4RGMA

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
total genus 62
structure length 223
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgmA01
1I4HA 1PZID 1FNVA 1UNSA 1AW7A 2AQ2B 5FKAC 1I4PA 1EU3A 4C56C 3R8BA 1SBBB 4ZYSA 5TSSA 2AQ3B 1TS5A 2CHBD 1DJRD 3DWQA 4O1NA 1PTOH 1FNUA 1JWSD 2J4XA 1AN8A 5D3IB 2IJ0A 1DYQA 1B44D 2NTTA 1YN3A 2NTSA 4BWGB 4L63B 1CHQD 1KTKA 1TS2A 4OHJA 1JWMD 4TSSA 1PRTC 5ELDA 1D6EC 2G9HD 1PYWD 1PRTD 1PTOB 1TS4A 2XN9C 1LTAD 1QILA 2AQ1B 1UUPA 3R2TA 1YN4A 3OWEB 1HQRD 3BYTB 3CHBD 1LTID 3TSSA 1KLGD 4RHSA 1HTLD 3EA6A 1RD9D 4K6LA 4RCOA 2QEJC 3O13A 3R2IA 1LTTD 1KLUD 1PTOF 5FK9C 1RDPD 5ELCA 1LLRD 1FNWA 1RCVD 1M4VA 1ET9A 1TY2A 4RHRA 1CK1A 3DWAA 1LTBD 5D3DA 2RDHA 2R61A 3BYYB 1D5MC 3GP7A 1EEFD 1SXTA 5ELFA 5I4DA 1F77A 1L0XB 1FGBD 1BCPB 1S5FD 1D5ZC 1SE4A 1JQYD 1SJHD 1T5XD 1BXTA 1LT3D 3BVMA 1LT4D 1FD7D 1PTOC 2QILA 3V05A 2XRSD 1I4GA 1S5ED 3BVZA 3URYA 1LTSD 1PRTB 1CQVA 1ET6A 1SJED 1SEBD 4Z9CB 1TS3A 1I4XA 5ELEA 1L0YB 3DWPA 2RDGA 1EU4A 1SE3A 1ENFA 1JCKB 1V1OA 1CHPD 1ESFA 1LT6D 1V1PB 2Z8LA 3BZDB 2XNAC 5ELBA 1TY0A 4RGMA 4RFBA 2XRQD 2TSSA 1STEA 1CT1D 4NZLB 1YN5A 2ICIA 4UDUC 1RF2D 4RGOS 1PZKD 1PTOD 1JWUD 1EWCA 1LO5D 4RGTA 1G8ZD 3MC0B 1BCPF 1LT5D 2IPKD 1B1ZA 4RH6A 1S5DD 1EFID 2SEBD 4DXFA 2WV6D 1MD2D 4L6TB 1XXGA 1V1PA 1S5CD 3MFGA 3EFXD 1PZJD 1JR0D 1D5XC 2O2LD 1I4RA 1I4QA 1LTGD 1GOZA 3BVGA 3KLSX 4RGNA 1BCPC 1LTRD 1HA5A 1HXYD 1XTCD 1SE2A 1BCPD 1S5BD 4DXGA 1PRTF 1EEID 3W2DA 3SEBA
chains in the Genus database with same CATH superfamily
2ZCCA 3OJ4B 4HPPA 2PLPA 4DUYL 3V61A 4K0KL 1LUZA 3MJ5A 1E7ZA 1J5EQ 1D1IA 4OX9L 1KDAA 5EAYA 3R8BA 2EMTA 2D0PA 4ZYSA 3PMFA 3GTPB 3TBIB 3N52A 2CHBD 3H0GH 5C0XJ 1WTQA 1ASYA 2R6GA 3PZDA 5LLIA 1L1OC 3FP9A 1QG7A 4OWTB 3RR5A 3CC4A 3ZNZB 4NNJB 4P71A 3IXSA 3GTMH 3VHTC 4ABNA 1TR5A 3OG5A 1TS2A 1TVXA 1P98A 1TWHH 3LGJA 4TRDA 2VUMB 1J7BA 3VDYA 2LUMA 1PTOB 4K3CA 2JXXA 3NTHA 4IKGA 1TWGH 4KN7C 3A54A 5M3FH 1E8WA 4CDDC 2UXBL 2F0IA 2H1EA 1T0SC 4UHVA 1IBKL 2NZOA 5A35A 1K9MC 2HHHQ 3FPUB 1U4PA 4DAYA 4IFDH 3RFZB 2L0CA 3AECB 2D0OA 1VQ7A 4C4VA 4FNFA 4IURA 1JALA 5DM73 3IT6B 3M4PA 1ZXIA 1WX8A 1EFWA 2X6GA 3MXPA 3J80i 1F2ZA 3HOWH 1G91A 4BY7G 3Q8AA 4YY3Q 4DF7A 4XDXA 2WAQE 1G6PA 4DFAA 3S16H 2IO3B 2LRWA 1A62A 1IBKQ 2HHHL 2EXZA 4LFAL 4DR6Q 2GBKA 3HOUB 1LTBD 1SNPA 2F0TA 2INDC 2O4XA 2R61A 4ZQ3A 4LNQA 4DR4L 3P63A 4FN2A 3GP7A 2KEEA 1L2NA 4JIOU 4N6EB 4A3KH 2BH8A 1S1QB 3BZCA 2JWUA 5EE0A 4JVZA 4CGYB 2JWZA 2JYEA 1J0GA 4DR4Q 4IW0A 2G4DB 1STGA 2KUMA 1WTXA 3FRPB 2MP1A 2JA6G 2KDIA 2X6LA 1X3GA 2FMCA 2KVRA 2VQFQ 4K5XA 5KIXA 3BVZA 4LF5L 1NR4A 5EKKA 1EQQA 3H3VI 1IBLQ 5KEEA 4K81A 1Q7YC 3M3YB 1EZ8A 1KAWA 4A20A 3CKIB 2B63H 3AN1A 3QARA 5CTRC 3BZDB 4E3CA 3VFKA 3H0GG 4X66Q 5BO4B 1N32L 2F3VA 4NXNL 3ZJVA 4BBSH 4A93G 1MJEA 1R4PB 4MEMA 1JB7A 3RN2A 1BQQT 1BO0A 2N8NA 2ZXPA 1T0RC 2GRIA 4BY1G 4UDUC 1Q90A 4RGOS 4BZAA 2EYPA 2L1BA 4BBNC 3BK1A 1HZBA 4NMZA 5A2QL 2BKRB 2DZKA 3DWMA 4A3DH 1T5EA 1V8QA 3K7UC 4LMQD 5DAUA 2Z59B 3D6CA 4W9JA 3I70A 1WR1A 4ZK9B 1V43A 1WGHA 1VQ5A 1GHKA 5HG2A 4DR5L 3A7AB 1HZ6A 1ZUD2 2V3PA 4KSKC 2J42A 1E7PB 2K5PA 1ASZA 1KXLA 1S5BD 5COYA 4PMBA 1V8CA 2H88B 1N63A 3I3CA 2C35B 3K5NA 1B53A 2ASQA 4X64L 1JW9D 1FNVA 2LFNA 2WX1A 3A33B 1V81A 3AE3B 5KHOA 2UU9Q 4AYBG 1A2UA 5FKAC 4JYAL 1MG4A 2K32A 1DOMA 3CCUA 1JJ2A 2DNCA 3KUZA 4JGHB 3IFWB 3WAPA 3DWQA 4ZUJA 1BR9A 5GAEC 5CV9A 2IY1B 4KGRA 1ICWA 3KJOA 1HNXL 2PE9A 4HROA 4HVBA 5L95C 5BYSA 1RFKA 3PUYA 1PH7A 4YSZB 2K5WA 4E74A 4YWMA 1TZOA 1XMOQ 1WI5A 3A8KE 3GTJH 4DHZB 5FO9B 2JU6X 4OHJA 4C3IG 1P1AA 4DR2L 4BY7B 3DHHC 1HPCA 3PIPA 1VQLA 2AX5A 1JWBD 4J3OD 3Q14C 4R4TA 4GLXA 3PUXA 4XT1B 5HI1A 2C7MB 2B2WA 1B9RA 3SK6A 4B0MA 2K5DA 1PFSA 3TP8A 3SDLC 1JWAD 4KY5A 3T9LA 4A3IH 2JA5H 4YWLA 3E9SA 1HHVA 3T53B 4QJFA 4RCOA 1R9TB 1HNZL 5BN3A 2K5QA 3AB9A 2ATWA 4LFCQ 2M56B 2WXHA 3T56B 4M02A 2PMZE 4FADA 2CKZB 3NUCA 3V60A 1KNAA 1NBWA 2GA4B 3L17A 4JBMA 1VJKA 4HPLB 5G2NA 4XWWA 4IPGA 3S14H 2GN5A 3N1XC 3DVNU 2R93G 1P8LA 5J2RA 4LCDE 4R9WA 2Z9HA 4HEA1 2NVQB 2PE6B 3Q8CA 1S4ZA 1KH0A 3P4QB 3RPFC 3L08A 1QLBB 3FPPA 4WURA 4YWGG 3RMHA 1L4ZB 2E74C 1KDBA 3T3NA 1WD0A 1F2YA 4NJ6A 1KL9A 1Q1OA 1FR3A 5JOBA 1I4GA 1S5ED 2ZTEA 4LUVA 1FRDA 2IGGA 5IGEA 1QZGA 2ES2A 5CBAE 2Q8RE 3TQYA 4TQUS 1V97A 3HOWG 3VTVA 1CZGA 5K36G 1DOLA 2J0TD 5ELEA 4LDTD 3HKZG 3Q3OC 1QOFA 3PZ7A 1KLVA 1A5RA 3DVGY 2FCMA 3QOJA 1V1OA 1IPGA 1K0SA 4A3FG 2KN4A 4TV3A 4RKBA 2KK8A 2F0NA 1LXDA 4IUUA 4D2KA 2DAFA 1EY5A 4A3GB 1FCLA 3NQTA 3MJWA 4RM8A 2BT6A 2M1MA 2K0PA 3N20C 4HJ5A 2N1VA 3ZLZA 3I72A 3A9JA 4ULLA 3AU4A 1OQRA 4JI6Q 3CWIA 3MWYW 3PV1A 2ZW0A 2HCIA 4YHHL 4B3RL 5JHBA 2C9OA 1F9PA 5C44H 3F2CA 1STAA 2FUHB 1G291 2D62A 5EKIA 5IYBH 2R93B 3NTIA 4W9DA 1EIHA 4APVA 4TKOB 1JR0D 5KYIA 1CKNB 1J8CA 5JJLA 3BVGA 1Z5SB 4K1RB 3B6YA 4Y7NH 2YVCA 2L9HA 3HKZE 4KMUC 3L16A 2JA5G 1TZ1A 5IODA 3FHWA 4YCWA 2NVXH 4B95A 1C9OA 2M9VA 5JEAJ 1TWAH 2K52A 1TT5B 1UNSA 3DPDA 4HAEA 1ILPA 1DGSA 2D07B 1P3QU 2R7ZG 4ZUIA 3L3OC 4M1UB 4NW2A 1VF5C 1CSPA 1XEEA 3AEVA 2J0JA 4IWPA 4EX5A 2VXWA 3EC8A 3K9OB 2SAKA 