1FCLA

Delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fclA00
1XCTL 3FILB 2LHDA 2ON8A 1GB4A 4IOIE 2JWUA 5BMIA 1IGCA 4KGTA 5HFYA 1JMLA 2N7JA 4D2KA 2K0PA 5HI1A 2N9KA 2JU6X 3MP9A 2PTLA 1FCCC 4KGSA 1MHHE 2I2YA 1MI0A 1XF5L 1F2RC 1P7FA 1HZ6A 4WH4A 2JSVX 1D4BA 2QSDA 1PGXA 1K52A 1FD6A 1IBXA 2PLPA 1FCLA 1P7EA 2PW9A 2KWDA 3FILA 1UWXA 4OZAA 4MACA 2LGIA 2QMTA 2IGDA 3V3XA 2ZW1A 1EM7A 2IGHA 5JXVA 1K50A 1MPEA 1IGDA 2J53A 5HHDG 2IGGA 1XCQL 1GB1A 2GB1A 1C9FA 5HG2A 1KH0A 1K53A 2ONQA 3GB1A 2OEDA 1F2RI 1YMHE 1PGBA 2KN4A 2LHEA 2JXTA 4IKGA 4HKZE 3UI3A 2GI9A 2RPVA 1K51A 1QKZA 1Q10A 2ZW0A 1ZXHA 4HJGE 2NMQA 1YNTE 2KDMA 2EELA 2N9LA 2J52A 1HZ5A 5BMHA 4OZCA 1PGAA 5BMGA 1MHXA 2KQ4X 2JZPA 1MVKA 2LUMA 1HEZE 4KGRA 2I38A 1IBXB 4GLSC 4OZBA 2RMMA 2KACA
chains in the Genus database with same CATH superfamily
3FILB 1I7HA 2WX0A 2INNE 1CJEA 1IGCA 4K1RB 2FCSA 4WWOA 3WA0A 4K3CA 3N30A 1TKEA 2MEKA 3GOEA 1C4AA 3L13A 1R4MI 1SE4A 2MQJA 5JH5C 1VDVA 2ZJDA 2QC8A 3A9KA 4GGQA 2NTSA 1YQ4B 2O6VA 2MSED 4ICUA 1RM6C 1T6BX 4N9F4 1JWSD 1TIFA 1UH6A 1V9JA 3RD2A 3W1SC 5JHAA 1C78A 2IY0B 4MGYE 3KWLA 3BYYB 4AUQC 3C0RB 1R7SA 3T3NA 2ICIA 4YXDB 1TYGB 2SEBD 1TS3A 2JT4B 3R2TA 1AWDA 4BOZB 1V97A 2ZNVC 3L16A 2KK8A 4NAWA 3RCZA 3V6CB 2L05A 2A5UA 3PZ7A 4K7WA 1K53A 4XE0A 3ECIA 4W9JA 1WXVA 1ZKHA 1F0ZA 1DOXA 5AZHA 4ZHOA 1YIWA 2IY1B 3ZXRA 2L3ZA 3J9CA 4ASWC 4W9HA 1OEYA 2QEJC 2CR5A 2KXJA 1TS4A 1MHXA 1I4GA 4M0WB 1UWMA 3M63B 4DHZE 3TCAA 2M56B 2N1WA 2MX2A 3I57A 4GN1A 2RDHA 2RMMA 1PYWD 3AULA 5BMIA 1L0XB 3WANA 3H1UA 3AECB 3B2FA 3EC8A 2V3PA 3PHWB 1WX8A 4RM8A 2JUOA 2DYMA 2V3NA 2WDTB 2I2YA 2HE7A 3SU8X 1BT0A 2MP2A 3SR6A 4RFBA 2IO3B 1RLFA 3RNAC 2LGXA 2E6XA 2ZCCA 5D7GA 1XEEA 3MC8A 2KYWA 5G5GA 2QDFA 3AEBB 2V1YA 1I4RA 2WU2B 3PZ8A 4FADA 2L0FA 4ICVA 4YTMB 5DPWA 1SJED 2MW5A 3E56A 4MGIE 3W1SA 3RZWC 4GDKB 2PIAA 3PS6A 2WXNA 3A9JA 1E8ZA 1KLGD 3MHZA 4M02A 4P7IA 3KUDB 4XGAB 3TIXA 4M00A 4W9IA 5BO4B 1V1PA 1Q0WB 3P1MA 2DAFA 4DHJD 4DXGA 4MJSA 1WE7A 1CK1A 3AEAB 5IAAC 2OOBB 3BYTB 2KJHB 2GI9A 2KANA 3ZLZA 4YSYB 4KKJA 2N7EA 3AU5A 3R66C 3NUHB 1P98A 3P4SB 3V05A 2LWPA 1H4RA 4EFOA 1V80A 3HM3A 3A33B 2KFKA 3O13A 2WXGA 2D07B 4AJYB 2JZ3B 2R61A 1SE9A 1JWAD 1B9RA 2CHXA 3ZDMC 2INCC 2KHWB 3RPFC 2K6QA 3PSEB 2KOXA 4ZRJA 1N6ZA 1OFFA 2KDEB 4NJ6A 3ZXVA 1ET9A 1DYQA 2JXXA 3VRBB 1WXQA 5AEKB 2G4SA 4FJZA 2Z0DB 4A90A 3PPAA 1T0RC 3O65B 2K1FA 3OWEB 1L5PA 1XF5L 1WY8A 4IWOA 1HTOA 4HVBA 2KQ7A 2V0GA 1LM8B 3ZKJC 3ZDTA 4J6IA 1TZOA 4LDTD 1E7PB 4HJKA 2XBBC 4IUMB 3X0WA 4GU2A 2K8HA 4HPMB 1WJUA 4BKSA 2O2VA 3Q3FA 3IT6B 1SIJA 5JXVA 4N6EB 1HA5A 1WGGA 3B08A 4CHKA 2N9PC 4WWNA 1C1YB 1Z5SB 2D3BA 2OEDA 4KDLB 2DWQA 4I6LB 3R8BA 3UI3A 2RR9A 1C79A 3A9KB 3BZDB 2O6VB 4TV3A 1RFKA 1TY0A 4IWQA 2KDIA 5BMGA 1GC6A 5AZGA 3VTVA 2GBMA 2WWZA 4IDIA 1WSPA 1EWCA 1I35A 2I38A 2BKFA 2BT6A 4JLCA 2OHFA 2MH7A 4IOIE 2KX3A 2LEKA 4FHKA 3APDA 1OTRB 2TSSA 1L2NA 1VZ7A 4E3CA 4NAWB 3NOBA 3DBRB 1PDXA 1ZDXA 2WXHA 4ANWA 2KAJA 4PS7A 4AQ7A 2LD9A 2BB6A 2WYQA 3VTWA 1E10A 1XXGA 4NNJB 1QLBB 2BGFA 5JZEB 4RCOA 3IVFA 5D94A 3BK2A 2K9XA 4G11A 3VH4B 1QZEA 2PMVA 3T8MA 1ROEA 3AE7B 4ZRQA 2YEPB 2LUEA 3SDLC 2M8SA 2IZVB 4WQOB 4BKGA 2KWUB 3U8ZA 5KHOA 1JW9D 4IM3A 2CJNA 1D5ZC 1FO4A 5EE1A 5J18A 1VRAB 1F2RI 4GOCA 2M1MA 2MJDA 3WCQA 4IC7B 2JXTA 3CSFA 4P1BC 2W3RA 4LK0M 2WX1A 3SFDB 2MP2B 1FXIA 1QT9A 2WXKA 1D6EC 3LXFA 2WXOA 3GZNI 1A70A 2J52A 3BY4B 4C4VA 4TQ0A 2WXLA 5FKAC 4WAFA 2D2QA 5EE9A 4ANXA 1WYWB 1WXSA 4MH0E 2QJLA 1TKGA 4PYZA 1NI2A 1L6UA 2BYVE 4R3DA 2GBKA 1UF0A 4OZBA 3H7PA 2DZJA 4EUTA 3SFEB 5L95C 1UUPA 1WZ3A 2M0XA 1N5WA 2NR2A 4FLHA 2L52A 1S3SG 3A9JB 3A4RA 1ISNA 3ABVB 1V1PB 1MHHE 3LB8C 2Y5CA 4II3B 4RGMA 2LI5A 2VH2A 4MJSB 1SEBD 2DYBA 3DVGX 3Q14C 2ZNVB 3KLSX 2JRIB 2W82A 3ZTDA 1ENFA 2RDBC 1WZ0A 1D5XC 3BVZA 2DENB 5TSSA 1LXDA 3QJZA 4P16A 4XDCA 3UQAA 2WS3B 1K8RB 4YTPB 3Q3OC 1KLVA 3AE6B 3D32A 1Q1OA 4HXDA 3V3XA 3DBLB 1K50A 1FFVA 4IM0A 2KFKB 2DLBA 5FR3A 2JYEA 2RD0A 1SE3A 3M95A 3AI5A 1WXAA 1LO5D 2Z59B 5HG2A 4BBNF 1WM2A 3UIOB 2EKEC 1Z2MA 4CO7A 4F7ZA 4RF1A 4NQLB 4WURA 2D10A 1Q5WB 5GMVA 1YN3A 1TTNA 1I4QA 2Y5PA 1V86A 3X23A 2RDGA 3V61A 1V6EA 1T5XD 1WGKA 1Q10A 4NJ7A 1ZXHA 2ZCBA 4L23A 5D3IB 3DDCB 2RPQA 3JYUA 2BVCA 1SXTA 1J19A 3Q8FA 3KQ4A 3I9V1 3TBLD 3MTNB 3IBEA 3LJ3A 2NPTA 4W9KA 4L1BA 3RNBC 2AWTA 2V3SA 2WXFA 2KC1A 2LRWA 1NBFC 2J0MA 2O2VB 5CHFA 4JL9A 2K25A 1EU4A 1V81A 1FRRA 4HDOA 1OEYJ 3BWUD 3HM6X 5I4DA 2BW2A 2L1AA 4BOSC 5HI1A 3DBHI 3KUZA 2G45B 4JWSC 3N9YC 2BQQA 5BYRA 1LQBA 2JVCA 3ZTCA 3DHGC 3TEXA 1FNUA 3KYCD 1JWMD 3L0WB 3WAMA 4B95A 1GOZA 3TEWA 1JQ4A 4BVUC 2MJ3A 2WXPA 1FCLA 3MJWA 4RGTA 4KZ0A 3ZIMA 5IO9A 3ZUNA 1TZ1A 1MG4A 1UWXA 2DHZA 3OG5A 3H6NA 3AEGB 2MBEA 2PJHA 4XC2A 1ZP0B 3SHQA 3CF6E 2GB1A 1L6VA 3BVMA 4US8A 1NVID 5D2MB 4OVZA 5E6OA 4GSWA 4F8CB 3PZDA 2YLMA 3P63A 3VUXA 3H9DA 3JW0X 5EDSA 5E6JA 1WGYA 2W54A 1QKZA 1GUAB 3UINB 4C7YA 4K7UA 3ETRA 4A3OA 4JE3B 2N9LA 2AL3A 3AE5B 4FHJA 1VD2A 1J7BA 3DWMA 1WJ6A 3ZW3A 2MBHA 3SD5A 4HWIB 3NVZA 3M3JA 4I6PA 2LHDA 3BK1A 1YQ3B 2LZ6A 2WHIA 1UBQA 2IO0B 3RNGC 2RSUA 1WYGA 2CHZA 3W5VB 2VRRB 4REZA 2BTEA 2XN9C 3UIPB 5GXGB 1HXYD 2WXRA 3QA8A 4KGSA 2INPE 2MBOA 4P6VF 4AP4C 3E9SA 1E0ZA 2L83A 2GOWA 3Q2AC 5AUIA 3N32A 1HZ6A 2JYTA 2BPSA 1P9DU 