4RGMA

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/immune system
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 62
structure length 223
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgmA01
1TY2A 3URYA 1SE2A 1D5XC 1I4PA 1CHQD 1JQYD 1KTKA 1XXGA 1RF2D 2NTSA 4K6LA 4RH6A 1PZKD 2AQ2B 5D3DA 1TS3A 1MD2D 4DXGA 1AN8A 1I4QA 1L0YB 1SEBD 2NTTA 1LTRD 1JWMD 3BVMA 5I4DA 3BVGA 1RD9D 2CHBD 3TSSA 2WV6D 5ELEA 1UNSA 1EWCA 1PRTD 1S5BD 2AQ1B 4RHSA 1TS5A 2IPKD 3R2TA 2AQ3B 1GOZA 4OHJA 2XRQD 1FNWA 3CHBD 1FD7D 4RGOS 5TSSA 1HXYD 1PTOC 1LTTD 1FGBD 1LTSD 1HQRD 1BXTA 3BYYB 4L6TB 1TS2A 2R61A 3MFGA 1LTGD 3MC0B 1LT3D 1YN4A 1BCPD 4RGNA 2RDGA 4RCOA 4BWGB 1PRTF 4L63B 1V1PA 1SXTA 2G9HD 3V05A 1KLUD 1PZJD 2O2LD 1B44D 1TY0A 2XN9C 1CQVA 1I4GA 1QILA 1ENFA 1D5MC 5FK9C 1TS4A 1LLRD 1PTOH 1SJHD 1PTOB 1SBBB 1B1ZA 4NZLB 1JWUD 1HTLD 1EU4A 2J4XA 1XTCD 3OWEB 1PZID 1SE4A 3SEBA 1I4HA 4TSSA 3BYTB 4RGTA 4RHRA 3DWQA 1ESFA 1SJED 1D5ZC 3EFXD 1DJRD 1BCPF 1S5DD 3GP7A 1EEID 1M4VA 1I4RA 1LTID 2IJ0A 2QEJC 3EA6A 1LT5D 5D3IB 1LO5D 1CHPD 1S5ED 4UDUC 2RDHA 1EFID 1YN5A 1EEFD 1FNUA 1LT6D 1S5CD 4Z9CB 1S5FD 4C56C 1PTOD 1LTBD 1PYWD 5FKAC 1EU3A 4O1NA 1T5XD 1SE3A 1D6EC 4RFBA 5ELBA 1ET6A 1PRTC 2SEBD 1I4XA 2XNAC 1RDPD 1F77A 2ICIA 3R2IA 2Z8LA 3BZDB 1G8ZD 1L0XB 1UUPA 1FNVA 2TSSA 4ZYSA 5ELCA 1JWSD 1STEA 1BCPB 1AW7A 3O13A 1KLGD 5ELDA 2XRSD 4RGMA 3W2DA 1HA5A 1LT4D 1V1PB 1PTOF 1LTAD 1YN3A 1DYQA 3DWAA 5ELFA 3R8BA 3BVZA 2QILA 1V1OA 1BCPC 1CT1D 1JR0D 1PRTB 1RCVD 3DWPA 4DXFA 1CK1A 3KLSX 1JCKB 1ET9A
chains in the Genus database with same CATH superfamily
5I6WA 3CCUA 4HIDA 1D5XC 2I1JA 3QHTA 3VAWA 4HMJA 2A6HC 3D6CA 2OJWA 2C7NB 4DUZL 2R2OA 1UE1A 3HIZA 3Q3FA 2E6XA 1C0AA 2OJRA 5G5GA 4TKOB 1SLJA 2CR5A 4A3JH 3KDFB 2WKCA 1N8RC 4FXDA 2WX1A 4GSWA 4GOPC 1MD2D 5BYRA 2FBWB 1EUJA 4PZ6A 2A1AA 1V97A 1HZCA 1VQDA 3EVQA 1EIYB 3NTKA 1OFFA 3L10B 4AWJA 1LTRD 3QIJA 2V3NA 2WB1E 4OZCA 1MSHA 1NBWA 1QG7A 3ULJA 4IO9A 1IUEA 3K0XA 1MHXA 3ZLZA 1L6VA 5IA7A 4G7ZC 3HOWG 3PVLA 2UU9L 5CV5A 5T1GA 3T51B 2KWUB 1FD7D 4LWCA 3E9SA 3I63C 4R3DA 2WAQE 1QCBD 2PZUA 1HTQA 2O5IC 2NB0A 2C7MB 4AOFA 1FGBD 4NB3A 1LTSD 3S2DH 3S2DB 1ZP0B 3EHVA 3AXCA 2ON8A 3ZNZB 1L7YA 4MTKA 4CYEA 2LEKA 2EQSA 1YITA 1BUIC 3H91A 3PCOB 3PHXB 4DHJD 2I5HA 2KEEA 3BG3A 4GKKQ 1XMQL 4C80A 5J2RA 1P1AA 3T13A 1A3UA 2HDMA 2YTYA 2GI9A 4JPSA 2JXXA 1RYJA 1YBYA 4NQLB 1JOKA 1FXIA 5CV4A 2G45B 3M3YH 1MGSA 3M3YB 1G2SA 2KN4A 3FPUB 2BH2A 4DR7L 2CHWA 4GN4B 4A3KG 5JEAJ 3FDTA 4GLVB 1JW9D 2G1EA 3U7DA 4YSXB 1EEID 2SAKA 2F0HA 1ESRA 3A9KA 2UXDL 3S16H 2V3SA 3GTPH 3S16B 1EY9A 3PGEA 2E5LQ 3BZCA 2KX0A 4C1NK 1YX6B 4HK2A 4J6IA 1IBKQ 1YOVB 2AKWB 4LFBL 2B2WC 3B6YA 2KUMA 4C1NI 5H92C 3QC8B 4EZJA 3J81j 5CMDA 2D3BA 1EWHA 1NEKB 3A1QA 4HDOA 4OWXB 2ASQA 4HSVA 1FXAA 1PTOD 2LXKA 3K81C 4YHHQ 1NJIC 2K7VA 1YJWA 3CSFA 2J7ZA 3PLUA 4UHVA 2JJQA 1SYFA 2CJNA 3ERQA 2M2LA 2BT6A 4DDGD 2BYTA 1WCMH 5IT9c 1VQ5A 1TBEA 4KSLC 4A3IG 3NWTA 4W9KA 3OW2A 1HNZL 1F77A 4DAVA 1GM5A 2F0QA 1OEYJ 1G8ZD 4HEDA 2CVRA 4ILWA 5JJKA 3R66C 1BF4A 3NHEB 1JWSD 3BS1A 1G6JA 4QB4A 5DNFA 4OIJA 5GAGC 3ZO5B 3KF6B 1V2YA 5HKHA 2QDBA 1PH8A 1PTOF 4BKTA 4JK1C 2EYJA 1DYQA 1A8VA 2A74C 1HRJA 3SHLA 4C2MH 1PH9A 1E1OA 4C2MB 1WH3A 1C9FA 3UE1A 1JB7A 3DXJC 4AYBE 2M0AA 1PRTB 1NCVA 1IW7D 2BBCA 3NG0A 2E2DC 3OAWA 3TS0A 2GBMA 2R7DA 4L1BA 3HOWH 1CHQD 5E6NA 5EKKA 3RN2A 3PIOA 1E7ZA 4K6LA 3IFTA 2NZHA 1N62A 1EOTA 2W82A 1ZGUB 2WXNA 2B2WA 1KRSA 4WJ3M 2XGTA 3VR3A 1WM3A 3WIMA 1OXSC 2UUAQ 4FJVB 3UIOB 2ZJDA 1P8LA 2QDLA 2E75C 3MA2B 2CU3A 4LW1A 2K33A 1XD3B 1I5FA 1ZE3D 3B1LX 2ZZPB 4RAUC 1K9MC 3U4EG 3IFWB 1TJEA 4FA6A 3AEAB 5JPMC 1KL9A 1WGYA 4KIKA 4JW0A 2MWSB 3RNEC 1V5OA 5DM63 5IP9G 2ZM6Q 2FXQA 5C3WA 5JJLA 2ZEQA 4IPGA 1WXAA 2HQEA 4DR1Q 3ITPA 4G7HC 4HRSA 3AE4B 2IX3A 4X66L 3S15B 5C3EG 4KV2A 1V43A 5FR3A 1Q8KA 2AWNA 4MGKE 1L1OB 2H88B 1XTDA 4A3KH 4A3KB 2HHHL 2L0CA 1YJ1A 1YNTE 4LTUA 4HTHA 1SYCA 2A5UA 3HP3A 1WM2A 2ZXOA 1I3QH 2KBNA 2PW7A 2MX2A 2E76C 1KDBA 4XT1B 1Q10A 4P72A 1PHJA 1XX8A 1TKYA 4XYOA 1I4GA 2VNUD 1RAXA 2H4OA 3D31A 5BN4A 4W9GA 1UELA 2EYPA 4K0KL 2XIWA 4HIKA 1W3SA 2UU9Q 2G4DB 1W6KA 3FKIG 2C7HA 5E3FA 4FN2A 4UY8C 2NZ1D 1D1IA 1UF0A 3QAQA 4JI8L 1KD1C 3CPFA 4TUUA 4DV7L 3BZKA 4XIGS 2DZKA 4N58A 2M19A 4A3IH 3I3CA 4A3IB 1KLVA 4AJYB 2KQ4X 2DAJA 1DOMA 1U4LA 2PIAA 5EE1A 3UI2A 4YTMB 3CSTA 1LTLA 1HZ9A 4LUZA 3Q3JA 1EEFD 4FF2A 1XO3A 1UBQA 4Z9CB 1XMQQ 3OSOA 2Z0DB 1DOXA 2D2QA 4JPBW 3TDQA 3VRBB 4F88A 1G51A 2MO1A 2SEBD 5ELNA 4DNTB 5M3FB 1VLBA 2Y3AA 3HEJA 4HJAA 1FCLA 1BNZA 3J80c 3GTOB 2MW5A 3ML8A 3M4YA 4R4QA 2Z8LA 5FLXE 1OQRA 1VQHA 2H1EA 2VXWA 4PMWA 2K14A 3SVMA 1KDAA 1SIFA 2LASA 3Q8DA 1XLNA 1AW7A 4BS9A 2QCZA 2VZKB 3K59A 2KT7A 3AE9B 1MJDA 2AUJD 2LGXA 2AYOB 3OMGA 1WGKA 1E10A 1TWCH 4D2KA 1E2ZA 1TWCB 2EJFC 5CGKA 4DUYL 1IYJB 1IZ6A 4ZUIA 4LFBQ 2GOWA 1FL0A 1EY7A 2LXAA 5DPRA 2KDFB 4DXFA 1V86A 1ZYRC 1TQOA 3KLSX 4WRDA 2O2VB 1IL8A 3NRZA 5AZGA 1JJGA 4IJLA 3VTUA 2LRUA 2BS3B 4REZA 4S0RA 1CTMA 2DJFC 4OONA 4GN3B 3TEHB 3K57A 1QLBB 4A4IA 5IP9H 2IL8A 3CPWA 2WDVB 2K75A 5CHFA 3SR1A 2AQ2B 