2KQSA

Phosphorylation of sumo-interacting motif by ck2 enhances daxx sumo binding activity
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, apoptosis
molecule keywords Small ubiquitin-related modifier 1
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kqsA00
1E8ZA 5GMVA 2D2QA 4AJYB 3PHWB 2LVQA 2KWCA 2MQJA 3U30A 3R3MA 3ZTCA 5LXHA 1YIWA 3DBSA 2FAZA 2VRRB 2PJHA 3B0AA 3ZUNA 3ZKJC 3BINA 4WWPA 3H7PA 4W9IA 4TQ0A 2KD0A 2FCSA 3LDZE 3JW0X 3H7PB 4WJOA 2XK5A 2ASQA 4OVVA 4E71A 3V62A 2ZPNA 3QA8A 4EOYA 2M8SA 5JZEB 4I6NB 3N32A 2KQSA 3PT2B 4N9F4 3TIXA 1NDDA 2J0MA 4KV2A 3L08A 3NY5A 4DHJB 4IW0A 4P7IA 1WZ0A 3DQVA 1C3TA 3AI5A 1EF1A 1Z5SB 2CKHB 1WX7A 4IWQA 1HE8A 2CHZA 4XX5A 3R7RA 3VTVA 4NJ7A 3EFUA 3QWZB 4CHKA 2RGFA 1Z2MA 2MBBB 2IO0B 2K1FA 1V49A 2V1YA 2GBJA 1YQBA 3U7DA 3OLMD 3TL5A 4NY0A 4FJVB 4NJ6A 4WWOA 1JRUA 2MLBA 4KVGB 2LUEA 2M1MA 5E6PA 4ANXA 1SE9A 3R66C 2ZVOA 1WGHA 1OEYJ 1YJ1A 3CSTA 4PS8A 1YX5B 3DVNU 3DVGY 4GB9A 2MW5A 3ENEA 4M8MA 4WAAA 3APCA 1P98A 4KIKB 3ML8A 2Y5BB 1D3ZA 2LZ6A 4NQLB 4GSWA 2M4NA 1H4RA 3DVNV 3APFA 5KHOA 3L16A 4F1SA 4X57B 1LXDA 3WIMA 1OQYA 5C23A 2K6QA 3DVGX 4LCDE 4PS7A 4ANUA 2IZVB 4GDKB 2RSUA 4E3CA 1T0YA 2KDEB 2LRUA 2ZCBA 4XZ4A 5AZGA 5G2NA 3N30A 1WE6A 3C0RB 4URKA 4A20A 1ZKHA 1BT0A 2JRIB 3A4SC 1GNUA 3PV1A 3ZNHB 2XEWA 3QJZA 2JVCA 2IYDB 1XD3B 4AJWA 3EHVA 2KC2A 1E7UA 1KM7A 3O65B 2KNBA 1WJ6A 1RAXA 4B9KA 4MSMB 1UBQA 5TR5A 5DPTA 3OAWA 2BYFA 2ZCCA 2L05A 4MJSB 3L0WB 1WGYA 3ZIMA 5KHQA 2KFKB 4ZYNA 4MJSA 4W9GA 3PRMB 2KFKA 2PEAA 2PE6B 3SU8X 4TUUA 1WXAA 1P0RA 2MP2B 3RD2A 1XQQA 2BYEA 2MP2A 3X23A 2JT4B 3A4RA 3V61A 3D32A 1V86A 5EDSA 3CMMB 1WF9A 1WR6E 3PZDA 2C7HA 2BYVE 3ZNID 2CR5A 2GBMA 1EO6A 4MELA 1C1YB 3ZRFA 4FN2A 1V81A 3PRPB 4HDQA 2KTFA 2LASA 2NPTA 4MGYE 2OJRA 2DAFA 3UF8A 2NS5A 2LRWA 3QC8B 1RLFA 1WGGA 3WALA 3VH4B 3IVFA 4B95A 4AUQC 2KOXA 4I6LB 1R4MI 2D11A 2N7EA 1GJZA 4OVUA 4DBGA 2LI5A 3B1LX 1E8WA 3KVFB 3NHEB 2MX2A 4CO7A 1WJUA 2D3GA 2K6DB 3ZLZA 4DHJD 1ISNA 2IO2B 2UYZB 4HDOA 2D10A 2I1KA 2WX1A 4II2B 5L95C 4EEWA 2K8CA 1UBIA 2NCNA 1XT9B 2K8HA 4F8CB 4WJQA 2N1WA 2BGFA 1WMHA 3TCAA 2K8BA 3ZW3A 5IA7A 2QHOA 1WMHB 3VH3B 1WXSA 2GMIC 4LDTD 3T9LA 2R2QA 2CHWA 2Z59B 1E8XA 1I42A 2L76A 4FULA 2LD9A 4ZRJA 3ZDTA 4NQKE 4DDID 4BBNC 2K39A 1R4NI 3VQIA 3AU5A 1CMXB 3M63B 4FLHA 4IM0A 4NAWB 4LDTB 3ZTDA 3JYUA 3HM3A 4IG7B 2JZ3B 2LVOA 4GMVA 1OTRB 2KWUB 2O6VD 4EZJA 1WYWB 4HWIB 4RM9A 1FXTB 1J19A 3KYDD 2DYBA 3EECA 4FA6A 1LQBA 1WJNA 3DCGA 3HIZA 4ICUA 4JQWC 2MBQA 5J17A 3VFKA 2AEHA 3IHPC 1KLVA 1S3SG 1Q1OA 1GC7A 2JUOA 2W9NA 4K81A 3WANA 2L00B 2O2VB 2DZKA 1Q5WB 2DZJA 4HJKA 3ZO5B 3H1UA 3AXCA 2BPSA 2J0KA 2YVCA 2Z0DB 1UGMA 5CHWA 3L54A 5JHAA 1MG8A 3A33B 4KDLB 2AWTA 2IY0B 4WWNA 5CHVC 3GZNI 4DXAB 3RYTA 3EC8A 2DX5B 4JIOU 3A9KA 1UD7A 4KIKA 2DZIA 1WY8A 2N4FA 2ZEQA 3DDCB 3A9JB 1EUVB 2N1VA 4HVBA 3PS6A 3A9JA 4MEMA 3NZSA 5CTRC 1YX6B 4II3B 2N7DA 2R2OA 3B08A 2KX0A 2WYQA 4TKNA 1WX9A 4GDLA 3VAWA 1LM8B 4GDKA 1H8CA 3L13A 3CF6E 4WQOB 2O6VB 5L83A 3KYCD 2N9EB 1WM2A 2L8JA 1RFAA 2O6VA 3MTNB 5LXIB 1TTNA 3RCZA 2ZNVB 1WR1A 2Z0EB 4KZ0A 2AYOB 3QAQA 2IO1B 3OJ4B 4HXDA 1QZEA 2NPTB 2A5UA 2AL6A 5CHFA 3N3KB 2MRPA 3PRZA 1KOTA 4W9EA 4DHZE 3AULA 2UWQA 4GN1A 5D6JB 2NBVB 2NBWB 2C7MB 2IBIB 5IAAC 4W9DA 1P1AA 2MBHA 1WGDA 2ZNVC 1GG3A 3UGBB 2KC1A 1ZGUB 2FIDA 3X0WA 1OGWA 2M0XA 5J2RA 2C5LC 4GXBA 4WJNA 2C9WB 3ALBA 3KW5B 3RT3B 2RD0A 2L0TA 3PPAA 3RZFA 1TGZB 2KJRA 2ZPYA 2MCNB 1WFYA 2KWVB 2JPHA 3ONSA 4FBJB 3Q3JA 1IPGA 4K7SA 2DZMA 4PS3A 1IYFA 2KANA 4ZRKA 4ZDVA 4M8NA 3JSVA 1M94A 4LJOB 1L2NA 5AZFA 2I1JA 2ZVNA 3TJPA 3ZDMC 4MM3A 2KDBA 1WRDB 1NBFC 4FHJA 4ASWC 2LWPA 2IO3B 2HTHA 4CYEA 4AWJA 3TMPB 2LVPA 2KLCA 2DYMA 3KUZA 4DWFA 2C60A 3PTFC 2KVRA 2J7QB 5E6OA 1X1MA 3AU4A 4MDKE 2G3QB 3VUWA 4PYZA 2KN5A 4JGHB 3CSFA 1UH6A 2KZRA 2RR9A 1WI0A 3RULA 3RZWC 1WJ4A 1G6JA 3TBLD 4IUMB 3JVZX 3VHTC 2FNJB 4MSQB 3VXWA 4W9FA 2PPHA 3HM6X 2ZJDA 2FUHB 3QIJA 4LJPB 2NVUI 3PSEB 3V6CB 3IFWB 2O2VA 2ZZPB 3SD5A 4HPLB 5D2MB 2WDTB 4FADA 2YLMA 5C1ZA 2CU1A 1EF5A 3WA0A 2BWFA 4HK2A 4MGZE 2GBKA 1VCBA 3IBEA 2KJHB 1E5WA 1SGHA 2C7NB 4EUTA 5AZHA 1Q0WB 4FJZA 3DOWA 2N9PC 5CX3A 5J18A 4BKTA 4IWOA 3ECIA 1GUAB 3BY4B 3MJWA 2D07B 3T8MA 2KHWB 3WAOA 3PLUA 2DHZA 2KQ7A 1UELA 3L17A 4DHZB 1E7VA 3HHMA 2G4SA 2OOBB 1GC6A 2JWZA 3PGEA 2LXAA 3SHQA 2LGXA 4BOZB 2JXXA 4K1RB 2JZZA 4FHKA 4EKUA 1WZ3A 3QQ8B 2AL3A 2KFJA 3A1QB 3W1SA 1WH3A 2N9XA 4W9KA 4E74A 5AEKB 3A1QA 4EFOA 4XC2A 2EMTA 4ANVA 4FJYA 4WJPA 4BFRA 3VUYA 4A3PA 5JHBA 2B3AA 1E90A 1V80A 4GU2A 2KX3A 1U4AA 2MBEA 2KMAA 1WX8A 2LXCA 3QX1A 3DPDA 3KH0A 3ZNZB 3ZRCA 2CS4A 2NR2A 2WX0A 2MWSB 3VUXA 3ZVVA 1KJTA 1A5RA 1L7YA 4TQ1A 2HE7A 4GDLB 4I6PA 1NI2A 5FR6A 4EZKA 1TZ1A 1V2YA 4BBNF 1AARA 3PVLA 3VVWB 2WWZA 3U8ZA 2HJ8A 2LGDA 3LJ3A 1WE7A 3M95A 1YD8U 4ZRIA 3SDLC 4G11A 3QK0A 2J0JA 2NBUA 2G45B 3H6NA 2KK8A 4BKSA 2MA9B 2IY1B 2EMSA 3DBHI 2XK5B 2BF8B 3VTWA 2KTRB 3UQBA 4MGKE 2JF5A 3NZUA 1Y8RC 2KTRA 3M3JA 4K7WA 5DPWA 2DENB 3UINB 1ZW7A 4RM8A 4BKGA 1WM3A 4BOSC 3Q3FA 5DPSA 4A3OA 2KDFB 5DPRA 1LFDA 4MH0E 2L3ZA 5HKHA 1V9JA 4JLCA 2L0FA 2KKCA 4DK5A 2KLGA 4HCNB 4RMAA 1UZXB 2V4LA 4GGQA 3W1YA 3NOBA 3RUIB 5JH5C 4HPMB 4KSKC 4W9JA 2MBOA 1E8YA 2FIFA 3JSVB 1WIAA 2MSED 1WXVA 3HK0A 2BKFA 1P3QU 4HLEA 1P9DU 4W9HA 3QARA 1IP9A 3WAMA 3S2AA 2PE9A 2HD5B 3APDA 4B6WA 3DBRI 4TV3A 3V6EB 3OJ3A 3H7SA 1V5TA 2EKEC 4HCPB 4MGIE 4W9LA 5E6NA 1I35A 2KXJA 3ZNGC 2A4ZA 3GOEA 4F7ZA 4IM3A 2M17A 3L10B 4GIVA 5G55A 3PHXB 2JY6A 4NAWA 4IWPA 4IM2A 2GOWA 4KSLC 4NPNA 4DDGD 2GBNA 3QHTA 5BO4B 4GOCA 2BWES 4M0WB 3DBLI 2CHXA 4ICVA 4JL9A 2FCNA 4AP4C 3UQAA 2BKRB 1F9JA 1RRBA 3M62B 1J0GA 3KUDB 4AOFA 2L7RA 4G50A 2GBRA 5LLIA 2FCMA 2KJ6A 2LGYA 5DCNA 3NS8A 4NNJB 1PQSA 2LJ5A 1V6EA 2RPQA 3MHSD 5D7GA 3VTUA 3WAPA 3R7QA 3W1SC 1TBEA 2DYOA 4G3XB 4BKSD 4G0NB 4PYUA 1SIFA 2KDIA 3VDZA 4IC7B 1VD2A 3PLVA 3UIPB 3PREA 4K7UA 5D94A 1V5OA 2XBBC 2KMCA 1J8CA 3ML9A 1WGRA 4BVUC 3A9KB 1K8RB 2REXA 3K9OB 2KO3A 2FCQA 3I3TB 3V60A 4EZLA 2K25A 2G4DB 2V3SA 1S1QB 3P2BA 4KDIC 3QCAA 4YL8A 2JRHA 3KUCB 1OEYA 4J6IA 2DAJA 3K9PB 3H9DA 4KZCA 3IG3A 4ANWA 1WXMA 4W9CA 3UIOB
chains in the Genus database with same CATH superfamily
