4B0EA

Crystal structure of the caf1a usher protein n-terminal domain from yersinia pestis
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
96
structure length
96
Chain Sequence
LPGNYFVNVFVNGRKVDSGNIDFRLEKHNGKELLWPCLSSLQLTKYGIDIDKYPDLIKSGTEQCVDLLAIPHSDVQFYFNQQKLSLIVPPQALLPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Transport protein
total genus 21
structure length 96
sequence length 96
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-07-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.410 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4b0eA00
4J3OD 1ZDXA 1ZE3D 4B0MA 3RFZB 4B0EA 1ZDVA 3BWUD
chains in the Genus database with same CATH superfamily
1XLPA 4IM3A 3RMKC 2K0PA 3AEGB 1OEYJ 1WXSA 1WSPA 3L4PA 4MGIE 5FK9C 1WX7A 2INNE 1KOTA 4REZA 1WYGA 3RI7C 1TY2A 2FE8A 1N60A 2KD0A 1E10A 2Y5CA 1ZW7A 1F2RC 1T0SC 3R7RA 3NVYA 2RDHA 3KUCB 2K39A 5IOIA 1XLNA 3Q6BA 1PGAA 2KWVB 5CX3A 3QCAA 4DXFA 1E7UA 4II2B 3ZJUA 3QK0A 4IWQA 3PTFC 2AX5A 3UIPB 1C77A 4KGTA 3MTNB 1MFWA 5G5HA 4A20A 1FM0D 2J0JA 2WXJA 3ML8A 4FXCA 3HIZA 4EFOA 1S3SG 1TS4A 3P4QB 1YMHE 2K8BA 4W9EA 2M8SA 3W2DA 2H89B 4K81A 2LUMA 3DVNV 2ZCCA 2NCNA 2INPE 1UD7A 4JWSC 4ZRQA 4N58A 1FXAA 4KX6B 2GLSA 1V5TA 3MHZA 5LNK1 1MI0A 3DBLI 3RNGC 3VR9B 1WGHA 4RFBA 1MPEA 3N30A 2N9LA 2BBCA 2V3PA 2WXOA 4WJPA 2D2QA 4WWOA 3I5JC 5IA7A 3Q8EA 2L7RA 3LDZE 1WM3A 2CJOA 4GMVA 1TJEA 2MBEA 1WYWB 1RRBA 2BS2B 1TBEA 4IKGA 2BW2A 2VRRB 2PVOD 4G0NB 3QHTA 2BKFA 2TSSA 2G3QB 4BZAA 2DZIA 1NI2A 3PRZA 3EECA 4PS8A 5IO9A 4HCPB 1PUTA 2FAZA 3O13A 3AE2B 4KIKA 5D3DA 1VR9A 3K9PB 1D5ZC 4M0WA 4MSQB 4FBJB 5FR3A 1EUVB 1H4RA 2FNJB 5L83A 2WXMA 3APCA 2KN4A 2FUG1 3QAQA 3BVZA 1L6UA 3PHXB 4YSYB 4HVBA 1HEZE 4BBNC 2KDMA 3OWEB 1R4NI 3UI3A 1R4MI 1V97A 3TUOA 2MBHA 3KUDB 5E6NA 2NBWB 5C1ZA 1IPGA 2L52A 2PLPA 1JRPA 3VDZA 4M0WB 1GC6A 1D6EC 4YSZB 4FULA 1C79A 2K9XA 4PT5A 2WX1A 2WLBA 2M0AA 2KC2A 4KDLB 1FMAD 3PLUA 1L0VB 3UINB 5D3IB 1HZ5A 1VDVA 1E0ZA 3ZNHB 3OG5A 3DCGA 4HEA1 2FCQA 1QT9A 1ET9A 1PGBA 4FHJA 4WURA 5TSSA 3KLSX 3T3OA 3R2IA 3AH7A 3EC8A 3WAOA 3V61A 1OQRA 2VZKD 2KQ4X 1PYWD 2KQSA 3H7SA 4GU2A 4NZLB 1Q0WB 1WI0A 2R2QA 4HLEA 3MJWA 4GB9A 2D10A 2KDIA 2B76B 4XDCA 2KTRA 5D6JB 3CIRB 1FNWA 2PVGC 1T0YA 3PRMB 1RFAA 2C7HA 4A90A 3NUHB 3VAWA 2ZW0A 4EUTA 4WIPA 4WQOB 2KO3A 1GAQB 2VZKB 3KYCD 4Q2JA 4HCNB 2HJ1A 2JPHA 3Q8AA 2WXHA 3PO0A 3JW0X 2WYQA 1FIQA 5JZEB 3O65B 4NAWA 2IY0B 3FILA 4RCOA 3ZDMC 1HQRD 4B0EA 2KC1A 1EWCA 2W55A 4NNJB 2PTLA 3AEFB 2IGGA 1JRUA 2KTRB 3RPFC 3ABVB 1SE3A 3KWVA 3DOWA 2ZNVC 4RNAA 2BS3B 2L32A 3ENEA 3L08A 3PT2B 4BOSC 3GS2A 1L6VA 4ARIA 4HKZE 3VHTC 1ZDXA 2C5LC 2LFIA 1OEYA 1FCLA 2ZNVB 3ZIMA 2MW5A 2MJEA 3W9CB 4NAWB 1JWSD 1IBXA 4N59A 2E6XA 1GNUA 2IGDA 1KTKA 3BK2A 1YJIA 5IN7A 3V05A 4AS1A 3DBHB 2LUEA 2CHWA 4DQOC 4G11A 4M8MA 1IGCA 4I6PA 4C00A 4W9KA 5FKAC 2RPQA 5D94A 4GDLA 2N9PC 4LNKA 2IO1B 1OGWA 4C7YA 3DWGC 1IBXB 3H6NA 3DHHC 4L2YA 1N63A 4TQ0A 3N1XC 4JWUC 1WWTA 3KW5B 4WJQA 2WXIA 3LXFA 3V3XA 4K3CA 2GBNA 1KLGD 4WJOA 2NTTA 1J8CA 3APFA 1N5XA 4PYUA 2DAJA 3WA0A 2J42A 3GOEA 1Q10A 4UDUC 4JQWC 4GDLB 1E8XA 3ZVVA 4YTMB 4O1NA 2MCNB 1F77A 4FADA 2XNAC 3BY4B 1XLQA 3TEXA 4EZKA 2WDQB 1WGGA 3PPAA 1DOXA 3TMPB 4BFRA 4OVZA 4ACFA 3V6EB 1K8RB 2KDFB 1RLFA 4OZAA 1P1AA 4ICUA 1I4XA 1EO6A 3H7PA 3P42A 5EE3A 2AEHA 1GB4A 4E71A 3A33B 1J7BA 2IZVB 2JUOA 3TEZA 4FJVB 2C7MB 2K6DB 4ICVA 2NBVB 1T5XD 2KJHB 4M00A 3IAM1 2MQJA 2I2YA 3M63B 2CJNA 4KKIA 3BYTB 1UUPA 1AARA 1WJ6A 3H7PB 5HG2A 4MSMB 4LTUA 3E56A 3DVGY 2UWQA 3PRPB 4IW0A 4HJGE 2L76A 4NQKE 1WXMA 4HK2A 4E74A 1YJ1A 2R61A 1C9FA 1KFYB 4JLCA 5CTRC 1NDDA 2EKEC 4OZBA 1HTOA 2MA9B 5I4DA 4GDKA 1JROA 2MJ3A 1K51A 4K7WA 5DPTA 2PJHA 4AWJA 3MC0B 1ZPSA 2KJRA 2DBYA 2JYEA 2L83A 2JT4B 3GZNI 5G55A 2BVCA 2GBKA 4MJSA 1XD3B 2CS4A 2RGFA 5T8IA 2V3NA 3ZQ4A 2ZZPB 1C3TA 1WH3A 3L0WB 3QA8A 5BYRA 2W3RA 3R7QA 1OQQA 3S2AA 2ZVOA 2KJ6A 1FRRA 1SF0A 4HPLB 4GDKB 1SJHD 3EUB2 2BB6A 3A4RA 2LD9A 1TS2A 2QC8A 3DPDA 2LGXA 4OW0A 4MJSB 3MFGA 1E9MA 4HDQA 1B1ZA 3L16A 1EM7A 2K8HA 1SJED 4W9FA 4BBNF 4DWFA 4W9HA 2MBQA 3SEBA 1M4VA 1TT5B 2KYWA 1F1HA 1JW9D 4TSSA 2IJ0A 3AMZA 2FIFA 1TIFA 4PS3A 2NPTA 2KLCA 5HKHA 2N7EA 1N6ZA 5D2MB 1ROEA 1P9DU 4IC7B 2GBMA 2QMTA 1UGMA 3BK1A 3PS6A 3DBRI 3TIXA 4XGAB 1D5MC 3SU8X 1LFDA 3BINA 3W1YA 2WU5B 1KJTA 3RNBC 3BYYB 4B95A 2W3SA 3NS8A 4HROA 2AQ2B 3HHMA 2JRIB 3MP9A 1AW7A 1XQQA 2LWPA 1WM2A 1D4BA 3CSFA 2L0TA 2FCMA 3EHVA 4US8A 3Q3FA 3TJPA 4DHZE 1N5WA 2M17A 3ZLZA 4OZCA 3DWMA 2PKOA 3ZKJC 1J0GA 2EMSA 2GB1A 3BVMA 3X0WA 1SGHA 2N9EB 3WAMA 1T3QA 2GOWA 4XWTA 3SDLC 2J52A 2LRWA 1EWYC 2REXA 3K9OB 3U30A 2KDEB 3IFWB 1WGKA 1GC7A 2PE6B 3TEWA 1WZ0A 3VUXA 1VZ7A 3UQAA 4BOZB 3PV1A 2BQQA 2WXPA 2V4LA 4EZLA 1SIFA 3DBSA 5BMIA 3RNCC 1QOGA 4L1BA 1Z5SB 4HPPA 3UIOB 3NOBA 2A5UA 2W54A 3PLVA 2BF8B 3IXSA 1FFUA 3P4PB 3SD5A 3JVZX 1SEBD 1I35A 3AE1B 1XF5L 5MPOA 4XYCA 2HE7A 2WXKA 2MHJA 2WHIA 1WY8A 2DAFA 4XWWA 3A9KA 3VXWA 2QDFA 3ZUNA 2D3CA 5J17A 1ISNA 1V8CA 2RPVA 4WJNA 4PYZA 2KMAA 2KK8A 3AEBB 2YEPB 5C2TB 3B0AA 2WS3B 2D3BA 3NZSA 4BKSD 2BYEA 4MEMA 1YN5A 1YOVB 1VLBA 3OLMD 3ZGZA 3GP7A 