2KQSA

Phosphorylation of sumo-interacting motif by ck2 enhances daxx sumo binding activity
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, apoptosis
molecule keywords Small ubiquitin-related modifier 1
publication title Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kqsA00
4EOYA 4BKGA 1WXMA 2RPQA 3DBSA 3EFUA 2LJ5A 1HE8A 4DHZE 4N9F4 2KX0A 1P1AA 2IZVB 4I6NB 2N4FA 3AXCA 4HVBA 3A4RA 4DK5A 2XK5B 4W9IA 1GC7A 1XQQA 2NBWB 4GIVA 3RT3B 1UD7A 4MGIE 1WRDB 3KW5B 2M1MA 4XX5A 4ZDVA 2FCQA 4HWIB 3K9OB 1WM2A 2AEHA 2M4NA 5E6PA 3TL5A 5LXIB 4TQ1A 2KOXA 3WANA 1Q5WB 2REXA 2JVCA 4B9KA 2CU1A 1V86A 1J19A 4KVGB 3VUWA 2KZRA 2RGFA 1P9DU 2BF8B 2QHOA 3ZRFA 1TBEA 2DZKA 2Z0DB 3OLMD 2FCNA 2HE7A 4II3B 3W1SA 2JZZA 4KDLB 2MP2A 4DDGD 4GGQA 3ZNZB 3DOWA 3U30A 2D2QA 2WYQA 4RMAA 5C1ZA 2M8SA 5D94A 2ZVOA 2KQ7A 1WX7A 4GDKA 4B6WA 1WJ4A 2O6VA 4TUUA 1WH3A 4OVVA 2A5UA 2MA9B 2L0FA 4BOZB 2YLMA 5J2RA 2RSUA 2LGXA 3KUDB 1OEYA 3TBLD 2G3QB 2KFKB 3PRMB 4NJ6A 4TKNA 1IPGA 1Q0WB 1WE7A 3B1LX 4MJSA 1E8ZA 4FN2A 5G2NA 4AUQC 4MGYE 1C3TA 2KDFB 2MBQA 2MSED 4WWPA 1FXTB 2G4DB 4FHJA 3W1SC 4ANUA 4F7ZA 2KHWB 2EKEC 4OVUA 4BKTA 2LZ6A 3L10B 4PS8A 3ZNHB 4X57B 4BFRA 1PQSA 3V6EB 3UGBB 1WJNA 4HPMB 1D3ZA 2N9XA 4WQOB 2KLGA 4FLHA 3I3TB 2DZMA 1KM7A 5E6OA 3KYCD 4MEMA 3SU8X 3VH4B 5D6JB 3U8ZA 3ECIA 4ZYNA 2R2OA 2MWSB 4G0NB 1MG8A 1OQYA 3DVGY 3TJPA 5D7GA 5JHAA 2ZPYA 1IYFA 3H7PA 2DAJA 3KYDD 1KJTA 5CX3A 4GSWA 2K8CA 2WWZA 3C0RB 5CHWA 4JLCA 3MTNB 3V60A 3PTFC 4KV2A 5KHOA 4CHKA 2LRWA 4NQKE 3Q3JA 2KMAA 1SGHA 1P3QU 5DPSA 2HD5B 2YVCA 2D07B 5JZEB 5E6NA 2V3SA 3JSVB 4HLEA 2KTRA 2KTFA 2Y5BB 4NAWA 3OAWA 4KZ0A 4MDKE 4A3OA 2J0JA 3PVLA 1A5RA 3MJWA 5L95C 1RFAA 4M0WB 3UINB 2CKHB 4IM2A 4NY0A 3APCA 2NPTB 1GJZA 3A1QB 2L05A 2JZ3B 2GOWA 4BBNF 3DCGA 4BKSA 1Q1OA 2JY6A 3H1UA 4IUMB 2DYBA 2KJRA 3QWZB 1TTNA 3WIMA 2N7DA 2WDTB 3A9JB 4KSKC 3MHSD 2KJ6A 4KDIC 2RD0A 1WX8A 2C5LC 1R4MI 1WX9A 3VH3B 3ZUNA 2O2VA 3PPAA 2KC2A 3ZVVA 3VAWA 3DVNV 4LDTD 3QAQA 3HK0A 1LQBA 2DENB 4W9FA 3ALBA 2IY1B 3CSFA 5CHVC 2JXXA 1E90A 4URKA 2DZIA 2FNJB 2G4SA 2NS5A 2N1VA 3VFKA 4AJYB 1UBQA 4DDID 4DHJD 1V80A 3HIZA 3PRPB 1CMXB 4W9KA 3ZIMA 4MGZE 3X0WA 1YX5B 4M8MA 1I42A 2C7HA 1EF1A 2K25A 2LWPA 4JQWC 3VQIA 3ZDMC 2I1KA 4PYUA 5HKHA 1V81A 3HM3A 4MM3A 3VUXA 2K6DB 2L7RA 3CF6E 4EZKA 2D10A 3APFA 4IG7B 3VTWA 3A33B 2JWZA 3QARA 4GDLA 4K7WA 3TCAA 4FBJB 2N9PC 2HJ8A 2W9NA 3NY5A 3U7DA 4BOSC 1Z5SB 2N9EB 4CO7A 3HHMA 4TV3A 5JH5C 3JYUA 1U4AA 1WGDA 2IO3B 4W9JA 4FHKA 2AL3A 2M0XA 3UQAA 1V9JA 3KVFB 4IC7B 4LJOB 4WJNA 3M3JA 3CSTA 4EFOA 1WZ3A 4HDOA 4LCDE 4ICVA 1E7VA 2FIDA 2M17A 3S2AA 4W9GA 3HM6X 3SHQA 1XD3B 4II2B 4DXAB 4IM3A 5IA7A 1M94A 5L83A 4WAAA 3DBLI 2LVPA 3M62B 4PS3A 5J18A 4GN1A 5AEKB 4WWOA 3N30A 4IW0A 2ZCBA 2IBIB 2OJRA 2KJHB 4HXDA 5GMVA 4GXBA 4EUTA 3NS8A 1WXAA 4KSLC 3QIJA 2ZNVB 2BYFA 2EMTA 2JF5A 2L0TA 3QHTA 3V62A 5C23A 3ML9A 3H7SA 1WJUA 2K8BA 4FJVB 1BT0A 2ZZPB 2KX3A 3TMPB 4HCNB 1LFDA 4E74A 3Q3FA 2KDBA 4BVUC 3VDZA 2DHZA 1EUVB 1Y8RC 2FCMA 2KDEB 3P2BA 3PS6A 2JT4B 2MP2B 2BYEA 4MSQB 4DWFA 4IWPA 2FIFA 2KD0A 3ZW3A 1VD2A 2IO0B 3W1YA 5CTRC 4IM0A 4AJWA 4NJ7A 4WJQA 4FJYA 3T9LA 3ENEA 2G45B 4GDKB 2CR5A 4GU2A 3PHXB 2MBEA 4FA6A 4FULA 1WXSA 2C60A 4W9CA 1WJ6A 1R4NI 3PGEA 3LDZE 1GG3A 1WI0A 2LRUA 2LUEA 4FJZA 3QC8B 3WALA 4W9DA 4GMVA 2N7EA 2D11A 4MJSB 4TQ0A 3DBHI 3VXWA 4GOCA 2K6QA 2VRRB 3L13A 2UYZB 3IG3A 2KKCA 4ASWC 4WJOA 2MRPA 2D3GA 4KIKA 4XZ4A 4G3XB 1KOTA 1WMHA 4LJPB 4WJPA 3TIXA 3K9PB 2KXJA 2BKFA 3PT2B 4EZLA 5DCNA 1WXVA 4W9LA 2NVUI 3A4SC 3DDCB 3RZWC 3AI5A 2IY0B 3IBEA 4ZRJA 5AZFA 2Z0EB 2FAZA 5DPWA 3A9KB 4I6LB 3A1QA 2KMCA 4A20A 3PHWB 2KVRA 3H7PB 3RUIB 2KWCA 2KN5A 3PREA 1V49A 3KUZA 1ZW7A 4ANXA 2DX5B 4PS7A 3VTUA 2Z59B 2MQJA 4AOFA 5FR6A 4E71A 3N32A 4EZJA 3L0WB 1T0YA 2GBRA 3PLUA 4E3CA 1XT9B 5TR5A 2KTRB 4W9HA 2LD9A 4NAWB 1J0GA 2LVOA 2ZJDA 5G55A 4RM9A 1GUAB 1WGRA 3ZTDA 2JPHA 4K81A 4PYZA 4ZRIA 5IAAC 5AZHA 4EEWA 2ZEQA 4JL9A 2EMSA 4YL8A 4AP4C 3AULA 1K8RB 1S3SG 1YD8U 3PV1A 3AU5A 1V5TA 1WZ0A 2K39A 3BINA 4MELA 3LJ3A 4M8NA 3B0AA 4MH0E 4F1SA 1V2YA 3ZLZA 3T8MA 3EECA 2XK5A 3GZNI 2MBBB 1C1YB 2DZJA 1H4RA 2J0MA 2PPHA 2O2VB 5D2MB 1WFYA 2FUHB 2WX0A 2KQSA 3UQBA 1WYWB 2XEWA 4K7SA 3R66C 2CS4A 2CHWA 3PSEB 4HJKA 3EHVA 3DQVA 1KLVA 3QJZA 2LVQA 3PRZA 1ISNA 2GBMA 3N3KB 4B95A 2NCNA 1LM8B 2I1JA 2R2QA 2NR2A 1L2NA 3PLVA 2GBJA 1WGYA 2ZPNA 5J17A 2C7NB 3H9DA 3RD2A 2LGDA 3ZO5B 3APDA 3AU4A 5AZGA 2V4LA 3RZFA 4HPLB 1NI2A 3RCZA 3IHPC 2AYOB 3RYTA 1TZ1A 3VTVA 1OTRB 2BKRB 3SDLC 2JRIB 1P98A 2DYMA 1E8XA 2IO1B 2KLCA 2OOBB 4JGHB 2BPSA 2GBNA 2ZVNA 2DAFA 4GDLB 1S1QB 2N1WA 1NBFC 3R7QA 2K1FA 3DVGX 3KUCB 3V61A 3QK0A 3ZNID 1OGWA 2C9WB 2KO3A 1WR1A 2KFKA 4G11A 3GOEA 4XC2A 3H6NA 2JUOA 1YQBA 1P0RA 1UGMA 5DPTA 2MBHA 1YX6B 3EC8A 3M63B 2FCSA 2GMIC 3VHTC 2KANA 2L00B 3NZUA 1E5WA 4NNJB 5LXHA 2CHZA 3D32A 5CHFA 2L76A 3JVZX 4CYEA 3X23A 2PEAA 4A3PA 1YJ1A 2ASQA 3QCAA 3L17A 4GB9A 2IYDB 3KH0A 4IWQA 1E8WA 2LASA 1X1MA 4P7IA 2NBVB 5DPRA 3DPDA 4G50A 1AARA 1L7YA 2ZNVC 4J6IA 5BO4B 2LXCA 2O6VB 4K1RB 2O6VD 2AL6A 2GBKA 2LGYA 1NDDA 1G6JA 3BY4B 1H8CA 2LXAA 4EKUA 3DBRI 1ZKHA 2BWES 4MSMB 4RM8A 3UIOB 2KDIA 4HDQA 1WIAA 1UZXB 3O65B 2KWVB 1E8YA 4W9EA 1EO6A 3VUYA 1WY8A 3WAOA 3OJ4B 1UH6A 1WM3A 1TGZB 3DVNU 3WAPA 1QZEA 5EDSA 2MX2A 3JSVA 2BYVE 2KNBA 1WR6E 2AWTA 2IO2B 2PJHA 4FADA 4F8CB 2L3ZA 4NQLB 1I35A 4K7UA 1ZGUB 4I6PA 1RLFA 4DHZB 4AWJA 4ANVA 3A9KA 3B08A 2HTHA 3CMMB 3QX1A 2DYOA 2MLBA 2NPTA 2V1YA 3IFWB 1V6EA 3NZSA 1SIFA 1RAXA 3IVFA 1YIWA 3QA8A 2UWQA 1V5OA 1OEYJ 1UELA 1WF9A 1IP9A 3A9JA 1UBIA 1GNUA 3OJ3A 3R7RA 4KIKB 1WMHB 2MBOA 3QQ8B 3SD5A 3ZKJC 3UF8A 3R3MA 3ONSA 2RR9A 2J0KA 1RRBA 1WGHA 2MW5A 4JIOU 3ZRCA 2KC1A 3VVWB 3ML8A 4IWOA 3ZNGC 2C7MB 5KHQA 2A4ZA 2WX1A 3L16A 1EF5A 1JRUA 2LI5A 3M95A 3NHEB 1GC6A 2BWFA 1SE9A 3JW0X 2L8JA 2NBUA 2J7QB 2KK8A 2MCNB 3PZDA 3WAMA 3ZTCA 4BKSD 3UIPB 3WA0A 4HCPB 5JHBA 1LXDA 3L08A 2PE6B 3V6CB 4ANWA 1VCBA 4LDTB 5LLIA 4ICUA 1J8CA 1E7UA 2KFJA 4HK2A 3ZDTA 2KWUB 3NOBA 4ZRKA 2CHXA 2ZCCA 1WE6A 1WGGA 3RULA 4NPNA 4BBNC 1Z2MA 4MGKE 3L54A 4WWNA 2XBBC 4DBGA 1F9JA 4KZCA 2K8HA 2BGFA 2B3AA 4DHJB 2JRHA 2PE9A
chains in the Genus database with same CATH superfamily
