4RGMA

Structure of staphylococcal enterotoxin b bound to the neutralizing antibody 20b1
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
236
structure length
223
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enterotoxin type B
publication title Mechanisms mediating enhanced neutralization efficacy of staphylococcal enterotoxin B by combinations of monoclonal antibodies.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin/immune system
total genus 62
structure length 223
sequence length 236
chains with identical sequence S
ec nomenclature
pdb deposition date 2014-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4rgmA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4rgmA01
2XRQD 1CT1D 3TSSA 2AQ3B 2R61A 1PRTC 3BYYB 1EEID 1F77A 1V1OA 2RDGA 2SEBD 1V1PA 1TS2A 5ELDA 1CQVA 1D5ZC 5TSSA 4OHJA 3MFGA 1LO5D 4L63B 1STEA 4K6LA 2G9HD 2QEJC 1PRTD 1I4XA 3URYA 1PTOB 1D5XC 1BCPC 1EU4A 2XN9C 1LT3D 3R8BA 1XTCD 1KLUD 3DWQA 3EFXD 3R2IA 1SE2A 1UUPA 1TY0A 1PZID 1ET6A 1LT5D 1BCPD 3O13A 4DXFA 1YN4A 4RH6A 1FNWA 1HA5A 1T5XD 1DYQA 3BVMA 1BXTA 3CHBD 4TSSA 1KLGD 1FD7D 1LTAD 4RCOA 4RGTA 1FNVA 1AN8A 4C56C 1LT6D 1SJHD 1B1ZA 1SBBB 1YN5A 2Z8LA 2XNAC 1S5DD 1D5MC 2WV6D 1L0XB 1I4GA 4NZLB 1EWCA 4RGMA 1I4HA 1PTOF 3W2DA 1HQRD 1EFID 1LTGD 1PRTB 1RDPD 3MC0B 5ELCA 2TSSA 1PRTF 1XXGA 3BVGA 2O2LD 1LTTD 3DWPA 5D3DA 1DJRD 1EU3A 1GOZA 4O1NA 2NTTA 1HXYD 3DWAA 1SJED 1LTSD 1CK1A 1PYWD 3OWEB 2QILA 4ZYSA 1FNUA 1BCPB 5FKAC 1MD2D 1CHPD 1BCPF 1I4RA 1SE3A 5D3IB 5I4DA 2CHBD 1G8ZD 4UDUC 4Z9CB 1SE4A 3BVZA 1D6EC 1YN3A 1PZKD 1S5BD 3R2TA 1I4PA 3SEBA 1JQYD 2J4XA 2AQ1B 2NTSA 1CHQD 5ELEA 1JWMD 1TS3A 4RFBA 5ELBA 4DXGA 1SEBD 3V05A 1ET9A 1PTOC 1S5CD 4RHRA 1S5FD 1V1PB 2IPKD 1LT4D 1S5ED 2AQ2B 3BZDB 4RGOS 1AW7A 1PZJD 3KLSX 1QILA 1RD9D 4RHSA 4L6TB 2IJ0A 1I4QA 1LLRD 1PTOD 1JWUD 1FGBD 1UNSA 2XRSD 1LTBD 1LTID 1SXTA 1TS4A 1L0YB 1RF2D 1EEFD 3EA6A 1RCVD 1JCKB 1B44D 1ENFA 5ELFA 5FK9C 1KTKA 1JWSD 3BYTB 1LTRD 1TY2A 1HTLD 4RGNA 4BWGB 1PTOH 2RDHA 2ICIA 1JR0D 3GP7A 1TS5A 1M4VA 1ESFA
chains in the Genus database with same CATH superfamily
4FJZA 1CT1D 3GB1A 4F8MA 1JORA 2VW9A 3I56A 4B6WA 2NB0A 3KWVA 3WAPA 1E2ZA 1K53A 2RQXA 5HGQA 3HRZC 1WXQA 4MZ9A 1FFUA 5BR8Q 3F2UA 4HIKA 1WM2A 1EF1A 4DK0A 3DHQA 2L12A 3I91A 1XMOL 1B7YB 3TREA 2UXBL 4WJOA 4L5TA 2FCMA 1BCPC 1E24A 3RZDH 4A20A 4FF2A 3ZVVA 2HJ8A 4CBVA 1KAWA 1H8CA 1B9MA 1TIID 4IUNA 1HNZL 2GVAA 2JXMB 1LQBA 2O2VA 1XTCD 1F9RA 1V43A 5GAGC 5BO4B 2K22A 1J5EL 3VQIA 2KCTA 1KHIA 1X9NA 1L6UA 2NVUI 1TY0A 3MVVA 2Z0SA 2A5UA 4FYDA 1Q5WB 3ZIMA 3I55A 1QOHA 1NYQA 4BBSH 4NXML 2I46A 1UE1A 3WOEA 4PYUA 1VQKA 4IPHA 1GUWA 1QOBA 1YVCA 1S72A 1OO9B 1B1ZA 3FKIG 3TP6A 4ZRQA 4F8CB 1MSHA 4LF6Q 1C48A 4XDCA 2WXFA 3AU7A 2ZVNA 2KFJA 3M95A 4NKLA 5EAYA 2EYOA 1VZ6A 3V96A 3DWGC 5JHAA 3KYDD 3CCMA 1X6OA 1GUGA 2K1BA 1PTOF 3M3YB 3BDOA 4HK2A 1OQRA 1YQBA 1VMCA 2IGDA 4LF4L 3NTHA 2H4OA 1EYDA 1I94Q 3M4OH 1N6ZA 2QCZA 2WXNA 4AYBG 1LTTD 2LSSA 5G5HA 5D3DA 2YU9H 3EBEA 3QX1A 3X3MA 2J7ZA 4BOZB 2WXKA 4GU2A 4DV4Q 1XO3A 2I1KA 1HZBA 1I6HH 4KX6B 1SMYD 3AB5A 4HJ7A 2VH2A 2WHIA 1WWTA 4X66L 3U8ZA 1IYVA 3ER0A 5FR6A 4RF1A 4WWPA 3ZDTA 1YNJD 2KDMA 3NE5B 5JZEB 2DYBA 2XGTA 2AWNA 4ITKA 4WURA 1OXSC 5IWAQ 5IP4D 2JA7B 3ERQA 3ECIA 3GDEA 1MI2A 2E2JB 4JI4L 2GB1A 4MGKE 1LM0A 2FHTA 1K8AC 4DQOC 1DXMA 4KJNA 2KNBA 2F0SA 1J9OA 4A3EG 4A3FH 3DBHB 1EO6A 1S5FD 1V1PB 3K57A 3UE0A 1DM0B 1L1OC 1HR0L 3B1LX 1YX5B 3ND9A 1EWHA 2R93B 2L4NA 3DM3A 2RDFA 3PUYA 3EFCA 1Q90A 3M4PA 4C3IH 4EGVA 5C3XA 2K9XA 3X0WA 2KWVB 4C3HB 2H5XA 2OEOA 3ZNGC 2ZJQA 4JVZA 1NNXA 4BFRA 1WX8A 1ENFA 2EKEC 1N32Q 2DAFA 2MJDA 3ONSA 5K36G 1JT8A 4CKCA 3E9SA 3U50C 4GN3B 2PTLA 4I65A 3BG3A 3H0GG 1PTOH 2MP2A 1CI3M 1WF9A 4A75A 2RF4A 1DGSA 1U4LA 1P16A 1XWEA 4JI8L 5M5YB 2K8HA 1ESFA 1G2SA 4YWGG 1IGDA 2CWPA 3S1NH 3RZFA 4WAFA 1U4PA 5E6OA 4AP4C 4AOFA 4MTNA 4H13C 1UBIA 3VTUA 2PPBC 2WU2B 2RDBC 5BN4A 3VTVA 1KAAA 1LO5D 4II2B 3J80i 3PV1A 3Q23A 4L5RC 1B8AA 3EVQA 3FMCA 5C4HA 2L0TA 1PGAA 2A6HC 5C4ZA 1STAA 3VA7A 2BS3B 1N34Q 2Y3AA 1JE5A 2IDYA 4WH4A 2ALYB 3RNUA 5LXHA 1IZ6A 1Q82C 4OVUA 3AB9A 2DN8A 2EY5A 2KVMA 3N1XC 2VQFL 3I57A 1N5WA 1P3QU 3LJ3A 1WTHA 4DAYB 1LV9A 1SNCA 2A69D 4XQNA 2V3SA 2PPHA 4RCOA 2KLGA 4IPDA 2JSOA 3RFZB 1D4BA 2FNJB 4TKOB 2NVXH 4X65Q 2PMZE 1GVPA 4JI7Q 1ZPSA 3KWLA 3HOYB 4MH0E 4FA6A 3IAS1 1U0LA 4DR5Q 3CF6E 4Q5VA 3Q3FA 2WXLA 3DEOA 3F8TA 2ZM6Q 2A19A 1SE8A 3VA5A 2PZUA 4J15A 4BA1I 1CJEA 2IO3B 2MBBB 4R1JA 5E6PA 3IFWB 5C44B 3KYHC 1Y1WG 1I50B 1QWYA 2CHXA 2I5MX 2Q2UA 3S1RH 3BK1A 4MH8A 3BVGA 1V2YA 4LW1A 4ZRJA 3PREA 2JE6I 3A8IE 1AH9A 4XC2A 4YSXB 4DR3Q 4O1NA 2LVOA 3GTQB 4G50A 1MBYA 1KNEA 1K8GA 1Q10A 4OVZA 2N78A 2D0OA 4I7AA 2KFKB 2KX3A 1G2TA 1RRBA 2O6VA 4DR4Q 4W9IA 4KN7C 1V86A 3P20A 4OX9Q 2UXDQ 2FXQA 2N7JA 2MEKA 1YN3A 3Q8BA 3U52E 2JN4A 2DY8A 3APFA 3S9WA 3L2PA 2E2IH 1XPOA 3JAME 4K3BA 2JA8H 1N63A 2LASA 1T9HA 3UQBA 3ITPA 3CCUA 2KEEA 3VHTC 3RR5A 3I4MB 3SHLA 3V6EB 1GC6A 2F0DA 5AJ3Q 2BB6A 2KAJA 4HR7B 2F0MA 2LD9A 4GDLB 3A74A 3LYYA 1TWAH 4OWTB 3CSFA 1BUIC 3KUDB 2YVCA 1ENCA 3T9LA 4LJPB 1SE9A 2EOTA 1VQ7A 3Q2AC 4JBJA 1CQFA 1RD9D 1V81A 