3P63A

Structure of m. laminosus ferredoxin with a shorter l1,2 loop
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
ATYKVTLINPTGNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Allostery in the ferredoxin protein motif does not involve a conformational switch.
pubmed doi rcsb
source organism Mastigocladus laminosus
molecule tags Electron transport
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p63A00
2MJEA 2E3TA 3NS1A 2Y5CA 3CIRB 2CU3A 3CWIA 1FO4A 1L5PA 1E0ZA 1AWDA 3AH7A 3AV8A 3AEAB 5AUIA 5G5GA 2W54A 5G5HA 1SF0A 1T3QA 1XLPA 4YTPB 2BT6A 1FIQA 1QT9A 1AYFA 3AEDB 1N61A 1RWSA 3P4QB 1EWYC 2AX5A 3AB5A 2WLBA 3EUB2 1N63A 2K9XA 4US8A 1QLBB 3HUIA 2N0SB 2QIEB 3AEFB 5EE1A 5AUKA 1NENB 2Q5WD 4LTUA 1JW9D 1V8CA 2W3SA 4YTNB 4N58A 5EE0A 1PDXA 1OQRA 5EE3A 2BS4B 4JWUC 3WCQA 1UWMA 1DOXA 1J7CA 1V97A 3VR9B 4US9A 1JRPA 1DOIA 4KX6B 1FM0D 2OHFA 1N5XA 4FXCA 1JQ4A 1FFVA 3AEGB 4IDIA 1OFFA 3HRDD 3VRBB 3B2FA 3NVYA 3RPFC 2WP9B 3AE5B 1RYJA 2MJ3A 1WGKA 3ABVB 3AE9B 3AE7B 1YQ3B 2PVGC 4ITKA 5EE9A 1IUEA 1E10A 1CJEA 4ZHPA 1FFUA 4ZHOA 3AE6B 3HVZA 1NEKB 3AMZA 1GAQB 3AE4B 3BIID 2M19A 3FC4A 5C3JB 1ZXIA 2BS2B 1TYGB 5H8YE 3AE2B 2BS3B 2JQRB 3LB8C 3W5VB 4USAA 1E9MA 2PVOD 3AECB 3NVWA 1JWBD 1ZP0B 2MH7A 4YSYB 5C2TB 1TKYA 2WU2B 2PIAA 3AM9A 4ZOHC 3NVVA 2G1EA 3AN1A 3LXFA 1DGJA 1WYGA 2KMMA 4C80A 3L4PA 4C7ZA 1N5WA 1NVID 5MPOA 4YSXB 1JROA 1B9RA 1CZPA 1WRIA 1FXAA 3AE8B 1KFYB 1NI3A 1VJKA 4YT0B 1WXQA 1R7SA 3P1MA 2LEKA 2WDVB 4WWMA 3SFEB 2CJOA 1QF6A 2PKOA 2EKIA 3P4PB 2KAJA 3AE1B 1GPXA 3B2GA 1NYQA 4N6EB 1J7AA 2FBWB 1E6EB 2M56B 2MJDA 2WDQB 2H88B 2HTME 1L0VB 3FAHA 4HROA 1SB3C 4YSZB 1L6VA 2WS3B 2WDRB 1FRRA 1JALA 4JWSC 2ACZB 1OQQA 4YTMB 3SR6A 1ROEA 3NRZA 1I7HA 2H89B 2L83A 1N60A 3W5UB 1DOYA 1FRDA 1PUTA 2DBYA 3PO0A 1RM6C 1FMAD 1XO3A 1TJEA 3P4RB 4WQMA 3B9JA 2WU5B 1WWTA 2W55A 4HRSA 1KRHA 1XLQA 3AEBB 3AEEB 1RFKA 1TKEA 1ZOYB 2DWQA 3P4SB 4A9AA 1A70A 3ZYYX 4YXDB 2WQYB 2L52A 4C7YA 3KWLA 5H92C 4N59A 1YQ4B 1VDVA 2JX5A 2K22A 3DWMA 3NVZA 1JWAD 1XLOA 1QOBA 1YJJA 3P63A 1VLBA 3DWGC 2QJLA 3AE3B 1E7PB 1XLNA 3VR8B 4P6VF 4JX1C 3W9CB 1QOAA 2W3RA 3VRAB 1KF6B 3SFDB 1YJIA 1L6UA 1SIJA 2B76B 1N62A 2K5PA 1J7BA 1QOGA 1FXIA 1F0ZA 1ZUD2 1PFDA 2CJNA 5GXGB 1QOFA 3ETRA 1NYRA 1TKGA
chains in the Genus database with same CATH superfamily
2K6DB 1TZOA 1U4AA 2Z0EB 5IAAC 4HCPB 2XNAC 4YTPB 1YMHE 2CS4A 5EE1A 5LLIA 4LTUA 2WWZA 4N58A 1PDXA 4P1CC 3VVWB 2IO0B 2N7EA 3A4SC 3VR9B 1YN5A 1VRAB 1UF0A 2WDTB 2ZCBA 1BT0A 2V0GA 3PLUA 2BGFA 2R2OA 2YVCA 3GS2A 3ONSA 1ZE3D 2MRPA 4TKNA 4WWOA 4GMVA 2JXXA 2KACA 3AE2B 2C5LC 3DBHI 3DVNU 2J4XA 5FK9C 3FILB 1TKYA 2D5GA 2GMIC 1K51A 3C0RB 1CZPA 1NI3A 3WALA 3RN9C 2L7RA 3PZDA 3AU5A 3QAQA 1YOVB 2YEPF 3NHEB 3QA8A 2J52A 2DLBA 2WDQB 3V6EB 4HROA 3ZIMA 1FRRA 2N1WA 5D3DA 4ANWA 1ZKHA 1VD2A 1EF5A 2Y3AA 3LYYA 2WQYB 2KLGA 2KJ6A 3IBEA 3CSTA 1E8XA 3T3OA 3PHXB 3QX1A 3BYYB 1OTRB 3S2AA 3VR8B 1MPEA 3W9CB 1WY8A 1QOAA 1YNTE 2VZKB 1ZXHA 2MCNB 4IUMB 1VZ6A 4K7UA 3UQBA 2LHEA 2N1VA 3DBHB 3R2TA 2I1JA 4XC2A 1V49A 3NS8A 3VUXA 4KZ0A 4GDLA 3KLSX 2N9XA 3AEDB 1Q1OA 2I1KA 4LJPB 1EWYC 1HEZE 4ZDVA 1QLBB 4HDOA 1SE4A 4KZCA 3ECIA 2W3SA 4HDQA 1RLFA 1DOXA 1L7YA 2JYEA 1FM0D 1EU4A 2MSED 3Q3JA 4AJWA 2JYTA 4OZCA 3AE9B 4XZ4A 5EDSA 1KJTA 3VDZA 4I6PA 3WAMA 4W9DA 2AQ3B 3RZWC 3VUWA 4IM3A 3ZJVA 1T5XD 2JZPA 3IT6B 2KXJA 2PIAA 4B0EA 3V61A 2WXKA 1XD3B 1I4RA 1LQBA 4W9CA 4KSKC 3L10B 1QF6A 5JXVA 4LNOA 3BY4B 3P4PB 4TQ1A 4RGMA 4AOFA 4DHZB 2FCQA 4KSLC 4MELA 1Z2MA 3APDA 1RM6C 2HTHA 1BXTA 1ET6A 1FPYA 1KRHA 3P4SB 5IP4D 1AN8A 4I6LB 4WWPA 2KMAA 1B1ZA 5JZEB 4GN1A 2KD0A 2VH1A 4GDLB 3L54A 3QK0A 1K53A 4K3BA 5HFYA 1CK1A 3VHTC 1F0ZA 2VH2A 4CQNA 1QOFA 4M8MA 1E0ZA 1AWDA 2ZNVC 2KDBA 4ZRPA 2GBRA 2IGHA 2ONQA 3V6CB 1TY2A 4C56C 2BT6A 2D3GA 1RWSA 1WXSA 1UWXA 1YJ1A 3FKYA 4BKSD 1IP9A 2HD5B 2C60A 1J8CA 1D5ZC 4KX6B 2IY1B 3W1YA 3W2DA 3E9SA 4NQLB 1XEEA 3B2FA 3NVYA 4RH6A 1JWMD 4KDLB 3BK1A 1E8WA 3AXCA 4KKIA 2L8JA 4XWTA 1C76A 1NEKB 4W9EA 1R4MI 5JHBA 4PS8A 4ASWC 3UI3A 4ICVA 3I63C 4JQWC 2OOBB 3PHWB 2NBUA 3AM9A 2NBWB 2J0KA 1YX5B 2KMMA 2HE7A 3SDLC 1D5XC 2AQ1B 4C7ZA 3A33B 4W9FA 2KHWB 2LUEA 2KVRA 1TT5B 4WWMA 1WI0A 2QEJC 1WH3A 2QSDA 2DAFA 4UDUC 2AYOB 2C7MB 2KFKA 3IAM1 3N1XC 2LJ5A 3DVGX 4HPMB 1ROEA 3NRZA 3AULA 3QC8B 1E8ZA 3M3JA 4MSMB 1V81A 3A9KA 1E5WA 1I4PA 2DWQA 2JU6X 1C78A 1F1HA 3SEBA 5IOIA 4OHJA 3VH4B 2PPHA 3P63A 1P3QU 2K6QA 1V5OA 2BYVE 5D6JB 1R4MB 3V62A 5JH5C 1MI0A 4WJNA 5C1ZA 5FR3A 3NZ3A 3RD2A 3N9YC 4MEMA 1Q0WB 1GB4A 2HJ8A 3BVMA 3GE3C 4TUUA 5AUIA 4A20A 3Q8CA 1CMXB 3C19A 1Y56A 1VR9A 2LFIA 3NUHB 5C23A 1IBXA 1V5TA 2WXPA 4YTNB 4RM8A 1J19A 1V97A 1HTOA 1SEBD 3A9JB 2WX0A 3N3KB 5IA7A 3AE5B 1L0YB 4HCNB 1T0QC 2JWUA 4K7SA 2WXHA 3Q8FA 2L3ZA 2L32A 2V3SA 4EZJA 3AE6B 3DVGY 4K1RB 4IG7B 5CHWA 4IWPA 4AWJA 1UUPA 1R4NI 1C4PA 2WXRA 2N7DA 2XK5A 5BO4B 3JYUA 2KFKB 1FNUA 1JROA 4JE3B 2Z0DB 3T9LA 1WJ6A 2EKIA 3AE1B 2X8XX 4L1BA 4N6EB 2FUG1 2KT7A 3QHTA 3A9KB 2MP2A 1AW7A 4WJOA 4W9LA 2IGGA 3R66C 4GOCA 2FCMA 2G3QB 4RM9A 4KDIC 1TKEA 4P16A 4WURA 2NR2A 4OVZA 2ASQA 3PVLA 3UGBB 5JHAA 3RFZB 1VLBA 2KK8A 3T3NA 1YJIA 4LJOB 2V4LA 4RMAA 2LI5A 4ARCA 1SJHD 4MDKE 4GXBA 5L95C 1IBXB 4H2AA 1C1YB 1R4NB 2DZJA 3HK0A 1SF0A 1N61A 2TSSA 1SSNA 1N63A 4US8A 2QIEB 3L0WB 1FCLA 1JW9D 2B3AA 2MQJA 3ZKJC 1WM2A 3WCQA 4FJVB 4ANVA 2REXA 4FJZA 3VFKA 1Y8RC 2D3AA 2J0JA 3I5JC 2G9HD 2NCNA 4II2B 1ZPSA 4C00A 2XK5B 5E6PA 3Q8AA 3MFGA 2M17A 2MBHA 3ZUNA 1PGAA 3W5VB 3R8BA 3ZNHB 2LGIA 2KWUB 1H8CA 5C2TB 3NVVA 1YX6B 3DBLI 2MP2B 4YSXB 2KTRA 2KKCA 5HHDG 5BMHA 1B9RA 4EFOA 2N9KA 2EMTA 1UNSA 3B2GA 2I2YA 1KLUD 4O1NA 2WNMA 4GB9A 5HKHA 1WE7A 2MBEA 