4RGMA

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 62
structure length 223
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgmA01
1F77A 1I4GA 1D5ZC 3EA6A 1SJHD 3MC0B 3TSSA 5D3DA 3BVMA 1CHQD 2G9HD 1TY2A 1I4XA 4RGNA 3V05A 1KTKA 2J4XA 1SJED 2XRQD 2AQ3B 1V1PA 1HQRD 1DYQA 1S5BD 2IPKD 5D3IB 1DJRD 1HXYD 1M4VA 1FD7D 5ELBA 1BCPF 1LT4D 2NTTA 3BYYB 1PRTF 2XRSD 1ENFA 3R2TA 3SEBA 4RGMA 2XNAC 1EEFD 2WV6D 4TSSA 3W2DA 4NZLB 1UUPA 1I4PA 1PYWD 1CHPD 1PTOH 1TS2A 1KLGD 5ELDA 4ZYSA 1RCVD 3R2IA 1RF2D 1EU4A 1SE4A 4RHRA 4L63B 1I4HA 1SBBB 5ELFA 2XN9C 1YN3A 1JCKB 2QEJC 1MD2D 1B1ZA 3KLSX 1CQVA 1YN4A 3CHBD 2RDGA 1STEA 3R8BA 4RHSA 1G8ZD 1S5FD 3DWPA 1LTID 4BWGB 1BXTA 1LTRD 2AQ2B 4O1NA 1CT1D 1SEBD 4K6LA 4UDUC 5TSSA 1YN5A 1FNVA 1PTOD 4L6TB 4RH6A 2TSSA 1KLUD 3DWAA 1TS3A 1UNSA 1V1OA 1JQYD 1D5XC 1SXTA 1LT3D 3OWEB 1XXGA 4Z9CB 5I4DA 1FNUA 5FKAC 1D6EC 3BVGA 1PTOC 1ET9A 1PTOB 3GP7A 1GOZA 1FNWA 1LLRD 1TS4A 1LT5D 1QILA 1AN8A 1I4RA 1EWCA 1BCPD 1PRTD 1L0YB 1ET6A 1LTBD 1AW7A 1D5MC 1SE3A 1PZJD 1I4QA 1XTCD 4RGOS 3URYA 1ESFA 1LTSD 1HTLD 1L0XB 5ELEA 1CK1A 1EFID 1FGBD 1RDPD 1LTGD 1JWUD 1T5XD 1LTAD 4OHJA 3O13A 1BCPC 1BCPB 1JR0D 1PRTC 1PRTB 2R61A 1TY0A 2RDHA 1EEID 1S5DD 4RFBA 4C56C 1LTTD 1S5ED 1JWMD 1V1PB 4DXGA 1PZKD 5ELCA 1JWSD 1LO5D 1SE2A 1PZID 2SEBD 1RD9D 1S5CD 2O2LD 2Z8LA 3BYTB 3DWQA 3MFGA 4RGTA 1LT6D 1B44D 2CHBD 2ICIA 4RCOA 3BVZA 1TS5A 3EFXD 2AQ1B 2QILA 5FK9C 2NTSA 3BZDB 1PTOF 2IJ0A 4DXFA 1HA5A 1EU3A
chains in the Genus database with same CATH superfamily
1KAWA 2KHIA 2AUKA 3MA2B 1H9KA 4NDXA 4C3JG 3H6NA 4CHKA 1E7VA 4A3EG 2PW7A 2FMMA 4LF5L 4BBSH 3AXCA 5IOIA 2LHEA 2MP2A 4RGNA 4MH0E 1PQSA 2LHDA 2KHWB 3PGZA 2R2QA 2AWTA 3TCAA 3UE0A 4R3DA 2PIAA 3GTMH 4JI5Q 1KRHA 3STBD 1WX9A 3ITPA 4X57B 1MSGA 3N3KB 1IBKL 2I07B 2MHVA 2KMAA 2M4NA 1PGBA 5A2QE 4K7SA 2KFKA 4GLAC 4RGMA 2XNAC 2LSSA 2A19A 5IGFA 1DONA 1LV9A 2VZKB 2M0XA 4AIMA 2MCNB 2GVAA 3OOCA 1R7SA 1J0GA 2NN6I 1KRTA 4BXXH 4B9WA 3HHMA 3H0GB 1PXUA 2RCNA 3GTKH 2XEWA 5D6JB 4ZRQA 3M85A 2PO4A 3S2HB 2JA7B 5C2TB 2R7ZH 3PO3B 3EFUA 1BQQT 1E0ZA 1E8YA 3T1HL 4B3TL 2ZEQA 3SXHA 1MD2D 1TT2A 2JA8G 1FL0A 1GO3E 5E3FA 1B7YB 2R7DA 3A56A 3HOUH 1KNAA 5BMIA 1WTOA 2KN4A 2L1BA 3OPOA 1JOKA 3K9OB 3TEHB 1O80A 4OIKA 2OQ0A 1PV4A 2WXMA 1VCBA 4HDOA 1CKMA 4HTHA 1SEBD 1GC6A 2K32A 3J7AF 1BBWA 1HFNA 1W6KA 3VHTC 5E4WC 1IGDA 4RH6A 4K14A 1WGKA 3NBHB 4ZRKA 1EOVA 1OQRA 1T3QA 3HOZG 4KSLC 1B8AA 1S40A 2PE6B 1V1OA 5J3BA 3QR8A 2B3AA 1JICA 4FLHA 3AMUA 2K0PA 3AB5A 1IBLQ 1X3FA 2A5HA 1BUVT 4B9KA 1O7ZA 2KMMA 3Q8AA 2VL6A 3GTOH 4W9EA 3GP7A 2PPBC 1CA6A 3JVZX 1SGHA 4GN1A 1BVSA 5FLXL 2G3QB 2MBOA 2N88A 4TQ0A 1TWCB 4N9PA 1QILA 1OTCA 1I4RA 2CKZB 1ZYRC 2L12A 2WP9B 4CDFC 1AE3A 3KYHC 4DA2A 1VQHA 4X3KA 3CCMA 5IYBH 4RGOS 1TKGA 1Q82C 4FF4A 4A9AA 1J7CA 1MKHA 3PRZA 2R2OA 4HWIB 3PV1A 3WALA 1ZKOA 1WTQA 2A6HD 4A3LG 3Q3OC 2TMPA 3HZXA 5J18A 1LTGD 1T5XD 1DM0B 4DNRB 3QX1A 2JEBI 3RNGC 1XJVA 3DPDA 5ISRA 4DV3Q 4EUTA 1S5DD 3EC8A 2LEKA 3V60A 2KQ7A 2E6XA 4OGQC 4LF8Q 1SROA 3CF6E 3P20A 1EYAA 5IAAC 3MXNB 1SE2A 4LFCQ 2WAQB 1RD9D 5FOBB 1XNQQ 1E7PB 2Z0DB 4ZOHC 3WAMA 4V190 4RGTA 2K5NA 1NR4A 2CH4W 3MHBA 3W1YA 1IBML 2KC1A 3OW7A 5T8IA 4LF9L 2C9WB 3TP5A 2L5TA 1G2SA 3VFKA 3DVNV 2M9VA 5C5LA 2V4IB 4MZ9A 4LW1A 1I4GA 1STBA 5IWAQ 1TT5B 2MO0A 3EA6A 3A9JB 2Z9HA 3AYHB 3HP3A 1V9PA 4HJGE 3X0WA 4KHZA 2G9HD 2Z4IA 3D6CA 4TRDA 5AFWA 3I4NB 1YQ3B 3LDZE 4KIKA 2MGSA 4P1BC 1A3VA 1UEBA 2Y0SE 3PHWB 2AYOB 2A73B 5ELBA 1TKYA 4LFAQ 5IP7G 3E6ZX 1FJGL 2ONQA 4LNIA 1PRTF 2JN4A 1RTNA 1T6BX 2VQEL 2R93B 2EJMA 4A93H 4C00A 1EEFD 1TYGB 3W2DA 4DR5L 4X66Q 3MAQA 1Y1VG 4YCWA 3PUXA 5ELDA 1YIJA 4KY7A 1NJIC 5JZEB 1RF2D 1TWGH 4JI3L 4R1JA 5A2QL 2DNFA 4ANXA 3NWSA 3U8ZA 2RR9A 4AUQC 3ERSX 4DDID 3UIOB 3A8JE 1V81A 2MFIA 2HIVA 2PMZB 4QUCA 3JAMi 3E9IA 4C3IG 2WXGA 3DHGC 3GOEA 3PHXB 4B3RL 1HUNA 1QWYA 1CFMA 2RQXA 2D10A 3KYDD 2JYTA 4IM3A 2LY7A 4NY0A 2MBHA 1KRSA 2X8XX 4X3UA 3M9BA 4HJ7A 3GZNB 4FJYA 1PFDA 3S1NB 5CTRC 4MNOA 1H9SB 3ZJYC 2NBUA 3DWPA 3I5JC 1LTID 2XIWA 5EE1A 5LXHA 2BB5A 2PYKA 5I6YA 2KWCA 4XT3B 3DM1A 4NPNA 1PH1A 3AEVA 2ZZPB 2XK5B 3L9AX 3S14B 3AE2B 2PJHA 2L0FA 4DR7L 1FRRA 2LVOA 1N63A 4W9CA 3U4EG 4KDIC 1PLFA 4MTKA 4C1NK 1L6UA 3PVLA 4I6NB 2IO2B 5DPTA 4J8QA 4W9FA 2NN6H 3DHQA 3SDZA 3F2DA 1CA5A 1KJTA 2NB0A 3SK6A 2D62A 4LNOA 3VXWA 3QIAA 2G4SA 1SXTA 2EZVA 4LAAA 1SYCA 2MUYA 3OSOA 1EIYB 4HDQA 4YSZB 1YHAA 3S15H 1HR0L 1FM0D 1AP0A 2BQQA 4YWKA 5FJ8H 1EUJA 2NUCA 1FNWA 1VLBA 2O5JC 2KMCA 1PDQA 4WJPA 4DV0L 2FNJB 2AWNA 3K9PB 1VQ7A 3PIOA 1KFYB 1XMQQ 3UI3A 2EKIA 4JWSC 3J80E 1I6HB 1C4PA 3CQZB 4B9XA 1UGJA 3CWIA 4MEMA 1N62A 2IX0A 1MG4A 3IFTA 3NBHA 1PYBA 2B29A 2K5VA 3MC8A 1PGAA 3DMUA 4NXNL 3TP7A 2CWAA 1U0LA 4YTPB 2E8GA 4KD3A 4RA8A 3KBXA 1I35A 3F8TA 2ZVNA 4CQNA 1K50A 1VQGA 3VA7A 2ZM6Q 4C3HG 4BY1H 1TU2B 3G6EA 3VTWA 4JBKA 4JK1C 2KANA 1AWDA 2PMVA 1ESRA 3GTJB 1LGRA 1X1MA 1IHZA 2B8GA 2LXCA 5M3FG 2HE7A 3CCSA 3KOJA 3BYTB 1T0YA 2EMSA 3NE5B 4QB4A 4YCUA 2N7EA 5CC4A 1WJUA 2B63H 3GV3A 3VR5A 3M7GA 2UUCL 2D11A 3VAWA 4URKA 1K83B 4IURA 3HFZB 1M90C 4YHHL 