4EOYA 3V3XA 4BKGA 3EFUA 2RPQA 3ZJVA 1HE8A 4DK5A 1GC7A 1XQQA 3DWMA 1ESFA 2M1MA 3EFCA 1WM2A 2M4NA 1UF0A 1V86A 2MH7A 4KVGB 4RF1A 1PGXA 2Z0DB 2DZKA 3W1SA 4NAMA 1CJEA 2MP2A 2JYEA 1NI3A 1HEZE 3ZNZB 1FPYA 2WYQA 4XGAB 4GDKA 1KFYB 1WJ4A 2YLMA 1OEYA 4TKNA 1Q0WB 1WE7A 1C3TA 3BIID 2KDFB 2MBQA 4WWPA 1FXTB 2G4DB 4OVUA 4BKTA 2LZ6A 2LFIA 4BFRA 1C77A 1C78A 1HTOA 1PQSA 1L5PA 4OVZA 4WQOB 4FLHA 1NYRA 1KM7A 5E6OA 3KYCD 5EE0A 5D6JB 3RNEC 3ECIA 4ZYNA 3CIRB 2IGDA 1OQYA 1SE2A 2KACA 5CX3A 2LRWA 4NQKE 1C4AA 3Q3JA 2KMAA 1SGHA 1UUPA 3Q8BA 2HD5B 3N9YC 2D07B 5DPSA 3Q3NC 2V3SA 2WXLA 4HLEA 4KZ0A 3MJWA 1WGKA 4M0WB 5FK9C 4NY0A 3APCA 1QLBB 2NPTB 2GOWA 3DCGA 2JY6A 2DYBA 3A9JB 2RD0A 1R4MI 1PYWD 1LO5D 3VAWA 1YN4A 1LQBA 3DBHB 3ZQ4A 5CHVC 4DQOC 1E90A 4URKA 1J7BA 2G4SA 2N1VA 1V80A 4JPSA 4PK1A 1JQ4A 2Y5CA 3ZIMA 4M8MA 3LYYA 1FFUA 2V4IB 2I1KA 1ZPSA 4B0MA 2I2YA 4EZKA 5C2TB 4IG7B 4HKQA 3TCAA 4FBJB 2W9NA 3U7DA 2N9EB 3C8YA 4L23A 2WXMA 4FHKA 2IDYA 2M0XA 3I9V1 1V9JA 1WSPA 4MH8A 4XDCA 4LJOB 2V3PA 1E0ZA 1WZ3A 4LCDE 1YJJA 2M0AA 2WXFA 2KT7A 4DXAB 5IA7A 1I4RA 1FRDA 3ZXRA 5BYQA 5TSSA 3M62B 4A90A 4GN1A 3P4SB 4RGNA 4QAYA 2W55A 2IBIB 2OJRA 3AEAB 2NTSA 5GMVA 1SXTA 3QHTA 3RFZB 3ML9A 4AQ7A 2QMTA 3GZNB 4Q2JA 3AEGB 1JROA 4E74A 3J9CA 1Y8RC 2KDEB 3P2BA 1HZ6A 3AM9A 2DNFA 2MP2B 4IWPA 4IM0A 4NJ7A 4WJQA 4FJYA 3T9LA 4GDKB 4GU2A 1ET6A 1R4NI 3URYA 3LDZE 1L0YB 2LRUA 4FJZA 3WALA 4W9DA 3VXWA 1FNVA 2OEDA 2R61A 1STEA 4WJOA 2D3GA 1ZXIA 1TKYA 1BMLC 2WXOA 4G3XB 1KOTA 4LNIA 4WJPA 2BKFA 1N6ZA 2GB1A 3AI5A 2LGIA 1K53A 4LK0M 2AQ3B 3U7ZA 2NMQA 1XF5L 2Z0EB 3A9KB 2KMCA 4KGRA 2BYTA 3RUIB 1ZDXA 3R8BA 4O1NA 3NRZA 4ANXA 4PS7A 1GOZA 4EZJA 3RNAC 4E3CA 1XT9B 1R4NB 3DWGC 2LD9A 3DBRB 4KGSA 1IGCA 1GUAB 1WGRA 4K81A 5IAAC 3P42A 2BS3B 4AP4C 3AULA 2JQRB 1FCLA 3L4PA 3AE6B 3AU5A 1WZ0A 2K39A 4M8NA 2X38A 3DHHC 2XK5A 2MBBB 1C1YB 3SR6A 1C79A 5D2MB 1QKZA 3RPFC 2KQSA 2CS4A 2CHWA 4HJKA 4TSSA 1KLVA 3FC4A 1MG4A 1LM8B 1XCQL 2I1JA 2R2QA 3KLSX 1C9FA 3CWIA 2GBJA 2ZPNA 1BXTA 1YNTE 1Q10A 2FUG1 1SJED 1TZ1A 1R7SA 1OTRB 3NZ3A 2JRIB 1P98A 4M00A 4ZRQA 1E8XA 2IO1B 3NS1A 4EE2A 2N7JA 4P1CC 1V1PA 1OGWA 2K0PA 2W82A 2C9WB 1WR1A 2OJWA 2BS4B 2KFKA 2WXQA 4G11A 4XC2A 4WWMA 5H92C 1UGMA 5DPTA 2MBHA 3M63B 4HEA1 2GMIC 3NZUA 5LXHA 3D32A 1MHHE 5MPOA 4CYEA 2PEAA 1YJ1A 1JWMD 2QJLA 3P1MA 1E8WA 3RNBC 1BUIC 3DPDA 4RFBA 1AARA 2RDBC 1D5MC 5BO4B 2O6VB 4B0EA 4C56C 2BTEA 2O6VD 2AL6A 2GBKA 5H8YE 1NDDA 3BY4B 4XDDA 1ZKHA 4HDQA 1I4GA 3WAOA 2MX2A 3JSVA 2BYVE 3W5UB 1VZ7A 4NQLB 4LNKA 2WS3B 1I35A 1YQ3B 1ZGUB 2MHJA 3CMMB 2MLBA 1E9MA 3NZSA 3QA8A 1V5OA 1IP9A 2MEKA 3TSSA 5E6JA 5AUKA 2K22A 2MBOA 1EWYC 3QQ8B 3ZKJC 1D5XC 1T0SC 2Q5WD 3NVZA 2J0KA 4L2YA 2KC1A 1NEKB 1FNUA 3AV8A 2XNAC 2BQQA 1GAQB 2NBUA 2J7QB 5EE3A 3WAMA 3ZTCA 1B1ZA 3NUHB 3B2GA 3WA0A 5JHBA 2PE6B 1VCBA 4LDTB 1J8CA 4J3OD 1E7PB 3P63A 1ET9A 1WGGA 2SEBD 3LXFA 4A9AA 4C4VA 2E3TA 4DHJB 1WF9A 3AN1A 2PE9A 1WXMA 3DBSA 2N0SB 2BVCA 4S17A 4ZYSA 2PVOD 5EE1A 1UGJA 1FMAD 3P4PB 3Q8FA 4HPPA 5BMHA 2XK5B 4W9IA 3R2IA 2JX5A 1IGDA 5D3DA 2WU2B 1I4QA 2KAJA 3KW5B 3P4QB 4HWIB 4NZLB 5E6PA 4TQ1A 2KOXA 2LEKA 1Q5WB 1J7CA 2WP9B 1RYJA 1J19A 1VDVA 3VUWA 4DXFA 2RGFA 3ZYYX 4ARCA 1TBEA 4II3B 2HE7A 1L4ZB 3U2SC 3U30A 2L52A 4RMAA 2KQ7A 3AE1B 4B6WA 4TUUA 4OVVA 2A5UA 2L0FA 3NVVA 3HUIA 1V1PB 3B2FA 2RSUA 2LGXA 4RGTA 2KFKB 4NJ6A 1IPGA 3B1LX 4AUQC 4BZAA 2MSED 4F7ZA 2LGSA 3W1SC 1JALA 3L10B 3IT6B 4X57B 1PFDA 4HPMB 2N9XA 2KLGA 3I3TB 4MEMA 3VH4B 3U8ZA 3AECB 4G0NB 1MG8A 3DVGY 3VRBB 5D7GA 5JHAA 2ZPYA 2SAKA 2DAJA 1SB3C 4GSWA 5HHDG 3ETRA 1C76A 5KHOA 4CHKA 3Q3MC 1D6EC 5JZEB 4C7YA 3JSVB 3LB8C 2KTRA 2WXGA 2Y5BB 4NAWA 3U52E 4A3OA 1RFAA 2QC8A 3UINB 3GE8C 3H8HA 1GJZA 3A1QB 1Q1OA 4IUMB 3QWZB 2N7DA 2WDTB 4KSKC 2KJ6A 1WX8A 2C5LC 2CJOA 3Q8EA 3ZUNA 3FILA 2I38A 3RNFC 5HFYA 2IY1B 2HDEA 2JXXA 3BK1A 2FNJB 1SEBD 1UBQA 1CMXB 4MGZE 2WXNA 1YX5B 1I42A 3AE7B 3Q3OC 1FM0D 1T0RC 2LWPA 1IBXB 2WDQB 1OQQA 3CF6E 2L7RA 3Q2AC 2D10A 3AE4B 3A33B 2JWZA 3QARA 3MFGA 2HJ8A 4BOSC 4CO7A 3HHMA 2IO3B 4C4VB 3BVZA 3E9SA 4OZAA 3GE3C 4IC7B 3MP9A 3M3JA 4EFOA 1DGJA 4ICVA 1E7VA 3S2AA 1FCCC 1RM6C 3SHQA 2KQ4X 4II2B 5L83A 2AQ1B 5I4DA 5J18A 3N30A 2KDMA 4EUTA 2VH1A 4KKIA 1WXAA 1WJUA 2INPE 2IGGA 3N1XC 1LFDA 1TJEA 3BZDB 4AS1A 5IOIA 3WCQA 2JWUA 1VD2A 2MJDA 1IUEA 3ENEA 3PHXB 4FA6A 4GLSC 1WXSA 2C60A 4LNFA 1GG3A 1WI0A 4UDUC 1HTQA 3DBHI 4GOCA 2K6QA 1VZ6A 3L13A 2WU5B 3BYYB 4ASWC 4YSYB 4KIKA 1CQVA 1ZP0B 4LJPB 2NVUI 1WWTA 3RZWC 4JX1C 5AZFA 5BYRA 3AE9B 2KVRA 5JXVA 3ZJUA 3PREA 1V49A 2DX5B 5HG2A 2MQJA 5FR6A 3N32A 1T0YA 1XXGA 4YT0B 3Q8CA 2KTRB 4W9HA 4NAWB 1D4BA 4PYZA 4REZA 4ZRIA 1TS4A 2ZEQA 4JL9A 1XCTL 1L0XB 2L1AA 1K8RB 1S3SG 3V05A 3SFDB 3IAS1 3LJ3A 4F1SA 3GZNI 4L1BA 2J0MA 2PPHA 1XLPA 3UQBA 1WFYA 3FILB 3R66C 3PSEB 2LJIA 3DQVA 3QJZA 2LVQA 2BB6A 1M4VA 4MT5A 1EM7A 2NCNA 2NR2A 4WH4A 1CK1A 3ABVB 2C7NB 3H9DA 3RD2A 1FEHA 2LGDA 2V4LA 3UI3A 3RCZA 2AYOB 2BKRB 1Y56A 2WLBA 1FXAA 2OOBB 2GBNA 2N1WA 1NBFC 2WHIA 2K1FA 3KUCB 3RI7C 2JUOA 1YX6B 2FCSA 2KANA 2HJ1A 2K5PA 5CHFA 3NG0A 4YWGG 4RCOA 1JW9D 3SEBA 4IWQA 4XE0A 1X1MA 5DPRA 4YSZB 1P7FA 2ZNVC 3AEEB 2LXCA 1DOYA 2LGYA 1G6JA 1H8CA 3DBRI 3MHZA 1WIAA 1UZXB 2KMMA 3O65B 1E8YA 2RDHA 2Z8LA 3VUYA 1JRPA 3OJ4B 1UH6A 4ARIA 3DVNU 3KWLA 4KX6B 5EDSA 1OFFA 2WQYB 4FADA 1RLFA 4LNOA 4ANVA 4IKGA 5IP4D 2JXTA 3IFWB 3T3NA 2PIAA 1V6EA 1SIFA 1KLUD 1RAXA 3IVFA 2Y3AA 3VRAB 1T3QA 5LNK1 1TS2A 1I4PA 4KIKB 2BW2A 3UF8A 3R3MA 1WGHA 4JIOU 3ZRCA 3AEFB 3C19A 4IWOA 3ZNGC 2C7MB 5KHQA 2CJNA 5T8IA 2M56B 1JRUA 2LI5A 3OG5A 1SE9A 3JW0X 1HQRD 1P7EA 1ZE3D 2KK8A 3PZDA 3UIPB 2VZKB 3RNCC 3TEYA 3RN9C 4YSXB 3I5JC 4ICUA 1E7UA 3MJ5A 4HK2A 2KWUB 3NOBA 2OHFA 4MGKE 3L54A 4N58A 2PKOA 1F9JA 2BGFA 1HXYD 2B3AA 3GP7A 2JRHA 1EU4A 3TJPA 1PDXA 3IT4B 2LJ5A 4DHZE 2MJEA 2KX0A 1P1AA 2IZVB 4I6NB 2N4FA 3AXCA 2ACZB 2NBWB 2ZW1A 1UD7A 4MGIE 1WRDB 4XX5A 4ZDVA 1I7HA 2FCQA 2LHEA 1AW7A 3K9OB 5LXIB 2JVCA 2CU1A 1QOGA 1ZOYB 2KZRA 1P9DU 1VRAB 2QHOA 3OLMD 2JZZA 1ZUD2 3DOWA 3O13A 3T3OA 2D2QA 5C1ZA 2M8SA 3NVWA 1WX7A 1WH3A 2IGHA 2L32A 4BOZB 5J2RA 3TBLD 1QF6A 2G3QB 3PRMB 4MJSA 1E8ZA 1JWBD 2ZW0A 4FN2A 1WYGA 1GPXA 4ANUA 4FHJA 1TZOA 2EKEC 4PS8A 2WXIA 3ZNHB 4M01A 3U4EG 3N1ZC 2DZMA 3SU8X 1N5XA 3IXSA 1N60A 1SSNA 3H7PA 2NTTA 5BYSA 2WWZA 3C0RB 4JLCA 2M19A 3PTFC 4KV2A 3AE5B 1P3QU 2EELA 2KTFA 2J0JA 3PVLA 1A5RA 5L95C 3FAHA 4A8XC 4IM2A 2WXRA 4HKZE 2RPVA 3EGRA 2L05A 4BBNF 4BKSA 3H1UA 1TTNA 2MJ3A 3WIMA 3MHSD 1WX9A 3ZVVA 3HVDA 4LDTD 4C00A 2DENB 2JZPA 4W9FA 3GS2A 3CSFA 4ZHPA 4K3CA 3VFKA 1QOFA 4DDID 4DHJD 4W9KA 3PRPB 3X0WA 3VR8B 1SE3A 2K25A 5FKAC 4D2KA 4MM3A 1UWMA 2K6DB 1FXIA 1XLOA 4K7WA 1MJDA 2ONQA 2N9PC 1YN5A 3NY5A 4OZBA 1FNWA 4JE3B 3JYUA 5JH5C 1WGDA 4W9JA 3UQAA 2AL3A 1AN8A 4US9A 3KVFB 1UWXA 4WJNA 3HVZA 3CSTA 4HDOA 4NJCA 2FIDA 3HRDD 4W9GA 1XD3B 3R2TA 1M94A 4WAAA 3E56A 5BMGA 5AEKB 1QOBA 4WWOA 2PTLA 2ZCBA 1V1OA 4HXDA 1YMHE 3NS8A 4KSLC 4P6VF 3QIJA 2H88B 2ZNVB 2EMTA 1K50A 2JF5A 2L0TA 3H7SA 2K8BA 4FJVB 2J42A 2JU6X 2ZZPB 5AUIA 4HCNB 3TMPB 2LMCA 3Q3FA 3VDZA 2DHZA 2FCMA 2JT4B 4MSQB 4DWFA 2FIFA 2KD0A 3Q14C 4BAXA 3ZW3A 5CTRC 2INCC 2J53A 4AJWA 2G45B 2MBEA 4W9CA 1ACCA 1WJ6A 3PGEA 2QCZA 1ZXHA 3RMKC 4USAA 1E6EB 2D11A 4MJSB 2VRRB 4DXGA 2UYZB 1MFWA 2KKCA 1F2RC 4FXCA 1WMHA 2L83A 3K9PB 2KXJA 1N5WA 3PT2B 4EZLA 5DCNA 3A4SC 3TEWA 3DDCB 1MHXA 2IY0B 1TYGB 4XWTA 1C4CA 5DPWA 3P4RB 1VLBA 4A20A 2YEPF 3H7PB 3KUZA 1ZW7A 4RH6A 1T6BX 4AOFA 2D3CA 4E71A 1OQRA 3MC0B 2GLSA 2INNE 3W9CB 1T5XD 2KWDA 3N1YC 1J0GA 5G55A 4RM9A 2YEPB 3ZTDA 4CQNA 2JPHA 4ACFA 1E10A 2EMSA 4YL8A 1JWUD 1YD8U 1V5TA 4MH0E 1FD6A 3T8MA 1RFKA 2N9LA 2QSDA 2DZJA 1H4RA 3KQ4A 2WX0A 5GXGB 3PRZA 1ISNA 2GBMA 2X8XX 3N3KB 3RNGC 1L2NA 3PLVA 1WGYA 1DOIA 1TIFA 2PW9A 3APDA 1XO3A 3AU4A 3I57A 4ZRPA 5AZGA 1DYQA 3RZFA 4HPLB 2KVZA 3RYTA 3VTVA 4MM3B 2DYMA 2JYTA 2BPSA 2ZVNA 2DAFA 3PZ7A 3V61A 3ZNID 2DBYA 1C4PA 5D3IB 4C80A 1KH0A 5EE9A 3GB1A 1E5WA 4NNJB 2L76A 2ASQA 4HROA 3EUB2 1HA5A 1NYQA 3KH0A 2NBVB 4RF0A 4G50A 2LUMA 4J6IA 1RWSA 4TMAB 4KKJA 2LXAA 3PO0A 3UIOB 4RM8A 2KDIA 4W9EA 1EO6A 1FRRA 1TS3A 2PMVA 1F1HA 1WM3A 2KNBA 2AWTA 3AB5A 3MC9A 2PJHA 4F8CB 2BB5A 3B9JA 4DHZB 3A9KA 3B08A 2HTHA 3QX1A 2V1YA 5HI1A 2UWQA 3N20C 1VZ8A 4YTMB 3R7RA 1ZDVA 1JMLA 1VJKA 1WMHB 2QEJC 3SD5A 3DHGC 1N61A 2WNMA 