2KQSA

Phosphorylation of sumo-interacting motif by ck2 enhances daxx sumo binding activity
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, apoptosis
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kqsA00
2LZ6A 4MSQB 4WQOB 4HCPB 1WR6E 2LGXA 1TZ1A 1XQQA 2KTRA 2RR9A 4J6IA 4RM8A 4EUTA 2LRWA 4GDLA 4WAAA 4B95A 5JHAA 5BO4B 2G4DB 2BYVE 3PGEA 3BY4B 2ZPNA 3QQ8B 5DCNA 2ZCBA 2C60A 3WANA 1Q5WB 4DHZB 2ZEQA 1D3ZA 2Z0DB 4RMAA 2GBNA 1EO6A 2MBQA 2ZPYA 3JVZX 1WR1A 3VTUA 5LXIB 4B9KA 1SIFA 2MP2A 4LDTD 1RLFA 3VUWA 2MW5A 2L0FA 3WALA 3ZNHB 1LQBA 2KD0A 3R66C 4KSLC 1ZGUB 2N1WA 2FAZA 3PV1A 4PS3A 3IG3A 2K39A 1IPGA 2DYMA 1ZKHA 4HDOA 5CHWA 3T8MA 3R7QA 2YVCA 2KJRA 3QAQA 3CMMB 4HVBA 3B1LX 3M62B 4IM3A 4NNJB 5CHVC 3GOEA 1LXDA 1IP9A 1E7VA 2MX2A 3RZFA 2N9XA 2KN5A 1WJNA 3M3JA 1C3TA 1Q0WB 3KUCB 2LGDA 4AJWA 2NS5A 2DZIA 3VUYA 4EOYA 4LJPB 2JUOA 2GBKA 4HPMB 2BWES 5E6OA 1WM2A 4PS7A 3PHXB 4AWJA 1CMXB 5LXHA 2JRHA 5C23A 2D2QA 1SE9A 2DZJA 2FIFA 2IO1B 3UQAA 1E8WA 2KFJA 3VTWA 3APCA 3QJZA 3OLMD 4KDIC 3ZKJC 5J17A 3HM6X 4EEWA 2C7NB 1PQSA 3ALBA 3U7DA 4FBJB 4W9LA 1NI2A 3L08A 4B6WA 4W9JA 3HM3A 3VHTC 1RRBA 4BBNC 2M1MA 2PEAA 4FA6A 2HTHA 4GSWA 3NHEB 1WIAA 3BINA 2PE9A 1WMHB 3H9DA 3L17A 3ZRFA 3SU8X 4ZRJA 4HJKA 1WZ3A 5D6JB 5D94A 3LJ3A 3RULA 2KK8A 2KWVB 1ISNA 2JRIB 4WWOA 4IW0A 2KANA 4M8MA 4KV2A 3RZWC 3ML9A 3GZNI 2OOBB 3A4RA 2JPHA 2L0TA 3A9KA 4DK5A 3B0AA 2KX3A 2G45B 2K1FA 4MELA 4BKSD 3O65B 1JRUA 2FIDA 4WJQA 2KDFB 2K6QA 2LRUA 3PTFC 2B3AA 3NS8A 3U30A 4NQLB 5DPSA 4AUQC 2IYDB 1NDDA 2O6VA 1SGHA 3NY5A 1P1AA 4ICUA 2KVRA 2O2VB 4CO7A 1YX6B 2D10A 2A5UA 3V6EB 2AL6A 5DPWA 4BOSC 2R2QA 4W9GA 1Y8RC 3DDCB 4MM3A 3L13A 4XC2A 1WX7A 4XX5A 3U8ZA 1KM7A 2LVOA 4AOFA 2GMIC 2LD9A 4E71A 4HLEA 2KC2A 3N30A 3P2BA 1S3SG 3V60A 3QCAA 4MJSB 1L7YA 1QZEA 1P0RA 1WGRA 4EFOA 3M95A 2DENB 2K6DB 2RD0A 2L8JA 3EECA 3EFUA 1R4NI 2KKCA 4MEMA 3VDZA 3VH3B 4AP4C 3A33B 4JIOU 2LJ5A 3EHVA 2HD5B 1I42A 4NJ7A 2XEWA 3OJ4B 1YIWA 4LCDE 4TKNA 1LFDA 2AEHA 4IG7B 4BKSA 1BT0A 2KFKB 2V3SA 2N4FA 3VAWA 3MJWA 5JZEB 2ZVOA 1V6EA 4G3XB 3AULA 4BVUC 1P3QU 4FJYA 2MBBB 2DAFA 3TCAA 3ZIMA 5AZFA 4EZLA 3SDLC 5JHBA 3RT3B 2W9NA 1HE8A 3DOWA 2XK5B 2A4ZA 2QHOA 3QIJA 3PT2B 1TBEA 4FJZA 2LXCA 2M8SA 3TL5A 2RSUA 4MGZE 4FULA 2DZKA 4FN2A 4FADA 4A3OA 2LVPA 1V5OA 5E6NA 2PPHA 3CF6E 2KC1A 3IBEA 3DBRI 2UWQA 1I35A 2C9WB 2IBIB 1WM3A 3IVFA 2NBUA 3ECIA 5D7GA 3UF8A 1V9JA 2WYQA 3UIPB 1UH6A 4CYEA 2FNJB 4I6LB 4KVGB 2K25A 1OQYA 1V49A 3AU4A 3HHMA 5CX3A 4NAWA 4M8NA 1WYWB 2CKHB 3H7SA 2CS4A 4ZRIA 2LASA 5L83A 1WX8A 3QWZB 2V4LA 4WWNA 2KTRB 4TV3A 1GG3A 4GDLB 2N1VA 4IWQA 1FXTB 2BYFA 4WJNA 5J2RA 2LI5A 2EMSA 4BFRA 3MHSD 3H7PA 4GN1A 1R4MI 1YQBA 2D11A 1J19A 3A1QB 2JXXA 2WWZA 4K7UA 4WJPA 4GIVA 3AI5A 4WWPA 1WGGA 4GXBA 3JYUA 3DPDA 1YX5B 5HKHA 3OAWA 5IA7A 2KOXA 3KUDB 3IFWB 1GC6A 2FCSA 1WF9A 1U4AA 1KLVA 1G6JA 4GOCA 5GMVA 2WX1A 4HWIB 1UBIA 4MSMB 2J7QB 4W9FA 4NPNA 2HJ8A 3DVGY 2DZMA 2KMCA 5G55A 3SD5A 5TR5A 3VUXA 1WXSA 2NPTB 2L76A 1UGMA 1Z2MA 3KUZA 3QC8B 2DAJA 2K8HA 3A9JA 3KVFB 2KX0A 3RYTA 2MRPA 5EDSA 4HK2A 2WDTB 4NJ6A 3ZDMC 1F9JA 1AARA 2V1YA 4PYUA 1EUVB 5E6PA 1TTNA 3OJ3A 4W9IA 3PRMB 1UZXB 1WE6A 2BYEA 2J0JA 2ZZPB 2KO3A 4A3PA 3UQBA 1GUAB 2KQSA 4DXAB 4ANWA 1GNUA 3NZUA 3I3TB 2C7MB 1IYFA 4GGQA 3ZNID 2Z59B 3PHWB 3TJPA 2ZNVB 1WE7A 2YLMA 4KIKA 4CHKA 1L2NA 1P9DU 2MSED 4MGKE 3VVWB 2L05A 4F8CB 2N7EA 5G2NA 2NR2A 3PRZA 4GDKA 1WY8A 2KNBA 3JSVA 1XD3B 1C1YB 4P7IA 4K7WA 4ANXA 2NVUI 3ZRCA 3PLUA 3ZUNA 1E8YA 3W1YA 4JQWC 4DHJB 3ZNGC 1VD2A 3WAMA 1Q1OA 2M17A 2LXAA 2FCMA 2XBBC 3H6NA 4RM9A 4E74A 3PVLA 4MJSA 4EZKA 3KYDD 1X1MA 3VXWA 4N9F4 2JF5A 2KDIA 3EC8A 3WIMA 4URKA 1P98A 3M63B 3DBSA 2RPQA 3HK0A 5C1ZA 3JW0X 2ZJDA 1OEYA 5KHQA 4KDLB 4G11A 4G0NB 2NCNA 2KZRA 3NOBA 2IZVB 4BBNF 5CTRC 4JLCA 1YJ1A 4IWPA 4II3B 3WAPA 2ASQA 4NY0A 2JT4B 2O6VB 3WAOA 3B08A 2NBWB 4GB9A 2BWFA 2XK5A 3S2AA 2LVQA 2C5LC 3DBHI 3L0WB 4OVUA 4M0WB 2DYBA 3CSFA 2CU1A 1M94A 2BPSA 1J8CA 4W9KA 2KDBA 1WXAA 2M0XA 5LLIA 2JY6A 4FHKA 3DVNV 4AJYB 4XZ4A 2BGFA 4K1RB 1WH3A 1GJZA 3APFA 3DQVA 1K8RB 4MGYE 2M4NA 3HIZA 3K9OB 2N9EB 1J0GA 1TGZB 3R7RA 3DBLI 2MBHA 1OTRB 2BF8B 3UGBB 2K8BA 1LM8B 2IO3B 2KJ6A 3K9PB 3KH0A 3KW5B 4JGHB 4FLHA 4HPLB 3PZDA 1A5RA 1T0YA 2KQ7A 2MQJA 3Q3FA 1WXMA 2CR5A 4K7SA 2KLGA 2CHXA 2KMAA 2G3QB 1E8XA 2GBJA 2IY0B 1E8ZA 3N32A 4PYZA 1WGHA 5AZHA 3A1QA 2IO2B 4FJVB 3RCZA 1WRDB 1NBFC 4G50A 3QX1A 4GMVA 2KTFA 3W1SC 1WXVA 2AYOB 3ENEA 2Y5BB 3VH4B 3PRPB 2ZVNA 3QARA 2GBMA 4ANVA 2OJRA 3VTVA 3X23A 2K8CA 4ASWC 2IY1B 3R3MA 1H8CA 2MP2B 4W9DA 3QK0A 3T9LA 5J18A 3ZDTA 2MA9B 4ICVA 4NAWB 2KHWB 4FHJA 3ZTDA 2NPTA 4WJOA 3VFKA 1WGYA 2HE7A 2PE6B 4ANUA 2N7DA 4X57B 3ZVVA 3A4SC 3UIOB 4EZJA 1RAXA 3IHPC 4OVVA 5IAAC 3Q3JA 1WZ0A 2D3GA 2LWPA 2UYZB 3N3KB 4IC7B 4IUMB 4GU2A 3DCGA 3UINB 3NZSA 4DHZE 3L54A 1S1QB 2CHWA 3H7PB 4MH0E 3TBLD 2KDEB 4DHJD 1KJTA 1E7UA 3PPAA 2EKEC 4EKUA 2D07B 4II2B 4PS8A 1WMHA 2AL3A 1V86A 2JZZA 2L7RA 3ML8A 2L3ZA 3RD2A 2R2OA 3ONSA 3LDZE 4YL8A 1WJ6A 5DPTA 2KJHB 3X0WA 1XT9B 1EF1A 3CSTA 4LDTB 5L95C 1KOTA 1WGDA 4BKTA 2PJHA 5AEKB 1WJ4A 1RFAA 2DYOA 2MWSB 4F1SA 5D2MB 2RGFA 3C0RB 1WFYA 2MLBA 3DVGX 4KZCA 5JH5C 1EF5A 2J0MA 4HDQA 2REXA 3A9JB 4LJOB 4HXDA 2FUHB 3ZNZB 2KLCA 2WX0A 2BKFA 2LUEA 3TMPB 2O6VD 3RUIB 3V62A 3ZTCA 1UBQA 1YD8U 2I1JA 4IM0A 1V2YA 4K81A 1OEYJ 2LGYA 2DX5B 4TQ1A 4DDGD 3PLVA 2GBRA 2I1KA 2O2VA 1H4RA 3WA0A 4DWFA 3VQIA 3L10B 3PS6A 2ZNVC 1ZW7A 5AZGA 4MDKE 2C7HA 3D32A 4W9EA 1Z5SB 1V5TA 3PSEB 3V6CB 4TUUA 2G4SA 1VCBA 5DPRA 4ZYNA 2KWCA 3DVNU 1GC7A 1WJUA 4DBGA 2BKRB 2JWZA 2Z0EB 4KIKB 2MCNB 2MBOA 4JL9A 2ZCCA 4KZ0A 4ZRKA 3A9KB 4F7ZA 3ZO5B 2KFKA 3ZW3A 5FR6A 2EMTA 2L00B 2VRRB 4GDKB 3L16A 3JSVB 2DHZA 5CHFA 5KHOA 4E3CA 3H1UA 2NBVB 1V80A 2JVCA 2FCQA 3QHTA 3V61A 1WX9A 4NQKE 4KSKC 3TIXA 1UD7A 2CHZA 3AU5A 2JZ3B 2KXJA 4HCNB 4ZDVA 2MBEA 2IO0B 1E90A 4IWOA 4A20A 4I6PA 1MG8A 4BKGA 4I6NB 4DDID 3KYCD 1OGWA 3PREA 3QA8A 1WI0A 4BOZB 3APDA 4TQ0A 2GOWA 2J0KA 1UELA 3AXCA 4MGIE 4W9CA 3W1SA 4IM2A 3SHQA 3MTNB 4W9HA 1V81A 2N9PC 2KWUB 2AWTA 2FCNA 3ZLZA 1E5WA
chains in the Genus database with same CATH superfamily
2LZ6A 4MSQB 4WQOB 4HCPB 2LGXA 1TZ1A 1XQQA 4RM8A 2LRWA 4FXCA 5JHAA 3PGEA 1QT9A 4XWWA 1D4BA 2WGSA 2WP9B 3U52E 3WANA 1Q5WB 4DHZB 1JRPA 1E10A 3AM9A 2GBNA 3IT4B 1EO6A 2KVZA 3HUIA 3JVZX 4B9KA 1EU3A 1LQBA 2KD0A 1ZGUB 2GRIA 3CMMB 3RNEC 3ETRA 5CHVC 3GOEA 2K5PA 2KN5A 3M3JA 1N5WA 1C3TA 3KUCB 2E6XA 2DZIA 3VUYA 2XN9C 3AV8A 2PMVA 4HPMB 3L4PA 3N9YC 1RWSA 1CJEA 1EWYC 2D2QA 1SE9A 1RYJA 2OJWA 1E8WA 3VTWA 4OW0A 3Q14C 3OLMD 5J17A 3HM6X 1PQSA 3U7DA 1VLBA 1NI2A 1FEHA 2OHFA 3Q3OC 2M1MA 3E9SA 3J9CA 2H89B 2WXRA 3H9DA 3L17A 1YJJA 3LJ3A 3RULA 2KK8A 3KWVA 2KQ4X 4M8MA 3GZNI 2OOBB 3I63C 3A4RA 3IXSA 2SEBD 2ON8A 1NEKB 2FE8A 3MC9A 3E56A 2B3AA 3NS8A 3U30A 5DPSA 2JU6X 3BVMA 4B0EA 2KVRA 2PVGC 5DPWA 2AL6A 4BOSC 2R2QA 4W9GA 1Y8RC 1KM7A 3P2BA 3V60A 3W9CB 3AB5A 2PLPA 1L7YA 1P0RA 3LB8C 2RD0A 4MEMA 4JIOU 2YEPF 3OJ4B 1YIWA 3SR6A 4LCDE 4LK0M 1LFDA 2AEHA 4IG7B 4BKSA 1BT0A 3VAWA 1TT5B 3PO0A 1V6EA 4G3XB 3AULA 1P3QU 4XDCA 2WXOA 1JW9D 1HE8A 3QIJA 3PT2B 1TBEA 4FJZA 2LXCA 2M8SA 2K3UA 1J7BA 2LVPA 1V5OA 3AEGB 1RFKA 2C9WB 2IBIB 3IVFA 3ECIA 2IGDA 3UF8A 1V9JA 1PUTA 1V1PB 2WYQA 