1MHXA

Crystal structures of the redesigned protein g variant nug1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MHHHHHHAMDTYKLFIVIGDRVVVVTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAAKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin-binding protein G
publication title Crystal structures and increased stabilization of the protein G variants with switched folding pathways NuG1 and NuG2
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhxA00
1HZ5A 2KWDA 2ZW0A 2J53A 1D4BA 5BMHA 1YNTE 1KH0A 1EM7A 1MHHE 2IGHA 1P7EA 2JSVX 5JXVA 2PLPA 1QKZA 1PGAA 2LGIA 1K52A 1K53A 2QMTA 4IKGA 2PW9A 1FD6A 2N9LA 4IOIE 5BMGA 1HEZE 2PTLA 2LHDA 1F2RI 4D2KA 4OZCA 1JMLA 1XF5L 1MI0A 2GI9A 2KDMA 4OZBA 1MHXA 4WH4A 2GB1A 1IBXB 5HG2A 2NMQA 2JXTA 2EELA 1K51A 1ZXHA 1FCCC 1P7FA 2LHEA 1FCLA 2JZPA 2ONQA 1PGBA 3MP9A 1GB4A 2KN4A 2QSDA 5HFYA 2IGGA 1XCQL 5BMIA 2JWUA 1IGDA 4OZAA 3V3XA 4GLSC 1UWXA 2IGDA 2J52A 2N9KA 2RPVA 2ON8A 4KGRA 1IBXA 2RMMA 1F2RC 2K0PA 3FILB 4HJGE 1YMHE 3FILA 4KGSA 1MVKA 5HHDG 2KACA 2I2YA 1Q10A 1C9FA 4MACA 2OEDA 1HZ6A 2ZW1A 1PGXA 5HI1A 1K50A 2I38A 2LUMA 1MPEA 1GB1A 2KQ4X 2N7JA 1IGCA 1XCTL 4HKZE 3UI3A 3GB1A 2JU6X 4KGTA
chains in the Genus database with same CATH superfamily
1WE6A 2D10A 4W9FA 4KZCA 2BS3B 3IBEA 4XYCA 4MDKE 1ZE3D 1WXVA 3V6CB 5C1ZA 2N7DA 2XK5B 1AARA 3Q3JA 4L23A 3ZTCA 2KWVB 3EA6A 2BGFA 3SU8X 3BVMA 2KJ6A 2I1JA 1WM3A 3BY4B 2WQYB 3ETRA 2KVZA 1LGRA 1XT9B 3ZYYX 1P1AA 3I3TB 2VZKB 1HE8A 2N9PC 2QEJC 5EE9A 3QQ8B 3M62B 3A9KA 5CHFA 4ZDVA 3R7QA 3SDLC 4C7ZA 1HTQA 2V3PA 3E56A 3TIXA 2M8SA 2AQ1B 2Y5CA 3EECA 1C77A 1L4DB 2KD0A 4A20A 4BOSC 2KYWA 3KYCD 2KN4A 3MTNB 5TR5A 3C19A 2QSDA 4M00A 3MFGA 1HTOA 2IGGA 3W1SC 4OZAA 1AW7A 1NENB 2GOWA 4A3PA 3Q8AA 4GOCA 1UZXB 3GE8C 3Q6BA 3W1YA 4YTMB 4GDLA 4JWSC 4ICVA 3A1QA 3AULA 2WS3B 1WZ3A 4NJ7A 2BS2B 4LNKA 5I4DA 2MBQA 2A5UA 4O1NA 3ZXRA 2LGSA 5LXIB 3JSVB 1VDVA 4RF0A 5IA7A 3NRZA 4A6QA 1D4BA 2DZMA 3PZDA 3PO0A 2V0GA 3H7SA 2JYEA 3JYUA 1PGAA 1ZPSA 2N1WA 2ZJDA 1FD6A 5AEKB 1GPXA 2LHDA 1OQQA 4C4VB 4TQ1A 2JPHA 2M56B 4S17A 4OZCA 1WXQA 2GBMA 3RNGC 1ZP0B 2KDMA 3OAWA 1RWSA 1HA5A 2KLGA 2MWSB 4MH0E 2LVPA 3HM3A 3BINA 2MQJA 1WGYA 3CSTA 2D3AA 4MSMB 5LLIA 4NAWB 3RT3B 3OLMD 4IM3A 5BO4B 4JL9A 3L10B 3GE3C 1E90A 4FXCA 4ZOHC 1M94A 5T8IA 4XDDA 3RUIB 3TEZA 1UWXA 3NVVA 1GOZA 1TY2A 1TKYA 2J52A 1JROA 2ON8A 3FAHA 5BYQA 2M17A 1JWSD 1UELA 4DXGA 1WJ4A 2MSED 3FILA 2KACA 3T9LA 2B3AA 5CHWA 2MX2A 2FIFA 1JWBD 4ZRPA 2HTME 1A5RA 3B0AA 1XXGA 3QA8A 1Y56A 4REZA 3OWEB 1TKGA 3ZW3A 3H9DA 4RF1A 3Q3MC 1T0QC 2DLBA 2WDVB 2WXLA 3HVZA 4CQNA 2LGXA 2KTFA 2IY1B 1I4HA 1Y8RC 1FEHA 1DOYA 4XZ4A 3HM6X 1L4ZB 4GIVA 4GDKA 4PK1A 4TMAB 3H7PB 4URKA 3ZJTA 1V86A 4WIPA 3T3NA 2RR9A 3W9CB 3IAM1 3AM9A 2ACZB 3QJZA 2KOXA 2K8CA 2KWUB 1E8XA 4R3DA 4PYUA 3FC4A 3CWIA 2QC8A 1EO6A 4W9JA 2UYZB 2L0FA 3AXCA 2GI9A 4WH4A 1WYGA 4AQ7A 2K9XA 1C3TA 1OEYJ 2J0KA 2NMQA 5C3JB 4KDIC 1I4PA 2WWZA 2V4IB 3PVLA 1YX6B 3MP9A 2DZIA 3OJ3A 3V61A 2WXMA 2D11A 4OVUA 1P9DU 4IUMB 2JT4B 5HFYA 2GBJA 2L52A 3MHZA 3VAWA 3DBSA 1Q0WB 4FJZA 3NZUA 2VH1A 3RNFC 3VUWA 2EMTA 3R2TA 4KKJA 3AE5B 1VJKA 2NPTA 5AUIA 1QT9A 4GN1A 3VHTC 2OEDA 4TUUA 4MGYE 2I38A 1SJHD 2KJRA 3HVDA 5AZGA 4GSWA 1MPEA 3ONSA 2KDFB 3N30A 1RFAA 2PKOA 2KVRA 1KLUD 2JYTA 1EWYC 1EF5A 4ANVA 1N63A 2BB6A 3O13A 1UF0A 1YIWA 2KMMA 2KJHB 2LRUA 2CJNA 4HCPB 3RNEC 5G5HA 5EE0A 2MCNB 4N58A 4FN2A 1KLVA 3Q3NC 1WMHB 4FJYA 4IG7B 3Q8FA 2WP9B 1OEYA 2N9LA 3GOEA 1L6UA 1C4PA 2NBWB 2MP2A 3ZQ4A 2JY6A 4DBGA 4JE3B 2KFKA 2K25A 1P0RA 1WY8A 4II3B 1JMLA 2FUHB 4KSLC 4AUQC 3AEGB 3AH7A 1YD8U 2FCMA 2KDBA 3AN1A 1WXSA 2EELA 5G5GA 2IO0B 3L54A 4YSZB 3RNAC 1PQSA 4AJWA 3Q8BA 1FNVA 4FHJA 3IXSA 2WDQB 4BKSD 2WXOA 5DPSA 2VH2A 4ZHOA 1P98A 2BT6A 3PREA 5IOIA 3AMZA 3KYDD 4K81A 3KUCB 2N9EB 2QJLA 1WM2A 4XE0A 1TS4A 3QX1A 2Z59B 3QC8B 4GU2A 3ECIA 2I2YA 4MM3A 1QOGA 3TUOA 1F52A 4WAFA 2LUMA 1KJTA 1BUIC 2ZEQA 3MC8A 3PRPB 1TBEA 2WXRA 4FLHA 3N1ZC 4HEA1 4DXAB 4HKZE 4HPMB 2W3SA 4KDLB 5JH5C 1KFYB 2GMIC 1SJED 1E8ZA 3U7DA 2W54A 3X23A 2K6DB 2KN5A 5LNK1 2IGHA 2DBYA 3OJ4B 1G6JA 1WX8A 4OW0A 2KAJA 3RN9C 3T8MA 4AWJA 4EEWA 3AE6B 1X1MA 2UWQA 3HK0A 3PPAA 4DDGD 2RDGA 4J6IA 1JQ4A 1PFDA 3HRDD 4YSYB 2AQ2B 2ICIA 2G1EA 4DHZE 4M0WA 4XWTA 4ZRKA 1UNSA 3KWVA 1WJNA 2KLCA 4ZRJA 3TCAA 3P63A 5GXGB 2PE9A 3ZXVA 3EGRA 1L0VB 4LCDE 1B1ZA 2R2OA 4US8A 1TZOA 1GB4A 3DDCB 1GNUA 1NEKB 2C60A 1TTNA 4N6EB 3M95A 4DHZB 2IPKD 4BAXA 1VD2A 2LD9A 2DZKA 1CJEA 3V60A 2BB5A 4TKNA 3GS2A 2YEPF 4RNAA 3PHWB 3ZGZA 3PT2B 1Z5SB 2FBWB 2C5LC 4FJVB 4ZYSA 2G4SA 4EE2A 1WJUA 2INNE 2MBHA 2DYMA 1V81A 1JW9D 1RM6C 3I5JC 3PV1A 4ZRIA 3KVFB 4C80A 1RRBA 2BYTA 3N20C 1RLFA 1EU3A 2L1AA 1FO4A 2J42A 4XWWA 4RFBA 1F1HA 3PS6A 3W5VB 1D5ZC 2JWZA 3QAQA 1ROEA 1EM7A 3BWUD 3A9KB 4ICUA 3WANA 3AE2B 1ACCA 3ML9A 1EWCA 1LO5D 2E3TA 5D7GA 4K7SA 3EUB2 2WDTB 1V1PA 1JWAD 4IWOA 1D6EC 1WR6E 2KXJA 1MHXA 1E9MA 2KK8A 3LYYA 2KDIA 1ZDXA 2MHJA 2SAKA 2DENB 3QARA 2ASQA 2INDC 3IG3A 2IJ0A 3T3OA 3A4RA 2BVCA 3V05A 3EHVA 2ZCBA 3RCZA 2LMCA 4A8XC 4ARIA 2GLSA 2KMCA 1C4CA 4CO7A 2BYFA 3FKYA 1IBXA 1WXAA 5D6JB 2K6QA 2D3GA 3BVGA 5BYSA 3HIZA 3PLVA 1HZ6A 3DBHI 3WCQA 2NBVB 3Q8CA 3BK2A 2KQ4X 2BS4B 3GZNI 1E7PB 1HQRD 1XCTL 3ALBA 2R2QA 4NQLB 1WI0A 2JU6X 1V49A 2LXCA 3EFCA 3U8ZA 5BMHA 3U2SC 3APDA 3S2AA 