2DHZA

Solution structure of the ra domain in the human link guanine nucleotide exchange factor ii (link-gefii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
120
structure length
120
Chain Sequence
GSSGSSGDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Rap guanine nucleotide exchange factor (GEF)-like 1
publication title Solution Structure of the RA Domain in the Human Link Guanine Nucleotide Exchange Factor II (Link-GEFII)
rcsb
source organism Homo sapiens
total genus 11
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dhzA01
1WI0A 2KK8A 2O6VD 3QCAA 4WQOB 3AU4A 2N7EA 2R2OA 1PQSA 2AL3A 4W9GA 1OEYJ 3KH0A 2L00B 4RMAA 4EZLA 1V86A 4B6WA 3RT3B 2LASA 4KSKC 3LDZE 4KDLB 1UBIA 2C7HA 2PEAA 3QK0A 4FHKA 4GDKB 5FR6A 4E74A 5AEKB 3PRMB 5G2NA 1WMHA 4FULA 4KDIC 2G4SA 3D32A 4ICUA 2FCNA 4GU2A 4W9JA 3A9JB 3RD2A 1JRUA 1SGHA 4CYEA 1WE7A 4GIVA 3TL5A 4AOFA 1LM8B 3UINB 4KIKA 2UYZB 2CU1A 3H7PB 2PE9A 3L54A 2HJ8A 4MM3A 5LXIB 3Q3FA 1WGDA 3L16A 1WR6E 4PYUA 4IWOA 4BOSC 1U4AA 3JSVB 1P1AA 1WY8A 1YIWA 3ZO5B 1M94A 1WJNA 2KWVB 2EKEC 5JZEB 4HK2A 4GOCA 2O2VB 3VXWA 3IBEA 5JH5C 2ZCBA 2KHWB 3NZSA 3WIMA 2JRIB 1WFYA 2BYFA 1WZ3A 3UGBB 2MQJA 4NPNA 1T0YA 2BF8B 3PHWB 3RUIB 3L08A 4HDOA 5J18A 3ZIMA 2AEHA 4IUMB 4AJYB 4CHKA 2M17A 3H6NA 2CHXA 2CHZA 2KANA 2XEWA 3ENEA 4TKNA 4W9IA 2HTHA 4PYZA 2NPTA 4LCDE 1WM3A 4E3CA 3DVNU 2JRHA 3ZDMC 4MDKE 2G4DB 2LD9A 3CSFA 2L0FA 4F7ZA 1LQBA 3RYTA 2LGDA 2C60A 2D07B 5L83A 1LFDA 2C5LC 3QQ8B 4W9DA 2KJHB 4BFRA 2BWES 1GNUA 1YX6B 2DYBA 4BBNF 2LZ6A 3QWZB 1L7YA 2L8JA 1V5TA 4N9F4 3R7RA 2M1MA 2MBQA 4B95A 3A9KA 2NCNA 2C7MB 1XT9B 2Y5BB 2LUEA 2DZIA 1ZGUB 5AZFA 2LGYA 4LJPB 2YVCA 2BKFA 2KFJA 3APFA 4IC7B 3MTNB 2V1YA 1E8WA 3ML8A 5E6PA 3W1SA 2NVUI 4FBJB 4M0WB 4II2B 5CHWA 2NBWB 5TR5A 2GMIC 4WJPA 3BINA 2DX5B 4FLHA 1OTRB 3QJZA 1WX9A 2JPHA 3OLMD 4DWFA 2OJRA 1EUVB 3KUCB 5IA7A 1IYFA 2KFKB 2IO0B 3L17A 4BVUC 3R7QA 3DBLI 3GZNI 3KUZA 1RFAA 3EC8A 2LI5A 4IW0A 1C1YB 4I6NB 4IWQA 5IAAC 1G6JA 4TQ1A 3K9OB 2JZZA 3QIJA 4MJSA 2AL6A 4OVUA 3WALA 1HE8A 2ZVOA 3QHTA 4FHJA 5CTRC 2KD0A 2DZKA 1WRDB 2KQSA 1Q0WB 2WYQA 3PHXB 1YQBA 1Z5SB 4HJKA 2NS5A 3L0WB 1E7VA 2MCNB 3OJ4B 4HWIB 2M4NA 2O6VB 2REXA 3RZWC 4JQWC 1WXVA 2PJHA 2IBIB 2IYDB 3SHQA 2KWCA 4CO7A 2KLGA 3X0WA 2GOWA 2W9NA 3DVGX 2DZMA 2J0JA 2ZZPB 2ZEQA 4G50A 3U30A 1LXDA 2I1KA 4I6LB 4F8CB 3ML9A 2K8BA 2KTRA 3AI5A 3VVWB 2KMAA 2WDTB 3GOEA 4TUUA 1J8CA 3L13A 2RD0A 5G55A 3M3JA 1SE9A 1WIAA 2LWPA 2HE7A 2LGXA 4MH0E 1E8ZA 2Z0EB 3ZW3A 4NJ7A 3NZUA 5L95C 1WYWB 3CMMB 3APDA 2BGFA 4W9FA 4ANVA 1H4RA 2OOBB 4W9LA 2JY6A 4NNJB 4W9EA 1WX8A 3IFWB 1WJUA 2V3SA 4JGHB 1OGWA 2KJ6A 3W1YA 1L2NA 4J6IA 4A3PA 3V60A 1C3TA 2N9EB 4JL9A 1YJ1A 4IM0A 2MP2A 3PREA 3A1QB 2ZPNA 1TBEA 4NAWB 3ZNID 4BKSA 4EEWA 2GBKA 2LVQA 2KDBA 2JXXA 3I3TB 5JHAA 2Z59B 3B1LX 3ZVVA 3DVGY 2KO3A 5DPRA 1UD7A 2IO2B 4KZCA 2JUOA 3RULA 4DHJD 2LRUA 3HM3A 2WX1A 3VUWA 1A5RA 2K6QA 3DBRI 3PRZA 4FJVB 4IM3A 1UBQA 2KLCA 4MEMA 1WXAA 3IG3A 2LVOA 3PT2B 3TJPA 3UF8A 1WJ4A 3ZNZB 1EO6A 2KX0A 1UGMA 1WGGA 3QAQA 4LDTD 4W9HA 1E7UA 3WA0A 3KYDD 4DDID 3H7SA 3N30A 5EDSA 5E6OA 3U8ZA 4FJYA 3VH4B 2N1VA 3PPAA 4ANUA 1KM7A 3PZDA 3NHEB 1UH6A 2JVCA 3ZKJC 4XC2A 1K8RB 1I42A 3VQIA 1WMHB 3VH3B 3VTUA 1V80A 2ZVNA 3AU5A 2MW5A 2DAJA 1GC7A 3UIOB 2K39A 3EFUA 2GBMA 1BT0A 4KIKB 2K8HA 1V49A 2DYMA 4JLCA 3WAOA 3NOBA 2N9XA 1TTNA 4M8MA 2K6DB 2BYVE 2M8SA 3HM6X 3ONSA 4BKSD 2FNJB 2ZJDA 2N1WA 4DK5A 1WF9A 2JT4B 3KW5B 5CHVC 2J0KA 2RSUA 5J2RA 1D3ZA 4EFOA 3CSTA 4GDLA 2CKHB 1V5OA 2FIFA 4JIOU 4PS8A 2ZPYA 2FIDA 3V6EB 1J19A 2MWSB 4BBNC 4URKA 4MGIE 4EKUA 3QC8B 1WH3A 2KMCA 2FCSA 2MBOA 2FCQA 3UQBA 4ZRKA 3T8MA 1J0GA 5DCNA 1WX7A 2DHZA 2KJRA 2KQ7A 2RPQA 3AXCA 2ASQA 4MGYE 4KVGB 5AZGA 2C9WB 4DXAB 2L7RA 2B3AA 3AULA 4RM9A 2PPHA 3PLVA 1S3SG 2IZVB 3VFKA 4NJ6A 2L76A 4IM2A 3L10B 3C0RB 3V61A 2IO1B 4HLEA 1E90A 4EZJA 3W1SC 3UQAA 3A4SC 1UZXB 2MA9B 1R4MI 4GDKA 3VDZA 3HHMA 1Q5WB 4LJOB 1KLVA 3QA8A 4II3B 2D11A 3VUYA 2G3QB 5CHFA 1H8CA 2JF5A 5AZHA 2IO3B 2KC1A 4GGQA 4ICVA 1WXSA 3A9JA 1P98A 2KDFB 1KOTA 3PV1A 2J0MA 5KHQA 1ISNA 1RAXA 4GN1A 3TMPB 4FJZA 3PLUA 2WX0A 1IPGA 3H7PA 2BWFA 5DPTA 2LXAA 4ZRIA 5DPSA 4G0NB 2G45B 4ASWC 4WJQA 2KN5A 3JSVA 2KC2A 4ANWA 2D2QA 3P2BA 2NBVB 3PSEB 5D7GA 3A9KB 3N32A 4NQLB 4MGZE 1WGRA 3K9PB 4X57B 3WANA 1OQYA 4K7SA 1UELA 2K8CA 2O2VA 3OAWA 3H9DA 4MSMB 2MRPA 3VUXA 2CR5A 1ZW7A 1WGYA 3JYUA 1Y8RC 2KZRA 2MX2A 4G11A 4I6PA 4W9KA 1S1QB 5JHBA 1QZEA 3DBHI 3MJWA 4WWOA 4TV3A 1YD8U 2LXCA 2XK5B 2ZCCA 3T9LA 2IY1B 3DVNV 3HK0A 3DPDA 4BKGA 2L0TA 3JVZX 2RGFA 4HPMB 2MBHA 1YX5B 4AJWA 4DHZB 1OEYA 1WM2A 3O65B 3ZNGC 2KNBA 3SDLC 2XBBC 2EMSA 3ZLZA 2KXJA 3ZRCA 4E71A 1V81A 2ZNVC 3ECIA 5GMVA 2LJ5A 3KYCD 3RCZA 3VAWA 2L3ZA 1TZ1A 4WAAA 1X1MA 5LXHA 1EF1A 2K1FA 2KDIA 2RR9A 3OJ3A 4MJSB 4WJOA 3WAPA 1Z2MA 4EOYA 1EF5A 2FCMA 3U7DA 1WE6A 2AWTA 3A4RA 3LJ3A 3B0AA 4DHJB 4DBGA 2BKRB 1VCBA 4IWPA 1WJ6A 3EHVA 1KJTA 3NY5A 4HVBA 2KTFA 2L05A 4P7IA 4RM8A 4AP4C 4PS3A 4HXDA 2N7DA 2GBNA 4OVVA 5CX3A 2AYOB 1I35A 2N9PC 4ANXA 2BPSA 4FA6A 2EMTA 3X23A 2BYEA 1GJZA 1VD2A 3ZNHB 5DPWA 1NI2A 3EECA 4BKTA 3TBLD 1XD3B 1V6EA 4LDTB 3HIZA 1E8YA 1RLFA 1SIFA 2QHOA 1FXTB 3H1UA 2V4LA 2ZNVB 4ZRJA 3DQVA 2KTRB 4HCNB 3M95A 2JWZA 4AWJA 1F9JA 2KVRA 3QX1A 4KV2A 2KOXA 2MSED 1WR1A 3PTFC 4K1RB 4EZKA 3PS6A 1TGZB 3JW0X 4DHZE 4WWPA 4AUQC 1IP9A 2KFKA 4ZYNA 3KVFB 2K25A 1P3QU 5C1ZA 2LRWA 3B08A 2MBBB 4GSWA 2CS4A 2MLBA 1P9DU 1WXMA 3M63B 4G3XB 4HPLB 3TCAA 1AARA 2MP2B 2NR2A 4KZ0A 2R2QA 3Q3JA 2KKCA 1MG8A 3DCGA 4HDQA 2FUHB 3MHSD 4DDGD 1R4NI 3CF6E 1E5WA 4MSQB 1V2YA 5E6NA 3NS8A 2NBUA 3DOWA 3VHTC 1WZ0A 3IHPC 5LLIA 4MELA 3VTWA 2J7QB 3ZDTA 1XQQA 2WWZA 2YLMA 2FAZA 1V9JA 1GC6A 2N4FA 4FADA 3R66C 4W9CA 1ZKHA 2IY0B 4A3OA 2C7NB 2O6VA 5KHOA 4ZDVA 1P0RA 2NPTB 3WAMA 4F1SA 4YL8A 2KWUB 3PGEA 2DZJA 2A5UA 2LVPA 3SU8X 4K7WA 3SD5A 1NBFC 4TQ0A 5BO4B 3V6CB 4FN2A 4HCPB 4A20A 3DBSA 2DAFA 4GB9A 4KSLC 2DENB 3BY4B 3UIPB 5D94A 5J17A 1E8XA 4NY0A 4NQKE 4MGKE 5C23A 2XK5A 3APCA 3S2AA 3PVLA 3N3KB 1RRBA 1NDDA 1Q1OA 3R3MA 2A4ZA 4IG7B 3ZTCA 4XZ4A 4WJNA 3IVFA 2Z0DB 3TIXA 2I1JA 2MBEA 1GG3A 2M0XA 2UWQA 4EUTA 2D3GA 2GBRA 3ALBA 3ZUNA 5D2MB 2JZ3B 3A33B 4GXBA 3A1QA 4NAWA 4PS7A 2D10A 3DDCB 2DYOA 1WGHA 4B9KA 3QARA 4GDLB 4K81A 2KDEB 2HD5B 1CMXB 4GMVA 3V62A 5HKHA 4K7UA 3PRPB 3VTVA 3ZTDA 4M8NA 4WWNA 2KX3A 2PE6B 2GBJA 4BOZB 1GUAB 2VRRB 3RZFA 3M62B 2CHWA 3KUDB 5D6JB 3ZRFA 4XX5A
chains in the Genus database with same CATH superfamily
