1FCLA

Delta1.5: a computationally designed core variant of the b1 domain of streptococcal protein g
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
56
structure length
56
Chain Sequence
TTFKLIINGKTLKGETTTEAVDAATAEKVLKQYINDNGIDGEWTYDDATKTWTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Designed protein G core variants fold to native-like structures: sequence selection by ORBIT tolerates variation in backbone specification.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Protein binding
molecule keywords IMMUNOGLOBULIN G BINDING PROTEIN G
total genus 8
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1fclA00
1UWXA 2J52A 2RPVA 4GLSC 4MACA 2N7JA 2N9LA 1K51A 1XCTL 1D4BA 1C9FA 2EELA 2QSDA 1IBXA 2PW9A 2GI9A 5HHDG 1ZXHA 1PGAA 1XCQL 4OZBA 5HFYA 1HZ6A 1IGDA 1MHXA 2JWUA 1YNTE 2LHDA 4KGTA 1MI0A 1FCCC 1P7FA 2ONQA 5HG2A 1K53A 3MP9A 5JXVA 5BMIA 1FCLA 1P7EA 1PGBA 2KN4A 4HJGE 2IGDA 2KACA 1YMHE 2ZW0A 2PLPA 4OZAA 2ON8A 4IKGA 4D2KA 1IBXB 2PTLA 3FILB 2NMQA 3GB1A 2JSVX 2KWDA 1XF5L 2JXTA 5BMGA 1IGCA 1MVKA 2QMTA 2ZW1A 1F2RC 4IOIE 2JZPA 2JU6X 4WH4A 4OZCA 1EM7A 2KDMA 1F2RI 2N9KA 5BMHA 2LGIA 1K50A 1HEZE 1FD6A 3FILA 1JMLA 1MPEA 2RMMA 2KQ4X 1Q10A 2J53A 4KGRA 3V3XA 2OEDA 4HKZE 1KH0A 1PGXA 2I38A 2GB1A 2LHEA 1GB1A 5HI1A 2K0PA 1K52A 1QKZA 2IGGA 3UI3A 1GB4A 2I2YA 1MHHE 2IGHA 4KGSA 1HZ5A 2LUMA
chains in the Genus database with same CATH superfamily
3VVWB 4JPSA 4FULA 3Q3JA 1WGYA 1D5ZC 1WXMA 2N9LA 1N5XA 3BZDB 1J7AA 1J0GA 2ZVNA 2MBBB 4HCNB 1V8CA 1WX9A 3NRZA 2LFIA 2KMMA 1VDVA 3PV1A 4H2AA 3R7QA 4K3BA 2G4DB 2DENB 2KTFA 3NOBA 3VR9B 4KSLC 5AZHA 1JCKB 4CQNA 2BYVE 2N7DA 1QF6A 3ENEA 2PVOD 3N1XC 3MJ5A 4A90A 1WSPA 4ZHOA 2D3GA 1VR9A 2PVGC 4LLGM 4IG7B 3I3TB 4URKA 3KQ4A 4OW0A 3H9DA 4D2KA 2IO2B 3CWIA 2WXPA 1JWAD 4EZKA 1V5TA 4B0MA 4DK5A 2WXRA 3NS1A 5DCNA 1CJEA 3Q69A 3WIMA 1YD8U 3IAM1 2ZVOA 1AYFA 1OEYA 3ZNID 2KC2A 5D3IB 2MW5A 2WYQA 2YEPF 3KYCD 1SEBD 3A9KB 1JQ4A 5EE1A 1EUVB 5JHAA 3NZSA 1XXGA 2OEDA 5DPRA 3RZFA 3SDLC 2MRPA 1PQSA 2C7HA 1E6EB 3VUWA 1V86A 3RNFC 2X8XX 2OHFA 4BKGA 3AEBB 3UI3A 3NG0A 3PZ7A 4ICVA 2LVOA 3BK2A 2AQ2B 2FCQA 2WXKA 2X38A 4AQ7A 2KC1A 1HQRD 2MCNB 2KMCA 3OAWA 1WH3A 1YX5B 2M0AA 2KMAA 2W3SA 2DZIA 3VH3B 1GC6A 1MHXA 1VZ8A 3ML9A 3P1MA 3U30A 1L4ZB 4BBNC 4ZDVA 5E6JA 2V3NA 2FCNA 3EUB2 2G4SA 2IGDA 2K6QA 2PLPA 3AXCA 3RI7C 2YVCA 3DHGC 1DYQA 1I35A 1U4AA 2JZ3B 4IC7B 1CZPA 4LDTD 1P98A 3APDA 3HVDA 3PVLA 1F2RC 2WXMA 4K7SA 3TUOA 4MEMA 2WP9B 3BYYB 4DBGA 2LGIA 1YJ1A 2HTHA 3IBEA 3R66C 2DAJA 2N9PC 4NZLB 4DHZE 1TT5B 1I4XA 3AECB 2FIDA 2YEPB 3DBRI 3VDZA 4HLEA 2DYBA 2HDEA 4L2YA 1RWSA 2LHEA 3L0WB 2KYWA 4E74A 4AJWA 2MBEA 1TS4A 4GN1A 4JLCA 5CHVC 1D5XC 3BINA 2N9XA 1SXTA 2GBRA 3K9OB 2WXGA 3ZXVA 2IYDB 2J0KA 4EKUA 1C9FA 3K9PB 1NEKB 1ET6A 2MJ3A 2I1JA 1FNWA 2GBKA 3GP7A 1NYRA 2LZ6A 4PYZA 2BT6A 4A3PA 3RFZB 4YL8A 1IPGA 5IA7A 1FCCC 2D3AA 2AQ1B 4KZCA 3X0WA 1X1MA 4XE0A 2NCNA 3W9CB 3PTFC 2K3UA 1FO4A 2BTEA 1ZUD2 2PPHA 1WM3A 3AE9B 2E3TA 3ZTCA 1V97A 2QIEB 1XF5L 2XK5B 1CK1A 4C7ZA 2LRWA 2AX5A 2WXIA 5D7GA 2WXNA 3L16A 1FXTB 4KZ0A 3V60A 1T0RC 5BYSA 4ZOHC 4IWPA 4I6NB 5HKHA 4K81A 4BKSA 3Q3FA 3FAHA 5D3DA 4II2B 3ML8A 1JROA 3A9JA 5IO9A 4CYEA 2AQ3B 4WWMA 2Z0EB 4LJOB 3V62A 2NTTA 3I9V1 4PK1A 4REZA 2GRIA 4RM8A 2WU2B 1YIWA 3A4SC 4RGOS 1WJNA 2M56B 2I38A 2GB1A 4I6LB 3M62B 4IM3A 3W1SA 3IG3A 2BKRB 3AULA 4KV2A 2FIFA 3PZDA 2MP2B 1C76A 2I2YA 4TQ0A 4HWIB 4ZRQA 4YSZB 1HXYD 1IUEA 4BVUC 4MACA 1NENB 1WJUA 4N59A 4HPPA 4GDLA 3QJZA 4BZAA 3L13A 5CHWA 5AUIA 4LNOA 1EU4A 3VUXA 4XZ4A 2KVZA 2HTME 2K8HA 2NVUI 4A55A 2NBVB 3AE2B 1OQYA 1L0YB 3B2FA 1PDXA 2LXAA 2KT7A 2MBOA 2M4NA 3M63B 3A9KA 1RFAA 3J9CA 5BMIA 2KN4A 4NQKE 3WA0A 3V05A 4EZLA 2ZW0A 1AWDA 2K8BA 5FR3A 2ON8A 5DPWA 2J0MA 3MC8A 2MEKA 3V6CB 4ZYSA 3L4PA 4PYUA 3NVZA 1TS5A 2REXA 2D2QA 2IY0B 4HXDA 3P4PB 3DVNV 5D6JB 4P7IA 1OQRA 2A5UA 2J0JA 1F52A 4BFRA 4WQOB 3QAQA 4N58A 2N9KA 3BWUD 4L1BA 4LDTB 2WGSA 3ZNGC 4EFOA 1F0ZA 2J7QB 3KH0A 2DZJA 4K3CA 1PYWD 1MPEA 2MBQA 3JSVB 1WI0A 2KQ4X 4RF0A 4C7YA 1JW9D 4LNIA 4ANXA 4C00A 1F9JA 4FLHA 2GOWA 3ZYYX 4AWJA 2XBBC 3L08A 1UBQA 1FXIA 2CHWA 2BVCA 1YQ3B 4Q2JA 2KOXA 2CHXA 3VFKA 2FUG1 1B1ZA 5H8YE 3A1QA 4W9JA 4EE2A 2L3ZA 1UWXA 2W54A 2H89B 1P0RA 2L52A 4HPMB 3RNBC 1EF1A 1D6EC 3I57A 2K9XA 4TKNA 1QOBA 2WXJA 2DYMA 3PRMB 2KX3A 1KLVA 4ICUA 4JQWC 2WDQB 1L0VB 3U52E 1E7PB 1V1OA 4GIVA 3T3OA 4TQ1A 2KDEB 3P42A 2SEBD 5C1ZA 1J7CA 1GNUA 2OOBB 5C3JB 5JXVA 2J42A 4KDLB 4AUQC 2WDVB 5IOIA 2GMIC 5CX3A 1XQQA 2WXOA 3PS6A 2FUHB 2L0TA 4JX1C 3B0AA 2SAKA 3VH4B 1SIJA 2ZJDA 2BWES 2JU6X 4MJSA 1EF5A 1EM7A 4GB9A 4E3CA 3A1QB 4WJPA 4PS3A 2C7MB 1FD6A 2QILA 1WYGA 1N63A 2RMMA 1NBFC 2Z8LA 1V1PB 2KTRB 4DHZB 2HE7A 3GZNB 4XC2A 2GLSA 2V9HA 3V3XA 4IWQA 2K22A 3H7PA 4X57B 4NJ6A 1I4QA 4MSQB 2BB6A 2K0PA 1TKGA 1K52A 1NVID 1UZXB 4YXDB 3SEBA 1GB4A 5EE0A 2M8SA 4GOCA 2GBJA 4QAYA 3DOWA 2V4IB 3H8HA 3W2DA 3ZO5B 2KJRA 3GE8C 3M95A 2RPVA 3DVGX 4W9GA 4ANVA 5FKAC 1K51A 2DYOA 3IAS1 1C4CA 3QHTA 5MPOA 1I42A 2CU1A 1SB3C 3Q6BA 3QARA 2Y5PA 2FNJB 2INNE 3ABVB 1LFDA 1FNUA 5JH5C 2KLGA 4WIPA 3TBLD 2VZKD 2JWUA 1J8CA 2A4ZA 2L76A 4MDKE 3HHMA 1ZGUB 2B3AA 3AEGB 1MI0A 2LXCA 2CKHB 3JVZX 1E8YA 1H4RA 3DBLI 4W9IA 2VH1A 2EMSA 3HRDD 4W9HA 1H8CA 5TSSA 5LXHA 3Q8EA 4KIKB 4J3OD 2MQJA 4A6QA 2WDRB 4IM0A 5DPSA 1WR6E 2WXFA 