1UH6A 2VZKB 3I5JC 4I6LB 1OQYA 3AU4A 3KLSX 1VRAB 2HDEA 3Q3MC 2LASA 5L83A 4C56C 4WWNA 1BXTA 4TV3A 3GZNB 4R3DA 5BYRA 2G9HD 5J2RA 1YQ3B 3TSSA 3H7PA 2D11A 4HJGE 1J19A 4RH6A 3Q2AC 3AI5A 1WGGA 2WXGA 3H8HA 2WXIA 3DPDA 2KOXA 5FR3A 2RDGA 2PTLA 1QF6A 5EE9A 2FCSA 2G1EA 3AECB 5LNK1 1UBIA 4NPNA 2HJ8A 3Q8FA 5G55A 3VUXA 3P1MA 2NPTB 2RDHA 2KX0A 5EDSA 1K50A 1AWDA 3R2IA 4NJ6A 1E0ZA 1MI0A 4PYUA 1EUVB 2X8XX 1WE6A 2BYEA 2J0JA 4C7ZA 5T8IA 1FCCC 4YTNB 4ZRPA 2C7MB 4JPSA 1DOYA 3TJPA 4XE0A 4N6EB 4MGKE 1FRRA 2L05A 2NR2A 4GDKA 1C1YB 4ANXA 2NVUI 1E8YA 3ZNGC 3ABVB 2JZPA 4EZKA 4B0MA 1FXIA 2JF5A 2KDIA 3EC8A 4URKA 1FD6A 4LLGM 2ZJDA 4KDLB 2KZRA 3DHGC 1XLPA 2WXPA 4BBNF 1YJ1A 4P1CC 5H92C 3WAOA 4GB9A 3VRAB 2LVQA 3DBHI 3L0WB 4OVUA 3OG5A 2M0XA 1F2RI 2INDC 4XZ4A 4OHJA 1GJZA 4K1RB 2M4NA 3HIZA 3K9OB 1TGZB 3R7RA 3UGBB 1IGDA 1LM8B 3KH0A 1J7CA 2QDFA 3KQ4A 4FLHA 4HPLB 3OWEB 1WRIA 1FMAD 1A5RA 1T0YA 2KQ7A 4CQNA 1WXMA 3N32A 2GBJA 4PYZA 1E8ZA 3A1QA 2IO2B 2DNFA 1F77A 3RCZA 4YTMB 1NBFC 3EFCA 1WXVA 2WU5B 2Y5BB 3P42A 2ZVNA 2GBMA 5TSSA 4ANVA 2OJRA 3MC0B 1YN4A 2IJ0A 2W3SA 3GB1A 1CZPA 4RGMA 3N1ZC 4A6QA 4EZJA 3UIOB 2WNMA 1RAXA 4OVVA 3Q3JA 3N3KB 3UINB 4IUMB 2QIEB 3L54A 4DHJD 1UF0A 3PPAA 2D07B 4PS8A 1WMHA 2AL3A 2JZZA 2HJ1A 2WXLA 1SIJA 2L3ZA 1MHHE 3RD2A 2Y3AA 3DBHB 3ONSA 4YL8A 5BYQA 4NJCA 2H88B 1KOTA 3T3NA 2LFIA 4RNAA 1FM0D 1ZXHA 5JXVA 5D2MB 1EM7A 2RGFA 3C0RB 1LO5D 4KGSA 4PK1A 1DGJA 2WX0A 2LUEA 1ESFA 3ZTCA 4DXGA 1YD8U 2Y5PA 4NZLB 1ACCA 4TQ1A 2I1KA 2O2VA 2PIAA 1ENFA 3L10B 4HRSA 4ITKA 2QSDA 2ZNVC 5AZGA 3AE2B 1CK1A 4A55A 1Z5SB 1V5TA 1R4MB 5I4DA 2K22A 1FFUA 4YT0B 2KWCA 4OZBA 4QAYA 2Y5CA 3TEWA 1YQ4B 3ZW3A 2VRRB 3GP7A 3L16A 2W82A 2QCZA 2NBVB 4YXDB 2FCQA 4KSKC 2CHZA 4HCNB 2KXJA 2IO0B 1I7HA 4IWOA 4I6PA 2BS3B 4BKGA 1Y56A 1OGWA 1SJHD 3PREA 2KYWA 3APDA 3P4SB 4P16A 3NG0A 1FXAA 1QOBA 1UELA 3AXCA 4W9CA 3W1SA 4ARCA 4IM2A 2V0GA 4W9HA 2X38A 1V81A 2FCNA 3ZXRA 3ZLZA 1WR6E 4EUTA 2KTRA 1FO4A 4GDLA 4B95A 1V97A 2BYVE 2ACZB 3QQ8B 2C60A 3SEBA 1D3ZA 2Z0DB 3W5UB 1TS2A 3MFGA 2K0PA 3ZQ4A 1RLFA 3VUWA 2MW5A 3HRDD 1XEEA 2N1WA 2FAZA 3MHZA 1L0YB 5HI1A 4LNNA 2KJRA 4YSYB 1LXDA 1FNWA 2BB5A 3NVWA 1WJNA 4GLSC 2NS5A 4LJPB 2GBKA 3N1YC 2MEKA 5E6JA 4AWJA 1CMXB 5LXHA 4XDDA 2JRHA 4ZHOA 2DZJA 3V3XA 2BVCA 2RMMA 3EGRA 1FFVA 3QJZA 1PGXA 4KDIC 3R2TA 3ZKJC 3L08A 4W9JA 3AE6B 3VHTC 3DBLB 1P7FA 3FKYA 4OZCA 2PEAA 4FA6A 1T0SC 1WIAA 3ZRFA 3SU8X 5BMHA 4ZRJA 4HJKA 5D6JB 2J52A 2IGHA 2L32A 1ISNA 2JRIB 1KH0A 1N5XA 1T0QC 4KV2A 3RZWC 2UU7A 1KLUD 2WXHA 2K1FA 1FRDA 4D2KA 4BKSD 1TKEA 4WJQA 2LRUA 2K6QA 3O13A 4YTPB 1SGHA 3NY5A 3T3OA 4CO7A 2A5UA 1NI3A 3DDCB 4MM3A 3L13A 4XC2A 4XX5A 1IBXB 2GMIC 2KC2A 2MJ3A 1HTOA 4M00A 2DENB 3EFUA 2JX5A 2KKCA 1YMHE 4AP4C 2LJ5A 3EHVA 1SE3A 2BQQA 1QLBB 4OZAA 2KFKB 2N4FA 4UDUC 5JZEB 1VZ8A 4BVUC 2PVOD 3TCAA 3ZIMA 5JHBA 2A4ZA 2QHOA 4C80A 4A3OA 3CF6E 3DBRI 1ZUD2 1AYFA 1UGJA 4CYEA 3IT6B 4KVGB 1V49A 3HHMA 5CX3A 4NAWA 4M8NA 3H7SA 2JSVX 4REZA 2KN4A 5HHDG 1FXTB 2BYFA 1TS3A 2EMSA 4BFRA 2CU3A 2WWZA 4GIVA 4WWPA 4GXBA 1HXYD 1B1ZA 3OAWA 5IA7A 1FNVA 1K51A 3KUDB 1GC6A 3LXFA 4LNIA 4ACFA 3RFZB 2DZMA 3SD5A 3Q8CA 3B2GA 1Z2MA 3A9JA 4HK2A 1F9JA 2INCC 2MJEA 2V1YA 5E6PA 3URYA 3OJ3A 1F2RC 3C8YA 1ZDXA 2GLSA 1C76A 1GNUA 1XF5L 2K9XA 3U7ZA 4DXFA 1IYFA 2Z59B 3DBRB 2WXJA 2ZNVB 1VZ6A 1L2NA 2LGSA 3VVWB 3AE8B 2WXQA 4F8CB 1QQRA 3FILA 2AX5A 3JSVA 1XD3B 2DBYA 3PLUA 4WAFA 1JWBD 2LHDA 1YJIA 3CIRB 2M17A 3VRBB 2FCMA 2XBBC 3ZJUA 4E74A 3ZXVA 1X1MA 1QILA 2BT6A 2WDQB 3DWMA 3DBSA 2IDYA 4HROA 1OEYA 4G11A 1T0RC 4G0NB 5C2TB 4C4VA 5CTRC 3AE7B 4II3B 2ASQA 4RGNA 2JT4B 2WDRB 3B08A 3C19A 4M0WB 3CSFA 2CU1A 2BPSA 4W9KA 1D6EC 2BGFA 1WH3A 3AE9B 1D5ZC 1JWMD 4US9A 1VR9A 4MGYE 3ZGZA 2V4IB 1UWMA 2N9EB 2MBHA 5G5HA 3AE5B 2K8BA 2IPKD 4NAMA 2AQ2B 4JGHB 2CR5A 4K7SA 1I4HA 2KMAA 2IY0B 2FUG1 1WRDB 2BS2B 3QX1A 3W1SC 2W3RA 4RF1A 2AYOB 1L5PA 2M19A 5G5GA 3NRZA 1L4ZB 2MP2B 5J18A 4PT5A 3SFDB 2MA9B 4ICVA 2NPTA 3VFKA 2HE7A 4ANUA 3Q8AA 5IAAC 4IC7B 3TEXA 3NZSA 3H7PB 3ZYYX 4MH0E 3TBLD 2KDEB 4AS1A 5H8YE 1R7SA 1N63A 2D3BA 1E7PB 1WJ6A 3ZJTA 5DPTA 3CSTA 5HG2A 1WJ4A 2DYOA 4F1SA 4RGTA 2WXKA 1WFYA 3AEAB 3DVGX 3VR9B 4P1BC 1EF5A 1F1HA 4LJOB 2REXA 2KLCA 3V62A 1SSNA 2O6VD 2PW9A 1UBQA 1ZP0B 1JROA 3Q8EA 1STEA 1V2YA 4K81A 2LGYA 2DX5B 4EE2A 1BUIC 1HZ5A 1ZW7A 4Q2JA 3NUHB 4M01A 4MDKE 2C7HA 4OVZA 4W9EA 2G4SA 5DPRA 1Q10A 1UWXA 4S17A 1GC7A 2JWZA 1L4DB 4ZRKA 3A9KB 5C3JB 4GDKB 5BMGA 2I2YA 1V80A 3QHTA 3V61A 1WX9A 4ZDVA 1UD7A 3AU5A 1WGKA 1E90A 2WU2B 1MG8A 4DDID 2KWDA 4I6NB 3KYCD 3QA8A 1WI0A 4BOZB 2KACA 3NS1A 2LJIA 1SF0A 2J0KA 1MJDA 3MTNB 2N9PC 2I38A 2KWUB 2L83A 1SB3C 4IKGA 2VH1A 2RR9A 5BO4B 2QEJC 3BY4B 5IN7A 4S0RA 2ZEQA 2ZPYA 2JYTA 1QOAA 1SIFA 4LDTD 4A8XC 3CWIA 3R66C 1ET9A 3PV1A 4PS3A 2K39A 1ZKHA 4HDOA 3R7QA 2V3PA 2YVCA 3QAQA 4HVBA 3M62B 4IM3A 4NNJB 1IP9A 4KX6B 1E7VA 2MX2A 3HVDA 4XWTA 1KFYB 1T3QA 1Q0WB 2LGDA 4AJWA 2JUOA 3V05A 2BWES 5E6OA 1CQVA 5C23A 5EE0A 1I4XA 3UQAA 2KFJA 1PFDA 4JWUC 5GXGB 3ALBA 4FBJB 1ZDVA 1MPEA 1PYWD 4B6WA 2M56B 3BVZA 3NJTA 4BBNC 4O1NA 2HTHA 4GSWA 1LGRA 1J7AA 2PE9A 1WMHB 2WXFA 2KWVB 4WWOA 1YN5A 2KANA 5HFYA 2JPHA 4DK5A 1MG4A 3O65B 2J4XA 1WYGA 2KDFB 4AUQC 2IYDB 2O6VA 3RNBC 1N6ZA 1P1AA 3KWLA 4ICUA 2O2VB 1YX6B 1FNUA 1WX7A 3MP9A 2LVOA 2LD9A 1YN3A 3N30A 1S3SG 2KAJA 4MJSB 1QZEA 3M95A 3EECA 1R4NI 3VDZA 3A33B 1C9FA 1KRHA 2HD5B 4NJ7A 4TKNA 3GE3C 2SAKA 2V3SA 2EKIA 2ZVOA 1F0ZA 5AZFA 1TS5A 3SDLC 1C79A 3RT3B 2W9NA 2XK5B 4A9AA 4MGZE 1EU4A 2DZKA 4FN2A 4FADA 2KC1A 3IBEA 1HZ6A 2UWQA 1I35A 1WM3A 2INNE 2CJOA 5D7GA 3UIPB 2FNJB 2K25A 4RF0A 3QWZB 2V4LA 3GS2A 2KTRB 4GDLB 4IWQA 4XGAB 4WJNA 2ONQA 1F52A 1YQBA 2RPVA 1K52A 2BTEA 2XNAC 2AQ3B 2RDBC 1TKGA 2QMTA 3IFWB 2BYTA 1U4AA 1G6JA 5GMVA 2WX1A 1TS4A 1WSPA 1JWAD 2J7QB 4W9FA 1I4PA 2KMCA 5TR5A 5D3IB 2D3CA 2DAJA 3RYTA 2MRPA 4K3CA 2BBCA 2JWUA 3IAM1 3PRMB 4XYCA 1UZXB 1HTQA 2YEPB 2KO3A 4A3PA 1GUAB 1V1OA 2BB6A 4DXAB 1M4VA 1WXQA 2QC8A 3NZUA 2TSSA 1SXTA 3PHWB 1KF6B 3Q6BA 1WE7A 4KIKA 1P9DU 2MSED 3I9V1 1PGBA 5IKCM 1TYGB 2N7EA 5G2NA 3PRZA 1WY8A 2KNBA 3P4RB 4K7WA 3ZRCA 3W1YA 4JQWC 4DHJB 1XLQA 3WAMA 1IBXA 3UI3A 2N9KA 3H6NA 4RM9A 3DWGC 3KYDD 4N9F4 2LMCA 1P98A 2V9HA 2VZKD 1QOFA 3JW0X 4N59A 3RNFC 5KHQA 2NCNA 1GB1A 2IZVB 3BYTB 1DOXA 1EWCA 3WAPA 1I4RA 2INPE 4C7YA 2NBWB 2C5LC 2DYBA 3RMKC 5LLIA 4HKQA 4FHKA 2M0AA 5BYSA 3APFA 3WCQA 1UUPA 1C4CA 3MC8A 1OTRB 2BF8B 1SE2A 1JQ4A 2IO3B 2KJ6A 3KW5B 4IOIE 2LHEA 3P4PB 3TUOA 3IAS1 2WXNA 4P6VF 3PZDA 5FK9C 2KLGA 1TKYA 2G3QB 5AZHA 4G50A 4ARIA 4AQ7A 1JMLA 3ENEA 3VH4B 4USAA 2ICIA 2KMMA 1P7EA 3VTVA 3X23A 2IY1B 1H8CA 3GE8C 4W9DA 1B9RA 5IP4D 3ZDTA 2ZW0A 2NTTA 4NAWB 4FHJA 3ZTDA 1WGYA 2PE6B 3ZVVA 3A4SC 1K53A 1VJKA 1WZ0A 2D3GA 2LWPA 1QOGA 1IUEA 1S1QB 2CHWA 3Q8BA 1KJTA 2VH2A 1IGCA 2EKEC 4EKUA 3AN1A 1V86A 2L7RA 3ML8A 1RM6C 3LDZE 3AEBB 1N60A 1OQQA 2KJHB 1XT9B 4WH4A 1WGDA 2PJHA 2D3AA 2MWSB 3P4QB 2MLBA 4KZCA 5JH5C 2J0MA 3A9JB 4HXDA 3RUIB 4IM0A 1MFWA 4JX1C 2GBRA 1ET6A 1H4RA 3RN9C 4DWFA 1XCTL 3PS6A 3NZ3A 4IDIA 2L1AA 1TZOA 3PSEB 1ZXIA 3V6CB 1NENB 4MT5A 3RI7C 4MH8A 3DVNU 1WJUA 2BKRB 2MCNB 2MBOA 4JL9A 2ZCCA 4KZ0A 3TEYA 4WQMA 2R61A 3ZO5B 2DLBA 2EMTA 3FILB 5FR6A 3BYYB 3JSVB 2DHZA 5CHFA 5KHOA 2N7JA 3H1UA 4M0WA 