2H89B 1QOAA 2RR9A 2MW5A 3VVWB 3ML8A 2FBWB 3NVYA 3L16A 1QT9A 1SBBB 4RGMA 2N9KA 1VR9A 1L0VB 1L6UA 2MCNB 2J52A 1XEEA 4OZCA 1KRHA 4HCPB 3L08A 2KFJA 3ZDTA 2CHXA 5G5GA 4US8A 3RULA 4BBNC 2V9HA 3I63C 4NPNA 1Z2MA 4WWNA 4KZCA 2K8HA 2G1EA 3TEXA 3SFEB 1NENB 1K51A 4LNNA 4N9F4 4HVBA 3A4RA 4A6QA 4YTPB 4GIVA 3RT3B 3BVGA 1TS5A 1F2RI 2AEHA 3TL5A 3WANA 2REXA 4B9KA 1YJIA 1R4MB 1SF0A 2BF8B 3ZRFA 2FCNA 4KDLB 3W5VB 3AH7A 4DDGD 1SJHD 4GGQA 5D94A 2ZVOA 2O6VA 2MA9B 4A55A 1D5ZC 3KUDB 4XYCA 1KLGD 1QQRA 5G2NA 2KN4A 4MGYE 2KHWB 4ZOHC 3V6EB 3UGBB 1WJNA 1D3ZA 1TY2A 2R2OA 2MWSB 1L6VA 1IYFA 1F52A 3KYDD 1KJTA 4WURA 2K8CA 3EA6A 5CHWA 3MTNB 3V60A 3FKYA 2YVCA 2WXKA 5E6NA 2HTME 3OAWA 3W2DA 4MDKE 1JWSD 4KGTA 1EU3A 2CKHB 1F77A 3ZJTA 1WXQA 2D3BA 2JZ3B 1PGBA 2GI9A 2KJRA 3AE3B 2VH2A 4KDIC 2VZKD 2WGSA 3VH3B 2O2VA 1NVID 3PPAA 2KC2A 1EWCA 4RGOS 2E6XA 4P16A 3DVNV 3AMZA 3QAQA 1HZ5A 2CU3A 3HK0A 2W3RA 4S0RA 3OWEB 3ALBA 1XLQA 2DZIA 2NS5A 2PLPA 4AJYB 3HIZA 4ITKA 2INDC 2C7HA 1T0QC 1EF1A 3ZDMC 2LHDA 4JQWC 3VQIA 4PYUA 5HKHA 1V81A 3HM3A 3VUXA 2RMMA 3APFA 3VTWA 4GDLA 4YXDB 1Z5SB 4TV3A 1U4AA 2BT6A 3PZ8A 1TKGA 4N59A 2DWQA 2M17A 1MPEA 3HM6X 4IM3A 4HRSA 1FIQA 2AX5A 3DBLI 4JWSC 4WQMA 2LVPA 4PS3A 2D3AA 3IAM1 4IW0A 2QDFA 2KJHB 1CZPA 4GXBA 4LLGM 2BYFA 4H2AA 3V62A 1YN3A 5C23A 1BT0A 2KX3A 2KDBA 4BVUC 1EUVB 1I4HA 2WXJA 3PS6A 2BYEA 1GB4A 4C7ZA 2IO0B 3W1YA 2K3UA 4YTNB 5IO9A 2CR5A 4FULA 2LUEA 3QC8B 4GMVA 2N7EA 4TQ0A 3Q8AA 3DBLB 3IG3A 4PT5A 1MVKA 1KF6B 3ZXVA 2G9HD 2MRPA 2ON8A 4XZ4A 3TIXA 1J7AA 1WXVA 4W9LA 2W54A 2WXHA 3IBEA 2JSVX 4ZRJA 4N6EB 2FAZA 2DLBA 4I6LB 3A1QA 3PHWB 2KWCA 2KN5A 1WRIA 1AYFA 1JCKB 3VTUA 1YQ4B 2Z59B 3BK2A 3L0WB 2GBRA 3PLUA 1N62A 3BYTB 5TR5A 1YOVB 3MC8A 1JWAD 2LVOA 2ZJDA 1FFVA 2TSSA 5BMIA 2WDRB 3TEZA 5AZHA 4EEWA 1AWDA 2Y5PA 1A70A 4WIPA 3PV1A 3BINA 4MELA 1IBXA 3B0AA 1I4XA 1V2YA 3ZLZA 2B76B 3EECA 2WXPA 1XLNA 2W3SA 2O2VB 5IKCM 2FUHB 1PGAA 1WYWB 2XEWA 4K7SA 1SE4A 1QILA 2QIEB 3EHVA 4B95A 3Q6BA 3TUOA 2EKIA 1TKEA 2BS2B 5J17A 5G5HA 4R3DA 3ZO5B 2FE8A 2V0GA 1NI2A 3IHPC 3SDLC 4JGHB 2KLCA 4P1BC 4HJGE 4GDLB 1S1QB 3BWUD 3R7QA 1B9RA 3DVGX 3QK0A 5IN7A 2KO3A 3GOEA 4IOIE 3H6NA 1YQBA 1P0RA 4IDIA 3EC8A 3VHTC 3VR9B 1SIJA 1GB1A 2L00B 3NJTA 2WDVB 2CHZA 1N63A 3BVMA 2IJ0A 4ZHOA 3JVZX 4LTUA 3X23A 4A3PA 1L4DB 3QCAA 3L17A 4GB9A 2IYDB 2AQ2B 2LASA 4P7IA 2K9XA 3DHIC 1L7YA 1KTKA 1K52A 4K1RB 2RDGA 4EKUA 4MSMB 2BWES 1F0ZA 1LGRA 4JWUC 1MI0A 2KWVB 3AEDB 1ENFA 3ZGZA 1WY8A 1PUTA 1TGZB 3WAPA 1QZEA 3KWVA 1WR6E 2IO2B 4K3BA 2L3ZA 1FO4A 2V3NA 4K7UA 4I6PA 4M0WA 4AWJA 1DOXA 2BBCA 2DYOA 3AE2B 2NPTA 5FR3A 4OHJA 3Q69A 1YIWA 2D5GA 2KYWA 4WAFA 1OEYJ 1UELA 4RNAA 5C3JB 3A9JA 4MACA 2J4XA 2XN9C 1GNUA 1UBIA 3OJ3A 3AEBB 2IPKD 3ONSA 1ROEA 1RRBA 2A4ZA 2WX1A 1EF5A 3M95A 3NHEB 1GC6A 1TY0A 2BWFA 2ICIA 2L8JA 1UNSA 2GRIA 3AE8B 2UU7A 4BKSD 4XWWA 4OW0A 2QILA 1LXDA 1V97A 3V6CB 4ANWA 5LLIA 1TT5B 1V8CA 4ZRKA 2ZCCA 1WE6A 2XBBC 4DBGA 2PVGC 4M02A
chains in the Genus database with same CATH topology
4EOYA 4BKGA 1WXMA 2RPQA 3DBSA 3EFUA 2LJ5A 1HE8A 4DHZE 4N9F4 2KX0A 1P1AA 2IZVB 4I6NB 2N4FA 3AXCA 4HVBA 3A4RA 4DK5A 2XK5B 4W9IA 1GC7A 1XQQA 2NBWB 4GIVA 3RT3B 1UD7A 4MGIE 1WRDB 3KW5B 2M1MA 4XX5A 4ZDVA 2FCQA 4HWIB 3K9OB 1WM2A 2AEHA 2M4NA 5E6PA 3TL5A 5LXIB 4TQ1A 2KOXA 3WANA 1Q5WB 2REXA 2JVCA 4B9KA 2CU1A 1V86A 1J19A 4KVGB 3VUWA 2KZRA 2RGFA 1P9DU 2BF8B 2QHOA 3ZRFA 1TBEA 2DZKA 2Z0DB 3OLMD 2FCNA 2HE7A 4II3B 3W1SA 2JZZA 4KDLB 2MP2A 4DDGD 4GGQA 3ZNZB 3DOWA 3U30A 2D2QA 2WYQA 4RMAA 5C1ZA 2M8SA 5D94A 2ZVOA 2KQ7A 1WX7A 4GDKA 4B6WA 1WJ4A 2O6VA 4TUUA 1WH3A 4OVVA 2A5UA 2MA9B 2L0FA 4BOZB 2YLMA 5J2RA 2RSUA 2LGXA 3KUDB 1OEYA 3TBLD 2G3QB 2KFKB 3PRMB 4NJ6A 4TKNA 1IPGA 1Q0WB 1WE7A 3B1LX 4MJSA 1E8ZA 4FN2A 5G2NA 4AUQC 4MGYE 1C3TA 2KDFB 2MBQA 2MSED 4WWPA 1FXTB 2G4DB 4FHJA 3W1SC 4ANUA 4F7ZA 2KHWB 2EKEC 4OVUA 4BKTA 2LZ6A 3L10B 4PS8A 3ZNHB 4X57B 4BFRA 1PQSA 3V6EB 3UGBB 1WJNA 4HPMB 1D3ZA 2N9XA 4WQOB 2KLGA 4FLHA 3I3TB 2DZMA 1KM7A 5E6OA 3KYCD 4MEMA 3SU8X 3VH4B 5D6JB 3U8ZA 3ECIA 4ZYNA 2R2OA 2MWSB 4G0NB 1MG8A 1OQYA 3DVGY 3TJPA 5D7GA 5JHAA 2ZPYA 1IYFA 3H7PA 2DAJA 3KYDD 1KJTA 5CX3A 4GSWA 2K8CA 2WWZA 3C0RB 5CHWA 4JLCA 3MTNB 3V60A 3PTFC 4KV2A 5KHOA 4CHKA 2LRWA 4NQKE 3Q3JA 2KMAA 1SGHA 1P3QU 5DPSA 2HD5B 2YVCA 2D07B 5JZEB 5E6NA 2V3SA 3JSVB 4HLEA 2KTRA 2KTFA 2Y5BB 4NAWA 3OAWA 4KZ0A 4MDKE 4A3OA 2J0JA 3PVLA 1A5RA 3MJWA 5L95C 1RFAA 4M0WB 3UINB 2CKHB 4IM2A 4NY0A 3APCA 2NPTB 1GJZA 3A1QB 2L05A 2JZ3B 2GOWA 4BBNF 3DCGA 4BKSA 1Q1OA 2JY6A 3H1UA 4IUMB 2DYBA 2KJRA 3QWZB 1TTNA 3WIMA 2N7DA 2WDTB 3A9JB 4KSKC 3MHSD 2KJ6A 4KDIC 2RD0A 1WX8A 2C5LC 1R4MI 1WX9A 3VH3B 3ZUNA 2O2VA 3PPAA 2KC2A 3ZVVA 3VAWA 3DVNV 4LDTD 3QAQA 3HK0A 1LQBA 2DENB 4W9FA 3ALBA 2IY1B 3CSFA 5CHVC 2JXXA 1E90A 4URKA 2DZIA 2FNJB 2G4SA 2NS5A 2N1VA 3VFKA 4AJYB 1UBQA 4DDID 4DHJD 1V80A 3HIZA 3PRPB 1CMXB 4W9KA 3ZIMA 4MGZE 3X0WA 1YX5B 4M8MA 1I42A 2C7HA 1EF1A 2K25A 2LWPA 4JQWC 3VQIA 3ZDMC 2I1KA 4PYUA 5HKHA 1V81A 3HM3A 4MM3A 3VUXA 2K6DB 2L7RA 3CF6E 4EZKA 2D10A 3APFA 4IG7B 3VTWA 3A33B 2JWZA 3QARA 4GDLA 4K7WA 3TCAA 4FBJB 2N9PC 2HJ8A 2W9NA 3NY5A 3U7DA 4BOSC 1Z5SB 2N9EB 4CO7A 3HHMA 4TV3A 5JH5C 3JYUA 1U4AA 1WGDA 2IO3B 4W9JA 4FHKA 2AL3A 2M0XA 3UQAA 1V9JA 3KVFB 4IC7B 4LJOB 4WJNA 3M3JA 3CSTA 4EFOA 1WZ3A 4HDOA 4LCDE 4ICVA 1E7VA 2FIDA 2M17A 3S2AA 4W9GA 3HM6X 3SHQA 1XD3B 4II2B 4DXAB 4IM3A 5IA7A 1M94A 5L83A 4WAAA 3DBLI 2LVPA 3M62B 4PS3A 5J18A 4GN1A 5AEKB 4WWOA 3N30A 4IW0A 2ZCBA 2IBIB 2OJRA 2KJHB 4HXDA 5GMVA 4GXBA 4EUTA 3NS8A 1WXAA 4KSLC 3QIJA 2ZNVB 2BYFA 2EMTA 2JF5A 2L0TA 3QHTA 3V62A 5C23A 3ML9A 3H7SA 1WJUA 2K8BA 4FJVB 1BT0A 2ZZPB 2KX3A 3TMPB 4HCNB 1LFDA 4E74A 3Q3FA 2KDBA 4BVUC 3VDZA 2DHZA 1EUVB 1Y8RC 2FCMA 2KDEB 3P2BA 3PS6A 2JT4B 2MP2B 2BYEA 4MSQB 4DWFA 4IWPA 2FIFA 2KD0A 3ZW3A 1VD2A 2IO0B 3W1YA 5CTRC 4IM0A 4AJWA 4NJ7A 4WJQA 4FJYA 3T9LA 3ENEA 2G45B 4GDKB 2CR5A 4GU2A 3PHXB 2MBEA 4FA6A 4FULA 1WXSA 2C60A 4W9CA 1WJ6A 1R4NI 3PGEA 3LDZE 1GG3A 1WI0A 2LRUA 2LUEA 4FJZA 3QC8B 3WALA 4W9DA 4GMVA 2N7EA 2D11A 4MJSB 4TQ0A 3DBHI 3VXWA 4GOCA 2K6QA 2VRRB 3L13A 2UYZB 3IG3A 2KKCA 4ASWC 4WJOA 2MRPA 2D3GA 4KIKA 4XZ4A 4G3XB 1KOTA 1WMHA 4LJPB 4WJPA 3TIXA 3K9PB 2KXJA 2BKFA 3PT2B 4EZLA 5DCNA 1WXVA 4W9LA 2NVUI 3A4SC 3DDCB 3RZWC 3AI5A 2IY0B 3IBEA 4ZRJA 5AZFA 2Z0EB 2FAZA 5DPWA 3A9KB 4I6LB 3A1QA 2KMCA 4A20A 3PHWB 2KVRA 3H7PB 3RUIB 2KWCA 2KN5A 3PREA 1V49A 3KUZA 1ZW7A 4ANXA 2DX5B 4PS7A 3VTUA 2Z59B 2MQJA 4AOFA 5FR6A 4E71A 3N32A 4EZJA 3L0WB 1T0YA 2GBRA 3PLUA 4E3CA 1XT9B 5TR5A 2KTRB 4W9HA 2LD9A 4NAWB 1J0GA 2LVOA 2ZJDA 5G55A 4RM9A 1GUAB 1WGRA 3ZTDA 2JPHA 4K81A 4PYZA 4ZRIA 5IAAC 5AZHA 4EEWA 2ZEQA 4JL9A 2EMSA 4YL8A 4AP4C 3AULA 1K8RB 1S3SG 1YD8U 3PV1A 3AU5A 1V5TA 1WZ0A 2K39A 3BINA 4MELA 3LJ3A 4M8NA 3B0AA 4MH0E 4F1SA 1V2YA 3ZLZA 3T8MA 3EECA 2XK5A 3GZNI 2MBBB 1C1YB 2DZJA 1H4RA 2J0MA 2PPHA 2O2VB 5D2MB 1WFYA 2FUHB 2WX0A 2KQSA 3UQBA 1WYWB 2XEWA 4K7SA 3R66C 2CS4A 2CHWA 3PSEB 4HJKA 3EHVA 3DQVA 1KLVA 3QJZA 2LVQA 3PRZA 1ISNA 2GBMA 3N3KB 4B95A 2NCNA 1LM8B 2I1JA 2R2QA 2NR2A 1L2NA 3PLVA 2GBJA 1WGYA 2ZPNA 5J17A 2C7NB 3H9DA 3RD2A 2LGDA 3ZO5B 3APDA 3AU4A 5AZGA 2V4LA 3RZFA 4HPLB 1NI2A 3RCZA 3IHPC 2AYOB 3RYTA 1TZ1A 3VTVA 1OTRB 2BKRB 3SDLC 2JRIB 