1Q1OA

Solution structure of the pb1 domain of cdc24p (long form)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
GPLGSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The PB1 domain and the PC motif-containing region are structurally similar protein binding modules
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
molecule keywords Cell division control protein 24
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1q1oA00
3RULA 1V49A 4IWQA 1GJZA 4ICVA 5DCNA 1UBQA 4W9CA 2MW5A 4ZRKA 2KANA 4IM3A 4IWPA 3TMPB 1ZKHA 4MEMA 3B08A 2O6VA 2ZNVC 3WALA 2FCQA 4MELA 2K25A 3L16A 1IYFA 2KFJA 4ASWC 3ZNZB 2ZEQA 2KC1A 4FLHA 2EMSA 3R7QA 2C5LC 3W1YA 1Y8RC 1XT9B 1L7YA 2VRRB 3S2AA 2WWZA 3DBRI 3H7PB 2MLBA 5JZEB 1KOTA 2JT4B 2KJ6A 3BY4B 2ZPNA 4G11A 4W9GA 4FHJA 1ZW7A 4IG7B 1YJ1A 2MBHA 1E8ZA 2LGDA 3N3KB 2D2QA 3KUCB 5KHOA 2FCNA 2KXJA 1H8CA 3A33B 1A5RA 1Q5WB 2KHWB 4WWPA 1E7VA 2NR2A 1P1AA 2FIDA 4WJPA 3APFA 4KZCA 2J0KA 2K39A 2V4LA 2B3AA 3H1UA 3DBHI 3QC8B 3VH3B 4LJPB 3X23A 4BKGA 1VD2A 1E7UA 2KDBA 3VVWB 3ML8A 3UQAA 3PSEB 4FJYA 1Z2MA 3MHSD 4PS8A 3W1SA 3DQVA 4I6NB 5AEKB 3QK0A 1YD8U 2IYDB 5LLIA 3A9JB 2FAZA 5DPRA 2MSED 2Z0EB 5EDSA 4FJVB 3Q3JA 5G2NA 3TJPA 3IHPC 1J19A 3V62A 3ZIMA 1GNUA 2BKFA 4KSLC 3ZDMC 3CMMB 5JHAA 2CHXA 3RCZA 1E8YA 1WMHB 3H7PA 4OVUA 4RM8A 2KDIA 5LXHA 4KV2A 4WQOB 1WI0A 1S3SG 2BWFA 2DHZA 2PEAA 3VHTC 2DAJA 3A4RA 3KUZA 3TIXA 2LXCA 1SIFA 2V1YA 2I1JA 3PV1A 5C23A 4KVGB 2O2VA 2WX1A 4B95A 4FULA 1NBFC 4BKTA 3PHXB 4B9KA 1WM2A 3DDCB 3QIJA 3RD2A 4PS7A 1PQSA 3QHTA 1AARA 4BKSD 3NY5A 4OVVA 3RZWC 3VXWA 4E3CA 1I42A 4NAWA 2LGYA 2BGFA 1G6JA 2DZMA 5L95C 1RAXA 5GMVA 4KIKB 2JRIB 2OOBB 2G4DB 1WXAA 3GOEA 1GC6A 3MTNB 1ISNA 3VTUA 2DAFA 3O65B 2NBWB 5DPSA 5AZFA 3ZRFA 3A9JA 1LXDA 4AJWA 1KLVA 1NI2A 2M4NA 3A9KA 3DVGY 2JPHA 2Z0DB 3TCAA 4WJNA 3CF6E 4IWOA 3N32A 2LGXA 4N9F4 3PHWB 3QAQA 1UD7A 2XBBC 3VTWA 1V9JA 1WMHA 2LUEA 4RM9A 3JW0X 3DVGX 2KTFA 2BYFA 1J0GA 1J8CA 3EFUA 3UIOB 5J17A 3M95A 3KYCD 2EMTA 4I6LB 4DWFA 4DK5A 3U30A 5D6JB 2K1FA 2ZJDA 4GXBA 2M17A 4J6IA 4HPMB 2RPQA 4MGKE 3VUXA 2REXA 3ZTDA 5CX3A 2M0XA 2BYEA 4M0WB 2KN5A 1MG8A 2KJHB 2CHZA 2AL6A 3NZSA 1WJUA 4HVBA 4BBNF 3PVLA 2CR5A 2K8CA 2C7MB 1E8WA 2M8SA 2ZPYA 4WAAA 2MA9B 3W1SC 1E90A 4DDID 3ZVVA 2N1VA 4MSMB 2CKHB 2KDFB 2KX3A 2LVPA 4GGQA 2FUHB 1S1QB 2KD0A 3HM6X 2KMCA 4TV3A 1V81A 1WZ3A 4FA6A 1D3ZA 2JWZA 3SU8X 2MBQA 2KFKB 2ZVNA 3DPDA 4ICUA 2DZKA 1WJNA 1CMXB 2D11A 2MQJA 3UIPB 5L83A 4XX5A 1TZ1A 2NBUA 1R4NI 3HM3A 2JUOA 1WGRA 1GC7A 2Z59B 3L17A 1YIWA 3M62B 2BKRB 2N1WA 1BT0A 2XEWA 4GB9A 5BO4B 2D10A 2N9XA 2KQSA 4AOFA 2ZVOA 1LM8B 2G3QB 4XC2A 4WWNA 3L10B 4LDTB 2NBVB 1P98A 1X1MA 3QQ8B 2LJ5A 1WX7A 2BYVE 2ZNVB 2C60A 4B6WA 1YX6B 4DDGD 2LRWA 2KOXA 4K81A 3JYUA 3A4SC 4M8MA 4W9IA 4K7WA 1EO6A 2GBRA 3K9PB 4MM3A 2RD0A 1L2NA 1OEYA 4NPNA 2RR9A 2LZ6A 2AWTA 2GOWA 3IG3A 4GDLA 4HPLB 4FN2A 2KC2A 2KWCA 4LCDE 1XD3B 2KFKA 4GN1A 2WX0A 2XK5B 4XZ4A 3VFKA 5DPWA 4KSKC 2KLCA 3UQBA 4KZ0A 3PGEA 4TQ0A 3APDA 1C3TA 5D2MB 1TBEA 1TGZB 2NS5A 4AUQC 4CO7A 2FCMA 4A3PA 4MH0E 4TQ1A 2JXXA 4KDLB 1WH3A 1Z5SB 2OJRA 2NPTB 3PRMB 2ZCBA 5J18A 1JRUA 2N9PC 1RRBA 1E5WA 3RT3B 1T0YA 2N7DA 3VAWA 2O2VB 1RFAA 4A3OA 3R7RA 2DYMA 2K6DB 3MJWA 3R66C 4EZJA 2KZRA 2O6VD 2L05A 3A1QA 4A20A 3SD5A 2CU1A 1WF9A 1RLFA 1P3QU 2LXAA 3QWZB 3V60A 1WR1A 2KNBA 1IPGA 2M1MA 4JLCA 4KIKA 2N7EA 4DXAB 2HTHA 1WX8A 4CYEA 3WAMA 5D94A 3ZLZA 4IW0A 4BVUC 5CTRC 3ZNHB 2GBJA 4F1SA 3ZUNA 4WWOA 4GDLB 4GIVA 3DVNV 2DYOA 2JRHA 2MWSB 4HDOA 1WGHA 2C7NB 2MRPA 3PLUA 4K7UA 3V61A 4HLEA 2L76A 2PJHA 2LD9A 3WAPA 2MP2A 1ZGUB 1V6EA 2QHOA 4TUUA 4BOSC 3BINA 3IVFA 3DOWA 2JZ3B 5J2RA 1WX9A 4NQKE 1E8XA 1U4AA 2LVQA 2LRUA 4ZYNA 2IY0B 2ASQA 3RZFA 2EKEC 2NPTA 2L8JA 2LASA 3QA8A 5E6NA 3OJ4B 5CHVC 4IM0A 1Q1OA 3D32A 3CSTA 1LQBA 2IBIB 1Q0WB 4AJYB 4F8CB 3QCAA 1OEYJ 3V6EB 2A4ZA 4AWJA 1WIAA 2KK8A 3ECIA 3JSVA 4NNJB 5CHWA 4W9EA 4DHZB 3APCA 3NZUA 3L0WB 3ML9A 1SE9A 3VUYA 1KJTA 3EC8A 3NOBA 2BWES 4GDKB 1YQBA 2PPHA 2A5UA 2R2OA 5G55A 2RGFA 4ANXA 4RMAA 3B0AA 3QJZA 1WE7A 1EF5A 3EHVA 3R3MA 4IM2A 4G50A 2N4FA 1H4RA 1R4MI 2KQ7A 2MBEA 3PPAA 3T8MA 3U8ZA 1EF1A 4PYUA 4GMVA 4BOZB 1YX5B 4EFOA 3N30A 4HK2A 3OJ3A 1WGGA 5IAAC 4BFRA 2YVCA 1GG3A 4G3XB 4HCNB 1WXMA 3H7SA 1K8RB 2K8BA 2UWQA 3DBSA 2WDTB 4URKA 2BF8B 2LI5A 1KM7A 1WGDA 2IZVB 3HHMA 4ZRIA 3U7DA 4EKUA 2CS4A 4DBGA 2LVOA 1WJ6A 1WR6E 3PRZA 3JSVB 3TBLD 4JQWC 3ZNGC 3WIMA 1UBIA 5KHQA 1OGWA 1V5TA 4M8NA 4P7IA 2MBOA 4WJQA 4HCPB 1WXVA 2L0TA 1I35A 2GBKA 4NJ7A 1WJ4A 3ALBA 4GDKA 5TR5A 4ANVA 4ZDVA 5E6OA 4JL9A 4EOYA 1WYWB 1V80A 2DENB 4II3B 4NY0A 4GSWA 2JY6A 4FBJB 3B1LX 4I6PA 3I3TB 2HD5B 4W9KA 2XK5A 2AYOB 1WY8A 3DCGA 2DX5B 3AU5A 2GMIC 2NCNA 5AZGA 2W9NA 2KMAA 2J0MA 4X57B 4IUMB 3SDLC 2MCNB 4G0NB 3T9LA 4TKNA 1UH6A 2O6VB 3LDZE 3PREA 2L7RA 4MGZE 1WRDB 3AXCA 2HJ8A 4CHKA 4EEWA 4GU2A 2JZZA 4W9HA 1OTRB 1TTNA 3VQIA 3HK0A 4LJOB 4NJ6A 4ANWA 1OQYA 2C9WB 3ZDTA 3VTVA 3A1QB 1V86A 2IO0B 3VUWA 4EZLA 4EUTA 3AU4A 3ZRCA 3PT2B 4MDKE 3PRPB 1UZXB 5JH5C 3NS8A 3PTFC 3H9DA 3VH4B 2IO1B 2L3ZA 3PS6A 4IC7B 2GBMA 4DHJB 1M94A 3RYTA 3L54A 3WANA 2DZJA 2ZZPB 4MGYE 4FHKA 1LFDA 2FCSA 2G45B 4W9JA 1VCBA 1WM3A 3CSFA 4W9LA 3NHEB 3WA0A 4II2B 3EECA 2MP2B 2KJRA 2L0FA 2J0JA 3UINB 3QARA 2WYQA 4AP4C 3KH0A 3OLMD 3GZNI 3VDZA 2CHWA 2IO2B 2J7QB 4YL8A 4EZKA 2HE7A 1IP9A 2RSUA 1C1YB 5E6PA 1WFYA 2Y5BB 3OAWA 1XQQA 2DYBA 3ENEA 3KVFB 2NVUI 4F7ZA 4MJSB 3IFWB 1HE8A 5AZHA 3ZKJC 3KW5B 3DBLI 3DVNU 3C0RB 4MSQB 4W9FA 2G4SA 5FR6A 3HIZA 4HJKA 4HDQA 1SGHA 4W9DA 2K6QA 2KTRB 3K9OB 2KX0A 2MX2A 2KDEB 3AULA 2K8HA 1GUAB 2AL3A 1V2YA 3V6CB 2JVCA 4K7SA 3L13A 4KDIC 2KO3A 2GBNA 1V5OA 2KKCA 4PYZA 5HKHA 2R2QA 2MBBB 3AI5A 3IBEA 4MGIE 5C1ZA 4LDTD 2D07B 3L08A 1UGMA 3M63B 3PZDA 1P9DU 4PS3A 3ZO5B 4FJZA 4JGHB 4NAWB 4HXDA 4JIOU 1P0RA 1WXSA 2C7HA 4E71A 3PLVA 3Q3FA 4GOCA 2V3SA 2FNJB 2N9EB 1UELA 2AEHA 3X0WA 2PE9A 3KYDD 3WAOA 3A9KB 3ZW3A 2IO3B 2LWPA 4FADA 1WE6A 1EUVB 5CHFA 4MJSA 3ZTCA 3M3JA 3JVZX 3P2BA 3UF8A 2KLGA 3SHQA 4DHJD 2I1KA 2UYZB 3TL5A 2BPSA 3RUIB 4E74A 5IA7A 4WJOA 3H6NA 3ZNID 3LJ3A 2KVRA 2KTRA 5DPTA 1WGYA 2FIFA 2KWVB 3QX1A 4NQLB 2D3GA 2ZCCA 2PE6B 5LXIB 1FXTB 3ONSA 4ZRJA 3KUDB 4K1RB 2IY1B 5D7GA 4DHZE 4ANUA 3UGBB 1NDDA 2L00B 5JHBA 2JF5A 2DZIA 1F9JA 1QZEA 4BBNC 4HWIB 1WZ0A 4BKSA 2KWUB 2YLMA
chains in the Genus database with same CATH superfamily
