2KQSA

Phosphorylation of sumo-interacting motif by ck2 enhances daxx sumo binding activity
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
97
structure length
97
Chain Sequence
b'MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Small ubiquitin-related modifier 1
molecule tags Transcription, apoptosis
source organism Homo sapiens
publication title Structural and functional roles of Daxx SIM phosphorylation in SUMO paralog-selective binding and apoptosis modulation.
pubmed doi rcsb
total genus 22
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2009-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kqsA00
2J7QB 2BF8B 2MRPA 1EF5A 4KV2A 2Z0DB 3HM6X 4MEMA 2FIFA 2C5LC 5JHBA 2W9NA 1E7VA 1F9JA 2L00B 2LGYA 5GMVA 2JUOA 1ZW7A 2KO3A 4OVUA 2WX1A 2AWTA 2MQJA 1UBIA 4AUQC 4E71A 2O2VA 5JH5C 3H7PB 3KW5B 1UBQA 1WM3A 4JIOU 1V6EA 4MM3A 3ALBA 5G55A 2LVOA 4MSQB 2RD0A 1RRBA 2OOBB 1RFAA 2L8JA 3N3KB 1P3QU 1QZEA 2LUEA 3A1QA 3AU5A 3H1UA 3PHXB 2M17A 2DAJA 4BBNC 3A9JB 4FHJA 2HTHA 3L17A 2A5UA 2NBWB 3SU8X 1E8WA 4BOSC 3QCAA 4CHKA 2FCMA 3JYUA 1PQSA 3UGBB 4WWOA 1EUVB 1UZXB 3JVZX 4NQKE 4RM9A 1AARA 3N32A 1WJUA 5KHOA 3DVNU 4TUUA 4NY0A 2KWVB 4W9IA 4HLEA 3QC8B 1V49A 5EDSA 2A4ZA 3PV1A 2K8BA 3M63B 3QIJA 2FAZA 2LD9A 3DBLI 2BKFA 2DZJA 1WGHA 2IYDB 2WDTB 2KD0A 2NBVB 4MSMB 2MBEA 2REXA 3OLMD 4G11A 3V60A 2KFKB 4PS3A 5D6JB 1P1AA 2KK8A 2N1WA 2O2VB 3B0AA 2DENB 3BINA 4NNJB 1RAXA 2JVCA 2WWZA 1J0GA 1FXTB 3PPAA 5CHWA 4WQOB 2LGDA 2LXCA 1TGZB 4GB9A 5AZGA 2PPHA 2CKHB 2AL3A 3VVWB 2JXXA 2Y5BB 3ZW3A 2L3ZA 4DHZE 3PS6A 5G2NA 1UH6A 2DX5B 2QHOA 4TKNA 3R7RA 1P98A 1WJNA 1R4NI 1V5TA 3L08A 3VH3B 1SIFA 2RSUA 5D2MB 1GG3A 5AEKB 4HWIB 4GIVA 4N9F4 3Q3FA 3HM3A 2MP2A 4JGHB 2KJRA 3LJ3A 2KN5A 4DWFA 1YQBA 4GGQA 1P0RA 2D2QA 2BWES 3KVFB 1WXSA 2DZIA 2BYVE 3VUYA 4AJWA 4MGIE 3WANA 4CO7A 4TQ1A 3ZTCA 4PYZA 3IFWB 2J0MA 2PJHA 2Z0EB 4WWNA 4RM8A 3PLUA 5E6OA 3VDZA 4FJYA 4A3PA 4MELA 2NR2A 4ZRJA 2V1YA 4KZCA 1GJZA 1NDDA 3RULA 1SGHA 3QWZB 5J17A 3WAPA 2FIDA 2KWUB 1GC6A 1LM8B 2L76A 4HVBA 4LJOB 4K1RB 3ZUNA 2BPSA 1UD7A 1WFYA 3W1YA 2DYMA 4BKGA 1V80A 3ZRFA 1M94A 2NPTA 2R2OA 3KYCD 4K81A 4LCDE 2R2QA 5DPTA 1IYFA 3N30A 4FLHA 2BGFA 2JPHA 2FCQA 2ZPNA 2YLMA 4TQ0A 5LLIA 2UWQA 3RUIB 1E90A 1SE9A 2NCNA 5DPSA 3SD5A 3EC8A 4W9JA 3WA0A 4GDKA 4GOCA 4XC2A 4WJOA 4RMAA 3VFKA 3WAMA 3WAOA 3GZNI 2K1FA 3DBSA 1WGYA 2GBJA 2M8SA 2MWSB 3A9KB 3WALA 4DHZB 3AU4A 3EECA 1WZ3A 2IBIB 2KX3A 2C7MB 1WX8A 2NS5A 4ICUA 4FN2A 1I42A 2M4NA 3L54A 4FHKA 3APFA 2AEHA 4IM2A 2JWZA 2KOXA 2JY6A 2KTRB 3KUZA 1KM7A 4IM0A 2ZCBA 3EHVA 4IG7B 3OAWA 4JQWC 2BWFA 3QARA 2KFJA 3BY4B 2NPTB 1NBFC 4MH0E 1LQBA 2ZNVC 3SDLC 4A20A 3ZVVA 3VQIA 1YX6B 4B6WA 1C1YB 5IA7A 2MLBA 1WI0A 4X57B 5DPWA 1WXMA 1H8CA 1Z5SB 2IZVB 1IPGA 4W9DA 2KQ7A 1OTRB 3LDZE 4FBJB 4GMVA 3AI5A 2IY1B 4JLCA 1WMHA 3A9JA 3MTNB 3H7PA 4FJZA 2LXAA 1Q1OA 1T0YA 2LGXA 2O6VD 4IW0A 4K7WA 4MGYE 1U4AA 2CS4A 3GOEA 2LI5A 3M3JA 2IO2B 3VTUA 2CHWA 2UYZB 4I6PA 3PHWB 4HK2A 3D32A 3QK0A 3V6EB 1V86A 1X1MA 4F8CB 3DPDA 4HPMB 4XX5A 3UIOB 2CR5A 2C60A 4ZRKA 3A9KA 3QQ8B 1L2NA 4KIKA 3JW0X 2CHXA 1IP9A 1TZ1A 2IO0B 2FCNA 1WJ4A 2D07B 4BKTA 4LJPB 1HE8A 3KH0A 1WE7A 3MHSD 1VCBA 1WM2A 1V81A 3APCA 3T8MA 3V62A 1WXAA 1Q0WB 2N9EB 2D3GA 1A5RA 1I35A 4F7ZA 1VD2A 1XQQA 3DCGA 5AZHA 2N7DA 2MBQA 4W9KA 4MDKE 3ECIA 3CSFA 3OJ3A 3RZFA 1V2YA 4FJVB 3ZNID 5E6NA 2M0XA 3K9PB 3UQAA 3ZNHB 3KYDD 3PLVA 1R4MI 4WJQA 1UELA 1KLVA 4MGKE 2ZVOA 4PS8A 1XD3B 1YX5B 3NHEB 4AJYB 3ML9A 4DK5A 5D94A 4BVUC 2K6DB 1UGMA 2L0TA 3TCAA 3QA8A 2KLCA 2KNBA 4HDOA 4W9GA 3UINB 4CYEA 4I6NB 3IBEA 2N9XA 3ZDTA 4ANWA 2WX0A 4DBGA 4K7UA 5DPRA 3RT3B 4GSWA 1V9JA 2IO3B 3W1SA 3B1LX 4OVVA 3PREA 4HPLB 2KWCA 4NAWB 3S2AA 2XK5A 4M8NA 2KMAA 3C0RB 2EKEC 4TV3A 4XZ4A 1S1QB 2XBBC 3VUXA 4EUTA 2I1KA 4W9FA 2ZEQA 3K9OB 5CHVC 3VTVA 3UF8A 1E8XA 3ZNZB 5AZFA 2D11A 4B95A 4M8MA 1RLFA 4W9EA 3TL5A 3A33B 3HIZA 2K8CA 2VRRB 2CHZA 3DOWA 3NOBA 2L7RA 4G3XB 4W9LA 4KSLC 2N9PC 3EFUA 4IM3A 2DAFA 5CTRC 4EZLA 1V5OA 3TMPB 3WIMA 1C3TA 4PYUA 2M1MA 3I3TB 1WY8A 2DYBA 3UQBA 3RYTA 2DZMA 3DBHI 3APDA 4ZYNA 2N1VA 1E5WA 1L7YA 3HHMA 1OEYA 4LDTD 4DHJB 2DYOA 5E6PA 4AWJA 5JHAA 1WF9A 5LXIB 1XT9B 4MGZE 4W9CA 2IY0B 5DCNA 2IO1B 2JF5A 2XEWA 3DVNV 4PS7A 1WGRA 2JT4B 4BBNF 3IHPC 2JRHA 2MX2A 4J6IA 2I1JA 5J2RA 3NZSA 2PE9A 2J0JA 4EFOA 4ANVA 3ONSA 4II2B 3KUDB 4KDLB 3SHQA 1H4RA 2C9WB 3NZUA 2KC2A 2PE6B 4M0WB 4A3OA 1YD8U 4DDID 4KIKB 4E74A 1WE6A 3VXWA 4E3CA 1MG8A 3PT2B 1WX9A 1WZ0A 2LWPA 2JZZA 3R3MA 1OEYJ 2JZ3B 2HD5B 2KKCA 3QHTA 3V6CB 3ZRCA 4ANXA 1ZKHA 2AYOB 1WGGA 4EOYA 2O6VA 3B08A 4IWQA 4B9KA 2PEAA 4DDGD 4WJPA 4YL8A 2LVPA 3IVFA 1JRUA 1WR1A 2KDIA 1EO6A 2KZRA 3CMMB 3VUWA 3X0WA 4F1SA 1LXDA 3NS8A 4WWPA 1G6JA 3RD2A 4FADA 3VHTC 4MJSA 5D7GA 4GXBA 4P7IA 2K25A 1WXVA 2MA9B 1EF1A 2ZNVB 4IWOA 3U7DA 5KHQA 1CMXB 3KUCB 3L13A 3CSTA 4LDTB 4DHJD 1K8RB 1YJ1A 5HKHA 1Q5WB 2JRIB 3VH4B 4IC7B 5FR6A 3JSVA 3TBLD 3DBRI 3P2BA 2OJRA 2KJHB 3ZTDA 1GUAB 3HK0A 1TTNA 1WX7A 5TR5A 4HCNB 2ZZPB 4BKSA 4MJSB 3TIXA 1GNUA 2G45B 1ISNA 2FNJB 5L83A 5J18A 4WJNA 2RR9A 2MP2B 2LVQA 2LRWA 4KDIC 1J8CA 4EEWA 5C1ZA 2MW5A 2BYFA 3U30A 3L16A 4HJKA 4HXDA 4JL9A 4GDKB 4FULA 1P9DU 2LJ5A 2NBUA 2ZVNA 2K39A 2C7HA 2KC1A 4G50A 2L0FA 3AXCA 1GC7A 3ZLZA 3H9DA 2KTFA 3ML8A 5IAAC 2Z59B 4ZRIA 3A4RA 1Z2MA 5BO4B 3QX1A 3QAQA 3PRPB 3ZDMC 2GMIC 2KANA 4GDLB 3R66C 4II3B 1S3SG 4EKUA 1ZGUB 4AP4C 2KX0A 4G0NB 3QJZA 2RPQA 2MSED 2DZKA 5CX3A 3UIPB 2FUHB 3M95A 2HJ8A 2YVCA 4NQLB 3RZWC 2KXJA 3RCZA 2LASA 4KZ0A 2N4FA 4AOFA 4ANUA 1WIAA 4NAWA 4EZKA 3NY5A 4ZDVA 2G4DB 4NPNA 2B3AA 2K6QA 2KDEB 2NVUI 3PSEB 2LRUA 4IWPA 2KTRA 4NJ7A 1KOTA 1WYWB 3PVLA 1WH3A 2KLGA 3A1QB 1BT0A 2ASQA 3W1SC 3ZNGC 4BOZB 3ENEA 3PTFC 1E8ZA 2KVRA 3M62B 3ZKJC 3JSVB 4GDLA 2LZ6A 3PRMB 2GBRA 2KDFB 1LFDA 2L05A 1WGDA 3PGEA 2KQSA 1OQYA 2KFKA 3TJPA 2KMCA 3A4SC 5C23A 1YIWA 2J0KA 2ZCCA 2CU1A 4FA6A 2GOWA 2MBHA 4URKA 2GBMA 3AULA 3H6NA 3MJWA 1WR6E 3PRZA 1J19A 2GBKA 2V3SA 1WRDB 5JZEB 1WJ6A 3PZDA 2G4SA 3VAWA 4GU2A 2FCSA 2MBOA 2XK5B 2WYQA 4K7SA 1E8YA 2K8HA 4BKSD 2C7NB 3OJ4B 5L95C 2AL6A 2EMSA 3CF6E 3IG3A 3O65B 3Q3JA 4NJ6A 1KJTA 2KJ6A 2BKRB 4WAAA 2RGFA 1D3ZA 1E7UA 3ZO5B 2EMTA 3V61A 2DHZA 1TBEA 4EZJA 3L0WB 4KSKC 4HCPB 3U8ZA 1WMHB 3DVGX 3X23A 2ZPYA 3L10B 3VTWA 4BFRA 4ICVA 3T9LA 2V4LA 4ASWC 4GN1A 3DVGY 2MBBB 3H7SA 4W9HA 5CHFA 4I6LB 1NI2A 2GBNA 4KVGB 2G3QB 3DDCB 2MCNB 1Y8RC 4DXAB 2KDBA 2ZJDA 5LXHA 2N7EA 2O6VB 3DQVA 2KHWB 2HE7A 4IUMB 3R7QA 3ZIMA 4HDQA 2D10A 2BYEA 1OGWA
chains in the Genus database with same CATH superfamily