1P98A 2DYMA 1E8XA 2IO1B 2KLCA 2OOBB 4JGHB 2BPSA 2GBNA 2ZVNA 2DAFA 4GDLB 1S1QB 2N1WA 1NBFC 3R7QA 2K1FA 3DVGX 3KUCB 3V61A 3QK0A 3ZNID 1OGWA 2C9WB 2KO3A 1WR1A 2KFKA 4G11A 3GOEA 4XC2A 3H6NA 2JUOA 1YQBA 1P0RA 1UGMA 5DPTA 2MBHA 1YX6B 3EC8A 3M63B 2FCSA 2GMIC 3VHTC 2KANA 2L00B 3NZUA 1E5WA 4NNJB 5LXHA 2CHZA 3D32A 5CHFA 2L76A 3JVZX 4CYEA 3X23A 2PEAA 4A3PA 1YJ1A 2ASQA 3QCAA 3L17A 4GB9A 2IYDB 3KH0A 4IWQA 1E8WA 2LASA 1X1MA 4P7IA 2NBVB 5DPRA 3DPDA 4G50A 1AARA 1L7YA 2ZNVC 4J6IA 5BO4B 2LXCA 2O6VB 4K1RB 2O6VD 2AL6A 2GBKA 2LGYA 1NDDA 1G6JA 3BY4B 1H8CA 2LXAA 4EKUA 3DBRI 1ZKHA 2BWES 4MSMB 4RM8A 3UIOB 2KDIA 4HDQA 1WIAA 1UZXB 3O65B 2KWVB 1E8YA 4W9EA 1EO6A 3VUYA 1WY8A 3WAOA 3OJ4B 1UH6A 1WM3A 1TGZB 3DVNU 3WAPA 1QZEA 5EDSA 2MX2A 3JSVA 2BYVE 2KNBA 1WR6E 2AWTA 2IO2B 2PJHA 4FADA 4F8CB 2L3ZA 4NQLB 1I35A 4K7UA 1ZGUB 4I6PA 1RLFA 4DHZB 4AWJA 4ANVA 3A9KA 3B08A 2HTHA 3CMMB 3QX1A 2DYOA 2MLBA 2NPTA 2V1YA 3IFWB 1V6EA 3NZSA 1SIFA 1RAXA 3IVFA 1YIWA 3QA8A 2UWQA 1V5OA 1OEYJ 1UELA 1WF9A 1IP9A 3A9JA 1UBIA 1GNUA 3OJ3A 3R7RA 4KIKB 1WMHB 2MBOA 3QQ8B 3SD5A 3ZKJC 3UF8A 3R3MA 3ONSA 2RR9A 2J0KA 1RRBA 1WGHA 2MW5A 4JIOU 3ZRCA 2KC1A 3VVWB 3ML8A 4IWOA 3ZNGC 2C7MB 5KHQA 2A4ZA 2WX1A 3L16A 1EF5A 1JRUA 2LI5A 3M95A 3NHEB 1GC6A 2BWFA 1SE9A 3JW0X 2L8JA 2NBUA 2J7QB 2KK8A 2MCNB 3PZDA 3WAMA 3ZTCA 4BKSD 3UIPB 3WA0A 4HCPB 5JHBA 1LXDA 3L08A 2PE6B 3V6CB 4ANWA 1VCBA 4LDTB 5LLIA 4ICUA 1J8CA 1E7UA 2KFJA 4HK2A 3ZDTA 2KWUB 3NOBA 4ZRKA 2CHXA 2ZCCA 1WE6A 1WGGA 3RULA 4NPNA 4BBNC 1Z2MA 4MGKE 3L54A 4WWNA 2XBBC 4DBGA 1F9JA 4KZCA 2K8HA 2BGFA 2B3AA 4DHJB 2JRHA 2PE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EOY A;  4BKG A;  1WXM A;  2RPQ A;  3DBS A;  3EFU A;  2LJ5 A;  1HE8 A;  4DHZ E;  4N9F 4;  2KX0 A;  1P1A A;  2IZV B;  4I6N B;  2N4F A;  3AXC A;  4HVB A;  3A4R A;  4DK5 A;  2XK5 B;  4W9I A;  1GC7 A;  1XQQ A;  2NBW B;  4GIV A;  3RT3 B;  1UD7 A;  4MGI E;  1WRD B;  3KW5 B;  2M1M A;  4XX5 A;  4ZDV A;  2FCQ A;  4HWI B;  3K9O B;  1WM2 A;  2AEH A;  2M4N A;  5E6P A;  3TL5 A;  5LXI B;  4TQ1 A;  2KOX A;  3WAN A;  1Q5W B;  2REX A;  2JVC A;  4B9K A;  2CU1 A;  1V86 A;  1J19 A;  4KVG B;  3VUW A;  2KZR A;  2RGF A;  1P9D U;  2BF8 B;  2QHO A;  3ZRF A;  1TBE A;  2DZK A;  2Z0D B;  3OLM D;  2FCN A;  2HE7 A;  4II3 B;  3W1S A;  2JZZ A;  4KDL B;  2MP2 A;  4DDG D;  4GGQ A;  3ZNZ B;  3DOW A;  3U30 A;  2D2Q A;  2WYQ A;  4RMA A;  5C1Z A;  2M8S A;  5D94 A;  2ZVO A;  2KQ7 A;  1WX7 A;  4GDK A;  4B6W A;  1WJ4 A;  2O6V A;  4TUU A;  1WH3 A;  4OVV A;  2A5U A;  2MA9 B;  2L0F A;  4BOZ B;  2YLM A;  5J2R A;  2RSU A;  2LGX A;  3KUD B;  1OEY A;  3TBL D;  2G3Q B;  2KFK B;  3PRM B;  4NJ6 A;  4TKN A;  1IPG A;  1Q0W B;  1WE7 A;  3B1L X;  4MJS A;  1E8Z A;  4FN2 A;  5G2N A;  4AUQ C;  4MGY E;  1C3T A;  2KDF B;  2MBQ A;  2MSE D;  4WWP A;  1FXT B;  2G4D B;  4FHJ A;  3W1S C;  4ANU A;  4F7Z A;  2KHW B;  2EKE C;  4OVU A;  4BKT A;  2LZ6 A;  3L10 B;  4PS8 A;  3ZNH B;  4X57 B;  4BFR A;  1PQS A;  3V6E B;  3UGB B;  1WJN A;  4HPM B;  1D3Z A;  2N9X A;  4WQO B;  2KLG A;  4FLH A;  3I3T B;  2DZM A;  1KM7 A;  5E6O A;  3KYC D;  4MEM A;  3SU8 X;  3VH4 B;  5D6J B;  3U8Z A;  3ECI A;  4ZYN A;  2R2O A;  2MWS B;  4G0N B;  1MG8 A;  1OQY A;  3DVG Y;  3TJP A;  5D7G A;  5JHA A;  2ZPY A;  1IYF A;  3H7P A;  2DAJ A;  3KYD D;  1KJT A;  5CX3 A;  4GSW A;  2K8C A;  2WWZ A;  3C0R B;  5CHW A;  4JLC A;  3MTN B;  3V60 A;  3PTF C;  4KV2 A;  5KHO A;  4CHK A;  2LRW A;  4NQK E;  3Q3J A;  2KMA A;  1SGH A;  1P3Q U;  5DPS A;  2HD5 B;  2YVC A;  2D07 B;  5JZE B;  5E6N A;  2V3S A;  3JSV B;  4HLE A;  2KTR A;  2KTF A;  2Y5B B;  4NAW A;  3OAW A;  4KZ0 A;  4MDK E;  4A3O A;  2J0J A;  3PVL A;  1A5R A;  3MJW A;  5L95 C;  1RFA A;  4M0W B;  3UIN B;  2CKH B;  4IM2 A;  4NY0 A;  3APC A;  2NPT B;  1GJZ A;  3A1Q B;  2L05 A;  2JZ3 B;  2GOW A;  4BBN F;  3DCG A;  4BKS A;  1Q1O A;  2JY6 A;  3H1U A;  4IUM B;  2DYB A;  2KJR A;  3QWZ B;  1TTN A;  3WIM A;  2N7D A;  2WDT B;  3A9J B;  4KSK C;  3MHS D;  2KJ6 A;  4KDI C;  2RD0 A;  1WX8 A;  2C5L C;  1R4M I;  1WX9 A;  3VH3 B;  3ZUN A;  2O2V A;  3PPA A;  2KC2 A;  3ZVV A;  3VAW A;  3DVN V;  4LDT D;  3QAQ A;  3HK0 A;  1LQB A;  2DEN B;  4W9F A;  3ALB A;  2IY1 B;  3CSF A;  5CHV C;  2JXX A;  1E90 A;  4URK A;  2DZI A;  2FNJ B;  2G4S A;  2NS5 A;  2N1V A;  3VFK A;  4AJY B;  1UBQ A;  4DDI D;  4DHJ D;  1V80 A;  3HIZ A;  3PRP B;  1CMX B;  4W9K A;  3ZIM A;  4MGZ E;  3X0W A;  1YX5 B;  4M8M A;  1I42 A;  2C7H A;  1EF1 A;  2K25 A;  2LWP A;  4JQW C;  3VQI A;  3ZDM C;  2I1K A;  4PYU A;  5HKH A;  1V81 A;  3HM3 A;  4MM3 A;  3VUX A;  2K6D B;  2L7R A;  3CF6 E;  4EZK A;  2D10 A;  3APF A;  4IG7 B;  3VTW A;  3A33 B;  2JWZ A;  3QAR A;  4GDL A;  4K7W A;  3TCA A;  4FBJ B;  2N9P C;  2HJ8 A;  2W9N A;  3NY5 A;  3U7D A;  4BOS C;  1Z5S B;  2N9E B;  4CO7 A;  3HHM A;  4TV3 A;  5JH5 C;  3JYU A;  1U4A A;  1WGD A;  2IO3 B;  4W9J A;  4FHK A;  2AL3 A;  2M0X A;  3UQA A;  1V9J A;  3KVF B;  4IC7 B;  4LJO B;  4WJN A;  3M3J A;  3CST A;  4EFO A;  1WZ3 A;  4HDO A;  4LCD E;  4ICV A;  1E7V A;  2FID A;  2M17 A;  3S2A A;  4W9G A;  3HM6 X;  3SHQ A;  1XD3 B;  4II2 B;  4DXA B;  4IM3 A;  5IA7 A;  1M94 A;  5L83 A;  4WAA A;  3DBL I;  2LVP A;  3M62 B;  4PS3 A;  5J18 A;  4GN1 A;  5AEK B;  4WWO A;  3N30 A;  4IW0 A;  2ZCB A;  2IBI B;  2OJR A;  2KJH B;  4HXD A;  5GMV A;  4GXB A;  4EUT A;  3NS8 A;  1WXA A;  4KSL C;  3QIJ A;  2ZNV B;  2BYF A;  2EMT A;  2JF5 A;  2L0T A;  3QHT A;  3V62 A;  5C23 A;  3ML9 A;  3H7S A;  1WJU A;  2K8B A;  4FJV B;  1BT0 A;  2ZZP B;  2KX3 A;  3TMP B;  4HCN B;  1LFD A;  4E74 A;  3Q3F A;  2KDB A;  4BVU C;  3VDZ A;  2DHZ A;  1EUV B;  1Y8R C;  2FCM A;  2KDE B;  3P2B A;  3PS6 A;  2JT4 B;  2MP2 B;  2BYE A;  4MSQ B;  4DWF A;  4IWP A;  2FIF A;  2KD0 A;  3ZW3 A;  1VD2 A;  2IO0 B;  3W1Y A;  5CTR C;  4IM0 A;  4AJW A;  4NJ7 A;  4WJQ A;  4FJY A;  3T9L A;  3ENE A;  2G45 B;  4GDK B;  2CR5 A;  4GU2 A;  3PHX B;  2MBE A;  4FA6 A;  4FUL A;  1WXS A;  2C60 A;  4W9C A;  1WJ6 A;  1R4N I;  3PGE A;  3LDZ E;  1GG3 A;  1WI0 A;  2LRU A;  2LUE A;  4FJZ A;  3QC8 B;  3WAL A;  4W9D A;  4GMV A;  2N7E A;  2D11 A;  4MJS B;  4TQ0 A;  3DBH I;  3VXW A;  4GOC A;  2K6Q A;  2VRR B;  3L13 A;  2UYZ B;  3IG3 A;  2KKC A;  4ASW C;  4WJO A;  2MRP A;  2D3G A;  4KIK A;  4XZ4 A;  4G3X B;  1KOT A;  1WMH A;  4LJP B;  4WJP A;  3TIX A;  3K9P B;  2KXJ A;  2BKF A;  3PT2 B;  4EZL A;  5DCN A;  1WXV A;  4W9L A;  2NVU I;  3A4S C;  3DDC B;  3RZW C;  3AI5 A;  2IY0 B;  3IBE A;  4ZRJ A;  5AZF A;  2Z0E B;  2FAZ A;  5DPW A;  3A9K B;  4I6L B;  3A1Q A;  2KMC A;  4A20 A;  3PHW B;  2KVR A;  3H7P B;  3RUI B;  2KWC A;  2KN5 A;  3PRE A;  1V49 A;  3KUZ A;  1ZW7 A;  4ANX A;  2DX5 B;  4PS7 A;  3VTU A;  2Z59 B;  2MQJ A;  4AOF A;  5FR6 A;  4E71 A;  3N32 A;  4EZJ A;  3L0W B;  1T0Y A;  2GBR A;  3PLU A;  4E3C A;  1XT9 B;  5TR5 A;  2KTR B;  4W9H A;  2LD9 A;  4NAW B;  1J0G A;  2LVO A;  2ZJD A;  5G55 A;  4RM9 A;  1GUA B;  1WGR A;  3ZTD A;  2JPH A;  4K81 A;  4PYZ A;  4ZRI A;  5IAA C;  5AZH A;  4EEW A;  2ZEQ A;  4JL9 A;  2EMS A;  4YL8 A;  4AP4 C;  3AUL A;  1K8R B;  1S3S G;  1YD8 U;  3PV1 A;  3AU5 A;  1V5T A;  1WZ0 A;  