5DCNA 5BYQA 1ZKHA 4MEMA 5BYSA 3WALA 2FCQA 4MELA 2RMMA 1IYFA 2KFJA 3DWMA 1Y8RC 2H89B 4S0RA 3DBRI 2QJLA 2KJ6A 4ZHOA 3ZXVA 4FHJA 1ZW7A 3KQ4A 2Q5WD 2L32A 1E8ZA 1FXIA 1NI3A 1E10A 1MI0A 1A5RA 1Q5WB 3HVDA 1JCKB 1TY0A 4KZCA 2V4LA 2B3AA 2HDEA 3VH3B 1VD2A 3VVWB 2N9LA 1RWSA 3DQVA 1SJED 2IYDB 1IBXB 5LLIA 2EELA 2Z0EB 3ZIMA 1KLUD 1QKZA 1J19A 3V62A 2V9HA 2QSDA 1GNUA 2BKFA 3AE2B 3HVZA 1XCQL 1SE3A 3H7PA 1WMHB 3Q8CA 1DOIA 1EU4A 4RM8A 2VZKB 4KV2A 2BWFA 3VHTC 3RNBC 3A4RA 3KUZA 4US8A 2V1YA 4P6VF 4KVGB 5HI1A 4B9KA 3QIJA 2OHFA 2WXRA 1GAQB 3VXWA 3P1MA 1FNUA 2K9XA 1I42A 1XLOA 4QAYA 2JRIB 3U2SC 3HRDD 1HTOA 3VTUA 2NBWB 1ET6A 5DPSA 3ZRFA 1LXDA 3A9KA 3AEDB 1QOGA 3AM9A 3QAQA 1UD7A 4RM9A 1QLBB 1HQRD 3GS2A 2EMTA 4I6LB 4UDUC 1BUIC 1SEBD 4HPMB 1V97A 2RPQA 3WCQA 3ZTDA 2KN5A 1T5XD 2CHZA 2AL6A 5L83A 4HVBA 1E8WA 2M8SA 1WGKA 3W1SC 1I4XA 3R2TA 2H88B 1K50A 2LVPA 2QIEB 5LNK1 1N6ZA 1WJNA 1CMXB 2D11A 4XX5A 1UWXA 1E7PB 2NBUA 3HM3A 1ACCA 1UUPA 2K3UA 3LB8C 1YJIA 2BKRB 1FD6A 1ESFA 1BT0A 1V8CA 2D10A 1F52A 1VLBA 4AOFA 4YSXB 3QQ8B 5BMGA 3AE8B 4DDGD 4DXGA 4ACFA 2KT7A 2RDHA 2RD0A 1OEYA 4AQ7A 3V05A 2GOWA 4HPLB 3I5JC 1STEA 4LCDE 4XZ4A 1JMLA 3VFKA 1UF0A 2KLCA 1B1ZA 1TGZB 4AUQC 3RNCC 2FCMA 5E6JA 4MH0E 1WH3A 1Z5SB 2OJRA 2NPTB 1JRUA 1RRBA 1T0YA 2N7DA 1SBBB 2LHEA 4A3OA 3R7RA 2E3TA 3MJWA 3R66C 4HROA 2L05A 4A20A 4LNIA 2KNBA 4CYEA 3MP9A 3W5VB 3OWEB 1JROA 1C4PA 4WWOA 2OEDA 4GIVA 4HDOA 3DVNV 1I4QA 2MRPA 2C7NB 2MP2A 1ZGUB 1V6EA 2WXQA 2MHJA 4TUUA 2JZ3B 2LVQA 4M00A 4ZYNA 1TJEA 2ASQA 3LYYA 2QILA 1ZDXA 3QA8A 2INNE 1D6EC 4IM0A 4A55A 1F2RC 1Q0WB 4AJYB 3V6EB 1FO4A 1WIAA 4P16A 2KK8A 2K22A 4DHZB 3APCA 1D5XC 3HUIA 1XO3A 2WXMA 1ZXHA 2PPHA 2A5UA 5G55A 3QJZA 1EF5A 3R3MA 3RPFC 3PPAA 3U8ZA 1YX5B 5IAAC 4BFRA 1T3QA 3H7SA 2LI5A 1KM7A 5AUIA 1WGDA 1FM0D 1T6BX 3U7DA 3TBLD 3P4RB 3DBRB 1UBIA 1OGWA 1GPXA 4M8NA 1I35A 2QC8A 3W2DA 5HFYA 5TR5A 5E6OA 4JL9A 1WYWB 2DENB 1JWMD 2PIAA 2JY6A 3B1LX 2HJ1A 3I3TB 4B0EA 4W9KA 1LGRA 2J0MA 4X57B 4YTNB 2MCNB 2WHIA 3T9LA 2O6VB 2L7RA 4CHKA 4GU2A 4W9HA 3EUB2 2C9WB 2I2YA 1K53A 1QF6A 3A1QB 3VUWA 4EZLA 1TY2A 2WXHA 3ZRCA 2ACZB 2FE8A 3Q8AA 2NTTA 3PS6A 4IC7B 2MJDA 3V3XA 1UGJA 3RYTA 3L54A 2ZZPB 2LGIA 2WS3B 3AEEB 1F77A 2G45B 1DGJA 1QT9A 2B76B 3EECA 2MP2B 2L0FA 5T8IA 3DBHB 3KH0A 3GZNI 3VDZA 2J7QB 4YL8A 2HE7A 3ZXRA 1E6EB 3ZJUA 3TEYA 5AZHA 1HE8A 4H2AA 3ZKJC 4YXDB 1TKEA 4HJKA 1Q10A 4HDQA 4W9DA 4EE2A 2KTRB 2KDEB 3AE9B 2K8HA 1GUAB 3NZ3A 4HKQA 3V6CB 2WDRB 4KDIC 4PYZA 2GBNA 1UGMA 3NG0A 4KGTA 4NJCA 4JGHB 4HXDA 1WXSA 4E71A 1QILA 2TSSA 3B9JA 5D3IB 1KLGD 3X0WA 2PE9A 2GI9A 1TS5A 3AEFB 1WE6A 5CHFA 1HTQA 2SEBD 4CQNA 3P2BA 2KLGA 2I1KA 2BPSA 5IA7A 1C78A 4IDIA 3ZNID 1TS4A 1VZ8A 2D3GA 5LXIB 2Y3AA 3ONSA 4K1RB 2R61A 2L00B 4LNFA 3IXSA 4BBNC 4BKSA 2KWUB 2YLMA 5C1ZA 5EE0A 1IGCA 2MW5A 4ZRKA 4IM3A 4IWPA 1TKGA 3FILB 2D3AA 3AN1A 3BK2A 5BMHA 2GRIA 4LTUA 1L7YA 3S2AA 3U52E 2MLBA 1KOTA 5EE9A 4K3CA 4G11A 4W9GA 2WXJA 2MBHA 2LGDA 3N3KB 4KKIA 2JXTA 1FRRA 5KHOA 2KXJA 1E7VA 1P1AA 2DNFA 2INCC 2JYEA 1F0ZA 4LJPB 4O1NA 4JWSC 4L2YA 3UQAA 3ML8A 3PSEB 4FJYA 4XE0A 2YEPF 4PS8A 3W1SA 5AEKB 3NVVA 3QK0A 3AE7B 4WWMA 5DPRA 2CJOA 1E8YA 2ON8A 1MG4A 3B2GA 2X8XX 1WI0A 2PEAA 2JQRB 2I1JA 4B95A 3C19A 3MJ5A 1NBFC 4BKTA 1RFKA 3RD2A 4HPPA 4PT5A 3P4QB 1AARA 1N62A 2BS3B 4E3CA 2INDC 2I38A 3GOEA 1ISNA 1SE2A 2BW2A 5JXVA 5AZFA 4AJWA 3A9JA 2M4NA 1JWBD 3CF6E 3RNGC 4N9F4 2WQYB 5H8YE 1FFUA 2BYFA 1J8CA 3EFUA 1PDXA 5D6JB 1NYRA 3VUXA 2REXA 3AE5B 1WYGA 2BYEA 4M0WB 4BBNF 3PVLA 2CR5A 2K8CA 1E0ZA 2ZPYA 1E90A 4DDID 3ZVVA 2CKHB 4ZHPA 2KX3A 4MM3B 4TV3A 4XYCA 1OFFA 2ZVNA 1CQVA 2MQJA 1FNVA 1R4NI 1L0VB 1NEKB 3GZNB 1WGRA 4LNKA 1GC7A 2Z59B 1VZ6A 3NVYA 3URYA 4XWWA 3MC0B 1XCTL 4P1CC 2N9XA 2WLBA 2KQSA 2ZVOA 1LM8B 2G3QB 3AEGB 4WWNA 2MJEA 1P98A 2LJ5A 2ZNVB 4ARIA 1VRAB 3A4SC 2EKIA 2GBRA 1N61A 2VH1A 4NPNA 2LZ6A 2AWTA 3IG3A 2JWUA 2KWCA 1ZUD2 3KLSX 4TSSA 2DBYA 1WRIA 3UQBA 1QOAA 1C3TA 1TBEA 4JWUC 4A3PA 4XDCA 1TKYA 4TQ1A 2JXXA 4KDLB 2ZCBA 1ZOYB 3VAWA 4TMAB 2DYMA 4WH4A 4EZJA 2Y5PA 2CU1A 1YOVB 1WR1A 2D3CA 4JLCA 1EU3A 2QDFA 4DXAB 1JRPA 1WX8A 3WAMA 3AE6B 2BBCA 3ZLZA 4IW0A 3RNAC 4F1SA 2GBJA 3Q8BA 1JQ4A 4GDLB 3V61A 4HLEA 2PJHA 3WAPA 4MH8A 1IUEA 1CK1A 2QHOA 4BOSC 3IVFA 1L4DB 2LRUA 1GOZA 3RZFA 2L8JA 2WNMA 3OJ4B 5CHVC 4OZCA 1Q1OA 4HJGE 1LQBA 4F8CB 3BVGA 2A4ZA 3ECIA 4NNJB 3NZUA 2KMMA 1QOFA 3ML9A 5IOIA 1KJTA 1P7FA 4N6EB 2BWES 1SB3C 1YQBA 2LJIA 3IAS1 4ANXA 4WAFA 3B0AA 1WE7A 4IM2A 4XGAB 2KYWA 5AUKA 3AE3B 1H4RA 2KQ7A 2MBEA 4EFOA 4HK2A 3U7ZA 1GG3A 1K8RB 1K52A 1WXQA 2WDTB 4URKA 2BF8B 2IDYA 3BYYB 3UI3A 1QOBA 2CS4A 2LVOA 1WR6E 3PRZA 3JSVB 4JQWC 1KH0A 4C4VA 3WIMA 3ZJVA 5KHQA 2WXKA 4LNNA 4ZRQA 1WXVA 2K5PA 3ALBA 4GDKA 2QEJC 2GLSA 4IOIE 4FBJB 2BT6A 4I6PA 1BMLC 1V1PA 2QMTA 3DCGA 2GMIC 2NCNA 2BB6A 1PGAA 2LEKA 4IUMB 1C77A 4G0NB 3W9CB 4ITKA 3PREA 3PZ7A 2WU2B 1OTRB 1TTNA 1HA5A 3RN9C 1OQYA 3ZDTA 4JE3B 3VTVA 2WXPA 4EUTA 3AU4A 3PT2B 1FIQA 1NENB 3AEAB 3PTFC 2L3ZA 3T3OA 3WANA 3R2IA 4W9JA 4RH6A 1TS3A 4W9LA 1JWAD 4RGMA 3NHEB 3WA0A 4II2B 1J7CA 3OLMD 2KACA 5C3JB 4YSYB 2IO2B 3AB5A 2BS4B 1IP9A 1C1YB 3BVZA 1B9RA 1J7AA 1MHXA 3KVFB 4PK1A 4F7ZA 3I63C 4MJSB 3IFWB 5FK9C 4MSQB 4J3OD 5IKCM 2G4SA 3N1YC 1C79A 4ZRPA 3K9OB 3AULA 2AL3A 1TIFA 1V2YA 3L13A 2KO3A 2KKCA 1V5OA 3ZYYX 1C9FA 1M4VA 2MBBB 4A90A 4RNAA 1PYWD 4YSZB 3M63B 3O13A 1P9DU 2RDBC 4NAWB 2MH7A 4JIOU 2C7HA 2IPKD 3Q3FA 4GOCA 2AEHA 3Q8FA 3KYDD 3WAOA 2AX5A 2IO3B 4OZBA 3RI7C 2IJ0A 3ZTCA 2W82A 3NVWA 3E9SA 3AEBB 3SHQA 2UYZB 1WGYA 5D7GA 1WSPA 4ANUA 1PUTA 3LXFA 2ZW1A 3RULA 1V49A 4IWQA 3NJTA 4BZAA 1GJZA 1V1PB 3DHIC 1UBQA 4MACA 4W9CA 3VR9B 3Q3OC 2KANA 1YQ4B 2W54A 1FPYA 3B08A 2O6VA 3L16A 4ASWC 3ZNZB 2ZEQA 2KC1A 4FLHA 2EMSA 2C5LC 1XT9B 2VRRB 2WWZA 3H7PB 1MJDA 2JT4B 2D3BA 2ZPNA 1FCCC 4IG7B 5IN7A 1YJ1A 2LFIA 1NVID 2D2QA 3MC8A 2V0GA 3I9V1 2WXOA 1WWTA 2J0KA 2K39A 3FAHA 3DBHI 1FXAA 3X23A 2WXLA 4BKGA 1E7UA 1Z2MA 3MHSD 4I6NB 4LK0M 1P7EA 3ZJTA 3A9JB 2FAZA 1D5ZC 5EDSA 4FJVB 5G2NA 3TJPA 1EM7A 3CMMB 3ZDMC 5JHAA 5H92C 2LMCA 4FXCA 3RCZA 4OVUA 5LXHA 1S3SG 2DHZA 2MEKA 3TIXA 1SIFA 5C23A 5TSSA 2O2VA 4FULA 3MC9A 1WM2A 3DDCB 2DLBA 1PQSA 4M0WA 3QHTA 4BKSD 3NY5A 1JALA 3VRAB 3ABVB 4NAWA 2BGFA 1G6JA 5GMVA 4N59A 4KIKB 5IO9A 2OOBB 1WXAA 3MTNB 5BYRA 2KN4A 1IBXA 3NS1A 1KLVA 4USAA 1NI2A 3DVGY 1XF5L 1UNSA 2DWQA 2Z0DB 3PO0A 4M02A 4IWOA 5BMIA 3VTWA 3SEBA 2J42A 3DVGX 2KTFA 1J0GA 3UIOB 5J17A 2INPE 3U30A 3NRZA 2M17A 4GXBA 4J6IA 5CX3A 1MG8A 3FKYA 4A6QA 2C7MB 4WAAA 2MA9B 2VH2A 1TYGB 2N1VA 3FILA 4MT5A 2FUHB 1S1QB 2KD0A 2PKOA 3MHZA 2G1EA 1V81A 1WZ3A 4FA6A 2JWZA 2MBQA 4ICUA 4RGNA 1F1HA 1TZ1A 3BIID 1FEHA 1YIWA 1SJHD 3KWVA 2WDVB 3SFDB 2XEWA 1VJKA 4ZOHC 5BO4B 3Q3MC 1RM6C 4LDTB 3BVMA 4B6WA 2C60A 3JYUA 4W9IA 4K7WA 3Q2AC 3VR8B 1YNTE 4GDLA 5EE3A 4OHJA 2KFKA 2L83A 2WX0A 2XK5B 1GB1A 4KSKC 2BB5A 4OVZA 2BQQA 1GB4A 4CO7A 5J18A 3PRMB 2O2VB 3FC4A 1ENFA 1RFAA 2K6DB 5EE1A 3Q6BA 3L4PA 2KZRA 2W55A 1WF9A 1SE4A 4KIKA 2QCZA 3GE3C 2UU7A 3DBLB 5CTRC 3ZNHB 1V1OA 3BWUD 4S17A 2DYOA 2JRHA 2MWSB 1WGHA 2L76A 1KFYB 2J4XA 4NQKE 1E8XA 5GXGB 3N20C 3ZQ4A 1U4AA 2L52A 2IY0B 4N58A 2SAKA 2EKEC 5FKAC 4GLSC 5E6NA 4IKGA 1J7BA 3P42A 3D32A 3CSTA 1SSNA 4AWJA 1OEYJ 2M0AA 1UWMA 2RDGA 4NAMA 4C4VB 3DHHC 3L0WB 1SE9A 2PMVA 1YMHE 3EC8A 2PVGC 4GDKB 1ET9A 2AQ3B 2R2OA 2RGFA 4RMAA 1L6VA 3EHVA 1C4AA 5HG2A 1XEEA 2N4FA 3T8MA 1LO5D 1EF1A 1L5PA 3NVZA 4BOZB 1R4NB 2YVCA 4G3XB 2UWQA 3DBSA 2KQ4X 3ETRA 2N9KA 2IZVB 1VZ7A 1JWUD 3HHMA 4LLGM 4EKUA 1PGXA 4RGTA 1JWSD 4DBGA 2WXNA 1DOYA 1V5TA 4RF0A 4P7IA 1I4PA 2MBOA 3TEWA 2GBKA 4NJ7A 4R3DA 3AE4B 1WJ4A 4ANVA 4ZDVA 1YN5A 4EOYA 1V80A 1MFWA 4GSWA 2HD5B 1DOXA 2XK5A 1HZ5A 2DX5B 2W9NA 1FCLA 3SDLC 4BAXA 1UH6A 4OZAA 4Q2JA 4MGZE 3AXCA 2HJ8A 3EGRA 4AS1A 3VQIA 4NJ6A 4ANWA 1XLNA 2IGDA 4WIPA 3TSSA 3AMZA 5JH5C 2D5GA 1YJJA 2GBMA 4DHJB 1XLQA 3Q8EA 4FHKA 1LFDA 3IAM1 4L23A 4ZYSA 2KJRA 3QARA 4AP4C 1CZPA 1MPEA 3Q3NC 2AQ1B 5E6PA 2Y5BB 1BXTA 1KTKA 2DYBA 3ENEA 3KW5B 3DBLI 4W9FA 3C0RB 5FR6A 3HIZA 2IGGA 5I4DA 2K6QA 1AN8A 2MX2A 2L1AA 4D2KA 1I4RA 3OG5A 2FBWB 2JVCA 3TEXA 1CJEA 4K7SA 4WQMA 3GE8C 5HKHA 3BK1A 2R2QA 1AW7A 4MGIE 1FFVA 4LDTD 2D07B 