1NI3A 2XNAC 4W9IA 2O2VA 1UWMA 5D3DA 3DBHB 2V9HA 3KH0A 3Q3OC 1IP9A 1I7HA 3V62A 1KLGD 2WHIA 3GZNB 2XK5A 1RYJA 2JZ3B 4ANXA 1KRHA 2O6VD 1TIFA 2PW9A 4BOZB 2K5PA 4WJQA 5J2RA 2B76B 2G4DB 3NVWA 3RD2A 4I6NB 4HROA 4WJOA 4USAA 3N1XC 1WRDB 1WX7A 5D2MB 4RCOA 5HG2A 4PT5A 2W3RA 2D2QA 2YVCA 4FULA 4IW0A 1SE4A 2DAJA 3AU5A 2FNJB 2O6VA 1FFUA 2INCC 3AE1B 2M1MA 1E0ZA 2PVGC 2G3QB 2M0XA 1KM7A 3AI5A 3P2BA 3V3XA 1L7YA 2KHWB 1CMXB 2AL3A 4K3BA 1GG3A 4KGRA 3IT6B 4AJYB 2WDRB 3UGBB 2LWPA 3ZO5B 3VTVA 3ZLZA 4GDKB 4EZKA 3APCA 3ENEA 3L17A 2SEBD 5AUKA 2K8BA 3ZJUA 3TEXA 3PZ8A 3JSVA 2MBBB 1KF6B 4BKGA 3PGEA 1BXTA 3Q14C 3Q2AC 3U7ZA 1FPYA 4FBJB 4WJPA 1WH3A 2JZZA 1NYRA 1NVID 3Q8EA 4B9KA 1K52A 4ANWA 1K53A 3N3KB 2FE8A 4HWIB 3AE3B 5FK9C 2ZPNA 2WXJA 3R8BA 4HJKA 5CX3A 2AWTA 1UGMA 1XF5L 2ZVOA 4LDTD 3NZ3A 3ZDTA 2CU3A 2KTRB 2CJOA 2QHOA 3IAS1 2ZPYA 2WXGA 2KFJA 1NDDA 2NPTB 4K7UA 3P4RB 1Z2MA 3KUZA 4E71A 4YWGG 1UUPA 4C7YA 4B6WA 5MPOA 1V5TA 3QCAA 2TSSA 1PUTA 4TQ0A 2D07B 3TEYA 2AL6A 1HXYD 4FADA 3UINB 3KQ4A 4ARCA 3ZNGC 1VLBA 2C7MB 1V6EA 1C79A 3B1LX 2J0JA 2FCSA 2OOBB 2KT7A 4C00A 1L2NA 2HDEA 1FNUA 3Q69A 1L0XB 1GB1A 4P6VF 2KQ7A 3GP7A 3NS8A 5AZFA 1ENFA 2MBOA 4YTPB 3RI7C 4ACFA 4LNFA 1E8WA 2WX0A 3ZTDA 3AEAB 2REXA 2KFKB 4M8NA 2V3SA 1YN5A 1NYQA 1KH0A 4G3XB 1T0SC 2HD5B 2KX3A 1AN8A 1GC6A 4KSKC 2JSVX 1I4XA 3SR6A 4DHJD 1N5XA 2LGIA 5C2TB 1XO3A 3L13A 2JF5A 1WWTA 4XX5A 3H6NA 3ZKJC 2WNMA 2KZRA 3SHQA 4KX6B 2MW5A 2BKRB 3E9SA 3VTWA 1EU4A 4RM9A 5AZHA 1KOTA 3BVZA 3KUDB 3R2IA 5HKHA 1I4GA 1VCBA 4MGZE 1ESFA 5H92C 1XEEA 1YQBA 3C8YA 3DQVA 4NQKE 2YEPB 2WXIA 2FIDA 3MC0B 4NZLB 4NAMA 4MM3B 1FM0D 1FXIA 2K8HA 1YQ4B 2JQRB 3NVZA 3IT4B 1I35A 2IZVB 1OQRA 3KLSX 1ET9A 2QIEB 1YJIA 3JW0X 1E10A 2RPVA 2IBIB 1SGHA 1OQYA 4F7ZA 2LJIA 3OG5A 3KWLA 1SE9A 2Z0EB 1R7SA 2K39A 4X57B 1MVKA 1SSNA 1RFKA 2ZW1A 1C1YB 1CK1A 1FIQA 1K50A 2K3UA 1YJJA 4CYEA 5D3IB 3L4PA 4J3OD 2DYOA 1DOIA 3ZNZB 3K9PB 3PTFC 4PYZA 4DQOC 1L0YB 3RNCC 5IKCM 3WAOA 2RDBC 4HPPA 1MFWA 3AEFB 2HE7A 1HZ5A 4DK5A 1WFYA 4JLCA 3VR9B 4LNOA 4WJNA 2CR5A 3V6EB 1YOVB 2DZJA 2CS4A 2LVQA 4NPNA 1WMHA 1Q1OA 1WGRA 2JX5A 5GMVA 4G50A 4W9LA 1HEZE 2MEKA 4HXDA 4HDOA 4ZYNA 1WGHA 2CHXA 4LTUA 2KMAA 4FA6A 1EF1A 3MJ5A 5L95C 2NBUA 3N1YC 2N4FA 4UDUC 2INPE 4OZBA 2LEKA 5E6OA 3AV8A 2GB1A 4HRSA 1P7FA 3CF6E 1SIJA 1STEA 4MGKE 4MEMA 3O65B 2KO3A 2QCZA 3RZWC 4EKUA 5JHAA 1R4MI 3J9CA 3BYTB 2QDFA 1L6VA 1C78A 1WGKA 1FNWA 4M02A 3DPDA 2L0TA 2V3NA 4A55A 4W9HA 3RYTA 1RAXA 1SE3A 4B0MA 4N59A 4P16A 4HJGE 3RNBC 2OJWA 4E3CA 4P1BC 1WSPA 4MJSA 3Q3FA 3DBRI 2WX1A 4W9EA 1IUEA 5HI1A 4HK2A 1JRUA 1ZOYB 2KDEB 2IYDB 3RMKC 1R4MB 5JZEB 4GMVA 4IM0A 1IGCA 2G9HD 2W82A 2EKEC 4RH6A 2RSUA 2PEAA 5EE1A 1BMLC 1FMAD 3VR8B 3IVFA 4KGTA 1C4AA 3H1UA 2I1KA 3R66C 2DHZA 5IO9A 2HJ8A 4C56C 1WRIA 2EMSA 2BW2A 1YNTE 4RGTA 2W55A 1WF9A 2GRIA 2MRPA 3NG0A 4B0EA 3DBRB 2ZNVC 3NUHB 3VFKA 3PZ7A 1P7EA 4Q2JA 2FCNA 3C0RB 2QMTA 1QOAA 1ZGUB 2E6XA 3TJPA 4HLEA 1V1OA 3A9JA 1YJ1A 2OHFA 3RULA 1ZXIA 4K1RB 2KC1A 1I42A 3APFA 1P3QU 2L3ZA 3A4SC 1MG8A 1J0GA 3WALA 4JQWC 2NVUI 2V1YA 3PSEB 1OFFA 2CU1A 1C76A 4EFOA 1IBXB 3A33B 3BYYB 2LHEA 2WXQA 2JXXA 2L32A 2ONQA 2VRRB 3PRMB 4GB9A 4WAAA 1ZUD2 1QOFA 5DPRA 3SFEB 3NS1A 5L83A 4PS8A 1DYQA 1FFVA 5E6JA 1VZ6A 2FAZA 1S1QB 4GDLB 1ET6A 2NTTA 1N5WA 2WU5B 3A1QB 3ZVVA 1F2RC 2PVOD 2BYVE 1XLOA 3ZJVA 2O2VB 2WXKA 3PHXB 4HDQA 2MH7A 5IP4D 3PRZA 1C9FA 4YSXB 5KHQA 2BTEA 2Z8LA 1FXAA 2GBRA 1AWDA 1N61A 3DVGY 2DAFA 4JIOU 2DWQA 3VH4B 2NS5A 3NY5A 2RPQA 3GB1A 1QOBA 4WQMA 2X8XX 4A3OA 2WU2B 2W9NA 4ZRQA 5KHOA 2KWDA 2N0SB 2Y5PA 3W5UB 5CTRC 5FR6A 1J7BA 1QILA 2EKIA 2DYBA 2FUG1 1U4AA 1MHHE 4KIKA 1YX5B 2DNFA 5G55A 1ZW7A 2PJHA 2L7RA 5EE3A 2D3CA 1WZ0A 3I57A 4MELA 2J0MA 3WAPA 5FR3A 2O6VB 4LLGM 4TV3A 2NR2A 3LXFA 2JUOA 2DX5B 2VZKD 1GAQB 5E6NA 3WA0A 1F77A 3VUXA 1J7AA 4F8CB 3NOBA 2LGYA 5EDSA 3DWGC 3VQIA 1IPGA 1F9JA 2L05A 2N1VA 3DBLI 2LJ5A 2K22A 2MJEA 2RD0A 2GBKA 2RDHA 3K9OB 1FXTB 4MGIE 2LASA 4G0NB 1IGDA 1TS5A 3TBLD 3HHMA 4AOFA 1UBQA 2WLBA 4YTNB 2PMVA 2BYEA 3NVYA 2PPHA 3QIJA 3RZFA 2RMMA 3UQAA 3SEBA 3FILB 3PLUA 2LZ6A 3DBLB 1ZDVA 4ASWC 1E7VA 5HHDG 4BVUC 1Q10A 2MJDA 3L16A 2MJ3A 4A90A 4WWMA 2LRWA 1MG4A 4DXFA 3DOWA 4BZAA 3I63C 4EUTA 4KKIA 1SE2A 3U4EG 3TSSA 3NHEB 4RMAA 4N9F4 4H2AA 1LM8B 1J8CA 3QWZB 3AE7B 4YT0B 1JWUD 1VR9A 1TJEA 1J19A 3ZDMC 1VZ8A 3H8HA 3MC9A 1ZKHA 5JXVA 1MJDA 2M4NA 1OGWA 5G2NA 1WE7A 4IKGA 3AEBB 4P7IA 5BYRA 2BWFA 4L2YA 2JRIB 3AE9B 3DHGC 1H4RA 4ZHPA 2GBNA 2JVCA 3VRAB 1YQ3B 4I6PA 3WAMA 1QQRA 1T5XD 3ZUNA 1K8RB 1MI0A 5FKAC 3RPFC 2BKFA 4LDTB 3AB5A 4AP4C 2J7QB 5C23A 4GGQA 3M3JA 1T0RC 5D94A 1YN3A 2A4ZA 3ZNID 2H88B 3P1MA 1ZXHA 1FCCC 3AECB 4A9AA 1FCLA 4E74A 4ANUA 1VRAB 3NZSA 2WGSA 1L5PA 4C4VA 4RM8A 2Q5WD 1SB3C 2WXHA 1DGJA 1LQBA 2JWUA 3AEEB 3L08A 3UF8A 2KKCA 2AQ3B 1SEBD 2N9KA 4CHKA 4G11A 3CIRB 3ML8A 2K0PA 4FHKA 4PS7A 4IDIA 2BF8B 1V2YA 3B2GA 2RGFA 4KZ0A 4MACA 4F1SA 2C7HA 2AX5A 4NAWA 1WJ6A 1TKEA 1M4VA 3UIOB 2KX0A 1TT5B 2LUEA 3RFZB 4K3CA 2L00B 3M63B 2UU7A 4XDCA 1XQQA 1WYWB 4DDID 4M8MA 4S0RA 2ZZPB 4RGOS 1V5OA 4LNNA 4KVGB 5IN7A 3MHSD 3DVNV 1FRRA 2XN9C 1SBBB 3P4QB 4JWUC 2OJRA 3NJTA 3BIID 1EUVB 2Y3AA 3DWMA 3QK0A 2PLPA 2FCQA 3QHTA 4DHJB 2WXPA 4IOIE 3SFDB 4YL8A 2L8JA 5TSSA 2MP2B 2HTHA 1NBFC 1WGGA 2LFIA 2BPSA 3EFUA 1JALA 3P4PB 1T0YA 4TSSA 3IFWB 4WWPA 