2DHZA

Solution structure of the ra domain in the human link guanine nucleotide exchange factor ii (link-gefii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
120
structure length
120
Chain Sequence
GSSGSSGDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the RA Domain in the Human Link Guanine Nucleotide Exchange Factor II (Link-GEFII)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Rap guanine nucleotide exchange factor (GEF)-like 1
total genus 11
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dhzA01
4MSQB 2KQSA 3CSFA 3O65B 2KK8A 1F9JA 3M62B 2J0JA 4XX5A 3ZTDA 2JWZA 2NVUI 3IVFA 2DZIA 4ICUA 3VHTC 2IYDB 2KX0A 2D3GA 4EZKA 3B08A 2GBRA 1IPGA 2V1YA 3PRZA 2K39A 4EZLA 4LJOB 2CS4A 2MWSB 2KFJA 4AOFA 3QWZB 2BKFA 4EZJA 3WAPA 3DOWA 2N4FA 2JVCA 2DZMA 1P3QU 1WMHA 4HLEA 3L13A 4GOCA 4CYEA 1VCBA 2QHOA 2GOWA 4E3CA 3ZNZB 2G4DB 2FAZA 2ZVNA 3L16A 1GG3A 4GU2A 2L8JA 4BKSA 5L95C 4MEMA 4GMVA 2BYVE 1P98A 3KVFB 3RYTA 3VVWB 2KN5A 2NBUA 1E5WA 1OGWA 1WGDA 2FNJB 5J18A 1FXTB 4ZRJA 2KTRA 2DYMA 3L54A 3ALBA 1SGHA 4I6NB 2DAFA 2KVRA 4M8MA 5D2MB 4HPLB 4RM9A 1EF5A 3R7RA 1UBIA 2DAJA 1T0YA 4IC7B 4JLCA 4KZCA 4IG7B 1WXVA 3SDLC 3OAWA 2JF5A 2AEHA 2HD5B 2IBIB 4II2B 2L7RA 2WX0A 2WYQA 2ASQA 4W9LA 3L17A 2MSED 4ZRIA 3PSEB 3IHPC 2BYEA 3TL5A 4PS8A 4E71A 3DVNV 1LQBA 2K6QA 4X57B 5J17A 3MTNB 1OEYJ 1I35A 2KNBA 3QCAA 2KDEB 3QC8B 2IO0B 3QIJA 3DQVA 2L3ZA 4HCPB 2LGXA 3ZTCA 3KUCB 3KUDB 1EF1A 2C60A 4K1RB 4KVGB 4ANUA 1YD8U 4A3PA 3NZUA 4KSKC 1WGYA 3PV1A 4FLHA 3QA8A 4F1SA 4FULA 2XEWA 4HVBA 4CO7A 4DK5A 1JRUA 4GDKA 3H9DA 4EOYA 2HTHA 1U4AA 3QAQA 4HDOA 4NJ6A 2KLGA 5J2RA 3WIMA 2PJHA 2HJ8A 2L76A 3DBHI 2J0KA 3HK0A 5KHQA 3KW5B 3IBEA 4WJQA 2JY6A 3DCGA 4KDIC 4KIKA 4W9IA 4DDGD 3A9KA 2ZZPB 3AU4A 1L2NA 2ZVOA 2N7EA 4GDLA 2GBMA 3OJ4B 2KLCA 3ZNHB 1E8YA 3CSTA 3R66C 2G4SA 2MP2A 2KFKA 3ZRCA 1V81A 3VH3B 3VXWA 4PYUA 3ZO5B 4DXAB 5KHOA 1V2YA 4IUMB 2BPSA 4IWOA 4A20A 4KV2A 2G45B 2J0MA 1WF9A 3C0RB 1C1YB 1WZ3A 3IG3A 4ZYNA 5LLIA 2CKHB 2KWUB 2PEAA 3R7QA 2O6VD 4GDKB 4RMAA 3VTUA 2A5UA 1PQSA 4JGHB 4WWPA 4HK2A 3U8ZA 3TMPB 4IWQA 3PT2B 1BT0A 2N9XA 2LJ5A 1E7UA 3RUIB 2KWCA 2A4ZA 5CTRC 3RZFA 1UD7A 2ZPYA 5C23A 1GNUA 1WXMA 1RRBA 2AL6A 5L83A 3KYCD 2DHZA 1NI2A 1XT9B 2LXCA 3DBSA 4G50A 4PS3A 2FIDA 2GMIC 4P7IA 4CHKA 2LVPA 4AP4C 4K81A 2MBQA 2LVOA 3APFA 1EUVB 3IFWB 4NQKE 4WWNA 2KDFB 3DPDA 3WALA 2LUEA 2XK5A 2CHXA 4HXDA 1V6EA 4ICVA 3W1SC 4AJWA 3TCAA 3NY5A 3MJWA 5JHAA 2C9WB 2KMAA 2RR9A 2CHWA 4ZRKA 2Y5BB 5IAAC 1CMXB 5IA7A 4PYZA 2FCSA 5EDSA 4KDLB 2ZNVB 3A33B 1NDDA 2N7DA 1WJNA 2KDIA 1WJUA 3MHSD 4MJSA 3T9LA 4XC2A 4DBGA 2AYOB 1R4NI 1GC6A 1RAXA 1WFYA 4WJOA 3JYUA 2D2QA 3LDZE 4G11A 4IWPA 2JZ3B 3JVZX 1J0GA 1TGZB 3H7PB 2XK5B 3QHTA 3R3MA 4KZ0A 3GOEA 4W9KA 2V4LA 4HDQA 2J7QB 1WM2A 2M17A 2DX5B 3KUZA 4IW0A 3VTWA 4NPNA 2NPTB 4FJVB 3A4RA 3QK0A 2KTFA 2GBNA 4FJYA 2D07B 2IO3B 2UYZB 3PHWB 3U30A 1WH3A 2BWFA 2NPTA 1LXDA 1WXSA 1UH6A 2L0TA 3WA0A 4BVUC 3QARA 2K6DB 1R4MI 1IP9A 3K9PB 5AEKB 1E8WA 4JIOU 1WZ0A 1YIWA 3LJ3A 3DVGX 4EFOA 2JZZA 1GC7A 4FA6A 4MJSB 2C7NB 4FN2A 3EFUA 3ZRFA 5DPRA 4MGZE 3H6NA 2K8HA 3V61A 2MBHA 3V6EB 4BOSC 4F8CB 1EO6A 3PHXB 4GXBA 4RM8A 3HM3A 2EKEC 2MBBB 3DDCB 3ZKJC 2O2VA 3ONSA 3PVLA 4ANXA 5HKHA 2LD9A 5DPTA 4BBNC 4BOZB 1WXAA 3NHEB 2MW5A 4HJKA 1V5TA 2K8CA 4MELA 4G3XB 2MRPA 1YX5B 2K1FA 2MBOA 2Z0EB 4KIKB 2IY1B 4TV3A 4A3OA 4W9DA 3QQ8B 1D3ZA 5AZGA 2MLBA 4IM2A 1KOTA 4DHJB 4TUUA 5CHFA 2MBEA 2Z59B 3PRMB 1YQBA 1QZEA 2K8BA 5DPWA 1TTNA 4GSWA 2LXAA 2JUOA 4LDTD 2DZKA 1J8CA 2WWZA 5FR6A 2BF8B 2FUHB 2NCNA 5CX3A 2FCMA 1A5RA 3X0WA 4JL9A 4WWOA 2UWQA 1WGGA 5CHVC 4W9CA 3UINB 5G55A 3OLMD 2LI5A 5G2NA 2DYBA 3TIXA 2KXJA 2YLMA 3CMMB 4M0WB 4JQWC 1I42A 4EEWA 1V9JA 2WDTB 3DVNU 3ZIMA 3V6CB 2KFKB 5DPSA 2MP2B 2GBJA 1Z5SB 4KSLC 1YJ1A 2M1MA 4GDLB 3RZWC 3ZVVA 4BKGA 1WRDB 2IZVB 5AZHA 2HE7A 2R2OA 2IO1B 1Q1OA 1V49A 4F7ZA 3PLVA 3UIPB 3M3JA 1ZKHA 2RGFA 3NOBA 2JT4B 5JH5C 2KMCA 1WGHA 3ZLZA 2CR5A 3VFKA 3DBLI 2Z0DB 4FADA 2RSUA 1S3SG 2AWTA 4B6WA 3ZNID 2C5LC 3ENEA 2NBVB 1AARA 1M94A 3VAWA 5C1ZA 4YL8A 3ZNGC 3L0WB 4MGIE 1WIAA 3RCZA 1C3TA 3AU5A 4TQ1A 1UZXB 3S2AA 3JW0X 2KX3A 2MQJA 2BKRB 1KLVA 3UQAA 2D10A 2MX2A 3K9OB 3V62A 4M8NA 3T8MA 5LXIB 2FCNA 2ZJDA 3H7SA 2JXXA 3DVGY 5E6NA 1ZGUB 2C7HA 2KWVB 2V3SA 1XQQA 2PPHA 5JZEB 3RD2A 4AJYB 2FIFA 4LJPB 3PS6A 2IY0B 3RT3B 1WX9A 4WJPA 4WJNA 3V60A 4ANVA 1V80A 4B9KA 5AZFA 3H7PA 2KC1A 4EUTA 1SIFA 3PGEA 2L0FA 4J6IA 4N9F4 3APCA 4MGKE 2NBWB 3EECA 1LM8B 2BGFA 2IO2B 4I6PA 3Q3JA 2OOBB 3EHVA 4MGYE 2G3QB 3VUXA 3PREA 1E8ZA 2NR2A 4DHJD 4NAWB 3ECIA 1KM7A 2LWPA 2KTRB 3N30A 3WAMA 2ZCCA 3UF8A 2B3AA 4MDKE 3H1UA 2BYFA 2L05A 4OVUA 4W9HA 2LASA 1XD3B 2LRUA 3N32A 1H8CA 5GMVA 3VH4B 2O6VB 1HE8A 3U7DA 2KOXA 2KANA 1WMHB 1IYFA 3HHMA 2KD0A 2XBBC 4MH0E 4BBNF 1KJTA 1UGMA 3VQIA 3TBLD 4GGQA 1MG8A 2YVCA 1WJ6A 4HWIB 2DZJA 2EMTA 2KZRA 4LCDE 1TZ1A 3NS8A 1WX7A 5D94A 1K8RB 1L7YA 1ISNA 2N1VA 3PLUA 5BO4B 1TBEA 3BY4B 1V86A 2LGYA 4E74A 4BFRA 4WAAA 3X23A 5E6PA 3B0AA 3NZSA 1ZW7A 1Y8RC 2L00B 2CHZA 2LZ6A 1UBQA 2CU1A 2O6VA 3QX1A 1V5OA 3A9KB 4TQ0A 4LDTB 1WX8A 3ML9A 4I6LB 3KYDD 1P1AA 3I3TB 1WM3A 3QJZA 3SHQA 3ZDTA 3D32A 1E8XA 3AXCA 4W9JA 1LFDA 3A9JA 3BINA 2JPHA 3AI5A 4K7UA 1H4RA 4IM0A 4MSMB 2OJRA 2M0XA 4IM3A 3N3KB 4AWJA 2R2QA 4PS7A 3PTFC 3UQBA 3ML8A 3DBRI 2FCQA 3CF6E 3UIOB 2ZCBA 3GZNI 1GJZA 1WJ4A 4OVVA 3PZDA 1J19A 4K7SA 2DYOA 5CHWA 2NS5A 5TR5A 2KJRA 2N1WA 4GN1A 2KJ6A 2KJHB 2AL3A 2KDBA 2MA9B 4II3B 4GB9A 3OJ3A 3UGBB 2KO3A 1G6JA 4URKA 3WANA 3JSVA 2WX1A 3EC8A 3L08A 2I1KA 2RD0A 3A4SC 3M63B 1WE7A 2M8SA 4MM3A 1WGRA 2KC2A 1WE6A 1GUAB 2KHWB 3W1YA 2JRIB 4ANWA 4FBJB 4FHJA 2RPQA 4G0NB 2MCNB 3A1QB 5LXHA 4DHZB 1WR6E 3VUYA 3VTVA 1S1QB 2KKCA 4B95A 1VD2A 4DWFA 3A1QA 4WQOB 1E7VA 1Z2MA 3A9JB 3HIZA 4TKNA 1WR1A 4NY0A 4DHZE 2LGDA 2GBKA 1WI0A 2PE6B 2N9EB 3JSVB 4HCNB 2DENB 4W9EA 2I1JA 3AULA 5E6OA 2M4NA 4EKUA 3B1LX 1Q5WB 1WY8A 4AUQC 5D7GA 4NNJB 1YX6B 3Q3FA 1X1MA 1RLFA 3ZUNA 1UELA 3L10B 4NJ7A 3PPAA 4GIVA 2JRHA 3WAOA 4ZDVA 2LRWA 3VDZA 1OTRB 1SE9A 2ZEQA 3PRPB 4BKSD 2W9NA 3TJPA 4FJZA 3VUWA 1Q0WB 4W9GA 1OQYA 2ZPNA 1NBFC 4BKTA 4NQLB 1P9DU 2LVQA 4HPMB 3M95A 2C7MB 4K7WA 3P2BA 3W1SA 1WYWB 4XZ4A 1P0RA 2PE9A 1E90A 2VRRB 3SU8X 2D11A 4DDID 3ZDMC 3ZW3A 2KQ7A 2REXA 2EMSA 2ZNVC 4ASWC 3SD5A 2K25A 2O2VB 1RFAA 5DCNA 5JHBA 5D6JB 2N9PC 3KH0A 4FHKA 3RULA 4W9FA 4NAWA 1OEYA 3APDA 2BWES 3HM6X
chains in the Genus database with same CATH superfamily