1I4GA 2BS4B 4KKJA 2JZ3B 3MJ5A 4A20A 3B9JA 1JALA 1GPXA 3BWUD 2GOWA 4TQ0A 1V1PA 2WLBA 3BIID 1FCLA 2L52A 1SJED 1TIFA 4C4VB 2J42A 4A90A 3U4EG 4J6IA 4WAAA 2G4DB 2ZPNA 5DCNA 4KGTA 2ZCBA 1T6BX 1C78A 4RMAA 5AUIA 2MBQA 3VTUA 5LXIB 1WR1A 2MP2A 2L0FA 3WALA 3ZNHB 1D5MC 1ZPSA 1C4AA 4KSLC 4WWMA 1N62A 3IG3A 1IPGA 2DYMA 2JXTA 1HQRD 5CHWA 3T8MA 3AE4B 3B1LX 2KDMA 2QJLA 3RZFA 2N9XA 4HPPA 4H2AA 3FAHA 2B76B 4RGOS 4EOYA 1E9MA 1WM2A 4PS7A 3PHXB 5AUKA 2FIFA 2IO1B 1TJEA 4WURA 3APCA 4ZOHC 3W5VB 1XO3A 3AE1B 4EEWA 2C7NB 3VR8B 2WDVB 4W9LA 1ZE3D 1L0XB 3HM3A 1RRBA 3NHEB 3TEZA 3BINA 1N61A 3AEEB 1XLOA 3DHHC 4M02A 5D94A 1WZ3A 3ZJVA 3B2FA 4RFBA 4IW0A 2LEKA 3ML9A 4KGRA 2L0TA 3A9KA 3BZDB 4L23A 3B0AA 2KX3A 2G45B 4MELA 3N1XC 1JRUA 4LNFA 2FIDA 3Q69A 3PTFC 4NQLB 1NDDA 2KT7A 1NVID 2J53A 3EA6A 2D10A 3V6EB 3BK2A 3U8ZA 2ZW1A 2Z8LA 4AOFA 4HLEA 4E71A 4JE3B 2MJDA 3QCAA 3AE3B 1WGRA 4EFOA 2K6DB 2MH7A 2L8JA 4TSSA 1L6UA 3VH3B 3EUB2 1YNTE 1I42A 2NMQA 1OQRA 2XEWA 3W2DA 3SFEB 1HEZE 5EE3A 3Q3NC 3MJWA 4FJYA 2MBBB 4WIPA 2DAFA 3AH7A 4EZLA 4US8A 3DOWA 3TL5A 2RSUA 4FULA 4MACA 5E6NA 3HVZA 2PPHA 2PKOA 2N9LA 2NBUA 4YSZB 4YWGG 1WYWB 2CKHB 4ZRIA 2CS4A 1E6EB 1XXGA 2W55A 3DHIC 1WX8A 1A70A 1GOZA 1FPYA 1GG3A 2N1VA 1L6VA 3BVGA 2LI5A 1KLGD 3MHSD 4GN1A 1R4MI 3A1QB 2JXXA 4K7UA 4WJPA 3NVVA 2GI9A 1BMLC 5FKAC 2N0SB 1NYQA 3JYUA 1YX5B 5HKHA 1PGAA 2LGIA 1WF9A 1KLVA 1TY2A 4GOCA 4L1BA 4HWIB 4MSMB 3DVGY 1XCQL 2WXMA 1WXSA 3KUZA 2L76A 1UGMA 3QC8B 1C77A 1OFFA 2K8HA 3KVFB 2JYEA 4DQOC 1MHXA 1GAQB 2WDTB 3RPFC 4KKIA 4JWSC 3ZDMC 1AARA 2BW2A 1PDXA 4ZRQA 1TTNA 4W9IA 1VZ7A 4LNKA 2ZZPB 3RNCC 3UQBA 2KQSA 4ANWA 2DWQA 4HEA1 3I3TB 4GGQA 3ZNID 4CHKA 2YLMA 1FIQA 3RNGC 5EE1A 3N20C 1GB4A 2EELA 4P7IA 2HTME 3ZUNA 1AN8A 4C00A 1VD2A 1Q1OA 2LXAA 3NVZA 3PVLA 4MJSA 3AEFB 2AQ1B 3VXWA 3FC4A 3WIMA 3M63B 1TY0A 2OEDA 2RPQA 3HK0A 5C1ZA 1D5XC 4K3BA 1SEBD 3NOBA 4JLCA 4HKZE 1ZOYB 3PZ8A 4IWPA 4NY0A 2O6VB 2FBWB 2BWFA 2XK5A 3S2AA 3R8BA 1M94A 1J8CA 2KDBA 1WXAA 2JY6A 3DVNV 4AJYB 2QILA 4LNOA 3DQVA 1K8RB 4ZYSA 1J0GA 2E3TA 3DBLI 2LUMA 3NVYA 3K9PB 3BK1A 3Q3FA 2MQJA 2CHXA 3PZ7A 1E8XA 1WGHA 4FJVB 3RNAC 4GMVA 2KTFA 3P63A 3PRPB 3QARA 2K8CA 4ASWC 3R3MA 2JQRB 1T5XD 1SBBB 3I57A 1L0VB 3QK0A 3T9LA 5IOIA 2KHWB 4WJOA 2N7DA 3AEDB 4X57B 1ROEA 3IHPC 2NTSA 2V3NA 1R4NB 2UYZB 4GU2A 3DCGA 4DHZE 2CJNA 4L2YA 1MVKA 1HA5A 5MPOA 1E7UA 4II2B 2D5GA 1UNSA 2R2OA 4BZAA 1AW7A 2WS3B 3X0WA 1EF1A 2IGGA 4LDTB 5L95C 3LYYA 1DYQA 4BKTA 5AEKB 1RFAA 1DOIA 4TMAB 1C4PA 1KTKA 4LTUA 3AMZA 1JCKB 4HDQA 4YSXB 1QKZA 2FUHB 3ZNZB 3TMPB 2BKFA 4ZHPA 3U2SC 2I1JA 4BAXA 5D3DA 1OEYJ 4DDGD 3PLVA 3WA0A 2GB1A 3VQIA 5IO9A 2Q5WD 1JWSD 3D32A 2W54A 1VDVA 4TUUA 1VCBA 4ZYNA 1V8CA 4DBGA 1SE4A 2Z0EB 2WQYB 4KIKB 4F7ZA 1XLNA 2KFKA 4RCOA 2L00B 1WWTA 4E3CA 2WHIA 2JVCA 1NYRA 4NQKE 3TIXA 5BMIA 2MBEA 1JWUD 1I4QA 4MM3B 4N58A 4MGIE 3SHQA 2AWTA 2MHJA 4J3OD 1E5WA 1YOVB
chains in the Genus database with same CATH topology
2LZ6A 4MSQB 4WQOB 4HCPB 1WR6E 2LGXA 1TZ1A 1XQQA 2KTRA 2RR9A 4J6IA 4RM8A 4EUTA 2LRWA 4GDLA 4WAAA 4B95A 5JHAA 5BO4B 2G4DB 2BYVE 3PGEA 3BY4B 2ZPNA 3QQ8B 5DCNA 2ZCBA 2C60A 3WANA 1Q5WB 4DHZB 2ZEQA 1D3ZA 2Z0DB 4RMAA 2GBNA 1EO6A 2MBQA 2ZPYA 3JVZX 1WR1A 3VTUA 5LXIB 4B9KA 1SIFA 2MP2A 4LDTD 1RLFA 3VUWA 2MW5A 2L0FA 3WALA 3ZNHB 1LQBA 2KD0A 3R66C 4KSLC 1ZGUB 2N1WA 2FAZA 3PV1A 4PS3A 3IG3A 2K39A 1IPGA 2DYMA 1ZKHA 4HDOA 5CHWA 3T8MA 3R7QA 2YVCA 2KJRA 3QAQA 3CMMB 4HVBA 3B1LX 3M62B 4IM3A 4NNJB 5CHVC 3GOEA 1LXDA 1IP9A 1E7VA 2MX2A 3RZFA 2N9XA 2KN5A 1WJNA 3M3JA 1C3TA 1Q0WB 3KUCB 2LGDA 4AJWA 2NS5A 2DZIA 3VUYA 4EOYA 4LJPB 2JUOA 2GBKA 4HPMB 2BWES 5E6OA 1WM2A 4PS7A 3PHXB 4AWJA 1CMXB 5LXHA 2JRHA 5C23A 2D2QA 1SE9A 2DZJA 2FIFA 2IO1B 3UQAA 1E8WA 2KFJA 3VTWA 3APCA 3QJZA 3OLMD 4KDIC 3ZKJC 5J17A 3HM6X 4EEWA 2C7NB 1PQSA 3ALBA 3U7DA 4FBJB 4W9LA 1NI2A 3L08A 4B6WA 4W9JA 3HM3A 3VHTC 1RRBA 4BBNC 2M1MA 2PEAA 4FA6A 2HTHA 4GSWA 3NHEB 1WIAA 3BINA 2PE9A 1WMHB 3H9DA 3L17A 3ZRFA 3SU8X 4ZRJA 4HJKA 1WZ3A 5D6JB 5D94A 3LJ3A 3RULA 2KK8A 2KWVB 1ISNA 2JRIB 4WWOA 4IW0A 2KANA 4M8MA 4KV2A 3RZWC 3ML9A 3GZNI 2OOBB 3A4RA 2JPHA 2L0TA 3A9KA 4DK5A 3B0AA 2KX3A 2G45B 2K1FA 4MELA 4BKSD 3O65B 1JRUA 2FIDA 4WJQA 2KDFB 2K6QA 2LRUA 3PTFC 2B3AA 3NS8A 3U30A 4NQLB 5DPSA 4AUQC 2IYDB 1NDDA 2O6VA 1SGHA 3NY5A 1P1AA 4ICUA 2KVRA 2O2VB 4CO7A 1YX6B 2D10A 2A5UA 3V6EB 2AL6A 5DPWA 4BOSC 2R2QA 4W9GA 1Y8RC 3DDCB 4MM3A 3L13A 4XC2A 1WX7A 4XX5A 3U8ZA 1KM7A 2LVOA 4AOFA 2GMIC 2LD9A 4E71A 4HLEA 2KC2A 3N30A 3P2BA 1S3SG 3V60A 3QCAA 4MJSB 1L7YA 1QZEA 1P0RA 1WGRA 4EFOA 3M95A 2DENB 2K6DB 2RD0A 2L8JA 3EECA 3EFUA 1R4NI 2KKCA 4MEMA 3VDZA 3VH3B 4AP4C 3A33B 4JIOU 2LJ5A 3EHVA 2HD5B 1I42A 4NJ7A 2XEWA 3OJ4B 1YIWA 4LCDE 4TKNA 1LFDA 2AEHA 4IG7B 4BKSA 1BT0A 2KFKB 2V3SA 2N4FA 3VAWA 3MJWA 5JZEB 2ZVOA 1V6EA 4G3XB 3AULA 4BVUC 1P3QU 4FJYA 2MBBB 2DAFA 3TCAA 3ZIMA 5AZFA 4EZLA 3SDLC 5JHBA 3RT3B 2W9NA 1HE8A 3DOWA 2XK5B 2A4ZA 2QHOA 3QIJA 3PT2B 1TBEA 4FJZA 2LXCA 2M8SA 3TL5A 2RSUA 4MGZE 4FULA 2DZKA 4FN2A 4FADA 4A3OA 2LVPA 1V5OA 5E6NA 2PPHA 3CF6E 2KC1A 3IBEA 3DBRI 2UWQA 1I35A 2C9WB 2IBIB 1WM3A 3IVFA 2NBUA 3ECIA 5D7GA 3UF8A 1V9JA 2WYQA 3UIPB 1UH6A 4CYEA 2FNJB 4I6LB 4KVGB 2K25A 1OQYA 1V49A 3AU4A 3HHMA 5CX3A 4NAWA 4M8NA 1WYWB 2CKHB 3H7SA 2CS4A 4ZRIA 2LASA 5L83A 1WX8A 3QWZB 2V4LA 4WWNA 2KTRB 4TV3A 1GG3A 4GDLB 2N1VA 4IWQA 1FXTB 2BYFA 4WJNA 5J2RA 2LI5A 2EMSA 4BFRA 3MHSD 3H7PA 4GN1A 1R4MI 1YQBA 2D11A 1J19A 3A1QB 2JXXA 2WWZA 4K7UA 4WJPA 4GIVA 3AI5A 4WWPA 1WGGA 4GXBA 3JYUA 3DPDA 1YX5B 5HKHA 3OAWA 5IA7A 2KOXA 3KUDB 3IFWB 1GC6A 2FCSA 1WF9A 1U4AA 1KLVA 1G6JA 4GOCA 5GMVA 2WX1A 4HWIB 1UBIA 4MSMB 2J7QB 4W9FA 4NPNA 2HJ8A 3DVGY 2DZMA 2KMCA 5G55A 3SD5A 5TR5A 3VUXA 1WXSA 2NPTB 2L76A 1UGMA 1Z2MA 3KUZA 3QC8B 2DAJA 2K8HA 3A9JA 3KVFB 2KX0A 3RYTA 2MRPA 5EDSA 4HK2A 2WDTB 4NJ6A 3ZDMC 1F9JA 1AARA 2V1YA 4PYUA 1EUVB 5E6PA 1TTNA 3OJ3A 4W9IA 3PRMB 1UZXB 1WE6A 2BYEA 2J0JA 2ZZPB 2KO3A 4A3PA 3UQBA 1GUAB 2KQSA 4DXAB 4ANWA 1GNUA 3NZUA 3I3TB 2C7MB 1IYFA 4GGQA 3ZNID 2Z59B 3PHWB 3TJPA 2ZNVB 1WE7A 2YLMA 4KIKA 4CHKA 1L2NA 1P9DU 2MSED 4MGKE 3VVWB 2L05A 4F8CB 2N7EA 5G2NA 2NR2A 3PRZA 4GDKA 1WY8A 2KNBA 3JSVA 1XD3B 1C1YB 4P7IA 4K7WA 4ANXA 2NVUI 3ZRCA 3PLUA 3ZUNA 1E8YA 3W1YA 4JQWC 4DHJB 3ZNGC 1VD2A 3WAMA 1Q1OA 2M17A 2LXAA 2FCMA 2XBBC 3H6NA 4RM9A 4E74A 3PVLA 4MJSA 4EZKA 3KYDD 1X1MA 3VXWA 4N9F4 2JF5A 2KDIA 3EC8A 3WIMA 4URKA 1P98A 3M63B 3DBSA 2RPQA 3HK0A 5C1ZA 3JW0X 2ZJDA 1OEYA 5KHQA 4KDLB 4G11A 4G0NB 2NCNA 2KZRA 3NOBA 2IZVB 4BBNF 5CTRC 4JLCA 1YJ1A 4IWPA 4II3B 3WAPA 2ASQA 4NY0A 2JT4B 2O6VB 3WAOA 3B08A 2NBWB 4GB9A 2BWFA 2XK5A 3S2AA 2LVQA 2C5LC 3DBHI 3L0WB 4OVUA 4M0WB 2DYBA 3CSFA 2CU1A 1M94A 2BPSA 1J8CA 4W9KA 2KDBA 1WXAA 2M0XA 5LLIA 2JY6A 4FHKA 3DVNV 4AJYB 4XZ4A 2BGFA 4K1RB 1WH3A 1GJZA 3APFA 3DQVA 1K8RB 4MGYE 2M4NA 3HIZA 3K9OB 2N9EB 1J0GA 1TGZB 3R7RA 3DBLI 2MBHA 1OTRB 2BF8B 3UGBB 2K8BA 1LM8B 2IO3B 2KJ6A 3K9PB 3KH0A 3KW5B 4JGHB 4FLHA 4HPLB 3PZDA 1A5RA 1T0YA 2KQ7A 2MQJA 3Q3FA 1WXMA 2CR5A 4K7SA 2KLGA 2CHXA 2KMAA 2G3QB 1E8XA 2GBJA 2IY0B 1E8ZA 3N32A 4PYZA 1WGHA 5AZHA 3A1QA 2IO2B 4FJVB 3RCZA 1WRDB 1NBFC 4G50A 3QX1A 4GMVA 2KTFA 3W1SC 1WXVA 2AYOB 3ENEA 2Y5BB 3VH4B 3PRPB 2ZVNA 3QARA 2GBMA 4ANVA 2OJRA 