1D4BA

Cide-n domain of human cide-b
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
122
structure length
122
Chain Sequence
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN CELL DEATH-INDUCING EFFECTOR B
publication title Solution structure of the CIDE-N domain of CIDE-B and a model for CIDE-N/CIDE-N interactions in the DNA fragmentation pathway of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 2
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1999-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d4bA00
2IGDA 3UI3A 2NMQA 5BMHA 4KGTA 5HHDG 1XF5L 2KWDA 2JZPA 3V3XA 2I2YA 2N7JA 3FILB 4MACA 1HEZE 1UWXA 2OEDA 2IGHA 2N9LA 4GLSC 1IBXA 1FCLA 2KN4A 2K0PA 2ZW1A 1MHHE 1P7EA 1IGCA 2ON8A 1K53A 2LGIA 1YMHE 1ZXHA 4OZAA 1QKZA 1FD6A 4KGSA 1C9FA 1PGAA 2KACA 4OZCA 5HG2A 1XCQL 2QMTA 1MPEA 1JMLA 2EELA 4D2KA 2LUMA 1HZ5A 2JU6X 1MVKA 3MP9A 1D4BA 1K51A 2RMMA 2J53A 1EM7A 1MI0A 2KDMA 4IKGA 2ZW0A 1GB1A 2JSVX 1YNTE 2ONQA 2LHEA 1IGDA 2QSDA 1Q10A 2LHDA 1IBXB 1F2RI 3FILA 4IOIE 2N9KA 4HJGE 4KGRA 2J52A 2JWUA 2RPVA 2GI9A 1K52A 1XCTL 2PLPA 2JXTA 2I38A 2PW9A 5HI1A 4OZBA 1MHXA 1PGBA 1KH0A 1F2RC 5BMIA 1HZ6A 1P7FA 5JXVA 2GB1A 2KQ4X 1PGXA 2PTLA 1K50A 5BMGA 2IGGA 3GB1A 1GB4A 4HKZE 1FCCC 4WH4A 5HFYA
chains in the Genus database with same CATH superfamily
1MJDA 3Q6BA 5DPTA 1XLNA 4NAWA 2D07B 3NS1A 2JWZA 3PRZA 1SIFA 3V3XA 3L4PA 4HCNB 3DBHI 3V6CB 2W3RA 3GE8C 1YJIA 4N9F4 5BYSA 3DVNV 2L00B 2K3UA 1PFDA 4N58A 2V3NA 2KC1A 1IP9A 2ON8A 1CQVA 2BYEA 3EFCA 1TIFA 3AEBB 3VH3B 4B0EA 1WJ4A 3AN1A 2VZKD 1C9FA 5IKCM 4W9HA 2KWCA 1JWMD 1SE2A 1JWAD 4RFBA 1SJED 1ZOYB 2WXGA 4XWWA 3AECB 3HHMA 3PVLA 3NS8A 2NBUA 2DENB 2BF8B 1WWTA 3MC0B 3OWEB 2MSED 2OHFA 5IA7A 2NVUI 1WRDB 4LNFA 1CJEA 4ZYNA 3W1SC 4IWOA 4FJVB 3RNBC 2LVQA 3LXFA 2L8JA 2MBBB 3Q8CA 4IOIE 2J42A 3J9CA 4XYCA 1BUIC 3H7PA 2K25A 3MHSD 1QT9A 2D3CA 2JXTA 2L7RA 4GDLA 2L0FA 1EU3A 1OQRA 1PGBA 4NAMA 2ZZPB 1F2RC 2O6VB 2G4SA 1T5XD 2DZJA 1N61A 2D5GA 5BMGA 1LFDA 4EE2A 2ZVNA 1R4MB 2MLBA 4XE0A 3PT2B 5KHQA 2EMTA 1TS5A 4YXDB 5HFYA 3AE8B 3DHGC 1ZP0B 1UZXB 2JYTA 2NTTA 4HWIB 5JZEB 3AEEB 1EF5A 1E8ZA 3CWIA 2XN9C 3FILB 3R66C 5C23A 1WXSA 4LNIA 1J0GA 2GBJA 3ZDMC 4LJPB 1ZPSA 1AW7A 3CF6E 3PREA 1WMHA 4GOCA 2I1JA 4WAFA 3B1LX 4HK2A 3A1QA 3PHXB 5E6OA 3PGEA 3ZJTA 2L32A 3DWGC 3APCA 2D3AA 2KN5A 2O2VA 3L17A 2Y5BB 2K1FA 4MM3B 4JX1C 2FIDA 2KJHB 5HG2A 2DZIA 1HTQA 4FADA 2WNMA 3RN9C 1UBIA 1SSNA 4BKGA 2M17A 1K51A 2PE6B 2FIFA 2KMCA 2G1EA 2OJWA 1V81A 1H8CA 3ML8A 5EE1A 1GB1A 1YNTE 4IDIA 1U4AA 5D3IB 1IGDA 2N7DA 1B1ZA 3RPFC 2PPHA 4NQLB 2D2QA 3TMPB 4WWMA 3KUZA 2K22A 3AB5A 1Q0WB 4W9CA 1UNSA 3TIXA 4IM3A 3ZJVA 3R2IA 3GS2A 3K9OB 3APFA 2RGFA 4GXBA 4RGNA 2AL3A 5BYRA 2WXRA 2I38A 3PV1A 4YL8A 1UF0A 3BYYB 5JXVA 3NVYA 1V2YA 2OOBB 1WX9A 3MC9A 3APDA 1CMXB 2K9XA 4TV3A 4K3CA 4RF0A 1WXMA 2INPE 3Q3OC 2QILA 2K39A 2L83A 4RCOA 2Z0EB 4HKQA 1NVID 3W5UB 1LXDA 2Y5PA 1YJ1A 4HLEA 2K5PA 4UDUC 5C3JB 2N9LA 4F7ZA 2MRPA 1EWYC 5T8IA 3N3KB 3H7PB 3A4RA 1EU4A 3ZNHB 2G4DB 1STEA 4FLHA 3WIMA 4FBJB 1SJHD 1NYQA 2L0TA 4KZCA 1FFVA 4CQNA 1B9RA 4FHJA 1JMLA 1E8YA 4EKUA 1BMLC 2FCMA 3CSFA 3DBLB 2KYWA 3IBEA 4A6QA 1F77A 2C7MB 3EC8A 1WRIA 3I9V1 2LVOA 3UINB 1CK1A 2D3GA 1L0XB 1MG8A 2LGXA 4REZA 4JGHB 4P1BC 2QSDA 4MELA 1YD8U 1WGRA 4DDGD 2REXA 3ZYYX 3Q14C 1ENFA 3B2FA 4IUMB 4KV2A 4KGRA 3A1QB 3HRDD 4YTNB 3VH4B 3Q2AC 2O2VB 1P98A 1I42A 3ZXRA 5C1ZA 3PLUA 4XWTA 2KT7A 1WJUA 2UWQA 5BYQA 2NR2A 4BOZB 3RT3B 2KD0A 4ASWC 3Q8FA 1WGDA 4L2YA 1WR6E 2KX3A 2VH2A 1LO5D 3H8HA 3B9JA 1V1OA 1G6JA 2I1KA 3CSTA 4IG7B 3ZIMA 4MSMB 3QIJA 2PEAA 3UGBB 4WJPA 2V9HA 4RGOS 3V60A 3SFDB 4BAXA 1OGWA 2KDFB 2LVPA 4M0WA 1C76A 2BWFA 5TSSA 4W9KA 2BPSA 4KDLB 3VAWA 3WAOA 4PS8A 3JSVA 2FCQA 4MSQB 4OZCA 3BYTB 4WIPA 1AARA 1FPYA 1VCBA 2IYDB 3B08A 3AU5A 3UQAA 3UIOB 2UYZB 2LASA 2YVCA 4D2KA 1C3TA 2NPTA 3KLSX 3OJ3A 4AJYB 3PHWB 1E6EB 1ET9A 4EOYA 1N5WA 3L16A 1LQBA 3A4SC 2PVOD 4NJCA 4XC2A 4OVZA 2VZKB 2WDRB 4RNAA 2WX1A 1D6EC 1I4RA 2WXPA 4QAYA 1NBFC 1JWBD 2IBIB 2V1YA 5G5GA 5DPSA 1VZ8A 4XGAB 3ZTCA 2M19A 1GC7A 3Q3NC 1E9MA 1DOYA 2AX5A 1T0QC 1L6UA 5HI1A 3AXCA 1YQ4B 2LGDA 4EZKA 2ZEQA 3M95A 2GOWA 3MFGA 3QAQA 3U52E 3I3TB 5MPOA 2M56B 4S0RA 3ECIA 4P6VF 2YEPF 3LB8C 3TEYA 4YWGG 3URYA 3RZFA 3HIZA 2MW5A 1KLGD 1C4PA 3P4PB 1FMAD 4PS7A 4BVUC 3DPDA 3KYDD 3QK0A 3A9JA 1FCLA 5D94A 1XLQA 3W1YA 3M3JA 4I6LB 4BKTA 1J7BA 4YT0B 2IJ0A 4JLCA 2SEBD 2DLBA 4J3OD 1F9JA 1PGAA 4W9EA 3N9YC 1SB3C 1N6ZA 1L7YA 2EELA 1E5WA 5AUIA 1TGZB 2BT6A 3N30A 2Q5WD 3HVDA 2KMAA 3IT6B 2GBRA 1C78A 2WYQA 2DBYA 3VR8B 4LK0M 2ONQA 1QILA 3U2SC 2LHDA 3WAMA 1FRRA 2KANA 4K3BA 4RGMA 5I4DA 1JRPA 3W5VB 2AEHA 4WJOA 2J52A 3BY4B 1RWSA 2L05A 4GDKA 4ZRKA 2DX5B 1KLUD 3AH7A 3PZ8A 3JSVB 1XCTL 3C19A 2YEPB 3O13A 3VTWA 1VDVA 3BVMA 2LRWA 3IT4B 3P1MA 1EWCA 2NPTB 2KWVB 3SHQA 3NVZA 3RNFC 1KF6B 4BZAA 3QX1A 3M62B 1TJEA 1UGJA 2INCC 1ISNA 2ZPNA 1FIQA 4FN2A 3LYYA 4USAA 3ML9A 3WALA 1QOAA 5CHVC 1L0YB 1ET6A 4GU2A 2N7EA 5J18A 2E3TA 4DQOC 1XF5L 1RFAA 1V80A 1KJTA 4KIKB 2JZ3B 5CHWA 4YTPB 1JALA 2KZRA 3GE3C 2WQYB 3Q3FA 2CHWA 2LFIA 3EA6A 4ANXA 4PT5A 3NUHB 1DOXA 3DCGA 4II2B 2B3AA 2JRIB 2MWSB 2DAJA 3B2GA 3DBRB 4NQKE 2FAZA 1WGGA 2MA9B 2WP9B 2TSSA 2X38A 4HDOA 1NENB 4RF1A 2AQ2B 3RI7C 4K81A 2YLMA 3NOBA 3VQIA 1RM6C 1L4DB 2FCSA 4IW0A 3TBLD 