4DWFA 1WYGA 1KRSA 3GTPH 3U7DA 3GTLB 2RPQA 2AWNA 3STBD 1R4NI 1VQKA 3J81L 4N9TA 5J22A 2E2IH 3OPOA 1X6OA 4XQQA 3P1HA 3BS1A 1SNOA 1EY8A 3Q24A 3S1NB 4IOAA 2V4LA 3ZGZA 1I42A 2NVXB 4X6AH 2ASBA 3KJPA 1YHQA 4DV6L 1TS4A 1KNEA 1GAQB 4TVAB 1K8GA 4LLGM 1VF7A 1KABA 2VUMG 1E7UA 3AEDB 1NYRA 1YN4A 4OZAA 1RRBA 4K5VA 1E6EB 2KX3A 2WXOA 1KC8C 4PK1A 1DCZA 1FRRA 1EWHA 4IOIE 4A3JH 3N6RA 1HR0L 1RTOA 1WX9A 3L7ZC 4X3KA 1YJ9A 2JEBI 1M1KC 1RD9D 1XMOL 3A1QB 3MXNA 3T1YL 3A9JB 2OEDA 1VQMA 1WYWB 5JJKA 4WORA 1EY9A 3H15A 1HTQA 2L15A 5JEAH 4A3EG 1MHXA 2MEKA 1VMPA 1Z47A 4XYQA 3CSFA 3J9CA 3J80c 2WB1G 3WALA 1LLRD 1FNWA 3IFDA 1D2BA 1BNZA 1X56A 3D31A 1N36Q 3TEXA 2KECA 3HFZB 1SYEA 1RL2A 3K57A 2B2TA 2CR5A 2CJNA 3PPAA 4PYZA 2BBCA 4WH4A 2LMCB 1SNDA 3L9AX 4C2MB 5D14A 5JJIA 1QT9A 3D8GA 3P7JA 1Q46A 1SR3A 3S2HH 4JI0L 2FIDA 2VQEL 4KKTA 4X62Q 2LD9A 3LNNA 4HIDA 4UP9A 3NUHB 1XQQA 3URYA 2JT4B 1Q1BA 3QG1A 4AH6A 5HURA 2W9NA 3MA2B 2EYOA 3QO2A 1CA5A 2RMMA 1WX7A 2MCNB 3BWUD 3KK7A 3TS2A 3UQBA 4A3IB 1UEAB 2KACA 4W9CA 3S9WA 4WJ4A 2X8XX 1Y8RC 3UE0A 1L0WA 1R4QB 4BAXA 2I5HA 1DZ1A 4JI3L 4URKA 4NZLB 2BWES 3TP6A 2NPTA 3Q22A 3KDFA 3DMUA 3NBHB 1E90A 1DD2A 2K01A 2QDLA 3AB5A 1M8AA 2KBNA 2OTJA 2ZT9C 3MC8A 5JJZA 3CP0A 4G0NB 3ULJA 1YQ3B 2YEPF 3B08A 4R3DA 2AUJD 3PGZA 4LF7Q 1SSOA 2GBJA 5CHVC 3W1BA 5LXHA 2MP2B 1GKHA 4IUPA 5C1ZA 2ONQA 2KVMA 1N8RC 1WMHB 2RA4A 2WNMA 4MZ9A 3I55A 2Y5BB 1BUVT 4EUTA 1B9MA 1SNMA 4YSXB 2UXBQ 4C1NK 1MHHE 3B2FA 5G5HA 1V49A 2KDBA 4KKJA 1PRTF 2OXPA 3H09A 2DNFA 3NXWA 1VS0A 1ZKHA 3RD2A 2MWSB 1XJVA 4GGQA 2NVYH 1X55A 5CYUA 4DU9A 4MACA 4REZA 1YJNA 4RF0A 1TWFB 2KQ4X 3RZDB 3AE2B 4CJ1B 4OVZA 1F2MA 1L1OA 4N8FA 4JI3Q 2NYZD 3RZOH 4KY7A 4NPSA 4YWKA 3I4MH 2IGDA 2PQEA 2J4XA 3SXHA 1FL0A 3CRKC 5CV6A 3DLLA 4GOPC 1HUMA 3VA7A 1OFFA 4IC7B 3OW7A 4GN3B 5CV4A 2J7ZA 4KKUA 1VCIA 3JW0X 1ICFB 3R7RA 3L0OA 3RZFA 4ARIA 4DUYQ 1GNUA 2PI2E 1CZPA 2HD3A 4TUUA 4GN1A 4A9AA 3Q69A 5DNFA 4FVMA 5CBEE 3F2BA 3H6NA 1C9FA 4XIGS 1LTAD 3VYSA 5M3MB 4XDDA 4KJOA 2NBUA 2VL6A 3KF6A 1WVLA 3STBC 1NUCA 1KFYB 1N62A 1X3EA 1LTID 4S3SA 4US8A 3KF8A 3S1QH 2YTVA 4AYBE 3NPPA 1JRUA 2KWUB 4CDEC 3QCAA 4RHSA 3L2PA 3M3YH 4PZ8A 2GOWA 2DY8A 3WAMA 4DV5L 1Q5WB 4DR2Q 2N9PC 1K0RA 1I5FA 3N9YC 3SGIA 1PDQA 5IP7G 1MVKA 2EY2A 3JAMc 1R9TH 2YLMA 4MNOA 4FP5D 3OJ3A 1RDPD 1E2WA 1X1MA 1EO6A 1MPEA 1WD1A 1QOBA 3QAQA 1M4VA 2V1YA 3ETRA 1ET9A 4DA2A 2CVRA 3TBLD 2D3CA 3JAME 4K0KQ 4OW0A 3JAML 3CCEA 3OLMD 1EQTA 5FLMG 3EROA 3CXCA 4GNXC 2NBVB 4HSVA 1J19A 1F77A 3MAQA 1XTDA 3T13A 3A9KB 1Y8NB 2JZPA 4YIJA 3E9IA 3GTKH 3BU2A 1T5XD 2F4VL 4XGAB 3SK8A 3HVDA 3TMEA 1K28A 4WRDA 5FJ8H 2BPSA 4NQLB 5G3LF 2QHOA 4P1CC 1VQIA 2OJWA 3QIAA 4GZYC 4WJWA 2VB3X 5GQOA 1NSNS 1V9PA 1QQRA 1E3PA 1VDZA 1YIWA 1UE5A 1N33Q 4XE0A 5NUCA 1FXTB 4DHJD 1C76A 4DV7Q 3HOZH 2KQ7A 1S3SG 5D2MB 2CCZA 2FCSA 2WKDA 5FLMH 4AP4C 2ON8A 1T0QC 3GTJB 2ZNVB 4I6PA 2K5VA 4TQ1A 1ESRA 3VUWA 3PO3B 1NI3A 1T6BX 2BS2B 4WJ3M 4DR6L 1QUQA 1C3TA 2VZKD 1PTOD 1BCPF 1H9RA 1LT5D 5DLQE 1STYA 1K73C 3C1EA 3W1SC 4LFBQ 1IYJB 5FLXc 1TKYA 1YOVB 1MD2D 1FJGQ 2MBBB 1XXGA 3PS6A 4LNIA 2BTEA 2ZJQA 4P75A 1VQPA 2JA8G 2WU5B 4B0EA 4POFA 2KQ3A 2MSED 1Q82C 2N1WA 3FKIB 3I2ZA 2XSCA 1X3FA 1LGRA 4LF5Q 3T16A 1F9QA 1Q10A 3TMPB 3D0FA 1MGSA 1AE2A 2RCFA 3W3AA 2OQ0A 3I56A 2HQEA 1I94Q 4JBKA 2JXTA 4I7AA 3CCRA 2J7QB 1I4HA 2L8JA 3ERSX 3GZNB 3PGEA 4KZCA 5CV7A 4B3TQ 4HTHA 1SBBB 3K5MA 2LXKA 3MHSD 3CCQA 2YEPB 1A6XA 5AZGA 2WYQA 3K81C 3ZJTA 2JF5A 2QF7A 3VH4B 1J9OA 1JJCB 4W9EA 3NWSA 2R93H 2VQEQ 4IM2A 4HJ7A 3F1ZA 2XEWA 2KENA 1U4AA 1B44D 3GE3C 2NWGA 3E56A 4IWQA 3W1GA 2ZCBA 3VR3A 1LQBA 4K2KA 2RGFA 1TWCH 5KYLA 2F0JA 4II2B 4JI4L 5IIFA 3FVQA 2DYOA 4WWPA 3APFA 3N30A 1A3VA 1ONLA 4MT5A 1WJ6A 4BOSC 4IJLA 3MXUA 4OEMB 1KD1C 1ISNA 1L7YA 1OEYJ 2KTRA 5BMGA 3S16B 1FFUA 5EQ0A 1I6HH 1HZ9A 3KF8B 4MDKE 3EJIA 3S15B 1EUVB 4W9LA 5GADC 1PTOF 2LASA 1MI2A 3UIPB 3NG0A 4MIUA 2NPTB 2E2IB 3K9PB 1XLQA 1B3QA 1AZPA 1VDVA 2DLBA 1JOKA 4OONA 1VQ6A 1RCVD 2D2QA 2LJ5A 3FKIH 3DOWA 3U4EG 4CKBA 2XK5A 3GZNI 2FBWB 1L0VB 2KLGA 1OTCA 3SE0A 1C4QA 1SYFA 4USAA 3RNFC 1WRDB 2MBEA 2RDHA 4PQXA 4L23A 1B70B 1TU2B 2WXIA 1QVFA 2RPVA 4ZKBB 3H7PA 3NP8A 1HE8A 4DAMA 4ODGA 4DV4Q 2FHTA 1LT4D 1FD7D 4DK0A 1QVGA 2PTLA 4HJKA 1PRTB 1ET6A 2KT7A 1VMCA 1PYSB 1ZEQX 2KYWA 2WXKA 2NZHA 1KAAA 2MJ8A 1N5XA 1QOGA 2HDEA 2V0GA 2KJ6A 2JRHA 3NVVA 3JSVA 3TRZA 1T3QA 3OAWA 2ZXRA 5ELBA 1GC7A 3PIO3 2OHFA 1BOSA 4QMGA 2PNHA 4FA6A 3APCA 3A74A 4KDLB 5CV8A 4TKNA 1X3QA 1N34L 1WF9A 4GXBA 3NQIA 1P7EA 2G5DA 2LKVA 4C2MH 1RF2D 4FXGC 4EVOA 3DCGA 3WIMA 2VS1A 1XNQQ 3HVZA 4TMAB 2EYLA 3BG3A 4X64Q 3N1YC 1V1QA 4DR3Q 3AU7A 4P72A 1NYQA 2HJ1A 4AWJA 4R8IA 3V2TA 1FFVA 4YHHQ 3EN2A 4BBRG 1F1HA 1TIFA 4F8MA 5E6NA 1FMAD 4DN4M 2B39A 3I4NH 1PXUA 4JL9A 3I4LA 3J81i 2DJFC 2K39A 4DV3Q 1XTCD 3UDFA 4U68A 4A3GG 2J0KA 5HHDG 2ZJDA 3HZXA 2GMIC 1FXAA 1VQHA 4ME5A 4S17A 4DV2Q 5FR6A 5GXGB 3RNEC 1VR9A 1IGDA 3HUIA 4G50A 4X65L 4JI1L 2GI9A 4A3OA 3S1QB 1RM6C 2AQ3B 4Q0FA 3HM3A 3TCAA 1ZGUB 2F0OA 1Y1WH 3DHGC 2IL8A 2YTYA 3CMEA 1AEXA 2OCEA 3J7AF 2WXFA 1HEZE 3S1RH 2XWJB 3G6JB 3R93A 