2J52A

Solution structure of gb1 domain protein g and low and high pressure.
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
56
structure length
56
Chain Sequence
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDAATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IMMUNOGLOBULIN G-BINDING PROTEIN G
publication title Pressure-Induced Changes in the Solution Structure of the Gb1 Domain of Protein G.
pubmed doi rcsb
source organism Streptococcus sp.
total genus 15
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2j52A00
2KQ4X 2IGGA 1K51A 2J52A 2PW9A 2ZW0A 3FILB 1HZ6A 1P7EA 1Q10A 2KWDA 4KGTA 5HHDG 5HFYA 1C9FA 2KACA 5BMIA 3V3XA 3FILA 2OEDA 2QMTA 2I38A 2PLPA 1HZ5A 2IGHA 2N9KA 1P7FA 2KDMA 2PTLA 2RPVA 1MI0A 4KGSA 5JXVA 3GB1A 2LUMA 5HI1A 1PGBA 1GB1A 1XF5L 3MP9A 1XCTL 4IKGA 2QSDA 1FD6A 2RMMA 1K53A 2NMQA 1FCCC 4HKZE 2ZW1A 2GB1A 1F2RC 4KGRA 2LGIA 2JU6X 2N7JA 4OZAA 2EELA 1UWXA 4D2KA 1D4BA 2I2YA 1F2RI 2JXTA 1FCLA 1EM7A 1MPEA 4GLSC 1YMHE 2JSVX 4WH4A 1KH0A 1YNTE 2KN4A 1ZXHA 5BMHA 4MACA 2J53A 2N9LA 1MHXA 2GI9A 1GB4A 1PGAA 1IBXB 1HEZE 2K0PA 1K52A 5BMGA 3UI3A 1MVKA 4OZCA 1IBXA 1IGDA 2ONQA 5HG2A 1K50A 2ON8A 4IOIE 1IGCA 2JWUA 1MHHE 1PGXA 2JZPA 1XCQL 1JMLA 2LHEA 4OZBA 2LHDA 1QKZA 2IGDA 4HJGE
chains in the Genus database with same CATH superfamily
2Y5CA 4CHKA 3WAMA 2INNE 4W9IA 4PYZA 2ZPYA 4FJYA 3MHZA 1NYRA 4HEA1 4LK0M 2WXFA 4YSXB 4DXFA 3DDCB 2WXIA 3ZO5B 1WF9A 2AYOB 2IGHA 1ET9A 1EF5A 2L00B 1A70A 1QT9A 4W9GA 1WYGA 5EE0A 2LXCA 3A9KA 3AE5B 4MH0E 3Q3FA 1VZ7A 1N5WA 1PGBA 4MEMA 4TMAB 1V1PB 2GBNA 4BVUC 1KF6B 2NVUI 2NS5A 3MJ5A 2K1FA 4HCNB 3QA8A 3IAM1 2C5LC 2LJ5A 1MJDA 5G2NA 2KDFB 1FFUA 5BYSA 2WXRA 2FNJB 3O65B 3ZLZA 4L2YA 2V9HA 3ZTCA 1JWAD 3L08A 1Q0WB 2WXPA 4TUUA 2ZNVB 2G1EA 2N1VA 4JQWC 3H1UA 5BMHA 1GPXA 3VHTC 4MSQB 1NI2A 2Z0DB 1D5MC 2ASQA 4HRSA 1OEYJ 1MVKA 2B76B 3W5UB 4JL9A 4OHJA 1L6VA 3VUYA 3Q2AC 1IGCA 1VD2A 2JX5A 1L2NA 3IXSA 1MHHE 1TIFA 3VRAB 1XCQL 1L4ZB 3VRBB 3GOEA 3P4QB 3NZ3A 4FULA 1UWMA 5TSSA 2JY6A 3IG3A 3PT2B 3TJPA 4FJVB 4RFBA 2K8HA 3V6CB 4II2B 2XK5A 5HFYA 2JXXA 5BMIA 2J7QB 2K8BA 4FXCA 2LGSA 2WLBA 4KV2A 2LXAA 1ZGUB 2C7MB 4MGIE 1IPGA 2WS3B 4AWJA 3NZSA 4M00A 3AE2B 4IUMB 4NY0A 1ZDVA 1YJIA 4RNAA 2KVRA 4MELA 3L17A 1E10A 1KJTA 3NJTA 1SXTA 2N7JA 3Q14C 3A1QB 1TJEA 3AEDB 1RFAA 4C7ZA 3DWGC 2WHIA 5DPRA 1SE3A 1STEA 3R7QA 2DZIA 2KOXA 2AL6A 1FXIA 2DYMA 2Y5PA 1TYGB 3Q8CA 1R4MB 5IP4D 2MX2A 2BQQA 4KX6B 3AM9A 1SEBD 3ZNGC 2INCC 5J17A 4OVVA 2M19A 3SFEB 4KZCA 1V8CA 4P1CC 4M0WA 3TMPB 2OHFA 3RMKC 3Q69A 4IM3A 1WH3A 2NTSA 1YN4A 1I4HA 3P2BA 2JYTA 4JX1C 3BWUD 5I4DA 3RNAC 1RYJA 2RGFA 1ROEA 3EFCA 4EZJA 2GMIC 2JWZA 2O6VD 1VDVA 4JGHB 1JRPA 2Z0EB 1LGRA 2DHZA 1K51A 1YQ3B 3VTVA 1EU4A 2A5UA 2FIFA 4Q2JA 1F9JA 1FNVA 1TKYA 3V3XA 1E5WA 3KW5B 1E90A 4PS8A 4A55A 2DENB 3T3OA 3U7ZA 1YD8U 3DVNV 2N1WA 4MM3A 4BKTA 5LXIB 2BT6A 2RPVA 3H7PA 4EEWA 3NVVA 5CX3A 1GOZA 2JZZA 2L3ZA 4GN1A 1R4NI 2K6DB 2IYDB 2C9WB 1XD3B 1GB1A 1VZ8A 4E71A 4A20A 3PREA 2QSDA 4II3B 2NMQA 2FIDA 2D10A 4HKZE 2DAFA 1TKGA 4HKQA 4WWOA 1F2RC 3OJ3A 3DBRB 2HTHA 2N4FA 2D07B 3C0RB 3C8YA 1UWXA 1HTOA 2A4ZA 1UD7A 2BBCA 4BFRA 3HK0A 2V4IB 3U8ZA 2MBHA 2KANA 4IWPA 3ZDTA 1WSPA 2WXKA 2KNBA 1ZP0B 3OJ4B 3SDLC 2L32A 3U2SC 2OJWA 3B9JA 1WX8A 2HTME 5AZHA 5EE3A 2YLMA 5FKAC 4M01A 2EMTA 2MBEA 4NAMA 4L1BA 2BS3B 3DHHC 1RM6C 2XNAC 1BT0A 2TSSA 3RPFC 2CHWA 5FR3A 2CHXA 3R3MA 1UBQA 3Q6BA 3LJ3A 3PS6A 4RCOA 2VZKB 4YSZB 2XEWA 2IGDA 3QAQA 4ARIA 2W55A 1AWDA 4GDKB 1VRAB 3BINA 4WWNA 2L0TA 2M0AA 4CYEA 1P7EA 1Q10A 1SBBB 2HJ1A 3RN9C 2WXNA 1KFYB 2X8XX 2FE8A 2DZKA 3A9JA 2BYTA 4ASWC 2O2VB 3UIPB 4GDLA 3PVLA 2PLPA 4WAAA 2JZ3B 1P7FA 3I5JC 2PTLA 3DWMA 3UGBB 1F77A 2KTRA 3NUHB 3APFA 2CHZA 1S3SG 4YT0B 5DPSA 3M3JA 4RM8A 3E9SA 4XYCA 4W9FA 2IBIB 3W1YA 3OWEB 1EUVB 2RMMA 2G3QB 3TSSA 2K3UA 3VXWA 4A6QA 2QCZA 1T0RC 3NHEB 1AW7A 4OZAA 1V6EA 3EGRA 2KK8A 2WXJA 3W5VB 2IY1B 4TKNA 3B0AA 3RNFC 2DAJA 1FCLA 4GLSC 3MTNB 4XZ4A 4BZAA 4ZOHC 1BMLC 3NS1A 3QQ8B 1SIFA 2FCSA 2KZRA 1GB4A 4ZRKA 2QILA 1PGAA 4R3DA 1QQRA 5CHWA 3AB5A 3AEBB 2K0PA 1GUAB 3D32A 2WDQB 2N9PC 4ZRIA 1ZOYB 3OAWA 4KVGB 1A5RA 1WR6E 3ONSA 4F8CB 1LM8B 3H7SA 4YXDB 4W9JA 1FO4A 2PE9A 2KHWB 5CHFA 4XWTA 4N59A 2JZPA 3RD2A 2L7RA 2FUG1 4RH6A 2PVOD 2LJIA 4AP4C 3L0WB 1SSNA 4N58A 2CKHB 1I7HA 1WYWB 2CJNA 1KLVA 1XT9B 3LXFA 1JCKB 1I4PA 5L83A 1PUTA 1I4GA 3RCZA 3PPAA 2Y5BB 2WDVB 2DWQA 4DHJD 4LDTD 5EE1A 3ZUNA 1ZW7A 2W3SA 4GU2A 3EFUA 5JXVA 4NAWA 4K81A 2LGXA 4EOYA 4C7YA 4TV3A 1N6ZA 2R2QA 1XCTL 2WU5B 4K3CA 2MP2A 4FADA 4LNFA 5D3IB 2QIEB 5D3DA 3QJZA 3ZXVA 3QARA 2KTFA 3L4PA 3AEFB 3PRZA 4RGOS 3AU5A 3WCQA 2E3TA 3AN1A 3PO0A 3BVZA 3I3TB 2G9HD 5C1ZA 3M63B 4ZHPA 1E9MA 1OGWA 1QOAA 3L54A 1OQRA 1I4XA 3GZNB 4PT5A 3BK1A 1ZXHA 3DQVA 4K7SA 3WA0A 1WGGA 4E3CA 5JH5C 2MH7A 1V81A 1OTRB 2K25A 3HRDD 4US9A 2KFKA 1VR9A 4KKJA 4WQOB 4RGTA 1HEZE 1SF0A 1EO6A 2I1KA 2WDTB 2ONQA 1ZKHA 1VCBA 1JWMD 3CSFA 2ON8A 1J7BA 1PYWD 1ESFA 4PS3A 3T3NA 2LHDA 1UF0A 1FNWA 1WMHA 1YOVB 3TEWA 2D3BA 3U52E 2MBQA 1EF1A 1TS2A 2CJOA 3APCA 2C7HA 4IM2A 2H88B 5LLIA 3J9CA 4DXAB 2SAKA 1N63A 4JLCA 3Q3OC 4P7IA 2BVCA 3LDZE 4HPPA 1WJNA 2M8SA 3A9KB 1PFDA 2J0MA 2KD0A 4BKSD 2L52A 4XC2A 5DPWA 2IPKD 3SD5A 2LVOA 3R66C 3BYYB 1E7UA 2W82A 3DVGX 3WANA 1WM2A 1TGZB 4DDGD 5JHAA 5D7GA 4WWMA 1K53A 