2N9PC 3IFWB 3BVGA 1PUTA 5LXHA 1MVKA 2D3BA 3O65B 2KX3A 4A9AA 2GBMA 1E7VA 2XEWA 2JX5A 1QOBA 1SGHA 2JUOA 2ZJDA 2PLPA 2JF5A 3IXSA 2JWZA 1OQYA 3A1QA 1QOGA 4MH0E 3ZXVA 4NY0A 1RRBA 3ZRFA 4OZBA 2WYQA 2MW5A 2MJEA 1WF9A 3PREA 3AV8A 5BYQA 1EU3A 3EHVA 1TS5A 3DBLB 1I42A 2DZIA 4JIOU 3EUB2 2IO1B 4CHKA 2G45B 1BUIC 4REZA 2DENB 2N7JA 3OWEB 1KH0A 2IO2B 2L0TA 1MG8A 4IKGA 2I38A 3GB1A 2ZW1A 3U30A 4A90A 3QJZA 3V60A 2D3CA 1E10A 2BWFA 1FFUA 1YQBA 2MBBB 5DPTA 4ZHPA 1FEHA 1I4QA 2KTRB 5C3JB 1P0RA 4USAA 2PVOD 2UWQA 2BYFA 3VQIA 2MH7A 4S17A 4AJYB 2AL3A 3IG3A 4WQOB 3KWVA 2RPQA 4MGIE 2KC1A 3TEZA 1GOZA 5HI1A 2J0MA 1K52A 2LRWA 4XWWA 2BKRB 3PTFC 4BAXA 4J6IA 5G55A 4EEWA 2KDEB 2NMQA 2WHIA 4E74A 4JWSC 2XBBC 4BOSC 1CQVA 1FRDA 2JXTA 3VAWA 2ZVOA 2Y5PA 4I6NB 4WJPA 2W55A 4E71A 3AEBB 3Q2AC 1RFKA 4L23A 4JL9A 3TJPA 4XX5A 1MHHE 3A1QB 1EUVB 3HVDA 2K22A 1JWAD 1XLOA 2PMVA 3DWGC 1E90A 2W3RA 1SIJA 2KQSA 2INNE 2QC8A 1WJNA 2INPE 1UH6A 3NS1A 2Y5CA 1UELA 3AEAB 2BB5A 1UBIA 2W54A 3R7QA 4DWFA 2KQ4X 3V05A 2IBIB 2K9XA 4LNFA 4GIVA 3BYTB 1WJUA 1V8CA 3MC9A 2JRIB 1WJ4A 4JWUC 3U2SC 1UGMA 2ZNVB 5IO9A 2JVCA 1N5XA 5J2RA 1LFDA 3VRBB 2WP9B 3LDZE 1WR1A 4WAAA 3IT4B 4F8CB 2MBOA 3ZDMC 2DNFA 1WGGA 1S3SG 4R3DA 1I4XA 2FIFA 2RMMA 3SHQA 3W1SA 5BMIA 4W9KA 2JQRB 2OJWA 3PSEB 1E9MA 2WXQA 5G2NA 1XF5L 4XYCA 2KDIA 2C9WB 1V9JA 5AZFA 1WGHA 4TV3A 3RNCC 3BZDB 3DBSA 1UD7A 4RGOS 2WDVB 4ANXA 2PKOA 4GSWA 1MHXA 2BYEA 3Q14C 2WXOA 3C8YA 3W5UB 2D07B 4NJCA 2ZPNA 4M0WA 2WU5B 1EO6A 3UIOB 1ENFA 1Q5WB 1F2RI 3DWMA 2SEBD 2RGFA 2DYMA 3EFCA 1JRUA 2CKHB 2GBKA 3PPAA 5J18A 2KN5A 1J7BA 1ZUD2 2CJNA 2KMCA 5GXGB 1WYWB 4G50A 3ZTCA 4HJKA 1FO4A 3GP7A 3N30A 4DXFA 4C4VA 2WXIA 5G5GA 4ARIA 4TQ0A 2W82A 1WGDA 3ZVVA 4LNNA 2AEHA 2RDGA 5IKCM 4DXGA 1NENB 2Q5WD 4IM2A 3GZNI 3B1LX 4HKZE 3DHGC 4RF1A 2LGDA 4N9F4 3H7SA 4US9A 2R2QA 1L0XB 1MG4A 3RNFC 5AEKB 1YN3A 2J7QB 2M0AA 3HHMA 1I4GA 3JSVA 4JPSA 4JGHB 3AE7B 2FAZA 5EE9A 4YL8A 1IUEA 4RCOA 5BYSA 5HG2A 3Q6BA 1GUAB 4B0MA 4ZRIA 1UGJA 4RGTA 4DDID 4EKUA 4KVGB 1C4AA 3NOBA 3L4PA 2WXLA 4NJ7A 2M4NA 3VH3B 1NBFC 4FULA 3RYTA 2IZVB 3P2BA 2LVPA 4M0WB 1KOTA 2DZKA 3VUYA 3H6NA 3A9JA 3QWZB 2O2VA 4EUTA 3GZNB 1A5RA 2NVUI 1F52A 3M95A 3KUDB 5KHOA 4BOZB 4ZRQA 3PT2B 2MEKA 3NJTA 2WX1A 3BINA 3AE3B 4C4VB 4PT5A 1HE8A 1EF1A 4LLGM 2LUMA 4LNIA 1QZEA 2LRUA 1JRPA 4MACA 1NI2A 3DBRI 3AH7A 2YLMA 2LGSA 4KIKA 2J53A 4FHKA 2FCSA 5G5HA 4A55A 1OEYA 3PZ7A 2CHZA 2WLBA 2FIDA 5TR5A 3JSVB 1GNUA 3ZGZA 2V3NA 5EE0A 5J17A 2KX0A 2V1YA 3APCA 1T0SC 2BS4B 2Z8LA 2JZZA 3DHIC 2RD0A 4W9JA 3I9V1 1V86A 4GDKA 2PE9A 3U7ZA 3IHPC 2OHFA 1XT9B 1WSPA 2BPSA 2DYOA 4B95A 3HRDD 3HIZA 3VTWA 4KGTA 3RPFC 5T8IA 3H8HA 2LWPA 3W1SC 1M94A 2INCC 3DCGA 3O13A 2ZCCA 3VTUA 2M19A 3ZNZB 3FC4A 4HVBA 5H8YE 2EMSA 3LB8C 2NBVB 1F2RC 3AECB 4QAYA 1C9FA 2E6XA 4YSYB 3N20C 1WX7A 2ZW0A 4AQ7A 3U52E 2O2VB 2A4ZA 2L00B 3PV1A 1WRIA 2N9EB 3DBRB 3B0AA 3DQVA 4NQKE 2FBWB 3FAHA 4L2YA 4KGRA 1L6VA 2WDRB 2LXAA 2D11A 4YTMB 1E7UA 1VZ8A 3SR6A 2MX2A 4MM3A 1DOYA 3WAPA 4S0RA 3P4RB 2ZPYA 3PRMB 2K8CA 3KWLA 1ZGUB 3NVZA 2NS5A 1YJJA 1TBEA 4CO7A 2QJLA 1P98A 4KIKB 3ZDTA 4EZLA 3E56A 4EZKA 2K5PA 1TY0A 4HWIB 4BKGA 1EWCA 2JPHA 2ZEQA 3MJ5A 3CIRB 3CWIA 4XDDA 1ET9A 2O6VA 3ZTDA 2CU1A 3OLMD 4NAWA 1FIQA 3ENEA 4GDKB 3RMKC 3AB5A 2AX5A 1UZXB 2LVOA 2JRHA 1TS2A 3I3TB 2LXCA 3KVFB 3J9CA 3RNBC 4TMAB 1WM3A 2K0PA 5TSSA 2GI9A 3RULA 4IDIA 3ZO5B 1L4ZB 2PJHA 4PS3A 1CJEA 4II3B 2KLCA 3H1UA 2IGDA 3M63B 2J42A 1WRDB 1TYGB 3ZXRA 2IJ0A 4NZLB 3V3XA 1Z5SB 1WYGA 1WGRA 1N5WA 4WIPA 1HQRD 4DXAB 2DYBA 4MM3B 1WXQA 1R7SA 2WXFA 4MSQB 4LDTB 2HTME 3KUCB 1SB3C 4LCDE 3MJWA 3OG5A 1I7HA 2A5UA 2SAKA 3PS6A 5D2MB 2DX5B 4NPNA 3M62B 1C77A 4HRSA 3TEYA 4RF0A 1QQRA 4DHZE 5H92C 4BFRA 2IY0B 2KWDA 4P6VF 5DPRA 2O6VB 1MJDA 4MGKE 4NAWB 4F1SA 2B76B 1N62A 1WGYA 1LM8B 1ISNA 1FXIA 4PK1A 3EA6A 3MC0B 2RR9A 3RT3B 3DOWA 1PGBA 3WIMA 2IYDB 4WAFA 1F77A 1WE6A 3K9PB 4GGQA 1T0RC 2L05A 3TMPB 3U8ZA 4HEA1 2GBJA 4FBJB 2WXGA 2KDFB 4DHJB 1J0GA 2M8SA 4Q2JA 2JSVX 2LJIA 4TSSA 1SE3A 1XXGA 3ZRCA 2MJ3A 1WGKA 3BK2A 2ZZPB 1D5MC 3KQ4A 2KN4A 3HVZA 2K8HA 3BIID 3R3MA 3TEXA 3GOEA 4EOYA 1L2NA 1VCBA 3D32A 3NVWA 3MHZA 1IGCA 4ZOHC 3AN1A 1DGJA 2W9NA 4FN2A 1FCCC 3EC8A 4BBNC 2KC2A 1FXAA 3AE8B 4YT0B 4OZAA 4OVUA 4M02A 2KQ7A 2K3UA 1TS4A 1GPXA 3JW0X 2N9LA 3LJ3A 4K3CA 2Y5BB 5CHFA 3OJ4B 3ZLZA 4YSZB 1PYWD 1HTQA 1JALA 3CSFA 3PLVA 4URKA 2H89B 4DDGD 1RFAA 2KTFA 2CHWA 2ICIA 4WQMA 1KTKA 2RSUA 3APFA 4W9HA 4PS7A 1XLQA 2GB1A 5IN7A 3NZUA 1OEYJ 4YXDB 2QMTA 1KM7A 3R7RA 1E7PB 3K9OB 3EFUA 3N1YC 1TS3A 1KF6B 3SFDB 1L6UA 1YN4A 3URYA 2DZMA 4M8NA 3TIXA 2K8BA 5BMGA 4WH4A 1QKZA 4P1BC 2G4SA 2LMCA 1WZ0A 3ML9A 2L1AA 3PRPB 4JLCA 1XLPA 2BBCA 3I57A 4F7ZA 2INDC 4FA6A 2UYZB 2UU7A 3KH0A 1LXDA 1E8YA 2JY6A 2BKFA 1D6EC 3TCAA 1UBQA 1J7CA 3N1ZC 1DOIA 2VZKD 4NAMA 1WR6E 2NTSA 3PGEA 3ABVB 2BW2A 2KYWA 2FE8A 2PVGC 2LZ6A 2N4FA 1WFYA 4ZHOA 4BBNF 3UQAA 1C79A 2PTLA 2BS3B 3N32A 1SE9A 4K7WA 1M4VA 4G0NB 3NY5A 3TSSA 3WAOA 5FKAC 1SJED 3B08A 3MTNB 2IO3B 1PQSA 4IOIE 2LEKA 3SFEB 1TIFA 2IDYA 1NYQA 1XCTL 1STEA 4ZRKA 2ACZB 1WIAA 1V1PA 2DBYA 3P42A 2WXNA 1V6EA 1WXMA 3AI5A 1V2YA 3WA0A 3ZYYX 4BZAA 4N59A 1VDVA 5CTRC 3OJ3A 1K50A 1P7EA 3DPDA 1LO5D 2Z59B 4JX1C 4A8XC 2CHXA 3VRAB 4ZYSA 2PEAA 1C4CA 4E3CA 2LVQA 2KDMA 4ANUA 3WANA 5BYRA 2VRRB 4G11A 2QCZA 2MHJA 4DQOC 3P4QB 1SE2A 2LGXA 2N0SB 3ZQ4A 3QQ8B 1OQRA 2FNJB 3RZFA 4A6QA 2WGSA 1L4DB 3RNGC 4BKSA 1VZ7A 3DHHC 2JT4B 1T6BX 3Q3MC 4M01A 1GG3A 2MLBA 1XCQL 1ZDXA 5DCNA 1P1AA 4RFBA 2X38A 3AMZA 1GAQB 1ZXIA 2BS2B 4XE0A 4BKTA 2KVZA 2BQQA 4KGSA 4A3PA 1JWBD 4BVUC 2WU2B 4ZYNA 2MWSB 1NVID 4B9KA 5MPOA 2C7HA 1FNWA 3MC8A 5EE3A 2BVCA 1V1PB 4FLHA 3Q3NC 