1MHXA

Crystal structures of the redesigned protein g variant nug1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
65
structure length
65
Chain Sequence
MHHHHHHAMDTYKLFIVIGDRVVVVTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAAKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords immunoglobulin-binding protein G
publication title Crystal structures and increased stabilization of the protein G variants with switched folding pathways NuG1 and NuG2
pubmed doi rcsb
source organism Finegoldia magna
total genus 13
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2002-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1mhxA00
1FD6A 2RPVA 5HFYA 2IGGA 2KWDA 3GB1A 1XCQL 2GI9A 2ONQA 4IKGA 1KH0A 2ZW1A 5JXVA 1IGDA 1YMHE 4OZAA 1P7FA 2LUMA 1GB1A 4OZCA 2NMQA 1GB4A 1P7EA 2EELA 1PGXA 2KN4A 4OZBA 1UWXA 1YNTE 1FCLA 2J52A 2I2YA 1K50A 3V3XA 1PGAA 4GLSC 2QSDA 2JSVX 2N9LA 2PLPA 1IBXB 2PTLA 1K53A 4KGSA 1F2RI 1MI0A 4HKZE 1QKZA 5HI1A 2KDMA 2ZW0A 3FILA 2ON8A 2LHDA 1F2RC 2N7JA 1D4BA 1PGBA 2J53A 4HJGE 1JMLA 2N9KA 1MPEA 1ZXHA 3FILB 5HG2A 2IGDA 1XF5L 1IGCA 1K52A 2PW9A 1IBXA 4WH4A 1MHHE 4D2KA 2I38A 1XCTL 5BMIA 4MACA 1FCCC 2JZPA 3MP9A 2JWUA 5HHDG 2LHEA 2K0PA 2KQ4X 3UI3A 5BMHA 4KGTA 2JU6X 2KACA 5BMGA 1HEZE 1EM7A 2RMMA 1MHXA 1C9FA 2GB1A 2LGIA 2JXTA 1K51A 2QMTA 4IOIE 2IGHA 1HZ6A 2OEDA 1MVKA 1HZ5A 1Q10A 4KGRA
chains in the Genus database with same CATH superfamily
4LJOB 3W1YA 2QILA 2AEHA 2KZRA 3R2IA 4ZRPA 4WWPA 3UIPB 4HVBA 4K7SA 4FN2A 4E74A 4C4VB 4IKGA 1KH0A 4R3DA 4WJOA 3P4PB 3MHSD 1ZP0B 2FAZA 1GB1A 2NBUA 3R7QA 3W2DA 2DZKA 4FHKA 4WAFA 2MP2A 1TJEA 2JRIB 4K81A 4HPLB 2L0FA 1YNTE 1GJZA 2WXGA 2L32A 1CJEA 3I57A 3FAHA 3Q3MC 2NTSA 2J0KA 1TZ1A 4DXFA 2TSSA 2KTRB 4WWNA 2N9LA 3PPAA 2JWZA 3B0AA 2V3SA 2BYVE 5CHFA 1VLBA 3AH7A 1SXTA 3KUZA 3PT2B 3DBRI 3DHIC 3H7SA 1SJED 1SE4A 5CX3A 3Q8CA 3RNAC 2QCZA 2MBHA 1WXQA 1C77A 2LJ5A 1QOAA 4B0EA 3ZO5B 2ZVNA 4ZRQA 3VQIA 2L0TA 3N32A 1J7CA 2INDC 1WJ4A 3TBLD 2N1WA 3W1SA 4PS8A 1RFKA 3SFDB 4W9HA 1B9RA 4KVGB 3PZ7A 3DBHI 3ZDMC 1Q0WB 4EZLA 1ZKHA 2ZVOA 4DXGA 1JWUD 3RI7C 1UD7A 1JWSD 2RDHA 2XEWA 4P7IA 3SD5A 1JW9D 3R7RA 2BVCA 2LVOA 3UQBA 3VDZA 5D7GA 2MBEA 3N30A 1YMHE 3M62B 3QCAA 3AI5A 2ZJDA 1P7FA 2RD0A 4C00A 1JROA 2N7EA 4ANVA 3ZVVA 2KN5A 4KSLC 1OTRB 3W1SC 3MC9A 3ML8A 4DQOC 2ASQA 1C4CA 1WJ6A 2KANA 2L1AA 4B9KA 1FNVA 1L5PA 5GXGB 1XO3A 4LNFA 2V3NA 3UINB 4LCDE 1N5XA 2PIAA 3Q3JA 2LMCA 1FO4A 3QJZA 5LNK1 2W3RA 5H8YE 3R8BA 1RAXA 3H8HA 4WURA 3ONSA 3DOWA 2J4XA 2CU1A 4K3BA 3N20C 3BVZA 2WQYB 2DAFA 2K8BA 3QHTA 4IWPA 3T9LA 3TEZA 3VH3B 3DVNU 1WJUA 2QDFA 2JVCA 2A5UA 4C7YA 1C3TA 1FCCC 3QAQA 1QLBB 5J17A 2WXLA 2WDTB 2WXJA 3TUOA 2VH2A 4HCNB 5JH5C 1L6UA 1ZUD2 3OJ3A 1JWBD 2MHJA 3EC8A 2MRPA 4DHJB 1VZ6A 2FCMA 4AQ7A 2V3PA 4OW0A 2JUOA 3LB8C 4ZRKA 2QMTA 2JYEA 1A5RA 2NS5A 3LXFA 4WQOB 2O2VA 4ZDVA 5DPRA 3B9JA 1LXDA 4JX1C 4RF1A 2BYFA 5IAAC 3NZSA 1E9MA 5IA7A 3V62A 2ZW1A 5JXVA 3ZRCA 4DDID 1DOYA 2WNMA 2KAJA 4WJQA 3ZRFA 1I7HA 3KYCD 4CHKA 1J8CA 1SE9A 5E6OA 3P4RB 2KDIA 1PGXA 3ZIMA 1ENFA 2G9HD 1WGDA 1RYJA 4K7UA 2JZ3B 2HJ1A 4QAYA 2Y5CA 2WYQA 1TS4A 1BUIC 4A9AA 2KWVB 2WXRA 4DXAB 2C7NB 2D5GA 1FIQA 4ICVA 1NI3A 3ZJUA 2G1EA 2L7RA 5D6JB 1EUVB 2DX5B 3P42A 1ZXHA 1P3QU 2JPHA 2IGDA 1XF5L 1HE8A 1SJHD 5LXHA 1V81A 2WXPA 2BPSA 3C19A 1WX8A 2K22A 3A1QB 1IYFA 1F0ZA 4GU2A 1WXAA 2D07B 5FK9C 4MH0E 3V60A 1YIWA 2QHOA 3IT4B 4BKGA 2KVZA 1UBQA 5BMHA 3B2FA 5G55A 1XQQA 5AUKA 3RFZB 4K3CA 1BT0A 1XLOA 3AEFB 1ZGUB 5L95C 1NVID 3KQ4A 2IO3B 4LNNA 2NCNA 4L1BA 2LGYA 1T3QA 1FD6A 1E0ZA 1UGMA 2M8SA 3ZNGC 1J0GA 5DPTA 4EOYA 2IY0B 4W9EA 2L00B 3BWUD 3KLSX 1STEA 1UZXB 4MGZE 1KFYB 2GBNA 3UQAA 4NQLB 2JRHA 4NJCA 5EE3A 2NMQA 2N9PC 2MQJA 4RF0A 2INCC 3RNBC 2FCNA 4GDKB 4IDIA 4II2B 2FUHB 1V49A 2DHZA 3VTWA 1UBIA 4JIOU 3DHHC 1QQRA 4ZHPA 2KFKA 3WANA 2JSVX 4IG7B 4TUUA 3TEXA 3VXWA 3CF6E 2KKCA 5IN7A 4NPNA 2D3CA 3A9JB 2WXFA 3L0WB 4AJYB 4LNKA 4HXDA 3Q8FA 2MBQA 4TV3A 4F7ZA 3APCA 4JPSA 1YN4A 1GNUA 3NHEB 4X57B 2V4LA 2VRRB 1TKYA 3A9KA 3EUB2 2KDBA 5HG2A 3U2SC 4YTMB 4WH4A 3N1XC 2WXOA 2BS2B 1OEYA 4WQMA 4WIPA 1KOTA 2W55A 2K0PA 3S2AA 5JHBA 2PEAA 3O65B 4C56C 3JYUA 1NBFC 4M02A 2JU6X 4A6QA 1YQ4B 2N9XA 2HD5B 1XT9B 4FXCA 5BMGA 5D2MB 4TKNA 1WX7A 3VH4B 3AEEB 1WY8A 4HPMB 5G5GA 4NQKE 1T0QC 3DHGC 1HTOA 2W3SA 1MFWA 2WX0A 3CWIA 1WGRA 2FUG1 3WALA 4ACFA 4PYUA 3E9SA 4OZAA 2L83A 1D5XC 3LYYA 3KYDD 2CU3A 3CMMB 2MJEA 1P98A 2SEBD 2G4DB 1VRAB 2WHIA 1XD3B 4BFRA 1LFDA 2UU7A 3Q8AA 1R4MB 2R2OA 4GDLA 3DPDA 4MSQB 3Q69A 4OZBA 2RR9A 4AOFA 2EKEC 1IP9A 1K50A 3UIOB 5BO4B 4A20A 1UF0A 4RCOA 3H7PA 2LXCA 1K53A 1KLGD 3B08A 3W9CB 1KM7A 1MG8A 3ML9A 3JW0X 1TGZB 1FRDA 4HLEA 2LHDA 1D4BA 3PHXB 1PGBA 2KWUB 1HA5A 2Z0DB 4ITKA 1WE7A 2WXQA 4GSWA 2PW9A 3AM9A 3NUHB 4D2KA 4RH6A 2PKOA 2WS3B 5HKHA 5J2RA 2KO3A 2XNAC 3DVNV 3OJ4B 2GOWA 3WAOA 1FMAD 2K39A 2VZKD 1I4HA 2DZMA 3K9OB 3V6EB 4KDLB 2FCQA 5CHVC 4RM9A 2FIFA 2BQQA 4W9DA 4LLGM 2DYOA 4IW0A 4KX6B 4EEWA 1LQBA 2LGIA 1N5WA 1QOBA 5I4DA 3KW5B 1KTKA 4MM3B 4C7ZA 1AARA 4XX5A 2Z59B 2DZIA 4BOZB 4IUMB 2KWDA 5CTRC 3VUWA 3SEBA 3JSVA 3PRMB 2IO1B 5C1ZA 2O6VD 3P1MA 1P0RA 2PE9A 1XLQA 5EE0A 2KN4A 3ZUNA 3BYTB 1FXTB 4O1NA 2ZPYA 4DWFA 5EDSA 1WZ0A 3DBRB 2BKFA 4NJ6A 3KH0A 2BF8B 3RNCC 1RM6C 1S1QB 1SIFA 2DZJA 2I2YA 1SE3A 1OEYJ 1I4XA 3QIJA 1N62A 1TS3A 