1Q1OA

Solution structure of the pb1 domain of cdc24p (long form)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
b'GPLGSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title The PB1 domain and the PC motif-containing region are structurally similar protein binding modules
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1q1oA00
1ZW7A 2KHWB 3VVWB 4RM8A 3MTNB 2LWPA 3QIJA 4NPNA 2LRWA 4II3B 4F8CB 2K1FA 2LUEA 3KUCB 4ZRIA 4F7ZA 3H7PA 4E71A 4DHJD 1P3QU 4EFOA 4ANUA 1GUAB 3BINA 3DDCB 2D3GA 2MA9B 5CHFA 2JY6A 1Q1OA 5D7GA 2FCQA 1L7YA 3QCAA 4LDTD 1SIFA 4RMAA 3DVNU 2BKFA 1WE7A 2L7RA 2NPTB 2NBWB 3KVFB 3KW5B 1WGHA 1EF1A 3DOWA 2EMTA 3W1SC 4GIVA 3M95A 4F1SA 4II2B 3VXWA 4PYZA 4TQ1A 4WQOB 4MGIE 3A1QA 2FCNA 2OOBB 3APCA 3GZNI 2ZCCA 3A9JB 2DYOA 4FJYA 2KKCA 1WMHA 1WI0A 1YJ1A 2BYFA 4FHKA 2XEWA 2BKRB 4B95A 2MRPA 1G6JA 4WWNA 2FNJB 2O6VB 2JZZA 3GOEA 3I3TB 4KDLB 5DPTA 4ZRJA 2JWZA 3QARA 3V6CB 1U4AA 3ALBA 2PJHA 5CHWA 4MJSB 3KH0A 3P2BA 1C3TA 2IO0B 2FCSA 3OAWA 3JSVB 3CSFA 2KN5A 4GDLA 3ZTCA 3DBRI 1E8YA 3DBHI 5E6PA 1P98A 3H7SA 3KYCD 2YLMA 3QK0A 1P1AA 2D2QA 3DPDA 4IUMB 5AEKB 1T0YA 1TBEA 1WJNA 1UZXB 2L3ZA 2LGXA 2LVPA 4AUQC 1Q5WB 2B3AA 4PS3A 4DBGA 2DZKA 3ZRCA 2IY1B 2D10A 2KMAA 3H6NA 5C1ZA 4E3CA 3Q3JA 2QHOA 1OEYJ 4NJ7A 4IG7B 1OQYA 1RLFA 3LJ3A 4NAWA 4BKSD 2C7MB 2KTRA 1WZ0A 4KSKC 3AI5A 4DK5A 3AU5A 2ZCBA 4I6NB 2MWSB 2ZZPB 4DHZE 1WXAA 4EZLA 1H4RA 1E8XA 4BOSC 1VCBA 1WIAA 3DQVA 3EHVA 3IFWB 3EFUA 1E5WA 1LM8B 4RM9A 2KNBA 3QC8B 4N9F4 2L0FA 1MG8A 4LJPB 1ISNA 2KWCA 1R4NI 3W1YA 4EZJA 5L95C 4KIKB 2O6VD 1NBFC 3VHTC 4BKSA 4FN2A 3U30A 2C5LC 2NPTA 3PSEB 3MHSD 3PLUA 5G55A 3VUXA 2FIDA 2MCNB 4GDLB 2J0KA 2RR9A 1H8CA 4WWPA 2AYOB 2YVCA 4K7UA 2BF8B 2LXAA 3CMMB 4MM3A 4FA6A 3R7QA 2DZJA 