2R2QA

Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (gabarap1), isoform cra_a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
GFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1 (GABARAP1), Isoform CRA_a.
rcsb
source organism Homo sapiens
molecule tags Signaling protein, protein transport
total genus 36
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2r2qA00
1V80A 1J19A 3IBEA 2IZVB 3HIZA 3PRZA 2MCNB 4KIKA 2ZVOA 3T8MA 3W1SA 5D2MB 1H4RA 3APFA 1WGYA 2M17A 3L08A 3JSVB 3HM6X 4FULA 4PYUA 3EECA 4DBGA 1LM8B 2FNJB 5LXIB 2WWZA 2LUEA 1V49A 1WYWB 3OAWA 1SE9A 1WGRA 2GBJA 2R2QA 3O65B 4LCDE 3V6CB 2N9PC 2V4LA 3H9DA 5DPSA 2PE9A 2EKEC 2DYOA 3C0RB 5CHVC 3NY5A 1WXMA 3S2AA 2KVRA 2DAFA 3PV1A 5FR6A 3VUXA 4EFOA 1YX5B 1V9JA 4W9JA 2LVQA 2MSED 2K39A 2O2VA 4G11A 3ZTCA 1C3TA 5DPTA 2LRUA 4AP4C 2DYBA 4GMVA 2UYZB 4PYZA 1OEYA 3A1QB 3H7PB 5L95C 4W9GA 3PSEB 4JIOU 4M0WB 3UIPB 4A3PA 2PJHA 3RZFA 2O6VD 3CSFA 4F7ZA 2N9EB 2D07B 1P9DU 2DAJA 3K9PB 2AL6A 1K8RB 4WJNA 4ANWA 3ZNZB 3QX1A 2KJRA 2JWZA 5KHOA 1J0GA 3B0AA 3QCAA 3PZDA 1YD8U 2DHZA 2WYQA 4AJYB 3W1SC 4ICUA 3KUDB 3WALA 1V5OA 3DVNU 4RM8A 2JRIB 2C7HA 2JPHA 2W9NA 4ZRIA 2B3AA 2D3GA 4GIVA 4ICVA 2KJHB 1YX6B 2KTRB 2LXCA 2FCNA 3MTNB 4K7SA 4KZCA 4W9HA 1KJTA 1WZ0A 4G50A 2CHWA 3TBLD 3AI5A 1ISNA 2UWQA 2KC2A 4WQOB 3KW5B 1OQYA 2AEHA 3A4SC 2G4SA 1M94A 4NY0A 3VXWA 3RULA 2ZNVB 1WFYA 3WIMA 1LFDA 3A9KA 4KZ0A 2IO2B 1P3QU 3AXCA 3VTWA 1Q0WB 2JUOA 2ZJDA 4M8NA 4WJQA 2KJ6A 1ZW7A 3A9KB 2L00B 2L76A 2AWTA 3ZNHB 5CTRC 4DHJB 1WJUA 4F8CB 3VTUA 3U8ZA 4WJOA 2JZ3B 3WA0A 1WX7A 2LVPA 4GDLA 5EDSA 2KTFA 5TR5A 2CHXA 3QK0A 2V1YA 3OJ3A 2LI5A 4MEMA 3EHVA 3I3TB 2HD5B 2MP2A 2JT4B 4IW0A 1WE6A 2LWPA 3U7DA 1T0YA 4HVBA 3CSTA 3X23A 4HCPB 2K8CA 4K1RB 1Z5SB 2C5LC 3N30A 4ZRJA 4K7UA 2KFKA 4MDKE 1LQBA 3A9JA 2ZZPB 4NQKE 3W1YA 5JHAA 1WX8A 3SDLC 2DZJA 2KNBA 4M8MA 2XEWA 2FCSA 2KD0A 4G3XB 4MH0E 4E74A 1UZXB 5IAAC 3BINA 3N3KB 2C7MB 2C60A 1E90A 2L0TA 3JVZX 4HJKA 4PS7A 2A4ZA 4DDGD 2QHOA 1V86A 2O6VB 4IC7B 2DZIA 2G45B 2IYDB 4W9CA 1LXDA 2ZCCA 3UF8A 1E8YA 2D10A 2N1VA 3KH0A 4DWFA 4W9DA 1TTNA 2LJ5A 1WGGA 2NPTA 4K7WA 4MJSB 1F9JA 2ASQA 2BYFA 4RMAA 4G0NB 1CMXB 1BT0A 2I1JA 2MBOA 2GBNA 3QHTA 4EZKA 2KDEB 3ZTDA 4KDLB 4FLHA 4KIKB 1XD3B 2LVOA 1XQQA 4ASWC 4KSLC 1NI2A 3PREA 2BYVE 1TGZB 4HXDA 3LDZE 2KKCA 4GSWA 4II3B 4TV3A 3DBRI 4EZLA 1WM2A 3APDA 2K25A 1RAXA 1KM7A 2WX0A 3DBSA 3V60A 1UD7A 3ZW3A 2XBBC 2N4FA 4JLCA 1WIAA 2JY6A 2RSUA 1WJ4A 1E8WA 3OJ4B 1R4NI 2LRWA 4HPLB 4EKUA 5HKHA 2KLGA 4MELA 1L2NA 3ZRFA 3H1UA 2J0MA 3SD5A 2MBBB 3DVNV 1GJZA 4ANVA 2VRRB 1WE7A 3ZO5B 2OOBB 4B9KA 2HTHA 2YLMA 2M0XA 2MBEA 1GC7A 1WR1A 3EFUA 3HK0A 5E6NA 1WR6E 3QARA 3DVGY 3IHPC 4WWNA 4XZ4A 2BGFA 1XT9B 1AARA 4CHKA 4ZYNA 2O2VB 3M62B 3VFKA 3HHMA 2GBKA 5J2RA 2D11A 2AYOB 2L05A 4AUQC 4NQLB 2N7EA 1TBEA 4TUUA 4WAAA 5J18A 3KYCD 4TQ0A 4J6IA 3L0WB 3AU5A 1SGHA 2KWUB 4IM3A 2GBMA 2Z0EB 3TMPB 2KWCA 2KQ7A 2MLBA 2PEAA 2NBVB 5JHBA 2FUHB 2HJ8A 4NJ7A 3WANA 2DZKA 2LXAA 3TL5A 3ENEA 3NOBA 3ALBA 4EUTA 4LDTD 1UGMA 1WH3A 3PVLA 5D7GA 2JF5A 1EF5A 4AWJA 2FIDA 2KDBA 4FN2A 2BKFA 4MSMB 3BY4B 4FJZA 2GMIC 2KDFB 2D2QA 2MX2A 4IWQA 2ZPNA 3VUYA 2KHWB 2DYMA 1OTRB 2A5UA 2IY0B 4MM3A 1TZ1A 2K8BA 2M4NA 2IBIB 2M8SA 3P2BA 3VTVA 3ZKJC 1I35A 2ZEQA 3VH4B 3M3JA 1S3SG 3GZNI 2MBQA 4HCNB 3KUZA 1YJ1A 4JQWC 5D94A 4FJYA 3JW0X 4TQ1A 2N7DA 1E8XA 3N32A 3V61A 2PE6B 2KMAA 2CHZA 4CO7A 2RGFA 4OVVA 4BBNF 1WF9A 4WWOA 5AZHA 3R7QA 1FXTB 2LZ6A 2R2OA 3Q3JA 4ZRKA 3VHTC 4MGIE 3VH3B 4PS8A 3K9OB 4GDLB 4GGQA 1WXVA 2CS4A 4OVUA 1U4AA 2MA9B 2ZVNA 4PS3A 2J0KA 3PTFC 5CHFA 4BOZB 2EMTA 3QA8A 1RFAA 2MP2B 4KV2A 5J17A 3QJZA 3PRMB 3QAQA 2XK5A 3RZWC 1UELA 2KOXA 1IPGA 1MG8A 1WGHA 2MW5A 1GC6A 3R66C 1X1MA 4HWIB 3UINB 2KFKB 3RT3B 2BKRB 3PHXB 3A9JB 3KYDD 2KWVB 2L3ZA 3RD2A 4WWPA 3UGBB 5C1ZA 2G3QB 2KDIA 3NZUA 4NAWA 4NNJB 2BF8B 1NBFC 4NPNA 1P0RA 3GOEA 1WI0A 3JYUA 4MGKE 3UQBA 2G4DB 4BKGA 2JRHA 4KVGB 3MJWA 5GMVA 3EC8A 4W9EA 3PT2B 5LLIA 3PLUA 4K81A 2KQSA 4B95A 2KX0A 2AL3A 3TJPA 3RCZA 1E8ZA 2YVCA 3R3MA 4DHZE 2NBWB 2FIFA 2JXXA 1H8CA 4FADA 3B1LX 4W9FA 2FAZA 2GOWA 3L16A 4GN1A 3KVFB 4E3CA 1WRDB 1RLFA 2RD0A 3ZLZA 3DOWA 3R7RA 3SU8X 3QQ8B 2NPTB 3X0WA 1WMHA 3QC8B 3NHEB 2L7RA 2KK8A 4YL8A 3WAOA 1IYFA 2MBHA 2KMCA 4HDOA 4HPMB 4I6LB 1ZGUB 5G55A 4WJPA 3M95A 2I1KA 4FHKA 4W9LA 1WX9A 1KOTA 3VDZA 2LGDA 4DHJD 2KX3A 3L13A 1WJNA 1QZEA 3ML8A 5D6JB 1I42A 4EOYA 3L10B 2K6QA 3JSVA 3PPAA 3QIJA 2J0JA 3A33B 3PGEA 3HM3A 4GB9A 2BYEA 4XC2A 1UH6A 2CU1A 2IO0B 3D32A 5E6PA 1E5WA 3RUIB 2LGYA 2N9XA 1WXSA 3AULA 4DXAB 2MQJA 4BOSC 4FA6A 3ZNID 4A20A 5JZEB 4GU2A 5AEKB 1RRBA 2KO3A 1WY8A 1E7VA 2KFJA 4GOCA 4I6NB 4MGZE 3ONSA 4W9KA 4RM9A 3T9LA 5JH5C 3WAPA 4IWOA 5DPRA 1EF1A 2CR5A 4GDKA 3ZDTA 3CF6E 1V81A 3H6NA 3RYTA 5AZFA 2L0FA 5IA7A 2KZRA 4ANUA 4IM2A 4NJ6A 3A1QA 3H7PA 4I6PA 3IVFA 3B08A 2LGXA 1UBQA 4GDKB 1GNUA 2BPSA 1HE8A 4BKSD 1KLVA 1P1AA 3ZRCA 4MGYE 2V3SA 3DVGX 1J8CA 4IUMB 1VCBA 2Z59B 4IM0A 4EEWA 3SHQA 4BBNC 4ANXA 1WM3A 4DDID 1EO6A 4DK5A 2LD9A 2BWES 4KDIC 1OGWA 2C7NB 2NS5A 3ZUNA 4B6WA 4BVUC 3M63B 2L8JA 4X57B 5BO4B 4AOFA 1GG3A 4GXBA 4AJWA 4HLEA 2IO1B 4A3OA 2KTRA 4BKTA 1G6JA 3DPDA 5KHQA 4KSKC 2REXA 3ZVVA 2WDTB 4F1SA 3UQAA 2JVCA 2K8HA 3QWZB 1Q1OA 3TCAA 4II2B 3MHSD 3ECIA 5CHWA 3DQVA 4N9F4 2NVUI 1WGDA 2FCQA 3NS8A 3IG3A 1IP9A 2IY1B 5E6OA 2DZMA 2MWSB 3ZNGC 1C1YB 3CMMB 1WJ6A 3PRPB 4W9IA 2N1WA 2NBUA 4XX5A 2FCMA 3VAWA 2DX5B 4URKA 5CX3A 4E71A 4FHJA 1ZKHA 1YIWA 2OJRA 3V6EB 4P7IA 1WXAA 4BFRA 2J7QB 3A4RA 4HDQA 2ZPYA 3PS6A 3APCA 4LJOB 1P98A 2Y5BB 3V62A 1YQBA 1Y8RC 1A5RA 2BWFA 3ML9A 2RPQA 2KXJA 5DCNA 2CKHB 2XK5B 5DPWA 3VUWA 2DENB 1VD2A 3L17A 3NZSA 5AZGA 2NCNA 1V2YA 2Z0DB 4TKNA 5G2NA 4EZJA 3VQIA 4FBJB 3UIOB 2C9WB 3DBHI 2GBRA 2NR2A 4CYEA 2K1FA 4LJPB 3DCGA 3U30A 1V6EA 1UBIA 2KN5A 3PLVA 4NAWB 3Q3FA 3H7SA 2K6DB 5L83A 1WZ3A 2PPHA 3VVWB 4MSQB 2HE7A 4DHZB 2ZNVC 4BKSA 1NDDA 3L54A 3ZIMA 1Z2MA 1GUAB 3WAMA 4JL9A 2JZZA 1S1QB 2WX1A 1OEYJ 2LASA 2RR9A 5LXHA 1R4MI 3OLMD 2O6VA 1V5TA 4FJVB 3LJ3A 2EMSA 4LDTB 1D3ZA 3DBLI 2KLCA 4JGHB 1JRUA 3ZDMC 2KC1A 1E7UA 4IG7B 3DDCB 4IWPA 3IFWB 1Q5WB 1WMHB 2KANA 5C23A 1SIFA 4ZDVA 4MJSA 1L7YA 1PQSA 4HK2A 2IO3B 3KUCB 1EUVB 2MRPA 3PHWB 2M1MA 3AU4A 2ZCBA 3TIXA
chains in the Genus database with same CATH superfamily
