4B0EA

Crystal structure of the caf1a usher protein n-terminal domain from yersinia pestis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
b'LPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSSLQLTKYGIDIDKYPDLIKSGTEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein
total genus 21
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4b0eA00
1ZDXA 1ZE3D 4B0MA 3BWUD 3RFZB 4B0EA 1ZDVA 4J3OD
chains in the Genus database with same CATH superfamily
3AE4B 1LQBA 1FCLA 1IP9A 4KGRA 5EE1A 3K9OB 2INPE 2WDQB 2Y5BB 4G3XB 1JWBD 2KJRA 4W9DA 4YXDB 3PHXB 4M00A 2WU2B 4E74A 4RF1A 1V80A 1K50A 4X57B 4AUQC 4FA6A 3VRAB 4KX6B 4DHJD 2R2QA 1SE9A 1GAQB 1XLQA 5KHOA 4YSZB 2N4FA 2KQ4X 1CK1A 1FNUA 3V3XA 3CMMB 3SR6A 5J2RA 3GS2A 5LXHA 2INDC 2LGYA 1A5RA 3SU8X 4LNNA 2WWZA 3T3OA 2ZCCA 2JX5A 1Z5SB 1ZW7A 1JRUA 4GU2A 2A5UA 4I6LB 5EE3A 4NZLB 2L7RA 1IGDA 3V61A 4MGKE 5HI1A 4I6NB 3GE8C 2D3GA 4JWSC 3WAMA 1V81A 2IGDA 3RPFC 4XE0A 5H92C 1P98A 2G4DB 4HJGE 3C8YA 1UBIA 5J17A 2FNJB 2KDMA 3MJ5A 2N7EA 2FUHB 1L4DB 1UZXB 2H89B 3PHWB 4FLHA 4W9CA 4A6QA 4JQWC 2LXCA 1LXDA 3B1LX 3QX1A 3U7ZA 1HZ6A 4KZ0A 4MM3A 2KC1A 3RZWC 3VFKA 4USAA 3KH0A 3BVGA 3VH4B 2LI5A 3UIPB 4BBNC 3WCQA 2I1KA 4FN2A 1N62A 1FFVA 4J3OD 1E6EB 1N5WA 2LD9A 4KZCA 1ZE3D 2J0JA 2WXIA 3GB1A 2WXNA 3QCAA 1HQRD 3A9JB 2M8SA 4R3DA 4LTUA 2JYEA 3DVGX 1U4AA 2C7NB 3DHGC 2I2YA 4N59A 1I4XA 4AWJA 1ZGUB 1T3QA 4W9EA 5FR3A 4OZBA 3ZKJC 2EKEC 4WWOA 1F2RC 1X1MA 5I4DA 2LVQA 2NBWB 2V3PA 4TQ1A 1WXMA 3Q3NC 3H7SA 3BK1A 4JIOU 2DZJA 4JGHB 4OZCA 3HK0A 4IW0A 3TSSA 1TIFA 3OAWA 4GDKA 4IKGA 1WM2A 3E9SA 4KIKB 4ZOHC 4FJVB 3TIXA 1D4BA 3P2BA 2DZIA 1WSPA 3RN9C 4GN1A 4IM3A 3DVNU 3A33B 4BKSD 5L83A 3T9LA 1SBBB 2KO3A 3AXCA 1V1PA 2WNMA 1FPYA 4HCNB 3B08A 4HEA1 2C5LC 3LB8C 4M0WB 2QILA 4DQOC 2MJDA 1N63A 1QOAA 2W9NA 3EFUA 2PIAA 1KH0A 4W9GA 3FC4A 2LASA 2W3SA 3NVZA 4C7YA 5AEKB 3EC8A 2HE7A 4S17A 2MWSB 4GDLA 2M0XA 1TT5B 5G5GA 1GOZA 4BBNF 2BT6A 2SEBD 1PUTA 2LJIA 2M4NA 1XO3A 1EO6A 2V9HA 2NR2A 1MI0A 3W1SC 2B76B 2C9WB 4DK5A 4TQ0A 3D32A 3IAS1 4REZA 4P6VF 3X0WA 1V2YA 2RGFA 4HXDA 1WJNA 2D3CA 2OOBB 3PLVA 3RNCC 3SD5A 2IGGA 3Q3OC 3CSFA 1MPEA 2ACZB 2AQ1B 2WXHA 1YNTE 3WA0A 4FJYA 4B6WA 2HJ1A 3NVWA 1Z2MA 2L52A 3WALA 2WU5B 4G11A 1Q5WB 2N1VA 1ROEA 4FJZA 1ZXHA 2K39A 3B2GA 1WGGA 1WH3A 3AN1A 2JWZA 1B9RA 1MJDA 1QT9A 1QQRA 1LM8B 3QIJA 3KQ4A 2KX3A 1ZDXA 4RGTA 3HM3A 3PZ8A 2XEWA 3A9KB 3MP9A 3R8BA 4AQ7A 4ZRJA 1M94A 3DPDA 4CO7A 2ZEQA 2KTFA 1TKEA 4WAFA 2ZPYA 3ZTCA 1CJEA 2WP9B 3BK2A 3MFGA 2MJ3A 3RI7C 1L4ZB 3NHEB 2FBWB 5LXIB 4N58A 2LRUA 1JRPA 1JWSD 1QOFA 2GBMA 2IJ0A 1WX7A 3KWLA 3ZTDA 3R2TA 4HCPB 3ZW3A 1JWMD 1V49A 4BOZB 4W9KA 3PGEA 3SFDB 3W1SA 4MSQB 1V8CA 2NPTA 4EZJA 1YX5B 4AS1A 3IT6B 3AEGB 2JZ3B 2MP2A 2BWES 3P4QB 4IOIE 4FHJA 1AYFA 1WFYA 4OHJA 2VH2A 5D6JB 2CJNA 4P1CC 3IBEA 3NRZA 1VCBA 4GSWA 3DWMA 2KWVB 1SIFA 2Z0DB 2BGFA 4US9A 2FCSA 4LNFA 3URYA 2L3ZA 4A55A 1WE7A 3APCA 4LJOB 1MG8A 3AE5B 3T8MA 3DBRB 2O6VD 3GZNB 3QQ8B 2RDHA 1DOXA 1TS4A 5AZGA 4A8XC 1RWSA 1ESFA 3M95A 4MM3B 2AQ3B 2LGDA 5TSSA 1FD6A 3NVVA 1TY0A 3TMPB 4II3B 3UQAA 4HKZE 2Y5PA 4LNIA 4M01A 3JYUA 3BYYB 1C1YB 1IGCA 3L13A 3ZVVA 3DBRI 4WWMA 2RPVA 3PRPB 2CHWA 2LXAA 1SGHA 4ZRQA 4FXCA 1TKGA 4XC2A 1E10A 2NVUI 2W55A 4BAXA 4C4VA 3Q69A 2KYWA 2D11A 1PGBA 1E7PB 1UGMA 4IM0A 4EEWA 1HXYD 2LEKA 2EMTA 2J52A 3U2SC 3AEEB 2JPHA 3AU4A 1WE6A 2HTHA 2FE8A 4HJKA 3VRBB 4ACFA 5GMVA 3U4EG 4C56C 1BUIC 1DGJA 1VZ8A 2WDVB 1I4GA 4A3PA 1D5XC 4RH6A 3DWGC 3P4PB 1T0YA 1TYGB 3DCGA 4B9KA 4M8NA 3HVZA 1T6BX 4MELA 1IYFA 2N9LA 4IWOA 4YL8A 5BMHA 1YQ4B 4ZHOA 5BYSA 2ONQA 1D3ZA 1FNVA 3ZGZA 1EF5A 3A4RA 3A1QA 2NTTA 3DBSA 3QA8A 1JALA 4M02A 3N3KB 3KWVA 3K9PB 5FR6A 1YMHE 4W9LA 2K22A 2LUMA 3O65B 3H7PA 2BS4B 2WS3B 2LVOA 1WF9A 2LVPA 3LJ3A 1QZEA 2KN5A 3VTUA 5HG2A 1PQSA 1L0VB 1RFAA 1OGWA 1T0SC 2CHZA 3NS8A 1S3SG 1KLUD 3EECA 2WQYB 2KHWB 4KKIA 4GDLB 3LXFA 3L54A 2K5PA 4P16A 3TEYA 1R4NB 3X23A 1N60A 3DVNV 1GC7A 1WYGA 1SEBD 3RT3B 2K25A 3ZDTA 1WYWB 1FXIA 1RFKA 2MRPA 4FBJB 4AP4C 2E6XA 1P1AA 1BMLC 3SEBA 1PDXA 1NI2A 2JT4B 1YQBA 3WIMA 1V6EA 1Y56A 1P7FA 1KLVA 4XWWA 4LCDE 3V6EB 5BO4B 1R4NI 2FIFA 2JZPA 1E0ZA 1RYJA 2ZW0A 1F1HA 2BYFA 2J7QB 2BS2B 4IDIA 1J7CA 2OEDA 4W9FA 3W1YA 1JWUD 3ECIA 1F2RI 4HK2A 5D7GA 4E71A 1ET9A 2WXFA 1R7SA 2JY6A 3KW5B 1AARA 1WMHA 3PS6A 4F8CB 2WXGA 1TS2A 1ZDVA 4RGMA 3QAQA 3RNEC 3RCZA 2KX0A 4KDIC 2V3SA 2O2VA 4YTPB 1SE2A 4DWFA 2CKHB 2BKFA 1UD7A 4WURA 1ENFA 2MSED 1UWXA 5IO9A 4EOYA 2AX5A 3LYYA 3DBHB 1CQVA 4RGOS 1KTKA 1SE4A 3MHZA 1L7YA 3BY4B 1P0RA 2LJ5A 3Q8EA 2RR9A 3DQVA 2NPTB 4HROA 3I5JC 3MJWA 5HHDG 1WXVA 3TJPA 3ENEA 4RF0A 1KFYB 4CYEA 2J4XA 3V05A 1WZ0A 4A20A 4S0RA 2LGXA 3DBHI 3P1MA 2G45B 5FKAC 1K53A 1UF0A 2W3RA 2V3NA 3BINA 4KGTA 2YLMA 1BT0A 2CHXA 2OJWA 1J19A 4NAWA 4OVUA 3AEAB 4CQNA 1L2NA 3R2IA 1GNUA 3HM6X 2IYDB 4K7UA 3NJTA 1WJUA 2ICIA 1WRIA 5BMIA 2D10A 5KHQA 4Q2JA 4L23A 2HTME 4HPMB 1MHXA 2KKCA 4YTNB 1CZPA 5EE9A 2KDBA 5LLIA 3ZRCA 3H6NA 1ZP0B 3WAOA 3JW0X 1VD2A 3OLMD 2ZCBA 3VVWB 2MCNB 2KN4A 1E90A 1H8CA 2DYOA 3W5UB 3MTNB 3AE9B 4C4VB 1NEKB 2JZZA 3PTFC 