2RD0A 3S2AA 5J18A 3RUIB 3PRPB 4IM3A 5L83A 1UBQA 1AARA 4ANVA 3A9JA 3L10B 1JRUA 1RFAA 1J19A 3QHTA 4HK2A 1NI2A 3IG3A 3KYDD 2ZVNA 4FJZA 4OVUA 3EC8A 5AZHA 1WZ3A 4AP4C 4G3XB 4NY0A 2O6VA 1XT9B 3UQAA 5AZFA 1E7UA 1WX9A 3VTVA 3NY5A 3R7RA 4MJSA 1GC7A 4A3OA 1XQQA 2N9PC 3JSVA 2ASQA 2K6QA 2J0JA 3U8ZA 2XK5B 2DX5B 1K8RB 2MQJA 2UYZB 2JXXA 4DHZB 2ZNVB 4CO7A 2IO3B 1IYFA 1WH3A 3L0WB 2BPSA 4KZ0A 4MEMA 2J7QB 2IZVB 1RRBA 3PV1A 2CHWA 3IVFA 2GMIC 4JQWC 3VH4B 2M17A 2LRUA 4IC7B 4WWOA 1GJZA 4EEWA 3X0WA 3UINB 4PS7A 3N3KB 1V5TA 2I1KA 2L8JA 3ZVVA 2WX1A 1F9JA 4IM0A 3PT2B 4ZRKA 3U7DA 5DCNA 1LQBA 1WGYA 2KLGA 3DVGX 4G11A 1I35A 1UELA 4GOCA 1P9DU 3DVGY 3QJZA 4WJNA 3RULA 4ASWC 3CSTA 1TTNA 4GMVA 1P0RA 5IAAC 2GBRA 3VFKA 2L00B 2KDFB 5KHOA 3NS8A 1V81A 2W9NA 5JZEB 2KTFA 1Y8RC 3ZIMA 1NDDA 2DAJA 3V60A 3OJ3A 1TZ1A 4MSQB 4TUUA 2A5UA 3TL5A 3ZRFA 2ZJDA 4KIKA 4E74A 1E90A 1GNUA 2LI5A 2NBVB 3T9LA 5C23A 2FIFA 2WYQA 2FUHB 3A4SC 2LZ6A 3NZSA 3NZUA 4MH0E 1OEYA 4W9KA 2CKHB 2N1WA 3DVNV 2MP2A 4BKTA 2KX3A 3ZTDA 2MX2A 2KFJA 1YX6B 4LJOB 4DDGD 3VAWA 3B0AA 1WYWB 2DENB 3RZWC 3RCZA 5HKHA 3PHWB 1KM7A 1VD2A 4I6PA 4J6IA 3AULA 4MGZE 4HVBA 5DPWA 2IY0B 3ENEA 3DBLI 4GN1A 1V2YA 3TJPA 4FLHA 3ZNHB 4BBNF 2KWVB 2LGDA 1C1YB 4GGQA 2LXCA 4IW0A 1V5OA 3HHMA 4NJ6A 1WX8A 5IA7A 1YD8U 1YX5B 2M0XA 2V1YA 2HD5B 3WAOA 1V49A 2JZ3B 3VH3B 3WALA 3QQ8B 1QZEA 4FULA 4JIOU 2CU1A 1GG3A 1J8CA 2FCMA 2MSED 2A4ZA 4GSWA 2PE6B 2XK5A 2N1VA 1D3ZA 2REXA 2MBQA 3APDA 5TR5A 5KHQA 1UD7A 2L05A 2C7HA 3H9DA 2CR5A 3N30A 1PQSA 4M0WB 4W9EA 2EMSA 4BKGA 3L54A 4GXBA 4X57B 3ECIA 4XX5A 3ZW3A 2LGYA 4B9KA 3OJ4B 4LCDE 4HDOA 4W9LA 1WFYA 2K6DB 3A33B 2Z59B 4MELA 2KMCA 2DZIA 3RZFA 4WJQA 3SD5A 1X1MA 4NNJB 3VDZA 4KV2A 1Z2MA 1WE6A 2WWZA 5FR6A 4ICVA 2KX0A 4JLCA 4NQLB 