4YT0B 4L23A 4IM3A 2PTLA 2WGSA 4DBGA 3P2BA 4XE0A 1T0YA 2BWES 4P16A 3EHVA 2NTTA 5HI1A 2BGFA 3DBHB 4OVUA 3RD2A 4BKTA 4LDTD 4BAXA 1JMLA 3ZXRA 1YJJA 2M56B 1EWYC 4KIKB 3ZNHB 1MHHE 3HRDD 2PVGC 1KRHA 2KYWA 2KK8A 4JLCA 3AE8B 2CHZA 3P63A 2LEKA 2DBYA 3L54A 1WF9A 4YWGG 1E8XA 4IM0A 5DPWA 3AU5A 2N1VA 1ZPSA 4PT5A 1D3ZA 3IT6B 2XK5B 4RGOS 3RZFA 4YTPB 3ABVB 2JXTA 3V61A 4W9GA 2MA9B 4DDGD 2EMTA 1JWAD 2K8HA 4N59A 3GZNI 1FPYA 1SGHA 2AL3A 4ZOHC 1GC7A 1QILA 1YN3A 2DLBA 3P4SB 2B76B 3AXCA 4N58A 3MTNB 2X8XX 3DCGA 2I1JA 2MSED 1F1HA 2KT7A 3GS2A 1TKEA 3PZ8A 4ANWA 2O6VA 2Z0EB 3T3NA 4NAWA 1D5MC 1WGGA 2MBBB 3D32A 2JQRB 1TIFA 2MP2B 4Q2JA 4LJPB 1UWXA 2IBIB 4EE2A 1SE2A 4M8MA 2V4IB 1GOZA 2R61A 4N9F4 2LGXA 3AEGB 3NZ3A 1GUAB 4GOCA 4E71A 4K7WA 1I4QA 5MPOA 1FEHA 2KWCA 2LRWA 4HK2A 1WI0A 4HRSA 5L83A 1CZPA 4HKZE 1QKZA 4ASWC 2DWQA 3A4SC 4E3CA 2L3ZA 3O13A 3HHMA 2JY6A 3RZWC 1OGWA 1NENB 3M95A 4IM2A 3ZNZB 3APDA 4MJSA 5IP4D 2WXHA 2AX5A 5HHDG 2L52A 5D3IB 2NPTA 2L76A 2K6DB 3ALBA 3NG0A 2ICIA 2INPE 4YXDB 4G50A 1E8YA 4ZYSA 2BS3B 1MHXA 4GXBA 2X38A 1RRBA 1TS2A 4H2AA 4FA6A 1V80A 4JWSC 3I3TB 3KUCB 5G5HA 2WLBA 2H89B 2WDRB 2GBMA 2JF5A 4FADA 2NR2A 4KKIA 2AL6A 3MC8A 3T3OA 1UUPA 3NS8A 4G0NB 1XCQL 2K25A 3NS1A 1WYWB 2UWQA 3PO0A 1TY2A 3BY4B 3J9CA 4MDKE 3P4QB 4WJPA 4DHZB 3SR6A 3QC8B 1L4ZB 1NYQA 3TJPA 1S3SG 1QOFA 2LGDA 3PRZA 2WDVB 1L0XB 3X23A 1C76A 5BYQA 3AU4A 3PTFC 4LNIA 2D3BA 3I63C 1TTNA 3I9V1 4GLSC 3KVFB 3TMPB 3C8YA 3MHZA 5T8IA 4GMVA 2K8CA 4KZCA 2GLSA 3PRPB 3RUIB 3DVGY 1EU3A 1WXVA 2WWZA 2N7JA 4HJKA 1DGJA 5IOIA 3RNGC 1V5OA 1WX9A 3BVMA 4W9CA 3Q8EA 3NJTA 3RNEC 2W82A 2J7QB 3MFGA 3HUIA 2HJ8A 3UF8A 4BBNF 2CR5A 3ZW3A 1TBEA 2M19A 2GBJA 3AEAB 2HE7A 3DQVA 3L10B 2RMMA 2LASA 4A90A 2GB1A 3RULA 2LXAA 4ANXA 4W9FA 2RPQA 3TSSA 1JALA 4M0WA 1SEBD 3A33B 3VTVA 1HZ5A 4ZRIA 1T5XD 4KGRA 3CIRB 4RGMA 1I35A 1RFAA 2BWFA 4JE3B 2O2VB 2MLBA 1TZOA 2ONQA 3SFEB 3L16A 1EU4A 1VJKA 1E7UA 4II3B 2LUMA 1WIAA 1DYQA 4WWMA 4PYZA 4ZHOA 4BVUC 2LJIA 5AEKB 4YL8A 4OHJA 3QA8A 2MEKA 1C4AA 1D6EC 1H4RA 1WM2A 1WMHA 3ECIA 2IY1B 1WGHA 1UGJA 4TSSA 1FXAA 5DCNA 2BKRB 4ICUA 3GE3C 3V3XA 2LI5A 2E3TA 4KGSA 3NVWA 2REXA 3L4PA 2RDBC 1E6EB 3WAPA 2LVQA 2J53A 3AECB 4L2YA 1IGCA 2KFJA 3HVZA 2HTME 4MACA 2MCNB 3CSFA 2KLGA 1E7PB 1JQ4A 4M8NA 5TSSA 4S0RA 3IFWB 1KLUD 2BT6A 4TMAB 2ZNVB 3RMKC 1L6VA 1U4AA 1UNSA 3HIZA 4HKQA 4AWJA 2HTHA 2IO0B 1EWCA 1E7VA 1L7YA 1YQBA 1WXSA 1V8CA 3N3KB 2IGGA 3OG5A 1A70A 3PREA 2GMIC 4W9IA 1V1OA 3BINA 3ENEA 3TL5A 4MELA 2L05A 1GC6A 2CHXA 1WRDB 2IJ0A 1V6EA 2KDEB 1ZOYB 1L0VB 4WWOA 3KUDB 1C4PA 4JL9A 4YSZB 1HTQA 3TEYA 3DBLI 1RLFA 2CS4A 3ZDTA 3SHQA 4US8A 5FKAC 2J52A 1TS5A 2BBCA 4HDOA 2KX3A 5D94A 2QJLA 1VR9A 2KFKB 4C80A 1YD8U 2DENB 2G45B 4FLHA 4RFBA 3QQ8B 1XXGA 1CK1A 3ZJVA 1V1PA 1QF6A 4NNJB 3U4EG 2DNFA 3AE7B 1PYWD 2YVCA 4MH8A 2KNBA 5D3DA 4XWTA 3FILA 3LDZE 4NAMA 1OQYA 2KJHB 5IO9A 3HVDA 4MGIE 1FNWA 1N61A 2ZCBA 3A9KB 1XCTL 3PLUA 3PSEB 2JZZA 4YSXB 1YJIA 4TQ1A 1V5TA 3AV8A 2L8JA 2KQ4X 4B6WA 4RNAA 2BYEA 5LLIA 2UYZB 2Q5WD 4XZ4A 4FBJB 2C7HA 3EECA 2D3GA 2KC1A 4REZA 3NRZA 3RN9C 1J19A 3IBEA 3PS6A 5G2NA 4NJ7A 5GMVA 2V1YA 1C78A 2Z8LA 5JZEB 2KQSA 3FKYA 3NVVA 4C4VA 3JVZX 2JX5A 3V05A 1V86A 2AQ1B 2GI9A 4BBNC 5DPSA 4IWOA 1PQSA 3SDLC 3ZTDA 2LFIA 3VRBB 1ACCA 3AN1A 1NEKB 4OVZA 4I6PA 4PK1A 1TYGB 3AEBB 2AQ3B 1K8RB 3VHTC 1FCLA 4XDCA 4XWWA 4GDLB 3URYA 4FJZA 2KTRA 4JGHB 1GAQB 1WR1A 1B1ZA 1F77A 2PVOD 4RGTA 3RCZA 3ZYYX 2DYBA 1V97A 3H7PB 1F9JA 1WWTA 1WM3A 1R7SA 3DVGX 2N9EB 1N60A 2I1KA 3L13A 1WXMA 2ON8A 1QZEA 1F2RC 2FBWB 2KXJA 1CQVA 3GE8C 1M94A 1MPEA 1EF1A 1IBXA 3E56A 5AUIA 4DHJD 3MP9A 1TT5B 3GZNB 2CJNA 3Q6BA 2RDGA 2MH7A 1ROEA 3B1LX 3WA0A 2G3QB 2N7DA 1T0SC 1X1MA 3HK0A 4FHJA 2J0JA 2D11A 2LZ6A 4YTNB 4CYEA 4AUQC 1C9FA 5E6PA 1WZ3A 3RPFC 2K1FA 4RGNA 4B95A 4KKJA 4M01A 5AZGA 4MSMB 3NOBA 2D2QA 4IOIE 5H92C 2OJRA 1HZ6A 1UWMA 4G11A 1QT9A 1I4PA 3VVWB 3OWEB 2RPVA 2AWTA 1TKGA 2LD9A 3GB1A 5EE9A 2NBWB 3X0WA 4A55A 1VD2A 4ANUA 2KD0A 1JRUA 4RMAA 1FFUA 3JSVB 3AEDB 2J0MA 1VZ8A 2WXNA 2EELA 2EKIA 1WRIA 2LWPA 1R4NI 2GBRA 1FXIA 2PJHA 4JQWC 2M0AA 4J3OD 4DHZE 2WP9B 3T8MA 1FRRA 5TR5A 3AE4B 3EFCA 3DWMA 3AE1B 2M1MA 2KDFB 1CMXB 1IBXB 2KHWB 1YN5A 1F2RI 1MG4A 4EZKA 1P1AA 1V9JA 4MGYE 2C60A 3PGEA 1D5ZC 2AYOB 1E10A 3HM6X 1MJDA 3H1UA 2QEJC 3IXSA 4HJGE 2WXIA 3APFA 1K52A 2KX0A 3WIMA 3WAMA 3EA6A 3NY5A 3BZDB 1HQRD 1LM8B 3RYTA 3ZXVA 2JWUA 5C3JB 2LHEA 1I4GA 3VTUA 2WU2B 1Y56A 3MJ5A 2KC2A 2LUEA 2BTEA 3ETRA 4KDIC 4ARCA 4HEA1 4XDDA 4JWUC 2CKHB 4A3PA 3AE2B 4HDQA 4LTUA 4AJWA 2VZKB 1KJTA 4P6VF 2MJ3A 3Q3OC 2GBKA 2KQ7A 1ET6A 1H8CA 3U7ZA 2W54A 2FE8A 2ZPNA 2BW2A 2M17A 3ZTCA 3QARA 4HWIB 5EE1A 4CO7A 3R66C 1P7EA 4ZYNA 4LK0M 1EF5A 3QX1A 3AB5A 2VH1A 3AE5B 3PHWB 2JT4B 2Y3AA 2G4SA 2K3UA 1FNUA 1ZE3D 3BYYB 2O6VB 4NAWB 4W9LA 3U8ZA 2IDYA 5AZFA 1WE6A 4K1RB 1WFYA 3VRAB 2MWSB 3EFUA 3Q8BA 3N1ZC 4I6LB 4XC2A 2EMSA 2KOXA 1PGAA 3BIID 2PLPA 1ZW7A 3SU8X 1ESFA 2IYDB 5E6JA 2WX1A 3IHPC 1L0YB 2KDMA 2ZW0A 2RGFA 2WDQB 1WR6E 2CJOA 1SB3C 2WXMA 3A1QA 1LO5D 1I42A 1GPXA 3VUYA 5BMIA 2KMAA 3MC0B 1T6BX 4LDTB 4CQNA 4MJSB 3N1YC 4DK5A 2ACZB 3TEWA 1L2NA 4EKUA 2OHFA 2NPTB 2QIEB 3NVZA 2KJRA 2HDEA 2K5PA 1HXYD 1JWMD 2Y5BB 2K6QA 2BB5A 2YEPB 4WJNA 2ZCCA 2MX2A 3IAM1 1K51A 1DOIA 1Q1OA 2KMCA 1F52A 1MVKA 1Q10A 1PFDA 3AE6B 4FULA 2MJDA 4IWQA 4W9KA 3TIXA 4URKA 