3VTVA 3X23A 2K8CA 4ASWC 2IY1B 3R3MA 1H8CA 2MP2B 4W9DA 3QK0A 3T9LA 5J18A 3ZDTA 2MA9B 4ICVA 4NAWB 2KHWB 4FHJA 3ZTDA 2NPTA 4WJOA 3VFKA 1WGYA 2HE7A 2PE6B 4ANUA 2N7DA 4X57B 3ZVVA 3A4SC 3UIOB 4EZJA 1RAXA 3IHPC 4OVVA 5IAAC 3Q3JA 1WZ0A 2D3GA 2LWPA 2UYZB 3N3KB 4IC7B 4IUMB 4GU2A 3DCGA 3UINB 3NZSA 4DHZE 3L54A 1S1QB 2CHWA 3H7PB 4MH0E 3TBLD 2KDEB 4DHJD 1KJTA 1E7UA 3PPAA 2EKEC 4EKUA 2D07B 4II2B 4PS8A 1WMHA 2AL3A 1V86A 2JZZA 2L7RA 3ML8A 2L3ZA 3RD2A 2R2OA 3ONSA 3LDZE 4YL8A 1WJ6A 5DPTA 2KJHB 3X0WA 1XT9B 1EF1A 3CSTA 4LDTB 5L95C 1KOTA 1WGDA 4BKTA 2PJHA 5AEKB 1WJ4A 1RFAA 2DYOA 2MWSB 4F1SA 5D2MB 2RGFA 3C0RB 1WFYA 2MLBA 3DVGX 4KZCA 5JH5C 1EF5A 2J0MA 4HDQA 2REXA 3A9JB 4LJOB 4HXDA 2FUHB 3ZNZB 2KLCA 2WX0A 2BKFA 2LUEA 3TMPB 2O6VD 3RUIB 3V62A 3ZTCA 1UBQA 1YD8U 2I1JA 4IM0A 1V2YA 4K81A 1OEYJ 2LGYA 2DX5B 4TQ1A 4DDGD 3PLVA 2GBRA 2I1KA 2O2VA 1H4RA 3WA0A 4DWFA 3VQIA 3L10B 3PS6A 2ZNVC 1ZW7A 5AZGA 4MDKE 2C7HA 3D32A 4W9EA 1Z5SB 1V5TA 3PSEB 3V6CB 4TUUA 2G4SA 1VCBA 5DPRA 4ZYNA 2KWCA 3DVNU 1GC7A 1WJUA 4DBGA 2BKRB 2JWZA 2Z0EB 4KIKB 2MCNB 2MBOA 4JL9A 2ZCCA 4KZ0A 4ZRKA 3A9KB 4F7ZA 3ZO5B 2KFKA 3ZW3A 5FR6A 2EMTA 2L00B 2VRRB 4GDKB 3L16A 3JSVB 2DHZA 5CHFA 5KHOA 4E3CA 3H1UA 2NBVB 1V80A 2JVCA 2FCQA 3QHTA 3V61A 1WX9A 4NQKE 4KSKC 3TIXA 1UD7A 2CHZA 3AU5A 2JZ3B 2KXJA 4HCNB 4ZDVA 2MBEA 2IO0B 1E90A 4IWOA 4A20A 4I6PA 1MG8A 4BKGA 4I6NB 4DDID 3KYCD 1OGWA 3PREA 3QA8A 1WI0A 4BOZB 3APDA 4TQ0A 2GOWA 2J0KA 1UELA 3AXCA 4MGIE 4W9CA 3W1SA 4IM2A 3SHQA 3MTNB 4W9HA 1V81A 2N9PC 2KWUB 2AWTA 2FCNA 3ZLZA 1E5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LZ6 A;  4MSQ B;  4WQO B;  4HCP B;  1WR6 E;  2LGX A;  1TZ1 A;  1XQQ A;  2KTR A;  2RR9 A;  4J6I A;  4RM8 A;  4EUT A;  2LRW A;  4GDL A;  4WAA A;  4B95 A;  5JHA A;  5BO4 B;  2G4D B;  2BYV E;  3PGE A;  3BY4 B;  2ZPN A;  3QQ8 B;  5DCN A;  2ZCB A;  2C60 A;  3WAN A;  1Q5W B;  4DHZ B;  2ZEQ A;  1D3Z A;  2Z0D B;  4RMA A;  2GBN A;  1EO6 A;  2MBQ A;  2ZPY A;  3JVZ X;  1WR1 A;  3VTU A;  5LXI B;  4B9K A;  1SIF A;  2MP2 A;  4LDT D;  1RLF A;  3VUW A;  2MW5 A;  2L0F A;  3WAL A;  3ZNH B;  1LQB A;  2KD0 A;  3R66 C;  4KSL C;  1ZGU B;  2N1W A;  2FAZ A;  3PV1 A;  4PS3 A;  3IG3 A;  2K39 A;  1IPG A;  2DYM A;  1ZKH A;  4HDO A;  5CHW A;  3T8M A;  3R7Q A;  2YVC A;  2KJR A;  3QAQ A;  3CMM B;  4HVB A;  3B1L X;  3M62 B;  4IM3 A;  4NNJ B;  5CHV C;  3GOE A;  1LXD A;  1IP9 A;  1E7V A;  2MX2 A;  3RZF A;  2N9X A;  2KN5 A;  1WJN A;  3M3J A;  1C3T A;  1Q0W B;  3KUC B;  2LGD A;  4AJW A;  2NS5 A;  2DZI A;  3VUY A;  4EOY A;  4LJP B;  2JUO A;  2GBK A;  4HPM B;  2BWE S;  5E6O A;  1WM2 A;  4PS7 A;  3PHX B;  4AWJ A;  1CMX B;  5LXH A;  2JRH A;  5C23 A;  2D2Q A;  1SE9 A;  2DZJ A;  2FIF A;  2IO1 B;  3UQA A;  1E8W A;  2KFJ A;  3VTW A;  3APC A;  3QJZ A;  3OLM D;  4KDI C;  3ZKJ C;  5J17 A;  3HM6 X;  4EEW A;  2C7N B;  1PQS A;  3ALB A;  3U7D A;  4FBJ B;  4W9L A;  1NI2 A;  3L08 A;  4B6W A;  4W9J A;  3HM3 A;  3VHT C;  1RRB A;  4BBN C;  2M1M A;  2PEA A;  4FA6 A;  2HTH A;  4GSW A;  3NHE B;  1WIA A;  3BIN A;  2PE9 A;  1WMH B;  3H9D A;  3L17 A;  3ZRF A;  3SU8 X;  4ZRJ A;  4HJK A;  1WZ3 A;  5D6J B;  5D94 A;  3LJ3 A;  3RUL A;  2KK8 A;  2KWV B;  1ISN A;  2JRI B;  4WWO A;  4IW0 A;  2KAN A;  4M8M A;  4KV2 A;  3RZW C;  3ML9 A;  3GZN I;  2OOB B;  3A4R A;  2JPH A;  2L0T A;  3A9K A;  4DK5 A;  3B0A A;  2KX3 A;  2G45 B;  2K1F A;  4MEL A;  4BKS D;  3O65 B;  1JRU A;  2FID A;  4WJQ A;  2KDF B;  2K6Q A;  2LRU A;  3PTF C;  2B3A A;  3NS8 A;  3U30 A;  4NQL B;  5DPS A;  4AUQ C;  2IYD B;  1NDD A;  2O6V A;  1SGH A;  3NY5 A;  1P1A A;  4ICU A;  2KVR A;  2O2V B;  4CO7 A;  1YX6 B;  2D10 A;  2A5U A;  3V6E B;  2AL6 A;  5DPW A;  4BOS C;  2R2Q A;  4W9G A;  1Y8R C;  3DDC B;  4MM3 A;  3L13 A;  4XC2 A;  1WX7 A;  4XX5 A;  3U8Z A;  1KM7 A;  2LVO A;  4AOF A;  2GMI C;  2LD9 A;  4E71 A;  4HLE A;  2KC2 A;  3N30 A;  3P2B A;  1S3S G;  3V60 A;  3QCA A;  4MJS B;  1L7Y A;  1QZE A;  1P0R A;  1WGR A;  4EFO A;  3M95 A;  2DEN B;  2K6D B;  2RD0 A;  2L8J A;  3EEC A;  3EFU A;  1R4N I;  2KKC A;  4MEM A;  3VDZ A;  3VH3 B;  4AP4 C;  3A33 B;  4JIO U;  2LJ5 A;  3EHV A;  2HD5 B;  1I42 A;  4NJ7 A;  2XEW A;  3OJ4 B;  1YIW A;  4LCD E;  4TKN A;  1LFD A;  2AEH A;  4IG7 B;  4BKS A;  1BT0 A;  2KFK B;  2V3S A;  2N4F A;  3VAW A;  3MJW A;  5JZE B;  2ZVO A;  1V6E A;  4G3X B;  3AUL A;  4BVU C;  1P3Q U;  4FJY A;  2MBB B;  2DAF A;  3TCA A;  3ZIM A;  5AZF A;  4EZL A;  3SDL C;  5JHB A;  3RT3 B;  2W9N A;  1HE8 A;  3DOW A;  2XK5 B;  2A4Z A;  2QHO A;  3QIJ A;  3PT2 B;  1TBE A;  4FJZ A;  2LXC A;  2M8S A;  3TL5 A;  2RSU A;  4MGZ E;  4FUL A;  2DZK A;  4FN2 A;  4FAD A;  4A3O A;  2LVP A;  1V5O A;  5E6N A;  2PPH A;  3CF6 E;  2KC1 A;  3IBE A;  3DBR I;  2UWQ A;  1I35 A;  2C9W B;  2IBI B;  1WM3 A;  3IVF A;  2NBU A;  3ECI A;  5D7G A;  3UF8 A;  1V9J A;  2WYQ A;  3UIP B;  1UH6 A;  4CYE A;  2FNJ B;  4I6L B;  4KVG B;  2K25 A;  1OQY A;  1V49 A;  3AU4 A;  3HHM A;  5CX3 A;  4NAW A;  4M8N A;  1WYW B;  2CKH B;  3H7S A;  2CS4 A;  4ZRI A;  2LAS A;  5L83 A;  1WX8 A;  3QWZ B;  2V4L A;  4WWN A;  2KTR B;  4TV3 A;  1GG3 A;  4GDL B;  2N1V A;  4IWQ A;  1FXT B;  2BYF A;  4WJN A;  5J2R A;  2LI5 A;  2EMS A;  4BFR A;  3MHS D;  3H7P A;  4GN1 A;  1R4M I;  1YQB A;  2D11 A;  1J19 A;  3A1Q B;  2JXX A;  2WWZ A;  4K7U A;  4WJP A;  4GIV A;  3AI5 A;  4WWP A;  1WGG A;  4GXB A;  3JYU A;  3DPD A;  1YX5 B;  5HKH A;  3OAW A;  5IA7 A;  2KOX A;  3KUD B;  3IFW B;  1GC6 A;  2FCS A;  1WF9 A;  1U4A A;  1KLV A;  1G6J A;  4GOC A;  5GMV A;  2WX1 A;  4HWI B;  1UBI A;  4MSM B;  2J7Q B;  4W9F A;  4NPN A;  2HJ8 A;  3DVG Y;  2DZM A;  2KMC A;  5G55 A;  3SD5 A;  5TR5 A;  3VUX A;  1WXS A;  2NPT B;  2L76 A;  1UGM A;  1Z2M A;  3KUZ A;  3QC8 B;  2DAJ A;  2K8H A;  3A9J A;  3KVF B;  2KX0 A;  3RYT A;  2MRP A;  5EDS A;  4HK2 A;  2WDT B;  4NJ6 A;  3ZDM C;  1F9J A;  1AAR A;  2V1Y A;  4PYU A;  1EUV B;  5E6P A;  1TTN A;  3OJ3 A;  4W9I A;  3PRM B;  1UZX B;  1WE6 A;  2BYE A;  2J0J A;  2ZZP B;  2KO3 A;  4A3P A;  3UQB A;  1GUA B;  2KQS A;  4DXA B;  4ANW A;  1GNU A;  3NZU A;  3I3T B;  2C7M B;  1IYF A;  4GGQ A;  3ZNI D;  2Z59 B;  3PHW B;  3TJP A;  2ZNV B;  1WE7 A;  2YLM A;  4KIK A;  4CHK A;  1L2N A;  1P9D U;  2MSE D;  4MGK E;  3VVW B;  2L05 A;  4F8C B;  2N7E A;  5G2N A;  2NR2 A;  3PRZ A;  4GDK A;  1WY8 A;  2KNB A;  3JSV A;  1XD3 B;  1C1Y B;  4P7I A;  4K7W A;  4ANX A;  2NVU I;  3ZRC A;  3PLU A;  3ZUN A;  1E8Y A;  3W1Y A;  4JQW C;  4DHJ B;  3ZNG C;  1VD2 A;  3WAM A;  1Q1O A;  2M17 A;  2LXA A;  2FCM A;  2XBB C;  3H6N A;  4RM9 A;  4E74 A;  3PVL A;  4MJS A;  4EZK A;  3KYD D;  1X1M A;  3VXW A;  4N9F 4;  2JF5 A;  2KDI A;  3EC8 A;  3WIM A;  4URK A;  1P98 A;  3M63 B;  3DBS A;  2RPQ A;  3HK0 A;  5C1Z A;  3JW0 X;  2ZJD A;  1OEY A;  5KHQ A;  4KDL B;  4G11 A;  4G0N B;  2NCN A;  2KZR A;  3NOB A;  2IZV B;  4BBN F;  5CTR C;  4JLC A;  1YJ1 A;  4IWP A;  4II3 B;  3WAP A;  2ASQ A;  4NY0 A;  2JT4 B;  2O6V B;  3WAO A;  3B08 A;  2NBW B;  4GB9 A;  2BWF A;  2XK5 A;  3S2A A;  2LVQ A;  2C5L C;  3DBH I;  3L0W B;  4OVU A;  4M0W B;  2DYB A;  3CSF A;  2CU1 A;  1M94 A;  2BPS A;  1J8C A;  4W9K