3C19A 4US8A 3B0AA 3O13A 2KZRA 4E3CA 1C78A 2GRIA 2AL3A 2Z59B 3AH7A 2FCMA 1KOTA 2ZJDA 1N6ZA 4PYUA 4PS3A 4JL9A 2XK5A 3KYCD 1FCCC 2KMMA 2LZ6A 3UGBB 2H88B 4M8MA 3ZNZB 4BFRA 3ZNHB 1EF1A 1VLBA 4NJ7A 3ONSA 3TL5A 1C76A 3ZRFA 3TEWA 1FFUA 2K8BA 3AE7B 1QOGA 2L05A 2JWUA 4N6EB 1PFDA 1LFDA 2LGIA 2GOWA 1KJTA 3VUYA 1SF0A 3QJZA 5TR5A 1VZ7A 2D3AA 2GBKA 1E8YA 4MGIE 2GBJA 3U7DA 4MH0E 1KRHA 3HVDA 2K8HA 2KK8A 4GXBA 1TKYA 3IT4B 3LDZE 4WAAA 3L4PA 1JMLA 1Q10A 1YIWA 3DBLB 3TEZA 3EFCA 1C4AA 3BWUD 3A1QB 1FXTB 3KUZA 2KJ6A 1NDDA 3RNGC 1QOBA 1T0RC 3AE2B 3NUHB 5IP4D 3H7PB 3U8ZA 3H8HA 3IHPC 2ZPNA 1P7EA 4XDCA 2J42A 4JPSA 2DZKA 1E8ZA 4P7IA 1XCTL 2JRIB 1WZ3A 2AYOB 5EE0A 3P4SB 3TEXA 4GGQA 3DBLI 2M0AA 2ZVOA 2KFJA 4C80A 1YD8U 2DLBA 1WGHA 4BZAA 4C00A 1HA5A 4ZRPA 4YWGG 2DNFA 4MDKE 2L32A 4WJNA 5HFYA 2C60A 3N9YC 3AE6B 4PS8A 3ZNGC 2QEJC 3MC0B 2WXPA 3ZQ4A 1L6VA 4JLCA 1WJ4A 2MX2A 1SSNA 3Q3FA 1WXQA 2MJEA 3H9DA 3SDLC 2KAJA 5D3DA 3VTVA 1J7AA 2MQJA 1PGAA 4KSKC 3CWIA 5BYQA 4BKSA 3HIZA 1UH6A 1QF6A 1SJHD 3UI3A 1TS3A 3PV1A 4LNKA 2V4LA 3ALBA 2WXMA 1HTQA 3BVZA 3ZLZA 4UDUC 2MA9B 2AL6A 3QARA 4ZYSA 1D5ZC 2BB6A 4GB9A 3PVLA 1HZ5A 4ANXA 2BW2A 2DYBA 2DAFA 2EMSA 3E56A 1WMHB 2JVCA 1EUVB 3QC8B 3CF6E 3PRZA 4GOCA 1Q1OA 2HJ8A 3AE1B 2DX5B 2L0TA 5G55A 2K3UA 3FKYA 3ZJUA 2O2VB 1XLPA 2JF5A 3RULA 4A90A 1T0QC 1ZKHA 4DXGA 5HKHA 2MEKA 1P3QU 3VUXA 4TV3A 3TUOA 1FRDA 2PEAA 1RAXA 2B3AA 3ZDMC 2M17A 1F9JA 2QMTA 1XT9B 1TJEA 3NOBA 1V1OA 4JWUC 4DBGA 2RDGA 4G50A 2V0GA 4FULA 2DAJA 1NBFC 1XF5L 3CSTA 3AB5A 4HRSA 5CX3A 1WX8A 2BTEA 1DOIA 2LGSA 5FK9C 2MH7A 2AQ2B 2FCNA 3RYTA 3KUCB 3RNAC 1GC6A 2XN9C 1TZOA 5AUKA 4NJ6A 4WJQA 2DZMA 2KDFB 2WHIA 4A3OA 4NAWB 2KXJA 3N30A 1H4RA 1NI3A 4LJPB 5GXGB 4IG7B 3ZO5B 2PMVA 1QKZA 2BKRB 4LK0M 3A4SC 2WXQA 1FXAA 2JUOA 5AUIA 4MT5A 4K3BA 4HPPA 4OVZA 3EGRA 2RSUA 3AE3B 1VZ6A 3RNBC 3BZDB 4W9JA 1L0XB 1VR9A 2MLBA 3ZYYX 2CU1A 1C4CA 2DENB 2VRRB 4K7WA 2WLBA 3J9CA 1NENB 1GPXA 1FIQA 1FO4A 2BYVE 3I63C 2QIEB 3C0RB 2KC2A 1TS5A 1V97A 1WJ6A 2ZW1A 3WAPA 3RZFA 1I4QA 2D5GA 2KNBA 2IY1B 1I4RA 1FRRA 2WXLA 1SIJA 4RGNA 4D2KA 1VJKA 1YX6B 3PPAA 2KT7A 2XK5B 4LNOA 4GDKB 2KVZA 2O6VA 1GUAB 3AI5A 1ET6A 5H8YE 2GLSA 2JSVX 3MC8A 3EUB2 3V6CB 2KJHB 1GB1A 4NAMA 1YJIA 1YJ1A 3IG3A 1MFWA 1LO5D 1V86A 1XXGA 2PW9A 1V1PB 2KWCA 3H1UA 2JYTA 3CIRB 1EU3A 2NTSA 1T5XD 5MPOA 1TTNA 2SAKA 3DOWA 4KSLC 3MC9A 1E9MA 2AWTA 2AEHA 1EWYC 2WX0A 4MEMA 2FAZA 3KLSX 4NQKE 4ZHPA 1WXSA 2GMIC 3NZSA 4GMVA 1C3TA 1SB3C 2D2QA 3R7QA 4PK1A 5JZEB 2WXJA 3VAWA 1F77A 1OQRA 1VDVA 3EHVA 3HRDD 5G2NA 4RCOA 1ZXIA 1NVID 3UIOB 2BBCA 3ZXVA 1WR1A 2KLGA 4ANWA 4K1RB 2QCZA 2M1MA 1C79A 4IM2A 1A70A 2G4SA 3ML8A 1RLFA 2MW5A 2K0PA 1I7HA 4EZKA 4HPLB 2L0FA 4ZYNA 2PJHA 4AOFA 3OWEB 3IVFA 2EELA 2K1FA 4YSYB 2I1JA 3DHIC 4ZRKA 3RUIB 5LNK1 1C4PA 1J7BA 2FIDA 4IC7B 5CTRC 3Q2AC 4BOSC 5D94A 4MGYE 2PKOA 3RNFC 5D2MB 3W5VB 1RRBA 2LWPA 2N0SB 5EDSA 2INNE 3VQIA 1IBXA 2IBIB 3A9KA 1NYRA 4LDTB 2DBYA 3KYDD 2G3QB 1YJJA 1AWDA 3AEDB 3M62B 4MGZE 5DPWA 2BB5A 1WI0A 3RFZB 1WRDB 1QILA 3VDZA 2LHDA 5CHFA 2BYEA 3RMKC 1TGZB 2PE9A 2CJOA 4MJSA 3ZJTA 4ITKA 4P1BC 2WGSA 1XEEA 4B95A 3AEFB 1WXAA 3BIID 4IWQA 2K6DB 2JXXA 2NBUA 2G9HD 3W9CB 3AECB 4XGAB 1Q0WB 3HHMA 2YEPF 4ICUA 4II2B 2MP2B 1JQ4A 1MHHE 3NZ3A 2KMAA 4BKTA 2MBEA 3N20C 4ANUA 1CMXB 3B9JA 1F0ZA 1I4PA 2ZNVC 3AULA 2DWQA 2TSSA 1KM7A 4J6IA 2C7HA 3FILA 5E6NA 3HUIA 5JH5C 2KFKA 4XDDA 4HWIB 4MH8A 2J0KA 4FADA 4AJYB 2GI9A 1I4HA 3VR8B 1NYQA 2KQ7A 5C3JB 2IDYA 3KUDB 2JXTA 1TZ1A 2HD5B 2HDEA 3P63A 5IA7A 3PO0A 1L5PA 4TMAB 1SE3A 5G5HA 3U52E 3Q14C 4KV2A 3L08A 4FHKA 3L0WB 2ON8A 2KLCA 4RFBA 2MHJA 4DDGD 4L1BA 5E6PA 1D5MC 4LLGM 3U30A 4C7ZA 3M3JA 4DHZB 4WWNA 3OJ4B 2MBBB 5C2TB 1G6JA 1HE8A 1M4VA 3QK0A 1J0GA 2IO3B 1OQYA 2FUG1 3ZJVA 3PZ7A 2BVCA 4YSXB 4O1NA 4B0MA 1R4MB 2ASQA 1WGYA 1ISNA 2JRHA 3M63B 4KVGB 2Y5CA 1WX9A 3N1YC 4OW0A 1BXTA 1MG4A 1WM3A 5CHVC 2KANA 4WH4A 1EM7A 1E8WA 2RPQA 3TBLD 2IO0B 5AZFA 1S1QB 1UGJA 1STEA 2OHFA 2QC8A 4RMAA 2KWUB 2X38A 1OFFA 3VUWA 2WYQA 1R4MI 2LMCA 3PRMB 4KKJA 4NJCA 4WQMA 5IAAC 5DPRA 2N9EB 3FAHA 2ZVNA 1WR6E 4AJWA 2O6VB 1V5OA 3JSVA 1I35A 1IUEA 4HVBA 2GBRA 2KD0A 3NVYA 3N1ZC 3VXWA 3R7RA 1IPGA 1GG3A 1ZOYB 4LDTD 3Q8BA 1EU4A 2GBNA 3MHSD 3NY5A 4OVVA 1DYQA 5BMGA 3ZNID 3N32A 4EZLA 3Q8AA 2WDRB 3GP7A 3P42A 3I57A 2KTRA 3AMZA 5DPTA 4WIPA 4EE2A 1I42A 4G0NB 1TY2A 2NCNA 4HDQA 2IY0B 3DVGY 4H2AA 2VZKB 3AV8A 5BYRA 1XLNA 2LHEA 2EKIA 3Q3MC 4DHZE 1C9FA 2D07B 3SFEB 1ZUD2 1UUPA 1KF6B 2WXOA 4URKA 4YTMB 1K8RB 3ZIMA 2REXA 2V4IB 1FMAD 4JE3B 1XLOA 3OG5A 1YN5A 3SHQA 3ETRA 2IO1B 1OEYA 1FM0D 1QLBB 2IGHA 2W54A 1E5WA 2JQRB 2WXRA 1JROA 1LGRA 2UU7A 3V60A 3UF8A 2L83A 4JX1C 2KVRA 1B1ZA 1WGKA 4EUTA 4IWPA 3BYTB 1HTOA 3JVZX 4RNAA 1WGRA 3Q3JA 4ZDVA 4GIVA 3NZUA 3APFA 1JW9D 1K52A 1GB4A 1E7VA 2BS3B 1L6UA 1IBXB 3NS1A 3L17A 2J53A 1AW7A 2WDTB 2BYTA 3KVFB 1PGXA 2QDFA 3ZXRA 1WIAA 3T3NA 2YEPB 4NNJB 2QSDA 2L00B 1AN8A 2N7DA 3Q6BA 2I38A 3IXSA 4I6PA 1D6EC 3RD2A 1WGDA 2NS5A 3AM9A 5T8IA 1P9DU 4F1SA 4GLSC 4MJSB 2R2OA 5IKCM 5DCNA 2E3TA 3Q8CA 1XD3B 2N9XA 4ZRIA 2PLPA 2FCQA 5JXVA 4WJPA 5J18A 2GB1A 