3P63A

Structure of m. laminosus ferredoxin with a shorter l1,2 loop
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'ATYKVTLINPTGNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Allostery in the ferredoxin protein motif does not involve a conformational switch.
pubmed doi rcsb
source organism Mastigocladus laminosus
molecule tags Electron transport
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p63A00
2DWQA 4JWUC 2FBWB 3CIRB 4YTMB 1ZP0B 3VR9B 2Q5WD 4US8A 3B2GA 3AEAB 2DBYA 2WQYB 1FO4A 5H8YE 1JROA 1XLPA 2HTME 5C3JB 1E9MA 1KFYB 5H92C 3NS1A 3LXFA 5EE0A 5AUIA 3NVWA 3AE8B 2BS2B 1KF6B 2K9XA 4USAA 1QOFA 1OQRA 1WWTA 5MPOA 1RM6C 1FMAD 2OHFA 1YQ4B 1E6EB 1SF0A 1VDVA 2WDRB 1JRPA 1XLQA 4FXCA 2BS4B 5AUKA 5EE1A 3VR8B 1OFFA 1QOAA 1ZUD2 2W55A 3W9CB 1RFKA 2WDQB 1J7CA 3PO0A 2JX5A 3AEDB 2K5PA 3AEBB 3P4QB 4YT0B 1B9RA 4C80A 2CU3A 1JW9D 3FAHA 3CWIA 1KRHA 2MH7A 4YSXB 1EWYC 1PUTA 2N0SB 2E3TA 4HRSA 1DOYA 3AE3B 3ABVB 1TKYA 3AEGB 1ROEA 1R7SA 2B76B 1TJEA 2WLBA 3P4SB 4KX6B 1XO3A 1V97A 1FFVA 2EKIA 1FIQA 3AE7B 3NVVA 2G1EA 4ZHPA 1E7PB 3AE2B 1QOBA 3SR6A 3VRBB 1DOIA 3AEEB 2MJ3A 3WCQA 2H88B 3FC4A 2WU5B 1E0ZA 3HUIA 1N62A 4WWMA 4N58A 1V8CA 3BIID 3AN1A 2K22A 3P4RB 3SFEB 1RYJA 3KWLA 1N60A 4IDIA 2BS3B 3AE6B 5GXGB 2PVOD 1FXIA 1XLNA 3AE1B 3B2FA 1WYGA 1DGJA 1L6VA 3AE5B 3AM9A 3P4PB 4ITKA 4HROA 2CJNA 2LEKA 4LTUA 1JALA 4JWSC 3SFDB 1YQ3B 1J7BA 1NI3A 2H89B 4P6VF 1T3QA 4JX1C 2MJEA 2W54A 2AX5A 3DWMA 1GPXA 5EE9A 1DOXA 3EUB2 5G5HA 2WDVB 5EE3A 1F0ZA 1TKGA 3B9JA 3AECB 1CJEA 1TKEA 2M56B 2W3SA 1NYRA 4C7ZA 1I7HA 1RWSA 3ZYYX 1JQ4A 3HVZA 1FFUA 2WP9B 1XLOA 1L0VB 2CJOA 1SIJA 3AEFB 3P63A 1AWDA 1A70A 1L6UA 2L83A 3RPFC 1NEKB 1L5PA 1FM0D 1WRIA 1JWBD 1ZXIA 1WXQA 3ETRA 1YJJA 1VJKA 1N5XA 2ACZB 2PKOA 3AE4B 1N61A 3DWGC 3NRZA 4N6EB 4ZOHC 1FRDA 4WQMA 3VRAB 3W5VB 1FXAA 2KMMA 4C7YA 1UWMA 2L52A 1QF6A 2PIAA 3AE9B 3NVYA 2JQRB 3AB5A 4YSZB 1NVID 2PVGC 2QIEB 3LB8C 1NYQA 1VLBA 2W3RA 1TYGB 2KAJA 2MJDA 5C2TB 2M19A 4N59A 1QLBB 1WGKA 4YSYB 1YJIA 1FRRA 1CZPA 1ZOYB 2WU2B 3NVZA 1N5WA 2Y5CA 2QJLA 3AMZA 2BT6A 2WS3B 3HRDD 3AV8A 5G5GA 3L4PA 4A9AA 1AYFA 3AH7A 4US9A 1IUEA 1NENB 1SB3C 1GAQB 1OQQA 3P1MA 1PFDA 4YTNB 4YTPB 3W5UB 1J7AA 1E10A 1QOGA 4YXDB 1QT9A 1PDXA 1JWAD 1N63A 4ZHOA
chains in the Genus database with same CATH superfamily
4PYZA 1OEYA 2NBVB 3APCA 2KVZA 3BVGA 1H4RA 2GBKA 4W9IA 2JU6X 1GG3A 1FMAD 3TEZA 1JRPA 2KFJA 1ZUD2 3ML9A 2KYWA 3AEBB 4L23A 3A1QB 3GE3C 4YT0B 1EWYC 3UF8A 2N0SB 1UH6A 4WJNA 3SEBA 4GXBA 2KANA 1ET6A 1IGCA 4DQOC 1IBXB 1YX5B 1YX6B 1JRUA 2R2QA 3HUIA 5AZHA 2IY1B 1GJZA 3AE5B 3TSSA 2LEKA 4E71A 1J7BA 2PJHA 4JX1C 2MJEA 2L1AA 4LJPB 2KDEB 1GPXA 2LMCA 5G5HA 3RZFA 3R7QA 1AARA 1EM7A 2KXJA 2BWES 2MBOA 4FULA 4HDQA 3ZYYX 2KHWB 2JUOA 1STEA 2V1YA 4JLCA 4GDKA 1VJKA 1N5XA 2KDFB 5BYRA 3RNBC 4WQMA 2L52A 3VQIA 3RNAC 3NS8A 3N32A 2IY0B 4RF1A 1JMLA 3N3KB 3ZDMC 3UI3A 4XC2A 1IUEA 1R4NI 1C9FA 3T8MA 3SHQA 1QT9A 1PDXA 4K81A 2HTHA 2K1FA 1WJ4A 3GP7A 3RNCC 1F1HA 3EFUA 3PV1A 1SEBD 5L83A 3C0RB 2QC8A 4ZYSA 4GOCA 1MVKA 2WX0A 1TTNA 1WXAA 4C56C 2GOWA 4KIKA 5CHVC 4PS3A 3RI7C 2WDQB 2QDFA 4EEWA 1N6ZA 5AEKB 1R7SA 1UBIA 4LNFA 4EOYA 1GB4A 3BY4B 4BKSA 2MSED 3VRBB 3BVMA 4E3CA 4LNIA 2D11A 2KTRA 2XK5A 2N9PC 5GXGB 2KO3A 3KUCB 5JXVA 3AE1B 2W82A 5BMHA 1DGJA 2I1KA 3FILA 2W54A 3P42A 1WJNA 1F0ZA 1I4XA 1PGXA 3HVZA 3BK1A 1L0VB 1P3QU 3OJ3A 3SDLC 3KW5B 4BKSD 4OVZA 4ZOHC 2EMSA 2JZ3B 1ZE3D 1IGDA 2PE9A 1ISNA 2KN5A 1VLBA 2O2VA 1HXYD 5C2TB 3KLSX 4NJCA 5L95C 2N9KA 4G50A 4ARCA 2LRUA 4KZCA 2DZIA 2R2OA 1WX9A 1J7AA 4EFOA 2DX5B 1QOGA 5IA7A 2BQQA 2DWQA 1WXSA 2KWCA 5H8YE 5IP4D 2K9XA 4USAA 2SAKA 1WWTA 2KJRA 3A33B 3RT3B 1J0GA 5D2MB 5AUKA 1L4DB 4DHJD 4JPSA 2KFKA 2XNAC 3P4QB 1R4MI 3VUXA 3EHVA 1YOVB 4IC7B 3A9JB 4KGSA 4YWGG 3TEXA 4BKGA 2NVUI 1A5RA 4XZ4A 3NZUA 3N1ZC 4GB9A 1WM3A 1WXVA 3N1XC 2LGIA 4KDIC 2WU5B 4XWTA 3MTNB 5IAAC 3KWLA 1GUAB 3ZRCA 1Z5SB 4JGHB 3SFDB 1NI2A 4A3PA 1NI3A 3WAPA 1WXMA 4P6VF 3VTWA 4TMAB 3EUB2 1I42A 2PLPA 1ZPSA 2L0TA 2LJIA 2KT7A 3HM6X 3PVLA 4RM8A 1F52A 2WP9B 1XQQA 3PRPB 2KK8A 3TEYA 1UD7A 3WAOA 3E56A 4WJOA 2D3BA 1WXQA 2RGFA 1P7EA 1YJJA 5FK9C 1XT9B 1V80A 2JWZA 4W9DA 2LASA 4RNAA 2QEJC 2NMQA 3PHWB 4RCOA 1T0YA 3KVFB 3AXCA 2DHZA 4WURA 2TSSA 4IG7B 1EU4A 4A9AA 3AH7A 2ZPYA 1E10A 1H8CA 2LJ5A 1UZXB 4W9FA 3AEAB 1C4AA 2NR2A 1C79A 3EFCA 4GN1A 1KLVA 1Y8RC 2JRHA 3ZVVA 4ACFA 1UBQA 3PS6A 2LGSA 2RMMA 3W9CB 1MG8A 3Q69A 4FA6A 3EA6A 3AE3B 3W1SA 2FCNA 1WYWB 2UYZB 4BOSC 2NPTA 2CHZA 2KLGA 4KGTA 1HTOA 4MSMB 2MJ3A 1WX7A 3VFKA 3VH4B 4UDUC 1EU3A 4N58A 3P4RB 2K22A 3MP9A 2D3GA 5C23A 2FIDA 4HLEA 2CJNA 4KIKB 2JY6A 1YMHE 4TSSA 5E6OA 1G6JA 3C8YA 4W9LA 3AU5A 2WXGA 3DWMA 4EZLA 3UGBB 4HPMB 2JT4B 3NZ3A 3RN9C 2JZZA 1I4QA 2RDHA 4XWWA 4ZRJA 4ANUA 2WXJA 3BYTB 1VR9A 3HHMA 1AWDA 1AW7A 2B3AA 2KTRB 3SD5A 2GRIA 2XK5B 3DWGC 2KDIA 2K25A 3ZNID 4ZRIA 4D2KA 1SE4A 1ZKHA 4ANVA 3FILB 2IYDB 3H8HA 3QQ8B 2J0JA 1N5WA 2HDEA 2BT6A 2WS3B 3Q14C 4MGYE 4FJYA 4P7IA 1F2RC 1TGZB 4F1SA 3ZLZA 2KC1A 2INNE 1OTRB 2CHXA 3ENEA 3VXWA 3HVDA 2GBMA 1KLUD 3APFA 4ZRQA 3UQAA 3V3XA 2K6DB 2PEAA 2IO1B 5EE1A 1OFFA 2O2VB 1QOAA 2L05A 4B0MA 2FAZA 4KV2A 1WX8A 4L2YA 3CSFA 4LDTB 1PUTA 4HEA1 4B0EA 4ANXA 1S1QB 2DZKA 3U2SC 3V6CB 1JWMD 1EO6A 1WR6E 1L2NA 2KDMA 3FC4A 4OZAA 2ASQA 4RMAA 4MGIE 1WY8A 4P16A 4TQ0A 2BS3B 1FD6A 5LNK1 3DPDA 2JYTA 4I6LB 2FUG1 2E6XA 1WE6A 4JWSC 2KFKB 1YQ3B 2JWUA 2KQ7A 3ZXVA 4AP4C 1L7YA 1CMXB 4HKQA 4A90A 4XX5A 4OVUA 3AECB 1TKEA 4MELA 1NYRA 5HI1A 1CQVA 1YD8U 1I7HA 1WH3A 3NHEB 3FKYA 4MH8A 1MJDA 2WXNA 4RF0A 2L83A 4LK0M 4NZLB 1NEKB 1FM0D 3WANA 4MGKE 2MBHA 2KD0A 4IUMB 3NRZA 2DENB 5JH5C 4C7YA 1WR1A 