1MHXA

Crystal structures of the redesigned protein g variant nug1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
b'MHHHHHHAMDTYKLFIVIGDRVVVVTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAAKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords immunoglobulin-binding protein G
publication title Crystal structures and increased stabilization of the protein G variants with switched folding pathways NuG1 and NuG2
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhxA00
2IGHA 1MVKA 1HEZE 2PW9A 2GB1A 5HG2A 2N9LA 1YNTE 2PTLA 5BMGA 4MACA 2J53A 2KQ4X 1GB1A 4HJGE 1MHXA 4GLSC 1P7EA 2ZW1A 1C9FA 1IBXA 2N7JA 1HZ6A 5HI1A 1IBXB 2ONQA 1HZ5A 3GB1A 1Q10A 2JZPA 4HKZE 2KN4A 2I2YA 1MPEA 5HHDG 1MHHE 4KGTA 1JMLA 2KWDA 2JSVX 4IKGA 1GB4A 5BMHA 2JXTA 1PGBA 1PGXA 1XF5L 2LHDA 2IGGA 2PLPA 2I38A 2EELA 1FCCC 1P7FA 5HFYA 4KGRA 3FILA 1F2RC 2JWUA 3FILB 2GI9A 2LHEA 5JXVA 2NMQA 2J52A 1QKZA 2KDMA 2RMMA 1YMHE 2LGIA 1K51A 1XCTL 1ZXHA 3V3XA 4D2KA 1IGCA 2ON8A 1UWXA 4OZCA 1F2RI 2ZW0A 1EM7A 3MP9A 1XCQL 2QSDA 2IGDA 2KACA 4OZAA 2LUMA 1FD6A 2JU6X 4KGSA 2QMTA 1K52A 1K50A 1K53A 4OZBA 2N9KA 1D4BA 1MI0A 5BMIA 4WH4A 1PGAA 2RPVA 4IOIE 2OEDA 1KH0A 1IGDA 3UI3A 2K0PA 1FCLA
chains in the Genus database with same CATH superfamily
2LGXA 4HVBA 2WDRB 1HEZE 2PW9A 3ML9A 4L2YA 3HRDD 2BYVE 1RM6C 2NTTA 2BTEA 2FIDA 4A90A 4HEA1 1C3TA 1DOIA 2D3GA 1ET6A 2NBUA 1L5PA 1TKEA 1IBXA 3P4RB 4JLCA 1YN4A 1HZ6A 2MBQA 3PRZA 2ZPYA 2K5PA 1XLPA 1V80A 3QX1A 2HE7A 1GJZA 4RH6A 3DHHC 2NCNA 5TR5A 1WI0A 3NHEB 3ZLZA 3RNFC 4BZAA 1ZW7A 3O13A 3ABVB 4S0RA 1ACCA 5J17A 4EZLA 1WX8A 2JT4B 2H89B 1GC6A 2WXMA 3W1SC 2V3NA 3M63B 3DBSA 5E6JA 2ZNVB 2NTSA 1FNVA 5AUKA 1E8WA 3FILB 3ONSA 2J52A 2KDMA 3L16A 4YL8A 3TEWA 3E9SA 2Q5WD 3DVNV 3QQ8B 3W5UB 1SIFA 4ZYSA 2MLBA 3B1LX 3N1XC 1L6UA 1IP9A 3NG0A 4D2KA 1N6ZA 1LXDA 3IVFA 2LXAA 1H8CA 2KKCA 2GBMA 1WM2A 1R4MB 2DNFA 1JWSD 1BMLC 3P63A 1N62A 3JYUA 4GDKA 4BKSD 2FCQA 2ZVNA 3VXWA 1BXTA 2GBKA 1UNSA 4DK5A 4WH4A 4MEMA 1LQBA 5D7GA 4ARCA 2V3SA 2J0KA 3AB5A 2WGSA 5EE1A 3AE4B 3GZNI 1TTNA 3CMMB 3VHTC 1R4NB 4XYCA 3WANA 4IW0A 3ZW3A 2KVRA 3EECA 1MVKA 2QHOA 1WRDB 3RCZA 1YIWA 4GDKB 1SE2A 4MACA 1FPYA 2IO2B 3CSTA 3DHGC 4RF0A 4WJOA 3SHQA 3OLMD 1GAQB 3LXFA 2J4XA 2G4DB 2G4SA 2DX5B 1LGRA 4KZ0A 4DHJB 2JYEA 3FKYA 3PZ8A 1FNUA 2Y5BB 4S17A 1L4ZB 4LLGM 2FIFA 3RZFA 2KTRB 3RNBC 5D2MB 3UQAA 1WH3A 2DLBA 3HVZA 1U4AA 4RMAA 1WXMA 4HCNB 5J2RA 4CYEA 3ZQ4A 1RYJA 5JH5C 1E7VA 1YMHE 4G11A 2LGIA 2K8CA 1KLUD 2QC8A 3P4PB 3AEAB 3SD5A 5C1ZA 2YVCA 1JW9D 1C78A 4A6QA 4RGTA 3U8ZA 4NPNA 1XD3B 1K53A 5TSSA 4A9AA 2KFJA 2KAJA 4OW0A 4RCOA 1E5WA 1QOBA 3VTVA 1GOZA 4AS1A 2IPKD 3ETRA 1VDVA 4JL9A 1J19A 3B0AA 3WIMA 2WLBA 4NJCA 3DWMA 3AH7A 1WYGA 3ZUNA 1I4GA 3A1QA 2L76A 1WX7A 3KYCD 1FO4A 4LNFA 2KVZA 3O65B 2C7MB 3NY5A 1XO3A 5BYSA 3DBHB 3RULA 4CQNA 1WIAA 3ZYYX 4KDLB 3V60A 3BVGA 3NS8A 4M0WA 4RM9A 3OJ3A 2JRHA 4XE0A 2DWQA 2HJ8A 1K8RB 3MC0B 3PRMB 5HHDG 1MHHE 4NJ6A 2JSVX 4R3DA 3H9DA 3PV1A 1XF5L 1TS4A 1M94A 1DGJA 2MJ3A 3Q3JA 2KDBA 3A33B 1WFYA 3Q8EA 3VTWA 2NVUI 1QOAA 5JXVA 1CMXB 3VRBB 4JWSC 4PYZA 3RNGC 4M0WB 2E3TA 3UF8A 4OHJA 2DZMA 1WY8A 3DPDA 1AW7A 4MELA 3V3XA 4MH0E 3WALA 2KQSA 3B2GA 4MM3A 1L0YB 4TV3A 1STEA 2Z0DB 2JZZA 2ZW0A 3NVVA 2RGFA 1SXTA 2DYBA 4II2B 1EM7A 4PS3A 2KOXA 3Q3FA 3RI7C 2J0JA 2WS3B 1ENFA 3WAPA 1K50A 2ACZB 2D3BA 4AP4C 2KXJA 4JPSA 3PTFC 1OEYA 2KDFB 2NBWB 2KWCA 1UWMA 4AUQC 4C4VA 3KH0A 1PGAA 4ANVA 3X0WA 3LDZE 4MM3B 3ECIA 4PS8A 2DAFA 2JWZA 2BBCA 2ZJDA 2WU5B 3V62A 2IGHA 2D07B 3ZNHB 3VH3B 2N9LA 2PTLA 5DPTA 2BPSA 3IBEA 2J53A 2JXXA 4JE3B 1A5RA 1I4HA 1WGHA 1KOTA 4C4VB 2PVGC 1ZOYB 3L08A 1EU3A 3QC8B 3EUB2 1D3ZA 4P1BC 1OGWA 4W9DA 4NQKE 4HCPB 1HZ5A 5FR6A 3GB1A 1QILA 3U4EG 5CTRC 2FAZA 1FRDA 2Y5CA 1JMLA 2XNAC 4CO7A 2NR2A 1WGGA 1HA5A 2K3UA 2DZIA 2BKFA 1JWBD 1GB4A 2JXTA 3D32A 3KLSX 4LNKA 4KSLC 5IO9A 3ZKJC 3AI5A 2CS4A 2M17A 3C8YA 1TYGB 4KGRA 4WJPA 1WJ4A 2WDTB 2NS5A 3K9OB 3M95A 1WZ3A 1OEYJ 5CX3A 4C80A 1L2NA 1ROEA 3GS2A 3ZTDA 2VZKB 4IM0A 2D10A 2V3PA 2PE6B 1TZOA 2LRUA 4MGKE 1I4PA 1NDDA 2JF5A 1IGCA 2AQ1B 2ZEQA 1TIFA 2RR9A 2WXLA 2PE9A 3N32A 1FIQA 4ZRIA 3U30A 2KHWB 4W9FA 1CZPA 2IYDB 3TBLD 4TQ1A 2A5UA 1S3SG 3VR9B 4ZOHC 3H7PA 1C4AA 4B0EA 2NBVB 5KHOA 2ZVOA 1IGDA 1OFFA 2PVOD 1OQRA 4YSZB 3TJPA 4NAWA 3VFKA 3RMKC 4USAA 2KDEB 2WXRA 4N9F4 4N58A 1YJ1A 2G9HD 2AL6A 1MHXA 3AEBB 2LGSA 1WJ6A 1N63A 3H7PB 5CHWA 4LDTD 3R3MA 2BGFA 2NPTA 4L1BA 4EOYA 5EE3A 5BO4B 1I4QA 1JWMD 2DZJA 4NAWB 4KV2A 3EGRA 4UDUC 3ML8A 2IBIB 2OOBB 2N9XA 5E6NA 3QJZA 3HM6X 3P42A 3I9V1 1D5MC 5AZHA 1TJEA 1FXIA 3APFA 3AE5B 2DYOA 3AE2B 4C56C 4EZKA 1JRPA 2BF8B 2NPTB 2KJHB 2RMMA 3MFGA 1QZEA 1TZ1A 2WXKA 1UGJA 4HK2A 1LM8B 2X38A 3QIJA 2ZCCA 1XCTL 2ZNVC 2HTHA 1VD2A 3M62B 2ON8A 2IO3B 2RDGA 4DDID 3ZRFA 1KJTA 1MG4A 4ITKA 1XCQL 3T3OA 1SBBB 4M00A 1ET9A 2KFKA 4B9KA 1IYFA 1FD6A 4BKTA 3AE3B 1Q1OA 1FEHA 2WXHA 2E6XA 4BAXA 3DBRI 3AULA 1C79A 5KHQA 1E7PB 2J7QB 1ZUD2 1PQSA 4W9LA 3VTUA 1E9MA 3NVZA 4BOSC 2O2VA 1L7YA 1WRIA 2QCZA 2KFKB 1VZ6A 1NYRA 3X23A 4W9JA 4LNIA 1YJJA 5I4DA 2DHZA 4XGAB 1QT9A 2KQ4X 1PDXA 3QAQA 4EFOA 4GOCA 5IKCM 1P7EA 1E0ZA 4N6EB 3DWGC 3N20C 4P16A 1WSPA 3DOWA 2WU2B 2JZPA 3E56A 3DBRB 3CWIA 3V05A 2O2VB 5BYRA 1D6EC 3ZVVA 2LRWA 4N59A 2BWFA 1FNWA 3ZDTA 1TY0A 3R7RA 1GPXA 1YOVB 3FILA 