4B0EA

Crystal structure of the caf1a usher protein n-terminal domain from yersinia pestis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
LPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSSLQLTKYGIDIDKYPDLIKSGTEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 21
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4b0eA00
4J3OD 1ZDXA 4B0MA 1ZE3D 1ZDVA 4B0EA 3RFZB 3BWUD
chains in the Genus database with same CATH superfamily
5CTRC 5BMHA 4NAWB 2LMCA 4YT0B 2GLSA 2K22A 1FCCC 4JL9A 1LXDA 4JWUC 2SEBD 1WZ0A 1SJHD 2R2OA 3SHQA 3LYYA 4N9F4 3ZJTA 4DDGD 1WXVA 2XK5B 3GZNI 3UGBB 4EOYA 4JX1C 4N6EB 1YOVB 2IJ0A 2RPQA 3DHIC 1LFDA 4BOSC 3WCQA 4WJPA 2C60A 3J9CA 1HTOA 2QJLA 4DQOC 2IY1B 2WU2B 4FXCA 3VRBB 5D94A 2PW9A 2WLBA 1CZPA 2BS2B 4WJOA 1WFYA 3GE8C 4M02A 2WGSA 3DHGC 3WANA 2MEKA 1YJ1A 1GUAB 1JALA 4XDDA 3APCA 1K52A 5IAAC 4JQWC 1VZ8A 2KDEB 1JROA 1T0RC 1XD3B 3KW5B 4AS1A 3M3JA 1PFDA 1AN8A 1R4NB 1ZDXA 1J7AA 3AE8B 3SD5A 1XLPA 4KZ0A 4RCOA 3TEWA 3DDCB 3VXWA 4FBJB 2QIEB 4FULA 3ZTDA 3ZXVA 1ROEA 2WYQA 3A1QB 4HEA1 3V61A 2WXOA 5EE3A 2KDMA 3H6NA 1WJ4A 1WM2A 2RDHA 1XLOA 2D11A 2WXGA 3IT4B 2JVCA 4B0EA 3L54A 1FD6A 1ISNA 3RNEC 3BY4B 2J53A 1NENB 1J8CA 1JWUD 3Q6BA 4US9A 3P42A 3HIZA 1OQYA 5CHWA 1VLBA 3D32A 1I4XA 3ENEA 4KDLB 3IHPC 5EE0A 1V2YA 1QOFA 4L1BA 1HXYD 3ZJVA 2ZEQA 2JQRB 3Q8AA 4W9LA 2KC1A 3DVNU 3AEEB 4E3CA 5LLIA 3P4SB 3AI5A 4CO7A 2LGXA 4BKSA 1WR1A 3FKYA 5IO9A 2RDGA 4NJCA 4LLGM 3ZRCA 2LUEA 2O2VB 4MGYE 1C1YB 1MFWA 2BT6A 4JIOU 4K7SA 1QQRA 4IM3A 2VZKD 3Q3FA 2OJRA 2ZCCA 4R3DA 3RCZA 1D3ZA 4LTUA 2KYWA 4A9AA 3DVGX 2JUOA 3MFGA 1SIFA 1HEZE 1R4MI 1V49A 2BWES 1WH3A 1QF6A 4PYZA 3QQ8B 1Q0WB 2PKOA 3QIJA 4JGHB 1D5MC 5G5GA 3ZYYX 1IP9A 1NEKB 1WMHA 1WGDA 3IXSA 2I1KA 4C7ZA 4ZRQA 1BUIC 2LASA 4FHKA 3MTNB 2C9WB 3WA0A 4DHZE 2W9NA 2XN9C 1NYQA 5C2TB 4OZAA 1TTNA 4GDLB 2KWDA 1QT9A 2KQ4X 2QC8A 2OJWA 1WXQA 2KWUB 1VR9A 2BF8B 1BMLC 4DDID 4HCNB 4KKJA 1C79A 5JZEB 2KK8A 3WAPA 4USAA 1RRBA 3H7PB 4MSQB 1RWSA 1UGMA 1SE3A 3TJPA 4DHZB 3N1YC 1WX9A 2N1WA 4H2AA 2KFKA 3IG3A 2B76B 1N61A 2H89B 3IAS1 1V9JA 1IGCA 4WAAA 1KF6B 1ZPSA 2LJ5A 4UDUC 4BVUC 1N60A 3PRPB 1WGYA 2TSSA 2WXNA 4OVVA 4WJQA 4XDCA 3AECB 4NAMA 5CX3A 1MHHE 2C7MB 1XT9B 2ZPYA 4WJNA 1QOGA 3PHXB 1E90A 1P0RA 2N7DA 3L0WB 3SDLC 3FILB 3W2DA 4FLHA 1SSNA 2PIAA 2EMSA 2YEPB 3AEGB 3AE1B 1TKEA 1U4AA 2N9XA 4ACFA 1MPEA 1F1HA 4M8MA 3M63B 2LGSA 5HHDG 2ACZB 2WHIA 4G0NB 1YN3A 1PGBA 3C0RB 2BVCA 2HTHA 2V3PA 2WP9B 3TIXA 3RFZB 4IWOA 2MBOA 3JSVA 3ZDTA 2L32A 1ZGUB 1C4CA 3ABVB 2K9XA 4W9IA 1OGWA 3QC8B 2MLBA 3R7QA 4MACA 1IPGA 2WXJA 2XNAC 1I7HA 1NVID 1KJTA 3R2TA 1YN5A 4REZA 4JWSC 2BS3B 3NZUA 2PVGC 2N9PC 1YX6B 2KANA 4KGSA 3NOBA 4WQMA 2LGIA 4P1BC 1ZW7A 2VZKB 2M19A 2VH1A 2JYTA 2LRUA 1N5XA 3OG5A 1V8CA 5AZGA 1Z2MA 2A5UA 1FXTB 4BKTA 3PREA 3P4RB 3T9LA 3DVNV 2MHJA 1V81A 2ZPNA 4RF1A 4K81A 3O13A 1D5XC 2BBCA 3N20C 3DCGA 4LNIA 3M62B 1UBIA 2L1AA 4XGAB 1E9MA 3B08A 3Q69A 2M0AA 2BGFA 5BMGA 2D3AA 4NJ6A 2ZZPB 1V6EA 2KXJA 3OWEB 3VUXA 2HD5B 3HM6X 3EUB2 4GN1A 3QHTA 1ACCA 3PLVA 5AEKB 2MJDA 1T0QC 4BZAA 1QZEA 4RGTA 2BYFA 1E8XA 1DOXA 4HKQA 2IPKD 1ZUD2 1B1ZA 2LFIA 3ZNZB 1I35A 1WI0A 2WXFA 2D3CA 2AX5A 4IDIA 3R7RA 3PV1A 4MT5A 5T8IA 3B0AA 3V6EB 4EZJA 4HPMB 4X57B 1E7UA 5BMIA 4MGKE 4IOIE 4E71A 4DXFA 4ARCA 4LNKA 4ZOHC 2KNBA 3A9KB 2Y5CA 2GBRA 2KQSA 1R7SA 2LXCA 4BBNF 4ZDVA 3PGEA 1ZDVA 2KT7A 2D3GA 4PT5A 2W55A 4HCPB 2CKHB 4LK0M 5C23A 1SE2A 3JYUA 5TSSA 1R4NI 4ZRKA 1UUPA 3CSFA 3MC0B 4IW0A 4TMAB 1TS3A 1VJKA 4HVBA 3LXFA 4AUQC 4W9KA 4AJYB 4S17A 1UELA 2INCC 3I5JC 5E6JA 1M94A 3AV8A 1GC6A 2ONQA 2UWQA 2W82A 1UF0A 2NR2A 1IBXB 3W5VB 4KGRA 4GDKA 4B0MA 2L52A 5HKHA 4JE3B 1TZOA 2BS4B 2KJRA 1ET6A 2L0TA 4RGMA 4W9EA 1TJEA 2N1VA 1Z5SB 1UD7A 3BZDB 1E7PB 2LD9A 3N9YC 1ZXHA 2L05A 2K25A 2BQQA 3SR6A 4IWQA 2KC2A 2DZKA 3BIID 1LGRA 3I3TB 2MQJA 4B95A 2AYOB 2MP2B 2IO2B 3VHTC 2MRPA 2Z59B 4P6VF 1S1QB 1YQBA 4HRSA 1C77A 1HA5A 3PZDA 4KIKB 3H9DA 2JF5A 2OEDA 4FADA 3ECIA 2ON8A 4KDIC 1WXSA 3QAQA 4LCDE 4RM8A 1XO3A 3KYDD 1J19A 5DPRA 4B6WA 2R61A 1FM0D 1KLUD 2Q5WD 2WDQB 2BYTA 1C76A 3CWIA 1GB1A 4MM3B 1YMHE 2NPTA 1JW9D 4US8A 1DGJA 2KDFB 4IWPA 2GBKA 1I4GA 3E9SA 1EU4A 3NRZA 4FJZA 4YSZB 1SB3C 4YWGG 3EGRA 1E10A 1L4DB 3U30A 2G4DB 3PRZA 2KKCA 4HDQA 3TL5A 2MJEA 1YN4A 4WH4A 1GJZA 5AUKA 1TYGB 1T0SC 2INNE 3CF6E 3MC8A 2BYEA 2QMTA 2FAZA 1KM7A 5MPOA 4TSSA 2LI5A 3MJWA 1IGDA 5IOIA 3P2BA 2WU5B 4K7UA 3UI3A 2K0PA 2WXKA 1YIWA 1JQ4A 2KFJA 2J4XA 3RN9C 4XWTA 4C80A 3MHSD 3Q3OC 4MH0E 2M17A 3NY5A 3AE7B 4HWIB 2HTME 1JMLA 2MCNB 3WIMA 1WX7A 2XK5A 2DAFA 4MGIE 2LWPA 1L0XB 3TSSA 2V4LA 2MH7A 3A9JB 3RNGC 2DYBA 1TGZB 4G50A 4ANVA 5TR5A 3NHEB 1VD2A 2MW5A 2K5PA 2K39A 1T6BX 3A4RA 4K3CA 2EKEC 1JRUA 1OEYJ 5D6JB 5BYRA 3SFDB 2JRHA 2FNJB 3HVZA 4EEWA 2XBBC 4IUMB 3R66C 2N7JA 1E5WA 1P3QU 1SEBD 1D5ZC 2KWVB 4MELA 2NS5A 3AXCA 3HVDA 2KAJA 2PJHA 1SJED 2D2QA 4DK5A 3A4SC 1TKGA 1UWMA 1GB4A 3ZNID 4RF0A 1YQ3B 3A1QA 4HDOA 3QWZB 3BINA 3RNBC 4II2B 4GIVA 4OVZA 2K8HA 3AE4B 3NS8A 3AMZA 3NZSA 4II3B 1D6EC 2GMIC 1FIQA 3PT2B 4W9JA 4KKIA 4K1RB 3RNFC 1K8RB 2JWZA 