3PO0A 2K3UA 1E8WA 1ESFA 4C4VB 1WMHA 4PYUA 3AE3B 1ACCA 3AE9B 1E6EB 4KIKA 1WRIA 2HJ8A 2ACZB 3H7PB 3LDZE 2WXMA 1E8YA 4NZLB 2KDFB 3RMKC 4PT5A 3EFUA 1YN4A 4C7ZA 1C9FA 1GAQB 2LASA 1MFWA 2WDRB 4LCDE 4GXBA 2LVOA 1SGHA 1TT5B 5FR6A 1JCKB 4USAA 5D3DA 4TUUA 5DCNA 4W9FA 4GIVA 1YD8U 1FM0D 1WR6E 2IO1B 1EO6A 5LXHA 4MGKE 1WJNA 3IAM1 2V9HA 3KH0A 2RGFA 2KWVB 2JZPA 4G3XB 3VHTC 2HTHA 1TY2A 3ZRCA 1XLOA 3NS8A 4DXFA 2LXAA 2UU7A 2ZZPB 2KFJA 1IUEA 4ACFA 5C1ZA 1D5MC 1AARA 3K9OB 3ZNGC 4FBJB 3HRDD 4MSQB 1KJTA 1XO3A 2ZPNA 5C2TB 1MG8A 5EE3A 1HE8A 2G3QB 1WI0A 4FULA 3ZO5B 3Q8EA 1V5OA 1GPXA 1RYJA 2J4XA 1L4ZB 1IYFA 1V5TA 3NVYA 2X8XX 3I63C 2JPHA 1D4BA 4FA6A 3RFZB 3APCA 1XLPA 1PGXA 4EZLA 2NCNA 1P7EA 2PE9A 3AH7A 2NPTB 3AV8A 4EOYA 4EEWA 4RM9A 2BYTA 3TSSA 1EM7A 2IGHA 1EF1A 2HD5B 4LJPB 1LGRA 2KVRA 2IGGA 5L83A 2JRHA 3Q8CA 3ZRFA 3RNCC 4PK1A 1WE6A 3W5UB 3ZGZA 4FXCA 2G4DB 3QCAA 3OAWA 2BYEA 2AL6A 1JRUA 1FIQA 3IG3A 1UGMA 3U4EG 4MH8A 2ZVOA 2W55A 1XD3B 4OVVA 4IKGA 3W1YA 1YJJA 2M17A 2MJEA 4HCNB 1J8CA 4ZYNA 5H8YE 2JWZA 3U7DA 1GG3A 1PGAA 3N20C 4B6WA 3PGEA 3NHEB 3NVWA 1C3TA 5EE0A 3VTUA 1ZXIA 5E6NA 5DPTA 2J0JA 3R7QA 4AWJA 1E9MA 1B1ZA 2HDEA 4MELA 1XQQA 2WXQA 2MBQA 3L10B 4KGTA 1JMLA 1PQSA 1WH3A 4KZCA 3VDZA 3PLUA 4HPPA 2JU6X 2N4FA 2EMSA 1I4PA 2PTLA 1I42A 2AQ1B 3EHVA 1V49A 2NTTA 1OQYA 3BIID 4RGOS 2X38A 1MJDA 2C5LC 5TR5A 1JROA 3RULA 2Q5WD 2GBJA 1F52A 3AEFB 3M62B 2M19A 4HK2A 3ZVVA 3VH3B 1YN5A 2PVGC 2DZMA 2N7DA 1GJZA 1KLUD 2N1VA 4EZKA 2QMTA 3DPDA 2FAZA 2ZW1A 1T3QA 3U2SC 2VZKD 2V4IB 2HJ1A 3MJ5A 1QILA 2BYFA 3DVNV 2L00B 5HHDG 2AQ2B 4IG7B 1S1QB 5IA7A 1VR9A 1C4CA 2LRUA 1GC7A 4ARCA 1G6JA 1XT9B 1KH0A 1L4DB 3DVNU 2LFIA 2KZRA 5J17A 1BMLC 4JIOU 2LHEA 3PLVA 2WP9B 3LYYA 5H92C 2DAJA 5T8IA 4LTUA 1EUVB 4DQOC 1K51A 2C7NB 3VR9B 4HJGE 2L0TA 5D6JB 4FN2A 4DHJB 1WRDB 3URYA 1SB3C 1L0YB 1HZ5A 5BMHA 1FXTB 1TKYA 2L8JA 4WQMA 4OHJA 1NYRA 4M8NA 1F9JA 4TQ1A 3L08A 2WDVB 1WMHB 1RWSA 1T0SC 3NG0A 1P0RA 4TKNA 2FIFA 1I4XA 3P4PB 1U4AA 2ON8A 4KIKB 1WIAA 3RT3B 2LJIA 3UF8A 4M01A 5CTRC 2LGSA 2J42A 2W3SA 2REXA 2ZPYA 4ZHPA 1UBIA 2KD0A 2MLBA 1FCCC 3NS1A 1F77A 3N3KB 4ZRIA 2D3AA 4LNNA 1R4NB 2JZZA 1NI3A 3TUOA 1F2RC 3B9JA 4MGZE 3L17A 2QHOA 1TS2A 4WH4A 1JRPA 5LXIB 2KNBA 4HEA1 3CSTA 1X1MA 3IFWB 1IBXA 3HVDA 3GE3C 4OZAA 4DXAB 2K6DB 3L54A 1R4MB 4HPLB 3HHMA 2I1KA 1EWYC 2AQ3B 1VJKA 4HKQA 3DOWA 1QOBA 1RAXA 1E5WA 3DHHC 3R3MA 2GBRA 1N63A 2MA9B 3VUYA 4CQNA 2NVUI 3ZJUA 2LVQA 1PGBA 2L7RA 4C00A 2CJOA 1FNWA 5JHBA 2EKIA 3L4PA 2KN5A 3DBRI 2RPVA 4W9GA 3ML9A 4ZOHC 2NMQA 2EELA 3OJ4B 3PT2B 2LVPA 3TL5A 3AB5A 2KTRA 2XK5A 4LNIA 2CU1A 1M4VA 3C8YA 4GDLA 3B1LX 3PVLA 2LXCA 2ASQA 4A55A 1VZ6A 2Y5BB 4IW0A 2BS3B 1WR1A 4KDIC 5CHWA 2WDQB 4II2B 3A4SC 1NYQA 3HVZA 3A1QA 2INDC 1BXTA 3PHXB 2JX5A 2B3AA 2D11A 2B76B 2GRIA 2MWSB 3IHPC 1UELA 2E3TA 3AXCA 3QX1A 5C23A 3VFKA 3ENEA 3FKYA 4YT0B 2AYOB 4RF0A 1J0GA 2KO3A 1IPGA 3DCGA 3Q3JA 4X57B 4XWWA 1WWTA 4GB9A 4HLEA 1I4HA 1WX9A 3WALA 4C80A 2N0SB 3EGRA 3KW5B 1CMXB 1EF5A 1K52A 4KX6B 2GBNA 1UGJA 2K8CA 2N9XA 4MACA 4WIPA 5BYQA 3I5JC 4YTNB 5MPOA 1ZDVA 1IGDA 4BAXA 2J53A 2KMAA 1KM7A 4LJOB 3TEZA 2BWFA 4DWFA 1R4NI 4KSLC 2MCNB 1FPYA 1TS5A 2ZEQA 1SE2A 2BKRB 1CQVA 2W9NA 2H89B 3KYDD 3MC9A 4HKZE 3ZNZB 2WNMA 3QK0A 4M8MA 3V62A 5DPRA 2YVCA 4C56C 2KDMA 3V6EB 2JF5A 3UQBA 2KVZA 4URKA 1SBBB 2C9WB 4WJNA 1QF6A 3B0AA 3SEBA 3NJTA 3AU4A 1MVKA 1QOGA 4XX5A 2SAKA 2KACA 1GB4A 3ONSA 1H8CA 4LNOA 4DK5A 4W9DA 2C7HA 2V4LA 2NBVB 3BINA 4RH6A 5HFYA 3T3OA 2Z0EB 4DDID 3BVGA 4W9CA 1SIFA 4RMAA 1V8CA 4K7SA 3DBLI 1E8XA 2K22A 4NQKE 4MM3A 3JSVA 2A4ZA 4PS8A 1MI0A 4ZRPA 1RRBA 2K8BA 4E74A 4JPSA 4FJYA 1IP9A 1KFYB 4MEMA 2IO2B 2OJRA 3IXSA 5C3JB 3KWVA 3KUCB 1WGDA 2JSVX 4HRSA 3AM9A 4YSXB 3JVZX 4RNAA 3ZYYX 3AN1A 2KWDA 5CX3A 5LLIA 1YJ1A 2J0KA 4KSKC 3QWZB 1KRHA 2NBWB 3HUIA 3AE2B 4AS1A 4HCPB 2L32A 2KWCA 1XCQL 1GB1A 3ML8A 3GE8C 2CS4A 1NDDA 4DBGA 3PTFC 2O6VD 2ONQA 3GB1A 1OQQA 2PKOA 1YMHE 1ZPSA 2D3CA 1WF9A 1N60A 5G5HA 2FUG1 4EZJA 3PRPB 5J2RA 2MHJA 2BB5A 4IM2A 2CU3A 4EE2A 4XWTA 1YNTE 4AOFA 3VR8B 3AE4B 2KLCA 3IAS1 2LJ5A 1WGHA 1EU3A 3QQ8B 3W2DA 2LGDA 4J3OD 2BBCA 3I3TB 2LUMA 1FNVA 4YSZB 4KGRA 1IBXB 3QC8B 4WWPA 4W9EA 1N61A 4EKUA 2AX5A 2NBUA 2FBWB 3RNFC 3NRZA 1A5RA 2CHWA 4JX1C 5IP4D 2FIDA 1ZW7A 4XYCA 2VH1A 2WQYB 1RFAA 4KVGB 2FNJB 4WWMA 2GMIC 3Q3MC 4ANUA 1TBEA 1L0VB 3RNEC 2KJRA 4G0NB 4RGNA 1WM3A 4ANVA 3CWIA 3EUB2 2WXIA 2H88B 2KC2A 2KX0A 3R2IA 3PRZA 3P4QB 3PRMB 2AEHA 1DOIA 1J7CA 3NVVA 4US9A 3R7RA 3RN9C 1ZUD2 2KTRB 2QSDA 2XK5B 3VAWA 4GDLB 4B9KA 2PLPA 4HROA 2BS4B 2PW9A 1XLQA 2BF8B 5E6PA 2Z8LA 1ZGUB 3A1QB 4BFRA 1ZOYB 1N62A 2KLGA 4DHZB 5IOIA 2WGSA 3Q69A 2PVOD 1C4PA 4B0EA 4ITKA 3GP7A 3H8HA 3C19A 4IWPA 2KN4A 1AN8A 4ZYSA 3EECA 1FRDA 1WFYA 4WJOA 2LGYA 4E71A 1L7YA 1AYFA 1WGRA 1SF0A 3B2GA 1V1OA 3CMMB 4WJPA 2MRPA 2K5PA 4LLGM 3V60A 3PREA 1WX7A 2DX5B 3VUWA 5LNK1 4ZDVA 4CYEA 3Q6BA 2DZIA 4N58A 2K39A 2N7JA 3ZQ4A 3DVGY 4D2KA 2DYOA 2Y3AA 2N9KA 1JWBD 1C76A 3DWGC 2M4NA 4JGHB 1V2YA 3GZNB 2IPKD 5DPSA 1YOVB 4FJVB 3PV1A 2IDYA 3NZUA 4H2AA 2J7QB 1NENB 4TSSA 3AE8B 3QAQA 1E7UA 5IKCM 3AEDB 3APFA 3UGBB 2DNFA 2WLBA 4I6NB 1P1AA 5AZFA 1KF6B 2KKCA 2D5GA 1FD6A 2MBBB 1ET6A 2L76A 3FILA 4MT5A 2LGIA 2OJWA 3NZ3A 3TEYA 3IT4B 1FMAD 2NS5A 3P42A 2PE6B 4K81A 