2DHZA

Solution structure of the ra domain in the human link guanine nucleotide exchange factor ii (link-gefii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
120
structure length
120
Chain Sequence
GSSGSSGDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor (GEF)-like 1
publication title Solution Structure of the RA Domain in the Human Link Guanine Nucleotide Exchange Factor II (Link-GEFII)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dhzA01
2O2VA 3ML8A 4HDOA 2KDIA 4AJYB 2XK5A 2REXA 4I6PA 2BKRB 5CHVC 5D2MB 3HHMA 3PGEA 4GGQA 4IUMB 1WRDB 4BKTA 5E6PA 2RPQA 4G3XB 4PYUA 4EEWA 3W1SA 2KNBA 4BKGA 4EZKA 1UGMA 1UELA 3R66C 3SHQA 5E6OA 3DVGX 4LDTD 4MSMB 3PHXB 5JH5C 3WAOA 3TCAA 2IO0B 2WX1A 3HM3A 2V4LA 4W9GA 1P1AA 1V49A 3CSFA 4OVVA 2KWUB 2NS5A 3IHPC 3A33B 1GUAB 1Q0WB 4A20A 4W9DA 1V9JA 1P3QU 1UBQA 2V3SA 1WGGA 3KW5B 3VH3B 1GC7A 4P7IA 2Z0DB 2L0TA 2BYVE 2KVRA 2BWES 1WF9A 4AWJA 1V6EA 2L00B 1I35A 1P98A 2MCNB 4LCDE 4DWFA 2KJRA 2MBQA 3LDZE 4EZJA 2JZ3B 3N3KB 4M8MA 3QJZA 2LJ5A 3VXWA 3Q3FA 5EDSA 3M62B 3R7QA 4BVUC 1X1MA 2DYMA 4ZRIA 3VQIA 3BINA 4KDLB 3KVFB 4DBGA 4XZ4A 1RFAA 2LGXA 5JHBA 1E8YA 1FXTB 2KJ6A 4ZYNA 4DHZE 3S2AA 2PE6B 3DDCB 4TQ0A 2PPHA 3NS8A 2A5UA 2JRHA 2NR2A 4TQ1A 2K8BA 3I3TB 3W1YA 4FJZA 3M3JA 4AJWA 1WE6A 1U4AA 2J0MA 2DYOA 3L13A 4FULA 4HCPB 2M17A 3C0RB 3TBLD 1VD2A 2LI5A 2N9PC 1OQYA 1XQQA 1OEYJ 2NBWB 3ZIMA 4EFOA 4F8CB 3PV1A 1QZEA 3CMMB 2JUOA 3PZDA 4W9EA 3EHVA 3QA8A 4JLCA 2FIFA 1WJ4A 1WMHA 1Y8RC 2MLBA 3APDA 3IBEA 2WX0A 4GDKB 2ASQA 4MM3A 4XC2A 4WWOA 3H6NA 4KIKA 3UIPB 4ANXA 2LGDA 2O6VA 4BOZB 2JXXA 1LFDA 2FUHB 4PS7A 1TGZB 3VTUA 2FCNA 3ZDMC 1F9JA 4ICVA 3V6CB 3VUYA 2O2VB 1XT9B 2PJHA 3PREA 4IM3A 2DAFA 3AXCA 4J6IA 3PLVA 4FHJA 1R4NI 3KYCD 2DZIA 2RGFA 4BOSC 2CKHB 1MG8A 1ZKHA 2VRRB 1E8XA 4I6NB 3ZO5B 5LLIA 2KWCA 1T0YA 2GOWA 2MQJA 4JIOU 3QIJA 2M8SA 2L76A 3APCA 3DVNU 4WJQA 4ANWA 3BY4B 2BYEA 2WDTB 3LJ3A 4HLEA 5AEKB 2ZPNA 1WM3A 4FBJB 4DDID 4HK2A 4E3CA 5C1ZA 1WY8A 1OTRB 4JQWC 2OJRA 4HPMB 1GG3A 2HTHA 2ZPYA 3QK0A 4WWPA 4I6LB 3EC8A 4NAWA 1A5RA 4KVGB 3RT3B 3ZNGC 2ZCCA 2ZNVB 2BGFA 3EFUA 3QAQA 4MGKE 1ZW7A 2W9NA 2ZZPB 4N9F4 2KX0A 3KUZA 2JRIB 4WJPA 4MJSA 3ZUNA 2K8CA 3RZWC 4W9JA 3B08A 4ICUA 3ZNZB 2DZJA 2MSED 2C7MB 2DYBA 4GU2A 3L08A 4CO7A 2CHXA 5IAAC 3VTVA 1E8WA 4LJPB 1Z5SB 3DBHI 2UWQA 2CR5A 2CS4A 2FAZA 4W9CA 1PQSA 1E90A 2FNJB 3PLUA 3MTNB 2JPHA 4MELA 3ZNID 4ZRJA 1OGWA 3TL5A 2G4DB 3PRPB 4GXBA 1IPGA 5J17A 2J0KA 3ALBA 4RM8A 3ZTCA 2ZJDA 4EUTA 1Q1OA 4FJYA 4ANUA 3VHTC 1WYWB 4KIKB 1WGDA 2O6VB 3IFWB 4MSQB 2KC1A 4II2B 1YX6B 2ZCBA 2C60A 5FR6A 4K1RB 5CTRC 2DX5B 1VCBA 4PYZA 4NY0A 2AWTA 1V5TA 5BO4B 2ZVNA 2KTRA 2KDEB 5E6NA 2XBBC 2RD0A 3JSVA 4GOCA 4W9IA 2BKFA 4WWNA 2JF5A 2GMIC 1WH3A 3OAWA 2MBBB 3N32A 4JL9A 4DXAB 2CHWA 3V62A 4EZLA 1RAXA 2AL3A 2A4ZA 4AP4C 4HCNB 4IC7B 3DBRI 3CSTA 3DOWA 2EKEC 1WE7A 4M0WB 1Q5WB 5CX3A 5KHQA 2G3QB 3A1QA 3WA0A 3NOBA 2L0FA 1BT0A 1V2YA 2KQSA 4AOFA 4CHKA 2GBKA 3MHSD 3NZSA 1P9DU 4HXDA 1SGHA 1CMXB 5DPWA 3WAMA 1YQBA 3V60A 2K8HA 4K81A 2O6VD 2K39A 4M8NA 2D3GA 3A9JA 4ASWC 2MBEA 3A9KB 2KANA 3PPAA 2GBNA 5JZEB 2B3AA 2N9EB 1ZGUB 4GDLA 4W9KA 3PVLA 4YL8A 4BBNC 3TMPB 2GBJA 4MJSB 2JVCA 1S3SG 2KLCA 3VVWB 2M4NA 3TIXA 1R4MI 4BFRA 4RM9A 3WIMA 4MGYE 1YD8U 2Z59B 3SDLC 3U7DA 1V5OA 2J0JA 4NQKE 1H4RA 3VAWA 3PSEB 4W9HA 2L8JA 2C5LC 2MX2A 1WXVA 1P0RA 2DENB 2XK5B 3R7RA 4E74A 1H8CA 3ZNHB 2MP2A 1NBFC 1WR6E 3KH0A 1GC6A 3Q3JA 4WJNA 2LUEA 1IYFA 2KKCA 2FCSA 2MBHA 4JGHB 4MDKE 4WAAA 3APFA 2DZMA 1SIFA 5TR5A 3ZKJC 1WXMA 2I1JA 3RUIB 5LXHA 3HM6X 3NY5A 2RSUA 3O65B 3RULA 3B1LX 3DBLI 5DPRA 2KTRB 3ECIA 4IW0A 2ZVOA 3PRZA 3RD2A 3VH4B 4A3PA 2KZRA 2NBUA 5C23A 2IYDB 4FLHA 4XX5A 1V80A 1LQBA 2PEAA 3SU8X 3RZFA 1M94A 1AARA 3DPDA 1IP9A 4ZRKA 4NNJB 5AZGA 3DVNV 2KXJA 3DVGY 3HIZA 3KYDD 1RLFA 2KFKA 5JHAA 3R3MA 1S1QB 5GMVA 3UIOB 3X23A 2AL6A 4FHKA 4F1SA 2I1KA 3AU5A 3IVFA 2FIDA 3T8MA 1V86A 5G55A 2K1FA 2KOXA 3QX1A 4KV2A 2CU1A 2BYFA 1TBEA 4W9FA 3W1SC 3L54A 2N7EA 2KWVB 4X57B 2LRUA 3QQ8B 3KUCB 3QC8B 4K7UA 3U8ZA 1G6JA 4KDIC 4G0NB 2AYOB 3A9JB 1ISNA 1SE9A 1WXAA 3ML9A 2LXCA 4GDLB 2KDBA 1C1YB 1L7YA 4B95A 4TUUA 1HE8A 2HJ8A 1V81A 2BWFA 4B6WA 3H7SA 4TV3A 2KLGA 3AULA 4KSLC 3ZDTA 4E71A 1WI0A 2K6QA 1WMHB 2CHZA 1E8ZA 1UH6A 1WFYA 4KZ0A 4HPLB 1KJTA 3N30A 2PE9A 2J7QB 3L10B 2IBIB 3WALA 2BF8B 4ANVA 2D07B 3RCZA 3H7PA 2KQ7A 4PS3A 4DHJB 1LM8B 3WAPA 1EUVB 2ZNVC 3QARA 2KFJA 2LVQA 2V1YA 3H9DA 3T9LA 2JT4B 2MP2B 2N1VA 4RMAA 5DPTA 3X0WA 4BKSA 2WWZA 2JZZA 2M0XA 2K6DB 3L17A 4URKA 4CYEA 1WIAA 5J18A 2C7NB 4HDQA 1WJ6A 3EECA 2KJHB 4NQLB 2JWZA 2HD5B 2KK8A 1J8CA 3UGBB 2FCMA 2KX3A 1I42A 4DHZB 2UYZB 4GB9A 2XEWA 1D3ZA 3ZTDA 4LJOB 4HJKA 1WZ0A 3VUWA 2LASA 1GNUA 4G11A 3UQAA 5L95C 1RRBA 4IM2A 4IM0A 3PS6A 3UINB 4B9KA 4WQOB 2KHWB 1E7VA 3UF8A 1WGRA 4NJ6A 3OLMD 1EO6A 3ZRCA 2FCQA 4NAWB 1J0GA 2KC2A 3PTFC 5AZFA 2HE7A 4FA6A 2MA9B 3SD5A 1TZ1A 4DHJD 4IWPA 4FADA 2KFKB 5HKHA 2D2QA 2G45B 5J2RA 1LXDA 2IY1B 2LGYA 4KSKC 2IY0B 2Y5BB 2M1MA 3KUDB 1YJ1A 4GIVA 1UBIA 3QWZB 5LXIB 2ZEQA 3NZUA 2NPTA 4NPNA 1KM7A 4GN1A 2G4SA 1WX8A 3QCAA 3QHTA 4GMVA 4MH0E 3ZW3A 4EOYA 2N9XA 3PT2B 3GZNI 3HK0A 2N1WA 2BPSA 4A3OA 2IO3B 2IO1B 4IG7B 3M63B 1L2NA 3VUXA 1K8RB 4MGIE 2GBMA 2LXAA 2LRWA 1NDDA 1UD7A 2IO2B 1OEYA 2KDFB 2LVOA 2Z0EB 2KN5A 3P2BA 4HVBA 1KLVA 2MBOA 2EMSA 4W9LA 3VFKA 4DDGD 2KO3A 3AI5A 2DZKA 2NVUI 3ZRFA 5KHOA 3VTWA 2NCNA 5DPSA 4IWQA 2N4FA 2L7RA 4K7SA 3RYTA 1WGHA 3JVZX 3DBSA 3H7PB 4FJVB 5CHFA 3ZLZA 4G50A 1WXSA 1JRUA 3OJ4B 4HWIB 2MWSB 3M95A 2R2OA 1Z2MA 2OOBB 2KD0A 3B0AA 2JY6A 4F7ZA 2MRPA 3JSVB 1E7UA 2KMAA 2RR9A 1WZ3A 1YX5B 2MW5A 1GJZA 2C7HA 4ZDVA 4IWOA 3A4SC 3PHWB 1WM2A 3OJ3A 3ONSA 4K7WA 3CF6E 2IZVB 2K25A 2YVCA 3IG3A 3ENEA 3JW0X 2LZ6A 4GSWA 2C9WB 5AZHA 3GOEA 4BBNF 4OVUA 3A4RA 4MEMA 2LVPA 3A1QB 1UZXB 1EF1A 4II3B 3L0WB 2D11A 4MGZE 2AEHA 3AU4A 3U30A 1TTNA 4PS8A 3NHEB 3JYUA 1XD3B 4WJOA 3V61A 4LDTB 3WANA 4DK5A 1WX7A 3DQVA 4KZCA 5D6JB 2QHOA 3DCGA 3PRMB 3UQBA 2EMTA 3A9KA 5D7GA 5CHWA 3ZVVA 2NBVB 4FN2A 5IA7A 4AUQC 3D32A 1EF5A 1J19A 2GBRA 3V6EB 4BKSD 2DHZA 1YIWA 2DAJA 2R2QA 4TKNA 2YLMA 1WGYA 3L16A 5D94A 1WR1A 3H1UA 2LWPA 2L3ZA 4NJ7A 2N7DA 4GDKA 1KOTA 2KMCA 1WJUA 5G2NA 2D10A 1NI2A 3MJWA 2NPTB 1WX9A 3VDZA 5L83A 4EKUA 1C3TA 2WYQA 1E5WA 1WJNA 3K9PB 5DCNA 2L05A 3TJPA 2LD9A 2KTFA 3K9OB
chains in the Genus database with same CATH superfamily