5BYQA 3R2TA 3VUWA 3QIJA 3CWIA 2QEJC 1WJ4A 2CU3A 4AJWA 2JUOA 4B0MA 3SHQA 2Z8LA 2FAZA 4ANWA 2Q5WD 3DBHI 2R61A 2JXTA 4EKUA 1WWTA 1MPEA 2KMAA 3FAHA 2L83A 4HROA 1AYFA 4YTPB 4GGQA 4BKSA 3V61A 3I63C 2CR5A 4KSLC 2ZVOA 3FC4A 2GI9A 3ZRCA 3V05A 2N7EA 3HM6X 4NJCA 2LRWA 1DOIA 3PTFC 4NPNA 3ALBA 2JT4B 1HXYD 5EE9A 4REZA 3PZDA 1ZUD2 2QDFA 4BBNC 1AN8A 1LFDA 2KKCA 2RR9A 5E6JA 2KFJA 1L5PA 1YJ1A 3ECIA 2XK5B 2RSUA 2PVGC 4YTMB 3H9DA 1J8CA 3WALA 4JIOU 4J6IA 2CS4A 3FILA 1WFYA 4MGKE 3ZNHB 3U30A 4C56C 3NZUA 1NI3A 3HVDA 2C60A 4JWUC 5KHOA 3R2IA 1D5XC 5GXGB 3HM3A 4PS7A 4ANVA 4ANXA 4IWOA 5JHBA 5AUIA 2AQ2B 2WX0A 4YL8A 5J18A 3AE7B 4HDOA 4KGRA 4QAYA 2K22A 2V3NA 2D3AA 3AE1B 4LCDE 1ZXIA 4NQLB 2KWCA 2JRIB 4MGZE 2GBRA 4D2KA 4EFOA 5D2MB 1VZ6A 2Z59B 1MFWA 3PSEB 1YMHE 4KKIA 3RUIB 4MACA 4URKA 4WWPA 3NG0A 2KYWA 3AEAB 4LTUA 1GNUA 1RRBA 4M0WB 2BYVE 1P9DU 1BUIC 1GAQB 2RDHA 1IP9A 4C80A 3AEEB 2KMMA 2PEAA 1XLNA 4XDDA 4GIVA 2WWZA 4NJ6A 1PGXA 5EDSA 1KOTA 2BB6A 1WXSA 3V6EB 4ZRJA 1CJEA 3ZIMA 1QKZA 2B3AA 1DGJA 1GC7A 5G5HA 1M94A 1FFVA 2NBVB 4I6LB 4XX5A 3VUXA 1XEEA 4CO7A 4FA6A 2YVCA 1WE6A 1XQQA 3ML9A 4MJSA 2WXMA 4MM3B 2I38A 2LWPA 3CMMB 4A3OA 3H7PB 1KRHA 2D2QA 4K1RB 1UELA 1JQ4A 4FBJB 1XLOA 1L6UA 3WAOA 1R4MI 3BIID 4IG7B 1AARA 3SR6A 4AQ7A 3IFWB 3ML8A 4HK2A 1ZPSA 1P98A 4BOZB 2FCNA 3PZ7A 4IKGA 1SJED 2BS4B 2H89B 3AE4B 2MSED 3JSVB 1FIQA 4IM0A 3X23A 1B1ZA 4BKGA 1DOYA 2BWES 1E8WA 1OFFA 3ABVB 3HIZA 3L16A 2BS2B 2BW2A 3ZDMC 4EUTA 4F1SA 2KN5A 4EE2A 1FMAD 3UQBA 3M62B 1L0YB 3Q8EA 5LXHA 3PV1A 2O6VA 3APDA 1Q5WB 4HWIB 1UZXB 1QOFA 1J7CA 2GBJA 1C77A 3JSVA 1WIAA 3V62A 4UDUC 4YTNB 2L1AA 3N32A 4OZCA 3PRMB 4ZDVA 1IGDA 1UBIA 1C76A 1YIWA 2WXOA 1K50A 2NR2A 2BTEA 1G6JA 2MJDA 4W9KA 3KWVA 1QF6A 3DVNU 3TIXA 1CZPA 3PHWB 2BB5A 3MC9A 2J52A 4N6EB 1IYFA 3DBRI 3Q8FA 2MLBA 3AE8B 4ANUA 2BYFA 3VTUA 3A9JB 2QJLA 4KIKA 2PKOA 4GDLB 1SIJA 2KDEB 1WGDA 1TZOA 4XDCA 3DOWA 4M02A 2HD5B 4OVUA 2KTRB 4WJNA 1C4CA 3AH7A 4HVBA 2GLSA 2KJRA 1NEKB 4JPSA 4KGSA 3NY5A 3ZKJC 3DBSA 3PLUA 2JQRB 2MRPA 2XN9C 2ZPNA 1H8CA 1GJZA 4RM9A 3R8BA 4AS1A 1PQSA 3RNCC 2LGIA 4IW0A 5D94A 1EU3A 3ZNID 1WZ0A 2DYBA 4KSKC 2AEHA 4ZRQA 1FNUA 2LGDA 2IO1B 1FRRA 1QZEA 2WGSA 2KN4A 3RZFA 2N9LA 2WXHA 3RT3B 1MHXA 2LASA 1E8XA 3VTWA 2N0SB 3B2GA 1M4VA 2N9EB 1J0GA 4G3XB 2XBBC 4E74A 3P4RB 1C78A 1Z5SB 3KYCD 4GOCA 4IOIE 3RI7C 1SGHA 2FUHB 1P1AA 2KXJA 4USAA 3HUIA 2LZ6A 1YX6B 1UGMA 4NQKE 4K7WA 1R7SA 1V5TA 3P4PB 4WURA 1TTNA 2KT7A 1YX5B 1H4RA 2WDRB 2QHOA 2RDGA 1C9FA 2DLBA 3VAWA 2SEBD 1PDXA 2MW5A 2V1YA 3W1SC 2N9KA 4NAWB 2KDIA 1E0ZA 1XLQA 3H8HA 4HXDA 2BPSA 3RFZB 1F0ZA 3A33B 3QC8B 1TY2A 3QHTA 2VH1A 2MP2B 3T8MA 2K8CA 1K8RB 3L13A 5BYRA 1XF5L 5AUKA 3U7DA 2N9XA 3JW0X 4B6WA 3BY4B 3BYTB 4XGAB 4B0EA 3CIRB 3ETRA 1C3TA 2D5GA 2NBUA 4WJQA 3IHPC 2FCMA 1KM7A 4HLEA 4G0NB 5H8YE 3ZTDA 3GS2A 1BXTA 2JF5A 3A4SC 5AEKB 5CTRC 3KUZA 1L4DB 3P4SB 4WH4A 2DZMA 4WQMA 2RPQA 2BKRB 3P63A 2GRIA 1V97A 2KFKB 5AZGA 1NVID 5IA7A 2PIAA 1FM0D 1ZDXA 2MQJA 3RNGC 3TUOA 5IOIA 3IVFA 3PZ8A 1IBXA 4KDLB 5AZFA 2J42A 2IO2B 2IZVB 1TZ1A 1JRUA 4FJZA 4M8MA 4M8NA 3JVZX 1UUPA 1QILA 4HPMB 3ZQ4A 2M1MA 1L7YA 2IO0B 3P1MA 1WMHB 3KQ4A 2X38A 3VDZA 3C19A 1SB3C 1E6EB 4W9LA 4C4VA 3RNBC 2ZW0A 3U4EG 5E6OA 4DBGA 2MCNB 3OLMD 2QC8A 2KLCA 2OEDA 3ZRFA 2QMTA 2MA9B 1Q1OA 2DZJA 1HZ5A 3QX1A 2N7DA 2KJ6A 3GZNI 2MEKA 3RNEC 3AXCA 4ZHOA 3AV8A 3K9OB 2J4XA 2LEKA 4F7ZA 1NDDA 1WI0A 1TS5A 3MP9A 3DBLI 1FD6A 1ET6A 2VRRB 1FCCC 1D5ZC 1QOBA 2IY0B 1P3QU 2JU6X 4ICVA 2LVPA 3P42A 1WZ3A 2JYEA 2I2YA 3MJWA 2LUEA 2L8JA 3JYUA 2G45B 1SE4A 2PPHA 3DBHB 2IJ0A 4P1BC 2JPHA 3IT6B 3M95A 1C1YB 3TCAA 2BYEA 1JW9D 1Z2MA 3NVZA 3W1SA 4EZKA 4RF1A 5BMGA 3UI3A 4MT5A 1UNSA 4IDIA 1V80A 3PRPB 2MWSB 4A3PA 1SJHD 4A90A 1RLFA 1J7AA 1WXMA 2R2OA 1JMLA 3B08A 3QWZB 3HHMA 1T3QA 4HJGE 3K9PB 1WXAA 4PYUA 1KLGD 3EC8A 2V3SA 3N1XC 2PW9A 2IDYA 2HJ8A 2K6QA 3FILB 5IO9A 2BF8B 4DHZE 2WXGA 1JWBD 4PK1A 2Y3AA 1WGHA 4BBNF 1OQYA 4TQ0A 1WY8A 2AX5A 1EWYC 5DPTA 4X57B 2I1JA 1RFKA 3UIOB 5C23A 2KDBA 3EA6A 3BK2A 1JROA 1U4AA 5LNK1 4DDID 4MH8A 1KLUD 3CSTA 1L0VB 1XO3A 1CQVA 2WXQA 1V1PA 2PE6B 1C4AA 4LNIA 2KX0A 1OEYA 3AE9B 3O13A 3Q3MC 4BAXA 4EZLA 2INPE 2GBKA 2OOBB 3GE8C 5FR6A 2NBWB 1F1HA 3VH4B 4HDQA 1Y56A 3CF6E 1NBFC 2ZCBA 1YQBA 2L05A 1ZE3D 1N60A 4CQNA 4AUQC 4YWGG 1RWSA 2KQ7A 3ZJVA 1J19A 3LYYA 1YJJA 2LMCA 1V9JA 4IWQA 4ITKA 4DK5A 4DQOC 4W9DA 1V1OA 3NOBA 3AI5A 4WAFA 4GSWA 2CU1A 1HQRD 2NPTB 4O1NA 4TSSA 4DHZB 1D6EC 2K39A 2V0GA 1TBEA 1FXAA 1HZ6A 4MJSB 2C7NB 2KWDA 4ZYSA 1WE7A 5L95C 1SE9A 5G5GA 3IAS1 3URYA 3Q3JA 2D3CA 3MHSD 2EMSA 4ZYNA 4TQ1A 3BVGA 4OW0A 4LNKA 2WYQA 5IKCM 2YEPF 2LUMA 2PMVA 3SU8X 2MBBB 2V3PA 3EECA 1LXDA 2NPTA 4A9AA 3PHXB 4W9EA 3SFDB 4YSYB 5J2RA 2KQSA 4RGNA 1SE2A 2EELA 1FRDA 4S17A 3SEBA 1D4BA 3DPDA 2KMCA 3ENEA 5JZEB 2MHJA 3A1QA 3VQIA 1EM7A 2O6VB 1ENFA 2INDC 2VH2A 1YNTE 2UWQA 4B95A 1NYQA 1I42A 4KZ0A 4LNNA 1R4NB 3LB8C 2WNMA 2NTTA 1MG4A 3UINB 1N5XA 1N61A 2KWVB 4P6VF 2M0XA 3VR9B 2KAJA 2FBWB 1WGKA 3VH3B 4ZRPA 1T0QC 5KHQA 2ZCCA 2D3GA 3I9V1 2D11A 4NNJB 2UYZB 3ZNZB 3Q8AA 2J0KA 2JVCA 4S0RA 4DXGA 3KYDD 4KIKB 2UU7A 1GC6A 1XXGA 3ZVVA 1KTKA 3Q8BA 5CHVC 3A4RA 4KGTA 3DCGA 1F52A 1RAXA 4H2AA 1FXTB 3R7RA 1X1MA 2J0JA 2KX3A 1CMXB 5IN7A 3B2FA 2RDBC 2ZEQA 3EUB2 3AECB 2MJ3A 2FCQA 3BVMA 3ZGZA 1I4RA 3EHVA 1LQBA 2WU2B 5T8IA 1T5XD 