3CSFA 3O65B 4XX5A 3M62B 3N1XC 2J0JA 2NVUI 2WXFA 3IVFA 2KX0A 2D3GA 2GBRA 2BKFA 2HTME 4ITKA 2N4FA 4HROA 4CQNA 2DZMA 3Q8BA 4K3BA 2FUG1 3BWUD 4E3CA 3ZNZB 2G4DB 1GG3A 3TEWA 2L8JA 1TYGB 3R2IA 4LNFA 2KN5A 1E5WA 2K3UA 1KLUD 2KTRA 1C77A 2DAFA 3RNBC 1F52A 4HPLB 4RM9A 1EF5A 3R7RA 4IC7B 1WXVA 3SDLC 2TSSA 2FE8A 2QC8A 2AEHA 2HD5B 2L7RA 2ASQA 1E9MA 5BMHA 3B2GA 2BYEA 3DVNV 2K6QA 4OVZA 2KDEB 2L3ZA 2J4XA 1PUTA 3AEDB 1F2RC 1WGYA 1XCTL 2W3SA 1KLGD 3DBHB 1JRUA 4RF1A 4DXFA 4NJ6A 2HJ8A 1SE3A 2J0KA 5KHQA 1N63A 4KDIC 4QAYA 4KIKA 1QOGA 4W9IA 3OG5A 2N7EA 3AM9A 3R66C 2IDYA 2MP2A 3L4PA 3ZRCA 4PYUA 4DXAB 4MH8A 4IWOA 4A20A 2WXNA 2J0MA 2WS3B 1WZ3A 2PEAA 1MG4A 4GDKB 3VTUA 4WWPA 4HK2A 3RUIB 3AEAB 5CTRC 5L83A 3KYCD 2LXCA 3AEBB 2GMIC 4P7IA 1SJED 2CJNA 1SBBB 4K81A 3APFA 3IFWB 1HTQA 4ICVA 4AJWA 3TCAA 3BIID 2E6XA 5JHAA 5H8YE 2C9WB 4ZRKA 5IAAC 2FCSA 4KKIA 4KDLB 4MJSA 1TZOA 1D6EC 3MHSD 4HJGE 4XC2A 1TJEA 1TS4A 4WJOA 4IKGA 2W3RA 2JZ3B 1J0GA 2RMMA 1TGZB 1FNVA 2V4LA 2HJ1A 4IW0A 4MT5A 3EUB2 2GBNA 2IO3B 1F1HA 2D3AA 2KACA 4K3CA 1IP9A 1D4BA 4S17A 3Q6BA 4EFOA 1MPEA 2K8HA 1WWTA 4GXBA 1ZUD2 3ONSA 3IAS1 5DPTA 2WU5B 3NHEB 2GB1A 4HJKA 1GB4A 4G3XB 2MRPA 4KIKB 1YN5A 2L52A 4B0MA 4TV3A 4PT5A 4TUUA 2MBEA 5DPWA 2JUOA 4OZAA 1J8CA 1XCQL 2BF8B 5FR6A 1QF6A 4WWOA 1WGGA 1VRAB 1NEKB 3TIXA 3Q8EA 1NI3A 2KFKB 2MP2B 4FXCA 4KSLC 1UF0A 2IZVB 2HE7A 1TIFA 2NTSA 1V49A 3PLVA 3RFZB 1ZKHA 2NMQA 4XDDA 1XO3A 2KT7A 2JYTA 4A55A 2WDVB 2AWTA 1TT5B 1AARA 5C1ZA 4YL8A 2QDFA 4XWTA 1UZXB 2EELA 1R4NB 2V3SA 1FEHA 1RM6C 4LJPB 3RT3B 1SE4A 4EUTA 2W55A 4N9F4 4MGKE 3EECA 1QT9A 2IO2B 3Q3JA 1QOBA 1L0VB 3PREA 1RWSA 4NAWB 3I63C 1WSPA 2KTRB 3GB1A 3N1YC 2LEKA 3DBRB 3H1UA 2BYFA 2L05A 1HZ6A 4OVUA 3AE1B 2QCZA 4LTUA 3N32A 1H8CA 2O6VB 1HE8A 2KOXA 4RGMA 1XF5L 4N59A 4C4VB 1TKEA 1A70A 5BYRA 3HHMA 4BBNF 1JCKB 1UGMA 3TBLD 2YVCA 4MACA 1WJ6A 2KZRA 1K8RB 1XXGA 3PLUA 3BY4B 1V86A 2LGYA 2WXOA 1GB1A 4BFRA 5IO9A 2ONQA 3NZSA 1ZW7A 2L00B 2BYTA 3QX1A 1V5OA 4TQ0A 4LDTB 4JWSC 3V3XA 1P1AA 1LO5D 3DWMA 3AXCA 2BW2A 1WXQA 1H4RA 4IM0A 1WRIA 5EE0A 2OJRA 2M0XA 3AEFB 4AWJA 2R2QA 3KWLA 1UWXA 2FCQA 5HFYA 4C7YA 2IGGA 4RNAA 1GJZA 3DBLB 5CHWA 2NS5A 4ARCA 5TR5A 2N1WA 3NVZA 2KQ4X 2AL3A 2KDBA 3MFGA 4KGSA 2WX1A 3L08A 4YTMB 2I1KA 2AQ2B 2QMTA 2KHWB 1GUAB 1IGCA 4ANWA 1PGAA 5D3IB 2SAKA 4G0NB 1K51A 4KX6B 1WR6E 3TEXA 2L1AA 4DWFA 1Z2MA 1WR1A 1PGXA 2LGDA 2GBKA 2PE6B 1N61A 2DENB 3AULA 2DWQA 4WURA 5E6OA 4EKUA 2WDQB 1K52A 5D7GA 1YX6B 3Q3FA 3MC0B 1OTRB 4BKSD 2WGSA 3W2DA 1OQYA 2ZPNA 4NQLB 1P9DU 4HPMB 2MHJA 2PE9A 2D11A 3NVYA 4DDID 3GE3C 2REXA 2EMSA 4P6VF 3MC8A 2K25A 5EE3A 3KH0A 2KYWA 2KQSA 1STEA 4EZKA 3B08A 4A9AA 4LJOB 2KFJA 4CYEA 1VCBA 2QHOA 2HDEA 2FAZA 2QILA 3NVVA 5L95C 1HQRD 2BYVE 1P98A 3KVFB 2NBUA 1OGWA 5J18A 3L54A 2KVRA 2G9HD 5JXVA 1TKGA 1XLPA 1RFKA 2BVCA 2JF5A 4II2B 2M56B 2WYQA 1N60A 4MM3B 2BB6A 4ZRIA 2OEDA 4E71A 4HPPA 5J17A 1LQBA 4C80A 1FFVA 3HVDA 1I35A 3QCAA 4BZAA 1KH0A 1ZDVA 3N1ZC 2IO0B 2ICIA 2LGXA 1EF1A 2GLSA 4K1RB 3ZJVA 4ANUA 4P1CC 3NZUA 3PV1A 5BMGA 5IOIA 1V1PA 5GXGB 2VZKD 4CO7A 4DK5A 4YSYB 2HTHA 3QAQA 4HDOA 3C8YA 2KLGA 4P1BC 3BZDB 3HK0A 2XNAC 2JY6A 3DCGA 3Q8CA 1E0ZA 3A9KA 2ZZPB 1UGJA 3AU4A 1L2NA 5FKAC 3OJ4B 3FC4A 3CSTA 2G4SA 2KFKA 3VRAB 5IP4D 3URYA 3GE8C 3NUHB 2G45B 3C0RB 1T3QA 3HVZA 4US8A 3J9CA 2QJLA 3R7QA 2O6VD 4RMAA 2A5UA 1PQSA 2PVOD 1V1PB 1Y56A 1E7UA 2KWCA 3BYYB 4DXGA 5C23A 1WXMA 2DHZA 2MJDA 3DBSA 2YEPB 4PS3A 2PVGC 2WU2B 3Q14C 4CHKA 1EUVB 4WWNA 2V3NA 2LUEA 2CHXA 1V6EA 3DHHC 3MJWA 3AEEB 1ACCA 4YTNB 2KMAA 2V3PA 2Y5BB 1HZ5A 5EDSA 1EM7A 1VLBA 3A33B 2KDIA 1WFYA 2D2QA 4G11A 4IWPA 3JVZX 2XK5B 3GOEA 4HDQA 2J7QB 3BVZA 4R3DA 2DX5B 3KUZA 3VTWA 1NYRA 1JWAD 1GOZA 1VZ6A 2WXGA 2UYZB 3PHWB 2NPTA 1LXDA 1WXSA 1UH6A 4BVUC 2JX5A 4B0EA 4RGNA 3K9PB 3PO0A 4JIOU 4FA6A 4MJSB 2C7NB 3ZRFA 3AB5A 3H6NA 3V61A 4F8CB 1EO6A 1JWUD 3PHXB 2N0SB 5HKHA 2O2VA 2ACZB 1WXAA 1TY0A 3Q3MC 2K8CA 2K1FA 2MBOA 2OHFA 2IY1B 4W9DA 2G1EA 1D3ZA 5CHFA 1N5XA 2Z59B 3PRMB 1YQBA 1QZEA 2PLPA 4LNKA 1ESFA 2CU3A 2FCMA 1A5RA 2LGIA 2UWQA 3UINB 1KFYB 5G2NA 2DYBA 4O1NA 2KXJA 2YLMA 3CMMB 4M0WB 4JQWC 2WDTB 3DVNU 4US9A 5DPSA 1IBXA 1WRDB 1EU3A 1E7PB 3UIPB 3M3JA 2RGFA 3NOBA 2LJIA 1WGHA 2D3BA 3ZLZA 2CR5A 2Z0DB 1F2RI 4OZCA 2RSUA 4WIPA 2NBVB 4XDCA 3VAWA 4JPSA 2Z8LA 3L0WB 4WH4A 3S2AA 3E56A 2KX3A 1YOVB 2MQJA 3AH7A 3K9OB 2MX2A 2WHIA 3DVGY 1ZXIA 1XQQA 2PPHA 5FK9C 3PS6A 2IY0B 2EKIA 4WJNA 2KC1A 2L0FA 3APCA 1V8CA 4I6PA 2G3QB 1BXTA 1E8ZA 2NR2A 3Q2AC 1ZP0B 3WAMA 4XWWA 3UF8A 1IGDA 3T3OA 2LRUA 1OFFA 3U7DA 1WMHB 4UDUC 4YSXB 1L4DB 4MH0E 1AW7A 1I4QA 1MG8A 3NS8A 1WX7A 1B9RA 3SFDB 1L7YA 1ISNA 2INNE 3AE2B 4LK0M 1VJKA 3VR9B 1Y8RC 2VZKB 2H88B 2CHZA 2LZ6A 1UBQA 2CU1A 2INPE 3A9KB 4XGAB 3MC9A 3ML9A 3KYDD 3SHQA 3D32A 2MEKA 3AI5A 4K7UA 4PS7A 3PTFC 4HEA1 3DBRI 4AQ7A 3HUIA 4ZHPA 3CF6E 1NYQA 2INCC 3UIOB 2BS4B 1FCLA 1WJ4A 1HEZE 1EWYC 2E3TA 1YJJA 1VDVA 4K7SA 2DYOA 2KJRA 4GN1A 2R61A 2MA9B 4II3B 3GS2A 1SF0A 3IT4B 3JSVA 1I4PA 4YT0B 1D5MC 4MM3A 1FM0D 1R7SA 2M8SA 3A4SC 1WE6A 1L0XB 5LXHA 2RPQA 2B76B 1QOAA 1FPYA 1TS3A 3AV8A 3VTVA 1GPXA 1S1QB 4B95A 2OJWA 3A1QA 4WQOB 1QQRA 3A9JB 1I4XA 3HIZA 4D2KA 2JYEA 4HCNB 1J7AA 3SEBA 2I1JA 5D3DA 2M4NA 1ET9A 3B1LX 3R8BA 2LGSA 1WY8A 3N9YC 1AN8A 3BVMA 1X1MA 3ZUNA 3GP7A 3L10B 4NJ7A 3ZYYX 1N62A 2ZEQA 2W9NA 2VH2A 3TJPA 5HHDG 4W9GA 5AUIA 3MJ5A 2K5PA 2LVQA 3VR8B 2C7MB 4K7WA 3P2BA 3W1SA 2N9KA 1E90A 5FR3A 4M00A 2VRRB 3P4RB 4YTPB 3SU8X 3C19A 3ZDMC 2J52A 2JU6X 2ZNVC 3R2TA 3SD5A 2O2VB 5D6JB 2N9PC 4FHKA 3RULA 4FADA 3HM6X 3SR6A 1F9JA 2JWZA 4ICUA 3VHTC 2W54A 4WQMA 4JWUC 3KLSX 4AOFA 4EZJA 3RNAC 1YJIA 1F77A 1P3QU 4GOCA 2GOWA 4BKSA 4GU2A 2ZVNA 3VVWB 1WGDA 4ZRJA 4Q2JA 3ALBA 1SGHA 5D2MB 1YN3A 4C7ZA 1UBIA 1T0YA 4JLCA 4KZCA 4IG7B 1N6ZA 2QEJC 3OAWA 2IBIB 1FXIA 2WP9B 3ZQ4A 3H8HA 4RCOA 2MSED 2CJOA 3PSEB 3IHPC 4PS8A 3MTNB 3VRBB 5TSSA 3QC8B 3QIJA 3DQVA 4N6EB 4HCPB 4M0WA 3ZTCA 3AE7B 3KUCB 4KVGB 3ZGZA 1YD8U 1XLQA 1PDXA 4A3PA 4KSKC 4FLHA 2BS3B 4F1SA 4FULA 5LNK1 3AEGB 3H9DA 5BMIA 1TY2A 1U4AA 5J2RA 3DHIC 3WIMA 1FNWA 4RFBA 3IBEA 4WJQA 4DDGD 1FRDA 2KAJA 4GDLA 2GBMA 2KLCA 3ZNHB 1E8YA 2D3CA 4P16A 3RNEC 3VXWA 3ZO5B 2BT6A 5KHOA 3Q8AA 4IUMB 5T8IA 2LHDA 1ENFA 3IG3A 4ZYNA 5LLIA 3LXFA 2KWUB 4JGHB 3TMPB 3PT2B 2LJ5A 2WXHA 1YQ4B 2A4ZA 3RZFA 2ZPYA 2D5GA 1RRBA 2AL6A 2PTLA 1NI2A 1XT9B 4G50A 2FIDA 2WXQA 1JQ4A 4NQKE 2MBQA 3Q3NC 3DPDA 3WALA 2CHWA 5IA7A 1CMXB 3U4EG 4RGOS 2ZNVB 3T9LA 1WJNA 2N7DA 4DBGA 2AYOB 1UWMA 1R4NI 1GC6A 4RF0A 1MFWA 5IN7A 3R3MA 1SB3C 4KZ0A 4W9KA 1WM2A 1VZ8A 4FJVB 2KTFA 4OW0A 4FJYA 1N5WA 2WXRA 1WH3A 2BWFA 3E9SA 5AEKB 1Q10A 2IPKD 1WZ0A 1YIWA 3LJ3A 2JWUA 2JZZA 1GC7A 1PFDA 4FN2A 1SSNA 3V6EB 4BOSC 2MBHA 3HM3A 4DQOC 3B9JA 2EKEC 2MBBB 3DDCB 3ZKJC 4ANXA 2ZW1A 4LLGM 2DLBA 1SE2A 1V5TA 5AUKA 4NAMA 4LNIA 1ROEA 3RPFC 2Z0EB 5BYSA 2GI9A 4A3OA 2WXKA 5AZGA 2MLBA 3LB8C 1C4AA 4NJCA 5G5GA 3TEYA 1SEBD 4LDTD 2FUHB 5CX3A 4JL9A 3OLMD 1JW9D 4USAA 3AMZA 4EEWA 1V9JA 3V6CB 1JMLA 4GDLB 2M1MA 3ZVVA 1WGKA 3RZWC 4BKGA 1XLOA 5AZHA 2R2OA 1Q1OA 1KF6B 1L6UA 1FO4A 2JT4B 2RDHA 2KMCA 1LGRA 3RN9C 2X38A 4B6WA 2C5LC 3RCZA 1C3TA 3AU5A 1MVKA 3JW0X 4M02A 2BKRB 1KLVA 3UQAA 2D10A 1ZOYB 3T8MA 1QILA 3P4QB 2JXXA 5E6NA 1ZGUB 2KWVB 5JZEB 3RD2A 1L6VA 2FIFA 3V60A 4WJPA 4RGTA 1UNSA 4B9KA 4ZYSA 5AZFA 3H7PA 3RNFC 1E6EB 5HG2A 2J53A 3HRDD 3MHZA 1JALA 2BGFA 3MP9A 2OOBB 3EHVA 4MGYE 3VUXA 4DHJD 2IGHA 1FD6A 1KM7A 2LWPA 3AE4B 3N30A 3BVGA 2B3AA 2I2YA 2W82A 2LASA 1XD3B 5GMVA 2QIEB 3VH4B 1I4HA 1SXTA 2JXTA 2KANA 2ON8A 1XEEA 3P4PB 2EMTA 3RNGC 4LCDE 5D94A 3FILA 2QSDA 1TBEA 4E74A 4YXDB 1T0RC 5E6PA 5G5HA 3B0AA 2O6VA 2WLBA 2WQYB 1WX8A 4I6LB 3NS1A 3I3TB 1M4VA 1E8XA 3A9JA 3BINA 1TS5A 2JPHA 5E6JA 2LMCA 3N3KB 2MJ3A 3Q69A 4IM3A 3UQBA 3ML8A 3T3NA 1CJEA 2ZCBA 3GZNI 3IXSA 3FKYA 3PZDA 1J19A 5MPOA 2WXIA 1QKZA 2KJHB 4URKA 3WANA 2BB5A 4XE0A 4ZHOA 3M63B 2BTEA 2KC2A 3W1YA 2JRIB 4H2AA 2N9LA 3I5JC 5HI1A 2YEPF 3EGRA 1KTKA 1E7VA 1F0ZA 3W9CB 4ZRQA 3JSVB 2N9EB 4W9EA 2KMMA 4C56C 3ZXVA 3DWGC 3RNCC 1UELA 3PPAA 3OWEB 4GIVA 3WAOA 4ZDVA 2LRWA 3ZXRA 2WNMA 4JE3B 3PZ8A 4YWGG 