1XLPA 2O2VA 3ML8A 5D2MB 4GGQA 3PGEA 4IUMB 5E6PA 4BKGA 2KNBA 1FD6A 1UGMA 1UELA 3R66C 3SHQA 1QT9A 2WX1A 3AE7B 4OVVA 2WXGA 4JE3B 2K22A 3KW5B 1OQRA 4P7IA 2Z0DB 2L0TA 2BYVE 2KVRA 4AWJA 1I35A 2V9HA 4RF0A 2KDMA 1ENFA 4KGRA 2LEKA 4LCDE 4DWFA 3R2TA 2JZ3B 1RYJA 2PTLA 5C2TB 2JZPA 3KVFB 3Q69A 4DBGA 3VR8B 2LGXA 1E8YA 1N63A 2KJ6A 4BAXA 4DHZE 2WXNA 3DDCB 1YOVB 1E10A 4RGTA 2DYOA 2SAKA 3C0RB 2N9PC 1SE3A 1OQYA 1XQQA 1OEYJ 3N20C 4EFOA 4W9EA 3EHVA 3APDA 4YWGG 3UIPB 4BOZB 2JXXA 1XCTL 2FUHB 3ZDMC 1TGZB 4WWMA 3SEBA 2DAFA 1I4HA 2JXTA 3OWEB 2CKHB 3ZO5B 1ZKHA 1E8XA 4LK0M 2KWCA 2MQJA 3ZGZA 2VH2A 1DYQA 1QOAA 3L4PA 2WDTB 4FBJB 4J3OD 4E3CA 2SEBD 1NI3A 1WY8A 2WXLA 2V4IB 4NAWA 4KVGB 2L32A 3ZNGC 4ARCA 2BGFA 3EFUA 1YN4A 1YN5A 2W9NA 2ZW1A 4WH4A 2K8CA 3B08A 3NS1A 4ICUA 4WURA 3ZQ4A 3ZNZB 1N6ZA 4C4VB 3L08A 4CO7A 1E8WA 4LJPB 3DBHI 2GI9A 5D3DA 2FAZA 1E90A 2FNJB 3PLUA 2WHIA 3P4PB 2JPHA 3IXSA 3TL5A 1SJED 1IPGA 1Q10A 4MM3B 1Q1OA 3NG0A 4FJYA 3VHTC 2PVOD 4MSQB 1IGDA 1P7FA 2C60A 5BO4B 2ZVNA 3PZ7A 2KTRA 1K53A 2HDEA 4RFBA 2JF5A 3PO0A 3OAWA 3HRDD 3R8BA 3V62A 1RAXA 3TSSA 1SSNA 2A4ZA 5G5HA 3DOWA 1R4NB 1I4RA 1WE7A 5KHQA 1BT0A 2INCC 2LHDA 2Y5CA 3BK1A 1SGHA 4USAA 4K3BA 1D5XC 4JWUC 3SFEB 3V05A 3AEDB 2Y5PA 3VRBB 2LGSA 4M8NA 4HEA1 2GBNA 4FXCA 1ZGUB 3PVLA 1L6UA 1S3SG 2QJLA 4N6EB 3TEWA 4MGYE 5IOIA 3U7DA 2J0JA 1WWTA 3PSEB 3U2SC 1DOYA 5FKAC 1WXVA 4E74A 3ZNHB 3KH0A 5AUIA 1GC6A 4WJNA 2LUEA 1T0RC 3APFA 5TR5A 1QOGA 1PGAA 3RUIB 3NY5A 3AE1B 3O65B 1FCLA 3DBLI 2X8XX 3NVZA 4BZAA 2ZVOA 3PRZA 4A3PA 2M19A 1XF5L 5EE0A 2JWUA 4NNJB 3EUB2 4IOIE 2HTME 5GMVA 1F1HA 4EE2A 2I1KA 2FIDA 3T8MA 1QF6A 2K1FA 2KOXA 1TBEA 2BW2A 3W1SC 3L54A 2N7EA 1G6JA 4K7UA 1FFVA 2AYOB 3A9JB 1ISNA 2LXCA 2KN4A 1L7YA 1I4QA 4TUUA 1HE8A 2HJ8A 3AE8B 4B6WA 3H7SA 3W5UB 4E71A 1E8ZA 2ON8A 1I7HA 4HPLB 3ZJTA 2D3BA 2BF8B 4DHJB 1LM8B 3WAPA 2LVQA 3X0WA 2ONQA 2MP2B 3AE6B 4LNFA 5J18A 1WIAA 3AV8A 3GB1A 3BIID 1WJ6A 2KJHB 1J8CA 2HD5B 2KK8A 3UGBB 1N5WA 2KX3A 2JQRB 3MC8A 4GB9A 3ZTDA 4HJKA 4YTMB 5IN7A 4G11A 5L95C 3B2GA 1TKGA 4B9KA 1L6VA 3Q6BA 1K51A 2FCQA 4NAWB 1EM7A 3AEGB 2KC2A 3PTFC 4FA6A 4YXDB 3KQ4A 1KTKA 4S17A 4MACA 1TZ1A 4HPPA 4IWPA 4FADA 2KFKB 2OEDA 4HKZE 2BS4B 4WIPA 3NZUA 1RWSA 4NPNA 1KM7A 4L1BA 4RNAA 4GMVA 4EOYA 1ESFA 4IG7B 1N60A 1GB1A 2W82A 2WU2B 3VUXA 1MPEA 3IT4B 1UD7A 2IO2B 1OEYA 4US8A 3P2BA 1WGKA 3VFKA 3AI5A 1L0YB 1HTQA 1L0XB 4Q2JA 1JWBD 4K7SA 1WGHA 3ZLZA 3H7PB 1XLNA 1JRUA 2R2OA 3RNFC 1E7UA 2KMAA 2MW5A 4RF1A 3Q8CA 3A4SC 3ZXVA 3ONSA 4K7WA 4XDCA 3CF6E 2IZVB 3NRZA 3IG3A 3ETRA 2C9WB 4XDDA 4II3B 3L0WB 4MGZE 2AEHA 2D3CA 2PMVA 1TTNA 4PS8A 3AE9B 1XD3B 3V61A 4LDTB 2Q5WD 3PRMB 3UQBA 3ZVVA 4AUQC 3BK2A 3D32A 1SBBB 1P7EA 2DAJA 4OHJA 3HVDA 1TY2A 2DLBA 2K9XA 3L16A 2LGIA 3VDZA 5L83A 4EKUA 2WYQA 3TJPA 2WDRB 2KTFA 4HDOA 1STEA 4I6PA 4M01A 5CHVC 1I4PA 2RPQA 4G3XB 4PYUA 2XNAC 3DVGX 3PHXB 5JH5C 2IO0B 1KLUD 3NUHB 3HM3A 4ARIA 3FAHA 1TS4A 3CSFA 5E6JA 3IHPC 3A33B 1GUAB 4R3DA 1V9JA 1P3QU 1UBQA 2V3SA 3VH3B 3BWUD 1ZUD2 4H2AA 2BWES 1WF9A 3RN9C 2PIAA 3TEXA 5BYQA 3LDZE 4XWTA 3Q14C 2LJ5A 4D2KA 3E9SA 3M62B 3R7QA 4BVUC 1X1MA 4ZRIA 4TMAB 4XZ4A 4ZYNA 3S2AA 4C4VA 2PPHA 2NR2A 1UWMA 3I3TB 2V0GA 1WYGA 4FJZA 1C78A 3AE5B 1WE6A 1GPXA 4FULA 4HCPB 1FM0D 1VD2A 2LI5A 4LNOA 4F8CB 3PZDA 4MH8A 2FIFA 1WJ4A 4MM3A 4GDKB 4MGIE 3V6EB 2X38A 3MJ5A 1N62A 3VTUA 1UNSA 2PJHA 3Q2AC 4J6IA 1QQRA 3AXCA 4OVZA 3PLVA 3KYCD 4BOSC 2NMQA 4ZHPA 1MG8A 2H88B 4HKQA 2PKOA 1C4CA 3HVZA 4JIOU 3DBHB 3QIJA 3UI3A 2L76A 2WXFA 2N9LA 1AYFA 1C79A 1V1OA 3BY4B 4N58A 1J7BA 4HK2A 4OZAA 5C1ZA 3TEYA 2OJRA 2J53A 5BMGA 4WWPA 2J52A 1A5RA 2QC8A 3RT3B 2ZCCA 4MGKE 3QAQA 3N1ZC 2KX0A 2WLBA 3KUZA 3ZUNA 3ZJVA 1TY0A 2WDQB 1TYGB 1PYWD 2MSED 2Z8LA 2DYBA 2CHXA 1QLBB 1DGJA 1YN3A 2D5GA 4MELA 1OGWA 5J17A 3ALBA 4C80A 1HQRD 1WYWB 4KIKB 2IGHA 2O6VB 2KC1A 2WXQA 2V3PA 3Q3MC 1CJEA 4NY0A 2KDEB 3JSVA 4GOCA 3SR6A 1MHXA 2LUMA 1NVID 1WH3A 1UUPA 4JL9A 4EZLA 3FKYA 2G9HD 2AL3A 4HCNB 3DBRI 2EKEC 3U52E 1PGXA 1ACCA 3A1QA 3WA0A 3NOBA 2L0FA 2LHEA 2KQSA 1FNUA 2IGDA 3NZSA 4P1CC 2VH1A 1XO3A 1YQBA 2K8HA 1QILA 3DBLB 3A9JA 2KANA 2GBJA 3P1MA 3VVWB 3TIXA 4HJGE 1R4MI 2LFIA 1T0QC 1SE4A 4LLGM 3WIMA 1YD8U 4LNNA 4DQOC 1V5OA 3VAWA 1ZPSA 1H8CA 2MP2A 1XCQL 3Q3JA 1N61A 1VR9A 1IYFA 2WXPA 4C7YA 3DHGC 4JGHB 4MDKE 1SIFA 4K3CA 3ZKJC 1VZ6A 1WXMA 1T0SC 2I1JA 3U7ZA 1TKEA 3RULA 1E7PB 3B1LX 3ECIA 4PK1A 1D6EC 3RD2A 3V3XA 5C23A 5H8YE 2IYDB 1LQBA 1M94A 3BVGA 1TT5B 1IP9A 4YTNB 2E3TA 4ZRKA 4O1NA 3KYDD 1RLFA 2KFKA 5BMHA 3BVZA 2AL6A 1YNTE 2RMMA 4QAYA 3AU5A 3IVFA 1T3QA 2RDGA 4X57B 3QQ8B 3QC8B 3U8ZA 1YQ4B 1LGRA 4WAFA 1TS3A 4GDLB 1V81A 2WDVB 3AMZA 2KLGA 1WI0A 1ZDVA 1KJTA 1QOBA 2G1EA 3Q8BA 4S0RA 2D07B 3RCZA 3H7PA 2ZNVC 2V1YA 1GOZA 3T9LA 2N1VA 4RMAA 2WWZA 1OFFA 3AEFB 4CYEA 4HDQA 3EECA 5LNK1 4NQLB 2JWZA 2FCMA 4C56C 1I42A 3ZXRA 2UYZB 3GP7A 2CU3A 4IDIA 1A70A 4LJOB 3P42A 1WZ0A 2LASA 1JWAD 4IM0A 3MFGA 3PS6A 1CZPA 1C4AA 2BS3B 2W3RA 3UF8A 2MJEA 3OLMD 1HZ6A 2MA9B 3C8YA 3SD5A 4DHJD 2L1AA 2UU7A 4WQMA 1UBIA 3QWZB 5LXIB 1ZOYB 4ZHOA 3T3OA 2ICIA 2G4SA 2N9XA 3RNCC 3BZDB 3HK0A 2IO3B 2IO1B 3M63B 1EWCA 1L2NA 1K8RB 2GBMA 1NDDA 2KDFB 1E0ZA 2Z0EB 4HVBA 2MBOA 4W9LA 2DZKA 2FE8A 3ZRFA 4L2YA 3IAM1 2NCNA 5DPSA 1L4DB 1TIFA 3JVZX 1CQVA 4G50A 3OJ4B 4A8XC 2MWSB 3B0AA 4F7ZA 3JSVB 1NYQA 4TSSA 4IWOA 3PHWB 3OJ3A 4LTUA 2BYTA 2YVCA 4RGNA 5AZHA 4MEMA 3Q8AA 3A1QB 4MT5A 1EF1A 2TSSA 1DOXA 3AU4A 3GS2A 3JYUA 2INNE 1F0ZA 3DQVA 3E56A 4KZCA 3BYTB 2QHOA 5IO9A 5HFYA 1HXYD 4KGSA 1F52A 1XXGA 1YIWA 3RNBC 2YLMA 1B9RA 1WGYA 5D94A 1WR1A 3H1UA 4KKIA 2LWPA 4NJ7A 4GDKA 1WJUA 2M0AA 2D10A 3AE2B 2NPTB 4ZOHC 1WX9A 2MHJA 4AJYB 2KDIA 2BKRB 2M56B 3RMKC 4BKTA 3W2DA 2QDFA 2OJWA 2W54A 1FXIA 2BQQA 4EEWA 3W1SA 4EZKA 1RM6C 1FFUA 5E6OA 4LDTD 3WAOA 3TCAA 4W9GA 2V4LA 1FNWA 5T8IA 3I5JC 3GE8C 2KT7A 4W9DA 4A20A 5AUKA 1HTOA 5MPOA 1FMAD 3AN1A 1GC7A 2EELA 4RGOS 4A9AA 2BT6A 1V6EA 3I63C 2EKIA 2L83A 3GE3C 4EZJA 5H92C 3N3KB 3VXWA 3VQIA 2DYMA 2K3UA 3BINA 1FXTB 1JRPA 4ITKA 2PE6B 2WQYB 1VDVA 4TQ1A 2K8BA 3W1YA 4AJWA 2J0MA 3AB5A 3L13A 3ZJUA 2NTTA 4B0MA 3TBLD 2JU6X 3ZIMA 2NBWB 1QZEA 3CMMB 3SDLC 1WMHA 1Y8RC 3IBEA 4ANXA 2ASQA 4XC2A 3H6NA 4KIKA 2LGDA 2O6VA 2YEPF 4PS7A 2FCNA 3VUYA 1FRRA 4IM3A 1YJIA 4YTPB 2RDBC 1R4NI 4I6NB 3Q8EA 3B9JA 2GOWA 1YJJA 2M8SA 2GB1A 2N0SB 1K52A 2W55A 3APCA 3DVNU 2E6XA 3EFCA 4ANWA 2BYEA 4HLEA 3LJ3A 4NJCA 2ZPNA 1YMHE 1ZXHA 3Q8FA 3MC0B 1OTRB 4JQWC 1TS5A 2ZPYA 2Y3AA 3EC8A 4I6LB 2ZNVB 5FK9C 5TSSA 2ZZPB 4WJPA 1QKZA 2JRIB 3DHHC 3RZWC 4W9JA 4AS1A 2QMTA 2AQ3B 3KWLA 2C7MB 3DBRB 4GU2A 4LNIA 5IAAC 1SXTA 2UWQA 1MVKA 1E9MA 3MTNB 2G4DB 3PRPB 4ACFA 3FC4A 2J0KA 4RM8A 3ZTCA 1KF6B 1F2RI 4KX6B 1WGDA 4N59A 1JCKB 4II2B 2ZCBA 5FR6A 4K1RB 5CTRC 3U4EG 2AWTA 1R4MB 4RH6A 1E6EB 2XBBC 2RD0A 2BKFA 4WWNA 1WRIA 2MBBB 2CHWA 1HZ5A 4AP4C 4IC7B 3CSTA 3J9CA 4M0WB 1Q5WB 1V2YA 4CHKA 2GBKA 2LMCA 1CMXB 4XGAB 4ZRQA 2O6VD 4XWWA 1EU3A 2D3GA 4ASWC 2MBEA 4C7ZA 5JZEB 2B3AA 4REZA 4GDLA 4BBNC 3TMPB 4MJSB 2JVCA 4A6QA 1I4XA 5HG2A 2PLPA 3T3NA 2M4NA 4BFRA 2PVGC 4RM9A 5JXVA 5EE9A 3I9V1 2Z59B 4NQKE 4W9HA 2L8JA 2MX2A 1P0RA 1SIJA 2GLSA 3NZ3A 3R7RA 1T5XD 1UGJA 2KKCA 3AEEB 4WAAA 1VRAB 2KMMA 1VZ8A 2RSUA 3P4RB 4IW0A 3VH4B 2WNMA 2KZRA 4FLHA 4XX5A 1V80A 3FILA 3SU8X 2AQ1B 1AARA 3DPDA 1GB4A 2ACZB 2INDC 3RFZB 3Q3NC 2IJ0A 2KXJA 1FO4A 3HIZA 3UIOB 4FHKA 4F1SA 4CQNA 2KAJA 2CU1A 2BYFA 4W9FA 1JROA 2RDHA 2KWVB 2LRUA 3KUCB 4KDIC 1WXAA 1SE9A 3ML9A 1L0VB 2KDBA 1WSPA 4B95A 3IT6B 2WXOA 4KGTA 2BWFA 3AULA 2KYWA 4KSLC 1F2RC 1WMHB 2CHZA 4KZ0A 3N30A 2PE9A 1SE2A 2J7QB 3L10B 1ZE3D 2IBIB 1KFYB 4XYCA 5EE1A 3QARA 2KFJA 3W5VB 3H9DA 5DPTA 1SEBD 3ZYYX 1ZDXA 2K6DB 3AE4B 4ZYSA 4M02A 1SB3C 2LJIA 2DBYA 4B0EA 2XEWA 4YSYB 4LNKA 3VUWA 2D3AA 1DOIA 1FXAA 1C9FA 1SF0A 1V97A 3MC9A 3UINB 1SJHD 3RPFC 4WQOB 2KHWB 1E7VA 2MH7A 2WXHA 2VZKB 1WGRA 3NVVA 1EO6A 2R61A 2HE7A 1TZOA 1JW9D 5J2RA 2IY1B 1KLGD 1FRDA 1JQ4A 4RGMA 2Y5BB 1MG4A 4GIVA 2NPTA 3AECB 1UWXA 3N1YC 1L5PA 3P63A 4US9A 3PT2B 3GZNI 2BPSA 1VZ7A 3AE3B 4UDUC 3WCQA 3NVYA 1D4BA 2EMSA 4DDGD 2NVUI 2WXKA 5KHOA 3VTWA 1C77A 4IWQA 3DBSA 4FJVB 1WXSA 4HWIB 1M4VA 3M95A 3N9YC 4JWSC 2JX5A 