3X0WA 3KUCB 1E7PB 2LVQA 1D3ZA 4GB9A 1WRIA 1UGJA 1FEHA 1TS4A 4GMVA 4RGMA 2HE7A 5C3JB 1WXVA 2HDEA 5G55A 3ZXRA 4G11A 1WGYA 4WIPA 4P16A 1KH0A 2VZKD 2KLGA 2YEPB 2WXLA 1ISNA 3W9CB 1C4PA 2KC2A 3ZW3A 1FPYA 3B1LX 1GG3A 2WX1A 1CK1A 1UH6A 4HPLB 3TBLD 3GP7A 2LFIA 2IO3B 2L0FA 4MGYE 3ZJUA 1YN3A 1K52A 2PJHA 5BO4B 3IT4B 2M56B 4ICUA 1TKEA 3VFKA 3IBEA 1Y8RC 4ARCA 4MSMB 4ACFA 1JWSD 2RD0A 3S2AA 3DVGY 3N1ZC 3AULA 3TEYA 2KQ4X 2IGGA 2BKFA 1I4QA 2DYOA 2KC1A 2ZZPB 1WR1A 4GDKA 3WAPA 1E7VA 4A8XC 5HHDG 4BOSC 1I35A 2G4DB 2ICIA 4FHKA 3RZWC 4LLGM 3GE3C 3AEGB 3TEXA 1QLBB 2MBOA 4FHJA 2O2VA 4NZLB 3NRZA 1QOGA 2ZJDA 4RMAA 3TEZA 2LD9A 1MI0A 1WM3A 1V5OA 2LI5A 1TT5B 2WQYB 3UF8A 3GB1A 1C79A 1TS3A 1T0SC 2EKEC 3NVWA 4AOFA 1VLBA 5TR5A 2K9XA 4RF0A 2ZW1A 5E6NA 2AQ1B 3N20C 3N1YC 4JWSC 4XE0A 2LRUA 3AU4A 2DNFA 1NENB 4L23A 2BWFA 2M4NA 2ZVNA 1F2RI 1HE8A 4HJKA 1B9RA 2REXA 4WJPA 4LNOA 3WIMA 3V60A 2JSVX 4K7UA 1TY0A 5C2TB 3DHGC 4OVZA 1JALA 1E8ZA 5D6JB 3MC8A 2J53A 4US8A 3NVYA 3N9YC 4N9F4 4I6PA 3KH0A 3MFGA 1IBXB 2E6XA 2V4LA 3BZDB 4HCPB 1E8YA 2MJEA 1ACCA 2AL3A 2L76A 4DHJB 2G4SA 5IAAC 4LDTB 1EWCA 3L10B 5HG2A 2JWUA 3PLVA 4AJYB 4G50A 1WJUA 3KWLA 2K5PA 1WX7A 1YQ4B 3KVFB 4C4VB 4C00A 4NJ7A 2NCNA 4J3OD 1VJKA 2LGYA 3I57A 3T9LA 3KLSX 1DYQA 3QK0A 2GBMA 2JRHA 5DCNA 3ZJTA 2WP9B 4W9CA 4LJOB 1WXQA 4I6NB 4JE3B 4KDIC 2KACA 3PGEA 4GXBA 4WJOA 4LJPB 4FN2A 3TL5A 3DHIC 4MDKE 1T6BX 1WX9A 2KJHB 2KDMA 3QCAA 5E6PA 2KWUB 1WJ6A 2BGFA 2W9NA 2AQ3B 4W9HA 5HI1A 2DBYA 3AE6B 4FLHA 1MG8A 2ZNVC 1P0RA 4DWFA 2KO3A 1LO5D 3AMZA 1V86A 1WRDB 1JWUD 3NS8A 1HA5A 2GB1A 1YN5A 1V2YA 4K3BA 3RYTA 5FK9C 3DBLB 4B9KA 3KUDB 4IC7B 3W2DA 3RULA 2AWTA 1S1QB 1DOXA 1V49A 2KVZA 1IUEA 4XWWA 2GOWA 3E56A 3N3KB 3N30A 1L0XB 3UQAA 3H6NA 3OG5A 1WGRA 3AE3B 2DX5B 3ZYYX 2ACZB 1HTQA 3VR8B 3HVZA 3FKYA 2W54A 2OJRA 2W3RA 5MPOA 3MC0B 5HKHA 2M17A 1N62A 1XLPA 1T0YA 5H92C 5GMVA 2EKIA 2LHEA 3Q3NC 4OZBA 3VVWB 1OQQA
chains in the Genus database with same CATH topology
2BB5A 4N6EB 2J52A 1HQRD 2Y5CA 4O1NA 1SSNA 4TSSA 1D6EC 4N58A 2INNE 3Q8FA 1I7HA 3AE8B 2V0GA 1FXAA 1HZ6A 2QJLA 2CJNA 3MHZA 2KWDA 2PKOA 4GDLB 1SIJA 3LXFA 4ZYSA 1JCKB 1NYRA 4HEA1 1I4PA 4LK0M 2WXFA 1PUTA 1TZOA 1I4GA 5G5GA 4XDCA 4YSXB 4DXFA 3IAS1 3URYA 2WDVB 2WXIA 2DWQA 2IGHA 1ET9A 1A70A 1C4CA 1QT9A 3AH7A 5EE1A 4TQ1A 3BVGA 4OW0A 2W3SA 1NEKB 1WYGA 4JPSA 4KGSA 5EE0A 5JXVA 2YEPF 3AE5B 1VZ7A 2LUMA 1N5WA 2PMVA 4C7YA 1PGBA 4TMAB 2V3PA 1V1PB 2JQRB 2XN9C 2WU5B 1XCTL 3R8BA 1KF6B 5D3IB 4A9AA 2QIEB 5D3DA 4AS1A 3MJ5A 2LGIA 3AEFB 3L4PA 4RGOS 1EU3A 3WCQA 3SFDB 2E3TA 4YSYB 4RGNA 3IAM1 1SE2A 2EELA 1FRDA 3AN1A 3SEBA 3PO0A 1FFUA 3BVZA 5BYSA 1D4BA 2WXRA 2G9HD 4L2YA 3VQIA 4ZHPA 4ZRQA 1EM7A 1JWAD 1E9MA 1FNUA 1QOAA 2WXPA 1ENFA 1OQRA 2G1EA 1FRRA 1I4XA 1YNTE 4PT5A 2KN4A 1ZXHA 3BK1A 5BMHA 1GPXA 1NYQA 2N9LA 2WXHA 3LB8C 1MHXA 2WNMA 2NTTA 2MH7A 2N0SB 3B2GA 3HRDD 1M4VA 1N5XA 4US9A 1N61A 1D5MC 4P6VF 1VR9A 4KKJA 4RGTA 4HRSA 1HEZE 3VR9B 1SF0A 2KAJA 2FBWB 1MVKA 1WGKA 2B76B 3P4RB 3W5UB 2ONQA 4ZRPA 1JWMD 1L6VA 4OHJA 1C78A 2ON8A 1J7BA 4IOIE 1PYWD 3I9V1 1IGCA 2JX5A 4USAA 3HUIA 3IXSA 1ESFA 1MHHE 3VRAB 1XCQL 3Q8AA 1L4ZB 3T3NA 3VRBB 2LHDA 4DXGA 3P4QB 3NZ3A 5TSSA 1UWMA 1FNWA 3TEWA 1R7SA 3P4PB 3U52E 4RFBA 4WURA 1TS2A 1XXGA 1KTKA 3Q8BA 2CJOA 2WDRB 4KGTA 2H88B 2RDGA 5HFYA 3J9CA 2SAKA 1C9FA 5BMIA 1N63A 2DLBA 4H2AA 2SEBD 1PDXA 4FXCA 2WLBA 2N9KA 4NAWB 1PFDA 1E0ZA 1XLQA 3H8HA 2L52A 3B2FA 2WS3B 3RFZB 3AE2B 2IPKD 1F0ZA 3BYYB 3EUB2 1TY2A 3AECB 1ZDVA 2MJ3A 2W82A 3BVMA 3ZGZA 1I4RA 1YJIA 4RNAA 2WU2B 5BYRA 1XF5L 5T8IA 1T5XD 5AUKA 5D7GA 4WWMA 1K53A 5BYQA 1E7PB 3R2TA 1E10A 3CWIA 2QEJC 3BYTB 2CU3A 1WRIA 4B0EA 3CIRB 3ETRA 1UGJA 1SXTA 2D5GA 1FEHA 2N7JA 4B0MA 1TS4A 2Z8LA 4RGMA 1TJEA 3AEDB 5H8YE 4C7ZA 5C3JB 2Q5WD 2HDEA 3DWGC 3GS2A 1SE3A 1STEA 2R61A 2JXTA 1WWTA 1BXTA 1MPEA 3FAHA 2L83A 4WIPA 1FXIA 2DYMA 4HROA 1L4DB 3P4SB 4WH4A 4P16A 1AYFA 1KH0A 1TYGB 2VZKD 2Y5PA 2YEPB 2WXLA 3Q8CA 4WQMA 1C4PA 4YTPB 3W9CB 3P63A 4KX6B 2GRIA 3AM9A 1V97A 1SEBD 3FC4A 1NVID 2GI9A 1CK1A 2PIAA 3GP7A 1FM0D 2M19A 1ZDXA 2LFIA 3SFEB 1V8CA 1YN3A 3ZJUA 1K52A 3TUOA 3PZ8A 4M0WA 1IBXA 3V05A 2J42A 2OHFA 3Q69A 3IT4B 2M56B 2NTSA 4NJCA 1YN4A 1I4HA 1TKEA 1UUPA 1QILA 3ZQ4A 2JYTA 4JX1C 1DOIA 3BWUD 5I4DA 1RYJA 4ARCA 3P1MA 1HXYD 1ROEA 5EE9A 4REZA 1JWSD 3KQ4A 1ZUD2 2X38A 1AN8A 5E6JA 1VDVA 1JRPA 1SB3C 1E6EB 3TEYA 2KQ4X 1L5PA 2IGGA 1K51A 1I4QA 1YQ3B 2DYOA 1EU4A 2PVGC 4YTMB 4Q2JA 2ZW0A 3U4EG 4A8XC 1FNVA 1TKYA 5HHDG 3V3XA 2ICIA 3FILA 4A55A 2OEDA 2QMTA 4LLGM 3AEGB 1HZ5A 3TEXA 3T3OA 3U7ZA 1QLBB 4C56C 4NZLB 3NRZA 1NI3A 1QOGA 2MEKA 3HVDA 4JWUC 3TEZA 2BT6A 2RPVA 1MI0A 3R2IA 3NVVA 1D5XC 5GXGB 1GOZA 2WQYB 4ZHOA 3GB1A 1C79A 3AV8A 1TS3A 2J4XA 3NVWA 2LEKA 1GB1A 1VZ8A 5AUIA 1TS5A 2AQ2B 3MP9A 2QSDA 1FD6A 1ET6A 1VLBA 2NMQA 1FCCC 1D5ZC 2K9XA 4HKZE 1QOBA 2ZW1A 2AQ1B 3AE7B 4RF0A 1TKGA 4HKQA 1F2RC 4KGRA 2K22A 2V3NA 4JWSC 3AE1B 3C8YA 2JU6X 4XE0A 1ZXIA 3P42A 1UWXA 1NENB 2JYEA 4L23A 4D2KA 2I2YA 1F2RI 1VZ6A 1B9RA 2BBCA 1YMHE 2JSVX 2V4IB 1SE4A 1TY0A 5C2TB 4KKIA 4OVZA 1JALA 2IJ0A 3IT6B 1WSPA 4MACA 2J53A 4US8A 2WXKA 3NVYA 3AEAB 1ZP0B 1JW9D 3N9YC 4LTUA 2L32A 3MFGA 3U2SC 3B9JA 1IBXB 3NVZA 2HTME 2E6XA 3W1SA 3BZDB 1BUIC 1GAQB 4RF1A 5EE3A 5BMGA 2RDHA 5FKAC 3UI3A 2MJEA 1ACCA 4MT5A 1UNSA 4C80A 4IDIA 4NAMA 3AEEB 2BS3B 