5AZGA 1WZ3A 2RMMA 4P7IA 3ZGZA 1EM7A 1DGJA 2LMCA 2JF5A 3UQBA 3PLVA 3A9KA 2N9PC 3A9JB 1DYQA 4YSZB 1R4NB 3T3NA 3OJ4B 2RPVA 4HEA1 2KX0A 2X8XX 3RNCC 3I63C 3HVZA 3RNEC 4OZBA 3BINA 4CHKA 1D5MC 2V0GA 2EMSA 4ANUA 1TBEA 1NEKB 1D5ZC 1S1QB 2RR9A 4NJ6A 1P9DU 1LM8B 2PKOA 2OJRA 4H2AA 4KZ0A 1NYRA 4C80A 2V4LA 1K8RB 2KQSA 4W9LA 4ZYSA 4WQOB 2JX5A 3H1UA 2KXJA 4AJWA 2N9EB 1WYGA 2JZPA 3EHVA 1HQRD 2FBWB 4KDIC 1S3SG 4GLSC 4GDKB 1ZDVA 2ZCCA 1F0ZA 1JQ4A 1TZ1A 1IBXA 2KN4A 3BZDB 3Q8EA 5L83A 1MHHE 1IGCA 4ZHOA 3JW0X 2MJDA 2FUHB 2XEWA 2CHXA 1I4PA 1P0RA 1RLFA 1PYWD 4AQ7A 1QF6A 2BQQA 1SF0A 4XDDA 2BKRB 1SGHA 3P4RB 4ZRPA 1DOIA 3P4QB 4GN1A 3VTUA 1RFKA 4IWPA 3NJTA 4WWNA 3VUXA 1YN3A 3ZLZA 5IN7A 2CU1A 3NZUA 3V05A 2J53A 4G50A 4ZRJA 1VLBA 3RNAC 1C1YB 2IO2B 2ZW0A 2W55A 2WDVB 3P63A 4EFOA 3ZKJC 1I35A 1GNUA 3HK0A 1XLOA 1GJZA 2WXFA 4NAWB 1V86A 1YX6B 3H9DA 1T0YA 4II3B 1GC6A 2ZVOA 1NI2A 4IM2A 2R2OA 2KLCA 3E9SA 2AWTA 4L23A 1P7FA 2GMIC 4A55A 2VRRB 2K8CA 1FNVA 1HA5A 3RYTA 3U8ZA 3SR6A 4JQWC 2D3BA 2LD9A 2L76A 1QQRA 3L13A 4WURA 1FEHA 4AOFA 1V8CA 3VHTC 2IGDA 4ACFA 1OEYJ 4HDQA 2KMMA 2UU7A 1OTRB 2KNBA 3MTNB 1I4HA 1VRAB 2DAFA 2KDBA 5DPWA 1JW9D 5KHOA 4GMVA 1D5XC 3HM6X 3TSSA 4C56C 4CO7A 3EECA 4AP4C 2MCNB 4HPPA 3O65B 4C7ZA 4CYEA 2Y5CA 2WXQA 4NPNA 2MHJA 3D32A 2QMTA 3BK1A 4KSLC 4A90A 2FE8A 3SEBA 1MFWA 2LUMA 4JWSC 2BGFA 5G2NA 2JU6X 2DHZA 3R7RA 2GLSA 4LJOB 4GGQA 3H6NA 5JH5C 2JRHA 2LGSA 3AE5B 3PO0A 4GDLB 3HUIA 1ZXIA 2JSVX 4W9JA 4YTMB 2KKCA 1V49A 2IO3B 2LJ5A 1IBXB 4TQ0A 4MT5A 4M8NA 1MG4A 4ARCA 3DBHB 3NVWA 5G5HA 5TR5A 1OFFA 1F52A 3AI5A 1GUAB 2HDEA 4B9KA 3Q3MC 2ICIA 3IAS1 1HE8A 1XO3A 2R2QA 2PW9A 2W3SA 4XX5A 4JWUC 3DVGY 3AULA 1WF9A 1HZ6A 5AZHA 1TKYA 2PTLA 1WMHB 4LNOA 4TMAB 3VR9B 4C4VA 3IFWB 1I7HA 3R8BA 2BS4B 2JPHA 2NS5A 3C0RB 4WAAA 5JHAA 2WXKA 2OEDA 5LXIB 4ZOHC 1P3QU 2KQ7A 2IGHA 3L10B 3ZRFA 4DBGA 3AM9A 4X57B 1C79A 1P7EA 2CS4A 4FULA 3WAPA 4ICVA 4BBNC 4F1SA 4EEWA 1WJNA 5G55A 4MJSA 1WXAA 4K7SA 1N60A 3UF8A 3ETRA 4J6IA 3QQ8B 2QJLA 4KX6B 1QLBB 3P4SB 4US8A 3AE9B 3VRAB 1AWDA 1SBBB 1IUEA 3DHHC 1P1AA 3DBRI 4JE3B 2FUG1 2JZZA 5EE0A 3KWLA 1KTKA 4BKSD 3CIRB 5FR3A 2V4IB 1UUPA 5CHFA 1E8XA 2KC2A 1RRBA 2WXJA 5DCNA 2CJNA 3IG3A 2DYMA 4A3PA 3AE1B 3DQVA 3DWMA 3AMZA 1QOFA 2W9NA 1K52A 3I5JC 3M63B 2PVGC 4MGIE 2HD5B 1MHXA 1F1HA 1SXTA 1YJJA 2MX2A 1TZOA 3KUCB 3ZTDA 2RD0A 2M0XA 3ZNZB 4TSSA 2N1VA 3MC8A 2L3ZA 4ARIA 5LLIA 2IGGA 1YQBA 4EZJA 3B0AA 1GB4A 4RMAA 5CX3A 3W9CB 3PRMB 2LRUA 3E56A 3AEFB 1RAXA 4NNJB 3FAHA 2JY6A 2LGYA 1WGHA 2C9WB 1FNWA 3NG0A 3PSEB 1WH3A 5IAAC 2WS3B 2DZKA 1NI3A 1E8WA 3VVWB 2KWUB 1GG3A 4B95A 1RYJA 4WJQA 1YMHE 2WWZA 1IYFA 4Q2JA 4AS1A 4HJKA 5CTRC 3VRBB 3AE3B 3L08A 2G3QB 1XCQL 1WZ0A 3WCQA 1R4MI 2XK5A 4HROA 1J7CA 2LJIA 4C4VB 1YN4A 1A70A 1WX7A 4ICUA 1UGMA 4GIVA 1VD2A 3NY5A 2B76B 3C8YA 2CU3A 1GPXA 2BVCA 3KWVA 1F2RI 1SEBD 4PYZA 3GOEA 4XDCA 1Z5SB 5GMVA 2XBBC 4DHJD 1X1MA 2C60A 1WE7A 2IO1B 3ALBA 2LUEA 3ZNID 1UD7A 5J17A 1AYFA 3ZVVA 4MH0E 1UH6A 2ZNVC 2IY0B 2W54A 1EO6A 3RUIB 5BMIA 2GBNA 2KQ4X 3BIID 4M0WB 5L95C 4HPMB 1VR9A 3GB1A 1FCCC 1WIAA 1WYWB 1HXYD 3OAWA 4ANWA 4EUTA 4JPSA 3RMKC 4G11A 4M8MA 2E6XA 2GBKA 4L1BA 2AQ3B 2KK8A 4G3XB 2EKIA 2BTEA 5D2MB 1FFUA 4E71A 2D11A 5D3DA 2J4XA 3AE6B 2CR5A 3AE4B 2CKHB 1KLVA 1UBQA 2XNAC 3N1XC 3JYUA 4OZAA 2DWQA 1FD6A 1WE6A 3NZ3A 2DYBA 3Q8BA 1T3QA 4DDID 4DHZB 4MEMA 1IPGA 4BKSA 4ITKA 3TL5A 2KJ6A 3ENEA 3MP9A 4ZDVA 2EKEC 2LXCA 4IKGA 2BKFA 2MJEA 1WJ6A 1FXAA 4HCPB 3TEXA 3AEAB 4MGZE 2LHEA 2PIAA 2HTME 1XLPA 2V3PA 3ZDTA 3GP7A 2Z8LA 3ZRCA 2QEJC 1TYGB 4DHZE 2INDC 3U7DA 3IAM1 2N9XA 2GI9A 2SAKA 4PS3A 3R3MA 2NBWB 2BYTA 2NBVB 1L4ZB 2NCNA 2KTRA 3A33B 3ZNGC 2XK5B 2HJ8A 3DBLI 5GXGB 4N59A 2WXOA 2JT4B 1WX8A 3KYCD 5AUKA 2PJHA 4MGYE 4HPLB 2RDHA 2CJOA 2G45B 2BS2B 4LCDE 3P42A 1J7AA 3QC8B 3SFEB 2PMVA 3EUB2 3QARA 4LDTD 3U30A 2NMQA 2L1AA 4KGTA 1TS2A 2MBQA 1JRUA 2N7JA 1M94A 2LXAA 4ZRIA 1E10A 1A5RA 4E74A 3OLMD 1Q5WB 3KUDB 1LGRA 1FM0D 3Q8AA 3V6EB 2MBHA 1ZE3D 4M02A 1ACCA 3N1ZC 3T9LA 4NJ7A 1C4AA 4A8XC 1NDDA 2KO3A 3PPAA 2KFKA 4FHKA 1FRDA 5HKHA 1E7VA 2WHIA 1WFYA 1HZ5A 2RDBC 4HVBA 4KKIA 1V1PA 5LXHA 2QDFA 1YIWA 1Y8RC 2KDMA 3PRPB 4P1CC 2K6DB 2J0MA 2WXMA 1L5PA 2WU2B 3QWZB 1WI0A 3R2TA 3TCAA 1E7PB 2N4FA 3DBSA 5FKAC 3EFUA 2HJ1A 2MQJA 4PYUA 2JXXA 3I57A 2H89B 4A9AA 2JWUA 3VXWA 4W9IA 3KH0A 4PK1A 1L0VB 2Z59B 1FXTB 3GZNB 3X23A 3IHPC 4ANVA 1WY8A 4YSYB 1KRHA 1TY2A 3LDZE 1QZEA 3V62A 1YQ3B 1PGXA 3RD2A 3RZWC 1BXTA 3BWUD 4BFRA 4IWQA 2KTFA 3LJ3A 1ZDXA 5HHDG 5IP4D 2BS3B 2BW2A 3K9PB 3T3OA 1UWXA 3MHZA 1TS4A 1V5TA 2MH7A 2M0AA 3AEDB 3SDLC 4GSWA 2HTHA 2K0PA 4B0MA 4LTUA 1V97A 1FXIA 1UELA 2KTRB 3Q69A 1QKZA 2QC8A 1SE9A 3A9KB 3VDZA 3WA0A 2LZ6A 1D3ZA 1OEYA 2JQRB 3KVFB 2L52A 3RCZA 2CHZA 2ZCBA 3RULA 4ZHPA 1XEEA 1XQQA 2Y3AA 4M00A 3IXSA 1WM3A 5IO9A 5FR6A 1EUVB 1MI0A 2BYFA 2K8BA 1WM2A 1ZW7A 3IVFA 4MGKE 4TKNA 4DWFA 3N32A 2LWPA 2JYEA 1WXVA 4E3CA 2RDGA 4MDKE 1E90A 5C2TB 4GB9A 4HXDA 5EDSA 2WXNA 4XZ4A 2MBEA 1WSPA 2N9KA 4B6WA 1JWUD 3UIPB 4US9A 2KLGA 1L2NA 2FCNA 1J8CA 1OQQA 4JL9A 3AE2B 2PLPA 3AV8A 1E0ZA 2KFKB 4I6NB 1KH0A 3QHTA 3R7QA 1TS3A 4FA6A 4LNNA 4K1RB 4LLGM 4S17A 1V1PB 4AUQC 3TEWA 4IM0A 4RGTA 4HRSA 4TUUA 1XT9B 4DHJB 3Q3JA 2MBOA 3ONSA 1ROEA 4M01A 2PE9A 1C77A 1PQSA 4BBNF 1E7UA 2HE7A 2KWDA 2LEKA 2A4ZA 2DYOA 5DPRA 2I2YA 5E6JA 4DXGA 