3P63A

Structure of m. laminosus ferredoxin with a shorter l1,2 loop
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
ATYKVTLINPTGNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKEEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin
publication title Allostery in the ferredoxin protein motif does not involve a conformational switch.
pubmed doi rcsb
source organism Mastigocladus laminosus
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3p63A00
3HUIA 2WU2B 3AE8B 1NVID 1PFDA 2BT6A 1YQ3B 3VRBB 1XLNA 1PDXA 1OFFA 1L0VB 1XLQA 2PVOD 5C2TB 1JALA 5MPOA 2MJDA 2PVGC 1R7SA 1CZPA 2QJLA 3P4QB 1TKYA 2WDRB 1JW9D 1VJKA 3ABVB 2ACZB 2BS4B 1SF0A 3KWLA 3W9CB 1ZXIA 3AM9A 1TKEA 1XLPA 4JX1C 1F0ZA 4A9AA 2OHFA 5G5GA 3WCQA 2B76B 2WP9B 1FMAD 3AN1A 3L4PA 3HRDD 3VR9B 1FFVA 1FRDA 1PUTA 1JWAD 5EE9A 1VDVA 3AECB 1NYQA 1OQRA 2KMMA 1OQQA 1N60A 1QOAA 1ZOYB 1YJJA 3NVYA 4C7YA 4WQMA 1AYFA 3AMZA 2W3SA 1ROEA 1NENB 4US8A 1DOYA 3AE4B 3AEDB 1QT9A 4IDIA 3AE1B 2WU5B 2CU3A 1E0ZA 3AE9B 3ETRA 5EE1A 1B9RA 2PIAA 4ZHOA 1E10A 2JQRB 1N5WA 1GAQB 1QLBB 1FFUA 2N0SB 3AE6B 2M19A 2M56B 1TJEA 3AE5B 3CIRB 5EE0A 1SB3C 1FO4A 4JWSC 1QOBA 1XLOA 4HRSA 4USAA 4JWUC 1KFYB 3AEEB 2BS2B 2JX5A 1A70A 1RWSA 4FXCA 3DWMA 1WXQA 3W5VB 4ZHPA 3AEAB 3AH7A 3AEGB 5GXGB 1EWYC 4YTMB 4ITKA 2LEKA 1DOIA 3B9JA 4YSYB 3SFEB 4P6VF 2E3TA 1L6VA 1IUEA 1N61A 1N62A 4N6EB 1DGJA 5EE3A 3VR8B 1AWDA 3AE2B 3LXFA 1I7HA 3RPFC 2K9XA 1V8CA 4YTNB 2FBWB 3PO0A 2Q5WD 4KX6B 2EKIA 1UWMA 3P4PB 1QOFA 1QOGA 2K5PA 2L83A 1FXAA 2W54A 3NS1A 2WQYB 3FC4A 4N58A 2KAJA 1FXIA 3NVZA 1E7PB 1WWTA 2QIEB 2W3RA 4HROA 3SFDB 1DOXA 1JQ4A 1L5PA 2W55A 2MH7A 1RM6C 1RYJA 1T3QA 1ZUD2 2AX5A 2CJOA 2H89B 5C3JB 2L52A 4ZOHC 1YQ4B 1J7AA 1J7CA 1NEKB 1FIQA 3DWGC 2PKOA 1QF6A 4YTPB 5AUIA 3NVVA 1WGKA 3ZYYX 1L6UA 5H8YE 1RFKA 1WRIA 2MJ3A 3B2GA 2WDVB 4LTUA 3AB5A 4C7ZA 1KRHA 4N59A 1NYRA 1JWBD 1XO3A 1JRPA 3EUB2 1NI3A 2MJEA 1TYGB 2G1EA 4YT0B 1V97A 1KF6B 3NVWA 3W5UB 1E9MA 1ZP0B 4YSZB 2CJNA 2Y5CA 4C80A 3AEFB 1N5XA 3P63A 1VLBA 1GPXA 3P1MA 3B2FA 3HVZA 3AE7B 1JROA 3CWIA 3FAHA 3VRAB 2DWQA 4WWMA 3P4SB 2DBYA 1SIJA 1CJEA 1TKGA 2BS3B 2HTME 3AV8A 1N63A 2K22A 3AEBB 1E6EB 1WYGA 4YSXB 2WLBA 3P4RB 3SR6A 4US9A 1YJIA 5AUKA 2H88B 2WDQB 5H92C 5G5HA 1J7BA 1FRRA 2WS3B 3LB8C 4YXDB 3BIID 3AE3B 3NRZA 1FM0D
chains in the Genus database with same CATH superfamily
3DBRB 3FILA 3Q8CA 5GMVA 3TUOA 2L05A 2LZ6A 3R66C 4RGNA 3L17A 1CK1A 1Q5WB 3VHTC 3ZUNA 2IYDB 2KK8A 3O13A 3NJTA 3RNEC 1WX8A 4PYZA 2ACZB 1RAXA 4OVZA 1SF0A 4RCOA 5L83A 5BYSA 4HEA1 2ZCBA 1R4NI 3A9JB 3HRDD 2J0MA 1FRDA 5HKHA 1YOVB 2KMMA 1IGCA 2D11A 2N9EB 2E6XA 3AE1B 3JYUA 2WU5B 1YNTE 4NJ6A 2EMTA 2LVOA 2GBRA 1WGDA 5HG2A 4HDQA 1YN3A 2J53A 2FUG1 4HVBA 3X23A 4NQKE 1DOIA 2IO2B 1JCKB 2K8HA 1ESFA 2KDEB 2D3BA 3HM3A 3VH4B 1ACCA 3K9PB 2KACA 2ZPYA 3RPFC 1N6ZA 2L83A 4GDLB 1C4PA 2KMCA 2I1KA 2OJWA 2O6VB 2NPTA 4II3B 3DQVA 2KX0A 4LJOB 2KDIA 4ZRJA 4C7ZA 2IJ0A 2QSDA 4ZDVA 1FPYA 4DQOC 3H7PA 4ZRQA 3UQAA 1JWUD 4KV2A 4ICUA 1JROA 3RNAC 5TR5A 3P4SB 2CR5A 3Q14C 2LGYA 2C9WB 1WYGA 3TBLD 2MLBA 3M63B 2BVCA 3BK2A 3MC9A 1YJIA 4W9IA 4TQ1A 3MJ5A 3DVNU 3LB8C 3K9OB 3BIID 3AE3B 1VCBA 1EF5A 1ZKHA 2BT6A 4IUMB 3ZRCA 2KFJA 1L0VB 5MPOA 4J3OD 1J19A 1V1OA 5IOIA 2INNE 3KYDD 3QCAA 1XLPA 4GLSC 2IO0B 1V5OA 1E8ZA 4GGQA 3ZJUA 2VH1A 2HTHA 2ICIA 3E56A 2RDHA 5BMIA 3U52E 4KGTA 1MJDA 2BW2A 4CO7A 5IP4D 2O2VA 4XDCA 3N1XC 3PS6A 1QOBA 2INDC 4KIKB 1N61A 3APFA 3AE2B 4NNJB 3ONSA 1BUIC 1GJZA 2KHWB 3VFKA 1WWTA 4D2KA 2DZIA 2QEJC 1RYJA 5AZGA 1I4HA 2JZPA 1J7CA 2AQ1B 2K39A 1A5RA 4A20A 5J17A 1WR6E 3PV1A 2Z8LA 1KF6B 2XN9C 2ZNVC 2BF8B 2MQJA 4FJZA 5D94A 5JHAA 2LJ5A 5C1ZA 1CJEA 2HTME 2BS3B 3BWUD 4IG7B 1UWXA 2GBMA 5E6NA 2WDQB 5JZEB 5JH5C 4K3BA 4KVGB 3FILB 3NRZA 3DCGA 3OG5A 1H8CA 2INPE 2J0KA 2MBQA 3HIZA 1P3QU 3H9DA 3MP9A 2RSUA 3WANA 2XEWA 1WM2A 2M1MA 4I6PA 4MDKE 2W82A 1FMAD 2G3QB 1BMLC 1NYQA 1C1YB 1HEZE 2WWZA 4OVVA 4B0MA 3AEDB 3I3TB 2XBBC 4G50A 2RDBC 1EUVB 2NTTA 5EE1A 1GUAB 4ZHOA 1ET6A 2KNBA 2L0FA 3ZNZB 4M8NA 4ANUA 3VH3B 1Q0WB 4ZRKA 1UGJA 2W9NA 2KO3A 2RPVA 4YTMB 4K7WA 2LEKA 2KKCA 2LGSA 3GP7A 4N6EB 2V4LA 2ASQA 1AWDA 1I7HA 1OGWA 2N9PC 3U7ZA 1TS5A 2WQYB 3TMPB 2C7NB 4B0EA 2KVRA 1HZ5A 3SHQA 1ZGUB 3KUCB 2WXIA 4YTPB 5CHVC 3ZYYX 1WY8A 1LQBA 1NYRA 2AEHA 2X8XX 3GS2A 5FR3A 3H7PB 4O1NA 1WXVA 4KGRA 3AEFB 1UUPA 4JGHB 2KLGA 4W9GA 3KUZA 1KJTA 4YSXB 2KQ7A 1E8XA 4URKA 2LD9A 3QK0A 4NJCA 2LUMA 4LLGM 1FM0D 4K7UA 2PW9A 3URYA 1NVID 1Q1OA 3V62A 1YQ3B 1WJUA 4EE2A 2UYZB 3H6NA 2I38A 3V05A 4F7ZA 4ICVA 3ABVB 1ZDVA 2KC1A 2IBIB 2WXPA 4KGSA 3C0RB 5G5GA 2G45B 5JHBA 5BMGA 1AN8A 3CSFA 2WXHA 2N7EA 2LGXA 2UWQA 1TIFA 2PIAA 2O2VB 4FULA 3CIRB 1P1AA 3ZDMC 3BVZA 5HFYA 1FNWA 4A6QA 2WYQA 4HRSA 3KLSX 4W9DA 3U7DA 1RWSA 4MM3A 3PZ8A 2BTEA 4MH8A 2IO3B 3OWEB 1C4CA 2MBEA 4ITKA 3SFEB 5LXHA 1E7VA 1FNUA 3X0WA 4LNIA 3PSEB 2N7JA 3P4PB 4R3DA 1UNSA 3WA0A 1E7PB 1WH3A 2W3RA 1SE3A 2TSSA 2NMQA 4FADA 2L52A 2WXJA 2IO1B 2PKOA 3JVZX 1WGKA 2Y3AA 4KKIA 3EUB2 1E5WA 4DHZB 3B08A 3ZNGC 3CMMB 5HI1A 2HDEA 3W1SA 2J4XA 3B2FA 1I4QA 1QZEA 1SSNA 2K3UA 1SIJA 3RI7C 1E6EB 3RFZB 1MPEA 4JL9A 3WAPA 4H2AA 4US9A 1OEYJ 4ANWA 1L2NA 1ZE3D 2IPKD 3JW0X 2WU2B 5G2NA 2CS4A 1XLNA 1OFFA 2MJDA 1L4ZB 2QJLA 2Y5BB 1TS3A 3N1ZC 1YIWA 3I63C 4FHKA 1ZW7A 4ZYSA 4M8MA 1K8RB 4I6NB 2B76B 4IM2A 5EE9A 1GOZA 3C19A 1V2YA 2UU7A 4PS8A 4TMAB 3AMZA 3BY4B 4GDKA 4WJQA 2FUHB 3I57A 4DHZE 1TBEA 1E10A 1MHXA 4WJOA 3DHIC 4M0WA 2QDFA 4BFRA 2C7HA 2DZMA 3RN9C 4USAA 2BS2B 4W9JA 1WXQA 3AEGB 3Q6BA 2DLBA 2AYOB 3GZNB 3OLMD 2SEBD 4IOIE 1WIAA 3R7QA 3ZJTA 3DBLI 2JT4B 2KXJA 2DYOA 3QWZB 4PS3A 1TS4A 2QIEB 1DOXA 1JMLA 3WIMA 3EC8A 