2BWFA 5D94A 4MACA 1IP9A 2W3RA 4N59A 3T9LA 2IO3B 3NVZA 2QJLA 3VHTC 1AYFA 2M8SA 1NENB 3MJ5A 4YXDB 3ZIMA 1D4BA 3VR9B 3M62B 4LCDE 2WYQA 3MC0B 1E9MA 4IW0A 5LXHA 1OQRA 1P9DU 5G55A 1D6EC 1VDVA 2EELA 1SF0A 2K8CA 3DBLI 4BKTA 4M8NA 4BFRA 2KNBA 3EC8A 1KJTA 2CU3A 2LZ6A 2E3TA 3PTFC 2BPSA 3JVZX 2WXIA 1L4ZB 3VTUA 1ROEA 3EECA 4KX6B 1XO3A 4XDCA 3SR6A 1C1YB 3Q3FA 4A6QA 1LGRA 3BYYB 2AQ3B 2Y5PA 5E6PA 1YQBA 2GBRA 2WGSA 2SEBD 4A8XC 3B08A 2MLBA 2VH2A 1YN4A 4IKGA 4DXGA 5FR3A 3DVNU 2IGGA 1TY0A 3GOEA 4M01A 3DVGY 2WDTB 4EUTA 1QQRA 3KUDB 2WDVB 1ENFA 1MPEA 4Q2JA 2VZKD 4P1BC 1XEEA 2A5UA 4C7ZA 3R2IA 3OWEB 3BWUD 3DVGX 2NPTB 1WRIA 1JWBD 1E7UA 3C19A 3ETRA 3U30A 3VUYA 4RFBA 3I63C 3ZTCA 2YVCA 3NVYA 2OEDA 3IG3A 2DNFA 5KHOA 1D5MC 1UGJA 3LB8C 2GBNA 3V60A 3QK0A 1WGYA 5IN7A 1SSNA 3L4PA 4FJZA 4TKNA 4LNNA 3W5UB 3RNEC 1TZOA 2LD9A 4NNJB 2J0KA 1F77A 1JCKB 1FNUA 4CQNA 2WQYB 1YNTE 3DCGA 3X0WA 2O6VA 2XBBC 2KN4A 3QHTA 4S17A 2G9HD 2RDBC 2WNMA 1Y56A 1E6EB 2L76A 5DPSA 3EGRA 4C4VA 1J7CA 3ZO5B 2N7JA 3OLMD 1KRHA 3PT2B 2MEKA 5LXIB 3IAM1 1CK1A 3ABVB 3DQVA 2JZPA 4MJSB 1PGAA 1SGHA 2DYBA 4AOFA 1F2RI 4B95A 4ASWC 2D10A 1RRBA 1LM8B 2NBUA 1UELA 3I9V1 2YEPF 3BK2A 2JXXA 3SFEB 2WXOA 2NCNA 2LXAA 5T8IA 3AE6B 1ZDXA 3ZKJC 2LXCA 2KVRA 3IHPC 1ESFA 3P4PB 2GLSA 2MW5A 4LNOA 3RUIB 5KHQA 2BYVE 2KOXA 4A20A 1WI0A 1Q0WB 4M00A 1E8YA 1I4RA 3B9JA 1CJEA 2AL3A 2M56B 2ZEQA 1MFWA 3IAS1 4MEMA 4WWPA 3QJZA 2MQJA 4ZRKA 4WWOA 3VTVA 2M4NA 1L5PA 4K1RB 2ACZB 2L3ZA 5JHBA 2MHJA 3UINB 4FHKA 1V9JA 1GB1A 1WGKA 3QWZB 1TS3A 3CSTA 3RULA 5G5GA 1QZEA 1OQQA 2J0MA 4DHZE 2HJ8A 4W9KA 4W9EA 5DPRA 3VUWA 1ZP0B 2WXMA 2DBYA 4DHZB 1V1OA 3U7ZA 3IXSA 1I35A 1WGDA 1KF6B 4FADA 1L0XB 3GZNB 1EF5A 3QC8B 5MPOA 1GC7A 4DDID 3HIZA 4FXCA 2W55A 4NAWA 1E8ZA 4KZ0A 1YN5A 1B9RA 1P7FA 3CWIA 2ZVNA 3B1LX 1SXTA 1UWXA 1WRDB 3AE7B 5IKCM 3TEWA 2V3SA 1KM7A 4K3CA 3UIPB 3AEEB 2LGYA 3N30A 3RMKC 4R3DA 4ANWA 3HM3A 4ZRPA 4M0WA 1K52A 4IM3A 4OZBA 2IZVB 3DBHB 2MWSB 1B1ZA 2J4XA 1WGRA 2MP2A 2AYOB 1E7VA 1EWCA 1PYWD 1C77A 3W1YA 4HDOA 4LDTD 4AS1A 4OHJA 2VZKB 4EZJA 2CHWA 3URYA 2ZVOA 2BKFA 2D2QA 2QSDA 3ZJUA 4HPPA 3T3NA 4HCNB 2YEPB 2V3NA 1WJ6A 2K39A 3Q3NC 3MHZA 2Y3AA 3PZDA 4N6EB 4EKUA 4REZA 3NJTA 1BXTA 3PHXB 4OW0A 2JQRB 4LJOB 2BBCA 5DPTA 2Y5BB 4DK5A 3R3MA 2ZCCA 1OGWA 4DBGA 1MG4A 3ZTDA 3DDCB 3Q8BA 4MH0E 3P1MA 2N1VA 4HJGE 3L10B 1Q5WB 2LWPA 2VRRB 5HKHA 2XN9C 1V5TA 2Q5WD 1WGGA 3DOWA 2INCC 1U4AA 1TY2A 1TS5A 4I6PA 1IYFA 4AWJA 1HTQA 2ICIA 1I4PA 4GIVA 3V6EB 1RM6C 3PREA 4URKA 4FHJA 1YQ4B 2V9HA 1XLQA 4K3BA 1WZ0A 2G4SA 1RFAA 2I38A 3TJPA 2QILA 3FAHA 5BYSA 4YSXB 1SJED 2DLBA 1DOYA 2GB1A 1FFVA 2DZMA 4GDKB 2BGFA 2MX2A 5FKAC 3R7RA 3AULA 1V8CA 3A9KA 2JSVX 1TS4A 3OAWA 2O6VB 2PVOD 1FEHA 1XLNA 2D07B 4J6IA 1D5ZC 4MDKE 2X8XX 2KWUB 2WX1A 2J42A 1ZDVA 4KSKC 4C4VB 1WFYA 3W1SC 1DOXA 3OJ4B 1WSPA 1PGBA 2CS4A 3N9YC 2PMVA 1WM2A 2W3SA 3LDZE 3MC8A 2K3UA 3LYYA 2N4FA 1RWSA 3IT4B 4QAYA 4FJVB 3CMMB 3KH0A 3KWVA 1VZ6A 4G3XB 4CYEA 2NBWB 1SIFA 5TR5A 3RPFC 2KMAA 2WHIA 1E5WA 2X38A 3W5VB 3Q3JA 2BB6A 3R2TA 2PIAA 3AE9B 2KC2A 2L8JA 2PW9A 3X23A 2CKHB 2G45B 2REXA 4S0RA 4KSLC 3RZWC 2J53A 2BB5A 5BMGA 1RAXA 1SB3C 1GAQB 4YTPB 2N1WA 3TCAA 1JWAD 2LVPA 5GMVA 2FBWB 4US8A 1T6BX 2RSUA 3Q6BA 1FO4A 1XLPA 5E6JA 1Q10A 3ZXRA 4PYUA 2BW2A 2K0PA 2MRPA 5JZEB 2OHFA 4EZKA 2WDRB 2K8BA 4WQOB 3DHGC 4X57B 1YN3A 3KUZA 4GU2A 1V97A 3QCAA 2VH1A 1WZ3A 4HPLB 3VVWB 1FXTB 4NJ7A 3CF6E 2J52A 1SBBB 3I3TB 4IDIA 3ZUNA 2DYOA 3WALA 2INDC 2IBIB 2MBBB 1E8XA 3R8BA 4G11A 4KKIA 4AJYB 4NAWB 1LFDA 5CTRC 2AX5A 4ZDVA 4WJQA 2J7QB 4NJ6A 1IPGA 2G4DB 4DWFA 3ZW3A 2CJOA 1D3ZA 1L0YB 1GNUA 2ZZPB 1KOTA 2KTFA 3HK0A 3ML8A 4M0WB 1QF6A 2PVGC 2QIEB 1TT5B 5EDSA 2A4ZA 2N9EB 2AL6A 4EE2A 2Z59B 4WWNA 3VDZA 2AEHA 3AV8A 1FPYA 1YJ1A 2DYMA 4E74A 3V62A 1LO5D 3H9DA 2L32A 4PS8A 1WIAA 4A55A 4M8MA 5C1ZA 3APDA 5H92C 2ZW0A 3LXFA 5EE0A 3IT6B 3NVWA 1ET9A 3QIJA 3QARA 2C7NB 4BVUC 2LGDA 2K5PA 2BYTA 4C80A 1JW9D 2JYEA 1C78A 1K53A 4HRSA 1T0QC 1T0SC 1TKYA 1TJEA 2Z0DB 3DBRI 1V81A 3Q8EA 4W9JA 2H88B 4BBNF 3Q3MC 4JIOU 2N7EA 4LNKA 5TSSA 3NOBA 1D5XC 4ITKA 3RNGC 1V86A 3OG5A 1JALA 5JHAA 2C9WB 4IM2A 3W2DA 1GOZA 3B0AA 5CHWA 2OJWA 2D5GA 3I5JC 3WIMA 4HK2A 4FLHA 2V0GA 3Q2AC 5D3DA 4HCPB 1ZW7A 1BT0A 3WAMA 3BZDB 1K50A 5D7GA 3A9KB 5IOIA 1UGMA 2INPE 4ARIA 4YSZB 1V5OA 1WMHA 2IPKD 3LJ3A 4WIPA 1NYQA 3UIOB 2G3QB 3P2BA 4XGAB 1KTKA 3DBSA 1QLBB 1PQSA 4L1BA 1FNVA 1CZPA 1V49A 2FIFA 2NS5A 2FE8A 5IO9A 3M95A 1ZXHA 1K8RB 2C60A 3IBEA 4YTNB 1C3TA 4K7SA 1AN8A 2WLBA 4ZHOA 4KDLB 5D6JB 4G0NB 4IOIE 2LUEA 4K7WA 3TL5A 3QX1A 1VZ8A 2QCZA 1K51A 2RPVA 2GBJA 1QOFA 4IWPA 4F7ZA 3TBLD 1C4PA 2FCMA 2JXTA 2KQSA 2CU1A 3VR8B 1T5XD 5DCNA 4AUQC 1E90A 2N9XA 1TZ1A 3AU4A 1P98A 4ZHPA 1I4HA 5HG2A 1HZ6A 1N62A 3T3OA 2KJ6A 3PRZA 5J2RA 1JWUD 1L6VA 3AM9A 5I4DA 2LHEA 4BOZB 3N1YC 2FCSA 2H89B 4GSWA 4II3B 4K7UA 4MM3A 2JF5A 4JQWC 1TKGA 3K9PB 3GB1A 2D3AA 4HXDA 1JQ4A 1EF1A 1R4NB 3MFGA 2WXFA 5LLIA 3AEFB 5BYQA 1V1PA 2HE7A 1ZXIA 4HVBA 1I4GA 2LI5A 2O6VD 4GGQA 2JPHA 3QA8A 2M0AA 3PZ7A 4NPNA 4NY0A 1NVID 2DAJA 2RD0A 4YSYB 3VAWA 4RGNA 3ZDTA 3V61A 1UF0A 2NTSA 4RH6A 2M17A 2KMCA 1PFDA 3V05A 3PGEA 4ZYNA 3GE8C 5AZGA 2FUHB 3WA0A 2IGDA 2XEWA 4RM9A 2LVOA 3DVNV 3B2GA 3RNFC 2L7RA 3BINA 5C3JB 2HTME 4OZCA 3PRMB 2BS2B 3RYTA 1M4VA 2UWQA 3MHSD 2IO0B 4GDLA 2BS4B 1VRAB 1HZ5A 3PO0A 2KZRA 4RGMA 3AEDB 3ZQ4A 4ICVA 2B76B 2WXQA 5J17A 3NVVA 2HJ1A 2G1EA 4GLSC 3AE2B 3WCQA 1E0ZA 4WWMA 2BYFA 1RYJA 3GZNI 5HHDG 4TV3A 2BYEA 2PE6B 2BVCA 1WYGA 3VH3B 4A3OA 3IFWB 1WGHA 2L0FA 2Z0EB 3U52E 4OVVA 1UUPA 3GS2A 2QHOA 1MHXA 3AI5A 5DPWA 3U7DA 3M3JA 4XE0A 2ZNVB 2GI9A 4W9CA 2JRIB 4MT5A 1FCLA 2KJHB 5J18A 4I6NB 1N61A 