2PE9A 4N58A 2H88B 2JX5A 3QX1A 2MSED 2JXTA 4GSWA 1WJUA 2IO0B 4ANUA 4W9GA 2Z0DB 4YXDB 4HJKA 3Q8CA 2EKIA 2INPE 3T3NA 4YTPB 1JWAD 2D3BA 2CHXA 3BK1A 2J42A 1M4VA 3A33B 3QA8A 2KTFA 3NJTA 3L4PA 4MDKE 2JZ3B 3V6CB 4DHJD 2O2VA 2GOWA 2DAJA 1WR6E 1OTRB 1SE9A 2I1JA 3ONSA 3W9CB 1EUVB 1A70A 1HE8A 3EC8A 3RULA 4ICVA 5EDSA 3AE3B 2NCNA 3OLMD 1E8WA 1TT5B 3NG0A 1FPYA 2MBHA 1NDDA 4I6PA 3QJZA 2QDFA 3DVGY 4YSYB 2ICIA 2GRIA 3N30A 1VRAB 1YD8U 2QILA 4EKUA 2NBWB 3NUHB 5CHFA 4HK2A 4BAXA 3VUWA 2C7HA 4A90A 2KQ7A 3GB1A 3LDZE 1EF1A 4GOCA 5D7GA 1GC7A 2N9KA 1TIFA 3AU5A 1KOTA 2X38A 3GOEA 1FRRA 2IZVB 4GDLA 3V05A 3URYA 5E6OA 4FJVB 5LNK1 2NMQA 1RAXA 4ANWA 1LO5D 2WXHA 4I6NB 1WZ3A 1T5XD 2IY0B 2GBNA 2KTRB 3V60A 4AOFA 4FA6A 1XQQA 3H7PA 2IO3B 1EO6A 4J6IA 3E56A 2PTLA 2LGDA 3MJ5A 3BYYB 2K8CA 3PO0A 1DOYA 3MHZA 2CJNA 5J17A 4MEMA 3DOWA 5H8YE 2LGYA 3W5UB 3VQIA 1AYFA 3U52E 1JWBD 4XYCA 3L10B 3HRDD 2KD0A 4NNJB 3EFUA 3W1YA 4FJYA 2DWQA 2KN5A 2DBYA 1WYGA 3QCAA 1MG8A 4G11A 3Q3JA 3JW0X 3Q8BA 2G9HD 3N3KB 3FAHA 2M0XA 3UQAA 4DXGA 1YJJA 3FILA 3LJ3A 4C4VB 3T3OA 3H7SA 2PE6B 3L08A 2KDBA 1ESFA 5HI1A 2K8BA 1WGKA 2VRRB 1GG3A 1VZ7A 1G6JA 2GI9A 2HE7A 3TMPB 3AEFB 5BO4B 1V97A 1JWMD 2AL6A 3DBRI 3EECA 4WWMA 2FIDA 3H8HA 1FXAA 2JRIB 4YL8A 4AP4C 2ZW0A 1TS4A 4TUUA 3KH0A 3N1XC 3U4EG 1WJNA 1V5OA 2E6XA 1L5PA 4S0RA 2JZZA 3KQ4A 1V1PB 2UYZB 1TBEA 3NS1A 2J0JA 2KMAA 4ICUA 4DHJB 3RPFC 4IKGA 1BT0A 3APFA 4NQLB 2Y5BB 5I4DA 3I63C 4DWFA 2K6QA 3AULA 2WS3B 1KRHA 1QILA 2UU7A 2O6VB 2BKFA 1C78A 3UQBA 3PRMB 1F9JA 1FEHA 2KVZA 5DPWA 2CJOA 3EFCA 4PK1A 1ZKHA 3ETRA 3HHMA 3L13A 3ZUNA 1KTKA 2V3SA 1TKYA 4RFBA 2MX2A 4TKNA 1JRPA 2NTTA 1NI2A 3TCAA 2V0GA 5BYQA 3P1MA 4EUTA 2WDRB 3KUDB 1GOZA 4CQNA 4ZRJA 2FCMA 1YJIA 1HTQA 2X8XX 1KLVA 4NY0A 3RYTA 3ZW3A 1YNTE 2CU1A 5D3IB 5J18A 1MJDA 3P4PB 2WXMA 1L0VB 3PTFC 4A55A 2JWUA 1XEEA 2DHZA 4IC7B 4F8CB 3Q3MC 4GLSC 2WX1A 2ZVOA 3SU8X 4CYEA 2FIFA 2JT4B 2KLCA 1RLFA 2EELA 1WE6A 3PSEB 5LXIB 2HDEA 2Y3AA 3ZDMC 1WE7A 1UNSA 1V86A 3VAWA 4GGQA 4HLEA 3ZNHB 2C7NB 4HROA 1QKZA 4M0WB 5IP4D 2QCZA 2AQ3B 1ZOYB 3X23A 2QSDA 4IM2A 2DNFA 1WM3A 1CK1A 2KZRA 2PLPA 2L0FA 3VDZA 3CSTA 2K3UA 3W1SC 2BPSA 3A9KA 4XZ4A 4KGTA 3RD2A 3UF8A 4EZKA 2WXIA 2KVRA 4M8NA 3AEBB 2HJ1A 3T8MA 1F2RC 3SFEB 3ZQ4A 1V80A 4HPLB 1E7VA 1H4RA 3LB8C 2J0MA 3O65B 2WNMA 1FO4A 3WALA 2IBIB 3AE9B 1QOBA 3VTWA 1E6EB 5FKAC 3AEDB 3VUYA 4HXDA 1LM8B 5KHOA 1YQ4B 1P7EA 3MP9A 4A8XC 4WWPA 1IBXA 1AWDA 3KWVA 3U7DA 3ALBA 4URKA 1MI0A 3VH4B 1SBBB 1OFFA 1N63A 1ZE3D 3VR9B 1UWXA 5E6PA 3UINB 1ET9A 2NTSA 2KJ6A 1XF5L 4A3PA 1TZ1A 2LHEA 3RZFA 1CQVA 2AQ1B 5FR3A 2BB6A 3ZVVA 1WXMA 3DBRB 3BK2A 1ENFA 2C5LC 2B3AA 2AL3A 2Z0EB 2FCNA 5E6NA 3JVZX 4YTNB 4BKSD 3RT3B 4MJSB 3NVWA 4W9CA 5JHBA 4LNOA 1FRDA 2MP2A 2WX0A 1HZ5A 2MBQA 3AE6B 1C3TA 4RH6A 1K50A 1WWTA 4KIKA 1L4ZB 4P16A 2V3NA 3VFKA 2Y5PA 3V62A 3VTVA 1WX8A 5HFYA 3DWGC 3ZLZA 1K53A 2DZIA 2G45B 4ZYNA 2BB5A 3B1LX 2JY6A 3EHVA 3PHWB 4RGNA 1QLBB 3TEXA 4E74A 1OQQA 1HQRD 2DZJA 4NZLB 4MM3A 2AQ2B 4XE0A 2RD0A 2V9HA 3VVWB 2YLMA 3OJ4B 1E0ZA 1NYRA 2E3TA 4HJGE 4FN2A 3R8BA 1UH6A 4EE2A 2IGGA 4EFOA 3WAOA 3DBHI 4W9DA 1FNUA 2CU3A 2WQYB 1FFUA 1PDXA 3RI7C 1WSPA 2KX3A 1WY8A 2I2YA 2AEHA 4ARIA 5G2NA 4NAWA 5GMVA 2MWSB 2G4SA 4M00A 4O1NA 2M56B 1C4AA 1XLQA 2NBUA 1IYFA 2V1YA 2N0SB 4ZHOA 5AZFA 1TS5A 2FBWB 1P98A 1PGAA 1Y56A 1F0ZA 1V5TA 3R3MA 4WWNA 2AWTA 2IO1B 5C3JB 2JZPA 1S3SG 1VZ6A 2OOBB 1WRIA 3AU4A 1PYWD 4JPSA 2DLBA 1T0YA 1P9DU 3TBLD 3NVZA 2IDYA 3I57A 3VH3B 3DBLB 2JYEA 3QK0A 4RGOS 2KDIA 3ZRFA 4XC2A 4JLCA 1NBFC 1E8ZA 1KLGD 5EE9A 4RM9A 3VRAB 1KH0A 1RFAA 4YTMB 3GE3C 2LZ6A 2LVOA 4F1SA 1WGGA 2D5GA 2NVUI 1CMXB 3A9JA 2N7EA 3KUZA 3P4QB 4BKGA 2JXXA 3RUIB 3CMMB 2KO3A 3U2SC 4ZRPA 4Q2JA 5AZHA 4AJWA 3RNAC 2W54A 4OZCA 1OEYA 3C19A 4LDTD 4LNNA 1JWSD 4GU2A 4RMAA 1TY0A 1WXAA 2KWCA 5CHVC 2YVCA 2GBMA 4G3XB 4KSLC 1SF0A 4BBNC 1N62A 1SGHA 1NI3A 2EMTA 1IUEA 1WF9A 5FR6A 2JPHA 3PPAA 2KMMA 2M4NA 3TEZA 3AB5A 3BVMA 3C8YA 4KVGB 1P1AA 1WMHB 5JXVA 3PZ8A 4W9FA 1I42A 2HJ8A 1ZXIA 4BFRA 3ZIMA 3TUOA 3R2IA 2CHZA 4AWJA 4GXBA 1BXTA 2D10A 4ANXA 1TS2A 2O6VD 1L0YB 1UGJA 2PMVA 2QHOA 1Q1OA 3IVFA 2M1MA 3V3XA 3H1UA 4F7ZA 3B9JA 2FUG1 1CJEA 3NVVA 4LJPB 4PYUA 2KFKB 3AM9A 4KV2A 3UIPB 4A3OA 2KLGA 4NJ7A 3KLSX 1HZ6A 2LXAA 2DX5B 2CR5A 2RGFA 4P1CC 1RM6C 1MG4A 1MVKA 4FHJA 4M01A 4L23A 4ASWC 3B2FA 1N6ZA 4K7WA 4K3BA 2KACA 3DBHB 2WDTB 2WDVB 3X0WA 1C4PA 4XX5A 1VDVA 1UBQA 3DHHC 4NPNA 3OJ3A 4WIPA 4C7YA 3UIOB 3KVFB 3QARA 5D3DA 3GZNB 5KHQA 1XXGA 2WWZA 4DXAB 5JHAA 2LRWA 3GP7A 2KJHB 3ZKJC 1MHXA 1FFVA 3K9OB 1T3QA 2IGDA 5IKCM 1F52A 4EZLA 1GAQB 2WXQA 3JSVB 2DYOA 1RYJA 3Q8EA 3BWUD 2KTRA 5BYSA 2KOXA 5LXHA 3ZGZA 1VCBA 3KWLA 5L95C 1FMAD 4A20A 5H92C 4LDTB 3NVYA 1H8CA 2J7QB 1F2RI 3ML9A 3DBSA 4A6QA 4KZCA 3U7ZA 2CS4A 2RDBC 3ZNGC 1WIAA 1YX5B 3SEBA 2R2QA 3CIRB 1SIJA 4IG7B 2LVPA 3DWMA 2SAKA 4TQ0A 3IT6B 1K51A 3BVGA 2W3RA 3Q2AC 2OHFA 2PPHA 1WJ6A 5EE1A 4L2YA 3BVZA 2N4FA 2IYDB 4WQOB 1GPXA 1FNVA 4PS8A 1Q5WB 1I4PA 2J0KA 1FCLA 3PZ7A 4C4VA 3VTUA 1X1MA 3AEAB 1TY2A 1WGHA 1RFKA 4TQ1A 3KUCB 2MA9B 2G1EA 2ZVNA 1L6VA 5DPTA 5J2RA 