4AJYB 2IDYA 1SXTA 3PHWB 1FM0D 3DBSA 2VRRB 3ZUNA 1QKZA 2N0SB 3JW0X 4WJOA 4OVVA 3V62A 1Y56A 1UUPA 3VR9B 5JZEB 3PT2B 1NDDA 4DHJB 4IW0A 3DQVA 3AI5A 3IAS1 1SE3A 3WCQA 1WX7A 1HE8A 2CHZA 3QWZB 1Z2MA 2MBBB 4JWSC 2LMCA 3U7DA 4NJ6A 4MM3B 2LUEA 4ANXA 3R66C 2ZVOA 2V9HA 3DVNU 2BBCA 4KIKB 1C78A 4K3CA 3ML8A 4WAFA 2LZ6A 2M4NA 5KHOA 3AEFB 3L16A 4OVZA 4F1SA 2RSUA 5BMGA 2ZCBA 4LNKA 3N30A 1XLNA 1FPYA 2ICIA 4FXCA 4A20A 1BT0A 1CJEA 2DLBA 3PV1A 2WU5B 2JVCA 2IYDB 1XD3B 4AJWA 4CQNA 4TSSA 3DWMA 4MSMB 1BMLC 2GRIA 1MHHE 3PRMB 2KFKA 2PE6B 1WXAA 2Q5WD 2KT7A 5FR3A 2W82A 3V61A 1V86A 3CMMB 1WF9A 2C7HA 2CR5A 2GBMA 2IJ0A 4MELA 1C1YB 4FN2A 2FE8A 3PRPB 2M0AA 3MP9A 1VR9A 3FILB 4KGSA 4MGYE 1KH0A 3IVFA 3VRBB 4TMAB 2KYWA 4LLGM 3AH7A 4OVUA 2WDQB 4DBGA 2LI5A 3B1LX 1E8WA 3VR8B 3NHEB 1L0XB 1WJUA 2D3GA 4JPSA 5LNK1 1DYQA 1XT9B 1WMHA 3AE8B 3TCAA 1A70A 2GMIC 1I42A 2LD9A 4NQKE 3GZNB 4BBNC 1ZXIA 1FNUA 4FLHA 3M63B 2WP9B 2JZ3B 2LVOA 1OTRB 2KWUB 2W3SA 1FXTB 3KYDD 2DYBA 4FA6A 2D3CA 1VZ7A 2MHJA 3BK2A 4LNOA 2L00B 5EE0A 4HJKA 3H1UA 4N6EB 2BPSA 3U52E 3GE8C 1N61A 1UGMA 2Z0DB 5CHWA 4A8XC 4KGRA 1MG8A 2HTME 4WWNA 3GZNI 1YN4A 3RYTA 1C4CA 1UD7A 4KIKA 2DZIA 1V1PB 2N4FA 2ZEQA 3A9JB 1N5XA 1I4XA 2QCZA 3PS6A 4HVBA 1UNSA 5CTRC 5IOIA 2H88B 2R2OA 4TKNA 1QT9A 1HTOA 1H8CA 1ROEA 1TS5A 4HRSA 5L83A 1WM2A 2O6VA 3KQ4A 3RCZA 1LO5D 2HDEA 2ZNVB 2AYOB 4YXDB 3AECB 2NPTB 2A5UA 3N3KB 3E56A 2MRPA 2UWQA 4GN1A 1FXAA 2C7MB 5IAAC 1GG3A 1MHXA 2PVOD 5G5GA 4US8A 3AEBB 3ALBA 3Q69A 1XEEA 2L0TA 2ZPYA 2JPHA 2MH7A 4FBJB 2AQ3B 3FILA 4KX6B 4LJOB 3TJPA 4MM3A 3MC8A 2LWPA 4AWJA 1E6EB 1D5ZC 3AN1A 1XLOA 1X1MA 4MDKE 1SB3C 2AQ2B 3CSFA 1UH6A 1ET9A 1T0SC 1WI0A 3AE5B 3NJTA 2OJWA 5HI1A 3SR6A 2KVZA 1K53A 5BMHA 2K5PA 4MSQB 4W9FA 2PPHA 1B9RA 3HM6X 1AW7A 2FUHB 2BS2B 2NVUI 2O2VA 2ZZPB 3AM9A 3SD5A 1MFWA 1XLPA 1VJKA 4FADA 5BYRA 3IXSA 2J4XA 2WXMA 4HK2A 3Q3MC 2Z8LA 2BYTA 1E5WA 5AZHA 1Q0WB 2CJOA 3PZ7A 2LEKA 1AYFA 1T6BX 3Q2AC 4BKTA 3ECIA 1GUAB 1NVID 2KMMA 1QOAA 1ZPSA 3PLUA 2L1AA 1UELA 1JQ4A 4DHZB 1CQVA 2OOBB 3SHQA 2JWZA 4FHKA 4EKUA 1WZ3A 1WH3A 4W9KA 4E74A 1I4QA 4XC2A 1WXQA 1F52A 2B3AA 1L5PA 2MBEA 1WX8A 1I4HA 2Y3AA 3DPDA 1JRPA 1MI0A 3ZVVA 2WS3B 4K3BA 4I6PA 2RPVA 5FR6A 4OW0A 1JWUD 1SEBD 2HJ8A 2LGDA 1E9MA 3NS1A 3AE1B 1YD8U 3BYYB 3QK0A 2NBUA 4MT5A 2LUMA 1STEA 4O1NA 2IY1B 3VTWA 2KTRB 2DENB 3T3OA 1OFFA 1ZW7A 2DWQA 3C8YA 1AWDA 3Q3FA 4RGNA 2L3ZA 4US9A 4HCNB 1UZXB 1V97A 5JH5C 4KSKC 2FIFA 4YTPB 3RNFC 1P3QU 3Q8AA 4HLEA 1IP9A 4DXGA 3TEXA 1JALA 1FMAD 1V1PA 5E6NA 1I35A 2KXJA 4XWTA 3NVYA 4GIVA 5I4DA 4IWPA 4IM2A 4NPNA 4DDGD 4P1CC 3QHTA 4P16A 5BO4B 4GOCA 3DBLI 4JL9A 3KWLA 3KLSX 3KUDB 4AOFA 1EU4A 5GXGB 2KAJA 2KJ6A 2LGYA 5DCNA 2QILA 2WXRA 4NNJB 2LJ5A 1V6EA 1TBEA 4G3XB 4G0NB 4IC7B 1VD2A 3CWIA 5D94A 2XBBC 2QSDA 5C3JB 3A9KB 1TJEA 2REXA 2WXOA 2G1EA 2KO3A 3RNGC 3V60A 1FNWA 4KDIC 5D3DA 2BTEA 1VDVA 2JWUA 3IG3A 2LVQA 3U30A 2WHIA 1YIWA 4B0EA 3ZKJC 2FCSA 3H7PB 2XK5A 2ZPNA 1PGXA 4EOYA 4I6NB 1JCKB 2KQSA 3TIXA 3L08A 1TS2A 4P7IA 1WZ0A 1C3TA 2QMTA 2CKHB 3Q8BA 3P4SB 4IWQA 2OEDA 4OZCA 3EFUA 4A55A 2V1YA 3OLMD 3TL5A 4NY0A 2G9HD 3BYTB 3N9YC 1JRUA 5E6PA 4KVGB 3ZXVA 2MW5A 2J53A 4MH8A 4R3DA 4NQLB 1T0QC 4GSWA 4JE3B 2PVGC 1HTQA 2K6QA 4ANUA 3P63A 1VRAB 1T0YA 1WE6A 2L32A 3C0RB 5EE9A 4LNNA 2EKIA 2JRIB 3A4SC 3ZNHB 4C7ZA 3EHVA 1E7UA 1C4PA 1KM7A 3FAHA 1WJ6A 1WYGA 1RAXA 1F2RC 5TR5A 5DPTA 3OAWA 2L05A 4MJSB 4W9GA 3SU8X 4TUUA 1P0RA 2MP2A 3X23A 2X8XX 5BMIA 3D32A 5EDSA 3PZDA 1C77A 3FKYA 3OG5A 1EO6A 1N5WA 3ZRFA 5HHDG 2E6XA 4HDQA 2IGDA 2LASA 4A6QA 2DAFA 3TSSA 1WGGA 1TZOA 2WXJA 2N7EA 1GJZA 3KVFB 1C4AA 1I7HA 2QC8A 1E7PB 2BS3B 5D3IB 2MJ3A 1YN3A 4DHJD 2UYZB 2WX1A 1DOIA 3RNBC 5L95C 1UBIA 4F8CB 2N1WA 5IA7A 2QHOA 4HEA1 3T9LA 2CHWA 2LJIA 3GS2A 4ZRJA 1VZ6A 3O13A 1TY0A 3AU5A 1CMXB 1CZPA 2LHEA 4IM0A 3BWUD 3V3XA 4XDCA 3ZQ4A 3SEBA 3ZTDA 3HM3A 2M56B 2O6VD 3EECA 1WJNA 5J17A 4JQWC 2MBQA 4WH4A 2RDBC 1Q1OA 1GC7A 4K81A 2DZKA 2DZJA 1NYQA 1SIJA 2J0KA 3U4EG 1E0ZA 3A33B 1ENFA 4KDLB 1KTKA 1JWBD 1N63A 2IY0B 2R61A 3A9KA 3GE3C 1WY8A 1V8CA 2N9LA 1EUVB 4MEMA 5EE3A 4II3B 2KQ4X 3B08A 2KX0A 3P1MA 4GDLA 1LM8B 2QDFA 1JROA 3L13A 3KYCD 2JX5A 2N9EB 1RFAA 3MTNB 2Z0EB 3QAQA 1GPXA 3OJ4B 3TEWA 2GLSA 4HXDA 1BXTA 1KOTA 2QIEB 3UGBB 2KC1A 1ZGUB 2M0XA 3Q3OC 5J2RA 1TKGA 1XCQL 2C9WB 3RT3B 3NG0A 2RD0A 3PPAA 1YQ4B 3RZFA 2KWDA 2KWVB 3ONSA 3Q3JA 1IPGA 2DZMA 2BVCA 1L2NA 5AZFA 2I1JA 1D3ZA 1VZ8A 4CYEA 2IO3B 3TMPB 2LVPA 3KUZA 2DYMA 4DWFA 2C60A 2KVRA 2INDC 2G3QB 3VUWA 4PK1A 2KN5A 4LTUA 1WGKA 2PKOA 1DGJA 4XE0A 4MACA 3ETRA 3VXWA 3Q6BA 3U2SC 4LJPB 3PSEB 3V6CB 3IFWB 1HZ6A 1N6ZA 2BQQA 2N9KA 4HPLB 2YLMA 5C1ZA 1ZUD2 1EF5A 3WA0A 2BWFA 4M02A 2WDRB 1VCBA 3NVVA 2KJHB 2JYEA 1K52A 1SE2A 2PLPA 4IWOA 1IGCA 3BY4B 3MJWA 1XXGA 2WU2B 2D07B 2DNFA 2RDGA 2KQ7A 3HHMA 4XDDA 3B2GA 1GC6A 3PGEA 2LGXA 1V1OA 2JZZA 4LNIA 3B9JA 3W1SA 3A1QB 2MJDA 4ANVA 2CU3A 1ZDXA 1Q10A 4IKGA 3Q14C 4J3OD 4A3PA 2WXQA 5JHBA 2KMAA 3LYYA 1QOBA 2WDVB 3KH0A 3ZRCA 2CS4A 2NR2A 3ZXRA 1L7YA 4TQ1A 4GDLB 3KWVA 5G5HA 2L52A 3VVWB 3U8ZA 4HJGE 3LJ3A 1WE7A 3M95A 3SDLC 2KN4A 3H6NA 4BKSA 3R2IA 2EMSA 3P4PB 4DQOC 2JF5A 4M01A 5DPWA 3PZ8A 4BKGA 5DPSA 1V9JA 3BZDB 4RMAA 4IOIE 1UWMA 4S17A 3RUIB 4RH6A 1E8YA 1WIAA 1WXVA 3HK0A 3V05A 2AX5A 5FK9C 2WGSA 1TIFA 2HD5B 3APDA 4B6WA 4TV3A 3V6EB 3TEZA 3H7SA 1OQQA 3AE2B 1F1HA 3GOEA 3L10B 3PHXB 4NAWA 3AE3B 3I63C 2BWES 4M0WA 1YN5A 3N1YC 4ICVA 1XF5L 3Q3NC 2BKRB 1F9JA 2WXKA 3M62B 4YT0B 2L7RA 3AE9B 2I38A 4RFBA 1TS4A 2XNAC 3MHSD 5D7GA 3R7QA 3W1SC 5IO9A 4PYUA 2KDIA 3PLVA 2NTSA 3UIPB 3PREA 2QJLA 1ACCA 1J8CA 1HZ5A 1T5XD 3AV8A 1PGBA 1YNTE 1KRHA 4YSYB 5EE1A 2K25A 2G4DB 5IKCM 2V3SA 1FCLA 3QCAA 3KUCB 1OEYA 2DAJA 3K9PB 3EFCA 2BW2A 4KZCA 4W9CA 3UIOB 1E8ZA 5GMVA 2D2QA 1D5XC 1HXYD 2KWCA 2MQJA 4RGOS 3ZTCA 4YSZB 2FAZA 3B0AA 1RWSA 3H8HA 1TS3A 4W9IA 4TQ0A 1R4NB 5BYSA 4E71A 4ZRPA 4AS1A 3Q8EA 2M8SA 1YQ3B 4KV2A 3MC9A 2JU6X 1L0YB 2UU7A 4PT5A 1EF1A 1Z5SB 1ZP0B 4XX5A 3VTVA 2IO0B 4L1BA 2K1FA 3R8BA 4C4VB 3DWGC 2WQYB 5HG2A 2SEBD 1TKEA 1NENB 3RN9C 2MLBA 3DHHC 3PO0A 1SE9A 5KHQA 1YJ1A 1YX5B 3DVGY 3ENEA 4WIPA 3NRZA 3APCA 1P98A 5JXVA 3HUIA 4X57B 3WIMA 1K51A 1OQYA 1PUTA 3DVGX 1T3QA 1RM6C 2K22A 4E3CA 2LRUA 5G2NA 3RNCC 4URKA 4N58A 2XEWA 3QJZA 2KC2A 4ARIA 2KNBA 4B9KA 4QAYA 3UI3A 2GI9A 2ZCCA 2Y5PA 2KFKB 3CIRB 4C80A 2PEAA 4OZBA 2BS4B 1XQQA 2BYEA 4ZRQA 1WR6E 3TEYA 3AEGB 1V81A 2GB1A 2KTFA 3UF8A 2IGHA 1RLFA 3VH4B 1FIQA 2KOXA 4AUQC 4I6LB 2D11A 1T0RC 3BVZA 1OQRA 3VRAB 2MX2A 3DHIC 4CO7A 2WNMA 2K6DB 3ZLZA 1ISNA 2IO2B 2V3NA 4II2B 4EEWA 2NCNA 1R4MB 2K8HA 4WJQA 3ZW3A 3ZGZA 1WMHB 1WXSA 4LDTD 2R2QA 1E8XA 3FC4A 2L76A 4FULA 4DDID 1WRIA 1FXIA 1R4NI 2K39A 3VQIA 1NI3A 3IT6B 4NAWB 2IPKD 3JYUA 3EUB2 4L23A 4EE2A 4EZJA 3MHZA 4RM9A 3HIZA 2J42A 3VFKA 2AEHA 3IHPC 1KLVA 1S3SG 1TYGB 2W9NA 1I4RA 3GP7A 1FRDA 3ZO5B 1ESFA 1LGRA 2WXLA 5C2TB 4C4VA 2VH1A 5JHAA 1KFYB 4NJCA 4ARCA 4DXAB 4NZLB 3EC8A 5MPOA 2DX5B 2INPE 2ONQA 4BZAA 4UDUC 4ACFA 1UGJA 2MJEA 2N1VA 3A9JA 3NZSA 2INCC 1IUEA 3VAWA 4XWWA 2O6VB 2K0PA 5LXIB 1WR1A 1MJDA 3I5JC 2IO1B 1ET6A 4C7YA 4WWMA 2AL6A 3ABVB 2E3TA 5D6JB 1FRRA 2NBWB 1WGDA 4OHJA 3X0WA 1F0ZA 1OGWA 3AMZA 2D3AA 1TKYA 1NYRA 1WFYA 3DHGC 1FO4A 5H92C 3J9CA 4ZRKA 3ZDMC 1YMHE 2KDBA 1WRDB 1PDXA 3NZ3A 3T3NA 2L83A 5E6OA 3EGRA 1FEHA 2WXIA 4RF1A 1WJ4A 3TBLD 4IUMB 3JVZX 3VHTC 2FNJB 3AEAB 3ZJVA 2MEKA 2ZJDA 4JWUC 4RF0A 3QIJA 4KGTA 5D2MB 2WDTB 2GBKA 3E9SA 3IBEA 2I2YA 1L4DB 4FJZA 3AE7B 3DOWA 4YSXB 5CX3A 4OZAA 2B76B 2WLBA 3T8MA 4KKJA 1E7VA 2G4SA 3IT4B 2JXXA 2WXGA 3P4RB 1FD6A 2EMTA 4USAA 4FJYA 4WJPA 4BFRA 3N20C 1E90A 3MFGA 4GU2A 1ZXHA 2H89B 3RNAC 5T8IA 1KJTA 1A5RA 5BYQA 2TSSA 4A9AA 2RMMA 3PVLA 3L4PA 3RI7C 2X38A 1YJJA 2V0GA 4G11A 3C19A 2G45B 2MA9B 2PW9A 4ZOHC 2BF8B 3UQBA 4MGKE 4RGTA 1Y8RC 3B2FA 2KTRA 1SJHD 4RM8A 4DXFA 3RMKC 3NVZA 4BOSC 4A3OA 2JQRB 5DPRA 1LFDA 1B1ZA 4MH0E 2KLGA 1UWXA 4H2AA 4GGQA 1P7EA 4HPMB 4W9JA 1I4PA 4HROA 2LHDA 2MSED 1E10A 2BKFA 4W9HA 1RFKA 2LGSA 4HCPB 3ZNGC 2A4ZA 4IM3A 3W9CB 2M17A 2JY6A 1SJED 2GOWA 4KSLC 4WURA 2LFIA 4AP4C 3UQAA 1C79A 1KF6B 2GBRA 3NS8A 1C76A 1PQSA 3DBLB 2RPQA 3VTUA 3WAPA 1JWMD 2JSVX 1M4VA 1PYWD 4BKSD 2K9XA 1IBXA 1FFUA 1SIFA 3VDZA 5FKAC 2WXPA 1JMLA 1V5OA 1GAQB 2KMCA 3ML9A 3OWEB 4ZHPA 4BVUC 4GLSC 3BK1A 3DBRB 3Q8FA 3I3TB 2K3UA 4EZLA 