3U4EG 3K9OB 1FXAA 3IVFA 2ZCBA 3DBHI 1BUIC 2BKRB 4B9KA 4N9F4 1TYGB 2MJDA 1Q1OA 1C4CA 3PSEB 4PK1A 2WU2B 3M63B 4DXFA 1R4MB 4YTMB 3HRDD 1V2YA 1SE3A 4US9A 1SE9A 3TIXA 3JSVA 4JWUC 5FR6A 2I2YA 3PLVA 1KH0A 2QMTA 4HWIB 4FBJB 3ZJVA 1HA5A 2OJRA 1YIWA 2L00B 3AE8B 2AWTA 2V4LA 1WMHB 4WJPA 1UNSA 3S2AA 3H7PA 2JX5A 1S3SG 3L54A 1WJUA 2MH7A 2BF8B 2I1JA 1FCCC 3PPAA 3SU8X 1E7PB 4FN2A 2ONQA 3Q8FA 1MI0A 4W9GA 4MSQB 1Z2MA 3JW0X 4NAMA 4H2AA 2ZPNA 5HFYA 2WXPA 2W9NA 2LGXA 1J8CA 2WWZA 4LTUA 3A4RA 4HJKA 4KKJA 4GMVA 1T3QA 2WXRA 1FNWA 2KX3A 2PPHA 1LQBA 1QILA 2KKCA 1WE7A 2KQ4X 4PT5A 1E8WA 2DAFA 3RCZA 2KX0A 2EKEC 3RFZB 2K8HA 1L6UA 2LRWA 4BZAA 1FRDA 2KMMA 1UWMA 4TQ1A 4LLGM 2N7DA 1DYQA 3H7SA 1HE8A 4NQLB 4B6WA 4IM0A 1QKZA 2AQ1B 3A1QA 4MM3B 3TMPB 2Y5CA 3AMZA 3ZRFA 4RGTA 1ZGUB 1HQRD 2MBEA 3UQBA 1BMLC 3L17A 4P1CC 1YJIA 2NTTA 1N63A 1XCQL 1IBXA 1V1PB 2UU7A 3ONSA 1JROA 1KFYB 3NS1A 5AUIA 1OQYA 5BO4B 3ZNZB 4KGRA 4XDDA 2GMIC 4TUUA 4HKZE 2ZW1A 1RFKA 4KVGB 1M94A 1VZ7A 2C7MB 4W9HA 3P4SB 1SE2A 1X1MA 4DXAB 3DHIC 1XF5L 1QOBA 1DOIA 1P0RA 3ZNGC 3N20C 3H6NA 3AN1A 1SJHD 3U8ZA 2K6QA 1V6EA 2PTLA 2M0XA 1EUVB 1FXIA 2DZJA 1WF9A 3B2FA 1TIFA 3MC9A 3ZJTA 4GDLB 1TS2A 3L08A 3MJWA 5CX3A 2R61A 5EE9A 2HD5B 1ACCA 3A4SC 3QAQA 4BBNC 3E9SA 1XLOA 2LFIA 4MJSA 1SIJA 5E6NA 3Q3OC 1A70A 4IWOA 4XYCA 2Z8LA 3NG0A 1VD2A 4ICUA 4O1NA 3Q8CA 3AE4B 4M02A 4JE3B 4C00A 5D3IB 5BMIA 2RPQA 3L0WB 1OEYJ 2M1MA 1C76A 2N9LA 3PZ8A 4RGOS 2OOBB 4NQKE 2KAJA 4DHJB 2RDGA 2LVQA 2KWDA 2ON8A 1MHHE 4F8CB 3JYUA 3ZNHB 1P1AA 3CIRB 2BTEA 2ZJDA 2FNJB 3ECIA 4YL8A 2MP2B 1KLGD 1J19A 3KYDD 5G2NA 2C5LC 2IGHA 4IWQA 2D3CA 2KLCA 1T0RC 3KYCD 3R66C 3ZGZA 4JL9A 3DHHC 4CHKA 2KACA 2C7HA 1LXDA 3D32A 3AEGB 3I57A 1NBFC 2EKIA 1FIQA 3JSVB 2MCNB 3Q8AA 2LUMA 3H1UA 3NY5A 3BIID 2IDYA 1N60A 2KDBA 1VCBA 3J9CA 3TUOA 4CO7A 4HROA 2MA9B 1XCTL 5AZFA 2IO2B 2IJ0A 3H7PB 2WXKA 5EE3A 2MBQA 1NDDA 2WXHA 2JVCA 3L16A 3KQ4A 4BAXA 1FFUA 4AQ7A 1TBEA 2ZNVC 3BVZA 3PLUA 2WXLA 3RD2A 4AJWA 3P63A 3DBRB 2CR5A 2PKOA 3VRAB 4J3OD 1GC6A 4II2B 2RR9A 3ALBA 1RLFA 1F9JA 1XD3B 2V4IB 3NZSA 1HEZE 5CHFA 1XXGA 2LHDA 2FCQA 3AB5A 2YLMA 3L13A 2EMTA 3NUHB 4DDGD 3DBLB 4WH4A 2M19A 4MGZE 1JWSD 1FRRA 1ZOYB 2KWVB 2V3PA 4WAFA 4WAAA 3O13A 3A9JA 3O65B 4PS7A 2AQ2B
chains in the Genus database with same CATH topology
2XN9C 2INNE 2Q5WD 3BVGA 3B2GA 3HVDA 5C3JB 2HTME 1TY2A 1TS5A 1KLUD 2JU6X 4OZCA 2ICIA 2BS2B 1I4PA 4ZRQA 1M4VA 3V3XA 1RM6C 1FMAD 1YQ4B 3TEZA 1JRPA 1XLQA 2BS4B 1VRAB 5EE1A 1OFFA 1QOAA 1ZUD2 1HZ5A 4B0MA 3PO0A 4RGMA 3AEDB 3AEBB 4L23A 4YT0B 3ZQ4A 2I38A 4L2YA 2QILA 3FAHA 5BYSA 4YSXB 1EWYC 1SJED 1PUTA 2N0SB 2DLBA 4HEA1 1DOYA 4B0EA 2B76B 2WXQA 2GB1A 3SEBA 1FFVA 3NVVA 2G1EA 4GDKB 4GLSC 3U2SC 3AE2B 1ET6A 1IGCA 1JWMD 4DQOC 1IBXB 5FKAC 3WCQA 2KDMA 3FC4A 1E0ZA 4OZAA 3HUIA 4WWMA 1V8CA 4P16A 2JSVX 1TS4A 1RYJA 4TQ0A 5HHDG 2BS3B 1FD6A 5LNK1 2PVOD 1FEHA 1XLNA 1WYGA 2JYTA 3AE5B 2FUG1 1D5ZC 3TSSA 2E6XA 2LEKA 4JWSC 2J42A 1YQ3B 1ZDVA 1J7BA 2JWUA 4JX1C 2MJEA 2L1AA 4HKQA 1GPXA 1DOXA 4A90A 2LMCA 5G5HA 1WSPA 3U52E 1PGBA 3N9YC 1EM7A 2PMVA 3AECB 1TKEA 2W3SA 1UUPA 2K3UA 1NYRA 3LYYA 3GS2A 5HI1A 1CQVA 1I7HA 1RWSA 3ZYYX 3IT4B 1MHXA 4MH8A 3KWVA 2WXNA 1VZ6A 4RF0A 2L83A 4LK0M 3RPFC 1STEA 4NZLB 1NEKB 1FM0D 4XE0A 2GI9A 4MT5A 1VJKA 1FCLA 1N5XA 5BYRA 2X38A 1N61A 3NRZA 3U4EG 3W5VB 4WQMA 2BB6A 1FXAA 4C7YA 3R2TA 2L52A 3VQIA 2PIAA 1BUIC 3AE9B 4MACA 2PW9A 1TYGB 2W3RA 4RF1A 1JMLA 2MJDA 4N59A 1C4CA 2WU2B 4DXFA 3NVZA 2J53A 2QJLA 3HRDD 4YTMB 2BB5A 3UI3A 1AYFA 5BMGA 1SE3A 1IUEA 1NENB 4US9A 1SB3C 1GAQB 4YTPB 1C9FA 3MJ5A 4YXDB 1QT9A 1PDXA 1JWAD 3GP7A 4JWUC 2FBWB 1D4BA 2I2YA 1SEBD 3VR9B 1KH0A 4US8A 1T6BX 2QMTA 3MC0B 4ZYSA 1FO4A 1XLPA 5E6JA 3ZJVA 1HA5A 1Q10A 1E9MA 1MVKA 3AE8B 2BW2A 1OQRA 2K0PA 1D6EC 2OHFA 4C56C 2EELA 1VDVA 1SF0A 2WDRB 1UNSA 2WDQB 2JX5A 2CU3A 1YN3A 2MH7A 2E3TA 2WXIA 1L4ZB 1ROEA 1R7SA 4KX6B 1XO3A 1V97A 4XDCA 1FCCC 1GB4A 1E7PB 3SR6A 3VRBB 2ONQA 3BVMA 4A6QA 3Q8FA 1MI0A 3BYYB 2AQ3B 2Y5PA 4NAMA 2SEBD 4H2AA 5HFYA 2J52A 1SBBB 2WXPA 4IDIA 4A8XC 2DYOA 5GXGB 5JXVA 1YN4A 2W82A 3AE1B 4IKGA 4DXGA 1DGJA 5BMHA 5FR3A 3R8BA 2IGGA 1TY0A 4KKIA 3FILA 4LTUA 4NAWB 4KKJA 1T3QA 2WXRA 2W54A 1FNWA 2AX5A 3P42A 1QQRA 1QILA 2WDVB 1ENFA 1MPEA 1F0ZA 4Q2JA 1I4XA 2VZKD 2KQ4X 4PT5A 1XEEA 1PGXA 4C7ZA 3R2IA 3OWEB 3HVZA 3BWUD 3BK1A 1L0VB 2CJOA 3RFZB 1L6UA 4OVZA 1WRIA 1JWBD 1L0YB 3ETRA 4RFBA 4ZOHC 1FRDA 2KMMA 1UWMA 1ZE3D 4TQ1A 4LLGM 1QF6A 1IGDA 3NVYA 2OEDA 1D5MC 1UGJA 2PVGC 2QIEB 3LB8C 1DYQA 1VLBA 1HXYD 5C2TB 3KLSX 4NJCA 1QKZA 2AQ1B 4MM3B 4EE2A 2N9KA 4ARCA 1SSNA 2Y5CA 3AMZA 3AV8A 3L4PA 4RGTA 2DYMA 1HQRD 3W5UB 1BMLC 1J7AA 1QOGA 1YJIA 2NTTA 1N63A 1TZOA 2DWQA 1LO5D 2L32A 1XCQL 1IBXA 4A55A 1F77A 1V1PB 1JCKB 1FNUA 4CQNA 2WQYB 5H8YE 1JROA 1YNTE 1KFYB 5H92C 2ZW0A 3LXFA 3NS1A 5EE0A 5AUIA 3IT6B 3NVWA 1ET9A 2K9XA 4USAA 2SAKA 1WWTA 2KN4A 4KGRA 2G9HD 2WNMA 1Y56A 1E6EB 5AUKA 1L4DB 4XDDA 4JPSA 3EGRA 4HKZE 2ZW1A 1RFKA 2XNAC 1J7CA 3P4QB 2K5PA 2BYTA 4C80A 2N7JA 1JW9D 1VZ7A 1KRHA 2JYEA 1C78A 2MEKA 1K53A 3IAM1 4HRSA 1CK1A 3ABVB 1TKYA 2JZPA 3P4SB 4KGSA 1SE2A 1TJEA 1PGAA 4YWGG 3TEXA 1F2RI 1XF5L 1QOBA 1DOIA 3Q8EA 2LGIA 2H88B 2WU5B 4XWTA 3I9V1 2YEPF 3BK2A 3AN1A 3SFEB 2WXOA 3KWLA 1SJHD 5TSSA 5T8IA 2PTLA 3AE6B 1ZDXA 1FXIA 3B2FA 1D5XC 1ESFA 3P4PB 3ZJTA 4ITKA 4GDLB 1TS2A 1JALA 3SFDB 1NI3A 4P6VF 3W2DA 4TMAB 1GOZA 2R61A 5EE9A 3EUB2 2PLPA 2D5GA 1ZPSA 2LJIA 1ACCA 1I4RA 3B9JA 1CJEA 2M56B 3IAS1 2V0GA 3E9SA 5D3DA 2WP9B 1XLOA 2LFIA 1SIJA 3TEYA 1A70A 3BZDB 2Z8LA 1L5PA 3E56A 4O1NA 1K50A 1WXQA 1P7EA 1YJJA 3Q8CA 5D7GA 2ACZB 3AE4B 5FK9C 4JE3B 4RNAA 5D3IB 5BMIA 2QEJC 2INPE 2NMQA 4ARIA 1C76A 