1D4BA

Cide-n domain of human cide-b
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
122
structure length
122
Chain Sequence
MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELLAKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords HUMAN CELL DEATH-INDUCING EFFECTOR B
publication title Solution structure of the CIDE-N domain of CIDE-B and a model for CIDE-N/CIDE-N interactions in the DNA fragmentation pathway of apoptosis.
pubmed doi rcsb
source organism Homo sapiens
total genus 2
structure length 122
sequence length 122
ec nomenclature
pdb deposition date 1999-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02017 CIDE-N CIDE-N domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d4bA00
2IGDA 3FILB 1P7EA 1P7FA 1HZ5A 2J52A 1XCQL 1HZ6A 1K52A 2N9KA 1IBXA 2RMMA 1K50A 4HKZE 2JXTA 4WH4A 1FD6A 1K53A 1MVKA 2K0PA 1XCTL 2N9LA 2J53A 4KGRA 1EM7A 4D2KA 1HEZE 5BMIA 1UWXA 1JMLA 2KDMA 2LHEA 1XF5L 4KGSA 1YMHE 2JU6X 2JSVX 5HG2A 2PTLA 1MHHE 1IBXB 5HFYA 2KWDA 2ZW1A 1C9FA 1PGAA 4OZAA 2LUMA 2ZW0A 5HI1A 3GB1A 2KACA 2LHDA 4MACA 2I38A 1MPEA 1GB4A 1KH0A 2GB1A 5JXVA 2ON8A 1PGBA 4OZCA 2ONQA 4KGTA 2OEDA 5BMHA 2LGIA 1PGXA 1FCLA 2KQ4X 1FCCC 1Q10A 4IKGA 2KN4A 1D4BA 4IOIE 1F2RC 2RPVA 2IGGA 3FILA 2GI9A 2IGHA 1F2RI 2PLPA 4HJGE 2QSDA 5BMGA 2JZPA 1K51A 2N7JA 2QMTA 2EELA 1GB1A 4OZBA 5HHDG 3V3XA 1MI0A 1MHXA 2PW9A 1ZXHA 1IGCA 2NMQA 1QKZA 4GLSC 1YNTE 3MP9A 2JWUA 1IGDA 2I2YA 3UI3A
chains in the Genus database with same CATH superfamily
2KX3A 3JYUA 2IY0B 4FHKA 2V4LA 5EDSA 3N20C 3HUIA 1D5ZC 4I6LB 2KANA 1PYWD 2AEHA 3DOWA 3P4PB 2LGDA 3B2GA 1FXTB 3HHMA 3DBRI 1J8CA 2WXFA 3EECA 5BMIA 1DOXA 4B0EA 1C4PA 5AZGA 4EKUA 2ZCBA 3KVFB 4XE0A 2J42A 4IG7B 4GDLB 2ZZPB 1MJDA 2C7MB 4BBNF 2O2VB 3DCGA 3U2SC 4PK1A 3CSFA 2ZJDA 1OGWA 5BYRA 2K3UA 2Z0EB 4BVUC 4K3BA 2R2QA 1MPEA 1WH3A 4LLGM 2WDRB 2WDVB 3DVGX 4HLEA 4MJSB 5AEKB 4LJOB 4MH8A 3RNCC 2D11A 3UIPB 4JWSC 4XC2A 4PYZA 5G5HA 3MTNB 1AN8A 1P0RA 4WQMA 2G4DB 3ZIMA 3BY4B 3ZW3A 4A6QA 2OJWA 4HCPB 3PZDA 1VZ7A 3PRMB 1NYRA 1RLFA 2D5GA 2XNAC 3PVLA 1TKEA 4BBNC 4ZYSA 1R7SA 2JZ3B 2MBHA 3URYA 3C0RB 3V3XA 2HTHA 1WJ4A 5IP4D 2KWUB 2KWVB 3VHTC 1SXTA 2YVCA 1IGDA 1I4GA 1RRBA 2QC8A 3H7PB 1WY8A 3NVVA 2CR5A 1SEBD 1Q1OA 1ZXIA 3NUHB 3TEWA 2MSED 2DZMA 2DNFA 4NPNA 4YSZB 4IWOA 1C4CA 1MG8A 2FBWB 4BOSC 3IHPC 4B6WA 3W5UB 2N9LA 4N6EB 2RGFA 1KOTA 1UZXB 3KW5B 2WXHA 1XF5L 4JIOU 3TL5A 4E74A 2IY1B 2V4IB 2KVRA 2G3QB 1T0SC 1WZ3A 3PREA 1ET6A 2MW5A 1TY2A 5CX3A 1YJJA 3NZ3A 1FRDA 2ZW0A 2LD9A 5J2RA 1GAQB 2YEPB 5G5GA 2BTEA 5JXVA 2KQSA 4KGTA 1EUVB 1WM2A 1WX7A 1V81A 1CQVA 3HM6X 1D5MC 1VLBA 4EEWA 2VRRB 2CJOA 2LGYA 2RPVA 1WJ6A 2KXJA 1FFUA 4W9FA 4A9AA 3JW0X 2BWES 2KVZA 2VH1A 3IVFA 3LB8C 5BYSA 1JALA 2EKEC 1GB1A 2LVPA 4DHJB 1KTKA 1J7CA 1BXTA 3AE2B 4WJNA 2WWZA 2GBRA 1CMXB 1UBQA 1SBBB 2AWTA 4M01A 4K7SA 4C00A 3ETRA 1YJIA 4DHZE 1D3ZA 2CJNA 2LVOA 2WDQB 2KHWB 2D3BA 2EKIA 2DAJA 5DPRA 2K9XA 2K1FA 1MG4A 1WWTA 2D3AA 2D3CA 4X57B 3AEBB 3HM3A 4GU2A 1WGDA 4ZRPA 3TEXA 4WH4A 1SIFA 4WURA 1GUAB 2WXJA 1FXIA 5MPOA 2Y5CA 4W9EA 3DPDA 2E3TA 5IKCM 3R7RA 4AQ7A 3IT6B 4C56C 2JSVX 1ZKHA 2JY6A 3ZDTA 1SE3A 2WXGA 4LK0M 1L4ZB 4YL8A 2LUMA 2BW2A 2MLBA 5E6PA 1SGHA 2K22A 3Q3OC 3EFUA 1F77A 3VH3B 3NY5A 4JGHB 2W3SA 3TIXA 4WAFA 2K5PA 4KZ0A 2CU3A 4ANVA 1TBEA 1TKGA 2WX0A 1YQ4B 3R8BA 4F1SA 4TSSA 2XK5B 4JLCA 2BB5A 1NBFC 3A9KB 2BYVE 3NS8A 3AEDB 4KVGB 1WRIA 1IUEA 1H8CA 1C77A 2QSDA 4A90A 3UQBA 3GE8C 1T0YA 4W9CA 1B9RA 2PMVA 2WXLA 2N9XA 3IFWB 2IO1B 2REXA 1IPGA 1WE7A 4LJPB 3E9SA 3DDCB 3MP9A 3H9DA 2IJ0A 2WXPA 5GMVA 1E5WA 2V3NA 4US9A 4M0WA 2Z0DB 1CJEA 3AEGB 3NZUA 3RZWC 2O6VD 1OEYJ 2WXNA 2WGSA 3NVWA 5D2MB 1JQ4A 4HWIB 4AP4C 3ZJVA 1KFYB 4LNNA 2RD0A 2MRPA 2NVUI 3SFDB 2D3GA 2ZEQA 3AE3B 3ZJTA 3ZXRA 2LHEA 1PUTA 3L17A 2K8BA 4RF0A 3L16A 2N0SB 2PTLA 3R2IA 1WYGA 4OVVA 1FNWA 3B1LX 1XXGA 3I3TB 2M4NA 4ZRKA 3AMZA 4HKQA 4MACA 3AEAB 3NS1A 1TZOA 1QILA 3L10B 4A20A 1TZ1A 3WANA 2CHXA 3ZRCA 2FAZA 1Q10A 1ACCA 2KN4A 3R3MA 4YSYB 2KAJA 2L83A 3L08A 4DK5A 2W54A 4IWQA 3WAMA 2V9HA 1OTRB 4CQNA 3QX1A 3VDZA 4HPLB 1UELA 4WIPA 1L5PA 3H6NA 2LUEA 4MM3A 1M94A 4NAWB 3BIID 2KLCA 4GDKB 3H7SA 1WXSA 4TMAB 1QOGA 5IOIA 1R4NI 1EWCA 2KTRA 3WALA 1N60A 5D3IB 1LFDA 3GZNB 1MVKA 4JX1C 2J0MA 3ZJUA 2KC1A 1WGGA 1YN4A 2N9PC 1VZ8A 3DBHB 4DHZB 2FUHB 5I4DA 3HK0A 2DYMA 4A55A 1WRDB 4FJYA 1WJNA 2J0JA 2ZVOA 2HE7A 2JRHA 3BYYB 1YMHE 2TSSA 1N62A 1TTNA 1ROEA 2BKFA 1MFWA 3N1XC 2GBKA 2RDGA 2G9HD 1JRUA 2MBBB 3N3KB 2ZW1A 1F0ZA 1C9FA 2W3RA 3QQ8B 1M4VA 2KMCA 4ZHPA 2VZKB 1IP9A 2N9EB 5FK9C 3VR9B 2KDFB 1ZOYB 3UGBB 3M3JA 4MGIE 3V6EB 2N7EA 3IT4B 2KKCA 1DOIA 3PRPB 1V5TA 1VR9A 1S1QB 1EU4A 3P4SB 4W9HA 2ZPYA 1I4PA 4LCDE 2X8XX 4LNOA 1L0YB 3MJ5A 3ZTDA 3JSVA 2KTFA 3BYTB 1F2RI 3WAPA 2JZPA 5TSSA 2KOXA 2GBJA 4EZKA 4M8MA 1UF0A 1PDXA 4CO7A 2NPTA 4EZJA 4GB9A 4M02A 1I42A 2K6QA 2UWQA 4FHJA 4KKJA 1XLQA 3RULA 2LVQA 2ZVNA 2N9KA 3DBLI 3W1SC 2ZPNA 1ISNA 2JVCA 1WIAA 2SEBD 1ZP0B 2BYTA 1S3SG 2QEJC 2JXTA 3RNBC 5IA7A 3E56A 4XWWA 3ZGZA 4MSMB 1N5WA 1Q5WB 1VZ6A 1UWXA 2WNMA 2KDMA 3TSSA 5CHFA 3V62A 4BOZB 2ACZB 4WWOA 1C1YB 2UYZB 5GXGB 4NQLB 4L2YA 1DGJA 2GMIC 1P98A 1AARA 4P16A 2K8CA 1OFFA 4NJ6A 2KFJA 2Y5BB 4XDCA 3A9JB 3GS2A 1PGBA 1SE9A 2C7HA 3V60A 1B1ZA 3A33B 3MFGA 1YX5B 2BS4B 2AQ3B 3Q8FA 3U8ZA 3AEEB 2VH2A 4P1CC 4HK2A 4OVUA 