3E56A 3N1YC 2J7QB 3Q8CA 2FIFA 1J7BA 2AWTA 2MQJA 1UBIA 2LFIA 2DLBA 2O2VA 1TY2A 3KW5B 4JIOU 2ACZB 2WNMA 2RD0A 1RRBA 1ZE3D 2LUEA 1FPYA 1QZEA 4BBNC 2DAJA 2HTHA 2LHEA 2NBWB 3SU8X 4BOSC 1HXYD 4QAYA 1PQSA 4LTUA 1EUVB 1T6BX 1HZ5A 1WJUA 2JX5A 2WXGA 4TUUA 4W9IA 4XWWA 3PV1A 2K8BA 3U52E 3W5VB 2LD9A 2BB6A 1ZDXA 2M0AA 2NBVB 4G11A 2KFKB 2KK8A 2DENB 3PPAA 4GB9A 2PPHA 3VVWB 4DQOC 4DHZE 3PS6A 1OQRA 3HRDD 1P98A 2PTLA 2G9HD 3VH3B 2D3CA 2RSUA 4O1NA 5D2MB 4N9F4 3Q3FA 4JGHB 3LJ3A 4GGQA 3B9JA 2BWES 2WDQB 1JWSD 1V8CA 1JWMD 2DZIA 4AJWA 1TJEA 1WSPA 3WANA 2Y5CA 3IFWB 2PJHA 3E9SA 3PLUA 3VDZA 4A3PA 2Q5WD 4FJYA 2V1YA 3ABVB 1NDDA 1SGHA 3QWZB 5EE3A 3WAPA 2CJNA 3WCQA 2KWUB 1GC6A 4HVBA 4LJOB 4K1RB 1UD7A 2BPSA 3W1YA 1SB3C 4R3DA 3ZRFA 2R2OA 2R2QA 1IYFA 2AX5A 2JPHA 3P4QB 2UWQA 3RUIB 5HHDG 3SD5A 1JWAD 4GOCA 3IAM1 3VFKA 4RGOS 2RDBC 3DBSA 1WGYA 2M8SA 1B9RA 2KX3A 2M4NA 3LB8C 4IM2A 2JWZA 1P7FA 2KTRB 3KUZA 4JQWC 4IG7B 3AE9B 1LQBA 4YSYB 1H8CA 2IZVB 5E6JA 3DHHC 3AI5A 2IY1B 2J52A 4YTPB 5HG2A 3CIRB 2LMCA 3H7PA 2LXAA 1T0YA 3U4EG 2N9LA 1ZOYB 2LGXA 1U4AA 2GLSA 2CHWA 1UWXA 5D3IB 3BWUD 3AEDB 3ZJTA 3U2SC 4XX5A 4ACFA 1L2NA 4KIKA 3JW0X 4BKTA 1HE8A 3T8MA 1V81A 3V62A 1WXAA 1Q0WB 2N7DA 1WRIA 2MBQA 3FAHA 2ON8A 2V3NA 3CSFA 3RZFA 4FJVB 2M0XA 3ZNHB 3RNFC 4IKGA 1SXTA 4ZRPA 1YNTE 1R4NB 4PS8A 1XD3B 1E9MA 2PW9A 5D94A 1T0SC 3GE8C 2KNBA 1D4BA 4I6NB 1XF5L 2N9XA 4ANWA 2IPKD 4K7UA 3RT3B 3PREA 2XK5A 1DOIA 2KMAA 3C0RB 4TV3A 3VUXA 3ETRA 1MVKA 1C4PA 1E8XA 3A33B 2INCC 1ZUD2 3DOWA 2E3TA 2L7RA 2N9PC 5CTRC 2YEPB 2K5PA 3TMPB 3I3TB 3UQBA 1WY8A 1HZ6A 3N1ZC 2N9KA 3RYTA 3RNEC 1HQRD 2FUG1 3AB5A 1KLUD 4A9AA 4YWGG 1TS3A 2PMVA 2VH2A 3MFGA 3L4PA 4W9CA 5DCNA 2JF5A 3P4RB 3DVNV 1FRDA 2M19A 4NAMA 1D5MC 2I1JA 3TEZA 1T0RC 1JROA 4ANVA 4KDLB 3SHQA 4A3OA 4DDID 4E74A 3DWGC 1L0VB 2LWPA 4LNFA 3ZRCA 3QHTA 3V6CB 3N1XC 1WGGA 1PGXA 1QKZA 1N63A 1HTOA 2V3PA 2JU6X 4OZAA 4F1SA 3AE2B 3NS8A 3HUIA 5D7GA 4RNAA 3C19A 5KHQA 1UUPA 4ZRQA 5HKHA 2LGSA 1C4CA 3DBRI 1GUAB 1WX7A 4BKSA 2KWDA 2D5GA 3BK2A 4XYCA 4EEWA 1NYRA 4JL9A 5AUIA 2ZVNA 2E6XA 1GC7A 3MC9A 3ML8A 2W3RA 1YQ3B 2RDHA 4D2KA 1AN8A 3QX1A 3QAQA 2GMIC 2KANA 2K22A 4II3B 4EKUA 3ZYYX 4WURA 2MSED 2FUHB 5BMHA 1MHXA 3RCZA 4KZ0A 1QOGA 4MT5A 1UGJA 2M56B 2N4FA 2WDRB 4AOFA 1WIAA 4NAWA 3NY5A 5AUKA 4ZDVA 2B3AA 1Y56A 4IWPA 4NJ7A 2LRUA 2GI9A 2KLGA 4AQ7A 3NG0A 3W1SC 2CJOA 2H88B 2B76B 1EM7A 3SFEB 4C4VB 2GBRA 1LFDA 5G5GA 5I4DA 2KMCA 4P1CC 2ZCCA 3R2IA 2LGIA 4URKA 3P1MA 4ARIA 2GBKA 1WRDB 1WJ6A 3PZDA 3AN1A 3VAWA 4GU2A 3Q8AA 2EMSA 1NVID 3BK1A 1YMHE 1KJTA 1D3ZA 4EZJA 5BYSA 4KSKC 4HCPB 2QILA 3U8ZA 3VTWA 2LJIA 4ICVA 3T9LA 2WU5B 3J9CA 4ASWC 5IP4D 2MBBB 3H7SA 4ZOHC 4W9HA 1EWYC 5LXHA 1MPEA 1QOFA 2O6VB 4IUMB 3R7QA 1C76A 3TSSA 3RPFC 4NJCA 4KV2A 2XNAC 3HM6X 4MEMA 2V9HA 2JUOA 4USAA 1ZW7A 1CJEA 4E71A 4AUQC 5JH5C 1VZ8A 1E7PB 3VRAB 1T5XD 2OOBB 3AEFB 3GS2A 2L8JA 3H1UA 2H89B 1TY0A 2DBYA 1VR9A 3MC8A 4EE2A 3QCAA 4CHKA 2WXPA 1JWUD 2FCMA 1TYGB 3UGBB 1UZXB 1NENB 4RM9A 3PO0A 3IT4B 2KWVB 5EDSA 4N6EB 3P63A 3KLSX 1A70A 2DZJA 1WGHA 2IYDB 4MM3B 1GB4A 2WDTB 2REXA 4WWMA 3V60A 4PS3A 1P1AA 2N1WA 3B0AA 1RAXA 2WWZA 1VZ6A 1FXTB 5CHWA 2LXCA 4C80A 2OHFA 3DHIC 3T3OA 3T3NA 3IXSA 1FFVA 4YTMB 1R4NI 1SIFA 5AEKB 1I4PA 4HWIB 1YQBA 3KVFB 4RFBA 1WXSA 4P6VF 4J3OD 4PYZA 4NZLB 5E6OA 1GJZA 4ZYSA 3RULA 1FCCC 5J17A 2FIDA 3BVMA 2L76A 4BKGA 4TMAB 2FBWB 4K81A 3N30A 3GB1A 1SJHD 2YLMA 1SE9A 1IBXA 1V1OA 3WA0A 3WAMA 3WAOA 2K1FA 3A9KB 4DHZB 3EECA 5EE9A 4FN2A 1QQRA 3L54A 4US8A 1L5PA 2KN4A 2X8XX 4FHKA 2KOXA 3FILA 2L32A 2IGHA 4P1BC 2L52A 2L83A 2BWFA 3QARA 2KFJA 4MH0E 1NBFC 2ZNVC 3SDLC 4B6WA 3ZQ4A 2MLBA 1L4DB 5DPWA 1V1PB 4W9DA 1OTRB 3LDZE 4REZA 3Q14C 3TEYA 1JW9D 2PIAA 2O6VD 3EGRA 3GOEA 2WQYB 3DHGC 3M3JA 3Q3OC 5FKAC 1V86A 2PVOD 4KKJA 4HPMB 4AS1A 2CR5A 3A9KA 3Q6BA 2Z8LA 1TZ1A 2CU3A 3ZXRA 1WJ4A 1TKGA 3W5UB 1WE7A 3APCA 1I35A 2N9EB 1FNVA 2INNE 4W9KA 4MDKE 3OJ3A 1V1PA 3ZNID 1F0ZA 1R4MI 1I4GA 4MGKE 3I57A 1YX5B 4P16A 4AJYB 2K6DB 1UGMA 2L0TA 3QA8A 1KF6B 3IBEA 2WX0A 4RGTA 5BYRA 2IO3B 3B1LX 4NAWB 1S1QB 2R61A 2I1KA 4W9EA 4WQMA 4DXGA 3AE3B 3NOBA 1TS5A 3Q69A 4WIPA 2HJ1A 4EZLA 1MFWA 1V5OA 1IGDA 2NMQA 1ZDVA 3WIMA 4PYUA 2M1MA 3NUHB 1I4RA 4ZYNA 2DYOA 5E6PA 4AWJA 1WF9A 2IJ0A 2IY0B 1QOAA 2JRHA 3AE4B 5J2RA 2XN9C 1QF6A 2J0JA 3ONSA 1GAQB 2QC8A 4II2B 1H4RA 4M0WB 3TEWA 4KIKB 1MG8A 2JZZA 1OEYJ 4ANXA 1XEEA 4EOYA 2O6VA 4DDGD 2LVPA 3IVFA 1QOBA 1JRUA 1WR1A 1EO6A 3X0WA 1D5XC 4MJSA 5IKCM 3MC0B 2V4IB 5TSSA 1WXVA 4RF0A 1CMXB 4WAFA 2KVZA 3KUCB 3CSTA 2JRIB 4XDDA 2QDFA 1YQ4B 5FR6A 3ZGZA 1FD6A 1TTNA 5TR5A 4HCNB 1D5ZC 3TIXA 2G45B 1TZOA 5L83A 3N20C 4WJNA 2LRWA 2MW5A 1N5XA 3U30A 3L16A 4GDKB 4FULA 1P9DU 1LO5D 4YSXB 3ZLZA 2Z59B 4KKIA 4YTNB 4ZRIA 1F1HA 5BO4B 1ZGUB 1AWDA 2DZKA 5CX3A 2HJ8A 2YVCA 1I4QA 2G1EA 4NQLB 3BVZA 1CK1A 1AW7A 4ANUA 2G4DB 4NPNA 2K6QA 3PSEB 2NVUI 2PVGC 1WYWB 2QIEB 4BAXA 1BT0A 4BOZB 3ENEA 1E8ZA 2HTME 1JRPA 3M62B 1WGKA 3JSVB 1JMLA 1CQVA 2KDFB 4C56C 3TEXA 1ET6A 2KQSA 3NVVA 1YIWA 1FMAD 2MBHA 3H6NA 4XDCA 4OW0A 1J19A 1MI0A 2J4XA 2G4SA 2KACA 2QJLA 2WYQA 1E8YA 3EA6A 1WXQA 2K8HA 2C7NB 5L95C 3IG3A 4NJ6A 2KJ6A 2BKRB 4WAAA 2VZKD 1E7UA 2WXHA 2EMTA 1TBEA 3DVGX 4ITKA 1N62A 2V4LA 4B0MA 1L0YB 4GN1A 2ZW0A 3GZNB 2WXFA 5IOIA 4KVGB 4N59A 1Y8RC 2ZJDA 2AQ2B 2LUMA 3AEGB 1B1ZA 3ZIMA 1XO3A 4HDQA 2BYEA 2BTEA 1EF5A 2KAJA 2Z0DB 2C5LC 3MP9A 1F9JA 2L00B 2LGYA 4OVUA 1ACCA 3VR8B 2NTSA 1UBQA 1WM3A 1V6EA 5G55A 4RH6A 4MSQB 1IGCA 2W55A 1RFAA 1P3QU 3A1QA 3AU5A 4FHJA 2A5UA 2UU7A 2ICIA 1E8WA 4C4VA 3Q3MC 3JVZX 2JYTA 5KHOA 3DVNU 3RI7C 4HLEA 3QC8B 1V49A 2A4ZA 2OEDA 5C2TB 1KRHA 2KD0A 3OLMD 3MHZA 3C8YA 2FE8A 1KH0A 2O2VB 2RPVA 3BINA 2JVCA 3AE6B 5JXVA 2LGDA 1T0QC 1J7CA 5AZGA 2AL3A 2JXXA 2Y5BB 2DX5B 3BZDB 2QHOA 1WJNA 1V5TA 4B0EA 2V0GA 1NYQA 2MEKA 1F77A 2KJRA 4XWTA 1P0RA 3BYYB 2JZPA 3VUYA 1N5WA 4RF1A 4MGIE 1PFDA 3ZTCA 3Q8EA 2Z0EB 4WWNA 4C7YA 4MELA 3RMKC 4ZRJA 2TSSA 1FXAA 2PLPA 1LM8B 3FILB 3ZUNA 1WFYA 2DYMA 1F52A 1I7HA 1M94A 2BT6A 2N7JA 4LCDE 4S17A 3AE8B 2K0PA 4FLHA 3UI3A 2ZPNA 4TQ0A 4PT5A 2NCNA 2VZKB 2MHJA 1ET9A 4W9JA 4XC2A 4WJOA 1NEKB 2WXLA 4C00A 3V05A 2INDC 2MWSB 2WXJA 3AU4A 2IBIB 4ZHOA 3APFA 2AEHA 2JY6A 4A55A 4M02A 1KM7A 4IM0A 3EHVA 3IT6B 2WXNA 1XXGA 2NPTB 4A20A 4A90A 3VQIA 1YX6B 1C1YB 5IA7A 2X38A 1WI0A 4X57B 1WXMA 2INPE 1Z5SB 2KQ7A 4FBJB 4GMVA 1YN4A 1E10A 4JLCA 1Q1OA 1SBBB 4IW0A 4K7WA 5IO9A 2CS4A 2LI5A 1TIFA 3AV8A 3H8HA 3VTUA 2UYZB 4LNKA 4M0WA 4I6PA 1TT5B 1L0XB 1UNSA 3QK0A 3V6EB 3I9V1 3DPDA 4ZRKA 2C60A 3QQ8B 2MJDA 2AQ1B 1E6EB 2FCNA 2D07B 2WDVB 3P4PB 4LJPB 3NJTA 3MHSD 3DBLB 2HDEA 1WM2A 3W9CB 4F7ZA 1VD2A 1SEBD 1C9FA 5AZHA 2BQQA 3ECIA 2WXIA 2N0SB 3K9PB 3KYDD 3RFZB 3NVYA 4WJQA 1UELA 3RNBC 1L6VA 1KLVA 2L1AA 3I5JC 1ZXHA 1SE4A 2Y3AA 3FC4A 3NHEB 4DK5A 4BVUC 2WS3B 3TCAA 4HDOA 4W9GA 1N6ZA 3URYA 3ZDTA 4DBGA 1RWSA 4GSWA 1XLPA 4RCOA 3W2DA 1N61A 4M8NA 4EUTA 1SJED 4W9FA 3K9OB 1SIJA 3VTVA 2D11A 3R2TA 3TL5A 2K8CA 3KWVA 2CHZA 4G3XB 3EFUA 4IM3A 2DAFA 4HJGE 1C3TA 4KGSA 4JWUC 1YJIA 2EELA 4MACA 3DBHI 3LXFA 3APDA 2N1VA 1E5WA 3HHMA 1OEYA 4LDTD 1SE3A 5JHAA 1WYGA 1XT9B 4MGZE 2BVCA 4A8XC 1ZPSA 1RFKA 2XEWA 1K50A 4TSSA 4PS7A 1WGRA 2PKOA 3AMZA 3IHPC 5HI1A 4J6IA 4HKQA 4LLGM 1CZPA 1K53A 4Q2JA 2QMTA 2Y5PA 4EFOA 1XCQL 3KUDB 1QILA 2C9WB 3EUB2 4HEA1 2KC2A 1YD8U 3VXWA 1WX9A 1WZ0A 2JYEA 2KT7A 3P42A 3R3MA 2J53A 1GOZA 3DBRB 1TKYA 3B08A 4IWQA 4B9KA 5BMGA 1V97A 3FKYA 4WWPA 3EFCA 1G6JA 2KYWA 5H92C 4FADA 4GXBA 4P7IA 3U7DA 1XLQA 4MH8A 4DHJD 4IC7B 3RN9C 3JSVA 3TBLD 2WGSA 3P2BA 2OJRA 2KJHB 4OZBA 3HK0A 3BYTB 4MJSB 1GNUA 5J18A 3ZJVA 1J8CA 2BYFA 2W3SA 2LJ5A 2NBUA 2K39A 4G50A 1SSNA 2L0FA 2YEPF 2KTFA 3H9DA 5IAAC 3A4RA 1Z2MA 1R4MB 5MPOA 5D3DA 3PRPB 2RDGA 3R66C 3QJZA 2RPQA 1VZ7A 3Q8FA 3UIPB 2WXOA 3M95A 2BS2B 3RZWC 2KXJA 4HPPA 1XLOA 1UF0A 1VJKA 2KDEB 2KDMA 3PVLA 5BYQA 4H2AA 2WXRA 3A1QB 2KVRA 3ZKJC 2DWQA 4GDLA 2LZ6A 3PRMB 4RGMA 4K3BA 1PGAA 1WGDA 4WH4A 2AQ3B 2I38A 2QCZA 3PGEA 1OQYA 2KFKA 2BS3B 2CU1A 2GBMA 1KTKA 5FK9C 1PYWD 