2K39 A;  3BIN A;  4MEL A;  3LJ3 A;  4M8N A;  3B0A A;  4MH0 E;  4F1S A;  1V2Y A;  3ZLZ A;  3T8M A;  3EEC A;  2XK5 A;  3GZN I;  2MBB B;  1C1Y B;  2DZJ A;  1H4R A;  2J0M A;  2PPH A;  2O2V B;  5D2M B;  1WFY A;  2FUH B;  2WX0 A;  2KQS A;  3UQB A;  1WYW B;  2XEW A;  4K7S A;  3R66 C;  2CS4 A;  2CHW A;  3PSE B;  4HJK A;  3EHV A;  3DQV A;  1KLV A;  3QJZ A;  2LVQ A;  3PRZ A;  1ISN A;  2GBM A;  3N3K B;  4B95 A;  2NCN A;  1LM8 B;  2I1J A;  2R2Q A;  2NR2 A;  1L2N A;  3PLV A;  2GBJ A;  1WGY A;  2ZPN A;  5J17 A;  2C7N B;  3H9D A;  3RD2 A;  2LGD A;  3ZO5 B;  3APD A;  3AU4 A;  5AZG A;  2V4L A;  3RZF A;  4HPL B;  1NI2 A;  3RCZ A;  3IHP C;  2AYO B;  3RYT A;  1TZ1 A;  3VTV A;  1OTR B;  2BKR B;  3SDL C;  2JRI B;  1P98 A;  2DYM A;  1E8X A;  2IO1 B;  2KLC A;  2OOB B;  4JGH B;  2BPS A;  2GBN A;  2ZVN A;  2DAF A;  4GDL B;  1S1Q B;  2N1W A;  1NBF C;  3R7Q A;  2K1F A;  3DVG X;  3KUC B;  3V61 A;  3QK0 A;  3ZNI D;  1OGW A;  2C9W B;  2KO3 A;  1WR1 A;  2KFK A;  4G11 A;  3GOE A;  4XC2 A;  3H6N A;  2JUO A;  1YQB A;  1P0R A;  1UGM A;  5DPT A;  2MBH A;  1YX6 B;  3EC8 A;  3M63 B;  2FCS A;  2GMI C;  3VHT C;  2KAN A;  2L00 B;  3NZU A;  1E5W A;  4NNJ B;  5LXH A;  2CHZ A;  3D32 A;  5CHF A;  2L76 A;  3JVZ X;  4CYE A;  3X23 A;  2PEA A;  4A3P A;  1YJ1 A;  2ASQ A;  3QCA A;  3L17 A;  4GB9 A;  2IYD B;  3KH0 A;  4IWQ A;  1E8W A;  2LAS A;  1X1M A;  4P7I A;  2NBV B;  5DPR A;  3DPD A;  4G50 A;  1AAR A;  1L7Y A;  2ZNV C;  4J6I A;  5BO4 B;  2LXC A;  2O6V B;  4K1R B;  2O6V D;  2AL6 A;  2GBK A;  2LGY A;  1NDD A;  1G6J A;  3BY4 B;  1H8C A;  2LXA A;  4EKU A;  3DBR I;  1ZKH A;  2BWE S;  4MSM B;  4RM8 A;  3UIO B;  2KDI A;  4HDQ A;  1WIA A;  1UZX B;  3O65 B;  2KWV B;  1E8Y A;  4W9E A;  1EO6 A;  3VUY A;  1WY8 A;  3WAO A;  3OJ4 B;  1UH6 A;  1WM3 A;  1TGZ B;  3DVN U;  3WAP A;  1QZE A;  5EDS A;  2MX2 A;  3JSV A;  2BYV E;  2KNB A;  1WR6 E;  2AWT A;  2IO2 B;  2PJH A;  4FAD A;  4F8C B;  2L3Z A;  4NQL B;  1I35 A;  4K7U A;  1ZGU B;  4I6P A;  1RLF A;  4DHZ B;  4AWJ A;  4ANV A;  3A9K A;  3B08 A;  2HTH A;  3CMM B;  3QX1 A;  2DYO A;  2MLB A;  2NPT A;  2V1Y A;  3IFW B;  1V6E A;  3NZS A;  1SIF A;  1RAX A;  3IVF A;  1YIW A;  3QA8 A;  2UWQ A;  1V5O A;  1OEY J;  1UEL A;  1WF9 A;  1IP9 A;  3A9J A;  1UBI A;  1GNU A;  3OJ3 A;  3R7R A;  4KIK B;  1WMH B;  2MBO A;  3QQ8 B;  3SD5 A;  3ZKJ C;  3UF8 A;  3R3M A;  3ONS A;  2RR9 A;  2J0K A;  1RRB A;  1WGH A;  2MW5 A;  4JIO U;  3ZRC A;  2KC1 A;  3VVW B;  3ML8 A;  4IWO A;  3ZNG C;  2C7M B;  5KHQ A;  2A4Z A;  2WX1 A;  3L16 A;  1EF5 A;  1JRU A;  2LI5 A;  3M95 A;  3NHE B;  1GC6 A;  2BWF A;  1SE9 A;  3JW0 X;  2L8J A;  2NBU A;  2J7Q B;  2KK8 A;  2MCN B;  3PZD A;  3WAM A;  3ZTC A;  4BKS D;  3UIP B;  3WA0 A;  4HCP B;  5JHB A;  1LXD A;  3L08 A;  2PE6 B;  3V6C B;  4ANW A;  1VCB A;  4LDT B;  5LLI A;  4ICU A;  1J8C A;  1E7U A;  2KFJ A;  4HK2 A;  3ZDT A;  2KWU B;  3NOB A;  4ZRK A;  2CHX A;  2ZCC A;  1WE6 A;  1WGG A;  3RUL A;  4NPN A;  4BBN C;  1Z2M A;  4MGK E;  3L54 A;  4WWN A;  2XBB C;  4DBG A;  1F9J A;  4KZC A;  2K8H A;  2BGF A;  2B3A A;  4DHJ B;  2JRH A;  2PE9 A; 
#chains in the Genus database with same CATH topology
 4EOY A;  3V3X A;  4BKG A;  3EFU A;  2RPQ A;  3ZJV A;  1HE8 A;  4DK5 A;  1GC7 A;  1XQQ A;  3DWM A;  1ESF A;  2M1M A;  3EFC A;  1WM2 A;  2M4N A;  1UF0 A;  1V86 A;  2MH7 A;  4KVG B;  4RF1 A;  1PGX A;  2Z0D B;  2DZK A;  3W1S A;  4NAM A;  1CJE A;  2MP2 A;  2JYE A;  1NI3 A;  1HEZ E;  3ZNZ B;  1FPY A;  2WYQ A;  4XGA B;  4GDK A;  1KFY B;  1WJ4 A;  2YLM A;  1OEY A;  4TKN A;  1Q0W B;  1WE7 A;  1C3T A;  3BII D;  2KDF B;  2MBQ A;  4WWP A;  1FXT B;  2G4D B;  4OVU A;  4BKT A;  2LZ6 A;  2LFI A;  4BFR A;  1C77 A;  1C78 A;  1HTO A;  1PQS A;  1L5P A;  4OVZ A;  4WQO B;  4FLH A;  1NYR A;  1KM7 A;  5E6O A;  3KYC D;  5EE0 A;  5D6J B;  3RNE C;  3ECI A;  4ZYN A;  3CIR B;  2IGD A;  1OQY A;  1SE2 A;  2KAC A;  5CX3 A;  2LRW A;  4NQK E;  1C4A A;  3Q3J A;  2KMA A;  1SGH A;  1UUP A;  3Q8B A;  2HD5 B;  3N9Y C;  2D07 B;  5DPS A;  3Q3N C;  2V3S A;  2WXL A;  4HLE A;  4KZ0 A;  3MJW A;  1WGK A;  4M0W B;  5FK9 C;  4NY0 A;  3APC A;  1QLB B;  2NPT B;  2GOW A;  3DCG A;  2JY6 A;  2DYB A;  3A9J B;  2RD0 A;  1R4M I;  1PYW D;  1LO5 D;  3VAW A;  1YN4 A;  1LQB A;  3DBH B;  3ZQ4 A;  5CHV C;  4DQO C;  1E90 A;  4URK A;  1J7B A;  2G4S A;  2N1V A;  1V80 A;  4JPS A;  4PK1 A;  1JQ4 A;  2Y5C A;  3ZIM A;  4M8M A;  3LYY A;  1FFU A;  2V4I B;  2I1K A;  1ZPS A;  4B0M A;  2I2Y A;  4EZK A;  5C2T B;  4IG7 B;  4HKQ A;  3TCA A;  4FBJ B;  2W9N A;  3U7D A;  2N9E B;  3C8Y A;  4L23 A;  2WXM A;  4FHK A;  2IDY A;  2M0X A;  3I9V 1;  1V9J A;  1WSP A;  4MH8 A;  4XDC A;  4LJO B;  2V3P A;  1E0Z A;  1WZ3 A;  4LCD E;  1YJJ A;  2M0A A;  2WXF A;  2KT7 A;  4DXA B;  5IA7 A;  1I4R A;  1FRD A;  3ZXR A;  5BYQ A;  5TSS A;  3M62 B;  4A90 A;  4GN1 A;  3P4S B;  4RGN A;  4QAY A;  2W55 A;  2IBI B;  2OJR A;  3AEA B;  2NTS A;  5GMV A;  1SXT A;  3QHT A;  3RFZ B;  3ML9 A;  4AQ7 A;  2QMT A;  3GZN B;  4Q2J A;  3AEG B;  1JRO A;  4E74 A;  3J9C A;  1Y8R C;  2KDE B;  3P2B A;  1HZ6 A;  3AM9 A;  2DNF A;  2MP2 B;  4IWP A;  4IM0 A;  4NJ7 A;  4WJQ A;  4FJY A;  3T9L A;  4GDK B;  4GU2 A;  1ET6 A;  1R4N I;  3URY A;  3LDZ E;  1L0Y B;  2LRU A;  4FJZ A;  3WAL A;  4W9D A;  3VXW A;  1FNV A;  2OED A;  2R61 A;  1STE A;  4WJO A;  2D3G A;  1ZXI A;  1TKY A;  1BML C;  2WXO A;  4G3X B;  1KOT A;  4LNI A;  4WJP A;  2BKF A;  1N6Z A;  2GB1 A;  3AI5 A;  2LGI A;  1K53 A;  4LK0 M;  2AQ3 B;  3U7Z A;  2NMQ A;  1XF5 L;  2Z0E B;  3A9K B;  2KMC A;  4KGR A;  2BYT A;  3RUI B;  1ZDX A;  3R8B A;  4O1N A;  3NRZ A;  4ANX A;  4PS7 A;  1GOZ A;  4EZJ A;  3RNA C;  4E3C A;  1XT9 B;  1R4N B;  3DWG C;  2LD9 A;  3DBR B;  4KGS A;  1IGC A;  1GUA B;  1WGR A;  4K81 A;  5IAA C;  3P42 A;  2BS3 B;  4AP4 C;  3AUL A;  2JQR B;  1FCL A;  3L4P A;  3AE6 B;  3AU5 A;  1WZ0 A;  2K39 A;  4M8N A;  2X38 A;  3DHH C;  2XK5 A;  2MBB B;  1C1Y B;  3SR6 A;  1C79 A;  5D2M B;  1QKZ A;  3RPF C;  2KQS A;  2CS4 A;  2CHW A;  4HJK A;  4TSS A;  1KLV A;  3FC4 A;  1MG4 A;  1LM8 B;  1XCQ L;  2I1J A;  2R2Q A;  3KLS X;  1C9F A;  3CWI A;  2GBJ A;  2ZPN A;  1BXT A;  1YNT E;  1Q10 A;  2FUG 1;  1SJE D;  1TZ1 A;  1R7S A;  1OTR B;  3NZ3 A;  2JRI B;  1P98 A;  4M00 A;  4ZRQ A;  1E8X A;  2IO1 B;  3NS1 A;  4EE2 A;  2N7J A;  4P1C C;  1V1P A;  1OGW A;  2K0P A;  2W82 A;  2C9W B;  1WR1 A;  2OJW A;  2BS4 B;  2KFK A;  2WXQ A;  4G11 A;  4XC2 A;  4WWM A;  5H92 C;  1UGM A;  5DPT A;  2MBH A;  3M63 B;  4HEA 1;  2GMI C;  3NZU A;  5LXH A;  3D32 A;  1MHH E;  5MPO A;  4CYE A;  2PEA A;  1YJ1 A;  1JWM D;  2QJL A;  3P1M A;  1E8W A;  3RNB C;  1BUI C;  3DPD A;  4RFB A;  1AAR A;  2RDB C;  1D5M C;  5BO4 B;  2O6V B;  4B0E A;  4C56 C;  2BTE A;  2O6V D;  2AL6 A;  2GBK A;  5H8Y E;  1NDD A;  3BY4 B;  4XDD A;  1ZKH A;  4HDQ A;  1I4G A;  3WAO A;  2MX2 A;  3JSV A;  2BYV E;  3W5U B;  1VZ7 A;  4NQL B;  4LNK A;  2WS3 B;  1I35 A;  1YQ3 B;  1ZGU B;  2MHJ A;  3CMM B;  2MLB A;  1E9M A;  3NZS A;  3QA8 A;  1V5O A;  1IP9 A;  2MEK A;  3TSS A;  5E6J A;  5AUK A;  2K22 A;  2MBO A;  1EWY C;  3QQ8 B;  3ZKJ C;  1D5X