYB 5LMNQ 3GTGB 3RMKC 2O6VA 3U30A 2JUOA 2FCQA 3PTFC 3Q8FA 4NQKE 4A3MB 2I38A 2VRRB 2H89B 4IM0A 3NY5A 2B8GA 1KNAA 3KYCD 1I7HA 3S1MH 4JBWA 5E6NA 1U4LA 4EQPA 3CC7A 3RUIB 3OW2A 4ZRKA 1HR0W 1TU2B 3D8GA 1FRDA 1JWAD 1UGJA 4ME5A 2VQFQ 2DNFA 2L83A 2PTLA 1W6JA 2Q2IA 1WD0A 2PW5A 1FXIA 2VH2A 3AE5B 2XVSA 3H6NA 1SF0A 4IKGA 5JXVA 4N59A 3KYDD 1FFUA 1M90C 3PUZA 2XGTA 3U50C 1JMCA 2EVBA 2BVCA 2EELA 3IAM1 2WXPA 3W2DA 2RPVA 2R7ZG 4HKZE 3KFUA 1WTHA 3NG0A 1MG8A 4FXGC 5FJ8G 2UU9L 4A3IH 3PO2B 2K1BA 2HD5B 1M94A 4JI4Q 1HHVA 5AZGA 1R4PB 1SIFA 1N34L 3ITPA 2UU9Q 2KTRA 2K3UA 2J52A 3P42A 4FADA 2K1FA 2GOWA 2Y5CA 1PH8A 3ZDMC 4I7ZC 1IW7C 2J0JA 2VZKD 1T0YA 3W5OA 4LFBL 1K28A 2C5LC 1N34Q 2KC2A 1H9SA 3KF6A 4Q5VA 1AWDA 2K0PA 2LWPA 2N7JA 2D3CA 1HUNA 3A0JA 1EU4A 3DDCB 2IL8A 3ER0A 3MHSD 2ZJRA 4LFBQ 3HVDA 3RZWC 3PO3H 4JK1C 3K7UC 4WJWA 5DM73 3H94A 4IWQA 4A3JH 2JJQA 1MIUA 3TS0A 4P6VF 3CU7A 2UXDQ 2NZHA 1J0GA 1P98A 2QMTA 1IBXA 1PLFA 3IRBA 1WM3A 2IY1B 4XDCA 5G5HA 1JROA 2EY2A 2KJHB 4N6EB 2JE6I 1EM7A 2V3SA 1CHPD 2G5DA 4RCOA 5C23A 3DBHI 1H4RA 5EKIA 3RFZB 4IOIE 5L37A 1K8OA 2HTME 3RR5A 1MI2A 2GBKA 2J42A 2D3BA 4KK7A 3FVQA 2K39A 2KQSA 3RNBC 1F9PA 4CBVA 2MCNB 4ZCKA 3UDXA 1QOGA 2C5CA 4A3KG 4DR3L 3DBHB 3Q8EA 3GD7A 4ASWC 2JQRB 1PGBA 1ESFA 1BO0A 1Y1WB 1PMRA 2KCCA 1K51A 2K52A 2PI2A 1D7QA 3T51B 4A3FH 2D07B 2N9LA 3OIPA 4DR3Q 4FF1A 4KSLC 2F0TA 4BBNF 2BW2A 2B63G 1TWCH 2SEBD 2WDQB 1Z2MA 2JZ3B 2IX0A 5D94A 5IGCA 1RRBA 2HIXA 3KOJA 1VCBA 4IWPA 5IA7A 1ILPA 2ZW1A 3CCSA 3I56A 4LMQD 1Y8OB 2BDOA 1TVXA 3VYRA 3DLLA 2KC1A 1DGJA 2I07B 2OJRA 4EFOA 5L83A 1VQAA 1RCVD 3JAML 3J7ZC 4GN5A 2DHZA 2L1AA 1TKEA 1EZ8A 3MJ5A 4DR6L 5HGTA 1I4RA 4RH6A 3Q22A 4XX5A 4A3CG 2DZIA 2JSOA 4LWCA 1WJUA 2UUCQ 5IYCH 2O5IC 2K5PA 1F2RI 1JWUD 1PYWD 2F3IA 5LMNW 2MBBB 3P4SB 4DR6Q 4R1JA 2WAQE 1I50B 3T3OA 2JA8G 1E2VA 1D3ZA 5J3BA 3UGBB 2R92B 4NNJB 1SBBB 4N9PA 1W3SA 3Q8DA 4ZQ3A 2C7NB 3FAHA 2VNUD 1ZW7A 3N1ZC 1SRUA 4Z9CB 3HOXB 3L54A 2JZZA 3ZNID 1CSPA 1JB3A 4G57A 4JI1L 2F0QA 4GDLA 1YN4A 4WORA 3BINA 2ZEQA 1RL2A 5D3IB 4G11A 4APVA 3HGBA 3BVZA 4CDCC 5GAGC 4A93G 3J7YW 2OEDA 4JI1Q 2CU1A 2KOLA 2LSSA 3VH3B 1KLGD 1FM0D 4M8NA 3Q23A 4JL9A 4OZBA 3VYSA 1C76A 2WX1A 3M85A 3IT6B 3RZFA 4IW0A 4ILWA 3DBLB 4B9XA 3SD5A 5C5LA 3TP8A 5BN5A 3I9V1 3I4LA 1HTQA 2K4KA 4JPBW 4ZOHC 3GQBA 3PMFA 3K7AH 1CJEA 2ZM6L 4C3HB 2JY6A 4JBMA 3TCAA 5AJ3L 4IUVA 1A2UA 3AU4A 3ZJYC 4KKJA 3SGIA 5KHQA 2NYZD 4A9AA 3D4RA 1F2ZA 4QCLA 2O2LD 3FPUB 1EY5A 1A2TA 1T5EA 2Y0SG 3H3VC 1DGSA 4HWIB 2WYQA 2E74C 4IUPA 4JI2Q 5M3FH 3DWAA 3H0GG 1G91A 2W82A 2WXHA 4KZ0A 3RNCC 1PFNA 3A9KB 4WWOA 2Q8TA 4PS8A 4ACFA 2IGHA 1JT8A 1JRUA 4H2AA 2GBRA 3DHQA 4C4VA 1DJRD 3QHTA 5IODA 1A63A 1G2TA 2WP9B 1Y1VB 3M4YA 4AH6A 3UDIA 3J7AV 2DBYA 4KY7A 4W9JA 1EQVA 1QLBB 2VY3A 4DV1L 2J0TD 1S1QB 2NBVB 1GD7A 2GI9A 2LS01 3P4RB 4B6WA 3OWFA 5M9OA 4RF1A 1PTOF 3M3YB 1CSQA 4DUYL 4KHVA 4DV1Q 5FO7B 3PUYA 2NTTA 3D0FA 1U0LA 2RDHA 1WM2A 4JCVE 2PKOA 1KRHA 3ENEA 4YCVA 2MHVA 2AQ2B 1JWSD 1EYAA 1GUSA 4DPGA 3I4MB 1KJTA 2IYDB 2I0QA 4RM8A 1FRRA 4IFDJ 2WXGA 3ZTDA 2AMCB 2DZKA 3STBD 5ISRA 2PW7A 2KMMA 2LGXA 2O2VA 1TXYA 1YX5B 2VUMB 2D3GA 2QEXA 2ZXOA 2UUBL 2WS3B 2K14A 3DM3A 3PPAA 2OOBB 2CW0C 2IPKD 3RNUA 5GMVA 3H8HA 4A6QA 1C3TA 3HS0C 4NPNA 4IPCA 3E9HA 3GTMH 1JC7A 2BA0A 3ND8A 1PHJA 4A3BH 1V1QA 3DHGC 3HOVB 3PSEB 3TREA 4MELA 4WJOA 2OEOA 2XIWA 1SJED 2AQ1B 2D11A 4JE3B 2RCNA 1EZ6A 2D3AA 4DWFA 2Q8RE 2F52A 3GTKB 1T0QC 3OLMD 3W5VB 1SNOA 2ZPYA 4KVGB 4C1NI 4IJHA 1TWHH 1EFID 4A3GH 5C4HA 4WH4A 1TKGA 2RDBC 3QB3A 3QIAA 4X6AH 2HCCA 1X65A 3KBGA 4XQJA 3K81C 1G6JA 3FKIG 1WRDB 3AE1B 3VR3A 1WTXA 4BY7G 4K5WA 3E6ZX 4FN2A 5EE1A 2M4NA 1E5WA 1ICFB 3NSWA 3NBIA 3F2BA 1HNWL 2E2JB 2BBCA 1GUWA 3E9IA 3GTLB 1A3VA 5I4DA 4KDIC 1S3SG 4U673 4N8X1 2E3TA 2LVOA 3DWMA 4RKLA 2M1MA 3ZRFA 2PE6B 1IBMQ 3G48A 2AEHA 2MJ3A 4LF6L 5DAUA 1TTNA 2CHWA 4HCNB 1B70B 2OF1A 3PO3G 4GSWA 2K22A 1S5FD 2HDLA 1IXRA 3KLWA 5I9OA 5HURA 1T6BX 3A4RA 4JV5L 2IO0B 4LF6Q 4CJ0B 5KRUA 2L11A 3UDGA 4JI6L 3WOEA 3OWEB 3U4ZA 5KNBA 3RYTA 2RA4A 1RKNA 3VTWA 4DK3C 4JV5Q 4P72A 1H9JA 2DNCA 3LNNA 4DV2L 1FJGL 4JI6Q 3G6JB 4GB9A 1LTRD 4H44C 4OWTB 5CORA 3HRZC 2N88A 1G2SA 2E76C 5FLMH 5EQ0A 2JXXA 3P1HA 5GAHC 1LV9A 2GRIA 2PNRC 4MIUA 3I4NH 1SYDA 2VL6A 1SMYC 2KDIA 3A9JA 1RODA 3DPDA 3F1ZA 4L5SA 4DKAC 4DNTB 1BXTA 1BOSA 4QQBX 2PW9A 4PMBA 4G50A 3S1NH 4LK0M 4Y7NB 4DAYA 1WGRA 2HT1A 2AKWB 4ZYNA 1JICA 1GUGA 3BYYB 1HTPA 3KF6B 4POFA 4K2LA 2KJRA 2G9HD 3VTUA 5IT9E 4HCSA 2CU3A 4POGA 3RZDH 3UIPB 4ZRQA 1R4QB 3HOWG 1JR0D 1VZ7A 3VFKA 2PI2E 2I1JA 3ZNZB 3PIP3 1MBYA 3S1RH 2WGSA 3OSOA 1F1HA 2A5UA 3N52A 3ZUNA 4O1NA 5LMUL 4FF4A 4FJYA 4GZYC 4GLXA 1KXLA 2LHDA 2JVCA 4W9IA 4XXEA 3BVGA 5IYCG 3RUZA 2L00B 5CBEE 4EVOA 4BWGB 3E0JA 1X3QA 1UGMA 3VAWA 3TUOA 4L5QA 3PLVA 4UP8A 3TSSA 1PH3A 1RTOA 5DM63 1WSPA 1ZGUB 3J81E 2EXDA 3KDFB 1EYDA 4KI0A 3RN5A 2B3AA 1I5FA 1C4CA 2L76A 1VQ9A 4WWPA 4A55A 1WTOA 2F0SA 3L7ZC 4RGTA 4DHJD 4JI5L 4PZ8A 4DK6C 1SEBD 1WTWA 3HZXA 4RKBA 1NEKB 3J81L 1XNQL 1EWCA 4OHJA 2W55A 1J7CA 1V1OA 4IUTA 1SN8A 2XWJB 4P1CC 3W5UB 4JI5Q 1QNKA 1BNZA 3EA6A 3OAWA 3BS1A 2EYFA 1BR9A 1KHIA 1SYEA 3RD4A 3TQYA 1IKMA 4FDBA 1TT5B 1V9JA 2CKHB 4AYBG 2V0GA 2LXCA 1P9DU 1ZPSA 2KXJA 3PIO3 4HR7B 4DAMA 4PMCA 4NPSA 4KSKC 1HE8A 5AUKA 2E5LL 4UHVA 1C0AA 3AMUA 4X62L 4KJNA 3ETRA 1XYIA 3IFWB 3X0WA 5C0XI 3NS8A 1Q7YC 3NTIA 2IY0B 1Y8PB 3B08A 3I5JC 4EE2A 3DBRI 5TSSA 4K5XA 5FLXE 3MTSA 1QG7A 2KCNA 2XSCA 4X62Q 1WJ4A 2D2CC 1WGGA 2PNHA 1B3AA 1UUPA 1HZ9A 