3ZJTA 4UDUC 4NJCA 4MDKE 2UWQA 1DOYA 3AMZA 1J7AA 1CZPA 3Q8AA 2PPHA 5IN7A 3KVFB 4MM3B 3JSVB 3RYTA 2R2OA 1ZE3D 4YWGG 5FK9C 1STEA 4LNKA 3OJ3A 2FCQA 2ZW0A 2EMTA 1C77A 1Y8RC 3DQVA 3ALBA 3EA6A 2UYZB 3FAHA 3HK0A 4NPNA 1GNUA 4WJQA 1D3ZA 4BKSD 4LNFA 2N9EB 1UZXB 1VCBA 2QILA 1WJ4A 3AEEB 3TJPA 1HEZE 4OW0A 4KKIA 1KTKA 3RI7C 1JALA 1E7VA 4BKTA 2K0PA 4F1SA 1UD7A 3VXWA 3H7SA 2R2QA 4L2YA 4NY0A 3MC0B 2FUHB 3DBSA 1N5XA 1OQRA 1WXMA 1YQBA 5G2NA 2KDBA 3W9CB 3ZNHB 2LMCA 5CHVC 3TMPB 4M0WA 2WU5B 1SJHD 4JQWC 5G55A 3U30A 1TJEA 2I1JA 1TGZB 3DBHB 2IYDB 3AE1B 1VZ8A 4K3BA 4A9AA 2C7MB 4NAMA 4S0RA 3ZJVA 1SSNA 3CIRB 3Q3NC 3P2BA 4A6QA 3K9PB 1YX5B 1XLNA 1HQRD 3U7ZA 3VQIA 1T0YA 2PEAA 5KHQA 1PFDA 2CKHB 4JWUC 4N59A 2DZKA 4G50A 5HKHA 3U52E 1LFDA 1QQRA 4W9LA 2KQSA 4LDTB 2BWES 5AUKA 1JWUD 2D3GA 2IJ0A 4OZCA 3QHTA 1E90A 1DGJA 2JQRB 2WXJA 3FC4A 2QIEB 4QAYA 3QIJA 1FFUA 1FEHA 4PS3A 4A20A 4GDKA 3N1YC 4A3PA 2G9HD 4KV2A 3WAPA 2IBIB 4GLSC 3RZFA 1XCTL 4WAAA 1M94A 1T0QC 1BUIC 2FCNA 2JWUA 4S17A 4BBNC 3S2AA 1YJIA 2KT7A 1QOAA 4O1NA 4XZ4A 4MSMB 3MFGA 3WIMA 1OGWA 4GMVA 2HTME 4BZAA 4ARIA 3N1XC 3MP9A 2QCZA 3ZNID 1P3QU 4TMAB 5BYSA 3T9LA 3RUIB 2KJ6A 3OLMD 1P7FA 3GS2A 3QARA 1PUTA 3N1ZC 3VRAB 2GLSA 3MHSD 3NZSA 2C60A 4XDDA 2KMMA 2BS2B 1NEKB 2IGDA 2FCMA 3Q8BA 2DBYA 1MPEA 1QOFA 4A8XC 3EFCA 2XEWA 2ZVNA 2JY6A 2VZKB 4DDGD 1KOTA 4Q2JA 2KTFA 3WAOA 3NY5A 2M0AA 3P4RB 1UNSA 4B0MA 1F1HA 1YX6B 4AJWA 2XNAC 3HIZA 4P1CC 1HTQA 2YEPF 2G1EA 2KMCA 2KQ4X 1AW7A 3DHIC 1VLBA 4YL8A 4ZRKA 4HDQA 2FE8A 1Y56A 1FXAA 3VVWB 4OVUA
chains in the Genus database with same CATH topology
3FILB 1I7HA 1N61A 2INNE 1E9MA 1CJEA 1B1ZA 2HDEA 3SFEB 2AX5A 2FBWB 2WXQA 1UUPA 1IGCA 3NRZA 4KGTA 1N5WA 1JMLA 4JX1C 2L52A 1TKEA 2MEKA 1C4AA 2JU6X 1I4PA 2WQYB 1SE4A 2PTLA 3ABVB 2AQ1B 4WWMA 1V1PB 1MHHE 3LB8C 1VDVA 2Y5CA 1L0VB 4RGMA 4RGNA 3CWIA 1SEBD 3EUB2 2NTSA 2NTTA 1YQ4B 2WXIA 3KLSX 2H88B 1RM6C 1T6BX 2W82A 1ENFA 3BIID 1JWSD 4RGOS 2X38A 1D5XC 1JROA 3R2IA 2Q5WD 3AEFB 3BVZA 5TSSA 1C78A 3P4QB 4P16A 4XDCA 1DOIA 1J7CA 3NVVA 4US9A 3KWLA 1ZUD2 2QSDA 3BYYB 2M19A 4GDLB 1R7SA 3T3NA 1YN5A 2ICIA 2PLPA 2WS3B 2PVGC 4HROA 2BS4B 4YXDB 4YTPB 2PW9A 1KLUD 1TYGB 1XLQA 3AE6B 2QMTA 2SEBD 2Z8LA 3V3XA 2ZW1A 1TS3A 1T3QA 1AWDA 1K50A 3R2TA 2VZKD 1FFVA 2V4IB 1V97A 3MJ5A 3U2SC 1QILA 2DLBA 5HHDG 1ZOYB 1N62A 2AQ2B 5FR3A 1VR9A 2JYEA 1SE3A 1C4CA 1LO5D 4ARCA 3PZ7A 3Q69A 5HG2A 2PVOD 1C4PA 1KH0A 4B0EA 1K53A 4ITKA 1L4DB 4XE0A 4RF1A 4WURA 3GP7A 2LFIA 3H8HA 1BMLC 1YN3A 2KN4A 1F0ZA 1DOXA 1AN8A 2LHEA 1I4QA 2WP9B 4ZHOA 2Y5PA 3LYYA 1FRDA 5H92C 4ZYSA 5T8IA 3J9CA 2RDGA 4LTUA 1T5XD 4DQOC 2QEJC 1AYFA 1K51A 1Q10A 1WGKA 1ZXHA 3VR9B 4HJGE 4L23A 1SF0A 5D3IB 3B2GA 1V1OA 1SXTA 3URYA 1SB3C 1TS4A 1L0YB 1HZ5A 3Q8FA 5BMHA 3KQ4A 3I9V1 1TKYA 1MHXA 4WQMA 4OHJA 1I4GA 1NYRA 4TQ1A 2K5PA 2WDVB 1UWMA 4LLGM 4L1BA 1RWSA 2M56B 2WXFA 3I57A 2RDHA 1I4XA 3P4PB 2RMMA 1PYWD 2ON8A 5LNK1 5BMIA 2LJIA 1L0XB 1EU4A 1FRRA 4N58A 2N7JA 3ZQ4A 3BWUD 3AECB 3B2FA 2V3PA 4D2KA 5I4DA 2BW2A 2L1AA 2DYOA 2Y3AA 2J42A 2W3SA 5HI1A 4ZHPA 2N9KA 1JWBD 1C76A 3DWGC 1FCCC 3NS1A 1F77A 2DYMA 4JWSC 2IPKD 3N9YC 2V3NA 5BYRA 3TEXA 2I2YA 3SR6A 2IDYA 4RFBA 4H2AA 1FNUA 1JWMD 2E6XA 1NI3A 3TUOA 1F2RC 3B9JA 1NENB 4TSSA 3AE8B 1GOZA 3TEWA 5D7GA 1XEEA 1TS2A 4WH4A 5G5GA 3AEDB 1JQ4A 1JRPA 3AEBB 2WLBA 1I4RA 2WU2B 4HEA1 3PZ8A 1KF6B 2MJ3A 2D5GA 2WXPA 4YTMB 1FD6A 1FCLA 1IBXA 4RGTA 3HVDA 1SJED 1ET6A 4MT5A 3FILA 1UWXA 3E56A 4OZAA 2LGIA 3W1SA 3AEGB 4GDKB 3NZ3A 1ZP0B 1EWYC 3TEYA 2PIAA 2AQ3B 3IT4B 1FMAD 1VJKA 4HKQA 3P42A 2WXNA 2GB1A 1QOBA 1KLGD 3ZJTA 3MHZA 4UDUC 1N63A 1L6VA 3BVMA 4NJCA 4US8A 1DOYA 1NVID 4CQNA 1V1PA 4OVZA 3AMZA 1J7AA 1CZPA 3P1MA 3ZJUA 3Q8AA 1PGBA 4DXGA 3P63A 2CJOA 4MM3B 1CK1A 1FNWA 3AEAB 2EKIA 3L4PA 3BYTB 1ZE3D 4YWGG 5E6JA 2GI9A 5FK9C 2RPVA 1STEA 4YSYB 2W54A 1QKZA 4KKJA 2ZW0A 4C7YA 4ZOHC 1C77A 2NMQA 3ETRA 3NUHB 2EELA 3EA6A 3FAHA 4JE3B 2N9LA 3AB5A 1M4VA 3C8YA 3P4SB 3AE5B 3V05A 4A55A 1VZ6A 2BS3B 2WDQB 1J7BA 2QILA 3AEEB 3DWMA 1HEZE 1NYQA 3HVZA 3O13A 3NVZA 2WXGA 2R61A 2LHDA 3BK1A 4OW0A 1JWAD 1B9RA 4KKIA 1YQ3B 3RPFC 1BXTA 1KTKA 2JX5A 2B76B 1JALA 2GRIA 1WYGA 3W5VB 1OFFA 2K0PA 4REZA 2BTEA 2XN9C 2E3TA 1ET9A 5GXGB 1DYQA 3VRBB 1WXQA 1HXYD 2WXRA 4KGSA 4YT0B 4A90A 2INPE 4L2YA 4P6VF 4RF0A 3MC0B 3E9SA 1E0ZA 3OWEB 1L5PA 2L83A 1N5XA 1OQRA 1XF5L 4XWWA 1WWTA 1I4HA 4C80A 5AUIA 2N0SB 1HZ6A 2JYTA 3EGRA 3W9CB 2V0GA 2LMCA 3PO0A 2K3UA 4M0WA 1ESFA 2WU5B 1TZOA 1K52A 1SJHD 4KX6B 1E7PB 3AE3B 1ACCA 3AE9B 1TJEA 1UGJA 4MACA 4WIPA 5BYQA 1E6EB 3AE1B 1WRIA 4YTNB 3IT6B 5MPOA 1ZDVA 1SIJA 5JXVA 1VZ8A 1IGDA 4A9AA 4NAMA 2J53A 3ZJVA 1SSNA 4N6EB 2ACZB 3CIRB 1HA5A 2WXMA 3TEZA 4A6QA 4NZLB 1XLNA 4PT5A 1HQRD 1YN4A 4C7ZA 1C9FA 3U7ZA 1GAQB 3VQIA 2OEDA 2WDRB 1PFDA 1TS5A 1SE2A 1CQVA 1JCKB 2DWQA 4USAA 5D3DA 4JWUC 2H89B 4N59A 3R8BA 4HKZE 3UI3A 2WNMA 1C79A 1FM0D 3BZDB 3U52E 4C56C 1QQRA 2KDMA 5AUKA 3IAM1 1JWUD 1SBBB 2IJ0A 1RFKA 1TY0A 4OZCA 5BMGA 1QF6A 1DGJA 2JQRB 2WXJA 3FC4A 3SEBA 2QIEB 2JZPA 1FFUA 1FEHA 1MVKA 4IDIA 1WSPA 1QOGA 1EWCA 2I38A 1TY2A 1XLOA 2G9HD 2SAKA 2BT6A 4DXFA 4GLSC 2KACA 1XCTL 2OHFA 2MH7A 1IUEA 1GB4A 4IOIE 2LEKA 1BUIC 1D5MC 2JWUA 1YJIA 2TSSA 1QOAA 4O1NA 1VZ7A 3HRDD 5HFYA 4RH6A 3MFGA 1XO3A 3T3OA 4NAWB 2HTME 