1L5PA

Crystal structure of trichomonas vaginalis ferredoxin
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
GTITAVKGGVKKQLKFEDDQTLFTVLTEAGLMSADDTCQGNKACGKCICKHVSGKVAAAEDDEKEFLEDQPANARLACAITLSGENDGAVFEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ferredoxin
publication title The crystal structure of Trichomonas vaginalis ferredoxin provides insight into metronidazole activation.
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Oxidoreductase
total genus 19
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1l5pA00
1KRHA 1FM0D 1J7CA 1NEKB 2PIAA 5G5HA 4C7YA 3AV8A 1EWYC 1SB3C 3B9JA 5H8YE 1YQ3B 2H88B 2BS4B 4YTPB 1E7PB 1ZXIA 2MJDA 3HUIA 1NVID 2CJNA 2BS2B 2MJ3A 1SIJA 1JWBD 3P63A 4A9AA 3FAHA 4US8A 1J7AA 2W3SA 2Y5CA 3P4SB 1E9MA 5GXGB 2K22A 2BT6A 2Q5WD 1KF6B 1GPXA 1XLQA 3AEBB 1WXQA 2QIEB 3P1MA 2JX5A 4WQMA 3DWMA 1QOBA 1OFFA 2CJOA 1J7BA 1TJEA 4JX1C 3NVYA 3VRAB 2W3RA 1E6EB 1FFUA 1RYJA 3HRDD 1E0ZA 1CJEA 1FRRA 1JRPA 4ZOHC 3VRBB 2QJLA 1AYFA 5G5GA 1OQQA 1WYGA 3ETRA 3NVVA 3AE7B 1XLNA 1PUTA 1ZOYB 1N61A 3P4QB 1N63A 3CWIA 1V97A 2MJEA 1TYGB 2DWQA 1VLBA 2M19A 1QOFA 3AEFB 3P4PB 1DOXA 1YJJA 2L83A 3HVZA 1F0ZA 5EE0A 1RM6C 1XO3A 2BS3B 2W54A 1QT9A 3NS1A 4YSXB 2B76B 1TKGA 3KWLA 1VDVA 1L0VB 1IUEA 3AMZA 5EE9A 3NVZA 1FO4A 4YXDB 3RPFC 4P6VF 1FRDA 3SFEB 1B9RA 1JALA 1VJKA 1ZUD2 2WQYB 3AE5B 5MPOA 3PO0A 1NYRA 1DGJA 2WU2B 3BIID 1N62A 3ZYYX 1KFYB 3AEGB 1SF0A 2PKOA 3AE8B 1AWDA 1FMAD 2WDQB 1TKYA 2FBWB 1JQ4A 1JROA 2CU3A 3EUB2 2WLBA 3P4RB 4USAA 1QF6A 2N0SB 1TKEA 2K5PA 2E3TA 1N5WA 2M56B 4N59A 4N6EB 1JWAD 3AEEB 2MH7A 3L4PA 4WWMA 3WCQA 1N5XA 4LTUA 1CZPA 1T3QA 1PDXA 1QOGA 4KX6B 3AEDB 1RFKA 1V8CA 3AE1B 4HRSA 4C7ZA 2ACZB 2WP9B 3LXFA 1A70A 1FXIA 4ITKA 3DWGC 1R7SA 2H89B 3AE9B 3AE2B 2AX5A 5AUKA 3VR9B 2WDVB 1YJIA 3W9CB 2G1EA 4C80A 4YTMB 1DOIA 2L52A 2HTME 3AN1A 3AE4B 1NENB 2OHFA 3LB8C 1QLBB 2DBYA 2JQRB 3AM9A 3NRZA 1RWSA 1OQRA 2K9XA 3AE6B 4YT0B 5AUIA 1PFDA 4HROA 4ZHPA 2WU5B 2KMMA 2PVOD 3ABVB 5EE1A 4YTNB 2WS3B 2WDRB 1ZP0B 1QOAA 1N60A 1YQ4B 3FC4A 3AEAB 1WRIA 4N58A 1L6VA 1L6UA 1I7HA 5EE3A 3AECB 5C2TB 4IDIA 1ROEA 3AH7A 1DOYA 3VR8B 1FFVA 1NYQA 1WGKA 3B2GA 3SR6A 5C3JB 4YSYB 1E10A 4YSZB 1XLPA 1WWTA 2KAJA 2EKIA 1XLOA 1UWMA 1NI3A 3AE3B 3CIRB 4JWUC 4US9A 4ZHOA 3AB5A 3W5VB 1GAQB 4FXCA 2W55A 2LEKA 3NVWA 4JWSC 3W5UB 5H92C 3SFDB 3B2FA 1FXAA 1JW9D 1L5PA 2PVGC 1FIQA
chains in the Genus database with same CATH superfamily
4C7YA 1UWXA 1E7PB 2ZW1A 5DPWA 3BINA 4US8A 4F7ZA 4R3DA 2DZJA 2M8SA 2MSED 4WWNA 2FCMA 2JRHA 3DWMA 4JX1C 3VXWA 1WX7A 3UQAA 1I4PA 3R8BA 3I3TB 3I5JC 1WX8A 2GB1A 4GMVA 3PHXB 2ZVNA 2KD0A 4MGKE 2NBVB 1VCBA 1V81A 4S0RA 2HTHA 5C23A 4RM9A 3DBLB 4NQKE 4YSXB 5BYSA 2WXQA 4DQOC 1OQYA 2LVOA 2NS5A 4FULA 3EFUA 2J7QB 2UU7A 3SFEB 1SSNA 3KYDD 2DYBA 3RFZB 4KDLB 3Q6BA 1N62A 1V6EA 2J53A 3RNGC 2CHXA 3EUB2 1XD3B 3PGEA 1HXYD 2E3TA 2IY0B 4WQOB 2CKHB 3AU5A 1Z5SB 2KC2A 2R61A 5DPSA 1I42A 3L0WB 1YD8U 2WP9B 2YVCA 2INDC 2GOWA 2KWVB 3Q8EA 2WXRA 4HRSA 4BZAA 4GDLA 2GMIC 3AM9A 3ZNGC 2L8JA 1KM7A 4RMAA 3H7PA 2KMCA 4FJVB 1WRIA 3AECB 4F1SA 3VTWA 1SXTA 3V61A 4KGTA 1NI3A 2G45B 2W55A 3NHEB 2PLPA 5DCNA 3SDLC 3DBHI 1KRHA 2I2YA 1NEKB 1T0RC 3ZXVA 3PV1A 4DDID 1P98A 4MGZE 4EEWA 4M00A 1AW7A 2NCNA 3P63A 1FNVA 1LXDA 4TUUA 1WXQA 3A9JB 2JX5A 2YEPF 3CF6E 4MEMA 1FCCC 1JRPA 3V6EB 1OQQA 1WXSA 1WYGA 2L00B 1QKZA 5IN7A 4P1CC 1SE4A 2M19A 1ZKHA 4I6LB 2A5UA 1I4GA 3KWLA 2RPQA 4A90A 3M3JA 3T3OA 4GGQA 5EE9A 1WFYA 4IC7B 3GE3C 1BT0A 1JALA 2IJ0A 4XWTA 4ZRQA 2G9HD 2K0PA 5HHDG 1E90A 3ALBA 3AEGB 3AE8B 3N30A 5D3IB 2WGSA 2FIDA 4EZJA 1QF6A 2WNMA 1CQVA 1YN5A 4JPSA 1TGZB 2QEJC 3U2SC 2LUEA 2PW9A 4JLCA 1UGMA 2LVPA 2D3GA 5J2RA 3U8ZA 1JWMD 3NZ3A 3KLSX 1C4AA 2IPKD 4HPPA 3C19A 2L0FA 1XLPA 2KQSA 2N1WA 4ANVA 3R7RA 2MP2B 1YX6B 3Q8AA 2N7EA 1SIFA 1D5XC 5H92C 2I1KA 3SHQA 2FBWB 2KJRA 3Q8BA 4GDKB 3P2BA 2JYTA 3AV8A 3N1ZC 1JMLA 2H88B 3URYA 3ZNZB 2BYFA 1J7AA 2JVCA 1TY0A 2Q5WD 1P7FA 4OZAA 4GSWA 4RF1A 2K8HA 2AEHA 4E74A 1ISNA 1CJEA 2MCNB 2MBHA 5BYRA 2LXAA 1HEZE 2REXA 3NOBA 4YL8A 3VUWA 2R2QA 1WGDA 1VZ7A 1R4MI 2FCNA 4RM8A 4BAXA 1VDVA 4M8MA 1L0VB 1FO4A 3GOEA 4YXDB 3T8MA 1PYWD 2BQQA 2V9HA 3R2IA 2KFKB 2KX0A 2WX0A 4WAFA 1NYRA 2N1VA 2WU2B 2ZJDA 3AXCA 1C9FA 3P4RB 3KVFB 4NAWA 2KTRA 4HXDA 4LTUA 4ICVA 4LDTB 1F9JA 2BYEA 3L08A 3ZJVA 3IVFA 2KOXA 2JRIB 3PSEB 4IM3A 4GXBA 3AE4B 1JCKB 2O6VA 3K9OB 3KUZA 2FCQA 4KIKB 2WS3B 2AYOB 1YQ4B 2ZW0A 3FC4A 4C4VB 4GB9A 3T3NA 3O13A 3V62A 1PQSA 4MSQB 5CTRC 1WGGA 1FFVA 3SR6A 4HDQA 2M1MA 2K6QA 4BKTA 2NTSA 3W1SC 4ZRJA 1UWMA 2PTLA 2RDHA 4MM3B 3U7DA 4K1RB 1IPGA 3QHTA 1IYFA 1J7CA 1L4DB 4OVZA 1EWYC 2FNJB 2JYEA 3B9JA 4EUTA 2KN4A 1MPEA 1WJNA 4KGSA 4FN2A 2AQ1B 1I4RA 3KYCD 2BVCA 1UBQA 1NBFC 2DENB 3ZUNA 1U4AA 2KFJA 2BGFA 1E6EB 3WAPA 5AZHA 4K3BA 2QMTA 2PMVA 2KDFB 4II3B 5LNK1 2LGDA 1AARA 1L7YA 2D3AA 3GP7A 4MJSA 2JUOA 1QOFA 3P4PB 1DOXA 3PPAA 1XO3A 1S1QB 4G0NB 3DVNU 2ZEQA 2J0MA 4WJNA 3ONSA 2V4IB 3TJPA 1C77A 3DDCB 3ZYYX 3PRZA 4NJ6A 1WM3A 1VZ8A 1E8XA 1J0GA 2JSVX 2BWFA 3DBLI 3ZDTA 3W1SA 1E7VA 2LWPA 2CR5A 2K3UA 2XEWA 3QC8B 1N5XA 2DNFA 3Q3JA 3QAQA 1WMHA 1D5ZC 5JXVA 2ACZB 2ZNVB 4PK1A 1I35A 4IM2A 3SU8X 3W9CB 5AUKA 3BWUD 3VRBB 2VZKD 2WXGA 2MW5A 2KMMA 2LJIA 4ACFA 3RZFA 1C4PA 1GC7A 4P16A 1XCTL 5G2NA 1H8CA 1C79A 1C1YB 3NZSA 2AWTA 5HI1A 3B2FA 4NJ7A 1P9DU 5D94A 4LJPB 2GBJA 4AWJA 2BTEA 4GU2A 1FD6A 4K81A 1SJHD 1MHHE 1NVID 3H6NA 3N20C 2QSDA 1JRUA 1JWUD 2DX5B 3RNBC 3NVYA 5BMGA 2W3RA 4HEA1 3DHHC 1C76A 2O2VB 1FRRA 2DAFA 3CMMB 3U7ZA 1AYFA 3AI5A 5AZFA 1I4QA 4MDKE 3ZRFA 1FNWA 3NVVA 4JGHB 3RN9C 2C5LC 4NZLB 3AEFB 3FKYA 1YJJA 5I4DA 3HVZA 2BS3B 3EECA 2GBMA 3RPFC 4RF0A 1VZ6A 