1V80A 1NI3A 3W1SA 1UGJA 3RI7C 2KACA 1C79A 5IP4D 3L08A 3EGRA 3BVGA 2LUEA 3OAWA 2GBJA 1WGRA 4LCDE 2VZKB 5DPSA 2PE9A 3RFZB 2DYOA 3KWVA 1SBBB 1WXMA 3NVZA 4EFOA 1F1HA 1YX5B 1V9JA 4W9JA 2LVQA 1V97A 3ZTCA 5DPTA 2DYBA 4NZLB 3H7PB 3UIPB 4A3PA 2D07B 3ZNZB 2JWZA 1YD8U 5AUIA 1I4HA 1ET9A 3WALA 1F2RI 2JRIB 2N0SB 4GIVA 2KTRB 5E6JA 2LXCA 2FCNA 3MTNB 4G50A 3TBLD 4WQOB 3KW5B 1E0ZA 1M94A 1E6EB 3FAHA 3RULA 2KQ4X 4OHJA 3VTWA 1PUTA 2ZJDA 1WWTA 2KJ6A 3AEDB 2JWUA 3U8ZA 3CWIA 4WJOA 3VTUA 1DOIA 2PTLA 1WX7A 4GDLA 4ZHPA 1I4GA 3OJ3A 2GRIA 3I3TB 2MP2A 2D3CA 2K0PA 3X23A 2WXGA 2K8CA 3BVMA 4ZRJA 4MDKE 1CZPA 4NQKE 3W1YA 5JHAA 3SDLC 2XEWA 4G3XB 1UZXB 1JROA 1EWYC 4WAFA 1ZUD2 2L0TA 4DDGD 2A4ZA 5EE3A 2O6VB 1FM0D 4B0MA 2IYDB 2DLBA 3UF8A 2KAJA 1NYQA 1ZE3D 1CMXB 2LGSA 2I1JA 4EZKA 5JXVA 4KDLB 4KIKB 2IGGA 1L5PA 4GSWA 4II3B 4EZLA 2KMMA 3DBSA 1RAXA 2N4FA 3LB8C 2JY6A 4HPLB 2LRWA 5HKHA 1L2NA 1F77A 3ZJUA 3SD5A 1I4XA 3DVNV 4ANVA 1GJZA 3ZO5B 4HPPA 2HTHA 2M0XA 3IT6B 1GC7A 1WR1A 3HK0A 1FFVA 3M62B 3VFKA 1TZOA 2VH1A 2GBKA 2L05A 4NQLB 2N7EA 1VLBA 4TQ0A 4J6IA 2CJOA 2KWUB 1QOGA 3BYTB 5HHDG 4WH4A 4L23A 3Q69A 1B9RA 2FUHB 3NVWA 4LDTD 3UI3A 1E10A 3AH7A 1TYGB 4AWJA 4FN2A 2GMIC 2KDFB 2MX2A 2RDHA 2WXRA 2A5UA 1N60A 2K8BA 3AB5A 2ZEQA 3VH4B 4XDDA 4HCNB 2QEJC 4FJYA 1JMLA 4C56C 4N59A 1DGJA 2PKOA 3GB1A 3GE8C 1YN4A 4PS8A 5HI1A 1WXVA 2Y5CA 4PS3A 3PTFC 1MPEA 2XK5A 3RZWC 2KOXA 1IPGA 2W82A 1XLOA 3RT3B 1P7EA 4TSSA 5C1ZA 3NZUA 3P4PB 2X38A 4JWUC 4NPNA 1P0RA 5BYSA 3GOEA 2G4DB 2E6XA 4BKGA 3URYA 5GMVA 5LLIA 3PZ7A 3P4RB 1E8ZA 1JWAD 3L16A 3ZLZA 3R7RA 1TT5B 2NPTB 2BBCA 1L6VA 2Y5PA 1IYFA 1SB3C 1RM6C 2MBHA 3AECB 4HDOA 1FMAD 1TIFA 5G55A 3M95A 4W9LA 1WX9A 2OJWA 4DHJD 2GI9A 1T0RC 5IOIA 1KFYB 1I42A 1KLUD 2K6QA 3JSVA 3PPAA 3QIJA 2BYEA 1UH6A 2CU1A 3D32A 3TEYA 1E5WA 3Q8EA 2MEKA 2LGYA 1WXSA 4N6EB 4FA6A 1JWMD 2CU3A 1PGAA 1BXTA 1WRIA 3FC4A 3BVZA 1MI0A 2DNFA 4XWTA 1EWCA 2LEKA 5EE0A 3U4EG 4GOCA 4MGZE 3ONSA 3BZDB 3WAPA 4IWOA 3CF6E 5IA7A 3RYTA 5AZFA 4KKIA 1YJJA 4IM2A 3NS1A 3KQ4A 3IVFA 2LGXA 3TUOA 3AE9B 2WHIA 4LK0M 1P1AA 2V3SA 3V3XA 2Z59B 1XLNA 2K9XA 5T8IA 4XDCA 3CIRB 3ZUNA 4B6WA 4AOFA 1GG3A 3GS2A 3AE4B 1XLPA 2PMVA 2IO1B 4KSKC 1GB4A 5AUKA 2QILA 4F1SA 3UQAA 4TMAB 2JVCA 2K8HA 1Q1OA 4II2B 1GPXA 2FCQA 3IG3A 2IY1B 5E6OA 2MWSB 3WCQA 1LGRA 4XX5A 4URKA 4OW0A 2BT6A 5D3IB 3V6EB 4P7IA 2BVCA 3A4RA 2ZPYA 3APCA 1P98A 1A5RA 1A70A 2RPQA 5DCNA 4PT5A 3VUWA 2DENB 4MACA 5G2NA 4S0RA 3AE7B 4RNAA 2GBRA 2K1FA 2WLBA 3DCGA 4NAWB 3RNCC 4ARIA 4OZCA 4HEA1 4REZA 3H7SA 2B76B 4MSQB 2HE7A 1V1PB 2ZNVC 1SJED 1Z2MA 2Z8LA 3WAMA 1OEYJ 1JWSD 1V5TA 3HUIA 3AE3B 3LJ3A 2EMSA 3ZDMC 4IWPA 4US8A 3FILA 1SJHD 1SIFA 4ZDVA 3FILB 1L7YA 2LUMA 4HK2A 5EE1A 2MRPA 1F2RC 1J19A 2L32A 2SEBD 1KH0A 1HTOA 3HM6X 4FULA 4PYUA 3HVZA 2YEPB 5LXIB 4C7YA 4WIPA 3O65B 3MJ5A 2K22A 2V4LA 3H9DA 1N62A 2EKEC 2XNAC 3C0RB 2IGDA 3BIID 1QQRA 3L4PA 5FR6A 3VUXA 3DHGC 3Q14C 4G11A 2MJDA 2JZPA 4MT5A 4PYZA 1HZ5A 3ETRA 5L95C 4RF0A 4JIOU 4M0WB 4F7ZA 1P9DU 3K9PB 1FNVA 2AL6A 1K8RB 1TKYA 3QX1A 2KJRA 3B0AA 3QCAA 3IAS1 2DHZA 3KUDB 1B1ZA 1CQVA 4ZOHC 4ZRIA 2B3AA 2D3GA 1JALA 2PLPA 2KJHB 1YX6B 3KLSX 3B2FA 4KZCA 2CHWA 1JWUD 1L0VB 1OQYA 3A4SC 2G4SA 3VXWA 3WIMA 4KZ0A 4P6VF 1Q0WB 1Y56A 2JUOA 3NZ3A 1RYJA 1QOAA 3I9V1 4F8CB 2JZ3B 1UNSA 4RGOS 2M56B 2CHXA 2LI5A 4MEMA 2K3UA 1WE6A 2LWPA 4OZAA 3RPFC 4XYCA 4K1RB 1Z5SB 2C5LC 1HZ6A 5BMIA 1LQBA 1FNUA 3A9JA 2ZZPB 2W54A 3NVVA 2FCSA 3J9CA 1FIQA 2AX5A 5IAAC 3BINA 3N3KB 2C60A 4HJKA 4PS7A 5IN7A 2DZIA 1QOBA 2WXNA 2PVGC 2D3BA 1FRRA 1TTNA 2LJ5A 4C4VA 3ZQ4A 1F9JA 4RMAA 4XWWA 1L4DB 4YSYB 3ZTDA 4FLHA 1XD3B 1YNTE 2LVOA 4ASWC 3PREA 3NG0A 2KKCA 4YTNB 3DBRI 2QDFA 1KM7A 2WX0A 2HDEA 3ZW3A 2XBBC 1WJ4A 1R4NI 4EKUA 4RGTA 3H1UA 2J0MA 1LO5D 1WE7A 1SE4A 2MBEA 1J7CA 2WNMA 3AEGB 5E6NA 3QARA 4XZ4A 4CHKA 4ZYNA 1UF0A 2DBYA 1UWXA 2D11A 5J2RA 4ACFA 1T0SC 2FE8A 4WAAA 3AU5A 1T6BX 3H8HA 1TY2A 3TMPB 2HTME 2PEAA 2NBVB 3AE8B 5JHBA 2HJ8A 3W5VB 2DZKA 2LXAA 3RNGC 1ZDXA 3ENEA 4YT0B 1UGMA 3PVLA 2WXQA 4BAXA 2KDBA 2BKFA 4HRSA 2KYWA 1V8CA 3VUYA 2DYMA 2IY0B 2M4NA 3ZKJC 1V1OA 3M3JA 1S3SG 3PO0A 3KUZA 4JQWC 1YMHE 3N32A 2KMAA 4JE3B 2CHZA 4OVVA 2ONQA 3FKYA 2D5GA 5AZHA 1FXTB 2R2OA 2VZKD 4ZRKA 3VHTC 4MGIE 3VH3B 3K9OB 4GDLB 4GGQA 4A55A 4P16A 2NTSA 2J0KA 5CHFA 4A9AA 2EMTA 1RFAA 2MP2B 5J17A 3QJZA 4K3CA 3QAQA 3MHZA 1I7HA 3R66C 4HWIB 2LFIA 3PHXB 3KYDD 3Q3MC 2KWVB 2L3ZA 3RD2A 3LYYA 4WWPA 2EELA 1TY0A 3GZNB 4NNJB 3JYUA 4KVGB 2J42A 1KLGD 4M02A 1NEKB 3R3MA 2NBWB 1H8CA 3RNFC 4FADA 3B1LX 4W9FA 2FAZA 4NAMA 1FXAA 4ZRPA 1WRDB 2H89B 4LNFA 5TSSA 5MPOA 3DOWA 3QC8B 2L7RA 3WAOA 3ZJTA 1EU4A 4HPMB 2MJEA 1ZGUB 1ZOYB 4AQ7A 4WJPA 3AEAB 2JX5A 5G5HA 1FFUA 4FHKA 1KOTA 2AQ1B 3VDZA 3ZXVA 1J7BA 1HEZE 3Q8CA 3E9SA 2INPE 3PGEA 5E6PA 2WDVB 3MP9A 1GB1A 3AULA 3I57A 1WSPA 2ON8A 3P4QB 2WQYB 4C7ZA 4GU2A 5AEKB 4DQOC 3GP7A 3AE6B 1FD6A 1N63A 2KFJA 4I6NB 4W9KA 3RN9C 4GDKA 4H2AA 2L0FA 4ANUA 2QCZA 3V05A 3ZXRA 4NJ6A 3A1QA 4GDKB 1UBQA 1GNUA 4D2KA 4BKSD 3ZRCA 4JWSC 2I38A 3DBRB 3DVGX 4IUMB 1VCBA 1T3QA 1SIJA 4DXGA 4DK5A 1M4VA 1R4NB 1OGWA 2C7NB 1MJDA 3DHIC 4X57B 4GXBA 4AJWA 3I5JC 4YSZB 4WQMA 4BKTA 1G6JA 3DPDA 1NYRA 1SF0A 5CHWA 2NVUI 3U7ZA 1FO4A 2W55A 1C1YB 2N1WA 2FCMA 2JSVX 2DX5B 1ZKHA 2OJRA 3BK1A 3PS6A 2Y5BB 3ML9A 1C9FA 1ZP0B 2CKHB 2XK5B 3DWGC 2Z0DB 1V2YA 1FCCC 3AM9A 2C9WB 2WXHA 3UIOB 4ZYSA 3TEZA 3ZGZA 1SXTA 2KN5A 3DWMA 3R2IA 5HG2A 3W9CB 3VVWB 4DHZB 3ZYYX 1ZDVA 2V4IB 2GLSA 1S1QB 2RR9A 1BMLC 3DBLI 1JRUA 2M19A 4IG7B 3DDCB 4M01A 1PYWD 1Q5WB 5FK9C 2KANA 3SR6A 1JQ4A 4MJSA 2IO3B 3KUCB 1C78A 1EUVB 3PHWB 2ZCBA 3TIXA 3IBEA 3HIZA 3PRZA 2MCNB 2ACZB 4YSXB 3SFDB 2ZVOA 3DBHB 1ZXHA 1DOYA 2WXJA 5D2MB 4PK1A 3APFA 1WGYA 3JSVB 3EECA 4DBGA 1LM8B 5FR3A 4R3DA 1QKZA 1WYWB 1YOVB 3V6CB 2N9PC 2QMTA 2WDQB 1R4MB 1SEBD 3NY5A 2KVRA 2DAFA 3Q2AC 2MSED 2O2VA 2GB1A 2N9LA 4AP4C 4GMVA 2UYZB 3U2SC 1C76A 3B9JA 4W9GA 3PSEB 4US9A 1OQQA 3RZFA 3CSFA 1C77A 2N9EB 2XN9C 2W3SA 2DAJA 5KHOA 1TKEA 2WYQA 4AJYB 1TKGA 1JW9D 3DVNU 4RM8A 2W9NA 4B0EA 1KJTA 1FNWA 3HVDA 3AI5A 2INNE 2KVZA 1ISNA 2KC2A 2AEHA 2N9KA 4NY0A 1N5WA 3BWUD 1LFDA 2IO2B 3IT4B 1D5ZC 1ZW7A 2L76A 2AWTA 3ZNHB 5CTRC 1WJUA 3N1ZC 3WA0A 5TR5A 2OHFA 3QK0A 5G5GA 3SFEB 1IGDA 2YEPF 4K7UA 2KFKA 1L6UA 1WX8A 2QC8A 2DZJA 3MFGA 2KD0A 1R7SA 3ABVB 1VZ8A 2BS2B 2QHOA 1V86A 4IC7B 2G45B 4W9CA 2VH2A 1LXDA 2ZCCA 1FCLA 1WXQA 2N1VA 3KH0A 4DWFA 1SSNA 4W9DA 4K7WA 1WGGA 2BQQA 2ASQA 2BYFA 4G0NB 2BS3B 2MBOA 4UDUC 2KDEB 3E56A 1I4QA 4KSLC 3T3NA 2BYVE 1TGZB 4YTMB 4P1CC 4TV3A 3Q6BA 2WGSA 2K25A 1VR9A 2Y3AA 3AE5B 2L83A 1K51A 4HKQA 2KLGA 1L4ZB 2KN4A 2IJ0A 2VRRB 2WXOA 2OOBB 1FPYA 3DBLB 4CQNA 3EFUA 1WR6E 1XEEA 3IHPC 1XT9B 3AE1B 2V3NA 3HHMA 5D3DA 3IXSA 5BYQA 1TBEA 3KYCD 1SGHA 4IM3A 4IOIE 2GBMA 3EFCA 3MC8A 1QOFA 2KQ7A 3W2DA 5GXGB 1K50A 3WANA 2INDC 1QT9A 5D7GA 1EF5A 4MSMB 3BY4B 4FJZA 4IWQA 1OTRB 4MM3A 1MG4A 1VJKA 2M8SA 2IBIB 3P63A 3P2BA 3VTVA 4BZAA 4Q2JA 3GZNI 2MBQA 4IDIA 1YJ1A 1MHHE 3JW0X 5C2TB 3V61A 1D4BA 5FKAC 2PE6B 2RGFA 1WF9A 3RNAC 1C4AA 2LZ6A 3Q3JA 1YQ3B 3R8BA 1OFFA 4OVUA 2J4XA 1D6EC 1WYGA 4KV2A 1PGBA 2WXFA 1L0YB 1MG8A 1WGHA 2MW5A 1GC6A 1HQRD 4YWGG 1YN5A 3UINB 3A9JB 1IBXA 1F52A 3UGBB 1QILA 2QJLA 1I4PA 2G3QB 2KT7A 1IBXB 2BF8B 1NBFC 2BYTA 3MC9A 1WI0A 4KGRA 3EC8A 3PT2B 3PLUA 4K81A 4B95A 2AL3A 2N7JA 3TJPA 3RCZA 1AYFA 1VDVA 2YVCA 3NRZA 4DHZE 2FIFA 2JXXA 2AQ3B 4GN1A 3IAM1 4E3CA 1RLFA 2RD0A 4C4VB 3X0WA 1WMHA 2V3PA 1OQRA 2KK8A 4YL8A 2AQ2B 4DXFA 3AEEB 2KMCA 2WXMA 2I1KA 1F0ZA 5BMGA 1YN3A 2JYTA 1WJNA 1E7PB 1QZEA 3ML8A 2ZW0A 3A33B 3HM3A 4XC2A 2IO0B 4KGTA 2LHDA 3RUIB 2N9XA 1FEHA 4DXAB 2MQJA 4BOSC 4IKGA 2M0AA 4KX6B 4XGAB 3ZJVA 1E7VA 4RM9A 5JH5C 3OWEB 2CR5A 2WU5B 3ZDTA 3BYYB 2L1AA 2KZRA 3H7PA 4I6PA 3B08A 2DWQA 3T3OA 4AS1A 1EM7A 2FUG1 2BTEA 3RMKC 1XCQL 3SHQA 4BBNC 4ANXA 1T5XD 4FXCA 1EO6A 2LD9A 2BWES 2FBWB 4LTUA 2L8JA 2K5PA 2WS3B 5BO4B 4HLEA 1N6ZA 2KTRA 3P42A 2WDTB 3QWZB 3N1XC 3MHSD 3DQVA 1WGDA 5H92C 2RDBC 2DZMA 2G9HD 3ZNGC 4LLGM 1L0XB 5CX3A 4A6QA 1YIWA 4RGNA 5IKCM 4HJGE 4LJOB 1YQBA 3NJTA 2BWFA 2KXJA 4LNKA 1Q10A 2PVOD 4J3OD 2RMMA 1GAQB 5DPWA 2R61A 4LNOA 2BW2A 5AZGA 4TKNA 4EZJA 2LJIA 1UWMA 4FBJB 1NENB 2BS4B 3DBHI 1HA5A 4CYEA 4LJPB 3U30A 