1WWTA 3GB1A 1S1QB 1TY2A 1ZE3D 1FCCC 1SBBB 3W2DA 3H9DA 2Y5CA 2W3RA 1ZOYB 3NUHB 1WXMA 3R3MA 5LXHA 2PJHA 3BINA 1YOVB 4WWPA 3H7PA 3P4QB 3IAM1 2KD0A 1RYJA 3LDZE 1NEKB 2ASQA 3RFZB 3LXFA 3QA8A 1GB1A 3N32A 4N9F4 2JXTA 2J0MA 3NY5A 4C00A 3MC0B 3RNEC 1IGDA 3I57A 4BAXA 1QF6A 2XN9C 3R7RA 4NJ7A 4RGMA 4CHKA 2RGFA 5E6JA 1YJIA 1V49A 2GBJA 1YQBA 1QOFA 4Q2JA 4FJVB 4WWOA 3W5VB 2M1MA 1L6VA 1WGHA 1OEYJ 3CSTA 4PS8A 4GB9A 4M8MA 4WAAA 4NAMA 1N60A 2Y5BB 2INNE 2W54A 1H4RA 2BB5A 2NTTA 3APFA 3DVNV 1LXDA 4HKQA 5C23A 1HA5A 4LCDE 4PS7A 1L0VB 2IZVB 4GDKB 2WXHA 5AZGA 2KDEB 4XZ4A 3LB8C 1EWYC 1ZKHA 1D5MC 1GNUA 2ZW1A 3O65B 1UBQA 3W5UB 2AQ1B 2BYFA 3L0WB 1WGYA 3ZIMA 4ZYNA 4MJSA 1DOXA 2YEPF 2MP2B 3RD2A 1XLQA 2KACA 1C9FA 2JT4B 3A4RA 2BYVE 3ZNID 3SFEB 3AEDB 2NPTA 1SE4A 4REZA 2OJRA 1JW9D 1IBXB 2NS5A 2PMVA 2LRWA 3QC8B 3WALA 4B95A 1R4MI 2FUG1 4IDIA 4WQMA 4HDOA 2D10A 2I1KA 1QOGA 2DBYA 2K8CA 2BGFA 4P1BC 2PTLA 2VH2A 2K8BA 1TT5B 3VH3B 4ZYSA 2Z59B 2NMQA 3ZDTA 1WSPA 1VLBA 4LDTB 4IG7B 4KKIA 4GMVA 3SFDB 1WYWB 4HWIB 1J19A 3NVWA 4RNAA 1LQBA 3DCGA 4ICUA 5AUKA 1XO3A 2JUOA 1P7FA 3WANA 2O2VB 1Q5WB 3R2TA 3AXCA 3EA6A 2YVCA 4P6VF 3L54A 2SAKA 1PFDA 2AWTA 2V4IB 5CHVC 1L6UA 4JIOU 1F77A 3DBHB 1SSNA 3DDCB 2JZPA 3N1XC 4YTNB 1QQRA 1YX6B 5H8YE 2FBWB 2N7DA 2PIAA 2WYQA 1WX9A 4JX1C 4GDKA 3CF6E 4WQOB 3BVGA 2L8JA 1TTNA 4RCOA 4KZ0A 3BIID 1MG4A 1QZEA 3N1ZC 5CHFA 1I4GA 1K50A 3PRZA 4W9EA 4DHZE 3AULA 1D6EC 2NBVB 2IBIB 4W9DA 1P1AA 2MBHA 1J7CA 2ZNVC 2FIDA 2IGGA 2C5LC 4GXBA 4WJNA 3KW5B 3ZYYX 2BT6A 3HRDD 1TGZB 2KJRA 2QEJC 2MCNB 4C56C 4PS3A 1QILA 4K7SA 1IYFA 2KANA 4ZDVA 4M8NA 3JSVA 1M94A 2HJ1A 2ZVNA 4ASWC 4FHJA 1NBFC 2HTHA 3ZJTA 2KLCA 3PTFC 2J7QB 3AU4A 1AN8A 3MJ5A 4AQ7A 4PYZA 4JGHB 2KZRA 2RR9A 3P42A 3RZWC 3RULA 3URYA 1G6JA 5IP4D 1GB4A 1FNVA 5HFYA 2WXNA 1HQRD 1PGAA 1ZDVA 4D2KA 3HVZA 2CU1A 4MGZE 1XCTL 2W55A 1SGHA 2C7NB 4EUTA 1L4ZB 1EM7A 2D3BA 1KLUD 2N9PC 5J18A 4LK0M 3RPFC 2ON8A 2KHWB 4N59A 3WAOA 2DHZA 2J52A 4M00A 2VZKB 3L17A 2OHFA 1EU3A 2LXAA 4BOZB 4YWGG 4K1RB 3QQ8B 3TUOA 2AL3A 2KFJA 1D4BA 2N9XA 5AEKB 3A1QA 4EFOA 2N7JA 3VUYA 1EWCA 4L2YA 3AB5A 1V80A 2YEPB 1U4AA 2KX3A 3AE4B 2ACZB 1F2RI 2LXCA 4ITKA 3QX1A 1QLBB 3ZNZB 5AUIA 2WX0A 2MWSB 3VUXA 2HE7A 1NI2A 2JYTA 1J7BA 2VZKD 4EZKA 1GOZA 1TZ1A 1V2YA 2D5GA 1AARA 4BBNF 2WWZA 4ZRIA 4HKZE 2J0JA 2KK8A 1JWAD 5TSSA 3DBHI 2XK5B 3NZUA 3M3JA 4K7WA 1FFVA 3UINB 4XGAB 1WM3A 2KDFB 1KLGD 5HKHA 4LNFA 4JLCA 2L0FA 2KKCA 4DK5A 2M19A 2CJNA 2V4LA 3W1YA 3NOBA 2EELA 1UF0A 1HEZE 2MBOA 4A90A 3JSVB 1P9DU 3QARA 4XYCA 3WAMA 4HPPA 1SF0A 3S2AA 2PE9A 4YTMB 3DBRI 3HVDA 1N62A 3OJ3A 2RDHA 1V5TA 2BB6A 2EKEC 4MGIE 4W9LA 1DOYA 4F7ZA 5G55A 1MVKA 3AEEB 2GBNA 4M0WB 1J7AA 2CHXA 2FCNA 1CK1A 1RRBA 1J0GA 3BVMA 5LLIA 4G50A 2FCMA 4S0RA 4B0MA 2KDMA 2ZW0A 1BUIC 1MPEA 2DYOA 3U7ZA 3AE6B 2LGIA 5IN7A 4K7UA 1WGRA 1R7SA 1K8RB 3K9OB 3ZJUA 2FCQA 2V3PA 3I9V1 3P2BA 1JWSD 4YL8A 2JRHA 3Q8CA 4J6IA 2WXFA 4ANWA 4ZHOA
chains in the Genus database with same CATH topology
1E8ZA 5GMVA 2D2QA 4AJYB 3PHWB 2LVQA 2KWCA 2MQJA 3U30A 3R3MA 3ZTCA 5LXHA 1YIWA 3DBSA 2FAZA 2VRRB 2PJHA 3B0AA 3ZUNA 3ZKJC 3BINA 4WWPA 3H7PA 4W9IA 4TQ0A 2KD0A 2FCSA 3LDZE 3JW0X 3H7PB 4WJOA 2XK5A 2ASQA 4OVVA 4E71A 3V62A 2ZPNA 3QA8A 4EOYA 2M8SA 5JZEB 4I6NB 3N32A 2KQSA 3PT2B 4N9F4 3TIXA 1NDDA 2J0MA 4KV2A 3L08A 3NY5A 4DHJB 4IW0A 4P7IA 1WZ0A 3DQVA 1C3TA 3AI5A 1EF1A 1Z5SB 2CKHB 1WX7A 4IWQA 1HE8A 2CHZA 4XX5A 3R7RA 3VTVA 4NJ7A 3EFUA 3QWZB 4CHKA 2RGFA 1Z2MA 2MBBB 2IO0B 2K1FA 1V49A 2V1YA 2GBJA 1YQBA 3U7DA 3OLMD 3TL5A 4NY0A 4FJVB 4NJ6A 4WWOA 1JRUA 2MLBA 4KVGB 2LUEA 2M1MA 5E6PA 4ANXA 1SE9A 3R66C 2ZVOA 1WGHA 1OEYJ 1YJ1A 3CSTA 4PS8A 1YX5B 3DVNU 3DVGY 4GB9A 2MW5A 3ENEA 4M8MA 4WAAA 3APCA 1P98A 4KIKB 3ML8A 2Y5BB 1D3ZA 2LZ6A 4NQLB 4GSWA 2M4NA 1H4RA 3DVNV 3APFA 5KHOA 3L16A 4F1SA 4X57B 1LXDA 3WIMA 1OQYA 5C23A 2K6QA 3DVGX 4LCDE 4PS7A 4ANUA 2IZVB 4GDKB 2RSUA 4E3CA 1T0YA 2KDEB 2LRUA 2ZCBA 4XZ4A 5AZGA 5G2NA 3N30A 1WE6A 3C0RB 4URKA 4A20A 1ZKHA 1BT0A 2JRIB 3A4SC 1GNUA 3PV1A 3ZNHB 2XEWA 3QJZA 2JVCA 2IYDB 1XD3B 4AJWA 3EHVA 2KC2A 1E7UA 1KM7A 3O65B 2KNBA 1WJ6A 1RAXA 4B9KA 4MSMB 1UBQA 5TR5A 5DPTA 3OAWA 2BYFA 2ZCCA 2L05A 4MJSB 3L0WB 1WGYA 3ZIMA 5KHQA 2KFKB 4ZYNA 4MJSA 4W9GA 3PRMB 2KFKA 2PEAA 2PE6B 3SU8X 4TUUA 1WXAA 1P0RA 2MP2B 3RD2A 1XQQA 2BYEA 2MP2A 3X23A 2JT4B 3A4RA 3V61A 3D32A 1V86A 5EDSA 3CMMB 1WF9A 1WR6E 3PZDA 2C7HA 2BYVE 3ZNID 2CR5A 2GBMA 1EO6A 4MELA 1C1YB 3ZRFA 4FN2A 1V81A 3PRPB 4HDQA 2KTFA 2LASA 2NPTA 4MGYE 2OJRA 2DAFA 3UF8A 2NS5A 2LRWA 3QC8B 1RLFA 1WGGA 3WALA 3VH4B 3IVFA 4B95A 4AUQC 2KOXA 4I6LB 1R4MI 2D11A 2N7EA 1GJZA 4OVUA 4DBGA 2LI5A 3B1LX 1E8WA 3KVFB 3NHEB 2MX2A 4CO7A 1WJUA 2D3GA 2K6DB 3ZLZA 4DHJD 1ISNA 2IO2B 2UYZB 4HDOA 2D10A 2I1KA 2WX1A 4II2B 5L95C 4EEWA 2K8CA 1UBIA 2NCNA 1XT9B 2K8HA 4F8CB 4WJQA 2N1WA 2BGFA 1WMHA 3TCAA 2K8BA 3ZW3A 5IA7A 2QHOA 1WMHB 3VH3B 1WXSA 2GMIC 4LDTD 3T9LA 2R2QA 2CHWA 2Z59B 1E8XA 1I42A 2L76A 4FULA 2LD9A 4ZRJA 3ZDTA 4NQKE 4DDID 4BBNC 2K39A 1R4NI 3VQIA 3AU5A 1CMXB 3M63B 4FLHA 4IM0A 4NAWB 4LDTB 3ZTDA 3JYUA 3HM3A 4IG7B 2JZ3B 2LVOA 4GMVA 1OTRB 2KWUB 2O6VD 4EZJA 1WYWB 4HWIB 4RM9A 1FXTB 1J19A 3KYDD 2DYBA 3EECA 4FA6A 1LQBA 1WJNA 3DCGA 3HIZA 4ICUA 4JQWC 2MBQA 5J17A 3VFKA 2AEHA 3IHPC 1KLVA 1S3SG 1Q1OA 1GC7A 2JUOA 2W9NA 4K81A 3WANA 2L00B 2O2VB 2DZKA 1Q5WB 2DZJA 4HJKA 3ZO5B 3H1UA 3AXCA 2BPSA 2J0KA 2YVCA 2Z0DB 1UGMA 5CHWA 3L54A 5JHAA 1MG8A 3A33B 4KDLB 2AWTA 2IY0B 4WWNA 5CHVC 3GZNI 4DXAB 3RYTA 3EC8A 2DX5B 4JIOU 3A9KA 1UD7A 4KIKA 2DZIA 1WY8A 2N4FA 2ZEQA 3DDCB 3A9JB 1EUVB 2N1VA 4HVBA 3PS6A 3A9JA 4MEMA 3NZSA 5CTRC 1YX6B 4II3B 2N7DA 2R2OA 3B08A 2KX0A 2WYQA 4TKNA 1WX9A 4GDLA 3VAWA 1LM8B 4GDKA 1H8CA 3L13A 3CF6E 4WQOB 2O6VB 5L83A 3KYCD 2N9EB 1WM2A 2L8JA 1RFAA 2O6VA 3MTNB 5LXIB 1TTNA 3RCZA 2ZNVB 1WR1A 2Z0EB 4KZ0A 2AYOB 3QAQA 2IO1B 3OJ4B 4HXDA 1QZEA 2NPTB 2A5UA 2AL6A 5CHFA 3N3KB 2MRPA 3PRZA 1KOTA 4W9EA 4DHZE 3AULA 2UWQA 4GN1A 5D6JB 2NBVB 2NBWB 2C7MB 2IBIB 5IAAC 4W9DA 1P1AA 2MBHA 1WGDA 2ZNVC 1GG3A 3UGBB 2KC1A 1ZGUB 2FIDA 3X0WA 1OGWA 2M0XA 5J2RA 2C5LC 4GXBA 4WJNA 2C9WB 3ALBA 3KW5B 3RT3B 2RD0A 2L0TA 3PPAA 3RZFA 1TGZB 2KJRA 2ZPYA 2MCNB 1WFYA 2KWVB 2JPHA 3ONSA 4FBJB 3Q3JA 1IPGA 4K7SA 2DZMA 4PS3A 1IYFA 2KANA 4ZRKA 4ZDVA 4M8NA 3JSVA 1M94A 4LJOB 1L2NA 5AZFA 2I1JA 2ZVNA 3TJPA 3ZDMC 4MM3A 2KDBA 1WRDB 1NBFC 4FHJA 4ASWC 2LWPA 2IO3B 2HTHA 4CYEA 4AWJA 3TMPB 2LVPA 2KLCA 2DYMA 3KUZA 4DWFA 2C60A 3PTFC 2KVRA 2J7QB 5E6OA 1X1MA 3AU4A 4MDKE 2G3QB 3VUWA 4PYZA 2KN5A 4JGHB 3CSFA 1UH6A 2KZRA 2RR9A 1WI0A 3RULA 3RZWC 1WJ4A 1G6JA 3TBLD 4IUMB 3JVZX 3VHTC 2FNJB 4MSQB 3VXWA 4W9FA 2PPHA 3HM6X 2ZJDA 2FUHB 3QIJA 4LJPB 2NVUI 3PSEB 3V6CB 3IFWB 2O2VA 2ZZPB 3SD5A 4HPLB 5D2MB 2WDTB 4FADA 2YLMA 5C1ZA 2CU1A 1EF5A 3WA0A 2BWFA 4HK2A 4MGZE 2GBKA 1VCBA 3IBEA 2KJHB 1E5WA 1SGHA 2C7NB 4EUTA 5AZHA 1Q0WB 4FJZA 3DOWA 2N9PC 5CX3A 5J18A 4BKTA 4IWOA 3ECIA 1GUAB 3BY4B 3MJWA 2D07B 3T8MA 2KHWB 3WAOA 3PLUA 2DHZA 2KQ7A 1UELA 3L17A 4DHZB 1E7VA 3HHMA 2G4SA 2OOBB 1GC6A 2JWZA 3PGEA 2LXAA 3SHQA 2LGXA 4BOZB 2JXXA 4K1RB 2JZZA 4FHKA 4EKUA 1WZ3A 3QQ8B 2AL3A 2KFJA 3A1QB 3W1SA 1WH3A 2N9XA 4W9KA 4E74A 5AEKB 3A1QA 4EFOA 4XC2A 2EMTA 4ANVA 4FJYA 4WJPA 4BFRA 3VUYA 4A3PA 5JHBA 2B3AA 