2R2QA

Crystal structure of human gamma-aminobutyric acid receptor-associated protein-like 1 (gabarap1), isoform cra_a
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
110
structure length
110
Chain Sequence
GFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, protein transport
molecule keywords Gamma-aminobutyric acid receptor-associated protein-like 1
publication title Crystal structure of human Gamma-Aminobutyric Acid Receptor-Associated Protein-like 1 (GABARAP1), Isoform CRA_a.
rcsb
source organism Homo sapiens
total genus 36
structure length 110
sequence length 110
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-08-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2r2qA00
2DYMA 1YD8U 1T0YA 4KVGB 2FCMA 1WJ6A 3R7RA 3RZFA 4WWNA 3A9JA 2N4FA 3QIJA 4GDLB 2OOBB 2ZPYA 1M94A 4MSMB 1V86A 4HPMB 5LXHA 2L0FA 4URKA 3APFA 2I1JA 2KD0A 4F8CB 5AZGA 1UZXB 2J0MA 3WAOA 2BWES 3L16A 2FUHB 2V4LA 2FCSA 3PSEB 2C7HA 2JVCA 4WJNA 2KZRA 3AULA 2M0XA 2DZIA 4DBGA 1RRBA 3PHWB 3APCA 1I35A 1EUVB 4IC7B 4PS7A 1NBFC 2O2VB 1E8YA 1LFDA 1UGMA 2JY6A 3WALA 1WXMA 2KVRA 2LGXA 3CSFA 4MGZE 1E90A 1NI2A 1WR6E 2GBKA 2BYFA 4OVVA 2KLCA 4AJWA 2KWVB 2R2OA 2PPHA 3Q3JA 3ENEA 1Y8RC 2L76A 2KXJA 2MBOA 2NCNA 4WWOA 3RYTA 1GJZA 2KJRA 2ZEQA 4KSKC 3JSVA 1S1QB 2JZZA 4NAWB 4OVUA 2MSED 1Z2MA 3VFKA 3L08A 1V5TA 4JGHB 2KKCA 2A5UA 2KJ6A 4IW0A 1TZ1A 3UINB 4PS3A 5DPWA 1PQSA 3L13A 1WH3A 5DPRA 4DHJD 1EF5A 1P98A 1L7YA 2N1WA 3KUCB 3R7QA 2KDIA 4DK5A 4LDTB 1UBQA 2IO3B 4B95A 1WJUA 2NS5A 3ZNZB 5J17A 1LXDA 2BKRB 3EHVA 4IM2A 3VXWA 3ZVVA 1KM7A 4EZJA 1OTRB 3ZIMA 3BINA 4ASWC 2K6DB 2C7NB 2OJRA 2EKEC 3JYUA 3W1YA 4TUUA 3VTUA 4TV3A 2GBNA 2CU1A 3KH0A 3UQAA 4W9LA 2FNJB 1TTNA 4HXDA 3IFWB 4KIKA 3OLMD 1E8WA 1Q0WB 4W9IA 2MCNB 3U8ZA 2LVPA 1WFYA 3DVNV 2WDTB 2ZNVC 5EDSA 3ML8A 5DCNA 3V6EB 3ZUNA 4IM3A 3TIXA 2DAJA 4ANVA 1Q1OA 3N3KB 1XD3B 4N9F4 3AXCA 4MGYE 1YQBA 2DHZA 1WJNA 2FIDA 2JWZA 4PYUA 3V6CB 1GNUA 2IZVB 3KW5B 4E74A 2GBMA 1WI0A 2MP2A 3P2BA 1UD7A 2LRUA 1C3TA 1CMXB 3DBHI 2RD0A 4BKTA 4YL8A 2LZ6A 2J0JA 4DHZB 2B3AA 2KTRB 3Q3FA 1NDDA 4FJVB 5CHWA 2KK8A 4WAAA 2WWZA 3VHTC 2DYOA 4W9CA 2N9XA 2D10A 2NBUA 3DBRI 4JIOU 4XX5A 3VVWB 1V9JA 1SE9A 4F7ZA 2MW5A 2O2VA 3PLUA 4II3B 1WX8A 3TMPB 5D6JB 2BWFA 3A4RA 4FULA 4KDIC 4I6NB 2MX2A 3NS8A 1WIAA 2V1YA 4K7SA 4ZRKA 3D32A 4PYZA 2KMAA 2KOXA 1WMHB 4F1SA 2AWTA 1P1AA 3N32A 2MBQA 4NNJB 1MG8A 3PV1A 1V80A 4WJQA 2PE9A 4NAWA 1P9DU 1SIFA 2V3SA 5DPTA 2Y5BB 4AP4C 2EMTA 1ZGUB 2N7DA 4B9KA 1K8RB 2YLMA 3N30A 2RR9A 2ZCBA 5CHVC 1L2NA 3OJ3A 2C60A 2EMSA 2XEWA 2CKHB 4GOCA 3PRPB 4KZ0A 2HJ8A 2UWQA 3QCAA 1IYFA 2O6VB 1YIWA 4DXAB 4JQWC 2RPQA 4ANUA 1VD2A 2M8SA 3APDA 2DZJA 1J0GA 4HVBA 4K1RB 4W9JA 5CTRC 1V81A 4M0WB 1Q5WB 3MTNB 4HPLB 3SD5A 1OGWA 4EKUA 3CSTA 3H7PB 2IYDB 3A4SC 5JZEB 2LASA 1WZ3A 1YX6B 2KO3A 2NBVB 3UF8A 3QA8A 3R3MA 2LD9A 4WJPA 3V62A 2ZPNA 3ML9A 4EUTA 4HJKA 4II2B 3HM3A 5GMVA 5G55A 4W9FA 3A33B 1GG3A 3AU4A 5AZHA 2WYQA 3A9KB 3IG3A 3ZW3A 2K8BA 1R4MI 3RT3B 4FBJB 4HK2A 2AL3A 3KYDD 3DCGA 1H8CA 2KQ7A 2IY0B 2KJHB 4X57B 2BYEA 4B6WA 2W9NA 3ZDTA 1P3QU 3DPDA 2KTRA 4MJSB 2L0TA 3L0WB 3M3JA 2ASQA 4TQ1A 2ZJDA 5IAAC 1RLFA 3DOWA 3QARA 2D2QA 1I42A 4HWIB 2K25A 2LJ5A 2Z59B 4K7WA 3EFUA 1WZ0A 2M17A 4DWFA 4A3OA 4GXBA 2G45B 1UBIA 2N1VA 4JL9A 2L7RA 2K1FA 4A20A 4RM9A 2I1KA 4ZRIA 4LJPB 2GOWA 2ZCCA 2RGFA 2D11A 3UQBA 2KDEB 4IUMB 4IWPA 3VDZA 3L54A 1WMHA 4BBNC 4GDKB 4MH0E 3O65B 3ZKJC 4BOSC 2GBRA 3L10B 2LWPA 1H4RA 2NPTB 3ONSA 4FA6A 2PEAA 3TBLD 4HLEA 2BGFA 3K9PB 3OJ4B 3PVLA 3PGEA 2JPHA 2VRRB 2DZKA 3B1LX 2K8HA 4KDLB 4ICVA 5FR6A 4DDID 4I6PA 4I6LB 1Z5SB 2G4DB 2LUEA 2M1MA 2K8CA 1XT9B 2ZZPB 4TKNA 4ZDVA 2L00B 3QAQA 4GGQA 4ANXA 3ZTCA 1V5OA 1KOTA 2FAZA 2KANA 2Z0EB 3A9JB 3PS6A 4KV2A 2KWUB 2N7EA 1X1MA 2O6VA 4G11A 4LDTD 5D94A 3PT2B 3ALBA 1EF1A 1JRUA 4GDLA 4ZRJA 1WE7A 3S2AA 2ZVOA 1AARA 2ZVNA 3DDCB 2J0KA 2CHZA 2XK5B 3I3TB 3PPAA 2KN5A 3ZNGC 3B0AA 1WE6A 3H7PA 3OAWA 3EC8A 2NBWB 3QX1A 4M8NA 1E8ZA 4LCDE 2KC1A 3CF6E 3KYCD 1WXAA 1RFAA 4P7IA 5CX3A 3TCAA 1WM2A 2C9WB 2MLBA 1UELA 3M95A 4FN2A 2QHOA 3K9OB 2AYOB 1G6JA 4HCPB 2K39A 3TJPA 3ZNHB 2DZMA 3SDLC 2L05A 5D7GA 2HE7A 2MBBB 3A9KA 3PRMB 2KMCA 1WXSA 2KC2A 2WX1A 2MQJA 1C1YB 3AU5A 2J7QB 2N9PC 2MWSB 2CHXA 2DYBA 5KHQA 3RCZA 3ZDMC 2LI5A 4MJSA 4MELA 2CS4A 1HE8A 2REXA 2WX0A 5G2NA 1IP9A 2DX5B 4W9DA 5JHAA 3NZSA 5E6OA 4BBNF 2MRPA 3NZUA 4K81A 2N9EB 4AUQC 1BT0A 3ECIA 2R2QA 3KUZA 3WAPA 3DBLI 4FHJA 2LXAA 1XQQA 3JW0X 1IPGA 2IO0B 3VUWA 2D3GA 1WGGA 4KSLC 1VCBA 2IO2B 3PREA 2KNBA 3RULA 4GSWA 3VUXA 3GZNI 4EFOA 5JH5C 4HDQA 4XC2A 2NPTA 4WWPA 1WGRA 1GUAB 4KIKB 1OEYJ 4KZCA 3CMMB 3PRZA 4G0NB 4CYEA 5JHBA 1FXTB 4BKSD 2BYVE 2MBHA 3BY4B 1J8CA 2XBBC 3AI5A 4XZ4A 3NY5A 3WANA 2LVOA 4K7UA 4M8MA 1E5WA 1A5RA 2LRWA 1OEYA 4GB9A 5KHOA 1F9JA 2L3ZA 2MP2B 5C23A 3VH3B 1E7UA 5E6PA 4PS8A 4WQOB 2NR2A 4E71A 2HD5B 2O6VD 1WF9A 1WX7A 4E3CA 5L95C 3DQVA 3QJZA 4MEMA 4EZKA 3VQIA 2AEHA 2BKFA 4W9KA 3PTFC 2XK5A 3ZO5B 1EO6A 3HK0A 2G4SA 3A1QB 4DHJB 3ZLZA 4ANWA 4DHZE 3LJ3A 2G3QB 2L8JA 3H7SA 2KX3A 4BVUC 2PJHA 5IA7A 1TGZB 2FIFA 2JUOA 1E8XA 2KDFB 2KQSA 1D3ZA 1YX5B 1S3SG 4NQKE 4NY0A 1R4NI 2LXCA 1WY8A 2BPSA 2KWCA 4DDGD 4EEWA 1UH6A 3DBSA 5LXIB 1RAXA 1J19A 1WR1A 4FHKA 3IBEA 3UIPB 2KFKB 3HM6X 3VTVA 1LQBA 5LLIA 3U30A 3SHQA 1WGDA 1ZW7A 1WGYA 4MDKE 3C0RB 2MA9B 3IHPC 4AOFA 1WM3A 5D2MB 2NVUI 3IVFA 2LGYA 4ZYNA 3PZDA 3L17A 1ZKHA 3SU8X 4BKSA 4IWOA 2K6QA 3H9DA 2LVQA 1SGHA 2KHWB 3B08A 4RM8A 2BF8B 5DPSA 2IY1B 3X0WA 4AWJA 4ICUA 2UYZB 3DVGY 4IWQA 4G50A 3KUDB 4IM0A 4NPNA 4BFRA 3VH4B 5E6NA 4CO7A 2JRHA 3R66C 4HDOA 1WYWB 3HHMA 2HTHA 5CHFA 3T9LA 5C1ZA 4GU2A 4AJYB 1P0RA 2C7MB 3VUYA 3H1UA 1GC7A 1WX9A 4JLCA 3H6NA 3QC8B 4HCNB 1WRDB 2KFJA 2D07B 2Z0DB 3WA0A 4FJYA 1V49A 3V61A 5TR5A 2FCNA 3VAWA 3NOBA 3VTWA 3QHTA 3DVGX 3MJWA 4G3XB 4NQLB 3WIMA 4WJOA 1LM8B 2LGDA 3GOEA 4EOYA 3ZNID 3RUIB 1GC6A 1WXVA 1ISNA 1U4AA 2A4ZA 2C5LC 2PE6B 4J6IA 4W9HA 4GIVA 4EZLA 5AEKB 1V2YA 1QZEA 5J18A 3PHXB 4LJOB 3HIZA 3JSVB 3QQ8B 3TL5A 2JRIB 1V6EA 4W9EA 1YJ1A 2RSUA 2CHWA 4RMAA 5BO4B 3W1SA 3UGBB 4GN1A 3A1QA 3M62B 2YVCA 2JF5A 1KLVA 2KX0A 3RD2A 2CR5A 2ZNVB 2AL6A 2JZ3B 4FADA 2JXXA 4FJZA 2DENB 1KJTA 4FLHA 3KVFB 4CHKA 2M4NA 3JVZX 2GBJA 3X23A 3ZRFA 2JT4B 4NJ6A 3DVNU 3T8MA 2GMIC 2KTFA 4MSQB 4MGIE 5HKHA 1WGHA 2KFKA 1OQYA 3MHSD 3ZTDA 4W9GA 4BKGA 2MBEA 4GDKA 3NHEB 2DAFA 4TQ0A 3V60A 3WAMA 2IO1B 3U7DA 3W1SC 4MM3A 4BOZB 3RZWC 4A3PA 4IG7B 3M63B 5L83A 4GMVA 2KDBA 4NJ7A 3ZRCA 2IBIB 3QK0A 5J2RA 2FCQA 3QWZB 3LDZE 3EECA 5AZFA 1TBEA 2KLGA 1WJ4A 4MGKE 3PLVA 3UIOB 1E7VA
chains in the Genus database with same CATH superfamily