3ZW3A 4L6TB 3VDZA 1LLRD 1Q12A 3MXNA 1XX8A 2BWFA 4EZLA 1ICWA 2N7EA 3RNAC 5GADC 4FXDA 2EYJA 5IYCH 3AEAB 1JCKB 4ANVA 2Z1CA 4S3SA 2WXQA 4GGQA 1EFWA 3EECA 2VZAA 5EE3A 2GOWA 3GO5A 1JOQA 1J6QA 4QQBX 5M5WH 1SNPA 1FRDA 4ZCKA 3MA2B 5IGEA 4DR6L 2N4FA 2SDFA 3MXPA 3DHHC 1F52A 4DA2A 3RD2A 1IXRA 5KRUA 1EUJA 4CHTB 2KK8A 2LUEA 3SD5A 1N60A 1HZ9A 1M4VA 2LY7A 4DV0L 1V8CA 3M63B 4WIPA 3S17B 3N9YC 5GAHC 3Q14C 5CBAE 2H88B 2QJLA 2M8SA 2RDGA 2KJ6A 3KBXA 4DK5A 1EYAA 4A3KB 5IT9c 1VQMA 1ZP0B 1D8LA 1LABA 4RWSC 5JJKA 2KD0A 2V4IB 4FF3A 5KEEA 4MEMA 3MEFA 4DHZE 1NMGA 4A3DB 4OZBA 2JPHA 3S15B 3IAM1 2PJHA 4DHJD 1Y1VH 2VB2X 3CCSA 2B3AA 4EKUA 3CKIB 3A56A 5CHFA 2L9HA 4NXNL 2L32A 4IG7B 3UDGA 3QG1A 1KH0A 2QDBA 4HKZE 1LXDA 2Z6BA 3PO3H 5EBDA 1S40A 5CYUA 2K6AA 1BF4A 4K3CA 1B9NA 2C9OA 2K75A 4RGTA 3OWFA 2KWUB 3HOXB 3NY5A 1PFMA 2A6ED 1V1QA 4GNXB 2BB5A 5M3FB 3DWMA 1YIWA 1K0SA 1K83H 2Z8LA 1Z47A 2B63H 4JG2A 3I7FA 2I5HA 3GTLH 3IXSA 3KDFA 1WD1A 2K5WA 3MXGA 3AEEB 1EIFA 1I4GA 4YCUA 4ULLA 4G3XB 2JA9A 3ZGZA 4RGMA 5J22A 1WGHA 2V9HA 4DK1A 1TVXA 1EQVA 1GUAB 1IGCA 2WWZA 2ZXRA 1WTXA 1Q86C 4J6HA 5EBCA 3P4QB 1SMYC 3FVQA 4NDXA 1B70B 4DNIA 1QOFA 3PUVA 3ZJUA 2K8BA 3U4ZA 2YEPF 2ZCBA 4B9KA 2WGSA 1A6XA 1YNJC 1PUTA 3M3JA 1VQDA 2PE6B 2KZRA 3CQZH 1HQMC 1TWHB 5D3IB 3APDA 2CKZB 5IIFA 1SSOA 1KNAA 3VFKA 3OOCA 4DKAC 4BBNF 2JJQA 1A15A 2E2HH 3GTJB 2KTRA 3W5OA 3SFDB 3GV6A 5ELNA 3PPAA 1XNRL 3TS0A 4JI6Q 3MP9A 2DENB 3DPDA 3DMUA 3KF6B 3L16A 2W55A 3V05A 1U4MA 2CH4W 2E8GA 2EJGC 5A2QL 1ASZA 1Y14B 4ZHOA 1HCZA 4BA2I 1PH4A 1IBKL 2JZ3B 4BKGA 3T3OA 2KEDA 5IT9L 3TBLD 5IGGA 5C4XB 4MGZE 5FLXE 3CCRA 5IYDH 3ALBA 2OJWA 5C23A 4EOYA 1BBWA 1Z7TA 2BH8A 4ABNA 2J53A 5BYRA 2HIVA 4BBSG 3HOVG 2G3QB 1F9QA 2F0WA 2PI2E 3HOUB 1XTDA 3SGIA 2DUDA 2KLCA 2REXA 3D4DA 2BVCA 1E10A 1HTLD 1ZKHA 1EOTA 1FJGQ 4CJ1B 1UEAB 4DV6Q 4B3MQ 2K01A 4N9PA 5GROA 3DDCB 3K5OA 2N9XA 5E6NA 4I7ZC 4A3BH 2C5LC 2BT6A 1E0BA 4BY1H 2GRIA 3BYYB 3KJPA 3ZJVA 4WQOB 1T0QC 3QB3A 4LNQA 4X6AH 2WAQE 3V61A 4K7WA 3MFGA 1I3QB 1T5EA 1OXXK 2SOBA 4OZCA 3T8MA 4FHKA 3CRKC 1K73C 4DAVA 1PMRA 1E22A 5CORA 2KHWB 1D7QA 4NJCA 1TYGB 2I07B 2F0IA 3CAMA 2VQEQ 2DZKA 1EIGA 1JB7A 4WAAA 2OQKA 4OWXB 5C0XJ 3ETRA 3ZLZA 3BY4B 1Q1EA 3R8BA 4HPPA 5T8IA 3U2SC 4K81A 3TEHB 4OO1I 1H9SA 3D4WA 4KY5A 3IL8A 2PNRC 1B50A 3NRZA 3CU7A 3O13A 3RNEC 4X64Q 1V8QA 3HFZB 4ASWC 2O4XA 4GOPC 3RNFC 5EGTA 3QOJA 5KGUA 3NBHA 3D6WA 3BVMA 1C8CA 3NTKA 3HOZB 1LTAD 1OTRB 3GOEA 4W9CA 1AN8A 2JP1A 3I4OA 4LAAA 3PUXA 4CDEC 3PO2H 1DONA 1GB1A 2EJFC 2QEXA 1WFYA 2VS1A 1TWCB 3VYSA 1O7ZA 4CJ0B 4A3FG 3N1ZC 5KIXA 4HPLB 3IT4B 4XT1B 2VUMG 2WX0A 1K51A 1WRIA 3QJZA 4NZLB 2DBYA 1QJOA 2V1CC 4DNTB 1STNA 4OO1G 4C3IG 3DLLA 4KV2A 1GO3E 3WIMA 4HCEA 3T1YL 3OLMD 5JAVA 3PCOB 5DM63 1V97A 3H8HA 1TTNA 2QHOA 2Z6KA 1HXYD 2ZW1A 2JQOA 2O6VB 3P1HA 1A8VA 1Q46A 2QILA 1HNXL 1SNMA 4DV2L 1R4MI 4ZRKA 3N6RA 1WZ3A 1TWFB 3H9DA 1BQQT 1C79A 1HZ6A 1FMAD 3BVZA 3S1QH 3FKIB 2MGSA 3AE9B 1OEYJ 2IGGA 2KQ7A 2K5PA 1Z2MA 4IUTA 4R4QA 5IE8A 4DR2L 3K80C 4NP5A 3MHBA 3HGBA 1NJIC 3HK0A 1CZPA 2NVTH 3KQ4A 1BUVT 4B3SQ 3QQ8B 4KKUA 1PH9A 3UQAA 3BS1A 2KC2A 2WX1A 4A3LH 3DCGA 1SEBD 4BY7H 4IJLA 4K0KQ 2LUMA 4AYBB 2JA5H 2IO0B 3EHVA 4JBMA 4YCVA 5EQ0A 2RR9A 2OJRA 2UXCL 2J42A 3NSWA 2BWES 5D2MB 2AUKA 4LUOA 5KNCA 2MX2A 5CTRC 1QILA 3OAWA 4M1UB 1I4QA 3AH7A 2R7DA 2RVLA 4FHJA 3JYUA 4JL9A 3S2AA 1JWAD 2E75C 1PFNA 4X3KA 4K7UA 1ZEQX 3UINB 1IYFA 1RCVD 2E6XA 1ZE3D 1Q0WB 4YY3Q 2A8VA 4GKJL 2GN5A 4P6VF 1B2TA 2OQ0A 3Q69A 4TRDA 4JI3Q 1U4AA 2ZJRA 4Q2JA 5FR3A 1FR3A 2N49A 2ID0A 3AMZA 1VCIA 1WGGA 1D1KA 1PYSB 4JI0Q 1EOVA 1E2VA 3J7ZC 3I9V1 2AEHA 4B3RQ 1V6EA 4RF0A 1X54A 1PVOA 1YD8U 1BMLC 2ZJDA 4KKIA 2FBWB 3A4RA 5E3FA 1F2YA 2BE5C 1EEID 1ACCA 4USAA 4CDCC 4NPSA 1JROA 1V1PA 2OCEA 3FP9A 1CQVA 1AE2A 2K32A 2N7DA 2XSCA 3UF8A 3M7GA 1B4OA 1STEA 3NWTA 1DOKA 1HA6A 3K8AA 4A3IH 4IM0A 3GTOH 2N8NA 3TUOA 3E0JA 3CIRB 3SVMA 2N55A 4DV5L 4FLHA 2XVSA 1LFDA 2D10A 3DVNV 3JSVA 2AWTA 1RTNA 5L95C 3R2IA 2A6EC 1R4QB 1SE2A 2O6VD 5C6AA 3ZDMC 2K6QA 4PS8A 1LT5D 4N59A 3H0GB 3E9IA 2WXOA 1SIJA 2CJNA 1EIYB 1UE6A 1HEZE 2BA1A 4P75A 1DYQA 1TKWB 4IUUA 4TSSA 4YWLA 3H3VC 4HXDA 4KDIC 5C5MA 1G291 3NQIA 2PQAB 1EZ6A 1QUQB 1A3VA 1SBBB 2YYZA 3KDFB 3UI2A 4BKSD 1EY8A 3MEHA 5I2XA 1JALA 1JJCB 4LF8L 3GTMB 3UI3A 5F2DA 1LUZA 2LRUA 4CJ2C 1KFYB 4G7OC 3T4AC 3W2DA 4B95A 1JC7A 4RA8A 3N20C 2Y5PA 2UXBQ 1VQCA 3I3CA 3WAOA 3HEJA 2Q8TA 4DV3L 1DJRD 3I2ZA 4WFN3 2Z4HA 3VUYA 4A76A 1UH6A 1GD7A 1G6JA 3J7A5 5HY6A 1HNZQ 4YTMB 3PSIA 2RSUA 3GTPH 3ZTCA 1STBA 4DUZL 1J5EQ 1A3TA 4G0NB 2VXWA 3KFUA 1MHHE 1YNND 4DAYA 1SGHA 2KJXA 2QC8A 1SE4A 4IURA 1L4DB 4APVA 3V2TA 2GI9A 1IBLL 2KTRB 1SFOB 3ML9A 2XK5B 2AQ1B 1HR0W 2BQQA 3H7PA 2ZXOA 2PVGC 4KKSA 4KGTA 4JI1L 4DR7Q 1RWSA 1YJJA 1Y1WB 2MQHA 5C4JB 2IX3A 1VQEA 4U673 4B3TL 2K5NA 4ZQ3A 2F1MA 3S2HH 4A3GH 1ZYRD 1TWGH 4Y7NH 3PIPA 2IPKD 1V80A 4C4VA 5L83A 3AEDB 1PFBA 3IRBA 1UGMA 1FCLA 3VTWA 4EX5A 5E1FA 1OGWA 5AZFA 1R4NI 4HKQA 5E7NA 5IP9G 3RN9C 2XRSD 3PO3G 2KFKA 5C3EH 3A0JA 2NR2A 1FCCC 4C1NK 5GAEC 4UY8C 1RFAA 4R9WA 1R9TB 4JV5Q 3EIVA 2D62A 1C77A 3ZNHB 2WDTB 1TY2A 4X66Q 1T0YA 1MJEA 4HJGE 2B63G 1SYDA 1WE6A 3K7AH 