5IKCM 3PZDA 3AE9B 4WAAA 3I5JC 3RNFC 2Y5PA 1IGDA 3PLVA 1Z2MA 3Q2AC 2XBBC 4PS3A 4J6IA 4ZRJA 1GB4A 4AS1A 4UDUC 5AZHA 5KHOA 4GDKA 1I4RA 1WGYA 1VDVA 1SSNA 4BKSD 3B2GA 1OQQA 3R3MA 4F8CB 1XEEA 2C7MB 1GG3A 4GB9A 1RWSA 1ZXIA 1N6ZA 3ZLZA 3NZUA 3W5UB 3A9JA 1WYGA 1JCKB 1BXTA 1QOGA 1EO6A 2CHWA 3BVGA 1AN8A 4US9A 1SF0A 4TQ0A 2KTFA 1AWDA 1N63A 1MI0A 3ZJTA 4EUTA 3ZKJC 3DDCB 3TCAA 1DOXA 3BK2A 3IG3A 2M0XA 4P1BC 4USAA 4OVVA 5KHQA 2YLMA 1OFFA 4RM8A 1AYFA 2OOBB 4NZLB 2K9XA 1BMLC 4HCPB 4F1SA 2KACA 3N9YC 1EM7A 3NVYA 1E8ZA 1E5WA 1E8WA 2PPHA 2FCSA 3OAWA 4M00A 3U52E 1ET9A 4A3OA 2ZNVC 5FR3A 2SAKA 2NVUI 2W9NA 4M0WB 4MT5A 5BYRA 5J18A 1JRPA 1ZDXA 3DBLB 1YQ3B 2RSUA 2GRIA 3WCQA 2BS4B 3VR8B 3LJ3A 2C9WB 2KVRA 5C2TB 3EGRA 2JXXA 4EFOA 4OZCA 4KV2A 3VFKA 4KSKC 2JYTA 3VAWA 3ZGZA 1AW7A 2C5LC 1J7BA 2PMVA 2H88B 3KWVA 1V2YA 4MGKE 1SBBB 2A4ZA 3Q3NC 4BKSA 2KLCA 3L08A 4I6NB 1ISNA 4MEMA 2V0GA 2IZVB 1WMHB 2DAJA 3DWGC 1M4VA 1Z5SB 2V9HA 5JHAA 1PUTA 3UGBB 3PVLA 3QK0A 1NYRA 3KWLA 1C1YB 1ZDVA 4W9JA 5E6NA 2MBOA 3VUXA 1VCBA 4GIVA 3GP7A 2JZPA 1L4DB 3BK1A 2ZEQA 4S17A 3UI3A 1TY0A 2D10A 3PV1A 3RT3B 3QWZB 1LGRA 4IC7B 1HEZE 4P1CC 2IO2B 3AE3B 4MM3A 1OQRA 3HM3A 4XYCA 2FIDA 4G3XB 4N6EB 1NI2A 1WGKA 4FJYA 1FFVA 1YOVB 2DYMA 1J7AA 1PDXA 5HFYA 2XN9C 3C0RB 1KLVA 2LGSA 2E6XA 4EZJA 4HPPA 2IPKD 2QC8A 4LNOA 1FM0D 2NBVB 4NY0A 3M63B 3IVFA 1VZ7A 5C23A 4FJVB 1G6JA 2WXKA 4B0MA 1WSPA 3U7DA 1WJNA 4HROA 3MJWA 3GOEA 2LRUA 3H9DA 4XGAB 5CHWA 4PS7A 4GN1A 2BYTA 3L17A 3IAS1 3R2TA 3A4RA 3ZQ4A 5BYSA 4GGQA 1C79A 2PE6B 2QSDA 1WH3A 1UH6A 1KF6B 3ZNID 3AMZA 2R2QA 2D3AA 3OLMD 1XLNA 1V1PB 3DBSA 3M3JA 5LXIB 2N0SB 1IUEA 1R4MI 2N4FA 4KIKA 2B3AA 4AP4C 5FR6A 1Y8RC 3FILB 2N9KA 4A8XC 1SIJA 2FNJB 1E90A 2YEPF 2I38A 3U30A 3W5VB 4ARIA 1YX6B 2BB6A 3FC4A 1T0RC 2OJWA 1YX5B 2J42A 2AQ2B 2KJ6A 1UELA 1P9DU 2INNE 1YJ1A 1IPGA 2XK5A 2M4NA 4KGTA 3H6NA 4BZAA 1NDDA 2WU5B 3K9PB 2MW5A 3V6CB 4BOSC 2KMMA 3Q14C 3CSTA 3AULA 3VR9B 3Q3FA 1R4NB 2ZZPB 4YSYB 1XLPA 2IGHA 2LVPA 2OEDA 1Q5WB 4KZ0A
chains in the Genus database with same CATH topology
4RGMA 2QILA 2FUG1 2W54A 2FE8A 4JE3B 2BW2A 3R2IA 4ZRPA 1TZOA 2ONQA 3SFEB 4IKGA 1EU4A 1KH0A 3E9SA 1VJKA 5EE1A 4R3DA 4OZAA 2L83A 1D5XC 3P4PB 3LYYA 2CU3A 2MJEA 2LUMA 1ZP0B 1GB1A 3W2DA 2SEBD 1P7EA 1VRAB 4LK0M 1DYQA 4WAFA 4WWMA 4ZHOA 3AB5A 3AE5B 1TJEA 2LJIA 3Q8AA 2Y3AA 2K3UA 1FNUA 1ZE3D 3BYYB 4OHJA 3Q69A 4OZBA 1YNTE 4NAWB 2MEKA 2WXGA 2IDYA 2L32A 1CJEA 3VRAB 1C4AA 1D6EC 3FAHA 3I57A 3Q8BA 1UGJA 2NTSA 4TSSA 1FXAA 1K50A 4DXFA 3V3XA 1PGAA 3BIID 2TSSA 4RCOA 2N9LA 2PLPA 2E3TA 1K53A 4KGSA 1KLGD 3NVWA 3W9CB 3L4PA 1ESFA 5E6JA 1L0YB 1E6EB 1VLBA 1FRDA 3AH7A 2KDMA 2ZW0A 2LHDA 1SXTA 2WDQB 2CJOA 1D4BA 1PGBA 2J53A 1SJED 3AECB 1SE4A 1HA5A 4L2YA 1SB3C 2WXMA 4ITKA 1LO5D 3Q8CA 1IGCA 2WXQA 2PW9A 3AM9A 1WXQA 1C77A 3HVZA 3NUHB 4D2KA 1GPXA 4RH6A 2HTME 2PKOA 5BMIA 4MACA 2WS3B 1QOAA 3MC0B 1T6BX 4B0EA 2XNAC 1E7PB 4ZRQA 3VQIA 1JQ4A 1J7CA 5TSSA 4CQNA 1FMAD 2VZKD 3W1SA 1I4HA 2ACZB 3TEWA 1RFKA 2OHFA 3SFDB 1KLUD 2BT6A 4TMAB 1B9RA 2QIEB 3NVZA 4LLGM 3PZ7A 2HDEA 2K5PA 1L6VA 1HXYD 1JWMD 2DYOA 4HKQA 1UNSA 4KX6B 2LGIA 1N5WA 1QOBA 5I4DA 2BB5A 2YEPB 1EWCA 4MM3B 1KTKA 3IAM1 1K51A 1DOIA 4C7ZA 4DXGA 1JWUD 1MVKA 1Q10A 1JWSD 1PFDA 3AE6B 2RDHA 2MJDA 1V8CA 3AE9B 1JW9D 2IGGA 2KWDA 1A70A 3SEBA 5D7GA 2Y5PA 1IGDA 1YMHE 1V1OA 1P7FA 3P1MA 1JROA 1GB4A 2IJ0A 1XLQA 5EE0A 4AS1A 1ZOYB 1L0VB 4UDUC 1C4PA 1I4RA 4DQOC 4YSZB 1C4CA 2KN4A 1VDVA 1SSNA 3BYTB 3B2GA 1OQQA 2L1AA 4O1NA 1XEEA 3TEYA 4US8A 5FKAC 1RWSA 2J52A 1FNVA 1L5PA 5GXGB 1TS5A 1XO3A 2BBCA 1RM6C 1ZXIA 2I2YA 1SE3A 1I4XA 2QJLA 1VR9A 3W5UB 1N62A 2V3NA 4C80A 1N5XA 1TS3A 1WYGA 2PIAA 1JCKB 4L23A 4YT0B 2LMCA 1BXTA 1QOGA 4RFBA 1XXGA 1CK1A 2PTLA 1FO4A 3ZJVA 1V1PA 3BVGA 1AN8A 2W3RA 4US9A 5H8YE 3R8BA 5LNK1 1QF6A 1SF0A 3H8HA 4WURA 4TQ0A 3U4EG 1AWDA 3AE7B 1N63A 2J4XA 1MI0A 1PYWD 4XE0A 3ZJTA 4P16A 3BVZA 4MH8A 2NTTA 5HI1A 5D3DA 4XWTA 3FILA 2WQYB 4NAMA 3TEZA 1JMLA 1YJJA 1DOXA 2M56B 3BK2A 1EWYC 3HVDA 1MHHE 4C7YA 3HRDD 1FNWA 1N61A 1XCTL 2PVGC 1KRHA 1FCCC 1QLBB 4YSXB 4USAA 1YJIA 4TQ1A 2WXLA 3AE8B 3AV8A 2KQ4X 3P63A 2LEKA 2WXJA 2DBYA 3TUOA 1OFFA 1AYFA 4NZLB 1L6UA 2K9XA 4RNAA 4YWGG 1BMLC 1ZUD2 1JWBD 2Q5WD 2KACA 1ZPSA 4PT5A 3N9YC 1EM7A 3NVYA 3IT6B 1VZ6A 4AQ7A 4RGOS 4YTPB 2V3PA 4OW0A 3ABVB 4REZA 3NRZA 2JXTA 3LB8C 3U52E 2QMTA 2JYEA 1ET9A 5FR3A 2SAKA 1C78A 2Z8LA 3LXFA 4MT5A 1JWAD 5BYRA 1JRPA 1ZDXA 4N59A 1YQ3B 3B9JA 2GRIA 3WCQA 4JX1C 4RF1A 3NVVA 4ZOHC 2JX5A 1E9MA 1QILA 3V05A 2BS4B 2AQ1B 1YN3A 2DLBA 2GI9A 3P4SB 2ZW1A 5JXVA 2B76B 3VR8B 4N58A 5C2TB 2WNMA 1DOYA 3EGRA 2KAJA 1I7HA 4OZCA 2LFIA 3GS2A 3VRBB 1TKEA 1ACCA 3AN1A 2JYTA 3PZ8A 3P4RB 1NEKB 1PGXA 4OVZA 3ZGZA 3T3NA 1TYGB 1ENFA 2G9HD 1AW7A 1D5MC 1J7BA 2PMVA 2H88B 2AQ3B 3AEBB 3KWVA 2JQRB 4Q2JA 1UWXA 1RYJA 1FCLA 4XDCA 4EE2A 4XWWA 1SE2A 4GDLB 3URYA 2V4IB 1GOZA 1SBBB 2R61A 3AEGB 2V0GA 1GAQB 3NZ3A 2Y5CA 3DWGC 1B1ZA 1F77A 1M4VA 2PVOD 1I4QA 4RGTA 3ZYYX 1TS4A 5MPOA 1FEHA 1PUTA 1BUIC 4A9AA 2WXRA 1V97A 4HRSA 2D5GA 1CZPA 4HKZE 1WWTA 1FIQA 1QKZA 1R7SA 1NI3A 3ZJUA 1NYRA 2DWQA 1N60A 3KWLA 2G1EA 2ON8A 1F2RC 2FBWB 3O13A 1ZDVA 1CQVA 3P42A 1MPEA 1ZXHA 2IGDA 1XF5L 1SJHD 2WXPA 1IBXA 3E56A 1NENB 3GP7A 5AUIA 2K22A 2JZPA 3MP9A 1F0ZA 1L4DB 2WXHA 5FK9C 3BK1A 2AX5A 2CJNA 5HHDG 2L52A 2RDGA 5D3IB 3UI3A 3IT4B 2MH7A 