2KANA 4OZBA 5E6JA 3PVLA 3NVVA 4P16A 4JE3B 1C79A 2MJ3A 3EA6A 3IAM1 4LTUA 3T9LA 1E7UA 3ZTDA 4G3XB 3W5UB 2CJNA 4A8XC 1N5XA 2NR2A 2ON8A 1WX9A 3HM6X 4M02A 4TV3A 2CKHB 4ASWC 4LK0M 2IZVB 2KQ4X 3DBHB 5AUKA 2INCC 3DVGY 4W9EA 3ZTCA 3Q3OC 2EKEC 3KYCD 3HUIA 4W9HA 3TSSA 2J0JA 3AE8B 3O65B 2PPHA 5BYQA 2I1JA 2PVOD 4GXBA 1JALA 1XF5L 2LXAA 1R4MB 4KDIC 4RNAA 1WE6A 4A9AA 2OHFA 1HXYD 1DYQA 2JYEA 2LMCA 4NY0A 1OQQA 5IKCM 1LGRA 1YMHE 3ZLZA 3HHMA 3U4EG 3WAOA 1UF0A 3QQ8B 1N5WA 1K50A 2M56B 1TJEA 1ZXHA 3DHGC 4P7IA 4JPSA 1KFYB 4FN2A 3RULA 1A70A 3IBEA 1HZ6A 1HTOA 3KW5B 2QHOA 2NBUA 4Q2JA 1L6VA 1C78A 3LYYA 5DPSA 2FBWB 1WR1A 1LM8B 3NS1A 2YLMA 1FXIA 2XK5B 3EGRA 3NVZA 3ZGZA 2LJIA 1EWCA 4ARCA 1UBIA 1HE8A 4GMVA 4NAMA 1WYWB 3B2GA 2RPQA 3N3KB 3KVFB 4N59A 3PRMB 3IT6B 1TYGB 4YSZB 1OTRB 3IT4B 1Y56A 2GB1A 2XNAC 3PZ7A 3GB1A 4BOZB 1EM7A 3VVWB 4L23A 1TKGA 4FJVB 3NY5A 3GE3C 3DVGX 4BZAA 2LRWA 5T8IA 2G9HD 4C00A 2KN4A 1F52A 2L3ZA 4L1BA 1Z2MA 1EU3A 2MBHA 2KN5A 2OEDA 3NOBA 1PGAA 3NHEB 2MCNB 4TQ0A 1TKEA 3A1QA 3N30A 5E6OA 2D2QA 2WP9B 2MA9B 1JWAD 3AECB 3LJ3A 4W9KA 3UIPB 1NENB 4IW0A 5D6JB 3V61A 3HVDA 3TCAA 5BMHA 1BT0A 1IBXA 1PGXA 1WFYA 1GC7A 2B3AA 1T0YA 1G6JA 1GAQB 3AE6B 4M0WB 5LXIB 4GOCA 4NPNA 4JWSC 3AEEB 3VUYA 3AH7A 3Q3FA 2KZRA 4YSYB 4IC7B 4NQLB 4FLHA 1YQBA 3TEYA 4KX6B 3VQIA 2K1FA 1QOGA 1IPGA 4G0NB 4EZKA 1VR9A 2KT7A 4MACA 2LUEA 1I4PA 2X38A 2KDMA 2C60A 2MP2A 4XYCA 2PMVA 1VZ8A 2IGHA 1I4GA 5IN7A 3NZSA 2Y5CA 3ZXVA 3JSVA 1WZ0A 2G4DB 1TTNA 3I5JC 3PLUA 4FA6A 4HPMB 3IXSA 1SIFA 3BVMA 4IKGA 4DDGD 2L32A 3C8YA 4MGZE 1PFDA 2MBOA 3KWVA 1NI2A 4A3OA 3KWLA 2DYBA 1F0ZA 1MG4A 3L10B 4EZLA 1OEYA 1R4NB 2GI9A 2W3SA 1HA5A 1T5XD 3HK0A 3GE8C 3OJ3A 3A4RA 1T0SC 5FKAC 3H1UA 3UI3A 2M0XA 4RH6A 3DVNV 4GN1A 3L54A 1TZOA 4AJYB 2FAZA 2JWUA 5GXGB 2JXTA 1LFDA 3FKYA 2ZJDA 2ZEQA 3VR8B 4REZA 1WXAA 3IHPC 5AZHA 1YJ1A 4HROA 2NS5A 2LHDA 2AL3A 1YQ4B 3DWGC 4CYEA 1FEHA 3DPDA 1L6UA 1KRHA 4YWGG 1JRPA 3H7SA 2MJEA 3ZVVA 4YT0B 1WRDB 3NVWA 2EELA 4C80A 3RT3B 3HVZA 4C4VA 4PS7A 3L16A 1MVKA 1NBFC 2RDGA 4HKZE 4PK1A 4MEMA 3ZKJC 4MT5A 2NBWB 2N9KA 2NPTB 1S3SG 3UQBA 2JPHA 3PHWB 2Z59B 2FNJB 4XDDA 5H8YE 2O6VD 4HWIB 4AQ7A 4OVUA 1PDXA 3R7RA 2FIFA 2K6DB 2BWES 1JW9D 1VJKA 3VUXA 2BYVE 4HPLB 3A1QB 3AM9A 5DPTA 4JX1C 2ONQA 3MHSD 1ISNA 2GRIA 3PT2B 3L4PA 2BPSA 3J9CA 2ZPNA 1RRBA 2K0PA 2LVQA 1N60A 4FHJA 2IDYA 4ANXA 4RF1A 1IBXB 3ZO5B 1BXTA 1WSPA 3MTNB 3U8ZA 1T6BX 2KFKA 5EE0A 2J52A 3ECIA 2ZNVB 1TZ1A 2JX5A 3A33B 2JRHA 4DXGA 3PTFC 1V6EA 4PYUA 4WWOA 5D3IB 3VTUA 1KLVA 2NCNA 3PO0A 1UD7A 2WXOA 1CQVA 5C3JB 2MH7A 2DX5B 1L7YA 2MP2B 1QF6A 4BBNF 4BVUC 1WGHA 2GBKA 3DHHC 4WQOB 1XEEA 1WRIA 2JZ3B 4XGAB 4KZ0A 1V9JA 2JXXA 3OAWA 4MSQB 3P2BA 1KOTA 1C3TA 1FCCC 3ML9A 2WXLA 2RMMA 3JSVB 3LDZE 1RLFA 2V3SA 3NZUA 4L2YA 3U30A 5L95C 2KTFA 1XXGA 2ZVNA 3BYYB 4E74A 3PGEA 4KDLB 1XT9B 3P4RB 2BB6A 3SR6A 3DBRI 2LHEA 2VZKD 2EMSA 3RCZA 1I4RA 2HD5B 2DHZA 2VH2A 1NDDA 3A4SC 5DPRA 2R2OA 2WX0A 1IGDA 3WCQA 1P7FA 2KVZA 1ENFA 4AP4C 2QILA 1VDVA 4NAWA 4AWJA 4C7YA 4US8A 2KJHB 1WI0A 4BKGA 1YN5A 3ETRA 3WAMA 2RR9A 3PRPB 2M19A 3RNGC 4B6WA 2PE6B 1SB3C 3CSTA 3Q8FA 1P0RA 4GSWA 2O6VA 4MSMB 2L1AA 4JLCA 4RFBA 4RGMA 4CHKA 1QKZA 2KC2A 2K9XA 4YTNB 1FNVA 3V6EB 1K51A 2D5GA 2KAJA 1WE7A 3W1YA 1D5MC 5FK9C 2H89B 2OJRA 1SE4A 2AL6A 5LLIA 3WALA 1F77A 2YVCA 4KSLC 1FXTB 4LJPB 1X1MA 4HCPB 2KJRA 4GIVA 4K3CA 4C4VB 1GPXA 2LASA 3P1MA 3ZQ4A 4EOYA 3FAHA 4KZCA 3RNBC 2N9LA 2K22A 3AEBB 2V3PA 2L76A 5BO4B 1Q10A 3Q2AC 2IY1B 4P1BC 5AEKB 2KWCA 4IWQA 1MI0A 1JWSD 2CU3A 2M8SA 3VXWA 2WGSA 3T8MA 3QX1A 3M3JA 2YEPF 1LO5D 2PVGC 3ENEA 1CZPA 2WDRB 3APCA 2KTRA 4WAAA 1FD6A 1MFWA 2PTLA 4KKJA 2MWSB 1GB4A 2YEPB 4HKQA 1YJJA 4HK2A 4RM9A 2ZVOA 2K8BA 1CMXB 3QAQA 3L08A 3EECA 4A90A 1SE2A 1VD2A 3AE9B 2D10A 1E90A 2KFKB 2IY0B 4MELA 5DPWA 2IGGA 1V80A 2M17A 3RYTA 4W9LA 2BGFA 4A55A 4OHJA 2L7RA 2GOWA 2K8CA 1SEBD 2N4FA 1WMHA 5EE3A 1DGJA 2D3GA 3LXFA 2WHIA 4S17A 3IVFA 5IA7A 2Q5WD 1YX6B 4XC2A 1TY0A 1OQYA 2LVPA 1WGGA 4AUQC 2JUOA 3SFDB 4G11A 1L0YB 1WJ4A 2AX5A 4HJKA 4ZOHC 4MM3B 3S2AA 4LDTD 1I42A 1WXMA 4II2B 2PEAA 4WH4A 2Z0DB 1JWMD 1SBBB 1PGBA 3OJ4B 2DWQA 3Q3NC 3AV8A 4K7SA 1EU4A 2N7DA 4PT5A 1FRRA 2WS3B 1P9DU 2DAJA 1PQSA 4LNOA 2N9XA 3IAS1 2HE7A 5JXVA 2D07B 1E8WA 5C2TB 3VUWA 4DHJD 1R7SA 3P4QB 1TKYA 2LI5A 5D2MB 1ZXIA 4P1CC 2VRRB 3SD5A 2WX1A 3ZW3A 4LCDE 1C9FA 3RD2A 3AULA 4NAWB 1FFVA 4A3PA 4RMAA 1K53A 1DOYA 1ROEA 1SJHD 4GU2A 1QT9A 4BKSD 3Q8BA 1UBQA 1E0ZA 4JIOU 3Q8AA 2MW5A 2KWVB 5CX3A 1QLBB 1FFUA 1J8CA 4ZRPA 1FO4A 3AE5B 5IAAC 3RMKC 2BWFA 3ZDTA 4EFOA 3TJPA 4AOFA 5DCNA 2AWTA 1U4AA 4M01A 4EKUA 1FCLA 4F1SA 3BK1A 4AJWA 4QAYA 4GDKB 1AW7A 2MSED 3QC8B 1S1QB 4AS1A 2K5PA 3PHXB 4OZCA 4ARIA 1C4AA 3Q3MC 4TKNA 2KWUB 4F8CB 2GMIC 3DBLB 2K25A 1AARA 1JQ4A 1TS2A 1WGYA 2IGDA 2NTSA 2FE8A 3PRZA 3AU5A 2DENB 4DXFA 5J2RA 4OW0A 2NBVB 2PJHA 4MGKE 1IYFA 2JY6A 2ZCCA 2QCZA 3MJWA 3P63A 4XWTA 3AI5A 5D3DA 3AE7B 1M94A 4HCNB 4WWMA 2WXGA 1D5XC 1P98A 3DOWA 2MBBB 2BB5A 2DNFA 5C23A 3P42A 2KOXA 1H4RA 1XCQL 2DZJA 2V1YA 3RNCC 4JQWC 4K1RB 3R3MA 3AXCA 5G55A 1ET9A 1F2RI 4XZ4A 3V3XA 2CHXA 1WZ3A 1YN4A 4S0RA 4ZRIA 2KTRB 3W9CB 2R61A 1IP9A 3DDCB 2JZZA 4RM8A 3NZ3A 2HJ1A 2JVCA 2WXQA 4LNKA 1Y8RC 5E6PA 1ZPSA 3DBSA 1XQQA 2SAKA 5HHDG 4RGOS 3QA8A 4XX5A 2JRIB 2J42A 2JQRB 2VZKB 1KLUD 3NUHB 2N0SB 2M0AA 3SDLC 1V81A 2ZZPB 4WURA 3PZDA 4JWUC 4FXCA 3DWMA 2C5LC 2KDBA 2M4NA 3UIOB 3KQ4A 1EWYC 1F2RC 1STEA 1V49A 2V9HA 1WMHB 2CU1A 3R2IA 5D7GA 2E3TA 1D4BA 2BKFA 5AZFA 1J0GA 5IO9A 4MGIE 2FCMA 1FXAA 4NJ7A 5KHOA 2MHJA 2KD0A 4BAXA 4N58A 4YL8A 2W55A 3E9SA 1T3QA 2JU6X 2CJOA 4E71A 1C77A 2FCSA 2LXCA 2RGFA 2BBCA 3MHZA 1JRUA 1YX5B 2LGDA 4BKSA 3AB5A 