4HROA 4BOZB 2W55A 2WQYB 3DQVA 4BBNF 2LI5A 1MFWA 4KX6B 3RZWC 1VRAB 1ZXIA 4J3OD 1TT5B 1EF5A 2ASQA 3ZDMC 2WXIA 2WNMA 4YTMB 2BB6A 3I3TB 3AE6B 2CKHB 2IDYA 3NS1A 3VRAB 3SR6A 2YEPF 1T5XD 1NI3A 3BINA 4TMAB 2K9XA 3PLUA 4HDQA 2QMTA 2JQRB 1RAXA 4TUUA 1RWSA 3UIOB 3AM9A 2B3AA 5L95C 2KZRA 4F1SA 1KLGD 3KUDB 2RPVA 4GGQA 1SB3C 2OEDA 2LFIA 2PJHA 3Q3OC 3WAOA 1WXAA 3PSEB 2WXQA 3HVDA 4DHZB 1HTOA 2C7NB 4RM8A 1I4RA 5IN7A 5BYQA 4WQOB 1G6JA 1SIJA 5EDSA 3GP7A 3CIRB 3B9JA 1M4VA 3CSFA 4W9IA 2PKOA 3KWLA 3EHVA 2GBJA 2C9WB 3UGBB 4O1NA 4YSYB 2K8BA 1I42A 4A55A 2LJIA 2CJOA 2QIEB 4PK1A 3AE7B 4NQLB 1PFDA 2KTRA 5BMHA 2IJ0A 3DBLI 1QLBB 5JHBA 4MSQB 1TS5A 3N30A 5GXGB 4KIKB 3PVLA 3VR8B 2DYMA 2M0AA 1E10A 3OWEB 4G0NB 1F77A 3P4QB 2JWUA 2KX3A 1FXTB 4IWOA 4AOFA 2FNJB 4DHZE 4K1RB 4IWPA 2IZVB 3IFWB 4MDKE 1XEEA 3GZNB 1UBIA 2O6VA 1WE6A 2V1YA 2QSDA 1UF0A 3Q3MC 1AARA 4KSKC 1UBQA 3DBLB 2AL3A 2KMCA 3BYTB 4IDIA 4US9A 4WWPA 4DHJD 1J7BA 5AZFA 4OZBA 5E6PA 1VLBA 1D4BA 1JCKB 3J9CA 2KQ7A 2KLCA 3Q14C 3KWVA 2ZCBA 2KX0A 1NYQA 3MHZA 1XQQA 4YTNB 2WDQB 4F8CB 2O6VB 1YQBA 4Q2JA 1V1OA 2DBYA 4IM2A 3ZNZB 1QOGA 2LWPA 2LVQA 1WYWB 3L10B 4I6LB 2V0GA 2V4IB 3BVMA 4RGMA 3AEEB 2LVPA 1YNTE 4CHKA 1KM7A 4ICVA 4OVVA 2ZPNA 4TKNA 1J0GA 3HIZA 1SE4A 2K39A 2N1WA 2ZW1A 3HHMA 4LJOB 4HPPA 2M1MA 1L0XB 1V49A 1T3QA 1EWCA 4HPMB 1N5XA 2KWUB 3M3JA 4HKZE 1V6EA 2G45B 2I2YA 3VH4B 4RNAA 4KGTA 2KWDA 4GIVA 3IAS1 3R7QA 1SSNA 3CF6E 4HKQA 3URYA 3ZJVA 2LZ6A 4PT5A 1XLQA 3AE1B 4KVGB 1FCCC 1TKGA 2LUEA 5AEKB 3QCAA 2LHEA 5IAAC 4K81A 3ZJTA 3AN1A 2LJ5A 1UUPA 2PMVA 2RSUA 2MW5A 2IO1B 2UWQA 5G5HA 4XWWA 4W9EA 4OVUA 2WXJA 4IM3A 1EF1A 3I5JC 4AJYB 4FLHA 1V9JA 4WAFA 1ZPSA 2Y5PA 2HTME 2IGDA 2K8HA 3BY4B 1XLNA 4KGSA 2W82A 2Z8LA 3BYYB 1B9RA 4FN2A 1RFAA 4NZLB 2EKIA 1UD7A 3ALBA 1IUEA 4WJNA 2BB5A 4TSSA 3RUIB 1WGKA 3N1YC 3IXSA 4W9KA 3NJTA 1EWYC 4LK0M 4GU2A 1VCBA 2WXPA 2LGYA 4XWTA 4FJYA 4C00A 3TSSA 4AQ7A 1XT9B 1PUTA 2JRIB 3SEBA 1CK1A 1JALA 4X57B 1WR1A 3LJ3A 2KN4A 2BS3B 2L3ZA 1MPEA 3ZXVA 3RT3B 5EE0A 3VDZA 4YTPB 3A9KB 3C0RB 1ZDXA 4ZRJA 5IP4D 4K3BA 1ZDVA 1PGBA 3ZO5B 2FUHB 2DAJA 2SEBD 1MJDA 4IC7B 1SF0A 4K7UA 4A20A 4A8XC 1F2RC 2WX1A 1ESFA 1NI2A 1T0YA 5C3JB 4BVUC 1V81A 4KKIA 5JZEB 2I1JA 1QF6A 1Q0WB 1ZP0B 3ZRCA 3OAWA 3SU8X 1HXYD 3TMPB 5LXIB 5G55A 1OQYA 2CHWA 4FA6A 4GN1A 1KTKA 2INPE 4YT0B 3VUXA 3GE3C 3R66C 2RPQA 4BFRA 4XX5A 2D11A 2AX5A 1TGZB 4YSXB 1EUVB 4L23A 3H1UA 4M8NA 5FKAC 3ZNID 1HQRD 2KTFA 2MSED 3DVGY 3PREA 4W9GA 2MWSB 3HUIA 1Q5WB 3MHSD 4DXAB 3RD2A 2FCMA 5HG2A 1JWUD 2JZ3B 3S2AA 1GB1A 1J7AA 4GSWA 4GLSC 5GMVA 1WZ0A 1LFDA 2MCNB 3WA0A 2CR5A 2D2QA 3VUYA 2QDFA 3UIPB 1Z2MA 3RNAC 3VQIA 4B0MA 4MT5A 3ZGZA 3W9CB 4MJSB 3H6NA 1Y56A 2IGGA 4LDTB 3KUCB 2KMAA 3LB8C 3MJWA 4GDLA 2LMCA 2KC1A 3N1ZC 2KJ6A 1WF9A 4K3CA 5D94A 3AE8B 3BZDB 3KVFB 1V5TA 2LGDA 2BYTA 1C4PA 5DPRA 2J42A 1P9DU 2V9HA 1L0VB 5E6OA 2KNBA 4YWGG 2C5LC 1YQ3B 2QILA 1RLFA 2W54A 2MA9B 3LYYA 3FC4A 4GDLB 2GBRA 2HJ1A 1RRBA 3HM3A 4ZYNA 3AEFB 2L32A 4HDOA 5CHFA 4IG7B 1V8CA 4XC2A 1CJEA 1C76A 2BW2A 4GMVA 2JY6A 2YEPB 2LVOA 2KMMA 3TIXA 1E7UA 3W2DA 4ZDVA 3BK2A 1NVID 2LXCA 3QK0A 2N7EA 3VAWA 3WAMA 1WJNA 2AQ2B 2MBHA 4RGOS 1D5ZC 4IUMB 5H92C 3JSVB 3TEYA 2IO0B 2R2OA 2XEWA 2RD0A 1QQRA 2K1FA 2A4ZA 4IKGA 1SJHD 1IPGA 1SE3A 2EKEC 2PLPA 1TS2A 2AEHA 2KC2A 2KN5A 2WXNA 2W3RA 2FUG1 1SJED 4MSMB 3AV8A 3L13A 4M8MA 2GI9A 4FXCA 1V1PA 3RNCC 3SFEB 5G2NA 3RN9C 3OG5A 2L05A 3A9JA 3IT4B 2BS4B 2SAKA 2J0MA 1RFKA 1LO5D 2MHJA 3I57A 2INDC 5AUIA 3R8BA 3V61A 3A4RA 4DQOC 1V1PB 1UELA 4TQ0A 1WGDA 1T0QC 2CU1A 4WAAA 2XK5B 2K22A 2IY0B 1SEBD 1N5WA 1WXQA 3A9JB 2YLMA 2WWZA 5H8YE 4BKSA 1HE8A 3PT2B 4FHKA 4WWMA 1WMHA 3KYDD 1T0RC 3AXCA 3RNEC 4ANWA 1P1AA 1R4MI 4K7SA 1PYWD 1QOFA 2OJWA 3V6CB 2MBOA 3U7ZA 1GNUA 3K9PB 4WIPA 3Q8CA 3Q2AC 3JVZX 3H7SA 1IBXB 1YX6B 1WMHB 4MGZE 1ZE3D 2QJLA 2G1EA 2JX5A 1R4NI 4J6IA 1TKYA 1PGXA 3NZ3A 4KIKA 4MGYE 4WWOA 1D5XC 3PO0A 2REXA 1BUIC 3AU5A 3PS6A 4LNNA 3EFCA 4QAYA 1QKZA 4WQMA 1NEKB 1JWAD 3AMZA 4EEWA 3NRZA 4F7ZA 3NVWA 2BT6A 2B76B 1GUAB 1KFYB 2N9PC 2PIAA 2L83A 5DPWA 2KT7A 1ZXHA 1F0ZA 1N61A 3PGEA 3DCGA 3RFZB 4XDCA 1DOYA 3MTNB 2LEKA 4P7IA 1FMAD 1X1MA 2ICIA 3PRPB 2KLGA 1L6VA 2KDIA 2BKRB 4B95A 4ARIA 2ZZPB 3KUZA 1WGRA 3Q8AA 2FCSA 2DENB 4DBGA 2R2QA 2KANA 1YN5A 5EE9A 1E8ZA 1KLVA 2HD5B 1H4RA 4RFBA 4EUTA 1I4XA 1E90A 2BYEA 3V6EB 3NOBA 3W1SA 2K0PA 2D5GA 4LTUA 2L52A 3DDCB 2WXFA 4WJQA 3W5VB 1Z5SB 3TUOA 2FE8A 3KW5B 2WHIA 4JQWC 4W9HA 5BMGA 2GOWA 2N7DA 4PS7A 2AWTA 3IT6B 4KDIC 2MP2A 4HJGE 1FRRA 5JHAA 3ZIMA 1E8XA 1P0RA 2L1AA 1TY2A 2K6DB 1V97A 1V5OA 2WYQA 2MX2A 3ZXRA 4NY0A 1Q10A 5LNK1 2M19A 4II3B 1CQVA 4NNJB 5AZGA 1ISNA 2WX0A 2W3SA 5D6JB 2INCC 1OQQA 1P7FA 1VJKA 2EELA 3BVZA 2MP2B 1XLOA 4REZA 4EKUA 4FJZA 2O6VD 3APDA 2TSSA 2PEAA 1VZ7A 2NMQA 2UU7A 3DBHI 4C7YA 3SFDB 3B2FA 3MC9A 1K51A 4HJKA 1ZGUB 3AE9B 2C7HA 5T8IA 3FAHA 4H2AA 3TCAA 2Z59B 2V4LA 1Y8RC 1WX9A 4M02A 4RF1A 4LJPB 1L4DB 3Q3NC 3TEZA 1FFUA 5FK9C 2LASA 1YQ4B 2N9EB 2RDHA 2MRPA 4XZ4A 4NJ7A 2Y3AA 3TEXA 2OJRA 3C19A 5BMIA 3L17A 4ANUA 4IOIE 1KH0A 3VVWB 3UI3A 3EFUA 4ICUA 2N0SB 2CJNA 1S1QB 1UH6A 2W9NA 3IG3A 3N3KB 2N1VA 2GB1A 4JGHB 1JRUA 3A1QB 1YN3A 5MPOA 2K25A 3UQBA 4URKA 1WR6E 2MBEA 4LNOA 2R61A 1C9FA 2WXGA 4E74A 3U52E 1UZXB 1F9JA 3A9KA 3WCQA 3PZDA 3I63C 3PZ7A 1P98A 1T0SC 3RPFC 1JQ4A 2FBWB 3ENEA 