3HVDA 1WFYA 1T0QC 4DXAB 3J9CA 1WMHA 3A9KB 2KX3A 4DHJD 2WXFA 2IYDB 1MG4A 3EFUA 3AI5A 2OJWA 3TSSA 1TS5A 1L0XB 2JX5A 1PDXA 5GXGB 4RGNA 3PZ8A 1FEHA 3OJ4B 3ZTCA 4XX5A 4P7IA 4S0RA 1FXTB 4TQ1A 1PGXA 3QX1A 2I1KA 1NI3A 4WAFA 3AE4B 4X57B 2M0XA 1I7HA 2OEDA 1SE2A 4P16A 1NBFC 1WMHB 1FFVA 3NJTA 1L4DB 1XEEA 2BT6A 1EF1A 3N9YC 3RN9C 1UBQA 1V2YA 3BIID 4LJPB 4AUQC 2D3AA 2OOBB 2LASA 3DVNU 2EELA 4KIKB 3KQ4A 2HDEA 4TMAB 4XC2A 1KLVA 2J0KA 2XEWA 1V86A 3C19A 5E6JA 2LXAA 3Q8FA 2DZJA 2WP9B 5BMGA 4CHKA 2IY1B 2BYFA 3DDCB 2LHDA 2LGYA 2J4XA 3L17A 2QEJC 1WF9A 4C7ZA 2L0FA 1F2RI 3AE9B 3U7DA 4P6VF 5FR6A 3FAHA 3ZNID 1FO4A 3CWIA 2R2OA 1YD8U 4TKNA 5AUIA 3RZFA 2G4SA 1UWXA 1PFDA 3WIMA 1IUEA 2DYOA 1WRDB 3IHPC 1WZ3A 2HJ8A 4LCDE 3VTUA 4JGHB 2L00B 3B1LX 4OVVA 2G1EA 1RWSA 4KGSA 4KDIC 2V4IB 3L10B 2N0SB 2K8CA 3KWLA 1STEA 1NEKB 3H8HA 3M62B 3RFZB 2C7NB 4WAAA 2FUHB 2B3AA 1RAXA 5DPRA 3LJ3A 4LK0M 2GMIC 3RYTA 4I6LB 4LNIA 1YIWA 3DQVA 2DYMA 2WDVB 4HKQA 2NS5A 1V1OA 1JCKB 3CF6E 4C56C 2A4ZA 2WXLA 4E3CA 3Q3MC 4ZOHC 1P7EA 1WJNA 5D7GA 4A3OA 4ZDVA 2E3TA 5LXIB 1AYFA 3ZXRA 1EU4A 1Z2MA 3C8YA 3AV8A 2MEKA 3PGEA 5DPWA 1I4GA 2LRUA 1CJEA 2IO3B 1WJUA 2RR9A 1UBIA 3NZUA 1WGRA 2N7JA 3AECB 3N3KB 1V1PA 1G6JA 1VJKA 3DVGX 2ZPNA 4KZ0A 2O6VA 3FILB 4RGTA 3Q69A 5H8YE 4J3OD 4JL9A 4D2KA 2O6VD 4NPNA 3ZNGC 4ZRJA 3OJ3A 4MGZE 3RNEC 3MC8A 2HTHA 2RMMA 1DOIA 2IDYA 2MJDA 4FN2A 1V1PB 4NJ7A 2GRIA 2HD5B 1E5WA 2O6VB 2W9NA 3IBEA 2KT7A 2IBIB 4RMAA 4ZYNA 1PQSA 1N62A 4BAXA 1C78A 1NYRA 1XCTL 4RH6A 1TY0A 3IT4B 3AEDB 4ZYSA 4CO7A 4K7SA 2FIDA 1FXIA 2XN9C 1WGDA 3CSTA 4KZCA 4CYEA 2MSED 4GOCA 1L0YB 3SFDB 1WXVA 5CHVC 2GI9A 4FLHA 1WXQA 3P4SB 5GMVA 2I1JA 4URKA 3SHQA 3ML9A 4MH0E 4MDKE 1KH0A 1Y8RC 2WQYB 1CK1A 2KWUB 5G2NA 1E8ZA 1KF6B 4K7UA 2BGFA 1LGRA 2KDBA 2KTFA 5KHOA 2QJLA 3L54A 1XXGA 4KKJA 1UGJA 4FA6A 2JVCA 2KWDA 3B9JA 2JXTA 3JYUA 2RSUA 2LGIA 4P1BC 3AE7B 1MG8A 2VH2A 2QIEB 4DK5A 1SIJA 3AE6B 3CMMB 4GIVA 2ZW1A 1J7CA 4EEWA 5DPSA 2K22A 3R66C 5E6PA 3N1ZC 3QIJA 2WDTB 3ZTDA 2V1YA 2YEPF 1MJDA 1YJJA 1WR6E 3P4RB 4JIOU 3NHEB 3PREA 1I4QA 3DBHI 2ICIA 2CHZA 4YWGG 3U4EG 2L3ZA 2MBBB 4EE2A 2V3SA 4ANWA 3TEYA 4LJOB 1J7AA 2BB5A 1GJZA 4IWPA 2CR5A 2RDBC 4HPMB 4HXDA 2N1VA 1N61A 1LM8B 1JWBD 3RT3B 3L13A 1UELA 2N9KA 3Q14C 3R2TA 4NJCA 4DDID 3OAWA 1C4CA 4HDOA 4W9GA 3VR8B 1QOFA 2KXJA 1RFKA 5KHQA 1TS3A 1E7VA 1XT9B 3A4SC 3AEEB 3PHWB 2LZ6A 2BYTA 3NVWA 1KLUD 1ACCA 2LVOA 3V62A 4XE0A 4P1CC 1EU3A 2LEKA 2AQ3B 2RDGA 3AU4A 4AQ7A 4F1SA 1YNTE 3ZO5B 4C80A 4LNNA 4HJKA 4IG7B 1JWAD 4ASWC 1YQ4B 1F9JA 1SSNA 1JWMD 1QILA 3C0RB 3NRZA 5AEKB 4ITKA 2ZVNA 1E8WA 1IYFA 1JWUD 4MACA 1I4RA 2PIAA 1XLOA 3KVFB 3EGRA 4YL8A 4MT5A 1WR1A 2FBWB 3BZDB 5BO4B 1CMXB 1MHXA 2AQ1B 1E7PB 2MLBA 3ZNZB 2ZEQA 3UF8A 3VH3B 2VH1A 3VVWB 3DBLB 4C4VA 5HI1A 3NVZA 1OTRB 4R3DA 1NYQA 3D32A 1V6EA 2KWCA 5AZFA 2D11A 1DYQA 4PS7A 5LXHA 2C60A 4JE3B 2Y5PA 5J2RA 2ONQA 4H2AA 4A3PA 2NPTB 2V9HA 4WWMA 3PVLA 3PZ7A 4C4VB 5AUKA 1YX5B 5JH5C 4FJZA 2INDC 3UQBA 1IGDA 2N9XA 1FNVA 3W1SC 1UNSA 1E90A 3M95A 1IP9A 4AJYB 1L7YA 2DHZA 2KNBA 2J53A 3UGBB 3H1UA 4M8NA 5IP4D 3V60A 3I3TB 1R4NB 1R4MB 1QOAA 1GG3A 1ZXIA 1KM7A 2QHOA 4AP4C 2D3GA 2JSVX 4W9LA 3N20C 2KHWB 2Z8LA 3IT6B 3IAS1 2JU6X 2PEAA 3ZYYX 4TV3A 2Z0EB 3HM3A 2LXCA 2LGDA 2KMCA 1TGZB 5J18A 2G4DB 3I57A 1AN8A 4IUMB 3TL5A 2K6QA 2WXNA 2MWSB 3WALA 2WXRA 1UWMA 1SE4A 4G3XB 3VRAB 1NENB 3T9LA 2EMTA 3IVFA 3RD2A 4RM9A 3BVGA 1I4HA 4QAYA 1BXTA 1P0RA 1TKEA 4IOIE 4XZ4A 4BKSA 2GBRA 1XCQL 1WE6A 2KKCA 4FHKA 4RF0A 1JQ4A 1J19A 4PK1A 2Y3AA 3VTWA 2JY6A 3ECIA 4GN1A 4A8XC 4ANVA 1M94A 3MJ5A 2UYZB 2N1WA 4AOFA 4CQNA 3SFEB 2LI5A 3ZRFA 4LNFA 4MELA 1T0RC 4M01A 1UF0A 2CKHB 1GPXA 1R7SA 1VCBA 1OQYA 4IM0A 4YT0B 5BYQA 1MHHE 2JZZA 5C3JB 2K5PA 2DWQA 1ET6A 1SXTA 3ETRA 4AJWA 2IGHA 3WAPA 3HM6X 4F7ZA 1WJ4A 2IO2B 3IG3A 4DHJB 2WU2B 4B9KA 1T6BX 2KLGA 4TUUA 1TTNA 2YVCA 1GB1A 5LLIA 4EKUA 5C23A 2KOXA 1F52A 3U7ZA 3T8MA 1K53A 3DHGC 3FC4A 1L2NA 4GSWA 1DGJA 3AM9A 4L23A 1WIAA 5AZGA 4II3B 2X8XX 2FCNA 1QOBA 1V5OA 5CHWA 2KN5A 2WNMA 3AE5B 1P3QU 3AULA 3HVZA 3V6CB 2NVUI 2NTSA 2OJRA 3QQ8B 3E9SA 3P2BA 2ZCBA 4N6EB 1ZE3D 2JRHA 3GE3C 4M02A 3H9DA 2BTEA 3N1YC 4K3BA 2NBUA 4W9CA 2Y5BB 4MGKE 2XBBC 4I6NB 5JHBA 2DENB 4USAA 2ON8A 3VRBB 3HUIA 4W9DA 1ZP0B 2K25A 4JPSA 1EF5A 2CU1A 4ARCA 3P63A 2KACA 4MH8A 1WX8A 1A5RA 3A1QA 2M56B 4ZRIA 4EZJA 2QCZA 4MM3A 1FNUA 5L95C 3B08A 1YN4A 4LNOA 4BKGA 4ANXA 1KRHA 2LVPA 3KUZA 3NS1A 3RNAC 1FPYA 1Y56A 2BPSA 2JXXA 3EA6A 1Q1OA 4GXBA 4OHJA 1FD6A 2PE9A 1C4PA 4YSXB 2WDRB 1DOYA 3PZDA 4B0MA 4DXGA 1B9RA 3Q8CA 3U52E 1WX9A 3A1QB 4MM3B 2ASQA 2X38A 3ONSA 2UU7A 1V81A 2JF5A 5CHFA 3JSVA 2V0GA 3VQIA 1VRAB 3NVVA 2RD0A 2OHFA 5HHDG 5H92C 4RGMA 4G50A 3NY5A 3Q2AC 3KH0A 2WXQA 3MC9A 2WGSA 2IPKD 4OVUA 1BUIC 1TYGB 2M4NA 4F8CB 2AL6A 2MRPA 3JSVB 1C1YB 4A55A 5EE9A 4IM2A 2DZKA 3ZRCA 2Q5WD 4NQLB 1TKYA 4XDDA 4BKTA 1LQBA 3QWZB 3RNFC 4B6WA 1WRIA 1TZOA 2AYOB 3VH4B 4KSLC 4S17A 3AB5A 1YQ3B 2IO0B 3B2GA 3VUYA 1UH6A 2Z59B 3FKYA 5E6OA 2CU3A 1HE8A 2L8JA 3DHIC 4ZRKA 2FCSA 4J6IA 3HK0A 2KZRA 3GZNB 1UZXB 3RUIB 3I63C 2DZMA 2KANA 2KQ7A 2INCC 1QF6A 3ZJVA 3QC8B 3VFKA 2LVQA 