2RGFA 3W1YA 2XN9C 1JWUD 2L05A 1OGWA 2XEWA 3DBRB 2NBUA 4RGNA 1HEZE 1MG4A 4CHKA 1J19A 3CF6E 4FBJB 1VLBA 3ZQ4A 3Q8AA 3OJ4B 1C79A 1CQVA 2N0SB 4A9AA 3AN1A 1TY0A 3BVZA 1TGZB 1E90A 4WAAA 2HJ1A 3Q8CA 1WR1A 1T5XD 1F77A 2J52A 3APCA 3P4RB 4GLSC 1T0SC 3ALBA 4HJKA 5DPTA 5KHQA 3EGRA 4II3B 2L0FA 2EELA 3UINB 2KWUB 3DHIC 2IJ0A 1EWCA 1TZ1A 4P1CC 2PW9A 4JL9A 2JQRB 4N6EB 3DHHC 3L54A 4RCOA 1XLOA 2FCMA 4NJ7A 2KD0A 1VJKA 1Z2MA 4RNAA 5AZFA 1QOAA 2VZKB 4W9FA 1QOGA 2V4LA 2QDFA 1E8XA 2LD9A 3SD5A 4WAFA 2N7EA 2DNFA 4FADA 3Q3OC 3CMMB 2JPHA 3EHVA 3R2IA 1XEEA 3TMPB 1R4MB 2LMCA 1P9DU 5CTRC 3ZRCA 4XGAB 1UBIA 4E71A 4NAMA 1OFFA 2WNMA 3HUIA 1FIQA 3EFCA 3AE3B 2KNBA 1BUIC 1NI3A 4OHJA 3RCZA 1JWBD 2JXXA 1G6JA 2JRHA 3T9LA 4ZRJA 1V9JA 3TEWA 4HDOA 2KXJA 3RYTA 1E5WA 2BBCA 3TL5A 2I1KA 2WQYB 2V1YA 2MJDA 2IGGA 3RN9C 2PKOA 2KZRA 1GOZA 3AE8B 2BB5A 2Y3AA 3SHQA 2UU7A 2WWZA 3ZVVA 1LXDA 1QZEA 5EDSA 4YSXB 2PE6B 2PJHA 3DBHB 2KFJA 1I4HA 3ZNHB 3WAOA 4DDGD 3ZTDA 2QJLA 4MM3B 3H6NA 1KTKA 1WMHB 4FJYA 3LYYA 4I6PA 1TYGB 2L00B 4OVUA 2KWCA 4LNNA 5E6PA 1TS2A 4G0NB 3MHZA 1WXSA 4KIKA 3ONSA 1R4MI 3AE7B 3GS2A 3DBLB 1K53A 1KF6B 3EECA 3GE3C 1HTOA 3UQBA 4HJGE 3R8BA 2C7NB 3AE1B 1WXVA 2K25A 1YMHE 3NY5A 3N3KB 3AI5A 1ZDVA 2DBYA 3UIOB 1KLUD 1YQ4B 1IBXB 4HPLB 2JSVX 2RR9A 1GJZA 1SJHD 3R3MA 1L0XB 5LXIB 4MJSB 2KLCA 1FM0D 4NJCA 2ZNVB 2NTSA 2Q5WD 2QEJC 2M1MA 3QCAA 4F8CB 1GC7A 1K50A 3DWGC 3B2GA 4UDUC 1D3ZA 3SR6A 3Q3NC 1WGKA 5E6OA 3H7PB 2NBWB 2YLMA 1FFUA 1WXAA 2JT4B 2MSED 4YTMB 2KJ6A 3DCGA 2E6XA 1F1HA 2L83A 1YX6B 2ZPNA 3CSTA 3U2SC 4NY0A 1Q5WB 1L5PA 2BPSA 3RNEC 4BOZB 3MC9A 4OVZA 1MHHE 3CIRB 1T0QC 1WGRA 2LUEA 1VCBA 2N7JA 3HK0A 3WALA 1C3TA 1YN3A 2DHZA 1TBEA 4MSMB 3RMKC 3NVWA 3CSFA 4F1SA 2D3CA 1IBXA 3RZWC 1E0ZA 4C80A 2KANA 1UGMA 1KLGD 3LB8C 1SE9A 4OZBA 4GDKA 2D11A 3ZLZA 1JWMD 4FHJA 2TSSA 1M94A 2MA9B 4HCPB 1UGJA 2LJ5A 1WZ3A 2M19A 5LNK1 5G55A 4DWFA 3V6EB 2KDIA 3R2TA 4IM2A 5J2RA 4OZAA 2KWVB 1WF9A 3WAPA 3QWZB 2NMQA 3FILB 3PT2B 4ZRIA 2N1WA 5J18A 4EUTA 1FFVA 1MVKA 2N1VA 3PLUA 3QA8A 3B08A 2JZPA 1KFYB 3UQAA 3TEXA 3AV8A 1VZ7A 1VD2A 4B0EA 4XDDA 1ZE3D 1C4PA 1JMLA 3ZGZA 1K8RB 2QC8A 3PPAA 1ZXIA 2EMTA 4IUMB 3RUIB 2J53A 1V49A 2L8JA 1PGXA 1XLNA 1UD7A 5D94A 1ZDXA 2WDTB 3WANA 2LGXA 2ZEQA 2KJHB 3AEDB 2INDC 1S1QB 3E56A 3DQVA 2OJRA 1LQBA 3RT3B 3WAMA 1XLPA 4W9EA 4BKTA 2W3RA 1BT0A 1UELA 1WE6A 2C5LC 2INPE 1ZP0B 1D4BA 2CR5A 2DLBA 2N4FA 4N9F4 3IT4B 1C77A 1SF0A 2ICIA 4GGQA 3IFWB 2M17A 1XCQL 1RAXA 2N9EB 2LJIA 4PS7A 4DHJD 5G5GA 2JF5A 4EZJA 3DBSA 4MT5A 1NYQA 3P2BA 2K6DB 4ZRKA 1TKEA 2DWQA 2JZZA 1P7EA 4LK0M 3AEFB 1N62A 1ISNA 5IKCM 3ECIA 5G2NA 3PZ8A 4MGYE 4K1RB 2MWSB 4MH8A 2IY1B 1FMAD 1WGDA 2ZCBA 1NI2A 1S3SG 3MJWA 3AEEB 4LNKA 1Z5SB 4P16A 4GDLB 3B9JA 1TS3A 2RDGA 2XK5A 3T8MA 2AEHA 3I5JC 2BWFA 3ZDTA 2R61A 3C0RB 4MGZE 2LWPA 2WLBA 4FXCA 4HROA 1KH0A 4US9A 1SGHA 3DPDA 4B9KA 3NZUA 3QC8B 1V81A 1WJ6A 4YTNB 5HI1A 2KX0A 3VRBB 4W9KA 2J4XA 3S2AA 2KQSA 2BW2A 3VTVA 1P1AA 1R4NI 2Z59B 4ANWA 1WGHA 1WZ0A 3FC4A 3OG5A 5JHBA 2M0XA 4USAA 2CJNA 3BY4B 4M02A 4W9LA 1UWMA 4IDIA 1M4VA 4G3XB 4RGTA 2ACZB 1JRUA 1WRIA 3UF8A 1N60A 3IXSA 2G1EA 4RFBA 3EA6A 3O65B 1J7BA 4KKJA 5HFYA 3O13A 1ZPSA 1ROEA 1YOVB 5EE9A 1L6VA 4BKSD 1SE2A 3MFGA 1TTNA 4B6WA 4G11A 1D5MC 2RSUA 1L7YA 2LASA 1Y56A 2KACA 4FA6A 1BMLC 2AWTA 2PTLA 4MGIE 2UYZB 2JXTA 1C4AA 1WY8A 5FR6A 2K5PA 2ZW1A 2KKCA 3QK0A 1OEYJ 2AL6A 2KQ7A 4LNFA 2IPKD 2W82A 5AUKA 2FAZA 3ZXRA 3TIXA 3FILA 2AL3A 3NJTA 1TJEA 1R4NB 3P63A 2V3PA 2VRRB 5L83A 2H88B 3KYDD 4HK2A 2MP2A 3TEZA 4JWSC 5GMVA 3JSVA 2C9WB 4RH6A 1QKZA 1LM8B 3ZJVA 3URYA 3AMZA 2RDBC 2IGHA 4ARIA 2HD5B 1MJDA 4GU2A 2JUOA 4A20A 3KWLA 3MHSD 2L7RA 2Y5CA 2KHWB 1E10A 1NDDA 2D5GA 3A33B 1V2YA 1FRRA 1V5OA 5L95C 2CJOA 3KLSX 1DOXA 2MX2A 2CU3A 4PS8A 2W9NA 1WM2A 2O6VB 3RNGC 1T6BX 5KHOA 3OJ3A 3BVGA 3RD2A 2RDHA 4NPNA 2BS2B 1R7SA 2O6VA 5IN7A 1YN5A 4C4VA 4M0WA 4XYCA 2PE9A 1PGBA 1JWSD 4ARCA 2RPQA 3M3JA 2EKIA 3PHWB 3LJ3A 1XO3A 1WIAA 1QOFA 2KWDA 3C8YA 5BMGA 3HM3A 1AW7A 1IGCA 1P3QU 3PRZA 3NVVA 3SFEB 1BXTA 4S0RA 4OVVA 1PUTA 1C78A 1YQBA 3ZIMA 1FPYA 3AE4B 1KRHA 2KK8A 4RGMA 2BYEA 1A70A 3HIZA 4R3DA 4MH0E 3PRPB 2KO3A 3KUDB 1E8ZA 1RFKA 1ET9A 4DXFA 2WU5B 2IO3B 4RMAA 3VQIA 1B9RA 3AM9A 4ANUA 2BKFA 2JRIB 2R2QA 3VXWA 4A3OA 1TZOA 1A5RA 3JW0X 2PMVA 3ZW3A 4KKIA 4TSSA 2NPTB 3Q8FA 2JWZA 4KGSA 1GUAB 3H1UA 1HZ5A 3U8ZA 2BYTA 3PLVA 3U4EG 2D10A 5J17A 5IP4D 4F7ZA 1I4PA 1N61A 1EWYC 2AYOB 1ZOYB 2K39A 5LLIA 1JALA 1MG8A 3UGBB 4JGHB 3BVMA 4MELA 5AEKB 4IW0A 4LTUA 2KN5A 1ZXHA 3GZNI 1FXAA 4FJVB 3ZJUA 4ACFA 3ZNZB 4PT5A 5AZGA 3TJPA 4M00A 1V1PA 2KTRA 2ONQA 3KWVA 3ZJTA 1TY2A 1XD3B 1L2NA 1WE7A 3W5VB 2KDFB 4XX5A 2Y5BB 5H92C 1LGRA 1WGGA 3PGEA 3UIPB 2HJ8A 1ENFA 2QMTA 4MGKE 3W5UB 2DZMA 1EU3A 1Q1OA 2CS4A 1E7UA 3GOEA 4WJOA 4DXAB 2MH7A 2KDMA 3SFDB 1F2RI 3AEAB 2ASQA 3U7DA 5BMHA 3BIID 3PSEB 1XLQA 2FCSA 4NQLB 4GMVA 1EO6A 1WYWB 4YT0B 3TSSA 3MTNB 3U7ZA 2BYFA 4WWPA 1I7HA 4M0WB 4HRSA 2W55A 4KGRA 4O1NA 5T8IA 4XWTA 2D3BA 2G45B 1UNSA 2GBMA 1SBBB 1GB1A 3P4QB 2QCZA 5BYQA 4DDID 2LVQA 1OTRB 2KFKB 1YJIA 4K7UA 2NS5A 1YJJA 4KSKC 3KVFB 3RPFC 5C23A 4HEA1 4HKQA 1TIFA 3ETRA 4NNJB 1XCTL 3QQ8B 2LGYA 2QSDA 3VAWA 1LO5D 4W9CA 4WJQA 2L32A 1VRAB 3RULA 3X23A 1WWTA 2GI9A 3NVYA 4S17A 1IP9A 3AE6B 1IGDA 3N32A 4CO7A 1YNTE 2D07B 4P6VF 1KOTA 4BBNF 3BK1A 3VUYA 2ZCCA 1OQQA 