2IHFA 5EPLA 3A7LA 3AE1B 1Q12A 1ZYRD 2E75C 3PRZA 1G2TA 2MJ3A 1QB5D 3PTFC 1GVPA 1YZ6A 2K75A 4DR7L 4EE2A 1WJNA 4ICVA 4X3SA 1E7VA 4BKGA 5K36H 1AFPA 4WWNA 4JG2A 3PIP3 3RZDH 4MGIE 4A4IA 3VR6A 4YT0B 5IP9H 3P1MA 1FGUA 2G4SA 3ZRFA 1GUOA 1Q3LA 5F2DA 4LF4Q 2IGHA 3VVWB 2VW9A 2EKIA 1R4MI 4ZRKA 3KDFB 2QCPX 5FK9C 5C4JH 4LUZA 1M90C 5LL6X 4X62L 3GOEA 3ITPA 1Z2MA 2WP9B 2UUAL 2ZNVC 3B1LX 4OO1H 3W5UB 1IYUA 5M3FG 4RHRA 3MEHA 4R4IA 1E10A 5C4XH 3NY5A 2LHDA 2INPE 1U0LA 3IVFA 3BDLA 5IY0A 3ZJYC 2A69C 3O65B 4K8JA 5AUKA 3S17B 4KLKA 3TS0A 1DOIA 2NVYB 1SE4A 2NN6G 2WINB 5M5WB 5CHFA 2UXDL 3I4NG 3AYHB 5J39A 1UD7A 1UGJA 4KV2A 1GG3A 3RLOA 1WRIA 2JVCA 3U52E 2LVPA 4F1SA 1NMGA 1R7SA 4C1NI 2Y0SE 3ONAB 4E71A 1SNCA 2IO0B 3VR9B 1NMFA 3SK4A 3TEHB 1WGDA 1AP0A 2KEDA 1V80A 2HIVA 2A19A 1A8VA 2BW2A 1B3AA 2PI2A 2EOTA 2EY6A 2F0GA 4AQYQ 2FCQA 3NHHA 1E5WA 4DAVA 5IE8A 2R7FA 4KTAA 1XNQL 5FR3A 3M9BA 2ICEC 1B8AA 4II3B 2SNMA 3C0RB 4DV3L 3ERQA 2DN8A 4GDLA 1Q81C 1K8OA 3VRBB 4QIWE 4DV5Q 2OWOA 2F0WA 3NVZA 2NS5A 4IFDI 4QL5A 2GVBA 1KQSA 3S14B 5EBCA 1IXRA 1MKHA 2SEBD 3MZ5A 4DV6Q 1WTVA 2A5UA 2KTRB 5DCNA 3SD5A 3NELA 3ZDMC 2QDBA 3ZQ4A 2N88A 2P5ZX 4XZ4A 4H2AA 1RWSA 1TT2A 1OXXK 1WCMG 1I3QB 3I57A 4Q2JA 3E9HA 1ZDXA 4IDIA 4JI5Q 4A6QA 2OOBB 4AJYB 4DNIA 4RKLA 1N61A 2QCZA 3GTQB 2PZWA 1UAPA 1GD7A 2F3IA 2KFJA 1PLFA 2KCCA 4K2LA 2L05A 3GB1A 2KMAA 3IAS1 4HDQA 3D4WA 4H0LC 2N78A 3PO2H 2E2HH 3KQ4A 3RI7C 2C5CA 2E2DC 3PVLA 4YL8A 2BDOA 2Q2UA 2MNAA 1VQEA 1C4CA 3TN2A 1N9WA 1P7FA 1XO3A 1HFNA 1OQYA 2QKIC 3V3XA 3E0EA 4QB4A 5IYCH 3A9KA 2NN6H 4LNFA 4JI5L 1YN3A 3HKZB 4BWGB 1ZPSA 4DBGA 3MHZA 1PA6A 1GJXA 2DY7A 4B3ML 2JE6I 3T4AC 5C4XG 2WDVB 3VR8B 2K7VA 3OIPA 4ZOHC 1WSPA 1OQQA 3JVZX 2EQSA 1GUSA 3ULPA 4A3MG 2OTLA 1N60A 2OF1A 3AULA 2N9LA 3I9V1 3U9OA 2D9UA 4EQPA 5FO8B 3RLNA 4BBRB 1NE3A 3A4SC 3AE5B 2KJRA 1R4NB 1XCTL 2K8BA 2INNE 2K5HA 3K0YA 4EQNA 4U673 2GB1A 2LEKA 3O13A 1WTWA 2GLSA 3NBHA 4XWTA 3DBSA 5H1SE 3L10B 1QNUA 2Z0DB 2IO1B 4KKSA 3PT2B 3OW2A 2F03A 1OEYA 2WIIB 2IO2B 5GMVA 1EF5A 4ILWA 1SN8A 2N4FA 1CI3M 2DZIA 1H9MA 5CHWA 1VLBA 4ANVA 3DWAA 4F88A 5M9OA 1YBYA 1TWGB 3J7YW 5M3FB 4G57A 1SXTA 3M4OH 4BBSG 5I4DA 2KXJA 2J53A 2VZAA 3HOYB 3DDCB 3PQIA 4C3JB 2A74C 1E22A 2IDYA 1TWHB 2IX3A 3TZDA 3LWEA 3G6EA 1HTOA 4J15A 2CWPA 3FMCA 1TJEA 2ZZPB 4C80A 2QILA 2PIAA 4KHZA 2B2VC 1TYGB 3ZTCA 3PUVA 2AYOB 1VQNA 2BE5D 4FHJA 4Z9CB 3M4YA 2XIWA 1L1OB 2WDQB 4EKUA 4P1BC 4HPMB 4MGYE 1I50H 3CMAA 4IALA 3T1HQ 4BXXH 2ZM6Q 1KF6B 3A5UA 1RAXA 2Z4HA 4MN3A 5ELOA 2CKHB 4OVUA 2K50A 4PMWA 5DEHA 2QDFA 4RFBA 1D7QA 2XRQD 4GN4B 3GTQH 4L5SA 4K6DA 3S2HB 1N33L 4N9F4 2I38A 1S3OA 4K14A 4KDIC 2FNJB 3A8IE 4RAUC 2FUG1 2EXDA 4MJSB 2M0AA 3EHVA 5C4JB 1C79A 3PRMB 1OTRB 2CH4W 4C7YA 2KDMA 4GDLB 1STNA 2DWQA 2LXJA 3U4ZA 2SDFA 2NVQH 2F0MA 3GS2A 2Z1CA 2KHIA 5IKCM 4P2CB 2PPBC 1A0IA 1D5XC 3N32A 1PH8A 3S2AA 1Q8KA 5L37A 3AEFB 3QC8B 2Q8TA 3HOYG 1BCPC 1S72A 3E0JA 1ZKOA 2KCMA 2X69A 4H44C 4R4QA 2KJHB 2HD5B 2K5NA 2UU9L 3DBHI 3HP3A 1CZWA 3CRLC 4CKEA 4EQ5A 1KOTA 1YNJC 2HIXA 3K6OA 3NWTA 1C1YB 1NEKB 1GPXA 1C77A 2K25A 1AW7A 1EWIA 2AQ2B 3J7AV 1H4RA 2RQXA 5TSSA 1UGMA 4PYUA 2DNEA 1TQOA 1DJRD 3QJYA 4ZKCB 2AUKA 2L55A 1HTPA 1PTOH 2JA7H 2WXJA 2CQAA 3PLVA 3MVVA 3F2DA 3GTGB 2ID0A 3Q3MC 3WOFA 2R92G 3FILA 3GTMB 3AU5A 1J6QA 5C3JB 1EY0A 1ZOYB 4HJGE 2D5DA 4AQYL 4LF8Q 3WA0A 2WKCA 3U7ZA 1L2FA 2L4NA 4UP7A 3NOBA 1XLNA 4M8MA 3WAOA 3ZDTA 4BKSA 2W3SA 5C4XB 4JWSC 3I4MB 3QOLA 4IUVA 3BYTB 2LVQA 5L83A 1SSNA 2V9HA 4RMAA 1MBYA 3AFPA 3GTOB 1C78A 4A8XC 1KLGD 5JEAG 3RNGC 3EA6A 1UEBA 1PH1A 3PO3H 4M01A 5CX3A 4J6HA 4A55A 4TQ0A 3SR6A 1V5TA 4CKCA 3KYDD 4AOFA 2EKEC 3ZYYX 2V4DA 2L12A 4FF3A 1UE1A 5ELCA 2LHEA 2PJHA 1U4RA 4QAYA 2NVTB 3M4QA 4DUZQ 3C3LA 2QIEB 2UUAQ 1CK1A 2GBNA 4CO7A 3D6WA 2E5LL 3BYYB 4B9WA 4OO1G 2A68D 2F0LA 3ONSA 1II3A 4DNTB 1VQBA 4NXNQ 3FC4A 4BFRA 4GLVB 2JJQA 2KWVB 4RNAA 3S1MB 4MGZE 4CBVA 2EJGC 5BN4A 2OEOA 2M0XA 1FPYA 4LNNA 4ZYNA 1D3ZA 5EPKA 4AUQC 2L76A 2JYOA 1LTSD 3W5OA 1WFYA 3LXFA 3Q8FA 1ENCA 3KLSA 4LFAQ 5G3LD 3AEBB 1O80A 2YV5A 1UWMA 4WIPA 2LMCA 1AH9A 4X66L 4I6LB 4LF7L 1V1PB 2IHEA 2BB5A 4LAAA 5CORA 1Z7TA 2KC2A 1H9KA 5IO9A 2VNUD 3TEWA 2L5TA 5E3FA 3RUIB 1FVIA 1WFQA 5J3BA 4AIMA 2AMCB 2RDBC 3AV8A 2DUDA 2O2VB 4MJSA 3L4PA 3GV6A 1YX5B 3CU7A 3D32A 1QZEA 2PW9A 1LYLA 3MTSA 1PH6A 4GNXB 3S15H 3RZOB 4DHZE 4JI7L 3WCQA 1SIJA 1QJOA 3HOXB 1I6HB 1BBXC 1KHIA 4DK5A 3NS8A 3KLSX 3FEWX 4PT5A 2H5XA 2KVZA 1SLJA 3W2DA 3BINA 3FKYA 5KNBA 2JQRB 4A90A 1PUTA 3RMKC 2OQKA 4BKSD 1D8LA 1I4PA 3IAYA 1KRHA 3QQ8B 4WQOB 1HJPA 1K83B 3ZXRA 1ML0D 5IN7A 1NY4A 2CU3A 2INCC 1EQVA 1C7YA 3W1SA 3W5VB 2JN4A 5D3IB 2MFIA 2MHVA 2R7DA 3HOVG 4C3IB 2LRUA 4OZBA 1GUWA 3WANA 4HLEA 4R8NA 5C6AA 4DV2L 1ZDVA 3VUYA 2Q8IB 4C3JH 4EGVA 1HH2P 1UELA 2JPHA 1PYWD 5C3EB 2I07B 2KHJA 5C4ZA 5CC4A 4FBJB 4LW1A 4S0RA 3M4OB 2EJFC 4HJAA 4JI2Q 1F9SA 1L6VA 2ZEQA 3EFCA 1WGRA 2CJOA 2MBHA 4DNRB 1RYJA 1WE6A 3L13A 4CDFC 4A3BH 2VB2X 3P4RB 3Q3JA 1AARA 1Y1VB 4XQNA 1K50A 1YD8U 2MX2A 3TP5A 2KWDA 4NKLA 1K83H 3KBGA 5DPRA 2PW5A 3KFUA 4NAMA 2ZVNA 3LJ3A 1XLPA 3AQQA 2BA0A 3EIVA 