4WWOA 4P1BC 1VJKA 4LJOB 3AE5B 2PJHA 2BKFA 4LCDE 3UIPB 2J0JA 3IFWB 3MC0B 4OZCA 2CU1A 1RRBA 2KO3A 2KVZA 1TBEA 3H8HA 2N0SB 1XXGA 2IZVB 2LD9A 1YMHE 3TL5A 2ZCCA 4C7ZA 2W9NA 2RR9A 4IW0A 2BPSA 1A70A 1GG3A 3A33B 3AE9B 3VR9B 2LI5A 2QC8A 3DBRB 3JSVB 5LXHA 2QCZA 2JPHA 3LDZE 5J18A 3DOWA 4B6WA 2WU5B 2C7NB 2KXJA 4G50A 2EELA 1E7UA 4N58A 2K25A 5C2TB 2KJHB 3AH7A 1HA5A 4GLSC 2IGGA 2Z0DB 4YSYB 2QHOA 1YJ1A 2MBBB 1WWTA 3CIRB 2LMCA 3TEXA 1GC6A 1P3QU 3W5VB 1WJUA 3IXSA 4MGIE 2Y3AA 2PVGC 1FIQA 1WF9A 4BBNF 5E6JA 3HK0A 3Q3NC 1ZXIA 4WIPA 2BS2B 2PE9A 3IBEA 1KLUD 1E9MA 4A3OA 1LGRA 2WDTB 2SAKA 2RSUA 1C3TA 2UYZB 4RGTA 3QWZB 2BB6A 1MVKA 1F1HA 1XLNA 4IWPA 3HM6X 4FA6A 4LNNA 1V86A 4TQ1A 1L4ZB 3PT2B 1UELA 1ET9A 1UUPA 2EKEC 1ZDXA 1F2RC 2L32A 4A55A 1P7EA 1CK1A 5JZEB 1ENFA 4WJOA 4GN1A 4LNFA 3U52E 3ZKJC 3PS6A 1F52A 4URKA 2KDEB 3DVNV 4IWOA 4IM0A 1OGWA 3AEEB 2MH7A 3QCAA 1NDDA 3WCQA 5FR3A 5IKCM 4TSSA 1VD2A 2PPHA 4DHZE 3EHVA 4O1NA 4WWPA 1DOIA 3IAS1 1RWSA 1OQRA 1OEYA 4YT0B 1PFDA 3NY5A 4GIVA 3ABVB 1UGJA 4ZYNA 1N60A 1KOTA 2DZIA 3TEWA 5EE3A 1WGRA 1NYQA 3VVWB 2KWUB 2KAJA 1XLOA 2E6XA 1MG4A 2ZZPB 2OJWA 1TZ1A 2INNE 3W5UB 4JIOU 4ARCA 5FKAC 2KT7A 1IP9A 3Q3OC 2DZMA 2PEAA 4S17A 3DHGC 4WJQA 4W9KA 5H8YE 1J8CA 5AEKB 2C7HA 4LNIA 1I4XA 1SBBB 2FUHB 2WXFA 1XLQA 4DXGA 2BB5A 1SE3A 3BYYB 3MFGA 5KHOA 1D3ZA 5LLIA 1E0ZA 1E8WA 2KQ7A 4XDDA 4Q2JA 1N61A 3VTUA 3RMKC 1T0QC 1WGYA 1WIAA 2KFKA 3H7SA 4KZ0A 3ZTCA 1ZUD2 1PGXA 4EFOA 3BK2A 2JWUA 2QDFA 1DGJA 2KACA 3BIID 2LFIA 3SD5A 2CU3A 3KW5B 3L10B 2FCSA 3ECIA 4CYEA 1TKEA 1HZ5A 2KZRA 4WWMA 4II2B 2XK5B 3WALA 4KX6B 2HD5B 1RFKA 1IBXA 4J3OD 2K8CA 1FXIA 1HE8A 3LYYA 1YX5B 2FUG1 2KJ6A 2VH1A 4C80A 4KIKA 2LXCA 2OHFA 3V05A 2JQRB 4C4VA 3ZGZA 1WJ4A 2D07B 3VH3B 2ONQA 4HROA 2PVOD 3RCZA 4FHJA 2N9EB 2LZ6A 1TTNA 4NPNA 2IO2B 3QQ8B 3IHPC 1TS3A 2EKIA 3R3MA 2N9LA 3TCAA 1X1MA 2ZNVC 3PTFC 1L5PA 1SGHA 1K8RB 5J17A 2MA9B 2KDIA 2D11A 1FXTB 3RI7C 2UWQA 2BS4B 4UDUC 1V1PA 3N3KB 3GB1A 4BBNC 2K22A 2ZPYA 1WYWB 2G3QB 4W9HA 4RGMA 4AS1A 1J7BA 3VRAB 3A9KA 4BKGA 1YNTE 2XBBC 2L7RA 5L83A 3D32A 3OJ3A 1PUTA 3MP9A 3VTVA 2IDYA 3BZDB 2BW2A 4E71A 1MJDA 4FADA 4W9DA 1IUEA 3NVZA 1Q5WB 2WXOA 2NTTA 4DWFA 3PREA 2RMMA 3A1QA 2RDBC 5HKHA 1WZ0A 3SEBA 4BFRA 4PS8A 4PT5A 1N5WA 2LVQA 3FILA 4C56C 1GJZA 3BYTB 3H7PB 1PDXA 2N4FA 4M01A 1V8CA 3ZIMA 2DZKA 2NBWB 4WH4A 1ACCA 2LGSA 2C60A 5BO4B 1YJIA 1WR6E 2L52A 4CHKA 2HTME 1PGAA 2KHWB 4DK5A 5CHVC 5IOIA 2KLGA 4NY0A 3BVMA 1TS5A 2DAJA 5LXIB 2INPE 4IUMB 4XZ4A 1LM8B 1L2NA 4KDIC 1WGKA 2QILA 4YSZB 2NPTA 2ICIA 2MLBA 2MBEA 3NVWA 1IGDA 3DBRI 4M0WA 1FXAA 1OTRB 1DYQA 3ZLZA 3NJTA 3EFCA 2PIAA 3Q14C 5FK9C 1SB3C 3NG0A 5GMVA 3QX1A 1YQ3B 3V60A 1KLVA 2IGHA 2K1FA 2Z8LA 3PHWB 1GNUA 3ZJUA 2JU6X 4ZRIA 3ENEA 1T6BX 4AQ7A 2CHWA 3B1LX 3ZO5B 1C4CA 2FIFA 2MBQA 3HHMA 1ZOYB 3JW0X 2JZPA 4OHJA 1C78A 2WXMA 5DPRA 1TYGB 2Y5BB 2HE7A 2L83A 1F0ZA 1RM6C 3EGRA 3NS8A 3PVLA 1J19A 4P6VF 2C7MB 2WQYB 2L1AA 1T5XD 3ZRCA 2IO1B 1I4HA 2K8BA 3PO0A 4CQNA 2KYWA 3I57A 3HVDA 1G6JA 2Z0EB 1JROA 3IAM1 1BXTA 2IO0B 3C8YA 1D6EC 1BUIC 1T3QA 3AE1B 2V3NA 5BMHA 4E3CA 3JSVA 2FE8A 4AJWA 1GB1A 3P42A 4ZRKA 2A4ZA 1Y8RC 5JHAA 1ET6A 1WSPA 3AN1A 2KTFA 2IYDB 1LQBA 3UGBB 1EU3A 1EM7A 3AEAB 2JT4B 1ZPSA 4LDTD 3VR8B 5C3JB 3N1XC 4JE3B 5TSSA 4FXCA 1WE7A 5T8IA 1S3SG 1FM0D 3MC8A 5D6JB 2EMSA 2ZPNA 2RPVA 4A6QA 2LRWA 4EE2A 3LJ3A 4XE0A 1JWBD 4EZKA 2L76A 2KWDA 4WURA 3TUOA 1EF5A 3WAMA 4KVGB 2LGIA 3ML8A 3KH0A 2KK8A 4BVUC 4BOZB 1GOZA 4FJYA 3APDA 1QQRA 4EOYA 3TMPB 1VLBA 2Y5PA 1TT5B 2I38A 2KTRB 1FRDA 2RDGA 2BYVE 3E56A 5EDSA 4HLEA 4KSLC 2BKRB 4PS7A 2MRPA 2O6VB 3EC8A 1V2YA 1V9JA 1QOGA 2LUMA 3LXFA 3APFA 2GI9A 3BVGA 3AE2B 2LASA 1P1AA 3DBSA 3V6CB 2KDMA 1ZP0B 1QOAA 2WWZA 3U4EG 1LFDA 1L6UA 2D10A 1WRDB 3W1YA 1ROEA 5HFYA 1ZGUB 2V1YA 2NVUI 3AB5A 3WIMA 3PZDA 3QA8A 4EKUA 3OJ4B 5FR6A 3O65B 3HUIA 3B08A 1SIJA 4HJGE 3H9DA 4FLHA 2W3SA 3ZDMC 4MH0E 2KDBA 4MJSB 2DHZA 1HTQA 2AQ3B 2MBOA 2ZVOA 5E6PA 2IO3B 4OW0A 3N32A 1TY2A 3ZJTA 1TZOA 5D7GA 3Q8CA 2J4XA 2MX2A 3A9JA 3ZXRA 2V3SA 2V4LA 2GBNA 1WXVA 4FJZA 3PLUA 5MPOA 4ASWC 2IBIB 3KQ4A 4XYCA 4MH8A 3MHZA 2OOBB 3ZQ4A 1ZE3D 3S2AA 3VUYA 4D2KA 1SF0A 3U30A 1ZXHA 2PKOA 1KH0A 4PYUA 1YOVB 2AQ2B 3N1YC 2D5GA 2AL6A 4NJCA 3GZNB 2K5PA 5CHWA 3WANA 3AULA 4DDGD 1GUAB 1SJED 3PRMB 1F2RI 3RULA 4ITKA 1EU4A 3DWGC 3I63C 1R7SA 3GS2A 3M63B 1K51A 2G1EA 4ANXA 1FCLA 1HQRD 2K9XA 1SEBD 2HDEA 4IOIE 4PYZA 2ON8A 4ZHPA 1N6ZA 3L13A 1WJ6A 1L6VA 3CSFA 5BMIA 3W2DA 4DHJB 3VHTC 1RAXA 3A4RA 4ARIA 5CHFA 1WI0A 4JWUC 4I6PA 1WXMA 2KLCA 4MGYE 4K7UA 2V3PA 2G4SA 2JWZA 2RGFA 2V0GA 2GLSA 1GB4A 1KLGD 4YWGG 1K53A 3IG3A 4RGOS 2MJ3A 3M62B 2L0TA 4IWQA 1SE2A 3FAHA 1EUVB 4J6IA 3E9SA 2BT6A 3MTNB 3AEBB 2MP2A 2X38A 4TMAB 4DBGA 2WXKA 4HCNB 4GDKA 4KGRA 3HRDD 2M17A 4HKQA 1WE6A 2KANA 5IP4D 1E8ZA 2BBCA 3UI3A 1P0RA 4WJPA 2W54A 3Q8FA 2IY1B 1PGBA 1XCQL 1K52A 1EF1A 5KHQA 1R4NB 1Q10A 4REZA 2AL3A 4B0EA 3NUHB 1HTOA 3L17A 5IA7A 3KWVA 3L54A 2LGXA 2N7DA 1V80A 4BKSD 1JWAD 1UF0A 3OLMD 1LO5D 4B9KA 1Y56A 3ZNHB 2K6DB 4M8NA 1XF5L 1YN4A 3RD2A 3QJZA 1A5RA 4A8XC 4AUQC 1XT9B 3GE8C 1WR1A 4HPMB 2WDRB 1V5TA 3QARA 1M4VA 2I1JA 1I7HA 2CHZA 4IDIA 4DHJD 1DOYA 4MACA 2L05A 3B2GA 2WXIA 2XN9C 4ZHOA 1IGCA 5IO9A 4IG7B 2NMQA 3BY4B 4B95A 3SFDB 1RFAA 4EZLA 2M0AA 3CSTA 3ZTDA 1CMXB 4ZYSA 4YTPB 2CJNA 1UD7A 1QILA 3R2TA 1GPXA 2D3BA 4MM3A 1Z2MA 4LK0M 4RFBA 2K39A 4LNOA 3PRPB 3X23A 3MHSD 1RYJA 3ZVVA 4G11A 1KJTA 2DLBA 2FAZA 3L16A 2KKCA 3VQIA 3H1UA 3P4QB 4ANWA 4F8CB 4CO7A 1TS2A 1QT9A 4ZDVA 3TIXA 4H2AA 4RCOA 4I6NB 1UH6A 4W9GA 4BOSC 1MI0A 1VRAB 2JXTA 3JYUA 4KZCA 3VFKA 2L3ZA 2W82A 1KFYB 4NQLB 2WDQB 1JQ4A 4KSKC 4FBJB 4USAA 3TBLD 4RH6A 2M56B 4OZBA 5IAAC 