3UF8A 1GG3A 3T3OA 4EZJA 4ANVA 1LXDA 2HJ8A 4UDUC 3VRAB 2QMTA 2KQSA 3BINA 3ALBA 2DBYA 1ZDXA 4IWOA 1N63A 2CHZA 2L8JA 2WLBA 4BOSC 4WJPA 4BBNC 1VZ7A 2BYTA 1PYWD 1Z5SB 4WWNA 4NZLB 3VRBB 1WX7A 1KTKA 1WGRA 2Y5PA 1WJNA 2LGIA 2R2QA 4HJGE 4MJSA 2FIDA 2WXRA 1SGHA 3Q69A 2AQ3B 1WJ6A 4TUUA 3AN1A 3RUIB 4B95A 4IM0A 4W9FA 3N9YC 1QOAA 3NVYA 2WXFA 3EHVA 4OZAA 3AE4B 4MGYE 2G4SA 2KJ6A 2QC8A 2K6QA 1B9RA 2WXMA 3RZFA 4XWWA 3IG3A 3M95A 1TY2A 3H8HA 3GZNI 1XD3B 1WXSA 3AEAB 2DZKA 4BKTA 1EO6A 2JYTA 3B9JA 2WNMA 1MHHE 4P6VF 3TL5A 1EF1A 3N1YC 1K52A 3ZNHB 1V8CA 2BYEA 2L0TA 4HXDA 1QOFA 2V4IB 3MC0B 4WWPA 3APDA 4LNFA 1I35A 1ZUD2 4W9CA 3I9V1 4EUTA 1NEKB 1QQRA 3L0WB 5AUIA 1SXTA 4CQNA 3NS8A 3VAWA 2A5UA 2KMAA 5J18A 1NI3A 2G1EA 4RGTA 2D3CA 4DDID 2J7QB 1E9MA 3RNFC 3A9KA 5CHWA 5BYRA 3R2TA 3DBHI 3ML8A 3QIJA 4DK5A 3VTVA 2LRUA 3W2DA 2KDFB 3VDZA 4XE0A 1D6EC 3KUDB 1P7EA 1V1PA 2REXA 4HLEA 1D3ZA 5G5HA 4K81A 4YXDB 3ZRFA 2CHWA 2MX2A 2DAFA 1B1ZA 1GB1A 5FR6A 2ZW1A 1R4MI 2BQQA 1XLQA 2GBNA 1KH0A 3NG0A 3V60A 3RZWC 4FBJB 4HDOA 1WM3A 2L00B 4LDTB 2KYWA 4HPPA 3BZDB 1VZ6A 3A9JA 3EFUA 1PUTA 1F1HA 3VTWA 1V5TA 1OQRA 1ZOYB 4WJNA 1RFAA 1E8YA 1HQRD 2DYMA 3QARA 1D5ZC 2FCQA 4DBGA 2LWPA 2XK5A 1GC6A 3EFCA 1XLOA 2Z0EB 3W5VB 1YD8U 2D3AA 4IWPA 2JSVX 3MFGA 2C7MB 4DHJB 1F9JA 1IUEA 1N62A 2AQ2B 3PLVA 1HTQA 2N1VA 4ZYNA 4ACFA 1GNUA 1UWMA 3ZJVA 2ZW0A 4E3CA 4GDLA 1L0XB 3Q3JA 2KLCA 2WXNA 3M62B 1L5PA 3ZNID 2FCNA 2RD0A 4EEWA 1RFKA 3N20C 2KX3A 2WXKA 4IM3A 1JWBD 2LFIA 3B1LX 2NVUI 3V6CB 2KWDA 2I2YA 4WAFA 2GLSA 4DWFA 5I4DA 4B9KA 3BYTB 5LNK1 1KM7A 3BVGA 2JWZA 5EDSA 1M4VA 5CTRC 3N32A 2N1WA 3AU4A 3U2SC 3TEXA 1UH6A 4J6IA 5CHFA 1UELA 3QJZA 3PREA 1UZXB 4MJSB 1QILA 3UINB 2BS4B 3D32A 3W1SC 4KSKC 4MH0E 2PE9A 3VR9B 1I4XA 1XCTL 3TEZA 1VRAB 3ZIMA 4WQMA 4C56C 1AYFA 1V86A 4GB9A 4IDIA 3T3NA 2BKRB 3R8BA 5TSSA 1MG8A 4M00A 2A4ZA 2V3NA 3TEWA 3SU8X 4ZHPA 3B0AA 1SE9A 4KIKA 3QHTA 3MC8A 1WF9A 2PLPA 2WDTB 3GOEA 1SJED 2EKIA 3KH0A 2W54A 3FC4A 4I6LB 1TGZB 1RM6C 4TSSA 1J7AA 1FIQA 2V0GA 2GBJA 3SEBA 2WDVB 3TIXA 4WIPA 4FJYA 1XO3A 3PPAA 2JF5A 5KHQA 1V97A 3A9KB 3ZXRA 1ZP0B 4X57B 2OOBB 1VLBA 3CWIA 4LNNA 4N9F4 3L13A 1TT5B 4RF0A 3Q8EA 1KLGD 3UGBB 1L4DB 3IFWB 2MEKA 1UGMA 1V1PB 1T0QC 2BYFA 2H88B 1T0RC 3CF6E 4DXAB 5H92C 2MRPA 1J7BA 1C76A
chains in the Genus database with same CATH topology
3FILA 3Q8CA 2WU2B 3TUOA 4AQ7A 1ET9A 1F2RI 1XLNA 3V3XA 4RGNA 1CK1A 1PDXA 1OFFA 1YN4A 2MJDA 1L4ZB 2QJLA 1TS3A 3O13A 1JW9D 1VJKA 2ACZB 4OVZA 1SF0A 4RCOA 3W9CB 2R61A 3AM9A 5BYSA 4JX1C 4HEA1 4ZYSA 2ONQA 3NZ3A 2GRIA 2B76B 3L4PA 3J9CA 3HRDD 1FRDA 5EE9A 1GOZA 2WXQA 2K0PA 2KMMA 1N60A 1IGCA 4TMAB 3AMZA 1ZPSA 2IDYA 2E6XA 3AE1B 2WU5B 4RF1A 1IBXB 1YNTE 1BXTA 1WSPA 2SAKA 1T6BX 3I57A 5HHDG 4RGOS 2J42A 2JQRB 2VZKB 1KLUD 3NUHB 1E10A 1MHXA 2N0SB 2M0AA 4WURA 5EE0A 2J52A 4M0WA 5HG2A 4USAA 4JWUC 2BS2B 2JX5A 1YN3A 4FXCA 3DWMA 1WXQA 2J53A 2FUG1 3AEGB 3KQ4A 1EWYC 4DXGA 1F2RC 1STEA 2DLBA 3R2IA 1DOIA 5D7GA 1JCKB 1ESFA 2E3TA 5D3IB 1ACCA 1D4BA 2SEBD 4IOIE 2KACA 3ZJTA 3RPFC 3PO0A 2DYOA 2L83A 4GDLB 1FXAA 1C4PA 2WXOA 4N58A 1TS4A 1CQVA 2QIEB 1DOXA 2W55A 2MH7A 1T3QA 1JMLA 2JU6X 2CJOA 3E9SA 5C3JB 1C77A 2BBCA 3MHZA 4OZBA 5E6JA 1QF6A 3NVVA 4P16A 4JE3B 1C79A 1XEEA 1WRIA 2MJ3A 3EA6A 3AB5A 3IAM1 4LTUA 4C7ZA 2IJ0A 1FCCC 2QSDA 3W5UB 4DQOC 2CJNA 4ZRQA 4A8XC 3T3OA 2WXLA 1JWUD 1N5XA 2RMMA 4UDUC 1JROA 3VRAB 2ON8A 2QMTA 3P4SB 4L2YA 2DBYA 1ZDXA 1XXGA 1N63A 1WYGA 3BYYB 2WLBA 3P4RB 2BB6A 3BK2A 3SR6A 1YJIA 2LHEA 4LK0M 2KQ4X 4TQ1A 2VZKD 5AUKA 3MJ5A 1VZ7A 3LB8C 2BYTA 3BIID 1PYWD 1I4RA 3AE3B 3HUIA 3TSSA 3AE8B 2BT6A 4NZLB 3VRBB 1KTKA 5BYQA 1L0VB 2PVOD 2Y5PA 5MPOA 1JALA 2LGIA 4J3OD 4HJGE 1V1OA 1XF5L 2INNE 1IGDA 2WXRA 1XLPA 4RNAA 3Q69A 4A9AA 4GLSC 2OHFA 1HXYD 1DYQA 2AQ3B 3WCQA 1P7FA 3AN1A 1ENFA 2JYEA 3ZJUA 2QILA 2LMCA 1VDVA 1OQQA 2ICIA 1QOAA 3E56A 3N9YC 3NVYA 2RDHA 2WXFA 4C7YA 4US8A 5BMIA 4OZAA 1YMHE 3AE4B 3U52E 4KGTA 1YN5A 2BW2A 1B9RA 2WXMA 3ETRA 4XWWA 3U4EG 1TY2A 1N5WA 1K50A 2M19A 2M56B 1TJEA 1ZXHA 3H8HA 1SB3C 4XDCA 1QOBA 3Q8FA 4JPSA 1KFYB 1A70A 2L1AA 3AEAB 1HZ6A 2JYTA 4RFBA 4RGMA 1QKZA 3B9JA 4Q2JA 2WNMA 1MHHE 4P6VF 1L6VA 1N61A 1C78A 3AE2B 3LYYA 1K52A 2K9XA 1V8CA 4YTNB 2FBWB 1FNVA 1QOFA 1K51A 1BUIC 3NS1A 2D5GA 2V4IB 2KAJA 1FXIA 3EGRA 3MC0B 3NVZA 1D5MC 1WWTA 5FK9C 4D2KA 3ZGZA 2QEJC 1RYJA 1ZUD2 1I4HA 2H89B 2JZPA 2LJIA 3I9V1 1EWCA 4ARCA 1J7CA 1NEKB 1QQRA 1SE4A 2AQ1B 5AUIA 4NAMA 1SXTA 1F77A 3B2GA 4CQNA 4N59A 3IT6B 1NI3A 1TYGB 2G1EA 2Z8LA 4RGTA 1KF6B 2XN9C 1E9MA 4YSZB 1GPXA 3IT4B 3P1MA 1Y56A 2GB1A 3ZQ4A 2XNAC 3FAHA 3PZ7A 5BYRA 3GB1A 3R2TA 1EM7A 4L23A 2N9LA 1CJEA 1TKGA 2BS3B 2HTME 3BWUD 2K22A 3AEBB 2V3PA 1UWXA 3W2DA 4XE0A 1D6EC 1Q10A 1P7EA 1V1PA 2WDQB 5G5HA 4YXDB 5T8IA 3FILB 2G9HD 1MI0A 1JWSD 2KN4A 1B1ZA 2CU3A 3NRZA 1GB1A 2INPE 4L1BA 2ZW1A 1EU3A 2YEPF 1XLQA 1LO5D 1KH0A 2PVGC 1CZPA 3MP9A 2OEDA 2WDRB 1PGAA 4TQ0A 1TKEA 1FD6A 3BZDB 2W82A 2PTLA 4KKJA 2WP9B 1FMAD 1VZ6A 1GB4A 2YEPB 1BMLC 1JWAD 1PUTA 3AECB 4HKQA 1NYQA 1OQRA 1HEZE 1ZOYB 1YJJA 1NENB 4B0MA 3AEDB 3HVDA 1HQRD 5BMHA 2DYMA 2NTTA 4A90A 1SE2A 1D5ZC 3AE9B 5EE1A 1IBXA 4ZHOA 1ET6A 1PGXA 1GAQB 3AE6B 2IGGA 4JWSC 1XLOA 3AEEB 3W5VB 4A55A 1UGJA 3AH7A 4OHJA 2JSVX 2RPVA 3MFGA 4YTMB 1SEBD 2LEKA 4YSYB 3GP7A 1IUEA 1N62A 4N6EB 5EE3A 1DGJA 2AQ2B 1AWDA 3LXFA 1I7HA 3TEYA 3U7ZA 4KX6B 2Q5WD 1UWMA 1TY0A 3VQIA 1QOGA 3ZJVA 2ZW0A 1TS5A 2WQYB 1L0XB 1VR9A 4MACA 3SFDB 1I4PA 2WXNA 4B0EA 1L5PA 1L0YB 2AX5A 2X38A 2KDMA 1HZ5A 4ZOHC 4MM3B 2WXIA 2PMVA 4YTPB 1VZ8A 3ZYYX 2IGHA 5H8YE 1RFKA 1I4GA 2WXKA 1JWBD 1NYRA 2LFIA 3GS2A 5FR3A 4O1NA 2Y5CA 4KGRA 4WH4A 3AEFB 1JWMD 1UUPA 2KWDA 4WAFA 2I2YA 