2N9LA 4YSZB 2IPKD 3PZ8A 4RGOS 4WIPA 1NYQA 4RCOA 1GB1A 1KTKA 2KAJA 1QLBB 1WGKA 2RDGA 2KWDA 2ON8A 1MHHE 1FNVA 1TS3A 1CZPA 4L1BA 4WURA 2TSSA 1EU4A 2FE8A 5G5GA 4A9AA 1ZXHA 3AH7A 4YTNB 1OQQA 1E10A 1AN8A 2WLBA 4ZHOA 3CIRB 4IOIE 1ZP0B 2BTEA 2WXMA 3AEAB 1C4AA 2DBYA 1VZ8A 1V1OA 1K51A 3U7ZA 1KLGD 1C79A 3IXSA 2RPVA 1KF6B 1L0XB 1QOFA 2IGHA 5MPOA 1C4PA 2JXTA 2RMMA 4FXCA 3VR8B 1T5XD 2W55A 3W9CB 3Q69A 3EA6A 3ZGZA 1YN5A 1B9RA 1P7FA 3CWIA 2KACA 3AE3B 3W1SA 3AEGB 1SXTA 1UWXA 3I57A 3AE7B 2EKIA 1FIQA 3TEWA 4ZHPA 1I4HA 3AEEB 4KGTA 5HG2A 2MJ3A 1HZ6A 3Q8AA 4R3DA 4UDUC 2LUMA 1N62A 1EU3A 4N58A 3T3OA 3BIID 2IDYA 2K22A 3P4RB 1N60A 3MP9A 4ZRPA 3J9CA 3TUOA 4M0WA 1K52A 1JWUD 4OZBA 1L6VA 1B1ZA 2J4XA 3AM9A 4HROA 2CJNA 2LHEA 5I4DA 1EWCA 1PYWD 1XCTL 1YMHE 4TSSA 1C77A 2IJ0A 2H89B 3C8YA 2WXKA 2WXGA 3DWMA 4OHJA 4AS1A 2VZKB 5EE3A 3NZ3A 3URYA 1TKGA 2WXHA 1I4QA 2RDHA 3GB1A 3KQ4A 4XWWA 1JQ4A 3MFGA 1FFUA 2QSDA 3ZJUA 2WXJA 2WXFA 4AQ7A 3T3NA 3BVZA 1VR9A 2WXLA 3BYTB 3AEFB 3P63A 1AWDA 1AW7A 5BYQA 1V1PA 2V3NA 2YEPB 1ZXIA 1I4GA 2GRIA 2PKOA 3VRAB 3DWGC 3MHZA 2Y3AA 4N6EB 4J3OD 2V4IB 4REZA 1HEZE 1BXTA 1XXGA 2LHDA 4OW0A 2JQRB 3AB5A 4D2KA 1SE4A 2BBCA 2M0AA 3PZ7A 1NVID 3NUHB 3FILB 4WH4A 2M19A 3Q8BA 3H8HA 4YSYB 4RGNA 1JWSD 1FRRA 1ZOYB 2V3PA 4WAFA 1N5WA 2HDEA 2NTSA 2BT6A 2WS3B 4RH6A 3O13A 3P1MA 1PFDA 4HJGE 3V05A 1F2RC 2AQ2B 2IGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DWQ A;  4JWU C;  2FBW B;  3CIR B;  4YTM B;  1ZP0 B;  3VR9 B;  2Q5W D;  4US8 A;  3B2G A;  3AEA B;  2DBY A;  2WQY B;  1FO4 A;  5H8Y E;  1JRO A;  1XLP A;  2HTM E;  5C3J B;  1E9M A;  1KFY B;  5H92 C;  3NS1 A;  3LXF A;  5EE0 A;  5AUI A;  3NVW A;  3AE8 B;  2BS2 B;  1KF6 B;  2K9X A;  4USA A;  1QOF A;  1OQR A;  1WWT A;  5MPO A;  1RM6 C;  1FMA D;  2OHF A;  1YQ4 B;  1E6E B;  1SF0 A;  1VDV A;  2WDR B;  1JRP A;  1XLQ A;  4FXC A;  2BS4 B;  5AUK A;  5EE1 A;  3VR8 B;  1OFF A;  1QOA A;  1ZUD 2;  2W55 A;  3W9C B;  1RFK A;  2WDQ B;  1J7C A;  3PO0 A;  2JX5 A;  3AED B;  2K5P A;  3AEB B;  3P4Q B;  4YT0 B;  1B9R A;  4C80 A;  2CU3 A;  1JW9 D;  3FAH A;  3CWI A;  1KRH A;  2MH7 A;  4YSX B;  1EWY C;  1PUT A;  2N0S B;  2E3T A;  4HRS A;  1DOY A;  3AE3 B;  3ABV B;  1TKY A;  3AEG B;  1ROE A;  1R7S A;  2B76 B;  1TJE A;  2WLB A;  3P4S B;  4KX6 B;  1XO3 A;  1V97 A;  1FFV A;  2EKI A;  1FIQ A;  3AE7 B;  3NVV A;  2G1E A;  4ZHP A;  1E7P B;  3AE2 B;  1QOB A;  3SR6 A;  3VRB B;  1DOI A;  3AEE B;  2MJ3 A;  3WCQ A;  2H88 B;  3FC4 A;  2WU5 B;  1E0Z A;  3HUI A;  1N62 A;  4WWM A;  4N58 A;  1V8C A;  3BII D;  3AN1 A;  2K22 A;  3P4R B;  3SFE B;  1RYJ A;  3KWL A;  1N60 A;  4IDI A;  2BS3 B;  3AE6 B;  5GXG B;  2PVO D;  1FXI A;  1XLN A;  3AE1 B;  3B2F A;  1WYG A;  1DGJ A;  1L6V A;  3AE5 B;  3AM9 A;  3P4P B;  4ITK A;  4HRO A;  2CJN A;  2LEK A;  4LTU A;  1JAL A;  4JWS C;  3SFD B;  1YQ3 B;  1J7B A;  1NI3 A;  2H89 B;  4P6V F;  1T3Q A;  4JX1 C;  2MJE A;  2W54 A;  2AX5 A;  3DWM A;  1GPX A;  5EE9 A;  1DOX A;  3EUB 2;  5G5H A;  2WDV B;  5EE3 A;  1F0Z A;  1TKG A;  3B9J A;  3AEC B;  1CJE A;  1TKE A;  2M56 B;  2W3S A;  1NYR A;  4C7Z A;  1I7H A;  1RWS A;  3ZYY X;  1JQ4 A;  3HVZ A;  1FFU A;  2WP9 B;  1XLO A;  1L0V B;  2CJO A;  1SIJ A;  3AEF B;  3P63 A;  1AWD A;  1A70 A;  1L6U A;  2L83 A;  3RPF C;  1NEK B;  1L5P A;  1FM0 D;  1WRI A;  1JWB D;  1ZXI A;  1WXQ A;  3ETR A;  1YJJ A;  1VJK A;  1N5X A;  2ACZ B;  2PKO A;  3AE4 B;  1N61 A;  3DWG C;  3NRZ A;  4N6E B;  4ZOH C;  1FRD A;  4WQM A;  3VRA B;  3W5V B;  1FXA A;  2KMM A;  4C7Y A;  1UWM A;  2L52 A;  1QF6 A;  2PIA A;  3AE9 B;  3NVY A;  2JQR B;  3AB5 A;  4YSZ B;  1NVI D;  2PVG C;  2QIE B;  3LB8 C;  1NYQ A;  1VLB A;  2W3R A;  1TYG B;  2KAJ A;  2MJD A;  5C2T B;  2M19 A;  4N59 A;  1QLB B;  1WGK A;  4YSY B;  1YJI A;  1FRR A;  1CZP A;  1ZOY B;  2WU2 B;  3NVZ A;  1N5W A;  2Y5C A;  2QJL A;  3AMZ A;  2BT6 A;  2WS3 B;  3HRD D;  3AV8 A;  5G5G A;  3L4P A;  4A9A A;  1AYF A;  3AH7 A;  4US9 A;  1IUE A;  1NEN B;  1SB3 C;  1GAQ B;  1OQQ A;  3P1M A;  1PFD A;  4YTN B;  4YTP B;  3W5U B;  1J7A A;  1E10 A;  1QOG A;  4YXD B;  1QT9 A;  1PDX A;  1JWA D;  1N63 A;  4ZHO A; 
#chains in the Genus database with same CATH topology
 4PYZ A;  1OEY A;  2NBV B;  3APC A;  2KVZ A;  3BVG A;  1H4R A;  2GBK A;  4W9I A;  2JU6 X;  1GG3 A;  1FMA D;  3TEZ A;  1JRP A;  2KFJ A;  1ZUD 2;  3ML9 A;  2KYW A;  3AEB B;  4L23 A;  3A1Q B;  3GE3 C;  4YT0 B;  1EWY C;  3UF8 A;  2N0S B;  1UH6 A;  4WJN A;  3SEB A;  4GXB A;  2KAN A;  1ET6 A;  1IGC A;  4DQO C;  1IBX B;  1YX5 B;  1YX6 B;  1JRU A;  2R2Q A;  3HUI A;  5AZH A;  2IY1 B;  1GJZ A;  3AE5 B;  3TSS A;  2LEK A;  4E71 A;  1J7B A;  2PJH A;  4JX1 C;  2MJE A;  2L1A A;  4LJP B;  2KDE B;  1GPX A;  2LMC A;  5G5H A;  3RZF A;  3R7Q A;  1AAR A;  1EM7 A;  2KXJ A;  2BWE S;  2MBO A;  4FUL A;  4HDQ A;  3ZYY X;  2KHW B;  2JUO A;  1STE A;  2V1Y A;  4JLC A;  4GDK A;  1VJK A;  1N5X A;  2KDF B;  5BYR A;  3RNB C;  4WQM A;  2L52 A;  3VQI A;  3RNA C;  3NS8 A;  3N32 A;  2IY0 B;  4RF1 A;  1JML A;  3N3K B;  3ZDM C;  3UI3 A;  4XC2 A;  1IUE A;  1R4N I;  1C9F A;  3T8M A;  3SHQ A;  1QT9 A;  1PDX A;  4K81 A;  2HTH A;  2K1F A;  1WJ4 A;  3GP7 A;  3RNC C;  1F1H A;  3EFU A;  3PV1 A;  1SEB D;  5L83 A;  3C0R B;  2QC8 A;  4ZYS A;  4GOC A;  1MVK A;  2WX0 A;  1TTN A;  1WXA A;  4C56 C;  2GOW A;  4KIK A;  5CHV C;  4PS3 A;  3RI7 C;  2WDQ B;  2QDF A;  4EEW A;  1N6Z A;  5AEK B;  1R7S A;  1UBI A;  4LNF A;  4EOY A;  1GB4 A;  3BY4 B;  4BKS A;  2MSE D;  3VRB B;  3BVM A;  4E3C A;  4LNI A;  2D11 A;  2KTR A;  2XK5 A;  2N9P C;  5GXG B;  2KO3 A;  3KUC B;  5JXV