1V5OA 2J52A 5CX3A 2EMTA 1YQBA 4DXFA 2KWCA 4B0MA 1B1ZA 4QAYA 2PE6B 3AE6B 2BF8B 2IGDA 4GDLB 3RNCC 2LHEA 3EA6A 4GOCA 3X0WA 4X57B 2OEDA 2WXLA 2DYMA 4XGAB 4K7WA 3RZWC 1ZDVA 2ZCBA 4TQ0A 3AE3B 1VR9A 1WGHA 2WYQA 3RNEC 5JH5C 3N9YC 1H4RA 2X8XX 4M02A 2KVRA 2KQ4X 1WZ3A 5D3DA 5E6NA 5E6OA 2MJDA 2KMAA 4XDCA 4A9AA 2Y5CA 1KF6B 4W9JA 1Q0WB 4WQMA 1QOBA 1OFFA 4L1BA 2B3AA 3DVGY 3OG5A 4KKJA 2BWES 3HIZA 1HZ6A 4FHKA 5G5GA 2D2QA 3ETRA 4XX5A 3DQVA 1V1OA 4W9EA 1NI2A 4TKNA 1WM2A 4HPLB 1WY8A 2N9KA 4MSMB 3TEYA 1K50A 2O2VA 2GBKA 1FPYA 1IBXB 3DPDA 3WA0A 3UF8A 2N9XA 4LNKA 4K7SA 2VZKB 2MHJA 2MQJA 4A20A 3L4PA 1MFWA 2KN5A 4HCPB 3B0AA 1QZEA 1UZXB 5HG2A 3AEDB 1Q1OA 4XWWA 3Q2AC 3UQBA 5JHBA 2YLMA 4W9LA 2H89B 2AX5A 4YTMB 4JQWC 1KTKA 2DBYA 3DBHB 3GZNI 1ESFA 4A3PA 2LRUA 3QK0A 3DHIC 4RNAA 3IT4B 1F77A 3NZUA 1E10A 3TSSA 3MC9A 3UINB 1V1PB 4HVBA 4P7IA 4XC2A 3KUDB 1GAQB 2LJ5A 4RGNA 2VH2A 1D5MC 1JW9D 1FEHA 3ZNID 2G4DB 3A9KB 3Q3FA 2LHDA 3PZ7A 5G5HA 1RLFA 4C00A 4AP4C 4W9FA 3RT3B 3RYTA 1E5WA 1TIFA 1BMLC 4K3CA 3ML9A 3P1MA 2ASQA 4DXAB 1TJEA 5L95C 2C9WB 4MELA 4ZOHC 4W9IA 3AE7B 3UIOB 3CWIA 1V97A 2MJEA 2DWQA 2M4NA 3A1QB 4OVUA 2JZ3B 3MJWA 2JY6A 2B76B 1TKGA 4HDOA 3AMZA 2SEBD 3FILB 1UNSA 2TSSA 4NAMA 3Q3MC 3BVZA 4OVVA 4KV2A 1EO6A 4ANUA 4BKSA 3DVGX 2WXNA 2WLBA 2WX1A 4N6EB 2WXPA 4WAAA 2CS4A 2D3CA 2WHIA 5TR5A 3VH4B 3R7QA 2M0XA 5G55A 1R4NI 3RUIB 4NAWB 2N7JA 4JL9A 2NPTB 1OEYJ 3LB8C 1QLBB 1WH3A 3NRZA 4M0WB 3T9LA 5EE1A 1XQQA 2JF5A 2Z59B 1L0YB 1EWCA 1WXAA 2JXXA 2NR2A 5D2MB 4MT5A 2GBRA 1T0YA 2RD0A 3VDZA 4DHZB 4JWSC 1E8YA 1M94A 4L2YA 1B9RA 3K9PB 1ZW7A 3TEZA 1WX9A 4W9CA 4LLGM 2KNBA 1YN3A 3P4SB 5GXGB 1R4MB 2DYOA 1SE9A 2GRIA 2N9PC 2QIEB 5C1ZA 2CJOA 5DPTA 3APCA 1L0XB 2WXJA 2LGYA 2J0KA 4NNJB 4AJYB 1FFUA 3BK1A 3J9CA 2OJRA 2QJLA 3C0RB 1V49A 2KX3A 1N63A 3AU4A 3I9V1 2VRRB 3Q69A 3QIJA 5EE0A 3NS1A 3RNAC 4ZRPA 2HJ1A 2BYTA 4KKIA 3WAOA 3OAWA 5BYQA 1MG8A 4IKGA 3HM3A 1AWDA 1FMAD 4HKZE 3RNFC 1TKYA 4TV3A 4HJKA 1D4BA 2XNAC 1JWSD 1T0SC 4N59A 1YIWA 4HWIB 3VUXA 2KC1A 1UBIA 1CZPA 4G3XB 2WXHA 1FNUA 5AZGA 3DCGA 3R66C 4AOFA 1MHXA 2WDVB 4HK2A 4L23A 1WMHB 3MJ5A 1NENB 2NBUA 5AUIA 3V3XA 3M95A 3VAWA 4N9F4 4YTNB 2XK5A 2O6VD 1TS4A 3ZW3A 4PS3A 3OWEB 2MWSB 3PZ8A 1XEEA 3IT6B 1STEA 3JVZX 2J42A 1AN8A 3PLVA 2INCC 2MEKA 4US9A 2YEPB 2LEKA 3A4SC 2JZZA 2HJ8A 3KUCB 4ICUA 2R2OA
chains in the Genus database with same CATH topology
4C7YA 2PIAA 5FK9C 2BTEA 1SB3C 4ZYSA 1YQ3B 1UWXA 1FD6A 1SJHD 4YTPB 1E7PB 1MHHE 1NVID 2CJNA 2ZW1A 1QILA 2IGHA 3R2TA 2Z8LA 4US8A 1GPXA 4R3DA 3ZJUA 2QSDA 2JU6X 4LK0M 4RFBA 1JWUD 3DWMA 1T6BX 4JX1C 4AQ7A 3NVYA 5BMGA 2W3RA 1RYJA 1I4PA 4HEA1 1C76A 3R8BA 1FRRA 3U7ZA 1AYFA 1C4CA 2GB1A 1I4QA 2DLBA 1FNWA 3NVVA 3VQIA 1ZOYB 2JZPA 3P4QB 4OHJA 1C78A 2WXMA 1TYGB 4NZLB 3AEFB 1YJJA 2L83A 3HVZA 1TS2A 5I4DA 1F0ZA 1RM6C 2BS3B 4YSXB 1QT9A 5BYSA 2WXQA 3EGRA 4H2AA 4RCOA 4DQOC 3RPFC 4RF0A 1MI0A 1VRAB 1VZ6A 4P6VF 3SFEB 2JXTA 1SSNA 1VJKA 2WQYB 3AE5B 2L1AA 1T5XD 3RFZB 1I4HA 3PO0A 4CQNA 2W82A 1N62A 3I57A 1KFYB 3MC0B 3HVDA 2J53A 4OZCA 2WDQB 1JQ4A 1JROA 3H8HA 3IAM1 3EUB2 1BXTA 4USAA 2N0SB 1HXYD 3C8YA 2E3TA 4RH6A 2M56B 4OZBA 1XXGA 1D6EC 2R61A 1BUIC 1T3QA 1YMHE 2J52A 3AE1B 2V3NA 5BMHA 4C7ZA 2WP9B 1A70A 2FE8A 1GB1A 4DXFA 3P42A 3AE9B 3VR9B 4B0MA 3Q8EA 1B1ZA 1ET6A 1WSPA 2WXRA 3AN1A 4HRSA 3AM9A 3AE6B 2IGDA 2WU5B 1EU3A 2EELA 4GDLB 1EM7A 3AEAB 1WRIA 2LHEA 4N58A 3EA6A 5C2TB 3AECB 1ZPSA 2OEDA 3AH7A 1HA5A 4GLSC 3VR8B 2IGGA 2WXLA 1SXTA 2DYMA 4YSYB 5C3JB 4KGTA 1ZDVA 1WWTA 3AE3B 2LMCA 3CIRB 3TEXA 1NI3A 4JE3B 4TQ0A 1VR9A 3W5VB 5TSSA 4FXCA 2W55A 3IXSA 3N9YC 2PLPA 2Y3AA 5T8IA 2PVGC 1FIQA 1KRHA 1FM0D 2I2YA 2KQ4X 1NEKB 5D3DA 5E6JA 2RPVA 4A6QA 4EE2A 1ZXIA 4WIPA 2MJDA 4XDCA 2BS2B 4XE0A 1JWBD 1AW7A 1KLUD 3P63A 4A9AA 1FNVA 2KWDA 2Y5CA 4WURA 1E9MA 3TUOA 1KF6B 1WXQA 2SAKA 2JX5A 2LGIA 2YEPF 4WQMA 1QOBA 1OFFA 4RGTA 4L1BA 1FCCC 4KKJA 1JRPA 1GOZA 1HZ6A 5G5GA 1OQQA 2BB6A 1MVKA 1WYGA 1QKZA 3ETRA 1XLNA 1QQRA 1SE4A 1V1OA 1VLBA 2M19A 2Y5PA 1I4GA 3KWLA 4TQ1A 1L4ZB 4A90A 2N9KA 3T3OA 2I38A 1ET9A 1UUPA 5EE9A 3TEYA 1K50A 1ZDXA 1FRDA 1F2RC 1JALA 2IJ0A 4XWTA 2L32A 4ZRQA 1P7EA 1CK1A 2RDGA 3E56A 1ENFA 4A55A 1IBXB 2G9HD 2K0PA 5HHDG 3U52E 3AEGB 3AE8B 5D3IB 2VZKB 1QF6A 3AEEB 2MH7A 2WNMA 3L4PA 3WCQA 1CQVA 5HG2A 1QOGA 4TSSA 1YN5A 4JPSA 3AEDB 5FR3A 4XWWA 2QEJC 2LUMA 3LXFA 3U2SC 2GI9A 2PW9A 2H89B 3BVGA 4O1NA 3AE2B 2AX5A 4YTMB 1DOIA 3IAS1 1KTKA 2DBYA 1RWSA 1OQRA 4YT0B 1PFDA 2KDMA 3ABVB 1UGJA 1ESFA 1ZP0B 1QOAA 1N60A 3U4EG 1L6UA 3TEWA 1JWMD 4RNAA 5EE3A 3IT4B 1F77A 3NZ3A 1ROEA 3KLSX 1C4AA 1E10A 1NYQA 3TSSA 5HFYA 2IPKD 1V1PB 1XLPA 2KAJA 1XLOA 2E6XA 3AB5A 3Q8AA 1GAQB 2INNE 3W5UB 1D5XC 4RGNA 5H92C 4ARCA 1D5MC 1JW9D 1FEHA 5FKAC 2FBWB 3Q8BA 2LHDA 4GDKB 3PZ7A 5G5HA 2JYTA 3AV8A 1JMLA 5H8YE 2H88B 3HUIA 3URYA 4HJGE 1SIJA 1I4XA 1SBBB 1J7AA 2W3SA 1TY0A 1BMLC 2Q5WD 2WXFA 1P7FA 1XLQA 4OZAA 3P1MA 4DXGA 2AQ3B 4RF1A 2BB5A 1SE3A 1TJEA 3BYYB 3MFGA 4OW0A 1TY2A 1E0ZA 1CJEA 4ZOHC 5BYRA 1HEZE 4XDDA 3AE7B 3ZJTA 1TZOA 4Q2JA 1N61A 5D7GA 3CWIA 1V97A 2MJEA 2DWQA 3Q8CA 2J4XA 1VZ7A 2B76B 1TKGA 1VDVA 1L0VB 3AMZA 2SEBD 3FILB 1FO4A 4YXDB 1PYWD 1UNSA 1ZUD2 3R2IA 5MPOA 1PGXA 2TSSA 4NAMA 3BK2A 3KQ4A 2JWUA 4WAFA 1NYRA 3BVZA 4MH8A 1DGJA 3MHZA 2KACA 2WU2B 3BIID 3ZQ4A 1ZE3D 4D2KA 1SF0A 1ZXHA 2LFIA 2PKOA 1C9FA 1KH0A 2CU3A 2WXNA 2AQ2B 2WLBA 3P4RB 2D5GA 4NJCA 1TKEA 2K5PA 1HZ5A 4N6EB 2WXPA 4WWMA 4LTUA 1SJED 4KX6B 1RFKA 1F2RI 1IBXA 4J3OD 3ZJVA 1FXIA 1EU4A 4ITKA 3LYYA 3DWGC 2FUG1 4NAWB 1R7SA 3GS2A 2N7JA 1K51A 4C80A 2G1EA 1FCLA 3AE4B 2OHFA 3LB8C 1QLBB 1HQRD 2JQRB 3NRZA 3V05A 2K9XA 3ZGZA 1SEBD 1JCKB 2HDEA 4IOIE 2ONQA 4HROA 2ON8A 4ZHPA 