C;  1T0S C;  2Q5W D;  3NVZ A;  2J0K A;  4L2Y A;  2KC1 A;  1NEK B;  1FNU A;  3AV8 A;  2XNA C;  2BQQ A;  1GAQ B;  2NBU A;  2J7Q B;  5EE3 A;  3WAM A;  3ZTC A;  1B1Z A;  3NUH B;  3B2G A;  3WA0 A;  5JHB A;  2PE6 B;  1VCB A;  4LDT B;  1J8C A;  4J3O D;  1E7P B;  3P63 A;  1ET9 A;  1WGG A;  2SEB D;  3LXF A;  4A9A A;  4C4V A;  2E3T A;  4DHJ B;  1WF9 A;  3AN1 A;  2PE9 A;  1WXM A;  3DBS A;  2N0S B;  2BVC A;  4S17 A;  4ZYS A;  2PVO D;  5EE1 A;  1UGJ A;  1FMA D;  3P4P B;  3Q8F A;  4HPP A;  5BMH A;  2XK5 B;  4W9I A;  3R2I A;  2JX5 A;  1IGD A;  5D3D A;  2WU2 B;  1I4Q A;  2KAJ A;  3KW5 B;  3P4Q B;  4HWI B;  4NZL B;  5E6P A;  4TQ1 A;  2KOX A;  2LEK A;  1Q5W B;  1J7C A;  2WP9 B;  1RYJ A;  1J19 A;  1VDV A;  3VUW A;  4DXF A;  2RGF A;  3ZYY X;  4ARC A;  1TBE A;  4II3 B;  2HE7 A;  1L4Z B;  3U2S C;  3U30 A;  2L52 A;  4RMA A;  2KQ7 A;  3AE1 B;  4B6W A;  4TUU A;  4OVV A;  2A5U A;  2L0F A;  3NVV A;  3HUI A;  1V1P B;  3B2F A;  2RSU A;  2LGX A;  4RGT A;  2KFK B;  4NJ6 A;  1IPG A;  3B1L X;  4AUQ C;  4BZA A;  2MSE D;  4F7Z A;  2LGS A;  3W1S C;  1JAL A;  3L10 B;  3IT6 B;  4X57 B;  1PFD A;  4HPM B;  2N9X A;  2KLG A;  3I3T B;  4MEM A;  3VH4 B;  3U8Z A;  3AEC B;  4G0N B;  1MG8 A;  3DVG Y;  3VRB B;  5D7G A;  5JHA A;  2ZPY A;  2SAK A;  2DAJ A;  1SB3 C;  4GSW A;  5HHD G;  3ETR A;  1C76 A;  5KHO A;  4CHK A;  3Q3M C;  1D6E C;  5JZE B;  4C7Y A;  3JSV B;  3LB8 C;  2KTR A;  2WXG A;  2Y5B B;  4NAW A;  3U52 E;  4A3O A;  1RFA A;  2QC8 A;  3UIN B;  3GE8 C;  3H8H A;  1GJZ A;  3A1Q B;  1Q1O A;  4IUM B;  3QWZ B;  2N7D A;  2WDT B;  4KSK C;  2KJ6 A;  1WX8 A;  2C5L C;  2CJO A;  3Q8E A;  3ZUN A;  3FIL A;  2I38 A;  3RNF C;  5HFY A;  2IY1 B;  2HDE A;  2JXX A;  3BK1 A;  2FNJ B;  1SEB D;  1UBQ A;  1CMX B;  4MGZ E;  2WXN A;  1YX5 B;  1I42 A;  3AE7 B;  3Q3O C;  1FM0 D;  1T0R C;  2LWP A;  1IBX B;  2WDQ B;  1OQQ A;  3CF6 E;  2L7R A;  3Q2A C;  2D10 A;  3AE4 B;  3A33 B;  2JWZ A;  3QAR A;  3MFG A;  2HJ8 A;  4BOS C;  4CO7 A;  3HHM A;  2IO3 B;  4C4V B;  3BVZ A;  3E9S A;  4OZA A;  3GE3 C;  4IC7 B;  3MP9 A;  3M3J A;  4EFO A;  1DGJ A;  4ICV A;  1E7V A;  3S2A A;  1FCC C;  1RM6 C;  3SHQ A;  2KQ4 X;  4II2 B;  5L83 A;  2AQ1 B;  5I4D A;  5J18 A;  3N30 A;  2KDM A;  4EUT A;  2VH1 A;  4KKI A;  1WXA A;  1WJU A;  2INP E;  2IGG A;  3N1X C;  1LFD A;  1TJE A;  3BZD B;  4AS1 A;  5IOI A;  3WCQ A;  2JWU A;  1VD2 A;  2MJD A;  1IUE A;  3ENE A;  3PHX B;  4FA6 A;  4GLS C;  1WXS A;  2C60 A;  4LNF A;  1GG3 A;  1WI0 A;  4UDU C;  1HTQ A;  3DBH I;  4GOC A;  2K6Q A;  1VZ6 A;  3L13 A;  2WU5 B;  3BYY B;  4ASW C;  4YSY B;  4KIK A;  1CQV A;  1ZP0 B;  4LJP B;  2NVU I;  1WWT A;  3RZW C;  4JX1 C;  5AZF A;  5BYR A;  3AE9 B;  2KVR A;  5JXV A;  3ZJU A;  3PRE A;  1V49 A;  2DX5 B;  5HG2 A;  2MQJ A;  5FR6 A;  3N32 A;  1T0Y A;  1XXG A;  4YT0 B;  3Q8C A;  2KTR B;  4W9H A;  4NAW B;  1D4B A;  4PYZ A;  4REZ A;  4ZRI A;  1TS4 A;  2ZEQ A;  4JL9 A;  1XCT L;  1L0X B;  2L1A A;  1K8R B;  1S3S G;  3V05 A;  3SFD B;  3IAS 1;  3LJ3 A;  4F1S A;  3GZN I;  4L1B A;  2J0M A;  2PPH A;  1XLP A;  3UQB A;  1WFY A;  3FIL B;  3R66 C;  3PSE B;  2LJI A;  3DQV A;  3QJZ A;  2LVQ A;  2BB6 A;  1M4V A;  4MT5 A;  1EM7 A;  2NCN A;  2NR2 A;  4WH4 A;  1CK1 A;  3ABV B;  2C7N B;  3H9D A;  3RD2 A;  1FEH A;  2LGD A;  2V4L A;  3UI3 A;  3RCZ A;  2AYO B;  2BKR B;  1Y56 A;  2WLB A;  1FXA A;  2OOB B;  2GBN A;  2N1W A;  1NBF C;  2WHI A;  2K1F A;  3KUC B;  3RI7 C;  2JUO A;  1YX6 B;  2FCS A;  2KAN A;  2HJ1 A;  2K5P A;  5CHF A;  3NG0 A;  4YWG G;  4RCO A;  1JW9 D;  3SEB A;  4IWQ A;  4XE0 A;  1X1M A;  5DPR A;  4YSZ B;  1P7F A;  2ZNV C;  3AEE B;  2LXC A;  1DOY A;  2LGY A;  1G6J A;  1H8C A;  3DBR I;  3MHZ A;  1WIA A;  1UZX B;  2KMM A;  3O65 B;  1E8Y A;  2RDH A;  2Z8L A;  3VUY A;  1JRP A;  3OJ4 B;  1UH6 A;  4ARI A;  3DVN U;  3KWL A;  4KX6 B;  5EDS A;  1OFF A;  2WQY B;  4FAD A;  1RLF A;  4LNO A;  4ANV A;  4IKG A;  5IP4 D;  2JXT A;  3IFW B;  3T3N A;  2PIA A;  1V6E A;  1SIF A;  1KLU D;  1RAX A;  3IVF A;  2Y3A A;  3VRA B;  1T3Q A;  5LNK 1;  1TS2 A;  1I4P A;  4KIK B;  2BW2 A;  3UF8 A;  3R3M A;  1WGH A;  4JIO U;  3ZRC A;  3AEF B;  3C19 A;  4IWO A;  3ZNG C;  2C7M B;  5KHQ A;  2CJN A;  5T8I A;  2M56 B;  1JRU A;  2LI5 A;  3OG5 A;  1SE9 A;  3JW0 X;  1HQR D;  1P7E A;  1ZE3 D;  2KK8 A;  3PZD A;  3UIP B;  2VZK B;  3RNC C;  3TEY A;  3RN9 C;  4YSX B;  3I5J C;  4ICU A;  1E7U A;  3MJ5 A;  4HK2 A;  2KWU B;  3NOB A;  2OHF A;  4MGK E;  3L54 A;  4N58 A;  2PKO A;  1F9J A;  2BGF A;  1HXY D;  2B3A A;  3GP7 A;  2JRH A;  1EU4 A;  3TJP A;  1PDX A;  3IT4 B;  2LJ5 A;  4DHZ E;  2MJE A;  2KX0 A;  1P1A A;  2IZV B;  4I6N B;  2N4F A;  3AXC A;  2ACZ B;  2NBW B;  2ZW1 A;  1UD7 A;  4MGI E;  1WRD B;  4XX5 A;  4ZDV A;  1I7H A;  2FCQ A;  2LHE A;  1AW7 A;  3K9O B;  5LXI B;  2JVC A;  2CU1 A;  1QOG A;  1ZOY B;  2KZR A;  1P9D U;  1VRA B;  2QHO A;  3OLM D;  2JZZ A;  1ZUD 2;  3DOW A;  3O13 A;  3T3O A;  2D2Q A;  5C1Z A;  2M8S A;  3NVW A;  1WX7 A;  1WH3 A;  2IGH A;  2L32 A;  4BOZ B;  5J2R A;  3TBL D;  1QF6 A;  2G3Q B;  3PRM B;  4MJS A;  1E8Z A;  1JWB D;  2ZW0 A;  4FN2 A;  1WYG A;  1GPX A;  4ANU A;  4FHJ A;  1TZO A;  2EKE C;  4PS8 A;  2WXI A;  3ZNH B;  4M01 A;  3U4E G;  3N1Z C;  2DZM A;  3SU8 X;  1N5X A;  3IXS A;  1N60 A;  1SSN A;  3H7P A;  2NTT A;  5BYS A;  2WWZ A;  3C0R B;  4JLC A;  2M19 A;  3PTF C;  4KV2 A;  3AE5 B;  1P3Q U;  2EEL A;  2KTF A;  2J0J A;  3PVL A;  1A5R A;  5L95 C;  3FAH A;  4A8X C;  4IM2 A;  2WXR A;  4HKZ E;  2RPV A;  3EGR A;  2L05 A;  4BBN F;  4BKS A;  3H1U A;  1TTN A;  2MJ3 A;  3WIM A;  3MHS D;  1WX9 A;  3ZVV A;  3HVD A;  4LDT D;  4C00 A;  2DEN B;  2JZP A;  4W9F A;  3GS2 A;  3CSF A;  4ZHP A;  4K3C A;  3VFK A;  1QOF A;  4DDI D;  4DHJ D;  4W9K A;  3PRP B;  3X0W A;  3VR8 B;  1SE3 A;  2K25 A;  5FKA C;  4D2K A;  4MM3 A;  1UWM A;  2K6D B;  1FXI A;  1XLO A;  4K7W A;  1MJD A;  2ONQ A;  2N9P C;  1YN5 A;  3NY5 A;  4OZB A;  1FNW A;  4JE3 B;  3JYU A;  5JH5 C;  1WGD A;  4W9J A;  3UQA A;  2AL3 A;  1AN8 A;  4US9 A;  3KVF B;  1UWX A;  4WJN A;  3HVZ A;  3CST A;  4HDO A;  4NJC A;  2FID A;  3HRD D;  4W9G A;  1XD3 B;  3R2T A;  1M94 A;  4WAA A;  3E56 A;  5BMG A;  5AEK B;  1QOB A;  4WWO A;  2PTL A;  2ZCB A;  1V1O A;  4HXD A;  1YMH E;  3NS8 A;  4KSL C;  4P6V F;  3QIJ A;  2H88 B;  2ZNV B;  2EMT A;  1K50 A;  2JF5 A;  2L0T A;  3H7S A;  2K8B A;  4FJV B;  2J42 A;  2JU6 X;  2ZZP B;  5AUI A;  4HCN B;  3TMP B;  2LMC A;  3Q3F A;  3VDZ A;  2DHZ A;  2FCM A;  2JT4 B;  4MSQ B;  4DWF A;  2FIF A;  2KD0 A;  3Q14 C;  4BAX A;  3ZW3 A;  5CTR C;  2INC C;  2J53 A;  4AJW A;  2G45 B;  2MBE A;  4W9C A;  1ACC A;  1WJ6 A;  3PGE A;  2QCZ A;  1ZXH A;  3RMK C;  4USA A;  1E6E B;  2D11 A;  4MJS B;  2VRR B;  4DXG A;  2UYZ B;  1MFW A;  2KKC A;  1F2R C;  4FXC A;  1WMH A;  2L83 A;  3K9P B;  2KXJ A;  1N5W A;  3PT2 B;  4EZL A;  5DCN A;  3A4S C;  3TEW A;  3DDC B;  1MHX A;  2IY0 B;  1TYG B;  4XWT A;  1C4C A;  5DPW A;  3P4R B;  1VLB A;  4A20 A;  2YEP F;  3H7P B;  3KUZ A;  1ZW7 A;  4RH6 A;  1T6B X;  4AOF A;  2D3C A;  4E71 A;  1OQR A;  3MC0 B;  2GLS A;  2INN E;  3W9C B;  1T5X D;  2KWD A;  3N1Y C;  1J0G