1QF6A 2O6VD 4WQOB 4A90A 3AU4A 3IT6B 1M4VA 2L00B 2KACA 1XXGA 1V86A 3RT3B 4KSKC 3LDZE 1T0QC 3I57A 4FHKA 3N1XC 3AE1B 3GB1A 3PRMB 4ZOHC 1WMHA 5MPOA 4YSYB 2V0GA 2D5GA 1SGHA 3ZJVA 3UINB 4ZYSA 2UYZB 2N9KA 3H7PB 4PYUA 4IWOA 1P1AA 4LTUA 2AQ2B 4XDDA 1ZDVA 2EKEC 2Y3AA 2O2VB 4S0RA 2X8XX 2ZCBA 3WIMA 1WZ3A 4ZRQA 2BF8B 1Y56A 3ZIMA 1RFKA 4IUMB 2CHZA 3ENEA 2HTHA 1R4NB 4LCDE 1WM3A 2AQ3B 2TSSA 3Q8BA 1GOZA 2G4DB 4ZRPA 4F7ZA 4K3BA 5L83A 5AUIA 3N1YC 1AYFA 2BWES 1YX6B 2KMMA 1L7YA 1CK1A 4N9F4 2M1MA 3ZJTA 3VRAB 2PKOA 1XT9B 1ZGUB 5AZFA 4YTMB 4J3OD 3AEFB 2V1YA 3ML8A 1JALA 2NVUI 3I5JC 4FBJB 4M0WB 5CHWA 5TR5A 2DX5B 1I7HA 1WX9A 3OLMD 2OJRA 5IA7A 1UWXA 3P4QB 1E9MA 2ON8A 1RFAA 4IW0A 1C1YB 1EU3A 4I6NB 4XWWA 2IJ0A 3QIJA 5C3JB 2PVOD 4DXGA 3FKYA 2QILA 3EFCA 4FHJA 4JQWC 1PGBA 2G9HD 3SHQA 3DVGX 2W9NA 5EE1A 5HI1A 2DZMA 2J0JA 1KH0A 1WYGA 4G50A 4I6LB 2YEPF 2K8BA 4WQMA 3VVWB 1STEA 3AI5A 2WDTB 1WSPA 1T0RC 2LGXA 4MH0E 1TS3A 4NJ7A 3NZUA 5HHDG 1DOYA 4BAXA 1LGRA 5BMHA 1WX8A 3IFWB 2V3SA 2IDYA 1L2NA 4J6IA 2WXNA 3PREA 3A1QB 3BYTB 3W2DA 2JXXA 3B1LX 1UD7A 3C8YA 3RULA 4C7YA 2WX1A 1BUIC 3E56A 4IM3A 1UBQA 3AV8A 3IG3A 2CU3A 3RN9C 3U4EG 1EO6A 1I4GA 3QAQA 1WGGA 4W9HA 1L0VB 3KYDD 3T3NA 2L52A 1QQRA 3H7SA 5EDSA 2L32A 2LHDA 1YN4A 3RNGC 3VH4B 4ANUA 1KM7A 2JVCA 3Q8AA 1WMHB 3TEWA 1GC7A 2WS3B 2K39A 2WXLA 3EFUA 5BYRA 4A8XC 2DYMA 4JLCA 2N9XA 4M8MA 2K6DB 2FE8A 2M8SA 2K9XA 1JWSD 3KW5B 4WAFA 1N60A 4GDLA 1BMLC 4JIOU 2FIDA 2WXQA 4EKUA 1WH3A 2FCSA 1J0GA 5DCNA 2RPQA 5AZGA 3AULA 2PPHA 1S3SG 2MJ3A 3VFKA 4A55A 1TJEA 3C0RB 2IO1B 4HLEA 3W1SC 4XYCA 3NVWA 1UZXB 4WIPA 3HHMA 1KLVA 4LJOB 4O1NA 4US9A 5AZHA 5G5HA 1MI0A 1FO4A 1F0ZA 2WXHA 5KHQA 4C7ZA 1RAXA 3AN1A 2GLSA 3AE2B 3NZ3A 2WX0A 2LUMA 1SB3C 3EA6A 4YTPB 3ZYYX 1QLBB 4OZCA 2QCZA 4ANWA 3P2BA 3PSEB 3N32A 4NQLB 4X57B 4REZA 1F1HA 2ICIA 4JWUC 1ZW7A 1WGYA 1Y8RC 3TEXA 2ONQA 2KN4A 1XCQL 1YD8U 2INNE 4MT5A 3DVNV 1N62A 1PFDA 4RFBA 2L0TA 2RGFA 1YX5B 4AJWA 2BS3B 1WM2A 3ZNGC 3SDLC 1KLGD 5IO9A 2LJ5A 2L3ZA 2N0SB 4WJOA 3WAPA 2JXTA 3U2SC 1WE6A 1ZXIA 4DHJB 1EWCA 1HXYD 1WJ6A 2BB5A 3IT4B 2KTFA 4RH6A 4P7IA 3ZXVA 4N58A 2AYOB 2N9PC 2WXIA 4FA6A 3X23A 2BYEA 1GJZA 5G5GA 3RPFC 3EECA 4BKTA 1ROEA 3TBLD 1RLFA 1QOBA 2QHOA 3H1UA 1FXTB 2V4LA 1QILA 4AWJA 4AQ7A 1EM7A 1FNWA 3Q8EA 4EZKA 3PS6A 4DHZE 4AUQC 1RWSA 2KFKA 4ZYNA 2KYWA 2WLBA 1UNSA 4RF1A 2MBBB 3BVZA 3FILB 3M63B 4HPLB 3TCAA 3Q3JA 2KKCA 3MHSD 4DDGD 1P7FA 3CF6E 3OG5A 4US8A 1YQ4B 4MELA 2LFIA 2Z8LA 1AN8A 2LJIA 3GZNB 4LNOA 4A3OA 5KHOA 1DOIA 2KWUB 2DZJA 1AWDA 3SD5A 4TQ0A 2GRIA 4A20A 3DBSA 4A9AA 4XE0A 3HRDD 1E8XA 4MGKE 2XK5A 1Q1OA 4IG7B 2FUG1 2RDHA 5EE0A 5C2TB 2GBRA 1IBXA 4KGTA 4NAWA 4L1BA 2KWDA 2LGIA 4QAYA 4B9KA 1MVKA 4GDLB 3V3XA 2KDEB 2HD5B 4GMVA 5HKHA 3VTVA 4XGAB 1GUAB 2X38A 3KUDB 3ZRFA 1WI0A 2KK8A 1FMAD 4W9GA 2BB6A 3KH0A 4RMAA 1F2RC 4LK0M 2MHJA 2LASA 4BZAA 2C7HA 3RNAC 4FULA 4ICUA 3CWIA 1JRUA 1SF0A 3GE8C 2IPKD 4AOFA 4KIKA 3UI3A 3RNBC 3L54A 4HKZE 2R61A 1C4PA 1L4DB 2W54A 2G1EA 2KWVB 5JZEB 4GOCA 3SEBA 3BVMA 3VXWA 5JH5C 4MACA 2M19A 2JRIB 2RPVA 1MFWA 1WXQA 2BYFA 2W3SA 3N9YC 2MQJA 2WQYB 4HDOA 4YXDB 1N61A 2DNFA 2CHXA 3EGRA 2MEKA 2XEWA 5I4DA 1IUEA 4PYZA 1F52A 1UF0A 3V05A 1TY2A 2D07B 3NJTA 2L83A 2C5LC 1TYGB 3QQ8B 4W9DA 1C4AA 5HG2A 1FFUA 1JW9D 2LZ6A 3URYA 3L4PA 1V5TA 4B95A 3A9KA 5BMIA 2V9HA 3NUHB 1NI3A 2YVCA 2BKFA 2KFJA 3MTNB 1E8WA 2INPE 5E6PA 5H92C 1VZ7A 1QKZA 3DHHC 4II2B 2NBWB 2GMIC 2JYTA 4WJPA 5E6JA 4OHJA 1OTRB 4K3CA 3KUCB 3RNCC 1IYFA 2KFKB 3KQ4A 3L17A 3R7QA 3SFEB 2JZZA 2AL6A 4OVZA 4OVUA 1I4QA 1KF6B 2KD0A 2KQSA 1YQBA 3LYYA 2NS5A 3OJ4B 2M4NA 1R7SA 2HTME 1TKGA 2REXA 1WXVA 2PJHA 2BS4B 3X0WA 2GOWA 2ZZPB 1LXDA 2DLBA 3ZGZA 4F8CB 2OJWA 3C19A 3B2GA 2KMAA 5HFYA 4TUUA 1J8CA 3L13A 2RD0A 4HRSA 3M3JA 1JWAD 1SE9A 1XEEA 1WIAA 5L95C 2Z0EB 3AB5A 2EKIA 1WYWB 3APDA 2BGFA 4RGOS 4W9FA 4ANVA 1H4RA 2OOBB 4NNJB 1WJUA 4JGHB 1IBXB 1C3TA 2N9EB 3P4PB 4Q2JA 4IM0A 4NAWB 1TBEA 4BKSA 3ZNID 4HKQA 2GBKA 2PIAA 1TS4A 1CJEA 1ZPSA 5JHAA 1N5WA 1JMLA 2IO2B 4DHJD 4WWMA 5FK9C 1WRIA 2LRUA 3B9JA 2K6QA 1SJED 4MEMA 4ACFA 3UF8A 4S17A 1WJ4A 4M02A 2J42A 3KWLA 2WXKA 1UGMA 1XCTL 3SFDB 1PGAA 3N30A 4N59A 5E6OA 3U8ZA 2M56B 3Q2AC 1F77A 3PZDA 3NHEB 1I42A 3AE5B 3VTUA 2ZVNA 3AU5A 1J7BA 2OHFA 2J52A 1SJHD 1YMHE 3UIOB 1T3QA 1BT0A 1XLOA 4KIKB 4KKIA 2BYVE 2FNJB 2WP9B 2ZJDA 2JT4B 2J0KA 5J2RA 2N7JA 3CSTA 3P42A 2CKHB 4RCOA 3TEZA 3MC8A 3V6EB 2MWSB 4BBNC 4TSSA 2MBOA 2FCQA 3UQBA 4ZRKA 4DXFA 4KKJA 2L7RA 4RM9A 2IZVB 2JX5A 2JYEA 4NJ6A 1YN3A 3V61A 3E9SA 4II3B 1ET6A 3VUYA 2G3QB 4YWGG 2JF5A 3KWVA 4GGQA 1P98A 1T0SC 3PV1A 2J0MA 1L4ZB 1SE4A 1ISNA 1C79A 1WWTA 4OZBA 1IPGA 1DOXA 2AQ1B 3T3OA 3JSVA 2DWQA 3A9KB 4YTNB 3WANA 1VZ8A 4K7SA 4MSMB 1E7PB 3H9DA 1TS2A 4W9KA 3JYUA 2V3NA 1I4PA 3P4RB 1QZEA 1ET9A 3MJWA 4C00A 2LXCA 4AS1A 2IY1B 3HK0A 1JCKB 4IKGA 1MPEA 1WGKA 3MP9A 1JWBD 2QIEB 3KYCD 3VAWA 5GXGB 4WAAA 5LXHA 1EF1A 1GB1A 3OJ3A 4WH4A 2FCMA 2WDQB 3Q3NC 3B0AA 4DBGA 4HVBA 4AP4C 4HXDA 2GBNA 2AX5A 3ZNHB 5DPWA 1NI2A 2LGSA 1V6EA 4LDTB 3HIZA 1E8YA 3AM9A 2KT7A 1HA5A 2ZNVB 3TEYA 1TT5B 4HCNB 2JWZA 2XN9C 1F9JA 2KVRA 1PYWD 4KV2A 2KOXA 2MSED 4K1RB 2WU2B 1TGZB 2E6XA 3JW0X 4WWPA 1IP9A 3KVFB 2QDFA 2K25A 1C9FA 1V1OA 3B08A 4GSWA 2CS4A 3BVGA 1AARA 2WXOA 3DCGA 2FUHB 2WU5B 1E5WA 1V2YA 5E6NA 2LMCA 3VHTC 3ZDTA 1XQQA 2YLMA 3AE9B 1OFFA 4JX1C 1E6EB 2N4FA 3R66C 1ZKHA 2IY0B 4C4VA 4P6VF 4OZAA 2JU6X 1TKEA 4K7WA 3V6CB 3OWEB 4FN2A 2DAFA 4KSLC 1DYQA 2DENB 5D94A 4NY0A 3APCA 3S2AA 3PVLA 1OQQA 3AEAB 1RRBA 2FBWB 2KDMA 3R3MA 2Z0DB 2I1JA 2UWQA 1GG3A 1GAQB 4DQOC 2JZ3B 4GXBA 2D10A 2DYOA 1WGHA 3QARA 4K81A 1CMXB 4B0EA 3PRPB 1FFVA 4M8NA 4WWNA 2KX3A 2V3PA 4BOZB 2PLPA 1FEHA 5D6JB 3AECB 1SIJA 3DWGC 4WURA 1D5ZC 4ARIA 2AL3A 3AMZA 1L0YB 2D3CA 4EZLA 2VH1A 1EU4A 4B6WA 2MJDA 4KDLB 1UBIA 4JPSA 2W82A 5FR6A 5FKAC 4KDIC 2FCNA 4W9JA 3RD2A 4CYEA 2NTSA 4GIVA 3TUOA 3TL5A 1SE3A 2CU1A 2JWUA 2PE9A 3HVDA 5LXIB 3Q3FA 1WGDA 3EUB2 3L16A 4BOSC 3JSVB 1WY8A 1YIWA 3ZO5B 1M94A 3MHZA 2Q5WD 4HK2A 2WDVB 1XLNA 3IBEA 1ENFA 1WFYA 1T0YA 5FR3A 3W5VB 3L08A 5J18A 1UUPA 4CHKA 2M17A 3H6NA 2XNAC 4W9IA 2NPTA 1Q10A 3NVVA 4E3CA 1HZ5A 2JRHA 3BZDB 2SEBD 1I4HA 1VR9A 2N9LA 3NVZA 4MDKE 1B1ZA 2JZPA 2LD9A 2C60A 1FXAA 3W9CB 4BFRA 2KJHB 3MJ5A 3W5UB 3BK2A 3QWZB 2L8JA 1OQRA 1VDVA 2NCNA 2C7MB 2Y5BB 2CJNA 2LGYA 4LJPB 2PVGC 4IC7B 3W1SA 2WDRB 1T5XD 1SXTA 2LHEA 3PZ7A 2JPHA 4DWFA 1EUVB 3RNFC 5IP4D 1SE2A 3AE6B 3PZ8A 3DBLI 2WXMA 3KUZA 4IWQA 2DBYA 4TQ1A 1HEZE 3WALA 1HE8A 2ZVOA 3QHTA 4N6EB 3BIID 1JWMD 5CTRC 2DZKA 2JQRB 3I63C 1Z5SB 2INDC 4HJKA 1MG4A 3L0WB 1E7VA 1SEBD 1TZOA 5H8YE 3RZWC 2BVCA 2K22A 2IBIB 2IYDB 2KWCA 4CO7A 2W3RA 4CQNA 1TKYA 3O13A 3ML9A 3MC9A 4KX6B 2KTRA 2W55A 5G55A 1ZP0B 2LWPA 2HE7A 5TSSA 3ZW3A 3RMKC 3CMMB 3KLSX 4W9LA 4W9EA 3AEBB 1OGWA 3W1YA 3ZJUA 1IGDA 1YJ1A 3AE7B 1L5PA 4EEWA 2ZPNA 1K52A 1AW7A 3HUIA 3I3TB 2Z59B 3ZVVA 3DVGY 5DPRA 3DHGC 4KZCA 5BMGA 2JUOA 3HM3A 3VUWA 1A5RA 2WXJA 1KFYB 1WXAA 2LVOA 1VZ6A 3PT2B 3ZNZB 3GS2A 4LDTD 3WA0A 3AH7A 4RGMA 2I38A 4DDID 4FJYA 2IGHA 1DGJA 3PPAA 3ZKJC 4XC2A 1FXIA 1K8RB 3VQIA 1PUTA 4KGRA 2GBMA 3Q8FA 2K8HA 4RF0A 1V49A 3NOBA 1SBBB 3IXSA 4BKSD 4DK5A 1PDXA 3R2IA 1D3ZA 4JE3B 3Q8CA 2ZPYA 1J19A 2K0PA 2KMCA 2D3AA 2WXPA 1L6VA 1WX7A 2DHZA 3GP7A 2KJRA 4MGYE 3DBLB 2ASQA 1LO5D 1YJJA 2C9WB 4DXAB 2B3AA 4HROA 1NYRA 3BWUD 1UGJA 2L76A 2KVZA 4IM2A 2KAJA 1E90A 1L0XB 5IN7A 4EZJA 1ZE3D 3UQAA 3A4SC 2HDEA 2MA9B 1R4MI 4GDKA 3VDZA 1Q5WB 3FAHA 1TY0A 3RNEC 2MJEA 1JWUD 2VZKB 4ITKA 1WXSA 3A9JA 2KDFB 5D3IB 1KOTA 4RGTA 4GN1A 3BYYB 1HZ6A 4FJZA 1QT9A 3PLUA 4JWSC 3TMPB 2BWFA 1D5XC 4ZRIA 2OEDA 4FXCA 4ASWC 2B76B 4WJQA 1B9RA 2MH7A 2NBVB 1WGRA 1UELA 2PW9A 1YOVB 3AE3B 2KZRA 2MX2A 3DBHI 4YSXB 4WWOA 2XK5B 3DPDA 4BKGA 2NMQA 3AE8B 3JVZX 4HPMB 3O65B 3ZRCA 2EMSA 3ZLZA 2KXJA 4E71A 1V81A 4GLSC 1YQ3B 3ECIA 5GMVA 3AEEB 2Y5CA 2M0AA 1RYJA 5IOIA 4USAA 2WGSA 2H89B 1KJTA 2L05A 5AUKA 4PS3A 2N7DA 4B0MA 4ANXA 3NRZA 2EMTA 4MH8A 1VD2A 1RM6C 3GE3C 2L1AA 3DQVA 2KTRB 3M95A 4IDIA 5IKCM 1FCCC 1F2RI 2RDBC 4RNAA 4PT5A 1WR1A 3NG0A 1P3QU 1FNUA 2MLBA 1WXMA 