1RJTA 2F0TA 1WXVA 1ZKHA 4A3MB 1AARA 4XDCA 1BR9A 1VQMA 1G91A 1I3QH 1YOVB 5CX3A 1YJ9A 2GLSA 2DAJA 1UE6A 1OXVA 5DEHA 1OEYJ 2Z4HA 1TY2A 3RN2A 3H9DA 3QC8B 2FCNA 3ETRA 4ANUA 1S5BD 1SAPA 3M4OB 2JA5B 3MXNA 4X3SA 2MJ8A 1X3GA 2DWQA 2GOWA 2K5DA 2MBQA 2DJGC 1I5FA 3P4SB 1SNOA 5BYSA 1TTNA 4JVZA 1F9RA 2AWOA 3ZJVA 3IFDA 1Q5WB 4HSPA 2MPMA 2MH7A 4ICUA 1YX5B 4NZLB 1VQ8A 1OO9B 5CV9A 2N9KA 2RSUA 4KI0A 2Q8IB 3PO3G 1WOCA 3OLMD 2K5PA 3VYSA 4EFOA 5KIXA 3TP8A 3QOLA 1EO6A 2WKCA 1D1KA 1BOSA 1WGHA 2OTJA 4Y7NH 4ANWA 2NVQB 1E10A 4ZK9B 1SYEA 1F2YA 4LK0M 2PZWA 1Y1WG 4DV6L 3S2DB 2IO1B 1IGCA 3MC9A 4KKIA 2XN9C 2Y5CA 2B39A 3K7AB 4HSVA 4KHPL 3KLSX 2A8VA 4GDKB 3E0EA 4JI4L 1JJCB 1VR9A 3ABVB 1L7YA 3B08A 2J7ZA 1P3QU 2WWZA 5BMHA 1UELA 1N9WA 5C23A 2IY0B 2GMIC 2DZMA 3J7AV 1T0SC 2CCZA 2HD5B 3MJWA 3PIP3 4NB3A 1L6VA 2RSNA 3AH7A 1E7ZA 2HCCA 4KV2A 1LYLA 5TSSA 3D4WA 1BBXC 2L55A 3R7QA 4PMBA 2KTFA 3EVQA 1H9RA 1A6XA 2INDC 4AQYQ 1WTHA 3PGEA 3VTUA 4KHVA 2PQEA 1EQRA 4Z9CB 2M0AA 3ULLA 4M8NA 5FKAC 4AYBB 1XD3B 2DAFA 3DBLB 4MGZE 2LKVA 1PTOC 2W9NA 2UU9L 3QA8A 3HVZA 3M62B 4R4OA 1HQMC 4B3SQ 2HHHQ 2HDEA 1E1TA 1H9SA 4JYAL 2BOSA 3HIZA 1E22A 1STYA 2L05A 1STAA 1BMLC 4BBRH 4QY7A 4R9WA 1N60A 3I7FA 4O42A 1WRDB 2XK5A 4FA6A 1E8XA 2KDEB 4ARIA 1NY4A 2EDGA 3ML9A 4FULA 1TWHH 5GQOA 5D94A 2F0LA 3HOVB 3J9CA 4FO2A 2VZAA 1C9FA 3FILB 4B0EA 1QUQB 3E9HA 1P7FA 3J80L 4BZAA 1PMRA 3UGBB 1WYGA 2WDRB 1E8WA 2KCMA 3L17A 4ANVA 4A3BG 2WAQG 1BCPB 1JR0D 4W9KA 4A3FB 4IPHA 4FYDA 3DQVA 4DK0A 1HNWQ 3HOWH 4PS3A 1BKBA 3IVFA 3RUZA 3BZCA 2PEAA 2B2YC 2QA4A 5DM73 3BIID 1QOGA 1F9SA 1SNMA 2PI2A 1R9TH 1VD2A 4KZCA 3MFGA 5C5MA 1ZDVA 1P0RA 1N5WA 2MSED 4WIPA 3MEHA 1WE7A 1VQLA 3W1SA 5C3EB 3ZTDA 1A15A 3DDCB 4DXFA 3I4NG 1DZ1A 3QARA 3W1SC 4NXML 1XMOL 4W9LA 1P8LA 5IT9E 5E6JA 4GMVA 4TQUS 4UP9A 2KQ4X 1WGGA 2B2WA 4REZA 5E6PA 2KA7A 2YEPB 1CHQD 3T3NA 3MVVA 4XDDA 2JUOA 4J6HA 1JJ2A 1WXAA 2A68D 3NHEB 2J52A 3A5UA 3MHZA 2VH2A 2K28A 3RI7C 3LJ3A 5A35A 3I4MH 3N9YC 4GOPA 1K52A 2KKCA 4ZCKA 4IM2A 4LMQD 4R4IA 3R2TA 4EX5A 5DNFA 4OWXB 4GOPC 1J7BA 2DZIA 2L3ZA 3M63B 3H3VI 2K52A 4WJQA 4US8A 2HD3A 5KGUA 5M5XH 4GKJQ 4RNAA 5IIFA 3GTMB 4DUZL 4N8X1 1DXMA 2D5GA 2FIFA 4P72A 2WX1A 1C78A 4QMGA 1C8CA 3MTNB 3S1MH 1PHJA 1EU4A 3RNBC 2F0PA 3RLFA 1XF5L 4PMCA 3RLNA 1HTPA 4GN5A 5BYQA 4UPAA 1D8LA 3BK2A 4RWSC 3NPPA 2ASQA 1KIXA 3NZUA 4LF4L 3RMHA 1SIJA 1Z47A 4WURA 4C3JB 4GS3A 1O78A 4RHSA 4A3EB 1HZAA 3GTKB 3J81E 1Z7TA 3KLWA 2KUMA 5IGBA 1L4ZB 3ZNHB 1FPYA 3K0XA 4W9DA 1NAPA 3KK7A 5T1IA 4XXEA 1BXTA 4GIVA 3FAHA 1CT1D 4K6LA 1QG7A 4ACFA 3C2PA 3CSFA 3HOUB 5C44G 1HZ6A 3F2BA 3HOXH 3I3TB 2PZTA 4L5SA 4Y52H 4LF7L 4JI1L 4GKKL 1GUTA 3KQ4A 5D2MB 4LUVA 3H3VC 1PH8A 2G5DA 4K8JA 4GDKA 5C0XJ 3LX0A 3SK4A 3FP9A 4C2MB 3SVMA 3RNAC 1CKOA 4APVA 1FRDA 3ZO5B 4DR2Q 3EN2A 2I0QA 1ILPA 3D4DA 3NEMA 5C4XB 4DV7L 2VUMG 3BDLA 1VCIA 3G6JB 1EZ8A 1L0WA 2LMCB 3U9SA 2E2HB 3J7ZC 4OO1G 3VRBB 5C0XI 2PE9A 3GTLB 1F9QA 1R4MI 2JA8B 1IXRA 3H6MA 3A1QB 3RT3B 3W9CB 3K6OA 3HEJA 2E5LL 3C46A 4HN7A 4DK6C 5FO9B 4GLXA 2ZJDA 2L0TA 1EUVB 4EZJA 1HZ5A 2BA0A 2D0OA 2ZW1A 3UF8A 1HNZL 2XBBC 4EOYA 2NVYH 2GN5A 2K05A 2UUAQ 2WHIA 2JZ3B 1TWFH 2ZVOA 4JI6L 4DHZE 3NXWA 1S5ED 5EE3A 2FJ2A 1SFOH 3HOZB 3E9SA 4A3MG 4PYUA 3OMCA 5CV8A 3T9LA 3AE5B 3CCEA 2Z1CA 1T0RC 3V6EB 2QILA 1S1QB 4OW0A 2DX5B 1MHHE 1AFPA 3FILA 4LLGM 3NP8A 3IAS1 1EF5A 4A90A 1C4CA 3MTSA 1SN8A 5IGCA 4DR1Q 2JA5G 4QL5A 4HIDA 2PNHA 3JYUA 4FN2A 2O4XA 2NCNA 1L1OA 1V80A 3MC0B 1P98A 3RN9C 1WR1A 4ICVA 3K80C 2EKEC 1QLBB 3IL8A 2ZJRA 1L1OC 1G6JA 3Q8BA 1I4XA 3CXCA 1WF9A 1HZCA 1GUSA 3AN1A 4FJVB 5JH5C 3PRMB 4HJ5A 3QG1A 2AQ3B 4BY7H 4DV2L 1BNZA 2VQFQ 2NS5A 1MJDA 1NVID 1PUTA 1RFAA 3AFPA 5EPLA 3OJ3A 5BR8L 1FD7D 4P16A 1E6EB 2JA6B 1B3QA 3AV8A 1BCPF 1I50H 1RHPA 3GQBA 1XTDA 2MHJA 2K6QA 3GO5A 4A3JB 4K3BA 4TKOB 2JPHA 3SEBA 5LXIB 2NVXB 1NEKB 2V9HA 1MJEA 2BA1A 2KEDA 1FVIA 4A20A 4M8MA 4CJ2C 1I4PA 4CDEC 2KFKB 4WJNA 2JY6A 3KUZA 2H4OA 2R92H 5AZFA 1E9MA 2ZTEA 5EKLA 5G3LD 3STBC 4MGYE 5JPNC 2E2IH 3VUXA 4DQOC 1ENAA 4LF5Q 1UD7A 4HMJA 1XQQA 3W5OA 2Y5BB 3EECA 3HKZB 3DBHI 2N1VA 4M8AA 4LDTB 1C0AA 4YTMB 1ZUD2 1XLQA 1SBBB 4PZ7A 2F0IA 4DU9A 2K3UA 3FDTA 4POFA 1QJOA 2F0UA 3P7JA 4K3CA 3DVGY 2F3WA 2NZHA 3OJ4B 1IBKQ 4N58A 1YMHE 2YEPF 3QO2A 4B6WA 5IY0A 1HEZE 3PZ7A 2ACZB 2I5LX 1EY0A 4U673 3BU2A 4KKTA 4ALPA 1DGJA 2K8CA 4O1NA 1UE1A 4RG1A 1OTRB 1WJNA 4BVUC 4K5VA 2K50A 4DR6L 4AYBG 1YN5A 4Q2JA 2XWBB 3J81L 4FDBA 1N61A 3NTHA 4CDDC 2TSSA 1JRUA 3A74A 2L32A 4IW0A 3RZWC 1RL2A 3Q3NC 1OXTA 1K28A 3HOYH 3RN5A 1V1QA 2CU3A 3T1HQ 4B3TQ 1E1OA 2WXFA 2WB1E 4HEDA 3AM9A 1P7EA 2WNMA 1NMFA 2BDNA 1YJNA 3HOVG 1GG3A 1GOZA 2QHOA 1PFNA 4CKCA 3MXGA 5IOCA 4MSQB 1AN8A 4N59A 1N32L 1Q0WB 2ZNVC 4ZKBB 1WR6E 4IPGA 4C3IB 2REXA 2FUHB 1U9RA 3UINB 3FMCA 2P5ZX 3MXUA 5M9OA 4HVBA 4BFRA 5J39A 1IP9A 4UP8A 3N32A 3VR4A 1EFID 3G4SA 4DUYQ 4X65Q 1J5EL 4XQJA 2W82A 2E3TA 4LFBQ 1V8CA 4BBNF 2WXQA 1J8CA 5CBEE 1ZP0B 1Y8RC 1JALA 4N6EB 1XEEA 2K4KA 4WORA 2JP1A 4LNQA 3WWVA 5C3EG 1FFVA 5KRUA 2A6HC 1V1PB 5JJZA 2KT7A 2JRIB 4M1UB 5DPRA 2D2CC 4DK3C 3RZDB 1K3BC 1WI0A 4ZRZA 