1ROEA 1TY0A 2ICIA 5BMHA 2INPE 3B2FA 1HEZE 5AUKA 4YXDB 3RFZB 4YTNB 4ZYSA 2BS3B 1MHXA 3AE3B 1OQRA 2X38A 1C9FA 4H2AA 1TS2A 1XLOA 3RPFC 4JWSC 4RGNA 3AEFB 4KKJA 5G5HA 4N6EB 2WLBA 5H92C 4IOIE 1NVID 1WGKA 2H89B 3KQ4A 1HZ6A 1FFVA 1UWMA 2WDRB 1QT9A 4L1BA 1I4PA 2DYMA 1T3QA 3OWEB 4KKIA 1J7AA 1FD6A 1E0ZA 2RPVA 1PDXA 5HFYA 3T3OA 2XN9C 1UUPA 1TKGA 3GB1A 5EE9A 3BWUD 2E6XA 1XCQL 3CWIA 3KLSX 1STEA 3NS1A 2IPKD 4A55A 1FM0D 1KFYB 3PO0A 1FFUA 1TY2A 3J9CA 3AEDB 4NJCA 3P4QB 5EE3A 1VZ8A 2NMQA 2WXNA 3SR6A 2EELA 2EKIA 1L4ZB 1WRIA 1NYQA 4RF0A 1VZ7A 1FXIA 2WXKA 2M0AA 4B0MA 1WSPA 4GDKB 4J3OD 4IDIA 2WP9B 1QOFA 4HROA 2WDVB 1FRRA 1QQRA 4ZHPA 1L0XB 3AE4B 1C76A 2BYTA 5BYQA 3IAS1 3DWMA 3R2TA 3ZQ4A 3AE1B 5BYSA 1C79A 3I9V1 4GLSC 2JSVX 2QSDA 3TEXA 3C8YA 3MHZA 1IBXB 5T8IA 1YN5A 1KF6B 1F2RI 3AMZA 2WXFA 1XLNA 1V1PB 3Q8FA 1D5ZC 1EU3A 2N0SB 1IUEA 1E10A 4JPSA 1YN4A 2N7JA 2QEJC 3IXSA 4HJGE 2N9KA 1DGJA 3FILB 1TKYA 1SIJA 2WXIA 3EUB2 4A8XC 5HG2A 3U2SC 1K52A 4YTMB 4WH4A 3BVMA 2WXOA 2YEPF 2I38A 2BS2B 3EA6A 3W5VB 3Q8EA 4ARIA 2BB6A 3FC4A 3BZDB 4WQMA 2W82A 1HQRD 4WIPA 3MFGA 2JWUA 3HUIA 5C3JB 2LHEA 2J42A 2W55A 1I4GA 2AQ2B 2K0PA 2INNE 2WU2B 4C56C 1Y56A 3MJ5A 4KGTA 2M19A 2JU6X 4A6QA 2BTEA 1YQ4B 4FXCA 3ETRA 5BMGA 3AEAB 4ARCA 3AEEB 4HEA1 2RMMA 2WU5B 4A90A 4XDDA 2GB1A 4JWUC 5G5GA 3AE2B 3TSSA 4LTUA 2KMMA 1JALA 4M0WA 3VR9B 2VZKB 4P6VF 1SEBD 2MJ3A 4YSYB 1XLPA 2IGHA 2OEDA 1ET6A 1HZ5A 3U7ZA 2W3SA 1T5XD 4KGRA 3CIRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FD6 A;  2RPV A;  5HFY A;  2IGG A;  2KWD A;  3GB1 A;  1XCQ L;  2GI9 A;  2ONQ A;  4IKG A;  1KH0 A;  2ZW1 A;  5JXV A;  1IGD A;  1YMH E;  4OZA A;  1P7F A;  2LUM A;  1GB1 A;  4OZC A;  2NMQ A;  1GB4 A;  1P7E A;  2EEL A;  1PGX A;  2KN4 A;  4OZB A;  1UWX A;  1YNT E;  1FCL A;  2J52 A;  2I2Y A;  1K50 A;  3V3X A;  1PGA A;  4GLS C;  2QSD A;  2JSV X;  2N9L A;  2PLP A;  1IBX B;  2PTL A;  1K53 A;  4KGS A;  1F2R I;  1MI0 A;  4HKZ E;  1QKZ A;  5HI1 A;  2KDM A;  2ZW0 A;  3FIL A;  2ON8 A;  2LHD A;  1F2R C;  2N7J A;  1D4B A;  1PGB A;  2J53 A;  4HJG E;  1JML A;  2N9K A;  1MPE A;  1ZXH A;  3FIL B;  5HG2 A;  2IGD A;  1XF5 L;  1IGC A;  1K52 A;  2PW9 A;  1IBX A;  4WH4 A;  1MHH E;  4D2K A;  2I38 A;  1XCT L;  5BMI A;  4MAC A;  1FCC C;  2JZP A;  3MP9 A;  2JWU A;  5HHD G;  2LHE A;  2K0P A;  2KQ4 X;  3UI3 A;  5BMH A;  4KGT A;  2JU6 X;  2KAC A;  5BMG A;  1HEZ E;  1EM7 A;  2RMM A;  1MHX A;  1C9F A;  2GB1 A;  2LGI A;  2JXT A;  1K51 A;  2QMT A;  4IOI E;  2IGH A;  1HZ6 A;  2OED A;  1MVK A;  1HZ5 A;  1Q10 A;  4KGR A; 
#chains in the Genus database with same CATH topology
 4LJO B;  3W1Y A;  2QIL A;  2AEH A;  2KZR A;  3R2I A;  4ZRP A;  4WWP A;  3UIP B;  4HVB A;  4K7S A;  4FN2 A;  4E74 A;  4C4V B;  4IKG A;  1KH0 A;  4R3D A;  4WJO A;  3P4P B;  3MHS D;  1ZP0 B;  2FAZ A;  1GB1 A;  2NBU A;  3R7Q A;  3W2D A;  2DZK A;  4FHK A;  4WAF A;  2MP2 A;  1TJE A;  2JRI B;  4K81 A;  4HPL B;  2L0F A;  1YNT E;  1GJZ A;  2WXG A;  2L32 A;  1CJE A;  3I57 A;  3FAH A;  3Q3M C;  2NTS A;  2J0K A;  1TZ1 A;  4DXF A;  2TSS A;  2KTR B;  4WWN A;  2N9L A;  3PPA A;  2JWZ A;  3B0A A;  2V3S A;  2BYV E;  5CHF A;  1VLB A;  3AH7 A;  1SXT A;  3KUZ A;  3PT2 B;  3DBR I;  3DHI C;  3H7S A;  1SJE D;  1SE4 A;  5CX3 A;  3Q8C A;  3RNA C;  2QCZ A;  2MBH A;  1WXQ A;  1C77 A;  2LJ5 A;  1QOA A;  4B0E A;  3ZO5 B;  2ZVN A;  4ZRQ A;  3VQI A;  2L0T A;  3N32 A;  1J7C A;  2IND C;  1WJ4 A;  3TBL D;  2N1W A;  3W1S A;  4PS8 A;  1RFK A;  3SFD B;  4W9H A;  1B9R A;  4KVG B;  3PZ7 A;  3DBH I;  3ZDM C;  1Q0W B;  4EZL A;  1ZKH A;  2ZVO A;  4DXG A;  1JWU D;  3RI7 C;  1UD7 A;  1JWS D;  2RDH A;  2XEW A;  4P7I A;  3SD5 A;  1JW9 D;  3R7R A;  2BVC A;  2LVO A;  3UQB A;  3VDZ A;  5D7G A;  2MBE A;  3N30 A;  1YMH E;  3M62 B;  3QCA A;  3AI5 A;  2ZJD A;  1P7F A;  2RD0 A;  4C00 A;  1JRO A;  2N7E A;  4ANV A;  3ZVV A;  2KN5 A;  4KSL C;  1OTR B;  3W1S C;  3MC9 A;  3ML8 A;  4DQO C;  2ASQ A;  1C4C A;  1WJ6 A;  2KAN A;  2L1A A;  4B9K A;  1FNV A;  1L5P A;  5GXG B;  1XO3 A;  4LNF A;  2V3N A;  3UIN B;  4LCD E;  1N5X A;  2PIA A;  3Q3J A;  2LMC A;  1FO4 A;  3QJZ A;  5LNK 1;  2W3R A;  5H8Y E;  3R8B A;  1RAX A;  3H8H A;  4WUR A;  3ONS A;  3DOW A;  2J4X A;  2CU1 A;  4K3B A;  3N20 C;  3BVZ A;  2WQY B;  2DAF A;  2K8B A;  3QHT A;  4IWP A;  3T9L A;  3TEZ A;  3VH3 B;  3DVN U;  1WJU A;  2QDF A;  2JVC A;  2A5U A;  4C7Y A;  1C3T A;  1FCC C;  3QAQ A;  1QLB B;  5J17 A;  2WXL A;  2WDT B;  2WXJ A;  3TUO A;  2VH2 A;  4HCN B;  5JH5 C;  1L6U A;  1ZUD 2;  3OJ3 A;  1JWB D;  2MHJ A;  3EC8 A;  2MRP A;  4DHJ B;  1VZ6 A;  2FCM A;  4AQ7 A;  2V3P A;  4OW0 A;  2JUO A;  3LB8 C;  4ZRK A;  2QMT A;  2JYE A;  1A5R A;  2NS5 A;  3LXF A;  4WQO B;  2O2V A;  4ZDV A;  5DPR A;  3B9J A;  1LXD A;  4JX1 C;  4RF1 A;  2BYF A;  5IAA C;  3NZS A;  1E9M A;  5IA7 A;  3V62 A;  2ZW1 A;  5JXV A;  3ZRC A;  4DDI D;  1DOY A;  2WNM A;  2KAJ A;  4WJQ A;  3ZRF A;  1I7H A;  3KYC D;  4CHK A;  1J8C A;  1SE9 A;  5E6O A;  3P4R B;  2KDI A;  1PGX A;  3ZIM A;  1ENF A;  2G9H D;  1WGD A;  1RYJ A;  4K7U A;  2JZ3 B;  2HJ1 A;  4QAY A;  2Y5C A;  2WYQ A;  1TS4 A;  1BUI C;  4A9A A;  2KWV B;  2WXR A;  4DXA B;  2C7N B;  2D5G A;  1FIQ A;  4ICV A;  1NI3 A;  3ZJU A;  2G1E A;  2L7R A;  5D6J B;  1EUV B;  2DX5 B;  