4YTNB 1YX6B 1E6EB 2PW9A 4KSKC 2D5GA 4LDTD 4A6QA 3BWUD 1E8YA 1CQVA 1D5XC 2H88B 4GLSC 1V49A 1QKZA 3SR6A 2QILA 3I9V1 2KAJA 5DCNA 2N7DA 1H8CA 5IAAC 2N4FA 2KVZA 3HRDD 3A9JA 4MGYE 3PSEB 2BKRB 3QARA 5AZHA 4LDTB 3X23A 2I38A 1LO5D 4RGOS 4US9A 1L4ZB 1L5PA 2LHEA 3Q8BA 1P7FA 3ZW3A 3W5VB 2JZPA 3NZ3A 4GGQA 1BMLC 2KX0A 4NAMA 1F0ZA 1SB3C 4IWOA 1V9JA 3A9JB 2PPHA 1GUAB 1YQBA 1P98A 1TZ1A 2MX2A 1U4AA 1VD2A 1C4AA 1X1MA 4WQMA 5G5GA 1HA5A 1V80A 2KVRA 3QJZA 2HTME 4RM8A 2DX5B 2W82A 3DBRB 3Q3NC 1VZ6A 3Q3OC 3RULA 2G9HD 2J0MA 3RCZA 1ZXHA 4WWNA 2NR2A 4LLGM 3N32A 3URYA 1TKGA 1QLBB 1FCCC 3GE8C 2WX0A 3LYYA 5IKCM 4WH4A 2ZJDA 2SEBD 3ZJTA 3RZWC 2ZPYA 4KV2A 3WANA 1WE7A 4A9AA 2MP2A 1HZ6A 5JHAA 1I4PA 1CZPA 2D07B 4NY0A 2BYVE 2JQRB 4FJYA 4HRSA 1YN3A 4BVUC 5EE0A 3U2SC 2JYTA 2DYBA 2DLBA 1NVID 1LXDA 1GOZA 5BMHA 2Z0DB 4ZHOA 1BT0A 2LGSA 1K50A 3ZXVA 1ENFA 3R3MA 2M1MA 2MP2B 4K1RB 1ESFA 1VZ8A 3VTVA 2G45B 1FRDA 4YXDB 4IDIA 1SE9A 3EFCA 4DHZB 4HWIB 2MBOA 2L05A 3M3JA 2JZ3B 2WWZA 3KYDD 3GB1A 1A70A 5HFYA 1JALA 4EOYA 1SBBB 4DDGD 2KFKA 2JWZA 2O2VA 3B2FA 3LB8C 4YTPB 5EDSA 2MH7A 2DNFA 2AWTA 4W9JA 5EE1A 3TBLD 2BWFA 2BS4B 2YLMA 1WGYA 4ZHPA 1K52A 2J7QB 4NJ6A 4ZRPA 1ZKHA 2QSDA 3NG0A 4ANUA 1MVKA 2LJ5A 4JX1C 5BYSA 1S1QB 1WXAA 1AWDA 4KGRA 4WWPA 3AU5A 3AN1A 1QQRA 1HXYD 1ZOYB 2L1AA 4W9IA 3WCQA 2XK5A 5JXVA 2KFKB 2PMVA 2O2VB 2AL3A 1RM6C 4RF1A 3AE3B 3MHSD 3AE8B 1QZEA 2JWUA 2C9WB 4KVGB 2M19A 2BWES 2GBJA 3APDA 3U8ZA 2CHXA 1RYJA 1Q5WB 1JMLA 2EKIA 3W1SA 3T3NA 3R8BA 4N9F4 3Q3JA 3VUWA 2K1FA 2LJIA 2LMCA 3P1MA 1ZDVA 5TR5A 3W5UB 1ZGUB 3AXCA 4DBGA 1I42A 2XK5B 1OFFA 2KMMA 2WXGA 1HTQA 1ZUD2 1C76A 2K3UA 2ACZB 2NMQA 1XO3A 2SAKA 2KFJA 3ZDTA 3ALBA 3AEAB 1D3ZA 3TCAA
chains in the Genus database with same CATH topology
1XLPA 5I4DA 2WNMA 2K0PA 3AE5B 3AEGB 1JROA 2MJ3A 1K51A 1WSPA 3L4PA 2RMMA 1DOIA 2IDYA 3HVZA 3MC0B 5FK9C 1ZPSA 2L83A 2DBYA 2JYEA 2NTSA 2INNE 4REZA 1WYGA 2MJDA 1V1PB 1TY2A 2FE8A 3E9SA 1N60A 2GRIA 1E10A 5T8IA 2V3NA 4N6EB 3ZQ4A 2Y5CA 1ZE3D 1F2RC 5BYRA 2W3RA 1OQQA 3NVYA 2RDHA 2BTEA 1XLNA 1N62A 1FRRA 1PGAA 1SF0A 1C78A 1NYRA 1XCTL 4DXFA 4RH6A 4USAA 2ON8A 1TY0A 3VRBB 3ZJUA 4GDKB 1SJHD 3IT4B 3EUB2 3AEDB 4ZYSA 3HUIA 2BB6A 2AX5A 1ZP0B 4JPSA 1TS2A 1C77A 1FXIA 2XN9C 3P63A 4KGTA 4ARCA 2KACA 4MH8A 5G5HA 1L0YB 1FM0D 3SFDB 2M56B 2GI9A 4OW0A 2WXJA 1FNUA 4FXCA 1WXQA 3P4SB 3MFGA 1YN4A 1E9MA 1B1ZA 1KRHA 1EM7A 1TS4A 3P4QB 1SJED 1YMHE 3NS1A 1KH0A 1Y56A 3W2DA 2H89B 2LUMA 2WQYB 4JWSC 3EA6A 1CK1A 2INPE 4ZRQA 4OHJA 4N58A 1FD6A 1C4PA 1FXAA 4YSXB 1KF6B 4KX6B 2WDRB 1DOYA 3MHZA 3SEBA 1M4VA 4B0MA 5LNK1 1MI0A 4DXGA 2QJLA 3VR9B 1B9RA 4RFBA 3Q8CA 1XXGA 4KKJA 1MPEA 1JW9D 3U52E 1UGJA 2N9LA 2BBCA 2V3PA 4TSSA 2KWDA 2WXOA 2IJ0A 3AMZA 4MM3B 2X38A 3B9JA 2JXTA 3Q8EA 2LGIA 2CJOA 1ROEA 1TJEA 3AE7B 2BS2B 2QMTA 2V0GA 4IKGA 2QIEB 3VQIA 1VRAB 1SIJA 2BW2A 3NVVA 3BK1A 2PVOD 2OHFA 5HHDG 5H92C 2TSSA 3AE6B 4RGMA 2ZW1A 1D5MC 1J7CA 2K22A 1PUTA 2WU5B 3BYYB 3O13A 3AE2B 2W3SA 5D3DA 1VR9A 2WXQA 4HROA 2AQ2B 2IPKD 3MP9A 1D5ZC 4M0WA 1AW7A 2YEPF 1D4BA 1YJJA 1BUIC 1TYGB 4US8A 5FR3A 3P4RB 1N5WA 1I4QA 2WXMA 4OZCA 3DWMA 2PKOA 2ICIA 2GB1A 2KN4A 3BVMA 2FUG1 4YWGG 4A55A 3U4EG 5EE9A 3BVZA 1L6UA 1T3QA 4YSYB 4EE2A 1HEZE 2Q5WD 3TEYA 4XWTA 1TKYA 4XDDA 2KDMA 1J7AA 2BB5A 2J52A 3OWEB 1EWYC 1WRIA 3UI3A 1TZOA 1N61A 1V97A 3TUOA 1WGKA 3AB5A 1YQ3B 3TEWA 1JWBD 2L52A 2PLPA 3B2GA 1JRPA 1VZ7A 2N9KA 2WXPA 3R2TA 4NJCA 2CU3A 1D6EC 1C4CA 4YSZB 3VR8B 5BMIA 1QOGA 1QOFA 4L1BA 1RFKA 1C79A 1TS3A 2K9XA 4PT5A 3AEEB 2WLBA 1QF6A 2M0AA 2BYTA 2W54A 3ZJVA 3NVWA 1FMAD 1KLUD 3IXSA 1ACCA 1L0VB 4YTNB 1E6EB 2PW9A 1FFUA 5D3IB 1HZ5A 1VDVA 3P4PB 2D5GA 4XE0A 1E0ZA 4A6QA 1EU3A 1SEBD 2LEKA 2AQ3B 4HEA1 1QT9A 3AE1B 2RDGA 3BWUD 1ET9A 4AQ7A 1XF5L 1PGBA 1YNTE 4C80A 5MPOA 1CQVA 2WXKA 1D5XC 4WURA 5TSSA 2H88B 3KLSX 4GLSC 4XWWA 3T3OA 1QKZA 1JWAD 3R2IA 3SR6A 3AH7A 2QILA 3I9V1 2KAJA 1YQ4B 1SSNA 1OQRA 2VZKD 1V8CA 2RPVA 3HRDD 1JWMD 2KQ4X 1QILA 3NRZA 4ITKA 1PYWD 4NZLB 1JWUD 4MACA 2I38A 1LO5D 3AEBB 2YEPB 4RGOS 2B76B 5C2TB 1I4RA 2PIAA 1XLOA 4XDCA 1L4ZB 3EGRA 2WS3B 4MT5A 4US9A 1L5PA 2FBWB 2LHEA 3BZDB 3Q8BA 3CIRB 1P7FA 1FNWA 2PVGC 1MHXA 2AQ1B 1E7PB 1YN5A 4A90A 3NUHB 3W5VB 1VLBA 2JZPA 2ZW0A 4WIPA 3NZ3A 3GP7A 3ZGZA 3HVDA 1GAQB 2VZKB 3J9CA 2WXFA 1BMLC 4Q2JA 3Q8AA 4NAMA 5HI1A 2WXHA 3PO0A 1F0ZA 3NVZA 1SB3C 4R3DA 1FIQA 1NYQA 3TSSA 4RCOA 3FILA 1TS5A 1HQRD 4B0EA 1L0XB 2JX5A 1C4AA 1PDXA 5GXGB 1EWCA 2W55A 4WQMA 4RGNA 2PTLA 3AEFB 3PZ8A 1FEHA 2IGGA 5G5GA 1HA5A 3RPFC 3ABVB 1DYQA 1SE3A 3KWVA 2HTME 4TQ1A 1PGXA 2W82A 4JE3B 1NI3A 2Y5PA 2BS3B 4RNAA 4WAFA 3AE4B 2ONQA 1VZ6A 4H2AA 2L32A 2G9HD 1I7HA 2OEDA 1SE2A 4P16A 4WWMA 1ZXHA 3GS2A 1L6VA 1FFVA 3PZ7A 4ARIA 4HKZE 1L4DB 1XEEA 1ZDXA 2LFIA 4LLGM 2BT6A 5AUKA 1FCLA 3URYA 3N9YC 2MJEA 1TKGA 3W9CB 4NAWB 1JWSD 1QLBB 1IBXA 1FCCC 1IGDA 4N59A 2E6XA 1FNVA 3BIID 3LYYA 2IGDA 4WH4A 1UNSA 2EELA 2SEBD 1KTKA 3BK2A 3KQ4A 3ZJTA 1YJIA 2HDEA 3V05A 4TMAB 2J53A 4AS1A 5E6JA 3Q8FA 4A9AA 1HZ6A 2WP9B 5BMGA 4DQOC 1IGCA 1QOAA 1I4PA 1CZPA 1ZXIA 5FKAC 2LHDA 2J4XA 2JSVX 2JQRB 2QEJC 2Z8LA 4HRSA 4C7YA 1YN3A 4C7ZA 1F2RI 