4RGMA

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 62
structure length 223
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgmA01
1L0YB 1PRTD 1KTKA 1PRTF 4RCOA 3BYYB 1FNWA 1JWUD 1EFID 3R2IA 1I4HA 1B44D 1EEFD 1M4VA 1LTAD 1PZKD 2IPKD 5FKAC 1FD7D 3KLSX 1STEA 1S5ED 1LO5D 4RGOS 1QILA 2Z8LA 4RHRA 4L63B 4TSSA 2AQ3B 1ESFA 1LTSD 1RD9D 3BVGA 1I4RA 5D3IB 5ELCA 1YN5A 1S5FD 1EU4A 4RGTA 4DXFA 1F77A 1MD2D 1ET9A 3BYTB 1PRTC 1DJRD 1I4PA 3BVMA 1TY2A 1V1PA 1PZJD 3URYA 1RDPD 1EU3A 2AQ2B 1CQVA 1D5XC 5TSSA 1BXTA 1KLGD 1HQRD 1LTTD 1G8ZD 1SJHD 1LTGD 3MC0B 1RF2D 4OHJA 1CHPD 1JWMD 5ELDA 1YN4A 2XNAC 1LTID 1SE3A 3DWPA 1S5CD 1FNUA 1TS4A 4O1NA 4RFBA 3W2DA 2G9HD 1AW7A 4L6TB 4RGNA 2XN9C 4RGMA 1TS3A 1ENFA 2R61A 1S5DD 1CK1A 4RH6A 1BCPF 5ELEA 2IJ0A 3MFGA 2XRQD 2CHBD 2NTTA 2TSSA 2ICIA 1XTCD 1FNVA 1LT5D 4K6LA 5ELBA 1I4GA 1D5MC 2J4XA 3EA6A 3GP7A 3BVZA 1SEBD 3CHBD 1PTOB 1HTLD 1JQYD 1TS5A 2XRSD 4DXGA 3DWAA 1LTBD 3SEBA 1CT1D 1SE4A 1PTOH 4C56C 1PTOF 1GOZA 4UDUC 1HXYD 1SXTA 1LT6D 1SBBB 1I4XA 2QILA 3BZDB 1V1OA 2RDGA 1LT4D 3O13A 1D5ZC 4NZLB 1L0XB 4Z9CB 1EWCA 5ELFA 1KLUD 1LLRD 1LTRD 1YN3A 1T5XD 1D6EC 3DWQA 1SE2A 1BCPC 1BCPB 1SJED 1JR0D 1CHQD 1UUPA 1DYQA 1EEID 1S5BD 2O2LD 1PRTB 2WV6D 1TS2A 1FGBD 1LT3D 3R8BA 4ZYSA 2AQ1B 1PYWD 1I4QA 3V05A 4BWGB 3OWEB 1JCKB 1ET6A 1PTOC 2NTSA 3TSSA 1XXGA 5FK9C 1B1ZA 1V1PB 5D3DA 1BCPD 1HA5A 1AN8A 2RDHA 1JWSD 3EFXD 2QEJC 1PZID 5I4DA 1TY0A 1PTOD 1UNSA 1RCVD 3R2TA 4RHSA 2SEBD
chains in the Genus database with same CATH superfamily
1PRTD 3ZRFA 1AFPA 1Z5SB 3K8AA 1B44D 1JMLA 3VAWA 1YNND 3HOXG 1EIHA 2F1MA 1RTNA 4QB4A 4B0MA 3ICEA 3ML9A 1L1OB 2NVTB 3KJPA 3N1YC 3LJ3A 1KDBA 3NZUA 4OELB 3L10B 3PZ8A 4JV5Q 1F1HA 1YN5A 1S5FD 1SYEA 3TP8A 2IO3B 2L5TA 2MSED 4ZHOA 4IN3A 3X3MA 3PSIA 4DR7L 3MHZA 2B8GA 4JCVE 4DR5L 5IOCA 1KFYB 3KYHC 2MX2A 2JSOA 4FYDA 5DEHA 1YVCA 2JSVX 2MO1A 2OXPA 4LUVA 2V4IB 4PYZA 3ENEA 4XTCS 1LTGD 1K53A 1V9JA 2EYPA 2YTXA 3OW2A 1EQTA 1WE7A 1GHKA 2MBEA 3SR6A 3J81c 1EZ6A 4KSKC 1XPUA 4BAXA 3ER0A 3TBIB 4W9JA 1JB7A 4I6PA 1YITA 2O6VD 2LGYA 4YY3Q 3K0YA 2EYMA 4S3SA 2FAZA 1MI0A 4IQZA 1C4AA 2VY3A 3RMHA 4JWUC 4DDID 5FLMG 2HQEA 1MKHA 1CSPA 1LUZA 2EY5A 2CHBD 3QG1A 3VYTA 3KJOA 2IGHA 4GOPB 2LASA 4IFDG 2WXKA 4N6EB 4PYUA 4EE2A 4AYBE 3KDFB 1G6JA 1MGSA 2ZJPA 2C35B 5M9OA 3PRPB 2JA8H 2B63B 1SEBD 4JI5L 3AMUA 3IG3A 3Q3FA 2HDLA 1YHQA 3HOZG 3GB1A 1E2WA 5BR8L 3CMMB 3PQIA 1D2BA 1YJ1A 4NNJB 1N5WA 2E6XA 4QMGA 1VQPA 3NWTA 1LT6D 1SFOB 3S2DB 3FAHA 1R4PB 4DF7A 3K7AB 4CQNA 3PMFA 2QF7A 4K7UA 3QHTA 3SK8A 1D1IA 2ZT9C 1V2YA 3PTFC 3Q8CA 1CHQD 1YOVB 1TXYA 2I1JA 4G7OC 1IW7D 1XX8A 1CMXB 1IYFA 3PO3B 1LT3D 2GVAA 1XJVA 1JOQA 3NTIA 2O2VA 1NAPA 1HR0W 2D10A 1BNZA 3B08A 1V9PA 4KGSA 1PLFA 2EY6A 1R4NI 3V05A 2C7NB 3ZDMC 1DOXA 1ET6A 2RCFA 2IX3A 1IPGA 1V97A 4DHZE 5L37A 4JI4Q 5CHWA 1XPOA 5E6PA 4CDDC 2L3ZA 2BS3B 2W9NA 3LXFA 3DHQA 4HCEA 3RZDB 2N7EA 2I07B 3EFXD 4MGKE 4LAAA 1EOTA 2L11A 5JOBA 2NVXH 1WZ3A 3OWFA 3NXWA 3S1RH 3GTLH 4A3LH 2BB6A 4DR1Q 5COYA 4IUMB 3CPFA 1SNMA 2K50A 3CF6E 5CBAE 1K3BC 1P98A 1EEFD 3H09A 4LJPB 4HVBA 3J81L 5BN3A 3AE1B 1PZKD 4MEMA 5FKAC 1Y1WG 4MELA 2PNHA 2NZHA 3VVWB 1MJDA 4H0LC 1PH1A 3BVGA 5D3IB 1GUWA 4WJPA 2JF5A 1LQBA 3S1MH 1EY9A 1VQ9A 3K7UC 2R2QA 2V4LA 4DR2Q 4RG1A 4DR4L 2CU3A 2HCIA 1HFGA 1E2ZA 1ET9A 5JEAG 2UXDL 4C80A 1AARA 3Q6SA 3UIOB 4A3MH 1JC7A 4DNTB 2KMAA 1EU3A 3FILB 1IXRA 1WD1A 1C77A 2JY6A 4I7AA 3DBLI 4OWTB 2XNAC 4A76A 4II3B 2KVZA 2LFIA 3A74A 1NSNS 2CCZA 1JROA 2N9EB 2E2JH 1PDXA 3DWPA 1XWEA 3GTOB 3BDCA 2HTHA 4G0NB 1F0ZA 4RFBA 1UAPA 1GC6A 3MC9A 1WJNA 1KH0A 2EJGC 2RQXA 2Q2TA 1TU2B 4JI1L 4LNIA 3I72A 3U50C 4LUOA 4DV5L 4OO1H 4TQ0A 1EWIA 3NENA 1QOBA 3FDTA 3W5VB 3B9JA 5DM73 3A9JB 2Q8IB 2JRIB 4PT5A 2A4ZA 2IGGA 3RT3B 2G9DA 1I94Q 5IYDH 1Y56A 1UELA 4M8NA 1AE2A 2VS1A 2F3WA 2PYKA 2K6AA 2E74C 3CRKC 3TZUA 1TZOA 2BGFA 4B3MQ 3HM3A 4N9PA 2BVCA 3J9CA 3VDYA 4GMVA 3P75A 4BXXH 1GOZA 4C4VB 2WACA 5C4ZA 1SBBB 1I4XA 5IYCH 1K8MA 2MQHA 3APDA 2K04A 3KBXA 1WMHA 4MTNA 2J0JA 4WH4A 2A68D 1D5ZC 3QR8A 1EWCA 1WTOA 4ZRJA 2L1AA 2ZXRA 3CRLC 1I6VC 1HR0Q 2ON8A 3I55A 2EKIA 1VQDA 2EJMA 2XSCA 2ZVOA 2RGFA 2ZM6L 1U9RA 4RWSC 1HNXQ 1QT9A 4IALA 2FNJB 2TMPA 4NXMQ 2Y3AA 3I91A 2WB1E 2FCNA 3S14H 2MBHA 3D32A 3K9PB 4LCDE 3T1HL 1O78A 1WXMA 2WWZA 2JXXA 1ISNA 3FKIG 4A3KB 2XIWA 3RN9C 2MW5A 2IT1A 2C5CA 1EY6A 2KDFB 3S24A 2W3RA 3NRZA 4MGZE 3AN1A 3GTQB 1NBFC 2F0VA 2NVQB 2KFKA 4WRDA 4EQOA 5IGDA 4HEA1 1IUEA 2SNMA 5JJIA 3BDLA 2BKFA 1WR6E 4BKTA 1AN8A 2RDHA 2A19A 3SK4A 1BO0A 1GUGA 4DAPA 4O42A 4BBRG 2Z6KA 1TY0A 1KC8C 2X38A 4GXBA 3R7QA 1QG7A 3BZCA 1HA6A 2K3UA 2N3SA 2VW9A 3L16A 2D0PA 3ZNGC 3PF4A 5EKIA 2VUMH 5M5YB 4RCOA 2H1EA 1JWUD 3EQLC 1V6EA 1X9NA 4W9KA 2LXKA 5AJ3Q 2DYBA 3LWEA 1WFQA 5BYQA 4NDXA 1GUAB 1V80A 1YJJA 2EYFA 3VXWA 4DV2L 3D0FA 4LFCQ 2MP2A 4DXAB 1S5ED 3E9SA 5K36G 3A33B 4GOPC 5FJ8H 5KRUA 2O6VB 2E3TA 3SE0A 4C1NK 4KV6A 1BUIC 2Q8TA 3MEFA 3P4SB 4OZAA 3L2PA 2KC2A 2R3ZA 2KA7A 3N6RA 4ARIA 2E2IH 2ONQA 1WXQA 1BMLC 4DHJB 1KLGD 1NBWA 3DVNV 2BA0A 4AH6A 2KK8A 3SHQA 4J6HA 3ZJUA 1I35A 3PSEB 3QWZB 