2OOBB 2JY6A 3P4SB 1GJZA 1YX5B 2DWQA 2WXIA 1VLBA 3LB8C 2K25A 3JW0X 2LZ6A 2WXJA 4OVUA 3A4RA 2LVPA 3URYA 2DNFA 1R7SA 1UZXB 3DHIC 3O13A 3BVMA 3U30A 4WJOA 2RPVA 4DK5A 4JX1C 3B2FA 2EMTA 3A9KA 2NBVB 4FN2A 5C3JB 1EF5A 4DXGA 3AEAB 1TS2A 2GBRA 2AQ2B 3MP9A 1FPYA 4IKGA 4TKNA 1V1PB 1JWSD 3RNEC 2L3ZA 2N9KA 5EE3A 1KOTA 3VRAB 3K9PB 2LD9A 3K9OB 3ABVB 2XK5A 1UF0A 2REXA 3HHMA 1WRDB 4OW0A 2BVCA 1I4GA 1Y56A 2AX5A 2KWDA 3NJTA 1C76A 2JYTA 4MSMB 1D5MC 3TEZA 1P1AA 1V49A 1JMLA 2KWUB 2NS5A 4XE0A 1Q0WB 3DWMA 1WGGA 2BS2B 3FILB 3EA6A 3I57A 2L00B 1P98A 1ROEA 2MCNB 2KJRA 1PGBA 2MBQA 1KRHA 2HJ1A 4M8MA 3QJZA 3Q3FA 5EDSA 1AN8A 1PUTA 2K0PA 2QSDA 4KDLB 5JHBA 1RFAA 2WP9B 4TQ0A 1ET9A 3NS8A 2A5UA 2JRHA 3AM9A 3EGRA 1AWDA 3M3JA 2BB6A 1RFKA 1C4PA 1U4AA 3OG5A 3C19A 2M17A 1FNVA 5HHDG 2H89B 3PV1A 2JUOA 2CJNA 1WXQA 2FBWB 3R2IA 3QA8A 4JLCA 2MLBA 3ZDTA 1LO5D 2WX0A 4WWOA 1LFDA 4OZCA 5HI1A 1F9JA 1IBXB 4ICVA 1OQQA 3V6CB 2W3SA 2O2VB 1XT9B 1ZXIA 2WS3B 3PREA 1FIQA 4FHJA 2DZIA 2PW9A 2RGFA 1F77A 1FEHA 1JALA 2VRRB 5LLIA 1T0YA 4JPSA 4WJQA 4M0WA 5AEKB 1WM3A 1EU4A 1HEZE 4DDID 1T6BX 2K5PA 2J4XA 4HPMB 1GG3A 2HTHA 3QK0A 1BUIC 1ZW7A 4N9F4 1YQ3B 4MJSA 5GXGB 3KWVA 1VJKA 1K50A 4GLSC 2DZJA 3LYYA 3RI7C 1BXTA 2KACA 3PZ8A 1MHHE 4L23A 3VTVA 1Z5SB 1D5ZC 2CR5A 2CS4A 4W9CA 2QEJC 1PQSA 4AQ7A 3ZNID 4ZRJA 2FUG1 4GXBA 2INPE 4NAMA 2IPKD 4EUTA 2ZJDA 4A55A 4ANUA 3IFWB 1YX6B 4HRSA 2DX5B 1VCBA 4PYZA 1V5TA 2WXMA 2MJ3A 5E6NA 2I2YA 4W9IA 2V3NA 2GMIC 1AW7A 3N32A 1J7CA 4DXAB 5CX3A 2OHFA 2G3QB 5I4DA 4AOFA 3MHSD 1P9DU 4HXDA 5DPWA 3WAMA 3NVWA 3V60A 4K81A 2K39A 3A9KB 3PPAA 2N9EB 1NYRA 4W9KA 3RNGC 4YSXB 4YL8A 2KLCA 1J7AA 2BB5A 4NZLB 3W9CB 3RNAC 2MJDA 1H4RA 2C5LC 1XEEA 2DENB 2XK5B 1GAQB 1NBFC 3DWGC 1WR6E 2ZW0A 5FR3A 2FCSA 2MBHA 1QOFA 2DZMA 3VR9B 5LXHA 3HM6X 4PT5A 3H8HA 5DPRA 2KTRB 1EWYC 2N7JA 2KVZA 1N5XA 2NBUA 2QILA 2PEAA 3RZFA 2WU5B 4ZRPA 5AZGA 3DVNV 3DVGY 5JHAA 3R3MA 1S1QB 3X23A 1V86A 5G55A 3SFDB 3CWIA 3QX1A 4KV2A 2GRIA 1V8CA 5IKCM 3LXFA 4G0NB 2JYEA 1IGCA 1NEKB 5BMIA 1C1YB 2B76B 1FCCC 4TV3A 2K6QA 1UH6A 1WFYA 3WALA 4PS3A 2KQ7A 1EUVB 1JWMD 4BKSA 2JT4B 5IP4D 2JZZA 2M0XA 1KH0A 3L17A 4URKA 2C7NB 4M00A 4DHZB 3CIRB 3GZNB 1D3ZA 2XN9C 1GNUA 3UQAA 1RRBA 4IM2A 4P1BC 2BTEA 5D3IB 3AEBB 2WGSA 4KKJA 4NJ6A 5G5GA 2QCZA 3ZRCA 1J0GA 5AZFA 2WXRA 1ZP0B 5HKHA 2D2QA 2G45B 1LXDA 2QIEB 2LGYA 4KSKC 1TJEA 2IY0B 1V1PA 2M1MA 4C00A 3KUDB 1YJ1A 2ZEQA 1XLQA 4GN1A 3TUOA 1PFDA 1WX8A 3QCAA 3QHTA 4MH0E 3ZW3A 4YSZB 2N1WA 4A3OA 1JWUD 1BMLC 2LXAA 2LRWA 2IGGA 2LVOA 1MI0A 2KN5A 1KLVA 2VZKD 1ET6A 3P4QB 1IUEA 2KO3A 2N4FA 2JSVX 2L7RA 3KLSX 3RYTA 2I38A 4ANVA 5CHFA 3HUIA 1Z2MA 2KD0A 5BYSA 2MRPA 2RR9A 1WZ3A 2C7HA 1B1ZA 4ZDVA 1WM2A 2NTSA 2CJOA 3ENEA 4GSWA 3Q3OC 5BYRA 3GOEA 4BBNF 1CK1A 2IDYA 3AH7A 2D11A 4P6VF 3MHZA 3N1XC 3IAS1 3NHEB 4HROA 1L4ZB 1XLOA 3WANA 1WX7A 5D6JB 4A90A 3DCGA 5D7GA 5CHWA 5IA7A 1NENB 2MEKA 2KQ4X 4P16A 1J19A 4DXFA 1MJDA 2J42A 2DHZA 4BKSD 2BBCA 2R2QA 1MFWA 1HA5A 4RCOA 2N7DA 2KMCA 5G2NA 1NI2A 2L52A 3MJWA 4YT0B 1C3TA 1E5WA 1TKYA 1WJNA 2YEPB 5DCNA 2L05A 1IBXA 1PDXA 4OZBA 3BYYB
chains in the Genus database with same CATH topology
2O2VA 3ML8A 4HDOA 2KDIA 4AJYB 2XK5A 2REXA 4I6PA 2BKRB 5CHVC 5D2MB 3HHMA 3PGEA 4GGQA 4IUMB 1WRDB 4BKTA 5E6PA 2RPQA 4G3XB 4PYUA 4EEWA 3W1SA 2KNBA 4BKGA 4EZKA 1UGMA 1UELA 3R66C 3SHQA 5E6OA 3DVGX 4LDTD 4MSMB 3PHXB 5JH5C 3WAOA 3TCAA 2IO0B 2WX1A 3HM3A 2V4LA 4W9GA 1P1AA 1V49A 3CSFA 4OVVA 2KWUB 2NS5A 3IHPC 3A33B 1GUAB 1Q0WB 4A20A 4W9DA 1V9JA 1P3QU 1UBQA 2V3SA 1WGGA 3KW5B 3VH3B 1GC7A 4P7IA 2Z0DB 2L0TA 2BYVE 2KVRA 2BWES 1WF9A 4AWJA 1V6EA 2L00B 1I35A 1P98A 2MCNB 4LCDE 4DWFA 2KJRA 2MBQA 3LDZE 4EZJA 2JZ3B 3N3KB 4M8MA 3QJZA 2LJ5A 3VXWA 3Q3FA 5EDSA 3M62B 3R7QA 4BVUC 1X1MA 2DYMA 4ZRIA 3VQIA 3BINA 4KDLB 3KVFB 4DBGA 4XZ4A 1RFAA 2LGXA 5JHBA 1E8YA 1FXTB 2KJ6A 4ZYNA 4DHZE 3S2AA 2PE6B 3DDCB 4TQ0A 2PPHA 3NS8A 2A5UA 2JRHA 2NR2A 4TQ1A 2K8BA 3I3TB 3W1YA 4FJZA 3M3JA 4AJWA 1WE6A 1U4AA 2J0MA 2DYOA 3L13A 4FULA 4HCPB 2M17A 3C0RB 3TBLD 1VD2A 2LI5A 2N9PC 1OQYA 1XQQA 1OEYJ 2NBWB 3ZIMA 4EFOA 4F8CB 3PV1A 1QZEA 3CMMB 2JUOA 3PZDA 4W9EA 3EHVA 3QA8A 4JLCA 2FIFA 1WJ4A 1WMHA 1Y8RC 2MLBA 3APDA 3IBEA 2WX0A 4GDKB 2ASQA 4MM3A 4XC2A 4WWOA 3H6NA 4KIKA 3UIPB 4ANXA 2LGDA 2O6VA 4BOZB 2JXXA 1LFDA 2FUHB 4PS7A 1TGZB 3VTUA 2FCNA 3ZDMC 1F9JA 4ICVA 3V6CB 3VUYA 2O2VB 1XT9B 2PJHA 3PREA 4IM3A 2DAFA 3AXCA 4J6IA 3PLVA 4FHJA 1R4NI 3KYCD 2DZIA 2RGFA 4BOSC 2CKHB 1MG8A 1ZKHA 2VRRB 1E8XA 4I6NB 3ZO5B 5LLIA 2KWCA 1T0YA 2GOWA 2MQJA 4JIOU 3QIJA 2M8SA 2L76A 3APCA 3DVNU 4WJQA 4ANWA 3BY4B 2BYEA 2WDTB 3LJ3A 4HLEA 5AEKB 2ZPNA 1WM3A 4FBJB 4DDID 4HK2A 4E3CA 5C1ZA 1WY8A 1OTRB 4JQWC 2OJRA 4HPMB 1GG3A 2HTHA 2ZPYA 3QK0A 4WWPA 4I6LB 3EC8A 4NAWA 1A5RA 4KVGB 3RT3B 3ZNGC 2ZCCA 2ZNVB 2BGFA 3EFUA 3QAQA 4MGKE 1ZW7A 2W9NA 2ZZPB 4N9F4 2KX0A 3KUZA 2JRIB 4WJPA 4MJSA 3ZUNA 2K8CA 3RZWC 4W9JA 3B08A 4ICUA 3ZNZB 2DZJA 2MSED 2C7MB 2DYBA 4GU2A 3L08A 4CO7A 2CHXA 5IAAC 3VTVA 1E8WA 4LJPB 1Z5SB 3DBHI 2UWQA 2CR5A 2CS4A 2FAZA 4W9CA 1PQSA 1E90A 2FNJB 3PLUA 3MTNB 2JPHA 4MELA 3ZNID 4ZRJA 1OGWA 3TL5A 2G4DB 3PRPB 4GXBA 1IPGA 5J17A 2J0KA 3ALBA 4RM8A 3ZTCA 2ZJDA 4EUTA 1Q1OA 4FJYA 4ANUA 3VHTC 1WYWB 4KIKB 1WGDA 2O6VB 3IFWB 4MSQB 2KC1A 4II2B 1YX6B 2ZCBA 2C60A 5FR6A 4K1RB 5CTRC 2DX5B 1VCBA 4PYZA 4NY0A 2AWTA 1V5TA 5BO4B 2ZVNA 2KTRA 2KDEB 5E6NA 2XBBC 2RD0A 3JSVA 4GOCA 4W9IA 2BKFA 4WWNA 2JF5A 2GMIC 1WH3A 3OAWA 2MBBB 3N32A 4JL9A 4DXAB 2CHWA 3V62A 4EZLA 1RAXA 2AL3A 2A4ZA 4AP4C 4HCNB 4IC7B 3DBRI 3CSTA 3DOWA 2EKEC 1WE7A 4M0WB 1Q5WB 5CX3A 5KHQA 2G3QB 3A1QA 3WA0A 3NOBA 2L0FA 1BT0A 1V2YA 2KQSA 4AOFA 4CHKA 2GBKA 3MHSD 3NZSA 1P9DU 4HXDA 1SGHA 1CMXB 5DPWA 3WAMA 1YQBA 3V60A 2K8HA 4K81A 2O6VD 2K39A 4M8NA 2D3GA 3A9JA 4ASWC 2MBEA 3A9KB 2KANA 3PPAA 2GBNA 5JZEB 2B3AA 2N9EB 1ZGUB 4GDLA 4W9KA 3PVLA 4YL8A 4BBNC 3TMPB 2GBJA 4MJSB 2JVCA 1S3SG 2KLCA 3VVWB 2M4NA 3TIXA 1R4MI 4BFRA 4RM9A 3WIMA 4MGYE 1YD8U 2Z59B 3SDLC 3U7DA 1V5OA 2J0JA 4NQKE 1H4RA 3VAWA 3PSEB 4W9HA 2L8JA 2C5LC 2MX2A 1WXVA 1P0RA 2DENB 2XK5B 3R7RA 4E74A 1H8CA 3ZNHB 2MP2A 1NBFC 1WR6E 3KH0A 1GC6A 3Q3JA 4WJNA 2LUEA 1IYFA 2KKCA 2FCSA 2MBHA 4JGHB 4MDKE 4WAAA 3APFA 2DZMA 1SIFA 5TR5A 3ZKJC 1WXMA 2I1JA 3RUIB 5LXHA 3HM6X 3NY5A 2RSUA 3O65B 3RULA 3B1LX 3DBLI 5DPRA 2KTRB 3ECIA 4IW0A 2ZVOA 3PRZA 3RD2A 3VH4B 4A3PA 2KZRA 2NBUA 5C23A 2IYDB 4FLHA 4XX5A 1V80A 1LQBA 2PEAA 3SU8X 3RZFA 1M94A 1AARA 3DPDA 1IP9A 4ZRKA 4NNJB 5AZGA 3DVNV 2KXJA 3DVGY 3HIZA 3KYDD 1RLFA 2KFKA 5JHAA 3R3MA 1S1QB 5GMVA 3UIOB 3X23A 2AL6A 4FHKA 4F1SA 2I1KA 3AU5A 3IVFA 2FIDA 3T8MA 1V86A 5G55A 2K1FA 2KOXA 3QX1A 4KV2A 2CU1A 2BYFA 1TBEA 4W9FA 3W1SC 3L54A 2N7EA 2KWVB 4X57B 2LRUA 3QQ8B 3KUCB 3QC8B 4K7UA 3U8ZA 1G6JA 4KDIC 4G0NB 2AYOB 3A9JB 1ISNA 1SE9A 1WXAA 3ML9A 2LXCA 4GDLB 2KDBA 1C1YB 1L7YA 4B95A 4TUUA 1HE8A 2HJ8A 1V81A 2BWFA 4B6WA 3H7SA 4TV3A 2KLGA 3AULA 4KSLC 3ZDTA 4E71A 1WI0A 2K6QA 1WMHB 2CHZA 1E8ZA 1UH6A 1WFYA 4KZ0A 4HPLB 1KJTA 3N30A 2PE9A 2J7QB 3L10B 2IBIB 3WALA 2BF8B 4ANVA 2D07B 3RCZA 3H7PA 2KQ7A 4PS3A 4DHJB 1LM8B 3WAPA 1EUVB 2ZNVC 3QARA 2KFJA 2LVQA 2V1YA 3H9DA 3T9LA 2JT4B 2MP2B 2N1VA 4RMAA 5DPTA 3X0WA 4BKSA 2WWZA 2JZZA 2M0XA 2K6DB 3L17A 4URKA 4CYEA 1WIAA 5J18A 2C7NB 4HDQA 1WJ6A 3EECA 2KJHB 4NQLB 