A;  2KDB A;  1WXA A;  2M0X A;  5LLI A;  2JY6 A;  4FHK A;  3DVN V;  4AJY B;  4XZ4 A;  2BGF A;  4K1R B;  1WH3 A;  1GJZ A;  3APF A;  3DQV A;  1K8R B;  4MGY E;  2M4N A;  3HIZ A;  3K9O B;  2N9E B;  1J0G A;  1TGZ B;  3R7R A;  3DBL I;  2MBH A;  1OTR B;  2BF8 B;  3UGB B;  2K8B A;  1LM8 B;  2IO3 B;  2KJ6 A;  3K9P B;  3KH0 A;  3KW5 B;  4JGH B;  4FLH A;  4HPL B;  3PZD A;  1A5R A;  1T0Y A;  2KQ7 A;  2MQJ A;  3Q3F A;  1WXM A;  2CR5 A;  4K7S A;  2KLG A;  2CHX A;  2KMA A;  2G3Q B;  1E8X A;  2GBJ A;  2IY0 B;  1E8Z A;  3N32 A;  4PYZ A;  1WGH A;  5AZH A;  3A1Q A;  2IO2 B;  4FJV B;  3RCZ A;  1WRD B;  1NBF C;  4G50 A;  3QX1 A;  4GMV A;  2KTF A;  3W1S C;  1WXV A;  2AYO B;  3ENE A;  2Y5B B;  3VH4 B;  3PRP B;  2ZVN A;  3QAR A;  2GBM A;  4ANV A;  2OJR A;  3VTV A;  3X23 A;  2K8C A;  4ASW C;  2IY1 B;  3R3M A;  1H8C A;  2MP2 B;  4W9D A;  3QK0 A;  3T9L A;  5J18 A;  3ZDT A;  2MA9 B;  4ICV A;  4NAW B;  2KHW B;  4FHJ A;  3ZTD A;  2NPT A;  4WJO A;  3VFK A;  1WGY A;  2HE7 A;  2PE6 B;  4ANU A;  2N7D A;  4X57 B;  3ZVV A;  3A4S C;  3UIO B;  4EZJ A;  1RAX A;  3IHP C;  4OVV A;  5IAA C;  3Q3J A;  1WZ0 A;  2D3G A;  2LWP A;  2UYZ B;  3N3K B;  4IC7 B;  4IUM B;  4GU2 A;  3DCG A;  3UIN B;  3NZS A;  4DHZ E;  3L54 A;  1S1Q B;  2CHW A;  3H7P B;  4MH0 E;  3TBL D;  2KDE B;  4DHJ D;  1KJT A;  1E7U A;  3PPA A;  2EKE C;  4EKU A;  2D07 B;  4II2 B;  4PS8 A;  1WMH A;  2AL3 A;  1V86 A;  2JZZ A;  2L7R A;  3ML8 A;  2L3Z A;  3RD2 A;  2R2O A;  3ONS A;  3LDZ E;  4YL8 A;  1WJ6 A;  5DPT A;  2KJH B;  3X0W A;  1XT9 B;  1EF1 A;  3CST A;  4LDT B;  5L95 C;  1KOT A;  1WGD A;  4BKT A;  2PJH A;  5AEK B;  1WJ4 A;  1RFA A;  2DYO A;  2MWS B;  4F1S A;  5D2M B;  2RGF A;  3C0R B;  1WFY A;  2MLB A;  3DVG X;  4KZC A;  5JH5 C;  1EF5 A;  2J0M A;  4HDQ A;  2REX A;  3A9J B;  4LJO B;  4HXD A;  2FUH B;  3ZNZ B;  2KLC A;  2WX0 A;  2BKF A;  2LUE A;  3TMP B;  2O6V D;  3RUI B;  3V62 A;  3ZTC A;  1UBQ A;  1YD8 U;  2I1J A;  4IM0 A;  1V2Y A;  4K81 A;  1OEY J;  2LGY A;  2DX5 B;  4TQ1 A;  4DDG D;  3PLV A;  2GBR A;  2I1K A;  2O2V A;  1H4R A;  3WA0 A;  4DWF A;  3VQI A;  3L10 B;  3PS6 A;  2ZNV C;  1ZW7 A;  5AZG A;  4MDK E;  2C7H A;  3D32 A;  4W9E A;  1Z5S B;  1V5T A;  3PSE B;  3V6C B;  4TUU A;  2G4S A;  1VCB A;  5DPR A;  4ZYN A;  2KWC A;  3DVN U;  1GC7 A;  1WJU A;  4DBG A;  2BKR B;  2JWZ A;  2Z0E B;  4KIK B;  2MCN B;  2MBO A;  4JL9 A;  2ZCC A;  4KZ0 A;  4ZRK A;  3A9K B;  4F7Z A;  3ZO5 B;  2KFK A;  3ZW3 A;  5FR6 A;  2EMT A;  2L00 B;  2VRR B;  4GDK B;  3L16 A;  3JSV B;  2DHZ A;  5CHF A;  5KHO A;  4E3C A;  3H1U A;  2NBV B;  1V80 A;  2JVC A;  2FCQ A;  3QHT A;  3V61 A;  1WX9 A;  4NQK E;  4KSK C;  3TIX A;  1UD7 A;  2CHZ A;  3AU5 A;  2JZ3 B;  2KXJ A;  4HCN B;  4ZDV A;  2MBE A;  2IO0 B;  1E90 A;  4IWO A;  4A20 A;  4I6P A;  1MG8 A;  4BKG A;  4I6N B;  4DDI D;  3KYC D;  1OGW A;  3PRE A;  3QA8 A;  1WI0 A;  4BOZ B;  3APD A;  4TQ0 A;  2GOW A;  2J0K A;  1UEL A;  3AXC A;  4MGI E;  4W9C A;  3W1S A;  4IM2 A;  3SHQ A;  3MTN B;  4W9H A;  1V81 A;  2N9P C;  2KWU B;  2AWT A;  2FCN A;  3ZLZ A;  1E5W A; 
#chains in the Genus database with same CATH topology
 2LZ6 A;  4MSQ B;  4WQO B;  4HCP B;  2LGX A;  1TZ1 A;  1XQQ A;  4RM8 A;  2LRW A;  4FXC A;  5JHA A;  3PGE A;  1QT9 A;  4XWW A;  1D4B A;  2WGS A;  2WP9 B;  3U52 E;  3WAN A;  1Q5W B;  4DHZ B;  1JRP A;  1E10 A;  3AM9 A;  2GBN A;  3IT4 B;  1EO6 A;  2KVZ A;  3HUI A;  3JVZ X;  4B9K A;  1EU3 A;  1LQB A;  2KD0 A;  1ZGU B;  2GRI A;  3CMM B;  3RNE C;  3ETR A;  5CHV C;  3GOE A;  2K5P A;  2KN5 A;  3M3J A;  1N5W A;  1C3T A;  3KUC B;  2E6X A;  2DZI A;  3VUY A;  2XN9 C;  3AV8 A;  2PMV A;  4HPM B;  3L4P A;  3N9Y C;  1RWS A;  1CJE A;  1EWY C;  2D2Q A;  1SE9 A;  1RYJ A;  2OJW A;  1E8W A;  3VTW A;  4OW0 A;  3Q14 C;  3OLM D;  5J17 A;  3HM6 X;  1PQS A;  3U7D A;  1VLB A;  1NI2 A;  1FEH A;  2OHF A;  3Q3O C;  2M1M A;  3E9S A;  3J9C A;  2H89 B;  2WXR A;  3H9D A;  3L17 A;  1YJJ A;  3LJ3 A;  3RUL A;  2KK8 A;  3KWV A;  2KQ4 X;  4M8M A;  3GZN I;  2OOB B;  3I63 C;  3A4R A;  3IXS A;  2SEB D;  2ON8 A;  1NEK B;  2FE8 A;  3MC9 A;  3E56 A;  2B3A A;  3NS8 A;  3U30 A;  5DPS A;  2JU6 X;  3BVM A;  4B0E A;  2KVR A;  2PVG C;  5DPW A;  2AL6 A;  4BOS C;  2R2Q A;  4W9G A;  1Y8R C;  1KM7 A;  3P2B A;  3V60 A;  3W9C B;  3AB5 A;  2PLP A;  1L7Y A;  1P0R A;  3LB8 C;  2RD0 A;  4MEM A;  4JIO U;  2YEP F;  3OJ4 B;  1YIW A;  3SR6 A;  4LCD E;  4LK0 M;  1LFD A;  2AEH A;  4IG7 B;  4BKS A;  1BT0 A;  3VAW A;  1TT5 B;  3PO0 A;  1V6E A;  4G3X B;  3AUL A;  1P3Q U;  4XDC A;  2WXO A;  1JW9 D;  1HE8 A;  3QIJ A;  3PT2 B;  1TBE A;  4FJZ A;  2LXC A;  2M8S A;  2K3U A;  1J7B A;  2LVP A;  1V5O A;  3AEG B;  1RFK A;  2C9W B;  2IBI B;  3IVF A;  3ECI A;  2IGD A;  3UF8 A;  1V9J A;  1PUT A;  1V1P B;  2WYQ A;  1UH6 A;  2VZK B;  3I5J C;  4I6L B;  1OQY A;  3AU4 A;  3KLS X;  1VRA B;  2HDE A;  3Q3M C;  2LAS A;  5L83 A;  4C56 C;  4WWN A;  1BXT A;  4TV3 A;  3GZN B;  4R3D A;  5BYR A;  2G9H D;  5J2R A;  1YQ3 B;  3TSS A;  3H7P A;  2D11 A;  4HJG E;  1J19 A;  4RH6 A;  3Q2A C;  3AI5 A;  1WGG A;  2WXG A;  3H8H A;  2WXI A;  3DPD A;  2KOX A;  5FR3 A;  2RDG A;  2PTL A;  1QF6 A;  5EE9 A;  2FCS A;  2G1E A;  3AEC B;  5LNK 1;  1UBI A;  4NPN A;  2HJ8 A;  3Q8F A;  5G55 A;  3VUX A;  3P1M A;  2NPT B;  2RDH A;  2KX0 A;  5EDS A;  1K50 A;  1AWD A;  3R2I A;  4NJ6 A;  1E0Z A;  1MI0 A;  4PYU A;  1EUV B;  2X8X X;  1WE6 A;  2BYE A;  2J0J A;  4C7Z A;  5T8I A;  1FCC C;  4YTN B;  4ZRP A;  2C7M B;  4JPS A;  1DOY A;  3TJP A;  4XE0 A;  4N6E B;  4MGK E;  1FRR A;  2L05 A;  2NR2 A;  4GDK A;  1C1Y B;  4ANX A;  2NVU I;  1E8Y A;  3ZNG C;  3ABV B;  2JZP A;  4EZK A;  4B0M A;  1FXI A;  2JF5 A;  2KDI A;  3EC8 A;  4URK A;  1FD6 A;  4LLG M;  2ZJD A;  4KDL B;  2KZR A;  3DHG C;  1XLP A;  2WXP A;  4BBN F;  1YJ1 A;  4P1C C;  5H92 C;  3WAO A;  4GB9 A;  3VRA B;  2LVQ A;  3DBH I;  3L0W B;  4OVU A;  3OG5 A;  2M0X A;  1F2R I;  2IND C;  4XZ4 A;  4OHJ A;  1GJZ A;  4K1R B;  2M4N A;  3HIZ A;  3K9O B;  1TGZ B;  3R7R A;  3UGB B;  1IGD A;  1LM8 B;  3KH0 A;  1J7C A;  2QDF A;  3KQ4 A;  4FLH A;  4HPL B;  3OWE B;  1WRI A;  1FMA D;  1A5R A;  1T0Y A;  2KQ7 A;  4CQN A;  1WXM A;  3N32 A;  2GBJ A;  4PYZ A;  1E8Z A;  3A1Q A;  2IO2 B;  2DNF A;  1F77 A;  3RCZ A;  4YTM B;  1NBF C;  3EFC A;  1WXV A;  2WU5 B;  2Y5B B;  3P42 A;  2ZVN A;  2GBM A;  5TSS A;  4ANV A;  2OJR A;  3MC0 B;  1YN4 A;  2IJ0 A;  2W3S A;  3GB1 A;  1CZP A;  4RGM A;  3N1Z C;  4A6Q A;  4EZJ A;  3UIO B;  2WNM A;  1RAX A;  4OVV A;  3Q3J A;  3N3K B;  3UIN B;  4IUM B;  2QIE B;  3L54 A;  4DHJ D;  1UF0 A;  3PPA A;  2D07 B;  4PS8 A;  1WMH A;  2AL3 A;  2JZZ A;  2HJ1 A;  2WXL A;  1SIJ A;  2L3Z A;  1MHH E;  3RD2 A;  2Y3A A;  3DBH B;  3ONS A;  4YL8 A;  5BYQ A;  4NJC A;  2H88 B;  1KOT A;  3T3N A;  2LFI A;  4RNA A;  1FM0 D;  1ZXH A;  5JXV A;  5D2M B;  1EM7 A;  2RGF A;  3C0R B;  1LO5 D;  4KGS A;  4PK1 A;  1DGJ A;  2WX0 A;  2LUE A;  1ESF A;  3ZTC A;  4DXG A;  1YD8 U;  2Y5P A;  4NZL B;  1ACC A;  4TQ1 A;  2I1K A;  2O2V A;  2PIA A;  1ENF A;  3L10 B;  4HRS A;  4ITK A;  2QSD A;  2ZNV C;  5AZG A;  3AE2 B;  1CK1 A;  4A55 