3IAM1 2INNE 2AQ3B 2D3CA 4WWNA 5HKHA 3PHWB 3U2SC 5FR3A 1DYQA 1UGMA 3P1MA 2WP9B 3DHIC 4KKJA 4E71A 4I6NB 4YXDB 1WJUA 1SGHA 3PHXB 3Q6BA 3T3NA 1AWDA 3NUHB 1VR9A 3RYTA 1VZ8A 2KYWA 1MG8A 1UWXA 3APCA 3MP9A 3VUWA 3AU4A 4OZAA 3A4SC 4ACFA 5C2TB 1K52A 4HPLB 2XBBC 4GB9A 4BBNC 1C77A 2N9KA 4M01A 3BWUD 5L83A 1SE9A 1NBFC 2CHXA 1OTRB 3GOEA 1E6EB 2GRIA 1YD8U 1B1ZA 1AN8A 4JX1C 4DXGA 5D3IB 2GMIC 2M4NA 4HRSA 3OJ4B 4IWQA 1FXAA 2JYTA 3SDLC 2MEKA 4AWJA 4FBJB 1WM3A 4ZRQA 2CU3A 2VH1A 2N7JA 4K7WA 3R2TA 2ONQA 2PPHA 4OVZA 1YX5B 1YJIA 3H8HA 2L0FA 2L7RA 2BYFA 1E8YA 4MJSA 4US8A 5CHVC 2MBBB 1F1HA 2L8JA 2VZKD 3AEGB 4AJWA 2LHDA 4DDGD 3TL5A 3ZNGC 2IY1B 3NVYA 2MJEA 2QEJC 1F52A 4ZHPA 4EE2A 2VRRB 3DVGX 4W9CA 4C7ZA 4DXFA 5J18A 4RGNA 3L0WB 1J8CA 3DVNU 1ZKHA 1AYFA 1F2RI 4FJVB 2BWES 4NAMA 3KQ4A 4G50A 5G5GA 4FHJA 1A70A 5IA7A 2XN9C 3BIID 5LXHA 2LUMA 2JU6X 4E3CA 4WURA 4HLEA 2KWVB 2LD9A 3PPAA 2EMTA 1WWTA 2D3AA 3NZUA 1EO6A 4HWIB 2M0XA 2M8SA 2HDEA 2MQJA 2WXOA 3B08A 4A3OA 4BKGA 1C4CA 3P4SB 3QA8A 2I1KA 2OHFA 3HK0A 2N4FA 2K6QA 1TBEA 2BVCA 2X8XX 1N60A 5D3DA 4A3PA 2WDVB 3ZJUA 2Z0EB 4KZCA 2JVCA 4ASWC 1J7CA 2L0TA 4FULA 3L54A 3L4PA 1FM0D 1GC7A 4JWUC 4G3XB 4GXBA 1GG3A 1WE7A 3JSVA 4P1CC 3BK1A 5IOIA 2C60A 5HI1A 4XDDA 3UINB 1WXVA 3QHTA 4LCDE 1P3QU 1EU4A 3N9YC 2L00B 3PLVA 2EMSA 3P2BA 3T8MA 2UYZB 2MJDA 5DPSA 3NZSA 4MH8A 1HTQA 2BQQA 1I35A 5LLIA 4JIOU 5C23A 4FADA 2I38A 2GBNA 3R2IA 2FCNA 2JPHA 1I7HA 5HFYA 2GLSA 3U7DA 2M56B 1KRHA 4B6WA 4P6VF 2JUOA 2KJRA 3GE8C 1V2YA 3T9LA 3Q8FA 2G3QB 1WXSA 3AEDB 4MGIE 4ZRPA 1DOXA 2AYOB 1JROA 2KK8A 1TS3A 1V86A 4OZCA 3Q8BA 2RDBC 1C1YB 1BT0A 1R7SA 4DWFA 1NENB 3JW0X 2DZKA 2KO3A 2KACA 2VH2A 3W1YA 3MJ5A 4ZHOA 2KD0A 2XK5A 3Q69A 2BS2B 2CHZA 3EC8A 2H88B 4EZJA 1T6BX 4HXDA 3EA6A 1MI0A 2MH7A 3IHPC 1WGYA 5DCNA 4I6PA 1XXGA 4ANXA 3MC8A 1KF6B 3QWZB 3AECB 3ZTCA 4PYUA 4ZRKA 1FCLA 3QARA 1FFVA
chains in the Genus database with same CATH topology
4LK0M 2FE8A 2WDRB 1HEZE 2PW9A 2WXPA 4L2YA 4USAA 3HRDD 1RM6C 2WXRA 4N58A 5BMGA 2NTTA 2BTEA 4XWTA 4A90A 2G9HD 4HEA1 3IT6B 1DOIA 4HJGE 3TSSA 1MHXA 1FRRA 3AEBB 4AQ7A 1ET6A 1L5PA 1N63A 1TKEA 1IBXA 3P4RB 1YN4A 2L1AA 1HZ6A 1TY2A 1V97A 1PUTA 2K5PA 4L1BA 1XLPA 3SEBA 5EE3A 1CK1A 1Q10A 1I4QA 1JALA 1JWMD 2KN4A 4RH6A 2BS3B 1MPEA 5LNK1 2M19A 5EE0A 1CQVA 4NAWB 4YTPB 3O13A 3ABVB 1ZDXA 3EGRA 4UDUC 1ZDVA 1PGBA 1ACCA 2W3SA 2H89B 2SEBD 2WXMA 3P42A 3I9V1 2EELA 1OQQA 1P7FA 1D5MC 1VJKA 2V3NA 3BVZA 5E6JA 1TJEA 1FXIA 1SF0A 4A8XC 1XLOA 1FNVA 2NTSA 1F2RC 3AE5B 4REZA 5AUKA 2DYOA 3AE2B 1ESFA 4C56C 3FILB 1JRPA 2TSSA 5C3JB 1VZ7A 2NMQA 2J52A 2KDMA 4C7YA 3SFDB 2RMMA 3B2FA 3E9SA 2Q5WD 3MFGA 3TEWA 4KKIA 1QF6A 3W5UB 1ZP0B 2WXKA 1K51A 1UGJA 4ZYSA 2X38A 1XCTL 1L6UA 1HXYD 3AE9B 4D2KA 2ON8A 5T8IA 2RDGA 3FAHA 4H2AA 1KTKA 2INPE 4ITKA 1XCQL 4YT0B 3T3OA 1JWSD 1BMLC 1SBBB 1ET9A 3P63A 1N62A 1FD6A 4RF1A 2AX5A 4YSXB 3AE3B 1L4DB 4L23A 3TEZA 1FFUA 5FK9C 1FEHA 5FKAC 2WXHA 1BXTA 1HQRD 1YQ4B 2E6XA 2RDHA 2Y3AA 3TEXA 1UNSA 5BMIA 4WH4A 1C79A 1E7PB 3HUIA 4IOIE 5D7GA 4ARCA 1KH0A 1ZUD2 3AB5A 3UI3A 5EE1A 3AE4B 1E9MA 2N0SB 3NVZA 2CJNA 1WRIA 1MVKA 1VZ6A 1NYRA 2GB1A 5HG2A 4GDKB 1JWUD 1YJJA 1SE2A 4MACA 1YN3A 5I4DA 1QT9A 5MPOA 2KQ4X 1GB1A 1PDXA 1J7AA 2R61A 1P7EA 4GLSC 1C9FA 1E0ZA 4RF0A 4N6EB 3DWGC 4P16A 1WSPA 1GAQB 2WXGA 3LXFA 3U52E 2J4XA 2WU2B 2JZPA 3E56A 2JYEA 3CWIA 3V05A 3PZ8A 1FNUA 3WCQA 3VQIA 5BYRA 4B0MA 1L4ZB 4MT5A 1D6EC 3PZ7A 4LLGM 3RPFC 3ZGZA 1JQ4A 2FBWB 3W9CB 1Y56A 4N59A 2IGGA 3IAM1 2INNE 1FNWA 2AQ3B 2DLBA 3HVZA 1TY0A 3LB8C 3U2SC 2LMCA 5FR3A 1DYQA 3FILA 4HROA 2W55A 2WQYB 1GPXA 3P1MA 2WP9B 4KKJA 3ZQ4A 1RYJA 4YXDB 1YMHE 3AE8B 4KX6B 3BZDB 1VRAB 2LGIA 2BYTA 3T3NA 1KLUD 1ZXIA 1AWDA 1C4PA 4J3OD 3NUHB 2J42A 1VR9A 3AEAB 3P4PB 1VZ8A 2WXIA 2WNMA 4YTMB 1L0VB 2BB6A 1UWXA 3AE6B 1JW9D 1C78A 2IDYA 3NS1A 4YWGG 3VRAB 1YQ3B 2QILA 3MP9A 3SR6A 2YEPF 4A6QA 2W54A 1T5XD 1NI3A 3LYYA 3FC4A 4OZAA 4GDLB 2K9XA 4TMAB 5C2TB 2QMTA 3AEFB 1K52A 4RGTA 2JQRB 2L32A 1K53A 5TSSA 1RWSA 4A9AA 1C77A 2N9KA 2KAJA 1V8CA 3AM9A 4OW0A 4RCOA 1CJEA 1C76A 2BW2A 3BWUD 2YEPB 1QOBA 1KLGD 2KMMA 1GOZA 4AS1A 2IPKD 2RPVA 1VDVA 3ETRA 3W2DA 1SB3C 2OEDA 2LFIA 3BK2A 1NVID 1E6EB 2GRIA 1B1ZA 2WLBA 1AN8A 2WXQA 3HVDA 4NJCA 4JX1C 3DWMA 3AH7A 1WYGA 4DXGA 1I4GA 5D3IB 4HRSA 1FO4A 1I4RA 5BYQA 2AQ2B 1FXAA 4RGOS 1SIJA 1XO3A 2JYTA 3GP7A 3CIRB 3B9JA 5BYSA 1M4VA 2MEKA 1D5ZC 2PKOA 3KWLA 4ZRQA 2CU3A 2N7JA 4CQNA 5H92C 3R2TA 4O1NA 3ZYYX 2ONQA 4YSYB 4OVZA 3BVGA 4M0WA 3TEYA 4XE0A 4A55A 2DWQA 3MC0B 2LJIA 2CJOA 2QIEB 1YJIA 3H8HA 5HHDG 1QQRA 1MHHE 3AE7B 1PFDA 4IKGA 2JSVX 4R3DA 5BMHA 4US8A 2IJ0A 1SJHD 2VZKD 3AEGB 1XF5L 1QLBB 1SE3A 2LHDA 1TS4A 2PLPA 1TS5A 1TS2A 1DGJA 3NVYA 2MJEA 5GXGB 3VR8B 2DYMA 2MJ3A 2QEJC 2M0AA 2W3RA 2WXNA 3OWEB 2FUG1 1SJED 1E10A 1F77A 3AV8A 3P4QB 3Q8EA 2JWUA 4ZHPA 1QOAA 2GI9A 1V1PA 4FXCA 4EE2A 5JXVA 3VRBB 4JWSC 2E3TA 4OHJA 3SFEB 4C7ZA 4DXFA 1AW7A 3V3XA 1XEEA 4RGNA 3IT4B 3B2GA 1AYFA 2BS4B 1L0YB 1F2RI 1STEA 2SAKA 2ZW0A 3NVVA 4NAMA 1SXTA 1EM7A 1RFKA 3KQ4A 1LO5D 3I57A 2QSDA 2WS3B 5G5GA 5AUIA 1ENFA 3R8BA 1A70A 2XN9C 3BIID 2LUMA 4DQOC 2JU6X 4WURA 1K50A 2ACZB 1V1PB 4TQ0A 3BYTB 4IDIA 4US9A 1J7BA 1WWTA 4JPSA 4OZBA 2K22A 1VLBA 2HDEA 1D4BA 1JCKB 2WXOA 3J9CA 1UWMA 1SEBD 1C4CA 3KWVA 1NYQA 3MHZA 3P4SB 1N5WA 1PGAA 1WXQA 2OHFA 4YTNB 