1UBIA 3PLVA 1WZ3A 1EU3A 1D5XC 4BKSA 1NDDA 1I4RA 4A8XC 4OVZA 4K3BA 1TS5A 4JL9A 2JZZA 5LXHA 2LASA 5BMHA 1R4MI 2PW9A 2O6VA 4KKJA 4LDTB 1UUPA 2KC1A 1E7UA 3IFWB 1PDXA 4N58A 3AMZA 2M1MA 3AU4A 1K53A 2IZVB 4USAA 4KIKA 3RNEC 3T8MA 1H4RA 2M17A 3MC0B 2FNJB 1DOXA 2WWZA 1V49A 3PZ8A 1ET6A 1SE9A 2R2QA 1FRDA 3B2GA 5CHVC 3GE3C 3S2AA 2LMCA 3PV1A 2NTTA 2K39A 1C3TA 3AEBB 2LRUA 2J52A 2JU6X 3AN1A 2PIAA 1OEYA 3A1QB 1ROEA 1IGCA 2PJHA 2WU2B 2IGHA 2O6VD 4HKZE 5LNK1 4WJNA 1QF6A 4ANWA 1XLQA 2JQRB 2G1EA 1J0GA 3PZDA 1ZXIA 3W1SC 4ICUA 1V5OA 1KRHA 5H8YE 2C7HA 2JPHA 3HRDD 4ICVA 4P1BC 4K7SA 4W9HA 1WZ0A 2KWDA 2UWQA 1CK1A 1XCTL 3Q8FA 2ZNVB 4JX1C 2WXIA 3VR9B 1WFYA 3A9KA 1P3QU 3AXCA 1HXYD 4M8NA 4JPSA 4WJQA 3A9KB 2L00B 2MHJA 3LXFA 2RDGA 4DHJB 4XE0A 2ICIA 1SE2A 2BB5A 2LVPA 5EDSA 2KTFA 2V1YA 3EHVA 2HD5B 4IW0A 2JT4B 2NMQA 1T0YA 3U7DA 2Q5WD 1RFKA 4HVBA 2D3AA 3CSTA 2LGIA 4HCPB 3N30A 4YTPB 1D5MC 2WDRB 2MH7A 2KNBA 4M8MA 1HTQA 4MH0E 1KF6B 4E74A 4ITKA 3AV8A 2BB6A 2C7MB 3JVZX 1E90A 1ZPSA 4RF1A 1YJIA 2V0GA 3AE2B 1E8YA 2D10A 3Q3OC 3NVYA 4MJSB 2NPTA 2JYEA 1BT0A 1WGKA 2GBNA 3QHTA 4OZBA 4RH6A 1XQQA 4ARCA 1NI2A 2J53A 4HXDA 3LDZE 3VR8B 1WM2A 3APDA 3V60A 2JXTA 1UD7A 4JLCA 3N20C 1WIAA 2RSUA 3OJ4B 1E8WA 4RGMA 1AW7A 4MELA 3ZRFA 4YXDB 2MBBB 1RWSA 3P4SB 4B9KA 1N5XA 2YLMA 3DHHC 3Q8BA 4WWNA 3DVGY 2BGFA 1AARA 1P7FA 2O2VB 3BK2A 4M00A 1DYQA 2AYOB 4AUQC 3N1YC 4TUUA 5J18A 3L0WB 2MJ3A 1J7AA 2Z0EB 2KWCA 2MLBA 4NJ7A 1AN8A 3TL5A 3U52E 3NOBA 3ALBA 4EUTA 1VZ6A 1WH3A 3RNBC 2JF5A 1QLBB 2FIDA 2V9HA 2D2QA 4ZHOA 2ZPNA 1ACCA 2KHWB 1TZ1A 1MHXA 1E9MA 3O13A 1I35A 2W3RA 3EA6A 1JRPA 5I4DA 5D94A 4TQ1A 2N7DA 1E8XA 4EE2A 4NJCA 4CO7A 4BBNF 4WWOA 3R7QA 1TS3A 3C19A 2CS4A 1U4AA 2MA9B 2ZVNA 4L1BA 3KWLA 1XO3A 4BOZB 2CJNA 3QA8A 1KTKA 3PRMB 2QIEB 1UELA 3P1MA 3AEFB 2IDYA 3OG5A 1X1MA 2KFKB 2BKRB 1AWDA 1PGXA 1IUEA 2I2YA 1BUIC 2KDIA 4NAWA 4MGKE 3UQBA 2JRHA 3MJWA 1STEA 1V1PA 2WP9B 4HROA 4W9EA 1SE3A 1ESFA 3SEBA 1K52A 2KQSA 2KX0A 1VZ7A 1T0QC 3N9YC 2EKIA 2GOWA 3KVFB 3SU8X 3QQ8B 2QSDA 3NHEB 2OEDA 4I6LB 4ZRQA 1N61A 2LGDA 2KX3A 3L13A 4C00A 5D6JB 4EOYA 3L10B 3TEWA 1XXGA 1GOZA 2J0JA 5IO9A 4GB9A 3R2TA 4WURA 2INCC 3C8YA 2TSSA 2L52A 5JZEB 3ZNID 4A20A 1C4CA 2ZW1A 1TS2A 1RRBA 2KDMA 2KO3A 4A90A 1WY8A 4L2YA 3T9LA 5DPRA 1EF1A 3H6NA 1V81A 3Q3NC 4MH8A 2BPSA 4M0WA 1HE8A 1KLVA 4MGYE 3W5UB 1JWBD 1J8CA 3Q8AA 1C4PA 1MFWA 4IM0A 3VRBB 4EEWA 1WM3A 4DDID 4KDIC 2WXKA 3VRAB 4LNIA 1NVID 2NS5A 4BVUC 3M63B 4QAYA 3TSSA 4A3OA 5KHQA 4MM3B 2REXA 4LNNA 3ZVVA 2E3TA 2SAKA 3TCAA 3ECIA 4N9F4 3NS8A 4RCOA 2HJ1A 1JCKB 1IP9A 3CMMB 1WJ6A 3PRPB 4W9IA 2NBUA 3VAWA 4O1NA 4E71A 4FHJA 1FXIA 1VRAB 1WXAA 4BFRA 2J7QB 4HDQA 4GLSC 3I63C 3V62A 1Y8RC 5EE9A 3NUHB 4RFBA 1VD2A 3L17A 3NZSA 2NCNA 5C3JB 3VQIA 2UU7A 2RPVA 1CJEA 5HFYA 1YQ4B 1TJEA 2NR2A 1XF5L 2H88B 1V6EA 3Q3FA 3EUB2 2K6DB 5L83A 2PPHA 4S17A 3L54A 3ZIMA 1GUAB 4WWMA 2WX1A 1PFDA 3OLMD 4FJVB 5BYRA 2LHEA 3TEXA 1D3ZA 4C80A 4JGHB 2KLCA 2IPKD 2X8XX 4KGSA 1MVKA 2WXPA 1WMHB 1ENFA 5C23A 1PQSA 2WXLA 1TS4A
chains in the Genus database with same CATH topology
1V80A 1J19A 3IBEA 2IZVB 3HIZA 3PRZA 2MCNB 4KIKA 2ZVOA 3T8MA 3W1SA 5D2MB 1H4RA 3APFA 1WGYA 2M17A 3L08A 3JSVB 3HM6X 4FULA 4PYUA 3EECA 4DBGA 1LM8B 2FNJB 5LXIB 2WWZA 2LUEA 1V49A 1WYWB 3OAWA 1SE9A 1WGRA 2GBJA 2R2QA 3O65B 4LCDE 3V6CB 2N9PC 2V4LA 3H9DA 5DPSA 2PE9A 2EKEC 2DYOA 3C0RB 5CHVC 3NY5A 1WXMA 3S2AA 2KVRA 2DAFA 3PV1A 5FR6A 3VUXA 4EFOA 1YX5B 1V9JA 4W9JA 2LVQA 2MSED 2K39A 2O2VA 4G11A 3ZTCA 1C3TA 5DPTA 2LRUA 4AP4C 2DYBA 4GMVA 2UYZB 4PYZA 1OEYA 3A1QB 3H7PB 5L95C 4W9GA 3PSEB 4JIOU 4M0WB 3UIPB 4A3PA 2PJHA 3RZFA 2O6VD 3CSFA 4F7ZA 2N9EB 2D07B 1P9DU 2DAJA 3K9PB 2AL6A 1K8RB 4WJNA 4ANWA 3ZNZB 3QX1A 2KJRA 2JWZA 5KHOA 1J0GA 3B0AA 3QCAA 3PZDA 1YD8U 2DHZA 2WYQA 4AJYB 3W1SC 4ICUA 3KUDB 3WALA 1V5OA 3DVNU 4RM8A 2JRIB 2C7HA 2JPHA 2W9NA 4ZRIA 2B3AA 2D3GA 4GIVA 4ICVA 2KJHB 1YX6B 2KTRB 2LXCA 2FCNA 3MTNB 4K7SA 4KZCA 4W9HA 1KJTA 1WZ0A 4G50A 2CHWA 3TBLD 3AI5A 1ISNA 2UWQA 2KC2A 4WQOB 3KW5B 1OQYA 2AEHA 3A4SC 2G4SA 1M94A 4NY0A 3VXWA 3RULA 2ZNVB 1WFYA 3WIMA 1LFDA 3A9KA 4KZ0A 2IO2B 1P3QU 3AXCA 3VTWA 1Q0WB 2JUOA 2ZJDA 4M8NA 4WJQA 2KJ6A 1ZW7A 3A9KB 2L00B 2L76A 2AWTA 3ZNHB 5CTRC 4DHJB 1WJUA 4F8CB 3VTUA 3U8ZA 4WJOA 2JZ3B 3WA0A 1WX7A 2LVPA 4GDLA 5EDSA 2KTFA 5TR5A 2CHXA 3QK0A 2V1YA 3OJ3A 2LI5A 4MEMA 3EHVA 3I3TB 2HD5B 2MP2A 2JT4B 4IW0A 1WE6A 2LWPA 3U7DA 1T0YA 4HVBA 3CSTA 3X23A 4HCPB 2K8CA 4K1RB 1Z5SB 2C5LC 3N30A 4ZRJA 4K7UA 2KFKA 4MDKE 1LQBA 3A9JA 2ZZPB 4NQKE 3W1YA 5JHAA 1WX8A 3SDLC 2DZJA 2KNBA 4M8MA 2XEWA 2FCSA 2KD0A 4G3XB 4MH0E 4E74A 1UZXB 5IAAC 3BINA 3N3KB 2C7MB 2C60A 1E90A 2L0TA 3JVZX 4HJKA 4PS7A 2A4ZA 4DDGD 2QHOA 1V86A 2O6VB 4IC7B 2DZIA 2G45B 2IYDB 4W9CA 1LXDA 2ZCCA 3UF8A 1E8YA 2D10A 2N1VA 3KH0A 4DWFA 4W9DA 1TTNA 2LJ5A 1WGGA 2NPTA 4K7WA 4MJSB 1F9JA 2ASQA 2BYFA 4RMAA 4G0NB 1CMXB 1BT0A 2I1JA 2MBOA 2GBNA 3QHTA 4EZKA 2KDEB 3ZTDA 4KDLB 4FLHA 4KIKB 1XD3B 2LVOA 1XQQA 4ASWC 4KSLC 1NI2A 3PREA 2BYVE 1TGZB 4HXDA 3LDZE 2KKCA 4GSWA 4II3B 4TV3A 3DBRI 4EZLA 1WM2A 3APDA 2K25A 1RAXA 1KM7A 2WX0A 3DBSA 3V60A 1UD7A 3ZW3A 2XBBC 2N4FA 4JLCA 1WIAA 2JY6A 2RSUA 1WJ4A 1E8WA 3OJ4B 1R4NI 2LRWA 4HPLB 4EKUA 5HKHA 2KLGA 4MELA 1L2NA 3ZRFA 3H1UA 2J0MA 3SD5A 2MBBB 3DVNV 1GJZA 4ANVA 2VRRB 1WE7A 3ZO5B 2OOBB 4B9KA 2HTHA 2YLMA 2M0XA 2MBEA 1GC7A 1WR1A 3EFUA 3HK0A 5E6NA 1WR6E 3QARA 3DVGY 3IHPC 4WWNA 4XZ4A 2BGFA 1XT9B 1AARA 4CHKA 4ZYNA 2O2VB 3M62B 3VFKA 3HHMA 2GBKA 5J2RA 2D11A 2AYOB 2L05A 4AUQC 4NQLB 2N7EA 1TBEA 4TUUA 4WAAA 5J18A 3KYCD 4TQ0A 4J6IA 3L0WB 3AU5A 1SGHA 2KWUB 4IM3A 2GBMA 2Z0EB 3TMPB 2KWCA 2KQ7A 2MLBA 2PEAA 2NBVB 5JHBA 2FUHB 2HJ8A 4NJ7A 3WANA 2DZKA 2LXAA 3TL5A 3ENEA 3NOBA 3ALBA 4EUTA 4LDTD 1UGMA 1WH3A 3PVLA 5D7GA 2JF5A 1EF5A 4AWJA 2FIDA 2KDBA 4FN2A 2BKFA 4MSMB 3BY4B 4FJZA 2GMIC 2KDFB 2D2QA 2MX2A 4IWQA 2ZPNA 3VUYA 2KHWB 2DYMA 1OTRB 2A5UA 2IY0B 4MM3A 1TZ1A 2K8BA 2M4NA 2IBIB 2M8SA 3P2BA 3VTVA 3ZKJC 1I35A 2ZEQA 3VH4B 3M3JA 1S3SG 3GZNI 2MBQA 4HCNB 3KUZA 1YJ1A 4JQWC 5D94A 4FJYA 3JW0X 4TQ1A 2N7DA 1E8XA 3N32A 3V61A 2PE6B 2KMAA 2CHZA 4CO7A 2RGFA 4OVVA 4BBNF 1WF9A 4WWOA 5AZHA 3R7QA 1FXTB 2LZ6A 2R2OA 3Q3JA 4ZRKA 3VHTC 4MGIE 3VH3B 4PS8A 3K9OB 4GDLB 4GGQA 1WXVA 2CS4A 4OVUA 1U4AA 2MA9B 2ZVNA 4PS3A 2J0KA 3PTFC 5CHFA 4BOZB 2EMTA 3QA8A 1RFAA 2MP2B 4KV2A 5J17A 3QJZA 3PRMB 3QAQA 2XK5A 3RZWC 1UELA 2KOXA 1IPGA 1MG8A 1WGHA 2MW5A 1GC6A 3R66C 1X1MA 4HWIB 3UINB 2KFKB 3RT3B 2BKRB 3PHXB 3A9JB 3KYDD 2KWVB 2L3ZA 3RD2A 4WWPA 3UGBB 5C1ZA 2G3QB 2KDIA 3NZUA 4NAWA 4NNJB 2BF8B 1NBFC 4NPNA 1P0RA 3GOEA 1WI0A 3JYUA 4MGKE 3UQBA 2G4DB 4BKGA 2JRHA 4KVGB 3MJWA 5GMVA 3EC8A 4W9EA 3PT2B 5LLIA 3PLUA 4K81A 2KQSA 4B95A 2KX0A 2AL3A 3TJPA 3RCZA 1E8ZA 2YVCA 3R3MA 4DHZE 2NBWB 2FIFA 2JXXA 1H8CA 4FADA 3B1LX 4W9FA 2FAZA 2GOWA 3L16A 4GN1A 3KVFB 4E3CA 1WRDB 1RLFA 2RD0A 3ZLZA 3DOWA 3R7RA 3SU8X 3QQ8B 2NPTB 3X0WA 1WMHA 3QC8B 3NHEB 2L7RA 2KK8A 4YL8A 3WAOA 1IYFA 2MBHA 2KMCA 4HDOA 4HPMB 4I6LB 1ZGUB 5G55A 4WJPA 3M95A 2I1KA 4FHKA 4W9LA 1WX9A 1KOTA 3VDZA 2LGDA 4DHJD 2KX3A 3L13A 1WJNA 1QZEA 3ML8A 5D6JB 1I42A 4EOYA 3L10B 2K6QA 3JSVA 3PPAA 3QIJA 2J0JA 3A33B 3PGEA 3HM3A 4GB9A 2BYEA 4XC2A 1UH6A 2CU1A 2IO0B 3D32A 5E6PA 1E5WA 3RUIB 2LGYA 2N9XA 1WXSA 