3CWIA 1HNZQ 3MTNB 2UYZB 2A73B 5C3EH 2D0OA 3O65B 2KDMA 1GB4A 1SIJA 1VRAB 1OXVA 1TXYA 1O80A 3BVMA 5FLMG 3GB1A 1SSOA 3M4PA 4G11A 4KGSA 2Z9HA 1KIXA 1DOLA 2CHBD 4DHZB 3TRZA 2F1MA 4ARCA 2R7ZB 1BO0A 5ELEA 2L83A 3ECIA 4OZAA 3TEWA 3BINA 3ND9A 3MVVA 2GVAA 1GXDC 5IN7A 3Q22A 4KHPL 2W54A 1J6QA 3GTJB 2NVTB 2V3PA 3BJUA 4H0LC 5C44B 3F1ZA 2CW0D 2K52A 1G2TA 1JORA 3J81i 4I6LB 4PQXA 3U8ZA 5DPTA 1LTTD 3D3RA 3K7AB 3M3JA 3FKIH 4RG1A 2M00A 3FKIB 4ZRZA 4QGUA 2JT4B 4U68A 1WSPA 1YN4A 3U7ZA 3RLNA 4JBJA 2K9XA 1XLPA 4GOCA 2IO1B 2D11A 2J0MA 1ILPA 1I42A 2ZJPA 2ZNVB 4IC7B 2RSNA 4NJ7A 1RODA 1WTHA 3CC4A 5D7GA 1HZAA 1WI0A 2A6HD 4KY6A 1LLRD 2D0PA 5MPOA 1JRPA 4JE3B 3H15A 5M3MG 2RDFA 5D14A 3HHMA 4LJPB 2WXIA 5CR3A 1IGCA 1RTOA 3A8KE 5IOIA 3T8MA 4TQUS 4X66Q 4KK7A 1EYDA 5J17A 2OT2A 2WXKA 3P4SB 2W3RA 1GUNA 2BPSA 2LVPA 3DOWA 3A8JE 2EKIA 1NAPA 1IKLA 1II3A 2VL6A 4IUQA 4GLXA 1XJVA 2K03A 1K8AC 2HHHQ 2D07B 3BK1A 3EJIA 4ANXA 1S5ED 5J3BA 3NVZA 2IDYA 4BBSB 4R8IA 1HHVA 1VS0A 1E3PA 4DAPA 1YNJC 3GTQB 5C4XG 4OELB 1NR4A 2JE6I 4BKGA 1S5FD 2R3ZA 3DEPA 1BMLC 4TKNA 4EQNA 3PO2B 2IW3A 1NTGA 2L9HA 4W9JA 2K0PA 4DK5A 1QUQA 2N55A 3NZ3A 4G0NB 5GMVA 5AUIA 4K0KQ 3SE0A 1RFKA 4QF4A 4Q2JA 1D3ZA 5IE8A 3PV1A 4LNIA 5EBCA 2W9NA 4M01A 3EBEA 2VRRB 2QC8A 2KECA 3OTOL 2EPBA 3Q3NC 4W9CA 1YVCA 3NQTA 4WH4A 1LYLA 4KZ0A 3ULPA 4LF7Q 4XDDA 5KYIA 1KAWA 1PA6A 2GBKA 4B9KA 5IYBG 5FLMH 3MAQA 1CT1D 4KKSA 1YI2A 4JBKA 2MUYA 5L95C 2SDFA 2NBVB 4NJCA 1YJ9A 1I6HB 3U30A 4LDTD 1KHIA 1SE2A 1S3OA 4HCSA 5CX3A 4TQ0A 4DA2A 1JJ2A 1ZKOA 2XSCA 3L4PA 3BU2A 2N9KA 1X6OA 1YNNC 2DN8A 2IY5B 5KIXA 1ZW7A 2FUHB 4NAWA 2EIFA 4M8NA 2UU7A 3MC9A 1YIWA 2CH4W 4XX5A 1CI3M 1RWSA 3VA7A 2NMQA 3IG3A 4GNXB 2EDGA 4MZ9A 4RA8A 3SDLC 2IGDA 1XNQL 5EBDA 4M0WB 1A2UA 5I4DA 1XWEA 3BVGA 2PI2E 5BMHA 4Q0FA 1HJPA 2AHOB 4ZUJA 3P7JA 1HR0W 2OOBB 1UNSA 2UXBL 4CJ1B 3IRBA 1Z6HA 1A62A 4DUYQ 2K50A 2GBNA 3H7SA 4F1SA 2IPKD 2ZXRA 5LMNW 4DKAC 3ETRA 4X65L 2ES2A 2G3QB 3NWSA 2JWZA 2N1WA 3CHBD 3Q14C 3WCQA 4XYCA 5C5LA 3Q6SA 5IGDA 5IY0A 4RKLA 1Y1VB 4IPHA 5IGBA 4DR2L 5BR8L 5M3MH 2LVQA 1EQQA 1MI0A 1YHAA 5KNBA 4YCVA 3I57A 1WMHB 1FD6A 1HUMA 4DV5L 3L0OA 2AWOA 1HTOA 2IY0B 5L83A 4R4CA 4BWGB 2V1CC 5IGEA 4L63B 3H6NA 3KWVA 3VYUA 1KLUD 3KJOA 2BH8A 1OEYA 1TY0A 2LSSA 4LCDE 1CQVA 2LUEA 2B76B 1Q0WB 4JI1L 4JYAL 2Q8RE 2BYVE 2L00B 1HTLD 5C4XH 4AQ7A 3SEBA 1SE4A 4KHPQ 1OGWA 2CH4A 3NZSA 2WACA 5IP4D 1E0ZA 1N32L 1E90A 1ML0D 1U4AA 3DLLA 3KW5B 4BY1G 2YLMA 2RR9A 3IAM1 4PMCA 4BVUC 2IO3B 1VQNA 2FNJB 2Q8IB 1JROA 3DMUA 1X56A 5JVH3 3FILB 4JLCA 5FR6A 3R7QA 4LFCL 3RNCC 5CV8A 2J0KA 2FAZA 2NN6G 2PMZB 4YWLA 1GUWA 5GROA 2KN5A 2KVRA 2RHQB 4OGQC 5IYBH 3JAMc 1C7YA 3TMEA 2L7RA 4B9WA 1PRTC 1EQTA 5EE9A 5J22A 4MT5A 2QGQA 2E74C 1DGSA 5IWAL 4DV1L 1GUGA 3UDGA 4B3ML 2IX1A 1XYIA 1VMCA 3RPFC 3RFZB 5IGCA 3MXPA 1TVXA 5NUCA 2A69C 1RIPA 3HKZE 3S1QH 3WAOA 3S1QB 2JWUA 1CA5A 2K05A 2F0WA 1QOGA 1GUSA 2D62A 3DQVA 3DWAA 2WDTB 2V4IB 2BVCA 3TBLD 3R93A 1ZEQX 1PFDA 2NWGA 1DD2A 2BS2B 2NN6I 4ZLTF 1U4PA 4L5RC 2R92G 5KYLA 4OXPA 3Q3MC 2FCMA 3TN2A 4JL9A 2HE7A 3MWYW 1I4PA 1GUTA 3I8ZA 1QVFA 2PW5A 2R93G 1QOBA 1TR5A 3CRKC 1I35A 4JI3L 3VUWA 3NK9A 1PGAA 1Q5WB 1B9MA 4DR4L 4FLHA 2BDOA 1PXUA 3D6WA 1TZ1A 4DXGA 4HDQA 3I91A 2BA0A 1N36L 2HJ8A 4W9LA 1JQ4A 2YEPF 3OTOQ 3Q6BA 4DV0L 1VQPA 3TJPA 2LRWA 1QOFA 4NAMA 3LYYA 5JZEB 1JMLA 1OQYA 1T0RC 1RD9D 2LVOA 2QA4A 2PVOD 4NNJB 1QOAA 4KJOA 2BA1A 3AE8B 3H7PA 3LGJA 2FCQA 4J3OD 3IHPC 3OWFA 5AFWA 5FO7B 4FDBA 5A35A 5C4HA 2RHSB 5LMUL 3K6OA 2XBBC 1DGJA 1KRTA 2L8JA 1Y56A 2SNMA 3P4RB 5D65A 2IHFA 3NP8A 2L4NA 3C1FA 3K7UC 4TRDA 3FC4A 4WFN3 2C5CA 4JI5L 1WRIA 3QJZA 2LWPA 2KQ3A 1PLFA 4LF5Q 1HA6A 4ACFA 4DDID 1HTPA 4IG7B 5IGGA 3FHWA 3T1YL 5G5HA 2VUMB 1NVID 2CHZA 2F0GA 3ALBA 2MBOA 2KO3A 3H3VH 4DK6C 4NQKE 1VMPA 2KYWA 4HPLB 3T1HL 1ZYRD 4E74A 4BY1H 3V05A 4BY1B 1XNQQ 1ZOYB 3ZJYC 2VQFL 1AWDA 2OTJA 1JWAD 4HXDA 3SR6A 2UUCL 2L55A 4BBRB 2PLPA 5JHAA 2UXBQ 4C4VA 3AULA 3CCLA 5ELOA 3PHWB 1QE6A 2NN6H 5J39A 1D4BA 1Q81C 4X65Q 2LFIA 5AZFA 4HCEA 2F0JA 4A8XC 1IP9A 1IYVA 5GADC 4V0BA 3G6JB 3W1YA 4BA2I 2NBUA 1C76A 3JSVA 4KVGB 2NVQB 1NYQA 2KQSA 4DV5Q 4X3TA 1M94A 2WXGA 2CJOA 1N63A 3Q2AC 5BYSA 1BBUA 2JN4A 2MP2B 1EL0A 4CHTB 2IWHA 1NYRA 1I6VC 4L5SA 4WORA 2C5LC 2B2UC 2J0TD 5IYCG 1K3BC 3ML9A 4EQPA 1BQQT 1JJCB 1H95A 4JI1Q 1WD0A 1C4QA 4K6DA 2KC2A 4IUNA 3E6ZX 2N49A 2R92H 4MN3A 2XNAC 1K8OA 4TQ1A 5KGUA 1DOYA 1F2RI 2L05A 3J7A5 1E2VA 1UUPA 2ALYB 2WKDA 1N32Q 1HPCA 3NBHB 3NPPA 2R93B 2R93H 1LM8B 4K8IA 3K8AA 5JJZA 1GKHA 4YWMA 4WWMA 2NVXH 1RL2A 2NVXB 2Z4HA 2PVGC 1STYA 2F3IA 3ZXRA 3BIID 1ZXIA 4FBJB 1D1KA 2KHIA 1PYBA 2IHEA 4HJ9A 4LFCQ 5T8IA 3N9YC 4FXKC 2Q2HA 3PZ7A 1F9JA 2IYDB 2DYMA 4NJ6A 3SK8A 4BOSC 2HCCA 3MHBA 2KDBA 4B3RL 1EWYC 2KCTA 3VUXA 1UWXA 4ANVA 3CU7A 4J15A 4JX1C 2ZTCA 3PUVA 2I0QA 5FOBB 3HOUG 1MPEA 3RMKC 5EPKA 3STBC 5IWAQ 4OX9L 4DV1Q 4B3MQ 1WE6A 2RSUA 1YNJD 4FULA 3CMAA 1SEBD 5IO9A 1LV9A 4HEA1 1P98A 2B2UA 2WIIB 4C3HG 2JA9A 3VQIA 1SDFA 1SB3C 3T9LA 3RNBC 2INDC 2JXMB 3KUPA 2QDFA 3AEEB 4K2KA 3CF5A 4LUOA 2KTRB 3B2FA 3V6CB 3MHZA 3KWLA 4QIWE 2AL6A 2FMCA 2WXQA 