1L0XB 3FILA 3EHVA 2GBNA 5HKHA 4J6IA 1WXAA 2PLPA 3DHIC 1V49A 1JWSD 1P3QU 5J18A 2FIFA 2IPKD 4PYUA 3IAS1 2CHZA 1SE2A 2MX2A 1R4MB 2PW9A 1ZXHA 4A3OA 1KLVA 3TUOA 4USAA 2KYWA 3BK1A 1WX8A 2W9NA 4M00A 2PE9A 3U30A 2RDHA 2YLMA 3RT3B 1WJUA 2HD5B 3AB5A 4BKSA 4DXAB 2N4FA 1LO5D 3P4QB 3QJZA 2WP9B 5DPWA 2HTME 5D6JB 4IW0A 3M95A 2NCNA 3SD5A 1E90A 1QLBB 1FMAD 5AUIA 3OJ4B 4YWGG 1VRAB 4LTUA 5IO9A 1YQ3B 1E10A 3AECB 3RN9C 3AV8A 2K8HA 3Q6BA 1ZGUB 4G3XB 4FULA 2O6VA 3PZ8A 2BT6A 2SAKA 2NR2A 3Q3FA 2KJ6A 2M17A 2GB1A 4C7YA 3BWUD 5KHOA 2LEKA 3EFCA 1IYFA 3AU5A 2WX1A 1RFAA 1V5OA 2LXAA 3NRZA 3RZFA 3IXSA 1G6JA 2IO2B 1HA5A 1WM3A 1E8YA 1N5XA 1NEKB 1FCCC 4IKGA 1TY0A 2FUG1 2NS5A 3EUB2 3W5VB 3AE5B 4N59A 2LGXA 1DYQA 5IN7A 4W9IA 4YTPB 4FBJB 4WJOA 2N7JA 1YN3A 4NZLB 3QAQA 1OEYA 2MH7A 2MHJA 4XDDA 1NENB 1WMHB 1L6UA 2NMQA 1QKZA 1WFYA 2EMSA 1TS3A 2W82A 3HVZA 5D3DA 2N1VA 1HZ5A 3ZVVA 1VJKA 4F7ZA 3C19A 2KFKA 4G50A 3VTUA 1QQRA 1WXVA 4US8A 3UQAA 2YEPF 2K25A 4TUUA 4EE2A 3AE8B 3PSEB 4BFRA 1F52A 2KJRA 1EM7A 3DWMA 1TGZB 2NBWB 3Q8BA 2JQRB 3A4SC 4E3CA 4BKTA 4OHJA 3SU8X 1WF9A 2BS2B 2KQ7A 3VTWA 3B0AA 1BT0A 4DHJD 3P42A 4HCNB 1GC7A 2L8JA 1LM8B 5HFYA 2MP2A 3AXCA 2LI5A 3DBRB 3DHHC 3ALBA 5KHQA 4FJVB 1J19A 3Q8AA 1V1PA 1RAXA 2KT7A 1PGAA 1P1AA 2WHIA 1EU3A 2BYFA 2LHDA 3JVZX 4K1RB 2BBCA 4RH6A 1WXQA 1PFDA 1D5XC 3Q8CA 2WYQA 2Z8LA 3U7DA 2L0TA 1AW7A 2D10A 5JH5C 3HVDA 3O13A 3AE1B 1XO3A 4QAYA 1FO4A 1AYFA 4ACFA 1GG3A 4JQWC 2DAFA 4KSKC 1V97A 2LASA 3AEFB 4DXGA 4MEMA 1WE6A 2KMAA 4PS3A 2KWCA 4BZAA 3W1SA 1WGRA 1FPYA 4KDLB 2HJ1A 3U52E 4NQKE 3KYCD 4RGMA 3X0WA 4BAXA 1GJZA 3UINB 1NI2A 4OZBA 4BKGA 3ZNID 1MHXA 3PLVA 3PPAA 4DXFA 2E6XA 2LRWA 3VFKA 2AYOB 2C5LC 2WXKA 4K3CA 4A8XC 2MJEA 1I4XA 4H2AA 4HROA 4BKSD 4RF1A 1IBXA 2MBEA 3SDLC 4B95A 2WXIA 2H89B 1FD6A 4AUQC 3KUDB 1NVID 1XCTL 4XGAB 2IZVB 1JMLA 2FIDA 4MGZE 2OOBB 4NAMA 3I57A 3LDZE 2B76B 2INCC 1SE4A 1I7HA 2LZ6A 1MHHE 3SEBA 1NI3A 3A1QA 4RGTA 3NJTA 1NDDA 3KYDD 2PPHA 2AQ2B 4F8CB 2M56B 2C9WB 4MELA 1TJEA 2NBUA 3RYTA 5G55A 1GB4A 3RNEC 2INPE 3DVGY 1LGRA 3ZUNA 2ONQA 3I63C 1UH6A 1WZ0A 1N61A 1AWDA 2KQ4X 3UF8A 1UUPA 1Q0WB 1C79A 1E8ZA 3U7ZA 3ZNGC 3TEZA 2KO3A 1RM6C 4URKA 2ZNVB 2I1KA 2M0AA 2BYEA 1UNSA 3CWIA 4PS8A 5E6NA 1WGKA 3H8HA 4HJGE 1YIWA 2G45B 1K51A 2FCSA 1XLOA 4HDOA 3NVZA 3QK0A 2EELA 1CK1A 3PLUA 2OJRA 1SSNA 2INNE 1IGCA 2N7DA 1WR6E 3DVNV 2I2YA 2J0KA 1OQYA 1QZEA 1T0RC 2KC2A 4GDLA 3HRDD 5D94A 3QA8A 1KF6B 3B9JA 3FC4A 1V80A 3OLMD 1GPXA 2O2VA 1ZUD2 5FR3A 3SHQA 2DYBA 2K0PA 4WWMA 3ZTCA 4FA6A 1WGHA 4TQ1A 2AQ1B 2BS3B 4P7IA 4DWFA 3Q3NC 3VH4B 1HTOA 4MJSA 3VQIA 2DWQA 4JWUC 1ZW7A 5BO4B 2HJ8A 4KZCA 1RWSA 3LXFA 2CKHB 1XLNA 3WIMA 5JZEB 1WXMA 3PHXB 3AI5A 3DWGC 4KIKA 3BZDB 4AS1A 1LXDA 2PIAA 1EO6A 3P2BA 1HXYD 1V9JA 4A3PA 2FCMA 4MT5A 1T5XD 2ZNVC 3NG0A 2JXXA 4AWJA 3W2DA 4OVZA 1QOAA 4RGOS 1TS5A 2OEDA 1WYWB 2AX5A 2ZCCA 2BWFA 1VDVA 2MCNB 4S0RA 3RFZB 2PVOD 1E7VA 3Q3JA 1SJHD 5H92C 1KLGD 2QCZA 3H7PA 5C1ZA 1UWMA 3DBSA 2QIEB 2JWZA 5DPSA 3ZLZA 4W9JA 2JRIB 2PEAA 3T3OA 4KSLC 1UGJA 4L23A 3TEYA 3N1YC 3PS6A 2GBMA 5HHDG 3KQ4A 2Y3AA 1WI0A 5IAAC 3ML8A 2VZKD 3AE7B 4IM0A 3V6CB 4GLSC 2K6DB 4ZYNA 1ZE3D 4IDIA 1P7EA 2INDC 3TBLD 1P7FA 1HZ6A 1ET9A 2PE6B 5CTRC 2RPQA 3K9OB 1FFVA 3TCAA 1L2NA 2LJ5A 2OHFA 4LDTD 3VUXA 3MHZA 1K50A 1LQBA 1JW9D 3ZDMC 3ZXVA 4KGRA 4RGNA 2MWSB 2WXRA 4TV3A 3DHGC 4M0WB 3EA6A 3RD2A 4ANXA 4KGSA 3N1ZC 1C3TA 5C3JB 1C78A 4Q2JA 3K9PB 2Z59B 2JYTA 2KDEB 3DVNU 3D32A 3MHSD 3H1UA 3NOBA 1KLUD 1H4RA 2BGFA 3IAM1 5CHVC 1SIJA 1KH0A 3L13A 3WAOA 2KNBA 4GSWA 3I9V1 1QT9A 4UDUC 4O1NA 1Y56A 5BMHA 2WQYB 4K7UA 4G0NB 3BVGA 1QF6A 5H8YE 1Z2MA 2WS3B 5AUKA 1YD8U 3IBEA 2CS4A 4C4VA 4GOCA 3NHEB 2KMMA 4YTMB 3NZSA 4NJCA 2IGHA 1UGMA 3AH7A 2RDBC 2Y5PA 3WCQA 2MBOA 2QDFA 2NBVB 3OAWA 1TS4A 4HVBA 4RFBA 3R66C 5CHWA 1XT9B 3PHWB 3FKYA 1V6EA 3LYYA 1KJTA 4MDKE 3KH0A 3T3NA 1ZDVA 3ECIA 1HE8A 2DX5B 2J52A 4MH0E 2G1EA 5JHAA 2RMMA 3GP7A 2LMCA 1XLPA 1ZPSA 1YJ1A 2ASQA 4II3B 4MM3B 3EC8A 4HKZE 3ZQ4A 2AL3A 1FIQA 4RM9A 4ZRIA 1R4NB 4ZRJA 4WWNA 1DOYA 1I35A 3SR6A 3R2TA 3Q14C 5FR6A 3QARA 4WQOB 2G4SA 3QHTA 1FXAA 5HG2A 2KTRB 4FXCA 2KX0A 3LJ3A 4CYEA 3QWZB 4L1BA 1FNUA 3OJ3A 5LLIA 4EUTA 4HPMB 4GN1A 4KIKB 2XK5A 2KACA 4FN2A 3ZNHB 3A9KA 2DBYA 1J7BA 1TS2A 1E8WA 2GOWA 2XN9C 1SB3C 2R61A 1JCKB 2WXMA 3VRBB 1K8RB 2LGIA 3RUIB 2BF8B 1FCLA 1J7AA 2KD0A 4HJKA 3HIZA 4CHKA 1ESFA 4YSXB 4DDID 4W9LA 1OQRA 2JPHA 1XEEA 1TT5B 3M63B 4B0MA 5C23A 2KLGA 2L1AA 4XYCA 5FKAC 3CSTA 1CZPA 2V1YA 1L0VB 4W9GA 1JROA 1YNTE 5E6OA 4FADA 4ANWA 3RPFC 3AU4A 4TQ0A 4ICUA 1GNUA 2L0FA 4C7ZA 2JT4B 2K39A 1E7UA 3BK2A 2BKRB 3JSVB 2L7RA 4NJ7A 2D07B 2DZIA 3R7QA 4DBGA 2C60A 3VXWA 1E6EB 2LGSA 3APFA 1K52A 5E6JA 3VUYA 3B2FA 1FM0D 3J9CA 4GXBA 1UD7A 4I6NB 3V05A 2A4ZA 4MGKE 1XD3B 1L6VA 4ZOHC 1FRRA 1WGYA 2NPTB 4B9KA 1FEHA 5T8IA 2WU2B 3UIOB 2M1MA 2D2QA 3DBLB 2IBIB 1YX6B 4XWTA 2LFIA 3BINA 3ZRFA 2WDTB 2JU6X 4J3OD 3O65B 1GC6A 1WR1A 1WSPA 3QCAA 1N6ZA 1T0QC 1KM7A 3AN1A 3GE3C 4EZLA 4EFOA 2IYDB 4NY0A 4OZAA 4EOYA 3RNGC 2I38A 4ARIA 2RR9A 4R3DA 1YOVB 2N1WA 3VRAB 1C4AA 4RNAA 5BYQA 1NYQA 3ABVB 1V8CA 1V86A 2KK8A 1PGXA 4NAWA 4GDKA 3ONSA 4ZDVA 3M62B 1XQQA 1I4RA 4HDQA 1JWUD 3MC8A 2XEWA 1Y8RC 4C4VB 2JX5A 1F2RC 2IGGA 1FNVA 2KJHB 3KWLA 3ML9A 2I1JA 1HQRD 2L32A 3MC9A 1WX9A 4HXDA 4LNFA 2WXQA 1A70A 3ZNZB 3AULA 4G11A 5D7GA 4MGYE 3P1MA 5L83A 