4QAYA 1ACCA 1K51A 3PT2B 2ZZPB 3QHTA 2XNAC 4ASWC 1PYWD 1OQQA 2IZVB 1OEYJ 2KDIA 2QHOA 4ARIA 1V5TA 1YN3A 1VRAB 3VHTC 4DDID 5IN7A 5DPSA 2W82A 4HDOA 5C23A 5JHAA 4A9AA 3V62A 1FEHA 5IOIA 1YQ3B 1UNSA 1TBEA 4CHKA 3AE8B 4HKQA 3EA6A 5E6JA 1N61A 4ICVA 2N9KA 1ZPSA 3DDCB 1F52A 3FILB 2MBHA 3UQBA 3GOEA 1RM6C 1GJZA 4NQLB 2KFKB 2BWFA 2C7MB 4TUUA 3PZDA 4K7SA 4OZAA 5JHBA 2BPSA 1XCQL 2OJRA 1OTRB 2BF8B 4XZ4A 2XBBC 2MBOA 1DOYA 1Y8RC 2R61A 2PVOD 3A9JA 2INCC 4DHJB 1N5XA 4WJOA 3AU5A 2Q5WD 1SXTA 4XWTA 3GZNI 4IUMB 2IPKD 1C77A 2IO2B 3I3TB 1YN4A 2G1EA 4NY0A 4HLEA 3UINB 3VH3B 1UELA 2X8XX 2VZKD 2RD0A 4WQOB 2K6QA 2JU6X 3N1XC 2CR5A 5E6OA 1FNWA 3AEBB 3L10B 2NMQA 5D3IB 3APDA 2A4ZA 4K3CA 4XYCA 2K9XA 4EKUA 2L76A 4PYZA 3L16A 5L95C 4KIKA 2M19A 1SJED 2RMMA 1YOVB 3GE3C 3PLUA 2NBVB 3QWZB 2ZNVB 2CU3A 1E8XA 2D3BA 3PREA 4RM9A 4DXAB 2KWDA 4L2YA 3PSEB 2N1WA 2KDEB 1EWCA 2K8CA 2PTLA 2DYMA 4BKGA 4DXFA 1JCKB 1HEZE 4MACA 4WWPA 1UBQA 2UWQA 3I9V1 3BVMA 3R3MA 1E7UA 2WX1A 4M0WA 2Z8LA 3JSVB 2YVCA 2CS4A 1L0YB 1J8CA 4W9IA 2UYZB 3DHHC 4F7ZA 1KLGD 3W2DA 3S2AA 5CHWA 2LUEA 4ARCA 2V1YA 3IAM1 1UWMA 2BQQA 2N9PC 3WANA 2QJLA 5C1ZA 2L1AA 2MBQA 3OJ3A 3ML9A 3IFWB 3ZUNA 1V9JA 4TSSA 2WXKA 3B2FA 2RDBC 4XX5A 1WWTA 3VR9B 2KTRB 2L8JA 5AZHA 2KACA 2DHZA 2VH1A 3ABVB 4BVUC 2PVGC 4YT0B 3VTWA 4ANVA 3R66C 2KOXA 4KGSA 3NG0A 2Z0EB 3Q8FA 2J0MA 2PE6B 2KMCA 2LFIA 3TCAA 4PT5A 4W9HA 4NPNA 3P4RB 4TKNA 4PS7A 4EFOA 4RM8A 2N7JA 4N9F4 4KDLB 1MVKA 1XQQA 2KQSA 2PPHA 4K81A 1JWAD 4B0EA 2LRWA 2Y3AA 1WY8A 4MSMB 2M56B
chains in the Genus database with same CATH topology
1PGBA 1PGAA 3AE4B 1E7PB 3PZ7A 3CWIA 5BYQA 4YSXB 4O1NA 4B0MA 1FCLA 4KGRA 5EE1A 2INPE 1HXYD 2LEKA 2J52A 2WDQB 3U2SC 1QF6A 1SJHD 3AEEB 1TS3A 3UI3A 1JWBD 4YXDB 2Y5CA 2WXMA 2FE8A 3BVZA 4UDUC 3VRBB 2WU2B 4ZYSA 4OW0A 4RF1A 1BXTA 3U4EG 1D5ZC 4C56C 1BUIC 2BB6A 1DGJA 4WH4A 1EM7A 1K50A 1HZ5A 1VZ8A 2WDVB 2BW2A 1I4GA 3E56A 3VRAB 4KX6B 1UGJA 1STEA 2OHFA 1D5XC 2X38A 1OFFA 4RH6A 1GAQB 1XLQA 2LMCA 3DWGC 4YSZB 3P4PB 4KKJA 4NJCA 2KQ4X 4WQMA 1TYGB 3AE1B 1CK1A 3FAHA 3HVZA 1FNUA 1T6BX 3SR6A 3V3XA 2K3UA 3GS2A 3ZJUA 2N9LA 1XLPA 4A90A 4DXGA 5BMHA 3T3OA 1IUEA 2JX5A 2MEKA 1YQ4B 4ZHOA 3TUOA 1FRDA 5BYSA 2ONQA 1FNVA 3ZGZA 3NVYA 5EE3A 4NZLB 2NTTA 1IGDA 1ZOYB 2QMTA 1JALA 1TJEA 3Q8BA 1V1OA 3KWVA 5HI1A 4JWUC 1EU4A 2RDGA 2V0GA 1YMHE 4JWSC 1DYQA 5BMGA 2K22A 2LUMA 1XF5L 2IGDA 2BS4B 2WS3B 3RPFC 4XE0A 3AB5A 5H92C 4HRSA 2BTEA 1DOIA 3Q8AA 4HJGE 3C8YA 2WDRB 3GP7A 3P42A 5FK9C 2KDMA 3MJ5A 3I57A 5HG2A 1L4DB 1L0VB 2MH7A 2AQ2B 3AMZA 2H89B 4WIPA 4A6QA 4EE2A 1KLUD 1TY2A 3U7ZA 2WQYB 1HZ6A 2XN9C 2VZKB 1TZOA 3AV8A 4H2AA 4KKIA 5AUKA 5BYRA 1XLNA 2LHEA 4GDLB 3LXFA 2EKIA 2K5PA 4P16A 4USAA 1C9FA 3BVGA 3SFEB 3TEYA 1ZUD2 1N60A 4NAWB 1UUPA 1KF6B 1SEBD 1WYGA 2WXOA 3WCQA 1NI3A 1FXIA 1RFKA 4YTMB 1N62A 1FFVA 5GXGB 2PMVA 1QKZA 1FMAD 2V4IB 2E6XA 4JE3B 4LK0M 4J3OD 1XLOA 1BMLC 3SEBA 1YN5A 1E6EB 1FXAA 1N5WA 1PDXA 2WXQA 3ETRA 1FM0D 1QLBB 2IGHA 5AUIA 4MT5A 4OVZA 2W54A 1ZE3D 3EGRA 1Y56A 2JQRB 3AE3B 2WXIA 1VZ6A 2WXRA 3GB1A 2WXNA 3BZDB 1P7FA 1L0XB 1VR9A 1JROA 4XWWA 1HQRD 2L83A 4JX1C 3ZYYX 1B1ZA 1WGKA 1C4CA 4R3DA 4LTUA 2JYEA 2JZPA 2I2YA 2WLBA 3J9CA 1E0ZA 1NENB 1GPXA 1RYJA 3BYTB 2ZW0A 4N59A 1I4XA 1FIQA 4RNAA 1FO4A 2BS2B 4IDIA 1J7CA 2QIEB 2OEDA 1T3QA 1TS5A 1V97A 1JWUD 1JW9D 1F2RI 5FR3A 1K52A 4OZBA 1GB4A 2ZW1A 5D7GA 1ET9A 2BS3B 1I4QA 2WXFA 1R7SA 1L6UA 2D5GA 1F2RC 1IBXB 3NS1A 5I4DA 2J53A 1I4RA 1FRRA 2V3PA 1AW7A 4TQ1A 2BYTA 2WXLA 1SIJA 1PGXA 4RGNA 4D2KA 2WXGA 1TS2A 1VJKA 1ZDVA 3BK1A 3T3NA 2YEPB 4RGMA 2QSDA 4OZCA 1AN8A 3TSSA 4IKGA 3E9SA 2I38A 3IXSA 4GDKB 4ZOHC 4YTPB 1SE2A 1D6EC 1ET6A 4WURA 1D4BA 5H8YE 1ENFA 1UWXA 3AM9A 5T8IA 2JSVX 2AX5A 3EUB2 1WSPA 3LYYA 4GLSC 1CQVA 4RGOS 1KTKA 1GB1A 4NAMA 1YJIA 1SE4A 1SBBB 2E3TA 3Q8CA 2PLPA 1V1PA 5JXVA 1LO5D 3MHZA 2GB1A 1XXGA 2PW9A 1V1PB 2WNMA 1ACCA 1K51A 2JYTA 4HEA1 3CIRB 3Q8EA 1EU3A 2NTSA 1T5XD 5MPOA 4HROA 2XNAC 3LB8C 1PYWD 1OQQA 2SAKA 5HHDG 4ARIA 1E9MA 1YN3A 1VRAB 2QILA 4DQOC 2MJDA 4RF0A 1EWYC 1KFYB 1N63A 2W82A 1QOAA 2J4XA 3KLSX 3V05A 4A9AA 2PIAA 1KH0A 3P1MA 4ZHPA 3FC4A 1FEHA 5FKAC 2W3SA 1YQ3B 1K53A 3NVZA 4C7YA 1UNSA 2W3RA 3AE8B 4HKQA 1SB3C 2V3NA 3EA6A 5E6JA 1N61A 2N9KA 1ZPSA 2WXJA 3FILB 4KGTA 1F77A 5G5GA 1GOZA 1VDVA 1OQRA 1RM6C 3AEAB 3HRDD 4RCOA 4CQNA 3R2IA 2BT6A 1ZXIA 2SEBD 1NVID 1PUTA 2LJIA 3ZJVA 2BBCA 1XO3A 1MI0A 2B76B 4TQ0A 2ICIA 4OZAA 1WRIA 5BMIA 3IAS1 1C79A 4REZA 4P6VF 1A70A 1XCQL 4Q2JA 4L23A 2HTME 1MHXA 2IGGA 1DOYA 2K0PA 1I7HA 4YTNB 2R61A 1MPEA 1CZPA 2PVOD 2ACZB 3OWEB 5EE9A 2AQ1B 2EELA 2WXHA 1YNTE 1N5XA 4YSYB 1ZP0B 2Q5WD 1SXTA 5LNK1 1C4PA 3NVWA 4XWTA 1J7BA 2IPKD 1C77A 2L52A 2WU5B 1YN4A 2G1EA 2KN4A 1ROEA 2DYOA 2PKOA 3W5UB 3AE9B 2VZKD 1ZXHA 1NEKB 3B2GA 3W5VB 3AN1A 1B9RA 2JU6X 2N0SB 1QT9A 4US8A 1QQRA 3O13A 2INNE 3VQIA 1FNWA 1IBXA 1C78A 2GRIA 3KQ4A 1NYRA 3AH7A 1ZDXA 4RGTA 2DBYA 3PZ8A 3AEBB 3MP9A 2NMQA 5D3IB 3R8BA 4AQ7A 1YJJA 1AWDA 3AEDB 2K9XA 1TKEA 1FCCC 2KMMA 4WAFA 2H88B 1CJEA 2WP9B 1VLBA 2BB5A 3BK2A 1C76A 3MFGA 3TEWA 2M19A 1FFUA 2MJ3A 3AE7B 1QOGA 1L4ZB 