A;  1Z5S B;  1V5T A;  1R4M B;  5I4D A;  2K22 A;  1FFU A;  4YT0 B;  2KWC A;  4OZB A;  4QAY A;  2Y5C A;  3TEW A;  1YQ4 B;  3ZW3 A;  2VRR B;  3GP7 A;  3L16 A;  2W82 A;  2QCZ A;  2NBV B;  4YXD B;  2FCQ A;  4KSK C;  2CHZ A;  4HCN B;  2KXJ A;  2IO0 B;  1I7H A;  4IWO A;  4I6P A;  2BS3 B;  4BKG A;  1Y56 A;  1OGW A;  1SJH D;  3PRE A;  2KYW A;  3APD A;  3P4S B;  4P16 A;  3NG0 A;  1FXA A;  1QOB A;  1UEL A;  3AXC A;  4W9C A;  3W1S A;  4ARC A;  4IM2 A;  2V0G A;  4W9H A;  2X38 A;  1V81 A;  2FCN A;  3ZXR A;  3ZLZ A;  1WR6 E;  4EUT A;  2KTR A;  1FO4 A;  4GDL A;  4B95 A;  1V97 A;  2BYV E;  2ACZ B;  3QQ8 B;  2C60 A;  3SEB A;  1D3Z A;  2Z0D B;  3W5U B;  1TS2 A;  3MFG A;  2K0P A;  3ZQ4 A;  1RLF A;  3VUW A;  2MW5 A;  3HRD D;  1XEE A;  2N1W A;  2FAZ A;  3MHZ A;  1L0Y B;  5HI1 A;  4LNN A;  2KJR A;  4YSY B;  1LXD A;  1FNW A;  2BB5 A;  3NVW A;  1WJN A;  4GLS C;  2NS5 A;  4LJP B;  2GBK A;  3N1Y C;  2MEK A;  5E6J A;  4AWJ A;  1CMX B;  5LXH A;  4XDD A;  2JRH A;  4ZHO A;  2DZJ A;  3V3X A;  2BVC A;  2RMM A;  3EGR A;  1FFV A;  3QJZ A;  1PGX A;  4KDI C;  3R2T A;  3ZKJ C;  3L08 A;  4W9J A;  3AE6 B;  3VHT C;  3DBL B;  1P7F A;  3FKY A;  4OZC A;  2PEA A;  4FA6 A;  1T0S C;  1WIA A;  3ZRF A;  3SU8 X;  5BMH A;  4ZRJ A;  4HJK A;  5D6J B;  2J52 A;  2IGH A;  2L32 A;  1ISN A;  2JRI B;  1KH0 A;  1N5X A;  1T0Q C;  4KV2 A;  3RZW C;  2UU7 A;  1KLU D;  2WXH A;  2K1F A;  1FRD A;  4D2K A;  4BKS D;  1TKE A;  4WJQ A;  2LRU A;  2K6Q A;  3O13 A;  4YTP B;  1SGH A;  3NY5 A;  3T3O A;  4CO7 A;  2A5U A;  1NI3 A;  3DDC B;  4MM3 A;  3L13 A;  4XC2 A;  4XX5 A;  1IBX B;  2GMI C;  2KC2 A;  2MJ3 A;  1HTO A;  4M00 A;  2DEN B;  3EFU A;  2JX5 A;  2KKC A;  1YMH E;  4AP4 C;  2LJ5 A;  3EHV A;  1SE3 A;  2BQQ A;  1QLB B;  4OZA A;  2KFK B;  2N4F A;  4UDU C;  5JZE B;  1VZ8 A;  4BVU C;  2PVO D;  3TCA A;  3ZIM A;  5JHB A;  2A4Z A;  2QHO A;  4C80 A;  4A3O A;  3CF6 E;  3DBR I;  1ZUD 2;  1AYF A;  1UGJ A;  4CYE A;  3IT6 B;  4KVG B;  1V49 A;  3HHM A;  5CX3 A;  4NAW A;  4M8N A;  3H7S A;  2JSV X;  4REZ A;  2KN4 A;  5HHD G;  1FXT B;  2BYF A;  1TS3 A;  2EMS A;  4BFR A;  2CU3 A;  2WWZ A;  4GIV A;  4WWP A;  4GXB A;  1HXY D;  1B1Z A;  3OAW A;  5IA7 A;  1FNV A;  1K51 A;  3KUD B;  1GC6 A;  3LXF A;  4LNI A;  4ACF A;  3RFZ B;  2DZM A;  3SD5 A;  3Q8C A;  3B2G A;  1Z2M A;  3A9J A;  4HK2 A;  1F9J A;  2INC C;  2MJE A;  2V1Y A;  5E6P A;  3URY A;  3OJ3 A;  1F2R C;  3C8Y A;  1ZDX A;  2GLS A;  1C76 A;  1GNU A;  1XF5 L;  2K9X A;  3U7Z A;  4DXF A;  1IYF A;  2Z59 B;  3DBR B;  2WXJ A;  2ZNV B;  1VZ6 A;  1L2N A;  2LGS A;  3VVW B;  3AE8 B;  2WXQ A;  4F8C B;  1QQR A;  3FIL A;  2AX5 A;  3JSV A;  1XD3 B;  2DBY A;  3PLU A;  4WAF A;  1JWB D;  2LHD A;  1YJI A;  3CIR B;  2M17 A;  3VRB B;  2FCM A;  2XBB C;  3ZJU A;  4E74 A;  3ZXV A;  1X1M A;  1QIL A;  2BT6 A;  2WDQ B;  3DWM A;  3DBS A;  2IDY A;  4HRO A;  1OEY A;  4G11 A;  1T0R C;  4G0N B;  5C2T B;  4C4V A;  5CTR C;  3AE7 B;  4II3 B;  2ASQ A;  4RGN A;  2JT4 B;  2WDR B;  3B08 A;  3C19 A;  4M0W B;  3CSF A;  2CU1 A;  2BPS A;  4W9K A;  1D6E C;  2BGF A;  1WH3 A;  3AE9 B;  1D5Z C;  1JWM D;  4US9 A;  1VR9 A;  4MGY E;  3ZGZ A;  2V4I B;  1UWM A;  2N9E B;  2MBH A;  5G5H A;  3AE5 B;  2K8B A;  2IPK D;  4NAM A;  2AQ2 B;  4JGH B;  2CR5 A;  4K7S A;  1I4H A;  2KMA A;  2IY0 B;  2FUG 1;  1WRD B;  2BS2 B;  3QX1 A;  3W1S C;  2W3R A;  4RF1 A;  2AYO B;  1L5P A;  2M19 A;  5G5G A;  3NRZ A;  1L4Z B;  2MP2 B;  5J18 A;  4PT5 A;  3SFD B;  2MA9 B;  4ICV A;  2NPT A;  3VFK A;  2HE7 A;  4ANU A;  3Q8A A;  5IAA C;  4IC7 B;  3TEX A;  3NZS A;  3H7P B;  3ZYY X;  4MH0 E;  3TBL D;  2KDE B;  4AS1 A;  5H8Y E;  1R7S A;  1N63 A;  2D3B A;  1E7P B;  1WJ6 A;  3ZJT A;  5DPT A;  3CST A;  5HG2 A;  1WJ4 A;  2DYO A;  4F1S A;  4RGT A;  2WXK A;  1WFY A;  3AEA B;  3DVG X;  3VR9 B;  4P1B C;  1EF5 A;  1F1H A;  4LJO B;  2REX A;  2KLC A;  3V62 A;  1SSN A;  2O6V D;  2PW9 A;  1UBQ A;  1ZP0 B;  1JRO A;  3Q8E A;  1STE A;  1V2Y A;  4K81 A;  2LGY A;  2DX5 B;  4EE2 A;  1BUI C;  1HZ5 A;  1ZW7 A;  4Q2J A;  3NUH B;  4M01 A;  4MDK E;  2C7H A;  4OVZ A;  4W9E A;  2G4S A;  5DPR A;  1Q10 A;  1UWX A;  4S17 A;  1GC7 A;  2JWZ A;  1L4D B;  4ZRK A;  3A9K B;  5C3J B;  4GDK B;  5BMG A;  2I2Y A;  1V80 A;  3QHT A;  3V61 A;  1WX9 A;  4ZDV A;  1UD7 A;  3AU5 A;  1WGK A;  1E90 A;  2WU2 B;  1MG8 A;  4DDI D;  2KWD A;  4I6N B;  3KYC D;  3QA8 A;  1WI0 A;  4BOZ B;  2KAC A;  3NS1 A;  2LJI A;  1SF0 A;  2J0K A;  1MJD A;  3MTN B;  2N9P C;  2I38 A;  2KWU B;  2L83 A;  1SB3 C;  4IKG A;  2VH1 A;  2RR9 A;  5BO4 B;  2QEJ C;  3BY4 B;  5IN7 A;  4S0R A;  2ZEQ A;  2ZPY A;  2JYT A;  1QOA A;  1SIF A;  4LDT D;  4A8X C;  3CWI A;  3R66 C;  1ET9 A;  3PV1 A;  4PS3 A;  2K39 A;  1ZKH A;  4HDO A;  3R7Q A;  2V3P A;  2YVC A;  3QAQ A;  4HVB A;  3M62 B;  4IM3 A;  4NNJ B;  1IP9 A;  4KX6 B;  1E7V A;  2MX2 A;  3HVD A;  4XWT A;  1KFY B;  1T3Q A;  1Q0W B;  2LGD A;  4AJW A;  2JUO A;  3V05 A;  2BWE S;  5E6O A;  1CQV A;  5C23 A;  5EE0 A;  1I4X A;  3UQA A;  2KFJ A;  1PFD A;  4JWU C;  5GXG B;  3ALB A;  4FBJ B;  1ZDV A;  1MPE A;  1PYW D;  4B6W A;  2M56 B;  3BVZ A;  3NJT A;  4BBN C;  4O1N A;  2HTH A;  4GSW A;  1LGR A;  1J7A A;  2PE9 A;  1WMH B;  2WXF A;  2KWV B;  4WWO A;  1YN5 A;  2KAN A;  5HFY A;  2JPH A;  4DK5 A;  1MG4 A;  3O65 B;  2J4X A;  1WYG A;  2KDF B;  4AUQ C;  2IYD B;  2O6V A;  3RNB C;  1N6Z A;  1P1A A;  3KWL A;  4ICU A;  2O2V B;  1YX6 B;  1FNU A;  1WX7 A;  3MP9 A;  2LVO A;  2LD9 A;  1YN3 A;  3N30 A;  1S3S G;  2KAJ A;  4MJS B;  1QZE A;  3M95 A;  3EEC A;  1R4N I;  3VDZ A;  3A33 B;  1C9F A;  1KRH A;  2HD5 B;  4NJ7 A;  4TKN A;  3GE3 C;  2SAK A;  2V3S A;  2EKI A;  2ZVO A;  1F0Z A;  5AZF A;  1TS5 A;  3SDL C;  1C79 A;  3RT3 B;  2W9N A;  2XK5 B;  4A9A A;  4MGZ E;  1EU4 A;  2DZK A;  4FN2 A;  4FAD A;  2KC1 A;  3IBE A;  1HZ6 A;  2UWQ A;  1I35 A;  1WM3 A;  2INN E;  2CJO A;  5D7G A;  3UIP B;  2FNJ B;  2K25 A;  4RF0 A;  3QWZ B;  2V4L A;  3GS2 A;  2KTR B;  4GDL B;  4IWQ A;  4XGA B;  4WJN A;  2ONQ A;  1F52 A;  1YQB A;  2RPV A;  1K52 A;  2BTE A;  2XNA C;  2AQ3 B;  2RDB C;  1TKG A;  2QMT A;  3IFW B;  2BYT A;  1U4A A;  1G6J A;  5GMV A;  2WX1 A;  1TS4 A;  1WSP A;  1JWA D;  2J7Q B;  4W9F A;  1I4P A;  2KMC A;  5TR5 A;  5D3I B;  2D3C A;  2DAJ A;  3RYT A;  2MRP A;  4K3C A;  2BBC A;  2JWU A;  3IAM 1;  3PRM B;  4XYC A;  1UZX B;  1HTQ A;  2YEP B;  2KO3 A;  4A3P A;  1GUA B;  1V1O A;  2BB6 A;  4DXA B;  1M4V A;  1WXQ A;  2QC8 A;  3NZU A;  2TSS A;  1SXT A;  3PHW B;  1KF6 B;  3Q6B A;  1WE7 A;  4KIK A;  1P9D U;  2MSE D;  3I9V 1;  1PGB A;  5IKC M;  1TYG B;  2N7E A;  5G2N A;  3PRZ A;  1WY8 A;  2KNB A;  3P4R B;  4K7W A;  3ZRC A;  3W1Y A;  4JQW C;  4DHJ B;  1XLQ A;  3WAM A;  1IBX A;  3UI3 A;  2N9K A;  3H6N A;  4RM9 A;  3DWG C;  3KYD D;  4N9F 4;  2LMC A;  1P98 A;  2V9H A;  2VZK D;  1QOF A;  3JW0 X;  4N59 A;  3RNF C;  5KHQ A;  2NCN A;  1GB1 A;  2IZV B;  3BYT B;  1DOX A;  1EWC A;  3WAP A;  1I4R A;  2INP E;  4C7Y A;  2NBW B;  2C5L C;  2DYB A;  3RMK C;  5LLI A;  4HKQ A;  4FHK A;  2M0A A;  5BYS A;  3APF A;  3WCQ A;  1UUP A;  1C4C A;  3MC8 A;  1OTR B;  2BF8 B;  1SE2 