1TKGA 2V0GA 1WJ6A 4WWNA 3AMZA 2K3UA 3APFA 4C7ZA 5AZGA 4F8CB 1L6UA 2J0MA 2V4LA 1NI3A 4S17A 2I38A 3VRAB 1EUVB 3W5UB 2WXMA 2KVRA 1NI2A 4OVVA 1XO3A 2X38A 3ENEA 1CQVA 3RYTA 1TS2A 4KSKC 2JZZA 1SIJA 2WDRB 2MSED 2WHIA 3L08A 4JGHB 2KKCA 2A5UA 3UINB 3AE3B 3L13A 3P4SB 1IUEA 4DK5A 4LDTB 4B95A 1FRDA 1WJUA 2NS5A 2LUMA 1LXDA 3EHVA 1GOZA 4J3OD 3AN1A 4KKIA 2OJRA 1SE3A 1VR9A 3T3OA 2ZNVC 1FXIA 2KT7A 2LGSA 3V6EB 4IM3A 5D3IB 2WXLA 5BYQA 3TIXA 3EFCA 3N3KB 4MGYE 1YQBA 3V6CB 2GBMA 1V8CA 4DXFA 2LRUA 4N6EB 4BKTA 3B2FA 2GRIA 3N1XC 4WAAA 2WWZA 1UNSA 2DYOA 2V3NA 2BS4B 1SE9A 1GPXA 2O2VA 1WX8A 1YN3A 3TMPB 2AQ3B 2PTLA 4I6NB 1FPYA 2V1YA 1MJDA 4WIPA 2LJIA 2QEJC 4F1SA 1P1AA 2DBYA 1FXAA 2MBQA 5EE0A 1E0ZA 1V80A 2PE9A 4NAWA 1LO5D 3HRDD 2V3SA 2Y5BB 5C2TB 4B9KA 2V4IB 2OEDA 1WRIA 3OJ3A 2EMSA 2CKHB 1FCLA 4GOCA 2UWQA 1YIWA 3CWIA 1XLQA 2RPQA 3APDA 4HVBA 4K1RB 5EE1A 1V81A 4NJCA 3MTNB 3H7PB 1D5ZC 2LASA 1YX6B 3BIID 1NVID 3HVDA 3PZ7A 5C3JB 2JZPA 3R3MA 4WJPA 4ZRQA 3HM3A 5GMVA 3BYYB 4W9FA 4WWMA 5AZHA 2BB5A 3A9KB 3IG3A 1R4MI 4HK2A 2AL3A 3Q2AC 5AUIA 3Q14C 3ZDTA 2L0TA 2WXFA 2MHJA 1JALA 2ZJDA 1RLFA 2D2QA 2Z59B 4K7WA 4A3OA 2PKOA 2Y3AA 1UWMA 2J52A 2G45B 3IXSA 2N1VA 1TY0A 2K1FA 4RM9A 2I1KA 1L6VA 3TEXA 1EWYC 3DBHB 3Q8BA 1PGAA 2D11A 3Q69A 2W3SA 3VDZA 1WMHA 2Z8LA 2BBCA 2NPTB 3TBLD 3K9PB 3LB8C 3OJ4B 3PGEA 2JPHA 2VRRB 4KDLB 2L52A 3V05A 5FK9C 1C4CA 2OHFA 4WURA 2M1MA 1F52A 2V9HA 2R61A 3ZTCA 3PS6A 3A9JB 2DNFA 4G11A 2LGIA 3AEGB 1JRUA 2ZVOA 5H92C 2IGGA 3R2IA 1D5MC 5AUKA 1N62A 2CHZA 3I3TB 1FM0D 2KN5A 3VUYA 3OAWA 2B76B 2NBWB 2IPKD 5FKAC 3ZJUA 4P7IA 1WM2A 1KRHA 3M95A 1T6BX 1G6JA 2DZMA 1TKYA 1XXGA 2HE7A 2MBBB 1WXSA 2WNMA 2J7QB 4A90A 2MWSB 2WXQA 2G9HD 2DYBA 2QIEB 2LI5A 5G2NA 2EELA 2DX5B 4MACA 3C8YA 2LXAA 1XQQA 2AQ1B 2XNAC 2IO0B 2D3GA 3P63A 5MPOA 2SEBD 3GE8C 5JHBA 3ZGZA 3NY5A 1HXYD 2LEKA 1F9JA 1STEA 2L3ZA 3VH3B 1E7UA 2NR2A 2HD5B 3FKYA 4R3DA 3DQVA 4MEMA 3IAS1 2BKFA 2VH2A 3HK0A 4KGRA 4ANWA 4DHZE 1I4QA 2L8JA 2KX3A 3NS1A 2KWDA 2FIFA 1E8XA 2KDFB 1D4BA 4NY0A 1RAXA 1C79A 3IBEA 3UIPB 1WGYA 3IHPC 2PIAA 1WGKA 5D2MB 1PGBA 1RWSA 3RI7C 3TEYA 3X0WA 4ICUA 2UYZB 4IM0A 2XN9C 1JWMD 2M19A 3R8BA 1N61A 4GU2A 1FNWA 1N5WA 2C7MB 2KDMA 4JLCA 4HCNB 1YJIA 4FJYA 1D6EC 4RCOA 3Q8AA 1KF6B 3VAWA 1VZ8A 3EA6A 3SFEB 2BTEA 4RH6A 1U4AA 1QZEA 4GLSC 4L23A 3HIZA 3QQ8B 1YQ3B 2JU6X 4W9EA 3TSSA 3UGBB 4KGSA 3M62B 1XLNA 1K51A 4NZLB 2AL6A 1KJTA 2K22A 3J9CA 1ENFA 2JT4B 3DVNU 3MHSD 3Q8EA 4JWSC 4HRSA 1RM6C 1TT5B 4GMVA 3VRBB 1F2RI 3FILA 4MGKE 3Q3OC 4WH4A 3N9YC 3A9JA 2N4FA 4RF0A 4GDLB 4HPMB 4LTUA 2I1JA 1OFFA 1ZP0B 5G5HA 4LNNA 4HKZE 4WJNA 2JVCA 1QT9A 3AULA 1ET9A 3PHWB 1JWBD 2O2VB 3NVZA 2JY6A 1UGMA 1UGJA 2L1AA 4MGZE 4RFBA 2KLCA 4AJWA 2KWVB 2PVGC 3UI3A 1L4ZB 3JSVA 4OVUA 4NAWB 4TSSA 1WWTA 2KJ6A 2M0AA 4PS3A 1PQSA 4P1BC 1FCCC 1WH3A 5DPRA 1XEEA 1EF5A 1P98A 2M56B 4O1NA 1L7YA 2N1WA 2INPE 2L32A 2IO3B 1EU4A 4RGOS 3N20C 3VXWA 4FXCA 4ASWC 2Q5WD 4K3CA 3JYUA 3W1YA 4TUUA 2CU1A 3L4PA 2MCNB 1I4HA 3OLMD 4W9IA 2LVPA 1WFYA 2QMTA 4XWTA 1UF0A 3DBLB 3ZUNA 5HI1A 4ANVA 1XD3B 2D5GA 3AXCA 1GNUA 3GZNB 1UD7A 2INDC 1CMXB 1I4RA 2LZ6A 4USAA 4DHZB 2B3AA 3Q3FA 1NDDA 4FJVB 2KK8A 3VHTC 1BXTA 2D10A 4JIOU 4XX5A 4F7ZA 3B2GA 4BZAA 3PLUA 1YJJA 1F77A 2BWFA 3ZJVA 1IGCA 4KDIC 3NS8A 4K7SA 4US9A 1WMHB 2L83A 2AWTA 3GB1A 3PV1A 4OHJA 1EM7A 4YSYB 1SIFA 4AP4C 2N7DA 3HVZA 2RR9A 2ZCBA 1PFDA 2J42A 1L2NA 1T3QA 2XEWA 2K5PA 3TUOA 1IYFA 2WGSA 4JQWC 3U52E 2M8SA 1E6EB 4W9JA 5CTRC 2TSSA 4RGNA 2BB6A 3RMKC 3SD5A 1HZ6A 3A4SC 5JZEB 2NBVB 4BAXA 3QA8A 2NMQA 5JXVA 3ML9A 4EUTA 5G55A 2LHDA 4A55A 3Q6BA 3RT3B 2KACA 2YEPB 3KYDD 1H8CA 5HHDG 3U4EG 4X57B 4B6WA 2KTRA 1DOXA 3L0WB 1YNTE 2ASQA 4HWIB 4DWFA 1F1HA 5BMGA 1UBIA 2ONQA 2WU2B 2JX5A 1T0QC 1T0RC 2RGFA 4HKQA 1F0ZA 4IUMB 4IWPA 3L54A 1JW9D 3ZKJC 2LWPA 3ONSA 1J7CA 2KVZA 2BGFA 3PVLA 1L5PA 3B1LX 3AH7A 5FR6A 5TSSA 4I6LB 1XT9B 2ZZPB 4ZDVA 4ANXA 4GGQA 1V5OA 2KANA 2Z0EB 4DQOC 2E3TA 4GDLA 3PO0A 3DWMA 2ZVNA 1N6ZA 1DOIA 4M0WA 3AE6B 5HG2A 1WE6A 3ZJTA 3EC8A 2KC1A 2KQ4X 1FEHA 1RFAA 2C9WB 1L0XB 2QHOA 1ZXIA 4YTMB 4HCPB 3SDLC 5D7GA 2KC2A 2MQJA 2JYEA 1V1OA 2N9PC 2WXHA 3MJ5A 1C4PA 5KHQA 3ZDMC 4MJSA 5GXGB 3RNBC 2REXA 1KFYB 2RDGA 4W9DA 1JWAD 4HROA 5JHAA 1WSPA 5E6OA 4BBNF 3NZUA 1DGJA 4AUQC 3ECIA 2R2QA 3WAPA 2WXGA 1YN5A 3DBLI 4FHJA 4M00A 3EGRA 1L0VB 4XDDA 3PREA 2KNBA 3RULA 3VUXA 3GZNI 4ZRPA 4HDQA 1GB4A 3VR8B 1GUAB 4KIKB 3HUIA 1OEYJ 2FUG1 1SJHD 4CYEA 2IDYA 1FXTB 2BYVE 4ARIA 2MBHA 3BY4B 3SFDB 2XBBC 4XZ4A 1NEKB 1VZ6A 2MP2B 4JWUC 5E6PA 4PS8A 4WQOB 1EU3A 4E71A 2D3BA 1FIQA 1WF9A 3P4PB 2AEHA 4W9KA 3PTFC 2XK5A 3ETRA 3LJ3A 3H7SA 2PJHA 3I63C 1YX5B 4XDCA 1WY8A 2BPSA 2KWCA 1TS4A 3KLSX 1UH6A 3DBSA 4FHKA 1F2RC 1ZW7A 2PVOD 3C0RB 4AOFA 3DBRB 3MP9A 4K3BA 3SU8X 3FILB 3H9DA 1SGHA 3B08A 4RM8A 2IY1B 4AWJA 3DVGY 1HTQA 4IWQA 4G50A 3KUDB 4BFRA 5E6NA 3Q8FA 2WLBA 3I9V1 2HTHA 1SEBD 5CHFA 3ZYYX 2W82A 1UWXA 2PMVA 1P0RA 1C9FA 1GC7A 2MEKA 1WRDB 2KFJA 2D07B 1PDXA 3N1YC 3WA0A 1V49A 1SXTA 1XCQL 3MJWA 1LM8B 2LGDA 4EOYA 3ZNID 3RUIB 1MI0A 1E9MA 1WXVA 4J6IA 4HJGE 1FFUA 2QILA 3PHXB 1NENB 1QQRA 3URYA 3JSVB 1UUPA 2JRIB 1V6EA 4YTPB 5BO4B 3A1QA 1ZPSA 1MHHE 1KLVA 2KX0A 5EE9A 2LFIA 2DENB 4FLHA 1SSNA 2V3PA 1PGXA 3ZRFA 2GBJA 3X23A 4NJ6A 3T8MA 2GMIC 1WGHA 4BKGA 2WXOA 4W9GA 2MBEA 3NZ3A 3V60A 1C77A 3WAMA 3U7DA 3W1SC 4IG7B 3M63B 5IP4D 2KDBA 5LNK1 3LDZE 3EECA 5AZFA 5IKCM 3UIOB 1YD8U 3TEZA 4KVGB 3R7RA 2OOBB 2RMMA 2N9LA 2ZPYA 2JXTA 4MSMB 1B1ZA 2L0FA 4URKA 3LXFA 2KD0A 3IT6B 3WAOA 3C19A 3L16A 2FUHB 2C7HA 2M0XA 2DZIA 1RRBA 1YMHE 3APCA 1I35A 1E8YA 1LFDA 4OVZA 3WALA 3CSFA 1E90A 2BYFA 2R2OA 2BS2B 1SJED 2KXJA 2MBOA 2NCNA 4WWOA 1GJZA 2INNE 5BYSA 3GS2A 1Z2MA 1V5TA 5FR3A 4C80A 4IW0A 1TZ1A 1V97A 2FE8A 3RNAC 3ZXVA 5IO9A 3GP7A 4DHJD 1OQRA 1UBQA 3ZNZB 1K53A 4IM2A 1KM7A 4EZJA 1OTRB 2JQRB 2K6DB 2EKEC 3VTUA 1FNUA 3UQAA 4W9LA 2FNJB 1MG4A 4HXDA 4KIKA 1E8WA 4TMAB 3U8ZA 2WDTB 5D3DA 4Q2JA 5EDSA 2D3AA 2QCZA 2WXKA 2ACZB 4YSZB 3BVMA 2DHZA 4CQNA 1WJNA 2FIDA 4PYUA 3AEDB 4WQMA 1ZDVA 3RNFC 3P2BA 2MP2A 1FD6A 1E10A 4HEA1 3DBHI 4YL8A 2J0JA 2KTRB 4M02A 3Q8CA 1FO4A 2MJDA 3P4QB 2GLSA 3VVWB 4A9AA 2NBUA 3DBRI 1AWDA 4II3B 1FNVA 5D6JB 5HFYA 2JWUA 4FULA 3T3NA 2MX2A 2WDQB 4PYZA 3W2DA 3MC0B 3N32A 1MG8A 4C7YA 3B9JA 4KX6B 2WU5B 5DPTA 4KGTA 4MH8A 4PK1A 2YLMA 5CHVC 3RPFC 3PRPB 4KZ0A 4RGTA 4ANUA 4AS1A 2ZW1A 4M0WB 1QOBA 4HPLB 4EKUA 3CSTA 2IYDB 2GB1A 4MT5A 2RDBC 1TYGB 2KO3A 1MVKA 2ZPNA 3A33B 2WYQA 3ZW3A 3I5JC 3AV8A 2EKIA 2KJHB 1P3QU 3DPDA 1TZOA 4MJSB 4RNAA 3M3JA 3MC8A 4TQ1A 3TEWA 3QARA 1I42A 2K25A 1WZ0A 3E9SA 1HEZE 2NTTA 2L7RA 2GOWA 2ZCCA 1E7PB 2QDFA 3ZQ4A 3UQBA 3O65B 3O13A 4BOSC 2GBRA 1DYQA 3L10B 1MHXA 2HTME 1H4RA 2BW2A 3DHGC 1JCKB 2WQYB 2I2YA 1TY2A 3FAHA 4DDID 4JPSA 1Z5SB 2G4DB 2LUEA 2W55A 2FBWB 3QAQA 2FAZA 2CJNA 2N7EA 1X1MA 2O6VA 5T8IA 3PT2B 3ALBA 1EF1A 4ZRJA 1WE7A 3S2AA 3AB5A 1AARA 4RF1A 2KAJA 3DDCB 1VZ7A 2XK5B 1XCTL 3PPAA 3ZNGC 3B0AA 4M8NA 2PW9A 2CJOA 1YN4A 3CF6E 3KQ4A 1WXAA 3KYCD 2MLBA 4FN2A 3K9OB 4HPPA 3TJPA 3ZNHB 3NVVA 2E6XA 5BYRA 3PRMB 4YTNB 1C1YB 3N1ZC 2WX0A 4L2YA 1IP9A 1T0SC 2MRPA 4UDUC 2H88B 3VR9B 1BT0A 1C78A 3KUZA 1YOVB 4C00A 3JW0X 1IPGA 1KLGD 2IO2B 1R7SA 4JX1C 4EFOA 5JH5C 1I4PA 4WWPA 1WGRA 3CMMB 3PRZA 4BKSD 1TS5A 4OZCA 1RYJA 1J8CA 3IAM1 4ITKA 2AX5A 2LVOA 4K7UA 1SF0A 4M8MA 1DOYA 1E5WA 1A5RA 1OEYA 3NJTA 3BWUD 5C23A 4LNFA 2J53A 2O6VD 1WX7A 5G5GA 2WXJA 3RNEC 5L95C 1QF6A 3AEFB 3QJZA 4EZKA 3ZO5B 4A6QA 4YT0B 2G4SA 3A1QB 4DHJB 1ESFA 2G3QB 5IA7A 2WDVB 2JUOA 2J4XA 1D3ZA 1S3SG 2LXCA 5LXIB 1WR1A 1TJEA 3HM6X 3VTVA 3SHQA 2MA9B 2SAKA 3IVFA 4ZYNA 3PZDA 3NVYA 2RDHA 4IWOA 3W9CB 3AEBB 4A8XC 3FC4A 1K50A 2LVQA 2BF8B 2JRHA 1WYWB 3HHMA 4LNOA 4D2KA 4XGAB 5C1ZA 4AJYB 3OG5A 4L1BA 2IGHA 3QC8B 1ROEA 2X8XX 3AECB 1PYWD 4KKJA 3V61A 3VTWA 4H2AA 1V1PA 3QHTA 3DVGX 4NQLB 1C4AA 1GC6A 2CU3A 3AEEB 1ISNA 2C5LC 2PE6B 4EZLA 5AEKB 3DHHC 1TIFA 3DHIC 5J18A 2W54A 2BYTA 1JRPA 2K9XA 1YJ1A 2RSUA 2CHWA 