3AE9B 3DWGC 3IT6B 5EE0A 3IAS1 4P6VF 2JU6X 1IBXB 3FAHA 3U2SC 3ZYYX 2JYTA 4L2YA 1N63A 1NVID 2DLBA 4TQ0A 4JWUC 1FO4A 3CWIA 1WWTA 1GOZA 5AUIA 5BMHA 1UWXA 1PFDA 4ZHOA 3I57A 1IUEA 1AN8A 2DYOA 2WXIA 3LXFA 3V3XA 1K50A 1ENFA 2WXNA 1ESFA 1VZ8A 2WXRA 1UWMA 1FRDA 4YXDB 1SE4A 1KLGD 4IDIA 3VRAB 1NENB 2NTTA 1N5XA 2J42A 3BVGA 1I4HA 1Q10A 1BXTA 4UDUC 4GDLB 3GB1A 1A70A 5HFYA 2G1EA 1JALA 1TKEA 4IOIE 1SBBB 4YTMB 1RWSA 4KGSA 3B2FA 3LB8C 2V4IB 4YTPB 2MH7A 4O1NA 1F77A 2N0SB 1XCQL 3KWLA 1STEA 1NEKB 4RF0A 1JQ4A 5EE1A 3H8HA 2BS4B 2XNAC 4ZHPA 1K52A 1XLQA 3TEXA 4ZRPA 2QSDA 3RFZB 2Y3AA 1MVKA 4JX1C 2WDQB 5BYSA 1DOXA 4A8XC 4OVZA 1AWDA 4LK0M 4KGRA 3MJ5A 3AN1A 1QQRA 2DYMA 2WDVB 4HKQA 4OZAA 1HXYD 1V1OA 4CQNA 3SFEB 1I4XA 1JCKB 4C56C 3P42A 1ZOYB 5EE3A 2L1AA 2WXLA 3WCQA 4ZOHC 1GPXA 1P7EA 1R7SA 1GB4A 5D7GA 5JXVA 1J7BA 2PMVA 4YT0B 2E3TA 5BYQA 1MHHE 1RM6C 4RF1A 3AE3B 3TEZA 3AE8B 2K5PA 2DWQA 5C3JB 1ET6A 1AYFA 1SXTA 2JWUA 1EU4A 3ETRA 2IGHA 3C8YA 3AV8A 1T5XD 2MEKA 2M19A 1RYJA 2WU2B 1JMLA 2EKIA 1I4GA 3IAM1 3W1SA 1T6BX 1CJEA 2I2YA 3T3NA 3R8BA 2CJNA 4KKIA 1GB1A 2LJIA 2N7JA 3AECB 2LMCA 3BYTB 1V1PA 3P1MA 1ZDVA 1VJKA 3U7ZA 1UUPA 3W5UB 1K53A 3FC4A 5HG2A 3FILB 4RGTA 1DGJA 3E56A 3Q69A 4LTUA 3AM9A 5H8YE 4HJGE 4L23A 4J3OD 1OFFA 2KMMA 2WXGA 4D2KA 1ZUD2 1C76A 2K3UA 2ACZB 1C9FA 2R61A 2NMQA 1KFYB 1XO3A 2SAKA 1QOBA 3AEAB 4OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J3O D;  1ZDX A;  1ZE3 D;  4B0M A;  3RFZ B;  4B0E A;  1ZDV A;  3BWU D; 
#chains in the Genus database with same CATH topology
 1XLP A;  4IM3 A;  3RMK C;  2K0P A;  3AEG B;  1OEY J;  1WXS A;  1WSP A;  3L4P A;  4MGI E;  5FK9 C;  1WX7 A;  2INN E;  1KOT A;  4REZ A;  1WYG A;  3RI7 C;  1TY2 A;  2FE8 A;  1N60 A;  2KD0 A;  1E10 A;  2Y5C A;  1ZW7 A;  1F2R C;  1T0S C;  3R7R A;  3NVY A;  2RDH A;  3KUC B;  2K39 A;  5IOI A;  1XLN A;  3Q6B A;  1PGA A;  2KWV B;  5CX3 A;  3QCA A;  4DXF A;  1E7U A;  4II2 B;  3ZJU A;  3QK0 A;  4IWQ A;  3PTF C;  2AX5 A;  3UIP B;  1C77 A;  4KGT A;  3MTN B;  1MFW A;  5G5H A;  4A20 A;  1FM0 D;  2J0J A;  2WXJ A;  3ML8 A;  4FXC A;  3HIZ A;  4EFO A;  1S3S G;  1TS4 A;  3P4Q B;  1YMH E;  2K8B A;  4W9E A;  2M8S A;  3W2D A;  2H89 B;  4K81 A;  2LUM A;  3DVN V;  2ZCC A;  2NCN A;  2INP E;  1UD7 A;  4JWS C;  4ZRQ A;  4N58 A;  1FXA A;  4KX6 B;  2GLS A;  1V5T A;  3MHZ A;  5LNK 1;  1MI0 A;  3DBL I;  3RNG C;  3VR9 B;  1WGH A;  4RFB A;  1MPE A;  3N30 A;  2N9L A;  2BBC A;  2V3P A;  2WXO A;  4WJP A;  2D2Q A;  4WWO A;  3I5J C;  5IA7 A;  3Q8E A;  2L7R A;  3LDZ E;  1WM3 A;  2CJO A;  4GMV A;  1TJE A;  2MBE A;  1WYW B;  1RRB A;  2BS2 B;  1TBE A;  4IKG A;  2BW2 A;  2VRR B;  2PVO D;  4G0N B;  3QHT A;  2BKF A;  2TSS A;  2G3Q B;  4BZA A;  2DZI A;  1NI2 A;  3PRZ A;  3EEC A;  4PS8 A;  5IO9 A;  4HCP B;  1PUT A;  2FAZ A;  3O13 A;  3AE2 B;  4KIK A;  5D3D A;  1VR9 A;  3K9P B;  1D5Z C;  4M0W A;  4MSQ B;  4FBJ B;  5FR3 A;  1EUV B;  1H4R A;  2FNJ B;  5L83 A;  2WXM A;  3APC A;  2KN4 A;  2FUG 1;  3QAQ A;  3BVZ A;  1L6U A;  3PHX B;  4YSY B;  4HVB A;  1HEZ E;  4BBN C;  2KDM A;  3OWE B;  1R4N I;  3UI3 A;  1R4M I;  1V97 A;  3TUO A;  2MBH A;  3KUD B;  5E6N A;  2NBW B;  5C1Z A;  1IPG A;  2L52 A;  2PLP A;  1JRP A;  3VDZ A;  4M0W B;  1GC6 A;  1D6E C;  4YSZ B;  4FUL A;  1C79 A;  2K9X A;  4PT5 A;  2WX1 A;  2WLB A;  2M0A A;  2KC2 A;  4KDL B;  1FMA D;  3PLU A;  1L0V B;  3UIN B;  5D3I B;  1HZ5 A;  1VDV A;  1E0Z A;  3ZNH B;  3OG5 A;  3DCG A;  4HEA 1;  2FCQ A;  1QT9 A;  1ET9 A;  1PGB A;  4FHJ A;  4WUR A;  5TSS A;  3KLS X;  3T3O A;  3R2I A;  3AH7 A;  3EC8 A;  3WAO A;  3V61 A;  1OQR A;  2VZK D;  2KQ4 X;  1PYW D;  2KQS A;  3H7S A;  4GU2 A;  4NZL B;  1Q0W B;  1WI0 A;  2R2Q A;  4HLE A;  3MJW A;  4GB9 A;  2D10 A;  2KDI A;  2B76 B;  4XDC A;  2KTR A;  5D6J B;  3CIR B;  1FNW A;  2PVG C;  1T0Y A;  3PRM B;  1RFA A;  2C7H A;  4A90 A;  3NUH B;  3VAW A;  2ZW0 A;  4EUT A;  4WIP A;  4WQO B;  2KO3 A;  1GAQ B;  2VZK B;  3KYC D;  4Q2J A;  4HCN B;  2HJ1 A;  2JPH A;  3Q8A A;  2WXH A;  3PO0 A;  3JW0 X;  2WYQ A;  1FIQ A;  5JZE B;  3O65 B;  4NAW A;  2IY0 B;  3FIL A;  4RCO A;  3ZDM C;  1HQR D;  4B0E A;  2KC1 A;  1EWC A;  2W55 A;  4NNJ B;  2PTL A;  3AEF B;  2IGG A;  1JRU A;  2KTR B;  3RPF C;  3ABV B;  1SE3 A;  3KWV A;  3DOW A;  2ZNV C;  4RNA A;  2BS3 B;  2L32 A;  3ENE A;  3L08 A;  3PT2 B;  4BOS C;  3GS2 A;  1L6V A;  4ARI A;  4HKZ E;  3VHT C;  1ZDX A;  2C5L C;  2LFI A;  1OEY A;  1FCL A;  2ZNV B;  3ZIM A;  2MW5 A;  2MJE A;  3W9C B;  4NAW B;  1JWS D;  1IBX A;  4N59 A;  2E6X A;  1GNU A;  2IGD A;  1KTK A;  3BK2 A;  1YJI A;  5IN7 A;  3V05 A;  4AS1 A;  3DBH B;  2LUE A;  2CHW A;  4DQO C;  4G11 A;  4M8M A;  1IGC A;  4I6P A;  4C00 A;  4W9K A;  5FKA C;  2RPQ A;  5D94 A;  4GDL A;  2N9P C;  4LNK A;  2IO1 B;  1OGW A;  4C7Y A;  3DWG C;  1IBX B;  3H6N A;  3DHH C;  4L2Y A;  1N63 A;  4TQ0 A;  3N1X C;  4JWU C;  1WWT A;  3KW5 B;  4WJQ A;  2WXI A;  3LXF A;  3V3X A;  4K3C A;  2GBN A;  1KLG D;  4WJO A;  2NTT A;  1J8C A;  3APF A;  1N5X A;  4PYU A;  2DAJ A;  3WA0 A;  2J42 A;  3GOE A;  1Q10 