2DHZA

Solution structure of the ra domain in the human link guanine nucleotide exchange factor ii (link-gefii)
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
120
structure length
120
Chain Sequence
GSSGSSGDEIFCRVYMPDHSYVTIRSRLSASVQDILGSVTEKLQYSEEPAGREDSLILVAVSSSGEKVLLQPTEDCVFTALGINSHLFACTRDSYEALVPLPEEIQVSPGDTEISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor (GEF)-like 1
publication title Solution Structure of the RA Domain in the Human Link Guanine Nucleotide Exchange Factor II (Link-GEFII)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 11
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2006-03-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dhzA01
3V6EB 1OTRB 2BF8B 2D10A 3A9KB 2MBOA 3TCAA 4EEWA 4WAAA 5E6NA 3U7DA 4AP4C 1V5OA 1LXDA 4GXBA 4TKNA 1WFYA 4DK5A 3UGBB 4W9IA 4HVBA 3ZNGC 3CF6E 1H4RA 2JF5A 2KXJA 3GOEA 1UD7A 2JY6A 4KV2A 3U8ZA 2JXXA 4HDQA 1VD2A 5JZEB 2BPSA 1WXSA 2DHZA 1J19A 3IG3A 4MGZE 4PS7A 1I35A 3EFUA 5DPTA 4EFOA 4FA6A 1V2YA 2MP2B 4DHZE 1YJ1A 2ZPNA 3W1YA 3V6CB 4HWIB 1F9JA 2GBKA 1WM2A 2WX1A 4K7UA 4KSKC 1C1YB 2LRWA 1U4AA 4LJPB 3VUWA 1SGHA 3RT3B 1P0RA 3WIMA 2L0FA 4B9KA 3A1QB 1RAXA 4GDLB 4AJYB 3PZDA 4KDLB 2V4LA 2KX3A 4MDKE 2KN5A 1LQBA 3VH3B 4NJ6A 2K6DB 1NI2A 3ZTDA 3DBSA 3B08A 4RM9A 1SE9A 4IM0A 4BOZB 3ALBA 1K8RB 2Z0EB 3Q3FA 2NCNA 4BBNF 2NVUI 2MCNB 3KYDD 2CS4A 3DVGY 1WJ6A 2V3SA 1WE6A 1NBFC 2MBBB 3IBEA 3KYCD 3L0WB 2HTHA 2K1FA 3ML8A 2KKCA 1EUVB 3H7PB 1SIFA 2LVPA 4IM3A 2KDIA 4WJOA 2MBEA 2LZ6A 4EUTA 4ANUA 1WYWB 2KLGA 4MEMA 5JH5C 3DVNV 2IO1B 1UZXB 3BINA 2G4DB 3L17A 1WJUA 4W9LA 4XZ4A 3QAQA 2MX2A 1E8XA 2DX5B 2C9WB 5D94A 3OAWA 2D2QA 2ASQA 1HE8A 1RLFA 2LVQA 3M63B 3X23A 2V1YA 3APDA 4IC7B 1I42A 3JSVA 4WWOA 3ZRFA 4NQLB 2N1VA 3L13A 3ZTCA 2NS5A 4DBGA 2ZCBA 2L00B 1WX9A 4URKA 2NBUA 5KHQA 1T0YA 1WH3A 1Y8RC 4IWOA 1R4MI 1GC6A 2XK5A 2BWFA 4TQ1A 5IA7A 2RGFA 5JHAA 3AU5A 2D07B 4A20A 2LVOA 2KWVB 2NPTB 3VTVA 1WXAA 4EZKA 4P7IA 2MRPA 2AWTA 5J2RA 1EO6A 4HCNB 1WMHB 2C7HA 2L76A 3ENEA 3N32A 3RUIB 2GOWA 3TBLD 1KM7A 1WIAA 2M4NA 4NAWB 1WE7A 4DWFA 4K7SA 4W9FA 2I1JA 2AEHA 3PPAA 4MSMB 3MTNB 2FCNA 3B0AA 4GIVA 3ZDTA 2C60A 2EMSA 4OVVA 2AL3A 1P3QU 4OVUA 2NBWB 3RD2A 4IWQA 3ZNZB 3U30A 4J6IA 4F1SA 3PREA 1UBIA 3DPDA 3DBLI 3IFWB 3PS6A 3AU4A 4ZRIA 5FR6A 2XK5B 3MJWA 2MQJA 1WI0A 4HPLB 3K9OB 1RFAA 4RM8A 3RZWC 2DYOA 3BY4B 3WALA 2LGXA 3QJZA 2DZJA 2O2VB 4PS3A 2N9PC 4MGYE 4BBNC 1V5TA 1GUAB 3DVGX 3LJ3A 3RZFA 2CHWA 5AZGA 1YX5B 2L3ZA 4W9GA 1E8YA 5CHVC 4IG7B 3PTFC 3WANA 1LM8B 4BKSA 5DPRA 3QC8B 2JPHA 4XC2A 1GG3A 5D2MB 3W1SA 2K8BA 4NQKE 4NY0A 3LDZE 1WR1A 3JW0X 3MHSD 3ZIMA 2KO3A 3NZSA 3ZNHB 4FHKA 1V49A 2DAJA 3EC8A 4G3XB 2JUOA 3DBHI 3PLUA 4JQWC 4ANWA 4GMVA 2O6VA 5E6PA 3AULA 1E7VA 3UQBA 3H7SA 3UIPB 1ZGUB 4WWPA 1Q1OA 5CHFA 1BT0A 2KANA 2KOXA 2WYQA 1YX6B 1S3SG 1Z5SB 2GMIC 2PEAA 3DDCB 3ZUNA 3I3TB 3QARA 3L54A 3TIXA 3VVWB 4K1RB 5C1ZA 2LD9A 2KHWB 2DAFA 2KWUB 2LASA 3QA8A 2OJRA 2K8HA 3SDLC 3ECIA 2A5UA 2FNJB 2GBMA 1V80A 4G0NB 4MM3A 5CX3A 4K7WA 2IY1B 4GN1A 2LGDA 4CHKA 4II2B 2KJRA 4G50A 4II3B 2VRRB 3Q3JA 2O6VD 2UWQA 4FJVB 3B1LX 4DDGD 2O6VB 4ZRKA 5LXIB 3UQAA 4EOYA 2PJHA 3R7RA 1WF9A 4HDOA 3NY5A 3ZDMC 2L8JA 4MGKE 2OOBB 3VQIA 4IUMB 2YVCA 2ZEQA 1WGYA 3H1UA 4KZCA 3A33B 2A4ZA 1ZKHA 1A5RA 4KDIC 3IVFA 4AJWA 2LUEA 4HK2A 4ANXA 3D32A 4DHJD 2GBRA 4E71A 3PRPB 1OEYJ 2B3AA 2J7QB 4DHJB 4FBJB 1WRDB 4JL9A 3KUDB 5KHOA 2J0JA 1TBEA 2KX0A 3GZNI 4RMAA 4W9KA 3TL5A 3ZLZA 2EMTA 3DBRI 2GBJA 1G6JA 2KJHB 3VTUA 3QX1A 2MBQA 4GDKA 3VXWA 4AOFA 2CR5A 4B6WA 1Z2MA 2IYDB 4MELA 4LJOB 5J17A 2BGFA 2N7DA 1R4NI 3PLVA 3N3KB 3SD5A 3PRMB 5CTRC 1IYFA 2ZVNA 1GJZA 2NBVB 2HJ8A 2WWZA 2LI5A 1P9DU 2J0KA 4YL8A 4GB9A 4K81A 4ZRJA 5BO4B 3R66C 5LLIA 4FJYA 3QIJA 4E3CA 4BKGA 1WGGA 2MWSB 4CYEA 1X1MA 2KFJA 2XBBC 3DQVA 3VTWA 2DZMA 1WJ4A 3A9JA 2KC1A 4KIKA 4AWJA 5E6OA 3UF8A 2KZRA 1WR6E 4HPMB 4MJSA 1WJNA 4F7ZA 2FIFA 2RPQA 2KFKA 1ZW7A 4GDKB 4KSLC 4WJQA 3DVNU 2D3GA 2FUHB 3JSVB 3KUZA 1XD3B 1WGHA 2N9XA 2MW5A 4HJKA 4BVUC 4IM2A 4DDID 2CKHB 2N9EB 2RD0A 1H8CA 3RCZA 5L83A 2KDFB 5CHWA 4PS8A 4F8CB 4AUQC 1ISNA 2JT4B 2M0XA 2IO0B 3DCGA 1UGMA 2KK8A 1KLVA 4TV3A 4KIKB 3KVFB 5TR5A 2KC2A 3A4RA 5D7GA 5AZHA 2LXAA 5AZFA 3UINB 4MJSB 1D3ZA 1IPGA 2LJ5A 1MG8A 3HK0A 3PV1A 5HKHA 4M0WB 1QZEA 2N4FA 4M8MA 2IBIB 2BYVE 2G45B 5GMVA 1E8WA 3W1SC 4PYZA 3R3MA 1WGDA 4NJ7A 1E8ZA 2KVRA 4HCPB 1RRBA 3R7QA 2ZNVC 5C23A 1L2NA 3A9KA 2LWPA 4WQOB 3L08A 2AL6A 3VUYA 3PSEB 1UELA 4LDTD 3T8MA 3VAWA 4FJZA 1LFDA 5G55A 4LDTB 3VUXA 4GU2A 2PE6B 1VCBA 2G3QB 2CHXA 3PGEA 2Z0DB 2C5LC 2KWCA 3TJPA 1S1QB 3PRZA 2KMCA 2WX0A 2MLBA 4WJPA 4BKSD 3M62B 3P2BA 1P1AA 2J0MA 3NS8A 2FCSA 1E7UA 3PHWB 3M95A 1TZ1A 3NOBA 3L10B 2L05A 4ZYNA 3AXCA 2RR9A 2WDTB 2DZKA 2D11A 2CHZA 2R2QA 2CU1A 3ZO5B 3A1QA 3AI5A 4GDLA 1Q0WB 2XEWA 2JVCA 4W9DA 4BOSC 1GNUA 5JHBA 4HXDA 3WAMA 2M8SA 3KUCB 3ONSA 1GC7A 1XQQA 2ZNVB 1EF5A 2C7MB 2IO2B 3H6NA 4MSQB 2JRIB 3V61A 4BKTA 4A3OA 1EF1A 1TGZB 4BFRA 2NR2A 4ICUA 2LGYA 3QWZB 2KJ6A 4FULA 3VDZA 1OEYA 3H7PA 1FXTB 1YQBA 2KQ7A 2KNBA 2BKFA 2DYMA 2DZIA 2I1KA 4CO7A 3ZW3A 2PE9A 2DENB 2KD0A 3CMMB 3EECA 3IHPC 4FLHA 3JYUA 1WM3A 4TQ0A 1WZ0A 1E90A 2KTFA 4NPNA 1OQYA 2LRUA 5DCNA 2FCMA 2EKEC 4N9F4 3OJ3A 3T9LA 1V81A 4FHJA 2IY0B 3ZNID 3TMPB 3UIOB 3WAPA 1WZ3A 3K9PB 1NDDA 2L7RA 1WX8A 1L7YA 3C0RB 3APCA 4W9HA 3NZUA 2JWZA 1WXVA 2M17A 4I6NB 1YIWA 3SHQA 4X57B 4ICVA 4MGIE 3VHTC 3EHVA 4DHZB 2K6QA 3VFKA 3WAOA 3H9DA 3HHMA 2G4SA 2K39A 4W9JA 4GOCA 5J18A 2ZPYA 4NNJB 4M8NA 1V86A 2RSUA 4ASWC 3DOWA 4LCDE 2BKRB 1WXMA 3OLMD 2NPTA 2AYOB 4JLCA 1M94A 2W9NA 3M3JA 1P98A 1WMHA 1WX7A 2JZ3B 2KDBA 1YD8U 2BYEA 2PPHA 3CSTA 5IAAC 5EDSA 3ZKJC 4NAWA 1Q5WB 2Y5BB 2BWES 1TTNA 3RULA 3HIZA 1AARA 4MH0E 1C3TA 4G11A 3N30A 2MSED 1UBQA 2HD5B 3ZVVA 3O65B 2LXCA 2ZZPB 2FIDA 3NHEB 4WJNA 4FADA 4I6LB 1CMXB 2N7EA 4FN2A 4W9CA 4EZJA 4EZLA 4IW0A 3SU8X 4GGQA 3KH0A 4KZ0A 4A3PA 3PT2B 2KLCA 4W9EA 4GSWA 4E74A 2O2VA 2FCQA 3APFA 1OGWA 3A9JB 3OJ4B 3KW5B 2BYFA 5DPWA 4ZDVA 2DYBA 3PHXB 2KFKB 1V9JA 3X0WA 3QCAA 5AEKB 3HM3A 2Z59B 3HM6X 2REXA 3VH4B 2KTRA 1PQSA 1WY8A 3L16A 4EKUA 2YLMA 4PYUA 4WWNA 4ANVA 4JGHB 3QHTA 1V6EA 5LXHA 5L95C 1J8CA 2ZCCA 2JZZA 2IO3B 1KJTA 3CSFA 2KDEB 4TUUA 2L0TA 1UH6A 2K25A 1J0GA 2IZVB 1E5WA 2C7NB 3JVZX 1WGRA 3ML9A 4DXAB 5DPSA 2N1WA 3QK0A 5D6JB 3V60A 3WA0A 4JIOU 2ZVOA 2R2OA 2ZJDA 2QHOA 4I6PA 2JRHA 2UYZB 2KMAA 4XX5A 3S2AA 1JRUA 2MP2A 3RYTA 4HLEA 3PVLA 4KVGB 5G2NA 4IWPA 2HE7A 3V62A 1XT9B 1IP9A 3ZRCA 2MBHA 2KTRB 2MA9B 2FAZA 3QQ8B 2KQSA 1KOTA 2K8CA 2GBNA 3A4SC 4B95A 2M1MA
chains in the Genus database with same CATH superfamily