2PVOD 5EE1A 2WS3B 1YQ4B 2ZW0A 3FC4A 3T3NA 1L0YB 1EWCA 1L6VA 5BMIA 3W2DA 3O13A 4MT5A 1TS3A 1FFVA 3SR6A 2NTSA 2EKIA 4ARIA 1UWMA 2PTLA 4JWUC 2N9LA 2RDHA 4MM3B 4JWSC 1L5PA 2V3PA 4L2YA 1B9RA 1J7CA 1L4DB 2V0GA 4OVZA 1GB4A 1EWYC 1KLGD 4YWGG 3TEZA 2JYEA 1K53A 3B9JA 2BS4B 2KN4A 4RGOS 2MJ3A 4UDUC 4LLGM 1MPEA 1V1PA 1SE2A 1YN3A 3FAHA 4KGSA 2AQ1B 3P4SB 3GB1A 5GXGB 1I4RA 2K22A 2BT6A 2DYOA 3E9SA 2GRIA 2QIEB 3AEBB 2X38A 4TMAB 4RGMA 2CJOA 4AS1A 1J7BA 1L0XB 2WXJA 2WXKA 3VRAB 1E6EB 1FFUA 4KGRA 3BK1A 3HRDD 4HKQA 1YNTE 2QMTA 2PMVA 3J9CA 2QJLA 5LNK1 2BBCA 1PUTA 3UI3A 3MP9A 1N63A 3GP7A 2IDYA 3BZDB 1QOFA 2BW2A 3I9V1 3P4PB 1DOXA 3Q69A 5EE0A 1XO3A 2W54A 3NS1A 4ZRPA 3Q8FA 1IUEA 2BYTA 3NVZA 1PGBA 1XCQL 2WXOA 1K52A 4KKIA 2NTTA 2V4IB 1Q10A 5BYQA 1C77A 2RMMA 3ZYYX 4IKGA 4REZA 1AWDA 1FMAD 1VZ8A 4HKZE 3NUHB 4B0EA 1TKYA 2JSVX 3KWVA 1D4BA 2XNAC 1JWSD 3SEBA 3W1SA 4PT5A 1N5WA 4N59A 1JWAD 3FILA 1LO5D 2K3UA 4C56C 1N5XA 1Y56A 3BYTB 1CZPA 1PDXA 1V8CA 2WXHA 1D5ZC 1FNUA 5JXVA 2ACZB 1XF5L 1YN4A 4WH4A 1ACCA 4A8XC 3W9CB 5AUKA 1MHXA 2WDVB 1YJIA 4L23A 3BWUD 2L52A 2HTME 3VRBB 3MJ5A 1NENB 1PGAA 5AUIA 3V3XA 2VZKD 2WXGA 3BVMA 2KMMA 1TS5A 4YTNB 2WDRB 2LJIA 1TS4A 1M4VA 3OWEB 3PZ8A 2INPE 1XEEA 1I7HA 3IT6B 1C4PA 1STEA 4IDIA 1DOYA 4P16A 1XCTL 2J42A 4MACA 1WGKA 3B2GA 2WXIA 2QILA 1AN8A 4YSZB 2XN9C 2MEKA 2ICIA 4US9A 1C79A 1IGCA 4ZHOA 2NMQA 2YEPB 5HI1A 2LEKA 3NVWA 1IGDA 4M0WA 3SFDB 3B2FA 1FXAA 1DYQA 2M0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRH A;  1FM0 D;  1J7C A;  1NEK B;  2PIA A;  5G5H A;  4C7Y A;  3AV8 A;  1EWY C;  1SB3 C;  3B9J A;  5H8Y E;  1YQ3 B;  2H88 B;  2BS4 B;  4YTP B;  1E7P B;  1ZXI A;  2MJD A;  3HUI A;  1NVI D;  2CJN A;  2BS2 B;  2MJ3 A;  1SIJ A;  1JWB D;  3P63 A;  4A9A A;  3FAH A;  4US8 A;  1J7A A;  2W3S A;  2Y5C A;  3P4S B;  1E9M A;  5GXG B;  2K22 A;  2BT6 A;  2Q5W D;  1KF6 B;  1GPX A;  1XLQ A;  3AEB B;  1WXQ A;  2QIE B;  3P1M A;  2JX5 A;  4WQM A;  3DWM A;  1QOB A;  1OFF A;  2CJO A;  1J7B A;  1TJE A;  4JX1 C;  3NVY A;  3VRA B;  2W3R A;  1E6E B;  1FFU A;  1RYJ A;  3HRD D;  1E0Z A;  1CJE A;  1FRR A;  1JRP A;  4ZOH C;  3VRB B;  2QJL A;  1AYF A;  5G5G A;  1OQQ A;  1WYG A;  3ETR A;  3NVV A;  3AE7 B;  1XLN A;  1PUT A;  1ZOY B;  1N61 A;  3P4Q B;  1N63 A;  3CWI A;  1V97 A;  2MJE A;  1TYG B;  2DWQ A;  1VLB A;  2M19 A;  1QOF A;  3AEF B;  3P4P B;  1DOX A;  1YJJ A;  2L83 A;  3HVZ A;  1F0Z A;  5EE0 A;  1RM6 C;  1XO3 A;  2BS3 B;  2W54 A;  1QT9 A;  3NS1 A;  4YSX B;  2B76 B;  1TKG A;  3KWL A;  1VDV A;  1L0V B;  1IUE A;  3AMZ A;  5EE9 A;  3NVZ A;  1FO4 A;  4YXD B;  3RPF C;  4P6V F;  1FRD A;  3SFE B;  1B9R A;  1JAL A;  1VJK A;  1ZUD 2;  2WQY B;  3AE5 B;  5MPO A;  3PO0 A;  1NYR A;  1DGJ A;  2WU2 B;  3BII D;  1N62 A;  3ZYY X;  1KFY B;  3AEG B;  1SF0 A;  2PKO A;  3AE8 B;  1AWD A;  1FMA D;  2WDQ B;  1TKY A;  2FBW B;  1JQ4 A;  1JRO A;  2CU3 A;  3EUB 2;  2WLB A;  3P4R B;  4USA A;  1QF6 A;  2N0S B;  1TKE A;  2K5P A;  2E3T A;  1N5W A;  2M56 B;  4N59 A;  4N6E B;  1JWA D;  3AEE B;  2MH7 A;  3L4P A;  4WWM A;  3WCQ A;  1N5X A;  4LTU A;  1CZP A;  1T3Q A;  1PDX A;  1QOG A;  4KX6 B;  3AED B;  1RFK A;  1V8C A;  3AE1 B;  4HRS A;  4C7Z A;  2ACZ B;  2WP9 B;  3LXF A;  1A70 A;  1FXI A;  4ITK A;  3DWG C;  1R7S A;  2H89 B;  3AE9 B;  3AE2 B;  2AX5 A;  5AUK A;  3VR9 B;  2WDV B;  1YJI A;  3W9C B;  2G1E A;  4C80 A;  4YTM B;  1DOI A;  2L52 A;  2HTM E;  3AN1 A;  3AE4 B;  1NEN B;  2OHF A;  3LB8 C;  1QLB B;  2DBY A;  2JQR B;  3AM9 A;  3NRZ A;  1RWS A;  1OQR A;  2K9X A;  3AE6 B;  4YT0 B;  5AUI A;  1PFD A;  4HRO A;  4ZHP A;  2WU5 B;  2KMM A;  2PVO D;  3ABV B;  5EE1 A;  4YTN B;  2WS3 B;  2WDR B;  1ZP0 B;  1QOA A;  1N60 A;  1YQ4 B;  3FC4 A;  3AEA B;  1WRI A;  4N58 A;  1L6V A;  1L6U A;  1I7H A;  5EE3 A;  3AEC B;  5C2T B;  4IDI A;  1ROE A;  3AH7 A;  1DOY A;  3VR8 B;  1FFV A;  1NYQ A;  1WGK A;  3B2G A;  3SR6 A;  5C3J B;  4YSY B;  1E10 A;  4YSZ B;  1XLP A;  1WWT A;  2KAJ A;  2EKI A;  1XLO A;  1UWM A;  1NI3 A;  3AE3 B;  3CIR B;  4JWU C;  4US9 A;  4ZHO A;  3AB5 A;  3W5V B;  1GAQ B;  4FXC A;  2W55 A;  2LEK A;  3NVW A;  4JWS C;  3W5U B;  5H92 C;  3SFD B;  3B2F A;  1FXA A;  1JW9 D;  1L5P A;  2PVG C;  1FIQ A; 
#chains in the Genus database with same CATH topology
 4C7Y A;  1UWX A;  1E7P B;  2ZW1 A;  5DPW A;  3BIN A;  4US8 A;  4F7Z A;  4R3D A;  2DZJ A;  2M8S A;  2MSE D;  4WWN A;  2FCM A;  2JRH A;  3DWM A;  4JX1 C;  3VXW A;  1WX7 A;  3UQA A;  1I4P A;  3R8B A;  3I3T B;  3I5J C;  1WX8 A;  2GB1 A;  4GMV A;  3PHX B;  2ZVN A;  2KD0 A;  4MGK E;  2NBV B;  1VCB A;  1V81 A;  4S0R A;  2HTH A;  5C23 A;  4RM9 A;  3DBL B;  4NQK E;  4YSX B;  5BYS A;  2WXQ A;  4DQO C;  1OQY A;  2LVO A;  2NS5 A;  4FUL A;  3EFU A;  2J7Q B;  2UU7 A;  3SFE B;  1SSN A;  3KYD D;  2DYB A;  3RFZ B;  4KDL B;  3Q6B A;  1N62 A;  1V6E A;  2J53 A;  3RNG C;  2CHX A;  3EUB 2;  1XD3 B;  3PGE A;  1HXY D;  2E3T A;  2IY0 B;  4WQO B;  2CKH B;  3AU5 A;  1Z5S B;  2KC2 A;  2R61 A;  5DPS A;  1I42 A;  3L0W B;  1YD8 U;  2WP9 B;  2YVC A;  2IND C;  2GOW A;  2KWV B;  3Q8E A;  2WXR A;  4HRS A;  4BZA A;  4GDL A;  2GMI C;  3AM9 A;  3ZNG C;  2L8J A;  1KM7 A;  4RMA A;  3H7P A;  2KMC A;  4FJV B;  1WRI A;  3AEC B;  4F1S A;  3VTW A;  1SXT A;  3V61 A;  4KGT A;  1NI3 A;  2G45 B;  2W55 A;  3NHE B;  2PLP A;  5DCN A;  3SDL C;  3DBH I;  1KRH A;  2I2Y A;  1NEK B;  1T0R C;  3ZXV A;  3PV1 A;  4DDI D;  1P98 A;  4MGZ E;  4EEW A;  4M00 A;  1AW7 A;  2NCN A;  3P63 A;  1FNV A;  1LXD A;  4TUU A;  1WXQ A;  3A9J B;  2JX5 A;  2YEP F;  3CF6 E;  4MEM A;  1FCC C;  1JRP A;  3V6E B;  1OQQ A;  1WXS A;  