3ULPA 3H7SA 4G11A 3IHPC 4HCNB 4TUUA 2SNSA 3I4NG 5IP7H 2L05A 3NEMA 2NVQB 2L7RA 1TR5A 2JX5A 2W9NA 1VQ9A 1G91A 5ELDA 3V60A 2L15A 2G45B 1JMLA 2M0AA 5JEAJ 4YCWA 2IW3A 2PO4A 2M2LA 1SN8A 4NW2A 3G71A 2CH4A 1P0RA 1HR0Q 2KANA 4KGSA 3RLOA 2WAQG 5KYIA 3RZOB 1DOMA 4POGA 1OQYA 1N62A 4QY7A 4I6PA 1E3PA 5JHBA 3S14H 3FPPA 3I3TB 2JQRB 4KD4A 3LNNA 1VF5C 5IGCA 4DF7A 1SR3A 4K6DA 2JK8A 5FJ8G 1KQSA 3HOWG 2DY7A 3NBHB 1J7AA 4J6IA 5GXGB 5D65A 3G7LA 2JEBI 5LMUQ 2IO1B 3AULA 4DK3C 4C80A 4FJVB 3APCA 4XYOA 1VQGA 3A55A 2ZXPA 4C4VB 4NB3A 3CMEA 3RUZA 2XEWA 2ZZPB 4FN2A 1ZOYB 1YN5A 4A3CG 3RLFA 1D1IA 2BH2A 1PFDA 4W9DA 1TQOA 4LUVA 1K8OA 1L0XB 2OXPA 3PZ8A 4LDTB 1IW7D 1IPGA 3MAQA 1F9JA 2EMSA 2N9KA 3A9JB 1EWCA 3OPOA 1ROEA 3WANA 5A35A 2LFNA 2UWQA 1VQIA 2FCSA 1O7YA 5IYDG 2B2TA 2KENA 4UP7A 5ELCA 3I90A 2QIEB 4R3DA 4KLKA 1XPUA 4LFAL 2D3GA 2KUMA 1C1YB 5EKKA 4EVOA 2JA7H 3VUXA 1N36L 4LLGM 1CK1A 4UP9A 3TRZA 2E2JH 2H89B 3AI5A 2F0TA 4KJOA 3AE7B 2IX1A 4PMBA 5FKAC 1A63A 4AJWA 2VQFQ 1XNQQ 3F2CA 4IQZA 1WJ4A 5HI1A 2KT7A 1BVSA 2D3CA 2KYWA 3LXFA 5C0XI 3RULA 5A2QE 4GNXA 1YJNA 1KL9A 3EROA 1IBML 2R93H 4C00A 4BY1G 3SEBA 3V62A 2B3GA 3A8JE 1JWBD 1GUSA 1YX6B 2PKOA 1A2UA 1RKNA 3C1EA 4DK6C 4LF9Q 1IKLA 3B9JA 1JWMD 3K9PB 4C3HH 3NVWA 1E2WA 3NELA 4OW0A 2RSNA 4RHRA 3Q3JA 2D3AA 2N9PC 1JW9D 1WR1A 5M5XB 5AUKA 3AECB 4QCLA 1VDVA 2K39A 1OXVA 1HTOA 2D9UA 1I42A 5JJZA 4LF7Q 2IJ0A 4LWCA 5C0XG 5M5YH 4YSYB 1JWUD 1FGBD 3OSOA 1TU2B 1LTID 1J8CA 2FMMA 4ODGA 3T1HL 4ZRIA 4QJFA 4JLCA 3EA6A 3WALA 1NDDA 3SR1A 1VQ5A 2KVZA 3VYRA 2V3NA 4ZDVA 2WB1E 2BF8B 3NVYA 2IWHA 3QA8A 4XGAB 4JI5L 3J80E 5C3WA 3PO2G 2KA7A 3VR6A 3KOJA 3WOFA 5I6YA 5LMNL 4PQXA 2KBNA 3FPUB 2EY2A 1VCBA 1XJVA 2ICIA 3QO2A 2J0TD 4PMWA 3FRPB 1WTRA 3AMUA 2MHJA 3M85A 3KF6A 2ZVOA 3OMCA 1F77A 1UGJA 3A8KE 1WTQA 1D5ZC 3PIOA 1ASYA 4AS1A 4RKLA 3LX0A 3MC8A 4EE2A 4P1BC 4KKJA 5H92C 4NQKE 3UGBB 2LJIA 4P73A 2HJ1A 1KM7A 3ZQ4A 3HP3A 3R3OA 1PGBA 4IFDJ 1RHPA 3TN2A 1X3PA 3EQLC 1E9MA 3JSVB 1YMHE 3TP7A 4IFDH 3HOYH 2BGFA 3B08A 4BBSB 2KVRA 4LF5L 3HOVB 2E5LQ 4ICVA 2M9VA 4LFBQ 1KLUD 3AM9A 4BBNC 4CDDC 1F9PA 4AIMA 4A4IA 3OTOQ 1V49A 1ET6A 4TQ1A 5C44H 3MFYA 5BN3A 1CA5A 4P7IA 3H94A 2N88A 2LGIA 1WTWA 1HZAA 4N58A 3W1YA 4E3CA 4GN5A 1WVLA 4GDKA 4DR6Q 2NBVB 3T16A 3VRAB 2CKHB 2LXJA 2H1EA 1S1QB 3ULLA 1SJHD 4C2MB 1B9RA 4JYAQ 2YTYA 3GTQH 4GIVA 4ICUA 4DV0Q 4YHHQ 4YTPB 4BY7G 3M4OB 4HDOA 2F0JA 2YU9B 1IKMA 5IGDA 3TCAA 4W9GA 1CSQA 1G6ZA 5AUIA 2Y5BB 1F0ZA 5EKLA 1EFID 4FJYA 4KV6A 1DOYA 3PZ7A 3J81c 3Q6BA 3MTNB 1PRTF 1I6HB 3R7RA 1YNNC 3DWPA 3CPFA 2JEAI 5KHOA 4P2CB 1NR2A 2A68D 2K5QA 4FF4A 3B2FA 3H3VH 3OWEB 4HIMA 4GLXA 3I4MH 2R2QA 4O0AA 3U9SA 4JPBW 1AFPA 3TMPB 3NWSA 1L0VB 1MD2D 4BBRG 1WIAA 1FXIA 2CHBD 1G8ZD 3A9KB 4MJSB 2XIWA 2WFWA 1ZDXA 3H7PB 1I4PA 5I2YA 4A3FB 3CMMB 4AQYQ 5AEKB 1Q8KA 2VUMB 1EY7A 1ZYRC 1K50A 4OZAA 1PH2A 3E3XA 2NTSA 2PMZB 1VQNA 4LFCL 1Y8NB 4IUPA 1WCMG 2ES2A 1QQRA 1PFSA 1KLVA 3KJOA 4AWJA 4C3IB 5DLQE 1AZQA 2FFKB 1XPRA 5EE1A 4GLAC 3BZKA 3NENA 1LT4D 1X32A 1JRUA 4LMQD 2R92H 1RODA 1EM7A 1GHJA 3F2BA 2K25A 3AXCA 4HIOA 4X57B 1HPCA 1NBFC 2KDIA 3HM3A 2ZNVB 2NS5A 2HCCA 1UNSA 4OXPA 4W9EA 1O7LA 3AEFB 3D32A 4CGYB 1RYJA 1OXUA 5CMDA 4RNAA 3MWYW 4OIKA 1YJ9A 5FLMH 4IZ8A 1Q3LA 4N8FA 1EWIA 1L0WA 4IO9A 1VF7A 2L0FA 1T0RC 2F0QA 4BKSA 5G5GA 2DHZA 5KHQA 3SDZA 4KZ0A 4LNNA 4ARIA 2KKCA 3BDLA 4PK1A 4IUQA 1XNRQ 2YTVA 3KLRA 3NJTA 1G51A 1V1OA 3LB8C 1I5FA 1W6JA 2ZTDA 4A55A 1R4MB 2IY5B 4DUYL 4A9AA 4DAMA 1MHXA 4OHJA 1VQOA 1X3FA 4JC0A 4FXCA 1M8AA 1IBKQ 2G9HD 3K9OB 4IUMB 1VS0A 1X65A 4G7HC 3C0RB 3KF8B 2INCC 2XTIA 2EPBA 1D5XC 4GN4B 3I72A 1LTLA 4JGHB 3J81L 1FXTB 4A93B 1VDZA 1NAPA 3UIOB 4RMFA 1WSPA 1C0AA 2NBUA 2XWJB 4A3MH 5J3BA 4WWNA 2NPTB 4DR1L 2VRRB 3S1MH 1N9WA 1C4AA 1E1OA 1AE3A 5DPWA 4YWKA 1RTOA 1S3OA 1YNXA 5IGFA 2FCQA 3VH4B 1WJUA 4C7YA 2RCFA 1IW7C 3ICEA 2VNUD 1RJTA 2ZEQA 4NAWB 5CHWA 3W5VB 5CV5A 5KNBA 3U4VA 4B08A 1N32L 1MFWA 1WI0A 3Q8EA 2F3WA 2IZVB 4PG3A 4UAIA 5LLIA 4JK1C 3RNGC 3DBRI 2B76B 1UEBA 4QL5A 2F0NA 1O80A 1PV4A 1N33Q 4KHPQ 2WINB 4TVAB 4A3JH 4JWUC 1WI5A 2M19A 3U58A 3HRDD 2W54A 1XLPA 4HJKA 1PRTB 2MBHA 4O2DA 1CMXB 4K2LA 4MSQB 2VL6A 4JPSA 2HD5B 5DAUA 3E56A 2BA0A 5CV6A 5C3EG 2FAZA 3A4SC 4DHZB 4OVVA 3AE1B 3MHSD 1LTSD 3NG0A 1H9KA 3EUB2 4FXGC 2F0GA 3ZRFA 3QIAA 3SK6A 2O5IC 4HPMB 3V3XA 4K2KA 1WR6E 3T56B 2RBMA 1GHKA 1RAXA 4MELA 1I4RA 1JE4A 1KC8C 4ZRPA 2D5DA 2UU9L 2DNEA 1D6EC 2PQAA 1QUQA 3LGJA 1EYCA 3BINA 5IN7A 5C4XH 5IP7G 2CHWA 3TS2A 4PV1C 3G4SA 3PF5A 1PH8A 2OTLA 2KQSA 1EY9A 3CCQA 1NSNS 3P2BA 2C7HA 3KVFB 1X3QA 4X62L 4G7ZC 3DBLI 4KSLC 1QNKA 1PLFA 4X65L 2PZWA 5JEAG 4JI7L 1ET9A 3NOBA 4IWQA 1TZOA 2GVBA 5NUCA 4KZCA 2HUGA 1K28A 2LVQA 2XBBC 5IO9A 2ZM6L 4EEWA 1V5OA 1JMCA 3T1YQ 1A3UA 4R4CA 2WXMA 3DHIC 2INDC 1WMHA 1JOOA 2ICEC 3RD4A 4URKA 5LL6S 1EY6A 3M4QA 4QUCA 2UUCL 3IT6B 5AFWA 1HNXQ 1L4ZB 4DV2Q 3D3RA 1B44D 4K5XA 4M00A 4WRDA 3W1SA 2BTEA 2RSOA 4FNFA 5FK9C 4FVMA 1TKEA 3VRBB 2K5DA 2NN6H 2E76C 1CZGA 1Z9FA 2NVYB 3NK9A 3Q3NC 4IM3A 2XK5A 1DOLA 1BOSA 3CMAA 3ZNID 2IY1B 2WB1G 2KDBA 1UWVA 2OF1A 3DBHI 3OJ4B 5EPKA 4OONA 2N1VA 2WP8J 1QT9A 3KUCB 2B2VA 2EZVA 5JVH3 2WXRA 5MPOA 2EIFA 1JOKA 