3L08A 3PZDA 3ZO5B 1OQRA 1P0RA 4A9AA 2WXGA 3PLVA 4JPSA 2V3SA 2M56B 2N9EB 1ZXIA 2J52A 3A9KB 2LWPA 4FADA 5HHDG 1EUVB 3JVZX 3UF8A 4DHJD 2WDQB 3TL5A 2KVRA 5DPTA 2FIFA 3QX1A 4NQLB 2PE6B 1E9MA 2HTME 1N5XA 3KUDB 4DHZE 5JHBA 2DZIA 1F9JA 1QZEA 4HWIB 3RNEC 1WZ0A 4WJOA 2JSVX 4ICVA 3H8HA 3KWLA 3TUOA 2WXFA 3TMPB 2LUMA 3BYTB 2BS2B 2ZNVC 1T0RC 2K25A 1VDVA 3N1XC 3R7QA 1A70A 1I7HA 3W1YA 4ARCA 1HEZE 1OQQA 2NMQA 5JZEB 1T0SC 3BY4B 1FMAD 3DWGC 2V3PA 3KUCB 1FNWA 4DXFA 2FCNA 1H8CA 2KAJA 3A33B 4WWPA 2KHWB 2NR2A 2FIDA 4WJPA 3APFA 3ZGZA 3H1UA 4C80A 3QC8B 2BVCA 2KDBA 3AECB 3DHGC 2GB1A 3P4SB 1YD8U 3IT4B 2J53A 3CIRB 2MSED 1FRDA 3Q3JA 3BZDB 3IHPC 2JZPA 4KSLC 1L0YB 2MJ3A 2CHXA 2XN9C 2G9HD 2KDIA 4WQOB 2DAJA 2LXCA 3PV1A 3RFZB 2WX1A 4YWGG 3PHXB 1D4BA 1SF0A 4PS7A 3PZ8A 5IP4D 3SR6A 4OVVA 3GB1A 3RZWC 4C56C 2LGYA 3NUHB 2DZMA 5L95C 1RAXA 2G4DB 1GC6A 4LNOA 1DYQA 2DAFA 3O65B 4C7YA 5G5HA 4C00A 2AQ2B 2JPHA 1N63A 3TCAA 1F2RI 4WJNA 4C7ZA 3N32A 2LGXA 3PHWB 2XBBC 1V9JA 1WMHA 2LUEA 5MPOA 3JW0X 3M95A 3KYCD 1L6UA 3Q69A 4DWFA 4DK5A 2K1FA 2ZJDA 2N7JA 4MGKE 3B2FA 2M0XA 2KJHB 2VZKD 3NZSA 1WJUA 1R4MB 1IGDA 4HRSA 4MSMB 3TEZA 2KDFB 4GGQA 1MVKA 3HM6X 1EWCA 2KMCA 5C2TB 1D3ZA 3SU8X 2KFKB 3DPDA 2DZKA 3N1ZC 2M19A 4XDDA 1SIJA 3UIPB 2WP9B 2JUOA 3L17A 3J9CA 3M62B 2N1WA 5D3DA 3EFCA 1KRHA 4GB9A 3IT6B 4XC2A 1HZ6A 3L10B 2NBVB 1X1MA 1WX7A 2BYVE 4HKZE 1YX6B 1K51A 2LRWA 2KOXA 4K81A 4M8MA 1EO6A 4OW0A 3I57A 3K9PB 4MM3A 1L2NA 3P4PB 3CWIA 1YN3A 2RR9A 4FN2A 2KC2A 1N5WA 1XD3B 4GN1A 4WURA 1L0XB 2BYTA 5DPWA 2ZW0A 4KZ0A 1NYQA 3PGEA 4TQ0A 3APDA 4RGOS 5D2MB 5FR3A 2NS5A 4K3BA 2V4IB 2N9PC 1E5WA 3RT3B 3MFGA 2FUG1 2ICIA 2XNAC 2O6VD 3SFEB 3A1QA 3SD5A 1XXGA 1RLFA 1P3QU 2X38A 2LXAA 3QWZB 3V60A 1IPGA 1JW9D 1R7SA 2M1MA 2N7EA 2HTHA 5D94A 3E56A 3RNFC 1XLPA 4BVUC 3ZUNA 1ROEA 3PLUA 4K7UA 1PFDA 1EWYC 2LD9A 3N9YC 2JU6X 1Y56A 2CU3A 2ONQA 2PLPA 3Q14C 4REZA 3BINA 3DOWA 1ZE3D 1WX9A 5J2RA 2NPTA 2LASA 2WU5B 2WGSA 2CJNA 2IBIB 3QCAA 3VRBB 3JSVA 5CHWA 1SXTA 4W9EA 3VUYA 2WXIA 2KWDA 2OJWA 2RPVA 3NOBA 2KVZA 1ZDVA 1L4ZB 1TZOA 4G50A 3RMKC 2W3RA 1R4MI 2LGSA 4PYUA 4GMVA 4L1BA 1RYJA 3EA6A 3N30A 3OJ3A 1WGGA 3R8BA 2Y5CA 1WXMA 4HCNB 4KX6B 3U4EG 2K8BA 2NTSA 3P63A 2JX5A 4KGRA 4ZRIA 1KF6B 4A8XC 1WJ6A 3ZNGC 4DQOC 2YEPB 4YTPB 4WJQA 4HCPB 2L0TA 4M01A 4II3B 4NY0A 1HXYD 2AYOB 4US9A 1WY8A 3AU5A 1AYFA 5AZGA 2KMAA 3C8YA 2PTLA 1PGBA 2N0SB 4TKNA 3LDZE 1WRDB 1I4GA 3AH7A 4EEWA 2JZZA 2W3SA 3HK0A 4LJOB 2LHDA 1V86A 2IO0B 4MDKE 3PRPB 1AWDA 1UZXB 3NS8A 1VR9A 3VH4B 3H9DA 2IO1B 1M94A 1I4HA 2E6XA 2DZJA 4YT0B 4MGYE 2FCSA 1VCBA 1WM3A 3CSFA 2J0JA 3UINB 1D5MC 2WYQA 4KGSA 2CHWA 4EZKA 3GP7A 4JX1C 1YN4A 2RSUA 1TT5B 1WFYA 4B0MA 3OAWA 1ZPSA 1XQQA 1ZP0B 2NVUI 2IGHA 1T0QC 4YTMB 1N60A 3DVNU 1C4CA 2KDMA 1SGHA 2KX0A 3AV8A 3AE1B 4P1BC 1MHHE 2JYTA 4RCOA 4KKJA 3T3NA 3AI5A 3IBEA 4PS3A 4FJZA 2PVOD 3W5UB 4RF1A 4NZLB 2FNJB 2V3NA 1UELA 2K0PA 5G5GA 1TS2A 1C76A 1YQ3B 3ZW3A 2PW9A 4MJSA 3M3JA 3RUIB 4E74A 3H6NA 3LJ3A 2KTRA 2KWVB 2ZCCA 4RFBA 1FXTB 4ZRJA 2IY1B 2BTEA 3UGBB 1QQRA 2Z8LA 1NDDA 2JF5A 4HEA1 4XWTA
chains in the Genus database with same CATH topology
3RULA 1V49A 4IWQA 1GJZA 4ICVA 5DCNA 1UBQA 4W9CA 2MW5A 4ZRKA 2KANA 4IM3A 4IWPA 3TMPB 1ZKHA 4MEMA 3B08A 2O6VA 2ZNVC 3WALA 2FCQA 4MELA 2K25A 3L16A 1IYFA 2KFJA 4ASWC 3ZNZB 2ZEQA 2KC1A 4FLHA 2EMSA 3R7QA 2C5LC 3W1YA 1Y8RC 1XT9B 1L7YA 2VRRB 3S2AA 2WWZA 3DBRI 3H7PB 2MLBA 5JZEB 1KOTA 2JT4B 2KJ6A 3BY4B 2ZPNA 4G11A 4W9GA 4FHJA 1ZW7A 4IG7B 1YJ1A 2MBHA 1E8ZA 2LGDA 3N3KB 2D2QA 3KUCB 5KHOA 2FCNA 2KXJA 1H8CA 3A33B 1A5RA 1Q5WB 2KHWB 4WWPA 1E7VA 2NR2A 1P1AA 2FIDA 4WJPA 3APFA 4KZCA 2J0KA 2K39A 2V4LA 2B3AA 3H1UA 3DBHI 3QC8B 3VH3B 4LJPB 3X23A 4BKGA 1VD2A 1E7UA 2KDBA 3VVWB 3ML8A 3UQAA 3PSEB 4FJYA 1Z2MA 3MHSD 4PS8A 3W1SA 3DQVA 4I6NB 5AEKB 3QK0A 1YD8U 2IYDB 5LLIA 3A9JB 2FAZA 5DPRA 2MSED 2Z0EB 5EDSA 4FJVB 3Q3JA 5G2NA 3TJPA 3IHPC 1J19A 3V62A 3ZIMA 1GNUA 2BKFA 4KSLC 3ZDMC 3CMMB 5JHAA 2CHXA 3RCZA 1E8YA 1WMHB 3H7PA 4OVUA 4RM8A 2KDIA 5LXHA 4KV2A 4WQOB 1WI0A 1S3SG 2BWFA 2DHZA 2PEAA 3VHTC 2DAJA 3A4RA 3KUZA 3TIXA 2LXCA 1SIFA 2V1YA 2I1JA 3PV1A 5C23A 4KVGB 2O2VA 2WX1A 4B95A 4FULA 1NBFC 4BKTA 3PHXB 4B9KA 1WM2A 3DDCB 3QIJA 3RD2A 4PS7A 1PQSA 3QHTA 1AARA 4BKSD 3NY5A 4OVVA 3RZWC 3VXWA 4E3CA 1I42A 4NAWA 2LGYA 2BGFA 1G6JA 2DZMA 5L95C 1RAXA 5GMVA 4KIKB 2JRIB 2OOBB 2G4DB 1WXAA 3GOEA 1GC6A 3MTNB 1ISNA 3VTUA 2DAFA 3O65B 2NBWB 5DPSA 5AZFA 3ZRFA 3A9JA 1LXDA 4AJWA 1KLVA 1NI2A 2M4NA 3A9KA 3DVGY 2JPHA 2Z0DB 3TCAA 4WJNA 3CF6E 4IWOA 3N32A 2LGXA 4N9F4 3PHWB 3QAQA 1UD7A 2XBBC 3VTWA 1V9JA 1WMHA 2LUEA 4RM9A 3JW0X 3DVGX 2KTFA 2BYFA 1J0GA 1J8CA 3EFUA 3UIOB 5J17A 3M95A 3KYCD 2EMTA 4I6LB 4DWFA 4DK5A 3U30A 5D6JB 2K1FA 2ZJDA 4GXBA 2M17A 4J6IA 4HPMB 2RPQA 4MGKE 3VUXA 2REXA 3ZTDA 5CX3A 2M0XA 2BYEA 4M0WB 2KN5A 1MG8A 2KJHB 2CHZA 2AL6A 3NZSA 1WJUA 4HVBA 4BBNF 3PVLA 2CR5A 2K8CA 2C7MB 1E8WA 2M8SA 2ZPYA 4WAAA 2MA9B 3W1SC 1E90A 4DDID 3ZVVA 2N1VA 4MSMB 2CKHB 2KDFB 2KX3A 2LVPA 4GGQA 2FUHB 1S1QB 2KD0A 3HM6X 2KMCA 4TV3A 1V81A 1WZ3A 4FA6A 1D3ZA 2JWZA 3SU8X 2MBQA 2KFKB 2ZVNA 3DPDA 4ICUA 2DZKA 1WJNA 1CMXB 2D11A 2MQJA 3UIPB 5L83A 4XX5A 1TZ1A 2NBUA 1R4NI 3HM3A 2JUOA 1WGRA 1GC7A 2Z59B 3L17A 1YIWA 3M62B 2BKRB 2N1WA 1BT0A 2XEWA 4GB9A 5BO4B 2D10A 2N9XA 2KQSA 4AOFA 2ZVOA 1LM8B 2G3QB 4XC2A 4WWNA 3L10B 4LDTB 2NBVB 1P98A 1X1MA 3QQ8B 2LJ5A 1WX7A 2BYVE 2ZNVB 2C60A 4B6WA 1YX6B 4DDGD 2LRWA 2KOXA 4K81A 3JYUA 3A4SC 4M8MA 4W9IA 4K7WA 1EO6A 2GBRA 3K9PB 4MM3A 2RD0A 1L2NA 1OEYA 4NPNA 2RR9A 2LZ6A 2AWTA 2GOWA 3IG3A 4GDLA 4HPLB 4FN2A 2KC2A 2KWCA 4LCDE 1XD3B 2KFKA 4GN1A 2WX0A 2XK5B 4XZ4A 3VFKA 5DPWA 4KSKC 2KLCA 3UQBA 4KZ0A 3PGEA 4TQ0A 3APDA 1C3TA 5D2MB 1TBEA 1TGZB 2NS5A 4AUQC 4CO7A 2FCMA 4A3PA 4MH0E 4TQ1A 2JXXA 4KDLB 1WH3A 1Z5SB 2OJRA 2NPTB 3PRMB 2ZCBA 5J18A 1JRUA 2N9PC 1RRBA 1E5WA 3RT3B 1T0YA 2N7DA 3VAWA 2O2VB 1RFAA 4A3OA 3R7RA 2DYMA 2K6DB 3MJWA 3R66C 4EZJA 2KZRA 2O6VD 2L05A 3A1QA 4A20A 3SD5A 2CU1A 1WF9A 1RLFA 1P3QU 2LXAA 3QWZB 3V60A 1WR1A 2KNBA 1IPGA 2M1MA 4JLCA 4KIKA 2N7EA 4DXAB 2HTHA 1WX8A 4CYEA 3WAMA 5D94A 3ZLZA 4IW0A 4BVUC 5CTRC 3ZNHB 2GBJA 4F1SA 3ZUNA 4WWOA 4GDLB 4GIVA 3DVNV 2DYOA 2JRHA 2MWSB 4HDOA 1WGHA 2C7NB 2MRPA 3PLUA 4K7UA 3V61A 4HLEA 2L76A 2PJHA 2LD9A 3WAPA 2MP2A 1ZGUB 1V6EA 2QHOA 4TUUA 4BOSC 3BINA 3IVFA 3DOWA 2JZ3B 5J2RA 1WX9A 4NQKE 1E8XA 1U4AA 2LVQA 2LRUA 4ZYNA 2IY0B 2ASQA 3RZFA 2EKEC 2NPTA 2L8JA 2LASA 3QA8A 5E6NA 3OJ4B 5CHVC 4IM0A 1Q1OA 3D32A 3CSTA 1LQBA 2IBIB 1Q0WB 4AJYB 4F8CB 3QCAA 1OEYJ 3V6EB 2A4ZA 4AWJA 1WIAA 2KK8A 3ECIA 3JSVA 4NNJB 5CHWA 4W9EA 4DHZB 3APCA 3NZUA 3L0WB 3ML9A 1SE9A 3VUYA 1KJTA 3EC8A 3NOBA 2BWES 4GDKB 1YQBA 2PPHA 2A5UA 2R2OA 5G55A 2RGFA 4ANXA 4RMAA 3B0AA 3QJZA 1WE7A 1EF5A 3EHVA 3R3MA 4IM2A 4G50A 2N4FA 1H4RA 1R4MI 2KQ7A 2MBEA 3PPAA 3T8MA 3U8ZA 1EF1A 4PYUA 4GMVA 4BOZB 1YX5B 4EFOA 3N30A 4HK2A 3OJ3A 1WGGA 5IAAC 4BFRA 2YVCA 1GG3A 4G3XB 4HCNB 1WXMA 3H7SA 1K8RB 2K8BA 2UWQA 3DBSA 2WDTB 4URKA 2BF8B 2LI5A 1KM7A 1WGDA 2IZVB 3HHMA 4ZRIA 3U7DA 4EKUA 2CS4A 4DBGA 2LVOA 1WJ6A 1WR6E 3PRZA 3JSVB 3TBLD 4JQWC 3ZNGC 3WIMA 1UBIA 5KHQA 1OGWA 1V5TA 4M8NA 4P7IA 2MBOA 4WJQA 4HCPB 1WXVA 2L0TA 1I35A 2GBKA 4NJ7A 1WJ4A 3ALBA 4GDKA 5TR5A 4ANVA 4ZDVA 5E6OA 4JL9A 4EOYA 1WYWB 1V80A 