1WYG A;  2L00 B;  1QKZ A;  5IN7 A;  4P1C C;  1SE4 A;  2M19 A;  1ZKH A;  4I6L B;  2A5U A;  1I4G A;  3KWL A;  2RPQ A;  4A90 A;  3M3J A;  3T3O A;  4GGQ A;  5EE9 A;  1WFY A;  4IC7 B;  3GE3 C;  1BT0 A;  1JAL A;  2IJ0 A;  4XWT A;  4ZRQ A;  2G9H D;  2K0P A;  5HHD G;  1E90 A;  3ALB A;  3AEG B;  3AE8 B;  3N30 A;  5D3I B;  2WGS A;  2FID A;  4EZJ A;  1QF6 A;  2WNM A;  1CQV A;  1YN5 A;  4JPS A;  1TGZ B;  2QEJ C;  3U2S C;  2LUE A;  2PW9 A;  4JLC A;  1UGM A;  2LVP A;  2D3G A;  5J2R A;  3U8Z A;  1JWM D;  3NZ3 A;  3KLS X;  1C4A A;  2IPK D;  4HPP A;  3C19 A;  2L0F A;  1XLP A;  2KQS A;  2N1W A;  4ANV A;  3R7R A;  2MP2 B;  1YX6 B;  3Q8A A;  2N7E A;  1SIF A;  1D5X C;  5H92 C;  2I1K A;  3SHQ A;  2FBW B;  2KJR A;  3Q8B A;  4GDK B;  3P2B A;  2JYT A;  3AV8 A;  3N1Z C;  1JML A;  2H88 B;  3URY A;  3ZNZ B;  2BYF A;  1J7A A;  2JVC A;  1TY0 A;  2Q5W D;  1P7F A;  4OZA A;  4GSW A;  4RF1 A;  2K8H A;  2AEH A;  4E74 A;  1ISN A;  1CJE A;  2MCN B;  2MBH A;  5BYR A;  2LXA A;  1HEZ E;  2REX A;  3NOB A;  4YL8 A;  3VUW A;  2R2Q A;  1WGD A;  1VZ7 A;  1R4M I;  2FCN A;  4RM8 A;  4BAX A;  1VDV A;  4M8M A;  1L0V B;  1FO4 A;  3GOE A;  4YXD B;  3T8M A;  1PYW D;  2BQQ A;  2V9H A;  3R2I A;  2KFK B;  2KX0 A;  2WX0 A;  4WAF A;  1NYR A;  2N1V A;  2WU2 B;  2ZJD A;  3AXC A;  1C9F A;  3P4R B;  3KVF B;  4NAW A;  2KTR A;  4HXD A;  4LTU A;  4ICV A;  4LDT B;  1F9J A;  2BYE A;  3L08 A;  3ZJV A;  3IVF A;  2KOX A;  2JRI B;  3PSE B;  4IM3 A;  4GXB A;  3AE4 B;  1JCK B;  2O6V A;  3K9O B;  3KUZ A;  2FCQ A;  4KIK B;  2WS3 B;  2AYO B;  1YQ4 B;  2ZW0 A;  3FC4 A;  4C4V B;  4GB9 A;  3T3N A;  3O13 A;  3V62 A;  1PQS A;  4MSQ B;  5CTR C;  1WGG A;  1FFV A;  3SR6 A;  4HDQ A;  2M1M A;  2K6Q A;  4BKT A;  2NTS A;  3W1S C;  4ZRJ A;  1UWM A;  2PTL A;  2RDH A;  4MM3 B;  3U7D A;  4K1R B;  1IPG A;  3QHT A;  1IYF A;  1J7C A;  1L4D B;  4OVZ A;  1EWY C;  2FNJ B;  2JYE A;  3B9J A;  4EUT A;  2KN4 A;  1MPE A;  1WJN A;  4KGS A;  4FN2 A;  2AQ1 B;  1I4R A;  3KYC D;  2BVC A;  1UBQ A;  1NBF C;  2DEN B;  3ZUN A;  1U4A A;  2KFJ A;  2BGF A;  1E6E B;  3WAP A;  5AZH A;  4K3B A;  2QMT A;  2PMV A;  2KDF B;  4II3 B;  5LNK 1;  2LGD A;  1AAR A;  1L7Y A;  2D3A A;  3GP7 A;  4MJS A;  2JUO A;  1QOF A;  3P4P B;  1DOX A;  3PPA A;  1XO3 A;  1S1Q B;  4G0N B;  3DVN U;  2ZEQ A;  2J0M A;  4WJN A;  3ONS A;  2V4I B;  3TJP A;  1C77 A;  3DDC B;  3ZYY X;  3PRZ A;  4NJ6 A;  1WM3 A;  1VZ8 A;  1E8X A;  1J0G A;  2JSV X;  2BWF A;  3DBL I;  3ZDT A;  3W1S A;  1E7V A;  2LWP A;  2CR5 A;  2K3U A;  2XEW A;  3QC8 B;  1N5X A;  2DNF A;  3Q3J A;  3QAQ A;  1WMH A;  1D5Z C;  5JXV A;  2ACZ B;  2ZNV B;  4PK1 A;  1I35 A;  4IM2 A;  3SU8 X;  3W9C B;  5AUK A;  3BWU D;  3VRB B;  2VZK D;  2WXG A;  2MW5 A;  2KMM A;  2LJI A;  4ACF A;  3RZF A;  1C4P A;  1GC7 A;  4P16 A;  1XCT L;  5G2N A;  1H8C A;  1C79 A;  1C1Y B;  3NZS A;  2AWT A;  5HI1 A;  3B2F A;  4NJ7 A;  1P9D U;  5D94 A;  4LJP B;  2GBJ A;  4AWJ A;  2BTE A;  4GU2 A;  1FD6 A;  4K81 A;  1SJH D;  1MHH E;  1NVI D;  3H6N A;  3N20 C;  2QSD A;  1JRU A;  1JWU D;  2DX5 B;  3RNB C;  3NVY A;  5BMG A;  2W3R A;  4HEA 1;  3DHH C;  1C76 A;  2O2V B;  1FRR A;  2DAF A;  3CMM B;  3U7Z A;  1AYF A;  3AI5 A;  5AZF A;  1I4Q A;  4MDK E;  3ZRF A;  1FNW A;  3NVV A;  4JGH B;  3RN9 C;  2C5L C;  4NZL B;  3AEF B;  3FKY A;  1YJJ A;  5I4D A;  3HVZ A;  2BS3 B;  3EEC A;  2GBM A;  3RPF C;  4RF0 A;  1VZ6 A;  4WWO A;  4P1B C;  1VJK A;  4LJO B;  3AE5 B;  2PJH A;  2BKF A;  4LCD E;  3UIP B;  2J0J A;  3IFW B;  3MC0 B;  4OZC A;  2CU1 A;  1RRB A;  2KO3 A;  2KVZ A;  1TBE A;  3H8H A;  2N0S B;  1XXG A;  2IZV B;  2LD9 A;  1YMH E;  3TL5 A;  2ZCC A;  4C7Z A;  2W9N A;  2RR9 A;  4IW0 A;  2BPS A;  1A70 A;  1GG3 A;  3A33 B;  3AE9 B;  3VR9 B;  2LI5 A;  2QC8 A;  3DBR B;  3JSV B;  5LXH A;  2QCZ A;  2JPH A;  3LDZ E;  5J18 A;  3DOW A;  4B6W A;  2WU5 B;  2C7N B;  2KXJ A;  4G50 A;  2EEL A;  1E7U A;  4N58 A;  2K25 A;  5C2T B;  2KJH B;  3AH7 A;  1HA5 A;  4GLS C;  2IGG A;  2Z0D B;  4YSY B;  2QHO A;  1YJ1 A;  2MBB B;  1WWT A;  3CIR B;  2LMC A;  3TEX A;  1GC6 A;  1P3Q U;  3W5V B;  1WJU A;  3IXS A;  4MGI E;  2Y3A A;  2PVG C;  1FIQ A;  1WF9 A;  4BBN F;  5E6J A;  3HK0 A;  3Q3N C;  1ZXI A;  4WIP A;  2BS2 B;  2PE9 A;  3IBE A;  1KLU D;  1E9M A;  4A3O A;  1LGR A;  2WDT B;  2SAK A;  2RSU A;  1C3T A;  2UYZ B;  4RGT A;  3QWZ B;  2BB6 A;  1MVK A;  1F1H A;  1XLN A;  4IWP A;  3HM6 X;  4FA6 A;  4LNN A;  1V86 A;  4TQ1 A;  1L4Z B;  3PT2 B;  1UEL A;  1ET9 A;  1UUP A;  2EKE C;  1ZDX A;  1F2R C;  2L32 A;  4A55 A;  1P7E A;  1CK1 A;  5JZE B;  1ENF A;  4WJO A;  4GN1 A;  4LNF A;  3U52 E;  3ZKJ C;  3PS6 A;  1F52 A;  4URK A;  2KDE B;  3DVN V;  4IWO A;  4IM0 A;  1OGW A;  3AEE B;  2MH7 A;  3QCA A;  1NDD A;  3WCQ A;  5FR3 A;  5IKC M;  4TSS A;  1VD2 A;  2PPH A;  4DHZ E;  3EHV A;  4O1N A;  4WWP A;  1DOI A;  3IAS 1;  1RWS A;  1OQR A;  1OEY A;  4YT0 B;  1PFD A;  3NY5 A;  4GIV A;  3ABV B;  1UGJ A;  4ZYN A;  1N60 A;  1KOT A;  2DZI A;  3TEW A;  5EE3 A;  1WGR A;  1NYQ A;  3VVW B;  2KWU B;  2KAJ A;  1XLO A;  2E6X A;  1MG4 A;  2ZZP B;  2OJW A;  1TZ1 A;  2INN E;  3W5U B;  4JIO U;  4ARC A;  5FKA C;  2KT7 A;  1IP9 A;  3Q3O C;  2DZM A;  2PEA A;  4S17 A;  3DHG C;  4WJQ A;  4W9K A;  5H8Y E;  1J8C A;  5AEK B;  2C7H A;  4LNI A;  1I4X A;  1SBB B;  2FUH B;  2WXF A;  1XLQ A;  4DXG A;  2BB5 A;  1SE3 A;  3BYY B;  3MFG A;  5KHO A;  1D3Z A;  5LLI A;  1E0Z A;  1E8W A;  2KQ7 A;  4XDD A;  4Q2J A;  1N61 A;  3VTU A;  3RMK C;  1T0Q C;  1WGY A;  1WIA A;  2KFK A;  3H7S A;  4KZ0 A;  3ZTC A;  1ZUD 2;  1PGX A;  4EFO A;  3BK2 A;  2JWU