2LMCA 4HRSA 3HS0C 4I6PA 3GD7A 2HJ1A 4LF6L 3A0JA 3HRZC 1ML0D 2F52A 3HG9A 4G7ZC 4RCNA 2UUBQ 2LASA 2CWPA 2VXWA 4K8IA 3TS0A 2GBJA 3TIXA 3V61A 3VR2A 1SYDA 1WXSA 2CHWA 3X3MA 4OWTB 2KXJA 3F2UA 2MW5A 2I2YA 1WIAA 2LWPA 4NKLA 1TKEA 5AUKA 1EY8A 5EKIA 1XNRQ 3ZKJC 2FCMA 4XYCA 2JWUA 2IGDA 3S9WA 3FPUB 1M1KC 4YXDB 2HQEA 3AULA 3KBGA 1Q12A 4DV4L 4NJ7A 5IP4D 1M4VA 1TZ1A 3RNEC 1SMYD 3C3LA 1QQRA 4MIUA 4EGVA 3RD2A 2NTTA 5JJLA 1IBMQ 2XRSD 1SLJA 4LF9Q 3GTPH 1PDXA 1HE8A 2IYDB 3DBRB 3P4QB 3A5ZB 1Q46A 3A7LA 2N78A 1PYWD 1DCZA 4ZRPA 3UQBA 3I55A 2DY8A 1KLGD 3MXPA 4KN4C 4BA1I 1QNUA 2KQ3A 3JW0X 1JE5A 5M3FB 2K75A 4ID6A 4M00A 1VMCA 4H44C 4PS7A 4BKSA 3GE3C 3MFYA 1JW9D 2WIIB 2FMCA 4NAWB 5C3WA 5IGGA 4DV5L 2ZPNA 4KN7C 1OXXK 2R7ZG 2A6ED 3KJPA 2M56B 2LFNA 3EUB2 2BDOA 2RPQA 5CHWA 1DOXA 2FINB 4AS1A 3Q3FA 1XT9B 2UXDQ 1FJGQ 2LZ6A 1K9MC 2F0QA 3QB3A 5IYCG 1YI2A 3HOUG 2MBEA 2H1EA 4KY6A 3FKIH 2B76B 1WD1A 2LD9A 3C19A 2LJ5A 4A3PA 5JJIA 2WXRA 1Q81C 2Q2UA 5CV4A 2QDLA 3SFEB 1SNCA 2Y0SB 1YJIA 3PO2B 4L6TB 2KEEA 2RSOA 1C77A 5BYRA 4HJKA 4PQXA 3HUIA 3PRPB 4A55A 1XPUA 1LT3D 1BBUA 4R8NA 4IKGA 4OZAA 5C4XG 3UIPB 3VH3B 4DV1L 4F7XA 4A3KB 3I4OA 3AEGB 4P71A 5GXGB 2QEXA 2M2LA 3R7RA 1ET9A 2UU7A 4K5WA 2K8BA 2JWZA 2LGDA 2KJXA 3W5UB 3DBSA 1MI0A 1Y1WB 1GUAB 3TP6A 2RKSA 1V43A 3NENA 3T1YL 4DR7Q 1HRJA 2HIXA 2L76A 1W3SA 1II3A 1WYDA 1OFFA 3KWLA 2FXQA 2F0HA 2L7RA 4USAA 2K01A 1CZWA 1QZGA 3LB8C 5FLXc 1V5OA 1MVKA 3L4PA 4J6IA 4FNFA 3TEXA 5BN3A 4BKTA 5L83A 4HLEA 4IOIE 3MJ5A 4ME3A 1GKHA 1SSOA 1RYJA 4ME5A 4JE3B 1QOFA 1NCVA 4HPPA 3P1HA 1EIHA 1I7HA 3TS2A 4U68A 3GV6A 3TMEA 3A9KB 3T16A 5EDSA 4DV0Q 4LUOA 3NSWA 3QK0A 4XYOA 2O2LD 1HNXL 2JSVX 2WKDA 1X3EA 3B0AA 3WDNA 3I4LA 2MO1A 1FO4A 2KD0A 4C7YA 4DR3L 1WY8A 1WZ3A 2ZCCA 3IFWB 3DEOA 1I6VC 2JSOA 2IJ0A 3D8GA 1YJWA 4DFAA 1I94Q 1E8ZA 1TGZB 2DYOA 3Q8EA 4IM0A 4NQKE 4K0KL 2BS4B 2LVPA 2JA6G 4ZRJA 3GTGH 1X3PA 3EROA 1HTOA 2G9DA 3TL5A 4A3JG 1XPRA 3Q22A 5AJ3L 3GTQH 1V1PA 2V1YA 2LGSA 4ILWA 1TQOA 2E2JB 5E6OA 1DOMA 1NNXA 3KVFB 1WVLA 3NZSA 3PUVA 1A62A 2HCIA 4X3TA 4A3BB 2C7NB 3AE1B 4S17A 5G5HA 5M5YH 1UWVA 3HKZG 2UUCQ 3AE9B 2X38A 3VUYA 3G48A 1YITA 4JI8Q 4DR4L 3DM3A 4A93G 2F4VQ 3NS8A 4P75A 2FUG1 3APCA 3U30A 5DPWA 4GNXC 1C4AA 4ZYSA 1PFSA 1EY5A 3I4MB 2R3ZA 1R4PB 1SE4A 1Z6HA 4L63B 1GVPA 1JOOA 4GZYC 4KSKC 2KDBA 2SNSA 5K36H 2FBWB 2CW0D 1ZDXA 1E90A 4JG2A 1SYFA 5K5PA 2Q2TA 1YN4A 4X62Q 2Z6KC 2KJHB 1F2ZA 3WOEA 2C5LC 2WDTB 4HEA1 4JWUC 5LMNQ 1STEA 3B6YA 4XWWA 1SNDA 4MTNA 4YSXB 2KZRA 4KV6A 3RZOH 5GMVA 1WD0A 3OIPA 3RD4A 2FCSA 3SD5A 2A74C 3ZDMC 4EQ5A 1QVGA 2PKOA 3S1QH 3ZRCA 2B8FA 2K25A 3S1RH 5J2RA 3LWUA 4EQPA 2KJ6A 1KDAA 3FHWA 2L9HA 3SFDB 4DHJD 2NN6G 4II3B 5I2XA 4NAWA 3KLRA 1VQKA 3AMZA 1UWMA 2RPVA 3DEPA 1XXGA 1K0RA 3I72A 1SMXA 4KHPQ 2DY7A 2QJLA 2LS01 1NR2A 4FHKA 4CKEA 4JI4Q 1U4AA 1PTOB 1B50A 1X56A 2D2QA 1KLVA 1K8AC 5FJ8G 2V3PA 2RMMA 4HJAA 4JV5Q 4JI5L 1F2MA 4LJZC 4ASWC 3NRZA 3GS2A 1LUZA 5CGKA 2E74C 2Z0EB 1EF1A 2CJNA 1IL2A 4C80A 1SE3A 4BKGA 2WDQB 2HDLA 1O7YA 1C48A 3TEZA 2O6VB 3ULPA 1YIWA 2MEKA 3B9JA 3PSIA 3D4RA 1R4QB 4A3CG 2JZZA 4A4IA 3OW2A 4XC2A 1A63A 3AU5A 3WIMA 4ZLTF 3NVZA 2AHOB 2R61A 1G6ZA 2IW3A 4HCEA 2OEDA 3AEEB 3SU8X 3ZNGC 4BY1G 4JPSA 3OMGA 3G7LA 5C44B 5IP7H 4JYAQ 1QE6A 3VYRA 1TKWB 4CBVA 1NI2A 3TEWA 2HDMA 2JXXA 2NVTB 2YV5A 2CHBD 1C9OA 2F0KA 1JJGA 3FKYA 4WFN3 1J6QA 2NVYB 3P1MA 3EHVA 4LDTD 2Z59B 3FVQA 4A3GB 1VF7A 1XYIA 2ZW0A 1G6PA 1Q1BA 2YU9H 2UXCQ 1J19A 3Q8DA 5BN4A 3NELA 3Q24A 4HJ9A 1DD2A 2VUMB 1V86A 4QJFA 5HFYA 4GN4B 2OXPA 5COYA 1IBLL 4D2KA 2SDFA 3Q0AA 3U2SC 3A9KA 2Q8TA 4IPCA 1B70B 5JEAH 2PPHA 3OYYA 3PREA 2MWSB 4DWFA 3PT2B 3TJPA 3N52A 1UAPA 2F0JA 4HCPB 3S17H 1ENFA 3ZRFA 1R4NB 2A68C 1VDVA 4GOPB 5KNDA 3K5LA 3M3YB 2DLBA 2NYZD 2IT1A 3JAMc 1AYFA 1P1AA 4ULLA 1PH6A 1VQEA 2BT6A 1F52A 1RCVD 1NBWA 1EWYC 5EPKA 2B2TC 4P73A 5IP9H 3S16H 2WAQE 1VF5C 2D3CA 2YVCA 4NJ6A 3RPFC 3RZFA 5GADC 1PGXA 3APDA 3P75A 4QIWB 2EYFA 4WQMA 3PIPA 3TZDA 4NAMA 4DV3L 1QZHA 1ZGUB 4XGAB 1FEHA 2JZPA 2KC2A 4WWOA 1WFQA 4BOSC 1IYJB 2KCNA 1K8GA 4UAIA 2BYFA 2Y0SG 3PO2G 5ELOA 4PMWA 3IAM1 4LFCL 3R8BA 1KDBA 2ES2A 2RHSB 4WH4A 1B53A 3EBEA 3E3XA 1A0IA 1WSPA 5IYDH 3KDFA 3ENEA 4IALA 3DVNU 3SGIA 4BOZB 2KENA 4ZDVA 1SNPA 4DUZQ 1Q3LA 4A3KG 2W54A 2L0CA 1FNVA 1D1IA 1YBYA 2HQLA 1QNKA 4P2CB 3CIRB 2XTIA 1V5TA 2DBYA 3FEWX 1UNSA 4OVZA 5M5WB 4C3HH 1EYDA 2VH1A 3TRZA 1YQBA 2DYMA 5CV5A 1WJ4A 1CI3M 2ZJPA 4YWLA 2EOTA 1XCQL 4LF4Q 2WDVB 1C79A 2A1AA 1ICWA 3NUCA 3TQYA 4UP7A 1T0QC 2K39A 3UQAA 1TS4A 2IDYA 2VB2X 2H89B 2RD0A 4QAYA 1K53A 2R6GA 1PRTD 2PMZE 4BBRG 1LM0A 1HZBA 4IJHA 1WE6A 1UE5A 2RCFA 2CHZA 3RFZB 1A3TA 1EOTA 1OEYA 4YCVA 1CK1A 1PFMA 3PPAA 4LF7Q 1LTAD 3DVGX 4JI1Q 3OWFA 1C4QA 1FIQA 3N20C 2YTYA 4OXPA 3CCQA 4BS9A 3KLSA 5GROA 1F1HA 2PTLA 1YNJD 1MHXA 2VRRB 5JOBA 1J7AA 3KUDB 3T51B 3NVWA 4I6LB 1A3UA 1A2TA 1Q8IA 5C4JB 2Y3AA 4LCDE 3HOWG 2JRHA 4K7WA 4LJPB 4DPGA 4DV7Q 3H0GH 4POGA 2DZJA 1AZPA 1UZXB 1FFUA 2RA4A 3UDGA 2JA7H 3S2HH 3AU4A 2BW2A 3PO3H 3EQLC 4R4QA 1WCMB 1PTOF 2OT2A 2LJIA 1HA5A 2O6VA 1AE2A 2RGFA 3N1ZC 3R66C 4PS8A 2GBRA 1JWBD 