A;  3AE1 B;  2W82 A;  5BMH A;  1DGJ A;  2I1K A;  3FIL A;  2W54 A;  3P42 A;  1WJN A;  1F0Z A;  1I4X A;  1PGX A;  3HVZ A;  3BK1 A;  1L0V B;  1P3Q U;  3OJ3 A;  3SDL C;  3KW5 B;  4BKS D;  4OVZ A;  4ZOH C;  2EMS A;  2JZ3 B;  1ZE3 D;  1IGD A;  2PE9 A;  1ISN A;  2KN5 A;  1VLB A;  2O2V A;  1HXY D;  5C2T B;  3KLS X;  4NJC A;  5L95 C;  2N9K A;  4G50 A;  4ARC A;  2LRU A;  4KZC A;  2DZI A;  2R2O A;  1WX9 A;  1J7A A;  4EFO A;  2DX5 B;  1QOG A;  5IA7 A;  2BQQ A;  2DWQ A;  1WXS A;  2KWC A;  5H8Y E;  5IP4 D;  2K9X A;  4USA A;  2SAK A;  1WWT A;  2KJR A;  3A33 B;  3RT3 B;  1J0G A;  5D2M B;  5AUK A;  1L4D B;  4DHJ D;  4JPS A;  2KFK A;  2XNA C;  3P4Q B;  1R4M I;  3VUX A;  3EHV A;  1YOV B;  4IC7 B;  3A9J B;  4KGS A;  4YWG G;  3TEX A;  4BKG A;  2NVU I;  1A5R A;  4XZ4 A;  3NZU A;  3N1Z C;  4GB9 A;  1WM3 A;  1WXV A;  3N1X C;  2LGI A;  4KDI C;  2WU5 B;  4XWT A;  3MTN B;  5IAA C;  3KWL A;  1GUA B;  3ZRC A;  1Z5S B;  4JGH B;  3SFD B;  1NI2 A;  4A3P A;  1NI3 A;  3WAP A;  1WXM A;  4P6V F;  3VTW A;  4TMA B;  3EUB 2;  1I42 A;  2PLP A;  1ZPS A;  2L0T A;  2LJI A;  2KT7 A;  3HM6 X;  3PVL A;  4RM8 A;  1F52 A;  2WP9 B;  1XQQ A;  3PRP B;  2KK8 A;  3TEY A;  1UD7 A;  3WAO A;  3E56 A;  4WJO A;  2D3B A;  1WXQ A;  2RGF A;  1P7E A;  1YJJ A;  5FK9 C;  1XT9 B;  1V80 A;  2JWZ A;  4W9D A;  2LAS A;  4RNA A;  2QEJ C;  2NMQ A;  3PHW B;  4RCO A;  1T0Y A;  3KVF B;  3AXC A;  2DHZ A;  4WUR A;  2TSS A;  4IG7 B;  1EU4 A;  4A9A A;  3AH7 A;  2ZPY A;  1E10 A;  1H8C A;  2LJ5 A;  1UZX B;  4W9F A;  3AEA B;  1C4A A;  2NR2 A;  1C79 A;  3EFC A;  4GN1 A;  1KLV A;  1Y8R C;  2JRH A;  3ZVV A;  4ACF A;  1UBQ A;  3PS6 A;  2LGS A;  2RMM A;  3W9C B;  1MG8 A;  3Q69 A;  4FA6 A;  3EA6 A;  3AE3 B;  3W1S A;  2FCN A;  1WYW B;  2UYZ B;  4BOS C;  2NPT A;  2CHZ A;  2KLG A;  4KGT A;  1HTO A;  4MSM B;  2MJ3 A;  1WX7 A;  3VFK A;  3VH4 B;  4UDU C;  1EU3 A;  4N58 A;  3P4R B;  2K22 A;  3MP9 A;  2D3G A;  5C23 A;  2FID A;  4HLE A;  2CJN A;  4KIK B;  2JY6 A;  1YMH E;  4TSS A;  5E6O A;  1G6J A;  3C8Y A;  4W9L A;  3AU5 A;  2WXG A;  3DWM A;  4EZL A;  3UGB B;  4HPM B;  2JT4 B;  3NZ3 A;  3RN9 C;  2JZZ A;  1I4Q A;  2RDH A;  4XWW A;  4ZRJ A;  4ANU A;  2WXJ A;  3BYT B;  1VR9 A;  3HHM A;  1AWD A;  1AW7 A;  2B3A A;  2KTR B;  3SD5 A;  2GRI A;  2XK5 B;  3DWG C;  2KDI A;  2K25 A;  3ZNI D;  4ZRI A;  4D2K A;  1SE4 A;  1ZKH A;  4ANV A;  3FIL B;  2IYD B;  3H8H A;  3QQ8 B;  2J0J A;  1N5W A;  2HDE A;  2BT6 A;  2WS3 B;  3Q14 C;  4MGY E;  4FJY A;  4P7I A;  1F2R C;  1TGZ B;  4F1S A;  3ZLZ A;  2KC1 A;  2INN E;  1OTR B;  2CHX A;  3ENE A;  3VXW A;  3HVD A;  2GBM A;  1KLU D;  3APF A;  4ZRQ A;  3UQA A;  3V3X A;  2K6D B;  2PEA A;  2IO1 B;  5EE1 A;  1OFF A;  2O2V B;  1QOA A;  2L05 A;  4B0M A;  2FAZ A;  4KV2 A;  1WX8 A;  4L2Y A;  3CSF A;  4LDT B;  1PUT A;  4HEA 1;  4B0E A;  4ANX A;  1S1Q B;  2DZK A;  3U2S C;  3V6C B;  1JWM D;  1EO6 A;  1WR6 E;  1L2N A;  2KDM A;  3FC4 A;  4OZA A;  2ASQ A;  4RMA A;  4MGI E;  1WY8 A;  4P16 A;  4TQ0 A;  2BS3 B;  1FD6 A;  5LNK 1;  3DPD A;  2JYT A;  4I6L B;  2FUG 1;  2E6X A;  1WE6 A;  4JWS C;  2KFK B;  1YQ3 B;  2JWU A;  2KQ7 A;  3ZXV A;  4AP4 C;  1L7Y A;  1CMX B;  4HKQ A;  4A90 A;  4XX5 A;  4OVU A;  3AEC B;  1TKE A;  4MEL A;  1NYR A;  5HI1 A;  1CQV A;  1YD8 U;  1I7H A;  1WH3 A;  3NHE B;  3FKY A;  4MH8 A;  1MJD A;  2WXN A;  4RF0 A;  2L83 A;  4LK0 M;  4NZL B;  1NEK B;  1FM0 D;  3WAN A;  4MGK E;  2MBH A;  2KD0 A;  4IUM B;  3NRZ A;  2DEN B;  5JH5 C;  4C7Y A;  1WR1 A;  2BWF A;  5D94 A;  4MAC A;  1IP9 A;  2W3R A;  4N59 A;  3T9L A;  2IO3 B;  3NVZ A;  2QJL A;  3VHT C;  1AYF A;  2M8S A;  1NEN B;  3MJ5 A;  4YXD B;  3ZIM A;  1D4B A;  3VR9 B;  3M62 B;  4LCD E;  2WYQ A;  3MC0 B;  1E9M A;  4IW0 A;  5LXH A;  1OQR A;  1P9D U;  5G55 A;  1D6E C;  1VDV A;  2EEL A;  1SF0 A;  2K8C A;  3DBL I;  4BKT A;  4M8N A;  4BFR A;  2KNB A;  3EC8 A;  1KJT A;  2CU3 A;  2LZ6 A;  2E3T A;  3PTF C;  2BPS A;  3JVZ X;  2WXI A;  1L4Z B;  3VTU A;  1ROE A;  3EEC A;  4KX6 B;  1XO3 A;  4XDC A;  3SR6 A;  1C1Y B;  3Q3F A;  4A6Q A;  1LGR A;  3BYY B;  2AQ3 B;  2Y5P A;  5E6P A;  1YQB A;  2GBR A;  2WGS A;  2SEB D;  4A8X C;  3B08 A;  2MLB A;  2VH2 A;  1YN4 A;  4IKG A;  4DXG A;  5FR3 A;  3DVN U;  2IGG A;  1TY0 A;  3GOE A;  4M01 A;  3DVG Y;  2WDT B;  4EUT A;  1QQR A;  3KUD B;  2WDV B;  1ENF A;  1MPE A;  4Q2J A;  2VZK D;  4P1B C;  1XEE A;  2A5U A;  4C7Z A;  3R2I A;  3OWE B;  3BWU D;  3DVG X;  2NPT B;  1WRI A;  1JWB D;  1E7U A;  3C19 A;  3ETR A;  3U30 A;  3VUY A;  4RFB A;  3I63 C;  3ZTC A;  2YVC A;  3NVY A;  2OED A;  3IG3 A;  2DNF A;  5KHO A;  1D5M C;  1UGJ A;  3LB8 C;  2GBN A;  3V60 A;  3QK0 A;  1WGY A;  5IN7 A;  1SSN A;  3L4P A;  4FJZ A;  4TKN A;  4LNN A;  3W5U B;  3RNE C;  1TZO A;  2LD9 A;  4NNJ B;  2J0K A;  1F77 A;  1JCK B;  1FNU A;  4CQN A;  2WQY B;  1YNT E;  3DCG A;  3X0W A;  2O6V A;  2XBB C;  2KN4 A;  3QHT A;  4S17 A;  2G9H D;  2RDB C;  2WNM A;  1Y56 A;  1E6E B;  2L76 A;  5DPS A;  3EGR A;  4C4V A;  1J7C A;  3ZO5 B;  2N7J A;  3OLM D;  1KRH A;  3PT2 B;  2MEK A;  5LXI B;  3IAM 1;  1CK1 A;  3ABV B;  3DQV A;  2JZP A;  4MJS B;  1PGA A;  1SGH A;  2DYB A;  4AOF A;  1F2R I;  4B95 A;  4ASW C;  2D10 A;  1RRB A;  1LM8 B;  2NBU A;  1UEL A;  3I9V 1;  2YEP F;  3BK2 A;  2JXX A;  3SFE B;  2WXO A;  2NCN A;  2LXA A;  5T8I A;  3AE6 B;  1ZDX A;  3ZKJ C;  2LXC A;  2KVR A;  3IHP C;  1ESF A;  3P4P B;  2GLS A;  2MW5 A;  4LNO A;  3RUI B;  5KHQ A;  2BYV E;  2KOX A;  4A20 A;  1WI0 A;  1Q0W B;  4M00 A;  1E8Y A;  1I4R A;  3B9J A;  1CJE A;  2AL3 A;  2M56 B;  2ZEQ A;  1MFW