1FCLA

Delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fclA00
1HZ6A 1MI0A 2IGDA 4MACA 4WH4A 2N7JA 1GB1A 3GB1A 2K0PA 2PLPA 2GI9A 2KDMA 2JXTA 1PGXA 4OZBA 1JMLA 1C9FA 3UI3A 1ZXHA 4OZAA 5BMHA 5HHDG 2ZW0A 2LGIA 1FD6A 1IBXB 2QMTA 2IGGA 4HJGE 1K51A 1HEZE 2KACA 4KGRA 1UWXA 2N9LA 5HI1A 1F2RC 1MHXA 1P7FA 2KN4A 1P7EA 1YMHE 5HFYA 1MPEA 2QSDA 2JZPA 4D2KA 2KQ4X 2ONQA 1KH0A 2KWDA 4OZCA 1MVKA 1D4BA 3FILB 1XCQL 4HKZE 5JXVA 1MHHE 2PTLA 1HZ5A 1IGDA 1K50A 1K52A 1K53A 3V3XA 1Q10A 2I38A 1FCLA 1F2RI 1XF5L 2J53A 4KGTA 4KGSA 5BMIA 4IOIE 1EM7A 5HG2A 2JWUA 1IGCA 1GB4A 2LHDA 2GB1A 2LHEA 5BMGA 2PW9A 4GLSC 3MP9A 1IBXA 1PGAA 1XCTL 1QKZA 2I2YA 2RPVA 2ON8A 2RMMA 2J52A 2JSVX 1YNTE 2NMQA 2EELA 4IKGA 2JU6X 2IGHA 2LUMA 3FILA 1PGBA 2N9KA 2OEDA 2ZW1A 1FCCC
chains in the Genus database with same CATH superfamily
3VHTC 4LJOB 4HKQA 1KOTA 1UD7A 2IGDA 4MH8A 4B6WA 2BWES 3MJ5A 3PS6A 4WQOB 2KZRA 4BZAA 1SXTA 3U8ZA 3K9OB 2L3ZA 2M17A 2MBOA 4EE2A 4AS1A 5J18A 1XLQA 3NJTA 1S1QB 5BYRA 3WAOA 5HI1A 4RCOA 4W9GA 2BS3B 4LNNA 2LEKA 5DPTA 1NENB 3AEFB 2IPKD 3ZYYX 3LDZE 2FCQA 3PTFC 3DWMA 4ANVA 1WSPA 1K53A 1DOYA 2IBIB 1TYGB 4X57B 2KK8A 4W9CA 1JALA 1YN3A 1TY0A 1KFYB 2GBMA 3IBEA 3UIPB 2HE7A 1SIJA 1ISNA 3DHGC 1QT9A 1F0ZA 1PYWD 4BKSA 1TY2A 1P98A 3OG5A 5BMGA 1FRRA 4HROA 4WWPA 2D2QA 4H2AA 2M1MA 2QHOA 4RM8A 3X0WA 3VH4B 2XN9C 3DHIC 2V1YA 2RMMA 2IO1B 2PVOD 3ZXVA 4JLCA 1I4XA 1WF9A 4DXFA 3GS2A 2BW2A 5CHVC 1RWSA 2C7NB 1UGJA 2GOWA 3KQ4A 4MT5A 2Y5PA 2FIDA 4USAA 2INCC 1WIAA 2JRIB 1I7HA 1MI0A 4MACA 4WH4A 4JX1C 4RGOS 1N5XA 3P1MA 4MJSB 2PLPA 4OZBA 4AUQC 2L32A 1ET6A 3ZKJC 3A33B 1UBQA 4IWOA 2VZKB 2C5LC 4RF1A 2NR2A 1WX7A 2O6VB 3N3KB 2KMAA 2XK5A 3VRAB 1ZDXA 3I57A 3HIZA 4MSQB 1NI3A 3HM6X 2JVCA 3JSVB 2M4NA 5BYQA 3SFEB 3N1XC 2QSDA 2D3AA 4MGZE 2LMCA 2KWDA 1WE7A 3A9JA 2MRPA 2FCSA 4PYUA 5E6NA 4OVZA 4WWMA 4JWUC 2JRHA 4HK2A 1Q10A 2W55A 3BY4B 4IM0A 4WURA 1WJUA 1L5PA 3BVMA 1FCLA 4HPMB 4AQ7A 2MBBB 3CSTA 5G5GA 3ZVVA 5CHFA 3AEEB 1SB3C 1B9RA 3I63C 2L76A 3B2GA 3KYDD 4FHKA 4HJKA 3V6EB 3I5JC 1EF1A 2BWFA 2PPHA 3VUYA 1VJKA 2CJOA 3OWEB 1AW7A 1DOXA 1TT5B 1AARA 3L13A 3ZJUA 1WYGA 3IG3A 4MM3B 5DPRA 4O1NA 4FBJB 5KHQA 1ZOYB 1R4MI 4YXDB 2BKRB 3V61A 1T6BX 4P1BC 2PEAA 2IYDB 4TQ0A 5HKHA 2V3SA 4KDLB 1YJ1A 3C8YA 1V97A 1FRDA 2RDBC 4N6EB 1AN8A 4G11A 3P42A 2PJHA 1BT0A 3BVGA 3TIXA 4W9LA 2ICIA 1E10A 3NZUA 1UNSA 4JGHB 1PGXA 4XX5A 3T8MA 2BF8B 2IY1B 5KHOA 3R7RA 1V49A 5CTRC 3RN9C 2LI5A 1YD8U 3M95A 4DXAB 4HXDA 2PIAA 3A9KA 1SEBD 2JWZA 3X23A 2HJ8A 4EZKA 3KLSX 1HTOA 1TTNA 2BPSA 3KYCD 2KFJA 1IPGA 2PE6B 4KSLC 3ENEA 3R2TA 4HKZE 4PS3A 2PTLA 4XWTA 4BKTA 2INPE 1K52A 1JCKB 4FADA 1BMLC 1V1OA 2AYOB 2LZ6A 5LXHA 3NG0A 5BMIA 3DVGY 4NNJB 1WRIA 4DHJD 2DX5B 5JHBA 1HXYD 3KUCB 2DAFA 1C3TA 3A9JB 3AE4B 1OTRB 4MJSA 3N1YC 4ZOHC 2A5UA 3ZUNA 1E5WA 3P4RB 1QLBB 4K81A 1CZPA 3AULA 4IWQA 3PLUA 3W9CB 4ACFA 1D5MC 2QDFA 1L6UA 2YEPB 1GOZA 4EKUA 2RD0A 3L16A 1WH3A 4KZ0A 3V62A 1OQQA 4W9JA 3HHMA 2K22A 1FFVA 2V3PA 4DHZE 1KF6B 3LB8C 3QARA 2OOBB 3PT2B 2N7JA 4LDTD 1VCBA 2EKIA 5EE9A 2BYTA 3OJ3A 4E3CA 2FAZA 1EF5A 2N7EA 2N9XA 5DCNA 3R66C 3O65B 1E8YA 2KACA 2BQQA 2JZZA 1JWUD 2WHIA 5C2TB 1E0ZA 2BS2B 2HJ1A 1ACCA 2DWQA 5D94A 4ZYSA 2RPQA 1C78A 2YLMA 4OZCA 4TQ1A 4UDUC 4NPNA 1TS4A 4II3B 2GBRA 4M01A 3BZDB 3AECB 1K50A 1WXSA 2WS3B 2WLBA 3MC8A 3WCQA 4KSKC 3R2IA 1Z5SB 3R7QA 2J53A 2W82A 4XE0A 2JZ3B 2JWUA 2KTRB 1SGHA 3EA6A 3PO0A 4RMAA 1V5OA 4IM2A 4G0NB 3GZNB 2OHFA 3KVFB 3RULA 1QOAA 4S17A 3E9SA 1L7YA 4ZHOA 2AQ3B 4NJCA 4WJNA 1ZKHA 3IVFA 2WXJA 1ZGUB 3ZXRA 2M8SA 1I4QA 5EE0A 3VAWA 2KMCA 1L0YB 3RYTA 3WAPA 4HVBA 2UYZB 2NMQA 5DPSA 1WZ3A 3QHTA 4KV2A 3NS8A 1J19A 2KJHB 1SE2A 3VFKA 2N9KA 2CU1A 4JE3B 3AE8B 2AEHA 1RFKA 1N6ZA 2CHWA 2UWQA 3O13A 3TUOA 3IHPC 2LFIA 3CIRB 4W9KA 3UINB 3RD2A 3QK0A 5AUKA 4EUTA 1C1YB 1E6EB 1JRUA 2C9WB 4YT0B 4M0WA 4FN2A 2KWUB 4RGTA 2V3NA 3ZRFA 2XBBC 3B0AA 3QCAA 4P6VF 2QMTA 2IGGA 1D3ZA 1WJ4A 2FNJB 2L0TA 4LJPB 1Z2MA 3ZQ4A 2C60A 2KN4A 4TSSA 3EC8A 4D2KA 2KQ4X 4ANUA 2CU3A 4LLGM 3NVZA 4LNIA 4HLEA 3H7SA 3N1ZC 4ITKA 3RCZA 2LXCA 2TSSA 4RGNA 3QA8A 2JUOA 1V5TA 2Y3AA 4HDQA 2LGDA 5AEKB 2KVRA 4REZA 4KZCA 5C3JB 1RRBA 1IUEA 2LVPA 2Z8LA 4K7UA 4KIKA 3UF8A 2GB1A 4PYZA 4JWSC 2N0SB 2L00B 1TKEA 2GRIA 3TBLD 1QILA 2YEPF 3MHSD 1ZUD2 1YQBA 1V6EA 3U7ZA 1G6JA 2KYWA 3A1QB 1I4GA 3NS1A 2JYEA 5LNK1 3RI7C 1TGZB 4ZRIA 1UZXB 1VLBA 3B9JA 3C19A 2IGHA 2LUMA 1WE6A 1WMHB 4LNOA 2FIFA 2LVQA 3FAHA 1E90A 1F52A 2DZMA 3NVVA 1T0RC 4CYEA 3Q14C 4DQOC 3BYYB 4II2B 3T3OA 4W9EA 1OFFA 3HRDD 1ZDVA 2LXAA 3ONSA 4W9IA 2K6QA 4MGIE 2ZNVC 3WANA 3AI5A 3M3JA 1F1HA 4DHZB 3Q8EA 1YX6B 4AP4C 2NS5A 2KTFA 4OVVA 3TCAA 2M0AA 1WGYA 3TEWA 4GMVA 5HFYA 1MPEA 1SSNA 1R7SA 4RM9A 3N32A 4DDID 1OQRA 3L17A 3QWZB 1FMAD 3EFCA 4JQWC 4N59A 1T0YA 2DYOA 3H7PA 1FXTB 4JIOU 3PHXB 4A6QA 1H8CA 5D7GA 2D3GA 1YIWA 2V9HA 3RUIB 3ZTDA 4KGTA 2MBEA 1EWCA 4GDLA 2WXLA 5GXGB 2CHXA 1MFWA 4A9AA 1IGCA 2ZEQA 3IT4B 2WXFA 1L0VB 4HEA1 1TS2A 1GJZA 3DCGA 4A55A 2K1FA 4CO7A 1B1ZA 4KVGB 1YQ3B 2N4FA 1UH6A 5IOIA 5E6JA 3T3NA 4ZRKA 1UWMA 2WX0A 4IW0A 2AQ2B 3DHHC 5E6OA 4I6LB 2K3UA 2JY6A 3KH0A 1YOVB 1YQ4B 3V6CB 4XDCA 3Q8CA 3J9CA 2IJ0A 4LNKA 3SFDB 2H89B 4YTNB 3IT6B 3KUDB 2C7MB 3Q69A 1P9DU 3UI3A 1WZ0A 3ZO5B 1TKYA 1KLUD 1ZXHA 