1E90A 1V80A 4GU2A 2KX3A 1U4AA 2MBEA 2KMAA 1WX8A 2LXCA 3QX1A 3DPDA 3KH0A 3ZNZB 3ZRCA 2CS4A 2NR2A 2WX0A 2MWSB 3VUXA 3ZVVA 1KJTA 1A5RA 1L7YA 4TQ1A 2HE7A 4GDLB 4I6PA 1NI2A 5FR6A 4EZKA 1TZ1A 1V2YA 4BBNF 1AARA 3PVLA 3VVWB 2WWZA 3U8ZA 2HJ8A 2LGDA 3LJ3A 1WE7A 3M95A 1YD8U 4ZRIA 3SDLC 4G11A 3QK0A 2J0JA 2NBUA 2G45B 3H6NA 2KK8A 4BKSA 2MA9B 2IY1B 2EMSA 3DBHI 2XK5B 2BF8B 3VTWA 2KTRB 3UQBA 4MGKE 2JF5A 3NZUA 1Y8RC 2KTRA 3M3JA 4K7WA 5DPWA 2DENB 3UINB 1ZW7A 4RM8A 4BKGA 1WM3A 4BOSC 3Q3FA 5DPSA 4A3OA 2KDFB 5DPRA 1LFDA 4MH0E 2L3ZA 5HKHA 1V9JA 4JLCA 2L0FA 2KKCA 4DK5A 2KLGA 4HCNB 4RMAA 1UZXB 2V4LA 4GGQA 3W1YA 3NOBA 3RUIB 5JH5C 4HPMB 4KSKC 4W9JA 2MBOA 1E8YA 2FIFA 3JSVB 1WIAA 2MSED 1WXVA 3HK0A 2BKFA 1P3QU 4HLEA 1P9DU 4W9HA 3QARA 1IP9A 3WAMA 3S2AA 2PE9A 2HD5B 3APDA 4B6WA 3DBRI 4TV3A 3V6EB 3OJ3A 3H7SA 1V5TA 2EKEC 4HCPB 4MGIE 4W9LA 5E6NA 1I35A 2KXJA 3ZNGC 2A4ZA 3GOEA 4F7ZA 4IM3A 2M17A 3L10B 4GIVA 5G55A 3PHXB 2JY6A 4NAWA 4IWPA 4IM2A 2GOWA 4KSLC 4NPNA 4DDGD 2GBNA 3QHTA 5BO4B 4GOCA 2BWES 4M0WB 3DBLI 2CHXA 4ICVA 4JL9A 2FCNA 4AP4C 3UQAA 2BKRB 1F9JA 1RRBA 3M62B 1J0GA 3KUDB 4AOFA 2L7RA 4G50A 2GBRA 5LLIA 2FCMA 2KJ6A 2LGYA 5DCNA 3NS8A 4NNJB 1PQSA 2LJ5A 1V6EA 2RPQA 3MHSD 5D7GA 3VTUA 3WAPA 3R7QA 3W1SC 1TBEA 2DYOA 4G3XB 4BKSD 4G0NB 4PYUA 1SIFA 2KDIA 3VDZA 4IC7B 1VD2A 3PLVA 3UIPB 3PREA 4K7UA 5D94A 1V5OA 2XBBC 2KMCA 1J8CA 3ML9A 1WGRA 4BVUC 3A9KB 1K8RB 2REXA 3K9OB 2KO3A 2FCQA 3I3TB 3V60A 4EZLA 2K25A 2G4DB 2V3SA 1S1QB 3P2BA 4KDIC 3QCAA 4YL8A 2JRHA 3KUCB 1OEYA 4J6IA 2DAJA 3K9PB 3H9DA 4KZCA 3IG3A 4ANWA 1WXMA 4W9CA 3UIOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E8Z A;  5GMV A;  2D2Q A;  4AJY B;  3PHW B;  2LVQ A;  2KWC A;  2MQJ A;  3U30 A;  3R3M A;  3ZTC A;  5LXH A;  1YIW A;  3DBS A;  2FAZ A;  2VRR B;  2PJH A;  3B0A A;  3ZUN A;  3ZKJ C;  3BIN A;  4WWP A;  3H7P A;  4W9I A;  4TQ0 A;  2KD0 A;  2FCS A;  3LDZ E;  3JW0 X;  3H7P B;  4WJO A;  2XK5 A;  2ASQ A;  4OVV A;  4E71 A;  3V62 A;  2ZPN A;  3QA8 A;  4EOY A;  2M8S A;  5JZE B;  4I6N B;  3N32 A;  2KQS A;  3PT2 B;  4N9F 4;  3TIX A;  1NDD A;  2J0M A;  4KV2 A;  3L08 A;  3NY5 A;  4DHJ B;  4IW0 A;  4P7I A;  1WZ0 A;  3DQV A;  1C3T A;  3AI5 A;  1EF1 A;  1Z5S B;  2CKH B;  1WX7 A;  4IWQ A;  1HE8 A;  2CHZ A;  4XX5 A;  3R7R A;  3VTV A;  4NJ7 A;  3EFU A;  3QWZ B;  4CHK A;  2RGF A;  1Z2M A;  2MBB B;  2IO0 B;  2K1F A;  1V49 A;  2V1Y A;  2GBJ A;  1YQB A;  3U7D A;  3OLM D;  3TL5 A;  4NY0 A;  4FJV B;  4NJ6 A;  4WWO A;  1JRU A;  2MLB A;  4KVG B;  2LUE A;  2M1M A;  5E6P A;  4ANX A;  1SE9 A;  3R66 C;  2ZVO A;  1WGH A;  1OEY J;  1YJ1 A;  3CST A;  4PS8 A;  1YX5 B;  3DVN U;  3DVG Y;  4GB9 A;  2MW5 A;  3ENE A;  4M8M A;  4WAA A;  3APC A;  1P98 A;  4KIK B;  3ML8 A;  2Y5B B;  1D3Z A;  2LZ6 A;  4NQL B;  4GSW A;  2M4N A;  1H4R A;  3DVN V;  3APF A;  5KHO A;  3L16 A;  4F1S A;  4X57 B;  1LXD A;  3WIM A;  1OQY A;  5C23 A;  2K6Q A;  3DVG X;  4LCD E;  4PS7 A;  4ANU A;  2IZV B;  4GDK B;  2RSU A;  4E3C A;  1T0Y A;  2KDE B;  2LRU A;  2ZCB A;  4XZ4 A;  5AZG A;  5G2N A;  3N30 A;  1WE6 A;  3C0R B;  4URK A;  4A20 A;  1ZKH A;  1BT0 A;  2JRI B;  3A4S C;  1GNU A;  3PV1 A;  3ZNH B;  2XEW A;  3QJZ A;  2JVC A;  2IYD B;  1XD3 B;  4AJW A;  3EHV A;  2KC2 A;  1E7U A;  1KM7 A;  3O65 B;  2KNB A;  1WJ6 A;  1RAX A;  4B9K A;  4MSM B;  1UBQ A;  5TR5 A;  5DPT A;  3OAW A;  2BYF A;  2ZCC A;  2L05 A;  4MJS B;  3L0W B;  1WGY A;  3ZIM A;  5KHQ A;  2KFK B;  4ZYN A;  4MJS A;  4W9G A;  3PRM B;  2KFK A;  2PEA A;  2PE6 B;  3SU8 X;  4TUU A;  1WXA A;  1P0R A;  2MP2 B;  3RD2 A;  1XQQ A;  2BYE A;  2MP2 A;  3X23 A;  2JT4 B;  3A4R A;  3V61 A;  3D32 A;  1V86 A;  5EDS A;  3CMM B;  1WF9 A;  1WR6 E;  3PZD A;  2C7H A;  2BYV E;  3ZNI D;  2CR5 A;  2GBM A;  1EO6 A;  4MEL A;  1C1Y B;  3ZRF A;  4FN2 A;  1V81 A;  3PRP B;  4HDQ A;  2KTF A;  2LAS A;  2NPT A;  4MGY E;  2OJR A;  2DAF A;  3UF8 A;  2NS5 A;  2LRW A;  3QC8 B;  1RLF A;  1WGG A;  3WAL A;  3VH4 B;  3IVF A;  4B95 A;  4AUQ C;  2KOX A;  4I6L B;  1R4M I;  2D11 A;  2N7E A;  1GJZ A;  4OVU A;  4DBG A;  2LI5 A;  3B1L X;  1E8W A;  3KVF B;  3NHE B;  2MX2 A;  4CO7 A;  1WJU A;  2D3G A;  2K6D B;  3ZLZ A;  4DHJ D;  1ISN A;  2IO2 B;  2UYZ B;  4HDO A;  2D10 A;  2I1K A;  2WX1 A;  4II2 B;  5L95 C;  4EEW A;  2K8C A;  1UBI A;  2NCN A;  1XT9 B;  2K8H A;  4F8C B;  4WJQ A;  2N1W A;  2BGF A;  1WMH A;  3TCA A;  2K8B A;  3ZW3 A;  5IA7 A;  2QHO A;  1WMH B;  3VH3 B;  1WXS A;  2GMI C;  4LDT D;  3T9L A;  2R2Q A;  2CHW A;  2Z59 B;  1E8X A;  1I42 A;  2L76 A;  4FUL A;  2LD9 A;  4ZRJ A;  3ZDT A;  4NQK E;  4DDI D;  4BBN C;  2K39 A;  1R4N I;  3VQI A;  3AU5 A;  1CMX B;  3M63 B;  4FLH A;  4IM0 A;  4NAW B;  4LDT B;  3ZTD A;  3JYU A;  3HM3 A;  4IG7 B;  2JZ3 B;  2LVO A;  4GMV A;  1OTR B;  2KWU B;  2O6V D;  4EZJ A;  1WYW B;  4HWI B;  4RM9 A;  1FXT B;  1J19 A;  3KYD D;  2DYB A;  3EEC A;  4FA6 A;  1LQB A;  1WJN A;  3DCG A;  3HIZ A;  4ICU A;  4JQW C;  2MBQ A;  5J17 A;  3VFK A;  2AEH A;  3IHP C;  1KLV A;  1S3S G;  1Q1O A;  1GC7 A;  2JUO A;  2W9N A;  4K81 A;  3WAN A;  2L00 B;  2O2V B;  2DZK A;  1Q5W B;  2DZJ A;  4HJK A;  3ZO5 B;  3H1U A;  3AXC A;  2BPS A;  2J0K A;  2YVC A;  2Z0D B;  1UGM A;  5CHW A;  3L54 A;  5JHA A;  1MG8 A;  3A33 B;  4KDL B;  2AWT A;  2IY0 B;  4WWN A;  5CHV C;  3GZN I;  4DXA B;  3RYT A;  3EC8 A;  2DX5 B;  4JIO U;  3A9K A;  1UD7 A;  4KIK A;  2DZI A;  1WY8 A;  2N4F A;  2ZEQ A;  3DDC B;  3A9J B;  1EUV B;  2N1V A;  4HVB A;  3PS6 A;  3A9J A;  4MEM A;  3NZS A;  5CTR C;  1YX6 B;  4II3 B;  2N7D A;  2R2O A;  3B08 A;  2KX0 A;  2WYQ A;  4TKN A;  1WX9 A;  4GDL A;  3VAW A;  1LM8 B;  4GDK A;  1H8C A;  3L13 A;  3CF6 E;  4WQO B;  2O6V B;  5L83 A;  3KYC D;  2N9E B;  1WM2 A;  2L8J A;  1RFA A;  2O6V A;  3MTN B;  5LXI B;  1TTN A;  3RCZ A;  2ZNV B;  1WR1 A;  2Z0E B;  4KZ0 A;  2AYO B;  3QAQ A;  2IO1 B;  3OJ4 B;  4HXD A;  1QZE A;  2NPT B;  2A5U A;  2AL6 A;  5CHF A;  3N3K B;  2MRP A;  3PRZ A;  1KOT A;  4W9E A;  4DHZ E;  3AUL A;  2UWQ A;  4GN1 A;  5D6J B;  2NBV B;  2NBW B;  2C7M B;  2IBI B;  5IAA C;  4W9D A;  1P1A A;  2MBH A;  1WGD A;  2ZNV C;  1GG3 A;  3UGB B;  2KC1 A;  1ZGU B;  2FID A;  3X0W A;  1OGW A;  2M0X A;  5J2R A;  2C5L C;  4GXB A;  4WJN A;  2C9W B;  3ALB A;  3KW5 B;  3RT3 B;  2RD0 A;  2L0T A;  3PPA A;  3RZF A;  1TGZ B;  2KJR A;  2ZPY A;  2MCN B;  1WFY A;  2KWV B;  2JPH A;  3ONS A;  4FBJ B;  3Q3J A;  1IPG A;  4K7S A;  2DZM A;  4PS3 A;  1IYF A;  2KAN A;  4ZRK A;  4ZDV A;  4M8N A;  3JSV A;  1M94 A;  4LJO B;  1L2N A;  5AZF A;  2I1J A;  2ZVN A;  3TJP A;  3ZDM C;  4MM3 A;  2KDB A;  1WRD B;  1NBF C;  4FHJ A;  4ASW C;  2LWP A;  2IO3 B;  2HTH A;  4CYE A;  4AWJ A;  3TMP B;  2LVP A;  2KLC A;  2DYM A;  3KUZ A;  4DWF A;  2C60 A;  3PTF C;  2KVR A;  2J7Q B;  5E6O A;  1X1M A;  3AU4 A;  4MDK E;  2G3Q B;  3VUW A;  4PYZ A;  2KN5 A;  4JGH B;  3CSF A;  1UH6 A;  2KZR A;  2RR9 A;  1WI0 A;  3RUL A;  3RZW C;  1WJ4 A;  1G6J A;  3TBL D;  4IUM B;  3JVZ X;  3VHT C;  2FNJ B;  4MSQ B;  3VXW A;  4W9F A;  2PPH A;  3HM6 X;  2ZJD A;  2FUH B;  3QIJ A;  4LJP B;  2NVU I;  3PSE B;  3V6C B;  3IFW B;  2O2V A;  2ZZP B;  3SD5 A;  4HPL B;  5D2M B;  2WDT