A;  4UDU C;  4JQW C;  4GDL B;  1E8X A;  3ZVV A;  4YTM B;  4O1N A;  2MCN B;  1F77 A;  4FAD A;  2XNA C;  3BY4 B;  1XLQ A;  3TEX A;  4EZK A;  2WDQ B;  1WGG A;  3PPA A;  1DOX A;  3TMP B;  4BFR A;  4OVZ A;  4ACF A;  3V6E B;  1K8R B;  2KDF B;  1RLF A;  4OZA A;  1P1A A;  4ICU A;  1I4X A;  1EO6 A;  3H7P A;  3P42 A;  5EE3 A;  2AEH A;  1GB4 A;  4E71 A;  3A33 B;  1J7B A;  2IZV B;  2JUO A;  3TEZ A;  4FJV B;  2C7M B;  2K6D B;  4ICV A;  2NBV B;  1T5X D;  2KJH B;  4M00 A;  3IAM 1;  2MQJ A;  2I2Y A;  3M63 B;  2CJN A;  4KKI A;  3BYT B;  1UUP A;  1AAR A;  1WJ6 A;  3H7P B;  5HG2 A;  4MSM B;  4LTU A;  3E56 A;  3DVG Y;  2UWQ A;  3PRP B;  4IW0 A;  4HJG E;  2L76 A;  4NQK E;  1WXM A;  4HK2 A;  4E74 A;  1YJ1 A;  2R61 A;  1C9F A;  1KFY B;  4JLC A;  5CTR C;  1NDD A;  2EKE C;  4OZB A;  1HTO A;  2MA9 B;  5I4D A;  4GDK A;  1JRO A;  2MJ3 A;  1K51 A;  4K7W A;  5DPT A;  2PJH A;  4AWJ A;  3MC0 B;  1ZPS A;  2KJR A;  2DBY A;  2JYE A;  2L83 A;  2JT4 B;  3GZN I;  5G55 A;  2BVC A;  2GBK A;  4MJS A;  1XD3 B;  2CS4 A;  2RGF A;  5T8I A;  2V3N A;  3ZQ4 A;  2ZZP B;  1C3T A;  1WH3 A;  3L0W B;  3QA8 A;  5BYR A;  2W3R A;  3R7Q A;  1OQQ A;  3S2A A;  2ZVO A;  2KJ6 A;  1FRR A;  1SF0 A;  4HPL B;  4GDK B;  1SJH D;  3EUB 2;  2BB6 A;  3A4R A;  2LD9 A;  1TS2 A;  2QC8 A;  3DPD A;  2LGX A;  4OW0 A;  4MJS B;  3MFG A;  1E9M A;  4HDQ A;  1B1Z A;  3L16 A;  1EM7 A;  2K8H A;  1SJE D;  4W9F A;  4BBN F;  4DWF A;  4W9H A;  2MBQ A;  3SEB A;  1M4V A;  1TT5 B;  2KYW A;  1F1H A;  1JW9 D;  4TSS A;  2IJ0 A;  3AMZ A;  2FIF A;  1TIF A;  4PS3 A;  2NPT A;  2KLC A;  5HKH A;  2N7E A;  1N6Z A;  5D2M B;  1ROE A;  1P9D U;  4IC7 B;  2GBM A;  2QMT A;  1UGM A;  3BK1 A;  3PS6 A;  3DBR I;  3TIX A;  4XGA B;  1D5M C;  3SU8 X;  1LFD A;  3BIN A;  3W1Y A;  2WU5 B;  1KJT A;  3RNB C;  3BYY B;  4B95 A;  2W3S A;  3NS8 A;  4HRO A;  2AQ2 B;  3HHM A;  2JRI B;  3MP9 A;  1AW7 A;  1XQQ A;  2LWP A;  1WM2 A;  1D4B A;  3CSF A;  2L0T A;  2FCM A;  3EHV A;  4US8 A;  3Q3F A;  3TJP A;  4DHZ E;  1N5W A;  2M17 A;  3ZLZ A;  4OZC A;  3DWM A;  2PKO A;  3ZKJ C;  1J0G A;  2EMS A;  2GB1 A;  3BVM A;  3X0W A;  1SGH A;  2N9E B;  3WAM A;  1T3Q A;  2GOW A;  4XWT A;  3SDL C;  2J52 A;  2LRW A;  1EWY C;  2REX A;  3K9O B;  3U30 A;  2KDE B;  3IFW B;  1WGK A;  1GC7 A;  2PE6 B;  3TEW A;  1WZ0 A;  3VUX A;  1VZ7 A;  3UQA A;  4BOZ B;  3PV1 A;  2BQQ A;  2WXP A;  2V4L A;  4EZL A;  1SIF A;  3DBS A;  5BMI A;  3RNC C;  1QOG A;  4L1B A;  1Z5S B;  4HPP A;  3UIO B;  3NOB A;  2A5U A;  2W54 A;  3PLV A;  2BF8 B;  3IXS A;  1FFU A;  3P4P B;  3SD5 A;  3JVZ X;  1SEB D;  1I35 A;  3AE1 B;  1XF5 L;  5MPO A;  4XYC A;  2HE7 A;  2WXK A;  2MHJ A;  2WHI A;  1WY8 A;  2DAF A;  4XWW A;  3A9K A;  3VXW A;  2QDF A;  3ZUN A;  2D3C A;  5J17 A;  1ISN A;  1V8C A;  2RPV A;  4WJN A;  4PYZ A;  2KMA A;  2KK8 A;  3AEB B;  2YEP B;  5C2T B;  3B0A A;  2WS3 B;  2D3B A;  3NZS A;  4BKS D;  2BYE A;  4MEM A;  1YN5 A;  1YOV B;  1VLB A;  3OLM D;  3ZGZ A;  3GP7 A;  3HVD A;  1WFY A;  1T0Q C;  4DXA B;  3J9C A;  1WMH A;  3A9K B;  2KX3 A;  4DHJ D;  2WXF A;  2IYD B;  1MG4 A;  3EFU A;  3AI5 A;  2OJW A;  3TSS A;  1TS5 A;  1L0X B;  2JX5 A;  1PDX A;  5GXG B;  4RGN A;  3PZ8 A;  1FEH A;  3OJ4 B;  3ZTC A;  4XX5 A;  4P7I A;  4S0R A;  1FXT B;  4TQ1 A;  1PGX A;  3QX1 A;  2I1K A;  1NI3 A;  4WAF A;  3AE4 B;  4X57 B;  2M0X A;  1I7H A;  2OED A;  1SE2 A;  4P16 A;  1NBF C;  1WMH B;  1FFV A;  3NJT A;  1L4D B;  1XEE A;  2BT6 A;  1EF1 A;  3N9Y C;  3RN9 C;  1UBQ A;  1V2Y A;  3BII D;  4LJP B;  4AUQ C;  2D3A A;  2OOB B;  2LAS A;  3DVN U;  2EEL A;  4KIK B;  3KQ4 A;  2HDE A;  4TMA B;  4XC2 A;  1KLV A;  2J0K A;  2XEW A;  1V86 A;  3C19 A;  5E6J A;  2LXA A;  3Q8F A;  2DZJ A;  2WP9 B;  5BMG A;  4CHK A;  2IY1 B;  2BYF A;  3DDC B;  2LHD A;  2LGY A;  2J4X A;  3L17 A;  2QEJ C;  1WF9 A;  4C7Z A;  2L0F A;  1F2R I;  3AE9 B;  3U7D A;  4P6V F;  5FR6 A;  3FAH A;  3ZNI D;  1FO4 A;  3CWI A;  2R2O A;  1YD8 U;  4TKN A;  5AUI A;  3RZF A;  2G4S A;  1UWX A;  1PFD A;  3WIM A;  1IUE A;  2DYO A;  1WRD B;  3IHP C;  1WZ3 A;  2HJ8 A;  4LCD E;  3VTU A;  4JGH B;  2L00 B;  3B1L X;  4OVV A;  2G1E A;  1RWS A;  4KGS A;  4KDI C;  2V4I B;  3L10 B;  2N0S B;  2K8C A;  3KWL A;  1STE A;  1NEK B;  3H8H A;  3M62 B;  3RFZ B;  2C7N B;  4WAA A;  2FUH B;  2B3A A;  1RAX A;  5DPR A;  3LJ3 A;  4LK0 M;  2GMI C;  3RYT A;  4I6L B;  4LNI A;  1YIW A;  3DQV A;  2DYM A;  2WDV B;  4HKQ A;  2NS5 A;  1V1O A;  1JCK B;  3CF6 E;  4C56 C;  2A4Z A;  2WXL A;  4E3C A;  3Q3M C;  4ZOH C;  1P7E A;  1WJN A;  5D7G A;  4A3O A;  4ZDV A;  2E3T A;  5LXI B;  1AYF A;  3ZXR A;  1EU4 A;  1Z2M A;  3C8Y A;  3AV8 A;  2MEK A;  3PGE A;  5DPW A;  1I4G A;  2LRU A;  1CJE A;  2IO3 B;  1WJU A;  2RR9 A;  1UBI A;  3NZU A;  1WGR A;  2N7J A;  3AEC B;  3N3K B;  1V1P A;  1G6J A;  1VJK A;  3DVG X;  2ZPN A;  4KZ0 A;  2O6V A;  3FIL B;  4RGT A;  3Q69 A;  5H8Y E;  4J3O D;  4JL9 A;  4D2K A;  2O6V D;  4NPN A;  3ZNG C;  4ZRJ A;  3OJ3 A;  4MGZ E;  3RNE C;  3MC8 A;  2HTH A;  2RMM A;  1DOI A;  2IDY A;  2MJD A;  4FN2 