3ONAB 4G7HC 1CM9A 1S4ZA 2A6EC 3WALA 1SE3A 2JEAI 4X6AH 3BIID 3AEDB 3AU5A 3NK9A 5C3XA 3HM6X 2K1FA 4XGAB 4RGNA 1X32A 5C4XH 3OYYA 3TEYA 3EVQA 4ZKBB 4EZLA 5D94A 2A69C 2AL3A 3B2GA 2NTTA 2TSSA 1WTVA 2A6HD 4BY7B 1GO3E 4C3JH 3ZW3A 4G4KA 5J17A 1QOAA 2PVGC 2IZVB 1Y1WB 2NCNA 4ASWC 4HCNB 4I65A 2K32A 1R4MI 4W9LA 1VQIA 2MHVA 1PTOB 1JQYD 1TWFH 1E1TA 4QJFA 1OO9B 4X66Q 1SRUA 3UDGA 3FC4A 4J15A 1UWXA 1SMYD 4ZKCB 2ZJRA 2KCNA 2Q2HA 1I5FA 1ZKOA 1Q8IA 1B4OA 1V1OA 3BZDB 1C4CA 2FIDA 2B39A 2KWVB 3CCUA 3T3NA 4IOIE 3KF8A 4JOIC 2KTRB 2KBNA 1OGWA 3JYUA 2KMCA 2F0LA 4C3IG 3D31A 2LXAA 4Y7NB 4U68A 5JVG3 1I7HA 3A8KE 3UE0A 2D3BA 4WWMA 2DX5B 2WLBA 4TMAB 3MP9A 3P2BA 3J80i 2AWNA 5FJ8G 2LXJA 3Q8AA 1ICFB 3QOLA 1FD6A 1ZW7A 2KT7A 2UUCQ 2KHWB 4KJNA 1SE9A 1E9MA 2I5LX 4BXXG 3PUYA 4DK1A 2R7ZB 2GBMA 5EPLA 2EQSA 1B9NA 1JJ2A 1LABA 4KKTA 5ELOA 5BN5A 2BKRB 1O7ZA 3VR4A 1PH5A 4LNNA 3V61A 5CV4A 1XNRQ 4F7XA 1LM8B 4KTAA 2WKDA 3A54A 4R4TA 4A93B 3QIJA 3SU8X 2KTFA 2F0UA 5C2TB 1F2LA 1SROA 5CV6A 4UAIA 1KABA 1TWCB 3DCGA 3R7RA 3CAMA 3VFKA 4LF6Q 2LWPA 1D3ZA 1JWBD 2RDBC 3OG5A 3AEEB 4GDKB 1N33Q 4IC7B 3HOYB 4LW1A 3S15H 3AU4A 4HPPA 3ULPA 5JHAA 2QEXA 4MHEA 2CJOA 4GOCA 1F2RI 1E90A 2K33A 2KN5A 5AEKB 4TRDA 3J81j 2CU1A 4PS3A 5J18A 4A3DG 1S3SG 3KLRA 3KK7A 1AZPA 1CKNA 4NP5A 3RD4A 1EF1A 4XYCA 1YNJC 3RNGC 1VD2A 4A3EG 1K83H 1ILPA 1YJIA 1FJGL 1Q8KA 2ZTEA 1LO5D 2L0CA 5EBDA 3GV3A 5DPTA 2EIFA 4K5VA 5CTRC 5AZFA 5JAVA 3S1NH 3T9LA 1CI3M 2DUDA 4JI3Q 1GUSA 2CR5A 4A3BG 4WJOA 3FKYA 2M00A 2NBVB 1F2YA 2FIFA 4AJYB 1JRUA 2N9PC 4KDIC 4DV6L 2JP1A 4YCVA 1S3OA 2MJ3A 1ENAA 4DNRB 3CD6A 3CMAA 2J7QB 3CWIA 4FULA 4XZ4A 3ZNZB 2QA4A 4J8QA 3MC0B 4PMBA 3OIQA 1JWMD 2Z4HA 3OOCA 1E5WA 1HJPA 3NWSA 1J5EL 3EECA 2WXRA 3B1LX 2L05A 2MFIA 3RZOH 3T3OA 3PT2B 1UE1A 4URKA 2A74C 5EKLA 1YBYA 4H44C 4YCWA 4DAYA 1EZ8A 1FNUA 4O1NA 4JI0L 1A70A 1PGBA 2G9HD 2M1MA 1OXUA 4GS3A 2R7ZH 2J53A 5HURA 4MDKE 4DA2A 1XNQQ 2JQOA 1HUMA 1DOMA 2B8FA 2CH4A 2NN6G 3S1QB 2INPE 2N1VA 2PEAA 3H6NA 3V6EB 4XWTA 5FLXL 1R9TB 2J42A 2RHSB 1ZEQX 4MM3A 4B9KA 2ICIA 3NQIA 5DM63 4FLHA 3NBHB 1LT5D 4K6LA 4OZCA 1TWAB 2V9HA 4EEWA 2HIXA 3KUPA 4QF4A 2N78A 3M85A 3GP7A 2K01A 5L95C 1TS5A 4B08A 2VH1A 2VB3X 2IY5B 2VH2A 1TJEA 4KMUC 4BKGA 3R93A 3PVLA 1T0YA 2NBUA 2WAQB 4JI6Q 1QVFA 1HXYD 1PH7A 2PIAA 2VXWA 1YJWA 3KVFB 2JJQA 2WNMA 1BR9A 2BPSA 1CKOA 4C3HG 2JWUA 2RSNA 4GKKQ 4DV7Q 1NYRA 1K51A 2MRPA 1KLUD 2KMMA 2B2WC 3DWQA 3RD2A 1BCPB 1BBXC 4OWWB 1NEKB 5CORA 1IHZA 2EOTA 3MFYA 1WFYA 3KH0A 3AU7A 1BKBA 1JT8A 3Q8FA 1WI5A 3I73A 2DZJA 4Q2JA 5FO7B 3U58A 3WAMA 1PDQA 1ZPSA 1WY8A 4HRSA 3P20A 4IJLA 4REZA 5E7NA 2EVBA 4LDTD 2LJIA 5ELNA 3WANA 5E6NA 3ONSA 3S14B 3M9BA 1Z7TA 1RYJA 3F2UA 3U4VA 5IODA 2JVCA 1Q1EA 3IVFA 3R3MA 3SD5A 4TUUA 1ML0D 4C00A 1JWAD 5IP9G 4IDIA 4C3HH 4W9GA 1N61A 4A3CG 4ANXA 1Z2MA 1UWMA 3Q23A 1VQ7A 3MZ5A 3GTJH 4DDGD 3PO2B 1L1OA 1VJKA 3HOUH 3NZSA 5I4DA 2WXJA 4TV3A 3BU2A 1V49A 2WDQB 4K7SA 1L2NA 1GM5A 1RKNA 3BG3A 4K8IA 2B2YC 2PQEA 3E3XA 1FNWA 3K5NA 1B7YB 2KCTA 1P7FA 2REXA 2YVCA 4JWSC 3A8IE 4LJOB 3KBGA 5IWAQ 2JQRB 4TQUS 1KHIA 1Q10A 1B2TA 3CSTA 4ZRKA 3VYRA 1VZ8A 4K7WA 2QHOA 5GXGB 3TS2A 3EN2A 1L4DB 2HDMA 5D14A 3KWVA 5K5PA 3IAS1 4HXDA 1O7YA 5EPKA 4AYBB 1IBKL 4MSQB 1QE6A 3H0GB 1CZPA 1EU4A 4P1CC 4N9TA 2X8XX 5JZEB 1EYDA 2LUMA 2B2UC 1MD2D 1GNUA 4P73A 4CJ1B 3GDEA 1U4PA 2ZTDA 2QKIC 4DQOC 2PPHA 3HOUG 2QC8A 2WB1B 4ZOHC 5C5MA 1PFSA 1N32Q 4JV5L 4A3DH 1LTTD 4FJYA 5ELDA 4ZUJA 1CHPD 3MTSA 1YN4A 2K05A 4WQOB 3ZTDA 4LK0M 3C19A 3GE3C 3L4PA 2Q5WD 2DY7A 3W3AA 1LTID 2VQEL 5DCNA 1PUTA 3AH7A 2WXIA 4LFBL 5E4XA 2MGSA 2BS2B 2IBIB 2QGQA 3T56B 1UD7A 5KNCA 2KECA 4BBSB 1EUVB 1L0VB 2GB1A 2MHJA 3TL5A 3NE5B 3QX1A 1S5DD 4HROA 1WIAA 3RZWC 4NXNL 2DN8A 4Q0FA 2IWHA 1VCIA 3G71A 4D2KA 3ML8A 1TWGB 4OEMB 4FNFA 4MIUA 1STYA 2ASBA 3PUZA 3AI5A 3RNCC 3ZTCA 2I2YA 4G57A 4GN4B 4QL5A 2F3IA 4FXKC 3S1RB 3GTLB 3D3RA 4MH8A 1ZXHA 4C3JB 2V3NA 4DXGA 1LTBD 3HKZB 1JE5A 1PTOH 4C56C 2INDC 3H1UA 3N1XC 2AEHA 2FBWB 4H2AA 4L1BA 5EE0A 5GMVA 3UIPB 3ZKJC 2KFKB 1WTRA 1SYCA 4HIKA 3Q6BA 1L0XB 2WX0A 3U4ZA 1PGAA 2K6QA 2KJRA 3QCAA 2JA5H 1KOTA 3H3VH 4FJVB 1EL0A 2KQ4X 4K81A 4M8MA 2VZKD 2JE6I 3UI3A 3RR5A 4OX9Q 1JR0D 3GZNI 2MA9B 1UUPA 2DJGC 2Z6BA 3OHXC 2O2LD 4Y7NH 3AMZA 2H5XA 5E1FA 2BQQA 2WV6D 1X55A 1I3QB 3U2SC 2VUMG 3KFUA 3VR6A 5LL6X 1SMYC 1PYWD 2Z0DB 2L1BA 1P8LA 1N9WA 1R4QB 2F4VQ 4BWGB 4P72A 2F52A 2A73B 3DEPA 2GA4B 1I50H 3IFTA 1KDAA 2BYFA 3I70A 2M19A 2NTSA 3CCQA 1R4NB 1XLQA 1H9JA 1MIUA 1PGXA 3FRPB 2Z0SA 5FK9C 4HMIA 2P5ZX 2J52A 2ZVNA 1H9SB 4JG2A 3CCVA 1KDCA 4GN5A 5D3DA 1XLNA 4BS9A 2KDEB 5KNDA 1LXDA 2Y5PA 3HK0A 1RWSA 5IYDG 2RMMA 2RCNA 3HOZB 2M56B 5CHVC 4A93H 2L7RA 5C0XI 1P16A 2MWSB 4US9A 1MFWA 1PYSB 4MN3A 2WAQG 4RF0A 1PRTF 4PZ6A 4TVAB 3BYYB 2PMZB 3HRDD 3TMPB 2EMSA 3PS6A 5FO8B 1EY7A 3PHWB 3HOYH 1YNTE 1OXTA 4EQNA 2PE6B 3UDFA 3ZXVA 4ILWA 3STBC 1FD7D 3RLOA 4DV6Q 4HIOA 4LTUA 2W82A 4RNAA 5AUKA 2F0JA 4XDDA 1HZBA 1PMRA 4IUNA 4ODGA 3MXPA 4XDXA 1LTSD 4NXML 2ZJDA 1CSQA 1FVIA 3EIVA 5D6JB 2I0QA 3GO5A 4WWPA 1WE6A 4A3FH 2F0DA 1VRAB 4M0WB 2LGSA 1NTGA 1DOKA 1GUOA 