1PDXA 1ZDXA 2WXHA 3BVGA 5C2TB 2KAJA 1V8CA 5EE3A 4AQ7A 4ARIA 3MP9A 2K22A 2BB6A 1E10A 1XXGA 1QLBB 1MI0A 4ZRPA 4RCOA 4TMAB 3BK2A 2K9XA 3Q8EA 4JPSA 5BYSA 2PMVA 1GPXA 1ROEA 1RYJA 3AE7B 4ZRQA 2J4XA 1L4ZB 2YEPB 1P7FA 1KFYB 3NVYA 3GS2A 3IXSA 5C3JB 3KWVA 1PUTA 2JSVX 3VRAB 1D4BA 4HRSA 3AM9A 3RFZB 4YSXB 1XLPA 1PGXA 4RNAA 3ZYYX 1P7EA 3AN1A 3AH7A 4XDDA 3AV8A 2KWDA 2KMMA 2BS2B 1NEKB 2BYTA 2IGDA 3Q8BA 1EM7A 3TSSA 1KRHA 2DBYA 3HUIA 2IGHA 3AE2B 1MPEA 1JW9D 4AS1A 2L32A 1QOFA 2IGGA 1XCQL 4A8XC 1GB1A 2CJNA 3Q8CA 3W5UB 3ZGZA 1D5ZC 4FXCA 1FO4A 5EE1A 2ONQA 3GB1A 1OQQA 1VRAB 1F2RI 2VZKB 2PKOA 4Q2JA 1YMHE 1FIQA 1ZPSA 3U4EG 4MH8A 2MJDA 1N60A 3WCQA 2M0AA 2JXTA 2W55A 3P4RB 5G5HA 2FUG1 1UNSA 4B0MA 4IKGA 2W3RA 4LK0M 1YJJA 2BB5A 3SFDB 1FXIA 1QT9A 2CU3A 2WXKA 4EE2A 2MJEA 1D6EC 3LXFA 1YNTE 4XWTA 3VR8B 2WXOA 3AE4B 2XNAC 3IAS1 5H8YE 1A70A 2J52A 4TQ0A 2WXLA 5FKAC 1PGAA 4WAFA 1EU3A 5EE9A 2YEPF 3W2DA 4J3OD 3NVWA 2G1EA 2KQ4X 1AW7A 5EE0A 2BBCA 1VLBA 2QJLA 1ZXIA 1TKGA 2LUMA 1FNVA 2FE8A 4YSZB 1L6UA 4KGRA 1Y56A 1IBXB 1FXAA 4R3DA 4OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCT L;  3FIL B;  2LHD A;  2ON8 A;  1GB4 A;  4IOI E;  2JWU A;  5BMI A;  1IGC A;  4KGT A;  5HFY A;  1JML A;  2N7J A;  4D2K A;  2K0P A;  5HI1 A;  2N9K A;  2JU6 X;  3MP9 A;  2PTL A;  1FCC C;  4KGS A;  1MHH E;  2I2Y A;  1MI0 A;  1XF5 L;  1F2R C;  1P7F A;  1HZ6 A;  4WH4 A;  2JSV X;  1D4B A;  2QSD A;  1PGX A;  1K52 A;  1FD6 A;  1IBX A;  2PLP A;  1FCL A;  1P7E A;  2PW9 A;  2KWD A;  3FIL A;  1UWX A;  4OZA A;  4MAC A;  2LGI A;  2QMT A;  2IGD A;  3V3X A;  2ZW1 A;  1EM7 A;  2IGH A;  5JXV A;  1K50 A;  1MPE A;  1IGD A;  2J53 A;  5HHD G;  2IGG A;  1XCQ L;  1GB1 A;  2GB1 A;  1C9F A;  5HG2 A;  1KH0 A;  1K53 A;  2ONQ A;  3GB1 A;  2OED A;  1F2R I;  1YMH E;  1PGB A;  2KN4 A;  2LHE A;  2JXT A;  4IKG A;  4HKZ E;  3UI3 A;  2GI9 A;  2RPV A;  1K51 A;  1QKZ A;  1Q10 A;  2ZW0 A;  1ZXH A;  4HJG E;  2NMQ A;  1YNT E;  2KDM A;  2EEL A;  2N9L A;  2J52 A;  1HZ5 A;  5BMH A;  4OZC A;  1PGA A;  5BMG A;  1MHX A;  2KQ4 X;  2JZP A;  1MVK A;  2LUM A;  1HEZ E;  4KGR A;  2I38 A;  1IBX B;  4GLS C;  4OZB A;  2RMM A;  2KAC A; 
#chains in the Genus database with same CATH topology
 3FIL B;  1I7H A;  2WX0 A;  2INN E;  1CJE A;  1IGC A;  4K1R B;  2FCS A;  4WWO A;  3WA0 A;  4K3C A;  3N30 A;  1TKE A;  2MEK A;  3GOE A;  1C4A A;  3L13 A;  1R4M I;  1SE4 A;  2MQJ A;  5JH5 C;  1VDV A;  2ZJD A;  2QC8 A;  3A9K A;  4GGQ A;  2NTS A;  1YQ4 B;  2O6V A;  2MSE D;  4ICU A;  1RM6 C;  1T6B X;  4N9F 4;  1JWS D;  1TIF A;  1UH6 A;  1V9J A;  3RD2 A;  3W1S C;  5JHA A;  1C78 A;  2IY0 B;  4MGY E;  3KWL A;  3BYY B;  4AUQ C;  3C0R B;  1R7S A;  3T3N A;  2ICI A;  4YXD B;  1TYG B;  2SEB D;  1TS3 A;  2JT4 B;  3R2T A;  1AWD A;  4BOZ B;  1V97 A;  2ZNV C;  3L16 A;  2KK8 A;  4NAW A;  3RCZ A;  3V6C B;  2L05 A;  2A5U A;  3PZ7 A;  4K7W A;  1K53 A;  4XE0 A;  3ECI A;  4W9J A;  1WXV A;  1ZKH A;  1F0Z A;  1DOX A;  5AZH A;  4ZHO A;  1YIW A;  2IY1 B;  3ZXR A;  2L3Z A;  3J9C A;  4ASW C;  4W9H A;  1OEY A;  2QEJ C;  2CR5 A;  2KXJ A;  1TS4 A;  1MHX A;  1I4G A;  4M0W B;  1UWM A;  3M63 B;  4DHZ E;  3TCA A;  2M56 B;  2N1W A;  2MX2 A;  3I57 A;  4GN1 A;  2RDH A;  2RMM A;  1PYW D;  3AUL A;  5BMI A;  1L0X B;  3WAN A;  3H1U A;  3AEC B;  3B2F A;  3EC8 A;  2V3P A;  3PHW B;  1WX8 A;  4RM8 A;  2JUO A;  2DYM A;  2V3N A;  2WDT B;  2I2Y A;  2HE7 A;  3SU8 X;  1BT0 A;  2MP2 A;  3SR6 A;  4RFB A;  2IO3 B;  1RLF A;  3RNA C;  2LGX A;  2E6X A;  2ZCC A;  5D7G A;  1XEE A;  3MC8 A;  2KYW A;  5G5G A;  2QDF A;  3AEB B;  2V1Y A;  1I4R A;  2WU2 B;  3PZ8 A;  4FAD A;  2L0F A;  4ICV A;  4YTM B;  5DPW A;  1SJE D;  2MW5 A;  3E56 A;  4MGI E;  3W1S A;  3RZW C;  4GDK B;  2PIA A;  3PS6 A;  2WXN A;  3A9J A;  1E8Z A;  1KLG D;  3MHZ A;  4M02 A;  4P7I A;  3KUD B;  4XGA B;  3TIX A;  4M00 A;  4W9I A;  5BO4 B;  1V1P A;  1Q0W B;  3P1M A;  2DAF A;  4DHJ D;  4DXG A;  4MJS A;  1WE7 A;  1CK1 A;  3AEA B;  5IAA C;  2OOB B;  3BYT B;  2KJH B;  2GI9 A;  2KAN A;  3ZLZ A;  4YSY B;  4KKJ A;  2N7E A;  3AU5 A;  3R66 C;  3NUH B;  1P98 A;  3P4S B;  3V05 A;  2LWP A;  1H4R A;  4EFO A;  1V80 A;  3HM3 A;  3A33 B;  2KFK A;  3O13 A;  2WXG A;  2D07 B;  4AJY B;  2JZ3 B;  2R61 A;  1SE9 A;  1JWA D;  1B9R A;  2CHX A;  3ZDM C;  2INC C;  2KHW B;  3RPF C;  2K6Q A;  3PSE B;  2KOX A;  4ZRJ A;  1N6Z A;  1OFF A;  2KDE B;  4NJ6 A;  3ZXV A;  1ET9 A;  1DYQ A;  2JXX A;  3VRB B;  1WXQ A;  5AEK B;  2G4S A;  4FJZ A;  2Z0D B;  4A90 A;  3PPA A;  1T0R C;  3O65 B;  2K1F A;  3OWE B;  1L5P A;  1XF5 L;  1WY8 A;  4IWO A;  1HTO A;  4HVB A;  2KQ7 A;  2V0G A;  1LM8 B;  3ZKJ C;  3ZDT A;  4J6I A;  1TZO A;  4LDT D;  1E7P B;  4HJK A;  2XBB C;  4IUM B;  3X0W A;  4GU2 A;  2K8H A;  4HPM B;  1WJU A;  4BKS A;  2O2V A;  3Q3F A;  3IT6 B;  1SIJ A;  5JXV A;  4N6E B;  1HA5 A;  1WGG A;  3B08 A;  4CHK A;  2N9P C;  4WWN A;  1C1Y B;  1Z5S B;  2D3B A;  2OED A;  4KDL B;  2DWQ A;  4I6L B;  3R8B A;  3UI3 A;  2RR9 A;  1C79 A;  3A9K B;  3BZD B;  2O6V B;  4TV3 A;  1RFK A;  1TY0 A;  4IWQ A;  2KDI A;  5BMG A;  1GC6 A;  5AZG A;  3VTV A;  2GBM A;  2WWZ A;  4IDI A;  1WSP A;  1EWC A;  1I35 A;  2I38 A;  2BKF A;  2BT6 A;  