2WDQB 5H8YE 4MM3B 4Q2JA 1V1OA 4WWMA 2DBYA 2BBCA 1N60A 5D3DA 1QOGA 2WU5B 2WDVB 2IGHA 3ZJUA 2V0GA 2V4IB 3BVMA 4RGMA 3AEEB 1PYWD 1QOFA 2N9LA 1YNTE 2PTLA 3U7ZA 2J53A 1J7CA 4JE3B 3L4PA 1FM0D 1I4HA 1SE4A 4JWUC 4WIPA 2PVGC 3Q8CA 1ZOYB 2ZW1A 1EU3A 3EUB2 1L0XB 3BK1A 5HI1A 1T3QA 1EWCA 1IBXB 1HZ5A 1N5XA 3GB1A 4XDDA 1QILA 3U4EG 4HKZE 1EU4A 2I2YA 3N9YC 1ZE3D 1FRDA 2QJLA 2G1EA 1JMLA 2JX5A 2XNAC 2Y5CA 4KGTA 4RNAA 2MJDA 2KWDA 1HA5A 2K3UA 3IAS1 1GB4A 1JWBD 4MH8A 2JXTA 1SSNA 3KLSX 1TKYA 4HKQA 1PGXA 3URYA 3NZ3A 3ZJVA 2I38A 1XLQA 3AE1B 4PT5A 3R2IA 1FCCC 1I7HA 1D5XC 1TKGA 3C8YA 1TYGB 5HFYA 3PO0A 4KGRA 1BUIC 2M56B 1KRHA 2LHEA 3ZJTA 3AN1A 4P6VF 1QKZA 4WQMA 1NEKB 1JWAD 3AMZA 4C80A 3NRZA 3NVWA 1ROEA 2BT6A 3GS2A 3Q8FA 2B76B 4YSZB 1KFYB 1UUPA 2PMVA 2VZKB 3AEDB 2V3PA 4ZRPA 2PIAA 2L83A 1TZOA 5G5HA 1ZXHA 4XWWA 1DOXA 1F0ZA 1N61A 1JROA 1I4PA 3RFZB 4XDCA 1DOYA 1IGCA 1TS3A 2LEKA 2WXJA 2AQ1B 1FMAD 3Q8BA 4OZCA 2ICIA 1R7SA 4WAFA 1ZPSA 1NENB 2WXLA 2Y5PA 2HTME 1L6VA 2IGDA 2KACA 1FIQA 4ARIA 3MJ5A 1XLNA 4KGSA 4ZHOA 2W82A 3Q8AA 2Z8LA 3BYYB 1B9RA 3Q69A 1CZPA 4NZLB 2EKIA 4TQ1A 1IUEA 2BS2B 2H88B 2BB5A 1YN5A 5EE9A 4TSSA 1T6BX 3EA6A 1MI0A 3TUOA 3VR9B 4ZOHC 2MH7A 1C4AA 4B0EA 1XXGA 4RFBA 1KF6B 1WGKA 1I4XA 1IGDA 3IXSA 3AECB 3W1SA 2K0PA 2D5GA 4LTUA 2L52A 1EWYC 1OFFA 2WXFA 1FCLA 2PVOD 3W5VB 1OQRA 1FFVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IGH A;  1MVK A;  1HEZ E;  2PW9 A;  2GB1 A;  5HG2 A;  2N9L A;  1YNT E;  2PTL A;  5BMG A;  4MAC A;  2J53 A;  2KQ4 X;  1GB1 A;  4HJG E;  1MHX A;  4GLS C;  1P7E A;  2ZW1 A;  1C9F A;  1IBX A;  2N7J A;  1HZ6 A;  5HI1 A;  1IBX B;  2ONQ A;  1HZ5 A;  3GB1 A;  1Q10 A;  2JZP A;  4HKZ E;  2KN4 A;  2I2Y A;  1MPE A;  5HHD G;  1MHH E;  4KGT A;  1JML A;  2KWD A;  2JSV X;  4IKG A;  1GB4 A;  5BMH A;  2JXT A;  1PGB A;  1PGX A;  1XF5 L;  2LHD A;  2IGG A;  2PLP A;  2I38 A;  2EEL A;  1FCC C;  1P7F A;  5HFY A;  4KGR A;  3FIL A;  1F2R C;  2JWU A;  3FIL B;  2GI9 A;  2LHE A;  5JXV A;  2NMQ A;  2J52 A;  1QKZ A;  2KDM A;  2RMM A;  1YMH E;  2LGI A;  1K51 A;  1XCT L;  1ZXH A;  3V3X A;  4D2K A;  1IGC A;  2ON8 A;  1UWX A;  4OZC A;  1F2R I;  2ZW0 A;  1EM7 A;  3MP9 A;  1XCQ L;  2QSD A;  2IGD A;  2KAC A;  4OZA A;  2LUM A;  1FD6 A;  2JU6 X;  4KGS A;  2QMT A;  1K52 A;  1K50 A;  1K53 A;  4OZB A;  2N9K A;  1D4B A;  1MI0 A;  5BMI A;  4WH4 A;  1PGA A;  2RPV A;  4IOI E;  2OED A;  1KH0 A;  1IGD A;  3UI3 A;  2K0P A;  1FCL A; 
#chains in the Genus database with same CATH topology
 2LGX A;  4HVB A;  2WDR B;  1HEZ E;  2PW9 A;  3ML9 A;  4L2Y A;  3HRD D;  2BYV E;  1RM6 C;  2NTT A;  2BTE A;  2FID A;  4A90 A;  4HEA 1;  1C3T A;  1DOI A;  2D3G A;  1ET6 A;  2NBU A;  1L5P A;  1TKE A;  1IBX A;  3P4R B;  4JLC A;  1YN4 A;  1HZ6 A;  2MBQ A;  3PRZ A;  2ZPY A;  2K5P A;  1XLP A;  1V80 A;  3QX1 A;  2HE7 A;  1GJZ A;  4RH6 A;  3DHH C;  2NCN A;  5TR5 A;  1WI0 A;  3NHE B;  3ZLZ A;  3RNF C;  4BZA A;  1ZW7 A;  3O13 A;  3ABV B;  4S0R A;  1ACC A;  5J17 A;  4EZL A;  1WX8 A;  2JT4 B;  2H89 B;  1GC6 A;  2WXM A;  3W1S C;  2V3N A;  3M63 B;  3DBS A;  5E6J A;  2ZNV B;  2NTS A;  1FNV A;  5AUK A;  1E8W A;  3FIL B;  3ONS A;  2J52 A;  2KDM A;  3L16 A;  4YL8 A;  3TEW A;  3E9S A;  2Q5W D;  3DVN V;  3QQ8 B;  3W5U B;  1SIF A;  4ZYS A;  2MLB A;  3B1L X;  3N1X C;  1L6U A;  1IP9 A;  3NG0 A;  4D2K A;  1N6Z A;  1LXD A;  3IVF A;  2LXA A;  1H8C A;  2KKC A;  2GBM A;  1WM2 A;  1R4M B;  2DNF A;  1JWS D;  1BML C;  3P63 A;  1N62 A;  3JYU A;  4GDK A;  4BKS D;  2FCQ A;  2ZVN A;  3VXW A;  1BXT A;  2GBK A;  1UNS A;  4DK5 A;  4WH4 A;  4MEM A;  1LQB A;  5D7G A;  4ARC A;  2V3S A;  2J0K A;  3AB5 A;  2WGS A;  5EE1 A;  3AE4 B;  3GZN I;  1TTN A;  3CMM B;  3VHT C;  1R4N B;  4XYC A;  3WAN A;  4IW0 A;  3ZW3 A;  2KVR A;  3EEC A;  1MVK A;  2QHO A;  1WRD B;  3RCZ A;  1YIW A;  4GDK B;  1SE2 A;  4MAC A;  1FPY A;  2IO2 B;  3CST A;  3DHG C;  4RF0 A;  4WJO A;  3SHQ A;  3OLM D;  1GAQ B;  3LXF A;  2J4X A;  2G4D B;  2G4S A;  2DX5 B;  1LGR A;  4KZ0 A;  4DHJ B;  2JYE A;  3FKY A;  3PZ8 A;  1FNU A;  2Y5B B;  4S17 A;  1L4Z B;  4LLG M;  2FIF A;  3RZF A;  2KTR B;  3RNB C;  5D2M B;  3UQA A;  1WH3 A;  2DLB A;  3HVZ A;  1U4A A;  4RMA A;  1WXM A;  4HCN B;  5J2R A;  4CYE A;  3ZQ4 A;  1RYJ A;  5JH5 C;  1E7V A;  1YMH E;  4G11 A;  2LGI A;  2K8C A;  1KLU D;  2QC8 A;  3P4P B;  3AEA B;  3SD5 A;  5C1Z A;  2YVC A;  1JW9 D;  1C78 A;  4A6Q A;  4RGT A;  3U8Z A;  4NPN A;  1XD3 B;  1K53 A;  5TSS A;  4A9A A;  2KFJ A;  2KAJ A;  4OW0 A;  4RCO A;  1E5W A;  1QOB A;  3VTV A;  1GOZ A;  4AS1 A;  2IPK D;  3ETR A;  1VDV A;  4JL9 A;  1J19 A;  3B0A A;  3WIM A;  2WLB A;  4NJC A;  3DWM A;  3AH7 A;  1WYG A;  3ZUN A;  1I4G A;  3A1Q A;  2L76 A;  1WX7 A;  3KYC D;  1FO4 A;  4LNF A;  2KVZ A;  3O65 B;  2C7M B;  3NY5 A;  1XO3 A;  5BYS A;  3DBH B;  3RUL A;  4CQN A;  1WIA A;  3ZYY X;  4KDL B;  3V60 A;  3BVG A;  3NS8 A;  4M0W A;  4RM9 A;  3OJ3 A;  2JRH A;  4XE0 A;  2DWQ A;  2HJ8 A;  1K8R B;  3MC0 B;  3PRM B;  5HHD G;  1MHH E;  4NJ6 A;  2JSV X;  4R3D A;  3H9D A;  3PV1 A;  1XF5 L;  1TS4 A;  1M94 A;  1DGJ A;  2MJ3 A;  3Q3J A;  2KDB A;  3A33 B;  1WFY A;  3Q8E A;  3VTW A;  2NVU I;  1QOA A;  5JXV A;  1CMX B;  3VRB B;  4JWS C;  4PYZ A;  3RNG C;  4M0W B;  2E3T A;  3UF8 