3AULA 4DXAB 2MQJA 4BOSC 4FA6A 3ZNID 4A20A 5JZEB 4GU2A 5AEKB 1RRBA 2KO3A 1WY8A 1E7VA 2KFJA 4GOCA 4I6NB 4MGZE 3ONSA 4W9KA 4RM9A 3T9LA 5JH5C 3WAPA 4IWOA 5DPRA 1EF1A 2CR5A 4GDKA 3ZDTA 3CF6E 1V81A 3H6NA 3RYTA 5AZFA 2L0FA 5IA7A 2KZRA 4ANUA 4IM2A 4NJ6A 3A1QA 3H7PA 4I6PA 3IVFA 3B08A 2LGXA 1UBQA 4GDKB 1GNUA 2BPSA 1HE8A 4BKSD 1KLVA 1P1AA 3ZRCA 4MGYE 2V3SA 3DVGX 1J8CA 4IUMB 1VCBA 2Z59B 4IM0A 4EEWA 3SHQA 4BBNC 4ANXA 1WM3A 4DDID 1EO6A 4DK5A 2LD9A 2BWES 4KDIC 1OGWA 2C7NB 2NS5A 3ZUNA 4B6WA 4BVUC 3M63B 2L8JA 4X57B 5BO4B 4AOFA 1GG3A 4GXBA 4AJWA 4HLEA 2IO1B 4A3OA 2KTRA 4BKTA 1G6JA 3DPDA 5KHQA 4KSKC 2REXA 3ZVVA 2WDTB 4F1SA 3UQAA 2JVCA 2K8HA 3QWZB 1Q1OA 3TCAA 4II2B 3MHSD 3ECIA 5CHWA 3DQVA 4N9F4 2NVUI 1WGDA 2FCQA 3NS8A 3IG3A 1IP9A 2IY1B 5E6OA 2DZMA 2MWSB 3ZNGC 1C1YB 3CMMB 1WJ6A 3PRPB 4W9IA 2N1WA 2NBUA 4XX5A 2FCMA 3VAWA 2DX5B 4URKA 5CX3A 4E71A 4FHJA 1ZKHA 1YIWA 2OJRA 3V6EB 4P7IA 1WXAA 4BFRA 2J7QB 3A4RA 4HDQA 2ZPYA 3PS6A 3APCA 4LJOB 1P98A 2Y5BB 3V62A 1YQBA 1Y8RC 1A5RA 2BWFA 3ML9A 2RPQA 2KXJA 5DCNA 2CKHB 2XK5B 5DPWA 3VUWA 2DENB 1VD2A 3L17A 3NZSA 5AZGA 2NCNA 1V2YA 2Z0DB 4TKNA 5G2NA 4EZJA 3VQIA 4FBJB 3UIOB 2C9WB 3DBHI 2GBRA 2NR2A 4CYEA 2K1FA 4LJPB 3DCGA 3U30A 1V6EA 1UBIA 2KN5A 3PLVA 4NAWB 3Q3FA 3H7SA 2K6DB 5L83A 1WZ3A 2PPHA 3VVWB 4MSQB 2HE7A 4DHZB 2ZNVC 4BKSA 1NDDA 3L54A 3ZIMA 1Z2MA 1GUAB 3WAMA 4JL9A 2JZZA 1S1QB 2WX1A 1OEYJ 2LASA 2RR9A 5LXHA 1R4MI 3OLMD 2O6VA 1V5TA 4FJVB 3LJ3A 2EMSA 4LDTB 1D3ZA 3DBLI 2KLCA 4JGHB 1JRUA 3ZDMC 2KC1A 1E7UA 4IG7B 3DDCB 4IWPA 3IFWB 1Q5WB 1WMHB 2KANA 5C23A 1SIFA 4ZDVA 4MJSA 1L7YA 1PQSA 4HK2A 2IO3B 3KUCB 1EUVB 2MRPA 3PHWB 2M1MA 3AU4A 2ZCBA 3TIXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V80 A;  1J19 A;  3IBE A;  2IZV B;  3HIZ A;  3PRZ A;  2MCN B;  4KIK A;  2ZVO A;  3T8M A;  3W1S A;  5D2M B;  1H4R A;  3APF A;  1WGY A;  2M17 A;  3L08 A;  3JSV B;  3HM6 X;  4FUL A;  4PYU A;  3EEC A;  4DBG A;  1LM8 B;  2FNJ B;  5LXI B;  2WWZ A;  2LUE A;  1V49 A;  1WYW B;  3OAW A;  1SE9 A;  1WGR A;  2GBJ A;  2R2Q A;  3O65 B;  4LCD E;  3V6C B;  2N9P C;  2V4L A;  3H9D A;  5DPS A;  2PE9 A;  2EKE C;  2DYO A;  3C0R B;  5CHV C;  3NY5 A;  1WXM A;  3S2A A;  2KVR A;  2DAF A;  3PV1 A;  5FR6 A;  3VUX A;  4EFO A;  1YX5 B;  1V9J A;  4W9J A;  2LVQ A;  2MSE D;  2K39 A;  2O2V A;  4G11 A;  3ZTC A;  1C3T A;  5DPT A;  2LRU A;  4AP4 C;  2DYB A;  4GMV A;  2UYZ B;  4PYZ A;  1OEY A;  3A1Q B;  3H7P B;  5L95 C;  4W9G A;  3PSE B;  4JIO U;  4M0W B;  3UIP B;  4A3P A;  2PJH A;  3RZF A;  2O6V D;  3CSF A;  4F7Z A;  2N9E B;  2D07 B;  1P9D U;  2DAJ A;  3K9P B;  2AL6 A;  1K8R B;  4WJN A;  4ANW A;  3ZNZ B;  3QX1 A;  2KJR A;  2JWZ A;  5KHO A;  1J0G A;  3B0A A;  3QCA A;  3PZD A;  1YD8 U;  2DHZ A;  2WYQ A;  4AJY B;  3W1S C;  4ICU A;  3KUD B;  3WAL A;  1V5O A;  3DVN U;  4RM8 A;  2JRI B;  2C7H A;  2JPH A;  2W9N A;  4ZRI A;  2B3A A;  2D3G A;  4GIV A;  4ICV A;  2KJH B;  1YX6 B;  2KTR B;  2LXC A;  2FCN A;  3MTN B;  4K7S A;  4KZC A;  4W9H A;  1KJT A;  1WZ0 A;  4G50 A;  2CHW A;  3TBL D;  3AI5 A;  1ISN A;  2UWQ A;  2KC2 A;  4WQO B;  3KW5 B;  1OQY A;  2AEH A;  3A4S C;  2G4S A;  1M94 A;  4NY0 A;  3VXW A;  3RUL A;  2ZNV B;  1WFY A;  3WIM A;  1LFD A;  3A9K A;  4KZ0 A;  2IO2 B;  1P3Q U;  3AXC A;  3VTW A;  1Q0W B;  2JUO A;  2ZJD A;  4M8N A;  4WJQ A;  2KJ6 A;  1ZW7 A;  3A9K B;  2L00 B;  2L76 A;  2AWT A;  3ZNH B;  5CTR C;  4DHJ B;  1WJU A;  4F8C B;  3VTU A;  3U8Z A;  4WJO A;  2JZ3 B;  3WA0 A;  1WX7 A;  2LVP A;  4GDL A;  5EDS A;  2KTF A;  5TR5 A;  2CHX A;  3QK0 A;  2V1Y A;  3OJ3 A;  2LI5 A;  4MEM A;  3EHV A;  3I3T B;  2HD5 B;  2MP2 A;  2JT4 B;  4IW0 A;  1WE6 A;  2LWP A;  3U7D A;  1T0Y A;  4HVB A;  3CST A;  3X23 A;  4HCP B;  2K8C A;  4K1R B;  1Z5S B;  2C5L C;  3N30 A;  4ZRJ A;  4K7U A;  2KFK A;  4MDK E;  1LQB A;  3A9J A;  2ZZP B;  4NQK E;  3W1Y A;  5JHA A;  1WX8 A;  3SDL C;  2DZJ A;  2KNB A;  4M8M A;  2XEW A;  2FCS A;  2KD0 A;  4G3X B;  4MH0 E;  4E74 A;  1UZX B;  5IAA C;  3BIN A;  3N3K B;  2C7M B;  2C60 A;  1E90 A;  2L0T A;  3JVZ X;  4HJK A;  4PS7 A;  2A4Z A;  4DDG D;  2QHO A;  1V86 A;  2O6V B;  4IC7 B;  2DZI A;  2G45 B;  2IYD B;  4W9C A;  1LXD A;  2ZCC A;  3UF8 A;  1E8Y A;  2D10 A;  2N1V A;  3KH0 A;  4DWF A;  4W9D A;  1TTN A;  2LJ5 A;  1WGG A;  2NPT A;  4K7W A;  4MJS B;  1F9J A;  2ASQ A;  2BYF A;  4RMA A;  4G0N B;  1CMX B;  1BT0 A;  2I1J A;  2MBO A;  2GBN A;  3QHT A;  4EZK A;  2KDE B;  3ZTD A;  4KDL B;  4FLH A;  4KIK B;  1XD3 B;  2LVO A;  1XQQ A;  4ASW C;  4KSL C;  1NI2 A;  3PRE A;  2BYV E;  1TGZ B;  4HXD A;  3LDZ E;  2KKC A;  4GSW A;  4II3 B;  4TV3 A;  3DBR I;  4EZL A;  1WM2 A;  3APD A;  2K25 A;  1RAX A;  1KM7 A;  2WX0 A;  3DBS A;  3V60 A;  1UD7 A;  3ZW3 A;  2XBB C;  2N4F A;  4JLC A;  1WIA A;  2JY6 A;  2RSU A;  1WJ4 A;  1E8W A;  3OJ4 B;  1R4N I;  2LRW A;  4HPL B;  4EKU A;  5HKH A;  2KLG A;  4MEL A;  1L2N A;  3ZRF A;  3H1U A;  2J0M A;  3SD5 A;  2MBB B;  3DVN V;  1GJZ A;  4ANV A;  2VRR B;  1WE7 A;  3ZO5 B;  2OOB B;  4B9K A;  2HTH A;  2YLM A;  2M0X A;  2MBE A;  1GC7 A;  1WR1 A;  3EFU A;  3HK0 A;  5E6N A;  1WR6 E;  3QAR A;  3DVG Y;  3IHP C;  4WWN A;  4XZ4 A;  2BGF A;  1XT9 B;  1AAR A;  4CHK A;  4ZYN A;  2O2V B;  3M62 B;  3VFK A;  3HHM A;  2GBK A;  5J2R A;  2D11 A;  2AYO B;  2L05 A;  4AUQ C;  4NQL B;  2N7E A;  1TBE A;  4TUU A;  4WAA A;  5J18 A;  3KYC D;  4TQ0 A;  4J6I A;  3L0W B;  3AU5 A;  1SGH A;  2KWU B;  4IM3 A;  2GBM A;  2Z0E B;  3TMP B;  2KWC A;  2KQ7 A;  2MLB A;  2PEA A;  2NBV B;  5JHB A;  2FUH B;  2HJ8 A;  4NJ7 A;  3WAN A;  2DZK A;  2LXA A;  3TL5 A;  3ENE A;  3NOB A;  3ALB A;  4EUT A;  4LDT D;  1UGM A;  1WH3 A;  3PVL A;  5D7G A;  2JF5 A;  1EF5 A;  4AWJ A;  2FID A;  2KDB A;  4FN2 A;  2BKF A;  4MSM B;  3BY4 B;  4FJZ A;  2GMI C;  2KDF B;  2D2Q A;  2MX2 A;  4IWQ A;  2ZPN A;  3VUY A;  2KHW B;  2DYM A;  1OTR B;  2A5U A;  2IY0 B;  4MM3 A;  1TZ1 A;  2K8B A;  2M4N A;  2IBI B;  2M8S A;  3P2B A;  3VTV A;  3ZKJ C;  1I35 A;  2ZEQ A;  3VH4 B;  3M3J A;  1S3S G;  3GZN I;  2MBQ A;  4HCN B;  3KUZ A;  1YJ1 A;  4JQW C;  5D94 A;  4FJY A;  3JW0 X;  4TQ1 A;  2N7D A;  1E8X A;  3N32 A;  3V61 A;  2PE6 B;  2KMA A;  2CHZ A;  4CO7 A;  2RGF A;  4OVV A;  4BBN F;  1WF9 A;  4WWO A;  5AZH A;  3R7Q A;  1FXT B;  2LZ6 A;  2R2O A;  3Q3J A;  4ZRK A;  3VHT C;  4MGI E;  3VH3 B;  4PS8 A;  3K9O B;  4GDL B;  4GGQ A;  1WXV A;  2CS4 A;  4OVU A;  1U4A A;  2MA9 B;  2ZVN A;  4PS3 A;  2J0K A;  3PTF C;  5CHF A;  4BOZ B;  2EMT A;  3QA8 A;  1RFA A;  2MP2 B;  4KV2 A;  5J17 A;  3QJZ A;  3PRM B;  3QAQ A;  2XK5 A;  3RZW C;  1UEL A;  2KOX A;  1IPG A;  1MG8 A;  1WGH A;  2MW5 A;  1GC6 A;  3R66 C;  1X1M A;  4HWI B;  3UIN B;  2KFK B;  3RT3 B;  2BKR B;  3PHX B;  3A9J B;  3KYD D;  2KWV B;  2L3Z A;  3RD2 A;  4WWP A;  3UGB B;  5C1Z A;  2G3Q B;  2KDI A;  3NZU A;  4NAW A;  4NNJ B;  2BF8 B;  1NBF C;  4NPN A;  1P0R A;  3GOE A;  1WI0 A;  3JYU A;  4MGK E;  3UQB A;  2G4D B;  4BKG A;  2JRH A;  4KVG B;  3MJW A;  5GMV A;  3EC8 A;  4W9E A;  3PT2 B;  5LLI A;  3PLU A;  4K81 A;  2KQS A;  4B95 A;  2KX0 A;  2AL3 A;  3TJP A;  3RCZ A;  1E8Z A;  2YVC A;  3R3M A;  4DHZ E;  2NBW B;  2FIF A;  2JXX A;  1H8C A;  4FAD