1D5XC 1RYJA 1FNUA 1Q0WB 1JRPA 1FFUA 3V05A 1D5ZC 2Y5PA 4C4VA 1WYWB 1WYGA 1P0RA 2L83A 4A8XC 1MI0A 2PMVA 5H92C 2KQ7A 3ZW3A 1T5XD 1BMLC 5JHBA 1RFAA 1NENB 4WWMA 4W9FA 5IKCM 2WXMA 4NAWA 1OEYA 2BWES 3O13A 4MSQB 2KK8A 3ZTDA 2DZIA 2IYDB 1IPGA 2V1YA 3PRZA 2K39A 4HKZE 4EZLA 2CS4A 2MWSB 3QWZB 3EFCA 3WAPA 3DOWA 1V1OA 2JVCA 1WMHA 4HLEA 3L13A 4S0RA 3L16A 3P63A 4MEMA 1JROA 2NTTA 4GMVA 3RYTA 1MHXA 1R4MB 2WDRB 1EU4A 5BYQA 2FNJB 1FXTB 2DYMA 1K53A 3Q3OC 4I6NB 4M8MA 3I9V1 4ZRPA 2DAJA 2RDBC 1QOFA 1DOYA 4A6QA 2WX0A 4KKJA 4W9LA 3L17A 1T0SC 4KGTA 3TL5A 3BK1A 4X57B 3P42A 3GZNB 2FBWB 1OEYJ 2KNBA 1IBXB 1YNTE 1QLBB 3Q8FA 2RPVA 3KUDB 1NVID 1P7EA 2C60A 2AQ3B 5C2TB 3QA8A 2XEWA 5EE9A 4RH6A 4HVBA 4GDKA 4EOYA 3N20C 2X8XX 3RMKC 1YMHE 1I7HA 1SIJA 2L76A 2PJHA 2Q5WD 3DBHI 3BYTB 1AYFA 3KW5B 1FIQA 1VR9A 2ZVOA 2I38A 3AE6B 1V81A 2RDGA 3VH3B 2J42A 3IAM1 2IGDA 1FRRA 1V2YA 2BPSA 4KV2A 1WF9A 3ZJTA 2Y3AA 1C1YB 1JWSD 3FILB 1C78A 4C00A 4OHJA 3U8ZA 4IWQA 1BT0A 2N9XA 3IT6B 4BAXA 2JQRB 1SJHD 1C79A 1ZDXA 1UD7A 1GNUA 2H89B 4KGRA 4REZA 4LNNA 3W5UB 2LVPA 4AP4C 2LVOA 2KDFB 2Y5CA 2XK5A 4HXDA 3W1SC 1K50A 3NY5A 1KRHA 4L2YA 2RR9A 3I57A 4PYZA 2PW9A 4BBNC 1NDDA 3NVWA 2LUMA 1WJUA 1RAXA 3JYUA 4TSSA 3LDZE 3H7PB 2INDC 3QHTA 4HKQA 2BQQA 2M17A 3NJTA 3PZ7A 4L1BA 4NPNA 2NPTB 4XYCA 3A4RA 3QK0A 2D07B 3AE5B 3U30A 4IDIA 4HRSA 2L0TA 3WA0A 1ZXHA 2IJ0A 3QARA 2K6DB 1R4MI 2KWDA 1E8WA 3DVGX 4L23A 3EFUA 1L5PA 5DPRA 4MGZE 1OQQA 1V97A 1J7BA 4RM8A 2AX5A 3PVLA 1ZPSA 2LD9A 3P1MA 4BOZB 1CK1A 1P7FA 2MW5A 1PYWD 4MELA 1YX5B 1ZE3D 3QQ8B 3FAHA 4IM2A 1KOTA 4DHJB 2BBCA 2K9XA 2K8BA 1TTNA 4GSWA 2LXAA 4ACFA 2DZKA 2UU7A 2K22A 2WWZA 2NCNA 4LNOA 1I4GA 3X0WA 4WAFA 5CHVC 4W9CA 5G55A 2LI5A 2PKOA 1I42A 4ARIA 3ZJUA 3ZIMA 2DBYA 1FCCC 4ZOHC 1PGBA 2GBJA 3UI3A 1Z5SB 2AQ1B 1YJ1A 4AS1A 2IO1B 1EWCA 4F7ZA 3NRZA 5JH5C 3VFKA 3DBLI 1S3SG 4OZBA 3ZNID 3ENEA 1BUIC 1M94A 3ZNGC 2V0GA 4MGIE 1WIAA 4A90A 3AE8B 2LHEA 1I4RA 4TQ1A 3BK2A 3SFEB 3V62A 4M8NA 5LXIB 2FCNA 2ZJDA 3H7SA 2C7HA 3TUOA 3NG0A 1AWDA 2V4IB 1TS2A 4AJYB 2GRIA 1C4PA 1C4CA 1WX9A 2SEBD 3NZ3A 4ANVA 1V80A 1XLNA 2VH1A 1SIFA 3PGEA 4J6IA 2NBWB 1LM8B 3U2SC 1DYQA 2V9HA 4YSZB 2LFIA 3KQ4A 3TEZA 3ECIA 3AE3B 2JSVX 2BS2B 1HA5A 2ZCCA 4MDKE 4PK1A 4W9HA 2KVZA 3P4SB 1L4ZB 4J3OD 3LYYA 1YN4A 1IYFA 4TMAB 1T6BX 2KD0A 2XBBC 1KJTA 3VQIA 1HTOA 4GGQA 5I4DA 4HWIB 2DZJA 3U7ZA 5C3JB 1TZ1A 3ETRA 1ET6A 2N1VA 2WXPA 1C76A 5BO4B 1L0YB 3KWVA 2JZPA 4WAAA 3X23A 3AN1A 1HXYD 2MJEA 3CWIA 1WM3A 3QJZA 3ZDTA 3CIRB 4W9JA 1LFDA 1T0QC 2XN9C 2PIAA 4MSMB 3B2FA 1JWMD 2K0PA 5EE1A 4OVVA 1J7CA 2ZW0A 3RI7C 3TSSA 2WXLA 2L32A 2KJ6A 1YQ3B 4GB9A 3OJ3A 1DOXA 3UGBB 2KO3A 1G6JA 2MH7A 1B1ZA 3EC8A 2RD0A 1DGJA 2WXJA 1WE7A 1WGRA 4IOIE 3W5VB 4FBJB 4FHJA 1IUEA 2MCNB 1CQVA 3A1QB 2KN4A 4DHZB 1E10A 3VUYA 2KKCA 1VD2A 4TKNA 4NY0A 4DHZE 2N7JA 1WI0A 4M01A 4GLSC 1Q5WB 1FXAA 1JWBD 4AUQC 4NNJB 1GAQB 1RLFA 2JRHA 4EE2A 3AE9B 2M19A 3VDZA 1SE9A 3WCQA 3PRPB 4NZLB 4N58A 4FJZA 3VUWA 3U52E 3ABVB 1MHHE 1NBFC 2DNFA 4BKTA 1UUPA 3M95A 3EA6A 3DHGC 4XZ4A 1FMAD 1C9FA 1VZ7A 3AECB 1MJDA 4ASWC 1DOIA 5DCNA 1CZPA 1OQRA 4JX1C 1TKYA 2KDMA 2M0AA 3APDA 2CKHB
chains in the Genus database with same CATH topology
4MSQB 2KQSA 3CSFA 3O65B 2KK8A 1F9JA 3M62B 2J0JA 4XX5A 3ZTDA 2JWZA 2NVUI 3IVFA 2DZIA 4ICUA 3VHTC 2IYDB 2KX0A 2D3GA 4EZKA 3B08A 2GBRA 1IPGA 2V1YA 3PRZA 2K39A 4EZLA 4LJOB 2CS4A 2MWSB 2KFJA 4AOFA 3QWZB 2BKFA 4EZJA 3WAPA 3DOWA 2N4FA 2JVCA 2DZMA 1P3QU 1WMHA 4HLEA 3L13A 4GOCA 4CYEA 1VCBA 2QHOA 2GOWA 4E3CA 3ZNZB 2G4DB 2FAZA 2ZVNA 3L16A 1GG3A 4GU2A 2L8JA 4BKSA 5L95C 4MEMA 4GMVA 2BYVE 1P98A 3KVFB 3RYTA 3VVWB 2KN5A 2NBUA 1E5WA 1OGWA 1WGDA 2FNJB 5J18A 1FXTB 4ZRJA 2KTRA 2DYMA 3L54A 3ALBA 1SGHA 4I6NB 2DAFA 2KVRA 4M8MA 5D2MB 4HPLB 4RM9A 1EF5A 3R7RA 1UBIA 2DAJA 1T0YA 4IC7B 4JLCA 4KZCA 4IG7B 1WXVA 3SDLC 3OAWA 2JF5A 2AEHA 2HD5B 2IBIB 4II2B 2L7RA 2WX0A 2WYQA 2ASQA 4W9LA 3L17A 2MSED 4ZRIA 3PSEB 3IHPC 2BYEA 3TL5A 4PS8A 4E71A 3DVNV 1LQBA 2K6QA 4X57B 5J17A 3MTNB 1OEYJ 1I35A 2KNBA 3QCAA 2KDEB 3QC8B 2IO0B 3QIJA 3DQVA 2L3ZA 4HCPB 2LGXA 3ZTCA 3KUCB 3KUDB 1EF1A 2C60A 4K1RB 4KVGB 4ANUA 1YD8U 4A3PA 3NZUA 4KSKC 1WGYA 3PV1A 4FLHA 3QA8A 4F1SA 4FULA 2XEWA 4HVBA 4CO7A 4DK5A 1JRUA 4GDKA 3H9DA 4EOYA 2HTHA 1U4AA 3QAQA 4HDOA 4NJ6A 2KLGA 5J2RA 3WIMA 2PJHA 2HJ8A 2L76A 3DBHI 2J0KA 3HK0A 5KHQA 3KW5B 3IBEA 4WJQA 2JY6A 3DCGA 4KDIC 4KIKA 4W9IA 4DDGD 3A9KA 2ZZPB 3AU4A 1L2NA 2ZVOA 2N7EA 4GDLA 2GBMA 3OJ4B 2KLCA 3ZNHB 1E8YA 3CSTA 3R66C 2G4SA 2MP2A 2KFKA 3ZRCA 1V81A 3VH3B 3VXWA 4PYUA 3ZO5B 4DXAB 5KHOA 1V2YA 4IUMB 2BPSA 4IWOA 4A20A 4KV2A 2G45B 2J0MA 1WF9A 3C0RB 1C1YB 1WZ3A 3IG3A 4ZYNA 5LLIA 2CKHB 2KWUB 2PEAA 3R7QA 2O6VD 4GDKB 4RMAA 3VTUA 2A5UA 1PQSA 4JGHB 4WWPA 4HK2A 3U8ZA 3TMPB 4IWQA 3PT2B 1BT0A 2N9XA 2LJ5A 1E7UA 3RUIB 2KWCA 2A4ZA 5CTRC 3RZFA 1UD7A 2ZPYA 5C23A 1GNUA 1WXMA 1RRBA 2AL6A 5L83A 3KYCD 2DHZA 1NI2A 1XT9B 2LXCA 3DBSA 4G50A 4PS3A 2FIDA 2GMIC 4P7IA 4CHKA 2LVPA 4AP4C 4K81A 2MBQA 2LVOA 3APFA 1EUVB 3IFWB 4NQKE 4WWNA 2KDFB 3DPDA 3WALA 2LUEA 2XK5A 2CHXA 4HXDA 1V6EA 4ICVA 3W1SC 4AJWA 3TCAA 3NY5A 3MJWA 5JHAA 2C9WB 2KMAA 2RR9A 2CHWA 4ZRKA 2Y5BB 5IAAC 1CMXB 5IA7A 4PYZA 2FCSA 5EDSA 4KDLB 2ZNVB 3A33B 1NDDA 2N7DA 1WJNA 2KDIA 1WJUA 3MHSD 4MJSA 3T9LA 4XC2A 4DBGA 2AYOB 1R4NI 1GC6A 1RAXA 1WFYA 4WJOA 3JYUA 2D2QA 3LDZE 4G11A 4IWPA 2JZ3B 3JVZX 1J0GA 1TGZB 3H7PB 2XK5B 3QHTA 3R3MA 4KZ0A 3GOEA 4W9KA 2V4LA 4HDQA 2J7QB 1WM2A 2M17A 2DX5B 3KUZA 4IW0A 3VTWA 4NPNA 2NPTB 4FJVB 3A4RA 3QK0A 2KTFA 2GBNA 4FJYA 2D07B 2IO3B 2UYZB 3PHWB 3U30A 1WH3A 2BWFA 2NPTA 1LXDA 1WXSA 1UH6A 2L0TA 3WA0A 4BVUC 3QARA 2K6DB 1R4MI 1IP9A 3K9PB 5AEKB 1E8WA 4JIOU 1WZ0A 1YIWA 3LJ3A 3DVGX 4EFOA 2JZZA 1GC7A 4FA6A 4MJSB 2C7NB 4FN2A 3EFUA 3ZRFA 5DPRA 4MGZE 3H6NA 2K8HA 3V61A 2MBHA 3V6EB 4BOSC 4F8CB 1EO6A 3PHXB 4GXBA 4RM8A 3HM3A 2EKEC 2MBBB 3DDCB 3ZKJC 2O2VA 3ONSA 3PVLA 4ANXA 5HKHA 2LD9A 5DPTA 4BBNC 4BOZB 1WXAA 3NHEB 2MW5A 4HJKA 1V5TA 2K8CA 4MELA 4G3XB 2MRPA 1YX5B 2K1FA 2MBOA 2Z0EB 4KIKB 2IY1B 4TV3A 4A3OA 4W9DA 3QQ8B 1D3ZA 5AZGA 2MLBA 4IM2A 1KOTA 4DHJB 4TUUA 5CHFA 2MBEA 2Z59B 3PRMB 1YQBA 1QZEA 2K8BA 5DPWA 1TTNA 4GSWA 2LXAA 2JUOA 4LDTD 2DZKA 1J8CA 2WWZA 5FR6A 2BF8B 2FUHB 2NCNA 5CX3A 2FCMA 1A5RA 3X0WA 4JL9A 4WWOA 2UWQA 1WGGA 5CHVC 4W9CA 3UINB 5G55A 3OLMD 2LI5A 5G2NA 2DYBA 3TIXA 2KXJA 2YLMA 3CMMB 4M0WB 4JQWC 1I42A 4EEWA 1V9JA 2WDTB 3DVNU 3ZIMA 3V6CB 2KFKB 5DPSA 2MP2B 2GBJA 1Z5SB 4KSLC 1YJ1A 2M1MA 4GDLB 3RZWC 3ZVVA 4BKGA 1WRDB 2IZVB 5AZHA 2HE7A 2R2OA 2IO1B 1Q1OA 1V49A 4F7ZA 3PLVA 3UIPB 3M3JA 1ZKHA 2RGFA 3NOBA 2JT4B 5JH5C 2KMCA 1WGHA 3ZLZA 2CR5A 3VFKA 3DBLI 2Z0DB 4FADA 2RSUA 1S3SG 2AWTA 4B6WA 3ZNID 2C5LC 3ENEA 2NBVB 1AARA 1M94A 3VAWA 5C1ZA 4YL8A 3ZNGC 3L0WB 4MGIE 1WIAA 3RCZA 1C3TA 3AU5A 4TQ1A 1UZXB 3S2AA 3JW0X 2KX3A 2MQJA 2BKRB 1KLVA 3UQAA 2D10A 2MX2A 3K9OB 3V62A 4M8NA 3T8MA 5LXIB 2FCNA 2ZJDA 3H7SA 2JXXA 3DVGY 5E6NA 1ZGUB 2C7HA 2KWVB 2V3SA 1XQQA 2PPHA 5JZEB 3RD2A 4AJYB 2FIFA 4LJPB 3PS6A 2IY0B 3RT3B 1WX9A 4WJPA 4WJNA 3V60A 4ANVA 1V80A 4B9KA 5AZFA 3H7PA 2KC1A 4EUTA 1SIFA 3PGEA 2L0FA 4J6IA 4N9F4 3APCA 4MGKE 2NBWB 3EECA 1LM8B 2BGFA 2IO2B 4I6PA 3Q3JA 2OOBB 3EHVA 4MGYE 2G3QB 3VUXA 3PREA 1E8ZA 2NR2A 4DHJD 4NAWB 3ECIA 1KM7A 2LWPA 2KTRB 3N30A 3WAMA 2ZCCA 