1SJED 3RFZB 2FBWB 1QILA 2RMMA 4N58A 2JWUA 2LHDA 4N6EB 1JRPA 1JWSD 2CJOA 1QOFA 2CU3A 1PFDA 2IJ0A 3KWLA 3ZJTA 2LGIA 2KWDA 4ITKA 4L2YA 1SF0A 1EWCA 1XEEA 3R2TA 3AEFB 1JWMD 3BIID 2PTLA 2DYMA 4DXFA 1JCKB 1VZ7A 1HEZE 4MACA 3SFDB 2G9HD 3W1SA 3W9CB 1V8CA 3I9V1 3AECB 4AS1A 3BVMA 1KRHA 3HVDA 3IT6B 4M0WA 2Z8LA 1TKYA 3AEGB 3IT4B 3P4QB 2YEPF 4IOIE 3L4PA 1L0YB 1JQ4A 1JMLA 1AYFA 1Q10A 4OHJA 1MHHE 3TEZA 3NZ3A 2CJNA 3NRZA 1KLGD 1C4AA 3BWUD 3W2DA 4ARCA 3B9JA 1F0ZA 3DWMA 1I4PA 2DWQA 2TSSA 1QOBA 4US9A 3URYA 3AE2B 3FILA 3IAM1 3NUHB 1UWMA 4A55A 3HUIA 2QJLA 2L1AA 4XDDA 3AE5B 3H8HA 1P7EA 4MH8A 4XDCA 2J42A 4JPSA 4TSSA 2RDHA 2WXKA 3B2FA 1DOXA 1WWTA 3VR9B 1TS4A 2GI9A 1I4HA 3VR8B 4A8XC 1NYQA 1XCTL 5C3JB 2IDYA 2KACA 3TEXA 5EE0A 3P4SB 1RWSA 2JXTA 2M0AA 1ESFA 2HDEA 3ABVB 2PVGC 4YT0B 4C80A 3P63A 2DLBA 4MM3B 2AQ3B 3PO0A 4KGSA 1L5PA 4TMAB 5TSSA 1HA5A 1FD6A 1SE3A 3NVVA 3Q8FA 4ZRPA 4YWGG 5G5HA 1TY0A 3U52E 2LFIA 2L32A 4HKZE 2Y5PA 4RFBA 2ON8A 4PT5A 5HFYA 3N9YC 3AE6B 3P4RB 3BYYB 4L1BA 1IGCA 2QEJC 3MC0B 2WXPA 4WWMA 2N7JA 2RPVA 1D5MC 3ZQ4A 4LLGM 4ZRQA 4FXCA 1L6VA 1MVKA 4C7ZA 1JWAD 4B0EA 1TKGA 2Y3AA 1SSNA 2M56B 5C2TB 1E10A 2W55A 1M4VA 1WXQA 2MJEA 3Q69A 2FUG1 2KAJA 5D3DA 1J7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZDX A;  1ZE3 D;  4B0M A;  3BWU D;  3RFZ B;  4B0E A;  1ZDV A;  4J3O D; 
#chains in the Genus database with same CATH topology
 3AE4 B;  1LQB A;  1FCL A;  1IP9 A;  4KGR A;  5EE1 A;  3K9O B;  2INP E;  2WDQ B;  2Y5B B;  4G3X B;  1JWB D;  2KJR A;  4W9D A;  4YXD B;  3PHX B;  4M00 A;  2WU2 B;  4E74 A;  4RF1 A;  1V80 A;  1K50 A;  4X57 B;  4AUQ C;  4FA6 A;  3VRA B;  4KX6 B;  4DHJ D;  2R2Q A;  1SE9 A;  1GAQ B;  1XLQ A;  5KHO A;  4YSZ B;  2N4F A;  2KQ4 X;  1CK1 A;  1FNU A;  3V3X A;  3CMM B;  3SR6 A;  5J2R A;  3GS2 A;  5LXH A;  2IND C;  2LGY A;  1A5R A;  3SU8 X;  4LNN A;  2WWZ A;  3T3O A;  2ZCC A;  2JX5 A;  1Z5S B;  1ZW7 A;  1JRU A;  4GU2 A;  2A5U A;  4I6L B;  5EE3 A;  4NZL B;  2L7R A;  1IGD A;  3V61 A;  4MGK E;  5HI1 A;  4I6N B;  3GE8 C;  2D3G A;  4JWS C;  3WAM A;  1V81 A;  2IGD A;  3RPF C;  4XE0 A;  5H92 C;  1P98 A;  2G4D B;  4HJG E;  3C8Y A;  1UBI A;  5J17 A;  2FNJ B;  2KDM A;  3MJ5 A;  2N7E A;  2FUH B;  1L4D B;  1UZX B;  2H89 B;  3PHW B;  4FLH A;  4W9C A;  4A6Q A;  4JQW C;  2LXC A;  1LXD A;  3B1L X;  3QX1 A;  3U7Z A;  1HZ6 A;  4KZ0 A;  4MM3 A;  2KC1 A;  3RZW C;  3VFK A;  4USA A;  3KH0 A;  3BVG A;  3VH4 B;  2LI5 A;  3UIP B;  4BBN C;  3WCQ A;  2I1K A;  4FN2 A;  1N62 A;  1FFV A;  4J3O D;  1E6E B;  1N5W A;  2LD9 A;  4KZC A;  1ZE3 D;  2J0J A;  2WXI A;  3GB1 A;  2WXN A;  3QCA A;  1HQR D;  3A9J B;  2M8S A;  4R3D A;  4LTU A;  2JYE A;  3DVG X;  1U4A A;  2C7N B;  3DHG C;  2I2Y A;  4N59 A;  1I4X A;  4AWJ A;  1ZGU B;  1T3Q A;  4W9E A;  5FR3 A;  4OZB A;  3ZKJ C;  2EKE C;  4WWO A;  1F2R C;  1X1M A;  5I4D A;  2LVQ A;  2NBW B;  2V3P A;  4TQ1 A;  1WXM A;  3Q3N C;  3H7S A;  3BK1 A;  4JIO U;  2DZJ A;  4JGH B;  4OZC A;  3HK0 A;  4IW0 A;  3TSS A;  1TIF A;  3OAW A;  4GDK A;  4IKG A;  1WM2 A;  3E9S A;  4KIK B;  4ZOH C;  4FJV B;  3TIX A;  1D4B A;  3P2B A;  2DZI A;  1WSP A;  3RN9 C;  4GN1 A;  4IM3 A;  3DVN U;  3A33 B;  4BKS D;  5L83 A;  3T9L A;  1SBB B;  2KO3 A;  3AXC A;  1V1P A;  2WNM A;  1FPY A;  4HCN B;  3B08 A;  4HEA 1;  2C5L C;  3LB8 C;  4M0W B;  2QIL A;  4DQO C;  2MJD A;  1N63 A;  1QOA A;  2W9N A;  3EFU A;  2PIA A;  1KH0 A;  4W9G A;  3FC4 A;  2LAS A;  2W3S A;  3NVZ A;  4C7Y A;  5AEK B;  3EC8 A;  2HE7 A;  4S17 A;  2MWS B;  4GDL A;  2M0X A;  1TT5 B;  5G5G A;  1GOZ A;  4BBN F;  2BT6 A;  2SEB D;  1PUT A;  2LJI A;  2M4N A;  1XO3 A;  1EO6 A;  2V9H A;  2NR2 A;  1MI0 A;  3W1S C;  2B76 B;  2C9W B;  4DK5 A;  4TQ0 A;  3D32 A;  3IAS 1;  4REZ A;  4P6V F;  3X0W A;  1V2Y A;  2RGF A;  4HXD A;  1WJN A;  2D3C A;  2OOB B;  3PLV A;  3RNC C;  3SD5 A;  2IGG A;  3Q3O C;  3CSF A;  1MPE A;  2ACZ B;  2AQ1 B;  2WXH A;  1YNT E;  3WA0 A;  4FJY A;  4B6W A;  2HJ1 A;  3NVW A;  1Z2M A;  2L52 A;  3WAL A;  2WU5 B;  4G11 A;  1Q5W B;  2N1V A;  1ROE A;  4FJZ A;  1ZXH A;  2K39 A;  3B2G A;  1WGG A;  1WH3 A;  3AN1 A;  2JWZ A;  1B9R A;  1MJD A;  1QT9 A;  1QQR A;  1LM8 B;  3QIJ A;  3KQ4 A;  2KX3 A;  1ZDX A;  4RGT A;  3HM3 A;  3PZ8 A;  2XEW A;  3A9K B;  3MP9 A;  3R8B A;  4AQ7 A;  4ZRJ A;  1M94 A;  3DPD A;  4CO7 A;  2ZEQ A;  2KTF A;  1TKE A;  4WAF A;  2ZPY A;  3ZTC A;  1CJE A;  2WP9 B;  3BK2 A;  3MFG A;  2MJ3 A;  3RI7 C;  1L4Z B;  3NHE B;  2FBW B;  5LXI B;  4N58 A;  2LRU A;  1JRP A;  1JWS D;  1QOF A;  2GBM A;  2IJ0 A;  1WX7 A;  3KWL A;  3ZTD A;  3R2T A;  4HCP B;  3ZW3 A;  1JWM D;  1V49 A;  4BOZ B;  4W9K A;  3PGE A;  3SFD B;  3W1S A;  4MSQ B;  1V8C A;  2NPT A;  4EZJ A;  1YX5 B;  4AS1 A;  3IT6 B;  3AEG B;  2JZ3 B;  2MP2 A;  2BWE S;  3P4Q B;  4IOI E;  4FHJ A;  1AYF A;  1WFY A;  4OHJ A;  2VH2 A;  5D6J B;  2CJN A;  4P1C C;  3IBE A;  3NRZ A;  1VCB A;  4GSW A;  3DWM A;  2KWV B;  1SIF A;  2Z0D B;  2BGF A;  4US9 A;  2FCS A;  4LNF A;  3URY A;  2L3Z A;  4A55 A;  1WE7 A;  3APC A;  4LJO