4WWPA 2MA9B 2MJDA 3APDA 2IGDA 3GZNI 3VUWA 3FILB 2ICIA 4IM3A 4MSQB 2LWPA 3DBHI 3BVMA 1U4AA 4WJPA 3VVWB 3SFEB 2FE8A 3S2AA 1TYGB 5LXIB 2C7NB 3GOEA 1L4DB 2IO3B 4OW0A 4RCOA 1T6BX 4D2KA 3DQVA 4GIVA 2M19A 2X38A 5G2NA 3CMMB 4AOFA 2JZZA 3OG5A 1F1HA 3MC0B 3KUCB 3PRZA 5DCNA 4GGQA 2WLBA 1JRPA 3VTVA 3N9YC 1RYJA 1ENFA 2L05A 3PV1A 3MJWA 2QILA 2WU5B 2M8SA 3GB1A 2R2OA 3Q69A 3PTFC 4JL9A 3TMPB 3X23A 2ON8A 4DDGD 4GMVA 4ZRQA 3P4RB 5L95C 4P6VF 4AJYB 3KUZA 5C2TB 2O6VB 1RFKA 1SF0A 4ANUA 1EF5A 4IOIE 2MEKA 2BVCA 5DPTA 3PO0A 5LNK1 4PS7A 5BMGA 1YQBA 2XBBC 3IG3A 3CF6E 3TJPA 4JPSA 2V3PA 2B3AA 5J17A 3W1YA 1YN5A 2PJHA 2QJLA 3N32A 2DYOA 2DZJA 2JYEA 3RNFC 5EE1A 1TKYA 2M0XA 1J0GA 3BVZA 4M8NA 3Q3MC 1JWAD 4KKIA 1A5RA 4IUMB 4XX5A 3Q2AC 2KDIA 3CIRB 2J53A 1ZDXA 4S17A 1HEZE 1X1MA 3EGRA 1VD2A 3A9JA 1E8XA 2H88B 2AL6A 2KFKB 4K81A 1L7YA 4REZA 2BPSA 2NTSA 3NVYA 3B08A 2KWDA 2DLBA 4IM2A 3RCZA 3L54A 3RI7C 2LRUA 3FAHA 5HI1A 3AE4B 3V61A 5AZFA 4WJQA 1BUIC 1STEA 3I5JC 3AM9A 2EMTA 2DZKA 1F9JA 4N58A 3QC8B 3Q8EA 4OZCA 2WXOA 4LNIA 2Q5WD 4ARCA 2KZRA 3P63A 3W9CB 2MP2B 4LNKA 4YXDB 1V1PB 2L00B 4ASWC 1UBIA 5AZHA 1R4MI 4KX6B 1V2YA 1QOFA 4KV2A 3KWVA 5EE3A 1EWYC 4HEA1 2A5UA 2L3ZA 2KDBA 1I4QA 2L52A 2MJ3A 4P1BC 4W9KA 2J7QB 1MI0A 2PKOA 5TR5A 3PZ7A 2QHOA 1JWMD 2CHWA 3ZKJC 1E7PB 1N63A 3UI3A 2IDYA 3OWEB 1SJED 3L4PA 5JHBA 3T9LA 3QIJA 1VCBA 4HRSA 1XCQL 2HDEA 3APCA 3KLSX 4I6PA 3WA0A 2RSUA 3VR8B 2GRIA 2BQQA 3ZYYX 2JUOA 4AJWA 1K53A 1D6EC 2DHZA 3ZO5B 4ITKA 2LXCA 4FJZA 2UU7A 2MQJA 4C80A 2FNJB 5LXHA 2IO0B 3U4EG 2L76A 4E71A 1HTQA 3RNAC 2FCNA 1IBXB 1I4HA 1P9DU 3AE9B 4WAAA 1V1OA 4II2B 4LDTB 3PT2B 5EE0A 2FCQA 2JF5A 3A4RA 4XZ4A 1E0ZA 1JWBD 4KDIC 1GOZA 1E9MA 1BMLC 2DENB 2GLSA 4YT0B 4W9DA 3PGEA 1PQSA 2V0GA 4HPPA 3AE6B 3A1QB 2CU1A 3RMKC 5EE9A 3VAWA 4DQOC 1WMHA 3T8MA 1Z5SB 2J4XA 4ZHOA 1T3QA 1QOBA 4RMAA 2MBQA 1D4BA 3N30A 4FLHA 4YTNB 2KN5A 2GI9A 4PT5A 4IWPA 1TIFA 4NNJB 2PVGC 4TKNA 3C8YA 1OQQA 3ENEA 1C76A 4K7WA 2W55A 1KRHA 2QMTA 4N9F4 2BB6A 4ICVA 4RM8A 4JE3B 2V3SA 2LJIA 2NTTA 1EF1A 4IC7B 2JWUA 3L0WB
chains in the Genus database with same CATH topology
3BK2A 2WXKA 1E6EB 1K52A 5E6JA 4A8XC 2MJEA 1EWCA 1I4XA 4H2AA 4HROA 4RF1A 1IBXA 3HUIA 3B2FA 1D5ZC 1FM0D 1N60A 3J9CA 1PYWD 2WXIA 2H89B 5D3IB 3V05A 3P4PB 1FD6A 1L6VA 4ZOHC 1MVKA 4JX1C 3ZJUA 3B2GA 1YN4A 1FRRA 1NVID 1XCTL 1VZ8A 1FEHA 2WXFA 5T8IA 2WU2B 5I4DA 5BMIA 1DOXA 4B0EA 1C4PA 1JMLA 4NAMA 4XWTA 2LFIA 2DYMA 3I57A 4A55A 2B76B 3BYYB 1YMHE 4XE0A 1SE4A 1I7HA 2J42A 2TSSA 2JU6X 4GDLB 4J3OD 1N62A 1ROEA 1MHHE 3SEBA 1NI3A 1WSPA 2RDGA 4RGTA 2G9HD 3AN1A 3U2SC 2ZW1A 5BYRA 1F0ZA 1C9FA 2K3UA 2W3RA 2AQ2B 4OZAA 1M4VA 2M56B 2VZKB 4ZHPA 1TJEA 2I38A 1MPEA 5FK9C 3VR9B 4ARIA 4LLGM 1GB4A 2WDRB 2WDVB 1ZOYB 4R3DA 2INPE 4MH8A 1C4AA 4RNAA 2ONQA 5BYQA 3VRAB 1NYQA 4JWSC 3ABVB 1V8CA 3IT4B 1PGXA 1DOIA 1VR9A 1N61A 1AWDA 2KQ4X 1EU4A 3P4SB 1UUPA 5G5HA 1I4RA 1I4PA 1JWUD 1AN8A 1C79A 3U7ZA 4WQMA 1L0YB 3TEZA 3MJ5A 2JX5A 1F2RC 4A6QA 1RM6C 2IGGA 1FNVA 3BYTB 2M0AA 1VZ7A 1UNSA 3CWIA 1NYRA 1F2RI 1WGKA 3KWLA 2D5GA 2XNAC 3H8HA 1TKEA 4HJGE 1HQRD 2L32A 4ZYSA 2JZPA 1K51A 1R7SA 1A70A 2WXQA 5TSSA 1XLOA 3NVZA 2EELA 1CK1A 3URYA 5D7GA 3V3XA 1PDXA 1SSNA 3P1MA 2MJDA 2INNE 1IGCA 1SXTA 1IGDA 1I4GA 2I2YA 2IGDA 3FILB 2ICIA 4KKJA 3NVVA 1XLQA 3BVMA 1SEBD 2N9KA 3HRDD 1ZXIA 3NUHB 1KF6B 3B9JA 3TEWA 3FC4A 3SFEB 2FE8A 1GPXA 2SEBD 1TYGB 1ZP0B 2BYTA 2QEJC 4YSZB 1C4CA 1ZUD2 2FBWB 2JXTA 5FR3A 1L4DB 3E56A 2K0PA 4WWMA 4XWWA 3ZGZA 3W5UB 2N9LA 4N6EB 4OW0A 4RCOA 4TQ1A 1N5WA 1T6BX 2AQ1B 4D2KA 1VZ6A 1UWXA 2WNMA 2BS3B 2KDMA 2M19A 2X38A 2WXHA 1XF5L 3VQIA 3TSSA 2DWQA 4JWUC 3MC0B 2ACZB 2V4IB 1RWSA 3LXFA 2WLBA 1JRPA 3N9YC 1RYJA 1XLNA 1ENFA 1ET6A 1TY2A 5GXGB 3DWGC 1YJJA 2QILA 3BZDB 4AS1A 3NZ3A 2PIAA 4L2YA 1FRDA 1DGJA 2WU5B 2ZW0A 1GAQB 3GB1A 4P16A 1HXYD 3Q69A 1OFFA 2YEPB 4MT5A 5G5GA 1T5XD 5JXVA 2BTEA 2ON8A 4XDCA 3GS2A 3W2DA 1PGBA 4ZRQA 3P4RB 4OVZA 1QOAA 4RGOS 4KGTA 1B1ZA 1TS5A 2OEDA 2AX5A 3MFGA 4P6VF 2BS4B 1VDVA 2AQ3B 3Q8FA 5C2TB 1CQVA 1D5MC 3RFZB 1VLBA 2PVOD 1RFKA 3AEEB 2CJOA 1SF0A 1SJHD 5H92C 1KLGD 4IOIE 2MEKA 1UWMA 1L0XB 2RPVA 3FILA 2QIEB 1FFUA 2PLPA 3PO0A 4A9AA 1JWSD 5LNK1 5BMGA 3T3OA 3LB8C 5BYSA 1JALA 1UGJA 4L23A 3TEYA 2IPKD 3IAS1 4JPSA 1GB1A 5HHDG 3KQ4A 2Y3AA 1KTKA 1J7CA 1SE2A 2V3PA 2PW9A 1ZXHA 1YN5A 2VZKD 3AE7B 1BXTA 2QJLA 3AE2B 4GLSC 2DYOA 3TUOA 4USAA 2JYEA 3BK1A 5EE1A 1SBBB 1TKYA 1ZE3D 3ETRA 1YJIA 4IDIA 1P7EA 1P7FA 2RDHA 2CJNA 2WDQB 1HZ6A 1ET9A 2EKIA 1FFVA 2K9XA 3BVZA 2OHFA 1WWTA 3AB5A 3P4QB 1LO5D 2WP9B 1JWAD 4KKIA 3MHZA 2HTME 1K50A 3AEBB 1JW9D 4ZRPA 3TEXA 4WH4A 4WURA 3CIRB 2WXJA 1FXIA 2J53A 5MPOA 4KGRA 4RGNA 1QLBB 1ZDXA 2WXRA 1HEZE 1FMAD 2Y5CA 5AUIA 3EGRA 4YWGG 1VRAB 4LTUA 1YQ3B 3EA6A 1E10A 2E3TA 2H88B 4AQ7A 4KGSA 3AECB 3IT6B 5C3JB 4C56C 1C78A 4Q2JA 2JSVX 3AV8A 2JYTA 4REZA 1SE3A 2NTSA 3NVYA 2WXGA 3PZ8A 2KWDA 2BT6A 2DLBA 2SAKA 4LK0M 1KLUD 1L4ZB 2LUMA 2BW2A 3FAHA 3IAM1 3AE4B 5HI1A 2K22A 1BUIC 1SIJA 1KH0A 1STEA 2GB1A 3AM9A 4C7YA 1F77A 3BWUD 2LEKA 2W3SA 3I9V1 4N58A 3Q8EA 4OZCA 2WXOA 1QT9A 3NRZA 2Q5WD 4UDUC 4ARCA 3IXSA 4O1NA 1Y56A 3P63A 5BMHA 2WQYB 4WAFA 1HA5A 2K5PA 3W9CB 2CU3A 3BVGA 1QF6A 1TKGA 1N5XA 1NEKB 1FCCC 2WS3B 5H8YE 1YQ4B 4IKGA 1TY0A 5AUKA 3R8BA 4YXDB 1V1PB 2FUG1 3EUB2 3W5VB 4TSSA 2KMMA 4YTMB 3AE5B 4NJCA 4KX6B 2BB5A 2IGHA 4N59A 