2O6VD 1P7FA 5HG2A 3MP9A 4W9DA 2BS4B 3KUCB 2WS3B 2JVCA 5CHFA 4KVGB 1VZ6A 4TMAB 2IZVB 1FEHA 5FK9C 5BO4B 1HTQA 4C56C 2LI5A 4IKGA 3NUHB 4ZYNA 3DVNU 1SIFA 4AS1A 5JZEB 4BOSC 4ASWC 2VH2A 4ZHPA 4LJPB 2OJWA 1ESFA 3N20C 2KFKA 4M01A 2CHZA 1WRDB 4L23A 3N1ZC 4BAXA 5BYRA 4JIOU 2ZNVC 3N1YC 3ZDMC 2MLBA 3NS8A 3EC8A 4K7WA 5GXGB 3JYUA 3VTWA 3BYTB 1GPXA 1WX8A 2JX5A 4JWUC 1QQRA 3P4SB 3QIJA 3HVZA 3V61A 2WXHA 4IWOA 1AN8A 1HA5A 1T0YA 2V3SA 3FKYA 4MM3A 3DBHI 1E8WA 2KAJA 3C19A 4XDCA 1ZKHA 4J6IA 1CMXB 1QILA 1DGJA 2NR2A 1JRPA 1ZW7A 3TEYA 2IO1B 4TV3A 2KVRA 4DHJB 2EKEC 2JYEA 4M8MA 3B1LX 3PHXB 4JE3B 4G50A 3ZUNA 3EFUA 4XWWA 1UH6A 1HZ6A 1QT9A 3RNCC 1IYFA 1GG3A 2LGDA 5I4DA 2C60A 2LHDA 1WFYA 3NZ3A 1WXQA 4FJZA 2O2VB 4RM9A 4B95A 3A4RA 3HM6X 1FCLA 1STEA 2DZKA 2UWQA 1FRDA 1L4DB 3MC0B 4WWOA 4FHKA 2V0GA 3L10B 2MJEA 4LCDE 4FN2A 2K1FA 4WH4A 1PFDA 3Q14C 1WX7A 4WWNA 1I4GA 3IVFA 2IBIB 2KDBA 2L1AA 1XT9B 4RF1A 1Q0WB 4AP4C 2DX5B 2WX1A 1AARA 2BGFA 3L17A 2G9HD 5C2TB 2DAFA 4GXBA 4YSYB 2LVPA 2XNAC 2PEAA 3PO0A 4C4VB 3LXFA 4EOYA 2MBHA 3TCAA 2WXQA 3KW5B 1RM6C 3AU5A 3Q3MC 3AB5A 2MHJA 2LEKA 3OWEB 2LUMA 1N5WA 1RYJA 2G3QB 3Q8BA 3A9JB 1ACCA 1WMHA 3ZRFA 4KX6B 3DDCB 3QX1A 2BS3B 2K8CA 2JY6A 3R7RA 1V80A 3W1SC 1FNVA 4M8NA 3DVGY 4EEWA 2INCC 2O2VA 2FE8A 2NPTA 3OLMD 5HHDG 1PGAA 3APFA 3AU4A 1L6UA 2B76B 1Y8RC 4NAWB 3VHTC 3DWMA 5TR5A 4GSWA 3IHPC 3KUZA 4KGTA 5D2MB 1YN4A 1QLBB 4YTPB 1V6EA 1KJTA 4DXGA 4NAWA 3AH7A 3ZKJC 4US8A 2JYTA 3N30A 1SSNA 2QHOA 2WXLA 4DQOC 3VR8B 3LDZE 1RLFA 1RRBA 1TKYA 3GB1A 4ZRPA 1GAQB 2ZZPB 3D32A 3VRAB 3H7SA 3PREA 4YWGG 3RNAC 1T3QA 4TUUA 1SJED 1N6ZA 1SE4A 2Z0DB 4KDIC 2IDYA 4IOIE 3WCQA 5E6NA 4OZCA 1HE8A 2R2OA 1C1YB 2BQQA 2LRUA 2ZPYA 2FBWB 2LGSA 1E7VA 3NHEB 3VTUA 1WJ4A 3IT6B 3Q2AC 4A8XC 3T3NA 2BF8B 1E9MA 2WHIA 4AJYB 1DOIA 4WURA 2WX0A 2PIAA 1Q10A 1MFWA 4HVBA 5IAAC 4HKZE 4P1BC 1SE3A 2RD0A 2IO0B 4GDKB 1DOYA 4AOFA 3I63C 3AE5B 5G5HA 1UUPA 4WJNA 4HDQA 4WQMA 3E9SA 5EE3A 3SU8X 1UF0A 4ITKA 1I4RA 2GBNA 3N9YC 1KM7A
chains in the Genus database with same CATH topology
1UWXA 2W54A 3U4EG 2H89B 4JPSA 2L52A 2N7JA 1D5ZC 2N9LA 1I4PA 1D6EC 1N5XA 3BZDB 1YN3A 1N61A 3I57A 2K9XA 1J7AA 1EWYC 1ZOYB 1QOBA 3NVWA 2WXJA 1JALA 1V8CA 2DYMA 3NRZA 2LFIA 2KMMA 1IBXA 2WDQB 1L0VB 3BVMA 3U52E 1VDVA 4H2AA 1E7PB 1E0ZA 4LTUA 1V1OA 4C80A 1ZXHA 1KLGD 3LB8C 4OZBA 3T3OA 3VR9B 1FXAA 1JCKB 4TQ1A 1JWMD 4CQNA 3P42A 2TSSA 2SEBD 3ZJUA 1QF6A 4PT5A 2PVOD 4A90A 3MJ5A 1UGJA 1J7CA 1WSPA 1V1PA 2ONQA 4ZHOA 5C3JB 2M19A 1VR9A 3KWVA 3ZJTA 2PVGC 1TY2A 5LNK1 4LLGM 5JXVA 3W5VB 2J42A 3R2TA 2WDVB 5H92C 3KQ4A 4OZAA 2WXOA 3N9YC 4OW0A 4D2KA 2NMQA 3CWIA 3FILB 2WXPA 4JX1C 1JWAD 4B0MA 1FFVA 2SAKA 2WXRA 1SIJA 3NS1A 1MVKA 1ENFA 2QMTA 3W5UB 1CJEA 2JZPA 3Q69A 2JU6X 1KFYB 1EU3A 1EM7A 3IAM1 2MH7A 2KDMA 3SFDB 3AV8A 1F2RI 1VZ7A 3AEAB 3TEXA 1AYFA 5BMHA 4B0EA 4XDDA 3BIID 1ZE3D 5D3IB 1XLQA 1C4PA 2YEPF 1FD6A 2QILA 1JMLA 3ZGZA 1SEBD 1WYGA 1N63A 2RMMA 2Z8LA 4YT0B 1JQ4A 1V1PB 5EE1A 3TSSA 3U7ZA 1ZXIA 1I7HA 4HRSA 2J53A 2W55A 4KGRA 3V3XA 1XXGA 2OEDA 4O1NA 5T8IA 2K22A 1PGXA 1E6EB 1I4QA 4XWTA 1XLNA 1UNSA 2BB6A 1SBBB 1GB1A 3P4QB 5BYQA 1ZDXA 2K0PA 1TKGA 1K52A 1NVID 2OHFA 3AEBB 3UI3A 4YXDB 1YJIA 3SEBA 1GB4A 5EE0A 3AEDB 3PZ7A 1YJJA 3E56A 2V4IB 3H8HA 3W2DA 3RPFC 1XLPA 4HEA1 3BK2A 2RPVA 4HKQA 2W3RA 3ETRA 2AQ2B 2WXKA 5FKAC 1K51A 1XCTL 2DYOA 2INPE 1ZP0B 2X38A 3IAS1 1C4CA 2DLBA 5MPOA 1D4BA 4AQ7A 1SB3C 1HQRD 2QSDA 1LO5D 3IT4B 2Y5PA 1C77A 2L32A 1SF0A 1VRAB 2ICIA 2INNE 3ABVB 2M0AA 1WWTA 2W3SA 2GI9A 3NVYA 1FNUA 4WIPA 1XCQL 3AE6B 2LJIA 5G5GA 1IGDA 1MHXA 1VZ8A 1YNTE 2JWUA 2VZKD 4P6VF 3P1MA 1L4ZB 3BK1A 3AEGB 4MT5A 1NYQA 1MI0A 1OQQA 1P7FA 5HG2A 3MP9A 5E6JA 2V3NA 3HRDD 1TKEA 2BS4B 5TSSA 2WS3B 3EUB2 3Q8EA 2DWQA 4LK0M 1P7EA 4J3OD 1VZ6A 4TMAB 2IGDA 3AEFB 1FEHA 1N62A 5FK9C 2PLPA 4C56C 4IKGA 3NUHB 4A6QA 1DYQA 3PZ8A 4AS1A 2WDRB 1CZPA 4MH8A 3HVDA 4ZHPA 1F2RC 1FMAD 2WXMA 2WXFA 1ESFA 2XN9C 3TUOA 3AEEB 1JWUD 2WP9B 3BYYB 4P16A 2LGIA 4GDLB 3B9JA 1TS3A 4RGNA 4L23A 2RDGA 1HEZE 4NZLB 5BYRA 2R61A 3AECB 1I4XA 2YEPB 5GXGB 2HDEA 2WLBA 4L2YA 4FXCA 3BYTB 1VLBA 4HROA 1KH0A 4US9A 3ZQ4A 1GPXA 3Q8AA 1C79A 2JX5A 1RWSA 2LHEA 4JWUC 1CQVA 1QQRA 3P4SB 4YTNB 3HVZA 5HI1A 2WXHA 3VRBB 2N0SB 2J4XA 4A9AA 3AN1A 1TY0A 1AN8A 3BVZA 1HA5A 1TS4A 2BW2A 3Q8CA 2KAJA 1T5XD 1F77A 2J52A 1D5XC 3FC4A 3P4RB 4GLSC 4XDCA 1QILA 4USAA 1SXTA 1DGJA 2CJNA 2WXGA 1JRPA 3EGRA 1C9FA 2EELA 1UWMA 3TEYA 2IJ0A 1EWCA 4IDIA 1M4VA 4RGTA 1NEKB 2ACZB 2JYEA 2PW9A 1ET6A 2MJ3A 2JQRB 1WRIA 4N6EB 1N60A 1FNWA 3IXSA 4JE3B 2G1EA 4RFBA 3EA6A 1J7BA 4KKJA 5HFYA 4XWWA 3O13A 4RCOA 1XLOA 1ZPSA 1HZ6A 1QT9A 1ROEA 3GP7A 1NYRA 5EE9A 1L6VA 2BT6A 3RFZB 5I4DA 2LHDA 3NZ3A 1SE2A 3MFGA 1FCCC 1WXQA 1VJKA 2AQ1B 4RNAA 2BYTA 1QOAA 4XE0A 1D5MC 2VZKB 1FCLA 1QOGA 1STEA 3W9CB 2K3UA 1FO4A 2BTEA 1ZUD2 1Y56A 1FRDA 1L4DB 3MC0B 2KACA 4WAFA 3AE9B 2V0GA 1BMLC 2E3TA 2PTLA 2MJEA 1V97A 2QIEB 1XF5L 2JXTA 1CK1A 4C7ZA 2AX5A 1C4AA 2WXIA 5D7GA 2WXNA 2K5PA 2ZW1A 3R2IA 1XEEA 2LMCA 4WH4A 1PFDA 2IPKD 2W82A 1I4GA 5AUKA 5BYSA 4ZOHC 4NAMA 1OFFA 2WNMA 3HUIA 1FIQA 2L1AA 3FILA 4RF1A 3AE3B 3FAHA 5D3DA 1BUIC 1TJEA 1NI3A 4OHJA 1JWBD 1JROA 2G9HD 5C2TB 2AQ3B 3P63A 4WWMA 2V3PA 2NTTA 3I9V1 3TEWA 4REZA 2H88B 4YSYB 2GRIA 2XNAC 2BBCA 2WU2B 4RGOS 2M56B 3TEZA 2I38A 2GB1A 4JWSC 2WQYB 3PO0A 3W1SA 2MJDA 3LXFA 