3P42 A;  1ZXH A;  1P3Q U;  2JPH A;  2IGD A;  1XF5 L;  1HE8 A;  1SJH D;  5LXH A;  1V81 A;  2WXP A;  2BPS A;  3C19 A;  1WX8 A;  2K22 A;  3A1Q B;  1IYF A;  1F0Z A;  4GU2 A;  1WXA A;  2D07 B;  5FK9 C;  4MH0 E;  3V60 A;  1YIW A;  2QHO A;  3IT4 B;  4BKG A;  2KVZ A;  1UBQ A;  5BMH A;  3B2F A;  5G55 A;  1XQQ A;  5AUK A;  3RFZ B;  4K3C A;  1BT0 A;  1XLO A;  3AEF B;  1ZGU B;  5L95 C;  1NVI D;  3KQ4 A;  2IO3 B;  4LNN A;  2NCN A;  4L1B A;  2LGY A;  1T3Q A;  1FD6 A;  1E0Z A;  1UGM A;  2M8S A;  3ZNG C;  1J0G A;  5DPT A;  4EOY A;  2IY0 B;  4W9E A;  2L00 B;  3BWU D;  3KLS X;  1STE A;  1UZX B;  4MGZ E;  1KFY B;  2GBN A;  3UQA A;  4NQL B;  2JRH A;  4NJC A;  5EE3 A;  2NMQ A;  2N9P C;  2MQJ A;  4RF0 A;  2INC C;  3RNB C;  2FCN A;  4GDK B;  4IDI A;  4II2 B;  2FUH B;  1V49 A;  2DHZ A;  3VTW A;  1UBI A;  4JIO U;  3DHH C;  1QQR A;  4ZHP A;  2KFK A;  3WAN A;  2JSV X;  4IG7 B;  4TUU A;  3TEX A;  3VXW A;  3CF6 E;  2KKC A;  5IN7 A;  4NPN A;  2D3C A;  3A9J B;  2WXF A;  3L0W B;  4AJY B;  4LNK A;  4HXD A;  3Q8F A;  2MBQ A;  4TV3 A;  4F7Z A;  3APC A;  4JPS A;  1YN4 A;  1GNU A;  3NHE B;  4X57 B;  2V4L A;  2VRR B;  1TKY A;  3A9K A;  3EUB 2;  2KDB A;  5HG2 A;  3U2S C;  4YTM B;  4WH4 A;  3N1X C;  2WXO A;  2BS2 B;  1OEY A;  4WQM A;  4WIP A;  1KOT A;  2W55 A;  2K0P A;  3S2A A;  5JHB A;  2PEA A;  3O65 B;  4C56 C;  3JYU A;  1NBF C;  4M02 A;  2JU6 X;  4A6Q A;  1YQ4 B;  2N9X A;  2HD5 B;  1XT9 B;  4FXC A;  5BMG A;  5D2M B;  4TKN A;  1WX7 A;  3VH4 B;  3AEE B;  1WY8 A;  4HPM B;  5G5G A;  4NQK E;  1T0Q C;  3DHG C;  1HTO A;  2W3S A;  1MFW A;  2WX0 A;  3CWI A;  1WGR A;  2FUG 1;  3WAL A;  4ACF A;  4PYU A;  3E9S A;  4OZA A;  2L83 A;  1D5X C;  3LYY A;  3KYD D;  2CU3 A;  3CMM B;  2MJE A;  1P98 A;  2SEB D;  2G4D B;  1VRA B;  2WHI A;  1XD3 B;  4BFR A;  1LFD A;  2UU7 A;  3Q8A A;  1R4M B;  2R2O A;  4GDL A;  3DPD A;  4MSQ B;  3Q69 A;  4OZB A;  2RR9 A;  4AOF A;  2EKE C;  1IP9 A;  1K50 A;  3UIO B;  5BO4 B;  4A20 A;  1UF0 A;  4RCO A;  3H7P A;  2LXC A;  1K53 A;  1KLG D;  3B08 A;  3W9C B;  1KM7 A;  1MG8 A;  3ML9 A;  3JW0 X;  1TGZ B;  1FRD A;  4HLE A;  2LHD A;  1D4B A;  3PHX B;  1PGB A;  2KWU B;  1HA5 A;  2Z0D B;  4ITK A;  1WE7 A;  2WXQ A;  4GSW A;  2PW9 A;  3AM9 A;  3NUH B;  4D2K A;  4RH6 A;  2PKO A;  2WS3 B;  5HKH A;  5J2R A;  2KO3 A;  2XNA C;  3DVN V;  3OJ4 B;  2GOW A;  3WAO A;  1FMA D;  2K39 A;  2VZK D;  1I4H A;  2DZM A;  3K9O B;  3V6E B;  4KDL B;  2FCQ A;  5CHV C;  4RM9 A;  2FIF A;  2BQQ A;  4W9D A;  4LLG M;  2DYO A;  4IW0 A;  4KX6 B;  4EEW A;  1LQB A;  2LGI A;  1N5W A;  1QOB A;  5I4D A;  3KW5 B;  1KTK A;  4MM3 B;  4C7Z A;  1AAR A;  4XX5 A;  2Z59 B;  2DZI A;  4BOZ B;  4IUM B;  2KWD A;  5CTR C;  3VUW A;  3SEB A;  3JSV A;  3PRM B;  2IO1 B;  5C1Z A;  2O6V D;  3P1M A;  1P0R A;  2PE9 A;  1XLQ A;  5EE0 A;  2KN4 A;  3ZUN A;  3BYT B;  1FXT B;  4O1N A;  2ZPY A;  4DWF A;  5EDS A;  1WZ0 A;  3DBR B;  2BKF A;  4NJ6 A;  3KH0 A;  2BF8 B;  3RNC C;  1RM6 C;  1S1Q B;  1SIF A;  2DZJ A;  2I2Y A;  1SE3 A;  1OEY J;  1I4X A;  3QIJ A;  1N62 A;  1TS3 A;  4YT0 B;  4L23 A;  4IM3 A;  2PTL A;  2WGS A;  4DBG A;  3P2B A;  4XE0 A;  1T0Y A;  2BWE S;  4P16 A;  3EHV A;  2NTT A;  5HI1 A;  2BGF A;  3DBH B;  4OVU A;  3RD2 A;  4BKT A;  4LDT D;  4BAX A;  1JML A;  3ZXR A;  1YJJ A;  2M56 B;  1EWY C;  4KIK B;  3ZNH B;  1MHH E;  3HRD D;  2PVG C;  1KRH A;  2KYW A;  2KK8 A;  4JLC A;  3AE8 B;  2CHZ A;  3P63 A;  2LEK A;  2DBY A;  3L54 A;  1WF9 A;  4YWG G;  1E8X A;  4IM0 A;  5DPW A;  3AU5 A;  2N1V A;  1ZPS A;  4PT5 A;  1D3Z A;  3IT6 B;  2XK5 B;  4RGO S;  3RZF A;  4YTP B;  3ABV B;  2JXT A;  3V61 A;  4W9G A;  2MA9 B;  4DDG D;  2EMT A;  1JWA D;  2K8H A;  4N59 A;  3GZN I;  1FPY A;  1SGH A;  2AL3 A;  4ZOH C;  1GC7 A;  1QIL A;  1YN3 A;  2DLB A;  3P4S B;  2B76 B;  3AXC A;  4N58 A;  3MTN B;  2X8X X;  3DCG A;  2I1J A;  2MSE D;  1F1H A;  2KT7 A;  3GS2 A;  1TKE A;  3PZ8 A;  4ANW A;  2O6V A;  2Z0E B;  3T3N A;  4NAW A;  1D5M C;  1WGG A;  2MBB B;  3D32 A;  2JQR B;  1TIF A;  2MP2 B;  4Q2J A;  4LJP B;  1UWX A;  2IBI B;  4EE2 A;  1SE2 A;  4M8M A;  2V4I B;  1GOZ A;  2R61 A;  4N9F 4;  2LGX A;  3AEG B;  3NZ3 A;  1GUA B;  4GOC A;  4E71 A;  4K7W A;  1I4Q A;  5MPO A;  1FEH A;  2KWC A;  2LRW A;  4HK2 A;  1WI0 A;  4HRS A;  5L83 A;  1CZP A;  4HKZ E;  1QKZ A;  4ASW C;  2DWQ A;  3A4S C;  4E3C A;  2L3Z A;  3O13 A;  3HHM A;  2JY6 A;  3RZW C;  1OGW A;  1NEN B;  3M95 A;  4IM2 A;  3ZNZ B;  3APD A;  4MJS A;  5IP4 D;  2WXH A;  2AX5 A;  5HHD G;  2L52 A;  5D3I B;  2NPT A;  2L76 A;  2K6D B;  3ALB A;  3NG0 A;  2ICI A;  2INP E;  4YXD B;  4G50 A;  1E8Y A;  4ZYS A;  2BS3 B;  1MHX A;  4GXB A;  2X38 A;  1RRB A;  1TS2 A;  4H2A A;  4FA6 A;  1V80 A;  4JWS C;  3I3T B;  3KUC B;  5G5H A;  2WLB A;  2H89 B;  2WDR B;  2GBM A;  2JF5 A;  4FAD A;  2NR2 A;  4KKI A;  2AL6 A;  3MC8 A;  3T3O A;  1UUP A;  3NS8 A;  4G0N B;  1XCQ L;  2K25 A;  3NS1 A;  1WYW B;  2UWQ A;  3PO0 A;  1TY2 A;  3BY4 B;  3J9C A;  4MDK E;  3P4Q B;  4WJP A;  4DHZ B;  3SR6 A;  3QC8 B;  1L4Z B;  1NYQ A;  3TJP A;  1S3S G;  1QOF A;  2LGD A;  3PRZ A;  2WDV B;  1L0X B;  3X23 A;  1C76 A;  5BYQ A;  3AU4 A;  3PTF C;  4LNI A;  2D3B A;  3I63 C;  1TTN A;  3I9V 1;  4GLS C;  3KVF B;  3TMP B;  3C8Y A;  3MHZ A;  5T8I