4JLC A;  2OHF A;  2MH7 A;  4IOI E;  2KX3 A;  2LEK A;  4FHK A;  3APD A;  1OTR B;  2TSS A;  1L2N A;  1VZ7 A;  4E3C A;  4NAW B;  3NOB A;  3DBR B;  1PDX A;  1ZDX A;  2WXH A;  4ANW A;  2KAJ A;  4PS7 A;  4AQ7 A;  2LD9 A;  2BB6 A;  2WYQ A;  3VTW A;  1E10 A;  1XXG A;  4NNJ B;  1QLB B;  2BGF A;  5JZE B;  4RCO A;  3IVF A;  5D94 A;  3BK2 A;  2K9X A;  4G11 A;  3VH4 B;  1QZE A;  2PMV A;  3T8M A;  1ROE A;  3AE7 B;  4ZRQ A;  2YEP B;  2LUE A;  3SDL C;  2M8S A;  2IZV B;  4WQO B;  4BKG A;  2KWU B;  3U8Z A;  5KHO A;  1JW9 D;  4IM3 A;  2CJN A;  1D5Z C;  1FO4 A;  5EE1 A;  5J18 A;  1VRA B;  1F2R I;  4GOC A;  2M1M A;  2MJD A;  3WCQ A;  4IC7 B;  2JXT A;  3CSF A;  4P1B C;  2W3R A;  4LK0 M;  2WX1 A;  3SFD B;  2MP2 B;  1FXI A;  1QT9 A;  2WXK A;  1D6E C;  3LXF A;  2WXO A;  3GZN I;  1A70 A;  2J52 A;  3BY4 B;  4C4V A;  4TQ0 A;  2WXL A;  5FKA C;  4WAF A;  2D2Q A;  5EE9 A;  4ANX A;  1WYW B;  1WXS A;  4MH0 E;  2QJL A;  1TKG A;  4PYZ A;  1NI2 A;  1L6U A;  2BYV E;  4R3D A;  2GBK A;  1UF0 A;  4OZB A;  3H7P A;  2DZJ A;  4EUT A;  3SFE B;  5L95 C;  1UUP A;  1WZ3 A;  2M0X A;  1N5W A;  2NR2 A;  4FLH A;  2L52 A;  1S3S G;  3A9J B;  3A4R A;  1ISN A;  3ABV B;  1V1P B;  1MHH E;  3LB8 C;  2Y5C A;  4II3 B;  4RGM A;  2LI5 A;  2VH2 A;  4MJS B;  1SEB D;  2DYB A;  3DVG X;  3Q14 C;  2ZNV B;  3KLS X;  2JRI B;  2W82 A;  3ZTD A;  1ENF A;  2RDB C;  1WZ0 A;  1D5X C;  3BVZ A;  2DEN B;  5TSS A;  1LXD A;  3QJZ A;  4P16 A;  4XDC A;  3UQA A;  2WS3 B;  1K8R B;  4YTP B;  3Q3O C;  1KLV A;  3AE6 B;  3D32 A;  1Q1O A;  4HXD A;  3V3X A;  3DBL B;  1K50 A;  1FFV A;  4IM0 A;  2KFK B;  2DLB A;  5FR3 A;  2JYE A;  2RD0 A;  1SE3 A;  3M95 A;  3AI5 A;  1WXA A;  1LO5 D;  2Z59 B;  5HG2 A;  4BBN F;  1WM2 A;  3UIO B;  2EKE C;  1Z2M A;  4CO7 A;  4F7Z A;  4RF1 A;  4NQL B;  4WUR A;  2D10 A;  1Q5W B;  5GMV A;  1YN3 A;  1TTN A;  1I4Q A;  2Y5P A;  1V86 A;  3X23 A;  2RDG A;  3V61 A;  1V6E A;  1T5X D;  1WGK A;  1Q10 A;  4NJ7 A;  1ZXH A;  2ZCB A;  4L23 A;  5D3I B;  3DDC B;  2RPQ A;  3JYU A;  2BVC A;  1SXT A;  1J19 A;  3Q8F A;  3KQ4 A;  3I9V 1;  3TBL D;  3MTN B;  3IBE A;  3LJ3 A;  2NPT A;  4W9K A;  4L1B A;  3RNB C;  2AWT A;  2V3S A;  2WXF A;  2KC1 A;  2LRW A;  1NBF C;  2J0M A;  2O2V B;  5CHF A;  4JL9 A;  2K25 A;  1EU4 A;  1V81 A;  1FRR A;  4HDO A;  1OEY J;  3BWU D;  3HM6 X;  5I4D A;  2BW2 A;  2L1A A;  4BOS C;  5HI1 A;  3DBH I;  3KUZ A;  2G45 B;  4JWS C;  3N9Y C;  2BQQ A;  5BYR A;  1LQB A;  2JVC A;  3ZTC A;  3DHG C;  3TEX A;  1FNU A;  3KYC D;  1JWM D;  3L0W B;  3WAM A;  4B95 A;  1GOZ A;  3TEW A;  1JQ4 A;  4BVU C;  2MJ3 A;  2WXP A;  1FCL A;  3MJW A;  4RGT A;  4KZ0 A;  3ZIM A;  5IO9 A;  3ZUN A;  1TZ1 A;  1MG4 A;  1UWX A;  2DHZ A;  3OG5 A;  3H6N A;  3AEG B;  2MBE A;  2PJH A;  4XC2 A;  1ZP0 B;  3SHQ A;  3CF6 E;  2GB1 A;  1L6V A;  3BVM A;  4US8 A;  1NVI D;  5D2M B;  4OVZ A;  5E6O A;  4GSW A;  4F8C B;  3PZD A;  2YLM A;  3P63 A;  3VUX A;  3H9D A;  3JW0 X;  5EDS A;  5E6J A;  1WGY A;  2W54 A;  1QKZ A;  1GUA B;  3UIN B;  4C7Y A;  4K7U A;  3ETR A;  4A3O A;  4JE3 B;  2N9L A;  2AL3 A;  3AE5 B;  4FHJ A;  1VD2 A;  1J7B A;  3DWM A;  1WJ6 A;  3ZW3 A;  2MBH A;  3SD5 A;  4HWI B;  3NVZ A;  3M3J A;  4I6P A;  2LHD A;  3BK1 A;  1YQ3 B;  2LZ6 A;  2WHI A;  1UBQ A;  2IO0 B;  3RNG C;  2RSU A;  1WYG A;  2CHZ A;  3W5V B;  2VRR B;  4REZ A;  2BTE A;  2XN9 C;  3UIP B;  5GXG B;  1HXY D;  2WXR A;  3QA8 A;  4KGS A;  2INP E;  2MBO A;  4P6V F;  4AP4 C;  3E9S A;  1E0Z A;  2L83 A;  2GOW A;  3Q2A C;  5AUI A;  3N32 A;  1HZ6 A;  2JYT A;  2BPS A;  1P9D U;  3PO0 A;  2K3U A;  1E8W A;  1ESF A;  4C4V B;  1WMH A;  4PYU A;  3AE3 B;  1ACC A;  3AE9 B;  1E6E B;  4KIK A;  1WRI A;  2HJ8 A;  2ACZ B;  3H7P B;  3LDZ E;  2WXM A;  1E8Y A;  4NZL B;  2KDF B;  3RMK C;  4PT5 A;  3EFU A;  1YN4 A;  4C7Z A;  1C9F A;  1GAQ B;  2LAS A;  1MFW A;  2WDR B;  4LCD E;  4GXB A;  2LVO A;  1SGH A;  1TT5 B;  5FR6 A;  1JCK B;  4USA A;  5D3D A;  4TUU A;  5DCN A;  4W9F A;  4GIV A;  1YD8 U;  1FM0 D;  1WR6 E;  2IO1 B;  1EO6 A;  5LXH A;  4MGK E;  1WJN A;  3IAM 1;  2V9H A;  3KH0 A;  2RGF A;  2KWV B;  2JZP A;  4G3X B;  3VHT C;  2HTH A;  1TY2 A;  3ZRC A;  1XLO A;  3NS8 A;  4DXF A;  2LXA A;  2UU7 A;  2ZZP B;  2KFJ A;  1IUE A;  4ACF A;  5C1Z A;  1D5M C;  1AAR A;  3K9O B;  3ZNG C;  4FBJ B;  3HRD D;  4MSQ B;  1KJT A;  1XO3 A;  2ZPN A;  5C2T B;  1MG8 A;  5EE3 A;  1HE8 A;  2G3Q B;  1WI0 A;  4FUL A;  3ZO5 B;  3Q8E A;  1V5O A;  1GPX A;  1RYJ A;  2J4X A;  1L4Z B;  1IYF A;  1V5T A;  3NVY A;  2X8X X;  3I63 C;  2JPH A;  1D4B A;  4FA6 A;  3RFZ B;  3APC A;  1XLP A;  1PGX A;  4EZL A;  2NCN A;  1P7E A;  2PE9 A;  3AH7 A;  2NPT B;  3AV8 A;  4EOY A;  4EEW A;  4RM9 A;  2BYT A;  3TSS A;  1EM7 A;  2IGH A;  1EF1 A;  2HD5 B;  4LJP B;  1LGR A;  2KVR A;  2IGG A;  5L83 A;  2JRH A;  3Q8C A;  3ZRF A;  3RNC C;  4PK1 A;  1WE6 A;  3W5U B;  3ZGZ A;  4FXC A;  2G4D B;  3QCA A;  3OAW A;  2BYE A;  2AL6 A;  1JRU A;  1FIQ A;  3IG3 A;  1UGM A;  3U4E G;  4MH8 A;  2ZVO A;  2W55 A;  1XD3 B;  4OVV A;  4IKG A;  3W1Y A;  1YJJ A;  2M17 A;  2MJE A;  4HCN B;  1J8C A;  4ZYN A;  5H8Y E;  2JWZ A;  3U7D A;  1GG3 A;  1PGA A;  3N20 C;  4B6W A;  3PGE A;  3NHE B;  3NVW