4RH6A 1QKZA 3ZJVA 2IGGA 3URYA 2WXQA 2PKOA 1RM6C 1GOZA 3AE8B 3AMZA 2BB5A 1C76A 2I2YA 2Y3AA 3AB5A 4TQ0A 2LEKA 2IGHA 4ARIA 3OWEB 2LUMA 4ZRQA 1N5WA 1RYJA 4YSZB 1HXYD 3Q8BA 1IUEA 4YSXB 4MACA 1NENB 1ACCA 3KWLA 4N59A 4KX6B 1I4HA 2Y5CA 1E10A 2BS3B 5AUIA 2QJLA 4MM3B 1EU4A 1KTKA 2D5GA 1FNVA 1FRRA 2CJOA 2HTME 3KLSX 2FE8A 3LYYA 1DOXA 1TYGB 2CU3A 5HHDG 1PGAA 1T6BX 1TS2A 4A55A 1L6UA 2B76B 3AE2B 3BVGA 4NAWB 2RDHA 1L0YB 3B2FA 3MHZA 2BS2B 3DWMA 1PDXA 1R7SA 4KGTA 1YN4A 1QLBB 3AE7B 4YTPB 3GS2A 1YN5A 1K53A 4DXGA 4M0WA 1KF6B 3AH7A 3J9CA 5BMIA 4US8A 2JYTA 1PGBA 2KN4A 4HJGE 3R8BA 1JWSD 1SSNA 2WXLA 3AE1B 3V05A 4ARCA 4DQOC 1YMHE 2EKIA 2ZW0A 1AWDA 3VR8B 1ZDVA 2DBYA 5FR3A 2ON8A 1KLUD 1YQ4B 1TKYA 1XO3A 2MEKA 4ZYSA 3GB1A 1IBXB 1QOFA 2JSVX 2KWDA 1GAQB 3L4PA 4ZRPA 3VRAB 1SJHD 3C8YA 3NVZA 1TS5A 4YWGG 5BMGA 1T3QA 1SJED 1AW7A 1IGCA 1L0XB 3NVVA 1SE4A 3P4PB 1FM0D 3SFEB 2IDYA 4IOIE 1BXTA 1OQRA 4NJCA 3WCQA 1PUTA 1C78A 4OZCA 4N58A 3AE4B 1KRHA 2N9KA 2NTSA 2Q5WD 2QEJC 3BWUD 4L1BA 4RGMA 2FBWB 1A70A 4R3DA 1K50A 3DWGC 1F0ZA 3B2GA 1RFKA 1PYWD 1ET9A 4DXFA 1MPEA 3IT6B 4UDUC 4A8XC 2WU5B 3SR6A 3T3NA 1WGKA 2KQ4X 1E9MA 4RF0A 3VQIA 1DOIA 4WURA 4C7YA 1B9RA 2PIAA 1Q10A 3AM9A 1JW9D 4HKZE 1FFUA 4YTMB 1SE3A 1TZOA 4GDKB 1DOYA 2E6XA 2L83A 3U2SC 3AE5B 3ZYYX 5G5HA 1UUPA 1FXIA 1L5PA 2PMVA 4WQMA 3E9SA 4KKIA 4TSSA 1YQ3B 4Q2JA 5EE3A 1MHHE 4OVZA 4ITKA 2FUG1 1B1ZA 3CIRB 3Q8FA 1I4RA 5H8YE 4KGSA 1HZ5A 4EE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWX A;  2J52 A;  2RPV A;  4GLS C;  4MAC A;  2N7J A;  2N9L A;  1K51 A;  1XCT L;  1D4B A;  1C9F A;  2EEL A;  2QSD A;  1IBX A;  2PW9 A;  2GI9 A;  5HHD G;  1ZXH A;  1PGA A;  1XCQ L;  4OZB A;  5HFY A;  1HZ6 A;  1IGD A;  1MHX A;  2JWU A;  1YNT E;  2LHD A;  4KGT A;  1MI0 A;  1FCC C;  1P7F A;  2ONQ A;  5HG2 A;  1K53 A;  3MP9 A;  5JXV A;  5BMI A;  1FCL A;  1P7E A;  1PGB A;  2KN4 A;  4HJG E;  2IGD A;  2KAC A;  1YMH E;  2ZW0 A;  2PLP A;  4OZA A;  2ON8 A;  4IKG A;  4D2K A;  1IBX B;  2PTL A;  3FIL B;  2NMQ A;  3GB1 A;  2JSV X;  2KWD A;  1XF5 L;  2JXT A;  5BMG A;  1IGC A;  1MVK A;  2QMT A;  2ZW1 A;  1F2R C;  4IOI E;  2JZP A;  2JU6 X;  4WH4 A;  4OZC A;  1EM7 A;  2KDM A;  1F2R I;  2N9K A;  5BMH A;  2LGI A;  1K50 A;  1HEZ E;  1FD6 A;  3FIL A;  1JML A;  1MPE A;  2RMM A;  2KQ4 X;  1Q10 A;  2J53 A;  4KGR A;  3V3X A;  2OED A;  4HKZ E;  1KH0 A;  1PGX A;  2I38 A;  2GB1 A;  2LHE A;  1GB1 A;  5HI1 A;  2K0P A;  1K52 A;  1QKZ A;  2IGG A;  3UI3 A;  1GB4 A;  2I2Y A;  1MHH E;  2IGH A;  4KGS A;  1HZ5 A;  2LUM A; 
#chains in the Genus database with same CATH topology
 3VVW B;  4JPS A;  4FUL A;  3Q3J A;  1WGY A;  1D5Z C;  1WXM A;  2N9L A;  1N5X A;  3BZD B;  1J7A A;  1J0G A;  2ZVN A;  2MBB B;  4HCN B;  1V8C A;  1WX9 A;  3NRZ A;  2LFI A;  2KMM A;  1VDV A;  3PV1 A;  4H2A A;  3R7Q A;  4K3B A;  2G4D B;  2DEN B;  2KTF A;  3NOB A;  3VR9 B;  4KSL C;  5AZH A;  1JCK B;  4CQN A;  2BYV E;  2N7D A;  1QF6 A;  3ENE A;  2PVO D;  3N1X C;  3MJ5 A;  4A90 A;  1WSP A;  4ZHO A;  2D3G A;  1VR9 A;  2PVG C;  4LLG M;  4IG7 B;  3I3T B;  4URK A;  3KQ4 A;  4OW0 A;  3H9D A;  4D2K A;  2IO2 B;  3CWI A;  2WXP A;  1JWA D;  4EZK A;  1V5T A;  4B0M A;  4DK5 A;  2WXR A;  3NS1 A;  5DCN A;  1CJE A;  3Q69 A;  3WIM A;  1YD8 U;  3IAM 1;  2ZVO A;  1AYF A;  1OEY A;  3ZNI D;  2KC2 A;  5D3I B;  2MW5 A;  2WYQ A;  2YEP F;  3KYC D;  1SEB D;  3A9K B;  1JQ4 A;  5EE1 A;  1EUV B;  5JHA A;  3NZS A;  1XXG A;  2OED A;  5DPR A;  3RZF A;  3SDL C;  2MRP A;  1PQS A;  2C7H A;  1E6E B;  3VUW A;  1V86 A;  3RNF C;  2X8X X;  2OHF A;  4BKG A;  3AEB B;  3UI3 A;  3NG0 A;  3PZ7 A;  4ICV A;  2LVO A;  3BK2 A;  2AQ2 B;  2FCQ A;  2WXK A;  2X38 A;  4AQ7 A;  2KC1 A;  1HQR D;  2MCN B;  2KMC A;  3OAW A;  1WH3 A;  1YX5 B;  2M0A A;  2KMA A;  2W3S A;  2DZI A;  3VH3 B;  1GC6 A;  1MHX A;  1VZ8 A;  3ML9 A;  3P1M A;  3U30 A;  1L4Z B;  4BBN C;  4ZDV A;  5E6J A;  2V3N A;  2FCN A;  3EUB 2;  2G4S A;  2IGD A;  2K6Q A;  2PLP A;  3AXC A;  3RI7 C;  2YVC A;  3DHG C;  1DYQ A;  1I35 A;  1U4A A;  2JZ3 B;  4IC7 B;  1CZP A;  4LDT D;  1P98 A;  3APD A;  3HVD A;  3PVL A;  1F2R C;  2WXM A;  4K7S A;  3TUO A;  4MEM A;  2WP9 B;  3BYY B;  4DBG A;  2LGI A;  1YJ1 A;  2HTH A;  3IBE A;  3R66 C;  2DAJ A;  2N9P C;  4NZL B;  4DHZ E;  1TT5 B;  1I4X A;  3AEC B;  2FID A;  2YEP B;  3DBR I;  3VDZ A;  4HLE A;  2DYB A;  2HDE A;  4L2Y A;  1RWS A;  2LHE A;  3L0W B;  2KYW A;  4E74 A;  4AJW A;  2MBE A;  1TS4 A;  4GN1 A;  4JLC A;  5CHV C;  1D5X C;  3BIN A;  2N9X A;  1SXT A;  2GBR A;  3K9O B;  2WXG A;  3ZXV A;  2IYD B;  2J0K A;  4EKU A;  1C9F A;  3K9P B;  1NEK B;  1ET6 A;  2MJ3 A;  2I1J A;  1FNW A;  2GBK A;  3GP7 A;  1NYR A;  2LZ6 A;  4PYZ A;  2BT6 A;  4A3P A;  3RFZ B;  4YL8 A;  1IPG A;  5IA7 A;  1FCC C;  2D3A A;  2AQ1 B;  4KZC A;  3X0W A;  1X1M A;  4XE0 A;  2NCN A;  3W9C B;  3PTF C;  2K3U A;  1FO4 A;  2BTE A;  1ZUD 2;  2PPH A;  1WM3 A;  3AE9 B;  2E3T A;  3ZTC A;  1V97 A;  2QIE B;  1XF5 L;  2XK5 B;  1CK1 A;  4C7Z A;  2LRW A;  2AX5 A;  2WXI A;  5D7G A;  2WXN A;  3L16 A;  1FXT B;  4KZ0 A;  3V60 A;  1T0R C;  5BYS A;  4ZOH C;  4IWP A;  4I6N B;  5HKH A;  4K81 A;  4BKS A;  3Q3F A;  3FAH A;  5D3D A;  4II2 B;  3ML8 A;  1JRO A;  3A9J A;  5IO9 A;  4CYE A;  2AQ3 B;  4WWM A;  2Z0E B;  4LJO