4BY1G 1GVPA 3J7AF 5BMHA 4L5QA 2H89B 4BFRA 4JLCA 1C9FA 4H13C 4JGHB 1A3UA 1RDPD 2AQ2B 4JPBW 2JYEA 1PXUA 4B3TL 1HQRD 2L15A 3OTOL 4BOSC 1XQQA 4ULLA 5GAHC 2FCSA 2G4SA 2JZZA 4XX5A 1KAWA 3CQZH 4V0BA 3I3CA 4IM3A 1OXSC 2XK5B 5F2DA 1X3FA 1SYBA 2F0SA 3DVNU 3MEHA 3WOFA 2LXCA 2F0PA 2RKSA 3DWGC 4HPLB 1IBXB 1A2UA 2LY7A 2QMTA 1ZOYB 2EKEC 2KOXA 4RGMA 5LNK1 1EY5A 5KYLA 3HIZA 3TDQA 3G6EA 2CKZB 4A3FG 1WGKA 4LFCL 3U7ZA 3ZXRA 1PH2A 3I90A 4OONA 2PW5A 2AKWB 3QIAA 3KQ4A 1I4GA 1JQ4A 1HTOA 4FO2A 4DV7L 2AUKA 1QQRA 1JMCA 1E2VA 4AYBG 1K8RB 4GU2A 1FRRA 4PZ8A 1VQMA 5JH5C 1QCBD 3PGZA 1CKNB 4HJAA 1PTOF 4C2MH 4DR1L 4O2DA 1TQOA 1N33L 4CYEA 3J7YW 5E4WC 2OTLA 1D1KA 4Z9CB 1M94A 5ELFA 2LZ6A 4ANUA 4WFN3 4LNFA 3HRZC 4A3IG 1C7YA 1FMAD 1RAXA 1SE2A 4A3OA 2M4NA 5IAAC 1LM0A 5EBCA 5G3LD 1SJED 3SK6A 5FLXc 2IY1B 2PKOA 2K9XA 3RULA 4BBNF 1WTPA 1IBXA 4NJ7A 2YU9H 1YJ9A 4IOAA 4EFOA 4PNYA 3CP0A 4YY3L 4NQLB 1FGBD 3RYTA 3R8BA 4UPAA 4F88A 3NVVA 1DZ1A 1MHHE 3Q2AC 3QC8B 4IZ8A 4ZK9B 1HE8A 2MBOA 4IW0A 4OVZA 1B53A 3KF6A 4FF3A 1JCKB 1TIID 1E8XA 1HRJA 5G2NA 4IUPA 4ZHPA 1H9RA 4IUQA 4CDEC 2KQSA 2D3GA 2MEKA 2WXQA 2FCQA 5C6AA 3D4RA 2V3SA 3U8ZA 1PH3A 4A3GB 4M0WA 2OT2A 2WAQE 1XLPA 3H3VI 3RNBC 2F0WA 2B2WA 2KDIA 4DHZB 3NVYA 1XMQQ 2PJHA 3TMEA 4MACA 3QK0A 4RKLA 3RCZA 4BKSD 1W6JA 4LMQD 1ZDXA 2KENA 4XQJA 3KWLA 1JOOA 3KDFA 4IURA 3QB3A 2KTRA 5LMUL 3A7LA 4KN7C 3CF5A 4BY7H 1IKMA 3T53B 1HH2P 2Y5CA 1M4VA 1DD2A 2JUOA 4E6IA 4KVGB 2F0IA 4BY1H 1J6QA 4XQNA 3PRZA 4P7IA 4P71A 2KEDA 4TSSA 4RHRA 1J7BA 1ESFA 1OEYA 1WX8A 1I4RA 3DPDA 4EOYA 1GHJA 2VL6A 5IGEA 1EYAA 1IGCA 4CGYB 3F2BA 5M5YH 2VUMB 1HTQA 2O4XA 4QIWE 3GTKH 1GAQB 2ZPNA 1GXDC 3OW7A 4CJ2C 4BBRH 1SNOA 1H9SA 2KEEA 4GLSC 3CSFA 4IUVA 4OIKA 5MPOA 2F0OA 1SSOA 2RPQA 4L5SA 1VR9A 4XC2A 1YD8U 1BXTA 2ES2A 3HOWB 1B70B 2ZXOA 1NY4A 4R4QA 4W9IA 5EE9A 3CMEA 2K75A 1J8CA 2KAJA 4QUCA 1YHBA 1GUNA 1D8LA 2KUMA 2VB2X 5CGKA 2N49A 1QZEA 2Y5BB 4N9F4 1ICWA 1UEBA 1VF5C 2EELA 3KYDD 2BDOA 4HWIB 2E2IB 2CQAA 3E9IA 5I6WA 1E8ZA 5ELEA 1GB4A 2A5UA 2WXHA 4BBSH 3KUDB 2Z1CA 3ALBA 2WFWA 3O65B 3ZNHB 4XT1B 1WJJA 1TKGA 2J0MA 4DR3L 2D3CA 2H4OA 1ASZA 1V86A 1WCMB 3I4NB 3MXGA 3W1GA 1EQRA 2IO2B 4GIVA 5C44B 2WDVB 4MGIE 3VUXA 1LACA 2YEPF 3RFZB 3TZDA 2M17A 4XDCA 5CHFA 1AP0A 1Q3LA 2EYLA 3SEBA 2NVYH 3DBHB 1W2BA 2K5NA 3NEMA 2JA5G 1QOGA 4BY1B 1WYGA 4RKBA 4ICVA 2MO0A 1SLJA 3V60A 1IBMQ 3GS2A 4NZLB 3K59A 4E74A 3CCEA 3FKIH 1KJTA 4OVUA 1YQ3B 2KDMA 3CPWA 4QCLA 4GNXC 5JEAJ 2EYHA 1QVCA 2RD0A 3BZKA 1ROEA 3NY5A 3OAWA 4N58A 5BN4A 4I7ZC 5CV9A 5LHY1 3GTKB 2NZOA 4K14A 3A9KB 3Q3OC 3ZJVA 2ALYB 5C4HA 2NN6H 2WXMA 3AE9B 1UEAB 2B3GA 3WDNA 3MVVA 1JRPA 2UXCQ 2E8GA 1HNWQ 1E8YA 4P74A 4W9CA 5HGTA 1E10A 1PH9A 4F7ZA 5I2YA 5BYRA 4DAMA 1DOYA 2NN6I 4WJ4A 4FJZA 5L83A 5C4JB 1B1ZA 3RZOB 3DVGX 3JVZX 4YWMA 4NPSA 4CKEA 3W1SA 4HJ9A 4HK2A 3BS1A 1E7UA 1HZCA 3W9CB 2L0FA 1ZXIA 2ZEQA 3VR9B 3LWUA 1S1QB 1Q12A 5C3EB 3HP3A 5EAYA 2VQEQ 2PMVA 3R2TA 4ZRZA 4EVOA 3LB8C 4JI6L 1YX5B 1MJEA 3HS0C 3NHHA 1UGMA 1QZHA 4JI4L 3TRZA 1L0YB 3TP7A 2UXBL 1WM2A 1EO6A 4CKCA 2YLMA 2KLCA 1QKZA 2K6DB 1EFID 2HHHQ 2V4DA 3L17A 4X3SA 3TUOA 2Z4IA 3NPPA 5LMNQ 4RMFA 3U30A 2BE5D 1HR0L 4AJWA 2IL8A 4DV0L 3L9AX 1QB5D 2G1EA 1OQRA 4K0KL 2F0HA 3HVZA 4UP8A 3QARA 3MA2B 1QUQA 4DNIA 1HNXL 1I6HH 2FHTA 3M62B 4KGTA 3NOBA 1A5RA 1M90C 1IYJB 3EUB2 3V3XA 4ZCKA 3V96A 3S15B 3BYTB 2Z9HA 4IM2A 3FKIB 3D4DA 4A3KG 3HOVB 3N1ZC 1FJGQ 1TY2A 4NJ6A 3NQTA 4LF9Q 4OZBA 1G2SA 1IW7C 3URYA 1P9DU 3DXJC 1PA6A 4A3CH 1WGYA 3PO0A 3ZLZA 3CC4A 4N8X1 2L0TA 3U7DA 4ZAIA 2K03A 5CV8A 2WHIA 1MSHA 4CHKA 2CVRA 3JAMi 4L8JA 4AS1A 1QJOA 4L23A 5M3MH 1T3QA 1A0IA 2WU5B 2EXDA 4JC0A 3H7SA 1HZ9A 2V1CC 1QOFA 2W3SA 3PV0A 1A8VA 3FILA 3X23A 2L55A 3PIP3 2JYTA 3GE8C 3WOEA 2PE9A 1RL2A 4RH6A 1EOVA 3S2HB 3T1YQ 2R93B 2K7VA 2Y0SB 3HOXH 3UQBA 3IHPC 4C1NI 4K2LA 1VQ5A 1NENB 3J7ZC 3IL8A 1FFUA 4J3OD 1BBWA 3RN5A 4JBKA 1FIQA 1O7LA 2I5MX 2NVQH 3J7A5 1U4RA 1NYQA 2OCEA 2G3QB 3C1FA 2N4FA 1X6OA 4YT0B 4WQMA 4UDUC 4IFDI 4A3JB 3K5MA 3RUIB 2RDGA 2C7MB 1MG8A 2RDFA 1FXTB 3Q69A 2J0TD 1LLRD 1A62A 4YHHL 3APFA 3ZDTA 2HQLA 2BS4B 2B63H 2JA8B 2NS5A 1WWTA 4GSWA 2HJ1A 3RNUA 1QUQB 4JBWA 3VR5A 2WU2B 3TEHB 2EJFC 3DBRI 5HG2A 4OVVA 4KK7A 3H15A 1XT9B 4USAA 2A6ED 3Q22A 4O0AA 2EY2A 3ABVB 1L5PA 2INCC 2NVUI 2NMQA 1I4QA 4X3TA 2R6GA 4YL8A 3NP8A 2E2HB 2Z6KC 2CKHB 1VQGA 3LGJA 1P7EA 5BYSA 4G7ZC 3IXSA 4S0RA 1H9MA 3I4MB 4MJSB 3K58A 1BCPD 5DPWA 3OTOQ 5KHOA 1VMCA 4B9WA 4KKSA 1SYFA 3T1HQ 1XEEA 1JWSD 1FM0D 3DBRB 1PZID 4A3PA 1QWYA 1Z47A 1CJEA 1WJ4A 1YZ6A 1EUJA 2F0QA 2SEBD 5CV7A 3ZQ4A 4TQ1A 1TWCH 4QGUA 3T51B 1VQFA 4M1UB 3AQQA 1WD0A 2JA7B 2R93H 1E6EB 3U9OA 1SF0A 1SNPA 1KNEA 4YSYB 1DONA 4JYAQ 4F8MA 5HI1A 1K28A 3MC8A 4KKIA 4JL9A 4DK5A 3RNEC 2DAFA 2D5DA 4RGOS 2NZ1D 1QILA 2D2QA 2A6HC 1E24A 3BK2A 5G55A 1STBA 1VQBA 1ILQA 4NW2A 1RLFA 5ELCA 1Q1OA 1MPEA 1WGGA 2KWUB 4DXFA 4LF5L 3SK5A 2ZCCA 3AULA 3S1NB 2F4IA 1VDZA 5M5WB 3MAQA 1VQAA 3W1SC 4PMWA 3D6CA 4JI2Q 5E6JA 3X0WA 2C7HA 2IO0B 3I7FA 2DZIA 4IUTA 5GADC 1P0RA 1CQVA 4GN1A 3GD7A 2F0FA 4GKKL 4B6WA 1VQJA 2MJDA 3J7AV 2G45B 4NXNQ 2JXTA 