4G3XB 2BS2B 4P16A 3P1MA 2NR2A 4KZ0A 3NS8A 1VLBA 2NBUA 3DOWA 3IHPC 2KQ4X 3VTWA 2WWZA 1FRRA 1K50A 2RDGA 4FADA 4W9CA 1NEKB 2C7NB 1R4MB 2J53A 2O6VA 2EELA 1P0RA 1D5MC 3PGEA 2A5UA 2LVPA 3VR9B 1HQRD 1NBFC 5BO4B 4HCPB 1D4BA 4GB9A 3UIPB 5LNK1 3TSSA 1TIFA 3N3KB 4NAMA 1NDDA 3IVFA 3CIRB 3TIXA 3ZXRA 4EUTA 2INCC 2K5PA 5D2MB 3DBHB 3DDCB 4HEA1 1CZPA 3ZTDA 3RZFA 2VRRB 3M62B 2CHWA 4L2YA 4XX5A 2ACZB 3QCAA 2N7EA 2PMVA 2R2OA 1PQSA 1YJIA 3Q14C 1OEYJ 2ZW1A 1QOAA 4L23A 3ETRA 1V97A 2PEAA 3QK0A 3MC0B 1YN5A 4GDKB 4E74A 5AEKB 1UWMA 1C76A 5G2NA 3H8HA 2G4SA 3D32A 4GU2A 3HVZA 3A9JB 1K51A 4UDUC 4LNKA 4LNIA 1WE7A 1FIQA 1FNVA 1LM8B 4KGSA 2HJ8A 4MM3A 1WR6E 3RI7C 3FILA 1U4AA 1E0ZA 1WJNA 5JXVA 2CJOA 2QEJC 4RGNA 3WCQA 1JQ4A 2KHWB 3NZSA 3UGBB 1ZOYB 4NPNA 1T6BX 3PHWB 3RUIB 2AEHA 4AJYB 5D3DA 2RMMA 3VR8B 1ZDXA 2KANA 4TKNA 4LNFA 3IAM1 2WXGA 1JRPA 3DVNU 3ZDMC 2IGGA 1XLPA 3CSFA 2UU7A 2L0FA 2GB1A 1C4CA 1LQBA 3Q6BA 3RYTA 2LGDA 1NENB 1LFDA 1QOFA 4YT0B 1GNUA 2DYBA 4BBNF 3R7RA 1ZUD2 2MBQA 3N1ZC 2LUEA 2DZIA 3APFA 1D6EC 1PGXA 1ZXHA 4M01A 1BXTA 3R2TA 3B2FA 3BINA 4FLHA 3QJZA 1SSNA 4XDCA 2BW2A 1I4RA 2IO0B 1MJDA 3MFGA 4BVUC 4XWTA 3GZNI 1J7CA 2LI5A 3EC8A 4NJCA 1EWYC 5IAAC 4ZHPA 2VZKD 1G6JA 4P1CC 1IGCA 3K9OB 4MJSA 1XLQA 1GPXA 2QMTA 3DHIC 1WRDB 3BK1A 1Q0WB 3LXFA 1JROA 2WYQA 3PHXB 2MCNB 4HWIB 2O6VB 4LNNA 2KLGA 2WHIA 2ZEQA 3U30A 1NVID 3R8BA 2I1KA 3U7ZA 1ESFA 3RFZB 3GOEA 1VRAB 1I4XA 1E8ZA 1A70A 2JY6A 2SAKA 2KJ6A 4A3PA 3V60A 4JL9A 3ZQ4A 1C77A 2MP2A 2LVQA 3I9V1 1P7EA 2KDBA 2JSVX 2KO3A 5EE3A 2V4IB 3DBRI 3PRZA 4FJVB 4D2KA 3U52E 1N5XA 2KLCA 3TJPA 1VJKA 2KX0A 1E7UA 4PK1A 2YEPB 2N1VA 1FRDA 1HTQA 1UH6A 1MHXA 3VH3B 1V80A 2MW5A 2DAJA 2BQQA 4IOIE 3LB8C 2WXRA 2I2YA 3WAOA 4MM3B 3PO0A 1TTNA 5BYSA 3HM6X 3ONSA 2N1WA 1C78A 1WF9A 5CHVC 2RSUA 4EFOA 1HTOA 3ABVB 1V5OA 2FIFA 4PS8A 2H88B 4URKA 4MGIE 3Q3OC 3QC8B 1V1PA 1XF5L 3T8MA 1V8CA 1J7AA 2KQ7A 3AXCA 3AEDB 4KVGB 2PTLA 1XO3A 3PLVA 4ZHOA 1KRHA 1NYQA 3L10B 3NVYA 3QA8A 2D11A 4NZLB 5CHFA 1H8CA 2IO3B 2KC1A 4ICVA 3VRBB 4ARCA 3AEGB 3H7PA 1MHHE 5DPTA 2LXAA 5DPSA 1N63A 4G0NB 4TMAB 1N6ZA 2G45B 2KN5A 2KC2A 2D2QA 4C4VB 5D7GA 4MGZE 3SR6A 3K9PB 1OQYA 4C80A 2O2VA 2K8CA 3OAWA 2MRPA 3VUXA 2CR5A 4G11A 4I6PA 5JHBA 1S1QB 3P63A 4HPPA 2WXFA 2NTTA 3P4SB 4TV3A 4OW0A 2ZCCA 3T9LA 1KLUD 2MBHA 4DHZB 1OEYA 2KNBA 2XBBC 1FD6A 2ZNVC 3DBRB 3RCZA 1TZ1A 2BYTA 1X1MA 2K1FA 2KDIA 2RR9A 4MJSB 1L6UA 1FCLA 1Z2MA 4EOYA 1EF5A 4M00A 3U7DA 2AWTA 2J4XA 3A4RA 3LJ3A 2BKRB 1VCBA 4IWPA 3EHVA 3NY5A 5T8IA 4A6QA 4RM8A 4C56C 1I35A 2VH2A 4OVVA 5CX3A 2BPSA 4LLGM 3DWMA 1XD3B 1ACCA 1SIFA 3NS1A 3FC4A 1K53A 4ZRJA 4M0WA 4R3DA 3QX1A 4EE2A 3PTFC 3N20C 1CQVA 2BTEA 5C1ZA 2LRWA 1P9DU 2IGDA 2Y5PA 2BT6A 3Q69A 2MP2B 2R2QA 4YSZB 1MG8A 4HDQA 4HJGE 1R4NI 2BBCA 4MSQB 4P1BC 1WZ0A 5LLIA 3AE4B 2J7QB 2FAZA 1V9JA 1FPYA 1GC6A 1QOGA 2E3TA 2GI9A 2D3BA 2QSDA 4ZDVA 4F1SA 2NPTB 3WAMA 4YL8A 3Q3MC 1YNTE 3J9CA 4H2AA 3SU8X 2HJ1A 2LEKA 3BY4B 5J17A 1KTKA 1E10A 1GB4A 4NQKE 5C23A 3ZTCA 2A4ZA 4XZ4A 4WJNA 2MBEA 2M0XA 2D3GA 3ALBA 3ZUNA 3A33B 3A1QA 4PS7A 2QJLA 5EE9A 3IAS1 2K3UA 3V62A 4K7UA 2PE6B 2GBJA 5BYQA 2WNMA 1V1PB 1TS5A 2ZW0A 2QC8A 1FM0D
chains in the Genus database with same CATH topology
1WI0A 2KK8A 2O6VD 3QCAA 4WQOB 3AU4A 2N7EA 2R2OA 1PQSA 2AL3A 4W9GA 1OEYJ 3KH0A 2L00B 4RMAA 4EZLA 1V86A 4B6WA 3RT3B 2LASA 4KSKC 3LDZE 4KDLB 1UBIA 2C7HA 2PEAA 3QK0A 4FHKA 4GDKB 5FR6A 4E74A 5AEKB 3PRMB 5G2NA 1WMHA 4FULA 4KDIC 2G4SA 3D32A 4ICUA 2FCNA 4GU2A 4W9JA 3A9JB 3RD2A 1JRUA 1SGHA 4CYEA 1WE7A 4GIVA 3TL5A 4AOFA 1LM8B 3UINB 4KIKA 2UYZB 2CU1A 3H7PB 2PE9A 3L54A 2HJ8A 4MM3A 5LXIB 3Q3FA 1WGDA 3L16A 1WR6E 4PYUA 4IWOA 4BOSC 1U4AA 3JSVB 1P1AA 1WY8A 1YIWA 3ZO5B 1M94A 1WJNA 2KWVB 2EKEC 5JZEB 4HK2A 4GOCA 2O2VB 3VXWA 3IBEA 5JH5C 2ZCBA 2KHWB 3NZSA 3WIMA 2JRIB 1WFYA 2BYFA 1WZ3A 3UGBB 2MQJA 4NPNA 1T0YA 2BF8B 3PHWB 3RUIB 3L08A 4HDOA 5J18A 3ZIMA 2AEHA 4IUMB 4AJYB 4CHKA 2M17A 3H6NA 2CHXA 2CHZA 2KANA 2XEWA 3ENEA 4TKNA 4W9IA 2HTHA 4PYZA 2NPTA 4LCDE 1WM3A 4E3CA 3DVNU 2JRHA 3ZDMC 4MDKE 2G4DB 2LD9A 3CSFA 2L0FA 4F7ZA 1LQBA 3RYTA 2LGDA 2C60A 2D07B 5L83A 1LFDA 2C5LC 3QQ8B 4W9DA 2KJHB 4BFRA 2BWES 1GNUA 1YX6B 2DYBA 4BBNF 2LZ6A 3QWZB 1L7YA 2L8JA 1V5TA 4N9F4 3R7RA 2M1MA 2MBQA 4B95A 3A9KA 2NCNA 2C7MB 1XT9B 2Y5BB 2LUEA 2DZIA 1ZGUB 5AZFA 2LGYA 4LJPB 2YVCA 2BKFA 2KFJA 3APFA 4IC7B 3MTNB 2V1YA 1E8WA 3ML8A 5E6PA 3W1SA 2NVUI 4FBJB 4M0WB 4II2B 5CHWA 2NBWB 5TR5A 2GMIC 4WJPA 3BINA 2DX5B 4FLHA 1OTRB 3QJZA 1WX9A 2JPHA 3OLMD 4DWFA 2OJRA 1EUVB 3KUCB 5IA7A 1IYFA 2KFKB 2IO0B 3L17A 4BVUC 3R7QA 3DBLI 3GZNI 3KUZA 1RFAA 3EC8A 2LI5A 4IW0A 1C1YB 4I6NB 4IWQA 5IAAC 1G6JA 4TQ1A 3K9OB 2JZZA 3QIJA 4MJSA 2AL6A 4OVUA 3WALA 1HE8A 2ZVOA 3QHTA 4FHJA 5CTRC 2KD0A 2DZKA 1WRDB 2KQSA 1Q0WB 2WYQA 3PHXB 1YQBA 1Z5SB 4HJKA 2NS5A 3L0WB 1E7VA 2MCNB 3OJ4B 4HWIB 2M4NA 2O6VB 2REXA 3RZWC 4JQWC 1WXVA 2PJHA 2IBIB 2IYDB 3SHQA 2KWCA 4CO7A 2KLGA 3X0WA 2GOWA 2W9NA 3DVGX 2DZMA 2J0JA 2ZZPB 2ZEQA 4G50A 3U30A 1LXDA 2I1KA 4I6LB 4F8CB 3ML9A 2K8BA 2KTRA 3AI5A 3VVWB 2KMAA 2WDTB 3GOEA 4TUUA 1J8CA 3L13A 2RD0A 5G55A 3M3JA 1SE9A 1WIAA 2LWPA 2HE7A 2LGXA 4MH0E 1E8ZA 2Z0EB 3ZW3A 4NJ7A 3NZUA 5L95C 1WYWB 3CMMB 3APDA 2BGFA 4W9FA 4ANVA 1H4RA 2OOBB 4W9LA 2JY6A 4NNJB 4W9EA 1WX8A 3IFWB 1WJUA 2V3SA 4JGHB 1OGWA 2KJ6A 3W1YA 1L2NA 4J6IA 4A3PA 3V60A 1C3TA 2N9EB 4JL9A 1YJ1A 4IM0A 2MP2A 3PREA 3A1QB 2ZPNA 1TBEA 4NAWB 3ZNID 4BKSA 4EEWA 2GBKA 2LVQA 2KDBA 2JXXA 3I3TB 5JHAA 2Z59B 3B1LX 3ZVVA 3DVGY 2KO3A 5DPRA 1UD7A 2IO2B 4KZCA 2JUOA 3RULA 4DHJD 2LRUA 3HM3A 2WX1A 3VUWA 1A5RA 2K6QA 3DBRI 3PRZA 4FJVB 4IM3A 1UBQA 2KLCA 4MEMA 1WXAA 3IG3A 2LVOA 3PT2B 3TJPA 3UF8A 1WJ4A 3ZNZB 1EO6A 2KX0A 1UGMA 1WGGA 3QAQA 4LDTD 4W9HA 1E7UA 3WA0A 3KYDD 4DDID 3H7SA 3N30A 5EDSA 5E6OA 3U8ZA 4FJYA 3VH4B 2N1VA 3PPAA 4ANUA 1KM7A 3PZDA 3NHEB 1UH6A 2JVCA 3ZKJC 4XC2A 1K8RB 1I42A 3VQIA 1WMHB 3VH3B 3VTUA 1V80A 2ZVNA 3AU5A 2MW5A 2DAJA 1GC7A 3UIOB 2K39A 3EFUA 2GBMA 1BT0A 4KIKB 2K8HA 1V49A 2DYMA 4JLCA 3WAOA 3NOBA 2N9XA 1TTNA 4M8MA 2K6DB 2BYVE 2M8SA 3HM6X 3ONSA 4BKSD 2FNJB 2ZJDA 2N1WA 4DK5A 1WF9A 2JT4B 3KW5B 5CHVC 2J0KA 2RSUA 5J2RA 1D3ZA 4EFOA 3CSTA 4GDLA 2CKHB 1V5OA 2FIFA 4JIOU 4PS8A 2ZPYA 2FIDA 3V6EB 1J19A 2MWSB 4BBNC 4URKA 4MGIE 4EKUA 3QC8B 1WH3A 2KMCA 2FCSA 2MBOA 2FCQA 3UQBA 4ZRKA 3T8MA 1J0GA 5DCNA 1WX7A 2DHZA 2KJRA 2KQ7A 2RPQA 3AXCA 2ASQA 4MGYE 4KVGB 5AZGA 2C9WB 4DXAB 2L7RA 2B3AA 3AULA 4RM9A 2PPHA 3PLVA 1S3SG 2IZVB 3VFKA 4NJ6A 2L76A 4IM2A 3L10B 3C0RB 3V61A 2IO1B 4HLEA 1E90A 4EZJA 3W1SC 3UQAA 3A4SC 1UZXB 2MA9B 1R4MI 4GDKA 3VDZA 3HHMA 1Q5WB 4LJOB 1KLVA 3QA8A 4II3B 2D11A 3VUYA 2G3QB 5CHFA 1H8CA 2JF5A 5AZHA 2IO3B 2KC1A 4GGQA 4ICVA 1WXSA 3A9JA 1P98A 2KDFB 1KOTA 3PV1A 2J0MA 5KHQA 1ISNA 1RAXA 4GN1A 3TMPB 4FJZA 3PLUA 2WX0A 1IPGA 3H7PA 2BWFA 5DPTA 2LXAA 4ZRIA 5DPSA 4G0NB 2G45B 4ASWC 4WJQA 2KN5A 3JSVA 2KC2A 4ANWA 2D2QA 3P2BA 2NBVB 3PSEB 5D7GA 3A9KB 3N32A 4NQLB 4MGZE 1WGRA 3K9PB 4X57B 3WANA 1OQYA 4K7SA 1UELA 2K8CA 2O2VA 3OAWA 3H9DA 4MSMB 2MRPA 3VUXA 2CR5A 1ZW7A 1WGYA 3JYUA 1Y8RC 2KZRA 2MX2A 4G11A 4I6PA 4W9KA 1S1QB 5JHBA 1QZEA 3DBHI 3MJWA 4WWOA 4TV3A 1YD8U 2LXCA 2XK5B 2ZCCA 3T9LA 2IY1B 3DVNV 3HK0A 3DPDA 4BKGA 2L0TA 3JVZX 2RGFA 4HPMB 2MBHA 1YX5B 4AJWA 4DHZB 1OEYA 1WM2A 3O65B 3ZNGC 