5T8IA 4DDGD 5AZFA 1U4AA 2LJIA 1NEKB 2PKOA 1RAXA 2KT7A 3V60A 2WDVB 3P4QB 2G4DB 1GC6A 3AEAB 5LXIB 3APFA 2DZIA 3ABVB 2L1AA 4DK5A 3ZNGC 2MWSB 3FILB 4MSMB 2X38A 3W5UB 5JXVA 1VDVA 2MH7A 2C7HA 1LXDA 2INDC 2I38A 3SR6A 1IYFA 1J7BA 3EGRA 4GB9A 3NZ3A 2LGSA 1EM7A 4FULA 5HG2A 1HE8A 1UELA 1Q0WB 4PS8A 3SU8X 3C0RB 2LWPA 2L52A 2JF5A 4C56C 2KWCA 3R3MA 1GPXA 5FK9C 1V9JA 4HCNB 4XYCA 3AXCA 2KKCA 1STEA 3APCA 4BBNC 1CMXB 2FUHB 1PQSA 1KLGD 2BYFA 2WXGA 3RNCC 2E3TA 3AEBB 4IKGA 2DYMA 2WXKA 2OJRA 3CWIA 2G3QB 3AE3B 3Q2AC 3BYTB 1I4PA 3TJPA 1ZP0B 4BOSC 4P16A 3TEXA 4MH0E 3GZNI 2O6VD 1ET9A 2GBKA 4A20A 4JPSA 3BVZA 2WGSA 1GB1A 3DWGC 4G3XB 2YVCA 4DWFA 1M94A 1PUTA 1JMLA 3M62B 1RYJA 2IO3B 2AQ1B 3CF6E 1ZW7A 4OZAA 2Y5BB 3RNGC 2MSED 3H1UA 2WXMA 3AN1A 4LTUA 3I3TB 3PVLA 3QJZA 2NVUI 2DYBA 2JYTA 1MHXA 3DPDA 4GIVA 2WDQB 3Q3JA 5IP4D 1WXQA 2ONQA 1C4AA 1MVKA 2N1VA 1A5RA 2WQYB 4XGAB 2ACZB 4TKNA 4EFOA 3ZDTA 3ALBA 2K8BA 1FXAA 4WJPA 4L23A 3RPFC 3PZ8A 2K39A 3ZW3A 3N9YC 1TBEA 5G5HA 2BVCA 2WWZA 2J42A 3VH3B 3H9DA 1XO3A 2LHDA 3IAM1 1VRAB 2L8JA 2FE8A 4MGYE 1WI0A 2QIEB 2G1EA 2I1KA 4ANXA 5D6JB 3RMKC 1SJED 2EMTA 1XD3B 3AE9B 1VD2A 4YSXB 3P63A 2RPVA 2ON8A 3WA0A 1ZPSA 1E9MA 2BB5A 2M0XA 4ZYNA 2KDBA 3HVDA 1UUPA 3MHZA 3VXWA 3FILA 1PGBA 3DVNV 3N20C 3NVWA 1QOGA 1EU3A 3D32A 4OHJA 1HZ6A 2EKEC 1WGRA 3Q6BA 3RFZB 3P4SB 2GBNA 2KDMA 2JQRB 3EHVA 1M4VA 3QX1A 1NI2A 4C00A 2DZKA 5D3IB 2NPTA 4WQMA 3ZNZB 3MC9A 2WNMA 2L0FA 1TJEA 2K8CA 4WIPA 3MTNB 4EEWA 1L6VA 2KDEB 1YN4A 1P7FA 3AEGB 1P7EA 3WALA 1V1PA 3AU4A 3WAMA 2D3CA 1WGGA 4DHJB 1D4BA 1L0XB 3A4RA 3Q3OC 3AU5A 4K3BA 2WU2B 2V4LA 1C4PA 1OEYA 2PE9A 1XLNA 4L1BA 4WAFA 2GLSA 3BK1A 1S3SG 3VQIA 1I4HA 1N61A 1XF5L 2N1WA 2UU7A 3VUXA 1E8WA 1E7PB 2XK5B 3CMMB 4MM3A 2KTRA 2Y5CA 3B2FA 4GDKB 1TZOA 2DLBA 3GP7A 3H8HA 1UF0A 5L83A 4NQKE 4KKJA 2AL3A 4ASWC 2MBHA 3AM9A 1RM6C 1KLVA 3VTUA 2KQSA 4B0EA 4C7ZA 1NVID 3HM3A 4IG7B 1R4MB 3DBSA 1ZXIA 2NBWB 2PVGC 4M00A 2V0GA 1WY8A 1N62A 4ZHPA 1WXMA 2WDRB 4LDTB 4WJQA 3TMPB 1N60A 3IAS1 4PK1A 4LK0M 2ZW1A 1J0GA 4FJZA 1FXIA 4E71A 2RGFA 3AMZA 4C4VA 2MJDA 4FHJA 1JW9D 2QC8A 3M63B 1C9FA 2D07B 2KX0A 1XLPA 1SE3A 3L08A 2Q5WD 3GE8C 3URYA 4GSWA 4GDKA 4NAWB 2IZVB 2J0KA 2J7QB 3AE6B 3ETRA 1UWXA 2N9LA 2ZPYA 1JWAD 5IO9A 4HDOA 2WXOA 3IXSA 2DNFA 2KANA 1QOBA 1AWDA 5TSSA 2G4SA 1WWTA 3T9LA 2KX3A 1IGDA 5CX3A 2J4XA 3SDLC 1ESFA 2WXIA 1XEEA 3AH7A 3HVZA 1V86A 3A9KB 2QCZA 2NTSA 3QAQA 4GU2A 4GGQA 3DOWA 1J7AA 1WYWB 3ZGZA 2BBCA 3MP9A 3Q3FA 3H7PB 4I6PA 2KOXA 1BUIC 4Q2JA 3IFWB 1YNTE 2KQ7A 2WP9B 2EELA 1T0QC 1MJDA 2JU6X 2KN5A 3P4PB 2LJ5A 2DAJA 1VZ7A 3TEYA 4W9DA 5JHAA 3GOEA 2FCNA 3BWUD 3UQAA 2REXA 1C79A 5H92C 2NTTA 2LUEA 1CK1A 2GI9A 2QEJC 1YN5A 3NOBA 4MDKE 1TS3A 3K9PB 4KKIA 2SEBD 1XLOA 1YJIA 4W9FA 1LGRA 1FD6A 4HJGE 1KJTA 5JH5C 4IWPA 3L54A 2KVZA 4MGKE 2VH2A 1H4RA 5FR6A 2BB6A 2GMIC 1RLFA 1WXVA 1I42A 3RNFC 2KNBA 2L83A 3V05A 4BKGA 1N63A 4HCPB 1V1PB 1VR9A 1WR1A 4A90A 3PSEB 5LLIA 1WGHA 4NAMA 5L95C 1T0SC 1LM8B 1FO4A 1WXAA 1ZE3D 2KO3A 4HWIB 3EUB2 1OQYA 4FJVB 3CSFA 3AE5B 2LRWA 1OEYJ 2PW9A 2CS4A 1PFDA 3MJWA 4M8MA 4BAXA 1D6EC 1XCTL 4DXGA 4HPLB 3APDA 4NAWA 2HDEA 5C23A 2W3SA 4BKSD 2J52A 3KW5B 3U7DA 1I4RA 5IAAC 3RNBC 2LGYA 3VTVA 1Y56A 5EE3A 1Y8RC 1JWBD 3DDCB 1E8ZA 1VZ8A 2OEDA 4FXCA 3Q3NC 2D10A 3UQBA 2XEWA 5FKAC 2L05A 4C7YA 3DBLI 4NQLB 1EO6A 2QJLA 2O6VA 1GC7A 2MP2A 4QAYA 1JROA 4RF0A 2K5PA 4US9A 3ECIA 3PLVA 3B1LX 3NHEB 5BMHA 5HHDG 1QQRA 1WGDA 5J2RA 1IBXB 3PV1A 2LD9A 2JPHA 3N30A 2KMMA 2W54A 1J8CA 1P1AA 4KX6B 4KGRA 1LO5D 5DPWA 1WJ6A 2B3AA 3E56A 4ZRQA 2K9XA 3BIID 4P1CC 1WFYA 1CQVA 3MC0B 1C4CA 3VDZA 4CQNA 2W9NA 3EFUA 3PHWB 4XC2A 2INNE 1V2YA 1SF0A 4KDIC 4WAAA 4FJYA 3AB5A 4JL9A 2AX5A 3W2DA 5D3DA 2V4IB 1EU4A 2RR9A 1PDXA 1LFDA 4LNFA 4US8A 2ZCBA 1SBBB 2MHJA 3Q8FA 2MBQA 3TSSA 2BS4B 1QZEA 3Q3MC 4KIKB 5EDSA 2FCMA 2SAKA 3Q8BA 3BK2A 2WU5B 2HTME 4PT5A 4AOFA 1NBFC 2M19A 1AYFA 1K8RB 4M8NA 3PRPB 2NPTB 4GN1A 4XZ4A 3ZDMC 1T5XD 2LGXA 1SE4A 2FUG1 2W3RA 5CHWA 5G55A 3RZWC 3RNAC 1EUVB 3L4PA 1XXGA 1FCCC 3KUZA 4RH6A 4RFBA 1TS5A 1N5WA 1RFAA 4J3OD 2RDGA 4MEMA 4IUMB 2VRRB 1KTKA 4PS7A 2N7DA 3RNEC 2WXHA 2KD0A 3W1SA 2KDFB 2BTEA 2ZW0A 2MX2A 3ML8A 4AWJA 2VZKD 1J7CA 1K51A 3ZTCA 3QIJA 1E7VA 2AWTA 4EZJA 1F2RC 2RSUA 1YMHE 1MG8A 4K7SA 1KH0A 4IC7B 1FPYA 5MPOA 3HUIA 4C80A 4OW0A 1JWMD 2J0MA 1L4DB 3V3XA 3KWLA 1KM7A 4WJOA 3R8BA 2ZCCA 2ASQA 4KGSA 4OVUA 4IOIE 4ICUA 2MJEA 4K7WA 1XQQA 2HTHA 2Z59B 2NCNA 3GE3C 1WMHA 2X8XX 4TMAB 1LQBA 4K3CA 1GG3A 1TZ1A 3QC8B 3UIOB 2I1JA 5G2NA 4ZDVA 1QF6A 1IBXA 2WYQA 3AE2B 1HA5A 1JRPA 1MG4A 4IM3A 4B9KA 4A8XC 1WM2A 5BYSA 4K1RB 4AJWA 3DBHI 3WIMA 2R2OA 4A3PA 3OAWA 2K6DB 2K25A 4A3OA 3DVGX 5BO4B 2MW5A 2D11A 2IY0B 1L2NA 1BXTA 4F1SA 2NBUA 1FFUA 4BFRA 1C76A 2M56B 1P0RA 4G50A 3VUWA 1WX9A 5IA7A 2ZVNA 4URKA 3KWVA 1R4NB 4NY0A 3SD5A 4F8CB 3P2BA 5D2MB 3Q8AA 1FNUA 2LRUA 2BGFA 2R61A 3DBRB 3S2AA 1WM3A 4TUUA 1L4ZB 1YJJA 3SHQA 2LGIA 3JYUA 2D3BA 2KJ6A 3L0WB 4MELA 1X1MA 4GDLB 3OLMD 2O2VA 3JW0X 4E74A 2JZPA 2WX1A 2VH1A 4YL8A 1ROEA 3I9V1 5GMVA 3VRBB 2KXJA 3W5VB 2CR5A 2G45B 3UGBB 2MJ3A 1V80A 1Q5WB 2JX5A 1DYQA 1F2RI 5EE1A 4LCDE 3DBRI 3FC4A 2EMSA 3ZNID 5JZEB 3NZSA 3LXFA 1R4NI 2O2VB 1HTQA 4NZLB 3W1SC 2ZPNA 2OJWA 2AL6A 1OGWA 2HD5B 4FA6A 3VVWB 2DZJA 2A4ZA 1GAQB 