3SR6A 2JF5A 3AE8B 2UU7A 1T5XD 3RD2A 2ZNVB 2WXIA 2JZ3B 2JXXA 4FJZA 3KVFB 1VJKA 2KMMA 2DWQA 2ON8A 4MSQB 2KFKA 3ZXRA 3ZTDA 3NHEB 3EUB2 2DAFA 2IO1B 3RZWC 5E6JA 4A3PA 5L83A 4NJ7A 3ZRCA 3QK0A 2FCQA 3BVGA 3QWZB 1L0YB 3DWGC 1BUIC 2IGDA 2KLGA 5H8YE 2QC8A 2DYMA 1HTOA 1T0YA 2FCMA 3RZFA 3QIJA 1HQRD 1M94A 1V86A 5LXHA 2BVCA 1UZXB 3H8HA 2BWES 3NVWA 2FCSA 3PSEB 4LK0M 2KZRA 4DBGA 3BZDB 4IC7B 4PS7A 1NBFC 2LHEA 1WXMA 2LGXA 2BQQA 1WR6E 2GBKA 1JROA 2PPHA 3Q3JA 1Y8RC 2L76A 2K0PA 4JE3B 4QAYA 3IT4B 2KJRA 2ZEQA 1S1QB 3VFKA 1YQ4B 1I4GA 4XYCA 1JWSD 3BK2A 4ZHPA 5DPWA 1J7AA 2OJWA 2N7JA 5EE3A 3KUCB 1ET6A 3I57A 4P6VF 3R7QA 2KDIA 4RGMA 1ZXHA 1AYFA 3U2SC 4ARCA 1IBXA 2INCC 5J17A 2BKRB 3ZVVA 2WXNA 1KH0A 3ZIMA 2DLBA 3RFZB 3BINA 3CIRB 2C7NB 4TV3A 2GBNA 3KH0A 1TTNA 4OZAA 3IFWB 1Q0WB 3DVNV 3OWEB 1SB3C 3ML8A 5DCNA 3KWLA 2DAJA 1Q1OA 1ZOYB 4N9F4 5BMIA 3AEAB 4C4VA 3NG0A 2JWZA 2IZVB 3KW5B 4E74A 1WI0A 4OZBA 1ACCA 4YXDB 4REZA 1C3TA 2RD0A 1I7HA 1MFWA 4C56C 1NYQA 1JWUD 3GE3C 5I4DA 5CHWA 3BVZA 2N0SB 4NAMA 5IN7A 4S0RA 4W9CA 1CJEA 2PLPA 2N9XA 1GB1A 3MFGA 1V9JA 2WP9B 4P16A 2Y5CA 1M4VA 2MW5A 1CK1A 3A4RA 2VZKD 1WIAA 4ZRKA 1P7FA 3D32A 1VDVA 3RNCC 2D3CA 2KMAA 2KOXA 4XWWA 1TKEA 4NNJB 2WS3B 4WJQA 2MJ3A 1P9DU 2MH7A 2EMTA 1ZGUB 1HZ5A 1K8RB 2WXPA 3N30A 1JMLA 1R4NB 2C60A 4B0MA 2HJ8A 1AN8A 3QCAA 1WYGA 2O6VB 4DXAB 1VD2A 2DZJA 4IDIA 1J0GA 1AW7A 1Q5WB 2G1EA 1OGWA 3KWVA 3BK1A 1WZ3A 3UF8A 2LD9A 3AE2B 2JYTA 2BS3B 3V62A 3E56A 4HJKA 4II2B 1BMLC 1GG3A 3AU4A 2K8BA 3P1MA 4FBJB 3DCGA 2KQ7A 2IY0B 3P4RB 2BYEA 2W9NA 2W3RA 4ACFA 5BMHA 1C76A 5IAAC 3DOWA 3AE7B 2LJ5A 3EFUA 2M17A 4YSXB 1EWCA 4GXBA 4JL9A 4A20A 4ZRIA 3MC9A 4LJPB 4ZOHC 3AE1B 1FMAD 2KDEB 4BBNC 4GDKB 4MH0E 4MM3B 4OW0A 4LNKA 1OQQA 4FA6A 4P1CC 2JSVX 2PEAA 4HLEA 2YEPF 2DZKA 2K8HA 1SE2A 4ICVA 4I6PA 3AE5B 1N5XA 2GI9A 1ZDXA 2K8CA 4TKNA 2L00B 1QLBB 1KOTA 4KV2A 2KWUB 1ZE3D 4LDTD 1XLOA 4IOIE 5D94A 1L4DB 3AE9B 1FFVA 1D5XC 2J0KA 1QOFA 1B9RA 3QX1A 3H7PA 2KN4A 1E8ZA 4LCDE 5CX3A 1ZUD2 3TCAA 1GAQB 1UELA 1KLUD 4AQ7A 3P42A 2AYOB 1Q10A 2K39A 2L05A 3A9KA 3AE4B 2KMCA 2WX1A 1XF5L 3AU5A 1WXQA 2CHXA 3RCZA 2BT6A 4MELA 1SE4A 2CS4A 1HE8A 1NYRA 3NZSA 4K81A 2N9EB 3R2TA 2Y5PA 4LLGM 3NRZA 3VUWA 1WGGA 4KSLC 1VCBA 4GSWA 4N59A 3LYYA 2QJLA 4XC2A 2NPTA 1I4XA 3RNGC 1HA5A 2MJEA 4KZCA 4G0NB 3Q3NC 1V1PB 1VLBA 4US8A 3AI5A 3WANA 1XLPA 2LRWA 4GB9A 5KHOA 1Y56A 3MHZA 4LNIA 2N9KA 4E3CA 3BYTB 2HDEA 3W5VB 3VQIA 4EE2A 1EO6A 2AQ2B 3ZLZA 3ABVB 1K52A 4IKGA 4BVUC 1TGZB 4M01A 2ICIA 2KQSA 4NQKE 1R4NI 4DDGD 4EEWA 1J19A 1IGDA 2KFKB 1LQBA 5LLIA 3U30A 4ZHOA 3V3XA 1WGDA 1TS3A 4MDKE 2LMCA 1WM3A 2NVUI 2LGYA 1JQ4A 3AM9A 1QILA 3L17A 1ZKHA 4BKSA 1P7EA 2K6QA 2KHWB 5DPSA 3U7ZA 1PUTA 4NPNA 3Q3MC 3VH4B 4PT5A 4CO7A 1QOAA 2HJ1A 3R66C 4HDOA 3T9LA 3RN9C 2QSDA 1CZPA 1N60A 2ZW0A 3H1UA 4N58A 1WX9A 3H6NA 4YWGG 3WCQA 2Z0DB 5TR5A 2FCNA 3NOBA 2VZKB 3NUHB 4G3XB 3WIMA 2NTSA 4WJOA 3GOEA 1QKZA 2A4ZA 1VRAB 4W9HA 4GIVA 1V2YA 4LJOB 4XE0A 3TL5A 2IJ0A 2WXRA 4RMAA 3W1SA 2VH1A 4GN1A 4WAFA 1N63A 2YVCA 1A70A 4DXGA 1J7BA 2CR5A 4FADA 3SEBA 4CHKA 1R4MB 2M4NA 3JVZX 4B0EA 1IBXB 1KTKA 2KTFA 1FRRA 4MGIE 5HKHA 1OQYA 4GDKA 4TQ0A 4MM3A 4BOZB 1MPEA 1LGRA 2KYWA 5IOIA 2IBIB 5J2RA 4ZYSA 1QOGA 1RFKA 1TBEA 2H89B 1WJ4A 1SBBB 3PLVA 2RPVA 3PZ8A 1E7VA 4C4VB
chains in the Genus database with same CATH topology
2DYMA 1YD8U 1T0YA 4KVGB 2FCMA 1WJ6A 3R7RA 3RZFA 4WWNA 3A9JA 2N4FA 3QIJA 4GDLB 2OOBB 2ZPYA 1M94A 4MSMB 1V86A 4HPMB 5LXHA 2L0FA 4URKA 3APFA 2I1JA 2KD0A 4F8CB 5AZGA 1UZXB 2J0MA 3WAOA 2BWES 3L16A 2FUHB 2V4LA 2FCSA 3PSEB 2C7HA 2JVCA 4WJNA 2KZRA 3AULA 2M0XA 2DZIA 4DBGA 1RRBA 3PHWB 3APCA 1I35A 1EUVB 4IC7B 4PS7A 1NBFC 2O2VB 1E8YA 1LFDA 1UGMA 2JY6A 3WALA 1WXMA 2KVRA 2LGXA 3CSFA 4MGZE 1E90A 1NI2A 1WR6E 2GBKA 2BYFA 4OVVA 2KLCA 4AJWA 2KWVB 2R2OA 2PPHA 3Q3JA 3ENEA 1Y8RC 2L76A 2KXJA 2MBOA 2NCNA 4WWOA 3RYTA 1GJZA 2KJRA 2ZEQA 4KSKC 3JSVA 1S1QB 2JZZA 4NAWB 4OVUA 2MSED 1Z2MA 3VFKA 3L08A 1V5TA 4JGHB 2KKCA 2A5UA 2KJ6A 4IW0A 1TZ1A 3UINB 4PS3A 5DPWA 1PQSA 3L13A 1WH3A 5DPRA 4DHJD 1EF5A 1P98A 1L7YA 2N1WA 3KUCB 3R7QA 2KDIA 4DK5A 4LDTB 1UBQA 2IO3B 4B95A 1WJUA 2NS5A 3ZNZB 5J17A 1LXDA 2BKRB 3EHVA 4IM2A 3VXWA 3ZVVA 1KM7A 4EZJA 1OTRB 3ZIMA 3BINA 4ASWC 2K6DB 2C7NB 2OJRA 2EKEC 3JYUA 3W1YA 4TUUA 3VTUA 4TV3A 2GBNA 2CU1A 3KH0A 3UQAA 4W9LA 2FNJB 1TTNA 4HXDA 3IFWB 4KIKA 3OLMD 1E8WA 1Q0WB 4W9IA 2MCNB 3U8ZA 2LVPA 1WFYA 3DVNV 2WDTB 2ZNVC 5EDSA 3ML8A 5DCNA 3V6EB 3ZUNA 4IM3A 3TIXA 2DAJA 4ANVA 1Q1OA 3N3KB 1XD3B 4N9F4 3AXCA 4MGYE 1YQBA 2DHZA 1WJNA 2FIDA 2JWZA 4PYUA 3V6CB 1GNUA 2IZVB 3KW5B 4E74A 2GBMA 1WI0A 2MP2A 3P2BA 1UD7A 2LRUA 1C3TA 1CMXB 3DBHI 2RD0A 4BKTA 4YL8A 2LZ6A 2J0JA 4DHZB 2B3AA 2KTRB 3Q3FA 1NDDA 4FJVB 5CHWA 2KK8A 4WAAA 2WWZA 3VHTC 2DYOA 4W9CA 2N9XA 2D10A 2NBUA 3DBRI 4JIOU 4XX5A 3VVWB 1V9JA 1SE9A 4F7ZA 2MW5A 2O2VA 3PLUA 4II3B 1WX8A 3TMPB 5D6JB 2BWFA 3A4RA 4FULA 4KDIC 4I6NB 2MX2A 3NS8A 1WIAA 2V1YA 4K7SA 4ZRKA 3D32A 4PYZA 2KMAA 2KOXA 1WMHB 4F1SA 2AWTA 1P1AA 3N32A 2MBQA 4NNJB 1MG8A 3PV1A 1V80A 4WJQA 2PE9A 4NAWA 1P9DU 1SIFA 2V3SA 5DPTA 2Y5BB 4AP4C 2EMTA 1ZGUB 2N7DA 4B9KA 1K8RB 2YLMA 3N30A 2RR9A 2ZCBA 5CHVC 1L2NA 3OJ3A 2C60A 2EMSA 2XEWA 2CKHB 4GOCA 3PRPB 4KZ0A 2HJ8A 2UWQA 3QCAA 1IYFA 2O6VB 1YIWA 4DXAB 4JQWC 2RPQA 4ANUA 1VD2A 2M8SA 3APDA 2DZJA 1J0GA 4HVBA 4K1RB 4W9JA 5CTRC 1V81A 4M0WB 1Q5WB 3MTNB 4HPLB 3SD5A 1OGWA 4EKUA 3CSTA 3H7PB 2IYDB 3A4SC 5JZEB 2LASA 1WZ3A 1YX6B 2KO3A 2NBVB 3UF8A 3QA8A 3R3MA 2LD9A 4WJPA 3V62A 2ZPNA 3ML9A 4EUTA 4HJKA 4II2B 3HM3A 5GMVA 5G55A 4W9FA 3A33B 1GG3A 3AU4A 5AZHA 2WYQA 3A9KB 3IG3A 3ZW3A 2K8BA 1R4MI 3RT3B 4FBJB 4HK2A 2AL3A 3KYDD 3DCGA 1H8CA 2KQ7A 2IY0B 2KJHB 4X57B 2BYEA 4B6WA 2W9NA 3ZDTA 1P3QU 3DPDA 2KTRA 4MJSB 2L0TA 3L0WB 3M3JA 2ASQA 4TQ1A 2ZJDA 5IAAC 1RLFA 3DOWA 3QARA 2D2QA 1I42A 4HWIB 2K25A 2LJ5A 2Z59B 4K7WA 3EFUA 1WZ0A 2M17A 4DWFA 4A3OA 4GXBA 2G45B 1UBIA 2N1VA 4JL9A 2L7RA 2K1FA 4A20A 4RM9A 2I1KA 4ZRIA 4LJPB 2GOWA 2ZCCA 2RGFA 2D11A 3UQBA 2KDEB 4IUMB 4IWPA 3VDZA 3L54A 1WMHA 4BBNC 4GDKB 4MH0E 3O65B 3ZKJC 4BOSC 2GBRA 3L10B 2LWPA 1H4RA 2NPTB 3ONSA 4FA6A 2PEAA 3TBLD 4HLEA 2BGFA 3K9PB 3OJ4B 3PVLA 3PGEA 2JPHA 2VRRB 2DZKA 3B1LX 2K8HA 4KDLB 4ICVA 5FR6A 4DDID 4I6PA 4I6LB 1Z5SB 2G4DB 2LUEA 2M1MA 2K8CA 1XT9B 2ZZPB 4TKNA 4ZDVA 2L00B 3QAQA 4GGQA 4ANXA 3ZTCA 1V5OA 1KOTA 2FAZA 2KANA 2Z0EB 3A9JB 3PS6A 4KV2A 2KWUB 2N7EA 1X1MA 2O6VA 4G11A 4LDTD 5D94A 3PT2B 3ALBA 1EF1A 1JRUA 4GDLA 4ZRJA 1WE7A 3S2AA 2ZVOA 1AARA 2ZVNA 3DDCB 2J0KA 2CHZA 2XK5B 3I3TB 3PPAA 2KN5A 3ZNGC 3B0AA 1WE6A 3H7PA 3OAWA 3EC8A 2NBWB 3QX1A 4M8NA 1E8ZA 4LCDE 2KC1A 3CF6E 3KYCD 1WXAA 1RFAA 4P7IA 5CX3A 3TCAA 1WM2A 2C9WB 2MLBA 1UELA 3M95A 4FN2A 2QHOA 3K9OB 2AYOB 1G6JA 4HCPB 2K39A 3TJPA 3ZNHB 2DZMA 3SDLC 2L05A 5D7GA 2HE7A 2MBBB 3A9KA 3PRMB 2KMCA 1WXSA 2KC2A 2WX1A 2MQJA 1C1YB 3AU5A 2J7QB 2N9PC 2MWSB 2CHXA 2DYBA 5KHQA 3RCZA 3ZDMC 2LI5A 4MJSA 4MELA 2CS4A 1HE8A 2REXA 2WX0A 5G2NA 1IP9A 2DX5B 4W9DA 5JHAA 3NZSA 5E6OA 4BBNF 2MRPA 3NZUA 4K81A 2N9EB 4AUQC 1BT0A 3ECIA 2R2QA 3KUZA 3WAPA 3DBLI 4FHJA 2LXAA 1XQQA 3JW0X 1IPGA 2IO0B 3VUWA 2D3GA 1WGGA 4KSLC 1VCBA 2IO2B 3PREA 2KNBA 3RULA 4GSWA 3VUXA 3GZNI 4EFOA 5JH5C 4HDQA 4XC2A 2NPTA 4WWPA 1WGRA 1GUAB 4KIKB 1OEYJ 4KZCA 3CMMB 3PRZA 4G0NB 4CYEA 5JHBA 1FXTB 4BKSD 