2KNBA 3SDLC 2XBBC 2EMSA 3ZLZA 2KXJA 3ZRCA 4E71A 1V81A 2ZNVC 3ECIA 5GMVA 2LJ5A 3KYCD 3RCZA 3VAWA 2L3ZA 1TZ1A 4WAAA 1X1MA 5LXHA 1EF1A 2K1FA 2KDIA 2RR9A 3OJ3A 4MJSB 4WJOA 3WAPA 1Z2MA 4EOYA 1EF5A 2FCMA 3U7DA 1WE6A 2AWTA 3A4RA 3LJ3A 3B0AA 4DHJB 4DBGA 2BKRB 1VCBA 4IWPA 1WJ6A 3EHVA 1KJTA 3NY5A 4HVBA 2KTFA 2L05A 4P7IA 4RM8A 4AP4C 4PS3A 4HXDA 2N7DA 2GBNA 4OVVA 5CX3A 2AYOB 1I35A 2N9PC 4ANXA 2BPSA 4FA6A 2EMTA 3X23A 2BYEA 1GJZA 1VD2A 3ZNHB 5DPWA 1NI2A 3EECA 4BKTA 3TBLD 1XD3B 1V6EA 4LDTB 3HIZA 1E8YA 1RLFA 1SIFA 2QHOA 1FXTB 3H1UA 2V4LA 2ZNVB 4ZRJA 3DQVA 2KTRB 4HCNB 3M95A 2JWZA 4AWJA 1F9JA 2KVRA 3QX1A 4KV2A 2KOXA 2MSED 1WR1A 3PTFC 4K1RB 4EZKA 3PS6A 1TGZB 3JW0X 4DHZE 4WWPA 4AUQC 1IP9A 2KFKA 4ZYNA 3KVFB 2K25A 1P3QU 5C1ZA 2LRWA 3B08A 2MBBB 4GSWA 2CS4A 2MLBA 1P9DU 1WXMA 3M63B 4G3XB 4HPLB 3TCAA 1AARA 2MP2B 2NR2A 4KZ0A 2R2QA 3Q3JA 2KKCA 1MG8A 3DCGA 4HDQA 2FUHB 3MHSD 4DDGD 1R4NI 3CF6E 1E5WA 4MSQB 1V2YA 5E6NA 3NS8A 2NBUA 3DOWA 3VHTC 1WZ0A 3IHPC 5LLIA 4MELA 3VTWA 2J7QB 3ZDTA 1XQQA 2WWZA 2YLMA 2FAZA 1V9JA 1GC6A 2N4FA 4FADA 3R66C 4W9CA 1ZKHA 2IY0B 4A3OA 2C7NB 2O6VA 5KHOA 4ZDVA 1P0RA 2NPTB 3WAMA 4F1SA 4YL8A 2KWUB 3PGEA 2DZJA 2A5UA 2LVPA 3SU8X 4K7WA 3SD5A 1NBFC 4TQ0A 5BO4B 3V6CB 4FN2A 4HCPB 4A20A 3DBSA 2DAFA 4GB9A 4KSLC 2DENB 3BY4B 3UIPB 5D94A 5J17A 1E8XA 4NY0A 4NQKE 4MGKE 5C23A 2XK5A 3APCA 3S2AA 3PVLA 3N3KB 1RRBA 1NDDA 1Q1OA 3R3MA 2A4ZA 4IG7B 3ZTCA 4XZ4A 4WJNA 3IVFA 2Z0DB 3TIXA 2I1JA 2MBEA 1GG3A 2M0XA 2UWQA 4EUTA 2D3GA 2GBRA 3ALBA 3ZUNA 5D2MB 2JZ3B 3A33B 4GXBA 3A1QA 4NAWA 4PS7A 2D10A 3DDCB 2DYOA 1WGHA 4B9KA 3QARA 4GDLB 4K81A 2KDEB 2HD5B 1CMXB 4GMVA 3V62A 5HKHA 4K7UA 3PRPB 3VTVA 3ZTDA 4M8NA 4WWNA 2KX3A 2PE6B 2GBJA 4BOZB 1GUAB 2VRRB 3RZFA 3M62B 2CHWA 3KUDB 5D6JB 3ZRFA 4XX5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WI0 A;  2KK8 A;  2O6V D;  3QCA A;  4WQO B;  3AU4 A;  2N7E A;  2R2O A;  1PQS A;  2AL3 A;  4W9G A;  1OEY J;  3KH0 A;  2L00 B;  4RMA A;  4EZL A;  1V86 A;  4B6W A;  3RT3 B;  2LAS A;  4KSK C;  3LDZ E;  4KDL B;  1UBI A;  2C7H A;  2PEA A;  3QK0 A;  4FHK A;  4GDK B;  5FR6 A;  4E74 A;  5AEK B;  3PRM B;  5G2N A;  1WMH A;  4FUL A;  4KDI C;  2G4S A;  3D32 A;  4ICU A;  2FCN A;  4GU2 A;  4W9J A;  3A9J B;  3RD2 A;  1JRU A;  1SGH A;  4CYE A;  1WE7 A;  4GIV A;  3TL5 A;  4AOF A;  1LM8 B;  3UIN B;  4KIK A;  2UYZ B;  2CU1 A;  3H7P B;  2PE9 A;  3L54 A;  2HJ8 A;  4MM3 A;  5LXI B;  3Q3F A;  1WGD A;  3L16 A;  1WR6 E;  4PYU A;  4IWO A;  4BOS C;  1U4A A;  3JSV B;  1P1A A;  1WY8 A;  1YIW A;  3ZO5 B;  1M94 A;  1WJN A;  2KWV B;  2EKE C;  5JZE B;  4HK2 A;  4GOC A;  2O2V B;  3VXW A;  3IBE A;  5JH5 C;  2ZCB A;  2KHW B;  3NZS A;  3WIM A;  2JRI B;  1WFY A;  2BYF A;  1WZ3 A;  3UGB B;  2MQJ A;  4NPN A;  1T0Y A;  2BF8 B;  3PHW B;  3RUI B;  3L08 A;  4HDO A;  5J18 A;  3ZIM A;  2AEH A;  4IUM B;  4AJY B;  4CHK A;  2M17 A;  3H6N A;  2CHX A;  2CHZ A;  2KAN A;  2XEW A;  3ENE A;  4TKN A;  4W9I A;  2HTH A;  4PYZ A;  2NPT A;  4LCD E;  1WM3 A;  4E3C A;  3DVN U;  2JRH A;  3ZDM C;  4MDK E;  2G4D B;  2LD9 A;  3CSF A;  2L0F A;  4F7Z A;  1LQB A;  3RYT A;  2LGD A;  2C60 A;  2D07 B;  5L83 A;  1LFD A;  2C5L C;  3QQ8 B;  4W9D A;  2KJH B;  4BFR A;  2BWE S;  1GNU A;  1YX6 B;  2DYB A;  4BBN F;  2LZ6 A;  3QWZ B;  1L7Y A;  2L8J A;  1V5T A;  4N9F 4;  3R7R A;  2M1M A;  2MBQ A;  4B95 A;  3A9K A;  2NCN A;  2C7M B;  1XT9 B;  2Y5B B;  2LUE A;  2DZI A;  1ZGU B;  5AZF A;  2LGY A;  4LJP B;  2YVC A;  2BKF A;  2KFJ A;  3APF A;  4IC7 B;  3MTN B;  2V1Y A;  1E8W A;  3ML8 A;  5E6P A;  3W1S A;  2NVU I;  4FBJ B;  4M0W B;  4II2 B;  5CHW A;  2NBW B;  5TR5 A;  2GMI C;  4WJP A;  3BIN A;  2DX5 B;  4FLH A;  1OTR B;  3QJZ A;  1WX9 A;  2JPH A;  3OLM D;  4DWF A;  2OJR A;  1EUV B;  3KUC B;  5IA7 A;  1IYF A;  2KFK B;  2IO0 B;  3L17 A;  4BVU C;  3R7Q A;  3DBL I;  3GZN I;  3KUZ A;  1RFA A;  3EC8 A;  2LI5 A;  4IW0 A;  1C1Y B;  4I6N B;  4IWQ A;  5IAA C;  1G6J A;  4TQ1 A;  3K9O B;  2JZZ A;  3QIJ A;  4MJS A;  2AL6 A;  4OVU A;  3WAL A;  1HE8 A;  2ZVO A;  3QHT A;  4FHJ A;  5CTR C;  2KD0 A;  2DZK A;  1WRD B;  2KQS A;  1Q0W B;  2WYQ A;  3PHX B;  1YQB A;  1Z5S B;  4HJK A;  2NS5 A;  3L0W B;  1E7V A;  2MCN B;  3OJ4 B;  4HWI B;  2M4N A;  2O6V B;  2REX A;  3RZW C;  4JQW C;  1WXV A;  2PJH A;  2IBI B;  2IYD B;  3SHQ A;  2KWC A;  4CO7 A;  2KLG A;  3X0W A;  2GOW A;  2W9N A;  3DVG X;  2DZM A;  2J0J A;  2ZZP B;  2ZEQ A;  4G50 A;  3U30 A;  1LXD A;  2I1K A;  4I6L B;  4F8C B;  3ML9 A;  2K8B A;  2KTR A;  3AI5 A;  3VVW B;  2KMA A;  2WDT B;  3GOE A;  4TUU A;  1J8C A;  3L13 A;  2RD0 A;  5G55 A;  3M3J A;  1SE9 A;  1WIA A;  2LWP A;  2HE7 A;  2LGX A;  4MH0 E;  1E8Z A;  2Z0E B;  3ZW3 A;  4NJ7 A;  3NZU A;  5L95 C;  1WYW B;  3CMM B;  3APD A;  2BGF A;  4W9F A;  4ANV A;  1H4R A;  2OOB B;  4W9L A;  2JY6 A;  4NNJ B;  4W9E A;  1WX8 A;  3IFW B;  1WJU A;  2V3S A;  4JGH B;  1OGW A;  2KJ6 A;  3W1Y A;  1L2N A;  4J6I A;  4A3P A;  3V60 A;  1C3T A;  2N9E B;  4JL9 A;  1YJ1 A;  4IM0 A;  2MP2 A;  3PRE A;  3A1Q B;  2ZPN A;  1TBE A;  4NAW B;  3ZNI D;  4BKS A;  4EEW A;  2GBK A;  2LVQ A;  2KDB A;  2JXX A;  3I3T B;  5JHA A;  2Z59 B;  3B1L X;  3ZVV A;  3DVG Y;  2KO3 A;  5DPR A;  1UD7 A;  2IO2 B;  4KZC A;  2JUO A;  3RUL A;  4DHJ D;  2LRU A;  3HM3 A;  2WX1 A;  3VUW A;  1A5R A;  2K6Q A;  3DBR I;  3PRZ A;  4FJV B;  4IM3 A;  1UBQ A;  2KLC A;  4MEM A;  1WXA A;  3IG3 A;  2LVO A;  3PT2 B;  3TJP A;  3UF8 A;  1WJ4 A;  3ZNZ B;  1EO6 A;  2KX0 A;  1UGM A;  1WGG A;  3QAQ A;  4LDT D;  4W9H A;  1E7U A;  3WA0 A;  3KYD D;  4DDI D;  3H7S A;  3N30 A;  5EDS A;  5E6O A;  3U8Z A;  4FJY A;  3VH4 B;  2N1V A;  3PPA A;  4ANU A;  1KM7 A;  3PZD A;  3NHE B;  1UH6 A;  2JVC A;  3ZKJ C;  4XC2 A;  1K8R B;  1I42 A;  3VQI A;  1WMH B;  3VH3 B;  3VTU A;  1V80 A;  2ZVN A;  3AU5 A;  2MW5 A;  2DAJ A;  1GC7 A;  3UIO B;  2K39 A;  3EFU A;  2GBM A;  1BT0 A;  4KIK B;  2K8H A;  1V49 A;  2DYM A;  4JLC A;  3WAO A;  3NOB A;  2N9X A;  1TTN A;  4M8M A;  2K6D B;  2BYV E;  2M8S A;  3HM6 X;  3ONS A;  4BKS D;  2FNJ B;  2ZJD A;  2N1W A;  4DK5 A;  1WF9 A;  2JT4 B;  3KW5 B;  5CHV C;  2J0K A;  2RSU A;  5J2R A;  1D3Z A;  4EFO A;  3CST A;  4GDL A;  2CKH B;  1V5O A;  2FIF A;  4JIO U;  4PS8 A;  2ZPY A;  2FID A;  3V6E B;  1J19 A;  2MWS B;  4BBN C;  4URK A;  4MGI E;  4EKU A;  3QC8 B;  1WH3 A;  2KMC A;  2FCS A;  2MBO A;  2FCQ A;  3UQB A;  4ZRK A;  3T8M A;  1J0G A;  5DCN A;  1WX7 A;  2DHZ A;  2KJR A;  2KQ7 A;  2RPQ A;  3AXC A;  2ASQ A;  4MGY E;  4KVG B;  5AZG A;  2C9W B;  4DXA B;  2L7R A;  2B3A A;  3AUL A;  4RM9 A;  2PPH A;  3PLV A;  1S3S G;  2IZV B;  3VFK A;  4NJ6 A;  2L76 A;  4IM2 A;  3L10 B;  3C0R B;  3V61 A;  2IO1 B;  4HLE A;  1E90 A;  4EZJ A;  3W1S C;  3UQA A;  3A4S C;  1UZX B;  2MA9 B;  1R4M I;  4GDK A;  3VDZ A;  3HHM A;  1Q5W B;  4LJO B;  1KLV A;  3QA8 A;  4II3 B;  2D11 A;  3VUY A;  2G3Q B;  5CHF A;  1H8C A;  2JF5 A;  5AZH A;  2IO3 B;  2KC1 A;  4GGQ A;  4ICV A;  1WXS A;  3A9J A;  1P98 A;  2KDF B;  1KOT A;  3PV1 A;  2J0M A;  5KHQ A;  1ISN A;  1RAX A;  4GN1 A;  3TMP B;  4FJZ A;  3PLU A;  2WX0 A;  1IPG A;  3H7P A;  2BWF A;  5DPT A;  2LXA A;  4ZRI A;  5DPS A;  4G0N B;  2G45 B;  4ASW C;  4WJQ A;  