A;  1V1P B;  4NJ7 A;  2GRI A;  2HD5 B;  1E5W A;  2O6V B;  2W9N A;  3IBE A;  2KT7 A;  2IBI B;  4RMA A;  4ZYN A;  1PQS A;  1N62 A;  4BAX A;  1C78 A;  1NYR A;  1XCT L;  4RH6 A;  1TY0 A;  3IT4 B;  3AED B;  4ZYS A;  4CO7 A;  4K7S A;  2FID A;  1FXI A;  2XN9 C;  1WGD A;  3CST A;  4KZC A;  4CYE A;  2MSE D;  4GOC A;  1L0Y B;  3SFD B;  1WXV A;  5CHV C;  2GI9 A;  4FLH A;  1WXQ A;  3P4S B;  5GMV A;  2I1J A;  4URK A;  3SHQ A;  3ML9 A;  4MH0 E;  4MDK E;  1KH0 A;  1Y8R C;  2WQY B;  1CK1 A;  2KWU B;  5G2N A;  1E8Z A;  1KF6 B;  4K7U A;  2BGF A;  1LGR A;  2KDB A;  2KTF A;  5KHO A;  2QJL A;  3L54 A;  1XXG A;  4KKJ A;  1UGJ A;  4FA6 A;  2JVC A;  2KWD A;  3B9J A;  2JXT A;  3JYU A;  2RSU A;  2LGI A;  4P1B C;  3AE7 B;  1MG8 A;  2VH2 A;  2QIE B;  4DK5 A;  1SIJ A;  3AE6 B;  3CMM B;  4GIV A;  2ZW1 A;  1J7C A;  4EEW A;  5DPS A;  2K22 A;  3R66 C;  5E6P A;  3N1Z C;  3QIJ A;  2WDT B;  3ZTD A;  2V1Y A;  2YEP F;  1MJD A;  1YJJ A;  1WR6 E;  3P4R B;  4JIO U;  3NHE B;  3PRE A;  1I4Q A;  3DBH I;  2ICI A;  2CHZ A;  4YWG G;  3U4E G;  2L3Z A;  2MBB B;  4EE2 A;  2V3S A;  4ANW A;  3TEY A;  4LJO B;  1J7A A;  2BB5 A;  1GJZ A;  4IWP A;  2CR5 A;  2RDB C;  4HPM B;  4HXD A;  2N1V A;  1N61 A;  1LM8 B;  1JWB D;  3RT3 B;  3L13 A;  1UEL A;  2N9K A;  3Q14 C;  3R2T A;  4NJC A;  4DDI D;  3OAW A;  1C4C A;  4HDO A;  4W9G A;  3VR8 B;  1QOF A;  2KXJ A;  1RFK A;  5KHQ A;  1TS3 A;  1E7V A;  1XT9 B;  3A4S C;  3AEE B;  3PHW B;  2LZ6 A;  2BYT A;  3NVW A;  1KLU D;  1ACC A;  2LVO A;  3V62 A;  4XE0 A;  4P1C C;  1EU3 A;  2LEK A;  2AQ3 B;  2RDG A;  3AU4 A;  4AQ7 A;  4F1S A;  1YNT E;  3ZO5 B;  4C80 A;  4LNN A;  4HJK A;  4IG7 B;  1JWA D;  4ASW C;  1YQ4 B;  1F9J A;  1SSN A;  1JWM D;  1QIL A;  3C0R B;  3NRZ A;  5AEK B;  4ITK A;  2ZVN A;  1E8W A;  1IYF A;  1JWU D;  4MAC A;  1I4R A;  2PIA A;  1XLO A;  3KVF B;  3EGR A;  4YL8 A;  4MT5 A;  1WR1 A;  2FBW B;  3BZD B;  5BO4 B;  1CMX B;  1MHX A;  2AQ1 B;  1E7P B;  2MLB A;  3ZNZ B;  2ZEQ A;  3UF8 A;  3VH3 B;  2VH1 A;  3VVW B;  3DBL B;  4C4V A;  5HI1 A;  3NVZ A;  1OTR B;  4R3D A;  1NYQ A;  3D32 A;  1V6E A;  2KWC A;  5AZF A;  2D11 A;  1DYQ A;  4PS7 A;  5LXH A;  2C60 A;  4JE3 B;  2Y5P A;  5J2R A;  2ONQ A;  4H2A A;  4A3P A;  2NPT B;  2V9H A;  4WWM A;  3PVL A;  3PZ7 A;  4C4V B;  5AUK A;  1YX5 B;  5JH5 C;  4FJZ A;  2IND C;  3UQB A;  1IGD A;  2N9X A;  1FNV A;  3W1S C;  1UNS A;  1E90 A;  3M95 A;  1IP9 A;  4AJY B;  1L7Y A;  2DHZ A;  2KNB A;  2J53 A;  3UGB B;  3H1U A;  4M8N A;  5IP4 D;  3V60 A;  3I3T B;  1R4N B;  1R4M B;  1QOA A;  1GG3 A;  1ZXI A;  1KM7 A;  2QHO A;  4AP4 C;  2D3G A;  2JSV X;  4W9L A;  3N20 C;  2KHW B;  2Z8L A;  3IT6 B;  3IAS 1;  2JU6 X;  2PEA A;  3ZYY X;  4TV3 A;  2Z0E B;  3HM3 A;  2LXC A;  2LGD A;  2KMC A;  1TGZ B;  5J18 A;  2G4D B;  3I57 A;  1AN8 A;  4IUM B;  3TL5 A;  2K6Q A;  2WXN A;  2MWS B;  3WAL A;  2WXR A;  1UWM A;  1SE4 A;  4G3X B;  3VRA B;  1NEN B;  3T9L A;  2EMT A;  3IVF A;  3RD2 A;  4RM9 A;  3BVG A;  1I4H A;  4QAY A;  1BXT A;  1P0R A;  1TKE A;  4IOI E;  4XZ4 A;  4BKS A;  2GBR A;  1XCQ L;  1WE6 A;  2KKC A;  4FHK A;  4RF0 A;  1JQ4 A;  1J19 A;  4PK1 A;  2Y3A A;  3VTW A;  2JY6 A;  3ECI A;  4GN1 A;  4A8X C;  4ANV A;  1M94 A;  3MJ5 A;  2UYZ B;  2N1W A;  4AOF A;  4CQN A;  3SFE B;  2LI5 A;  3ZRF A;  4LNF A;  4MEL A;  1T0R C;  4M01 A;  1UF0 A;  2CKH B;  1GPX A;  1R7S A;  1VCB A;  1OQY A;  4IM0 A;  4YT0 B;  5BYQ A;  1MHH E;  2JZZ A;  5C3J B;  2K5P A;  2DWQ A;  1ET6 A;  1SXT A;  3ETR A;  4AJW A;  2IGH A;  3WAP A;  3HM6 X;  4F7Z A;  1WJ4 A;  2IO2 B;  3IG3 A;  4DHJ B;  2WU2 B;  4B9K A;  1T6B X;  2KLG A;  4TUU A;  1TTN A;  2YVC A;  1GB1 A;  5LLI A;  4EKU A;  5C23 A;  2KOX A;  1F52 A;  3U7Z A;  3T8M A;  1K53 A;  3DHG C;  3FC4 A;  1L2N A;  4GSW A;  1DGJ A;  3AM9 A;  4L23 A;  1WIA A;  5AZG A;  4II3 B;  2X8X X;  2FCN A;  1QOB A;  1V5O A;  5CHW A;  2KN5 A;  2WNM A;  3AE5 B;  1P3Q U;  3AUL A;  3HVZ A;  3V6C B;  2NVU I;  2NTS A;  2OJR A;  3QQ8 B;  3E9S A;  3P2B A;  2ZCB A;  4N6E B;  1ZE3 D;  2JRH A;  3GE3 C;  4M02 A;  3H9D A;  2BTE A;  3N1Y C;  4K3B A;  2NBU A;  4W9C A;  2Y5B B;  4MGK E;  2XBB C;  4I6N B;  5JHB A;  2DEN B;  4USA A;  2ON8 A;  3VRB B;  3HUI A;  4W9D A;  1ZP0 B;  2K25 A;  4JPS A;  1EF5 A;  2CU1 A;  4ARC A;  3P63 A;  2KAC A;  4MH8 A;  1WX8 A;  1A5R A;  3A1Q A;  2M56 B;  4ZRI A;  4EZJ A;  2QCZ A;  4MM3 A;  1FNU A;  5L95 C;  3B08 A;  1YN4 A;  4LNO A;  4BKG A;  4ANX A;  1KRH A;  2LVP A;  3KUZ A;  3NS1 A;  3RNA C;  1FPY A;  1Y56 A;  2BPS A;  2JXX A;  3EA6 A;  1Q1O A;  4GXB A;  4OHJ A;  1FD6 A;  2PE9 A;  1C4P A;  4YSX B;  2WDR B;  1DOY A;  3PZD A;  4B0M A;  4DXG A;  1B9R A;  3Q8C A;  3U52 E;  1WX9 A;  3A1Q B;  4MM3 B;  2ASQ A;  2X38 A;  3ONS A;  2UU7 A;  1V81 A;  2JF5 A;  5CHF A;  3JSV A;  2V0G A;  3VQI A;  1VRA B;  3NVV A;  2RD0 A;  2OHF A;  5HHD G;  5H92 C;  4RGM A;  4G50 A;  3NY5 A;  3Q2A C;  3KH0 A;  2WXQ A;  3MC9 A;  2WGS A;  2IPK D;  4OVU A;  1BUI C;  1TYG B;  2M4N A;  4F8C B;  2AL6 A;  2MRP A;  3JSV B;  1C1Y B;  4A55 A;  5EE9 A;  