B;  4FAD A;  2YLM A;  5C1Z A;  2CU1 A;  1EF5 A;  3WA0 A;  2BWF A;  4HK2 A;  4MGZ E;  2GBK A;  1VCB A;  3IBE A;  2KJH B;  1E5W A;  1SGH A;  2C7N B;  4EUT A;  5AZH A;  1Q0W B;  4FJZ A;  3DOW A;  2N9P C;  5CX3 A;  5J18 A;  4BKT A;  4IWO A;  3ECI A;  1GUA B;  3BY4 B;  3MJW A;  2D07 B;  3T8M A;  2KHW B;  3WAO A;  3PLU A;  2DHZ A;  2KQ7 A;  1UEL A;  3L17 A;  4DHZ B;  1E7V A;  3HHM A;  2G4S A;  2OOB B;  1GC6 A;  2JWZ A;  3PGE A;  2LXA A;  3SHQ A;  2LGX A;  4BOZ B;  2JXX A;  4K1R B;  2JZZ A;  4FHK A;  4EKU A;  1WZ3 A;  3QQ8 B;  2AL3 A;  2KFJ A;  3A1Q B;  3W1S A;  1WH3 A;  2N9X A;  4W9K A;  4E74 A;  5AEK B;  3A1Q A;  4EFO A;  4XC2 A;  2EMT A;  4ANV A;  4FJY A;  4WJP A;  4BFR A;  3VUY A;  4A3P A;  5JHB A;  2B3A A;  1E90 A;  1V80 A;  4GU2 A;  2KX3 A;  1U4A A;  2MBE A;  2KMA A;  1WX8 A;  2LXC A;  3QX1 A;  3DPD A;  3KH0 A;  3ZNZ B;  3ZRC A;  2CS4 A;  2NR2 A;  2WX0 A;  2MWS B;  3VUX A;  3ZVV A;  1KJT A;  1A5R A;  1L7Y A;  4TQ1 A;  2HE7 A;  4GDL B;  4I6P A;  1NI2 A;  5FR6 A;  4EZK A;  1TZ1 A;  1V2Y A;  4BBN F;  1AAR A;  3PVL A;  3VVW B;  2WWZ A;  3U8Z A;  2HJ8 A;  2LGD A;  3LJ3 A;  1WE7 A;  3M95 A;  1YD8 U;  4ZRI A;  3SDL C;  4G11 A;  3QK0 A;  2J0J A;  2NBU A;  2G45 B;  3H6N A;  2KK8 A;  4BKS A;  2MA9 B;  2IY1 B;  2EMS A;  3DBH I;  2XK5 B;  2BF8 B;  3VTW A;  2KTR B;  3UQB A;  4MGK E;  2JF5 A;  3NZU A;  1Y8R C;  2KTR A;  3M3J A;  4K7W A;  5DPW A;  2DEN B;  3UIN B;  1ZW7 A;  4RM8 A;  4BKG A;  1WM3 A;  4BOS C;  3Q3F A;  5DPS A;  4A3O A;  2KDF B;  5DPR A;  1LFD A;  4MH0 E;  2L3Z A;  5HKH A;  1V9J A;  4JLC A;  2L0F A;  2KKC A;  4DK5 A;  2KLG A;  4HCN B;  4RMA A;  1UZX B;  2V4L A;  4GGQ A;  3W1Y A;  3NOB A;  3RUI B;  5JH5 C;  4HPM B;  4KSK C;  4W9J A;  2MBO A;  1E8Y A;  2FIF A;  3JSV B;  1WIA A;  2MSE D;  1WXV A;  3HK0 A;  2BKF A;  1P3Q U;  4HLE A;  1P9D U;  4W9H A;  3QAR A;  1IP9 A;  3WAM A;  3S2A A;  2PE9 A;  2HD5 B;  3APD A;  4B6W A;  3DBR I;  4TV3 A;  3V6E B;  3OJ3 A;  3H7S A;  1V5T A;  2EKE C;  4HCP B;  4MGI E;  4W9L A;  5E6N A;  1I35 A;  2KXJ A;  3ZNG C;  2A4Z A;  3GOE A;  4F7Z A;  4IM3 A;  2M17 A;  3L10 B;  4GIV A;  5G55 A;  3PHX B;  2JY6 A;  4NAW A;  4IWP A;  4IM2 A;  2GOW A;  4KSL C;  4NPN A;  4DDG D;  2GBN A;  3QHT A;  5BO4 B;  4GOC A;  2BWE S;  4M0W B;  3DBL I;  2CHX A;  4ICV A;  4JL9 A;  2FCN A;  4AP4 C;  3UQA A;  2BKR B;  1F9J A;  1RRB A;  3M62 B;  1J0G A;  3KUD B;  4AOF A;  2L7R A;  4G50 A;  2GBR A;  5LLI A;  2FCM A;  2KJ6 A;  2LGY A;  5DCN A;  3NS8 A;  4NNJ B;  1PQS A;  2LJ5 A;  1V6E A;  2RPQ A;  3MHS D;  5D7G A;  3VTU A;  3WAP A;  3R7Q A;  3W1S C;  1TBE A;  2DYO A;  4G3X B;  4BKS D;  4G0N B;  4PYU A;  1SIF A;  2KDI A;  3VDZ A;  4IC7 B;  1VD2 A;  3PLV A;  3UIP B;  3PRE A;  4K7U A;  5D94 A;  1V5O A;  2XBB C;  2KMC A;  1J8C A;  3ML9 A;  1WGR A;  4BVU C;  3A9K B;  1K8R B;  2REX A;  3K9O B;  2KO3 A;  2FCQ A;  3I3T B;  3V60 A;  4EZL A;  2K25 A;  2G4D B;  2V3S A;  1S1Q B;  3P2B A;  4KDI C;  3QCA A;  4YL8 A;  2JRH A;  3KUC B;  1OEY A;  4J6I A;  2DAJ A;  3K9P B;  3H9D A;  4KZC A;  3IG3 A;  4ANW A;  1WXM A;  4W9C A;  3UIO B; 
#chains in the Genus database with same CATH topology
 4AJY B;  2IDY A;  1SXT A;  3PHW B;  1FM0 D;  3DBS A;  2VRR B;  3ZUN A;  1QKZ A;  2N0S B;  3JW0 X;  4WJO A;  4OVV A;  3V62 A;  1Y56 A;  1UUP A;  3VR9 B;  5JZE B;  3PT2 B;  1NDD A;  4DHJ B;  4IW0 A;  3DQV A;  3AI5 A;  3IAS 1;  1SE3 A;  3WCQ A;  1WX7 A;  1HE8 A;  2CHZ A;  3QWZ B;  1Z2M A;  2MBB B;  4JWS C;  2LMC A;  3U7D A;  4NJ6 A;  4MM3 B;  2LUE A;  4ANX A;  3R66 C;  2ZVO A;  2V9H A;  3DVN U;  2BBC A;  4KIK B;  1C78 A;  4K3C A;  3ML8 A;  4WAF A;  2LZ6 A;  2M4N A;  5KHO A;  3AEF B;  3L16 A;  4OVZ A;  4F1S A;  2RSU A;  5BMG A;  2ZCB A;  4LNK A;  3N30 A;  1XLN A;  1FPY A;  2ICI A;  4FXC A;  4A20 A;  1BT0 A;  1CJE A;  2DLB A;  3PV1 A;  2WU5 B;  2JVC A;  2IYD B;  1XD3 B;  4AJW A;  4CQN A;  4TSS A;  3DWM A;  4MSM B;  1BML C;  2GRI A;  1MHH E;  3PRM B;  2KFK A;  2PE6 B;  1WXA A;  2Q5W D;  2KT7 A;  5FR3 A;  2W82 A;  3V61 A;  1V86 A;  3CMM B;  1WF9 A;  2C7H A;  2CR5 A;  2GBM A;  2IJ0 A;  4MEL A;  1C1Y B;  4FN2 A;  2FE8 A;  3PRP B;  2M0A A;  3MP9 A;  1VR9 A;  3FIL B;  4KGS A;  4MGY E;  1KH0 A;  3IVF A;  3VRB B;  4TMA B;  2KYW A;  4LLG M;  3AH7 A;  4OVU A;  2WDQ B;  4DBG A;  2LI5 A;  3B1L X;  1E8W A;  3VR8 B;  3NHE B;  1L0X B;  1WJU A;  2D3G A;  4JPS A;  5LNK 1;  1DYQ A;  1XT9 B;  1WMH A;  3AE8 B;  3TCA A;  1A70 A;  2GMI C;  1I42 A;  2LD9 A;  4NQK E;  3GZN B;  4BBN C;  1ZXI A;  1FNU A;  4FLH A;  3M63 B;  2WP9 B;  2JZ3 B;  2LVO A;  1OTR B;  2KWU B;  2W3S A;  1FXT B;  3KYD D;  2DYB A;  4FA6 A;  2D3C A;  1VZ7 A;  2MHJ A;  3BK2 A;  4LNO A;  2L00 B;  5EE0 A;  4HJK A;  3H1U A;  4N6E B;  2BPS A;  3U52 E;  3GE8 C;  1N61 A;  1UGM A;  2Z0D B;  5CHW A;  4A8X C;  4KGR A;  1MG8 A;  2HTM E;  4WWN A;  3GZN I;  1YN4 A;  3RYT A;  1C4C A;  1UD7 A;  4KIK A;  2DZI A;  1V1P B;  2N4F A;  2ZEQ A;  3A9J B;  1N5X A;  1I4X A;  2QCZ A;  3PS6 A;  4HVB A;  1UNS A;  5CTR C;  5IOI A;  2H88 B;  2R2O A;  4TKN A;  1QT9 A;  1HTO A;  1H8C A;  1ROE A;  1TS5 A;  4HRS A;  5L83 A;  1WM2 A;  2O6V A;  3KQ4 A;  3RCZ A;  1LO5 D;  2HDE A;  2ZNV B;  2AYO B;  4YXD B;  3AEC B;  2NPT B;  2A5U A;  3N3K B;  3E56 A;  2MRP A;  2UWQ A;  4GN1 A;  1FXA A;  2C7M B;  5IAA C;  1GG3 A;  1MHX A;  2PVO D;  5G5G A;  4US8 A;  3AEB B;  3ALB A;  3Q69 A;  1XEE A;  2L0T A;  2ZPY A;  2JPH A;  2MH7 A;  4FBJ B;  2AQ3 B;  3FIL A;  4KX6 B;  4LJO B;  3TJP A;  4MM3 A;  3MC8 A;  2LWP A;  4AWJ A;  1E6E B;  1D5Z C;  3AN1 A;  1XLO A;  1X1M A;  4MDK E;  1SB3 C;  2AQ2 B;  3CSF A;  1UH6 A;  1ET9 A;  1T0S C;  1WI0 A;  3AE5 B;  3NJT A;  2OJW A;  5HI1 A;  3SR6 A;  2KVZ A;  1K53 A;  5BMH A;  2K5P A;  4MSQ B;  4W9F A;  2PPH A;  1B9R A;  3HM6 X;  1AW7 A;  2FUH B;  2BS2 B;  2NVU I;  2O2V A;  2ZZP B;  3AM9 A;  3SD5 A;  1MFW A;  1XLP A;  1VJK A;  4FAD A;  5BYR A;  3IXS A;  2J4X A;  2WXM A;  4HK2 A;  3Q3M C;  2Z8L A;  2BYT A;  1E5W A;  5AZH A;  1Q0W B;  2CJO A;  3PZ7 A;  2LEK A;  1AYF A;  1T6B X;  3Q2A C;  4BKT A;  3ECI A;  1GUA B;  1NVI D;  2KMM A;  1QOA A;  1ZPS A;  3PLU A;  2L1A A;  1UEL A;  1JQ4 A;  4DHZ B;  1CQV A;  2OOB B;  3SHQ A;  2JWZ A;  4FHK A;  4EKU A;  1WZ3 A;  1WH3 A;  4W9K A;  4E74 A;  1I4Q A;  4XC2 A;  1WXQ A;  1F52 A;  2B3A A;  1L5P A;  2MBE A;  1WX8 A;  1I4H A;  2Y3A A;  3DPD A;  1JRP A;  1MI0 A;  3ZVV A;  2WS3 B;  4K3B A;  4I6P A;  2RPV A;  5FR6 A;  4OW0 A;  1JWU D;  1SEB D;  2HJ8 A;  2LGD A;  1E9M A;  3NS1 A;  3AE1 B;  1YD8 U;  3BYY B;  3QK0 A;  2NBU A;  4MT5 A;  2LUM A;  1STE A;  4O1N A;  2IY1 B;  3VTW A;  2KTR B;  2DEN B;  3T3O A;  1OFF A;  1ZW7 A;  2DWQ A;  3C8Y A;  1AWD A;  3Q3F A;  4RGN A;  2L3Z A;  4US9 A;  4HCN B;  1UZX B;  1V97 A;  5JH5 C;  4KSK C;  2FIF A;  4YTP B;  3RNF C;  1P3Q U;  3Q8A A;  4HLE A;  1IP9 A;  4DXG A;  3TEX A;  1JAL A;  1FMA D;  1V1P A;  5E6N A;  1I35 A;  2KXJ A;  4XWT A;  3NVY A;  4GIV A;  5I4D A;  4IWP A;  4IM2 A;  4NPN A;  4DDG D;  4P1C C;  3QHT A;  4P16 A;  5BO4 B;  4GOC A;  3DBL I;  4JL9 A;  3KWL A;  3KLS X;  3KUD B;  4AOF A;  1EU4 A;  5GXG