2KAJA 2NPTA 4M00A 1S1QB 4HKQA 3T8MA 2KOXA 3Q8BA 2M56B 1QILA 2H88B 3KW5B 2LD9A 1GB1A 3BVZA 5D3IB 1YD8U 1N60A 2L0FA 4X57B 4ICUA 3PO0A 1XO3A 3ZNID 3CF6E 1XQQA 4HPLB 3PRZA 5GMVA 3L17A 2ON8A 2L52A 1SIFA 2WXMA 3Q3FA 4NNJB 1FXTB 4AS1A 3SD5A 1XLNA 1SXTA 1WXAA 1TZ1A 1LGRA 3ETRA 1TKGA 2E3TA 4MJSA 1QT9A 1AYFA 3L08A 2KO3A 4OW0A 1MFWA 3UIPB 3HUIA 1IPGA 1I35A 2M0XA 2AWTA 4RNAA 3KYCD 4WWNA 1V80A 3PZ8A 1I4HA 3AEGB 1OFFA 4RGNA 1D3ZA 1FNVA 5LNK1 4LK0M 4ITKA 3U7DA 1RAXA 2D2QA 4WJQA 3H7PA 4CYEA 2KWVB 2NPTB 3LXFA 1HXYD 2QDFA 4C80A 4HJGE 1EM7A 3H9DA 4DK5A 2QHOA 1WX9A 3DVNV 5E6OA 2CJOA 2IPKD 2C7NB 1C3TA 1TTNA 2BF8B 1DYQA 3R2IA 3VTVA 4LNKA 3ZJTA 2WS3B 4A3OA 3U4EG 4MT5A 1FMAD 2EKEC 1WWTA 3IAS1 5E6NA 3GE8C 3ZJUA 3AEEB 4KV2A 1X1MA 3TBLD 3HM3A 1AARA 1JWUD 1PGXA 4KKJA 2KANA 3JVZX 2LHDA 4MJSB 1P7FA 4YWGG 1WMHA 1PFDA 2K39A 3Q3OC 2M1MA 5AZGA 2CU3A 3BWUD 2GBNA 2FCNA 1ESFA 4J3OD 2RPVA 1T3QA 2JZ3B 2BYTA 1OGWA 2V4IB 4DBGA 3A4RA 5AUKA 1IYFA 2QILA 2WXJA 4GLSC 2K1FA 2KJHB 2OJRA 5L83A 2KJRA 4K81A 1WXVA 2FUHB 3QIJA 2CR5A 1F9JA 3IVFA 3NZSA 2V9HA 3H7PB 1RYJA 3CMMB 5DPSA 2GRIA 2OEDA 1JMLA 3AE4B 3RNEC 2ZVNA 1JWSD 1WX8A 2DHZA 2GOWA 1GC6A 4IM0A 1G6JA 4MGZE 3Q69A 5D7GA 3L13A 1ZP0B 2KFJA 1GJZA 5DPWA 3RI7C 1KFYB 4AUQC 3P1MA 4IWOA 3UF8A 3TL5A 4XGAB 2BTEA 4IWQA 2MJDA 3EECA 4LDTD 2L83A 2YEPB 4HK2A 1HZ6A 1ACCA 2L76A 2LGYA 3OAWA 5I4DA 3UINB 4XDCA 5LXIB 1NDDA 2HDEA 1D4BA 1A70A 3NG0A 2AL6A 1WMHB 1HZ5A 1YQ4B 4GU2A 3HM6X 1JCKB 4D2KA 4ACFA 5CHVC 5E6JA 3EGRA 2D10A 4HPPA 2G4DB 4ZRJA 2O6VD 3RNAC 2PW9A 2PE6B 5KHQA 4W9GA 2RDHA 3DDCB 4FHJA 1NYRA 4B6WA 5AZHA 1L5PA 1HA5A 3RCZA 3ZW3A 1KLVA 2KNBA 2MBQA 2R61A 4P7IA 3Q8EA 4W9IA 3MHSD 3AEFB 2EELA 2K25A 2BWES 1IGDA 1UWMA 1YIWA 3MP9A 2HJ1A 4FXCA 1JQ4A 1FFVA 2V3PA 1N6ZA 1ZW7A 2GLSA 4DHJD 3KYDD 1H4RA 1YQ3B 1KLGD 3QCAA 4HXDA 5CX3A 3TEWA 4IC7B 3QARA 1T0YA 1K8RB 4FJYA 4MH8A 1WZ3A 4G3XB 4NJ6A 5FR6A 1Q10A 4C7YA 3AU4A 2G1EA 4AP4C 2NTTA 1GC7A 4FADA 3VXWA 3ML8A 1VJKA 4IW0A 3TUOA 3FILA 3ALBA 2AQ2B 1J7AA 1E6EB 1L0VB 2KZRA 4OVVA 1OQQA 4PYUA 2LASA 4MGYE 3SU8X 3L16A 1TGZB 3KUZA 1TJEA 2RDBC 3B9JA 1FD6A 1ZOYB 4HLEA 1ZDVA 1BMLC 3RUIB 2XN9C 2BB6A 1V1OA 4PYZA 3X23A 5D94A 1P9DU 2KWCA 1SBBB 2MA9B 3X0WA 4EE2A 3ZNGC 2DAJA
chains in the Genus database with same CATH topology
5BYRA 4MACA 1IBXB 4H2AA 3AH7A 1TZOA 2J53A 2XNAC 5G5HA 4DQOC 1SF0A 4YTPB 4A55A 1YMHE 1N61A 2TSSA 3P4QB 1SSNA 3PZ7A 2WLBA 1N63A 1SE2A 4US8A 5EE1A 2N0SB 2QIEB 1FCLA 4LTUA 1JW9D 3ZGZA 2V3NA 3ZQ4A 5EE0A 4N58A 1PDXA 1OQRA 2BS4B 2Z8LA 3WCQA 4A6QA 1L4DB 3I9V1 3U7ZA 3VR9B 1VZ7A 1YN5A 1T6BX 1VRAB 1WSPA 2OHFA 2DYOA 3HRDD 2V0GA 4KGTA 3RPFC 5T8IA 2G9HD 1XCQL 1ZDXA 3GS2A 3H8HA 1ZPSA 4RFBA 1ZE3D 2X38A 3AMZA 3O13A 3Q8AA 1GAQB 3MFGA 2M19A 3FC4A 1ZXIA 2BS2B 2KACA 4XE0A 5H8YE 3AE2B 1PGAA 3W5VB 3LB8C 3R8BA 2LGIA 2J4XA 1F2RC 3AECB 4KGSA 1C9FA 2E6XA 1JWBD 5FK9C 3FILB 4YSYB 5C2TB 1TKYA 2WU2B 2D5GA 3NVVA 2ZW0A 1K51A 1NVID 4AQ7A 3U52E 5MPOA 4YSXB 5BMHA 1FNWA 5HHDG 1B9RA 1CZPA 1WRIA 5EE3A 1NI3A 2N9KA 1V1PB 1UNSA 2KAJA 3B2GA 2I2YA 2YEPF 2J52A 4HKQA 2DLBA 3Q8BA 2FBWB 2M56B 1KLUD 1QILA 2WDQB 2H88B 2WNMA 3FAHA 4HROA 4O1NA 4L2YA 4KGRA 1L6VA 2WDRB 1GB1A 1FRRA 4YTMB 1VZ8A 3BVZA 3SR6A 5D3IB 1DOYA 1N60A 3BVGA 1PUTA 3PO0A 1MVKA 1XO3A 5D3DA 3P4RB 4A9AA 2Y3AA 3LYYA 2ON8A 2WQYB 2L52A 3KWLA 2WXMA 4AS1A 2JX5A 3NVZA 3T3OA 1YJJA 1QOBA 3BYYB 2QJLA 2PLPA 1XLNA 3VR8B 1MPEA 3W9CB 1QOAA 1YNTE 1SXTA 2VZKB 3IXSA 1ZXHA 3E56A 2K5PA 1TY0A 1QOGA 1VZ6A 1EWCA 4OZBA 2LHEA 3ETRA 1TKGA 2MJEA 2E3TA 3MJ5A 3CIRB 3CWIA 3R2TA 4XDDA 3AV8A 5BYQA 1ET9A 1EU3A 1TS5A 3KLSX 1FIQA 1QT9A 1AYFA 3AEDB 4GDKB 1EWYC 2AX5A 3AB5A 1HEZE 3EUB2 4OW0A 1QLBB 3HUIA 1SE4A 1BUIC 4REZA 1TS2A 2W3SA 2N7JA 3OWEB 1KH0A 4RNAA 3J9CA 4TMAB 1DOXA 2JYEA 4IKGA 3PZ8A 1I4HA 1FM0D 2I38A 3GB1A 1EU4A 2K0PA 2ZW1A 5TSSA 2GI9A 3AEGB 4IDIA 1OFFA 4RGNA 4A90A 2JYTA 4OZCA 3AE9B 1L4ZB 1FNVA 5LNK1 4LK0M 1E10A 4ITKA 1CJEA 2AQ3B 4ZHPA 1FFUA 1FEHA 3ZJVA 2JZPA 1T5XD 2IGDA 1I4QA 2J42A 3IT6B 5C3JB 1TYGB 2IJ0A 4USAA 2PVOD 3VQIA 2MH7A 4NZLB 3V3XA 2PIAA 3LXFA 4B0EA 1WYGA 1HXYD 4C80A 2WXKA 3KWVA 1I4RA 1N5WA 4HJGE 4WIPA 1HQRD 3TEZA 1EM7A 1GOZA 5HI1A 4MM3B 1WXQA 1R7SA 2WXFA 1QF6A 1K52A 2CJOA 2IPKD 5JXVA 4XWWA 4TQ1A 3P4PB 1DYQA 4RGMA 3R2IA 2HTME 2NMQA 3ZJTA 1SB3C 2WS3B 4JWSC 1CQVA 3U4EG 1I7HA 4MT5A 1FRDA 2SAKA 1RM6C 1FMAD 2JXTA 1BXTA 1ET6A 2Y5PA 1WWTA 3IAS1 2W55A 1C77A 4HRSA 1KRHA 3AEBB 3AEEB 1RFKA 3P4SB 4L23A 3ZJUA 3TEYA 4RF0A 1AN8A 1QQRA 1MHHE 5H92C 3HVDA 1JWUD 2K22A 1B1ZA 1PGXA 2KWDA 1JWAD 1XLOA 4KKJA 2PMVA 3DWGC 4P6VF 2LHDA 1P7FA 2W3RA 4YWGG 4GDLB 4NAWB 1SIJA 1K53A 2B76B 1N62A 5HFYA 1CK1A 1F0ZA 1FXIA 1PFDA 2INNE 2INPE 3EA6A 4CQNA 1QOFA 3NS1A 2Y5CA 3MC0B 2CU3A 3BWUD 1E0ZA 1AWDA 4J3OD 1ESFA 2BB5A 3AEAB 4ZRPA 2IGHA 2ONQA 2W54A 2RPVA 1T3QA 1TY2A 4C56C 2BT6A 2BYTA 1PGBA 2KQ4X 1RWSA 3V05A 1UWXA 4WAFA 2K9XA 1F77A 2V4IB 3BYTB 5AUKA 1V8CA 2QILA 2WXJA 4JWUC 3U2SC 4GLSC 4HEA1 1D5ZC 4KX6B 2WXGA 1N5XA 3W2DA 3E9SA 4Q2JA 2JSVX 2LJIA 4TSSA 3VRBB 1XEEA 3B2FA 3NVYA 4RH6A 1SE3A 1XXGA 2WP9B 1RYJA 2MJ3A 1WGKA 2GRIA 1JWMD 3BK2A 3BK1A 3IT4B 1D5MC 4KKIA 3KQ4A 4XWTA 1C76A 2KN4A 2OEDA 1JMLA 3HVZA 1NEKB 3BIID 3AE4B 3TEXA 1JWSD 4R3DA 1I4XA 2RMMA 5BMIA 3W1SA 3UI3A 2JQRB 3Q69A 5D7GA 1E9MA 3NVWA 2WXQA 1ZP0B 1XF5L 3MHZA 1IGCA 3AM9A 4ZOHC 3AN1A 1DGJA 2KMMA 1D5XC 2AQ1B 4C7ZA 1FCCC 3AE8B 1FXAA 4YT0B 1KFYB 3BZDB 4OZAA 4RGOS 3P1MA 2WDVB 4WWMA 2QEJC 2PKOA 2K3UA 1TS4A 1GPXA 1MHXA 2QSDA 4UDUC 2N9LA 2BTEA 2MJDA 3IAM1 4YSZB 1PYWD 1JALA 2WXOA 3C8YA 1ROEA 3NRZA 3W5UB 2H89B 2L83A 2YEPB 4NJCA 1HZ6A 1ACCA 2ICIA 4WQMA 5I4DA 4M0WA 1KTKA 2WU5B 