1EY7A 2UUCQ 4C3HG 1TKGA 3BDOA 3AE9B 4YCUA 1KLUD 1QUQB 2N9KA 2D10A 3NZ3A 4NJCA 1OXSC 2O5JC 1SYDA 1N36L 1VRAB 2N55A 2JZZA 1SIFA 2QGQA 2KC1A 3KF6B 3I3TB 2KHSA 4FF4A 3IAM1 1UWVA 3CCSA 1Q86C 2NBFA 2TMPA 3OHXC 1EL0A 2LGIA 5T8IA 1MFWA 2EYFA 1CJEA 4W9KA 2WXGA 4LJOB 2DAJA 3NENA 2B2VA 1NNXA 2KO3A 2EELA 2A6ED 2AL6A 2EYJA 1FO4A 4JV5Q 5C0XI 1L0XB 5LMNQ 2DZMA 5C4HA 3TIXA 2BS4B 1BCPB 2H89B 2V3SA 4BBSB 2I0QA 2FAZA 2RR9A 2L7RA 1CKOA 2ZJRA 4NQKE 2CQOA 1FD6A 2RVLA 3NHEB 2MGSA 3GTKB 4DV4L 3VXWA 5J17A 3UDXA 5IYBG 2ZPYA 2DBYA 1TS3A 3X23A 2NB0A 2CW0C 2WAQB 2RDGA 1HUNA 1VZ8A 2K1FA 4JI4Q 1ILQA 3P2BA 2REXA 2MA9B 1EOVA 5GROA 3R3MA 5KNDA 4IM0A 1TWCB 5LXIB 3RN5A 4QUFA 2M19A 1A3UA 2JXMB 2QW7A 5IGCA 1BBUA 2PW7A 3S1NH 2D3AA 2F0FA 2ZM6L 4X3TA 3SR1A 2LS01 4K8IA 3HOYH 2DENB 4JLCA 3K5OA 1BVSA 1GXDC 2G9DA 2CS4A 2JYTA 2KWCA 2F52A 4BBNF 3I5JC 1AYFA 1Y14B 2KDFB 1JWUD 3R3OA 1E0BA 1G8ZD 2O2VA 1FXIA 2IPKD 2KOLA 2CHZA 2DYBA 3Q6SA 5ELNA 2MJEA 1KIXA 4L6TB 1RODA 1KJTA 4GNXA 4HWIB 3RNCC 5EGTA 2A69D 4HJ8A 1WTOA 1T0YA 1ZXHA 2B2WC 1YNJD 1JE5A 1XF5L 3A55A 1QE6A 2O2LD 1RLFA 1I4QA 2WXMA 3ENEA 5DPSA 1I94L 3RULA 1YIJA 2WACA 4NXML 1O7LA 3H6MA 3I4MG 5HGTA 4IFDG 1WJJA 1YNND 1HXYD 2F0KA 3I8ZA 2WXNA 1Y1WG 3R66C 4OWWB 3S1MH 3DHIC 4B3TL 2F0UA 3SEBA 1NR2A 2KCTA 4NAWB 2MO1A 1LABA 4HMJA 4B3RQ 4LF9Q 1PV4A 4B9XA 3CCLA 3ZTDA 2F0SA 4DHJB 2LGYA 3S2DB 1QF6A 3CPFA 5ISRA 3GTOH 2A4ZA 2O6VA 2F0EA 4UY8C 1JQ4A 4JI8Q 3P75A 5J1ZA 1MJDA 2K6DB 4R4OA 1YITA 1WWTA 2B8GA 3HEJA 3J80E 1F52A 2A73B 3CW2C 4DR1L 3DM1A 3AMUA 1DYQA 3J81j 1HZAA 2I5LX 1XPRA 1IYFA 1DOKA 3T51B 5JXVA 2XGTA 1DGJA 1PRTC 2FCNA 4LFCL 3PREA 2CU1A 1ZYRC 5MPOA 1PRTD 5CMDA 4XDCA 4GKKQ 2CHXA 5IAAC 1JOQA 4KX6B 3R2TA 2AHOB 5EBDA 2PQAA 1OO9B 1JMLA 2KCNA 5JPMC 2ZVOA 2N7EA 2GVAA 3VRAB 3E3XA 2PQAB 3KYHC 5BMIA 2D2CC 1PH2A 4QUCA 1E1OA 2J0MA 3DBLI 5A2QE 2JA8H 4KVGB 1WZ0A 3R2IA 2UUBL 4ZCKA 1IHZA 1MHWC 1IW7C 3ND9A 1SYCA 3RZWC 1AZQA 1Z9FA 1JJGA 4ZRPA 3E6ZX 3SHLA 3KUDB 2M17A 3TJPA 1K8MA 5D65A 3VR2A 4PS8A 2JA7B 2BYEA 1Y1WB 4KJNA 2LGXA 4JBWA 2K3UA 3ZUNA 5EE1A 1JICA 1K3BC 2IX0A 1K51A 1YMHE 2M4NA 4IUMB 4ZDVA 1C48A 1FGBD 1RTNA 2IYDB 1O7IA 3H91A 3G71A 1JQYD 2JA8B 2QMTA 5G5GA 2ZTDA 4EEWA 2UXCL 2O6VB 5KRUA 1VQ8A 4GU2A 4IWOA 3TL5A 5AZFA 1YEZA 2CH4A 2E8GA 4N58A 2PVGC 5JHAA 4EFOA 1L5PA 2Q2HA 4GS3A 2LJIA 3SU8X 1C4AA 4K3BA 1Y1VG 1ENFA 5JVH3 2Z8LA 1CHPD 1LT6D 2MQHA 1UE7A 1YNTE 4NY0A 2D5GA 4HKZE 1W6KA 2E3TA 5M5WH 2F0PA 2TSSA 4LF6L 3H94A 1GUAB 3A56A 5AUIA 1WZ3A 3RUZA 4JW0A 4KIKB 4MM3A 2ZW1A 3T1YQ 5E4XA 5LMNW 1JRPA 4RGTA 2UUBQ 4DV1L 2HTHA 3NEMA 3DHQA 4FYDA 4RH6A 4A3KB 2VZKB 4R4CA 5AJ3L 4DV0Q 2JA7G 2A68C 2IBIB 4HKQA 2IT1A 3OTOQ 4HCPB 2MLBA 3UF8A 4EZKA 1SRUA 3KBXA 2LSSA 2RSNA 3I7FA 4JE3B 1I4RA 4A3BB 3KH0A 5HGQA 1LTGD 4PS3A 2EVBA 1HNWL 4KD3A 1SMYD 4ME3A 5CV5A 2K22A 4O42A 2KKCA 3QWZB 2F1MA 3GTGH 2A5HA 3ZIMA 5M5XB 1ZE3D 4ICUA 1PQSA 3PRPB 5C23A 2JZ3B 1N6ZA 1PZID 2PO4A 3UI3A 3X0WA 2JY6A 1YNXA 4HJ9A 3M7NA 4GDKA 2C7HA 1GM5A 3ML9A 4C56C 2NZ1D 1MSGA 3AMZA 2WXPA 2LGDA 4W9IA 2I2YA 4O1NA 4OIKA 5HY6A 1B50A 5D7GA 1EZ6A 1FNUA 1JWSD 1STHA 1P16A 2YYZA 3TZUA 3AEEB 1AN8A 2K03A 4PV1C 4PZ6A 4WAAA 2KMMA 3LWUA 3K58A 4C3JG 2VQFL 4A76A 2NTSA 4A3CG 1GB1A 3CQZH 1TBEA 3MTNB 4CDCC 1Z6HA 1PDXA 3D3RA 4JK1C 3H7PB 3KW5B 1ENAA 2B8FA 5ELDA 1L6UA 2Q2TA 1D6EC 2PKOA 1EOTA 4DR7Q 1D1KA 3HOVH 2W3RA 3MC9A 3J81c 1FEHA 1QILA 3HHMA 1HZ5A 4C7ZA 2IW3A 1CM9A 2A6HD 1SB3C 1UUPA 3PZ8A 2JA6B 4WAFA 4K7UA 4K7WA 2VRRB 4OZCA 2V3NA 4UPAA 3PO2B 1PGAA 5GAHC 1XT9B 3VAWA 2I5MX 4MELA 4MGKE 1RFAA 4PMCA 5GAGC 2BWFA 1G6ZA 2WXRA 5C44B 1WR6E 1MG8A 3DVNV 4J1MA 4G4KA 2C60A 1CQFA 5C3WA 4JQWC 5C5LA 4AQ7A 3U50C 2ZJPA 3DBRB 4OVVA 2Q2IA 3GV3A 3GO5A 2A1AA 3PO2G 2EZVA 4JPSA 2E5LQ 2JX5A 4KI0A 1PHJA 3A8JE 3DBRI 3NZUA 5AZHA 1YI2A 4LF9L 4KHPL 3K80C 2E2HB 5E7NA 4HR7B 1IW7D 5ELFA 1WE7A 1JE4A 2NR2A 3CCVA 1I35A 5JH5C 4L5QA 2K05A 5EE3A 5FLXE 1JT8A 4MH0E 1QVCA 1CUKA 1SJHD 1VQFA 3PUZA 1BXTA 1LT3D 2RSOA 1N34Q 4G7OC 1SE9A 2LUEA 2LVOA 1Q1EA 1SJED 3KLWA 4MTKA 4LF8L 3Q3FA 2ENBA 4WQMA 3IL8A 4A3JG 2L32A 1I4XA 1Y1VH 2PPHA 1VQAA 5IP7H 4JC0A 4QY7A 4DV0L 4A3BG 1O7YA 1W3SA 2JSVX 2OJRA 5K5PA 3IT4B 3HOVB 5FJ8G 1TWAB 1A3TA 1PFDA 2KLCA 3M62B 4IN3A 5M5XH 3Q0AA 1SFOB 1NBFC 2HJ8A 2LXAA 4DK6C 2MJDA 1X3PA 3I91A 1UBQA 4KY6A 5BN5A 2LFIA 5I6WA 4BBRH 4QQBX 2O6VD 1EWCA 1LTLA 4BY1B 3GE8C 3PHXB 4JV5L 3JC66 4RM9A 3UINB 1GUGA 3IG3A 1QWYA 1A2TA 2R92H 2B63G 5IYDH 3OMCA 3MXGA 1GJZA 3HK0A 4RGNA 3JSVB 2XTIA 4NDXA 5IGFA 4A3LH 1WY8A 3BK2A 1EIGA 5LMUQ 4GN5A 1XPUA 1SE2A 1WTPA 1ACCA 2BS3B 2RD0A 5C3XA 2E76C 1HR0Q 4GKJQ 4FO2A 3H8HA 4DAPA 4XXEA 4ITKA 1GB4A 4EZJA 1EIYB 4GSWA 1EU3A 4RCNA 1IBXA 4BA1I 1H8CA 2R2QA 1G6JA 3CF5A 3DQVA 2K28A 3EUB2 4X3UA 4YXDB 3HRDD 1BBWA 3J7A5 2K1BA 1WXMA 4MTNA 3H3VH 3I90A 4MH8A 3T3OA 3JYUA 3P42A 4QIWB 1WH3A 1WJ4A 2D3GA 4JOIC 1DM0B 2A6HC 3UDGA 3APDA 1VZ7A 2WXQA 4P16A 4TSSA 2XK5B 2KX0A 1STBA 2WGSA 3U2SC 1V2YA 5JAVA 3B0AA 2VH2A 4I7ZC 3WWVA 3PV0A 2BF8B 3AFQA 3PF5A 2FXQA 2Z6BA 4LNKA 4HCSA 5E6PA 3LYYA 2AWOA 3OWEB 3G4SA 2F0QA 1UH6A 1WJUA 3DWGC 