5JZEB 2KQ4X 2MBOA 2XK5B 1E0ZA 2WXMA 4BKSD 1TKEA 2AL6A 3CF6E 1TS2A 1D6EC 2RGFA 3V61A 2LEKA 1ENFA 3X23A 2ZPYA 3AECB 4BFRA 2J42A 4M01A 3OG5A 1ZP0B 3DVGY 2NTTA 2GRIA 1DGJA 4YXDB 5H8YE 1NI3A 3NVWA 1FM0D 2G3QB 2MCNB 4HROA 2N7EA 1PGBA 1OFFA 3SR6A 2HE7A 3B2FA 2ZNVB 2BF8B 2MRPA 4HRSA 2BYTA 1JALA 3B2GA 4KX6B 1FEHA 1E7VA 1SF0A 2W9NA 5JHBA 5GMVA 2KO3A 1ZXIA 2WLBA 2LHDA 2WX1A 1MHHE 1YJJA 3RNGC 1KLGD 3H7PB 1F2RI 4MM3A 3KQ4A 1FNUA 3ALBA 2LVOA 4LNIA 2VH1A 3N3KB 3PHXB 2M17A 3A9JB 3L17A 3ZJUA 3MJ5A 1FNWA 3JYUA 1C78A 4WWOA 4NQKE 3RNCC 4L23A 1AARA 3N32A 5EE1A 2BB5A 1ESFA 4NY0A 4CQNA 3QIJA 3M63B 5FR3A 2FAZA 3DBLI 2BKFA 3VR9B 4YSZB 4OVZA 4MSMB 2MBEA 4YT0B 5D6JB 4NNJB 1VDVA 1EWCA 1DYQA 1J0GA 4WQOB 1TGZB 2KMMA 2WP9B 2CKHB 3ZW3A 2L3ZA 5G2NA 1UH6A 4TKNA 1YN5A 3R7RA 3L08A 1JQ4A 4LNNA 1GG3A 4GIVA 3HM3A 2MP2A 2KN5A 2SAKA 4DWFA 1RYJA 2D2QA 4XE0A 2MH7A 1PUTA 3Q2AC 2BYVE 4CO7A 1VLBA 4TQ1A 1FRRA 4KGRA 2QSDA 5C3JB 2J0MA 3AEEB 4RM8A 5EE0A 1XCTL 2DNFA 4JWSC 2NR2A 4C7ZA 5T8IA 3AE5B 4KZCA 3CWIA 1YOVB 5HFYA 1V80A 4OHJA 2NPTA 3KYCD 5DPTA 4LNOA 2BGFA 3DBHB 2FCQA 5LLIA 1E90A 5DPSA 2IDYA 1DOYA 4L2YA 3EC8A 4GDKA 4RMAA 3AE1B 3GZNI 2I2YA 2D3BA 2GBJA 3WALA 1WZ3A 2NS5A 1I42A 1K51A 1WX8A 2C7MB 4ICUA 4RGNA 1AYFA 3IAS1 1VRAB 1BXTA 2ZCBA 1HTQA 3OAWA 3BY4B 3ZVVA 1M4VA 1IPGA 1LGRA 1I4XA 4DXFA 1WMHA 3A9JA 1HEZE 1OQQA 3MTNB 1DOXA 4FJZA 2WXQA 3NRZA 4MGYE 1GB1A 2IO2B 3R8BA 3PHWB 4HK2A 3D32A 1X1MA 4F8CB 3UIOB 3P4SB 4L1BA 2GB1A 2CHXA 2WXKA 1IP9A 2IGGA 2IO0B 1N60A 3KH0A 1VCBA 1A5RA 1QT9A 2D3GA 1TS4A 1XQQA 4XGAB 3U7ZA 4BZAA 3DCGA 1WWTA 3NS1A 2SEBD 1V2YA 3SEBA 2JSVX 5E6NA 3UQAA 3PLVA 4ARCA 2WHIA 2ZVOA 3GE3C 3N9YC 3ML9A 2KLCA 4CYEA 3UINB 1IBXB 5DPRA 2IGDA 1V9JA 1RM6C 2MJ3A 3W1SA 4OVVA 4HPLB 2KWCA 3S2AA 2EKEC 4XZ4A 2XBBC 2ONQA 2ZEQA 1I4HA 5CHVC 3UF8A 3ZNZB 3AEAB 5AZFA 4B95A 5BMIA 4M8MA 1RLFA 3HIZA 4KGTA 3PZ8A 2VRRB 1JWBD 4W9LA 4KSLC 1FCLA 3AH7A 4US9A 1KFYB 2K9XA 2DYBA 3DWMA 3Q3NC 2DZMA 4GLSC 4UDUC 2W82A 1L7YA 1FIQA 1YN3A 4DHJB 4S0RA 5LXIB 1MG4A 1FXIA 4PK1A 4IOIE 2IO1B 2JWUA 4JX1C 2JT4B 4BBNF 1K52A 2MX2A 1L6UA 1JCKB 3NZSA 2PE9A 1XLNA 1BUIC 3BVGA 3NZUA 2EKIA 2PE6B 2WU2B 4E3CA 1WE6A 3PT2B 5G5HA 3I63C 2HD5B 2JZ3B 2KKCA 1ZKHA 2AYOB 3OWEB 1F2RC 2PEAA 4WJPA 4YL8A 2JQRB 2KDIA 4K3CA 2KZRA 3CMMB 3VUWA 1LXDA 4LK0M 3RD2A 3VHTC 5GXGB 2BS4B 2OJWA 2K25A 2MA9B 1EF1A 4IWOA 2K3UA 3L13A 4LDTB 1K8RB 1YJ1A 3V3XA 1Q5WB 3VH4B 4A6QA 1J7AA 3ZTDA 2ZZPB 1MJDA 4HKZE 1ISNA 3RNAC 2FNJB 1ROEA 2RR9A 2MP2B 2W54A 1SE2A 2LVQA 4KDIC 5C1ZA 2D3AA 1EU3A 4HJKA 4HXDA 2C7HA 2KC1A 4JPSA 1Q10A 1FO4A 3AXCA 3O13A 4M00A 4IDIA 3GP7A 3ZDMC 4GDLB 1S3SG 4AP4C 2KX0A 4G0NB 1EU4A 1R7SA 2LASA 1HA5A 4EZKA 3SFDB 1KOTA 2KTRA 3HVDA 1WH3A 2ASQA 3ZNGC 2RMMA 3PTFC 1L4ZB 1GPXA 3VRBB 3BIID 4FXCA 3Q8BA 3AM9A 2L05A 2MJEA 2JXTA 4ZHPA 3TJPA 3A4SC 5C23A 2J0KA 3NZ3A 4FA6A 2GOWA 1T3QA 3AULA 3MJWA 1WR6E 3PRZA 1C79A 2V3SA 4N58A 3AEBB 1QLBB 1UWMA 5IN7A 2FCSA 3NVZA 4K7SA 1BMLC 5LNK1 3OJ4B 1C77A 3O65B 3Q3JA 1P7EA 3HVZA 1C4AA 1IUEA 3ZO5B 3AE7B 2DHZA 3PZ7A 2BW2A 3L0WB 1WMHB 3L10B 4JE3B 1FFUA 2QEJC 4OZCA 5CHFA 1PDXA 3ZXVA 3TUOA 4I6LB 1NI2A 2GBNA 2BBCA 3DDCB 3KWLA 4DXAB 2KDBA 1STEA 3DQVA 3LYYA 2KHWB 2D10A 1OGWA 2ZW1A
chains in the Genus database with same CATH topology
2J7QB 2BF8B 2MRPA 1EF5A 4KV2A 2Z0DB 3HM6X 4MEMA 2FIFA 2C5LC 5JHBA 2W9NA 1E7VA 1F9JA 2L00B 2LGYA 5GMVA 2JUOA 1ZW7A 2KO3A 4OVUA 2WX1A 2AWTA 2MQJA 1UBIA 4AUQC 4E71A 2O2VA 5JH5C 3H7PB 3KW5B 1UBQA 1WM3A 4JIOU 1V6EA 4MM3A 3ALBA 5G55A 2LVOA 4MSQB 2RD0A 1RRBA 2OOBB 1RFAA 2L8JA 3N3KB 1P3QU 1QZEA 2LUEA 3A1QA 3AU5A 3H1UA 3PHXB 2M17A 2DAJA 4BBNC 3A9JB 4FHJA 2HTHA 3L17A 2A5UA 2NBWB 3SU8X 1E8WA 4BOSC 3QCAA 4CHKA 2FCMA 3JYUA 1PQSA 3UGBB 4WWOA 1EUVB 1UZXB 3JVZX 4NQKE 4RM9A 1AARA 3N32A 1WJUA 5KHOA 3DVNU 4TUUA 4NY0A 2KWVB 4W9IA 4HLEA 3QC8B 1V49A 5EDSA 2A4ZA 3PV1A 2K8BA 3M63B 3QIJA 2FAZA 2LD9A 3DBLI 2BKFA 2DZJA 1WGHA 2IYDB 2WDTB 2KD0A 2NBVB 4MSMB 2MBEA 2REXA 3OLMD 4G11A 3V60A 2KFKB 4PS3A 5D6JB 1P1AA 2KK8A 2N1WA 2O2VB 3B0AA 2DENB 3BINA 4NNJB 1RAXA 2JVCA 2WWZA 1J0GA 1FXTB 3PPAA 5CHWA 4WQOB 2LGDA 2LXCA 1TGZB 4GB9A 5AZGA 2PPHA 2CKHB 2AL3A 3VVWB 2JXXA 2Y5BB 3ZW3A 2L3ZA 4DHZE 3PS6A 5G2NA 1UH6A 2DX5B 2QHOA 4TKNA 3R7RA 1P98A 1WJNA 1R4NI 1V5TA 3L08A 3VH3B 1SIFA 2RSUA 5D2MB 1GG3A 5AEKB 4HWIB 4GIVA 4N9F4 3Q3FA 3HM3A 2MP2A 4JGHB 2KJRA 3LJ3A 2KN5A 4DWFA 1YQBA 4GGQA 1P0RA 2D2QA 2BWES 3KVFB 1WXSA 2DZIA 2BYVE 3VUYA 4AJWA 4MGIE 3WANA 4CO7A 4TQ1A 3ZTCA 4PYZA 3IFWB 2J0MA 2PJHA 2Z0EB 4WWNA 4RM8A 3PLUA 5E6OA 3VDZA 4FJYA 4A3PA 4MELA 2NR2A 4ZRJA 2V1YA 4KZCA 1GJZA 1NDDA 3RULA 1SGHA 3QWZB 5J17A 3WAPA 2FIDA 2KWUB 1GC6A 1LM8B 2L76A 4HVBA 4LJOB 4K1RB 3ZUNA 2BPSA 1UD7A 1WFYA 3W1YA 2DYMA 4BKGA 1V80A 3ZRFA 1M94A 2NPTA 2R2OA 3KYCD 4K81A 4LCDE 2R2QA 5DPTA 1IYFA 3N30A 4FLHA 2BGFA 2JPHA 2FCQA 2ZPNA 2YLMA 4TQ0A 5LLIA 2UWQA 3RUIB 1E90A 1SE9A 2NCNA 5DPSA 3SD5A 3EC8A 4W9JA 3WA0A 4GDKA 4GOCA 4XC2A 4WJOA 4RMAA 3VFKA 3WAMA 3WAOA 3GZNI 2K1FA 3DBSA 1WGYA 2GBJA 2M8SA 2MWSB 3A9KB 3WALA 4DHZB 3AU4A 3EECA 1WZ3A 2IBIB 2KX3A 2C7MB 1WX8A 2NS5A 4ICUA 4FN2A 1I42A 2M4NA 3L54A 4FHKA 3APFA 2AEHA 4IM2A 2JWZA 2KOXA 2JY6A 2KTRB 3KUZA 1KM7A 4IM0A 2ZCBA 3EHVA 4IG7B 3OAWA 4JQWC 2BWFA 3QARA 2KFJA 3BY4B 2NPTB 1NBFC 4MH0E 1LQBA 2ZNVC 3SDLC 4A20A 3ZVVA 3VQIA 1YX6B 4B6WA 1C1YB 5IA7A 2MLBA 1WI0A 4X57B 5DPWA 1WXMA 1H8CA 1Z5SB 2IZVB 1IPGA 4W9DA 2KQ7A 1OTRB 3LDZE 4FBJB 4GMVA 3AI5A 2IY1B 4JLCA 1WMHA 3A9JA 3MTNB 3H7PA 4FJZA 2LXAA 1Q1OA 1T0YA 2LGXA 2O6VD 4IW0A 4K7WA 4MGYE 1U4AA 2CS4A 3GOEA 2LI5A 3M3JA 2IO2B 3VTUA 2CHWA 2UYZB 4I6PA 3PHWB 4HK2A 3D32A 3QK0A 3V6EB 1V86A 1X1MA 4F8CB 3DPDA 4HPMB 4XX5A 3UIOB 2CR5A 2C60A 4ZRKA 3A9KA 3QQ8B 1L2NA 4KIKA 3JW0X 2CHXA 1IP9A 1TZ1A 2IO0B 2FCNA 1WJ4A 2D07B 4BKTA 4LJPB 1HE8A 3KH0A 1WE7A 3MHSD 1VCBA 1WM2A 1V81A 3APCA 3T8MA 3V62A 1WXAA 1Q0WB 2N9EB 2D3GA 1A5RA 1I35A 4F7ZA 1VD2A 1XQQA 3DCGA 5AZHA 2N7DA 2MBQA 4W9KA 4MDKE 3ECIA 3CSFA 3OJ3A 3RZFA 1V2YA 4FJVB 3ZNID 5E6NA 2M0XA 3K9PB 3UQAA 3ZNHB 3KYDD 3PLVA 1R4MI 4WJQA 1UELA 1KLVA 4MGKE 2ZVOA 4PS8A 1XD3B 1YX5B 3NHEB 4AJYB 3ML9A 4DK5A 5D94A 4BVUC 2K6DB 1UGMA 2L0TA 3TCAA 3QA8A 2KLCA 2KNBA 4HDOA 4W9GA 3UINB 4CYEA 4I6NB 3IBEA 2N9XA 3ZDTA 4ANWA 2WX0A 4DBGA 4K7UA 5DPRA 3RT3B 4GSWA 1V9JA 2IO3B 3W1SA 3B1LX 4OVVA 3PREA 4HPLB 2KWCA 4NAWB 3S2AA 2XK5A 4M8NA 2KMAA 3C0RB 2EKEC 4TV3A 4XZ4A 1S1QB 2XBBC 3VUXA 4EUTA 2I1KA 4W9FA 2ZEQA 3K9OB 5CHVC 3VTVA 3UF8A 1E8XA 3ZNZB 5AZFA 2D11A 4B95A 4M8MA 1RLFA 4W9EA 3TL5A 3A33B 3HIZA 2K8CA 2VRRB 2CHZA 3DOWA 3NOBA 2L7RA 4G3XB 4W9LA 4KSLC 2N9PC 3EFUA 4IM3A 2DAFA 5CTRC 4EZLA 1V5OA 3TMPB 3WIMA 1C3TA 4PYUA 2M1MA 3I3TB 1WY8A 2DYBA 3UQBA 3RYTA 2DZMA 3DBHI 3APDA 4ZYNA 2N1VA 1E5WA 1L7YA 3HHMA 1OEYA 4LDTD 4DHJB 2DYOA 5E6PA 4AWJA 5JHAA 1WF9A 5LXIB 1XT9B 4MGZE 4W9CA 2IY0B 5DCNA 2IO1B 2JF5A 2XEWA 3DVNV 4PS7A 1WGRA 2JT4B 4BBNF 3IHPC 2JRHA 2MX2A 4J6IA 2I1JA 5J2RA 3NZSA 2PE9A 2J0JA 4EFOA 4ANVA 3ONSA 4II2B 3KUDB 4KDLB 3SHQA 1H4RA 2C9WB 3NZUA 2KC2A 2PE6B 4M0WB 4A3OA 1YD8U 4DDID 4KIKB 4E74A 1WE6A 3VXWA 4E3CA 1MG8A 3PT2B 1WX9A 1WZ0A 2LWPA 2JZZA 3R3MA 1OEYJ 2JZ3B 2HD5B 2KKCA 3QHTA 3V6CB 3ZRCA 4ANXA 1ZKHA 2AYOB 1WGGA 4EOYA 2O6VA 3B08A 4IWQA 4B9KA 2PEAA 4DDGD 4WJPA 4YL8A 2LVPA 3IVFA 1JRUA 