2KN5 A;  3JSV A;  2KC2 A;  4ANW A;  2D2Q A;  3P2B A;  2NBV B;  3PSE B;  5D7G A;  3A9K B;  3N32 A;  4NQL B;  4MGZ E;  1WGR A;  3K9P B;  4X57 B;  3WAN A;  1OQY A;  4K7S A;  1UEL A;  2K8C A;  2O2V A;  3OAW A;  3H9D A;  4MSM B;  2MRP A;  3VUX A;  2CR5 A;  1ZW7 A;  1WGY A;  3JYU A;  1Y8R C;  2KZR A;  2MX2 A;  4G11 A;  4I6P A;  4W9K A;  1S1Q B;  5JHB A;  1QZE A;  3DBH I;  3MJW A;  4WWO A;  4TV3 A;  1YD8 U;  2LXC A;  2XK5 B;  2ZCC A;  3T9L A;  2IY1 B;  3DVN V;  3HK0 A;  3DPD A;  4BKG A;  2L0T A;  3JVZ X;  2RGF A;  4HPM B;  2MBH A;  1YX5 B;  4AJW A;  4DHZ B;  1OEY A;  1WM2 A;  3O65 B;  3ZNG C;  2KNB A;  3SDL C;  2XBB C;  2EMS A;  3ZLZ A;  2KXJ A;  3ZRC A;  4E71 A;  1V81 A;  2ZNV C;  3ECI A;  5GMV A;  2LJ5 A;  3KYC D;  3RCZ A;  3VAW A;  2L3Z A;  1TZ1 A;  4WAA A;  1X1M A;  5LXH A;  1EF1 A;  2K1F A;  2KDI A;  2RR9 A;  3OJ3 A;  4MJS B;  4WJO A;  3WAP A;  1Z2M A;  4EOY A;  1EF5 A;  2FCM A;  3U7D A;  1WE6 A;  2AWT A;  3A4R A;  3LJ3 A;  3B0A A;  4DHJ B;  4DBG A;  2BKR B;  1VCB A;  4IWP A;  1WJ6 A;  3EHV A;  1KJT A;  3NY5 A;  4HVB A;  2KTF A;  2L05 A;  4P7I A;  4RM8 A;  4AP4 C;  4PS3 A;  4HXD A;  2N7D A;  2GBN A;  4OVV A;  5CX3 A;  2AYO B;  1I35 A;  2N9P C;  4ANX A;  2BPS A;  4FA6 A;  2EMT A;  3X23 A;  2BYE A;  1GJZ A;  1VD2 A;  3ZNH B;  5DPW A;  1NI2 A;  3EEC A;  4BKT A;  3TBL D;  1XD3 B;  1V6E A;  4LDT B;  3HIZ A;  1E8Y A;  1RLF A;  1SIF A;  2QHO A;  1FXT B;  3H1U A;  2V4L A;  2ZNV B;  4ZRJ A;  3DQV A;  2KTR B;  4HCN B;  3M95 A;  2JWZ A;  4AWJ A;  1F9J A;  2KVR A;  3QX1 A;  4KV2 A;  2KOX A;  2MSE D;  1WR1 A;  3PTF C;  4K1R B;  4EZK A;  3PS6 A;  1TGZ B;  3JW0 X;  4DHZ E;  4WWP A;  4AUQ C;  1IP9 A;  2KFK A;  4ZYN A;  3KVF B;  2K25 A;  1P3Q U;  5C1Z A;  2LRW A;  3B08 A;  2MBB B;  4GSW A;  2CS4 A;  2MLB A;  1P9D U;  1WXM A;  3M63 B;  4G3X B;  4HPL B;  3TCA A;  1AAR A;  2MP2 B;  2NR2 A;  4KZ0 A;  2R2Q A;  3Q3J A;  2KKC A;  1MG8 A;  3DCG A;  4HDQ A;  2FUH B;  3MHS D;  4DDG D;  1R4N I;  3CF6 E;  1E5W A;  4MSQ B;  1V2Y A;  5E6N A;  3NS8 A;  2NBU A;  3DOW A;  3VHT C;  1WZ0 A;  3IHP C;  5LLI A;  4MEL A;  3VTW A;  2J7Q B;  3ZDT A;  1XQQ A;  2WWZ A;  2YLM A;  2FAZ A;  1V9J A;  1GC6 A;  2N4F A;  4FAD A;  3R66 C;  4W9C A;  1ZKH A;  2IY0 B;  4A3O A;  2C7N B;  2O6V A;  5KHO A;  4ZDV A;  1P0R A;  2NPT B;  3WAM A;  4F1S A;  4YL8 A;  2KWU B;  3PGE A;  2DZJ A;  2A5U A;  2LVP A;  3SU8 X;  4K7W A;  3SD5 A;  1NBF C;  4TQ0 A;  5BO4 B;  3V6C B;  4FN2 A;  4HCP B;  4A20 A;  3DBS A;  2DAF A;  4GB9 A;  4KSL C;  2DEN B;  3BY4 B;  3UIP B;  5D94 A;  5J17 A;  1E8X A;  4NY0 A;  4NQK E;  4MGK E;  5C23 A;  2XK5 A;  3APC A;  3S2A A;  3PVL A;  3N3K B;  1RRB A;  1NDD A;  1Q1O A;  3R3M A;  2A4Z A;  4IG7 B;  3ZTC A;  4XZ4 A;  4WJN A;  3IVF A;  2Z0D B;  3TIX A;  2I1J A;  2MBE A;  1GG3 A;  2M0X A;  2UWQ A;  4EUT A;  2D3G A;  2GBR A;  3ALB A;  3ZUN A;  5D2M B;  2JZ3 B;  3A33 B;  4GXB A;  3A1Q A;  4NAW A;  4PS7 A;  2D10 A;  3DDC B;  2DYO A;  1WGH A;  4B9K A;  3QAR A;  4GDL B;  4K81 A;  2KDE B;  2HD5 B;  1CMX B;  4GMV A;  3V62 A;  5HKH A;  4K7U A;  3PRP B;  3VTV A;  3ZTD A;  4M8N A;  4WWN A;  2KX3 A;  2PE6 B;  2GBJ A;  4BOZ B;  1GUA B;  2VRR B;  3RZF A;  3M62 B;  2CHW A;  3KUD B;  5D6J B;  3ZRF A;  4XX5 A; 
#chains in the Genus database with same CATH topology
 1QF6 A;  2O6V D;  4WQO B;  4A90 A;  3AU4 A;  3IT6 B;  1M4V A;  2L00 B;  2KAC A;  1XXG A;  1V86 A;  3RT3 B;  4KSK C;  3LDZ E;  1T0Q C;  3I57 A;  4FHK A;  3N1X C;  3AE1 B;  3GB1 A;  3PRM B;  4ZOH C;  1WMH A;  5MPO A;  4YSY B;  2V0G A;  2D5G A;  1SGH A;  3ZJV A;  3UIN B;  4ZYS A;  2UYZ B;  2N9K A;  3H7P B;  4PYU A;  4IWO A;  1P1A A;  4LTU A;  2AQ2 B;  4XDD A;  1ZDV A;  2EKE C;  2Y3A A;  2O2V B;  4S0R A;  2X8X X;  2ZCB A;  3WIM A;  1WZ3 A;  4ZRQ A;  2BF8 B;  1Y56 A;  3ZIM A;  1RFK A;  4IUM B;  2CHZ A;  3ENE A;  2HTH A;  1R4N B;  4LCD E;  1WM3 A;  2AQ3 B;  2TSS A;  3Q8B A;  1GOZ A;  2G4D B;  4ZRP A;  4F7Z A;  4K3B A;  5L83 A;  5AUI A;  3N1Y C;  1AYF A;  2BWE S;  1YX6 B;  2KMM A;  1L7Y A;  1CK1 A;  4N9F 4;  2M1M A;  3ZJT A;  3VRA B;  2PKO A;  1XT9 B;  1ZGU B;  5AZF A;  4YTM B;  4J3O D;  3AEF B;  2V1Y A;  3ML8 A;  1JAL A;  2NVU I;  3I5J C;  4FBJ B;  4M0W B;  5CHW A;  5TR5 A;  2DX5 B;  1I7H A;  1WX9 A;  3OLM D;  2OJR A;  5IA7 A;  1UWX A;  3P4Q B;  1E9M A;  2ON8 A;  1RFA A;  4IW0 A;  1C1Y B;  1EU3 A;  4I6N B;  4XWW A;  2IJ0 A;  3QIJ A;  5C3J B;  2PVO D;  4DXG A;  3FKY A;  2QIL A;  3EFC A;  4FHJ A;  4JQW C;  1PGB A;  2G9H D;  3SHQ A;  3DVG X;  2W9N A;  5EE1 A;  5HI1 A;  2DZM A;  2J0J A;  1KH0 A;  1WYG A;  4G50 A;  4I6L B;  2YEP F;  2K8B A;  4WQM A;  3VVW B;  1STE A;  3AI5 A;  2WDT B;  1WSP A;  1T0R C;  2LGX A;  4MH0 E;  1TS3 A;  4NJ7 A;  3NZU A;  5HHD G;  1DOY A;  4BAX A;  1LGR A;  5BMH A;  1WX8 A;  3IFW B;  2V3S A;  2IDY A;  1L2N A;  4J6I A;  2WXN A;  3PRE A;  3A1Q B;  3BYT B;  3W2D A;  2JXX A;  3B1L X;  1UD7 A;  3C8Y A;  3RUL A;  4C7Y A;  2WX1 A;  1BUI C;  3E56 A;  4IM3 A;  1UBQ A;  3AV8 A;  3IG3 A;  2CU3 A;  3RN9 C;  3U4E G;  1EO6 A;  1I4G A;  3QAQ A;  1WGG A;  4W9H A;  1L0V B;  3KYD D;  3T3N A;  2L52 A;  1QQR A;  3H7S A;  5EDS A;  2L32 A;  2LHD A;  1YN4 A;  3RNG C;  3VH4 B;  4ANU A;  1KM7 A;  2JVC A;  3Q8A A;  1WMH B;  3TEW A;  1GC7 A;  2WS3 B;  2K39 A;  2WXL A;  3EFU A;  5BYR A;  4A8X C;  2DYM A;  4JLC A;  2N9X A;  4M8M A;  2K6D B;  2FE8 A;  2M8S A;  2K9X A;  1JWS D;  3KW5 B;  4WAF A;  1N60 A;  4GDL A;  1BML C;  4JIO U;  2FID A;  2WXQ A;  4EKU A;  1WH3 A;  2FCS A;  1J0G A;  5DCN A;  2RPQ A;  5AZG A;  3AUL A;  2PPH A;  1S3S G;  2MJ3 A;  3VFK A;  4A55 A;  1TJE A;  3C0R B;  2IO1 B;  4HLE A;  3W1S C;  4XYC A;  3NVW A;  1UZX B;  4WIP A;  3HHM A;  1KLV A;  4LJO B;  4O1N A;  4US9 A;  5AZH A;  5G5H A;  1MI0 A;  1FO4 A;  1F0Z A;  2WXH A;  5KHQ A;  4C7Z A;  1RAX A;  3AN1 A;  2GLS A;  3AE2 B;  3NZ3 A;  2WX0 A;  2LUM A;  1SB3 C;  3EA6 A;  4YTP B;  3ZYY X;  1QLB B;  4OZC A;  2QCZ A;  4ANW A;  3P2B A;  3PSE B;  3N32 A;  4NQL B;  4X57 B;  4REZ A;  1F1H A;  2ICI A;  4JWU C;  1ZW7 A;  1WGY A;  1Y8R C;  3TEX A;  2ONQ A;  2KN4 A;  1XCQ L;  1YD8 U;  2INN E;  4MT5 A;  3DVN V;  1N62 A;  1PFD A;  4RFB A;  2L0T A;  2RGF A;  1YX5 B;  4AJW A;  2BS3 B;  1WM2 A;  3ZNG C;  3SDL C;  1KLG D;  5IO9 A;  2LJ5 A;  2L3Z A;  2N0S B;  4WJO A;  3WAP A;  2JXT A;  3U2S C;  1WE6 A;  1ZXI A;  4DHJ B;  1EWC A;  1HXY D;  1WJ6 A;  2BB5 A;  3IT4 B;  2KTF A;  4RH6 A;  4P7I A;  3ZXV A;  4N58 A;  2AYO B;  2N9P C;  2WXI A;  4FA6 A;  3X23 A;  2BYE A;  1GJZ A;  5G5G A;  3RPF C;  3EEC A;  4BKT A;  1ROE A;  3TBL D;  1RLF A;  1QOB A;  2QHO A;  3H1U A;  1FXT B;  2V4L A;  1QIL A;  4AWJ A;  4AQ7 A;  1EM7 A;  1FNW A;  3Q8E A;  4EZK A;  3PS6 A;  4DHZ E;  4AUQ C;  1RWS A;  2KFK A;  4ZYN A;  2KYW A;  2WLB A;  1UNS A;  4RF1 A;  2MBB B;  3BVZ A;  3FIL B;  3M63 B;  4HPL B;  3TCA A;  3Q3J A;  2KKC A;  3MHS D;  4DDG D;  1P7F A;  3CF6 E;  3OG5 A;  4US8 A;  1YQ4 B;  4MEL A;  2LFI A;  2Z8L A;  1AN8 A;  2LJI A;  3GZN B;  4LNO A;  4A3O A;  5KHO A;  1DOI A;  2KWU B;  2DZJ A;  1AWD A;  3SD5 A;  4TQ0 A;  2GRI A;  4A20 A;  3DBS A;  4A9A A;  4XE0 A;  3HRD D;  1E8X A;  