1D5XC 3R3MA 4WQOB 2KTRA 4RGMA 3TMPB 3H7PA 3KW5B 5J17A 1N62A 4NNJB 4II2B 3LJ3A 5DPWA 4HVBA 1JCKB 1J7CA 4W9GA 5E6PA 2KQSA 2J4XA 5IAAC 1SXTA 3I9V1 2NCNA 5BMIA 4LNIA 1N6ZA 1LFDA 3DCGA 1XLPA 1TY0A 1GJZA 2D3BA 3VH3B 3IHPC 4MSQB 4IWPA 5CHVC 1Q5WB 2C7NB 3VRBB 1YMHE 4KGSA 2L76A 3W2DA 2WXNA 1PGXA 1N60A 4NJ6A 4P1CC 2PIAA 4RGNA 3R7RA 2ZNVB 1VZ7A 1E6EB 1V9JA 3CMMB 4WWOA 4MH8A 2IO3B 3URYA 2ZW0A 3VVWB 2J53A 4GXBA 4HPLB 3VXWA 3ZRFA 2IO2B 1SF0A 2MBEA 4ITKA 1E5WA 3N32A 1E8YA 3BK1A 3WIMA 2D5GA 4YXDB 3DHIC 3TEWA 4KV2A 1V80A 4HKQA 4LJOB 4M01A 3ZIMA 1SIFA 4W9CA 2M0AA 1D5MC 1CQVA 4WWNA 2PTLA 3AE8B 1A70A 2QILA 1QZEA 2Y5BB 4IWQA 1F2RI 3AE4B 2M19A 2K1FA 5LXHA 1WGDA 3N9YC 2LGDA 2LXAA 4M0WB 1PDXA 2ZCCA 1XLNA 4PS3A 2JRHA 4US9A 4K7WA 4AS1A 3LDZE 2KANA 1T3QA 4OVZA 1TGZB 4NJCA 1TS2A 2JZPA 4W9DA 2YLMA 2ZVNA 1R4NI 4MJSB 1PGBA 5J18A 2Z0DB 2G45B 4B95A 4I6LB 4W9KA 3LB8C 3U52E 4EOYA 1S3SG 2XBBC 3VDZA 3B2FA 3UIPB 1UH6A 2CHZA 4GLSC 2N7EA 3B08A 4BKSA 1WX9A 4EZLA 4NY0A 4MT5A 3EC8A 1R4NB 1I4QA 1JRPA 2L83A 1KTKA 4LJPB 1AYFA 2MLBA 2X38A 5DPTA 4XGAB 1TS3A 4HCNB 3UI3A 3A9JB 5H8YE 2WYQA 4JX1C 4QAYA 4OVVA 2H89B 3DVGX 4WURA 4LK0M 1QKZA 2LI5A 3CSFA 3U30A 1B9RA 2WXFA 1F0ZA 1I4RA 3X0WA 3JVZX 1NI2A 3ZRCA 5BMGA 2R61A 1YN4A 3UQBA 3P4SB 1TYGB 1TZ1A 1V1PB 4IM2A 2AYOB 1WR1A 1WXMA 1PYWD 1GUAB 1UBIA 2IDYA 3P42A 5DCNA 4D2KA 2KWCA 2NTSA 4IC7B 1XD3B 3AU4A 1GC7A 4OHJA 1DOXA 1QLBB 2BQQA 3DVNU 2KNBA 4BBNC 1BT0A 2JXTA 2MA9B 2XEWA 4BFRA 1K51A 2V4LA 1H8CA 4DWFA 2IY0B 4XC2A 3D32A 3TL5A 4BKTA 2KC2A 1FRDA 4BBNF 3BZDB 3HUIA 1UD7A 3VUYA 3AEDB 4JPSA 1V97A 1XCQL 2HJ1A 3ABVB 1D3ZA 2IGDA 4L1BA 2PE6B 1WIAA 4EZJA 3W1SA 3DHHC 5JHBA 1IYFA 3B9JA 1ISNA 2C9WB 1JWMD 1LXDA 1XLQA 2N9XA 1CZPA 2CHWA 4KIKB 1E7UA 3MJWA 2BBCA 1T6BX 2AEHA 2LVOA 2CKHB 1V8CA 3L0WB 2IO1B 2N7JA 4JGHB 1OTRB 3SD5A 2BWES 1UGJA 3VTUA 3ZNHB 1QF6A
chains in the Genus database with same CATH topology
1ENFA 4YTPB 3AE7B 4YT0B 1JWUD 1KFYB 1VR9A 2BS3B 3AEAB 1TJEA 1SJED 1ZE3D 1YN5A 1VZ8A 2W54A 1NYQA 1KH0A 5LNK1 1AN8A 2IGHA 3H8HA 2JSVX 5JXVA 1I4XA 3SR6A 2DBYA 1N5XA 2LGIA 5C2TB 1XO3A 4L23A 4IKGA 4OW0A 2KAJA 1WWTA 3AEBB 3EA6A 5BYRA 4L2YA 3AE9B 3BVMA 2WNMA 4ZHPA 3AE6B 4KX6B 2WQYB 3E9SA 1EU4A 3ETRA 3VRAB 2RDGA 1YQ3B 3BVZA 1JQ4A 3ZYYX 1PFDA 3HRDD 4YSYB 1QQRA 3R2IA 1I4GA 1T5XD 2VZKB 2QEJC 1ESFA 5EE9A 1MI0A 2AQ2B 5FKAC 3RPFC 2ICIA 5H92C 2G1EA 4M0WA 1XEEA 3AB5A 3C8YA 4XWTA 4C7ZA 1UNSA 2YEPB 2V3PA 1YN3A 3KWVA 2WXIA 3E56A 3P63A 2H88B 3P1MA 2Y5CA 2AQ1B 1C77A 1ZXHA 1FCCC 3AECB 3MC0B 1L4DB 5GXGB 4A9AA 1FCLA 4NZLB 3EGRA 1L0VB 4NAMA 4MM3B 1FM0D 1B1ZA 1FXIA 1VRAB 1YQ4B 2JQRB 3NVZA 4US8A 3IT4B 1TZOA 1GB4A 2KN4A 1OQRA 1L5PA 2QSDA 3MFGA 1NEKB 3KLSX 1ET9A 1SB3C 2Q5WD 1DGJA 1YJIA 2QIEB 2IGGA 2WXHA 4N6EB 2JWUA 3AEEB 4OZAA 2IPKD 1AW7A 1NENB 2AQ3B 3Q8AA 1E10A 1CJEA 2BB5A 1SEBD 2N9KA 2RPVA 3GS2A 4YTMB 4JWSC 3CIRB 2LJIA 2YEPF 3KWLA 2K0PA 4RNAA 2WS3B 1R7SA 4IDIA 3ZGZA 3B2GA 2BS2B 1MVKA 1SSNA 2FBWB 1RFKA 5I4DA 4ZYSA 4MACA 2ZW1A 4EE2A 2INNE 2AX5A 2DYMA 1FIQA 1CK1A 1K50A 1JW9D 1TKEA 4O1NA 2K3UA 1RM6C 1YJJA 5D3IB 1M4VA 3L4PA 4J3OD 2DYOA 1DOIA 4C80A 2BYTA 3RFZB 4DQOC 1VDVA 4RF0A 1L0YB 1EU3A 4XDCA 3NRZA 2L1AA 1FO4A 3AEFB 2J42A 4XWWA 4A6QA 1HZ5A 4RFBA 4RGOS 1D4BA 3W5VB 1FRRA 2XN9C 1D5ZC 1SBBB 3PO0A 1ROEA 3P4QB 4JWUC 2V0GA 3BIID 1EM7A 3BWUD 3VR9B 2Y3AA 2JYEA 3DWMA 2PLPA 1PGAA 1ZPSA 3AE2B 2WXPA 1FD6A 4IOIE 2JX5A 1ACCA 3SFDB 1HEZE 2MEKA 5TSSA 1GPXA 1EWCA 2LFIA 2LHDA 1LO5D 1JALA 1OQQA 2E3TA 4LTUA 5D7GA 3P4PB 3EUB2 4TSSA 4TQ1A 1V1PA 2M56B 1JWAD 3MJ5A 4OZCA 1D6EC 1D5XC 1WXQA 4UDUC 1ZP0B 2INPE 2KDMA 4OZBA 1MHXA 2LEKA 1E9MA 1RWSA 3AV8A 1HA5A 2GB1A 3LYYA 4RGMA 1ZDXA 4HRSA 1N62A 2SAKA 1P7FA 1SIJA 3NVVA 1STEA 1JCKB 1J7CA 4NAWB 2IJ0A 3T3OA 2J4XA 4FXCA 4ZOHC 1SXTA 3I9V1 5T8IA 3V05A 5BMIA 3J9CA 2LMCA 4XDDA 1XLPA 3BYTB 4A8XC 3TEZA 1UWXA 4ARIA 1TY0A 2J52A 1GOZA 1L6VA 1C78A 1TKYA 1C4CA 1FNWA 1JROA 1TY2A 1WGKA 2ON8A 2V3NA 4A55A 1IBXA 3FAHA 5BYQA 1SE3A 4B0MA 1JWSD 4N59A 4P16A 4DXGA 3VRBB 4HJGE 3BVGA 1YMHE 3FILA 4KGSA 5BYSA 2KACA 1WSPA 3W2DA 2WXNA 1HZ6A 1IUEA 1PGXA 5HI1A 1N60A 3WCQA 1ZOYB 4ZRPA 1JWBD 2HTME 3Q8CA 2PIAA 4RGNA 3BK2A 2KQ4X 1XXGA 2BS4B 1IGCA 2G9HD 1VZ7A 2W82A 1E7PB 1HQRD 4RH6A 1XCTL 1E6EB 1Y56A 4REZA 3OWEB 1TKGA 5EE1A 1BMLC 1FMAD 4RF1A 2JU6X 3VR8B 4MH8A 4KGTA 1C4AA 2DLBA 2WDVB 2WXLA 3HVZA 3URYA 4CQNA 2ZW0A 2J53A 1I4HA 1WRIA 3U2SC 1FEHA 4C56C 2BW2A 1SF0A 1YNTE 1NI3A 2W55A 2XNAC 1L4ZB 4ITKA 4RGTA 1UWMA 2GRIA 4B0EA 3BK1A 5D3DA 3NUHB 3PZ7A 1I7HA 1P7EA 2D5GA 4TMAB 4YXDB 1KLGD 4Q2JA 3TEWA 4HKQA 1RYJA 2QMTA 1QOAA 1KRHA 3ZJTA 4WIPA 3T3NA 3W9CB 3IAM1 2PW9A 2M0AA 2E6XA 3AM9A 2ACZB 1V1OA 1D5MC 2K5PA 1CQVA 2OHFA 1ZXIA 2PTLA 3AE8B 1A70A 2B76B 2QILA 3NVWA 4R3DA 1F2RI 3FC4A 3AE4B 2M19A 3CWIA 4HROA 3N9YC 4USAA 1PDXA 1XLNA 4RCOA 4US9A 2GI9A 4AS1A 1OFFA 4WH4A 1WYGA 1C76A 1T3QA 4OVZA 2K9XA 4AQ7A 1IBXB 5HG2A 2NMQA 5C3JB 4PT5A 3BYYB 1I4PA 4NJCA 2W3RA 2V4IB 2LHEA 2WXQA 1TS2A 1SE4A 2JZPA 2L32A 2ONQA 1PGBA 1FFUA 3MP9A 1ZUD2 1QOFA 3SFEB 3AE1B 2WXMA 3LB8C 1E0ZA 2PVGC 3NS1A 3U52E 5HFYA 1DYQA 1FFVA 2L52A 3V3XA 3B2FA 5E6JA 1VZ6A 3MHZA 4GLSC 4GDLB 1ET6A 2NTTA 1N5WA 4KGRA 3IT6B 2WU5B 1F2RC 2PVOD 3R2TA 1XLOA 4KKJA 2WDRB 3AE5B 4MT5A 3ZJVA 2WXKA 1VJKA 5AUIA 2MH7A 1I4QA 1QT9A 1JRPA 1C9FA 