2BYVE 2MBHA 3BY4B 1J8CA 2XBBC 3AI5A 4XZ4A 3NY5A 3WANA 2LVOA 4K7UA 4M8MA 1E5WA 1A5RA 2LRWA 1OEYA 4GB9A 5KHOA 1F9JA 2L3ZA 2MP2B 5C23A 3VH3B 1E7UA 5E6PA 4PS8A 4WQOB 2NR2A 4E71A 2HD5B 2O6VD 1WF9A 1WX7A 4E3CA 5L95C 3DQVA 3QJZA 4MEMA 4EZKA 3VQIA 2AEHA 2BKFA 4W9KA 3PTFC 2XK5A 3ZO5B 1EO6A 3HK0A 2G4SA 3A1QB 4DHJB 3ZLZA 4ANWA 4DHZE 3LJ3A 2G3QB 2L8JA 3H7SA 2KX3A 4BVUC 2PJHA 5IA7A 1TGZB 2FIFA 2JUOA 1E8XA 2KDFB 2KQSA 1D3ZA 1YX5B 1S3SG 4NQKE 4NY0A 1R4NI 2LXCA 1WY8A 2BPSA 2KWCA 4DDGD 4EEWA 1UH6A 3DBSA 5LXIB 1RAXA 1J19A 1WR1A 4FHKA 3IBEA 3UIPB 2KFKB 3HM6X 3VTVA 1LQBA 5LLIA 3U30A 3SHQA 1WGDA 1ZW7A 1WGYA 4MDKE 3C0RB 2MA9B 3IHPC 4AOFA 1WM3A 5D2MB 2NVUI 3IVFA 2LGYA 4ZYNA 3PZDA 3L17A 1ZKHA 3SU8X 4BKSA 4IWOA 2K6QA 3H9DA 2LVQA 1SGHA 2KHWB 3B08A 4RM8A 2BF8B 5DPSA 2IY1B 3X0WA 4AWJA 4ICUA 2UYZB 3DVGY 4IWQA 4G50A 3KUDB 4IM0A 4NPNA 4BFRA 3VH4B 5E6NA 4CO7A 2JRHA 3R66C 4HDOA 1WYWB 3HHMA 2HTHA 5CHFA 3T9LA 5C1ZA 4GU2A 4AJYB 1P0RA 2C7MB 3VUYA 3H1UA 1GC7A 1WX9A 4JLCA 3H6NA 3QC8B 4HCNB 1WRDB 2KFJA 2D07B 2Z0DB 3WA0A 4FJYA 1V49A 3V61A 5TR5A 2FCNA 3VAWA 3NOBA 3VTWA 3QHTA 3DVGX 3MJWA 4G3XB 4NQLB 3WIMA 4WJOA 1LM8B 2LGDA 3GOEA 4EOYA 3ZNID 3RUIB 1GC6A 1WXVA 1ISNA 1U4AA 2A4ZA 2C5LC 2PE6B 4J6IA 4W9HA 4GIVA 4EZLA 5AEKB 1V2YA 1QZEA 5J18A 3PHXB 4LJOB 3HIZA 3JSVB 3QQ8B 3TL5A 2JRIB 1V6EA 4W9EA 1YJ1A 2RSUA 2CHWA 4RMAA 5BO4B 3W1SA 3UGBB 4GN1A 3A1QA 3M62B 2YVCA 2JF5A 1KLVA 2KX0A 3RD2A 2CR5A 2ZNVB 2AL6A 2JZ3B 4FADA 2JXXA 4FJZA 2DENB 1KJTA 4FLHA 3KVFB 4CHKA 2M4NA 3JVZX 2GBJA 3X23A 3ZRFA 2JT4B 4NJ6A 3DVNU 3T8MA 2GMIC 2KTFA 4MSQB 4MGIE 5HKHA 1WGHA 2KFKA 1OQYA 3MHSD 3ZTDA 4W9GA 4BKGA 2MBEA 4GDKA 3NHEB 2DAFA 4TQ0A 3V60A 3WAMA 2IO1B 3U7DA 3W1SC 4MM3A 4BOZB 3RZWC 4A3PA 4IG7B 3M63B 5L83A 4GMVA 2KDBA 4NJ7A 3ZRCA 2IBIB 3QK0A 5J2RA 2FCQA 3QWZB 3LDZE 3EECA 5AZFA 1TBEA 2KLGA 1WJ4A 4MGKE 3PLVA 3UIOB 1E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYM A;  1YD8 U;  1T0Y A;  4KVG B;  2FCM A;  1WJ6 A;  3R7R A;  3RZF A;  4WWN A;  3A9J A;  2N4F A;  3QIJ A;  4GDL B;  2OOB B;  2ZPY A;  1M94 A;  4MSM B;  1V86 A;  4HPM B;  5LXH A;  2L0F A;  4URK A;  3APF A;  2I1J A;  2KD0 A;  4F8C B;  5AZG A;  1UZX B;  2J0M A;  3WAO A;  2BWE S;  3L16 A;  2FUH B;  2V4L A;  2FCS A;  3PSE B;  2C7H A;  2JVC A;  4WJN A;  2KZR A;  3AUL A;  2M0X A;  2DZI A;  4DBG A;  1RRB A;  3PHW B;  3APC A;  1I35 A;  1EUV B;  4IC7 B;  4PS7 A;  1NBF C;  2O2V B;  1E8Y A;  1LFD A;  1UGM A;  2JY6 A;  3WAL A;  1WXM A;  2KVR A;  2LGX A;  3CSF A;  4MGZ E;  1E90 A;  1NI2 A;  1WR6 E;  2GBK A;  2BYF A;  4OVV A;  2KLC A;  4AJW A;  2KWV B;  2R2O A;  2PPH A;  3Q3J A;  3ENE A;  1Y8R C;  2L76 A;  2KXJ A;  2MBO A;  2NCN A;  4WWO A;  3RYT A;  1GJZ A;  2KJR A;  2ZEQ A;  4KSK C;  3JSV A;  1S1Q B;  2JZZ A;  4NAW B;  4OVU A;  2MSE D;  1Z2M A;  3VFK A;  3L08 A;  1V5T A;  4JGH B;  2KKC A;  2A5U A;  2KJ6 A;  4IW0 A;  1TZ1 A;  3UIN B;  4PS3 A;  5DPW A;  1PQS A;  3L13 A;  1WH3 A;  5DPR A;  4DHJ D;  1EF5 A;  1P98 A;  1L7Y A;  2N1W A;  3KUC B;  3R7Q A;  2KDI A;  4DK5 A;  4LDT B;  1UBQ A;  2IO3 B;  4B95 A;  1WJU A;  2NS5 A;  3ZNZ B;  5J17 A;  1LXD A;  2BKR B;  3EHV A;  4IM2 A;  3VXW A;  3ZVV A;  1KM7 A;  4EZJ A;  1OTR B;  3ZIM A;  3BIN A;  4ASW C;  2K6D B;  2C7N B;  2OJR A;  2EKE C;  3JYU A;  3W1Y A;  4TUU A;  3VTU A;  4TV3 A;  2GBN A;  2CU1 A;  3KH0 A;  3UQA A;  4W9L A;  2FNJ B;  1TTN A;  4HXD A;  3IFW B;  4KIK A;  3OLM D;  1E8W A;  1Q0W B;  4W9I A;  2MCN B;  3U8Z A;  2LVP A;  1WFY A;  3DVN V;  2WDT B;  2ZNV C;  5EDS A;  3ML8 A;  5DCN A;  3V6E B;  3ZUN A;  4IM3 A;  3TIX A;  2DAJ A;  4ANV A;  1Q1O A;  3N3K B;  1XD3 B;  4N9F 4;  3AXC A;  4MGY E;  1YQB A;  2DHZ A;  1WJN A;  2FID A;  2JWZ A;  4PYU A;  3V6C B;  1GNU A;  2IZV B;  3KW5 B;  4E74 A;  2GBM A;  1WI0 A;  2MP2 A;  3P2B A;  1UD7 A;  2LRU A;  1C3T A;  1CMX B;  3DBH I;  2RD0 A;  4BKT A;  4YL8 A;  2LZ6 A;  2J0J A;  4DHZ B;  2B3A A;  2KTR B;  3Q3F A;  1NDD A;  4FJV B;  5CHW A;  2KK8 A;  4WAA A;  2WWZ A;  3VHT C;  2DYO A;  4W9C A;  2N9X A;  2D10 A;  2NBU A;  3DBR I;  4JIO U;  4XX5 A;  3VVW B;  1V9J A;  1SE9 A;  4F7Z A;  2MW5 A;  2O2V A;  3PLU A;  4II3 B;  1WX8 A;  3TMP B;  5D6J B;  2BWF A;  3A4R A;  4FUL A;  4KDI C;  4I6N B;  2MX2 A;  3NS8 A;  1WIA A;  2V1Y A;  4K7S A;  4ZRK A;  3D32 A;  4PYZ A;  2KMA A;  2KOX A;  1WMH B;  4F1S A;  2AWT A;  1P1A A;  3N32 A;  2MBQ A;  4NNJ B;  1MG8 A;  3PV1 A;  1V80 A;  4WJQ A;  2PE9 A;  4NAW A;  1P9D U;  1SIF A;  2V3S A;  5DPT A;  2Y5B B;  4AP4 C;  2EMT A;  1ZGU B;  2N7D A;  4B9K A;  1K8R B;  2YLM A;  3N30 A;  2RR9 A;  2ZCB A;  5CHV C;  1L2N A;  3OJ3 A;  2C60 A;  2EMS A;  2XEW A;  2CKH B;  4GOC A;  3PRP B;  4KZ0 A;  2HJ8 A;  2UWQ A;  3QCA A;  1IYF A;  2O6V B;  1YIW A;  4DXA B;  4JQW C;  2RPQ A;  4ANU A;  1VD2 A;  2M8S A;  3APD A;  2DZJ A;  1J0G A;  4HVB A;  4K1R B;  4W9J A;  5CTR C;  1V81 A;  4M0W B;  1Q5W B;  3MTN B;  4HPL B;  3SD5 A;  1OGW A;  4EKU A;  3CST A;  3H7P B;  2IYD B;  3A4S C;  5JZE B;  2LAS A;  1WZ3 A;  1YX6 B;  2KO3 A;  2NBV B;  3UF8 A;  3QA8 A;  3R3M A;  2LD9 A;  4WJP A;  3V62 A;  2ZPN A;  3ML9 A;  4EUT A;  4HJK A;  4II2 B;  3HM3 A;  5GMV A;  5G55 A;  4W9F A;  3A33 B;  1GG3 A;  3AU4 A;  5AZH A;  2WYQ A;  3A9K B;  3IG3 A;  3ZW3 A;  2K8B A;  1R4M I;  3RT3 B;  4FBJ B;  4HK2 A;  2AL3 A;  3KYD D;  3DCG A;  1H8C A;  2KQ7 A;  2IY0 B;  2KJH B;  4X57 B;  2BYE A;  4B6W A;  2W9N A;  3ZDT A;  1P3Q U;  3DPD A;  2KTR A;  4MJS B;  2L0T A;  3L0W B;  3M3J A;  2ASQ A;  4TQ1 A;  2ZJD A;  5IAA C;  1RLF A;  3DOW A;  3QAR A;  2D2Q A;  1I42 A;  4HWI B;  2K25 A;  2LJ5 A;  2Z59 B;  4K7W A;  3EFU A;  1WZ0 A;  2M17 A;  4DWF A;  4A3O A;  4GXB A;  2G45 B;  1UBI A;  2N1V A;  4JL9 A;  2L7R A;  2K1F A;  4A20 A;  4RM9 A;  2I1K A;  4ZRI A;  4LJP B;  2GOW A;  2ZCC A;  2RGF A;  2D11 A;  3UQB A;  2KDE B;  4IUM B;  4IWP A;  3VDZ A;  3L54 A;  1WMH A;  4BBN C;  4GDK B;  4MH0 E;  3O65 B;  3ZKJ C;  4BOS C;  2GBR A;  3L10 B;  2LWP A;  1H4R A;  2NPT B;  3ONS A;  4FA6 A;  2PEA A;  3TBL D;  4HLE A;  2BGF A;  3K9P B;  3OJ4 B;  3PVL A;  3PGE A;  2JPH A;  2VRR B;  2DZK A;  3B1L X;  2K8H A;  4KDL B;  4ICV A;  5FR6 A;  4DDI D;  4I6P A;  4I6L B;  1Z5S B;  2G4D B;  2LUE A;  2M1M A;  2K8C A;  1XT9 B;  2ZZP B;  4TKN A;  4ZDV A;  2L00 B;  3QAQ A;  4GGQ A;  4ANX A;  3ZTC A;  1V5O A;  1KOT A;  2FAZ A;  2KAN A;  2Z0E B;  3A9J B;  3PS6 A;  4KV2 A;  2KWU B;  2N7E A;  1X1M A;  2O6V A;  4G11 A;  4LDT D;  5D94 A;  3PT2 B;  3ALB A;  1EF1 A;  1JRU A;  4GDL A;  4ZRJ A;  1WE7 A;  3S2A A;  2ZVO A;  1AAR A;  2ZVN A;  3DDC B;  2J0K A;  2CHZ A;  2XK5 B;  3I3T B;  3PPA A;  2KN5 A;  3ZNG C;  3B0A A;  1WE6 A;  3H7P A;  3OAW A;  3EC8 A;  2NBW B;  3QX1 A;  4M8N A;  1E8Z A;  4LCD E;  2KC1 A;  3CF6 E;  3KYC D;  1WXA A;  1RFA A;  4P7I A;  5CX3 A;  3TCA A;  1WM2 A;  2C9W B;  2MLB A;  1UEL A;  3M95 A;  4FN2 A;  2QHO A;  3K9O B;  2AYO B;  1G6J A;  4HCP B;  2K39 A;  3TJP A;  3ZNH B;  2DZM A;  3SDL C;  2L05 A;  5D7G A;  2HE7 A;  2MBB B;  3A9K A;  3PRM B;  2KMC A;  1WXS A;  2KC2 A;  2WX1 A;  2MQJ A;  1C1Y B;  3AU5 A;  2J7Q B;  2N9P C;  2MWS B;  2CHX A;  2DYB A;  5KHQ A;  3RCZ A;  3ZDM C;  2LI5 A;  4MJS A;  4MEL A;  2CS4 