3R2TA 1GNUA 3KUZA 4DR6L 2PI2A 4MEMA 2VB3X 3DBSA 3MEHA 3U4ZA 4MGZE 2WNMA 3AB9A 2J7QB 2F0TA 3HRDD 4RMFA 1T5EA 5HFYA 4JI3Q 2WDQB 1JWBD 4DR4Q 4N8FA 1WJNA 3M63B 3CQZH 3L3OC 3CQZB 4JOIC 3APCA 1C9OA 2MHJA 1N36Q 2JYEA 1R9TB 3QOJA 4DV0Q 4IOIE 4JG2A 2IGGA 1KFYB 4B3SL 1F2MA 1X3FA 3E3XA 1VQJA 1M1KC 3QA8A 1EFWA 1BR9A 3B2GA 1I94L 3WDNA 2J53A 1RHPA 1YNND 5CV9A 4ZOHC 3VUYA 5LMUQ 2E2HH 4DQOC 2E2HB 4TSSA 5IYCH 4HROA 4RGTA 2DZIA 4GXBA 1GB1A 4KKTA 3K0YA 3IKJA 1MG8A 3EQLC 1L0VB 4AH6A 4JI5Q 3RULA 2ZW1A 4KY7A 3EA6A 2F0LA 4P75A 3QG1A 4O0AA 3HRZC 4G7OC 2X38A 4GDLB 4CHKA 3T1YQ 4O2DA 4NXML 3GO5A 5DCNA 2CQOA 4HJ8A 4HLEA 3GTGH 3T1HQ 2DJGC 3GTGB 1YN5A 2L3ZA 4WJQA 1YQ4B 5BMIA 2Q8TA 2VQFQ 1FM0D 1V81A 2UUCQ 3DBHI 1BDOA 4YY3L 2KENA 1EU3A 4XXEA 2LUMA 1VQ9A 4FXCA 4A3LG 2JA5B 2BB6A 1D6EC 5ELBA 4GOPA 2VY3A 4PG3A 2RD0A 4JOIA 1KM7A 2K3UA 2WXRA 3LJ3A 3N3KB 2P5ZX 2XK5B 4UP8A 1WX8A 1LUZA 4IDIA 1N61A 1V9JA 1H9SB 4MACA 5ELCA 1N6ZA 4AUQC 3D0FA 3TUOA 1GUAB 5HURA 2JX5A 3VR8B 3HOUH 4HKQA 2LFNA 3HOUB 1A3VA 3AQQA 3S1MB 1N60A 2MH7A 2N9PC 2Y5BB 3EUB2 1LT4D 3NENA 1EYAA 3JC66 2CCZA 1K8RB 2WGSA 4C3HH 2BYFA 2RPQA 4C3HB 3RCZA 4MJSB 2DBYA 3LXFA 2B2YC 2BGFA 2LHDA 1K8MA 4U673 2XEWA 1DZ1A 3D4DA 1CZWA 2I46A 4XDCA 5JJIA 3P1MA 4ANWA 5CBAE 1LM0A 3DPDA 1DOIA 1T9HA 1EF1A 2RSOA 3Q3OC 1PH3A 3TP7A 1C4PA 3K9OB 4RH6A 4AP4C 1A70A 2K1BA 3PGZA 1JB3A 4MHEA 4HIOA 1N34L 2R7FA 4M8AA 1HEZE 2D10A 1B9RA 2ZW0A 2UXCL 3M9BA 4I65A 3QWNA 2BB5A 3AEGB 4PS7A 1WTOA 4IQZA 4DU9A 1KH0A 2WV6D 2DWQA 1VQIA 3HOVG 4OWWB 1PRTD 3RUZA 1NNXA 2Z4IA 2K5PA 1CSPA 5G55A 1WJ4A 5C23A 1V80A 2MBQA 1VR9A 2B8GA 3DM3A 4L8JA 5M3FG 3ICEA 4OHJA 3DBLI 4WURA 3RNGC 4GGQA 3SFEB 2A69D 2QW7A 1XCTL 2I1KA 4BKSA 4B3RQ 2D3CA 1YZ6A 3K80C 4QUCA 3F2DA 4K2LA 1BBXC 2XVSA 1HNXL 2L52A 2KCCA 3TMPB 3W5VB 4HIMA 3GE3C 4MM3B 2OQKA 2JPHA 1VQAA 4R9WA 1VZ7A 5E6JA 4OX9Q 1B70B 4LUVA 3A9JA 4V190 2XTIA 3CAMA 1PRTF 4YWKA 3PRPB 1PUTA 3NTHA 2G9HD 4KY5A 1E0BA 1JC7A 4DAYA 1VJKA 3E56A 3A5ZB 1EY6A 2GLSA 1OXTA 1LGRA 3VR4A 1HZBA 2NPTB 3W1BA 3GTKH 3CW2C 4AIMA 3GTKB 1MHWC 5EGTA 4KI0A 2KLCA 4KKIA 2Z6BA 3KBGA 5I9OA 2IT1A 4DR6Q 3TZDA 2KLGA 4A76A 3S15H 2KFKA 1F9QA 1OTCA 4A3LH 3MZ5A 1HFNA 3A54A 1SNQA 4I7AA 1MVKA 3L54A 1WZ3A 4LK1C 2R7ZG 4BBNF 4EOYA 1Z47A 1IBXB 5DM73 3W9CB 3PIO3 3S2HH 1FFVA 4PS3A 3S2HB 1EWIA 3RZWC 1EIFA 1YHQA 3RUIB 4HJ7A 3ZJUA 2N78A 2ZPNA 3RMHA 4B3SQ 5C44G 1FPYA 1LTBD 4IWQA 1EYGA 3NTIA 1I94Q 3N1ZC 2KVMA 5EKLA 3DBLB 2L0TA 5I2XA 1U9RA 3S1RH 2QCPX 3S1RB 2X69A 3R2IA 4J1MA 5HY6A 3P2BA 1L0XB 2RQXA 5I2YA 3PS6A 5BN3A 4CDEC 4XQJA 4LF7L 2NBWB 3F2CA 3L16A 1YN3A 3N6RA 4KD4A 1HZ5A 1IPGA 3T3OA 3TBIB 4NXMQ 5ELFA 3TEZA 2N9EB 2PJHA 1V1OA 3RD4A 1BCPC 2DNEA 3ZXVA 5K36G 2PO4A 1RCVD 2JY6A 4B95A 1STAA 3AU5A 2B29A 2FFKB 3HOVH 4ULLA 3HOVB 4FVMA 4YY3Q 3APDA 1IHZA 3ZNGC 3UDIA 3WANA 4WJPA 2F0KA 5KNDA 3F2BA 1NY4A 5M3FH 3GD7A 1AP0A 2KD0A 1JOOA 3U9OA 3GTOH 1S40A 3KF8A 4ASWC 2JF5A 4A3MB 1X65A 1A6XA 2VZKD 1E8WA 3IBEA 2JZ3B 4BBSG 2NR2A 3MC8A 3I4LA 3KOJA 4P16A 4HKZE 4UP9A 2BKRB 4WJNA 4WWNA 4PMBA 3PO2G 2AL3A 3V6EB 2VH1A 1SE8A 4FXGC 3HOXB 4W9FA 3H3VC 4RHSA 4Y52H 2HTHA 3DUZA 1K51A 4ARIA 1R4QB 3V60A 3IFDA 4ID6A 3RZFA 2F0FA 2LMCA 4DNIA 4DXAB 4IFDG 1STGA 4ZRIA 4GN1A 3ZTCA 2EMSA 2MNAA 1TZOA 1FYCA 5KHOA 1YEZA 1N34Q 1J8IA 1WXMA 4EQOA 1SF0A 1VQ6A 1E8XA 2UXCQ 1WTQA 2VZAA 4X6AH 4ZDVA 4E71A 5DAUA 1AH9A 1V1PA 2B2VC 4LF9L 3L9AX 1J7CA 3NSWA 2XN9C 2R7ZH 5FK9C 3DVNV 1ENFA 4QMGA 3L0WB 1TWGH 1TWGB 1YHBA 2N8NA 3TP6A 3MJ5A 4ZHOA 4YT0B 1E22A 2J4XA 4C3JG 2Z0SA 3GTJH 4R4TA 2BS4B 4DFAA 3AFQA 2NVTH 4A3DG 4CQNA 3STBD 4AS1A 4ZAIA 5C44H 1JALA 1B9NA 3KJPA 2RF4A 1NENB 3B0AA 1LFDA 4IFDI 1S5DD 3K7AH 3LB8C 3T4AC 1SYEA 1W6JA 3DWMA 4NW2A 4OEMB 4UPAA 2NCNA 3R3OA 1AZPA 4N59A 3OMCA 1HNXQ 4KGRA 4N9F4 1PFNA 2CU1A 2M4NA 2KOXA 1ZXHA 2JP1A 3ERSX 2HIXA 3ZTDA 3P20A 2VQEL 5BMGA 3U4VA 1T6BX 1R7SA 1ASYA 1T0QC 1EFID 1WI5A 1SYBA 1BKBA 2C9OA 2KEDA 1S5CD 4BA1I 3CC7A 3G7LA 1QKZA 1B53A 4W9IA 5E6PA 2D5GA 3WA0A 2JA7B 3I3TB 5DPWA 2PPHA 5FKAC 5EKIA 1Y1VG 4O1NA 5F2DA 4WWPA 3C46A 2O5JC 1T5XD 3EN2A 3TS2A 2F3VA 3RLOA 5K36H 3W1GA 4C3IG 3PIPA 5D6JB 1RTNA 2HQLA 1FR3A 2WINB 2DGYA 4BOZB 2DNCA 1RM6C 1I50H 1C4AA 1I50B 4CDFC 2LHEA 2NZOA 3PTFC 1WJJA 2PQAB 3HGBA 5BO4B 2N3SA 4PV1C 1V49A 4J8QA 2WU2B 4L2YA 1STEA 1F2ZA 2KWDA 3ONSA 4CJ2C 1Y1WG 4C7ZA 1VQBA 4L5QA 1HCZA 4RGMA 1NI2A 2OEDA 1S3SG 1ICFB 1V8QA 2K5VA 1TYGB 3PRZA 1EIGA 2FJ2A 1WIAA 1L4DB 4M8MA 1LTAD 3V61A 1UAPA 2O6VA 3GQBA 4BBSH 2L12A 3BVZA 3NBIA 1ACCA 1IXRA 3GTQH 2GRIA 3AI5A 4F8CB 4OVZA 5D94A 2QKIC 1JR0D 5AJ3L 3KBXA 3PO2H 3EECA 3KYHC 2PZWA 3PLVA 4IWPA 4P73A 3KYDD 3OYYA 3S24A 1L6UA 4H13C 3VR2A 4DN4M 2I2YA 4KD3A 3HK0A 1TKGA 1QZHA 2FIFA 2KCNA 3NBHA 1WGGA 3A9KB 4CKCA 2GBJA 4IFDH 4N8X1 1ICWA 1AN8A 1L0YB 1W2BA 1IL2A 4X3UA 4EGVA 1E6EB 5C1ZA 4MH8A 1FXTB 2W55A 5LL6S 5IT9E 3ZKJC 3TZUA 2IX0A 3A1QB 2C35B 4A20A 2WXMA 2Q2IA 4K5WA 1F9RA 1EQVA 1E7VA 1I6HH 1VQFA 2XRQD 4RF0A 1ZXTA 3LWEA 1QZEA 4DV3L 2H89B 4LK0M 4URKA 3JAML 1RFAA 1HXYD 4BKSD 4C3JH 3VYSA 4LF5L 4C3JB 3Q8CA 4PNYA 1YJJA 4A3DH 4A3DB 2WYQA 2V0GA 