4XDCA 2HDEA 1XLQA 2GB1A 1I4PA 2DWQA 1ENFA 1D4BA 2JU6X 1A70A 4YXDB 1C78A 2QMTA 1HZ5A 1F2RI 1YQ4B 3SEBA 4OHJA 3DWMA 2SEBD 1JCKB 3P63A 4D2KA 2DYMA 1E7PB 1TS3A 5E6JA 1KF6B 3EGRA 3SFDB 1L6UA 1YN4A 3URYA 2PW9A 1J7BA 1ZUD2 1MI0A 2RDHA 2CJNA 5BMGA 5GXGB 5FR3A 3NZ3A 4WH4A 1NYRA 1QKZA 3N9YC 2LMCA 1GB4A 1FO4A 1L5PA 3BVMA 3GP7A 1HA5A 2L1AA 4DXFA 5AUIA 2WXIA 5G5GA 4ARIA 1XLPA 3Q8CA 4TQ0A 2W82A 2BBCA 1Y56A 3I57A 2R61A 1VR9A 2RDGA 3Q8EA 2LFIA 3NUHB 3AEFB 1IBXA 4DXGA 2WXPA 1NENB 2Q5WD 2EELA 4YTNB 1IGDA 4HKZE 1UWMA 4RF1A 3MP9A 1D6EC 1J7CA 1V97A 4US9A 1SEBD 1DOIA 1L0XB 2VZKD 4NAMA 1YN3A 4FXCA 1JQ4A 2NTSA 1FFVA 2M0AA 2V3PA 1I4GA 4JPSA 3AE5B 1L0YB 2JWUA 3ABVB 2WXHA 3AE7B 3Q8FA 2BW2A 1YQ3B 2FE8A 1KLGD 2PVGC 5EE9A 1IUEA 4RCOA 2L32A 5HG2A 5BYSA 4ZHOA 3AE6B 3TEWA 1C79A 4B0MA 1UGJA 2PTLA 4RGTA 4MH8A 2BS3B 1C4AA 1M4VA 1Q10A 4C7YA 1UUPA 3TSSA 1C4PA 2WXRA 2G1EA 5FKAC 2NTTA 1SJED 3L4PA 1FNUA 2WXLA 1JROA 4JE3B 4IOIE 1VJKA 2LEKA 3TUOA 3SFEB 3FILA 2EKIA 3AE1B 2IDYA 1NYQA 4L1BA 1XCTL 4N6EB 1STEA 2AQ2B 2FUG1 1J7AA 1E6EB 1L0VB 1AW7A 2ACZB 1OQQA 1V1PA 2DBYA 3P42A 1TJEA 2IGGA 3B9JA 2WXNA 1FD6A 4P16A 1TKEA 4WURA 1ZOYB 4OVZA 3ZYYX 1ZDVA 1BMLC 4N59A 1VDVA 4ZRQA 2MEKA 2XN9C 1K50A 3RFZB 1P7EA 1VLBA 2BB6A 3AE3B 1V1OA 3T3NA 1LO5D 4JX1C 4PT5A 4A8XC 3VRAB 1YJIA 1SBBB 4LLGM 4ZYSA 1C4CA 2LUMA 4EE2A 2KDMA 4ARCA 1JRPA 1SJHD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJE A;  2E3T A;  3NS1 A;  2Y5C A;  3CIR B;  2CU3 A;  3CWI A;  1FO4 A;  1L5P A;  1E0Z A;  1AWD A;  3AH7 A;  3AV8 A;  3AEA B;  5AUI A;  5G5G A;  2W54 A;  5G5H A;  1SF0 A;  1T3Q A;  1XLP A;  4YTP B;  2BT6 A;  1FIQ A;  1QT9 A;  1AYF A;  3AED B;  1N61 A;  1RWS A;  3P4Q B;  1EWY C;  2AX5 A;  3AB5 A;  2WLB A;  3EUB 2;  1N63 A;  2K9X A;  4US8 A;  1QLB B;  3HUI A;  2N0S B;  2QIE B;  3AEF B;  5EE1 A;  5AUK A;  1NEN B;  2Q5W D;  4LTU A;  1JW9 D;  1V8C A;  2W3S A;  4YTN B;  4N58 A;  5EE0 A;  1PDX A;  1OQR A;  5EE3 A;  2BS4 B;  4JWU C;  3WCQ A;  1UWM A;  1DOX A;  1J7C A;  1V97 A;  3VR9 B;  4US9 A;  1JRP A;  1DOI A;  4KX6 B;  1FM0 D;  2OHF A;  1N5X A;  4FXC A;  1JQ4 A;  1FFV A;  3AEG B;  4IDI A;  1OFF A;  3HRD D;  3VRB B;  3B2F A;  3NVY A;  3RPF C;  2WP9 B;  3AE5 B;  1RYJ A;  2MJ3 A;  1WGK A;  3ABV B;  3AE9 B;  3AE7 B;  1YQ3 B;  2PVG C;  4ITK A;  5EE9 A;  1IUE A;  1E10 A;  1CJE A;  4ZHP A;  1FFU A;  4ZHO A;  3AE6 B;  3HVZ A;  1NEK B;  3AMZ A;  1GAQ B;  3AE4 B;  3BII D;  2M19 A;  3FC4 A;  5C3J B;  1ZXI A;  2BS2 B;  1TYG B;  5H8Y E;  3AE2 B;  2BS3 B;  2JQR B;  3LB8 C;  3W5V B;  4USA A;  1E9M A;  2PVO D;  3AEC B;  3NVW A;  1JWB D;  1ZP0 B;  2MH7 A;  4YSY B;  5C2T B;  1TKY A;  2WU2 B;  2PIA A;  3AM9 A;  4ZOH C;  3NVV A;  2G1E A;  3AN1 A;  3LXF A;  1DGJ A;  1WYG A;  2KMM A;  4C80 A;  3L4P A;  4C7Z A;  1N5W A;  1NVI D;  5MPO A;  4YSX B;  1JRO A;  1B9R A;  1CZP A;  1WRI A;  1FXA A;  3AE8 B;  1KFY B;  1NI3 A;  1VJK A;  4YT0 B;  1WXQ A;  1R7S A;  3P1M A;  2LEK A;  2WDV B;  4WWM A;  3SFE B;  2CJO A;  1QF6 A;  2PKO A;  2EKI A;  3P4P B;  2KAJ A;  3AE1 B;  1GPX A;  3B2G A;  1NYQ A;  4N6E B;  1J7A A;  2FBW B;  1E6E B;  2M56 B;  2MJD A;  2WDQ B;  2H88 B;  2HTM E;  1L0V B;  3FAH A;  4HRO A;  1SB3 C;  4YSZ B;  1L6V A;  2WS3 B;  2WDR B;  1FRR A;  1JAL A;  4JWS C;  2ACZ B;  1OQQ A;  4YTM B;  3SR6 A;  1ROE A;  3NRZ A;  1I7H A;  2H89 B;  2L83 A;  1N60 A;  3W5U B;  1DOY A;  1FRD A;  1PUT A;  2DBY A;  3PO0 A;  1RM6 C;  1FMA D;  1XO3 A;  1TJE A;  3P4R B;  4WQM A;  3B9J A;  2WU5 B;  1WWT A;  2W55 A;  4HRS A;  1KRH A;  1XLQ A;  3AEB B;  3AEE B;  1RFK A;  1TKE A;  1ZOY B;  2DWQ A;  3P4S B;  4A9A A;  1A70 A;  3ZYY X;  4YXD B;  2WQY B;  2L52 A;  4C7Y A;  3KWL A;  5H92 C;  4N59 A;  1YQ4 B;  1VDV A;  2JX5 A;  2K22 A;  3DWM A;  3NVZ A;  1JWA D;  1XLO A;  1QOB A;  1YJJ A;  3P63 A;  1VLB A;  3DWG C;  2QJL A;  3AE3 B;  1E7P B;  1XLN A;  3VR8 B;  4P6V F;  4JX1 C;  3W9C B;  1QOA A;  2W3R A;  3VRA B;  1KF6 B;  3SFD B;  1YJI A;  1L6U A;  1SIJ A;  2B76 B;  1N62 A;  2K5P A;  1J7B A;  1QOG A;  1FXI A;  1F0Z A;  1ZUD 2;  1PFD A;  2CJN A;  5GXG B;  1QOF A;  3ETR A;  1NYR A;  1TKG A; 
#chains in the Genus database with same CATH topology
 2K6D B;  1TZO A;  1U4A A;  2Z0E B;  5IAA C;  4HCP B;  2XNA C;  4YTP B;  1YMH E;  2CS4 A;  5EE1 A;  5LLI A;  4LTU A;  2WWZ A;  4N58 A;  1PDX A;  4P1C C;  3VVW B;  2IO0 B;  2N7E A;  3A4S C;  3VR9 B;  1YN5 A;  1VRA B;  1UF0 A;  2WDT B;  2ZCB A;  1BT0 A;  2V0G A;  3PLU A;  2BGF A;  2R2O A;  2YVC A;  3GS2 A;  3ONS A;  1ZE3 D;  2MRP A;  4TKN A;  4WWO A;  4GMV A;  2JXX A;  2KAC A;  3AE2 B;  2C5L C;  3DBH I;  3DVN U;  2J4X A;  5FK9 C;  3FIL B;  1TKY A;  2D5G A;  2GMI C;  1K51 A;  3C0R B;  1CZP A;  1NI3 A;  3WAL A;  3RN9 C;  2L7R A;  3PZD A;  3AU5 A;  3QAQ A;  1YOV B;  2YEP F;  3NHE B;  3QA8 A;  2J52 A;  2DLB A;  2WDQ B;  3V6E B;  4HRO A;  3ZIM A;  1FRR A;  2N1W A;  5D3D A;  4ANW A;  1ZKH A;  1VD2 A;  1EF5 A;  2Y3A A;  3LYY A;  2WQY B;  2KLG A;  2KJ6 A;  3IBE A;  3CST A;  1E8X A;  3T3O A;  3PHX B;  3QX1 A;  3BYY B;  1OTR B;  3S2A A;  3VR8 B;  1MPE A;  3W9C B;  1WY8 A;  1QOA A;  1YNT E;  2VZK B;  1ZXH A;  2MCN B;  4IUM B;  1VZ6 A;  4K7U A;  3UQB A;  2LHE A;  2N1V A;  3DBH B;  3R2T A;  2I1J A;  4XC2 A;  1V49 A;  3NS8 A;  3VUX A;  4KZ0 A;  4GDL A;  3KLS X;  2N9X A;  3AED B;  1Q1O A;  2I1K A;  4LJP B;  1EWY C;  1HEZ E;  4ZDV A;  1QLB B;  4HDO A;  1SE4 A;  4KZC A;  3ECI A;  2W3S A;  4HDQ A;  1RLF A;  1DOX A;  1L7Y A;  2JYE A;  1FM0 D;  1EU4 A;  2MSE D;  3Q3J A;  4AJW A;  2JYT A;  4OZC A;  3AE9 B;  4XZ4 A;  5EDS A;  1KJT