4L1BA 1EWCA 2KMMA 5HG2A 1RM6C 1XLNA 2XNAC 4XDDA 2TSSA 3RPFC 5FR3A 1SJHD 2JWUA 4A90A 1J7AA 3KWLA 1PGXA 2K5PA 1YQ4B 1JMLA 2BB6A 1T3QA 1CJEA 4RCOA 2VZKB 1QKZA 4YSZB 2IGDA 4ARIA 4HJGE 1DGJA 1AWDA 2W55A 4GDKB 4J3OD 1VRAB 1VJKA 3I57A 5G5HA 3KLSX 1DYQA 1KLGD 2M0AA 1FFVA 2PW9A 2IDYA 3FILB 1P7EA 1Q10A 1SBBB 1XEEA 3ZJTA 2WP9B 2WXGA 1WXQA 1JWBD 2WXNA 1KFYB 4JE3B 2KACA 2Y3AA 2FE8A 2BYTA 4TQ0A 2AX5A 1EWYC 2WXMA 4MM3B 2I38A 2PLPA 1KRHA 1RFKA 1T6BX 1P7FA 1JQ4A 1XLOA 2KDMA 3EA6A 1L6UA 2PTLA 3DWMA 3BIID 1F77A 3NUHB 3SR6A 4AQ7A 2AQ3B 4YT0B 3BK2A 3E9SA 5HI1A 1JROA 1ZPSA 2DBYA 3AE6B 5LNK1 4MH8A 3PZ7A 3OWEB 4IKGA 1SJED 1LO5D 2BS4B 2H89B 2RMMA 3AE4B 3AMZA 1KLUD 1L0VB 1XO3A 1JWUD 1CQVA 2K3UA 3TSSA 2WXQA 1HA5A 2GB1A 1V1PA 1YN5A 4A6QA 1FIQA 1B1ZA 1AW7A 1DOYA 4OZAA 5FK9C 3EGRA 1C4AA 1OFFA 3ABVB 2WXJA 3AE9B 2BS2B 2BW2A 3W5VB 3O13A 3W2DA 2INPE 1DOXA 4EE2A 1FMAD 1FCLA 1IUEA 4GLSC 4XWWA 1L0YB 4ZOHC 3Q8EA 3E56A 1BMLC 1L0XB 3NS1A 1Y56A 3AE3B 1GB4A 1QOFA 2QILA 1PGAA 3ZYYX 1J7CA 2ACZB 4R3DA 1ZE3D 1QQRA 3VR8B 1C77A 3AB5A 3HVZA 1N60A 4CQNA 3AEBB 2K0PA 4UDUC 4YTNB 2W54A 2L1AA 4OZCA 2W3RA 4YWGG 2WDQB 1RWSA 5MPOA 1IGDA 3MC0B 1C76A 1N62A 1ZOYB 3ZJVA 3LYYA 2WXOA 1K50A 2BTEA 2MJDA 4YXDB 1YJJA 2LMCA 1XLPA 1FO4A 5H92C 3KWVA 1QF6A 4XWTA 4ITKA 4N59A 2JZPA 4DQOC 1CZPA 2FUG1 4RH6A 2PVOD 1V1OA 2EKIA 2LJIA 2LHEA 4OZBA 4WAFA 1OQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQ4 X;  2IGG A;  1K51 A;  2J52 A;  2PW9 A;  2ZW0 A;  3FIL B;  1HZ6 A;  1P7E A;  1Q10 A;  2KWD A;  4KGT A;  5HHD G;  5HFY A;  1C9F A;  2KAC A;  5BMI A;  3V3X A;  3FIL A;  2OED A;  2QMT A;  2I38 A;  2PLP A;  1HZ5 A;  2IGH A;  2N9K A;  1P7F A;  2KDM A;  2PTL A;  2RPV A;  1MI0 A;  4KGS A;  5JXV A;  3GB1 A;  2LUM A;  5HI1 A;  1PGB A;  1GB1 A;  1XF5 L;  3MP9 A;  1XCT L;  4IKG A;  2QSD A;  1FD6 A;  2RMM A;  1K53 A;  2NMQ A;  1FCC C;  4HKZ E;  2ZW1 A;  2GB1 A;  1F2R C;  4KGR A;  2LGI A;  2JU6 X;  2N7J A;  4OZA A;  2EEL A;  1UWX A;  4D2K A;  1D4B A;  2I2Y A;  1F2R I;  2JXT A;  1FCL A;  1EM7 A;  1MPE A;  4GLS C;  1YMH E;  2JSV X;  4WH4 A;  1KH0 A;  1YNT E;  2KN4 A;  1ZXH A;  5BMH A;  4MAC A;  2J53 A;  2N9L A;  1MHX A;  2GI9 A;  1GB4 A;  1PGA A;  1IBX B;  1HEZ E;  2K0P A;  1K52 A;  5BMG A;  3UI3 A;  1MVK A;  4OZC A;  1IBX A;  1IGD A;  2ONQ A;  5HG2 A;  1K50 A;  2ON8 A;  4IOI E;  1IGC A;  2JWU A;  1MHH E;  1PGX A;  2JZP A;  1XCQ L;  1JML A;  2LHE A;  4OZB A;  2LHD A;  1QKZ A;  2IGD A;  4HJG E; 
#chains in the Genus database with same CATH topology
 2Y5C A;  4CHK A;  3WAM A;  2INN E;  4W9I A;  4PYZ A;  2ZPY A;  4FJY A;  3MHZ A;  1NYR A;  4HEA 1;  4LK0 M;  2WXF A;  4YSX B;  4DXF A;  3DDC B;  2WXI A;  3ZO5 B;  1WF9 A;  2AYO B;  2IGH A;  1ET9 A;  1EF5 A;  2L00 B;  1A70 A;  1QT9 A;  4W9G A;  1WYG A;  5EE0 A;  2LXC A;  3A9K A;  3AE5 B;  4MH0 E;  3Q3F A;  1VZ7 A;  1N5W A;  1PGB A;  4MEM A;  4TMA B;  1V1P B;  2GBN A;  4BVU C;  1KF6 B;  2NVU I;  2NS5 A;  3MJ5 A;  2K1F A;  4HCN B;  3QA8 A;  3IAM 1;  2C5L C;  2LJ5 A;  1MJD A;  5G2N A;  2KDF B;  1FFU A;  5BYS A;  2WXR A;  2FNJ B;  3O65 B;  3ZLZ A;  4L2Y A;  2V9H A;  3ZTC A;  1JWA D;  3L08 A;  1Q0W B;  2WXP A;  4TUU A;  2ZNV B;  2G1E A;  2N1V A;  4JQW C;  3H1U A;  5BMH A;  1GPX A;  3VHT C;  4MSQ B;  1NI2 A;  2Z0D B;  1D5M C;  2ASQ A;  4HRS A;  1OEY J;  1MVK A;  2B76 B;  3W5U B;  4JL9 A;  4OHJ A;  1L6V A;  3VUY A;  3Q2A C;  1IGC A;  1VD2 A;  2JX5 A;  1L2N A;  3IXS A;  1MHH E;  1TIF A;  3VRA B;  1XCQ L;  1L4Z B;  3VRB B;  3GOE A;  3P4Q B;  3NZ3 A;  4FUL A;  1UWM A;  5TSS A;  2JY6 A;  3IG3 A;  3PT2 B;  3TJP A;  4FJV B;  4RFB A;  2K8H A;  3V6C B;  4II2 B;  2XK5 A;  5HFY A;  2JXX A;  5BMI A;  2J7Q B;  2K8B A;  4FXC A;  2LGS A;  2WLB A;  4KV2 A;  2LXA A;  1ZGU B;  2C7M B;  4MGI E;  1IPG A;  2WS3 B;  4AWJ A;  3NZS A;  4M00 A;  3AE2 B;  4IUM B;  4NY0 A;  1ZDV A;  1YJI A;  4RNA A;  2KVR A;  4MEL A;  3L17 A;  1E10 A;  1KJT A;  3NJT A;  1SXT A;  2N7J A;  3Q14 C;  3A1Q B;  1TJE A;  3AED B;  1RFA A;  4C7Z A;  3DWG C;  2WHI A;  5DPR A;  1SE3 A;  1STE A;  3R7Q A;  2DZI A;  2KOX A;  2AL6 A;  1FXI A;  2DYM A;  2Y5P A;  1TYG B;  3Q8C A;  1R4M B;  5IP4 D;  2MX2 A;  2BQQ A;  4KX6 B;  3AM9 A;  1SEB D;  3ZNG C;  2INC C;  5J17 A;  4OVV A;  2M19 A;  3SFE B;  4KZC A;  1V8C A;  4P1C C;  4M0W A;  3TMP B;  2OHF A;  3RMK C;  3Q69 A;  4IM3 A;  1WH3 A;  2NTS A;  1YN4 A;  1I4H A;  3P2B A;  2JYT A;  4JX1 C;  3BWU D;  5I4D A;  3RNA C;  1RYJ A;  2RGF A;  1ROE A;  3EFC A;  4EZJ A;  2GMI C;  2JWZ A;  2O6V D;  1VDV A;  4JGH B;  1JRP A;  2Z0E B;  1LGR A;  2DHZ A;  1K51 A;  1YQ3 B;  3VTV A;  1EU4 A;  2A5U A;  2FIF A;  4Q2J A;  1F9J A;  1FNV A;  1TKY A;  3V3X A;  1E5W A;  3KW5 B;  1E90 A;  4PS8 A;  4A55 A;  2DEN B;  3T3O A;  3U7Z A;  1YD8 U;  3DVN V;  2N1W A;  4MM3 A;  4BKT A;  5LXI B;  2BT6 A;  2RPV A;  3H7P A;  4EEW A;  3NVV A;  5CX3 A;  1GOZ A;  2JZZ A;  2L3Z A;  4GN1 A;  1R4N I;  2K6D B;  2IYD B;  2C9W B;  1XD3 B;  1GB1 A;  1VZ8 A;  4E71 A;  4A20 A;  3PRE A;  2QSD A;  4II3 B;  2NMQ A;  2FID A;  2D10 A;  4HKZ E;  2DAF A;  1TKG A;  4HKQ A;  4WWO A;  1F2R C;  3OJ3 A;  3DBR B;  2HTH A;  2N4F A;  2D07 B;  3C0R B;  3C8Y A;  1UWX A;  1HTO A;  2A4Z A;  1UD7 A;  2BBC A;  4BFR A;  3HK0 A;  