1H9RA 1D2BA 1QNKA 2R61A 1AARA 1IBMQ 2F0UA 4EFOA 3HKSA 3HUIA 3S2AA 2K01A 2ZPYA 1UGMA 3J7ZC 1WY8A 1TGZB 1A2TA 3TEYA 4F87A 1HH2P 4JCVE 2PPBC 2ZXPA 3C1EA 2KTRA 4GLSC 4H7BA 4J6HA 4X57B 3A33B 3HG9A 5JHBA 2HCIA 4KGTA 5M5WB 4GLAC 4IN3A 2ZVOA 4I6PA 4ZK9B 3NELA 2HT1A 2WP8J 4X62L 4KLKA 4BY7G 1YIJA 2GVBA 5H1SE 2EVBA 4RNAA 4YWGG 2RA4A 1ESFA 1SNOA 1D5ZC 1Y1VH 3EROA 1XNRL 1Z5SB 3CCEA 4DHZE 2LD9A 3KDFA 4C3IH 3OG5A 1J7AA 4C3IB 2AX5A 5DPSA 3Q69A 4LNNA 1FCCC 1X9NA 3T53B 1P3QU 2IY1B 3RLFA 4WAAA 1EY0A 4LMQD 5IOCA 2K8HA 2KC1A 1WFYA 3G71A 2N7JA 3DCGA 4Y7NH 2M17A 4FHJA 4Y7NB 2FMMA 1MHHE 1T0YA 2IBIB 1Y1WH 1Y1WB 1CKNB 4C00A 2A6EC 4LF9Q 4XT3B 1GUOA 3VTWA 1UZXB 1AE2A 4KIKB 4IFDJ 3SHQA 4DV4L 3MJWA 5HG2A 2KMMA 1CA6A 1E7UA 2LJ5A 1N33L 2KHSA 3SU8X 3W1SC 1EZ6A 4P74A 3FPPA 3L7ZC 1XQQA 2FUG1 3X3MA 1K73C 2VUMG 3TIXA 4K5XA 2OQ0A 1A5RA 4KJNA 4ANUA 4US8A 2A19A 1QVGA 3AEFB 3MFYA 1FEHA 2INCC 2JEBI 2EYHA 3PMFA 1B3AA 1K53A 4BBRG 1F2LA 2BE5C 1FGUA 1YQ3B 4YTNB 1M8AA 1PH4A 1Q7YC 2VQEQ 1UWMA 2N7EA 2J52A 1FO4A 4CGYB 2Z0EB 1C1YB 1R4MI 4XE0A 1JMCA 4ME5A 3MTSA 4QUFA 4DK1A 1SROA 3RZDB 3AE6B 1WZ0A 4ITKA 1Y14B 4K14A 5EPLA 2DNFA 2KMAA 2F0IA 2I5LX 1TT2A 3FRPB 1QWYA 2B39A 3G6EA 3MP9A 1X55A 5E7NA 1P7EA 2XK5A 2WAQG 1Y8NB 2JU6X 1CKMA 1PH6A 2KANA 1PZKD 1QZGA 1FRDA 3X23A 1J8CA 2YTVA 4GDKB 4BAXA 1GD7A 3M95A 1UE7A 1XMOL 3ZVVA 4TV3A 2JA8B 4NY0A 2INPE 2K5WA 1JWMD 2O4XA 4YIJA 3TSSA 4ZHPA 4MJSA 3J80E 4KN7C 4JI0L 4IM0A 4FJYA 3W1SA 2RBMA 3H94A 2LGDA 3SK4A 1GHKA 2SNSA 5AJ3Q 5IODA 1L4ZB 2F3WA 1K52A 4LJZC 1BT0A 4CKBA 3I4OA 1Y8PB 2J0JA 4JQWC 3CCVA 3U58A 5DLQE 1DXMA 5A2QL 4BY7H 2JQRB 2OXPA 4BY7B 1K8GA 3WAMA 4LF6Q 3AE7B 5KEEA 2N1VA 1BCPD 5E1FA 1CJEA 2LGSA 3AMZA 2KTFA 3KF6A 2WXLA 2AMCB 1L1OC 1PVOA 2EYLA 3RN9C 2YEPB 2EOTA 2LZ6A 3JYUA 4G50A 4EZKA 1Z2MA 4FADA 1QILA 3OPOA 1TS4A 3RZOH 3RZOB 1SJHD 2CWPA 3EGRA 3NOBA 2YTXA 1R4MB 3VVWB 3RNAC 2OWOA 4DV3Q 4GB9A 1BCPF 4ZKCB 2F0DA 4LNQA 2KAJA 2N9LA 2TMPA 2OEOA 1HNWL 1VD2A 3KH0A 3DHGC 4IM3A 2VUMH 3DHIC 4OL7A 4KN4C 3C0RB 4OO1G 1A15A 1EF5A 1VQGA 1E2WA 1EZ8A 2I07B 2ZJRA 2AWTA 1TWFH 2K28A 2ZTEA 1TWFB 5J1ZA 1TWHH 3I56A 3N20C 1TWHB 3Q8AA 3NJTA 5C0XG 4BBRH 4PZ8A 2FHTA 3QJYA 2CKZB 4AYBG 3CF6E 3IAS1 5L37A 1J0GA 2F0OA 3A0JA 3ZDTA 2PE6B 2A8VA 3UGBB 2VS1A 1GHJA 3HOYG 2MA9B 4X62Q 2JYOA 1P7FA 3NY5A 4KDLB 2KFJA 2CKHB 4AQYQ 1L1OA 4HVBA 2A68C 5LHY1 1MSGA 1XNRQ 3SK6A 2HDEA 5GAEC 1AE3A 2NVYH 3UQBA 5JPNC 2NVYB 2WAQB 3MHSD 2XRSD 1IBXA 2NVQH 1H4RA 1VQ4A 3NVWA 1ZDXA 4OO1I 5KRUA 4HMIA 2O6VD 1B7YB 2YU9H 2B63B 1CQFA 4CBVA 4RCNA 3J81c 2YU9B 1Y8RC 3UI3A 3DWPA 4LFAL 4G3XB 3B9JA 4CDCC 2H5XA 5LXIB 5C0XI 1JCKB 2K5NA 3URYA 3TCAA 2G9DA 4DV4Q 2F0VA 3JW0X 4MIUA 1XLQA 4MH0E 1XXGA 1N33Q 2LKVA 1G91A 4CO7A 5C5MA 1PH2A 2CS4A 3M7NA 3PUZA 1PQSA 3E0EA 2JZPA 2QJLA 3AM9A 1XCQL 1L0WA 2PMZE 3M4QA 2IO0B 3CXCA 1PH7A 3I4NG 1H8CA 1K83H 1K83B 2WFWA 3PPAA 4LLGM 5KHQA 2MBBB 1KDCA 4YCWA 1WWTA 3N30A 3L13A 2DY7A 2KX3A 3RI7C 2I5MX 3PO0A 2GMIC 2JA5G 1C77A 1LQBA 1ASZA 1F1HA 4I7ZC 5IP7G 1GO3E 2AQ3B 1QUQB 1SGHA 3TP8A 1FNWA 3AEVA 1N5WA 4RGOS 2HD3A 2L1BA 2RVLA 3MXUA 3FVQA 5TSSA 5JVG3 3RD2A 2ZJQA 3M4OH 3FAHA 1X32A 1OO9B 3M4OB 5CC4A 4GZYC 4FJZA 1TIID 1I7HA 3K58A 4II3B 3WWVA 5EQ0A 3C8YA 3QIAA 1BVSA 1VQEA 3X3NA 1FJGL 3H9DA 4R1JA 1CZPA 1XLOA 1B8AA 1XMOQ 3PF4A 1BBWA 2MQHA 1PZJD 2X6LA 3I5JC 1TKWB 4P71A 1QF6A 1VQ7A 4K81A 5FLXc 2LXJA 4PS8A 5EE0A 1EQRA 4ZYNA 4KHVA 4JI0Q 5M5XB 2F4VL 2L32A 3A4RA 2O2VA 1XTCD 2MJ8A 3K9PB 3J7AV 2ZNVC 4S17A 3PQIA 2WXPA 4DWFA 5CV6A 4NXNL 3BYTB 5C0XH 1TIFA 4JI7Q 3D4WA 4HAEA 3SXHA 3P1HA 3Q8BA 5LNK1 4AYBB 2WWZA 3MXNB 4NAWB 1M4VA 3ND8A 4OVVA 1I4RA 5IT9L 3L2PA 3HOYH 2MEKA 3HOYB 1TTNA 4A3BG 4TMAB 4JV5L 2M9VA 1WGDA 1C8CA 2BWES 2L76A 2HD5B 1LXDA 2JSVX 1ENAA 1O7ZA 1S72A 3PREA 1X3EA 4UDUC 1KF6B 2Y5PA 1R9TH 3WALA 4A90A 3QB3A 5EPJA 3CCSA 1E24A 1JOQA 4CJ0B 1NDDA 2K25A 4HJKA 1Q46A 2FINB 5EAYA 4XQNA 2CFMA 4POFA 3KUDB 2BOSA 2XWJB 3FP9A 2RPVA 5HI1A 1KAAA 4N6EB 2M0XA 1VCBA 1SE3A 3GV3A 2OCEA 4ZKBB 1Q1OA 4B3TL 1A3TA 2BQQA 2R2QA 4NP5A 2ICIA 4A3JB 4RM9A 1WTXA 4ZYSA 3ONAB 4DAMA 2K6DB 3EFUA 3CMEA 1HNWQ 4HPPA 4O42A 4YL8A 4P1BC 3I70A 4XYQA 2BDNA 4WWOA 4X64Q 1J7BA 3W2DA 3AECB 3BWUD 3EC8A 1NMGA 2DUDA 1X3GA 3NZUA 1Q82C 1O7LA 1ZDVA 2K6AA 3I4NH 4GS3A 3IT6B 3I4NB 4A3OA 2MCNB 1JT8A 2EY1A 1HFGA 2EXDA 2F0MA 2K8CA 3I2ZA 1AZQA 4JI6L 4X3SA 1WX9A 5C3JB 2JA5H 1KNAA 4ODGA 4WJ4A 2MBHA 1JQYD 5IP7H 4DK0A 1E1TA 4DK3C 1WFQA 2PQAA 2IZVB 5H8YE 4BFRA 1V5TA 3I55A 2PQEA 3U52E 1TS3A 4GMVA 1JICA 2JVCA 3N52A 4FO2A 2KOLA 1H9KA 1PYSB 2A6ED 3IL8A 3LNNA 2BWFA 4PYZA 4B0MA 3JAME 3W3AA 3S1MH 3A74A 2JK8A 2KK8A 2WX0A 5C0XJ 1L2FA 4DHJB 2K04A 1GPXA 3A8IE 4XTCS 4LNOA 4GNXC 4KZCA 1EY5A 1TT5B 1X54A 4PK1A 2AQ1B 5E6OA 3FKYA 3W5UB 3NS8A 2RKSA 4A6QA 3CIRB 5CTRC 5JXVA 3BY4B 4LFAQ 2NYZD 5G2NA 4A55A 4MDKE 2YV5A 4WJWA 4DR5L 2HTME 4KDIC 2A5HA 2IGHA 4MNOA 3KLWA 4ALPA 1MJCA 2KJXA 4L6TB 4S3SA 2BE5D 3MFGA 1LTGD 3MC0B 3GTPB 1ENCA 2RGFA 1EO6A 3OOCA 4B9XA 5FO9B 3C2PA 3NHHA 4RCOA 1G6PA 1ISNA 2KMCA 3AB5A 4EZLA 4A3BH 1Q1BA 4A3BB 2QEXA 2M8SA 2LXCA 1SNDA 4IJHA 