2JWZA 2HD5B 2KK8A 1J8CA 3UGBB 2FCMA 2KX3A 1I42A 4DHZB 2UYZB 4GB9A 2XEWA 1D3ZA 3ZTDA 4LJOB 4HJKA 1WZ0A 3VUWA 2LASA 1GNUA 4G11A 3UQAA 5L95C 1RRBA 4IM2A 4IM0A 3PS6A 3UINB 4B9KA 4WQOB 2KHWB 1E7VA 3UF8A 1WGRA 4NJ6A 3OLMD 1EO6A 3ZRCA 2FCQA 4NAWB 1J0GA 2KC2A 3PTFC 5AZFA 2HE7A 4FA6A 2MA9B 3SD5A 1TZ1A 4DHJD 4IWPA 4FADA 2KFKB 5HKHA 2D2QA 2G45B 5J2RA 1LXDA 2IY1B 2LGYA 4KSKC 2IY0B 2Y5BB 2M1MA 3KUDB 1YJ1A 4GIVA 1UBIA 3QWZB 5LXIB 2ZEQA 3NZUA 2NPTA 4NPNA 1KM7A 4GN1A 2G4SA 1WX8A 3QCAA 3QHTA 4GMVA 4MH0E 3ZW3A 4EOYA 2N9XA 3PT2B 3GZNI 3HK0A 2N1WA 2BPSA 4A3OA 2IO3B 2IO1B 4IG7B 3M63B 1L2NA 3VUXA 1K8RB 4MGIE 2GBMA 2LXAA 2LRWA 1NDDA 1UD7A 2IO2B 1OEYA 2KDFB 2LVOA 2Z0EB 2KN5A 3P2BA 4HVBA 1KLVA 2MBOA 2EMSA 4W9LA 3VFKA 4DDGD 2KO3A 3AI5A 2DZKA 2NVUI 3ZRFA 5KHOA 3VTWA 2NCNA 5DPSA 4IWQA 2N4FA 2L7RA 4K7SA 3RYTA 1WGHA 3JVZX 3DBSA 3H7PB 4FJVB 5CHFA 3ZLZA 4G50A 1WXSA 1JRUA 3OJ4B 4HWIB 2MWSB 3M95A 2R2OA 1Z2MA 2OOBB 2KD0A 3B0AA 2JY6A 4F7ZA 2MRPA 3JSVB 1E7UA 2KMAA 2RR9A 1WZ3A 1YX5B 2MW5A 1GJZA 2C7HA 4ZDVA 4IWOA 3A4SC 3PHWB 1WM2A 3OJ3A 3ONSA 4K7WA 3CF6E 2IZVB 2K25A 2YVCA 3IG3A 3ENEA 3JW0X 2LZ6A 4GSWA 2C9WB 5AZHA 3GOEA 4BBNF 4OVUA 3A4RA 4MEMA 2LVPA 3A1QB 1UZXB 1EF1A 4II3B 3L0WB 2D11A 4MGZE 2AEHA 3AU4A 3U30A 1TTNA 4PS8A 3NHEB 3JYUA 1XD3B 4WJOA 3V61A 4LDTB 3WANA 4DK5A 1WX7A 3DQVA 4KZCA 5D6JB 2QHOA 3DCGA 3PRMB 3UQBA 2EMTA 3A9KA 5D7GA 5CHWA 3ZVVA 2NBVB 4FN2A 5IA7A 4AUQC 3D32A 1EF5A 1J19A 2GBRA 3V6EB 4BKSD 2DHZA 1YIWA 2DAJA 2R2QA 4TKNA 2YLMA 1WGYA 3L16A 5D94A 1WR1A 3H1UA 2LWPA 2L3ZA 4NJ7A 2N7DA 4GDKA 1KOTA 2KMCA 1WJUA 5G2NA 2D10A 1NI2A 3MJWA 2NPTB 1WX9A 3VDZA 5L83A 4EKUA 1C3TA 2WYQA 1E5WA 1WJNA 3K9PB 5DCNA 2L05A 3TJPA 2LD9A 2KTFA 3K9OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2V A;  3ML8 A;  4HDO A;  2KDI A;  4AJY B;  2XK5 A;  2REX A;  4I6P A;  2BKR B;  5CHV C;  5D2M B;  3HHM A;  3PGE A;  4GGQ A;  4IUM B;  1WRD B;  4BKT A;  5E6P A;  2RPQ A;  4G3X B;  4PYU A;  4EEW A;  3W1S A;  2KNB A;  4BKG A;  4EZK A;  1UGM A;  1UEL A;  3R66 C;  3SHQ A;  5E6O A;  3DVG X;  4LDT D;  4MSM B;  3PHX B;  5JH5 C;  3WAO A;  3TCA A;  2IO0 B;  2WX1 A;  3HM3 A;  2V4L A;  4W9G A;  1P1A A;  1V49 A;  3CSF A;  4OVV A;  2KWU B;  2NS5 A;  3IHP C;  3A33 B;  1GUA B;  1Q0W B;  4A20 A;  4W9D A;  1V9J A;  1P3Q U;  1UBQ A;  2V3S A;  1WGG A;  3KW5 B;  3VH3 B;  1GC7 A;  4P7I A;  2Z0D B;  2L0T A;  2BYV E;  2KVR A;  2BWE S;  1WF9 A;  4AWJ A;  1V6E A;  2L00 B;  1I35 A;  1P98 A;  2MCN B;  4LCD E;  4DWF A;  2KJR A;  2MBQ A;  3LDZ E;  4EZJ A;  2JZ3 B;  3N3K B;  4M8M A;  3QJZ A;  2LJ5 A;  3VXW A;  3Q3F A;  5EDS A;  3M62 B;  3R7Q A;  4BVU C;  1X1M A;  2DYM A;  4ZRI A;  3VQI A;  3BIN A;  4KDL B;  3KVF B;  4DBG A;  4XZ4 A;  1RFA A;  2LGX A;  5JHB A;  1E8Y A;  1FXT B;  2KJ6 A;  4ZYN A;  4DHZ E;  3S2A A;  2PE6 B;  3DDC B;  4TQ0 A;  2PPH A;  3NS8 A;  2A5U A;  2JRH A;  2NR2 A;  4TQ1 A;  2K8B A;  3I3T B;  3W1Y A;  4FJZ A;  3M3J A;  4AJW A;  1WE6 A;  1U4A A;  2J0M A;  2DYO A;  3L13 A;  4FUL A;  4HCP B;  2M17 A;  3C0R B;  3TBL D;  1VD2 A;  2LI5 A;  2N9P C;  1OQY A;  1XQQ A;  1OEY J;  2NBW B;  3ZIM A;  4EFO A;  4F8C B;  3PV1 A;  1QZE A;  3CMM B;  2JUO A;  3PZD A;  4W9E A;  3EHV A;  3QA8 A;  4JLC A;  2FIF A;  1WJ4 A;  1WMH A;  1Y8R C;  2MLB A;  3APD A;  3IBE A;  2WX0 A;  4GDK B;  2ASQ A;  4MM3 A;  4XC2 A;  4WWO A;  3H6N A;  4KIK A;  3UIP B;  4ANX A;  2LGD A;  2O6V A;  4BOZ B;  2JXX A;  1LFD A;  2FUH B;  4PS7 A;  1TGZ B;  3VTU A;  2FCN A;  3ZDM C;  1F9J A;  4ICV A;  3V6C B;  3VUY A;  2O2V B;  1XT9 B;  2PJH A;  3PRE A;  4IM3 A;  2DAF A;  3AXC A;  4J6I A;  3PLV A;  4FHJ A;  1R4N I;  3KYC D;  2DZI A;  2RGF A;  4BOS C;  2CKH B;  1MG8 A;  1ZKH A;  2VRR B;  1E8X A;  4I6N B;  3ZO5 B;  5LLI A;  2KWC A;  1T0Y A;  2GOW A;  2MQJ A;  4JIO U;  3QIJ A;  2M8S A;  2L76 A;  3APC A;  3DVN U;  4WJQ A;  4ANW A;  3BY4 B;  2BYE A;  2WDT B;  3LJ3 A;  4HLE A;  5AEK B;  2ZPN A;  1WM3 A;  4FBJ B;  4DDI D;  4HK2 A;  4E3C A;  5C1Z A;  1WY8 A;  1OTR B;  4JQW C;  2OJR A;  4HPM B;  1GG3 A;  2HTH A;  2ZPY A;  3QK0 A;  4WWP A;  4I6L B;  3EC8 A;  4NAW A;  1A5R A;  4KVG B;  3RT3 B;  3ZNG C;  2ZCC A;  2ZNV B;  2BGF A;  3EFU A;  3QAQ A;  4MGK E;  1ZW7 A;  2W9N A;  2ZZP B;  4N9F 4;  2KX0 A;  3KUZ A;  2JRI B;  4WJP A;  4MJS A;  3ZUN A;  2K8C A;  3RZW C;  4W9J A;  3B08 A;  4ICU A;  3ZNZ B;  2DZJ A;  2MSE D;  2C7M B;  2DYB A;  4GU2 A;  3L08 A;  4CO7 A;  2CHX A;  5IAA C;  3VTV A;  1E8W A;  4LJP B;  1Z5S B;  3DBH I;  2UWQ A;  2CR5 A;  2CS4 A;  2FAZ A;  4W9C A;  1PQS A;  1E90 A;  2FNJ B;  3PLU A;  3MTN B;  2JPH A;  4MEL A;  3ZNI D;  4ZRJ A;  1OGW A;  3TL5 A;  2G4D B;  3PRP B;  4GXB A;  1IPG A;  5J17 A;  2J0K A;  3ALB A;  4RM8 A;  3ZTC A;  2ZJD A;  4EUT A;  1Q1O A;  4FJY A;  4ANU A;  3VHT C;  1WYW B;  4KIK B;  1WGD A;  2O6V B;  3IFW B;  4MSQ B;  2KC1 A;  4II2 B;  1YX6 B;  2ZCB A;  2C60 A;  5FR6 A;  4K1R B;  5CTR C;  2DX5 B;  1VCB A;  4PYZ A;  4NY0 A;  2AWT A;  1V5T A;  5BO4 B;  2ZVN A;  2KTR A;  2KDE B;  5E6N A;  2XBB C;  2RD0 A;  3JSV A;  4GOC A;  4W9I A;  2BKF A;  4WWN A;  2JF5 A;  2GMI C;  1WH3 A;  3OAW A;  2MBB B;  3N32 A;  4JL9 A;  4DXA B;  2CHW A;  3V62 A;  4EZL A;  1RAX A;  2AL3 A;  2A4Z A;  4AP4 C;  4HCN B;  4IC7 B;  3DBR I;  3CST A;  3DOW A;  2EKE C;  1WE7 A;  4M0W B;  1Q5W B;  5CX3 A;  5KHQ A;  2G3Q B;  3A1Q A;  3WA0 A;  3NOB A;  2L0F A;  1BT0 A;  1V2Y A;  2KQS A;  4AOF A;  4CHK A;  2GBK A;  3MHS D;  3NZS A;  1P9D U;  4HXD A;  1SGH A;  1CMX B;  5DPW A;  3WAM A;  1YQB A;  3V60 A;  2K8H A;  4K81 A;  2O6V D;  2K39 A;  4M8N A;  2D3G A;  3A9J A;  4ASW C;  2MBE A;  3A9K B;  2KAN A;  3PPA A;  2GBN A;  5JZE B;  2B3A A;  2N9E B;  1ZGU B;  4GDL A;  4W9K A;  3PVL A;  4YL8 A;  4BBN C;  3TMP B;  2GBJ A;  4MJS B;  2JVC A;  1S3S G;  2KLC A;  3VVW B;  2M4N A;  3TIX A;  1R4M I;  4BFR A;  4RM9 A;  3WIM A;  4MGY E;  1YD8 U;  2Z59 B;  3SDL C;  3U7D A;  1V5O A;  2J0J A;  4NQK E;  1H4R A;  3VAW A;  3PSE B;  4W9H A;  2L8J A;  2C5L C;  2MX2 A;  1WXV A;  1P0R A;  2DEN B;  2XK5 B;  3R7R A;  4E74 A;  1H8C A;  3ZNH B;  2MP2 A;  1NBF C;  1WR6 E;  3KH0 A;  1GC6 A;  3Q3J A;  4WJN A;  2LUE A;  1IYF A;  2KKC A;  2FCS A;  2MBH A;  4JGH B;  4MDK E;  4WAA A;  3APF A;  2DZM A;  1SIF A;  5TR5 A;  3ZKJ C;  1WXM A;  2I1J A;  3RUI B;  5LXH A;  3HM6 X;  3NY5 A;  2RSU A;  3O65 B;  3RUL A;  3B1L X;  3DBL I;  5DPR A;  2KTR B;  3ECI A;  4IW0 A;  2ZVO A;  3PRZ A;  3RD2 A;  3VH4 B;  4A3P A;  2KZR A;  2NBU A;  5C23 A;  2IYD B;  4FLH A;  4XX5 A;  1V80 A;  1LQB A;  2PEA A;  3SU8 X;  3RZF A;  1M94 A;  1AAR A;  3DPD A;  1IP9 A;  4ZRK A;  4NNJ B;  5AZG A;  3DVN V;  2KXJ A;  3DVG Y;  3HIZ A;  3KYD D;  1RLF A;  2KFK A;  5JHA A;  3R3M A;  1S1Q B;  5GMV A;  3UIO B;  3X23 A;  2AL6 A;  4FHK A;  4F1S A;  2I1K A;  3AU5 A;  3IVF A;  2FID A;  3T8M A;  1V86 A;  5G55 A;  2K1F A;  2KOX A;  3QX1 A;  4KV2 A;  2CU1 A;  2BYF A;  1TBE A;  4W9F A;  3W1S C;  3L54 A;  2N7E A;  2KWV B;  4X57 B;  2LRU A;  3QQ8 B;  3KUC B;  3QC8 B;  4K7U A;  3U8Z A;  1G6J A;  4KDI C;  4G0N B;  2AYO B;  3A9J B;  1ISN A;  1SE9 A;  1WXA A;  3ML9 A;  2LXC A;  4GDL B;  2KDB A;  1C1Y B;  1L7Y A;  