1SBBB 1PGBA 2DWQA 5I4DA 3BYTB 3AV8A 4YSXB 5LNK1 3BVGA 3IXSA 3BVMA 1EU4A 4NJCA 4PT5A 1M4VA 4IKGA 1FRRA 2L32A 2LUMA 2WS3B 3U2SC 3C8YA 4LLGM 1FM0D 3TEXA 2PW9A 3URYA 1NVID 1PFDA 1YQ3B 3IAS1 3KWVA 4EE2A 5JXVA 2I38A 5C2TB 3V05A 1QILA 1R7SA 3P4QB 1TKYA 3ABVB 1ZDVA 2BS4B 3KWLA 2WXPA 1ZXIA 4KGSA 1F0ZA 1C9FA 5G5GA 4NAWB 1FFVA 3VR9B 1I4XA 1XCTL 3TEZA 5BMGA 1AN8A 1VRAB 2WXHA 1K53A 4WQMA 4C56C 1AYFA 2GI9A 1DOYA 2W3SA 1HA5A 1ROEA 1SJHD 1T5XD 1QT9A 4IDIA 3T3NA 3Q8BA 1E0ZA 5FKAC 3Q8AA 2PIAA 3UI3A 3R8BA 1QLBB 1FFUA 4RH6A 5TSSA 4ZRPA 1FO4A 3AE5B 3CIRB 3BVZA 5HFYA 1FNWA 4A6QA 4HRSA 3KLSX 2V3NA 1TZOA 3TEWA 1RWSA 4ZHPA 3PZ8A 2BTEA 5GXGB 2JWUA 4MH8A 3OWEB 1C4CA 1FCLA 4ITKA 3SFEB 2JXTA 3BK1A 2PLPA 4GDKB 3VR8B 1FNUA 1AW7A 1SJED 4REZA 2EKIA 2N7JA 3P4PB 4AS1A 2K5PA 4R3DA 1UNSA 2W54A 4OZCA 4ARIA 1C4AA 3FC4A 1E7PB 2W3RA 1SE3A 4HROA 1JQ4A 1TS2A 2TSSA 1RM6C 2NMQA 2LHDA 2L52A 4TSSA 1YQ4B 1J7AA 1FIQA 2WXJA 2V0GA 3DWGC 2PKOA 1FEHA 2IGDA 1WGKA 1L6UA 2FE8A 2NTSA 2Y3AA 4KKIA 3SEBA 2WDVB 4WIPA 1KRHA 4DXFA 4YWGG 1XO3A 1JRPA 3EUB2 4OW0A 2MJEA 4YT0B 1V97A 3NVWA 1ZP0B 2EELA 4C80A 5HI1A 3P63A 2HDEA 1VLBA 4XWTA 3W1SA 2J4XA 5D3DA 3B2FA 3HVZA 3AE7B 3CWIA 4WWMA 1I4QA 1MVKA 2RDGA 2WXGA 1D5XC 4RF0A 3Q8EA 1KLGD 1SSNA 2K3UA 4HKZE 1SIJA 1L4DB 1E6EB 2BB5A 2MEKA 3RFZB 1MPEA 1V1PB 4MT5A 4H2AA 4US9A 2N9KA 3P42A 2H88B 1XCQL 5H92C 1ZE3D 1J7BA 1C76A 2IPKD 4XDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUI A;  2WU2 B;  3AE8 B;  1NVI D;  1PFD A;  2BT6 A;  1YQ3 B;  3VRB B;  1XLN A;  1PDX A;  1OFF A;  1L0V B;  1XLQ A;  2PVO D;  5C2T B;  1JAL A;  5MPO A;  2MJD A;  2PVG C;  1R7S A;  1CZP A;  2QJL A;  3P4Q B;  1TKY A;  2WDR B;  1JW9 D;  1VJK A;  3ABV B;  2ACZ B;  2BS4 B;  1SF0 A;  3KWL A;  3W9C B;  1ZXI A;  3AM9 A;  1TKE A;  1XLP A;  4JX1 C;  1F0Z A;  4A9A A;  2OHF A;  5G5G A;  3WCQ A;  2B76 B;  2WP9 B;  1FMA D;  3AN1 A;  3L4P A;  3HRD D;  3VR9 B;  1FFV A;  1FRD A;  1PUT A;  1JWA D;  5EE9 A;  1VDV A;  3AEC B;  1NYQ A;  1OQR A;  2KMM A;  1OQQ A;  1N60 A;  1QOA A;  1ZOY B;  1YJJ A;  3NVY A;  4C7Y A;  4WQM A;  1AYF A;  3AMZ A;  2W3S A;  1ROE A;  1NEN B;  4US8 A;  1DOY A;  3AE4 B;  3AED B;  1QT9 A;  4IDI A;  3AE1 B;  2WU5 B;  2CU3 A;  1E0Z A;  3AE9 B;  3ETR A;  5EE1 A;  1B9R A;  2PIA A;  4ZHO A;  1E10 A;  2JQR B;  1N5W A;  1GAQ B;  1QLB B;  1FFU A;  2N0S B;  3AE6 B;  2M19 A;  2M56 B;  1TJE A;  3AE5 B;  3CIR B;  5EE0 A;  1SB3 C;  1FO4 A;  4JWS C;  1QOB A;  1XLO A;  4HRS A;  4USA A;  4JWU C;  1KFY B;  3AEE B;  2BS2 B;  2JX5 A;  1A70 A;  1RWS A;  4FXC A;  3DWM A;  1WXQ A;  3W5V B;  4ZHP A;  3AEA B;  3AH7 A;  3AEG B;  5GXG B;  1EWY C;  4YTM B;  4ITK A;  2LEK A;  1DOI A;  3B9J A;  4YSY B;  3SFE B;  4P6V F;  2E3T A;  1L6V A;  1IUE A;  1N61 A;  1N62 A;  4N6E B;  1DGJ A;  5EE3 A;  3VR8 B;  1AWD A;  3AE2 B;  3LXF A;  1I7H A;  3RPF C;  2K9X A;  1V8C A;  4YTN B;  2FBW B;  3PO0 A;  2Q5W D;  4KX6 B;  2EKI A;  1UWM A;  3P4P B;  1QOF A;  1QOG A;  2K5P A;  2L83 A;  1FXA A;  2W54 A;  3NS1 A;  2WQY B;  3FC4 A;  4N58 A;  2KAJ A;  1FXI A;  3NVZ A;  1E7P B;  1WWT A;  2QIE B;  2W3R A;  4HRO A;  3SFD B;  1DOX A;  1JQ4 A;  1L5P A;  2W55 A;  2MH7 A;  1RM6 C;  1RYJ A;  1T3Q A;  1ZUD 2;  2AX5 A;  2CJO A;  2H89 B;  5C3J B;  2L52 A;  4ZOH C;  1YQ4 B;  1J7A A;  1J7C A;  1NEK B;  1FIQ A;  3DWG C;  2PKO A;  1QF6 A;  4YTP B;  5AUI A;  3NVV A;  1WGK A;  3ZYY X;  1L6U A;  5H8Y E;  1RFK A;  1WRI A;  2MJ3 A;  3B2G A;  2WDV B;  4LTU A;  3AB5 A;  4C7Z A;  1KRH A;  4N59 A;  1NYR A;  1JWB D;  1XO3 A;  1JRP A;  3EUB 2;  1NI3 A;  2MJE A;  1TYG B;  2G1E A;  4YT0 B;  1V97 A;  1KF6 B;  3NVW A;  3W5U B;  1E9M A;  1ZP0 B;  4YSZ B;  2CJN A;  2Y5C A;  4C80 A;  3AEF B;  1N5X A;  3P63 A;  1VLB A;  1GPX A;  3P1M A;  3B2F A;  3HVZ A;  3AE7 B;  1JRO A;  3CWI A;  3FAH A;  3VRA B;  2DWQ A;  4WWM A;  3P4S B;  2DBY A;  1SIJ A;  1CJE A;  1TKG A;  2BS3 B;  2HTM E;  3AV8 A;  1N63 A;  2K22 A;  3AEB B;  1E6E B;  1WYG A;  4YSX B;  2WLB A;  3P4R B;  3SR6 A;  4US9 A;  1YJI A;  5AUK A;  2H88 B;  2WDQ B;  5H92 C;  5G5H A;  1J7B A;  1FRR A;  2WS3 B;  3LB8 C;  4YXD B;  3BII D;  3AE3 B;  3NRZ A;  1FM0 D; 
#chains in the Genus database with same CATH topology
 3DBR B;  3FIL A;  3Q8C A;  5GMV A;  3TUO A;  2L05 A;  2LZ6 A;  3R66 C;  4RGN A;  3L17 A;  1CK1 A;  1Q5W B;  3VHT C;  3ZUN A;  2IYD B;  2KK8 A;  3O13 A;  3NJT A;  3RNE C;  1WX8 A;  4PYZ A;  2ACZ B;  1RAX A;  4OVZ A;  1SF0 A;  4RCO A;  5L83 A;  5BYS A;  4HEA 1;  2ZCB A;  1R4N I;  3A9J B;  3HRD D;  2J0M A;  1FRD A;  5HKH A;  1YOV B;  2KMM A;  1IGC A;  2D11 A;  2N9E B;  2E6X A;  3AE1 B;  3JYU A;  2WU5 B;  1YNT E;  4NJ6 A;  2EMT A;  2LVO A;  2GBR A;  1WGD A;  5HG2 A;  4HDQ A;  1YN3 A;  2J53 A;  2FUG 1;  4HVB A;  3X23 A;  4NQK E;  1DOI A;  2IO2 B;  1JCK B;  2K8H A;  1ESF A;  2KDE B;  2D3B A;  3HM3 A;  3VH4 B;  1ACC A;  3K9P B;  2KAC A;  2ZPY A;  3RPF C;  1N6Z A;  2L83 A;  4GDL B;  1C4P A;  2KMC A;  2I1K A;  2OJW A;  2O6V B;  2NPT A;  4II3 B;  3DQV A;  2KX0 A;  4LJO B;  2KDI A;  4ZRJ A;  4C7Z A;  2IJ0 A;  2QSD A;  4ZDV A;  1FPY A;  4DQO C;  3H7P A;  4ZRQ A;  3UQA A;  1JWU D;  4KV2 A;  4ICU A;  1JRO A;  3RNA C;  5TR5 A;  3P4S B;  2CR5 A;  3Q14 C;  2LGY A;  2C9W B;  1WYG A;  3TBL D;  2MLB A;  3M63 B;  2BVC A;  3BK2 A;  3MC9 A;  1YJI A;  4W9I A;  4TQ1 A;  3MJ5 A;  3DVN U;  3LB8 C;  3K9O B;  3BII D;  3AE3 B;  1VCB A;  1EF5 A;  1ZKH A;  2BT6 A;  4IUM B;  3ZRC A;  2KFJ A;  1L0V B;  5MPO A;  4J3O D;  1J19 A;  1V1O A;  5IOI A;  2INN E;  3KYD D;  3QCA A;  1XLP A;  4GLS C;  2IO0 B;  1V5O A;  1E8Z A;  