4FLHA 2CHZA 4NJ6A 5AZHA 4CHKA 1QKZA 1WGKA 4AJYB 3PZ7A 2KDIA 3DBHB 4BBNF 4GOCA 4XWWA 2LASA 1D5ZC 1E8XA 2KLCA 3PPAA 4YWGG 5TR5A 2B76B 5AZGA 2WXRA 4IDIA 1NYQA 2DHZA 1FIQA 5I4DA 1C77A 2K8HA 3NUHB 3NY5A 1YX5B 3U30A 4R3DA 4DBGA 1IP9A 4N58A 1NYRA 2DBYA 1VZ6A 3A4SC 5H8YE 1FM0D 3NRZA 1WX8A 2XNAC 4HRSA 2KFKA 3GB1A 1WJNA 3PZDA 2JXTA 1E7UA 5J17A 3OJ4B 1GUAB 3VTWA 1UBIA 2BYEA 3ZJTA 3QQ8B 1FNWA 2MQJA 1HEZE 2FBWB 1GNUA 4ZRJA 4ZRPA 4XDDA 1UGMA 4BVUC 1WRDB 2L7RA 3AE1B 3W1YA 1F77A 1V8CA 2WXPA 2KHWB 1HQRD 1XT9B 1HZ5A 3AEDB 2KWVB 3AV8A 3ZJVA 3ZRCA 3MFGA 2CKHB 2WXNA 3JSVA 2Z0EB 3U52E 1JWSD 4BOZB 1T3QA 5E6PA 1FEHA 2WXQA 1NDDA 2LVOA 4YTMB 1ENFA 1TIFA 3TL5A 3RT3B 1I35A 1P3QU 3B08A 2MCNB 2CJNA 2MP2B 4GLSC 3ZNHB 2JXXA 1WR6E 1PGAA 2IO2B 1F9JA 2PMVA 3AE7B 2IDYA 2ZZPB 1EWYC 3VR8B 4RGMA 2E6XA 3PRZA 5IKCM 4I6NB 1SJHD 2JSVX 3SEBA 4EZLA 1FNVA 4HPPA 2D5GA 4C4VB 3RZFA 3LJ3A 2G9HD 1DGJA 4YTPB 4ANWA 2J0JA 3HK0A 2GBJA 4F7ZA 1Q1OA 1CJEA 2JT4B 1D5XC 3ZIMA 2ZVOA 3BINA 3PRMB 1V81A 4W9HA 2K0PA 4N9F4 4GXBA 4M02A 1SE9A 3U4EG 2BT6A 3PGEA 2BKFA 2WDTB 1KRHA 2KLGA 1DOIA 3DQVA 2KC2A 4ARIA 3DVNU 2IO0B 2R2QA 3EECA 2NBVB 3LYYA 2DENB 2QILA 4ARCA 2Z0DB 4RNAA 4WWNA 4J6IA 5FR3A 1XCQL 2MEKA 3TEZA 1MHHE 4ICVA 2KJRA 4S0RA 2RDHA 3ZLZA 2KAJA 3H6NA 2H88B 1TKGA 1QOFA 4M0WB 3A1QA 3JVZX 2ZJDA 3PREA 2BYVE 2N9EB 1GB4A 1JQ4A 3DBLB 5C1ZA 2N9PC 2LHEA 3NVYA 3ML9A 3L10B 4L2YA 4YSYB 4B95A 4YSZB 2MA9B 3FKYA 1SIFA 5IN7A 2MLBA 4NJ7A 4EOYA 2I2YA 4TV3A 3U2SC 2ZNVB 5AUIA 2KFKB 3VR9B 4B0MA 4P7IA 4WWOA 2KC1A 1A70A
chains in the Genus database with same CATH topology
1HZ6A 3O13A 4RH6A 4RFBA 4HKQA 3TUOA 1TS5A 2LFIA 2IGDA 1N5WA 3RFZB 4J3OD 3P4SB 2RDGA 3CIRB 4MH8A 2KDMA 3MJ5A 1KTKA 5AUKA 2JQRB 1M4VA 1E6EB 5D3IB 2WXHA 4YT0B 3W1SA 4M0WA 4WQMA 4RGTA 2V3NA 1SXTA 2BTEA 2ZW0A 2WNMA 4P6VF 2QMTA 1TJEA 2IGGA 2VZKD 4WIPA 1J7CA 4EE2A 4AS1A 1K51A 1XLQA 5BYRA 1L6VA 3ZQ4A 5HI1A 4RCOA 1YN4A 1F2RC 1P7FA 2BS3B 2KN4A 3AEGB 2LEKA 1P7EA 1YMHE 4TSSA 1NENB 1V1PA 1FCCC 4D2KA 2KQ4X 3AEFB 2IPKD 1KH0A 2CU3A 3ZYYX 4LLGM 3NVZA 5MPOA 3HUIA 1D4BA 1L0XB 4C80A 2WU2B 4OW0A 1JWMD 3DWMA 4ITKA 1C4PA 1WSPA 2TSSA 1XLNA 1L4DB 3V3XA 3KWLA 1K53A 4RGNA 4L1BA 4WAFA 3BK1A 1DOYA 2Y3AA 3VQIA 1I4HA 1N61A 1TYGB 3R8BA 1XF5L 4REZA 1JALA 1E7PB 4KGSA 1YN3A 1TY0A 4IOIE 1KFYB 2Y5CA 3B2FA 2MJEA 5C3JB 1IUEA 4GDKB 1TZOA 2DLBA 3GP7A 1SIJA 3H8HA 2Z8LA 1QT9A 1F0ZA 1PYWD 2GB1A 4KKJA 4TMAB 4JWSC 2N0SB 1TY2A 1TKEA 2GRIA 5BMGA 1QILA 1FRRA 2YEPF 3AM9A 1RM6C 4HROA 1ZUD2 1QF6A 4B0EA 1IBXA 4C7ZA 3AE2B 4H2AA 3U7ZA 1HA5A 1NVID 1JRPA 1I4GA 4A8XC 5BYSA 3NS1A 2XN9C 1ZXIA 2PVGC 2JYEA 5LNK1 2RMMA 2V0GA 1N62A 2PVOD 4ZHPA 2WDRB 1VLBA 1I4XA 3B9JA 2IGHA 4DXFA 2LUMA 3GS2A 1N60A 2BW2A 1BXTA 3IAS1 1RWSA 4LK0M 1FFUA 1UGJA 4MT5A 1C76A 2M56B 2ZW1A 3FAHA 3KQ4A 2Y5PA 4USAA 1FXIA 3AMZA 1I7HA 3NVVA 3KWVA 1MI0A 4MACA 2MJDA 4WH4A 4JX1C 4RGOS 1N5XA 3P1MA 3Q8AA 2PLPA 4DQOC 3BYYB 4OZBA 2L32A 1FNUA 1ET6A 1JW9D 2R61A 3T3OA 2VZKB 1C9FA 1OFFA 4RF1A 3HRDD 1ZDVA 1L4ZB 1XLPA 1YJJA 1SE3A 2LGIA 3VRAB 2Q5WD 1ZDXA 3I57A 3URYA 3Q8EA 1NI3A 2M0AA 4NAWB 4GDLB 3AE6B 3ETRA 1UWXA 2N9LA 3TEWA 5BYQA 3SFEB 1JWAD 5HFYA 1MPEA 2QSDA 2JZPA 1SSNA 2LMCA 1R7SA 2WXOA 3IXSA 2KWDA 1QOBA 1OQRA 1AWDA 1ROEA 5TSSA 3I9V1 3VRBB 4OVZA 1FMAD 4WWMA 4JWUC 3W5VB 1WWTA 4N59A 2DYOA 1IGDA 2J4XA 1Q10A 2W55A 4A6QA 1ESFA 2MJ3A 5D7GA 4WURA 1L5PA 2JX5A 3BVMA 1DYQA 1F2RI 2WXIA 4AQ7A 1FCLA 1XEEA 5EE1A 3FC4A 4KGTA 1EWCA 5G5GA 2WXLA 5GXGB 3AEEB 1SB3C 1B9RA 4A9AA 3AH7A 3B2GA 3HVZA 3LXFA 1IGCA 4NZLB 3IT4B 1VJKA 2CJOA 2WXFA 3OWEB 1L0VB 2NTSA 4HEA1 1TS2A 4A55A 1GAQB 1AW7A 1J7AA 1DOXA 3ZGZA 2BBCA 1B1ZA 3MP9A 1YQ3B 1QKZA 3ZJUA 1WGKA 1WYGA 4MM3B 3PZ7A 5E6JA 3T3NA 4O1NA 1UWMA 1BUIC 4Q2JA 4XWWA 2AQ2B 1D5ZC 1ZOYB 1YNTE 2WP9B 4YXDB 2EELA 4YWGG 2JU6X 2B76B 1T6BX 2WXRA 4IDIA 1NYQA 2K3UA 4TQ0A 5I4DA 1FIQA 1C77A 3NUHB 3P4PB 1YQ4B 4R3DA 4XDCA 3C8YA 4N58A 1NYRA 1VZ7A 3J9CA 3Q8CA 3TEYA 2DBYA 1VZ6A 1V97A 2IJ0A 1FRDA 4N6EB 5H8YE 3BWUD 1AN8A 3SFDB 1FM0D 3NRZA 3P42A 1C79A 2H89B 2XNAC 4YTNB 5H92C 3IT6B 3BVGA 4HRSA 2NTTA 3GB1A 2ICIA 1CK1A 1E10A 2GI9A 1UNSA 2JXTA 1PGXA 3Q69A 2QEJC 1YN5A 3UI3A 1TS3A 1TKYA 1KLUD 4KKIA 1ZXHA 5T8IA 2SEBD 2LJIA 1NEKB 1XLOA 1YJIA 3ZJTA 2PKOA 1FD6A 1FNWA 4HJGE 2WDVB 1HEZE 2PIAA 3P4QB 2FBWB 1SEBD 3AEAB 4ZRPA 4XDDA 3ABVB 3KLSX 3AE1B 2BB6A 2L1AA 1F77A 1V8CA 2WXPA 3FILB 2X38A 3W5UB 4HKZE 3R2TA 1HQRD 5JXVA 2PTLA 2L83A 1VDVA 4XWTA 1HZ5A 2INPE 2MH7A 3AEDB 3V05A 1K52A 1N63A 3AV8A 1JCKB 3ZJVA 1V1PB 2I38A 1VR9A 1BMLC 3MFGA 4A90A 3SR6A 1J7BA 3EGRA 1V1OA 2WXNA 4NAMA 3U52E 5BMIA 1JWSD 3NZ3A 1WRIA 1EM7A 5HG2A 1T3QA 1FO4A 1HXYD 1FEHA 2WXQA 1ZE3D 3AE4B 4YTMB 1ENFA 3EUB2 2L52A 4C56C 3AE5B 4ZOHC 2PW9A 1PFDA 1GPXA 2CJNA 3P4RB 4GLSC 1QLBB 5FK9C 1CZPA 1D6EC 1PGAA 1XCTL 4DXGA 2PMVA 1STEA 3W9CB 3L4PA 1D5MC 3AE7B 2HDEA 2IDYA 1L6UA 1EWYC 2W3SA 3VR8B 4RGMA 1KLGD 2YEPB 2E6XA 2J52A 2WXGA 1SJHD 2JSVX 2E3TA 3SEBA 1GOZA 1I4RA 3AEBB 1FNVA 4IKGA 2DYMA 2D5GA 2WXKA 3CWIA 3AE3B 1Y56A 2G9HD 3BYTB 5EE3A 1I4PA 1DGJA 1JWBD 4YTPB 1ZP0B 1OQQA 1VZ8A 4P16A 3TEXA 2OEDA 4FXCA 2K22A 5FKAC 4C7YA 1CJEA 1FFVA 1ET9A 2V3PA 4JPSA 1KF6B 2QJLA 1D5XC 3BVZA 3LB8C 1JROA 4RF0A 2K5PA 2N7JA 1GB1A 3DWGC 2K0PA 2EKIA 5EE9A 4US9A 