1QOFA 3AH7A 3KWVA 5EE3A 1DYQA 3AEDB 1WRIA 1EWYC 1IUEA 4HEA1 4YTPB 1C77A 2QSDA 2Y5PA 2N7JA 3WCQA 4A90A 1I4QA 2L52A 2MJ3A 1YN3A 4NZLB 1B9RA 1TS4A 2MH7A 1MI0A 2PMVA 2WXLA 4RFBA 2PKOA 4XDDA 3PZ7A 1NENB 1L6UA 2NMQA 1QKZA 3E9SA 1JWMD 3MP9A 1E7PB 2W82A 1TS3A 3HVZA 2IJ0A 1N63A 3LYYA 3UI3A 2WXPA 2IDYA 3T3NA 5D3DA 2V3NA 3OWEB 4M0WA 4US9A 1SJED 1ZDVA 3L4PA 1HZ5A 2J52A 4HRSA 1XCQL 2HDEA 3KLSX 1VJKA 1CJEA 2G1EA 3AEGB 2RMMA 3GP7A 3VR8B 2LMCA 1XLPA 1QQRA 1ZPSA 2GRIA 4US8A 2WXNA 2YEPF 3ZYYX 3NVWA 4MM3B 1JQ4A 4EE2A 4HKZE 3ZQ4A 3ZJVA 1KFYB 1FIQA 1K53A 1D6EC 3AE8B 1EM7A 3DWMA 1DOYA 4ITKA 3SFDB 3AE3B 3Q8BA 3ZJTA 3SR6A 4C80A 2JQRB 2LHEA 4OHJA 3R2TA 1PUTA 3U4EG 2BS2B 1FXAA 4RF0A 5HG2A 2N0SB 2PTLA 3P42A 4FXCA 1IBXB 1I4HA 3AE9B 3R2IA 1WYGA 5HFYA 1V1OA 4L1BA 1FNUA 5EE0A 1FNWA 3Q8AA 1V1PA 1E0ZA 1XXGA 1PGAA 1JWBD 1GOZA 3AMZA 1EU3A 4HKQA 1E9MA 2KACA 2LHDA 4MACA 2BBCA 1BMLC 4RH6A 2DBYA 1J7BA 1TS2A 3AEAB 3NS1A 1WXQA 1TZOA 4YT0B 1QILA 1PFDA 1D5XC 3Q8CA 2XN9C 1SB3C 2Z8LA 2R61A 1AW7A 1JCKB 2WXMA 2V0GA 3VRBB 3AE6B 2LGIA 3HVDA 3O13A 3AE1B 1XO3A 1FO4A 1FCLA 1AYFA 1J7AA 5EE9A 1Q10A 1ACCA 4DQOC 2KN4A 2J4XA 4ZHOA 1T3QA 1V97A 1QOBA 3AEFB 4YSYB 1ESFA 4DXGA 2KAJA 2L83A 4YTNB 1D4BA 2GI9A 4YSXB 4PT5A 2W54A 3W1SA 1OQRA 2PVGC 3U52E 3C8YA 1OQQA 1XEEA 4CQNA 4RGMA 1C76A 4B0MA 2W55A 4WIPA 1L5PA 1KRHA 2QMTA 4NAWB 2BB6A 3BIID 4OZBA 2L1AA 4JE3B 5FKAC 1MHXA 4GDKB 1CZPA 4DXFA 2LJIA 1L0VB 4TMAB 1JROA 1QOGA 1YNTE 2NTTA 2JWUA 2E6XA 3RPFC 4TQ0A 4C7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGD A;  3FIL B;  1P7E A;  1P7F A;  1HZ5 A;  2J52 A;  1XCQ L;  1HZ6 A;  1K52 A;  2N9K A;  1IBX A;  2RMM A;  1K50 A;  4HKZ E;  2JXT A;  4WH4 A;  1FD6 A;  1K53 A;  1MVK A;  2K0P A;  1XCT L;  2N9L A;  2J53 A;  4KGR A;  1EM7 A;  4D2K A;  1HEZ E;  5BMI A;  1UWX A;  1JML A;  2KDM A;  2LHE A;  1XF5 L;  4KGS A;  1YMH E;  2JU6 X;  2JSV X;  5HG2 A;  2PTL A;  1MHH E;  1IBX B;  5HFY A;  2KWD A;  2ZW1 A;  1C9F A;  1PGA A;  4OZA A;  2LUM A;  2ZW0 A;  5HI1 A;  3GB1 A;  2KAC A;  2LHD A;  4MAC A;  2I38 A;  1MPE A;  1GB4 A;  1KH0 A;  2GB1 A;  5JXV A;  2ON8 A;  1PGB A;  4OZC A;  2ONQ A;  4KGT A;  2OED A;  5BMH A;  2LGI A;  1PGX A;  1FCL A;  2KQ4 X;  1FCC C;  1Q10 A;  4IKG A;  2KN4 A;  1D4B A;  4IOI E;  1F2R C;  2RPV A;  2IGG A;  3FIL A;  2GI9 A;  2IGH A;  1F2R I;  2PLP A;  4HJG E;  2QSD A;  5BMG A;  2JZP A;  1K51 A;  2N7J A;  2QMT A;  2EEL A;  1GB1 A;  4OZB A;  5HHD G;  3V3X A;  1MI0 A;  1MHX A;  2PW9 A;  1ZXH A;  1IGC A;  2NMQ A;  1QKZ A;  4GLS C;  1YNT E;  3MP9 A;  2JWU A;  1IGD A;  2I2Y A;  3UI3 A; 
#chains in the Genus database with same CATH topology
 2KX3 A;  3JYU A;  2IY0 B;  4FHK A;  2V4L A;  5EDS A;  3N20 C;  3HUI A;  1D5Z C;  4I6L B;  2KAN A;  1PYW D;  2AEH A;  3DOW A;  3P4P B;  2LGD A;  3B2G A;  1FXT B;  3HHM A;  3DBR I;  1J8C A;  2WXF A;  3EEC A;  5BMI A;  1DOX A;  4B0E A;  1C4P A;  5AZG A;  4EKU A;  2ZCB A;  3KVF B;  4XE0 A;  2J42 A;  4IG7 B;  4GDL B;  2ZZP B;  1MJD A;  2C7M B;  4BBN F;  2O2V B;  3DCG A;  3U2S C;  4PK1 A;  3CSF A;  2ZJD A;  1OGW A;  5BYR A;  2K3U A;  2Z0E B;  4BVU C;  4K3B A;  2R2Q A;  1MPE A;  1WH3 A;  4LLG M;  2WDR B;  2WDV B;  3DVG X;  4HLE A;  4MJS B;  5AEK B;  4LJO B;  4MH8 A;  3RNC C;  2D11 A;  3UIP B;  4JWS C;  4XC2 A;  4PYZ A;  5G5H A;  3MTN B;  1AN8 A;  1P0R A;  4WQM A;  2G4D B;  3ZIM A;  3BY4 B;  3ZW3 A;  4A6Q A;  2OJW A;  4HCP B;  3PZD A;  1VZ7 A;  3PRM B;  1NYR A;  1RLF A;  2D5G A;  2XNA C;  3PVL A;  1TKE A;  4BBN C;  4ZYS A;  1R7S A;  2JZ3 B;  2MBH A;  3URY A;  3C0R B;  3V3X A;  2HTH A;  1WJ4 A;  5IP4 D;  2KWU B;  2KWV B;  3VHT C;  1SXT A;  2YVC A;  1IGD A;  1I4G A;  1RRB A;  2QC8 A;  3H7P B;  1WY8 A;  3NVV A;  2CR5 A;  1SEB D;  1Q1O A;  1ZXI A;  3NUH B;  3TEW A;  2MSE D;  2DZM A;  2DNF A;  4NPN A;  4YSZ B;  4IWO A;  1C4C A;  1MG8 A;  2FBW B;  4BOS C;  3IHP C;  4B6W A;  3W5U B;  2N9L A;  4N6E B;  2RGF A;  1KOT A;  1UZX B;  3KW5 B;  2WXH A;  1XF5 L;  4JIO U;  3TL5 A;  4E74 A;  2IY1 B;  2V4I B;  2KVR A;  2G3Q B;  1T0S C;  1WZ3 A;  3PRE A;  1ET6 A;  2MW5 A;  1TY2 A;  5CX3 A;  1YJJ A;  3NZ3 A;  1FRD A;  2ZW0 A;  2LD9 A;  5J2R A;  1GAQ B;  2YEP B;  5G5G A;  2BTE A;  5JXV A;  2KQS A;  4KGT A;  1EUV B;  1WM2 A;  1WX7 A;  1V81 A;  1CQV A;  3HM6 X;  1D5M C;  1VLB A;  4EEW A;  2VRR B;  2CJO A;  2LGY A;  2RPV A;  1WJ6 A;  2KXJ A;  1FFU A;  4W9F A;  4A9A A;  3JW0 X;  2BWE S;  2KVZ A;  2VH1 A;  3IVF A;  3LB8 C;  5BYS A;  1JAL A;  2EKE C;  1GB1 A;  2LVP A;  4DHJ B;  1KTK A;  1J7C A;  1BXT A;  3AE2 B;  4WJN A;  2WWZ A;  2GBR A;  1CMX B;  1UBQ A;  1SBB B;  2AWT A;  4M01 A;  4K7S A;  4C00 A;  3ETR A;  1YJI A;  4DHZ E;  1D3Z A;  2CJN A;  2LVO A;  2WDQ B;  2KHW B;  2D3B A;  2EKI A;  2DAJ A;  5DPR A;  2K9X A;  2K1F A;  1MG4 A;  1WWT A;  2D3A A;  2D3C A;  4X57 B;  3AEB B;  3HM3 A;  4GU2 A;  1WGD A;  4ZRP A;  3TEX A;  4WH4 A;  1SIF A;  4WUR A;  1GUA B;  2WXJ A;  1FXI A;  5MPO A;  2Y5C A;  4W9E A;  3DPD A;  2E3T A;  5IKC M;  3R7R A;  4AQ7 A;  3IT6 B;  4C56 C;  2JSV X;  1ZKH A;  2JY6 A;  3ZDT A;  1SE3 A;  2WXG A;  4LK0 M;  1L4Z B;  4YL8 A;  2LUM A;  2BW2 A;  2MLB A;  5E6P A;  1SGH A;  2K22 A;  3Q3O C;  3EFU A;  1F77 A;  3VH3 B;  3NY5 A;  4JGH B;  2W3S A;  3TIX A;  4WAF A;  2K5P A;  