4YSXB 2OEDA 2BTEA 2Z8LA 2L83A 1FXAA 4GDKB 1KTKA 1AWDA 1N61A 2I38A 1SJHD 2SEBD 1AYFA 3HVDA 5AUKA 1MPEA 2X38A 3ZJUA 1TS3A 3TEXA 3PZ8A 2DWQA 2PKOA 3UI3A 1KLUD 1KF6B 3GB1A 5H8YE 1QOBA 2JYTA 4WQMA 1EWYC 2WU2B 4JX1C 1N63A 4ZRQA 1BXTA 2KWDA 2N0SB 2Y5PA 3W5UB 2H89B 3U7ZA 2BB6A 1J7BA 3O13A 2KMMA 1QILA 4WURA 2EKIA 4LK0M 1NYRA 2CJNA 1NVID 2FUG1 1MHHE 5EE0A 5G5HA 4N58A 1QKZA 3Q8EA 1K52A 1B9RA 2WXFA 1K53A 1F0ZA 1I4RA 3Q8FA 2WP9B 5EE3A 3I57A 2N9LA 1L6UA 5BMGA 1C4PA 2FE8A 2R61A 5FR3A 1YN4A 3AE3B 5FK9C 4LLGM 3LXFA 3P4SB 1TYGB 2WXJA 3ZQ4A 1V1PB 3R8BA 2VZKD 1GAQB 1PYWD 2IDYA 3P42A 4JE3B 4D2KA 1F77A 2NTSA 1JMLA 1XF5L 3NZ3A 5BMHA 4OHJA 1J7AA 1DOXA 2CU3A 3AEGB 1QLBB 3AH7A 2CJOA 3IAS1 2WXGA 3DWGC 3AN1A 2JXTA 3VQIA 2EELA 1K51A 5G5GA 4YSZB 3P4RB 4YWGG 1UUPA 1FNVA 1FRDA 3Q8BA 4C7YA 3BZDB 2K22A 3HUIA 2MJEA 5MPOA 2RDHA 3AEDB 3IXSA 4JPSA 2WDQB 2TSSA 1PUTA 1V97A 4TQ0A 1XCQL 2WXOA 1IGDA 1TS5A 3TEYA 1HXYD 4ZHOA 3ABVB 2IGDA 2BT6A 2WLBA 2PMVA 3KQ4A 4L1BA 4YTNB 3NVYA 4ARCA 3AMZA 3W1SA 2RMMA 2QJLA 1VLBA 1DOYA 3B9JA 4XE0A 1TS4A 3FILB 3SEBA 1JWMD 1XLQA 1ZDVA 1C79A 5HHDG 1CZPA 2I2YA 1Q10A 2MJDA 1QOGA 3TUOA 4WAFA 2BBCA 1T6BX 2MJ3A 4A90A 2LUMA 2HDEA 4WWMA 1BUIC 4DXFA 1FNUA 1V8CA 3Q69A 1L0XB 1GB1A 4P6VF 4KKIA 2WXRA 1SE2A 2N7JA 4HEA1 3U4EG 4HKZE 3GP7A 3TSSA 1UGJA 1QF6A 4H2AA 2W3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZ5 A;  2KWD A;  2ZW0 A;  2J53 A;  1D4B A;  5BMH A;  1YNT E;  1KH0 A;  1EM7 A;  1MHH E;  2IGH A;  1P7E A;  2JSV X;  5JXV A;  2PLP A;  1QKZ A;  1PGA A;  2LGI A;  1K52 A;  1K53 A;  2QMT A;  4IKG A;  2PW9 A;  1FD6 A;  2N9L A;  4IOI E;  5BMG A;  1HEZ E;  2PTL A;  2LHD A;  1F2R I;  4D2K A;  4OZC A;  1JML A;  1XF5 L;  1MI0 A;  2GI9 A;  2KDM A;  4OZB A;  1MHX A;  4WH4 A;  2GB1 A;  1IBX B;  5HG2 A;  2NMQ A;  2JXT A;  2EEL A;  1K51 A;  1ZXH A;  1FCC C;  1P7F A;  2LHE A;  1FCL A;  2JZP A;  2ONQ A;  1PGB A;  3MP9 A;  1GB4 A;  2KN4 A;  2QSD A;  5HFY A;  2IGG A;  1XCQ L;  5BMI A;  2JWU A;  1IGD A;  4OZA A;  3V3X A;  4GLS C;  1UWX A;  2IGD A;  2J52 A;  2N9K A;  2RPV A;  2ON8 A;  4KGR A;  1IBX A;  2RMM A;  1F2R C;  2K0P A;  3FIL B;  4HJG E;  1YMH E;  3FIL A;  4KGS A;  1MVK A;  5HHD G;  2KAC A;  2I2Y A;  1Q10 A;  1C9F A;  4MAC A;  2OED A;  1HZ6 A;  2ZW1 A;  1PGX A;  5HI1 A;  1K50 A;  2I38 A;  2LUM A;  1MPE A;  1GB1 A;  2KQ4 X;  2N7J A;  1IGC A;  1XCT L;  4HKZ E;  3UI3 A;  3GB1 A;  2JU6 X;  4KGT A; 
#chains in the Genus database with same CATH topology
 1WE6 A;  2D10 A;  4W9F A;  4KZC A;  2BS3 B;  3IBE A;  4XYC A;  4MDK E;  1ZE3 D;  1WXV A;  3V6C B;  5C1Z A;  2N7D A;  2XK5 B;  1AAR A;  3Q3J A;  4L23 A;  3ZTC A;  2KWV B;  3EA6 A;  2BGF A;  3SU8 X;  3BVM A;  2KJ6 A;  2I1J A;  1WM3 A;  3BY4 B;  2WQY B;  3ETR A;  2KVZ A;  1LGR A;  1XT9 B;  3ZYY X;  1P1A A;  3I3T B;  2VZK B;  1HE8 A;  2N9P C;  2QEJ C;  5EE9 A;  3QQ8 B;  3M62 B;  3A9K A;  5CHF A;  4ZDV A;  3R7Q A;  3SDL C;  4C7Z A;  1HTQ A;  2V3P A;  3E56 A;  3TIX A;  2M8S A;  2AQ1 B;  2Y5C A;  3EEC A;  1C77 A;  1L4D B;  2KD0 A;  4A20 A;  4BOS C;  2KYW A;  3KYC D;  2KN4 A;  3MTN B;  5TR5 A;  3C19 A;  2QSD A;  4M00 A;  3MFG A;  1HTO A;  2IGG A;  3W1S C;  4OZA A;  1AW7 A;  1NEN B;  2GOW A;  4A3P A;  3Q8A A;  4GOC A;  1UZX B;  3GE8 C;  3Q6B A;  3W1Y A;  4YTM B;  4GDL A;  4JWS C;  4ICV A;  3A1Q A;  3AUL A;  2WS3 B;  1WZ3 A;  4NJ7 A;  2BS2 B;  4LNK A;  5I4D A;  2MBQ A;  2A5U A;  4O1N A;  3ZXR A;  2LGS A;  5LXI B;  3JSV B;  1VDV A;  4RF0 A;  5IA7 A;  3NRZ A;  4A6Q A;  1D4B A;  2DZM A;  3PZD A;  3PO0 A;  2V0G A;  3H7S A;  2JYE A;  3JYU A;  1PGA A;  1ZPS A;  2N1W A;  2ZJD A;  1FD6 A;  5AEK B;  1GPX A;  2LHD A;  1OQQ A;  4C4V B;  4TQ1 A;  2JPH A;  2M56 B;  4S17 A;  4OZC A;  1WXQ A;  2GBM A;  3RNG C;  1ZP0 B;  2KDM A;  3OAW A;  1RWS A;  1HA5 A;  2KLG A;  2MWS B;  4MH0 E;  2LVP A;  3HM3 A;  3BIN A;  2MQJ A;  1WGY A;  3CST A;  2D3A A;  4MSM B;  5LLI A;  4NAW B;  3RT3 B;  3OLM D;  4IM3 A;  5BO4 B;  4JL9 A;  3L10 B;  3GE3 C;  1E90 A;  4FXC A;  4ZOH C;  1M94 A;  5T8I A;  4XDD A;  3RUI B;  3TEZ A;  1UWX A;  3NVV A;  1GOZ A;  1TY2 A;  1TKY A;  2J52 A;  1JRO A;  2ON8 A;  3FAH A;  5BYQ A;  2M17 A;  1JWS D;  1UEL A;  4DXG A;  1WJ4 A;  2MSE D;  3FIL A;  2KAC A;  3T9L A;  2B3A A;  5CHW A;  2MX2 A;  2FIF A;  1JWB D;  4ZRP A;  2HTM E;  1A5R A;  3B0A A;  1XXG A;  3QA8 A;  1Y56 A;  4REZ A;  3OWE B;  1TKG A;  3ZW3 A;  3H9D A;  4RF1 A;  3Q3M C;  1T0Q C;  2DLB A;  2WDV B;  2WXL A;  3HVZ A;  4CQN A;  2LGX A;  2KTF A;  2IY1 B;  1I4H A;  1Y8R C;  1FEH A;  1DOY A;  4XZ4 A;  3HM6 X;  1L4Z B;  4GIV A;  4GDK A;  4PK1 A;  4TMA B;  3H7P B;  4URK A;  3ZJT A;  1V86 A;  4WIP A;  3T3N A;  2RR9 A;  3W9C B;  3IAM 1;  3AM9 A;  2ACZ B;  3QJZ A;  2KOX A;  2K8C A;  2KWU B;  1E8X A;  4R3D A;  4PYU A;  3FC4 A;  3CWI A;  2QC8 A;  1EO6 A;  4W9J A;  2UYZ B;  2L0F A;  3AXC A;  2GI9 A;  4WH4 A;  1WYG A;  4AQ7 A;  2K9X A;  1C3T A;  1OEY J;  2J0K A;  2NMQ A;  5C3J B;  4KDI C;  1I4P A;  2WWZ A;  2V4I B;  3PVL A;  1YX6 B;  3MP9 A;  2DZI A;  3OJ3 A;  3V61 A;  2WXM A;  2D11 A;  4OVU A;  1P9D U;  4IUM B;  2JT4 B;  5HFY A;  2GBJ A;  2L52 A;  3MHZ A;  3VAW A;  3DBS A;  1Q0W B;  4FJZ A;  3NZU A;  2VH1 A;  3RNF C;  3VUW A;  2EMT A;  3R2T