5C6AA 1D5MC 2NUCA 3VDYA 2K5QA 4KTAA 2E2IH 2E2IB 2CQAA 2DHZA 2MFIA 1PTOH 5C4ZA 3DVGY 1PTOB 2PMVA 1X3QA 4EKUA 2JYTA 4ICUA 3RT3B 4LF8L 3DVGX 1I4HA 3ABVB 3G4SA 1QVCA 5AUKA 4HR7B 3DBHB 3U50C 1WCMB 4RHRA 2Q2TA 3AU7A 4A3MG 3VYRA 4X3KA 4LAAA 1PMRA 4JBMA 4LNKA 2LS01 3J80L 4DNRB 4GNXA 2K5DA 1WGRA 4C7YA 1RKNA 1XF5L 3UDFA 4M0WA 3HOXG 1P16A 2JSOA 1LO5D 2B2YA 1FJGQ 4FF1A 2KZRA 2BYEA 3UDXA 1LT6D 4IUTA 3H7PB 3NUHB 1LACA 2FCSA 3QX1A 1YJIA 4XDXA 2V1YA 2YVCA 2MGSA 3HM6X 2EMTA 1CUKA 3S14H 2KA7A 3S14B 2LJIA 1EOVA 1VQKA 2F4VQ 3ZJVA 4W9EA 3HOWB 3VTVA 1QB5D 1WTVA 5D2MB 5CV7A 4NXNQ 5IYDG 4NDXA 2KJRA 1WJ6A 1WTWA 1OXXK 1WMHA 2JEAI 3LWUA 2LGYA 4JWUC 3NEMA 1KNEA 2Y0SG 4JV5Q 1WYGA 4R4OA 4GIVA 3ZQ4A 1HQMC 3KFUA 1HA5A 1MIUA 5J18A 4NPSA 1SN8A 1C78A 1CKNA 1UE6A 4ZQ3A 3ZRFA 1FRRA 5JOBA 4K3BA 2QMTA 2HDLA 3VXWA 4C4VB 4M1UB 1TY2A 2PNRC 3IVFA 1WTRA 4M02A 4QCLA 3CCRA 1V6EA 2EYMA 2PYKA 3A4SC 1UE5A 1DOKA 3J81E 2NTSA 4DUZQ 2Q5WD 4WQOB 3VFKA 4B3TQ 1WX7A 2PW9A 1O7YA 1E5WA 3QWZB 1NSNS 2K8BA 3JAMi 3JSVB 2DENB 1YNXA 3GV6A 1VZ6A 1I3QB 2B2TC 4A3FG 1EIHA 2JRIB 2MQJA 3FILA 4IM2A 4A3EG 4N9TA 2R6GA 4ABNA 2JA7G 3AU4A 1U4RA 5A2QE 1SSNA 5JH5C 2Z6KC 3DDCB 1Q90A 2OHFA 5AZHA 1SNCA 3Q23A 2MO0A 1SMYC 1WR6E 4FP5D 2Z59B 2A68D 3WOFA 4F8MA 2EZVA 1PFMA 1MKHA 1SRUA 4JI6Q 3JVZX 3SFDB 1RJTA 4JBWA 2PZTA 1HQRD 1BXTA 3AFPA 3T56B 3HOZG 1UD7A 1IBML 1SAPA 2QF7A 4GDKA 4JWSC 1VQOA 3NVYA 5HHDG 3VH3B 4A3MH 1WD1A 1K3RA 3NQIA 4HJGE 1B3QA 4B6WA 5BN5A 1SYGA 4RF1A 3P42A 4DGZA 2GN5A 3ZW3A 2B3GA 4A3PA 2O2LD 3H0GG 2N88A 3IT4B 4FF4A 3AN1A 3HOXH 2X6GA 3ER0A 1OQQA 3UINB 2KQ7A 1GJZA 4IOCA 4NZLB 1SBBB 1B1ZA 1NI3A 1EU4A 3BDLA 3EFCA 4HPMB 3J7YW 3V2TA 3OWEB 1PZID 3ZIMA 2HUGA 1TWAH 3KK7A 1TWAB 4DBGA 3PSIA 1SNMA 1SNPA 4DR7Q 2B2TA 1C79A 1WXQA 1XEEA 3V3XA 3EFXD 4YXDB 1DJRD 4DR5Q 3AV8A 3T3NA 4NPNA 1QOHA 3I72A 3PUWA 1R4NI 1XPRA 2ZCCA 3C3LA 1XT9B 1LTID 3QCAA 1MBYA 3GTLH 3HS0C 2IJ0A 3GTLB 1V9PA 2BCOA 3ZGZA 4E3CA 4KKUA 1LT5D 4OWTB 5IYDH 1D8LA 1H9JA 1PFSA 2Z6KA 2UXDQ 3HKZG 2VH2A 2FCNA 1SYDA 3SDZA 4FYDA 5KNCA 4B0EA 3E9HA 2EJMA 1Q86C 2N0SB 1KABA 3DM1A 1CSQA 2RCNA 1HZ6A 2Y0SB 3I7FA 5IGFA 2EYOA 1V8CA 3ZJTA 2EY5A 1WTPA 3OIPA 3GZNI 1FFUA 3Q0AA 2WLBA 4KHZA 2MLBA 2LI5A 1CZGA 2XWBB 3QARA 5FO8B 1PH5A 2KDEB 4LF8Q 3K5LA 4JI4L 4I6NB 3C19A 2KJ6A 2V4DA 3L08A 2F4IA 2ATWA 2V4LA 5C3EB 1Q8IA 1FIQA 4IALA 1T3QA 1G6ZA 4ICVA 2KHJA 2DAFA 1R4PB 3Q8FA 3BK2A 2HJ1A 4A3FH 4A3FB 4A3EH 4A3EB 1VF7A 1QQRA 2JA7H 1WXVA 1EY4A 3R3MA 1ET9A 4YTPB 2MHVA 2GBRA 1FMAD 3A7AB 4L5TA 3QQ8B 5DEHA 3PUXA 1Q12A 3TP5A 3AEDB 3AE3B 3W5OA 1QT9A 3RNFC 2B2VA 2ACZB 4GU2A 5IAAC 3ZRCA 4XWWA 1I4QA 4A75A 1R4NB 2B8FA 2K39A 3HOZH 1Z9FA 1PDXA 3HOZB 2NTTA 2AUKA 1JE5A 4HCPB 2WXJA 2MP2A 2PCFB 4IUPA 2ICEC 4EQ5A 1NBFC 3VH4B 2PNHA 1KC8C 5T1IA 2EELA 1EWCA 3GDEA 1IYUA 5E4WC 1VF5C 3WOEA 2M1MA 3H0GH 4JVZA 3H0GB 4JGHB 2WXHA 1JE4A 2KACA 1O7IA 3PT2B 4P7IA 4GOPB 1H9MA 4CDDC 4DV2L 3GZNB 4H2AA 5C2TB 1FVIA 4FNFA 3S1NH 1ROEA 1STNA 3S1NB 3DVNU 3N1XC 3N32A 4KV6A 3BYYB 4LF6L 3DEOA 4FF3A 1E7PB 2K6QA 3TL5A 3QK0A 3DHQA 3TQYA 1Q1EA 4DF7A 4YCUA 3N1YC 1EYCA 1SFOH 1L2NA 1SFOB 1VDZA 2D2CC 2RDGA 4NKLA 4GKJL 5EDSA 5ISRA 1F9SA 3PIP3 2KXJA 2RCFA 3RN5A 2OTLA 4K7SA 1A0IA 4RKBA 2WDRB 3D32A 2DLBA 1F2RC 2EY2A 3MEFA 3HKZB 4PZ7A 1UH6A 3VR5A 1UGJA 3I9V1 3CCJA 5LL6X 1NR2A 4N9PA 1HUNA 1JWUD 2WHIA 3X0WA 5IIFA 3PO3G 2YYZA 3PSEB 5M5YH 5M5YB 4A9AA 3OIQA 2CWAA 4QJFA 1XPOA 4IUMB 1F9PA 2PTLA 1SJED 2UUBL 1RLFA 5CYUA 3OLMD 3FMCA 3K5OA 4H02A 1E8ZA 4MELA 4A93G 1U5KA 1MJEA 2JA8G 2WQYB 4G4KA 4W9DA 1GVPA 1NUCA 4JI8Q 2KJHB 3SD5A 1TKEA 5AEKB 4DV7Q 2DZJA 4H44C 2F0EA 1ZKHA 3ULLA 3ZNID 3APFA 3H6MA 1CHPD 3AE5B 4POGA 4USAA 4BZAA 1K0RA 2KCMA 3GE8C 3TEXA 1MG4A 2EJGC 3P4PB 4A3CG 1ZPSA 4OVUA 1PYWD 1J5EL 5M5WH 3QR8A 4RMAA 4EE2A 1ILQA 1B50A 4UAIA 3OHXC 1NE3A 3QOLA 4LDTB 3F8TA 2EKEC 1ET6A 1ONLA 5E4XA 4W9HA 1KOTA 3CCMA 4AQYL 3MXNA 5CORA 1WVLA 2B3AA 4OW0A 4YSZB 5IKCM 1VZ8A 3GTMH 3L17A 1X3PA 5GAHC 3GTMB 3R7RA 1FNVA 2TSSA 2Y0SE 2Z1CA 4HCNB 1N9WA 3E5SA 3ZNHB 3O13A 1KLGD 1K0SA 3A9JB 1ZUD2 3A7LA 2IO2B 4HWIB 4ZRPA 3V62A 2KWCA 1C3TA 1IKMA 2L11A 4DAYB 5G3LD 2F52A 3P75A 1KJTA 2DZMA 4K3CA 4HN7A 4MSMB 2K5HA 1K50A 4JI2L 4BXXG 4XC2A 1AFPA 1J19A 1HE8A 1OXUA 2GA4B 3PRMB 2L1AA 4XWTA 3ZUNA 4IUVA 4K8JA 1IGDA 4WIPA 3U9SA 2ZCBA 3K5NA 1A63A 4IPDA 2VB2X 3PF5A 4IW0A 1KTKA 4HJ5A 2E2JH 2E2JB 2KFKB 1WRDB 1AEXA 1RF2D 5M3MB 2A4ZA 3AEBB 4LF4L 5D3DA 4XQQA 2Q2UA 4JI4Q 3IXSA 1STHA 1YX5B 2DYBA 4ZRQA 4GDLA 5CHWA 5M9OA 3J7AF 1P0RA 2Y5CA 5COYA 5G3LF 3CRLC 3GS2A 4CKEA 4II2B 4OIKA 2JXTA 2FIDA 1PGXA 1GJXA 4GN5A 1E9MA 3VR9B 2WB1G 3NS1A 4KSKC 4EVOA 1DCZA 1TS5A 1SE9A 5HGQA 1DONA 2W3SA 5C4XB 3RZDH 1GOZA 2C60A 1PH1A 5EE3A 4P2CB 3E9IA 1UEBA 2VW9A 4QQBX 4FHKA 5CHVC 2BTEA 3CP0A 3S9WA 3K5MA 1PTOC 4DR3L 1EY8A 3TREA 3KQ4A 3PO3H 2V9HA 3NVVA 3PO3B 5GQOA 4KX6B 1TS2A 1H9SA 2MP1A 1C4CA 1GC7A 2JUOA 2KNBA 2N7DA 3B08A 5GXGB 1IBLL 3Q8EA 3ZYYX 2JQOA 2MSED 2L0FA 1B4OA 4IUUA 2F0PA 2B63G 2JA8H 4Q5VA 4A93H 4A93B 1WE7A 1YQBA 2QHOA 2J42A 4XGAB 3PZ8A 2UWQA 1SXTA 1PDQA 4IWOA 2WP9B 4RM8A 1CFMA 