2V4I B;  3U8Z A;  2MBH A;  2KAN A;  4IWP A;  3ZDT A;  1WSP A;  2WXK A;  2KNB A;  1ZP0 B;  3OJ4 B;  3SDL C;  2L32 A;  3U2S C;  2OJW A;  3B9J A;  1WX8 A;  2HTM E;  5AZH A;  5EE3 A;  2YLM A;  5FKA C;  4M01 A;  2EMT A;  2MBE A;  4NAM A;  4L1B A;  2BS3 B;  3DHH C;  1RM6 C;  2XNA C;  1BT0 A;  2TSS A;  3RPF C;  2CHW A;  5FR3 A;  2CHX A;  3R3M A;  1UBQ A;  3Q6B A;  3LJ3 A;  3PS6 A;  4RCO A;  2VZK B;  4YSZ B;  2XEW A;  2IGD A;  3QAQ A;  4ARI A;  2W55 A;  1AWD A;  4GDK B;  1VRA B;  3BIN A;  4WWN A;  2L0T A;  2M0A A;  4CYE A;  1P7E A;  1Q10 A;  1SBB B;  2HJ1 A;  3RN9 C;  2WXN A;  1KFY B;  2X8X X;  2FE8 A;  2DZK A;  3A9J A;  2BYT A;  4ASW C;  2O2V B;  3UIP B;  4GDL A;  3PVL A;  2PLP A;  4WAA A;  2JZ3 B;  1P7F A;  3I5J C;  2PTL A;  3DWM A;  3UGB B;  1F77 A;  2KTR A;  3NUH B;  3APF A;  2CHZ A;  1S3S G;  4YT0 B;  5DPS A;  3M3J A;  4RM8 A;  3E9S A;  4XYC A;  4W9F A;  2IBI B;  3W1Y A;  3OWE B;  1EUV B;  2RMM A;  2G3Q B;  3TSS A;  2K3U A;  3VXW A;  4A6Q A;  2QCZ A;  1T0R C;  3NHE B;  1AW7 A;  4OZA A;  1V6E A;  3EGR A;  2KK8 A;  2WXJ A;  3W5V B;  2IY1 B;  4TKN A;  3B0A A;  3RNF C;  2DAJ A;  1FCL A;  4GLS C;  3MTN B;  4XZ4 A;  4BZA A;  4ZOH C;  1BML C;  3NS1 A;  3QQ8 B;  1SIF A;  2FCS A;  2KZR A;  1GB4 A;  4ZRK A;  2QIL A;  1PGA A;  4R3D A;  1QQR A;  5CHW A;  3AB5 A;  3AEB B;  2K0P A;  1GUA B;  3D32 A;  2WDQ B;  2N9P C;  4ZRI A;  1ZOY B;  3OAW A;  4KVG B;  1A5R A;  1WR6 E;  3ONS A;  4F8C B;  1LM8 B;  3H7S A;  4YXD B;  4W9J A;  1FO4 A;  2PE9 A;  2KHW B;  5CHF A;  4XWT A;  4N59 A;  2JZP A;  3RD2 A;  2L7R A;  2FUG 1;  4RH6 A;  2PVO D;  2LJI A;  4AP4 C;  3L0W B;  1SSN A;  4N58 A;  2CKH B;  1I7H A;  1WYW B;  2CJN A;  1KLV A;  1XT9 B;  3LXF A;  1JCK B;  1I4P A;  5L83 A;  1PUT A;  1I4G A;  3RCZ A;  3PPA A;  2Y5B B;  2WDV B;  2DWQ A;  4DHJ D;  4LDT D;  5EE1 A;  3ZUN A;  1ZW7 A;  2W3S A;  4GU2 A;  3EFU A;  5JXV A;  4NAW A;  4K81 A;  2LGX A;  4EOY A;  4C7Y A;  4TV3 A;  1N6Z A;  2R2Q A;  1XCT L;  2WU5 B;  4K3C A;  2MP2 A;  4FAD A;  4LNF A;  5D3I B;  2QIE B;  5D3D A;  3QJZ A;  3ZXV A;  3QAR A;  2KTF A;  3L4P A;  3AEF B;  3PRZ A;  4RGO S;  3AU5 A;  3WCQ A;  2E3T A;  3AN1 A;  3PO0 A;  3BVZ A;  3I3T B;  2G9H D;  5C1Z A;  3M63 B;  4ZHP A;  1E9M A;  1OGW A;  1QOA A;  3L54 A;  1OQR A;  1I4X A;  3GZN B;  4PT5 A;  3BK1 A;  1ZXH A;  3DQV A;  4K7S A;  3WA0 A;  1WGG A;  4E3C A;  5JH5 C;  2MH7 A;  1V81 A;  1OTR B;  2K25 A;  3HRD D;  4US9 A;  2KFK A;  1VR9 A;  4KKJ A;  4WQO B;  4RGT A;  1HEZ E;  1SF0 A;  1EO6 A;  2I1K A;  2WDT B;  2ONQ A;  1ZKH A;  1VCB A;  1JWM D;  3CSF A;  2ON8 A;  1J7B A;  1PYW D;  1ESF A;  4PS3 A;  3T3N A;  2LHD A;  1UF0 A;  1FNW A;  1WMH A;  1YOV B;  3TEW A;  2D3B A;  3U52 E;  2MBQ A;  1EF1 A;  1TS2 A;  2CJO A;  3APC A;  2C7H A;  4IM2 A;  2H88 B;  5LLI A;  3J9C A;  4DXA B;  2SAK A;  1N63 A;  4JLC A;  3Q3O C;  4P7I A;  2BVC A;  3LDZ E;  4HPP A;  1WJN A;  2M8S A;  3A9K B;  1PFD A;  2J0M A;  2KD0 A;  4BKS D;  2L52 A;  4XC2 A;  5DPW A;  2IPK D;  3SD5 A;  2LVO A;  3R66 C;  3BYY B;  1E7U A;  2W82 A;  3DVG X;  3WAN A;  1WM2 A;  1TGZ B;  4DDG D;  5JHA A;  5D7G A;  4WWM A;  1K53 A;  5BYQ A;  3R2T A;  3VUW A;  3QIJ A;  3CWI A;  2QEJ C;  1WJ4 A;  2CU3 A;  4AJW A;  2JUO A;  4B0M A;  3SHQ A;  2Z8L A;  2FAZ A;  4ANW A;  2Q5W D;  3DBH I;  2R61 A;  2JXT A;  4EKU A;  1WWT A;  1MPE A;  2KMA A;  3FAH A;  2L83 A;  4HRO A;  1AYF A;  4YTP B;  4GGQ A;  4BKS A;  3V61 A;  3I63 C;  2CR5 A;  4KSL C;  2ZVO A;  3FC4 A;  2GI9 A;  3ZRC A;  3V05 A;  2N7E A;  3HM6 X;  4NJC A;  2LRW A;  1DOI A;  3PTF C;  4NPN A;  3ALB A;  2JT4 B;  1HXY D;  5EE9 A;  4REZ A;  3PZD A;  1ZUD 2;  2QDF A;  4BBN C;  1AN8 A;  1LFD A;  2KKC A;  2RR9 A;  5E6J A;  2KFJ A;  1L5P A;  1YJ1 A;  3ECI A;  2XK5 B;  2RSU A;  2PVG C;  4YTM B;  3H9D A;  1J8C A;  3WAL A;  4JIO U;  4J6I A;  2CS4 A;  3FIL A;  1WFY A;  4MGK E;  3ZNH B;  3U30 A;  4C56 C;  3NZU A;  1NI3 A;  3HVD A;  2C60 A;  4JWU C;  5KHO A;  3R2I A;  1D5X C;  5GXG B;  3HM3 A;  4PS7 A;  4ANV A;  4ANX A;  4IWO A;  5JHB A;  5AUI A;  2AQ2 B;  2WX0 A;  4YL8 A;  5J18 A;  3AE7 B;  4HDO A;  4KGR A;  4QAY A;  2K22 A;  2V3N A;  2D3A A;  3AE1 B;  4LCD E;  1ZXI A;  4NQL B;  2KWC A;  2JRI B;  4MGZ E;  2GBR A;  4D2K A;  4EFO A;  5D2M B;  1VZ6 A;  2Z59 B;  1MFW A;  3PSE B;  1YMH E;  4KKI A;  3RUI B;  4MAC A;  4URK A;  4WWP A;  3NG0 A;  2KYW A;  3AEA B;  4LTU A;  1GNU A;  1RRB A;  4M0W B;  2BYV E;  1P9D U;  1BUI C;  1GAQ B;  2RDH A;  1IP9 A;  4C80 A;  3AEE B;  2KMM A;  2PEA A;  1XLN A;  4XDD A;  4GIV A;  2WWZ A;  4NJ6 A;  1PGX A;  5EDS A;  1KOT A;  2BB6 A;  1WXS A;  3V6E B;  4ZRJ A;  1CJE A;  3ZIM A;  1QKZ A;  2B3A A;  1DGJ A;  1GC7 A;  5G5H A;  1M94 A;  1FFV A;  2NBV B;  4I6L B;  4XX5 A;  3VUX A;  1XEE A;  4CO7 A;  4FA6 A;  2YVC A;  1WE6 A;  1XQQ A;  3ML9 A;  4MJS A;  2WXM A;  4MM3 B;  2I38 A;  2LWP A;  3CMM B;  4A3O A;  3H7P B;  1KRH A;  2D2Q A;  4K1R B;  1UEL A;  1JQ4 A;  4FBJ B;  1XLO A;  1L6U A;  3WAO A;  1R4M I;  3BII D;  4IG7 B;  1AAR A;  3SR6 A;  4AQ7 A;  3IFW B;  3ML8 A;  4HK2 A;  1ZPS A;  1P98 A;  4BOZ B;  2FCN A;  3PZ7 A;  4IKG A;  1SJE D;  2BS4 B;  2H89 B;  3AE4 B;  2MSE D;  3JSV B;  1FIQ A;  4IM0 A;  3X23 A;  1B1Z A;  4BKG A;  