2BYTA 1PUTA 1JMLA 3U4EG 1RYJA 2AQ1B 2BT6A 4OZAA 5BMHA 5HHDG 1QQRA 1IBXB 2WXMA 3AN1A 1KRHA 4LTUA 1DOIA 2KMMA 2KACA 2W54A 4KX6B 4KGRA 1LO5D 4ARIA 1JWUD 2JYTA 1MHXA 5C2TB 3E56A 1E0ZA 2BS2B 2WDQB 1ACCA 2DWQA 2K9XA 1WXQA 3BIID 3LYYA 2ONQA 2QILA 1C4AA 1C78A 4ZRQA 4OZCA 4ZYSA 4RNAA 4ARCA 1MVKA 4TQ1A 2WQYB 4UDUC 1CQVA 1TS4A 1XCQL 2ACZB 2MEKA 3MC0B 5FR3A 1C4CA 1MHHE 3TEZA 2RDHA 4CQNA 3BZDB 2KAJA 3AECB 1K50A 2INNE 1SF0A 2WLBA 2H88B 1FXAA 2WS3B 4L23A 3WCQA 3R2IA 1TKGA 3AB5A 1QOFA 2AX5A 2J53A 3RPFC 3PZ8A 3N9YC 2W82A 3W2DA 5D3DA 5G5HA 2V4IB 1EU4A 4XE0A 1PDXA 2JWUA 1GB4A 4US8A 2J42A 3EA6A 3PO0A 1SBBB 3Q8FA 1JQ4A 1XO3A 2LHDA 3IAM1 3TSSA 1VRAB 2BS4B 2FE8A 2OHFA 2LHEA 3NVYA 2QIEB 2G1EA 1QOAA 4L2YA 3E9SA 4ZHOA 2AQ3B 4YSYB 2SAKA 4NJCA 4YSZB 3Q8BA 3BK2A 1SJED 2HTME 2WU5B 2WXJA 4PT5A 2M19A 3AE9B 1I4QA 1AYFA 4YSXB 3P63A 5EE0A 2I2YA 2RPVA 2ON8A 1T5XD 1ZPSA 1L0YB 1E9MA 2BB5A 1SE4A 2NMQA 2FUG1 3U2SC 2W3RA 3HVDA 1UUPA 3MHZA 5AUIA 3FILA 3VR9B 4B0MA 1SE2A 1PGBA 2N9KA 1QOGA 3NVWA 1EU3A 4JE3B 3AE8B 1A70A 1RFKA 1XXGA 4OHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ6 A;  1MI0 A;  2IGD A;  4MAC A;  4WH4 A;  2N7J A;  1GB1 A;  3GB1 A;  2K0P A;  2PLP A;  2GI9 A;  2KDM A;  2JXT A;  1PGX A;  4OZB A;  1JML A;  1C9F A;  3UI3 A;  1ZXH A;  4OZA A;  5BMH A;  5HHD G;  2ZW0 A;  2LGI A;  1FD6 A;  1IBX B;  2QMT A;  2IGG A;  4HJG E;  1K51 A;  1HEZ E;  2KAC A;  4KGR A;  1UWX A;  2N9L A;  5HI1 A;  1F2R C;  1MHX A;  1P7F A;  2KN4 A;  1P7E A;  1YMH E;  5HFY A;  1MPE A;  2QSD A;  2JZP A;  4D2K A;  2KQ4 X;  2ONQ A;  1KH0 A;  2KWD A;  4OZC A;  1MVK A;  1D4B A;  3FIL B;  1XCQ L;  4HKZ E;  5JXV A;  1MHH E;  2PTL A;  1HZ5 A;  1IGD A;  1K50 A;  1K52 A;  1K53 A;  3V3X A;  1Q10 A;  2I38 A;  1FCL A;  1F2R I;  1XF5 L;  2J53 A;  4KGT A;  4KGS A;  5BMI A;  4IOI E;  1EM7 A;  5HG2 A;  2JWU A;  1IGC A;  1GB4 A;  2LHD A;  2GB1 A;  2LHE A;  5BMG A;  2PW9 A;  4GLS C;  3MP9 A;  1IBX A;  1PGA A;  1XCT L;  1QKZ A;  2I2Y A;  2RPV A;  2ON8 A;  2RMM A;  2J52 A;  2JSV X;  1YNT E;  2NMQ A;  2EEL A;  4IKG A;  2JU6 X;  2IGH A;  2LUM A;  3FIL A;  1PGB A;  2N9K A;  2OED A;  2ZW1 A;  1FCC C; 
#chains in the Genus database with same CATH topology
 3VHT C;  4LJO B;  4HKQ A;  1KOT A;  1UD7 A;  2IGD A;  4MH8 A;  4B6W A;  2BWE S;  3MJ5 A;  3PS6 A;  4WQO B;  2KZR A;  4BZA A;  1SXT A;  3U8Z A;  3K9O B;  2L3Z A;  2M17 A;  2MBO A;  4EE2 A;  4AS1 A;  5J18 A;  1XLQ A;  3NJT A;  1S1Q B;  5BYR A;  3WAO A;  5HI1 A;  4RCO A;  4W9G A;  2BS3 B;  4LNN A;  2LEK A;  5DPT A;  1NEN B;  3AEF B;  2IPK D;  3ZYY X;  3LDZ E;  2FCQ A;  3PTF C;  3DWM A;  4ANV A;  1WSP A;  1K53 A;  1DOY A;  2IBI B;  1TYG B;  4X57 B;  2KK8 A;  4W9C A;  1JAL A;  1YN3 A;  1TY0 A;  1KFY B;  2GBM A;  3IBE A;  3UIP B;  2HE7 A;  1SIJ A;  1ISN A;  3DHG C;  1QT9 A;  1F0Z A;  1PYW D;  4BKS A;  1TY2 A;  1P98 A;  3OG5 A;  5BMG A;  1FRR A;  4HRO A;  4WWP A;  2D2Q A;  4H2A A;  2M1M A;  2QHO A;  4RM8 A;  3X0W A;  3VH4 B;  2XN9 C;  3DHI C;  2V1Y A;  2RMM A;  2IO1 B;  2PVO D;  3ZXV A;  4JLC A;  1I4X A;  1WF9 A;  4DXF A;  3GS2 A;  2BW2 A;  5CHV C;  1RWS A;  2C7N B;  1UGJ A;  2GOW A;  3KQ4 A;  4MT5 A;  2Y5P A;  2FID A;  4USA A;  2INC C;  1WIA A;  2JRI B;  1I7H A;  1MI0 A;  4MAC A;  4WH4 A;  4JX1 C;  4RGO S;  1N5X A;  3P1M A;  4MJS B;  2PLP A;  4OZB A;  4AUQ C;  2L32 A;  1ET6 A;  3ZKJ C;  3A33 B;  1UBQ A;  4IWO A;  2VZK B;  2C5L C;  4RF1 A;  2NR2 A;  1WX7 A;  2O6V B;  3N3K B;  2KMA A;  2XK5 A;  3VRA B;  1ZDX A;  3I57 A;  3HIZ A;  4MSQ B;  1NI3 A;  3HM6 X;  2JVC A;  3JSV B;  2M4N A;  5BYQ A;  3SFE B;  3N1X C;  2QSD A;  2D3A A;  4MGZ E;  2LMC A;  2KWD A;  1WE7 A;  3A9J A;  2MRP A;  2FCS A;  4PYU A;  5E6N A;  4OVZ A;  4WWM A;  4JWU C;  2JRH A;  4HK2 A;  1Q10 A;  2W55 A;  3BY4 B;  4IM0 A;  4WUR A;  1WJU A;  1L5P A;  3BVM A;  1FCL A;  4HPM B;  4AQ7 A;  2MBB B;  3CST A;  5G5G A;  3ZVV A;  5CHF A;  3AEE B;  1SB3 C;  1B9R A;  3I63 C;  2L76 A;  3B2G A;  3KYD D;  4FHK A;  4HJK A;  3V6E B;  3I5J C;  1EF1 A;  2BWF A;  2PPH A;  3VUY A;  1VJK A;  2CJO A;  3OWE B;  1AW7 A;  1DOX A;  1TT5 B;  1AAR A;  3L13 A;  3ZJU A;  1WYG A;  3IG3 A;  4MM3 B;  5DPR A;  4O1N A;  4FBJ B;  5KHQ A;  1ZOY B;  1R4M I;  4YXD B;  2BKR B;  3V61 A;  1T6B X;  4P1B C;  2PEA A;  2IYD B;  4TQ0 A;  5HKH A;  2V3S A;  4KDL B;  1YJ1 A;  3C8Y A;  1V97 A;  1FRD A;  2RDB C;  4N6E B;  1AN8 A;  4G11 A;  3P42 A;  2PJH A;  1BT0 A;  3BVG A;  3TIX A;  4W9L A;  2ICI A;  1E10 A;  3NZU A;  1UNS A;  4JGH B;  1PGX A;  4XX5 A;  3T8M A;  2BF8 B;  2IY1 B;  5KHO A;  3R7R A;  1V49 A;  5CTR C;  3RN9 C;  2LI5 A;  1YD8 U;  3M95 A;  4DXA B;  4HXD A;  2PIA A;  3A9K A;  1SEB D;  2JWZ A;  3X23 A;  2HJ8 A;  4EZK A;  3KLS X;  1HTO A;  1TTN A;  2BPS A;  3KYC D;  2KFJ A;  1IPG A;  2PE6 B;  4KSL C;  3ENE A;  3R2T A;  4HKZ E;  4PS3 A;  2PTL A;  4XWT A;  4BKT A;  2INP E;  1K52 A;  1JCK B;  4FAD A;  1BML C;  1V1O A;  2AYO B;  2LZ6 A;  5LXH A;  3NG0 A;  5BMI A;  3DVG Y;  4NNJ B;  1WRI A;  4DHJ D;  2DX5 B;  5JHB A;  1HXY D;  3KUC B;  2DAF A;  1C3T A;  3A9J B;  3AE4 B;  1OTR B;  4MJS A;  3N1Y C;  4ZOH C;  2A5U A;  3ZUN A;  1E5W A;  3P4R B;  1QLB B;  4K81 A;  