2D10A 4WAAA 1AW7A 1RM6C 1V5OA 1LXDA 1FNVA 1HA5A 2H88B 4HRSA 3CF6E 2KXJA 2JY6A 3U8ZA 4HDQA 2W3RA 1HEZE 1IUEA 4MGZE 4PS7A 5IN7A 3EFUA 5DPTA 4EFOA 4FA6A 4IKGA 1YJ1A 2EELA 2L1AA 1C1YB 4C00A 4JX1C 3PZDA 4KDLB 1E7PB 1V1PB 3ZTDA 3DBSA 1SE9A 4IM0A 1YN5A 3ALBA 5HHDG 4BBNF 2DNFA 2NVUI 3DVGY 1WJ6A 2V3SA 1WE6A 1NBFC 2MBBB 4BBNC 1GPXA 1JW9D 3DWMA 2LHEA 3AE5B 2KDIA 1QOBA 2LMCA 4EUTA 3Q3NC 1B9RA 3BINA 4XZ4A 1KLUD 2J42A 1E8XA 3OAWA 2BW2A 2ASQA 1HE8A 4YWGG 3L13A 2WXFA 1NENB 4OZBA 2WXIA 2NS5A 2K9XA 1MHHE 4URKA 5KHQA 2N9LA 2V9HA 2WP9B 1R4MI 1GC6A 1K53A 2RGFA 2KT7A 2PIAA 1FRRA 2NPTB 4EZKA 2I2YA 5J2RA 3WCQA 4RGOS 3O13A 2GOWA 2M4NA 4DWFA 4W9FA 2I1JA 5LNK1 3MTNB 3FILB 3ZDTA 1N5WA 3GS2A 3SFDB 4OVVA 1C9FA 5EE9A 1P3QU 4OVUA 2NBWB 3ZJVA 1F1HA 2QILA 2XK5B 1WI0A 3K9OB 2DWQA 4PS3A 2N9PC 4MGYE 4MH8A 3DVGX 1FRDA 3FC4A 2PMVA 2QSDA 4LTUA 1SJED 3GE8C 3PTFC 1LM8B 1WXQA 3WANA 2WXNA 3Q6BA 5D2MB 3W1SA 2K8BA 4NY0A 4C80A 2DAJA 3DBHI 2SEBD 5E6PA 2KANA 2WYQA 2WXOA 1FFUA 1S3SG 2GMIC 2PEAA 4D2KA 4RF0A 3L54A 5C1ZA 2KHWB 4MT5A 5IOIA 2DAFA 3QA8A 1TKYA 2HTME 2FNJB 2GBMA 1V80A 4YTNB 4P1CC 4GN1A 2LGDA 4G50A 2VRRB 4FJVB 4EOYA 2PJHA 3R7RA 1NYRA 1TIFA 2L8JA 2LJIA 3H1UA 3A33B 4B0EA 2PKOA 4AJWA 4HK2A 4ANXA 4DHJD 2GBRA 2HDEA 4UDUC 1TBEA 3GZNI 4RMAA 2EMTA 1XEEA 4AOFA 3VXWA 4B6WA 1CK1A 2NTSA 2IYDB 2N7DA 3N3KB 3SD5A 3PRMB 3BYTB 1GJZA 2HJ8A 3J9CA 4RNAA 1J7AA 2AQ1B 3TEYA 4FJYA 2B76B 4BKGA 3AE9B 2MWSB 4CYEA 2N7JA 1ACCA 2NTTA 1CQVA 1UUPA 2Z8LA 1L5PA 2KFKA 3N20C 4GDKB 4KSLC 3DVNU 3KUZA 2GI9A 3E9SA 1T0SC 1XD3B 2MJEA 3KQ4A 2MW5A 2CKHB 2GRIA 3W9CB 2N9EB 2RD0A 3RCZA 4RGNA 2QMTA 4PS8A 1UWXA 1K52A 4H2AA 1UGMA 2KK8A 2QC8A 5TR5A 2CU3A 4ZOHC 5AZHA 3UINB 1D3ZA 1IPGA 1B1ZA 3RNGC 1NVID 5G5HA 1HTQA 3VRAB 3AECB 5EE1A 1JROA 2YEPF 1BMLC 2G45B 3W1SC 1N5XA 4PYZA 3R3MA 1P7EA 2JWUA 1RRBA 3R7QA 2INDC 1TS4A 1L2NA 2LWPA 1FFVA 2ZW0A 3L08A 4LDTD 3T8MA 3VAWA 4FJZA 4A90A 3VUXA 2N9KA 1PGXA 1ZOYB 2BS3B 1NEKB 2G3QB 2CHXA 2MJDA 1XLQA 4C7ZA 2C5LC 1TKEA 2J0MA 1I4QA 2FCSA 1EM7A 1E7UA 2WXRA 3M95A 2L05A 1I4PA 3AXCA 2FUG1 2D11A 1Q0WB 2XEWA 4BOSC 1GNUA 2YEPB 1C76A 3MC9A 4MSQB 4KGTA 3UI3A 1D6EC 1EF1A 1TGZB 1JWUD 5H92C 3N1YC 1YQBA 5BMHA 3Q8BA 3AH7A 2I1KA 2QCZA 1QOGA 1SB3C 3EECA 1WM3A 1WZ0A 1OQYA 3BVMA 2JU6X 2QEJC 1KH0A 1ZUD2 1WZ3A 1E6EB 1MHXA 3APCA 3NZUA 3MC0B 2M17A 3RNAC 3SHQA 1YIWA 3VHTC 3BIID 3H9DA 3HHMA 2G4SA 2K39A 4W9JA 2IGDA 1C4PA 4M8NA 1V86A 3EA6A 2RSUA 4LNOA 2XNAC 3DOWA 4LCDE 4GLSC 1WX7A 1QOFA 4RFBA 1YD8U 1N60A 3ZKJC 4NAWA 4OZCA 2ONQA 2RDHA 4XGAB 3TEWA 3N30A 3ZXRA 2MSED 1FMAD 2HD5B 2Y3AA 1LGRA 3ZVVA 1KTKA 3IXSA 2LXCA 3NVZA 4W9CA 4YTPB 4IW0A 3SU8X 3KH0A 4A3PA 4GSWA 4ACFA 2O2VA 1JWSD 1YOVB 3RPFC 2WXPA 2DYBA 2IGHA 2KFKB 2KN4A 2REXA 3VH4B 1PQSA 4EKUA 3GP7A 3NS1A 2VZKB 2KWDA 2KDEB 4NJCA 1UH6A 2K25A 4HKZE 2VH1A 2IZVB 1IBXA 1WGRA 2JQRB 2E6XA 2R2OA 4P1BC 4I6PA 3DWGC 2MEKA 3S2AA 1JRUA 2MH7A 1C78A 1TYGB 3T3NA 3ZRCA 2UU7A 4ARCA 2KTRB 3QQ8B 2KQSA 1TKGA 2GBNA 4EEWA 5E6NA 3VRBB 2RDBC 4GXBA 1V1PA 4TKNA 1WFYA 4XDCA 3UGBB 1FCLA 3ZNGC 3GOEA 1JWBD 1UD7A 2JXXA 4KGRA 4NZLB 5JZEB 2BPSA 1WXSA 1ZDXA 3URYA 2INCC 2MP2B 4DHZE 2ZPNA 1GB4A 1N61A 2GBKA 2LRWA 1SGHA 1P0RA 4AJYB 1JWMD 4MDKE 2KN5A 1LQBA 3VH3B 1NI2A 4C4VA 4WQMA 2M19A 3B08A 4CQNA 4FXCA 3W5UB 2Z0EB 1MJDA 1J7BA 1QQRA 1L6UA 3KYDD 2MCNB 3KYCD 3ML8A 1GOZA 2HTHA 2KKCA 1SIFA 4WJOA 4YT0B 5JH5C 3DVNV 2IO1B 3L17A 1ZPSA 3I63C 2MX2A 2DX5B 5FR3A 2PTLA 2LVQA 1RLFA 3X23A 3APDA 2FE8A 1KF6B 2KYWA 3JSVA 4NQLB 4WWOA 2N1VA 1ROEA 2ZCBA 1ZP0B 2L00B 2JXTA 1T0YA 1QOAA 2G1EA 4ZRQA 3CIRB 2BB5A 1YNTE 1XO3A 2XK5A 2BWFA 3TUOA 4LNIA 3VTVA 2OHFA 3NZ3A 2Y5PA 1K50A 3AE4B 4DQOC 4NAWB 2AEHA 3PPAA 1UNSA 1V8CA 4GIVA 1QILA 3P1MA 1FCCC 1PUTA 4IWQA 3ZNZB 2G9HD 1HTOA 3PREA 4F1SA 1UBIA 1T0RC 3DBLI 5FK9C 4OVZA 1PDXA 2PLPA 4LNFA 3WALA 2O2VB 3RZFA 2CHWA 5AZGA 1YX5B 2L3ZA 1MPEA 4W9GA 1E8YA 5CHVC 1VLBA 5DPRA 4DXGA 3QC8B 1D5MC 2WDRB 4M01A 1F52A 1QLBB 3LDZE 3JW0X 1L4ZB 1F2RI 3ZNHB 1IBXB 5IP4D 2JUOA 2JSVX 4JQWC 3AULA 1E7VA 3H7SA 5G5GA 2HJ1A 1ZGUB 4WWPA 1BT0A 2KOXA 1YX6B 4K3CA 3I3TB 5BMGA 4K1RB 2OJRA 3SDLC 3ECIA 1SBBB 3NVWA 2MHJA 5CX3A 5AUKA 2PVGC 3BK1A 1FNWA 1F0ZA 2O6VD 2UWQA 4DDGD 2ZW1A 2J52A 3GB1A 3ZDMC 4MGKE 2WGSA 1ZE3D 3VQIA 2ZEQA 1FO4A 2A4ZA 1ZKHA 3GZNB 1A5RA 4KDIC 1YN3A 2BBCA 2LUEA 3VR9B 4E71A 2W55A 2B3AA 2J7QB 3W5VB 4DHJB 4FBJB 2K5PA 4C4VB 4W9KA 3ZLZA 3DBRI 2GBJA 1G6JA 4GDKA 2CR5A 3PO0A 1Z2MA 4LJOB 2BGFA 3AEFB 1STEA 2ZVNA 1P9DU 4K81A 3R66C 5LLIA 3QIJA 4JWSC 2KFJA 3DQVA 2DZMA 3TSSA 2L32A 3UF8A 1FNUA 2W82A 4A9AA 5EE3A 4F7ZA 2RPQA 5EE0A 1ZW7A 4XDDA 3C19A 1VJKA 3JSVB 2INNE 2N9XA 4IM2A 4L2YA 4WWMA 3Q8CA 3DHGC 1ISNA 2JT4B 2M0XA 3DCGA 3Q3OC 2RPVA 1SIJA 1WWTA 3KVFB 3A4RA 5D7GA 3MFGA 5AZFA 1D4BA 3PV1A 1Y56A 5D3DA 3AEAB 2N4FA 1E8WA 2WLBA 2WXJA 1WGDA 1E8ZA 5C23A 4WQOB 1HZ6A 4LDTB 4GU2A 1VCBA 3PGEA 2Z0DB 2WS3B 2KWCA 1S1QB 1WRIA 3PRZA 1SE4A 2KMCA 2MLBA 3ABVB 3NS8A 5D3IB 1VZ7A 4IDIA 1XF5L 1UF0A 3NOBA 2CU1A 3SFEB 3A1QA 3AI5A 4GDLA 3ZO5B 2M8SA 5BYSA 2BTEA 1GC7A 1EF5A 3MC8A 4KKJA 3AM9A 2JRIB 4BFRA 2NR2A 4ICUA 2KJ6A 3VDZA 2INPE 3H7PA 1FXTB 2JX5A 2BKFA 2DZIA 3ZW3A 1OFFA 1SF0A 1BUIC 3CMMB 3BVZA 3AEGB 3JYUA 4TQ0A 2LRUA 2FBWB 1VDVA 2WXHA 2EKEC 1R4NB 1V81A 3UIOB 3K9PB 3C0RB 2WQYB 4I6NB 4ICVA 3VFKA 4O1NA 2EKIA 4GOCA 4N59A 3N1ZC 3OLMD 1RFKA 1I4GA 5BMIA 2AYOB 2K3UA 2XN9C 2W9NA 4A55A 1WMHA 2JZ3B 2BYEA 2JYEA 2H89B 2BWES 1NYQA 3RULA 1KRHA 3HIZA 1SSNA 3U7ZA 1C3TA 3MHZA 1KFYB 3AE3B 1L6VA 1T5XD 3O65B 2ZZPB 1CMXB 2M0AA 2N7EA 4FN2A 4EZJA 4KZ0A 2J4XA 2FCQA 5C3JB 1OGWA 3OJ4B 2BYFA 4YXDB 4ZDVA 1D5XC 2IJ0A 3B9JA 2KTRA 3RNBC 2IDYA 4PYUA 4ANVA 1V6EA 1VRAB 2Y5CA 1PFDA 2BB6A 4TUUA 1J0GA 3AE8B 5IKCM 1E5WA 3ML9A 4DXAB 5DPSA 3V60A 3QK0A 1YMHE 4XX5A 2MP2A 4L1BA 4HLEA 3PVLA 4KVGB 3V62A 2MA9B 2FAZA 4B95A 3P4SB 2M1MA 1R7SA 3P4RB 4IOIE 2MBOA 3TCAA 3BWUD 3DHHC 1F77A 4AP4C 1YQ4B 4DK5A 4HVBA 1H4RA 2JF5A 1VD2A 1AN8A 1J19A 4DXFA 1PGAA 3RFZB 3KWVA 4OW0A 3W1YA 4LLGM 1F9JA 4S0RA 2WX1A 1WM2A 3Q3MC 2L52A 4KSKC 1U4AA 3RT3B 2L0FA 4B9KA 3A1QB 1RAXA 4GDLB 2KX3A 4WH4A 4NJ6A 2LFIA 4RM9A 2JZPA 3HVDA 3FKYA 3IBEA 1EUVB 3H7PB 1V97A 2LVPA 2WDQB 3RNEC 2LZ6A 4ANUA 1WYWB 4MEMA 1UZXB 1WJUA 3QAQA 1T3QA 2C9WB 1HQRD 3VR8B 1I42A 3ZRFA 4TMAB 2WXKA 2NBUA 1Y8RC 4IWOA 1QKZA 4TQ1A 4ZHPA 5IA7A 4M00A 1TY2A 4R3DA 3AU5A 3Q8EA 3GE3C 2D07B 3NJTA 4A20A 1XLOA 2LVOA 5GXGB 4Q2JA 2M56B 1EO6A 1I7HA 4HCNB 4QAYA 1WMHB 2L76A 2BS4B 4MSMB 2FCNA 2C60A 2AL3A 3RD2A 2AX5A 5FR6A 3ETRA 1FD6A 4C7YA 5HFYA 1UGJA 2V3NA 3AE6B 2DYOA 3BY4B 1SXTA 2LGXA 1FEHA 2DZJA 3QJZA 1GUAB 1D5ZC 3EGRA 4IG7B 1ENFA 1M4VA 1AWDA 4HJGE 4XC2A 1P7FA 4EE2A 1GG3A 2CJOA 3Q69A 4US8A 1L0YB 2I38A 4PK1A 3MHSD 2PW9A 3NZSA 4FHKA 3EC8A 4USAA 4RGMA 3AB5A 4ANWA 1ZXIA 1TS3A 4US9A 3UQBA 4XWWA 3B2GA 4MACA 1V1OA 2NMQA 1XCTL 1Z5SB 1TS5A 3TIXA 5H8YE 3MJ5A 2KWUB 4P16A 2LASA 2KDMA 4MM3A 2IY1B 3U4EG 4CHKA 4II2B 2KJRA 3Q3JA 1DGJA 3RNCC 4WAFA 2O6VB 1DOYA 4ZRKA 4P6VF 3EUB2 1WF9A 4ZRPA 3NY5A 2OOBB 2YVCA 2KQ4X 1XXGA 3IAS1 2D5GA 2OJWA 3CWIA 1C77A 3PRPB 3KUDB 1TJEA 2DBYA 1MFWA 3BVGA 1FPYA 2KJHB 4ARIA 3QX1A 2MBQA 1R4MB 5J17A 3PLVA 1SJHD 1VZ6A 2JYTA 2NBVB 2DLBA 4XE0A 4YL8A 4GB9A 4AS1A 1RYJA 3BZDB 4RF1A 1FIQA 2XBBC 3VTWA 3A9JA 1WJ4A 2KC1A 5E6OA 1WR6E 4HPMB 4K3BA 1WJNA 2FIFA 4J3OD 3U2SC 1ZXHA 2V4IB 1ET9A 1HXYD 1XLNA 4HJKA 4DDID 1H8CA 5L83A 2KDFB 5CHWA 2KVZA 4F8CB 2IO0B 1YN4A 3TEZA 4TV3A 4KIKB 2KC2A 2LXAA 4MJSB 3AEDB 3ZJUA 1ESFA 4A6QA 4HKQA 5E6JA 5GMVA 2AQ3B 4NJ7A 4AQ7A 4HCPB 1C79A 3A9KA 2AL6A 1LO5D 3DBHB 3VUYA 3PSEB 2PE6B 3NUHB 3TJPA 3ZYYX 1WGKA 4BKSD 1I4XA 2WXMA 1P1AA 3PHWB 2WHIA 1TZ1A 1YJIA 1FXAA 4ZYNA 2RR9A 2DZKA 3N9YC 2R2QA 1JWAD 1XCQL 2JVCA 3AE7B 4HXDA 1JALA 3KUCB 3ONSA 1XQQA 2C7MB 3AEEB 4BKTA 3V61A 4A3OA 3OG5A 2BS2B 3Q8FA 1OEYA 4YSXB 3R2IA 4HEA1 2KQ7A 4CO7A 3RI7C 4YSZB 2PE9A 3Q8AA 1E90A 2KTFA 4HROA 4NPNA 3ZGZA 1JCKB 5HG2A 1UWMA 1L0XB 4N9F4 3OJ3A 4MM3B 5AUIA 2E3TA 2QIEB 