1WR1A 2KDIA 1EO6A 2KZRA 3CMMB 3VUWA 3X0WA 4F1SA 1LXDA 3NS8A 4WWPA 1G6JA 3RD2A 4FADA 3VHTC 4MJSA 5D7GA 4GXBA 4P7IA 2K25A 1WXVA 2MA9B 1EF1A 2ZNVB 4IWOA 3U7DA 5KHQA 1CMXB 3KUCB 3L13A 3CSTA 4LDTB 4DHJD 1K8RB 1YJ1A 5HKHA 1Q5WB 2JRIB 3VH4B 4IC7B 5FR6A 3JSVA 3TBLD 3DBRI 3P2BA 2OJRA 2KJHB 3ZTDA 1GUAB 3HK0A 1TTNA 1WX7A 5TR5A 4HCNB 2ZZPB 4BKSA 4MJSB 3TIXA 1GNUA 2G45B 1ISNA 2FNJB 5L83A 5J18A 4WJNA 2RR9A 2MP2B 2LVQA 2LRWA 4KDIC 1J8CA 4EEWA 5C1ZA 2MW5A 2BYFA 3U30A 3L16A 4HJKA 4HXDA 4JL9A 4GDKB 4FULA 1P9DU 2LJ5A 2NBUA 2ZVNA 2K39A 2C7HA 2KC1A 4G50A 2L0FA 3AXCA 1GC7A 3ZLZA 3H9DA 2KTFA 3ML8A 5IAAC 2Z59B 4ZRIA 3A4RA 1Z2MA 5BO4B 3QX1A 3QAQA 3PRPB 3ZDMC 2GMIC 2KANA 4GDLB 3R66C 4II3B 1S3SG 4EKUA 1ZGUB 4AP4C 2KX0A 4G0NB 3QJZA 2RPQA 2MSED 2DZKA 5CX3A 3UIPB 2FUHB 3M95A 2HJ8A 2YVCA 4NQLB 3RZWC 2KXJA 3RCZA 2LASA 4KZ0A 2N4FA 4AOFA 4ANUA 1WIAA 4NAWA 4EZKA 3NY5A 4ZDVA 2G4DB 4NPNA 2B3AA 2K6QA 2KDEB 2NVUI 3PSEB 2LRUA 4IWPA 2KTRA 4NJ7A 1KOTA 1WYWB 3PVLA 1WH3A 2KLGA 3A1QB 1BT0A 2ASQA 3W1SC 3ZNGC 4BOZB 3ENEA 3PTFC 1E8ZA 2KVRA 3M62B 3ZKJC 3JSVB 4GDLA 2LZ6A 3PRMB 2GBRA 2KDFB 1LFDA 2L05A 1WGDA 3PGEA 2KQSA 1OQYA 2KFKA 3TJPA 2KMCA 3A4SC 5C23A 1YIWA 2J0KA 2ZCCA 2CU1A 4FA6A 2GOWA 2MBHA 4URKA 2GBMA 3AULA 3H6NA 3MJWA 1WR6E 3PRZA 1J19A 2GBKA 2V3SA 1WRDB 5JZEB 1WJ6A 3PZDA 2G4SA 3VAWA 4GU2A 2FCSA 2MBOA 2XK5B 2WYQA 4K7SA 1E8YA 2K8HA 4BKSD 2C7NB 3OJ4B 5L95C 2AL6A 2EMSA 3CF6E 3IG3A 3O65B 3Q3JA 4NJ6A 1KJTA 2KJ6A 2BKRB 4WAAA 2RGFA 1D3ZA 1E7UA 3ZO5B 2EMTA 3V61A 2DHZA 1TBEA 4EZJA 3L0WB 4KSKC 4HCPB 3U8ZA 1WMHB 3DVGX 3X23A 2ZPYA 3L10B 3VTWA 4BFRA 4ICVA 3T9LA 2V4LA 4ASWC 4GN1A 3DVGY 2MBBB 3H7SA 4W9HA 5CHFA 4I6LB 1NI2A 2GBNA 4KVGB 2G3QB 3DDCB 2MCNB 1Y8RC 4DXAB 2KDBA 2ZJDA 5LXHA 2N7EA 2O6VB 3DQVA 2KHWB 2HE7A 4IUMB 3R7QA 3ZIMA 4HDQA 2D10A 2BYEA 1OGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Q B;  2BF8 B;  2MRP A;  1EF5 A;  4KV2 A;  2Z0D B;  3HM6 X;  4MEM A;  2FIF A;  2C5L C;  5JHB A;  2W9N A;  1E7V A;  1F9J A;  2L00 B;  2LGY A;  5GMV A;  2JUO A;  1ZW7 A;  2KO3 A;  4OVU A;  2WX1 A;  2AWT A;  2MQJ A;  1UBI A;  4AUQ C;  4E71 A;  2O2V A;  5JH5 C;  3H7P B;  3KW5 B;  1UBQ A;  1WM3 A;  4JIO U;  1V6E A;  4MM3 A;  3ALB A;  5G55 A;  2LVO A;  4MSQ B;  2RD0 A;  1RRB A;  2OOB B;  1RFA A;  2L8J A;  3N3K B;  1P3Q U;  1QZE A;  2LUE A;  3A1Q A;  3AU5 A;  3H1U A;  3PHX B;  2M17 A;  2DAJ A;  4BBN C;  3A9J B;  4FHJ A;  2HTH A;  3L17 A;  2A5U A;  2NBW B;  3SU8 X;  1E8W A;  4BOS C;  3QCA A;  4CHK A;  2FCM A;  3JYU A;  1PQS A;  3UGB B;  4WWO A;  1EUV B;  1UZX B;  3JVZ X;  4NQK E;  4RM9 A;  1AAR A;  3N32 A;  1WJU A;  5KHO A;  3DVN U;  4TUU A;  4NY0 A;  2KWV B;  4W9I A;  4HLE A;  3QC8 B;  1V49 A;  5EDS A;  2A4Z A;  3PV1 A;  2K8B A;  3M63 B;  3QIJ A;  2FAZ A;  2LD9 A;  3DBL I;  2BKF A;  2DZJ A;  1WGH A;  2IYD B;  2WDT B;  2KD0 A;  2NBV B;  4MSM B;  2MBE A;  2REX A;  3OLM D;  4G11 A;  3V60 A;  2KFK B;  4PS3 A;  5D6J B;  1P1A A;  2KK8 A;  2N1W A;  2O2V B;  3B0A A;  2DEN B;  3BIN A;  4NNJ B;  1RAX A;  2JVC A;  2WWZ A;  1J0G A;  1FXT B;  3PPA A;  5CHW A;  4WQO B;  2LGD A;  2LXC A;  1TGZ B;  4GB9 A;  5AZG A;  2PPH A;  2CKH B;  2AL3 A;  3VVW B;  2JXX A;  2Y5B B;  3ZW3 A;  2L3Z A;  4DHZ E;  3PS6 A;  5G2N A;  1UH6 A;  2DX5 B;  2QHO A;  4TKN A;  3R7R A;  1P98 A;  1WJN A;  1R4N I;  1V5T A;  3L08 A;  3VH3 B;  1SIF A;  2RSU A;  5D2M B;  1GG3 A;  5AEK B;  4HWI B;  4GIV A;  4N9F 4;  3Q3F A;  3HM3 A;  2MP2 A;  4JGH B;  2KJR A;  3LJ3 A;  2KN5 A;  4DWF A;  1YQB A;  4GGQ A;  1P0R A;  2D2Q A;  2BWE S;  3KVF B;  1WXS A;  2DZI A;  2BYV E;  3VUY A;  4AJW A;  4MGI E;  3WAN A;  4CO7 A;  4TQ1 A;  3ZTC A;  4PYZ A;  3IFW B;  2J0M A;  2PJH A;  2Z0E B;  4WWN A;  4RM8 A;  3PLU A;  5E6O A;  3VDZ A;  4FJY A;  4A3P A;  4MEL A;  2NR2 A;  4ZRJ A;  2V1Y A;  4KZC A;  1GJZ A;  1NDD A;  3RUL A;  1SGH A;  3QWZ B;  5J17 A;  3WAP A;  2FID A;  2KWU B;  1GC6 A;  1LM8 B;  2L76 A;  4HVB A;  4LJO B;  4K1R B;  3ZUN A;  2BPS A;  1UD7 A;  1WFY A;  3W1Y A;  2DYM A;  4BKG A;  1V80 A;  3ZRF A;  1M94 A;  2NPT A;  2R2O A;  3KYC D;  4K81 A;  4LCD E;  2R2Q A;  5DPT A;  1IYF A;  3N30 A;  4FLH A;  2BGF A;  2JPH A;  2FCQ A;  2ZPN A;  2YLM A;  4TQ0 A;  5LLI A;  2UWQ A;  3RUI B;  1E90 A;  1SE9 A;  2NCN A;  5DPS A;  3SD5 A;  3EC8 A;  4W9J A;  3WA0 A;  4GDK A;  4GOC A;  4XC2 A;  4WJO A;  4RMA A;  3VFK A;  3WAM A;  3WAO A;  3GZN I;  2K1F A;  3DBS A;  1WGY A;  2GBJ A;  2M8S A;  2MWS B;  3A9K B;  3WAL A;  4DHZ B;  3AU4 A;  3EEC A;  1WZ3 A;  2IBI B;  2KX3 A;  2C7M B;  1WX8 A;  2NS5 A;  4ICU A;  4FN2 A;  1I42 A;  2M4N A;  3L54 A;  4FHK A;  3APF A;  2AEH A;  4IM2 A;  2JWZ A;  2KOX A;  2JY6 A;  2KTR B;  3KUZ A;  1KM7 A;  4IM0 A;  2ZCB A;  3EHV A;  4IG7 B;  3OAW A;  4JQW C;  2BWF A;  3QAR A;  2KFJ A;  3BY4 B;  2NPT B;  1NBF C;  4MH0 E;  1LQB A;  2ZNV C;  3SDL C;  4A20 A;  3ZVV A;  3VQI A;  1YX6 B;  4B6W A;  1C1Y B;  5IA7 A;  2MLB A;  1WI0 A;  4X57 B;  5DPW A;  1WXM A;  1H8C A;  1Z5S B;  2IZV B;  1IPG A;  4W9D A;  2KQ7 A;  1OTR B;  3LDZ E;  4FBJ B;  4GMV A;  3AI5 A;  2IY1 B;  4JLC A;  1WMH A;  3A9J A;  3MTN B;  3H7P A;  4FJZ A;  2LXA A;  1Q1O A;  1T0Y A;  2LGX A;  2O6V D;  4IW0 A;  4K7W A;  4MGY E;  1U4A A;  2CS4 A;  3GOE A;  2LI5 A;  3M3J A;  2IO2 B;  3VTU A;  2CHW A;  2UYZ B;  4I6P A;  3PHW B;  4HK2 A;  3D32 A;  3QK0 A;  3V6E B;  1V86 A;  1X1M A;  4F8C B;  3DPD A;  4HPM B;  4XX5 A;  3UIO B;  2CR5 A;  2C60 A;  4ZRK A;  3A9K A;  3QQ8 B;  1L2N A;  4KIK A;  3JW0 X;  2CHX A;  1IP9 A;  1TZ1 A;  2IO0 B;  2FCN A;  1WJ4 A;  2D07 B;  4BKT A;  4LJP B;  1HE8 A;  3KH0 A;  1WE7 A;  3MHS D;  1VCB A;  1WM2 A;  1V81 A;  3APC A;  3T8M A;  3V62 A;  1WXA A;  1Q0W B;  2N9E B;  2D3G A;  1A5R A;  1I35 A;  4F7Z A;  1VD2 A;  1XQQ A;  3DCG A;  5AZH A;  2N7D A;  2MBQ A;  4W9K A;  4MDK E;  3ECI A;  3CSF A;  3OJ3 A;  3RZF A;  1V2Y A;  4FJV B;  3ZNI D;  5E6N A;  2M0X A;  3K9P B;  3UQA A;  3ZNH B;  3KYD D;  3PLV A;  1R4M I;  4WJQ A;  1UEL A;  1KLV A;  4MGK E;  2ZVO A;  4PS8 A;  1XD3 B;  1YX5 B;  3NHE B;  4AJY B;  3ML9 A;  4DK5 A;  5D94 A;  4BVU C;  2K6D B;  1UGM A;  2L0T A;  3TCA A;  3QA8 A;  2KLC A;  2KNB A;  4HDO A;  4W9G A;  3UIN B;  4CYE A;  4I6N B;  3IBE A;  2N9X A;  3ZDT A;  4ANW A;  2WX0 A;  4DBG A;  4K7U A;  5DPR A;  3RT3 B;  4GSW A;  1V9J A;  2IO3 B;  3W1S A;  3B1L X;  4OVV A;  3PRE A;  4HPL B;  2KWC A;  4NAW B;  3S2A A;  2XK5 A;  4M8N A;  2KMA A;  3C0R B;  2EKE C;  4TV3 A;  4XZ4 A;  1S1Q B;  2XBB C;  3VUX A;  4EUT A;  2I1K A;  4W9F A;  2ZEQ A;  3K9O B;  5CHV C;  3VTV A;  3UF8 A;  1E8X A;  3ZNZ B;  5AZF A;  2D11 A;  4B95 A;  4M8M A;  1RLF A;  4W9E A;  3TL5 A;  3A33 B;  3HIZ A;  2K8C A;  2VRR B;  2CHZ A;  3DOW A;  3NOB A;  2L7R A;  4G3X B;  4W9L A;  4KSL C;  2N9P C;  3EFU A;  4IM3 A;  2DAF A;  5CTR C;  4EZL A;  1V5O A;  3TMP B;  3WIM A;  1C3T A;  4PYU A;  2M1M A;  3I3T B;  1WY8 A;  2DYB A;  3UQB A;  3RYT A;  2DZM A;  3DBH I;  3APD A;  4ZYN A;  2N1V A;  1E5W A;  1L7Y A;  3HHM A;  1OEY A;  4LDT D;  4DHJ B;  2DYO A;  5E6P A;  4AWJ A;  5JHA A;  1WF9 A;  5LXI B;  1XT9 B;  4MGZ E;  4W9C A;  2IY0 B;  5DCN A;  2IO1 B;  2JF5 A;  2XEW A;  3DVN V;  4PS7 A;  1WGR A;  