1FCLA

Delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
b'TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fclA00
1MVKA 4KGRA 1JMLA 4KGSA 4MACA 4OZBA 1GB1A 2IGDA 5BMIA 1K50A 1EM7A 5BMHA 2LHDA 5BMGA 1MI0A 1FCLA 5JXVA 3FILB 2GB1A 2I2YA 2KQ4X 2PLPA 1YNTE 4HJGE 2NMQA 1PGXA 1P7FA 2I38A 2JWUA 2J53A 1C9FA 2QSDA 2KWDA 2N9KA 2ZW1A 4IOIE 3GB1A 3MP9A 1PGAA 4GLSC 2K0PA 2ON8A 2RPVA 5HG2A 4KGTA 4WH4A 2LHEA 1IGCA 2RMMA 1K53A 1P7EA 1GB4A 1IGDA 2GI9A 1XCQL 2PTLA 3UI3A 1IBXB 4HKZE 3FILA 1MHHE 2J52A 1F2RC 1HEZE 2JZPA 1FCCC 1QKZA 5HI1A 1KH0A 2PW9A 1ZXHA 2LUMA 4D2KA 1K51A 1MPEA 2IGHA 2JSVX 2N9LA 1YMHE 1UWXA 5HFYA 2ZW0A 1K52A 2JU6X 4OZCA 2QMTA 1D4BA 2KACA 1HZ5A 2N7JA 1PGBA 2LGIA 2JXTA 1XCTL 1F2RI 1Q10A 1XF5L 2IGGA 2KDMA 4OZAA 2OEDA 4IKGA 1MHXA 3V3XA 2ONQA 1HZ6A 5HHDG 1FD6A 2KN4A 1IBXA 2EELA
chains in the Genus database with same CATH superfamily
3Q2AC 2W9NA 5IA7A 2KDIA 5AZFA 3ETRA 1D5ZC 2NTSA 2DZJA 1XO3A 1NBFC 4XWTA 5JHAA 4KZCA 3AULA 1YNTE 2C7HA 2PE6B 3NZ3A 5DCNA 2JUOA 3IVFA 4M8NA 2D11A 4UDUC 3UQBA 3OJ3A 1X1MA 4FLHA 3OWEB 3W5VB 1EO6A 2QJLA 3RULA 3UQAA 4YWGG 1VCBA 3MC8A 4A20A 2MJDA 1QOBA 2RDHA 4HRSA 4FULA 3ZLZA 2DHZA 3TIXA 3ZGZA 2AX5A 2CJNA 5HI1A 2BQQA 4IWOA 3APFA 3R7RA 4KDLB 3AEDB 2KMMA 1E6EB 4PYZA 2LXCA 1YMHE 2FCQA 1I4QA 2WU5B 1U4AA 2G45B 4CO7A 3A1QB 3QX1A 3AV8A 3W1YA 1SE3A 1V5TA 1WSPA 1VDVA 4DHZB 2J0MA 2QMTA 2UWQA 5IAAC 1T0RC 3CSFA 1XLNA 2MSED 3W1SA 1C4CA 2MQJA 3URYA 1QOGA 3AU5A 5AZGA 4XDCA 4ZRIA 4MEMA 2KKCA 4TSSA 3NVVA 4QAYA 2JZ3B 2HDEA 2IO0B 2LD9A 4MGIE 1DOIA 1ACCA 2Q5WD 3AE5B 2RPQA 2WX0A 1GNUA 4OZBA 2M56B 3PREA 3P1MA 3MHZA 2CKHB 2I2YA 2GBRA 3GOEA 1HTQA 3TEYA 4NQLB 3MFGA 2M0XA 1VRAB 3ZJTA 1SE9A 3KUZA 2VZKD 1WY8A 5D94A 4KKIA 4TV3A 3GE8C 4MGKE 3A9JB 3GB1A 3DDCB 1DYQA 1UGJA 2WQYB 2C7NB 3ONSA 1AWDA 3P4PB 2J42A 4HLEA 1WRDB 3DVNV 2JRIB 1WR6E 3MJWA 3PVLA 1FPYA 2AQ3B 4MM3B 3PHWB 4W9HA 4HKZE 5E6NA 4JLCA 1T3QA 3ZYYX 4KSLC 1NENB 3JW0X 4I6PA 3IT6B 2MP2A 4GDKA 2Y5CA 3TMPB 4US9A 2FBWB 2ZEQA 2KMAA 2LVOA 3TEZA 2WXLA 5TR5A 1QF6A 2WWZA 5IP4D 3BVMA 2KDFB 4LJOB 2L1AA 4YTNB 5J2RA 4REZA 1L6UA 1N6ZA 1XLPA 2KD0A 3I9V1 4K3BA 4BKGA 2N9PC 2KC1A 2MBHA 1Z5SB 2JRHA 2REXA 3KYDD 3VVWB 3WANA 1NDDA 4S17A 1CQVA 4B0EA 2ZZPB 2PE9A 3LYYA 2AEHA 3EFUA 4A9AA 2IY0B 1IBXA 2DZIA 2R2OA 1VR9A 2YEPF 3ZW3A 3BINA 4P6VF 2D3CA 2MBQA 1P1AA 1A5RA 4HPLB 2KOXA 2IDYA 1EM7A 4FHJA 5JXVA 2AQ1B 4AQ7A 1PFDA 2D3AA 3AE3B 4HJGE 2N7DA 2MBBB 1JWSD 1KF6B 2LASA 3MC9A 2V4LA 4MGYE 1FNUA 2FIDA 4L23A 1N5XA 5J17A 3I57A 3Q8FA 1Y56A 1GPXA 2QDFA 2ZPYA 4GDLB 2RMMA 5D3DA 5H92C 1IPGA 1CK1A 3WAOA 3O65B 1Y8RC 4NJCA 2LGSA 3RT3B 3QK0A 4MSMB 1XXGA 4LK0M 2J4XA 3CF6E 2L0FA 4HKQA 3AE4B 1E90A 1KH0A 1R4MI 2LZ6A 2K8BA 5J18A 3WALA 2XK5A 4LJPB 2IGHA 4NY0A 4TMAB 2KTRB 1EU3A 4F1SA 2ZPNA 1CJEA 1N61A 2BS3B 2MLBA 2N9EB 1R4MB 1SBBB 4RCOA 3UGBB 2MH7A 1V80A 3NRZA 3PS6A 1ZKHA 1L6VA 4ANVA 4BOSC 3OLMD 3QWZB 3H1UA 2LWPA 2BYEA 5G5HA 1V1PB 2WDQB 3UIPB 4KGRA 1JMLA 4LNKA 3AB5A 2WLBA 2QIEB 1JROA 1TKGA 2JX5A 2M8SA 5FR6A 5BMHA 2BKRB 5AUIA 2OHFA 1A70A 1TKEA 1M94A 1D6EC 4EUTA 2WYQA 1WX9A 4HEA1 1YJ1A 2ASQA 3DBLB 3VH3B 1TT5B 2C9WB 4JWUC 3VXWA 4WWOA 2M4NA 1ISNA 1KLVA 1FXIA 2KWVB 3PT2B 1FNVA 1K53A 4MJSA 1P9DU 1F52A 1I4XA 2CHWA 3AEGB 4B6WA 3P2BA 1JWUD 2BW2A 3BVZA 5D3IB 4W9FA 5CX3A 1KRHA 3IBEA 3SFDB 2NVUI 2KZRA 2BYTA 4GIVA 2YEPB 4M02A 2D3BA 3U4EG 1L4ZB 2JF5A 2UYZB 4D2KA 3O13A 4XWWA 2AQ2B 4N58A 4GMVA 1UWXA 1SF0A 2EMTA 3TSSA 1DOYA 4WQMA 1KLUD 1ZOYB 2PVGC 4GOCA 3PHXB 5IKCM 3W1SC 3TBLD 2KACA 2X38A 2N0SB 3K9PB 4NJ6A 2JXTA 3H7PA 1WGGA 2DAJA 2HTME 4RF1A 5JZEB 1FRDA 4FJVB 2M1MA 5HHDG 5H8YE 1D5MC 2MP2B 1TBEA 3U52E 4EZKA 1SJHD 3VTUA 2IJ0A 2W3SA 1GB1A 4JX1C 1DOXA 3R66C 5BMIA 4YSYB 4G0NB 2RDBC 4W9IA 2NS5A 2C5LC 2I1KA 4NAMA 1FMAD 1PGXA 3HIZA 4TQ0A 2I38A 3E56A 3U7DA 4CHKA 2NPTB 1QT9A 1JW9D 1PGAA 1MG4A 1QOAA 2L8JA 5HG2A 2IBIB 3RPFC 4JQWC 2G9HD 3JSVA 2KLCA 3X23A 3EA6A 4WWNA 3RNFC 3Q3OC 1XCQL 2PTLA 2XEWA 3DBRB 3P4RB 1IBXB 3AM9A 4CQNA 1LO5D 3I3TB 2KFJA 2PJHA 1WXMA 1VZ7A 2WXGA 4MGZE 1G6JA 4M8MA 5CHWA 3TL5A 4LNFA 3ZQ4A 4K1RB 1K51A 3PRZA 1PUTA 1T0QC 5FKAC 3TUOA 3NVYA 3DCGA 2ZW0A 3ZNGC 3E9SA 2CS4A 2ZCBA 3PSEB 2SAKA 1L2NA 2PKOA 4KV2A 3SFEB 3ZUNA 2FAZA 4YXDB 2NBWB 3N3KB 4LNIA 4EKUA 1K8RB 2GLSA 1PQSA 1RWSA 2IGGA 2O6VA 3WAPA 3PZDA 4DDGD 2KXJA 5KHOA 2KNBA 4FADA 4NPNA 2MRPA 3N1YC 3N30A 2KLGA 4ACFA 3HRDD 1HTOA 1YN5A 2WXQA 1AN8A 4WURA 2XK5B 3DHHC 2BYFA 4KSKC 4MSQB 5AUKA 3P42A 1YQBA 2JWZA 1PDXA 3IG3A 1V8CA 1GUAB 1VJKA 2GB1A 3L4PA 1C3TA 1ZW7A 3VUYA 2FCMA 2LI5A 4HXDA 1T0YA 2Z59B 2NMQA 2B3AA 2LRWA 4PYUA 2ZNVC 2N1VA 2QSDA 4N59A 4IOIE 4RH6A 4OVZA 1V86A 3C19A 5JH5C 4M0WA 1OQRA 1WGKA 2WDRB 1T5XD 2OJWA 4US8A 1EU4A 1ESFA 2GBKA 3DHGC 5EDSA 1BXTA 1DGJA 2DYOA 1TGZB 2K6QA 4I6NB 3AE1B 1L7YA 1WXQA 2PEAA 1C78A 4YL8A 1UWMA 4TUUA 2FUG1 3ZKJC 1V1OA 4RNAA 2BWES 4PS8A 4E3CA 1N5WA 4Q2JA 2V1YA 2BB5A 3A9KA 1D3ZA 4USAA 3DWMA 3NJTA 2DAFA 4EEWA 2Z0EB 4XC2A 5TSSA 2NR2A 4CYEA 4GSWA 2G4SA 3RYTA 3OJ4B 5GMVA 4BKSA 1WZ3A 2M17A 2YVCA 4KKJA 4TKNA 3QJZA 3M3JA 3RZWC 3NOBA 2DYBA 3L16A 4KIKA 2KQSA 1P3QU 3W9CB 4A6QA 2QILA 1UUPA 2K6DB 3DPDA 3EC8A 4HROA 1FO4A 4BKTA 3FAHA 1YJIA 1WXAA 4HWIB 3FILB 3TCAA 2K25A 1I7HA 2BS4B 4K7WA 4DQOC 3H7SA 