A;  3B1L X;  4W9F A;  2FAZ A;  2GOW A;  3L16 A;  4GN1 A;  3KVF B;  4E3C A;  1WRD B;  1RLF A;  2RD0 A;  3ZLZ A;  3DOW A;  3R7R A;  3SU8 X;  3QQ8 B;  2NPT B;  3X0W A;  1WMH A;  3QC8 B;  3NHE B;  2L7R A;  2KK8 A;  4YL8 A;  3WAO A;  1IYF A;  2MBH A;  2KMC A;  4HDO A;  4HPM B;  4I6L B;  1ZGU B;  5G55 A;  4WJP A;  3M95 A;  2I1K A;  4FHK A;  4W9L A;  1WX9 A;  1KOT A;  3VDZ A;  2LGD A;  4DHJ D;  2KX3 A;  3L13 A;  1WJN A;  1QZE A;  3ML8 A;  5D6J B;  1I42 A;  4EOY A;  3L10 B;  2K6Q A;  3JSV A;  3PPA A;  3QIJ A;  2J0J A;  3A33 B;  3PGE A;  3HM3 A;  4GB9 A;  2BYE A;  4XC2 A;  1UH6 A;  2CU1 A;  2IO0 B;  3D32 A;  5E6P A;  1E5W A;  3RUI B;  2LGY A;  2N9X A;  1WXS A;  3AUL A;  4DXA B;  2MQJ A;  4BOS C;  4FA6 A;  3ZNI D;  4A20 A;  5JZE B;  4GU2 A;  5AEK B;  1RRB A;  2KO3 A;  1WY8 A;  1E7V A;  2KFJ A;  4GOC A;  4I6N B;  4MGZ E;  3ONS A;  4W9K A;  4RM9 A;  3T9L A;  5JH5 C;  3WAP A;  4IWO A;  5DPR A;  1EF1 A;  2CR5 A;  4GDK A;  3ZDT A;  3CF6 E;  1V81 A;  3H6N A;  3RYT A;  5AZF A;  2L0F A;  5IA7 A;  2KZR A;  4ANU A;  4IM2 A;  4NJ6 A;  3A1Q A;  3H7P A;  4I6P A;  3IVF A;  3B08 A;  2LGX A;  1UBQ A;  4GDK B;  1GNU A;  2BPS A;  1HE8 A;  4BKS D;  1KLV A;  1P1A A;  3ZRC A;  4MGY E;  2V3S A;  3DVG X;  1J8C A;  4IUM B;  1VCB A;  2Z59 B;  4IM0 A;  4EEW A;  3SHQ A;  4BBN C;  4ANX A;  1WM3 A;  4DDI D;  1EO6 A;  4DK5 A;  2LD9 A;  2BWE S;  4KDI C;  1OGW A;  2C7N B;  2NS5 A;  3ZUN A;  4B6W A;  4BVU C;  3M63 B;  2L8J A;  4X57 B;  5BO4 B;  4AOF A;  1GG3 A;  4GXB A;  4AJW A;  4HLE A;  2IO1 B;  4A3O A;  2KTR A;  4BKT A;  1G6J A;  3DPD A;  5KHQ A;  4KSK C;  2REX A;  3ZVV A;  2WDT B;  4F1S A;  3UQA A;  2JVC A;  2K8H A;  3QWZ B;  1Q1O A;  3TCA A;  4II2 B;  3MHS D;  3ECI A;  5CHW A;  3DQV A;  4N9F 4;  2NVU I;  1WGD A;  2FCQ A;  3NS8 A;  3IG3 A;  1IP9 A;  2IY1 B;  5E6O A;  2DZM A;  2MWS B;  3ZNG C;  1C1Y B;  3CMM B;  1WJ6 A;  3PRP B;  4W9I A;  2N1W A;  2NBU A;  4XX5 A;  2FCM A;  3VAW A;  2DX5 B;  4URK A;  5CX3 A;  4E71 A;  4FHJ A;  1ZKH A;  1YIW A;  2OJR A;  3V6E B;  4P7I A;  1WXA A;  4BFR A;  2J7Q B;  3A4R A;  4HDQ A;  2ZPY A;  3PS6 A;  3APC A;  4LJO B;  1P98 A;  2Y5B B;  3V62 A;  1YQB A;  1Y8R C;  1A5R A;  2BWF A;  3ML9 A;  2RPQ A;  2KXJ A;  5DCN A;  2CKH B;  2XK5 B;  5DPW A;  3VUW A;  2DEN B;  1VD2 A;  3L17 A;  3NZS A;  5AZG A;  2NCN A;  1V2Y A;  2Z0D B;  4TKN A;  5G2N A;  4EZJ A;  3VQI A;  4FBJ B;  3UIO B;  2C9W B;  3DBH I;  2GBR A;  2NR2 A;  4CYE A;  2K1F A;  4LJP B;  3DCG A;  3U30 A;  1V6E A;  1UBI A;  2KN5 A;  3PLV A;  4NAW B;  3Q3F A;  3H7S A;  2K6D B;  5L83 A;  1WZ3 A;  2PPH A;  3VVW B;  4MSQ B;  2HE7 A;  4DHZ B;  2ZNV C;  4BKS A;  1NDD A;  3L54 A;  3ZIM A;  1Z2M A;  1GUA B;  3WAM A;  4JL9 A;  2JZZ A;  1S1Q B;  2WX1 A;  1OEY J;  2LAS A;  2RR9 A;  5LXH A;  1R4M I;  3OLM D;  2O6V A;  1V5T A;  4FJV B;  3LJ3 A;  2EMS A;  4LDT B;  1D3Z A;  3DBL I;  2KLC A;  4JGH B;  1JRU A;  3ZDM C;  2KC1 A;  1E7U A;  4IG7 B;  3DDC B;  4IWP A;  3IFW B;  1Q5W B;  1WMH B;  2KAN A;  5C23 A;  1SIF A;  4ZDV A;  4MJS A;  1L7Y A;  1PQS A;  4HK2 A;  2IO3 B;  3KUC B;  1EUV B;  2MRP A;  3PHW B;  2M1M A;  3AU4 A;  2ZCB A;  3TIX A; 
#chains in the Genus database with same CATH topology
 1V80 A;  1NI3 A;  3W1S A;  1UGJ A;  3RI7 C;  2KAC A;  1C79 A;  5IP4 D;  3L08 A;  3EGR A;  3BVG A;  2LUE A;  3OAW A;  2GBJ A;  1WGR A;  4LCD E;  2VZK B;  5DPS A;  2PE9 A;  3RFZ B;  2DYO A;  3KWV A;  1SBB B;  1WXM A;  3NVZ A;  4EFO A;  1F1H A;  1YX5 B;  1V9J A;  4W9J A;  2LVQ A;  1V97 A;  3ZTC A;  5DPT A;  2DYB A;  4NZL B;  3H7P B;  3UIP B;  4A3P A;  2D07 B;  3ZNZ B;  2JWZ A;  1YD8 U;  5AUI A;  1I4H A;  1ET9 A;  3WAL A;  1F2R I;  2JRI B;  2N0S B;  4GIV A;  2KTR B;  5E6J A;  2LXC A;  2FCN A;  3MTN B;  4G50 A;  3TBL D;  4WQO B;  3KW5 B;  1E0Z A;  1M94 A;  1E6E B;  3FAH A;  3RUL A;  2KQ4 X;  4OHJ A;  3VTW A;  1PUT A;  2ZJD A;  1WWT A;  2KJ6 A;  3AED B;  2JWU A;  3U8Z A;  3CWI A;  4WJO A;  3VTU A;  1DOI A;  2PTL A;  1WX7 A;  4GDL A;  4ZHP A;  1I4G A;  3OJ3 A;  2GRI A;  3I3T B;  2MP2 A;  2D3C A;  2K0P A;  3X23 A;  2WXG A;  2K8C A;  3BVM A;  4ZRJ A;  4MDK E;  1CZP A;  4NQK E;  3W1Y A;  5JHA A;  3SDL C;  2XEW A;  4G3X B;  1UZX B;  1JRO A;  1EWY C;  4WAF A;  1ZUD 2;  2L0T A;  4DDG D;  2A4Z A;  5EE3 A;  2O6V B;  1FM0 D;  4B0M A;  2IYD B;  2DLB A;  3UF8 A;  2KAJ A;  1NYQ A;  1ZE3 D;  1CMX B;  2LGS A;  2I1J A;  4EZK A;  5JXV A;  4KDL B;  4KIK B;  2IGG A;  1L5P A;  4GSW A;  4II3 B;  4EZL A;  2KMM A;  3DBS A;  1RAX A;  2N4F A;  3LB8 C;  2JY6 A;  4HPL B;  2LRW A;  5HKH A;  1L2N A;  1F77 A;  3ZJU A;  3SD5 A;  1I4X A;  3DVN V;  4ANV A;  1GJZ A;  3ZO5 B;  4HPP A;  2HTH A;  2M0X A;  3IT6 B;  1GC7 A;  1WR1 A;  3HK0 A;  1FFV A;  3M62 B;  3VFK A;  1TZO A;  2VH1 A;  2GBK A;  2L05 A;  4NQL B;  2N7E A;  1VLB A;  4TQ0 A;  4J6I A;  2CJO A;  2KWU B;  1QOG A;  3BYT B;  5HHD G;  4WH4 A;  4L23 A;  3Q69 A;  1B9R A;  2FUH B;  3NVW A;  4LDT D;  3UI3 A;  1E10 A;  3AH7 A;  1TYG B;  4AWJ A;  4FN2 A;  2GMI C;  2KDF B;  2MX2 A;  2RDH A;  2WXR A;  2A5U A;  1N60 A;  2K8B A;  3AB5 A;  2ZEQ A;  3VH4 B;  4XDD A;  4HCN B;  2QEJ C;  4FJY A;  1JML A;  4C56 C;  4N59 A;  1DGJ A;  2PKO A;  3GB1 A;  3GE8 C;  1YN4 A;  4PS8 A;  5HI1 A;  1WXV A;  2Y5C A;  4PS3 A;  3PTF C;  1MPE A;  2XK5 A;  3RZW C;  2KOX A;  1IPG A;  2W82 A;  1XLO A;  3RT3 B;  1P7E A;  4TSS A;  5C1Z A;  3NZU A;  3P4P B;  2X38 A;  4JWU C;  4NPN A;  1P0R A;  5BYS A;  3GOE A;  2G4D B;  2E6X A;  4BKG A;  3URY A;  5GMV A;  5LLI A;  3PZ7 A;  3P4R B;  1E8Z A;  1JWA D;  3L16 A;  3ZLZ A;  3R7R A;  1TT5 B;  2NPT B;  2BBC A;  1L6V A;  2Y5P A;  1IYF A;  1SB3 C;  1RM6 C;  2MBH A;  3AEC B;  4HDO A;  1FMA D;  1TIF A;  5G55 A;  3M95 A;  4W9L A;  1WX9 A;  2OJW A;  4DHJ D;  2GI9 A;  1T0R C;  5IOI A;  1KFY B;  1I42 A;  1KLU D;  2K6Q A;  3JSV A;  3PPA A;  3QIJ A;  2BYE A;  1UH6 A;  2CU1 A;  3D32 A;  3TEY A;  1E5W A;  3Q8E A;  2MEK A;  2LGY A;  1WXS A;  4N6E B;  4FA6 A;  1JWM D;  2CU3 A;  1PGA A;  1BXT A;  1WRI A;  3FC4 A;  3BVZ A;  1MI0 A;  2DNF A;  4XWT A;  1EWC A;  2LEK A;  5EE0 A;  3U4E G;  4GOC A;  4MGZ E;  3ONS A;  3BZD B;  3WAP A;  4IWO A;  3CF6 E;  5IA7 A;  3RYT A;  5AZF A;  4KKI A;  1YJJ A;  4IM2 A;  3NS1 A;  3KQ4 A;  3IVF A;  2LGX A;  3TUO A;  3AE9 B;  2WHI A;  4LK0 M;  1P1A A;  2V3S A;  3V3X A;  2Z59 B;  1XLN A;  2K9X A;  5T8I A;  4XDC A;  3CIR B;  3ZUN A;  4B6W A;  4AOF A;  1GG3 A;  3GS2 A;  3AE4 B;  1XLP A;  2PMV A;  2IO1 B;  4KSK C;  1GB4 A;  5AUK A;  2QIL A;  4F1S A;  3UQA A;  4TMA B;  2JVC A;  2K8H A;  1Q1O A;  4II2 B;  1GPX A;  2FCQ A;  3IG3 A;  2IY1 B;  5E6O A;  2MWS B;  3WCQ A;  1LGR A;  4XX5 A;  4URK A;  4OW0 A;  2BT6 A;  5D3I B;  3V6E B;  4P7I A;  2BVC A;  3A4R A;  2ZPY A;  3APC A;  1P98 A;  1A5R A;  1A70 A;  2RPQ A;  5DCN A;  4PT5 A;  3VUW A;  2DEN B;  4MAC A;  5G2N A;  4S0R A;  3AE7 B;  4RNA A;  2GBR A;  2K1F A;  2WLB A;  3DCG A;  4NAW B;  3RNC C;  4ARI A;  4OZC A;  4HEA 1;  4REZ A;  3H7S A;  2B76 B;  4MSQ B;  2HE7 A;  1V1P B;  2ZNV C;  1SJE D;  1Z2M A;  2Z8L A;  3WAM A;  1OEY J;  1JWS D;  1V5T A;  3HUI A;  3AE3 B;  3LJ3 A;  2EMS