A;  1C3T A;  5EE0 A;  3VTU A;  1ZXI A;  5E6N A;  5DPT A;  2J0J A;  3R7Q A;  4AWJ A;  1E9M A;  1B1Z A;  2HDE A;  4MEL A;  1XQQ A;  2WXQ A;  2MBQ A;  3L10 B;  4KGT A;  1JML A;  1PQS A;  1WH3 A;  4KZC A;  3VDZ A;  3PLU A;  4HPP A;  2JU6 X;  2N4F A;  2EMS A;  1I4P A;  2PTL A;  1I42 A;  2AQ1 B;  3EHV A;  1V49 A;  2NTT A;  1OQY A;  3BII D;  4RGO S;  2X38 A;  1MJD A;  2C5L C;  5TR5 A;  1JRO A;  3RUL A;  2Q5W D;  2GBJ A;  1F52 A;  3AEF B;  3M62 B;  2M19 A;  4HK2 A;  3ZVV A;  3VH3 B;  1YN5 A;  2PVG C;  2DZM A;  2N7D A;  1GJZ A;  1KLU D;  2N1V A;  4EZK A;  2QMT A;  3DPD A;  2FAZ A;  2ZW1 A;  1T3Q A;  3U2S C;  2VZK D;  2V4I B;  2HJ1 A;  3MJ5 A;  1QIL A;  2BYF A;  3DVN V;  2L00 B;  5HHD G;  2AQ2 B;  4IG7 B;  1S1Q B;  5IA7 A;  1VR9 A;  1C4C A;  2LRU A;  1GC7 A;  4ARC A;  1G6J A;  1XT9 B;  1KH0 A;  1L4D B;  3DVN U;  2LFI A;  2KZR A;  5J17 A;  1BML C;  4JIO U;  2LHE A;  3PLV A;  2WP9 B;  3LYY A;  5H92 C;  2DAJ A;  5T8I A;  4LTU A;  1EUV B;  4DQO C;  1K51 A;  2C7N B;  3VR9 B;  4HJG E;  2L0T A;  5D6J B;  4FN2 A;  4DHJ B;  1WRD B;  3URY A;  1SB3 C;  1L0Y B;  1HZ5 A;  5BMH A;  1FXT B;  1TKY A;  2L8J A;  4WQM A;  4OHJ A;  1NYR A;  4M8N A;  1F9J A;  4TQ1 A;  3L08 A;  2WDV B;  1WMH B;  1RWS A;  1T0S C;  3NG0 A;  1P0R A;  4TKN A;  2FIF A;  1I4X A;  3P4P B;  1U4A A;  2ON8 A;  4KIK B;  1WIA A;  3RT3 B;  2LJI A;  3UF8 A;  4M01 A;  5CTR C;  2LGS A;  2J42 A;  2W3S A;  2REX A;  2ZPY A;  4ZHP A;  1UBI A;  2KD0 A;  2MLB A;  1FCC C;  3NS1 A;  1F77 A;  3N3K B;  4ZRI A;  2D3A A;  4LNN A;  1R4N B;  2JZZ A;  1NI3 A;  3TUO A;  1F2R C;  3B9J A;  4MGZ E;  3L17 A;  2QHO A;  1TS2 A;  4WH4 A;  1JRP A;  5LXI B;  2KNB A;  4HEA 1;  3CST A;  1X1M A;  3IFW B;  1IBX A;  3HVD A;  3GE3 C;  4OZA A;  4DXA B;  2K6D B;  3L54 A;  1R4M B;  4HPL B;  3HHM A;  2I1K A;  1EWY C;  2AQ3 B;  1VJK A;  4HKQ A;  3DOW A;  1QOB A;  1RAX A;  1E5W A;  3DHH C;  3R3M A;  2GBR A;  1N63 A;  2MA9 B;  3VUY A;  4CQN A;  2NVU I;  3ZJU A;  2LVQ A;  1PGB A;  2L7R A;  4C00 A;  2CJO A;  1FNW A;  5JHB A;  2EKI A;  3L4P A;  2KN5 A;  3DBR I;  2RPV A;  4W9G A;  3ML9 A;  4ZOH C;  2NMQ A;  2EEL A;  3OJ4 B;  3PT2 B;  2LVP A;  3TL5 A;  3AB5 A;  2KTR A;  2XK5 A;  4LNI A;  2CU1 A;  1M4V A;  3C8Y A;  4GDL A;  3B1L X;  3PVL A;  2LXC A;  2ASQ A;  4A55 A;  1VZ6 A;  2Y5B B;  4IW0 A;  2BS3 B;  1WR1 A;  4KDI C;  5CHW A;  2WDQ B;  4II2 B;  3A4S C;  1NYQ A;  3HVZ A;  3A1Q A;  2IND C;  1BXT A;  3PHX B;  2JX5 A;  2B3A A;  2D11 A;  2B76 B;  2GRI A;  2MWS B;  3IHP C;  1UEL A;  2E3T A;  3AXC A;  3QX1 A;  5C23 A;  3VFK A;  3ENE A;  3FKY A;  4YT0 B;  2AYO B;  4RF0 A;  1J0G A;  2KO3 A;  1IPG A;  3DCG A;  3Q3J A;  4X57 B;  4XWW A;  1WWT A;  4GB9 A;  4HLE A;  1I4H A;  1WX9 A;  3WAL A;  4C80 A;  2N0S B;  3EGR A;  3KW5 B;  1CMX B;  1EF5 A;  1K52 A;  4KX6 B;  2GBN A;  1UGJ A;  2K8C A;  2N9X A;  4MAC A;  4WIP A;  5BYQ A;  3I5J C;  4YTN B;  5MPO A;  1ZDV A;  1IGD A;  4BAX A;  2J53 A;  2KMA A;  1KM7 A;  4LJO B;  3TEZ A;  2BWF A;  4DWF A;  1R4N I;  4KSL C;  2MCN B;  1FPY A;  1TS5 A;  2ZEQ A;  1SE2 A;  2BKR B;  1CQV A;  2W9N A;  2H89 B;  3KYD D;  3MC9 A;  4HKZ E;  3ZNZ B;  2WNM A;  3QK0 A;  4M8M A;  3V62 A;  5DPR A;  2YVC A;  4C56 C;  2KDM A;  3V6E B;  2JF5 A;  3UQB A;  2KVZ A;  4URK A;  1SBB B;  2C9W B;  4WJN A;  1QF6 A;  3B0A A;  3SEB A;  3NJT A;  3AU4 A;  1MVK A;  1QOG A;  4XX5 A;  2SAK A;  2KAC A;  1GB4 A;  3ONS A;  1H8C A;  4LNO A;  4DK5 A;  4W9D A;  2C7H A;  2V4L A;  2NBV B;  3BIN A;  4RH6 A;  5HFY A;  3T3O A;  2Z0E B;  4DDI D;  3BVG A;  4W9C A;  1SIF A;  4RMA A;  1V8C A;  4K7S A;  3DBL I;  1E8X A;  2K22 A;  4NQK E;  4MM3 A;  3JSV A;  2A4Z A;  4PS8 A;  1MI0 A;  4ZRP A;  1RRB A;  2K8B A;  4E74 A;  4JPS A;  4FJY A;  1IP9 A;  1KFY B;  4MEM A;  2IO2 B;  2OJR A;  3IXS A;  5C3J B;  3KWV A;  3KUC B;  1WGD A;  2JSV X;  4HRS A;  3AM9 A;  4YSX B;  3JVZ X;  4RNA A;  3ZYY X;  3AN1 A;  2KWD A;  5CX3 A;  5LLI A;  1YJ1 A;  2J0K A;  4KSK C;  3QWZ B;  1KRH A;  2NBW B;  3HUI A;  3AE2 B;  4AS1 A;  4HCP B;  2L32 A;  2KWC A;  1XCQ L;  1GB1 A;  3ML8 A;  3GE8 C;  2CS4 A;  1NDD A;  4DBG A;  3PTF C;  2O6V D;  2ONQ A;  3GB1 A;  1OQQ A;  2PKO A;  1YMH E;  1ZPS A;  2D3C A;  1WF9 A;  1N60 A;  5G5H A;  2FUG 1;  4EZJ A;  3PRP B;  5J2R A;  2MHJ A;  2BB5 A;  4IM2 A;  2CU3 A;  4EE2 A;  4XWT A;  1YNT E;  4AOF A;  3VR8 B;  3AE4 B;  2KLC A;  3IAS 1;  2LJ5 A;  1WGH A;  1EU3 A;  3QQ8 B;  3W2D A;  2LGD A;  4J3O D;  2BBC A;  3I3T B;  2LUM A;  1FNV A;  4YSZ B;  4KGR A;  1IBX B;  3QC8 B;  4WWP A;  4W9E A;  1N61 A;  4EKU A;  2AX5 A;  2NBU A;  2FBW B;  3RNF C;  3NRZ A;  1A5R A;  2CHW A;  4JX1 C;  5IP4 D;  2FID A;  1ZW7 A;  4XYC A;  2VH1 A;  2WQY B;  1RFA A;  4KVG B;  2FNJ B;  4WWM A;  2GMI C;  3Q3M C;  4ANU A;  1TBE A;  1L0V B;  3RNE C;  2KJR A;  4G0N B;  4RGN A;  1WM3 A;  4ANV A;  3CWI A;  3EUB 2;  2WXI A;  2H88 B;  2KC2 A;  2KX0 A;  3R2I A;  3PRZ A;  3P4Q B;  3PRM B;  2AEH A;  1DOI A;  1J7C A;  3NVV A;  4US9 A;  3R7R A;  3RN9 C;  1ZUD 2;  2KTR B;  2QSD A;  2XK5 B;  3VAW A;  4GDL B;  4B9K A;  2PLP A;  4HRO A;  2BS4 B;  2PW9 A;  1XLQ A;  2BF8 B;  5E6P A;  2Z8L A;  1ZGU B;  3A1Q B;  4BFR A;  