A;  4KKJ A;  3AE5 B;  1VJK A;  2NPT A;  5AUI A;  1QT9 A;  4GN1 A;  3VHT C;  2OED A;  4TUU A;  4MGY E;  2I38 A;  1SJH D;  2KJR A;  3HVD A;  5AZG A;  4GSW A;  1MPE A;  3ONS A;  2KDF B;  3N30 A;  1RFA A;  2PKO A;  2KVR A;  1KLU D;  2JYT A;  1EWY C;  1EF5 A;  4ANV A;  1N63 A;  2BB6 A;  3O13 A;  1UF0 A;  1YIW A;  2KMM A;  2KJH B;  2LRU A;  2CJN A;  4HCP B;  3RNE C;  5G5H A;  5EE0 A;  2MCN B;  4N58 A;  4FN2 A;  1KLV A;  3Q3N C;  1WMH B;  4FJY A;  4IG7 B;  3Q8F A;  2WP9 B;  1OEY A;  2N9L A;  3GOE A;  1L6U A;  1C4P A;  2NBW B;  2MP2 A;  3ZQ4 A;  2JY6 A;  4DBG A;  4JE3 B;  2KFK A;  2K25 A;  1P0R A;  1WY8 A;  4II3 B;  1JML A;  2FUH B;  4KSL C;  4AUQ C;  3AEG B;  3AH7 A;  1YD8 U;  2FCM A;  2KDB A;  3AN1 A;  1WXS A;  2EEL A;  5G5G A;  2IO0 B;  3L54 A;  4YSZ B;  3RNA C;  1PQS A;  4AJW A;  3Q8B A;  1FNV A;  4FHJ A;  3IXS A;  2WDQ B;  4BKS D;  2WXO A;  5DPS A;  2VH2 A;  4ZHO A;  1P98 A;  2BT6 A;  3PRE A;  5IOI A;  3AMZ A;  3KYD D;  4K81 A;  3KUC B;  2N9E B;  2QJL A;  1WM2 A;  4XE0 A;  1TS4 A;  3QX1 A;  2Z59 B;  3QC8 B;  4GU2 A;  3ECI A;  2I2Y A;  4MM3 A;  1QOG A;  3TUO A;  1F52 A;  4WAF A;  2LUM A;  1KJT A;  1BUI C;  2ZEQ A;  3MC8 A;  3PRP B;  1TBE A;  2WXR A;  4FLH A;  3N1Z C;  4HEA 1;  4DXA B;  4HKZ E;  4HPM B;  2W3S A;  4KDL B;  5JH5 C;  1KFY B;  2GMI C;  1SJE D;  1E8Z A;  3U7D A;  2W54 A;  3X23 A;  2K6D B;  2KN5 A;  5LNK 1;  2IGH A;  2DBY A;  3OJ4 B;  1G6J A;  1WX8 A;  4OW0 A;  2KAJ A;  3RN9 C;  3T8M A;  4AWJ A;  4EEW A;  3AE6 B;  1X1M A;  2UWQ A;  3HK0 A;  3PPA A;  4DDG D;  2RDG A;  4J6I A;  1JQ4 A;  1PFD A;  3HRD D;  4YSY B;  2AQ2 B;  2ICI A;  2G1E A;  4DHZ E;  4M0W A;  4XWT A;  4ZRK A;  1UNS A;  3KWV A;  1WJN A;  2KLC A;  4ZRJ A;  3TCA A;  3P63 A;  5GXG B;  2PE9 A;  3ZXV A;  3EGR A;  1L0V B;  4LCD E;  1B1Z A;  2R2O A;  4US8 A;  1TZO A;  1GB4 A;  3DDC B;  1GNU A;  1NEK B;  2C60 A;  1TTN A;  4N6E B;  3M95 A;  4DHZ B;  2IPK D;  4BAX A;  1VD2 A;  2LD9 A;  2DZK A;  1CJE A;  3V60 A;  2BB5 A;  4TKN A;  3GS2 A;  2YEP F;  4RNA A;  3PHW B;  3ZGZ A;  3PT2 B;  1Z5S B;  2FBW B;  2C5L C;  4FJV B;  4ZYS A;  2G4S A;  4EE2 A;  1WJU A;  2INN E;  2MBH A;  2DYM A;  1V81 A;  1JW9 D;  1RM6 C;  3I5J C;  3PV1 A;  4ZRI A;  3KVF B;  4C80 A;  1RRB A;  2BYT A;  3N20 C;  1RLF A;  1EU3 A;  2L1A A;  1FO4 A;  2J42 A;  4XWW A;  4RFB A;  1F1H A;  3PS6 A;  3W5V B;  1D5Z C;  2JWZ A;  3QAQ A;  1ROE A;  1EM7 A;  3BWU D;  3A9K B;  4ICU A;  3WAN A;  3AE2 B;  1ACC A;  3ML9 A;  1EWC A;  1LO5 D;  2E3T A;  5D7G A;  4K7S A;  3EUB 2;  2WDT B;  1V1P A;  1JWA D;  4IWO A;  1D6E C;  1WR6 E;  2KXJ A;  1MHX A;  1E9M A;  2KK8 A;  3LYY A;  2KDI A;  1ZDX A;  2MHJ A;  2SAK A;  2DEN B;  3QAR A;  2ASQ A;  2IND C;  3IG3 A;  2IJ0 A;  3T3O A;  3A4R A;  2BVC A;  3V05 A;  3EHV A;  2ZCB A;  3RCZ A;  2LMC A;  4A8X C;  4ARI A;  2GLS A;  2KMC A;  1C4C A;  4CO7 A;  2BYF A;  3FKY A;  1IBX A;  1WXA A;  5D6J B;  2K6Q A;  2D3G A;  3BVG A;  5BYS A;  3HIZ A;  3PLV A;  1HZ6 A;  3DBH I;  3WCQ A;  2NBV B;  3Q8C A;  3BK2 A;  2KQ4 X;  2BS4 B;  3GZN I;  1E7P B;  1HQR D;  1XCT L;  3ALB A;  2R2Q A;  4NQL B;  1WI0 A;  2JU6 X;  1V49 A;  2LXC A;  3EFC A;  3U8Z A;  5BMH A;  3U2S C;  3APD A;  3S2A A;  1NI3 A;  2XNA C;  4W9I A;  2O2V A;  1UWM A;  5D3D A;  3DBH B;  2V9H A;  3KH0 A;  3Q3O C;  1IP9 A;  1I7H A;  3V62 A;  1KLG D;  2WHI A;  3GZN B;  2XK5 A;  1RYJ A;  2JZ3 B;  4ANX A;  1KRH A;  2O6V D;  1TIF A;  2PW9 A;  4BOZ B;  2K5P A;  4WJQ A;  5J2R A;  2B76 B;  2G4D B;  3NVW A;  3RD2 A;  4I6N B;  4HRO A;  4WJO A;  4USA A;  3N1X C;  1WRD B;  1WX7 A;  5D2M B;  4RCO A;  5HG2 A;  4PT5 A;  2W3R A;  2D2Q A;  2YVC A;  4FUL A;  4IW0 A;  1SE4 A;  2DAJ A;  3AU5 A;  2FNJ B;  2O6V A;  1FFU A;  2INC C;  3AE1 B;  2M1M A;  1E0Z A;  2PVG C;  2G3Q B;  2M0X A;  1KM7 A;  3AI5 A;  3P2B A;  3V3X A;  1L7Y A;  2KHW B;  1CMX B;  2AL3 A;  4K3B A;  1GG3 A;  4KGR A;  3IT6 B;  4AJY B;  2WDR B;  3UGB B;  2LWP A;  3ZO5 B;  3VTV A;  3ZLZ A;  4GDK B;  4EZK A;  3APC A;  3ENE A;  3L17 A;  2SEB D;  5AUK A;  2K8B A;  3ZJU A;  3TEX A;  3PZ8 A;  3JSV A;  2MBB B;  1KF6 B;  4BKG A;  3PGE A;  1BXT A;  3Q14 C;  3Q2A C;  3U7Z A;  1FPY A;  4FBJ B;  4WJP A;  1WH3 A;  2JZZ A;  1NYR A;  1NVI D;  3Q8E A;  4B9K A;  1K52 A;  4ANW A;  1K53 A;  3N3K B;  2FE8 A;  4HWI B;  3AE3 B;  5FK9 C;  2ZPN A;  2WXJ A;  3R8B A;  4HJK A;  5CX3 A;  2AWT A;  1UGM A;  1XF5 L;  2ZVO A;  4LDT D;  3NZ3 A;  3ZDT A;  2CU3 A;  2KTR B;  2CJO A;  2QHO A;  3IAS 1;  2ZPY A;  2WXG A;  2KFJ A;  1NDD A;  2NPT B;  4K7U A;  3P4R B;  1Z2M A;  3KUZ A;  4E71 A;  4YWG G;  1UUP A;  4C7Y A;  4B6W A;  5MPO A;  1V5T A;  3QCA A;  2TSS A;  1PUT A;  4TQ0 A;  2D07 B;  3TEY A;  2AL6 A;  1HXY D;  4FAD A;  3UIN B;  3KQ4 A;  4ARC A;  3ZNG C;  1VLB A;  2C7M B;  1V6E A;  1C79 A;  3B1L X;  2J0J A;  2FCS A;  2OOB B;  2KT7 A;  4C00 A;  1L2N A;  2HDE A;  1FNU A;  3Q69 A;  1L0X B;  1GB1 A;  4P6V F;  2KQ7 A;  3GP7 A;  3NS8 A;  5AZF A;  1ENF A;  2MBO A;  4YTP B;  3RI7 C;  4ACF A;  4LNF A;  1E8W A;  2WX0 A;  3ZTD A;  3AEA B;  2REX A;  2KFK B;  4M8N A;  2V3S A;  1YN5 A;  1NYQ A;  1KH0 A;  4G3X B;  1T0S C;  2HD5 B;  2KX3 A;  1AN8 A;  1GC6 A;  4KSK C;  2JSV X;  1I4X A;  3SR6 A;  4DHJ D;  1N5X A;  