A;  2QDF A;  1DGJ A;  2KAC A;  3BII D;  2LFI A;  3SD5 A;  2CU3 A;  3KW5 B;  3L10 B;  2FCS A;  3ECI A;  4CYE A;  1TKE A;  1HZ5 A;  2KZR A;  4WWM A;  4II2 B;  2XK5 B;  3WAL A;  4KX6 B;  2HD5 B;  1RFK A;  1IBX A;  4J3O D;  2K8C A;  1FXI A;  1HE8 A;  3LYY A;  1YX5 B;  2FUG 1;  2KJ6 A;  2VH1 A;  4C80 A;  4KIK A;  2LXC A;  2OHF A;  3V05 A;  2JQR B;  4C4V A;  3ZGZ A;  1WJ4 A;  2D07 B;  3VH3 B;  2ONQ A;  4HRO A;  2PVO D;  3RCZ A;  4FHJ A;  2N9E B;  2LZ6 A;  1TTN A;  4NPN A;  2IO2 B;  3QQ8 B;  3IHP C;  1TS3 A;  2EKI A;  3R3M A;  2N9L A;  3TCA A;  1X1M A;  2ZNV C;  3PTF C;  1L5P A;  1SGH A;  1K8R B;  5J17 A;  2MA9 B;  2KDI A;  2D11 A;  1FXT B;  3RI7 C;  2UWQ A;  2BS4 B;  4UDU C;  1V1P A;  3N3K B;  3GB1 A;  4BBN C;  2K22 A;  2ZPY A;  1WYW B;  2G3Q B;  4W9H A;  4RGM A;  4AS1 A;  1J7B A;  3VRA B;  3A9K A;  4BKG A;  1YNT E;  2XBB C;  2L7R A;  5L83 A;  3D32 A;  3OJ3 A;  1PUT A;  3MP9 A;  3VTV A;  2IDY A;  3BZD B;  2BW2 A;  4E71 A;  1MJD A;  4FAD A;  4W9D A;  1IUE A;  3NVZ A;  1Q5W B;  2WXO A;  2NTT A;  4DWF A;  3PRE A;  2RMM A;  3A1Q A;  2RDB C;  5HKH A;  1WZ0 A;  3SEB A;  4BFR A;  4PS8 A;  4PT5 A;  1N5W A;  2LVQ A;  3FIL A;  4C56 C;  1GJZ A;  3BYT B;  3H7P B;  1PDX A;  2N4F A;  4M01 A;  1V8C A;  3ZIM A;  2DZK A;  2NBW B;  4WH4 A;  1ACC A;  2LGS A;  2C60 A;  5BO4 B;  1YJI A;  1WR6 E;  2L52 A;  4CHK A;  2HTM E;  1PGA A;  2KHW B;  4DK5 A;  5CHV C;  5IOI A;  2KLG A;  4NY0 A;  3BVM A;  1TS5 A;  2DAJ A;  5LXI B;  2INP E;  4IUM B;  4XZ4 A;  1LM8 B;  1L2N A;  4KDI C;  1WGK A;  2QIL A;  4YSZ B;  2NPT A;  2ICI A;  2MLB A;  2MBE A;  3NVW A;  1IGD A;  3DBR I;  4M0W A;  1FXA A;  1OTR B;  1DYQ A;  3ZLZ A;  3NJT A;  3EFC A;  2PIA A;  3Q14 C;  5FK9 C;  1SB3 C;  3NG0 A;  5GMV A;  3QX1 A;  1YQ3 B;  3V60 A;  1KLV A;  2IGH A;  2K1F A;  2Z8L A;  3PHW B;  1GNU A;  3ZJU A;  2JU6 X;  4ZRI A;  3ENE A;  1T6B X;  4AQ7 A;  2CHW A;  3B1L X;  3ZO5 B;  1C4C A;  2FIF A;  2MBQ A;  3HHM A;  1ZOY B;  3JW0 X;  2JZP A;  4OHJ A;  1C78 A;  2WXM A;  5DPR A;  1TYG B;  2Y5B B;  2HE7 A;  2L83 A;  1F0Z A;  1RM6 C;  3EGR A;  3NS8 A;  3PVL A;  1J19 A;  4P6V F;  2C7M B;  2WQY B;  2L1A A;  1T5X D;  3ZRC A;  2IO1 B;  1I4H A;  2K8B A;  3PO0 A;  4CQN A;  2KYW A;  3I57 A;  3HVD A;  1G6J A;  2Z0E B;  1JRO A;  3IAM 1;  1BXT A;  2IO0 B;  3C8Y A;  1D6E C;  1BUI C;  1T3Q A;  3AE1 B;  2V3N A;  5BMH A;  4E3C A;  3JSV A;  2FE8 A;  4AJW A;  1GB1 A;  3P42 A;  4ZRK A;  2A4Z A;  1Y8R C;  5JHA A;  1ET6 A;  1WSP A;  3AN1 A;  2KTF A;  2IYD B;  1LQB A;  3UGB B;  1EU3 A;  1EM7 A;  3AEA B;  2JT4 B;  1ZPS A;  4LDT D;  3VR8 B;  5C3J B;  3N1X C;  4JE3 B;  5TSS A;  4FXC A;  1WE7 A;  5T8I A;  1S3S G;  1FM0 D;  3MC8 A;  5D6J B;  2EMS A;  2ZPN A;  2RPV A;  4A6Q A;  2LRW A;  4EE2 A;  3LJ3 A;  4XE0 A;  1JWB D;  4EZK A;  2L76 A;  2KWD A;  4WUR A;  3TUO A;  1EF5 A;  3WAM A;  4KVG B;  2LGI A;  3ML8 A;  3KH0 A;  2KK8 A;  4BVU C;  4BOZ B;  1GOZ A;  4FJY A;  3APD A;  1QQR A;  4EOY A;  3TMP B;  1VLB A;  2Y5P A;  1TT5 B;  2I38 A;  2KTR B;  1FRD A;  2RDG A;  2BYV E;  3E56 A;  5EDS A;  4HLE A;  4KSL C;  2BKR B;  4PS7 A;  2MRP A;  2O6V B;  3EC8 A;  1V2Y A;  1V9J A;  1QOG A;  2LUM A;  3LXF A;  3APF A;  2GI9 A;  3BVG A;  3AE2 B;  2LAS A;  1P1A A;  3DBS A;  3V6C B;  2KDM A;  1ZP0 B;  1QOA A;  2WWZ A;  3U4E G;  1LFD A;  1L6U A;  2D10 A;  1WRD B;  3W1Y A;  1ROE A;  5HFY A;  1ZGU B;  2V1Y A;  2NVU I;  3AB5 A;  3WIM A;  3PZD A;  3QA8 A;  4EKU A;  3OJ4 B;  5FR6 A;  3O65 B;  3HUI A;  3B08 A;  1SIJ A;  4HJG E;  3H9D A;  4FLH A;  2W3S A;  3ZDM C;  4MH0 E;  2KDB A;  4MJS B;  2DHZ A;  1HTQ A;  2AQ3 B;  2MBO A;  2ZVO A;  5E6P A;  2IO3 B;  4OW0 A;  3N32 A;  1TY2 A;  3ZJT A;  1TZO A;  5D7G A;  3Q8C A;  2J4X A;  2MX2 A;  3A9J A;  3ZXR A;  2V3S A;  2V4L A;  2GBN A;  1WXV A;  4FJZ A;  3PLU A;  5MPO A;  4ASW C;  2IBI B;  3KQ4 A;  4XYC A;  4MH8 A;  3MHZ A;  2OOB B;  3ZQ4 A;  1ZE3 D;  3S2A A;  3VUY A;  4D2K A;  1SF0 A;  3U30 A;  1ZXH A;  2PKO A;  1KH0 A;  4PYU A;  1YOV B;  2AQ2 B;  3N1Y C;  2D5G A;  2AL6 A;  4NJC A;  3GZN B;  2K5P A;  5CHW A;  3WAN A;  3AUL A;  4DDG D;  1GUA B;  1SJE D;  3PRM B;  1F2R I;  3RUL A;  4ITK A;  1EU4 A;  3DWG C;  3I63 C;  1R7S A;  3GS2 A;  3M63 B;  1K51 A;  2G1E A;  4ANX A;  1FCL A;  1HQR D;  2K9X A;  1SEB D;  2HDE A;  4IOI E;  4PYZ A;  2ON8 A;  4ZHP A;  1N6Z A;  3L13 A;  1WJ6 A;  1L6V A;  3CSF A;  5BMI A;  3W2D A;  4DHJ B;  3VHT C;  1RAX A;  3A4R A;  4ARI A;  5CHF A;  1WI0 A;  4JWU C;  4I6P A;  1WXM A;  2KLC A;  4MGY E;  4K7U A;  2V3P A;  2G4S A;  2JWZ A;  2RGF A;  2V0G A;  2GLS A;  1GB4 A;  1KLG D;  4YWG G;  1K53 A;  3IG3 A;  4RGO S;  2MJ3 A;  3M62 B;  2L0T A;  4IWQ A;  1SE2 A;  3FAH A;  1EUV B;  4J6I A;  3E9S A;  2BT6 A;  3MTN B;  3AEB B;  2MP2 A;  2X38 A;  4TMA B;  4DBG A;  2WXK A;  4HCN B;  4GDK A;  4KGR A;  3HRD D;  2M17 A;  4HKQ A;  1WE6 A;  2KAN A;  5IP4 D;  1E8Z A;  2BBC A;  3UI3 A;  1P0R A;  4WJP A;  2W54 A;  3Q8F A;  2IY1 B;  1PGB A;  1XCQ L;  1K52 A;  1EF1 A;  5KHQ A;  1R4N B;  1Q10 A;  4REZ A;  2AL3 A;  4B0E A;  3NUH B;  1HTO A;  3L17 A;  5IA7 A;  3KWV A;  3L54 A;  2LGX A;  2N7D A;  1V80 A;  4BKS D;  1JWA D;  1UF0 A;  3OLM D;  1LO5 D;  4B9K A;  1Y56 A;  3ZNH B;  2K6D B;  4M8N A;  1XF5 L;  1YN4 A;  3RD2 A;  3QJZ A;  1A5R A;  4A8X C;  4AUQ C;  1XT9 B;  3GE8 C;  1WR1 A;  4HPM B;  2WDR B;  1V5T A;  3QAR A;  1M4V A;  2I1J A;  1I7H A;  2CHZ A;  4IDI A;  4DHJ D;  1DOY A;  4MAC A;  2L05 A;  3B2G A;  2WXI A;  2XN9 C;  4ZHO A;  1IGC A;  5IO9 A;  4IG7 B;  2NMQ A;  3BY4 B;  4B95 A;  3SFD B;  1RFA A;  4EZL A;  2M0A