1CZP A;  3AUL A;  4IWQ A;  3PLU A;  3W9C B;  4ACF A;  1D5M C;  2QDF A;  1L6U A;  2YEP B;  1GOZ A;  4EKU A;  2RD0 A;  3L16 A;  1WH3 A;  4KZ0 A;  3V62 A;  1OQQ A;  4W9J A;  3HHM A;  2K22 A;  1FFV A;  2V3P A;  4DHZ E;  1KF6 B;  3LB8 C;  3QAR A;  2OOB B;  3PT2 B;  2N7J A;  4LDT D;  1VCB A;  2EKI A;  5EE9 A;  2BYT A;  3OJ3 A;  4E3C A;  2FAZ A;  1EF5 A;  2N7E A;  2N9X A;  5DCN A;  3R66 C;  3O65 B;  1E8Y A;  2KAC A;  2BQQ A;  2JZZ A;  1JWU D;  2WHI A;  5C2T B;  1E0Z A;  2BS2 B;  2HJ1 A;  1ACC A;  2DWQ A;  5D94 A;  4ZYS A;  2RPQ A;  1C78 A;  2YLM A;  4OZC A;  4TQ1 A;  4UDU C;  4NPN A;  1TS4 A;  4II3 B;  2GBR A;  4M01 A;  3BZD B;  3AEC B;  1K50 A;  1WXS A;  2WS3 B;  2WLB A;  3MC8 A;  3WCQ A;  4KSK C;  3R2I A;  1Z5S B;  3R7Q A;  2J53 A;  2W82 A;  4XE0 A;  2JZ3 B;  2JWU A;  2KTR B;  1SGH A;  3EA6 A;  3PO0 A;  4RMA A;  1V5O A;  4IM2 A;  4G0N B;  3GZN B;  2OHF A;  3KVF B;  3RUL A;  1QOA A;  4S17 A;  3E9S A;  1L7Y A;  4ZHO A;  2AQ3 B;  4NJC A;  4WJN A;  1ZKH A;  3IVF A;  2WXJ A;  1ZGU B;  3ZXR A;  2M8S A;  1I4Q A;  5EE0 A;  3VAW A;  2KMC A;  1L0Y B;  3RYT A;  3WAP A;  4HVB A;  2UYZ B;  2NMQ A;  5DPS A;  1WZ3 A;  3QHT A;  4KV2 A;  3NS8 A;  1J19 A;  2KJH B;  1SE2 A;  3VFK A;  2N9K A;  2CU1 A;  4JE3 B;  3AE8 B;  2AEH A;  1RFK A;  1N6Z A;  2CHW A;  2UWQ A;  3O13 A;  3TUO A;  3IHP C;  2LFI A;  3CIR B;  4W9K A;  3UIN B;  3RD2 A;  3QK0 A;  5AUK A;  4EUT A;  1C1Y B;  1E6E B;  1JRU A;  2C9W B;  4YT0 B;  4M0W A;  4FN2 A;  2KWU B;  4RGT A;  2V3N A;  3ZRF A;  2XBB C;  3B0A A;  3QCA A;  4P6V F;  2QMT A;  2IGG A;  1D3Z A;  1WJ4 A;  2FNJ B;  2L0T A;  4LJP B;  1Z2M A;  3ZQ4 A;  2C60 A;  2KN4 A;  4TSS A;  3EC8 A;  4D2K A;  2KQ4 X;  4ANU A;  2CU3 A;  4LLG M;  3NVZ A;  4LNI A;  4HLE A;  3H7S A;  3N1Z C;  4ITK A;  3RCZ A;  2LXC A;  2TSS A;  4RGN A;  3QA8 A;  2JUO A;  1V5T A;  2Y3A A;  4HDQ A;  2LGD A;  5AEK B;  2KVR A;  4REZ A;  4KZC A;  5C3J B;  1RRB A;  1IUE A;  2LVP A;  2Z8L A;  4K7U A;  4KIK A;  3UF8 A;  2GB1 A;  4PYZ A;  4JWS C;  2N0S B;  2L00 B;  1TKE A;  2GRI A;  3TBL D;  1QIL A;  2YEP F;  3MHS D;  1ZUD 2;  1YQB A;  1V6E A;  3U7Z A;  1G6J A;  2KYW A;  3A1Q B;  1I4G A;  3NS1 A;  2JYE A;  5LNK 1;  3RI7 C;  1TGZ B;  4ZRI A;  1UZX B;  1VLB A;  3B9J A;  3C19 A;  2IGH A;  2LUM A;  1WE6 A;  1WMH B;  4LNO A;  2FIF A;  2LVQ A;  3FAH A;  1E90 A;  1F52 A;  2DZM A;  3NVV A;  1T0R C;  4CYE A;  3Q14 C;  4DQO C;  3BYY B;  4II2 B;  3T3O A;  4W9E A;  1OFF A;  3HRD D;  1ZDV A;  2LXA A;  3ONS A;  4W9I A;  2K6Q A;  4MGI E;  2ZNV C;  3WAN A;  3AI5 A;  3M3J A;  1F1H A;  4DHZ B;  3Q8E A;  1YX6 B;  4AP4 C;  2NS5 A;  2KTF A;  4OVV A;  3TCA A;  2M0A A;  1WGY A;  3TEW A;  4GMV A;  5HFY A;  1MPE A;  1SSN A;  1R7S A;  4RM9 A;  3N32 A;  4DDI D;  1OQR A;  3L17 A;  3QWZ B;  1FMA D;  3EFC A;  4JQW C;  4N59 A;  1T0Y A;  2DYO A;  3H7P A;  1FXT B;  4JIO U;  3PHX B;  4A6Q A;  1H8C A;  5D7G A;  2D3G A;  1YIW A;  2V9H A;  3RUI B;  3ZTD A;  4KGT A;  2MBE A;  1EWC A;  4GDL A;  2WXL A;  5GXG B;  2CHX A;  1MFW A;  4A9A A;  1IGC A;  2ZEQ A;  3IT4 B;  2WXF A;  1L0V B;  4HEA 1;  1TS2 A;  1GJZ A;  3DCG A;  4A55 A;  2K1F A;  4CO7 A;  1B1Z A;  4KVG B;  1YQ3 B;  2N4F A;  1UH6 A;  5IOI A;  5E6J A;  3T3N A;  4ZRK A;  1UWM A;  2WX0 A;  4IW0 A;  2AQ2 B;  3DHH C;  5E6O A;  4I6L B;  2K3U A;  2JY6 A;  3KH0 A;  1YOV B;  1YQ4 B;  3V6C B;  4XDC A;  3Q8C A;  3J9C A;  2IJ0 A;  4LNK A;  3SFD B;  2H89 B;  4YTN B;  3IT6 B;  3KUD B;  2C7M B;  3Q69 A;  1P9D U;  3UI3 A;  1WZ0 A;  3ZO5 B;  1TKY A;  1KLU D;  1ZXH A;  5T8I A;  4DDG D;  5AZF A;  1U4A A;  2LJI A;  1NEK B;  2PKO A;  1RAX A;  2KT7 A;  3V60 A;  2WDV B;  3P4Q B;  2G4D B;  1GC6 A;  3AEA B;  5LXI B;  3APF A;  2DZI A;  3ABV B;  2L1A A;  4DK5 A;  3ZNG C;  2MWS B;  3FIL B;  4MSM B;  2X38 A;  3W5U B;  5JXV A;  1VDV A;  2MH7 A;  2C7H A;  1LXD A;  2IND C;  2I38 A;  3SR6 A;  1IYF A;  1J7B A;  3EGR A;  4GB9 A;  3NZ3 A;  2LGS A;  1EM7 A;  4FUL A;  5HG2 A;  1HE8 A;  1UEL A;  1Q0W B;  4PS8 A;  3SU8 X;  3C0R B;  2LWP A;  2L52 A;  2JF5 A;  4C56 C;  2KWC A;  3R3M A;  1GPX A;  5FK9 C;  1V9J A;  4HCN B;  4XYC A;  3AXC A;  2KKC A;  1STE A;  3APC A;  4BBN C;  1CMX B;  2FUH B;  1PQS A;  1KLG D;  2BYF A;  2WXG A;  3RNC C;  2E3T A;  3AEB B;  4IKG A;  2DYM A;  2WXK A;  2OJR A;  3CWI A;  2G3Q B;  3AE3 B;  3Q2A C;  3BYT B;  1I4P A;  3TJP A;  1ZP0 B;  4BOS C;  4P16 A;  3TEX A;  4MH0 E;  3GZN I;  2O6V D;  1ET9 A;  2GBK A;  4A20 A;  4JPS A;  3BVZ A;  2WGS A;  1GB1 A;  3DWG C;  4G3X B;  2YVC A;  4DWF A;  1M94 A;  1PUT A;  1JML A;  3M62 B;  1RYJ A;  2IO3 B;  2AQ1 B;  3CF6 E;  1ZW7 A;  4OZA A;  2Y5B B;  3RNG C;  2MSE D;  3H1U A;  2WXM A;  3AN1 A;  4LTU A;  3I3T B;  3PVL A;  3QJZ A;  2NVU I;  2DYB A;  2JYT A;  1MHX A;  3DPD A;  4GIV A;  2WDQ B;  3Q3J A;  5IP4 D;  1WXQ A;  2ONQ A;  1C4A A;  1MVK A;  2N1V A;  1A5R A;  2WQY B;  4XGA B;  2ACZ B;  4TKN A;  4EFO A;  3ZDT A;  3ALB A;  2K8B A;  1FXA A;  4WJP A;  4L23 A;  3RPF C;  3PZ8 A;  2K39 A;  3ZW3 A;  3N9Y C;  1TBE A;  5G5H A;  2BVC A;  2WWZ A;  2J42 A;  3VH3 B;  3H9D A;  1XO3 A;  2LHD A;  3IAM 1;  1VRA B;  2L8J A;  2FE8 A;  4MGY E;  1WI0 A;  2QIE B;  2G1E