3UF8A 2B3AA 4MDKE 3H1UA 2BYFA 2L05A 4OVUA 4W9HA 2LASA 1XD3B 2LRUA 3N32A 1H8CA 5GMVA 3VH4B 2O6VB 1HE8A 3U7DA 2KOXA 2KANA 1WMHB 1IYFA 3HHMA 2KD0A 2XBBC 4MH0E 4BBNF 1KJTA 1UGMA 3VQIA 3TBLD 4GGQA 1MG8A 2YVCA 1WJ6A 4HWIB 2DZJA 2EMTA 2KZRA 4LCDE 1TZ1A 3NS8A 1WX7A 5D94A 1K8RB 1L7YA 1ISNA 2N1VA 3PLUA 5BO4B 1TBEA 3BY4B 1V86A 2LGYA 4E74A 4BFRA 4WAAA 3X23A 5E6PA 3B0AA 3NZSA 1ZW7A 1Y8RC 2L00B 2CHZA 2LZ6A 1UBQA 2CU1A 2O6VA 3QX1A 1V5OA 3A9KB 4TQ0A 4LDTB 1WX8A 3ML9A 4I6LB 3KYDD 1P1AA 3I3TB 1WM3A 3QJZA 3SHQA 3ZDTA 3D32A 1E8XA 3AXCA 4W9JA 1LFDA 3A9JA 3BINA 2JPHA 3AI5A 4K7UA 1H4RA 4IM0A 4MSMB 2OJRA 2M0XA 4IM3A 3N3KB 4AWJA 2R2QA 4PS7A 3PTFC 3UQBA 3ML8A 3DBRI 2FCQA 3CF6E 3UIOB 2ZCBA 3GZNI 1GJZA 1WJ4A 4OVVA 3PZDA 1J19A 4K7SA 2DYOA 5CHWA 2NS5A 5TR5A 2KJRA 2N1WA 4GN1A 2KJ6A 2KJHB 2AL3A 2KDBA 2MA9B 4II3B 4GB9A 3OJ3A 3UGBB 2KO3A 1G6JA 4URKA 3WANA 3JSVA 2WX1A 3EC8A 3L08A 2I1KA 2RD0A 3A4SC 3M63B 1WE7A 2M8SA 4MM3A 1WGRA 2KC2A 1WE6A 1GUAB 2KHWB 3W1YA 2JRIB 4ANWA 4FBJB 4FHJA 2RPQA 4G0NB 2MCNB 3A1QB 5LXHA 4DHZB 1WR6E 3VUYA 3VTVA 1S1QB 2KKCA 4B95A 1VD2A 4DWFA 3A1QA 4WQOB 1E7VA 1Z2MA 3A9JB 3HIZA 4TKNA 1WR1A 4NY0A 4DHZE 2LGDA 2GBKA 1WI0A 2PE6B 2N9EB 3JSVB 4HCNB 2DENB 4W9EA 2I1JA 3AULA 5E6OA 2M4NA 4EKUA 3B1LX 1Q5WB 1WY8A 4AUQC 5D7GA 4NNJB 1YX6B 3Q3FA 1X1MA 1RLFA 3ZUNA 1UELA 3L10B 4NJ7A 3PPAA 4GIVA 2JRHA 3WAOA 4ZDVA 2LRWA 3VDZA 1OTRB 1SE9A 2ZEQA 3PRPB 4BKSD 2W9NA 3TJPA 4FJZA 3VUWA 1Q0WB 4W9GA 1OQYA 2ZPNA 1NBFC 4BKTA 4NQLB 1P9DU 2LVQA 4HPMB 3M95A 2C7MB 4K7WA 3P2BA 3W1SA 1WYWB 4XZ4A 1P0RA 2PE9A 1E90A 2VRRB 3SU8X 2D11A 4DDID 3ZDMC 3ZW3A 2KQ7A 2REXA 2EMSA 2ZNVC 4ASWC 3SD5A 2K25A 2O2VB 1RFAA 5DCNA 5JHBA 5D6JB 2N9PC 3KH0A 4FHKA 3RULA 4W9FA 4NAWA 1OEYA 3APDA 2BWES 3HM6X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MSQ B;  2KQS A;  3CSF A;  3O65 B;  2KK8 A;  1F9J A;  3M62 B;  2J0J A;  4XX5 A;  3ZTD A;  2JWZ A;  2NVU I;  3IVF A;  2DZI A;  4ICU A;  3VHT C;  2IYD B;  2KX0 A;  2D3G A;  4EZK A;  3B08 A;  2GBR A;  1IPG A;  2V1Y A;  3PRZ A;  2K39 A;  4EZL A;  4LJO B;  2CS4 A;  2MWS B;  2KFJ A;  4AOF A;  3QWZ B;  2BKF A;  4EZJ A;  3WAP A;  3DOW A;  2N4F A;  2JVC A;  2DZM A;  1P3Q U;  1WMH A;  4HLE A;  3L13 A;  4GOC A;  4CYE A;  1VCB A;  2QHO A;  2GOW A;  4E3C A;  3ZNZ B;  2G4D B;  2FAZ A;  2ZVN A;  3L16 A;  1GG3 A;  4GU2 A;  2L8J A;  4BKS A;  5L95 C;  4MEM A;  4GMV A;  2BYV E;  1P98 A;  3KVF B;  3RYT A;  3VVW B;  2KN5 A;  2NBU A;  1E5W A;  1OGW A;  1WGD A;  2FNJ B;  5J18 A;  1FXT B;  4ZRJ A;  2KTR A;  2DYM A;  3L54 A;  3ALB A;  1SGH A;  4I6N B;  2DAF A;  2KVR A;  4M8M A;  5D2M B;  4HPL B;  4RM9 A;  1EF5 A;  3R7R A;  1UBI A;  2DAJ A;  1T0Y A;  4IC7 B;  4JLC A;  4KZC A;  4IG7 B;  1WXV A;  3SDL C;  3OAW A;  2JF5 A;  2AEH A;  2HD5 B;  2IBI B;  4II2 B;  2L7R A;  2WX0 A;  2WYQ A;  2ASQ A;  4W9L A;  3L17 A;  2MSE D;  4ZRI A;  3PSE B;  3IHP C;  2BYE A;  3TL5 A;  4PS8 A;  4E71 A;  3DVN V;  1LQB A;  2K6Q A;  4X57 B;  5J17 A;  3MTN B;  1OEY J;  1I35 A;  2KNB A;  3QCA A;  2KDE B;  3QC8 B;  2IO0 B;  3QIJ A;  3DQV A;  2L3Z A;  4HCP B;  2LGX A;  3ZTC A;  3KUC B;  3KUD B;  1EF1 A;  2C60 A;  4K1R B;  4KVG B;  4ANU A;  1YD8 U;  4A3P A;  3NZU A;  4KSK C;  1WGY A;  3PV1 A;  4FLH A;  3QA8 A;  4F1S A;  4FUL A;  2XEW A;  4HVB A;  4CO7 A;  4DK5 A;  1JRU A;  4GDK A;  3H9D A;  4EOY A;  2HTH A;  1U4A A;  3QAQ A;  4HDO A;  4NJ6 A;  2KLG A;  5J2R A;  3WIM A;  2PJH A;  2HJ8 A;  2L76 A;  3DBH I;  2J0K A;  3HK0 A;  5KHQ A;  3KW5 B;  3IBE A;  4WJQ A;  2JY6 A;  3DCG A;  4KDI C;  4KIK A;  4W9I A;  4DDG D;  3A9K A;  2ZZP B;  3AU4 A;  1L2N A;  2ZVO A;  2N7E A;  4GDL A;  2GBM A;  3OJ4 B;  2KLC A;  3ZNH B;  1E8Y A;  3CST A;  3R66 C;  2G4S A;  2MP2 A;  2KFK A;  3ZRC A;  1V81 A;  3VH3 B;  3VXW A;  4PYU A;  3ZO5 B;  4DXA B;  5KHO A;  1V2Y A;  4IUM B;  2BPS A;  4IWO A;  4A20 A;  4KV2 A;  2G45 B;  2J0M A;  1WF9 A;  3C0R B;  1C1Y B;  1WZ3 A;  3IG3 A;  4ZYN A;  5LLI A;  2CKH B;  2KWU B;  2PEA A;  3R7Q A;  2O6V D;  4GDK B;  4RMA A;  3VTU A;  2A5U A;  1PQS A;  4JGH B;  4WWP A;  4HK2 A;  3U8Z A;  3TMP B;  4IWQ A;  3PT2 B;  1BT0 A;  2N9X A;  2LJ5 A;  1E7U A;  3RUI B;  2KWC A;  2A4Z A;  5CTR C;  3RZF A;  1UD7 A;  2ZPY A;  5C23 A;  1GNU A;  1WXM A;  1RRB A;  2AL6 A;  5L83 A;  3KYC D;  2DHZ A;  1NI2 A;  1XT9 B;  2LXC A;  3DBS A;  4G50 A;  4PS3 A;  2FID A;  2GMI C;  4P7I A;  4CHK A;  2LVP A;  4AP4 C;  4K81 A;  2MBQ A;  2LVO A;  3APF A;  1EUV B;  3IFW B;  4NQK E;  4WWN A;  2KDF B;  3DPD A;  3WAL A;  2LUE A;  2XK5 A;  2CHX A;  4HXD A;  1V6E A;  4ICV A;  3W1S C;  4AJW A;  3TCA A;  3NY5 A;  3MJW A;  5JHA A;  2C9W B;  2KMA A;  2RR9 A;  2CHW A;  4ZRK A;  2Y5B B;  5IAA C;  1CMX B;  5IA7 A;  4PYZ A;  2FCS A;  5EDS A;  4KDL B;  2ZNV B;  3A33 B;  1NDD A;  2N7D A;  1WJN A;  2KDI A;  1WJU A;  3MHS D;  4MJS A;  3T9L A;  4XC2 A;  4DBG A;  2AYO B;  1R4N I;  1GC6 A;  1RAX A;  1WFY A;  4WJO A;  3JYU A;  2D2Q A;  3LDZ E;  4G11 A;  4IWP A;  2JZ3 B;  3JVZ X;  1J0G A;  1TGZ B;  3H7P B;  2XK5 B;  3QHT A;  3R3M A;  4KZ0 A;  3GOE A;  4W9K A;  2V4L A;  4HDQ A;  2J7Q B;  1WM2 A;  2M17 A;  2DX5 B;  3KUZ A;  4IW0 A;  3VTW A;  4NPN A;  2NPT B;  4FJV B;  3A4R A;  3QK0 A;  2KTF A;  2GBN A;  4FJY A;  2D07 B;  2IO3 B;  2UYZ B;  3PHW B;  3U30 A;  1WH3 A;  2BWF A;  2NPT A;  1LXD A;  1WXS A;  1UH6 A;  2L0T A;  3WA0 A;  4BVU C;  3QAR A;  2K6D B;  1R4M I;  1IP9 A;  3K9P B;  5AEK B;  1E8W A;  4JIO U;  1WZ0 A;  1YIW A;  3LJ3 A;  3DVG X;  4EFO A;  2JZZ A;  1GC7 A;  4FA6 A;  4MJS B;  2C7N B;  4FN2 A;  3EFU A;  3ZRF A;  5DPR A;  4MGZ E;  3H6N A;  2K8H A;  3V61 A;  2MBH A;  3V6E B;  4BOS C;  4F8C B;  1EO6 A;  3PHX B;  4GXB A;  4RM8 A;  3HM3 A;  2EKE C;  2MBB B;  3DDC B;  3ZKJ C;  2O2V A;  3ONS A;  3PVL A;  4ANX A;  5HKH A;  2LD9 A;  5DPT A;  4BBN C;  4BOZ B;  1WXA A;  3NHE B;  2MW5 A;  4HJK A;  1V5T A;  2K8C A;  4MEL A;  4G3X B;  2MRP A;  1YX5 B;  2K1F A;  2MBO A;  2Z0E B;  4KIK B;  2IY1 B;  4TV3 A;  4A3O A;  4W9D A;  3QQ8 B;  1D3Z A;  5AZG A;  2MLB A;  4IM2 A;  1KOT A;  4DHJ B;  4TUU A;  5CHF A;  2MBE A;  2Z59 B;  3PRM B;  1YQB A;  1QZE A;  2K8B A;  5DPW A;  1TTN A;  4GSW A;  2LXA A;  2JUO A;  4LDT D;  2DZK A;  1J8C A;  2WWZ A;  5FR6 A;  2BF8 B;  2FUH B;  2NCN A;  5CX3 A;  2FCM A;  1A5R A;  3X0W A;  4JL9 A;  4WWO A;  2UWQ A;  1WGG A;  5CHV C;  4W9C A;  3UIN B;  5G55 A;  3OLM D;  2LI5 A;  5G2N A;  2DYB A;  3TIX A;  2KXJ A;  2YLM A;  3CMM B;  4M0W B;  4JQW C;  1I42 A;  4EEW A;  1V9J A;  2WDT B;  3DVN U;  3ZIM A;  3V6C B;  2KFK B;  5DPS A;  2MP2 B;  2GBJ A;  1Z5S B;  4KSL C;  1YJ1 A;  2M1M A;  4GDL B;  3RZW C;  3ZVV A;  4BKG A;  1WRD B;  2IZV B;  5AZH A;  2HE7 A;  2R2O A;  2IO1 B;  1Q1O A;  1V49 A;  4F7Z A;  3PLV A;  3UIP B;  3M3J A;  1ZKH A;  2RGF A;  3NOB A;  2JT4 B;  5JH5 C;  2KMC A;  1WGH A;  3ZLZ A;  2CR5 A;  3VFK A;  3DBL I;  2Z0D B;  4FAD A;  2RSU A;  1S3S G;  2AWT A;  4B6W A;  3ZNI D;  2C5L C;  3ENE A;  2NBV B;  1AAR A;  1M94 A;  3VAW A;  5C1Z A;  4YL8 A;  3ZNG C;  3L0W B;  4MGI E;  1WIA A;  3RCZ A;  1C3T A;  3AU5 A;  4TQ1 A;  1UZX B;  3S2A A;  3JW0 X;  2KX3 A;  2MQJ A;  2BKR B;  1KLV A;  3UQA A;  2D10 A;  2MX2 