3DOWA 1E5WA 2NBVB 2KANA 1E7UA 1TZ1A 3QCAA 2ZW1A 3SEBA 1IGCA 3QHTA 2K22A 4YSZB 5I4DA 4DXGA 3NHEB 3IAM1 2WHIA 2QHOA 2W55A 3SD5A 3ZTDA 3PLVA 4XZ4A 2PMVA 2ZJDA 1S3SG 3VH4B 1ZGUB 1FEHA 4ZRQA 2I1JA 1NI2A 1TS5A 2JY6A 1WIAA 4LLGM 1WGRA 3T3NA 2JSVX 4GGQA 4GB9A 1TIFA 3ZRFA 2IZVB 1F9JA 2KFKA 3IT4B 2VH1A 1WX8A 3KQ4A 2L83A 4BBNC 1EWYC 1ET6A 2CU3A 4DBGA 2JYTA 4HDQA 3RNAC 3HM6X 4II2B 3DHIC 3V6CB 3BYYB 4IWPA 1Q10A 1LM8B 3CSTA 4AOFA 2A5UA 3SR6A 3N32A 2LGXA 4IC7B 5IO9A 1JRUA 1B9RA 4OHJA 2LJ5A 3B9JA 5AZHA 2KWCA 4IW0A 2G4DB 2D2QA 1ROEA 4B95A 1MI0A 3MC0B 1L5PA 1GOZA 5D6JB 4ZHPA 1YOVB 3LB8C 4LNNA 5FK9C 1JALA 4F8CB 3LDZE 4KDIC 2KDBA 2MEKA 3OAWA 4MH0E 1C9FA 1KJTA 2DNFA 4EOYA 2MX2A 1F77A 1FRRA 4WWPA 1TKYA 1UF0A 2KO3A 2W54A 4K7SA 2BB6A 1WXVA 3HHMA 2JYEA 2MBOA 4AS1A 1OGWA 1KOTA 3RNGC 3V62A 2KVRA 3KWLA 4YTPB 4URKA 4NAWA 3ZRCA 5CTRC 2NBUA 1FM0D 2C7MB 3AEFB 1P98A 3R3MA 1WF9A 4R3DA 4A8XC 1QOFA 4IDIA 1GG3A 3KWVA 1CZPA 4ZYSA 3KYCD 2WU2B 3WCQA 4E74A 3UF8A 2D10A 2SEBD 3AE9B 1XF5L 3GP7A 2K1FA 5BO4B 2HTHA 5D2MB 2LXAA 1FD6A 4DHJD 2M0AA 4ZYNA 3U2SC 4DHZE 1SB3C 1NI3A 2BWFA 4EFOA 1EF5A 4ANWA 4KGSA 4MACA 2D07B 3DWGC 3BIID 5LNK1 3EGRA 1HQRD 5EE3A 4MH8A 3A9KB 4EE2A 3DVGX 3H8HA 3JVZX 3NG0A 4O1NA 3DQVA 1TY2A 2M19A 1WMHA 2GRIA 4RMAA 1YQ3B 3VR8B 2KMCA 4ZRPA 3H6NA 1I42A 2RPVA 3PLUA 1JCKB 1YN3A 2LHEA 1VZ8A 1AYFA 1H8CA 3R2TA 2QEJC 3KVFB 2BT6A 2J52A 4PS3A 4W9DA 3PRMB 1GAQB 1TS4A 1ZDXA 4C56C 3ZNZB 4C7YA 3N20C 4BZAA 2MW5A 1UBIA 1TY0A 3Q8AA 3RNCC 2ZVOA 4P7IA 2XNAC 5EE9A 3U7ZA 5GXGB 1Q0WB 1L4DB 4WJOA 2LGDA 1WJ4A 2KJHB 3VDZA 2K39A 2WS3B 4DK5A 4BOZB 4S0RA 2AL3A 1D4BA 3V60A 1OQYA 1J7CA 4K7UA 2K9XA 1FFVA 2WXNA 4ITKA 5C1ZA 3TEXA 3AN1A 3V3XA 1WRIA 4WAFA 2IO3B 2WP9B 1E8YA 1V49A 3AEBB 1WWTA 4X57B 2D5GA 1SEBD 4DXFA 4DDID 4C80A 2KYWA 1UGMA 4ZOHC 1I35A 2X8XX 2L00B 2HJ1A 2Z0DB 5BMGA 2DWQA 2GOWA 1XLOA 4ZRKA 2JQRB 1MJDA 3HK0A 4FXCA 4LNOA 4WIPA 2FE8A 3ZJUA 4C7ZA 2ZVNA 1VLBA 4XDDA 4GDKB 1NYRA 5KHQA 4FJZA 1SXTA 3RUIB 1SIJA 2RD0A 2KTFA 3PZ8A 1P0RA 1M4VA 1JRPA 2GI9A 3U8ZA 3Q14C 3T8MA 2MJEA 1WYGA 3L17A 1TZOA 2KJ6A 1F2RC 3I5JC 3L54A 3RNBC 3BVGA 4ICVA 2DZKA 1ZPSA 3TEWA 2ZCCA 3A9JA 1TTNA 4PK1A 4N9F4 2N9LA 4IWQA 2K8CA 2O2VA 1C4PA 4OVUA 3ZXRA 3X0WA 4GU2A 3ENEA 2O6VD 4OZCA 4XE0A 3IAS1 2E3TA 2WXIA 4MM3A 2EMSA 3CWIA 3BK2A 2WDVB 2QC8A 3VUWA 4HCPB 3B08A 3BK1A 2J7QB 1TS2A 3RD2A 2WXHA 4BBNF 2LUEA 3RI7C 2RDGA 4OZAA 3ZVVA 3KW5B 5D7GA 2BVCA 1MHXA 1LFDA 3PZ7A 1J7AA 2CJOA 1ZUD2 2V4IB 1FIQA 2ZNVB 3Q8EA 3ZXVA 2KT7A 3UIOB 3EHVA 2KX3A 4RM9A 4P16A 3U30A 4B0MA 4JE3B 4YSXB 1VZ6A 1FXTB 2LMCA 2DYMA 1HE8A 2N1WA 1Z2MA 2GBNA 4ZRJA 1QILA 1K50A 1L0XB 2E6XA 1XEEA 2KDEB 2KQ4X 1FXAA 2WXJA 3Q3JA 2QCZA 1E8WA 4FA6A 3KLSX 3KUCB 3Q8BA 4J3OD 4HDOA 3RNEC 1WZ0A 4KGTA 4WH4A 1HA5A 1L0VB 1TYGB 1YIWA 4ZHOA 1JQ4A 1J0GA 1H4RA 3JYUA 2AYOB 4GXBA 2GBJA 3TJPA 4WAAA 1TJEA 2LVPA 3NUHB 2CHXA 5C23A 3LJ3A 2L0TA 1ZXHA 4WQOB 1D5XC 2YLMA 3Q3NC 5C2TB 3W2DA 4PT5A 3AEAB 2PPHA 3PV1A 2LEKA 1C79A 2JXXA 4FJYA 4RM8A 1S1QB 1WX7A 4J6IA 1C76A 2BPSA 4DHJB 4M01A 2WNMA 3SDLC 1LXDA 1LGRA 2JVCA 1XCTL 3IHPC 5DPTA 3APDA 2IO2B 2N9XA 4IKGA 4L1BA 4I6LB 3C8YA 4NQKE 2BS2B 1WM2A 4ICUA 4LDTB 4TQ1A 5DPSA 3PPAA 1FNWA 4ANUA 1QQRA 3B1LX 1OEYJ 4ASWC 2RR9A 4IUMB 2KTRA 2KC2A 3GZNI 4AJYB 4MJSB 3CIRB 1UNSA 4W9LA 5LLIA 1T6BX 2RSUA 3SHQA 1J7BA 2V3SA 2L76A 1YD8U 3NY5A 2WXKA 2BBCA 2Y3AA 1P7FA 1AW7A 2JZZA 3Q69A 3IFWB 3ML9A 3QAQA 4HVBA 4GLSC 3VR9B 2MBEA 3FKYA 4BVUC 4EZLA 2K0PA 4JWSC 2LJIA 3GZNB 1XLQA 1V1PA 2B76B 3UINB 1SIFA 3EECA 4FN2A 1WM3A 3AI5A 1Q5WB 1J8CA 1E8ZA 2INDC 3L08A 2LFIA 4XYCA 3VTWA 1T0SC 3VQIA 3ZDTA 3P4QB 3AECB 3H7PB 3QC8B 4WJPA 3V05A 3BZDB 2INCC 4OVVA 5LXHA 2PW9A 1KTKA 5DPWA 3V6EB 3QIJA 1V5OA 1AARA 2J0KA 1E7PB 2KJRA 1OTRB 3M62B 2VH2A 2HD5B 1JWBD 1WXSA 3A4SC 2Y5BB 1V6EA 4II3B 2K5PA 1V9JA 2JU6X 3A33B 2K3UA 1ZDVA 2A4ZA 4PS7A 4RGMA 2JPHA 2H89B 4C00A 3WAMA 2Z8LA 1WFYA 2MJ3A 4AUQC 3ZNID 1SJED 1ZE3D 3NZSA 2ONQA 2R2QA 4W9KA 2FNJB 1EF1A 5G55A 1EUVB 3VAWA 5AEKB 4IM2A 3JSVB 3KH0A 4WJNA 1TS3A 1MVKA 3EUB2 5G2NA 3VRAB 2IGDA 2O2VB 4MELA 2L05A 1N63A 2GBMA 2LHDA 3AH7A 3BY4B 1FCLA 3MJ5A 2DBYA 5L83A 1V2YA 1C1YB 3AE8B 4P1BC 3ZTCA 4IG7B 3GS2A 2JWUA 4F7ZA 3Q3FA 2GMIC 3MP9A 3NZUA 1WE6A 4P1CC 2FCSA 3NS1A 4DWFA 2EKEC 1IGDA 1JWAD 2KVZA 1SGHA 1I4RA 1CMXB 4LCDE 1BUIC 5HKHA 2L32A 2WX1A 1MHHE 3DBHI 3OG5A 1C77A 4HPMB 1RFAA 1ENFA 2KAJA 2MWSB 5L95C 1BMLC 2O6VB 3RCZA 1JWMD 2XBBC 2LUMA 4XGAB 2NPTA 2CHZA 2OJRA 2V3NA 3PRPB 3AXCA 3NS8A 4A3PA 4A90A 4GN1A 1R7SA 5E6JA 1XT9B 3AEEB 2MCNB 2V3PA 4OW0A 4LTUA 1HZ5A 3DBHB 4L2YA 1V81A 4N6EB 1WJUA 3N1ZC 2JT4B 2WDTB 2G3QB 4W9JA 4RGNA 2KDMA 2OEDA 4C4VA 1FFUA 5IN7A 1J19A 3ML8A 4WJQA 2WXRA 3DBSA 2H88B 3VFKA 1GJZA 2LVQA 4M0WB 3MHSD 2KN4A 2DLBA 3A4RA 4AJWA 3FC4A 1WYWB 3HM3A 4JPSA 3ZDMC 3MTNB 1QZEA 3B0AA 4EZJA 3RFZB 2AL6A 1UBQA 2PLPA 4AWJA 1MFWA 1PYWD 4K81A 4G50A 2ICIA 5JHBA 3VHTC 5EE0A 2FIFA 2INNE 5C3JB 4E71A 5MPOA 4ANXA 1KM7A 5BYRA 2N9KA 1OEYA 2LRUA 3W5UB 5CHVC 4NZLB 4K3CA 1MG8A 4IM0A 1P7EA 3AE6B 2INPE 1LQBA 3J9CA 2V0GA 4LDTD 1UZXB 2R61A 3DVGY 3D32A 1WGDA 2WXFA 3QQ8B 2WXOA 3ZNHB 1YQ4B 1YX5B 2KX0A 1UD7A 3V61A 3R2IA 4AP4C 3S2AA 3ECIA 4DXAB 5E6OA 3N9YC 4KIKB 1SE4A 3DBLI 3DVNU 3VTVA 2IO1B 2XN9C 2C60A 5HFYA 3ZIMA 