4IM2 A;  2DZK A;  3ZRC A;  2Q5W D;  4NQL B;  1TKY A;  4XDD A;  4BKT A;  1LQB A;  3QWZ B;  3RNF C;  4B6W A;  1WRI A;  1TZO A;  2AYO B;  3VH4 B;  4KSL C;  4S17 A;  3AB5 A;  1YQ3 B;  2IO0 B;  3B2G A;  3VUY A;  1UH6 A;  2Z59 B;  3FKY A;  5E6O A;  2CU3 A;  1HE8 A;  2L8J A;  3DHI C;  4ZRK A;  2FCS A;  4J6I A;  3HK0 A;  2KZR A;  3GZN B;  1UZX B;  3RUI B;  3I63 C;  2DZM A;  2KAN A;  2KQ7 A;  2INC C;  1QF6 A;  3ZJV A;  3QC8 B;  3VFK A;  2LVQ A;  4YTN B;  1YX6 B;  1E6E B;  2PW9 A;  4KSK C;  2D5G A;  4LDT D;  4A6Q A;  3BWU D;  1E8Y A;  1CQV A;  1D5X C;  2H88 B;  4GLS C;  1V49 A;  1QKZ A;  3SR6 A;  2QIL A;  3I9V 1;  2KAJ A;  5DCN A;  2N7D A;  1H8C A;  5IAA C;  2N4F A;  2KVZ A;  3HRD D;  3A9J A;  4MGY E;  3PSE B;  2BKR B;  3QAR A;  5AZH A;  4LDT B;  3X23 A;  2I38 A;  1LO5 D;  4RGO S;  4US9 A;  1L4Z B;  1L5P A;  2LHE A;  3Q8B A;  1P7F A;  3ZW3 A;  3W5V B;  2JZP A;  3NZ3 A;  4GGQ A;  1BML C;  2KX0 A;  4NAM A;  1F0Z A;  1SB3 C;  4IWO A;  1V9J A;  3A9J B;  2PPH A;  1GUA B;  1YQB A;  1P98 A;  1TZ1 A;  2MX2 A;  1U4A A;  1VD2 A;  1C4A A;  1X1M A;  4WQM A;  5G5G A;  1HA5 A;  1V80 A;  2KVR A;  3QJZ A;  2HTM E;  4RM8 A;  2DX5 B;  2W82 A;  3DBR B;  3Q3N C;  1VZ6 A;  3Q3O C;  3RUL A;  2G9H D;  2J0M A;  3RCZ A;  1ZXH A;  4WWN A;  2NR2 A;  4LLG M;  3N32 A;  3URY A;  1TKG A;  1QLB B;  1FCC C;  3GE8 C;  2WX0 A;  3LYY A;  5IKC M;  4WH4 A;  2ZJD A;  2SEB D;  3ZJT A;  3RZW C;  2ZPY A;  4KV2 A;  3WAN A;  1WE7 A;  4A9A A;  2MP2 A;  1HZ6 A;  5JHA A;  1I4P A;  1CZP A;  2D07 B;  4NY0 A;  2BYV E;  2JQR B;  4FJY A;  4HRS A;  1YN3 A;  4BVU C;  5EE0 A;  3U2S C;  2JYT A;  2DYB A;  2DLB A;  1NVI D;  1LXD A;  1GOZ A;  5BMH A;  2Z0D B;  4ZHO A;  1BT0 A;  2LGS A;  1K50 A;  3ZXV A;  1ENF A;  3R3M A;  2M1M A;  2MP2 B;  4K1R B;  1ESF A;  1VZ8 A;  3VTV A;  2G45 B;  1FRD A;  4YXD B;  4IDI A;  1SE9 A;  3EFC A;  4DHZ B;  4HWI B;  2MBO A;  2L05 A;  3M3J A;  2JZ3 B;  2WWZ A;  3KYD D;  3GB1 A;  1A70 A;  5HFY A;  1JAL A;  4EOY A;  1SBB B;  4DDG D;  2KFK A;  2JWZ A;  2O2V A;  3B2F A;  3LB8 C;  4YTP B;  5EDS A;  2MH7 A;  2DNF A;  2AWT A;  4W9J A;  5EE1 A;  3TBL D;  2BWF A;  2BS4 B;  2YLM A;  1WGY A;  4ZHP A;  1K52 A;  2J7Q B;  4NJ6 A;  4ZRP A;  1ZKH A;  2QSD A;  3NG0 A;  4ANU A;  1MVK A;  2LJ5 A;  4JX1 C;  5BYS A;  1S1Q B;  1WXA A;  1AWD A;  4KGR A;  4WWP A;  3AU5 A;  3AN1 A;  1QQR A;  1HXY D;  1ZOY B;  2L1A A;  4W9I A;  3WCQ A;  2XK5 A;  5JXV A;  2KFK B;  2PMV A;  2O2V B;  2AL3 A;  1RM6 C;  4RF1 A;  3AE3 B;  3MHS D;  3AE8 B;  1QZE A;  2JWU A;  2C9W B;  4KVG B;  2M19 A;  2BWE S;  2GBJ A;  3APD A;  3U8Z A;  2CHX A;  1RYJ A;  1Q5W B;  1JML A;  2EKI A;  3W1S A;  3T3N A;  3R8B A;  4N9F 4;  3Q3J A;  3VUW A;  2K1F A;  2LJI A;  2LMC A;  3P1M A;  1ZDV A;  5TR5 A;  3W5U B;  1ZGU B;  3AXC A;  4DBG A;  1I42 A;  2XK5 B;  1OFF A;  2KMM A;  2WXG A;  1HTQ A;  1ZUD 2;  1C76 A;  2K3U A;  2ACZ B;  2NMQ A;  1XO3 A;  2SAK A;  2KFJ A;  3ZDT A;  3ALB A;  3AEA B;  1D3Z A;  3TCA A; 
#chains in the Genus database with same CATH homology
 1XLP A;  5I4D A;  2WNM A;  2K0P A;  3AE5 B;  3AEG B;  1JRO A;  2MJ3 A;  1K51 A;  1WSP A;  3L4P A;  2RMM A;  1DOI A;  2IDY A;  3HVZ A;  3MC0 B;  5FK9 C;  1ZPS A;  2L83 A;  2DBY A;  2JYE A;  2NTS A;  2INN E;  4REZ A;  1WYG A;  2MJD A;  1V1P B;  1TY2 A;  2FE8 A;  3E9S A;  1N60 A;  2GRI A;  1E10 A;  5T8I A;  2V3N A;  4N6E B;  3ZQ4 A;  2Y5C A;  1ZE3 D;  1F2R C;  5BYR A;  2W3R A;  1OQQ A;  3NVY A;  2RDH A;  2BTE A;  1XLN A;  1N62 A;  1FRR A;  1PGA A;  1SF0 A;  1C78 A;  1NYR A;  1XCT L;  4DXF A;  4RH6 A;  4USA A;  2ON8 A;  1TY0 A;  3VRB B;  3ZJU A;  4GDK B;  1SJH D;  3IT4 B;  3EUB 2;  3AED B;  4ZYS A;  3HUI A;  2BB6 A;  2AX5 A;  1ZP0 B;  4JPS A;  1TS2 A;  1C77 A;  1FXI A;  2XN9 C;  3P63 A;  4KGT A;  4ARC A;  2KAC A;  4MH8 A;  5G5H A;  1L0Y B;  1FM0 D;  3SFD B;  2M56 B;  2GI9 A;  4OW0 A;  2WXJ A;  1FNU A;  4FXC A;  1WXQ A;  3P4S B;  3MFG A;  1YN4 A;  1E9M A;  1B1Z A;  1KRH A;  1EM7 A;  1TS4 A;  3P4Q B;  1SJE D;  1YMH E;  3NS1 A;  1KH0 A;  1Y56 A;  3W2D A;  2H89 B;  2LUM A;  2WQY B;  4JWS C;  3EA6 A;  1CK1 A;  2INP E;  4ZRQ A;  4OHJ A;  4N58 A;  1FD6 A;  1C4P A;  1FXA A;  4YSX B;  1KF6 B;  4KX6 B;  2WDR B;  1DOY A;  3MHZ A;  3SEB A;  1M4V A;  4B0M A;  5LNK 1;  1MI0 A;  4DXG A;  2QJL A;  3VR9 B;  1B9R A;  4RFB A;  3Q8C A;  1XXG A;  4KKJ A;  1MPE A;  1JW9 D;  3U52 E;  1UGJ A;  2N9L A;  2BBC A;  2V3P A;  4TSS A;  2KWD A;  2WXO A;  2IJ0 A;  3AMZ A;  4MM3 B;  2X38 A;  3B9J A;  2JXT A;  3Q8E A;  2LGI A;  2CJO A;  1ROE A;  1TJE A;  3AE7 B;  2BS2 B;  2QMT A;  2V0G A;  4IKG A;  2QIE B;  3VQI A;  1VRA B;  1SIJ A;  2BW2 A;  3NVV A;  3BK1 A;  2PVO D;  2OHF A;  5HHD G;  5H92 C;  2TSS A;  3AE6 B;  4RGM A;  2ZW1 A;  1D5M C;  1J7C A;  2K22 A;  1PUT A;  2WU5 B;  3BYY B;  3O13 A;  3AE2 B;  2W3S A;  5D3D A;  1VR9 A;  2WXQ A;  4HRO A;  2AQ2 B;  2IPK D;  3MP9 A;  1D5Z C;  4M0W A;  1AW7 A;  2YEP F;  1D4B A;  1YJJ A;  1BUI C;  1TYG B;  4US8 A;  5FR3 A;  3P4R B;  1N5W A;  1I4Q A;  2WXM A;  