B;  2KAJ A;  2KJ6 A;  2LGY A;  5DCN A;  2QIL A;  2WXR A;  4NNJ B;  2LJ5 A;  1V6E A;  1TBE A;  4G3X B;  4G0N B;  4IC7 B;  1VD2 A;  3CWI A;  5D94 A;  2XBB C;  2QSD A;  5C3J B;  3A9K B;  1TJE A;  2REX A;  2WXO A;  2G1E A;  2KO3 A;  3RNG C;  3V60 A;  1FNW A;  4KDI C;  5D3D A;  2BTE A;  1VDV A;  2JWU A;  3IG3 A;  2LVQ A;  3U30 A;  2WHI A;  1YIW A;  4B0E A;  3ZKJ C;  2FCS A;  3H7P B;  2XK5 A;  2ZPN A;  1PGX A;  4EOY A;  4I6N B;  1JCK B;  2KQS A;  3TIX A;  3L08 A;  1TS2 A;  4P7I A;  1WZ0 A;  1C3T A;  2QMT A;  2CKH B;  3Q8B A;  3P4S B;  4IWQ A;  2OED A;  4OZC A;  3EFU A;  4A55 A;  2V1Y A;  3OLM D;  3TL5 A;  4NY0 A;  2G9H D;  3BYT B;  3N9Y C;  1JRU A;  5E6P A;  4KVG B;  3ZXV A;  2MW5 A;  2J53 A;  4MH8 A;  4R3D A;  4NQL B;  1T0Q C;  4GSW A;  4JE3 B;  2PVG C;  1HTQ A;  2K6Q A;  4ANU A;  3P63 A;  1VRA B;  1T0Y A;  1WE6 A;  2L32 A;  3C0R B;  5EE9 A;  4LNN A;  2EKI A;  2JRI B;  3A4S C;  3ZNH B;  4C7Z A;  3EHV A;  1E7U A;  1C4P A;  1KM7 A;  3FAH A;  1WJ6 A;  1WYG A;  1RAX A;  1F2R C;  5TR5 A;  5DPT A;  3OAW A;  2L05 A;  4MJS B;  4W9G A;  3SU8 X;  4TUU A;  1P0R A;  2MP2 A;  3X23 A;  2X8X X;  5BMI A;  3D32 A;  5EDS A;  3PZD A;  1C77 A;  3FKY A;  3OG5 A;  1EO6 A;  1N5W A;  3ZRF A;  5HHD G;  2E6X A;  4HDQ A;  2IGD A;  2LAS A;  4A6Q A;  2DAF A;  3TSS A;  1WGG A;  1TZO A;  2WXJ A;  2N7E A;  1GJZ A;  3KVF B;  1C4A A;  1I7H A;  2QC8 A;  1E7P B;  2BS3 B;  5D3I B;  2MJ3 A;  1YN3 A;  4DHJ D;  2UYZ B;  2WX1 A;  1DOI A;  3RNB C;  5L95 C;  1UBI A;  4F8C B;  2N1W A;  5IA7 A;  2QHO A;  4HEA 1;  3T9L A;  2CHW A;  2LJI A;  3GS2 A;  4ZRJ A;  1VZ6 A;  3O13 A;  1TY0 A;  3AU5 A;  1CMX B;  1CZP A;  2LHE A;  4IM0 A;  3BWU D;  3V3X A;  4XDC A;  3ZQ4 A;  3SEB A;  3ZTD A;  3HM3 A;  2M56 B;  2O6V D;  3EEC A;  1WJN A;  5J17 A;  4JQW C;  2MBQ A;  4WH4 A;  2RDB C;  1Q1O A;  1GC7 A;  4K81 A;  2DZK A;  2DZJ A;  1NYQ A;  1SIJ A;  2J0K A;  3U4E G;  1E0Z A;  3A33 B;  1ENF A;  4KDL B;  1KTK A;  1JWB D;  1N63 A;  2IY0 B;  2R61 A;  3A9K A;  3GE3 C;  1WY8 A;  1V8C A;  2N9L A;  1EUV B;  4MEM A;  5EE3 A;  4II3 B;  2KQ4 X;  3B08 A;  2KX0 A;  3P1M A;  4GDL A;  1LM8 B;  2QDF A;  1JRO A;  3L13 A;  3KYC D;  2JX5 A;  2N9E B;  1RFA A;  3MTN B;  2Z0E B;  3QAQ A;  1GPX A;  3OJ4 B;  3TEW A;  2GLS A;  4HXD A;  1BXT A;  1KOT A;  2QIE B;  3UGB B;  2KC1 A;  1ZGU B;  2M0X A;  3Q3O C;  5J2R A;  1TKG A;  1XCQ L;  2C9W B;  3RT3 B;  3NG0 A;  2RD0 A;  3PPA A;  1YQ4 B;  3RZF A;  2KWD A;  2KWV B;  3ONS A;  3Q3J A;  1IPG A;  2DZM A;  2BVC A;  1L2N A;  5AZF A;  2I1J A;  1D3Z A;  1VZ8 A;  4CYE A;  2IO3 B;  3TMP B;  2LVP A;  3KUZ A;  2DYM A;  4DWF A;  2C60 A;  2KVR A;  2IND C;  2G3Q B;  3VUW A;  4PK1 A;  2KN5 A;  4LTU A;  1WGK A;  2PKO A;  1DGJ A;  4XE0 A;  4MAC A;  3ETR A;  3VXW A;  3Q6B A;  3U2S C;  4LJP B;  3PSE B;  3V6C B;  3IFW B;  1HZ6 A;  1N6Z A;  2BQQ A;  2N9K A;  4HPL B;  2YLM A;  5C1Z A;  1ZUD 2;  1EF5 A;  3WA0 A;  2BWF A;  4M02 A;  2WDR B;  1VCB A;  3NVV A;  2KJH B;  2JYE A;  1K52 A;  1SE2 A;  2PLP A;  4IWO A;  1IGC A;  3BY4 B;  3MJW A;  1XXG A;  2WU2 B;  2D07 B;  2DNF A;  2RDG A;  2KQ7 A;  3HHM A;  4XDD A;  3B2G A;  1GC6 A;  3PGE A;  2LGX A;  1V1O A;  2JZZ A;  4LNI A;  3B9J A;  3W1S A;  3A1Q B;  2MJD A;  4ANV A;  2CU3 A;  1ZDX A;  1Q10 A;  4IKG A;  3Q14 C;  4J3O D;  4A3P A;  2WXQ A;  5JHB A;  2KMA A;  3LYY A;  1QOB A;  2WDV B;  3KH0 A;  3ZRC A;  2CS4 A;  2NR2 A;  3ZXR A;  1L7Y A;  4TQ1 A;  4GDL B;  3KWV A;  5G5H A;  2L52 A;  3VVW B;  3U8Z A;  4HJG E;  3LJ3 A;  1WE7 A;  3M95 A;  3SDL C;  2KN4 A;  3H6N A;  4BKS A;  3R2I A;  2EMS A;  3P4P B;  4DQO C;  2JF5 A;  4M01 A;  5DPW A;  3PZ8 A;  4BKG A;  5DPS A;  1V9J A;  3BZD B;  4RMA A;  4IOI E;  1UWM A;  4S17 A;  3RUI B;  4RH6 A;  1E8Y A;  1WIA A;  1WXV A;  3HK0 A;  3V05 A;  2AX5 A;  5FK9 C;  2WGS A;  1TIF A;  2HD5 B;  3APD A;  4B6W A;  4TV3 A;  3V6E B;  3TEZ A;  3H7S A;  1OQQ A;  3AE2 B;  1F1H A;  3GOE A;  3L10 B;  3PHX B;  4NAW A;  3AE3 B;  3I63 C;  2BWE S;  4M0W A;  1YN5 A;  3N1Y C;  4ICV A;  1XF5 L;  3Q3N C;  2BKR B;  1F9J A;  2WXK A;  3M62 B;  4YT0 B;  2L7R A;  3AE9 B;  2I38 A;  4RFB A;  1TS4 A;  2XNA C;  3MHS D;  5D7G A;  3R7Q A;  3W1S C;  5IO9 A;  4PYU A;  2KDI A;  3PLV A;  2NTS A;  3UIP B;  3PRE A;  2QJL A;  1ACC A;  1J8C A;  1HZ5 A;  1T5X D;  3AV8 A;  1PGB A;  1YNT E;  1KRH A;  4YSY B;  5EE1 A;  2K25 A;  2G4D B;  5IKC M;  2V3S A;  1FCL A;  3QCA A;  3KUC B;  1OEY A;  2DAJ A;  3K9P B;  3EFC A;  2BW2 A;  4KZC A;  4W9C A;  3UIO B;  1E8Z A;  5GMV A;  2D2Q A;  1D5X C;  1HXY D;  2KWC A;  2MQJ A;  4RGO S;  3ZTC A;  4YSZ B;  2FAZ A;  3B0A A;  1RWS A;  3H8H A;  1TS3 A;  4W9I A;  4TQ0 A;  1R4N B;  5BYS A;  4E71 A;  4ZRP A;  4AS1 A;  3Q8E A;  2M8S A;  1YQ3 B;  4KV2 A;  3MC9 A;  2JU6 X;  1L0Y B;  2UU7 A;  4PT5 A;  1EF1 A;  1Z5S B;  1ZP0 B;  4XX5 A;  3VTV A;  2IO0 B;  4L1B A;  2K1F A;  3R8B A;  4C4V B;  3DWG C;  2WQY B;  5HG2 A;  2SEB D;  1TKE A;  1NEN B;  3RN9 C;  2MLB A;  3DHH C;  3PO0 A;  1SE9 A;  5KHQ A;  1YJ1 A;  1YX5 B;  3DVG Y;  3ENE A;  4WIP A;  3NRZ A;  3APC A;  1P98 A;  5JXV A;  3HUI A;  4X57 B;  3WIM A;  1K51 A;  1OQY A;  1PUT A;  3DVG X;  1T3Q A;  1RM6 C;  2K22 A;  4E3C A;  2LRU A;  5G2N A;  3RNC C;  4URK A;  4N58 A;  2XEW A;  3QJZ A;  2KC2 A;  4ARI A;  2KNB A;  4B9K A;  4QAY A;  3UI3 A;  2GI9 A;  2ZCC A;  2Y5P A;  2KFK B;  3CIR B;  4C80 A;  2PEA A;  4OZB A;  2BS4 B;  1XQQ A;  2BYE A;  4ZRQ A;  1WR6 E;  3TEY A;  3AEG B;  1V81 A;  2GB1 A;  2KTF A;  3UF8 A;  2IGH A;  1RLF A;  3VH4 B;  1FIQ A;  2KOX A;  4AUQ C;  4I6L B;  2D11 A;  1T0R C;  3BVZ A;  1OQR A;  3VRA B;  2MX2 A;  3DHI C;  4CO7 A;  2WNM A;  2K6D B;  3ZLZ A;  1ISN A;  2IO2 B;  2V3N A;  4II2 B;  4EEW A;  2NCN A;  1R4M B;  2K8H A;  4WJQ A;  3ZW3 A;  3ZGZ A;  1WMH B;  1WXS A;  4LDT D;  2R2Q A;  1E8X A;  3FC4 A;  2L76 A;  4FUL A;  4DDI D;  1WRI A;  1FXI A;  1R4N I;  2K39 A;  3VQI A;  1NI3 A;  3IT6 B;  4NAW B;  2IPK D;  3JYU A;  3EUB 2;  4L23 A;  4EE2 A;  4EZJ A;  3MHZ A;  4RM9 A;  3HIZ A;  2J42 A;  3VFK A;  2AEH A;  3IHP C;  1KLV A;  1S3S G;  1TYG B;  2W9N A;  1I4R A;  3GP7 A;  1FRD A;  3ZO5 B;  1ESF A;  1LGR A;  2WXL A;  5C2T B;  4C4V A;  2VH1 A;  5JHA A;  1KFY B;  4NJC A;  4ARC A;  4DXA B;  4NZL B;  3EC8 A;  5MPO A;  2DX5 B;  2INP E;  2ONQ A;  4BZA A;  4UDU C;  4ACF A;  1UGJ A;  2MJE A;  2N1V A;  3A9J A;  3NZS A;  2INC C;  1IUE A;  3VAW A;  4XWW A;  2O6V B;  2K0P A;  5LXI B;  1WR1 A;  1MJD A;  3I5J C;  2IO1 B;  1ET6 A;  4C7Y A;  4WWM A;  2AL6 A;  3ABV B;  2E3T A;  5D6J B;  1FRR A;  2NBW B;  1WGD A;  4OHJ A;  3X0W A;  1F0Z A;  1OGW A;  3AMZ A;  2D3A A;  1TKY A;  1NYR A;  1WFY A;  3DHG C;  1FO4 A;  5H92 C;  3J9C A;  4ZRK A;  3ZDM C;  1YMH E;  2KDB A;  1WRD B;  1PDX A;  3NZ3 A;  3T3N A;  2L83 A;  5E6O A;  3EGR A;  1FEH A;  2WXI A;  4RF1 A;  1WJ4 A;  3TBL D;  4IUM B;  3JVZ X;  3VHT C;  2FNJ B;  3AEA B;  3ZJV A;  2MEK A;  2ZJD A;  4JWU C;  4RF0 A;  3QIJ A;  4KGT A;  5D2M B;  2WDT B;  2GBK A;  3E9S A;  3IBE A;  2I2Y A;  1L4D B;  4FJZ A;  3AE7 B;  3DOW A;  4YSX B;  5CX3 A;  4OZA A;  2B76 B;  2WLB A;  3T8M A;  4KKJ A;  