3TDQA 3GTOH 2ZNVB 3L0OA 3FKYA 4MHEA 2MLBA 4M01A 2AL3A 1L1OA 5FLXL 5M3FG 2K7VA 2ZCCA 2XK5A 4RAUC 2PZTA 1VZ8A 2QF7A 1VQKA 4G0NB 3S2HB 5D3DA 1UH6A 2JSVX 2FHTA 4X66Q 5H8YE 4GDLB 3F2CA 3DVGY 3KF8B 3MXUA 2R7ZH 2V1CC 3RZOB 3S16H 4QAYA 3NJTA 4XYCA 2CS4A 2F3VA 5M5XB 3TS2A 2N55A 1ROEA 1YVCA 1QOFA 4TKNA 4BY1B 5FJ8H 2YEPB 2NWGA 5JAVA 5BO4B 3BIID 3KJPA 2KQ7A 1KL9A 1LT3D 4ZK9B 4EQOA 3VDYA 2ONQA 1R4MI 2N3SA 1V5OA 1TGZB 4W9CA 4P75A 1ZKHA 3PZ7A 4NJ7A 4HMJA 1N61A 3KUPA 4LJOB 3W1GA 4YHHL 1C79A 1VDZA 4O0AA 5FO9B 2FE8A 2JEBI 2X6LA 1EY8A 4IPDA 2I1KA 3V3XA 3BZKA 4LJZC 3IKJA 1QT9A 5HFYA 2CHXA 1C4QA 1HQRD 3MA2B 1ML0D 4YHHQ 2B63B 3R7RA 1GXDC 4XZ4A 1HPCA 2G1EA 3C46A 3CPFA 3GTQB 1BCPB 1CT1D 4ZRIA 4FNFA 4S0RA 4K8IA 2YTVA 5AZHA 1C9FA 4W9LA 4KGTA 3CAMA 5IKCM 3CRKC 1Q8KA 3IFDA 5A2QL 1N32L 4C4VB 1CTMA 1D6EC 1PDQA 2SNMA 5LL6X 5EPJA 3S2DH 4IOAA 1YZ6A 3KWVA 1HRJA 2W3RA 2MGSA 1NE3A 4YWKA 1BKBA 2BS3B 2ZCBA 1N32Q 2XRQD 3EFCA 1KDBA 5C3WA 4KV6A 1MSGA 4A3KH 2JA8B 2KFKA 2LEKA 3CCQA 1HR0L 3ONAB 3MEHA 3SHQA 1GUOA 1C77A 3AB9A 1YQBA 4A3OA 2J7ZA 3EIVA 4HDOA 3GTPH 4RGNA 1HR0Q 1IL8A 3EFUA 4FP5D 3HFZB 5C4JB 2Y0SE 4G4KA 2ZVNA 3HEJA 4E6IA 1RIPA 4OIJA 3CC4A 5I9PA 4IUQA 2LRWA 1K3RA 2LZ6A 4JW0A 5EAYA 2A69C 4KHPL 4AWJA 1EWIA 2EXZA 2BF8B 3T1HL 1A5RA 3CQZH 1XLQA 4QUFA 1V80A 4MZ9A 4BKSD 3G4SA 4PV1C 3A8IE 1CFMA 4KHPQ 1ZEQX 4M1UB 3T1HQ 3AE4B 2H1EA 1N8RC 1LT6D 2X8XX 3VR2A 3TL5A 5BMGA 3D6CA 3I70A 1SIJA 5IT9c 2GB1A 2WKCA 4QB4A 1BVSA 1XMOL 2L32A 3ECIA 1FCLA 3TP6A 5LLIA 3AQQA 2Z0EB 1XPUA 4I6NB 1JALA 3L17A 5LHY1 1YJWA 2GBNA 4DAPA 2JX5A 1YN3A 4DBGA 1RDPD 1GUTA 3I4OA 5EBCA 1H95A 4A20A 2CKZB 1LT4D 1XMOQ 1I6HH 3AE3B 3RNEC 3H0GB 1E6EB 3NBHA 2B3GA 5M5YH 4CJ1B 1JW9D 3QC8B 4A90A 1STEA 3A55A 3MJWA 4YTPB 1NI3A 4LCDE 3BWUD 1UWVA 1VD2A 4MTNA 2IHFA 5G55A 1KRTA 3I4NG 5BN3A 1P7EA 3Q3MC 2GVAA 2N9EB 2K01A 5HG2A 3SFDB 4ZLTF 3AEVA 2LI5A 1CMXB 3J81c 2WXIA 3AV8A 4GLSC 1VQCA 1FNWA 4A93H 1EY6A 4W9KA 4K2KA 1NY4A 2MA9B 2ES2A 3Q8BA 2DZJA 4JGHB 4A76A 1CQFA 2CWPA 4IALA 2A74C 1MHWC 3QARA 2R93B 4AOFA 3TP7A 5C0XH 1VDVA 1EEFD 4URKA 2JA5G 3EECA 1SDFA 2YTXA 4R8NA 1LTTD 1ZKOA 3H6MA 2K5HA 4DR1L 4K3CA 4JBJA 3NUCA 3GV6A 3RLFA 1LABA 1U4PA 4OWWB 2F4VL 1IYFA 5JEAH 3I3CA 3NZ3A 4DAVA 3DM1A 2Y5PA 2QHOA 3DWGC 3ZDTA 1OXSC 1WCMG 5E6JA 2N9KA 2QKIC 5EE3A 4E71A 1UNSA 4YWMA 1BBUA 1YNND 3K6OA 2F4VQ 3I57A 1E22A 1XLPA 3A5ZB 1PRTD 2KMAA 4A3DG 2IGDA 2GBMA 2WXFA 3S1MB 1XT9B 4KHZA 3IT4B 2WIIB 1ZP0B 1BF4A 5IGEA 1O7LA 3A33B 1AZQA 1Q81C 4JYAL 1PH2A 4HEDA 4A75A 2OQKA 3ZTCA 2CH4W 3NHHA 1CKNB 1WJJA 3A1QB 5JJZA 2NBWB 4GMVA 1IBKL 2Z0DB 2EYLA 3K0YA 2K04A 3SK4A 1N9WA 2LFNA 2W9NA 3DEOA 3SU8X 3QR8A 4NAMA 1DCZA 2A6EC 5D65A 3CCJA 2E2HH 2JXTA 1VQJA 2K5VA 2K6DB 1IBKQ 