A;  5G55 A;  4RM9 A;  2YEP B;  3ZTD A;  4CQN A;  2JPH A;  4ACF A;  1E10 A;  2EMS A;  4YL8 A;  1JWU D;  1YD8 U;  1V5T A;  4MH0 E;  1FD6 A;  3T8M A;  1RFK A;  2N9L A;  2QSD A;  2DZJ A;  1H4R A;  3KQ4 A;  2WX0 A;  5GXG B;  3PRZ A;  1ISN A;  2GBM A;  2X8X X;  3N3K B;  3RNG C;  1L2N A;  3PLV A;  1WGY A;  1DOI A;  1TIF A;  2PW9 A;  3APD A;  1XO3 A;  3AU4 A;  3I57 A;  4ZRP A;  5AZG A;  1DYQ A;  3RZF A;  4HPL B;  2KVZ A;  3RYT A;  3VTV A;  4MM3 B;  2DYM A;  2JYT A;  2BPS A;  2ZVN A;  2DAF A;  3PZ7 A;  3V61 A;  3ZNI D;  2DBY A;  1C4P A;  5D3I B;  4C80 A;  1KH0 A;  5EE9 A;  3GB1 A;  1E5W A;  4NNJ B;  2L76 A;  2ASQ A;  4HRO A;  3EUB 2;  1HA5 A;  1NYQ A;  3KH0 A;  2NBV B;  4RF0 A;  4G50 A;  2LUM A;  4J6I A;  1RWS A;  4TMA B;  4KKJ A;  2LXA A;  3PO0 A;  3UIO B;  4RM8 A;  2KDI A;  4W9E A;  1EO6 A;  1FRR A;  1TS3 A;  2PMV A;  1F1H A;  1WM3 A;  2KNB A;  2AWT A;  3AB5 A;  3MC9 A;  2PJH A;  4F8C B;  2BB5 A;  3B9J A;  4DHZ B;  3A9K A;  3B08 A;  2HTH A;  3QX1 A;  2V1Y A;  5HI1 A;  2UWQ A;  3N20 C;  1VZ8 A;  4YTM B;  3R7R A;  1ZDV A;  1JML A;  1VJK A;  1WMH B;  2QEJ C;  3SD5 A;  3DHG C;  1N61 A;  2WNM A;  2H89 B;  1QOA A;  2RR9 A;  2MW5 A;  3VVW B;  3ML8 A;  2FBW B;  3NVY A;  3L16 A;  1QT9 A;  1SBB B;  4RGM A;  2N9K A;  1VR9 A;  1L0V B;  1L6U A;  2MCN B;  2J52 A;  1XEE A;  4OZC A;  1KRH A;  4HCP B;  3L08 A;  2KFJ A;  3ZDT A;  2CHX A;  5G5G A;  4US8 A;  3RUL A;  4BBN C;  2V9H A;  3I63 C;  4NPN A;  1Z2M A;  4WWN A;  4KZC A;  2K8H A;  2G1E A;  3TEX A;  3SFE B;  1NEN B;  1K51 A;  4LNN A;  4N9F 4;  4HVB A;  3A4R A;  4A6Q A;  4YTP B;  4GIV A;  3RT3 B;  3BVG A;  1TS5 A;  1F2R I;  2AEH A;  3TL5 A;  3WAN A;  2REX A;  4B9K A;  1YJI A;  1R4M B;  1SF0 A;  2BF8 B;  3ZRF A;  2FCN A;  4KDL B;  3W5V B;  3AH7 A;  4DDG D;  1SJH D;  4GGQ A;  5D94 A;  2ZVO A;  2O6V A;  2MA9 B;  4A55 A;  1D5Z C;  3KUD B;  4XYC A;  1KLG D;  1QQR A;  5G2N A;  2KN4 A;  4MGY E;  2KHW B;  4ZOH C;  3V6E B;  3UGB B;  1WJN A;  1D3Z A;  1TY2 A;  2R2O A;  2MWS B;  1L6V A;  1IYF A;  1F52 A;  3KYD D;  1KJT A;  4WUR A;  2K8C A;  3EA6 A;  5CHW A;  3MTN B;  3V60 A;  3FKY A;  2YVC A;  2WXK A;  5E6N A;  2HTM E;  3OAW A;  3W2D A;  4MDK E;  1JWS D;  4KGT A;  1EU3 A;  2CKH B;  1F77 A;  3ZJT A;  1WXQ A;  2D3B A;  2JZ3 B;  1PGB A;  2GI9 A;  2KJR A;  3AE3 B;  2VH2 A;  4KDI C;  2VZK D;  2WGS A;  3VH3 B;  2O2V A;  1NVI D;  3PPA A;  2KC2 A;  1EWC A;  4RGO S;  2E6X A;  4P16 A;  3DVN V;  3AMZ A;  3QAQ A;  1HZ5 A;  2CU3 A;  3HK0 A;  2W3R A;  4S0R A;  3OWE B;  3ALB A;  1XLQ A;  2DZI A;  2NS5 A;  2PLP A;  4AJY B;  3HIZ A;  4ITK A;  2IND C;  2C7H A;  1T0Q C;  1EF1 A;  3ZDM C;  2LHD A;  4JQW C;  3VQI A;  4PYU A;  5HKH A;  1V81 A;  3HM3 A;  3VUX A;  2RMM A;  3APF A;  3VTW A;  4GDL A;  4YXD B;  1Z5S B;  4TV3 A;  1U4A A;  2BT6 A;  3PZ8 A;  1TKG A;  4N59 A;  2DWQ A;  2M17 A;  1MPE A;  3HM6 X;  4IM3 A;  4HRS A;  1FIQ A;  2AX5 A;  3DBL I;  4JWS C;  4WQM A;  2LVP A;  4PS3 A;  2D3A A;  3IAM 1;  4IW0 A;  2QDF A;  2KJH B;  1CZP A;  4GXB A;  4LLG M;  2BYF A;  4H2A A;  3V62 A;  1YN3 A;  5C23 A;  1BT0 A;  2KX3 A;  2KDB A;  4BVU C;  1EUV B;  1I4H A;  2WXJ A;  3PS6 A;  2BYE A;  1GB4 A;  4C7Z A;  2IO0 B;  3W1Y A;  2K3U A;  4YTN B;  5IO9 A;  2CR5 A;  4FUL A;  2LUE A;  3QC8 B;  4GMV A;  2N7E A;  4TQ0 A;  3Q8A A;  3DBL B;  3IG3 A;  4PT5 A;  1MVK A;  1KF6 B;  3ZXV A;  2G9H D;  2MRP A;  2ON8 A;  4XZ4 A;  3TIX A;  1J7A A;  1WXV A;  4W9L A;  2W54 A;  2WXH A;  3IBE A;  2JSV X;  4ZRJ A;  4N6E B;  2FAZ A;  2DLB A;  4I6L B;  3A1Q A;  3PHW B;  2KWC A;  2KN5 A;  1WRI A;  1AYF A;  1JCK B;  3VTU A;  1YQ4 B;  2Z59 B;  3BK2 A;  3L0W B;  2GBR A;  3PLU A;  1N62 A;  3BYT B;  5TR5 A;  1YOV B;  3MC8 A;  1JWA D;  2LVO A;  2ZJD A;  1FFV A;  2TSS A;  5BMI A;  2WDR B;  3TEZ A;  5AZH A;  4EEW A;  1AWD A;  2Y5P A;  1A70 A;  4WIP A;  3PV1 A;  3BIN A;  4MEL A;  1IBX A;  3B0A A;  1I4X A;  1V2Y A;  3ZLZ A;  2B76 B;  3EEC A;  2WXP A;  1XLN A;  2W3S A;  2O2V B;  5IKC M;  2FUH B;  1PGA A;  1WYW B;  2XEW A;  4K7S A;  1SE4 A;  1QIL A;  2QIE B;  3EHV A;  4B95 A;  3Q6B A;  3TUO A;  2EKI A;  1TKE A;  2BS2 B;  5J17 A;  5G5H A;  4R3D A;  3ZO5 B;  2FE8 A;  2V0G A;  1NI2 A;  3IHP C;  3SDL C;  4JGH B;  2KLC A;  4P1B C;  4HJG E;  4GDL B;  1S1Q B;  3BWU D;  3R7Q A;  1B9R A;  3DVG X;  3QK0 A;  5IN7 A;  2KO3 A;  3GOE A;  4IOI E;  3H6N A;  1YQB A;  1P0R A;  4IDI A;  3EC8 A;  3VHT C;  3VR9 B;  1SIJ A;  1GB1 A;  2L00 B;  3NJT A;  2WDV B;  2CHZ A;  1N63 A;  3BVM A;  2IJ0 A;  4ZHO A;  3JVZ X;  4LTU A;  3X23 A;  4A3P A;  1L4D B;  3QCA A;  3L17 A;  4GB9 A;  2IYD B;  2AQ2 B;  2LAS A;  4P7I A;  2K9X A;  3DHI C;  1L7Y A;  1KTK A;  1K52 A;  4K1R B;  2RDG A;  4EKU A;  4MSM B;  2BWE S;  1F0Z A;  1LGR A;  4JWU C;  1MI0 A;  2KWV B;  3AED B;  1ENF A;  3ZGZ A;  1WY8 A;  1PUT A;  1TGZ B;  3WAP A;  1QZE A;  3KWV A;  1WR6 E;  2IO2 B;  4K3B A;  2L3Z A;  1FO4 A;  2V3N A;  4K7U A;  4I6P A;  4M0W A;  4AWJ A;  1DOX A;  2BBC A;  2DYO A;  3AE2 B;  2NPT A;  5FR3 A;  4OHJ A;  3Q69 A;  1YIW A;  2D5G A;  2KYW A;  4WAF A;  1OEY J;  1UEL A;  4RNA A;  5C3J B;  3A9J A;  4MAC A;  2J4X A;  2XN9 C;  1GNU A;  1UBI A;  3OJ3 A;  3AEB B;  2IPK D;  3ONS A;  1ROE A;  1RRB A;  2A4Z A;  2WX1 A;  1EF5 A;  3M95 A;  3NHE B;  1GC6 A;  1TY0 A;  2BWF A;  2ICI A;  2L8J A;  1UNS A;  2GRI A;  3AE8 B;  2UU7 A;  4BKS D;  4XWW A;  4OW0 A;  2QIL A;  1LXD A;  1V97 A;  3V6C B;  4ANW A;  5LLI A;  1TT5 B;  1V8C A;  4ZRK A;  2ZCC A;  1WE6 A;  2XBB C;  4DBG A;  2PVG C;  4M02 A; 
#chains in the Genus database with same CATH homology
 4EOY A;  4BKG A;  1WXM A;  2RPQ A;  3DBS A;  3EFU A;  2LJ5 A;  1HE8 A;  4DHZ E;  4N9F 4;  2KX0 A;  1P1A A;  2IZV B;  4I6N B;  2N4F A;  3AXC A;  4HVB A;  3A4R A;  4DK5 A;  2XK5 B;  4W9I A;  1GC7 A;  1XQQ A;  2NBW B;  4GIV A;  3RT3 B;  1UD7 A;  4MGI E;  1WRD B;  3KW5 B;  2M1M A;  4XX5 A;  4ZDV A;  2FCQ A;  4HWI B;  3K9O B;  1WM2 A;  2AEH A;  2M4N A;  5E6P A;  3TL5 A;  5LXI B;  4TQ1 A;  2KOX A;  3WAN A;  1Q5W B;  2REX A;  2JVC A;  4B9K A;  2CU1 A;  1V86 A;  1J19 A;  4KVG B;  3VUW A;  2KZR A;  2RGF A;  1P9D U;  2BF8 B;  2QHO A;  3ZRF A;  1TBE A;  2DZK A;  2Z0D B;  3OLM D;  2FCN A;  2HE7 A;  4II3 B;  3W1S A;  2JZZ A;  4KDL B;  2MP2 A;  4DDG D;  4GGQ A;  3ZNZ B;  3DOW A;  3U30 A;  2D2Q A;  2WYQ A;  4RMA A;  5C1Z A;  2M8S A;  5D94 A;  2ZVO A;  2KQ7 A;  1WX7 A;  4GDK A;  4B6W A;  1WJ4 A;  2O6V A;  4TUU A;  1WH3 A;  4OVV A;  2A5U A;  2MA9 B;  2L0F A;  4BOZ B;  2YLM A;  5J2R A;  2RSU A;  2LGX A;  3KUD B;  1OEY A;  3TBL D;  2G3Q B;  2KFK B;  3PRM B;  4NJ6 A;  4TKN A;  1IPG A;  1Q0W B;  1WE7 A;  3B1L X;  4MJS A;  1E8Z A;  4FN2 A;  5G2N A;  4AUQ C;  4MGY E;  1C3T A;  2KDF B;  2MBQ A;  2MSE D;  4WWP A;  1FXT B;  2G4D B;  4FHJ A;  3W1S C;  4ANU A;  4F7Z A;  2KHW B;  2EKE C;  4OVU A;  4BKT A;  2LZ6 A;  3L10 B;  4PS8 A;  3ZNH B;  4X57 B;  4BFR A;  1PQS A;  3V6E B;  3UGB B;  1WJN A;  4HPM B;  1D3Z A;  2N9X A;  4WQO B;  2KLG A;  4FLH A;  3I3T B;  2DZM A;  1KM7 A;  5E6O A;  3KYC D;  4MEM A;  3SU8 X;  3VH4 B;  5D6J B;  3U8Z A;  3ECI A;  4ZYN A;  2R2O A;  2MWS