2LGI A;  5C2T B;  1XO3 A;  3L13 A;  2JF5 A;  1WWT A;  4XX5 A;  3H6N A;  3ZKJ C;  2WNM A;  2KZR A;  3SHQ A;  4KX6 B;  2MW5 A;  2BKR B;  3E9S A;  3VTW A;  1EU4 A;  4RM9 A;  5AZH A;  1KOT A;  3BVZ A;  3KUD B;  3R2I A;  5HKH A;  1I4G A;  1VCB A;  4MGZ E;  1ESF A;  5H92 C;  1XEE A;  1YQB A;  3C8Y A;  3DQV A;  4NQK E;  2YEP B;  2WXI A;  2FID A;  3MC0 B;  4NZL B;  4NAM A;  4MM3 B;  1FM0 D;  1FXI A;  2K8H A;  1YQ4 B;  2JQR B;  3NVZ A;  3IT4 B;  1I35 A;  2IZV B;  1OQR A;  3KLS X;  1ET9 A;  2QIE B;  1YJI A;  3JW0 X;  1E10 A;  2RPV A;  2IBI B;  1SGH A;  1OQY A;  4F7Z A;  2LJI A;  3OG5 A;  3KWL A;  1SE9 A;  2Z0E B;  1R7S A;  2K39 A;  4X57 B;  1MVK A;  1SSN A;  1RFK A;  2ZW1 A;  1C1Y B;  1CK1 A;  1FIQ A;  1K50 A;  2K3U A;  1YJJ A;  4CYE A;  5D3I B;  3L4P A;  4J3O D;  2DYO A;  1DOI A;  3ZNZ B;  3K9P B;  3PTF C;  4PYZ A;  4DQO C;  1L0Y B;  3RNC C;  5IKC M;  3WAO A;  2RDB C;  4HPP A;  1MFW A;  3AEF B;  2HE7 A;  1HZ5 A;  4DK5 A;  1WFY A;  4JLC A;  3VR9 B;  4LNO A;  4WJN A;  2CR5 A;  3V6E B;  1YOV B;  2DZJ A;  2CS4 A;  2LVQ A;  4NPN A;  1WMH A;  1Q1O A;  1WGR A;  2JX5 A;  5GMV A;  4G50 A;  4W9L A;  1HEZ E;  2MEK A;  4HXD A;  4HDO A;  4ZYN A;  1WGH A;  2CHX A;  4LTU A;  2KMA A;  4FA6 A;  1EF1 A;  3MJ5 A;  5L95 C;  2NBU A;  3N1Y C;  2N4F A;  4UDU C;  2INP E;  4OZB A;  2LEK A;  5E6O A;  3AV8 A;  2GB1 A;  4HRS A;  1P7F A;  3CF6 E;  1SIJ A;  1STE A;  4MGK E;  4MEM A;  3O65 B;  2KO3 A;  2QCZ A;  3RZW C;  4EKU A;  5JHA A;  1R4M I;  3J9C A;  3BYT B;  2QDF A;  1L6V A;  1C78 A;  1WGK A;  1FNW A;  4M02 A;  3DPD A;  2L0T A;  2V3N A;  4A55 A;  4W9H A;  3RYT A;  1RAX A;  1SE3 A;  4B0M A;  4N59 A;  4P16 A;  4HJG E;  3RNB C;  2OJW A;  4E3C A;  4P1B C;  1WSP A;  4MJS A;  3Q3F A;  3DBR I;  2WX1 A;  4W9E A;  1IUE A;  5HI1 A;  4HK2 A;  1JRU A;  1ZOY B;  2KDE B;  2IYD B;  3RMK C;  1R4M B;  5JZE B;  4GMV A;  4IM0 A;  1IGC A;  2G9H D;  2W82 A;  2EKE C;  4RH6 A;  2RSU A;  2PEA A;  5EE1 A;  1BML C;  1FMA D;  3VR8 B;  3IVF A;  4KGT A;  1C4A A;  3H1U A;  2I1K A;  3R66 C;  2DHZ A;  5IO9 A;  2HJ8 A;  4C56 C;  1WRI A;  2EMS A;  2BW2 A;  1YNT E;  4RGT A;  2W55 A;  1WF9 A;  2GRI A;  2MRP A;  3NG0 A;  4B0E A;  3DBR B;  2ZNV C;  3NUH B;  3VFK A;  3PZ7 A;  1P7E A;  4Q2J A;  2FCN A;  3C0R B;  2QMT A;  1QOA A;  1ZGU B;  2E6X A;  3TJP A;  4HLE A;  1V1O A;  3A9J A;  1YJ1 A;  2OHF A;  3RUL A;  1ZXI A;  4K1R B;  2KC1 A;  1I42 A;  3APF A;  1P3Q U;  2L3Z A;  3A4S C;  1MG8 A;  1J0G A;  3WAL A;  4JQW C;  2NVU I;  2V1Y A;  3PSE B;  1OFF A;  2CU1 A;  1C76 A;  4EFO A;  1IBX B;  3A33 B;  3BYY B;  2LHE A;  2WXQ A;  2JXX A;  2L32 A;  2ONQ A;  2VRR B;  3PRM B;  4GB9 A;  4WAA A;  1ZUD 2;  1QOF A;  5DPR A;  3SFE B;  3NS1 A;  5L83 A;  4PS8 A;  1DYQ A;  1FFV A;  5E6J A;  1VZ6 A;  2FAZ A;  1S1Q B;  4GDL B;  1ET6 A;  2NTT A;  1N5W A;  2WU5 B;  3A1Q B;  3ZVV A;  1F2R C;  2PVO D;  2BYV E;  1XLO A;  3ZJV A;  2O2V B;  2WXK A;  3PHX B;  4HDQ A;  2MH7 A;  5IP4 D;  3PRZ A;  1C9F A;  4YSX B;  5KHQ A;  2BTE A;  2Z8L A;  1FXA A;  2GBR A;  1AWD A;  1N61 A;  3DVG Y;  2DAF A;  4JIO U;  2DWQ A;  3VH4 B;  2NS5 A;  3NY5 A;  2RPQ A;  3GB1 A;  1QOB A;  4WQM A;  2X8X X;  4A3O A;  2WU2 B;  2W9N A;  4ZRQ A;  5KHO A;  2KWD A;  2N0S B;  2Y5P A;  3W5U B;  5CTR C;  5FR6 A;  1J7B A;  1QIL A;  2EKI A;  2DYB A;  2FUG 1;  1U4A A;  1MHH E;  4KIK A;  1YX5 B;  2DNF A;  5G55 A;  1ZW7 A;  2PJH A;  2L7R A;  5EE3 A;  2D3C A;  1WZ0 A;  3I57 A;  4MEL A;  2J0M A;  3WAP A;  5FR3 A;  2O6V B;  4LLG M;  4TV3 A;  2NR2 A;  3LXF A;  2JUO A;  2DX5 B;  2VZK D;  1GAQ B;  5E6N A;  3WA0 A;  1F77 A;  3VUX A;  1J7A A;  4F8C B;  3NOB A;  2LGY A;  5EDS A;  3DWG C;  3VQI A;  1IPG A;  1F9J A;  2L05 A;  2N1V A;  3DBL I;  2LJ5 A;  2K22 A;  2MJE A;  2RD0 A;  2GBK A;  2RDH A;  3K9O B;  1FXT B;  4MGI E;  2LAS A;  4G0N B;  1IGD A;  1TS5 A;  3TBL D;  3HHM A;  4AOF A;  1UBQ A;  2WLB A;  4YTN B;  2PMV A;  2BYE A;  3NVY A;  2PPH A;  3QIJ A;  3RZF A;  2RMM A;  3UQA A;  3SEB A;  3FIL B;  3PLU A;  2LZ6 A;  3DBL B;  1ZDV A;  4ASW C;  1E7V A;  5HHD G;  4BVU C;  1Q10 A;  2MJD A;  3L16 A;  2MJ3 A;  4A90 A;  4WWM A;  2LRW A;  1MG4 A;  4DXF A;  3DOW A;  4BZA A;  3I63 C;  4EUT A;  4KKI A;  1SE2 A;  3U4E G;  3TSS A;  3NHE B;  4RMA A;  4N9F 4;  4H2A A;  1LM8 B;  1J8C A;  3QWZ B;  3AE7 B;  4YT0 B;  1JWU D;  1VR9 A;  1TJE A;  1J19 A;  3ZDM C;  1VZ8 A;  3H8H A;  3MC9 A;  1ZKH A;  5JXV A;  1MJD A;  2M4N A;  1OGW A;  5G2N A;  1WE7 A;  4IKG A;  3AEB B;  4P7I A;  5BYR A;  2BWF A;  4L2Y A;  2JRI B;  3AE9 B;  3DHG C;  1H4R A;  4ZHP A;  2GBN A;  2JVC A;  3VRA B;  1YQ3 B;  4I6P A;  3WAM A;  1QQR A;  1T5X D;  3ZUN A;  1K8R B;  1MI0 A;  5FKA C;  3RPF C;  2BKF A;  4LDT B;  3AB5 A;  4AP4 C;  2J7Q B;  5C23 A;  4GGQ A;  3M3J A;  1T0R C;  5D94 A;  1YN3 A;  2A4Z A;  3ZNI D;  2H88 B;  3P1M A;  1ZXH A;  1FCC C;  3AEC B;  4A9A A;  1FCL A;  4E74 A;  4ANU A;  1VRA B;  3NZS A;  2WGS A;  1L5P A;  4C4V A;  4RM8 A;  2Q5W D;  1SB3 C;  2WXH A;  1DGJ A;  1LQB A;  2JWU A;  3AEE B;  3L08 A;  3UF8 A;  2KKC A;  2AQ3 B;  1SEB D;  2N9K A;  4CHK A;  4G11 A;  3CIR B;  3ML8 A;  2K0P A;  4FHK A;  4PS7 A;  4IDI A;  2BF8 B;  1V2Y A;  3B2G A;  2RGF A;  4KZ0 A;  4MAC A;  4F1S A;  