3VYUA 4A3LH 5K36H 1YIWA 5DPSA 4IQZA 1IKLA 5LMNL 3CCRA 4WJPA 1KLUD 1B9NA 4YWLA 3T16A 2PEAA 2HTHA 4JX1C 1WZ0A 4M02A 2KD0A 3CF5A 3MP9A 4A3IB 3ZXRA 2MBOA 1EYGA 1LQBA 4FHKA 4UP7A 1PDXA 2OTLA 2WACA 3GDEA 2I46A 1WYDA 3IAS1 3FDTA 3H7PA 2LGIA 1L2NA 4GGQA 1QCBD 1WJ6A 3FP9A 2X6GA 3HOUG 1AYFA 1TYGB 2W54A 2M56B 3DVNV 5E6PA 4DHJB 1VJKA 1PTOD 1VQMA 1UBQA 2VQFL 4X3KA 4HJGE 2IO1B 1XTDA 3ONSA 1T0SC 3GB1A 4ZYSA 1QWYA 4B3ML 1WE7A 3QJZA 3NZUA 3BU2A 1L4DB 1MFWA 1WYGA 5LNK1 3SFEB 3Q24A 1GM5A 1QE6A 1DD2A 4K0KL 4W9DA 1WX7A 3TMEA 1Z9FA 5CHFA 4B3MQ 4DU9A 2DLBA 3GO5A 3IG3A 1WX9A 1STGA 4FF2A 1O80A 2F1MA 1WGHA 2IZVB 1E3PA 4A3JB 2KNBA 3PF4A 3UF8A 2Q5WD 2EYMA 1JJCB 4K0KQ 4OVVA 4HSPA 1F52A 2AWOA 4IWOA 2UXCQ 2MUYA 1WGDA 1AE3A 4JI4L 2F0EA 3RNAC 1WX8A 3T3NA 2DYBA 4HIKA 5M3MH 3BK2A 5KNDA 4RHSA 2NZ1D 3UE1A 1I6VC 3FKIH 5IGDA 3VR9B 4LK1C 4RFBA 1Q1BA 1L7YA 4LUVA 1WTQA 5E7NA 4BY7H 3KYHC 3MC9A 3E9SA 3I72A 1PGAA
chains in the Genus database with same CATH topology
3TP5A 5E4WC 1DONA 3O13A 2EJFC 3R93A 4ZUIA 2A5HA 4A3FB 1IYVA 2WXRA 1TWCB 1F9SA 4N58A 2K9XA 2F0MA 2HDEA 3U52E 1GHJA 5JOBA 3MWYW 2BE5C 1DZ1A 1NVID 1PZID 2D5DA 4DF7A 1XCQL 3AMZA 1Q1EA 1CM9A 2F0GA 3VA5A 4XDDA 1VCIA 1JWMD 5E1FA 2JU6X 1UEAB 4US9A 5BMHA 4ZKCB 2WQYB 2KVMA 1Q8IA 1X32A 1D4BA 4PNYA 1LTSD 3I90A 1TJEA 2PIAA 5G3LF 1L0VB 1D1IA 1OXTA 1U4RA 4L1BA 1VR9A 3JAME 2C9OA 2M0AA 5KYIA 4AYBB 4L8JA 3TEZA 1B1ZA 1VMPA 4PT5A 1HZ5A 2JZPA 2WU2B 4OZAA 2IJ0A 1A3TA 4J8QA 3KLSX 2WNMA 4FXKC 3K7AB 1I4QA 1EYCA 2SDFA 3W3AA 3OOCA 4EQNA 2EOTA 4FF3A 1SYFA 5M3FB 4YTNB 2A6HD 1CZWA 2KDMA 3AE8B 2K6AA 3KF8A 5CV7A 2L12A 3QOLA 4TKOB 1YQ3B 5NUCA 4FXDA 3K5OA 4IN3A 5C0XG 5CV8A 1VZ6A 2WAQB 2CJOA 3IFTA 3W1SA 1EY4A 3D31A 3I73A 4XDXA 1CA6A 2JYOA 4JWSC 4DN4M 5DNFA 4A8XC 5JEAG 2KUMA 1YQ4B 1XO3A 5G5GA 3EVQA 1IUEA 4TMAB 2IX1A 3VA7A 4LLGM 1S5DD 5I2YA 4CQNA 3IL8A 4C1NK 4F87A 4HEA1 4ZUJA 3GTMB 5JVH3 3KK7A 4A3BB 4RCNA 2RDFA 3R3OA 1YN5A 1U4MA 2FMMA 2TSSA 4J6HA 5K36G 3AM9A 2L1BA 2KEDA 1XX8A 1TWHB 1BCPC 4A3GB 4X3SA 2RSNA 2FFKB 2AUKA 1RYJA 1AP0A 2RQXA 2SOBA 1ILQA 1PRTB 3EROA 1YMHE 4EGVA 2DY8A 3AE2B 3U2SC 4DFAA 4MACA 3LB8C 5C5MA 1S5CD 3FPPA 2CVRA 2K28A 3OPOA 2RKSA 3X3NA 4XQNA 1SNDA 1JOQA 2AX5A 2J4XA 3K5MA 4C3IG 1F9QA 4OZCA 1SB3C 2JYTA 5BYQA 1VLBA 2K5DA 5D7GA 1MD2D 2R61A 2PLPA 5KNCA 2PCFB 3P4PB 3I8ZA 5EPLA 2I2YA 1OQRA 2RSOA 4IUUA 3DWQA 1IGCA 4NJCA 3CIRB 3SE0A 3I4NB 3NXWA 3W9CB 2LMCB 3R2IA 1PFMA 3J80E 3B2FA 2L5TA 1YNJD 1DYQA 3S1NB 1MHHE 4J1MA 3DXJC 4F88A 1IYUA 1D2BA 5CGKA 1JRPA 3J80L 3ND9A 4XIGS 5ELEA 2V3NA 2NN6I 3A7LA 4L63B 5AFWA 3R2TA 2KACA 1EOTA 3RZDB 3KBXA 1OXVA 4V0BA 1E7PB 3S1RB 4HMIA 1NYRA 1OFFA 1ACCA 2WV6D 3BDOA 1VF5C 2L0CA 1STHA 1AFPA 1PTOH 5EE0A 1QKZA 3RPFC 