2JT4 B;  4BBN F;  3IHP C;  2JRH A;  2MX2 A;  4J6I A;  2I1J A;  5J2R A;  3NZS A;  2PE9 A;  2J0J A;  4EFO A;  4ANV A;  3ONS A;  4II2 B;  3KUD B;  4KDL B;  3SHQ A;  1H4R A;  2C9W B;  3NZU A;  2KC2 A;  2PE6 B;  4M0W B;  4A3O A;  1YD8 U;  4DDI D;  4KIK B;  4E74 A;  1WE6 A;  3VXW A;  4E3C A;  1MG8 A;  3PT2 B;  1WX9 A;  1WZ0 A;  2LWP A;  2JZZ A;  3R3M A;  1OEY J;  2JZ3 B;  2HD5 B;  2KKC A;  3QHT A;  3V6C B;  3ZRC A;  4ANX A;  1ZKH A;  2AYO B;  1WGG A;  4EOY A;  2O6V A;  3B08 A;  4IWQ A;  4B9K A;  2PEA A;  4DDG D;  4WJP A;  4YL8 A;  2LVP A;  3IVF A;  1JRU A;  1WR1 A;  2KDI A;  1EO6 A;  2KZR A;  3CMM B;  3VUW A;  3X0W A;  4F1S A;  1LXD A;  3NS8 A;  4WWP A;  1G6J A;  3RD2 A;  4FAD A;  3VHT C;  4MJS A;  5D7G A;  4GXB A;  4P7I A;  2K25 A;  1WXV A;  2MA9 B;  1EF1 A;  2ZNV B;  4IWO A;  3U7D A;  5KHQ A;  1CMX B;  3KUC B;  3L13 A;  3CST A;  4LDT B;  4DHJ D;  1K8R B;  1YJ1 A;  5HKH A;  1Q5W B;  2JRI B;  3VH4 B;  4IC7 B;  5FR6 A;  3JSV A;  3TBL D;  3DBR I;  3P2B A;  2OJR A;  2KJH B;  3ZTD A;  1GUA B;  3HK0 A;  1TTN A;  1WX7 A;  5TR5 A;  4HCN B;  2ZZP B;  4BKS A;  4MJS B;  3TIX A;  1GNU A;  2G45 B;  1ISN A;  2FNJ B;  5L83 A;  5J18 A;  4WJN A;  2RR9 A;  2MP2 B;  2LVQ A;  2LRW A;  4KDI C;  1J8C A;  4EEW A;  5C1Z A;  2MW5 A;  2BYF A;  3U30 A;  3L16 A;  4HJK A;  4HXD A;  4JL9 A;  4GDK B;  4FUL A;  1P9D U;  2LJ5 A;  2NBU A;  2ZVN A;  2K39 A;  2C7H A;  2KC1 A;  4G50 A;  2L0F A;  3AXC A;  1GC7 A;  3ZLZ A;  3H9D A;  2KTF A;  3ML8 A;  5IAA C;  2Z59 B;  4ZRI A;  3A4R A;  1Z2M A;  5BO4 B;  3QX1 A;  3QAQ A;  3PRP B;  3ZDM C;  2GMI C;  2KAN A;  4GDL B;  3R66 C;  4II3 B;  1S3S G;  4EKU A;  1ZGU B;  4AP4 C;  2KX0 A;  4G0N B;  3QJZ A;  2RPQ A;  2MSE D;  2DZK A;  5CX3 A;  3UIP B;  2FUH B;  3M95 A;  2HJ8 A;  2YVC A;  4NQL B;  3RZW C;  2KXJ A;  3RCZ A;  2LAS A;  4KZ0 A;  2N4F A;  4AOF A;  4ANU A;  1WIA A;  4NAW A;  4EZK A;  3NY5 A;  4ZDV A;  2G4D B;  4NPN A;  2B3A A;  2K6Q A;  2KDE B;  2NVU I;  3PSE B;  2LRU A;  4IWP A;  2KTR A;  4NJ7 A;  1KOT A;  1WYW B;  3PVL A;  1WH3 A;  2KLG A;  3A1Q B;  1BT0 A;  2ASQ A;  3W1S C;  3ZNG C;  4BOZ B;  3ENE A;  3PTF C;  1E8Z A;  2KVR A;  3M62 B;  3ZKJ C;  3JSV B;  4GDL A;  2LZ6 A;  3PRM B;  2GBR A;  2KDF B;  1LFD A;  2L05 A;  1WGD A;  3PGE A;  2KQS A;  1OQY A;  2KFK A;  3TJP A;  2KMC A;  3A4S C;  5C23 A;  1YIW A;  2J0K A;  2ZCC A;  2CU1 A;  4FA6 A;  2GOW A;  2MBH A;  4URK A;  2GBM A;  3AUL A;  3H6N A;  3MJW A;  1WR6 E;  3PRZ A;  1J19 A;  2GBK A;  2V3S A;  1WRD B;  5JZE B;  1WJ6 A;  3PZD A;  2G4S A;  3VAW A;  4GU2 A;  2FCS A;  2MBO A;  2XK5 B;  2WYQ A;  4K7S A;  1E8Y A;  2K8H A;  4BKS D;  2C7N B;  3OJ4 B;  5L95 C;  2AL6 A;  2EMS A;  3CF6 E;  3IG3 A;  3O65 B;  3Q3J A;  4NJ6 A;  1KJT A;  2KJ6 A;  2BKR B;  4WAA A;  2RGF A;  1D3Z A;  1E7U A;  3ZO5 B;  2EMT A;  3V61 A;  2DHZ A;  1TBE A;  4EZJ A;  3L0W B;  4KSK C;  4HCP B;  3U8Z A;  1WMH B;  3DVG X;  3X23 A;  2ZPY A;  3L10 B;  3VTW A;  4BFR A;  4ICV A;  3T9L A;  2V4L A;  4ASW C;  4GN1 A;  3DVG Y;  2MBB B;  3H7S A;  4W9H A;  5CHF A;  4I6L B;  1NI2 A;  2GBN A;  4KVG B;  2G3Q B;  3DDC B;  2MCN B;  1Y8R C;  4DXA B;  2KDB A;  2ZJD A;  5LXH A;  2N7E A;  2O6V B;  3DQV A;  2KHW B;  2HE7 A;  4IUM B;  3R7Q A;  3ZIM A;  4HDQ A;  2D10 A;  2BYE A;  1OGW A; 
#chains in the Genus database with same CATH topology
 3E56 A;  3N1Y C;  2J7Q B;  3Q8C A;  2FIF A;  1J7B A;  2AWT A;  2MQJ A;  1UBI A;  2LFI A;  2DLB A;  2O2V A;  1TY2 A;  3KW5 B;  4JIO U;  2ACZ B;  2WNM A;  2RD0 A;  1RRB A;  1ZE3 D;  2LUE A;  1FPY A;  1QZE A;  4BBN C;  2DAJ A;  2HTH A;  2LHE A;  2NBW B;  3SU8 X;  4BOS C;  1HXY D;  4QAY A;  1PQS A;  4LTU A;  1EUV B;  1T6B X;  1HZ5 A;  1WJU A;  2JX5 A;  2WXG A;  4TUU A;  4W9I A;  4XWW A;  3PV1 A;  2K8B A;  3U52 E;  3W5V B;  2LD9 A;  2BB6 A;  1ZDX A;  2M0A A;  2NBV B;  4G11 A;  2KFK B;  2KK8 A;  2DEN B;  3PPA A;  4GB9 A;  2PPH A;  3VVW B;  4DQO C;  4DHZ E;  3PS6 A;  1OQR A;  3HRD D;  1P98 A;  2PTL A;  2G9H D;  3VH3 B;  2D3C A;  2RSU A;  4O1N A;  5D2M B;  4N9F 4;  3Q3F A;  4JGH B;  3LJ3 A;  4GGQ A;  3B9J A;  2BWE S;  2WDQ B;  1JWS D;  1V8C A;  1JWM D;  2DZI A;  4AJW A;  1TJE A;  1WSP A;  3WAN A;  2Y5C A;  3IFW B;  2PJH A;  3E9S A;  3PLU A;  3VDZ A;  4A3P A;  2Q5W D;  4FJY A;  2V1Y A;  3ABV B;  1NDD A;  1SGH A;  3QWZ B;  5EE3 A;  3WAP A;  2CJN A;  3WCQ A;  2KWU B;  1GC6 A;  4HVB A;  4LJO B;  4K1R B;  1UD7 A;  2BPS A;  3W1Y A;  1SB3 C;  4R3D A;  3ZRF A;  2R2O A;  2R2Q A;  1IYF A;  2AX5 A;  2JPH A;  3P4Q B;  2UWQ A;  3RUI B;  5HHD G;  3SD5 A;  1JWA D;  4GOC A;  3IAM 1;  3VFK A;  4RGO S;  2RDB C;  3DBS A;  1WGY A;  2M8S A;  1B9R A;  2KX3 A;  2M4N A;  3LB8 C;  4IM2 A;  2JWZ A;  1P7F A;  2KTR B;  3KUZ A;  4JQW C;  4IG7 B;  3AE9 B;  1LQB A;  4YSY B;  1H8C A;  2IZV B;  5E6J A;  3DHH C;  3AI5 A;  2IY1 B;  2J52 A;  4YTP B;  5HG2 A;  3CIR B;  2LMC A;  3H7P A;  2LXA A;  1T0Y A;  3U4E G;  2N9L A;  1ZOY B;  2LGX A;  1U4A A;  2GLS A;  2CHW A;  1UWX A;  5D3I B;  3BWU D;  3AED B;  3ZJT A;  3U2S C;  4XX5 A;  4ACF A;  1L2N A;  4KIK A;  3JW0 X;  4BKT A;  1HE8 A;  3T8M A;  1V81 A;  3V62 A;  1WXA A;  1Q0W B;  2N7D A;  1WRI A;  2MBQ A;  3FAH A;  2ON8 A;  2V3N A;  3CSF A;  3RZF A;  4FJV B;  2M0X A;  3ZNH B;  3RNF C;  4IKG A;  1SXT A;  4ZRP A;  1YNT E;  1R4N B;  4PS8 A;  1XD3 B;  1E9M A;  2PW9 A;  5D94 A;  1T0S C;  3GE8 C;  2KNB A;  1D4B A;  4I6N B;  1XF5 L;  2N9X A;  4ANW A;  2IPK D;  4K7U A;  3RT3 B;  3PRE A;  2XK5 A;  1DOI A;  2KMA A;  3C0R B;  4TV3 A;  3VUX A;  3ETR A;  1MVK A;  1C4P A;  1E8X A;  3A33 B;  2INC C;  1ZUD 2;  3DOW A;  2E3T A;  2L7R A;  2N9P C;  5CTR C;  2YEP B;  2K5P A;  3TMP B;  3I3T B;  3UQB A;  1WY8 A;  1HZ6 A;  3N1Z C;  2N9K A;  3RYT A;  3RNE C;  1HQR D;  2FUG 1;  3AB5 A;  1KLU D;  4A9A A;  4YWG G;  1TS3 A;  2PMV A;  2VH2 A;  3MFG A;  3L4P A;  4W9C A;  5DCN A;  2JF5 A;  3P4R B;  3DVN V;  1FRD A;  2M19 A;  4NAM A;  1D5M C;  2I1J A;  3TEZ A;  1T0R C;  1JRO A;  4ANV A;  4KDL B;  3SHQ A;  4A3O A;  4DDI D;  4E74 A;  3DWG C;  1L0V B;  2LWP A;  4LNF A;  3ZRC A;  3QHT A;  3V6C B;  3N1X C;  1WGG A;  1PGX A;  1QKZ A;  1N63 A;  1HTO A;  2V3P A;  2JU6 X;  4OZA A;  4F1S A;  3AE2 B;  3NS8 A;  3HUI A;  5D7G A;  4RNA A;  3C19 A;  5KHQ A;  1UUP A;  4ZRQ A;  5HKH A;  2LGS A;  1C4C A;  3DBR I;  1GUA B;  1WX7 A;  4BKS A;  2KWD A;  2D5G A;  3BK2 A;  4XYC A;  4EEW A;  1NYR A;  4JL9 A;  5AUI A;  2ZVN A;  2E6X A;  1GC7 A;  3MC9 A;  3ML8 A;  2W3R A;  1YQ3 B;  2RDH A;  4D2K A;  1AN8 A;  3QX1 A;  3QAQ A;  2GMI C;  2KAN A;  2K22 A;  4II3 B;  4EKU A;  3ZYY X;  4WUR A;  2MSE D;  2FUH B;  5BMH A;  1MHX A;  3RCZ A;  4KZ0 A;  1QOG A;  4MT5 A;  1UGJ A;  2M56 B;  2N4F A;  2WDR B;  4AOF A;  1WIA A;  4NAW A;  3NY5 A;  5AUK A;  4ZDV A;  2B3A A;  1Y56 A;  4IWP A;  4NJ7 A;  2LRU A;  2GI9 A;  2KLG A;  4AQ7 A;  3NG0 A;  3W1S C;  2CJO A;  2H88 B;  2B76 B;  1EM7 A;  3SFE B;  4C4V B;  2GBR A;  1LFD A;  5G5G A;  5I4D A;  2KMC A;  4P1C C;  2ZCC A;  3R2I A;  2LGI A;  4URK A;  3P1M A;  4ARI A;  2GBK A;  1WRD B;  1WJ6 A;  3PZD A;  3AN1 A;  3VAW A;  4GU2 A;  3Q8A A;  2EMS A;  1NVI D;  3BK1 A;  1YMH E;  1KJT A;  1D3Z