4B95 A;  4TUU A;  1HE8 A;  2HJ8 A;  1V81 A;  2BWF A;  4B6W A;  3H7S A;  4TV3 A;  2KLG A;  3AUL A;  4KSL C;  3ZDT A;  4E71 A;  1WI0 A;  2K6Q A;  1WMH B;  2CHZ A;  1E8Z A;  1UH6 A;  1WFY A;  4KZ0 A;  4HPL B;  1KJT A;  3N30 A;  2PE9 A;  2J7Q B;  3L10 B;  2IBI B;  3WAL A;  2BF8 B;  4ANV A;  2D07 B;  3RCZ A;  3H7P A;  2KQ7 A;  4PS3 A;  4DHJ B;  1LM8 B;  3WAP A;  1EUV B;  2ZNV C;  3QAR A;  2KFJ A;  2LVQ A;  2V1Y A;  3H9D A;  3T9L A;  2JT4 B;  2MP2 B;  2N1V A;  4RMA A;  5DPT A;  3X0W A;  4BKS A;  2WWZ A;  2JZZ A;  2M0X A;  2K6D B;  3L17 A;  4URK A;  4CYE A;  1WIA A;  5J18 A;  2C7N B;  4HDQ A;  1WJ6 A;  3EEC A;  2KJH B;  4NQL B;  2JWZ A;  2HD5 B;  2KK8 A;  1J8C A;  3UGB B;  2FCM A;  2KX3 A;  1I42 A;  4DHZ B;  2UYZ B;  4GB9 A;  2XEW A;  1D3Z A;  3ZTD A;  4LJO B;  4HJK A;  1WZ0 A;  3VUW A;  2LAS A;  1GNU A;  4G11 A;  3UQA A;  5L95 C;  1RRB A;  4IM2 A;  4IM0 A;  3PS6 A;  3UIN B;  4B9K A;  4WQO B;  2KHW B;  1E7V A;  3UF8 A;  1WGR A;  4NJ6 A;  3OLM D;  1EO6 A;  3ZRC A;  2FCQ A;  4NAW B;  1J0G A;  2KC2 A;  3PTF C;  5AZF A;  2HE7 A;  4FA6 A;  2MA9 B;  3SD5 A;  1TZ1 A;  4DHJ D;  4IWP A;  4FAD A;  2KFK B;  5HKH A;  2D2Q A;  2G45 B;  5J2R A;  1LXD A;  2IY1 B;  2LGY A;  4KSK C;  2IY0 B;  2Y5B B;  2M1M A;  3KUD B;  1YJ1 A;  4GIV A;  1UBI A;  3QWZ B;  5LXI B;  2ZEQ A;  3NZU A;  2NPT A;  4NPN A;  1KM7 A;  4GN1 A;  2G4S A;  1WX8 A;  3QCA A;  3QHT A;  4GMV A;  4MH0 E;  3ZW3 A;  4EOY A;  2N9X A;  3PT2 B;  3GZN I;  3HK0 A;  2N1W A;  2BPS A;  4A3O A;  2IO3 B;  2IO1 B;  4IG7 B;  3M63 B;  1L2N A;  3VUX A;  1K8R B;  4MGI E;  2GBM A;  2LXA A;  2LRW A;  1NDD A;  1UD7 A;  2IO2 B;  1OEY A;  2KDF B;  2LVO A;  2Z0E B;  2KN5 A;  3P2B A;  4HVB A;  1KLV A;  2MBO A;  2EMS A;  4W9L A;  3VFK A;  4DDG D;  2KO3 A;  3AI5 A;  2DZK A;  2NVU I;  3ZRF A;  5KHO A;  3VTW A;  2NCN A;  5DPS A;  4IWQ A;  2N4F A;  2L7R A;  4K7S A;  3RYT A;  1WGH A;  3JVZ X;  3DBS A;  3H7P B;  4FJV B;  5CHF A;  3ZLZ A;  4G50 A;  1WXS A;  1JRU A;  3OJ4 B;  4HWI B;  2MWS B;  3M95 A;  2R2O A;  1Z2M A;  2OOB B;  2KD0 A;  3B0A A;  2JY6 A;  4F7Z A;  2MRP A;  3JSV B;  1E7U A;  2KMA A;  2RR9 A;  1WZ3 A;  1YX5 B;  2MW5 A;  1GJZ A;  2C7H A;  4ZDV A;  4IWO A;  3A4S C;  3PHW B;  1WM2 A;  3OJ3 A;  3ONS A;  4K7W A;  3CF6 E;  2IZV B;  2K25 A;  2YVC A;  3IG3 A;  3ENE A;  3JW0 X;  2LZ6 A;  4GSW A;  2C9W B;  5AZH A;  3GOE A;  4BBN F;  4OVU A;  3A4R A;  4MEM A;  2LVP A;  3A1Q B;  1UZX B;  1EF1 A;  4II3 B;  3L0W B;  2D11 A;  4MGZ E;  2AEH A;  3AU4 A;  3U30 A;  1TTN A;  4PS8 A;  3NHE B;  3JYU A;  1XD3 B;  4WJO A;  3V61 A;  4LDT B;  3WAN A;  4DK5 A;  1WX7 A;  3DQV A;  4KZC A;  5D6J B;  2QHO A;  3DCG A;  3PRM B;  3UQB A;  2EMT A;  3A9K A;  5D7G A;  5CHW A;  3ZVV A;  2NBV B;  4FN2 A;  5IA7 A;  4AUQ C;  3D32 A;  1EF5 A;  1J19 A;  2GBR A;  3V6E B;  4BKS D;  2DHZ A;  1YIW A;  2DAJ A;  2R2Q A;  4TKN A;  2YLM A;  1WGY A;  3L16 A;  5D94 A;  1WR1 A;  3H1U A;  2LWP A;  2L3Z A;  4NJ7 A;  2N7D A;  4GDK A;  1KOT A;  2KMC A;  1WJU A;  5G2N A;  2D10 A;  1NI2 A;  3MJW A;  2NPT B;  1WX9 A;  3VDZ A;  5L83 A;  4EKU A;  1C3T A;  2WYQ A;  1E5W A;  1WJN A;  3K9P B;  5DCN A;  2L05 A;  3TJP A;  2LD9 A;  2KTF A;  3K9O B; 
#chains in the Genus database with same CATH topology
 1XLP A;  2O2V A;  3ML8 A;  5D2M B;  4GGQ A;  3PGE A;  4IUM B;  5E6P A;  4BKG A;  2KNB A;  1FD6 A;  1UGM A;  1UEL A;  3R66 C;  3SHQ A;  1QT9 A;  2WX1 A;  3AE7 B;  4OVV A;  2WXG A;  4JE3 B;  2K22 A;  3KW5 B;  1OQR A;  4P7I A;  2Z0D B;  2L0T A;  2BYV E;  2KVR A;  4AWJ A;  1I35 A;  2V9H A;  4RF0 A;  2KDM A;  1ENF A;  4KGR A;  2LEK A;  4LCD E;  4DWF A;  3R2T A;  2JZ3 B;  1RYJ A;  2PTL A;  5C2T B;  2JZP A;  3KVF B;  3Q69 A;  4DBG A;  3VR8 B;  2LGX A;  1E8Y A;  1N63 A;  2KJ6 A;  4BAX A;  4DHZ E;  2WXN A;  3DDC B;  1YOV B;  1E10 A;  4RGT A;  2DYO A;  2SAK A;  3C0R B;  2N9P C;  1SE3 A;  1OQY A;  1XQQ A;  1OEY J;  3N20 C;  4EFO A;  4W9E A;  3EHV A;  3APD A;  4YWG G;  3UIP B;  4BOZ B;  2JXX A;  1XCT L;  2FUH B;  3ZDM C;  1TGZ B;  4WWM A;  3SEB A;  2DAF A;  1I4H A;  2JXT A;  3OWE B;  2CKH B;  3ZO5 B;  1ZKH A;  1E8X A;  4LK0 M;  2KWC A;  2MQJ A;  3ZGZ A;  2VH2 A;  1DYQ A;  1QOA A;  3L4P A;  2WDT B;  4FBJ B;  4J3O D;  4E3C A;  2SEB D;  1NI3 A;  1WY8 A;  2WXL A;  2V4I B;  4NAW A;  4KVG B;  2L32 A;  3ZNG C;  4ARC A;  2BGF A;  3EFU A;  1YN4 A;  1YN5 A;  2W9N A;  2ZW1 A;  4WH4 A;  2K8C A;  3B08 A;  3NS1 A;  4ICU A;  4WUR A;  3ZQ4 A;  3ZNZ B;  1N6Z A;  4C4V B;  3L08 A;  4CO7 A;  1E8W A;  4LJP B;  3DBH I;  2GI9 A;  5D3D A;  2FAZ A;  1E90 A;  2FNJ B;  3PLU A;  2WHI A;  3P4P B;  2JPH A;  3IXS A;  3TL5 A;  1SJE D;  1IPG A;  1Q10 A;  4MM3 B;  1Q1O A;  3NG0 A;  4FJY A;  3VHT C;  2PVO D;  4MSQ B;  1IGD A;  1P7F A;  2C60 A;  5BO4 B;  2ZVN A;  3PZ7 A;  2KTR A;  1K53 A;  2HDE A;  4RFB A;  2JF5 A;  3PO0 A;  3OAW A;  3HRD D;  3R8B A;  3V62 A;  1RAX A;  3TSS A;  1SSN A;  2A4Z A;  5G5H A;  3DOW A;  1R4N B;  1I4R A;  1WE7 A;  5KHQ A;  1BT0 A;  2INC C;  2LHD A;  2Y5C A;  3BK1 A;  1SGH A;  4USA A;  4K3B A;  1D5X C;  4JWU C;  3SFE B;  3V05 A;  3AED B;  2Y5P A;  3VRB B;  2LGS A;  4M8N A;  4HEA 1;  2GBN A;  4FXC A;  1ZGU B;  3PVL A;  1L6U A;  1S3S G;  2QJL A;  4N6E B;  3TEW A;  4MGY E;  5IOI A;  3U7D A;  2J0J A;  1WWT A;  3PSE B;  3U2S C;  1DOY A;  5FKA C;  1WXV A;  4E74 A;  3ZNH B;  3KH0 A;  5AUI A;  1GC6 A;  4WJN A;  2LUE A;  1T0R C;  3APF A;  5TR5 A;  1QOG A;  1PGA A;  3RUI B;  3NY5 A;  3AE1 B;  3O65 B;  1FCL A;  3DBL I;  2X8X X;  3NVZ A;  4BZA A;  2ZVO A;  3PRZ A;  4A3P A;  2M19 A;  1XF5 L;  5EE0 A;  2JWU A;  4NNJ B;  3EUB 2;  4IOI E;  2HTM E;  5GMV A;  1F1H A;  4EE2 A;  2I1K A;  2FID A;  3T8M A;  1QF6 A;  2K1F A;  2KOX A;  1TBE A;  2BW2 A;  3W1S C;  3L54 A;  2N7E A;  1G6J A;  4K7U A;  1FFV A;  2AYO B;  3A9J B;  1ISN A;  2LXC A;  2KN4 A;  1L7Y A;  1I4Q A;  4TUU A;  1HE8 A;  2HJ8 A;  3AE8 B;  4B6W A;  3H7S A;  3W5U B;  4E71 A;  1E8Z A;  2ON8 A;  1I7H A;  4HPL B;  3ZJT A;  2D3B A;  2BF8 B;  4DHJ B;  1LM8 B;  3WAP A;  2LVQ A;  3X0W A;  2ONQ A;  2MP2 B;  3AE6 B;  4LNF A;  5J18 A;  1WIA A;  3AV8 A;  3GB1 A;  3BII D;  1WJ6 A;  2KJH B;  1J8C A;  2HD5 B;  2KK8 A;  3UGB B;  1N5W A;  2KX3 A;  2JQR B;  3MC8 A;  4GB9 A;  3ZTD A;  4HJK A;  4YTM B;  5IN7 A;  4G11 A;  5L95 C;  3B2G A;  1TKG A;  4B9K A;  1L6V A;  3Q6B A;  1K51 A;  2FCQ A;  4NAW B;  1EM7 A;  3AEG B;  2KC2 A;  3PTF C;  4FA6 A;  4YXD B;  3KQ4 A;  1KTK A;  4S17 A;  4MAC A;  1TZ1 A;  4HPP A;  4IWP A;  4FAD A;  2KFK B;  2OED A;  4HKZ E;  2BS4 B;  4WIP A;  3NZU A;  1RWS A;  4NPN A;  1KM7 A;  4L1B A;  4RNA A;  4GMV A;  4EOY A;  1ESF A;  4IG7 B;  1N60 A;  1GB1 A;  2W82 A;  2WU2 B;  3VUX A;  1MPE A;  3IT4 B;  1UD7 A;  2IO2 B;  1OEY A;  4US8 A;  3P2B A;  1WGK A;  3VFK A;  3AI5 A;  1L0Y B;  1HTQ A;  1L0X B;  4Q2J A;  1JWB D;  4K7S A;  1WGH A;  3ZLZ A;  3H7P B;  1XLN A;  1JRU A;  2R2O A;  3RNF C;  1E7U A;  2KMA A;  2MW5 A;  4RF1 A;  3Q8C A;  3A4S C;  3ZXV A;  3ONS A;  4K7W A;  4XDC A;  3CF6 E;  2IZV B;  3NRZ A;  3IG3 A;  3ETR A;  2C9W B;  4XDD A;  4II3 B;  3L0W B;  4MGZ E;  2AEH A;  2D3C A;  2PMV A;  1TTN A;  4PS8 