4ZHPA 1Q10A 3N1ZC 4OVUA 1GNUA 5FK9C 5DCNA 5JH5C 2MJ3A 1L2NA 2D07B 3HM3A 4D2KA 3Q8FA 1STEA 1OQRA 1V1PA 2ZJDA 4LNFA 2K1FA 2GBJA 3RZWC 3U8ZA 1J0GA 3L17A 4MGZE 1LQBA 1XLNA 1I4RA 2BTEA 4XWWA 2V4IB 3ZJUA 2K6DB 2LEKA 3HK0A 1ZP0B 4GMVA 2L76A 1FXIA 2O6VA 4NQKE 3VR8B 4QAYA 1AARA 1WGRA 1V1OA 4ZRIA 2N9EB 4C56C 2LUMA 1R4MB 4OW0A 2NBVB 5G55A 2I38A 3I9V1 3NZ3A 4HKZE 4LJOB 4YSXB 4PS7A 3OAWA 5D2MB 2KMCA 1Y8RC 4MH8A 5C1ZA 2M8SA 5DPSA 1A5RA 1I4HA 4WAFA 2DENB 2DYMA 1PUTA 1C9FA 2RR9A 2L8JA 5IA7A 4PS3A 2Z8LA 2L3ZA 1I4QA 2MBEA 4GB9A 4C00A 3RNCC 1J7BA 3DBLI 1KFYB 2RMMA 4BOZB 1SXTA 2PVOD 5G5HA 4DBGA 2ZNVC 3P63A 2IGHA 2WXPA 2RSUA 1PQSA 2BW2A 2KHWB 4I6LB 4ITKA 4TV3A 4GDKB 2FCQA 4MSMB 4J3OD 2ZCBA 2BWFA 4KSKC 4P7IA 4M0WA 3Q14C 3BYTB 3MC9A 3AE2B 1J7CA 1EU3A 1L7YA 3ZO5B 4KX6B 1WYWB 1B9RA 4B9KA 1P7FA 5IN7A 2MBBB 4AQ7A 3AE5B 3IFWB 2ZNVB 3FC4A 4HPPA 1WRDB 4OZBA 3HUIA 2G3QB 2REXA 1SE4A 1XCTL 2ZW1A 1N5WA 1L6UA 2KX0A 4W9HA 1E8YA 1UZXB 4OHJA 2RPVA 2L00B 3TEYA 3DPDA 2FUHB 2L83A 2KN4A 2QEJC 1D4BA 1PGXA 1EWCA 3KYCD 3K9PB 4IM0A 3GS2A 1QOAA 3PVLA 2WXLA 3W1SA 2N9LA 3Q3NC 5L83A 1FNWA 1JCKB 2LJIA 2NPTB 2BYVE 3AN1A 2LVQA 2GB1A 2L7RA 3B2GA 3ZTCA 2YEPF 2DZMA 1EF5A 3PS6A 1AW7A 3M95A 3S2AA 4WURA 2JU6X 2LHDA 2CHWA 2VH2A 2ASQA 3WAMA 3PLUA 2J52A 1DYQA 4CHKA 4ZYSA 2INDC 2FE8A 5HG2A 4WWOA 3DQVA 3N32A 5AUIA 3RMKC 3ZXRA 3APDA 2XEWA 5GXGB 1DOIA 1EM7A 1F77A 1EWYC 3IBEA 1XCQL 4N59A 4RNAA 4MJSA 3EA6A 3IAM1 2JSVX 3L16A 3ML8A 3AH7A 2BKRB 2A4ZA 2WXRA 2PEAA 2W3SA 2FCSA
chains in the Genus database with same CATH topology
4PT5A 2W55A 3FILA 4LK0M 5BMHA 1NI3A 1IUEA 1SE2A 3T3OA 4NAWB 5TSSA 5HI1A 1ESFA 2LMCA 1UUPA 2KMMA 4YT0B 3MC0B 3TEZA 2K22A 1FCCC 3AB5A 1TS3A 4TMAB 1VJKA 3BVMA 1WGKA 3C8YA 3LXFA 4JWUC 1VZ7A 2SEBD 5JXVA 3PZ8A 2GI9A 1ZXIA 3AEFB 5E6JA 1SJHD 3LYYA 1V97A 1JWMD 3AV8A 4WWMA 3TUOA 3ZJTA 3H8HA 1FXAA 2ONQA 3R2IA 2W82A 2ZW0A 1TS4A 4JX1C 3U4EG 4N6EB 1IBXB 1BXTA 3W5VB 2IJ0A 4KGRA 2E6XA 1L5PA 1TS2A 1L0YB 1UGJA 2PMVA 3KQ4A 1V1PB 4B0MA 3WCQA 3NS1A 3V3XA 3J9CA 2L52A 2QJLA 4JE3B 1TZOA 2BS4B 3RPFC 4DQOC 4IKGA 2WU2B 1ET6A 4RGMA 5I4DA 1TJEA 3B9JA 4FXCA 3VRBB 2PW9A 1KRHA 1QILA 2WS3B 2FUG1 1CJEA 2WLBA 3NVVA 1CZPA 2BS2B 3AM9A 3BZDB 1E7PB 3N9YC 1C78A 1ZXHA 1FEHA 2MEKA 3KLSX 1JALA 1HZ6A 2CJOA 4XDDA 3SR6A 1K52A 1RM6C 1MVKA 3BIID 1VZ8A 3ETRA 1JROA 4L23A 1KTKA 3B2FA 4AS1A 1TKYA 1PFDA 2KACA 1AN8A 1ZDXA 1J7AA 3AE8B 4P6VF 1XLPA 4RCOA 4RFBA 3TEWA 2WDVB 1C4PA 2QIEB 1JRPA 4HRSA 2NTTA 1C77A 2V0GA 1VDVA 1HA5A 5BYQA 3P1MA 1ROEA 2OEDA 2WDRB 4HEA1 1GOZA 2WXOA 5EE3A 4CQNA 2ON8A 2KDMA 2RDHA 4WIPA 1YJIA 1XLOA 2WXGA 3IT4B 4C7YA 1XO3A 5D3DA 1YNTE 2R61A 1FM0D 5D3IB 4B0EA 1FD6A 1XXGA 2WXMA 3P4PB 1KLUD 3GP7A 2Q5WD 2J53A 1L0VB 2WDQB 1NENB 4A55A 1JWUD 2BYTA 1C76A 3CWIA 1MHXA 2JWUA 1XEEA 3P42A 1FFVA 4US9A 1VLBA 1I4XA 1GB1A 4MM3B 1T3QA 2IGDA 1GAQB 1YMHE 5EE0A 1JW9D 4US8A 1DGJA 4GLSC 2WXQA 1QOFA 1I4GA 3E9SA 2DYOA 1RYJA 3Q8EA 1EU4A 3NRZA 4L1BA 2EELA 1HXYD 3BWUD 4YSZB 3ZJVA 5BYSA 1SB3C 2JQRB 3Q8AA 3EGRA 4YWGG 1E10A 1L4DB 2HDEA 3AEEB 3ZGZA 2Y3AA 3KWLA 1FMAD 1UNSA 3P4SB 5H92C 3NVYA 2MJEA 1YN4A 4HROA 4WH4A 1QKZA 1F2RI 5AUKA 1TYGB 2RDGA 2AQ3B 4NJCA 4LLGM 4A6QA 3U7ZA 1ZOYB 2INNE 2QSDA 2BT6A 1CK1A 2PLPA 3SEBA 1QQRA 2QMTA 3CIRB 2K3UA 2VZKD 1SIJA 3DWMA 2SAKA 4R3DA 4TQ0A 3IT6B 1K51A 3BVGA 2W3RA 4KGTA 5MPOA 4TSSA 2OHFA 5EE1A 4L2YA 3BVZA 1GPXA 1IGDA 1FNVA 2WXIA 4LTUA 4A9AA 2WU5B 3UI3A 3MFGA 2K0PA 2WXKA 1HEZE 3AEBB 1I4PA 1FCLA 3PZ7A 1F2RC 3SFEB 3ZQ4A 1JQ4A 3AEAB 1QF6A 1TY2A 1RFKA 4TQ1A 3LB8C 2J4XA 2PKOA 2G1EA 2WNMA 1FO4A 1D5MC 5G5GA 3ZYYX 4XWTA 4C80A 1NEKB 3AE9B 1QOBA 3IXSA 1E6EB 4C7ZA 1L6VA 5FKAC 3AEDB 4ZRQA 1BUIC 3AE7B 2HTME 4ZHPA 1JMLA 1Q10A 1YQ4B 1P7EA 5FK9C 3MP9A 2XN9C 1NYQA 4A8XC 5C2TB 2MJ3A 4OZAA 1IBXA 4GDLB 2KWDA 4D2KA 1QT9A 3Q8FA 1AWDA 1STEA 1L0XB 1WXQA 2KQ4X 3KWVA 1OQRA 3TSSA 2MH7A 1V1PA 1VR9A 1MI0A 1BMLC 1SBBB 1OFFA 1N63A 4KKJA 1C79A 1XLNA 1ZE3D 1I4RA 3VR9B 4USAA 4XWWA 2BTEA 2V4IB 1RWSA 1UWXA 3ZJUA 2LEKA 1ET9A 1ZP0B 2NTSA 1SE3A 1XF5L 2K5PA 1FXIA 4H2AA 1T6BX 2LHEA 1CQVA 3VR8B 2AQ1B 2B76B 1N61A 5FR3A 2BB6A 2H89B 3IAS1 5BYRA 3BK2A 1ENFA 1IGCA 1KF6B 1V1OA 3SFDB 1ZPSA 3HVZA 4YTNB 4UDUC 1N60A 2TSSA 2WXNA 4C56C 3NVWA 3AECB 4NAMA 4XDCA 2LUMA 2N7JA 1FRDA 1MHHE 1SEBD 1D5ZC 4OW0A 1HZ5A 3HVDA 2KAJA 3AE6B 1SJED 1QOGA 2I38A 4RH6A 3I9V1 1K50A 1WWTA 3NZ3A 1TKGA 1UWMA 1GB4A 4HKZE 3FILB 3W2DA 4RF0A 4YSXB 1L4ZB 1SSNA 1YQ3B 4P16A 2V3NA 2Y5PA 2PIAA 2YEPB 3AEGB 4MH8A 3AE1B 1TKEA 1I4HA 4WAFA 3DWGC 5HFYA 2DYMA 1PUTA 1MPEA 1K53A 1C9FA 2BB5A 4OVZA 3AE4B 5HHDG 2Z8LA 4RGNA 2ACZB 3AMZA 1I4QA 1YN3A 1PGBA 1QLBB 1D6EC 1FIQA 3TEXA 1J7BA 4KKIA 1OQQA 1HQRD 1KFYB 2V3PA 2WP9B 4NZLB 2AQ2B 2RMMA 4XE0A 1SXTA 3RFZB 2PVOD 4N58A 5G5HA 2H88B 3P63A 2JX5A 1E0ZA 1NYRA 2IGHA 2L32A 1C4CA 2E3TA 2WXPA 4HJGE 3ABVB 2K9XA 2JXTA 3R8BA 2BW2A 4MACA 2WXJA 2XNAC 1I7HA 1NVID 4EE2A 4ITKA 4GDKB 2IGGA 1YN5A 3R2TA 4YXDB 3Q8CA 2EKIA 4REZA 2INPE 4J3OD 4JWSC 2CU3A 1FNUA 3T3NA 2WQYB 1FFUA 2BS3B 4YTPB 1PDXA 1JWAD 1WSPA 2PVGC 3BK1A 2I2YA 2J42A 4ARIA 1M4VA 