1OEYJ 2BF8B 2KLGA 3C0RB 1TBEA 4KJOA 4PV1C 3CCMA 2CJNA 2D5GA 1TKEA 2K8HA 2ZZPB 4GB9A 2DENB 2JK8A 2RR9A 3VUYA 3V2TA 3HOYG 4KZCA 2KHSA 3PGEA 1CK1A 1RRBA 2QCZA 1BCPF 1IYUA 2OEDA 4K5XA 3ERQA 1QZGA 1SNDA 4H02A 4JBJA 3CC2A 2LJ5A 4Y52H 1FNVA 1VQ8A 2CHXA 2AHOB 1D5MC 1VMPA 2N0SB 4HKZE 1C76A 3HZXA 2JA9A 3MJWA 4J6IA 1NMGA 2IHFA 4B3SL 4A20A 1TWAH 4QY7A 3DWAA 3MJ5A 3N9YC 5IIFA 1S72A 4PG3A 3EHVA 4EX5A 4C3IH 2B2VA 1FEHA 3H94A 1PYBA 1WMHB 5G5GA 3I2ZA 3K9OB 1XCTL 2M9VA 3F2CA 2BT6A 2WB1G 3CCRA 3T13A 5LMUQ 1WXSA 4FF4A 2BW2A 2C60A 1OQYA 2ZTCA 4ID6A 2LVQA 1ZYRD 3NUCA 2L9HA 2RA4A 2C9OA 2JA6G 5M3FB 1EY8A 3CIRB 1DYQA 3OJ3A 1X3GA 3TS0A 4XXEA 5TR5A 2A69D 2WXFA 2JX5A 1K0SA 1L6UA 3M63B 5IO9A 4L5RC 2KOLA 4YTNB 2RF4A 2EYJA 2BYVE 3RNFC 4LNQA 2AMCB 4K2KA 3ULLA 2N88A 1K50A 4GLAC 1ZP0B 3PCOB 2K5WA 1NR2A 4HMJA 1M8AA 5IGBA 4IKGA 2MCNB 2OF1A 1N32L 2LHEA 4K5WA 2K22A 2WXLA 3J81E 2HHHL 3N30A 1KIXA 2ZPYA 2B63G 4A9AA 3I3TB 2F4VL 3M4PA 1CZWA 1B3QA 4CJ0B 4LF7L 4HPMB 3B6YA 2OJWA 4AQ7A 1A3VA 1GJZA 4FDBA 3PO2H 1RIPA 1EWHA 2GN5A 4NMZA 5H1SE 1XNRL 1I4HA 3ZGZA 1K8GA 3BY4B 1BDOA 2XBBC 3KLWA 1IBLL 3KLSX 2K4KA 3DBHI 2IW3A 3N52A 3F8TA 4A3IH 4ANWA 2R2OA 2Z8LA 3C2PA 4DV3L 3UE1A 1YEZA 2DBYA 3EFCA 2ZJQA 4HJ8A 2Y0SE 5C0XJ 5FO9B 4AQYQ 2GI9A 3M95A 1FGUA 3GTQH 4IPHA 1UE7A 1P3QU 2VQFQ 4DPGA 4KX6B 2GOWA 3P7JA 3NSWA 1OFFA 4MM3B 3H3VC 4X62Q 2I5HA 3FEWX 4XIGS 3VR8B 3HOVH 4RMAA 4MTKA 5D2MB 1G8ZD 1II3A 4OHJA 1Y1VG 1RF2D 2B2YA 3AFPA 2ACZB 2UU7A 1B9RA 2WGSA 4BVUC 1H95A 3T1YL 3U52E 4DAYB 2D2CC 3NS8A 4WORA 1WZ0A 1F9JA 1UWVA 4NKLA 5KNBA 2O5IC 5IT9L 3W2DA 1Y8RC 4ZDVA 3PIO3 2XWBB 2R92H 2FUHB 2KJ6A 3OPOA 4A6QA 2K25A 2K5QA 1HZAA 2JU6X 4WURA 3PO3H 4PK1A 2V1YA 1WXVA 4HSPA 2XRQD 2MJEA 3GV6A 1SIFA 4WAFA 3FP9A 2PW7A 2FMMA 3M4OH 2KJHB 5ELBA 1ZE3D 1G2TA 4C4VA 2J4XA 1CKMA 4BA1I 1IBKQ 4JE3B 2XEWA 5C0XH 1XNQL 4AUQC 1E0ZA 4HAEA 4ME3A 3VA5A 3L08A 2XRSD 4P2CB 2PZTA 4ZYNA 2FJ2A 2KANA 3D6WA 2L12A 1B3AA 1SE4A 3ITPA 4ITKA 3J80L 1WXAA 2RSOA 2YEPB 1LV9A 1QLBB 1NNXA 2QILA 3A9JA 3SXHA 3HOUB 2J7ZA 1TR5A 1KM7A 2CS4A 4HIDA 5HFYA 1LTRD 2FFKB 3QOJA 3AEFB 5J2RA 4XQQA 3A5UA 4JBMA 1DOLA 5IYBH 4EZJA 2V3PA 3IAM1 4K0KQ 3DHGC 4DV1L 2OJRA 4POFA 1PRTB 3PUWA 2GBRA 1GG3A 1J9OA 2PVOD 5EE3A 4HN7A 4FF1A 5AFWA 1NJIC 1CA5A 1UE5A 2WINB 1V1QA 2E75C 4BBSG 3S1MB 4RF1A 3OWEB 4C7ZA 4HEDA 1XMQL 2BB5A 1B8AA 3DM1A 2JXMB 1XXGA 1TWFB 3A8JE 2KDBA 4JPSA 3L0WB 1MI2A 3JAMc 2E2HH 3AEAB 4F8CB 2BCOA 2BH8A 4A3MB 2IO1B 4JQWC 2R92B 2QEJC 4R4IA 1F2RC 4CKBA 3VHTC 4JI8Q 3C8YA 1F9SA 2WS3B 4DBGA 2NBWB 3UGBB 4KHPQ 4WWNA 1EY0A 1VF7A 2KQ7A 1TTNA 3S17H 4OO1G 3OMCA 1IYVA 4X64Q 3GTPH 4M02A 2GBJA 2K39A 3ZYYX 2KYWA 5EPJA 2LMCB 5IT9c 1STEA 4DR5Q 1E7VA 4A3GH 1Q46A 4L63B 4DR6Q 3E9HA 3PF5A 1N34Q 1ONLA 2B3AA 5IGGA 4JX1C 2QDBA 2NUCA 1YHAA 1WTWA 3PHXB 3D8GA 4B3RQ 3QQ8B 1C4PA 2F0KA 5JXVA 5G5HA 1F77A 4M01A 4FVMA 3NHEB 1SAPA 3L7ZC 3B0AA 1JOKA 3PPAA 4PS7A 3VRAB 3R3OA 1WR1A 4ANVA 1DJRD 4FA6A 1DGSA 1STAA 2BDNA 1RTOA 2F0NA 2N55A 4R4OA 4HJGE 3S16H 2GBKA 4LNKA 3ECIA 3MXNB 2FMCA 4OXPA 1K8AC 2OTJA 4YHHQ 3FPPA 4E3CA 1QNUA 1T0SC 1WM3A 1X54A 2O2VB 5C1ZA 4HR7B 3NBIA 5CBEE 4WIPA 1YNXA 1S5CD 5BMGA 1Y14B 2QW7A 2BYEA 1AZQA 2L00B 2AUJD 1AW7A 2GRIA 2UXBQ 3NZ3A 1BVSA 5IKCM 2K5PA 1L4ZB 2LGDA 2N8NA 2XTIA 1EIYB 3JW0X 4OIJA 4HKQA 2R7ZG 2GBNA 1LFDA 2W54A 3P42A 4W9DA 4N59A 4EZKA 1Y8NB 2LKVA 2LRUA 1HNZQ 3GTMH 4LWCA 5JJKA 5IY0A 2I38A 1MHWC 3AECB 3P4PB 1V8QA 1G6ZA 5C3EH 1VLBA 3BWUD 3EA6A 4G50A 1EWYC 1K0RA 3Q8BA 4RM9A 5FR6A 2QDLA 1FR3A 3SR1A 1GB1A 1D4BA 1DOIA 2JN4A 1UBIA 2DLBA 4HJKA 4NJCA 5CR3A 4K1RB 4MH0E 1SXTA 3DEOA 5KEEA 4DR3Q 5AZHA 4GN3B 3HOZH 1QVGA 3A5ZB 2FINB 1B9MA 4B3TQ 4KN4C 5CX3A 1SDFA 2UUAL 3HVDA 4FP5D 1RHPA 4TKOB 3CCSA 1T5XD 2EZVA 5T1GA 2O5JC 5K36H 2AWOA 1ZYRC 1Y1VB 2PPBC 1EYCA 3L54A 3IBEA 1ZKHA 2LEKA 1S5BD 4FXCA 2PCFB 1GKHA 2OQKA 1UGJA 3QJYA 1KLVA 5HHDG 1X65A 2EY1A 2W55A 1TGZB 5M5XH 2OQ0A 4LF4Q 4UHVA 1FFVA 4B9XA 1K3RA 1Q1BA 1BOSA 3EFUA 2KD0A 2KQ3A 3M7NA 4XE0A 4A3FB 3DOWA 3E6ZX 1RJTA 3MHBA 1HQMC 4EGVA 1A15A 2HT1A 4IPDA 1BQQT 1XMOL 4IUUA 5I6YA 4BY7G 2UWQA 1IGDA 1IZ6A 1WCMG 3I4NG 3OJ4B 2CWAA 2PLPA 4CHTB 4R9WA 4W9EA 4N8FA 1KQSA 4P6VF 2ZNVC 1SFOH 3K57A 3GZNB 3NG0A 1W3SA 3I4LA 1VS0A 5DNFA 1HCZA 3OLMD 4X65L 3VTVA 4LJZC 3KW5B 1VZ6A 2HD3A 3AE6B 4LNOA 1XCQL 2CWPA 3K5OA 3I56A 1WF9A 5EQ0A 1JB3A 4K8JA 3J81i 3K80C 2NVTH 4JI7L 3Q24A 4GDLB 4M00A 3BK1A 4DU9A 2F03A 4BA2I 5C4XB 3EGRA 2CHZA 1S40A 1C8CA 3TIXA 2B2TC 3ZJTA 1RD9D 2NPTA 2C5LC 3VUWA 5A2QE 3HKZE 3AE4B 2LFNA 2MBBB 1PRTC 4FHKA 3BVMA 3L13A 4C3HB 2LGIA 3AM9A 3CW2C 2RPVA 3HFZB 5G3LF 5J1ZA 3U4EG 2A1AA 3KOJA 5EGTA 3G7LA 2NVXB 4L5TA 2QDFA 4ICUA 4P75A 1IP9A 2EMTA 2OEOA 3ULJA 3DVGY 4AP4C 3HUIA 3H0GH 2OWOA 3IT4B 3NUHB 3TEZA 3CKIB 5C5LA 3B2FA 3PO3G 1TS4A 3NBHA 2UUBQ 2ICEC 3M4QA 2ASQA 3JSVA 2E5LL 2BWES 1I94L 3QWNA 1E22A 1TS3A 1ENFA 2YU9B 1X56A 3A55A 4GNXA 3TP6A 3I4MH 2VNUD 4GDLA 3KYCD 1HFNA 2IJ0A 4QQBX 3HKSA 2GMIC 2KKCA 2ZNVB 4A3DB 2UU9Q 3EROA 4HDOA 3VRBB 1NMFA 1XTCD 1N60A 2J0KA 1H8CA 4MZ9A 3M3JA 4DV4L 3MWYW 4NAWA 1KAAA 5AZGA 1X3EA 