A;  3AE9 B;  1XD3 B;  3V61 A;  4LDT B;  2Q5W D;  3PRM B;  3UQB A;  3ZVV A;  4AUQ C;  3BK2 A;  3D32 A;  1SBB B;  1P7E A;  2DAJ A;  4OHJ A;  3HVD A;  1TY2 A;  2DLB A;  2K9X A;  3L16 A;  2LGI A;  3VDZ A;  5L83 A;  4EKU A;  2WYQ A;  3TJP A;  2WDR B;  2KTF A;  4HDO A;  1STE A;  4I6P A;  4M01 A;  5CHV C;  1I4P A;  2RPQ A;  4G3X B;  4PYU A;  2XNA C;  3DVG X;  3PHX B;  5JH5 C;  2IO0 B;  1KLU D;  3NUH B;  3HM3 A;  4ARI A;  3FAH A;  1TS4 A;  3CSF A;  5E6J A;  3IHP C;  3A33 B;  1GUA B;  4R3D A;  1V9J A;  1P3Q U;  1UBQ A;  2V3S A;  3VH3 B;  3BWU D;  1ZUD 2;  4H2A A;  2BWE S;  1WF9 A;  3RN9 C;  2PIA A;  3TEX A;  5BYQ A;  3LDZ E;  4XWT A;  3Q14 C;  2LJ5 A;  4D2K A;  3E9S A;  3M62 B;  3R7Q A;  4BVU C;  1X1M A;  4ZRI A;  4TMA B;  4XZ4 A;  4ZYN A;  3S2A A;  4C4V A;  2PPH A;  2NR2 A;  1UWM A;  3I3T B;  2V0G A;  1WYG A;  4FJZ A;  1C78 A;  3AE5 B;  1WE6 A;  1GPX A;  4FUL A;  4HCP B;  1FM0 D;  1VD2 A;  2LI5 A;  4LNO A;  4F8C B;  3PZD A;  4MH8 A;  2FIF A;  1WJ4 A;  4MM3 A;  4GDK B;  4MGI E;  3V6E B;  2X38 A;  3MJ5 A;  1N62 A;  3VTU A;  1UNS A;  2PJH A;  3Q2A C;  4J6I A;  1QQR A;  3AXC A;  4OVZ A;  3PLV A;  3KYC D;  4BOS C;  2NMQ A;  4ZHP A;  1MG8 A;  2H88 B;  4HKQ A;  2PKO A;  1C4C A;  3HVZ A;  4JIO U;  3DBH B;  3QIJ A;  3UI3 A;  2L76 A;  2WXF A;  2N9L A;  1AYF A;  1C79 A;  1V1O A;  3BY4 B;  4N58 A;  1J7B A;  4HK2 A;  4OZA A;  5C1Z A;  3TEY A;  2OJR A;  2J53 A;  5BMG A;  4WWP A;  2J52 A;  1A5R A;  2QC8 A;  3RT3 B;  2ZCC A;  4MGK E;  3QAQ A;  3N1Z C;  2KX0 A;  2WLB A;  3KUZ A;  3ZUN A;  3ZJV A;  1TY0 A;  2WDQ B;  1TYG B;  1PYW D;  2MSE D;  2Z8L A;  2DYB A;  2CHX A;  1QLB B;  1DGJ A;  1YN3 A;  2D5G A;  4MEL A;  1OGW A;  5J17 A;  3ALB A;  4C80 A;  1HQR D;  1WYW B;  4KIK B;  2IGH A;  2O6V B;  2KC1 A;  2WXQ A;  2V3P A;  3Q3M C;  1CJE A;  4NY0 A;  2KDE B;  3JSV A;  4GOC A;  3SR6 A;  1MHX A;  2LUM A;  1NVI D;  1WH3 A;  1UUP A;  4JL9 A;  4EZL A;  3FKY A;  2G9H D;  2AL3 A;  4HCN B;  3DBR I;  2EKE C;  3U52 E;  1PGX A;  1ACC A;  3A1Q A;  3WA0 A;  3NOB A;  2L0F A;  2LHE A;  2KQS A;  1FNU A;  2IGD A;  3NZS A;  4P1C C;  2VH1 A;  1XO3 A;  1YQB A;  2K8H A;  1QIL A;  3DBL B;  3A9J A;  2KAN A;  2GBJ A;  3P1M A;  3VVW B;  3TIX A;  4HJG E;  1R4M I;  2LFI A;  1T0Q C;  1SE4 A;  4LLG M;  3WIM A;  1YD8 U;  4LNN A;  4DQO C;  1V5O A;  3VAW A;  1ZPS A;  1H8C A;  2MP2 A;  1XCQ L;  3Q3J A;  1N61 A;  1VR9 A;  1IYF A;  2WXP A;  4C7Y A;  3DHG C;  4JGH B;  4MDK E;  1SIF A;  4K3C A;  3ZKJ C;  1VZ6 A;  1WXM A;  1T0S C;  2I1J A;  3U7Z A;  1TKE A;  3RUL A;  1E7P B;  3B1L X;  3ECI A;  4PK1 A;  1D6E C;  3RD2 A;  3V3X A;  5C23 A;  5H8Y E;  2IYD B;  1LQB A;  1M94 A;  3BVG A;  1TT5 B;  1IP9 A;  4YTN B;  2E3T A;  4ZRK A;  4O1N A;  3KYD D;  1RLF A;  2KFK A;  5BMH A;  3BVZ A;  2AL6 A;  1YNT E;  2RMM A;  4QAY A;  3AU5 A;  3IVF A;  1T3Q A;  2RDG A;  4X57 B;  3QQ8 B;  3QC8 B;  3U8Z A;  1YQ4 B;  1LGR A;  4WAF A;  1TS3 A;  4GDL B;  1V81 A;  2WDV B;  3AMZ A;  2KLG A;  1WI0 A;  1ZDV A;  1KJT A;  1QOB A;  2G1E A;  3Q8B A;  4S0R A;  2D07 B;  3RCZ A;  3H7P A;  2ZNV C;  2V1Y A;  1GOZ A;  3T9L A;  2N1V A;  4RMA A;  2WWZ A;  1OFF A;  3AEF B;  4CYE A;  4HDQ A;  3EEC A;  5LNK 1;  4NQL B;  2JWZ A;  2FCM A;  4C56 C;  1I42 A;  3ZXR A;  2UYZ B;  3GP7 A;  2CU3 A;  4IDI A;  1A70 A;  4LJO B;  3P42 A;  1WZ0 A;  2LAS A;  1JWA D;  4IM0 A;  3MFG A;  3PS6 A;  1CZP A;  1C4A A;  2BS3 B;  2W3R A;  3UF8 A;  2MJE A;  3OLM D;  1HZ6 A;  2MA9 B;  3C8Y A;  3SD5 A;  4DHJ D;  2L1A A;  2UU7 A;  4WQM A;  1UBI A;  3QWZ B;  5LXI B;  1ZOY B;  4ZHO A;  3T3O A;  2ICI A;  2G4S A;  2N9X A;  3RNC C;  3BZD B;  3HK0 A;  2IO3 B;  2IO1 B;  3M63 B;  1EWC A;  1L2N A;  1K8R B;  2GBM A;  1NDD A;  2KDF B;  1E0Z A;  2Z0E B;  4HVB A;  2MBO A;  4W9L A;  2DZK A;  2FE8 A;  3ZRF A;  4L2Y A;  3IAM 1;  2NCN A;  5DPS A;  1L4D B;  1TIF A;  3JVZ X;  1CQV A;  4G50 A;  3OJ4 B;  4A8X C;  2MWS B;  3B0A A;  4F7Z A;  3JSV B;  1NYQ A;  4TSS A;  4IWO A;  3PHW B;  3OJ3 A;  4LTU A;  2BYT A;  2YVC A;  4RGN A;  5AZH A;  4MEM A;  3Q8A A;  3A1Q B;  4MT5 A;  1EF1 A;  2TSS A;  1DOX A;  3AU4 A;  3GS2 A;  3JYU A;  2INN E;  1F0Z A;  3DQV A;  3E56 A;  4KZC A;  3BYT B;  2QHO A;  5IO9 A;  5HFY A;  1HXY D;  4KGS A;  1F52 A;  1XXG A;  1YIW A;  3RNB C;  2YLM A;  1B9R A;  1WGY A;  5D94 A;  1WR1 A;  3H1U A;  4KKI A;  2LWP A;  4NJ7 A;  4GDK A;  1WJU A;  2M0A A;  2D10 A;  3AE2 B;  2NPT B;  4ZOH C;  1WX9 A;  2MHJ A;  4AJY B;  2KDI A;  2BKR B;  2M56 B;  3RMK C;  4BKT A;  3W2D A;  2QDF A;  2OJW A;  2W54 A;  1FXI A;  2BQQ A;  4EEW A;  3W1S A;  4EZK A;  1RM6 C;  1FFU A;  5E6O A;  4LDT D;  3WAO A;  3TCA A;  4W9G A;  2V4L A;  1FNW A;  5T8I A;  3I5J C;  3GE8 C;  2KT7 A;  4W9D A;  4A20 A;  5AUK A;  1HTO A;  5MPO A;  1FMA D;  3AN1 A;  1GC7 A;  2EEL A;  4RGO S;  4A9A A;  2BT6 A;  1V6E A;  3I63 C;  2EKI A;  2L83 A;  3GE3 C;  4EZJ A;  5H92 C;  3N3K B;  3VXW A;  3VQI A;  2DYM A;  2K3U A;  3BIN A;  1FXT B;  1JRP A;  4ITK A;  2PE6 B;  2WQY B;  1VDV A;  4TQ1 A;  2K8B A;  3W1Y A;  4AJW A;  2J0M A;  3AB5 A;  3L13 A;  3ZJU A;  2NTT A;  4B0M A;  3TBL D;  2JU6 X;  3ZIM A;  2NBW B;  1QZE A;  3CMM B;  3SDL C;  1WMH A;  1Y8R C;  3IBE A;  4ANX A;  2ASQ A;  4XC2 A;  3H6N A;  4KIK A;  2LGD A;  2O6V A;  2YEP F;  4PS7 A;  2FCN A;  3VUY A;  1FRR A;  4IM3 A;  1YJI A;  4YTP B;  2RDB C;  1R4N I;  4I6N B;  3Q8E A;  3B9J A;  2GOW A;  1YJJ A;  2M8S A;  2GB1 A;  2N0S B;  1K52 A;  2W55 A;  3APC A;  3DVN U;  2E6X A;  3EFC A;  4ANW A;  2BYE A;  4HLE A;  3LJ3 A;  4NJC A;  2ZPN A;  1YMH E;  1ZXH A;  3Q8F A;  3MC0 B;  1OTR B;  4JQW C;  1TS5 A;  2ZPY A;  2Y3A A;  3EC8 A;  4I6L B;  2ZNV B;  5FK9 C;  5TSS A;  2ZZP B;  4WJP A;  1QKZ A;  2JRI B;  3DHH C;  3RZW C;  4W9J A;  4AS1 A;  2QMT A;  2AQ3 B;  3KWL A;  2C7M B;  3DBR B;  4GU2 A;  4LNI A;  5IAA C;  1SXT A;  2UWQ A;  1MVK A;  1E9M A;  3MTN B;  2G4D B;  3PRP B;  4ACF A;  3FC4 A;  2J0K A;  4RM8 A;  3ZTC A;  1KF6 B;  1F2R I;  4KX6 B;  1WGD A;  4N59 A;  1JCK B;  4II2 B;  2ZCB A;  5FR6 A;  4K1R B;  5CTR C;  3U4E G;  2AWT A;  1R4M B;  4RH6 A;  1E6E B;  2XBB C;  2RD0 A;  2BKF A;  4WWN A;  1WRI A;  2MBB B;  2CHW A;  1HZ5 A;  4AP4 C;  4IC7 B;  3CST A;  3J9C A;  4M0W B;  1Q5W B;  1V2Y A;  4CHK A;  2GBK A;  2LMC A;  1CMX B;  4XGA B;  4ZRQ A;  2O6V D;  4XWW A;  1EU3 A;  2D3G A;  4ASW C;  2MBE A;  4C7Z A;  5JZE B;  2B3A A;  4REZ A;  4GDL A;  4BBN C;  3TMP B;  4MJS B;  2JVC A;  4A6Q A;  1I4X A;  5HG2 A;  2PLP A;  3T3N A;  2M4N A;  4BFR A;  2PVG C;  4RM9 A;  5JXV A;  5EE9 A;  3I9V 1;  2Z59 B;  4NQK E;  4W9H A;  2L8J A;  2MX2 A;  1P0R A;  1SIJ A;  2GLS A;  3NZ3 A;  3R7R A;  1T5X D;  1UGJ A;  2KKC A;  3AEE B;  4WAA A;  1VRA B;  2KMM A;  1VZ8 A;  2RSU A;  3P4R B;  4IW0 A;  3VH4 B;  2WNM A;  2KZR A;  4FLH A;  4XX5 A;  1V80 A;  3FIL A;  3SU8 X;  2AQ1 B;  1AAR A;  3DPD A;  1GB4 A;  2ACZ B;  2IND C;  3RFZ B;  3Q3N C;  2IJ0 A;  2KXJ A;  1FO4 A;  3HIZ A;  3UIO B;  4FHK A;  4F1S A;  4CQN A;  2KAJ A;  2CU1 A;  2BYF A;  4W9F A;  1JRO A;  2RDH A;  2KWV B;  2LRU A;  3KUC B;  4KDI C;  1WXA A;  1SE9 A;  3ML9 A;  1L0V B;  2KDB A;  1WSP A;  4B95 A;  3IT6 B;  