4GGQ A;  3ZJU A;  2VH1 A;  2HTH A;  2ICI A;  3E56 A;  2RDH A;  5BMI A;  3U52 E;  4KGT A;  1MJD A;  2BW2 A;  4CO7 A;  5IP4 D;  2O2V A;  4XDC A;  3N1X C;  3PS6 A;  1QOB A;  2IND C;  4KIK B;  1N61 A;  3APF A;  3AE2 B;  4NNJ B;  3ONS A;  1BUI C;  1GJZ A;  2KHW B;  3VFK A;  1WWT A;  4D2K A;  2DZI A;  2QEJ C;  1RYJ A;  5AZG A;  1I4H A;  2JZP A;  1J7C A;  2AQ1 B;  2K39 A;  1A5R A;  4A20 A;  5J17 A;  1WR6 E;  3PV1 A;  2Z8L A;  1KF6 B;  2XN9 C;  2ZNV C;  2BF8 B;  2MQJ A;  4FJZ A;  5D94 A;  5JHA A;  2LJ5 A;  5C1Z A;  1CJE A;  2HTM E;  2BS3 B;  3BWU D;  4IG7 B;  1UWX A;  2GBM A;  5E6N A;  2WDQ B;  5JZE B;  5JH5 C;  4K3B A;  4KVG B;  3FIL B;  3NRZ A;  3DCG A;  3OG5 A;  1H8C A;  2INP E;  2J0K A;  2MBQ A;  3HIZ A;  1P3Q U;  3H9D A;  3MP9 A;  2RSU A;  3WAN A;  2XEW A;  1WM2 A;  2M1M A;  4I6P A;  4MDK E;  2W82 A;  1FMA D;  2G3Q B;  1BML C;  1NYQ A;  1C1Y B;  1HEZ E;  2WWZ A;  4OVV A;  4B0M A;  3AED B;  3I3T B;  2XBB C;  4G50 A;  2RDB C;  1EUV B;  2NTT A;  5EE1 A;  1GUA B;  4ZHO A;  1ET6 A;  2KNB A;  2L0F A;  3ZNZ B;  4M8N A;  4ANU A;  3VH3 B;  1Q0W B;  4ZRK A;  1UGJ A;  2W9N A;  2KO3 A;  2RPV A;  4YTM B;  4K7W A;  2LEK A;  2KKC A;  2LGS A;  3GP7 A;  4N6E B;  2V4L A;  2ASQ A;  1AWD A;  1I7H A;  1OGW A;  2N9P C;  3U7Z A;  1TS5 A;  2WQY B;  3TMP B;  2C7N B;  4B0E A;  2KVR A;  1HZ5 A;  3SHQ A;  1ZGU B;  3KUC B;  2WXI A;  4YTP B;  5CHV C;  3ZYY X;  1WY8 A;  1LQB A;  1NYR A;  2AEH A;  2X8X X;  3GS2 A;  5FR3 A;  3H7P B;  4O1N A;  1WXV A;  4KGR A;  3AEF B;  1UUP A;  4JGH B;  2KLG A;  4W9G A;  3KUZ A;  1KJT A;  4YSX B;  2KQ7 A;  1E8X A;  4URK A;  2LD9 A;  3QK0 A;  4NJC A;  2LUM A;  4LLG M;  1FM0 D;  4K7U A;  2PW9 A;  3URY A;  1NVI D;  1Q1O A;  3V62 A;  1YQ3 B;  1WJU A;  4EE2 A;  2UYZ B;  3H6N A;  2I38 A;  3V05 A;  4F7Z A;  4ICV A;  3ABV B;  1ZDV A;  2KC1 A;  2IBI B;  2WXP A;  4KGS A;  3C0R B;  5G5G A;  2G45 B;  5JHB A;  5BMG A;  1AN8 A;  3CSF A;  2WXH A;  2N7E A;  2LGX A;  2UWQ A;  1TIF A;  2PIA A;  2O2V B;  4FUL A;  3CIR B;  1P1A A;  3ZDM C;  3BVZ A;  5HFY A;  1FNW A;  4A6Q A;  2WYQ A;  4HRS A;  3KLS X;  4W9D A;  3U7D A;  1RWS A;  4MM3 A;  3PZ8 A;  2BTE A;  4MH8 A;  2IO3 B;  3OWE B;  1C4C A;  2MBE A;  4ITK A;  3SFE B;  5LXH A;  1E7V A;  1FNU A;  3X0W A;  4LNI A;  3PSE B;  2N7J A;  3P4P B;  4R3D A;  1UNS A;  3WA0 A;  1E7P B;  1WH3 A;  2W3R A;  1SE3 A;  2TSS A;  2NMQ A;  4FAD A;  2L52 A;  2WXJ A;  2IO1 B;  2PKO A;  3JVZ X;  1WGK A;  2Y3A A;  4KKI A;  3EUB 2;  1E5W A;  4DHZ B;  3B08 A;  3ZNG C;  3CMM B;  5HI1 A;  2HDE A;  3W1S A;  2J4X A;  3B2F A;  1I4Q A;  1QZE A;  1SSN A;  2K3U A;  1SIJ A;  3RI7 C;  1E6E B;  3RFZ B;  1MPE A;  4JL9 A;  3WAP A;  4H2A A;  4US9 A;  1OEY J;  4ANW A;  1L2N A;  1ZE3 D;  2IPK D;  3JW0 X;  2WU2 B;  5G2N A;  2CS4 A;  1XLN A;  1OFF A;  2MJD A;  1L4Z B;  2QJL A;  2Y5B B;  1TS3 A;  3N1Z C;  1YIW A;  3I63 C;  4FHK A;  1ZW7 A;  4ZYS A;  4M8M A;  1K8R B;  4I6N B;  2B76 B;  4IM2 A;  5EE9 A;  1GOZ A;  3C19 A;  1V2Y A;  2UU7 A;  4PS8 A;  4TMA B;  3AMZ A;  3BY4 B;  4GDK A;  4WJQ A;  2FUH B;  3I57 A;  4DHZ E;  1TBE A;  1E10 A;  1MHX A;  4WJO A;  3DHI C;  4M0W A;  2QDF A;  4BFR A;  2C7H A;  2DZM A;  3RN9 C;  4USA A;  2BS2 B;  4W9J A;  1WXQ A;  3AEG B;  3Q6B A;  2DLB A;  2AYO B;  3GZN B;  3OLM D;  2SEB D;  4IOI E;  1WIA A;  3R7Q A;  3ZJT A;  3DBL I;  2JT4 B;  2KXJ A;  2DYO A;  3QWZ B;  4PS3 A;  1TS4 A;  2QIE B;  1DOX A;  1JML A;  3WIM A;  3EC8 A;  2KAN A;  4OZB A;  5E6J A;  3PVL A;  3NVV A;  4P16 A;  4JE3 B;  1C79 A;  2MJ3 A;  3EA6 A;  3IAM 1;  4LTU A;  3T9L A;  1E7U A;  3ZTD A;  4G3X B;  3W5U B;  2CJN A;  4A8X C;  1N5X A;  2NR2 A;  2ON8 A;  1WX9 A;  3HM6 X;  4M02 A;  4TV3 A;  2CKH B;  4ASW C;  4LK0 M;  2IZV B;  2KQ4 X;  3DBH B;  5AUK A;  2INC C;  3DVG Y;  4W9E A;  3ZTC A;  3Q3O C;  2EKE C;  3KYC D;  3HUI A;  4W9H A;  3TSS A;  2J0J A;  3AE8 B;  3O65 B;  2PPH A;  5BYQ A;  2I1J A;  2PVO D;  4GXB A;  1JAL A;  1XF5 L;  2LXA A;  1R4M B;  4KDI C;  4RNA A;  1WE6 A;  4A9A A;  2OHF A;  1HXY D;  1DYQ A;  2JYE A;  2LMC A;  4NY0 A;  1OQQ A;  5IKC M;  1LGR A;  1YMH E;  3ZLZ A;  3HHM A;  3U4E G;  3WAO A;  1UF0 A;  3QQ8 B;  1N5W A;  1K50 A;  2M56 B;  1TJE A;  1ZXH A;  3DHG C;  4P7I A;  4JPS A;  1KFY B;  4FN2 A;  3RUL A;  1A70 A;  3IBE A;  1HZ6 A;  1HTO A;  3KW5 B;  2QHO A;  2NBU A;  4Q2J A;  1L6V A;  1C78 A;  3LYY A;  5DPS A;  2FBW B;  1WR1 A;  1LM8 B;  3NS1 A;  2YLM A;  1FXI A;  2XK5 B;  3EGR A;  3NVZ A;  3ZGZ A;  2LJI A;  1EWC A;  4ARC A;  1UBI A;  1HE8 A;  4GMV A;  4NAM A;  1WYW B;  3B2G A;  2RPQ A;  3N3K B;  3KVF B;  4N59 A;  3PRM B;  3IT6 B;  1TYG B;  4YSZ B;  1OTR B;  3IT4 B;  1Y56 A;  2GB1 A;  2XNA C;  3PZ7 A;  3GB1 A;  4BOZ B;  1EM7 A;  3VVW B;  4L23 A;  1TKG A;  4FJV B;  3NY5 A;  3GE3 C;  3DVG X;  4BZA A;  2LRW A;  5T8I A;  2G9H D;  4C00 A;  2KN4 A;  1F52 A;  2L3Z A;  4L1B A;  1Z2M A;  1EU3 A;  2MBH A;  2KN5 A;  2OED A;  3NOB A;  1PGA A;  3NHE B;  2MCN B;  4TQ0 A;  1TKE A;  3A1Q A;  3N30 A;  5E6O A;  2D2Q A;  2WP9 B;  2MA9 B;  1JWA D;  3AEC B;  3LJ3 A;  4W9K A;  3UIP B;  1NEN B;  4IW0 A;  5D6J B;  3V61 A;  3HVD A;  3TCA A;  5BMH A;  1BT0 A;  1IBX A;  1PGX A;  1WFY A;  1GC7 A;  2B3A A;  1T0Y A;  1G6J A;  1GAQ B;  3AE6 B;  4M0W B;  5LXI B;  4GOC A;  4NPN A;  4JWS C;  3AEE B;  3VUY A;  3AH7 A;  3Q3F A;  2KZR A;  4YSY B;  4IC7 B;  4NQL B;  4FLH A;  1YQB A;  3TEY A;  4KX6 B;  3VQI A;  2K1F A;  1QOG A;  1IPG A;  4G0N B;  4EZK A;  1VR9 A;  2KT7 A;  4MAC A;  2LUE A;  1I4P A;  2X38 A;  2KDM A;  2C60 A;  2MP2 A;  4XYC A;  2PMV A;  1VZ8 