3DDCB 4MACA 1ZUD2 2V3SA 3ZXVA 4BOSC 4I6PA 3QCAA 4A3OA 5EE9A 2JVCA 3HM3A 5EE3A 1T6BX 1V5OA 4IC7B 2ACZB 2J7QB 3ZJUA 2KOXA 1XD3B 1Z2MA 1ZXHA 3RFZB 4C00A 1R7SA 1YN5A 4KGSA 2KVRA 5LNK1 4RM8A 3CMMB 1MPEA 1N5XA 1JWSD 2KDEB 2GRIA 5AEKB 1I4GA 3EGRA 2AYOB 2M1MA 2MP2A 2J0JA 4TQ1A 4URKA 2J0KA 1I4XA 2C5LC 2O6VD 2WLBA 2WDQB 1Q10A 4OW0A 3PZ7A 2WXIA 4YSXB 3VUWA 5JHBA 3PZDA 3U4EG 1H4RA 3V61A 2W82A 3JVZX 2KVZA 2INNE 3T8MA 2IO0B 2QCZA 2LI5A 1QOGA 4DXAB 2WX0A 2IDYA 1WGYA 5BO4B 2JUOA 1FO4A 4KKJA 1YOVB 2KDIA 4N6EB 2RPQA 3OG5A 2KJRA 4KVGB 4FXCA 5D6JB 1BT0A 4R3DA 1TKEA 1UWMA 4WH4A 4W9DA 4WWPA 3X0WA 3UI3A 3KQ4A 5BMHA 1I4QA 2BB6A 3SU8X 2KHWB 2ASQA 2MJ3A 3L54A 2VH1A 1TTNA 1R4NI 1VZ6A 2H88B 2QIEB 2M4NA 2WGSA 3TUOA 5H92C 4OHJA 2ZW1A 1V6EA 2A5UA 1J19A 3N1YC 4AWJA 1K53A 4WQMA 1TKGA 3TJPA 4LDTB 3TEZA 2C7NB 4OVUA 2BBCA 3S2AA 3NHEB 4KIKA 3H7SA 4LNKA 1C4CA 3BK2A 1M4VA 3P2BA 2G9HD 1MVKA 1KOTA 1D4BA 2M8SA 3NRZA 1KFYB 4EZLA 2AQ1B 2K8HA 4RM9A 5D7GA 2N1WA 2BB5A 2WXHA 2NTSA 1VZ7A 2WU5B 3U7ZA 3ZQ4A 3DOWA 4HJGE 3DVNU 1N63A 1YX5B 4OVVA 3ZO5B 1Q1OA 2DNFA 5E6NA 1PDXA 3W2DA 3N20C 2IPKD 4WWOA 3RNGC 4P16A 1ESFA 1WXQA 1XXGA 1ZKHA 2AL6A 2MP2B 3GZNI 2BWES 1HTOA 3ZUNA 3DHIC 1KM7A 1WGKA 2WDTB 3NZSA 4HKZE 2DZMA 4MJSB 2IY1B 1OQYA 3QJZA 1SE3A 4A20A 1N62A 1Y56A 1HEZE 4FJZA 2ZPYA 1TY0A 2D10A 2RSUA 2R61A 3ZW3A 3QA8A 4W9GA 4K7WA 2K6QA 2C7HA 4C7YA 2KFJA 2FNJB 2LGIA 5FK9C 1CZPA 4WJNA 3SD5A 5AZFA 4FJYA 1VJKA 4NZLB 1AN8A 2Z0DB 3VTVA 1JCKB 2KACA 2QHOA 1GAQB 3FKYA 2IZVB 4F8CB 2ZNVB 2O6VA 1WR1A 2MEKA 2WXLA 4NY0A 3AE7B 1SE4A 3W1SA 3NVVA 1PUTA 1FNUA 3DVGX 1T0RC 5J2RA 1ZGUB 3AU4A 3FC4A 4RH6A 4W9FA 1L6VA 3BVGA 3MJ5A 4O1NA 3MJWA 1TT5B 5E6PA 4ZRQA 3FILA 1JROA 2BYVE 1QOBA 2ZJDA 5IOIA 1EF1A 3KW5B 4JIOU 3L0WB 1SIJA 1GOZA 4KSKC 2KAJA 3AEGB 5H8YE 1V9JA 4DK5A 2GB1A 4G0NB 2GBMA 2N0SB 4MM3A 1K50A 3PS6A 4DXFA 3WANA 3VUYA 3BVZA 4MH8A 3VFKA 3ABVB 3PTFC 4K7UA 1T0SC
chains in the Genus database with same CATH topology
1ZDXA 4YWGG 1XLNA 1I7HA 3R8BA 3URYA 2BS4B 5HHDG 3NS1A 2BS3B 1KLGD 3V3XA 2BW2A 1C4PA 3L4PA 2W3RA 1YJIA 3P4PB 3T3OA 1UWXA 1FMAD 2WXKA 2OEDA 5BYSA 3MHZA 4ZOHC 1TS4A 2MH7A 2K3UA 2IGHA 1PFDA 2M0AA 3AEDB 4N58A 3AM9A 1C79A 1FCLA 2K0PA 1P7EA 2V3NA 1XLQA 4B0MA 4LTUA 2ON8A 1V97A 1CQVA 1FXIA 1J7BA 4YT0B 2IJ0A 2SEBD 3AEBB 3Q69A 1N60A 1QKZA 4B0EA 3ETRA 2DLBA 4J3OD 3AN1A 2VZKD 1PGAA 1C9FA 2QJLA 4KX6B 3N9YC 1QLBB 1SB3C 1JWMD 2JQRB 3P4SB 1SE2A 1JWAD 3AE9B 2EELA 1SJED 1ZOYB 2L52A 2WXGA 4RFBA 3VRAB 3AECB 1AWDA 1SBBB 4XWWA 1IUEA 5AUIA 4ZHPA 1XEEA 2BT6A 2Q5WD 2Y3AA 3HVDA 1WWTA 3IT6B 3MC0B 3IXSA 3OWEB 4JE3B 2FUG1 2OHFA 1C78A 5EE0A 1MI0A 3KWLA 1KTKA 2DBYA 3VR8B 4LK0M 2ONQA 3CIRB 1CJEA 2V4IB 1UUPA 2JYEA 5FR3A 1QILA 2RDGA 3U2SC 2LHDA 5C2TB 3LXFA 1FRRA 4RGMA 5I4DA 2WXJA 2WXNA 2CJNA 3Q8CA 1JRPA 4IOIE 2N9KA 1WSPA 3W5VB 2DYMA 2J52A 1JWUD 2J42A 3AE1B 1RWSA 3DWMA 4US9A 3J9CA 1KLUD 1QOFA 3AMZA 3AH7A 1BUIC 3PZ8A 1K52A 1OQQA 3AE2B 1XCTL 2YEPB 1QT9A 3O13A 2PLPA 3AV8A 2JXTA 2PVGC 1VDVA 1E0ZA 3BVMA 1MHXA 1EU3A 1OQRA 1PGBA 1SXTA 1YJJA 4NAMA 1KH0A 1F2RC 1TS3A 1TZOA 3IT4B 1T5XD 3P1MA 1EWCA 4LLGM 1N61A 2D5GA 3NVZA 5BMGA 1V1PB 4TSSA 1KF6B 4EE2A 4ARIA 1TJEA 1UGJA 3TEWA 1FIQA 3LYYA 2IGGA 4RGTA 4USAA 4XE0A 4HRSA 1GB4A 1TS5A 4YXDB 1QOAA 1L0YB 5HFYA 1ET6A 3W9CB 3AE8B 1ZP0B 1ROEA 2E3TA 1C77A 2JYTA 4DQOC 2NTTA 3E56A 3AEFB 1XF5L 2KWDA 2LEKA 2DYOA 2I2YA 5E6JA 4DXGA 3AEEB 3FILB 3CWIA 3FAHA 2XN9C 4MACA 4YTPB 1JALA 1ZUD2 1FNWA 2WS3B 2WQYB 1ZPSA 5EE9A 2LFIA 1NI3A 1AW7A 5EE3A 1T6BX 3EA6A 2ACZB 3ZJUA 4WAFA 1RYJA 4PT5A 1YMHE 3NUHB 1DOXA 3ZJTA 1ZXHA 2L32A 3RFZB 3DWGC 1R7SA 1YN5A 3B2GA 4Q2JA 4AS1A 4KGSA 3VRBB 4MM3B 3AE3B 4JX1C 2WP9B 5LNK1 2TSSA 5HG2A 1XCQL 2X38A 3WCQA 1NENB 4RF1A 1MPEA 1N5XA 2AQ2B 4HROA 1JWSD 2WNMA 1J7CA 2GRIA 1I4GA 2LJIA 3EGRA 3VQIA 1SSNA 1RM6C 1L4DB 1YN4A 1K51A 1A70A 2RMMA 4TQ1A 2G1EA 3ZGZA 1EM7A 1DGJA 5EE1A 1GB1A 1I4XA 1YNTE 2LMCA 4IDIA 5D3IB 1IGDA 2WLBA 2B76B 2WDQB 1B1ZA 1Q10A 3C8YA 3PZ7A 4OW0A 2CU3A 3RPFC 1GPXA 3KWVA 2WXIA 1F2RI 1DYQA 4WWMA 4YSXB 2K22A 1SEBD 3U4EG 3AB5A 4XDCA 4US8A 2W82A 1UNSA 2INNE 4YSZB 3ZJVA 3R2IA 3GS2A 3T3NA 2RPVA 4HEA1 1QOGA 1AYFA 4RGNA 5BYRA 3HVZA 2WXRA 2I38A 2IDYA 4OZBA 1FO4A 4KKJA 1D5MC 2V0GA 2W54A 3BYYB 5BMIA 1NEKB 4N6EB 5JXVA 1D5ZC 2KQ4X 3NVYA 3BIID 2PKOA 4FXCA 2K9XA 4H2AA 4R3DA 1TKEA 1UWMA 1VR9A 4RF0A 1NYRA 3GB1A 4C80A 4WH4A 1FCCC 2INPE 2QILA 1HXYD 4ZYSA 2L83A 3UI3A 3KQ4A 2JX5A 5BMHA 4JPSA 4RCOA 1I4QA 2BB6A 4HKQA 1WYGA 2E6XA 2JZPA 1NVID 2MJ3A 1HQRD 2AQ3B 4L1BA 2FBWB 3W5UB 1VZ6A 2Y5PA 2H88B 2K5PA 2QIEB 4UDUC 5C3JB 2EKIA 4GLSC 2N9LA 2BTEA 1EWYC 4GDKB 5T8IA 3TUOA 1FFUA 1ZDVA 1F0ZA 5H92C 4OHJA 1JQ4A 1IBXA 2KN4A 3BZDB 3Q8EA 2ZW1A 1MHHE 1IGCA 4ZHOA 5D3DA 1EU4A 1K53A 2J4XA 3AE4B 2MJDA 3AE6B 1I4PA 1STEA 1PYWD 4WQMA 1TKGA 2XNAC 1SJHD 4AQ7A 1QF6A 4OZAA 1SF0A 2DWQA 3TEZA 4XDDA 1FD6A 1NYQA 3NZ3A 3P4RB 4ZRPA 3Q8BA 1T3QA 1DOIA 2BBCA 1FFVA 4CQNA 3P4QB 1B9RA 1RFKA 1JMLA 1BMLC 1C4CA 3BK2A 4ITKA 1M4VA 4A6QA 1F77A 1YN3A 2G9HD 1MVKA 3MP9A 3V05A 1WRIA 3I9V1 1D4BA 3NRZA 2J53A 1KFYB 1VLBA 2AQ1B 1CK1A 4IKGA 2ZW0A 1L0XB 2MJEA 1FXAA 5D7GA 4REZA 3TEXA 2W55A 2WDVB 3AEAB 3P63A 2LHEA 2PIAA 2BB5A 2WXHA 2NTSA 2QSDA 2HTME 1XLPA 2V3PA 3GP7A 3ZYYX 1VZ7A 2Z8LA 2QEJC 1TYGB 2WU5B 3U7ZA 3ZQ4A 1ENFA 3B2FA 1XLOA 4HJGE 