4MGK E;  2XK5 A;  1Q1O A;  4IG7 B;  2FUG 1;  2RDH A;  5EE0 A;  5C2T B;  2GBR A;  1IBX A;  4KGT A;  4NAW A;  4L1B A;  2KWD A;  2LGI A;  4QAY A;  4B9K A;  1MVK A;  4GDL B;  3V3X A;  2KDE B;  2HD5 B;  4GMV A;  5HKH A;  3VTV A;  4XGA B;  1GUA B;  2X38 A;  3KUD B;  3ZRF A;  1WI0 A;  2KK8 A;  1FMA D;  4W9G A;  2BB6 A;  3KH0 A;  4RMA A;  1F2R C;  4LK0 M;  2MHJ A;  2LAS A;  4BZA A;  2C7H A;  3RNA C;  4FUL A;  4ICU A;  3CWI A;  1JRU A;  1SF0 A;  3GE8 C;  2IPK D;  4AOF A;  4KIK A;  3UI3 A;  3RNB C;  3L54 A;  4HKZ E;  2R61 A;  1C4P A;  1L4D B;  2W54 A;  2G1E A;  2KWV B;  5JZE B;  4GOC A;  3SEB A;  3BVM A;  3VXW A;  5JH5 C;  4MAC A;  2M19 A;  2JRI B;  2RPV A;  1MFW A;  1WXQ A;  2BYF A;  2W3S A;  3N9Y C;  2MQJ A;  2WQY B;  4HDO A;  4YXD B;  1N61 A;  2DNF A;  2CHX A;  3EGR A;  2MEK A;  2XEW A;  5I4D A;  1IUE A;  4PYZ A;  1F52 A;  1UF0 A;  3V05 A;  1TY2 A;  2D07 B;  3NJT A;  2L83 A;  2C5L C;  1TYG B;  3QQ8 B;  4W9D A;  1C4A A;  5HG2 A;  1FFU A;  1JW9 D;  2LZ6 A;  3URY A;  3L4P A;  1V5T A;  4B95 A;  3A9K A;  5BMI A;  2V9H A;  3NUH B;  1NI3 A;  2YVC A;  2BKF A;  2KFJ A;  3MTN B;  1E8W A;  2INP E;  5E6P A;  5H92 C;  1VZ7 A;  1QKZ A;  3DHH C;  4II2 B;  2NBW B;  2GMI C;  2JYT A;  4WJP A;  5E6J A;  4OHJ A;  1OTR B;  4K3C A;  3KUC B;  3RNC C;  1IYF A;  2KFK B;  3KQ4 A;  3L17 A;  3R7Q A;  3SFE B;  2JZZ A;  2AL6 A;  4OVZ A;  4OVU A;  1I4Q A;  1KF6 B;  2KD0 A;  2KQS A;  1YQB A;  3LYY A;  2NS5 A;  3OJ4 B;  2M4N A;  1R7S A;  2HTM E;  1TKG A;  2REX A;  1WXV A;  2PJH A;  2BS4 B;  3X0W A;  2GOW A;  2ZZP B;  1LXD A;  2DLB A;  3ZGZ A;  4F8C B;  2OJW A;  3C19 A;  3B2G A;  2KMA A;  5HFY A;  4TUU A;  1J8C A;  3L13 A;  2RD0 A;  4HRS A;  3M3J A;  1JWA D;  1SE9 A;  1XEE A;  1WIA A;  5L95 C;  2Z0E B;  3AB5 A;  2EKI A;  1WYW B;  3APD A;  2BGF A;  4RGO S;  4W9F A;  4ANV A;  1H4R A;  2OOB B;  4NNJ B;  1WJU A;  4JGH B;  1IBX B;  1C3T A;  2N9E B;  3P4P B;  4Q2J A;  4IM0 A;  4NAW B;  1TBE A;  4BKS A;  3ZNI D;  4HKQ A;  2GBK A;  2PIA A;  1TS4 A;  1CJE A;  1ZPS A;  5JHA A;  1N5W A;  1JML A;  2IO2 B;  4DHJ D;  4WWM A;  5FK9 C;  1WRI A;  2LRU A;  3B9J A;  2K6Q A;  1SJE D;  4MEM A;  4ACF A;  3UF8 A;  4S17 A;  1WJ4 A;  4M02 A;  2J42 A;  3KWL A;  2WXK A;  1UGM A;  1XCT L;  3SFD B;  1PGA A;  3N30 A;  4N59 A;  5E6O A;  3U8Z A;  2M56 B;  3Q2A C;  1F77 A;  3PZD A;  3NHE B;  1I42 A;  3AE5 B;  3VTU A;  2ZVN A;  3AU5 A;  1J7B A;  2OHF A;  2J52 A;  1SJH D;  1YMH E;  3UIO B;  1T3Q A;  1BT0 A;  1XLO A;  4KIK B;  4KKI A;  2BYV E;  2FNJ B;  2WP9 B;  2ZJD A;  2JT4 B;  2J0K A;  5J2R A;  2N7J A;  3CST A;  3P42 A;  2CKH B;  4RCO A;  3TEZ A;  3MC8 A;  3V6E B;  2MWS B;  4BBN C;  4TSS A;  2MBO A;  2FCQ A;  3UQB A;  4ZRK A;  4DXF A;  4KKJ A;  2L7R A;  4RM9 A;  2IZV B;  2JX5 A;  2JYE A;  4NJ6 A;  1YN3 A;  3V61 A;  3E9S A;  4II3 B;  1ET6 A;  3VUY A;  2G3Q B;  4YWG G;  2JF5 A;  3KWV A;  4GGQ A;  1P98 A;  1T0S C;  3PV1 A;  2J0M A;  1L4Z B;  1SE4 A;  1ISN A;  1C79 A;  1WWT A;  4OZB A;  1IPG A;  1DOX A;  2AQ1 B;  3T3O A;  3JSV A;  2DWQ A;  3A9K B;  4YTN B;  3WAN A;  1VZ8 A;  4K7S A;  4MSM B;  1E7P B;  3H9D A;  1TS2 A;  4W9K A;  3JYU A;  2V3N A;  1I4P A;  3P4R B;  1QZE A;  1ET9 A;  3MJW A;  4C00 A;  2LXC A;  4AS1 A;  2IY1 B;  3HK0 A;  1JCK B;  4IKG A;  1MPE A;  1WGK A;  3MP9 A;  1JWB D;  2QIE B;  3KYC D;  3VAW A;  5GXG B;  4WAA A;  5LXH A;  1EF1 A;  1GB1 A;  3OJ3 A;  4WH4 A;  2FCM A;  2WDQ B;  3Q3N C;  3B0A A;  4DBG A;  4HVB A;  4AP4 C;  4HXD A;  2GBN A;  2AX5 A;  3ZNH B;  5DPW A;  1NI2 A;  2LGS A;  1V6E A;  4LDT B;  3HIZ A;  1E8Y A;  3AM9 A;  2KT7 A;  1HA5 A;  2ZNV B;  3TEY A;  1TT5 B;  4HCN B;  2JWZ A;  2XN9 C;  1F9J A;  2KVR A;  1PYW D;  4KV2 A;  2KOX A;  2MSE D;  4K1R B;  2WU2 B;  1TGZ B;  2E6X A;  3JW0 X;  4WWP A;  1IP9 A;  3KVF B;  2QDF A;  2K25 A;  1C9F A;  1V1O A;  3B08 A;  4GSW A;  2CS4 A;  3BVG A;  1AAR A;  2WXO A;  3DCG A;  2FUH B;  2WU5 B;  1E5W A;  1V2Y A;  5E6N A;  2LMC A;  3VHT C;  3ZDT A;  1XQQ A;  2YLM A;  3AE9 B;  1OFF A;  4JX1 C;  1E6E B;  2N4F A;  3R66 C;  1ZKH A;  2IY0 B;  4C4V A;  4P6V F;  4OZA A;  2JU6 X;  1TKE A;  4K7W A;  3V6C B;  3OWE B;  4FN2 A;  2DAF A;  4KSL C;  1DYQ A;  2DEN B;  5D94 A;  4NY0 A;  3APC A;  3S2A A;  3PVL A;  1OQQ A;  3AEA B;  1RRB A;  2FBW B;  2KDM A;  3R3M A;  2Z0D B;  2I1J A;  2UWQ A;  1GG3 A;  1GAQ B;  4DQO C;  2JZ3 B;  4GXB A;  2D10 A;  2DYO A;  1WGH A;  3QAR A;  4K81 A;  1CMX B;  4B0E A;  3PRP B;  1FFV A;  4M8N A;  4WWN A;  2KX3 A;  2V3P A;  4BOZ B;  2PLP A;  1FEH A;  5D6J B;  3AEC B;  1SIJ A;  3DWG C;  4WUR A;  1D5Z C;  4ARI A;  2AL3 A;  3AMZ A;  1L0Y B;  2D3C A;  4EZL A;  2VH1 A;  1EU4 A;  4B6W A;  2MJD A;  4KDL B;  1UBI A;  4JPS A;  2W82 A;  5FR6 A;  5FKA C;  4KDI C;  2FCN A;  4W9J A;  3RD2 A;  4CYE A;  2NTS A;  4GIV A;  3TUO A;  3TL5 A;  1SE3 A;  2CU1 A;  2JWU A;  2PE9 A;  3HVD A;  5LXI B;  3Q3F A;  1WGD A;  3EUB 2;  3L16 A;  4BOS C;  3JSV B;  1WY8 A;  1YIW A;  3ZO5 B;  1M94 A;  3MHZ A;  2Q5W D;  4HK2 A;  2WDV B;  1XLN A;  3IBE A;  1ENF A;  1WFY A;  1T0Y A;  5FR3 A;  3W5V B;  3L08 A;  5J18 A;  1UUP A;  4CHK A;  2M17 A;  3H6N A;  2XNA C;  4W9I A;  2NPT A;  1Q10 A;  3NVV A;  4E3C A;  1HZ5 A;  2JRH A;  3BZD B;  2SEB D;  1I4H A;  1VR9 A;  2N9L A;  3NVZ A;  4MDK E;  1B1Z A;  2JZP A;  2LD9 A;  2C60 A;  1FXA A;  3W9C B;  4BFR A;  2KJH B;  3MJ5 A;  3W5U B;  3BK2 A;  3QWZ B;  2L8J A;  1OQR A;  1VDV A;  2NCN A;  2C7M B;  2Y5B B;  2CJN A;  2LGY A;  4LJP B;  2PVG C;  4IC7 B;  3W1S A;  2WDR B;  1T5X D;  1SXT A;  2LHE A;  3PZ7 A;  2JPH A;  4DWF A;  1EUV B;  3RNF C;  5IP4 D;  1SE2 A;  3AE6 B;  3PZ8 A;  3DBL I;  2WXM A;  3KUZ A;  4IWQ A;  2DBY A;  4TQ1 A;  1HEZ E;  3WAL A;  1HE8 A;  2ZVO A;  3QHT A;  4N6E B;  3BII D;  1JWM D;  5CTR C;  2DZK A;  2JQR B;  3I63 C;  1Z5S B;  2IND C;  4HJK A;  1MG4 A;  3L0W B;  1E7V A;  1SEB D;  1TZO A;  5H8Y E;  3RZW C;  2BVC A;  2K22 A;  2IBI B;  2IYD B;  2KWC A;  4CO7 A;  2W3R A;  4CQN A;  1TKY A;  3O13 A;  3ML9 A;  3MC9 A;  4KX6 B;  2KTR A;  2W55 A;  5G55 A;  1ZP0 B;  2LWP A;  2HE7 A;  5TSS A;  3ZW3 A;  3RMK C;  3CMM B;  3KLS X;  4W9L A;  4W9E A;  3AEB B;  1OGW A;  3W1Y A;  3ZJU A;  1IGD A;  1YJ1 A;  3AE7 B;  1L5P A;  4EEW A;  2ZPN A;  1K52 A;  1AW7 A;  3HUI A;  3I3T B;  2Z59 B;  3ZVV A;  3DVG Y;  5DPR A;  3DHG C;  4KZC A;  5BMG A;  2JUO A;  3HM3 A;  3VUW A;  1A5R A;  2WXJ A;  1KFY B;  1WXA A;  2LVO A;  1VZ6 A;  3PT2 B;  3ZNZ B;  3GS2 A;  4LDT D;  3WA0 A;  3AH7 A;  4RGM A;  2I38 A;  4DDI D;  4FJY A;  2IGH A;  1DGJ A;  3PPA A;  3ZKJ C;  4XC2 A;  1FXI A;  1K8R B;  3VQI A;  1PUT A;  4KGR A;  2GBM A;  3Q8F A;  2K8H A;  4RF0 A;  1V49 A;  3NOB A;  1SBB B;  3IXS A;  4BKS D;  4DK5 A;  1PDX A;  3R2I A;  1D3Z A;  4JE3 B;  3Q8C A;  2ZPY A;  1J19 A;  2K0P A;  2KMC A;  2D3A A;  2WXP A;  1L6V A;  1WX7 A;  2DHZ A;  3GP7 A;  2KJR A;  4MGY E;  3DBL B;  2ASQ A;  1LO5 D;  1YJJ A;  2C9W B;  4DXA B;  2B3A A;  4HRO A;  1NYR A;  3BWU D;  1UGJ A;  2L76 A;  2KVZ A;  4IM2 A;  2KAJ A;  1E90 A;  1L0X B;  5IN7 A;  4EZJ A;  1ZE3 D;  3UQA A;  3A4S C;  2HDE A;  2MA9 B;  1R4M I;  4GDK A;  3VDZ A;  1Q5W B;  3FAH A;  1TY0 