A;  2IGH A;  1I4G A;  5IN7 A;  3NZS A;  2Y5C A;  3ZXV A;  3JSV A;  1WZ0 A;  2G4D B;  1TTN A;  3I5J C;  3PLU A;  4FA6 A;  4HPM B;  3IXS A;  1SIF A;  3BVM A;  4IKG A;  4DDG D;  2L32 A;  3C8Y A;  4MGZ E;  1PFD A;  2MBO A;  3KWV A;  1NI2 A;  4A3O A;  3KWL A;  2DYB A;  1F0Z A;  1MG4 A;  3L10 B;  4EZL A;  1OEY A;  1R4N B;  2GI9 A;  2W3S A;  1HA5 A;  1T5X D;  3HK0 A;  3GE8 C;  3OJ3 A;  3A4R A;  1T0S C;  5FKA C;  3H1U A;  3UI3 A;  2M0X A;  4RH6 A;  3DVN V;  4GN1 A;  3L54 A;  1TZO A;  4AJY B;  2FAZ A;  2JWU A;  5GXG B;  2JXT A;  1LFD A;  3FKY A;  2ZJD A;  2ZEQ A;  3VR8 B;  4REZ A;  1WXA A;  3IHP C;  5AZH A;  1YJ1 A;  4HRO A;  2NS5 A;  2LHD A;  2AL3 A;  1YQ4 B;  3DWG C;  4CYE A;  1FEH A;  3DPD A;  1L6U A;  1KRH A;  4YWG G;  1JRP A;  3H7S A;  2MJE A;  3ZVV A;  4YT0 B;  1WRD B;  3NVW A;  2EEL A;  4C80 A;  3RT3 B;  3HVZ A;  4C4V A;  4PS7 A;  3L16 A;  1MVK A;  1NBF C;  2RDG A;  4HKZ E;  4PK1 A;  4MEM A;  3ZKJ C;  4MT5 A;  2NBW B;  2N9K A;  2NPT B;  1S3S G;  3UQB A;  2JPH A;  3PHW B;  2Z59 B;  2FNJ B;  4XDD A;  5H8Y E;  2O6V D;  4HWI B;  4AQ7 A;  4OVU A;  1PDX A;  3R7R A;  2FIF A;  2K6D B;  2BWE S;  1JW9 D;  1VJK A;  3VUX A;  2BYV E;  4HPL B;  3A1Q B;  3AM9 A;  5DPT A;  4JX1 C;  2ONQ A;  3MHS D;  1ISN A;  2GRI A;  3PT2 B;  3L4P A;  2BPS A;  3J9C A;  2ZPN A;  1RRB A;  2K0P A;  2LVQ A;  1N60 A;  4FHJ A;  2IDY A;  4ANX A;  4RF1 A;  1IBX B;  3ZO5 B;  1BXT A;  1WSP A;  3MTN B;  3U8Z A;  1T6B X;  2KFK A;  5EE0 A;  2J52 A;  3ECI A;  2ZNV B;  1TZ1 A;  2JX5 A;  3A33 B;  2JRH A;  4DXG A;  3PTF C;  1V6E A;  4PYU A;  4WWO A;  5D3I B;  3VTU A;  1KLV A;  2NCN A;  3PO0 A;  1UD7 A;  2WXO A;  1CQV A;  5C3J B;  2MH7 A;  2DX5 B;  1L7Y A;  2MP2 B;  1QF6 A;  4BBN F;  4BVU C;  1WGH A;  2GBK A;  3DHH C;  4WQO B;  1XEE A;  1WRI A;  2JZ3 B;  4XGA B;  4KZ0 A;  1V9J A;  2JXX A;  3OAW A;  4MSQ B;  3P2B A;  1KOT A;  1C3T A;  1FCC C;  3ML9 A;  2WXL A;  2RMM A;  3JSV B;  3LDZ E;  1RLF A;  2V3S A;  3NZU A;  4L2Y A;  3U30 A;  5L95 C;  2KTF A;  1XXG A;  2ZVN A;  3BYY B;  4E74 A;  3PGE A;  4KDL B;  1XT9 B;  3P4R B;  2BB6 A;  3SR6 A;  3DBR I;  2LHE A;  2VZK D;  2EMS A;  3RCZ A;  1I4R A;  2HD5 B;  2DHZ A;  2VH2 A;  1NDD A;  3A4S C;  5DPR A;  2R2O A;  2WX0 A;  1IGD A;  3WCQ A;  1P7F A;  2KVZ A;  1ENF A;  4AP4 C;  2QIL A;  1VDV A;  4NAW A;  4AWJ A;  4C7Y A;  4US8 A;  2KJH B;  1WI0 A;  4BKG A;  1YN5 A;  3ETR A;  3WAM A;  2RR9 A;  3PRP B;  2M19 A;  3RNG C;  4B6W A;  2PE6 B;  1SB3 C;  3CST A;  3Q8F A;  1P0R A;  4GSW A;  2O6V A;  4MSM B;  2L1A A;  4JLC A;  4RFB A;  4RGM A;  4CHK A;  1QKZ A;  2KC2 A;  2K9X A;  4YTN B;  1FNV A;  3V6E B;  1K51 A;  2D5G A;  2KAJ A;  1WE7 A;  3W1Y A;  1D5M C;  5FK9 C;  2H89 B;  2OJR A;  1SE4 A;  2AL6 A;  5LLI A;  3WAL A;  1F77 A;  2YVC A;  4KSL C;  1FXT B;  4LJP B;  1X1M A;  4HCP B;  2KJR A;  4GIV A;  4K3C A;  4C4V B;  1GPX A;  2LAS A;  3P1M A;  3ZQ4 A;  4EOY A;  3FAH A;  4KZC A;  3RNB C;  2N9L A;  2K22 A;  3AEB B;  2V3P A;  2L76 A;  5BO4 B;  1Q10 A;  3Q2A C;  2IY1 B;  4P1B C;  5AEK B;  2KWC A;  4IWQ A;  1MI0 A;  1JWS D;  2CU3 A;  2M8S A;  3VXW A;  2WGS A;  3T8M A;  3QX1 A;  3M3J A;  2YEP F;  1LO5 D;  2PVG C;  3ENE A;  1CZP A;  2WDR B;  3APC A;  2KTR A;  4WAA A;  1FD6 A;  1MFW A;  2PTL A;  4KKJ A;  2MWS B;  1GB4 A;  2YEP B;  4HKQ A;  1YJJ A;  4HK2 A;  4RM9 A;  2ZVO A;  2K8B A;  1CMX B;  3QAQ A;  3L08 A;  3EEC A;  4A90 A;  1SE2 A;  1VD2 A;  3AE9 B;  2D10 A;  1E90 A;  2KFK B;  2IY0 B;  4MEL A;  5DPW A;  2IGG A;  1V80 A;  2M17 A;  3RYT A;  4W9L A;  2BGF A;  4A55 A;  4OHJ A;  2L7R A;  2GOW A;  2K8C A;  1SEB D;  2N4F A;  1WMH A;  5EE3 A;  1DGJ A;  2D3G A;  3LXF A;  2WHI A;  4S17 A;  3IVF A;  5IA7 A;  2Q5W D;  1YX6 B;  4XC2 A;  1TY0 A;  1OQY A;  2LVP A;  1WGG A;  4AUQ C;  2JUO A;  3SFD B;  4G11 A;  1L0Y B;  1WJ4 A;  2AX5 A;  4HJK A;  4ZOH C;  4MM3 B;  3S2A A;  4LDT D;  1I42 A;  1WXM A;  4II2 B;  2PEA A;  4WH4 A;  2Z0D B;  1JWM D;  1SBB B;  1PGB A;  3OJ4 B;  2DWQ A;  3Q3N C;  3AV8 A;  4K7S A;  1EU4 A;  2N7D A;  4PT5 A;  1FRR A;  2WS3 B;  1P9D U;  2DAJ A;  1PQS A;  4LNO A;  2N9X A;  3IAS 1;  2HE7 A;  5JXV A;  2D07 B;  1E8W A;  5C2T B;  3VUW A;  4DHJ D;  1R7S A;  3P4Q B;  1TKY A;  2LI5 A;  5D2M B;  1ZXI A;  4P1C C;  2VRR B;  3SD5 A;  2WX1 A;  3ZW3 A;  4LCD E;  1C9F A;  3RD2 A;  3AUL A;  4NAW B;  1FFV A;  4A3P A;  4RMA A;  1K53 A;  1DOY A;  1ROE A;  1SJH D;  4GU2 A;  1QT9 A;  4BKS D;  3Q8B A;  1UBQ A;  1E0Z A;  4JIO U;  3Q8A A;  2MW5 A;  2KWV B;  5CX3 A;  1QLB B;  1FFU A;  1J8C A;  4ZRP A;  1FO4 A;  3AE5 B;  5IAA C;  3RMK C;  2BWF A;  3ZDT A;  4EFO A;  3TJP A;  4AOF A;  5DCN A;  2AWT A;  1U4A A;  4M01 A;  4EKU A;  1FCL A;  4F1S A;  3BK1 A;  4AJW A;  4QAY A;  4GDK B;  1AW7 A;  2MSE D;  3QC8 B;  1S1Q B;  4AS1 A;  2K5P A;  3PHX B;  4OZC A;  4ARI A;  1C4A A;  3Q3M C;  4TKN A;  2KWU B;  4F8C B;  2GMI C;  3DBL B;  2K25 A;  1AAR A;  1JQ4 A;  1TS2 A;  1WGY A;  2IGD A;  2NTS A;  2FE8 A;  3PRZ A;  3AU5 A;  2DEN B;  4DXF A;  5J2R A;  4OW0 A;  2NBV B;  2PJH A;  4MGK E;  1IYF A;  2JY6 A;  2ZCC A;  2QCZ A;  3MJW A;  3P63 A;  4XWT A;  3AI5 A;  5D3D A;  3AE7 B;  1M94 A;  4HCN B;  4WWM A;  2WXG A;  1D5X C;  1P98 A;  3DOW A;  2MBB B;  2BB5 A;  2DNF A;  5C23 A;  3P42 A;  2KOX A;  1H4R A;  1XCQ L;  2DZJ A;  2V1Y A;  3RNC C;  4JQW C;  4K1R B;  3R3M A;  3AXC A;  5G55 A;  1ET9 A;  1F2R I;  4XZ4 A;  3V3X A;  2CHX A;  1WZ3 A;  1YN4 A;  4S0R A;  4ZRI A;  2KTR B;  3W9C B;  2R61 A;  1IP9 A;  3DDC B;  2JZZ A;  4RM8 A;  3NZ3 A;  2HJ1 A;  2JVC A;  2WXQ A;  4LNK A;  1Y8R C;  5E6P