4OZC A;  3DWM A;  2PKO A;  2ICI A;  2GB1 A;  2KN4 A;  3BVM A;  2FUG 1;  4YWG G;  4A55 A;  3U4E G;  5EE9 A;  3BVZ A;  1L6U A;  1T3Q A;  4YSY B;  4EE2 A;  1HEZ E;  2Q5W D;  3TEY A;  4XWT A;  1TKY A;  4XDD A;  2KDM A;  1J7A A;  2BB5 A;  2J52 A;  3OWE B;  1EWY C;  1WRI A;  3UI3 A;  1TZO A;  1N61 A;  1V97 A;  3TUO A;  1WGK A;  3AB5 A;  1YQ3 B;  3TEW A;  1JWB D;  2L52 A;  2PLP A;  3B2G A;  1JRP A;  1VZ7 A;  2N9K A;  2WXP A;  3R2T A;  4NJC A;  2CU3 A;  1D6E C;  1C4C A;  4YSZ B;  3VR8 B;  5BMI A;  1QOG A;  1QOF A;  4L1B A;  1RFK A;  1C79 A;  1TS3 A;  2K9X A;  4PT5 A;  3AEE B;  2WLB A;  1QF6 A;  2M0A A;  2BYT A;  2W54 A;  3ZJV A;  3NVW A;  1FMA D;  1KLU D;  3IXS A;  1ACC A;  1L0V B;  4YTN B;  1E6E B;  2PW9 A;  1FFU A;  5D3I B;  1HZ5 A;  1VDV A;  3P4P B;  2D5G A;  4XE0 A;  1E0Z A;  4A6Q A;  1EU3 A;  1SEB D;  2LEK A;  2AQ3 B;  4HEA 1;  1QT9 A;  3AE1 B;  2RDG A;  3BWU D;  1ET9 A;  4AQ7 A;  1XF5 L;  1PGB A;  1YNT E;  4C80 A;  5MPO A;  1CQV A;  2WXK A;  1D5X C;  4WUR A;  5TSS A;  2H88 B;  3KLS X;  4GLS C;  4XWW A;  3T3O A;  1QKZ A;  1JWA D;  3R2I A;  3SR6 A;  3AH7 A;  2QIL A;  3I9V 1;  2KAJ A;  1YQ4 B;  1SSN A;  1OQR A;  2VZK D;  1V8C A;  2RPV A;  3HRD D;  1JWM D;  2KQ4 X;  1QIL A;  3NRZ A;  4ITK A;  1PYW D;  4NZL B;  1JWU D;  4MAC A;  2I38 A;  1LO5 D;  3AEB B;  2YEP B;  4RGO S;  2B76 B;  5C2T B;  1I4R A;  2PIA A;  1XLO A;  4XDC A;  1L4Z B;  3EGR A;  2WS3 B;  4MT5 A;  4US9 A;  1L5P A;  2FBW B;  2LHE A;  3BZD B;  3Q8B A;  3CIR B;  1P7F A;  1FNW A;  2PVG C;  1MHX A;  2AQ1 B;  1E7P B;  1YN5 A;  4A90 A;  3NUH B;  3W5V B;  1VLB A;  2JZP A;  2ZW0 A;  4WIP A;  3NZ3 A;  3GP7 A;  3ZGZ A;  3HVD A;  1GAQ B;  2VZK B;  3J9C A;  2WXF A;  1BML C;  4Q2J A;  3Q8A A;  4NAM A;  5HI1 A;  2WXH A;  3PO0 A;  1F0Z A;  3NVZ A;  1SB3 C;  4R3D A;  1FIQ A;  1NYQ A;  3TSS A;  4RCO A;  3FIL A;  1TS5 A;  1HQR D;  4B0E A;  1L0X B;  2JX5 A;  1C4A A;  1PDX A;  5GXG B;  1EWC A;  2W55 A;  4WQM A;  4RGN A;  2PTL A;  3AEF B;  3PZ8 A;  1FEH A;  2IGG A;  5G5G A;  1HA5 A;  3RPF C;  3ABV B;  1DYQ A;  1SE3 A;  3KWV A;  2HTM E;  4TQ1 A;  1PGX A;  2W82 A;  4JE3 B;  1NI3 A;  2Y5P A;  2BS3 B;  4RNA A;  4WAF A;  3AE4 B;  2ONQ A;  1VZ6 A;  4H2A A;  2L32 A;  2G9H D;  1I7H A;  2OED A;  1SE2 A;  4P16 A;  4WWM A;  1ZXH A;  3GS2 A;  1L6V A;  1FFV A;  3PZ7 A;  4ARI A;  4HKZ E;  1L4D B;  1XEE A;  1ZDX A;  2LFI A;  4LLG M;  2BT6 A;  5AUK A;  1FCL A;  3URY A;  3N9Y C;  2MJE A;  1TKG A;  3W9C B;  4NAW B;  1JWS D;  1QLB B;  1IBX A;  1FCC C;  1IGD A;  4N59 A;  2E6X A;  1FNV A;  3BII D;  3LYY A;  2IGD A;  4WH4 A;  1UNS A;  2EEL A;  2SEB D;  1KTK A;  3BK2 A;  3KQ4 A;  3ZJT A;  1YJI A;  2HDE A;  3V05 A;  4TMA B;  2J53 A;  4AS1 A;  5E6J A;  3Q8F A;  4A9A A;  1HZ6 A;  2WP9 B;  5BMG A;  4DQO C;  1IGC A;  1QOA A;  1I4P A;  1CZP A;  1ZXI A;  5FKA C;  2LHD A;  2J4X A;  2JSV X;  2JQR B;  2QEJ C;  2Z8L A;  4HRS A;  4C7Y A;  1YN3 A;  4C7Z A;  1F2R I;  3AE9 B;  3DWG C;  3IT6 B;  5EE0 A;  3IAS 1;  4P6V F;  2JU6 X;  1IBX B;  3FAH A;  3U2S C;  3ZYY X;  2JYT A;  4L2Y A;  1N63 A;  1NVI D;  2DLB A;  4TQ0 A;  4JWU C;  1FO4 A;  3CWI A;  1WWT A;  1GOZ A;  5AUI A;  5BMH A;  1UWX A;  1PFD A;  4ZHO A;  3I57 A;  1IUE A;  1AN8 A;  2DYO A;  2WXI A;  3LXF A;  3V3X A;  1K50 A;  1ENF A;  2WXN A;  1ESF A;  1VZ8 A;  2WXR A;  1UWM A;  1FRD A;  4YXD B;  1SE4 A;  1KLG D;  4IDI A;  3VRA B;  1NEN B;  2NTT A;  1N5X A;  2J42 A;  3BVG A;  1I4H A;  1Q10 A;  1BXT A;  4UDU C;  4GDL B;  3GB1 A;  1A70 A;  5HFY A;  2G1E A;  1JAL A;  1TKE A;  4IOI E;  1SBB B;  4YTM B;  1RWS A;  4KGS A;  3B2F A;  3LB8 C;  2V4I B;  4YTP B;  2MH7 A;  4O1N A;  1F77 A;  2N0S B;  1XCQ L;  3KWL A;  1STE A;  1NEK B;  4RF0 A;  1JQ4 A;  5EE1 A;  3H8H A;  2BS4 B;  2XNA C;  4ZHP A;  1K52 A;  1XLQ A;  3TEX A;  4ZRP A;  2QSD A;  3RFZ B;  2Y3A A;  1MVK A;  4JX1 C;  2WDQ B;  5BYS A;  1DOX A;  4A8X C;  4OVZ A;  1AWD A;  4LK0 M;  4KGR A;  3MJ5 A;  3AN1 A;  1QQR A;  2DYM A;  2WDV B;  4HKQ A;  4OZA A;  1HXY D;  1V1O A;  4CQN A;  3SFE B;  1I4X A;  1JCK B;  4C56 C;  3P42 A;  1ZOY B;  5EE3 A;  2L1A A;  2WXL A;  3WCQ A;  4ZOH C;  1GPX A;  1P7E A;  1R7S A;  1GB4 A;  5D7G A;  5JXV A;  1J7B A;  2PMV A;  4YT0 B;  2E3T A;  5BYQ A;  1MHH E;  1RM6 C;  4RF1 A;  3AE3 B;  3TEZ A;  3AE8 B;  2K5P A;  2DWQ A;  5C3J B;  1ET6 A;  1AYF A;  1SXT A;  2JWU A;  1EU4 A;  3ETR A;  2IGH A;  3C8Y A;  3AV8 A;  1T5X D;  2MEK A;  2M19 A;  1RYJ A;  2WU2 B;  1JML A;  2EKI A;  1I4G A;  3IAM 1;  3W1S A;  1T6B X;  1CJE A;  2I2Y A;  3T3N A;  3R8B A;  2CJN A;  4KKI A;  1GB1 A;  2LJI A;  2N7J A;  3AEC B;  2LMC A;  3BYT B;  1V1P A;  3P1M A;  1ZDV A;  1VJK A;  3U7Z A;  1UUP A;  3W5U B;  1K53 A;  3FC4 A;  5HG2 A;  3FIL B;  4RGT A;  1DGJ A;  3E56 A;  3Q69 A;  4LTU A;  3AM9 A;  5H8Y E;  4HJG E;  4L23 A;  4J3O D;  1OFF A;  2KMM A;  2WXG A;  4D2K A;  1ZUD 2;  1C76 A;  2K3U A;  2ACZ B;  1C9F A;  2R61 A;  2NMQ A;  1KFY B;  1XO3 A;  2SAK A;  1QOB A;  3AEA B;  4OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...