1E2WA 2N55A 3V2TA 1JWAD 3QJZA 4GXBA 3L0OA 3GB1A 5E6NA 3BVMA 2Q2HA 4GDLB 1YHQA 4A3DH 1L1OB 3QCAA 4K1RB 3F1ZA 4NMZA 3V05A 1N36L 4JI6Q 5IN7A 1WJJA 2B2VC 2SAKA 2B2YA 1R4MB 2VZKD 2WS3B 1X3QA 1K8RB 2VNUD 3U4VA 3LNNA 1N33Q 3I4MG 1OQYA 3BYYB 3ZVVA 1N34Q 4OEMB 2DGYA 1XMQL 3PF4A 4WRDA 1KHIA 4JC0A 2WU2B 4G57A 4E6IA 3AE6B 3IHPC 4IUMB 4R4CA 2NZ1D 5EGTA 4FXDA 4CJ0B 2IY1B 2O2VA 1SYBA 4X64L 4W9IA 4O2DA 1WM3A 1TWCH 2EIFA 2BWFA 4RHRA 3L2PA 4S3SA 1B9NA 2MQHA 2BB6A 5KYLA 1YJ1A 4A3IB 2KTRB 2I1KA 3L0WB 5AZGA 2N9XA 1RTOA 2ZTDA 3NOBA 1VQNA 5E4XA 5BR8Q 4HK2A 2OEOA 1GAQB 2JX5A 4H2AA 1L2FA 5CMDA 2I1JA 1H95A 5JPMC 1E2ZA 2UXBL 1OXSC 1WTPA 4BBSB 4XIGS 2EY1A 1WGRA 4NNJB 2NPTB 1JQ4A 3P4RB 4KKSA 3CF5A 4IFDI 3FC4A 1MI2A 4GLSC 3IRBA 1M8AA 2KN5A 2KWDA 3BG3A 2GI9A 4RMFA 1E2VA 3HOXG 3LYYA 2CH4A 2NMQA 4CHTB 3AB9A 2FE8A 2J0TD 2OJRA 1KL9A 3H15A 2L15A 2BYVE 2N7DA 2KVRA 4B95A 3BDOA 2ZNVB 4JOIC 4NPSA 2R7ZB 3PUWA 4DR6Q 3RNCC 1FXTB 5AUIA 3JSVB 1RRBA 4CDCC 2BVCA 2D3AA 4DNTB 2WINB 2KQSA 2BF8B 2K6DB 3DHIC 1IL8A 4HKQA 4OZCA 5LMUQ 3WA0A 3RMKC 3VR6A 4ZYNA 2M17A 1MIUA 3SK8A 2R93H 4YWGG 4MACA 5J22A 5EPJA 1GD7A 1KABA 1JB3A 2KOLA 4HJ8A 4L2YA 4A3GG 3D0FA 3PF5A 2AL6A 2F0FA 5BO4B 3L7ZC 4GOCA 3DHHC 5DPSA 3OTOL 1W2BA 3VVWB 2SEBD 1N32Q 4DXAB 2A69D 3U9OA 1LT6D 4G0NB 3BVZA 1ROEA 3SDLC 2BTEA 3VQIA 2WB1B 1JT8A 3DBLI 5FK9C 4AYBE 3J81i 2KWUB 3GTOB 2ZTCA 2V1CC 3PS6A 1J5EQ 3QQ8B 2CKHB 1D5ZC 1KM7A 2DHZA 2C7MB 2MJ3A 4OVVA 1SDFA 5FR6A 2C9OA 2EY6A 2EYLA 1NE3A 2QKIC 2DENB 2GBKA 1ISNA 2MA9B 3SK5A 1YNXA 1NI3A 2DZKA 2KLGA 3I90A 4KVGB 2J4XA 5G5GA 1A8VA 5L37A 1TBEA 1IZ6A 4BY7G 1S3SG 1ONLA 2IHFA 4KGTA 3ZGZA 4B3SL 1K3RA 1VQIA 1WI5A 3VRAB 3A8IE 2IX3A 3QHTA 2K8HA 4NQLB 4LF6Q 4ZKCB 5JVG3 1VDZA 4ZHPA 5IT9c 5M3MH 3I57A 1SE8A 4GSWA 2YLMA 2ZXOA 3CSTA 3BJUA 1SMYC 2INNE 1GB1A 1HFGA 5C4ZA 4P6VF 4KJOA 4FJZA 4GDLA 3NTIA 1I6HH 2EELA 3UDFA 2G4DB 2J0JA 1ENCA 3CQZH 2Q5WD 1UF0A 1JCKB 2MP1A 4HAEA 4DV4Q 4KY5A 4XE0A 1DGSA 2RDGA 1F0ZA 2BKFA 4WAFA 4IG7B 1D7QA 2JU6X 4OO1H 2MJDA 3I70A 3MP9A 1GB4A 2VW9A 1YVCA 3AQQA 3NTKA 2A6EC 1Q86C 3T53B 1LTRD 2B2UC 3I8ZA 5HHDG 3X23A 4TKNA 2KHSA 3GTJH 5C1ZA 2QSDA 3NBIA 4JQWC 4E74A 4B3ML 1FCCC 2WXJA 3I63C 5CHVC 1MJCA 2X6LA 4K81A 4DV5Q 2KTRA 3M4QA 4KK7A 2KJRA 4A93B 3SHLA 1DOKA 3HRDD 1D6EC 1Y14B 2JYOA 2JJQA 5CR3A 1WRIA 5ELNA 2H5XA 4A3MH 1LLRD 2QW7A 1TWGB 3OIQA 2L83A 3PZDA 2Z0SA 2NPTA 3D31A 1IBXB 2NZOA 2WXPA 3IKJA 2K5WA 4JPBW 5C3JB 5I2YA 1AZQA 4IFDH 3M4OH 2JA5H 4KGRA 3I9V1 2QCPX 4GKJL 4ZAIA 3U58A 2KHJA 2W3RA 3RUIB 2K5QA 4CYEA 1MFWA 5LMNW 1EIFA 1PVOA 4IO9A 3QWNA 5DAUA 2ZPYA 3RCZA 1TXYA 5C4HA 4DV1Q 2HTME 3PZ8A 2WQYB 3DWGC 4RFBA 1SB3C 3KFUA 1HTQA 3ZIMA 5J1ZA 1WCMG 4P1CC 5CV6A 3VDYA 2CVRA 2BS2B 2NVQH 3WAOA 1VQAA 2F0WA 4IUPA 3DWQA 4XX5A 5HY6A 3QOJA 4WWPA 2DUDA 3S2DH 2Y5PA 4K6DA 2Q2IA 3TZUA 2GVBA 5JVH3 3K7AH 2OOBB 3JSVA 3L08A 3P42A 4DAYA 1SE9A 5C0XG 1RODA 2JVCA 3B2GA 3C1FA 1CSPA 3CMEA 5FLMH 2PNRC 1NYQA 5EBCA 3S15B 3ALBA 3ECIA 1EFWA 4II2B 1F77A 3BS1A 3TN2A 4YWMA 5MPOA 4YIJA 2KVZA 3HKSA 3LGJA 3APFA 2VY3A 4KLKA 2BE5D 4L5QA 4XT1B 4HIOA 2R7FA 3CCUA 3W1GA 2D3BA 4ARCA 2LUEA 5KNBA 1C76A 3FPPA 1VMPA 4GU2A 1DYQA 3NVVA 1CUKA 1XWEA 2I5HA 3T8MA 2F0DA 5D3IB 1DJRD 4IWQA 1HNXQ 4G3XB 3NK9A 1MHWC 2KFJA 1LT4D 3D6WA 5G2NA 1GJZA 4DR3Q 3CKIB 4XQQA 1GHKA 1YNND 4BY1B 2JA9A 2JE6I 3PV0A 3CD6A 4A3IG 1TS2A 2KYWA 4YT0B 4DDGD 2N49A 4GNXB 1TWAH 3KF8B 4A8XC 2G45B 1F9JA 2NBVB 1WTXA 1NYRA 1JB7A 4FXCA 1PH4A 4OZBA 4N9F4 1KAAA 2B63B 1EQTA 1G291 4BBSG 5ELFA 4RKBA 2UUAL 4IOCA 4I7ZC 1YN3A 3HOVH 4AJWA 2QEJC 5FO8B 1B1ZA 1JC7A 2OCEA 2M19A 1K8MA 1P16A 5KEEA 3BINA 3B1LX 4M0WB 3PQIA 2WXIA 3M4YA 3VR8B 3Q2AC 1I3QB 1IW7D 4A3FH 1ACCA 1WZ0A 4G11A 1WTVA 5LL6X 1KF6B 2CW0C 4IJLA 4ZUJA 3NY5A 3Q8FA 1GUGA 3K57A 1X6OA 2KWVB 2EYJA 4DF7A 4RF1A 1X65A 5EJWA 4JCVE 2FAZA 3BWUD 3M4PA 1WXQA 1CSQA 1WJ6A 4LTUA 4BXXG 1JQYD 5JHAA 1TZOA 2JYEA 3OWEB 2DNCA 3AEAB 4YTNB 4E3CA 4NP5A 2EYMA 5C3EH 4G7OC 4CO7A 2WYQA 1IKLA 3K5OA 2O5IC 4JI7L 1BT0A 1B9MA 2PVGC 3IG3A 1QVCA 4UY8C 1FXAA 3KH0A 4HIMA 4Y7NB 1C1YB 2N9EB 1FYCA 3I56A 2VQEQ 1BCPD 1DOIA 2C60A 3H91A 4DR5Q 3ER0A 1GUWA 2J7QB 3URYA 1HJPA 4JL9A 1PFBA 1ESFA 3VDZA 1EL0A 1HTLD 4JI3Q 5ELEA 1VQDA 4WJ4A 5IKCM 1CKNB 3Q14C 1VQFA 2WU5B 1V8QA 4YY3L 2PW9A 5EKKA 4EEWA 3J7YW 1SF0A 2ALYB 2PLPA 4B3RQ 4IUTA 2WB1G 1A2UA 1Q1OA 3L54A 2LVQA 2D9UA 4RM9A 3N1XC 2KAJA 1UEAB 2NBWB 2WLBA 1JWMD 4AP4C 3K8AA 3TDQA 4DXGA 3OHXC 3ZNID 2D0PA 1EY4A 2PQAA 5I6WA 1IBXA 4HR7B 1VQ5A 4W9JA 5DM63 1RLFA 1U4PA 2CS4A 4K7UA 4OX9L 3UDXA 2CU1A 2ON8A 2BPSA 5AZHA 1TS5A 3P4PB 3CW2C 2WXKA 1TVXA 2KBNA 2GB1A 3V62A 4DBGA 4F8CB 1D3ZA 1EU3A 4H13C 4JBWA 3K7UC 5IYBG 4JI0L 4XQNA 4C3JH 4TV3A 2WFWA 1HPCA 4A3EH 4IQZA 1SJHD 2PW5A 5JEAJ 5D3DA 1IYFA 2CQAA 4BBRB 4ZRIA 5IGEA 1IUEA 1QZEA 1WMHB 4JX1C 1TWHB 3LXFA 1HR0Q 5GAEC 1VS0A 4RKLA 5IYCH 1K51A 1QOHA 1WFYA 2OWOA 1HXYD 2MBBB 1CTMA 2LGYA 2N9PC 5KHQA 4EQNA 3VA5A 1MBYA 3L3OC 4LUZA 4A3DB 1FXIA 1H4RA 2LRUA 1KXLA 5D7GA 2HJ8A 2YTVA 2DNEA 3HOWB 1GUNA 1QB5D 1YQ4B 5EBDA 4C2MH 1G2TA 3A4SC 1ILQA 3J7A5 3VR3A 2I5MX 3R2IA 