A;  3ZDM C;  4IWP A;  4US8 A;  3FIL A;  1SJH D;  1SIF A;  4ZDV A;  3FIL B;  1L7Y A;  2LUM A;  4HK2 A;  5EE1 A;  2MRP A;  1F2R C;  1J19 A;  2L32 A;  2SEB D;  1KH0 A;  1HTO A;  3HM6 X;  4FUL A;  4PYU A;  3HVZ A;  2YEP B;  5LXI B;  4C7Y A;  4WIP A;  3O65 B;  3MJ5 A;  2K22 A;  2V4L A;  3H9D A;  1N62 A;  2EKE C;  2XNA C;  3C0R B;  2IGD A;  3BII D;  1QQR A;  3L4P A;  5FR6 A;  3VUX A;  3DHG C;  3Q14 C;  4G11 A;  2MJD A;  2JZP A;  4MT5 A;  4PYZ A;  1HZ5 A;  3ETR A;  5L95 C;  4RF0 A;  4JIO U;  4M0W B;  4F7Z A;  1P9D U;  3K9P B;  1FNV A;  2AL6 A;  1K8R B;  1TKY A;  3QX1 A;  2KJR A;  3B0A A;  3QCA A;  3IAS 1;  2DHZ A;  3KUD B;  1B1Z A;  1CQV A;  4ZOH C;  4ZRI A;  2B3A A;  2D3G A;  1JAL A;  2PLP A;  2KJH B;  1YX6 B;  3KLS X;  3B2F A;  4KZC A;  2CHW A;  1JWU D;  1L0V B;  1OQY A;  3A4S C;  2G4S A;  3VXW A;  3WIM A;  4KZ0 A;  4P6V F;  1Q0W B;  1Y56 A;  2JUO A;  3NZ3 A;  1RYJ A;  1QOA A;  3I9V 1;  4F8C B;  2JZ3 B;  1UNS A;  4RGO S;  2M56 B;  2CHX A;  2LI5 A;  4MEM A;  2K3U A;  1WE6 A;  2LWP A;  4OZA A;  3RPF C;  4XYC A;  4K1R B;  1Z5S B;  2C5L C;  1HZ6 A;  5BMI A;  1LQB A;  1FNU A;  3A9J A;  2ZZP B;  2W54 A;  3NVV A;  2FCS A;  3J9C A;  1FIQ A;  2AX5 A;  5IAA C;  3BIN A;  3N3K B;  2C60 A;  4HJK A;  4PS7 A;  5IN7 A;  2DZI A;  1QOB A;  2WXN A;  2PVG C;  2D3B A;  1FRR A;  1TTN A;  2LJ5 A;  4C4V A;  3ZQ4 A;  1F9J A;  4RMA A;  4XWW A;  1L4D B;  4YSY B;  3ZTD A;  4FLH A;  1XD3 B;  1YNT E;  2LVO A;  4ASW C;  3PRE A;  3NG0 A;  2KKC A;  4YTN B;  3DBR I;  2QDF A;  1KM7 A;  2WX0 A;  2HDE A;  3ZW3 A;  2XBB C;  1WJ4 A;  1R4N I;  4EKU A;  4RGT A;  3H1U A;  2J0M A;  1LO5 D;  1WE7 A;  1SE4 A;  2MBE A;  1J7C A;  2WNM A;  3AEG B;  5E6N A;  3QAR A;  4XZ4 A;  4CHK A;  4ZYN A;  1UF0 A;  2DBY A;  1UWX A;  2D11 A;  5J2R A;  4ACF A;  1T0S C;  2FE8 A;  4WAA A;  3AU5 A;  1T6B X;  3H8H A;  1TY2 A;  3TMP B;  2HTM E;  2PEA A;  2NBV B;  3AE8 B;  5JHB A;  2HJ8 A;  3W5V B;  2DZK A;  2LXA A;  3RNG C;  1ZDX A;  3ENE A;  4YT0 B;  1UGM A;  3PVL A;  2WXQ A;  4BAX A;  2KDB A;  2BKF A;  4HRS A;  2KYW A;  1V8C A;  3VUY A;  2DYM A;  2IY0 B;  2M4N A;  3ZKJ C;  1V1O A;  3M3J A;  1S3S G;  3PO0 A;  3KUZ A;  4JQW C;  1YMH E;  3N32 A;  2KMA A;  4JE3 B;  2CHZ A;  4OVV A;  2ONQ A;  3FKY A;  2D5G A;  5AZH A;  1FXT B;  2R2O A;  2VZK D;  4ZRK A;  3VHT C;  4MGI E;  3VH3 B;  3K9O B;  4GDL B;  4GGQ A;  4A55 A;  4P16 A;  2NTS A;  2J0K A;  5CHF A;  4A9A A;  2EMT A;  1RFA A;  2MP2 B;  5J17 A;  3QJZ A;  4K3C A;  3QAQ A;  3MHZ A;  1I7H A;  3R66 C;  4HWI B;  2LFI A;  3PHX B;  3KYD D;  3Q3M C;  2KWV B;  2L3Z A;  3RD2 A;  3LYY A;  4WWP A;  2EEL A;  1TY0 A;  3GZN B;  4NNJ B;  3JYU A;  4KVG B;  2J42 A;  1KLG D;  4M02 A;  1NEK B;  3R3M A;  2NBW B;  1H8C A;  3RNF C;  4FAD A;  3B1L X;  4W9F A;  2FAZ A;  4NAM A;  1FXA A;  4ZRP A;  1WRD B;  2H89 B;  4LNF A;  5TSS A;  5MPO A;  3DOW A;  3QC8 B;  2L7R A;  3WAO A;  3ZJT A;  1EU4 A;  4HPM B;  2MJE A;  1ZGU B;  1ZOY B;  4AQ7 A;  4WJP A;  3AEA B;  2JX5 A;  5G5H A;  1FFU A;  4FHK A;  1KOT A;  2AQ1 B;  3VDZ A;  3ZXV A;  1J7B A;  1HEZ E;  3Q8C A;  3E9S A;  2INP E;  3PGE A;  5E6P A;  2WDV B;  3MP9 A;  1GB1 A;  3AUL A;  3I57 A;  1WSP A;  2ON8 A;  3P4Q B;  2WQY B;  4C7Z A;  4GU2 A;  5AEK B;  4DQO C;  3GP7 A;  3AE6 B;  1FD6 A;  1N63 A;  2KFJ A;  4I6N B;  4W9K A;  3RN9 C;  4GDK A;  4H2A A;  2L0F A;  4ANU A;  2QCZ A;  3V05 A;  3ZXR A;  4NJ6 A;  3A1Q A;  4GDK B;  1UBQ A;  1GNU A;  4D2K A;  4BKS D;  3ZRC A;  4JWS C;  2I38 A;  3DBR B;  3DVG X;  4IUM B;  1VCB A;  1T3Q A;  1SIJ A;  4DXG A;  4DK5 A;  1M4V A;  1R4N B;  1OGW A;  2C7N B;  1MJD A;  3DHI C;  4X57 B;  4GXB A;  4AJW A;  3I5J C;  4YSZ B;  4WQM A;  4BKT A;  1G6J A;  3DPD A;  1NYR A;  1SF0 A;  5CHW A;  2NVU I;  3U7Z A;  1FO4 A;  2W55 A;  1C1Y B;  2N1W A;  2FCM A;  2JSV X;  2DX5 B;  1ZKH A;  2OJR A;  3BK1 A;  3PS6 A;  2Y5B B;  3ML9 A;  1C9F A;  1ZP0 B;  2CKH B;  2XK5 B;  3DWG C;  2Z0D B;  1V2Y A;  1FCC C;  3AM9 A;  2C9W B;  2WXH A;  3UIO B;  4ZYS A;  3TEZ A;  3ZGZ A;  1SXT A;  2KN5 A;  3DWM A;  3R2I A;  5HG2 A;  3W9C B;  3VVW B;  4DHZ B;  3ZYY X;  1ZDV A;  2V4I B;  2GLS A;  1S1Q B;  2RR9 A;  1BML C;  3DBL I;  1JRU A;  2M19 A;  4IG7 B;  3DDC B;  4M01 A;  1PYW D;  1Q5W B;  5FK9 C;  2KAN A;  3SR6 A;  1JQ4 A;  4MJS A;  2IO3 B;  3KUC B;  1C78 A;  1EUV B;  3PHW B;  2ZCB A;  3TIX A;  3IBE A;  3HIZ A;  3PRZ A;  2MCN B;  2ACZ B;  4YSX B;  3SFD B;  2ZVO A;  3DBH B;  1ZXH A;  1DOY A;  2WXJ A;  5D2M B;  4PK1 A;  3APF A;  1WGY A;  3JSV B;  3EEC A;  4DBG A;  1LM8 B;  5FR3 A;  4R3D A;  1QKZ A;  1WYW B;  1YOV B;  3V6C B;  2N9P C;  2QMT A;  2WDQ B;  1R4M B;  1SEB D;  3NY5 A;  2KVR A;  2DAF A;  3Q2A C;  2MSE D;  2O2V A;  2GB1 A;  2N9L A;  4AP4 C;  4GMV A;  2UYZ B;  3U2S C;  1C76 A;  3B9J A;  4W9G A;  3PSE B;  4US9 A;  1OQQ A;  3RZF A;  3CSF A;  1C77 A;  2N9E B;  2XN9 C;  2W3S A;  2DAJ A;  5KHO A;  1TKE A;  2WYQ A;  4AJY B;  1TKG A;  1JW9 D;  3DVN U;  4RM8 A;  2W9N A;  4B0E A;  1KJT A;  1FNW A;  3HVD A;  3AI5 A;  2INN E;  2KVZ A;  1ISN A;  2KC2 A;  2AEH A;  2N9K A;  4NY0 A;  1N5W A;  3BWU D;  1LFD A;  2IO2 B;  3IT4 B;  1D5Z C;  1ZW7 A;  2L76 A;  2AWT A;  3ZNH B;  5CTR C;  1WJU A;  3N1Z C;  3WA0 A;  5TR5 A;  2OHF A;  3QK0 A;  5G5G A;  3SFE B;  1IGD A;  2YEP F;  4K7U A;  2KFK A;  1L6U A;  1WX8 A;  2QC8 A;  2DZJ A;  3MFG A;  2KD0 A;  1R7S A;  3ABV B;  1VZ8 A;  2BS2 B;  2QHO A;  1V86 A;  4IC7 B;  2G45 B;  4W9C A;  2VH2 A;  1LXD A;  2ZCC A;  1FCL A;  1WXQ A;  2N1V A;  3KH0 A;  4DWF A;  1SSN A;  4W9D A;  4K7W A;  1WGG A;  2BQQ A;  2ASQ A;  2BYF A;  4G0N B;  2BS3 B;  2MBO A;  4UDU C;  2KDE B;  3E56 A;  1I4Q A;  4KSL C;  3T3N A;  2BYV E;  1TGZ B;  4YTM B;  4P1C C;  4TV3 A;  3Q6B A;  2WGS A;  2K25 A;  1VR9 A;  2Y3A A;  3AE5 B;  2L83 A;  1K51 A;  4HKQ A;  2KLG A;  1L4Z B;  2KN4 A;  2IJ0 A;  2VRR B;  2WXO A;  2OOB B;  1FPY A;  3DBL B;  4CQN A;  3EFU A;  1WR6 E;  1XEE A;  3IHP C;  1XT9 B;  3AE1 B;  2V3N A;  3HHM A;  5D3D A;  3IXS A;  5BYQ A;  1TBE A;  3KYC D;  1SGH A;  4IM3 A;  4IOI E;  2GBM A;  3EFC A;  3MC8 A;  1QOF A;  2KQ7 A;  3W2D A;  5GXG B;  1K50 A;  3WAN A;  2IND C;  1QT9 A;  5D7G A;  1EF5 A;  4MSM B;  3BY4 B;  4FJZ A;  4IWQ A;  1OTR B;  4MM3 A;  1MG4 A;  1VJK A;  2M8S A;  2IBI B;  3P63 A;  3P2B A;  3VTV A;  4BZA A;  4Q2J A;  3GZN I;  2MBQ A;  4IDI A;  1YJ1 A;  1MHH E;  3JW0 X;  5C2T B;  3V61 A;  1D4B A;  5FKA C;  2PE6 B;  2RGF A;  1WF9 A;  3RNA C;  1C4A A;  2LZ6 A;  3Q3J A;  1YQ3 B;  3R8B A;  1OFF A;  4OVU A;  2J4X A;  1D6E C;  1WYG A;  4KV2 A;  1PGB A;  2WXF A;  1L0Y B;  1MG8 A;  1WGH A;  2MW5 A;  1GC6 A;  1HQR D;  4YWG G;  1YN5 A;  3UIN B;  3A9J B;  1IBX A;  1F52 A;  3UGB B;  1QIL A;  2QJL A;  1I4P A;  2G3Q B;  2KT7 A;  1IBX B;  2BF8 B;  1NBF C;  2BYT A;  3MC9 A;  1WI0 A;  4KGR A;  3EC8 A;  3PT2 B;  3PLU A;  4K81 A;  4B95 A;  2AL3 A;  2N7J A;  3TJP A;  3RCZ A;  1AYF A;  1VDV A;  2YVC A;  3NRZ A;  4DHZ E;  2FIF A;  2JXX A;  2AQ3 B;  4GN1 A;  3IAM 1;  4E3C A;  1RLF A;  2RD0 A;  4C4V B;  3X0W A;  1WMH A;  2V3P A;  1OQR A;  2KK8 A;  4YL8 A;  2AQ2 B;  4DXF A;  3AEE B;  2KMC A;  2WXM A;  