4KGRA 3HRDD 3IAM1 1N63A 4YTNB 2WXFA 4NAWB 2GI9A 2SAKA 1PDXA 2BYTA 1L4ZB 3W2DA 3E9SA 4XWTA 5GXGB 4L23A 4N59A 2WXOA 1P7FA 5AUKA 5BYQA 2IPKD 4A55A 2RDHA 1FNVA 1HA5A 2CJOA 2BS2B 3SR6A 4P16A 1ESFA 1WXQA 1XXGA 3P42A 3Q8FA 1J7AA 4L2YA 3SFEB 2PMVA 1LO5D 1WGKA 1QQRA 3EUB2 4HKZE 3H8HA 1FEHA 4WURA 1V8CA 3B9JA 1V1OA 2IGDA 1SE3A 2NMQA 2L1AA 2KMMA 4KGTA 1I4HA 1TS2A 1VRAB 2N7JA 1N62A 1Y56A 1E10A 1HEZE 1JW9D 4RGOS 1TY0A 1D5XC 3SFDB 2R61A 3TSSA 4C56C 1FM0D 3Q8AA 4C7YA 4M0WA 1C76A 2LGIA 4C7ZA 5FK9C 1CZPA 2Y5CA 5TSSA 2WXQA 1ZE3D 1ACCA 1VJKA 4NZLB 1AN8A 1JCKB 2KACA 4OZCA 3BYTB 1C4AA 4WIPA 4A8XC 1GAQB 2QMTA 3BK1A 4A90A 2FE8A 3SEBA 1FRDA 4D2KA 2LUMA 1HZ5A 4JWSC 2JU6X 2MEKA 3KLSX 2WXLA 4KKIA 1V1PA 3AE7B 1SE4A 3W1SA 3NVVA 1PUTA 3AE5B 1FNUA 3PO0A 4GDLB 2KDMA 1E6EB 1ET9A 3HUIA 1ZXIA 1N5WA 2JSVX 2WXMA 4YTMB 1L5PA 2WU2B 2PVOD 3FC4A 3R2TA 4RH6A 1E7PB 4NJCA 1L6VA 3BVGA 3MJ5A 4O1NA 4OVZA 5FKAC 2VZKB 4TQ0A 1IBXB 4MT5A 2WDRB 3FILA 4ZRQA 4RNAA 4ARCA 1D6EC 1I4RA 3NVWA 3I57A 5G5HA 2WXPA 1JROA 1OFFA 2H89B 4A9AA 1QOBA 2JWUA 1JWBD 5G5GA 1VZ8A 1L0VB 2HDEA 2M19A 1E9MA 1DOYA 2ICIA 2AX5A 1L6UA 3IAS1 1XO3A 1SIJA 1GOZA 2PW9A 2W3SA 4YSYB 5HI1A 1YQ4B 1KRHA 1TY2A 4JWUC 2KAJA 3AEGB 5H8YE 1HZ6A 3MFGA 2GB1A 3U52E 1TKYA 1YQ3B 2N0SB 1PGXA 2PTLA 5MPOA 1K50A 4DXFA 2M56B 3BVZA 4MH8A 3ABVB 1BXTA 3BWUD 4P6VF 4TMAB 3VR9B 2YEPF 3LB8C 3TEYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  3UI3 A;  2NMQ A;  5BMH A;  4KGT A;  5HHD G;  1XF5 L;  2KWD A;  2JZP A;  3V3X A;  2I2Y A;  2N7J A;  3FIL B;  4MAC A;  1HEZ E;  1UWX A;  2OED A;  2IGH A;  2N9L A;  4GLS C;  1IBX A;  1FCL A;  2KN4 A;  2K0P A;  2ZW1 A;  1MHH E;  1P7E A;  1IGC A;  2ON8 A;  1K53 A;  2LGI A;  1YMH E;  1ZXH A;  4OZA A;  1QKZ A;  1FD6 A;  4KGS A;  1C9F A;  1PGA A;  2KAC A;  4OZC A;  5HG2 A;  1XCQ L;  2QMT A;  1MPE A;  1JML A;  2EEL A;  4D2K A;  2LUM A;  1HZ5 A;  2JU6 X;  1MVK A;  3MP9 A;  1D4B A;  1K51 A;  2RMM A;  2J53 A;  1EM7 A;  1MI0 A;  2KDM A;  4IKG A;  2ZW0 A;  1GB1 A;  2JSV X;  1YNT E;  2ONQ A;  2LHE A;  1IGD A;  2QSD A;  1Q10 A;  2LHD A;  1IBX B;  1F2R I;  3FIL A;  4IOI E;  2N9K A;  4HJG E;  4KGR A;  2J52 A;  2JWU A;  2RPV A;  2GI9 A;  1K52 A;  1XCT L;  2PLP A;  2JXT A;  2I38 A;  2PW9 A;  5HI1 A;  4OZB A;  1MHX A;  1PGB A;  1KH0 A;  1F2R C;  5BMI A;  1HZ6 A;  1P7F A;  5JXV A;  2GB1 A;  2KQ4 X;  1PGX A;  2PTL A;  1K50 A;  5BMG A;  2IGG A;  3GB1 A;  1GB4 A;  4HKZ E;  1FCC C;  4WH4 A;  5HFY A; 
#chains in the Genus database with same CATH topology
 1MJD A;  3Q6B A;  5DPT A;  1XLN A;  4NAW A;  2D07 B;  3NS1 A;  2JWZ A;  3PRZ A;  1SIF A;  3V3X A;  3L4P A;  4HCN B;  3DBH I;  3V6C B;  2W3R A;  3GE8 C;  1YJI A;  4N9F 4;  5BYS A;  3DVN V;  2L00 B;  2K3U A;  1PFD A;  4N58 A;  2V3N A;  2KC1 A;  1IP9 A;  2ON8 A;  1CQV A;  2BYE A;  3EFC A;  1TIF A;  3AEB B;  3VH3 B;  4B0E A;  1WJ4 A;  3AN1 A;  2VZK D;  1C9F A;  5IKC M;  4W9H A;  2KWC A;  1JWM D;  1SE2 A;  1JWA D;  4RFB A;  1SJE D;  1ZOY B;  2WXG A;  4XWW A;  3AEC B;  3HHM A;  3PVL A;  3NS8 A;  2NBU A;  2DEN B;  2BF8 B;  1WWT A;  3MC0 B;  3OWE B;  2MSE D;  2OHF A;  5IA7 A;  2NVU I;  1WRD B;  4LNF A;  1CJE A;  4ZYN A;  3W1S C;  4IWO A;  4FJV B;  3RNB C;  2LVQ A;  3LXF A;  2L8J A;  2MBB B;  3Q8C A;  4IOI E;  2J42 A;  3J9C A;  4XYC A;  1BUI C;  3H7P A;  2K25 A;  3MHS D;  1QT9 A;  2D3C A;  2JXT A;  2L7R A;  4GDL A;  2L0F A;  1EU3 A;  1OQR A;  1PGB A;  4NAM A;  2ZZP B;  1F2R C;  2O6V B;  2G4S A;  1T5X D;  2DZJ A;  1N61 A;  2D5G A;  5BMG A;  1LFD A;  4EE2 A;  2ZVN A;  1R4M B;  2MLB A;  4XE0 A;  3PT2 B;  5KHQ A;  2EMT A;  1TS5 A;  4YXD B;  5HFY A;  3AE8 B;  3DHG C;  1ZP0 B;  1UZX B;  2JYT A;  2NTT A;  4HWI B;  5JZE B;  3AEE B;  1EF5 A;  1E8Z A;  3CWI A;  2XN9 C;  3FIL B;  3R66 C;  5C23 A;  1WXS A;  4LNI A;  1J0G A;  2GBJ A;  3ZDM C;  4LJP B;  1ZPS A;  1AW7 A;  3CF6 E;  3PRE A;  1WMH A;  4GOC A;  2I1J A;  4WAF A;  3B1L X;  4HK2 A;  3A1Q A;  3PHX B;  5E6O A;  3PGE A;  3ZJT A;  2L32 A;  3DWG C;  3APC A;  2D3A A;  2KN5 A;  2O2V A;  3L17 A;  2Y5B B;  2K1F A;  4MM3 B;  4JX1 C;  2FID A;  2KJH B;  5HG2 A;  2DZI A;  1HTQ A;  4FAD A;  2WNM A;  3RN9 C;  1UBI A;  1SSN A;  4BKG A;  2M17 A;  1K51 A;  2PE6 B;  2FIF A;  2KMC A;  2G1E A;  2OJW A;  1V81 A;  1H8C A;  3ML8 A;  5EE1 A;  1GB1 A;  1YNT E;  4IDI A;  1U4A A;  5D3I B;  1IGD A;  2N7D A;  1B1Z A;  3RPF C;  2PPH A;  4NQL B;  2D2Q A;  3TMP B;  4WWM A;  3KUZ A;  2K22 A;  3AB5 A;  1Q0W B;  4W9C A;  1UNS A;  3TIX A;  4IM3 A;  3ZJV A;  3R2I A;  3GS2 A;  3K9O B;  3APF A;  2RGF A;  4GXB A;  4RGN A;  2AL3 A;  5BYR A;  2WXR A;  2I38 A;  3PV1 A;  4YL8 A;  1UF0 A;  3BYY B;  5JXV A;  3NVY A;  1V2Y A;  2OOB B;  1WX9 A;  3MC9 A;  3APD A;  1CMX B;  2K9X A;  4TV3 A;  4K3C A;  4RF0 A;  1WXM A;  2INP E;  3Q3O C;  2QIL A;  2K39 A;  2L83 A;  4RCO A;  2Z0E B;  4HKQ A;  1NVI D;  3W5U B;  1LXD A;  2Y5P A;  1YJ1 A;  4HLE A;  2K5P A;  4UDU C;  5C3J B;  2N9L A;  4F7Z A;  2MRP A;  1EWY C;  5T8I A;  3N3K B;  3H7P B;  3A4R A;  1EU4 A;  3ZNH B;  2G4D B;  1STE A;  4FLH A;  3WIM A;  4FBJ B;  1SJH D;  1NYQ A;  2L0T A;  4KZC A;  1FFV A;  4CQN A;  1B9R A;  4FHJ A;  1JML A;  1E8Y A;  4EKU A;  1BML C;  2FCM A;  3CSF A;  3DBL B;  2KYW A;  3IBE A;  4A6Q