2G4SA 2W3SA 1DGJA 2BYTA 1YI2A 2Z6KC 2WIIB 3S24A 2HTME 2PE9A 3L08A 4PS7A 1CKOA 1AYFA 2PMVA 3MHZA 1IYUA 1K8MA 2UUAL 4QGUA 2VY3A 3A7LA 4K6LA 3HOZH 1OXTA 1I4XA 1PRTD 3URYA 3PO3B 2UXCQ 1KRSA 2LGDA 3OJ3A 3JVZX 4CO7A 4HCSA 3IVFA 1QZGA 1WTOA 2ZCCA 3NZ3A 1P7EA 3HS0C 2I5LX 1GAQB 3H15A 3OW2A 1PH7A 2JT4B 3BWUD 3PMFA 1UBQA 1NR4A 3DVNU 4GSWA 4XWWA 1STYA 1W2BA 1RFKA 2DYOA 1PZID 2IBIB 4I6NB 4GKJQ 4GDKB 1K83B 4RH6A 2B63B 2R93G 2EJMA 4LK0M 3GTLB 3DVGX 2F3VA 4JI2L 4R8IA 3NUHB 4DV1L 4TQ0A 3ND8A 3CHBD 4GN1A 2IHFA 5HFYA 3ZXRA 3TEZA 3I4NB 3A33B 2LHEA 4C3HG 1U4RA 3FDTA 3Q22A 2ASQA 3MTSA 3H91A 4OGQC 2QCPX 4UHVA 4JBKA 2C60A 4IN3A 3SU8X 4IOIE 1S5DD 2R7ZH 3C2PA 2KDEB 5BMIA 2JYTA 3GZNI 4XWTA 4UP8A 3AE6B 2KMAA 4XYCA 5G2NA 1IL8A 1SROA 2A68C 2WAQB 4YL8A 5EE9A 4X3UA 5LXIB 2PW7A 3FKIH 1RDPD 3KLWA 2A69C 4U68A 3D31A 2FUG1 4JOIA 5IGBA 1MVKA 3L13A 4C3JB 3P4PB 4HCPB 4NJ7A 4PS3A 4IUVA 1MKHA 4GKKQ 4DV5Q 3HOWB 3DWAA 1KD1C 3SK8A 1PYWD 2NZHA 4ID6A 4EQNA 4E71A 2WNMA 5M3MH 2E2HB 2QDFA 1Q7YC 4KVGB 3HVDA 4IFDI 1XYIA 1HRJA 1CHPD 1SE3A 3VR8B 2KCNA 2Y5CA 3IG3A 2LGYA 1S5BD 3RLNA 2DZIA 4REZA 2FE8A 4LCDE 1H4RA 2X69A 5DEHA 3NZSA 1CHQD 3P1MA 4B9XA 2AL3A 2B2UA 4KIKB 1U9RA 3A9JA 1TS3A 2HHHL 4LF8Q 1SYCA 1XEEA 4NAMA 3J7YW 4RAUC 3GTGH 1E8YA 3AEBB 2X6LA 2VZKB 4QIWE 2QDLA 3T51B 2ZPNA 2JA6H 2DGYA 1HNWL 4HN7A 2NBFA 1L5PA 1H9JA 2AQ2B 2IL8A 4IFDG 2MA9B 3S16H 2HDMA 2JU6X 1ZXIA 3KYCD 2BBCA 3K0YA 1J7BA 4P71A 4GS3A 5BYSA 4ARCA 3JAMc 2HTHA 2RMMA 1SXTA 4ZYNA 4IM2A 2RD0A 5C44G 1EEFD 1SNOA 1X3GA 1PQSA 2EYMA 2JRIB 2F4IA 3PZDA 4MIUA 5ELFA 1T0SC 2IO2B 2NCNA 1L1OB 3VDYA 1Y8PB 3H6MA 2B29A 3LDZE 4BY1B 3BYTB 3H3VI 5C5LA 5H1SE 2TMPA 1BR9A 3CCVA 4L5SA 2A5HA 1AWDA 3AEGB 3TDQA 2B2YA 4OELB 5E4XA 2L1BA 2G1EA 4JI1Q 1VD2A 3RMKC 3TIXA 4W9LA 2SEBD 3PIP3 4OIJA 1EYGA 4B3TQ 3ZKJC 2DLBA 3H0GH 1HZ5A 2WXGA 3RNCC 4JI6L 4LK1C 3MXUA 3MZ5A 3R3MA 2KN5A 1E0ZA 2RA4A 4ACFA 1WJJA 1H9MA 2KCMA 1TIFA 2AL6A 3I70A 1NCVA 4GMVA 1PYBA 2VB3X 4HAEA 1NMFA 4EUTA 3U4EG 2KWDA 4FF1A 3GTMH 1GUNA 1WH3A 1MIUA 2I1JA 4EQ5A 4JIOU 1K3BC 1FXAA 2DZJA 2L8JA 4JW0A 1NY4A 5FO7B 2L3ZA 2BW2A 2YLMA 4ILWA 2F52A 2WLBA 2CS4A 1TT5B 2B2WA 4A3EB 3BK2A 4HJAA 5IKCM 4CHKA 4CYEA 4C56C 2GBNA 4IOCA 1P8LA 4ZUJA 2WXIA 1CM9A 1ISNA 3STBD 2BCOA 5C3JB 2XNAC 3GTKB 4HRSA 4PT5A 4LNFA 3TEWA 4K5VA 2PYKA 4DV6L 3FKYA 4L2YA 1B3AA 2R92G 4B0MA 1FVIA 2VZKD 1Y8RC 2N3SA 4DU9A 2A4ZA 2IHEA 3AE4B 2C35B 3Q3OC 4IOAA 1L2NA 1IL2A 2MQJA 2F0PA 2J0JA 5FLMG 3JAML 4ZYSA 1Y1WH 1TJEA 2EKIA 5C4JH 2JF5A 2JA8G 2J0KA 2V0GA 4RCNA 2KJRA 4ANXA 2WXHA 5J2RA 2DNCA 2ZPYA 2N9LA 2D2CC 4HROA 4BY7B 4X64L 4XXEA 2AX5A 2PLPA 4MGIE 1XT9B 5IODA 1EY5A 3HKZG 1HUMA 1Q81C 2F0LA 2I2YA 4FULA 4MT5A 2ZTEA 1XMOQ 1SF0A 4ME5A 1R9TH 2LVPA 4QB4A 1YHBA 3QR8A 3HG9A 5LHY1 3B2GA 2K1FA 5IYCG 3PGZA 2JXXA 3E0EA 1PHJA 2ASBA 3EN2A 3RI7C 3BZDB 2JY6A 1P7FA 2KJHB 4AQ7A 4K8IA 3SFEB 4F1SA 4FO2A 1WMHB 1ZXHA 4BZAA 4A3MG 4JX1C 3R7QA 1VRAB 2UUBL 1K52A 3WCQA 2LZ6A 4J8QA 1EQTA 1N36Q 1TS4A 2K05A 5LMNW 4BBRB 3U7ZA 2NYZD 3PUWA 5EJWA 1M1KC 1XCQL 4NXMQ 4OWWB 1OFFA 1QLBB 2LXKA 2BPSA 4A3OA 3A9KA 4MJSA 4TV3A 2JZZA 1LTRD 3DUZA 1YQ3B 1K9MC 3QWZB 4JWSC 1IBMQ 1S3SG 3W1GA 3RZOH 3M62B 3Q8CA 5BYQA 1WCMB 2RDHA 1MGSA 5HGTA 3C46A 4KY7A 1VQBA 2B2TC 2F0OA 1PXUA 1QNUA 4PNYA 1NENB 1J7CA 5CX3A 5HKHA 1PRTC 1GB4A 4F7XA 4A3JG 4M8AA 4ZLTF 1GPXA 1Y1VG 4LF4Q 4B0EA 4NY0A 5TSSA 1WJ6A 2GBKA 1E90A 3G48A 1Q1BA 4HJ8A 2M56B 1SNQA 3GE3C 3W1BA 2NUCA 3GQBA 1WM3A 1C78A 3OG5A 2SNMA 1XCTL 4K0KL 4K14A 1EU4A 4DV7L 3PLVA 2XN9C 2QA4A 1LT3D 1HZCA 4GNXC 1II3A 3QJYA 5LL6X 3BJUA 1E8ZA 1XLNA 1A2TA 4N6EB 3T1HQ 2Y0SE 2K7VA 4A90A 3U9OA 5M9OA 1MG4A 1KRHA 3PUZA 3LWEA 5DNFA 3J81j 2PCFB 1YN4A 3ZNZB 1FNWA 4YWMA 4JI5Q 2QW7A 4AUQC 2ACZB 4ZK9B 4HEDA 1GC7A 4L23A 1STGA 1R4PB 4XYQA 1FD7D 2LGSA 3ZYYX 4YY3L 4JI4Q 4GZYC 5LMNQ 1JICA 4RG1A 1N8RC 2DNFA 2Z0EB 5C2TB 4AJYB 4CKBA 1SMXA 4QMGA 2F0KA 2CU3A 1WXAA 1WGRA 1SLJA 3UDFA 3VR3A 5DPRA 2LMCA 4WJQA 4JI0L 1CKMA 3ZJYC 3K7UC 4IPGA 4Y52H 4DGZA 3CW2C 5DPSA 2G9DA 2F4VL 1E1TA 2CFMA 3KF8A 2O5JC 1LTGD 2IY0B 3I8ZA 3GTPB 2DZMA 2QKIC 5HURA 2TSSA 3J81i 3KH0A 1UF0A 2MJ3A 3I5JC 1SAPA 2R6GA 2YTXA 1WE7A 3HM6X 3V6CB 2NTTA 2NPTA 3ML8A 1SJED 4LF5Q 3R66C 1YJWA 3M3YH 4LJOB 2RCNA 2WS3B 4WWMA 1WZ0A 1B3QA 4AH6A 3S2DB 2MUYA 3VVWB 4H44C 1C9OA 1ML0D 1FO4A 3LWUA 4Z9CB 4JI8Q 5M5XH 2EVBA 3NTIA 4NAWA 3AYHB 1CKNA 4EZJA 2QMTA 1F1HA 1SRUA 3N3KB 1AEXA 1SNDA 2W82A 3DOWA 1Q1OA 4NNJB 2ZT9C 1BBXC 4M01A 2EXDA 3VR5A 2MLBA 4KD3A 2EQSA 2LXAA 1MI0A 1P9DU 5IY0A 1NUCA 1T3QA 3ZUNA 1V9PA 1KRTA 5C3EB 2JXTA 1PZJD 3KLSX 2FINB 4ZOHC 4HDQA 3ENEA 3QOLA 1PGXA 2KHSA 3DBRB 3O65B 1YIJA 1YQ4B 2Z4IA 4YIJA 4K1RB 4NPNA 1IHZA 2QF7A 4A3BG 3K7AB 1ENAA 4FP5D 4RKBA 1WY8A 5CR3A 2B39A 2MWSB 1R7SA 1KTKA 2NZ1D 2K03A 4GLVB 4MDKE 5IT9E 5DCNA 5EDSA 3RZWC 2A1AA 2V3PA 3VXWA 2KOLA 3VYTA 2Q2TA 2R7ZG 2B8GA 1EL0A 3HOVH 3U7DA 2WDRB 4LFCQ 3PRZA 4GB9A 3Q24A 1V5TA 2D11A 1VZ7A 2PNHA 4HEA1 3PRPB 3S14B 4PZ7A 4DR7L 2OOBB 2Q2HA 3D0FA 2L76A 4DDID 1QF6A 2F0HA 2D07B 2QEJC 2AUJD 4WJPA 1UD7A 4C2MH 5M3MG 5ISRA 2ZW0A 1EZ8A 4KHZA 4MNOA 2LXCA 1A5RA 1C9FA 3SR6A 3DBLB 3T13A 4P1CC 4LJZC 2LKVA 4NQLB 