2I1K A;  1F0Z A;  5BMG A;  1YN3 A;  2JYT A;  1WJN A;  1E7P B;  1QZE A;  3ML8 A;  2ZW0 A;  3A33 B;  3HM3 A;  4XC2 A;  2IO0 B;  4KGT A;  2LHD A;  3RUI B;  2N9X A;  1FEH A;  4DXA B;  2MQJ A;  4BOS C;  4IKG A;  2M0A A;  4KX6 B;  4XGA B;  3ZJV A;  1E7V A;  4RM9 A;  5JH5 C;  3OWE B;  2CR5 A;  2WU5 B;  3ZDT A;  3BYY B;  2L1A A;  2KZR A;  3H7P A;  4I6P A;  3B08 A;  2DWQ A;  3T3O A;  4AS1 A;  1EM7 A;  2FUG 1;  2BTE A;  3RMK C;  1XCQ L;  3SHQ A;  4BBN C;  4ANX A;  1T5X D;  4FXC A;  1EO6 A;  2LD9 A;  2BWE S;  2FBW B;  4LTU A;  2L8J A;  2K5P A;  2WS3 B;  5BO4 B;  4HLE A;  1N6Z A;  2KTR A;  3P42 A;  2WDT B;  3QWZ B;  3N1X C;  3MHS D;  3DQV A;  1WGD A;  5H92 C;  2RDB C;  2DZM A;  2G9H D;  3ZNG C;  4LLG M;  1L0X B;  5CX3 A;  4A6Q A;  1YIW A;  4RGN A;  5IKC M;  4HJG E;  4LJO B;  1YQB A;  3NJT A;  2BWF A;  2KXJ A;  4LNK A;  1Q10 A;  2PVO D;  4J3O D;  2RMM A;  1GAQ B;  5DPW A;  2R61 A;  4LNO A;  2BW2 A;  5AZG A;  4TKN A;  4EZJ A;  2LJI A;  1UWM A;  4FBJ B;  1NEN B;  2BS4 B;  3DBH I;  1HA5 A;  4CYE A;  4LJP B;  3U30 A;  1UBI A;  3PLV A;  1WZ3 A;  1EU3 A;  1D5X C;  4BKS A;  1NDD A;  1I4R A;  4A8X C;  4OVZ A;  4K3B A;  1TS5 A;  4JL9 A;  2JZZ A;  5LXH A;  2LAS A;  5BMH A;  1R4M I;  2PW9 A;  2O6V A;  4KKJ A;  4LDT B;  1UUP A;  2KC1 A;  1E7U A;  3IFW B;  1PDX A;  4N58 A;  3AMZ A;  2M1M A;  3AU4 A;  1K53 A;  2IZV B;  4USA A;  4KIK A;  3RNE C;  3T8M A;  1H4R A;  2M17 A;  3MC0 B;  2FNJ B;  1DOX A;  2WWZ A;  1V49 A;  3PZ8 A;  1ET6 A;  1SE9 A;  2R2Q A;  1FRD A;  3B2G A;  5CHV C;  3GE3 C;  3S2A A;  2LMC A;  3PV1 A;  2NTT A;  2K39 A;  1C3T A;  3AEB B;  2LRU A;  2J52 A;  2JU6 X;  3AN1 A;  2PIA A;  1OEY A;  3A1Q B;  1ROE A;  1IGC A;  2PJH A;  2WU2 B;  2IGH A;  2O6V D;  4HKZ E;  5LNK 1;  4WJN A;  1QF6 A;  4ANW A;  1XLQ A;  2JQR B;  2G1E A;  1J0G A;  3PZD A;  1ZXI A;  3W1S C;  4ICU A;  1V5O A;  1KRH A;  5H8Y E;  2C7H A;  2JPH A;  3HRD D;  4ICV A;  4P1B C;  4K7S A;  4W9H A;  1WZ0 A;  2KWD A;  2UWQ A;  1CK1 A;  1XCT L;  3Q8F A;  2ZNV B;  4JX1 C;  2WXI A;  3VR9 B;  1WFY A;  3A9K A;  1P3Q U;  3AXC A;  1HXY D;  4M8N A;  4JPS A;  4WJQ A;  3A9K B;  2L00 B;  2MHJ A;  3LXF A;  2RDG A;  4DHJ B;  4XE0 A;  2ICI A;  1SE2 A;  2BB5 A;  2LVP A;  5EDS A;  2KTF A;  2V1Y A;  3EHV A;  2HD5 B;  4IW0 A;  2JT4 B;  2NMQ A;  1T0Y A;  3U7D A;  2Q5W D;  1RFK A;  4HVB A;  2D3A A;  3CST A;  2LGI A;  4HCP B;  3N30 A;  4YTP B;  1D5M C;  2WDR B;  2MH7 A;  2KNB A;  4M8M A;  1HTQ A;  4MH0 E;  1KF6 B;  4E74 A;  4ITK A;  3AV8 A;  2BB6 A;  2C7M B;  3JVZ X;  1E90 A;  1ZPS A;  4RF1 A;  1YJI A;  2V0G A;  3AE2 B;  1E8Y A;  2D10 A;  3Q3O C;  3NVY A;  4MJS B;  2NPT A;  2JYE A;  1BT0 A;  1WGK A;  2GBN A;  3QHT A;  4OZB A;  4RH6 A;  1XQQ A;  4ARC A;  1NI2 A;  2J53 A;  4HXD A;  3LDZ E;  3VR8 B;  1WM2 A;  3APD A;  3V60 A;  2JXT A;  1UD7 A;  4JLC A;  3N20 C;  1WIA A;  2RSU A;  3OJ4 B;  1E8W A;  4RGM A;  1AW7 A;  4MEL A;  3ZRF A;  4YXD B;  2MBB B;  1RWS A;  3P4S B;  4B9K A;  1N5X A;  2YLM A;  3DHH C;  3Q8B A;  4WWN A;  3DVG Y;  2BGF A;  1AAR A;  1P7F A;  2O2V B;  3BK2 A;  4M00 A;  1DYQ A;  2AYO B;  4AUQ C;  3N1Y C;  4TUU A;  5J18 A;  3L0W B;  2MJ3 A;  1J7A A;  2Z0E B;  2KWC A;  2MLB A;  4NJ7 A;  1AN8 A;  3TL5 A;  3U52 E;  3NOB A;  3ALB A;  4EUT A;  1VZ6 A;  1WH3 A;  3RNB C;  2JF5 A;  1QLB B;  2FID A;  2V9H A;  2D2Q A;  4ZHO A;  2ZPN A;  1ACC A;  2KHW B;  1TZ1 A;  1MHX A;  1E9M A;  3O13 A;  1I35 A;  2W3R A;  3EA6 A;  1JRP A;  5I4D A;  5D94 A;  4TQ1 A;  2N7D A;  1E8X A;  4EE2 A;  4NJC A;  4CO7 A;  4BBN F;  4WWO A;  3R7Q A;  1TS3 A;  3C19 A;  2CS4 A;  1U4A A;  2MA9 B;  2ZVN A;  4L1B A;  3KWL A;  1XO3 A;  4BOZ B;  2CJN A;  3QA8 A;  1KTK A;  3PRM B;  2QIE B;  1UEL A;  3P1M A;  3AEF B;  2IDY A;  3OG5 A;  1X1M A;  2KFK B;  2BKR B;  1AWD A;  1PGX A;  1IUE A;  2I2Y A;  1BUI C;  2KDI A;  4NAW A;  4MGK E;  3UQB A;  2JRH A;  3MJW A;  1STE A;  1V1P A;  2WP9 B;  4HRO A;  4W9E A;  1SE3 A;  1ESF A;  3SEB A;  1K52 A;  2KQS A;  2KX0 A;  1VZ7 A;  1T0Q C;  3N9Y C;  2EKI A;  2GOW A;  3KVF B;  3SU8 X;  3QQ8 B;  2QSD A;  3NHE B;  2OED A;  4I6L B;  4ZRQ A;  1N61 A;  2LGD A;  2KX3 A;  3L13 A;  4C00 A;  5D6J B;  4EOY A;  3L10 B;  3TEW A;  1XXG A;  1GOZ A;  2J0J A;  5IO9 A;  4GB9 A;  3R2T A;  4WUR A;  2INC C;  3C8Y A;  2TSS A;  2L52 A;  5JZE B;  3ZNI D;  4A20 A;  1C4C A;  2ZW1 A;  1TS2 A;  1RRB A;  2KDM A;  2KO3 A;  4A90 A;  1WY8 A;  4L2Y A;  3T9L A;  5DPR A;  1EF1 A;  3H6N A;  1V81 A;  3Q3N C;  4MH8 A;  2BPS A;  4M0W A;  1HE8 A;  1KLV A;  4MGY E;  3W5U B;  1JWB D;  1J8C A;  3Q8A A;  1C4P A;  1MFW A;  4IM0 A;  3VRB B;  4EEW A;  1WM3 A;  4DDI D;  4KDI C;  2WXK A;  3VRA B;  4LNI A;  1NVI D;  2NS5 A;  4BVU C;  3M63 B;  4QAY A;  3TSS A;  4A3O A;  5KHQ A;  4MM3 B;  2REX A;  4LNN A;  3ZVV A;  2E3T A;  2SAK A;  3TCA A;  3ECI A;  4N9F 4;  3NS8 A;  4RCO A;  2HJ1 A;  1JCK B;  1IP9 A;  3CMM B;  1WJ6 A;  3PRP B;  4W9I A;  2NBU A;  3VAW A;  4O1N A;  4E71 A;  4FHJ A;  1FXI A;  1VRA B;  1WXA A;  4BFR A;  2J7Q B;  4HDQ A;  4GLS C;  3I63 C;  3V62 A;  1Y8R C;  5EE9 A;  3NUH B;  4RFB A;  1VD2 A;  3L17 A;  3NZS A;  2NCN A;  5C3J B;  3VQI A;  2UU7 A;  2RPV A;  1CJE A;  5HFY A;  1YQ4 B;  1TJE A;  2NR2 A;  1XF5 L;  2H88 B;  1V6E A;  3Q3F A;  3EUB 2;  2K6D B;  5L83 A;  2PPH A;  4S17 A;  3L54 A;  3ZIM A;  1GUA B;  4WWM A;  2WX1 A;  1PFD A;  3OLM D;  4FJV B;  5BYR A;  2LHE A;  3TEX A;  1D3Z A;  4C80 A;  4JGH B;  2KLC A;  2IPK D;  2X8X X;  4KGS A;  1MVK A;  2WXP A;  1WMH B;  1ENF A;  5C23 A;  1PQS A;  2WXL A;  1TS4 A; 
#chains in the Genus database with same CATH homology
 1V80 A;  1J19 A;  3IBE A;  2IZV B;  3HIZ A;  3PRZ A;  2MCN B;  4KIK A;  2ZVO A;  3T8M A;  3W1S A;  5D2M B;  1H4R A;  3APF A;  1WGY A;  2M17 A;  3L08 A;  3JSV B;  3HM6 X;  4FUL A;  4PYU A;  3EEC A;  4DBG A;  1LM8 B;  2FNJ B;  5LXI B;  2WWZ A;  2LUE A;  1V49 A;  1WYW B;  3OAW A;  1SE9 A;  1WGR A;  2GBJ A;  2R2Q A;  3O65 B;  4LCD E;  3V6C B;  2N9P C;  2V4L A;  3H9D A;  5DPS A;  2PE9 A;  2EKE C;  2DYO A;  3C0R B;  5CHV C;  3NY5 A;  1WXM A;  3S2A A;  2KVR A;  2DAF A;  3PV1 A;  5FR6 A;  3VUX A;  4EFO A;  1YX5 B;  1V9J A;  4W9J A;  2LVQ A;  2MSE D;  2K39 A;  2O2V A;  4G11 A;  3ZTC A;  1C3T A;  5DPT A;  2LRU A;  4AP4 C;  2DYB A;  4GMV A;  2UYZ B;  4PYZ A;  1OEY A;  3A1Q B;  3H7P B;  5L95 C;  4W9G A;  3PSE B;  4JIO U;  4M0W B;  3UIP B;  4A3P A;  2PJH A;  3RZF A;  2O6V D;  3CSF A;  4F7Z A;  2N9E B;  2D07 B;  1P9D U;  2DAJ A;  3K9P B;  2AL6 A;  1K8R B;  4WJN A;  4ANW A;  3ZNZ B;  3QX1 A;  2KJR A;  2JWZ A;  5KHO A;  1J0G A;  3B0A A;  3QCA A;  3PZD A;  1YD8 U;  2DHZ A;  2WYQ A;  4AJY B;  3W1S C;  4ICU A;  3KUD B;  3WAL A;  1V5O A;  3DVN U;  4RM8 A;  2JRI B;  2C7H A;  2JPH A;  2W9N A;  4ZRI A;  2B3A A;  2D3G A;  4GIV A;  4ICV A;  2KJH B;  1YX6 B;  2KTR B;  2LXC A;  2FCN A;  3MTN B;  4K7S A;  4KZC A;  4W9H A;  1KJT A;  1WZ0 A;  4G50 A;  2CHW A;  3TBL D;  3AI5 A;  1ISN A;  2UWQ A;  2KC2 A;  4WQO B;  3KW5 B;  1OQY A;  2AEH A;  3A4S C;  2G4S A;  1M94 A;  4NY0 A;  3VXW A;  3RUL A;  2ZNV B;  1WFY A;  3WIM A;  1LFD A;  3A9K A;  4KZ0 A;  2IO2 B;  1P3Q