A;  1F77 A;  2C7M B;  3EC8 A;  1WRI A;  3I9V 1;  2LVO A;  3UIN B;  1CK1 A;  2D3G A;  1L0X B;  1MG8 A;  2LGX A;  4REZ A;  4JGH B;  4P1B C;  2QSD A;  4MEL A;  1YD8 U;  1WGR A;  4DDG D;  2REX A;  3ZYY X;  3Q14 C;  1ENF A;  3B2F A;  4IUM B;  4KV2 A;  4KGR A;  3A1Q B;  3HRD D;  4YTN B;  3VH4 B;  3Q2A C;  2O2V B;  1P98 A;  1I42 A;  3ZXR A;  5C1Z A;  3PLU A;  4XWT A;  2KT7 A;  1WJU A;  2UWQ A;  5BYQ A;  2NR2 A;  4BOZ B;  3RT3 B;  2KD0 A;  4ASW C;  3Q8F A;  1WGD A;  4L2Y A;  1WR6 E;  2KX3 A;  2VH2 A;  1LO5 D;  3H8H A;  3B9J A;  1V1O A;  1G6J A;  2I1K A;  3CST A;  4IG7 B;  3ZIM A;  4MSM B;  3QIJ A;  2PEA A;  3UGB B;  4WJP A;  2V9H A;  4RGO S;  3V60 A;  3SFD B;  4BAX A;  1OGW A;  2KDF B;  2LVP A;  4M0W A;  1C76 A;  2BWF A;  5TSS A;  4W9K A;  2BPS A;  4KDL B;  3VAW A;  3WAO A;  4PS8 A;  3JSV A;  2FCQ A;  4MSQ B;  4OZC A;  3BYT B;  4WIP A;  1AAR A;  1FPY A;  1VCB A;  2IYD B;  3B08 A;  3AU5 A;  3UQA A;  3UIO B;  2UYZ B;  2LAS A;  2YVC A;  4D2K A;  1C3T A;  2NPT A;  3KLS X;  3OJ3 A;  4AJY B;  3PHW B;  1E6E B;  1ET9 A;  4EOY A;  1N5W A;  3L16 A;  1LQB A;  3A4S C;  2PVO D;  4NJC A;  4XC2 A;  4OVZ A;  2VZK B;  2WDR B;  4RNA A;  2WX1 A;  1D6E C;  1I4R A;  2WXP A;  4QAY A;  1NBF C;  1JWB D;  2IBI B;  2V1Y A;  5G5G A;  5DPS A;  1VZ8 A;  4XGA B;  3ZTC A;  2M19 A;  1GC7 A;  3Q3N C;  1E9M A;  1DOY A;  2AX5 A;  1T0Q C;  1L6U A;  5HI1 A;  3AXC A;  1YQ4 B;  2LGD A;  4EZK A;  2ZEQ A;  3M95 A;  2GOW A;  3MFG A;  3QAQ A;  3U52 E;  3I3T B;  5MPO A;  2M56 B;  4S0R A;  3ECI A;  4P6V F;  2YEP F;  3LB8 C;  3TEY A;  4YWG G;  3URY A;  3RZF A;  3HIZ A;  2MW5 A;  1KLG D;  1C4P A;  3P4P B;  1FMA D;  4PS7 A;  4BVU C;  3DPD A;  3KYD D;  3QK0 A;  3A9J A;  1FCL A;  5D94 A;  1XLQ A;  3W1Y A;  3M3J A;  4I6L B;  4BKT A;  1J7B A;  4YT0 B;  2IJ0 A;  4JLC A;  2SEB D;  2DLB A;  4J3O D;  1F9J A;  1PGA A;  4W9E A;  3N9Y C;  1SB3 C;  1N6Z A;  1L7Y A;  2EEL A;  1E5W A;  5AUI A;  1TGZ B;  2BT6 A;  3N30 A;  2Q5W D;  3HVD A;  2KMA A;  3IT6 B;  2GBR A;  1C78 A;  2WYQ A;  2DBY A;  3VR8 B;  4LK0 M;  2ONQ A;  1QIL A;  3U2S C;  2LHD A;  3WAM A;  1FRR A;  2KAN A;  4K3B A;  4RGM A;  5I4D A;  1JRP A;  3W5V B;  2AEH A;  4WJO A;  2J52 A;  3BY4 B;  1RWS A;  2L05 A;  4GDK A;  4ZRK A;  2DX5 B;  1KLU D;  3AH7 A;  3PZ8 A;  3JSV B;  1XCT L;  3C19 A;  2YEP B;  3O13 A;  3VTW A;  1VDV A;  3BVM A;  2LRW A;  3IT4 B;  3P1M A;  1EWC A;  2NPT B;  2KWV B;  3SHQ A;  3NVZ A;  3RNF C;  1KF6 B;  4BZA A;  3QX1 A;  3M62 B;  1TJE A;  1UGJ A;  2INC C;  1ISN A;  2ZPN A;  1FIQ A;  4FN2 A;  3LYY A;  4USA A;  3ML9 A;  3WAL A;  1QOA A;  5CHV C;  1L0Y B;  1ET6 A;  4GU2 A;  2N7E A;  5J18 A;  2E3T A;  4DQO C;  1XF5 L;  1RFA A;  1V80 A;  1KJT A;  4KIK B;  2JZ3 B;  5CHW A;  4YTP B;  1JAL A;  2KZR A;  3GE3 C;  2WQY B;  3Q3F A;  2CHW A;  2LFI A;  3EA6 A;  4ANX A;  4PT5 A;  3NUH B;  1DOX A;  3DCG A;  4II2 B;  2B3A A;  2JRI B;  2MWS B;  2DAJ A;  3B2G A;  3DBR B;  4NQK E;  2FAZ A;  1WGG A;  2MA9 B;  2WP9 B;  2TSS A;  2X38 A;  4HDO A;  1NEN B;  4RF1 A;  2AQ2 B;  3RI7 C;  4K81 A;  2YLM A;  3NOB A;  3VQI A;  1RM6 C;  1L4D B;  2FCS A;  4IW0 A;  3TBL D;  5AZG A;  1WZ3 A;  2RMM A;  4P7I A;  3ZGZ A;  1EM7 A;  1DGJ A;  2LMC A;  2JF5 A;  3UQB A;  3PLV A;  3A9K A;  2N9P C;  3A9J B;  1DYQ A;  4YSZ B;  1R4N B;  3T3N A;  3OJ4 B;  2RPV A;  4HEA 1;  2KX0 A;  2X8X X;  3RNC C;  3I63 C;  3HVZ A;  3RNE C;  4OZB A;  3BIN A;  4CHK A;  1D5M C;  2V0G A;  2EMS A;  4ANU A;  1TBE A;  1NEK B;  1D5Z C;  1S1Q B;  2RR9 A;  4NJ6 A;  1P9D U;  1LM8 B;  2PKO A;  2OJR A;  4H2A A;  4KZ0 A;  1NYR A;  4C80 A;  2V4L A;  1K8R B;  2KQS A;  4W9L A;  4ZYS A;  4WQO B;  2JX5 A;  3H1U A;  2KXJ A;  4AJW A;  2N9E B;  1WYG A;  2JZP A;  3EHV A;  1HQR D;  2FBW B;  4KDI C;  1S3S G;  4GLS C;  4GDK B;  1ZDV A;  2ZCC A;  1F0Z A;  1JQ4 A;  1TZ1 A;  1IBX A;  2KN4 A;  3BZD B;  3Q8E A;  5L83 A;  1MHH E;  1IGC A;  4ZHO A;  3JW0 X;  2MJD A;  2FUH B;  2XEW A;  2CHX A;  1I4P A;  1P0R A;  1RLF A;  1PYW D;  4AQ7 A;  1QF6 A;  2BQQ A;  1SF0 A;  4XDD A;  2BKR B;  1SGH A;  3P4R B;  4ZRP A;  1DOI A;  3P4Q B;  4GN1 A;  3VTU A;  1RFK A;  4IWP A;  3NJT A;  4WWN A;  3VUX A;  1YN3 A;  3ZLZ A;  5IN7 A;  2CU1 A;  3NZU A;  3V05 A;  2J53 A;  4G50 A;  4ZRJ A;  1VLB A;  3RNA C;  1C1Y B;  2IO2 B;  2ZW0 A;  2W55 A;  2WDV B;  3P63 A;  4EFO A;  3ZKJ C;  1I35 A;  1GNU A;  3HK0 A;  1XLO A;  1GJZ A;  2WXF A;  4NAW B;  1V86 A;  1YX6 B;  3H9D A;  1T0Y A;  4II3 B;  1GC6 A;  2ZVO A;  1NI2 A;  4IM2 A;  2R2O A;  2KLC A;  3E9S A;  2AWT A;  4L23 A;  1P7F A;  2GMI C;  4A55 A;  2VRR B;  2K8C A;  1FNV A;  1HA5 A;  3RYT A;  3U8Z A;  3SR6 A;  4JQW C;  2D3B A;  2LD9 A;  2L76 A;  1QQR A;  3L13 A;  4WUR A;  1FEH A;  4AOF A;  1V8C A;  3VHT C;  2IGD A;  4ACF A;  1OEY J;  4HDQ A;  2KMM A;  2UU7 A;  1OTR B;  2KNB A;  3MTN B;  1I4H A;  1VRA B;  2DAF A;  2KDB A;  5DPW A;  1JW9 D;  5KHO A;  4GMV A;  1D5X C;  3HM6 X;  3TSS A;  4C56 C;  4CO7 A;  3EEC A;  4AP4 C;  2MCN B;  4HPP A;  3O65 B;  4C7Z A;  4CYE A;  2Y5C A;  2WXQ A;  4NPN A;  2MHJ A;  3D32 A;  2QMT A;  3BK1 A;  4KSL C;  4A90 A;  2FE8 A;  3SEB A;  1MFW A;  2LUM A;  4JWS C;  2BGF A;  5G2N A;  2JU6 X;  2DHZ A;  3R7R A;  2GLS A;  4LJO B;  4GGQ A;  3H6N