2RMMA 3UQAA 3J81L 2KWVB 4DV6L 3I90A 2MJDA 4K7UA 2K22A 4MGYE 2SOBA 4IZ8A 2KHWB 3QO2A 2ID0A 4QAYA 4JI7L 4A3CH 2JRHA 1WOCA 3HFZB 3DWQA 4R4IA 1IW7C 2BW2A 3J9CA 3A56A 2L15A 1VDVA 4DV2Q 3VHTC 2KVZA 3H3VI 3KF8B 1VQMA 2DX5B 3BDCA 4K1RB 3AE2B 3KUCB 2MPMA 3D8GA 4A3GG 3G48A 1J9OA 3UIPB 3Q24A 4MGIE 3A55A 1HR0L 2X8XX 4GKJQ 1SMYD 4P1CC 1FNUA 5LMNL 1KRHA 3PV0A 1IYFA 3A5UA 4IURA 4BBNC 1YD8U 4RFBA 1N5XA 2LMCB 1WXSA 4BXXH 3M85A 3AE1B 4US9A 2N4FA 4ZRJA 3HVZA 5JAVA 4QIWB 2AEHA 2UUBQ 3MXGA 4LJOB 3HM3A 2WU5B 3PZDA 4KKJA 2JA6G 4MM3A 1BCPB 3PUYA 1G291 4X64L 5FJ8G 3ENEA 2L5TA 1MFWA 1NMFA 2M56B 1V1PB 1VQ8A 2QILA 4EX5A 1YJNA 1VCIA 1X1MA 1CKOA 1TU2B 1S4ZA 5FLXL 2NPTA 3I4MG 1CK1A 5TR5A 2OF1A 3CCQA 3VDZA 1V1QA 1J5EQ 2CHXA 3SK5A 2LGIA 1SMXA 2WB1B 2QIEB 4WQMA 5LXHA 1RRBA 2FE8A 2G4SA 2D5DA 3P63A 1WYWB 5I6YA 5C4JH 3SGIA 1U0LA 2ENBA 5C4JB 2MBEA 3HVDA 5EJWA 4LNFA 4APVA 5JEAG 3S17H 2KDIA 4IKGA 3S17B 1KXLA 2WS3B 4MTNA 1PV4A 2GB1A 1CMXB 2NVUI 3I73A 5I9PA 4GKKL 1SR3A 3AMUA 2ZVNA 3KYCD 4PT5A 4NMZA 3KLSA 5K5PA 2B63H 1S5BD 2K1FA 3P4QB 4JI2Q 3M62B 1WF9A 2MJ3A 4A3JG 3AH7A 3UF8A 3KVFB 3IAYA 2F0NA 1K28A 2LY7A 4ZRKA 2NBFA 2RDBC 4DR2Q 3F2UA 5BR8Q 1STBA 2EXZA 2EE1A 3DBRI 2KKCA 3RNUA 4PYUA 2E5LL 1WJUA 2WXFA 3NXWA 2G5DA 2E3TA 4LF4Q 1LT3D 1UEAB 5C3XA 1IBKL 2F03A 4RGNA 1C48A 1WYDA 4F7ZA 2EYFA 1CM9A 1F2YA 4TVAB 2PKOA 4QY7A 1JRUA 2D3GA 4WAFA 1Y8OB 1LABA 5LLIA 2I38A 3LX0A 3DWGC 4A3GH 5HGTA 3J80i 3KLRA 1B44D 1UWVA 4A3GB 2O6VB 3CMMB 1QJOA 4F7XA 1AYFA 4IPCA 3HZXA 4QL5A 4YHHL 1XPUA 3FEWX 3V96A 2BKFA 2INNE 5BYQA 2ONQA 3T16A 1S1QB 2JZZA 1Y69U 4JYAQ 4OZBA 5CBEE 3VRAB 2EY6A 1DM0B 2WXOA 3NE5B 2R92B 1F52A 2REXA 4JC0A 2C9WB 3U2SC 2E8GA 3E0JA 3VA5A 2DY8A 4K7WA 3GP7A 3WAPA 2HIVA 4DR3Q 2D9UA 3H09A 1B2TA 1UBIA 3ZDMC 2QEJC 4EEWA 4EUTA 1PFBA 4ME3A 1GAQB 3AYHB 3CD6A 2PE9A 2K4KA 5D3IB 3CKIB 1VQLA 1Z7TA 4R8NA 1IBLQ 3GOEA 1KQSA 4B08A 2JA6H 4WJOA 2JA6B 1T0SC 1U4MA 2RDHA 2NS5A 2ZTDA 2ASBA 4KMUC 5FJ8H 2PEAA 4UP7A 2MJEA 1E8YA 4C56C 4OO1H 1P9DU 3DHHC 4L23A 2ZT9C 3EIVA 5M5XH 3OJ4B 3OW7A 4HSPA 4DV6Q 1QNUA 1L5PA 1WR1A 1D7QA 4XZ4A 1GC6A 4M00A 1MI2A 1I4XA 3RR5A 3I4MH 3I4MB 2N9XA 3VYTA 3VR6A 1RDPD 1M90C 1GG3A 3LDZE 1O78A 4DPGA 3BZDB 2UUAL 1YMHE 1VQCA 4G57A 3H1UA 1BOSA 4YSYB 2CW0C 2F0SA 2K32A 4AJWA 1Q3LA 5ELDA 4MSQB 3DBRB 2BF8B 3CC2A 1PGBA 1F0ZA 5JEAH 4JIOU 1OTRB 4ZCKA 3BDOA 4RWSC 2D3AA 3R8BA 3NUCA 4K5VA 1HR0Q 4IOAA 1EM7A 4P6VF 3D4RA 1EUVB 2QSDA 3UE0A 4E6IA 2ZM6L 1WGHA 2MRPA 3H8HA 1BUVT 1WCMG 5LMNQ 3OJ3A 3RYTA 4DR1L 2DYOA 3M7GA
chains in the Genus database with same CATH topology
5I6WA 1D5XC 4HMJA 2A6HC 3D6CA 2E6XA 5G5GA 4TKOB 2WKCA 4FXDA 1MD2D 5BYRA 2FBWB 1V97A 3EVQA 3NTKA 1OFFA 1LTRD 2V3NA 4OZCA 1MSHA 1QG7A 1IUEA 1MHXA 1L6VA 4G7ZC 5CV5A 5T1GA 3T51B 1FD7D 3E9SA 4R3DA 1QCBD 2PZUA 2O5IC 2NB0A 1FGBD 1LTSD 3S2DB 1ZP0B 2ON8A 2LEKA 1BUIC 3H91A 2KEEA 3BG3A 4C80A 3T13A 1A3UA 2HDMA 2GI9A 4JPSA 1RYJA 1JOKA 1FXIA 5CV4A 1MGSA 3M3YB 1G2SA 2KN4A 3FPUB 2G1EA 4YSXB 1JW9D 5JEAJ 3FDTA 1EEID 2SAKA 2F0HA 1ESRA 3S16B 1EY9A 4C1NK 2B2WC 4C1NI 2KUMA 5H92C 5CMDA 1EWHA 1NEKB 4HSVA 1FXAA 1PTOD 2K7VA 2J7ZA 1SYFA 2CJNA 3ERQA 2M2LA 2BT6A 2BYTA 3NWTA 1F77A 4DAVA 2F0QA 1G8ZD 4HEDA 2CVRA 4ILWA 1BF4A 1JWSD 3BS1A 4QB4A 5DNFA 4OIJA 2QDBA 1PTOF 4JK1C 2EYJA 1DYQA 1HRJA 2A74C 3SHLA 1C9FA 4C2MB 3DXJC 2M0AA 1PRTB 1NCVA 1IW7D 2BBCA 2E2DC 4L1BA 1CHQD 5EKKA 4K6LA 3IFTA 1N62A 1EOTA 2W82A 2WXNA 2B2WA 3VR3A 1OXSC 2E75C 3MA2B 2CU3A 1ZE3D 2K33A 4RAUC 3U4EG 1TJEA 3AEAB 5JPMC 5DM63 5C3WA 2HQEA 4G7HC 3ITPA 4HRSA 3AE4B 2IX3A 3S15B 5FR3A 1V43A 2AWNA 2H88B 4A3KB 2L0CA 1YNTE 4LTUA 4HTHA 1SYCA 3HP3A 2ZXOA 2PW7A 2E76C 1KDBA 4XT1B 1Q10A 1XX8A 1TKYA 4XYOA 1I4GA 2VNUD 2H4OA 3D31A 5BN4A 2EYPA 2XIWA 1W6KA 5E3FA 2NZ1D 1D1IA 4XIGS 4N58A 2M19A 3I3CA 4A3IB 2KQ4X 1DOMA 1U4LA 2PIAA 5EE1A 3UI2A 4YTMB 1EEFD 4FF2A 1XO3A 4Z9CB 3OSOA 1DOXA 3TDQA 3VRBB 4F88A 2SEBD 4DNTB 5M3FB 2Y3AA 1VLBA 3HEJA 1FCLA 1BNZA 3GTOB 3M4YA 2Z8LA 5FLXE 1OQRA 2H1EA 4PMWA 2VXWA 3SVMA 1KDAA 1XLNA 1AW7A 4BS9A 2VZKB 3K59A 3AE9B 2AUJD 3OMGA 1WGKA 1E10A 4D2KA 1E2ZA 1TWCB 2EJFC 5CGKA 4ZUIA 1EY7A 4DXFA 1ZYRC 1TQOA 3KLSX 4WRDA 1IL8A 3NRZA 2BS3B 4REZA 1CTMA 3K57A 1QLBB 2WDVB 2IL8A 3SR1A 2AQ2B 3CWIA 2A73B 2KDMA 1GB4A 1SIJA 1VRAB 1OXVA 4L23A 1O80A 3BVMA 4KGSA 3GB1A 1SSOA 1DOLA 2CHBD 2F1MA 4ARCA 2R7ZB 1BO0A 5ELEA 2L83A 3TEWA 4OZAA 3ND9A 3MVVA 1GXDC 3Q22A 2W54A 3GTJB 2NVTB 2V3PA 4H0LC 5C44B 2CW0D 1G2TA 1JORA 4PQXA 1LTTD 3D3RA 3K7AB 4ZRZA 2M00A 3FKIB 4U68A 1WSPA 1YN4A 3U7ZA 2K9XA 1XLPA 1ILPA 2RSNA 1RODA 5D7GA 2A6HD 4KY6A 1LLRD 5MPOA 1JRPA 4JE3B 2RDFA 5D14A 2WXIA 5CR3A 1IGCA 1RTOA 3A8KE 4TQUS 4KK7A 1EYDA 2OT2A 2WXKA 3P4SB 2W3RA 1GUNA 3A8JE 2EKIA 1NAPA 1IKLA 1II3A 4IUQA 2K03A 3BK1A 3EJIA 1S5ED 3NVZA 2IDYA 4BBSB 4R8IA 1HHVA 4DAPA 3GTQB 1YNJC 1NR4A 2JE6I 1S5FD 2R3ZA 3DEPA 1BMLC 4EQNA 3PO2B 2IW3A 2L9HA 2K0PA 2N55A 3NZ3A 5AUIA 3SE0A 1RFKA 4QF4A 4Q2JA 5EBCA 2KECA 2EPBA 3NQTA 4WH4A 4XDDA 5KYIA 3MAQA 1CT1D 4KKSA 2MUYA 2SDFA 4NJCA 1I6HB 1SE2A 4HCSA 4TQ0A 4DA2A 1ZKOA 2XSCA 3L4PA 2N9KA 2DN8A 1YNNC 