B;  3V62 A;  2NTT A;  3I9V 1;  4PK1 A;  4REZ A;  2GRI A;  4RM8 A;  2WU2 B;  1YIW A;  3A4S C;  4RGO S;  1WJN A;  2M56 B;  2I38 A;  2GB1 A;  4I6L B;  3M62 B;  4IM3 A;  3W1S A;  3IG3 A;  2BKR B;  3AUL A;  4KV2 A;  2FIF A;  3PZD A;  2MP2 B;  1C76 A;  2I2Y A;  4TQ0 A;  4HWI B;  4ZRQ A;  4YSZ B;  1HXY D;  1IUE A;  4BVU C;  4MAC A;  1NEN B;  1WJU A;  4N59 A;  4HPP A;  4GDL A;  3QJZ A;  4BZA A;  3L13 A;  5CHW A;  5AUI A;  4LNO A;  1EU4 A;  3VUX A;  4XZ4 A;  2KVZ A;  2HTM E;  2K8H A;  2NVU I;  4A55 A;  2NBV B;  3AE2 B;  1OQY A;  1L0Y B;  3B2F A;  1PDX A;  2LXA A;  2KT7 A;  2MBO A;  2M4N A;  3M63 B;  3A9K A;  1RFA A;  3J9C A;  5BMI A;  2KN4 A;  4NQK E;  3WA0 A;  3V05 A;  4EZL A;  2ZW0 A;  1AWD A;  2K8B A;  5FR3 A;  2ON8 A;  5DPW A;  2J0M A;  3MC8 A;  2MEK A;  3V6C B;  4ZYS A;  3L4P A;  4PYU A;  3NVZ A;  1TS5 A;  2REX A;  2D2Q A;  2IY0 B;  4HXD A;  3P4P B;  3DVN V;  5D6J B;  4P7I A;  1OQR A;  2A5U A;  2J0J A;  1F52 A;  4BFR A;  4WQO B;  3QAQ A;  4N58 A;  2N9K A;  3BWU D;  4L1B A;  4LDT B;  2WGS A;  3ZNG C;  4EFO A;  1F0Z A;  2J7Q B;  3KH0 A;  2DZJ A;  4K3C A;  1PYW D;  1MPE A;  2MBQ A;  3JSV B;  1WI0 A;  2KQ4 X;  4RF0 A;  4C7Y A;  1JW9 D;  4LNI A;  4ANX A;  4C00 A;  1F9J A;  4FLH A;  2GOW A;  3ZYY X;  4AWJ A;  2XBB C;  3L08 A;  1UBQ A;  1FXI A;  2CHW A;  2BVC A;  1YQ3 B;  4Q2J A;  2KOX A;  2CHX A;  3VFK A;  2FUG 1;  1B1Z A;  5H8Y E;  3A1Q A;  4W9J A;  4EE2 A;  2L3Z A;  1UWX A;  2W54 A;  2H89 B;  1P0R A;  2L52 A;  4HPM B;  3RNB C;  1EF1 A;  1D6E C;  3I57 A;  2K9X A;  4TKN A;  1QOB A;  2WXJ A;  2DYM A;  3PRM B;  2KX3 A;  1KLV A;  4ICU A;  4JQW C;  2WDQ B;  1L0V B;  3U52 E;  1E7P B;  1V1O A;  4GIV A;  3T3O A;  4TQ1 A;  2KDE B;  3P42 A;  2SEB D;  5C1Z A;  1J7C A;  1GNU A;  2OOB B;  5C3J B;  5JXV A;  2J42 A;  4KDL B;  4AUQ C;  2WDV B;  5IOI A;  2GMI C;  5CX3 A;  1XQQ A;  2WXO A;  3PS6 A;  2FUH B;  2L0T A;  4JX1 C;  3B0A A;  2SAK A;  3VH4 B;  1SIJ A;  2ZJD A;  2BWE S;  2JU6 X;  4MJS A;  1EF5 A;  1EM7 A;  4GB9 A;  4E3C A;  3A1Q B;  4WJP A;  4PS3 A;  2C7M B;  1FD6 A;  2QIL A;  1WYG A;  1N63 A;  2RMM A;  1NBF C;  2Z8L A;  1V1P B;  2KTR B;  4DHZ B;  2HE7 A;  3GZN B;  4XC2 A;  2GLS A;  2V9H A;  3V3X A;  4IWQ A;  2K22 A;  3H7P A;  4X57 B;  4NJ6 A;  1I4Q A;  4MSQ B;  2BB6 A;  2K0P A;  1TKG A;  1K52 A;  1NVI D;  1UZX B;  4YXD B;  3SEB A;  1GB4 A;  5EE0 A;  2M8S A;  4GOC A;  2GBJ A;  4QAY A;  3DOW A;  2V4I B;  3H8H A;  3W2D A;  3ZO5 B;  2KJR A;  3GE8 C;  3M95 A;  2RPV A;  3DVG X;  4W9G A;  4ANV A;  5FKA C;  1K51 A;  2DYO A;  3IAS 1;  1C4C A;  3QHT A;  5MPO A;  1I42 A;  2CU1 A;  1SB3 C;  3Q6B A;  3QAR A;  2Y5P A;  2FNJ B;  2INN E;  3ABV B;  1LFD A;  1FNU A;  5JH5 C;  2KLG A;  4WIP A;  3TBL D;  2VZK D;  2JWU A;  1J8C A;  2A4Z A;  2L76 A;  4MDK E;  3HHM A;  1ZGU B;  2B3A A;  3AEG B;  1MI0 A;  2LXC A;  2CKH B;  3JVZ X;  1E8Y A;  1H4R A;  3DBL I;  4W9I A;  2VH1 A;  2EMS A;  3HRD D;  4W9H A;  1H8C A;  5TSS A;  5LXH A;  3Q8E A;  4KIK B;  4J3O D;  2MQJ A;  4A6Q A;  2WDR B;  4IM0 A;  5DPS A;  1WR6 E;  2WXF A;  2RGF A;  3W1Y A;  2XN9 C;  1JWU D;  2L05 A;  1OGW A;  2XEW A;  3DBR B;  2NBU A;  4RGN A;  1HEZ E;  1MG4 A;  4CHK A;  1J19 A;  3CF6 E;  4FBJ B;  1VLB A;  3ZQ4 A;  3Q8A A;  3OJ4 B;  1C79 A;  1CQV A;  2N0S B;  4A9A A;  3AN1 A;  1TY0 A;  3BVZ A;  1TGZ B;  1E90 A;  4WAA A;  2HJ1 A;  3Q8C A;  1WR1 A;  1T5X D;  1F77 A;  2J52 A;  3APC A;  3P4R B;  4GLS C;  1T0S C;  3ALB A;  4HJK A;  5DPT A;  5KHQ A;  3EGR A;  4II3 B;  2L0F A;  2EEL A;  3UIN B;  2KWU B;  3DHI C;  2IJ0 A;  1EWC A;  1TZ1 A;  4P1C C;  2PW9 A;  4JL9 A;  2JQR B;  4N6E B;  3DHH C;  3L54 A;  4RCO A;  1XLO A;  2FCM A;  4NJ7 A;  2KD0 A;  1VJK A;  1Z2M A;  4RNA A;  5AZF A;  1QOA A;  2VZK B;  4W9F A;  1QOG A;  2V4L A;  2QDF A;  1E8X A;  2LD9 A;  3SD5 A;  4WAF A;  2N7E A;  2DNF A;  4FAD A;  3Q3O C;  3CMM B;  2JPH A;  3EHV A;  3R2I A;  1XEE A;  3TMP B;  1R4M B;  2LMC A;  1P9D U;  5CTR C;  3ZRC A;  4XGA B;  1UBI A;  4E71 A;  4NAM A;  1OFF A;  2WNM A;  3HUI A;  1FIQ A;  3EFC A;  3AE3 B;  2KNB A;  1BUI C;  1NI3 A;  4OHJ A;  3RCZ A;  1JWB D;  2JXX A;  1G6J A;  2JRH A;  3T9L A;  4ZRJ A;  1V9J A;  3TEW A;  4HDO A;  2KXJ A;  3RYT A;  1E5W A;  2BBC A;  3TL5 A;  2I1K A;  2WQY B;  2V1Y A;  2MJD A;  2IGG A;  3RN9 C;  2PKO A;  2KZR A;  1GOZ A;  3AE8 B;  2BB5 A;  2Y3A A;  3SHQ A;  2UU7 A;  2WWZ A;  3ZVV A;  1LXD A;  1QZE A;  5EDS A;  4YSX B;  2PE6 B;  2PJH A;  3DBH B;  2KFJ A;  1I4H A;  3ZNH B;  3WAO A;  4DDG D;  3ZTD A;  2QJL A;  4MM3 B;  3H6N A;  1KTK A;  1WMH B;  4FJY A;  3LYY A;  4I6P A;  1TYG B;  2L00 B;  4OVU A;  2KWC A;  4LNN A;  5E6P A;  1TS2 A;  4G0N B;  3MHZ A;  1WXS A;  4KIK A;  3ONS A;  1R4M I;  3AE7 B;  3GS2 A;  3DBL B;  1K53 A;  1KF6 B;  3EEC A;  3GE3 C;  1HTO A;  3UQB A;  4HJG E;  3R8B A;  2C7N B;  3AE1 B;  1WXV A;  2K25 A;  1YMH E;  3NY5 A;  3N3K B;  3AI5 A;  1ZDV A;  2DBY A;  3UIO B;  1KLU D;  1YQ4 B;  1IBX B;  4HPL B;  2JSV X;  2RR9 A;  1GJZ A;  1SJH D;  3R3M A;  1L0X B;  5LXI B;  4MJS B;  2KLC A;  1FM0 D;  4NJC A;  2ZNV B;  2NTS A;  2Q5W D;  2QEJ C;  2M1M A;  3QCA A;  4F8C B;  1GC7 A;  1K50 A;  3DWG C;  3B2G A;  4UDU C;  1D3Z A;  3SR6 A;  3Q3N C;  1WGK A;  5E6O A;  3H7P B;  2NBW B;  