1E7V A;  2G4S A;  3IT4 B;  2JXX A;  2WXG A;  3P4R B;  1FD6 A;  2EMT A;  4USA A;  4FJY A;  4WJP A;  4BFR A;  3N20 C;  1E90 A;  3MFG A;  4GU2 A;  1ZXH A;  2H89 B;  3RNA C;  5T8I A;  1KJT A;  1A5R A;  5BYQ A;  2TSS A;  4A9A A;  2RMM A;  3PVL A;  3L4P A;  3RI7 C;  2X38 A;  1YJJ A;  2V0G A;  4G11 A;  3C19 A;  2G45 B;  2MA9 B;  2PW9 A;  4ZOH C;  2BF8 B;  3UQB A;  4MGK E;  4RGT A;  1Y8R C;  3B2F A;  2KTR A;  1SJH D;  4RM8 A;  4DXF A;  3RMK C;  3NVZ A;  4BOS C;  4A3O A;  2JQR B;  5DPR A;  1LFD A;  1B1Z A;  4MH0 E;  2KLG A;  1UWX A;  4H2A A;  4GGQ A;  1P7E A;  4HPM B;  4W9J A;  1I4P A;  4HRO A;  2LHD A;  2MSE D;  1E10 A;  2BKF A;  4W9H A;  1RFK A;  2LGS A;  4HCP B;  3ZNG C;  2A4Z A;  4IM3 A;  3W9C B;  2M17 A;  2JY6 A;  1SJE D;  2GOW A;  4KSL C;  4WUR A;  2LFI A;  4AP4 C;  3UQA A;  1C79 A;  1KF6 B;  2GBR A;  3NS8 A;  1C76 A;  1PQS A;  3DBL B;  2RPQ A;  3VTU A;  3WAP A;  1JWM D;  2JSV X;  1M4V A;  1PYW D;  4BKS D;  2K9X A;  1IBX A;  1FFU A;  1SIF A;  3VDZ A;  5FKA C;  2WXP A;  1JML A;  1V5O A;  1GAQ B;  2KMC A;  3ML9 A;  3OWE B;  4ZHP A;  4BVU C;  4GLS C;  3BK1 A;  3DBR B;  3Q8F A;  3I3T B;  2K3U A;  4EZL A;  1WWT A;  3GB1 A;  1S1Q B;  1TY2 A;  1ZE3 D;  1FCC C;  1SBB B;  3W2D A;  3H9D A;  2Y5C A;  2W3R A;  1ZOY B;  3NUH B;  1WXM A;  3R3M A;  5LXH A;  2PJH A;  3BIN A;  1YOV B;  4WWP A;  3H7P A;  3P4Q B;  3IAM 1;  2KD0 A;  1RYJ A;  3LDZ E;  1NEK B;  2ASQ A;  3RFZ B;  3LXF A;  3QA8 A;  1GB1 A;  3N32 A;  4N9F 4;  2JXT A;  2J0M A;  3NY5 A;  4C00 A;  3MC0 B;  3RNE C;  1IGD A;  3I57 A;  4BAX A;  1QF6 A;  2XN9 C;  3R7R A;  4NJ7 A;  4RGM A;  4CHK A;  2RGF A;  5E6J A;  1YJI A;  1V49 A;  2GBJ A;  1YQB A;  1QOF A;  4Q2J A;  4FJV B;  4WWO A;  3W5V B;  2M1M A;  1L6V A;  1WGH A;  1OEY J;  3CST A;  4PS8 A;  4GB9 A;  4M8M A;  4WAA A;  4NAM A;  1N60 A;  2Y5B B;  2INN E;  2W54 A;  1H4R A;  2BB5 A;  2NTT A;  3APF A;  3DVN V;  1LXD A;  4HKQ A;  5C23 A;  1HA5 A;  4LCD E;  4PS7 A;  1L0V B;  2IZV B;  4GDK B;  2WXH A;  5AZG A;  2KDE B;  4XZ4 A;  3LB8 C;  1EWY C;  1ZKH A;  1D5M C;  1GNU A;  2ZW1 A;  3O65 B;  1UBQ A;  3W5U B;  2AQ1 B;  2BYF A;  3L0W B;  1WGY A;  3ZIM A;  4ZYN A;  4MJS A;  1DOX A;  2YEP F;  2MP2 B;  3RD2 A;  1XLQ A;  2KAC A;  1C9F A;  2JT4 B;  3A4R A;  2BYV E;  3ZNI D;  3SFE B;  3AED B;  2NPT A;  1SE4 A;  4REZ A;  2OJR A;  1JW9 D;  1IBX B;  2NS5 A;  2PMV A;  2LRW A;  3QC8 B;  3WAL A;  4B95 A;  1R4M I;  2FUG 1;  4IDI A;  4WQM A;  4HDO A;  2D10 A;  2I1K A;  1QOG A;  2DBY A;  2K8C A;  2BGF A;  4P1B C;  2PTL A;  2VH2 A;  2K8B A;  1TT5 B;  3VH3 B;  4ZYS A;  2Z59 B;  2NMQ A;  3ZDT A;  1WSP A;  1VLB A;  4LDT B;  4IG7 B;  4KKI A;  4GMV A;  3SFD B;  1WYW B;  4HWI B;  1J19 A;  3NVW A;  4RNA A;  1LQB A;  3DCG A;  4ICU A;  5AUK A;  1XO3 A;  2JUO A;  1P7F A;  3WAN A;  2O2V B;  1Q5W B;  3R2T A;  3AXC A;  3EA6 A;  2YVC A;  4P6V F;  3L54 A;  2SAK A;  1PFD A;  2AWT A;  2V4I B;  5CHV C;  1L6U A;  4JIO U;  1F77 A;  3DBH B;  1SSN A;  3DDC B;  2JZP A;  3N1X C;  4YTN B;  1QQR A;  1YX6 B;  5H8Y E;  2FBW B;  2N7D A;  2PIA A;  2WYQ A;  1WX9 A;  4JX1 C;  4GDK A;  3CF6 E;  4WQO B;  3BVG A;  2L8J A;  1TTN A;  4RCO A;  4KZ0 A;  3BII D;  1MG4 A;  1QZE A;  3N1Z C;  5CHF A;  1I4G A;  1K50 A;  3PRZ A;  4W9E A;  4DHZ E;  3AUL A;  1D6E C;  2NBV B;  2IBI B;  4W9D A;  1P1A A;  2MBH A;  1J7C A;  2ZNV C;  2FID A;  2IGG A;  2C5L C;  4GXB A;  4WJN A;  3KW5 B;  3ZYY X;  2BT6 A;  3HRD D;  1TGZ B;  2KJR A;  2QEJ C;  2MCN B;  4C56 C;  4PS3 A;  1QIL A;  4K7S A;  1IYF A;  2KAN A;  4ZDV A;  4M8N A;  3JSV A;  1M94 A;  2HJ1 A;  2ZVN A;  4ASW C;  4FHJ A;  1NBF C;  2HTH A;  3ZJT A;  2KLC A;  3PTF C;  2J7Q B;  3AU4 A;  1AN8 A;  3MJ5 A;  4AQ7 A;  4PYZ A;  4JGH B;  2KZR A;  2RR9 A;  3P42 A;  3RZW C;  3RUL A;  3URY A;  1G6J A;  5IP4 D;  1GB4 A;  1FNV A;  5HFY A;  2WXN A;  1HQR D;  1PGA A;  1ZDV A;  4D2K A;  3HVZ A;  2CU1 A;  4MGZ E;  1XCT L;  2W55 A;  1SGH A;  2C7N B;  4EUT A;  1L4Z B;  1EM7 A;  2D3B A;  1KLU D;  2N9P C;  5J18 A;  4LK0 M;  3RPF C;  2ON8 A;  2KHW B;  4N59 A;  3WAO A;  2DHZ A;  2J52 A;  4M00 A;  2VZK B;  3L17 A;  2OHF A;  1EU3 A;  2LXA A;  4BOZ B;  4YWG G;  4K1R B;  3QQ8 B;  3TUO A;  2AL3 A;  2KFJ A;  1D4B A;  2N9X A;  5AEK B;  3A1Q A;  4EFO A;  2N7J A;  3VUY A;  1EWC A;  4L2Y A;  3AB5 A;  1V80 A;  2YEP B;  1U4A A;  2KX3 A;  3AE4 B;  2ACZ B;  1F2R I;  2LXC A;  4ITK A;  3QX1 A;  1QLB B;  3ZNZ B;  5AUI A;  2WX0 A;  2MWS B;  3VUX A;  2HE7 A;  1NI2 A;  2JYT A;  1J7B A;  2VZK D;  4EZK A;  1GOZ A;  1TZ1 A;  1V2Y A;  2D5G A;  1AAR A;  4BBN F;  2WWZ A;  4ZRI A;  4HKZ E;  2J0J A;  2KK8 A;  1JWA D;  5TSS A;  3DBH I;  2XK5 B;  3NZU A;  3M3J A;  4K7W A;  1FFV A;  3UIN B;  4XGA B;  1WM3 A;  2KDF B;  1KLG D;  5HKH A;  4LNF A;  4JLC A;  2L0F A;  2KKC A;  4DK5 A;  2M19 A;  2CJN A;  2V4L A;  3W1Y A;  3NOB A;  2EEL A;  1UF0 A;  1HEZ E;  2MBO A;  4A90 A;  3JSV B;  1P9D U;  3QAR A;  4XYC A;  3WAM A;  4HPP A;  1SF0 A;  3S2A A;  2PE9 A;  4YTM B;  3DBR I;  3HVD A;  1N62 A;  3OJ3 A;  2RDH A;  1V5T A;  2BB6 A;  2EKE C;  4MGI E;  4W9L A;  1DOY A;  4F7Z A;  5G55 A;  1MVK A;  3AEE B;  2GBN A;  4M0W B;  1J7A A;  2CHX A;  2FCN A;  1CK1 A;  1RRB A;  1J0G A;  3BVM A;  5LLI A;  4G50 A;  2FCM A;  4S0R A;  4B0M A;  2KDM A;  2ZW0 A;  1BUI C;  1MPE A;  2DYO A;  3U7Z A;  3AE6 B;  2LGI A;  5IN7 A;  4K7U A;  1WGR A;  1R7S A;  1K8R B;  3K9O B;  3ZJU A;  2FCQ A;  2V3P A;  3I9V 1;  3P2B A;  1JWS D;  4YL8 A;  2JRH A;  3Q8C A;  4J6I A;  2WXF A;  4ANW A;  4ZHO A; 
#chains in the Genus database with same CATH homology
 1E8Z A;  5GMV A;  2D2Q A;  4AJY B;  3PHW B;  2LVQ A;  2KWC A;  2MQJ A;  3U30 A;  3R3M A;  3ZTC A;  5LXH A;  1YIW A;  3DBS A;  2FAZ A;  2VRR B;  2PJH A;  3B0A A;  3ZUN A;  3ZKJ C;  3BIN A;  4WWP A;  3H7P A;  4W9I A;  4TQ0 A;  2KD0 A;  2FCS A;  3LDZ E;  3JW0 X;  3H7P B;  4WJO A;  2XK5 A;  2ASQ A;  4OVV A;  4E71 A;  3V62 A;  2ZPN A;  3QA8 A;  4EOY A;  2M8S A;  5JZE B;  4I6N B;  3N32 A;  2KQS A;  3PT2 B;  4N9F 4;  3TIX A;  1NDD A;  2J0M A;  4KV2 A;  3L08 A;  3NY5 A;  4DHJ B;  4IW0 A;  4P7I A;  1WZ0 A;  3DQV A;  1C3T A;  3AI5 A;  1EF1 A;  1Z5S B;  2CKH B;  1WX7 A;  4IWQ A;  1HE8 A;  2CHZ A;  4XX5 A;  3R7R A;  3VTV A;  4NJ7 A;  3EFU A;  3QWZ B;  4CHK A;  2RGF A;  1Z2M A;  2MBB B;  2IO0 B;  2K1F A;  1V49 A;  2V1Y A;  2GBJ A;  1YQB A;  3U7D A;  3OLM D;  3TL5 A;  4NY0 A;  4FJV B;  4NJ6 A;  4WWO A;  1JRU A;  2MLB A;  4KVG B;  2LUE A;  2M1M A;  5E6P A;  4ANX A;  1SE9 A;  3R66 C;  2ZVO A;  1WGH A;  1OEY J;  1YJ1 A;  3CST A;  4PS8 A;  1YX5 B;  3DVN U;  3DVG Y;  4GB9 A;  2MW5 A;  3ENE A;  4M8M A;  4WAA A;  3APC A;  1P98 A;  4KIK B;  3ML8 A;  2Y5B B;  1D3Z A;  2LZ6 A;  4NQL B;  4GSW A;  2M4N A;  1H4R A;  3DVN V;  3APF A;  5KHO A;  3L16 A;  4F1S A;  4X57 B;  1LXD A;  3WIM A;  1OQY A;  5C23 A;  2K6Q A;  3DVG X;  4LCD E;  4PS7 A;  4ANU A;  2IZV B;  4GDK B;  2RSU A;  4E3C A;  1T0Y A;  2KDE B;  2LRU A;  2ZCB A;  4XZ4 A;  5AZG A;  5G2N A;  3N30 A;  1WE6 A;  3C0R B;  4URK A;  4A20 A;  1ZKH A;  1BT0 A;  2JRI B;  3A4S C;  1GNU A;  3PV1 A;  3ZNH B;  2XEW A;  3QJZ A;  