A;  4OHJ A;  2DZM A;  1WY8 A;  3DPD A;  1AW7 A;  4MEL A;  3V3X A;  4MH0 E;  3WAL A;  2KQS A;  3B2G A;  4MM3 A;  1L0Y B;  4TV3 A;  1STE A;  2Z0D B;  2JZZ A;  2ZW0 A;  3NVV A;  2RGF A;  1SXT A;  2DYB A;  4II2 B;  1EM7 A;  4PS3 A;  2KOX A;  3Q3F A;  3RI7 C;  2J0J A;  2WS3 B;  1ENF A;  3WAP A;  1K50 A;  2ACZ B;  2D3B A;  4AP4 C;  2KXJ A;  4JPS A;  3PTF C;  1OEY A;  2KDF B;  2NBW B;  2KWC A;  1UWM A;  4AUQ C;  4C4V A;  3KH0 A;  1PGA A;  4ANV A;  3X0W A;  3LDZ E;  4MM3 B;  3ECI A;  4PS8 A;  2DAF A;  2JWZ A;  2BBC A;  2ZJD A;  2WU5 B;  3V62 A;  2IGH A;  2D07 B;  3ZNH B;  3VH3 B;  2N9L A;  2PTL A;  5DPT A;  2BPS A;  3IBE A;  2J53 A;  2JXX A;  4JE3 B;  1A5R A;  1I4H A;  1WGH A;  1KOT A;  4C4V B;  2PVG C;  1ZOY B;  3L08 A;  1EU3 A;  3QC8 B;  3EUB 2;  1D3Z A;  4P1B C;  1OGW A;  4W9D A;  4NQK E;  4HCP B;  1HZ5 A;  5FR6 A;  3GB1 A;  1QIL A;  3U4E G;  5CTR C;  2FAZ A;  1FRD A;  2Y5C A;  1JML A;  2XNA C;  4CO7 A;  2NR2 A;  1WGG A;  1HA5 A;  2K3U A;  2DZI A;  2BKF A;  1JWB D;  1GB4 A;  2JXT A;  3D32 A;  3KLS X;  4LNK A;  4KSL C;  5IO9 A;  3ZKJ C;  3AI5 A;  2CS4 A;  2M17 A;  3C8Y A;  1TYG B;  4KGR A;  4WJP A;  1WJ4 A;  2WDT B;  2NS5 A;  3K9O B;  3M95 A;  1WZ3 A;  1OEY J;  5CX3 A;  4C80 A;  1L2N A;  1ROE A;  3GS2 A;  3ZTD A;  2VZK B;  4IM0 A;  2D10 A;  2V3P A;  2PE6 B;  1TZO A;  2LRU A;  4MGK E;  1I4P A;  1NDD A;  2JF5 A;  1IGC A;  2AQ1 B;  2ZEQ A;  1TIF A;  2RR9 A;  2WXL A;  2PE9 A;  3N32 A;  1FIQ A;  4ZRI A;  3U30 A;  2KHW B;  4W9F A;  1CZP A;  2IYD B;  3TBL D;  4TQ1 A;  2A5U A;  1S3S G;  3VR9 B;  4ZOH C;  3H7P A;  1C4A A;  4B0E A;  2NBV B;  5KHO A;  2ZVO A;  1IGD A;  1OFF A;  2PVO D;  1OQR A;  4YSZ B;  3TJP A;  4NAW A;  3VFK A;  3RMK C;  4USA A;  2KDE B;  2WXR A;  4N9F 4;  4N58 A;  1YJ1 A;  2G9H D;  2AL6 A;  1MHX A;  3AEB B;  2LGS A;  1WJ6 A;  1N63 A;  3H7P B;  5CHW A;  4LDT D;  3R3M A;  2BGF A;  2NPT A;  4L1B A;  4EOY A;  5EE3 A;  5BO4 B;  1I4Q A;  1JWM D;  2DZJ A;  4NAW B;  4KV2 A;  3EGR A;  4UDU C;  3ML8 A;  2IBI B;  2OOB B;  2N9X A;  5E6N A;  3QJZ A;  3HM6 X;  3P42 A;  3I9V 1;  1D5M C;  5AZH A;  1TJE A;  1FXI A;  3APF A;  3AE5 B;  2DYO A;  3AE2 B;  4C56 C;  4EZK A;  1JRP A;  2BF8 B;  2NPT B;  2KJH B;  2RMM A;  3MFG A;  1QZE A;  1TZ1 A;  2WXK A;  1UGJ A;  4HK2 A;  1LM8 B;  2X38 A;  3QIJ A;  2ZCC A;  1XCT L;  2ZNV C;  2HTH A;  1VD2 A;  3M62 B;  2ON8 A;  2IO3 B;  2RDG A;  4DDI D;  3ZRF A;  1KJT A;  1MG4 A;  4ITK A;  1XCQ L;  3T3O A;  1SBB B;  4M00 A;  1ET9 A;  2KFK A;  4B9K A;  1IYF A;  1FD6 A;  4BKT A;  3AE3 B;  1Q1O A;  1FEH A;  2WXH A;  2E6X A;  4BAX A;  3DBR I;  3AUL A;  1C79 A;  5KHQ A;  1E7P B;  2J7Q B;  1ZUD 2;  1PQS A;  4W9L A;  3VTU A;  1E9M A;  3NVZ A;  4BOS C;  2O2V A;  1L7Y A;  1WRI A;  2QCZ A;  2KFK B;  1VZ6 A;  1NYR A;  3X23 A;  4W9J A;  4LNI A;  1YJJ A;  5I4D A;  2DHZ A;  4XGA B;  1QT9 A;  2KQ4 X;  1PDX A;  3QAQ A;  4EFO A;  4GOC A;  5IKC M;  1P7E A;  1E0Z A;  4N6E B;  3DWG C;  3N20 C;  4P16 A;  1WSP A;  3DOW A;  2WU2 B;  2JZP A;  3E56 A;  3DBR B;  3CWI A;  3V05 A;  2O2V B;  5BYR A;  1D6E C;  3ZVV A;  2LRW A;  4N59 A;  2BWF A;  1FNW A;  3ZDT A;  1TY0 A;  3R7R A;  1GPX A;  1YOV B;  3FIL A;  4HRO A;  4BOZ B;  2W55 A;  2WQY B;  3DQV A;  4BBN F;  2LI5 A;  1MFW A;  4KX6 B;  3RZW C;  1VRA B;  1ZXI A;  4J3O D;  1TT5 B;  1EF5 A;  2ASQ A;  3ZDM C;  2WXI A;  2WNM A;  4YTM B;  2BB6 A;  3I3T B;  3AE6 B;  2CKH B;  2IDY A;  3NS1 A;  3VRA B;  3SR6 A;  2YEP F;  1T5X D;  1NI3 A;  3BIN A;  4TMA B;  2K9X A;  3PLU A;  4HDQ A;  2QMT A;  2JQR B;  1RAX A;  4TUU A;  1RWS A;  3UIO B;  3AM9 A;  2B3A A;  5L95 C;  2KZR A;  4F1S A;  1KLG D;  3KUD B;  2RPV A;  4GGQ A;  1SB3 C;  2OED A;  2LFI A;  2PJH A;  3Q3O C;  3WAO A;  1WXA A;  3PSE B;  2WXQ A;  3HVD A;  4DHZ B;  1HTO A;  2C7N B;  4RM8 A;  1I4R A;  5IN7 A;  5BYQ A;  4WQO B;  1G6J A;  1SIJ A;  5EDS A;  3GP7 A;  3CIR B;  3B9J A;  1M4V A;  3CSF A;  4W9I A;  2PKO A;  3KWL A;  3EHV A;  2GBJ A;  2C9W B;  3UGB B;  4O1N A;  4YSY B;  2K8B A;  1I42 A;  4A55 A;  2LJI A;  2CJO A;  2QIE B;  4PK1 A;  3AE7 B;  4NQL B;  1PFD A;  2KTR A;  5BMH A;  2IJ0 A;  3DBL I;  1QLB B;  5JHB A;  4MSQ B;  1TS5 A;  3N30 A;  5GXG B;  4KIK B;  3PVL A;  3VR8 B;  2DYM A;  2M0A A;  1E10 A;  3OWE B;  4G0N B;  1F77 A;  3P4Q B;  2JWU A;  2KX3 A;  1FXT B;  4IWO A;  4AOF A;  2FNJ B;  4DHZ E;  4K1R B;  4IWP A;  2IZV B;  3IFW B;  4MDK E;  1XEE A;  3GZN B;  1UBI A;  2O6V A;  1WE6 A;  2V1Y A;  2QSD A;  1UF0 A;  3Q3M C;  1AAR A;  4KSK C;  1UBQ A;  3DBL B;  2AL3 A;  2KMC A;  3BYT B;  4IDI A;  4US9 A;  4WWP A;  4DHJ D;  1J7B A;  5AZF A;  4OZB A;  5E6P A;  1VLB A;  1D4B A;  1JCK B;  3J9C A;  2KQ7 A;  2KLC A;  3Q14 C;  3KWV A;  2ZCB A;  2KX0 A;  1NYQ A;  3MHZ A;  1XQQ A;  4YTN B;  2WDQ B;  4F8C B;  2O6V B;  1YQB A;  4Q2J A;  1V1O A;  2DBY A;  4IM2 A;  3ZNZ B;  1QOG A;  2LWP A;  2LVQ A;  1WYW B;  3L10 B;  4I6L B;  2V0G A;  2V4I B;  3BVM A;  4RGM A;  3AEE B;  2LVP A;  1YNT E;  4CHK A;  1KM7 A;  4ICV A;  4OVV A;  2ZPN A;  4TKN A;  1J0G A;  3HIZ A;  1SE4 A;  2K39 A;  2N1W A;  2ZW1 A;  3HHM A;  4LJO B;  4HPP A;  2M1M A;  1L0X B;  1V49 A;  1T3Q A;  1EWC A;  4HPM B;  1N5X A;  2KWU B;  3M3J A;  4HKZ E;  1V6E A;  2G45 B;  2I2Y A;  3VH4 B;  4RNA A;  4KGT A;  2KWD A;  4GIV A;  3IAS 1;  3R7Q A;  1SSN A;  3CF6 E;  4HKQ A;  3URY A;  3ZJV A;  2LZ6 A;  4PT5 A;  1XLQ A;  3AE1 B;  4KVG B;  1FCC C;  1TKG A;  2LUE A;  5AEK B;  3QCA A;  2LHE A;  5IAA C;  4K81 A;  3ZJT A;  3AN1 A;  2LJ5 A;  1UUP A;  2PMV A;  2RSU A;  2MW5 A;  2IO1 B;  2UWQ A;  5G5H A;  4XWW A;  4W9E A;  4OVU A;  2WXJ A;  4IM3 A;  1EF1 A;  3I5J C;  4AJY B;  4FLH A;  1V9J A;  4WAF A;  1ZPS A;  2Y5P A;  2HTM E;  2IGD A;  2K8H A;  3BY4 B;  1XLN A;  4KGS A;  2W82 A;  2Z8L A;  3BYY B;  1B9R A;  4FN2 A;  1RFA A;  4NZL B;  2EKI A;  1UD7 A;  3ALB A;  1IUE A;  4WJN A;  2BB5 A;  4TSS A;  3RUI B;  1WGK A;  3N1Y C;  3IXS A;  4W9K A;  3NJT A;  1EWY C;  4LK0 M;  4GU2 A;  1VCB A;  2WXP A;  2LGY A;  4XWT A;  4FJY A;  4C00 A;  3TSS A;  4AQ7 A;  1XT9 B;  1PUT A;  2JRI B;  3SEB A;  1CK1 A;  1JAL A;  4X57 B;  1WR1 A;  3LJ3 A;  2KN4 A;  2BS3 B;  2L3Z A;  1MPE A;  3ZXV A;  3RT3 B;  5EE0 A;  3VDZ A;  4YTP B;  3A9K B;  3C0R B;  1ZDX A;  4ZRJ A;  5IP4 D;  4K3B A;  1ZDV A;  1PGB A;  3ZO5 B;  2FUH B;  2DAJ A;  2SEB D;  1MJD A;  4IC7 B;  1SF0 A;  4K7U A;  4A20 A;  4A8X C;  1F2R C;  2WX1 A;  1ESF A;  1NI2 A;  1T0Y A;  5C3J B;  4BVU C;  1V81 A;  4KKI A;  5JZE B;  2I1J A;  1QF6 A;  1Q0W B;  1ZP0 B;  3ZRC A;  3OAW A;  3SU8 X;  1HXY D;  3TMP B;  5LXI B;  5G55 A;  1OQY A;  2CHW A;  4FA6 A;  4GN1 A;  1KTK A;  2INP E;  4YT0 B;  3VUX A;  3GE3 C;  3R66 C;  2RPQ A;  4BFR A;  4XX5 A;  2D11 A;  2AX5 A;  1TGZ B;  4YSX B;  1EUV B;  4L23 A;  3H1U A;  4M8N A;  5FKA C;  3ZNI D;  1HQR D;  2KTF A;  2MSE D;  3DVG Y;  3PRE A;  4W9G A;  2MWS B;  3HUI A;  1Q5W B;  3MHS D;  4DXA B;  3RD2 A;  2FCM A;  5HG2 A;  1JWU D;  2JZ3 B;  3S2A A;  1GB1 A;  1J7A A;  4GSW A;  4GLS C;  5GMV A;  1WZ0 A;  1LFD A;  2MCN B;  3WA0 A;  2CR5 A;  2D2Q A;  3VUY A;  2QDF A;  3UIP B;  1Z2M A;  3RNA C;  3VQI A;  4B0M A;  4MT5 A;  3ZGZ A;  3W9C B;  4MJS B;  3H6N A;  1Y56 A;  2IGG A;  4LDT B;  3KUC B;  2KMA A;  3LB8 C;  3MJW A;  4GDL A;  2LMC A;  2KC1 A;  3N1Z C;  2KJ6 A;  1WF9 A;  4K3C A;  5D94 A;  3AE8 B;  3BZD B;  3KVF B;  1V5T A;  2LGD A;  2BYT A;  1C4P A;  5DPR A;  2J42 A;  1P9D U;  2V9H A;  1L0V B;  5E6O A;  2KNB A;  4YWG G;  2C5L C;  1YQ3 B;  2QIL A;  1RLF A;  2W54 A;  2MA9 B;  3LYY A;  3FC4 A;  4GDL B;  2GBR A;  2HJ1 A;  1RRB A;  3HM3 A;  4ZYN A;  3AEF B;  2L32 A;  4HDO A;  5CHF A;  4IG7 B;  1V8C A;  4XC2 A;  1CJE A;  1C76 A;  2BW2 A;  4GMV A;  2JY6 A;  2YEP B;  2LVO A;  2KMM A;  3TIX A;  1E7U A;  3W2D A;  4ZDV A;  3BK2 A;  1NVI D;  2LXC A;  3QK0 A;  2N7E A;  3VAW A;  3WAM A;  1WJN A;  2AQ2 B;  2MBH A;  4RGO S;  1D5Z C;  4IUM B;  5H92 C;  3JSV B;  3TEY A;  2IO0 B;  2R2O A;  2XEW A;  2RD0 A;  1QQR A;  2K1F A;  2A4Z A;  4IKG A;  1SJH D;  1IPG A;  1SE3 A;  2EKE C;  2PLP A;  1TS2 A;  2AEH A;  2KC2 A;  2KN5 A;  2WXN A;  2W3R A;  2FUG 1;  1SJE D;  4MSM B;  3AV8 A;  3L13 A;  4M8M A;  2GI9 A;  4FXC A;  1V1P A;  3RNC C;  3SFE B;  5G2N A;  3RN9 C;  3OG5 A;  2L05 A;  3A9J A;  3IT4 B;  2BS4 B;  2SAK A;  2J0M A;  1RFK A;  1LO5 D;  2MHJ A;  3I57 A;  2IND C;  5AUI A;  3R8B A;  3V61 A;  3A4R A;  4DQO C;  1V1P B;  1UEL A;  4TQ0 A;  1WGD A;  1T0Q C;  2CU1 A;  4WAA A;  2XK5 B;  2K22 A;  2IY0 B;  1SEB D;  1N5W A;  1WXQ A;  3A9J B;  2YLM A;  2WWZ A;  5H8Y E;  4BKS A;  1HE8 A;  3PT2 B;  4FHK A;  4WWM A;  1WMH A;  3KYD D;  1T0R C;  3AXC A;  3RNE C;  4ANW A;  1P1A A;  1R4M I;  4K7S A;  1PYW D;  1QOF A;  2OJW A;  3V6C B;  2MBO A;  3U7Z A;  1GNU A;  3K9P B;  4WIP A;  3Q8C A;  3Q2A C;  3JVZ X;  3H7S A;  1IBX B;  1YX6 B;  1WMH B;  4MGZ E;  1ZE3 D;  2QJL A;  2G1E A;  2JX5 A;  1R4N I;  4J6I A;  1TKY A;  1PGX A;  3NZ3 A;  4KIK A;  4MGY E;  4WWO A;  1D5X C;  3PO0 A;  2REX A;  1BUI C;  3AU5 A;  3PS6 A;  4LNN A;  3EFC A;  4QAY A;  1QKZ A;  4WQM A;  1NEK B;  1JWA D;  3AMZ A;  4EEW A;  3NRZ A;  4F7Z A;  3NVW A;  2BT6 A;  2B76 B;  1GUA B;  1KFY B;  2N9P C;  2PIA A;  2L83 A;  5DPW A;  2KT7 A;  1ZXH A;  1F0Z A;  1N61 A;  3PGE A;  3DCG A;  3RFZ B;  4XDC A;  1DOY A;  3MTN B;  2LEK A;  4P7I A;  1FMA D;  1X1M A;  2ICI A;  3PRP B;  2KLG A;  1L6V A;  2KDI A;  2BKR B;  4B95 A;  4ARI A;  2ZZP B;  3KUZ A;  1WGR A;  3Q8A A;  2FCS A;  2DEN B;  4DBG A;  2R2Q A;  2KAN A;  1YN5 A;  5EE9 A;  1E8Z A;  1KLV A;  2HD5 B;  1H4R A;  4RFB A;  4EUT A;  1I4X A;  1E90 A;  2BYE A;  3V6E B;  3NOB A;  3W1S A;  2K0P A;  2D5G A;  4LTU A;  2L52 A;  3DDC B;  2WXF A;  4WJQ A;  3W5V B;  1Z5S B;  3TUO A;  2FE8 A;  3KW5 B;  2WHI A;  4JQW C;  4W9H A;  5BMG A;  2GOW A;  2N7D A;  4PS7 A;  2AWT A;  3IT6 B;  4KDI C;  2MP2 A;  4HJG E;  1FRR A;  5JHA A;  3ZIM A;  1E8X A;  1P0R A;  2L1A A;  1TY2 A;  2K6D B;  1V97 A;  1V5O A;  2WYQ A;  2MX2 A;  3ZXR A;  4NY0 A;  1Q10 A;  5LNK 1;  2M19 A;  4II3 B;  1CQV A;  4NNJ B;  5AZG A;  1ISN A;  2WX0 A;  2W3S A;  5D6J B;  2INC C;  1OQQ A;  1P7F A;  1VJK A;  2EEL A;  3BVZ A;  2MP2 B;  1XLO A;  4REZ A;  4EKU A;  4FJZ A;  2O6V D;  3APD A;  2TSS A;  2PEA A;  1VZ7 A;  2NMQ A;  2UU7 A;  3DBH I;  4C7Y A;  3SFD B;  3B2F A;  3MC9 A;  1K51 A;  4HJK A;  1ZGU B;  3AE9 B;  2C7H A;  5T8I A;  3FAH A;  4H2A A;  3TCA A;  2Z59 B;  2V4L A;  1Y8R C;  1WX9 A;  4M02 A;  4RF1 A;  4LJP B;  1L4D