A;  1HE8 A;  2REX A;  2WX0 A;  5G2N A;  1IP9 A;  2DX5 B;  4W9D A;  5JHA A;  3NZS A;  5E6O A;  4BBN F;  2MRP A;  3NZU A;  4K81 A;  2N9E B;  4AUQ C;  1BT0 A;  3ECI A;  2R2Q A;  3KUZ A;  3WAP A;  3DBL I;  4FHJ A;  2LXA A;  1XQQ A;  3JW0 X;  1IPG A;  2IO0 B;  3VUW A;  2D3G A;  1WGG A;  4KSL C;  1VCB A;  2IO2 B;  3PRE A;  2KNB A;  3RUL A;  4GSW A;  3VUX A;  3GZN I;  4EFO A;  5JH5 C;  4HDQ A;  4XC2 A;  2NPT A;  4WWP A;  1WGR A;  1GUA B;  4KIK B;  1OEY J;  4KZC A;  3CMM B;  3PRZ A;  4G0N B;  4CYE A;  5JHB A;  1FXT B;  4BKS D;  2BYV E;  2MBH A;  3BY4 B;  1J8C A;  2XBB C;  3AI5 A;  4XZ4 A;  3NY5 A;  3WAN A;  2LVO A;  4K7U A;  4M8M A;  1E5W A;  1A5R A;  2LRW A;  1OEY A;  4GB9 A;  5KHO A;  1F9J A;  2L3Z A;  2MP2 B;  5C23 A;  3VH3 B;  1E7U A;  5E6P A;  4PS8 A;  4WQO B;  2NR2 A;  4E71 A;  2HD5 B;  2O6V D;  1WF9 A;  1WX7 A;  4E3C A;  5L95 C;  3DQV A;  3QJZ A;  4MEM A;  4EZK A;  3VQI A;  2AEH A;  2BKF A;  4W9K A;  3PTF C;  2XK5 A;  3ZO5 B;  1EO6 A;  3HK0 A;  2G4S A;  3A1Q B;  4DHJ B;  3ZLZ A;  4ANW A;  4DHZ E;  3LJ3 A;  2G3Q B;  2L8J A;  3H7S A;  2KX3 A;  4BVU C;  2PJH A;  5IA7 A;  1TGZ B;  2FIF A;  2JUO A;  1E8X A;  2KDF B;  2KQS A;  1D3Z A;  1YX5 B;  1S3S G;  4NQK E;  4NY0 A;  1R4N I;  2LXC A;  1WY8 A;  2BPS A;  2KWC A;  4DDG D;  4EEW A;  1UH6 A;  3DBS A;  5LXI B;  1RAX A;  1J19 A;  1WR1 A;  4FHK A;  3IBE A;  3UIP B;  2KFK B;  3HM6 X;  3VTV A;  1LQB A;  5LLI A;  3U30 A;  3SHQ A;  1WGD A;  1ZW7 A;  1WGY A;  4MDK E;  3C0R B;  2MA9 B;  3IHP C;  4AOF A;  1WM3 A;  5D2M B;  2NVU I;  3IVF A;  2LGY A;  4ZYN A;  3PZD A;  3L17 A;  1ZKH A;  3SU8 X;  4BKS A;  4IWO A;  2K6Q A;  3H9D A;  2LVQ A;  1SGH A;  2KHW B;  3B08 A;  4RM8 A;  2BF8 B;  5DPS A;  2IY1 B;  3X0W A;  4AWJ A;  4ICU A;  2UYZ B;  3DVG Y;  4IWQ A;  4G50 A;  3KUD B;  4IM0 A;  4NPN A;  4BFR A;  3VH4 B;  5E6N A;  4CO7 A;  2JRH A;  3R66 C;  4HDO A;  1WYW B;  3HHM A;  2HTH A;  5CHF A;  3T9L A;  5C1Z A;  4GU2 A;  4AJY B;  1P0R A;  2C7M B;  3VUY A;  3H1U A;  1GC7 A;  1WX9 A;  4JLC A;  3H6N A;  3QC8 B;  4HCN B;  1WRD B;  2KFJ A;  2D07 B;  2Z0D B;  3WA0 A;  4FJY A;  1V49 A;  3V61 A;  5TR5 A;  2FCN A;  3VAW A;  3NOB A;  3VTW A;  3QHT A;  3DVG X;  3MJW A;  4G3X B;  4NQL B;  3WIM A;  4WJO A;  1LM8 B;  2LGD A;  3GOE A;  4EOY A;  3ZNI D;  3RUI B;  1GC6 A;  1WXV A;  1ISN A;  1U4A A;  2A4Z A;  2C5L C;  2PE6 B;  4J6I A;  4W9H A;  4GIV A;  4EZL A;  5AEK B;  1V2Y A;  1QZE A;  5J18 A;  3PHX B;  4LJO B;  3HIZ A;  3JSV B;  3QQ8 B;  3TL5 A;  2JRI B;  1V6E A;  4W9E A;  1YJ1 A;  2RSU A;  2CHW A;  4RMA A;  5BO4 B;  3W1S A;  3UGB B;  4GN1 A;  3A1Q A;  3M62 B;  2YVC A;  2JF5 A;  1KLV A;  2KX0 A;  3RD2 A;  2CR5 A;  2ZNV B;  2AL6 A;  2JZ3 B;  4FAD A;  2JXX A;  4FJZ A;  2DEN B;  1KJT A;  4FLH A;  3KVF B;  4CHK A;  2M4N A;  3JVZ X;  2GBJ A;  3X23 A;  3ZRF A;  2JT4 B;  4NJ6 A;  3DVN U;  3T8M A;  2GMI C;  2KTF A;  4MSQ B;  4MGI E;  5HKH A;  1WGH A;  2KFK A;  1OQY A;  3MHS D;  3ZTD A;  4W9G A;  4BKG A;  2MBE A;  4GDK A;  3NHE B;  2DAF A;  4TQ0 A;  3V60 A;  3WAM A;  2IO1 B;  3U7D A;  3W1S C;  4MM3 A;  4BOZ B;  3RZW C;  4A3P A;  4IG7 B;  3M63 B;  5L83 A;  4GMV A;  2KDB A;  4NJ7 A;  3ZRC A;  2IBI B;  3QK0 A;  5J2R A;  2FCQ A;  3QWZ B;  3LDZ E;  3EEC A;  5AZF A;  1TBE A;  2KLG A;  1WJ4 A;  4MGK E;  3PLV A;  3UIO B;  1E7V A; 
#chains in the Genus database with same CATH topology
 1TKG A;  2V0G A;  1WJ6 A;  4WWN A;  3AMZ A;  2K3U A;  3APF A;  4C7Z A;  5AZG A;  4F8C B;  1L6U A;  2J0M A;  2V4L A;  1NI3 A;  4S17 A;  2I38 A;  3VRA B;  1EUV B;  3W5U B;  2WXM A;  2KVR A;  1NI2 A;  4OVV A;  1XO3 A;  2X38 A;  3ENE A;  1CQV A;  3RYT A;  1TS2 A;  4KSK C;  2JZZ A;  1SIJ A;  2WDR B;  2MSE D;  2WHI A;  3L08 A;  4JGH B;  2KKC A;  2A5U A;  3UIN B;  3AE3 B;  3L13 A;  3P4S B;  1IUE A;  4DK5 A;  4LDT B;  4B95 A;  1FRD A;  1WJU A;  2NS5 A;  2LUM A;  1LXD A;  3EHV A;  1GOZ A;  4J3O D;  3AN1 A;  4KKI A;  2OJR A;  1SE3 A;  1VR9 A;  3T3O A;  2ZNV C;  1FXI A;  2KT7 A;  2LGS A;  3V6E B;  4IM3 A;  5D3I B;  2WXL A;  5BYQ A;  3TIX A;  3EFC A;  3N3K B;  4MGY E;  1YQB A;  3V6C B;  2GBM A;  1V8C A;  4DXF A;  2LRU A;  4N6E B;  4BKT A;  3B2F A;  2GRI A;  3N1X C;  4WAA A;  2WWZ A;  1UNS A;  2DYO A;  2V3N A;  2BS4 B;  1SE9 A;  1GPX A;  2O2V A;  1WX8 A;  1YN3 A;  3TMP B;  2AQ3 B;  2PTL A;  4I6N B;  1FPY A;  2V1Y A;  1MJD A;  4WIP A;  2LJI A;  2QEJ C;  4F1S A;  1P1A A;  2DBY A;  1FXA A;  2MBQ A;  5EE0 A;  1E0Z A;  1V80 A;  2PE9 A;  4NAW A;  1LO5 D;  3HRD D;  2V3S A;  2Y5B B;  5C2T B;  4B9K A;  2V4I B;  2OED A;  1WRI A;  3OJ3 A;  2EMS A;  2CKH B;  1FCL A;  4GOC A;  2UWQ A;  1YIW A;  3CWI A;  1XLQ A;  2RPQ A;  3APD A;  4HVB A;  4K1R B;  5EE1 A;  1V81 A;  4NJC A;  3MTN B;  3H7P B;  1D5Z C;  2LAS A;  1YX6 B;  3BII D;  1NVI D;  3HVD A;  3PZ7 A;  5C3J B;  2JZP A;  3R3M A;  4WJP A;  4ZRQ A;  3HM3 A;  5GMV A;  3BYY B;  4W9F A;  4WWM A;  5AZH A;  2BB5 A;  3A9K B;  3IG3 A;  1R4M I;  4HK2 A;  2AL3 A;  3Q2A C;  5AUI A;  3Q14 C;  3ZDT A;  2L0T A;  2WXF A;  2MHJ A;  1JAL A;  2ZJD A;  1RLF A;  2D2Q A;  2Z59 B;  4K7W A;  4A3O A;  2PKO A;  2Y3A A;  1UWM A;  2J52 A;  2G45 B;  3IXS A;  2N1V A;  1TY0 A;  2K1F A;  4RM9 A;  2I1K A;  1L6V A;  3TEX A;  1EWY C;  3DBH B;  3Q8B A;  1PGA A;  2D11 A;  3Q69 A;  2W3S A;  3VDZ A;  1WMH A;  2Z8L A;  2BBC A;  2NPT B;  3TBL D;  3K9P B;  3LB8 C;  3OJ4 B;  3PGE A;  2JPH A;  2VRR B;  4KDL B;  2L52 A;  3V05 A;  5FK9 C;  1C4C A;  2OHF A;  4WUR A;  2M1M A;  1F52 A;  2V9H A;  2R61 A;  3ZTC A;  3PS6 A;  3A9J B;  2DNF A;  4G11 A;  2LGI A;  3AEG B;  1JRU A;  2ZVO A;  5H92 C;  2IGG A;  3R2I A;  1D5M C;  5AUK A;  1N62 A;  2CHZ A;  3I3T B;  1FM0 D;  2KN5 A;  3VUY A;  3OAW A;  2B76 B;  2NBW B;  2IPK D;  5FKA C;  3ZJU A;  4P7I A;  1WM2 A;  1KRH A;  3M95 A;  1T6B X;  1G6J A;  2DZM A;  1TKY A;  1XXG A;  2HE7 A;  2MBB B;  1WXS A;  2WNM A;  2J7Q B;  4A90 A;  2MWS B;  2WXQ A;  2G9H D;  2DYB A;  2QIE B;  2LI5 A;  5G2N A;  2EEL A;  2DX5 B;  4MAC A;  3C8Y A;  2LXA A;  1XQQ A;  2AQ1 B;  2XNA C;  2IO0 B;  2D3G A;  3P63 A;  5MPO A;  2SEB D;  3GE8 C;  5JHB A;  3ZGZ A;  3NY5 A;  1HXY D;  2LEK A;  1F9J A;  1STE A;  2L3Z A;  3VH3 B;  1E7U A;  2NR2 A;  2HD5 B;  3FKY A;  4R3D A;  3DQV A;  4MEM A;  3IAS 1;  2BKF A;  2VH2 A;  3HK0 A;  4KGR A;  4ANW A;  4DHZ E;  1I4Q A;  2L8J A;  2KX3 A;  3NS1 A;  2KWD A;  2FIF A;  1E8X A;  2KDF B;  1D4B A;  4NY0 A;  1RAX A;  1C79 A;  3IBE A;  3UIP B;  1WGY A;  3IHP C;  2PIA A;  1WGK A;  5D2M B;  1PGB A;  1RWS A;  3RI7 C;  3TEY A;  3X0W A;  4ICU A;  2UYZ B;  4IM0 A;  2XN9 C;  1JWM D;  2M19 A;  3R8B A;  1N61 A;  4GU2 A;  1FNW A;  1N5W A;  2C7M B;  2KDM A;  4JLC A;  4HCN B;  1YJI A;  4FJY A;  1D6E C;  4RCO A;  3Q8A A;  1KF6 B;  3VAW A;  1VZ8 A;  3EA6 A;  3SFE B;  2BTE A;  4RH6 A;  1U4A A;  1QZE A;  4GLS C;  4L23 A;  3HIZ A;  3QQ8 B;  1YQ3 B;  2JU6 X;  4W9E A;  3TSS A;  3UGB B;  4KGS A;  3M62 B;  1XLN A;  1K51 A;  4NZL B;  2AL6 A;  1KJT A;  2K22 A;  3J9C A;  1ENF A;  2JT4 B;  3DVN U;  3MHS D;  3Q8E A;  4JWS C;  4HRS A;  1RM6 C;  1TT5 B;  4GMV A;  3VRB B;  1F2R I;  3FIL A;  4MGK E;  3Q3O C;  4WH4 A;  3N9Y C;  3A9J A;  2N4F A;  4RF0 