4M00A 1XD3B 3EFCA 4HCNB 1ET9A 1VD2A 1IP9A 2Y5PA 4WWMA 1PGBA 1I4GA 2LGIA 1F2RI 5BYSA 2K8HA 3B2FA 2N4FA 1IUEA 2BF8B 1HZ6A 4B9KA 5G5GA 1OQQA 3BWUD 3K9OB 3T9LA 2MHJA 2EELA 2KK8A 5LXIB 1E10A 3NVWA 2KN5A 1SE2A 2WXPA 1F0ZA 2J0JA 3HVZA 4HJKA 4RF0A 1STEA 1IYFA 2IYDB 1YJJA 1KFYB 3SU8X 2DZMA 2J53A 3R7QA 1E7VA 2RGFA 3A1QA 1I4PA 4KVGB 2ACZB 1RLFA 3HVDA 2KFKB 4RGTA 4ZDVA 1GB4A 2IPKD 4BFRA 1RAXA 3UI3A 1QLBB 2NTTA 4G3XB 3AE7B 1E8XA 3L13A 1WGYA 3AU4A 3FILA 3Q3MC 4BAXA 1HEZE 4FBJB 1V97A 2PVOD 4H2AA 1FCCC 2HJ8A 2DX5B 2D3GA 1WE7A 2G1EA 2VRRB 3HUIA 2BYVE 2IY1B 2WGSA 3H9DA 5EE1A 2PIAA 3IXSA 4MDKE 1RFKA 5DPRA 3ABVB 1K52A 4JIOU 3RMKC 3APCA 4NNJB 4ARCA 2VZKB 4W9GA 2FCNA 1R4NI 3DBRI 4ARIA 2CU1A 3ZO5B 3QA8A 2EKIA 3M63B 1N60A 1OFFA 1WH3A 1E0ZA 3L10B 2V9HA 2BKFA 4KZ0A 1GC7A 3QARA 3AE2B 3CMMB 2HE7A 1GC6A 2TSSA 2AWTA 2KHWB 5CHFA 4JGHB 2BGFA 2WXMA 2W3RA 3AMZA 4XX5A 4HK2A 2FUHB 1ZXIA 3Q8CA 3L0WB 1F1HA 4IM3A 1EWCA 3LXFA 1R4NB 3KUDB 1N62A 1WJ6A 4MT5A 1XQQA 1HXYD 3P4SB 3WIMA 1I4HA 1C4AA 2KWDA 4NAWB 3RN9C 2L3ZA 5IOIA 4C4VB 4RGOS 4W9CA 2ON8A 3Q6BA 5BYQA 1NEKB 3M95A 4W9EA 4YTMB 2KQ7A 1SSNA 4NJ7A 5FR3A 2KWUB 3N1XC 1WI0A 3ZJVA 3RZFA 1ZP0B 3T3OA 3R8BA 3P63A 3ALBA 4A3OA 2L52A 2LGYA 4KX6B 3BYTB 2BTEA 3GE3C 1RYJA 2JZPA 4RFBA 4YT0B 1UELA 1QKZA 3PO0A 4G11A 5T8IA 1YN4A 3B2GA 2CR5A 2MA9B 2NCNA 1NVID 1NYQA 1E9MA 1MPEA 2W82A 4HPPA 1WJNA 1RRBA 5E6PA 1BT0A 3VRBB 4A55A 1Q1OA 3C0RB 3WA0A 1UH6A 2DENB 3VUXA 2N7JA 1L0YB 3PGEA 1YX6B 3I63C 3PTFC 1B1ZA 2OOBB 1WR1A 1RM6C 1WMHB 2L7RA 2UU7A 4JL9A 4BKSD 4GDLA 1KLGD 2N7EA 1WGHA 4FHKA 3NVZA
chains in the Genus database with same CATH topology
1TS3A 1MVKA 4KGSA 3EUB2 4MACA 2IJ0A 2W3SA 3VRAB 1GB1A 4JX1C 2IGDA 3DWGC 3BIID 1DOXA 3ETRA 5BMIA 5LNK1 3EGRA 4YSYB 1HQRD 1N63A 3AH7A 2LHDA 4MH8A 5EE3A 4EE2A 1D5ZC 2NTSA 1FCLA 3MJ5A 2DBYA 1XO3A 3H8HA 4XWTA 4O1NA 1TY2A 1YNTE 3AE8B 2M19A 4NAMA 1FMAD 1PGXA 3GS2A 2GRIA 4TQ0A 2I38A 2JWUA 3NZ3A 3E56A 1QT9A 4UDUC 1JW9D 1YQ3B 3MP9A 1PGAA 3VR8B 1QOAA 4ZRPA 3OWEB 3W5VB 2RPVA 2QJLA 5HG2A 1JCKB 3NS1A 1YN3A 2LHEA 1VZ8A 2G9HD 4YWGG 3RPFC 3EA6A 1AYFA 1IGDA 1JWAD 3R2TA 1XCQL 2PTLA 2QEJC 1IBXB 3P4RB 3AM9A 2MJDA 1I4RA 4CQNA 1LO5D 1BUIC 1QOBA 2BT6A 2L32A 2RDHA 4HRSA 1MHHE 2J52A 1C77A 1VZ7A 2WXGA 1GAQB 1ENFA 1TS4A 1ZDXA 2KAJA 3ZGZA 4C56C 1BMLC 2AX5A 2CJNA 5HI1A 4C7YA 1JWMD 1TY0A 2LUMA 3Q8AA 3ZQ4A 3AEDB 1K51A 2KMMA 2V3NA 1PUTA 1E6EB 5FKAC 3TUOA 2XNAC 3NVYA 5EE9A 3U7ZA 1YMHE 4A90A 5GXGB 1R7SA 1I4QA 5E6JA 1L4DB 2WU5B 2ZW0A 3AEEB 3AV8A 2WS3B 1SE3A 1WSPA 1VDVA 2V3PA 3E9SA 4LTUA 4OW0A 2SAKA 2QMTA 1D4BA 2PKOA 3SFEB 1HZ5A 1XLNA 4L2YA 4N6EB 3W1SA 1C4CA 4YXDB 1J7CA 3URYA 1QOGA 2K9XA 1FFVA 1RWSA 2WXNA 4RGNA 2IGGA 2KDMA 2OEDA 4ITKA 4XDCA 3TEXA 1FFUA 3AN1A 3V3XA 1WRIA 4WAFA 2WP9B 4TSSA 3HRDD 1YN5A 3AEBB 1WWTA 3NVVA 2D5GA 2WXQA 1AN8A 2WXRA 1SEBD 2H88B 4DXFA 4WURA 2HDEA 4C80A 2KN4A 2DLBA 4ZOHC 1DOIA 1ACCA 3FC4A 2Q5WD 3AE5B 4OZBA 5AUKA 4JPSA 2M56B 3P42A 1PDXA 3P1MA 5BMGA 3MHZA 1V8CA 1VJKA 2GB1A 3L4PA 2I2YA 3RFZB 2DWQA 2PLPA 1XLOA 3TEYA 1PYWD 3MFGA 2JQRB 1VRAB 2ICIA 2NMQA 3ZJTA 2VZKD 4FXCA 5EE0A 2INNE 5C3JB 4WIPA 2FE8A 3ZJUA 4C7ZA 5MPOA 1VLBA 4KKIA 4XDDA 4GDKB 5BYRA 2QSDA 1NYRA 4N59A 2N9KA 4IOIE 3GB1A 4RH6A 1SXTA 4OVZA 3W5UB 1SIJA 4NZLB 1DYQA 3PZ8A 4M0WA 1UGJA 1OQRA 2WQYB 1WGKA 2WDRB 1AWDA 3P4PB 1T5XD 1M4VA 4US8A 2J42A 1EU4A 1P7EA 3AE6B 1ESFA 2INPE 3J9CA 1JRPA 2GI9A 2V0GA 1BXTA 2AQ3B 4MM3B 2R61A 2MJEA 1WYGA 1DGJA 2DYOA 1TZOA 4HKZE 2WXFA 2WXOA 1YQ4B 1F2RC 3AE1B 3BVGA 1T3QA 1WXQA 3ZYYX 1C78A 1ZPSA 3R2IA 3TEWA 1NENB 1UWMA 3IT6B 2Y5CA 2FUG1 3N9YC 1V1OA 4RNAA 1SE4A 2N9LA 4US9A 1C4PA 1N5WA 2FBWB 4Q2JA 2XN9C 5HFYA 2BB5A 3TEZA 4USAA 3DWMA 2WXLA 1QF6A 4OZCA 4XE0A 1ET9A 3IAS1 2E3TA 2WXIA 5TSSA 3BVMA 3CWIA 3BK2A 2WDVB 2Y5PA 4WWMA 2L1AA 4YTNB 1PGBA 1I4GA 2LGIA 4REZA 1L6UA 3BK1A 1TS2A 1XLPA 4KKJA 3I9V1 2WXHA 1F2RI 5BYSA 2RDGA 4OZAA 3B2FA 5D7GA 1IUEA 1MHXA 3PZ7A 1J7AA 1CQVA 1ZUD2 2CJOA 1HZ6A 1FIQA 2V4IB 4B0EA 3Q8EA 3LYYA 5G5GA 3W9CB 4A9AA 4A6QA 4P16A 1OQQA 3BWUD 4B0MA 4JE3B 4YSXB 1IBXA 2YEPF 2QILA 2EELA 1VZ6A 1VR9A 2LMCA 4P6VF 1E10A 2DYMA 3NVWA 1UUPA 4HROA 1FO4A 1SE2A 2IDYA 2WXPA 1F0ZA 1QILA 1K50A 1YJIA 3FAHA 1L0XB 2E6XA 1EM7A 1XEEA 5JXVA 3FILB 3HVZA 2AQ1B 2KQ4X 1FXAA 4AQ7A 1I7HA 2BS4B 1STEA 2WXJA 4RF0A 1PFDA 4DQOC 3AE3B 1YJJA 4HJGE 1KFYB 3KLSX 1JWSD 1KF6B 1FNUA 2J53A 4L23A 1N5XA 3Q8BA 4J3OD 3I57A 3Q8FA 2ZW1A 1Y56A 1GPXA 1I4PA 3SEBA 2ACZB 4KGTA 4WH4A 4GDLB 1IGCA 1HA5A 1L0VB 1TYGB 2RMMA 3HVDA 5D3DA 2K22A 4RGTA 5H92C 4YSZB 5I4DA 2IPKD 4DXGA 1CK1A 1GB4A 3IAM1 3UI3A 1QLBB 4ZHOA 1JQ4A 2NTTA 2W55A 3AE7B 4NJCA 3FILA 2PMVA 1TJEA 3NUHB 1FEHA 1HEZE 1XXGA 4ZRQA 4LK0M 2J4XA 1TS5A 1V97A 2PVOD 4H2AA 4HKQA 3AE4B 1FCCC 1KH0A 2G1EA 4LLGM 3HUIA 1ZXHA 1D5XC 3T3NA 5C2TB 3W2DA 4PT5A 3AEAB 2IGHA 2JSVX 4TMAB 5EE1A 2PIAA 3IXSA 1RFKA 3ABVB 1EU3A 2LEKA 1C79A 3IT4B 1K52A 1CJEA 3KQ4A 2L83A 1N61A 1EWYC 4ARCA 2VZKB 1C76A 1ET6A 2CU3A 2BS3B 2JYTA 2WNMA 1XCTL 3BYYB 4ARIA 1Q10A 2EKIA 1SBBB 4RCOA 1N60A 4IKGA 2MH7A 4L1BA 1OFFA 3NRZA 3C8YA 1L6VA 2BS2B 1E0ZA 3SR6A 4TQ1A 1B9RA 1FNWA 3AE2B 1QQRA 4OHJA 3B9JA 5G5HA 1V1PB 2WDQB 2TSSA 4KGRA 1JMLA 3CIRB 1UNSA 2WLBA 3AB5A 2QIEB 1T6BX 2WXMA 2W3RA 3AMZA 1JROA 1TKGA 2JX5A 