2C7H A;  2AX5 A;  4NAW A;  1WJ6 A;  1TKE A;  1M4V A;  3UIO B;  2KX0 A;  1TT5 B;  2LUE A;  3RFZ B;  4K3C A;  2L00 B;  3M63 B;  2UU7 A;  4XDC A;  1XQQ A;  1WYW B;  4DDI D;  4M8M A;  4S0R A;  2ZZP B;  4RGO S;  1V5O A;  4LNN A;  4KVG B;  5IN7 A;  3MHS D;  3DVN V;  1FRR A;  2XN9 C;  1SBB B;  3P4Q B;  4JWU C;  2OJR A;  3NJT A;  3BII D;  1EUV B;  2Y3A A;  3DWM A;  3QK0 A;  2PLP A;  2FCQ A;  3QHT A;  4DHJ B;  2WXP A;  4IOI E;  3SFD B;  4YL8 A;  2L8J A;  5TSS A;  2MP2 B;  2HTH A;  1NBF C;  1WGG A;  2LFI A;  2BPS A;  3EFU A;  1JAL A;  3P4P B;  1T0Y A;  4TSS A;  3IFW B;  4WWP A;  1D5X C;  3R3M A;  4WQO B;  2KTR A;  4RGM A;  3TMP B;  3H7P A;  3KW5 B;  5J17 A;  1N62 A;  4NNJ B;  4II2 B;  3LJ3 A;  5DPW A;  4HVB A;  1JCK B;  1J7C A;  4W9G A;  5E6P A;  2KQS A;  2J4X A;  5IAA C;  1SXT A;  3I9V 1;  2NCN A;  5BMI A;  4LNI A;  1N6Z A;  1LFD A;  3DCG A;  1XLP A;  1TY0 A;  1GJZ A;  2D3B A;  3VH3 B;  3IHP C;  4MSQ B;  4IWP A;  5CHV C;  1Q5W B;  2C7N B;  3VRB B;  1YMH E;  4KGS A;  2L76 A;  3W2D A;  2WXN A;  1PGX A;  1N60 A;  4NJ6 A;  4P1C C;  2PIA A;  4RGN A;  3R7R A;  2ZNV B;  1VZ7 A;  1E6E B;  1V9J A;  3CMM B;  4WWO A;  4MH8 A;  2IO3 B;  3URY A;  2ZW0 A;  3VVW B;  2J53 A;  4GXB A;  4HPL B;  3VXW A;  3ZRF A;  2IO2 B;  1SF0 A;  2MBE A;  4ITK A;  1E5W A;  3N32 A;  1E8Y A;  3BK1 A;  3WIM A;  2D5G A;  4YXD B;  3DHI C;  3TEW A;  4KV2 A;  1V80 A;  4HKQ A;  4LJO B;  4M01 A;  3ZIM A;  1SIF A;  4W9C A;  2M0A A;  1D5M C;  1CQV A;  4WWN A;  2PTL A;  3AE8 B;  1A70 A;  2QIL A;  1QZE A;  2Y5B B;  4IWQ A;  1F2R I;  3AE4 B;  2M19 A;  2K1F A;  5LXH A;  1WGD A;  3N9Y C;  2LGD A;  2LXA A;  4M0W B;  1PDX A;  2ZCC A;  1XLN A;  4PS3 A;  2JRH A;  4US9 A;  4K7W A;  4AS1 A;  3LDZ E;  2KAN A;  1T3Q A;  4OVZ A;  1TGZ B;  4NJC A;  1TS2 A;  2JZP A;  4W9D A;  2YLM A;  2ZVN A;  1R4N I;  4MJS B;  1PGB A;  5J18 A;  2Z0D B;  2G45 B;  4B95 A;  4I6L B;  4W9K A;  3LB8 C;  3U52 E;  4EOY A;  1S3S G;  2XBB C;  3VDZ A;  3B2F A;  3UIP B;  1UH6 A;  2CHZ A;  4GLS C;  2N7E A;  3B08 A;  4BKS A;  1WX9 A;  4EZL A;  4NY0 A;  4MT5 A;  3EC8 A;  1R4N B;  1I4Q A;  1JRP A;  2L83 A;  1KTK A;  4LJP B;  1AYF A;  2MLB A;  2X38 A;  5DPT A;  4XGA B;  1TS3 A;  4HCN B;  3UI3 A;  3A9J B;  5H8Y E;  2WYQ A;  4JX1 C;  4QAY A;  4OVV A;  2H89 B;  3DVG X;  4WUR A;  4LK0 M;  1QKZ A;  2LI5 A;  3CSF A;  3U30 A;  1B9R A;  2WXF A;  1F0Z A;  1I4R A;  3X0W A;  3JVZ X;  1NI2 A;  3ZRC A;  5BMG A;  2R61 A;  1YN4 A;  3UQB A;  3P4S B;  1TYG B;  1TZ1 A;  1V1P B;  4IM2 A;  2AYO B;  1WR1 A;  1WXM A;  1PYW D;  1GUA B;  1UBI A;  2IDY A;  3P42 A;  5DCN A;  4D2K A;  2KWC A;  2NTS A;  4IC7 B;  1XD3 B;  3AU4 A;  1GC7 A;  4OHJ A;  1DOX A;  1QLB B;  2BQQ A;  3DVN U;  2KNB A;  4BBN C;  1BT0 A;  2JXT A;  2MA9 B;  2XEW A;  4BFR A;  1K51 A;  2V4L A;  1H8C A;  4DWF A;  2IY0 B;  4XC2 A;  3D32 A;  3TL5 A;  4BKT A;  2KC2 A;  1FRD A;  4BBN F;  3BZD B;  3HUI A;  1UD7 A;  3VUY A;  3AED B;  4JPS A;  1V97 A;  1XCQ L;  2HJ1 A;  3ABV B;  1D3Z A;  2IGD A;  4L1B A;  2PE6 B;  1WIA A;  4EZJ A;  3W1S A;  3DHH C;  5JHB A;  1IYF A;  3B9J A;  1ISN A;  2C9W B;  1JWM D;  1LXD A;  1XLQ A;  2N9X A;  1CZP A;  2CHW A;  4KIK B;  1E7U A;  3MJW A;  2BBC A;  1T6B X;  2AEH A;  2LVO A;  2CKH B;  1V8C A;  3L0W B;  2IO1 B;  2N7J A;  4JGH B;  1OTR B;  3SD5 A;  2BWE S;  1UGJ A;  3VTU A;  3ZNH B;  1QF6 A; 
#chains in the Genus database with same CATH homology
 1ENF A;  4YTP B;  3AE7 B;  4YT0 B;  1JWU D;  1KFY B;  1VR9 A;  2BS3 B;  3AEA B;  1TJE A;  1SJE D;  1ZE3 D;  1YN5 A;  1VZ8 A;  2W54 A;  1NYQ A;  1KH0 A;  5LNK 1;  1AN8 A;  2IGH A;  3H8H A;  2JSV X;  5JXV A;  1I4X A;  3SR6 A;  2DBY A;  1N5X A;  2LGI A;  5C2T B;  1XO3 A;  4L23 A;  4IKG A;  4OW0 A;  2KAJ A;  1WWT A;  3AEB B;  3EA6 A;  5BYR A;  4L2Y A;  3AE9 B;  3BVM A;  2WNM A;  4ZHP A;  3AE6 B;  4KX6 B;  2WQY B;  3E9S A;  1EU4 A;  3ETR A;  3VRA B;  2RDG A;  1YQ3 B;  3BVZ A;  1JQ4 A;  3ZYY X;  1PFD A;  3HRD D;  4YSY B;  1QQR A;  3R2I A;  1I4G A;  1T5X D;  2VZK B;  2QEJ C;  1ESF A;  5EE9 A;  1MI0 A;  2AQ2 B;  5FKA C;  3RPF C;  2ICI A;  5H92 C;  2G1E A;  4M0W A;  1XEE A;  3AB5 A;  3C8Y A;  4XWT A;  4C7Z A;  1UNS A;  2YEP B;  2V3P A;  1YN3 A;  3KWV A;  2WXI A;  3E56 A;  3P63 A;  2H88 B;  3P1M A;  2Y5C A;  2AQ1 B;  1C77 A;  1ZXH A;  1FCC C;  3AEC B;  3MC0 B;  1L4D B;  5GXG B;  4A9A A;  1FCL A;  4NZL B;  3EGR A;  1L0V B;  4NAM A;  4MM3 B;  1FM0 D;  1B1Z A;  1FXI A;  1VRA B;  1YQ4 B;  2JQR B;  3NVZ A;  4US8 A;  3IT4 B;  1TZO A;  1GB4 A;  2KN4 A;  1OQR A;  1L5P A;  2QSD A;  3MFG A;  1NEK B;  3KLS X;  1ET9 A;  1SB3 C;  2Q5W D;  1DGJ A;  1YJI A;  2QIE B;  2IGG A;  2WXH A;  4N6E B;  2JWU A;  3AEE B;  4OZA A;  2IPK D;  1AW7 A;  1NEN B;  2AQ3 B;  3Q8A A;  1E10 A;  1CJE A;  2BB5 A;  1SEB D;  2N9K A;  2RPV A;  3GS2 A;  4YTM B;  4JWS C;  3CIR B;  2LJI A;  2YEP F;  3KWL A;  2K0P A;  4RNA A;  2WS3 B;  1R7S A;  4IDI A;  3ZGZ A;  3B2G A;  2BS2 B;  1MVK A;  1SSN A;  2FBW B;  1RFK A;  5I4D A;  4ZYS A;  4MAC A;  2ZW1 A;  4EE2 A;  2INN E;  2AX5 A;  2DYM A;  1FIQ A;  1CK1 A;  1K50 A;  1JW9 D;  1TKE A;  4O1N A;  2K3U A;  1RM6 C;  1YJJ A;  5D3I B;  1M4V A;  3L4P A;  4J3O D;  2DYO A;  1DOI A;  4C80 A;  2BYT A;  3RFZ B;  4DQO C;  1VDV A;  4RF0 A;  1L0Y B;  1EU3 A;  4XDC A;  3NRZ A;  2L1A A;  1FO4 A;  3AEF B;  2J42 A;  4XWW A;  4A6Q A;  1HZ5 A;  4RFB A;  4RGO S;  1D4B A;  3W5V B;  1FRR A;  2XN9 C;  1D5Z C;  1SBB B;  3PO0 A;  1ROE A;  3P4Q B;  4JWU C;  2V0G A;  3BII D;  1EM7 A;  3BWU D;  3VR9 B;  2Y3A A;  2JYE A;  3DWM A;  2PLP A;  1PGA A;  1ZPS A;  3AE2 B;  2WXP A;  1FD6 A;  4IOI E;  2JX5 A;  1ACC A;  3SFD B;  1HEZ E;  2MEK A;  5TSS A;  1GPX A;  1EWC A;  2LFI A;  2LHD A;  1LO5 D;  1JAL A;  1OQQ A;  2E3T A;  4LTU A;  5D7G A;  3P4P B;  3EUB 2;  4TSS A;  4TQ1 A;  1V1P A;  2M56 B;  1JWA D;  3MJ5 A;  4OZC A;  1D6E C;  1D5X C;  1WXQ A;  4UDU C;  1ZP0 B;  2INP E;  2KDM A;  4OZB A;  1MHX A;  2LEK A;  1E9M A;  1RWS A;  3AV8 A;  1HA5 A;  2GB1 A;  3LYY A;  4RGM A;  1ZDX A;  4HRS A;  1N62 A;  2SAK A;  1P7F A;  1SIJ A;  3NVV A;  1STE A;  1JCK B;  1J7C A;  4NAW B;  2IJ0 A;  3T3O A;  2J4X A;  4FXC A;  4ZOH C;  1SXT A;  3I9V 1;  5T8I A;  3V05 A;  5BMI A;  3J9C A;  2LMC A;  4XDD A;  1XLP A;  3BYT B;  4A8X C;  3TEZ A;  1UWX A;  4ARI A;  1TY0 A;  2J52 A;  1GOZ A;  1L6V A;  1C78 A;  1TKY A;  1C4C A;  1FNW A;  1JRO A;  1TY2 A;  1WGK A;  2ON8 A;  2V3N A;  4A55 A;  1IBX A;  3FAH A;  5BYQ A;  1SE3 A;  4B0M A;  1JWS D;  4N59 A;  4P16 A;  4DXG A;  3VRB B;  4HJG E;  3BVG A;  1YMH E;  3FIL A;  4KGS A;  5BYS A;  2KAC A;  1WSP A;  3W2D A;  2WXN A;  1HZ6 A;  1IUE A;  1PGX A;  5HI1 A;  1N60 A;  3WCQ A;  1ZOY B;  4ZRP A;  1JWB D;  2HTM E;  3Q8C A;  2PIA A;  4RGN A;  3BK2 A;  2KQ4 X;  1XXG A;  2BS4 B;  1IGC A;  2G9H D;  1VZ7 A;  2W82 A;  1E7P B;  1HQR D;  4RH6 A;  1XCT L;  1E6E B;  1Y56 A;  4REZ A;  3OWE B;  1TKG A;  5EE1 A;  1BML C;  1FMA D;  4RF1 A;  2JU6 X;  3VR8 B;  4MH8 A;  4KGT A;  1C4A A;  2DLB A;  2WDV B;  2WXL A;  3HVZ A;  3URY A;  4CQN A;  2ZW0 A;  2J53 A;  1I4H A;  1WRI A;  3U2S C;  1FEH A;  4C56 C;  2BW2 A;  1SF0 A;  1YNT E;  1NI3 A;  2W55 A;  2XNA C;  1L4Z B;  4ITK A;  4RGT A;  1UWM A;  2GRI A;  4B0E A;  3BK1 A;  5D3D A;  3NUH B;  3PZ7 A;  1I7H A;  1P7E A;  2D5G A;  4TMA B;  4YXD B;  1KLG D;  4Q2J A;  3TEW A;  4HKQ A;  1RYJ A;  2QMT A;  1QOA A;  1KRH A;  3ZJT A;  4WIP A;  3T3N A;  3W9C B;  3IAM 1;  2PW9 A;  2M0A A;  2E6X A;  3AM9 A;  2ACZ B;  1V1O A;  1D5M C;  2K5P A;  1CQV A;  2OHF A;  1ZXI A;  2PTL A;  3AE8 B;  1A70 A;  2B76 B;  2QIL A;  3NVW A;  4R3D A;  1F2R I;  3FC4 A;  3AE4 B;  2M19 A;  3CWI A;  4HRO A;  3N9Y C;  4USA A;  1PDX A;  1XLN A;  4RCO A;  4US9 A;  2GI9 A;  4AS1 A;  1OFF A;  4WH4 A;  1WYG A;  1C76 A;  1T3Q A;  4OVZ A;  2K9X A;  4AQ7 A;  1IBX B;  5HG2 A;  2NMQ A;  5C3J B;  4PT5 A;  3BYY B;  1I4P A;  4NJC A;  2W3R A;  2V4I B;  2LHE A;  2WXQ A;  1TS2 A;  1SE4 A;  2JZP A;  2L32 A;  2ONQ A;  1PGB A;  1FFU A;  3MP9 A;  1ZUD 2;  1QOF A;  3SFE B;  3AE1 B;  2WXM A;  3LB8 C;  1E0Z A;  2PVG C;  3NS1 A;  3U52 E;  5HFY A;  1DYQ A;  1FFV A;  2L52 A;  3V3X A;  3B2F A;  5E6J A;  1VZ6 A;  3MHZ A;  4GLS C;  4GDL B;  1ET6 A;  2NTT A;  1N5W A;  4KGR A;  3IT6 B;  2WU5 B;  1F2R C;  2PVO D;  3R2T A;  1XLO A;  4KKJ A;  2WDR B;  3AE5 B;  4MT5 A;  3ZJV A;  2WXK A;  1VJK A;  5AUI A;  2MH7 A;  1I4Q A;  1QT9 A;  1JRP A;  1C9F A;  4YSX B;  2OED A;  2BTE A;  2Z8L A;  2L83 A;  1FXA A;  4GDK B;  1KTK A;  1AWD A;  1N61 A;  2I38 A;  1SJH D;  2SEB D;  1AYF A;  3HVD A;  5AUK A;  1MPE A;  2X38 A;  3ZJU A;  1TS3 A;  3TEX A;  3PZ8 A;  2DWQ A;  2PKO A;  3UI3 A;  1KLU D;  1KF6 B;  3GB1 A;  5H8Y E;  1QOB A;  2JYT A;  4WQM A;  1EWY C;  2WU2 B;  4JX1 C;  1N63 A;  4ZRQ A;  1BXT A;  2KWD A;  2N0S B;  2Y5P A;  3W5U B;  2H89 B;  3U7Z A;  2BB6 A;  1J7B A;  3O13 A;  2KMM A;  1QIL A;  4WUR A;  2EKI A;  4LK0 M;  1NYR A;  2CJN A;  1NVI D;  2FUG 1;  1MHH E;  5EE0 A;  5G5H A;  4N58 A;  1QKZ A;  3Q8E A;  1K52 A;  1B9R A;  2WXF A;  1K53 A;  1F0Z A;  1I4R A;  3Q8F A;  2WP9 B;  5EE3 A;  3I57 A;  2N9L A;  1L6U A;  5BMG A;  1C4P A;  2FE8 A;  2R61 A;  5FR3 A;  1YN4 A;  3AE3 B;  5FK9 C;  4LLG M;  3LXF A;  3P4S B;  1TYG B;  2WXJ A;  3ZQ4 A;  1V1P B;  3R8B A;  2VZK D;  1GAQ B;  1PYW D;  2IDY A;  3P42 A;  4JE3 B;  4D2K A;  1F77 A;  2NTS A;  1JML A;  1XF5 L;  3NZ3 A;  5BMH A;  4OHJ A;  1J7A A;  1DOX A;  2CU3 A;  3AEG B;  1QLB B;  3AH7 A;  2CJO A;  3IAS 1;  2WXG A;  3DWG C;  3AN1 A;  2JXT A;  3VQI A;  2EEL A;  1K51 A;  5G5G A;  4YSZ B;  3P4R B;  4YWG G;  1UUP A;  1FNV A;  1FRD A;  3Q8B A;  4C7Y A;  3BZD B;  2K22 A;  3HUI A;  2MJE A;  5MPO A;  2RDH A;  3AED B;  3IXS A;  4JPS A;  2WDQ B;  2TSS A;  1PUT A;  1V97 A;  4TQ0 A;  1XCQ L;  2WXO A;  1IGD A;  1TS5 A;  3TEY A;  1HXY D;  4ZHO A;  3ABV B;  2IGD A;  2BT6 A;  2WLB A;  2PMV A;  3KQ4 A;  4L1B A;  4YTN B;  3NVY A;  4ARC A;  3AMZ A;  3W1S A;  2RMM A;  2QJL A;  1VLB A;  1DOY A;  3B9J A;  4XE0 A;  1TS4 A;  3FIL B;  3SEB A;  1JWM D;  1XLQ A;  1ZDV A;  1C79 A;  5HHD G;  1CZP A;  2I2Y A;  1Q10 A;  2MJD A;  1QOG A;  3TUO A;  4WAF A;  2BBC A;  1T6B X;  2MJ3 A;  4A90 A;  2LUM A;  2HDE A;  4WWM A;  1BUI C;  4DXF A;  1FNU A;  1V8C A;  3Q69 A;  1L0X B;  1GB1 A;  4P6V F;  4KKI A;  2WXR A;  1SE2 A;  2N7J A;  4HEA 1;  3U4E G;  4HKZ E;  3GP7 A;  3TSS A;  1UGJ A;  1QF6 A;  4H2A A;  2W3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...