A;  4GDL B;  4HPM B;  4LTU A;  2I1J A;  1OFF A;  1ZP0 B;  5G5H A;  4LNN A;  4HKZ E;  4WJN A;  2JVC A;  1QT9 A;  3AUL A;  1ET9 A;  3PHW B;  1JWB D;  2O2V B;  3NVZ A;  2JY6 A;  1UGM A;  1UGJ A;  2L1A A;  4MGZ E;  4RFB A;  2KLC A;  4AJW A;  2KWV B;  2PVG C;  3UI3 A;  1L4Z B;  3JSV A;  4OVU A;  4NAW B;  4TSS A;  1WWT A;  2KJ6 A;  2M0A A;  4PS3 A;  1PQS A;  4P1B C;  1FCC C;  1WH3 A;  5DPR A;  1XEE A;  1EF5 A;  1P98 A;  2M56 B;  4O1N A;  1L7Y A;  2N1W A;  2INP E;  2L32 A;  2IO3 B;  1EU4 A;  4RGO S;  3N20 C;  3VXW A;  4FXC A;  4ASW C;  2Q5W D;  4K3C A;  3JYU A;  3W1Y A;  4TUU A;  2CU1 A;  3L4P A;  2MCN B;  1I4H A;  3OLM D;  4W9I A;  2LVP A;  1WFY A;  2QMT A;  4XWT A;  1UF0 A;  3DBL B;  3ZUN A;  5HI1 A;  4ANV A;  1XD3 B;  2D5G A;  3AXC A;  1GNU A;  3GZN B;  1UD7 A;  2IND C;  1CMX B;  1I4R A;  2LZ6 A;  4USA A;  4DHZ B;  2B3A A;  3Q3F A;  1NDD A;  4FJV B;  2KK8 A;  3VHT C;  1BXT A;  2D10 A;  4JIO U;  4XX5 A;  4F7Z A;  3B2G A;  4BZA A;  3PLU A;  1YJJ A;  1F77 A;  2BWF A;  3ZJV A;  1IGC A;  4KDI C;  3NS8 A;  4K7S A;  4US9 A;  1WMH B;  2L83 A;  2AWT A;  3GB1 A;  3PV1 A;  4OHJ A;  1EM7 A;  4YSY B;  1SIF A;  4AP4 C;  2N7D A;  3HVZ A;  2RR9 A;  2ZCB A;  1PFD A;  2J42 A;  1L2N A;  1T3Q A;  2XEW A;  2K5P A;  3TUO A;  1IYF A;  2WGS A;  4JQW C;  3U52 E;  2M8S A;  1E6E B;  4W9J A;  5CTR C;  2TSS A;  4RGN A;  2BB6 A;  3RMK C;  3SD5 A;  1HZ6 A;  3A4S C;  5JZE B;  2NBV B;  4BAX A;  3QA8 A;  2NMQ A;  5JXV A;  3ML9 A;  4EUT A;  5G55 A;  2LHD A;  4A55 A;  3Q6B A;  3RT3 B;  2KAC A;  2YEP B;  3KYD D;  1H8C A;  5HHD G;  3U4E G;  4X57 B;  4B6W A;  2KTR A;  1DOX A;  3L0W B;  1YNT E;  2ASQ A;  4HWI B;  4DWF A;  1F1H A;  5BMG A;  1UBI A;  2ONQ A;  2WU2 B;  2JX5 A;  1T0Q C;  1T0R C;  2RGF A;  4HKQ A;  1F0Z A;  4IUM B;  4IWP A;  3L54 A;  1JW9 D;  3ZKJ C;  2LWP A;  3ONS A;  1J7C A;  2KVZ A;  2BGF A;  3PVL A;  1L5P A;  3B1L X;  3AH7 A;  5FR6 A;  5TSS A;  4I6L B;  1XT9 B;  2ZZP B;  4ZDV A;  4ANX A;  4GGQ A;  1V5O A;  2KAN A;  2Z0E B;  4DQO C;  2E3T A;  4GDL A;  3PO0 A;  3DWM A;  2ZVN A;  1N6Z A;  1DOI A;  4M0W A;  3AE6 B;  5HG2 A;  1WE6 A;  3ZJT A;  3EC8 A;  2KC1 A;  2KQ4 X;  1FEH A;  1RFA A;  2C9W B;  1L0X B;  2QHO A;  1ZXI A;  4YTM B;  4HCP B;  3SDL C;  5D7G A;  2KC2 A;  2MQJ A;  2JYE A;  1V1O A;  2N9P C;  2WXH A;  3MJ5 A;  1C4P A;  5KHQ A;  3ZDM C;  4MJS A;  5GXG B;  3RNB C;  2REX A;  1KFY B;  2RDG A;  4W9D A;  1JWA D;  4HRO A;  5JHA A;  1WSP A;  5E6O A;  4BBN F;  3NZU A;  1DGJ A;  4AUQ C;  3ECI A;  2R2Q A;  3WAP A;  2WXG A;  1YN5 A;  3DBL I;  4FHJ A;  4M00 A;  3EGR A;  1L0V B;  4XDD A;  3PRE A;  2KNB A;  3RUL A;  3VUX A;  3GZN I;  4ZRP A;  4HDQ A;  1GB4 A;  3VR8 B;  1GUA B;  4KIK B;  3HUI A;  1OEY J;  2FUG 1;  1SJH D;  4CYE A;  2IDY A;  1FXT B;  2BYV E;  4ARI A;  2MBH A;  3BY4 B;  3SFD B;  2XBB C;  4XZ4 A;  1NEK B;  1VZ6 A;  2MP2 B;  4JWU C;  5E6P A;  4PS8 A;  4WQO B;  1EU3 A;  4E71 A;  2D3B A;  1FIQ A;  1WF9 A;  3P4P B;  2AEH A;  4W9K A;  3PTF C;  2XK5 A;  3ETR A;  3LJ3 A;  3H7S A;  2PJH A;  3I63 C;  1YX5 B;  4XDC A;  1WY8 A;  2BPS A;  2KWC A;  1TS4 A;  3KLS X;  1UH6 A;  3DBS A;  4FHK A;  1F2R C;  1ZW7 A;  2PVO D;  3C0R B;  4AOF A;  3DBR B;  3MP9 A;  4K3B A;  3SU8 X;  3FIL B;  3H9D A;  1SGH A;  3B08 A;  4RM8 A;  2IY1 B;  4AWJ A;  3DVG Y;  1HTQ A;  4IWQ A;  4G50 A;  3KUD B;  4BFR A;  5E6N A;  3Q8F A;  2WLB A;  3I9V 1;  2HTH A;  1SEB D;  5CHF A;  3ZYY X;  2W82 A;  1UWX A;  2PMV A;  1P0R A;  1C9F A;  1GC7 A;  2MEK A;  1WRD B;  2KFJ A;  2D07 B;  1PDX A;  3N1Y C;  3WA0 A;  1V49 A;  1SXT A;  1XCQ L;  3MJW A;  1LM8 B;  2LGD A;  4EOY A;  3ZNI D;  3RUI B;  1MI0 A;  1E9M A;  1WXV A;  4J6I A;  4HJG E;  1FFU A;  2QIL A;  3PHX B;  1NEN B;  1QQR A;  3URY A;  3JSV B;  1UUP A;  2JRI B;  1V6E A;  4YTP B;  5BO4 B;  3A1Q A;  1ZPS A;  1MHH E;  1KLV A;  2KX0 A;  5EE9 A;  2LFI A;  2DEN B;  4FLH A;  1SSN A;  2V3P A;  1PGX A;  3ZRF A;  2GBJ A;  3X23 A;  4NJ6 A;  3T8M A;  2GMI C;  1WGH A;  4BKG A;  2WXO A;  4W9G A;  2MBE A;  3NZ3 A;  3V60 A;  1C77 A;  3WAM A;  3U7D A;  3W1S C;  4IG7 B;  3M63 B;  5IP4 D;  2KDB A;  5LNK 1;  3LDZ E;  3EEC A;  5AZF A;  5IKC M;  3UIO B;  1YD8 U;  3TEZ A;  4KVG B;  3R7R A;  2OOB B;  2RMM A;  2N9L A;  2ZPY A;  2JXT A;  4MSM B;  1B1Z A;  2L0F A;  4URK A;  3LXF A;  2KD0 A;  3IT6 B;  3WAO A;  3C19 A;  3L16 A;  2FUH B;  2C7H A;  2M0X A;  2DZI A;  1RRB A;  1YMH E;  3APC A;  1I35 A;  1E8Y A;  1LFD A;  4OVZ A;  3WAL A;  3CSF A;  1E90 A;  2BYF A;  2R2O A;  2BS2 B;  1SJE D;  2KXJ A;  2MBO A;  2NCN A;  4WWO A;  1GJZ A;  2INN E;  5BYS A;  3GS2 A;  1Z2M A;  1V5T A;  5FR3 A;  4C80 A;  4IW0 A;  1TZ1 A;  1V97 A;  2FE8 A;  3RNA C;  3ZXV A;  5IO9 A;  3GP7 A;  4DHJ D;  1OQR A;  1UBQ A;  3ZNZ B;  1K53 A;  4IM2 A;  1KM7 A;  4EZJ A;  1OTR B;  2JQR B;  2K6D B;  2EKE C;  3VTU A;  1FNU A;  3UQA A;  4W9L A;  2FNJ B;  1MG4 A;  4HXD A;  4KIK A;  1E8W A;  4TMA B;  3U8Z A;  2WDT B;  5D3D A;  4Q2J A;  5EDS A;  2D3A A;  2QCZ A;  2WXK A;  2ACZ B;  4YSZ B;  3BVM A;  2DHZ A;  4CQN A;  1WJN A;  2FID A;  4PYU A;  3AED B;  4WQM A;  1ZDV A;  3RNF C;  3P2B A;  2MP2 A;  1FD6 A;  1E10 A;  4HEA 1;  3DBH I;  4YL8 A;  2J0J A;  2KTR B;  4M02 A;  3Q8C A;  1FO4 A;  2MJD A;  3P4Q B;  2GLS A;  3VVW B;  4A9A A;  2NBU A;  3DBR I;  1AWD A;  4II3 B;  1FNV A;  5D6J B;  5HFY A;  2JWU A;  4FUL A;  3T3N A;  2MX2 A;  2WDQ B;  4PYZ A;  3W2D A;  3MC0 B;  3N32 A;  1MG8 A;  4C7Y A;  3B9J A;  4KX6 B;  2WU5 B;  5DPT A;  4KGT A;  4MH8 A;  4PK1 A;  2YLM A;  5CHV C;  3RPF C;  3PRP B;  4KZ0 A;  4RGT A;  4ANU A;  4AS1 A;  2ZW1 A;  4M0W B;  1QOB A;  4HPL B;  4EKU A;  3CST A;  2IYD B;  2GB1 A;  4MT5 A;  2RDB C;  1TYG B;  2KO3 A;  1MVK A;  2ZPN A;  3A33 B;  2WYQ A;  3ZW3 A;  3I5J C;  3AV8 A;  2EKI A;  2KJH B;  1P3Q U;  3DPD A;  1TZO A;  4MJS B;  4RNA A;  3M3J A;  3MC8 A;  4TQ1 A;  3TEW A;  3QAR A;  1I42 A;  2K25 A;  1WZ0 A;  3E9S A;  1HEZ E;  2NTT A;  2L7R A;  2GOW A;  2ZCC A;  1E7P B;  2QDF A;  3ZQ4 A;  3UQB A;  3O65 B;  3O13 A;  4BOS C;  2GBR A;  1DYQ A;  3L10 B;  1MHX A;  2HTM E;  1H4R A;  2BW2 A;  3DHG C;  1JCK B;  2WQY B;  2I2Y A;  1TY2 A;  3FAH A;  4DDI D;  4JPS A;  1Z5S B;  2G4D B;  2LUE A;  2W55 A;  2FBW B;  3QAQ A;  2FAZ A;  2CJN A;  2N7E A;  1X1M A;  2O6V A;  5T8I A;  3PT2 B;  3ALB A;  1EF1 A;  4ZRJ A;  1WE7 A;  3S2A A;  3AB5 A;  1AAR A;  4RF1 A;  2KAJ A;  3DDC B;  1VZ7 A;  2XK5 B;  1XCT L;  3PPA A;  3ZNG C;  3B0A A;  4M8N A;  2PW9 A;  2CJO A;  1YN4 A;  3CF6 E;  3KQ4 A;  1WXA A;  3KYC D;  2MLB A;  4FN2 A;  3K9O B;  4HPP A;  3TJP A;  3ZNH B;  3NVV A;  2E6X A;  5BYR A;  3PRM B;  4YTN B;  1C1Y B;  3N1Z C;  2WX0 A;  4L2Y A;  1IP9 A;  1T0S C;  2MRP A;  4UDU C;  2H88 B;  3VR9 B;  1BT0 A;  1C78 A;  3KUZ A;  1YOV B;  4C00 A;  3JW0 X;  1IPG A;  1KLG D;  2IO2 B;  1R7S A;  4JX1 C;  4EFO A;  5JH5 C;  1I4P A;  4WWP A;  1WGR A;  3CMM B;  3PRZ A;  4BKS D;  1TS5 A;  4OZC A;  1RYJ A;  1J8C A;  3IAM 1;  4ITK A;  2AX5 A;  2LVO A;  4K7U A;  1SF0 A;  4M8M A;  1DOY A;  1E5W A;  1A5R A;  1OEY A;  3NJT A;  3BWU D;  5C23 A;  4LNF A;  2J53 A;  2O6V D;  1WX7 A;  5G5G A;  2WXJ A;  3RNE C;  5L95 C;  1QF6 A;  3AEF B;  