1ROEA 5BMHA 1J7BA 1MI0A 5AUIA 1ZXIA 2OHFA 3Q8CA 1A70A 1EWCA 3LXFA 3MC0B 1L5PA 1GOZA 1TKEA 2WXKA 1D6EC 4ZHPA 1N62A 2BBCA 1P7FA 2Y3AA 4MT5A 3LB8C 4HEA1 1AW7A 5FK9C 1JALA 3Q69A 1HXYD 3P4SB 1I4HA 2MEKA 1C9FA 1C4AA 2KWDA 4JWUC 4NAWB 4RGOS 4GLSC 3VR9B 2K0PA 4JWSC 2LJIA 2ON8A 1FXIA 5BYQA 1F77A 1NEKB 1XLQA 1FNVA 1FRRA 1V1PA 1K53A 1TKYA 2B76B 4YTMB 2W54A 1SSNA 1I4XA 5FR3A 2BB6A 3ZJVA 3AEGB 1ZP0B 3T3OA 3R8BA 2JYEA 3P63A 1JWUD 2LFIA 2BW2A 2L52A 3BVZA 5D3IB 4KX6B 3BYTB 3VQIA 2BTEA 4AS1A 1RYJA 1KRHA 3AECB 2JZPA 3P4QB 4RFBA 4YT0B 3SFDB 3V05A 2BYTA 3BZDB 1QKZA 3PO0A 2PW9A 5T8IA 2YEPB 1KTKA 1YN4A 3B2GA 3KWLA 4YTPB 1NVID 1NYQA 1E9MA 1L4ZB 3U4EG 4D2KA 1E7PB 1FM0D 1MPEA 2W82A 3AEFB 3O13A 4XWWA 2AQ2B 4N58A 1JWBD 4R3DA 1UWXA 1SF0A 3VRBB 3TSSA 4A55A 4A8XC 1DOYA 2K5PA 4WQMA 2JU6X 1KLUD 1ZOYB 1QOFA 2K3UA 2PVGC 4IDIA 1ZDVA 3KWVA 1CZPA 2KACA 4RGMA 2X38A 2N7JA 4ZYSA 1L0YB 2WU2B 3WCQA 2H89B 2N0SB 2Z8LA 1B1ZA 2JXTA 2MJ3A 2SEBD 1RM6C 2HTME 3AE9B 1XF5L 3GP7A 4RF1A 1FRDA 1SJED 1ZE3D 2ONQA 5HHDG 1KLGD 5H8YE 1FD6A 1D5MC 2M0AA 3U2SC 1SB3C 1NI3A 3U52E 3NVZA 1SJHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MVK A;  4KGR A;  1JML A;  4KGS A;  4MAC A;  4OZB A;  1GB1 A;  2IGD A;  5BMI A;  1K50 A;  1EM7 A;  5BMH A;  2LHD A;  5BMG A;  1MI0 A;  1FCL A;  5JXV A;  3FIL B;  2GB1 A;  2I2Y A;  2KQ4 X;  2PLP A;  1YNT E;  4HJG E;  2NMQ A;  1PGX A;  1P7F A;  2I38 A;  2JWU A;  2J53 A;  1C9F A;  2QSD A;  2KWD A;  2N9K A;  2ZW1 A;  4IOI E;  3GB1 A;  3MP9 A;  1PGA A;  4GLS C;  2K0P A;  2ON8 A;  2RPV A;  5HG2 A;  4KGT A;  4WH4 A;  2LHE A;  1IGC A;  2RMM A;  1K53 A;  1P7E A;  1GB4 A;  1IGD A;  2GI9 A;  1XCQ L;  2PTL A;  3UI3 A;  1IBX B;  4HKZ E;  3FIL A;  1MHH E;  2J52 A;  1F2R C;  1HEZ E;  2JZP A;  1FCC C;  1QKZ A;  5HI1 A;  1KH0 A;  2PW9 A;  1ZXH A;  2LUM A;  4D2K A;  1K51 A;  1MPE A;  2IGH A;  2JSV X;  2N9L A;  1YMH E;  1UWX A;  5HFY A;  2ZW0 A;  1K52 A;  2JU6 X;  4OZC A;  2QMT A;  1D4B A;  2KAC A;  1HZ5 A;  2N7J A;  1PGB A;  2LGI A;  2JXT A;  1XCT L;  1F2R I;  1Q10 A;  1XF5 L;  2IGG A;  2KDM A;  4OZA A;  2OED A;  4IKG A;  1MHX A;  3V3X A;  2ONQ A;  1HZ6 A;  5HHD G;  1FD6 A;  2KN4 A;  1IBX A;  2EEL A; 
#chains in the Genus database with same CATH topology
 3Q2A C;  2W9N A;  5IA7 A;  2KDI A;  5AZF A;  3ETR A;  1D5Z C;  2NTS A;  2DZJ A;  1XO3 A;  1NBF C;  4XWT A;  5JHA A;  4KZC A;  3AUL A;  1YNT E;  2C7H A;  2PE6 B;  3NZ3 A;  5DCN A;  2JUO A;  3IVF A;  4M8N A;  2D11 A;  4UDU C;  3UQB A;  3OJ3 A;  1X1M A;  4FLH A;  3OWE B;  3W5V B;  1EO6 A;  2QJL A;  3RUL A;  3UQA A;  4YWG G;  1VCB A;  3MC8 A;  4A20 A;  2MJD A;  1QOB A;  2RDH A;  4HRS A;  4FUL A;  3ZLZ A;  2DHZ A;  3TIX A;  3ZGZ A;  2AX5 A;  2CJN A;  5HI1 A;  2BQQ A;  4IWO A;  3APF A;  3R7R A;  4KDL B;  3AED B;  2KMM A;  1E6E B;  4PYZ A;  2LXC A;  1YMH E;  2FCQ A;  1I4Q A;  2WU5 B;  1U4A A;  2G45 B;  4CO7 A;  3A1Q B;  3QX1 A;  3AV8 A;  3W1Y A;  1SE3 A;  1V5T A;  1WSP A;  1VDV A;  4DHZ B;  2J0M A;  2QMT A;  2UWQ A;  5IAA C;  1T0R C;  3CSF A;  1XLN A;  2MSE D;  3W1S A;  1C4C A;  2MQJ A;  3URY A;  1QOG A;  3AU5 A;  5AZG A;  4XDC A;  4ZRI A;  4MEM A;  2KKC A;  4TSS A;  3NVV A;  4QAY A;  2JZ3 B;  2HDE A;  2IO0 B;  2LD9 A;  4MGI E;  1DOI A;  1ACC A;  2Q5W D;  3AE5 B;  2RPQ A;  2WX0 A;  1GNU A;  4OZB A;  2M56 B;  3PRE A;  3P1M A;  3MHZ A;  2CKH B;  2I2Y A;  2GBR A;  3GOE A;  1HTQ A;  3TEY A;  4NQL B;  3MFG A;  2M0X A;  1VRA B;  3ZJT A;  1SE9 A;  3KUZ A;  2VZK D;  1WY8 A;  5D94 A;  4KKI A;  4TV3 A;  3GE8 C;  4MGK E;  3A9J B;  3GB1 A;  3DDC B;  1DYQ A;  1UGJ A;  2WQY B;  2C7N B;  3ONS A;  1AWD A;  3P4P B;  2J42 A;  4HLE A;  1WRD B;  3DVN V;  2JRI B;  1WR6 E;  3MJW A;  3PVL A;  1FPY A;  2AQ3 B;  4MM3 B;  3PHW B;  4W9H A;  4HKZ E;  5E6N A;  4JLC A;  1T3Q A;  3ZYY X;  4KSL C;  1NEN B;  3JW0 X;  4I6P A;  3IT6 B;  2MP2 A;  4GDK A;  2Y5C A;  3TMP B;  4US9 A;  2FBW B;  2ZEQ A;  2KMA A;  2LVO A;  3TEZ A;  2WXL A;  5TR5 A;  1QF6 A;  2WWZ A;  5IP4 D;  3BVM A;  2KDF B;  4LJO B;  2L1A A;  4YTN B;  5J2R A;  4REZ A;  1L6U A;  1N6Z A;  1XLP A;  2KD0 A;  3I9V 1;  4K3B A;  4BKG A;  2N9P C;  2KC1 A;  2MBH A;  1Z5S B;  2JRH A;  2REX A;  3KYD D;  3VVW B;  3WAN A;  1NDD A;  4S17 A;  1CQV A;  4B0E A;  2ZZP B;  2PE9 A;  3LYY A;  2AEH A;  3EFU A;  4A9A A;  2IY0 B;  1IBX A;  2DZI A;  2R2O A;  1VR9 A;  2YEP F;  3ZW3 A;  3BIN A;  4P6V F;  2D3C A;  2MBQ A;  1P1A A;  1A5R A;  4HPL B;  2KOX A;  2IDY A;  1EM7 A;  4FHJ A;  5JXV A;  2AQ1 B;  4AQ7 A;  1PFD A;  2D3A A;  3AE3 B;  4HJG E;  2N7D A;  2MBB B;  1JWS D;  1KF6 B;  2LAS A;  3MC9 A;  2V4L A;  4MGY E;  1FNU A;  2FID A;  4L23 A;  1N5X A;  5J17 A;  3I57 A;  3Q8F A;  1Y56 A;  1GPX A;  2QDF A;  2ZPY A;  4GDL B;  2RMM A;  5D3D A;  5H92 C;  1IPG A;  1CK1 A;  3WAO A;  3O65 B;  1Y8R C;  4NJC A;  2LGS A;  3RT3 B;  3QK0 A;  4MSM B;  1XXG A;  4LK0 M;  2J4X A;  3CF6 E;  2L0F A;  4HKQ A;  3AE4 B;  1E90 A;  1KH0 A;  1R4M I;  2LZ6 A;  2K8B A;  5J18 A;  3WAL A;  2XK5 A;  4LJP B;  2IGH A;  4NY0 A;  4TMA B;  2KTR B;  1EU3 A;  4F1S A;  2ZPN A;  1CJE A;  1N61 A;  2BS3 B;  2MLB A;  2N9E B;  1R4M B;  1SBB B;  4RCO A;  3UGB B;  2MH7 A;  1V80 A;  3NRZ A;  3PS6 A;  1ZKH A;  1L6V A;  4ANV A;  4BOS C;  3OLM D;  3QWZ B;  3H1U A;  2LWP A;  2BYE A;  5G5H A;  1V1P B;  2WDQ B;  3UIP B;  4KGR A;  1JML A;  4LNK A;  3AB5 A;  2WLB A;  2QIE B;  1JRO A;  1TKG A;  2JX5 A;  2M8S A;  5FR6 A;  5BMH A;  2BKR B;  5AUI A;  2OHF A;  1A70 A;  1TKE A;  1M94 A;  1D6E C;  4EUT A;  2WYQ A;  1WX9 A;  4HEA 1;  1YJ1 A;  2ASQ A;  3DBL B;  3VH3 B;  1TT5 B;  2C9W B;  4JWU C;  3VXW A;  4WWO A;  2M4N A;  1ISN A;  1KLV A;  1FXI A;  2KWV B;  3PT2 B;  1FNV A;  1K53 A;  4MJS A;  1P9D U;  1F52 A;  1I4X A;  2CHW A;  3AEG B;  4B6W A;  3P2B A;  1JWU D;  2BW2 A;  3BVZ A;  5D3I B;  4W9F A;  5CX3 A;  1KRH A;  3IBE A;  3SFD B;  2NVU I;  2KZR A;  2BYT A;  4GIV A;  2YEP B;  4M02 A;  2D3B A;  3U4E G;  1L4Z B;  2JF5 A;  2UYZ B;  4D2K A;  3O13 A;  4XWW A;  2AQ2 B;  4N58 A;  4GMV A;  1UWX A;  1SF0 A;  2EMT A;  3TSS A;  1DOY A;  4WQM A;  1KLU D;  1ZOY B;  2PVG C;  4GOC A;  3PHX B;  5IKC M;  3W1S C;  3TBL D;  2KAC A;  2X38 A;  2N0S B;  3K9P B;  4NJ6 A;  2JXT A;  3H7P A;  1WGG A;  2DAJ A;  2HTM E;  4RF1 A;  5JZE B;  1FRD A;  4FJV B;  2M1M A;  5HHD G;  5H8Y E;  1D5M C;  2MP2 B;  1TBE A;  3U52 E;  4EZK A;  1SJH D;  3VTU A;  2IJ0 A;  2W3S A;  1GB1 A;  4JX1 C;  1DOX A;  3R66 C;  5BMI A;  4YSY B;  4G0N B;  2RDB C;  4W9I A;  2NS5 A;  2C5L C;  2I1K A;  4NAM A;  1FMA D;  1PGX A;  3HIZ A;  4TQ0 A;  2I38 A;  3E56 A;  3U7D A;  4CHK A;  2NPT B;  1QT9 A;  1JW9 D;  1PGA A;  1MG4 A;  1QOA A;  2L8J A;  5HG2 A;  2IBI B;  3RPF C;  4JQW C;  2G9H D;  3JSV A;  2KLC A;  3X23 A;  3EA6 A;  4WWN A;  3RNF C;  3Q3O C;  1XCQ L;  2PTL A;  2XEW A;  3DBR B;  3P4R B;  1IBX B;  3AM9 A;  4CQN A;  1LO5 D;  3I3T B;  2KFJ A;  2PJH A;  1WXM A;  1VZ7 A;  2WXG A;  4MGZ E;  1G6J A;  4M8M A;  5CHW A;  3TL5 A;  4LNF A;  3ZQ4 A;  4K1R B;  1K51 A;  3PRZ A;  1PUT A;  1T0Q C;  5FKA C;  3TUO A;  3NVY A;  3DCG A;  2ZW0 A;  3ZNG C;  3E9S A;  2CS4 A;  2ZCB A;  3PSE B;  2SAK A;  1L2N A;  2PKO A;  4KV2 A;  3SFE B;  3ZUN A;  2FAZ A;  4YXD B;  2NBW B;  3N3K B;  4LNI A;  4EKU A;  1K8R B;  2GLS A;  1PQS A;  1RWS A;  2IGG A;  2O6V A;  3WAP A;  3PZD A;  4DDG D;  2KXJ A;  5KHO A;  2KNB A;  4FAD A;  4NPN A;  2MRP A;  3N1Y C;  3N30 A;  2KLG A;  4ACF A;  3HRD D;  1HTO A;  1YN5 A;  2WXQ A;  1AN8 A;  4WUR A;  2XK5 B;  3DHH C;  2BYF A;  4KSK C;  4MSQ B;  5AUK A;  3P42 A;  1YQB A;  2JWZ A;  1PDX A;  3IG3 A;  1V8C A;  1GUA B;  1VJK A;  2GB1 A;  3L4P A;  1C3T A;  1ZW7 A;  3VUY A;  2FCM A;  2LI5 A;  4HXD A;  1T0Y A;  2Z59 B;  2NMQ A;  2B3A A;  2LRW A;  4PYU A;  2ZNV C;  2N1V A;  2QSD A;  4N59 A;  4IOI E;  4RH6 A;  4OVZ A;  1V86 A;  3C19 A;  5JH5 C;  4M0W A;  1OQR A;  1WGK A;  2WDR B;  1T5X D;  2OJW A;  4US8 A;  1EU4 A;  1ESF A;  2GBK A;  3DHG C;  5EDS A;  1BXT A;  1DGJ A;  2DYO A;  1TGZ B;  2K6Q A;  4I6N B;  3AE1 B;  1L7Y A;  1WXQ A;  2PEA A;  1C78 A;  4YL8 A;  1UWM A;  4TUU A;  2FUG 1;  3ZKJ C;  1V1O A;  4RNA A;  2BWE S;  4PS8 A;  4E3C A;  1N5W A;  4Q2J A;  2V1Y A;  2BB5 A;  3A9K A;  1D3Z A;  4USA A;  3DWM A;  3NJT A;  2DAF A;  4EEW A;  2Z0E B;  4XC2 A;  5TSS A;  2NR2 A;  4CYE A;  4GSW A;  2G4S A;  3RYT A;  3OJ4 B;  5GMV A;  4BKS A;  1WZ3 A;  2M17 A;  2YVC A;  4KKJ A;  4TKN A;  3QJZ A;  3M3J A;  3RZW C;  3NOB A;  2DYB A;  3L16 A;  4KIK A;  2KQS A;  1P3Q U;  3W9C B;  4A6Q A;  2QIL A;  1UUP A;  2K6D B;  3DPD A;  3EC8 A;  4HRO A;  1FO4 A;  4BKT A;  3FAH A;  1YJI A;  1WXA A;  4HWI B;  3FIL B;  3TCA A;  2K25 A;  1I7H A;  2BS4 B;  4K7W A;  4DQO C;  3H7S A;  3DOW A;  1E5W A;  2NBV B;  2KAN A;  1E7U A;  1TZ1 A;  3QCA A;  2ZW1 A;  3SEB A;  1IGC A;  3QHT A;  2K22 A;  4YSZ B;  5I4D A;  4DXG A;  3NHE B;  3IAM 1;  2WHI A;  2QHO A;  2W55 A;  3SD5 A;  3ZTD A;  3PLV A;  4XZ4 A;  2PMV A;  2ZJD A;  1S3S G;  3VH4 B;  1ZGU B;  1FEH A;  4ZRQ A;  2I1J A;  1NI2 A;  1TS5 A;  2JY6 A;  1WIA A;  4LLG M;  1WGR A;  3T3N A;  2JSV X;  4GGQ A;  4GB9 A;  1TIF A;  3ZRF A;  2IZV B;  1F9J A;  2KFK A;  3IT4 B;  2VH1 A;  1WX8 A;  3KQ4 A;  2L83 A;  4BBN C;  1EWY C;  1ET6 A;  2CU3 A;  4DBG A;  2JYT A;  4HDQ A;  3RNA C;  3HM6 X;  4II2 B;  3DHI C;  3V6C B;  3BYY B;  4IWP A;  1Q10 A;  1LM8 B;  3CST A;  4AOF A;  2A5U A;  3SR6 A;  3N32 A;  2LGX A;  4IC7 B;  5IO9 A;  1JRU A;  1B9R A;  4OHJ A;  2LJ5 A;  3B9J A;  5AZH A;  2KWC A;  4IW0 A;  2G4D B;  2D2Q A;  1ROE A;  4B95 A;  1MI0 A;  3MC0 B;  1L5P A;  1GOZ A;  5D6J B;  4ZHP A;  1YOV B;  3LB8 C;  4LNN A;  5FK9 C;  1JAL A;  4F8C B;  3LDZ E;  4KDI C;  2KDB A;  2MEK A;  3OAW A;  4MH0 E;  1C9F A;  1KJT A;  2DNF A;  4EOY A;  2MX2 A;  1F77 A;  1FRR A;  4WWP A;  1TKY A;  1UF0 A;  2KO3 A;  2W54 A;  4K7S A;  2BB6 A;  1WXV A;  3HHM A;  2JYE A;  2MBO A;  4AS1 A;  1OGW A;  1KOT A;  3RNG C;  3V62 A;  2KVR A;  3KWL A;  4YTP B;  4URK A;  4NAW A;  3ZRC A;  5CTR C;  2NBU A;  1FM0 D;  2C7M B;  3AEF B;  1P98 A;  3R3M A;  1WF9 A;  4R3D A;  4A8X C;  1QOF A;  4IDI A;  1GG3 A;  3KWV A;  1CZP A;  4ZYS A;  3KYC D;  2WU2 B;  3WCQ A;  4E74 A;  3UF8 A;  2D10 A;  2SEB D;  3AE9 B;  1XF5 L;  3GP7 A;  2K1F A;  5BO4 B;  2HTH A;  5D2M B;  2LXA A;  1FD6 A;  4DHJ D;  2M0A A;  4ZYN A;  3U2S C;  4DHZ E;  1SB3 C;  1NI3 A;  2BWF A;  4EFO A;  1EF5 A;  