B;  3Q3N C;  3TEZ A;  1FFU A;  5FK9 C;  2LAS A;  1YQ4 B;  2N9E B;  2RDH A;  2MRP A;  4XZ4 A;  4NJ7 A;  2Y3A A;  3TEX A;  2OJR A;  3C19 A;  5BMI A;  3L17 A;  4ANU A;  4IOI E;  1KH0 A;  3VVW B;  3UI3 A;  3EFU A;  4ICU A;  2N0S B;  2CJN A;  1S1Q B;  1UH6 A;  2W9N A;  3IG3 A;  3N3K B;  2N1V A;  2GB1 A;  4JGH B;  1JRU A;  3A1Q B;  1YN3 A;  5MPO A;  2K25 A;  3UQB A;  4URK A;  1WR6 E;  2MBE A;  4LNO A;  2R61 A;  1C9F A;  2WXG A;  4E74 A;  3U52 E;  1UZX B;  1F9J A;  3A9K A;  3WCQ A;  3PZD A;  3I63 C;  3PZ7 A;  1P98 A;  1T0S C;  3RPF C;  1JQ4 A;  2FBW B;  3ENE A;  3IAM 1;  2INN E;  2AQ3 B;  2D3C A;  4WWN A;  5HKH A;  3PHW B;  3U2S C;  5FR3 A;  1DYQ A;  1UGM A;  3P1M A;  2WP9 B;  3DHI C;  4KKJ A;  4E71 A;  4I6N B;  4YXD B;  1WJU A;  1SGH A;  3PHX B;  3Q6B A;  3T3N A;  1AWD A;  3NUH B;  1VR9 A;  3RYT A;  1VZ8 A;  2KYW A;  1MG8 A;  1UWX A;  3APC A;  3MP9 A;  3VUW A;  3AU4 A;  4OZA A;  3A4S C;  4ACF A;  5C2T B;  1K52 A;  4HPL B;  2XBB C;  4GB9 A;  4BBN C;  1C77 A;  2N9K A;  4M01 A;  3BWU D;  5L83 A;  1SE9 A;  1NBF C;  2CHX A;  1OTR B;  3GOE A;  1E6E B;  2GRI A;  1YD8 U;  1B1Z A;  1AN8 A;  4JX1 C;  4DXG A;  5D3I B;  2GMI C;  2M4N A;  4HRS A;  3OJ4 B;  4IWQ A;  1FXA A;  2JYT A;  3SDL C;  2MEK A;  4AWJ A;  4FBJ B;  1WM3 A;  4ZRQ A;  2CU3 A;  2VH1 A;  2N7J A;  4K7W A;  3R2T A;  2ONQ A;  2PPH A;  4OVZ A;  1YX5 B;  1YJI A;  3H8H A;  2L0F A;  2L7R A;  2BYF A;  1E8Y A;  4MJS A;  4US8 A;  5CHV C;  2MBB B;  1F1H A;  2L8J A;  2VZK D;  3AEG B;  4AJW A;  2LHD A;  4DDG D;  3TL5 A;  3ZNG C;  2IY1 B;  3NVY A;  2MJE A;  2QEJ C;  1F52 A;  4ZHP A;  4EE2 A;  2VRR B;  3DVG X;  4W9C A;  4C7Z A;  4DXF A;  5J18 A;  4RGN A;  3L0W B;  1J8C A;  3DVN U;  1ZKH A;  1AYF A;  1F2R I;  4FJV B;  2BWE S;  4NAM A;  3KQ4 A;  4G50 A;  5G5G A;  4FHJ A;  1A70 A;  5IA7 A;  2XN9 C;  3BII D;  5LXH A;  2LUM A;  2JU6 X;  4E3C A;  4WUR A;  4HLE A;  2KWV B;  2LD9 A;  3PPA A;  2EMT A;  1WWT A;  2D3A A;  3NZU A;  1EO6 A;  4HWI B;  2M0X A;  2M8S A;  2HDE A;  2MQJ A;  2WXO A;  3B08 A;  4A3O A;  4BKG A;  1C4C A;  3P4S B;  3QA8 A;  2I1K A;  2OHF A;  3HK0 A;  2N4F A;  2K6Q A;  1TBE A;  2BVC A;  2X8X X;  1N60 A;  5D3D A;  4A3P A;  2WDV B;  3ZJU A;  2Z0E B;  4KZC A;  2JVC A;  4ASW C;  1J7C A;  2L0T A;  4FUL A;  3L54 A;  3L4P A;  1FM0 D;  1GC7 A;  4JWU C;  4G3X B;  4GXB A;  1GG3 A;  1WE7 A;  3JSV A;  4P1C C;  3BK1 A;  5IOI A;  2C60 A;  5HI1 A;  4XDD A;  3UIN B;  1WXV A;  3QHT A;  4LCD E;  1P3Q U;  1EU4 A;  3N9Y C;  2L00 B;  3PLV A;  2EMS A;  3P2B A;  3T8M A;  2UYZ B;  2MJD A;  5DPS A;  3NZS A;  4MH8 A;  1HTQ A;  2BQQ A;  1I35 A;  5LLI A;  4JIO U;  5C23 A;  4FAD A;  2I38 A;  2GBN A;  3R2I A;  2FCN A;  2JPH A;  1I7H A;  5HFY A;  2GLS A;  3U7D A;  2M56 B;  1KRH A;  4B6W A;  4P6V F;  2JUO A;  2KJR A;  3GE8 C;  1V2Y A;  3T9L A;  3Q8F A;  2G3Q B;  1WXS A;  3AED B;  4MGI E;  4ZRP A;  1DOX A;  2AYO B;  1JRO A;  2KK8 A;  1TS3 A;  1V86 A;  4OZC A;  3Q8B A;  2RDB C;  1C1Y B;  1BT0 A;  1R7S A;  4DWF A;  1NEN B;  3JW0 X;  2DZK A;  2KO3 A;  2KAC A;  2VH2 A;  3W1Y A;  3MJ5 A;  4ZHO A;  2KD0 A;  2XK5 A;  3Q69 A;  2BS2 B;  2CHZ A;  3EC8 A;  2H88 B;  4EZJ A;  1T6B X;  4HXD A;  3EA6 A;  1MI0 A;  2MH7 A;  3IHP C;  1WGY A;  5DCN A;  4I6P A;  1XXG A;  4ANX A;  3MC8 A;  1KF6 B;  3QWZ B;  3AEC B;  3ZTC A;  4PYU A;  4ZRK A;  1FCL A;  3QAR A;  1FFV A; 
#chains in the Genus database with same CATH homology
 4LK0 M;  2FE8 A;  2WDR B;  1HEZ E;  2PW9 A;  2WXP A;  4L2Y A;  4USA A;  3HRD D;  1RM6 C;  2WXR A;  4N58 A;  5BMG A;  2NTT A;  2BTE A;  4XWT A;  4A90 A;  2G9H D;  4HEA 1;  3IT6 B;  1DOI A;  4HJG E;  3TSS A;  1MHX A;  1FRR A;  3AEB B;  4AQ7 A;  1ET6 A;  1L5P A;  1N63 A;  1TKE A;  1IBX A;  3P4R B;  1YN4 A;  2L1A A;  1HZ6 A;  1TY2 A;  1V97 A;  1PUT A;  2K5P A;  4L1B A;  1XLP A;  3SEB A;  5EE3 A;  1CK1 A;  1Q10 A;  1I4Q A;  1JAL A;  1JWM D;  2KN4 A;  4RH6 A;  2BS3 B;  1MPE A;  5LNK 1;  2M19 A;  5EE0 A;  1CQV A;  4NAW B;  4YTP B;  3O13 A;  3ABV B;  1ZDX A;  3EGR A;  4UDU C;  1ZDV A;  1PGB A;  1ACC A;  2W3S A;  2H89 B;  2SEB D;  2WXM A;  3P42 A;  3I9V 1;  2EEL A;  1OQQ A;  1P7F A;  1D5M C;  1VJK A;  2V3N A;  3BVZ A;  5E6J A;  1TJE A;  1FXI A;  1SF0 A;  4A8X C;  1XLO A;  1FNV A;  2NTS A;  1F2R C;  3AE5 B;  4REZ A;  5AUK A;  2DYO A;  3AE2 B;  1ESF A;  4C56 C;  3FIL B;  1JRP A;  2TSS A;  5C3J B;  1VZ7 A;  2NMQ A;  2J52 A;  2KDM A;  4C7Y A;  3SFD B;  2RMM A;  3B2F A;  3E9S A;  2Q5W D;  3MFG A;  3TEW A;  4KKI A;  1QF6 A;  3W5U B;  1ZP0 B;  2WXK A;  1K51 A;  1UGJ A;  4ZYS A;  2X38 A;  1XCT L;  1L6U A;  1HXY D;  3AE9 B;  4D2K A;  2ON8 A;  5T8I A;  2RDG A;  3FAH A;  4H2A A;  1KTK A;  2INP E;  4ITK A;  1XCQ L;  4YT0 B;  3T3O A;  1JWS D;  1BML C;  1SBB B;  1ET9 A;  3P63 A;  1N62 A;  1FD6 A;  4RF1 A;  2AX5 A;  4YSX B;  3AE3 B;  1L4D B;  4L23 A;  3TEZ A;  1FFU A;  5FK9 C;  1FEH A;  5FKA C;  2WXH A;  1BXT A;  1HQR D;  1YQ4 B;  2E6X A;  2RDH A;  2Y3A A;  3TEX A;  1UNS A;  5BMI A;  4WH4 A;  1C79 A;  1E7P B;  3HUI A;  4IOI E;  5D7G A;  4ARC A;  1KH0 A;  1ZUD 2;  3AB5 A;  3UI3 A;  5EE1 A;  3AE4 B;  1E9M A;  2N0S B;  3NVZ A;  2CJN A;  1WRI A;  1MVK A;  1VZ6 A;  1NYR A;  2GB1 A;  5HG2 A;  4GDK B;  1JWU D;  