1DOY A;  2BWE S;  1E8W A;  1OFF A;  3ABV B;  3HIZ A;  3L16 A;  2BS2 B;  2BW2 A;  3ZDM C;  4EUT A;  4F1S A;  2KN5 A;  4EE2 A;  1FMA D;  3UQB A;  3M62 B;  1L0Y B;  3Q8E A;  5LXH A;  3PV1 A;  2O6V A;  3APD A;  1Q5W B;  4HWI B;  1UZX B;  1QOF A;  1J7C A;  2GBJ A;  1C77 A;  3JSV A;  1WIA A;  3V62 A;  4UDU C;  4YTN B;  2L1A A;  3N32 A;  4OZC A;  3PRM B;  4ZDV A;  1IGD A;  1UBI A;  1C76 A;  1YIW A;  2WXO A;  1K50 A;  2NR2 A;  2BTE A;  1G6J A;  2MJD A;  4W9K A;  3KWV A;  1QF6 A;  3DVN U;  3TIX A;  1CZP A;  3PHW B;  2BB5 A;  3MC9 A;  2J52 A;  4N6E B;  1IYF A;  3DBR I;  3Q8F A;  2MLB A;  3AE8 B;  4ANU A;  2BYF A;  3VTU A;  3A9J B;  2QJL A;  4KIK A;  2PKO A;  4GDL B;  1SIJ A;  2KDE B;  1WGD A;  1TZO A;  4XDC A;  3DOW A;  4M02 A;  2HD5 B;  4OVU A;  2KTR B;  4WJN A;  1C4C A;  3AH7 A;  4HVB A;  2GLS A;  2KJR A;  1NEK B;  4JPS A;  4KGS A;  3NY5 A;  3ZKJ C;  3DBS A;  3PLU A;  2JQR B;  2MRP A;  2XN9 C;  2ZPN A;  1H8C A;  1GJZ A;  4RM9 A;  3R8B A;  4AS1 A;  1PQS A;  3RNC C;  2LGI A;  4IW0 A;  5D94 A;  1EU3 A;  3ZNI D;  1WZ0 A;  2DYB A;  4KSK C;  2AEH A;  4ZRQ A;  1FNU A;  2LGD A;  2IO1 B;  1FRR A;  1QZE A;  2WGS A;  2KN4 A;  3RZF A;  2N9L A;  2WXH A;  3RT3 B;  1MHX A;  2LAS A;  1E8X A;  3VTW A;  2N0S B;  3B2G A;  1M4V A;  2N9E B;  1J0G A;  4G3X B;  2XBB C;  4E74 A;  3P4R B;  1C78 A;  1Z5S B;  3KYC D;  4GOC A;  4IOI E;  3RI7 C;  1SGH A;  2FUH B;  1P1A A;  2KXJ A;  4USA A;  3HUI A;  2LZ6 A;  1YX6 B;  1UGM A;  4NQK E;  4K7W A;  1R7S A;  1V5T A;  3P4P B;  4WUR A;  1TTN A;  2KT7 A;  1YX5 B;  1H4R A;  2WDR B;  2QHO A;  2RDG A;  1C9F A;  2DLB A;  3VAW A;  2SEB D;  1PDX A;  2MW5 A;  2V1Y A;  3W1S C;  2N9K A;  4NAW B;  2KDI A;  1E0Z A;  1XLQ A;  3H8H A;  4HXD A;  2BPS A;  3RFZ B;  1F0Z A;  3A33 B;  3QC8 B;  1TY2 A;  3QHT A;  2VH1 A;  2MP2 B;  3T8M A;  2K8C A;  1K8R B;  3L13 A;  5BYR A;  1XF5 L;  5AUK A;  3U7D A;  2N9X A;  3JW0 X;  4B6W A;  3BY4 B;  3BYT B;  4XGA B;  4B0E A;  3CIR B;  3ETR A;  1C3T A;  2D5G A;  2NBU A;  4WJQ A;  3IHP C;  2FCM A;  1KM7 A;  4HLE A;  4G0N B;  5H8Y E;  3ZTD A;  3GS2 A;  1BXT A;  2JF5 A;  3A4S C;  5AEK B;  5CTR C;  3KUZ A;  1L4D B;  3P4S B;  4WH4 A;  2DZM A;  4WQM A;  2RPQ A;  2BKR B;  3P63 A;  2GRI A;  1V97 A;  2KFK B;  5AZG A;  1NVI D;  5IA7 A;  2PIA A;  1FM0 D;  1ZDX A;  2MQJ A;  3RNG C;  3TUO A;  5IOI A;  3IVF A;  3PZ8 A;  1IBX A;  4KDL B;  5AZF A;  2J42 A;  2IO2 B;  2IZV B;  1TZ1 A;  1JRU A;  4FJZ A;  4M8M A;  4M8N A;  3JVZ X;  1UUP A;  1QIL A;  4HPM B;  3ZQ4 A;  2M1M A;  1L7Y A;  2IO0 B;  3P1M A;  1WMH B;  3KQ4 A;  2X38 A;  3VDZ A;  3C19 A;  1SB3 C;  1E6E B;  4W9L A;  4C4V A;  3RNB C;  2ZW0 A;  3U4E G;  5E6O A;  4DBG A;  2MCN B;  3OLM D;  2QC8 A;  2KLC A;  2OED A;  3ZRF A;  2QMT A;  2MA9 B;  1Q1O A;  2DZJ A;  1HZ5 A;  3QX1 A;  2N7D A;  2KJ6 A;  3GZN I;  2MEK A;  3RNE C;  3AXC A;  4ZHO A;  3AV8 A;  3K9O B;  2J4X A;  2LEK A;  4F7Z A;  1NDD A;  1WI0 A;  1TS5 A;  3MP9 A;  3DBL I;  1FD6 A;  1ET6 A;  2VRR B;  1FCC C;  1D5Z C;  1QOB A;  2IY0 B;  1P3Q U;  2JU6 X;  4ICV A;  2LVP A;  3P42 A;  1WZ3 A;  2JYE A;  2I2Y A;  3MJW A;  2LUE A;  2L8J A;  3JYU A;  2G45 B;  1SE4 A;  2PPH A;  3DBH B;  2IJ0 A;  4P1B C;  2JPH A;  3IT6 B;  3M95 A;  1C1Y B;  3TCA A;  2BYE A;  1JW9 D;  1Z2M A;  3NVZ A;  3W1S A;  4EZK A;  4RF1 A;  5BMG A;  3UI3 A;  4MT5 A;  1UNS A;  4IDI A;  1V80 A;  3PRP B;  2MWS B;  4A3P A;  1SJH D;  4A90 A;  1RLF A;  1J7A A;  1WXM A;  2R2O A;  1JML A;  3B08 A;  3QWZ B;  3HHM A;  1T3Q A;  4HJG E;  3K9P B;  1WXA A;  4PYU A;  1KLG D;  3EC8 A;  2V3S A;  3N1X C;  2PW9 A;  2IDY A;  2HJ8 A;  2K6Q A;  3FIL B;  5IO9 A;  2BF8 B;  4DHZ E;  2WXG A;  1JWB D;  4PK1 A;  2Y3A A;  1WGH A;  4BBN F;  1OQY A;  4TQ0 A;  1WY8 A;  2AX5 A;  1EWY C;  5DPT A;  4X57 B;  2I1J A;  1RFK A;  3UIO B;  5C23 A;  2KDB A;  3EA6 A;  3BK2 A;  1JRO A;  1U4A A;  5LNK 1;  4DDI D;  4MH8 A;  1KLU D;  3CST A;  1L0V B;  1XO3 A;  1CQV A;  2WXQ A;  1V1P A;  2PE6 B;  1C4A A;  4LNI A;  2KX0 A;  1OEY A;  3AE9 B;  3O13 A;  3Q3M C;  4BAX A;  4EZL A;  2INP E;  2GBK A;  2OOB B;  3GE8 C;  5FR6 A;  2NBW B;  1F1H A;  3VH4 B;  4HDQ A;  1Y56 A;  3CF6 E;  1NBF C;  2ZCB A;  1YQB A;  2L05 A;  1ZE3 D;  1N60 A;  4CQN A;  4AUQ C;  4YWG G;  1RWS A;  2KQ7 A;  3ZJV A;  1J19 A;  3LYY A;  1YJJ A;  2LMC A;  1V9J A;  4IWQ A;  4ITK A;  4DK5 A;  4DQO C;  4W9D A;  1V1O A;  3NOB A;  3AI5 A;  4WAF A;  4GSW A;  2CU1 A;  1HQR D;  2NPT B;  4O1N A;  4TSS A;  4DHZ B;  1D6E C;  2K39 A;  2V0G A;  1TBE A;  1FXA A;  1HZ6 A;  4MJS B;  2C7N B;  2KWD A;  4ZYS A;  1WE7 A;  5L95 C;  1SE9 A;  5G5G A;  3IAS 1;  3URY A;  3Q3J A;  2D3C A;  3MHS D;  2EMS A;  4ZYN A;  4TQ1 A;  3BVG A;  4OW0 A;  4LNK A;  2WYQ A;  5IKC M;  2YEP F;  2LUM A;  2PMV A;  3SU8 X;  2MBB B;  2V3P A;  3EEC A;  1LXD A;  2NPT A;  4A9A A;  3PHX B;  4W9E A;  3SFD B;  4YSY B;  5J2R A;  2KQS A;  4RGN A;  1SE2 A;  2EEL A;  1FRD A;  4S17 A;  3SEB A;  1D4B A;  3DPD A;  2KMC A;  3ENE A;  5JZE B;  2MHJ A;  3A1Q A;  3VQI A;  1EM7 A;  2O6V B;  1ENF A;  2IND C;  2VH2 A;  1YNT E;  2UWQ A;  4B95 A;  1NYQ A;  1I42 A;  4KZ0 A;  4LNN A;  1R4N B;  3LB8 C;  2WNM A;  2NTT A;  1MG4 A;  3UIN B;  1N5X A;  1N61 A;  2KWV B;  4P6V F;  2M0X A;  