A;  1JQ4 A;  2IO3 B;  2KJ6 A;  3KW5 B;  4IOI E;  2LHE A;  3P4P B;  3TUO A;  3IAS 1;  2WXN A;  4P6V F;  3PZD A;  5FK9 C;  2KLG A;  1TKY A;  2G3Q B;  5AZH A;  4G50 A;  4ARI A;  4AQ7 A;  1JML A;  3ENE A;  3VH4 B;  4USA A;  2ICI A;  2KMM A;  1P7E A;  3VTV A;  3X23 A;  2IY1 B;  1H8C A;  3GE8 C;  4W9D A;  1B9R A;  5IP4 D;  3ZDT A;  2ZW0 A;  2NTT A;  4NAW B;  4FHJ A;  3ZTD A;  1WGY A;  2PE6 B;  3ZVV A;  3A4S C;  1K53 A;  1VJK A;  1WZ0 A;  2D3G A;  2LWP A;  1QOG A;  1IUE A;  1S1Q B;  2CHW A;  3Q8B A;  1KJT A;  2VH2 A;  1IGC A;  2EKE C;  4EKU A;  3AN1 A;  1V86 A;  2L7R A;  3ML8 A;  1RM6 C;  3LDZ E;  3AEB B;  1N60 A;  1OQQ A;  2KJH B;  1XT9 B;  4WH4 A;  1WGD A;  2PJH A;  2D3A A;  2MWS B;  3P4Q B;  2MLB A;  4KZC A;  5JH5 C;  2J0M A;  3A9J B;  4HXD A;  3RUI B;  4IM0 A;  1MFW A;  4JX1 C;  2GBR A;  1ET6 A;  1H4R A;  3RN9 C;  4DWF A;  1XCT L;  3PS6 A;  3NZ3 A;  4IDI A;  2L1A A;  1TZO A;  3PSE B;  1ZXI A;  3V6C B;  1NEN B;  4MT5 A;  3RI7 C;  4MH8 A;  3DVN U;  1WJU A;  2BKR B;  2MCN B;  2MBO A;  4JL9 A;  2ZCC A;  4KZ0 A;  3TEY A;  4WQM A;  2R61 A;  3ZO5 B;  2DLB A;  2EMT A;  3FIL B;  5FR6 A;  3BYY B;  3JSV B;  2DHZ A;  5CHF A;  5KHO A;  2N7J A;  3H1U A;  4M0W A;  1I4G A;  2BS4 B;  4KKJ A;  2JZ3 B;  3MJ5 A;  4A20 A;  3B9J A;  1JAL A;  1GPX A;  3BWU D;  2GOW A;  4TQ0 A;  1V1P A;  2WLB A;  3BII D;  1FCL A;  2L52 A;  1SJE D;  1TIF A;  4C4V B;  2J42 A;  4A90 A;  3U4E G;  4J6I A;  4WAA A;  2G4D B;  2ZPN A;  5DCN A;  4KGT A;  2ZCB A;  1T6B X;  1C78 A;  4RMA A;  5AUI A;  2MBQ A;  3VTU A;  5LXI B;  1WR1 A;  2MP2 A;  2L0F A;  3WAL A;  3ZNH B;  1D5M C;  1ZPS A;  1C4A A;  4KSL C;  4WWM A;  1N62 A;  3IG3 A;  1IPG A;  2DYM A;  2JXT A;  1HQR D;  5CHW A;  3T8M A;  3AE4 B;  3B1L X;  2KDM A;  2QJL A;  3RZF A;  2N9X A;  4HPP A;  4H2A A;  3FAH A;  2B76 B;  4RGO S;  4EOY A;  1E9M A;  1WM2 A;  4PS7 A;  3PHX B;  5AUK A;  2FIF A;  2IO1 B;  1TJE A;  4WUR A;  3APC A;  4ZOH C;  3W5V B;  1XO3 A;  3AE1 B;  4EEW A;  2C7N B;  3VR8 B;  2WDV B;  4W9L A;  1ZE3 D;  1L0X B;  3HM3 A;  1RRB A;  3NHE B;  3TEZ A;  3BIN A;  1N61 A;  3AEE B;  1XLO A;  3DHH C;  4M02 A;  5D94 A;  1WZ3 A;  3ZJV A;  3B2F A;  4RFB A;  4IW0 A;  2LEK A;  3ML9 A;  4KGR A;  2L0T A;  3A9K A;  3BZD B;  4L23 A;  3B0A A;  2KX3 A;  2G45 B;  4MEL A;  3N1X C;  1JRU A;  4LNF A;  2FID A;  3Q69 A;  3PTF C;  4NQL B;  1NDD A;  2KT7 A;  1NVI D;  2J53 A;  3EA6 A;  2D10 A;  3V6E B;  3BK2 A;  3U8Z A;  2ZW1 A;  2Z8L A;  4AOF A;  4HLE A;  4E71 A;  4JE3 B;  2MJD A;  3QCA A;  3AE3 B;  1WGR A;  4EFO A;  2K6D B;  2MH7 A;  2L8J A;  4TSS A;  1L6U A;  3VH3 B;  3EUB 2;  1YNT E;  1I42 A;  2NMQ A;  1OQR A;  2XEW A;  3W2D A;  3SFE B;  1HEZ E;  5EE3 A;  3Q3N C;  3MJW A;  4FJY A;  2MBB B;  4WIP A;  2DAF A;  3AH7 A;  4EZL A;  4US8 A;  3DOW A;  3TL5 A;  2RSU A;  4FUL A;  4MAC A;  5E6N A;  3HVZ A;  2PPH A;  2PKO A;  2N9L A;  2NBU A;  4YSZ B;  4YWG G;  1WYW B;  2CKH B;  4ZRI A;  2CS4 A;  1E6E B;  1XXG A;  2W55 A;  3DHI C;  1WX8 A;  1A70 A;  1GOZ A;  1FPY A;  1GG3 A;  2N1V A;  1L6V A;  3BVG A;  2LI5 A;  1KLG D;  3MHS D;  4GN1 A;  1R4M I;  3A1Q B;  2JXX A;  4K7U A;  4WJP A;  3NVV A;  2GI9 A;  1BML C;  5FKA C;  2N0S B;  1NYQ A;  3JYU A;  1YX5 B;  5HKH A;  1PGA A;  2LGI A;  1WF9 A;  1KLV A;  1TY2 A;  4GOC A;  4L1B A;  4HWI B;  4MSM B;  3DVG Y;  1XCQ L;  2WXM A;  1WXS A;  3KUZ A;  2L76 A;  1UGM A;  3QC8 B;  1C77 A;  1OFF A;  2K8H A;  3KVF B;  2JYE A;  4DQO C;  1MHX A;  1GAQ B;  2WDT B;  3RPF C;  4KKI A;  4JWS C;  3ZDM C;  1AAR A;  2BW2 A;  1PDX A;  4ZRQ A;  1TTN A;  4W9I A;  1VZ7 A;  4LNK A;  2ZZP B;  3RNC C;  3UQB A;  2KQS A;  4ANW A;  2DWQ A;  4HEA 1;  3I3T B;  4GGQ A;  3ZNI D;  4CHK A;  2YLM A;  1FIQ A;  3RNG C;  5EE1 A;  3N20 C;  1GB4 A;  2EEL A;  4P7I A;  2HTM E;  3ZUN A;  1AN8 A;  4C00 A;  1VD2 A;  1Q1O A;  2LXA A;  3NVZ A;  3PVL A;  4MJS A;  3AEF B;  2AQ1 B;  3VXW A;  3FC4 A;  3WIM A;  3M63 B;  1TY0 A;  2OED A;  2RPQ A;  3HK0 A;  5C1Z A;  1D5X C;  4K3B A;  1SEB D;  3NOB A;  4JLC A;  4HKZ E;  1ZOY B;  3PZ8 A;  4IWP A;  4NY0 A;  2O6V B;  2FBW B;  2BWF A;  2XK5 A;  3S2A A;  3R8B A;  1M94 A;  1J8C A;  2KDB A;  1WXA A;  2JY6 A;  3DVN V;  4AJY B;  2QIL A;  4LNO A;  3DQV A;  1K8R B;  4ZYS A;  1J0G A;  2E3T A;  3DBL I;  2LUM A;  3NVY A;  3K9P B;  3BK1 A;  3Q3F A;  2MQJ A;  2CHX A;  3PZ7 A;  1E8X A;  1WGH A;  4FJV B;  3RNA C;  4GMV A;  2KTF A;  3P63 A;  3PRP B;  3QAR A;  2K8C A;  4ASW C;  3R3M A;  2JQR B;  1T5X D;  1SBB B;  3I57 A;  1L0V B;  3QK0 A;  3T9L A;  5IOI A;  2KHW B;  4WJO A;  2N7D A;  3AED B;  4X57 B;  1ROE A;  3IHP C;  2NTS A;  2V3N A;  1R4N B;  2UYZ B;  4GU2 A;  3DCG A;  4DHZ E;  2CJN A;  4L2Y A;  1MVK A;  1HA5 A;  5MPO A;  1E7U A;  4II2 B;  2D5G A;  1UNS A;  2R2O A;  4BZA A;  1AW7 A;  2WS3 B;  3X0W A;  1EF1 A;  2IGG A;  4LDT B;  5L95 C;  3LYY A;  1DYQ A;  4BKT A;  5AEK B;  1RFA A;  1DOI A;  4TMA B;  1C4P A;  1KTK A;  4LTU A;  3AMZ A;  1JCK B;  4HDQ A;  4YSX B;  1QKZ A;  2FUH B;  3ZNZ B;  3TMP B;  2BKF A;  4ZHP A;  3U2S C;  2I1J A;  4BAX A;  5D3D A;  1OEY J;  4DDG D;  3PLV A;  3WA0 A;  2GB1 A;  3VQI A;  5IO9 A;  2Q5W D;  1JWS D;  3D32 A;  2W54 A;  1VDV A;  4TUU A;  1VCB A;  4ZYN A;  1V8C A;  4DBG A;  1SE4 A;  2Z0E B;  2WQY B;  4KIK B;  4F7Z A;  1XLN A;  2KFK A;  4RCO A;  2L00 B;  1WWT A;  4E3C A;  2WHI A;  2JVC A;  1NYR A;  4NQK E;  3TIX A;  5BMI A;  2MBE A;  1JWU D;  1I4Q A;  4MM3 B;  4N58 A;  4MGI E;  3SHQ A;  2AWT A;  2MHJ A;  4J3O D;  1E5W A;  1YOV B; 
#chains in the Genus database with same CATH homology
 2LZ6 A;  4MSQ B;  4WQO B;  4HCP B;  1WR6 E;  2LGX A;  1TZ1 A;  1XQQ A;  2KTR A;  2RR9 A;  4J6I A;  4RM8 A;  4EUT A;  2LRW A;  4GDL A;  4WAA A;  4B95 A;  5JHA A;  5BO4 B;  2G4D B;  2BYV E;  3PGE A;  3BY4 B;  2ZPN A;  3QQ8 B;  5DCN A;  2ZCB A;  2C60 A;  3WAN A;  1Q5W B;  4DHZ B;  2ZEQ A;  1D3Z A;  2Z0D B;  4RMA A;  2GBN A;  1EO6 A;  2MBQ A;  2ZPY A;  3JVZ X;  1WR1 A;  3VTU A;  5LXI B;  4B9K A;  1SIF A;  2MP2 A;  4LDT D;  1RLF A;  3VUW A;  2MW5 A;  2L0F A;  3WAL A;  3ZNH B;  1LQB A;  2KD0 A;  3R66 C;  4KSL C;  1ZGU B;  2N1W A;  2FAZ A;  3PV1 A;  4PS3 A;  3IG3 A;  2K39 A;  1IPG A;  2DYM A;  1ZKH A;  4HDO A;  5CHW A;  3T8M A;  3R7Q A;  2YVC A;  2KJR A;  3QAQ A;  3CMM B;  4HVB A;  3B1L X;  3M62 B;  4IM3 A;  4NNJ B;  5CHV C;  3GOE A;  1LXD A;  1IP9 A;  1E7V A;  2MX2 A;  3RZF A;  2N9X A;  2KN5 A;  1WJN A;  3M3J A;  1C3T A;  1Q0W B;  3KUC B;  2LGD A;  4AJW A;  2NS5 A;  2DZI A;  3VUY A;  4EOY A;  4LJP B;  2JUO A;  2GBK A;  4HPM B;  2BWE S;  5E6O A;  1WM2 A;  4PS7 A;  3PHX B;  4AWJ A;  1CMX B;  5LXH A;  2JRH A;  5C23 A;  2D2Q A;  1SE9 A;  2DZJ A;  2FIF A;  2IO1 B;  3UQA A;  1E8W A;  2KFJ A;  3VTW A;  3APC A;  3QJZ A;  3OLM D;  4KDI C;  3ZKJ C;  5J17 A;  3HM6 X;  4EEW A;  2C7N B;  1PQS A;  3ALB A;  3U7D A;  4FBJ B;  4W9L A;  1NI2 A;  3L08 A;  4B6W A;  4W9J A;  3HM3 A;  3VHT C;  1RRB A;  4BBN C;  2M1M A;  2PEA A;  4FA6 A;  2HTH A;  4GSW A;  3NHE B;  1WIA A;  3BIN A;  2PE9 A;  1WMH B;  3H9D A;  3L17 A;  3ZRF A;  3SU8 X;  4ZRJ A;  4HJK A;  1WZ3 A;  5D6J B;  5D94 