3QJZ A;  4EZK A;  3ZO5 B;  4A6Q A;  4YT0 B;  2G4S A;  3A1Q B;  4DHJ B;  1ESF A;  2G3Q B;  5IA7 A;  2WDV B;  2JUO A;  2J4X A;  1D3Z A;  1S3S G;  2LXC A;  5LXI B;  1WR1 A;  1TJE A;  3HM6 X;  3VTV A;  3SHQ A;  2MA9 B;  2SAK A;  3IVF A;  4ZYN A;  3PZD A;  3NVY A;  2RDH A;  4IWO A;  3W9C B;  3AEB B;  4A8X C;  3FC4 A;  1K50 A;  2LVQ A;  2BF8 B;  2JRH A;  1WYW B;  3HHM A;  4LNO A;  4D2K A;  4XGA B;  5C1Z A;  4AJY B;  3OG5 A;  4L1B A;  2IGH A;  3QC8 B;  1ROE A;  2X8X X;  3AEC B;  1PYW D;  4KKJ A;  3V61 A;  3VTW A;  4H2A A;  1V1P A;  3QHT A;  3DVG X;  4NQL B;  1C4A A;  1GC6 A;  2CU3 A;  3AEE B;  1ISN A;  2C5L C;  2PE6 B;  4EZL A;  5AEK B;  3DHH C;  1TIF A;  3DHI C;  5J18 A;  2W54 A;  2BYT A;  1JRP A;  2K9X A;  1YJ1 A;  2RSU A;  2CHW A;  3SR6 A;  2JF5 A;  3AE8 B;  2UU7 A;  1T5X D;  3RD2 A;  2ZNV B;  2WXI A;  2JZ3 B;  2JXX A;  4FJZ A;  3KVF B;  1VJK A;  2KMM A;  2DWQ A;  2ON8 A;  4MSQ B;  2KFK A;  3ZXR A;  3ZTD A;  3NHE B;  3EUB 2;  2DAF A;  2IO1 B;  3RZW C;  5E6J A;  4A3P A;  5L83 A;  4NJ7 A;  3ZRC A;  3QK0 A;  2FCQ A;  3BVG A;  3QWZ B;  1L0Y B;  3DWG C;  1BUI C;  2IGD A;  2KLG A;  5H8Y E;  2QC8 A;  2DYM A;  1HTO A;  1T0Y A;  2FCM A;  3RZF A;  3QIJ A;  1HQR D;  1M94 A;  1V86 A;  5LXH A;  2BVC A;  1UZX B;  3H8H A;  2BWE S;  3NVW A;  2FCS A;  3PSE B;  4LK0 M;  2KZR A;  4DBG A;  3BZD B;  4IC7 B;  4PS7 A;  1NBF C;  2LHE A;  1WXM A;  2LGX A;  2BQQ A;  1WR6 E;  2GBK A;  1JRO A;  2PPH A;  3Q3J A;  1Y8R C;  2L76 A;  2K0P A;  4JE3 B;  4QAY A;  3IT4 B;  2KJR A;  2ZEQ A;  1S1Q B;  3VFK A;  1YQ4 B;  1I4G A;  4XYC A;  1JWS D;  3BK2 A;  4ZHP A;  5DPW A;  1J7A A;  2OJW A;  2N7J A;  5EE3 A;  3KUC B;  1ET6 A;  3I57 A;  4P6V F;  3R7Q A;  2KDI A;  4RGM A;  1ZXH A;  1AYF A;  3U2S C;  4ARC A;  1IBX A;  2INC C;  5J17 A;  2BKR B;  3ZVV A;  2WXN A;  1KH0 A;  3ZIM A;  2DLB A;  3RFZ B;  3BIN A;  3CIR B;  2C7N B;  4TV3 A;  2GBN A;  3KH0 A;  1TTN A;  4OZA A;  3IFW B;  1Q0W B;  3DVN V;  3OWE B;  1SB3 C;  3ML8 A;  5DCN A;  3KWL A;  2DAJ A;  1Q1O A;  1ZOY B;  4N9F 4;  5BMI A;  3AEA B;  4C4V A;  3NG0 A;  2JWZ A;  2IZV B;  3KW5 B;  4E74 A;  1WI0 A;  4OZB A;  1ACC A;  4YXD B;  4REZ A;  1C3T A;  2RD0 A;  1I7H A;  1MFW A;  4C56 C;  1NYQ A;  1JWU D;  3GE3 C;  5I4D A;  5CHW A;  3BVZ A;  2N0S B;  4NAM A;  5IN7 A;  4S0R A;  4W9C A;  1CJE A;  2PLP A;  2N9X A;  1GB1 A;  3MFG A;  1V9J A;  2WP9 B;  4P16 A;  2Y5C A;  1M4V A;  2MW5 A;  1CK1 A;  3A4R A;  2VZK D;  1WIA A;  4ZRK A;  1P7F A;  3D32 A;  1VDV A;  3RNC C;  2D3C A;  2KMA A;  2KOX A;  4XWW A;  1TKE A;  4NNJ B;  2WS3 B;  4WJQ A;  2MJ3 A;  1P9D U;  2MH7 A;  2EMT A;  1ZGU B;  1HZ5 A;  1K8R B;  2WXP A;  3N30 A;  1JML A;  1R4N B;  2C60 A;  4B0M A;  2HJ8 A;  1AN8 A;  3QCA A;  1WYG A;  2O6V B;  4DXA B;  1VD2 A;  2DZJ A;  4IDI A;  1J0G A;  1AW7 A;  1Q5W B;  2G1E A;  1OGW A;  3KWV A;  3BK1 A;  1WZ3 A;  3UF8 A;  2LD9 A;  3AE2 B;  2JYT A;  2BS3 B;  3V62 A;  3E56 A;  4HJK A;  4II2 B;  1BML C;  1GG3 A;  3AU4 A;  2K8B A;  3P1M A;  4FBJ B;  3DCG A;  2KQ7 A;  2IY0 B;  3P4R B;  2BYE A;  2W9N A;  2W3R A;  4ACF A;  5BMH A;  1C76 A;  5IAA C;  3DOW A;  3AE7 B;  2LJ5 A;  3EFU A;  2M17 A;  4YSX B;  1EWC A;  4GXB A;  4JL9 A;  4A20 A;  4ZRI A;  3MC9 A;  4LJP B;  4ZOH C;  3AE1 B;  1FMA D;  2KDE B;  4BBN C;  4GDK B;  4MH0 E;  4MM3 B;  4OW0 A;  4LNK A;  1OQQ A;  4FA6 A;  4P1C C;  2JSV X;  2PEA A;  4HLE A;  2YEP F;  2DZK A;  2K8H A;  1SE2 A;  4ICV A;  4I6P A;  3AE5 B;  1N5X A;  2GI9 A;  1ZDX A;  2K8C A;  4TKN A;  2L00 B;  1QLB B;  1KOT A;  4KV2 A;  2KWU B;  1ZE3 D;  4LDT D;  1XLO A;  4IOI E;  5D94 A;  1L4D B;  3AE9 B;  1FFV A;  1D5X C;  2J0K A;  1QOF A;  1B9R A;  3QX1 A;  3H7P A;  2KN4 A;  1E8Z A;  4LCD E;  5CX3 A;  1ZUD 2;  3TCA A;  1GAQ B;  1UEL A;  1KLU D;  4AQ7 A;  3P42 A;  2AYO B;  1Q10 A;  2K39 A;  2L05 A;  3A9K A;  3AE4 B;  2KMC A;  2WX1 A;  1XF5 L;  3AU5 A;  1WXQ A;  2CHX A;  3RCZ A;  2BT6 A;  4MEL A;  1SE4 A;  2CS4 A;  1HE8 A;  1NYR A;  3NZS A;  4K81 A;  2N9E B;  3R2T A;  2Y5P A;  4LLG M;  3NRZ A;  3VUW A;  1WGG A;  4KSL C;  1VCB A;  4GSW A;  4N59 A;  3LYY A;  2QJL A;  4XC2 A;  2NPT A;  1I4X A;  3RNG C;  1HA5 A;  2MJE A;  4KZC A;  4G0N B;  3Q3N C;  1V1P B;  1VLB A;  4US8 A;  3AI5 A;  3WAN A;  1XLP A;  2LRW A;  4GB9 A;  5KHO A;  1Y56 A;  3MHZ A;  4LNI A;  2N9K A;  4E3C A;  3BYT B;  2HDE A;  3W5V B;  3VQI A;  4EE2 A;  1EO6 A;  2AQ2 B;  3ZLZ A;  3ABV B;  1K52 A;  4IKG A;  4BVU C;  1TGZ B;  4M01 A;  2ICI A;  2KQS A;  4NQK E;  1R4N I;  4DDG D;  4EEW A;  1J19 A;  1IGD A;  2KFK B;  1LQB A;  5LLI A;  3U30 A;  4ZHO A;  3V3X A;  1WGD A;  1TS3 A;  4MDK E;  2LMC A;  1WM3 A;  2NVU I;  2LGY A;  1JQ4 A;  3AM9 A;  1QIL A;  3L17 A;  1ZKH A;  4BKS A;  1P7E A;  2K6Q A;  2KHW B;  5DPS A;  3U7Z A;  1PUT A;  4NPN A;  3Q3M C;  3VH4 B;  4PT5 A;  4CO7 A;  1QOA A;  2HJ1 A;  3R66 C;  4HDO A;  3T9L A;  3RN9 C;  2QSD A;  1CZP A;  1N60 A;  2ZW0 A;  3H1U A;  4N58 A;  1WX9 A;  3H6N A;  4YWG G;  3WCQ A;  2Z0D B;  5TR5 A;  2FCN A;  3NOB A;  2VZK B;  3NUH B;  4G3X B;  3WIM A;  2NTS A;  4WJO A;  3GOE A;  1QKZ A;  2A4Z A;  1VRA B;  4W9H A;  4GIV A;  1V2Y A;  4LJO B;  4XE0 A;  3TL5 A;  2IJ0 A;  2WXR A;  4RMA A;  3W1S A;  2VH1 A;  4GN1 A;  4WAF A;  1N63 A;  2YVC A;  1A70 A;  4DXG A;  1J7B A;  2CR5 A;  4FAD A;  3SEB A;  4CHK A;  1R4M B;  2M4N A;  3JVZ X;  4B0E A;  1IBX B;  1KTK A;  2KTF A;  1FRR A;  4MGI E;  5HKH A;  1OQY A;  4GDK A;  4TQ0 A;  4MM3 A;  4BOZ B;  1MPE A;  1LGR A;  2KYW A;  5IOI A;  2IBI B;  5J2R A;  4ZYS A;  1QOG A;  1RFK A;  1TBE A;  2H89 B;  1WJ4 A;  1SBB B;  3PLV A;  2RPV A;  3PZ8 A;  1E7V A;  4C4V B; 
#chains in the Genus database with same CATH homology
 2DYM A;  1YD8 U;  1T0Y A;  4KVG B;  2FCM A;  1WJ6 A;  3R7R A;  3RZF A;  4WWN A;  3A9J A;  2N4F A;  3QIJ A;  4GDL B;  2OOB B;  2ZPY A;  1M94 A;  4MSM B;  1V86 A;  4HPM B;  5LXH A;  2L0F A;  4URK A;  3APF A;  2I1J A;  2KD0 A;  4F8C B;  5AZG A;  1UZX B;  2J0M A;  3WAO A;  2BWE S;  3L16 A;  2FUH B;  2V4L A;  2FCS A;  3PSE B;  2C7H A;  2JVC A;  4WJN A;  2KZR A;  3AUL A;  2M0X A;  2DZI A;  4DBG A;  1RRB A;  3PHW B;  3APC A;  1I35 A;  1EUV B;  4IC7 B;  4PS7 A;  1NBF C;  2O2V B;  1E8Y A;  1LFD A;  1UGM A;  2JY6 A;  3WAL A;  1WXM A;  2KVR A;  2LGX A;  3CSF A;  4MGZ E;  1E90 A;  1NI2 A;  1WR6 E;  2GBK A;  2BYF A;  4OVV A;  2KLC A;  4AJW A;  2KWV B;  2R2O A;  2PPH A;  3Q3J A;  3ENE A;  1Y8R C;  2L76 A;  2KXJ A;  2MBO A;  2NCN A;  4WWO A;  3RYT A;  1GJZ A;  2KJR A;  2ZEQ A;  4KSK C;  3JSV A;  1S1Q B;  2JZZ A;  4NAW B;  4OVU A;  2MSE D;  1Z2M A;  3VFK A;  3L08 A;  1V5T A;  4JGH B;  2KKC A;  2A5U A;  2KJ6 A;  4IW0 A;  1TZ1 A;  3UIN B;  4PS3 A;  5DPW A;  1PQS A;  3L13 A;  1WH3 A;  5DPR A;  4DHJ D;  1EF5 A;  1P98 A;  1L7Y A;  2N1W A;  3KUC B;  3R7Q A;  2KDI A;  4DK5 A;  4LDT B;  1UBQ A;  2IO3 B;  4B95 A;  1WJU A;  2NS5 A;  3ZNZ B;  5J17 A;  1LXD A;  2BKR B;  3EHV A;  4IM2 A;  3VXW A;  3ZVV A;  1KM7 A;  4EZJ A;  1OTR B;  3ZIM A;  3BIN A;  4ASW C;  2K6D B;  2C7N B;  2OJR A;  2EKE C;  3JYU A;  3W1Y A;  4TUU A;  3VTU A;  4TV3 A;  2GBN A;  2CU1 A;  3KH0 A;  3UQA A;  4W9L A;  2FNJ B;  1TTN A;  4HXD A;  3IFW