A;  3K9O B;  3V62 A;  4M8N A;  3T8M A;  5LXI B;  2FCN A;  2ZJD A;  3H7S A;  2JXX A;  3DVG Y;  5E6N A;  1ZGU B;  2C7H A;  2KWV B;  2V3S A;  1XQQ A;  2PPH A;  5JZE B;  3RD2 A;  4AJY B;  2FIF A;  4LJP B;  3PS6 A;  2IY0 B;  3RT3 B;  1WX9 A;  4WJP A;  4WJN A;  3V60 A;  4ANV A;  1V80 A;  4B9K A;  5AZF A;  3H7P A;  2KC1 A;  4EUT A;  1SIF A;  3PGE A;  2L0F A;  4J6I A;  4N9F 4;  3APC A;  4MGK E;  2NBW B;  3EEC A;  1LM8 B;  2BGF A;  2IO2 B;  4I6P A;  3Q3J A;  2OOB B;  3EHV A;  4MGY E;  2G3Q B;  3VUX A;  3PRE A;  1E8Z A;  2NR2 A;  4DHJ D;  4NAW B;  3ECI A;  1KM7 A;  2LWP A;  2KTR B;  3N30 A;  3WAM A;  2ZCC A;  3UF8 A;  2B3A A;  4MDK E;  3H1U A;  2BYF A;  2L05 A;  4OVU A;  4W9H A;  2LAS A;  1XD3 B;  2LRU A;  3N32 A;  1H8C A;  5GMV A;  3VH4 B;  2O6V B;  1HE8 A;  3U7D A;  2KOX A;  2KAN A;  1WMH B;  1IYF A;  3HHM A;  2KD0 A;  2XBB C;  4MH0 E;  4BBN F;  1KJT A;  1UGM A;  3VQI A;  3TBL D;  4GGQ A;  1MG8 A;  2YVC A;  1WJ6 A;  4HWI B;  2DZJ A;  2EMT A;  2KZR A;  4LCD E;  1TZ1 A;  3NS8 A;  1WX7 A;  5D94 A;  1K8R B;  1L7Y A;  1ISN A;  2N1V A;  3PLU A;  5BO4 B;  1TBE A;  3BY4 B;  1V86 A;  2LGY A;  4E74 A;  4BFR A;  4WAA A;  3X23 A;  5E6P A;  3B0A A;  3NZS A;  1ZW7 A;  1Y8R C;  2L00 B;  2CHZ A;  2LZ6 A;  1UBQ A;  2CU1 A;  2O6V A;  3QX1 A;  1V5O A;  3A9K B;  4TQ0 A;  4LDT B;  1WX8 A;  3ML9 A;  4I6L B;  3KYD D;  1P1A A;  3I3T B;  1WM3 A;  3QJZ A;  3SHQ A;  3ZDT A;  3D32 A;  1E8X A;  3AXC A;  4W9J A;  1LFD A;  3A9J A;  3BIN A;  2JPH A;  3AI5 A;  4K7U A;  1H4R A;  4IM0 A;  4MSM B;  2OJR A;  2M0X A;  4IM3 A;  3N3K B;  4AWJ A;  2R2Q A;  4PS7 A;  3PTF C;  3UQB A;  3ML8 A;  3DBR I;  2FCQ A;  3CF6 E;  3UIO B;  2ZCB A;  3GZN I;  1GJZ A;  1WJ4 A;  4OVV A;  3PZD A;  1J19 A;  4K7S A;  2DYO A;  5CHW A;  2NS5 A;  5TR5 A;  2KJR A;  2N1W A;  4GN1 A;  2KJ6 A;  2KJH B;  2AL3 A;  2KDB A;  2MA9 B;  4II3 B;  4GB9 A;  3OJ3 A;  3UGB B;  2KO3 A;  1G6J A;  4URK A;  3WAN A;  3JSV A;  2WX1 A;  3EC8 A;  3L08 A;  2I1K A;  2RD0 A;  3A4S C;  3M63 B;  1WE7 A;  2M8S A;  4MM3 A;  1WGR A;  2KC2 A;  1WE6 A;  1GUA B;  2KHW B;  3W1Y A;  2JRI B;  4ANW A;  4FBJ B;  4FHJ A;  2RPQ A;  4G0N B;  2MCN B;  3A1Q B;  5LXH A;  4DHZ B;  1WR6 E;  3VUY A;  3VTV A;  1S1Q B;  2KKC A;  4B95 A;  1VD2 A;  4DWF A;  3A1Q A;  4WQO B;  1E7V A;  1Z2M A;  3A9J B;  3HIZ A;  4TKN A;  1WR1 A;  4NY0 A;  4DHZ E;  2LGD A;  2GBK A;  1WI0 A;  2PE6 B;  2N9E B;  3JSV B;  4HCN B;  2DEN B;  4W9E A;  2I1J A;  3AUL A;  5E6O A;  2M4N A;  4EKU A;  3B1L X;  1Q5W B;  1WY8 A;  4AUQ C;  5D7G A;  4NNJ B;  1YX6 B;  3Q3F A;  1X1M A;  1RLF A;  3ZUN A;  1UEL A;  3L10 B;  4NJ7 A;  3PPA A;  4GIV A;  2JRH A;  3WAO A;  4ZDV A;  2LRW A;  3VDZ A;  1OTR B;  1SE9 A;  2ZEQ A;  3PRP B;  4BKS D;  2W9N A;  3TJP A;  4FJZ A;  3VUW A;  1Q0W B;  4W9G A;  1OQY A;  2ZPN A;  1NBF C;  4BKT A;  4NQL B;  1P9D U;  2LVQ A;  4HPM B;  3M95 A;  2C7M B;  4K7W A;  3P2B A;  3W1S A;  1WYW B;  4XZ4 A;  1P0R A;  2PE9 A;  1E90 A;  2VRR B;  3SU8 X;  2D11 A;  4DDI D;  3ZDM C;  3ZW3 A;  2KQ7 A;  2REX A;  2EMS A;  2ZNV C;  4ASW C;  3SD5 A;  2K25 A;  2O2V B;  1RFA A;  5DCN A;  5JHB A;  5D6J B;  2N9P C;  3KH0 A;  4FHK A;  3RUL A;  4W9F A;  4NAW A;  1OEY A;  3APD A;  2BWE S;  3HM6 X; 
#chains in the Genus database with same CATH topology
 3CSF A;  3O65 B;  4XX5 A;  3M62 B;  3N1X C;  2J0J A;  2NVU I;  2WXF A;  3IVF A;  2KX0 A;  2D3G A;  2GBR A;  2BKF A;  2HTM E;  4ITK A;  2N4F A;  4HRO A;  4CQN A;  2DZM A;  3Q8B A;  4K3B A;  2FUG 1;  3BWU D;  4E3C A;  3ZNZ B;  2G4D B;  1GG3 A;  3TEW A;  2L8J A;  1TYG B;  3R2I A;  4LNF A;  2KN5 A;  1E5W A;  2K3U A;  1KLU D;  2KTR A;  1C77 A;  2DAF A;  3RNB C;  1F52 A;  4HPL B;  4RM9 A;  1EF5 A;  3R7R A;  4IC7 B;  1WXV A;  3SDL C;  2TSS A;  2FE8 A;  2QC8 A;  2AEH A;  2HD5 B;  2L7R A;  2ASQ A;  1E9M A;  5BMH A;  3B2G A;  2BYE A;  3DVN V;  2K6Q A;  4OVZ A;  2KDE B;  2L3Z A;  2J4X A;  1PUT A;  3AED B;  1F2R C;  1WGY A;  1XCT L;  2W3S A;  1KLG D;  3DBH B;  1JRU A;  4RF1 A;  4DXF A;  4NJ6 A;  2HJ8 A;  1SE3 A;  2J0K A;  5KHQ A;  1N63 A;  4KDI C;  4QAY A;  4KIK A;  1QOG A;  4W9I A;  3OG5 A;  2N7E A;  3AM9 A;  3R66 C;  2IDY A;  2MP2 A;  3L4P A;  3ZRC A;  4PYU A;  4DXA B;  4MH8 A;  4IWO A;  4A20 A;  2WXN A;  2J0M A;  2WS3 B;  1WZ3 A;  2PEA A;  1MG4 A;  4GDK B;  3VTU A;  4WWP A;  4HK2 A;  3RUI B;  3AEA B;  5CTR C;  5L83 A;  3KYC D;  2LXC A;  3AEB B;  2GMI C;  4P7I A;  1SJE D;  2CJN A;  1SBB B;  4K81 A;  3APF A;  3IFW B;  1HTQ A;  4ICV A;  4AJW A;  3TCA A;  3BII D;  2E6X A;  5JHA A;  5H8Y E;  2C9W B;  4ZRK A;  5IAA C;  2FCS A;  4KKI A;  4KDL B;  4MJS A;  1TZO A;  1D6E C;  3MHS D;  4HJG E;  4XC2 A;  1TJE A;  1TS4 A;  4WJO A;  4IKG A;  2W3R A;  2JZ3 B;  1J0G A;  2RMM A;  1TGZ B;  1FNV A;  2V4L A;  2HJ1 A;  4IW0 A;  4MT5 A;  3EUB 2;  2GBN A;  2IO3 B;  1F1H A;  2D3A A;  2KAC A;  4K3C A;  1IP9 A;  1D4B A;  4S17 A;  3Q6B A;  4EFO A;  1MPE A;  2K8H A;  1WWT A;  4GXB A;  1ZUD 2;  3ONS A;  3IAS 1;  5DPT A;  2WU5 B;  3NHE B;  2GB1 A;  4HJK A;  1GB4 A;  4G3X B;  2MRP A;  4KIK B;  1YN5 A;  2L52 A;  4B0M A;  4TV3 A;  4PT5 A;  4TUU A;  2MBE A;  5DPW A;  2JUO A;  4OZA A;  1J8C A;  1XCQ L;  2BF8 B;  5FR6 A;  1QF6 A;  4WWO A;  1WGG A;  1VRA B;  1NEK B;  3TIX A;  3Q8E A;  1NI3 A;  2KFK B;  2MP2 B;  4FXC A;  4KSL C;  1UF0 A;  2IZV B;  2HE7 A;  1TIF A;  2NTS A;  1V49 A;  3PLV A;  3RFZ B;  1ZKH A;  2NMQ A;  4XDD A;  1XO3 A;  2KT7 A;  2JYT A;  4A55 A;  2WDV B;  2AWT A;  1TT5 B;  1AAR A;  5C1Z A;  4YL8 A;  2QDF A;  4XWT A;  1UZX B;  2EEL A;  1R4N B;  2V3S A;  1FEH A;  1RM6 C;  4LJP B;  3RT3 B;  1SE4 A;  4EUT A;  2W55 A;  4N9F 4;  4MGK E;  3EEC A;  1QT9 A;  2IO2 B;  3Q3J A;  1QOB A;  1L0V B;  3PRE A;  1RWS A;  4NAW B;  3I63 C;  1WSP A;  2KTR B;  3GB1 A;  3N1Y C;  2LEK A;  3DBR B;  3H1U A;  2BYF A;  2L05 A;  1HZ6 A;  4OVU A;  3AE1 B;  2QCZ A;  4LTU A;  3N32 A;  1H8C A;  2O6V B;  1HE8 A;  2KOX A;  4RGM A;  1XF5 L;  4N59 A;  4C4V B;  1TKE A;  1A70 A;  5BYR A;  3HHM A;  4BBN F;  1JCK B;  1UGM A;  3TBL D;  2YVC A;  4MAC A;  1WJ6 A;  2KZR A;  1K8R B;  1XXG A;  3PLU A;  3BY4 B;  1V86 A;  2LGY A;  2WXO A;  1GB1 A;  4BFR A;  5IO9 A;  2ONQ A;  3NZS A;  1ZW7 A;  2L00 B;  2BYT A;  3QX1 A;  1V5O A;  4TQ0 A;  4LDT B;  4JWS C;  3V3X A;  1P1A A;  1LO5 D;  3DWM A;  3AXC A;  2BW2 A;  1WXQ A;  1H4R A;  4IM0 A;  1WRI A;  5EE0 A;  2OJR A;  2M0X A;  3AEF B;  4AWJ A;  2R2Q A;  3KWL A;  1UWX A;  2FCQ A;  5HFY A;  4C7Y A;  2IGG A;  4RNA A;  1GJZ A;  3DBL B;  5CHW A;  2NS5 A;  4ARC A;  5TR5 A;  2N1W A;  3NVZ A;  2KQ4 X;  2AL3 A;  2KDB A;  3MFG A;  4KGS A;  2WX1 A;  3L08 A;  4YTM B;  2I1K A;  2AQ2 B;  2QMT A;  2KHW B;  1GUA B;  1IGC A;  4ANW A;  1PGA A;  5D3I B;  2SAK A;  4G0N B;  1K51 A;  4KX6 B;  1WR6 E;  3TEX A;  2L1A A;  4DWF A;  1Z2M A;  1WR1 A;  1PGX A;  2LGD A;  2GBK A;  2PE6 B;  1N61 A;  2DEN B;  3AUL A;  2DWQ A;  4WUR A;  5E6O A;  4EKU A;  2WDQ B;  1K52 A;  5D7G A;  1YX6 B;  3Q3F A;  3MC0 B;  1OTR B;  4BKS D;  2WGS A;  3W2D A;  1OQY A;  2ZPN A;  4NQL B;  1P9D U;  4HPM B;  2MHJ A;  2PE9 A;  2D11 A;  3NVY A;  4DDI D;  3GE3 C;  2REX A;  2EMS A;  4P6V