4M0WA 4KGSA 3BYTB 4WQMA 2LGIA 2VZKB 2M19A 3AE2B 3L4PA 1J7CA 2JYTA 4O1NA 1EU3A 2M56B 4KX6B 1B9RA 1N5XA 1C4AA 1P7FA 1V8CA 1XLQA 4AQ7A 3AE5B 3FC4A 2N0SB 4ZHOA 1TS5A 3P4RB 2FBWB 4OZBA 3W9CB 1PGAA 1Y56A 1F0ZA 1A70A 4RF1A 3AE3B 3HUIA 3O13A 1D5XC 2BBCA 1SE4A 1XCTL 2ZW1A 1N5WA 5C3JB 2JZPA 1VZ6A 1L6UA 1WRIA 2L1AA 1E9MA 1PYWD 4JPSA 3Q69A 2DLBA 4OHJA 2RPVA 4YSYB 2ICIA 2GRIA 3TEYA 2M0AA 1VRAB 3NVZA 5BMGA 2QILA 2L83A 2KN4A 2IDYA 3I57A 2QEJC 2JYEA 1D4BA 3NUHB 1PGXA 3OWEB 1EWCA 4RGOS 3GS2A 1QOAA 2WXLA 4A90A 3W1SA 2N9LA 3GB1A 1KLGD 5EE9A 3VRAB 5D7GA 3EUB2 1KH0A 2N9KA 4YTMB 1ACCA 2X38A 1FNWA 2MJDA 1JCKB 2LJIA 1FRRA 3V05A 3AN1A 4RGTA 3URYA 2GB1A 3B2GA 5LNK1 2D5GA 2NMQA 2YEPF 1DOXA 1LO5D 2WXHA 3P4QB 4HKQA 2IPKD 1ZUD2 1T5XD 1B1ZA 2LFIA 1AW7A 4WURA 2WXFA 2JU6X 2LHDA 2AX5A 4IDIA 3E56A 2PTLA 3U2SC 4ZRPA 3MJ5A 4Q2JA 3BYYB 3PO0A 1DOYA 3MHZA 2CJNA 2J52A 4MT5A 1DYQA 5T8IA 4ZYSA 2FE8A 5HG2A 5H8YE 2W54A 5AUIA 3W5UB 4OZCA 5GXGB 3VQIA 1AYFA 3U52E 1JWSD 1JWBD 1DOIA 5BMIA 1EM7A 1F77A 4IOIE 3HRDD 1TY0A 1EWYC 4RNAA 1XCQL 4N59A 4DXFA 4ARCA 3EA6A 3IAM1 4ZOHC 2DWQA 2JSVX 2DBYA 1WYGA 2Y5CA 3AH7A 1R7SA 2WXRA 3Q8BA 2G9HD 1SF0A 1ZDVA 3FAHA 2W3SA 4DXGA 1N62A 1YJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3O D;  1ZDX A;  4B0M A;  1ZE3 D;  1ZDV A;  4B0E A;  3RFZ B;  3BWU D; 
#chains in the Genus database with same CATH topology
 5CTR C;  5BMH A;  4NAW B;  2LMC A;  4YT0 B;  2GLS A;  2K22 A;  1FCC C;  4JL9 A;  1LXD A;  4JWU C;  2SEB D;  1WZ0 A;  1SJH D;  2R2O A;  3SHQ A;  3LYY A;  4N9F 4;  3ZJT A;  4DDG D;  1WXV A;  2XK5 B;  3GZN I;  3UGB B;  4EOY A;  4JX1 C;  4N6E B;  1YOV B;  2IJ0 A;  2RPQ A;  3DHI C;  1LFD A;  4BOS C;  3WCQ A;  4WJP A;  2C60 A;  3J9C A;  1HTO A;  2QJL A;  4DQO C;  2IY1 B;  2WU2 B;  4FXC A;  3VRB B;  5D94 A;  2PW9 A;  2WLB A;  1CZP A;  2BS2 B;  4WJO A;  1WFY A;  3GE8 C;  4M02 A;  2WGS A;  3DHG C;  3WAN A;  2MEK A;  1YJ1 A;  1GUA B;  1JAL A;  4XDD A;  3APC A;  1K52 A;  5IAA C;  4JQW C;  1VZ8 A;  2KDE B;  1JRO A;  1T0R C;  1XD3 B;  3KW5 B;  4AS1 A;  3M3J A;  1PFD A;  1AN8 A;  1R4N B;  1ZDX A;  1J7A A;  3AE8 B;  3SD5 A;  1XLP A;  4KZ0 A;  4RCO A;  3TEW A;  3DDC B;  3VXW A;  4FBJ B;  2QIE B;  4FUL A;  3ZTD A;  3ZXV A;  1ROE A;  2WYQ A;  3A1Q B;  4HEA 1;  3V61 A;  2WXO A;  5EE3 A;  2KDM A;  3H6N A;  1WJ4 A;  1WM2 A;  2RDH A;  1XLO A;  2D11 A;  2WXG A;  3IT4 B;  2JVC A;  4B0E A;  3L54 A;  1FD6 A;  1ISN A;  3RNE C;  3BY4 B;  2J53 A;  1NEN B;  1J8C A;  1JWU D;  3Q6B A;  4US9 A;  3P42 A;  3HIZ A;  1OQY A;  5CHW A;  1VLB A;  3D32 A;  1I4X A;  3ENE A;  4KDL B;  3IHP C;  5EE0 A;  1V2Y A;  1QOF A;  4L1B A;  1HXY D;  3ZJV A;  2ZEQ A;  2JQR B;  3Q8A A;  4W9L A;  2KC1 A;  3DVN U;  3AEE B;  4E3C A;  5LLI A;  3P4S B;  3AI5 A;  4CO7 A;  2LGX A;  4BKS A;  1WR1 A;  3FKY A;  5IO9 A;  2RDG A;  4NJC A;  4LLG M;  3ZRC A;  2LUE A;  2O2V B;  4MGY E;  1C1Y B;  1MFW A;  2BT6 A;  4JIO U;  4K7S A;  1QQR A;  4IM3 A;  2VZK D;  3Q3F A;  2OJR A;  2ZCC A;  4R3D A;  3RCZ A;  1D3Z A;  4LTU A;  2KYW A;  4A9A A;  3DVG X;  2JUO A;  3MFG A;  1SIF A;  1HEZ E;  1R4M I;  1V49 A;  2BWE S;  1WH3 A;  1QF6 A;  4PYZ A;  3QQ8 B;  1Q0W B;  2PKO A;  3QIJ A;  4JGH B;  1D5M C;  5G5G A;  3ZYY X;  1IP9 A;  1NEK B;  1WMH A;  1WGD A;  3IXS A;  2I1K A;  4C7Z A;  4ZRQ A;  1BUI C;  2LAS A;  4FHK A;  3MTN B;  2C9W B;  3WA0 A;  4DHZ E;  2W9N A;  2XN9 C;  1NYQ A;  5C2T B;  4OZA A;  1TTN A;  4GDL B;  2KWD A;  1QT9 A;  2KQ4 X;  2QC8 A;  2OJW A;  1WXQ A;  2KWU B;  1VR9 A;  2BF8 B;  1BML C;  4DDI D;  4HCN B;  4KKJ A;  1C79 A;  5JZE B;  2KK8 A;  3WAP A;  4USA A;  1RRB A;  3H7P B;  4MSQ B;  1RWS A;  1UGM A;  1SE3 A;  3TJP A;  4DHZ B;  3N1Y C;  1WX9 A;  2N1W A;  4H2A A;  2KFK A;  3IG3 A;  2B76 B;  1N61 A;  2H89 B;  3IAS 1;  1V9J A;  1IGC A;  4WAA A;  1KF6 B;  1ZPS A;  2LJ5 A;  4UDU C;  4BVU C;  1N60 A;  3PRP B;  1WGY A;  2TSS A;  2WXN A;  4OVV A;  4WJQ A;  4XDC A;  3AEC B;  4NAM A;  5CX3 A;  1MHH E;  2C7M B;  1XT9 B;  2ZPY A;  4WJN A;  1QOG A;  3PHX B;  1E90 A;  1P0R A;  2N7D A;  3L0W B;  3SDL C;  3FIL B;  3W2D A;  4FLH A;  1SSN A;  2PIA A;  2EMS A;  2YEP B;  3AEG B;  3AE1 B;  1TKE A;  1U4A A;  2N9X A;  4ACF A;  1MPE A;  1F1H A;  4M8M A;  3M63 B;  2LGS A;  5HHD G;  2ACZ B;  2WHI A;  4G0N B;  1YN3 A;  1PGB A;  3C0R B;  2BVC A;  2HTH A;  2V3P A;  2WP9 B;  3TIX A;  3RFZ B;  4IWO A;  2MBO A;  3JSV A;  3ZDT A;  2L32 A;  1ZGU B;  1C4C A;  3ABV B;  2K9X A;  4W9I A;  1OGW A;  3QC8 B;  2MLB A;  3R7Q A;  4MAC A;  1IPG A;  2WXJ A;  2XNA C;  1I7H A;  1NVI D;  1KJT A;  3R2T A;  1YN5 A;  4REZ A;  4JWS C;  2BS3 B;  3NZU A;  2PVG C;  2N9P C;  1YX6 B;  2KAN A;  4KGS A;  3NOB A;  4WQM A;  2LGI A;  4P1B C;  1ZW7 A;  2VZK B;  2M19 A;  2VH1 A;  2JYT A;  2LRU A;  1N5X A;  3OG5 A;  1V8C A;  5AZG A;  1Z2M A;  2A5U A;  1FXT B;  4BKT A;  3PRE A;  3P4R B;  3T9L A;  3DVN V;  2MHJ A;  1V81 A;  2ZPN A;  4RF1 A;  4K81 A;  3O13 A;  1D5X C;  2BBC A;  3N20 C;  3DCG A;  4LNI A;  3M62 B;  1UBI A;  2L1A