5KIXA 1CI3M 1RWSA 3VA7A 2NMQA 2EDGA 4RA8A 2IGDA 5EBDA 1A2UA 5I4DA 1XWEA 3BVGA 5BMHA 4Q0FA 4ZUJA 3P7JA 1UNSA 4CJ1B 1Z6HA 2IPKD 2ZXRA 3ETRA 3NWSA 3WCQA 3CHBD 5C5LA 3Q6SA 5IGDA 4RKLA 1Y1VB 5IGBA 1MI0A 5KNBA 3I57A 1FD6A 1HUMA 2AWOA 4BWGB 5IGEA 4L63B 3KWVA 3VYUA 1KLUD 1TY0A 1CQVA 2B76B 2Q8RE 1HTLD 4AQ7A 3SEBA 1SE4A 2WACA 1E0ZA 1ML0D 3IAM1 4PMCA 2Q8IB 1JROA 3DMUA 5JVH3 3FILB 5CV8A 2NN6G 2PMZB 1GUWA 4OGQC 3TMEA 4B9WA 1PRTC 1EQTA 5EE9A 5J22A 4MT5A 2E74C 2IX1A 1GUGA 3RFZB 3RPFC 1XYIA 1VMCA 5IGCA 3MXPA 5NUCA 1TVXA 2A69C 3S1QB 2JWUA 1CA5A 2K05A 2F0WA 1QOGA 1GUSA 2D62A 3DWAA 2V4IB 3R93A 1ZEQX 1PFDA 2NWGA 1DD2A 2BS2B 2NN6I 4ZLTF 1U4PA 5KYLA 3TN2A 3MWYW 1I4PA 1GUTA 3I8ZA 1QOBA 2PW5A 1TR5A 3CRKC 3NK9A 1PGAA 1B9MA 2BDOA 1PXUA 3D6WA 4DXGA 3I91A 2BA0A 1JQ4A 2YEPF 1QOFA 4NAMA 3LYYA 1JMLA 1RD9D 2PVOD 1QOAA 4KJOA 2BA1A 3AE8B 4J3OD 3OWFA 5AFWA 5FO7B 5A35A 5C4HA 3K6OA 1DGJA 3P4RB 1Y56A 2SNMA 5D65A 3NP8A 2L4NA 3C1FA 4TRDA 3FC4A 4WFN3 2C5CA 1WRIA 2KQ3A 1PLFA 1HA6A 1HTPA 5IGGA 5G5HA 2VUMB 1NVID 2F0GA 1VMPA 1ZYRD 3V05A 4BY1B 1ZOYB 1AWDA 1JWAD 3SR6A 2L55A 4BBRB 2PLPA 1QE6A 2NN6H 5J39A 1D4BA 2LFIA 4HCEA 2F0JA 4A8XC 1IYVA 4V0BA 3G6JB 4BA2I 1C76A 2NVQB 1NYQA 4X3TA 2WXGA 2CJOA 1N63A 5BYSA 1EL0A 4CHTB 2IWHA 1NYRA 1I6VC 4WORA 2B2UC 2J0TD 4EQPA 1BQQT 1WD0A 1C4QA 4K6DA 4IUNA 3E6ZX 4MN3A 2XNAC 1K8OA 4TQ1A 5KGUA 1DOYA 1F2RI 1E2VA 1UUPA 2WKDA 2R93B 1HPCA 3NPPA 4K8IA 5JJZA 4WWMA 2NVXB 2Z4HA 2PVGC 1STYA 3BIID 1ZXIA 1D1KA 5T8IA 3N9YC 4FXKC 3PZ7A 2DYMA 3SK8A 2HCCA 3MHBA 1EWYC 1UWXA 3CU7A 4JX1C 3PUVA 1MPEA 5FOBB 5EPKA 1YNJD 1SEBD 1LV9A 4HEA1 2B2UA 2WIIB 4C3HG 3VQIA 1SDFA 1SB3C 2JXMB 3KUPA 3AEEB 4K2KA 3B2FA 3MHZA 3KWLA 2WXQA 2FMCA 3R2TA 2VB3X 3MEHA 2WNMA 3AB9A 3HRDD 2F0TA 1T5EA 5HFYA 2WDQB 1JWBD 3L3OC 3CQZB 2JYEA 1R9TB 3QOJA 4IOIE 2IGGA 1KFYB 1F2MA 1BR9A 3B2GA 3WDNA 2J53A 1RHPA 1YNND 5CV9A 4ZOHC 4DQOC 2E2HB 4TSSA 4HROA 4RGTA 1GB1A 4KKTA 3K0YA 3IKJA 3EQLC 1L0VB 2ZW1A 4KY7A 3EA6A 2F0LA 3QG1A 4GDLB 3HRZC 4G7OC 2X38A 3GO5A 3GTGB 1YN5A 5BMIA 1YQ4B 2Q8TA 1FM0D 1BDOA 4XXEA 1EU3A 2LUMA 4FXCA 2JA5B 2BB6A 1D6EC 5ELBA 2K3UA 2WXRA 4IDIA 1N61A 1H9SB 4MACA 5ELCA 3TUOA 5HURA 2JX5A 3VR8B 4HKQA 2LFNA 3HOUB 1A3VA 3S1MB 1N60A 2MH7A 3EUB2 1LT4D 1EYAA 4C3HB 2DBYA 3LXFA 2B2YC 2LHDA 1K8MA 4U673 1DZ1A 3D4DA 1CZWA 2I46A 4XDCA 3P1MA 5CBAE 1DOIA 2RSOA 3TP7A 1C4PA 4RH6A 1A70A 2K1BA 1JB3A 4MHEA 1B9RA 4M8AA 1HEZE 2ZW0A 4I65A 3QWNA 2BB5A 3AEGB 1WTOA 4IQZA 4DU9A 1KH0A 2WV6D 2DWQA 1PRTD 3RUZA 2K5PA 2Z4IA 1VR9A 2B8GA 4L8JA 4OHJA 4WURA 3SFEB 2A69D 1XCTL 4QUCA 4K2LA 1BBXC 2XVSA 2L52A 2KCCA 3W5VB 4MM3B 4R9WA 1VZ7A 5E6JA 4V190 1PRTF 1PUTA 3NTHA 2G9HD 4KY5A 1E0BA 1JC7A 4DAYA 1VJKA 3E56A 1EY6A 1OXTA 3VR4A 3GTKB 5EGTA 4KI0A 4KKIA 3KBGA 5I9OA 2IT1A 3TZDA 1F9QA 3MZ5A 1HFNA 3A54A 1SNQA 1MVKA 4LK1C 1Z47A 1IBXB 5DM73 3W9CB 3PIO3 1FFVA 3S2HB 3ZJUA 3RMHA 1LTBD 3NTIA 2KVMA 5EKLA 5I2XA 1U9RA 2QCPX 3S1RB 2X69A 3R2IA 4J1MA 1L0XB 2RQXA 5I2YA 5BN3A 4XQJA 1YN3A 3N6RA 4KD4A 1HZ5A 3T3OA 3TBIB 3TEZA 5ELFA 1V1OA 3RD4A 1BCPC 2DNEA 5K36G 2PO4A 1RCVD 1STAA 2FFKB 4ULLA 3HOVB 4FVMA 1IHZA 2F0KA 5KNDA 3GD7A 1AP0A 1JOOA 3U9OA 3KF8A 4A3MB 1A6XA 2VZKD 3I4LA 4P16A 4HKZE 4PMBA 4FXGC 3HOXB 3H3VC 4RHSA 3DUZA 1K51A 4ARIA 1R4QB 3IFDA 4ID6A 2F0FA 2LMCA 4IFDG 1STGA 1TZOA 1FYCA 1J8IA 4EQOA 1SF0A 1WTQA 5DAUA 1V1PA 2B2VC 3L9AX 1J7CA 3NSWA 2XN9C 5FK9C 1ENFA 4QMGA 1TWGB 3TP6A 3MJ5A 4ZHOA 4YT0B 2J4XA 4C3JG 2BS4B 4DFAA 4CQNA 4AS1A 4ZAIA 1JALA 1B9NA 1NENB 4IFDI 1S5DD 3LB8C 3T4AC 1SYEA 1W6JA 3DWMA 4NW2A 3R3OA 1AZPA 4N59A 3OMCA 4KGRA 1PFNA 1ZXHA 2JP1A 3P20A 5BMGA 1T6BX 1R7SA 1EFID 2KEDA 1SYBA 2C9OA 4BA1I 1S5CD 1QKZA 3G7LA 1B53A 2D5GA 2JA7B 5FKAC 5EKIA 4O1NA 5F2DA 3C46A 2O5JC 1T5XD 5K36H 2F3VA 4C3IG 1RTNA 1FR3A 2WINB 2DNCA 1RM6C 1C4AA 1I50B 2LHEA 3HGBA 4PV1C 2WU2B 4J8QA 4L2YA 1STEA 1F2ZA 2KWDA 4C7ZA 4CJ2C 2OEDA 1HCZA 4RGMA 1V8QA 1TYGB 1EIGA 2FJ2A 1L4DB 1LTAD 1UAPA 3GQBA 1ACCA 2L12A 3BVZA 3NBIA 2GRIA 4OVZA 2QKIC 1JR0D 3KBXA 2PZWA 1L6UA 4H13C 3VR2A 4DN4M 2I2YA 4KD3A 1TKGA 2KCNA 3NBHA 4CKCA 4IFDH 1ICWA 1AN8A 1L0YB 1E6EB 4X3UA 4EGVA 4MH8A 2W55A 5LL6S 5IT9E 3TZUA 2IX0A 2WXMA 4K5WA 1F9RA 1EQVA 2XRQD 4RF0A 1ZXTA 3LWEA 2H89B 4LK0M 3JAML 1HXYD 3Q8CA 3VYSA 4C3JB 4PNYA 1YJJA 4A3DB 2V0GA 1H9RA 1D2BA 1QNKA 2R61A 2F0UA 3HUIA 2K01A 3TEYA 1A2TA 4F87A 2PPBC 4GLSC 2ZXPA 3C1EA 4H7BA 4J6HA 3HG9A 2HCIA 4KGTA 5M5WB 4IN3A 4ZK9B 2WP8J 2EVBA 4RNAA 4YWGG 2RA4A 1ESFA 1SNOA 1D5ZC 3EROA 1J7AA 4C3IB 2AX5A 3Q69A 1FCCC 3T53B 3RLFA 1EY0A 4LMQD 5IOCA 2N7JA 4Y7NB 2FMMA 1MHHE 1Y1WB 2A6EC 4XT3B 1GUOA 4IFDJ 5HG2A 2KMMA 1CA6A 2KHSA 1EZ6A 3FPPA 3L7ZC 2FUG1 3X3MA 4K5XA 4KJNA 4US8A 3AEFB 3MFYA 1FEHA 2JEBI 2EYHA 3PMFA 1B3AA 1K53A 1F2LA 2BE5C 1YQ3B 4YTNB 1M8AA 1FO4A 1UWMA 2J52A 4CGYB 4XE0A 4ME5A 3MTSA 4QUFA 4DK1A 3RZDB 4ITKA 3AE6B 4K14A 5EPLA 2F0IA 1TT2A 3FRPB 1QWYA 2B39A 3MP9A 1P7EA 1Y8NB 2JU6X 1PZKD 1FRDA 4GDKB 2JA8B 2INPE 2K5WA 1JWMD 2O4XA 4YIJA 3TSSA 4ZHPA 3J80E 4KN7C 3W1SA 2RBMA 3H94A 3SK4A 1GHKA 2SNSA 5IODA 1L4ZB 2F3WA 1K52A 4LJZC 4CKBA 1Y8PB 1DXMA 5A2QL 2JQRB 