A;  3LJ3 A;  3RUL A;  2KK8 A;  2KWV B;  1ISN A;  2JRI B;  4WWO A;  4IW0 A;  2KAN A;  4M8M A;  4KV2 A;  3RZW C;  3ML9 A;  3GZN I;  2OOB B;  3A4R A;  2JPH A;  2L0T A;  3A9K A;  4DK5 A;  3B0A A;  2KX3 A;  2G45 B;  2K1F A;  4MEL A;  4BKS D;  3O65 B;  1JRU A;  2FID A;  4WJQ A;  2KDF B;  2K6Q A;  2LRU A;  3PTF C;  2B3A A;  3NS8 A;  3U30 A;  4NQL B;  5DPS A;  4AUQ C;  2IYD B;  1NDD A;  2O6V A;  1SGH A;  3NY5 A;  1P1A A;  4ICU A;  2KVR A;  2O2V B;  4CO7 A;  1YX6 B;  2D10 A;  2A5U A;  3V6E B;  2AL6 A;  5DPW A;  4BOS C;  2R2Q A;  4W9G A;  1Y8R C;  3DDC B;  4MM3 A;  3L13 A;  4XC2 A;  1WX7 A;  4XX5 A;  3U8Z A;  1KM7 A;  2LVO A;  4AOF A;  2GMI C;  2LD9 A;  4E71 A;  4HLE A;  2KC2 A;  3N30 A;  3P2B A;  1S3S G;  3V60 A;  3QCA A;  4MJS B;  1L7Y A;  1QZE A;  1P0R A;  1WGR A;  4EFO A;  3M95 A;  2DEN B;  2K6D B;  2RD0 A;  2L8J A;  3EEC A;  3EFU A;  1R4N I;  2KKC A;  4MEM A;  3VDZ A;  3VH3 B;  4AP4 C;  3A33 B;  4JIO U;  2LJ5 A;  3EHV A;  2HD5 B;  1I42 A;  4NJ7 A;  2XEW A;  3OJ4 B;  1YIW A;  4LCD E;  4TKN A;  1LFD A;  2AEH A;  4IG7 B;  4BKS A;  1BT0 A;  2KFK B;  2V3S A;  2N4F A;  3VAW A;  3MJW A;  5JZE B;  2ZVO A;  1V6E A;  4G3X B;  3AUL A;  4BVU C;  1P3Q U;  4FJY A;  2MBB B;  2DAF A;  3TCA A;  3ZIM A;  5AZF A;  4EZL A;  3SDL C;  5JHB A;  3RT3 B;  2W9N A;  1HE8 A;  3DOW A;  2XK5 B;  2A4Z A;  2QHO A;  3QIJ A;  3PT2 B;  1TBE A;  4FJZ A;  2LXC A;  2M8S A;  3TL5 A;  2RSU A;  4MGZ E;  4FUL A;  2DZK A;  4FN2 A;  4FAD A;  4A3O A;  2LVP A;  1V5O A;  5E6N A;  2PPH A;  3CF6 E;  2KC1 A;  3IBE A;  3DBR I;  2UWQ A;  1I35 A;  2C9W B;  2IBI B;  1WM3 A;  3IVF A;  2NBU A;  3ECI A;  5D7G A;  3UF8 A;  1V9J A;  2WYQ A;  3UIP B;  1UH6 A;  4CYE A;  2FNJ B;  4I6L B;  4KVG B;  2K25 A;  1OQY A;  1V49 A;  3AU4 A;  3HHM A;  5CX3 A;  4NAW A;  4M8N A;  1WYW B;  2CKH B;  3H7S A;  2CS4 A;  4ZRI A;  2LAS A;  5L83 A;  1WX8 A;  3QWZ B;  2V4L A;  4WWN A;  2KTR B;  4TV3 A;  1GG3 A;  4GDL B;  2N1V A;  4IWQ A;  1FXT B;  2BYF A;  4WJN A;  5J2R A;  2LI5 A;  2EMS A;  4BFR A;  3MHS D;  3H7P A;  4GN1 A;  1R4M I;  1YQB A;  2D11 A;  1J19 A;  3A1Q B;  2JXX A;  2WWZ A;  4K7U A;  4WJP A;  4GIV A;  3AI5 A;  4WWP A;  1WGG A;  4GXB A;  3JYU A;  3DPD A;  1YX5 B;  5HKH A;  3OAW A;  5IA7 A;  2KOX A;  3KUD B;  3IFW B;  1GC6 A;  2FCS A;  1WF9 A;  1U4A A;  1KLV A;  1G6J A;  4GOC A;  5GMV A;  2WX1 A;  4HWI B;  1UBI A;  4MSM B;  2J7Q B;  4W9F A;  4NPN A;  2HJ8 A;  3DVG Y;  2DZM A;  2KMC A;  5G55 A;  3SD5 A;  5TR5 A;  3VUX A;  1WXS A;  2NPT B;  2L76 A;  1UGM A;  1Z2M A;  3KUZ A;  3QC8 B;  2DAJ A;  2K8H A;  3A9J A;  3KVF B;  2KX0 A;  3RYT A;  2MRP A;  5EDS A;  4HK2 A;  2WDT B;  4NJ6 A;  3ZDM C;  1F9J A;  1AAR A;  2V1Y A;  4PYU A;  1EUV B;  5E6P A;  1TTN A;  3OJ3 A;  4W9I A;  3PRM B;  1UZX B;  1WE6 A;  2BYE A;  2J0J A;  2ZZP B;  2KO3 A;  4A3P A;  3UQB A;  1GUA B;  2KQS A;  4DXA B;  4ANW A;  1GNU A;  3NZU A;  3I3T B;  2C7M B;  1IYF A;  4GGQ A;  3ZNI D;  2Z59 B;  3PHW B;  3TJP A;  2ZNV B;  1WE7 A;  2YLM A;  4KIK A;  4CHK A;  1L2N A;  1P9D U;  2MSE D;  4MGK E;  3VVW B;  2L05 A;  4F8C B;  2N7E A;  5G2N A;  2NR2 A;  3PRZ A;  4GDK A;  1WY8 A;  2KNB A;  3JSV A;  1XD3 B;  1C1Y B;  4P7I A;  4K7W A;  4ANX A;  2NVU I;  3ZRC A;  3PLU A;  3ZUN A;  1E8Y A;  3W1Y A;  4JQW C;  4DHJ B;  3ZNG C;  1VD2 A;  3WAM A;  1Q1O A;  2M17 A;  2LXA A;  2FCM A;  2XBB C;  3H6N A;  4RM9 A;  4E74 A;  3PVL A;  4MJS A;  4EZK A;  3KYD D;  1X1M A;  3VXW A;  4N9F 4;  2JF5 A;  2KDI A;  3EC8 A;  3WIM A;  4URK A;  1P98 A;  3M63 B;  3DBS A;  2RPQ A;  3HK0 A;  5C1Z A;  3JW0 X;  2ZJD A;  1OEY A;  5KHQ A;  4KDL B;  4G11 A;  4G0N B;  2NCN A;  2KZR A;  3NOB A;  2IZV B;  4BBN F;  5CTR C;  4JLC A;  1YJ1 A;  4IWP A;  4II3 B;  3WAP A;  2ASQ A;  4NY0 A;  2JT4 B;  2O6V B;  3WAO A;  3B08 A;  2NBW B;  4GB9 A;  2BWF A;  2XK5 A;  3S2A A;  2LVQ A;  2C5L C;  3DBH I;  3L0W B;  4OVU A;  4M0W B;  2DYB A;  3CSF A;  2CU1 A;  1M94 A;  2BPS A;  1J8C A;  4W9K A;  2KDB A;  1WXA A;  2M0X A;  5LLI A;  2JY6 A;  4FHK A;  3DVN V;  4AJY B;  4XZ4 A;  2BGF A;  4K1R B;  1WH3 A;  1GJZ A;  3APF A;  3DQV A;  1K8R B;  4MGY E;  2M4N A;  3HIZ A;  3K9O B;  2N9E B;  1J0G A;  1TGZ B;  3R7R A;  3DBL I;  2MBH A;  1OTR B;  2BF8 B;  3UGB B;  2K8B A;  1LM8 B;  2IO3 B;  2KJ6 A;  3K9P B;  3KH0 A;  3KW5 B;  4JGH B;  4FLH A;  4HPL B;  3PZD A;  1A5R A;  1T0Y A;  2KQ7 A;  2MQJ A;  3Q3F A;  1WXM A;  2CR5 A;  4K7S A;  2KLG A;  2CHX A;  2KMA A;  2G3Q B;  1E8X A;  2GBJ A;  2IY0 B;  1E8Z A;  3N32 A;  4PYZ A;  1WGH A;  5AZH A;  3A1Q A;  2IO2 B;  4FJV B;  3RCZ A;  1WRD B;  1NBF C;  4G50 A;  3QX1 A;  4GMV A;  2KTF A;  3W1S C;  1WXV A;  2AYO B;  3ENE A;  2Y5B B;  3VH4 B;  3PRP B;  2ZVN A;  3QAR A;  2GBM A;  4ANV A;  2OJR A;  3VTV A;  3X23 A;  2K8C A;  4ASW C;  2IY1 B;  3R3M A;  1H8C A;  2MP2 B;  4W9D A;  3QK0 A;  3T9L A;  5J18 A;  3ZDT A;  2MA9 B;  4ICV A;  4NAW B;  2KHW B;  4FHJ A;  3ZTD A;  2NPT A;  4WJO A;  3VFK A;  1WGY A;  2HE7 A;  2PE6 B;  4ANU A;  2N7D A;  4X57 B;  3ZVV A;  3A4S C;  3UIO B;  4EZJ A;  1RAX A;  3IHP C;  4OVV A;  5IAA C;  3Q3J A;  1WZ0 A;  2D3G A;  2LWP A;  2UYZ B;  3N3K B;  4IC7 B;  4IUM B;  4GU2 A;  3DCG A;  3UIN B;  3NZS A;  4DHZ E;  3L54 A;  1S1Q B;  2CHW A;  3H7P B;  4MH0 E;  3TBL D;  2KDE B;  4DHJ D;  1KJT A;  1E7U A;  3PPA A;  2EKE C;  4EKU A;  2D07 B;  4II2 B;  4PS8 A;  1WMH A;  2AL3 A;  1V86 A;  2JZZ A;  2L7R A;  3ML8 A;  2L3Z A;  3RD2 A;  2R2O A;  3ONS A;  3LDZ E;  4YL8 A;  1WJ6 A;  5DPT A;  2KJH B;  3X0W A;  1XT9 B;  1EF1 A;  3CST A;  4LDT B;  5L95 C;  1KOT A;  1WGD A;  4BKT A;  2PJH A;  5AEK B;  1WJ4 A;  1RFA A;  2DYO A;  2MWS B;  4F1S A;  5D2M B;  2RGF A;  3C0R B;  1WFY A;  2MLB A;  3DVG X;  4KZC A;  5JH5 C;  1EF5 A;  2J0M A;  4HDQ A;  2REX A;  3A9J B;  4LJO B;  4HXD A;  2FUH B;  3ZNZ B;  2KLC A;  2WX0 A;  2BKF A;  2LUE A;  3TMP B;  2O6V D;  3RUI B;  3V62 A;  3ZTC A;  1UBQ A;  1YD8 U;  2I1J A;  4IM0 A;  1V2Y A;  4K81 A;  1OEY J;  2LGY A;  2DX5 B;  4TQ1 A;  4DDG D;  3PLV A;  2GBR A;  2I1K A;  2O2V A;  1H4R A;  3WA0 A;  4DWF A;  3VQI A;  3L10 B;  3PS6 A;  2ZNV C;  1ZW7 A;  5AZG A;  4MDK E;  2C7H A;  3D32 A;  4W9E A;  1Z5S B;  1V5T A;  3PSE B;  3V6C B;  4TUU A;  2G4S A;  1VCB A;  5DPR A;  4ZYN A;  2KWC A;  3DVN U;  1GC7 A;  1WJU A;  4DBG A;  2BKR B;  2JWZ A;  2Z0E B;  4KIK B;  2MCN B;  2MBO A;  4JL9 A;  2ZCC A;  4KZ0 A;  4ZRK A;  3A9K B;  4F7Z A;  3ZO5 B;  2KFK A;  3ZW3 A;  5FR6 A;  2EMT A;  2L00 B;  2VRR B;  4GDK B;  3L16 A;  3JSV B;  2DHZ A;  5CHF A;  5KHO A;  4E3C A;  3H1U A;  2NBV B;  1V80 A;  2JVC A;  2FCQ A;  3QHT A;  3V61 A;  1WX9 A;  4NQK E;  4KSK C;  3TIX A;  1UD7 A;  2CHZ A;  3AU5 A;  2JZ3 B;  2KXJ A;  4HCN B;  4ZDV A;  2MBE A;  2IO0 B;  1E90 A;  4IWO A;  4A20 A;  4I6P A;  1MG8 A;  4BKG A;  4I6N B;  4DDI D;  3KYC D;  1OGW A;  3PRE A;  3QA8 A;  1WI0 A;  4BOZ B;  3APD A;  4TQ0 A;  2GOW A;  2J0K A;  1UEL A;  3AXC A;  4MGI E;  4W9C A;  3W1S A;  4IM2 A;  3SHQ A;  3MTN B;  4W9H A;  1V81 A;  2N9P C;  2KWU B;  2AWT A;  2FCN A;  3ZLZ A;  1E5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...