3QX1A 1TXYA 2BOSA 1SROA 1VD2A 4P73A 3WOEA 2Z6KA 4YTNB 4ANXA 3WDNA 2B63B 3PF4A 4K6LA 2Q5WD 5I2YA 4LK1C 4RMFA 2SNSA 3DUZA 4KIKA 4KZ0A 4YSYB 5JZEB 1VQJA 1BF4A 1QOHA 1SMYC 1Q8IA 3TP7A 2BH2A 1NI2A 5BYQA 1NENB 2JP1A 3HOXG 2B29A 2PCFB 3QA8A 2MPMA 3HG9A 1HA6A 1JROA 2WHIA 5C5MA 2JK8A 5E4WC 5TR5A 4HRSA 2F0HA 2KJXA 2Y0SG 3HKSA 3W1YA 1WTRA 4A3FH 2RBMA 3BJUA 3ER0A 2B3AA 3NVWA 1XMQL 4P6VF 3NK9A 3CIRB 1E0ZA 1F2RC 3LX0A 4LWCA 1WM3A 3V6CB 2WDRB 3QR8A 3ICEA 3MP9A 1OXVA 2W82A 1CQVA 4KV6A 4YCVA 4DPGA 2JA5B 1V6EA 4CJ0B 3Q6BA 4DK3C 2FFKB 1RKNA 3L0WB 3HS0C 4GLSC 5IT9E 3BY4B 1HNZQ 2NN6I 1SE3A 4JCVE 2EE1A 2EPBA 2FMMA 3CCMA 1I50B 4A3JB 4NB3A 4DQOC 2K14A 2JA9A 3NVYA 3VTWA 1EM7A 3ZNHB 4KHVA 4HCNB 1TY0A 2EMSA 4K7SA 3UQAA 1VCBA 3AE8B 4A3FB 4B6WA 4IQZA 2DGYA 3U4VA 4HN7A 3AEGB 4NP5A 1PZKD 2VUMH 4LFBL 1CMXB 3GQBA 5CR3A 3UDIA 2CFMA 1IYVA 2L3ZA 3MC0B 4K5WA 3Q23A 3KWVA 4IG7B 4ZRZA 1PGBA 1NCVA 3ZNID 3LB8C 3GTLH 1SYGA 2BQQA 1HZCA 1V1PA 3K7AB 4N9PA 1HCZA 1YHBA 3VYRA 1CFMA 4LJPB 4Q5VA 2K8CA 2LGSA 5HKHA 5IYCG 4LF6Q 1IUEA 3ZXVA 4KN4C 1E2VA 3EBEA 1YJWA 4IO9A 2N9XA 3D4DA 3A4RA 1D4BA 1VQDA 3KUPA 4BOZB 3ABVB 1HA5A 2JEAI 1WGKA 5IGGA 3SVMA 2IX1A 1EUJA 3HOZG 2SOBA 2HDLA 3S1RB 1WXVA 1X65A 3RN9C 2Y5CA 3RCZA 4DUZL 3P4SB 4A75A 1JOOA 2D3BA 2HTME 3OTOL 4M8NA 3CAMA 5M3MH 2QA4A 3CSTA 2V1CC 4FHKA 3I63C 4DR5Q 1UBIA 2KFKB 1YJ1A 3NRZA 1GC6A 5EJWA 5M5YH 2MO0A 1PFBA 2IJ0A 2XWBB 1C4PA 1UWXA 5IA7A 1OXUA 4CJ2C 1FM0D 4L63B 3M63B 1CHQD 2G3QB 1JWMD 2NMQA 3TREA 3J80L 2L11A 2Z0SA 4JBJA 2XN9C 2BYFA 4KK7A 3QB3A 2QSDA 4GOCA 4MHEA 3AE4B 1IBML 2X38A 1P9DU 1PVOA 1HR0W 2HQLA 2GBMA 1N32Q 2R7ZH 1HFGA 4N8X1 3ECIA 5C2TB 2Y0SB 1F9RA 4EOYA 1VQOA 2KQSA 3RNBC 2F0DA 2YU9B 1ZW7A 5IP4D 1QCBD 1FYCA 2LZ6A 4H02A 4LJZC 4ZHOA 1Y8OB 2I46A 1QKZA 2JQOA 1F9JA 4B3SL 4JI7Q 2L1AA 1E8YA 3KYCD 2MRPA 1YNNC 5J18A 4C3HH 1TY2A 2LXCA 4RWSC 4JWUC 4YY3L 2DYMA 1TTNA 5DPWA 2IY5B 5AEKB 2RSUA 1D5MC 4OWXB 4A93H 2JRIB 2KTFA 2UWQA 4HMIA 1JORA 2WAQG 4JPBW 2ACZB 2WDTB 4BA2I 4GLAC 1XPOA 4LF4L 2WWZA 3ALBA 3B9JA 3RNAC 1TKEA 3C1FA 1KRTA 1YVCA 4MSQB 4PG3A 1EIFA 3SK5A 3H7SA 4DXAB 4A3MB 3QJZA 4POGA 4A93B 3PIOA 1Y56A 4XX5A 1GUNA 4GDKB 2N49A 2KD0A 1DONA 1X9NA 1WYDA 2J52A 2F3WA 5IP9G 4A3EB 2FIFA 5E1FA 4ARCA 2HE7A 4US9A 1SGHA 2PMVA 5C3EH 3UE1A 2XNAC 4Y52H 1F2RI 1I6VC 1PH3A 1B2TA 4WWMA 1IGCA 4A3IG 2JSOA 2QJLA 1BT0A 1HNWQ 4L2YA 5EDSA 1PFMA 4FXCA 5C0XH 1H9SB 2BDNA 1XD3B 3MEFA 3C8YA 1LV9A 1O78A 4ZAIA 2M8SA 1S5DD 4C3HB 1H9SA 3H0GB 4DXFA 5I9OA 1WGGA 2WV6D 1U5KA 4X65Q 2MH7A 4JX1C 3HOUG 4M00A 1RJTA 4N59A 4X57B 1HQMC 3IKJA 3MFGA 4NXMQ 4JI0Q 1P0RA 1PZJD 4V190 1K8AC 1WIAA 3NZSA 3VQIA 3SFDB 1VZ6A 4V0BA 1IBMQ 1XWEA 1H95A 1IKMA 3S2DH 4FXKC 2AL3A 1J8IA 2QC8A 1BCPD 2W55A 3NS1A 4F7ZA 1J5EL 4OX9Q 5C3EG 3NSWA 3KUCB 3C46A 2CWAA 2R7ZB 1EYCA 2G1EA 2RHQB 1GHJA 1DXMA 1JB3A 4PZ7A 3ULLA 2I1KA 1TS5A 2KZRA 4BVUC 3A0JA 2FJ2A 4IPDA 4XTCS 5CGKA 4WJNA 1YX6B 4O0AA 3DM3A 4BS9A 5IYDG 1E2ZA 1MSHA 1AWDA 3V62A 3ZKJC 4XT3B 4FF2A 2PMZB 1BKBA 2XBBC 5DM63 1KTKA 3NTKA 4M8AA 2HT1A 5M5YB 2F4IA 2AEHA 2WX0A 3H9DA 3PSEB 3TUOA 2G9HD 4IJHA 1PH4A 1IKLA 3K7AH 5EKLA 2VY3A 2MP2A 4RG1A 3X3MA 1XNRQ 1NJIC 4IUNA 1CKNA 3RD4A 3AE7B 2BE5C 3K5LA 2ZPNA 3JAMi 2I1JA 1GUTA 1SMXA 3DXJC 1W2BA 1XNRL 3TEZA 2OT2A 2ALYB 1CTMA 4L8JA 4G3XB 4FLHA 1HTLD 2A8VA 4ZRIA 5IOIA 1F0ZA 2L52A 4IPCA 1PMRA 3SDZA 2VH1A 2MHJA 4HIMA 1XLOA 4A3LG 3W9CB 4JI2L 4UAIA 3KLRA 4W9HA 3S24A 2LY7A 4L1BA 3AI5A 2HCCA 1QZHA 5AFWA 3RLFA 3OSOA 2R92B 3FDTA 2NVTH 1YJIA 2LWPA 4KD4A 4OGQC 2WQYB 2KHWB 4JOIA 2RCNA 4ASWC 2EDGA 4KHPQ 5FOBB 4IOCA 5KHQA 2FINB 3OMGA 4DDID 2R3ZA 1N5WA 1B9NA 5BYRA 4H13C 3AXCA 4DR1Q 3BVMA 1PTOC 2MUYA 1CKMA 2XRSD 1SFOH 1WXSA 3RYTA 3E5SA 2UXDQ 5LHY1 4C00A 2Z4IA 2EYHA 1I7HA 3U30A 1IP9A 5FLXL 2NBWB 4CQNA 4DK1A 4IUQA 4UP8A 3DWPA 4FF1A 3D4RA 3J7ZC 4CHKA 4F8CB 4AS1A 1A63A 3PSIA 3P20A 4L5TA 1J7AA 2AWTA 2UYZB 5G55A 3UIOB 4I6NB 1KDCA 3VA5A 4BY1H 4RGMA 3QK0A 1X32A 5T1GA 1STEA 1CT1D 3U58A 2XVSA 4GOPA 3J81E 2WU2B 3Q8EA 4M0WA 2K8HA 3MFYA 5FO7B 1QNKA 4HDOA 2ZXOA 3VR4A 1B7YB 4JI6L 3BDCA 3DBHB 5KNCA 2M00A 4LDTB 5BR8L 4ANWA 4A3PA 3CCJA 3ZW3A 3KOJA 1LACA 4WJQA 1XCQL 1EF1A 1YHAA 1LTRD 3OOCA 2BCOA 3M85A 3ZO5B 2R2OA 4LK0M 1JC7A 4A3KG 4GMVA 1L4DB 4LTUA 5DPTA 4OELB 1CA6A 1XX8A 3P4PB 4RF1A 3PCOB 3K59A 2O5IC 2YU9H 4ID6A 1FJGL 2N0SB 1HRJA 1NTGA 2EY5A 1VQGA 3VUXA 1X54A 2HUGA 1IL8A 2N3SA 4XQJA 3RT3B 1Q0WB 4F87A 4BXXG 1ZP0B 4E6IA 2JUOA 2KFKA 3V6EB 1VQ4A 2B2UC 3NJTA 3HOXH 2LI5A 3F2UA 4GKJL 3B2GA 1S40A 1E9MA 1WI0A 5EPJA 4ZLTF 2RF4A 3ND8A 4P74A 2CW0D 3C2PA 2KANA 3BZKA 3EGRA 3HGBA 1RHPA 1JMCA 1TWFH 4DDGD 4DV1Q 1YQBA 3ZVVA 3A5ZB 3TDQA 3U8ZA 4CHTB 3TSSA 4GIVA 1U4MA 2G45B 3C19A 2PEAA 4C4VB 1W6JA 3QHTA 3ZRCA 3F8TA 4DKAC 5IWAQ 4WJPA 2WP8J 2BB6A 1SDFA 1EYGA 3T8MA 2A6EC 4OL7A 3CQZB 4DV7L 3Q3NC 4IM3A 2V4IB 4C3IH 4FULA 3OYYA 4A3EH 4Y7NB 4QGUA 2DX5B 2L83A 3KVFB 4MM3B 3N3KB 4HK2A 3HRZC 5LNK1 3PUWA 1E24A 3EQLC 2GBRA 4A3DB 2NVUI 4QCLA 2B2YC 1EWYC 4IUTA 2Y5PA 1EEFD 2WB1E 3FKIG 3L54A 1IZ6A 2EY1A 4DR3L 4A3MH 1YJJA 5AJ3Q 1K3RA 1HNXQ 4IZ8A 3M3JA 