2DENB 4II3B 4NY0A 4GSWA 2JY6A 4FBJB 3B1LX 4I6PA 3I3TB 2HD5B 4W9KA 2XK5A 2AYOB 1WY8A 3DCGA 2DX5B 3AU5A 2GMIC 2NCNA 5AZGA 2W9NA 2KMAA 2J0MA 4X57B 4IUMB 3SDLC 2MCNB 4G0NB 3T9LA 4TKNA 1UH6A 2O6VB 3LDZE 3PREA 2L7RA 4MGZE 1WRDB 3AXCA 2HJ8A 4CHKA 4EEWA 4GU2A 2JZZA 4W9HA 1OTRB 1TTNA 3VQIA 3HK0A 4LJOB 4NJ6A 4ANWA 1OQYA 2C9WB 3ZDTA 3VTVA 3A1QB 1V86A 2IO0B 3VUWA 4EZLA 4EUTA 3AU4A 3ZRCA 3PT2B 4MDKE 3PRPB 1UZXB 5JH5C 3NS8A 3PTFC 3H9DA 3VH4B 2IO1B 2L3ZA 3PS6A 4IC7B 2GBMA 4DHJB 1M94A 3RYTA 3L54A 3WANA 2DZJA 2ZZPB 4MGYE 4FHKA 1LFDA 2FCSA 2G45B 4W9JA 1VCBA 1WM3A 3CSFA 4W9LA 3NHEB 3WA0A 4II2B 3EECA 2MP2B 2KJRA 2L0FA 2J0JA 3UINB 3QARA 2WYQA 4AP4C 3KH0A 3OLMD 3GZNI 3VDZA 2CHWA 2IO2B 2J7QB 4YL8A 4EZKA 2HE7A 1IP9A 2RSUA 1C1YB 5E6PA 1WFYA 2Y5BB 3OAWA 1XQQA 2DYBA 3ENEA 3KVFB 2NVUI 4F7ZA 4MJSB 3IFWB 1HE8A 5AZHA 3ZKJC 3KW5B 3DBLI 3DVNU 3C0RB 4MSQB 4W9FA 2G4SA 5FR6A 3HIZA 4HJKA 4HDQA 1SGHA 4W9DA 2K6QA 2KTRB 3K9OB 2KX0A 2MX2A 2KDEB 3AULA 2K8HA 1GUAB 2AL3A 1V2YA 3V6CB 2JVCA 4K7SA 3L13A 4KDIC 2KO3A 2GBNA 1V5OA 2KKCA 4PYZA 5HKHA 2R2QA 2MBBB 3AI5A 3IBEA 4MGIE 5C1ZA 4LDTD 2D07B 3L08A 1UGMA 3M63B 3PZDA 1P9DU 4PS3A 3ZO5B 4FJZA 4JGHB 4NAWB 4HXDA 4JIOU 1P0RA 1WXSA 2C7HA 4E71A 3PLVA 3Q3FA 4GOCA 2V3SA 2FNJB 2N9EB 1UELA 2AEHA 3X0WA 2PE9A 3KYDD 3WAOA 3A9KB 3ZW3A 2IO3B 2LWPA 4FADA 1WE6A 1EUVB 5CHFA 4MJSA 3ZTCA 3M3JA 3JVZX 3P2BA 3UF8A 2KLGA 3SHQA 4DHJD 2I1KA 2UYZB 3TL5A 2BPSA 3RUIB 4E74A 5IA7A 4WJOA 3H6NA 3ZNID 3LJ3A 2KVRA 2KTRA 5DPTA 1WGYA 2FIFA 2KWVB 3QX1A 4NQLB 2D3GA 2ZCCA 2PE6B 5LXIB 1FXTB 3ONSA 4ZRJA 3KUDB 4K1RB 2IY1B 5D7GA 4DHZE 4ANUA 3UGBB 1NDDA 2L00B 5JHBA 2JF5A 2DZIA 1F9JA 1QZEA 4BBNC 4HWIB 1WZ0A 4BKSA 2KWUB 2YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RUL A;  1V49 A;  4IWQ A;  1GJZ A;  4ICV A;  5DCN A;  1UBQ A;  4W9C A;  2MW5 A;  4ZRK A;  2KAN A;  4IM3 A;  4IWP A;  3TMP B;  1ZKH A;  4MEM A;  3B08 A;  2O6V A;  2ZNV C;  3WAL A;  2FCQ A;  4MEL A;  2K25 A;  3L16 A;  1IYF A;  2KFJ A;  4ASW C;  3ZNZ B;  2ZEQ A;  2KC1 A;  4FLH A;  2EMS A;  3R7Q A;  2C5L C;  3W1Y A;  1Y8R C;  1XT9 B;  1L7Y A;  2VRR B;  3S2A A;  2WWZ A;  3DBR I;  3H7P B;  2MLB A;  5JZE B;  1KOT A;  2JT4 B;  2KJ6 A;  3BY4 B;  2ZPN A;  4G11 A;  4W9G A;  4FHJ A;  1ZW7 A;  4IG7 B;  1YJ1 A;  2MBH A;  1E8Z A;  2LGD A;  3N3K B;  2D2Q A;  3KUC B;  5KHO A;  2FCN A;  2KXJ A;  1H8C A;  3A33 B;  1A5R A;  1Q5W B;  2KHW B;  4WWP A;  1E7V A;  2NR2 A;  1P1A A;  2FID A;  4WJP A;  3APF A;  4KZC A;  2J0K A;  2K39 A;  2V4L A;  2B3A A;  3H1U A;  3DBH I;  3QC8 B;  3VH3 B;  4LJP B;  3X23 A;  4BKG A;  1VD2 A;  1E7U A;  2KDB A;  3VVW B;  3ML8 A;  3UQA A;  3PSE B;  4FJY A;  1Z2M A;  3MHS D;  4PS8 A;  3W1S A;  3DQV A;  4I6N B;  5AEK B;  3QK0 A;  1YD8 U;  2IYD B;  5LLI A;  3A9J B;  2FAZ A;  5DPR A;  2MSE D;  2Z0E B;  5EDS A;  4FJV B;  3Q3J A;  5G2N A;  3TJP A;  3IHP C;  1J19 A;  3V62 A;  3ZIM A;  1GNU A;  2BKF A;  4KSL C;  3ZDM C;  3CMM B;  5JHA A;  2CHX A;  3RCZ A;  1E8Y A;  1WMH B;  3H7P A;  4OVU A;  4RM8 A;  2KDI A;  5LXH A;  4KV2 A;  4WQO B;  1WI0 A;  1S3S G;  2BWF A;  2DHZ A;  2PEA A;  3VHT C;  2DAJ A;  3A4R A;  3KUZ A;  3TIX A;  2LXC A;  1SIF A;  2V1Y A;  2I1J A;  3PV1 A;  5C23 A;  4KVG B;  2O2V A;  2WX1 A;  4B95 A;  4FUL A;  1NBF C;  4BKT A;  3PHX B;  4B9K A;  1WM2 A;  3DDC B;  3QIJ A;  3RD2 A;  4PS7 A;  1PQS A;  3QHT A;  1AAR A;  4BKS D;  3NY5 A;  4OVV A;  3RZW C;  3VXW A;  4E3C A;  1I42 A;  4NAW A;  2LGY A;  2BGF A;  1G6J A;  2DZM A;  5L95 C;  1RAX A;  5GMV A;  4KIK B;  2JRI B;  2OOB B;  2G4D B;  1WXA A;  3GOE A;  1GC6 A;  3MTN B;  1ISN A;  3VTU A;  2DAF A;  3O65 B;  2NBW B;  5DPS A;  5AZF A;  3ZRF A;  3A9J A;  1LXD A;  4AJW A;  1KLV A;  1NI2 A;  2M4N A;  3A9K A;  3DVG Y;  2JPH A;  2Z0D B;  3TCA A;  4WJN A;  3CF6 E;  4IWO A;  3N32 A;  2LGX A;  4N9F 4;  3PHW B;  3QAQ A;  1UD7 A;  2XBB C;  3VTW A;  1V9J A;  1WMH A;  2LUE A;  4RM9 A;  3JW0 X;  3DVG X;  2KTF A;  2BYF A;  1J0G A;  1J8C A;  3EFU A;  3UIO B;  5J17 A;  3M95 A;  3KYC D;  2EMT A;  4I6L B;  4DWF A;  4DK5 A;  3U30 A;  5D6J B;  2K1F A;  2ZJD A;  4GXB A;  2M17 A;  4J6I A;  4HPM B;  2RPQ A;  4MGK E;  3VUX A;  2REX A;  3ZTD A;  5CX3 A;  2M0X A;  2BYE A;  4M0W B;  2KN5 A;  1MG8 A;  2KJH B;  2CHZ A;  2AL6 A;  3NZS A;  1WJU A;  4HVB A;  4BBN F;  3PVL A;  2CR5 A;  2K8C A;  2C7M B;  1E8W A;  2M8S A;  2ZPY A;  4WAA A;  2MA9 B;  3W1S C;  1E90 A;  4DDI D;  3ZVV A;  2N1V A;  4MSM B;  2CKH B;  2KDF B;  2KX3 A;  2LVP A;  4GGQ A;  2FUH B;  1S1Q B;  2KD0 A;  3HM6 X;  2KMC A;  4TV3 A;  1V81 A;  1WZ3 A;  4FA6 A;  1D3Z A;  2JWZ A;  3SU8 X;  2MBQ A;  2KFK B;  2ZVN A;  3DPD A;  4ICU A;  2DZK A;  1WJN A;  1CMX B;  2D11 A;  2MQJ A;  3UIP B;  5L83 A;  4XX5 A;  1TZ1 A;  2NBU A;  1R4N I;  3HM3 A;  2JUO A;  1WGR A;  1GC7 A;  2Z59 B;  3L17 A;  1YIW A;  3M62 B;  2BKR B;  2N1W A;  1BT0 A;  2XEW A;  4GB9 A;  5BO4 B;  2D10 A;  2N9X A;  2KQS A;  4AOF A;  2ZVO A;  1LM8 B;  2G3Q B;  4XC2 A;  4WWN A;  3L10 B;  4LDT B;  2NBV B;  1P98 A;  1X1M A;  3QQ8 B;  2LJ5 A;  1WX7 A;  2BYV E;  2ZNV B;  2C60 A;  4B6W A;  1YX6 B;  4DDG D;  2LRW A;  2KOX A;  4K81 A;  3JYU A;  3A4S C;  4M8M A;  4W9I A;  4K7W A;  1EO6 A;  2GBR A;  3K9P B;  4MM3 A;  2RD0 A;  1L2N A;  1OEY A;  4NPN A;  2RR9 A;  2LZ6 A;  2AWT A;  2GOW A;  3IG3 A;  4GDL A;  4HPL B;  4FN2 A;  2KC2 A;  2KWC A;  4LCD E;  1XD3 B;  2KFK A;  4GN1 A;  2WX0 A;  2XK5 B;  4XZ4 A;  3VFK A;  5DPW A;  4KSK C;  2KLC A;  3UQB A;  4KZ0 A;  3PGE A;  4TQ0 A;  3APD A;  1C3T A;  5D2M B;  1TBE A;  1TGZ B;  2NS5 A;  4AUQ C;  4CO7 A;  2FCM A;  4A3P A;  4MH0 E;  4TQ1 A;  2JXX A;  4KDL B;  1WH3 A;  1Z5S B;  2OJR A;  2NPT B;  3PRM B;  2ZCB A;  5J18 A;  1JRU A;  2N9P C;  1RRB A;  1E5W A;  3RT3 B;  1T0Y A;  2N7D A;  3VAW A;  2O2V B;  1RFA A;  4A3O A;  3R7R A;  2DYM A;  2K6D B;  3MJW A;  3R66 C;  4EZJ A;  2KZR A;  2O6V D;  2L05 A;  3A1Q A;  4A20 A;  3SD5 A;  2CU1 A;  1WF9 A;  1RLF A;  1P3Q U;  2LXA A;  3QWZ B;  3V60 A;  1WR1 A;  2KNB A;  1IPG A;  2M1M A;  4JLC A;  4KIK A;  2N7E A;  4DXA B;  2HTH A;  1WX8 A;  4CYE A;  3WAM A;  5D94 A;  3ZLZ A;  4IW0 A;  4BVU C;  5CTR C;  3ZNH B;  2GBJ A;  4F1S A;  3ZUN A;  4WWO A;  4GDL B;  4GIV A;  3DVN V;  2DYO A;  2JRH A;  2MWS B;  4HDO A;  1WGH A;  2C7N B;  2MRP A;  3PLU A;  4K7U A;  3V61 A;  4HLE A;  2L76 A;  2PJH A;  2LD9 A;  3WAP A;  2MP2 A;  1ZGU B;  1V6E A;  2QHO A;  4TUU A;  4BOS C;  3BIN A;  3IVF A;  3DOW A;  2JZ3 B;  5J2R A;  1WX9 A;  4NQK E;  1E8X A;  1U4A A;  2LVQ A;  2LRU A;  4ZYN A;  2IY0 B;  2ASQ A;  3RZF A;  2EKE C;  2NPT A;  2L8J A;  2LAS A;  3QA8 A;  5E6N A;  3OJ4 B;  5CHV C;  4IM0 A;  1Q1O A;  3D32 A;  3CST A;  1LQB A;  2IBI B;  1Q0W B;  4AJY B;  4F8C B;  3QCA A;  1OEY J;  3V6E B;  2A4Z A;  4AWJ A;  1WIA A;  2KK8 A;  3ECI A;  3JSV A;  4NNJ B;  5CHW A;  4W9E A;  4DHZ B;  3APC A;  3NZU A;  3L0W B;  3ML9 A;  1SE9 A;  3VUY A;  1KJT A;  3EC8 A;  3NOB A;  2BWE S;  4GDK B;  1YQB A;  2PPH A;  2A5U A;  2R2O A;  5G55 A;  2RGF A;  4ANX A;  4RMA A;  3B0A A;  3QJZ A;  1WE7 A;  1EF5 A;  3EHV A;  3R3M A;  4IM2 A;  4G50 A;  2N4F A;  1H4R A;  1R4M I;  2KQ7 A;  2MBE A;  3PPA A;  