2IY0B 4FHJA 3TMPB 3V05A 3WAPA 3ZNID 1NDDA 1OQRA 1L7YA 1YQ3B 2JWZA 4MGIE 2K6QA 3WAOA 1T6BX 1EU4A 1NI3A 5J18A 4NNJB 2LGSA 4ASWC 2BKRB 1WXMA 3ZQ4A 1OQQA 4JLCA 1M94A 3R2TA 2CJNA 3NRZA 4JPSA 2PPHA 3CSTA 5EDSA 5IAAC 3HRDD 1TTNA 4G11A 2ACZB 4WURA 1FM0D 1N6ZA 3NHEB 4FADA 2W3SA 4REZA 4I6LB 4EZLA 4BAXA 3PT2B 2KLCA 2RDGA 3A9JB 3KW5B 3EFCA 2OEDA 3PHXB 4M02A 3X0WA 5AEKB 2Z59B 3NVVA 1WY8A 4JGHB 3QHTA 3L4PA 3C8YA 2L0TA 1L4DB 2X8XX 2C7NB 3WA0A 2N1WA 5D6JB 4JIOU 3SR6A 2QHOA 4KKIA 1TZOA 2KMAA 1E10A 3RYTA 5G2NA 1T0QC 1IP9A 3LYYA 2MBHA 2K8CA 3A4SC 4S17A 3V6EB 1OTRB 2BF8B 3A9KB 3U7DA 3RN9C 4W9IA 2K22A 3RMKC 5BYRA 4KV2A 4LK0M 2DHZA 5BYQA 3IG3A 2QDFA 1I35A 1V2YA 3FAHA 3V6CB 4HWIB 2KAJA 2AQ2B 4K7UA 4LJPB 3VUWA 3WIMA 4B0MA 2ICIA 1MI0A 2V4LA 3IAM1 2K6DB 4BOZB 3T3OA 3BYYB 1K8RB 3Q3FA 2NCNA 2K0PA 2LGIA 2CS4A 3L0WB 2SAKA 2K1FA 3R8BA 2X38A 1I4RA 4IM3A 3RNFC 4LNKA 2MBEA 2KLGA 2G4DB 4W9LA 2WXGA 5D94A 2D2QA 2V3PA 3M63B 1BXTA 3P4PB 1AYFA 2V1YA 4IC7B 1L0VB 1CZPA 3ZTCA 1QF6A 4DBGA 1SE3A 1WX9A 1WH3A 2LEKA 1QT9A 3B2FA 3AE2B 2WNMA 5JHAA 2KWVB 1WXAA 4C56C 4P7IA 2MJ3A 2MRPA 2AWTA 2C7HA 1A70A 3ENEA 1EU3A 3N32A 3RUIB 4M0WA 3TBLD 1KM7A 1WIAA 2IPKD 1ET6A 1WE7A 4K7SA 4HPPA 3B0AA 2D3BA 2EMSA 2ON8A 2WU5B 4OHJA 4WIPA 3I5JC 2V0GA 3U30A 4J6IA 3DPDA 3IFWB 3PS6A 3AU4A 4ZRIA 3MJWA 2MQJA 4HPLB 1RFAA 4RM8A 3RZWC 3ZJTA 3P63A 3P42A 1V5TA 4RGTA 3LJ3A 3IT6B 3LXFA 4BKSA 4LNNA 3OWEB 3U52E 2JPHA 2WU2B 1DYQA 1GAQB 4NQKE 4JWUC 5TSSA 1HZ5A 1WR1A 3HUIA 3ZIMA 2KO3A 4G3XB 1V49A 3TEXA 3IT4B 3PLUA 4GMVA 2O6VA 3MP9A 3UIPB 1FXIA 3Q14C 1Q1OA 3V3XA 5CHFA 5T8IA 3NVYA 3ZUNA 3DDCB 1IGCA 1KLGD 3QARA 2KACA 2D3CA 3AN1A 3VVWB 2LD9A 1C4AA 1IGDA 1JRPA 3KWLA 2K8HA 3Q2AC 2A5UA 4G0NB 4XYCA 4K7WA 4II3B 1Q10A 3B1LX 5LXIB 3UQAA 4BZAA 4ZHOA 4HDOA 4IUMB 3E56A 1WGYA 4KZCA 5FKAC 3IVFA 5C2TB 1VR9A 3D32A 1OEYJ 1WRDB 4JL9A 3ZXVA 5KHOA 2J0JA 1DOIA 2KX0A 3TL5A 3VTUA 2L83A 3BK2A 4MELA 1R4NI 2WDVB 5CTRC 1IYFA 1DOXA 2WWZA 2LI5A 1TY0A 2J0KA 4ZRJA 5BO4B 2J53A 4PT5A 4E3CA 1WGGA 4ITKA 1X1MA 4RCOA 4AWJA 4KIKA 4KGSA 2KZRA 4MJSA 1F2RC 1EWCA 3DBLB 2D3GA 2FUHB 4WJQA 4L23A 1WGHA 1TS2A 4BVUC 3I9V1 4AUQC 1VZ8A 2TSSA 2BVCA 1KLVA 1JMLA 1TT5B 2LJ5A 1MG8A 3HK0A 1E0ZA 1C4CA 5HKHA 1N63A 4M0WB 1QZEA 1PYWD 2GB1A 4M8MA 2IBIB 3N1XC 2BYVE 2KVRA 2ZNVC 1J7CA 1UELA 2KMMA 3HVZA 1LFDA 5G55A 2LHDA 2RMMA 5I4DA 1PGBA 4RH6A 2PVOD 2IGGA 1YJJA 4KX6B 3KLSX 1N62A 4WJPA 2WX0A 3I57A 3M62B 3P2BA 4XWTA 3L10B 2WDTB 2CHZA 2WXLA 3AEBB 4W9DA 2VH2A 5JHBA 3WAMA 5IO9A 2ZNVB 2Q5WD 4ZYSA 2IO2B 3H6NA 1K51A 2QJLA 2LGYA 3QWZB 4FULA 2KNBA 2DYMA 4TSSA 3AV8A 2DENB 2KD0A 4FLHA 3IHPC 3DBRB 5JXVA 3PZ7A 1EWYC 5DCNA 1CJEA 2FCMA 3T9LA 4YSYB 2L7RA 3H8HA 1WX8A 4W9HA 1WXVA 4X57B 2W54A 3EHVA 4DHZB 3AE1B 1MVKA 3P4QB 2ZPYA 4N6EB 1SEBD 2NPTA 2GLSA 2LUMA 3M3JA 1P98A 2KDBA 1XLPA 2N0SB 1E9MA 5HI1A 1Q5WB 1RWSA 2Y5BB 3PZ8A 2BQQA 1AARA 4MH0E 3FILA 3NG0A 1UBQA 1WYGA 2R61A 2FIDA 1MG4A 1I4HA 4WJNA 1SE2A 4A8XC 4NAMA 4GGQA 2D3AA 1GB1A 4YTMB 5MPOA 4W9EA 4E74A 3APFA 5DPWA 1WSPA 3LB8C 1V9JA 3QCAA 3HM3A 3HM6X 4JE3B 3L16A 2YLMA 4WWNA 4OZAA 5LXHA 2VZKD 5L95C 1J8CA 3AMZA 2ZCCA 3CSFA 2JZZA 2IO3B 1KJTA 1ZDVA 3W2DA 2WXQA 3JVZX 1JQ4A 2BYTA 2ZVOA 2ZJDA 2JRHA 3SEBA 2UYZB 3DHIC 4IWPA 2HE7A 1XT9B 1KOTA 2BT6A 4N58A
chains in the Genus database with same CATH topology
3V6EB 1OTRB 2BF8B 2D10A 3A9KB 2MBOA 3TCAA 4EEWA 4WAAA 5E6NA 3U7DA 4AP4C 1V5OA 1LXDA 4GXBA 4TKNA 1WFYA 4DK5A 3UGBB 4W9IA 4HVBA 3ZNGC 3CF6E 1H4RA 2JF5A 2KXJA 3GOEA 1UD7A 2JY6A 4KV2A 3U8ZA 2JXXA 4HDQA 1VD2A 5JZEB 2BPSA 1WXSA 2DHZA 1J19A 3IG3A 4MGZE 4PS7A 1I35A 3EFUA 5DPTA 4EFOA 4FA6A 1V2YA 2MP2B 4DHZE 1YJ1A 2ZPNA 3W1YA 3V6CB 4HWIB 1F9JA 2GBKA 1WM2A 2WX1A 4K7UA 4KSKC 1C1YB 2LRWA 1U4AA 4LJPB 3VUWA 1SGHA 3RT3B 1P0RA 3WIMA 2L0FA 4B9KA 3A1QB 1RAXA 4GDLB 4AJYB 3PZDA 4KDLB 2V4LA 2KX3A 4MDKE 2KN5A 1LQBA 3VH3B 4NJ6A 2K6DB 1NI2A 3ZTDA 3DBSA 3B08A 4RM9A 1SE9A 4IM0A 4BOZB 3ALBA 1K8RB 2Z0EB 3Q3FA 2NCNA 4BBNF 2NVUI 2MCNB 3KYDD 2CS4A 3DVGY 1WJ6A 2V3SA 1WE6A 1NBFC 2MBBB 3IBEA 3KYCD 3L0WB 2HTHA 2K1FA 3ML8A 2KKCA 1EUVB 3H7PB 1SIFA 2LVPA 4IM3A 2KDIA 4WJOA 2MBEA 2LZ6A 4EUTA 4ANUA 1WYWB 2KLGA 4MEMA 5JH5C 3DVNV 2IO1B 1UZXB 3BINA 2G4DB 3L17A 1WJUA 4W9LA 4XZ4A 3QAQA 2MX2A 1E8XA 2DX5B 2C9WB 5D94A 3OAWA 2D2QA 2ASQA 1HE8A 1RLFA 2LVQA 3M63B 3X23A 2V1YA 3APDA 4IC7B 1I42A 3JSVA 4WWOA 3ZRFA 4NQLB 2N1VA 3L13A 3ZTCA 2NS5A 4DBGA 2ZCBA 2L00B 1WX9A 4URKA 2NBUA 5KHQA 1T0YA 1WH3A 1Y8RC 4IWOA 1R4MI 1GC6A 2XK5A 2BWFA 4TQ1A 5IA7A 2RGFA 5JHAA 3AU5A 2D07B 4A20A 2LVOA 2KWVB 2NPTB 3VTVA 1WXAA 4EZKA 4P7IA 2MRPA 2AWTA 5J2RA 1EO6A 4HCNB 1WMHB 2C7HA 2L76A 3ENEA 3N32A 3RUIB 2GOWA 3TBLD 1KM7A 1WIAA 2M4NA 4NAWB 1WE7A 4DWFA 4K7SA 4W9FA 2I1JA 2AEHA 3PPAA 4MSMB 3MTNB 2FCNA 3B0AA 4GIVA 3ZDTA 2C60A 2EMSA 4OVVA 2AL3A 1P3QU 4OVUA 2NBWB 3RD2A 4IWQA 3ZNZB 3U30A 4J6IA 4F1SA 3PREA 1UBIA 3DPDA 3DBLI 3IFWB 3PS6A 3AU4A 4ZRIA 5FR6A 2XK5B 3MJWA 2MQJA 1WI0A 4HPLB 3K9OB 1RFAA 4RM8A 3RZWC 2DYOA 3BY4B 3WALA 2LGXA 3QJZA 2DZJA 2O2VB 4PS3A 2N9PC 4MGYE 4BBNC 1V5TA 1GUAB 3DVGX 3LJ3A 3RZFA 2CHWA 5AZGA 1YX5B 2L3ZA 4W9GA 1E8YA 5CHVC 4IG7B 3PTFC 3WANA 1LM8B 4BKSA 5DPRA 3QC8B 2JPHA 4XC2A 1GG3A 5D2MB 3W1SA 2K8BA 4NQKE 4NY0A 3LDZE 1WR1A 3JW0X 3MHSD 3ZIMA 2KO3A 3NZSA 3ZNHB 4FHKA 1V49A 2DAJA 3EC8A 4G3XB 2JUOA 3DBHI 3PLUA 4JQWC 4ANWA 4GMVA 2O6VA 5E6PA 3AULA 1E7VA 3UQBA 3H7SA 3UIPB 1ZGUB 4WWPA 1Q1OA 5CHFA 1BT0A 2KANA 2KOXA 2WYQA 1YX6B 1S3SG 1Z5SB 2GMIC 2PEAA 3DDCB 3ZUNA 3I3TB 3QARA 3L54A 3TIXA 3VVWB 4K1RB 5C1ZA 2LD9A 2KHWB 2DAFA 2KWUB 2LASA 3QA8A 2OJRA 2K8HA 3SDLC 3ECIA 2A5UA 2FNJB 2GBMA 1V80A 4G0NB 4MM3A 5CX3A 4K7WA 2IY1B 4GN1A 2LGDA 4CHKA 4II2B 2KJRA 4G50A 4II3B 2VRRB 3Q3JA 2O6VD 2UWQA 4FJVB 3B1LX 4DDGD 2O6VB 4ZRKA 5LXIB 3UQAA 4EOYA 2PJHA 3R7RA 1WF9A 4HDOA 3NY5A 3ZDMC 2L8JA 4MGKE 2OOBB 3VQIA 4IUMB 2YVCA 2ZEQA 1WGYA 3H1UA 4KZCA 3A33B 2A4ZA 1ZKHA 1A5RA 4KDIC 3IVFA 4AJWA 2LUEA 4HK2A 4ANXA 3D32A 4DHJD 2GBRA 4E71A 3PRPB 1OEYJ 2B3AA 2J7QB 4DHJB 4FBJB 1WRDB 4JL9A 3KUDB 5KHOA 2J0JA 1TBEA 2KX0A 3GZNI 4RMAA 4W9KA 3TL5A 3ZLZA 2EMTA 3DBRI 2GBJA 1G6JA 2KJHB 3VTUA 3QX1A 2MBQA 4GDKA 3VXWA 4AOFA 2CR5A 4B6WA 1Z2MA 2IYDB 4MELA 4LJOB 5J17A 2BGFA 2N7DA 1R4NI 3PLVA 3N3KB 3SD5A 3PRMB 5CTRC 1IYFA 2ZVNA 1GJZA 2NBVB 2HJ8A 2WWZA 2LI5A 1P9DU 2J0KA 4YL8A 4GB9A 4K81A 4ZRJA 5BO4B 3R66C 5LLIA 4FJYA 3QIJA 4E3CA 4BKGA 1WGGA 2MWSB 4CYEA 1X1MA 2KFJA 2XBBC 3DQVA 3VTWA 2DZMA 1WJ4A 3A9JA 2KC1A 4KIKA 4AWJA 5E6OA 3UF8A 2KZRA 1WR6E 4HPMB 4MJSA 1WJNA 4F7ZA 2FIFA 2RPQA 2KFKA 1ZW7A 4GDKB 4KSLC 4WJQA 3DVNU 2D3GA 2FUHB 3JSVB 3KUZA 1XD3B 1WGHA 2N9XA 2MW5A 4HJKA 4BVUC 4IM2A 4DDID 2CKHB 2N9EB 2RD0A 1H8CA 3RCZA 5L83A 2KDFB 5CHWA 4PS8A 4F8CB 4AUQC 1ISNA 2JT4B 2M0XA 2IO0B 3DCGA 1UGMA 2KK8A 1KLVA 4TV3A 4KIKB 3KVFB 5TR5A 2KC2A 3A4RA 5D7GA 5AZHA 2LXAA 5AZFA 3UINB 4MJSB 1D3ZA 1IPGA 2LJ5A 1MG8A 3HK0A 3PV1A 5HKHA 4M0WB 1QZEA 2N4FA 4M8MA 2IBIB 2BYVE 2G45B 5GMVA 1E8WA 3W1SC 4PYZA 3R3MA 1WGDA 4NJ7A 1E8ZA 2KVRA 4HCPB 1RRBA 3R7QA 2ZNVC 5C23A 1L2NA 3A9KA 2LWPA 4WQOB 3L08A 2AL6A 3VUYA 3PSEB 1UELA 4LDTD 3T8MA 3VAWA 4FJZA 1LFDA 5G55A 4LDTB 3VUXA 4GU2A 2PE6B 1VCBA 2G3QB 2CHXA 3PGEA 2Z0DB 2C5LC 2KWCA 3TJPA 1S1QB 3PRZA 2KMCA 2WX0A 2MLBA 4WJPA 4BKSD 3M62B 3P2BA 1P1AA 2J0MA 3NS8A 2FCSA 