A;  4GMV A;  2K8C A;  4KZC A;  2GLS A;  3PRP B;  3RUI B;  3DVG Y;  1EU3 A;  1WXV A;  2WWZ A;  2N7J A;  4HJK A;  1DGJ A;  5IOI A;  3RNG C;  1V5O A;  1WX9 A;  3BVM A;  4W9C A;  3Q8E A;  3NJT A;  3RNE C;  2W82 A;  2J7Q B;  3MFG A;  3HUI A;  2HJ8 A;  3UF8 A;  4BBN F;  2CR5 A;  3ZW3 A;  1TBE A;  2M19 A;  2GBJ A;  3AEA B;  2HE7 A;  3DQV A;  3L10 B;  2RMM A;  2LAS A;  4A90 A;  2GB1 A;  3RUL A;  2LXA A;  4ANX A;  4W9F A;  2RPQ A;  3TSS A;  1JAL A;  4M0W A;  1SEB D;  3A33 B;  3VTV A;  1HZ5 A;  4ZRI A;  1T5X D;  4KGR A;  3CIR B;  4RGM A;  1I35 A;  1RFA A;  2BWF A;  4JE3 B;  2O2V B;  2MLB A;  1TZO A;  2ONQ A;  3SFE B;  3L16 A;  1EU4 A;  1VJK A;  1E7U A;  4II3 B;  2LUM A;  1WIA A;  1DYQ A;  4WWM A;  4PYZ A;  4ZHO A;  4BVU C;  2LJI A;  5AEK B;  4YL8 A;  4OHJ A;  3QA8 A;  2MEK A;  1C4A A;  1D6E C;  1H4R A;  1WM2 A;  1WMH A;  3ECI A;  2IY1 B;  1WGH A;  1UGJ A;  4TSS A;  1FXA A;  5DCN A;  2BKR B;  4ICU A;  3GE3 C;  3V3X A;  2LI5 A;  2E3T A;  4KGS A;  3NVW A;  2REX A;  3L4P A;  2RDB C;  1E6E B;  3WAP A;  2LVQ A;  2J53 A;  3AEC B;  4L2Y A;  1IGC A;  2KFJ A;  3HVZ A;  2HTM E;  4MAC A;  2MCN B;  3CSF A;  2KLG A;  1E7P B;  1JQ4 A;  4M8N A;  5TSS A;  4S0R A;  3IFW B;  1KLU D;  2BT6 A;  4TMA B;  2ZNV B;  3RMK C;  1L6V A;  1U4A A;  1UNS A;  3HIZ A;  4HKQ A;  4AWJ A;  2HTH A;  2IO0 B;  1EWC A;  1E7V A;  1L7Y A;  1YQB A;  1WXS A;  1V8C A;  3N3K B;  2IGG A;  3OG5 A;  1A70 A;  3PRE A;  2GMI C;  4W9I A;  1V1O A;  3BIN A;  3ENE A;  3TL5 A;  4MEL A;  2L05 A;  1GC6 A;  2CHX A;  1WRD B;  2IJ0 A;  1V6E A;  2KDE B;  1ZOY B;  1L0V B;  4WWO A;  3KUD B;  1C4P A;  4JL9 A;  4YSZ B;  1HTQ A;  3TEY A;  3DBL I;  1RLF A;  2CS4 A;  3ZDT A;  3SHQ A;  4US8 A;  5FKA C;  2J52 A;  1TS5 A;  2BBC A;  4HDO A;  2KX3 A;  5D94 A;  2QJL A;  1VR9 A;  2KFK B;  4C80 A;  1YD8 U;  2DEN B;  2G45 B;  4FLH A;  4RFB A;  3QQ8 B;  1XXG A;  1CK1 A;  3ZJV A;  1V1P A;  1QF6 A;  4NNJ B;  3U4E G;  2DNF A;  3AE7 B;  1PYW D;  2YVC A;  4MH8 A;  2KNB A;  5D3D A;  4XWT A;  3FIL A;  3LDZ E;  4NAM A;  1OQY A;  2KJH B;  5IO9 A;  3HVD A;  4MGI E;  1FNW A;  1N61 A;  2ZCB A;  3A9K B;  1XCT L;  3PLU A;  3PSE B;  2JZZ A;  4YSX B;  1YJI A;  4TQ1 A;  1V5T A;  3AV8 A;  2L8J A;  2KQ4 X;  4B6W A;  4RNA A;  2BYE A;  5LLI A;  2UYZ B;  2Q5W D;  4XZ4 A;  4FBJ B;  2C7H A;  3EEC A;  2D3G A;  2KC1 A;  4REZ A;  3NRZ A;  3RN9 C;  1J19 A;  3IBE A;  3PS6 A;  5G2N A;  4NJ7 A;  5GMV A;  2V1Y A;  1C78 A;  2Z8L A;  5JZE B;  2KQS A;  3FKY A;  3NVV A;  4C4V A;  3JVZ X;  2JX5 A;  3V05 A;  1V86 A;  2AQ1 B;  2GI9 A;  4BBN C;  5DPS A;  4IWO A;  1PQS A;  3SDL C;  3ZTD A;  2LFI A;  3VRB B;  1ACC A;  3AN1 A;  1NEK B;  4OVZ A;  4I6P A;  4PK1 A;  1TYG B;  3AEB B;  2AQ3 B;  1K8R B;  3VHT C;  1FCL A;  4XDC A;  4XWW A;  4GDL B;  3URY A;  4FJZ A;  2KTR A;  4JGH B;  1GAQ B;  1WR1 A;  1B1Z A;  1F77 A;  2PVO D;  4RGT A;  3RCZ A;  3ZYY X;  2DYB A;  1V97 A;  3H7P B;  1F9J A;  1WWT A;  1WM3 A;  1R7S A;  3DVG X;  2N9E B;  1N60 A;  2I1K A;  3L13 A;  1WXM A;  2ON8 A;  1QZE A;  1F2R C;  2FBW B;  2KXJ A;  1CQV A;  3GE8 C;  1M94 A;  1MPE A;  1EF1 A;  1IBX A;  3E56 A;  5AUI A;  4DHJ D;  3MP9 A;  1TT5 B;  3GZN B;  2CJN A;  3Q6B A;  2RDG A;  2MH7 A;  1ROE A;  3B1L X;  3WA0 A;  2G3Q B;  2N7D A;  1T0S C;  1X1M A;  3HK0 A;  4FHJ A;  2J0J A;  2D11 A;  2LZ6 A;  4YTN B;  4CYE A;  4AUQ C;  1C9F A;  5E6P A;  1WZ3 A;  3RPF C;  2K1F A;  4RGN A;  4B95 A;  4KKJ A;  4M01 A;  5AZG A;  4MSM B;  3NOB A;  2D2Q A;  4IOI E;  5H92 C;  2OJR A;  1HZ6 A;  1UWM A;  4G11 A;  1QT9 A;  1I4P A;  3VVW B;  3OWE B;  2RPV A;  2AWT A;  1TKG A;  2LD9 A;  3GB1 A;  5EE9 A;  2NBW B;  3X0W A;  4A55 A;  1VD2 A;  4ANU A;  2KD0 A;  1JRU A;  4RMA A;  1FFU A;  3JSV B;  3AED B;  2J0M A;  1VZ8 A;  2WXN A;  2EEL A;  2EKI A;  1WRI A;  2LWP A;  1R4N I;  2GBR A;  1FXI A;  2PJH A;  4JQW C;  2M0A A;  4J3O D;  4DHZ E;  2WP9 B;  3T8M A;  1FRR A;  5TR5 A;  3AE4 B;  3EFC A;  3DWM A;  3AE1 B;  2M1M A;  2KDF B;  1CMX B;  1IBX B;  2KHW B;  1YN5 A;  1F2R I;  1MG4 A;  4EZK A;  1P1A A;  1V9J A;  4MGY E;  2C60 A;  3PGE A;  1D5Z C;  2AYO B;  1E10 A;  3HM6 X;  1MJD A;  3H1U A;  2QEJ C;  3IXS A;  4HJG E;  2WXI A;  3APF A;  1K52 A;  2KX0 A;  3WIM A;  3WAM A;  3EA6 A;  3NY5 A;  3BZD B;  1HQR D;  1LM8 B;  3RYT A;  3ZXV A;  2JWU A;  5C3J B;  2LHE A;  1I4G A;  3VTU A;  2WU2 B;  1Y56 A;  3MJ5 A;  2KC2 A;  2LUE A;  2BTE A;  3ETR A;  4KDI C;  4ARC A;  4HEA 1;  4XDD A;  4JWU C;  2CKH B;  4A3P A;  3AE2 B;  4HDQ A;  4LTU A;  4AJW A;  2VZK B;  1KJT A;  4P6V F;  2MJ3 A;  3Q3O C;  2GBK A;  2KQ7 A;  1ET6 A;  1H8C A;  3U7Z A;  2W54 A;  2FE8 A;  2ZPN A;  2BW2 A;  2M17 A;  3ZTC A;  3QAR A;  4HWI B;  5EE1 A;  4CO7 A;  3R66 C;  1P7E A;  4ZYN A;  4LK0 M;  1EF5 A;  3QX1 A;  3AB5 A;  2VH1 A;  3AE5 B;  3PHW B;  2JT4 B;  2Y3A A;  2G4S A;  2K3U A;  1FNU A;  1ZE3 D;  3BYY B;  2O6V B;  4NAW B;  4W9L A;  3U8Z A;  2IDY A;  5AZF A;  1WE6 A;  4K1R B;  1WFY A;  3VRA B;  2MWS B;  3EFU A;  3Q8B A;  3N1Z C;  4I6L B;  4XC2 A;  2EMS A;  2KOX A;  1PGA A;  3BII D;  2PLP A;  1ZW7 A;  3SU8 X;  1ESF A;  2IYD B;  5E6J A;  2WX1 A;  3IHP C;  1L0Y B;  2KDM A;  2ZW0 A;  2RGF A;  2WDQ B;  1WR6 E;  2CJO A;  1SB3 C;  2WXM A;  3A1Q A;  1LO5 D;  1I42 A;  