A;  3VDZ A;  4I6P A;  3WAM A;  4W9D A;  2AQ3 B;  3RZW C;  3VUW A;  4IM3 A;  3ZJV A;  1T5X D;  2JZP A;  3IT6 B;  2KXJ A;  2PIA A;  4B0E A;  3V61 A;  2WXK A;  1XD3 B;  1I4R A;  1LQB A;  4W9C A;  4KSK C;  3L10 B;  1QF6 A;  5JXV A;  4LNO A;  3BY4 B;  3P4P B;  4TQ1 A;  4RGM A;  4AOF A;  4DHZ B;  2FCQ A;  4KSL C;  4MEL A;  1Z2M A;  3APD A;  1RM6 C;  2HTH A;  1BXT A;  1ET6 A;  1FPY A;  1KRH A;  3P4S B;  5IP4 D;  1AN8 A;  4I6L B;  4WWP A;  2KMA A;  1B1Z A;  5JZE B;  4GN1 A;  2KD0 A;  2VH1 A;  4GDL B;  3L54 A;  3QK0 A;  1K53 A;  4K3B A;  5HFY A;  1CK1 A;  3VHT C;  1F0Z A;  2VH2 A;  4CQN A;  1QOF A;  4M8M A;  1E0Z A;  1AWD A;  2ZNV C;  2KDB A;  4ZRP A;  2GBR A;  2IGH A;  2ONQ A;  3V6C B;  1TY2 A;  4C56 C;  2BT6 A;  2D3G A;  1RWS A;  1WXS A;  1UWX A;  1YJ1 A;  3FKY A;  4BKS D;  1IP9 A;  2HD5 B;  2C60 A;  1J8C A;  1D5Z C;  4KX6 B;  2IY1 B;  3W1Y A;  3W2D A;  3E9S A;  4NQL B;  1XEE A;  3B2F A;  3NVY A;  4RH6 A;  1JWM D;  4KDL B;  3BK1 A;  1E8W A;  3AXC A;  4KKI A;  2L8J A;  4XWT A;  1C76 A;  1NEK B;  4W9E A;  1R4M I;  5JHB A;  4PS8 A;  4ASW C;  3UI3 A;  4ICV A;  3I63 C;  4JQW C;  2OOB B;  3PHW B;  2NBU A;  3AM9 A;  2NBW B;  2J0K A;  1YX5 B;  2KMM A;  2HE7 A;  3SDL C;  1D5X C;  2AQ1 B;  4C7Z A;  3A33 B;  4W9F A;  2KHW B;  2LUE A;  2KVR A;  1TT5 B;  4WWM A;  1WI0 A;  2QEJ C;  1WH3 A;  2QSD A;  2DAF A;  4UDU C;  2AYO B;  2C7M B;  2KFK A;  3IAM 1;  3N1X C;  2LJ5 A;  3DVG X;  4HPM B;  1ROE A;  3NRZ A;  3AUL A;  3QC8 B;  1E8Z A;  3M3J A;  4MSM B;  1V81 A;  3A9K A;  1E5W A;  1I4P A;  2DWQ A;  2JU6 X;  1C78 A;  1F1H A;  3SEB A;  5IOI A;  4OHJ A;  3VH4 B;  2PPH A;  3P63 A;  1P3Q U;  2K6Q A;  1V5O A;  2BYV E;  5D6J B;  1R4M B;  3V62 A;  5JH5 C;  1MI0 A;  4WJN A;  5C1Z A;  5FR3 A;  3NZ3 A;  3RD2 A;  3N9Y C;  4MEM A;  1Q0W B;  1GB4 A;  2HJ8 A;  3BVM A;  3GE3 C;  4TUU A;  5AUI A;  4A20 A;  3Q8C A;  1CMX B;  3C19 A;  1Y56 A;  1VR9 A;  2LFI A;  3NUH B;  5C23 A;  1IBX A;  1V5T A;  2WXP A;  4YTN B;  4RM8 A;  1J19 A;  1V97 A;  1HTO A;  1SEB D;  3A9J B;  2WX0 A;  3N3K B;  5IA7 A;  3AE5 B;  1L0Y B;  4HCN B;  1T0Q C;  2JWU A;  4K7S A;  2WXH A;  3Q8F A;  2L3Z A;  2L32 A;  2V3S A;  4EZJ A;  3AE6 B;  3DVG Y;  4K1R B;  4IG7 B;  5CHW A;  4IWP A;  4AWJ A;  1UUP A;  1R4N I;  1C4P A;  2WXR A;  2N7D A;  2XK5 A;  5BO4 B;  3JYU A;  2KFK B;  1FNU A;  1JRO A;  4JE3 B;  2Z0D B;  3T9L A;  1WJ6 A;  2EKI A;  3AE1 B;  2X8X X;  4L1B A;  4N6E B;  2FUG 1;  2KT7 A;  3QHT A;  3A9K B;  2MP2 A;  1AW7 A;  4WJO A;  4W9L A;  2IGG A;  3R66 C;  4GOC A;  2FCM A;  2G3Q B;  4RM9 A;  4KDI C;  1TKE A;  4P16 A;  4WUR A;  2NR2 A;  4OVZ A;  2ASQ A;  3PVL A;  3UGB B;  5JHA A;  3RFZ B;  1VLB A;  2KK8 A;  3T3N A;  1YJI A;  4LJO B;  2V4L A;  4RMA A;  2LI5 A;  4ARC A;  1SJH D;  4MDK E;  4GXB A;  5L95 C;  1IBX B;  4H2A A;  1C1Y B;  1R4N B;  2DZJ A;  3HK0 A;  1SF0 A;  1N61 A;  2TSS A;  1SSN A;  1N63 A;  4US8 A;  2QIE B;  3L0W B;  1FCL A;  1JW9 D;  2B3A A;  2MQJ A;  3ZKJ C;  1WM2 A;  3WCQ A;  4FJV B;  4ANV A;  2REX A;  4FJZ A;  3VFK A;  1Y8R C;  2D3A A;  2J0J A;  3I5J C;  2G9H D;  2NCN A;  4II2 B;  1ZPS A;  4C00 A;  2XK5 B;  5E6P A;  3Q8A A;  3MFG A;  2M17 A;  2MBH A;  3ZUN A;  1PGA A;  3W5V B;  3R8B A;  3ZNH B;  2LGI A;  2KWU B;  1H8C A;  5C2T B;  3NVV A;  1YX6 B;  3DBL I;  2MP2 B;  4YSX B;  2KTR A;  2KKC A;  5HHD G;  5BMH A;  1B9R A;  4EFO A;  2N9K A;  2EMT A;  1UNS A;  3B2G A;  2I2Y A;  1KLU D;  4O1N A;  2WNM A;  4GB9 A;  5HKH A;  1WE7 A;  2MBE A;  2N9P C;  3IFW B;  3BVG A;  1PUT A;  5LXH A;  1MVK A;  2D3B A;  3O65 B;  2KX3 A;  4A9A A;  2GBM A;  1E7V A;  2XEW A;  2JX5 A;  1QOB A;  1SGH A;  2JUO A;  2ZJD A;  2PLP A;  2JF5 A;  3IXS A;  2JWZ A;  1OQY A;  3A1Q A;  1QOG A;  4MH0 E;  3ZXV A;  4NY0 A;  1RRB A;  3ZRF A;  4OZB A;  2WYQ A;  2MW5 A;  2MJE A;  1WF9 A;  3PRE A;  3AV8 A;  5BYQ A;  1EU3 A;  3EHV A;  1TS5 A;  3DBL B;  1I42 A;  2DZI A;  4JIO U;  3EUB 2;  2IO1 B;  4CHK A;  2G45 B;  1BUI C;  4REZ A;  2DEN B;  2N7J A;  3OWE B;  1KH0 A;  2IO2 B;  2L0T A;  1MG8 A;  4IKG A;  2I38 A;  3GB1 A;  2ZW1 A;  3U30 A;  4A90 A;  3QJZ A;  3V60 A;  2D3C A;  1E10 A;  2BWF A;  1FFU A;  1YQB A;  2MBB B;  5DPT A;  4ZHP A;  1FEH A;  1I4Q A;  2KTR B;  5C3J B;  1P0R A;  4USA A;  2PVO D;  2UWQ A;  2BYF A;  3VQI A;  2MH7 A;  4S17 A;  4AJY B;  2AL3 A;  3IG3 A;  4WQO B;  3KWV A;  2RPQ A;  4MGI E;  2KC1 A;  3TEZ A;  1GOZ A;  5HI1 A;  2J0M A;  1K52 A;  2LRW A;  4XWW A;  2BKR B;  3PTF C;  4BAX A;  4J6I A;  5G55 A;  4EEW A;  2KDE B;  2NMQ A;  2WHI A;  4E74 A;  4JWS C;  2XBB C;  4BOS C;  1CQV A;  1FRD A;  2JXT A;  3VAW A;  2ZVO A;  2Y5P A;  4I6N B;  4WJP A;  2W55 A;  4E71 A;  3AEB B;  3Q2A C;  1RFK A;  4L23 A;  4JL9 A;  3TJP A;  4XX5 A;  1MHH E;  3A1Q B;  1EUV B;  3HVD A;  2K22 A;  1JWA D;  1XLO A;  2PMV A;  3DWG C;  1E90 A;  2W3R A;  1SIJ A;  2KQS A;  2INN E;  2QC8 A;  1WJN A;  2INP E;  1UH6 A;  3NS1 A;  2Y5C A;  1UEL A;  3AEA B;  2BB5 A;  1UBI A;  2W54 A;  3R7Q A;  4DWF A;  2KQ4 X;  3V05 A;  2IBI B;  2K9X A;  4LNF A;  4GIV A;  3BYT B;  1WJU A;  1V8C A;  3MC9 A;  2JRI B;  1WJ4 A;  4JWU C;  3U2S C;  1UGM A;  2ZNV B;  5IO9 A;  2JVC A;  1N5X A;  5J2R A;  1LFD A;  3VRB B;  2WP9 B;  3LDZ E;  1WR1 A;  4WAA A;  3IT4 B;  4F8C B;  2MBO A;  3ZDM C;  2DNF A;  1WGG A;  1S3S G;  4R3D A;  1I4X A;  2FIF A;  2RMM A;  3SHQ A;  3W1S A;  5BMI A;  4W9K A;  2JQR B;  2OJW A;  3PSE B;  1E9M A;  2WXQ A;  5G2N A;  1XF5 L;  4XYC A;  2KDI A;  2C9W B;  1V9J A;  5AZF A;  1WGH A;  4TV3 A;  3RNC C;  3BZD B;  3DBS A;  1UD7 A;  4RGO S;  2WDV