2YLM A;  1FFU A;  1WXA A;  2JT4 B;  2MSE D;  4YTM B;  2KJ6 A;  3DCG A;  2E6X A;  1F1H A;  2L83 A;  1YX6 B;  2ZPN A;  3CST A;  3U2S C;  4NY0 A;  1Q5W B;  1L5P A;  2BPS A;  3RNE C;  4BOZ B;  3MC9 A;  4OVZ A;  1MHH E;  3CIR B;  1T0Q C;  1WGR A;  2LUE A;  1VCB A;  2N7J A;  3HK0 A;  3WAL A;  1C3T A;  1YN3 A;  2DHZ A;  1TBE A;  4MSM B;  3RMK C;  3NVW A;  3CSF A;  4F1S A;  2D3C A;  1IBX A;  3RZW C;  1E0Z A;  4C80 A;  2KAN A;  1UGM A;  1KLG D;  3LB8 C;  1SE9 A;  4OZB A;  4GDK A;  2D11 A;  3ZLZ A;  1JWM D;  4FHJ A;  2TSS A;  1M94 A;  2MA9 B;  4HCP B;  1UGJ A;  2LJ5 A;  1WZ3 A;  2M19 A;  5LNK 1;  5G55 A;  4DWF A;  3V6E B;  2KDI A;  3R2T A;  4IM2 A;  5J2R A;  4OZA A;  2KWV B;  1WF9 A;  3WAP A;  3QWZ B;  2NMQ A;  3FIL B;  3PT2 B;  4ZRI A;  2N1W A;  5J18 A;  4EUT A;  1FFV A;  1MVK A;  2N1V A;  3PLU A;  3QA8 A;  3B08 A;  2JZP A;  1KFY B;  3UQA A;  3TEX A;  3AV8 A;  1VZ7 A;  1VD2 A;  4B0E A;  4XDD A;  1ZE3 D;  1C4P A;  1JML A;  3ZGZ A;  1K8R B;  2QC8 A;  3PPA A;  1ZXI A;  2EMT A;  4IUM B;  3RUI B;  2J53 A;  1V49 A;  2L8J A;  1PGX A;  1XLN A;  1UD7 A;  5D94 A;  1ZDX A;  2WDT B;  3WAN A;  2LGX A;  2ZEQ A;  2KJH B;  3AED B;  2IND C;  1S1Q B;  3E56 A;  3DQV A;  2OJR A;  1LQB A;  3RT3 B;  3WAM A;  1XLP A;  4W9E A;  4BKT A;  2W3R A;  1BT0 A;  1UEL A;  1WE6 A;  2C5L C;  2INP E;  1ZP0 B;  1D4B A;  2CR5 A;  2DLB A;  2N4F A;  4N9F 4;  3IT4 B;  1C77 A;  1SF0 A;  2ICI A;  4GGQ A;  3IFW B;  2M17 A;  1XCQ L;  1RAX A;  2N9E B;  2LJI A;  4PS7 A;  4DHJ D;  5G5G A;  2JF5 A;  4EZJ A;  3DBS A;  4MT5 A;  1NYQ A;  3P2B A;  2K6D B;  4ZRK A;  1TKE A;  2DWQ A;  2JZZ A;  1P7E A;  4LK0 M;  3AEF B;  1N62 A;  1ISN A;  5IKC M;  3ECI A;  5G2N A;  3PZ8 A;  4MGY E;  4K1R B;  2MWS B;  4MH8 A;  2IY1 B;  1FMA D;  1WGD A;  2ZCB A;  1NI2 A;  1S3S G;  3MJW A;  3AEE B;  4LNK A;  1Z5S B;  4P16 A;  4GDL B;  3B9J A;  1TS3 A;  2RDG A;  2XK5 A;  3T8M A;  2AEH A;  3I5J C;  2BWF A;  3ZDT A;  2R61 A;  3C0R B;  4MGZ E;  2LWP A;  2WLB A;  4FXC A;  4HRO A;  1KH0 A;  4US9 A;  1SGH A;  3DPD A;  4B9K A;  3NZU A;  3QC8 B;  1V81 A;  1WJ6 A;  4YTN B;  5HI1 A;  2KX0 A;  3VRB B;  4W9K A;  2J4X A;  3S2A A;  2KQS A;  2BW2 A;  3VTV A;  1P1A A;  1R4N I;  2Z59 B;  4ANW A;  1WGH A;  1WZ0 A;  3FC4 A;  3OG5 A;  5JHB A;  2M0X A;  4USA A;  2CJN A;  3BY4 B;  4M02 A;  4W9L A;  1UWM A;  4IDI A;  1M4V A;  4G3X B;  4RGT A;  2ACZ B;  1JRU A;  1WRI A;  3UF8 A;  1N60 A;  3IXS A;  2G1E A;  4RFB A;  3EA6 A;  3O65 B;  1J7B A;  4KKJ A;  5HFY A;  3O13 A;  1ZPS A;  1ROE A;  1YOV B;  5EE9 A;  1L6V A;  4BKS D;  1SE2 A;  3MFG A;  1TTN A;  4B6W A;  4G11 A;  1D5M C;  2RSU A;  1L7Y A;  2LAS A;  1Y56 A;  2KAC A;  4FA6 A;  1BML C;  2AWT A;  2PTL A;  4MGI E;  2UYZ B;  2JXT A;  1C4A A;  1WY8 A;  5FR6 A;  2K5P A;  2ZW1 A;  2KKC A;  3QK0 A;  1OEY J;  2AL6 A;  2KQ7 A;  4LNF A;  2IPK D;  2W82 A;  5AUK A;  2FAZ A;  3ZXR A;  3TIX A;  3FIL A;  2AL3 A;  3NJT A;  1TJE A;  1R4N B;  3P63 A;  2V3P A;  2VRR B;  5L83 A;  2H88 B;  3KYD D;  4HK2 A;  2MP2 A;  3TEZ A;  4JWS C;  5GMV A;  3JSV A;  2C9W B;  4RH6 A;  1QKZ A;  1LM8 B;  3ZJV A;  3URY A;  3AMZ A;  2RDB C;  2IGH A;  4ARI A;  2HD5 B;  1MJD A;  4GU2 A;  2JUO A;  4A20 A;  3KWL A;  3MHS D;  2L7R A;  2Y5C A;  2KHW B;  1E10 A;  1NDD A;  2D5G A;  3A33 B;  1V2Y A;  1FRR A;  1V5O A;  5L95 C;  2CJO A;  3KLS X;  1DOX A;  2MX2 A;  2CU3 A;  4PS8 A;  2W9N A;  1WM2 A;  2O6V B;  3RNG C;  1T6B X;  5KHO A;  3OJ3 A;  3BVG A;  3RD2 A;  2RDH A;  4NPN A;  2BS2 B;  1R7S A;  2O6V A;  5IN7 A;  1YN5 A;  4C4V A;  4M0W A;  4XYC A;  2PE9 A;  1PGB A;  1JWS D;  4ARC A;  2RPQ A;  3M3J A;  2EKI A;  3PHW B;  3LJ3 A;  1XO3 A;  1WIA A;  1QOF A;  2KWD A;  3C8Y A;  5BMG A;  3HM3 A;  1AW7 A;  1IGC A;  1P3Q U;  3PRZ A;  3NVV A;  3SFE B;  1BXT A;  4S0R A;  4OVV A;  1PUT A;  1C78 A;  1YQB A;  3ZIM A;  1FPY A;  3AE4 B;  1KRH A;  2KK8 A;  4RGM A;  2BYE A;  1A70 A;  3HIZ A;  4R3D A;  4MH0 E;  3PRP B;  2KO3 A;  3KUD B;  1E8Z A;  1RFK A;  1ET9 A;  4DXF A;  2WU5 B;  2IO3 B;  4RMA A;  3VQI A;  1B9R A;  3AM9 A;  4ANU A;  2BKF A;  2JRI B;  2R2Q A;  3VXW A;  4A3O A;  1TZO A;  1A5R A;  3JW0 X;  2PMV A;  3ZW3 A;  4KKI A;  4TSS A;  2NPT B;  3Q8F A;  2JWZ A;  4KGS A;  1GUA B;  3H1U A;  1HZ5 A;  3U8Z A;  2BYT A;  3PLV A;  3U4E G;  2D10 A;  5J17 A;  5IP4 D;  4F7Z A;  1I4P A;  1N61 A;  1EWY C;  2AYO B;  1ZOY B;  2K39 A;  5LLI A;  1JAL A;  1MG8 A;  3UGB B;  4JGH B;  3BVM A;  4MEL A;  5AEK B;  4IW0 A;  4LTU A;  2KN5 A;  1ZXH A;  3GZN I;  1FXA A;  4FJV B;  3ZJU A;  4ACF A;  3ZNZ B;  4PT5 A;  5AZG A;  3TJP A;  4M00 A;  1V1P A;  2KTR A;  2ONQ A;  3KWV A;  3ZJT A;  1TY2 A;  1XD3 B;  1L2N A;  1WE7 A;  3W5V B;  2KDF B;  4XX5 A;  2Y5B B;  5H92 C;  1LGR A;  1WGG A;  3PGE A;  3UIP B;  2HJ8 A;  1ENF A;  2QMT A;  4MGK E;  3W5U B;  2DZM A;  1EU3 A;  1Q1O A;  2CS4 A;  1E7U A;  3GOE A;  4WJO A;  4DXA B;  2MH7 A;  2KDM A;  3SFD B;  1F2R I;  3AEA B;  2ASQ A;  3U7D A;  5BMH A;  3BII D;  3PSE B;  1XLQ A;  2FCS A;  4NQL B;  4GMV A;  1EO6 A;  1WYW B;  4YT0 B;  3TSS A;  3MTN B;  3U7Z A;  2BYF A;  4WWP A;  1I7H A;  4M0W B;  4HRS A;  2W55 A;  4KGR A;  4O1N A;  5T8I A;  4XWT A;  2D3B A;  2G45 B;  1UNS A;  2GBM A;  1SBB B;  1GB1 A;  3P4Q B;  2QCZ A;  5BYQ A;  4DDI D;  2LVQ A;  1OTR B;  2KFK B;  1YJI A;  4K7U A;  2NS5 A;  1YJJ A;  4KSK C;  3KVF B;  3RPF C;  5C23 A;  4HEA 1;  4HKQ A;  1TIF A;  3ETR A;  4NNJ B;  1XCT L;  3QQ8 B;  2LGY A;  2QSD A;  3VAW A;  1LO5 D;  4W9C A;  4WJQ A;  2L32 A;  1VRA B;  3RUL A;  3X23 A;  1WWT A;  2GI9 A;  3NVY A;  4S17 A;  1IP9 A;  3AE6 B;  1IGD A;  3N32 A;  4CO7 A;  1YNT E;  2D07 B;  4P6V F;  1KOT A;  4BBN F;  3BK1 A;  3VUY A;  2ZCC A;  1OQQ A;  2O6V D;  1P7F A;  5HG2 A;  3MP9 A;  4W9D A;  2BS4 B;  3KUC B;  2WS3 B;  2JVC A;  5CHF A;  4KVG B;  1VZ6 A;  4TMA B;  2IZV B;  1FEH A;  5FK9 C;  5BO4 B;  1HTQ A;  4C56 C;  2LI5 A;  4IKG A;  3NUH B;  4ZYN A;  3DVN U;  1SIF A;  4AS1 A;  5JZE B;  4BOS C;  4ASW C;  2VH2 A;  4ZHP A;  4LJP B;  2OJW A;  1ESF A;  3N20 C;  2KFK A;  4M01 A;  2CHZ A;  1WRD B;  4L23 A;  3N1Z C;  4BAX A;  5BYR A;  4JIO U;  2ZNV C;  3N1Y C;  3ZDM C;  2MLB A;  3NS8 A;  3EC8 A;  4K7W A;  5GXG B;  3JYU A;  3VTW A;  3BYT B;  1GPX A;  1WX8 A;  2JX5 A;  4JWU C;  1QQR A;  3P4S B;  3QIJ A;  3HVZ A;  3V61 A;  2WXH A;  4IWO A;  1AN8 A;  1HA5 A;  1T0Y A;  2V3S A;  3FKY A;  4MM3 A;  3DBH I;  1E8W A;  2KAJ A;  3C19 A;  4XDC A;  1ZKH A;  4J6I A;  1CMX B;  1QIL A;  1DGJ A;  2NR2 A;  1JRP A;  1ZW7 A;  3TEY A;  2IO1 B;  4TV3 A;  2KVR A;  4DHJ B;  2EKE C;  2JYE A;  4M8M A;  3B1L X;  3PHX B;  4JE3 B;  4G50 A;  3ZUN A;  3EFU A;  4XWW A;  1UH6 A;  1HZ6 A;  1QT9 A;  3RNC C;  1IYF A;  1GG3 A;  2LGD A;  5I4D A;  2C60 A;  2LHD A;  1WFY A;  3NZ3 A;  1WXQ A;  4FJZ A;  2O2V B;  4RM9 A;  4B95 A;  3A4R A;  3HM6 X;  1FCL A;  1STE A;  2DZK A;  2UWQ A;  1FRD A;  1L4D B;  3MC0 B;  4WWO A;  4FHK A;  2V0G A;  3L10 B;  2MJE A;  4LCD E;  4FN2 A;  2K1F A;  4WH4 A;  1PFD A;  3Q14 C;  1WX7 A;  4WWN A;  1I4G A;  3IVF A;  2IBI B;  2KDB A;  2L1A A;  1XT9 B;  4RF1 A;  1Q0W B;  4AP4 C;  2DX5 B;  2WX1 A;  1AAR A;  2BGF A;  3L17 A;  2G9H D;  5C2T B;  2DAF A;  4GXB A;  4YSY B;  2LVP A;  2XNA C;  2PEA A;  3PO0 A;  4C4V B;  3LXF A;  4EOY A;  2MBH A;  3TCA A;  2WXQ A;  3KW5 B;  1RM6 C;  3AU5 A;  3Q3M C;  3AB5 A;  2MHJ A;  2LEK A;  3OWE B;  2LUM A;  1N5W A;  1RYJ A;  2G3Q B;  3Q8B A;  3A9J B;  1ACC A;  1WMH A;  3ZRF A;  4KX6 B;  3DDC B;  3QX1 A;  2BS3 B;  2K8C A;  2JY6 A;  3R7R A;  1V80 A;  3W1S C;  1FNV A;  4M8N A;  3DVG Y;  4EEW A;  2INC C;  2O2V A;  2FE8 A;  2NPT A;  3OLM D;  5HHD G;  1PGA A;  3APF A;  3AU4 A;  1L6U A;  2B76 B;  1Y8R C;  4NAW B;  3VHT C;  3DWM A;  5TR5 A;  4GSW A;  3IHP C;  3KUZ A;  4KGT A;  5D2M B;  1YN4 A;  1QLB B;  4YTP B;  1V6E A;  1KJT A;  4DXG A;  4NAW A;  3AH7 A;  3ZKJ C;  4US8 A;  2JYT A;  3N30 A;  1SSN A;  2QHO A;  2WXL A;  4DQO C;  3VR8 B;  3LDZ E;  1RLF A;  1RRB A;  1TKY A;  3GB1 A;  4ZRP A;  1GAQ B;  2ZZP B;  3D32 A;  3VRA B;  3H7S A;  3PRE A;  4YWG G;  3RNA C;  1T3Q A;  4TUU A;  1SJE D;  1N6Z A;  1SE4 A;  2Z0D B;  4KDI C;  2IDY A;  4IOI E;  3WCQ A;  5E6N A;  4OZC A;  1HE8 A;  2R2O A;  1C1Y B;  2BQQ A;  2LRU A;  2ZPY A;  2FBW B;  2LGS A;  1E7V A;  3NHE B;  3VTU A;  1WJ4 A;  3IT6 B;  3Q2A C;  4A8X C;  3T3N A;  2BF8 B;  1E9M A;  2WHI A;  4AJY B;  1DOI A;  4WUR A;  2WX0 A;  2PIA A;  1Q10 A;  1MFW A;  4HVB A;  5IAA C;  4HKZ E;  4P1B C;  1SE3 A;  2RD0 A;  2IO0 B;  4GDK B;  1DOY A;  4AOF A;  3I63 C;  3AE5 B;  5G5H A;  1UUP A;  4WJN A;  4HDQ A;  4WQM A;  3E9S A;  5EE3 A;  3SU8 X;  1UF0 A;  4ITK A;  1I4R A;  2GBN A;  3N9Y C;  1KM7 A; 
#chains in the Genus database with same CATH homology
 1UWX A;  2W54 A;  3U4E G;  2H89 B;  4JPS A;  2L52 A;  2N7J A;  1D5Z C;  2N9L A;  1I4P A;  1D6E C;  1N5X A;  3BZD B;  1YN3 A;  1N61 A;  3I57 A;  2K9X A;  1J7A A;  1EWY C;  1ZOY B;  1QOB A;  3NVW A;  2WXJ A;  1JAL A;  1V8C A;  2DYM A;  3NRZ A;  2LFI A;  2KMM A;  1IBX A;  2WDQ B;  1L0V B;  3BVM A;  3U52 E;  1VDV A;  4H2A A;  1E7P B;  1E0Z A;  4LTU A;  1V1O A;  4C80 A;  1ZXH A;  1KLG D;  3LB8 C;  4OZB A;  3T3O A;  3VR9 B;  1FXA A;  1JCK B;  4TQ1 A;  1JWM D;  4CQN A;  3P42 A;  2TSS A;  2SEB D;  3ZJU A;  1QF6 A;  4PT5 A;  2PVO D;  4A90 A;  3MJ5 A;  1UGJ A;  1J7C A;  1WSP A;  1V1P A;  2ONQ A;  4ZHO A;  5C3J B;  2M19 A;  1VR9 A;  3KWV A;  3ZJT A;  2PVG C;  1TY2 A;  5LNK 1;  4LLG M;  5JXV A;  3W5V B;  2J42 A;  3R2T A;  2WDV B;  5H92 C;  3KQ4 A;  4OZA A;  2WXO A;  3N9Y C;  4OW0 A;  4D2K A;  2NMQ A;  3CWI A;  3FIL B;  2WXP A;  4JX1 C;  1JWA D;  4B0M A;  1FFV A;  2SAK A;  2WXR A;  1SIJ A;  3NS1 A;  1MVK A;  1ENF A;  2QMT A;  3W5U B;  1CJE A;  2JZP A;  3Q69 A;  2JU6 X;  1KFY B;  1EU3 A;  1EM7 A;  3IAM 1;  2MH7 A;  2KDM A;  3SFD B;  3AV8 A;  1F2R I;  1VZ7 A;  3AEA B;  3TEX A;  1AYF A;  5BMH A;  4B0E A;  4XDD A;  3BII D;  1ZE3 D;  5D3I B;  1XLQ A;  1C4P A;  2YEP F;  1FD6 A;  2QIL A;  1JML A;  3ZGZ A;  1SEB D;  1WYG A;  1N63 A;  2RMM A;  2Z8L A;  4YT0 B;  1JQ4 A;  1V1P B;  5EE1 A;  3TSS A;  3U7Z A;  1ZXI A;  1I7H A;  4HRS A;  2J53 A;  2W55 A;  4KGR A;  3V3X A;  1XXG A;  2OED A;  4O1N A;  5T8I A;  2K22 A;  1PGX A;  1E6E B;  1I4Q A;  4XWT A;  1XLN A;  1UNS A;  2BB6 A;  1SBB B;  1GB1 A;  3P4Q B;  5BYQ A;  1ZDX A;  2K0P A;  1TKG A;  1K52 A;  1NVI D;  2OHF A;  3AEB B;  3UI3 A;  4YXD B;  1YJI A;  3SEB A;  1GB4 A;  5EE0 A;  3AED B;  3PZ7 A;  1YJJ A;  3E56 A;  2V4I B;  3H8H A;  3W2D A;  