1UUPA 3NUCA 3B6YA 3STBC 2EYHA 2WB1B 4HSVA 3Q8AA 5GMVA 4ZKBB 1D2BA 1E7ZA 1VQJA 1HA5A 2QGQA 4G4KA 2IGHA 2WP9B 1BXTA 3RYTA 2BS2B 2KMMA 4JV5L 1FNVA 4HTHA 1PDXA 1LT6D 4S0RA 2V4DA 1F2RC 3RZDB 1QKZA 3TZDA 4LDTD 4M8MA 1TBEA 2JA6G 1D5MC 3X23A 3PGEA 4GLSC 2F0UA 2PVOD 1VQAA 5TR5A 3AQQA 2K14A 1FRRA 4DUYQ 4N8X1 4GOPB 2AHOB 3OW7A 2INNE 2ONQA 3L0WB 3MC0B 3N30A 1XD3B 1EF5A 1PDQA 1I7HA 3A1QB 3IFDA 2VUMH 2HIXA 3MC9A 2LRWA 3TQYA 3E5SA 1I50H 2MO0A 2JVCA 4OO1H 4TKNA 4X3TA 1QZHA 3UDXA 2PI2A 4DR1Q 3E6ZX 2EMTA 3AE3B 4BOSC 2LJ5A 2KN4A 1RIPA 1YJIA 3D4RA 3NQTA 3G6EA 1XMQL 3L3OC 1C3TA 4A3LG 5JJIA 2JYOA 3QARA 2FJ2A 1ZGUB 3ERSX 2JA5G 1SSNA 5LMUL 1BDOA 2Z9HA 3U30A 1UE7A 2RHQB 3OIQA 5G3LD 1P98A 3FC4A 2ZJPA 3PQIA 4KDLB 3HZXA 4ME3A 4PYZA 5BR8L 4BXXH 1FPYA 4PZ6A 4KHVA 2L83A 2WDVB 4A8XC 1E8WA 5D7GA 4ZHPA 4NXNQ 5IA7A 5FO8B 1A0IA 3Q0AA 3JW0X 1FFVA 3QCAA 2ZTCA 1YJ1A 5D94A 1LTBD 2KDFB 2HE7A 1Z5SB 5J39A 1VQHA 1TXYA 4MM3A 1KOTA 3CCJA 3GZNB 1JWSD 1KDAA 2CJOA 4HSPA 2UU9Q 2P5ZX 1FL0A 4XZ4A 3TZUA 1MSGA 5LNK1 4R8NA 3X3NA 4WJ3M 2RGFA 3GV3A 3NVVA 1XNQL 1RLFA 2ATWA 4KIKA 5G55A 3TMEA 3AFQA 1F9SA 1KABA 5I6WA 4A93H 3GP7A 1TS5A 1Z6HA 1IYJB 4LF6L 2L52A 2XRQD 3TSSA 4A3IG 2I0QA 4RMAA 4X62Q 4Q0FA 5EKIA 1L7YA 3K5NA 3SDLC 2LFIA 1A70A 4K8JA 4KMUC 4R4TA 1J19A 3NS8A 1STHA 3IFTA 1N61A 4LF9L 4HVBA 2OTJA 1QVCA 1NI3A 1KDCA 5K5PA 1NYRA 1I94L 3WWVA 3S17H 1UZXB 1DCZA 3BIID 1PTOB 1WXVA 2Q5WD 1QE6A 4MACA 4A3KH 2DX5B 1UWXA 2HCIA 3S1NB 4DV4L 1IBXA 4DHJB 2C7MB 1L1OA 1SDFA 2PQEA 4WJWA 2UUCQ 4LF7L 4JQWC 2OEDA 3H09A 4A3DH 4H0LC 3TP5A 2E2DC 3S15H 4M02A 1WD0A 1E7UA 2WYQA 1WX9A 2Y0SG 2CWAA 5IYBH 2L55A 1Y69U 5JVG3 2CCZA 3FHWA 1YITA 4QF4A 3ABVB 4FBJB 1CA6A 4A6QA 3AN1A 4L1BA 3T3NA 4W9KA 2LMCB 5IWAL 2KECA 3J9CA 1LM8B 3SK4A 2ON8A 3C1FA 4BAXA 3A5UA 1AZPA 3CWIA 2INPE 2KACA 1OQQA 1CSPA 1ONLA 2RKSA 3HKSA 2Q8IB 3HOXH 1ZUD2 1NBWA 3K0XA 2UU7A 4XDXA 3NHEB 5M3FH 2KTFA 4DN4M 3GD7A 1HQRD 1QCBD 1ZKOA 2UUAQ 1QOAA 4OEMB 3PTFC 4TQUS 4IC7B 3TEXA 3W1SC 2O2LD 3IKJA 3W9CB 2K50A 2NVXB 3BU2A 2IX0A 2X8XX 3RUIB 2J7QB 1F2LA 5COYA 2G5DA 5JH5C 3NXWA 4DFAA 3A7AB 3L7ZC 4MTKA 3RN5A 2K33A 1G6PA 1BBUA 4IPCA 2MCNB 3UIPB 4HLEA 4V0BA 3L54A 2B2VC 1BCPF 1CKNB 1CZWA 2E5LL 4LFBL 1XQQA 5EE0A 4W9JA 4JI2Q 4W9FA 4DV1Q 1EUVB 3S1RB 4ANUA 3R2TA 1UAPA 2MJ8A 3OTOL 1M90C 4A3GG 4POFA 3TEYA 2YV5A 2J4XA 4MSMB 1WGDA 4P74A 1TWHH 2R92B 3VUWA 4LUZA 1CUKA 4QUFA 1X3EA 5ELBA 2MSED 1FGUA 4DXGA 3H6NA 5C1ZA 1WTPA 4JYAL 1S5CD 4CQNA 4IWOA 4DXAB 3GTJH 4YHHL 4F88A 2EY6A 1BNZA 2R7FA 2NVYH 3Q3MC 4PMCA 1GG3A 4RGOS 1F2ZA 3PRMB 1NVID 1WYGA 4HMIA 4DPGA 2M4NA 1WGYA 2KOXA 3AE8B 3B0AA 1N34L 2E2IB 1PTOD 1AARA 2D0PA 5J18A 3JAMi 2JA8B 2BKFA 2F0VA 4H02A 1OEYA 3FILA 2KXJA 1GKHA 4IKGA 1L0YB 2BE5D 2IT1A 3L0OA 3F2DA 1DZ1A 3SHQA 3CRLC 2O2VB 3HKZE 2EYPA 2DWQA 3MJWA 2LGXA 2C7NB 2Z0DB 4EZKA 2D5GA 2K4KA 1TWAB 2W3RA 2WKDA 4P72A 1FYCA 5IP9H 3W3AA 4BWGB 1YZ6A 5JJLA 3PS6A 3HKZB 2N0SB 1WYDA 5JXVA 1QOGA 2M17A 5L37A 3HOUH 1MPEA 3PHWB 3KW5B 4DR5L 2CVRA 1B53A 2MHVA 4JOIC 2HHHQ 4AQYL 2X6GA 2C9WB 1GXDC 5CV7A 5I9OA 3KBGA 3VYUA 1J8IA 2I38A 4UPAA 2F0EA 5E6JA 2PEAA 1HNWQ 3J80c 3UDIA 4A3MB 5M5WB 2KQ4X 2D2QA 3S1MB 1NEKB 2DAJA 1JB3A 4E6IA 3I4NH 1AP0A 2Q2IA 1D3ZA 4DR3L 1SB3C 1A62A 3I73A 3C3LA 3M7NA 1J0GA 2V4LA 1ZW7A 1ZXTA 1C4CA 4KTAA 2CQOA 4L8JA 3EFXD 1I3QH 1C76A 4FADA 3KUPA 4BVUC 4CKEA 1TT2A 4DR4L 5DM73 3J7AF 1KXLA 2B2UC 4DR2Q 5T1GA 4YTNB 2Q8RE 4OX9L 2UXDL 2F3IA 2V1YA 4KKTA 3EGRA 2WXJA 1KDBA 1T5XD 3RCZA 2EDGA 1KLGD 1U5KA 4C3JH 1LGRA 2CR5A 1K0RA 4LTUA 2BDOA 3I4LA 4XX5A 5IOIA 2BOSA 2E3TA 2A74C 4A3JB 1NI2A 3K58A 5EPLA 5FJ8H 1Y1VB 3HOWH 1CFMA 2KCCA 4V190 1E7PB 2MP1A 1MHWC 1EWYC 2WV6D 3C19A 3TJPA 3P7JA 1SYGA 5AJ3L 2KQ3A 2JA7G 1K8RB 3P63A 1SIFA 4BKTA 3A54A 2K04A 1I4HA 1L6VA 3TP8A 2MBQA 3A5ZB 1TWCH 2MRPA 4A3CH 1XXGA 2CW0D 3FAHA 3TL5A 1YBYA 4HJ5A 1TGZB 4HJ9A 1EU3A 3EJIA 1KIXA 2F03A 1YOVB 2LI5A 2N9EB 3CF5A 3RT3B 4C7ZA 3DHGC 1I35A 2GMIC 1OTCA 4HWIB 2UYZB 2J0MA 5FOBB 2B2YC 1BCPB 4BS9A 1IUEA 3NVZA 4K5WA 2PW9A 4II3B 4XE0A 1VJKA 4US8A 3CCLA 3PO0A 1HUNA 1R4NB 2FIDA 2WDQB 4G57A 5CGKA 3AEVA 4J3OD 5JPNC 3EC8A 1O7IA 3L10B 4CDFC 4KSKC 3BZCA 1JQYD 3H1UA 3DEPA 1JJ2A 2LHDA 1VQ8A 3TBIB 3CC7A 1TWFH 2AYOB 2MP2B 2VH1A 3AV8A 2BDNA 1HHVA 4RFBA 2RHSB 2BS4B 2NBWB 4M0WA 2LEKA 3CXCA 1DOIA 3CQZB 3DXJC 2CU1A 3KLSA 4DAPA 4TMAB 1EY0A 5CV4A 1S4ZA 3PF4A 1S5ED 1VR9A 2AKWB 2XWBB 1AW7A 3M9BA 2R2OA 3GE8C 5BMHA 1HH2P 1N33L 2MPMA 3J80L 1WOCA 4KHPL 1TKYA 4IDIA 4WQMA 1E7VA 2K0PA 3OYYA 2PZTA 2L00B 2LWPA 2B2WC 3SE0A 2GBJA 4MM3B 1YEZA 3AFPA 3CP0A 3UE1A 1GM5A 2L1AA 3ZTDA 1HFNA 2LS01 3RNBC 4HMJA 4XTCS 3K6OA 4HIDA 1HJPA 2N1WA 4DWFA 4EFOA 2DJGC 2DJFC 3K5MA 4LNKA 3DM1A 5KNDA 5C0XH 1KJTA 3OIPA 1E5WA 1F2MA 2M00A 1HTQA 5D6JB 2MFIA 3HVZA 1WFQA 2FMCA 2M0XA 1XLOA 1QVFA 3C8YA 4WWOA 1LACA 2R61A 5J1ZA 4WORA 2KC1A 1TZ1A 5IAAC 4NMZA 3HOYG 3ONAB 1O78A 1UE5A 3NS1A 2BKRB 1TS2A 2AWOA 2EELA 1VLBA 3DQVA 5JPMC 4H2AA 3CD6A 5J17A 5JOBA 4QIWB 4DV3Q 2E74C 3PHXB 3VAWA 1BO0A 4A3EH 3I63C 1GJXA 3RMHA 3HUIA 1QZEA 3W5UB 2MNAA 4DUZQ 1RM6C 1GUOA 1VZ8A 1FM0D 2UUBQ 2AMCB 1IBXB 1P1AA 3QK0A 4A3BB 3GTKH 1IP9A 2K5HA 4PZ8A 