2VZKB 2W3SA 1ZUD2 4F8MA 4K6LA 5CMDA 4DA2A 1WGKA 1JMLA 4F7XA 5C6AA 2EJMA 2PMZB 3GP7A 3MAQA 3ZGZA 1KABA 3C3LA 1H9MA 3FRPB 1T3QA 1FNUA 2WXNA 1QJOA 4YT0B 3HRDD 2KJXA 2FBWB 4ZHPA 1OXUA 2VB3X 1V8CA 3CKIB 3OMGA 1HQMC 2IDYA 2JYEA 1HZ6A 1ZOYB 1M4VA 2FUG1 3AEFB 3MC0B 3PUXA 1RFKA 3MFGA 2CJNA 1N63A 4K6DA 2EYOA 5C3XA 3AEGB 1B2TA 2IX3A 3AECB 1UWMA 1DOYA 2HDMA 3KLSA 2WXKA 1FMAD 5FR3A 4ARIA 4J3OD 3VR6A 3LWUA 2XN9C 3GTOB 1HEZE 1LACA 3SR6A 1EEID 2A68C 1GPXA 2ICIA 3WDNA 4NMZA 2H4OA 2MP1A 1XLOA 3HP3A 5H92C 1ZYRD 4OGQC 3SHLA 1B9RA 2QSDA 5CBAE 2QEJC 2FINB 1CHQD 4KKIA 2R7ZB 2QILA 1FXAA 5I2XA 1EIGA 2NMQA 3Q6SA 1V97A 4H7BA 1K52A 1V43A 4RGMA 3AEEB 1J9OA 4FXCA 4QUCA 3CHBD 1Z7TA 3FEWX 1PUTA 3G7LA 4WIPA 5J1ZA 2IT1A 2A73B 3T13A 3QWNA 3X3MA 3BYTB 2MJEA 1TKYA 2B2TA 1QOHA 4RA8A 1ZXTA 1JE4A 3NVZA 2YEPF 5MPOA 2KA7A 3J7AF 1BUVT 3TEXA 3AH7A 1ZXHA 2PPBC 1ZDVA 3GS2A 3A54A 4FVMA 4H13C 2B2TC 3S2DB 5FOBB 2F3WA 3A7AB 1E9MA 2B76B 1Q12A 3NPPA 3QG1A 3K57A 5IGFA 4A3KB 1BCPF 2YYZA 3KQ4A 3MXGA 1FYCA 1Q3LA 1I4HA 2JWUA 2E75C 4DXFA 4DK1A 2OT2A 1HCZA 2B2UA 2JXMB 3VR5A 3GTPB 1VF7A 3DEPA 3SDZA 1V8QA 2NN6H 1EU3A 1L0XB 1SJHD 4YSZB 5A2QE 4CKBA 1KAAA 4ZRPA 3CQZB 4KY6A 1F2MA 1YNTE 4C3HG 5BYRA 1FD7D 1WTPA 4Q2JA 4UAIA 5JVG3 3AE9B 4K8JA 3ABVB 2EYHA 4P16A 3ERQA 3Q8AA 1JQ4A 4XE0A 5EKKA 1I6HB 1BQQT 5M5YB 3AE7B 2BDNA 3N9YC 1TKWB 3NS1A 5BYSA 1EWYC 2ZXRA 4A93B 3T53B 4OW0A 2K05A 2BB5A 3AU7A 4YIJA 5G3LD 3HVZA 1HA6A 2FJ2A 3SVMA 3TBIB 3WCQA 1BDOA 4TQ0A 5E4XA 2G9DA 2M00A 3T56B 1RTNA 4FO2A 1ZXIA 4L23A 1PZKD 2D5GA 2WB1B 2Y0SB 4AS1A 5CV9A 1TZOA 4XTCS 4RWSC 1YJIA 1UAPA 1KNEA 4CKEA 1ENCA 1EQTA 5LL6S 5C4ZA 2V3PA 3E5SA 2DN8A 3DUZA 1TS4A 2RBMA 5FO8B 2B2YA 5JPNC 1D5ZC 1SE3A 2OXPA 2EY1A 1EWHA 1IHZA 1SAPA 2WP8J 2DYMA 4WRDA 1G291 2B2VA 2EJGC 2BB6A 2NUCA 2KWDA 2B39A 4V190 4PQXA 4G7OC 3DWPA 3EJIA 3K59A 1YNNC 4NAWB 2F0LA 4C3JG 3KWLA 3P63A 1E2ZA 2B2YC 1PRTC 4IDIA 1WRIA 1J8IA 2ID0A 4G7ZC 2PO4A 2BA1A 3LYYA 2JP1A 1PFBA 2ACZB 4TQUS 2B2VC 3SK8A 2M19A 5EGTA 2QIEB 2PZUA 3VRBB 4YSXB 1Y69U 2F0KA 3M7NA 5CV4A 1KH0A 2L55A 2WXLA 1YJJA 5HHDG 3FKIB 1FNVA 1NYQA 1MGSA 2F0VA 3EFXD 4Q0FA 4BY7B 3SEBA 3TEWA 1BMLC 2LMCA 2A6ED 2NVQB 1KTKA 1F2RC 4GLSC 4M8AA 1JOKA 2K5WA 3MXNA 3GV3A 1BBXC 1O7YA 3ZQ4A 2MEKA 3P1MA 1G8ZD 1PXUA 2EYPA 1ET6A 3VYTA 3U7ZA 3PO3B 4MM3B 1G6ZA 4XT1B 1JWBD 4H0LC 3EQLC 4OIKA 2IWHA 1AW7A 5D14A 2B8FA 1ONLA 1RJTA 3H09A 5T1GA 3A8JE 4R9WA 5K5PA 1ENAA 5EE9A 3F2UA 3OHXC 2DNEA 3V2TA 4JPSA 3GTJB 1RM6C 1UWXA 1XTCD 1HA5A 3HOYB 4IFDG 2BOSA 1TWAB 2VB2X 3TEYA 3NTKA 1N60A 4HTHA 3SK6A 2E6XA 2WLBA 1Q10A 2LY7A 3P20A 2NN6G 4CJ2C 1F2LA 2MJ8A 1S5BD 4FYDA 4KTAA 3NQTA 4ULLA 1TT2A 1IW7D 3HOWB 4K5VA 3D6WA 2BYTA 1NSNS 3FILB 1D5MC 1JQYD 1FIQA 3MHZA 