1AEXA 1TT2A 2R7DA 1HZ6A 3N3KB 3BVZA 2KWDA 1VDVA 1LGRA 3H9DA 3M4OB 1WCMH 3I4NH 4CO7A 2A68C 4APVA 3ZIMA 4BOZB 2JZ3B 3S2DH 3LX0A 4LF7Q 1Z6HA 3TP5A 1PHJA 2HD5B 4CDCC 1Q86C 5H92C 2PMZE 1U0LA 3ETRA 3LDZE 2NVYB 2IY0B 2JPHA 3M3YB 2PTLA 3TEXA 3HOXB 4DUZQ 2G5DA 2E2JB 2IX1A 1UF0A 3UI2A 5A2QL 4X3KA 3PLVA 2EDGA 4LFAQ 1LYLA 1CZGA 3QJZA 4KKUA 1EEID 3K5LA 1N8RC 2EXZA 4CDFC 4DV3Q 4EQPA 3I57A 4BZAA 2QSDA 1K83B 1EM7A 1Y8OB 1FYCA 3G6JB 4HDQA 1C78A 4A3JH 2MJ8A 1YMHE 4WJQA 1QF6A 1DGJA 4AOFA 1DM0B 2INNE 2UXDQ 4ZRQA 4YTMB 4YWLA 4LF9L 4GDKA 4IWQA 2N9LA 4MSMB 4X62L 1XD3B 1P1AA 3K81C 4FF2A 5FLXE 3RLNA 3DDCB 3DWMA 5HKHA 4WWOA 2BOSA 3VR2A 4IG7B 2K5DA 3AB9A 1FCCC 2XK5A 3T4AC 3PREA 4KV2A 5A35A 1RODA 3W1YA 4V190 1H9KA 3CC7A 1N34L 2JA5B 1AWDA 1KTKA 1IBML 1KNAA 3P4QB 2KACA 1I50B 2YTVA 2FCMA 1IKLA 5CMDA 1CTMA 2MP1A 4ZUIA 4JI1Q 4LF5Q 1YQ4B 1LTAD 3A1QB 4DUYL 4JIOU 2JA6H 2D07B 5IE8A 3ND9A 3AE8B 2MQJA 2IHEA 2NB0A 3A7AB 1WVLA 1OTCA 4POGA 2WXNA 4A55A 3T8MA 3HKZG 4RGTA 3SGIA 4IWOA 1UBQA 3EBEA 4GZYC 2UXCL 1HNWL 1I6HB 2AL6A 3I5JC 2JA7H 4JYAL 1X1MA 3NJTA 4B3ML 1F9PA 4P16A 3Q3MC 1JORA 2DZMA 1MSGA 1ACCA 4GOPA 4C7YA 4EQ5A 1E7PB 2L52A 3UDIA 4DWFA 3EC8A 2WKCA 1J19A 4DKAC 1WSPA 1SIJA 5LLIA 4KI0A 2CW0D 2LVOA 2MPMA 3PLUA 4B95A 1SYDA 3I4MG 1DXMA 5C0XG 1X3PA 1G6PA 5I9PA 4FXDA 1PQSA 4DR7Q 3W5UB 1O80A 4JI2L 3AXCA 2K5HA 2ZM6Q 3R66C 2D3AA 5J3BA 1T5EA 1KRHA 1EIGA 1WH3A 1J8IA 2IDYA 5M3MB 1WTHA 1T6BX 2DNFA 3DHIC 3E56A 4X66L 3E0JA 4YSXB 2KFJA 4EKUA 1YJNA 2WXPA 3STBD 2ZW1A 2G4DB 2B29A 2HJ8A 3ZRCA 5IYBG 2PO4A 1XF5L 2L76A 5C4XG 3S2AA 1YIWA 2ENBA 4KIKA 4P1BC 1F2ZA 1KRSA 2IX0A 3HGBA 3RN2A 1Y8PB 4AQYL 2KWCA 4KSLC 1U5KA 4WJ3M 1HTLD 1YNNC 5HGQA 3S9WA 2LS01 5C4JH 2LUEA 1I42A 3H0GG 4A4IA 1XLOA 3VA7A 2A5HA 2D11A 4HLEA 2CH4W 1WOCA 2QCPX 1Y69U 1FO4A 4R1JA 1ZXTA 2LD9A 1V8CA 1SNQA 2K52A 3GQBA 2MNAA 4A3EH 4QAYA 2X6LA 3HEJA 1PV4A 5T1IA 4JI5Q 1C0AA 4GLXA 3TREA 1STNA 1L1OC 5DPSA 3TJPA 3PUVA 3K0XA 2SAKA 2MUYA 2KXJA 3ZNID 3NS1A 1AYFA 1BCPC 4RM8A 5IGFA 2WXOA 4ZQ3A 2XGTA 4A3BH 2M2LA 4M8AA 1XO3A 1E7ZA 2PI2A 1K52A 2O6VA 5ISRA 4TKNA 3RUZA 1EQQA 1WGHA 5DAUA 3OIPA 2BWFA 3KUZA 4KD4A 2DZKA 2HE7A 5T8IA 2EPBA 1VQEA 4LF8Q 3DHHC 3VR3A 1AH9A 1TZ1A 3DQVA 3IAYA 2Q2IA 4ZRIA 1N36L 1C79A 1Q90A 2R93G 2JEBI 4UP7A 1E8WA 2Y0SG 2X6GA 1V1PB 1ESRA 2DNEA 3APCA 3AYHB 2ID0A 2KHJA 5M3FH 1WRIA 1WRDB 1O7IA 2WP8J 2BTEA 5DPRA 2BE5C 2PZWA 5KIXA 2Q2UA 2HTME 3A4RA 3GOEA 3A0JA 4C3JG 3Q0AA 4ZLTF 1NCVA 1UNSA 1RCVD 4XWWA 4U673 4IFDJ 2JRHA 4RA8A 5GAEC 2H88B 1MVKA 4K6DA 2ZW0A 1YI2A 2KC1A 2BA1A 5E3FA 4JI3L 1K8OA 2PI2E 5GROA 1C1YB 1WGRA 4YWKA 4OO1I 1OQQA 2L8JA 4YTPB 4YSZB 2A8VA 2NR2A 1SSNA 4NAMA 3VH3B 1V81A 3ZUNA 2NBFA 5FLMH 4QUFA 1F9QA 1SYGA 3K7AH 1HNZL 2JA8G 2KVRA 2KCCA 4RAUC 1L6VA 1R4MB 2M0XA 1VQHA 3VYSA 3H8HA 5LMNL 3EJIA 1NI2A 1NR4A 5BR8Q 2QJLA 1HHVA 4G11A 4MJSA 3E5SA 3VYUA 1N62A 4XT3B 4DV0Q 2DHZA 2JWZA 4LDTB 4W9FA 4PQXA 1KRTA 1I4PA 1LTLA 3GTGB 3H7PA 1HEZE 4F1SA 1OXVA 5I2XA 1FL0A 2K1BA 3BINA 5KHQA 4A3IB 4HTHA 3JSVB 1WGDA 3PIOA 4GKJQ 1SJHD 4KHVA 1L0WA 1TWGH 4R8IA 1JALA 3AE2B 2CQOA 3SVMA 2LHDA 1U4MA 2DAJA 2Z59B 1Q5WB 4EUTA 4KLKA 4ME5A 4PMCA 1JW9D 2K28A 4DV4Q 2F0GA 1VCBA 3HHMA 1MJCA 1U4LA 2PQAA 5GAGC 3WCQA 1JE4A 2XN9C 1VQ6A 1K73C 2OOBB 4I6LB 3J80c 4OGQC 3KUCB 5IP9H 3MFGA 2E76C 3WWVA 1RFKA 1GJXA 1XPRA 1UH6A 4US8A 3Q3NC 3N20C 3JC66 1VQOA 4DR6L 2D62A 1FPYA 2IGDA 1PFNA 1WJ6A 5C23A 3VH4B 1FRDA 4A3GG 2NPTB 4NB3A 4DK6C 4BBRB 5EE1A 5CC4A 2WQYB 2GVBA 4HJ5A 2FXQA 2ATWA 1EIFA 3CCJA 4K3BA 5E6OA 3V62A 4FXGC 4RCNA 4LF6L 4HCPB 2N9XA 3HOWH 4FADA 4A3LG 4KZ0A 1F9RA 4X65Q 4R8NA 1WTXA 2OHFA 3ZVVA 2JT4B 1UZXB 1LT4D 1L7YA 5JJLA 5JPNC 3G48A 1EY4A 4KY5A 5CYUA 1WI0A 2F0TA 3M3YH 1D7QA 3NVWA 2Z0EB 3WAPA 5FR3A 3IKJA 3FHWA 1ZGUB 3RZFA 3TQYA 4YWGG 3BDOA 4KIKB 2PQAB 1YIJA 1TVXA 2JZPA 4KKJA 3DMUA 3CCLA 4OW0A 1H4RA 1A2TA 1TS2A 1C48A 1TWHB 2DYMA 1STGA 3UQAA 2BH2A 3PZ7A 3RLFA 1SNCA 1PFDA 5LXIB 4ZYSA 4DR2L 3GTOH 2VRRB 4L2YA 5M3MG 1N6ZA 2KX0A 2VQFL 3WA0A 4DHJD 1E0BA 4YXDB 1MBYA 4DV1Q 3NTHA 1YX6B 4DAVA 4II2B 2WIIB 5M5WH 3HOWG 1U4AA 2KJXA 4KHPL 5NUCA 5IT9E 3LYYA 5AJ3L 1HA5A 4KD3A 4B3SQ 3AE7B 4B0EA 2N1WA 3X3NA 4PS8A 4JOIA 2KHIA 4ACFA 2V0GA 4A90A 1W6KA 2LVPA 1B50A 1E1OA 5J22A 1PVOA 2N9KA 5IP7G 1OTRB 2KO3A 3UF8A 3WIMA 1J0GA 1GD7A 2LSSA 3CQZB 3I8ZA 1T9HA 3W5OA 4OL7A 5I9OA 4JI0Q 1VQNA 3Q8EA 3QO2A 2HDEA 3RMKC 1BF4A 4WJWA 1C9OA 1EYGA 2PNRC 3GTMB 4XYOA 1BT0A 4E71A 4R4CA 1FXIA 4KGRA 1STHA 5IOIA 5IA7A 2BYTA 2F0EA 5EJWA 2PZUA 1EFWA 4ZRPA 1JJCB 3JAME 2B76B 1PFMA 4X3UA 4FBJB 1CFMA 5C44G 5M3FG 2JA6B 2FUG1 4R3DA 2DY8A 3NTKA 3C3LA 5LL6S 5LMNW 1ENCA 3M4YA 4AWJA 4CBVA 3A1QA 5EKKA 1PH4A 4DV2Q 1JJGA 3S17B 1F52A 3KF6B 4FHJA 3IFDA 4JK1C 1V1PA 1ZUD2 2L83A 1PZJD 4Q5VA 2DWQA 1Y1VH 5TSSA 4A3KH 1XMOQ 3Q8DA 4J1MA 4C3IB 5DLQE 1F2MA 1WYDA 3PUXA 2ZCBA 2B2UA 1VQKA 4A8XC 4HCSA 2KX3A 2K8CA 3P1HA 1SGHA 1Y1WH 3NELA 4LFAL 2KN4A 2R92G 3NVZA 1TKYA 5M5XB 1IL8A 3S1QH 4A75A 2YTYA 1NI3A 1A3TA 1JICA 1KF6B 2WX1A 3AEVA 3DBLB 3MXNA 5AUIA 5J39A 2Q8RE 3S16B 4C2MB 5JEAH 3TCAA 2AYOB 1QOHA 