B;  1MG8 A;  3AE5 B;  3T8M A;  3DBR B;  2O6V D;  3GZN B;  3QQ8 B;  2RDH A;  1DOX A;  1TS4 A;  5AZG A;  4A8X C;  1RWS A;  1ESF A;  3M95 A;  4MM3 B;  2AQ3 B;  2LGD A;  5TSS A;  1FD6 A;  3NVV A;  1TY0 A;  3TMP B;  4II3 B;  3UQA A;  4HKZ E;  2Y5P A;  4LNI A;  4M01 A;  3JYU A;  3BYY B;  1C1Y B;  1IGC A;  3L13 A;  3ZVV A;  3DBR I;  4WWM A;  2RPV A;  3PRP B;  2CHW A;  2LXA A;  1SGH A;  4ZRQ A;  4FXC A;  1TKG A;  4XC2 A;  1E10 A;  2NVU I;  2W55 A;  4BAX A;  4C4V A;  3Q69 A;  2KYW A;  2D11 A;  1PGB A;  1E7P B;  1UGM A;  4IM0 A;  4EEW A;  1HXY D;  2LEK A;  2EMT A;  2J52 A;  3U2S C;  3AEE B;  2JPH A;  3AU4 A;  1WE6 A;  2HTH A;  2FE8 A;  4HJK A;  3VRB B;  4ACF A;  5GMV A;  3U4E G;  4C56 C;  1BUI C;  1DGJ A;  1VZ8 A;  2WDV B;  1I4G A;  4A3P A;  1D5X C;  4RH6 A;  3DWG C;  3P4P B;  1T0Y A;  1TYG B;  3DCG A;  4B9K A;  4M8N A;  3HVZ A;  1T6B X;  4MEL A;  1IYF A;  2N9L A;  4IWO A;  4YL8 A;  5BMH A;  1YQ4 B;  4ZHO A;  5BYS A;  2ONQ A;  1D3Z A;  1FNV A;  3ZGZ A;  1EF5 A;  3A4R A;  3A1Q A;  2NTT A;  3DBS A;  3QA8 A;  1JAL A;  4M02 A;  3N3K B;  3KWV A;  3K9P B;  5FR6 A;  1YMH E;  4W9L A;  2K22 A;  2LUM A;  3O65 B;  3H7P A;  2BS4 B;  2WS3 B;  2LVO A;  1WF9 A;  2LVP A;  3LJ3 A;  1QZE A;  2KN5 A;  3VTU A;  5HG2 A;  1PQS A;  1L0V B;  1RFA A;  1OGW A;  1T0S C;  2CHZ A;  3NS8 A;  1S3S G;  1KLU D;  3EEC A;  2WQY B;  2KHW B;  4KKI A;  4GDL B;  3LXF A;  3L54 A;  2K5P A;  4P16 A;  3TEY A;  1R4N B;  3X23 A;  1N60 A;  3DVN V;  1GC7 A;  1WYG A;  1SEB D;  3RT3 B;  2K25 A;  3ZDT A;  1WYW B;  1FXI A;  1RFK A;  2MRP A;  4FBJ B;  4AP4 C;  2E6X A;  1P1A A;  1BML C;  3SEB A;  1PDX A;  1NI2 A;  2JT4 B;  1YQB A;  3WIM A;  1V6E A;  1Y56 A;  1P7F A;  1KLV A;  4XWW A;  4LCD E;  3V6E B;  5BO4 B;  1R4N I;  2FIF A;  2JZP A;  1E0Z A;  1RYJ A;  2ZW0 A;  1F1H A;  2BYF A;  2J7Q B;  2BS2 B;  4IDI A;  1J7C A;  2OED A;  4W9F A;  3W1Y A;  1JWU D;  3ECI A;  1F2R I;  4HK2 A;  5D7G A;  4E71 A;  1ET9 A;  2WXF A;  1R7S A;  2JY6 A;  3KW5 B;  1AAR A;  1WMH A;  3PS6 A;  4F8C B;  2WXG A;  1TS2 A;  1ZDV A;  4RGM A;  3QAQ A;  3RNE C;  3RCZ A;  2KX0 A;  4KDI C;  2V3S A;  2O2V A;  4YTP B;  1SE2 A;  4DWF A;  2CKH B;  2BKF A;  1UD7 A;  4WUR A;  1ENF A;  2MSE D;  1UWX A;  5IO9 A;  4EOY A;  2AX5 A;  3LYY A;  3DBH B;  1CQV A;  4RGO S;  1KTK A;  1SE4 A;  3MHZ A;  1L7Y A;  3BY4 B;  1P0R A;  2LJ5 A;  3Q8E A;  2RR9 A;  3DQV A;  2NPT B;  4HRO A;  3I5J C;  3MJW A;  5HHD G;  1WXV A;  3TJP A;  3ENE A;  4RF0 A;  1KFY B;  4CYE A;  2J4X A;  3V05 A;  1WZ0 A;  4A20 A;  4S0R A;  2LGX A;  3DBH I;  3P1M A;  2G45 B;  5FKA C;  1K53 A;  1UF0 A;  2W3R A;  2V3N A;  3BIN A;  4KGT A;  2YLM A;  1BT0 A;  2CHX A;  2OJW A;  1J19 A;  4NAW A;  4OVU A;  3AEA B;  4CQN A;  1L2N A;  3R2I A;  1GNU A;  3HM6 X;  2IYD B;  4K7U A;  3NJT A;  1WJU A;  2ICI A;  1WRI A;  5BMI A;  2D10 A;  5KHQ A;  4Q2J A;  4L23 A;  2HTM E;  4HPM B;  1MHX A;  2KKC A;  4YTN B;  1CZP A;  5EE9 A;  2KDB A;  5LLI A;  3ZRC A;  3H6N A;  1ZP0 B;  3WAO A;  3JW0 X;  1VD2 A;  3OLM D;  2ZCB A;  3VVW B;  2MCN B;  2KN4 A;  1E90 A;  1H8C A;  2DYO A;  3W5U B;  3MTN B;  3AE9 B;  4C4V B;  1NEK B;  2JZZ A;  3PTF C;  3C19 A;  4US8 A;  3B0A A;  3O13 A;  2KZR A;  4E3C A;  1C78 A;  2GRI A;  2AL3 A;  2Z59 B;  3AH7 A;  2FCM A;  1KOT A;  2ZJD A;  1N6Z A;  4PYU A;  4PS3 A;  4JL9 A;  2XK5 A;  3KYC D;  1FCC C;  2KMM A;  2LZ6 A;  3UGB B;  2H88 B;  4M8M A;  3ZNZ B;  4BFR A;  3ZNH B;  1EF1 A;  1VLB A;  4NJ7 A;  3ONS A;  3TL5 A;  1C76 A;  3ZRF A;  3TEW A;  1FFU A;  2K8B A;  3AE7 B;  1QOG A;  2L05 A;  2JWU A;  4N6E B;  1PFD A;  1LFD A;  2LGI A;  2GOW A;  1KJT A;  3VUY A;  1SF0 A;  3QJZ A;  5TR5 A;  1VZ7 A;  2D3A A;  2GBK A;  1E8Y A;  4MGI E;  2GBJ A;  3U7D A;  4MH0 E;  1KRH A;  3HVD A;  2K8H A;  2KK8 A;  4GXB A;  1TKY A;  3IT4 B;  3LDZ E;  4WAA A;  3L4P A;  1JML A;  1Q10 A;  1YIW A;  3DBL B;  3TEZ A;  3EFC A;  1C4A A;  3BWU D;  3A1Q B;  1FXT B;  3KUZ A;  2KJ6 A;  1NDD A;  3RNG C;  1QOB A;  1T0R C;  3AE2 B;  3NUH B;  5IP4 D;  3H7P B;  3U8Z A;  3H8H A;  3IHP C;  2ZPN A;  1P7E A;  4XDC A;  2J42 A;  4JPS A;  2DZK A;  1E8Z A;  4P7I A;  1XCT L;  2JRI B;  1WZ3 A;  2AYO B;  5EE0 A;  3P4S B;  3TEX A;  4GGQ A;  3DBL I;  2M0A A;  2ZVO A;  2KFJ A;  4C80 A;  1YD8 U;  2DLB A;  1WGH A;  4BZA A;  4C00 A;  1HA5 A;  4ZRP A;  4YWG G;  2DNF A;  4MDK E;  2L32 A;  4WJN A;  5HFY A;  2C60 A;  3N9Y C;  3AE6 B;  4PS8 A;  3ZNG C;  2QEJ C;  3MC0 B;  2WXP A;  3ZQ4 A;  1L6V A;  4JLC A;  1WJ4 A;  2MX2 A;  1SSN A;  3Q3F A;  1WXQ A;  2MJE A;  3H9D A;  3SDL C;  2KAJ A;  5D3D A;  3VTV A;  1J7A A;  2MQJ A;  1PGA A;  4KSK C;  3CWI A;  5BYQ A;  4BKS A;  3HIZ A;  1UH6 A;  1QF6 A;  1SJH D;  3UI3 A;  1TS3 A;  3PV1 A;  4LNK A;  2V4L A;  3ALB A;  2WXM A;  1HTQ A;  3BVZ A;  3ZLZ A;  4UDU C;  2MA9 B;  2AL6 A;  3QAR A;  4ZYS A;  1D5Z C;  2BB6 A;  4GB9 A;  3PVL A;  1HZ5 A;  4ANX A;  2BW2 A;  2DYB A;  2DAF A;  2EMS A;  3E56 A;  1WMH B;  2JVC A;  1EUV B;  3QC8 B;  3CF6 E;  3PRZ A;  4GOC A;  1Q1O A;  