U;  3AXC A;  3VTW A;  1Q0W B;  2JUO A;  2ZJD A;  4M8N A;  4WJQ A;  2KJ6 A;  1ZW7 A;  3A9K B;  2L00 B;  2L76 A;  2AWT A;  3ZNH B;  5CTR C;  4DHJ B;  1WJU A;  4F8C B;  3VTU A;  3U8Z A;  4WJO A;  2JZ3 B;  3WA0 A;  1WX7 A;  2LVP A;  4GDL A;  5EDS A;  2KTF A;  5TR5 A;  2CHX A;  3QK0 A;  2V1Y A;  3OJ3 A;  2LI5 A;  4MEM A;  3EHV A;  3I3T B;  2HD5 B;  2MP2 A;  2JT4 B;  4IW0 A;  1WE6 A;  2LWP A;  3U7D A;  1T0Y A;  4HVB A;  3CST A;  3X23 A;  4HCP B;  2K8C A;  4K1R B;  1Z5S B;  2C5L C;  3N30 A;  4ZRJ A;  4K7U A;  2KFK A;  4MDK E;  1LQB A;  3A9J A;  2ZZP B;  4NQK E;  3W1Y A;  5JHA A;  1WX8 A;  3SDL C;  2DZJ A;  2KNB A;  4M8M A;  2XEW A;  2FCS A;  2KD0 A;  4G3X B;  4MH0 E;  4E74 A;  1UZX B;  5IAA C;  3BIN A;  3N3K B;  2C7M B;  2C60 A;  1E90 A;  2L0T A;  3JVZ X;  4HJK A;  4PS7 A;  2A4Z A;  4DDG D;  2QHO A;  1V86 A;  2O6V B;  4IC7 B;  2DZI A;  2G45 B;  2IYD B;  4W9C A;  1LXD A;  2ZCC A;  3UF8 A;  1E8Y A;  2D10 A;  2N1V A;  3KH0 A;  4DWF A;  4W9D A;  1TTN A;  2LJ5 A;  1WGG A;  2NPT A;  4K7W A;  4MJS B;  1F9J A;  2ASQ A;  2BYF A;  4RMA A;  4G0N B;  1CMX B;  1BT0 A;  2I1J A;  2MBO A;  2GBN A;  3QHT A;  4EZK A;  2KDE B;  3ZTD A;  4KDL B;  4FLH A;  4KIK B;  1XD3 B;  2LVO A;  1XQQ A;  4ASW C;  4KSL C;  1NI2 A;  3PRE A;  2BYV E;  1TGZ B;  4HXD A;  3LDZ E;  2KKC A;  4GSW A;  4II3 B;  4TV3 A;  3DBR I;  4EZL A;  1WM2 A;  3APD A;  2K25 A;  1RAX A;  1KM7 A;  2WX0 A;  3DBS A;  3V60 A;  1UD7 A;  3ZW3 A;  2XBB C;  2N4F A;  4JLC A;  1WIA A;  2JY6 A;  2RSU A;  1WJ4 A;  1E8W A;  3OJ4 B;  1R4N I;  2LRW A;  4HPL B;  4EKU A;  5HKH A;  2KLG A;  4MEL A;  1L2N A;  3ZRF A;  3H1U A;  2J0M A;  3SD5 A;  2MBB B;  3DVN V;  1GJZ A;  4ANV A;  2VRR B;  1WE7 A;  3ZO5 B;  2OOB B;  4B9K A;  2HTH A;  2YLM A;  2M0X A;  2MBE A;  1GC7 A;  1WR1 A;  3EFU A;  3HK0 A;  5E6N A;  1WR6 E;  3QAR A;  3DVG Y;  3IHP C;  4WWN A;  4XZ4 A;  2BGF A;  1XT9 B;  1AAR A;  4CHK A;  4ZYN A;  2O2V B;  3M62 B;  3VFK A;  3HHM A;  2GBK A;  5J2R A;  2D11 A;  2AYO B;  2L05 A;  4AUQ C;  4NQL B;  2N7E A;  1TBE A;  4TUU A;  4WAA A;  5J18 A;  3KYC D;  4TQ0 A;  4J6I A;  3L0W B;  3AU5 A;  1SGH A;  2KWU B;  4IM3 A;  2GBM A;  2Z0E B;  3TMP B;  2KWC A;  2KQ7 A;  2MLB A;  2PEA A;  2NBV B;  5JHB A;  2FUH B;  2HJ8 A;  4NJ7 A;  3WAN A;  2DZK A;  2LXA A;  3TL5 A;  3ENE A;  3NOB A;  3ALB A;  4EUT A;  4LDT D;  1UGM A;  1WH3 A;  3PVL A;  5D7G A;  2JF5 A;  1EF5 A;  4AWJ A;  2FID A;  2KDB A;  4FN2 A;  2BKF A;  4MSM B;  3BY4 B;  4FJZ A;  2GMI C;  2KDF B;  2D2Q A;  2MX2 A;  4IWQ A;  2ZPN A;  3VUY A;  2KHW B;  2DYM A;  1OTR B;  2A5U A;  2IY0 B;  4MM3 A;  1TZ1 A;  2K8B A;  2M4N A;  2IBI B;  2M8S A;  3P2B A;  3VTV A;  3ZKJ C;  1I35 A;  2ZEQ A;  3VH4 B;  3M3J A;  1S3S G;  3GZN I;  2MBQ A;  4HCN B;  3KUZ A;  1YJ1 A;  4JQW C;  5D94 A;  4FJY A;  3JW0 X;  4TQ1 A;  2N7D A;  1E8X A;  3N32 A;  3V61 A;  2PE6 B;  2KMA A;  2CHZ A;  4CO7 A;  2RGF A;  4OVV A;  4BBN F;  1WF9 A;  4WWO A;  5AZH A;  3R7Q A;  1FXT B;  2LZ6 A;  2R2O A;  3Q3J A;  4ZRK A;  3VHT C;  4MGI E;  3VH3 B;  4PS8 A;  3K9O B;  4GDL B;  4GGQ A;  1WXV A;  2CS4 A;  4OVU A;  1U4A A;  2MA9 B;  2ZVN A;  4PS3 A;  2J0K A;  3PTF C;  5CHF A;  4BOZ B;  2EMT A;  3QA8 A;  1RFA A;  2MP2 B;  4KV2 A;  5J17 A;  3QJZ A;  3PRM B;  3QAQ A;  2XK5 A;  3RZW C;  1UEL A;  2KOX A;  1IPG A;  1MG8 A;  1WGH A;  2MW5 A;  1GC6 A;  3R66 C;  1X1M A;  4HWI B;  3UIN B;  2KFK B;  3RT3 B;  2BKR B;  3PHX B;  3A9J B;  3KYD D;  2KWV B;  2L3Z A;  3RD2 A;  4WWP A;  3UGB B;  5C1Z A;  2G3Q B;  2KDI A;  3NZU A;  4NAW A;  4NNJ B;  2BF8 B;  1NBF C;  4NPN A;  1P0R A;  3GOE A;  1WI0 A;  3JYU A;  4MGK E;  3UQB A;  2G4D B;  4BKG A;  2JRH A;  4KVG B;  3MJW A;  5GMV A;  3EC8 A;  4W9E A;  3PT2 B;  5LLI A;  3PLU A;  4K81 A;  2KQS A;  4B95 A;  2KX0 A;  2AL3 A;  3TJP A;  3RCZ A;  1E8Z A;  2YVC A;  3R3M A;  4DHZ E;  2NBW B;  2FIF A;  2JXX A;  1H8C A;  4FAD A;  3B1L X;  4W9F A;  2FAZ A;  2GOW A;  3L16 A;  4GN1 A;  3KVF B;  4E3C A;  1WRD B;  1RLF A;  2RD0 A;  3ZLZ A;  3DOW A;  3R7R A;  3SU8 X;  3QQ8 B;  2NPT B;  3X0W A;  1WMH A;  3QC8 B;  3NHE B;  2L7R A;  2KK8 A;  4YL8 A;  3WAO A;  1IYF A;  2MBH A;  2KMC A;  4HDO A;  4HPM B;  4I6L B;  1ZGU B;  5G55 A;  4WJP A;  3M95 A;  2I1K A;  4FHK A;  4W9L A;  1WX9 A;  1KOT A;  3VDZ A;  2LGD A;  4DHJ D;  2KX3 A;  3L13 A;  1WJN A;  1QZE A;  3ML8 A;  5D6J B;  1I42 A;  4EOY A;  3L10 B;  2K6Q A;  3JSV A;  3PPA A;  3QIJ A;  2J0J A;  3A33 B;  3PGE A;  3HM3 A;  4GB9 A;  2BYE A;  4XC2 A;  1UH6 A;  2CU1 A;  2IO0 B;  3D32 A;  5E6P A;  1E5W A;  3RUI B;  2LGY A;  2N9X A;  1WXS A;  3AUL A;  4DXA B;  2MQJ A;  4BOS C;  4FA6 A;  3ZNI D;  4A20 A;  5JZE B;  4GU2 A;  5AEK B;  1RRB A;  2KO3 A;  1WY8 A;  1E7V A;  2KFJ A;  4GOC A;  4I6N B;  4MGZ E;  3ONS A;  4W9K A;  4RM9 A;  3T9L A;  5JH5 C;  3WAP A;  4IWO A;  5DPR A;  1EF1 A;  2CR5 A;  4GDK A;  3ZDT A;  3CF6 E;  1V81 A;  3H6N A;  3RYT A;  5AZF A;  2L0F A;  5IA7 A;  2KZR A;  4ANU A;  4IM2 A;  4NJ6 A;  3A1Q A;  3H7P A;  4I6P A;  3IVF A;  3B08 A;  2LGX A;  1UBQ A;  4GDK B;  1GNU A;  2BPS A;  1HE8 A;  4BKS D;  1KLV A;  1P1A A;  3ZRC A;  4MGY E;  2V3S A;  3DVG X;  1J8C A;  4IUM B;  1VCB A;  2Z59 B;  4IM0 A;  4EEW A;  3SHQ A;  4BBN C;  4ANX A;  1WM3 A;  4DDI D;  1EO6 A;  4DK5 A;  2LD9 A;  2BWE S;  4KDI C;  1OGW A;  2C7N B;  2NS5 A;  3ZUN A;  4B6W A;  4BVU C;  3M63 B;  2L8J A;  4X57 B;  5BO4 B;  4AOF A;  1GG3 A;  4GXB A;  4AJW A;  4HLE A;  2IO1 B;  4A3O A;  2KTR A;  4BKT A;  1G6J A;  3DPD A;  5KHQ A;  4KSK C;  2REX A;  3ZVV A;  2WDT B;  4F1S A;  3UQA A;  2JVC A;  2K8H A;  3QWZ B;  1Q1O A;  3TCA A;  4II2 B;  3MHS D;  3ECI A;  5CHW A;  3DQV A;  4N9F 4;  2NVU I;  1WGD A;  2FCQ A;  3NS8 A;  3IG3 A;  1IP9 A;  2IY1 B;  5E6O A;  2DZM A;  2MWS B;  3ZNG C;  1C1Y B;  3CMM B;  1WJ6 A;  3PRP B;  4W9I A;  2N1W A;  2NBU A;  4XX5 A;  2FCM A;  3VAW A;  2DX5 B;  4URK A;  5CX3 A;  4E71 A;  4FHJ A;  1ZKH A;  1YIW A;  2OJR A;  3V6E B;  4P7I A;  1WXA A;  4BFR A;  2J7Q B;  3A4R A;  4HDQ A;  2ZPY A;  3PS6 A;  3APC A;  4LJO B;  1P98 A;  2Y5B B;  3V62 A;  1YQB A;  1Y8R C;  1A5R A;  2BWF A;  3ML9 A;  2RPQ A;  2KXJ A;  5DCN A;  2CKH B;  2XK5 B;  5DPW A;  3VUW A;  2DEN B;  1VD2 A;  3L17 A;  3NZS A;  5AZG A;  2NCN A;  1V2Y A;  2Z0D B;  4TKN A;  5G2N A;  4EZJ A;  3VQI A;  4FBJ B;  3UIO B;  2C9W B;  3DBH I;  2GBR A;  2NR2 A;  4CYE A;  2K1F A;  4LJP B;  3DCG A;  3U30 A;  1V6E A;  1UBI A;  2KN5 A;  3PLV A;  4NAW B;  3Q3F A;  3H7S A;  2K6D B;  5L83 A;  1WZ3 A;  2PPH A;  3VVW B;  4MSQ B;  2HE7 A;  4DHZ B;  2ZNV C;  4BKS A;  1NDD A;  3L54 A;  3ZIM A;  1Z2M A;  1GUA B;  3WAM A;  4JL9 A;  2JZZ A;  1S1Q B;  2WX1 A;  1OEY J;  2LAS A;  2RR9 A;  5LXH A;  1R4M I;  3OLM D;  2O6V A;  1V5T A;  4FJV B;  3LJ3 A;  2EMS A;  4LDT B;  1D3Z A;  3DBL I;  2KLC A;  4JGH B;  1JRU A;  3ZDM C;  2KC1 A;  1E7U A;  4IG7 B;  3DDC B;  4IWP A;  3IFW B;  1Q5W B;  1WMH B;  2KAN A;  5C23 A;  1SIF A;  4ZDV A;  4MJS A;  1L7Y A;  1PQS A;  4HK2 A;  2IO3 B;  3KUC B;  1EUV B;  2MRP A;  3PHW B;  2M1M A;  3AU4 A;  2ZCB A;  3TIX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...