2JVC A;  2IYD B;  1XD3 B;  4AJW A;  3EHV A;  2KC2 A;  1E7U A;  1KM7 A;  3O65 B;  2KNB A;  1WJ6 A;  1RAX A;  4B9K A;  4MSM B;  1UBQ A;  5TR5 A;  5DPT A;  3OAW A;  2BYF A;  2ZCC A;  2L05 A;  4MJS B;  3L0W B;  1WGY A;  3ZIM A;  5KHQ A;  2KFK B;  4ZYN A;  4MJS A;  4W9G A;  3PRM B;  2KFK A;  2PEA A;  2PE6 B;  3SU8 X;  4TUU A;  1WXA A;  1P0R A;  2MP2 B;  3RD2 A;  1XQQ A;  2BYE A;  2MP2 A;  3X23 A;  2JT4 B;  3A4R A;  3V61 A;  3D32 A;  1V86 A;  5EDS A;  3CMM B;  1WF9 A;  1WR6 E;  3PZD A;  2C7H A;  2BYV E;  3ZNI D;  2CR5 A;  2GBM A;  1EO6 A;  4MEL A;  1C1Y B;  3ZRF A;  4FN2 A;  1V81 A;  3PRP B;  4HDQ A;  2KTF A;  2LAS A;  2NPT A;  4MGY E;  2OJR A;  2DAF A;  3UF8 A;  2NS5 A;  2LRW A;  3QC8 B;  1RLF A;  1WGG A;  3WAL A;  3VH4 B;  3IVF A;  4B95 A;  4AUQ C;  2KOX A;  4I6L B;  1R4M I;  2D11 A;  2N7E A;  1GJZ A;  4OVU A;  4DBG A;  2LI5 A;  3B1L X;  1E8W A;  3KVF B;  3NHE B;  2MX2 A;  4CO7 A;  1WJU A;  2D3G A;  2K6D B;  3ZLZ A;  4DHJ D;  1ISN A;  2IO2 B;  2UYZ B;  4HDO A;  2D10 A;  2I1K A;  2WX1 A;  4II2 B;  5L95 C;  4EEW A;  2K8C A;  1UBI A;  2NCN A;  1XT9 B;  2K8H A;  4F8C B;  4WJQ A;  2N1W A;  2BGF A;  1WMH A;  3TCA A;  2K8B A;  3ZW3 A;  5IA7 A;  2QHO A;  1WMH B;  3VH3 B;  1WXS A;  2GMI C;  4LDT D;  3T9L A;  2R2Q A;  2CHW A;  2Z59 B;  1E8X A;  1I42 A;  2L76 A;  4FUL A;  2LD9 A;  4ZRJ A;  3ZDT A;  4NQK E;  4DDI D;  4BBN C;  2K39 A;  1R4N I;  3VQI A;  3AU5 A;  1CMX B;  3M63 B;  4FLH A;  4IM0 A;  4NAW B;  4LDT B;  3ZTD A;  3JYU A;  3HM3 A;  4IG7 B;  2JZ3 B;  2LVO A;  4GMV A;  1OTR B;  2KWU B;  2O6V D;  4EZJ A;  1WYW B;  4HWI B;  4RM9 A;  1FXT B;  1J19 A;  3KYD D;  2DYB A;  3EEC A;  4FA6 A;  1LQB A;  1WJN A;  3DCG A;  3HIZ A;  4ICU A;  4JQW C;  2MBQ A;  5J17 A;  3VFK A;  2AEH A;  3IHP C;  1KLV A;  1S3S G;  1Q1O A;  1GC7 A;  2JUO A;  2W9N A;  4K81 A;  3WAN A;  2L00 B;  2O2V B;  2DZK A;  1Q5W B;  2DZJ A;  4HJK A;  3ZO5 B;  3H1U A;  3AXC A;  2BPS A;  2J0K A;  2YVC A;  2Z0D B;  1UGM A;  5CHW A;  3L54 A;  5JHA A;  1MG8 A;  3A33 B;  4KDL B;  2AWT A;  2IY0 B;  4WWN A;  5CHV C;  3GZN I;  4DXA B;  3RYT A;  3EC8 A;  2DX5 B;  4JIO U;  3A9K A;  1UD7 A;  4KIK A;  2DZI A;  1WY8 A;  2N4F A;  2ZEQ A;  3DDC B;  3A9J B;  1EUV B;  2N1V A;  4HVB A;  3PS6 A;  3A9J A;  4MEM A;  3NZS A;  5CTR C;  1YX6 B;  4II3 B;  2N7D A;  2R2O A;  3B08 A;  2KX0 A;  2WYQ A;  4TKN A;  1WX9 A;  4GDL A;  3VAW A;  1LM8 B;  4GDK A;  1H8C A;  3L13 A;  3CF6 E;  4WQO B;  2O6V B;  5L83 A;  3KYC D;  2N9E B;  1WM2 A;  2L8J A;  1RFA A;  2O6V A;  3MTN B;  5LXI B;  1TTN A;  3RCZ A;  2ZNV B;  1WR1 A;  2Z0E B;  4KZ0 A;  2AYO B;  3QAQ A;  2IO1 B;  3OJ4 B;  4HXD A;  1QZE A;  2NPT B;  2A5U A;  2AL6 A;  5CHF A;  3N3K B;  2MRP A;  3PRZ A;  1KOT A;  4W9E A;  4DHZ E;  3AUL A;  2UWQ A;  4GN1 A;  5D6J B;  2NBV B;  2NBW B;  2C7M B;  2IBI B;  5IAA C;  4W9D A;  1P1A A;  2MBH A;  1WGD A;  2ZNV C;  1GG3 A;  3UGB B;  2KC1 A;  1ZGU B;  2FID A;  3X0W A;  1OGW A;  2M0X A;  5J2R A;  2C5L C;  4GXB A;  4WJN A;  2C9W B;  3ALB A;  3KW5 B;  3RT3 B;  2RD0 A;  2L0T A;  3PPA A;  3RZF A;  1TGZ B;  2KJR A;  2ZPY A;  2MCN B;  1WFY A;  2KWV B;  2JPH A;  3ONS A;  4FBJ B;  3Q3J A;  1IPG A;  4K7S A;  2DZM A;  4PS3 A;  1IYF A;  2KAN A;  4ZRK A;  4ZDV A;  4M8N A;  3JSV A;  1M94 A;  4LJO B;  1L2N A;  5AZF A;  2I1J A;  2ZVN A;  3TJP A;  3ZDM C;  4MM3 A;  2KDB A;  1WRD B;  1NBF C;  4FHJ A;  4ASW C;  2LWP A;  2IO3 B;  2HTH A;  4CYE A;  4AWJ A;  3TMP B;  2LVP A;  2KLC A;  2DYM A;  3KUZ A;  4DWF A;  2C60 A;  3PTF C;  2KVR A;  2J7Q B;  5E6O A;  1X1M A;  3AU4 A;  4MDK E;  2G3Q B;  3VUW A;  4PYZ A;  2KN5 A;  4JGH B;  3CSF A;  1UH6 A;  2KZR A;  2RR9 A;  1WI0 A;  3RUL A;  3RZW C;  1WJ4 A;  1G6J A;  3TBL D;  4IUM B;  3JVZ X;  3VHT C;  2FNJ B;  4MSQ B;  3VXW A;  4W9F A;  2PPH A;  3HM6 X;  2ZJD A;  2FUH B;  3QIJ A;  4LJP B;  2NVU I;  3PSE B;  3V6C B;  3IFW B;  2O2V A;  2ZZP B;  3SD5 A;  4HPL B;  5D2M B;  2WDT B;  4FAD A;  2YLM A;  5C1Z A;  2CU1 A;  1EF5 A;  3WA0 A;  2BWF A;  4HK2 A;  4MGZ E;  2GBK A;  1VCB A;  3IBE A;  2KJH B;  1E5W A;  1SGH A;  2C7N B;  4EUT A;  5AZH A;  1Q0W B;  4FJZ A;  3DOW A;  2N9P C;  5CX3 A;  5J18 A;  4BKT A;  4IWO A;  3ECI A;  1GUA B;  3BY4 B;  3MJW A;  2D07 B;  3T8M A;  2KHW B;  3WAO A;  3PLU A;  2DHZ A;  2KQ7 A;  1UEL A;  3L17 A;  4DHZ B;  1E7V A;  3HHM A;  2G4S A;  2OOB B;  1GC6 A;  2JWZ A;  3PGE A;  2LXA A;  3SHQ A;  2LGX A;  4BOZ B;  2JXX A;  4K1R B;  2JZZ A;  4FHK A;  4EKU A;  1WZ3 A;  3QQ8 B;  2AL3 A;  2KFJ A;  3A1Q B;  3W1S A;  1WH3 A;  2N9X A;  4W9K A;  4E74 A;  5AEK B;  3A1Q A;  4EFO A;  4XC2 A;  2EMT A;  4ANV A;  4FJY A;  4WJP A;  4BFR A;  3VUY A;  4A3P A;  5JHB A;  2B3A A;  1E90 A;  1V80 A;  4GU2 A;  2KX3 A;  1U4A A;  2MBE A;  2KMA A;  1WX8 A;  2LXC A;  3QX1 A;  3DPD A;  3KH0 A;  3ZNZ B;  3ZRC A;  2CS4 A;  2NR2 A;  2WX0 A;  2MWS B;  3VUX A;  3ZVV A;  1KJT A;  1A5R A;  1L7Y A;  4TQ1 A;  2HE7 A;  4GDL B;  4I6P A;  1NI2 A;  5FR6 A;  4EZK A;  1TZ1 A;  1V2Y A;  4BBN F;  1AAR A;  3PVL A;  3VVW B;  2WWZ A;  3U8Z A;  2HJ8 A;  2LGD A;  3LJ3 A;  1WE7 A;  3M95 A;  1YD8 U;  4ZRI A;  3SDL C;  4G11 A;  3QK0 A;  2J0J A;  2NBU A;  2G45 B;  3H6N A;  2KK8 A;  4BKS A;  2MA9 B;  2IY1 B;  2EMS A;  3DBH I;  2XK5 B;  2BF8 B;  3VTW A;  2KTR B;  3UQB A;  4MGK E;  2JF5 A;  3NZU A;  1Y8R C;  2KTR A;  3M3J A;  4K7W A;  5DPW A;  2DEN B;  3UIN B;  1ZW7 A;  4RM8 A;  4BKG A;  1WM3 A;  4BOS C;  3Q3F A;  5DPS A;  4A3O A;  2KDF B;  5DPR A;  1LFD A;  4MH0 E;  2L3Z A;  5HKH A;  1V9J A;  4JLC A;  2L0F A;  2KKC A;  4DK5 A;  2KLG A;  4HCN B;  4RMA A;  1UZX B;  2V4L A;  4GGQ A;  3W1Y A;  3NOB A;  3RUI B;  5JH5 C;  4HPM B;  4KSK C;  4W9J A;  2MBO A;  1E8Y A;  2FIF A;  3JSV B;  1WIA A;  2MSE D;  1WXV A;  3HK0 A;  2BKF A;  1P3Q U;  4HLE A;  1P9D U;  4W9H A;  3QAR A;  1IP9 A;  3WAM A;  3S2A A;  2PE9 A;  2HD5 B;  3APD A;  4B6W A;  3DBR I;  4TV3 A;  3V6E B;  3OJ3 A;  3H7S A;  1V5T A;  2EKE C;  4HCP B;  4MGI E;  4W9L A;  5E6N A;  1I35 A;  2KXJ A;  3ZNG C;  2A4Z A;  3GOE A;  4F7Z A;  4IM3 A;  2M17 A;  3L10 B;  4GIV A;  5G55 A;  3PHX B;  2JY6 A;  4NAW A;  4IWP A;  4IM2 A;  2GOW A;  4KSL C;  4NPN A;  4DDG D;  2GBN A;  3QHT A;  5BO4 B;  4GOC A;  2BWE S;  4M0W B;  3DBL I;  2CHX A;  4ICV A;  4JL9 A;  2FCN A;  4AP4 C;  3UQA A;  2BKR B;  1F9J A;  1RRB A;  3M62 B;  1J0G A;  3KUD B;  4AOF A;  2L7R A;  4G50 A;  2GBR A;  5LLI A;  2FCM A;  2KJ6 A;  2LGY A;  5DCN A;  3NS8 A;  4NNJ B;  1PQS A;  2LJ5 A;  1V6E A;  2RPQ A;  3MHS D;  5D7G A;  3VTU A;  3WAP A;  3R7Q A;  3W1S C;  1TBE A;  2DYO A;  4G3X B;  4BKS D;  4G0N B;  4PYU A;  1SIF A;  2KDI A;  3VDZ A;  4IC7 B;  1VD2 A;  3PLV A;  3UIP B;  3PRE A;  4K7U A;  5D94 A;  1V5O A;  2XBB C;  2KMC A;  1J8C A;  3ML9 A;  1WGR A;  4BVU C;  3A9K B;  1K8R B;  2REX A;  3K9O B;  2KO3 A;  2FCQ A;  3I3T B;  3V60 A;  4EZL A;  2K25 A;  2G4D B;  2V3S A;  1S1Q B;  3P2B A;  4KDI C;  3QCA A;  4YL8 A;  2JRH A;  3KUC B;  1OEY A;  4J6I A;  2DAJ A;  3K9P B;  3H9D A;  4KZC A;  3IG3 A;  4ANW A;  1WXM A;  4W9C A;  3UIO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...