2HJ8 A;  3AE1 B;  2DX5 B;  2L0T A;  5G55 A;  2K3U A;  3FKY A;  3ZJU A;  2O2V B;  1XLP A;  2JF5 A;  3RUL A;  4A90 A;  1T0Q C;  1ZKH A;  4DXG A;  5HKH A;  2MEK A;  1P3Q U;  3VUX A;  4TV3 A;  3TUO A;  1FRD A;  2PEA A;  1RAX A;  2B3A A;  3ZDM C;  2M17 A;  1F9J A;  2QMT A;  1XT9 B;  1TJE A;  3NOB A;  1V1O A;  4JWU C;  4DBG A;  2RDG A;  4G50 A;  2V0G A;  4FUL A;  2DAJ A;  1NBF C;  1XF5 L;  3CST A;  3AB5 A;  4HRS A;  5CX3 A;  1WX8 A;  2BTE A;  1DOI A;  2LGS A;  5FK9 C;  2MH7 A;  2AQ2 B;  2FCN A;  3RYT A;  3KUC B;  3RNA C;  1GC6 A;  2XN9 C;  1TZO A;  5AUK A;  4NJ6 A;  4WJQ A;  2DZM A;  2KDF B;  2WHI A;  4A3O A;  4NAW B;  2KXJ A;  3N30 A;  1H4R A;  1NI3 A;  4LJP B;  5GXG B;  4IG7 B;  3ZO5 B;  2PMV A;  1QKZ A;  2BKR B;  4LK0 M;  3A4S C;  2WXQ A;  1FXA A;  2JUO A;  5AUI A;  4MT5 A;  4K3B A;  4HPP A;  4OVZ A;  3EGR A;  2RSU A;  3AE3 B;  1VZ6 A;  3RNB C;  3BZD B;  4W9J A;  1L0X B;  1VR9 A;  2MLB A;  3ZYY X;  2CU1 A;  1C4C A;  2DEN B;  2VRR B;  4K7W A;  2WLB A;  3J9C A;  1NEN B;  1GPX A;  1FIQ A;  1FO4 A;  2BYV E;  3I63 C;  2QIE B;  3C0R B;  2KC2 A;  1TS5 A;  1V97 A;  1WJ6 A;  2ZW1 A;  3WAP A;  3RZF A;  1I4Q A;  2D5G A;  2KNB A;  2IY1 B;  1I4R A;  1FRR A;  2WXL A;  1SIJ A;  4RGN A;  4D2K A;  1VJK A;  1YX6 B;  3PPA A;  2KT7 A;  2XK5 B;  4LNO A;  4GDK B;  2KVZ A;  2O6V A;  1GUA B;  3AI5 A;  1ET6 A;  5H8Y E;  2GLS A;  2JSV X;  3MC8 A;  3EUB 2;  3V6C B;  2KJH B;  1GB1 A;  4NAM A;  1YJI A;  1YJ1 A;  3IG3 A;  1MFW A;  1LO5 D;  1V86 A;  1XXG A;  2PW9 A;  1V1P B;  2KWC A;  3H1U A;  2JYT A;  3CIR B;  1EU3 A;  2NTS A;  1T5X D;  5MPO A;  1TTN A;  2SAK A;  3DOW A;  4KSL C;  3MC9 A;  1E9M A;  2AWT A;  2AEH A;  1EWY C;  2WX0 A;  4MEM A;  2FAZ A;  3KLS X;  4NQK E;  4ZHP A;  1WXS A;  2GMI C;  3NZS A;  4GMV A;  1C3T A;  1SB3 C;  2D2Q A;  3R7Q A;  4PK1 A;  5JZE B;  2WXJ A;  3VAW A;  1F77 A;  1OQR A;  1VDV A;  3EHV A;  3HRD D;  5G2N A;  4RCO A;  1ZXI A;  1NVI D;  3UIO B;  2BBC A;  3ZXV A;  1WR1 A;  2KLG A;  4ANW A;  4K1R B;  2QCZ A;  2M1M A;  1C79 A;  4IM2 A;  1A70 A;  2G4S A;  3ML8 A;  1RLF A;  2MW5 A;  2K0P A;  1I7H A;  4EZK A;  4HPL B;  2L0F A;  4ZYN A;  2PJH A;  4AOF A;  3OWE B;  3IVF A;  2EEL A;  2K1F A;  4YSY B;  2I1J A;  3DHI C;  4ZRK A;  3RUI B;  5LNK 1;  1C4P A;  1J7B A;  2FID A;  4IC7 B;  5CTR C;  3Q2A C;  4BOS C;  5D94 A;  4MGY E;  2PKO A;  3RNF C;  5D2M B;  3W5V B;  1RRB A;  2LWP A;  2N0S B;  5EDS A;  2INN E;  3VQI A;  1IBX A;  2IBI B;  3A9K A;  1NYR A;  4LDT B;  2DBY A;  3KYD D;  2G3Q B;  1YJJ A;  1AWD A;  3AED B;  3M62 B;  4MGZ E;  5DPW A;  2BB5 A;  1WI0 A;  3RFZ B;  1WRD B;  1QIL A;  3VDZ A;  2LHD A;  5CHF A;  2BYE A;  3RMK C;  1TGZ B;  2PE9 A;  2CJO A;  4MJS A;  3ZJT A;  4ITK A;  4P1B C;  2WGS A;  1XEE A;  4B95 A;  3AEF B;  1WXA A;  3BII D;  4IWQ A;  2K6D B;  2JXX A;  2NBU A;  2G9H D;  3W9C B;  3AEC B;  4XGA B;  1Q0W B;  3HHM A;  2YEP F;  4ICU A;  4II2 B;  2MP2 B;  1JQ4 A;  1MHH E;  3NZ3 A;  2KMA A;  4BKT A;  2MBE A;  3N20 C;  4ANU A;  1CMX B;  3B9J A;  1F0Z A;  1I4P A;  2ZNV C;  3AUL A;  2DWQ A;  2TSS A;  1KM7 A;  4J6I A;  2C7H A;  3FIL A;  5E6N A;  3HUI A;  5JH5 C;  2KFK A;  4XDD A;  4HWI B;  4MH8 A;  2J0K A;  4FAD A;  4AJY B;  2GI9 A;  1I4H A;  3VR8 B;  1NYQ A;  2KQ7 A;  5C3J B;  2IDY A;  3KUD B;  2JXT A;  1TZ1 A;  2HD5 B;  2HDE A;  3P63 A;  5IA7 A;  3PO0 A;  1L5P A;  4TMA B;  1SE3 A;  5G5H A;  3U52 E;  3Q14 C;  4KV2 A;  3L08 A;  4FHK A;  3L0W B;  2ON8 A;  2KLC A;  4RFB A;  2MHJ A;  4DDG D;  4L1B A;  5E6P A;  1D5M C;  4LLG M;  3U30 A;  4C7Z A;  3M3J A;  4DHZ B;  4WWN A;  3OJ4 B;  2MBB B;  5C2T B;  1G6J A;  1HE8 A;  1M4V A;  3QK0 A;  1J0G A;  2IO3 B;  1OQY A;  2FUG 1;  3ZJV A;  3PZ7 A;  2BVC A;  4YSX B;  4O1N A;  4B0M A;  1R4M B;  2ASQ A;  1WGY A;  1ISN A;  2JRH A;  3M63 B;  4KVG B;  2Y5C A;  1WX9 A;  3N1Y C;  4OW0 A;  1BXT A;  1MG4 A;  1WM3 A;  5CHV C;  2KAN A;  4WH4 A;  1EM7 A;  1E8W A;  2RPQ A;  3TBL D;  2IO0 B;  5AZF A;  1S1Q B;  1UGJ A;  1STE A;  2OHF A;  2QC8 A;  4RMA A;  2KWU B;  2X38 A;  1OFF A;  3VUW A;  2WYQ A;  1R4M I;  2LMC A;  3PRM B;  4KKJ A;  4NJC A;  4WQM A;  5IAA C;  5DPR A;  2N9E B;  3FAH A;  2ZVN A;  1WR6 E;  4AJW A;  2O6V B;  1V5O A;  3JSV A;  1I35 A;  1IUE A;  4HVB A;  2GBR A;  2KD0 A;  3NVY A;  3N1Z C;  3VXW A;  3R7R A;  1IPG A;  1GG3 A;  1ZOY B;  4LDT D;  3Q8B A;  1EU4 A;  2GBN A;  3MHS D;  3NY5 A;  4OVV A;  1DYQ A;  5BMG A;  3ZNI D;  3N32 A;  4EZL A;  3Q8A A;  2WDR B;  3GP7 A;  3P42 A;  3I57 A;  2KTR A;  3AMZ A;  5DPT A;  4WIP A;  4EE2 A;  1I42 A;  4G0N B;  1TY2 A;  2NCN A;  4HDQ A;  2IY0 B;  3DVG Y;  4H2A A;  2VZK B;  3AV8 A;  5BYR A;  1XLN A;  2LHE A;  2EKI A;  3Q3M C;  4DHZ E;  1C9F A;  2D07 B;  3SFE B;  1ZUD 2;  1UUP A;  1KF6 B;  2WXO A;  4URK A;  4YTM B;  1K8R B;  3ZIM A;  2REX A;  2V4I B;  1FMA D;  4JE3 B;  1XLO A;  3OG5 A;  1YN5 A;  3SHQ A;  3ETR A;  2IO1 B;  1OEY A;  1FM0 D;  1QLB B;  2IGH A;  2W54 A;  1E5W A;  2JQR B;  2WXR A;  1JRO A;  1LGR A;  2UU7 A;  3V60 A;  