A;  4EZJ A;  5BYS A;  4KSK C;  4HCP B;  2QIL A;  3U8Z A;  3VTW A;  2LJI A;  4ICV A;  3T9L A;  2WU5 B;  3J9C A;  4ASW C;  5IP4 D;  2MBB B;  3H7S A;  4ZOH C;  4W9H A;  1EWY C;  5LXH A;  1MPE A;  1QOF A;  2O6V B;  4IUM B;  3R7Q A;  1C76 A;  3TSS A;  3RPF C;  4NJC A;  4KV2 A;  2XNA C;  3HM6 X;  4MEM A;  2V9H A;  2JUO A;  4USA A;  1ZW7 A;  1CJE A;  4E71 A;  4AUQ C;  5JH5 C;  1VZ8 A;  1E7P B;  3VRA B;  1T5X D;  2OOB B;  3AEF B;  3GS2 A;  2L8J A;  3H1U A;  2H89 B;  1TY0 A;  2DBY A;  1VR9 A;  3MC8 A;  4EE2 A;  3QCA A;  4CHK A;  2WXP A;  1JWU D;  2FCM A;  1TYG B;  3UGB B;  1UZX B;  1NEN B;  4RM9 A;  3PO0 A;  3IT4 B;  2KWV B;  5EDS A;  4N6E B;  3P63 A;  3KLS X;  1A70 A;  2DZJ A;  1WGH A;  2IYD B;  4MM3 B;  1GB4 A;  2WDT B;  2REX A;  4WWM A;  3V60 A;  4PS3 A;  1P1A A;  2N1W A;  3B0A A;  1RAX A;  2WWZ A;  1VZ6 A;  1FXT B;  5CHW A;  2LXC A;  4C80 A;  2OHF A;  3DHI C;  3T3O A;  3T3N A;  3IXS A;  1FFV A;  4YTM B;  1R4N I;  1SIF A;  5AEK B;  1I4P A;  4HWI B;  1YQB A;  3KVF B;  4RFB A;  1WXS A;  4P6V F;  4J3O D;  4PYZ A;  4NZL B;  5E6O A;  1GJZ A;  4ZYS A;  3RUL A;  1FCC C;  5J17 A;  2FID A;  3BVM A;  2L76 A;  4BKG A;  4TMA B;  2FBW B;  4K81 A;  3N30 A;  3GB1 A;  1SJH D;  2YLM A;  1SE9 A;  1IBX A;  1V1O A;  3WA0 A;  3WAM A;  3WAO A;  2K1F A;  3A9K B;  4DHZ B;  3EEC A;  5EE9 A;  4FN2 A;  1QQR A;  3L54 A;  4US8 A;  1L5P A;  2KN4 A;  2X8X X;  4FHK A;  2KOX A;  3FIL A;  2L32 A;  2IGH A;  4P1B C;  2L52 A;  2L83 A;  2BWF A;  3QAR A;  2KFJ A;  4MH0 E;  1NBF C;  2ZNV C;  3SDL C;  4B6W A;  3ZQ4 A;  2MLB A;  1L4D B;  5DPW A;  1V1P B;  4W9D A;  1OTR B;  3LDZ E;  4REZ A;  3Q14 C;  3TEY A;  1JW9 D;  2PIA A;  2O6V D;  3EGR A;  3GOE A;  2WQY B;  3DHG C;  3M3J A;  3Q3O C;  5FKA C;  1V86 A;  2PVO D;  4KKJ A;  4HPM B;  4AS1 A;  2CR5 A;  3A9K A;  3Q6B A;  2Z8L A;  1TZ1 A;  2CU3 A;  3ZXR A;  1WJ4 A;  1TKG A;  3W5U B;  1WE7 A;  3APC A;  1I35 A;  2N9E B;  1FNV A;  2INN E;  4W9K A;  4MDK E;  3OJ3 A;  1V1P A;  3ZNI D;  1F0Z A;  1R4M I;  1I4G A;  4MGK E;  3I57 A;  1YX5 B;  4P16 A;  4AJY B;  2K6D B;  1UGM A;  2L0T A;  3QA8 A;  1KF6 B;  3IBE A;  2WX0 A;  4RGT A;  5BYR A;  2IO3 B;  3B1L X;  4NAW B;  1S1Q B;  2R61 A;  2I1K A;  4W9E A;  4WQM A;  4DXG A;  3AE3 B;  3NOB A;  1TS5 A;  3Q69 A;  4WIP A;  2HJ1 A;  4EZL A;  1MFW A;  1V5O A;  1IGD A;  2NMQ A;  1ZDV A;  3WIM A;  4PYU A;  2M1M A;  3NUH B;  1I4R A;  4ZYN A;  2DYO A;  5E6P A;  4AWJ A;  1WF9 A;  2IJ0 A;  2IY0 B;  1QOA A;  2JRH A;  3AE4 B;  5J2R A;  2XN9 C;  1QF6 A;  2J0J A;  3ONS A;  1GAQ B;  2QC8 A;  4II2 B;  1H4R A;  4M0W B;  3TEW A;  4KIK B;  1MG8 A;  2JZZ A;  1OEY J;  4ANX A;  1XEE A;  4EOY A;  2O6V A;  4DDG D;  2LVP A;  3IVF A;  1QOB A;  1JRU A;  1WR1 A;  1EO6 A;  3X0W A;  1D5X C;  4MJS A;  5IKC M;  3MC0 B;  2V4I B;  5TSS A;  1WXV A;  4RF0 A;  1CMX B;  4WAF A;  2KVZ A;  3KUC B;  3CST A;  2JRI B;  4XDD A;  2QDF A;  1YQ4 B;  5FR6 A;  3ZGZ A;  1FD6 A;  1TTN A;  5TR5 A;  4HCN B;  1D5Z C;  3TIX A;  2G45 B;  1TZO A;  5L83 A;  3N20 C;  4WJN A;  2LRW A;  2MW5 A;  1N5X A;  3U30 A;  3L16 A;  4GDK B;  4FUL A;  1P9D U;  1LO5 D;  4YSX B;  3ZLZ A;  2Z59 B;  4KKI A;  4YTN B;  4ZRI A;  1F1H A;  5BO4 B;  1ZGU B;  1AWD A;  2DZK A;  5CX3 A;  2HJ8 A;  2YVC A;  1I4Q A;  2G1E A;  4NQL B;  3BVZ A;  1CK1 A;  1AW7 A;  4ANU A;  2G4D B;  4NPN A;  2K6Q A;  3PSE B;  2NVU I;  2PVG C;  1WYW B;  2QIE B;  4BAX A;  1BT0 A;  4BOZ B;  3ENE A;  1E8Z A;  2HTM E;  1JRP A;  3M62 B;  1WGK A;  3JSV B;  1JML A;  1CQV A;  2KDF B;  4C56 C;  3TEX A;  1ET6 A;  2KQS A;  3NVV A;  1YIW A;  1FMA D;  2MBH A;  3H6N A;  4XDC A;  4OW0 A;  1J19 A;  1MI0 A;  2J4X A;  2G4S A;  2KAC A;  2QJL A;  2WYQ A;  1E8Y A;  3EA6 A;  1WXQ A;  2K8H A;  2C7N B;  5L95 C;  3IG3 A;  4NJ6 A;  2KJ6 A;  2BKR B;  4WAA A;  2VZK D;  1E7U A;  2WXH A;  2EMT A;  1TBE A;  3DVG X;  4ITK A;  1N62 A;  2V4L A;  4B0M A;  1L0Y B;  4GN1 A;  2ZW0 A;  3GZN B;  2WXF A;  5IOI A;  4KVG B;  4N59 A;  1Y8R C;  2ZJD A;  2AQ2 B;  2LUM A;  3AEG B;  1B1Z A;  3ZIM A;  1XO3 A;  4HDQ A;  2BYE A;  2BTE A;  1EF5 A;  2KAJ A;  2Z0D B;  2C5L C;  3MP9 A;  1F9J A;  2L00 B;  2LGY A;  4OVU A;  1ACC A;  3VR8 B;  2NTS A;  1UBQ A;  1WM3 A;  1V6E A;  5G55 A;  4RH6 A;  4MSQ B;  1IGC A;  2W55 A;  1RFA A;  1P3Q U;  3A1Q A;  3AU5 A;  4FHJ A;  2A5U A;  2UU7 A;  2ICI A;  1E8W A;  4C4V A;  3Q3M C;  3JVZ X;  2JYT A;  5KHO A;  3DVN U;  3RI7 C;  4HLE A;  3QC8 B;  1V49 A;  2A4Z A;  2OED A;  5C2T B;  1KRH A;  2KD0 A;  3OLM D;  3MHZ A;  3C8Y A;  2FE8 A;  1KH0 A;  2O2V B;  2RPV A;  3BIN A;  2JVC A;  3AE6 B;  5JXV A;  2LGD A;  1T0Q C;  1J7C A;  5AZG A;  2AL3 A;  2JXX A;  2Y5B B;  2DX5 B;  3BZD B;  2QHO A;  1WJN A;  1V5T A;  4B0E A;  2V0G A;  1NYQ A;  2MEK A;  1F77 A;  2KJR A;  4XWT A;  1P0R A;  3BYY B;  2JZP A;  3VUY A;  1N5W A;  4RF1 A;  4MGI E;  1PFD A;  3ZTC A;  3Q8E A;  2Z0E B;  4WWN A;  4C7Y A;  4MEL A;  3RMK C;  4ZRJ A;  2TSS A;  1FXA A;  2PLP A;  1LM8 B;  3FIL B;  3ZUN A;  1WFY A;  2DYM A;  1F52 A;  1I7H A;  1M94 A;  2BT6 A;  2N7J A;  4LCD E;  4S17 A;  3AE8 B;  2K0P A;  4FLH A;  3UI3 A;  2ZPN A;  4TQ0 A;  4PT5 A;  2NCN A;  2VZK B;  2MHJ A;  1ET9 A;  4W9J A;  4XC2 A;  4WJO A;  1NEK B;  2WXL A;  4C00 A;  3V05 A;  2IND C;  2MWS B;  2WXJ A;  3AU4 A;  2IBI B;  4ZHO A;  3APF A;  2AEH A;  2JY6 A;  4A55 A;  4M02 A;  1KM7 A;  4IM0 A;  3EHV A;  3IT6 B;  2WXN A;  1XXG A;  2NPT B;  4A20 A;  4A90 A;  3VQI A;  1YX6 B;  1C1Y B;  5IA7 A;  2X38 A;  1WI0 A;  4X57 B;  1WXM A;  2INP E;  1Z5S B;  2KQ7 A;  4FBJ B;  4GMV A;  1YN4 A;  1E10 A;  4JLC A;  1Q1O A;  1SBB B;  4IW0 A;  4K7W A;  5IO9 A;  2CS4 A;  2LI5 A;  1TIF A;  3AV8 A;  3H8H A;  3VTU A;  2UYZ B;  4LNK A;  4M0W A;  4I6P A;  1TT5 B;  1L0X B;  1UNS A;  3QK0 A;  3V6E B;  3I9V 1;  3DPD A;  4ZRK A;  2C60 A;  3QQ8 B;  2MJD A;  2AQ1 B;  1E6E B;  2FCN A;  2D07 B;  2WDV B;  3P4P B;  4LJP B;  3NJT A;  3MHS D;  3DBL B;  2HDE A;  1WM2 A;  3W9C B;  4F7Z A;  1VD2 A;  1SEB D;  1C9F A;  5AZH A;  2BQQ A;  3ECI A;  2WXI A;  2N0S B;  3K9P B;  3KYD D;  3RFZ B;  3NVY A;  4WJQ A;  1UEL A;  3RNB C;  1L6V A;  1KLV A;  2L1A A;  3I5J C;  1ZXH A;  1SE4 A;  2Y3A A;  3FC4 A;  3NHE B;  4DK5 A;  4BVU C;  2WS3 B;  3TCA A;  4HDO A;  4W9G A;  1N6Z A;  3URY A;  3ZDT A;  4DBG A;  1RWS A;  4GSW A;  1XLP A;  4RCO A;  3W2D A;  1N61 A;  4M8N A;  4EUT A;  1SJE D;  4W9F A;  3K9O B;  1SIJ A;  3VTV A;  2D11 A;  3R2T A;  3TL5 A;  2K8C A;  3KWV A;  2CHZ A;  4G3X B;  3EFU A;  4IM3 A;  2DAF A;  4HJG E;  1C3T A;  4KGS A;  4JWU C;  1YJI A;  2EEL A;  4MAC A;  3DBH I;  3LXF A;  3APD A;  2N1V A;  1E5W A;  3HHM A;  1OEY A;  4LDT D;  1SE3 A;  5JHA A;  1WYG A;  1XT9 B;  4MGZ E;  2BVC A;  4A8X C;  1ZPS A;  1RFK A;  2XEW A;  1K50 A;  4TSS A;  4PS7 A;  1WGR A;  2PKO A;  3AMZ A;  3IHP C;  5HI1 A;  4J6I A;  4HKQ A;  4LLG M;  1CZP A;  1K53 A;  4Q2J A;  2QMT A;  2Y5P A;  4EFO A;  1XCQ L;  3KUD B;  1QIL A;  2C9W B;  3EUB 2;  4HEA 1;  2KC2 A;  1YD8 U;  3VXW A;  1WX9 A;  1WZ0 A;  2JYE A;  2KT7 A;  3P42 A;  3R3M A;  2J53 A;  1GOZ A;  3DBR B;  1TKY A;  3B08 A;  4IWQ A;  4B9K A;  5BMG A;  1V97 A;  3FKY A;  4WWP A;  3EFC A;  1G6J A;  