A;  3RNE C;  2MJE A;  1JWU D;  2VZK B;  4ITK A;  1WXS A;  3A9J A;  2KDF B;  5D3I B;  1KOT A;  4RGT A;  4GN1 A;  3BYY B;  1HZ6 A;  4FJZ A;  1QT9 A;  3PLU A;  4JWS C;  3TMP B;  2BWF A;  1D5X C;  4ZRI A;  2OED A;  4FXC A;  4ASW C;  2B76 B;  4WJQ A;  1B9R A;  2MH7 A;  2NBV B;  1WGR A;  1UEL A;  2PW9 A;  1YOV B;  3AE3 B;  2KZR A;  2MX2 A;  3DBH I;  4YSX B;  4WWO A;  2XK5 B;  3DPD A;  4BKG A;  2NMQ A;  3AE8 B;  3JVZ X;  4HPM B;  3O65 B;  3ZRC A;  2EMS A;  3ZLZ A;  2KXJ A;  4E71 A;  1V81 A;  4GLS C;  1YQ3 B;  3ECI A;  5GMV A;  3AEE B;  2Y5C A;  2M0A A;  1RYJ A;  5IOI A;  4USA A;  2WGS A;  2H89 B;  1KJT A;  2L05 A;  5AUK A;  4PS3 A;  2N7D A;  4B0M A;  4ANX A;  3NRZ A;  2EMT A;  4MH8 A;  1VD2 A;  1RM6 C;  3GE3 C;  2L1A A;  3DQV A;  2KTR B;  3M95 A;  4IDI A;  5IKC M;  1FCC C;  1F2R I;  2RDB C;  4RNA A;  4PT5 A;  1WR1 A;  3NG0 A;  1P3Q U;  1FNU A;  2MLB A;  1WXM A;  4G3X B;  2BS2 B;  4P16 A;  3P1M A;  2NR2 A;  4KZ0 A;  3NS8 A;  1VLB A;  2NBU A;  3DOW A;  3IHP C;  2KQ4 X;  3VTW A;  2WWZ A;  1FRR A;  1K50 A;  2RDG A;  4FAD A;  4W9C A;  1NEK B;  2C7N B;  1R4M B;  2J53 A;  2O6V A;  2EEL A;  1P0R A;  1D5M C;  3PGE A;  2A5U A;  2LVP A;  3VR9 B;  1HQR D;  1NBF C;  5BO4 B;  4HCP B;  1D4B A;  4GB9 A;  3UIP B;  5LNK 1;  3TSS A;  1TIF A;  3N3K B;  4NAM A;  1NDD A;  3IVF A;  3CIR B;  3TIX A;  3ZXR A;  4EUT A;  2INC C;  2K5P A;  5D2M B;  3DBH B;  3DDC B;  4HEA 1;  1CZP A;  3ZTD A;  3RZF A;  2VRR B;  3M62 B;  2CHW A;  4L2Y A;  4XX5 A;  2ACZ B;  3QCA A;  2N7E A;  2PMV A;  2R2O A;  1PQS A;  1YJI A;  3Q14 C;  1OEY J;  2ZW1 A;  1QOA A;  4L23 A;  3ETR A;  1V97 A;  2PEA A;  3QK0 A;  3MC0 B;  1YN5 A;  4GDK B;  4E74 A;  5AEK B;  1UWM A;  1C76 A;  5G2N A;  3H8H A;  2G4S A;  3D32 A;  4GU2 A;  3HVZ A;  3A9J B;  1K51 A;  4UDU C;  4LNK A;  4LNI A;  1WE7 A;  1FIQ A;  1FNV A;  1LM8 B;  4KGS A;  2HJ8 A;  4MM3 A;  1WR6 E;  3RI7 C;  3FIL A;  1U4A A;  1E0Z A;  1WJN A;  5JXV A;  2CJO A;  2QEJ C;  4RGN A;  3WCQ A;  1JQ4 A;  2KHW B;  3NZS A;  3UGB B;  1ZOY B;  4NPN A;  1T6B X;  3PHW B;  3RUI B;  2AEH A;  4AJY B;  5D3D A;  2RMM A;  3VR8 B;  1ZDX A;  2KAN A;  4TKN A;  4LNF A;  3IAM 1;  2WXG A;  1JRP A;  3DVN U;  3ZDM C;  2IGG A;  1XLP A;  3CSF A;  2UU7 A;  2L0F A;  2GB1 A;  1C4C A;  1LQB A;  3Q6B A;  3RYT A;  2LGD A;  1NEN B;  1LFD A;  1QOF A;  4YT0 B;  1GNU A;  2DYB A;  4BBN F;  3R7R A;  1ZUD 2;  2MBQ A;  3N1Z C;  2LUE A;  2DZI A;  3APF A;  1D6E C;  1PGX A;  1ZXH A;  4M01 A;  1BXT A;  3R2T A;  3B2F A;  3BIN A;  4FLH A;  3QJZ A;  1SSN A;  4XDC A;  2BW2 A;  1I4R A;  2IO0 B;  1MJD A;  3MFG A;  4BVU C;  4XWT A;  3GZN I;  1J7C A;  2LI5 A;  3EC8 A;  4NJC A;  1EWY C;  5IAA C;  4ZHP A;  2VZK D;  1G6J A;  4P1C C;  1IGC A;  3K9O B;  4MJS A;  1XLQ A;  1GPX A;  2QMT A;  3DHI C;  1WRD B;  3BK1 A;  1Q0W B;  3LXF A;  1JRO A;  2WYQ A;  3PHX B;  2MCN B;  4HWI B;  2O6V B;  4LNN A;  2KLG A;  2WHI A;  2ZEQ A;  3U30 A;  1NVI D;  3R8B A;  2I1K A;  3U7Z A;  1ESF A;  3RFZ B;  3GOE A;  1VRA B;  1I4X A;  1E8Z A;  1A70 A;  2JY6 A;  2SAK A;  2KJ6 A;  4A3P A;  3V60 A;  4JL9 A;  3ZQ4 A;  1C77 A;  2MP2 A;  2LVQ A;  3I9V 1;  1P7E A;  2KDB A;  2JSV X;  2KO3 A;  5EE3 A;  2V4I B;  3DBR I;  3PRZ A;  4FJV B;  4D2K A;  3U52 E;  1N5X A;  2KLC A;  3TJP A;  1VJK A;  2KX0 A;  1E7U A;  4PK1 A;  2YEP B;  2N1V A;  1FRD A;  1HTQ A;  1UH6 A;  1MHX A;  3VH3 B;  1V80 A;  2MW5 A;  2DAJ A;  2BQQ A;  4IOI E;  3LB8 C;  2WXR A;  2I2Y A;  3WAO A;  4MM3 B;  3PO0 A;  1TTN A;  5BYS A;  3HM6 X;  3ONS A;  2N1W A;  1C78 A;  1WF9 A;  5CHV C;  2RSU A;  4EFO A;  1HTO A;  3ABV B;  1V5O A;  2FIF A;  4PS8 A;  2H88 B;  4URK A;  4MGI E;  3Q3O C;  3QC8 B;  1V1P A;  1XF5 L;  3T8M A;  1V8C A;  1J7A A;  2KQ7 A;  3AXC A;  3AED B;  4KVG B;  2PTL A;  1XO3 A;  3PLV A;  4ZHO A;  1KRH A;  1NYQ A;  3L10 B;  3NVY A;  3QA8 A;  2D11 A;  4NZL B;  5CHF A;  1H8C A;  2IO3 B;  2KC1 A;  4ICV A;  3VRB B;  4ARC A;  3AEG B;  3H7P A;  1MHH E;  5DPT A;  2LXA A;  5DPS A;  1N63 A;  4G0N B;  4TMA B;  1N6Z A;  2G45 B;  2KN5 A;  2KC2 A;  2D2Q A;  4C4V B;  5D7G A;  4MGZ E;  3SR6 A;  3K9P B;  1OQY A;  4C80 A;  2O2V A;  2K8C A;  3OAW A;  2MRP A;  3VUX A;  2CR5 A;  4G11 A;  4I6P A;  5JHB A;  1S1Q B;  3P63 A;  4HPP A;  2WXF A;  2NTT A;  3P4S B;  4TV3 A;  4OW0 A;  2ZCC A;  3T9L A;  1KLU D;  2MBH A;  4DHZ B;  1OEY A;  2KNB A;  2XBB C;  1FD6 A;  2ZNV C;  3DBR B;  3RCZ A;  1TZ1 A;  2BYT A;  1X1M A;  2K1F A;  2KDI A;  2RR9 A;  4MJS B;  1L6U A;  1FCL A;  1Z2M A;  4EOY A;  1EF5 A;  4M00 A;  3U7D A;  2AWT A;  2J4X A;  3A4R A;  3LJ3 A;  2BKR B;  1VCB A;  4IWP A;  3EHV A;  3NY5 A;  5T8I A;  4A6Q A;  4RM8 A;  4C56 C;  1I35 A;  2VH2 A;  4OVV A;  5CX3 A;  2BPS A;  4LLG M;  3DWM A;  1XD3 B;  1ACC A;  1SIF A;  3NS1 A;  3FC4 A;  1K53 A;  4ZRJ A;  4M0W A;  4R3D A;  3QX1 A;  4EE2 A;  3PTF C;  3N20 C;  1CQV A;  2BTE A;  5C1Z A;  2LRW A;  1P9D U;  2IGD A;  2Y5P A;  2BT6 A;  3Q69 A;  2MP2 B;  2R2Q A;  4YSZ B;  1MG8 A;  4HDQ A;  4HJG E;  1R4N I;  2BBC A;  4MSQ B;  4P1B C;  1WZ0 A;  5LLI A;  3AE4 B;  2J7Q B;  2FAZ A;  1V9J A;  1FPY A;  1GC6 A;  1QOG A;  2E3T A;  2GI9 A;  2D3B A;  2QSD A;  4ZDV A;  4F1S A;  2NPT B;  3WAM A;  4YL8 A;  3Q3M C;  1YNT E;  3J9C A;  4H2A A;  3SU8 X;  2HJ1 A;  2LEK A;  3BY4 B;  5J17 A;  1KTK A;  1E10 A;  1GB4 A;  4NQK E;  5C23 A;  3ZTC A;  2A4Z A;  4XZ4 A;  4WJN A;  2MBE A;  2M0X A;  2D3G A;  3ALB A;  3ZUN A;  3A33 B;  3A1Q A;  4PS7 A;  2QJL A;  5EE9 A;  3IAS 1;  2K3U A;  3V62 A;  4K7U A;  2PE6 B;  2GBJ A;  5BYQ A;  2WNM A;  1V1P B;  1TS5 A;  2ZW0 A;  2QC8 A;  1FM0 D; 
#chains in the Genus database with same CATH homology
 1WI0 A;  2KK8 A;  2O6V D;  3QCA A;  4WQO B;  3AU4 A;  2N7E A;  2R2O A;  1PQS A;  2AL3 A;  4W9G A;  1OEY J;  3KH0 A;  2L00 B;  4RMA A;  4EZL A;  1V86 A;  4B6W A;  3RT3 B;  2LAS A;  4KSK C;  3LDZ E;  4KDL B;  1UBI A;  2C7H A;  2PEA A;  3QK0 A;  4FHK A;  4GDK B;  5FR6 A;  4E74 A;  5AEK B;  3PRM B;  5G2N A;  1WMH A;  4FUL A;  4KDI C;  2G4S A;  3D32 A;  4ICU A;  2FCN A;  4GU2 A;  4W9J A;  3A9J B;  3RD2 A;  1JRU A;  1SGH A;  4CYE A;  1WE7 A;  4GIV A;  3TL5 A;  4AOF A;  1LM8 B;  3UIN B;  4KIK A;  2UYZ B;  2CU1 A;  3H7P B;  2PE9 A;  3L54 A;  2HJ8 A;  4MM3 A;  5LXI B;  3Q3F A;  1WGD A;  3L16 A;  1WR6 E;  4PYU A;  4IWO A;  4BOS C;  1U4A A;  3JSV B;  1P1A A;  1WY8 A;  1YIW A;  3ZO5 B;  1M94 A;  1WJN A;  2KWV B;  2EKE C;  5JZE B;  4HK2 A;  4GOC A;  2O2V B;  3VXW A;  3IBE A;  5JH5 C;  2ZCB A;  2KHW B;  3NZS A;  3WIM A;  2JRI B;  1WFY A;  2BYF A;  1WZ3 A;  3UGB B;  2MQJ A;  4NPN A;  1T0Y A;  2BF8 B;  3PHW B;  3RUI B;  3L08 A;  4HDO A;  5J18 A;  3ZIM A;  2AEH A;  4IUM B;  4AJY B;  4CHK A;  2M17 A;  3H6N A;  2CHX A;  2CHZ A;  2KAN A;  2XEW A;  3ENE A;  4TKN A;  4W9I A;  2HTH A;  4PYZ A;  2NPT A;  4LCD E;  1WM3 A;  4E3C A;  3DVN U;  2JRH A;  3ZDM C;  4MDK E;  2G4D B;  2LD9 A;  3CSF A;  2L0F A;  4F7Z A;  1LQB A;  3RYT A;  2LGD A;  2C60 A;  2D07 B;  5L83 A;  1LFD A;  2C5L C;  3QQ8 B;  4W9D A;  2KJH B;  4BFR A;  2BWE S;  1GNU A;  1YX6 B;  2DYB A;  4BBN F;  2LZ6 A;  3QWZ B;  1L7Y A;  2L8J A;  1V5T A;  4N9F 4;  3R7R A;  2M1M A;  