1J7BA 1DOLA 2Z4IA 1OO9B 2BE5D 5J39A 3Q8CA 2XRSD 2L9HA 2LJIA 3K5NA 5KYLA 4TQ1A 1JORA 4ZAIA 1GB4A 1H9KA 4NP5A 5J22A 3QO2A 4B0EA 2PVOD 2F0NA 1SYBA 1TWGB 2D9UA 3P4QB 3V96A 1LTBD 3MZ5A 1STBA 1SYGA 3VR4A 5CV5A 2JA7B 2PVGC 1LTGD 1F2YA 3BDCA 4OVZA 4MT5A 2PMVA 4NDXA 3SK5A 3L9AX 4ZKBB 4DQOC 2R6GA 1SNMA 1NR4A 4R3DA 2EY5A 1FFVA 2WDRB 1RWSA 1Y56A 2NTSA 2Y3AA 4R8IA 3D3RA 2CQAA 3B2GA 2HQEA 3L3OC 1II3A 5JPMC 4OO1I 4L6TB 2A6HC 1LTAD 1FO4A 3SR1A 2NB0A 1ET9A 2L52A 2KEEA 1U9RA 1PFDA 2K33A 1B4OA 2IGGA 2F0IA 2F0WA 2LKVA 4X3UA 3TZUA 3U9OA 4RNAA 4XQQA 1EIHA 4KX6B 4KGSA 1FR3A 3AE6B 2NBFA 4NW2A 2SNSA 1XEEA 1HFGA 3D4DA 3S17B 1OQQA 5C4XB 3BDLA 3ZYYX 3MFYA 1NUCA 4B9WA 4XT3B 5ELFA 1NR2A 1FCCC 2J53A 1NAPA 3C1EA 1I4XA 5ELDA 3NRZA 1XXGA 2K5QA 1O78A 1SYCA 3CWIA 1B9MA 2BS4B 2BTEA 1PRTF 1TY2A 3Q69A 3UI2A 2HCIA 2KHSA 1N5WA 1W6KA 3M7GA 1MPEA 2RDGA 5CV6A 4ZRZA 3NVWA 5KEEA 3D4WA 4I65A 1EY7A 1STNA 2F0DA 1R7SA 4MH8A 4ABNA 3RMHA 2F0HA 1A70A 1ENFA 2SAKA 5EPKA 1C8CA 1KFYB 3NVYA 2PYKA 1C4PA 3EUB2 3MHBA 3E56A 4XWTA 1JOOA 3TZDA 1GOZA 2ZXPA 1PGXA 3BVMA 1NCVA 1Y8NB 3CRLC 1STAA 1E0ZA 1BCPD 1TS2A 4XYOA 3L4PA 5HI1A 2F0OA 4S3SA 4TRDA 3HUIA 2WINB 4DNRB 1AZPA 2WDVB 3M4OB 1R9TB 2XNAC 4KN7C 2INPE 1T5XD 3BZDB 1N5XA 4LAAA 1WTVA 5M5WB 3AEDB 4HROA 4REZA 1QOAA 2QDBA 4HSVA 2EYJA 2CW0D 1CZPA 1PTOB 1SE2A 5T1IA 2VXWA 3H91A 4MN3A 1A3UA 1SNQA 1ZE3D 3S1QB 1CA5A 1KDAA 4K14A 2KQ4X 5COYA 1TS3A 1VMCA 2WXJA 2Q8IB 3K58A 1K83B 1RHPA 2D62A 3AN1A 4IFDI 1YNJC 3J9CA 2WXQA 5IOCA 3Q0AA 4GDKB 2O5JC 4KKTA 4ARCA 2JA5B 1KF6B 3PZ8A 3PUVA 1SNCA 3IAYA 1SNPA 4X3TA 1RF2D 2RMMA 4C7ZA 4CHTB 2JA6B 4L2YA 2Z4HA 2O4XA 1FEHA 2MPMA 5ELBA 1GHKA 1WCMB 5IGGA 1TR5A 4TSSA 4YWGG 4OO1H 1VRAB 2Z8LA 1V1PA 4A3DB 4QIWB 4C3JB 5BMIA 1TS5A 4JWUC 1QILA 1DOKA 4BBRB 5T8IA 4KD4A 2EZVA 1F0ZA 2QCPX 2R3ZA 2AQ3B 2F4IA 3URYA 3QOJA 3A8KE 3ZJUA 1P7FA 4NKLA 1MI0A 1FGBD 4DXGA 1M8AA 4USAA 1TIID 1B53A 4OL7A 2RVLA 1SMYD 2AWNA 5EJWA 1X3PA 2PQEA 1A15A 3B9JA 4ZHOA 1H9RA 2WKDA 4KKUA 4WAFA 3HOUB 5C2TB 2M2LA 3VR8B 5KIXA 2QJLA 2ICEC 1EY9A 1XF5L 1H9SB 1F9RA 1JCKB 1WD1A 1AEXA 5GXGB 3ZJTA 1LTID 5C0XJ 2DYOA 2ON8A 2EPBA 2V4DA 4C7YA 4C80A 1Z6HA 5FK9C 4P2CB 5IT9L 4CKCA 3LX0A 1IBXB 4PMWA 5JEAJ 3HG9A 5F2DA 1ZYRC 3P75A 3S16B 4B08A 1ZDXA 1IGDA 4WURA 2A68D 5C3JB 3V05A 3PUWA 3OMCA 4RGOS 5CR3A 1E10A 3MVVA 1KDCA 1N62A 4NZLB 4KJOA 1DOIA 2ZW0A 4B0MA 5I6YA 3FMCA 4XWWA 3IXSA 3K5LA 1C78A 3OIQA 4QF4A 3KLRA 4HCEA 2E2DC 1HXYD 4D2KA 4DGZA 3ZJVA 3NTHA 4HRSA 5KGUA 3FILA 1QF6A 2INNE 1QOBA 3NUHB 1Z47A 3MXPA 3BK1A 2M9VA 1S5ED 3OW7A 5FKAC 2BCOA 1DXMA 2K32A 1QNUA 1BUIC 3C8YA 4U68A 2V0GA 3U9SA 3TN2A 1SXTA 1TWFB 2HUGA 3FC4A 3U4EG 2F0FA 2L4NA 4IFDH 5CC4A 1XCTL 2BS2B 3NK9A 1C4AA 3BG3A 2KECA 2FMCA 