2KYW A;  5H92 C;  4FAD A;  4GXB A;  4P7I A;  3U7D A;  1XLQ A;  4MH8 A;  4DHJ D;  4IC7 B;  3RN9 C;  3JSV A;  3TBL D;  2WGS A;  3P2B A;  2OJR A;  2KJH B;  4OZB A;  3HK0 A;  3BYT B;  4MJS B;  1GNU A;  5J18 A;  3ZJV A;  1J8C A;  2BYF A;  2W3S A;  2LJ5 A;  2NBU A;  2K39 A;  4G50 A;  1SSN A;  2L0F A;  2YEP F;  2KTF A;  3H9D A;  5IAA C;  3A4R A;  1Z2M A;  1R4M B;  5MPO A;  5D3D A;  3PRP B;  2RDG A;  3R66 C;  3QJZ A;  2RPQ A;  1VZ7 A;  3Q8F A;  3UIP B;  2WXO A;  3M95 A;  2BS2 B;  3RZW C;  2KXJ A;  4HPP A;  1XLO A;  1UF0 A;  1VJK A;  2KDE B;  2KDM A;  3PVL A;  5BYQ A;  4H2A A;  2WXR A;  3A1Q B;  2KVR A;  3ZKJ C;  2DWQ A;  4GDL A;  2LZ6 A;  3PRM B;  4RGM A;  4K3B A;  1PGA A;  1WGD A;  4WH4 A;  2AQ3 B;  2I38 A;  2QCZ A;  3PGE A;  1OQY A;  2KFK A;  2BS3 B;  2CU1 A;  2GBM A;  1KTK A;  5FK9 C;  1PYW D;  5JZE B;  2KQ4 X;  2MBO A;  2XK5 B;  1E0Z A;  2WXM A;  4BKS D;  1TKE A;  2AL6 A;  3CF6 E;  1TS2 A;  1D6E C;  2RGF A;  3V61 A;  2LEK A;  1ENF A;  3X23 A;  2ZPY A;  3AEC B;  4BFR A;  2J42 A;  4M01 A;  3OG5 A;  1ZP0 B;  3DVG Y;  2NTT A;  2GRI A;  1DGJ A;  4YXD B;  5H8Y E;  1NI3 A;  3NVW A;  1FM0 D;  2G3Q B;  2MCN B;  4HRO A;  2N7E A;  1PGB A;  1OFF A;  3SR6 A;  2HE7 A;  3B2F A;  2ZNV B;  2BF8 B;  2MRP A;  4HRS A;  2BYT A;  1JAL A;  3B2G A;  4KX6 B;  1FEH A;  1E7V A;  1SF0 A;  2W9N A;  5JHB A;  5GMV A;  2KO3 A;  1ZXI A;  2WLB A;  2LHD A;  2WX1 A;  1MHH E;  1YJJ A;  3RNG C;  1KLG D;  3H7P B;  1F2R I;  4MM3 A;  3KQ4 A;  1FNU A;  3ALB A;  2LVO A;  4LNI A;  2VH1 A;  3N3K B;  3PHX B;  2M17 A;  3A9J B;  3L17 A;  3ZJU A;  3MJ5 A;  1FNW A;  3JYU A;  1C78 A;  4WWO A;  4NQK E;  3RNC C;  4L23 A;  1AAR A;  3N32 A;  5EE1 A;  2BB5 A;  1ESF A;  4NY0 A;  4CQN A;  3QIJ A;  3M63 B;  5FR3 A;  2FAZ A;  3DBL I;  2BKF A;  3VR9 B;  4YSZ B;  4OVZ A;  4MSM B;  2MBE A;  4YT0 B;  5D6J B;  4NNJ B;  1VDV A;  1EWC A;  1DYQ A;  1J0G A;  4WQO B;  1TGZ B;  2KMM A;  2WP9 B;  2CKH B;  3ZW3 A;  2L3Z A;  5G2N A;  1UH6 A;  4TKN A;  1YN5 A;  3R7R A;  3L08 A;  1JQ4 A;  4LNN A;  1GG3 A;  4GIV A;  3HM3 A;  2MP2 A;  2KN5 A;  2SAK A;  4DWF A;  1RYJ A;  2D2Q A;  4XE0 A;  2MH7 A;  1PUT A;  3Q2A C;  2BYV E;  4CO7 A;  1VLB A;  4TQ1 A;  1FRR A;  4KGR A;  2QSD A;  5C3J B;  2J0M A;  3AEE B;  4RM8 A;  5EE0 A;  1XCT L;  2DNF A;  4JWS C;  2NR2 A;  4C7Z A;  5T8I A;  3AE5 B;  4KZC A;  3CWI A;  1YOV B;  5HFY A;  1V80 A;  4OHJ A;  2NPT A;  3KYC D;  5DPT A;  4LNO A;  2BGF A;  3DBH B;  2FCQ A;  5LLI A;  1E90 A;  5DPS A;  2IDY A;  1DOY A;  4L2Y A;  3EC8 A;  4GDK A;  4RMA A;  3AE1 B;  3GZN I;  2I2Y A;  2D3B A;  2GBJ A;  3WAL A;  1WZ3 A;  2NS5 A;  1I42 A;  1K51 A;  1WX8 A;  2C7M B;  4ICU A;  4RGN A;  1AYF A;  3IAS 1;  1VRA B;  1BXT A;  2ZCB A;  1HTQ A;  3OAW A;  3BY4 B;  3ZVV A;  1M4V A;  1IPG A;  1LGR A;  1I4X A;  4DXF A;  1WMH A;  3A9J A;  1HEZ E;  1OQQ A;  3MTN B;  1DOX A;  4FJZ A;  2WXQ A;  3NRZ A;  4MGY E;  1GB1 A;  2IO2 B;  3R8B A;  3PHW B;  4HK2 A;  3D32 A;  1X1M A;  4F8C B;  3UIO B;  3P4S B;  4L1B A;  2GB1 A;  2CHX A;  2WXK A;  1IP9 A;  2IGG A;  2IO0 B;  1N60 A;  3KH0 A;  1VCB A;  1A5R A;  1QT9 A;  2D3G A;  1TS4 A;  1XQQ A;  4XGA B;  3U7Z A;  4BZA A;  3DCG A;  1WWT A;  3NS1 A;  2SEB D;  1V2Y A;  3SEB A;  2JSV X;  5E6N A;  3UQA A;  3PLV A;  4ARC A;  2WHI A;  2ZVO A;  3GE3 C;  3N9Y C;  3ML9 A;  2KLC A;  4CYE A;  3UIN B;  1IBX B;  5DPR A;  2IGD A;  1V9J A;  1RM6 C;  2MJ3 A;  3W1S A;  4OVV A;  4HPL B;  2KWC A;  3S2A A;  2EKE C;  4XZ4 A;  2XBB C;  2ONQ A;  2ZEQ A;  1I4H A;  5CHV C;  3UF8 A;  3ZNZ B;  3AEA B;  5AZF A;  4B95 A;  5BMI A;  4M8M A;  1RLF A;  3HIZ A;  4KGT A;  3PZ8 A;  2VRR B;  1JWB D;  4W9L A;  4KSL C;  1FCL A;  3AH7 A;  4US9 A;  1KFY B;  2K9X A;  2DYB A;  3DWM A;  3Q3N C;  2DZM A;  4GLS C;  4UDU C;  2W82 A;  1L7Y A;  1FIQ A;  1YN3 A;  4DHJ B;  4S0R A;  5LXI B;  1MG4 A;  1FXI A;  4PK1 A;  4IOI E;  2IO1 B;  2JWU A;  4JX1 C;  2JT4 B;  4BBN F;  1K52 A;  2MX2 A;  1L6U A;  1JCK B;  3NZS A;  2PE9 A;  1XLN A;  1BUI C;  3BVG A;  3NZU A;  2EKI A;  2PE6 B;  2WU2 B;  4E3C A;  1WE6 A;  3PT2 B;  5G5H A;  3I63 C;  2HD5 B;  2JZ3 B;  2KKC A;  1ZKH A;  2AYO B;  3OWE B;  1F2R C;  2PEA A;  4WJP A;  4YL8 A;  2JQR B;  2KDI A;  4K3C A;  2KZR A;  3CMM B;  3VUW A;  1LXD A;  4LK0 M;  3RD2 A;  3VHT C;  5GXG B;  2BS4 B;  2OJW A;  2K25 A;  2MA9 B;  1EF1 A;  4IWO A;  2K3U A;  3L13 A;  4LDT B;  1K8R B;  1YJ1 A;  3V3X A;  1Q5W B;  3VH4 B;  4A6Q A;  1J7A A;  3ZTD A;  2ZZP B;  1MJD A;  4HKZ E;  1ISN A;  3RNA C;  2FNJ B;  1ROE A;  2RR9 A;  2MP2 B;  2W54 A;  1SE2 A;  2LVQ A;  4KDI C;  5C1Z A;  2D3A A;  1EU3 A;  4HJK A;  4HXD A;  2C7H A;  2KC1 A;  4JPS A;  1Q10 A;  1FO4 A;  3AXC A;  3O13 A;  4M00 A;  4IDI A;  3GP7 A;  3ZDM C;  4GDL B;  1S3S G;  4AP4 C;  2KX0 A;  4G0N B;  1EU4 A;  1R7S A;  2LAS A;  1HA5 A;  4EZK A;  3SFD B;  1KOT A;  2KTR A;  3HVD A;  1WH3 A;  2ASQ A;  3ZNG C;  2RMM A;  3PTF C;  1L4Z B;  1GPX A;  3VRB B;  3BII D;  4FXC A;  3Q8B A;  3AM9 A;  2L05 A;  2MJE A;  2JXT A;  4ZHP A;  3TJP A;  3A4S C;  5C23 A;  2J0K A;  3NZ3 A;  4FA6 A;  2GOW A;  1T3Q A;  3AUL A;  3MJW A;  1WR6 E;  3PRZ A;  1C79 A;  2V3S A;  4N58 A;  3AEB B;  1QLB B;  1UWM A;  5IN7 A;  2FCS A;  3NVZ A;  4K7S A;  1BML C;  5LNK 1;  3OJ4 B;  1C77 A;  3O65 B;  3Q3J A;  1P7E A;  3HVZ A;  1C4A A;  1IUE A;  3ZO5 B;  3AE7 B;  2DHZ A;  3PZ7 A;  2BW2 A;  3L0W B;  1WMH B;  3L10 B;  4JE3 B;  1FFU A;  2QEJ C;  4OZC A;  5CHF A;  1PDX A;  3ZXV A;  3TUO A;  4I6L B;  1NI2 A;  2GBN A;  2BBC A;  3DDC B;  3KWL A;  4DXA B;  2KDB A;  1STE A;  3DQV A;  3LYY A;  2KHW B;  2D10 A;  1OGW A;  2ZW1 A; 
#chains in the Genus database with same CATH homology
 2J7Q B;  2BF8 B;  2MRP A;  1EF5 A;  4KV2 A;  2Z0D B;  3HM6 X;  4MEM A;  2FIF A;  2C5L C;  5JHB A;  2W9N A;  1E7V A;  1F9J A;  2L00 B;  2LGY A;  5GMV A;  2JUO A;  1ZW7 A;  2KO3 A;  4OVU A;  2WX1 A;  2AWT A;  2MQJ A;  1UBI A;  4AUQ C;  4E71 A;  2O2V A;  5JH5 C;  3H7P B;  3KW5 B;  1UBQ A;  1WM3 A;  4JIO U;  1V6E A;  4MM3 A;  3ALB A;  5G55 A;  2LVO A;  4MSQ B;  2RD0 A;  1RRB A;  2OOB B;  1RFA A;  2L8J A;  3N3K B;  1P3Q U;  1QZE A;  2LUE A;  3A1Q A;  3AU5 A;  3H1U A;  3PHX B;  2M17 A;  2DAJ A;  4BBN C;  3A9J B;  4FHJ A;  2HTH A;  3L17 A;  2A5U A;  2NBW B;  3SU8 X;  1E8W A;  4BOS C;  3QCA A;  4CHK A;  2FCM A;  3JYU A;  1PQS A;  3UGB B;  4WWO A;  1EUV B;  1UZX B;  3JVZ X;  4NQK E;  4RM9 A;  1AAR A;  3N32 A;  1WJU A;  5KHO A;  3DVN U;  4TUU A;  4NY0 A;  2KWV B;  4W9I A;  4HLE A;  3QC8 B;  1V49 A;  5EDS A;  2A4Z A;  3PV1 A;  2K8B A;  3M63 B;  3QIJ A;  2FAZ A;  2LD9 A;  3DBL I;  2BKF A;  2DZJ A;  1WGH A;  2IYD B;  2WDT B;  2KD0 A;  2NBV B;  4MSM B;  2MBE A;  2REX A;  3OLM D;  4G11 A;  3V60 A;  2KFK B;  4PS3 A;  5D6J B;  1P1A A;  2KK8 A;  2N1W A;  2O2V B;  3B0A A;  2DEN B;  3BIN A;  4NNJ B;  1RAX A;  2JVC A;  2WWZ A;  1J0G A;  1FXT B;  3PPA A;  5CHW A;  4WQO B;  2LGD A;  2LXC A;  1TGZ B;  4GB9 A;  5AZG A;  2PPH A;  2CKH B;  2AL3 A;  3VVW B;  2JXX A;  2Y5B B;  3ZW3 A;  2L3Z A;  4DHZ E;  3PS6 A;  5G2N A;  1UH6 A;  2DX5 B;  2QHO A;  4TKN A;  3R7R A;  1P98 A;  1WJN A;  1R4N I;  1V5T A;  3L08 A;  3VH3 B;  1SIF A;  