3T8M A;  3U8Z A;  1EF1 A;  4PYU A;  4GMV A;  4BOZ B;  1YX5 B;  4EFO A;  3N30 A;  4HK2 A;  3OJ3 A;  1WGG A;  5IAA C;  4BFR A;  2YVC A;  1GG3 A;  4G3X B;  4HCN B;  1WXM A;  3H7S A;  1K8R B;  2K8B A;  2UWQ A;  3DBS A;  2WDT B;  4URK A;  2BF8 B;  2LI5 A;  1KM7 A;  1WGD A;  2IZV B;  3HHM A;  4ZRI A;  3U7D A;  4EKU A;  2CS4 A;  4DBG A;  2LVO A;  1WJ6 A;  1WR6 E;  3PRZ A;  3JSV B;  3TBL D;  4JQW C;  3ZNG C;  3WIM A;  1UBI A;  5KHQ A;  1OGW A;  1V5T A;  4M8N A;  4P7I A;  2MBO A;  4WJQ A;  4HCP B;  1WXV A;  2L0T A;  1I35 A;  2GBK A;  4NJ7 A;  1WJ4 A;  3ALB A;  4GDK A;  5TR5 A;  4ANV A;  4ZDV A;  5E6O A;  4JL9 A;  4EOY A;  1WYW B;  1V80 A;  2DEN B;  4II3 B;  4NY0 A;  4GSW A;  2JY6 A;  4FBJ B;  3B1L X;  4I6P A;  3I3T B;  2HD5 B;  4W9K A;  2XK5 A;  2AYO B;  1WY8 A;  3DCG A;  2DX5 B;  3AU5 A;  2GMI C;  2NCN A;  5AZG A;  2W9N A;  2KMA A;  2J0M A;  4X57 B;  4IUM B;  3SDL C;  2MCN B;  4G0N B;  3T9L A;  4TKN A;  1UH6 A;  2O6V B;  3LDZ E;  3PRE A;  2L7R A;  4MGZ E;  1WRD B;  3AXC A;  2HJ8 A;  4CHK A;  4EEW A;  4GU2 A;  2JZZ A;  4W9H A;  1OTR B;  1TTN A;  3VQI A;  3HK0 A;  4LJO B;  4NJ6 A;  4ANW A;  1OQY A;  2C9W B;  3ZDT A;  3VTV A;  3A1Q B;  1V86 A;  2IO0 B;  3VUW A;  4EZL A;  4EUT A;  3AU4 A;  3ZRC A;  3PT2 B;  4MDK E;  3PRP B;  1UZX B;  5JH5 C;  3NS8 A;  3PTF C;  3H9D A;  3VH4 B;  2IO1 B;  2L3Z A;  3PS6 A;  4IC7 B;  2GBM A;  4DHJ B;  1M94 A;  3RYT A;  3L54 A;  3WAN A;  2DZJ A;  2ZZP B;  4MGY E;  4FHK A;  1LFD A;  2FCS A;  2G45 B;  4W9J A;  1VCB A;  1WM3 A;  3CSF A;  4W9L A;  3NHE B;  3WA0 A;  4II2 B;  3EEC A;  2MP2 B;  2KJR A;  2L0F A;  2J0J A;  3UIN B;  3QAR A;  2WYQ A;  4AP4 C;  3KH0 A;  3OLM D;  3GZN I;  3VDZ A;  2CHW A;  2IO2 B;  2J7Q B;  4YL8 A;  4EZK A;  2HE7 A;  1IP9 A;  2RSU A;  1C1Y B;  5E6P A;  1WFY A;  2Y5B B;  3OAW A;  1XQQ A;  2DYB A;  3ENE A;  3KVF B;  2NVU I;  4F7Z A;  4MJS B;  3IFW B;  1HE8 A;  5AZH A;  3ZKJ C;  3KW5 B;  3DBL I;  3DVN U;  3C0R B;  4MSQ B;  4W9F A;  2G4S A;  5FR6 A;  3HIZ A;  4HJK A;  4HDQ A;  1SGH A;  4W9D A;  2K6Q A;  2KTR B;  3K9O B;  2KX0 A;  2MX2 A;  2KDE B;  3AUL A;  2K8H A;  1GUA B;  2AL3 A;  1V2Y A;  3V6C B;  2JVC A;  4K7S A;  3L13 A;  4KDI C;  2KO3 A;  2GBN A;  1V5O A;  2KKC A;  4PYZ A;  5HKH A;  2R2Q A;  2MBB B;  3AI5 A;  3IBE A;  4MGI E;  5C1Z A;  4LDT D;  2D07 B;  3L08 A;  1UGM A;  3M63 B;  3PZD A;  1P9D U;  4PS3 A;  3ZO5 B;  4FJZ A;  4JGH B;  4NAW B;  4HXD A;  4JIO U;  1P0R A;  1WXS A;  2C7H A;  4E71 A;  3PLV A;  3Q3F A;  4GOC A;  2V3S A;  2FNJ B;  2N9E B;  1UEL A;  2AEH A;  3X0W A;  2PE9 A;  3KYD D;  3WAO A;  3A9K B;  3ZW3 A;  2IO3 B;  2LWP A;  4FAD A;  1WE6 A;  1EUV B;  5CHF A;  4MJS A;  3ZTC A;  3M3J A;  3JVZ X;  3P2B A;  3UF8 A;  2KLG A;  3SHQ A;  4DHJ D;  2I1K A;  2UYZ B;  3TL5 A;  2BPS A;  3RUI B;  4E74 A;  5IA7 A;  4WJO A;  3H6N A;  3ZNI D;  3LJ3 A;  2KVR A;  2KTR A;  5DPT A;  1WGY A;  2FIF A;  2KWV B;  3QX1 A;  4NQL B;  2D3G A;  2ZCC A;  2PE6 B;  5LXI B;  1FXT B;  3ONS A;  4ZRJ A;  3KUD B;  4K1R B;  2IY1 B;  5D7G A;  4DHZ E;  4ANU A;  3UGB B;  1NDD A;  2L00 B;  5JHB A;  2JF5 A;  2DZI A;  1F9J A;  1QZE A;  4BBN C;  4HWI B;  1WZ0 A;  4BKS A;  2KWU B;  2YLM A; 
#chains in the Genus database with same CATH topology
 5DCN A;  5BYQ A;  1ZKH A;  4MEM A;  5BYS A;  3WAL A;  2FCQ A;  4MEL A;  2RMM A;  1IYF A;  2KFJ A;  3DWM A;  1Y8R C;  2H89 B;  4S0R A;  3DBR I;  2QJL A;  2KJ6 A;  4ZHO A;  3ZXV A;  4FHJ A;  1ZW7 A;  3KQ4 A;  2Q5W D;  2L32 A;  1E8Z A;  1FXI A;  1NI3 A;  1E10 A;  1MI0 A;  1A5R A;  1Q5W B;  3HVD A;  1JCK B;  1TY0 A;  4KZC A;  2V4L A;  2B3A A;  2HDE A;  3VH3 B;  1VD2 A;  3VVW B;  2N9L A;  1RWS A;  3DQV A;  1SJE D;  2IYD B;  1IBX B;  5LLI A;  2EEL A;  2Z0E B;  3ZIM A;  1KLU D;  1QKZ A;  1J19 A;  3V62 A;  2V9H A;  2QSD A;  1GNU A;  2BKF A;  3AE2 B;  3HVZ A;  1XCQ L;  1SE3 A;  3H7P A;  1WMH B;  3Q8C A;  1DOI A;  1EU4 A;  4RM8 A;  2VZK B;  4KV2 A;  2BWF A;  3VHT C;  3RNB C;  3A4R A;  3KUZ A;  4US8 A;  2V1Y A;  4P6V F;  4KVG B;  5HI1 A;  4B9K A;  3QIJ A;  2OHF A;  2WXR A;  1GAQ B;  3VXW A;  3P1M A;  1FNU A;  2K9X A;  1I42 A;  1XLO A;  4QAY A;  2JRI B;  3U2S C;  3HRD D;  1HTO A;  3VTU A;  2NBW B;  1ET6 A;  5DPS A;  3ZRF A;  1LXD A;  3A9K A;  3AED B;  1QOG A;  3AM9 A;  3QAQ A;  1UD7 A;  4RM9 A;  1QLB B;  1HQR D;  3GS2 A;  2EMT A;  4I6L B;  4UDU C;  1BUI C;  1SEB D;  4HPM B;  1V97 A;  2RPQ A;  3WCQ A;  3ZTD A;  2KN5 A;  1T5X D;  2CHZ A;  2AL6 A;  5L83 A;  4HVB A;  1E8W A;  2M8S A;  1WGK A;  3W1S C;  1I4X A;  3R2T A;  2H88 B;  1K50 A;  2LVP A;  2QIE B;  5LNK 1;  1N6Z A;  1WJN A;  1CMX B;  2D11 A;  4XX5 A;  1UWX A;  1E7P B;  2NBU A;  3HM3 A;  1ACC A;  1UUP A;  2K3U A;  3LB8 C;  1YJI A;  2BKR B;  1FD6 A;  1ESF A;  1BT0 A;  1V8C A;  2D10 A;  1F52 A;  1VLB A;  4AOF A;  4YSX B;  3QQ8 B;  5BMG A;  3AE8 B;  4DDG D;  4DXG A;  4ACF A;  2KT7 A;  2RDH A;  2RD0 A;  1OEY A;  4AQ7 A;  3V05 A;  2GOW A;  4HPL B;  3I5J C;  1STE A;  4LCD E;  4XZ4 A;  1JML A;  3VFK A;  1UF0 A;  2KLC A;  1B1Z A;  1TGZ B;  4AUQ C;  3RNC C;  2FCM A;  5E6J A;  4MH0 E;  1WH3 A;  1Z5S B;  2OJR A;  2NPT B;  1JRU A;  1RRB A;  1T0Y A;  2N7D A;  1SBB B;  2LHE A;  4A3O A;  3R7R A;  2E3T A;  3MJW A;  3R66 C;  4HRO A;  2L05 A;  4A20 A;  4LNI A;  2KNB A;  4CYE A;  3MP9 A;  3W5V B;  3OWE B;  1JRO A;  1C4P A;  4WWO A;  2OED A;  4GIV A;  4HDO A;  3DVN V;  1I4Q A;  2MRP A;  2C7N B;  2MP2 A;  1ZGU B;  1V6E A;  2WXQ A;  2MHJ A;  4TUU A;  2JZ3 B;  2LVQ A;  4M00 A;  4ZYN A;  1TJE A;  2ASQ A;  3LYY A;  2QIL A;  1ZDX A;  3QA8 A;  2INN E;  1D6E C;  4IM0 A;  4A55 A;  1F2R C;  1Q0W B;  4AJY B;  3V6E B;  1FO4 A;  1WIA A;  4P16 A;  2KK8 A;  2K22 A;  4DHZ B;  3APC A;  1D5X C;  3HUI A;  1XO3 A;  2WXM A;  1ZXH A;  2PPH A;  2A5U A;  5G55 A;  3QJZ A;  1EF5 A;  3R3M A;  3RPF C;  3PPA A;  3U8Z A;  1YX5 B;  5IAA C;  4BFR A;  1T3Q A;  3H7S A;  2LI5 A;  1KM7 A;  5AUI A;  1WGD A;  1FM0 D;  1T6B X;  3U7D A;  3TBL D;  3P4R B;  3DBR B;  1UBI A;  1OGW A;  1GPX A;  4M8N A;  1I35 A;  2QC8 A;  3W2D A;  5HFY A;  5TR5 A;  5E6O A;  4JL9 A;  1WYW B;  2DEN B;  1JWM D;  2PIA A;  2JY6 A;  3B1L X;  2HJ1 A;  3I3T B;  4B0E A;  4W9K A;  1LGR A;  2J0M A;  4X57 B;  4YTN B;  2MCN B;  2WHI A;  3T9L A;  2O6V B;  2L7R A;  4CHK A;  4GU2 A;  4W9H A;  3EUB 2;  2C9W B;  2I2Y A;  1K53 A;  1QF6 A;  3A1Q B;  3VUW A;  4EZL A;  1TY2 A;  2WXH A;  3ZRC A;  2ACZ B;  2FE8 A;  3Q8A A;  2NTT A;  3PS6 A;  4IC7 B;  2MJD A;  3V3X A;  1UGJ A;  3RYT A;  3L54 A;  2ZZP B;  2LGI A;  2WS3 B;  3AEE B;  1F77 A;  2G45 B;  1DGJ A;  1QT9 A;  2B76 B;  3EEC A;  2MP2 B;  2L0F A;  5T8I A;  3DBH B;  3KH0 A;  3GZN I;  3VDZ A;  2J7Q B;  4YL8 A;  2HE7 A;  3ZXR A;  1E6E B;  3ZJU A;  3TEY A;  5AZH A;  1HE8 A;  4H2A A;  3ZKJ C;  4YXD B;  1TKE A;  4HJK A;  1Q10 A;  4HDQ A;  4W9D A;  4EE2 A;  2KTR B;  2KDE B;  3AE9 B;  2K8H A;  1GUA B;  3NZ3 A;  4HKQ A;  3V6C B;  2WDR B;  4KDI C;  4PYZ A;  2GBN A;  1UGM A;  3NG0 A;  4KGT A;  4NJC A;  4JGH B;  4HXD A;  1WXS A;  4E71 A;  1QIL A;  2TSS A;  3B9J A;  5D3I B;  1KLG D;  3X0W A;  2PE9 A;  2GI9 A;  1TS5 A;  3AEF B;  1WE6 A;  5CHF A;  