2ZPYA 3V62A 2ZEQA 3A9KA 3DBSA 4G50A 2KQSA 2KK8A 2Y5BB 4MGKE 3JVZX 2GOWA 1WXSA 2MP2B 3L08A 1KJTA 3WIMA 4MSMB 2JRIB 3TCAA 2DYBA 4GDKB 1CMXB 2KDEB 2M1MA 2NS5A 2BYEA 4XZ4A 4I6LB 4ICUA 5E6OA 2OJRA 2G4SA 2GBKA 3EECA 3L16A 2ZNVC 2ZVOA 1SGHA 2KLCA 1V6EA 2JT4B 3ZNID 4ANWA 4M8MA 1KLVA 5DPSA 3RD2A 4W9JA 2DYMA 2KQ7A 2L0TA 2KD0A 5BO4B 4WJOA 1WGRA 3ML9A 3NOBA 4HCPB 3VUWA 1WJ6A 3UIOB 1HE8A 5D6JB 2K8CA 4CHKA 3PLVA 2GBJA 1EO6A 2KXJA 3TIXA 3PGEA 3X23A 2G45B 2XBBC 3WA0A 2FAZA 1IP9A 2AL3A 4IWPA 2K25A 3WANA 2WDTB 1I42A 2N9EB 1SE9A 3LDZE 3B1LX 2LD9A 3IBEA 1WRDB 2I1JA 1LXDA 4HPLB 3HM3A 2JPHA 5JHBA 3PS6A 1FXTB 3L13A 2R2OA 1E8WA 1V9JA 1E8ZA 2Z0EB 4TV3A 3UIPB 4A20A 3M3JA 3PREA 3PRMB 3A9KB 4IWOA 3VQIA 1EF5A 3V61A 4KVGB 3WAMA 5GMVA 3ZO5B 4PS8A 1OTRB 3QWZB 3JYUA 2C9WB 4HJKA 4K81A 2AEHA 2CHZA 2IO2B 2GBMA 4HWIB 4BVUC 3AU4A 1KOTA 2C60A 2KANA 4GB9A 1M94A 4M8NA 4KSLC 4AWJA 4DDID 3V6EB 2MBEA 1WXVA 2V3SA 3BY4B 4P7IA 5E6NA 1S3SG 3ZNGC 4HLEA 1EUVB 5CTRC 2NCNA 3B08A 2CS4A 2DZMA 1WJUA 2JUOA 4G0NB 1IPGA 5CX3A 3KUZA 2K39A 4NQKE 5D2MB 1V80A 2KWUB 4HPMB 3VTUA 4ZDVA 4IM2A 4KZCA 2LVQA 2KC1A 2MLBA 1YIWA 1WGGA 5EDSA 3C0RB 4HXDA 3SU8X 2N7DA 2BYVE 2MBBB 4BOZB 2CHXA 4K7WA 2VRRB 3ZKJC 4ANXA 2NR2A 3ZDTA 1WF9A 4GDKA 4EOYA 2C7NB 4AJWA 4GU2A 3ZUNA 1WGDA 2JVCA 2L76A 3K9OB 4FHJA 3IHPC 4YL8A 1WR1A 3RYTA 3SDLC 4ZYNA 2KZRA 3T8MA 3HM6X 4PYUA 1RAXA 2G3QB 1A5RA 2MBOA 3ONSA 2NVUI 4MGYE 1Q0WB 4DWFA 2LVOA 5J17A 2AWTA 1L2NA 2RSUA 3MJWA 2HTHA 3ZNZB 1WX7A 4CYEA 3L17A 2WX0A 2O2VA 3UQBA 3H7PB 2IBIB 1TGZB 2ZPNA 4AJYB 5D94A 2D11A 1LFDA 4K7SA 2N9XA 3ZDMC 3H1UA 2KO3A 3HIZA 4EZKA 3SHQA 1BT0A 3TMPB 3WAPA 5DPRA 2KJHB 2MBHA 2RPQA 3PZDA 3QX1A 3APFA 3Q3FA 3CF6E 2LASA 1UBIA 1WM3A 5G2NA 1WM2A 2JRHA 4WJPA 2M8SA 3UF8A 4TQ0A 