3UF8 A;  2L83 A;  4JX1 C;  2KVR A;  1B1Z A;  1WGK A;  4EUT A;  4IWP A;  3BYT B;  1HTO A;  3JVZ X;  4RNA A;  1WGR A;  3Q3J A;  4ZDV A;  4GIV A;  3NZU A;  3APF A;  1JW9 D;  1K52 A;  1GB4 A;  1E7V A;  2BS3 B;  1L6U A;  1IBX B;  3NS1 A;  3L17 A;  2J53 A;  1AW7 A;  2WDT B;  2BYT A;  3KVF B;  1PGX A;  2QDF A;  3ZXR A;  1WIA A;  3T3N A;  2YEP B;  4NNJ B;  2QSD A;  2L00 B;  1AN8 A;  2N7D A;  3Q6B A;  2I38 A;  3IXS A;  4I6P A;  1D6E C;  3RD2 A;  1WGD A;  2NS5 A;  3AM9 A;  5T8I A;  1P9D U;  4F1S A;  4GLS C;  4MJS B;  2R2O A;  5IKC M;  5DCN A;  2E3T A;  3Q8C A;  1XD3 B;  2N9X A;  4ZRI A;  2PLP A;  2FCQ A;  5JXV A;  4WJP A;  5J18 A;  2GB1 A;  4QAY A;  1ACC A;  1K51 A;  3PT2 B;  2ZZP B;  3QHT A;  2XNA C;  4ASW C;  1PYW D;  1OQQ A;  2IZV B;  1OEY J;  2KDI A;  2QHO A;  4ARI A;  1V5T A;  1YN3 A;  1VRA B;  3VHT C;  4DDI D;  5IN7 A;  5DPS A;  2W82 A;  4HDO A;  5C23 A;  5JHA A;  4A9A A;  3V62 A;  1FEH A;  5IOI A;  1YQ3 B;  1UNS A;  1TBE A;  4CHK A;  3AE8 B;  4HKQ A;  3EA6 A;  5E6J A;  1N61 A;  4ICV A;  2N9K A;  1ZPS A;  3DDC B;  1F52 A;  3FIL B;  2MBH A;  3UQB A;  3GOE A;  1RM6 C;  1GJZ A;  4NQL B;  2KFK B;  2BWF A;  2C7M B;  4TUU A;  3PZD A;  4K7S A;  4OZA A;  5JHB A;  2BPS A;  1XCQ L;  2OJR A;  1OTR B;  2BF8 B;  4XZ4 A;  2XBB C;  2MBO A;  1DOY A;  1Y8R C;  2R61 A;  2PVO D;  3A9J A;  2INC C;  4DHJ B;  1N5X A;  4WJO A;  3AU5 A;  2Q5W D;  1SXT A;  4XWT A;  3GZN I;  4IUM B;  2IPK D;  1C77 A;  2IO2 B;  3I3T B;  1YN4 A;  2G1E A;  4NY0 A;  4HLE A;  3UIN B;  3VH3 B;  1UEL A;  2X8X X;  2VZK D;  2RD0 A;  4WQO B;  2K6Q A;  2JU6 X;  3N1X C;  2CR5 A;  5E6O A;  1FNW A;  3AEB B;  3L10 B;  2NMQ A;  5D3I B;  3APD A;  2A4Z A;  4K3C A;  4XYC A;  2K9X A;  4EKU A;  2L76 A;  4PYZ A;  3L16 A;  5L95 C;  4KIK A;  2M19 A;  1SJE D;  2RMM A;  1YOV B;  3GE3 C;  3PLU A;  2NBV B;  3QWZ B;  2ZNV B;  2CU3 A;  1E8X A;  2D3B A;  3PRE A;  4RM9 A;  4DXA B;  2KWD A;  4L2Y A;  3PSE B;  2N1W A;  2KDE B;  1EWC A;  2K8C A;  2PTL A;  2DYM A;  4BKG A;  4DXF A;  1JCK B;  1HEZ E;  4MAC A;  4WWP A;  1UBQ A;  2UWQ A;  3I9V 1;  3BVM A;  3R3M A;  1E7U A;  2WX1 A;  4M0W A;  2Z8L A;  3JSV B;  2YVC A;  2CS4 A;  1L0Y B;  1J8C A;  4W9I A;  2UYZ B;  3DHH C;  4F7Z A;  1KLG D;  3W2D A;  3S2A A;  5CHW A;  2LUE A;  4ARC A;  2V1Y A;  3IAM 1;  1UWM A;  2BQQ A;  2N9P C;  3WAN A;  2QJL A;  5C1Z A;  2L1A A;  2MBQ A;  3OJ3 A;  3ML9 A;  3IFW B;  3ZUN A;  1V9J A;  4TSS A;  2WXK A;  3B2F A;  2RDB C;  4XX5 A;  1WWT A;  3VR9 B;  2KTR B;  2L8J A;  5AZH A;  2KAC A;  2DHZ A;  2VH1 A;  3ABV B;  4BVU C;  2PVG C;  4YT0 B;  3VTW A;  4ANV A;  3R66 C;  2KOX A;  4KGS A;  3NG0 A;  2Z0E B;  3Q8F A;  2J0M A;  2PE6 B;  2KMC A;  2LFI A;  3TCA A;  4PT5 A;  4W9H A;  4NPN A;  3P4R B;  4TKN A;  4PS7 A;  4EFO A;  4RM8 A;  2N7J A;  4N9F 4;  4KDL B;  1MVK A;  1XQQ A;  2KQS A;  2PPH A;  4K81 A;  1JWA D;  4B0E A;  2LRW A;  2Y3A A;  1WY8 A;  4MSM B;  2M56 B; 
#chains in the Genus database with same CATH homology
 1PGB A;  1PGA A;  3AE4 B;  1E7P B;  3PZ7 A;  3CWI A;  5BYQ A;  4YSX B;  4O1N A;  4B0M A;  1FCL A;  4KGR A;  5EE1 A;  2INP E;  1HXY D;  2LEK A;  2J52 A;  2WDQ B;  3U2S C;  1QF6 A;  1SJH D;  3AEE B;  1TS3 A;  3UI3 A;  1JWB D;  4YXD B;  2Y5C A;  2WXM A;  2FE8 A;  3BVZ A;  4UDU C;  3VRB B;  2WU2 B;  4ZYS A;  4OW0 A;  4RF1 A;  1BXT A;  3U4E G;  1D5Z C;  4C56 C;  1BUI C;  2BB6 A;  1DGJ A;  4WH4 A;  1EM7 A;  1K50 A;  1HZ5 A;  1VZ8 A;  2WDV B;  2BW2 A;  1I4G A;  3E56 A;  3VRA B;  4KX6 B;  1UGJ A;  1STE A;  2OHF A;  1D5X C;  2X38 A;  1OFF A;  4RH6 A;  1GAQ B;  1XLQ A;  2LMC A;  3DWG C;  4YSZ B;  3P4P B;  4KKJ A;  4NJC A;  2KQ4 X;  4WQM A;  1TYG B;  3AE1 B;  1CK1 A;  3FAH A;  3HVZ A;  1FNU A;  1T6B X;  3SR6 A;  3V3X A;  2K3U A;  3GS2 A;  3ZJU A;  2N9L A;  1XLP A;  4A90 A;  4DXG A;  5BMH A;  3T3O A;  1IUE A;  2JX5 A;  2MEK A;  1YQ4 B;  4ZHO A;  3TUO A;  1FRD A;  5BYS A;  2ONQ A;  1FNV A;  3ZGZ A;  3NVY A;  5EE3 A;  4NZL B;  2NTT A;  1IGD A;  1ZOY B;  2QMT A;  1JAL A;  1TJE A;  3Q8B A;  1V1O A;  3KWV A;  5HI1 A;  4JWU C;  1EU4 A;  2RDG A;  2V0G A;  1YMH E;  4JWS C;  1DYQ A;  5BMG A;  2K22 A;  2LUM A;  1XF5 L;  2IGD A;  2BS4 B;  2WS3 B;  3RPF C;  4XE0 A;  3AB5 A;  5H92 C;  4HRS A;  2BTE A;  1DOI A;  3Q8A A;  4HJG E;  3C8Y A;  2WDR B;  3GP7 A;  3P42 A;  5FK9 C;  2KDM A;  3MJ5 A;  3I57 A;  5HG2 A;  1L4D B;  1L0V B;  2MH7 A;  2AQ2 B;  3AMZ A;  2H89 B;  4WIP A;  4A6Q A;  4EE2 A;  1KLU D;  1TY2 A;  3U7Z A;  2WQY B;  1HZ6 A;  2XN9 C;  2VZK B;  1TZO A;  3AV8 A;  4H2A A;  4KKI A;  5AUK A;  5BYR A;  1XLN A;  2LHE A;  4GDL B;  3LXF A;  2EKI A;  2K5P A;  4P16 A;  4USA A;  1C9F A;  3BVG A;  3SFE B;  3TEY A;  1ZUD 2;  1N60 A;  4NAW B;  1UUP A;  1KF6 B;  1SEB D;  1WYG A;  2WXO A;  3WCQ A;  1NI3 A;  1FXI A;  1RFK A;  4YTM B;  1N62 A;  1FFV A;  5GXG B;  2PMV A;  1QKZ A;  1FMA D;  2V4I B;  2E6X A;  4JE3 B;  4LK0 M;  4J3O D;  1XLO A;  1BML C;  3SEB A;  1YN5 A;  1E6E B;  1FXA A;  1N5W A;  1PDX A;  2WXQ A;  3ETR A;  1FM0 