1N5XA 3DWQA 4EQOA 1WRDB 2YEPB 2EYLA 1IBLQ 3M4YA 4XT3B 4LNIA 3L9AX 3Q8FA 4DXFA 1BCPD 2KHJA 1YHQA 2OWOA 2R7ZB 1L2FA 1VQLA 1UELA 2FCNA 3KK7A 2WQYB 4DDGD 1EQQA 5K36H 3PVLA 2JZPA 4P16A 5D14A 4JBWA 4US9A 5KYLA 1XLQA 3QHTA 3OMGA 1HE8A 2CQAA 3JC66 1SYFA 1JJGA 2BYVE 3HHMA 1VMPA 1BT0A 3L4PA 4BXXG 1FIQA 2IYDB 3CPWA 5CHVC 3K5LA 2L0CA 2L11A 3P42A 3IBEA 2EY1A 4AYBE 3I4MG 5E4WC 5M3MB 3N1YC 2K28A 2RPQA 5IOCA 3CC2A 2DYMA 4DV7Q 3PO2B 3QIJA 3F1ZA 2SAKA 4B9WA 4N9F4 1NE3A 3MXNB 2BYFA 4YXDB 1FNUA 2FIFA 1XF5L 2B8FA 3MJ5A 2ENBA 1C4QA 2KO3A 3QWNA 3T53B 2WKCA 5I4DA 1MJDA 3HIZA 4JE3B 4UDUC 1QVGA 1MJCA 1WX7A 4A93G 2EYFA 3OHXC 2JSVX 3BDCA 1FJGL 3GTGB 1X1MA 4B3ML 3AE5B 1NTGA 2MJEA 3Q6SA 2JA6B 2KHIA 3VH3B 1FEHA 4BBRH 5CBEE 1ZDVA 3S16B 2FUHB 1QG7A 4GOPA 2ZNVC 3AU5A 5EPJA 4RM9A 1SFOH 1PTOC 1M94A 3CSTA 3DVGY 2K5VA 3ULJA 5T1IA 2F4VQ 3A1QA 3EFUA 3S1QB 4MHEA 3P75A 4ALPA 2RPVA 4MN3A 4A3KG 3NPPA 4I6LB 1WCMH 2HQLA 5CV9A 3FILB 3K81C 2VQEL 1ICFB 3L17A 5HG2A 2KWCA 1KF6B 1ILQA 4F87A 1PH5A 4D2KA 2NVTB 3PSEB 4A3DG 3SK5A 1VQ4A 5CV8A 4ZRZA 2BYEA 4IW0A 4S17A 5IYBG 2MH7A 4GKKL 4K7SA 5FO9B 5I9PA 5BMGA 2X38A 1SYEA 1Q8IA 1E6EB 3WA0A 1PH3A 2G4DB 2GA4B 2JA5B 3AE2B 1X55A 5H8YE 1H95A 3SXHA 4J1MA 1BKBA 1CTMA 4L5QA 1Y56A 1JR0D 1ESRA 2MBEA 4M8NA 3Q8DA 3G6JB 1W3SA 4FXKC 3N52A 1YNTE 2AQ3B 3HOXG 1PH6A 5HHDG 5M3FG 1GUTA 4H7BA 1HTPA 3RN2A 1TKGA 1W6KA 2HDLA 4QAYA 4XDDA 4LFAQ 1VQPA 1QB5D 4X3SA 4GOCA 4L63B 4E74A 3ZJTA 2NZOA 1UWMA 2NVQH 4OL7A 3QAQA 2WU5B 1H9RA 5AZHA 1VQFA 2QSDA 4A3PA 2C5CA 3PT2B 4DBGA 2WACA 4W9HA 5ELOA 3K59A 1GJZA 3P4SB 2A6HD 3NP8A 5BN5A 2K3UA 5FLXc 5G3LF 5CC4A 4ZKCB 3J81E 3P4RB 4WJNA 4A3IB 4R4IA 3GTOB 1RL2A 1V9JA 3R93A 4N9TA 2GBMA 4LNOA 4EQPA 4B3SL 4KI0A 2JWZA 2CW0C 2GBRA 4FDBA 4YT0B 3J7AV 4IJHA 4YSZB 2PIAA 1X56A 2OHFA 3S2DH 3ZO5B 4ZUIA 2PW5A 2M1MA 3ZRCA 2HD3A 3N32A 2JYEA 2D3BA 2J52A 3KUZA 2JRHA 1WTVA 4RM8A 4KGRA 1PA6A 2KMCA 3CCEA 1EQRA 1WGKA 3QC8B 5AZGA 1GOZA 1WYWB 2KX0A 3NZUA 1VQ6A 5C4XG 4F7ZA 3PV0A 1EY4A 1LYLA 2Y0SB 1T6BX 3FEWX 1EIHA 4GXBA 2MO1A 2K52A 4O42A 2NN6I 4JI3L 2NMQA 1K3RA 2R3ZA 1PZKD 1C7YA 3IAYA 1E8XA 3HOUG 3DBSA 1WXMA 3PIO3 1I6VC 4DNRB 4KK7A 2F0FA 4B3RL 1C4PA 4M0WB 5ELEA 3VR2A 2EXZA 3PLUA 2JWUA 2HQEA 4XQJA 3E9HA 3D8GA 1GNUA 2L5TA 3CC4A 1JRPA 1MG8A 3ZXVA 2MW5A 4XQQA 4IALA 1YHAA 1HFGA 2JUOA 3VR9B 4ZAIA 1ILPA 4GDLA 3RPFC 4KN4C 4MGYE 1FD6A 2NN6G 4WJ4A 4RHSA 2A73B 2MBOA 4JCVE 5DPTA 2EE1A 3NBIA 5JEAH 2OT2A 2HDEA 3D6CA 4ANWA 1RF2D 2NWGA 4IWPA 5GQOA 2CHZA 1WJNA 3GS2A 1JQ4A 1PH1A 4NJ6A 3NHHA 2WXPA 1H9SB 4A3GB 4C3JG 3S2HB 2GLSA 1TWGB 4XIGS 4Y7NB 1XMQQ 2Z59B 4R4OA 4C1NI 2K8CA 1DOXA 5FLXL 1DD2A 4RGNA 3WDNA 2HT1A 1F2RI 1WXSA 3AU4A 4KY6A 3WAMA 2K6DB 1Y8OB 3HOZG 3VR4A 1SYBA
chains in the Genus database with same CATH topology
1CT1D 3GB1A 4F8MA 1JORA 2NB0A 3KWVA 1E2ZA 1K53A 2RQXA 3HRZC 1WXQA 1FFUA 3F2UA 4DK0A 3DHQA 2L12A 3I91A 1BCPC 4FF2A 4CBVA 1B9MA 1TIID 4IUNA 4GLSC 2JXMB 1XTCD 1F9RA 1V43A 2K22A 3VQIA 1L6UA 1TY0A 3MVVA 4FYDA 1QOHA 1NYQA 2I46A 3WOEA 1GUWA 1QOBA 1OO9B 1B1ZA 3TP6A 4ZRQA 1MSHA 1C48A 4XDCA 2WXFA 3AU7A 4NKLA 1VZ6A 2EYOA 3DWGC 3V96A 1GUGA 2K1BA 1PTOF 3M3YB 3BDOA 1OQRA 1VMCA 2IGDA 3NTHA 2H4OA 1EYDA 2WXNA 1LTTD 5G5HA 5D3DA 3X3MA 2J7ZA 2WXKA 1XO3A 4KX6B 1SMYD 3AB5A 1WWTA 1IYVA 4RF1A 1YNJD 2KDMA 3NE5B 4ITKA 2AWNA 4WURA 1OXSC 2JA7B 3ERQA 1MI2A 2E2JB 2GB1A 4DQOC 2FHTA 1DXMA 4KJNA 2F0SA 1J9OA 1S5FD 1V1PB 3K57A 1DM0B 3ND9A 1EWHA 2R93B 2L4NA 2RDFA 3PUYA 1Q90A 4EGVA 5C3XA 2K9XA 4C3HB 2OEOA 1ENFA 2MJDA 5K36G 4CKCA 3E9SA 2PTLA 4I65A 3BG3A 1PTOH 1CI3M 1U4LA 1XWEA 5M5YB 1ESFA 1G2SA 4YWGG 1IGDA 4WAFA 1U4PA 4H13C 2PPBC 2WU2B 5BN4A 1KAAA 1LO5D 3Q23A 3EVQA 3FMCA 5C4HA 1PGAA 2A6HC 5C4ZA 1STAA 3VA7A 2BS3B 2Y3AA 2IDYA 4WH4A 3AB9A 2DN8A 2EY5A 2KVMA 3I57A 1N5WA 1LV9A 1SNCA 2A69D 4XQNA 4RCOA 2JSOA 3RFZB 1D4BA 4TKOB 1ZPSA 3KWLA 3HOYB 3IAS1 4Q5VA 2WXLA 3DEOA 4BA1I 3VA5A 2PZUA 1CJEA 5C44B 1I50B 1QWYA 3BK1A 4MH8A 3BVGA 2JE6I 3A8IE 4YSXB 4O1NA 3GTQB 1MBYA 1KNEA 1Q10A 4OVZA 1G2TA 4KN7C 3P20A 2N7JA 2MEKA 1YN3A 3Q8BA 3U52E 2DY8A 3S9WA 3JAME 1N63A 3ITPA 2KEEA 3I4MB 3SHLA 2F0DA 2BB6A 2KAJA 4HR7B 2F0MA 4GDLB 3LYYA 1BUIC 1ENCA 2EOTA 1CQFA 1RD9D 4L6TB 1LLRD 1Q12A 1XX8A 3MXNA 1ICWA 4FXDA 2EYJA 3AEAB 1JCKB 2Z1CA 4S3SA 2WXQA 5EE3A 3GO5A 1JOQA 1FRDA 1SNPA 3MA2B 5IGEA 2SDFA 3MXPA 4DA2A 5KRUA 4CHTB 1N60A 2LY7A 1M4VA 1V8CA 4WIPA 3S17B 3N9YC 5CBAE 2H88B 2QJLA 2RDGA 3KBXA 1EYAA 4A3KB 1ZP0B 1LABA 4RWSC 2V4IB 4FF3A 5KEEA 4A3DB 4OZBA 3S15B 3IAM1 2VB2X 3CKIB 3A56A 2L9HA 2L32A 3QG1A 1KH0A 2QDBA 4HKZE 5EBDA 5CYUA 2K6AA 1BF4A 1B9NA 2C9OA 4RGTA 3OWFA 3HOXB 1PFMA 2A6ED 2BB5A 5M3FB 3DWMA 2Z8LA 1Z47A 3IXSA 1WD1A 2K5WA 3MXGA 3AEEB 1I4GA 4ULLA 3ZGZA 4RGMA 5J22A 4DK1A 1TVXA 1EQVA 1IGCA 2ZXRA 1WTXA 4J6HA 5EBCA 3P4QB 1SMYC 3FVQA 4NDXA 1QOFA 3PUVA 3ZJUA 2YEPF 1A6XA 1YNJC 1PUTA 1HQMC 1TWHB 5D3IB 5IIFA 1SSOA 1KNAA 3OOCA 1A15A 3GTJB 3SFDB 3GV6A 3MP9A 3DMUA 2W55A 3V05A 1U4MA 2EJGC 5A2QL 4ZHOA 1HCZA 4BA2I 3T3OA 2KEDA 5IT9L 5IGGA 5C4XB 5FLXE 1Z7TA 4ABNA 2J53A 5BYRA 1F9QA 2F0WA 3HOUB 3D4DA 1E10A 1HTLD 1EOTA 4CJ1B 1UEAB 2K01A 4N9PA 3K5OA 4I7ZC 2BT6A 1E0BA 2GRIA 