3VR9 B;  2KAJ A;  2FBW B;  1WGK A;  3VH3 B;  4ZRP A;  1T0Q C;  5KHQ A;  2ZCC A;  2D3G A;  3I9V 1;  2D11 A;  4NNJ B;  2UYZ B;  3ZNZ B;  3Q8A A;  2J0K A;  2JVC A;  4S0R A;  4DXG A;  3KYD D;  4KIK B;  2UU7 A;  1GC6 A;  1XXG A;  3ZVV A;  1KTK A;  3Q8B A;  5CHV C;  3A4R A;  4KGT A;  3DCG A;  1F52 A;  1RAX A;  4H2A A;  1FXT B;  3R7R A;  1X1M A;  2J0J A;  2KX3 A;  1CMX B;  5IN7 A;  3B2F A;  2RDB C;  2ZEQ A;  3EUB 2;  3AEC B;  2MJ3 A;  2FCQ A;  3BVM A;  3ZGZ A;  1I4R A;  3EHV A;  1LQB A;  2WU2 B;  5T8I A;  1T5X D;  3X0W A;  3KUC B;  1E7P B;  2LVQ A;  1D3Z A;  4GB9 A;  1WRI A;  1UGJ A;  1FEH A;  1TS4 A;  4GMV A;  4RGM A;  2HE7 A;  5C3J B;  1WXV A;  2HDE A;  5G55 A;  3ZXR A;  4G11 A;  1WGY A;  4WIP A;  4P16 A;  1KH0 A;  2VZK D;  2KLG A;  2YEP B;  2WXL A;  1ISN A;  3W9C B;  1C4P A;  2KC2 A;  3ZW3 A;  1FPY A;  3B1L X;  1GG3 A;  2WX1 A;  1CK1 A;  1UH6 A;  4HPL B;  3TBL D;  3GP7 A;  2LFI A;  2IO3 B;  2L0F A;  4MGY E;  3ZJU A;  1YN3 A;  1K52 A;  2PJH A;  5BO4 B;  3IT4 B;  2M56 B;  4ICU A;  1TKE A;  3VFK A;  3IBE A;  1Y8R C;  4ARC A;  4MSM B;  4ACF A;  1JWS D;  2RD0 A;  3S2A A;  3DVG Y;  3N1Z C;  3AUL A;  3TEY A;  2KQ4 X;  2IGG A;  2BKF A;  1I4Q A;  2DYO A;  2KC1 A;  2ZZP B;  1WR1 A;  4GDK A;  3WAP A;  1E7V A;  4A8X C;  5HHD G;  4BOS C;  1I35 A;  2G4D B;  2ICI A;  4FHK A;  3RZW C;  4LLG M;  3GE3 C;  3AEG B;  3TEX A;  1QLB B;  2MBO A;  4FHJ A;  2O2V A;  4NZL B;  3NRZ A;  1QOG A;  2ZJD A;  4RMA A;  3TEZ A;  2LD9 A;  1MI0 A;  1WM3 A;  1V5O A;  2LI5 A;  1TT5 B;  2WQY B;  3UF8 A;  3GB1 A;  1C79 A;  1TS3 A;  1T0S C;  2EKE C;  3NVW A;  4AOF A;  1VLB A;  5TR5 A;  2K9X A;  4RF0 A;  2ZW1 A;  5E6N A;  2AQ1 B;  3N20 C;  3N1Y C;  4JWS C;  4XE0 A;  2LRU A;  3AU4 A;  2DNF A;  1NEN B;  4L23 A;  2BWF A;  2M4N A;  2ZVN A;  1F2R I;  1HE8 A;  4HJK A;  1B9R A;  2REX A;  4WJP A;  4LNO A;  3WIM A;  3V60 A;  2JSV X;  4K7U A;  1TY0 A;  5C2T B;  3DHG C;  4OVZ A;  1JAL A;  1E8Z A;  5D6J B;  3MC8 A;  2J53 A;  4US8 A;  3NVY A;  3N9Y C;  4N9F 4;  4I6P A;  3KH0 A;  3MFG A;  1IBX B;  2E6X A;  2V4L A;  3BZD B;  4HCP B;  1E8Y A;  2MJE A;  1ACC A;  2AL3 A;  2L76 A;  4DHJ B;  2G4S A;  5IAA C;  4LDT B;  1EWC A;  3L10 B;  5HG2 A;  2JWU A;  3PLV A;  4AJY B;  4G50 A;  1WJU A;  3KWL A;  2K5P A;  1WX7 A;  1YQ4 B;  3KVF B;  4C4V B;  4C00 A;  4NJ7 A;  2NCN A;  4J3O D;  1VJK A;  2LGY A;  3I57 A;  3T9L A;  3KLS X;  1DYQ A;  3QK0 A;  2GBM A;  2JRH A;  5DCN A;  3ZJT A;  2WP9 B;  4W9C A;  4LJO B;  1WXQ A;  4I6N B;  4JE3 B;  4KDI C;  2KAC A;  3PGE A;  4GXB A;  4WJO A;  4LJP B;  4FN2 A;  3TL5 A;  3DHI C;  4MDK E;  1T6B X;  1WX9 A;  2KJH B;  2KDM A;  3QCA A;  5E6P A;  2KWU B;  1WJ6 A;  2BGF A;  2W9N A;  2AQ3 B;  4W9H A;  5HI1 A;  2DBY A;  3AE6 B;  4FLH A;  1MG8 A;  2ZNV C;  1P0R A;  4DWF A;  2KO3 A;  1LO5 D;  3AMZ A;  1V86 A;  1WRD B;  1JWU D;  3NS8 A;  1HA5 A;  2GB1 A;  1YN5 A;  1V2Y A;  4K3B A;  3RYT A;  5FK9 C;  3DBL B;  4B9K A;  3KUD B;  4IC7 B;  3W2D A;  3RUL A;  2AWT A;  1S1Q B;  1DOX A;  1V49 A;  2KVZ A;  1IUE A;  4XWW A;  2GOW A;  3E56 A;  3N3K B;  3N30 A;  1L0X B;  3UQA A;  3H6N A;  3OG5 A;  1WGR A;  3AE3 B;  2DX5 B;  3ZYY X;  2ACZ B;  1HTQ A;  3VR8 B;  3HVZ A;  3FKY A;  2W54 A;  2OJR A;  2W3R A;  5MPO A;  3MC0 B;  5HKH A;  2M17 A;  1N62 A;  1XLP A;  1T0Y A;  5H92 C;  5GMV A;  2EKI A;  2LHE A;  3Q3N C;  4OZB A;  3VVW B;  1OQQ A; 
#chains in the Genus database with same CATH homology
 2BB5 A;  4N6E B;  2J52 A;  1HQR D;  2Y5C A;  4O1N A;  1SSN A;  4TSS A;  1D6E C;  4N58 A;  2INN E;  3Q8F A;  1I7H A;  3AE8 B;  2V0G A;  1FXA A;  1HZ6 A;  2QJL A;  2CJN A;  3MHZ A;  2KWD A;  2PKO A;  4GDL B;  1SIJ A;  3LXF A;  4ZYS A;  1JCK B;  1NYR A;  4HEA 1;  1I4P A;  4LK0 M;  2WXF A;  1PUT A;  1TZO A;  1I4G A;  5G5G A;  4XDC A;  4YSX B;  4DXF A;  3IAS 1;  3URY A;  2WDV B;  2WXI A;  2DWQ A;  2IGH A;  1ET9 A;  1A70 A;  1C4C A;  1QT9 A;  3AH7 A;  5EE1 A;  4TQ1 A;  3BVG A;  4OW0 A;  2W3S A;  1NEK B;  1WYG A;  4JPS A;  4KGS A;  5EE0 A;  5JXV A;  2YEP F;  3AE5 B;  1VZ7 A;  2LUM A;  1N5W A;  2PMV A;  4C7Y A;  1PGB A;  4TMA B;  2V3P A;  1V1P B;  2JQR B;  2XN9 C;  2WU5 B;  1XCT L;  3R8B A;  1KF6 B;  5D3I B;  4A9A A;  2QIE B;  5D3D A;  4AS1 A;  3MJ5 A;  2LGI A;  3AEF B;  3L4P A;  4RGO S;  1EU3 A;  3WCQ A;  3SFD B;  2E3T A;  4YSY B;  4RGN A;  3IAM 1;  1SE2 A;  2EEL A;  1FRD A;  3AN1 A;  3SEB A;  3PO0 A;  1FFU A;  3BVZ A;  5BYS A;  1D4B A;  2WXR A;  2G9H D;  4L2Y A;  3VQI A;  4ZHP A;  4ZRQ A;  1EM7 A;  1JWA D;  1E9M A;  1FNU A;  1QOA A;  2WXP A;  1ENF A;  1OQR A;  2G1E A;  1FRR A;  1I4X A;  1YNT E;  4PT5 A;  2KN4 A;  1ZXH A;  3BK1 A;  5BMH A;  1GPX A;  1NYQ A;  2N9L A;  2WXH A;  3LB8 C;  1MHX A;  2WNM A;  2NTT A;  2MH7 A;  2N0S B;  3B2G A;  3HRD D;  1M4V A;  1N5X A;  4US9 A;  1N61 A;  1D5M C;  4P6V F;  1VR9 A;  4KKJ A;  4RGT A;  4HRS A;  1HEZ E;  3VR9 B;  1SF0 A;  2KAJ A;  2FBW B;  1MVK A;  1WGK A;  2B76 B;  3P4R B;  3W5U B;  2ONQ A;  4ZRP A;  1JWM D;  1L6V A;  4OHJ A;  1C78 A;  2ON8 A;  1J7B A;  4IOI E;  1PYW D;  3I9V 1;  1IGC A;  2JX5 A;  4USA A;  3HUI A;  3IXS A;  1ESF A;  1MHH E;  3VRA B;  1XCQ L;  3Q8A A;  1L4Z B;  3T3N A;  3VRB B;  2LHD A;  4DXG A;  3P4Q B;  3NZ3 A;  5TSS A;  1UWM