3RPF C;  1XLP A;  4HEA 1;  3BK2 A;  2RPV A;  4HKQ A;  2W3R A;  3ETR A;  2AQ2 B;  2WXK A;  5FKA C;  1K51 A;  1XCT L;  2DYO A;  2INP E;  1ZP0 B;  2X38 A;  3IAS 1;  1C4C A;  2DLB A;  5MPO A;  1D4B A;  4AQ7 A;  1SB3 C;  1HQR D;  2QSD A;  1LO5 D;  3IT4 B;  2Y5P A;  1C77 A;  2L32 A;  1SF0 A;  1VRA B;  2ICI A;  2INN E;  3ABV B;  2M0A A;  1WWT A;  2W3S A;  2GI9 A;  3NVY A;  1FNU A;  4WIP A;  1XCQ L;  3AE6 B;  2LJI A;  5G5G A;  1IGD A;  1MHX A;  1VZ8 A;  1YNT E;  2JWU A;  2VZK D;  4P6V F;  3P1M A;  1L4Z B;  3BK1 A;  3AEG B;  4MT5 A;  1NYQ A;  1MI0 A;  1OQQ A;  1P7F A;  5HG2 A;  3MP9 A;  5E6J A;  2V3N A;  3HRD D;  1TKE A;  2BS4 B;  5TSS A;  2WS3 B;  3EUB 2;  3Q8E A;  2DWQ A;  4LK0 M;  1P7E A;  4J3O D;  1VZ6 A;  4TMA B;  2IGD A;  3AEF B;  1FEH A;  1N62 A;  5FK9 C;  2PLP A;  4C56 C;  4IKG A;  3NUH B;  4A6Q A;  1DYQ A;  3PZ8 A;  4AS1 A;  2WDR B;  1CZP A;  4MH8 A;  3HVD A;  4ZHP A;  1F2R C;  1FMA D;  2WXM A;  2WXF A;  1ESF A;  2XN9 C;  3TUO A;  3AEE B;  1JWU D;  2WP9 B;  3BYY B;  4P16 A;  2LGI A;  4GDL B;  3B9J A;  1TS3 A;  4RGN A;  4L23 A;  2RDG A;  1HEZ E;  4NZL B;  5BYR A;  2R61 A;  3AEC B;  1I4X A;  2YEP B;  5GXG B;  2HDE A;  2WLB A;  4L2Y A;  4FXC A;  3BYT B;  1VLB A;  4HRO A;  1KH0 A;  4US9 A;  3ZQ4 A;  1GPX A;  3Q8A A;  1C79 A;  2JX5 A;  1RWS A;  2LHE A;  4JWU C;  1CQV A;  1QQR A;  3P4S B;  4YTN B;  3HVZ A;  5HI1 A;  2WXH A;  3VRB B;  2N0S B;  2J4X A;  4A9A A;  3AN1 A;  1TY0 A;  1AN8 A;  3BVZ A;  1HA5 A;  1TS4 A;  2BW2 A;  3Q8C A;  2KAJ A;  1T5X D;  1F77 A;  2J52 A;  1D5X C;  3FC4 A;  3P4R B;  4GLS C;  4XDC A;  1QIL A;  4USA A;  1SXT A;  1DGJ A;  2CJN A;  2WXG A;  1JRP A;  3EGR A;  1C9F A;  2EEL A;  1UWM A;  3TEY A;  2IJ0 A;  1EWC A;  4IDI A;  1M4V A;  4RGT A;  1NEK B;  2ACZ B;  2JYE A;  2PW9 A;  1ET6 A;  2MJ3 A;  2JQR B;  1WRI A;  4N6E B;  1N60 A;  1FNW A;  3IXS A;  4JE3 B;  2G1E A;  4RFB A;  3EA6 A;  1J7B A;  4KKJ A;  5HFY A;  4XWW A;  3O13 A;  4RCO A;  1XLO A;  1ZPS A;  1HZ6 A;  1QT9 A;  1ROE A;  3GP7 A;  1NYR A;  5EE9 A;  1L6V A;  2BT6 A;  3RFZ B;  5I4D A;  2LHD A;  3NZ3 A;  1SE2 A;  3MFG A;  1FCC C;  1WXQ A;  1VJK A;  2AQ1 B;  4RNA A;  2BYT A;  1QOA A;  4XE0 A;  1D5M C;  2VZK B;  1FCL A;  1QOG A;  1STE A;  3W9C B;  2K3U A;  1FO4 A;  2BTE A;  1ZUD 2;  1Y56 A;  1FRD A;  1L4D B;  3MC0 B;  2KAC A;  4WAF A;  3AE9 B;  2V0G A;  1BML C;  2E3T A;  2PTL A;  2MJE A;  1V97 A;  2QIE B;  1XF5 L;  2JXT A;  1CK1 A;  4C7Z A;  2AX5 A;  1C4A A;  2WXI A;  5D7G A;  2WXN A;  2K5P A;  2ZW1 A;  3R2I A;  1XEE A;  2LMC A;  4WH4 A;  1PFD A;  2IPK D;  2W82 A;  1I4G A;  5AUK A;  5BYS A;  4ZOH C;  4NAM A;  1OFF A;  2WNM A;  3HUI A;  1FIQ A;  2L1A A;  3FIL A;  4RF1 A;  3AE3 B;  3FAH A;  5D3D A;  1BUI C;  1TJE A;  1NI3 A;  4OHJ A;  1JWB D;  1JRO A;  2G9H D;  5C2T B;  2AQ3 B;  3P63 A;  4WWM A;  2V3P A;  2NTT A;  3I9V 1;  3TEW A;  4REZ A;  2H88 B;  4YSY B;  2GRI A;  2XNA C;  2BBC A;  2WU2 B;  4RGO S;  2M56 B;  3TEZ A;  2I38 A;  2GB1 A;  4JWS C;  2WQY B;  3PO0 A;  3W1S A;  2MJD A;  3LXF A;  4RH6 A;  1QKZ A;  3ZJV A;  2IGG A;  3URY A;  2WXQ A;  2PKO A;  1RM6 C;  1GOZ A;  3AE8 B;  3AMZ A;  2BB5 A;  1C76 A;  2I2Y A;  2Y3A A;  3AB5 A;  4TQ0 A;  2LEK A;  2IGH A;  4ARI A;  3OWE B;  2LUM A;  4ZRQ A;  1N5W A;  1RYJ A;  4YSZ B;  1HXY D;  3Q8B A;  1IUE A;  4YSX B;  4MAC A;  1NEN B;  1ACC A;  3KWL A;  4N59 A;  4KX6 B;  1I4H A;  2Y5C A;  1E10 A;  2BS3 B;  5AUI A;  2QJL A;  4MM3 B;  1EU4 A;  1KTK A;  2D5G A;  1FNV A;  1FRR A;  2CJO A;  2HTM E;  3KLS X;  2FE8 A;  3LYY A;  1DOX A;  1TYG B;  2CU3 A;  5HHD G;  1PGA A;  1T6B X;  1TS2 A;  4A55 A;  1L6U A;  2B76 B;  3AE2 B;  3BVG A;  4NAW B;  2RDH A;  1L0Y B;  3B2F A;  3MHZ A;  2BS2 B;  3DWM A;  1PDX A;  1R7S A;  4KGT A;  1YN4 A;  1QLB B;  3AE7 B;  4YTP B;  3GS2 A;  1YN5 A;  1K53 A;  4DXG A;  4M0W A;  1KF6 B;  3AH7 A;  3J9C A;  5BMI A;  4US8 A;  2JYT A;  1PGB A;  2KN4 A;  4HJG E;  3R8B A;  1JWS D;  1SSN A;  2WXL A;  3AE1 B;  3V05 A;  4ARC A;  4DQO C;  1YMH E;  2EKI A;  2ZW0 A;  1AWD A;  3VR8 B;  1ZDV A;  2DBY A;  5FR3 A;  2ON8 A;  1KLU D;  1YQ4 B;  1TKY A;  1XO3 A;  2MEK A;  4ZYS A;  3GB1 A;  1IBX B;  1QOF A;  2JSV X;  2KWD A;  1GAQ B;  3L4P A;  4ZRP A;  3VRA B;  1SJH D;  3C8Y A;  3NVZ A;  1TS5 A;  4YWG G;  5BMG A;  1T3Q A;  1SJE D;  1AW7 A;  1IGC A;  1L0X B;  3NVV A;  1SE4 A;  3P4P B;  1FM0 D;  3SFE B;  2IDY A;  4IOI E;  1BXT A;  1OQR A;  4NJC A;  3WCQ A;  1PUT A;  1C78 A;  4OZC A;  4N58 A;  3AE4 B;  1KRH A;  2N9K A;  2NTS A;  2Q5W D;  2QEJ C;  3BWU D;  4L1B A;  4RGM A;  2FBW B;  1A70 A;  4R3D A;  1K50 A;  3DWG C;  1F0Z A;  3B2G A;  1RFK A;  1PYW D;  1ET9 A;  4DXF A;  1MPE A;  3IT6 B;  4UDU C;  4A8X C;  2WU5 B;  3SR6 A;  3T3N A;  1WGK A;  2KQ4 X;  1E9M A;  4RF0 A;  3VQI A;  1DOI A;  4WUR A;  4C7Y A;  1B9R A;  2PIA A;  1Q10 A;  3AM9 A;  1JW9 D;  4HKZ E;  1FFU A;  4YTM B;  1SE3 A;  1TZO A;  4GDK B;  1DOY A;  2E6X A;  2L83 A;  3U2S C;  3AE5 B;  3ZYY X;  5G5H A;  1UUP A;  1FXI A;  1L5P A;  2PMV A;  4WQM A;  3E9S A;  4KKI A;  4TSS A;  1YQ3 B;  4Q2J A;  5EE3 A;  1MHH E;  4OVZ A;  4ITK A;  2FUG 1;  1B1Z A;  3CIR B;  3Q8F A;  1I4R A;  5H8Y E;  4KGS A;  1HZ5 A;  4EE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...