A;  4XGA B;  1E9M A;  3B08 A;  3Q69 A;  2M0A A;  2BGF A;  5BMG A;  2D3A A;  4NJ6 A;  2ZZP B;  1V6E A;  2KXJ A;  3OWE B;  3VUX A;  2HD5 B;  3HM6 X;  3EUB 2;  4GN1 A;  3QHT A;  1ACC A;  3PLV A;  5AEK B;  2MJD A;  1T0Q C;  4BZA A;  1QZE A;  4RGT A;  2BYF A;  1E8X A;  1DOX A;  4HKQ A;  2IPK D;  1ZUD 2;  1B1Z A;  2LFI A;  3ZNZ B;  1I35 A;  1WI0 A;  2WXF A;  2D3C A;  2AX5 A;  4IDI A;  3R7R A;  3PV1 A;  4MT5 A;  5T8I A;  3B0A A;  3V6E B;  4EZJ A;  4HPM B;  4X57 B;  1E7U A;  5BMI A;  4MGK E;  4IOI E;  4E71 A;  4DXF A;  4ARC A;  4LNK A;  4ZOH C;  2KNB A;  3A9K B;  2Y5C A;  2GBR A;  2KQS A;  1R7S A;  2LXC A;  4BBN F;  4ZDV A;  3PGE A;  1ZDV A;  2KT7 A;  2D3G A;  4PT5 A;  2W55 A;  4HCP B;  2CKH B;  4LK0 M;  5C23 A;  1SE2 A;  3JYU A;  5TSS A;  1R4N I;  4ZRK A;  1UUP A;  3CSF A;  3MC0 B;  4IW0 A;  4TMA B;  1TS3 A;  1VJK A;  4HVB A;  3LXF A;  4AUQ C;  4W9K A;  4AJY B;  4S17 A;  1UEL A;  2INC C;  3I5J C;  5E6J A;  1M94 A;  3AV8 A;  1GC6 A;  2ONQ A;  2UWQ A;  2W82 A;  1UF0 A;  2NR2 A;  1IBX B;  3W5V B;  4KGR A;  4GDK A;  4B0M A;  2L52 A;  5HKH A;  4JE3 B;  1TZO A;  2BS4 B;  2KJR A;  1ET6 A;  2L0T A;  4RGM A;  4W9E A;  1TJE A;  2N1V A;  1Z5S B;  1UD7 A;  3BZD B;  1E7P B;  2LD9 A;  3N9Y C;  1ZXH A;  2L05 A;  2K25 A;  2BQQ A;  3SR6 A;  4IWQ A;  2KC2 A;  2DZK A;  3BII D;  1LGR A;  3I3T B;  2MQJ A;  4B95 A;  2AYO B;  2MP2 B;  2IO2 B;  3VHT C;  2MRP A;  2Z59 B;  4P6V F;  1S1Q B;  1YQB A;  4HRS A;  1C77 A;  1HA5 A;  3PZD A;  4KIK B;  3H9D A;  2JF5 A;  2OED A;  4FAD A;  3ECI A;  2ON8 A;  4KDI C;  1WXS A;  3QAQ A;  4LCD E;  4RM8 A;  1XO3 A;  3KYD D;  1J19 A;  5DPR A;  4B6W A;  2R61 A;  1FM0 D;  1KLU D;  2Q5W D;  2WDQ B;  2BYT A;  1C76 A;  3CWI A;  1GB1 A;  4MM3 B;  1YMH E;  2NPT A;  1JW9 D;  4US8 A;  1DGJ A;  2KDF B;  4IWP A;  2GBK A;  1I4G A;  3E9S A;  1EU4 A;  3NRZ A;  4FJZ A;  4YSZ B;  1SB3 C;  4YWG G;  3EGR A;  1E10 A;  1L4D B;  3U30 A;  2G4D B;  3PRZ A;  2KKC A;  4HDQ A;  3TL5 A;  2MJE A;  1YN4 A;  4WH4 A;  1GJZ A;  5AUK A;  1TYG B;  1T0S C;  2INN E;  3CF6 E;  3MC8 A;  2BYE A;  2QMT A;  2FAZ A;  1KM7 A;  5MPO A;  4TSS A;  2LI5 A;  3MJW A;  1IGD A;  5IOI A;  3P2B A;  2WU5 B;  4K7U A;  3UI3 A;  2K0P A;  2WXK A;  1YIW A;  1JQ4 A;  2KFJ A;  2J4X A;  3RN9 C;  4XWT A;  4C80 A;  3MHS D;  3Q3O C;  4MH0 E;  2M17 A;  3NY5 A;  3AE7 B;  4HWI B;  2HTM E;  1JML A;  2MCN B;  3WIM A;  1WX7 A;  2XK5 A;  2DAF A;  4MGI E;  2LWP A;  1L0X B;  3TSS A;  2V4L A;  2MH7 A;  3A9J B;  3RNG C;  2DYB A;  1TGZ B;  4G50 A;  4ANV A;  5TR5 A;  3NHE B;  1VD2 A;  2MW5 A;  2K5P A;  2K39 A;  1T6B X;  3A4R A;  4K3C A;  2EKE C;  1JRU A;  1OEY J;  5D6J B;  5BYR A;  3SFD B;  2JRH A;  2FNJ B;  3HVZ A;  4EEW A;  2XBB C;  4IUM B;  3R66 C;  2N7J A;  1E5W A;  1P3Q U;  1SEB D;  1D5Z C;  2KWV B;  4MEL A;  2NS5 A;  3AXC A;  3HVD A;  2KAJ A;  2PJH A;  1SJE D;  2D2Q A;  4DK5 A;  3A4S C;  1TKG A;  1UWM A;  1GB4 A;  3ZNI D;  4RF0 A;  1YQ3 B;  3A1Q A;  4HDO A;  3QWZ B;  3BIN A;  3RNB C;  4II2 B;  4GIV A;  4OVZ A;  2K8H A;  3AE4 B;  3NS8 A;  3AMZ A;  3NZS A;  4II3 B;  1D6E C;  2GMI C;  1FIQ A;  3PT2 B;  4W9J A;  4KKI A;  4K1R B;  3RNF C;  1K8R B;  2JWZ A;  2PE9 A;  4N58 A;  2H88 B;  2JX5 A;  3QX1 A;  2MSE D;  2JXT A;  4GSW A;  1WJU A;  2IO0 B;  4ANU A;  4W9G A;  2Z0D B;  4YXD B;  4HJK A;  3Q8C A;  2EKI A;  2INP E;  3T3N A;  4YTP B;  1JWA D;  2D3B A;  2CHX A;  3BK1 A;  2J42 A;  1M4V A;  3A33 B;  3QA8 A;  2KTF A;  3NJT A;  3L4P A;  4MDK E;  2JZ3 B;  3V6C B;  4DHJ D;  2O2V A;  2GOW A;  2DAJ A;  1WR6 E;  1OTR B;  1SE9 A;  2I1J A;  3ONS A;  3W9C B;  1EUV B;  1A70 A;  1HE8 A;  3EC8 A;  3RUL A;  4ICV A;  5EDS A;  3AE3 B;  2NCN A;  3OLM D;  1E8W A;  1TT5 B;  3NG0 A;  1FPY A;  2MBH A;  1NDD A;  4I6P A;  3QJZ A;  2QDF A;  3DVG Y;  4YSY B;  2ICI A;  2GRI A;  3N30 A;  1VRA B;  1YD8 U;  2QIL A;  4EKU A;  2NBW B;  3NUH B;  5CHF A;  4HK2 A;  4BAX A;  3VUW A;  2C7H A;  4A90 A;  2KQ7 A;  3GB1 A;  3LDZ E;  1EF1 A;  4GOC A;  5D7G A;  1GC7 A;  2N9K A;  1TIF A;  3AU5 A;  1KOT A;  2X38 A;  3GOE A;  1FRR A;  2IZV B;  4GDL A;  3V05 A;  3URY A;  5E6O A;  4FJV B;  5LNK 1;  2NMQ A;  1RAX A;  4ANW A;  1LO5 D;  2WXH A;  4I6N B;  1WZ3 A;  1T5X D;  2IY0 B;  2GBN A;  2KTR B;  3V60 A;  4AOF A;  4FA6 A;  1XQQ A;  3H7P A;  2IO3 B;  1EO6 A;  4J6I A;  3E56 A;  2PTL A;  2LGD A;  3MJ5 A;  3BYY B;  2K8C A;  3PO0 A;  1DOY A;  3MHZ A;  2CJN A;  5J17 A;  4MEM A;  3DOW A;  5H8Y E;  2LGY A;  3W5U B;  3VQI A;  1AYF A;  3U52 E;  1JWB D;  4XYC A;  3L10 B;  3HRD D;  2KD0 A;  4NNJ B;  3EFU A;  3W1Y A;  4FJY A;  2DWQ A;  2KN5 A;  2DBY A;  1WYG A;  3QCA A;  1MG8 A;  4G11 A;  3Q3J A;  3JW0 X;  3Q8B A;  2G9H D;  3N3K B;  3FAH A;  2M0X A;  3UQA A;  4DXG A;  1YJJ A;  3FIL A;  3LJ3 A;  4C4V B;  3T3O A;  3H7S A;  2PE6 B;  3L08 A;  2KDB A;  1ESF A;  5HI1 A;  2K8B A;  1WGK A;  2VRR B;  1GG3 A;  1VZ7 A;  1G6J A;  2GI9 A;  2HE7 A;  3TMP B;  3AEF B;  5BO4 B;  1V97 A;  1JWM D;  2AL6 A;  3DBR I;  3EEC A;  4WWM A;  2FID