2OXPA 4BY7B 3AE7B 5KEEA 5E1FA 1BCPD 1CJEA 3AMZA 2WXLA 2EYLA 2YEPB 2EOTA 1QILA 3OPOA 1TS4A 3RZOB 1SJHD 3EGRA 1BCPF 4ZKCB 2F0DA 2N9LA 2KAJA 2TMPA 2OEOA 4OL7A 4KN4C 4OO1G 1A15A 1E2WA 1EZ8A 2I07B 2K28A 3Q8AA 1TWFB 5J1ZA 1TWHB 5C0XG 2FHTA 3QJYA 3IAS1 2F0OA 1GHJA 2JYOA 1P7FA 2A68C 5LHY1 1MSGA 3SK6A 2HDEA 5JPNC 2NVYB 2WAQB 2XRSD 1IBXA 3NVWA 1ZDXA 4OO1I 5KRUA 4HMIA 2B63B 1CQFA 4CBVA 4RCNA 2YU9B 3UI3A 3DWPA 3B9JA 5C0XI 1JCKB 3URYA 2G9DA 2F0VA 4MIUA 1XLQA 1XXGA 1G91A 2LKVA 5C5MA 3M7NA 3PUZA 2JZPA 2QJLA 3AM9A 1XCQL 1K83B 4LLGM 1KDCA 1WWTA 2DY7A 3PO0A 1C77A 4I7ZC 2AQ3B 3TP8A 1FNWA 1N5WA 4RGOS 2L1BA 2RVLA 3MXUA 3FVQA 5TSSA 5JVG3 3FAHA 1X32A 1OO9B 3M4OB 5CC4A 4GZYC 1TIID 1I7HA 3K58A 5EQ0A 3C8YA 3QIAA 3X3NA 1CZPA 1XLOA 1PZJD 2X6LA 1TKWB 1QF6A 5EE0A 4KHVA 2L32A 5M5XB 1XTCD 2MJ8A 3J7AV 2WXPA 5CV6A 5C0XH 3BYTB 3Q8BA 3D4WA 4HAEA 3SXHA 3P1HA 5LNK1 4AYBB 4NAWB 1M4VA 3ND8A 1I4RA 5IT9L 2MEKA 3HOYB 4TMAB 2M9VA 1C8CA 2JSVX 1ENAA 1O7ZA 4UDUC 1KF6B 2Y5PA 4A90A 3QB3A 5EPJA 1JOQA 4CJ0B 2FINB 4XQNA 2BOSA 2XWJB 2RPVA 5HI1A 1KAAA 4N6EB 1SE3A 3GV3A 4ZKBB 1A3TA 4NP5A 2ICIA 4A3JB 1WTXA 4ZYSA 3ONAB 4O42A 3I70A 4XYQA 2BDNA 1J7BA 3W2DA 3AECB 3BWUD 1O7LA 1ZDVA 2K6AA 3IT6B 3I4NB 2EY1A 1HFGA 2F0MA 1AZQA 4X3SA 5C3JB 1KNAA 4ODGA 1JQYD 4DK0A 5H8YE 2PQEA 3U52E 1TS3A 1JICA 3N52A 4FO2A 2KOLA 1H9KA 2A6ED 3IL8A 3LNNA 4B0MA 3JAME 3W3AA 5C0XJ 2K04A 1GPXA 3A8IE 4XTCS 1EY5A 2AQ1B 3W5UB 2RKSA 4A6QA 3CIRB 5JXVA 4A55A 2NYZD 4WJWA 2HTME 2A5HA 2IGHA 2KJXA 4L6TB 4S3SA 2BE5D 3MFGA 1LTGD 3MC0B 3GTPB 1ENCA 3OOCA 4B9XA 5FO9B 3C2PA 3NHHA 4RCOA 3AB5A 1Q1BA 4A3BB 5C6AA 1SNDA 1D5MC 2NUCA 2K5QA 4KTAA 2E2IB 2CQAA 1PTOH 5C4ZA 1PTOB 2PMVA 1X3QA 2JYTA 1I4HA 3ABVB 5AUKA 4HR7B 1WCMB 4RHRA 3AU7A 3VYRA 4X3KA 4LAAA 1PMRA 2LS01 3J80L 4DNRB 2K5DA 4C7YA 1RKNA 1XF5L 4M0WA 2JSOA 1LO5D 2B2YA 4FF1A 1LT6D 4IUTA 3NUHB 1LACA 1YJIA 4XDXA 2MGSA 2KA7A 3S14B 2LJIA 3ZJVA 3HOWB 1QB5D 1WTVA 5CV7A 4NDXA 1WTWA 1OXXK 2JEAI 3LWUA 4JWUC 1KNEA 1WYGA 3ZQ4A 1HQMC 1HA5A 1C78A 4ZQ3A 1FRRA 5JOBA 2QMTA 2HDLA 4M1UB 1TY2A 2PNRC 1WTRA 4QCLA 2EYMA 2PYKA 1DOKA 3J81E 2NTSA 2Q5WD 2PW9A 1O7YA 1NSNS 3GV6A 1VZ6A 1I3QB 2B2TC 1EIHA 3FILA 4N9TA 2R6GA 4ABNA 1U4RA 5A2QE 1SSNA 1Q90A 2OHFA 1SNCA 3Q23A 1SMYC 4FP5D 2A68D 3WOFA 4F8MA 2EZVA 1PFMA 3SFDB 1RJTA 4JBWA 2PZTA 1HQRD 1BXTA 3T56B 1SAPA 2QF7A 4JWSC 5HHDG 3NVYA 1WD1A 3NQIA 4HJGE 5BN5A 1SYGA 4RF1A 3P42A 4DGZA 2O2LD 3IT4B 2N88A 4FF4A 3AN1A 2X6GA 1OQQA 4NZLB 1SBBB 1B1ZA 1NI3A 1EU4A 3BDLA 3J7YW 3V2TA 3OWEB 1PZID 2HUGA 3KK7A 1TWAB 1SNMA 1SNPA 4YXDB 2B2TA 1C79A 1WXQA 1XEEA 3V3XA 3EFXD 1DJRD 3AV8A 3T3NA 1QOHA 3I72A 3PUWA 3C3LA 1LTID 1MBYA 3HS0C 2IJ0A 3GTLB 2BCOA 3ZGZA 4KKUA 1LT5D 1H9JA 1SYDA 3SDZA 4FYDA 5KNCA 4B0EA 2EJMA 2N0SB 1KABA 3DM1A 1HZ6A 2Y0SB 1V8CA 5IGFA 2EYOA 3ZJTA 2EY5A 1WTPA 3OIPA 1FFUA 3Q0AA 2WLBA 4KHZA 1CZGA 2XWBB 5FO8B 3K5LA 2V4DA 2F4IA 5C3EB 1Q8IA 1FIQA 4IALA 1T3QA 1G6ZA 1R4PB 3Q8FA 3BK2A 4A3FB 4A3EB 1VF7A 1QQRA 1EY4A 1ET9A 4YTPB 2MHVA 1FMAD 3A7AB 5DEHA 3PUXA 1Q12A 3TP5A 3AEDB 3AE3B 1QT9A 2B2VA 2ACZB 4XWWA 1I4QA 2B8FA 1PDXA 3HOZB 2NTTA 2AUKA 2WXJA 2PCFB 4IUPA 2ICEC 5T1IA 2EELA 1EWCA 5E4WC 1IYUA 3WOEA 1VF5C 3H0GB 2WXHA 1JE4A 2KACA 1H9MA 4H2AA 5C2TB 4FNFA 1ROEA 1STNA 3S1NB 4KV6A 3BYYB 3DEOA 4FF3A 1E7PB 3DHQA 1Q1EA 4DF7A 1EYCA 1SFOB 1VDZA 2D2CC 2RDGA 4NKLA 5ISRA 1F9SA 3PIP3 4RKBA 2WDRB 2DLBA 1F2RC 2EY2A 3HKZB 3VR5A 1UGJA 3I9V1 5LL6X 1NR2A 4N9PA 1HUNA 1JWUD 5IIFA 2YYZA 5M5YB 4A9AA 3OIQA 1F9PA 2PTLA 1SJED 5CYUA 3FMCA 3K5OA 2WQYB 4G4KA 1NUCA 1TKEA 4H44C 2F0EA 3H6MA 1CHPD 3AE5B 4USAA 3TEXA 2EJGC 3P4PB 1ZPSA 1PYWD 4EE2A 1ILQA 1B50A 4UAIA 3OHXC 3QOLA 1ET6A 1ONLA 5E4XA 3MXNA 5CORA 1WVLA 4OW0A 4YSZB 1VZ8A 1X3PA 3GTMB 1FNVA 2TSSA 2Z1CA 3E5SA 3O13A 1KLGD 1ZUD2 3A7LA 4ZRPA 1IKMA 2L11A 5G3LD 3P75A 4HN7A 1K50A 1AFPA 4XWTA 1OXUA 2GA4B 2L1AA 4IUVA 4K8JA 1IGDA 4WIPA 3U9SA 3K5NA 2VB2X 1KTKA 2E2JB 1AEXA 1RF2D 5M3MB 3AEBB 5D3DA 4XQQA 3IXSA 1STHA 4ZRQA 5M9OA 3J7AF 2Y5CA 5COYA 5G3LF 3CRLC 3GS2A 4CKEA 4OIKA 2JXTA 1PGXA 1GJXA 1E9MA 3VR9B 3NS1A 4EVOA 1DCZA 1TS5A 1DONA 2W3SA 5C4XB 1GOZA 5EE3A 4P2CB 2BTEA 3K5MA 3S9WA 1PTOC 1EY8A 3KQ4A 3NVVA 3PO3B 4KX6B 1TS2A 1H9SA 2MP1A 1C4CA 5GXGB 3Q8EA 3ZYYX 1B4OA 4IUUA 2F0PA 4Q5VA 4A93B 2J42A 3PZ8A 1SXTA 1PDQA 2WP9B 1CFMA 2RMMA 3J81L 3I90A 2MJDA 2K22A 2SOBA 4IZ8A 3QO2A 2ID0A 3DWQA 1IW7C 2BW2A 3J9CA 3A56A 1VDVA 3BDCA 3AE2B 2MPMA 3D8GA 1J9OA 3Q24A 3A55A 1SMYD 1FNUA 1KRHA 3PV0A 4IURA 4RFBA 1N5XA 2LMCB 4US9A 3M85A 3AE1B 3HVZA 5JAVA 4QIWB 3MXGA 4KKJA 2WU5B 1BCPB 3PUYA 1G291 2L5TA 2M56B 1V1PB 2QILA 1VCIA 1TU2B 1S4ZA 5FLXL 1CK1A 2OF1A 3SK5A 2LGIA 2WB1B 2QIEB 4WQMA 2FE8A 3P63A 2D5DA 5I6YA 2ENBA 5C4JB 3HVDA 5EJWA 5JEAG 4IKGA 3S17B 2WS3B 2GB1A 3I73A 5I9PA 3AMUA 4PT5A 4NMZA 3KLSA 5K5PA 1S5BD 3P4QB 2MJ3A 3AH7A 3IAYA 2F0NA 2LY7A 2NBFA 3F2UA 1STBA 2EXZA 2EE1A 2WXFA 3NXWA 2E3TA 1LT3D 1UEAB 5C3XA 2F03A 4RGNA 1C48A 2EYFA 1CM9A 1F2YA 2PKOA 4WAFA 1Y8OB 1LABA 2I38A 3LX0A 3DWGC 5HGTA 4A3GB 3KLRA 1B44D 1QJOA 4F7XA 1AYFA 5BYQA 3HZXA 3FEWX 3V96A 2INNE 2ONQA 3T16A