1YJJ A;  1SE2 A;  4MAC A;  1YN3 A;  5I4D A;  1QT9 A;  5MPO A;  2KQ4 X;  1GB1 A;  1PDX A;  1J7A A;  2R61 A;  1P7E A;  4GLS C;  1C9F A;  1E0Z A;  4RF0 A;  4N6E B;  3DWG C;  4P16 A;  1WSP A;  1GAQ B;  2WXG A;  3LXF A;  3U52 E;  2J4X A;  2WU2 B;  2JZP A;  3E56 A;  2JYE A;  3CWI A;  3V05 A;  3PZ8 A;  1FNU A;  3WCQ A;  3VQI A;  5BYR A;  4B0M A;  1L4Z B;  4MT5 A;  1D6E C;  3PZ7 A;  4LLG M;  3RPF C;  3ZGZ A;  1JQ4 A;  2FBW B;  3W9C B;  1Y56 A;  4N59 A;  2IGG A;  3IAM 1;  2INN E;  1FNW A;  2AQ3 B;  2DLB A;  3HVZ A;  1TY0 A;  3LB8 C;  3U2S C;  2LMC A;  5FR3 A;  1DYQ A;  3FIL A;  4HRO A;  2W55 A;  2WQY B;  1GPX A;  3P1M A;  2WP9 B;  4KKJ A;  3ZQ4 A;  1RYJ A;  4YXD B;  1YMH E;  3AE8 B;  4KX6 B;  3BZD B;  1VRA B;  2LGI A;  2BYT A;  3T3N A;  1KLU D;  1ZXI A;  1AWD A;  1C4P A;  4J3O D;  3NUH B;  2J42 A;  1VR9 A;  3AEA B;  3P4P B;  1VZ8 A;  2WXI A;  2WNM A;  4YTM B;  1L0V B;  2BB6 A;  1UWX A;  3AE6 B;  1JW9 D;  1C78 A;  2IDY A;  3NS1 A;  4YWG G;  3VRA B;  1YQ3 B;  2QIL A;  3MP9 A;  3SR6 A;  2YEP F;  4A6Q A;  2W54 A;  1T5X D;  1NI3 A;  3LYY A;  3FC4 A;  4OZA A;  4GDL B;  2K9X A;  4TMA B;  5C2T B;  2QMT A;  3AEF B;  1K52 A;  4RGT A;  2JQR B;  2L32 A;  1K53 A;  5TSS A;  1RWS A;  4A9A A;  1C77 A;  2N9K A;  2KAJ A;  1V8C A;  3AM9 A;  4OW0 A;  4RCO A;  1CJE A;  1C76 A;  2BW2 A;  3BWU D;  2YEP B;  1QOB A;  1KLG D;  2KMM A;  1GOZ A;  4AS1 A;  2IPK D;  2RPV A;  1VDV A;  3ETR A;  3W2D A;  1SB3 C;  2OED A;  2LFI A;  3BK2 A;  1NVI D;  1E6E B;  2GRI A;  1B1Z A;  2WLB A;  1AN8 A;  2WXQ A;  3HVD A;  4NJC A;  4JX1 C;  3DWM A;  3AH7 A;  1WYG A;  4DXG A;  1I4G A;  5D3I B;  4HRS A;  1FO4 A;  1I4R A;  5BYQ A;  2AQ2 B;  1FXA A;  4RGO S;  1SIJ A;  1XO3 A;  2JYT A;  3GP7 A;  3CIR B;  3B9J A;  5BYS A;  1M4V A;  2MEK A;  1D5Z C;  2PKO A;  3KWL A;  4ZRQ A;  2CU3 A;  2N7J A;  4CQN A;  5H92 C;  3R2T A;  4O1N A;  3ZYY X;  2ONQ A;  4YSY B;  4OVZ A;  3BVG A;  4M0W A;  3TEY A;  4XE0 A;  4A55 A;  2DWQ A;  3MC0 B;  2LJI A;  2CJO A;  2QIE B;  1YJI A;  3H8H A;  5HHD G;  1QQR A;  1MHH E;  3AE7 B;  1PFD A;  4IKG A;  2JSV X;  4R3D A;  5BMH A;  4US8 A;  2IJ0 A;  1SJH D;  2VZK D;  3AEG B;  1XF5 L;  1QLB B;  1SE3 A;  2LHD A;  1TS4 A;  2PLP A;  1TS5 A;  1TS2 A;  1DGJ A;  3NVY A;  2MJE A;  5GXG B;  3VR8 B;  2DYM A;  2MJ3 A;  2QEJ C;  2M0A A;  2W3R A;  2WXN A;  3OWE B;  2FUG 1;  1SJE D;  1E10 A;  1F77 A;  3AV8 A;  3P4Q B;  3Q8E A;  2JWU A;  4ZHP A;  1QOA A;  2GI9 A;  1V1P A;  4FXC A;  4EE2 A;  5JXV A;  3VRB B;  4JWS C;  2E3T A;  4OHJ A;  3SFE B;  4C7Z A;  4DXF A;  1AW7 A;  3V3X A;  1XEE A;  4RGN A;  3IT4 B;  3B2G A;  1AYF A;  2BS4 B;  1L0Y B;  1F2R I;  1STE A;  2SAK A;  2ZW0 A;  3NVV A;  4NAM A;  1SXT A;  1EM7 A;  1RFK A;  3KQ4 A;  1LO5 D;  3I57 A;  2QSD A;  2WS3 B;  5G5G A;  5AUI A;  1ENF A;  3R8B A;  1A70 A;  2XN9 C;  3BII D;  2LUM A;  4DQO C;  2JU6 X;  4WUR A;  1K50 A;  2ACZ B;  1V1P B;  4TQ0 A;  3BYT B;  4IDI A;  4US9 A;  1J7B A;  1WWT A;  4JPS A;  4OZB A;  2K22 A;  1VLB A;  2HDE A;  1D4B A;  1JCK B;  2WXO A;  3J9C A;  1UWM A;  1SEB D;  1C4C A;  3KWV A;  1NYQ A;  3MHZ A;  3P4S B;  1N5W A;  1PGA A;  1WXQ A;  2OHF A;  4YTN B;  2WDQ B;  5H8Y E;  4MM3 B;  4Q2J A;  1V1O A;  4WWM A;  2DBY A;  2BBC A;  1N60 A;  5D3D A;  1QOG A;  2WU5 B;  2WDV B;  2IGH A;  3ZJU A;  2V0G A;  2V4I B;  3BVM A;  4RGM A;  3AEE B;  1PYW D;  1QOF A;  2N9L A;  1YNT E;  2PTL A;  3U7Z A;  2J53 A;  1J7C A;  4JE3 B;  3L4P A;  1FM0 D;  1I4H A;  1SE4 A;  4JWU C;  4WIP A;  2PVG C;  3Q8C A;  1ZOY B;  2ZW1 A;  1EU3 A;  3EUB 2;  1L0X B;  3BK1 A;  5HI1 A;  1T3Q A;  1EWC A;  1IBX B;  1HZ5 A;  1N5X A;  3GB1 A;  4XDD A;  1QIL A;  3U4E G;  4HKZ E;  1EU4 A;  2I2Y A;  3N9Y C;  1ZE3 D;  1FRD A;  2QJL A;  2G1E A;  1JML A;  2JX5 A;  2XNA C;  2Y5C A;  4KGT A;  4RNA A;  2MJD A;  2KWD A;  1HA5 A;  2K3U A;  3IAS 1;  1GB4 A;  1JWB D;  4MH8 A;  2JXT A;  1SSN A;  3KLS X;  1TKY A;  4HKQ A;  1PGX A;  3URY A;  3NZ3 A;  3ZJV A;  2I38 A;  1XLQ A;  3AE1 B;  4PT5 A;  3R2I A;  1FCC C;  1I7H A;  1D5X C;  1TKG A;  3C8Y A;  1TYG B;  5HFY A;  3PO0 A;  4KGR A;  1BUI C;  2M56 B;  1KRH A;  2LHE A;  3ZJT A;  3AN1 A;  4P6V F;  1QKZ A;  4WQM A;  1NEK B;  1JWA D;  3AMZ A;  4C80 A;  3NRZ A;  3NVW A;  1ROE A;  2BT6 A;  3GS2 A;  3Q8F A;  2B76 B;  4YSZ B;  1KFY B;  1UUP A;  2PMV A;  2VZK B;  3AED B;  2V3P A;  4ZRP A;  2PIA A;  2L83 A;  1TZO A;  5G5H A;  1ZXH A;  4XWW A;  1DOX A;  1F0Z A;  1N61 A;  1JRO A;  1I4P A;  3RFZ B;  4XDC A;  1DOY A;  1IGC A;  1TS3 A;  2LEK A;  2WXJ A;  2AQ1 B;  1FMA D;  3Q8B A;  4OZC A;  2ICI A;  1R7S A;  4WAF A;  1ZPS A;  1NEN B;  2WXL A;  2Y5P A;  2HTM E;  1L6V A;  2IGD A;  2KAC A;  1FIQ A;  4ARI A;  3MJ5 A;  1XLN A;  4KGS A;  4ZHO A;  2W82 A;  3Q8A A;  2Z8L A;  3BYY B;  1B9R A;  3Q69 A;  1CZP A;  4NZL B;  2EKI A;  4TQ1 A;  1IUE A;  2BS2 B;  2H88 B;  2BB5 A;  1YN5 A;  5EE9 A;  4TSS A;  1T6B X;  3EA6 A;  1MI0 A;  3TUO A;  3VR9 B;  4ZOH C;  2MH7 A;  1C4A A;  4B0E A;  1XXG A;  4RFB A;  1KF6 B;  1WGK A;  1I4X A;  1IGD A;  3IXS A;  3AEC B;  3W1S A;  2K0P A;  2D5G A;  4LTU A;  2L52 A;  1EWY C;  1OFF A;  2WXF A;  1FCL A;  2PVO D;  3W5V B;  1OQR A;  1FFV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...