1E7UA 3PHWB 3M95A 1TZ1A 3NOBA 3L10B 2L05A 4ZYNA 3AXCA 2RR9A 2WDTB 2DZKA 2D11A 2CHZA 2R2QA 2CU1A 3ZO5B 3A1QA 3AI5A 4GDLA 1Q0WB 2XEWA 2JVCA 4W9DA 4BOSC 1GNUA 5JHBA 4HXDA 3WAMA 2M8SA 3KUCB 3ONSA 1GC7A 1XQQA 2ZNVB 1EF5A 2C7MB 2IO2B 3H6NA 4MSQB 2JRIB 3V61A 4BKTA 4A3OA 1EF1A 1TGZB 4BFRA 2NR2A 4ICUA 2LGYA 3QWZB 2KJ6A 4FULA 3VDZA 1OEYA 3H7PA 1FXTB 1YQBA 2KQ7A 2KNBA 2BKFA 2DYMA 2DZIA 2I1KA 4CO7A 3ZW3A 2PE9A 2DENB 2KD0A 3CMMB 3EECA 3IHPC 4FLHA 3JYUA 1WM3A 4TQ0A 1WZ0A 1E90A 2KTFA 4NPNA 1OQYA 2LRUA 5DCNA 2FCMA 2EKEC 4N9F4 3OJ3A 3T9LA 1V81A 4FHJA 2IY0B 3ZNID 3TMPB 3UIOB 3WAPA 1WZ3A 3K9PB 1NDDA 2L7RA 1WX8A 1L7YA 3C0RB 3APCA 4W9HA 3NZUA 2JWZA 1WXVA 2M17A 4I6NB 1YIWA 3SHQA 4X57B 4ICVA 4MGIE 3VHTC 3EHVA 4DHZB 2K6QA 3VFKA 3WAOA 3H9DA 3HHMA 2G4SA 2K39A 4W9JA 4GOCA 5J18A 2ZPYA 4NNJB 4M8NA 1V86A 2RSUA 4ASWC 3DOWA 4LCDE 2BKRB 1WXMA 3OLMD 2NPTA 2AYOB 4JLCA 1M94A 2W9NA 3M3JA 1P98A 1WMHA 1WX7A 2JZ3B 2KDBA 1YD8U 2BYEA 2PPHA 3CSTA 5IAAC 5EDSA 3ZKJC 4NAWA 1Q5WB 2Y5BB 2BWES 1TTNA 3RULA 3HIZA 1AARA 4MH0E 1C3TA 4G11A 3N30A 2MSED 1UBQA 2HD5B 3ZVVA 3O65B 2LXCA 2ZZPB 2FIDA 3NHEB 4WJNA 4FADA 4I6LB 1CMXB 2N7EA 4FN2A 4W9CA 4EZJA 4EZLA 4IW0A 3SU8X 4GGQA 3KH0A 4KZ0A 4A3PA 3PT2B 2KLCA 4W9EA 4GSWA 4E74A 2O2VA 2FCQA 3APFA 1OGWA 3A9JB 3OJ4B 3KW5B 2BYFA 5DPWA 4ZDVA 2DYBA 3PHXB 2KFKB 1V9JA 3X0WA 3QCAA 5AEKB 3HM3A 2Z59B 3HM6X 2REXA 3VH4B 2KTRA 1PQSA 1WY8A 3L16A 4EKUA 2YLMA 4PYUA 4WWNA 4ANVA 4JGHB 3QHTA 1V6EA 5LXHA 5L95C 1J8CA 2ZCCA 2JZZA 2IO3B 1KJTA 3CSFA 2KDEB 4TUUA 2L0TA 1UH6A 2K25A 1J0GA 2IZVB 1E5WA 2C7NB 3JVZX 1WGRA 3ML9A 4DXAB 5DPSA 2N1WA 3QK0A 5D6JB 3V60A 3WA0A 4JIOU 2ZVOA 2R2OA 2ZJDA 2QHOA 4I6PA 2JRHA 2UYZB 2KMAA 4XX5A 3S2AA 1JRUA 2MP2A 3RYTA 4HLEA 3PVLA 4KVGB 5G2NA 4IWPA 2HE7A 3V62A 1XT9B 1IP9A 3ZRCA 2MBHA 2KTRB 2MA9B 2FAZA 3QQ8B 2KQSA 1KOTA 2K8CA 2GBNA 3A4SC 4B95A 2M1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V6E B;  1OTR B;  2BF8 B;  2D10 A;  3A9K B;  2MBO A;  3TCA A;  4EEW A;  4WAA A;  5E6N A;  3U7D A;  4AP4 C;  1V5O A;  1LXD A;  4GXB A;  4TKN A;  1WFY A;  4DK5 A;  3UGB B;  4W9I A;  4HVB A;  3ZNG C;  3CF6 E;  1H4R A;  2JF5 A;  2KXJ A;  3GOE A;  1UD7 A;  2JY6 A;  4KV2 A;  3U8Z A;  2JXX A;  4HDQ A;  1VD2 A;  5JZE B;  2BPS A;  1WXS A;  2DHZ A;  1J19 A;  3IG3 A;  4MGZ E;  4PS7 A;  1I35 A;  3EFU A;  5DPT A;  4EFO A;  4FA6 A;  1V2Y A;  2MP2 B;  4DHZ E;  1YJ1 A;  2ZPN A;  3W1Y A;  3V6C B;  4HWI B;  1F9J A;  2GBK A;  1WM2 A;  2WX1 A;  4K7U A;  4KSK C;  1C1Y B;  2LRW A;  1U4A A;  4LJP B;  3VUW A;  1SGH A;  3RT3 B;  1P0R A;  3WIM A;  2L0F A;  4B9K A;  3A1Q B;  1RAX A;  4GDL B;  4AJY B;  3PZD A;  4KDL B;  2V4L A;  2KX3 A;  4MDK E;  2KN5 A;  1LQB A;  3VH3 B;  4NJ6 A;  2K6D B;  1NI2 A;  3ZTD A;  3DBS A;  3B08 A;  4RM9 A;  1SE9 A;  4IM0 A;  4BOZ B;  3ALB A;  1K8R B;  2Z0E B;  3Q3F A;  2NCN A;  4BBN F;  2NVU I;  2MCN B;  3KYD D;  2CS4 A;  3DVG Y;  1WJ6 A;  2V3S A;  1WE6 A;  1NBF C;  2MBB B;  3IBE A;  3KYC D;  3L0W B;  2HTH A;  2K1F A;  3ML8 A;  2KKC A;  1EUV B;  3H7P B;  1SIF A;  2LVP A;  4IM3 A;  2KDI A;  4WJO A;  2MBE A;  2LZ6 A;  4EUT A;  4ANU A;  1WYW B;  2KLG A;  4MEM A;  5JH5 C;  3DVN V;  2IO1 B;  1UZX B;  3BIN A;  2G4D B;  3L17 A;  1WJU A;  4W9L A;  4XZ4 A;  3QAQ A;  2MX2 A;  1E8X A;  2DX5 B;  2C9W B;  5D94 A;  3OAW A;  2D2Q A;  2ASQ A;  1HE8 A;  1RLF A;  2LVQ A;  3M63 B;  3X23 A;  2V1Y A;  3APD A;  4IC7 B;  1I42 A;  3JSV A;  4WWO A;  3ZRF A;  4NQL B;  2N1V A;  3L13 A;  3ZTC A;  2NS5 A;  4DBG A;  2ZCB A;  2L00 B;  1WX9 A;  4URK A;  2NBU A;  5KHQ A;  1T0Y A;  1WH3 A;  1Y8R C;  4IWO A;  1R4M I;  1GC6 A;  2XK5 A;  2BWF A;  4TQ1 A;  5IA7 A;  2RGF A;  5JHA A;  3AU5 A;  2D07 B;  4A20 A;  2LVO A;  2KWV B;  2NPT B;  3VTV A;  1WXA A;  4EZK A;  4P7I A;  2MRP A;  2AWT A;  5J2R A;  1EO6 A;  4HCN B;  1WMH B;  2C7H A;  2L76 A;  3ENE A;  3N32 A;  3RUI B;  2GOW A;  3TBL D;  1KM7 A;  1WIA A;  2M4N A;  4NAW B;  1WE7 A;  4DWF A;  4K7S A;  4W9F A;  2I1J A;  2AEH A;  3PPA A;  4MSM B;  3MTN B;  2FCN A;  3B0A A;  4GIV A;  3ZDT A;  2C60 A;  2EMS A;  4OVV A;  2AL3 A;  1P3Q U;  4OVU A;  2NBW B;  3RD2 A;  4IWQ A;  3ZNZ B;  3U30 A;  4J6I A;  4F1S A;  3PRE A;  1UBI A;  3DPD A;  3DBL I;  3IFW B;  3PS6 A;  3AU4 A;  4ZRI A;  5FR6 A;  2XK5 B;  3MJW A;  2MQJ A;  1WI0 A;  4HPL B;  3K9O B;  1RFA A;  4RM8 A;  3RZW C;  2DYO A;  3BY4 B;  3WAL A;  2LGX A;  3QJZ A;  2DZJ A;  2O2V B;  4PS3 A;  2N9P C;  4MGY E;  4BBN C;  1V5T A;  1GUA B;  3DVG X;  3LJ3 A;  3RZF A;  2CHW A;  5AZG A;  1YX5 B;  2L3Z A;  4W9G A;  1E8Y A;  5CHV C;  4IG7 B;  3PTF C;  3WAN A;  1LM8 B;  4BKS A;  5DPR A;  3QC8 B;  2JPH A;  4XC2 A;  1GG3 A;  5D2M B;  3W1S A;  2K8B A;  4NQK E;  4NY0 A;  3LDZ E;  1WR1 A;  3JW0 X;  3MHS D;  3ZIM A;  2KO3 A;  3NZS A;  3ZNH B;  4FHK A;  1V49 A;  2DAJ A;  3EC8 A;  4G3X B;  2JUO A;  3DBH I;  3PLU A;  4JQW C;  4ANW A;  4GMV A;  2O6V A;  5E6P A;  3AUL A;  1E7V A;  3UQB A;  3H7S A;  3UIP B;  1ZGU B;  4WWP A;  1Q1O A;  5CHF A;  1BT0 A;  2KAN A;  2KOX A;  2WYQ A;  1YX6 B;  1S3S G;  1Z5S B;  2GMI C;  2PEA A;  3DDC B;  3ZUN A;  3I3T B;  3QAR A;  3L54 A;  3TIX A;  3VVW B;  4K1R B;  5C1Z A;  2LD9 A;  2KHW B;  2DAF A;  2KWU B;  2LAS A;  3QA8 A;  2OJR A;  2K8H A;  3SDL C;  3ECI A;  2A5U A;  2FNJ B;  2GBM A;  1V80 A;  4G0N B;  4MM3 A;  5CX3 A;  4K7W A;  2IY1 B;  4GN1 A;  2LGD A;  4CHK A;  4II2 B;  2KJR A;  4G50 A;  4II3 B;  2VRR B;  3Q3J A;  2O6V D;  2UWQ A;  4FJV B;  3B1L X;  4DDG D;  2O6V B;  4ZRK A;  5LXI B;  3UQA A;  4EOY A;  2PJH A;  3R7R A;  1WF9 A;  4HDO A;  3NY5 A;  3ZDM C;  2L8J A;  4MGK E;  2OOB B;  3VQI A;  4IUM B;  2YVC A;  2ZEQ A;  1WGY A;  3H1U A;  4KZC A;  3A33 B;  2A4Z A;  1ZKH A;  1A5R A;  4KDI C;  3IVF A;  4AJW A;  2LUE A;  4HK2 A;  4ANX A;  3D32 A;  4DHJ D;  2GBR A;  4E71 A;  3PRP B;  1OEY J;  2B3A A;  2J7Q B;  4DHJ B;  4FBJ B;  1WRD B;  4JL9 A;  3KUD B;  5KHO A;  2J0J A;  1TBE A;  2KX0 A;  3GZN I;  4RMA A;  4W9K A;  3TL5 A;  3ZLZ A;  2EMT A;  3DBR I;  2GBJ A;  1G6J A;  2KJH B;  3VTU A;  3QX1 A;  2MBQ A;  4GDK A;  3VXW A;  4AOF A;  2CR5 A;  4B6W A;  1Z2M A;  2IYD B;  4MEL A;  4LJO B;  5J17 A;  2BGF A;  2N7D A;  1R4N I;  3PLV A;  3N3K B;  3SD5 A;  3PRM B;  5CTR C;  1IYF A;  2ZVN A;  1GJZ A;  2NBV B;  2HJ8 A;  2WWZ A;  2LI5 A;  1P9D U;  2J0K A;  4YL8 A;  4GB9 A;  4K81 A;  4ZRJ A;  5BO4 B;  3R66 C;  5LLI A;  4FJY A;  3QIJ A;  4E3C A;  4BKG A;  1WGG A;  2MWS B;  4CYE A;  1X1M A;  2KFJ A;  2XBB C;  3DQV A;  3VTW A;  2DZM A;  1WJ4 A;  3A9J A;  2KC1 A;  4KIK A;  4AWJ A;  5E6O A;  3UF8 A;  2KZR A;  1WR6 E;  4HPM B;  4MJS A;  1WJN A;  4F7Z A;  2FIF A;  2RPQ A;  2KFK A;  1ZW7 A;  4GDK B;  4KSL C;  4WJQ A;  3DVN U;  2D3G A;  2FUH B;  3JSV B;  3KUZ A;  1XD3 B;  1WGH A;  2N9X A;  2MW5 A;  4HJK A;  4BVU C;  4IM2 A;  4DDI D;  2CKH B;  2N9E B;  2RD0 A;  1H8C A;  3RCZ A;  5L83 A;  2KDF B;  5CHW A;  4PS8 A;  4F8C B;  4AUQ C;  1ISN A;  2JT4 B;  2M0X A;  2IO0 B;  3DCG A;  1UGM A;  2KK8 A;  1KLV A;  4TV3 A;  4KIK B;  3KVF B;  5TR5 A;  2KC2 A;  3A4R A;  5D7G A;  5AZH A;  2LXA A;  5AZF A;  3UIN B;  4MJS B;  1D3Z A;  1IPG A;  2LJ5 A;  1MG8 A;  3HK0 A;  3PV1 A;  5HKH A;  4M0W B;  1QZE A;  2N4F