2WXO A;  4KGT A;  2BWF A;  3AUL A;  2KYW A;  4KSL C;  1F2R C;  1WMH B;  2CHZ A;  4KZ0 A;  3N30 A;  2PE9 A;  1SE2 A;  2J7Q B;  3L10 B;  1ZE3 D;  2IBI B;  1KFY B;  4XYC A;  5EE1 A;  3QAR A;  2KFJ A;  3W5V B;  3H9D A;  5DPT A;  1SEB D;  3ZYY X;  1ZDX A;  2K6D B;  3AE4 B;  4ZYS A;  4M02 A;  1SB3 C;  2LJI A;  2DBY A;  4B0E A;  2XEW A;  4YSY B;  4LNK A;  3VUW A;  2D3A A;  1DOI A;  1FXA A;  1C9F A;  1SF0 A;  1V97 A;  3MC9 A;  3UIN B;  1SJH D;  3RPF C;  4WQO B;  2KHW B;  1E7V A;  2MH7 A;  2WXH A;  2VZK B;  1WGR A;  3NVV A;  1EO6 A;  2R61 A;  2HE7 A;  1TZO A;  1JW9 D;  5J2R A;  2IY1 B;  1KLG D;  1FRD A;  1JQ4 A;  4RGM A;  2Y5B B;  1MG4 A;  4GIV A;  2NPT A;  3AEC B;  1UWX A;  3N1Y C;  1L5P A;  3P63 A;  4US9 A;  3PT2 B;  3GZN I;  2BPS A;  1VZ7 A;  3AE3 B;  4UDU C;  3WCQ A;  3NVY A;  1D4B A;  2EMS A;  4DDG D;  2NVU I;  2WXK A;  5KHO A;  3VTW A;  1C77 A;  4IWQ A;  3DBS A;  4FJV B;  1WXS A;  4HWI B;  1M4V A;  3M95 A;  3N9Y C;  4JWS C;  2JX5 A;  2OOB B;  2JY6 A;  3P4S B;  1GJZ A;  1YX5 B;  2DWQ A;  2WXI A;  1VLB A;  3LB8 C;  2K25 A;  3JW0 X;  2LZ6 A;  2WXJ A;  4OVU A;  3A4R A;  2LVP A;  3URY A;  2DNF A;  1R7S A;  1UZX B;  3DHI C;  3O13 A;  3BVM A;  3U30 A;  4WJO A;  2RPV A;  4DK5 A;  4JX1 C;  3B2F A;  2EMT A;  3A9K A;  2NBV B;  4FN2 A;  5C3J B;  1EF5 A;  4DXG A;  3AEA B;  1TS2 A;  2GBR A;  2AQ2 B;  3MP9 A;  1FPY A;  4IKG A;  4TKN A;  1V1P B;  1JWS D;  3RNE C;  2L3Z A;  2N9K A;  5EE3 A;  1KOT A;  3VRA B;  3K9P B;  2LD9 A;  3K9O B;  3ABV B;  2XK5 A;  1UF0 A;  2REX A;  3HHM A;  1WRD B;  4OW0 A;  2BVC A;  1I4G A;  1Y56 A;  2AX5 A;  2KWD A;  3NJT A;  1C76 A;  2JYT A;  4MSM B;  1D5M C;  3TEZ A;  1P1A A;  1V49 A;  1JML A;  2KWU B;  2NS5 A;  4XE0 A;  1Q0W B;  3DWM A;  1WGG A;  2BS2 B;  3FIL B;  3EA6 A;  3I57 A;  2L00 B;  1P98 A;  1ROE A;  2MCN B;  2KJR A;  1PGB A;  2MBQ A;  1KRH A;  2HJ1 A;  4M8M A;  3QJZ A;  3Q3F A;  5EDS A;  1AN8 A;  1PUT A;  2K0P A;  2QSD A;  4KDL B;  5JHB A;  1RFA A;  2WP9 B;  4TQ0 A;  1ET9 A;  3NS8 A;  2A5U A;  2JRH A;  3AM9 A;  3EGR A;  1AWD A;  3M3J A;  2BB6 A;  1RFK A;  1C4P A;  1U4A A;  3OG5 A;  3C19 A;  2M17 A;  1FNV A;  5HHD G;  2H89 B;  3PV1 A;  2JUO A;  2CJN A;  1WXQ A;  2FBW B;  3R2I A;  3QA8 A;  4JLC A;  2MLB A;  3ZDT A;  1LO5 D;  2WX0 A;  4WWO A;  1LFD A;  4OZC A;  5HI1 A;  1F9J A;  1IBX B;  4ICV A;  1OQQ A;  3V6C B;  2W3S A;  2O2V B;  1XT9 B;  1ZXI A;  2WS3 B;  3PRE A;  1FIQ A;  4FHJ A;  2DZI A;  2PW9 A;  2RGF A;  1F77 A;  1FEH A;  1JAL A;  2VRR B;  5LLI A;  1T0Y A;  4JPS A;  4WJQ A;  4M0W A;  5AEK B;  1WM3 A;  1EU4 A;  1HEZ E;  4DDI D;  1T6B X;  2K5P A;  2J4X A;  4HPM B;  1GG3 A;  2HTH A;  3QK0 A;  1BUI C;  1ZW7 A;  4N9F 4;  1YQ3 B;  4MJS A;  5GXG B;  3KWV A;  1VJK A;  1K50 A;  4GLS C;  2DZJ A;  3LYY A;  3RI7 C;  1BXT A;  2KAC A;  3PZ8 A;  1MHH E;  4L23 A;  3VTV A;  1Z5S B;  1D5Z C;  2CR5 A;  2CS4 A;  4W9C A;  2QEJ C;  1PQS A;  4AQ7 A;  3ZNI D;  4ZRJ A;  2FUG 1;  4GXB A;  2INP E;  4NAM A;  2IPK D;  4EUT A;  2ZJD A;  4A55 A;  4ANU A;  3IFW B;  1YX6 B;  4HRS A;  2DX5 B;  1VCB A;  4PYZ A;  1V5T A;  2WXM A;  2MJ3 A;  5E6N A;  2I2Y A;  4W9I A;  2V3N A;  2GMI C;  1AW7 A;  3N32 A;  1J7C A;  4DXA B;  5CX3 A;  2OHF A;  2G3Q B;  5I4D A;  4AOF A;  3MHS D;  1P9D U;  4HXD A;  5DPW A;  3WAM A;  3NVW A;  3V60 A;  4K81 A;  2K39 A;  3A9K B;  3PPA A;  2N9E B;  1NYR A;  4W9K A;  3RNG C;  4YSX B;  4YL8 A;  2KLC A;  1J7A A;  2BB5 A;  4NZL B;  3W9C B;  3RNA C;  2MJD A;  1H4R A;  2C5L C;  1XEE A;  2DEN B;  2XK5 B;  1GAQ B;  1NBF C;  3DWG C;  1WR6 E;  2ZW0 A;  5FR3 A;  2FCS A;  2MBH A;  1QOF A;  2DZM A;  3VR9 B;  5LXH A;  3HM6 X;  4PT5 A;  3H8H A;  5DPR A;  2KTR B;  1EWY C;  2N7J A;  2KVZ A;  1N5X A;  2NBU A;  2QIL A;  2PEA A;  3RZF A;  2WU5 B;  4ZRP A;  5AZG A;  3DVN V;  3DVG Y;  5JHA A;  3R3M A;  1S1Q B;  3X23 A;  1V86 A;  5G55 A;  3SFD B;  3CWI A;  3QX1 A;  4KV2 A;  2GRI A;  1V8C A;  5IKC M;  3LXF A;  4G0N B;  2JYE A;  1IGC A;  1NEK B;  5BMI A;  1C1Y B;  2B76 B;  1FCC C;  4TV3 A;  2K6Q A;  1UH6 A;  1WFY A;  3WAL A;  4PS3 A;  2KQ7 A;  1EUV B;  1JWM D;  4BKS A;  2JT4 B;  5IP4 D;  2JZZ A;  2M0X A;  1KH0 A;  3L17 A;  4URK A;  2C7N B;  4M00 A;  4DHZ B;  3CIR B;  3GZN B;  1D3Z A;  2XN9 C;  1GNU A;  3UQA A;  1RRB A;  4IM2 A;  4P1B C;  2BTE A;  5D3I B;  3AEB B;  2WGS A;  4KKJ A;  4NJ6 A;  5G5G A;  2QCZ A;  3ZRC A;  1J0G A;  5AZF A;  2WXR A;  1ZP0 B;  5HKH A;  2D2Q A;  2G45 B;  1LXD A;  2QIE B;  2LGY A;  4KSK C;  1TJE A;  2IY0 B;  1V1P A;  2M1M A;  4C00 A;  3KUD B;  1YJ1 A;  2ZEQ A;  1XLQ A;  4GN1 A;  3TUO A;  1PFD A;  1WX8 A;  3QCA A;  3QHT A;  4MH0 E;  3ZW3 A;  4YSZ B;  2N1W A;  4A3O A;  1JWU D;  1BML C;  2LXA A;  2LRW A;  2IGG A;  2LVO A;  1MI0 A;  2KN5 A;  1KLV A;  2VZK D;  1ET6 A;  3P4Q B;  1IUE A;  2KO3 A;  2N4F A;  2JSV X;  2L7R A;  3KLS X;  3RYT A;  2I38 A;  4ANV A;  5CHF A;  3HUI A;  1Z2M A;  2KD0 A;  5BYS A;  2MRP A;  2RR9 A;  1WZ3 A;  2C7H A;  1B1Z A;  4ZDV A;  1WM2 A;  2NTS A;  2CJO A;  3ENE A;  4GSW A;  3Q3O C;  5BYR A;  3GOE A;  4BBN F;  1CK1 A;  2IDY A;  3AH7 A;  2D11 A;  4P6V F;  3MHZ A;  3N1X C;  3IAS 1;  3NHE B;  4HRO A;  1L4Z B;  1XLO A;  3WAN A;  1WX7 A;  5D6J B;  4A90 A;  3DCG A;  5D7G A;  5CHW A;  5IA7 A;  1NEN B;  2MEK A;  2KQ4 X;  4P16 A;  1J19 A;  4DXF A;  1MJD A;  2J42 A;  2DHZ A;  4BKS D;  2BBC A;  2R2Q A;  1MFW A;  1HA5 A;  4RCO A;  2N7D A;  2KMC A;  5G2N A;  1NI2 A;  2L52 A;  3MJW A;  4YT0 B;  1C3T A;  1E5W A;  1TKY A;  1WJN A;  2YEP B;  5DCN A;  2L05 A;  1IBX A;  1PDX A;  4OZB A;  3BYY B; 
#chains in the Genus database with same CATH homology
 2O2V A;  3ML8 A;  4HDO A;  2KDI A;  4AJY B;  2XK5 A;  2REX A;  4I6P A;  2BKR B;  5CHV C;  5D2M B;  3HHM A;  3PGE A;  4GGQ A;  4IUM B;  1WRD B;  4BKT A;  5E6P A;  2RPQ A;  4G3X B;  4PYU A;  4EEW A;  3W1S A;  2KNB A;  4BKG A;  4EZK A;  1UGM A;  1UEL A;  3R66 C;  3SHQ A;  5E6O A;  3DVG X;  4LDT D;  4MSM B;  3PHX B;  5JH5 C;  3WAO A;  3TCA A;  2IO0 B;  2WX1 A;  3HM3 A;  2V4L A;  4W9G A;  1P1A A;  1V49 A;  3CSF A;  4OVV A;  2KWU B;  2NS5 A;  3IHP C;  3A33 B;  1GUA B;  1Q0W B;  4A20 A;  4W9D A;  1V9J A;  1P3Q U;  1UBQ A;  2V3S A;  1WGG A;  3KW5 B;  3VH3 B;  1GC7 A;  4P7I A;  2Z0D B;  2L0T A;  2BYV E;  2KVR A;  2BWE S;  1WF9 A;  4AWJ A;  1V6E A;  2L00 B;  1I35 A;  1P98 A;  2MCN B;  4LCD E;  4DWF A;  2KJR A;  2MBQ A;  3LDZ E;  4EZJ A;  2JZ3 B;  3N3K B;  4M8M A;  3QJZ A;  2LJ5 A;  3VXW A;  3Q3F A;  5EDS A;  3M62 B;  3R7Q A;  4BVU C;  1X1M A;  2DYM A;  4ZRI A;  3VQI A;  3BIN A;  4KDL B;  3KVF B;  4DBG A;  4XZ4 A;  1RFA A;  2LGX A;  5JHB A;  1E8Y A;  1FXT B;  2KJ6 A;  4ZYN A;  4DHZ E;  3S2A A;  2PE6 B;  3DDC B;  4TQ0 A;  2PPH A;  3NS8 A;  2A5U A;  2JRH A;  2NR2 A;  4TQ1 A;  2K8B A;  3I3T B;  3W1Y A;  4FJZ A;  3M3J A;  4AJW A;  1WE6 A;  1U4A A;  2J0M A;  2DYO A;  3L13 A;  4FUL A;  4HCP B;  2M17 A;  3C0R B;  3TBL D;  1VD2 A;  2LI5 A;  2N9P C;  1OQY A;  1XQQ A;  1OEY J;  2NBW B;  3ZIM A;  4EFO A;  4F8C B;  3PV1 A;  1QZE A;  3CMM B;  2JUO A;  3PZD A;  4W9E A;  3EHV A;  3QA8 A;  4JLC A;  2FIF A;  1WJ4 A;  1WMH A;  1Y8R C;  2MLB A;  