3MXUA 2DYOA 1VZ7A 3QA8A 3LNNA 5CV5A 1KD1C 1TKWB 1R7SA 1G91A 3TEWA 4LLGM 3AE3B 4A93G 4F87A 3PIPA 3UDXA 3CHBD 3PO2G 1Q82C 4YIJA 2K14A 1A6XA 2CFMA 2M0AA 4KY6A 2DNCA 1CT1D 1XTDA 3HG9A 2HIVA 4JI8L 2JYOA 4OX9L 3C46A 1A63A 2C9WB 2LMCA 2M8SA 3FMCA 4IOCA 1QNKA 3FVQA 3S2HH 2R7FA 3BJUA 3TN2A 1J7CA 1PFBA 3KF8B 1AE3A 5IWAL 4H7BA 2UUCL 1YN3A 3SDZA 5JHBA 4A3EB 1D6EC 4MT5A 4NY0A 2ZXPA 2SOBA 3AFQA 1N63A 2B2VC 5BO4B 3SDLC 3SFDB 4LUZA 3DBSA 3M7GA 4IO9A 2LI5A 1N36Q 4IPCA 4KY7A 4NAWB 1HZ5A 3F2DA 4A3BB 3IRBA 2WDRB 1BBUA 2WP9B 1MG4A 2D0OA 1T0RC 3P4RB 1CQFA 2UUAQ 3E0EA 4XYQA 3KLSA 3P1MA 4WAAA 1K9MC 3HOVG 4DV5Q 2NWGA 4UP9A 5IP7H 3H91A 3FPUB 2UU9L 4OWXB 1XYIA 3VTWA 5IYCG 2F3VA 1G51A 5D65A 3RZDH 4K3CA 1G291 1UE6A 1V5TA 4W9HA 3I63C 3OSOA 3GTJB 2GLSA 1YNJD 4JVZA 3CU7A 3PZDA 3P63A 4LF4L 2CW0C 3DLLA 2K0PA 5JVH3 4ARCA 4RHSA 5JPMC 4L6TB 1V5OA 1SN8A 4GGQA 3UINB 2KNBA 3VTUA 4LFBQ 2DGYA 3N32A 1C4QA 2RVLA 3R2IA 1KL9A 4IPGA 1GUTA 4PZ7A 5GQOA 4DFAA 4DUZL 1GC7A 4IWPA 5JJZA 3I9V1 4I6NB 5EDSA 3RI7C 4FN2A 2IPKD 3DUZA 2BBCA 3DM3A 2MBQA 2X69A 1L2FA 1HUNA 3ND8A 3A56A 1Z9FA 2AQ3B 2EE1A 2RBMA 3H6MA 4KHZA 4BKSA 2XVSA 1OXXK 3K6OA 4GLVB 4GKJL 2AWTA 4ABNA 4LK1C 3JAML 1YQBA 4UY8C 4HIMA 4JW0A 4IJHA 3AV8A 3AEGB 1IBLQ 3PV1A 5LXHA 4HJ7A 2MP2B 4A3JG 1T0QC 2N7DA 4IFDH 1NDDA 1DCZA 1D5XC 1VQ4A 2E5LQ 1TIFA 1Q7YC 2DJFC 2HCCA 3GTGH 4NPNA 3VQIA 3MTNB 4DR4Q 3AB5A 1HTPA 3TBLD 4A3MG 3VDZA 1WJUA 1J7AA 1CUKA 3SHLA 3WAOA 1SMXA 2UYZB 5C44H 2E2DC 2WYQA 5H8YE 5IGCA 5C3EG 5C3JB 5C3WA 3ZO5B 2KZRA 4KDLB 5BMIA 2KVMA 1VQCA 1E3PA 3U9SA 3ERSX 3ZJYC 4X64L 2R61A 2MH7A 4BBNC 4LF8L 2IYDB 4DUYQ 1V43A 2WDTB 1Q81C 3IT6B 1X3QA 2I46A 2MLBA 3H7PB 1EF5A 1FCLA 1NUCA 2YYZA 2XWJB 4NQKE 1WX9A 1HPCA 3L3OC 3QAQA 1EQVA 2UUBL 2K8BA 3AEBB 1IL2A 1GPXA 4B3RL 2EYOA 5D7GA 5IN7A 2D9UA 1RFAA 4WJNA 5FOBB 1WX7A 1PH6A 3G4SA 4X57B 1BUVT 3RNAC 2K5VA 4AIMA 3Q14C 3RPFC 2JA7G 3I4OA 4DK3C 1ASYA 5HY6A 3C1EA 3O13A 3CXCA 3T16A 2LGXA 1NVID 2I1KA 4JI7Q 2SNSA 4GNXB 1MHXA 2YV5A 1RM6C 1N5XA 2LRWA 2N7JA 2WXGA 4IM0A 4QIWB 2CHWA 1I3QH 1SB3C 3GTPB 1WYWB 4DGZA 5KGUA 2FE8A 5KYIA 2L32A 2QIEB 1TT5B 3A9KA 4ALPA 1SE8A 4YCUA 3MHSD 1CA6A 4S17A 2AQ1B 1TWHH 1Q0WB 3AE5B 4MNOA 2B2TA 2KCMA 1VQLA 1KXLA 3D4WA 1ZDVA 3Q3JA 1PTOC 3F1ZA 5IP4D 2F0MA 3TSSA 1FXAA 2HUGA 3SFEB 1R9TH 1C3TA 3W1BA 3IFWB 3V6CB 2PW9A 1M1KC 3A4SC 2VZKB 3L0OA 1TYGB 2SDFA 4HSVA 2VZAA 4DK0A 4G3XB 1J5EQ 2NYZD 1WTQA 2AX5A 4DN4M 1NE3A 1PTOD 3OMGA 1PH8A 3PRMB 2RHQB 4MGYE 2RSUA 3J80E 1SR3A 2L4NA
chains in the Genus database with same CATH topology
1PRTD 1AFPA 1B44D 1JMLA 1YNND 1EIHA 2F1MA 1RTNA 4QB4A 4B0MA 2NVTB 1KDBA 3PZ8A 1YN5A 1S5FD 1SYEA 3TP8A 2L5TA 4ZHOA 4IN3A 3X3MA 3MHZA 2B8GA 5IOCA 1KFYB 2JSOA 4FYDA 5DEHA 2JSVX 2V4IB 2OXPA 4XTCS 1LTGD 1K53A 2EYPA 3SR6A 1EQTA 1GHKA 1EZ6A 3TBIB 3K0YA 2EYMA 4S3SA 1MI0A 4IQZA 1C4AA 3RMHA 4JWUC 2HQEA 3QG1A 2IGHA 2EY5A 2CHBD 3VYTA 4N6EB 4EE2A 4IFDG 2WXKA 1MGSA 5M9OA 2B63B 1SEBD 3AMUA 2HDLA 3GB1A 1E2WA 1D2BA 1N5WA 2E6XA 4QMGA 3NWTA 1LT6D 1SFOB 3S2DB 3FAHA 1R4PB 4DF7A 3K7AB 4CQNA 3PMFA 2QF7A 3SK8A 1D1IA 2ZT9C 3Q8CA 1CHQD 4G7OC 1IW7D 1XX8A 3PO3B 1LT3D 1JOQA 3NTIA 1NAPA 1BNZA 4KGSA 1PLFA 2EY6A 3V05A 1DOXA 1ET6A 2IX3A 1V97A 3LXFA 2BS3B 3DHQA 4HCEA 3RZDB 2I07B 3EFXD 4LAAA 1EOTA 2L11A 5JOBA 3OWFA 3NXWA 2BB6A 5COYA 1SNMA 5CBAE 1EEFD 3H09A 3J81L 5BN3A 3AE1B 1PZKD 5FKAC 4H0LC 1GUWA 3BVGA 5D3IB 1EY9A 2CU3A 2HCIA 1HFGA 1E2ZA 1ET9A 5JEAG 4C80A 3Q6SA 1JC7A 4DNTB 3FILB 1EU3A 1WD1A 1C77A 2XNAC 2LFIA 1NSNS 1JROA 1PDXA 3GTOB 3DWPA 1XWEA 3BDCA 4RFBA 1UAPA 1KH0A 2EJGC 2RQXA 1TU2B 3I72A 4OO1H 4TQ0A 1QOBA 3FDTA 3W5VB 3B9JA 5DM73 2Q8IB 4PT5A 2IGGA 2G9DA 1Y56A 2F3WA 2PYKA 2K6AA 2E74C 3CRKC 3TZUA 1TZOA 4N9PA 3J9CA 3P75A 1GOZA 2WACA 5C4ZA 1SBBB 1I4XA 1K8MA 2K04A 3KBXA 4WH4A 2A68D 1D5ZC 1EWCA 1WTOA 2L1AA 2ZXRA 3CRLC 1I6VC 2ON8A 2EKIA 2EJMA 2XSCA 1U9RA 4RWSC 1QT9A 4IALA 2TMPA 2Y3AA 3I91A 1O78A 4A3KB 2XIWA 2IT1A 2C5CA 1EY6A 2W3RA 3NRZA 3AN1A 3GTQB 2F0VA 2NVQB 4WRDA 4EQOA 5IGDA 4HEA1 1IUEA 2SNMA 3BDLA 1AN8A 2RDHA 3SK4A 1BO0A 1GUGA 4DAPA 4O42A 1TY0A 2X38A 1QG7A 1HA6A 2K3UA 5EKIA 5M5YB 4RCOA 2H1EA 1JWUD 3EQLC 3LWEA 5BYQA 4NDXA 1YJJA 2EYFA 1S5ED 3E9SA 5K36G 5KRUA 2E3TA 3SE0A 4C1NK 4KV6A 1BUIC 2Q8TA 3P4SB 4OZAA 2R3ZA 2KA7A 3N6RA 4ARIA 2ONQA 1WXQA 1BMLC 1KLGD 2BA0A 4J6HA 3ZJUA 3ONAB 4G7HC 1CM9A 1S4ZA 2A6EC 1SE3A 2JEAI 3BIID 3AEDB 3NK9A 5C3XA 4RGNA 1X32A 3TEYA 3EVQA 4ZKBB 2A69C 3B2GA 2NTTA 2TSSA 1WTVA 2A6HD 4BY7B 4G4KA 1QOAA 2PVGC 1Y1WB 4I65A 2K32A 2MHVA 1PTOB 1JQYD 1OO9B 3FC4A 1UWXA 1SMYD 4ZKCB 2KCNA 1ZKOA 1Q8IA 1B4OA 1V1OA 3BZDB 1C4CA 2B39A 3T3NA 4IOIE 3KF8A 4C3IG 2F0LA 3D31A 4Y7NB 4U68A 5JVG3 1I7HA 3A8KE 4WWMA 2WLBA 4TMAB 3MP9A 2AWNA 3Q8AA 3QOLA 1FD6A 4KJNA 1E9MA 3PUYA 4DK1A 2R7ZB 5EPLA 1B9NA 1LABA 5BN5A 4KKTA 1O7ZA 3VR4A 5CV4A 4F7XA 4KTAA 2WKDA 3A54A 4A93B 2F0UA 5C2TB 1F2LA 5CV6A 4UAIA 1KABA 1TWCB 1JWBD 3AEEB 4GDKB 3HOYB 4MHEA 2CJOA 1F2RI 2K33A 4TRDA 3KLRA 3KK7A 1AZPA 4NP5A 3RD4A 1YNJC 1ILPA 1YJIA 1LO5D 2L0CA 5EBDA 3GV3A 4K5VA 5JAVA 1CI3M 1GUSA 2M00A 1F2YA 