2RSU A;  5D2M B;  1GG3 A;  5AEK B;  4HWI B;  4GIV A;  4N9F 4;  3Q3F A;  3HM3 A;  2MP2 A;  4JGH B;  2KJR A;  3LJ3 A;  2KN5 A;  4DWF A;  1YQB A;  4GGQ A;  1P0R A;  2D2Q A;  2BWE S;  3KVF B;  1WXS A;  2DZI A;  2BYV E;  3VUY A;  4AJW A;  4MGI E;  3WAN A;  4CO7 A;  4TQ1 A;  3ZTC A;  4PYZ A;  3IFW B;  2J0M A;  2PJH A;  2Z0E B;  4WWN A;  4RM8 A;  3PLU A;  5E6O A;  3VDZ A;  4FJY A;  4A3P A;  4MEL A;  2NR2 A;  4ZRJ A;  2V1Y A;  4KZC A;  1GJZ A;  1NDD A;  3RUL A;  1SGH A;  3QWZ B;  5J17 A;  3WAP A;  2FID A;  2KWU B;  1GC6 A;  1LM8 B;  2L76 A;  4HVB A;  4LJO B;  4K1R B;  3ZUN A;  2BPS A;  1UD7 A;  1WFY A;  3W1Y A;  2DYM A;  4BKG A;  1V80 A;  3ZRF A;  1M94 A;  2NPT A;  2R2O A;  3KYC D;  4K81 A;  4LCD E;  2R2Q A;  5DPT A;  1IYF A;  3N30 A;  4FLH A;  2BGF A;  2JPH A;  2FCQ A;  2ZPN A;  2YLM A;  4TQ0 A;  5LLI A;  2UWQ A;  3RUI B;  1E90 A;  1SE9 A;  2NCN A;  5DPS A;  3SD5 A;  3EC8 A;  4W9J A;  3WA0 A;  4GDK A;  4GOC A;  4XC2 A;  4WJO A;  4RMA A;  3VFK A;  3WAM A;  3WAO A;  3GZN I;  2K1F A;  3DBS A;  1WGY A;  2GBJ A;  2M8S A;  2MWS B;  3A9K B;  3WAL A;  4DHZ B;  3AU4 A;  3EEC A;  1WZ3 A;  2IBI B;  2KX3 A;  2C7M B;  1WX8 A;  2NS5 A;  4ICU A;  4FN2 A;  1I42 A;  2M4N A;  3L54 A;  4FHK A;  3APF A;  2AEH A;  4IM2 A;  2JWZ A;  2KOX A;  2JY6 A;  2KTR B;  3KUZ A;  1KM7 A;  4IM0 A;  2ZCB A;  3EHV A;  4IG7 B;  3OAW A;  4JQW C;  2BWF A;  3QAR A;  2KFJ A;  3BY4 B;  2NPT B;  1NBF C;  4MH0 E;  1LQB A;  2ZNV C;  3SDL C;  4A20 A;  3ZVV A;  3VQI A;  1YX6 B;  4B6W A;  1C1Y B;  5IA7 A;  2MLB A;  1WI0 A;  4X57 B;  5DPW A;  1WXM A;  1H8C A;  1Z5S B;  2IZV B;  1IPG A;  4W9D A;  2KQ7 A;  1OTR B;  3LDZ E;  4FBJ B;  4GMV A;  3AI5 A;  2IY1 B;  4JLC A;  1WMH A;  3A9J A;  3MTN B;  3H7P A;  4FJZ A;  2LXA A;  1Q1O A;  1T0Y A;  2LGX A;  2O6V D;  4IW0 A;  4K7W A;  4MGY E;  1U4A A;  2CS4 A;  3GOE A;  2LI5 A;  3M3J A;  2IO2 B;  3VTU A;  2CHW A;  2UYZ B;  4I6P A;  3PHW B;  4HK2 A;  3D32 A;  3QK0 A;  3V6E B;  1V86 A;  1X1M A;  4F8C B;  3DPD A;  4HPM B;  4XX5 A;  3UIO B;  2CR5 A;  2C60 A;  4ZRK A;  3A9K A;  3QQ8 B;  1L2N A;  4KIK A;  3JW0 X;  2CHX A;  1IP9 A;  1TZ1 A;  2IO0 B;  2FCN A;  1WJ4 A;  2D07 B;  4BKT A;  4LJP B;  1HE8 A;  3KH0 A;  1WE7 A;  3MHS D;  1VCB A;  1WM2 A;  1V81 A;  3APC A;  3T8M A;  3V62 A;  1WXA A;  1Q0W B;  2N9E B;  2D3G A;  1A5R A;  1I35 A;  4F7Z A;  1VD2 A;  1XQQ A;  3DCG A;  5AZH A;  2N7D A;  2MBQ A;  4W9K A;  4MDK E;  3ECI A;  3CSF A;  3OJ3 A;  3RZF A;  1V2Y A;  4FJV B;  3ZNI D;  5E6N A;  2M0X A;  3K9P B;  3UQA A;  3ZNH B;  3KYD D;  3PLV A;  1R4M I;  4WJQ A;  1UEL A;  1KLV A;  4MGK E;  2ZVO A;  4PS8 A;  1XD3 B;  1YX5 B;  3NHE B;  4AJY B;  3ML9 A;  4DK5 A;  5D94 A;  4BVU C;  2K6D B;  1UGM A;  2L0T A;  3TCA A;  3QA8 A;  2KLC A;  2KNB A;  4HDO A;  4W9G A;  3UIN B;  4CYE A;  4I6N B;  3IBE A;  2N9X A;  3ZDT A;  4ANW A;  2WX0 A;  4DBG A;  4K7U A;  5DPR A;  3RT3 B;  4GSW A;  1V9J A;  2IO3 B;  3W1S A;  3B1L X;  4OVV A;  3PRE A;  4HPL B;  2KWC A;  4NAW B;  3S2A A;  2XK5 A;  4M8N A;  2KMA A;  3C0R B;  2EKE C;  4TV3 A;  4XZ4 A;  1S1Q B;  2XBB C;  3VUX A;  4EUT A;  2I1K A;  4W9F A;  2ZEQ A;  3K9O B;  5CHV C;  3VTV A;  3UF8 A;  1E8X A;  3ZNZ B;  5AZF A;  2D11 A;  4B95 A;  4M8M A;  1RLF A;  4W9E A;  3TL5 A;  3A33 B;  3HIZ A;  2K8C A;  2VRR B;  2CHZ A;  3DOW A;  3NOB A;  2L7R A;  4G3X B;  4W9L A;  4KSL C;  2N9P C;  3EFU A;  4IM3 A;  2DAF A;  5CTR C;  4EZL A;  1V5O A;  3TMP B;  3WIM A;  1C3T A;  4PYU A;  2M1M A;  3I3T B;  1WY8 A;  2DYB A;  3UQB A;  3RYT A;  2DZM A;  3DBH I;  3APD A;  4ZYN A;  2N1V A;  1E5W A;  1L7Y A;  3HHM A;  1OEY A;  4LDT D;  4DHJ B;  2DYO A;  5E6P A;  4AWJ A;  5JHA A;  1WF9 A;  5LXI B;  1XT9 B;  4MGZ E;  4W9C A;  2IY0 B;  5DCN A;  2IO1 B;  2JF5 A;  2XEW A;  3DVN V;  4PS7 A;  1WGR A;  2JT4 B;  4BBN F;  3IHP C;  2JRH A;  2MX2 A;  4J6I A;  2I1J A;  5J2R A;  3NZS A;  2PE9 A;  2J0J A;  4EFO A;  4ANV A;  3ONS A;  4II2 B;  3KUD B;  4KDL B;  3SHQ A;  1H4R A;  2C9W B;  3NZU A;  2KC2 A;  2PE6 B;  4M0W B;  4A3O A;  1YD8 U;  4DDI D;  4KIK B;  4E74 A;  1WE6 A;  3VXW A;  4E3C A;  1MG8 A;  3PT2 B;  1WX9 A;  1WZ0 A;  2LWP A;  2JZZ A;  3R3M A;  1OEY J;  2JZ3 B;  2HD5 B;  2KKC A;  3QHT A;  3V6C B;  3ZRC A;  4ANX A;  1ZKH A;  2AYO B;  1WGG A;  4EOY A;  2O6V A;  3B08 A;  4IWQ A;  4B9K A;  2PEA A;  4DDG D;  4WJP A;  4YL8 A;  2LVP A;  3IVF A;  1JRU A;  1WR1 A;  2KDI A;  1EO6 A;  2KZR A;  3CMM B;  3VUW A;  3X0W A;  4F1S A;  1LXD A;  3NS8 A;  4WWP A;  1G6J A;  3RD2 A;  4FAD A;  3VHT C;  4MJS A;  5D7G A;  4GXB A;  4P7I A;  2K25 A;  1WXV A;  2MA9 B;  1EF1 A;  2ZNV B;  4IWO A;  3U7D A;  5KHQ A;  1CMX B;  3KUC B;  3L13 A;  3CST A;  4LDT B;  4DHJ D;  1K8R B;  1YJ1 A;  5HKH A;  1Q5W B;  2JRI B;  3VH4 B;  4IC7 B;  5FR6 A;  3JSV A;  3TBL D;  3DBR I;  3P2B A;  2OJR A;  2KJH B;  3ZTD A;  1GUA B;  3HK0 A;  1TTN A;  1WX7 A;  5TR5 A;  4HCN B;  2ZZP B;  4BKS A;  4MJS B;  3TIX A;  1GNU A;  2G45 B;  1ISN A;  2FNJ B;  5L83 A;  5J18 A;  4WJN A;  2RR9 A;  2MP2 B;  2LVQ A;  2LRW A;  4KDI C;  1J8C A;  4EEW A;  5C1Z A;  2MW5 A;  2BYF A;  3U30 A;  3L16 A;  4HJK A;  4HXD A;  4JL9 A;  4GDK B;  4FUL A;  1P9D U;  2LJ5 A;  2NBU A;  2ZVN A;  2K39 A;  2C7H A;  2KC1 A;  4G50 A;  2L0F A;  3AXC A;  1GC7 A;  3ZLZ A;  3H9D A;  2KTF A;  3ML8 A;  5IAA C;  2Z59 B;  4ZRI A;  3A4R A;  1Z2M A;  5BO4 B;  3QX1 A;  3QAQ A;  3PRP B;  3ZDM C;  2GMI C;  2KAN A;  4GDL B;  3R66 C;  4II3 B;  1S3S G;  4EKU A;  1ZGU B;  4AP4 C;  2KX0 A;  4G0N B;  3QJZ A;  2RPQ A;  2MSE D;  2DZK A;  5CX3 A;  3UIP B;  2FUH B;  3M95 A;  2HJ8 A;  2YVC A;  4NQL B;  3RZW C;  2KXJ A;  3RCZ A;  2LAS A;  4KZ0 A;  2N4F A;  4AOF A;  4ANU A;  1WIA A;  4NAW A;  4EZK A;  3NY5 A;  4ZDV A;  2G4D B;  4NPN A;  2B3A A;  2K6Q A;  2KDE B;  2NVU I;  3PSE B;  2LRU A;  4IWP A;  2KTR A;  4NJ7 A;  1KOT A;  1WYW B;  3PVL A;  1WH3 A;  2KLG A;  3A1Q B;  1BT0 A;  2ASQ A;  3W1S C;  3ZNG C;  4BOZ B;  3ENE A;  3PTF C;  1E8Z A;  2KVR A;  3M62 B;  3ZKJ C;  3JSV B;  4GDL A;  2LZ6 A;  3PRM B;  2GBR A;  2KDF B;  1LFD A;  2L05 A;  1WGD A;  3PGE A;  2KQS A;  1OQY A;  2KFK A;  3TJP A;  2KMC A;  3A4S C;  5C23 A;  1YIW A;  2J0K A;  2ZCC A;  2CU1 A;  4FA6 A;  2GOW A;  2MBH A;  4URK A;  2GBM A;  3AUL A;  3H6N A;  3MJW A;  1WR6 E;  3PRZ A;  1J19 A;  2GBK A;  2V3S A;  1WRD B;  5JZE B;  1WJ6 A;  3PZD A;  2G4S A;  3VAW A;  4GU2 A;  2FCS A;  2MBO A;  2XK5 B;  2WYQ A;  4K7S A;  1E8Y A;  2K8H A;  4BKS D;  2C7N B;  3OJ4 B;  5L95 C;  2AL6 A;  2EMS A;  3CF6 E;  3IG3 A;  3O65 B;  3Q3J A;  4NJ6 A;  1KJT A;  2KJ6 A;  2BKR B;  4WAA A;  2RGF A;  1D3Z A;  1E7U A;  3ZO5 B;  2EMT A;  3V61 A;  2DHZ A;  1TBE A;  4EZJ A;  3L0W B;  4KSK C;  4HCP B;  3U8Z A;  1WMH B;  3DVG X;  3X23 A;  2ZPY A;  3L10 B;  3VTW A;  4BFR A;  4ICV A;  3T9L A;  2V4L A;  4ASW C;  4GN1 A;  3DVG Y;  2MBB B;  3H7S A;  4W9H A;  5CHF A;  4I6L B;  1NI2 A;  2GBN A;  4KVG B;  2G3Q B;  3DDC B;  2MCN B;  1Y8R C;  4DXA B;  2KDB A;  2ZJD A;  5LXH A;  2N7E A;  2O6V B;  3DQV A;  2KHW B;  2HE7 A;  4IUM B;  3R7Q A;  3ZIM A;  4HDQ A;  2D10 A;  2BYE A;  1OGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...