2X69A 4NXNQ 2BBCA 3VH4B 1R9TB 4DUYL 3EFCA 5C4XH 4X65L 3TEYA 2E2HH 4LFBL 3AEFB 3DUZA 3K0YA 2LXKA 3WANA 3MEFA 3GTLH 3KW5B 4PK1A 1XX8A 3KUCB 4JI2L 2JA8H 5K36G 4MT5A 3S24A 4C4VB 2NVUI 3Q6SA 4FHJA 1ICFB 3ERQA 2GBMA 2V4LA 1LFDA 3Q8CA 3NQTA 5T1GA 2CR5A 3CCVA 3J81j 4GNXA 2UUBL 4PYZA 4GB9A 3KDFB 3KF8A 4YHHQ 3CPFA 4QGUA 5CORA 4MH8A 2KACA 1H9MA 3HOZH 1IKMA 3DWAA 2OF1A 1QT9A 3CC2A 4AWJA 4TQ1A 3DBRI 1FNUA 2QGQA 1B9RA 1XNRL 4HPLB 1N6ZA 3EGRA 4PNYA 3AE8B 2Z6KA 2CJOA 5M5XB 4M0WA 2RBMA 2KLCA 2KCTA 1C7YA 1BDOA 1F2RI 2LGXA 4HCNB 2QMTA 2LUMA 2W3SA 2J0KA 2ZCBA 3S1MB 3M95A 4KKJA 2UYZB 1DOYA 1IYVA 4FVMA 2IO0B 1N8RC 3I73A 3N1YC 4TVAB 3HGBA 4EVOA 5KYIA 1X32A 2C7HA 4A3LH 1UBIA 1N5XA 4L23A 1Q90A 3JAME 2BCOA 2JA6H 4TMAB 3H8HA 2RVLA 4HIKA 1CZPA 1PRTC 4A3JH 1PA6A 4DV6Q 2J0MA 2NVXH 3BK1A 1YZ6A 2F1MA 4QCLA 2IBIB 4DN4M 2JQRB 1MG8A 2IX1A 4GLVB 1XLNA 3ZLZA 2K1BA 5ELCA 3LWEA 4FP5D 2UXDL 1UE7A 2X6GA 2JXTA 1VQPA 3HOXB 1VJKA 3M3JA 2Z8LA 5J17A 1YNJC 4BKSD 3N6RA 2KNBA 4TUUA 3P63A 2RHQB 3RYTA 2RDBC 4EQOA 4K2KA 5DLQE 2XSCA 1RWSA 2MQJA 3ULJA 1EY7A 3CCLA 1CKNA 1KQSA 1F2RC 1WM2A 2KDFB 1KDCA 3U7DA 2WACA 4ABNA 1QOBA 1WGYA 3T3OA 4MM3B 4L5RC 4MN3A 1XLPA 1TIID 4N9TA 1L5PA 4KTAA 3PCOB 5IGDA 2AKWB 4DK5A 1YD8U 1SIFA 4UHVA 2UU9Q 3S2AA 2IPKD 4QUFA 4IWPA 3ZJTA 4YSYB 2IL8A 5JEAG 4L5TA 1X9NA 4WWMA 3H7PB 3U52E 5L95C 4ZHOA 4F1SA 1VQJA 5D14A 3H94A 2K22A 2C5CA 3NUHB 2KX0A 1E5WA 2LFIA 4L1BA 2B63G 1Y1VH 2MNAA 1TWFB 1GPXA 1YJJA 2K03A 1GUOA 2XVSA 3JC66 4OONA 2WXOA 2M1MA 1SFOB 3U4ZA 2O2VB 4WWNA 1PH9A 2Z6BA 5IP9G 2F0NA 4ZQ3A 2AX5A 3ZYYX 1N36Q 4BA2I 4C3IH 1WMHA 2KVMA 3UI2A 3I3CA 5M3MB 3P2BA 5HKHA 1V6EA 3WAPA 4E71A 1HA6A 3K58A 2KO3A 2KX3A 4J15A 1MPEA 5BMGA 3F2CA 3R93A 4P7IA 3ZUNA 1VQOA 3OG5A 1G8ZD 4AQ7A 1QOAA 2GBNA 2BH8A 2G1EA 1FCLA 1U4LA 4FADA 4GGQA 2FIDA 5IYDG 3IBEA 4BWGB 4X64Q 3X3NA 3BDCA 1F9PA 4BY7B 2IGGA 3AE7B 4NXMQ 1XMOQ 1I94L 1CJEA 4LNKA 4B0MA 3J80i 2B2TA 4A3CH 3RNFC 2I46A 2DYBA 2RDFA 3RZDH 2ATWA 1FD6A 3CRKC 1XPOA 2DJFC 4LNFA 1I50B 2F0OA 1EWIA 3SR1A 4XTCS 3K5MA 5LNK1 1SSNA 3TREA 1ZYRD 1ZW7A 4K2LA 1RAXA 5C6AA 1EIGA 1STGA 4C4VA 3C8YA 3IXSA 3Q3MC 4DAVA 2R92B 2UXBQ 3TBIB 1E7UA 4LF8L 3Q23A 3DWMA 5HGTA 5I9PA 2E2IB 4QF4A 4JGHB 3CAMA 2L1AA 1LACA 1EWCA 4IUVA 1XNQL 2AL3A 4KDLB 2VB3X 3PLUA 3CC4A 3AEDB 4WAAA 5EE9A 2B3GA 1EYCA 1JOQA 4JI8L 1D5MC 4PZ8A 2F4VL 1I4QA 4RAUC 2LRWA 1QCBD 1NMGA 3R3MA 3ZJUA 5HI1A 1VZ7A 2YTXA 3MZ5A 3MWYW 3IT4B 1NUCA 3O13A 2N3SA 3ZTCA 5IWAL 4JLCA 4KX6B 4K5XA 5GAHC 3PIO3 1K0SA 4WJ3M 2F0SA 2WXHA 1YEZA 3SR6A 5CYUA 3JAML 1O7IA 1NSNS 2BWES 3E0JA 3VR9B 3MHSD 4AOFA 3DLLA 2OJWA 5M3FH 4X62L 1JWSD 4A6QA 5JJKA 4CKBA 4LJOB 3ZXVA 5LMNL 3CPWA 2EYOA 2L11A 2PZUA 3H0GG 2MJEA 4LFAL 3HOYB 3ZNZB 2D07B 1O7LA 2JA7G 5H92C 1TIFA 1SYGA 4JIOU 3FRPB 1Q10A 4X66L 1JMLA 3A9JA 4IDIA 2OQKA 2OTLA 4A76A 1U5KA 1IPGA 2A69C 1PH7A 3GZNI 2QDBA 3IT6B 3NJTA 4F8MA 2ID0A 5AEKB 4GKKQ 2W55A 4NJCA 5FR3A 4A3DG 1SJED 2GA4B 2K9XA 2HTHA 2F0VA 2HUGA 4KJNA 3ND8A 2AUJD 3OTOQ 3PO2H 1HHVA 1EQQA 2INCC 2JT4B 4FXGC 4HPMB 2ZXPA 2IZVB 1A5RA 3J80c 1GM5A 4JV5L 4FBJB 3ONSA 1U4MA 1CM9A 3AU7A 4V0BA 2E2DC 4DK1A 2KDMA 2EPBA 4TSSA 4A3KH 4HROA 3PO0A 2L8JA 1VZ8A 2N0SB 3ZW3A 2DN8A 2BGFA 5IE8A 2E5LQ 2F0EA 5KNCA 2M8SA 2JK8A 4R4TA 4MM3A 2PI2E 4FF2A 3K81C 2CQOA 2F0MA 2SNMA 1Y1WH 1HNZQ 2IY5B 3PSEB 2B2VA 4B08A 1I4HA 1YX6B 1PH2A 1NBFC 3DOWA 2K7VA 3CU7A 3NZ3A 2SOBA 5JHBA 1TWAB 4MGKE 2MRPA 2NWGA 4US9A 3H09A 4A75A 2H88B 2WX0A 3H7PA 4RMAA 5DCNA 1OXUA 3AFQA 1S5FD 4IZ8A 4PG3A 4OO1I 4ZUIA 3BY4B 1Q7YC 3O65B 5IO9A 3SHQA 4MJSB 4I7AA 2XWJB 4DHZB 3RR5A 2UXCL 4OELB 2K14A 4PT5A 3M7NA 1KLUD 1Y8OB 2F0GA 4ODGA 1Q8KA 1J9OA 1ZPSA 4BAXA 3AI5A 1M94A 1D5XC 1R4NI 1EWHA 2LGIA 3GTPB 3KF6B 1E24A 3HM3A 2JF5A 4DV2Q 3I91A 2ZM6L 4YL8A 2K33A 2RF4A 4IFDJ 2NBFA 2PCFB 3TMPB 3KUPA 3KWVA 4R8IA 4XYQA 1EY6A 4Q0FA 2EXZA 4ITKA 4QIWE 4CGYB 1ZXHA 3KYCD 4WQOB 1GHJA 3NVYA 3T56B 2KK8A 1PZJD 2KCCA 5G3LF 2E2JH 3VUWA 3A33B 4B3MQ 1VQ6A 5TR5A 3ND9A 1VRAB 1WX7A 4LK1C 4A3BH 2EXDA 2V3NA 4G50A 1T5EA 3FKIB 2B2WC 2R93G 1EZ6A 2EE1A 3TBLD 1W6JA 1EEID 4J1MA 2KECA 1LTTD 2A4ZA 2CHXA 1AH9A 4FF3A 2ZXRA 3CP0A 3U50C 3HVDA 1Z9FA 2QCZA 1WGDA 1F2LA 5LL6S 2VS1A 1SR3A 2ICIA 4JOIA 4EE2A 3DBHB 2K5HA 4F7ZA 2N7JA 2K1FA 1STNA 2NTSA 3BZDB 4DNIA 3I4NH 2WP8J 2EYHA 1XO3A 4W9HA 3VTVA 2K04A 4N8FA 3QJYA 4DAYB 1STHA 1VQ9A 2QIEB 4FXKC 1GC7A 2GRIA 4MELA 3WOFA 3C1EA 3ONAB 4RF0A 3PMFA 1KH0A 1Z2MA 1KTKA 1UBQA 4S0RA 3ICEA 1GJXA 3E56A 5IA7A 5EE0A 5HG2A 1WTWA 4XDXA 2ASBA 1UH6A 2IWHA 2BE5C 3GE8C 3V6CB 4NW2A 2EJGC 3K5NA 3TUOA 4PZ6A 1FGUA 2WV6D 1SNQA 2ZJQA 1UUPA 5M3MG 1D2BA 1PTOH 2KOXA 4MGIE 1CMXB 3IAYA 1WWTA 4LNNA 2XGTA 1L0VB 3Q6BA 1I42A 3A54A 2D5DA 3S1NH 1ZOYB 4H0LC 4HKZE 2E76C 4AQYL 3A55A 4H7BA 1PH3A 2IGHA 1YNNC 1CQFA 4WJWA 5F2DA 2HT1A 3S14H 1C3TA 4EZLA 1UGMA 4MSMB 3GDEA 1ASYA 2F03A 4OWWB 1CQVA 1V9JA 2LI5A 1NTGA 1ZXTA 3CHBD 3ML8A 3A4RA 1ZE3D 5JXVA 2HHHL 4CJ1B 2V3SA 3H1UA 1VQBA 5G55A 5E1FA 3PTFC 1WYWB 4HXDA 3GTGB 1LTLA 4XZ4A 3D3RA 3CRLC 5LHY1 3GTQB 5E7NA 2KDIA 4UDUC 1HR0W 4KKUA 5EQ0A 5C44H 1PTOD 