F;  3MC8 A;  2K25 A;  5EE3 A;  3KH0 A;  2KYW A;  2KQS A;  1STE A;  4EZK A;  3B08 A;  4A9A A;  4LJO B;  2KFJ A;  4CYE A;  1VCB A;  2QHO A;  2HDE A;  2FAZ A;  2QIL A;  3NVV A;  5L95 C;  1HQR D;  2BYV E;  1P98 A;  3KVF B;  2NBU A;  1OGW A;  5J18 A;  3L54 A;  2KVR A;  2G9H D;  5JXV A;  1TKG A;  1XLP A;  1RFK A;  2BVC A;  2JF5 A;  4II2 B;  2M56 B;  2WYQ A;  1N60 A;  4MM3 B;  2BB6 A;  4ZRI A;  2OED A;  4E71 A;  4HPP A;  5J17 A;  1LQB A;  4C80 A;  1FFV A;  3HVD A;  1I35 A;  3QCA A;  4BZA A;  1KH0 A;  1ZDV A;  3N1Z C;  2IO0 B;  2ICI A;  2LGX A;  1EF1 A;  2GLS A;  4K1R B;  3ZJV A;  4ANU A;  4P1C C;  3NZU A;  3PV1 A;  5BMG A;  5IOI A;  1V1P A;  5GXG B;  2VZK D;  4CO7 A;  4DK5 A;  4YSY B;  2HTH A;  3QAQ A;  4HDO A;  3C8Y A;  2KLG A;  4P1B C;  3BZD B;  3HK0 A;  2XNA C;  2JY6 A;  3DCG A;  3Q8C A;  1E0Z A;  3A9K A;  2ZZP B;  1UGJ A;  3AU4 A;  1L2N A;  5FKA C;  3OJ4 B;  3FC4 A;  3CST A;  2G4S A;  2KFK A;  3VRA B;  5IP4 D;  3URY A;  3GE8 C;  3NUH B;  2G45 B;  3C0R B;  1T3Q A;  3HVZ A;  4US8 A;  3J9C A;  2QJL A;  3R7Q A;  2O6V D;  4RMA A;  2A5U A;  1PQS A;  2PVO D;  1V1P B;  1Y56 A;  1E7U A;  2KWC A;  3BYY B;  4DXG A;  5C23 A;  1WXM A;  2DHZ A;  2MJD A;  3DBS A;  2YEP B;  4PS3 A;  2PVG C;  2WU2 B;  3Q14 C;  4CHK A;  1EUV B;  4WWN A;  2V3N A;  2LUE A;  2CHX A;  1V6E A;  3DHH C;  3MJW A;  3AEE B;  1ACC A;  4YTN B;  2KMA A;  2V3P A;  2Y5B B;  1HZ5 A;  5EDS A;  1EM7 A;  1VLB A;  3A33 B;  2KDI A;  1WFY A;  2D2Q A;  4G11 A;  4IWP A;  3JVZ X;  2XK5 B;  3GOE A;  4HDQ A;  2J7Q B;  3BVZ A;  4R3D A;  2DX5 B;  3KUZ A;  3VTW A;  1NYR A;  1JWA D;  1GOZ A;  1VZ6 A;  2WXG A;  2UYZ B;  3PHW B;  2NPT A;  1LXD A;  1WXS A;  1UH6 A;  4BVU C;  2JX5 A;  4B0E A;  4RGN A;  3K9P B;  3PO0 A;  4JIO U;  4FA6 A;  4MJS B;  2C7N B;  3ZRF A;  3AB5 A;  3H6N A;  3V61 A;  4F8C B;  1EO6 A;  1JWU D;  3PHX B;  2N0S B;  5HKH A;  2O2V A;  2ACZ B;  1WXA A;  1TY0 A;  3Q3M C;  2K8C A;  2K1F A;  2MBO A;  2OHF A;  2IY1 B;  4W9D A;  2G1E A;  1D3Z A;  5CHF A;  1N5X A;  2Z59 B;  3PRM B;  1YQB A;  1QZE A;  2PLP A;  4LNK A;  1ESF A;  2CU3 A;  2FCM A;  1A5R A;  2LGI A;  2UWQ A;  3UIN B;  1KFY B;  5G2N A;  2DYB A;  4O1N A;  2KXJ A;  2YLM A;  3CMM B;  4M0W B;  4JQW C;  2WDT B;  3DVN U;  4US9 A;  5DPS A;  1IBX A;  1WRD B;  1EU3 A;  1E7P B;  3UIP B;  3M3J A;  2RGF A;  3NOB A;  2LJI A;  1WGH A;  2D3B A;  3ZLZ A;  2CR5 A;  2Z0D B;  1F2R I;  4OZC A;  2RSU A;  4WIP A;  2NBV B;  4XDC A;  3VAW A;  4JPS A;  2Z8L A;  3L0W B;  4WH4 A;  3S2A A;  3E56 A;  2KX3 A;  1YOV B;  2MQJ A;  3AH7 A;  3K9O B;  2MX2 A;  2WHI A;  3DVG Y;  1ZXI A;  1XQQ A;  2PPH A;  5FK9 C;  3PS6 A;  2IY0 B;  2EKI A;  4WJN A;  2KC1 A;  2L0F A;  3APC A;  1V8C A;  4I6P A;  2G3Q B;  1BXT A;  1E8Z A;  2NR2 A;  3Q2A C;  1ZP0 B;  3WAM A;  4XWW A;  3UF8 A;  1IGD A;  3T3O A;  2LRU A;  1OFF A;  3U7D A;  1WMH B;  4UDU C;  4YSX B;  1L4D B;  4MH0 E;  1AW7 A;  1I4Q A;  1MG8 A;  3NS8 A;  1WX7 A;  1B9R A;  3SFD B;  1L7Y A;  1ISN A;  2INN E;  3AE2 B;  4LK0 M;  1VJK A;  3VR9 B;  1Y8R C;  2VZK B;  2H88 B;  2CHZ A;  2LZ6 A;  1UBQ A;  2CU1 A;  2INP E;  3A9K B;  4XGA B;  3MC9 A;  3ML9 A;  3KYD D;  3SHQ A;  3D32 A;  2MEK A;  3AI5 A;  4K7U A;  4PS7 A;  3PTF C;  4HEA 1;  3DBR I;  4AQ7 A;  3HUI A;  4ZHP A;  3CF6 E;  1NYQ A;  2INC C;  3UIO B;  2BS4 B;  1FCL A;  1WJ4 A;  1HEZ E;  1EWY C;  2E3T A;  1YJJ A;  1VDV A;  4K7S A;  2DYO A;  2KJR A;  4GN1 A;  2R61 A;  2MA9 B;  4II3 B;  3GS2 A;  1SF0 A;  3IT4 B;  3JSV A;  1I4P A;  4YT0 B;  1D5M C;  4MM3 A;  1FM0 D;  1R7S A;  2M8S A;  3A4S C;  1WE6 A;  1L0X B;  5LXH A;  2RPQ A;  2B76 B;  1QOA A;  1FPY A;  1TS3 A;  3AV8 A;  3VTV A;  1GPX A;  1S1Q B;  4B95 A;  2OJW A;  3A1Q A;  4WQO B;  1QQR A;  3A9J B;  1I4X A;  3HIZ A;  4D2K A;  2JYE A;  4HCN B;  1J7A A;  3SEB A;  2I1J A;  5D3D A;  2M4N A;  1ET9 A;  3B1L X;  3R8B A;  2LGS A;  1WY8 A;  3N9Y C;  1AN8 A;  3BVM A;  1X1M A;  3ZUN A;  3GP7 A;  3L10 B;  4NJ7 A;  3ZYY X;  1N62 A;  2ZEQ A;  2W9N A;  2VH2 A;  3TJP A;  5HHD G;  4W9G A;  5AUI A;  3MJ5 A;  2K5P A;  2LVQ A;  3VR8 B;  2C7M B;  4K7W A;  3P2B A;  3W1S A;  2N9K A;  1E90 A;  5FR3 A;  4M00 A;  2VRR B;  3P4R B;  4YTP B;  3SU8 X;  3C19 A;  3ZDM C;  2J52 A;  2JU6 X;  2ZNV C;  3R2T A;  3SD5 A;  2O2V B;  5D6J B;  2N9P C;  4FHK A;  3RUL A;  4FAD A;  3HM6 X;  3SR6 A;  1F9J A;  2JWZ A;  4ICU A;  3VHT C;  2W54 A;  4WQM A;  4JWU C;  3KLS X;  4AOF A;  4EZJ A;  3RNA C;  1YJI A;  1F77 A;  1P3Q U;  4GOC A;  2GOW A;  4BKS A;  4GU2 A;  2ZVN A;  3VVW B;  1WGD A;  4ZRJ A;  4Q2J A;  3ALB A;  1SGH A;  5D2M B;  1YN3 A;  4C7Z A;  1UBI A;  1T0Y A;  4JLC A;  4KZC A;  4IG7 B;  1N6Z A;  2QEJ C;  3OAW A;  2IBI B;  1FXI A;  2WP9 B;  3ZQ4 A;  3H8H A;  4RCO A;  2MSE D;  2CJO A;  3PSE B;  3IHP C;  4PS8 A;  3MTN B;  3VRB B;  5TSS A;  3QC8 B;  3QIJ A;  3DQV A;  4N6E B;  4HCP B;  4M0W A;  3ZTC A;  3AE7 B;  3KUC B;  4KVG B;  3ZGZ A;  1YD8 U;  1XLQ A;  1PDX A;  4A3P A;  4KSK C;  4FLH A;  2BS3 B;  4F1S A;  4FUL A;  5LNK 1;  3AEG B;  3H9D A;  5BMI A;  1TY2 A;  1U4A A;  5J2R A;  3DHI C;  3WIM A;  1FNW A;  4RFB A;  3IBE A;  4WJQ A;  4DDG D;  1FRD A;  2KAJ A;  4GDL A;  2GBM A;  2KLC A;  3ZNH B;  1E8Y A;  2D3C A;  4P16 A;  3RNE C;  3VXW A;  3ZO5 B;  2BT6 A;  5KHO A;  3Q8A A;  4IUM B;  5T8I A;  2LHD A;  1ENF A;  3IG3 A;  4ZYN A;  5LLI A;  3LXF A;  2KWU B;  4JGH B;  3TMP B;  3PT2 B;  2LJ5 A;  2WXH A;  1YQ4 B;  2A4Z A;  3RZF A;  2ZPY A;  2D5G A;  1RRB A;  2AL6 A;  2PTL A;  1NI2 A;  1XT9 B;  4G50 A;  2FID A;  2WXQ A;  1JQ4 A;  4NQK E;  2MBQ A;  3Q3N C;  3DPD A;  3WAL A;  2CHW A;  5IA7 A;  1CMX B;  3U4E G;  4RGO S;  2ZNV B;  3T9L A;  1WJN A;  2N7D A;  4DBG A;  2AYO B;  1UWM A;  1R4N I;  1GC6 A;  4RF0 A;  1MFW A;  5IN7 A;  3R3M A;  1SB3 C;  4KZ0 A;  4W9K A;  1WM2 A;  1VZ8 A;  4FJV B;  2KTF A;  4OW0 A;  4FJY A;  1N5W A;  2WXR A;  1WH3 A;  2BWF A;  3E9S A;  5AEK B;  1Q10 A;  2IPK D;  1WZ0 A;  1YIW A;  3LJ3 A;  2JWU A;  2JZZ A;  1GC7 A;  1PFD A;  4FN2 A;  1SSN A;  3V6E B;  4BOS C;  2MBH A;  3HM3 A;  4DQO C;  3B9J A;  2EKE C;  2MBB B;  3DDC B;  3ZKJ C;  4ANX A;  2ZW1 A;  4LLG M;  2DLB A;  1SE2 A;  1V5T A;  5AUK A;  4NAM A;  4LNI A;  1ROE A;  3RPF C;  2Z0E B;  5BYS A;  2GI9 A;  4A3O A;  2WXK A;  5AZG A;  2MLB A;  3LB8 C;  1C4A A;  4NJC A;  5G5G A;  3TEY A;  1SEB D;  4LDT D;  2FUH B;  5CX3 A;  4JL9 A;  3OLM D;  1JW9 D;  4USA A;  3AMZ A;  4EEW A;  1V9J A;  3V6C B;  1JML A;  4GDL B;  2M1M A;  3ZVV A;  1WGK A;  3RZW C;  4BKG A;  1XLO A;  5AZH A;  2R2O A;  1Q1O A;  1KF6 B;  1L6U A;  1FO4 A;  2JT4 B;  2RDH A;  2KMC A;  1LGR A;  3RN9 C;  2X38 A;  4B6W A;  2C5L C;  3RCZ A;  1C3T A;  3AU5 A;  1MVK A;  3JW0 X;  4M02 A;  2BKR B;  1KLV A;  3UQA A;  2D10 A;  1ZOY B;  3T8M A;  1QIL A;  3P4Q B;  2JXX A;  5E6N A;  1ZGU B;  2KWV B;  5JZE B;  3RD2 A;  1L6V A;  2FIF A;  3V60 A;  4WJP A;  4RGT A;  1UNS A;  4B9K A;  4ZYS A;  5AZF A;  3H7P A;  3RNF C;  1E6E B;  5HG2 A;  2J53 A;  3HRD D;  3MHZ A;  1JAL A;  2BGF A;  3MP9 A;  2OOB B;  3EHV A;  4MGY E;  3VUX A;  4DHJ D;  2IGH A;  1FD6 A;  1KM7 A;  2LWP A;  3AE4 B;  3N30 A;  3BVG A;  2B3A A;  2I2Y A;  2W82 A;  