1HTQ A;  2SEB D;  4CQN A;  3P2B A;  2KLG A;  2I1K A;  2BPS A;  5IA7 A;  1C78 A;  4IDI A;  3ZNI D;  1TS4 A;  1VZ8 A;  2D3G A;  5LXI B;  2Y3A A;  3ONS A;  4K1R B;  2R61 A;  2L00 B;  4LNF A;  3IXS A;  4BBN C;  4BKS A;  2KWU B;  2YLM A;  5C1Z A;  5EE0 A;  1IGC A;  2MW5 A;  4ZRK A;  4IM3 A;  4IWP A;  1TKG A;  3FIL B;  2D3A A;  3AN1 A;  3BK2 A;  5BMH A;  2GRI A;  4LTU A;  1L7Y A;  3S2A A;  3U52 E;  2MLB A;  1KOT A;  5EE9 A;  4K3C A;  4G11 A;  4W9G A;  2WXJ A;  2MBH A;  2LGD A;  3N3K B;  4KKI A;  2JXT A;  1FRR A;  5KHO A;  2KXJ A;  1E7V A;  1P1A A;  2DNF A;  2INC C;  2JYE A;  1F0Z A;  4LJP B;  4O1N A;  4JWS C;  4L2Y A;  3UQA A;  3ML8 A;  3PSE B;  4FJY A;  4XE0 A;  2YEP F;  4PS8 A;  3W1S A;  5AEK B;  3NVV A;  3QK0 A;  3AE7 B;  4WWM A;  5DPR A;  2CJO A;  1E8Y A;  2ON8 A;  1MG4 A;  3B2G A;  2X8X X;  1WI0 A;  2PEA A;  2JQR B;  2I1J A;  4B95 A;  3C19 A;  3MJ5 A;  1NBF C;  4BKT A;  1RFK A;  3RD2 A;  4HPP A;  4PT5 A;  3P4Q B;  1AAR A;  1N62 A;  2BS3 B;  4E3C A;  2IND C;  2I38 A;  3GOE A;  1ISN A;  1SE2 A;  2BW2 A;  5JXV A;  5AZF A;  4AJW A;  3A9J A;  2M4N A;  1JWB D;  3CF6 E;  3RNG C;  4N9F 4;  2WQY B;  5H8Y E;  1FFU A;  2BYF A;  1J8C A;  3EFU A;  1PDX A;  5D6J B;  1NYR A;  3VUX A;  2REX A;  3AE5 B;  1WYG A;  2BYE A;  4M0W B;  4BBN F;  3PVL A;  2CR5 A;  2K8C A;  1E0Z A;  2ZPY A;  1E90 A;  4DDI D;  3ZVV A;  2CKH B;  4ZHP A;  2KX3 A;  4MM3 B;  4TV3 A;  4XYC A;  1OFF A;  2ZVN A;  1CQV A;  2MQJ A;  1FNV A;  1R4N I;  1L0V B;  1NEK B;  3GZN B;  1WGR A;  4LNK A;  1GC7 A;  2Z59 B;  1VZ6 A;  3NVY A;  3URY A;  4XWW A;  3MC0 B;  1XCT L;  4P1C C;  2N9X A;  2WLB A;  2KQS A;  2ZVO A;  1LM8 B;  2G3Q B;  3AEG B;  4WWN A;  2MJE A;  1P98 A;  2LJ5 A;  2ZNV B;  4ARI A;  1VRA B;  3A4S C;  2EKI A;  2GBR A;  1N61 A;  2VH1 A;  4NPN A;  2LZ6 A;  2AWT A;  3IG3 A;  2JWU A;  2KWC A;  1ZUD 2;  3KLS X;  4TSS A;  2DBY A;  1WRI A;  3UQB A;  1QOA A;  1C3T A;  1TBE A;  4JWU C;  4A3P A;  4XDC A;  1TKY A;  4TQ1 A;  2JXX A;  4KDL B;  2ZCB A;  1ZOY B;  3VAW A;  4TMA B;  2DYM A;  4WH4 A;  4EZJ A;  2Y5P A;  2CU1 A;  1YOV B;  1WR1 A;  2D3C A;  4JLC A;  1EU3 A;  2QDF A;  4DXA B;  1JRP A;  1WX8 A;  3WAM A;  3AE6 B;  2BBC A;  3ZLZ A;  4IW0 A;  3RNA C;  4F1S A;  2GBJ A;  3Q8B A;  1JQ4 A;  4GDL B;  3V61 A;  4HLE A;  2PJH A;  3WAP A;  4MH8 A;  1IUE A;  1CK1 A;  2QHO A;  4BOS C;  3IVF A;  1L4D B;  2LRU A;  1GOZ A;  3RZF A;  2L8J A;  2WNM A;  3OJ4 B;  5CHV C;  4OZC A;  1Q1O A;  4HJG E;  1LQB A;  4F8C B;  3BVG A;  2A4Z A;  3ECI A;  4NNJ B;  3NZU A;  2KMM A;  1QOF A;  3ML9 A;  5IOI A;  1KJT A;  1P7F A;  4N6E B;  2BWE S;  1SB3 C;  1YQB A;  2LJI A;  3IAS 1;  4ANX A;  4WAF A;  3B0A A;  1WE7 A;  4IM2 A;  4XGA B;  2KYW A;  5AUK A;  3AE3 B;  1H4R A;  2KQ7 A;  2MBE A;  4EFO A;  4HK2 A;  3U7Z A;  1GG3 A;  1K8R B;  1K52 A;  1WXQ A;  2WDT B;  4URK A;  2BF8 B;  2IDY A;  3BYY B;  3UI3 A;  1QOB A;  2CS4 A;  2LVO A;  1WR6 E;  3PRZ A;  3JSV B;  4JQW C;  1KH0 A;  4C4V A;  3WIM A;  3ZJV A;  5KHQ A;  2WXK A;  4LNN A;  4ZRQ A;  1WXV A;  2K5P A;  3ALB A;  4GDK A;  2QEJ C;  2GLS A;  4IOI E;  4FBJ B;  2BT6 A;  4I6P A;  1BML C;  1V1P A;  2QMT A;  3DCG A;  2GMI C;  2NCN A;  2BB6 A;  1PGA A;  2LEK A;  4IUM B;  1C77 A;  4G0N B;  3W9C B;  4ITK A;  3PRE A;  3PZ7 A;  2WU2 B;  1OTR B;  1TTN A;  1HA5 A;  3RN9 C;  1OQY A;  3ZDT A;  4JE3 B;  3VTV A;  2WXP A;  4EUT A;  3AU4 A;  3PT2 B;  1FIQ A;  1NEN B;  3AEA B;  3PTF C;  2L3Z A;  3T3O A;  3WAN A;  3R2I A;  4W9J A;  4RH6 A;  1TS3 A;  4W9L A;  1JWA D;  4RGM A;  3NHE B;  3WA0 A;  4II2 B;  1J7C A;  3OLM D;  2KAC A;  5C3J B;  4YSY B;  2IO2 B;  3AB5 A;  2BS4 B;  1IP9 A;  1C1Y B;  3BVZ A;  1B9R A;  1J7A A;  1MHX A;  3KVF B;  4PK1 A;  4F7Z A;  3I63 C;  4MJS B;  3IFW B;  5FK9 C;  4MSQ B;  4J3O D;  5IKC M;  2G4S A;  3N1Y C;  1C79 A;  4ZRP A;  3K9O B;  3AUL A;  2AL3 A;  1TIF A;  1V2Y A;  3L13 A;  2KO3 A;  2KKC A;  1V5O A;  3ZYY X;  1C9F A;  1M4V A;  2MBB B;  4A90 A;  4RNA A;  1PYW D;  4YSZ B;  3M63 B;  3O13 A;  1P9D U;  2RDB C;  4NAW B;  2MH7 A;  4JIO U;  2C7H A;  2IPK D;  3Q3F A;  4GOC A;  2AEH A;  3Q8F A;  3KYD D;  3WAO A;  2AX5 A;  2IO3 B;  4OZB A;  3RI7 C;  2IJ0 A;  3ZTC A;  2W82 A;  3NVW A;  3E9S A;  3AEB B;  3SHQ A;  2UYZ B;  1WGY A;  5D7G A;  1WSP A;  4ANU A;  1PUT A;  3LXF A;  2ZW1 A;  3RUL A;  1V49 A;  4IWQ A;  3NJT A;  4BZA A;  1GJZ A;  1V1P B;  3DHI C;  1UBQ A;  4MAC A;  4W9C A;  3VR9 B;  3Q3O C;  2KAN A;  1YQ4 B;  2W54 A;  1FPY A;  3B08 A;  2O6V A;  3L16 A;  4ASW C;  3ZNZ B;  2ZEQ A;  2KC1 A;  4FLH A;  2EMS A;  2C5L C;  1XT9 B;  2VRR B;  2WWZ A;  3H7P B;  1MJD A;  2JT4 B;  2D3B A;  2ZPN A;  1FCC C;  4IG7 B;  5IN7 A;  1YJ1 A;  2LFI A;  1NVI D;  2D2Q A;  3MC8 A;  2V0G A;  3I9V 1;  2WXO A;  1WWT A;  2J0K A;  2K39 A;  3FAH A;  3DBH I;  1FXA A;  3X23 A;  2WXL A;  4BKG A;  1E7U A;  1Z2M A;  3MHS D;  4I6N B;  4LK0 M;  1P7E A;  3ZJT A;  3A9J B;  2FAZ A;  1D5Z C;  5EDS A;  4FJV B;  5G2N A;  3TJP A;  1EM7 A;  3CMM B;  3ZDM C;  5JHA A;  5H92 C;  2LMC A;  4FXC A;  3RCZ A;  4OVU A;  5LXH A;  1S3S G;  2DHZ A;  2MEK A;  3TIX A;  1SIF A;  5C23 A;  5TSS A;  2O2V A;  4FUL A;  3MC9 A;  1WM2 A;  3DDC B;  2DLB A;  1PQS A;  4M0W A;  3QHT A;  4BKS D;  3NY5 A;  1JAL A;  3VRA B;  3ABV B;  4NAW A;  2BGF A;  1G6J A;  5GMV A;  4N59 A;  4KIK B;  5IO9 A;  2OOB B;  1WXA A;  3MTN B;  5BYR A;  2KN4 A;  1IBX A;  3NS1 A;  1KLV A;  4USA A;  1NI2 A;  3DVG Y;  1XF5 L;  1UNS A;  2DWQ A;  2Z0D B;  3PO0 A;  4M02 A;  4IWO A;  5BMI A;  3VTW A;  3SEB A;  2J42 A;  3DVG X;  2KTF A;  1J0G A;  3UIO B;  5J17 A;  2INP E;  3U30 A;  3NRZ A;  2M17 A;  4GXB A;  4J6I A;  5CX3 A;  1MG8 A;  3FKY A;  4A6Q A;  2C7M B;  4WAA A;  2MA9 B;  2VH2 A;  1TYG B;  2N1V A;  3FIL A;  4MT5 A;  2FUH B;  1S1Q B;  2KD0 A;  2PKO A;  3MHZ A;  2G1E A;  1V81 A;  1WZ3 A;  4FA6 A;  2JWZ A;  2MBQ A;  4ICU A;  4RGN A;  1F1H A;  1TZ1 A;  3BII D;  1FEH A;  1YIW A;  1SJH D;  3KWV A;  2WDV B;  3SFD B;  2XEW A;  1VJK A;  4ZOH C;  5BO4 B;  3Q3M C;  1RM6 C;  4LDT B;  3BVM A;  4B6W A;  2C60 A;  3JYU A;  4W9I A;  4K7W A;  3Q2A C;  3VR8 B;  1YNT E;  4GDL A;  5EE3 A;  4OHJ A;  2KFK A;  2L83 A;  2WX0 A;  2XK5 B;  1GB1 A;  4KSK C;  2BB5 A;  4OVZ A;  2BQQ A;  1GB4 A;  4CO7 A;  5J18 A;  3PRM B;  2O2V B;  3FC4 A;  1ENF A;  1RFA A;  2K6D B;  5EE1 A;  3Q6B A;  3L4P A;  2KZR A;  2W55 A;  1WF9 A;  1SE4 A;  4KIK A;  2QCZ A;  3GE3 C;  2UU7 A;  3DBL B;  5CTR C;  3ZNH B;  1V1O A;  3BWU D;  4S17 A;  2DYO A;  2JRH A;  2MWS B;  1WGH A;  2L76 A;  1KFY B;  2J4X A;  4NQK E;  1E8X A;  5GXG B;  3N20 C;  3ZQ4 A;  1U4A A;  2L52 A;  2IY0 B;  4N58 A;  2SAK A;  2EKE C;  5FKA C;  4GLS C;  5E6N A;  4IKG A;  1J7B A;  3P42 A;  3D32 A;  3CST A;  1SSN A;  4AWJ A;  1OEY J;  2M0A A;  1UWM A;  2RDG A;  4NAM A;  4C4V B;  3DHH C;  3L0W B;  1SE9 A;  2PMV A;  1YMH E;  3EC8 A;  2PVG C;  4GDK B;  1ET9 A;  2AQ3 B;  2R2O A;  2RGF A;  4RMA A;  1L6V A;  3EHV A;  1C4A A;  5HG2 A;  1XEE A;  2N4F A;  3T8M A;  1LO5 D;  1EF1 A;  1L5P A;  3NVZ A;  4BOZ B;  1R4N B;  2YVC A;  4G3X B;  2UWQ A;  3DBS A;  2KQ4 X;  3ETR A;  2N9K A;  2IZV B;  1VZ7 A;  1JWU D;  3HHM