1ZXIA 2N9LA 5LLIA 3T13A 1BF4A 5KHOA 2R92G 1IW7C 2WXLA 4IWOA 1TS3A 2NVTH 1YNTE 1V97A 5GAGC 1WH3A 4Q5VA 4IN3A 5M5YB 2JEAI 5HGQA 4A3GH 2J42A 5CBAE 1P9DU 1RM6C 3NHHA 1HNWL 1S4ZA 2N8NA 3RLOA 1LXDA 3Q3JA 4LWCA 1BO0A 1GNUA 4IOAA 3CCRA 1A70A 3KJOA 3H7SA 5H8YE 2O6VD 1Y69U 4DHJB 3EIVA 1LT5D 4IUNA 1N33L 1WX8A 2VUMH 1PYSB 2YYZA 3CCJA 1VQ4A 1N34L 4JBMA 4MJSA 1Z5SB 2B2UA 3L16A 1UWXA 1QUQA 3CMMB 2IHEA 4OVUA 4IFDG 3WCQA 4AJYB 1XTCD 4F87A 3CMAA 2L4NA 1LTSD 1HUMA 4M02A 1L0XB 2CFMA 1RDPD 1E3PA 4G4KA 4M01A 5FO7B 2V0GA 4KMUC 1K73C 1BCPC 3KF6A 5D65A 1V2YA 3D32A 3AE4B 1KNEA 1B2TA 2WXNA 5IT9L 3RZOB 1TJEA 3HOYG 2RDHA 2MP2B 3HK0A 3M3YH 4IUUA 4JI7Q 4C56C 1K8OA 1NDDA 3L13A 4GN3B 4RM8A 3HM6X 1K83H 3S1QB 2L52A 4HCSA 1AEXA 3S1RB 1PZKD 2BYEA 3J81c 3V3XA 1U4RA 4C1NI 3ZQ4A 1EYGA 1JMCA 2AMCB 4RCOA 2PQAB 2Q8RE 3A7AB 1E0BA 2AQ1B 2ZT9C 3DCGA 1X54A 2EVBA 1LABA 5C3XA 4FF1A 1QF6A 2EYPA 5FLMG 1VQCA 2M00A 1S3OA 2EY5A 4X6AH 4YY3Q 2BKRB 3TSSA 3RNUA 1EQVA 5NUCA 4XWTA 3K59A 2IO3B 4EZKA 2F3VA 3T4AC 1Y56A 3L10B 4J3OD 3W1BA 4DAPA 3DXJC 1MGSA 2XRQD 1PH5A 3NQIA 1HQRD 1RIPA 4OIJA 5JAVA 3VYTA 2A5UA 2QC8A 3RULA 1FR3A 4OX9Q 5M5WH 4MDKE 3AECB 4EKUA 5IODA 2BS3B 3T1YQ 4KD4A 3H3VH 1BUIC 4I65A 3B2FA 3QWZB 1CHPD 1CZGA 4JI0Q 4DAMA 1LM8B 2EJFC 2LXAA 3UE1A 4A3OA 1SRUA 3I2ZA 5EAYA 2ENBA 5LMUL 1L2NA 1DOLA 3U7ZA 3PUZA 2LXJA 3C0RB 2FHTA 2OHFA 3W5VB 4P74A 2FCQA 4C7ZA 1HZ9A 1B3AA 1MSHA 1Y1VB 1QVFA 2EMTA 4DGZA 2YU9B 2FFKB 1KC8C 1VZ6A 2AEHA 2J53A 2WGSA 4DR2L 1LQBA 4O0AA 1H9JA 4BBNC 4A3FG 2EY2A 2I38A 5C4JH 3SE0A 1L4DB 4DKAC 4KZ0A 2AQ2B 1Y8PB 1X55A 1EM7A 4JW0A 3EJIA 1Y8NB 1WTRA 3AEBB 4K0KQ 1HCZA 1JORA 1YHBA 1TR5A 1NENB 5CHFA 4PV1C 2MLBA 3NWTA 5FLXE 3G71A 3S17B 1Q1EA 1EY9A 5I4DA 1G51A 1FMAD 1WXMA 2NR2A 4JI2Q 4W9GA 5AJ3Q 1WCMH 1XCTL 3AE3B 2N1WA 3BVGA 1HH2P 3E5SA 2JQOA 1J8IA 4H02A 3PLVA 2EQSA 3ZDTA 4IPDA 3V96A 4G7HC 3Q69A 2D3GA 4IC7B 4JBJA 3S16B 5H1SE 5BN5A 2L00B 1V49A 2N4FA 1L0YB 1ET6A 1LTBD 3FKIG 5C0XH 4DR4Q 5HURA 3NG0A 3OAWA 1H8CA 1KOTA 1GXDC 1AW7A 1S72A 3A1QA 5CV7A 1JE4A 1ZEQX 4QQBX 1FGBD 1B4OA 3N30A 1JWUD 4DR1L 4OHJA 2MX2A 2PVOD 3ZXRA 3BZKA 3QIJA 4F88A 1QKZA 1PRTB 2INPE 4MHEA 2JXMB 1TY0A 1OGWA 2F4IA 1IYUA 4L8JA 4AH6A 3NS1A 4KGSA 3QAQA 4HMIA 1RKNA 1JRPA 2UWQA 3A8KE 4KIKB 2VQFL 2BYTA 1LO5D 1T9HA 3CC7A 3PUYA 1PZID 2E75C 2V4DA 1S5CD 4IUQA 3R3OA 4OL7A 1KD1C 2C35B 1D4BA 1B44D 5I9OA 2BH2A 2K6AA 2QF7A 3HKZE 3W3AA 4C3HB 1RFKA 2ICEC 3EFXD 1OQQA 4A3IH 1ASZA 2F3IA 3UDIA 1JROA 1XLOA 4WJOA 2QDFA 3VYUA
chains in the Genus database with same CATH topology
2AUKA 3MA2B 1H9KA 4NDXA 4C3JG 2PW7A 2FMMA 2LHEA 4RGNA 2LHDA 4R3DA 2PIAA 1KRHA 3ITPA 1MSGA 2I07B 2MHVA 1PGBA 5A2QE 4RGMA 2XNAC 5IGFA 1DONA 1LV9A 2VZKB 3OOCA 1R7SA 2NN6I 4B9WA 3H0GB 1PXUA 4ZRQA 3M85A 2PO4A 3S2HB 2JA7B 5C2TB 3PO3B 1BQQT 1E0ZA 3SXHA 1MD2D 1TT2A 5E3FA 3A56A 1KNAA 5BMIA 1WTOA 2KN4A 2L1BA 3OPOA 1JOKA 1O80A 4OIKA 2WXMA 4HTHA 1SEBD 2K32A 3J7AF 1HFNA 1W6KA 5E4WC 1IGDA 4RH6A 4K14A 1WGKA 1OQRA 1T3QA 1V1OA 1JICA 3AMUA 2K0PA 3AB5A 2A5HA 1BUVT 1O7ZA 2KMMA 3Q8AA 3GP7A 2PPBC 1CA6A 5FLXL 2N88A 4TQ0A 1TWCB 4N9PA 1QILA 1I4RA 1ZYRC 2L12A 2WP9B 4DA2A 4X3KA 4RGOS 1TKGA 4A9AA 4FF4A 1J7CA 1ZKOA 1WTQA 2A6HD 2TMPA 3HZXA 1LTGD 1T5XD 1DM0B 4DNRB 2JEBI 5ISRA 1S5DD 2LEKA 2E6XA 4OGQC 3P20A 1EYAA 1SE2A 2WAQB 1RD9D 5FOBB 1E7PB 4ZOHC 4V190 4RGTA 1NR4A 3MHBA 5T8IA 3OW7A 3TP5A 2L5TA 1G2SA 2M9VA 5C5LA 2V4IB 1I4GA 1STBA 3EA6A 3HP3A 4HJGE 4KHZA 2G9HD 2Z4IA 3D6CA 4TRDA 5AFWA 3I4NB 1YQ3B 2MGSA 1A3VA 2A73B 5ELBA 1TKYA 2ONQA 3E6ZX 1PRTF 1RTNA 1T6BX 2R93B 2EJMA 1EEFD 1TYGB 3W2DA 3MAQA 3PUXA 5ELDA 4KY7A 1RF2D 5A2QL 3NWSA 3A8JE 2PMZB 4QUCA 2WXGA 4C3IG 1HUNA 1QWYA 1CFMA 2RQXA 2JYTA 2LY7A 4X3UA 1PFDA 3S1NB 1H9SB 3DWPA 1LTID 2XIWA 5EE1A 2BB5A 2PYKA 5I6YA 4XT3B 3DM1A 4TMAB 1E10A 3AE2B 3L9AX 3S14B 1FRRA 1N63A 3U4EG 1PLFA 4C1NK 1L6UA 4J8QA 2NN6H 3DHQA 3SDZA 1CA5A 2NB0A 3SK6A 2D62A 3QIAA 1SXTA 2EZVA 4LAAA 1SYCA 2MUYA 3OSOA 4YSZB 1FM0D 1AP0A 1VLBA 2NUCA 1FNWA 2O5JC 1PDQA 2AWNA 1KFYB 3UI3A 2EKIA 4JWSC 3J80E 1I6HB 1C4PA 3CQZB 4B9XA 1UGJA 3CWIA 1N62A 2IX0A 3IFTA 3NBHA 1PGAA 3DMUA 3TP7A 4YTPB 4KD3A 4RA8A 3KBXA 4CQNA 1K50A 3VA7A 4C3HG 1TU2B 4JK1C 1AWDA 2PMVA 1ESRA 3GTJB 1IHZA 2B8GA 3BYTB 3NE5B 4QB4A 5CC4A 3GV3A 3VR5A 3M7GA 1K83B 4IURA 1RJTA 2F0TA 4A3MB 4XDCA 1BR9A 1G91A 1OXVA 5DEHA 2Z4HA 1TY2A 3ETRA 1S5BD 1SAPA 3M4OB 2JA5B 3MXNA 4X3SA 2MJ8A 2DWQA 2K5DA 3P4SB 1SNOA 5BYSA 1F9RA 2AWOA 3ZJVA 3IFDA 4HSPA 2MPMA 2MH7A 4NZLB 1OO9B 5CV9A 2N9KA 4KI0A 2Q8IB 2K5PA 3VYSA 5KIXA 3TP8A 3QOLA 2WKCA 1D1KA 1BOSA 2NVQB 4ZK9B 1SYEA 1F2YA 4LK0M 2PZWA 3S2DB 4KKIA 1IGCA 2XN9C 2Y5CA 2B39A 3K7AB 4HSVA 3KLSX 4GDKB 3ABVB 1VR9A 2J7ZA 5BMHA 3J7AV 3PIP3 1L6VA 2RSNA 3AH7A 2HCCA 5TSSA 3D4WA 1BBXC 2L55A 4PMBA 3EVQA 1H9RA 1A6XA 4KHVA 2PQEA 4Z9CB 2M0AA 5FKAC 4AYBB 2LKVA 1PTOC 3HVZA 1HQMC 2HDEA 1H9SA 2BOSA 1STYA 1STAA 1BMLC 1N60A 4R9WA 4O42A 4ARIA 2EDGA 2F0LA 3HOVB 3J9CA 4FO2A 1C9FA 3FILB 4B0EA 1P7FA 3J80L 1PMRA 1WYGA 2WDRB 1BCPB 1JR0D 4A3FB 4FYDA 4DK0A 3RUZA 2B2YC 5DM73 3BIID 1QOGA 1F9SA 1SNMA 