1OXXK 5EKLA 1CK1A 2EE1A 4DK0A 5IGBA 4WFN3 4KN4C 3LXFA 4O42A 2MJDA 5C3EB 2KN4A 4BA1I 4WQMA 3AB5A 3LWEA 4A3EB 4IURA 1C48A 5C44B 5A35A 3EGRA 2B2UC 5E3FA 1MHXA 1E0BA 4KD3A 2XWBB 3HOZB 1QQRA 2TMPA 3A56A 3PV0A 3S15B 1FD6A 1HFNA 1MVKA 3NP8A 4BBSB 3T4AC 2F0JA 1GJXA 1DOXA 3NWSA 4BA2I 1I4PA 4QMGA 1K8MA 5ELCA 1DOMA 1SE4A 1WVLA 1I4GA 2NVXB 4US8A 4KGRA 1SSOA 2KQ3A 2OHFA 2LFIA 1EL0A 4RF0A 2V4IB 1F77A 4M0WA 1CI3M 1XLNA 2LHEA 4IZ8A 2PZWA 1MSHA 1ESRA 4CGYB 4HN7A 4ID6A 2B2WA 3S14B 4BS9A 2K03A 1J7AA 1K50A 5IIFA 1PZJD 2CHBD 2DWQA 2X69A 5CYUA 1GAQB 1SSNA 3HKZB 2A69D 4XYQA 2Z1CA 3I91A 2N0SB 3WOFA 1EY0A 4OO1G 1RD9D 3R8BA 3SXHA 1D1KA 3NQIA 1A6XA 2WXMA 4RHRA 2F03A 1B44D 1L6UA 1L5PA 5EBDA 1ICWA 3QJYA 2E2IB 2B2WC 2F0UA 1L4ZB 1WWTA 2KAJA 2WU5B 2ZT9C 4C2MB 3NVVA 2WXOA 5AUIA 1D5XC 2YU9B 1TY0A 1GUNA 3S9WA 2LUMA 4HKQA 2E2HB 4G7HC 1L0YB 2F0PA 3VQIA 3NWTA 1HUMA 3NE5B 5DEHA 1LO5D 4YSYB 4C56C 1DM0B 1XWEA 2X38A 4KY5A 1HTLD 2EY6A 1SFOB 1L6VA 2AUJD 1LLRD 3AEBB 4ODGA 1AN8A 1V1PB 3PO0A 1Q90A 4KKSA 3N6RA 1K53A 4IUNA 1O7ZA 4C3IB 1B50A 4LTUA 2H88B 2GA4B 1GB1A 4KMUC 1QB5D 3DMUA 4YTMB 5M3MB 2ENBA 2EKIA 3UI3A 5I6WA 3C2PA 2DY7A 1I3QB 1CQVA 1STYA 2EDGA 2BT6A 4ITKA 1WTRA 4HAEA 4AQ7A 1E2WA 2MH7A 2NVTB 1LT5D 3C1FA 2IW3A 1PTOC 1TQOA 1S4ZA 3AEAB 1CZGA 4N9TA 3P7JA 1NENB 1WXQA 4YXDB 4UDUC 5BN4A 4WWMA 2JEAI 3GTGB 2NVYB 3Q8FA 4A3MB 2I38A 2H89B 2B8GA 1KNAA 1I7HA 4JBWA 1U4LA 4EQPA 1JWAD 1TU2B 3D8GA 1FRDA 1UGJA 4ME5A 2L83A 2PTLA 1W6JA 1FXIA 1WD0A 2PW5A 3AE5B 2XVSA 1SF0A 4IKGA 5JXVA 4N59A 1FFUA 3PUZA 2EVBA 2EELA 3IAM1 2WXPA 3W2DA 2RPVA 4HKZE 4FXGC 3PO2B 2K1BA 1HHVA 1R4PB 3ITPA 2K3UA 2J52A 3P42A 2Y5CA 4I7ZC 1IW7C 2VZKD 1H9SA 2K0PA 4Q5VA 1AWDA 2N7JA 1HUNA 1EU4A 2IL8A 3HVDA 4JK1C 4WJWA 5DM73 3H94A 4P6VF 3CU7A 2QMTA 1IBXA 1PLFA 4XDCA 5G5HA 1JROA 2EY2A 4N6EB 2JE6I 1EM7A 1CHPD 4RCOA 3RFZB 5EKIA 4IOIE 1K8OA 2HTME 2J42A 1MI2A 4KK7A 3FVQA 1F9PA 4CBVA 1QOGA 2C5CA 3Q8EA 3GD7A 2JQRB 1PGBA 1ESFA 1BO0A 1Y1WB 1PMRA 2KCCA 1K51A 3T51B 2N9LA 3OIPA 4FF1A 2F0TA 2BW2A 2SEBD 2WDQB 2IX0A 5IGCA 1ILPA 2ZW1A 4LMQD 1Y8OB 2BDOA 1TVXA 3VYRA 1DGJA 2I07B 1RCVD 3JAML 2L1AA 1TKEA 1EZ8A 3MJ5A 5HGTA 1I4RA 4RH6A 3Q22A 2JSOA 2O5IC 2K5PA 1F2RI 1JWUD 1PYWD 3P4SB 1I50B 3T3OA 1E2VA 2R92B 1SBBB 4N9PA 4ZQ3A 3FAHA 2VNUD 3HOXB 4Z9CB 1JB3A 4G57A 2F0QA 1YN4A 4WORA 5D3IB 3HGBA 3BVZA 3J7YW 2OEDA 2KOLA 1KLGD 1FM0D 3Q23A 4OZBA 3VYSA 1C76A 3M85A 3IT6B 4ILWA 4B9XA 5C5LA 3TP8A 5BN5A 3I9V1 3I4LA 4ZOHC 3GQBA 3PMFA 1CJEA 4C3HB 4IUVA 1A2UA 4KKJA 2NYZD 4A9AA 3D4RA 1F2ZA 4QCLA 2O2LD 3FPUB 1EY5A 1A2TA 1T5EA 3H3VC 2WXHA 2E74C 4IUPA 1G91A 3DWAA 2W82A 1PFNA 2Q8TA 2IGHA 4H2AA 3DHQA 1DJRD 5IODA 1G2TA 2WP9B 1Y1VB 3M4YA 3J7AV 2DBYA 4KY7A 1EQVA 1QLBB 2J0TD 