1GPX A;  3VUY A;  5BMI A;  2KMA A;  3MC0 B;  1T6B X;  4LDT B;  4CQN A;  4MJS B;  3N1Y C;  4DK5 A;  2ACZ B;  3TEW A;  1L2N A;  4EKU A;  2OHF A;  2NPT B;  2QIE B;  3NVZ A;  2KJR A;  2HDE A;  2K5P A;  1HXY D;  1JWM D;  2Y5B B;  2K6Q A;  2BB5 A;  2YEP B;  4WJN A;  2ZCC A;  2MX2 A;  3IAM 1;  1K51 A;  1DOI A;  1Q1O A;  2KMC A;  1F52 A;  1MVK A;  1Q10 A;  1PFD A;  3AE6 B;  4FUL A;  2MJD A;  4IWQ A;  4W9K A;  3TIX A;  4URK A;  5IKC M;  3PZD A;  3AE9 B;  4WAA A;  3I5J C;  3RNF C;  2Y5P A;  1IGD A;  3PLV A;  1Z2M A;  3Q2A C;  2XBB C;  4PS3 A;  4J6I A;  4ZRJ A;  1GB4 A;  4AS1 A;  4UDU C;  5AZH A;  5KHO A;  4GDK A;  1I4R A;  1WGY A;  1VDV A;  1SSN A;  4BKS D;  3B2G A;  1OQQ A;  3R3M A;  4F8C B;  1XEE A;  2C7M B;  1GG3 A;  4GB9 A;  1RWS A;  1ZXI A;  1N6Z A;  3ZLZ A;  3NZU A;  3W5U B;  3A9J A;  1WYG A;  1JCK B;  1BXT A;  1QOG A;  1EO6 A;  2CHW A;  3BVG A;  1AN8 A;  4US9 A;  1SF0 A;  4TQ0 A;  2KTF A;  1AWD A;  1N63 A;  1MI0 A;  3ZJT A;  4EUT A;  3ZKJ C;  3DDC B;  3TCA A;  1DOX A;  3BK2 A;  3IG3 A;  2M0X A;  4P1B C;  4USA A;  4OVV A;  5KHQ A;  2YLM A;  1OFF A;  4RM8 A;  1AYF A;  2OOB B;  4NZL B;  2K9X A;  1BML C;  4HCP B;  4F1S A;  2KAC A;  3N9Y C;  1EM7 A;  3NVY A;  1E8Z A;  1E5W A;  1E8W A;  2PPH A;  2FCS A;  3OAW A;  4M00 A;  3U52 E;  1ET9 A;  4A3O A;  2ZNV C;  5FR3 A;  2SAK A;  2NVU I;  2W9N A;  4M0W B;  4MT5 A;  5BYR A;  5J18 A;  1JRP A;  1ZDX A;  3DBL B;  1YQ3 B;  2RSU A;  2GRI A;  3WCQ A;  2BS4 B;  3VR8 B;  3LJ3 A;  2C9W B;  2KVR A;  5C2T B;  3EGR A;  2JXX A;  4EFO A;  4OZC A;  4KV2 A;  3VFK A;  4KSK C;  2JYT A;  3VAW A;  3ZGZ A;  1AW7 A;  2C5L C;  1J7B A;  2PMV A;  2H88 B;  3KWV A;  1V2Y A;  4MGK E;  1SBB B;  2A4Z A;  3Q3N C;  4BKS A;  2KLC A;  3L08 A;  4I6N B;  1ISN A;  4MEM A;  2V0G A;  2IZV B;  1WMH B;  2DAJ A;  3DWG C;  1M4V A;  1Z5S B;  2V9H A;  5JHA A;  1PUT A;  3UGB B;  3PVL A;  3QK0 A;  1NYR A;  3KWL A;  1C1Y B;  1ZDV A;  4W9J A;  5E6N A;  2MBO A;  3VUX A;  1VCB A;  4GIV A;  3GP7 A;  2JZP A;  1L4D B;  3BK1 A;  2ZEQ A;  4S17 A;  3UI3 A;  1TY0 A;  2D10 A;  3PV1 A;  3RT3 B;  3QWZ B;  1LGR A;  4IC7 B;  1HEZ E;  4P1C C;  2IO2 B;  3AE3 B;  4MM3 A;  1OQR A;  3HM3 A;  4XYC A;  2FID A;  4G3X B;  4N6E B;  1NI2 A;  1WGK A;  4FJY A;  1FFV A;  1YOV B;  2DYM A;  1J7A A;  1PDX A;  5HFY A;  2XN9 C;  3C0R B;  1KLV A;  2LGS A;  2E6X A;  4EZJ A;  4HPP A;  2IPK D;  2QC8 A;  4LNO A;  1FM0 D;  2NBV B;  4NY0 A;  3M63 B;  3IVF A;  1VZ7 A;  5C23 A;  4FJV B;  1G6J A;  2WXK A;  4B0M A;  1WSP A;  3U7D A;  1WJN A;  4HRO A;  3MJW A;  3GOE A;  2LRU A;  3H9D A;  4XGA B;  5CHW A;  4PS7 A;  4GN1 A;  2BYT A;  3L17 A;  3IAS 1;  3R2T A;  3A4R A;  3ZQ4 A;  5BYS A;  4GGQ A;  1C79 A;  2PE6 B;  2QSD A;  1WH3 A;  1UH6 A;  1KF6 B;  3ZNI D;  3AMZ A;  2R2Q A;  2D3A A;  3OLM D;  1XLN A;  1V1P B;  3DBS A;  3M3J A;  5LXI B;  2N0S B;  1IUE A;  1R4M I;  2N4F A;  4KIK A;  2B3A A;  4AP4 C;  5FR6 A;  1Y8R C;  3FIL B;  2N9K A;  4A8X C;  1SIJ A;  2FNJ B;  1E90 A;  2YEP F;  2I38 A;  3U30 A;  3W5V B;  4ARI A;  1YX6 B;  2BB6 A;  3FC4 A;  1T0R C;  2OJW A;  1YX5 B;  2J42 A;  2AQ2 B;  2KJ6 A;  1UEL A;  1P9D U;  2INN E;  1YJ1 A;  1IPG A;  2XK5 A;  2M4N A;  4KGT A;  3H6N A;  4BZA A;  1NDD A;  2WU5 B;  3K9P B;  2MW5 A;  3V6C B;  4BOS C;  2KMM A;  3Q14 C;  3CST A;  3AUL A;  3VR9 B;  3Q3F A;  1R4N B;  2ZZP B;  4YSY B;  1XLP A;  2IGH A;  2LVP A;  2OED A;  1Q5W B;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 4RGM A;  2QIL A;  2FUG 1;  2W54 A;  2FE8 A;  4JE3 B;  2BW2 A;  3R2I A;  4ZRP A;  1TZO A;  2ONQ A;  3SFE B;  4IKG A;  1EU4 A;  1KH0 A;  3E9S A;  1VJK A;  5EE1 A;  4R3D A;  4OZA A;  2L83 A;  1D5X C;  3P4P B;  3LYY A;  2CU3 A;  2MJE A;  2LUM A;  1ZP0 B;  1GB1 A;  3W2D A;  2SEB D;  1P7E A;  1VRA B;  4LK0 M;  1DYQ A;  4WAF A;  4WWM A;  4ZHO A;  3AB5 A;  3AE5 B;  1TJE A;  2LJI A;  3Q8A A;  2Y3A A;  2K3U A;  1FNU A;  1ZE3 D;  3BYY B;  4OHJ A;  3Q69 A;  4OZB A;  1YNT E;  4NAW B;  2MEK A;  2WXG A;  2IDY A;  2L32 A;  1CJE A;  3VRA B;  1C4A A;  1D6E C;  3FAH A;  3I57 A;  3Q8B A;  1UGJ A;  2NTS A;  4TSS A;  1FXA A;  1K50 A;  4DXF A;  3V3X A;  1PGA A;  3BII D;  2TSS A;  4RCO A;  2N9L A;  2PLP A;  2E3T A;  1K53 A;  4KGS A;  1KLG D;  3NVW A;  3W9C B;  3L4P A;  1ESF A;  5E6J A;  1L0Y B;  1E6E B;  1VLB A;  1FRD A;  3AH7 A;  2KDM A;  2ZW0 A;  2LHD A;  1SXT A;  2WDQ B;  2CJO A;  1D4B A;  1PGB A;  2J53 A;  1SJE D;  3AEC B;  1SE4 A;  1HA5 A;  4L2Y A;  1SB3 C;  2WXM A;  4ITK A;  1LO5 D;  3Q8C A;  1IGC A;  2WXQ A;  2PW9 A;  3AM9 A;  1WXQ A;  1C77 A;  3HVZ A;  3NUH B;  4D2K A;  1GPX A;  4RH6 A;  2HTM E;  2PKO A;  5BMI A;  4MAC A;  2WS3 B;  1QOA A;  3MC0 B;  1T6B X;  4B0E A;  2XNA C;  1E7P B;  4ZRQ A;  3VQI A;  1JQ4 A;  1J7C A;  5TSS A;  4CQN A;  1FMA D;  2VZK D;  3W1S A;  1I4H A;  2ACZ B;  3TEW A;  1RFK A;  2OHF A;  3SFD B;  1KLU D;  2BT6 A;  4TMA B;  1B9R A;  2QIE B;  3NVZ A;  4LLG M;  3PZ7 A;  2HDE A;  2K5P A;  1L6V A;  1HXY D;  1JWM D;  2DYO A;  4HKQ A;  1UNS A;  4KX6 B;  2LGI A;  1N5W A;  1QOB A;  5I4D A;  2BB5 A;  2YEP B;  1EWC A;  4MM3 B;  1KTK A;  3IAM 1;  1K51 A;  1DOI A;  4C7Z A;  4DXG A;  1JWU D;  1MVK A;  1Q10 A;  1JWS D;  1PFD A;  3AE6 B;  2RDH A;  2MJD A;  1V8C A;  3AE9 B;  