3QAQA 3R66C 3VUYA 5CHVC 2KFKA 3M62B 3PPAA 2IO1B 4WAAA 2KJ6A 1S1QB 4W9FA 4XC2A 2K8HA 3TBLD 2G4DB 3A1QB 1ZGUB 2UWQA 4K1RB 2KJRA 3A4RA 4B6WA 2NBUA 2PPHA 2AL6A 4HCNB 5JHAA 3VTWA 5LLIA 2LJ5A 4DHJB 1WMHB 4IWQA 2N4FA 3ML8A 3K9PB 1UGMA 1Z5SB 2IYDB 4MDKE 4AOFA 4BBNC 2KC2A 4EUTA 5J2RA 2N7EA 5JH5C 1OGWA 4LDTB 4EKUA 1YQBA 4KDIC 1WJ4A 2PEAA 5LXIB 4TKNA 1ZKHA 5AZGA 4W9DA 2M4NA 1V86A 4FJVB 1E7VA 3OLMD 1WR6E 4URKA 1J0GA 2DHZA 3RT3B 2HE7A 2KVRA 2JF5A 4W9CA 3PVLA 4DXAB 2DAFA 2HJ8A 2PE9A 2BGFA 4W9GA 3PRZA 4W9IA 3UGBB 3HK0A 4W9HA 1GC6A 1UH6A 2KDBA 1WXMA 2O2VB 3DCGA 3PTFC 4JL9A 1R4MI 4A3PA 3O65B 2BWES 2R2QA 1XD3B 2BWFA 2D07B 2J0MA 4JGHB 2RGFA 3KUDB 4OVVA 4BFRA 3W1SA 3M63B 2V4LA 3R3MA 3PHXB 4NAWB 4FADA 2KTRB 3AXCA 3ZLZA 2EKEC 3JW0X 3N32A 1WY8A 3QA8A 4HDQA 2GBNA 2MW5A 3NHEB 2KDIA 3D32A 4FBJB 2KFKB 2Z0DB 2KOXA 2K8BA 5LXHA
chains in the Genus database with same CATH superfamily
3RMKC 1ZW7A 3ABVB 4ZHOA 1L6UA 4RFBA 1QOFA 4ZRIA 4E71A 1EM7A 1P3QU 4EFOA 3DDCB 3NVWA 2MA9B 4KX6B 3P4SB 3QCAA 4RMAA 2INPE 2L7RA 2NBWB 3KW5B 3EUB2 1EF1A 4K3CA 1IGDA 3W1SC 4GIVA 1ZUD2 3Q8EA 4II2B 1OQRA 1XLPA 2VH2A 4MM3B 4MGIE 2FCNA 4M00A 3A9JB 2KKCA 1WMHA 3NVVA 3TSSA 1L4DB 2V3NA 2MRPA 1ZPSA 4ZOHC 2H89B 4WWNA 5DPTA 1U4AA 4MJSB 1ESFA 1OFFA 2KN5A 3MHZA 3ZTCA 5E6PA 3H7SA 2YLMA 1P1AA 3DPDA 5AEKB 4M01A 1N63A 2LJIA 1UZXB 3GB1A 2L3ZA 2LGXA 1Q5WB 4DBGA 4RGOS 3Q3NC 4NJ7A 4IG7B 4BKSD 2C7MB 2W3RA 1H4RA 1E8XA 3DQVA 3IFWB 1F77A 1E5WA 1LM8B 3T3NA 3QC8B 2DNFA 4C7YA 2KWCA 3W1YA 4EZJA 3MC8A 1VZ7A 2O6VD 1NBFC 4FN2A 2C5LC 2NPTA 1L4ZB 4WWPA 3CWIA 2BF8B 2LXAA 3CMMB 5EE9A 4FA6A 1NI3A 3PRPB 1JWBD 5AZHA 2INCC 3EC8A 4AP4C 1E7UA 5EE1A 2YEPF 3NY5A 2AQ3B 3U2SC 1GC7A 1M4VA 2K6QA 4MACA 2DX5B 1K8RB 2B76B 2MQJA 2UYZB 2JXXA 