A;  1ZPS A;  3DBS A;  1XQQ A;  2SAK A;  5HHD G;  4RGO S;  3QA8 A;  4XX5 A;  2JRI B;  2J42 A;  2JQR B;  2VZK B;  1KLU D;  3NUH B;  2N0S B;  2M0A A;  3SDL C;  1V81 A;  2ZZP B;  4WUR A;  3PZD A;  4JWU C;  4FXC A;  3DWM A;  2C5L C;  2KDB A;  2M4N A;  3UIO B;  3KQ4 A;  1EWY C;  1F2R C;  1STE A;  1V49 A;  2V9H A;  1WMH B;  2CU1 A;  3R2I A;  5D7G A;  2E3T A;  1D4B A;  2BKF A;  5AZF A;  1J0G A;  5IO9 A;  4MGI E;  2FCM A;  1FXA A;  4NJ7 A;  5KHO A;  2MHJ A;  2KD0 A;  4BAX A;  4N58 A;  4YL8 A;  2W55 A;  3E9S A;  1T3Q A;  2JU6 X;  2CJO A;  4E71 A;  1C77 A;  2FCS A;  2LXC A;  2RGF A;  2BBC A;  3MHZ A;  1JRU A;  1YX5 B;  2LGD A;  4BKS A;  3AB5 A;  3UF8 A;  1GG3 A;  3T3O A;  4EZJ A;  4ANV A;  1LXD A;  2HJ8 A;  4UDU C;  3VRA B;  2QMT A;  2KQS A;  3BIN A;  3ALB A;  2DBY A;  1ZDX A;  4IWO A;  1N63 A;  2CHZ A;  2L8J A;  2WLB A;  4BOS C;  4WJP A;  4BBN C;  1VZ7 A;  2BYT A;  1PYW D;  1Z5S B;  4WWN A;  4NZL B;  3VRB B;  1WX7 A;  1KTK A;  1WGR A;  2Y5P A;  1WJN A;  2LGI A;  2R2Q A;  4HJG E;  4MJS A;  2FID A;  2WXR A;  1SGH A;  3Q69 A;  2AQ3 B;  1WJ6 A;  4TUU A;  3AN1 A;  3RUI B;  4B95 A;  4IM0 A;  4W9F A;  3N9Y C;  1QOA A;  3NVY A;  2WXF A;  3EHV A;  4OZA A;  3AE4 B;  4MGY E;  2G4S A;  2KJ6 A;  2QC8 A;  2K6Q A;  1B9R A;  2WXM A;  3RZF A;  4XWW A;  3IG3 A;  3M95 A;  1TY2 A;  3H8H A;  3GZN I;  1XD3 B;  1WXS A;  3AEA B;  2DZK A;  4BKT A;  1EO6 A;  2JYT A;  3B9J A;  2WNM A;  1MHH E;  4P6V F;  3TL5 A;  1EF1 A;  3N1Y C;  1K52 A;  3ZNH B;  1V8C A;  2BYE A;  2L0T A;  4HXD A;  1QOF A;  2V4I B;  3MC0 B;  4WWP A;  3APD A;  4LNF A;  1I35 A;  1ZUD 2;  4W9C A;  3I9V 1;  4EUT A;  1NEK B;  1QQR A;  3L0W B;  5AUI A;  1SXT A;  4CQN A;  3NS8 A;  3VAW A;  2A5U A;  2KMA A;  5J18 A;  1NI3 A;  2G1E A;  4RGT A;  2D3C A;  4DDI D;  2J7Q B;  1E9M A;  3RNF C;  3A9K A;  5CHW A;  5BYR A;  3R2T A;  3DBH I;  3ML8 A;  3QIJ A;  4DK5 A;  3VTV A;  2LRU A;  3W2D A;  2KDF B;  3VDZ A;  4XE0 A;  1D6E C;  3KUD B;  1P7E A;  1V1P A;  2REX A;  4HLE A;  1D3Z A;  5G5H A;  4K81 A;  4YXD B;  3ZRF A;  2CHW A;  2MX2 A;  2DAF A;  1B1Z A;  1GB1 A;  5FR6 A;  2ZW1 A;  1R4M I;  2BQQ A;  1XLQ A;  2GBN A;  1KH0 A;  3NG0 A;  3V60 A;  3RZW C;  4FBJ B;  4HDO A;  1WM3 A;  2L00 B;  4LDT B;  2KYW A;  4HPP A;  3BZD B;  1VZ6 A;  3A9J A;  3EFU A;  1PUT A;  1F1H A;  3VTW A;  1V5T A;  1OQR A;  1ZOY B;  4WJN A;  1RFA A;  1E8Y A;  1HQR D;  2DYM A;  3QAR A;  1D5Z C;  2FCQ A;  4DBG A;  2LWP A;  2XK5 A;  1GC6 A;  3EFC A;  1XLO A;  2Z0E B;  3W5V B;  1YD8 U;  2D3A A;  4IWP A;  2JSV X;  3MFG A;  2C7M B;  4DHJ B;  1F9J A;  1IUE A;  1N62 A;  2AQ2 B;  3PLV A;  1HTQ A;  2N1V A;  4ZYN A;  4ACF A;  1GNU A;  1UWM A;  3ZJV A;  2ZW0 A;  4E3C A;  4GDL A;  1L0X B;  3Q3J A;  2KLC A;  2WXN A;  3M62 B;  1L5P A;  3ZNI D;  2FCN A;  2RD0 A;  4EEW A;  1RFK A;  3N20 C;  2KX3 A;  2WXK A;  4IM3 A;  1JWB D;  2LFI A;  3B1L X;  2NVU I;  3V6C B;  2KWD A;  2I2Y A;  4WAF A;  2GLS A;  4DWF A;  5I4D A;  4B9K A;  3BYT B;  5LNK 1;  1KM7 A;  3BVG A;  2JWZ A;  5EDS A;  1M4V A;  5CTR C;  3N32 A;  2N1W A;  3AU4 A;  3U2S C;  3TEX A;  1UH6 A;  4J6I A;  5CHF A;  1UEL A;  3QJZ A;  3PRE A;  1UZX B;  4MJS B;  1QIL A;  3UIN B;  2BS4 B;  3D32 A;  3W1S C;  4KSK C;  4MH0 E;  2PE9 A;  3VR9 B;  1I4X A;  1XCT L;  3TEZ A;  1VRA B;  3ZIM A;  4WQM A;  4C56 C;  1AYF A;  1V86 A;  4GB9 A;  4IDI A;  3T3N A;  2BKR B;  3R8B A;  5TSS A;  1MG8 A;  4M00 A;  2A4Z A;  2V3N A;  3TEW A;  3SU8 X;  4ZHP A;  3B0A A;  1SE9 A;  4KIK A;  3QHT A;  3MC8 A;  1WF9 A;  2PLP A;  2WDT B;  3GOE A;  1SJE D;  2EKI A;  3KH0 A;  2W54 A;  3FC4 A;  4I6L B;  1TGZ B;  1RM6 C;  4TSS A;  1J7A A;  1FIQ A;  2V0G A;  2GBJ A;  3SEB A;  2WDV B;  3TIX A;  4WIP A;  4FJY A;  1XO3 A;  3PPA A;  2JF5 A;  5KHQ A;  1V97 A;  3A9K B;  3ZXR A;  1ZP0 B;  4X57 B;  2OOB B;  1VLB A;  3CWI A;  4LNN A;  4N9F 4;  3L13 A;  1TT5 B;  4RF0 A;  3Q8E A;  1KLG D;  3UGB B;  1L4D B;  3IFW B;  2MEK A;  1UGM A;  1V1P B;  1T0Q C;  2BYF A;  2H88 B;  1T0R C;  3CF6 E;  4DXA B;  5H92 C;  2MRP A;  1J7B A;  1C76 A; 
#chains in the Genus database with same CATH homology
 3FIL A;  3Q8C A;  2WU2 B;  3TUO A;  4AQ7 A;  1ET9 A;  1F2R I;  1XLN A;  3V3X A;  4RGN A;  1CK1 A;  1PDX A;  1OFF A;  1YN4 A;  2MJD A;  1L4Z B;  2QJL A;  1TS3 A;  3O13 A;  1JW9 D;  1VJK A;  2ACZ B;  4OVZ A;  1SF0 A;  4RCO A;  3W9C B;  2R61 A;  3AM9 A;  5BYS A;  4JX1 C;  4HEA 1;  4ZYS A;  2ONQ A;  3NZ3 A;  2GRI A;  2B76 B;  3L4P A;  3J9C A;  3HRD D;  1FRD A;  5EE9 A;  1GOZ A;  2WXQ A;  2K0P A;  2KMM A;  1N60 A;  1IGC A;  4TMA B;  3AMZ A;  1ZPS A;  2IDY A;  2E6X A;  3AE1 B;  2WU5 B;  4RF1 A;  1IBX B;  1YNT E;  1BXT A;  1WSP A;  2SAK A;  1T6B X;  3I57 A;  5HHD G;  4RGO S;  2J42 A;  2JQR B;  2VZK B;  1KLU D;  3NUH B;  1E10 A;  1MHX A;  2N0S B;  2M0A A;  4WUR A;  5EE0 A;  2J52 A;  4M0W A;  5HG2 A;  4USA A;  4JWU C;  2BS2 B;  2JX5 A;  1YN3 A;  4FXC A;  3DWM A;  1WXQ A;  2J53 A;  2FUG 1;  3AEG B;  3KQ4 A;  1EWY C;  4DXG A;  1F2R C;  1STE A;  2DLB A;  3R2I A;  1DOI A;  5D7G A;  1JCK B;  1ESF A;  2E3T A;  5D3I B;  1ACC A;  1D4B A;  2SEB D;  4IOI E;  2KAC A;  3ZJT A;  3RPF C;  3PO0 A;  2DYO A;  2L83 A;  4GDL B;  1FXA A;  1C4P A;  2WXO A;  4N58 A;  1TS4 A;  1CQV A;  2QIE B;  1DOX A;  2W55 A;  2MH7 A;  1T3Q A;  1JML A;  2JU6 X;  2CJO A;  3E9S A;  5C3J B;  1C77 A;  2BBC A;  3MHZ A;  4OZB A;  5E6J A;  1QF6 A;  3NVV A;  4P16 A;  4JE3 B;  1C79 A;  1XEE A;  1WRI A;  2MJ3 A;  3EA6 A;  3AB5 A;  3IAM 1;  4LTU A;  4C7Z A;  2IJ0 A;  1FCC C;  2QSD A;  3W5U B;  4DQO C;  2CJN A;  4ZRQ A;  