B;  4G0N B;  1MG8 A;  1OQY A;  3DVG Y;  3TJP A;  5D7G A;  5JHA A;  2ZPY A;  1IYF A;  3H7P A;  2DAJ A;  3KYD D;  1KJT A;  5CX3 A;  4GSW A;  2K8C A;  2WWZ A;  3C0R B;  5CHW A;  4JLC A;  3MTN B;  3V60 A;  3PTF C;  4KV2 A;  5KHO A;  4CHK A;  2LRW A;  4NQK E;  3Q3J A;  2KMA A;  1SGH A;  1P3Q U;  5DPS A;  2HD5 B;  2YVC A;  2D07 B;  5JZE B;  5E6N A;  2V3S A;  3JSV B;  4HLE A;  2KTR A;  2KTF A;  2Y5B B;  4NAW A;  3OAW A;  4KZ0 A;  4MDK E;  4A3O A;  2J0J A;  3PVL A;  1A5R A;  3MJW A;  5L95 C;  1RFA A;  4M0W B;  3UIN B;  2CKH B;  4IM2 A;  4NY0 A;  3APC A;  2NPT B;  1GJZ A;  3A1Q B;  2L05 A;  2JZ3 B;  2GOW A;  4BBN F;  3DCG A;  4BKS A;  1Q1O A;  2JY6 A;  3H1U A;  4IUM B;  2DYB A;  2KJR A;  3QWZ B;  1TTN A;  3WIM A;  2N7D A;  2WDT B;  3A9J B;  4KSK C;  3MHS D;  2KJ6 A;  4KDI C;  2RD0 A;  1WX8 A;  2C5L C;  1R4M I;  1WX9 A;  3VH3 B;  3ZUN A;  2O2V A;  3PPA A;  2KC2 A;  3ZVV A;  3VAW A;  3DVN V;  4LDT D;  3QAQ A;  3HK0 A;  1LQB A;  2DEN B;  4W9F A;  3ALB A;  2IY1 B;  3CSF A;  5CHV C;  2JXX A;  1E90 A;  4URK A;  2DZI A;  2FNJ B;  2G4S A;  2NS5 A;  2N1V A;  3VFK A;  4AJY B;  1UBQ A;  4DDI D;  4DHJ D;  1V80 A;  3HIZ A;  3PRP B;  1CMX B;  4W9K A;  3ZIM A;  4MGZ E;  3X0W A;  1YX5 B;  4M8M A;  1I42 A;  2C7H A;  1EF1 A;  2K25 A;  2LWP A;  4JQW C;  3VQI A;  3ZDM C;  2I1K A;  4PYU A;  5HKH A;  1V81 A;  3HM3 A;  4MM3 A;  3VUX A;  2K6D B;  2L7R A;  3CF6 E;  4EZK A;  2D10 A;  3APF A;  4IG7 B;  3VTW A;  3A33 B;  2JWZ A;  3QAR A;  4GDL A;  4K7W A;  3TCA A;  4FBJ B;  2N9P C;  2HJ8 A;  2W9N A;  3NY5 A;  3U7D A;  4BOS C;  1Z5S B;  2N9E B;  4CO7 A;  3HHM A;  4TV3 A;  5JH5 C;  3JYU A;  1U4A A;  1WGD A;  2IO3 B;  4W9J A;  4FHK A;  2AL3 A;  2M0X A;  3UQA A;  1V9J A;  3KVF B;  4IC7 B;  4LJO B;  4WJN A;  3M3J A;  3CST A;  4EFO A;  1WZ3 A;  4HDO A;  4LCD E;  4ICV A;  1E7V A;  2FID A;  2M17 A;  3S2A A;  4W9G A;  3HM6 X;  3SHQ A;  1XD3 B;  4II2 B;  4DXA B;  4IM3 A;  5IA7 A;  1M94 A;  5L83 A;  4WAA A;  3DBL I;  2LVP A;  3M62 B;  4PS3 A;  5J18 A;  4GN1 A;  5AEK B;  4WWO A;  3N30 A;  4IW0 A;  2ZCB A;  2IBI B;  2OJR A;  2KJH B;  4HXD A;  5GMV A;  4GXB A;  4EUT A;  3NS8 A;  1WXA A;  4KSL C;  3QIJ A;  2ZNV B;  2BYF A;  2EMT A;  2JF5 A;  2L0T A;  3QHT A;  3V62 A;  5C23 A;  3ML9 A;  3H7S A;  1WJU A;  2K8B A;  4FJV B;  1BT0 A;  2ZZP B;  2KX3 A;  3TMP B;  4HCN B;  1LFD A;  4E74 A;  3Q3F A;  2KDB A;  4BVU C;  3VDZ A;  2DHZ A;  1EUV B;  1Y8R C;  2FCM A;  2KDE B;  3P2B A;  3PS6 A;  2JT4 B;  2MP2 B;  2BYE A;  4MSQ B;  4DWF A;  4IWP A;  2FIF A;  2KD0 A;  3ZW3 A;  1VD2 A;  2IO0 B;  3W1Y A;  5CTR C;  4IM0 A;  4AJW A;  4NJ7 A;  4WJQ A;  4FJY A;  3T9L A;  3ENE A;  2G45 B;  4GDK B;  2CR5 A;  4GU2 A;  3PHX B;  2MBE A;  4FA6 A;  4FUL A;  1WXS A;  2C60 A;  4W9C A;  1WJ6 A;  1R4N I;  3PGE A;  3LDZ E;  1GG3 A;  1WI0 A;  2LRU A;  2LUE A;  4FJZ A;  3QC8 B;  3WAL A;  4W9D A;  4GMV A;  2N7E A;  2D11 A;  4MJS B;  4TQ0 A;  3DBH I;  3VXW A;  4GOC A;  2K6Q A;  2VRR B;  3L13 A;  2UYZ B;  3IG3 A;  2KKC A;  4ASW C;  4WJO A;  2MRP A;  2D3G A;  4KIK A;  4XZ4 A;  4G3X B;  1KOT A;  1WMH A;  4LJP B;  4WJP A;  3TIX A;  3K9P B;  2KXJ A;  2BKF A;  3PT2 B;  4EZL A;  5DCN A;  1WXV A;  4W9L A;  2NVU I;  3A4S C;  3DDC B;  3RZW C;  3AI5 A;  2IY0 B;  3IBE A;  4ZRJ A;  5AZF A;  2Z0E B;  2FAZ A;  5DPW A;  3A9K B;  4I6L B;  3A1Q A;  2KMC A;  4A20 A;  3PHW B;  2KVR A;  3H7P B;  3RUI B;  2KWC A;  2KN5 A;  3PRE A;  1V49 A;  3KUZ A;  1ZW7 A;  4ANX A;  2DX5 B;  4PS7 A;  3VTU A;  2Z59 B;  2MQJ A;  4AOF A;  5FR6 A;  4E71 A;  3N32 A;  4EZJ A;  3L0W B;  1T0Y A;  2GBR A;  3PLU A;  4E3C A;  1XT9 B;  5TR5 A;  2KTR B;  4W9H A;  2LD9 A;  4NAW B;  1J0G A;  2LVO A;  2ZJD A;  5G55 A;  4RM9 A;  1GUA B;  1WGR A;  3ZTD A;  2JPH A;  4K81 A;  4PYZ A;  4ZRI A;  5IAA C;  5AZH A;  4EEW A;  2ZEQ A;  4JL9 A;  2EMS A;  4YL8 A;  4AP4 C;  3AUL A;  1K8R B;  1S3S G;  1YD8 U;  3PV1 A;  3AU5 A;  1V5T A;  1WZ0 A;  2K39 A;  3BIN A;  4MEL A;  3LJ3 A;  4M8N A;  3B0A A;  4MH0 E;  4F1S A;  1V2Y A;  3ZLZ A;  3T8M A;  3EEC A;  2XK5 A;  3GZN I;  2MBB B;  1C1Y B;  2DZJ A;  1H4R A;  2J0M A;  2PPH A;  2O2V B;  5D2M B;  1WFY A;  2FUH B;  2WX0 A;  2KQS A;  3UQB A;  1WYW B;  2XEW A;  4K7S A;  3R66 C;  2CS4 A;  2CHW A;  3PSE B;  4HJK A;  3EHV A;  3DQV A;  1KLV A;  3QJZ A;  2LVQ A;  3PRZ A;  1ISN A;  2GBM A;  3N3K B;  4B95 A;  2NCN A;  1LM8 B;  2I1J A;  2R2Q A;  2NR2 A;  1L2N A;  3PLV A;  2GBJ A;  1WGY A;  2ZPN A;  5J17 A;  2C7N B;  3H9D A;  3RD2 A;  2LGD A;  3ZO5 B;  3APD A;  3AU4 A;  5AZG A;  2V4L A;  3RZF A;  4HPL B;  1NI2 A;  3RCZ A;  3IHP C;  2AYO B;  3RYT A;  1TZ1 A;  3VTV A;  1OTR B;  2BKR B;  3SDL C;  2JRI B;  1P98 A;  2DYM A;  1E8X A;  2IO1 B;  2KLC A;  2OOB B;  4JGH B;  2BPS A;  2GBN A;  2ZVN A;  2DAF A;  4GDL B;  1S1Q B;  2N1W A;  1NBF C;  3R7Q A;  2K1F A;  3DVG X;  3KUC B;  3V61 A;  3QK0 A;  3ZNI D;  1OGW A;  2C9W B;  2KO3 A;  1WR1 A;  2KFK A;  4G11 A;  3GOE A;  4XC2 A;  3H6N A;  2JUO A;  1YQB A;  1P0R A;  1UGM A;  5DPT A;  2MBH A;  1YX6 B;  3EC8 A;  3M63 B;  2FCS A;  2GMI C;  3VHT C;  2KAN A;  2L00 B;  3NZU A;  1E5W A;  4NNJ B;  5LXH A;  2CHZ A;  3D32 A;  5CHF A;  2L76 A;  3JVZ X;  4CYE A;  3X23 A;  2PEA A;  4A3P A;  1YJ1 A;  2ASQ A;  3QCA A;  3L17 A;  4GB9 A;  2IYD B;  3KH0 A;  4IWQ A;  1E8W A;  2LAS A;  1X1M A;  4P7I A;  2NBV B;  5DPR A;  3DPD A;  4G50 A;  1AAR A;  1L7Y A;  2ZNV C;  4J6I A;  5BO4 B;  2LXC A;  2O6V B;  4K1R B;  2O6V D;  2AL6 A;  2GBK A;  2LGY A;  1NDD A;  1G6J A;  3BY4 B;  1H8C A;  2LXA A;  4EKU A;  3DBR I;  1ZKH A;  2BWE S;  4MSM B;  4RM8 A;  3UIO B;  2KDI A;  4HDQ A;  1WIA A;  1UZX B;  3O65 B;  2KWV B;  1E8Y A;  4W9E A;  1EO6 A;  3VUY A;  1WY8 A;  3WAO A;  3OJ4 B;  1UH6 A;  1WM3 A;  1TGZ B;  3DVN U;  3WAP A;  1QZE A;  5EDS A;  2MX2 A;  3JSV A;  2BYV E;  2KNB A;  1WR6 E;  2AWT A;  2IO2 B;  2PJH A;  4FAD A;  4F8C B;  2L3Z A;  4NQL B;  1I35 A;  4K7U A;  1ZGU B;  4I6P A;  1RLF A;  4DHZ B;  4AWJ A;  4ANV A;  3A9K A;  3B08 A;  2HTH A;  3CMM B;  3QX1 A;  2DYO A;  2MLB A;  2NPT A;  2V1Y A;  3IFW B;  1V6E A;  3NZS A;  1SIF A;  1RAX A;  3IVF A;  1YIW A;  3QA8 A;  2UWQ A;  1V5O A;  1OEY J;  1UEL A;  1WF9 A;  1IP9 A;  3A9J A;  1UBI A;  1GNU A;  3OJ3 A;  3R7R A;  4KIK B;  1WMH B;  2MBO A;  3QQ8 B;  3SD5 A;  3ZKJ C;  3UF8 A;  3R3M A;  3ONS A;  2RR9 A;  2J0K A;  1RRB A;  1WGH A;  2MW5 A;  4JIO U;  3ZRC A;  2KC1 A;  3VVW B;  3ML8 A;  4IWO A;  3ZNG C;  2C7M B;  5KHQ A;  2A4Z A;  2WX1 A;  3L16 A;  1EF5 A;  1JRU A;  2LI5 A;  3M95 A;  3NHE B;  1GC6 A;  2BWF A;  1SE9 A;  3JW0 X;  2L8J A;  2NBU A;  2J7Q B;  2KK8 A;  2MCN B;  3PZD A;  3WAM A;  3ZTC A;  4BKS D;  3UIP B;  3WA0 A;  4HCP B;  5JHB A;  1LXD A;  3L08 A;  2PE6 B;  3V6C B;  4ANW A;  1VCB A;  4LDT B;  5LLI A;  4ICU A;  1J8C A;  1E7U A;  2KFJ A;  4HK2 A;  3ZDT A;  2KWU B;  3NOB A;  4ZRK A;  2CHX A;  2ZCC A;  1WE6 A;  1WGG A;  3RUL A;  4NPN A;  4BBN C;  1Z2M A;  4MGK E;  3L54 A;  4WWN A;  2XBB C;  4DBG A;  1F9J A;  4KZC A;  2K8H A;  2BGF A;  2B3A A;  4DHJ B;  2JRH A;  2PE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...