A;  4LLG M;  4EKU A;  1PGX A;  4RGT A;  1JWS D;  4DBG A;  2WXN A;  1DOY A;  1V5T A;  4RF0 A;  4P7I A;  1I4P A;  2MBO A;  3TEW A;  2GBK A;  4NJ7 A;  4R3D A;  3AE4 B;  1WJ4 A;  4ANV A;  4ZDV A;  1YN5 A;  4EOY A;  1V80 A;  1MFW A;  4GSW A;  2HD5 B;  1DOX A;  2XK5 A;  1HZ5 A;  2DX5 B;  2W9N A;  1FCL A;  3SDL C;  4BAX A;  1UH6 A;  4OZA A;  4Q2J A;  4MGZ E;  3AXC A;  2HJ8 A;  3EGR A;  4AS1 A;  3VQI A;  4NJ6 A;  4ANW A;  1XLN A;  2IGD A;  4WIP A;  3TSS A;  3AMZ A;  5JH5 C;  2D5G A;  1YJJ A;  2GBM A;  4DHJ B;  1XLQ A;  3Q8E A;  4FHK A;  1LFD A;  3IAM 1;  4L23 A;  4ZYS A;  2KJR A;  3QAR A;  4AP4 C;  1CZP A;  1MPE A;  3Q3N C;  2AQ1 B;  5E6P A;  2Y5B B;  1BXT A;  1KTK A;  2DYB A;  3ENE A;  3KW5 B;  3DBL I;  4W9F A;  3C0R B;  5FR6 A;  3HIZ A;  2IGG A;  5I4D A;  2K6Q A;  1AN8 A;  2MX2 A;  2L1A A;  4D2K A;  1I4R A;  3OG5 A;  2FBW B;  2JVC A;  3TEX A;  1CJE A;  4K7S A;  4WQM A;  3GE8 C;  5HKH A;  3BK1 A;  2R2Q A;  1AW7 A;  4MGI E;  1FFV A;  4LDT D;  2D07 B;  3L08 A;  3PZD A;  3ZO5 B;  1OQR A;  1P0R A;  4A9A A;  2WXG A;  3PLV A;  4JPS A;  2V3S A;  2M56 B;  2N9E B;  1ZXI A;  2J52 A;  3A9K B;  2LWP A;  4FAD A;  5HHD G;  1EUV B;  3JVZ X;  3UF8 A;  4DHJ D;  2WDQ B;  3TL5 A;  2KVR A;  5DPT A;  2FIF A;  3QX1 A;  4NQL B;  2PE6 B;  1E9M A;  2HTM E;  1N5X A;  3KUD B;  4DHZ E;  5JHB A;  2DZI A;  1F9J A;  1QZE A;  4HWI B;  3RNE C;  1WZ0 A;  4WJO A;  2JSV X;  4ICV A;  3H8H A;  3KWL A;  3TUO A;  2WXF A;  3TMP B;  2LUM A;  3BYT B;  2BS2 B;  2ZNV C;  1T0R C;  2K25 A;  1VDV A;  3N1X C;  3R7Q A;  1A70 A;  1I7H A;  3W1Y A;  4ARC A;  1HEZ E;  1OQQ A;  2NMQ A;  5JZE B;  1T0S C;  3BY4 B;  1FMA D;  3DWG C;  2V3P A;  3KUC B;  1FNW A;  4DXF A;  2FCN A;  1H8C A;  2KAJ A;  3A33 B;  4WWP A;  2KHW B;  2NR2 A;  2FID A;  4WJP A;  3APF A;  3ZGZ A;  3H1U A;  4C80 A;  3QC8 B;  2BVC A;  2KDB A;  3AEC B;  3DHG C;  2GB1 A;  3P4S B;  1YD8 U;  3IT4 B;  2J53 A;  3CIR B;  2MSE D;  1FRD A;  3Q3J A;  3BZD B;  3IHP C;  2JZP A;  4KSL C;  1L0Y B;  2MJ3 A;  2CHX A;  2XN9 C;  2G9H D;  2KDI A;  4WQO B;  2DAJ A;  2LXC A;  3PV1 A;  3RFZ B;  2WX1 A;  4YWG G;  3PHX B;  1D4B A;  1SF0 A;  4PS7 A;  3PZ8 A;  5IP4 D;  3SR6 A;  4OVV A;  3GB1 A;  3RZW C;  4C56 C;  2LGY A;  3NUH B;  2DZM A;  5L95 C;  1RAX A;  2G4D B;  1GC6 A;  4LNO A;  1DYQ A;  2DAF A;  3O65 B;  4C7Y A;  5G5H A;  4C00 A;  2AQ2 B;  2JPH A;  1N63 A;  3TCA A;  1F2R I;  4WJN A;  4C7Z A;  3N32 A;  2LGX A;  3PHW B;  2XBB C;  1V9J A;  1WMH A;  2LUE A;  5MPO A;  3JW0 X;  3M95 A;  3KYC D;  1L6U A;  3Q69 A;  4DWF A;  4DK5 A;  2K1F A;  2ZJD A;  2N7J A;  4MGK E;  3B2F A;  2M0X A;  2KJH B;  2VZK D;  3NZS A;  1WJU A;  1R4M B;  1IGD A;  4HRS A;  4MSM B;  3TEZ A;  2KDF B;  4GGQ A;  1MVK A;  3HM6 X;  1EWC A;  2KMC A;  5C2T B;  1D3Z A;  3SU8 X;  2KFK B;  3DPD A;  2DZK A;  3N1Z C;  2M19 A;  4XDD A;  1SIJ A;  3UIP B;  2WP9 B;  2JUO A;  3L17 A;  3J9C A;  3M62 B;  2N1W A;  5D3D A;  3EFC A;  1KRH A;  4GB9 A;  3IT6 B;  4XC2 A;  1HZ6 A;  3L10 B;  2NBV B;  1X1M A;  1WX7 A;  2BYV E;  4HKZ E;  1YX6 B;  1K51 A;  2LRW A;  2KOX A;  4K81 A;  4M8M A;  1EO6 A;  4OW0 A;  3I57 A;  3K9P B;  4MM3 A;  1L2N A;  3P4P B;  3CWI A;  1YN3 A;  2RR9 A;  4FN2 A;  2KC2 A;  1N5W A;  1XD3 B;  4GN1 A;  4WUR A;  1L0X B;  2BYT A;  5DPW A;  2ZW0 A;  4KZ0 A;  1NYQ A;  3PGE A;  4TQ0 A;  3APD A;  4RGO S;  5D2M B;  5FR3 A;  2NS5 A;  4K3B A;  2V4I B;  2N9P C;  1E5W A;  3RT3 B;  3MFG A;  2FUG 1;  2ICI A;  2XNA C;  2O6V D;  3SFE B;  3A1Q A;  3SD5 A;  1XXG A;  1RLF A;  1P3Q U;  2X38 A;  2LXA A;  3QWZ B;  3V60 A;  1IPG A;  1JW9 D;  1R7S A;  2M1M A;  2N7E A;  2HTH A;  5D94 A;  3E56 A;  3RNF C;  1XLP A;  4BVU C;  3ZUN A;  1ROE A;  3PLU A;  4K7U A;  1PFD A;  1EWY C;  2LD9 A;  3N9Y C;  2JU6 X;  1Y56 A;  2CU3 A;  2ONQ A;  2PLP A;  3Q14 C;  4REZ A;  3BIN A;  3DOW A;  1ZE3 D;  1WX9 A;  5J2R A;  2NPT A;  2LAS A;  2WU5 B;  2WGS A;  2CJN A;  2IBI B;  3QCA A;  3VRB B;  3JSV A;  5CHW A;  1SXT A;  4W9E A;  3VUY A;  2WXI A;  2KWD A;  2OJW A;  2RPV A;  3NOB A;  2KVZ A;  1ZDV A;  1L4Z B;  1TZO A;  4G50 A;  3RMK C;  2W3R A;  1R4M I;  2LGS A;  4PYU A;  4GMV A;  4L1B A;  1RYJ A;  3EA6 A;  3N30 A;  3OJ3 A;  1WGG A;  3R8B A;  2Y5C A;  1WXM A;  4HCN B;  4KX6 B;  3U4E G;  2K8B A;  2NTS A;  3P63 A;  2JX5 A;  4KGR A;  4ZRI A;  1KF6 B;  4A8X C;  1WJ6 A;  3ZNG C;  4DQO C;  2YEP B;  4YTP B;  4WJQ A;  4HCP B;  2L0T A;  4M01 A;  4II3 B;  4NY0 A;  1HXY D;  2AYO B;  4US9 A;  1WY8 A;  3AU5 A;  1AYF A;  5AZG A;  2KMA A;  3C8Y A;  2PTL A;  1PGB A;  2N0S B;  4TKN A;  3LDZ E;  1WRD B;  1I4G A;  3AH7 A;  4EEW A;  2JZZ A;  2W3S A;  3HK0 A;  4LJO B;  2LHD A;  1V86 A;  2IO0 B;  4MDK E;  3PRP B;  1AWD A;  1UZX B;  3NS8 A;  1VR9 A;  3VH4 B;  3H9D A;  2IO1 B;  1M94 A;  1I4H A;  2E6X A;  2DZJ A;  4YT0 B;  4MGY E;  2FCS A;  1VCB A;  1WM3 A;  3CSF A;  2J0J A;  3UIN B;  1D5M C;  2WYQ A;  4KGS A;  2CHW A;  4EZK A;  3GP7 A;  4JX1 C;  1YN4 A;  2RSU A;  1TT5 B;  1WFY A;  4B0M A;  3OAW A;  1ZPS A;  1XQQ A;  1ZP0 B;  2NVU I;  2IGH A;  1T0Q C;  4YTM B;  1N60 A;  3DVN U;  1C4C A;  2KDM A;  1SGH A;  2KX0 A;  3AV8 A;  3AE1 B;  4P1B C;  1MHH E;  2JYT A;  4RCO A;  4KKJ A;  3T3N A;  3AI5 A;  3IBE A;  4PS3 A;  4FJZ A;  2PVO D;  3W5U B;  4RF1 A;  4NZL B;  2FNJ B;  2V3N A;  1UEL A;  2K0P A;  5G5G A;  1TS2 A;  1C76 A;  1YQ3 B;  3ZW3 A;  2PW9 A;  4MJS A;  3M3J A;  3RUI B;  4E74 A;  3H6N A;  3LJ3 A;  2KTR A;  2KWV B;  2ZCC A;  4RFB A;  1FXT B;  4ZRJ A;  2IY1 B;  2BTE A;  3UGB B;  1QQR A;  2Z8L A;  1NDD A;  2JF5 A;  4HEA 1;  4XWT A; 
#chains in the Genus database with same CATH homology
 3RUL A;  1V49 A;  4IWQ A;  1GJZ A;  4ICV A;  5DCN A;  1UBQ A;  4W9C A;  2MW5 A;  4ZRK A;  2KAN A;  4IM3 A;  4IWP A;  3TMP B;  1ZKH A;  4MEM A;  3B08 A;  2O6V A;  2ZNV C;  3WAL A;  2FCQ A;  4MEL A;  2K25 A;  3L16 A;  1IYF A;  2KFJ A;  4ASW C;  3ZNZ B;  2ZEQ A;  2KC1 A;  4FLH A;  2EMS A;  3R7Q A;  2C5L C;  3W1Y A;  1Y8R C;  1XT9 B;  1L7Y A;  2VRR B;  3S2A A;  2WWZ A;  3DBR I;  3H7P B;  2MLB A;  5JZE B;  1KOT A;  2JT4 B;  2KJ6 A;  3BY4 B;  2ZPN A;  4G11 A;  4W9G A;  4FHJ A;  1ZW7 A;  4IG7 B;  1YJ1 A;  2MBH A;  1E8Z A;  2LGD A;  3N3K B;  2D2Q A;  3KUC B;  5KHO A;  2FCN A;  2KXJ A;  1H8C A;  3A33 B;  1A5R A;  1Q5W B;  2KHW B;  4WWP A;  1E7V A;  2NR2 A;  1P1A A;  2FID A;  4WJP A;  3APF A;  4KZC A;  2J0K A;  2K39 A;  2V4L A;  2B3A A;  3H1U A;  3DBH I;  3QC8 B;  3VH3 B;  4LJP B;  3X23 A;  4BKG A;  1VD2 A;  1E7U A;  2KDB A;  3VVW B;  3ML8 A;  3UQA A;  3PSE B;  4FJY A;  1Z2M A;  3MHS D;  4PS8 A;  3W1S A;  3DQV A;  4I6N B;  5AEK B;  3QK0 A;  1YD8 U;  2IYD B;  5LLI A;  3A9J B;  2FAZ A;  5DPR A;  2MSE D;  2Z0E B;  5EDS A;  4FJV B;  3Q3J A;  5G2N A;  3TJP A;  3IHP C;  1J19 A;  3V62 A;  3ZIM A;  1GNU A;  2BKF A;  4KSL C;  3ZDM C;  3CMM B;  5JHA A;  2CHX A;  3RCZ A;  1E8Y A;  1WMH B;  3H7P A;  4OVU A;  4RM8 A;  2KDI A;  5LXH A;  4KV2 A;  4WQO B;  1WI0 A;  1S3S G;  2BWF A;  2DHZ A;  2PEA A;  3VHT C;  2DAJ A;  3A4R A;  3KUZ A;  3TIX A;  2LXC A;  1SIF A;  2V1Y A;  2I1J A;  3PV1 A;  5C23 A;  4KVG B;  2O2V A;  2WX1 A;  4B95 A;  4FUL A;  1NBF