4ANW A;  4KGS A;  4MAC A;  2D07 B;  3DWG C;  3BII D;  5LNK 1;  3EGR A;  1HQR D;  5EE3 A;  4MH8 A;  3A9K B;  4EE2 A;  3DVG X;  3H8H A;  3JVZ X;  3NG0 A;  4O1N A;  3DQV A;  1TY2 A;  2M19 A;  1WMH A;  2GRI A;  4RMA A;  1YQ3 B;  3VR8 B;  2KMC A;  4ZRP A;  3H6N A;  1I42 A;  2RPV A;  3PLU A;  1JCK B;  1YN3 A;  2LHE A;  1VZ8 A;  1AYF A;  1H8C A;  3R2T A;  2QEJ C;  3KVF B;  2BT6 A;  2J52 A;  4PS3 A;  4W9D A;  3PRM B;  1GAQ B;  1TS4 A;  1ZDX A;  4C56 C;  3ZNZ B;  4C7Y A;  3N20 C;  4BZA A;  2MW5 A;  1UBI A;  1TY0 A;  3Q8A A;  3RNC C;  2ZVO A;  4P7I A;  2XNA C;  5EE9 A;  3U7Z A;  5GXG B;  1Q0W B;  1L4D B;  4WJO A;  2LGD A;  1WJ4 A;  2KJH B;  3VDZ A;  2K39 A;  2WS3 B;  4DK5 A;  4BOZ B;  4S0R A;  2AL3 A;  1D4B A;  3V60 A;  1OQY A;  1J7C A;  4K7U A;  2K9X A;  1FFV A;  2WXN A;  4ITK A;  5C1Z A;  3TEX A;  3AN1 A;  3V3X A;  1WRI A;  4WAF A;  2IO3 B;  2WP9 B;  1E8Y A;  1V49 A;  3AEB B;  1WWT A;  4X57 B;  2D5G A;  1SEB D;  4DXF A;  4DDI D;  4C80 A;  2KYW A;  1UGM A;  4ZOH C;  1I35 A;  2X8X X;  2L00 B;  2HJ1 A;  2Z0D B;  5BMG A;  2DWQ A;  2GOW A;  1XLO A;  4ZRK A;  2JQR B;  1MJD A;  3HK0 A;  4FXC A;  4LNO A;  4WIP A;  2FE8 A;  3ZJU A;  4C7Z A;  2ZVN A;  1VLB A;  4XDD A;  4GDK B;  1NYR A;  5KHQ A;  4FJZ A;  1SXT A;  3RUI B;  1SIJ A;  2RD0 A;  2KTF A;  3PZ8 A;  1P0R A;  1M4V A;  1JRP A;  2GI9 A;  3U8Z A;  3Q14 C;  3T8M A;  2MJE A;  1WYG A;  3L17 A;  1TZO A;  2KJ6 A;  1F2R C;  3I5J C;  3L54 A;  3RNB C;  3BVG A;  4ICV A;  2DZK A;  1ZPS A;  3TEW A;  2ZCC A;  3A9J A;  1TTN A;  4PK1 A;  4N9F 4;  2N9L A;  4IWQ A;  2K8C A;  2O2V A;  1C4P A;  4OVU A;  3ZXR A;  3X0W A;  4GU2 A;  3ENE A;  2O6V D;  4OZC A;  4XE0 A;  3IAS 1;  2E3T A;  2WXI A;  4MM3 A;  2EMS A;  3CWI A;  3BK2 A;  2WDV B;  2QC8 A;  3VUW A;  4HCP B;  3B08 A;  3BK1 A;  2J7Q B;  1TS2 A;  3RD2 A;  2WXH A;  4BBN F;  2LUE A;  3RI7 C;  2RDG A;  4OZA A;  3ZVV A;  3KW5 B;  5D7G A;  2BVC A;  1MHX A;  1LFD A;  3PZ7 A;  1J7A A;  2CJO A;  1ZUD 2;  2V4I B;  1FIQ A;  2ZNV B;  3Q8E A;  3ZXV A;  2KT7 A;  3UIO B;  3EHV A;  2KX3 A;  4RM9 A;  4P16 A;  3U30 A;  4B0M A;  4JE3 B;  4YSX B;  1VZ6 A;  1FXT B;  2LMC A;  2DYM A;  1HE8 A;  2N1W A;  1Z2M A;  2GBN A;  4ZRJ A;  1QIL A;  1K50 A;  1L0X B;  2E6X A;  1XEE A;  2KDE B;  2KQ4 X;  1FXA A;  2WXJ A;  3Q3J A;  2QCZ A;  1E8W A;  4FA6 A;  3KLS X;  3KUC B;  3Q8B A;  4J3O D;  4HDO A;  3RNE C;  1WZ0 A;  4KGT A;  4WH4 A;  1HA5 A;  1L0V B;  1TYG B;  1YIW A;  4ZHO A;  1JQ4 A;  1J0G A;  1H4R A;  3JYU A;  2AYO B;  4GXB A;  2GBJ A;  3TJP A;  4WAA A;  1TJE A;  2LVP A;  3NUH B;  2CHX A;  5C23 A;  3LJ3 A;  2L0T A;  1ZXH A;  4WQO B;  1D5X C;  2YLM A;  3Q3N C;  5C2T B;  3W2D A;  4PT5 A;  3AEA B;  2PPH A;  3PV1 A;  2LEK A;  1C79 A;  2JXX A;  4FJY A;  4RM8 A;  1S1Q B;  1WX7 A;  4J6I A;  1C76 A;  2BPS A;  4DHJ B;  4M01 A;  2WNM A;  3SDL C;  1LXD A;  1LGR A;  2JVC A;  1XCT L;  3IHP C;  5DPT A;  3APD A;  2IO2 B;  2N9X A;  4IKG A;  4L1B A;  4I6L B;  3C8Y A;  4NQK E;  2BS2 B;  1WM2 A;  4ICU A;  4LDT B;  4TQ1 A;  5DPS A;  3PPA A;  1FNW A;  4ANU A;  1QQR A;  3B1L X;  1OEY J;  4ASW C;  2RR9 A;  4IUM B;  2KTR A;  2KC2 A;  3GZN I;  4AJY B;  4MJS B;  3CIR B;  1UNS A;  4W9L A;  5LLI A;  1T6B X;  2RSU A;  3SHQ A;  1J7B A;  2V3S A;  2L76 A;  1YD8 U;  3NY5 A;  2WXK A;  2BBC A;  2Y3A A;  1P7F A;  1AW7 A;  2JZZ A;  3Q69 A;  3IFW B;  3ML9 A;  3QAQ A;  4HVB A;  4GLS C;  3VR9 B;  2MBE A;  3FKY A;  4BVU C;  4EZL A;  2K0P A;  4JWS C;  2LJI A;  3GZN B;  1XLQ A;  1V1P A;  2B76 B;  3UIN B;  1SIF A;  3EEC A;  4FN2 A;  1WM3 A;  3AI5 A;  1Q5W B;  1J8C A;  1E8Z A;  2IND C;  3L08 A;  2LFI A;  4XYC A;  3VTW A;  1T0S C;  3VQI A;  3ZDT A;  3P4Q B;  3AEC B;  3H7P B;  3QC8 B;  4WJP A;  3V05 A;  3BZD B;  2INC C;  4OVV A;  5LXH A;  2PW9 A;  1KTK A;  5DPW A;  3V6E B;  3QIJ A;  1V5O A;  1AAR A;  2J0K A;  1E7P B;  2KJR A;  1OTR B;  3M62 B;  2VH2 A;  2HD5 B;  1JWB D;  1WXS A;  3A4S C;  2Y5B B;  1V6E A;  4II3 B;  2K5P A;  1V9J A;  2JU6 X;  3A33 B;  2K3U A;  1ZDV A;  2A4Z A;  4PS7 A;  4RGM A;  2JPH A;  2H89 B;  4C00 A;  3WAM A;  2Z8L A;  1WFY A;  2MJ3 A;  4AUQ C;  3ZNI D;  1SJE D;  1ZE3 D;  3NZS A;  2ONQ A;  2R2Q A;  4W9K A;  2FNJ B;  1EF1 A;  5G55 A;  1EUV B;  3VAW A;  5AEK B;  4IM2 A;  3JSV B;  3KH0 A;  4WJN A;  1TS3 A;  1MVK A;  3EUB 2;  5G2N A;  3VRA B;  2IGD A;  2O2V B;  4MEL A;  2L05 A;  1N63 A;  2GBM A;  2LHD A;  3AH7 A;  3BY4 B;  1FCL A;  3MJ5 A;  2DBY A;  5L83 A;  1V2Y A;  1C1Y B;  3AE8 B;  4P1B C;  3ZTC A;  4IG7 B;  3GS2 A;  2JWU A;  4F7Z A;  3Q3F A;  2GMI C;  3MP9 A;  3NZU A;  1WE6 A;  4P1C C;  2FCS A;  3NS1 A;  4DWF A;  2EKE C;  1IGD A;  1JWA D;  2KVZ A;  1SGH A;  1I4R A;  1CMX B;  4LCD E;  1BUI C;  5HKH A;  2L32 A;  2WX1 A;  1MHH E;  3DBH I;  3OG5 A;  1C77 A;  4HPM B;  1RFA A;  1ENF A;  2KAJ A;  2MWS B;  5L95 C;  1BML C;  2O6V B;  3RCZ A;  1JWM D;  2XBB C;  2LUM A;  4XGA B;  2NPT A;  2CHZ A;  2OJR A;  2V3N A;  3PRP B;  3AXC A;  3NS8 A;  4A3P A;  4A90 A;  4GN1 A;  1R7S A;  5E6J A;  1XT9 B;  3AEE B;  2MCN B;  2V3P A;  4OW0 A;  4LTU A;  1HZ5 A;  3DBH B;  4L2Y A;  1V81 A;  4N6E B;  1WJU A;  3N1Z C;  2JT4 B;  2WDT B;  2G3Q B;  4W9J A;  4RGN