3MFGA 5C5MA 1ZDVA 1N5WA 4WIPA 3MEHA 3W1SA 5C3EB 1A15A 4DXFA 1DZ1A 5IT9E 5E6JA 4TQUS 2KQ4X 2B2WA 4REZA 2KA7A 2YEPB 1CHQD 3T3NA 3MVVA 4XDDA 4J6HA 2A68D 2J52A 3MHZA 2K28A 5A35A 3N9YC 1K52A 4LMQD 3R2TA 1J7BA 5DNFA 4US8A 5KGUA 4RNAA 5IIFA 3GTMB 2D5GA 1DXMA 1C78A 4QMGA 1C8CA 1EU4A 2F0PA 3RLFA 1XF5L 4PMCA 1HTPA 5BYQA 3BK2A 4RWSC 3NPPA 3RMHA 1SIJA 1Z47A 4WURA 4C3JB 1O78A 4RHSA 4A3EB 3GTKB 3J81E 1Z7TA 5IGBA 2KUMA 1L4ZB 1NAPA 3KK7A 5T1IA 4XXEA 1BXTA 3FAHA 1CT1D 4K6LA 1QG7A 3C2PA 3HOUB 1HZ6A 2PZTA 1GUTA 3KQ4A 3H3VC 4K8JA 5C0XJ 3LX0A 3SK4A 4C2MB 3SVMA 1FRDA 1ILPA 3D4DA 5C4XB 3BDLA 1VCIA 3G6JB 1EZ8A 2LMCB 3U9SA 2E2HB 3VRBB 4OO1G 5C0XI 3GTLB 1F9QA 2JA8B 3H6MA 3W9CB 3K6OA 3HEJA 3C46A 4HN7A 5FO9B 1HZ5A 2BA0A 2ZW1A 2K05A 3NXWA 1S5ED 5EE3A 2FJ2A 3HOZB 3E9SA 3OMCA 5CV8A 3AE5B 2Z1CA 2QILA 4OW0A 1MHHE 1AFPA 3FILA 4LLGM 3NP8A 3IAS1 4A90A 1C4CA 5IGCA 3MTSA 2O4XA 3MC0B 1QLBB 3IL8A 3Q8BA 1I4XA 3AN1A 1GUSA 3QG1A 2AQ3B 1BNZA 1NVID 1PUTA 5EPLA 1FD7D 4P16A 1E6EB 2JA6B 3AV8A 1BCPF 1RHPA 3GQBA 3GO5A 4A3JB 4TKOB 3SEBA 2NVXB 1NEKB 2BA1A 2KEDA 4CJ2C 1I4PA 2H4OA 1E9MA 5EKLA 5G3LD 4DQOC 5JPNC 4EE2A 1ENAA 4HMJA 3HKZB 4M8AA 4YTMB 1ZUD2 1XLQA 1SBBB 2F0IA 4DU9A 2K3UA 3FDTA 1QJOA 2F0UA 3P7JA 2F3WA 4N58A 1YMHE 2YEPF 3QO2A 1HEZE 3PZ7A 2ACZB 1EY0A 4U673 4KKTA 1DGJA 4O1NA 4K5VA 1YN5A 4Q2JA 2XWBB 3J81L 1N61A 3NTHA 2L32A 2TSSA 1OXTA 2CU3A 2WXFA 4HEDA 3AM9A 1P7EA 2WNMA 2BDNA 1GOZA 1PFNA 4CKCA 3MXGA 5IOCA 1AN8A 4N59A 4ZKBB 4C3IB 1U9RA 3FMCA 3MXUA 5M9OA 5J39A 3VR4A 1EFID 2W82A 4XQJA 2E3TA 1V8CA 2WXQA 5CBEE 1ZP0B 1JALA 4N6EB 1XEEA 4WORA 2JP1A 1FFVA 5KRUA 2A6HC 1V1PB 5JJZA 4M1UB 2D2CC 3RZDB 4HRSA 4ZRZA 2LMCA 3HS0C 3GD7A 3HRZC 1ML0D 3HG9A 4G7ZC 4RCNA 2VXWA 4K8IA 3VR2A 1SYDA 3X3MA 2I2YA 3F2UA 4NKLA 1TKEA 5AUKA 1EY8A 5EKIA 2JWUA 2IGDA 3S9WA 3FPUB 4YXDB 2HQEA 3KBGA 1Q12A 1M4VA 1SMYD 3C3LA 1QQRA 4MIUA 4EGVA 2NTTA 2XRSD 1PDXA 3P4QB 3A7LA 1PYWD 1DCZA 4ZRPA 2DY8A 1KLGD 3MXPA 4KN4C 4BA1I 1QNUA 2KQ3A 5M3FB 4ID6A 1VMCA 4H44C 3MFYA 1JW9D 2WIIB 2FMCA 4NAWB 5C3WA 5IGGA 4KN7C 1OXXK 2A6ED 2M56B 2LFNA 3EUB2 2BDOA 1DOXA 2FINB 4AS1A 2F0QA 3QB3A 2H1EA 4KY6A 2B76B 1WD1A 2WXRA 5CV4A 3SFEB 1SNCA 2Y0SB 1YJIA 3PO2B 4L6TB 2KEEA 2RSOA 1C77A 5BYRA 4PQXA 3HUIA 4A55A 1LT3D 4R8NA 4IKGA 4OZAA 4F7XA 4A3KB 3AEGB 5GXGB 2M2LA 1ET9A 4K5WA 2KJXA 3W5UB 1MI0A 1Y1WB 3TP6A 2RKSA 1V43A 1HRJA 1II3A 1OFFA 3KWLA 2F0HA 4USAA 2K01A 1CZWA 3LB8C 3L4PA 1MVKA 3TEXA 4FNFA 5BN3A 4IOIE 3MJ5A 1SSOA 1RYJA 4ME5A 4JE3B 1QOFA 1NCVA 3P1HA 1EIHA 1I7HA 4U68A 3GV6A 3TMEA 3T16A 3NSWA 4XYOA 2O2LD 2JSVX 2WKDA 3WDNA 3I4LA 1FO4A 4C7YA 3DEOA 1I6VC 2JSOA 2IJ0A 3D8GA 4DFAA 2DYOA 3Q8EA 2BS4B 1X3PA 3EROA 2G9DA 3Q22A 1V1PA 4ILWA 1TQOA 2E2JB 1DOMA 1WVLA 3PUVA 2HCIA 4X3TA 4A3BB 3AE1B 5G5HA 3AE9B 2X38A 2FUG1 1C4AA 4ZYSA 1EY5A 3I4MB 2R3ZA 1R4PB 1SE4A 1Z6HA 4L63B 1JOOA 4GZYC 2SNSA 5K36H 2FBWB 2CW0D 1ZDXA 1SYFA 5K5PA 1YN4A 1F2ZA 3WOEA 4HEA1 4JWUC 1STEA 4XWWA 1SNDA 4YSXB 4KV6A 1WD0A 3OIPA 3RD4A 2A74C 2PKOA 2B8FA 3LWUA 4EQPA 1KDAA 3SFDB 2L9HA 2NN6G 5I2XA 3KLRA 3AMZA 1UWMA 2RPVA 3DEPA 1XXGA 3I72A 2DY7A 2QJLA 2LS01 1NR2A 4CKEA 1PTOB 1B50A 2V3PA 2RMMA 1F2MA 4LJZC 3NRZA 3GS2A 5CGKA 2E74C 2CJNA 4C80A 1SE3A 2WDQB 2HDLA 1O7YA 1C48A 3TEZA 2MEKA 3B9JA 3D4RA 1R4QB 4ZLTF 3NVZA 2R61A 1G6ZA 2OEDA 2IW3A 4HCEA 3AEEB 4JPSA 3OMGA 3G7LA 5C44B 1QE6A 3VYRA 1TKWB 4CBVA 3TEWA 2HDMA 2NVTB 2CHBD 2F0KA 4WFN3 2NVYB 3P1MA 3FVQA 4A3GB 1VF7A 1XYIA 2ZW0A 1Q1BA 5BN4A 3Q24A 1DD2A 2VUMB 5HFYA 2OXPA 5COYA 4D2KA 2SDFA 3Q0AA 3U2SC 2Q8TA 5JEAH 3N52A 1UAPA 2F0JA 1ENFA 2A68C 1VDVA 5KNDA 3K5LA 3M3YB 2DLBA 2NYZD 2IT1A 2BT6A 1AYFA 4ULLA 1RCVD 1EWYC 5EPKA 2B2TC 3RPFC 1VF5C 1PGXA 3P75A 4QIWB 2EYFA 4WQMA 3TZDA 4NAMA 1FEHA 2JZPA 2KCNA 4UAIA 4PMWA 3IAM1 3R8BA 1KDBA 4WH4A 1B53A 1WSPA 4IALA 1SNPA 1Q3LA 2W54A 2L0CA 1FNVA 1D1IA 1QNKA 4P2CB 3CIRB 2DBYA 3FEWX 1UNSA 4OVZA 5M5WB 1EYDA 2DYMA 5CV5A 1CI3M 2EOTA 1XCQL 2WDVB 1C79A 1ICWA 3NUCA 1TS4A 2IDYA 2VB2X 2H89B 1K53A 2R6GA 1PRTD 3RFZB 1A3TA 1EOTA 1CK1A 1PFMA 1LTAD 1FIQA 3OWFA 1C4QA 4BS9A 3KLSA 2PTLA 1YNJD 1MHXA 5JOBA 1J7AA 3T51B 3NVWA 1A3UA 1A2TA 1Q8IA 5C4JB 2Y3AA 1AZPA 1FFUA 2RA4A 2BW2A 3EQLC 1WCMB 1PTOF 2OT2A 2LJIA 1HA5A 1JWBD 1E2WA 2N55A 3V2TA 1JWAD 3GB1A 3BVMA 4GDLB 4NMZA 3V05A 2B2VC 2B2YA 2VZKD 2WS3B 1X3QA 2VNUD 3LNNA 3BYYB 4WRDA 2WU2B 4G57A 4E6IA 3AE6B 2NZ1D 5EGTA 4FXDA 4CJ0B 1SYBA 4RHRA 4S3SA 1B9NA 2BB6A 5KYLA 4A3IB 1RTOA 5E4XA 2OEOA 1GAQB 2JX5A 4H2AA 5CMDA 5JPMC 1E2ZA 1OXSC 1WTPA 4BBSB 4XIGS 2EY1A 1JQ4A 3P4RB 4KKSA 4IFDI 3FC4A 1MI2A 4GLSC 1M8AA 2KWDA 3BG3A 2GI9A 1E2VA 3LYYA 2NMQA 4CHTB 3AB9A 2FE8A 2J0TD 3BDOA 2R7ZB 3PUWA 5AUIA 4DNTB 2WINB 1IL8A 4HKQA 4OZCA 3VR6A 3SK8A 4YWGG 4MACA 5J22A 5EPJA 1KABA 4L2YA 1JB3A 2KOLA 2F0FA 3L7ZC 2SEBD 2A69D 3U9OA 1LT6D 3BVZA 1ROEA 2BTEA 3VQIA 2WB1B 5FK9C 3GTOB 1D5ZC 2MJ3A 1SDFA 2C9OA 2EY6A 2EYLA 2QKIC 2SAKA 3SK5A 1NI3A 3I90A 5G5GA 2J4XA 1ONLA 4KGTA 3ZGZA 3VRAB 3A8IE 2IX3A 4ZKCB 5JVG3 1VDZA 4ZHPA 3I57A 2ZXOA 1SMYC 2INNE 1GB1A 1HFGA 5C4ZA 4P6VF 4KJOA 3NTIA 2EELA 1ENCA 2Q5WD 1JCKB 