B;  4KIK A;  3OLM D;  1E8W A;  1Q0W B;  4W9I A;  2MCN B;  3U8Z A;  2LVP A;  1WFY A;  3DVN V;  2WDT B;  2ZNV C;  5EDS A;  3ML8 A;  5DCN A;  3V6E B;  3ZUN A;  4IM3 A;  3TIX A;  2DAJ A;  4ANV A;  1Q1O A;  3N3K B;  1XD3 B;  4N9F 4;  3AXC A;  4MGY E;  1YQB A;  2DHZ A;  1WJN A;  2FID A;  2JWZ A;  4PYU A;  3V6C B;  1GNU A;  2IZV B;  3KW5 B;  4E74 A;  2GBM A;  1WI0 A;  2MP2 A;  3P2B A;  1UD7 A;  2LRU A;  1C3T A;  1CMX B;  3DBH I;  2RD0 A;  4BKT A;  4YL8 A;  2LZ6 A;  2J0J A;  4DHZ B;  2B3A A;  2KTR B;  3Q3F A;  1NDD A;  4FJV B;  5CHW A;  2KK8 A;  4WAA A;  2WWZ A;  3VHT C;  2DYO A;  4W9C A;  2N9X A;  2D10 A;  2NBU A;  3DBR I;  4JIO U;  4XX5 A;  3VVW B;  1V9J A;  1SE9 A;  4F7Z A;  2MW5 A;  2O2V A;  3PLU A;  4II3 B;  1WX8 A;  3TMP B;  5D6J B;  2BWF A;  3A4R A;  4FUL A;  4KDI C;  4I6N B;  2MX2 A;  3NS8 A;  1WIA A;  2V1Y A;  4K7S A;  4ZRK A;  3D32 A;  4PYZ A;  2KMA A;  2KOX A;  1WMH B;  4F1S A;  2AWT A;  1P1A A;  3N32 A;  2MBQ A;  4NNJ B;  1MG8 A;  3PV1 A;  1V80 A;  4WJQ A;  2PE9 A;  4NAW A;  1P9D U;  1SIF A;  2V3S A;  5DPT A;  2Y5B B;  4AP4 C;  2EMT A;  1ZGU B;  2N7D A;  4B9K A;  1K8R B;  2YLM A;  3N30 A;  2RR9 A;  2ZCB A;  5CHV C;  1L2N A;  3OJ3 A;  2C60 A;  2EMS A;  2XEW A;  2CKH B;  4GOC A;  3PRP B;  4KZ0 A;  2HJ8 A;  2UWQ A;  3QCA A;  1IYF A;  2O6V B;  1YIW A;  4DXA B;  4JQW C;  2RPQ A;  4ANU A;  1VD2 A;  2M8S A;  3APD A;  2DZJ A;  1J0G A;  4HVB A;  4K1R B;  4W9J A;  5CTR C;  1V81 A;  4M0W B;  1Q5W B;  3MTN B;  4HPL B;  3SD5 A;  1OGW A;  4EKU A;  3CST A;  3H7P B;  2IYD B;  3A4S C;  5JZE B;  2LAS A;  1WZ3 A;  1YX6 B;  2KO3 A;  2NBV B;  3UF8 A;  3QA8 A;  3R3M A;  2LD9 A;  4WJP A;  3V62 A;  2ZPN A;  3ML9 A;  4EUT A;  4HJK A;  4II2 B;  3HM3 A;  5GMV A;  5G55 A;  4W9F A;  3A33 B;  1GG3 A;  3AU4 A;  5AZH A;  2WYQ A;  3A9K B;  3IG3 A;  3ZW3 A;  2K8B A;  1R4M I;  3RT3 B;  4FBJ B;  4HK2 A;  2AL3 A;  3KYD D;  3DCG A;  1H8C A;  2KQ7 A;  2IY0 B;  2KJH B;  4X57 B;  2BYE A;  4B6W A;  2W9N A;  3ZDT A;  1P3Q U;  3DPD A;  2KTR A;  4MJS B;  2L0T A;  3L0W B;  3M3J A;  2ASQ A;  4TQ1 A;  2ZJD A;  5IAA C;  1RLF A;  3DOW A;  3QAR A;  2D2Q A;  1I42 A;  4HWI B;  2K25 A;  2LJ5 A;  2Z59 B;  4K7W A;  3EFU A;  1WZ0 A;  2M17 A;  4DWF A;  4A3O A;  4GXB A;  2G45 B;  1UBI A;  2N1V A;  4JL9 A;  2L7R A;  2K1F A;  4A20 A;  4RM9 A;  2I1K A;  4ZRI A;  4LJP B;  2GOW A;  2ZCC A;  2RGF A;  2D11 A;  3UQB A;  2KDE B;  4IUM B;  4IWP A;  3VDZ A;  3L54 A;  1WMH A;  4BBN C;  4GDK B;  4MH0 E;  3O65 B;  3ZKJ C;  4BOS C;  2GBR A;  3L10 B;  2LWP A;  1H4R A;  2NPT B;  3ONS A;  4FA6 A;  2PEA A;  3TBL D;  4HLE A;  2BGF A;  3K9P B;  3OJ4 B;  3PVL A;  3PGE A;  2JPH A;  2VRR B;  2DZK A;  3B1L X;  2K8H A;  4KDL B;  4ICV A;  5FR6 A;  4DDI D;  4I6P A;  4I6L B;  1Z5S B;  2G4D B;  2LUE A;  2M1M A;  2K8C A;  1XT9 B;  2ZZP B;  4TKN A;  4ZDV A;  2L00 B;  3QAQ A;  4GGQ A;  4ANX A;  3ZTC A;  1V5O A;  1KOT A;  2FAZ A;  2KAN A;  2Z0E B;  3A9J B;  3PS6 A;  4KV2 A;  2KWU B;  2N7E A;  1X1M A;  2O6V A;  4G11 A;  4LDT D;  5D94 A;  3PT2 B;  3ALB A;  1EF1 A;  1JRU A;  4GDL A;  4ZRJ A;  1WE7 A;  3S2A A;  2ZVO A;  1AAR A;  2ZVN A;  3DDC B;  2J0K A;  2CHZ A;  2XK5 B;  3I3T B;  3PPA A;  2KN5 A;  3ZNG C;  3B0A A;  1WE6 A;  3H7P A;  3OAW A;  3EC8 A;  2NBW B;  3QX1 A;  4M8N A;  1E8Z A;  4LCD E;  2KC1 A;  3CF6 E;  3KYC D;  1WXA A;  1RFA A;  4P7I A;  5CX3 A;  3TCA A;  1WM2 A;  2C9W B;  2MLB A;  1UEL A;  3M95 A;  4FN2 A;  2QHO A;  3K9O B;  2AYO B;  1G6J A;  4HCP B;  2K39 A;  3TJP A;  3ZNH B;  2DZM A;  3SDL C;  2L05 A;  5D7G A;  2HE7 A;  2MBB B;  3A9K A;  3PRM B;  2KMC A;  1WXS A;  2KC2 A;  2WX1 A;  2MQJ A;  1C1Y B;  3AU5 A;  2J7Q B;  2N9P C;  2MWS B;  2CHX A;  2DYB A;  5KHQ A;  3RCZ A;  3ZDM C;  2LI5 A;  4MJS A;  4MEL A;  2CS4 A;  1HE8 A;  2REX A;  2WX0 A;  5G2N A;  1IP9 A;  2DX5 B;  4W9D A;  5JHA A;  3NZS A;  5E6O A;  4BBN F;  2MRP A;  3NZU A;  4K81 A;  2N9E B;  4AUQ C;  1BT0 A;  3ECI A;  2R2Q A;  3KUZ A;  3WAP A;  3DBL I;  4FHJ A;  2LXA A;  1XQQ A;  3JW0 X;  1IPG A;  2IO0 B;  3VUW A;  2D3G A;  1WGG A;  4KSL C;  1VCB A;  2IO2 B;  3PRE A;  2KNB A;  3RUL A;  4GSW A;  3VUX A;  3GZN I;  4EFO A;  5JH5 C;  4HDQ A;  4XC2 A;  2NPT A;  4WWP A;  1WGR A;  1GUA B;  4KIK B;  1OEY J;  4KZC A;  3CMM B;  3PRZ A;  4G0N B;  4CYE A;  5JHB A;  1FXT B;  4BKS D;  2BYV E;  2MBH A;  3BY4 B;  1J8C A;  2XBB C;  3AI5 A;  4XZ4 A;  3NY5 A;  3WAN A;  2LVO A;  4K7U A;  4M8M A;  1E5W A;  1A5R A;  2LRW A;  1OEY A;  4GB9 A;  5KHO A;  1F9J A;  2L3Z A;  2MP2 B;  5C23 A;  3VH3 B;  1E7U A;  5E6P A;  4PS8 A;  4WQO B;  2NR2 A;  4E71 A;  2HD5 B;  2O6V D;  1WF9 A;  1WX7 A;  4E3C A;  5L95 C;  3DQV A;  3QJZ A;  4MEM A;  4EZK A;  3VQI A;  2AEH A;  2BKF A;  4W9K A;  3PTF C;  2XK5 A;  3ZO5 B;  1EO6 A;  3HK0 A;  2G4S A;  3A1Q B;  4DHJ B;  3ZLZ A;  4ANW A;  4DHZ E;  3LJ3 A;  2G3Q B;  2L8J A;  3H7S A;  2KX3 A;  4BVU C;  2PJH A;  5IA7 A;  1TGZ B;  2FIF A;  2JUO A;  1E8X A;  2KDF B;  2KQS A;  1D3Z A;  1YX5 B;  1S3S G;  4NQK E;  4NY0 A;  1R4N I;  2LXC A;  1WY8 A;  2BPS A;  2KWC A;  4DDG D;  4EEW A;  1UH6 A;  3DBS A;  5LXI B;  1RAX A;  1J19 A;  1WR1 A;  4FHK A;  3IBE A;  3UIP B;  2KFK B;  3HM6 X;  3VTV A;  1LQB A;  5LLI A;  3U30 A;  3SHQ A;  1WGD A;  1ZW7 A;  1WGY A;  4MDK E;  3C0R B;  2MA9 B;  3IHP C;  4AOF A;  1WM3 A;  5D2M B;  2NVU I;  3IVF A;  2LGY A;  4ZYN A;  3PZD A;  3L17 A;  1ZKH A;  3SU8 X;  4BKS A;  4IWO A;  2K6Q A;  3H9D A;  2LVQ A;  1SGH A;  2KHW B;  3B08 A;  4RM8 A;  2BF8 B;  5DPS A;  2IY1 B;  3X0W A;  4AWJ A;  4ICU A;  2UYZ B;  3DVG Y;  4IWQ A;  4G50 A;  3KUD B;  4IM0 A;  4NPN A;  4BFR A;  3VH4 B;  5E6N A;  4CO7 A;  2JRH A;  3R66 C;  4HDO A;  1WYW B;  3HHM A;  2HTH A;  5CHF A;  3T9L A;  5C1Z A;  4GU2 A;  4AJY B;  1P0R A;  2C7M B;  3VUY A;  3H1U A;  1GC7 A;  1WX9 A;  4JLC A;  3H6N A;  3QC8 B;  4HCN B;  1WRD B;  2KFJ A;  2D07 B;  2Z0D B;  3WA0 A;  4FJY A;  1V49 A;  3V61 A;  5TR5 A;  2FCN A;  3VAW A;  3NOB A;  3VTW A;  3QHT A;  3DVG X;  3MJW A;  4G3X B;  4NQL B;  3WIM A;  4WJO A;  1LM8 B;  2LGD A;  3GOE A;  4EOY A;  3ZNI D;  3RUI B;  1GC6 A;  1WXV A;  1ISN A;  1U4A A;  2A4Z A;  2C5L C;  2PE6 B;  4J6I A;  4W9H A;  4GIV A;  4EZL A;  5AEK B;  1V2Y A;  1QZE A;  5J18 A;  3PHX B;  4LJO B;  3HIZ A;  3JSV B;  3QQ8 B;  3TL5 A;  2JRI B;  1V6E A;  4W9E A;  1YJ1 A;  2RSU A;  2CHW A;  4RMA A;  5BO4 B;  3W1S A;  3UGB B;  4GN1 A;  3A1Q A;  3M62 B;  2YVC A;  2JF5 A;  1KLV A;  2KX0 A;  3RD2 A;  2CR5 A;  2ZNV B;  2AL6 A;  2JZ3 B;  4FAD A;  2JXX A;  4FJZ A;  2DEN B;  1KJT A;  4FLH A;  3KVF B;  4CHK A;  2M4N A;  3JVZ X;  2GBJ A;  3X23 A;  3ZRF A;  2JT4 B;  4NJ6 A;  3DVN U;  3T8M A;  2GMI C;  2KTF A;  4MSQ B;  4MGI E;  5HKH A;  1WGH A;  2KFK A;  1OQY A;  3MHS D;  3ZTD A;  4W9G A;  4BKG A;  2MBE A;  4GDK A;  3NHE B;  2DAF A;  4TQ0 A;  3V60 A;  3WAM A;  2IO1 B;  3U7D A;  3W1S C;  4MM3 A;  4BOZ B;  3RZW C;  4A3P A;  4IG7 B;  3M63 B;  5L83 A;  4GMV A;  2KDB A;  4NJ7 A;  3ZRC A;  2IBI B;  3QK0 A;  5J2R A;  2FCQ A;  3QWZ B;  3LDZ E;  3EEC A;  5AZF A;  1TBE A;  2KLG A;  1WJ4 A;  4MGK E;  3PLV A;  3UIO B;  1E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...