1S5FD 4R1JA 4FJZA 4WJOA 2EYMA 2L0FA 2Z0EB 1CSQA 3IRBA 4I65A 5IGDA 1PH5A 4JYAQ 3I73A 1H9JA 3Q8DA 5E6JA 3ZNGC 2EJMA 2K04A 3CD6A 3VTUA 1PFNA 1SEBD 5E6OA 3S17H 4HXDA 5IWAL 1EU4A 4ACFA 3GD7A 4P7IA 4ZRJA 4J8QA 3DVGX 4HSPA 1E8ZA 5EE9A 2WS3B 4LUOA 2RKSA 1WMHA 5M3MG 1T9HA 3IBEA 1YQ4B 1MIUA 3VYUA 1UE6A 2EIFA 3A1QA 4KSLC 1YN5A 4GKKL 3AEAB 2ICIA 1I3QH 2UXCQ 1SYBA 1U4LA 4GOPB 4B08A 4FJVB 5IGBA 1LO5D 1IBLL 3PLUA 5H8YE 4M0WB 3HOUH 1DOYA 1WCMH 1B1ZA 3EFUA 2B2TC 1TGZB 1EYAA 3G48A 4G11A 4WWOA 4A3DG 1GO3E 3IFTA 1XMQQ 3QWNA 1G2SA 3EFXD 5C0XG 1K52A 1M94A 1V86A 5H92C 1PH9A 1A70A 1PYBA 4CYEA 4ZHPA 2KMCA 4XC2A 4ANUA 2KA7A 1FIQA 4WFN3 3SFEB 4DXGA 2K6QA 2M2LA 1WM2A 3QIJA 3I4OA 2YTXA 1BMLC 1TKWB 4DGZA 3H1UA 4NJ7A 2K4KA 1SAPA 4JI8L 4XYCA 1NVID 3VH3B 1C0AA 4HIOA 2BA1A 1K8RB 2B3GA 1MI0A 3BIID 1G51A 1EQRA 2KAJA 4W9FA 5JVG3 1IL2A 2BVCA 3UGBB 4AYBB 2H4OA 1EYDA 3Q2AC 3R7QA 3LDZE 4GB9A 2MBOA 3OWFA 3DBLB 5C44G 1MJCA 2QEXA 1Y69U 1BDOA 1NAPA 2B2YA 2CHWA 3EECA 1EY4A 4MSMB 1LM8B 5LL6S 2ZTCA 3AH7A 3NE5B 3K8AA 2NTTA 2E6XA 1PGXA 2MBQA 2E2JH 2HDMA 4BY7H 2C7NB 4PS7A 1WXAA 4EZLA 2WB1B 1K53A 2Y3AA 2PZUA 2K9XA 5KGUA 2KNBA 5IT9c 3HOZB 3CF6E 3OIQA 3CMMB 4B9KA 1XYIA 4NAWA 2AQ1B 2PYKA 3X3NA 1U9RA 3T1HL 4ZRQA 1J7CA 3I4NB 3M95A 3PHWB 1KM7A 2C5LC 2IY0B 5JPNC 2D11A 1HQRD 2Z6KC 3CHBD 4DAYB 2KN5A 3DEPA 2W54A 1O7ZA 5IT9L 1E1TA 1WGYA 4KKIA 3HM6X 4EQOA 1A15A 4BKTA 3MHBA 3NBIA 4O2DA 2KOXA 3IHPC 3RNUA 3FAHA 2QEJC 4KGTA 5I2XA 1ROEA 1LTTD 1E8XA 2MQJA 3HIZA 4A3GH 4IFDJ 2E2JB 2WLBA 1WOCA 3GDEA 4HIKA 2BKFA 4XYOA 2C9WB 1VQCA 5BR8Q 1VQ9A 4A3CH 2N7DA 2PVOD 1R4MB 1WXQA 3PO0A 3VDZA 3ZJUA 5D6JB 3V96A 3H3VC 5D3DA 2PNRC 1LFDA 2DZJA 2L00B 5LMUL 4JI1Q 5I6YA 3CPWA 1OGWA 2F0VA 4AJWA 4W9GA 2N9EB 5D94A 1D5ZC 4IPHA 2K33A 2IZVB 2NCNA 1SE8A 2BYVE 2PZTA 2RDFA 2WFWA 3V05A 4YTMB 3EVQA 3AM9A 1QOAA 2K6AA 1IBXB 3KWLA 2DJGC 1EY6A 1TIID 4QF4A 4F7XA 3DEOA 4H7BA 4B3MQ 1Y8PB 3M7GA 1F2LA 2NUCA 5IOCA 4FXDA 1L0YB 3UI2A 2UUCL 4HEDA 1BUIC 1NDDA 2FE8A 5BMHA 3VYTA 2IWHA 1JCKB 1ESFA 1RIPA 3K0XA 5HFYA 4ALPA 1FCCC 4B3SQ 3ML8A 3MXNB 1WTHA 1V5OA 2B2UA 4OIJA 1UF0A 3Q8BA 1DOXA 4KGSA 3TEYA 2L0TA 1UZXB 4J6IA 2MW5A 1SNQA 1AE3A 3AE6B 3VR5A 1ZXTA 4FJYA 4HCEA 2RHSB 1SF0A 2BYTA 4FDBA 1LM0A 1EFID 2AKWB 5LMNL 3N1ZC 1OXTA 1C8CA 2BGFA 3CC7A 2WXLA 1S5CD 3U9SA 5I9PA 4G7HC 3CC2A 1WCMB 4LNOA 2F4VQ 4L5RC 4OO1I 3PO3G 4PNYA 1B4OA 4G7ZC 2N7JA 2JA6H 1GOZA 2B76B 3FILB 2DHZA 3SHQA 4RA8A 2KDEB 1V9JA 3HOWB 4NPNA 2UU7A 4YTPB 1EEID 4OXPA 5T1IA 3G7LA
chains in the Genus database with same CATH topology
2PLPA 3MJ5A 1D1IA 1KDAA 3R8BA 4ZYSA 3PMFA 3GTPB 3TBIB 3N52A 2CHBD 5C0XJ 1WTQA 2R6GA 1QG7A 3IXSA 4ABNA 1TR5A 1TS2A 1TVXA 4TRDA 2VUMB 1J7BA 2LUMA 1PTOB 3NTHA 4IKGA 4KN7C 3A54A 2F0IA 2H1EA 5A35A 3FPUB 1U4PA 4DAYA 4IFDH 3RFZB 2L0CA 3AECB 4FNFA 4IURA 1JALA 5DM73 3IT6B 1ZXIA 2X6GA 3MXPA 1F2ZA 1G91A 3Q8AA 4DF7A 4XDXA 4DFAA 2EXZA 3HOUB 1LTBD 1SNPA 2F0TA 3P63A 2O4XA 2R61A 4ZQ3A 3GP7A 2KEEA 4N6EB 2JWUA 4CGYB 2JYEA 1STGA 2KUMA 1WTXA 3FRPB 2MP1A 2X6LA 2FMCA 4K5XA 5KIXA 3BVZA 1NR4A 5EKKA 5KEEA 3M3YB 1EZ8A 3CKIB 3AN1A 3BZDB 3ZJVA 2F3VA 1R4PB 1BQQT 1BO0A 2ZXPA 2GRIA 4UDUC 1Q90A 4RGOS 2EYPA 2L1BA 3BK1A 4NMZA 5A2QL 3DWMA 1T5EA 1V8QA 4LMQD 5DAUA 3D6CA 3I70A 4ZK9B 1V43A 1GHKA 5HG2A 3A7AB 1HZ6A 1ZUD2 2V3PA 2J42A 1E7PB 2K5PA 1S5BD 5COYA 4PMBA 1V8CA 2H88B 1N63A 3I3CA 3K5NA 1B53A 1JW9D 1FNVA 2LFNA 3AE3B 1A2UA 5FKAC 2K32A 1DOMA 2DNCA 3DWQA 4ZUJA 1BR9A 5CV9A 4KGRA 1ICWA 4HROA 5BYSA 1RFKA 3PUYA 4YSZB 2K5WA 1TZOA 3A8KE 5FO9B 2JU6X 4OHJA 4C3IG 4BY7B 1HPCA 2AX5A 1JWBD 4J3OD 3PUXA 4XT1B 5HI1A 1B9RA 2B2WA 3SK6A 4B0MA 2K5DA 3TP8A 1JWAD 4KY5A 3E9SA 1HHVA 3T53B 4RCOA 1R9TB 5BN3A 2K5QA 3AB9A 2M56B 2WXHA 3T56B 3NUCA 1KNAA 2GA4B 1VJKA 4XWWA 4R9WA 4HEA1 2NVQB 3Q8CA 1S4ZA 1KH0A 3P4QB 3RPFC 4YWGG 1QLBB 3FPPA 4WURA 3RMHA 1L4ZB 2E74C 1KDBA 3T3NA 1WD0A 1F2YA 1FR3A 5JOBA 1I4GA 1S5ED 2IGGA 1FRDA 5IGEA 1V97A 5CBAE 2Q8RE 4TQUS 1CZGA 5K36G 1DOLA 2J0TD 5ELEA 1QOFA 3PZ7A 3QOJA 1V1OA 2KN4A 4RKBA 2F0NA 4IUUA 4D2KA 1EY5A 4A3GB 1FCLA 3NQTA 2BT6A 2K0PA 3I72A 3CWIA 4ULLA 1OQRA 3MWYW 2ZW0A 2HCIA 2C9OA 1F9PA 1STAA 1G291 2D62A 5EKIA 2R93B 3NTIA 1EIHA 4TKOB 1JR0D 5KYIA 3BVGA 2L9HA 4KMUC 5IODA 2M9VA 5JEAJ 1UNSA 4HAEA 1ILPA 4ZUIA 3L3OC 4M1UB 4NW2A 1VF5C 1XEEA 2VXWA 2SAKA 1WYGA 3GTLB 2AWNA 3J81L 4N9TA 5J22A 3OPOA 4XQQA 3P1HA 3BS1A 1SNOA 1EY8A 3Q24A 3S1NB 3ZGZA 2NVXB 1TS4A 1KNEA 1GAQB 4LLGM 1VF7A 1KABA 4OZAA 3AEDB 1NYRA 1YN4A 4K5VA 1E6EB 2WXOA 1DCZA 1FRRA 1EWHA 4IOIE 3N6RA 1RTOA 3L7ZC 4X3KA 2JEBI 1RD9D 3MXNA 2OEDA 4WORA 1EY9A 5JEAH 1MHXA 2MEKA 1VMPA 1Z47A 4XYQA 3J9CA 1LLRD 1FNWA 3IFDA 1D2BA 1BNZA 3D31A 3TEXA 2KECA 1SYEA 3K57A 2B2TA 2CJNA 4WH4A 2BBCA 2LMCB 1SNDA 3L9AX 4C2MB 5D14A 1QT9A 3D8GA 3P7JA 4KKTA 3LNNA 3NUHB 3URYA 1Q1BA 3QG1A 5HURA 2EYOA 3MA2B 3QO2A 1CA5A 2RMMA 3BWUD 3KK7A 4A3IB 1UEAB 2KACA 3S9WA 1R4QB 1DZ1A 4NZLB 3TP6A 3Q22A 3DMUA 1DD2A 2K01A 3AB5A 1M8AA 2ZT9C 5JJZA 1YQ3B 2YEPF 4R3DA 2AUJD 1SSOA 4IUPA 2ONQA 2KVMA 2RA4A 2WNMA 1BUVT 1B9MA 1SNMA 4YSXB 4C1NK 1MHHE 3B2FA 5G5HA 4KKJA 1PRTF 2OXPA 3H09A 3NXWA 5CYUA 4DU9A 4MACA 4REZA 4RF0A 1TWFB 2KQ4X 3RZDB 3AE2B 4CJ1B 4OVZA 1F2MA 2NYZD 4KY7A 2IGDA 2PQEA 2J4XA 3SXHA 3CRKC 5CV6A 1HUMA 3VA7A 1OFFA 3OW7A 5CV4A 2J7ZA 4KKUA 1VCIA 4ARIA 1CZPA 4A9AA 3Q69A 5DNFA 4FVMA 5CBEE 1C9FA 4XIGS 1LTAD 3VYSA 5M3MB 4XDDA 4KJOA 1WVLA 1NUCA 1KFYB 1N62A 1LTID 4S3SA 3KF8A 3NPPA 4RHSA 2DY8A 3N9YC 1PDQA 1MVKA 2EY2A 4FP5D 1RDPD 1E2WA 1MPEA 1WD1A 1QOBA 1M4VA 3ETRA 1ET9A 4DA2A 2CVRA 3JAME 4OW0A 3JAML 1EQTA 3EROA 4HSVA 1F77A 3MAQA 3T13A 1Y8NB 2JZPA 4YIJA 1T5XD 3SK8A 3HVDA 3TMEA 4WRDA 5G3LF 3QIAA 4GZYC 4WJWA 2VB3X 1NSNS 5D7GA 1QQRA 1VDZA 4XE0A 5NUCA 1C76A 2WKDA 2ON8A 4TQ1A 3GTJB 1ESRA 3PO3B 1NI3A 1T6BX 2BS2B 2VZKD 1PTOD 1BCPF 1H9RA 1LT5D 1STYA 3C1EA 1TKYA 1MD2D 1XXGA 2BTEA 2WU5B 4B0EA 2KQ3A 3FKIB 2XSCA 3T16A 1F9QA 1Q10A 1MGSA 3W3AA 5EE0A 2HQEA 2JXTA 1I4HA 5CV7A 4HTHA 1SBBB 3K5MA 2YEPB 1A6XA 3ZJTA 2QF7A 1J9OA 3NWSA 1B44D 2NWGA 3E56A 3VR3A 4K2KA 5KYLA 2F0JA 5IIFA 3FVQA 2DYOA 1A3VA 1ONLA 4MT5A 3MXUA 5BMGA 3S16B 1FFUA 5EQ0A 3EJIA 3S15B 1PTOF 1MI2A 4MIUA 2E2IB 1XLQA 1VDVA 1AZPA 2DLBA 1JOKA 3U4EG 1RCVD 4CKBA 2FBWB 1L0VB 3SE0A 1C4QA 1SYFA 4USAA 2RDHA 4PQXA 4L23A 1TU2B 2WXIA 2RPVA 4ZKBB 3NP8A 4ODGA 2FHTA 1LT4D 1FD7D 4DK0A 2PTLA 1PRTB 1ET6A 1VMCA 1ZEQX 2WXKA 1KAAA 2MJ8A 1N5XA 1QOGA 2HDEA 2V0GA 3NVVA 1T3QA 2ZXRA 5ELBA 2OHFA 3PIO3 1BOSA 4QMGA 5CV8A 1X3QA 3NQIA 1P7EA 4EVOA 2LKVA 1RF2D 4FXGC 3HVZA 4TMAB 2EYLA 3BG3A 3AU7A 1NYQA 4R8IA 3V2TA 1FFVA 4F8MA 1FMAD 4DN4M 2B39A 1PXUA 3I4LA 1XTCD 4U68A 5HHDG 3HZXA 1FXAA 4ME5A 5GXGB 1VR9A 1IGDA 3HUIA 2GI9A 3S1QB 1RM6C 2AQ3B 4Q0FA 2F0OA 2IL8A 1AEXA 3J7AF 2WXFA 1HEZE 2XWJB 3G6JB 3R93A 5EPLA 3A7LA 3AE1B 1Q12A 1ZYRD 2E75C 1G2TA 2MJ3A 1QB5D 4EE2A 4X3SA 5K36H 1AFPA 3PIP3 3VR6A 4YT0B 3P1MA 1GUOA 1Q3LA 5F2DA 2IGHA 2EKIA 2QCPX 5FK9C 5LL6X 3ITPA 2WP9B 4OO1H 3W5UB 1IYUA 4RHRA 3MEHA 1E10A 2LHDA 2INPE 3BDLA 2A69C 4K8JA 5AUKA 3S17B 1DOIA 2NVYB 1SE4A 2NN6G 2WINB 5M5WB 1UGJA 5J39A 1WRIA 3U52E 1R7SA 4C1NI 3ONAB 1SNCA 3VR9B 3SK4A 1AP0A 2KEDA 2BW2A 1B3AA 2EOTA 2EY6A 2F0GA 3NHHA 4DAVA 4KTAA 5FR3A 2ICEC 2SNMA 3ERQA 2DN8A 3VRBB 1K8OA 2F0WA 3NVZA 4IFDI 3S14B 5EBCA 2SEBD 3MZ5A 1WTVA 2QDBA 3ZQ4A 2N88A 4H2AA 1RWSA 1TT2A 1OXXK 1I3QB 3I57A 4Q2JA 1ZDXA 4IDIA 4A6QA 4RKLA 1N61A 3GTQB 2PZWA 1UAPA 1PLFA 2KCCA 4K2LA 3GB1A 3IAS1 3D4WA 4H0LC 3KQ4A 2C5CA 2E2DC 2BDOA 1C4CA 3TN2A 1P7FA 1XO3A 1HFNA 2QKIC 3V3XA 4QB4A 2NN6H 1YN3A 3HKZB 4BWGB 1ZPSA 3MHZA 1GJXA 2DY7A 2JE6I 3T4AC 2WDVB 3VR8B 2K7VA 3OIPA 4ZOHC 1WSPA 1OQQA 1GUSA 1N60A 2OF1A 2N9LA 3I9V1 3U9OA 2D9UA 4EQPA 5FO8B 4BBRB 3AE5B 1XCTL 2INNE 3K0YA 4EQNA 4U673 2GB1A 2LEKA 3O13A 1WTWA 3NBHA 4XWTA 1QNUA 4KKSA 2F03A 2WIIB 4ILWA 1CI3M 1H9MA 1VLBA 3DWAA 4F88A 5M9OA 5M3FB 1TWGB 3J7YW 4G57A 1SXTA 5I4DA 2J53A 3HOYB 4C3JB 2A74C 2IDYA 1TWHB 2IX3A 3TZDA 3LWEA 1TJEA 3FMCA 4C80A 2QILA 2PIAA 4KHZA 2B2VC 1TYGB 3PUVA 2BE5D 4Z9CB 3M4YA 2XIWA 2WDQB 4IALA 1KF6B 2Z4HA 4MN3A 4PMWA 5DEHA 4RFBA 2XRQD 3S2HB 4K6DA 2I38A 4K14A 2FUG1 3A8IE 4RAUC 2M0AA 5C4JB 1C79A 4C7YA 2KDMA 4GDLB 1STNA 2DWQA 2SDFA 2F0MA 3GS2A 2Z1CA 4P2CB 2PPBC 1D5XC 3AEFB 2Q8TA 1BCPC 3E0JA 1ZKOA 2X69A 4H44C 3HP3A 1CZWA 3CRLC 4CKEA 1YNJC 3NWTA 3K6OA 1NEKB 1GPXA 1C77A 1AW7A 2AQ2B 3J7AV 2RQXA 5TSSA 4ZKCB 2DNEA 1TQOA 1DJRD 3QJYA 2AUKA 2L55A 1HTPA 1PTOH 2WXJA 2CQAA 3MVVA 3GTGB 2ID0A 3WOFA 3FILA 3GTMB 5C3JB 1EY0A 1ZOYB 4HJGE 2D5DA 2WKCA 3U7ZA 2L4NA 1XLNA 2W3SA 5C4XB 4JWSC 3I4MB 3BYTB 3QOLA 4IUVA 1SSNA 1MBYA 3GTOB 1C78A 4A8XC 1KLGD 5JEAG 3EA6A 4J6HA 4A55A 4TQ0A 3SR6A 4CKCA 3ZYYX 2V4DA 2L12A 4FF3A 5ELCA 2LHEA 1U4RA 2NVTB 3C3LA 2QIEB 1CK1A 3D6WA 3BYYB 4B9WA 4OO1G 2A68D 2F0LA 1II3A 4DNTB 3FC4A 4RNAA 3S1MB 4CBVA 2EJGC 5BN4A 2OEOA 5EPKA 2JYOA 1LTSD 3LXFA 3Q8FA 1ENCA 3KLSA 3AEBB 5G3LD 1O80A 4WIPA 1UWMA 2LMCA 1V1PB 2BB5A 4LAAA 5CORA 1Z7TA 1H9KA 2VNUD 3TEWA 2L5TA 5E3FA 3AV8A 3L4PA 3GV6A 3CU7A 2PW9A 3MTSA 3RZOB 3WCQA 1SIJA 1QJOA 3HOXB 1I6HB 1BBXC 3KLSX 3FEWX 4PT5A 3W2DA 5KNBA 2JQRB 4A90A 1PUTA 1I4PA 3IAYA 1KRHA 1K83B 1ML0D 2CU3A 1EQVA 3W1SA 3W5VB 5D3IB 2MHVA 4C3IB 4OZBA 1GUWA 4R8NA 5C6AA 1ZDVA 2Q8IB 4EGVA 1PYWD 5C3EB 2I07B 5C4ZA 5CC4A 3M4OB 2EJFC 1L6VA 1F9SA 2CJOA 4DNRB 1RYJA 3P4RB 2VB2X 1Y1VB 4XQNA 1K50A 3TP5A 2KWDA 4NKLA 3KBGA 2PW5A 4NAMA 1XLPA 2BA0A 1EY7A 4C3HG 1TKGA 3BDOA 3AE9B 1KLUD 2N9KA 3NZ3A 4NJCA 1OXSC 2O5JC 1SYDA 1VRAB 2N55A 2KHSA 4FF4A 3IAM1 2NBFA 2TMPA 3OHXC 1EL0A 2LGIA 5T8IA 2EYFA 1CJEA 2WXGA 2B2VA 2EELA 2A6ED 2EYJA 1FO4A 5C0XI 1L0XB 5C4HA 2BS4B 1BCPB 2H89B 4BBSB 1FD6A 2RVLA 2MGSA 3GTKB 2DBYA 1TS3A 2NB0A 2CW0C 2WAQB 2RDGA 1HUNA 1VZ8A 1ILQA 5KNDA 1TWCB 4QUFA 2M19A 1A3UA 2JXMB 5IGCA 2PW7A 2F0FA 4X3TA 3SR1A 2LS01 4K8IA 3K5OA 1GXDC 2G9DA 2JYTA 1AYFA 1JWUD 3R3OA 1E0BA 1G8ZD 1FXIA 2IPKD 2KOLA 3Q6SA 2MJEA 4L6TB 1RODA 5EGTA 2A69D 1WTOA 1ZXHA 2B2WC 1YNJD 1XF5L 3A55A 1QE6A 2O2LD 2WXMA 1I4QA 2WACA 1O7LA 3H6MA 2WXNA 5HGTA 4IFDG 1YNND 2F0KA 1HXYD 3I8ZA 2F0UA 3SEBA 1NR2A 4NAWB 4HMJA 1LABA 4B9XA 2F0SA 3S2DB 1QF6A 5ISRA 2F0EA 1JQ4A 3P75A 5J1ZA 1WWTA 2B8GA 3HEJA 3J80E 2A73B 3DM1A 