4A8X C;  3T3O A;  2WXL A;  1JWU D;  1N5X A;  2RMM A;  4UDU C;  1JRO A;  3VRA B;  2ON8 A;  2QMT A;  3P4S B;  4L2Y A;  2DBY A;  1ZDX A;  1XXG A;  1N63 A;  1WYG A;  3BYY B;  2WLB A;  3P4R B;  2BB6 A;  3BK2 A;  3SR6 A;  1YJI A;  2LHE A;  4LK0 M;  2KQ4 X;  4TQ1 A;  2VZK D;  5AUK A;  3MJ5 A;  1VZ7 A;  3LB8 C;  2BYT A;  3BII D;  1PYW D;  1I4R A;  3AE3 B;  3HUI A;  3TSS A;  3AE8 B;  2BT6 A;  4NZL B;  3VRB B;  1KTK A;  5BYQ A;  1L0V B;  2PVO D;  2Y5P A;  5MPO A;  1JAL A;  2LGI A;  4J3O D;  4HJG E;  1V1O A;  1XF5 L;  2INN E;  1IGD A;  2WXR A;  1XLP A;  4RNA A;  3Q69 A;  4A9A A;  4GLS C;  2OHF A;  1HXY D;  1DYQ A;  2AQ3 B;  3WCQ A;  1P7F A;  3AN1 A;  1ENF A;  2JYE A;  3ZJU A;  2QIL A;  2LMC A;  1VDV A;  1OQQ A;  2ICI A;  1QOA A;  3E56 A;  3N9Y C;  3NVY A;  2RDH A;  2WXF A;  4C7Y A;  4US8 A;  5BMI A;  4OZA A;  1YMH E;  3AE4 B;  3U52 E;  4KGT A;  1YN5 A;  2BW2 A;  1B9R A;  2WXM A;  3ETR A;  4XWW A;  3U4E G;  1TY2 A;  1N5W A;  1K50 A;  2M19 A;  2M56 B;  1TJE A;  1ZXH A;  3H8H A;  1SB3 C;  4XDC A;  1QOB A;  3Q8F A;  4JPS A;  1KFY B;  1A70 A;  2L1A A;  3AEA B;  1HZ6 A;  2JYT A;  4RFB A;  4RGM A;  1QKZ A;  3B9J A;  4Q2J A;  2WNM A;  1MHH E;  4P6V F;  1L6V A;  1N61 A;  1C78 A;  3AE2 B;  3LYY A;  1K52 A;  2K9X A;  1V8C A;  4YTN B;  2FBW B;  1FNV A;  1QOF A;  1K51 A;  1BUI C;  3NS1 A;  2D5G A;  2V4I B;  2KAJ A;  1FXI A;  3EGR A;  3MC0 B;  3NVZ A;  1D5M C;  1WWT A;  5FK9 C;  4D2K A;  3ZGZ A;  2QEJ C;  1RYJ A;  1ZUD 2;  1I4H A;  2H89 B;  2JZP A;  2LJI A;  3I9V 1;  1EWC A;  4ARC A;  1J7C A;  1NEK B;  1QQR A;  1SE4 A;  2AQ1 B;  5AUI A;  4NAM A;  1SXT A;  1F77 A;  3B2G A;  4CQN A;  4N59 A;  3IT6 B;  1NI3 A;  1TYG B;  2G1E A;  2Z8L A;  4RGT A;  1KF6 B;  2XN9 C;  1E9M A;  4YSZ B;  1GPX A;  3IT4 B;  3P1M A;  1Y56 A;  2GB1 A;  3ZQ4 A;  2XNA C;  3FAH A;  3PZ7 A;  5BYR A;  3GB1 A;  3R2T A;  1EM7 A;  4L23 A;  2N9L A;  1CJE A;  1TKG A;  2BS3 B;  2HTM E;  3BWU D;  2K22 A;  3AEB B;  2V3P A;  1UWX A;  3W2D A;  4XE0 A;  1D6E C;  1Q10 A;  1P7E A;  1V1P A;  2WDQ B;  5G5H A;  4YXD B;  5T8I A;  3FIL B;  2G9H D;  1MI0 A;  1JWS D;  2KN4 A;  1B1Z A;  2CU3 A;  3NRZ A;  1GB1 A;  2INP E;  4L1B A;  2ZW1 A;  1EU3 A;  2YEP F;  1XLQ A;  1LO5 D;  1KH0 A;  2PVG C;  1CZP A;  3MP9 A;  2OED A;  2WDR B;  1PGA A;  4TQ0 A;  1TKE A;  1FD6 A;  3BZD B;  2W82 A;  2PTL A;  4KKJ A;  2WP9 B;  1FMA D;  1VZ6 A;  1GB4 A;  2YEP B;  1BML C;  1JWA D;  1PUT A;  3AEC B;  4HKQ A;  1NYQ A;  1OQR A;  1HEZ E;  1ZOY B;  1YJJ A;  1NEN B;  4B0M A;  3AED B;  3HVD A;  1HQR D;  5BMH A;  2DYM A;  2NTT A;  4A90 A;  1SE2 A;  1D5Z C;  3AE9 B;  5EE1 A;  1IBX A;  4ZHO A;  1ET6 A;  1PGX A;  1GAQ B;  3AE6 B;  2IGG A;  4JWS C;  1XLO A;  3AEE B;  3W5V B;  4A55 A;  1UGJ A;  3AH7 A;  4OHJ A;  2JSV X;  2RPV A;  3MFG A;  4YTM B;  1SEB D;  2LEK A;  4YSY B;  3GP7 A;  1IUE A;  1N62 A;  4N6E B;  5EE3 A;  1DGJ A;  2AQ2 B;  1AWD A;  3LXF A;  1I7H A;  3TEY A;  3U7Z A;  4KX6 B;  2Q5W D;  1UWM A;  1TY0 A;  3VQI A;  1QOG A;  3ZJV A;  2ZW0 A;  1TS5 A;  2WQY B;  1L0X B;  1VR9 A;  4MAC A;  3SFD B;  1I4P A;  2WXN A;  4B0E A;  1L5P A;  1L0Y B;  2AX5 A;  2X38 A;  2KDM A;  1HZ5 A;  4ZOH C;  4MM3 B;  2WXI A;  2PMV A;  4YTP B;  1VZ8 A;  3ZYY X;  2IGH A;  5H8Y E;  1RFK A;  1I4G A;  2WXK A;  1JWB D;  1NYR A;  2LFI A;  3GS2 A;  5FR3 A;  4O1N A;  2Y5C A;  4KGR A;  4WH4 A;  3AEF B;  1JWM D;  1UUP A;  2KWD A;  4WAF A;  2I2Y A;  1SBB B;  1PGB A;  2DWQ A;  5I4D A;  3BYT B;  3AV8 A;  4YSX B;  5LNK 1;  3BVG A;  3IXS A;  3BVM A;  1EU4 A;  4NJC A;  4PT5 A;  1M4V A;  4IKG A;  1FRR A;  2L32 A;  2LUM A;  2WS3 B;  3U2S C;  3C8Y A;  4LLG M;  1FM0 D;  3TEX A;  2PW9 A;  3URY A;  1NVI D;  1PFD A;  1YQ3 B;  3IAS 1;  3KWV A;  4EE2 A;  5JXV A;  2I38 A;  5C2T B;  3V05 A;  1QIL A;  1R7S A;  3P4Q B;  1TKY A;  3ABV B;  1ZDV A;  2BS4 B;  3KWL A;  2WXP A;  1ZXI A;  4KGS A;  1F0Z A;  1C9F A;  5G5G A;  4NAW B;  1FFV A;  3VR9 B;  1I4X A;  1XCT L;  3TEZ A;  5BMG A;  1AN8 A;  1VRA B;  2WXH A;  1K53 A;  4WQM A;  4C56 C;  1AYF A;  2GI9 A;  1DOY A;  2W3S A;  1HA5 A;  1ROE A;  1SJH D;  1T5X D;  1QT9 A;  4IDI A;  3T3N A;  3Q8B A;  1E0Z A;  5FKA C;  3Q8A A;  2PIA A;  3UI3 A;  3R8B A;  1QLB B;  1FFU A;  4RH6 A;  5TSS A;  4ZRP A;  1FO4 A;  3AE5 B;  3CIR B;  3BVZ A;  5HFY A;  1FNW A;  4A6Q A;  4HRS A;  3KLS X;  2V3N A;  1TZO A;  3TEW A;  1RWS A;  4ZHP A;  3PZ8 A;  2BTE A;  5GXG B;  2JWU A;  4MH8 A;  3OWE B;  1C4C A;  1FCL A;  4ITK A;  3SFE B;  2JXT A;  3BK1 A;  2PLP A;  4GDK B;  3VR8 B;  1FNU A;  1AW7 A;  1SJE D;  4REZ A;  2EKI A;  2N7J A;  3P4P B;  4AS1 A;  2K5P A;  4R3D A;  1UNS A;  2W54 A;  4OZC A;  4ARI A;  1C4A A;  3FC4 A;  1E7P B;  2W3R A;  1SE3 A;  4HRO A;  1JQ4 A;  1TS2 A;  2TSS A;  1RM6 C;  2NMQ A;  2LHD A;  2L52 A;  4TSS A;  1YQ4 B;  1J7A A;  1FIQ A;  2WXJ A;  2V0G A;  3DWG C;  2PKO A;  1FEH A;  2IGD A;  1WGK A;  1L6U A;  2FE8 A;  2NTS A;  2Y3A A;  4KKI A;  3SEB A;  2WDV B;  4WIP A;  1KRH A;  4DXF A;  4YWG G;  1XO3 A;  1JRP A;  3EUB 2;  4OW0 A;  2MJE A;  4YT0 B;  1V97 A;  3NVW A;  1ZP0 B;  2EEL A;  4C80 A;  5HI1 A;  3P63 A;  2HDE A;  1VLB A;  4XWT A;  3W1S A;  2J4X A;  5D3D A;  3B2F A;  3HVZ A;  3AE7 B;  3CWI A;  4WWM A;  1I4Q A;  1MVK A;  2RDG A;  2WXG A;  1D5X C;  4RF0 A;  3Q8E A;  1KLG D;  1SSN A;  2K3U A;  4HKZ E;  1SIJ A;  1L4D B;  1E6E B;  2BB5 A;  2MEK A;  3RFZ B;  1MPE A;  1V1P B;  4MT5 A;  4H2A A;  4US9 A;  2N9K A;  3P42 A;  2H88 B;  1XCQ L;  5H92 C;  1ZE3 D;  1J7B A;  1C76 A;  2IPK D;  4XDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...