A;  1FNW A;  3TEW A;  1R7S A;  3P4P B;  3U52 E;  4RFB A;  4WUR A;  1TS2 A;  1XXG A;  1KTK A;  3Q8B A;  2CJO A;  2WDR B;  4KGT A;  2H88 B;  2RDG A;  5HFY A;  3J9C A;  2SAK A;  1C9F A;  5BMI A;  1N63 A;  2DLB A;  4H2A A;  2SEB D;  1PDX A;  4FXC A;  2WLB A;  2N9K A;  4NAW B;  1PFD A;  1E0Z A;  1XLQ A;  3H8H A;  2L52 A;  3B2F A;  2WS3 B;  3RFZ B;  3AE2 B;  2IPK D;  1F0Z A;  3BYY B;  3EUB 2;  1TY2 A;  3AEC B;  1ZDV A;  2MJ3 A;  2W82 A;  3BVM A;  3ZGZ A;  1I4R A;  1YJI A;  4RNA A;  2WU2 B;  5BYR A;  1XF5 L;  5T8I A;  1T5X D;  5AUK A;  5D7G A;  4WWM A;  1K53 A;  5BYQ A;  1E7P B;  3R2T A;  1E10 A;  3CWI A;  2QEJ C;  3BYT B;  2CU3 A;  1WRI A;  4B0E A;  3CIR B;  3ETR A;  1UGJ A;  1SXT A;  2D5G A;  1FEH A;  2N7J A;  4B0M A;  1TS4 A;  2Z8L A;  4RGM A;  1TJE A;  3AED B;  5H8Y E;  4C7Z A;  5C3J B;  2Q5W D;  2HDE A;  3DWG C;  3GS2 A;  1SE3 A;  1STE A;  2R61 A;  2JXT A;  1WWT A;  1BXT A;  1MPE A;  3FAH A;  2L83 A;  4WIP A;  1FXI A;  2DYM A;  4HRO A;  1L4D B;  3P4S B;  4WH4 A;  4P16 A;  1AYF A;  1KH0 A;  1TYG B;  2VZK D;  2Y5P A;  2YEP B;  2WXL A;  3Q8C A;  4WQM A;  1C4P A;  4YTP B;  3W9C B;  3P63 A;  4KX6 B;  2GRI A;  3AM9 A;  1V97 A;  1SEB D;  3FC4 A;  1NVI D;  2GI9 A;  1CK1 A;  2PIA A;  3GP7 A;  1FM0 D;  2M19 A;  1ZDX A;  2LFI A;  3SFE B;  1V8C A;  1YN3 A;  3ZJU A;  1K52 A;  3TUO A;  3PZ8 A;  4M0W A;  1IBX A;  3V05 A;  2J42 A;  2OHF A;  3Q69 A;  3IT4 B;  2M56 B;  2NTS A;  4NJC A;  1YN4 A;  1I4H A;  1TKE A;  1UUP A;  1QIL A;  3ZQ4 A;  2JYT A;  4JX1 C;  1DOI A;  3BWU D;  5I4D A;  1RYJ A;  4ARC A;  3P1M A;  1HXY D;  1ROE A;  5EE9 A;  4REZ A;  1JWS D;  3KQ4 A;  1ZUD 2;  2X38 A;  1AN8 A;  5E6J A;  1VDV A;  1JRP A;  1SB3 C;  1E6E B;  3TEY A;  2KQ4 X;  1L5P A;  2IGG A;  1K51 A;  1I4Q A;  1YQ3 B;  2DYO A;  1EU4 A;  2PVG C;  4YTM B;  4Q2J A;  2ZW0 A;  3U4E G;  4A8X C;  1FNV A;  1TKY A;  5HHD G;  3V3X A;  2ICI A;  3FIL A;  4A55 A;  2OED A;  2QMT A;  4LLG M;  3AEG B;  1HZ5 A;  3TEX A;  3T3O A;  3U7Z A;  1QLB B;  4C56 C;  4NZL B;  3NRZ A;  1NI3 A;  1QOG A;  2MEK A;  3HVD A;  4JWU C;  3TEZ A;  2BT6 A;  2RPV A;  1MI0 A;  3R2I A;  3NVV A;  1D5X C;  5GXG B;  1GOZ A;  2WQY B;  4ZHO A;  3GB1 A;  1C79 A;  3AV8 A;  1TS3 A;  2J4X A;  3NVW A;  2LEK A;  1GB1 A;  1VZ8 A;  5AUI A;  1TS5 A;  2AQ2 B;  3MP9 A;  2QSD A;  1FD6 A;  1ET6 A;  1VLB A;  2NMQ A;  1FCC C;  1D5Z C;  2K9X A;  4HKZ E;  1QOB A;  2ZW1 A;  2AQ1 B;  3AE7 B;  4RF0 A;  1TKG A;  4HKQ A;  1F2R C;  4KGR A;  2K22 A;  2V3N A;  4JWS C;  3AE1 B;  3C8Y A;  2JU6 X;  4XE0 A;  1ZXI A;  3P42 A;  1UWX A;  1NEN B;  2JYE A;  4L23 A;  4D2K A;  2I2Y A;  1F2R I;  1VZ6 A;  1B9R A;  2BBC A;  1YMH E;  2JSV X;  2V4I B;  1SE4 A;  1TY0 A;  5C2T B;  4KKI A;  4OVZ A;  1JAL A;  2IJ0 A;  3IT6 B;  1WSP A;  4MAC A;  2J53 A;  4US8 A;  2WXK A;  3NVY A;  3AEA B;  1ZP0 B;  1JW9 D;  3N9Y C;  4LTU A;  2L32 A;  3MFG A;  3U2S C;  3B9J A;  1IBX B;  3NVZ A;  2HTM E;  2E6X A;  3W1S A;  3BZD B;  1BUI C;  1GAQ B;  4RF1 A;  5EE3 A;  5BMG A;  2RDH A;  5FKA C;  3UI3 A;  2MJE A;  1ACC A;  4MT5 A;  1UNS A;  4C80 A;  4IDI A;  4NAM A;  3AEE B;  2BS3 B;  4L1B A;  1EWC A;  2KMM A;  5HG2 A;  1RM6 C;  1XLN A;  2XNA C;  4XDD A;  2TSS A;  3RPF C;  5FR3 A;  1SJH D;  2JWU A;  4A90 A;  1J7A A;  3KWL A;  1PGX A;  2K5P A;  1YQ4 B;  1JML A;  2BB6 A;  1T3Q A;  1CJE A;  4RCO A;  2VZK B;  1QKZ A;  4YSZ B;  2IGD A;  4ARI A;  4HJG E;  1DGJ A;  1AWD A;  2W55 A;  4GDK B;  4J3O D;  1VRA B;  1VJK A;  3I57 A;  5G5H A;  3KLS X;  1DYQ A;  1KLG D;  2M0A A;  1FFV A;  2PW9 A;  2IDY A;  3FIL B;  1P7E A;  1Q10 A;  1SBB B;  1XEE A;  3ZJT A;  2WP9 B;  2WXG A;  1WXQ A;  1JWB D;  2WXN A;  1KFY B;  4JE3 B;  2KAC A;  2Y3A A;  2FE8 A;  2BYT A;  4TQ0 A;  2AX5 A;  1EWY C;  2WXM A;  4MM3 B;  2I38 A;  2PLP A;  1KRH A;  1RFK A;  1T6B X;  1P7F A;  1JQ4 A;  1XLO A;  2KDM A;  3EA6 A;  1L6U A;  2PTL A;  3DWM A;  3BII D;  1F77 A;  3NUH B;  3SR6 A;  4AQ7 A;  2AQ3 B;  4YT0 B;  3BK2 A;  3E9S A;  5HI1 A;  1JRO A;  1ZPS A;  2DBY A;  3AE6 B;  5LNK 1;  4MH8 A;  3PZ7 A;  3OWE B;  4IKG A;  1SJE D;  1LO5 D;  2BS4 B;  2H89 B;  2RMM A;  3AE4 B;  3AMZ A;  1KLU D;  1L0V B;  1XO3 A;  1JWU D;  1CQV A;  2K3U A;  3TSS A;  2WXQ A;  1HA5 A;  2GB1 A;  1V1P A;  1YN5 A;  4A6Q A;  1FIQ A;  1B1Z A;  1AW7 A;  1DOY A;  4OZA A;  5FK9 C;  3EGR A;  1C4A A;  1OFF A;  3ABV B;  2WXJ A;  3AE9 B;  2BS2 B;  2BW2 A;  3W5V B;  3O13 A;  3W2D A;  2INP E;  1DOX A;  4EE2 A;  1FMA D;  1FCL A;  1IUE A;  4GLS C;  4XWW A;  1L0Y B;  4ZOH C;  3Q8E A;  3E56 A;  1BML C;  1L0X B;  3NS1 A;  1Y56 A;  3AE3 B;  1GB4 A;  1QOF A;  2QIL A;  1PGA A;  3ZYY X;  1J7C A;  2ACZ B;  4R3D A;  1ZE3 D;  1QQR A;  3VR8 B;  1C77 A;  3AB5 A;  3HVZ A;  1N60 A;  4CQN A;  3AEB B;  2K0P A;  4UDU C;  4YTN B;  2W54 A;  2L1A A;  4OZC A;  2W3R A;  4YWG G;  2WDQ B;  1RWS A;  5MPO A;  1IGD A;  3MC0 B;  1C76 A;  1N62 A;  1ZOY B;  3ZJV A;  3LYY A;  2WXO A;  1K50 A;  2BTE A;  2MJD A;  4YXD B;  1YJJ A;  2LMC A;  1XLP A;  1FO4 A;  5H92 C;  3KWV A;  1QF6 A;  4XWT A;  4ITK A;  4N59 A;  2JZP A;  4DQO C;  1CZP A;  2FUG 1;  4RH6 A;  2PVO D;  1V1O A;  2EKI A;  2LJI A;  2LHE A;  4OZB A;  4WAF A;  1OQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...