C;  4BKT A;  3PHX B;  4B9K A;  1WM2 A;  3DDC B;  3QIJ A;  3RD2 A;  4PS7 A;  1PQS A;  3QHT A;  1AAR A;  4BKS D;  3NY5 A;  4OVV A;  3RZW C;  3VXW A;  4E3C A;  1I42 A;  4NAW A;  2LGY A;  2BGF A;  1G6J A;  2DZM A;  5L95 C;  1RAX A;  5GMV A;  4KIK B;  2JRI B;  2OOB B;  2G4D B;  1WXA A;  3GOE A;  1GC6 A;  3MTN B;  1ISN A;  3VTU A;  2DAF A;  3O65 B;  2NBW B;  5DPS A;  5AZF A;  3ZRF A;  3A9J A;  1LXD A;  4AJW A;  1KLV A;  1NI2 A;  2M4N A;  3A9K A;  3DVG Y;  2JPH A;  2Z0D B;  3TCA A;  4WJN A;  3CF6 E;  4IWO A;  3N32 A;  2LGX A;  4N9F 4;  3PHW B;  3QAQ A;  1UD7 A;  2XBB C;  3VTW A;  1V9J A;  1WMH A;  2LUE A;  4RM9 A;  3JW0 X;  3DVG X;  2KTF A;  2BYF A;  1J0G A;  1J8C A;  3EFU A;  3UIO B;  5J17 A;  3M95 A;  3KYC D;  2EMT A;  4I6L B;  4DWF A;  4DK5 A;  3U30 A;  5D6J B;  2K1F A;  2ZJD A;  4GXB A;  2M17 A;  4J6I A;  4HPM B;  2RPQ A;  4MGK E;  3VUX A;  2REX A;  3ZTD A;  5CX3 A;  2M0X A;  2BYE A;  4M0W B;  2KN5 A;  1MG8 A;  2KJH B;  2CHZ A;  2AL6 A;  3NZS A;  1WJU A;  4HVB A;  4BBN F;  3PVL A;  2CR5 A;  2K8C A;  2C7M B;  1E8W A;  2M8S A;  2ZPY A;  4WAA A;  2MA9 B;  3W1S C;  1E90 A;  4DDI D;  3ZVV A;  2N1V A;  4MSM B;  2CKH B;  2KDF B;  2KX3 A;  2LVP A;  4GGQ A;  2FUH B;  1S1Q B;  2KD0 A;  3HM6 X;  2KMC A;  4TV3 A;  1V81 A;  1WZ3 A;  4FA6 A;  1D3Z A;  2JWZ A;  3SU8 X;  2MBQ A;  2KFK B;  2ZVN A;  3DPD A;  4ICU A;  2DZK A;  1WJN A;  1CMX B;  2D11 A;  2MQJ A;  3UIP B;  5L83 A;  4XX5 A;  1TZ1 A;  2NBU A;  1R4N I;  3HM3 A;  2JUO A;  1WGR A;  1GC7 A;  2Z59 B;  3L17 A;  1YIW A;  3M62 B;  2BKR B;  2N1W A;  1BT0 A;  2XEW A;  4GB9 A;  5BO4 B;  2D10 A;  2N9X A;  2KQS A;  4AOF A;  2ZVO A;  1LM8 B;  2G3Q B;  4XC2 A;  4WWN A;  3L10 B;  4LDT B;  2NBV B;  1P98 A;  1X1M A;  3QQ8 B;  2LJ5 A;  1WX7 A;  2BYV E;  2ZNV B;  2C60 A;  4B6W A;  1YX6 B;  4DDG D;  2LRW A;  2KOX A;  4K81 A;  3JYU A;  3A4S C;  4M8M A;  4W9I A;  4K7W A;  1EO6 A;  2GBR A;  3K9P B;  4MM3 A;  2RD0 A;  1L2N A;  1OEY A;  4NPN A;  2RR9 A;  2LZ6 A;  2AWT A;  2GOW A;  3IG3 A;  4GDL A;  4HPL B;  4FN2 A;  2KC2 A;  2KWC A;  4LCD E;  1XD3 B;  2KFK A;  4GN1 A;  2WX0 A;  2XK5 B;  4XZ4 A;  3VFK A;  5DPW A;  4KSK C;  2KLC A;  3UQB A;  4KZ0 A;  3PGE A;  4TQ0 A;  3APD A;  1C3T A;  5D2M B;  1TBE A;  1TGZ B;  2NS5 A;  4AUQ C;  4CO7 A;  2FCM A;  4A3P A;  4MH0 E;  4TQ1 A;  2JXX A;  4KDL B;  1WH3 A;  1Z5S B;  2OJR A;  2NPT B;  3PRM B;  2ZCB A;  5J18 A;  1JRU A;  2N9P C;  1RRB A;  1E5W A;  3RT3 B;  1T0Y A;  2N7D A;  3VAW A;  2O2V B;  1RFA A;  4A3O A;  3R7R A;  2DYM A;  2K6D B;  3MJW A;  3R66 C;  4EZJ A;  2KZR A;  2O6V D;  2L05 A;  3A1Q A;  4A20 A;  3SD5 A;  2CU1 A;  1WF9 A;  1RLF A;  1P3Q U;  2LXA A;  3QWZ B;  3V60 A;  1WR1 A;  2KNB A;  1IPG A;  2M1M A;  4JLC A;  4KIK A;  2N7E A;  4DXA B;  2HTH A;  1WX8 A;  4CYE A;  3WAM A;  5D94 A;  3ZLZ A;  4IW0 A;  4BVU C;  5CTR C;  3ZNH B;  2GBJ A;  4F1S A;  3ZUN A;  4WWO A;  4GDL B;  4GIV A;  3DVN V;  2DYO A;  2JRH A;  2MWS B;  4HDO A;  1WGH A;  2C7N B;  2MRP A;  3PLU A;  4K7U A;  3V61 A;  4HLE A;  2L76 A;  2PJH A;  2LD9 A;  3WAP A;  2MP2 A;  1ZGU B;  1V6E A;  2QHO A;  4TUU A;  4BOS C;  3BIN A;  3IVF A;  3DOW A;  2JZ3 B;  5J2R A;  1WX9 A;  4NQK E;  1E8X A;  1U4A A;  2LVQ A;  2LRU A;  4ZYN A;  2IY0 B;  2ASQ A;  3RZF A;  2EKE C;  2NPT A;  2L8J A;  2LAS A;  3QA8 A;  5E6N A;  3OJ4 B;  5CHV C;  4IM0 A;  1Q1O A;  3D32 A;  3CST A;  1LQB A;  2IBI B;  1Q0W B;  4AJY B;  4F8C B;  3QCA A;  1OEY J;  3V6E B;  2A4Z A;  4AWJ A;  1WIA A;  2KK8 A;  3ECI A;  3JSV A;  4NNJ B;  5CHW A;  4W9E A;  4DHZ B;  3APC A;  3NZU A;  3L0W B;  3ML9 A;  1SE9 A;  3VUY A;  1KJT A;  3EC8 A;  3NOB A;  2BWE S;  4GDK B;  1YQB A;  2PPH A;  2A5U A;  2R2O A;  5G55 A;  2RGF A;  4ANX A;  4RMA A;  3B0A A;  3QJZ A;  1WE7 A;  1EF5 A;  3EHV A;  3R3M A;  4IM2 A;  4G50 A;  2N4F A;  1H4R A;  1R4M I;  2KQ7 A;  2MBE A;  3PPA A;  3T8M A;  3U8Z A;  1EF1 A;  4PYU A;  4GMV A;  4BOZ B;  1YX5 B;  4EFO A;  3N30 A;  4HK2 A;  3OJ3 A;  1WGG A;  5IAA C;  4BFR A;  2YVC A;  1GG3 A;  4G3X B;  4HCN B;  1WXM A;  3H7S A;  1K8R B;  2K8B A;  2UWQ A;  3DBS A;  2WDT B;  4URK A;  2BF8 B;  2LI5 A;  1KM7 A;  1WGD A;  2IZV B;  3HHM A;  4ZRI A;  3U7D A;  4EKU A;  2CS4 A;  4DBG A;  2LVO A;  1WJ6 A;  1WR6 E;  3PRZ A;  3JSV B;  3TBL D;  4JQW C;  3ZNG C;  3WIM A;  1UBI A;  5KHQ A;  1OGW A;  1V5T A;  4M8N A;  4P7I A;  2MBO A;  4WJQ A;  4HCP B;  1WXV A;  2L0T A;  1I35 A;  2GBK A;  4NJ7 A;  1WJ4 A;  3ALB A;  4GDK A;  5TR5 A;  4ANV A;  4ZDV A;  5E6O A;  4JL9 A;  4EOY A;  1WYW B;  1V80 A;  2DEN B;  4II3 B;  4NY0 A;  4GSW A;  2JY6 A;  4FBJ B;  3B1L X;  4I6P A;  3I3T B;  2HD5 B;  4W9K A;  2XK5 A;  2AYO B;  1WY8 A;  3DCG A;  2DX5 B;  3AU5 A;  2GMI C;  2NCN A;  5AZG A;  2W9N A;  2KMA A;  2J0M A;  4X57 B;  4IUM B;  3SDL C;  2MCN B;  4G0N B;  3T9L A;  4TKN A;  1UH6 A;  2O6V B;  3LDZ E;  3PRE A;  2L7R A;  4MGZ E;  1WRD B;  3AXC A;  2HJ8 A;  4CHK A;  4EEW A;  4GU2 A;  2JZZ A;  4W9H A;  1OTR B;  1TTN A;  3VQI A;  3HK0 A;  4LJO B;  4NJ6 A;  4ANW A;  1OQY A;  2C9W B;  3ZDT A;  3VTV A;  3A1Q B;  1V86 A;  2IO0 B;  3VUW A;  4EZL A;  4EUT A;  3AU4 A;  3ZRC A;  3PT2 B;  4MDK E;  3PRP B;  1UZX B;  5JH5 C;  3NS8 A;  3PTF C;  3H9D A;  3VH4 B;  2IO1 B;  2L3Z A;  3PS6 A;  4IC7 B;  2GBM A;  4DHJ B;  1M94 A;  3RYT A;  3L54 A;  3WAN A;  2DZJ A;  2ZZP B;  4MGY E;  4FHK A;  1LFD A;  2FCS A;  2G45 B;  4W9J A;  1VCB A;  1WM3 A;  3CSF A;  4W9L A;  3NHE B;  3WA0 A;  4II2 B;  3EEC A;  2MP2 B;  2KJR A;  2L0F A;  2J0J A;  3UIN B;  3QAR A;  2WYQ A;  4AP4 C;  3KH0 A;  3OLM D;  3GZN I;  3VDZ A;  2CHW A;  2IO2 B;  2J7Q B;  4YL8 A;  4EZK A;  2HE7 A;  1IP9 A;  2RSU A;  1C1Y B;  5E6P A;  1WFY A;  2Y5B B;  3OAW A;  1XQQ A;  2DYB A;  3ENE A;  3KVF B;  2NVU I;  4F7Z A;  4MJS B;  3IFW B;  1HE8 A;  5AZH A;  3ZKJ C;  3KW5 B;  3DBL I;  3DVN U;  3C0R B;  4MSQ B;  4W9F A;  2G4S A;  5FR6 A;  3HIZ A;  4HJK A;  4HDQ A;  1SGH A;  4W9D A;  2K6Q A;  2KTR B;  3K9O B;  2KX0 A;  2MX2 A;  2KDE B;  3AUL A;  2K8H A;  1GUA B;  2AL3 A;  1V2Y A;  3V6C B;  2JVC A;  4K7S A;  3L13 A;  4KDI C;  2KO3 A;  2GBN A;  1V5O A;  2KKC A;  4PYZ A;  5HKH A;  2R2Q A;  2MBB B;  3AI5 A;  3IBE A;  4MGI E;  5C1Z A;  4LDT D;  2D07 B;  3L08 A;  1UGM A;  3M63 B;  3PZD A;  1P9D U;  4PS3 A;  3ZO5 B;  4FJZ A;  4JGH B;  4NAW B;  4HXD A;  4JIO U;  1P0R A;  1WXS A;  2C7H A;  4E71 A;  3PLV A;  3Q3F A;  4GOC A;  2V3S A;  2FNJ B;  2N9E B;  1UEL A;  2AEH A;  3X0W A;  2PE9 A;  3KYD D;  3WAO A;  3A9K B;  3ZW3 A;  2IO3 B;  2LWP A;  4FAD A;  1WE6 A;  1EUV B;  5CHF A;  4MJS A;  3ZTC A;  3M3J A;  3JVZ X;  3P2B A;  3UF8 A;  2KLG A;  3SHQ A;  4DHJ D;  2I1K A;  2UYZ B;  3TL5 A;  2BPS A;  3RUI B;  4E74 A;  5IA7 A;  4WJO A;  3H6N A;  3ZNI D;  3LJ3 A;  2KVR A;  2KTR A;  5DPT A;  1WGY A;  2FIF A;  2KWV B;  3QX1 A;  4NQL B;  2D3G A;  2ZCC A;  2PE6 B;  5LXI B;  1FXT B;  3ONS A;  4ZRJ A;  3KUD B;  4K1R B;  2IY1 B;  5D7G A;  4DHZ E;  4ANU A;  3UGB B;  1NDD A;  2L00 B;  5JHB A;  2JF5 A;  2DZI A;  1F9J A;  1QZE A;  4BBN C;  4HWI B;  1WZ0 A;  4BKS A;  2KWU B;  2YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...