A;  5JH5 C;  2JRH A;  2LGS A;  3AE5 B;  3PO0 A;  4GDL B;  3HUI A;  1ZXI A;  2JSV X;  4W9J A;  4YTM B;  2KKC A;  1V49 A;  2IO3 B;  2LJ5 A;  1IBX B;  4TQ0 A;  4MT5 A;  4M8N A;  1MG4 A;  4ARC A;  3DBH B;  3NVW A;  5G5H A;  5TR5 A;  1OFF A;  1F52 A;  3AI5 A;  1GUA B;  2HDE A;  4B9K A;  3Q3M C;  2ICI A;  3IAS 1;  1HE8 A;  1XO3 A;  2R2Q A;  2PW9 A;  2W3S A;  4XX5 A;  4JWU C;  3DVG Y;  3AUL A;  1WF9 A;  1HZ6 A;  5AZH A;  1TKY A;  2PTL A;  1WMH B;  4LNO A;  4TMA B;  3VR9 B;  4C4V A;  3IFW B;  1I7H A;  3R8B A;  2BS4 B;  2JPH A;  2NS5 A;  3C0R B;  4WAA A;  5JHA A;  2WXK A;  2OED A;  5LXI B;  4ZOH C;  1P3Q U;  2KQ7 A;  2IGH A;  3L10 B;  3ZRF A;  4DBG A;  3AM9 A;  4X57 B;  1C79 A;  1P7E A;  2CS4 A;  4FUL A;  3WAP A;  4ICV A;  4BBN C;  4F1S A;  4EEW A;  1WJN A;  5G55 A;  4MJS A;  1WXA A;  4K7S A;  1N60 A;  3UF8 A;  3ETR A;  4J6I A;  3QQ8 B;  2QJL A;  4KX6 B;  1QLB B;  3P4S B;  4US8 A;  3AE9 B;  3VRA B;  1AWD A;  1SBB B;  1IUE A;  3DHH C;  1P1A A;  3DBR I;  4JE3 B;  2FUG 1;  2JZZ A;  5EE0 A;  3KWL A;  1KTK A;  4BKS D;  3CIR B;  5FR3 A;  2V4I B;  1UUP A;  5CHF A;  1E8X A;  2KC2 A;  1RRB A;  2WXJ A;  5DCN A;  2CJN A;  3IG3 A;  2DYM A;  4A3P A;  3AE1 B;  3DQV A;  3DWM A;  3AMZ A;  1QOF A;  2W9N A;  1K52 A;  3I5J C;  3M63 B;  2PVG C;  4MGI E;  2HD5 B;  1MHX A;  1F1H A;  1SXT A;  1YJJ A;  2MX2 A;  1TZO A;  3KUC B;  3ZTD A;  2RD0 A;  2M0X A;  3ZNZ B;  4TSS A;  2N1V A;  3MC8 A;  2L3Z A;  4ARI A;  5LLI A;  2IGG A;  1YQB A;  4EZJ A;  3B0A A;  1GB4 A;  4RMA A;  5CX3 A;  3W9C B;  3PRM B;  2LRU A;  3E56 A;  3AEF B;  1RAX A;  4NNJ B;  3FAH A;  2JY6 A;  2LGY A;  1WGH A;  2C9W B;  1FNW A;  3NG0 A;  3PSE B;  1WH3 A;  5IAA C;  2WS3 B;  2DZK A;  1NI3 A;  1E8W A;  3VVW B;  2KWU B;  1GG3 A;  4B95 A;  1RYJ A;  4WJQ A;  1YMH E;  2WWZ A;  1IYF A;  4Q2J A;  4AS1 A;  4HJK A;  5CTR C;  3VRB B;  3AE3 B;  3L08 A;  2G3Q B;  1XCQ L;  1WZ0 A;  3WCQ A;  1R4M I;  2XK5 A;  4HRO A;  1J7C A;  2LJI A;  4C4V B;  1YN4 A;  1A70 A;  1WX7 A;  4ICU A;  1UGM A;  4GIV A;  1VD2 A;  3NY5 A;  2B76 B;  3C8Y A;  2CU3 A;  1GPX A;  2BVC A;  3KWV A;  1F2R I;  1SEB D;  4PYZ A;  3GOE A;  4XDC A;  1Z5S B;  5GMV A;  2XBB C;  4DHJ D;  1X1M A;  2C60 A;  1WE7 A;  2IO1 B;  3ALB A;  2LUE A;  3ZNI D;  1UD7 A;  5J17 A;  1AYF A;  3ZVV A;  4MH0 E;  1UH6 A;  2ZNV C;  2IY0 B;  2W54 A;  1EO6 A;  3RUI B;  5BMI A;  2GBN A;  2KQ4 X;  3BII D;  4M0W B;  5L95 C;  4HPM B;  1VR9 A;  3GB1 A;  1FCC C;  1WIA A;  1WYW B;  1HXY D;  3OAW A;  4ANW A;  4EUT A;  4JPS A;  3RMK C;  4G11 A;  4M8M A;  2E6X A;  2GBK A;  4L1B A;  2AQ3 B;  2KK8 A;  4G3X B;  2EKI A;  2BTE A;  5D2M B;  1FFU A;  4E71 A;  2D11 A;  5D3D A;  2J4X A;  3AE6 B;  2CR5 A;  3AE4 B;  2CKH B;  1KLV A;  1UBQ A;  2XNA C;  3N1X C;  3JYU A;  4OZA A;  2DWQ A;  1FD6 A;  1WE6 A;  3NZ3 A;  2DYB A;  3Q8B A;  1T3Q A;  4DDI D;  4DHZ B;  4MEM A;  1IPG A;  4BKS A;  4ITK A;  3TL5 A;  2KJ6 A;  3ENE A;  3MP9 A;  4ZDV A;  2EKE C;  2LXC A;  4IKG A;  2BKF A;  2MJE A;  1WJ6 A;  1FXA A;  4HCP B;  3TEX A;  3AEA B;  4MGZ E;  2LHE A;  2PIA A;  2HTM E;  1XLP A;  2V3P A;  3ZDT A;  3GP7 A;  2Z8L A;  3ZRC A;  2QEJ C;  1TYG B;  4DHZ E;  2IND C;  3U7D A;  3IAM 1;  2N9X A;  2GI9 A;  2SAK A;  4PS3 A;  3R3M A;  2NBW B;  2BYT A;  2NBV B;  1L4Z B;  2NCN A;  2KTR A;  3A33 B;  3ZNG C;  2XK5 B;  2HJ8 A;  3DBL I;  5GXG B;  4N59 A;  2WXO A;  2JT4 B;  1WX8 A;  3KYC D;  5AUK A;  2PJH A;  4MGY E;  4HPL B;  2RDH A;  2CJO A;  2G45 B;  2BS2 B;  4LCD E;  3P42 A;  1J7A A;  3QC8 B;  3SFE B;  2PMV A;  3EUB 2;  3QAR A;  4LDT D;  3U30 A;  2NMQ A;  2L1A A;  4KGT A;  1TS2 A;  2MBQ A;  1JRU A;  2N7J A;  1M94 A;  2LXA A;  4ZRI A;  1E10 A;  1A5R A;  4E74 A;  3OLM D;  1Q5W B;  3KUD B;  1LGR A;  1FM0 D;  3Q8A A;  3V6E B;  2MBH A;  1ZE3 D;  4M02 A;  1ACC A;  3N1Z C;  3T9L A;  4NJ7 A;  1C4A A;  4A8X C;  1NDD A;  2KO3 A;  3PPA A;  2KFK A;  4FHK A;  1FRD A;  5HKH A;  1E7V A;  2WHI A;  1WFY A;  1HZ5 A;  2RDB C;  4HVB A;  4KKI A;  1V1P A;  5LXH A;  2QDF A;  1YIW A;  1Y8R C;  2KDM A;  3PRP B;  4P1C C;  2K6D B;  2J0M A;  2WXM A;  1L5P A;  2WU2 B;  3QWZ B;  1WI0 A;  3R2T A;  3TCA A;  1E7P B;  2N4F A;  3DBS A;  5FKA C;  3EFU A;  2HJ1 A;  2MQJ A;  4PYU A;  2JXX A;  3I57 A;  2H89 B;  4A9A A;  2JWU A;  3VXW A;  4W9I A;  3KH0 A;  4PK1 A;  1L0V B;  2Z59 B;  1FXT B;  3GZN B;  3X23 A;  3IHP C;  4ANV A;  1WY8 A;  4YSY B;  1KRH A;  1TY2 A;  3LDZ E;  1QZE A;  3V62 A;  1YQ3 B;  1PGX A;  3RD2 A;  3RZW C;  1BXT A;  3BWU D;  4BFR A;  4IWQ A;  2KTF A;  3LJ3 A;  1ZDX A;  5HHD G;  5IP4 D;  2BS3 B;  2BW2 A;  3K9P B;  3T3O A;  1UWX A;  3MHZ A;  1TS4 A;  1V5T A;  2MH7 A;  2M0A A;  3AED B;  3SDL C;  4GSW A;  2HTH A;  2K0P A;  4B0M A;  4LTU A;  1V97 A;  1FXI A;  1UEL A;  2KTR B;  3Q69 A;  1QKZ A;  2QC8 A;  1SE9 A;  3A9K B;  3VDZ A;  3WA0 A;  2LZ6 A;  1D3Z A;  1OEY A;  2JQR B;  3KVF B;  2L52 A;  3RCZ A;  2CHZ A;  2ZCB A;  3RUL A;  4ZHP A;  1XEE A;  1XQQ A;  2Y3A A;  4M00 A;  3IXS A;  1WM3 A;  5IO9 A;  5FR6 A;  1EUV B;  1MI0 A;  2BYF A;  2K8B A;  1WM2 A;  1ZW7 A;  3IVF A;  4MGK E;  4TKN A;  4DWF A;  3N32 A;  2LWP A;  2JYE A;  1WXV A;  4E3C A;  2RDG A;  4MDK E;  1E90 A;  5C2T B;  4GB9 A;  4HXD A;  5EDS A;  2WXN A;  4XZ4 