3BYYB 3ZJVA 3QB3A 3MFGA 1I3QB 1T5EA 1OXXK 2SOBA 4OZCA 4NJCA 3CRKC 4DAVA 1PMRA 5CORA 1TYGB 2I07B 2F0IA 1EIGA 5C0XJ 3ETRA 1Q1EA 3R8BA 3U2SC 5T8IA 4OO1I 1H9SA 3D4WA 4KY5A 3IL8A 2PNRC 1B50A 3NRZA 3CU7A 3O13A 1V8QA 2O4XA 5EGTA 3QOJA 5KGUA 3NBHA 3D6WA 3BVMA 1C8CA 3NTKA 3HOZB 1LTAD 1AN8A 2JP1A 4LAAA 3PUXA 1DONA 1GB1A 2EJFC 1TWCB 3VYSA 1O7ZA 4CJ0B 5KIXA 3IT4B 4XT1B 1K51A 1WRIA 4NZLB 2DBYA 1QJOA 4DNTB 1STNA 4OO1G 4C3IG 4HCEA 5JAVA 5DM63 1V97A 3H8HA 1HXYD 2ZW1A 3P1HA 2QILA 1SNMA 3N6RA 1TWFB 1BQQT 1C79A 1HZ6A 1FMAD 3BVZA 3FKIB 2MGSA 3AE9B 2IGGA 2K5PA 4IUTA 4NP5A 3MHBA 3HGBA 1CZPA 3KQ4A 1BUVT 4KKUA 3BS1A 1SEBD 2LUMA 4AYBB 5EQ0A 2J42A 3NSWA 2AUKA 5KNCA 1QILA 4M1UB 1I4QA 3AH7A 2RVLA 1JWAD 2E75C 1PFNA 4X3KA 1ZEQX 1RCVD 2E6XA 1ZE3D 4P6VF 1B2TA 3Q69A 4TRDA 4Q2JA 5FR3A 1FR3A 2ID0A 3AMZA 1VCIA 3I9V1 1D1KA 1E2VA 4RF0A 1BMLC 4KKIA 2FBWB 5E3FA 1F2YA 2BE5C 1EEID 1ACCA 4USAA 1JROA 1V1PA 1CQVA 2K32A 2XSCA 3M7GA 1B4OA 1STEA 3NWTA 1DOKA 1HA6A 3TUOA 3E0JA 3CIRB 3SVMA 2N55A 2XVSA 1RTNA 3R2IA 2A6EC 1R4QB 1SE2A 5C6AA 1LT5D 4N59A 3H0GB 2WXOA 1SIJA 2CJNA 1HEZE 2BA1A 1DYQA 1TKWB 4IUUA 4TSSA 3H3VC 5C5MA 1G291 3NQIA 1EZ6A 1A3VA 1SBBB 2YYZA 3UI2A 1EY8A 3MEHA 5I2XA 1JALA 3GTMB 3UI3A 5F2DA 4CJ2C 1KFYB 4G7OC 3T4AC 3W2DA 1JC7A 4RA8A 2Y5PA 3I3CA 3HEJA 2Q8TA 1DJRD 4WFN3 2Z4HA 4YTMB 1STBA 1A3TA 2VXWA 1MHHE 1YNND 4DAYA 2KJXA 1SE4A 4IURA 1L4DB 2GI9A 3V2TA 1SFOB 2AQ1B 2ZXOA 2PVGC 4KKSA 4KGTA 1RWSA 1YJJA 1Y1WB 5C4JB 2IX3A 4U673 4ZQ3A 2F1MA 1ZYRD 2IPKD 3AEDB 1PFBA 1FCLA 5E1FA 4HKQA 2XRSD 1FCCC 4C1NK 4R9WA 1R9TB 2D62A 1C77A 1TY2A 4HJGE 1SYDA 2SNSA 2NVQB 1TR5A 2JX5A 1G91A 5ELDA 1JMLA 2M0AA 5JEAJ 2IW3A 2PO4A 2M2LA 4NW2A 4KGSA 5KYIA 3RZOB 1DOMA 1N62A 3FPPA 2JQRB 4KD4A 3LNNA 5IGCA 1VF5C 4DF7A 4K6DA 1J7AA 2DY7A 5GXGB 5D65A 3G7LA 2JEBI 4C80A 4XYOA 3A55A 2ZXPA 3RUZA 1ZOYB 1YN5A 3RLFA 1D1IA 1PFDA 1TQOA 1K8OA 1L0XB 2OXPA 3PZ8A 1IW7D 3MAQA 2N9KA 1EWCA 3OPOA 1ROEA 5A35A 2LFNA 1O7YA 2B2TA 5ELCA 3I90A 2QIEB 4R3DA 2KUMA 5EKKA 4EVOA 4LLGM 1CK1A 2H89B 2F0TA 4KJOA 3AE7B 2IX1A 4PMBA 5FKAC 5HI1A 4IQZA 3LXFA 5C0XI 5A2QE 3EROA 3SEBA 3A8JE 1JWBD 1GUSA 2PKOA 1A2UA 1RKNA 3C1EA 1IKLA 3B9JA 1JWMD 3NVWA 1E2WA 4OW0A 2RSNA 4RHRA 1JW9D 5M5XB 5AUKA 3AECB 4QCLA 1VDVA 1OXVA 2D9UA 5JJZA 2IJ0A 5C0XG 4YSYB 1JWUD 1FGBD 3OSOA 1TU2B 1LTID 2FMMA 4ODGA 3EA6A 3SR1A 3VYRA 2V3NA 3NVYA 2IWHA 3J80E 5C3WA 2KA7A 3VR6A 3WOFA 5I6YA 3FPUB 2EY2A 2ICIA 4PMWA 2J0TD 3QO2A 3FRPB 1WTRA 3AMUA 3M85A 3OMCA 1F77A 1UGJA 3A8KE 1WTQA 1D5ZC 4RKLA 3LX0A 4EE2A 4KKJA 5H92C 2LJIA 3ZQ4A 3HP3A 3R3OA 1PGBA 4IFDJ 1RHPA 3TN2A 1X3PA 3EQLC 1E9MA 1YMHE 3TP7A 4IFDH 4BBSB 3HOVB 2M9VA 1KLUD 3AM9A 1F9PA 1ET6A 4TQ1A 3MFYA 5BN3A 1CA5A 3H94A 2N88A 2LGIA 1WTWA 4N58A 1WVLA 3T16A 3VRAB 2H1EA 4C2MB 1SJHD 1B9RA 4YTPB 3M4OB 2F0JA 2YU9B 1IKMA 5IGDA 1G6ZA 5AUIA 1F0ZA 5EKLA 1EFID 4KV6A 1DOYA 3PZ7A 1PRTF 1I6HB 1YNNC 3DWPA 2JEAI 4P2CB 1NR2A 2A68D 2K5QA 4FF4A 3B2FA 3OWEB 3U9SA 1AFPA 3NWSA 1L0VB 1MD2D 1FXIA 2CHBD 1G8ZD 2XIWA 1ZDXA 1I4PA 5I2YA 4A3FB 2VUMB 1K50A 1EY7A 1ZYRC 4OZAA 2NTSA 2PMZB 1Y8NB 4IUPA 1QQRA 4C3IB 1AZQA 2FFKB 5EE1A 1LT4D 1X32A 4LMQD 1RODA 1EM7A 1GHJA 1HPCA 2HCCA 1UNSA 1O7LA 3AEFB 4CGYB 1RYJA 1OXUA 5CMDA 4RNAA 3MWYW 4OIKA 4IZ8A 1Q3LA 1VF7A 2F0QA 5G5GA 3SDZA 4ARIA 3BDLA 4IUQA 3KLRA 1V1OA 3LB8C 4A55A 1W6JA 4A9AA 1MHXA 4OHJA 4FXCA 1M8AA 2G9HD 4G7HC 2EPBA 1D5XC 3I72A 3J81L 4A93B 1VDZA 1NAPA 1WSPA 2XWJB 1C4AA 1RTOA 5IGFA 4C7YA 1IW7C 2VNUD 1RJTA 4NAWB 3W5VB 5CV5A 5KNBA 4B08A 3Q8EA 2F3WA 4UAIA 4JK1C 2B76B 2F0NA 1O80A 2WINB 4JWUC 2M19A 3HRDD 2W54A 1XLPA 1PRTB 4K2LA 4JPSA 5DAUA 3E56A 2BA0A 5CV6A 3AE1B 1LTSD 1H9KA 3EUB2 4FXGC 2F0GA 3QIAA 3SK6A 2O5IC 3V3XA 4K2KA 3T56B 2RBMA 1GHKA 4ZRPA 1I4RA 1JE4A 2D5DA 2DNEA 1D6EC 1EYCA 4PV1C 1EY9A 1NSNS 1X3QA 4G7ZC 1QNKA 1PLFA 2PZWA 5JEAG 1ET9A 1TZOA 5NUCA 2HUGA 1A3UA 2WXMA 1JOOA 2ICEC 3RD4A 5LL6S 1EY6A 4QUCA 3IT6B 5AFWA 1L4ZB 3D3RA 1B44D 4K5XA 4WRDA 3W1SA 2BTEA 2RSOA 4FNFA 5FK9C 4FVMA 1TKEA 3VRBB 2K5DA 2NN6H 2E76C 1CZGA 2NVYB 3NK9A 1DOLA 1BOSA 2OF1A 5EPKA 2WP8J 1QT9A 2B2VA 2EZVA 5JVH3 2WXRA 5MPOA 1JOKA 2W3SA 1DGJA 2BYTA 2HTME 2WIIB 1AYFA 2PMVA 3MHZA 1IYUA 1K8MA 4K6LA 3A7LA 1OXTA 1I4XA 1PRTD 3URYA 3PO3B 4HCSA 1WTOA 3NZ3A 1P7EA 3HS0C 1GAQB 4XWWA 3BWUD 3PMFA 1NR4A 1STYA 1RFKA 2DYOA 1PZID 4GDKB 1K83B 4RH6A 2B63B 2EJMA 4LK0M 3GTLB 4TQ0A 2F3VA 4AS1A 4R8IA 3NUHB 3ND8A 3CHBD 5HFYA 3TEZA 3I4NB 2LHEA 4C3HG 1U4RA 3FDTA 3Q22A 3MTSA 3H91A 4OGQC 2QCPX 4IN3A 4IOIE 1S5DD 3C2PA 5BMIA 2JYTA 4XWTA 3AE6B 1IL8A 2A68C 2WAQB 5EE9A 4X3UA 2PW7A 2FUG1 1RDPD 2A69C 4U68A 3D31A 5IGBA 3P4PB 1MVKA 4C3JB 4IUVA 3HOWB 3DWAA 3SK8A 1PYWD 4ID6A 4EQNA 2WNMA 2E2HB 3HVDA 4IFDI 1XYIA 1HRJA 1CHPD 1SE3A 3VR8B 2KCNA 2Y5CA 1S5BD 4REZA 2FE8A 2X69A 5DEHA 1CHQD 3P1MA 4B9XA 2B2UA 1U9RA 1TS3A 1SYCA 1XEEA 4NAMA 3J7YW 4RAUC 3AEBB 2X6LA 2VZKB 3T51B 4HN7A 2NBFA 1L5PA 1H9JA 2AQ2B 2IL8A 4IFDG 2HDMA 2JU6X 1ZXIA 2BBCA 3K0YA 1J7BA 5BYSA 4ARCA 2RMMA 1SXTA 1EEFD 1SNOA 2EYMA 2F4IA 4MIUA 5ELFA 1Y8PB 3H6MA 4BY1B 3BYTB 5C5LA 2TMPA 1BR9A 2A5HA 1AWDA 3AEGB 3TDQA 2B2YA 5E4XA 2L1BA 2G1EA 2SEBD 3PIP3 4OIJA 2DLBA 1HZ5A 