1ZOY B;  1N62 A;  2KLG A;  4DHZ B;  5IOI A;  2WGS A;  3Q69 A;  2PVO D;  1C4P A;  4B0E A;  4ITK A;  3GP7 A;  3H8H A;  3C19 A;  4IWP A;  2KN4 A;  1AN8 A;  4ZYS A;  3EEC A;  1FRD A;  1WFY A;  4WJO A;  2LGY A;  4E71 A;  1L7Y A;  1AYF A;  1WGR A;  1SF0 A;  3B2G A;  1V1O A;  3CMM B;  4WJP A;  2MRP A;  2K5P A;  4LLG M;  3V60 A;  3PRE A;  1WX7 A;  2DX5 B;  3VUW A;  5LNK 1;  4ZDV A;  4CYE A;  3Q6B A;  2DZI A;  4N58 A;  2K39 A;  2N7J A;  3ZQ4 A;  3DVG Y;  4D2K A;  2DYO A;  2Y3A A;  2N9K A;  1JWB D;  1C76 A;  3DWG C;  2M4N A;  4JGH B;  1V2Y A;  3GZN B;  2IPK D;  5DPS A;  1YOV B;  4FJV B;  3PV1 A;  2IDY A;  3NZU A;  4H2A A;  2J7Q B;  1NEN B;  4TSS A;  3AE8 B;  3QAQ A;  1E7U A;  5IKC M;  3AED B;  3APF A;  3UGB B;  2DNF A;  2WLB A;  4I6N B;  1P1A A;  5AZF A;  1KF6 B;  2KKC A;  2D5G A;  1FD6 A;  2MBB B;  1ET6 A;  2L76 A;  3FIL A;  4MT5 A;  2LGI A;  2OJW A;  3NZ3 A;  3TEY A;  3IT4 B;  1FMA D;  2NS5 A;  3P42 A;  2PE6 B;  4K81 A;  3ZJT A;  4UDU C;  4NJC A;  4MDK E;  2UWQ A;  1DOY A;  3AMZ A;  1J7A A;  1CZP A;  3Q8A A;  2PPH A;  5IN7 A;  3KVF B;  4MM3 B;  3JSV B;  3RYT A;  2R2O A;  1ZE3 D;  4YWG G;  5FK9 C;  1STE A;  4LNK A;  3OJ3 A;  2FCQ A;  2ZW0 A;  2EMT A;  1C77 A;  1Y8R C;  3DQV A;  3ALB A;  3EA6 A;  2UYZ B;  3FAH A;  3HK0 A;  4NPN A;  1GNU A;  4WJQ A;  1D3Z A;  4BKS D;  4LNF A;  2N9E B;  1UZX B;  1VCB A;  2QIL A;  1WJ4 A;  3AEE B;  3TJP A;  1HEZ E;  4OW0 A;  4KKI A;  1KTK A;  3RI7 C;  1JAL A;  1E7V A;  4BKT A;  2K0P A;  4F1S A;  1UD7 A;  3VXW A;  3H7S A;  2R2Q A;  4L2Y A;  4NY0 A;  3MC0 B;  2FUH B;  3DBS A;  1N5X A;  1OQR A;  1WXM A;  1YQB A;  5G2N A;  2KDB A;  3W9C B;  3ZNH B;  2LMC A;  5CHV C;  3TMP B;  4M0W A;  2WU5 B;  1SJH D;  4JQW C;  5G55 A;  3U30 A;  1TJE A;  2I1J A;  1TGZ B;  3DBH B;  2IYD B;  3AE1 B;  1VZ8 A;  4K3B A;  4A9A A;  2C7M B;  4NAM A;  4S0R A;  3ZJV A;  1SSN A;  3CIR B;  3Q3N C;  3P2B A;  4A6Q A;  3K9P B;  1YX5 B;  1XLN A;  1HQR D;  3U7Z A;  3VQI A;  1T0Y A;  2PEA A;  5KHQ A;  1PFD A;  2CKH B;  4JWU C;  4N59 A;  2DZK A;  4G50 A;  5HKH A;  3U52 E;  1LFD A;  1QQR A;  4W9L A;  2KQS A;  4LDT B;  2BWE S;  5AUK A;  1JWU D;  2D3G A;  2IJ0 A;  4OZC A;  3QHT A;  1E90 A;  1DGJ A;  2JQR B;  2WXJ A;  3FC4 A;  2QIE B;  4QAY A;  3QIJ A;  1FFU A;  1FEH A;  4PS3 A;  4A20 A;  4GDK A;  3N1Y C;  4A3P A;  2G9H D;  4KV2 A;  3WAP A;  2IBI B;  4GLS C;  3RZF A;  1XCT L;  4WAA A;  1M94 A;  1T0Q C;  1BUI C;  2FCN A;  2JWU A;  4S17 A;  4BBN C;  3S2A A;  1YJI A;  2KT7 A;  1QOA A;  4O1N A;  4XZ4 A;  4MSM B;  3MFG A;  3WIM A;  1OGW A;  4GMV A;  2HTM E;  4BZA A;  4ARI A;  3N1X C;  3MP9 A;  2QCZ A;  3ZNI D;  1P3Q U;  4TMA B;  5BYS A;  3T9L A;  3RUI B;  2KJ6 A;  3OLM D;  1P7F A;  3GS2 A;  3QAR A;  1PUT A;  3N1Z C;  3VRA B;  2GLS A;  3MHS D;  3NZS A;  2C60 A;  4XDD A;  2KMM A;  2BS2 B;  1NEK B;  2IGD A;  2FCM A;  3Q8B A;  2DBY A;  1MPE A;  1QOF A;  4A8X C;  3EFC A;  2XEW A;  2ZVN A;  2JY6 A;  2VZK B;  4DDG D;  1KOT A;  4Q2J A;  2KTF A;  3WAO A;  3NY5 A;  2M0A A;  3P4R B;  1UNS A;  4B0M A;  1F1H A;  1YX6 B;  4AJW A;  2XNA C;  3HIZ A;  4P1C C;  1HTQ A;  2YEP F;  2G1E A;  2KMC A;  2KQ4 X;  1AW7 A;  3DHI C;  1VLB A;  4YL8 A;  4ZRK A;  4HDQ A;  2FE8 A;  1Y56 A;  1FXA A;  3VVW B;  4OVU A; 
#chains in the Genus database with same CATH homology
 3FIL B;  1I7H A;  1N61 A;  2INN E;  1E9M A;  1CJE A;  1B1Z A;  2HDE A;  3SFE B;  2AX5 A;  2FBW B;  2WXQ A;  1UUP A;  1IGC A;  3NRZ A;  4KGT A;  1N5W A;  1JML A;  4JX1 C;  2L52 A;  1TKE A;  2MEK A;  1C4A A;  2JU6 X;  1I4P A;  2WQY B;  1SE4 A;  2PTL A;  3ABV B;  2AQ1 B;  4WWM A;  1V1P B;  1MHH E;  3LB8 C;  1VDV A;  2Y5C A;  1L0V B;  4RGM A;  4RGN A;  3CWI A;  1SEB D;  3EUB 2;  2NTS A;  2NTT A;  1YQ4 B;  2WXI A;  3KLS X;  2H88 B;  1RM6 C;  1T6B X;  2W82 A;  1ENF A;  3BII D;  1JWS D;  4RGO S;  2X38 A;  1D5X C;  1JRO A;  3R2I A;  2Q5W D;  3AEF B;  3BVZ A;  5TSS A;  1C78 A;  3P4Q B;  4P16 A;  4XDC A;  1DOI A;  1J7C A;  3NVV A;  4US9 A;  3KWL A;  1ZUD 2;  2QSD A;  3BYY B;  2M19 A;  4GDL B;  1R7S A;  3T3N A;  1YN5 A;  2ICI A;  2PLP A;  2WS3 B;  2PVG C;  4HRO A;  2BS4 B;  4YXD B;  4YTP B;  2PW9 A;  1KLU D;  1TYG B;  1XLQ A;  3AE6 B;  2QMT A;  2SEB D;  2Z8L A;  3V3X A;  2ZW1 A;  1TS3 A;  1T3Q A;  1AWD A;  1K50 A;  3R2T A;  2VZK D;  1FFV A;  2V4I B;  1V97 A;  3MJ5 A;  3U2S C;  1QIL A;  2DLB A;  5HHD G;  1ZOY B;  1N62 A;  2AQ2 B;  5FR3 A;  1VR9 A;  2JYE A;  1SE3 A;  1C4C A;  1LO5 D;  4ARC A;  3PZ7 A;  3Q69 A;  5HG2 A;  2PVO D;  1C4P A;  1KH0 A;  4B0E A;  1K53 A;  4ITK A;  1L4D B;  4XE0 A;  4RF1 A;  4WUR A;  3GP7 A;  2LFI A;  3H8H A;  1BML C;  1YN3 A;  2KN4 A;  1F0Z A;  1DOX A;  1AN8 A;  2LHE A;  1I4Q A;  2WP9 B;  4ZHO A;  2Y5P A;  3LYY A;  1FRD A;  5H92 C;  4ZYS A;  5T8I A;  3J9C A;  2RDG A;  4LTU A;  1T5X D;  4DQO C;  2QEJ C;  1AYF A;  1K51 A;  1Q10 A;  1WGK A;  1ZXH A;  3VR9 B;  4HJG E;  4L23 A;  1SF0 A;  5D3I B;  3B2G A;  1V1O A;  1SXT A;  3URY A;  1SB3 C;  1TS4 A;  1L0Y B;  1HZ5 A;  3Q8F A;  5BMH A;  3KQ4 A;  3I9V 1;  1TKY A;  1MHX A;  4WQM A;  4OHJ A;  1I4G A;  1NYR A;  4TQ1 A;  2K5P A;  2WDV B;  1UWM A;  4LLG M;  4L1B A;  1RWS A;  2M56 B;  