A;  2I1K A;  4ANX A;  5D6J B;  3RMK C;  1SJE D;  2EMT A;  1XD3 B;  3AE9 B;  1VD2 A;  4YSX B;  3P63 A;  2RPV A;  2ON8 A;  3WA0 A;  1ZPS A;  1E9M A;  2BB5 A;  2M0X A;  4ZYN A;  2KDB A;  3HVD A;  1UUP A;  3MHZ A;  3VXW A;  3FIL A;  1PGB A;  3DVN V;  3N20 C;  3NVW A;  1QOG A;  1EU3 A;  3D32 A;  4OHJ A;  1HZ6 A;  2EKE C;  1WGR A;  3Q6B A;  3RFZ B;  3P4S B;  2GBN A;  2KDM A;  2JQR B;  3EHV A;  1M4V A;  3QX1 A;  1NI2 A;  4C00 A;  2DZK A;  5D3I B;  2NPT A;  4WQM A;  3ZNZ B;  3MC9 A;  2WNM A;  2L0F A;  1TJE A;  2K8C A;  4WIP A;  3MTN B;  4EEW A;  1L6V A;  2KDE B;  1YN4 A;  1P7F A;  3AEG B;  1P7E A;  3WAL A;  1V1P A;  3AU4 A;  3WAM A;  2D3C A;  1WGG A;  4DHJ B;  1D4B A;  1L0X B;  3A4R A;  3Q3O C;  3AU5 A;  4K3B A;  2WU2 B;  2V4L A;  1C4P A;  1OEY A;  2PE9 A;  1XLN A;  4L1B A;  4WAF A;  2GLS A;  3BK1 A;  1S3S G;  3VQI A;  1I4H A;  1N61 A;  1XF5 L;  2N1W A;  2UU7 A;  3VUX A;  1E8W A;  1E7P B;  2XK5 B;  3CMM B;  4MM3 A;  2KTR A;  2Y5C A;  3B2F A;  4GDK B;  1TZO A;  2DLB A;  3GP7 A;  3H8H A;  1UF0 A;  5L83 A;  4NQK E;  4KKJ A;  2AL3 A;  4ASW C;  2MBH A;  3AM9 A;  1RM6 C;  1KLV A;  3VTU A;  2KQS A;  4B0E A;  4C7Z A;  1NVI D;  3HM3 A;  4IG7 B;  1R4M B;  3DBS A;  1ZXI A;  2NBW B;  2PVG C;  4M00 A;  2V0G A;  1WY8 A;  1N62 A;  4ZHP A;  1WXM A;  2WDR B;  4LDT B;  4WJQ A;  3TMP B;  1N60 A;  3IAS 1;  4PK1 A;  4LK0 M;  2ZW1 A;  1J0G A;  4FJZ A;  1FXI A;  4E71 A;  2RGF A;  3AMZ A;  4C4V A;  2MJD A;  4FHJ A;  1JW9 D;  2QC8 A;  3M63 B;  1C9F A;  2D07 B;  2KX0 A;  1XLP A;  1SE3 A;  3L08 A;  2Q5W D;  3GE8 C;  3URY A;  4GSW A;  4GDK A;  4NAW B;  2IZV B;  2J0K A;  2J7Q B;  3AE6 B;  3ETR A;  1UWX A;  2N9L A;  2ZPY A;  1JWA D;  5IO9 A;  4HDO A;  2WXO A;  3IXS A;  2DNF A;  2KAN A;  1QOB A;  1AWD A;  5TSS A;  2G4S A;  1WWT A;  3T9L A;  2KX3 A;  1IGD A;  5CX3 A;  2J4X A;  3SDL C;  1ESF A;  2WXI A;  1XEE A;  3AH7 A;  3HVZ A;  1V86 A;  3A9K B;  2QCZ A;  2NTS A;  3QAQ A;  4GU2 A;  4GGQ A;  3DOW A;  1J7A A;  1WYW B;  3ZGZ A;  2BBC A;  3MP9 A;  3Q3F A;  3H7P B;  4I6P A;  2KOX A;  1BUI C;  4Q2J A;  3IFW B;  1YNT E;  2KQ7 A;  2WP9 B;  2EEL A;  1T0Q C;  1MJD A;  2JU6 X;  2KN5 A;  3P4P B;  2LJ5 A;  2DAJ A;  1VZ7 A;  3TEY A;  4W9D A;  5JHA A;  3GOE A;  2FCN A;  3BWU D;  3UQA A;  2REX A;  1C79 A;  5H92 C;  2NTT A;  2LUE A;  1CK1 A;  2GI9 A;  2QEJ C;  1YN5 A;  3NOB A;  4MDK E;  1TS3 A;  3K9P B;  4KKI A;  2SEB D;  1XLO A;  1YJI A;  4W9F A;  1LGR A;  1FD6 A;  4HJG E;  1KJT A;  5JH5 C;  4IWP A;  3L54 A;  2KVZ A;  4MGK E;  2VH2 A;  1H4R A;  5FR6 A;  2BB6 A;  2GMI C;  1RLF A;  1WXV A;  1I42 A;  3RNF C;  2KNB A;  2L83 A;  3V05 A;  4BKG A;  1N63 A;  4HCP B;  1V1P B;  1VR9 A;  1WR1 A;  4A90 A;  3PSE B;  5LLI A;  1WGH A;  4NAM A;  5L95 C;  1T0S C;  1LM8 B;  1FO4 A;  1WXA A;  1ZE3 D;  2KO3 A;  4HWI B;  3EUB 2;  1OQY A;  4FJV B;  3CSF A;  3AE5 B;  2LRW A;  1OEY J;  2PW9 A;  2CS4 A;  1PFD A;  3MJW A;  4M8M A;  4BAX A;  1D6E C;  1XCT L;  4DXG A;  4HPL B;  3APD A;  4NAW A;  2HDE A;  5C23 A;  2W3S A;  4BKS D;  2J52 A;  3KW5 B;  3U7D A;  1I4R A;  5IAA C;  3RNB C;  2LGY A;  3VTV A;  1Y56 A;  5EE3 A;  1Y8R C;  1JWB D;  3DDC B;  1E8Z A;  1VZ8 A;  2OED A;  4FXC A;  3Q3N C;  2D10 A;  3UQB A;  2XEW A;  5FKA C;  2L05 A;  4C7Y A;  3DBL I;  4NQL B;  1EO6 A;  2QJL A;  2O6V A;  1GC7 A;  2MP2 A;  4QAY A;  1JRO A;  4RF0 A;  2K5P A;  4US9 A;  3ECI A;  3PLV A;  3B1L X;  3NHE B;  5BMH A;  5HHD G;  1QQR A;  1WGD A;  5J2R A;  1IBX B;  3PV1 A;  2LD9 A;  2JPH A;  3N30 A;  2KMM A;  2W54 A;  1J8C A;  1P1A A;  4KX6 B;  4KGR A;  1LO5 D;  5DPW A;  1WJ6 A;  2B3A A;  3E56 A;  4ZRQ A;  2K9X A;  3BII D;  4P1C C;  1WFY A;  1CQV A;  3MC0 B;  1C4C A;  3VDZ A;  4CQN A;  2W9N A;  3EFU A;  3PHW B;  4XC2 A;  2INN E;  1V2Y A;  1SF0 A;  4KDI C;  4WAA A;  4FJY A;  3AB5 A;  4JL9 A;  2AX5 A;  3W2D A;  5D3D A;  2V4I B;  1EU4 A;  2RR9 A;  1PDX A;  1LFD A;  4LNF A;  4US8 A;  2ZCB A;  1SBB B;  2MHJ A;  3Q8F A;  2MBQ A;  3TSS A;  2BS4 B;  1QZE A;  3Q3M C;  4KIK B;  5EDS A;  2FCM A;  2SAK A;  3Q8B A;  3BK2 A;  2WU5 B;  2HTM E;  4PT5 A;  4AOF A;  1NBF C;  2M19 A;  1AYF A;  1K8R B;  4M8N A;  3PRP B;  2NPT B;  4GN1 A;  4XZ4 A;  3ZDM C;  1T5X D;  2LGX A;  1SE4 A;  2FUG 1;  2W3R A;  5CHW A;  5G55 A;  3RZW C;  3RNA C;  1EUV B;  3L4P A;  1XXG A;  1FCC C;  3KUZ A;  4RH6 A;  4RFB A;  1TS5 A;  1N5W A;  1RFA A;  4J3O D;  2RDG A;  4MEM A;  4IUM B;  2VRR B;  1KTK A;  4PS7 A;  2N7D A;  3RNE C;  2WXH A;  2KD0 A;  3W1S A;  2KDF B;  2BTE A;  2ZW0 A;  2MX2 A;  3ML8 A;  4AWJ A;  2VZK D;  1J7C A;  1K51 A;  3ZTC A;  3QIJ A;  1E7V A;  2AWT A;  4EZJ A;  1F2R C;  2RSU A;  1YMH E;  1MG8 A;  4K7S A;  1KH0 A;  4IC7 B;  1FPY A;  5MPO A;  3HUI A;  4C80 A;  4OW0 A;  1JWM D;  2J0M A;  1L4D B;  3V3X A;  3KWL A;  1KM7 A;  4WJO A;  3R8B A;  2ZCC A;  2ASQ A;  4KGS A;  4OVU A;  4IOI E;  4ICU A;  2MJE A;  4K7W A;  1XQQ A;  2HTH A;  2Z59 B;  2NCN A;  3GE3 C;  1WMH A;  2X8X X;  4TMA B;  1LQB A;  4K3C A;  1GG3 A;  1TZ1 A;  3QC8 B;  3UIO B;  2I1J A;  5G2N A;  4ZDV A;  1QF6 A;  1IBX A;  2WYQ A;  3AE2 B;  1HA5 A;  1JRP A;  1MG4 A;  4IM3 A;  4B9K A;  4A8X C;  1WM2 A;  5BYS A;  4K1R B;  4AJW