4KZ0 A;  2CU3 A;  4ANV A;  1TBE A;  1TKG A;  2WX0 A;  1YQ4 B;  3R8B A;  4F1S A;  4TSS A;  2XK5 B;  4JLC A;  2BB5 A;  1NBF C;  3A9K B;  2BYV E;  3NS8 A;  3AED B;  4KVG B;  1WRI A;  1IUE A;  1H8C A;  1C77 A;  2QSD A;  4A90 A;  3UQB A;  3GE8 C;  1T0Y A;  4W9C A;  1B9R A;  2PMV A;  2WXL A;  2N9X A;  3IFW B;  2IO1 B;  2REX A;  1IPG A;  1WE7 A;  4LJP B;  3E9S A;  3DDC B;  3MP9 A;  3H9D A;  2IJ0 A;  2WXP A;  5GMV A;  1E5W A;  2V3N A;  4US9 A;  4M0W A;  2Z0D B;  1CJE A;  3AEG B;  3NZU A;  3RZW C;  2O6V D;  1OEY J;  2WXN A;  2WGS A;  3NVW A;  5D2M B;  1JQ4 A;  4HWI B;  4AP4 C;  3ZJV A;  1KFY B;  4LNN A;  2RD0 A;  2MRP A;  2NVU I;  3SFD B;  2D3G A;  2ZEQ A;  3AE3 B;  3ZJT A;  3ZXR A;  2LHE A;  1PUT A;  3L17 A;  2K8B A;  4RF0 A;  3L16 A;  2N0S B;  2PTL A;  3R2I A;  1WYG A;  4OVV A;  1FNW A;  3B1L X;  1XXG A;  3I3T B;  2M4N A;  4ZRK A;  3AMZ A;  4HKQ A;  4MAC A;  3AEA B;  3NS1 A;  1TZO A;  1QIL A;  3L10 B;  4A20 A;  1TZ1 A;  3WAN A;  2CHX A;  3ZRC A;  2FAZ A;  1Q10 A;  1ACC A;  2KN4 A;  3R3M A;  4YSY B;  2KAJ A;  2L83 A;  3L08 A;  4DK5 A;  2W54 A;  4IWQ A;  3WAM A;  2V9H A;  1OTR B;  4CQN A;  3QX1 A;  3VDZ A;  4HPL B;  1UEL A;  4WIP A;  1L5P A;  3H6N A;  2LUE A;  4MM3 A;  1M94 A;  4NAW B;  3BII D;  2KLC A;  4GDK B;  3H7S A;  1WXS A;  4TMA B;  1QOG A;  5IOI A;  1R4N I;  1EWC A;  2KTR A;  3WAL A;  1N60 A;  5D3I B;  1LFD A;  3GZN B;  1MVK A;  4JX1 C;  2J0M A;  3ZJU A;  2KC1 A;  1WGG A;  1YN4 A;  2N9P C;  1VZ8 A;  3DBH B;  4DHZ B;  2FUH B;  5I4D A;  3HK0 A;  2DYM A;  4A55 A;  1WRD B;  4FJY A;  1WJN A;  2J0J A;  2ZVO A;  2HE7 A;  2JRH A;  3BYY B;  1YMH E;  2TSS A;  1N62 A;  1TTN A;  1ROE A;  2BKF A;  1MFW A;  3N1X C;  2GBK A;  2RDG A;  2G9H D;  1JRU A;  2MBB B;  3N3K B;  2ZW1 A;  1F0Z A;  1C9F A;  2W3R A;  3QQ8 B;  1M4V A;  2KMC A;  4ZHP A;  2VZK B;  1IP9 A;  2N9E B;  5FK9 C;  3VR9 B;  2KDF B;  1ZOY B;  3UGB B;  3M3J A;  4MGI E;  3V6E B;  2N7E A;  3IT4 B;  2KKC A;  1DOI A;  3PRP B;  1V5T A;  1VR9 A;  1S1Q B;  1EU4 A;  3P4S B;  4W9H A;  2ZPY A;  1I4P A;  4LCD E;  2X8X X;  4LNO A;  1L0Y B;  3MJ5 A;  3ZTD A;  3JSV A;  2KTF A;  3BYT B;  1F2R I;  3WAP A;  2JZP A;  5TSS A;  2KOX A;  2GBJ A;  4EZK A;  4M8M A;  1UF0 A;  1PDX A;  4CO7 A;  2NPT A;  4EZJ A;  4GB9 A;  4M02 A;  1I42 A;  2K6Q A;  2UWQ A;  4FHJ A;  4KKJ A;  1XLQ A;  3RUL A;  2LVQ A;  2ZVN A;  2N9K A;  3DBL I;  3W1S C;  2ZPN A;  1ISN A;  2JVC A;  1WIA A;  2SEB D;  1ZP0 B;  2BYT A;  1S3S G;  2QEJ C;  2JXT A;  3RNB C;  5IA7 A;  3E56 A;  4XWW A;  3ZGZ A;  4MSM B;  1N5W A;  1Q5W B;  1VZ6 A;  1UWX A;  2WNM A;  2KDM A;  3TSS A;  5CHF A;  3V62 A;  4BOZ B;  2ACZ B;  4WWO A;  1C1Y B;  2UYZ B;  5GXG B;  4NQL B;  4L2Y A;  1DGJ A;  2GMI C;  1P98 A;  1AAR A;  4P16 A;  2K8C A;  1OFF A;  4NJ6 A;  2KFJ A;  2Y5B B;  4XDC A;  3A9J B;  3GS2 A;  1PGB A;  1SE9 A;  2C7H A;  3V60 A;  1B1Z A;  3A33 B;  3MFG A;  1YX5 B;  2BS4 B;  2AQ3 B;  3Q8F A;  3U8Z A;  3AEE B;  2VH2 A;  4P1C C;  4HK2 A;  4OVU A;  1L0X B;  3FIL A;  3EHV A;  2GBN A;  5HKH A;  4J6I A;  1WXA A;  2PLP A;  3DHI C;  1V49 A;  1JWS D;  1P3Q U;  5J18 A;  2FIF A;  2IPK D;  4PYU A;  3IAS 1;  2CHZ A;  1SE2 A;  2MX2 A;  1R4M B;  2PW9 A;  1ZXH A;  4A3O A;  1KLV A;  3TUO A;  4USA A;  2KYW A;  3BK1 A;  1WX8 A;  2W9N A;  4M00 A;  2PE9 A;  3U30 A;  2RDH A;  2YLM A;  3RT3 B;  1WJU A;  2HD5 B;  3AB5 A;  4BKS A;  4DXA B;  2N4F A;  1LO5 D;  3P4Q B;  3QJZ A;  2WP9 B;  5DPW A;  2HTM E;  5D6J B;  4IW0 A;  3M95 A;  2NCN A;  3SD5 A;  1E90 A;  1QLB B;  1FMA D;  5AUI A;  3OJ4 B;  4YWG G;  1VRA B;  4LTU A;  5IO9 A;  1YQ3 B;  1E10 A;  3AEC B;  3RN9 C;  3AV8 A;  2K8H A;  3Q6B A;  1ZGU B;  4G3X B;  4FUL A;  2O6V A;  3PZ8 A;  2BT6 A;  2SAK A;  2NR2 A;  3Q3F A;  2KJ6 A;  2M17 A;  2GB1 A;  4C7Y A;  3BWU D;  5KHO A;  2LEK A;  3EFC A;  1IYF A;  3AU5 A;  2WX1 A;  1RFA A;  1V5O A;  2LXA A;  3NRZ A;  3RZF A;  3IXS A;  1G6J A;  2IO2 B;  1HA5 A;  1WM3 A;  1E8Y A;  1N5X A;  1NEK B;  1FCC C;  4IKG A;  1TY0 A;  2FUG 1;  2NS5 A;  3EUB 2;  3W5V B;  3AE5 B;  4N59 A;  2LGX A;  1DYQ A;  5IN7 A;  4W9I A;  4YTP B;  4FBJ B;  4WJO A;  2N7J A;  1YN3 A;  4NZL B;  3QAQ A;  1OEY A;  2MH7 A;  2MHJ A;  4XDD A;  1NEN B;  1WMH B;  1L6U A;  2NMQ A;  1QKZ A;  1WFY A;  2EMS A;  1TS3 A;  2W82 A;  3HVZ A;  5D3D A;  2N1V A;  1HZ5 A;  3ZVV A;  1VJK A;  4F7Z A;  3C19 A;  2KFK A;  4G50 A;  3VTU A;  1QQR A;  1WXV A;  4US8 A;  3UQA A;  2YEP F;  2K25 A;  4TUU A;  4EE2 A;  3AE8 B;  3PSE B;  4BFR A;  1F52 A;  2KJR A;  1EM7 A;  3DWM A;  1TGZ B;  2NBW B;  3Q8B A;  2JQR B;  3A4S C;  4E3C A;  4BKT A;  4OHJ A;  3SU8 X;  1WF9 A;  2BS2 B;  2KQ7 A;  3VTW A;  3B0A A;  1BT0 A;  4DHJ D;  3P42 A;  4HCN B;  1GC7 A;  2L8J A;  1LM8 B;  5HFY A;  2MP2 A;  3AXC A;  2LI5 A;  3DBR B;  3DHH C;  3ALB A;  5KHQ A;  4FJV B;  1J19 A;  3Q8A A;  1V1P A;  1RAX A;  2KT7 A;  1PGA A;  1P1A A;  2WHI A;  1EU3 A;  2BYF A;  2LHD A;  3JVZ X;  4K1R B;  2BBC A;  4RH6 A;  1WXQ A;  1PFD A;  1D5X C;  3Q8C A;  2WYQ A;  2Z8L A;  3U7D A;  2L0T A;  1AW7 A;  2D10 A;  5JH5 C;  3HVD A;  3O13 A;  3AE1 B;  1XO3 A;  4QAY A;  1FO4 A;  1AYF A;  4ACF A;  1GG3 A;  4JQW C;  2DAF A;  4KSK C;  1V97 A;  2LAS A;  3AEF B;  4DXG A;  4MEM A;  1WE6 A;  2KMA A;  4PS3 A;  2KWC