2GI9A 2LS01 3P4RB 3OWFA 5M9OA 4RF1A 1PTOF 3M3YB 4KHVA 5FO7B 3PUYA 2NTTA 2RDHA 2PKOA 1KRHA 2MHVA 2AQ2B 1JWSD 1EYAA 1GUSA 3I4MB 1FRRA 4IFDJ 2WXGA 5ISRA 2PW7A 2KMMA 2VUMB 2ZXOA 2WS3B 3VRAB 4A6QA 2CW0C 2IPKD 3H8HA 3HS0C 1JC7A 2BA0A 3ND8A 3HOVB 2OEOA 2XIWA 1SJED 2AQ1B 4JE3B 1EZ6A 2Q8RE 3W5VB 3GTKB 1SNOA 4C1NI 1EFID 4WH4A 5C4HA 1TKGA 3QB3A 3QIAA 2HCCA 3KBGA 4XQJA 3AE1B 3VR3A 1WTXA 4K5WA 3E6ZX 5EE1A 2E2JB 3NSWA 3NBIA 2BBCA 1GUWA 3GTLB 1A3VA 5I4DA 4U673 2E3TA 3DWMA 4RKLA 2MJ3A 5DAUA 2OF1A 2K22A 1S5FD 2HDLA 5I9OA 5HURA 1T6BX 4CJ0B 5KRUA 2L11A 3WOEA 3OWEB 5KNBA 2RA4A 1RKNA 1H9JA 2DNCA 3LNNA 3G6JB 1LTRD 4H44C 5CORA 3HRZC 2N88A 1G2SA 2E76C 5EQ0A 3P1HA 1LV9A 2GRIA 2PNRC 4MIUA 1SYDA 1SMYC 1RODA 4DNTB 1BXTA 1BOSA 2PW9A 4PMBA 4LK0M 4Y7NB 4DAYA 1JICA 1GUGA 3BYYB 1HTPA 4K2LA 2G9HD 5IT9E 4HCSA 2CU3A 4ZRQA 1R4QB 1JR0D 1VZ7A 3PIP3 1MBYA 3OSOA 3N52A 4O1NA 4FF4A 4GZYC 2LHDA 4XXEA 3BVGA 3RUZA 5CBEE 4EVOA 4BWGB 3E0JA 1X3QA 3TUOA 3TSSA 1WSPA 1RTOA 5DM63 3J81E 1EYDA 4KI0A 1C4CA 4A55A 1WTOA 2F0SA 3L7ZC 4RGTA 1WTWA 1SEBD 3HZXA 4RKBA 1NEKB 3J81L 1EWCA 4OHJA 2W55A 1J7CA 1V1OA 4IUTA 2XWJB 3W5UB 1QNKA 1BNZA 3EA6A 3BS1A 2EYFA 1BR9A 1SYEA 1IKMA 3RD4A 1ZPSA 3PIO3 4HR7B 4PMCA 5AUKA 3AMUA 4KJNA 3ETRA 1XYIA 5C0XI 3NTIA 1Y8PB 4EE2A 5TSSA 4K5XA 5FLXE 1QG7A 2KCNA 3MTSA 2XSCA 2D2CC 1B3AA 1UUPA 3TDQA 4MHEA 5FLXL 2K7VA 4RAUC 2PZTA 1VZ8A 2QF7A 3S2HB 5D3DA 2JSVX 5H8YE 2FHTA 4GDLB 3MXUA 3RZOB 2F3VA 5M5XB 1ROEA 2N55A 1QOFA 4BY1B 2YEPB 2NWGA 5JAVA 3BIID 1LT3D 4ZK9B 4EQOA 2ONQA 3PZ7A 4HMJA 1N61A 3KUPA 1C79A 1VDZA 5FO9B 2FE8A 2JEBI 2X6LA 1EY8A 3V3XA 4LJZC 3IKJA 1QT9A 5HFYA 1C4QA 1HQRD 3MA2B 1ML0D 2B63B 1GXDC 1HPCA 2G1EA 3C46A 3GTQB 1BCPB 1CT1D 1C9FA 4FNFA 4K8IA 4KGTA 3CRKC 3IFDA 5A2QL 1CTMA 1D6EC 1PDQA 2SNMA 5LL6X 5EPJA 3KWVA 1HRJA 2W3RA 2MGSA 2BS3B 2XRQD 1KDBA 5C3WA 4KV6A 1MSGA 2JA8B 2LEKA 3ONAB 3MEHA 1GUOA 1C77A 3AB9A 2J7ZA 4RGNA 1IL8A 4FP5D 5C4JB 4G4KA 3HEJA 4E6IA 4OIJA 5I9PA 4IUQA 2A69C 2EXZA 1XLQA 4QUFA 4PV1C 3A8IE 1CFMA 1ZEQX 4M1UB 3AE4B 2H1EA 1LT6D 3VR2A 5BMGA 3D6CA 3I70A 1SIJA 2L32A 2GB1A 2WKCA 4QB4A 1FCLA 3TP6A 1JALA 5LHY1 4DAPA 2JX5A 1YN3A 1RDPD 1GUTA 5EBCA 1LT4D 3AE3B 3H0GB 1E6EB 3NBHA 4A90A 4CJ1B 1JW9D 1STEA 3A55A 4YTPB 1NI3A 3BWUD 5BN3A 1P7EA 2K01A 5HG2A 3SFDB 4ZLTF 2WXIA 3AV8A 1FNWA 1EY6A 4K2KA 3Q8BA 1CQFA 4IALA 2A74C 2R93B 3TP7A 5C0XH 1VDVA 1EEFD 1SDFA 4R8NA 1LTTD 1ZKOA 3H6MA 3NUCA 3GV6A 3RLFA 1LABA 1U4PA 5JEAH 3I3CA 3NZ3A 4DAVA 3DM1A 2Y5PA 3DWGC 1OXSC 5E6JA 2N9KA 2QKIC 5EE3A 1UNSA 1YNND 3K6OA 3I57A 1XLPA 1PRTD 2IGDA 2WXFA 3S1MB 3IT4B 4KHZA 2WIIB 1ZP0B 1BF4A 5IGEA 1O7LA 1AZQA 4HEDA 3NHHA 5JJZA 2EYLA 3K0YA 2K04A 3SK4A 2LFNA 3DEOA 4NAMA 1DCZA 2A6EC 5D65A 2JXTA 3VYUA <