A;  2KDM A;  2OED A;  4C4V A;  1FFU A;  5IN7 A;  1J19 A;  3ML8 A;  4WJQ A;  2WXR A;  3DBS A;  2H88 B;  3VFK A;  1GJZ A;  2LVQ A;  4M0W B;  3MHS D;  2KN4 A;  2DLB A;  3A4R A;  4AJW A;  3FC4 A;  1WYW B;  3HM3 A;  4JPS A;  3ZDM C;  3MTN B;  1QZE A;  3B0A A;  4EZJ A;  3RFZ B;  2AL6 A;  1UBQ A;  2PLP A;  4AWJ A;  1MFW A;  1PYW D;  4K81 A;  4G50 A;  2ICI A;  5JHB A;  3VHT C;  5EE0 A;  2FIF A;  2INN E;  5C3J B;  4E71 A;  5MPO A;  4ANX A;  1KM7 A;  5BYR A;  2N9K A;  1OEY A;  2LRU A;  3W5U B;  5CHV C;  4NZL B;  4K3C A;  1MG8 A;  4IM0 A;  1P7E A;  3AE6 B;  2INP E;  1LQB A;  3J9C A;  2V0G A;  4LDT D;  1UZX B;  2R61 A;  3DVG Y;  3D32 A;  1WGD A;  2WXF A;  3QQ8 B;  2WXO A;  3ZNH B;  1YQ4 B;  1YX5 B;  2KX0 A;  1UD7 A;  3V61 A;  3R2I A;  4AP4 C;  3S2A A;  3ECI A;  4DXA B;  5E6O A;  3N9Y C;  4KIK B;  1SE4 A;  3DBL I;  3DVN U;  3VTV A;  2IO1 B;  2XN9 C;  2C60 A;  5HFY A;  3ZIM A;  4M00 A;  1XD3 B;  3EFC A;  4HCN B;  1ET9 A;  1VD2 A;  1IP9 A;  2Y5P A;  4WWM A;  1PGB A;  1I4G A;  2LGI A;  1F2R I;  5BYS A;  2K8H A;  3B2F A;  2N4F A;  1IUE A;  2BF8 B;  1HZ6 A;  4B9K A;  5G5G A;  1OQQ A;  3BWU D;  3K9O B;  3T9L A;  2MHJ A;  2EEL A;  2KK8 A;  5LXI B;  1E10 A;  3NVW A;  2KN5 A;  1SE2 A;  2WXP A;  1F0Z A;  2J0J A;  3HVZ A;  4HJK A;  4RF0 A;  1STE A;  1IYF A;  2IYD B;  1YJJ A;  1KFY B;  3SU8 X;  2DZM A;  2J53 A;  3R7Q A;  1E7V A;  2RGF A;  3A1Q A;  1I4P A;  4KVG B;  2ACZ B;  1RLF A;  3HVD A;  2KFK B;  4RGT A;  4ZDV A;  1GB4 A;  2IPK D;  4BFR A;  1RAX A;  3UI3 A;  1QLB B;  2NTT A;  4G3X B;  3AE7 B;  1E8X A;  3L13 A;  1WGY A;  3AU4 A;  3FIL A;  3Q3M C;  4BAX A;  1HEZ E;  4FBJ B;  1V97 A;  2PVO D;  4H2A A;  1FCC C;  2HJ8 A;  2DX5 B;  2D3G A;  1WE7 A;  2G1E A;  2VRR B;  3HUI A;  2BYV E;  2IY1 B;  2WGS A;  3H9D A;  5EE1 A;  2PIA A;  3IXS A;  4MDK E;  1RFK A;  5DPR A;  3ABV B;  1K52 A;  4JIO U;  3RMK C;  3APC A;  4NNJ B;  4ARC A;  2VZK B;  4W9G A;  2FCN A;  1R4N I;  3DBR I;  4ARI A;  2CU1 A;  3ZO5 B;  3QA8 A;  2EKI A;  3M63 B;  1N60 A;  1OFF A;  1WH3 A;  1E0Z A;  3L10 B;  2V9H A;  2BKF A;  4KZ0 A;  1GC7 A;  3QAR A;  3AE2 B;  3CMM B;  2HE7 A;  1GC6 A;  2TSS A;  2AWT A;  2KHW B;  5CHF A;  4JGH B;  2BGF A;  2WXM A;  2W3R A;  3AMZ A;  4XX5 A;  4HK2 A;  2FUH B;  1ZXI A;  3Q8C A;  3L0W B;  1F1H A;  4IM3 A;  1EWC A;  3LXF A;  1R4N B;  3KUD B;  1N62 A;  1WJ6 A;  4MT5 A;  1XQQ A;  1HXY D;  3P4S B;  3WIM A;  1I4H A;  1C4A A;  2KWD A;  4NAW B;  3RN9 C;  2L3Z A;  5IOI A;  4C4V B;  4RGO S;  4W9C A;  2ON8 A;  3Q6B A;  5BYQ A;  1NEK B;  3M95 A;  4W9E A;  4YTM B;  2KQ7 A;  1SSN A;  4NJ7 A;  5FR3 A;  2KWU B;  3N1X C;  1WI0 A;  3ZJV A;  3RZF A;  1ZP0 B;  3T3O A;  3R8B A;  3P63 A;  3ALB A;  4A3O A;  2L52 A;  2LGY A;  4KX6 B;  3BYT B;  2BTE A;  3GE3 C;  1RYJ A;  2JZP A;  4RFB A;  4YT0 B;  1UEL A;  1QKZ A;  3PO0 A;  4G11 A;  5T8I A;  1YN4 A;  3B2G A;  2CR5 A;  2MA9 B;  2NCN A;  1NVI D;  1NYQ A;  1E9M A;  1MPE A;  2W82 A;  4HPP A;  1WJN A;  1RRB A;  5E6P A;  1BT0 A;  3VRB B;  4A55 A;  1Q1O A;  3C0R B;  3WA0 A;  1UH6 A;  2DEN B;  3VUX A;  2N7J A;  1L0Y B;  3PGE A;  1YX6 B;  3I63 C;  3PTF C;  1B1Z A;  2OOB B;  1WR1 A;  1RM6 C;  1WMH B;  2L7R A;  2UU7 A;  4JL9 A;  4BKS D;  4GDL A;  1KLG D;  2N7E A;  1WGH A;  4FHK A;  3NVZ A; 
#chains in the Genus database with same CATH homology
 1TS3 A;  1MVK A;  4KGS A;  3EUB 2;  4MAC A;  2IJ0 A;  2W3S A;  3VRA B;  1GB1 A;  4JX1 C;  2IGD A;  3DWG C;  3BII D;  1DOX A;  3ETR A;  5BMI A;  5LNK 1;  3EGR A;  4YSY B;  1HQR D;  1N63 A;  3AH7 A;  2LHD A;  4MH8 A;  5EE3 A;  4EE2 A;  1D5Z C;  2NTS A;  1FCL A;  3MJ5 A;  2DBY A;  1XO3 A;  3H8H A;  4XWT A;  4O1N A;  1TY2 A;  1YNT E;  3AE8 B;  2M19 A;  4NAM A;  1FMA D;  1PGX A;  3GS2 A;  2GRI A;  4TQ0 A;  2I38 A;  2JWU A;  3NZ3 A;  3E56 A;  1QT9 A;  4UDU C;  1JW9 D;  1YQ3 B;  3MP9 A;  1PGA A;  3VR8 B;  1QOA A;  4ZRP A;  3OWE B;  3W5V B;  2RPV A;  2QJL A;  5HG2 A;  1JCK B;  3NS1 A;  1YN3 A;  2LHE A;  1VZ8 A;  2G9H D;  4YWG G;  3RPF C;  3EA6 A;  1AYF A;  1IGD A;  1JWA D;  3R2T A;  1XCQ L;  2PTL A;  2QEJ C;  1IBX B;  3P4R B;  3AM9 A;  2MJD A;  1I4R A;  4CQN A;  1LO5 D;  1BUI C;  1QOB A;  2BT6 A;  2L32 A;  2RDH A;  4HRS A;  1MHH E;  2J52 A;  1C77 A;  1VZ7 A;  2WXG A;  1GAQ B;  1ENF A;  1TS4 A;  1ZDX A;  2KAJ A;  3ZGZ A;  4C56 C;  1BML C;  2AX5 A;  2CJN A;  5HI1 A;  4C7Y A;  1JWM D;  1TY0 A;  2LUM A;  3Q8A A;  3ZQ4 A;  3AED B;  1K51 A;  2KMM A;  2V3N A;  1PUT A;  1E6E B;  5FKA C;  3TUO A;  2XNA C;  3NVY A;  5EE9 A;  3U7Z A;  1YMH E;  4A90 A;  5GXG B;  1R7S A;  1I4Q A;  5E6J A;  1L4D B;  2WU5 B;  2ZW0 A;  3AEE B;  3AV8 A;  2WS3 B;  1SE3 A;  1WSP A;  1VDV A;  2V3P A;  3E9S A;  4LTU A;  4OW0 A;  2SAK A;  2QMT A;  1D4B A;  2PKO A;  3SFE B;  1HZ5 A;  1XLN A;  4L2Y A;  4N6E B;  3W1S A;  1C4C A;  4YXD B;  1J7C A;  3URY A;  1QOG A;  2K9X A;  1FFV A;  1RWS A;  2WXN A;  4RGN A;  2IGG A;  2KDM A;  2OED A;  4ITK A;  4XDC A;  3TEX A;  1FFU A;  3AN1 A;  3V3X A;  1WRI A;  4WAF A;  2WP9 B;  4TSS A;  3HRD D;  1YN5 A;  3AEB B;  1WWT A;  3NVV A;  2D5G A;  2WXQ A;  1AN8 A;  2WXR A;  1SEB D;  2H88 B;  4DXF A;  4WUR A;  2HDE A;  4C80 A;  2KN4 A;  2DLB A;  