A;  4BZA A;  3W1S A;  1WGR A;  1FPY A;  4KDL B;  2HJ1 A;  3U52 E;  4NQK E;  3KYC D;  4RGM A;  3X0W A;  4BAX A;  1GJZ A;  3UIN B;  1NI2 A;  4OZB A;  4BKG A;  3ZNI D;  1MHX A;  3PLV A;  3PPA A;  4DXF A;  2E6X A;  2LRW A;  3VFK A;  2AYO B;  2C5L C;  2WXK A;  4K3C A;  4A8X C;  2MJE A;  1I4X A;  4H2A A;  4HRO A;  4BKS D;  4RF1 A;  1IBX A;  2MBE A;  3SDL C;  4B95 A;  2WXI A;  2H89 B;  1FD6 A;  4AUQ C;  3KUD B;  1NVI D;  1XCT L;  4XGA B;  2IZV B;  1JML A;  2FID A;  4MGZ E;  2OOB B;  4NAM A;  3I57 A;  3LDZ E;  2B76 B;  2INC C;  1SE4 A;  1I7H A;  2LZ6 A;  1MHH E;  3SEB A;  1NI3 A;  3A1Q A;  4RGT A;  3NJT A;  1NDD A;  3KYD D;  2PPH A;  2AQ2 B;  4F8C B;  2M56 B;  2C9W B;  4MEL A;  1TJE A;  2NBU A;  3RYT A;  5G55 A;  1GB4 A;  3RNE C;  2INP E;  3DVG Y;  1LGR A;  3ZUN A;  2ONQ A;  3I63 C;  1UH6 A;  1WZ0 A;  1N61 A;  1AWD A;  2KQ4 X;  3UF8 A;  1UUP A;  1Q0W B;  1C79 A;  1E8Z A;  3U7Z A;  3ZNG C;  3TEZ A;  2KO3 A;  1RM6 C;  4URK A;  2ZNV B;  2I1K A;  2M0A A;  2BYE A;  1UNS A;  3CWI A;  4PS8 A;  5E6N A;  1WGK A;  3H8H A;  4HJG E;  1YIW A;  2G45 B;  1K51 A;  2FCS A;  1XLO A;  4HDO A;  3NVZ A;  3QK0 A;  2EEL A;  1CK1 A;  3PLU A;  2OJR A;  1SSN A;  2INN E;  1IGC A;  2N7D A;  1WR6 E;  3DVN V;  2I2Y A;  2J0K A;  1OQY A;  1QZE A;  1T0R C;  2KC2 A;  4GDL A;  3HRD D;  5D94 A;  3QA8 A;  1KF6 B;  3B9J A;  3FC4 A;  1V80 A;  3OLM D;  1GPX A;  2O2V A;  1ZUD 2;  5FR3 A;  3SHQ A;  2DYB A;  2K0P A;  4WWM A;  3ZTC A;  4FA6 A;  1WGH A;  4TQ1 A;  2AQ1 B;  2BS3 B;  4P7I A;  4DWF A;  3Q3N C;  3VH4 B;  1HTO A;  4MJS A;  3VQI A;  2DWQ A;  4JWU C;  1ZW7 A;  5BO4 B;  2HJ8 A;  4KZC A;  1RWS A;  3LXF A;  2CKH B;  1XLN A;  3WIM A;  5JZE B;  1WXM A;  3PHX B;  3AI5 A;  3DWG C;  4KIK A;  3BZD B;  4AS1 A;  1LXD A;  2PIA A;  1EO6 A;  3P2B A;  1HXY D;  1V9J A;  4A3P A;  2FCM A;  4MT5 A;  1T5X D;  2ZNV C;  3NG0 A;  2JXX A;  4AWJ A;  3W2D A;  4OVZ A;  1QOA A;  4RGO S;  1TS5 A;  2OED A;  1WYW B;  2AX5 A;  2ZCC A;  2BWF A;  1VDV A;  2MCN B;  4S0R A;  3RFZ B;  2PVO D;  1E7V A;  3Q3J A;  1SJH D;  5H92 C;  1KLG D;  2QCZ A;  3H7P A;  5C1Z A;  1UWM A;  3DBS A;  2QIE B;  2JWZ A;  5DPS A;  3ZLZ A;  4W9J A;  2JRI B;  2PEA A;  3T3O A;  4KSL C;  1UGJ A;  4L23 A;  3TEY A;  3N1Y C;  3PS6 A;  2GBM A;  5HHD G;  3KQ4 A;  2Y3A A;  1WI0 A;  5IAA C;  3ML8 A;  2VZK D;  3AE7 B;  4IM0 A;  3V6C B;  4GLS C;  2K6D B;  4ZYN A;  1ZE3 D;  4IDI A;  1P7E A;  2IND C;  3TBL D;  1P7F A;  1HZ6 A;  1ET9 A;  2PE6 B;  5CTR C;  2RPQ A;  3K9O B;  1FFV A;  3TCA A;  1L2N A;  2LJ5 A;  2OHF A;  4LDT D;  3VUX A;  3MHZ A;  1K50 A;  1LQB A;  1JW9 D;  3ZDM C;  3ZXV A;  4KGR A;  4RGN A;  2MWS B;  2WXR A;  4TV3 A;  3DHG C;  4M0W B;  3EA6 A;  3RD2 A;  4ANX A;  4KGS A;  3N1Z C;  1C3T A;  5C3J B;  1C78 A;  4Q2J A;  3K9P B;  2Z59 B;  2JYT A;  2KDE B;  3DVN U;  3D32 A;  3MHS D;  3H1U A;  3NOB A;  1KLU D;  1H4R A;  2BGF A;  3IAM 1;  5CHV C;  1SIJ A;  1KH0 A;  3L13 A;  3WAO A;  2KNB A;  4GSW A;  3I9V 1;  1QT9 A;  4UDU C;  4O1N A;  1Y56 A;  5BMH A;  2WQY B;  4K7U A;  4G0N B;  3BVG A;  1QF6 A;  5H8Y E;  1Z2M A;  2WS3 B;  5AUK A;  1YD8 U;  3IBE A;  2CS4 A;  4C4V A;  4GOC A;  3NHE B;  2KMM A;  4YTM B;  3NZS A;  4NJC A;  2IGH A;  1UGM A;  3AH7 A;  2RDB C;  2Y5P A;  3WCQ A;  2MBO A;  2QDF A;  2NBV B;  3OAW A;  1TS4 A;  4HVB A;  4RFB A;  3R66 C;  5CHW A;  1XT9 B;  3PHW B;  3FKY A;  1V6E A;  3LYY A;  1KJT A;  4MDK E;  3KH0 A;  3T3N A;  1ZDV A;  3ECI A;  1HE8 A;  2DX5 B;  2J52 A;  4MH0 E;  2G1E A;  5JHA A;  2RMM A;  3GP7 A;  2LMC A;  1XLP A;  1ZPS A;  1YJ1 A;  2ASQ A;  4II3 B;  4MM3 B;  3EC8 A;  4HKZ E;  3ZQ4 A;  2AL3 A;  1FIQ A;  4RM9 A;  4ZRI A;  1R4N B;  4ZRJ A;  4WWN A;  1DOY A;  1I35 A;  3SR6 A;  3R2T A;  3Q14 C;  5FR6 A;  3QAR A;  4WQO B;  2G4S A;  3QHT A;  1FXA A;  5HG2 A;  2KTR B;  4FXC A;  2KX0 A;  3LJ3 A;  4CYE A;  3QWZ B;  4L1B A;  1FNU A;  3OJ3 A;  5LLI A;  4EUT A;  4HPM B;  4GN1 A;  4KIK B;  2XK5 A;  2KAC A;  4FN2 A;  3ZNH B;  3A9K A;  2DBY A;  1J7B A;  1TS2 A;  1E8W A;  2GOW A;  2XN9 C;  1SB3 C;  2R61 A;  1JCK B;  2WXM A;  3VRB B;  1K8R B;  2LGI A;  3RUI B;  2BF8 B;  1FCL A;  1J7A A;  2KD0 A;  4HJK A;  3HIZ A;  4CHK A;  1ESF A;  4YSX B;  4DDI D;  4W9L A;  1OQR A;  2JPH A;  1XEE A;  1TT5 B;  3M63 B;  4B0M A;  5C23 A;  2KLG A;  2L1A A;  4XYC A;  5FKA C;  3CST A;  1CZP A;  2V1Y A;  1L0V B;  4W9G A;  1JRO A;  1YNT E;  5E6O A;  4FAD A;  4ANW A;  3RPF C;  3AU4 A;  4TQ0 A;  4ICU A;  1GNU A;  2L0F A;  4C7Z A;  2JT4 B;  2K39 A;  1E7U A;  3BK2 A;  2BKR B;  3JSV B;  2L7R A;  4NJ7 A;  2D07 B;  2DZI A;  3R7Q A;  4DBG A;  2C60 A;  3VXW A;  1E6E B;  2LGS A;  3APF A;  1K52 A;  5E6J A;  3VUY A;  3B2F A;  1FM0 D;  3J9C A;  4GXB A;  1UD7 A;  4I6N B;  3V05 A;  2A4Z A;  4MGK E;  1XD3 B;  1L6V A;  4ZOH C;  1FRR A;  1WGY A;  2NPT B;  4B9K A;  1FEH A;  5T8I A;  2WU2 B;  3UIO B;  2M1M A;  2D2Q A;  3DBL B;  2IBI B;  1YX6 B;  4XWT A;  2LFI A;  3BIN A;  3ZRF A;  2WDT B;  2JU6 X;  4J3O D;  3O65 B;  1GC6 A;  1WR1 A;  1WSP A;  3QCA A;  1N6Z A;  1T0Q C;  1KM7 A;  3AN1 A;  3GE3 C;  4EZL A;  4EFO A;  2IYD B;  4NY0 A;  4OZA A;  4EOY A;  3RNG C;  2I38 A;  4ARI A;  2RR9 A;  4R3D A;  1YOV B;  2N1W A;  3VRA B;  1C4A A;  4RNA A;  5BYQ A;  1NYQ A;  3ABV B;  