A;  4M8M A;  2IBI B;  2BYV E;  2G45 B;  5GMV A;  1E8W A;  3W1S C;  4PYZ A;  3R3M A;  1WGD A;  4NJ7 A;  1E8Z A;  2KVR A;  4HCP B;  1RRB A;  3R7Q A;  2ZNV C;  5C23 A;  1L2N A;  3A9K A;  2LWP A;  4WQO B;  3L08 A;  2AL6 A;  3VUY A;  3PSE B;  1UEL A;  4LDT D;  3T8M A;  3VAW A;  4FJZ A;  1LFD A;  5G55 A;  4LDT B;  3VUX A;  4GU2 A;  2PE6 B;  1VCB A;  2G3Q B;  2CHX A;  3PGE A;  2Z0D B;  2C5L C;  2KWC A;  3TJP A;  1S1Q B;  3PRZ A;  2KMC A;  2WX0 A;  2MLB A;  4WJP A;  4BKS D;  3M62 B;  3P2B A;  1P1A A;  2J0M A;  3NS8 A;  2FCS A;  1E7U A;  3PHW B;  3M95 A;  1TZ1 A;  3NOB A;  3L10 B;  2L05 A;  4ZYN A;  3AXC A;  2RR9 A;  2WDT B;  2DZK A;  2D11 A;  2CHZ A;  2R2Q A;  2CU1 A;  3ZO5 B;  3A1Q A;  3AI5 A;  4GDL A;  1Q0W B;  2XEW A;  2JVC A;  4W9D A;  4BOS C;  1GNU A;  5JHB A;  4HXD A;  3WAM A;  2M8S A;  3KUC B;  3ONS A;  1GC7 A;  1XQQ A;  2ZNV B;  1EF5 A;  2C7M B;  2IO2 B;  3H6N A;  4MSQ B;  2JRI B;  3V61 A;  4BKT A;  4A3O A;  1EF1 A;  1TGZ B;  4BFR A;  2NR2 A;  4ICU A;  2LGY A;  3QWZ B;  2KJ6 A;  4FUL A;  3VDZ A;  1OEY A;  3H7P A;  1FXT B;  1YQB A;  2KQ7 A;  2KNB A;  2BKF A;  2DYM A;  2DZI A;  2I1K A;  4CO7 A;  3ZW3 A;  2PE9 A;  2DEN B;  2KD0 A;  3CMM B;  3EEC A;  3IHP C;  4FLH A;  3JYU A;  1WM3 A;  4TQ0 A;  1WZ0 A;  1E90 A;  2KTF A;  4NPN A;  1OQY A;  2LRU A;  5DCN A;  2FCM A;  2EKE C;  4N9F 4;  3OJ3 A;  3T9L A;  1V81 A;  4FHJ A;  2IY0 B;  3ZNI D;  3TMP B;  3UIO B;  3WAP A;  1WZ3 A;  3K9P B;  1NDD A;  2L7R A;  1WX8 A;  1L7Y A;  3C0R B;  3APC A;  4W9H A;  3NZU A;  2JWZ A;  1WXV A;  2M17 A;  4I6N B;  1YIW A;  3SHQ A;  4X57 B;  4ICV A;  4MGI E;  3VHT C;  3EHV A;  4DHZ B;  2K6Q A;  3VFK A;  3WAO A;  3H9D A;  3HHM A;  2G4S A;  2K39 A;  4W9J A;  4GOC A;  5J18 A;  2ZPY A;  4NNJ B;  4M8N A;  1V86 A;  2RSU A;  4ASW C;  3DOW A;  4LCD E;  2BKR B;  1WXM A;  3OLM D;  2NPT A;  2AYO B;  4JLC A;  1M94 A;  2W9N A;  3M3J A;  1P98 A;  1WMH A;  1WX7 A;  2JZ3 B;  2KDB A;  1YD8 U;  2BYE A;  2PPH A;  3CST A;  5IAA C;  5EDS A;  3ZKJ C;  4NAW A;  1Q5W B;  2Y5B B;  2BWE S;  1TTN A;  3RUL A;  3HIZ A;  1AAR A;  4MH0 E;  1C3T A;  4G11 A;  3N30 A;  2MSE D;  1UBQ A;  2HD5 B;  3ZVV A;  3O65 B;  2LXC A;  2ZZP B;  2FID A;  3NHE B;  4WJN A;  4FAD A;  4I6L B;  1CMX B;  2N7E A;  4FN2 A;  4W9C A;  4EZJ A;  4EZL A;  4IW0 A;  3SU8 X;  4GGQ A;  3KH0 A;  4KZ0 A;  4A3P A;  3PT2 B;  2KLC A;  4W9E A;  4GSW A;  4E74 A;  2O2V A;  2FCQ A;  3APF A;  1OGW A;  3A9J B;  3OJ4 B;  3KW5 B;  2BYF A;  5DPW A;  4ZDV A;  2DYB A;  3PHX B;  2KFK B;  1V9J A;  3X0W A;  3QCA A;  5AEK B;  3HM3 A;  2Z59 B;  3HM6 X;  2REX A;  3VH4 B;  2KTR A;  1PQS A;  1WY8 A;  3L16 A;  4EKU A;  2YLM A;  4PYU A;  4WWN A;  4ANV A;  4JGH B;  3QHT A;  1V6E A;  5LXH A;  5L95 C;  1J8C A;  2ZCC A;  2JZZ A;  2IO3 B;  1KJT A;  3CSF A;  2KDE B;  4TUU A;  2L0T A;  1UH6 A;  2K25 A;  1J0G A;  2IZV B;  1E5W A;  2C7N B;  3JVZ X;  1WGR A;  3ML9 A;  4DXA B;  5DPS A;  2N1W A;  3QK0 A;  5D6J B;  3V60 A;  3WA0 A;  4JIO U;  2ZVO A;  2R2O A;  2ZJD A;  2QHO A;  4I6P A;  2JRH A;  2UYZ B;  2KMA A;  4XX5 A;  3S2A A;  1JRU A;  2MP2 A;  3RYT A;  4HLE A;  3PVL A;  4KVG B;  5G2N A;  4IWP A;  2HE7 A;  3V62 A;  1XT9 B;  1IP9 A;  3ZRC A;  2MBH A;  2KTR B;  2MA9 B;  2FAZ A;  3QQ8 B;  2KQS A;  1KOT A;  2K8C A;  2GBN A;  3A4S C;  4B95 A;  2M1M A; 
#chains in the Genus database with same CATH topology
 2D10 A;  4WAA A;  1AW7 A;  1RM6 C;  1V5O A;  1LXD A;  1FNV A;  1HA5 A;  2H88 B;  4HRS A;  3CF6 E;  2KXJ A;  2JY6 A;  3U8Z A;  4HDQ A;  2W3R A;  1HEZ E;  1IUE A;  4MGZ E;  4PS7 A;  5IN7 A;  3EFU A;  5DPT A;  4EFO A;  4FA6 A;  4IKG A;  1YJ1 A;  2EEL A;  2L1A A;  1C1Y B;  4C00 A;  4JX1 C;  3PZD A;  4KDL B;  1E7P B;  1V1P B;  3ZTD A;  3DBS A;  1SE9 A;  4IM0 A;  1YN5 A;  3ALB A;  5HHD G;  4BBN F;  2DNF A;  2NVU I;  3DVG Y;  1WJ6 A;  2V3S A;  1WE6 A;  1NBF C;  2MBB B;  4BBN C;  1GPX A;  1JW9 D;  3DWM A;  2LHE A;  3AE5 B;  2KDI A;  1QOB A;  2LMC A;  4EUT A;  3Q3N C;  1B9R A;  3BIN A;  4XZ4 A;  1KLU D;  2J42 A;  1E8X A;  3OAW A;  2BW2 A;  2ASQ A;  1HE8 A;  4YWG G;  3L13 A;  2WXF A;  1NEN B;  4OZB A;  2WXI A;  2NS5 A;  2K9X A;  1MHH E;  4URK A;  5KHQ A;  2N9L A;  2V9H A;  2WP9 B;  1R4M I;  1GC6 A;  1K53 A;  2RGF A;  2KT7 A;  2PIA A;  1FRR A;  2NPT B;  4EZK A;  2I2Y A;  5J2R A;  3WCQ A;  4RGO S;  3O13 A;  2GOW A;  2M4N A;  4DWF A;  4W9F A;  2I1J A;  5LNK 1;  3MTN B;  3FIL B;  3ZDT A;  1N5W A;  3GS2 A;  3SFD B;  4OVV A;  1C9F A;  5EE9 A;  1P3Q U;  4OVU A;  2NBW B;  3ZJV A;  1F1H A;  2QIL A;  2XK5 B;  1WI0 A;  3K9O B;  2DWQ A;  4PS3 A;  2N9P C;  4MGY E;  4MH8 A;  3DVG X;  1FRD A;  3FC4 A;  2PMV A;  2QSD A;  4LTU A;  1SJE D;  3GE8 C;  3PTF C;  1LM8 B;  1WXQ A;  3WAN A;  2WXN A;  3Q6B A;  5D2M B;  3W1S A;  2K8B A;  4NY0 A;  4C80 A;  2DAJ A;  3DBH I;  2SEB D;  5E6P A;  2KAN A;  2WYQ A;  2WXO A;  1FFU A;  1S3S G;  2GMI C;  2PEA A;  4D2K A;  4RF0 A;  3L54 A;  5C1Z A;  2KHW B;  4MT5 A;  5IOI A;  2DAF A;  3QA8 A;  1TKY A;  2HTM E;  2FNJ B;  2GBM A;  1V80 A;  4YTN B;  4P1C C;  4GN1 A;  2LGD A;  4G50 A;  2VRR B;  4FJV B;  4EOY A;  2PJH A;  3R7R A;  1NYR A;  1TIF A;  2L8J A;  2LJI A;  3H1U A;  3A33 B;  4B0E A;  2PKO A;  4AJW A;  4HK2 A;  4ANX A;  4DHJ D;  2GBR A;  2HDE A;  4UDU C;  1TBE A;  3GZN I;  4RMA A;  2EMT A;  1XEE A;  4AOF A;  3VXW A;  4B6W A;  1CK1 A;  2NTS A;  2IYD B;  2N7D A;  3N3K B;  3SD5 A;  3PRM B;  3BYT B;  1GJZ A;  2HJ8 A;  3J9C A;  4RNA A;  1J7A A;  2AQ1 B;  3TEY A;  4FJY A;  2B76 B;  4BKG A;  3AE9 B;  2MWS B;  4CYE A;  2N7J A;  1ACC A;  2NTT A;  1CQV A;  1UUP A;  2Z8L A;  1L5P A;  2KFK A;  3N20 C;  4GDK B;  4KSL C;  3DVN U;  3KUZ A;  2GI9 A;  3E9S A;  1T0S C;  1XD3 B;  2MJE A;  3KQ4 A;  2MW5 A;  2CKH B;  2GRI A;  3W9C B;  2N9E B;  2RD0 A;  3RCZ A;  4RGN A;  2QMT A;  4PS8 A;  1UWX A;  1K52 A;  4H2A A;  1UGM A;  2KK8 A;  2QC8 A;  5TR5 A;  2CU3 A;  4ZOH C;  5AZH A;  3UIN B;  1D3Z A;  1IPG A;  1B1Z A;  3RNG C;  1NVI D;  5G5H A;  1HTQ A;  3VRA B;  3AEC B;  5EE1 A;  1JRO A;  2YEP F;  1BML C;  2G45 B;  3W1S C;  1N5X A;  4PYZ A;  3R3M A;  1P7E A;  2JWU A;  1RRB A;  3R7Q A;  2IND C;  1TS4 A;  1L2N A;  2LWP A;  1FFV A;  2ZW0 A;  3L08 A;  4LDT D;  3T8M A;  3VAW A;  4FJZ A;  4A90 A;  3VUX A;  2N9K A;  1PGX A;  1ZOY B;  2BS3 B;  1NEK B;  2G3Q B;  2CHX A;  2MJD A;  1XLQ A;  4C7Z A;  2C5L C;  1TKE A;  2J0M A;  1I4Q A;  2FCS A;  1EM7 A;  1E7U A;  2WXR A;  3M95 A;  2L05 A;  1I4P A;  3AXC A;  2FUG 1;  2D11 A;  1Q0W B;  2XEW A;  4BOS C;  1GNU A;  2YEP B;  1C76 A;  3MC9 A;  4MSQ B;  4KGT A;  3UI3 A;  1D6E C;  1EF1 A;  1TGZ B;  1JWU D;  5H92 C;  3N1Y C;  1YQB A;  5BMH A;  3Q8B A;  3AH7 A;  2I1K A;  2QCZ A;  1QOG A;  1SB3 C;  3EEC A;  1WM3 A;  1WZ0 A;  1OQY A;  3BVM A;  2JU6 X;  2QEJ C;  1KH0 A;  1ZUD 2;  1WZ3 A;  1E6E B;  1MHX A;  3APC A;  3NZU A;  3MC0 B;  2M17 A;  3RNA C;  3SHQ A;  1YIW A;  3VHT C;  3BII D;  3H9D A;  3HHM A;  2G4S A;  2K39 A;  4W9J A;  2IGD A;  1C4P A;  4M8N A;  1V86 A;  3EA6 A;  2RSU A;  4LNO A;  2XNA C;  3DOW A;  4LCD E;  4GLS C;  1WX7 A;  1QOF A;  4RFB A;  1YD8 U;  1N60 A;  3ZKJ C;  4NAW A;  4OZC A;  2ONQ A;  2RDH A;  4XGA B;  3TEW A;  