B;  4ANX A;  2PKO A;  4GSW A;  1MHX A;  2BYE A;  3Q14 C;  2WXO A;  3C8Y A;  3W5U B;  2D07 B;  4NJC A;  2ZPN A;  4M0W A;  2WU5 B;  1EO6 A;  3UIO B;  1ENF A;  1Q5W B;  1F2R I;  3DWM A;  2SEB D;  2RGF A;  2DYM A;  3EFC A;  1JRU A;  2CKH B;  2GBK A;  3PPA A;  5J18 A;  2KN5 A;  1J7B A;  1ZUD 2;  2CJN A;  2KMC A;  5GXG B;  1WYW B;  4G50 A;  3ZTC A;  4HJK A;  1FO4 A;  3GP7 A;  3N30 A;  4DXF A;  4C4V A;  2WXI A;  5G5G A;  4ARI A;  4TQ0 A;  2W82 A;  1WGD A;  3ZVV A;  4LNN A;  2AEH A;  2RDG A;  5IKC M;  4DXG A;  1NEN B;  2Q5W D;  4IM2 A;  3GZN I;  3B1L X;  4HKZ E;  3DHG C;  4RF1 A;  2LGD A;  4N9F 4;  3H7S A;  4US9 A;  2R2Q A;  1L0X B;  1MG4 A;  3RNF C;  5AEK B;  1YN3 A;  2J7Q B;  2M0A A;  3HHM A;  1I4G A;  3JSV A;  4JPS A;  4JGH B;  3AE7 B;  2FAZ A;  5EE9 A;  4YL8 A;  1IUE A;  4RCO A;  5BYS A;  5HG2 A;  3Q6B A;  1GUA B;  4B0M A;  4ZRI A;  1UGJ A;  4RGT A;  4DDI D;  4EKU A;  4KVG B;  1C4A A;  3NOB A;  3L4P A;  2WXL A;  4NJ7 A;  2M4N A;  3VH3 B;  1NBF C;  4FUL A;  3RYT A;  2IZV B;  3P2B A;  2LVP A;  4M0W B;  1KOT A;  2DZK A;  3VUY A;  3H6N A;  3A9J A;  3QWZ B;  2O2V A;  4EUT A;  3GZN B;  1A5R A;  2NVU I;  1F52 A;  3M95 A;  3KUD B;  5KHO A;  4BOZ B;  4ZRQ A;  3PT2 B;  2MEK A;  3NJT A;  2WX1 A;  3BIN A;  3AE3 B;  4C4V B;  4PT5 A;  1HE8 A;  1EF1 A;  4LLG M;  2LUM A;  4LNI A;  1QZE A;  2LRU A;  1JRP A;  4MAC A;  1NI2 A;  3DBR I;  3AH7 A;  2YLM A;  2LGS A;  4KIK A;  2J53 A;  4FHK A;  2FCS A;  5G5H A;  4A55 A;  1OEY A;  3PZ7 A;  2CHZ A;  2WLB A;  2FID A;  5TR5 A;  3JSV B;  1GNU A;  3ZGZ A;  2V3N A;  5EE0 A;  5J17 A;  2KX0 A;  2V1Y A;  3APC A;  1T0S C;  2BS4 B;  2Z8L A;  2JZZ A;  3DHI C;  2RD0 A;  4W9J A;  3I9V 1;  1V86 A;  4GDK A;  2PE9 A;  3U7Z A;  3IHP C;  2OHF A;  1XT9 B;  1WSP A;  2BPS A;  2DYO A;  4B95 A;  3HRD D;  3HIZ A;  3VTW A;  4KGT A;  3RPF C;  5T8I A;  3H8H A;  2LWP A;  3W1S C;  1M94 A;  2INC C;  3DCG A;  3O13 A;  2ZCC A;  3VTU A;  2M19 A;  3ZNZ B;  3FC4 A;  4HVB A;  5H8Y E;  2EMS A;  3LB8 C;  2NBV B;  1F2R C;  3AEC B;  4QAY A;  1C9F A;  2E6X A;  4YSY B;  3N20 C;  1WX7 A;  2ZW0 A;  4AQ7 A;  3U52 E;  2O2V B;  2A4Z A;  2L00 B;  3PV1 A;  1WRI A;  2N9E B;  3DBR B;  3B0A A;  3DQV A;  4NQK E;  2FBW B;  3FAH A;  4L2Y A;  4KGR A;  1L6V A;  2WDR B;  2LXA A;  2D11 A;  4YTM B;  1E7U A;  1VZ8 A;  3SR6 A;  2MX2 A;  4MM3 A;  1DOY A;  3WAP A;  4S0R A;  3P4R B;  2ZPY A;  3PRM B;  2K8C A;  3KWL A;  1ZGU B;  3NVZ A;  2NS5 A;  1YJJ A;  1TBE A;  4CO7 A;  2QJL A;  1P98 A;  4KIK B;  3ZDT A;  4EZL A;  3E56 A;  4EZK A;  2K5P A;  1TY0 A;  4HWI B;  4BKG A;  1EWC A;  2JPH A;  2ZEQ A;  3MJ5 A;  3CIR B;  3CWI A;  4XDD A;  1ET9 A;  2O6V A;  3ZTD A;  2CU1 A;  3OLM D;  4NAW A;  1FIQ A;  3ENE A;  4GDK B;  3RMK C;  3AB5 A;  2AX5 A;  1UZX B;  2LVO A;  2JRH A;  1TS2 A;  3I3T B;  2LXC A;  3KVF B;  3J9C A;  3RNB C;  4TMA B;  1WM3 A;  2K0P A;  5TSS A;  2GI9 A;  3RUL A;  4IDI A;  3ZO5 B;  1L4Z B;  2PJH A;  4PS3 A;  1CJE A;  4II3 B;  2KLC A;  3H1U A;  2IGD A;  3M63 B;  2J42 A;  1WRD B;  1TYG B;  3ZXR A;  2IJ0 A;  4NZL B;  3V3X A;  1Z5S B;  1WYG A;  1WGR A;  1N5W A;  4WIP A;  1HQR D;  4DXA B;  2DYB A;  4MM3 B;  1WXQ A;  1R7S A;  2WXF A;  4MSQ B;  4LDT B;  2HTM E;  3KUC B;  1SB3 C;  4LCD E;  3MJW A;  3OG5 A;  1I7H A;  2A5U A;  2SAK A;  3PS6 A;  5D2M B;  2DX5 B;  4NPN A;  3M62 B;  1C77 A;  4HRS A;  3TEY A;  4RF0 A;  1QQR A;  4DHZ E;  5H92 C;  4BFR A;  2IY0 B;  2KWD A;  4P6V F;  5DPR A;  2O6V B;  1MJD A;  4MGK E;  4NAW B;  4F1S A;  2B76 B;  1N62 A;  1WGY A;  1LM8 B;  1ISN A;  1FXI A;  4PK1 A;  3EA6 A;  3MC0 B;  2RR9 A;  3RT3 B;  3DOW A;  1PGB A;  3WIM A;  2IYD B;  4WAF A;  1F77 A;  1WE6 A;  3K9P B;  4GGQ A;  1T0R C;  2L05 A;  3TMP B;  3U8Z A;  4HEA 1;  2GBJ A;  4FBJ B;  2WXG A;  2KDF B;  4DHJ B;  1J0G A;  2M8S A;  4Q2J A;  2JSV X;  2LJI A;  4TSS A;  1SE3 A;  1XXG A;  3ZRC A;  2MJ3 A;  1WGK A;  3BK2 A;  2ZZP B;  1D5M C;  3KQ4 A;  2KN4 A;  3HVZ A;  2K8H A;  3BII D;  3R3M A;  3TEX A;  3GOE A;  4EOY A;  1L2N A;  1VCB A;  3D32 A;  3NVW A;  3MHZ A;  1IGC A;  4ZOH C;  3AN1 A;  1DGJ A;  2W9N A;  4FN2 A;  1FCC C;  3EC8 A;  4BBN C;  2KC2 A;  1FXA A;  3AE8 B;  4YT0 B;  4OZA A;  4OVU A;  4M02 A;  2KQ7 A;  2K3U A;  1TS4 A;  1GPX A;  3JW0 X;  2N9L A;  3LJ3 A;  4K3C A;  2Y5B B;  5CHF A;  3OJ4 B;  3ZLZ A;  4YSZ B;  1PYW D;  1HTQ A;  1JAL A;  3CSF A;  3PLV A;  4URK A;  2H89 B;  4DDG D;  1RFA A;  2KTF A;  2CHW A;  2ICI A;  4WQM A;  1KTK A;  2RSU A;  3APF A;  4W9H A;  4PS7 A;  1XLQ A;  2GB1 A;  5IN7 A;  3NZU A;  1OEY J;  4YXD B;  2QMT A;  1KM7 A;  3R7R A;  1E7P B;  3K9O B;  3EFU A;  3N1Y C;  1TS3 A;  1KF6 B;  3SFD B;  1L6U A;  1YN4 A;  3URY A;  2DZM A;  4M8N A;  3TIX A;  2K8B A;  5BMG A;  4WH4 A;  1QKZ A;  4P1B C;  2G4S A;  2LMC A;  1WZ0 A;  3ML9 A;  2L1A A;  3PRP B;  4JLC A;  1XLP A;  2BBC A;  3I57 A;  4F7Z A;  2IND C;  4FA6 A;  2UYZ B;  2UU7 A;  3KH0 A;  1LXD A;  1E8Y A;  2JY6 A;  2BKF A;  1D6E C;  3TCA A;  1UBQ A;  1J7C A;  3N1Z C;  1DOI A;  2VZK D;  4NAM A;  1WR6 E;  2NTS A;  3PGE A;  3ABV B;  2BW2 A;  2KYW A;  2FE8 A;  2PVG C;  2LZ6 A;  2N4F A;  1WFY A;  4ZHO A;  4BBN F;  3UQA A;  1C79 A;  2PTL A;  2BS3 B;  3N32 A;  1SE9 A;  4K7W A;  1M4V A;  4G0N B;  3NY5 A;  3TSS A;  3WAO A;  5FKA C;  1SJE D;  3B08 A;  3MTN B;  2IO3 B;  1PQS A;  4IOI E;  2LEK A;  3SFE B;  1TIF A;  2IDY A;  1NYQ A;  1XCT L;  1STE A;  4ZRK A;  2ACZ B;  1WIA A;  1V1P A;  2DBY A;  3P42 A;  2WXN A;  1V6E A;  1WXM A;  3AI5 A;  1V2Y A;  3WA0 A;  3ZYY X;  4BZA A;  4N59 A;  1VDV A;  5CTR C;  3OJ3 A;  1K50 A;  