2JP1A 2MJ3A 1ENAA 4DNRB 3CWIA 4J8QA 3MC0B 4PMBA 3OIQA 1JWMD 2Z4HA 3OOCA 3NWSA 2WXRA 3T3OA 2A74C 5EKLA 1A70A 4H44C 4DAYA 1PGBA 1EZ8A 1FNUA 4O1NA 2G9HD 1OXUA 2J53A 5HURA 4DA2A 1HUMA 1DOMA 2B8FA 2NN6G 3S1QB 2INPE 4XWTA 5FLXL 1R9TB 2J42A 1ZEQX 2ICIA 3NQIA 5DM63 1LT5D 4K6LA 4OZCA 1TWAB 4QF4A 3KUPA 3M85A 3GP7A 2K01A 1TS5A 4B08A 2VB3X 1TJEA 4KMUC 3R93A 2WAQB 1HXYD 2PIAA 2VXWA 2WNMA 1BR9A 4C3HG 2JWUA 2RSNA 1NYRA 1K51A 1KLUD 2KMMA 2B2WC 3DWQA 1BCPB 1BBXC 1NEKB 5CORA 1IHZA 2EOTA 3MFYA 3AU7A 3Q8FA 3I73A 4Q2JA 5FO7B 1PDQA 1ZPSA 4HRSA 3P20A 4REZA 2EVBA 2LJIA 3S14B 1Z7TA 1RYJA 3F2UA 5IODA 1Q1EA 1ML0D 1JWAD 4IDIA 1N61A 1UWMA 3Q23A 3MZ5A 3PO2B 1VJKA 5I4DA 2WXJA 2WDQB 1RKNA 3BG3A 4K8IA 2B2YC 2PQEA 3K5NA 1FNWA 4JWSC 1P7FA 3A8IE 3KBGA 2JQRB 4TQUS 1Q10A 1B2TA 3VYRA 1VZ8A 5GXGB 1L4DB 2HDMA 5D14A 3KWVA 5K5PA 3IAS1 1O7YA 5EPKA 4AYBB 1QE6A 3H0GB 1CZPA 1EU4A 4N9TA 1EYDA 2LUMA 2B2UC 1MD2D 4CJ1B 1U4PA 4DQOC 2QKIC 2WB1B 4ZOHC 5C5MA 1LTTD 5ELDA 4ZUJA 1CHPD 3MTSA 1YN4A 2K05A 4LK0M 3L4PA 2Q5WD 2DY7A 3W3AA 1LTID 1PUTA 3AH7A 2WXIA 5E4XA 2MGSA 2BS2B 3T56B 5KNCA 2KECA 4BBSB 1L0VB 2GB1A 3NE5B 4HROA 1S5DD 2DN8A 4Q0FA 2IWHA 1VCIA 4D2KA 1TWGB 4FNFA 4MIUA 1STYA 3PUZA 2I2YA 4G57A 3S1RB 3GTLB 4FXKC 4MH8A 3D3RA 1ZXHA 4C3JB 2V3NA 4DXGA 1LTBD 3HKZB 1PTOH 4C56C 5EE0A 4L1BA 2FBWB 4H2AA 1WTRA 1SYCA 1L0XB 1PGAA 1EL0A 2KQ4X 2VZKD 2JE6I 3UI3A 1JR0D 1UUPA 3OHXC 2O2LD 3AMZA 5E1FA 2WV6D 1I3QB 3U2SC 3VR6A 5LL6X 1SMYC 1PYWD 2L1BA 1R4QB 4BWGB 2A73B 3DEPA 2GA4B 3IFTA 1KDAA 3I70A 2M19A 2NTSA 1XLQA 1H9JA 1PGXA 3FRPB 5FK9C 4HMIA 2J52A 1H9SB 1KDCA 5D3DA 1XLNA 4BS9A 5KNDA 2Y5PA 1RWSA 2RMMA 2M56B 3HOZB 5C0XI 4US9A 4MN3A 4RF0A 1PRTF 3BYYB 2PMZB 3HRDD 5FO8B 1EY7A 1YNTE 1OXTA 4EQNA 4ILWA 4RNAA 1FD7D 5AUKA 4LTUA 2W82A 2F0JA 4XDDA 1PMRA 4IUNA 4ODGA 3MXPA 4XDXA 1LTSD 3GO5A 2F0DA 1VRAB 1DOKA 1GUOA 3J7AF 5BMHA 2H89B 1C9FA 4H13C 1A3UA 1RDPD 2AQ2B 2JYEA 1PXUA 1HQRD 4ULLA 4V0BA 3I3CA 1OXSC 5F2DA 1SYBA 2F0SA 3MEHA 3WOFA 3DWGC 2F0PA 2RKSA 1IBXB 1A2UA 2LY7A 2QMTA 1ZOYB 4RGMA 5LNK1 1EY5A 5KYLA 3TDQA 1WGKA 3U7ZA 3I90A 2PW5A 3QIAA 3KQ4A 1I4GA 1JQ4A 4FO2A 2AUKA 1QQRA 1E2VA 1FRRA 1QCBD 1PTOF 1TQOA 3J7YW 5E4WC 1D1KA 4Z9CB 5ELFA 4WFN3 3HRZC 1FMAD 1SE2A 5EBCA 3SK6A 5G3LD 1SJED 2PKOA 2K9XA 1WTPA 1IBXA 4PNYA 1FGBD 3R8BA 4F88A 3NVVA 1DZ1A 1MHHE 4OVZA 4IZ8A 4ZK9B 1B53A 4FF3A 1JCKB 1TIID 1HRJA 4IUPA 4ZHPA 1H9RA 4IUQA 2MEKA 2WXQA 5C6AA 3D4RA 4A3GB 4M0WA 2OT2A 1XLPA 2F0WA 2B2WA 3NVYA 3TMEA 4MACA 4RKLA 1W6JA 4LMQD 1ZDXA 4XQJA 3KWLA 1JOOA 4IURA 3QB3A 3A7LA 4KN7C 1IKMA 3T53B 2Y5CA 1M4VA 1DD2A 4E6IA 2F0IA 4XQNA 2KEDA 4TSSA 4RHRA 1J7BA 1ESFA 1I4RA 1GHJA 5IGEA 1EYAA 1IGCA 4CGYB 2VUMB 2O4XA 1GAQB 1GXDC 3OW7A 4CJ2C 1SNOA 1H9SA 2KEEA 4GLSC 5MPOA 4IUVA 4OIKA 2F0OA 1SSOA 1VR9A 1BXTA 3HOWB 2ZXOA 5EE9A 2KAJA 4QUCA 1GUNA 2KUMA 2VB2X 5CGKA 1ICWA 1VF5C 2EELA 2BDOA 2E2IB 2CQAA 5I6WA 5ELEA 1GB4A 2WXHA 2Z1CA 4XT1B 1TKGA 2H4OA 1WCMB 3I4NB 3MXGA 5C44B 2WDVB 1LACA 2YEPF 3RFZB 3TZDA 4XDCA 1AP0A 1Q3LA 2EYLA 3SEBA 1QOGA 4BY1B 1WYGA 4RKBA 3GS2A 4NZLB 3K59A 1YQ3B 2KDMA 4QCLA 5JEAJ 2EYHA 1ROEA 4N58A 5BN4A 4I7ZC 5CV9A 5LHY1 3GTKB 3ZJVA 4K14A 5C4HA 2NN6H 2WXMA 3AE9B 1UEAB 3WDNA 3MVVA 1JRPA 5HGTA 1E10A 5I2YA 5BYRA 1DOYA 2NN6I 5C4JB 1B1ZA 3RZOB 4CKEA 3W1SA 3BS1A 3W9CB 1ZXIA 3VR9B 3LWUA 1Q12A 5C3EB 3HP3A 3LB8C 2PMVA 3R2TA 4ZRZA 4EVOA 3HS0C 3NHHA 1L0YB 3TP7A 4CKCA 1QKZA 1EFID 2V4DA 4X3SA 3TUOA 2Z4IA 3NPPA 2BE5D 2IL8A 2G1EA 3L9AX 1QB5D 1OQRA 2F0HA 3HVZA 3MA2B 4KGTA 2FHTA 3EUB2 3V3XA 3V96A 3S15B 3BYTB 3FKIB 3D4DA 3HOVB 1TY2A 3NQTA 4OZBA 1G2SA 1IW7C 3URYA 3PO0A 3DXJC 4ZAIA 2K03A 5CV8A 1MSHA 2CVRA 4L8JA 4AS1A 1QJOA 4L23A 1T3QA 2WU5B 1QOFA 2W3SA 3PV0A 3FILA 2L55A 3PIP3 2JYTA 3WOEA 4RH6A 3S2HB 2R93B 2K7VA 2Y0SB 4C1NI 4K2LA 1NENB 4J3OD 3IL8A 1FFUA 1FIQA 1O7LA 1U4RA 1NYQA 3C1FA 4YT0B 4WQMA 4UDUC 4IFDI 4A3JB 3K5MA 2RDGA 2RDFA 3Q69A 2J0TD 1LLRD 2BS4B 2JA8B 1WWTA 4JBWA 3VR5A 2WU2B 2EJFC 5HG2A 4KK7A 4USAA 2A6ED 3Q22A 2EY2A 3ABVB 1L5PA 2NMQA 1I4QA 4X3TA 2R6GA 3NP8A 2E2HB 1P7EA 5BYSA 4G7ZC 3IXSA 1H9MA 3I4MB 3K58A 1BCPD 1VMCA 4B9WA 4KKSA 1SYFA 1XEEA 1JWSD 1FM0D 1PZID 1QWYA 1Z47A 1CJEA 2F0QA 2SEBD 5CV7A 3ZQ4A 4TQ1A 3T51B 4M1UB 1WD0A 2JA7B 1E6EB 3U9OA 1SF0A 1SNPA 1KNEA 4YSYB 1DONA 4F8MA 5HI1A 4KKIA 2D5DA 4RGOS 2NZ1D 1QILA 2A6HC 3BK2A 1STBA 4NW2A 1ILQA 5ELCA 1MPEA 4DXFA 3SK5A 3S1NB 2F4IA 1VDZA 5M5WB 3MAQA 4PMWA 3D6CA 5E6JA 4IUTA 1CQVA 3GD7A 2F0FA 2MJDA 3J7AV 2JXTA 4KJOA 4PV1C 2D5GA 2CJNA 1TKEA 3V2TA 2KHSA 1CK1A 1BCPF 1IYUA 2OEDA 4K5XA 3ERQA 1SNDA 1FNVA 1D5MC 1VMPA 2N0SB 4HKZE 1C76A 3HZXA 3DWAA 3MJ5A 3N9YC 5IIFA 1FEHA 2B2VA 3H94A 5G5GA 1XCTL 2M9VA 2BT6A 3T13A 4FF4A 2BW2A 4ID6A 1ZYRD 3NUCA 2L9HA 2RA4A 2C9OA 3CIRB 5M3FB 1EY8A 1DYQA 4XXEA 2A69D 2WXFA 2JX5A 1L6UA 2KOLA 4YTNB 2EYJA 4K2KA 2N88A 1K50A 1ZP0B 2K5WA 1NR2A 4HMJA 1M8AA 5IGBA 4IKGA 2OF1A 2LHEA 4K5WA 2K22A 2WXLA 3J81E 4A9AA 1CZWA 4CJ0B 4AQ7A 1A3VA 4NMZA 1EWHA 1I4HA 3ZGZA 1BDOA 3KLSX 2IW3A 3N52A 2Z8LA 3C2PA 2DBYA 5C0XJ 5FO9B 2GI9A 4KX6B 3P7JA 3NSWA 1OFFA 4MM3B 3H3VC 3FEWX 