1JW9 D;  2IGG A;  2KWD A;  1A70 A;  3SEB A;  5D7G A;  2Y5P A;  1IGD A;  1YMH E;  1V1O A;  1P7F A;  3P1M A;  1JRO A;  1GB4 A;  2IJ0 A;  1XLQ A;  5EE0 A;  4AS1 A;  1ZOY B;  1L0V B;  4UDU C;  1C4P A;  1I4R A;  4DQO C;  4YSZ B;  1C4C A;  2KN4 A;  1VDV A;  1SSN A;  3BYT B;  3B2G A;  1OQQ A;  2L1A A;  4O1N A;  1XEE A;  3TEY A;  4US8 A;  5FKA C;  1RWS A;  2J52 A;  1FNV A;  1L5P A;  5GXG B;  1TS5 A;  1XO3 A;  2BBC A;  1RM6 C;  1ZXI A;  2I2Y A;  1SE3 A;  1I4X A;  2QJL A;  1VR9 A;  3W5U B;  1N62 A;  2V3N A;  4C80 A;  1N5X A;  1TS3 A;  1WYG A;  2PIA A;  1JCK B;  4L23 A;  4YT0 B;  2LMC A;  1BXT A;  1QOG A;  4RFB A;  1XXG A;  1CK1 A;  2PTL A;  1FO4 A;  3ZJV A;  1V1P A;  3BVG A;  1AN8 A;  2W3R A;  4US9 A;  5H8Y E;  3R8B A;  5LNK 1;  1QF6 A;  1SF0 A;  3H8H A;  4WUR A;  4TQ0 A;  3U4E G;  1AWD A;  3AE7 B;  1N63 A;  2J4X A;  1MI0 A;  1PYW D;  4XE0 A;  3ZJT A;  4P16 A;  3BVZ A;  4MH8 A;  2NTT A;  5HI1 A;  5D3D A;  4XWT A;  3FIL A;  2WQY B;  4NAM A;  3TEZ A;  1JML A;  1YJJ A;  1DOX A;  2M56 B;  3BK2 A;  1EWY C;  3HVD A;  1MHH E;  4C7Y A;  3HRD D;  1FNW A;  1N61 A;  1XCT L;  2PVG C;  1KRH A;  1FCC C;  1QLB B;  4YSX B;  4USA A;  1YJI A;  4TQ1 A;  2WXL A;  3AE8 B;  3AV8 A;  2KQ4 X;  3P63 A;  2LEK A;  2WXJ A;  2DBY A;  3TUO A;  1OFF A;  1AYF A;  4NZL B;  1L6U A;  2K9X A;  4RNA A;  4YWG G;  1BML C;  1ZUD 2;  1JWB D;  2Q5W D;  2KAC A;  1ZPS A;  4PT5 A;  3N9Y C;  1EM7 A;  3NVY A;  3IT6 B;  1VZ6 A;  4AQ7 A;  4RGO S;  4YTP B;  2V3P A;  4OW0 A;  3ABV B;  4REZ A;  3NRZ A;  2JXT A;  3LB8 C;  3U52 E;  2QMT A;  2JYE A;  1ET9 A;  5FR3 A;  2SAK A;  1C78 A;  2Z8L A;  3LXF A;  4MT5 A;  1JWA D;  5BYR A;  1JRP A;  1ZDX A;  4N59 A;  1YQ3 B;  3B9J A;  2GRI A;  3WCQ A;  4JX1 C;  4RF1 A;  3NVV A;  4ZOH C;  2JX5 A;  1E9M A;  1QIL A;  3V05 A;  2BS4 B;  2AQ1 B;  1YN3 A;  2DLB A;  2GI9 A;  3P4S B;  2ZW1 A;  5JXV A;  2B76 B;  3VR8 B;  4N58 A;  5C2T B;  2WNM A;  1DOY A;  3EGR A;  2KAJ A;  1I7H A;  4OZC A;  2LFI A;  3GS2 A;  3VRB B;  1TKE A;  1ACC A;  3AN1 A;  2JYT A;  3PZ8 A;  3P4R B;  1NEK B;  1PGX A;  4OVZ A;  3ZGZ A;  3T3N A;  1TYG B;  1ENF A;  2G9H D;  1AW7 A;  1D5M C;  1J7B A;  2PMV A;  2H88 B;  2AQ3 B;  3AEB B;  3KWV A;  2JQR B;  4Q2J A;  1UWX A;  1RYJ A;  1FCL A;  4XDC A;  4EE2 A;  4XWW A;  1SE2 A;  4GDL B;  3URY A;  2V4I B;  1GOZ A;  1SBB B;  2R61 A;  3AEG B;  2V0G A;  1GAQ B;  3NZ3 A;  2Y5C A;  3DWG C;  1B1Z A;  1F77 A;  1M4V A;  2PVO D;  1I4Q A;  4RGT A;  3ZYY X;  1TS4 A;  5MPO A;  1FEH A;  1PUT A;  1BUI C;  4A9A A;  2WXR A;  1V97 A;  4HRS A;  2D5G A;  1CZP A;  4HKZ E;  1WWT A;  1FIQ A;  1QKZ A;  1R7S A;  1NI3 A;  3ZJU A;  1NYR A;  2DWQ A;  1N60 A;  3KWL A;  2G1E A;  2ON8 A;  1F2R C;  2FBW B;  3O13 A;  1ZDV A;  1CQV A;  3P42 A;  1MPE A;  1ZXH A;  2IGD A;  1XF5 L;  1SJH D;  2WXP A;  1IBX A;  3E56 A;  1NEN B;  3GP7 A;  5AUI A;  2K22 A;  2JZP A;  3MP9 A;  1F0Z A;  1L4D B;  2WXH A;  5FK9 C;  3BK1 A;  2AX5 A;  2CJN A;  5HHD G;  2L52 A;  2RDG A;  5D3I B;  3UI3 A;  3IT4 B;  2MH7 A;  1ROE A;  1TY0 A;  2ICI A;  5BMH A;  2INP E;  3B2F A;  1HEZ E;  5AUK A;  4YXD B;  3RFZ B;  4YTN B;  4ZYS A;  2BS3 B;  1MHX A;  3AE3 B;  1OQR A;  2X38 A;  1C9F A;  4H2A A;  1TS2 A;  1XLO A;  3RPF C;  4JWS C;  4RGN A;  3AEF B;  4KKJ A;  5G5H A;  4N6E B;  2WLB A;  5H92 C;  4IOI E;  1NVI D;  1WGK A;  2H89 B;  3KQ4 A;  1HZ6 A;  1FFV A;  1UWM A;  2WDR B;  1QT9 A;  4L1B A;  1I4P A;  2DYM A;  1T3Q A;  3OWE B;  4KKI A;  1J7A A;  1FD6 A;  1E0Z A;  2RPV A;  1PDX A;  5HFY A;  3T3O A;  2XN9 C;  1UUP A;  1TKG A;  3GB1 A;  5EE9 A;  3BWU D;  2E6X A;  1XCQ L;  3CWI A;  3KLS X;  1STE A;  3NS1 A;  2IPK D;  4A55 A;  1FM0 D;  1KFY B;  3PO0 A;  1FFU A;  1TY2 A;  3J9C A;  3AED B;  4NJC A;  3P4Q B;  5EE3 A;  1VZ8 A;  2NMQ A;  2WXN A;  3SR6 A;  2EEL A;  2EKI A;  1L4Z B;  1WRI A;  1NYQ A;  4RF0 A;  1VZ7 A;  1FXI A;  2WXK A;  2M0A A;  4B0M A;  1WSP A;  4GDK B;  4J3O D;  4IDI A;  2WP9 B;  1QOF A;  4HRO A;  2WDV B;  1FRR A;  1QQR A;  4ZHP A;  1L0X B;  3AE4 B;  1C76 A;  2BYT A;  5BYQ A;  3IAS 1;  3DWM A;  3R2T A;  3ZQ4 A;  3AE1 B;  5BYS A;  1C79 A;  3I9V 1;  4GLS C;  2JSV X;  2QSD A;  3TEX A;  3C8Y A;  3MHZ A;  1IBX B;  5T8I A;  1YN5 A;  1KF6 B;  1F2R I;  3AMZ A;  2WXF A;  1XLN A;  1V1P B;  3Q8F A;  1D5Z C;  1EU3 A;  2N0S B;  1IUE A;  1E10 A;  4JPS A;  1YN4 A;  2N7J A;  2QEJ C;  3IXS A;  4HJG E;  2N9K A;  1DGJ A;  3FIL B;  1TKY A;  1SIJ A;  2WXI A;  3EUB 2;  4A8X C;  5HG2 A;  3U2S C;  1K52 A;  4YTM B;  4WH4 A;  3BVM A;  2WXO A;  2YEP F;  2I38 A;  2BS2 B;  3EA6 A;  3W5V B;  3Q8E A;  4ARI A;  2BB6 A;  3FC4 A;  3BZD B;  4WQM A;  2W82 A;  1HQR D;  4WIP A;  3MFG A;  2JWU A;  3HUI A;  5C3J B;  2LHE A;  2J42 A;  2W55 A;  1I4G A;  2AQ2 B;  2K0P A;  2INN E;  2WU2 B;  4C56 C;  1Y56 A;  3MJ5 A;  4KGT A;  2M19 A;  2JU6 X;  4A6Q A;  2BTE A;  1YQ4 B;  4FXC A;  3ETR A;  5BMG A;  3AEA B;  4ARC A;  3AEE B;  4HEA 1;  2RMM A;  2WU5 B;  4A90 A;  4XDD A;  2GB1 A;  4JWU C;  5G5G A;  3AE2 B;  3TSS A;  4LTU A;  2KMM A;  1JAL A;  4M0W A;  3VR9 B;  2VZK B;  4P6V F;  1SEB D;  2MJ3 A;  4YSY B;  1XLP A;  2IGH A;  2OED A;  1ET6 A;  1HZ5 A;  3U7Z A;  2W3S A;  1T5X D;  4KGR A;  3CIR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...