1V8C A;  1V86 A;  2KK8 A;  1PGX A;  4NAW A;  4GDK A;  3ONS A;  4ZDV A;  3M62 B;  1XQQ A;  1I4R A;  4HDQ A;  1JWU D;  3MC8 A;  2XEW A;  1Y8R C;  4C4V B;  2JX5 A;  1F2R C;  2IGG A;  1FNV A;  2KJH B;  3KWL A;  3ML9 A;  2I1J A;  1HQR D;  2L32 A;  3MC9 A;  1WX9 A;  4HXD A;  4LNF A;  2WXQ A;  1A70 A;  3ZNZ B;  3AUL A;  4G11 A;  5D7G A;  4MGY E;  3P1M A;  5L83 A;  4WWP A;  2MA9 B;  2MJD A;  3APD A;  2IGD A;  3GZN I;  3VUW A;  3FIL B;  2ICI A;  4IM3 A;  4MSQ B;  2LWP A;  3DBH I;  3BVM A;  1U4A A;  4WJP A;  3VVW B;  3SFE B;  2FE8 A;  3S2A A;  1TYG B;  5LXI B;  2C7N B;  3GOE A;  1L4D B;  2IO3 B;  4OW0 A;  4RCO A;  1T6B X;  4D2K A;  3DQV A;  4GIV A;  2M19 A;  2X38 A;  5G2N A;  3CMM B;  4AOF A;  2JZZ A;  3OG5 A;  1F1H A;  3MC0 B;  3KUC B;  3PRZ A;  5DCN A;  4GGQ A;  2WLB A;  1JRP A;  3VTV A;  3N9Y C;  1RYJ A;  1ENF A;  2L05 A;  3PV1 A;  3MJW A;  2QIL A;  2WU5 B;  2M8S A;  3GB1 A;  2R2O A;  3Q69 A;  3PTF C;  4JL9 A;  3TMP B;  3X23 A;  2ON8 A;  4DDG D;  4GMV A;  4ZRQ A;  3P4R B;  5L95 C;  4P6V F;  4AJY B;  3KUZ A;  5C2T B;  2O6V B;  1RFK A;  1SF0 A;  4ANU A;  1EF5 A;  4IOI E;  2MEK A;  2BVC A;  5DPT A;  3PO0 A;  5LNK 1;  4PS7 A;  5BMG A;  1YQB A;  2XBB C;  3IG3 A;  3CF6 E;  3TJP A;  4JPS A;  2V3P A;  2B3A A;  5J17 A;  3W1Y A;  1YN5 A;  2PJH A;  2QJL A;  3N32 A;  2DYO A;  2DZJ A;  2JYE A;  3RNF C;  5EE1 A;  1TKY A;  2M0X A;  1J0G A;  3BVZ A;  4M8N A;  3Q3M C;  1JWA D;  4KKI A;  1A5R A;  4IUM B;  4XX5 A;  3Q2A C;  2KDI A;  3CIR B;  2J53 A;  1ZDX A;  4S17 A;  1HEZ E;  1X1M A;  3EGR A;  1VD2 A;  3A9J A;  1E8X A;  2H88 B;  2AL6 A;  2KFK B;  4K81 A;  1L7Y A;  4REZ A;  2BPS A;  2NTS A;  3NVY A;  3B08 A;  2KWD A;  2DLB A;  4IM2 A;  3RCZ A;  3L54 A;  3RI7 C;  2LRU A;  3FAH A;  5HI1 A;  3AE4 B;  3V61 A;  5AZF A;  4WJQ A;  1BUI C;  1STE A;  3I5J C;  3AM9 A;  2EMT A;  2DZK A;  1F9J A;  4N58 A;  3QC8 B;  3Q8E A;  4OZC A;  2WXO A;  4LNI A;  2Q5W D;  4ARC A;  2KZR A;  3P63 A;  3W9C B;  2MP2 B;  4LNK A;  4YXD B;  1V1P B;  2L00 B;  4ASW C;  1UBI A;  5AZH A;  1R4M I;  4KX6 B;  1V2Y A;  1QOF A;  4KV2 A;  3KWV A;  5EE3 A;  1EWY C;  4HEA 1;  2A5U A;  2L3Z A;  2KDB A;  1I4Q A;  2L52 A;  2MJ3 A;  4P1B C;  4W9K A;  2J7Q B;  1MI0 A;  2PKO A;  5TR5 A;  3PZ7 A;  2QHO A;  1JWM D;  2CHW A;  3ZKJ C;  1E7P B;  1N63 A;  3UI3 A;  2IDY A;  3OWE B;  1SJE D;  3L4P A;  5JHB A;  3T9L A;  3QIJ A;  1VCB A;  4HRS A;  1XCQ L;  2HDE A;  3APC A;  3KLS X;  4I6P A;  3WA0 A;  2RSU A;  3VR8 B;  2GRI A;  2BQQ A;  3ZYY X;  2JUO A;  4AJW A;  1K53 A;  1D6E C;  2DHZ A;  3ZO5 B;  4ITK A;  2LXC A;  4FJZ A;  2UU7 A;  2MQJ A;  4C80 A;  2FNJ B;  5LXH A;  2IO0 B;  3U4E G;  2L76 A;  4E71 A;  1HTQ A;  3RNA C;  2FCN A;  1IBX B;  1I4H A;  1P9D U;  3AE9 B;  4WAA A;  1V1O A;  4II2 B;  4LDT B;  3PT2 B;  5EE0 A;  2FCQ A;  2JF5 A;  3A4R A;  4XZ4 A;  1E0Z A;  1JWB D;  4KDI C;  1GOZ A;  1E9M A;  1BML C;  2DEN B;  2GLS A;  4YT0 B;  4W9D A;  3PGE A;  1PQS A;  2V0G A;  4HPP A;  3AE6 B;  3A1Q B;  2CU1 A;  3RMK C;  5EE9 A;  3VAW A;  4DQO C;  1WMH A;  3T8M A;  1Z5S B;  2J4X A;  4ZHO A;  1T3Q A;  1QOB A;  4RMA A;  2MBQ A;  1D4B A;  3N30 A;  4FLH A;  4YTN B;  2KN5 A;  2GI9 A;  4PT5 A;  4IWP A;  1TIF A;  4NNJ B;  2PVG C;  4TKN A;  3C8Y A;  1OQQ A;  3ENE A;  1C76 A;  4K7W A;  2W55 A;  1KRH A;  2QMT A;  4N9F 4;  2BB6 A;  4ICV A;  4RM8 A;  4JE3 B;  2V3S A;  2LJI A;  2NTT A;  1EF1 A;  4IC7 B;  2JWU A;  3L0W B; 
#chains in the Genus database with same CATH homology
 3BK2 A;  2WXK A;  1E6E B;  1K52 A;  5E6J A;  4A8X C;  2MJE A;  1EWC A;  1I4X A;  4H2A A;  4HRO A;  4RF1 A;  1IBX A;  3HUI A;  3B2F A;  1D5Z C;  1FM0 D;  1N60 A;  3J9C A;  1PYW D;  2WXI A;  2H89 B;  5D3I B;  3V05 A;  3P4P B;  1FD6 A;  1L6V A;  4ZOH C;  1MVK A;  4JX1 C;  3ZJU A;  3B2G A;  1YN4 A;  1FRR A;  1NVI D;  1XCT L;  1VZ8 A;  1FEH A;  2WXF A;  5T8I A;  2WU2 B;  5I4D A;  5BMI A;  1DOX A;  4B0E A;  1C4P A;  1JML A;  4NAM A;  4XWT A;  2LFI A;  2DYM A;  3I57 A;  4A55 A;  2B76 B;  3BYY B;  1YMH E;  4XE0 A;  1SE4 A;  1I7H A;  2J42 A;  2TSS A;  2JU6 X;  4GDL B;  4J3O D;  1N62 A;  1ROE A;  1MHH E;  3SEB A;  1NI3 A;  1WSP A;  2RDG A;  4RGT A;  2G9H D;  3AN1 A;  3U2S C;  2ZW1 A;  5BYR A;  1F0Z A;  1C9F A;  2K3U A;  2W3R A;  2AQ2 B;  4OZA A;  1M4V A;  2M56 B;  2VZK B;  4ZHP A;  1TJE A;  2I38 A;  1MPE A;  5FK9 C;  3VR9 B;  4ARI A;  4LLG M;  1GB4 A;  2WDR B;  2WDV B;  1ZOY B;  4R3D A;  2INP E;  4MH8 A;  1C4A A;  4RNA A;  2ONQ A;  5BYQ A;  3VRA B;  1NYQ A;  4JWS C;  3ABV B;  1V8C A;  3IT4 B;  1PGX A;  1DOI A;  1VR9 A;  1N61 A;  1AWD A;  2KQ4 X;  1EU4 A;  3P4S B;  1UUP A;  5G5H A;  1I4R A;  1I4P A;  1JWU D;  1AN8 A;  1C79 A;  3U7Z A;  4WQM A;  1L0Y B;  3TEZ A;  3MJ5 A;  2JX5 A;  1F2R C;  4A6Q A;  1RM6 C;  2IGG A;  1FNV A;  3BYT B;  2M0A A;  1VZ7 A;  1UNS A;  3CWI A;  1NYR A;  1F2R I;  1WGK A;  3KWL A;  2D5G A;  2XNA C;  3H8H A;  1TKE A;  4HJG E;  1HQR D;  2L32 A;  4ZYS A;  2JZP A;  1K51 A;  1R7S A;  1A70 A;  2WXQ A;  5TSS A;  1XLO A;  3NVZ A;  2EEL A;  1CK1 A;  3URY A;  5D7G A;  3V3X A;  1PDX A;  1SSN A;  3P1M A;  2MJD A;  2INN E;  1IGC A;  1SXT A;  1IGD A;  1I4G A;  2I2Y A;  2IGD A;  3FIL B;  2ICI A;  4KKJ A;  3NVV A;  1XLQ A;  3BVM A;  1SEB D;  2N9K A;  3HRD D;  