A;  3DBH I;  3WIM A;  2R2O A;  4A3P A;  3OAW A;  2K6D B;  2K25 A;  4A3O A;  3DVG X;  5BO4 B;  2MW5 A;  2D11 A;  2IY0 B;  1L2N A;  1BXT A;  4F1S A;  2NBU A;  1FFU A;  4BFR A;  1C76 A;  2M56 B;  1P0R A;  4G50 A;  3VUW A;  1WX9 A;  5IA7 A;  2ZVN A;  4URK A;  3KWV A;  1R4N B;  4NY0 A;  3SD5 A;  4F8C B;  3P2B A;  5D2M B;  3Q8A A;  1FNU A;  2LRU A;  2BGF A;  2R61 A;  3DBR B;  3S2A A;  1WM3 A;  4TUU A;  1L4Z B;  1YJJ A;  3SHQ A;  2LGI A;  3JYU A;  2D3B A;  2KJ6 A;  3L0W B;  4MEL A;  1X1M A;  4GDL B;  3OLM D;  2O2V A;  3JW0 X;  4E74 A;  2JZP A;  2WX1 A;  2VH1 A;  4YL8 A;  1ROE A;  3I9V 1;  5GMV A;  3VRB B;  2KXJ A;  3W5V B;  2CR5 A;  2G45 B;  3UGB B;  2MJ3 A;  1V80 A;  1Q5W B;  2JX5 A;  1DYQ A;  1F2R I;  5EE1 A;  4LCD E;  3DBR I;  3FC4 A;  2EMS A;  3ZNI D;  5JZE B;  3NZS A;  3LXF A;  1R4N I;  2O2V B;  1HTQ A;  4NZL B;  3W1S C;  2ZPN A;  2OJW A;  2AL6 A;  1OGW A;  2HD5 B;  4FA6 A;  3VVW B;  2DZJ A;  2A4Z A;  1GAQ B;  4FLH A;  2CHZ A;  4NJ6 A;  5AZH A;  4CHK A;  1QKZ A;  1WGK A;  4AJY B;  3PZ7 A;  2KDI A;  3DBH B;  4BBN F;  4GOC A;  4XWW A;  2LAS A;  1D5Z C;  1E8X A;  2KLC A;  3PPA A;  4YWG G;  5TR5 A;  2B76 B;  5AZG A;  2WXR A;  4IDI A;  1NYQ A;  2DHZ A;  1FIQ A;  5I4D A;  1C77 A;  2K8H A;  3NUH B;  3NY5 A;  1YX5 B;  3U30 A;  4R3D A;  4DBG A;  1IP9 A;  4N58 A;  1NYR A;  2DBY A;  1VZ6 A;  3A4S C;  5H8Y E;  1FM0 D;  3NRZ A;  1WX8 A;  2XNA C;  4HRS A;  2KFK A;  3GB1 A;  1WJN A;  3PZD A;  2JXT A;  1E7U A;  5J17 A;  3OJ4 B;  1GUA B;  3VTW A;  1UBI A;  2BYE A;  3ZJT A;  3QQ8 B;  1FNW A;  2MQJ A;  1HEZ E;  2FBW B;  1GNU A;  4ZRJ A;  4ZRP A;  4XDD A;  1UGM A;  4BVU C;  1WRD B;  2L7R A;  3AE1 B;  3W1Y A;  1F77 A;  1V8C A;  2WXP A;  2KHW B;  1HQR D;  1XT9 B;  1HZ5 A;  3AED B;  2KWV B;  3AV8 A;  3ZJV A;  3ZRC A;  3MFG A;  2CKH B;  2WXN A;  3JSV A;  2Z0E B;  3U52 E;  1JWS D;  4BOZ B;  1T3Q A;  5E6P A;  1FEH A;  2WXQ A;  1NDD A;  2LVO A;  4YTM B;  1ENF A;  1TIF A;  3TL5 A;  3RT3 B;  1I35 A;  1P3Q U;  3B08 A;  2MCN B;  2CJN A;  2MP2 B;  4GLS C;  3ZNH B;  2JXX A;  1WR6 E;  1PGA A;  2IO2 B;  1F9J A;  2PMV A;  3AE7 B;  2IDY A;  2ZZP B;  1EWY C;  3VR8 B;  4RGM A;  2E6X A;  3PRZ A;  5IKC M;  4I6N B;  1SJH D;  2JSV X;  3SEB A;  4EZL A;  1FNV A;  4HPP A;  2D5G A;  4C4V B;  3RZF A;  3LJ3 A;  2G9H D;  1DGJ A;  4YTP B;  4ANW A;  2J0J A;  3HK0 A;  2GBJ A;  4F7Z A;  1Q1O A;  1CJE A;  2JT4 B;  1D5X C;  3ZIM A;  2ZVO A;  3BIN A;  3PRM B;  1V81 A;  4W9H A;  2K0P A;  4N9F 4;  4GXB A;  4M02 A;  1SE9 A;  3U4E G;  2BT6 A;  3PGE A;  2BKF A;  2WDT B;  1KRH A;  2KLG A;  1DOI A;  3DQV A;  2KC2 A;  4ARI A;  3DVN U;  2IO0 B;  2R2Q A;  3EEC A;  2NBV B;  3LYY A;  2DEN B;  2QIL A;  4ARC A;  2Z0D B;  4RNA A;  4WWN A;  4J6I A;  5FR3 A;  1XCQ L;  2MEK A;  3TEZ A;  1MHH E;  4ICV A;  2KJR A;  4S0R A;  2RDH A;  3ZLZ A;  2KAJ A;  3H6N A;  2H88 B;  1TKG A;  1QOF A;  4M0W B;  3A1Q A;  3JVZ X;  2ZJD A;  3PRE A;  2BYV E;  2N9E B;  1GB4 A;  1JQ4 A;  3DBL B;  5C1Z A;  2N9P C;  2LHE A;  3NVY A;  3ML9 A;  3L10 B;  4L2Y A;  4YSY B;  4B95 A;  4YSZ B;  2MA9 B;  3FKY A;  1SIF A;  5IN7 A;  2MLB A;  4NJ7 A;  4EOY A;  2I2Y A;  4TV3 A;  3U2S C;  2ZNV B;  5AUI A;  2KFK B;  3VR9 B;  4B0M A;  4P7I A;  4WWO A;  2KC1 A;  1A70 A; 
#chains in the Genus database with same CATH homology
 1HZ6 A;  3O13 A;  4RH6 A;  4RFB A;  4HKQ A;  3TUO A;  1TS5 A;  2LFI A;  2IGD A;  1N5W A;  3RFZ B;  4J3O D;  3P4S B;  2RDG A;  3CIR B;  4MH8 A;  2KDM A;  3MJ5 A;  1KTK A;  5AUK A;  2JQR B;  1M4V A;  1E6E B;  5D3I B;  2WXH A;  4YT0 B;  3W1S A;  4M0W A;  4WQM A;  4RGT A;  2V3N A;  1SXT A;  2BTE A;  2ZW0 A;  2WNM A;  4P6V F;  2QMT A;  1TJE A;  2IGG A;  2VZK D;  4WIP A;  1J7C A;  4EE2 A;  4AS1 A;  1K51 A;  1XLQ A;  5BYR A;  1L6V A;  3ZQ4 A;  5HI1 A;  4RCO A;  1YN4 A;  1F2R C;  1P7F A;  2BS3 B;  2KN4 A;  3AEG B;  2LEK A;  1P7E A;  1YMH E;  4TSS A;  1NEN B;  1V1P A;  1FCC C;  4D2K A;  2KQ4 X;  3AEF B;  2IPK D;  1KH0 A;  2CU3 A;  3ZYY X;  4LLG M;  3NVZ A;  5MPO A;  3HUI A;  1D4B A;  1L0X B;  4C80 A;  2WU2 B;  4OW0 A;  1JWM D;  3DWM A;  4ITK A;  1C4P A;  1WSP A;  2TSS A;  1XLN A;  1L4D B;  3V3X A;  3KWL A;  1K53 A;  4RGN A;  4L1B A;  4WAF A;  3BK1 A;  1DOY A;  2Y3A A;  3VQI A;  1I4H A;  1N61 A;  1TYG B;  3R8B A;  1XF5 L;  4REZ A;  1JAL A;  1E7P B;  4KGS A;  1YN3 A;  1TY0 A;  4IOI E;  1KFY B;  2Y5C A;  3B2F A;  2MJE A;  5C3J B;  1IUE A;  4GDK B;  1TZO A;  2DLB A;  3GP7 A;  1SIJ A;  3H8H A;  2Z8L A;  1QT9 A;  1F0Z A;  1PYW D;  2GB1 A;  4KKJ A;  4TMA B;  4JWS C;  2N0S B;  1TY2 A;  1TKE A;  2GRI A;  5BMG A;  1QIL A;  1FRR A;  2YEP F;  3AM9 A;  1RM6 C;  4HRO A;  1ZUD 2;  1QF6 A;  4B0E A;  1IBX A;  4C7Z A;  3AE2 B;  4H2A A;  3U7Z A;  1HA5 A;  1NVI D;  1JRP A;  1I4G A;  4A8X C;  5BYS A;  3NS1 A;  2XN9 C;  1ZXI A;  2PVG C;  2JYE A;  5LNK 1;  2RMM A;  2V0G A;  1N62 A;  2PVO D;  4ZHP A;  2WDR B;  1VLB A;  1I4X A;  3B9J A;  2IGH A;  4DXF A;  2LUM A;  3GS2 A;  1N60 A;  2BW2 A;  1BXT A;  3IAS 1;  1RWS A;  4LK0 M;  1FFU A;  1UGJ A;  4MT5 A;  1C76 A;  2M56 B;  2ZW1 A;  3FAH A;  3KQ4 A;  2Y5P A;  4USA A;  1FXI A;  3AMZ A;  1I7H A;  3NVV A;  3KWV A;  1MI0 A;  