4ZOH C;  1DOI A;  1ACC A;  3FC4 A;  2Q5W D;  3AE5 B;  4OZB A;  5AUK A;  4JPS A;  2M56 B;  3P42 A;  1PDX A;  3P1M A;  5BMG A;  3MHZ A;  1V8C A;  1VJK A;  2GB1 A;  3L4P A;  2I2Y A;  3RFZ B;  2DWQ A;  2PLP A;  1XLO A;  3TEY A;  1PYW D;  3MFG A;  2JQR B;  1VRA B;  2ICI A;  2NMQ A;  3ZJT A;  2VZK D;  4FXC A;  5EE0 A;  2INN E;  5C3J B;  4WIP A;  2FE8 A;  3ZJU A;  4C7Z A;  5MPO A;  1VLB A;  4KKI A;  4XDD A;  4GDK B;  5BYR A;  2QSD A;  1NYR A;  4N59 A;  2N9K A;  4IOI E;  3GB1 A;  4RH6 A;  1SXT A;  4OVZ A;  3W5U B;  1SIJ A;  4NZL B;  1DYQ A;  3PZ8 A;  4M0W A;  1UGJ A;  1OQR A;  2WQY B;  1WGK A;  2WDR B;  1AWD A;  3P4P B;  1T5X D;  1M4V A;  4US8 A;  2J42 A;  1EU4 A;  1P7E A;  3AE6 B;  1ESF A;  2INP E;  3J9C A;  1JRP A;  2GI9 A;  2V0G A;  1BXT A;  2AQ3 B;  4MM3 B;  2R61 A;  2MJE A;  1WYG A;  1DGJ A;  2DYO A;  1TZO A;  4HKZ E;  2WXF A;  2WXO A;  1YQ4 B;  1F2R C;  3AE1 B;  3BVG A;  1T3Q A;  1WXQ A;  3ZYY X;  1C78 A;  1ZPS A;  3R2I A;  3TEW A;  1NEN B;  1UWM A;  3IT6 B;  2Y5C A;  2FUG 1;  3N9Y C;  1V1O A;  4RNA A;  1SE4 A;  2N9L A;  4US9 A;  1C4P A;  1N5W A;  2FBW B;  4Q2J A;  2XN9 C;  5HFY A;  2BB5 A;  3TEZ A;  4USA A;  3DWM A;  2WXL A;  1QF6 A;  4OZC A;  4XE0 A;  1ET9 A;  3IAS 1;  2E3T A;  2WXI A;  5TSS A;  3BVM A;  3CWI A;  3BK2 A;  2WDV B;  2Y5P A;  4WWM A;  2L1A A;  4YTN B;  1PGB A;  1I4G A;  2LGI A;  4REZ A;  1L6U A;  3BK1 A;  1TS2 A;  1XLP A;  4KKJ A;  3I9V 1;  2WXH A;  1F2R I;  5BYS A;  2RDG A;  4OZA A;  3B2F A;  5D7G A;  1IUE A;  1MHX A;  3PZ7 A;  1J7A A;  1CQV A;  1ZUD 2;  2CJO A;  1HZ6 A;  1FIQ A;  2V4I B;  4B0E A;  3Q8E A;  3LYY A;  5G5G A;  3W9C B;  4A9A A;  4A6Q A;  4P16 A;  1OQQ A;  3BWU D;  4B0M A;  4JE3 B;  4YSX B;  1IBX A;  2YEP F;  2QIL A;  2EEL A;  1VZ6 A;  1VR9 A;  2LMC A;  4P6V F;  1E10 A;  2DYM A;  3NVW A;  1UUP A;  4HRO A;  1FO4 A;  1SE2 A;  2IDY A;  2WXP A;  1F0Z A;  1QIL A;  1K50 A;  1YJI A;  3FAH A;  1L0X B;  2E6X A;  1EM7 A;  1XEE A;  5JXV A;  3FIL B;  3HVZ A;  2AQ1 B;  2KQ4 X;  1FXA A;  4AQ7 A;  1I7H A;  2BS4 B;  1STE A;  2WXJ A;  4RF0 A;  1PFD A;  4DQO C;  3AE3 B;  1YJJ A;  4HJG E;  1KFY B;  3KLS X;  1JWS D;  1KF6 B;  1FNU A;  2J53 A;  4L23 A;  1N5X A;  3Q8B A;  4J3O D;  3I57 A;  3Q8F A;  2ZW1 A;  1Y56 A;  1GPX A;  1I4P A;  3SEB A;  2ACZ B;  4KGT A;  4WH4 A;  4GDL B;  1IGC A;  1HA5 A;  1L0V B;  1TYG B;  2RMM A;  3HVD A;  5D3D A;  2K22 A;  4RGT A;  5H92 C;  4YSZ B;  5I4D A;  2IPK D;  4DXG A;  1CK1 A;  1GB4 A;  3IAM 1;  3UI3 A;  1QLB B;  4ZHO A;  1JQ4 A;  2NTT A;  2W55 A;  3AE7 B;  4NJC A;  3FIL A;  2PMV A;  1TJE A;  3NUH B;  1FEH A;  1HEZ E;  1XXG A;  4ZRQ A;  4LK0 M;  2J4X A;  1TS5 A;  1V97 A;  2PVO D;  4H2A A;  4HKQ A;  3AE4 B;  1FCC C;  1KH0 A;  2G1E A;  4LLG M;  3HUI A;  1ZXH A;  1D5X C;  3T3N A;  5C2T B;  3W2D A;  4PT5 A;  3AEA B;  2IGH A;  2JSV X;  4TMA B;  5EE1 A;  2PIA A;  3IXS A;  1RFK A;  3ABV B;  1EU3 A;  2LEK A;  1C79 A;  3IT4 B;  1K52 A;  1CJE A;  3KQ4 A;  2L83 A;  1N61 A;  1EWY C;  4ARC A;  2VZK B;  1C76 A;  1ET6 A;  2CU3 A;  2BS3 B;  2JYT A;  2WNM A;  1XCT L;  3BYY B;  4ARI A;  1Q10 A;  2EKI A;  1SBB B;  4RCO A;  1N60 A;  4IKG A;  2MH7 A;  4L1B A;  1OFF A;  3NRZ A;  3C8Y A;  1L6V A;  2BS2 B;  1E0Z A;  3SR6 A;  4TQ1 A;  1B9R A;  1FNW A;  3AE2 B;  1QQR A;  4OHJ A;  3B9J A;  5G5H A;  1V1P B;  2WDQ B;  2TSS A;  4KGR A;  1JML A;  3CIR B;  1UNS A;  2WLB A;  3AB5 A;  2QIE B;  1T6B X;  2WXM A;  2W3R A;  3AMZ A;  1JRO A;  1TKG A;  2JX5 A;  1ROE A;  5BMH A;  1J7B A;  1MI0 A;  5AUI A;  1ZXI A;  2OHF A;  3Q8C A;  1A70 A;  1EWC A;  3LXF A;  3MC0 B;  1L5P A;  1GOZ A;  1TKE A;  2WXK A;  1D6E C;  4ZHP A;  1N62 A;  2BBC A;  1P7F A;  2Y3A A;  4MT5 A;  3LB8 C;  4HEA 1;  1AW7 A;  5FK9 C;  1JAL A;  3Q69 A;  1HXY D;  3P4S B;  1I4H A;  2MEK A;  1C9F A;  1C4A A;  2KWD A;  4JWU C;  4NAW B;  4RGO S;  4GLS C;  3VR9 B;  2K0P A;  4JWS C;  2LJI A;  2ON8 A;  1FXI A;  5BYQ A;  1F77 A;  1NEK B;  1XLQ A;  1FNV A;  1FRR A;  1V1P A;  1K53 A;  1TKY A;  2B76 B;  4YTM B;  2W54 A;  1SSN A;  1I4X A;  5FR3 A;  2BB6 A;  3ZJV A;  3AEG B;  1ZP0 B;  3T3O A;  3R8B A;  2JYE A;  3P63 A;  1JWU D;  2LFI A;  2BW2 A;  2L52 A;  3BVZ A;  5D3I B;  4KX6 B;  3BYT B;  3VQI A;  2BTE A;  4AS1 A;  1RYJ A;  1KRH A;  3AEC B;  2JZP A;  3P4Q B;  4RFB A;  4YT0 B;  3SFD B;  3V05 A;  2BYT A;  3BZD B;  1QKZ A;  3PO0 A;  2PW9 A;  5T8I A;  2YEP B;  1KTK A;  1YN4 A;  3B2G A;  3KWL A;  4YTP B;  1NVI D;  1NYQ A;  1E9M A;  1L4Z B;  3U4E G;  4D2K A;  1E7P B;  1FM0 D;  1MPE A;  2W82 A;  3AEF B;  3O13 A;  4XWW A;  2AQ2 B;  4N58 A;  1JWB D;  4R3D A;  1UWX A;  1SF0 A;  3VRB B;  3TSS A;  4A55 A;  4A8X C;  1DOY A;  2K5P A;  4WQM A;  2JU6 X;  1KLU D;  1ZOY B;  1QOF A;  2K3U A;  2PVG C;  4IDI A;  1ZDV A;  3KWV A;  1CZP A;  2KAC A;  4RGM A;  2X38 A;  2N7J A;  4ZYS A;  1L0Y B;  2WU2 B;  3WCQ A;  2H89 B;  2N0S B;  2Z8L A;  1B1Z A;  2JXT A;  2MJ3 A;  2SEB D;  1RM6 C;  2HTM E;  3AE9 B;  1XF5 L;  3GP7 A;  4RF1 A;  1FRD A;  1SJE D;  1ZE3 D;  2ONQ A;  5HHD G;  1KLG D;  5H8Y E;  1FD6 A;  1D5M C;  2M0A A;  3U2S C;  1SB3 C;  1NI3 A;  3U52 E;  3NVZ A;  1SJH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...