3AMUA 1DYQA 1DOKA 3T51B 5JXVA 1DGJA 1PRTC 1ZYRC 5MPOA 1PRTD 5CMDA 4XDCA 1JOQA 4KX6B 3R2TA 5EBDA 1OO9B 1JMLA 2KCNA 5JPMC 3VRAB 5BMIA 2D2CC 4QUCA 5A2QE 3R2IA 1IHZA 1IW7C 3ND9A 1SYCA 1AZQA 4ZRPA 3E6ZX 3SHLA 1K8MA 5D65A 3VR2A 2JA7B 1Y1WB 4KJNA 4JBWA 2K3UA 5EE1A 1JICA 2IX0A 1K51A 1YMHE 1C48A 1FGBD 1RTNA 3H91A 1JQYD 2JA8B 2QMTA 5G5GA 5KRUA 4N58A 2PVGC 1L5PA 2LJIA 1C4AA 1ENFA 5JVH3 2Z8LA 1CHPD 1LT6D 1YNTE 2D5GA 4HKZE 1W6KA 2E3TA 2F0PA 2TSSA 5AUIA 3H94A 3A56A 3RUZA 2ZW1A 5E4XA 1JRPA 4RGTA 3DHQA 4FYDA 4RH6A 4A3KB 2VZKB 2A68C 4HKQA 2IT1A 3KBXA 2RSNA 4JE3B 1I4RA 4A3BB 1LTGD 2EVBA 4KD3A 1SMYD 5CV5A 2K22A 4O42A 2F1MA 2A5HA 5M5XB 1ZE3D 1PZID 2PO4A 3UI3A 3M7NA 4C56C 2NZ1D 1MSGA 3AMZA 2WXPA 2I2YA 4O1NA 4OIKA 1B50A 1EZ6A 1FNUA 1JWSD 1STHA 2YYZA 3TZUA 3AEEB 1AN8A 2K03A 4PV1C 2KMMA 3LWUA 3K58A 4C3JG 2NTSA 1GB1A 1Z6HA 1PDXA 3D3RA 4JK1C 1ENAA 2B8FA 5ELDA 1L6UA 1D6EC 2PKOA 1EOTA 2W3RA 1D1KA 1FEHA 1QILA 1HZ5A 4C7ZA 2IW3A 1CM9A 2A6HD 1SB3C 1UUPA 3PZ8A 2JA6B 4WAFA 4OZCA 2V3NA 3PO2B 1PGAA 4PMCA 1G6ZA 2WXRA 5C44B 4J1MA 4G4KA 1CQFA 5C3WA 5C5LA 4AQ7A 3GV3A 3GO5A 2EZVA 4JPSA 2JX5A 4KI0A 3A8JE 2E2HB 4HR7B 1IW7D 5ELFA 1JE4A 2K05A 5EE3A 5FLXE 1SJHD 4US8A 3PUZA 1BXTA 1LT3D 2RSOA 4G7OC 1Q1EA 1SJED 4WQMA 2ENBA 3IL8A 2L32A 1I4XA 1O7YA 2JSVX 5K5PA 3IT4B 3HOVB 1TWAB 1A3TA 1PFDA 4IN3A 3Q0AA 1SFOB 2MJDA 1X3PA 3I91A 4KY6A 5BN5A 2LFIA 5I6WA 1EWCA 4BY1B 1GUGA 1QWYA 1A2TA 3OMCA 3MXGA 4RGNA 5IGFA 4NDXA 3BK2A 1EIGA 1ACCA 1SE2A 1WTPA 2BS3B 5C3XA 2E76C 4FO2A 3H8HA 4DAPA 4XXEA 4ITKA 1GB4A 1EU3A 4RCNA 1IBXA 4BA1I 2K28A 3EUB2 4X3UA 4YXDB 3HRDD 2K1BA 4MH8A 3I90A 3T3OA 3P42A 4QIWB 1DM0B 2A6HC 1VZ7A 2WXQA 4P16A 4TSSA 1STBA 3U2SC 5JAVA 4I7ZC 3PV0A 4HCSA 3LYYA 2AWOA 3OWEB 2F0QA 3DWGC 2BOSA 3WOEA 4YTNB 3WDNA 2B63B 4K6LA 2Q5WD 5I2YA 4LK1C 2SNSA 3DUZA 4YSYB 1BF4A 1QOHA 1SMYC 1Q8IA 3TP7A 5BYQA 1NENB 2JP1A 2PCFB 2MPMA 3HG9A 1HA6A 1JROA 5C5MA 5E4WC 4HRSA 2F0HA 2KJXA 1WTRA 2RBMA 3NVWA 4P6VF 3NK9A 3CIRB 1E0ZA 1F2RC 3LX0A 2WDRB 3MP9A 1OXVA 2W82A 1CQVA 4KV6A 2JA5B 4CJ0B 2FFKB 1RKNA 3HS0C 4GLSC 5IT9E 2NN6I 1SE3A 2EE1A 2EPBA 2FMMA 4A3JB 1I50B 4DQOC 3NVYA 1EM7A 4KHVA 1TY0A 3AE8B 4A3FB 4IQZA 4HN7A 3AEGB 4NP5A 1PZKD 3GQBA 5CR3A 1IYVA 3MC0B 4K5WA 3Q23A 3KWVA 4ZRZA 1PGBA 1NCVA 3LB8C 1SYGA 1V1PA 3K7AB 4N9PA 1HCZA 3VYRA 1CFMA 4Q5VA 1IUEA 4KN4C 1E2VA 3D4DA 1D4BA 3KUPA 3ABVB 1HA5A 2JEAI 1WGKA 5IGGA 3SVMA 2IX1A 2SOBA 2HDLA 3S1RB 2Y5CA 3P4SB 1JOOA 2HTME 3NRZA 5EJWA 2XWBB 1PFBA 2IJ0A 1C4PA 1UWXA 1OXUA 4CJ2C 1FM0D 4L63B 1CHQD 1JWMD 2NMQA 3J80L 2L11A 2XN9C 4KK7A 3QB3A 2QSDA 4MHEA 3AE4B 2X38A 1HFGA 5C2TB 2Y0SB 1F9RA 2F0DA 2YU9B 1QCBD 1FYCA 4LJZC 4ZHOA 1Y8OB 2I46A 1QKZA 2L1AA 1YNNC 1TY2A 4RWSC 4JWUC 2DYMA 1D5MC 4HMIA 1JORA 2ACZB 4BA2I 3B9JA 1TKEA 3C1FA 3SK5A 4A3MB 4A93B 1Y56A 1GUNA 4GDKB 1DONA 2J52A 2F3WA 4A3EB 5E1FA 4ARCA 4US9A 2PMVA 2XNAC 1F2RI 1I6VC 1B2TA 4WWMA 1IGCA 2JSOA 2QJLA 4L2YA 1PFMA 4FXCA 5C0XH 1H9SB 2BDNA 3C8YA 1LV9A 1O78A 4ZAIA 1S5DD 4C3HB 1H9SA 3H0GB 4DXFA 5I9OA 2MH7A 2WV6D 4JX1C 1RJTA 4N59A 1HQMC 3IKJA 3MFGA 3VQIA 1PZJD 4V190 3SFDB 1VZ6A 4V0BA 1XWEA 1IKMA 4FXKC 1J8IA 1BCPD 2W55A 3NS1A 3NSWA 3C46A 2R7ZB 1EYCA 2G1EA 1GHJA 1DXMA 1JB3A 1TS5A 4XTCS 2FJ2A 5CGKA 4BS9A 1E2ZA 1MSHA 1AWDA 4XT3B 4FF2A 2PMZB 5DM63 1KTKA 3NTKA 4M8AA 5M5YB 2F4IA 3TUOA 2G9HD 1IKLA 5EKLA 3X3MA 4IUNA 3RD4A 3AE7B 2BE5C 3K5LA 1GUTA 3DXJC 3TEZA 2OT2A 1CTMA 4L8JA 1HTLD 1F0ZA 2L52A 1PMRA 3SDZA 3W9CB 1XLOA 4UAIA 3KLRA 2LY7A 4L1BA 2HCCA 5AFWA 3RLFA 3OSOA 2R92B 3FDTA 1YJIA 4KD4A 4OGQC 2WQYB 2EDGA 5FOBB 2FINB 3OMGA 2R3ZA 1N5WA 1B9NA 5BYRA 4H13C 3BVMA 1PTOC 2MUYA 2XRSD 3E5SA 5LHY1 2Z4IA 2EYHA 1I7HA 5FLXL 4CQNA 4DK1A 4IUQA 3DWPA 4FF1A 3D4RA 4AS1A 3P20A 1J7AA 1KDCA 3VA5A 4RGMA 1X32A 5T1GA 1STEA 1CT1D 2XVSA 3J81E 2WU2B 3Q8EA 4M0WA 3MFYA 5FO7B 1QNKA 2ZXOA 3VR4A 3BDCA 5KNCA 2M00A 1LACA 1XCQL 1LTRD 3OOCA 2BCOA 3M85A 4LK0M 1JC7A 1L4DB 4LTUA 1CA6A 1XX8A 3P4PB 4RF1A 3K59A 2O5IC 4ID6A 2N0SB 1HRJA 2EY5A 2HUGA 1IL8A 4XQJA 4F87A 1ZP0B 4E6IA 2B2UC 3F2UA 3B2GA 1E9MA 5EPJA 4ZLTF 3ND8A 2CW0D 3C2PA 3EGRA 3HGBA 1RHPA 3TDQA 4CHTB 3TSSA 1U4MA 1W6JA 2WP8J 2BB6A 1SDFA 2A6EC 4OL7A 3CQZB 2V4IB 4Y7NB 2L83A 4MM3B 3HRZC 5LNK1 3PUWA 3EQLC 4A3DB 4QCLA 2B2YC 1EWYC 4IUTA 2Y5PA 1EEFD 2EY1A 1YJJA 4IZ8A 1S5FD 2EYMA 4I65A 5IGDA 3I73A 1H9JA 5E6JA 2EJMA 2K04A 1PFNA 1SEBD 1EU4A 3GD7A 4J8QA 4HSPA 5EE9A 2WS3B 2RKSA 1YQ4B 3VYUA 1YN5A 3AEAB 2ICIA 1SYBA 1U4LA 4B08A 5IGBA 1LO5D 5H8YE 1DOYA 1B1ZA 2B2TC 1EYAA 3IFTA 3QWNA 1G2SA 3EFXD 5C0XG 1K52A 5H92C 1A70A 4ZHPA 2KA7A 1FIQA 4WFN3 3SFEB 4DXGA 2M2LA 1BMLC 1TKWB 4DGZA 1SAPA 1NVID 2BA1A 3BIID 1MI0A 2KAJA 5JVG3 4AYBB 2H4OA 1EYDA 3OWFA 1Y69U 1BDOA 1NAPA 2B2YA 1EY4A 5LL6S 3AH7A 3NE5B 2E6XA 2NTTA 1PGXA 2HDMA 2WB1B 1K53A 2Y3AA 2PZUA 2K9XA 5KGUA 3HOZB 3OIQA 1XYIA 2AQ1B 2PYKA 3X3NA 1U9RA 4ZRQA 1J7CA 3I4NB 5JPNC 1HQRD 3CHBD 3DEPA 2W54A 1O7ZA 5IT9L 4KKIA 4EQOA 1A15A 3MHBA 3NBIA 3FAHA 2QEJC 4KGTA 5I2XA 1ROEA 1LTTD 4IFDJ 2E2JB 2WLBA 4XYOA 2PVOD 1WXQA 3PO0A 3ZJUA 3H3VC 3V96A 5D3DA 2PNRC 5I6YA 2F0VA 1D5ZC