A;  3CST A;  3ZTD A;  1CMX B;  4ZYS A;  4YTP B;  2CJN A;  1UD7 A;  1QIL A;  3R2T A;  1GPX A;  2D3B A;  4MM3 A;  1Z2M A;  4LK0 M;  4RFB A;  2K39 A;  4LNO A;  3PRP B;  3X23 A;  3MHS D;  1RYJ A;  3ZVV A;  4G11 A;  1KJT A;  2DLB A;  2FAZ A;  3L16 A;  2KKC A;  3VQI A;  3H1U A;  3P4Q B;  4ANW A;  4F8C B;  4CO7 A;  1TS2 A;  1QT9 A;  4ZDV A;  3TIX A;  4H2A A;  4RCO A;  4I6N B;  1UH6 A;  4W9G A;  4BOS C;  1MI0 A;  1VRA B;  2JXT A;  3JYU A;  4KZC A;  3VFK A;  2L3Z A;  2W82 A;  1KFY B;  4NQL B;  2WDQ B;  1JQ4 A;  4KSK C;  4FBJ B;  4USA A;  3TBL D;  4RH6 A;  2M56 B;  4OZB A;  5IAA C;  1V5O A;  2J52 A;  5CX3 A;  2EMT A;  1YQB A;  4DXF A;  2KWC A;  4B0M A;  1B1Z A;  4QAY A;  2PE6 B;  3AE6 B;  2BF8 B;  2IGD A;  4GDL B;  3RNC C;  2LHE A;  3EA6 A;  4GOC A;  3X0W A;  4X57 B;  2OED A;  2WXL A;  2DYM A;  4XGA B;  4K7W A;  3RZW C;  1ZDV A;  2ZCB A;  4TQ0 A;  3AE3 B;  1VR9 A;  1WGH A;  2WYQ A;  3RNE C;  5JH5 C;  3N9Y C;  1H4R A;  2X8X X;  4M02 A;  2KVR A;  2KQ4 X;  1WZ3 A;  5D3D A;  5E6N A;  5E6O A;  2MJD A;  2KMA A;  4XDC A;  4A9A A;  2Y5C A;  1KF6 B;  4W9J A;  1Q0W B;  4WQM A;  1QOB A;  1OFF A;  4L1B A;  2B3A A;  3DVG Y;  3OG5 A;  4KKJ A;  2BWE S;  3HIZ A;  1HZ6 A;  4FHK A;  5G5G A;  2D2Q A;  3ETR A;  4XX5 A;  3DQV A;  1V1O A;  4W9E A;  1NI2 A;  4TKN A;  1WM2 A;  4HPL B;  1WY8 A;  2N9K A;  4MSM B;  3TEY A;  1K50 A;  2O2V A;  2GBK A;  1FPY A;  1IBX B;  3DPD A;  3WA0 A;  3UF8 A;  2N9X A;  4LNK A;  4K7S A;  2VZK B;  2MHJ A;  2MQJ A;  4A20 A;  3L4P A;  1MFW A;  2KN5 A;  4HCP B;  3B0A A;  1QZE A;  1UZX B;  5HG2 A;  3AED B;  1Q1O A;  4XWW A;  3Q2A C;  3UQB A;  5JHB A;  2YLM A;  4W9L A;  2H89 B;  2AX5 A;  4YTM B;  4JQW C;  1KTK A;  2DBY A;  3DBH B;  3GZN I;  1ESF A;  4A3P A;  2LRU A;  3QK0 A;  3DHI C;  4RNA A;  3IT4 B;  1F77 A;  3NZU A;  1E10 A;  3TSS A;  3MC9 A;  3UIN B;  1V1P B;  4HVB A;  4P7I A;  4XC2 A;  3KUD B;  1GAQ B;  2LJ5 A;  4RGN A;  2VH2 A;  1D5M C;  1JW9 D;  1FEH A;  3ZNI D;  2G4D B;  3A9K B;  3Q3F A;  2LHD A;  3PZ7 A;  5G5H A;  1RLF A;  4C00 A;  4AP4 C;  4W9F A;  3RT3 B;  3RYT A;  1E5W A;  1TIF A;  1BML C;  4K3C A;  3ML9 A;  3P1M A;  2ASQ A;  4DXA B;  1TJE A;  5L95 C;  2C9W B;  4MEL A;  4ZOH C;  4W9I A;  3AE7 B;  3UIO B;  3CWI A;  1V97 A;  2MJE A;  2DWQ A;  2M4N A;  3A1Q B;  4OVU A;  2JZ3 B;  3MJW A;  2JY6 A;  2B76 B;  1TKG A;  4HDO A;  3AMZ A;  2SEB D;  3FIL B;  1UNS A;  2TSS A;  4NAM A;  3Q3M C;  3BVZ A;  4OVV A;  4KV2 A;  1EO6 A;  4ANU A;  4BKS A;  3DVG X;  2WXN A;  2WLB A;  2WX1 A;  4N6E B;  2WXP A;  4WAA A;  2CS4 A;  2D3C A;  2WHI A;  5TR5 A;  3VH4 B;  3R7Q A;  2M0X A;  5G55 A;  1R4N I;  3RUI B;  4NAW B;  2N7J A;  4JL9 A;  2NPT B;  1OEY J;  3LB8 C;  1QLB B;  1WH3 A;  3NRZ A;  4M0W B;  3T9L A;  5EE1 A;  1XQQ A;  2JF5 A;  2Z59 B;  1L0Y B;  1EWC A;  1WXA A;  2JXX A;  2NR2 A;  5D2M B;  4MT5 A;  2GBR A;  1T0Y A;  2RD0 A;  3VDZ A;  4DHZ B;  4JWS C;  1E8Y A;  1M94 A;  4L2Y A;  1B9R A;  3K9P B;  1ZW7 A;  3TEZ A;  1WX9 A;  4W9C A;  4LLG M;  2KNB A;  1YN3 A;  3P4S B;  5GXG B;  1R4M B;  2DYO A;  1SE9 A;  2GRI A;  2N9P C;  2QIE B;  5C1Z A;  2CJO A;  5DPT A;  3APC A;  1L0X B;  2WXJ A;  2LGY A;  2J0K A;  4NNJ B;  4AJY B;  1FFU A;  3BK1 A;  3J9C A;  2OJR A;  2QJL A;  3C0R B;  1V49 A;  2KX3 A;  1N63 A;  3AU4 A;  3I9V 1;  2VRR B;  3Q69 A;  3QIJ A;  5EE0 A;  3NS1 A;  3RNA C;  4ZRP A;  2HJ1 A;  2BYT A;  4KKI A;  3WAO A;  3OAW A;  5BYQ A;  1MG8 A;  4IKG A;  3HM3 A;  1AWD A;  1FMA D;  4HKZ E;  3RNF C;  1TKY A;  4TV3 A;  4HJK A;  1D4B A;  2XNA C;  1JWS D;  1T0S C;  4N59 A;  1YIW A;  4HWI B;  3VUX A;  2KC1 A;  1UBI A;  1CZP A;  4G3X B;  2WXH A;  1FNU A;  5AZG A;  3DCG A;  3R66 C;  4AOF A;  1MHX A;  2WDV B;  4HK2 A;  4L23 A;  1WMH B;  3MJ5 A;  1NEN B;  2NBU A;  5AUI A;  3V3X A;  3M95 A;  3VAW A;  4N9F 4;  4YTN B;  2XK5 A;  2O6V D;  1TS4 A;  3ZW3 A;  4PS3 A;  3OWE B;  2MWS B;  3PZ8 A;  1XEE A;  3IT6 B;  1STE A;  3JVZ X;  2J42 A;  1AN8 A;  3PLV A;  2INC C;  2MEK A;  4US9 A;  2YEP B;  2LEK A;  3A4S C;  2JZZ A;  2HJ8 A;  3KUC B;  4ICU A;  2R2O A; 
#chains in the Genus database with same CATH homology
 4C7Y A;  2PIA A;  5FK9 C;  2BTE A;  1SB3 C;  4ZYS A;  1YQ3 B;  1UWX A;  1FD6 A;  1SJH D;  4YTP B;  1E7P B;  1MHH E;  1NVI D;  2CJN A;  2ZW1 A;  1QIL A;  2IGH A;  3R2T A;  2Z8L A;  4US8 A;  1GPX A;  4R3D A;  3ZJU A;  2QSD A;  2JU6 X;  4LK0 M;  4RFB A;  1JWU D;  3DWM A;  1T6B X;  4JX1 C;  4AQ7 A;  3NVY A;  5BMG A;  2W3R A;  1RYJ A;  1I4P A;  4HEA 1;  1C76 A;  3R8B A;  1FRR A;  3U7Z A;  1AYF A;  1C4C A;  2GB1 A;  1I4Q A;  2DLB A;  1FNW A;  3NVV A;  3VQI A;  1ZOY B;  2JZP A;  3P4Q B;  4OHJ A;  1C78 A;  2WXM A;  1TYG B;  4NZL B;  3AEF B;  1YJJ A;  2L83 A;  3HVZ A;  1TS2 A;  5I4D A;  1F0Z A;  1RM6 C;  2BS3 B;  4YSX B;  1QT9 A;  5BYS A;  2WXQ A;  3EGR A;  4H2A A;  4RCO A;  4DQO C;  3RPF C;  4RF0 A;  1MI0 A;  1VRA B;  1VZ6 A;  4P6V F;  3SFE B;  2JXT A;  1SSN A;  1VJK A;  2WQY B;  3AE5 B;  2L1A A;  1T5X D;  3RFZ B;  1I4H A;  3PO0 A;  4CQN A;  2W82 A;  1N62 A;  3I57 A;  1KFY B;  3MC0 B;  3HVD A;  2J53 A;  4OZC A;  2WDQ B;  1JQ4 A;  1JRO A;  3H8H A;  3IAM 1;  3EUB 2;  1BXT A;  4USA A;  2N0S B;  1HXY D;  3C8Y A;  2E3T A;  4RH6 A;  2M56 B;  4OZB A;  1XXG A;  1D6E C;  2R61 A;  1BUI C;  1T3Q A;  1YMH E;  2J52 A;  3AE1 B;  2V3N A;  5BMH A;  4C7Z A;  2WP9 B;  1A70 A;  2FE8 A;  1GB1 A;  4DXF A;  3P42 A;  3AE9 B;  3VR9 B;  4B0M A;  3Q8E A;  1B1Z A;  1ET6 A;  1WSP A;  2WXR A;  3AN1 A;  4HRS A;  3AM9 A;  3AE6 B;  2IGD A;  2WU5 B;  1EU3 A;  2EEL A;  4GDL B;  1EM7 A;  3AEA B;  