4MAC A;  2MJD A;  4WH4 A;  4JX1 C;  4RGO S;  1N5X A;  3P1M A;  3Q8A A;  2PLP A;  4DQO C;  3BYY B;  4OZB A;  2L32 A;  1FNU A;  1ET6 A;  1JW9 D;  2R61 A;  3T3O A;  2VZK B;  1C9F A;  1OFF A;  4RF1 A;  3HRD D;  1ZDV A;  1L4Z B;  1XLP A;  1YJJ A;  1SE3 A;  2LGI A;  3VRA B;  2Q5W D;  1ZDX A;  3I57 A;  3URY A;  3Q8E A;  1NI3 A;  2M0A A;  4NAW B;  4GDL B;  3AE6 B;  3ETR A;  1UWX A;  2N9L A;  3TEW A;  5BYQ A;  3SFE B;  1JWA D;  5HFY A;  1MPE A;  2QSD A;  2JZP A;  1SSN A;  2LMC A;  1R7S A;  2WXO A;  3IXS A;  2KWD A;  1QOB A;  1OQR A;  1AWD A;  1ROE A;  5TSS A;  3I9V 1;  3VRB B;  4OVZ A;  1FMA D;  4WWM A;  4JWU C;  3W5V B;  1WWT A;  4N59 A;  2DYO A;  1IGD A;  2J4X A;  1Q10 A;  2W55 A;  4A6Q A;  1ESF A;  2MJ3 A;  5D7G A;  4WUR A;  1L5P A;  2JX5 A;  3BVM A;  1DYQ A;  1F2R I;  2WXI A;  4AQ7 A;  1FCL A;  1XEE A;  5EE1 A;  3FC4 A;  4KGT A;  1EWC A;  5G5G A;  2WXL A;  5GXG B;  3AEE B;  1SB3 C;  1B9R A;  4A9A A;  3AH7 A;  3B2G A;  3HVZ A;  3LXF A;  1IGC A;  4NZL B;  3IT4 B;  1VJK A;  2CJO A;  2WXF A;  3OWE B;  1L0V B;  2NTS A;  4HEA 1;  1TS2 A;  4A55 A;  1GAQ B;  1AW7 A;  1J7A A;  1DOX A;  3ZGZ A;  2BBC A;  1B1Z A;  3MP9 A;  1YQ3 B;  1QKZ A;  3ZJU A;  1WGK A;  1WYG A;  4MM3 B;  3PZ7 A;  5E6J A;  3T3N A;  4O1N A;  1UWM A;  1BUI C;  4Q2J A;  4XWW A;  2AQ2 B;  1D5Z C;  1ZOY B;  1YNT E;  2WP9 B;  4YXD B;  2EEL A;  4YWG G;  2JU6 X;  2B76 B;  1T6B X;  2WXR A;  4IDI A;  1NYQ A;  2K3U A;  4TQ0 A;  5I4D A;  1FIQ A;  1C77 A;  3NUH B;  3P4P B;  1YQ4 B;  4R3D A;  4XDC A;  3C8Y A;  4N58 A;  1NYR A;  1VZ7 A;  3J9C A;  3Q8C A;  3TEY A;  2DBY A;  1VZ6 A;  1V97 A;  2IJ0 A;  1FRD A;  4N6E B;  5H8Y E;  3BWU D;  1AN8 A;  3SFD B;  1FM0 D;  3NRZ A;  3P42 A;  1C79 A;  2H89 B;  2XNA C;  4YTN B;  5H92 C;  3IT6 B;  3BVG A;  4HRS A;  2NTT A;  3GB1 A;  2ICI A;  1CK1 A;  1E10 A;  2GI9 A;  1UNS A;  2JXT A;  1PGX A;  3Q69 A;  2QEJ C;  1YN5 A;  3UI3 A;  1TS3 A;  1TKY A;  1KLU D;  4KKI A;  1ZXH A;  5T8I A;  2SEB D;  2LJI A;  1NEK B;  1XLO A;  1YJI A;  3ZJT A;  2PKO A;  1FD6 A;  1FNW A;  4HJG E;  2WDV B;  1HEZ E;  2PIA A;  3P4Q B;  2FBW B;  1SEB D;  3AEA B;  4ZRP A;  4XDD A;  3ABV B;  3KLS X;  3AE1 B;  2BB6 A;  2L1A A;  1F77 A;  1V8C A;  2WXP A;  3FIL B;  2X38 A;  3W5U B;  4HKZ E;  3R2T A;  1HQR D;  5JXV A;  2PTL A;  2L83 A;  1VDV A;  4XWT A;  1HZ5 A;  2INP E;  2MH7 A;  3AED B;  3V05 A;  1K52 A;  1N63 A;  3AV8 A;  1JCK B;  3ZJV A;  1V1P B;  2I38 A;  1VR9 A;  1BML C;  3MFG A;  4A90 A;  3SR6 A;  1J7B A;  3EGR A;  1V1O A;  2WXN A;  4NAM A;  3U52 E;  5BMI A;  1JWS D;  3NZ3 A;  1WRI A;  1EM7 A;  5HG2 A;  1T3Q A;  1FO4 A;  1HXY D;  1FEH A;  2WXQ A;  1ZE3 D;  3AE4 B;  4YTM B;  1ENF A;  3EUB 2;  2L52 A;  4C56 C;  3AE5 B;  4ZOH C;  2PW9 A;  1PFD A;  1GPX A;  2CJN A;  3P4R B;  4GLS C;  1QLB B;  5FK9 C;  1CZP A;  1D6E C;  1PGA A;  1XCT L;  4DXG A;  2PMV A;  1STE A;  3W9C B;  3L4P A;  1D5M C;  3AE7 B;  2HDE A;  2IDY A;  1L6U A;  1EWY C;  2W3S A;  3VR8 B;  4RGM A;  1KLG D;  2YEP B;  2E6X A;  2J52 A;  2WXG A;  1SJH D;  2JSV X;  2E3T A;  3SEB A;  1GOZ A;  1I4R A;  3AEB B;  1FNV A;  4IKG A;  2DYM A;  2D5G A;  2WXK A;  3CWI A;  3AE3 B;  1Y56 A;  2G9H D;  3BYT B;  5EE3 A;  1I4P A;  1DGJ A;  1JWB D;  4YTP B;  1ZP0 B;  1OQQ A;  1VZ8 A;  4P16 A;  3TEX A;  2OED A;  4FXC A;  2K22 A;  5FKA C;  4C7Y A;  1CJE A;  1FFV A;  1ET9 A;  2V3P A;  4JPS A;  1KF6 B;  2QJL A;  1D5X C;  3BVZ A;  3LB8 C;  1JRO A;  4RF0 A;  2K5P A;  2N7J A;  1GB1 A;  3DWG C;  2K0P A;  2EKI A;  5EE9 A;  4US9 A;  2BYT A;  1PUT A;  1JML A;  3U4E G;  1RYJ A;  2AQ1 B;  2BT6 A;  4OZA A;  5BMH A;  5HHD G;  1QQR A;  1IBX B;  2WXM A;  3AN1 A;  1KRH A;  4LTU A;  1DOI A;  2KMM A;  2KAC A;  2W54 A;  4KX6 B;  4KGR A;  1LO5 D;  4ARI A;  1JWU D;  2JYT A;  1MHX A;  5C2T B;  3E56 A;  1E0Z A;  2BS2 B;  2WDQ B;  1ACC A;  2DWQ A;  2K9X A;  1WXQ A;  3BII D;  3LYY A;  2ONQ A;  2QIL A;  1C4A A;  1C78 A;  4ZRQ A;  4OZC A;  4ZYS A;  4RNA A;  4ARC A;  1MVK A;  4TQ1 A;  2WQY B;  4UDU C;  1CQV A;  1TS4 A;  1XCQ L;  2ACZ B;  2MEK A;  3MC0 B;  5FR3 A;  1C4C A;  1MHH E;  3TEZ A;  2RDH A;  4CQN A;  3BZD B;  2KAJ A;  3AEC B;  1K50 A;  2INN E;  1SF0 A;  2WLB A;  2H88 B;  1FXA A;  2WS3 B;  4L23 A;  3WCQ A;  3R2I A;  1TKG A;  3AB5 A;  1QOF A;  2AX5 A;  2J53 A;  3RPF C;  3PZ8 A;  3N9Y C;  2W82 A;  3W2D A;  5D3D A;  5G5H A;  2V4I B;  1EU4 A;  4XE0 A;  1PDX A;  2JWU A;  1GB4 A;  4US8 A;  2J42 A;  3EA6 A;  3PO0 A;  1SBB B;  3Q8F A;  1JQ4 A;  1XO3 A;  2LHD A;  3IAM 1;  3TSS A;  1VRA B;  2BS4 B;  2FE8 A;  2OHF A;  2LHE A;  3NVY A;  2QIE B;  2G1E A;  1QOA A;  4L2Y A;  3E9S A;  4ZHO A;  2AQ3 B;  4YSY B;  2SAK A;  4NJC A;  4YSZ B;  3Q8B A;  3BK2 A;  1SJE D;  2HTM E;  2WU5 B;  2WXJ A;  4PT5 A;  2M19 A;  3AE9 B;  1I4Q A;  1AYF A;  4YSX B;  3P63 A;  5EE0 A;  2I2Y A;  2RPV A;  2ON8 A;  1T5X D;  1ZPS A;  1L0Y B;  1E9M A;  2BB5 A;  1SE4 A;  2NMQ A;  2FUG 1;  3U2S C;  2W3R A;  3HVD A;  1UUP A;  3MHZ A;  5AUI A;  3FIL A;  3VR9 B;  4B0M A;  1SE2 A;  1PGB A;  2N9K A;  1QOG A;  3NVW A;  1EU3 A;  4JE3 B;  3AE8 B;  1A70 A;  1RFK A;  1XXG A;  4OHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...