2MP1A 4HAEA 4KY5A 4XE0A 2RDGA 1F0ZA 4WAFA 2JU6X 4OO1H 2MJDA 3I70A 3MP9A 1GB4A 3NTKA 2A6EC 3T53B 1LTRD 2B2UC 3I8ZA 5HHDG 2KHSA 2QSDA 3NBIA 1FCCC 2WXJA 2X6LA 4KK7A 4A93B 3SHLA 1DOKA 3HRDD 1D6EC 2JYOA 1WRIA 5CR3A 1LLRD 1TWGB 3OIQA 2L83A 3D31A 1IBXB 2WXPA 3IKJA 2K5WA 5C3JB 5I2YA 1AZQA 4IFDH 4KGRA 3I9V1 2QCPX 4ZAIA 2W3RA 2K5QA 3QWNA 5DAUA 2HTME 5C4HA 3PZ8A 2WQYB 3DWGC 4RFBA 1SB3C 5J1ZA 5CV6A 2CVRA 2BS2B 2F0WA 4IUPA 3DWQA 3QOJA 2Y5PA 4K6DA 3TZUA 3P42A 5JVH3 4DAYA 5C0XG 1RODA 3B2GA 3C1FA 1NYQA 2PNRC 5EBCA 3S15B 1F77A 3BS1A 3TN2A 5MPOA 4YIJA 2BE5D 4XT1B 4ARCA 5KNBA 1C76A 3FPPA 1VMPA 1DYQA 3NVVA 1XWEA 2F0DA 5D3IB 1DJRD 3NK9A 1LT4D 3D6WA 3CKIB 4XQQA 1GHKA 1YNND 4BY1B 2JE6I 3PV0A 1TS2A 4YT0B 4A8XC 1WTXA 1NYRA 4FXCA 4OZBA 1KAAA 2B63B 1EQTA 1G291 5ELFA 4RKBA 1YN3A 4I7ZC 2QEJC 5FO8B 1B1ZA 1JC7A 2M19A 1K8MA 5KEEA 2WXIA 3M4YA 3VR8B 1I3QB 1IW7D 1ACCA 1WTVA 5LL6X 1KF6B 2CW0C 4ZUJA 3Q8FA 1GUGA 3K57A 4DF7A 2EYJA 4RF1A 5EJWA 3BWUD 1WXQA 4LTUA 1JQYD 1TZOA 2JYEA 3OWEB 2DNCA 3AEAB 4YTNB 4NP5A 2EYMA 4G7OC 1IKLA 3K5OA 2O5IC 2PVGC 1B9MA 1FXAA 4Y7NB 1FYCA 1BCPD 1DOIA 3H91A 1GUWA 3URYA 1PFBA 1ESFA 1EL0A 1HTLD 5ELEA 2WU5B 1V8QA 2PW9A 5EKKA 3J7YW 1SF0A 2PLPA 4IUTA 1A2UA 2D9UA 2KAJA 1UEAB 2WLBA 1JWMD 3TDQA 4DXGA 3OHXC 1EY4A 5I6WA 1IBXA 4HR7B 5DM63 1U4PA 2ON8A 1TS5A 3P4PB 2WXKA 1TVXA 2GB1A 1EU3A 4H13C 4JBWA 4XQNA 1HPCA 4IQZA 1SJHD 2PW5A 5JEAJ 5D3DA 2CQAA 4BBRB 5IGEA 1IUEA 4JX1C 1TWHB 3LXFA 4RKLA 1K51A 1QOHA 1HXYD 1CTMA 4EQNA 3VA5A 1MBYA 3L3OC 1FXIA 4A3DB 5D7GA 3HOWB 2DNEA 1GUNA 1QB5D 1YQ4B 5EBDA 1G2TA 1ILQA 3VR3A 3R2IA 2BBCA 2X69A 1R9TB 3TEYA 3AEFB 3DUZA 3K0YA 1XX8A 5K36G 4MT5A 3Q6SA 3ERQA 3Q8CA 3NQTA 5T1GA 3KF8A 5CORA 4MH8A 2KACA 1H9MA 1IKMA 3DWAA 2OF1A 1QT9A 4TQ1A 1FNUA 1B9RA 3EGRA 4PNYA 3AE8B 2CJOA 5M5XB 4M0WA 2RBMA 1BDOA 1F2RI 2QMTA 2LUMA 2W3SA 3S1MB 4KKJA 1DOYA 1IYVA 4FVMA 3I73A 3HGBA 4EVOA 5KYIA 1X32A 1N5XA 4L23A 1Q90A 3JAME 2BCOA 3H8HA 2RVLA 1CZPA 1PRTC 3BK1A 2F1MA 4QCLA 4DN4M 2JQRB 1XLNA 2IX1A 2K1BA 5ELCA 3LWEA 4FP5D 2X6GA 2JXTA 3HOXB 1VJKA 2Z8LA 1YNJC 3N6RA 3P63A 4EQOA 4K2KA 2XSCA 1RWSA 1EY7A 1F2RC 1KDCA 2WACA 4ABNA 1QOBA 3T3OA 4MM3B 4MN3A 1XLPA 1TIID 4N9TA 1L5PA 4KTAA 5IGDA 2IPKD 4QUFA 3ZJTA 4YSYB 2IL8A 5JEAG 4WWMA 3U52E 4ZHOA 5D14A 2K22A 3H94A 2C5CA 3NUHB 2LFIA 4L1BA 1TWFB 1GPXA 1YJJA 2K03A 1GUOA 2XVSA 2WXOA 1SFOB 2F0NA 4ZQ3A 2AX5A 3ZYYX 4BA2I 2KVMA 3UI2A 3I3CA 5M3MB 1HA6A 3K58A 1MPEA 5BMGA 3R93A 4AQ7A 1G8ZD 1QOAA 2G1EA 1FCLA 1U4LA 4BWGB 3X3NA 3BDCA 1F9PA 4BY7B 2IGGA 3AE7B 4B0MA 1CJEA 2B2TA 2I46A 2RDFA 1FD6A 3CRKC 1I50B 2F0OA 3SR1A 3K5MA 4XTCS 5LNK1 1SSNA 1ZYRD 4K2LA 5C6AA 1EIGA 1STGA 3C8YA 3IXSA 4DAVA 2R92B 3TBIB 3Q23A 3DWMA 5HGTA 5I9PA 2E2IB 4QF4A 2L1AA 1LACA 1EWCA 4IUVA 2VB3X 3AEDB 5EE9A 1JOQA 1EYCA 1D5MC 1I4QA 4RAUC 1QCBD 3ZJUA 5HI1A 1VZ7A 3MZ5A 3MWYW 3IT4B 1NUCA 3O13A 4KX6B 4K5XA 3PIO3 2F0SA 2WXHA 3SR6A 5CYUA 3JAML 1NSNS 3E0JA 3VR9B 1JWSD 4A6QA 4CKBA 2EYOA 2L11A 2PZUA 2MJEA 3HOYB 1O7LA 5H92C 1SYGA 3FRPB 1Q10A 1JMLA 4IDIA 2A69C 3IT6B 2QDBA 4F8MA 2ID0A 2W55A 4NJCA 5FR3A 1SJED 2GA4B 2K9XA 2F0VA 2HUGA 4KJNA 3ND8A 2AUJD 1HHVA 4FXGC 2ZXPA 1U4MA 1CM9A 3AU7A 4V0BA 2E2DC 4DK1A 2KDMA 2EPBA 4TSSA 4HROA 3PO0A 1VZ8A 2N0SB 2DN8A 2F0EA 5KNCA 4FF2A 2F0MA 2SNMA 2B2VA 4B08A 1I4HA 2K7VA 3CU7A 3NZ3A 2SOBA 1TWAB 4US9A 2NWGA 3H09A 2H88B 1OXUA 1S5FD 4IZ8A 4OO1I 4ZUIA 2XWJB 4PT5A 3M7NA 1KLUD 1Y8OB 2F0GA 4ODGA 1J9OA 1ZPSA 1D5XC 1EWHA 2LGIA 3GTPB 3I91A 2K33A 4IFDJ 2NBFA 2PCFB 3KUPA 3KWVA 4R8IA 4XYQA 1EY6A 4Q0FA 2EXZA 4ITKA 4CGYB 1ZXHA 1GHJA 3NVYA 3T56B 1PZJD 2KCCA 5G3LF 3ND9A 1VRAB 4LK1C 2V3NA 1T5EA 3FKIB 2B2WC 1EZ6A 2EE1A 1W6JA 1EEID 4J1MA 2KECA 1LTTD 4FF3A 2ZXRA 3HVDA 1F2LA 5LL6S 2ICIA 2N7JA 1STNA 2NTSA 3BZDB 2WP8J 2EYHA 1XO3A 2K04A 3QJYA 1STHA 2QIEB 4FXKC 2GRIA 3WOFA 3C1EA 3ONAB 4RF0A 3PMFA 1KH0A 1KTKA 1GJXA 3E56A 5EE0A 5HG2A 1WTWA 4XDXA 2IWHA 2BE5C 4NW2A 2EJGC 3K5NA 3TUOA 2WV6D 1SNQA 1UUPA 1D2BA 1PTOH 3IAYA 1WWTA 1L0VB 3A54A 2D5DA 1ZOYB 4HKZE 4H0LC 2E76C 3A55A 4H7BA 2IGHA 1YNNC 1CQFA 4WJWA 5F2DA 2F03A 1CQVA 1ZXTA 3CHBD 1ZE3D 5JXVA 4CJ1B 5E1FA 3GTGB 3D3RA 3CRLC 5LHY1 3GTQB 4UDUC 4KKUA 5EQ0A 1ZXIA 1PTOD 2N9LA 3T13A 1BF4A 1IW7C 2WXLA 1TS3A 1YNTE 1V97A 4Q5VA 4IN3A 5M5YB 2JEAI 2J42A 5CBAE 1RM6C 3NHHA 1S4ZA 1BO0A 1A70A 5H8YE 1Y69U 1LT5D 4IUNA 2YYZA 2B2UA 1UWXA 3WCQA 4IFDG 1XTCD 4F87A 2L4NA 1LTSD 1HUMA 1L0XB 4G4KA 1RDPD 2V0GA 5FO7B 4KMUC 1BCPC 5D65A 3AE4B 1KNEA 1B2TA 2WXNA 5IT9L 3RZOB 1TJEA 2RDHA 1K8OA 4IUUA 4C56C 3S1QB 2L52A 4HCSA 1AEXA 3S1RB 1PZKD 3V3XA 1U4RA 4C1NI 3ZQ4A 4RCOA 2Q8RE 3A7AB 1E0BA 2AQ1B 2ZT9C 2EVBA 1LABA 5C3XA 4FF1A 1QF6A 2EYPA 2M00A 2EY5A 3TSSA 1EQVA 5NUCA 4XWTA 3K59A 2F3VA 3T4AC 1Y56A 4J3OD 4DAPA 3DXJC 1MGSA 2XRQD 3NQIA 1HQRD 4OIJA 5JAVA 3VYTA 1FR3A 3AECB 5IODA 2BS3B 4KD4A 1BUIC 4I65A 3B2FA 1CHPD 1CZGA 2EJFC 2ENBA 1DOLA 3U7ZA 3PUZA 2FHTA 2OHFA 3W5VB 4C7ZA 1MSHA 1B3AA 1Y1VB 4DGZA 2YU9B 2FFKB 1VZ6A 2J53A 1H9JA 2EY2A 2I38A 3SE0A 1L4DB 2AQ2B 1Y8PB 1EM7A 3EJIA 1Y8NB 1WTRA 3AEBB 1HCZA 1JORA 1NENB 1TR5A 4PV1C 3NWTA