2WXF A;  3I57 A;  2RDH A;  1I4X A;  3P4P B;  2RMM A;  1PYW D;  2ON8 A;  5LNK 1;  5BMI A;  2LJI A;  1L0X B;  1EU4 A;  1FRR A;  4N58 A;  2N7J A;  3ZQ4 A;  3BWU D;  3AEC B;  3B2F A;  2V3P A;  4D2K A;  5I4D A;  2BW2 A;  2L1A A;  2DYO A;  2Y3A A;  2J42 A;  2W3S A;  5HI1 A;  4ZHP A;  2N9K A;  1JWB D;  1C76 A;  3DWG C;  1FCC C;  3NS1 A;  1F77 A;  2DYM A;  4JWS C;  2IPK D;  3N9Y C;  2V3N A;  5BYR A;  3TEX A;  2I2Y A;  3SR6 A;  2IDY A;  4RFB A;  4H2A A;  1FNU A;  1JWM D;  2E6X A;  1NI3 A;  3TUO A;  1F2R C;  3B9J A;  1NEN B;  4TSS A;  3AE8 B;  1GOZ A;  3TEW A;  5D7G A;  1XEE A;  1TS2 A;  4WH4 A;  5G5G A;  3AED B;  1JQ4 A;  1JRP A;  3AEB B;  2WLB A;  1I4R A;  2WU2 B;  4HEA 1;  3PZ8 A;  1KF6 B;  2MJ3 A;  2D5G A;  2WXP A;  4YTM B;  1FD6 A;  1FCL A;  1IBX A;  4RGT A;  3HVD A;  1SJE D;  1ET6 A;  4MT5 A;  3FIL A;  1UWX A;  3E56 A;  4OZA A;  2LGI A;  3W1S A;  3AEG B;  4GDK B;  3NZ3 A;  1ZP0 B;  1EWY C;  3TEY A;  2PIA A;  2AQ3 B;  3IT4 B;  1FMA D;  1VJK A;  4HKQ A;  3P42 A;  2WXN A;  2GB1 A;  1QOB A;  1KLG D;  3ZJT A;  3MHZ A;  4UDU C;  1N63 A;  1L6V A;  3BVM A;  4NJC A;  4US8 A;  1DOY A;  1NVI D;  4CQN A;  1V1P A;  4OVZ A;  3AMZ A;  1J7A A;  1CZP A;  3P1M A;  3ZJU A;  3Q8A A;  1PGB A;  4DXG A;  3P63 A;  2CJO A;  4MM3 B;  1CK1 A;  1FNW A;  3AEA B;  2EKI A;  3L4P A;  3BYT B;  1ZE3 D;  4YWG G;  5E6J A;  2GI9 A;  5FK9 C;  2RPV A;  1STE A;  4YSY B;  2W54 A;  1QKZ A;  4KKJ A;  2ZW0 A;  4C7Y A;  4ZOH C;  1C77 A;  2NMQ A;  3ETR A;  3NUH B;  2EEL A;  3EA6 A;  3FAH A;  4JE3 B;  2N9L A;  3AB5 A;  1M4V A;  3C8Y A;  3P4S B;  3AE5 B;  3V05 A;  4A55 A;  1VZ6 A;  2BS3 B;  2WDQ B;  1J7B A;  2QIL A;  3AEE B;  3DWM A;  1HEZ E;  1NYQ A;  3HVZ A;  3O13 A;  3NVZ A;  2WXG A;  2R61 A;  2LHD A;  3BK1 A;  4OW0 A;  1JWA D;  1B9R A;  4KKI A;  1YQ3 B;  3RPF C;  1BXT A;  1KTK A;  2JX5 A;  2B76 B;  1JAL A;  2GRI A;  1WYG A;  3W5V B;  1OFF A;  2K0P A;  4REZ A;  2BTE A;  2XN9 C;  2E3T A;  1ET9 A;  5GXG B;  1DYQ A;  3VRB B;  1WXQ A;  1HXY D;  2WXR A;  4KGS A;  4YT0 B;  4A90 A;  2INP E;  4L2Y A;  4P6V F;  4RF0 A;  3MC0 B;  3E9S A;  1E0Z A;  3OWE B;  1L5P A;  2L83 A;  1N5X A;  1OQR A;  1XF5 L;  4XWW A;  1WWT A;  1I4H A;  4C80 A;  5AUI A;  2N0S B;  1HZ6 A;  2JYT A;  3EGR A;  3W9C B;  2V0G A;  2LMC A;  3PO0 A;  2K3U A;  4M0W A;  1ESF A;  2WU5 B;  1TZO A;  1K52 A;  1SJH D;  4KX6 B;  1E7P B;  3AE3 B;  1ACC A;  3AE9 B;  1TJE A;  1UGJ A;  4MAC A;  4WIP A;  5BYQ A;  1E6E B;  3AE1 B;  1WRI A;  4YTN B;  3IT6 B;  5MPO A;  1ZDV A;  1SIJ A;  5JXV A;  1VZ8 A;  1IGD A;  4A9A A;  4NAM A;  2J53 A;  3ZJV A;  1SSN A;  4N6E B;  2ACZ B;  3CIR B;  1HA5 A;  2WXM A;  3TEZ A;  4A6Q A;  4NZL B;  1XLN A;  4PT5 A;  1HQR D;  1YN4 A;  4C7Z A;  1C9F A;  3U7Z A;  1GAQ B;  3VQI A;  2OED A;  2WDR B;  1PFD A;  1TS5 A;  1SE2 A;  1CQV A;  1JCK B;  2DWQ A;  4USA A;  5D3D A;  4JWU C;  2H89 B;  4N59 A;  3R8B A;  4HKZ E;  3UI3 A;  2WNM A;  1C79 A;  1FM0 D;  3BZD B;  3U52 E;  4C56 C;  1QQR A;  2KDM A;  5AUK A;  3IAM 1;  1JWU D;  1SBB B;  2IJ0 A;  1RFK A;  1TY0 A;  4OZC A;  5BMG A;  1QF6 A;  1DGJ A;  2JQR B;  2WXJ A;  3FC4 A;  3SEB A;  2QIE B;  2JZP A;  1FFU A;  1FEH A;  1MVK A;  4IDI A;  1WSP A;  1QOG A;  1EWC A;  2I38 A;  1TY2 A;  1XLO A;  2G9H D;  2SAK A;  2BT6 A;  4DXF A;  4GLS C;  2KAC A;  1XCT L;  2OHF A;  2MH7 A;  1IUE A;  1GB4 A;  4IOI E;  2LEK A;  1BUI C;  1D5M C;  2JWU A;  1YJI A;  2TSS A;  1QOA A;  4O1N A;  1VZ7 A;  3HRD D;  5HFY A;  4RH6 A;  3MFG A;  1XO3 A;  3T3O A;  4NAW B;  2HTM E;  1PDX A;  1ZDX A;  2WXH A;  3BVG A;  5C2T B;  2KAJ A;  1V8C A;  5EE3 A;  4AQ7 A;  4ARI A;  3MP9 A;  2K22 A;  2BB6 A;  1E10 A;  1XXG A;  1QLB B;  1MI0 A;  4ZRP A;  4RCO A;  4TMA B;  3BK2 A;  2K9X A;  3Q8E A;  4JPS A;  5BYS A;  2PMV A;  1GPX A;  1ROE A;  1RYJ A;  3AE7 B;  4ZRQ A;  2J4X A;  1L4Z B;  2YEP B;  1P7F A;  1KFY B;  3NVY A;  3GS2 A;  3IXS A;  5C3J B;  3KWV A;  1PUT A;  2JSV X;  3VRA B;  1D4B A;  4HRS A;  3AM9 A;  3RFZ B;  4YSX B;  1XLP A;  1PGX A;  4RNA A;  3ZYY X;  1P7E A;  3AN1 A;  3AH7 A;  4XDD A;  3AV8 A;  2KWD A;  2KMM A;  2BS2 B;  1NEK B;  2BYT A;  2IGD A;  3Q8B A;  1EM7 A;  3TSS A;  1KRH A;  2DBY A;  3HUI A;  2IGH A;  3AE2 B;  1MPE A;  1JW9 D;  4AS1 A;  2L32 A;  1QOF A;  2IGG A;  1XCQ L;  4A8X C;  1GB1 A;  2CJN A;  3Q8C A;  3W5U B;  3ZGZ A;  1D5Z C;  4FXC A;  1FO4 A;  5EE1 A;  2ONQ A;  3GB1 A;  1OQQ A;  1VRA B;  1F2R I;  2VZK B;  2PKO A;  4Q2J A;  1YMH E;  1FIQ A;  1ZPS A;  3U4E G;  4MH8 A;  2MJD A;  1N60 A;  3WCQ A;  2M0A A;  2JXT A;  2W55 A;  3P4R B;  5G5H A;  2FUG 1;  1UNS A;  4B0M A;  4IKG A;  2W3R A;  4LK0 M;  1YJJ A;  2BB5 A;  3SFD B;  1FXI A;  1QT9 A;  2CU3 A;  2WXK A;  4EE2 A;  2MJE A;  1D6E C;  3LXF A;  1YNT E;  4XWT A;  3VR8 B;  2WXO A;  3AE4 B;  2XNA C;  3IAS 1;  5H8Y E;  1A70 A;  2J52 A;  4TQ0 A;  2WXL A;  5FKA C;  1PGA A;  4WAF A;  1EU3 A;  5EE9 A;  2YEP F;  3W2D A;  4J3O D;  3NVW A;  2G1E A;  2KQ4 X;  1AW7 A;  5EE0 A;  2BBC A;  1VLB A;  2QJL A;  1ZXI A;  1TKG A;  2LUM A;  1FNV A;  2FE8 A;  4YSZ B;  1L6U A;  4KGR A;  1Y56 A;  1IBX B;  1FXA A;  4R3D A;  4OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...