1WRI A;  2LHE A;  4N58 A;  3EA6 A;  5C2T B;  3AEC B;  1ZPS A;  2OED A;  3AH7 A;  1HA5 A;  4GLS C;  3VR8 B;  2IGG A;  2WXL A;  1SXT A;  2DYM A;  4YSY B;  5C3J B;  4KGT A;  1ZDV A;  1WWT A;  3AE3 B;  2LMC A;  3CIR B;  3TEX A;  1NI3 A;  4JE3 B;  4TQ0 A;  1VR9 A;  3W5V B;  5TSS A;  4FXC A;  2W55 A;  3IXS A;  3N9Y C;  2PLP A;  2Y3A A;  5T8I A;  2PVG C;  1FIQ A;  1KRH A;  1FM0 D;  2I2Y A;  2KQ4 X;  1NEK B;  5D3D A;  5E6J A;  2RPV A;  4A6Q A;  4EE2 A;  1ZXI A;  4WIP A;  2MJD A;  4XDC A;  2BS2 B;  4XE0 A;  1JWB D;  1AW7 A;  1KLU D;  3P63 A;  4A9A A;  1FNV A;  2KWD A;  2Y5C A;  4WUR A;  1E9M A;  3TUO A;  1KF6 B;  1WXQ A;  2SAK A;  2JX5 A;  2LGI A;  2YEP F;  4WQM A;  1QOB A;  1OFF A;  4RGT A;  4L1B A;  1FCC C;  4KKJ A;  1JRP A;  1GOZ A;  1HZ6 A;  5G5G A;  1OQQ A;  2BB6 A;  1MVK A;  1WYG A;  1QKZ A;  3ETR A;  1XLN A;  1QQR A;  1SE4 A;  1V1O A;  1VLB A;  2M19 A;  2Y5P A;  1I4G A;  3KWL A;  4TQ1 A;  1L4Z B;  4A90 A;  2N9K A;  3T3O A;  2I38 A;  1ET9 A;  1UUP A;  5EE9 A;  3TEY A;  1K50 A;  1ZDX A;  1FRD A;  1F2R C;  1JAL A;  2IJ0 A;  4XWT A;  2L32 A;  4ZRQ A;  1P7E A;  1CK1 A;  2RDG A;  3E56 A;  1ENF A;  4A55 A;  1IBX B;  2G9H D;  2K0P A;  5HHD G;  3U52 E;  3AEG B;  3AE8 B;  5D3I B;  2VZK B;  1QF6 A;  3AEE B;  2MH7 A;  2WNM A;  3L4P A;  3WCQ A;  1CQV A;  5HG2 A;  1QOG A;  4TSS A;  1YN5 A;  4JPS A;  3AED B;  5FR3 A;  4XWW A;  2QEJ C;  2LUM A;  3LXF A;  3U2S C;  2GI9 A;  2PW9 A;  2H89 B;  3BVG A;  4O1N A;  3AE2 B;  2AX5 A;  4YTM B;  1DOI A;  3IAS 1;  1KTK A;  2DBY A;  1RWS A;  1OQR A;  4YT0 B;  1PFD A;  2KDM A;  3ABV B;  1UGJ A;  1ESF A;  1ZP0 B;  1QOA A;  1N60 A;  3U4E G;  1L6U A;  3TEW A;  1JWM D;  4RNA A;  5EE3 A;  3IT4 B;  1F77 A;  3NZ3 A;  1ROE A;  3KLS X;  1C4A A;  1E10 A;  1NYQ A;  3TSS A;  5HFY A;  2IPK D;  1V1P B;  1XLP A;  2KAJ A;  1XLO A;  2E6X A;  3AB5 A;  3Q8A A;  1GAQ B;  2INN E;  3W5U B;  1D5X C;  4RGN A;  5H92 C;  4ARC A;  1D5M C;  1JW9 D;  1FEH A;  5FKA C;  2FBW B;  3Q8B A;  2LHD A;  4GDK B;  3PZ7 A;  5G5H A;  2JYT A;  3AV8 A;  1JML A;  5H8Y E;  2H88 B;  3HUI A;  3URY A;  4HJG E;  1SIJ A;  1I4X A;  1SBB B;  1J7A A;  2W3S A;  1TY0 A;  1BML C;  2Q5W D;  2WXF A;  1P7F A;  1XLQ A;  4OZA A;  3P1M A;  4DXG A;  2AQ3 B;  4RF1 A;  2BB5 A;  1SE3 A;  1TJE A;  3BYY B;  3MFG A;  4OW0 A;  1TY2 A;  1E0Z A;  1CJE A;  4ZOH C;  5BYR A;  1HEZ E;  4XDD A;  3AE7 B;  3ZJT A;  1TZO A;  4Q2J A;  1N61 A;  5D7G A;  3CWI A;  1V97 A;  2MJE A;  2DWQ A;  3Q8C A;  2J4X A;  1VZ7 A;  2B76 B;  1TKG A;  1VDV A;  1L0V B;  3AMZ A;  2SEB D;  3FIL B;  1FO4 A;  4YXD B;  1PYW D;  1UNS A;  1ZUD 2;  3R2I A;  5MPO A;  1PGX A;  2TSS A;  4NAM A;  3BK2 A;  3KQ4 A;  2JWU A;  4WAF A;  1NYR A;  3BVZ A;  4MH8 A;  1DGJ A;  3MHZ A;  2KAC A;  2WU2 B;  3BII D;  3ZQ4 A;  1ZE3 D;  4D2K A;  1SF0 A;  1ZXH A;  2LFI A;  2PKO A;  1C9F A;  1KH0 A;  2CU3 A;  2WXN A;  2AQ2 B;  2WLB A;  3P4R B;  2D5G A;  4NJC A;  1TKE A;  2K5P A;  1HZ5 A;  4N6E B;  2WXP A;  4WWM A;  4LTU A;  1SJE D;  4KX6 B;  1RFK A;  1F2R I;  1IBX A;  4J3O D;  3ZJV A;  1FXI A;  1EU4 A;  4ITK A;  3LYY A;  3DWG C;  2FUG 1;  4NAW B;  1R7S A;  3GS2 A;  2N7J A;  1K51 A;  4C80 A;  2G1E A;  1FCL A;  3AE4 B;  2OHF A;  3LB8 C;  1QLB B;  1HQR D;  2JQR B;  3NRZ A;  3V05 A;  2K9X A;  3ZGZ A;  1SEB D;  1JCK B;  2HDE A;  4IOI E;  2ONQ A;  4HRO A;  2ON8 A;  4ZHP A;  2PVO D;  5EE1 A;  2WS3 B;  1YQ4 B;  2ZW0 A;  3FC4 A;  3T3N A;  1L0Y B;  1EWC A;  1L6V A;  5BMI A;  3W2D A;  3O13 A;  4MT5 A;  1TS3 A;  1FFV A;  3SR6 A;  2NTS A;  2EKI A;  4ARI A;  1UWM A;  2PTL A;  4JWU C;  2N9L A;  2RDH A;  4MM3 B;  4JWS C;  1L5P A;  2V3P A;  4L2Y A;  1B9R A;  1J7C A;  1L4D B;  2V0G A;  4OVZ A;  1GB4 A;  1EWY C;  1KLG D;  4YWG G;  3TEZ A;  2JYE A;  1K53 A;  3B9J A;  2BS4 B;  2KN4 A;  4RGO S;  2MJ3 A;  4UDU C;  4LLG M;  1MPE A;  1V1P A;  1SE2 A;  1YN3 A;  3FAH A;  4KGS A;  2AQ1 B;  3P4S B;  3GB1 A;  5GXG B;  1I4R A;  2K22 A;  2BT6 A;  2DYO A;  3E9S A;  2GRI A;  2QIE B;  3AEB B;  2X38 A;  4TMA B;  4RGM A;  2CJO A;  4AS1 A;  1J7B A;  1L0X B;  2WXJ A;  2WXK A;  3VRA B;  1E6E B;  1FFU A;  4KGR A;  3BK1 A;  3HRD D;  4HKQ A;  1YNT E;  2QMT A;  2PMV A;  3J9C A;  2QJL A;  5LNK 1;  2BBC A;  1PUT A;  3UI3 A;  3MP9 A;  1N63 A;  3GP7 A;  2IDY A;  3BZD B;  1QOF A;  2BW2 A;  3I9V 1;  3P4P B;  1DOX A;  3Q69 A;  5EE0 A;  1XO3 A;  2W54 A;  3NS1 A;  4ZRP A;  3Q8F A;  1IUE A;  2BYT A;  3NVZ A;  1PGB A;  1XCQ L;  2WXO A;  1K52 A;  4KKI A;  2NTT A;  2V4I B;  1Q10 A;  5BYQ A;  1C77 A;  2RMM A;  3ZYY X;  4IKG A;  4REZ A;  1AWD A;  1FMA D;  1VZ8 A;  4HKZ E;  3NUH B;  4B0E A;  1TKY A;  2JSV X;  3KWV A;  1D4B A;  2XNA C;  1JWS D;  3SEB A;  3W1S A;  4PT5 A;  1N5W A;  4N59 A;  1JWA D;  3FIL A;  1LO5 D;  2K3U A;  4C56 C;  1N5X A;  1Y56 A;  3BYT B;  1CZP A;  1PDX A;  1V8C A;  2WXH A;  1D5Z C;  1FNU A;  5JXV A;  2ACZ B;  1XF5 L;  1YN4 A;  4WH4 A;  1ACC A;  4A8X C;  3W9C B;  5AUK A;  1MHX A;  2WDV B;  1YJI A;  4L23 A;  3BWU D;  2L52 A;  2HTM E;  3VRB B;  3MJ5 A;  1NEN B;  1PGA A;  5AUI A;  3V3X A;  2VZK D;  2WXG A;  3BVM A;  2KMM A;  1TS5 A;  4YTN B;  2WDR B;  2LJI A;  1TS4 A;  1M4V A;  3OWE B;  3PZ8 A;  2INP E;  1XEE A;  1I7H A;  3IT6 B;  1C4P A;  1STE A;  4IDI A;  1DOY A;  4P16 A;  1XCT L;  2J42 A;  4MAC A;  1WGK A;  3B2G A;  2WXI A;  2QIL A;  1AN8 A;  4YSZ B;  2XN9 C;  2MEK A;  2ICI A;  4US9 A;  1C79 A;  1IGC A;  4ZHO A;  2NMQ A;  2YEP B;  5HI1 A;  2LEK A;  3NVW A;  1IGD A;  4M0W A;  3SFD B;  3B2F A;  1FXA A;  1DYQ A;  2M0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...