1ZXI A;  3NUH B;  1KF6 B;  3B9J A;  3TEW A;  3FC4 A;  3SFE B;  2FE8 A;  1GPX A;  2SEB D;  1TYG B;  1ZP0 B;  2BYT A;  2QEJ C;  4YSZ B;  1C4C A;  1ZUD 2;  2FBW B;  2JXT A;  5FR3 A;  1L4D B;  3E56 A;  2K0P A;  4WWM A;  4XWW A;  3ZGZ A;  3W5U B;  2N9L A;  4N6E B;  4OW0 A;  4RCO A;  4TQ1 A;  1N5W A;  1T6B X;  2AQ1 B;  4D2K A;  1VZ6 A;  1UWX A;  2WNM A;  2BS3 B;  2KDM A;  2M19 A;  2X38 A;  2WXH A;  1XF5 L;  3VQI A;  3TSS A;  2DWQ A;  4JWU C;  3MC0 B;  2ACZ B;  2V4I B;  1RWS A;  3LXF A;  2WLB A;  1JRP A;  3N9Y C;  1RYJ A;  1XLN A;  1ENF A;  1ET6 A;  1TY2 A;  5GXG B;  3DWG C;  1YJJ A;  2QIL A;  3BZD B;  4AS1 A;  3NZ3 A;  2PIA A;  4L2Y A;  1FRD A;  1DGJ A;  2WU5 B;  2ZW0 A;  1GAQ B;  3GB1 A;  4P16 A;  1HXY D;  3Q69 A;  1OFF A;  2YEP B;  4MT5 A;  5G5G A;  1T5X D;  5JXV A;  2BTE A;  2ON8 A;  4XDC A;  3GS2 A;  3W2D A;  1PGB A;  4ZRQ A;  3P4R B;  4OVZ A;  1QOA A;  4RGO S;  4KGT A;  1B1Z A;  1TS5 A;  2OED A;  2AX5 A;  3MFG A;  4P6V F;  2BS4 B;  1VDV A;  2AQ3 B;  3Q8F A;  5C2T B;  1CQV A;  1D5M C;  3RFZ B;  1VLB A;  2PVO D;  1RFK A;  3AEE B;  2CJO A;  1SF0 A;  1SJH D;  5H92 C;  1KLG D;  4IOI E;  2MEK A;  1UWM A;  1L0X B;  2RPV A;  3FIL A;  2QIE B;  1FFU A;  2PLP A;  3PO0 A;  4A9A A;  1JWS D;  5LNK 1;  5BMG A;  3T3O A;  3LB8 C;  5BYS A;  1JAL A;  1UGJ A;  4L23 A;  3TEY A;  2IPK D;  3IAS 1;  4JPS A;  1GB1 A;  5HHD G;  3KQ4 A;  2Y3A A;  1KTK A;  1J7C A;  1SE2 A;  2V3P A;  2PW9 A;  1ZXH A;  1YN5 A;  2VZK D;  3AE7 B;  1BXT A;  2QJL A;  3AE2 B;  4GLS C;  2DYO A;  3TUO A;  4USA A;  2JYE A;  3BK1 A;  5EE1 A;  1SBB B;  1TKY A;  1ZE3 D;  3ETR A;  1YJI A;  4IDI A;  1P7E A;  1P7F A;  2RDH A;  2CJN A;  2WDQ B;  1HZ6 A;  1ET9 A;  2EKI A;  1FFV A;  2K9X A;  3BVZ A;  2OHF A;  1WWT A;  3AB5 A;  3P4Q B;  1LO5 D;  2WP9 B;  1JWA D;  4KKI A;  3MHZ A;  2HTM E;  1K50 A;  3AEB B;  1JW9 D;  4ZRP A;  3TEX A;  4WH4 A;  4WUR A;  3CIR B;  2WXJ A;  1FXI A;  2J53 A;  5MPO A;  4KGR A;  4RGN A;  1QLB B;  1ZDX A;  2WXR A;  1HEZ E;  1FMA D;  2Y5C A;  5AUI A;  3EGR A;  4YWG G;  1VRA B;  4LTU A;  1YQ3 B;  3EA6 A;  1E10 A;  2E3T A;  2H88 B;  4AQ7 A;  4KGS A;  3AEC B;  3IT6 B;  5C3J B;  4C56 C;  1C78 A;  4Q2J A;  2JSV X;  3AV8 A;  2JYT A;  4REZ A;  1SE3 A;  2NTS A;  3NVY A;  2WXG A;  3PZ8 A;  2KWD A;  2BT6 A;  2DLB A;  2SAK A;  4LK0 M;  1KLU D;  1L4Z B;  2LUM A;  2BW2 A;  3FAH A;  3IAM 1;  3AE4 B;  5HI1 A;  2K22 A;  1BUI C;  1SIJ A;  1KH0 A;  1STE A;  2GB1 A;  3AM9 A;  4C7Y A;  1F77 A;  3BWU D;  2LEK A;  2W3S A;  3I9V 1;  4N58 A;  3Q8E A;  4OZC A;  2WXO A;  1QT9 A;  3NRZ A;  2Q5W D;  4UDU C;  4ARC A;  3IXS A;  4O1N A;  1Y56 A;  3P63 A;  5BMH A;  2WQY B;  4WAF A;  1HA5 A;  2K5P A;  3W9C B;  2CU3 A;  3BVG A;  1QF6 A;  1TKG A;  1N5X A;  1NEK B;  1FCC C;  2WS3 B;  5H8Y E;  1YQ4 B;  4IKG A;  1TY0 A;  5AUK A;  3R8B A;  4YXD B;  1V1P B;  2FUG 1;  3EUB 2;  3W5V B;  4TSS A;  2KMM A;  4YTM B;  3AE5 B;  4NJC A;  4KX6 B;  2BB5 A;  2IGH A;  4N59 A;  1QOF A;  3AH7 A;  3KWV A;  5EE3 A;  1DYQ A;  3AED B;  1WRI A;  1EWY C;  1IUE A;  4HEA 1;  4YTP B;  1C77 A;  2QSD A;  2Y5P A;  2N7J A;  3WCQ A;  4A90 A;  1I4Q A;  2L52 A;  2MJ3 A;  1YN3 A;  4NZL B;  1B9R A;  1TS4 A;  2MH7 A;  1MI0 A;  2PMV A;  2WXL A;  4RFB A;  2PKO A;  4XDD A;  3PZ7 A;  1NEN B;  1L6U A;  2NMQ A;  1QKZ A;  3E9S A;  1JWM D;  3MP9 A;  1E7P B;  2W82 A;  1TS3 A;  3HVZ A;  2IJ0 A;  1N63 A;  3LYY A;  3UI3 A;  2WXP A;  2IDY A;  3T3N A;  5D3D A;  2V3N A;  3OWE B;  4M0W A;  4US9 A;  1SJE D;  1ZDV A;  3L4P A;  1HZ5 A;  2J52 A;  4HRS A;  1XCQ L;  2HDE A;  3KLS X;  1VJK A;  1CJE A;  2G1E A;  3AEG B;  2RMM A;  3GP7 A;  3VR8 B;  2LMC A;  1XLP A;  1QQR A;  1ZPS A;  2GRI A;  4US8 A;  2WXN A;  2YEP F;  3ZYY X;  3NVW A;  4MM3 B;  1JQ4 A;  4EE2 A;  4HKZ E;  3ZQ4 A;  3ZJV A;  1KFY B;  1FIQ A;  1K53 A;  1D6E C;  3AE8 B;  1EM7 A;  3DWM A;  1DOY A;  4ITK A;  3SFD B;  3AE3 B;  3Q8B A;  3ZJT A;  3SR6 A;  4C80 A;  2JQR B;  2LHE A;  4OHJ A;  3R2T A;  1PUT A;  3U4E G;  2BS2 B;  1FXA A;  4RF0 A;  5HG2 A;  2N0S B;  2PTL A;  3P42 A;  4FXC A;  1IBX B;  1I4H A;  3AE9 B;  3R2I A;  1WYG A;  5HFY A;  1V1O A;  4L1B A;  1FNU A;  5EE0 A;  1FNW A;  3Q8A A;  1V1P A;  1E0Z A;  1XXG A;  1PGA A;  1JWB D;  1GOZ A;  3AMZ A;  1EU3 A;  4HKQ A;  1E9M A;  2KAC A;  2LHD A;  4MAC A;  2BBC A;  1BML C;  4RH6 A;  2DBY A;  1J7B A;  1TS2 A;  3AEA B;  3NS1 A;  1WXQ A;  1TZO A;  4YT0 B;  1QIL A;  1PFD A;  1D5X C;  3Q8C A;  2XN9 C;  1SB3 C;  2Z8L A;  2R61 A;  1AW7 A;  1JCK B;  2WXM A;  2V0G A;  3VRB B;  3AE6 B;  2LGI A;  3HVD A;  3O13 A;  3AE1 B;  1XO3 A;  1FO4 A;  1FCL A;  1AYF A;  1J7A A;  5EE9 A;  1Q10 A;  1ACC A;  4DQO C;  2KN4 A;  2J4X A;  4ZHO A;  1T3Q A;  1V97 A;  1QOB A;  3AEF B;  4YSY B;  1ESF A;  4DXG A;  2KAJ A;  2L83 A;  4YTN B;  1D4B A;  2GI9 A;  4YSX B;  4PT5 A;  2W54 A;  3W1S A;  1OQR A;  2PVG C;  3U52 E;  3C8Y A;  1OQQ A;  1XEE A;  4CQN A;  4RGM A;  1C76 A;  4B0M A;  2W55 A;  4WIP A;  1L5P A;  1KRH A;  2QMT A;  4NAW B;  2BB6 A;  3BII D;  4OZB A;  2L1A A;  4JE3 B;  5FKA C;  1MHX A;  4GDK B;  1CZP A;  4DXF A;  2LJI A;  1L0V B;  4TMA B;  1JRO A;  1QOG A;  1YNT E;  2NTT A;  2JWU A;  2E6X A;  3RPF C;  4TQ0 A;  4C7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...