A;  2MBE A;  1WSP A;  2N9K A;  4B6W A;  1JWU D;  3UIP B;  4US9 A;  2KLG A;  1L2N A;  2FCN A;  1J8C A;  1OQQ A;  4JL9 A;  3AE2 B;  2PLP A;  3AV8 A;  1E0Z A;  2KFK B;  4I6N B;  1KH0 A;  3QHT A;  3R7Q A;  1TS3 A;  4FA6 A;  4LNN A;  4K1R B;  4LLG M;  4S17 A;  1V1P B;  4AUQ C;  3TEW A;  4IM0 A;  4RGT A;  4HRS A;  4TUU A;  1XT9 B;  4DHJ B;  3Q3J A;  2MBO A;  3ONS A;  1ROE A;  4M01 A;  2PE9 A;  1C77 A;  1PQS A;  4BBN F;  1E7U A;  2HE7 A;  2KWD A;  2LEK A;  2A4Z A;  2DYO A;  5DPR A;  2I2Y A;  5E6J A;  4DXG A;  3DDC B;  4MAC A;  1ZUD 2;  2V3S A;  3ZXV A;  4BOS C;  4I6P A;  3QCA A;  4A3O A;  5EE9 A;  2JVC A;  3HM3 A;  5EE3 A;  1T6B X;  1V5O A;  4IC7 B;  2ACZ B;  2J7Q B;  3ZJU A;  2KOX A;  1XD3 B;  1Z2M A;  1ZXH A;  3RFZ B;  4C00 A;  1R7S A;  1YN5 A;  4KGS A;  2KVR A;  5LNK 1;  4RM8 A;  3CMM B;  1MPE A;  1N5X A;  1JWS D;  2KDE B;  2GRI A;  5AEK B;  1I4G A;  3EGR A;  2AYO B;  2M1M A;  2MP2 A;  2J0J A;  4TQ1 A;  4URK A;  2J0K A;  1I4X A;  2C5L C;  2O6V D;  2WLB A;  2WDQ B;  1Q10 A;  4OW0 A;  3PZ7 A;  2WXI A;  4YSX B;  3VUW A;  5JHB A;  3PZD A;  3U4E G;  1H4R A;  3V61 A;  2W82 A;  3JVZ X;  2KVZ A;  2INN E;  3T8M A;  2IO0 B;  2QCZ A;  2LI5 A;  1QOG A;  4DXA B;  2WX0 A;  2IDY A;  1WGY A;  5BO4 B;  2JUO A;  1FO4 A;  4KKJ A;  1YOV B;  2KDI A;  4N6E B;  2RPQ A;  3OG5 A;  2KJR A;  4KVG B;  4FXC A;  5D6J B;  1BT0 A;  4R3D A;  1TKE A;  1UWM A;  4WH4 A;  4W9D A;  4WWP A;  3X0W A;  3UI3 A;  3KQ4 A;  5BMH A;  1I4Q A;  2BB6 A;  3SU8 X;  2KHW B;  2ASQ A;  2MJ3 A;  3L54 A;  2VH1 A;  1TTN A;  1R4N I;  1VZ6 A;  2H88 B;  2QIE B;  2M4N A;  2WGS A;  3TUO A;  5H92 C;  4OHJ A;  2ZW1 A;  1V6E A;  2A5U A;  1J19 A;  3N1Y C;  4AWJ A;  1K53 A;  4WQM A;  1TKG A;  3TJP A;  4LDT B;  3TEZ A;  2C7N B;  4OVU A;  2BBC A;  3S2A A;  3NHE B;  4KIK A;  3H7S A;  4LNK A;  1C4C A;  3BK2 A;  1M4V A;  3P2B A;  2G9H D;  1MVK A;  1KOT A;  1D4B A;  2M8S A;  3NRZ A;  1KFY B;  4EZL A;  2AQ1 B;  2K8H A;  4RM9 A;  5D7G A;  2N1W A;  2BB5 A;  2WXH A;  2NTS A;  1VZ7 A;  2WU5 B;  3U7Z A;  3ZQ4 A;  3DOW A;  4HJG E;  3DVN U;  1N63 A;  1YX5 B;  4OVV A;  3ZO5 B;  1Q1O A;  2DNF A;  5E6N A;  1PDX A;  3W2D A;  3N20 C;  2IPK D;  4WWO A;  3RNG C;  4P16 A;  1ESF A;  1WXQ A;  1XXG A;  1ZKH A;  2AL6 A;  2MP2 B;  3GZN I;  2BWE S;  1HTO A;  3ZUN A;  3DHI C;  1KM7 A;  1WGK A;  2WDT B;  3NZS A;  4HKZ E;  2DZM A;  4MJS B;  2IY1 B;  1OQY A;  3QJZ A;  1SE3 A;  4A20 A;  1N62 A;  1Y56 A;  1HEZ E;  4FJZ A;  2ZPY A;  1TY0 A;  2D10 A;  2RSU A;  2R61 A;  3ZW3 A;  3QA8 A;  4W9G A;  4K7W A;  2K6Q A;  2C7H A;  4C7Y A;  2KFJ A;  2FNJ B;  2LGI A;  5FK9 C;  1CZP A;  4WJN A;  3SD5 A;  5AZF A;  4FJY A;  1VJK A;  4NZL B;  1AN8 A;  2Z0D B;  3VTV A;  1JCK B;  2KAC A;  2QHO A;  1GAQ B;  3FKY A;  2IZV B;  4F8C B;  2ZNV B;  2O6V A;  1WR1 A;  2MEK A;  2WXL A;  4NY0 A;  3AE7 B;  1SE4 A;  3W1S A;  3NVV A;  1PUT A;  1FNU A;  3DVG X;  1T0R C;  5J2R A;  1ZGU B;  3AU4 A;  3FC4 A;  4RH6 A;  4W9F A;  1L6V A;  3BVG A;  3MJ5 A;  4O1N A;  3MJW A;  1TT5 B;  5E6P A;  4ZRQ A;  3FIL A;  1JRO A;  2BYV E;  1QOB A;  2ZJD A;  5IOI A;  1EF1 A;  3KW5 B;  4JIO U;  3L0W B;  1SIJ A;  1GOZ A;  4KSK C;  2KAJ A;  3AEG B;  5H8Y E;  1V9J A;  4DK5 A;  2GB1 A;  4G0N B;  2GBM A;  2N0S B;  4MM3 A;  1K50 A;  3PS6 A;  4DXF A;  3WAN A;  3VUY A;  3BVZ A;  4MH8 A;  3VFK A;  3ABV B;  3PTF C;  4K7U A;  1T0S C; 
#chains in the Genus database with same CATH homology
 1ZDX A;  4YWG G;  1XLN A;  1I7H A;  3R8B A;  3URY A;  2BS4 B;  5HHD G;  3NS1 A;  2BS3 B;  1KLG D;  3V3X A;  2BW2 A;  1C4P A;  3L4P A;  2W3R A;  1YJI A;  3P4P B;  3T3O A;  1UWX A;  1FMA D;  2WXK A;  2OED A;  5BYS A;  3MHZ A;  4ZOH C;  1TS4 A;  2MH7 A;  2K3U A;  2IGH A;  1PFD A;  2M0A A;  3AED B;  4N58 A;  3AM9 A;  1C79 A;  1FCL A;  2K0P A;  1P7E A;  2V3N A;  1XLQ A;  4B0M A;  4LTU A;  2ON8 A;  1V97 A;  1CQV A;  1FXI A;  1J7B A;  4YT0 B;  2IJ0 A;  2SEB D;  3AEB B;  3Q69 A;  1N60 A;  1QKZ A;  4B0E A;  3ETR A;  2DLB A;  4J3O D;  3AN1 A;  2VZK D;  1PGA A;  1C9F A;  2QJL A;  4KX6 B;  3N9Y C;  1QLB B;  1SB3 C;  1JWM D;  2JQR B;  3P4S B;  1SE2 A;  1JWA D;  3AE9 B;  2EEL A;  1SJE D;  1ZOY B;  2L52 A;  2WXG A;  4RFB A;  3VRA B;  3AEC B;  1AWD A;  1SBB B;  4XWW A;  1IUE A;  5AUI A;  4ZHP A;  1XEE A;  2BT6 A;  2Q5W D;  2Y3A A;  3HVD A;  1WWT A;  3IT6 B;  3MC0 B;  3IXS A;  3OWE B;  4JE3 B;  2FUG 1;  2OHF A;  1C78 A;  5EE0 A;  1MI0 A;  3KWL A;  1KTK A;  2DBY A;  3VR8 B;  4LK0 M;  2ONQ A;  3CIR B;  1CJE A;  2V4I B;  1UUP A;  2JYE A;  5FR3 A;  1QIL A;  2RDG A;  3U2S C;  2LHD A;  5C2T B;  3LXF A;  1FRR A;  4RGM A;  5I4D A;  2WXJ A;  2WXN A;  2CJN A;  3Q8C A;  1JRP A;  4IOI E;  2N9K A;  1WSP A;  3W5V B;  2DYM A;  2J52 A;  1JWU D;  2J42 A;  3AE1 B;  1RWS A;  3DWM A;  4US9 A;  3J9C A;  1KLU D;  1QOF A;  3AMZ A;  3AH7 A;  1BUI C;  3PZ8 A;  1K52 A;  1OQQ A;  3AE2 B;  1XCT L;  2YEP B;  1QT9 A;  3O13 A;  2PLP A;  3AV8 A;  2JXT A;  2PVG C;  1VDV A;  1E0Z A;  3BVM A;  1MHX A;  1EU3 A;  1OQR A;  1PGB A;  1SXT A;  1YJJ A;  4NAM A;  1KH0 A;  1F2R C;  1TS3 A;  1TZO A;  3IT4 B;  1T5X D;  3P1M A;  1EWC A;  4LLG M;  1N61 A;  2D5G A;  3NVZ A;  5BMG A;  1V1P B;  4TSS A;  1KF6 B;  4EE2 A;  4ARI A;  1TJE A;  1UGJ A;  3TEW A;  1FIQ A;  3LYY A;  2IGG A;  4RGT A;  4USA A;  4XE0 A;  4HRS A;  1GB4 A;  1TS5 A;  4YXD B;  1QOA A;  1L0Y B;  5HFY A;  1ET6 A;  3W9C B;  3AE8 B;  1ZP0 B;  1ROE A;  2E3T A;  1C77 A;  2JYT A;  4DQO C;  2NTT A;  3E56 A;  3AEF B;  1XF5 L;  2KWD A;  2LEK A;  2DYO A;  2I2Y A;  5E6J A;  4DXG A;  3AEE B;  3FIL B;  3CWI A;  3FAH A;  2XN9 C;  4MAC A;  4YTP B;  1JAL A;  1ZUD 2;  1FNW A;  2WS3 B;  2WQY B;  1ZPS A;  5EE9 A;  2LFI A;  1NI3 A;  1AW7 A;  5EE3 A;  1T6B X;  3EA6 A;  2ACZ B;  3ZJU A;  4WAF A;  1RYJ A;  4PT5 A;  1YMH E;  3NUH B;  1DOX A;  3ZJT A;  1ZXH A;  2L32 A;  3RFZ B;  3DWG C;  1R7S A;  1YN5 A;  3B2G A;  4Q2J A;  4AS1 A;  4KGS A;  3VRB B;  4MM3 B;  3AE3 B;  4JX1 C;  2WP9 B;  5LNK 1;  2TSS A;  5HG2 A;  1XCQ L;  2X38 A;  3WCQ A;  1NEN B;  4RF1 A;  1MPE A;  1N5X A;  2AQ2 B;  4HRO A;  1JWS D;  2WNM A;  1J7C A;  2GRI A;  1I4G A;  2LJI A;  3EGR A;  3VQI A;  1SSN A;  1RM6 C;  1L4D B;  1YN4 A;  1K51 A;  1A70 A;  2RMM A;  4TQ1 A;  2G1E A;  3ZGZ A;  1EM7 A;  1DGJ A;  5EE1 A;  1GB1 A;  1I4X A;  1YNT E;  2LMC A;  4IDI A;  5D3I B;  1IGD A;  2WLB A;  2B76 B;  2WDQ B;  1B1Z A;  1Q10 A;  3C8Y A;  3PZ7 A;  4OW0 A;  2CU3 A;  3RPF C;  1GPX A;  3KWV A;  2WXI A;  1F2R I;  1DYQ A;  4WWM A;  4YSX B;  2K22 A;  1SEB D;  3U4E G;  3AB5 A;  4XDC A;  4US8 A;  2W82 A;  1UNS A;  2INN E;  4YSZ B;  3ZJV A;  3R2I A;  3GS2 A;  3T3N A;  2RPV A;  4HEA 1;  1QOG A;  1AYF A;  4RGN A;  5BYR A;  3HVZ A;  2WXR A;  2I38 A;  2IDY A;  4OZB A;  1FO4 A;  4KKJ A;  1D5M C;  2V0G A;  2W54 A;  3BYY B;  5BMI A;  1NEK B;  4N6E B;  5JXV A;  1D5Z C;  2KQ4 X;  3NVY A;  3BII D;  2PKO A;  4FXC A;  2K9X A;  4H2A A;  4R3D A;  1TKE A;  1UWM A;  1VR9 A;  4RF0 A;  1NYR A;  3GB1 A;  4C80 A;  4WH4 A;  1FCC C;  2INP E;  2QIL A;  1HXY D;  4ZYS A;  2L83 A;  3UI3 A;  3KQ4 A;  2JX5 A;  5BMH A;  4JPS A;  4RCO A;  1I4Q A;  2BB6 A;  4HKQ A;  1WYG A;  2E6X A;  2JZP A;  1NVI D;  2MJ3 A;  1HQR D;  2AQ3 B;  4L1B A;  2FBW B;  3W5U B;  1VZ6 A;  2Y5P A;  2H88 B;  2K5P A;  2QIE B;  4UDU C;  5C3J B;  2EKI A;  4GLS C;  2N9L A;  2BTE A;  1EWY C;  4GDK B;  5T8I A;  3TUO A;  1FFU A;  1ZDV A;  1F0Z A;  5H92 C;  4OHJ A;  1JQ4 A;  1IBX A;  2KN4 A;  3BZD B;  3Q8E A;  2ZW1 A;  1MHH E;  1IGC A;  4ZHO A;  5D3D A;  1EU4 A;  1K53 A;  2J4X A;  3AE4 B;  2MJD A;  3AE6 B;  1I4P A;  1STE A;  1PYW D;  4WQM A;  1TKG A;  2XNA C;  1SJH D;  4AQ7 A;  1QF6 A;  4OZA A;  1SF0 A;  2DWQ A;  3TEZ A;  4XDD A;  1FD6 A;  1NYQ A;  3NZ3 A;  3P4R B;  4ZRP A;  3Q8B A;  1T3Q A;  1DOI A;  2BBC A;  1FFV A;  4CQN A;  3P4Q B;  1B9R A;  1RFK A;  1JML A;  1BML C;  1C4C A;  3BK2 A;  4ITK A;  1M4V A;  4A6Q A;  1F77 A;  1YN3 A;  2G9H D;  1MVK A;  3MP9 A;  3V05 A;  1WRI A;  3I9V 1;  1D4B A;  3NRZ A;  2J53 A;  1KFY B;  1VLB A;  2AQ1 B;  1CK1 A;  4IKG A;  2ZW0 A;  1L0X B;  2MJE A;  1FXA A;  5D7G A;  4REZ A;  3TEX A;  2W55 A;  2WDV B;  3AEA B;  3P63 A;  2LHE A;  2PIA A;  2BB5 A;  2WXH A;  2NTS A;  2QSD A;  2HTM E;  1XLP A;  2V3P A;  3GP7 A;  3ZYY X;  1VZ7 A;  2Z8L A;  2QEJ C;  1TYG B;  2WU5 B;  3U7Z A;  3ZQ4 A;  1ENF A;  3B2F A;  1XLO A;  4HJG E;  4KGR A;  3HRD D;  3IAM 1;  1N63 A;  4YTN B;  2WXF A;  4NAW B;  2GI9 A;  2SAK A;  1PDX A;  2BYT A;  1L4Z B;  3W2D A;  3E9S A;  4XWT A;  5GXG B;  4L23 A;  4N59 A;  2WXO A;  1P7F A;  5AUK A;  5BYQ A;  2IPK D;  4A55 A;  2RDH A;  1FNV A;  1HA5 A;  2CJO A;  2BS2 B;  3SR6 A;  4P16 A;  1ESF A;  1WXQ A;  1XXG A;  3P42 A;  3Q8F A;  1J7A A;  4L2Y A;  3SFE B;  2PMV A;  1LO5 D;  1WGK A;  1QQR A;  3EUB 2;  4HKZ E;  3H8H A;  1FEH A;  4WUR A;  1V8C A;  3B9J A;  1V1O A;  2IGD A;  1SE3 A;  2NMQ A;  2L1A A;  2KMM A;  4KGT A;  1I4H A;  1TS2 A;  1VRA B;  2N7J A;  1N62 A;  1Y56 A;  1E10 A;  1HEZ E;  1JW9 D;  4RGO S;  1TY0 A;  1D5X C;  3SFD B;  2R61 A;  3TSS A;  4C56 C;  1FM0 D;  3Q8A A;  4C7Y A;  4M0W A;  1C76 A;  2LGI A;  4C7Z A;  5FK9 C;  1CZP A;  2Y5C A;  5TSS A;  2WXQ A;  1ZE3 D;  1ACC A;  1VJK A;  4NZL B;  1AN8 A;  1JCK B;  2KAC A;  4OZC A;  3BYT B;  1C4A A;  4WIP A;  4A8X C;  1GAQ B;  2QMT A;  3BK1 A;  4A90 A;  2FE8 A;  3SEB A;  1FRD A;  4D2K A;  2LUM A;  1HZ5 A;  4JWS C;  2JU6 X;  2MEK A;  3KLS X;  2WXL A;  4KKI A;  1V1P A;  3AE7 B;  1SE4 A;  3W1S A;  3NVV A;  1PUT A;  3AE5 B;  1FNU A;  3PO0 A;  4GDL B;  2KDM A;  1E6E B;  1ET9 A;  3HUI A;  1ZXI A;  1N5W A;  2JSV X;  2WXM A;  4YTM B;  1L5P A;  2WU2 B;  2PVO D;  3FC4 A;  3R2T A;  4RH6 A;  1E7P B;  4NJC A;  1L6V A;  3BVG A;  3MJ5 A;  4O1N A;  4OVZ A;  5FKA C;  2VZK B;  4TQ0 A;  1IBX B;  4MT5 A;  2WDR B;  3FIL A;  4ZRQ A;  4RNA A;  4ARC A;  1D6E C;  1I4R A;  3NVW A;  3I57 A;  5G5H A;  2WXP A;  1JRO A;  1OFF A;  2H89 B;  4A9A A;  1QOB A;  2JWU A;  1JWB D;  5G5G A;  1VZ8 A;  1L0V B;  2HDE A;  2M19 A;  1E9M A;  1DOY A;  2ICI A;  2AX5 A;  1L6U A;  3IAS 1;  1XO3 A;  1SIJ A;  1GOZ A;  2PW9 A;  2W3S A;  4YSY B;  5HI1 A;  1YQ4 B;  1KRH A;  1TY2 A;  4JWU C;  2KAJ A;  3AEG B;  5H8Y E;  1HZ6 A;  3MFG A;  2GB1 A;  3U52 E;  1TKY A;  1YQ3 B;  2N0S B;  1PGX A;  2PTL A;  5MPO A;  1K50 A;  4DXF A;  2M56 B;  3BVZ A;  4MH8 A;  3ABV B;  1BXT A;  3BWU D;  4P6V F;  4TMA B;  3VR9 B;  2YEP F;  3LB8 C;  3TEY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...