3N30 A;  3ZXR A;  2MSE D;  1FMA D;  2HD5 B;  2Y3A A;  1LGR A;  3ZVV A;  1KTK A;  3IXS A;  2LXC A;  3NVZ A;  4W9C A;  4YTP B;  4IW0 A;  3SU8 X;  3KH0 A;  4A3P A;  4GSW A;  4ACF A;  2O2V A;  1JWS D;  1YOV B;  3RPF C;  2WXP A;  2DYB A;  2IGH A;  2KFK B;  2KN4 A;  2REX A;  3VH4 B;  1PQS A;  4EKU A;  3GP7 A;  3NS1 A;  2VZK B;  2KWD A;  2KDE B;  4NJC A;  1UH6 A;  2K25 A;  4HKZ E;  2VH1 A;  2IZV B;  1IBX A;  1WGR A;  2JQR B;  2E6X A;  2R2O A;  4P1B C;  4I6P A;  3DWG C;  2MEK A;  3S2A A;  1JRU A;  2MH7 A;  1C78 A;  1TYG B;  3T3N A;  3ZRC A;  2UU7 A;  4ARC A;  2KTR B;  3QQ8 B;  2KQS A;  1TKG A;  2GBN A;  4EEW A;  5E6N A;  3VRB B;  2RDB C;  4GXB A;  1V1P A;  4TKN A;  1WFY A;  4XDC A;  3UGB B;  1FCL A;  3ZNG C;  3GOE A;  1JWB D;  1UD7 A;  2JXX A;  4KGR A;  4NZL B;  5JZE B;  2BPS A;  1WXS A;  1ZDX A;  3URY A;  2INC C;  2MP2 B;  4DHZ E;  2ZPN A;  1GB4 A;  1N61 A;  2GBK A;  2LRW A;  1SGH A;  1P0R A;  4AJY B;  1JWM D;  4MDK E;  2KN5 A;  1LQB A;  3VH3 B;  1NI2 A;  4C4V A;  4WQM A;  2M19 A;  3B08 A;  4CQN A;  4FXC A;  3W5U B;  2Z0E B;  1MJD A;  1J7B A;  1QQR A;  1L6U A;  3KYD D;  2MCN B;  3KYC D;  3ML8 A;  1GOZ A;  2HTH A;  2KKC A;  1SIF A;  4WJO A;  4YT0 B;  5JH5 C;  3DVN V;  2IO1 B;  3L17 A;  1ZPS A;  3I63 C;  2MX2 A;  2DX5 B;  5FR3 A;  2PTL A;  2LVQ A;  1RLF A;  3X23 A;  3APD A;  2FE8 A;  1KF6 B;  2KYW A;  3JSV A;  4NQL B;  4WWO A;  2N1V A;  1ROE A;  2ZCB A;  1ZP0 B;  2L00 B;  2JXT A;  1T0Y A;  1QOA A;  2G1E A;  4ZRQ A;  3CIR B;  2BB5 A;  1YNT E;  1XO3 A;  2XK5 A;  2BWF A;  3TUO A;  4LNI A;  3VTV A;  2OHF A;  3NZ3 A;  2Y5P A;  1K50 A;  3AE4 B;  4DQO C;  4NAW B;  2AEH A;  3PPA A;  1UNS A;  1V8C A;  4GIV A;  1QIL A;  3P1M A;  1FCC C;  1PUT A;  4IWQ A;  3ZNZ B;  2G9H D;  1HTO A;  3PRE A;  4F1S A;  1UBI A;  1T0R C;  3DBL I;  5FK9 C;  4OVZ A;  1PDX A;  2PLP A;  4LNF A;  3WAL A;  2O2V B;  3RZF A;  2CHW A;  5AZG A;  1YX5 B;  2L3Z A;  1MPE A;  4W9G A;  1E8Y A;  5CHV C;  1VLB A;  5DPR A;  4DXG A;  3QC8 B;  1D5M C;  2WDR B;  4M01 A;  1F52 A;  1QLB B;  3LDZ E;  3JW0 X;  1L4Z B;  1F2R I;  3ZNH B;  1IBX B;  5IP4 D;  2JUO A;  2JSV X;  4JQW C;  3AUL A;  1E7V A;  3H7S A;  5G5G A;  2HJ1 A;  1ZGU B;  4WWP A;  1BT0 A;  2KOX A;  1YX6 B;  4K3C A;  3I3T B;  5BMG A;  4K1R B;  2OJR A;  3SDL C;  3ECI A;  1SBB B;  3NVW A;  2MHJ A;  5CX3 A;  5AUK A;  2PVG C;  3BK1 A;  1FNW A;  1F0Z A;  2O6V D;  2UWQ A;  4DDG D;  2ZW1 A;  2J52 A;  3GB1 A;  3ZDM C;  4MGK E;  2WGS A;  1ZE3 D;  3VQI A;  2ZEQ A;  1FO4 A;  2A4Z A;  1ZKH A;  3GZN B;  1A5R A;  4KDI C;  1YN3 A;  2BBC A;  2LUE A;  3VR9 B;  4E71 A;  2W55 A;  2B3A A;  2J7Q B;  3W5V B;  4DHJ B;  4FBJ B;  2K5P A;  4C4V B;  4W9K A;  3ZLZ A;  3DBR I;  2GBJ A;  1G6J A;  4GDK A;  2CR5 A;  3PO0 A;  1Z2M A;  4LJO B;  2BGF A;  3AEF B;  1STE A;  2ZVN A;  1P9D U;  4K81 A;  3R66 C;  5LLI A;  3QIJ A;  4JWS C;  2KFJ A;  3DQV A;  2DZM A;  3TSS A;  2L32 A;  3UF8 A;  1FNU A;  2W82 A;  4A9A A;  5EE3 A;  4F7Z A;  2RPQ A;  5EE0 A;  1ZW7 A;  4XDD A;  3C19 A;  1VJK A;  3JSV B;  2INN E;  2N9X A;  4IM2 A;  4L2Y A;  4WWM A;  3Q8C A;  3DHG C;  1ISN A;  2JT4 B;  2M0X A;  3DCG A;  3Q3O C;  2RPV A;  1SIJ A;  1WWT A;  3KVF B;  3A4R A;  5D7G A;  3MFG A;  5AZF A;  1D4B A;  3PV1 A;  1Y56 A;  5D3D A;  3AEA B;  2N4F A;  1E8W A;  2WLB A;  2WXJ A;  1WGD A;  1E8Z A;  5C23 A;  4WQO B;  1HZ6 A;  4LDT B;  4GU2 A;  1VCB A;  3PGE A;  2Z0D B;  2WS3 B;  2KWC A;  1S1Q B;  1WRI A;  3PRZ A;  1SE4 A;  2KMC A;  2MLB A;  3ABV B;  3NS8 A;  5D3I B;  1VZ7 A;  4IDI A;  1XF5 L;  1UF0 A;  3NOB A;  2CU1 A;  3SFE B;  3A1Q A;  3AI5 A;  4GDL A;  3ZO5 B;  2M8S A;  5BYS A;  2BTE A;  1GC7 A;  1EF5 A;  3MC8 A;  4KKJ A;  3AM9 A;  2JRI B;  4BFR A;  2NR2 A;  4ICU A;  2KJ6 A;  3VDZ A;  2INP E;  3H7P A;  1FXT B;  2JX5 A;  2BKF A;  2DZI A;  3ZW3 A;  1OFF A;  1SF0 A;  1BUI C;  3CMM B;  3BVZ A;  3AEG B;  3JYU A;  4TQ0 A;  2LRU A;  2FBW B;  1VDV A;  2WXH A;  2EKE C;  1R4N B;  1V81 A;  3UIO B;  3K9P B;  3C0R B;  2WQY B;  4I6N B;  4ICV A;  3VFK A;  4O1N A;  2EKI A;  4GOC A;  4N59 A;  3N1Z C;  3OLM D;  1RFK A;  1I4G A;  5BMI A;  2AYO B;  2K3U A;  2XN9 C;  2W9N A;  4A55 A;  1WMH A;  2JZ3 B;  2BYE A;  2JYE A;  2H89 B;  2BWE S;  1NYQ A;  3RUL A;  1KRH A;  3HIZ A;  1SSN A;  3U7Z A;  1C3T A;  3MHZ A;  1KFY B;  3AE3 B;  1L6V A;  1T5X D;  3O65 B;  2ZZP B;  1CMX B;  2M0A A;  2N7E A;  4FN2 A;  4EZJ A;  4KZ0 A;  2J4X A;  2FCQ A;  5C3J B;  1OGW A;  3OJ4 B;  2BYF A;  4YXD B;  4ZDV A;  1D5X C;  2IJ0 A;  3B9J A;  2KTR A;  3RNB C;  2IDY A;  4PYU A;  4ANV A;  1V6E A;  1VRA B;  2Y5C A;  1PFD A;  2BB6 A;  4TUU A;  1J0G A;  3AE8 B;  5IKC M;  1E5W A;  3ML9 A;  4DXA B;  5DPS A;  3V60 A;  3QK0 A;  1YMH E;  4XX5 A;  2MP2 A;  4L1B A;  4HLE A;  3PVL A;  4KVG B;  3V62 A;  2MA9 B;  2FAZ A;  4B95 A;  3P4S B;  2M1M A;  1R7S A;  3P4R B;  4IOI E;  2MBO A;  3TCA A;  3BWU D;  3DHH C;  1F77 A;  4AP4 C;  1YQ4 B;  4DK5 A;  4HVB A;  1H4R A;  2JF5 A;  1VD2 A;  1AN8 A;  1J19 A;  4DXF A;  1PGA A;  3RFZ B;  3KWV A;  4OW0 A;  3W1Y A;  4LLG M;  1F9J A;  4S0R A;  2WX1 A;  1WM2 A;  3Q3M C;  2L52 A;  4KSK C;  1U4A A;  3RT3 B;  2L0F A;  4B9K A;  3A1Q B;  1RAX A;  4GDL B;  2KX3 A;  4WH4 A;  4NJ6 A;  2LFI A;  4RM9 A;  2JZP A;  3HVD A;  3FKY A;  3IBE A;  1EUV B;  3H7P B;  1V97 A;  2LVP A;  2WDQ B;  3RNE C;  2LZ6 A;  4ANU A;  1WYW B;  4MEM A;  1UZX B;  1WJU A;  3QAQ A;  1T3Q A;  2C9W B;  1HQR D;  3VR8 B;  1I42 A;  3ZRF A;  4TMA B;  2WXK A;  2NBU A;  1Y8R C;  4IWO A;  1QKZ A;  4TQ1 A;  4ZHP A;  5IA7 A;  4M00 A;  1TY2 A;  4R3D A;  3AU5 A;  3Q8E A;  3GE3 C;  2D07 B;  3NJT A;  4A20 A;  1XLO A;  2LVO A;  5GXG B;  4Q2J A;  2M56 B;  1EO6 A;  1I7H A;  4HCN B;  4QAY A;  1WMH B;  2L76 A;  2BS4 B;  4MSM B;  2FCN A;  2C60 A;  2AL3 A;  3RD2 A;  2AX5 A;  5FR6 A;  3ETR A;  1FD6 A;  4C7Y A;  5HFY A;  1UGJ A;  2V3N A;  3AE6 B;  2DYO A;  3BY4 B;  1SXT A;  2LGX A;  1FEH A;  2DZJ A;  3QJZ A;  1GUA B;  1D5Z C;  3EGR A;  4IG7 B;  1ENF A;  1M4V A;  1AWD A;  4HJG E;  4XC2 A;  1P7F A;  4EE2 A;  1GG3 A;  2CJO A;  3Q69 A;  4US8 A;  1L0Y B;  2I38 A;  4PK1 A;  3MHS D;  2PW9 A;  3NZS A;  4FHK A;  3EC8 A;  4USA A;  4RGM A;  3AB5 A;  4ANW A;  1ZXI A;  1TS3 A;  4US9 A;  3UQB A;  4XWW A;  3B2G A;  4MAC A;  1V1O A;  2NMQ A;  1XCT L;  1Z5S B;  1TS5 A;  3TIX A;  5H8Y E;  3MJ5 A;  2KWU B;  4P16 A;  2LAS A;  2KDM A;  4MM3 A;  2IY1 B;  3U4E G;  4CHK A;  4II2 B;  2KJR A;  3Q3J A;  1DGJ A;  3RNC C;  4WAF A;  2O6V B;  1DOY A;  4ZRK A;  4P6V F;  3EUB 2;  1WF9 A;  4ZRP A;  3NY5 A;  2OOB B;  2YVC A;  2KQ4 X;  1XXG A;  3IAS 1;  2D5G A;  2OJW A;  3CWI A;  1C77 A;  3PRP B;  3KUD B;  1TJE A;  2DBY A;  1MFW A;  3BVG A;  1FPY A;  2KJH B;  4ARI A;  3QX1 A;  2MBQ A;  1R4M B;  5J17 A;  3PLV A;  1SJH D;  1VZ6 A;  2JYT A;  2NBV B;  2DLB A;  4XE0 A;  4YL8 A;  4GB9 A;  4AS1 A;  1RYJ A;  3BZD B;  4RF1 A;  1FIQ A;  2XBB C;  3VTW A;  3A9J A;  1WJ4 A;  2KC1 A;  5E6O A;  1WR6 E;  4HPM B;  4K3B A;  1WJN A;  2FIF A;  4J3O D;  3U2S C;  1ZXH A;  2V4I B;  1ET9 A;  1HXY D;  1XLN A;  4HJK A;  4DDI D;  1H8C A;  5L83 A;  2KDF B;  5CHW A;  2KVZ A;  4F8C B;  2IO0 B;  1YN4 A;  3TEZ A;  4TV3 A;  4KIK