A;  3IAS 1;  4MEM A;  4WWP A;  3QJZ A;  2MQJ A;  4ZRK A;  4WWO A;  3VTV A;  2M4N A;  1L5P A;  4K1R B;  2ACZ B;  2L3Z A;  5JHB A;  2MHJ A;  3UIN B;  4FHK A;  1V9J A;  1GB1 A;  1WGK A;  3QWZ B;  1TS3 A;  3CST A;  3RUL A;  5G5G A;  1QZE A;  1OQQ A;  2J0M A;  4DHZ E;  2HJ8 A;  4W9K A;  4W9E A;  5DPR A;  3VUW A;  1ZP0 B;  2WXM A;  2DBY A;  4DHZ B;  1V1O A;  3U7Z A;  3IXS A;  1I35 A;  1WGD A;  1KF6 B;  4FAD A;  1L0X B;  3GZN B;  1EF5 A;  3QC8 B;  5MPO A;  1GC7 A;  4DDI D;  3HIZ A;  4FXC A;  2W55 A;  4NAW A;  1E8Z A;  4KZ0 A;  1YN5 A;  1B9R A;  1P7F A;  3CWI A;  2ZVN A;  3B1L X;  1SXT A;  1UWX A;  1WRD B;  3AE7 B;  5IKC M;  3TEW A;  2V3S A;  1KM7 A;  4K3C A;  3UIP B;  3AEE B;  2LGY A;  3N30 A;  3RMK C;  4R3D A;  4ANW A;  3HM3 A;  4ZRP A;  4M0W A;  1K52 A;  4IM3 A;  4OZB A;  2IZV B;  3DBH B;  2MWS B;  1B1Z A;  2J4X A;  1WGR A;  2MP2 A;  2AYO B;  1E7V A;  1EWC A;  1PYW D;  1C77 A;  3W1Y A;  4HDO A;  4LDT D;  4AS1 A;  4OHJ A;  2VZK B;  4EZJ A;  2CHW A;  3URY A;  2ZVO A;  2BKF A;  2D2Q A;  2QSD A;  3ZJU A;  4HPP A;  3T3N A;  4HCN B;  2YEP B;  2V3N A;  1WJ6 A;  2K39 A;  3Q3N C;  3MHZ A;  2Y3A A;  3PZD A;  4N6E B;  4EKU A;  4REZ A;  3NJT A;  1BXT A;  3PHX B;  4OW0 A;  2JQR B;  4LJO B;  2BBC A;  5DPT A;  2Y5B B;  4DK5 A;  3R3M A;  2ZCC A;  1OGW A;  4DBG A;  1MG4 A;  3ZTD A;  3DDC B;  3Q8B A;  4MH0 E;  3P1M A;  2N1V A;  4HJG E;  3L10 B;  1Q5W B;  2LWP A;  2VRR B;  5HKH A;  2XN9 C;  1V5T A;  2Q5W D;  1WGG A;  3DOW A;  2INC C;  1U4A A;  1TY2 A;  1TS5 A;  4I6P A;  1IYF A;  4AWJ A;  1HTQ A;  2ICI A;  1I4P A;  4GIV A;  3V6E B;  1RM6 C;  3PRE A;  4URK A;  4FHJ A;  1YQ4 B;  2V9H A;  1XLQ A;  4K3B A;  1WZ0 A;  2G4S A;  1RFA A;  2I38 A;  3TJP A;  2QIL A;  3FAH A;  5BYS A;  4YSX B;  1SJE D;  2DLB A;  1DOY A;  2GB1 A;  1FFV A;  2DZM A;  4GDK B;  2BGF A;  2MX2 A;  5FKA C;  3R7R A;  3AUL A;  1V8C A;  3A9K A;  2JSV X;  1TS4 A;  3OAW A;  2O6V B;  2PVO D;  1FEH A;  1XLN A;  2D07 B;  4J6I A;  1D5Z C;  4MDK E;  2X8X X;  2KWU B;  2WX1 A;  2J42 A;  1ZDV A;  4KSK C;  4C4V B;  1WFY A;  3W1S C;  1DOX A;  3OJ4 B;  1WSP A;  1PGB A;  2CS4 A;  3N9Y C;  2PMV A;  1WM2 A;  2W3S A;  3LDZ E;  3MC8 A;  2K3U A;  3LYY A;  2N4F A;  1RWS A;  3IT4 B;  4QAY A;  4FJV B;  3CMM B;  3KH0 A;  3KWV A;  1VZ6 A;  4G3X B;  4CYE A;  2NBW B;  1SIF A;  5TR5 A;  3RPF C;  2KMA A;  2WHI A;  1E5W A;  2X38 A;  3W5V B;  3Q3J A;  2BB6 A;  3R2T A;  2PIA A;  3AE9 B;  2KC2 A;  2L8J A;  2PW9 A;  3X23 A;  2CKH B;  2G45 B;  2REX A;  4S0R A;  4KSL C;  3RZW C;  2J53 A;  2BB5 A;  5BMG A;  1RAX A;  1SB3 C;  1GAQ B;  4YTP B;  2N1W A;  3TCA A;  1JWA D;  2LVP A;  5GMV A;  2FBW B;  4US8 A;  1T6B X;  2RSU A;  3Q6B A;  1FO4 A;  1XLP A;  5E6J A;  1Q10 A;  3ZXR A;  4PYU A;  2BW2 A;  2K0P A;  2MRP A;  5JZE B;  2OHF A;  4EZK A;  2WDR B;  2K8B A;  4WQO B;  3DHG C;  4X57 B;  1YN3 A;  3KUZ A;  4GU2 A;  1V97 A;  3QCA A;  2VH1 A;  1WZ3 A;  4HPL B;  3VVW B;  1FXT B;  4NJ7 A;  3CF6 E;  2J52 A;  1SBB B;  3I3T B;  4IDI A;  3ZUN A;  2DYO A;  3WAL A;  2IND C;  2IBI B;  2MBB B;  1E8X A;  3R8B A;  4G11 A;  4KKI A;  4AJY B;  4NAW B;  1LFD A;  5CTR C;  2AX5 A;  4ZDV A;  4WJQ A;  2J7Q B;  4NJ6 A;  1IPG A;  2G4D B;  4DWF A;  3ZW3 A;  2CJO A;  1D3Z A;  1L0Y B;  1GNU A;  2ZZP B;  1KOT A;  2KTF A;  3HK0 A;  3ML8 A;  4M0W B;  1QF6 A;  2PVG C;  2QIE B;  1TT5 B;  5EDS A;  2A4Z A;  2N9E B;  2AL6 A;  4EE2 A;  2Z59 B;  4WWN A;  3VDZ A;  2AEH A;  3AV8 A;  1FPY A;  1YJ1 A;  2DYM A;  4E74 A;  3V62 A;  1LO5 D;  3H9D A;  2L32 A;  4PS8 A;  1WIA A;  4A55 A;  4M8M A;  5C1Z A;  3APD A;  5H92 C;  2ZW0 A;  3LXF A;  5EE0 A;  3IT6 B;  3NVW A;  1ET9 A;  3QIJ A;  3QAR A;  2C7N B;  4BVU C;  2LGD A;  2K5P A;  2BYT A;  4C80 A;  1JW9 D;  2JYE A;  1C78 A;  1K53 A;  4HRS A;  1T0Q C;  1T0S C;  1TKY A;  1TJE A;  2Z0D B;  3DBR I;  1V81 A;  3Q8E A;  4W9J A;  2H88 B;  4BBN F;  3Q3M C;  4JIO U;  2N7E A;  4LNK A;  5TSS A;  3NOB A;  1D5X C;  4ITK A;  3RNG C;  1V86 A;  3OG5 A;  1JAL A;  5JHA A;  2C9W B;  4IM2 A;  3W2D A;  1GOZ A;  3B0A A;  5CHW A;  2OJW A;  2D5G A;  3I5J C;  3WIM A;  4HK2 A;  4FLH A;  2V0G A;  3Q2A C;  5D3D A;  4HCP B;  1ZW7 A;  1BT0 A;  3WAM A;  3BZD B;  1K50 A;  5D7G A;  3A9K B;  5IOI A;  1UGM A;  2INP E;  4ARI A;  4YSZ B;  1V5O A;  1WMH A;  2IPK D;  3LJ3 A;  4WIP A;  1NYQ A;  3UIO B;  2G3Q B;  3P2B A;  4XGA B;  1KTK A;  3DBS A;  1QLB B;  1PQS A;  4L1B A;  1FNV A;  1CZP A;  1V49 A;  2FIF A;  2NS5 A;  2FE8 A;  5IO9 A;  3M95 A;  1ZXH A;  1K8R B;  2C60 A;  3IBE A;  4YTN B;  1C3T A;  4K7S A;  1AN8 A;  2WLB A;  4ZHO A;  4KDL B;  5D6J B;  4G0N B;  4IOI E;  2LUE A;  4K7W A;  3TL5 A;  3QX1 A;  1VZ8 A;  2QCZ A;  1K51 A;  2RPV A;  2GBJ A;  1QOF A;  4IWP A;  4F7Z A;  3TBL D;  1C4P A;  2FCM A;  2JXT A;  2KQS A;  2CU1 A;  3VR8 B;  1T5X D;  5DCN A;  4AUQ C;  1E90 A;  2N9X A;  1TZ1 A;  3AU4 A;  1P98 A;  4ZHP A;  1I4H A;  5HG2 A;  1HZ6 A;  1N62 A;  3T3O A;  2KJ6 A;  3PRZ A;  5J2R A;  1JWU D;  1L6V A;  3AM9 A;  5I4D A;  2LHE A;  4BOZ B;  3N1Y C;  2FCS A;  2H89 B;  4GSW A;  4II3 B;  4K7U A;  4MM3 A;  2JF5 A;  4JQW C;  1TKG A;  3K9P B;  3GB1 A;  2D3A A;  4HXD A;  1JQ4 A;  1EF1 A;  1R4N B;  3MFG A;  2WXF A;  5LLI A;  3AEF B;  5BYQ A;  1V1P A;  2HE7 A;  1ZXI A;  4HVB A;  1I4G A;  2LI5 A;  2O6V D;  4GGQ A;  2JPH A;  3QA8 A;  2M0A A;  3PZ7 A;  4NPN A;  4NY0 A;  1NVI D;  2DAJ A;  2RD0 A;  4YSY B;  3VAW A;  4RGN A;  3ZDT A;  3V61 A;  1UF0 A;  2NTS A;  4RH6 A;  2M17 A;  2KMC A;  1PFD A;  3V05 A;  3PGE A;  4ZYN A;  3GE8 C;  5AZG A;  2FUH B;  3WA0 A;  2IGD A;  2XEW A;  4RM9 A;  2LVO A;  3DVN V;  3B2G A;  3RNF C;  2L7R A;  3BIN A;  5C3J B;  2HTM E;  4OZC A;  3PRM B;  2BS2 B;  3RYT A;  1M4V A;  2UWQ A;  3MHS D;  2IO0 B;  4GDL A;  2BS4 B;  1VRA B;  1HZ5 A;  3PO0 A;  2KZR A;  4RGM A;  3AED B;  3ZQ4 A;  4ICV A;  2B76 B;  2WXQ A;  5J17 A;  3NVV A;  2HJ1 A;  2G1E A;  4GLS C;  3AE2 B;  3WCQ A;  1E0Z A;  4WWM A;  2BYF A;  1RYJ A;  3GZN I;  5HHD G;  4TV3 A;  2BYE A;  2PE6 B;  2BVC A;  1WYG A;  3VH3 B;  4A3O A;  3IFW B;  1WGH A;  2L0F A;  2Z0E B;  3U52 E;  4OVV A;  1UUP A;  3GS2 A;  2QHO A;  1MHX A;  3AI5 A;  5DPW A;  3U7D A;  3M3J A;  4XE0 A;  2ZNV B;  2GI9 A;  4W9C A;  2JRI B;  4MT5 A;  1FCL A;  2KJH B;  5J18 A;  4I6N B;  1N61 A;  3U4E G;  3K9O B;  1FXA A;  3IVF A;  2ZCB A;  3DBH I;  1BUI C;  2BKR B;  4B9K A;  4N9F 4;  1TYG B;  2MJD A;  1Q1O A;  1C4C A;  3PSE B;  4PK1 A;  2WU2 B;  3M63 B;  4DXF A;  1R4M B;  4YTM B;  3HRD D;  1V2Y A;  1SE3 A;  4US9 A;  1SE9 A;  3TIX A;  3JSV A;  4JWU C;  5FR6 A;  2I2Y A;  3PLV A;  1KH0 A;  2QMT A;  4HWI B;  4FBJ B;  3ZJV A;  1HA5 A;  2OJR A;  1YIW A;  2L00 B;  3AE8 B;  2AWT A;  2V4L A;  1WMH B;  4WJP A;  1UNS A;  3S2A A;  3H7P A;  2JX5 A;  1S3S G;  3L54 A;  1WJU A;  2MH7 A;  2BF8 B;  2I1J A;  1FCC C;  3PPA A;  3SU8 X;  1E7P B;  4FN2 A;  2ONQ A;  3Q8F A;  1MI0 A;  4W9G A;  4MSQ B;  1Z2M A;  3JW0 X;  4NAM A;  4H2A A;  2ZPN A;  5HFY A;  2WXP A;  2W9N A;  2LGX A;  1J8C A;  2WWZ A;  4LTU A;  3A4R A;  4HJK A;  4KKJ A;  4GMV A;  1T3Q A;  2WXR A;  1FNW A;  2KX3 A;  2PPH A;  1LQB A;  1QIL A;  2KKC A;  1WE7 A;  2KQ4 X;  4PT5 A;  1E8W A;  2DAF A;  3RCZ A;  2KX0 A;  2EKE C;  3RFZ B;  2K8H A;  1L6U A;  2LRW A;  4BZA A;  1FRD A;  2KMM A;  1UWM A;  4TQ1 A;  4LLG M;  2N7D A;  1DYQ A;  3H7S A;  1HE8 A;  4NQL B;  4B6W A;  4IM0 A;  1QKZ A;  2AQ1 B;  3A1Q A;  4MM3 B;  3TMP B;  2Y5C A;  3AMZ A;  3ZRF A;  4RGT A;  1ZGU B;  1HQR D;  2MBE A;  3UQB A;  1BML C;  3L17 A;  4P1C C;  1YJI A;  2NTT A;  1N63 A;  1XCQ L;  1IBX A;  1V1P B;  2UU7 A;  3ONS A;  1JRO A;  1KFY B;  3NS1 A;  5AUI A;  1OQY A;  5BO4 B;  3ZNZ B;  4KGR A;  4XDD A;  2GMI C;  4TUU A;  4HKZ E;  2ZW1 A;  1RFK A;  4KVG B;  1M94 A;  1VZ7 A;  2C7M B;  4W9H A;  3P4S B;  1SE2 A;  1X1M A;  4DXA B;  3DHI C;  1XF5 L;  1QOB A;  1DOI A;  1P0R A;  3ZNG C;  3N20 C;  3H6N A;  3AN1 A;  1SJH D;  3U8Z A;  2K6Q A;  1V6E A;  2PTL A;  2M0X A;  1EUV B;  1FXI A;  2DZJ A;  1WF9 A;  3B2F A;  1TIF A;  3MC9 A;  3ZJT A;  4GDL B;  1TS2 A;  3L08 A;  3MJW A;  5CX3 A;  2R61 A;  5EE9 A;  2HD5 B;  1ACC A;  3A4S C;  3QAQ A;  4BBN C;  3E9S A;  1XLO A;  2LFI A;  4MJS A;  1SIJ A;  5E6N A;  3Q3O C;  1A70 A;  4IWO A;  4XYC A;  2Z8L A;  3NG0 A;  1VD2 A;  4ICU A;  4O1N A;  3Q8C A;  3AE4 B;  4M02 A;  4JE3 B;  4C00 A;  5D3I B;  5BMI A;  2RPQ A;  3L0W B;  1OEY J;  2M1M A;  1C76 A;  2N9L A;  3PZ8 A;  4RGO S;  2OOB B;  4NQK E;  2KAJ A;  4DHJ B;  2RDG A;  2LVQ A;  2KWD A;  2ON8 A;  1MHH E;  4F8C B;  3JYU A;  3ZNH B;  1P1A A;  3CIR B;  2BTE A;  2ZJD A;  2FNJ B;  3ECI A;  4YL8 A;  2MP2 B;  1KLG D;  1J19 A;  3KYD D;  5G2N A;  2C5L C;  2IGH A;  4IWQ A;  2D3C A;  2KLC A;  1T0R C;  3KYC D;  3R66 C;  3ZGZ A;  4JL9 A;  3DHH C;  4CHK A;  2KAC A;  2C7H A;  1LXD A;  3D32 A;  3AEG B;  3I57 A;  1NBF C;  2EKI A;  1FIQ A;  3JSV B;  2MCN B;  3Q8A A;  2LUM A;  3H1U A;  3NY5 A;  3BII D;  2IDY A;  1N60 A;  2KDB A;  1VCB A;  3J9C A;  3TUO A;  4CO7 A;  4HRO A;  2MA9 B;  1XCT L;  5AZF A;  2IO2 B;  2IJ0 A;  3H7P B;  2WXK A;  5EE3 A;  2MBQ A;  1NDD A;  2WXH A;  2JVC A;  3L16 A;  3KQ4 A;  4BAX A;  1FFU A;  4AQ7 A;  1TBE A;  2ZNV C;  3BVZ A;  3PLU A;  2WXL A;  3RD2 A;  4AJW A;  3P63 A;  3DBR B;  2CR5 A;  2PKO A;  3VRA B;  4J3O D;  1GC6 A;  4II2 B;  2RR9 A;  3ALB A;  1RLF A;  1F9J A;  1XD3 B;  2V4I B;  3NZS A;  1HEZ E;  5CHF A;  1XXG A;  2LHD A;  2FCQ A;  3AB5 A;  2YLM A;  3L13 A;  2EMT A;  3NUH B;  4DDG D;  3DBL B;  4WH4 A;  2M19 A;  4MGZ E;  1JWS D;  1FRR A;  1ZOY B;  2KWV B;  2V3P A;  4WAF A;  4WAA A;  3O13 A;  3A9J A;  3O65 B;  4PS7 A;  2AQ2 B; 
#chains in the Genus database with same CATH homology
 2XN9 C;  2INN E;  2Q5W D;  3BVG A;  3B2G A;  3HVD A;  5C3J B;  2HTM E;  1TY2 A;  1TS5 A;  1KLU D;  2JU6 X;  4OZC A;  2ICI A;  2BS2 B;  1I4P A;  4ZRQ A;  1M4V A;  3V3X A;  1RM6 C;  1FMA D;  1YQ4 B;  3TEZ A;  1JRP A;  1XLQ A;  2BS4 B;  1VRA B;  5EE1 A;  1OFF A;  1QOA A;  1ZUD 2;  1HZ5 A;  4B0M A;  3PO0 A;  4RGM A;  3AED B;  3AEB B;  4L23 A;  4YT0 B;  3ZQ4 A;  2I38 A;  4L2Y A;  2QIL A;  3FAH A;  5BYS A;  4YSX B;  1EWY C;  1SJE D;  1PUT A;  2N0S B;  2DLB A;  4HEA 1;  1DOY A;  4B0E A;  2B76 B;  2WXQ A;  2GB1 A;  3SEB A;  1FFV A;  3NVV A;  2G1E A;  4GDK B;  4GLS C;  3U2S C;  3AE2 B;  1ET6 A;  1IGC A;  1JWM D;  4DQO C;  1IBX B;  5FKA C;  3WCQ A;  2KDM A;  3FC4 A;  1E0Z A;  4OZA A;  3HUI A;  4WWM A;  1V8C A;  4P16 A;  2JSV X;  1TS4 A;  1RYJ A;  4TQ0 A;  5HHD G;  2BS3 B;  1FD6 A;  5LNK 1;  2PVO D;  1FEH A;  1XLN A;  1WYG A;  2JYT A;  3AE5 B;  2FUG 1;  1D5Z C;  3TSS A;  2E6X A;  2LEK A;  4JWS C;  2J42 A;  1YQ3 B;  1ZDV A;  1J7B A;  2JWU A;  4JX1 C;  2MJE A;  2L1A A;  4HKQ A;  1GPX A;  1DOX A;  4A90 A;  2LMC A;  5G5H A;  1WSP A;  3U52 E;  1PGB A;  3N9Y C;  1EM7 A;  2PMV A;  3AEC B;  1TKE A;  2W3S A;  1UUP A;  2K3U A;  1NYR A;  3LYY A;  3GS2 A;  5HI1 A;  1CQV A;  1I7H A;  1RWS A;  3ZYY X;  3IT4 B;  1MHX A;  4MH8 A;  3KWV A;  2WXN A;  1VZ6 A;  4RF0 A;  2L83 A;  4LK0 M;  3RPF C;  1STE A;  4NZL B;  1NEK B;  1FM0 D;  4XE0 A;  2GI9 A;  4MT5 A;  1VJK A;  1FCL A;  1N5X A;  5BYR A;  2X38 