2LAS A;  1XD3 B;  5GMV A;  2QIE B;  3VH4 B;  1I4H A;  1SXT A;  2JXT A;  2KAN A;  2ON8 A;  1XEE A;  3P4P B;  2EMT A;  3RNG C;  4LCD E;  5D94 A;  3FIL A;  2QSD A;  1TBE A;  4E74 A;  4YXD B;  1T0R C;  5E6P A;  5G5H A;  3B0A A;  2O6V A;  2WLB A;  2WQY B;  1WX8 A;  4I6L B;  3NS1 A;  3I3T B;  1M4V A;  1E8X A;  3A9J A;  3BIN A;  1TS5 A;  2JPH A;  5E6J A;  2LMC A;  3N3K B;  2MJ3 A;  3Q69 A;  4IM3 A;  3UQB A;  3ML8 A;  3T3N A;  1CJE A;  2ZCB A;  3GZN I;  3IXS A;  3FKY A;  3PZD A;  1J19 A;  5MPO A;  2WXI A;  1QKZ A;  2KJH B;  4URK A;  3WAN A;  2BB5 A;  4XE0 A;  4ZHO A;  3M63 B;  2BTE A;  2KC2 A;  3W1Y A;  2JRI B;  4H2A A;  2N9L A;  3I5J C;  5HI1 A;  2YEP F;  3EGR A;  1KTK A;  1E7V A;  1F0Z A;  3W9C B;  4ZRQ A;  3JSV B;  2N9E B;  4W9E A;  2KMM A;  4C56 C;  3ZXV A;  3DWG C;  3RNC C;  1UEL A;  3PPA A;  3OWE B;  4GIV A;  3WAO A;  4ZDV A;  2LRW A;  3ZXR A;  2WNM A;  4JE3 B;  3PZ8 A;  4YWG G;  1D5X C;  1RYJ A;  1FNU A;  1Q0W B;  1JRP A;  1FFU A;  3V05 A;  1D5Z C;  2Y5P A;  4C4V A;  1WYW B;  1WYG A;  1P0R A;  2L83 A;  4A8X C;  1MI0 A;  2PMV A;  5H92 C;  2KQ7 A;  3ZW3 A;  1T5X D;  1BML C;  5JHB A;  1RFA A;  1NEN B;  4WWM A;  4W9F A;  5IKC M;  2WXM A;  4NAW A;  1OEY A;  2BWE S;  3O13 A;  4MSQ B;  2KK8 A;  3ZTD A;  2DZI A;  2IYD B;  1IPG A;  2V1Y A;  3PRZ A;  2K39 A;  4HKZ E;  4EZL A;  2CS4 A;  2MWS B;  3QWZ B;  3EFC A;  3WAP A;  3DOW A;  1V1O A;  2JVC A;  1WMH A;  4HLE A;  3L13 A;  4S0R A;  3L16 A;  3P63 A;  4MEM A;  1JRO A;  2NTT A;  4GMV A;  3RYT A;  1MHX A;  1R4M B;  2WDR B;  1EU4 A;  5BYQ A;  2FNJ B;  1FXT B;  2DYM A;  1K53 A;  3Q3O C;  4I6N B;  4M8M A;  3I9V 1;  4ZRP A;  2DAJ A;  2RDB C;  1QOF A;  1DOY A;  4A6Q A;  2WX0 A;  4KKJ A;  4W9L A;  3L17 A;  1T0S C;  4KGT A;  3TL5 A;  3BK1 A;  4X57 B;  3P42 A;  3GZN B;  2FBW B;  1OEY J;  2KNB A;  1IBX B;  1YNT E;  1QLB B;  3Q8F A;  2RPV A;  3KUD B;  1NVI D;  1P7E A;  2C60 A;  2AQ3 B;  5C2T B;  3QA8 A;  2XEW A;  5EE9 A;  4RH6 A;  4HVB A;  4GDK A;  4EOY A;  3N20 C;  2X8X X;  3RMK C;  1YMH E;  1I7H A;  1SIJ A;  2L76 A;  2PJH A;  2Q5W D;  3DBH I;  3BYT B;  1AYF A;  3KW5 B;  1FIQ A;  1VR9 A;  2ZVO A;  2I38 A;  3AE6 B;  1V81 A;  2RDG A;  3VH3 B;  2J42 A;  3IAM 1;  2IGD A;  1FRR A;  1V2Y A;  2BPS A;  4KV2 A;  1WF9 A;  3ZJT A;  2Y3A A;  1C1Y B;  1JWS D;  3FIL B;  1C78 A;  4C00 A;  4OHJ A;  3U8Z A;  4IWQ A;  1BT0 A;  2N9X A;  3IT6 B;  4BAX A;  2JQR B;  1SJH D;  1C79 A;  1ZDX A;  1UD7 A;  1GNU A;  2H89 B;  4KGR A;  4REZ A;  4LNN A;  3W5U B;  2LVP A;  4AP4 C;  2LVO A;  2KDF B;  2Y5C A;  2XK5 A;  4HXD A;  3W1S C;  1K50 A;  3NY5 A;  1KRH A;  4L2Y A;  2RR9 A;  3I57 A;  4PYZ A;  2PW9 A;  4BBN C;  1NDD A;  3NVW A;  2LUM A;  1WJU A;  1RAX A;  3JYU A;  4TSS A;  3LDZ E;  3H7P B;  2IND C;  3QHT A;  4HKQ A;  2BQQ A;  2M17 A;  3NJT A;  3PZ7 A;  4L1B A;  4NPN A;  2NPT B;  4XYC A;  3A4R A;  3QK0 A;  2D07 B;  3AE5 B;  3U30 A;  4IDI A;  4HRS A;  2L0T A;  3WA0 A;  1ZXH A;  2IJ0 A;  3QAR A;  2K6D B;  1R4M I;  2KWD A;  1E8W A;  3DVG X;  4L23 A;  3EFU A;  1L5P A;  5DPR A;  4MGZ E;  1OQQ A;  1V97 A;  1J7B A;  4RM8 A;  2AX5 A;  3PVL A;  1ZPS A;  2LD9 A;  3P1M A;  4BOZ B;  1CK1 A;  1P7F A;  2MW5 A;  1PYW D;  4MEL A;  1YX5 B;  1ZE3 D;  3QQ8 B;  3FAH A;  4IM2 A;  1KOT A;  4DHJ B;  2BBC A;  2K9X A;  2K8B A;  1TTN A;  4GSW A;  2LXA A;  4ACF A;  2DZK A;  2UU7 A;  2K22 A;  2WWZ A;  2NCN A;  4LNO A;  1I4G A;  3X0W A;  4WAF A;  5CHV C;  4W9C A;  5G55 A;  2LI5 A;  2PKO A;  1I42 A;  4ARI A;  3ZJU A;  3ZIM A;  2DBY A;  1FCC C;  4ZOH C;  1PGB A;  2GBJ A;  3UI3 A;  1Z5S B;  2AQ1 B;  1YJ1 A;  4AS1 A;  2IO1 B;  1EWC A;  4F7Z A;  3NRZ A;  5JH5 C;  3VFK A;  3DBL I;  1S3S G;  4OZB A;  3ZNI D;  3ENE A;  1BUI C;  1M94 A;  3ZNG C;  2V0G A;  4MGI E;  1WIA A;  4A90 A;  3AE8 B;  2LHE A;  1I4R A;  4TQ1 A;  3BK2 A;  3SFE B;  3V62 A;  4M8N A;  5LXI B;  2FCN A;  2ZJD A;  3H7S A;  2C7H A;  3TUO A;  3NG0 A;  1AWD A;  2V4I B;  1TS2 A;  4AJY B;  2GRI A;  1C4P A;  1C4C A;  1WX9 A;  2SEB D;  3NZ3 A;  4ANV A;  1V80 A;  1XLN A;  2VH1 A;  1SIF A;  3PGE A;  4J6I A;  2NBW B;  1LM8 B;  3U2S C;  1DYQ A;  2V9H A;  4YSZ B;  2LFI A;  3KQ4 A;  3TEZ A;  3ECI A;  3AE3 B;  2JSV X;  2BS2 B;  1HA5 A;  2ZCC A;  4MDK E;  4PK1 A;  4W9H A;  2KVZ A;  3P4S B;  1L4Z B;  4J3O D;  3LYY A;  1YN4 A;  1IYF A;  4TMA B;  1T6B X;  2KD0 A;  2XBB C;  1KJT A;  3VQI A;  1HTO A;  4GGQ A;  5I4D A;  4HWI B;  2DZJ A;  3U7Z A;  5C3J B;  1TZ1 A;  3ETR A;  1ET6 A;  2N1V A;  2WXP A;  1C76 A;  5BO4 B;  1L0Y B;  3KWV A;  2JZP A;  4WAA A;  3X23 A;  3AN1 A;  1HXY D;  2MJE A;  3CWI A;  1WM3 A;  3QJZ A;  3ZDT A;  3CIR B;  4W9J A;  1LFD A;  1T0Q C;  2XN9 C;  2PIA A;  4MSM B;  3B2F A;  1JWM D;  2K0P A;  5EE1 A;  4OVV A;  1J7C A;  2ZW0 A;  3RI7 C;  3TSS A;  2WXL A;  2L32 A;  2KJ6 A;  1YQ3 B;  4GB9 A;  3OJ3 A;  1DOX A;  3UGB B;  2KO3 A;  1G6J A;  2MH7 A;  1B1Z A;  3EC8 A;  2RD0 A;  1DGJ A;  2WXJ A;  1WE7 A;  1WGR A;  4IOI E;  3W5V B;  4FBJ B;  4FHJ A;  1IUE A;  2MCN B;  1CQV A;  3A1Q B;  2KN4 A;  4DHZ B;  1E10 A;  3VUY A;  2KKC A;  1VD2 A;  4TKN A;  4NY0 A;  4DHZ E;  2N7J A;  1WI0 A;  4M01 A;  4GLS C;  1Q5W B;  1FXA A;  1JWB D;  4AUQ C;  4NNJ B;  1GAQ B;  1RLF A;  2JRH A;  4EE2 A;  3AE9 B;  2M19 A;  3VDZ A;  1SE9 A;  3WCQ A;  3PRP B;  4NZL B;  4N58 A;  4FJZ A;  3VUW A;  3U52 E;  3ABV B;  1MHH E;  1NBF C;  2DNF A;  4BKT A;  1UUP A;  3M95 A;  3EA6 A;  3DHG C;  4XZ4 A;  1FMA D;  1C9F A;  1VZ7 A;  3AEC B;  1MJD A;  4ASW C;  1DOI A;  5DCN A;  1CZP A;  1OQR A;  4JX1 C;  1TKY A;  2KDM A;  2M0A A;  3APD A;  2CKH B; 
#chains in the Genus database with same CATH homology
 4MSQ B;  2KQS A;  3CSF A;  3O65 B;  2KK8 A;  1F9J A;  3M62 B;  2J0J A;  4XX5 A;  3ZTD A;  2JWZ A;  2NVU I;  3IVF A;  2DZI A;  4ICU A;  3VHT C;  2IYD B;  2KX0 A;  2D3G A;  4EZK A;  3B08 A;  2GBR A;  1IPG A;  2V1Y A;  3PRZ A;  2K39 A;  4EZL A;  4LJO B;  2CS4 A;  2MWS B;  2KFJ A;  4AOF A;  3QWZ B;  2BKF A;  4EZJ A;  3WAP A;  3DOW A;  2N4F A;  2JVC A;  2DZM A;  1P3Q U;  1WMH A;  4HLE A;  3L13 A;  4GOC A;  4CYE A;  1VCB A;  2QHO A;  2GOW A;  4E3C A;  3ZNZ B;  2G4D B;  2FAZ A;  2ZVN A;  3L16 A;  1GG3 A;  4GU2 A;  2L8J A;  4BKS A;  5L95 C;  4MEM A;  4GMV A;  2BYV E;  1P98 A;  3KVF B;  3RYT A;  3VVW B;  2KN5 A;  2NBU A;  1E5W A;  1OGW A;  1WGD A;  2FNJ B;  5J18 A;  1FXT B;  4ZRJ A;  2KTR A;  2DYM A;  3L54 A;  3ALB A;  1SGH A;  4I6N B;  2DAF A;  2KVR A;  4M8M A;  5D2M B;  4HPL B;  4RM9 A;  1EF5 A;  3R7R A;  1UBI A;  2DAJ A;  1T0Y A;  4IC7 B;  4JLC A;  4KZC A;  4IG7 B;  1WXV A;  3SDL C;  3OAW A;  2JF5 A;  2AEH A;  2HD5 B;  2IBI B;  4II2 B;  2L7R A;  2WX0 A;  2WYQ A;  2ASQ A;  4W9L A;  3L17 A;  2MSE D;  4ZRI A;  3PSE B;  3IHP C;  2BYE A;  3TL5 A;  4PS8 A;  4E71 A;  3DVN V;  1LQB A;  2K6Q A;  4X57 B;  5J17 A;  3MTN B;  1OEY J;  1I35 A;  2KNB A;  3QCA A;  2KDE B;  3QC8 B;  2IO0 B;  3QIJ A;  3DQV A;  2L3Z A;  4HCP B;  2LGX A;  3ZTC A;  3KUC B;  3KUD B;  1EF1 A;  2C60 A;  4K1R B;  4KVG B;  4ANU A;  1YD8 U;  4A3P A;  3NZU A;  4KSK C;  1WGY A;  3PV1 A;  4FLH A;  3QA8 A;  4F1S A;  4FUL A;  2XEW A;  4HVB A;  4CO7 A;  4DK5 A;  1JRU