A;  3H8H A;  1FXA A;  2JRI B;  4YL8 A;  4AP4 C;  2ZW0 A;  1TS4 A;  4TUU A;  3KH0 A;  3N1X C;  3U4E G;  1WJN A;  1V5O A;  2E6X A;  1L5P A;  4S0R A;  2JZZ A;  3KQ4 A;  1V1P B;  2UYZ B;  1TBE A;  3NS1 A;  2J0J A;  2KMA A;  4ICU A;  4DHJ B;  3RPF C;  4IKG A;  1BT0 A;  3APF A;  4NQL B;  2Y5B B;  5I4D A;  3I63 C;  4DWF A;  2K6Q A;  3AUL A;  2WS3 B;  1KRH A;  1QIL A;  2UU7 A;  2O6V B;  2BKF A;  1C78 A;  3UQB A;  3PRM B;  1F9J A;  1FEH A;  2KVZ A;  5DPW A;  2CJO A;  3EFC A;  4PK1 A;  1ZKH A;  3ETR A;  3HHM A;  3L13 A;  3ZUN A;  1KTK A;  2V3S A;  1TKY A;  4RFB A;  2MX2 A;  4TKN A;  1JRP A;  2NTT A;  1NI2 A;  3TCA A;  2V0G A;  5BYQ A;  3P1M A;  4EUT A;  2WDR B;  3KUD B;  1GOZ A;  4CQN A;  4ZRJ A;  2FCM A;  1YJI A;  1HTQ A;  2X8X X;  1KLV A;  4NY0 A;  3RYT A;  3ZW3 A;  1YNT E;  2CU1 A;  5D3I B;  5J18 A;  1MJD A;  3P4P B;  2WXM A;  1L0V B;  3PTF C;  4A55 A;  2JWU A;  1XEE A;  2DHZ A;  4IC7 B;  4F8C B;  3Q3M C;  4GLS C;  2WX1 A;  2ZVO A;  3SU8 X;  4CYE A;  2FIF A;  2JT4 B;  2KLC A;  1RLF A;  2EEL A;  1WE6 A;  3PSE B;  5LXI B;  2HDE A;  2Y3A A;  3ZDM C;  1WE7 A;  1UNS A;  1V86 A;  3VAW A;  4GGQ A;  4HLE A;  3ZNH B;  2C7N B;  4HRO A;  1QKZ A;  4M0W B;  5IP4 D;  2QCZ A;  2AQ3 B;  1ZOY B;  3X23 A;  2QSD A;  4IM2 A;  2DNF A;  1WM3 A;  1CK1 A;  2KZR A;  2PLP A;  2L0F A;  3VDZ A;  3CST A;  2K3U A;  3W1S C;  2BPS A;  3A9K A;  4XZ4 A;  4KGT A;  3RD2 A;  3UF8 A;  4EZK A;  2WXI A;  2KVR A;  4M8N A;  3AEB B;  2HJ1 A;  3T8M A;  1F2R C;  3SFE B;  3ZQ4 A;  1V80 A;  4HPL B;  1E7V A;  1H4R A;  3LB8 C;  2J0M A;  3O65 B;  2WNM A;  1FO4 A;  3WAL A;  2IBI B;  3AE9 B;  1QOB A;  3VTW A;  1E6E B;  5FKA C;  3AED B;  3VUY A;  4HXD A;  1LM8 B;  5KHO A;  1YQ4 B;  1P7E A;  3MP9 A;  4A8X C;  4WWP A;  1IBX A;  1AWD A;  3KWV A;  3U7D A;  3ALB A;  4URK A;  1MI0 A;  3VH4 B;  1SBB B;  1OFF A;  1N63 A;  1ZE3 D;  3VR9 B;  1UWX A;  5E6P A;  3UIN B;  1ET9 A;  2NTS A;  2KJ6 A;  1XF5 L;  4A3P A;  1TZ1 A;  2LHE A;  3RZF A;  1CQV A;  2AQ1 B;  5FR3 A;  2BB6 A;  3ZVV A;  1WXM A;  3DBR B;  3BK2 A;  1ENF A;  2C5L C;  2B3A A;  2AL3 A;  2Z0E B;  2FCN A;  5E6N A;  3JVZ X;  4YTN B;  4BKS D;  3RT3 B;  4MJS B;  3NVW A;  4W9C A;  5JHB A;  4LNO A;  1FRD A;  2MP2 A;  2WX0 A;  1HZ5 A;  2MBQ A;  3AE6 B;  1C3T A;  4RH6 A;  1K50 A;  1WWT A;  4KIK A;  1L4Z B;  4P16 A;  2V3N A;  3VFK A;  2Y5P A;  3V62 A;  3VTV A;  1WX8 A;  5HFY A;  3DWG C;  3ZLZ A;  1K53 A;  2DZI A;  2G45 B;  4ZYN A;  2BB5 A;  3B1L X;  2JY6 A;  3EHV A;  3PHW B;  4RGN A;  1QLB B;  3TEX A;  4E74 A;  1OQQ A;  1HQR D;  2DZJ A;  4NZL B;  4MM3 A;  2AQ2 B;  4XE0 A;  2RD0 A;  2V9H A;  3VVW B;  2YLM A;  3OJ4 B;  1E0Z A;  1NYR A;  2E3T A;  4HJG E;  4FN2 A;  3R8B A;  1UH6 A;  4EE2 A;  2IGG A;  4EFO A;  3WAO A;  3DBH I;  4W9D A;  1FNU A;  2CU3 A;  2WQY B;  1FFU A;  1PDX A;  3RI7 C;  1WSP A;  2KX3 A;  1WY8 A;  2I2Y A;  2AEH A;  4ARI A;  5G2N A;  4NAW A;  5GMV A;  2MWS B;  2G4S A;  4M00 A;  4O1N A;  2M56 B;  1C4A A;  1XLQ A;  2NBU A;  1IYF A;  2V1Y A;  2N0S B;  4ZHO A;  5AZF A;  1TS5 A;  2FBW B;  1P98 A;  1PGA A;  1Y56 A;  1F0Z A;  1V5T A;  3R3M A;  4WWN A;  2AWT A;  2IO1 B;  5C3J B;  2JZP A;  1S3S G;  1VZ6 A;  2OOB B;  1WRI A;  3AU4 A;  1PYW D;  4JPS A;  2DLB A;  1T0Y A;  1P9D U;  3TBL D;  3NVZ A;  2IDY A;  3I57 A;  3VH3 B;  3DBL B;  2JYE A;  3QK0 A;  4RGO S;  2KDI A;  3ZRF A;  4XC2 A;  4JLC A;  1NBF C;  1E8Z A;  1KLG D;  5EE9 A;  4RM9 A;  3VRA B;  1KH0 A;  1RFA A;  4YTM B;  3GE3 C;  2LZ6 A;  2LVO A;  4F1S A;  1WGG A;  2D5G A;  2NVU I;  1CMX B;  3A9J A;  2N7E A;  3KUZ A;  3P4Q B;  4BKG A;  2JXX A;  3RUI B;  3CMM B;  2KO3 A;  3U2S C;  4ZRP A;  4Q2J A;  5AZH A;  4AJW A;  3RNA C;  2W54 A;  4OZC A;  1OEY A;  3C19 A;  4LDT D;  4LNN A;  1JWS D;  4GU2 A;  4RMA A;  1TY0 A;  1WXA A;  2KWC A;  5CHV C;  2YVC A;  2GBM A;  4G3X B;  4KSL C;  1SF0 A;  4BBN C;  1N62 A;  1SGH A;  1NI3 A;  2EMT A;  1IUE A;  1WF9 A;  5FR6 A;  2JPH A;  3PPA A;  2KMM A;  2M4N A;  3TEZ A;  3AB5 A;  3BVM A;  3C8Y A;  4KVG B;  1P1A A;  1WMH B;  5JXV A;  3PZ8 A;  4W9F A;  1I42 A;  2HJ8 A;  1ZXI A;  4BFR A;  3ZIM A;  3TUO A;  3R2I A;  2CHZ A;  4AWJ A;  4GXB A;  1BXT A;  2D10 A;  4ANX A;  1TS2 A;  2O6V D;  1L0Y B;  1UGJ A;  2PMV A;  2QHO A;  1Q1O A;  3IVF A;  2M1M A;  3V3X A;  3H1U A;  4F7Z A;  3B9J A;  2FUG 1;  1CJE A;  3NVV A;  4LJP B;  4PYU A;  2KFK B;  3AM9 A;  4KV2 A;  3UIP B;  4A3O A;  2KLG A;  4NJ7 A;  3KLS X;  1HZ6 A;  2LXA A;  2DX5 B;  2CR5 A;  2RGF A;  4P1C C;  1RM6 C;  1MG4 A;  1MVK A;  4FHJ A;  4M01 A;  4L23 A;  4ASW C;  3B2F A;  1N6Z A;  4K7W A;  4K3B A;  2KAC A;  3DBH B;  2WDT B;  2WDV B;  3X0W A;  1C4P A;  4XX5 A;  1VDV A;  1UBQ A;  3DHH C;  4NPN A;  3OJ3 A;  4WIP A;  4C7Y A;  3UIO B;  3KVF B;  3QAR A;  5D3D A;  3GZN B;  5KHQ A;  1XXG A;  2WWZ A;  4DXA B;  5JHA A;  2LRW A;  3GP7 A;  2KJH B;  3ZKJ C;  1MHX A;  1FFV A;  3K9O B;  1T3Q A;  2IGD A;  5IKC M;  1F52 A;  4EZL A;  1GAQ B;  2WXQ A;  3JSV B;  2DYO A;  1RYJ A;  3Q8E A;  3BWU