1P7E A;  3DPD A;  1LO5 D;  2Z59 B;  4JX1 C;  4A8X C;  2CHX A;  3VRA B;  4ZYS A;  2PEA A;  1C4C A;  4E3C A;  2LVQ A;  2KDM A;  4ANU A;  3WAN A;  5BYR A;  2VRR B;  4G11 A;  2QCZ A;  2MHJ A;  4DQO C;  3P4Q B;  1SE2 A;  2LGX A;  2N0S B;  3ZQ4 A;  3QQ8 B;  1OQR A;  2FNJ B;  3RZF A;  4A6Q A;  2WGS A;  1L4D B;  3RNG C;  4BKS A;  1VZ7 A;  3DHH C;  2JT4 B;  1T6B X;  3Q3M C;  4M01 A;  1GG3 A;  2MLB A;  1XCQ L;  1ZDX A;  5DCN A;  1P1A A;  4RFB A;  2X38 A;  3AMZ A;  1GAQ B;  1ZXI A;  2BS2 B;  4XE0 A;  4BKT A;  2KVZ A;  2BQQ A;  4KGS A;  4A3P A;  1JWB D;  4BVU C;  2WU2 B;  4ZYN A;  2MWS B;  1NVI D;  4B9K A;  5MPO A;  2C7H A;  1FNW A;  3MC8 A;  5EE3 A;  2BVC A;  1V1P B;  4FLH A;  3Q3N C;  2KAJ A;  2NPT A;  4M00 A;  1S1Q B;  4HKQ A;  3T8M A;  2KOX A;  3Q8B A;  2M56 B;  1QIL A;  2H88 B;  3KW5 B;  2LD9 A;  1GB1 A;  3BVZ A;  5D3I B;  1YD8 U;  1N60 A;  2L0F A;  4X57 B;  4ICU A;  3PO0 A;  1XO3 A;  3ZNI D;  3CF6 E;  1XQQ A;  4HPL B;  3PRZ A;  5GMV A;  3L17 A;  2ON8 A;  2L52 A;  1SIF A;  2WXM A;  3Q3F A;  4NNJ B;  1FXT B;  4AS1 A;  3SD5 A;  1XLN A;  1SXT A;  1WXA A;  1TZ1 A;  1LGR A;  3ETR A;  1TKG A;  2E3T A;  4MJS A;  1QT9 A;  1AYF A;  3L08 A;  2KO3 A;  4OW0 A;  1MFW A;  3UIP B;  3HUI A;  1IPG A;  1I35 A;  2M0X A;  2AWT A;  4RNA A;  3KYC D;  4WWN A;  1V80 A;  3PZ8 A;  1I4H A;  3AEG B;  1OFF A;  4RGN A;  1D3Z A;  1FNV A;  5LNK 1;  4LK0 M;  4ITK A;  3U7D A;  1RAX A;  2D2Q A;  4WJQ A;  3H7P A;  4CYE A;  2KWV B;  2NPT B;  3LXF A;  1HXY D;  2QDF A;  4C80 A;  4HJG E;  1EM7 A;  3H9D A;  4DK5 A;  2QHO A;  1WX9 A;  3DVN V;  5E6O A;  2CJO A;  2IPK D;  2C7N B;  1C3T A;  1TTN A;  2BF8 B;  1DYQ A;  3R2I A;  3VTV A;  4LNK A;  3ZJT A;  2WS3 B;  4A3O A;  3U4E G;  4MT5 A;  1FMA D;  2EKE C;  1WWT A;  3IAS 1;  5E6N A;  3GE8 C;  3ZJU A;  3AEE B;  4KV2 A;  1X1M A;  3TBL D;  3HM3 A;  1AAR A;  1JWU D;  1PGX A;  4KKJ A;  2KAN A;  3JVZ X;  2LHD A;  4MJS B;  1P7F A;  4YWG G;  1WMH A;  1PFD A;  2K39 A;  3Q3O C;  2M1M A;  5AZG A;  2CU3 A;  3BWU D;  2GBN A;  2FCN A;  1ESF A;  4J3O D;  2RPV A;  1T3Q A;  2JZ3 B;  2BYT A;  1OGW A;  2V4I B;  4DBG A;  3A4R A;  5AUK A;  1IYF A;  2QIL A;  2WXJ A;  4GLS C;  2K1F A;  2KJH B;  2OJR A;  5L83 A;  2KJR A;  4K81 A;  1WXV A;  2FUH B;  3QIJ A;  2CR5 A;  1F9J A;  3IVF A;  3NZS A;  2V9H A;  3H7P B;  1RYJ A;  3CMM B;  5DPS A;  2GRI A;  2OED A;  1JML A;  3AE4 B;  3RNE C;  2ZVN A;  1JWS D;  1WX8 A;  2DHZ A;  2GOW A;  1GC6 A;  4IM0 A;  1G6J A;  4MGZ E;  3Q69 A;  5D7G A;  3L13 A;  1ZP0 B;  2KFJ A;  1GJZ A;  5DPW A;  3RI7 C;  1KFY B;  4AUQ C;  3P1M A;  4IWO A;  3UF8 A;  3TL5 A;  4XGA B;  2BTE A;  4IWQ A;  2MJD A;  3EEC A;  4LDT D;  2L83 A;  2YEP B;  4HK2 A;  1HZ6 A;  1ACC A;  2L76 A;  2LGY A;  3OAW A;  5I4D A;  3UIN B;  4XDC A;  5LXI B;  1NDD A;  2HDE A;  1D4B A;  1A70 A;  3NG0 A;  2AL6 A;  1WMH B;  1HZ5 A;  1YQ4 B;  4GU2 A;  3HM6 X;  1JCK B;  4D2K A;  4ACF A;  5CHV C;  5E6J A;  3EGR A;  2D10 A;  4HPP A;  2G4D B;  4ZRJ A;  2O6V D;  3RNA C;  2PW9 A;  2PE6 B;  5KHQ A;  4W9G A;  2RDH A;  3DDC B;  4FHJ A;  1NYR A;  4B6W A;  5AZH A;  1L5P A;  1HA5 A;  3RCZ A;  3ZW3 A;  1KLV A;  2KNB A;  2MBQ A;  2R61 A;  4P7I A;  3Q8E A;  4W9I A;  3MHS D;  3AEF B;  2EEL A;  2K25 A;  2BWE S;  1IGD A;  1UWM A;  1YIW A;  3MP9 A;  2HJ1 A;  4FXC A;  1JQ4 A;  1FFV A;  2V3P A;  1N6Z A;  1ZW7 A;  2GLS A;  4DHJ D;  3KYD D;  1H4R A;  1YQ3 B;  1KLG D;  3QCA A;  4HXD A;  5CX3 A;  3TEW A;  4IC7 B;  3QAR A;  1T0Y A;  1K8R B;  4FJY A;  4MH8 A;  1WZ3 A;  4G3X B;  4NJ6 A;  5FR6 A;  1Q10 A;  4C7Y A;  3AU4 A;  2G1E A;  4AP4 C;  2NTT A;  1GC7 A;  4FAD A;  3VXW A;  3ML8 A;  1VJK A;  4IW0 A;  3TUO A;  3FIL A;  3ALB A;  2AQ2 B;  1J7A A;  1E6E B;  1L0V B;  2KZR A;  4OVV A;  1OQQ A;  4PYU A;  2LAS A;  4MGY E;  3SU8 X;  3L16 A;  1TGZ B;  3KUZ A;  1TJE A;  2RDB C;  3B9J A;  1FD6 A;  1ZOY B;  4HLE A;  1ZDV A;  1BML C;  3RUI B;  2XN9 C;  2BB6 A;  1V1O A;  4PYZ A;  3X23 A;  5D94 A;  1P9D U;  2KWC A;  1SBB B;  2MA9 B;  3X0W A;  4EE2 A;  3ZNG C;  2DAJ A; 
#chains in the Genus database with same CATH homology
 5BYR A;  4MAC A;  1IBX B;  4H2A A;  3AH7 A;  1TZO A;  2J53 A;  2XNA C;  5G5H A;  4DQO C;  1SF0 A;  4YTP B;  4A55 A;  1YMH E;  1N61 A;  2TSS A;  3P4Q B;  1SSN A;  3PZ7 A;  2WLB A;  1N63 A;  1SE2 A;  4US8 A;  5EE1 A;  2N0S B;  2QIE B;  1FCL A;  4LTU A;  1JW9 D;  3ZGZ A;  2V3N A;  3ZQ4 A;  5EE0 A;  4N58 A;  1PDX A;  1OQR A;  2BS4 B;  2Z8L A;  3WCQ A;  4A6Q A;  1L4D B;  3I9V 1;  3U7Z A;  3VR9 B;  1VZ7 A;  1YN5 A;  1T6B X;  1VRA B;  1WSP A;  2OHF A;  2DYO A;  3HRD D;  2V0G A;  4KGT A;  3RPF C;  5T8I A;  2G9H D;  1XCQ L;  1ZDX A;  3GS2 A;  3H8H A;  1ZPS A;  4RFB A;  1ZE3 D;  2X38 A;  3AMZ A;  3O13 A;  3Q8A A;  1GAQ B;  3MFG A;  2M19 A;  3FC4 A;  1ZXI A;  2BS2 B;  2KAC A;  4XE0 A;  5H8Y E;  3AE2 B;  1PGA A;  3W5V B;  3LB8 C;  3R8B A;  2LGI A;  2J4X A;  1F2R C;  3AEC B;  4KGS A;  1C9F A;  2E6X A;  1JWB D;  5FK9 C;  3FIL B;  4YSY B;  5C2T B;  1TKY A;  2WU2 B;  2D5G A;  3NVV A;  2ZW0 A;  1K51 A;  1NVI D;  4AQ7 A;  3U52 E;  5MPO A;  4YSX B;  5BMH A;  1FNW A;  5HHD G;  1B9R A;  1CZP A;  1WRI A;  5EE3 A;  1NI3 A;  2N9K A;  1V1P B;  1UNS A;  2KAJ A;  3B2G A;  2I2Y A;  2YEP F;  2J52 A;  4HKQ A;  2DLB A;  3Q8B A;  2FBW B;  2M56 B;  1KLU D;  1QIL A;  2WDQ B;  2H88 B;  2WNM A;  3FAH A;  4HRO A;  4O1N A;  4L2Y A;  4KGR A;  1L6V A;  2WDR B;  1GB1 A;  1FRR A;  4YTM B;  1VZ8 A;  3BVZ A;  3SR6 A;  5D3I B;  1DOY A;  1N60 A;  3BVG A;  1PUT A;  3PO0 A;  1MVK A;  1XO3 A;  5D3D A;  3P4R B;  4A9A A;  