B;  2KC2 A;  2LXA A;  4MJS B;  3AED B;  3ZJU A;  1ESF A;  4A6Q A;  4HKQ A;  5E6J A;  5GMV A;  2AQ3 B;  4NJ7 A;  4AQ7 A;  4HCP B;  1C79 A;  3A9K A;  2AL6 A;  1LO5 D;  3DBH B;  3VUY A;  3PSE B;  2PE6 B;  3NUH B;  3TJP A;  3ZYY X;  1WGK A;  4BKS D;  1I4X A;  2WXM A;  1P1A A;  3PHW B;  2WHI A;  1TZ1 A;  1YJI A;  1FXA A;  4ZYN A;  2RR9 A;  2DZK A;  3N9Y C;  2R2Q A;  1JWA D;  1XCQ L;  2JVC A;  3AE7 B;  4HXD A;  1JAL A;  3KUC B;  3ONS A;  1XQQ A;  2C7M B;  3AEE B;  4BKT A;  3V61 A;  4A3O A;  3OG5 A;  2BS2 B;  3Q8F A;  1OEY A;  4YSX B;  3R2I A;  4HEA 1;  2KQ7 A;  4CO7 A;  3RI7 C;  4YSZ B;  2PE9 A;  3Q8A A;  1E90 A;  2KTF A;  4HRO A;  4NPN A;  3ZGZ A;  1JCK B;  5HG2 A;  1UWM A;  1L0X B;  4N9F 4;  3OJ3 A;  4MM3 B;  5AUI A;  2E3T A;  2QIE B;  2IY0 B;  4FHJ A;  3TMP B;  3V05 A;  3WAP A;  3ZNI D;  1NDD A;  1OQR A;  1L7Y A;  1YQ3 B;  2JWZ A;  4MGI E;  2K6Q A;  3WAO A;  1T6B X;  1EU4 A;  1NI3 A;  5J18 A;  4NNJ B;  2LGS A;  4ASW C;  2BKR B;  1WXM A;  3ZQ4 A;  1OQQ A;  4JLC A;  1M94 A;  3R2T A;  2CJN A;  3NRZ A;  4JPS A;  2PPH A;  3CST A;  5EDS A;  5IAA C;  3HRD D;  1TTN A;  4G11 A;  2ACZ B;  4WUR A;  1FM0 D;  1N6Z A;  3NHE B;  4FAD A;  2W3S A;  4REZ A;  4I6L B;  4EZL A;  4BAX A;  3PT2 B;  2KLC A;  2RDG A;  3A9J B;  3KW5 B;  3EFC A;  2OED A;  3PHX B;  4M02 A;  3X0W A;  5AEK B;  2Z59 B;  3NVV A;  1WY8 A;  4JGH B;  3QHT A;  3L4P A;  3C8Y A;  2L0T A;  1L4D B;  2X8X X;  2C7N B;  3WA0 A;  2N1W A;  5D6J B;  4JIO U;  3SR6 A;  2QHO A;  4KKI A;  1TZO A;  2KMA A;  1E10 A;  3RYT A;  5G2N A;  1T0Q C;  1IP9 A;  3LYY A;  2MBH A;  2K8C A;  3A4S C;  4S17 A;  3V6E B;  1OTR B;  2BF8 B;  3A9K B;  3U7D A;  3RN9 C;  4W9I A;  2K22 A;  3RMK C;  5BYR A;  4KV2 A;  4LK0 M;  2DHZ A;  5BYQ A;  3IG3 A;  2QDF A;  1I35 A;  1V2Y A;  3FAH A;  3V6C B;  4HWI B;  2KAJ A;  2AQ2 B;  4K7U A;  4LJP B;  3VUW A;  3WIM A;  4B0M A;  2ICI A;  1MI0 A;  2V4L A;  3IAM 1;  2K6D B;  4BOZ B;  3T3O A;  3BYY B;  1K8R B;  3Q3F A;  2NCN A;  2K0P A;  2LGI A;  2CS4 A;  3L0W B;  2SAK A;  2K1F A;  3R8B A;  2X38 A;  1I4R A;  4IM3 A;  3RNF C;  4LNK A;  2MBE A;  2KLG A;  2G4D B;  4W9L A;  2WXG A;  5D94 A;  2D2Q A;  2V3P A;  3M63 B;  1BXT A;  3P4P B;  1AYF A;  2V1Y A;  4IC7 B;  1L0V B;  1CZP A;  3ZTC A;  1QF6 A;  4DBG A;  1SE3 A;  1WX9 A;  1WH3 A;  2LEK A;  1QT9 A;  3B2F A;  3AE2 B;  2WNM A;  5JHA A;  2KWV B;  1WXA A;  4C56 C;  4P7I A;  2MJ3 A;  2MRP A;  2AWT A;  2C7H A;  1A70 A;  3ENE A;  1EU3 A;  3N32 A;  3RUI B;  4M0W A;  3TBL D;  1KM7 A;  1WIA A;  2IPK D;  1ET6 A;  1WE7 A;  4K7S A;  4HPP A;  3B0A A;  2D3B A;  2EMS A;  2ON8 A;  2WU5 B;  4OHJ A;  4WIP A;  3I5J C;  2V0G A;  3U30 A;  4J6I A;  3DPD A;  3IFW B;  3PS6 A;  3AU4 A;  4ZRI A;  3MJW A;  2MQJ A;  4HPL B;  1RFA A;  4RM8 A;  3RZW C;  3ZJT A;  3P63 A;  3P42 A;  1V5T A;  4RGT A;  3LJ3 A;  3IT6 B;  3LXF A;  4BKS A;  4LNN A;  3OWE B;  3U52 E;  2JPH A;  2WU2 B;  1DYQ A;  1GAQ B;  4NQK E;  4JWU C;  5TSS A;  1HZ5 A;  1WR1 A;  3HUI A;  3ZIM A;  2KO3 A;  4G3X B;  1V49 A;  3TEX A;  3IT4 B;  3PLU A;  4GMV A;  2O6V A;  3MP9 A;  3UIP B;  1FXI A;  3Q14 C;  1Q1O A;  3V3X A;  5CHF A;  5T8I A;  3NVY A;  3ZUN A;  3DDC B;  1IGC A;  1KLG D;  3QAR A;  2KAC A;  2D3C A;  3AN1 A;  3VVW B;  2LD9 A;  1C4A A;  1IGD A;  1JRP A;  3KWL A;  2K8H A;  3Q2A C;  2A5U A;  4G0N B;  4XYC A;  4K7W A;  4II3 B;  1Q10 A;  3B1L X;  5LXI B;  3UQA A;  4BZA A;  4ZHO A;  4HDO A;  4IUM B;  3E56 A;  1WGY A;  4KZC A;  5FKA C;  3IVF A;  5C2T B;  1VR9 A;  3D32 A;  1OEY J;  1WRD B;  4JL9 A;  3ZXV A;  5KHO A;  2J0J A;  1DOI A;  2KX0 A;  3TL5 A;  3VTU A;  2L83 A;  3BK2 A;  4MEL A;  1R4N I;  2WDV B;  5CTR C;  1IYF A;  1DOX A;  2WWZ A;  2LI5 A;  1TY0 A;  2J0K A;  4ZRJ A;  5BO4 B;  2J53 A;  4PT5 A;  4E3C A;  1WGG A;  4ITK A;  1X1M A;  4RCO A;  4AWJ A;  4KIK A;  4KGS A;  2KZR A;  4MJS A;  1F2R C;  1EWC A;  3DBL B;  2D3G A;  2FUH B;  4WJQ A;  4L23 A;  1WGH A;  1TS2 A;  4BVU C;  3I9V 1;  4AUQ C;  1VZ8 A;  2TSS A;  2BVC A;  1KLV A;  1JML A;  1TT5 B;  2LJ5 A;  1MG8 A;  3HK0 A;  1E0Z A;  1C4C A;  5HKH A;  1N63 A;  4M0W B;  1QZE A;  1PYW D;  2GB1 A;  4M8M A;  2IBI B;  3N1X C;  2BYV E;  2KVR A;  2ZNV C;  1J7C A;  1UEL A;  2KMM A;  3HVZ A;  1LFD A;  5G55 A;  2LHD A;  2RMM A;  5I4D A;  1PGB A;  4RH6 A;  2PVO D;  2IGG A;  1YJJ A;  4KX6 B;  3KLS X;  1N62 A;  4WJP A;  2WX0 A;  3I57 A;  3M62 B;  3P2B A;  4XWT A;  3L10 B;  2WDT B;  2CHZ A;  2WXL A;  3AEB B;  4W9D A;  2VH2 A;  5JHB A;  3WAM A;  5IO9 A;  2ZNV B;  2Q5W D;  4ZYS A;  2IO2 B;  3H6N A;  1K51 A;  2QJL A;  2LGY A;  3QWZ B;  4FUL A;  2KNB A;  2DYM A;  4TSS A;  3AV8 A;  2DEN B;  2KD0 A;  4FLH A;  3IHP C;  3DBR B;  5JXV A;  3PZ7 A;  1EWY C;  5DCN A;  1CJE A;  2FCM A;  3T9L A;  4YSY B;  2L7R A;  3H8H A;  1WX8 A;  4W9H A;  1WXV A;  4X57 B;  2W54 A;  3EHV A;  4DHZ B;  3AE1 B;  1MVK A;  3P4Q B;  2ZPY A;  4N6E B;  1SEB D;  2NPT A;  2GLS A;  2LUM A;  3M3J A;  1P98 A;  2KDB A;  1XLP A;  2N0S B;  1E9M A;  5HI1 A;  1Q5W B;  1RWS A;  2Y5B B;  3PZ8 A;  2BQQ A;  1AAR A;  4MH0 E;  3FIL A;  3NG0 A;  1UBQ A;  1WYG A;  2R61 A;  2FID A;  1MG4 A;  1I4H A;  4WJN A;  1SE2 A;  4A8X C;  4NAM A;  4GGQ A;  2D3A A;  1GB1 A;  4YTM B;  5MPO A;  4W9E A;  4E74 A;  3APF A;  5DPW A;  1WSP A;  3LB8 C;  1V9J A;  3QCA A;  3HM3 A;  3HM6 X;  4JE3 B;  3L16 A;  2YLM A;  4WWN A;  4OZA A;  5LXH A;  2VZK D;  5L95 C;  1J8C A;  3AMZ A;  2ZCC A;  3CSF A;  2JZZ A;  2IO3 B;  1KJT A;  1ZDV A;  3W2D A;  2WXQ A;  3JVZ X;  1JQ4 A;  2BYT A;  2ZVO A;  2ZJD A;  2JRH A;  3SEB A;  2UYZ B;  3DHI C;  4IWP A;  2HE7 A;  1XT9 B;  1KOT A;  2BT6 A;  4N58 A; 
#chains in the Genus database with same CATH homology
 3V6E B;  1OTR B;  2BF8 B;  2D10 A;  3A9K B;  2MBO A;  3TCA A;  4EEW A;  4WAA A;  5E6N A;  3U7D A;  4AP4 C;  1V5O A;  1LXD A;  4GXB A;  4TKN A;  1WFY A;  4DK5 A;  3UGB B;  4W9I A;  4HVB A;  3ZNG C;  3CF6 E;  1H4R A;  2JF5 A;  2KXJ A;  3GOE A;  1UD7 A;  2JY6 A;  4KV2 A;  3U8Z A;  2JXX A;  4HDQ A;  1VD2 A;  5JZE B;  2BPS A;  1WXS A;  2DHZ A;  1J19 A;  3IG3 A;  4MGZ E;  4PS7 A;  1I35 A;  3EFU A;  5DPT A;  4EFO A;  4FA6 A;  1V2Y A;  2MP2 B;  4DHZ E;  1YJ1 A;  2ZPN A;  3W1Y A;  3V6C B;  4HWI B;  1F9J A;  2GBK A;  1WM2 A;  2WX1 A;  4K7U A;  4KSK C;  1C1Y B;  2LRW A;  1U4A A;  4LJP B;  3VUW A;  1SGH A;  3RT3 B;  1P0R A;  3WIM A;  2L0F A;  4B9K A;  3A1Q B;  1RAX A;  4GDL B;  4AJY B;  3PZD A;  4KDL B;  2V4L A;  2KX3 A;  4MDK E;  2KN5 A;  1LQB A;  3VH3 B;  4NJ6 A;  2K6D B;  1NI2 A;  3ZTD A;  3DBS A;  3B08 A;  4RM9 A;  1SE9 A;  4IM0 A;  4BOZ B;  3ALB A;  1K8R B;  2Z0E B;  3Q3F A;  2NCN A;  4BBN F;  2NVU I;  2MCN B;  3KYD D;  2CS4 A;  3DVG Y;  1WJ6 A;  2V3S A;  1WE6 A;  1NBF C;  2MBB B;  3IBE A;  3KYC D;  3L0W B;  2HTH A;  2K1F A;  3ML8 A;  2KKC A;  1EUV B;  3H7P B;  1SIF A;  2LVP A;  4IM3 A;  2KDI A;  4WJO A;  2MBE A;  2LZ6 A;  4EUT A;  4ANU A;  1WYW B;  2KLG A;  4MEM A;  5JH5 C;  3DVN V;  2IO1 B;  1UZX B;  3BIN A;  2G4D B;  3L17 A;  1WJU A;  4W9L A;  4XZ4 A;  3QAQ A;  2MX2 A;  1E8X A;  2DX5 B;  2C9W B;  5D94 A;  3OAW A;  2D2Q A;  2ASQ A;  1HE8 A;  1RLF A;  2LVQ A;  3M63 B;  3X23 A;  2V1Y A;  3APD A;  4IC7 B;  1I42 A;  3JSV A;  4WWO A;  3ZRF A;  4NQL B;  2N1V A;  3L13 A;  3ZTC A;  2NS5 A;  4DBG A;  2ZCB A;  2L00 B;  1WX9 A;  4URK A;  2NBU A;  5KHQ A;  1T0Y A;  1WH3 A;  1Y8R C;  4IWO A;  1R4M I;  1GC6 A;  2XK5 A;  2BWF A;  4TQ1 A;  5IA7 A;  2RGF A;  5JHA A;  3AU5 A;  2D07 B;  4A20 A;  2LVO A;  2KWV B;  2NPT B;  3VTV A;  1WXA A;  4EZK A;  4P7I A;  2MRP A;  2AWT A;  5J2R A;  1EO6 A;  4HCN B;  1WMH B;  2C7H A;  2L76 A;  3ENE A;  3N32 A;  3RUI B;  2GOW A;  3TBL D;  1KM7 A;  1WIA A;  2M4N A;  4NAW B;  1WE7 A;  4DWF A;  4K7S A;  4W9F A;  2I1J A;  2AEH A;  3PPA A;  4MSM B;  3MTN B;  2FCN A;  3B0A A;  4GIV A;  3ZDT A;  2C60 A;  2EMS A;  4OVV A;  2AL3 A;  1P3Q U;  4OVU A;  2NBW B;  3RD2 A;  4IWQ A;  3ZNZ B;  3U30 A;  4J6I A;  4F1S A;  3PRE A;  1UBI A;  3DPD A;  3DBL I;  3IFW B;  3PS6 A;  3AU4 A;  4ZRI A;  5FR6 A;  2XK5 B;  3MJW A;  2MQJ A;  1WI0 A;  4HPL B;  3K9O B;  1RFA A;  4RM8 A;  3RZW C;  2DYO A;  3BY4 B;  3WAL A;  2LGX A;  3QJZ A;  2DZJ A;  2O2V B;  4PS3 A;  2N9P C;  4MGY E;  4BBN C;  1V5T A;  1GUA B;  3DVG X;  3LJ3 A;  3RZF A;  2CHW A;  5AZG A;  1YX5 B;  2L3Z A;  4W9G A;  1E8Y A;  5CHV C;  4IG7 B;  3PTF C;  3WAN A;  1LM8 B;  4BKS A;  5DPR A;  3QC8 B;  2JPH A;  4XC2 A;  1GG3 A;  5D2M B;  3W1S A;  2K8B A;  4NQK E;  4NY0 A;  3LDZ E;  1WR1 A;  3JW0 X;  3MHS D;  3ZIM A;  2KO3 A;  3NZS A;  3ZNH B;  4FHK A;  1V49 A;  2DAJ A;  3EC8 A;  4G3X B;  2JUO A;  3DBH I;  3PLU A;  4JQW C;  4ANW A;  4GMV A;  2O6V A;  5E6P A;  3AUL A;  1E7V A;  3UQB A;  3H7S A;  3UIP B;  1ZGU B;  4WWP A;  1Q1O A;  5CHF A;  1BT0 A;  2KAN A;  2KOX A;  2WYQ A;  1YX6 B;  1S3S G;  1Z5S B;  2GMI C;  2PEA A;  3DDC B;  3ZUN A;  3I3T B;  3QAR A;  3L54 A;  3TIX A;  3VVW B;  4K1R B;  5C1Z A;  2LD9 A;  2KHW B;  2DAF A;  2KWU B;  2LAS A;  3QA8 A;  2OJR A;  2K8H A;  3SDL C;  3ECI A;  2A5U A;  2FNJ B;  2GBM A;  1V80 A;  4G0N B;  4MM3 A;  5CX3 A;  4K7W A;  2IY1 B;  4GN1 A;  2LGD A;  4CHK A;  4II2 B;  2KJR A;  4G50 A;  4II3 B;  2VRR B;  3Q3J A;  2O6V D;  2UWQ A;  4FJV B;  3B1L X;  4DDG D;  2O6V B;  4ZRK A;  5LXI B;  3UQA A;  4EOY A;  2PJH A;  3R7R A;  1WF9 A;  4HDO A;  3NY5 A;  3ZDM C;  2L8J A;  4MGK E;  2OOB B;  3VQI A;  4IUM B;  2YVC A;  2ZEQ A;  1WGY A;  3H1U A;  4KZC A;  3A33 B;  2A4Z A;  1ZKH A;  1A5R A;  4KDI C;  3IVF A;  4AJW A;  2LUE A;  4HK2 A;  4ANX A;  3D32 A;  4DHJ D;  2GBR A;  4E71 A;  3PRP B;  1OEY J;  2B3A A;  2J7Q B;  4DHJ B;  4FBJ B;  1WRD B;  4JL9 A;  3KUD B;  5KHO A;  2J0J A;  1TBE A;  2KX0 A;  3GZN I;  4RMA A;  4W9K A;  3TL5 A;  3ZLZ A;  2EMT A;  3DBR I;  2GBJ A;  1G6J A;  2KJH B;  3VTU A;  3QX1 A;  2MBQ A;  4GDK A;  3VXW A;  4AOF A;  2CR5 A;  4B6W A;  1Z2M A;  2IYD B;  4MEL A;  4LJO B;  5J17 A;  2BGF A;  2N7D A;  1R4N I;  3PLV A;  3N3K B;  3SD5 A;  3PRM B;  5CTR C;  1IYF A;  2ZVN A;  1GJZ A;  2NBV B;  2HJ8 A;  2WWZ A;  2LI5 A;  1P9D U;  2J0K A;  4YL8 A;  4GB9 A;  4K81 A;  4ZRJ A;  5BO4 B;  3R66 C;  5LLI A;  4FJY A;  3QIJ A;  4E3C A;  4BKG A;  1WGG A;  2MWS B;  4CYE A;  1X1M A;  2KFJ A;  2XBB C;  3DQV A;  3VTW A;  2DZM A;  1WJ4 A;  3A9J A;  2KC1 A;  4KIK A;  4AWJ A;  5E6O A;  3UF8 A;  2KZR A;  1WR6 E;  4HPM B;  4MJS A;  1WJN A;  4F7Z A;  2FIF A;  2RPQ A;  2KFK A;  1ZW7 A;  4GDK B;  4KSL C;  4WJQ A;  3DVN U;  2D3G A;  2FUH B;  3JSV B;  3KUZ A;  1XD3 B;  1WGH A;  2N9X A;  2MW5 A;  4HJK A;  4BVU C;  4IM2 A;  4DDI D;  2CKH B;  2N9E B;  2RD0 A;  1H8C A;  3RCZ A;  5L83 A;  2KDF B;  5CHW A;  4PS8 A;  4F8C B;  4AUQ C;  1ISN A;  2JT4 B;  2M0X A;  2IO0 B;  3DCG A;  1UGM A;  2KK8 A;  1KLV A;  4TV3 A;  4KIK B;  3KVF B;  5TR5 A;  2KC2 A;  3A4R A;  5D7G A;  5AZH A;  2LXA A;  5AZF A;  3UIN B;  4MJS B;  1D3Z A;  1IPG A;  2LJ5 A;  1MG8 A;  3HK0 A;  3PV1 A;  5HKH A;  4M0W B;  1QZE A;  2N4F A;  4M8M A;  2IBI B;  2BYV E;  2G45 B;  5GMV A;  1E8W A;  3W1S C;  4PYZ A;  3R3M A;  1WGD A;  4NJ7 A;  1E8Z A;  2KVR A;  4HCP B;  1RRB A;  3R7Q A;  2ZNV C;  5C23 A;  1L2N A;  3A9K A;  2LWP A;  4WQO B;  3L08 A;  2AL6 A;  3VUY A;  3PSE B;  1UEL A;  4LDT D;  3T8M A;  3VAW A;  4FJZ A;  1LFD A;  5G55 A;  4LDT B;  3VUX A;  4GU2 A;  2PE6 B;  1VCB A;  2G3Q B;  2CHX A;  3PGE A;  2Z0D B;  2C5L C;  2KWC A;  3TJP A;  1S1Q B;  3PRZ A;  2KMC A;  2WX0 A;  2MLB A;  4WJP A;  4BKS D;  3M62 B;  3P2B A;  1P1A A;  2J0M A;  3NS8 A;  2FCS A;  1E7U A;  3PHW B;  3M95 A;  1TZ1 A;  3NOB A;  3L10 B;  2L05 A;  4ZYN A;  3AXC A;  2RR9 A;  2WDT B;  2DZK A;  2D11 A;  2CHZ A;  2R2Q A;  2CU1 A;  3ZO5 B;  3A1Q A;  3AI5 A;  4GDL A;  1Q0W B;  2XEW A;  2JVC A;  4W9D A;  4BOS C;  1GNU A;  5JHB A;  4HXD A;  3WAM A;  2M8S A;  3KUC B;  3ONS A;  1GC7 A;  1XQQ A;  2ZNV B;  1EF5 A;  2C7M B;  2IO2 B;  3H6N A;  4MSQ B;  2JRI B;  3V61 A;  4BKT A;  4A3O A;  1EF1 A;  1TGZ B;  4BFR A;  2NR2 A;  4ICU A;  2LGY A;  3QWZ B;  2KJ6 A;  4FUL A;  3VDZ A;  1OEY A;  3H7P A;  1FXT B;  1YQB A;  2KQ7 A;  2KNB A;  2BKF A;  2DYM A;  2DZI A;  2I1K A;  4CO7 A;  3ZW3 A;  2PE9 A;  2DEN B;  2KD0 A;  3CMM B;  3EEC A;  3IHP C;  4FLH A;  3JYU A;  1WM3 A;  4TQ0 A;  1WZ0 A;  1E90 A;  2KTF A;  4NPN A;  1OQY A;  2LRU A;  5DCN A;  2FCM A;  2EKE C;  4N9F 4;  3OJ3 A;  3T9L A;  1V81 A;  4FHJ A;  2IY0 B;  3ZNI D;  3TMP B;  3UIO B;  3WAP A;  1WZ3 A;  3K9P B;  1NDD A;  2L7R A;  1WX8 A;  1L7Y A;  3C0R B;  3APC A;  4W9H A;  3NZU A;  2JWZ A;  1WXV A;  2M17 A;  4I6N B;  1YIW A;  3SHQ A;  4X57 B;  4ICV A;  4MGI E;  3VHT C;  3EHV A;  4DHZ B;  2K6Q A;  3VFK A;  3WAO A;  3H9D A;  3HHM A;  2G4S A;  2K39 A;  4W9J A;  4GOC A;  5J18 A;  2ZPY A;  4NNJ B;  4M8N A;  1V86 A;  2RSU A;  4ASW C;  3DOW A;  4LCD E;  2BKR B;  1WXM A;  3OLM D;  2NPT A;  2AYO B;  4JLC A;  1M94 A;  2W9N A;  3M3J A;  1P98 A;  1WMH A;  1WX7 A;  2JZ3 B;  2KDB A;  1YD8 U;  2BYE A;  2PPH A;  3CST A;  5IAA C;  5EDS A;  3ZKJ C;  4NAW A;  1Q5W B;  2Y5B B;  2BWE S;  1TTN A;  3RUL A;  3HIZ A;  1AAR A;  4MH0 E;  1C3T A;  4G11 A;  3N30 A;  2MSE D;  1UBQ A;  2HD5 B;  3ZVV A;  3O65 B;  2LXC A;  2ZZP B;  2FID A;  3NHE B;  4WJN A;  4FAD A;  4I6L B;  1CMX B;  2N7E A;  4FN2 A;  4W9C A;  4EZJ A;  4EZL A;  4IW0 A;  3SU8 X;  4GGQ A;  3KH0 A;  4KZ0 A;  4A3P A;  3PT2 B;  2KLC A;  4W9E A;  4GSW A;  4E74 A;  2O2V A;  2FCQ A;  3APF A;  1OGW A;  3A9J B;  3OJ4 B;  3KW5 B;  2BYF A;  5DPW A;  4ZDV A;  2DYB A;  3PHX B;  2KFK B;  1V9J A;  3X0W A;  3QCA A;  5AEK B;  3HM3 A;  2Z59 B;  3HM6 X;  2REX A;  3VH4 B;  2KTR A;  1PQS A;  1WY8 A;  3L16 A;  4EKU A;  2YLM A;  4PYU A;  4WWN A;  4ANV A;  4JGH B;  3QHT A;  1V6E A;  5LXH A;  5L95 C;  1J8C A;  2ZCC A;  2JZZ A;  2IO3 B;  1KJT A;  3CSF A;  2KDE B;  4TUU A;  2L0T A;  1UH6 A;  2K25 A;  1J0G A;  2IZV B;  1E5W A;  2C7N B;  3JVZ X;  1WGR A;  3ML9 A;  4DXA B;  5DPS A;  2N1W A;  3QK0 A;  5D6J B;  3V60 A;  3WA0 A;  4JIO U;  2ZVO A;  2R2O A;  2ZJD A;  2QHO A;  4I6P A;  2JRH A;  2UYZ B;  2KMA A;  4XX5 A;  3S2A A;  1JRU A;  2MP2 A;  3RYT A;  4HLE A;  3PVL A;  4KVG B;  5G2N A;  4IWP A;  2HE7 A;  3V62 A;  1XT9 B;  1IP9 A;  3ZRC A;  2MBH A;  2KTR B;  2MA9 B;  2FAZ A;  3QQ8 B;  2KQS A;  1KOT A;  2K8C A;  2GBN A;  3A4S C;  4B95 A;  2M1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...