D;  2KTR A;  5BYS A;  2KOX A;  5LXH A;  3ZGZ A;  1VCB A;  3KWL A;  5L95 C;  1FMA D;  4A20 A;  5H92 C;  4LDT B;  3NVY A;  1H8C A;  2J7Q B;  1F2R I;  3ML9 A;  3DBS A;  4A6Q A;  4KZC A;  3U7Z A;  2CS4 A;  2RDB C;  3ZNG C;  1WIA A;  1YX5 B;  3SEB A;  2R2Q A;  3CIR B;  1SIJ A;  4IG7 B;  2LVP A;  3DWM A;  2SAK A;  4TQ0 A;  3IT6 B;  1K51 A;  3BVG A;  2W3R A;  3Q2A C;  2OHF A;  2PPH A;  1WJ6 A;  5EE1 A;  4L2Y A;  3BVZ A;  2N4F A;  2IYD B;  4WQO B;  1GPX A;  1FNV A;  4PS8 A;  1Q5W B;  1I4P A;  2J0K A;  1FCL A;  3PZ7 A;  4C4V A;  3VTU A;  1X1M A;  3AEA B;  1TY2 A;  1WGH A;  1RFK A;  4TQ1 A;  3KUC B;  2MA9 B;  2G1E A;  2ZVN A;  1L6V A;  5DPT A;  5J2R A;  4ZHP A;  1Q10 A;  3N1Z C;  4OVU A;  1GNU A;  5FK9 C;  5DCN A;  5JH5 C;  2MJ3 A;  1L2N A;  2D07 B;  3HM3 A;  4D2K A;  3Q8F A;  1STE A;  1OQR A;  1V1P A;  2ZJD A;  4LNF A;  2K1F A;  2GBJ A;  3RZW C;  3U8Z A;  1J0G A;  3L17 A;  4MGZ E;  1LQB A;  1XLN A;  1I4R A;  2BTE A;  4XWW A;  2V4I B;  3ZJU A;  2K6D B;  2LEK A;  3HK0 A;  1ZP0 B;  4GMV A;  2L76 A;  1FXI A;  2O6V A;  4NQK E;  3VR8 B;  4QAY A;  1AAR A;  1WGR A;  1V1O A;  4ZRI A;  2N9E B;  4C56 C;  2LUM A;  1R4M B;  4OW0 A;  2NBV B;  5G55 A;  2I38 A;  3I9V 1;  3NZ3 A;  4HKZ E;  4LJO B;  4YSX B;  4PS7 A;  3OAW A;  5D2M B;  2KMC A;  1Y8R C;  4MH8 A;  5C1Z A;  2M8S A;  5DPS A;  1A5R A;  1I4H A;  4WAF A;  2DEN B;  2DYM A;  1PUT A;  1C9F A;  2RR9 A;  2L8J A;  5IA7 A;  4PS3 A;  2Z8L A;  2L3Z A;  1I4Q A;  2MBE A;  4GB9 A;  4C00 A;  3RNC C;  1J7B A;  3DBL I;  1KFY B;  2RMM A;  4BOZ B;  1SXT A;  2PVO D;  5G5H A;  4DBG A;  2ZNV C;  3P63 A;  2IGH A;  2WXP A;  2RSU A;  1PQS A;  2BW2 A;  2KHW B;  4I6L B;  4ITK A;  4TV3 A;  4GDK B;  2FCQ A;  4MSM B;  4J3O D;  2ZCB A;  2BWF A;  4KSK C;  4P7I A;  4M0W A;  3Q14 C;  3BYT B;  3MC9 A;  3AE2 B;  1J7C A;  1EU3 A;  1L7Y A;  3ZO5 B;  4KX6 B;  1WYW B;  1B9R A;  4B9K A;  1P7F A;  5IN7 A;  2MBB B;  4AQ7 A;  3AE5 B;  3IFW B;  2ZNV B;  3FC4 A;  4HPP A;  1WRD B;  4OZB A;  3HUI A;  2G3Q B;  2REX A;  1SE4 A;  1XCT L;  2ZW1 A;  1N5W A;  1L6U A;  2KX0 A;  4W9H A;  1E8Y A;  1UZX B;  4OHJ A;  2RPV A;  2L00 B;  3TEY A;  3DPD A;  2FUH B;  2L83 A;  2KN4 A;  2QEJ C;  1D4B A;  1PGX A;  1EWC A;  3KYC D;  3K9P B;  4IM0 A;  3GS2 A;  1QOA A;  3PVL A;  2WXL A;  3W1S A;  2N9L A;  3Q3N C;  5L83 A;  1FNW A;  1JCK B;  2LJI A;  2NPT B;  2BYV E;  3AN1 A;  2LVQ A;  2GB1 A;  2L7R A;  3B2G A;  3ZTC A;  2YEP F;  2DZM A;  1EF5 A;  3PS6 A;  1AW7 A;  3M95 A;  3S2A A;  4WUR A;  2JU6 X;  2LHD A;  2CHW A;  2VH2 A;  2ASQ A;  3WAM A;  3PLU A;  2J52 A;  1DYQ A;  4CHK A;  4ZYS A;  2IND C;  2FE8 A;  5HG2 A;  4WWO A;  3DQV A;  3N32 A;  5AUI A;  3RMK C;  3ZXR A;  3APD A;  2XEW A;  5GXG B;  1DOI A;  1EM7 A;  1F77 A;  1EWY C;  3IBE A;  1XCQ L;  4N59 A;  4RNA A;  4MJS A;  3EA6 A;  3IAM 1;  2JSV X;  3L16 A;  3ML8 A;  3AH7 A;  2BKR B;  2A4Z A;  2WXR A;  2PEA A;  2W3S A;  2FCS A; 
#chains in the Genus database with same CATH homology
 4PT5 A;  2W55 A;  3FIL A;  4LK0 M;  5BMH A;  1NI3 A;  1IUE A;  1SE2 A;  3T3O A;  4NAW B;  5TSS A;  5HI1 A;  1ESF A;  2LMC A;  1UUP A;  2KMM A;  4YT0 B;  3MC0 B;  3TEZ A;  2K22 A;  1FCC C;  3AB5 A;  1TS3 A;  4TMA B;  1VJK A;  3BVM A;  1WGK A;  3C8Y A;  3LXF A;  4JWU C;  1VZ7 A;  2SEB D;  5JXV A;  3PZ8 A;  2GI9 A;  1ZXI A;  3AEF B;  5E6J A;  1SJH D;  3LYY A;  1V97 A;  1JWM D;  3AV8 A;  4WWM A;  3TUO A;  3ZJT A;  3H8H A;  1FXA A;  2ONQ A;  3R2I A;  2W82 A;  2ZW0 A;  1TS4 A;  4JX1 C;  3U4E G;  4N6E B;  1IBX B;  1BXT A;  3W5V B;  2IJ0 A;  4KGR A;  2E6X A;  1L5P A;  1TS2 A;  1L0Y B;  1UGJ A;  2PMV A;  3KQ4 A;  1V1P B;  4B0M A;  3WCQ A;  3NS1 A;  3V3X A;  3J9C A;  2L52 A;  2QJL A;  4JE3 B;  1TZO A;  2BS4 B;  3RPF C;  4DQO C;  4IKG A;  2WU2 B;  1ET6 A;  4RGM A;  5I4D A;  1TJE A;  3B9J A;  4FXC A;  3VRB B;  2PW9 A;  1KRH A;  1QIL A;  2WS3 B;  2FUG 1;  1CJE A;  2WLB A;  3NVV A;  1CZP A;  2BS2 B;  3AM9 A;  3BZD B;  1E7P B;  3N9Y C;  1C78 A;  1ZXH A;  1FEH A;  2MEK A;  3KLS X;  1JAL A;  1HZ6 A;  2CJO A;  4XDD A;  3SR6 A;  1K52 A;  1RM6 C;  1MVK A;  3BII D;  1VZ8 A;  3ETR A;  1JRO A;  4L23 A;  1KTK A;  3B2F A;  4AS1 A;  1TKY A;  1PFD A;  2KAC A;  1AN8 A;  1ZDX A;  1J7A A;  3AE8 B;  4P6V F;  1XLP A;  4RCO A;  4RFB A;  3TEW A;  2WDV B;  1C4P A;  2QIE B;  1JRP A;  4HRS A;  2NTT A;  1C77 A;  2V0G A;  1VDV A;  1HA5 A;  5BYQ A;  3P1M A;  1ROE A;  2OED A;  2WDR B;  4HEA 1;  1GOZ A;  2WXO A;  5EE3 A;  4CQN A;  2ON8 A;  2KDM A;  2RDH A;  4WIP A;  1YJI A;  1XLO A;  2WXG A;  3IT4 B;  4C7Y A;  1XO3 A;  5D3D A;  1YNT E;  2R61 A;  1FM0 D;  5D3I B;  4B0E A;  1FD6 A;  1XXG A;  2WXM A;  3P4P B;  1KLU D;  3GP7 A;  2Q5W D;  2J53 A;  1L0V B;  2WDQ B;  1NEN B;  4A55 A;  1JWU D;  2BYT A;  1C76 A;  3CWI A;  1MHX A;  2JWU A;  1XEE A;  3P42 A;  1FFV A;  4US9 A;  1VLB A;  1I4X A;  1GB1 A;  4MM3 B;  1T3Q A;  2IGD A;  1GAQ B;  1YMH E;  5EE0 A;  1JW9 D;  4US8 A;  1DGJ A;  4GLS C;  2WXQ A;  1QOF A;  1I4G A;  3E9S A;  2DYO A;  1RYJ A;  3Q8E A;  1EU4 A;  3NRZ A;  4L1B A;  2EEL A;  1HXY D;  3BWU D;  4YSZ B;  3ZJV A;  5BYS A;  1SB3 C;  2JQR B;  3Q8A A;  3EGR A;  4YWG G;  1E10 A;  1L4D B;  2HDE A;  3AEE B;  3ZGZ A;  2Y3A A;  3KWL A;  1FMA D;  1UNS A;  3P4S B;  5H92 C;  3NVY A;  2MJE A;  1YN4 A;  4HRO A;  4WH4 A;  1QKZ A;  1F2R I;  5AUK A;  1TYG B;  2RDG A;  2AQ3 B;  4NJC A;  4LLG M;  4A6Q A;  3U7Z A;  1ZOY B;  2INN E;  2QSD A;  2BT6 A;  1CK1 A;  2PLP A;  3SEB A;  1QQR A;  2QMT A;  3CIR B;  2K3U A;  2VZK D;  1SIJ A;  3DWM A;  2SAK A;  4R3D A;  4TQ0 A;  3IT6 B;  1K51 A;  3BVG A;  2W3R A;  4KGT A;  5MPO A;  4TSS A;  2OHF A;  5EE1 A;  4L2Y A;  3BVZ A;  1GPX A;  1IGD A;  1FNV A;  2WXI A;  4LTU A;  4A9A A;  2WU5 B;  3UI3 A;  3MFG A;  2K0P A;  2WXK A;  1HEZ E;  3AEB B;  1I4P A;  1FCL A;  3PZ7 A;  1F2R C;  3SFE B;  3ZQ4 A;  1JQ4 A;  3AEA B;  1QF6 A;  1TY2 A;  1RFK A;  4TQ1 A;  3LB8 C;  2J4X A;  2PKO A;  2G1E A;  2WNM A;  1FO4 A;  1D5M C;  5G5G A;  3ZYY X;  4XWT A;  4C80 A;  1NEK B;  3AE9 B;  1QOB A;  3IXS A;  1E6E B;  4C7Z A;  1L6V A;  5FKA C;  3AED B;  4ZRQ A;  1BUI C;  3AE7 B;  2HTM E;  4ZHP A;  1JML A;  1Q10 A;  1YQ4 B;  1P7E A;  5FK9 C;  3MP9 A;  2XN9 C;  1NYQ A;  4A8X C;  5C2T B;  2MJ3 A;  4OZA A;  1IBX A;  4GDL B;  2KWD A;  4D2K A;  1QT9 A;  3Q8F A;  1AWD A;  1STE A;  1L0X B;  1WXQ A;  2KQ4 X;  3KWV A;  1OQR A;  3TSS A;  2MH7 A;  1V1P A;  1VR9 A;  1MI0 A;  1BML C;  1SBB B;  1OFF A;  1N63 A;  4KKJ A;  1C79 A;  1XLN A;  1ZE3 D;  1I4R A;  3VR9 B;  4USA A;  4XWW A;  2BTE A;  2V4I B;  1RWS A;  1UWX A;  3ZJU A;  2LEK A;  1ET9 A;  1ZP0 B;  2NTS A;  1SE3 A;  1XF5 L;  2K5P A;  1FXI A;  4H2A A;  1T6B X;  2LHE A;  1CQV A;  3VR8 B;  2AQ1 B;  2B76 B;  1N61 A;  5FR3 A;  2BB6 A;  2H89 B;  3IAS 1;  5BYR A;  3BK2 A;  1ENF A;  1IGC A;  1KF6 B;  1V1O A;  3SFD B;  1ZPS A;  3HVZ A;  4YTN B;  4UDU C;  1N60 A;  2TSS A;  2WXN A;  4C56 C;  3NVW A;  3AEC B;  4NAM A;  4XDC A;  2LUM A;  2N7J A;  1FRD A;  1MHH E;  1SEB D;  1D5Z C;  4OW0 A;  1HZ5 A;  3HVD A;  2KAJ A;  3AE6 B;  1SJE D;  1QOG A;  2I38 A;  4RH6 A;  3I9V 1;  1K50 A;  1WWT A;  3NZ3 A;  1TKG A;  1UWM A;  1GB4 A;  4HKZ E;  3FIL B;  3W2D A;  4RF0 A;  4YSX B;  1L4Z B;  1SSN A;  1YQ3 B;  4P16 A;  2V3N A;  2Y5P A;  2PIA A;  2YEP B;  3AEG B;  4MH8 A;  3AE1 B;  1TKE A;  1I4H A;  4WAF A;  3DWG C;  5HFY A;  2DYM A;  1PUT A;  1MPE A;  1K53 A;  1C9F A;  2BB5 A;  4OVZ A;  3AE4 B;  5HHD G;  2Z8L A;  4RGN A;  2ACZ B;  3AMZ A;  1I4Q A;  1YN3 A;  1PGB A;  1QLB B;  1D6E C;  1FIQ A;  3TEX A;  1J7B A;  4KKI A;  1OQQ A;  1HQR D;  1KFY B;  2V3P A;  2WP9 B;  4NZL B;  2AQ2 B;  2RMM A;  4XE0 A;  1SXT A;  3RFZ B;  2PVO D;  4N58 A;  5G5H A;  2H88 B;  3P63 A;  2JX5 A;  1E0Z A;  1NYR A;  2IGH A;  2L32 A;  1C4C A;  2E3T A;  2WXP A;  4HJG E;  3ABV B;  2K9X A;  2JXT A;  3R8B A;  2BW2 A;  4MAC A;  2WXJ A;  2XNA C;  1I7H A;  1NVI D;  4EE2 A;  4ITK A;  4GDK B;  2IGG A;  1YN5 A;  3R2T A;  4YXD B;  3Q8C A;  2EKI A;  4REZ A;  2INP E;  4J3O D;  4JWS C;  2CU3 A;  1FNU A;  3T3N A;  2WQY B;  1FFU A;  2BS3 B;  4YTP B;  1PDX A;  1JWA D;  1WSP A;  2PVG C;  3BK1 A;  2I2Y A;  2J42 A;  4ARI A;  1M4V A;  4M0W A;  4KGS A;  3BYT B;  4WQM A;  2LGI A;  2VZK B;  2M19 A;  3AE2 B;  3L4P A;  1J7C A;  2JYT A;  4O1N A;  1EU3 A;  2M56 B;  4KX6 B;  1B9R A;  1N5X A;  1C4A A;  1P7F A;  1V8C A;  1XLQ A;  4AQ7 A;  3AE5 B;  3FC4 A;  2N0S B;  4ZHO A;  1TS5 A;  3P4R B;  2FBW B;  4OZB A;  3W9C B;  1PGA A;  1Y56 A;  1F0Z A;  1A70 A;  4RF1 A;  3AE3 B;  3HUI A;  3O13 A;  1D5X C;  2BBC A;  1SE4 A;  1XCT L;  2ZW1 A;  1N5W A;  5C3J B;  2JZP A;  1VZ6 A;  1L6U A;  1WRI A;  2L1A A;  1E9M A;  1PYW D;  4JPS A;  3Q69 A;  2DLB A;  4OHJ A;  2RPV A;  4YSY B;  2ICI A;  2GRI A;  3TEY A;  2M0A A;  1VRA B;  3NVZ A;  5BMG A;  2QIL A;  2L83 A;  2KN4 A;  2IDY A;  3I57 A;  2QEJ C;  2JYE A;  1D4B A;  3NUH B;  1PGX A;  3OWE B;  1EWC A;  4RGO S;  3GS2 A;  1QOA A;  2WXL A;  4A90 A;  3W1S A;  2N9L A;  3GB1 A;  1KLG D;  5EE9 A;  3VRA B;  5D7G A;  3EUB 2;  1KH0 A;  2N9K A;  4YTM B;  1ACC A;  2X38 A;  1FNW A;  2MJD A;  1JCK B;  2LJI A;  1FRR A;  3V05 A;  3AN1 A;  4RGT A;  3URY A;  2GB1 A;  3B2G A;  5LNK 1;  2D5G A;  2NMQ A;  2YEP F;  1DOX A;  1LO5 D;  2WXH A;  3P4Q B;  4HKQ A;  2IPK D;  1ZUD 2;  1T5X D;  1B1Z A;  2LFI A;  1AW7 A;  4WUR A;  2WXF A;  2JU6 X;  2LHD A;  2AX5 A;  4IDI A;  3E56 A;  2PTL A;  3U2S C;  4ZRP A;  3MJ5 A;  4Q2J A;  3BYY B;  3PO0 A;  1DOY A;  3MHZ A;  2CJN A;  2J52 A;  4MT5 A;  1DYQ A;  5T8I A;  4ZYS A;  2FE8 A;  5HG2 A;  5H8Y E;  2W54 A;  5AUI A;  3W5U B;  4OZC A;  5GXG B;  3VQI A;  1AYF A;  3U52 E;  1JWS D;  1JWB D;  1DOI A;  5BMI A;  1EM7 A;  1F77 A;  4IOI E;  3HRD D;  1TY0 A;  1EWY C;  4RNA A;  1XCQ L;  4N59 A;  4DXF A;  4ARC A;  3EA6 A;  3IAM 1;  4ZOH C;  2DWQ A;  2JSV X;  2DBY A;  1WYG A;  2Y5C A;  3AH7 A;  1R7S A;  2WXR A;  3Q8B A;  2G9H D;  1SF0 A;  1ZDV A;  3FAH A;  2W3S A;  4DXG A;  1N62 A;  1YJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...