2Y3A A;  3LYY A;  2ON8 A;  2WQY B;  2L52 A;  3KWL A;  2WXM A;  4AS1 A;  2JX5 A;  3NVZ A;  3T3O A;  1YJJ A;  1QOB A;  3BYY B;  2QJL A;  2PLP A;  1XLN A;  3VR8 B;  1MPE A;  3W9C B;  1QOA A;  1YNT E;  1SXT A;  2VZK B;  3IXS A;  1ZXH A;  3E56 A;  2K5P A;  1TY0 A;  1QOG A;  1VZ6 A;  1EWC A;  4OZB A;  2LHE A;  3ETR A;  1TKG A;  2MJE A;  2E3T A;  3MJ5 A;  3CIR B;  3CWI A;  3R2T A;  4XDD A;  3AV8 A;  5BYQ A;  1ET9 A;  1EU3 A;  1TS5 A;  3KLS X;  1FIQ A;  1QT9 A;  1AYF A;  3AED B;  4GDK B;  1EWY C;  2AX5 A;  3AB5 A;  1HEZ E;  3EUB 2;  4OW0 A;  1QLB B;  3HUI A;  1SE4 A;  1BUI C;  4REZ A;  1TS2 A;  2W3S A;  2N7J A;  3OWE B;  1KH0 A;  4RNA A;  3J9C A;  4TMA B;  1DOX A;  2JYE A;  4IKG A;  3PZ8 A;  1I4H A;  1FM0 D;  2I38 A;  3GB1 A;  1EU4 A;  2K0P A;  2ZW1 A;  5TSS A;  2GI9 A;  3AEG B;  4IDI A;  1OFF A;  4RGN A;  4A90 A;  2JYT A;  4OZC A;  3AE9 B;  1L4Z B;  1FNV A;  5LNK 1;  4LK0 M;  1E10 A;  4ITK A;  1CJE A;  2AQ3 B;  4ZHP A;  1FFU A;  1FEH A;  3ZJV A;  2JZP A;  1T5X D;  2IGD A;  1I4Q A;  2J42 A;  3IT6 B;  5C3J B;  1TYG B;  2IJ0 A;  4USA A;  2PVO D;  3VQI A;  2MH7 A;  4NZL B;  3V3X A;  2PIA A;  3LXF A;  4B0E A;  1WYG A;  1HXY D;  4C80 A;  2WXK A;  3KWV A;  1I4R A;  1N5W A;  4HJG E;  4WIP A;  1HQR D;  3TEZ A;  1EM7 A;  1GOZ A;  5HI1 A;  4MM3 B;  1WXQ A;  1R7S A;  2WXF A;  1QF6 A;  1K52 A;  2CJO A;  2IPK D;  5JXV A;  4XWW A;  4TQ1 A;  3P4P B;  1DYQ A;  4RGM A;  3R2I A;  2HTM E;  2NMQ A;  3ZJT A;  1SB3 C;  2WS3 B;  4JWS C;  1CQV A;  3U4E G;  1I7H A;  4MT5 A;  1FRD A;  2SAK A;  1RM6 C;  1FMA D;  2JXT A;  1BXT A;  1ET6 A;  2Y5P A;  1WWT A;  3IAS 1;  2W55 A;  1C77 A;  4HRS A;  1KRH A;  3AEB B;  3AEE B;  1RFK A;  3P4S B;  4L23 A;  3ZJU A;  3TEY A;  4RF0 A;  1AN8 A;  1QQR A;  1MHH E;  5H92 C;  3HVD A;  1JWU D;  2K22 A;  1B1Z A;  1PGX A;  2KWD A;  1JWA D;  1XLO A;  4KKJ A;  2PMV A;  3DWG C;  4P6V F;  2LHD A;  1P7F A;  2W3R A;  4YWG G;  4GDL B;  4NAW B;  1SIJ A;  1K53 A;  2B76 B;  1N62 A;  5HFY A;  1CK1 A;  1F0Z A;  1FXI A;  1PFD A;  2INN E;  2INP E;  3EA6 A;  4CQN A;  1QOF A;  3NS1 A;  2Y5C A;  3MC0 B;  2CU3 A;  3BWU D;  1E0Z A;  1AWD A;  4J3O D;  1ESF A;  2BB5 A;  3AEA B;  4ZRP A;  2IGH A;  2ONQ A;  2W54 A;  2RPV A;  1T3Q A;  1TY2 A;  4C56 C;  2BT6 A;  2BYT A;  1PGB A;  2KQ4 X;  1RWS A;  3V05 A;  1UWX A;  4WAF A;  2K9X A;  1F77 A;  2V4I B;  3BYT B;  5AUK A;  1V8C A;  2QIL A;  2WXJ A;  4JWU C;  3U2S C;  4GLS C;  4HEA 1;  1D5Z C;  4KX6 B;  2WXG A;  1N5X A;  3W2D A;  3E9S A;  4Q2J A;  2JSV X;  2LJI A;  4TSS A;  3VRB B;  1XEE A;  3B2F A;  3NVY A;  4RH6 A;  1SE3 A;  1XXG A;  2WP9 B;  1RYJ A;  2MJ3 A;  1WGK A;  2GRI A;  1JWM D;  3BK2 A;  3BK1 A;  3IT4 B;  1D5M C;  4KKI A;  3KQ4 A;  4XWT A;  1C76 A;  2KN4 A;  2OED A;  1JML A;  3HVZ A;  1NEK B;  3BII D;  3AE4 B;  3TEX A;  1JWS D;  4R3D A;  1I4X A;  2RMM A;  5BMI A;  3W1S A;  3UI3 A;  2JQR B;  3Q69 A;  5D7G A;  1E9M A;  3NVW A;  2WXQ A;  1ZP0 B;  1XF5 L;  3MHZ A;  1IGC A;  3AM9 A;  4ZOH C;  3AN1 A;  1DGJ A;  2KMM A;  1D5X C;  2AQ1 B;  4C7Z A;  1FCC C;  3AE8 B;  1FXA A;  4YT0 B;  1KFY B;  3BZD B;  4OZA A;  4RGO S;  3P1M A;  2WDV B;  4WWM A;  2QEJ C;  2PKO A;  2K3U A;  1TS4 A;  1GPX A;  1MHX A;  2QSD A;  4UDU C;  2N9L A;  2BTE A;  2MJD A;  3IAM 1;  4YSZ B;  1PYW D;  1JAL A;  2WXO A;  3C8Y A;  1ROE A;  3NRZ A;  3W5U B;  2H89 B;  2L83 A;  2YEP B;  4NJC A;  1HZ6 A;  1ACC A;  2ICI A;  4WQM A;  5I4D A;  4M0W A;  1KTK A;  2WU5 B;  4XDC A;  2HDE A;  1XLQ A;  2GB1 A;  1I4P A;  2DWQ A;  1ENF A;  1D4B A;  2JU6 X;  1A70 A;  4YXD B;  1C78 A;  2QMT A;  1HZ5 A;  1F2R I;  1YQ4 B;  3SEB A;  4OHJ A;  3DWM A;  2SEB D;  1JCK B;  3P63 A;  4D2K A;  2DYM A;  1E7P B;  1TS3 A;  5E6J A;  1KF6 B;  3EGR A;  3SFD B;  1L6U A;  1YN4 A;  3URY A;  2PW9 A;  1J7B A;  1ZUD 2;  1MI0 A;  2RDH A;  2CJN A;  5BMG A;  5GXG B;  5FR3 A;  3NZ3 A;  4WH4 A;  1NYR A;  1QKZ A;  3N9Y C;  2LMC A;  1GB4 A;  1FO4 A;  1L5P A;  3BVM A;  3GP7 A;  1HA5 A;  2L1A A;  4DXF A;  5AUI A;  2WXI A;  5G5G A;  4ARI A;  1XLP A;  3Q8C A;  4TQ0 A;  2W82 A;  2BBC A;  1Y56 A;  3I57 A;  2R61 A;  1VR9 A;  2RDG A;  3Q8E A;  2LFI A;  3NUH B;  3AEF B;  1IBX A;  4DXG A;  2WXP A;  1NEN B;  2Q5W D;  2EEL A;  4YTN B;  1IGD A;  4HKZ E;  1UWM A;  4RF1 A;  3MP9 A;  1D6E C;  1J7C A;  1V97 A;  4US9 A;  1SEB D;  1DOI A;  1L0X B;  2VZK D;  4NAM A;  1YN3 A;  4FXC A;  1JQ4 A;  2NTS A;  1FFV A;  2M0A A;  2V3P A;  1I4G A;  4JPS A;  3AE5 B;  1L0Y B;  2JWU A;  3ABV B;  2WXH A;  3AE7 B;  3Q8F A;  2BW2 A;  1YQ3 B;  2FE8 A;  1KLG D;  2PVG C;  5EE9 A;  1IUE A;  4RCO A;  2L32 A;  5HG2 A;  5BYS A;  4ZHO A;  3AE6 B;  3TEW A;  1C79 A;  4B0M A;  1UGJ A;  2PTL A;  4RGT A;  4MH8 A;  2BS3 B;  1C4A A;  1M4V A;  1Q10 A;  4C7Y A;  1UUP A;  3TSS A;  1C4P A;  2WXR A;  2G1E A;  5FKA C;  2NTT A;  1SJE D;  3L4P A;  1FNU A;  2WXL A;  1JRO A;  4JE3 B;  4IOI E;  1VJK A;  2LEK A;  3TUO A;  3SFE B;  3FIL A;  2EKI A;  3AE1 B;  2IDY A;  1NYQ A;  4L1B A;  1XCT L;  4N6E B;  1STE A;  2AQ2 B;  2FUG 1;  1J7A A;  1E6E B;  1L0V B;  1AW7 A;  2ACZ B;  1OQQ A;  1V1P A;  2DBY A;  3P42 A;  1TJE A;  2IGG A;  3B9J A;  2WXN A;  1FD6 A;  4P16 A;  1TKE A;  4WUR A;  1ZOY B;  4OVZ A;  3ZYY X;  1ZDV A;  1BML C;  4N59 A;  1VDV A;  4ZRQ A;  2MEK A;  2XN9 C;  1K50 A;  3RFZ B;  1P7E A;  1VLB A;  2BB6 A;  3AE3 B;  1V1O A;  3T3N A;  1LO5 D;  4JX1 C;  4PT5 A;  4A8X C;  3VRA B;  1YJI A;  1SBB B;  4LLG M;  4ZYS A;  1C4C A;  2LUM A;  4EE2 A;  2KDM A;  4ARC A;  1JRP A;  1SJH D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...