2MBQ A;  4B95 A;  3A9K A;  2NCN A;  2C7M B;  1XT9 B;  2Y5B B;  2LUE A;  2DZI A;  1ZGU B;  5AZF A;  2LGY A;  4LJP B;  2YVC A;  2BKF A;  2KFJ A;  3APF A;  4IC7 B;  3MTN B;  2V1Y A;  1E8W A;  3ML8 A;  5E6P A;  3W1S A;  2NVU I;  4FBJ B;  4M0W B;  4II2 B;  5CHW A;  2NBW B;  5TR5 A;  2GMI C;  4WJP A;  3BIN A;  2DX5 B;  4FLH A;  1OTR B;  3QJZ A;  1WX9 A;  2JPH A;  3OLM D;  4DWF A;  2OJR A;  1EUV B;  3KUC B;  5IA7 A;  1IYF A;  2KFK B;  2IO0 B;  3L17 A;  4BVU C;  3R7Q A;  3DBL I;  3GZN I;  3KUZ A;  1RFA A;  3EC8 A;  2LI5 A;  4IW0 A;  1C1Y B;  4I6N B;  4IWQ A;  5IAA C;  1G6J A;  4TQ1 A;  3K9O B;  2JZZ A;  3QIJ A;  4MJS A;  2AL6 A;  4OVU A;  3WAL A;  1HE8 A;  2ZVO A;  3QHT A;  4FHJ A;  5CTR C;  2KD0 A;  2DZK A;  1WRD B;  2KQS A;  1Q0W B;  2WYQ A;  3PHX B;  1YQB A;  1Z5S B;  4HJK A;  2NS5 A;  3L0W B;  1E7V A;  2MCN B;  3OJ4 B;  4HWI B;  2M4N A;  2O6V B;  2REX A;  3RZW C;  4JQW C;  1WXV A;  2PJH A;  2IBI B;  2IYD B;  3SHQ A;  2KWC A;  4CO7 A;  2KLG A;  3X0W A;  2GOW A;  2W9N A;  3DVG X;  2DZM A;  2J0J A;  2ZZP B;  2ZEQ A;  4G50 A;  3U30 A;  1LXD A;  2I1K A;  4I6L B;  4F8C B;  3ML9 A;  2K8B A;  2KTR A;  3AI5 A;  3VVW B;  2KMA A;  2WDT B;  3GOE A;  4TUU A;  1J8C A;  3L13 A;  2RD0 A;  5G55 A;  3M3J A;  1SE9 A;  1WIA A;  2LWP A;  2HE7 A;  2LGX A;  4MH0 E;  1E8Z A;  2Z0E B;  3ZW3 A;  4NJ7 A;  3NZU A;  5L95 C;  1WYW B;  3CMM B;  3APD A;  2BGF A;  4W9F A;  4ANV A;  1H4R A;  2OOB B;  4W9L A;  2JY6 A;  4NNJ B;  4W9E A;  1WX8 A;  3IFW B;  1WJU A;  2V3S A;  4JGH B;  1OGW A;  2KJ6 A;  3W1Y A;  1L2N A;  4J6I A;  4A3P A;  3V60 A;  1C3T A;  2N9E B;  4JL9 A;  1YJ1 A;  4IM0 A;  2MP2 A;  3PRE A;  3A1Q B;  2ZPN A;  1TBE A;  4NAW B;  3ZNI D;  4BKS A;  4EEW A;  2GBK A;  2LVQ A;  2KDB A;  2JXX A;  3I3T B;  5JHA A;  2Z59 B;  3B1L X;  3ZVV A;  3DVG Y;  2KO3 A;  5DPR A;  1UD7 A;  2IO2 B;  4KZC A;  2JUO A;  3RUL A;  4DHJ D;  2LRU A;  3HM3 A;  2WX1 A;  3VUW A;  1A5R A;  2K6Q A;  3DBR I;  3PRZ A;  4FJV B;  4IM3 A;  1UBQ A;  2KLC A;  4MEM A;  1WXA A;  3IG3 A;  2LVO A;  3PT2 B;  3TJP A;  3UF8 A;  1WJ4 A;  3ZNZ B;  1EO6 A;  2KX0 A;  1UGM A;  1WGG A;  3QAQ A;  4LDT D;  4W9H A;  1E7U A;  3WA0 A;  3KYD D;  4DDI D;  3H7S A;  3N30 A;  5EDS A;  5E6O A;  3U8Z A;  4FJY A;  3VH4 B;  2N1V A;  3PPA A;  4ANU A;  1KM7 A;  3PZD A;  3NHE B;  1UH6 A;  2JVC A;  3ZKJ C;  4XC2 A;  1K8R B;  1I42 A;  3VQI A;  1WMH B;  3VH3 B;  3VTU A;  1V80 A;  2ZVN A;  3AU5 A;  2MW5 A;  2DAJ A;  1GC7 A;  3UIO B;  2K39 A;  3EFU A;  2GBM A;  1BT0 A;  4KIK B;  2K8H A;  1V49 A;  2DYM A;  4JLC A;  3WAO A;  3NOB A;  2N9X A;  1TTN A;  4M8M A;  2K6D B;  2BYV E;  2M8S A;  3HM6 X;  3ONS A;  4BKS D;  2FNJ B;  2ZJD A;  2N1W A;  4DK5 A;  1WF9 A;  2JT4 B;  3KW5 B;  5CHV C;  2J0K A;  2RSU A;  5J2R A;  1D3Z A;  4EFO A;  3CST A;  4GDL A;  2CKH B;  1V5O A;  2FIF A;  4JIO U;  4PS8 A;  2ZPY A;  2FID A;  3V6E B;  1J19 A;  2MWS B;  4BBN C;  4URK A;  4MGI E;  4EKU A;  3QC8 B;  1WH3 A;  2KMC A;  2FCS A;  2MBO A;  2FCQ A;  3UQB A;  4ZRK A;  3T8M A;  1J0G A;  5DCN A;  1WX7 A;  2DHZ A;  2KJR A;  2KQ7 A;  2RPQ A;  3AXC A;  2ASQ A;  4MGY E;  4KVG B;  5AZG A;  2C9W B;  4DXA B;  2L7R A;  2B3A A;  3AUL A;  4RM9 A;  2PPH A;  3PLV A;  1S3S G;  2IZV B;  3VFK A;  4NJ6 A;  2L76 A;  4IM2 A;  3L10 B;  3C0R B;  3V61 A;  2IO1 B;  4HLE A;  1E90 A;  4EZJ A;  3W1S C;  3UQA A;  3A4S C;  1UZX B;  2MA9 B;  1R4M I;  4GDK A;  3VDZ A;  3HHM A;  1Q5W B;  4LJO B;  1KLV A;  3QA8 A;  4II3 B;  2D11 A;  3VUY A;  2G3Q B;  5CHF A;  1H8C A;  2JF5 A;  5AZH A;  2IO3 B;  2KC1 A;  4GGQ A;  4ICV A;  1WXS A;  3A9J A;  1P98 A;  2KDF B;  1KOT A;  3PV1 A;  2J0M A;  5KHQ A;  1ISN A;  1RAX A;  4GN1 A;  3TMP B;  4FJZ A;  3PLU A;  2WX0 A;  1IPG A;  3H7P A;  2BWF A;  5DPT A;  2LXA A;  4ZRI A;  5DPS A;  4G0N B;  2G45 B;  4ASW C;  4WJQ A;  2KN5 A;  3JSV A;  2KC2 A;  4ANW A;  2D2Q A;  3P2B A;  2NBV B;  3PSE B;  5D7G A;  3A9K B;  3N32 A;  4NQL B;  4MGZ E;  1WGR A;  3K9P B;  4X57 B;  3WAN A;  1OQY A;  4K7S A;  1UEL A;  2K8C A;  2O2V A;  3OAW A;  3H9D A;  4MSM B;  2MRP A;  3VUX A;  2CR5 A;  1ZW7 A;  1WGY A;  3JYU A;  1Y8R C;  2KZR A;  2MX2 A;  4G11 A;  4I6P A;  4W9K A;  1S1Q B;  5JHB A;  1QZE A;  3DBH I;  3MJW A;  4WWO A;  4TV3 A;  1YD8 U;  2LXC A;  2XK5 B;  2ZCC A;  3T9L A;  2IY1 B;  3DVN V;  3HK0 A;  3DPD A;  4BKG A;  2L0T A;  3JVZ X;  2RGF A;  4HPM B;  2MBH A;  1YX5 B;  4AJW A;  4DHZ B;  1OEY A;  1WM2 A;  3O65 B;  3ZNG C;  2KNB A;  3SDL C;  2XBB C;  2EMS A;  3ZLZ A;  2KXJ A;  3ZRC A;  4E71 A;  1V81 A;  2ZNV C;  3ECI A;  5GMV A;  2LJ5 A;  3KYC D;  3RCZ A;  3VAW A;  2L3Z A;  1TZ1 A;  4WAA A;  1X1M A;  5LXH A;  1EF1 A;  2K1F A;  2KDI A;  2RR9 A;  3OJ3 A;  4MJS B;  4WJO A;  3WAP A;  1Z2M A;  4EOY A;  1EF5 A;  2FCM A;  3U7D A;  1WE6 A;  2AWT A;  3A4R A;  3LJ3 A;  3B0A A;  4DHJ B;  4DBG A;  2BKR B;  1VCB A;  4IWP A;  1WJ6 A;  3EHV A;  1KJT A;  3NY5 A;  4HVB A;  2KTF A;  2L05 A;  4P7I A;  4RM8 A;  4AP4 C;  4PS3 A;  4HXD A;  2N7D A;  2GBN A;  4OVV A;  5CX3 A;  2AYO B;  1I35 A;  2N9P C;  4ANX A;  2BPS A;  4FA6 A;  2EMT A;  3X23 A;  2BYE A;  1GJZ A;  1VD2 A;  3ZNH B;  5DPW A;  1NI2 A;  3EEC A;  4BKT A;  3TBL D;  1XD3 B;  1V6E A;  4LDT B;  3HIZ A;  1E8Y A;  1RLF A;  1SIF A;  2QHO A;  1FXT B;  3H1U A;  2V4L A;  2ZNV B;  4ZRJ A;  3DQV A;  2KTR B;  4HCN B;  3M95 A;  2JWZ A;  4AWJ A;  1F9J A;  2KVR A;  3QX1 A;  4KV2 A;  2KOX A;  2MSE D;  1WR1 A;  3PTF C;  4K1R B;  4EZK A;  3PS6 A;  1TGZ B;  3JW0 X;  4DHZ E;  4WWP A;  4AUQ C;  1IP9 A;  2KFK A;  4ZYN A;  3KVF B;  2K25 A;  1P3Q U;  5C1Z A;  2LRW A;  3B08 A;  2MBB B;  4GSW A;  2CS4 A;  2MLB A;  1P9D U;  1WXM A;  3M63 B;  4G3X B;  4HPL B;  3TCA A;  1AAR A;  2MP2 B;  2NR2 A;  4KZ0 A;  2R2Q A;  3Q3J A;  2KKC A;  1MG8 A;  3DCG A;  4HDQ A;  2FUH B;  3MHS D;  4DDG D;  1R4N I;  3CF6 E;  1E5W A;  4MSQ B;  1V2Y A;  5E6N A;  3NS8 A;  2NBU A;  3DOW A;  3VHT C;  1WZ0 A;  3IHP C;  5LLI A;  4MEL A;  3VTW A;  2J7Q B;  3ZDT A;  1XQQ A;  2WWZ A;  2YLM A;  2FAZ A;  1V9J A;  1GC6 A;  2N4F A;  4FAD A;  3R66 C;  4W9C A;  1ZKH A;  2IY0 B;  4A3O A;  2C7N B;  2O6V A;  5KHO A;  4ZDV A;  1P0R A;  2NPT B;  3WAM A;  4F1S A;  4YL8 A;  2KWU B;  3PGE A;  2DZJ A;  2A5U A;  2LVP A;  3SU8 X;  4K7W A;  3SD5 A;  1NBF C;  4TQ0 A;  5BO4 B;  3V6C B;  4FN2 A;  4HCP B;  4A20 A;  3DBS A;  2DAF A;  4GB9 A;  4KSL C;  2DEN B;  3BY4 B;  3UIP B;  5D94 A;  5J17 A;  1E8X A;  4NY0 A;  4NQK E;  4MGK E;  5C23 A;  2XK5 A;  3APC A;  3S2A A;  3PVL A;  3N3K B;  1RRB A;  1NDD A;  1Q1O A;  3R3M A;  2A4Z A;  4IG7 B;  3ZTC A;  4XZ4 A;  4WJN A;  3IVF A;  2Z0D B;  3TIX A;  2I1J A;  2MBE A;  1GG3 A;  2M0X A;  2UWQ A;  4EUT A;  2D3G A;  2GBR A;  3ALB A;  3ZUN A;  5D2M B;  2JZ3 B;  3A33 B;  4GXB A;  3A1Q A;  4NAW A;  4PS7 A;  2D10 A;  3DDC B;  2DYO A;  1WGH A;  4B9K A;  3QAR A;  4GDL B;  4K81 A;  2KDE B;  2HD5 B;  1CMX B;  4GMV A;  3V62 A;  5HKH A;  4K7U A;  3PRP B;  3VTV A;  3ZTD A;  4M8N A;  4WWN A;  2KX3 A;  2PE6 B;  2GBJ A;  4BOZ B;  1GUA B;  2VRR B;  3RZF A;  3M62 B;  2CHW A;  3KUD B;  5D6J B;  3ZRF A;  4XX5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...