A;  1N61 A;  3NRZ A;  3U4E G;  3W5V B;  4WQM A;  2BB6 A;  1FXA A;  4C7Y A;  3R2T A;  2L52 A;  3VQI A;  2PIA A;  1BUI C;  3AE9 B;  4MAC A;  2PW9 A;  1TYG B;  2W3R A;  4RF1 A;  1JML A;  2MJD A;  4N59 A;  1C4C A;  2WU2 B;  4DXF A;  3NVZ A;  2J53 A;  2QJL A;  3HRD D;  4YTM B;  2BB5 A;  3UI3 A;  1AYF A;  5BMG A;  1SE3 A;  1IUE A;  1NEN B;  4US9 A;  1SB3 C;  1GAQ B;  4YTP B;  1C9F A;  3MJ5 A;  4YXD B;  1QT9 A;  1PDX A;  1JWA D;  3GP7 A;  4JWU C;  2FBW B;  1D4B A;  2I2Y A;  1SEB D;  3VR9 B;  1KH0 A;  4US8 A;  1T6B X;  2QMT A;  3MC0 B;  4ZYS A;  1FO4 A;  1XLP A;  5E6J A;  3ZJV A;  1HA5 A;  1Q10 A;  1E9M A;  1MVK A;  3AE8 B;  2BW2 A;  1OQR A;  2K0P A;  1D6E C;  2OHF A;  4C56 C;  2EEL A;  1VDV A;  1SF0 A;  2WDR B;  1UNS A;  2WDQ B;  2JX5 A;  2CU3 A;  1YN3 A;  2MH7 A;  2E3T A;  2WXI A;  1L4Z B;  1ROE A;  1R7S A;  4KX6 B;  1XO3 A;  1V97 A;  4XDC A;  1FCC C;  1GB4 A;  1E7P B;  3SR6 A;  3VRB B;  2ONQ A;  3BVM A;  4A6Q A;  3Q8F A;  1MI0 A;  3BYY B;  2AQ3 B;  2Y5P A;  4NAM A;  2SEB D;  4H2A A;  5HFY A;  2J52 A;  1SBB B;  2WXP A;  4IDI A;  4A8X C;  2DYO A;  5GXG B;  5JXV A;  1YN4 A;  2W82 A;  3AE1 B;  4IKG A;  4DXG A;  1DGJ A;  5BMH A;  5FR3 A;  3R8B A;  2IGG A;  1TY0 A;  4KKI A;  3FIL A;  4LTU A;  4NAW B;  4KKJ A;  1T3Q A;  2WXR A;  2W54 A;  1FNW A;  2AX5 A;  3P42 A;  1QQR A;  1QIL A;  2WDV B;  1ENF A;  1MPE A;  1F0Z A;  4Q2J A;  1I4X A;  2VZK D;  2KQ4 X;  4PT5 A;  1XEE A;  1PGX A;  4C7Z A;  3R2I A;  3OWE B;  3HVZ A;  3BWU D;  3BK1 A;  1L0V B;  2CJO A;  3RFZ B;  1L6U A;  4OVZ A;  1WRI A;  1JWB D;  1L0Y B;  3ETR A;  4RFB A;  4ZOH C;  1FRD A;  2KMM A;  1UWM A;  1ZE3 D;  4TQ1 A;  4LLG M;  1QF6 A;  1IGD A;  3NVY A;  2OED A;  1D5M C;  1UGJ A;  2PVG C;  2QIE B;  3LB8 C;  1DYQ A;  1VLB A;  1HXY D;  5C2T B;  3KLS X;  4NJC A;  1QKZ A;  2AQ1 B;  4MM3 B;  4EE2 A;  2N9K A;  4ARC A;  1SSN A;  2Y5C A;  3AMZ A;  3AV8 A;  3L4P A;  4RGT A;  2DYM A;  1HQR D;  3W5U B;  1BML C;  1J7A A;  1QOG A;  1YJI A;  2NTT A;  1N63 A;  1TZO A;  2DWQ A;  1LO5 D;  2L32 A;  1XCQ L;  1IBX A;  4A55 A;  1F77 A;  1V1P B;  1JCK B;  1FNU A;  4CQN A;  2WQY B;  5H8Y E;  1JRO A;  1YNT E;  1KFY B;  5H92 C;  2ZW0 A;  3LXF A;  3NS1 A;  5EE0 A;  5AUI A;  3IT6 B;  3NVW A;  1ET9 A;  2K9X A;  4USA A;  2SAK A;  1WWT A;  2KN4 A;  4KGR A;  2G9H D;  2WNM A;  1Y56 A;  1E6E B;  5AUK A;  1L4D B;  4XDD A;  4JPS A;  3EGR A;  4HKZ E;  2ZW1 A;  1RFK A;  2XNA C;  1J7C A;  3P4Q B;  2K5P A;  2BYT A;  4C80 A;  2N7J A;  1JW9 D;  1VZ7 A;  1KRH A;  2JYE A;  1C78 A;  2MEK A;  1K53 A;  3IAM 1;  4HRS A;  1CK1 A;  3ABV B;  1TKY A;  2JZP A;  3P4S B;  4KGS A;  1SE2 A;  1TJE A;  1PGA A;  4YWG G;  3TEX A;  1F2R I;  1XF5 L;  1QOB A;  1DOI A;  3Q8E A;  2LGI A;  2H88 B;  2WU5 B;  4XWT A;  3I9V 1;  2YEP F;  3BK2 A;  3AN1 A;  3SFE B;  2WXO A;  3KWL A;  1SJH D;  5TSS A;  5T8I A;  2PTL A;  3AE6 B;  1ZDX A;  1FXI A;  3B2F A;  1D5X C;  1ESF A;  3P4P B;  3ZJT A;  4ITK A;  4GDL B;  1TS2 A;  1JAL A;  3SFD B;  1NI3 A;  4P6V F;  3W2D A;  4TMA B;  1GOZ A;  2R61 A;  5EE9 A;  3EUB 2;  2PLP A;  2D5G A;  1ZPS A;  2LJI A;  1ACC A;  1I4R A;  3B9J A;  1CJE A;  2M56 B;  3IAS 1;  2V0G A;  3E9S A;  5D3D A;  2WP9 B;  1XLO A;  2LFI A;  1SIJ A;  3TEY A;  1A70 A;  3BZD B;  2Z8L A;  1L5P A;  3E56 A;  4O1N A;  1K50 A;  1WXQ A;  1P7E A;  1YJJ A;  3Q8C A;  5D7G A;  2ACZ B;  3AE4 B;  5FK9 C;  4JE3 B;  4RNA A;  5D3I B;  5BMI A;  2QEJ C;  2INP E;  2NMQ A;  4ARI A;  1C76 A;  2N9L A;  4YSZ B;  2IPK D;  3PZ8 A;  4RGO S;  4WIP A;  1NYQ A;  4RCO A;  1GB1 A;  1KTK A;  2KAJ A;  1QLB B;  1WGK A;  2RDG A;  2KWD A;  2ON8 A;  1MHH E;  1FNV A;  1TS3 A;  1CZP A;  4L1B A;  4WUR A;  2TSS A;  1EU4 A;  2FE8 A;  5G5G A;  4A9A A;  1ZXH A;  3AH7 A;  4YTN B;  1OQQ A;  1E10 A;  1AN8 A;  2WLB A;  4ZHO A;  3CIR B;  4IOI E;  1ZP0 B;  2BTE A;  2WXM A;  3AEA B;  1C4A A;  2DBY A;  1VZ8 A;  1V1O A;  1K51 A;  3U7Z A;  1KLG D;  1C79 A;  3IXS A;  2RPV A;  1KF6 B;  1L0X B;  1QOF A;  2IGH A;  5MPO A;  1C4P A;  2JXT A;  2RMM A;  4FXC A;  3VR8 B;  1T5X D;  2W55 A;  3W9C B;  3Q69 A;  3EA6 A;  3ZGZ A;  1YN5 A;  1B9R A;  1P7F A;  3CWI A;  2KAC A;  3AE3 B;  3W1S A;  3AEG B;  1SXT A;  1UWX A;  3I57 A;  3AE7 B;  2EKI A;  1FIQ A;  3TEW A;  4ZHP A;  1I4H A;  3AEE B;  4KGT A;  5HG2 A;  2MJ3 A;  1HZ6 A;  3Q8A A;  4R3D A;  4UDU C;  2LUM A;  1N62 A;  1EU3 A;  4N58 A;  3T3O A;  3BII D;  2IDY A;  2K22 A;  3P4R B;  1N60 A;  3MP9 A;  4ZRP A;  3J9C A;  3TUO A;  4M0W A;  1K52 A;  1JWU D;  4OZB A;  1L6V A;  1B1Z A;  2J4X A;  3AM9 A;  4HRO A;  2CJN A;  2LHE A;  5I4D A;  1EWC A;  1PYW D;  1XCT L;  1YMH E;  4TSS A;  1C77 A;  2IJ0 A;  2H89 B;  3C8Y A;  2WXK A;  2WXG A;  3DWM A;  4OHJ A;  4AS1 A;  2VZK B;  5EE3 A;  3NZ3 A;  3URY A;  1TKG A;  2WXH A;  1I4Q A;  2RDH A;  3GB1 A;  3KQ4 A;  4XWW A;  1JQ4 A;  3MFG A;  1FFU A;  2QSD A;  3ZJU A;  2WXJ A;  2WXF A;  4AQ7 A;  3T3N A;  3BVZ A;  1VR9 A;  2WXL A;  3BYT B;  3AEF B;  3P63 A;  1AWD A;  1AW7 A;  5BYQ A;  1V1P A;  2V3N A;  2YEP B;  1ZXI A;  1I4G A;  2GRI A;  2PKO A;  3VRA B;  3DWG C;  3MHZ A;  2Y3A A;  4N6E B;  4J3O D;  2V4I B;  4REZ A;  1HEZ E;  1BXT A;  1XXG A;  2LHD A;  4OW0 A;  2JQR B;  3AB5 A;  4D2K A;  1SE4 A;  2BBC A;  2M0A A;  3PZ7 A;  1NVI D;  3NUH B;  3FIL B;  4WH4 A;  2M19 A;  3Q8B A;  3H8H A;  4YSY B;  4RGN A;  1JWS D;  1FRR A;  1ZOY B;  2V3P A;  4WAF A;  1N5W A;  2HDE A;  2NTS A;  2BT6 A;  2WS3 B;  4RH6 A;  3O13 A;  3P1M A;  1PFD A;  4HJG E;  3V05 A;  1F2R C;  2AQ2 B;  2IGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...