4XIGS 3VR8B 1G8ZD 1II3A 2B2YA 4OHJA 1RF2D 2ACZB 1B9RA 3U52E 2D2CC 4WORA 5KNBA 4NKLA 2O5IC 5IT9L 3W2DA 3PIO3 2XWBB 3OPOA 4A6QA 2K5QA 2JU6X 4WURA 4HSPA 2XRQD 2MJEA 3GV6A 4WAFA 2PW7A 2FMMA 5ELBA 1ZE3D 1G2TA 2J4XA 4BA1I 4JE3B 1E0ZA 5C0XH 4HAEA 3VA5A 2XRSD 4P2CB 2PZTA 2FJ2A 3D6WA 2L12A 1B3AA 1SE4A 3ITPA 4ITKA 3J80L 2YEPB 2RSOA 1LV9A 1QLBB 2QILA 3SXHA 3HOUB 2J7ZA 1TR5A 5HFYA 1LTRD 2FFKB 3QOJA 3AEFB 4XQQA 1DOLA 2V3PA 3IAM1 1PRTB 3PUWA 1J9OA 2PVOD 5EE3A 4HN7A 4FF1A 5AFWA 1CA5A 2WINB 2E75C 3S1MB 4RF1A 3OWEB 4C7ZA 4HEDA 2BB5A 3DM1A 2JXMB 1XXGA 1TWFB 3A8JE 4JPSA 1MI2A 3AEAB 2BCOA 4A3MB 2R92B 2QEJC 1F2RC 4CKBA 3C8YA 1F9SA 2WS3B 1EY0A 1VF7A 4OO1G 3OMCA 1IYVA 3ZYYX 5EPJA 2LMCB 1STEA 4L63B 1ONLA 5IGGA 4JX1C 2QDBA 2NUCA 1WTWA 3D8GA 1C4PA 2F0KA 5JXVA 5G5HA 1F77A 4FVMA 1SAPA 3L7ZC 3VRAB 1JOKA 3R3OA 1DJRD 1STAA 2BDNA 1RTOA 2F0NA 2N55A 4HJGE 2FMCA 3FPPA 1QNUA 4HR7B 3NBIA 5CBEE 4WIPA 1S5CD 5BMGA 4A55A 1AZQA 2AUJD 1AW7A 2GRIA 3NZ3A 2K5PA 1L4ZB 4OIJA 4HKQA 2W54A 3P42A 4N59A 1Y8NB 2LKVA 3P4PB 2I38A 3AECB 1V8QA 1G6ZA 3BWUD 1VLBA 3EA6A 1EWYC 3Q8BA 1FR3A 3SR1A 1GB1A 1D4BA 1DOIA 2DLBA 4NJCA 5CR3A 1SXTA 3DEOA 5KEEA 2FINB 1B9MA 4KN4C 1SDFA 3HVDA 4FP5D 1RHPA 4TKOB 1T5XD 2EZVA 5T1GA 2O5JC 5K36H 2AWOA 1ZYRC 1Y1VB 2PPBC 1EYCA 2LEKA 1S5BD 4FXCA 2PCFB 1UGJA 3QJYA 5HHDG 2EY1A 2W55A 1FFVA 4B9XA 1Q1BA 1BOSA 2KQ3A 3M7NA 4XE0A 4A3FB 3E6ZX 1RJTA 3MHBA 1HQMC 4EGVA 1A15A 1BQQT 4IUUA 5I6YA 1IGDA 2PLPA 4CHTB 4R9WA 4P6VF 3K57A 3I4LA 5DNFA 1HCZA 4LJZC 1VZ6A 3AE6B 1XCQL 3K5OA 5EQ0A 1JB3A 4K8JA 3Q24A 4GDLB 3BK1A 4DU9A 2F03A 4BA2I 5C4XB 3EGRA 1C8CA 2B2TC 3ZJTA 1RD9D 5A2QE 3AE4B 2LFNA 1PRTC 3BVMA 4C3HB 2LGIA 3AM9A 2RPVA 5G3LF 5J1ZA 3U4EG 5EGTA 3G7LA 2NVXB 2OEOA 3HUIA 3IT4B 3NUHB 3TEZA 3CKIB 5C5LA 3B2FA 1TS4A 3NBHA 2ICEC 3QWNA 1TS3A 1ENFA 2YU9B 3A55A 3TP6A 2VNUD 1HFNA 2IJ0A 4A3DB 3EROA 1XTCD 1N60A 3MWYW 1KAAA 1AEXA 1TT2A 1HZ6A 3BVZA 2KWDA 1VDVA 3M4OB 2A68C 3LX0A 1Z6HA 3TP5A 5H92C 3ETRA 2NVYB 3M3YB 2PTLA 3TEXA 3HOXB 2E2JB 2IX1A 3UI2A 5A2QL 4X3KA 2EDGA 1CZGA 4KKUA 1EEID 3K5LA 2EXZA 4EQPA 3I57A 2QSDA 1K83B 1EM7A 1Y8OB 1FYCA 3G6JB 1C78A 2MJ8A 1YMHE 1QF6A 1DGJA 1DM0B 2INNE 4ZRQA 4YTMB 2N9LA 4FF2A 5FLXE 3DWMA 2BOSA 3VR2A 2K5DA 3AB9A 1FCCC 3T4AC 5A35A 1RODA 4V190 1H9KA 2JA5B 1AWDA 3P4QB 1KTKA 1KNAA 2KACA 1I50B 1IKLA 5CMDA 1CTMA 2MP1A 4ZUIA 1YQ4B 1LTAD 3ND9A 3AE8B 3A7AB 2NB0A 1WVLA 2WXNA 4RGTA 4GZYC 1I6HB 1F9PA 4P16A 1JORA 1MSGA 1ACCA 4C7YA 1E7PB 2L52A 2WKCA 1WSPA 1SIJA 4KI0A 2CW0D 2MPMA 1SYDA 1DXMA 5C0XG 1X3PA 5I9PA 4FXDA 3W5UB 1O80A 1T5EA 1KRHA 1EIGA 1J8IA 2IDYA 5M3MB 1T6BX 3E56A 3E0JA 4YSXB 2WXPA 2ZW1A 2PO4A 1XF5L 2ENBA 1F2ZA 2IX0A 3HGBA 1Y8PB 1HTLD 1YNNC 3S9WA 2LS01 1XLOA 3VA7A 2A5HA 2QCPX 1Y69U 1FO4A 1ZXTA 1V8CA 1SNQA 3GQBA 2X6LA 3HEJA 5T1IA 1STNA 3PUVA 2SAKA 2MUYA 3NS1A 1AYFA 1BCPC 5IGFA 2WXOA 4ZQ3A 1XO3A 2M2LA 4M8AA 1K52A 5ISRA 3RUZA 5DAUA 3OIPA 4KD4A 5T8IA 2EPBA 3VR3A 3IAYA 1C79A 1Q90A 2JEBI 2X6GA 1V1PB 1ESRA 2DNEA 2ID0A 1WRIA 2WP8J 2BTEA 2BE5C 2PZWA 5KIXA 2HTME 4C3JG 3Q0AA 4ZLTF 1NCVA 1UNSA 1RCVD 4XWWA 4U673 4IFDJ 4RA8A 2H88B 1MVKA 4K6DA 2ZW0A 2BA1A 5E3FA 1K8OA 4OO1I 1OQQA 4YTPB 4YSZB 1SSNA 4NAMA 2NBFA 4QUFA 1F9QA 1SYGA 2KCCA 4RAUC 1L6VA 3VYSA 3H8HA 3EJIA 1NR4A 2QJLA 1HHVA 3E5SA 3VYUA 1N62A 4XT3B 4PQXA 1I4PA 3GTGB 1HEZE 1OXVA 5I2XA 2K1BA 4A3IB 4HTHA 1SJHD 4KHVA 4R8IA 1JALA 3AE2B 3SVMA 2LHDA 1U4MA 4ME5A 4PMCA 1JW9D 2K28A 2F0GA 1U4LA 3WCQA 1JE4A 2XN9C 4OGQC 3MFGA 2E76C 1RFKA 1GJXA 4US8A 2D62A 2IGDA 1PFNA 1FRDA 4BBRB 5EE1A 5CC4A 2WQYB 4FXGC 4RCNA 1F9RA 1WTXA 4R8NA 2OHFA 1LT4D 5JPNC 1EY4A 4KY5A 5CYUA 2F0TA 3NVWA 5FR3A 3IKJA 4YWGG 3BDOA 1TVXA 2JZPA 4KKJA 3DMUA 4OW0A 1A2TA 1TS2A 1TWHB 1C48A 2DYMA 1STGA 3PZ7A 3RLFA 1SNCA 1PFDA 4ZYSA 4L2YA 1E0BA 4YXDB 1MBYA 3NTHA 4DAVA 2WIIB 2KJXA 5NUCA 5IT9E 3LYYA 1HA5A 4KD3A 3AE7B 4B0EA 3X3NA 2V0GA 4A90A 1W6KA 1B50A 5J22A 2N9KA 3CQZB 3I8ZA 5I9OA 3Q8EA 4OL7A 3QO2A 2HDEA 1BF4A 4WJWA 2PNRC 3GTMB 4XYOA 1FXIA 4KGRA 1STHA 2BYTA 2F0EA 5EJWA 2PZUA 4ZRPA 3JAME 2B76B 1PFMA 4X3UA 1CFMA 2JA6B 2FUG1 4R3DA 2DY8A 3NTKA 3C3LA 5LL6S 1ENCA 3M4YA 4CBVA 5EKKA 3S17B 3IFDA 4JK1C 1V1PA 1ZUD2 2L83A 1PZJD 4Q5VA 2DWQA 5TSSA 4J1MA 4C3IB 1F2MA 3PUXA 2B2UA 4A8XC 4HCSA 3P1HA 2KN4A 3NVZA 1TKYA 5M5XB 1IL8A 1NI3A 1A3TA 1JICA 1KF6B 3MXNA 5AUIA 5J39A 2Q8RE 3S16B 4C2MB 5JEAH 1QOHA 3MXUA 2DYOA 1VZ7A 3LNNA 5CV5A 1TKWB 1R7SA 1G91A 3TEWA 4LLGM 3AE3B 4F87A 3CHBD 1A6XA 4YIJA 2M0AA 4KY6A 2DNCA 1CT1D 3HG9A 2LMCA 1F0ZA 2JYOA 3C46A 3FMCA 1QNKA 3FVQA 3TN2A 1J7CA 1PFBA 4H7BA 1YN3A 3SDZA 4A3EB 1D6EC 4MT5A 3SFDB 2ZXPA 2SOBA 1N63A 2B2VC 3M7GA 4KY7A 4NAWB 1HZ5A 4A3BB 2WDRB 2WP9B 3P4RB 1CQFA 3P1MA 4XYQA 3KLSA 2NWGA 3H91A 3FPUB 1XYIA 2F3VA 5D65A 1G291 3OSOA 3GTJB 1YNJD 3CU7A 3P63A 2CW0C 2K0PA 5JVH3 4ARCA 4RHSA 5JPMC 4L6TB 1C4QA 4DFAA 2RVLA 3R2IA 1GUTA 5JJZA 3I9V1 2IPKD 3DUZA 2BBCA 2X69A 1HUNA 3ND8A 3A56A 2AQ3B 2EE1A 2RBMA 3H6MA 4KHZA 2XVSA 1OXXK 3K6OA 4ABNA 4LK1C 3JAML 3AV8A 3AEGB 4IFDH 1DCZA 1D5XC 2HCCA 3VQIA 3AB5A 1HTPA 1J7AA 3SHLA 2E2DC 5H8YE 5IGCA 5C3JB