2WXGA 4LK1C 3MXUA 3MZ5A 1E0ZA 2RA4A 1H9MA 3I70A 1NCVA 2VB3X 4HAEA 3U4EG 2KWDA 4FF1A 1GUNA 1FXAA 5FO7B 2BW2A 4ILWA 2WLBA 2B2WA 4A3EB 3BK2A 4C56C 4ZUJA 2WXIA 1CM9A 2BCOA 5C3JB 2XNAC 3GTKB 4HRSA 4PT5A 3TEWA 4K5VA 2PYKA 4L2YA 1B3AA 4B0MA 2VZKD 4DU9A 3AE4B 2F0PA 3JAML 4ZYSA 1TJEA 2EKIA 2V0GA 4RCNA 2WXHA 2DNCA 2N9LA 2D2CC 4HROA 4BY7B 4XXEA 2AX5A 2PLPA 5IODA 1EY5A 1HUMA 2I2YA 2F0LA 4MT5A 1SF0A 4ME5A 4QB4A 3HG9A 5LHY1 3B2GA 3BZDB 1P7FA 4AQ7A 4K8IA 3SFEB 4FO2A 1ZXHA 4JX1C 1VRAB 1K52A 3WCQA 4J8QA 1EQTA 1TS4A 2K05A 4BBRB 3U7ZA 2NYZD 3PUWA 5EJWA 1XCQL 1OFFA 1QLBB 1LTRD 3DUZA 1YQ3B 4JWSC 3Q8CA 5BYQA 1WCMB 2RDHA 5HGTA 1MGSA 3C46A 4KY7A 2B2TC 1NENB 2F0OA 1PXUA 1QNUA 4PNYA 4A8XC 1J7CA 1GB4A 1PRTC 4F7XA 4M8AA 4ZLTF 1GPXA 4B0EA 5TSSA 1Q1BA 2M56B 1SNQA 2NUCA 3GQBA 1C78A 2SNMA 1XCTL 4K14A 1EU4A 2XN9C 1LT3D 1II3A 3QJYA 5LL6X 1XLNA 4N6EB 1A2TA 2K7VA 4A90A 3U9OA 5M9OA 1KRHA 3PUZA 3LWEA 5DNFA 1YN4A 2PCFB 1FNWA 2ACZB 4ZK9B 4HEDA 4L23A 1STGA 1R4PB 4XYQA 1FD7D 3ZYYX 4GZYC 1JICA 5C2TB 4CKBA 4QMGA 2F0KA 2CU3A 3VR3A 2LMCA 4DGZA 2G9DA 3KF8A 2O5JC 1LTGD 3I8ZA 3GTPB 2QKIC 5HURA 2TSSA 2MJ3A 1SAPA 2R6GA 2NTTA 1SJED 2WS3B 4WWMA 3S2DB 2MUYA 4H44C 1ML0D 1FO4A 3LWUA 4Z9CB 2EVBA 3NTIA 2QMTA 1AEXA 1SNDA 2W82A 2ZT9C 1BBXC 3VR5A 4KD3A 1MI0A 1NUCA 1T3QA 5C3EB 2JXTA 1PZJD 3KLSX 2FINB 4ZOHC 3QOLA 1PGXA 2KHSA 1YQ4B 2Z4IA 4YIJA 1IHZA 2QF7A 3K7AB 1ENAA 4FP5D 4RKBA 5CR3A 2B39A 1R7SA 1KTKA 2NZ1D 2K03A 5IT9E 2V3PA 2KOLA 3VYTA 2B8GA 1EL0A 2WDRB 3Q24A 1VZ7A 4HEA1 3S14B 1QF6A 2F0HA 2QEJC 2AUJD 5ISRA 2ZW0A 1EZ8A 4KHZA 1C9FA 3SR6A 3T13A 4LJZC 2LKVA 1UUPA 3NUCA 2EYHA 2WB1B 4HSVA 3Q8AA 4ZKBB 1D2BA 2IGHA 1HA5A 4G4KA 2WP9B 1BXTA 2BS2B 2KMMA 1FNVA 4HTHA 1PDXA 1LT6D 2V4DA 1F2RC 3RZDB 1QKZA 3TZDA 1D5MC 2F0UA 2PVOD 1FRRA 3OW7A 2INNE 2ONQA 3MC0B 1PDQA 1I7HA 3IFDA 3E5SA 4OO1H 4X3TA 3E6ZX 3AE3B 2KN4A 1YJIA 3D4RA 3NQTA 3L3OC 2JYOA 2FJ2A 1SSNA 1BDOA 3OIQA 5G3LD 3FC4A 3HZXA 4KHVA 2L83A 2WDVB 5D7GA 4ZHPA 5FO8B 3Q0AA 1FFVA 1LTBD 5J39A 1JWSD 1KDAA 2CJOA 4HSPA 3TZUA 1MSGA 5LNK1 4R8NA 3X3NA 3GV3A 3NVVA 3TMEA 5I6WA 1F9SA 1KABA 2L52A 3GP7A 1Z6HA 1TS5A 2XRQD 3TSSA 4Q0FA 5EKIA 3K5NA 2LFIA 1A70A 4K8JA 4KMUC 1STHA 3IFTA 1N61A 1NI3A 1KDCA 5K5PA 1NYRA 1DCZA 3BIID 1PTOB 2Q5WD 1QE6A 4MACA 1UWXA 2HCIA 3S1NB 1IBXA 2PQEA 1SDFA 4WJWA 2OEDA 3H09A 4H0LC 3TP5A 2E2DC 1WD0A 2L55A 1Y69U 5JVG3 4QF4A 3ABVB 1CA6A 4A6QA 3AN1A 4L1BA 3T3NA 2LMCB 2KECA 3J9CA 3SK4A 2ON8A 3C1FA 1AZPA 3CWIA 2INPE 2KACA 1OQQA 1ONLA 2RKSA 2Q8IB 1ZUD2 4XDXA 4DN4M 3GD7A 1HQRD 1QCBD 1ZKOA 1QOAA 3TEXA 4TQUS 2O2LD 3IKJA 3W9CB 2NVXB 2IX0A 1F2LA 5COYA 3NXWA 4DFAA 3A7AB 3L7ZC 2K33A 4V0BA 2B2VC 1BCPF 1CZWA 5EE0A 3S1RB 3R2TA 1UAPA 2MJ8A 3TEYA 2J4XA 2R92B 4QUFA 5ELBA 4DXGA 1WTPA 1S5CD 4CQNA 4F88A 2EY6A 1BNZA 4PMCA 4RGOS 1F2ZA 1NVID 1WYGA 4HMIA 3AE8B 2E2IB 1PTOD 2JA8B 2F0VA 3FILA 4IKGA 1L0YB 2BE5D 2IT1A 1DZ1A 3CRLC 2DWQA 2EYPA 2D5GA 1TWAB 2W3RA 2WKDA 1FYCA 3W3AA 4BWGB 3HKZB 2N0SB 5JXVA 1QOGA 1MPEA 2CVRA 1B53A 2MHVA 2X6GA 1GXDC 5CV7A 5I9OA 3KBGA 3VYUA 1J8IA 2I38A 2F0EA 5E6JA 4A3MB 5M5WB 2KQ4X 3S1MB 1NEKB 1JB3A 4E6IA 1AP0A 1SB3C 3I73A 3C3LA 3M7NA 1ZXTA 1C4CA 4KTAA 1C76A 4L8JA 3EFXD 3KUPA 4CKEA 1TT2A 5DM73 3J7AF 2B2UC 5T1GA 4YTNB 2Q8RE 4KKTA 3EGRA 2WXJA 1KDBA 1T5XD 2EDGA 1KLGD 4LTUA 2BDOA 3I4LA 2BOSA 2E3TA 2A74C 4A3JB 3K58A 5EPLA 1Y1VB 1CFMA 2KCCA 4V190 1E7PB 2MP1A 1EWYC 2WV6D 3P7JA 1SYGA 2KQ3A 3P63A 3A54A 2K04A 1I4HA 1L6VA 3TP8A 1XXGA 2CW0D 3FAHA 1EU3A 3EJIA 2F03A 4C7ZA 3NVZA 5FOBB 2B2YC 1BCPB 4BS9A 1IUEA 4K5WA 2PW9A 4XE0A 4US8A 1VJKA 3PO0A 1HUNA 2WDQB 4G57A 5CGKA 4J3OD 5JPNC 1JQYD 3DEPA 2LHDA 3TBIB 3AV8A 2BDNA 1HHVA 4RFBA 4M0WA 2BS4B 2LEKA 1DOIA 3CQZB 3DXJC 3KLSA 4DAPA 4TMAB 1EY0A 5CV4A 1S4ZA 1S5ED 1VR9A 2XWBB 1AW7A 5BMHA 4WQMA 2MPMA 3J80L 1TKYA 4IDIA 2K0PA 2PZTA 2B2WC 3SE0A 4MM3B 2L1AA 1HFNA 2LS01 4HMJA 4XTCS 3K6OA 3K5MA 3DM1A 5KNDA 5C0XH 3OIPA 1F2MA 2M00A 3HVZA 2FMCA 1XLOA 3C8YA 1LACA 2R61A 5J1ZA 4WORA 4NMZA 3NS1A 3ONAB 1O78A 4H2AA 1TS2A 2AWOA 2EELA 1VLBA 5JPMC 5JOBA 4QIWB 2E74C 1BO0A 1GJXA 3RMHA 3HUIA 3W5UB 1RM6C 1GUOA 1VZ8A 1FM0D 1IBXB 4A3BB 1N5XA 3DWQA 4EQOA 2YEPB 2EYLA 3M4YA 4XT3B 3L9AX 3Q8FA 4DXFA 1BCPD 2R7ZB 3KK7A 2WQYB 5K36H 2JZPA 4P16A 5D14A 4JBWA 4US9A 5KYLA 1XLQA 3OMGA 2CQAA 1SYFA 3L4PA 1VMPA 1FIQA 3K5LA 2L0CA 2L11A 3P42A 2EY1A 5E4WC 5M3MB 2K28A 5IOCA 2DYMA 3PO2B 2SAKA 4B9WA 4YXDB 1FNUA 1XF5L 2B8FA 3MJ5A 2ENBA 1C4QA 3QWNA 3T53B 2WKCA 5I4DA 4JE3B 4UDUC 2EYFA 3OHXC 2JSVX 3BDCA 3GTGB 3AE5B 2MJEA 3Q6SA 2JA6B 1FEHA 1ZDVA 5CBEE 3S16B 1QG7A 5EPJA 1PTOC 5T1IA 3S1QB 4MHEA 3P75A 2RPVA 4MN3A 3NPPA 4KGRA 5CV9A 5HG2A 3FILB 1KF6B 1ILQA 4F87A 4D2KA 2NVTB 3SK5A 5CV8A 4ZRZA 2MH7A 5BMGA 5FO9B 5I9PA 2X38A 1SYEA 1Q8IA 1E6EB 2GA4B 2JA5B 3AE2B 5H8YE 3SXHA 4J1MA 1Y8OB 1CTMA 1Y56A 1JR0D 1ESRA 4FXKC 3G6JB 1YNTE 3N52A 2AQ3B 5HHDG 1GUTA 4H7BA 1HTPA 1TKGA 1W6KA 2HDLA 4XDDA 1QB5D 4X3SA 4L63B 3ZJTA 1UWMA 4OL7A 2WU5B 1H9RA 2QSDA 2C5CA 2WACA 3K59A 3P4SB 2A6HD 3NP8A 5BN5A 2K3UA 5G3LF 5CC4A 4ZKCB 3J81E 3P4RB 4A3IB 3GTOB 3R93A 4N9TA 4EQPA 4KI0A 2CW0C 4YT0B 3J7AV 4YSZB 2PIAA 2OHFA 4ZUIA 2PW5A 2JYEA 2J52A 1WTVA