D;  1QLB B;  2IGH A;  5AUI A;  4MT5 A;  4OVZ A;  2W54 A;  1ZE3 D;  3EGR A;  1Y56 A;  2JQR B;  3AE3 B;  2WXI A;  1VZ6 A;  2WXR A;  3GB1 A;  2WXN A;  3BZD B;  1P7F A;  1L0X B;  1VR9 A;  1JRO A;  4XWW A;  1HQR D;  2L83 A;  4JX1 C;  3ZYY X;  1B1Z A;  1WGK A;  1C4C A;  4R3D A;  4LTU A;  2JYE A;  2JZP A;  2I2Y A;  2WLB A;  3J9C A;  1E0Z A;  1NEN B;  1GPX A;  1RYJ A;  3BYT B;  2ZW0 A;  4N59 A;  1I4X A;  1FIQ A;  4RNA A;  1FO4 A;  2BS2 B;  4IDI A;  1J7C A;  2QIE B;  2OED A;  1T3Q A;  1TS5 A;  1V97 A;  1JWU D;  1JW9 D;  1F2R I;  5FR3 A;  1K52 A;  4OZB A;  1GB4 A;  2ZW1 A;  5D7G A;  1ET9 A;  2BS3 B;  1I4Q A;  2WXF A;  1R7S A;  1L6U A;  2D5G A;  1F2R C;  1IBX B;  3NS1 A;  5I4D A;  2J53 A;  1I4R A;  1FRR A;  2V3P A;  1AW7 A;  4TQ1 A;  2BYT A;  2WXL A;  1SIJ A;  1PGX A;  4RGN A;  4D2K A;  2WXG A;  1TS2 A;  1VJK A;  1ZDV A;  3BK1 A;  3T3N A;  2YEP B;  4RGM A;  2QSD A;  4OZC A;  1AN8 A;  3TSS A;  4IKG A;  3E9S A;  2I38 A;  3IXS A;  4GDK B;  4ZOH C;  4YTP B;  1SE2 A;  1D6E C;  1ET6 A;  4WUR A;  1D4B A;  5H8Y E;  1ENF A;  1UWX A;  3AM9 A;  5T8I A;  2JSV X;  2AX5 A;  3EUB 2;  1WSP A;  3LYY A;  4GLS C;  1CQV A;  4RGO S;  1KTK A;  1GB1 A;  4NAM A;  1YJI A;  1SE4 A;  1SBB B;  2E3T A;  3Q8C A;  2PLP A;  1V1P A;  5JXV A;  1LO5 D;  3MHZ A;  2GB1 A;  1XXG A;  2PW9 A;  1V1P B;  2WNM A;  1ACC A;  1K51 A;  2JYT A;  4HEA 1;  3CIR B;  3Q8E A;  1EU3 A;  2NTS A;  1T5X D;  5MPO A;  4HRO A;  2XNA C;  3LB8 C;  1PYW D;  1OQQ A;  2SAK A;  5HHD G;  4ARI A;  1E9M A;  1YN3 A;  1VRA B;  2QIL A;  4DQO C;  2MJD A;  4RF0 A;  1EWY C;  1KFY B;  1N63 A;  2W82 A;  1QOA A;  2J4X A;  3KLS X;  3V05 A;  4A9A A;  2PIA A;  1KH0 A;  3P1M A;  4ZHP A;  3FC4 A;  1FEH A;  5FKA C;  2W3S A;  1YQ3 B;  1K53 A;  3NVZ A;  4C7Y A;  1UNS A;  2W3R A;  3AE8 B;  4HKQ A;  1SB3 C;  2V3N A;  3EA6 A;  5E6J A;  1N61 A;  2N9K A;  1ZPS A;  2WXJ A;  3FIL B;  4KGT A;  1F77 A;  5G5G A;  1GOZ A;  1VDV A;  1OQR A;  1RM6 C;  3AEA B;  3HRD D;  4RCO A;  4CQN A;  3R2I A;  2BT6 A;  1ZXI A;  2SEB D;  1NVI D;  1PUT A;  2LJI A;  3ZJV A;  2BBC A;  1XO3 A;  1MI0 A;  2B76 B;  4TQ0 A;  2ICI A;  4OZA A;  1WRI A;  5BMI A;  3IAS 1;  1C79 A;  4REZ A;  4P6V F;  1A70 A;  1XCQ L;  4Q2J A;  4L23 A;  2HTM E;  1MHX A;  2IGG A;  1DOY A;  2K0P A;  1I7H A;  4YTN B;  2R61 A;  1MPE A;  1CZP A;  2PVO D;  2ACZ B;  3OWE B;  5EE9 A;  2AQ1 B;  2EEL A;  2WXH A;  1YNT E;  1N5X A;  4YSY B;  1ZP0 B;  2Q5W D;  1SXT A;  5LNK 1;  1C4P A;  3NVW A;  4XWT A;  1J7B A;  2IPK D;  1C77 A;  2L52 A;  2WU5 B;  1YN4 A;  2G1E A;  2KN4 A;  1ROE A;  2DYO A;  2PKO A;  3W5U B;  3AE9 B;  2VZK D;  1ZXH A;  1NEK B;  3B2G A;  3W5V B;  3AN1 A;  1B9R A;  2JU6 X;  2N0S B;  1QT9 A;  4US8 A;  1QQR A;  3O13 A;  2INN E;  3VQI A;  1FNW A;  1IBX A;  1C78 A;  2GRI A;  3KQ4 A;  1NYR A;  3AH7 A;  1ZDX A;  4RGT A;  2DBY A;  3PZ8 A;  3AEB B;  3MP9 A;  2NMQ A;  5D3I B;  3R8B A;  4AQ7 A;  1YJJ A;  1AWD A;  3AED B;  2K9X A;  1TKE A;  1FCC C;  2KMM A;  4WAF A;  2H88 B;  1CJE A;  2WP9 B;  1VLB A;  2BB5 A;  3BK2 A;  1C76 A;  3MFG A;  3TEW A;  2M19 A;  1FFU A;  2MJ3 A;  3AE7 B;  1QOG A;  1L4Z B;  1SJE D;  3RFZ B;  2FBW B;  1QIL A;  2RMM A;  4N58 A;  2JWU A;  2LHD A;  4N6E B;  1JRP A;  1JWS D;  2CJO A;  1QOF A;  2CU3 A;  1PFD A;  2IJ0 A;  3KWL A;  3ZJT A;  2LGI A;  2KWD A;  4ITK A;  4L2Y A;  1SF0 A;  1EWC A;  1XEE A;  3R2T A;  3AEF B;  1JWM D;  3BII D;  2PTL A;  2DYM A;  4DXF A;  1JCK B;  1VZ7 A;  1HEZ E;  4MAC A;  3SFD B;  2G9H D;  3W1S A;  3W9C B;  1V8C A;  3I9V 1;  3AEC B;  4AS1 A;  3BVM A;  1KRH A;  3HVD A;  3IT6 B;  4M0W A;  2Z8L A;  1TKY A;  3AEG B;  3IT4 B;  3P4Q B;  2YEP F;  4IOI E;  3L4P A;  1L0Y B;  1JQ4 A;  1JML A;  1AYF A;  1Q10 A;  4OHJ A;  1MHH E;  3TEZ A;  3NZ3 A;  2CJN A;  3NRZ A;  1KLG D;  1C4A A;  3BWU D;  3W2D A;  4ARC A;  3B9J A;  1F0Z A;  3DWM A;  1I4P A;  2DWQ A;  2TSS A;  1QOB A;  4US9 A;  3URY A;  3AE2 B;  3FIL A;  3IAM 1;  3NUH B;  1UWM A;  4A55 A;  3HUI A;  2QJL A;  2L1A A;  4XDD A;  3AE5 B;  3H8H A;  1P7E A;  4MH8 A;  4XDC A;  2J42 A;  4JPS A;  4TSS A;  2RDH A;  2WXK A;  3B2F A;  1DOX A;  1WWT A;  3VR9 B;  1TS4 A;  2GI9 A;  1I4H A;  3VR8 B;  4A8X C;  1NYQ A;  1XCT L;  5C3J B;  2IDY A;  2KAC A;  3TEX A;  5EE0 A;  3P4S B;  1RWS A;  2JXT A;  2M0A A;  1ESF A;  2HDE A;  3ABV B;  2PVG C;  4YT0 B;  4C80 A;  3P63 A;  2DLB A;  4MM3 B;  2AQ3 B;  3PO0 A;  4KGS A;  1L5P A;  4TMA B;  5TSS A;  1HA5 A;  1FD6 A;  1SE3 A;  3NVV A;  3Q8F A;  4ZRP A;  4YWG G;  5G5H A;  1TY0 A;  3U52 E;  2LFI A;  2L32 A;  4HKZ E;  2Y5P A;  4RFB A;  2ON8 A;  4PT5 A;  5HFY A;  3N9Y C;  3AE6 B;  3P4R B;  3BYY B;  4L1B A;  1IGC A;  2QEJ C;  3MC0 B;  2WXP A;  4WWM A;  2N7J A;  2RPV A;  1D5M C;  3ZQ4 A;  4LLG M;  4ZRQ A;  4FXC A;  1L6V A;  1MVK A;  4C7Z A;  1JWA D;  4B0E A;  1TKG A;  2Y3A A;  1SSN A;  2M56 B;  5C2T B;  1E10 A;  2W55 A;  1M4V A;  1WXQ A;  2MJE A;  3Q69 A;  2FUG 1;  2KAJ A;  5D3D A;  1J7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...