3APD A;  3IBE A;  2WX0 A;  4GDK B;  2ASQ A;  4MM3 A;  4XC2 A;  4WWO A;  3H6N A;  4KIK A;  3UIP B;  4ANX A;  2LGD A;  2O6V A;  4BOZ B;  2JXX A;  1LFD A;  2FUH B;  4PS7 A;  1TGZ B;  3VTU A;  2FCN A;  3ZDM C;  1F9J A;  4ICV A;  3V6C B;  3VUY A;  2O2V B;  1XT9 B;  2PJH A;  3PRE A;  4IM3 A;  2DAF A;  3AXC A;  4J6I A;  3PLV A;  4FHJ A;  1R4N I;  3KYC D;  2DZI A;  2RGF A;  4BOS C;  2CKH B;  1MG8 A;  1ZKH A;  2VRR B;  1E8X A;  4I6N B;  3ZO5 B;  5LLI A;  2KWC A;  1T0Y A;  2GOW A;  2MQJ A;  4JIO U;  3QIJ A;  2M8S A;  2L76 A;  3APC A;  3DVN U;  4WJQ A;  4ANW A;  3BY4 B;  2BYE A;  2WDT B;  3LJ3 A;  4HLE A;  5AEK B;  2ZPN A;  1WM3 A;  4FBJ B;  4DDI D;  4HK2 A;  4E3C A;  5C1Z A;  1WY8 A;  1OTR B;  4JQW C;  2OJR A;  4HPM B;  1GG3 A;  2HTH A;  2ZPY A;  3QK0 A;  4WWP A;  4I6L B;  3EC8 A;  4NAW A;  1A5R A;  4KVG B;  3RT3 B;  3ZNG C;  2ZCC A;  2ZNV B;  2BGF A;  3EFU A;  3QAQ A;  4MGK E;  1ZW7 A;  2W9N A;  2ZZP B;  4N9F 4;  2KX0 A;  3KUZ A;  2JRI B;  4WJP A;  4MJS A;  3ZUN A;  2K8C A;  3RZW C;  4W9J A;  3B08 A;  4ICU A;  3ZNZ B;  2DZJ A;  2MSE D;  2C7M B;  2DYB A;  4GU2 A;  3L08 A;  4CO7 A;  2CHX A;  5IAA C;  3VTV A;  1E8W A;  4LJP B;  1Z5S B;  3DBH I;  2UWQ A;  2CR5 A;  2CS4 A;  2FAZ A;  4W9C A;  1PQS A;  1E90 A;  2FNJ B;  3PLU A;  3MTN B;  2JPH A;  4MEL A;  3ZNI D;  4ZRJ A;  1OGW A;  3TL5 A;  2G4D B;  3PRP B;  4GXB A;  1IPG A;  5J17 A;  2J0K A;  3ALB A;  4RM8 A;  3ZTC A;  2ZJD A;  4EUT A;  1Q1O A;  4FJY A;  4ANU A;  3VHT C;  1WYW B;  4KIK B;  1WGD A;  2O6V B;  3IFW B;  4MSQ B;  2KC1 A;  4II2 B;  1YX6 B;  2ZCB A;  2C60 A;  5FR6 A;  4K1R B;  5CTR C;  2DX5 B;  1VCB A;  4PYZ A;  4NY0 A;  2AWT A;  1V5T A;  5BO4 B;  2ZVN A;  2KTR A;  2KDE B;  5E6N A;  2XBB C;  2RD0 A;  3JSV A;  4GOC A;  4W9I A;  2BKF A;  4WWN A;  2JF5 A;  2GMI C;  1WH3 A;  3OAW A;  2MBB B;  3N32 A;  4JL9 A;  4DXA B;  2CHW A;  3V62 A;  4EZL A;  1RAX A;  2AL3 A;  2A4Z A;  4AP4 C;  4HCN B;  4IC7 B;  3DBR I;  3CST A;  3DOW A;  2EKE C;  1WE7 A;  4M0W B;  1Q5W B;  5CX3 A;  5KHQ A;  2G3Q B;  3A1Q A;  3WA0 A;  3NOB A;  2L0F A;  1BT0 A;  1V2Y A;  2KQS A;  4AOF A;  4CHK A;  2GBK A;  3MHS D;  3NZS A;  1P9D U;  4HXD A;  1SGH A;  1CMX B;  5DPW A;  3WAM A;  1YQB A;  3V60 A;  2K8H A;  4K81 A;  2O6V D;  2K39 A;  4M8N A;  2D3G A;  3A9J A;  4ASW C;  2MBE A;  3A9K B;  2KAN A;  3PPA A;  2GBN A;  5JZE B;  2B3A A;  2N9E B;  1ZGU B;  4GDL A;  4W9K A;  3PVL A;  4YL8 A;  4BBN C;  3TMP B;  2GBJ A;  4MJS B;  2JVC A;  1S3S G;  2KLC A;  3VVW B;  2M4N A;  3TIX A;  1R4M I;  4BFR A;  4RM9 A;  3WIM A;  4MGY E;  1YD8 U;  2Z59 B;  3SDL C;  3U7D A;  1V5O A;  2J0J A;  4NQK E;  1H4R A;  3VAW A;  3PSE B;  4W9H A;  2L8J A;  2C5L C;  2MX2 A;  1WXV A;  1P0R A;  2DEN B;  2XK5 B;  3R7R A;  4E74 A;  1H8C A;  3ZNH B;  2MP2 A;  1NBF C;  1WR6 E;  3KH0 A;  1GC6 A;  3Q3J A;  4WJN A;  2LUE A;  1IYF A;  2KKC A;  2FCS A;  2MBH A;  4JGH B;  4MDK E;  4WAA A;  3APF A;  2DZM A;  1SIF A;  5TR5 A;  3ZKJ C;  1WXM A;  2I1J A;  3RUI B;  5LXH A;  3HM6 X;  3NY5 A;  2RSU A;  3O65 B;  3RUL A;  3B1L X;  3DBL I;  5DPR A;  2KTR B;  3ECI A;  4IW0 A;  2ZVO A;  3PRZ A;  3RD2 A;  3VH4 B;  4A3P A;  2KZR A;  2NBU A;  5C23 A;  2IYD B;  4FLH A;  4XX5 A;  1V80 A;  1LQB A;  2PEA A;  3SU8 X;  3RZF A;  1M94 A;  1AAR A;  3DPD A;  1IP9 A;  4ZRK A;  4NNJ B;  5AZG A;  3DVN V;  2KXJ A;  3DVG Y;  3HIZ A;  3KYD D;  1RLF A;  2KFK A;  5JHA A;  3R3M A;  1S1Q B;  5GMV A;  3UIO B;  3X23 A;  2AL6 A;  4FHK A;  4F1S A;  2I1K A;  3AU5 A;  3IVF A;  2FID A;  3T8M A;  1V86 A;  5G55 A;  2K1F A;  2KOX A;  3QX1 A;  4KV2 A;  2CU1 A;  2BYF A;  1TBE A;  4W9F A;  3W1S C;  3L54 A;  2N7E A;  2KWV B;  4X57 B;  2LRU A;  3QQ8 B;  3KUC B;  3QC8 B;  4K7U A;  3U8Z A;  1G6J A;  4KDI C;  4G0N B;  2AYO B;  3A9J B;  1ISN A;  1SE9 A;  1WXA A;  3ML9 A;  2LXC A;  4GDL B;  2KDB A;  1C1Y B;  1L7Y A;  4B95 A;  4TUU A;  1HE8 A;  2HJ8 A;  1V81 A;  2BWF A;  4B6W A;  3H7S A;  4TV3 A;  2KLG A;  3AUL A;  4KSL C;  3ZDT A;  4E71 A;  1WI0 A;  2K6Q A;  1WMH B;  2CHZ A;  1E8Z A;  1UH6 A;  1WFY A;  4KZ0 A;  4HPL B;  1KJT A;  3N30 A;  2PE9 A;  2J7Q B;  3L10 B;  2IBI B;  3WAL A;  2BF8 B;  4ANV A;  2D07 B;  3RCZ A;  3H7P A;  2KQ7 A;  4PS3 A;  4DHJ B;  1LM8 B;  3WAP A;  1EUV B;  2ZNV C;  3QAR A;  2KFJ A;  2LVQ A;  2V1Y A;  3H9D A;  3T9L A;  2JT4 B;  2MP2 B;  2N1V A;  4RMA A;  5DPT A;  3X0W A;  4BKS A;  2WWZ A;  2JZZ A;  2M0X A;  2K6D B;  3L17 A;  4URK A;  4CYE A;  1WIA A;  5J18 A;  2C7N B;  4HDQ A;  1WJ6 A;  3EEC A;  2KJH B;  4NQL B;  2JWZ A;  2HD5 B;  2KK8 A;  1J8C A;  3UGB B;  2FCM A;  2KX3 A;  1I42 A;  4DHZ B;  2UYZ B;  4GB9 A;  2XEW A;  1D3Z A;  3ZTD A;  4LJO B;  4HJK A;  1WZ0 A;  3VUW A;  2LAS A;  1GNU A;  4G11 A;  3UQA A;  5L95 C;  1RRB A;  4IM2 A;  4IM0 A;  3PS6 A;  3UIN B;  4B9K A;  4WQO B;  2KHW B;  1E7V A;  3UF8 A;  1WGR A;  4NJ6 A;  3OLM D;  1EO6 A;  3ZRC A;  2FCQ A;  4NAW B;  1J0G A;  2KC2 A;  3PTF C;  5AZF A;  2HE7 A;  4FA6 A;  2MA9 B;  3SD5 A;  1TZ1 A;  4DHJ D;  4IWP A;  4FAD A;  2KFK B;  5HKH A;  2D2Q A;  2G45 B;  5J2R A;  1LXD A;  2IY1 B;  2LGY A;  4KSK C;  2IY0 B;  2Y5B B;  2M1M A;  3KUD B;  1YJ1 A;  4GIV A;  1UBI A;  3QWZ B;  5LXI B;  2ZEQ A;  3NZU A;  2NPT A;  4NPN A;  1KM7 A;  4GN1 A;  2G4S A;  1WX8 A;  3QCA A;  3QHT A;  4GMV A;  4MH0 E;  3ZW3 A;  4EOY A;  2N9X A;  3PT2 B;  3GZN I;  3HK0 A;  2N1W A;  2BPS A;  4A3O A;  2IO3 B;  2IO1 B;  4IG7 B;  3M63 B;  1L2N A;  3VUX A;  1K8R B;  4MGI E;  2GBM A;  2LXA A;  2LRW A;  1NDD A;  1UD7 A;  2IO2 B;  1OEY A;  2KDF B;  2LVO A;  2Z0E B;  2KN5 A;  3P2B A;  4HVB A;  1KLV A;  2MBO A;  2EMS A;  4W9L A;  3VFK A;  4DDG D;  2KO3 A;  3AI5 A;  2DZK A;  2NVU I;  3ZRF A;  5KHO A;  3VTW A;  2NCN A;  5DPS A;  4IWQ A;  2N4F A;  2L7R A;  4K7S A;  3RYT A;  1WGH A;  3JVZ X;  3DBS A;  3H7P B;  4FJV B;  5CHF A;  3ZLZ A;  4G50 A;  1WXS A;  1JRU A;  3OJ4 B;  4HWI B;  2MWS B;  3M95 A;  2R2O A;  1Z2M A;  2OOB B;  2KD0 A;  3B0A A;  2JY6 A;  4F7Z A;  2MRP A;  3JSV B;  1E7U A;  2KMA A;  2RR9 A;  1WZ3 A;  1YX5 B;  2MW5 A;  1GJZ A;  2C7H A;  4ZDV A;  4IWO A;  3A4S C;  3PHW B;  1WM2 A;  3OJ3 A;  3ONS A;  4K7W A;  3CF6 E;  2IZV B;  2K25 A;  2YVC A;  3IG3 A;  3ENE A;  3JW0 X;  2LZ6 A;  4GSW A;  2C9W B;  5AZH A;  3GOE A;  4BBN F;  4OVU A;  3A4R A;  4MEM A;  2LVP A;  3A1Q B;  1UZX B;  1EF1 A;  4II3 B;  3L0W B;  2D11 A;  4MGZ E;  2AEH A;  3AU4 A;  3U30 A;  1TTN A;  4PS8 A;  3NHE B;  3JYU A;  1XD3 B;  4WJO A;  3V61 A;  4LDT B;  3WAN A;  4DK5 A;  1WX7 A;  3DQV A;  4KZC A;  5D6J B;  2QHO A;  3DCG A;  3PRM B;  3UQB A;  2EMT A;  3A9K A;  5D7G A;  5CHW A;  3ZVV A;  2NBV B;  4FN2 A;  5IA7 A;  4AUQ C;  3D32 A;  1EF5 A;  1J19 A;  2GBR A;  3V6E B;  4BKS D;  2DHZ A;  1YIW A;  2DAJ A;  2R2Q A;  4TKN A;  2YLM A;  1WGY A;  3L16 A;  5D94 A;  1WR1 A;  3H1U A;  2LWP A;  2L3Z A;  4NJ7 A;  2N7D A;  4GDK A;  1KOT A;  2KMC A;  1WJU A;  5G2N A;  2D10 A;  1NI2 A;  3MJW A;  2NPT B;  1WX9 A;  3VDZ A;  5L83 A;  4EKU A;  1C3T A;  2WYQ A;  1E5W A;  1WJN A;  3K9P B;  5DCN A;  2L05 A;  3TJP A;  2LD9 A;  2KTF A;  3K9O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...