A;  4GDK A;  3H9D A;  4EOY A;  2HTH A;  1U4A A;  3QAQ A;  4HDO A;  4NJ6 A;  2KLG A;  5J2R A;  3WIM A;  2PJH A;  2HJ8 A;  2L76 A;  3DBH I;  2J0K A;  3HK0 A;  5KHQ A;  3KW5 B;  3IBE A;  4WJQ A;  2JY6 A;  3DCG A;  4KDI C;  4KIK A;  4W9I A;  4DDG D;  3A9K A;  2ZZP B;  3AU4 A;  1L2N A;  2ZVO A;  2N7E A;  4GDL A;  2GBM A;  3OJ4 B;  2KLC A;  3ZNH B;  1E8Y A;  3CST A;  3R66 C;  2G4S A;  2MP2 A;  2KFK A;  3ZRC A;  1V81 A;  3VH3 B;  3VXW A;  4PYU A;  3ZO5 B;  4DXA B;  5KHO A;  1V2Y A;  4IUM B;  2BPS A;  4IWO A;  4A20 A;  4KV2 A;  2G45 B;  2J0M A;  1WF9 A;  3C0R B;  1C1Y B;  1WZ3 A;  3IG3 A;  4ZYN A;  5LLI A;  2CKH B;  2KWU B;  2PEA A;  3R7Q A;  2O6V D;  4GDK B;  4RMA A;  3VTU A;  2A5U A;  1PQS A;  4JGH B;  4WWP A;  4HK2 A;  3U8Z A;  3TMP B;  4IWQ A;  3PT2 B;  1BT0 A;  2N9X A;  2LJ5 A;  1E7U A;  3RUI B;  2KWC A;  2A4Z A;  5CTR C;  3RZF A;  1UD7 A;  2ZPY A;  5C23 A;  1GNU A;  1WXM A;  1RRB A;  2AL6 A;  5L83 A;  3KYC D;  2DHZ A;  1NI2 A;  1XT9 B;  2LXC A;  3DBS A;  4G50 A;  4PS3 A;  2FID A;  2GMI C;  4P7I A;  4CHK A;  2LVP A;  4AP4 C;  4K81 A;  2MBQ A;  2LVO A;  3APF A;  1EUV B;  3IFW B;  4NQK E;  4WWN A;  2KDF B;  3DPD A;  3WAL A;  2LUE A;  2XK5 A;  2CHX A;  4HXD A;  1V6E A;  4ICV A;  3W1S C;  4AJW A;  3TCA A;  3NY5 A;  3MJW A;  5JHA A;  2C9W B;  2KMA A;  2RR9 A;  2CHW A;  4ZRK A;  2Y5B B;  5IAA C;  1CMX B;  5IA7 A;  4PYZ A;  2FCS A;  5EDS A;  4KDL B;  2ZNV B;  3A33 B;  1NDD A;  2N7D A;  1WJN A;  2KDI A;  1WJU A;  3MHS D;  4MJS A;  3T9L A;  4XC2 A;  4DBG A;  2AYO B;  1R4N I;  1GC6 A;  1RAX A;  1WFY A;  4WJO A;  3JYU A;  2D2Q A;  3LDZ E;  4G11 A;  4IWP A;  2JZ3 B;  3JVZ X;  1J0G A;  1TGZ B;  3H7P B;  2XK5 B;  3QHT A;  3R3M A;  4KZ0 A;  3GOE A;  4W9K A;  2V4L A;  4HDQ A;  2J7Q B;  1WM2 A;  2M17 A;  2DX5 B;  3KUZ A;  4IW0 A;  3VTW A;  4NPN A;  2NPT B;  4FJV B;  3A4R A;  3QK0 A;  2KTF A;  2GBN A;  4FJY A;  2D07 B;  2IO3 B;  2UYZ B;  3PHW B;  3U30 A;  1WH3 A;  2BWF A;  2NPT A;  1LXD A;  1WXS A;  1UH6 A;  2L0T A;  3WA0 A;  4BVU C;  3QAR A;  2K6D B;  1R4M I;  1IP9 A;  3K9P B;  5AEK B;  1E8W A;  4JIO U;  1WZ0 A;  1YIW A;  3LJ3 A;  3DVG X;  4EFO A;  2JZZ A;  1GC7 A;  4FA6 A;  4MJS B;  2C7N B;  4FN2 A;  3EFU A;  3ZRF A;  5DPR A;  4MGZ E;  3H6N A;  2K8H A;  3V61 A;  2MBH A;  3V6E B;  4BOS C;  4F8C B;  1EO6 A;  3PHX B;  4GXB A;  4RM8 A;  3HM3 A;  2EKE C;  2MBB B;  3DDC B;  3ZKJ C;  2O2V A;  3ONS A;  3PVL A;  4ANX A;  5HKH A;  2LD9 A;  5DPT A;  4BBN C;  4BOZ B;  1WXA A;  3NHE B;  2MW5 A;  4HJK A;  1V5T A;  2K8C A;  4MEL A;  4G3X B;  2MRP A;  1YX5 B;  2K1F A;  2MBO A;  2Z0E B;  4KIK B;  2IY1 B;  4TV3 A;  4A3O A;  4W9D A;  3QQ8 B;  1D3Z A;  5AZG A;  2MLB A;  4IM2 A;  1KOT A;  4DHJ B;  4TUU A;  5CHF A;  2MBE A;  2Z59 B;  3PRM B;  1YQB A;  1QZE A;  2K8B A;  5DPW A;  1TTN A;  4GSW A;  2LXA A;  2JUO A;  4LDT D;  2DZK A;  1J8C A;  2WWZ A;  5FR6 A;  2BF8 B;  2FUH B;  2NCN A;  5CX3 A;  2FCM A;  1A5R A;  3X0W A;  4JL9 A;  4WWO A;  2UWQ A;  1WGG A;  5CHV C;  4W9C A;  3UIN B;  5G55 A;  3OLM D;  2LI5 A;  5G2N A;  2DYB A;  3TIX A;  2KXJ A;  2YLM A;  3CMM B;  4M0W B;  4JQW C;  1I42 A;  4EEW A;  1V9J A;  2WDT B;  3DVN U;  3ZIM A;  3V6C B;  2KFK B;  5DPS A;  2MP2 B;  2GBJ A;  1Z5S B;  4KSL C;  1YJ1 A;  2M1M A;  4GDL B;  3RZW C;  3ZVV A;  4BKG A;  1WRD B;  2IZV B;  5AZH A;  2HE7 A;  2R2O A;  2IO1 B;  1Q1O A;  1V49 A;  4F7Z A;  3PLV A;  3UIP B;  3M3J A;  1ZKH A;  2RGF A;  3NOB A;  2JT4 B;  5JH5 C;  2KMC A;  1WGH A;  3ZLZ A;  2CR5 A;  3VFK A;  3DBL I;  2Z0D B;  4FAD A;  2RSU A;  1S3S G;  2AWT A;  4B6W A;  3ZNI D;  2C5L C;  3ENE A;  2NBV B;  1AAR A;  1M94 A;  3VAW A;  5C1Z A;  4YL8 A;  3ZNG C;  3L0W B;  4MGI E;  1WIA A;  3RCZ A;  1C3T A;  3AU5 A;  4TQ1 A;  1UZX B;  3S2A A;  3JW0 X;  2KX3 A;  2MQJ A;  2BKR B;  1KLV A;  3UQA A;  2D10 A;  2MX2 A;  3K9O B;  3V62 A;  4M8N A;  3T8M A;  5LXI B;  2FCN A;  2ZJD A;  3H7S A;  2JXX A;  3DVG Y;  5E6N A;  1ZGU B;  2C7H A;  2KWV B;  2V3S A;  1XQQ A;  2PPH A;  5JZE B;  3RD2 A;  4AJY B;  2FIF A;  4LJP B;  3PS6 A;  2IY0 B;  3RT3 B;  1WX9 A;  4WJP A;  4WJN A;  3V60 A;  4ANV A;  1V80 A;  4B9K A;  5AZF A;  3H7P A;  2KC1 A;  4EUT A;  1SIF A;  3PGE A;  2L0F A;  4J6I A;  4N9F 4;  3APC A;  4MGK E;  2NBW B;  3EEC A;  1LM8 B;  2BGF A;  2IO2 B;  4I6P A;  3Q3J A;  2OOB B;  3EHV A;  4MGY E;  2G3Q B;  3VUX A;  3PRE A;  1E8Z A;  2NR2 A;  4DHJ D;  4NAW B;  3ECI A;  1KM7 A;  2LWP A;  2KTR B;  3N30 A;  3WAM A;  2ZCC A;  3UF8 A;  2B3A A;  4MDK E;  3H1U A;  2BYF A;  2L05 A;  4OVU A;  4W9H A;  2LAS A;  1XD3 B;  2LRU A;  3N32 A;  1H8C A;  5GMV A;  3VH4 B;  2O6V B;  1HE8 A;  3U7D A;  2KOX A;  2KAN A;  1WMH B;  1IYF A;  3HHM A;  2KD0 A;  2XBB C;  4MH0 E;  4BBN F;  1KJT A;  1UGM A;  3VQI A;  3TBL D;  4GGQ A;  1MG8 A;  2YVC A;  1WJ6 A;  4HWI B;  2DZJ A;  2EMT A;  2KZR A;  4LCD E;  1TZ1 A;  3NS8 A;  1WX7 A;  5D94 A;  1K8R B;  1L7Y A;  1ISN A;  2N1V A;  3PLU A;  5BO4 B;  1TBE A;  3BY4 B;  1V86 A;  2LGY A;  4E74 A;  4BFR A;  4WAA A;  3X23 A;  5E6P A;  3B0A A;  3NZS A;  1ZW7 A;  1Y8R C;  2L00 B;  2CHZ A;  2LZ6 A;  1UBQ A;  2CU1 A;  2O6V A;  3QX1 A;  1V5O A;  3A9K B;  4TQ0 A;  4LDT B;  1WX8 A;  3ML9 A;  4I6L B;  3KYD D;  1P1A A;  3I3T B;  1WM3 A;  3QJZ A;  3SHQ A;  3ZDT A;  3D32 A;  1E8X A;  3AXC A;  4W9J A;  1LFD A;  3A9J A;  3BIN A;  2JPH A;  3AI5 A;  4K7U A;  1H4R A;  4IM0 A;  4MSM B;  2OJR A;  2M0X A;  4IM3 A;  3N3K B;  4AWJ A;  2R2Q A;  4PS7 A;  3PTF C;  3UQB A;  3ML8 A;  3DBR I;  2FCQ A;  3CF6 E;  3UIO B;  2ZCB A;  3GZN I;  1GJZ A;  1WJ4 A;  4OVV A;  3PZD A;  1J19 A;  4K7S A;  2DYO A;  5CHW A;  2NS5 A;  5TR5 A;  2KJR A;  2N1W A;  4GN1 A;  2KJ6 A;  2KJH B;  2AL3 A;  2KDB A;  2MA9 B;  4II3 B;  4GB9 A;  3OJ3 A;  3UGB B;  2KO3 A;  1G6J A;  4URK A;  3WAN A;  3JSV A;  2WX1 A;  3EC8 A;  3L08 A;  2I1K A;  2RD0 A;  3A4S C;  3M63 B;  1WE7 A;  2M8S A;  4MM3 A;  1WGR A;  2KC2 A;  1WE6 A;  1GUA B;  2KHW B;  3W1Y A;  2JRI B;  4ANW A;  4FBJ B;  4FHJ A;  2RPQ A;  4G0N B;  2MCN B;  3A1Q B;  5LXH A;  4DHZ B;  1WR6 E;  3VUY A;  3VTV A;  1S1Q B;  2KKC A;  4B95 A;  1VD2 A;  4DWF A;  3A1Q A;  4WQO B;  1E7V A;  1Z2M A;  3A9J B;  3HIZ A;  4TKN A;  1WR1 A;  4NY0 A;  4DHZ E;  2LGD A;  2GBK A;  1WI0 A;  2PE6 B;  2N9E B;  3JSV B;  4HCN B;  2DEN B;  4W9E A;  2I1J A;  3AUL A;  5E6O A;  2M4N A;  4EKU A;  3B1L X;  1Q5W B;  1WY8 A;  4AUQ C;  5D7G A;  4NNJ B;  1YX6 B;  3Q3F A;  1X1M A;  1RLF A;  3ZUN A;  1UEL A;  3L10 B;  4NJ7 A;  3PPA A;  4GIV A;  2JRH A;  3WAO A;  4ZDV A;  2LRW A;  3VDZ A;  1OTR B;  1SE9 A;  2ZEQ A;  3PRP B;  4BKS D;  2W9N A;  3TJP A;  4FJZ A;  3VUW A;  1Q0W B;  4W9G A;  1OQY A;  2ZPN A;  1NBF C;  4BKT A;  4NQL B;  1P9D U;  2LVQ A;  4HPM B;  3M95 A;  2C7M B;  4K7W A;  3P2B A;  3W1S A;  1WYW B;  4XZ4 A;  1P0R A;  2PE9 A;  1E90 A;  2VRR B;  3SU8 X;  2D11 A;  4DDI D;  3ZDM C;  3ZW3 A;  2KQ7 A;  2REX A;  2EMS A;  2ZNV C;  4ASW C;  3SD5 A;  2K25 A;  2O2V B;  1RFA A;  5DCN A;  5JHB A;  5D6J B;  2N9P C;  3KH0 A;  4FHK A;  3RUL A;  4W9F A;  4NAW A;  1OEY A;  3APD A;  2BWE S;  3HM6 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...