1TKGA 1IYFA 1EU3A 2BPSA 3U52E 4MEMA 2IZVB 2GMIC 4JQWC 4WWOA 1P7EA 2MHJA 3UINB 4PS7A 4OZAA 3N3KB 1V5TA 1QKZA 2L8JA 3ZVVA 1F9JA 4ZRKA 2WXNA 3PT2B 1BMLC 3U7DA 1LQBA 1YN3A 1WSPA 3DVGY 4WJNA 3SR6A 5IAAC 5BMGA 4WURA 4M02A 4L23A 1SIJA 5EE3A 1IUEA 1V81A 3AN1A 1Y8RC 3ZIMA 1NDDA 1TZ1A 1J7CA 2A5UA 3LXFA 2ZJDA 4E74A 2LI5A 4ITKA 2FIFA 4W9KA 2CKHB 1JWAD 2MP2A 4BKTA 2KX3A 2NTTA 2M56B 3MC0B 3B0AA 1WYWB 2PMVA 3VAWA 3RCZA 3PHWB 1KM7A 4HVBA 3PZ7A 4HROA 3DBLI 4GN1A 1NYRA 4FXCA 3RPFC 3NG0A 4WAFA 2OHFA 2AQ1B 2LGDA 1GB1A 3NS1A 3DBRB 1XLOA 1GB4A 2WDQB 3AEEB 2JZ3B 4BZAA 2CJNA 3VH3B 3RNFC 4FULA 1J8CA 5AUIA 1VZ8A 2RDHA 5TR5A 1JWMD 1GAQB 1UD7A 2C7HA 3H9DA 3Q8AA 1PQSA 4XX5A 5IN7A 3OJ4B 4LCDE 4HDOA 1SEBD 2KMCA 2DZIA 1MG4A 1MJDA 4KV2A 5FR6A 4JLCA 2GB1A 3B2GA 3Q2AC 1AWDA 2Y5BB 4MGKE 3JVZX 2WXOA 4O1NA 1PGBA 2MP2B 2INNE 1KJTA 4MSMB 2JRIB 2BYEA 2JSVX 2G4SA 2BB6A 2WQYB 3L16A 3N9YC 1V6EA 4M8MA 2OEDA 2KD0A 4WJOA 1WJ6A 1A70A 5D6JB 2GRIA 3RI7C 2G45B 3WA0A 1TT5B 4IWPA 1KFYB 2K25A 1I42A 1F2RI 2LD9A 3IBEA 4A55A 1LXDA 1WRIA 1FXTB 1ZE3D 4XWWA 3P42A 3AM9A 4WQMA 3I5JC 1QT9A 1OTRB 2MH7A 3JYUA 4HWIB 3AU4A 4GB9A 4DDID 4B0EA 4M0WA 3V6EB 2V3SA 3C8YA 1EUVB 2KAJA 1C76A 1WJUA 2JUOA 3NZ3A 1EU4A 2L52A 2PW9A 5D2MB 4HPMB 3VTUA 4NZLB 4IM2A 2VH1A 2KC1A 2MLBA 1YIWA 1WGGA 2MBBB 3ZKJC 4ANXA 2NR2A 4D2KA 2WXGA 2C7NB 3ZQ4A 4A8XC 1KH0A 2KYWA 4YL8A 1WR1A 3RYTA 3T8MA 4JPSA 4PYUA 1FNUA 1A5RA 2MBOA 1L2NA 4LNNA 1E10A 2HTHA 1WX7A 3L17A 2WX0A 3H7PB 4K7SA 3ZDMC 4A6QA 3WAPA 2RPQA 3PZDA 2K3UA 3APFA 3CF6E 5G2NA 1WM2A 2VZKB 1JALA 4LK0M 2LFIA 5CHVC 4WAAA 2KJ6A 1S1QB 2KJRA 3A4RA 2NBUA 2RMMA 5LLIA 3K9PB 5IOIA 4EUTA 4OHJA 1FCLA 1WJ4A 5LXIB 4TKNA 1ZKHA 2QEJC 4W9DA 2M4NA 1V86A 4FJVB 1E7VA 1J0GA 2DHZA 3RT3B 4DXAB 1UH6A 4WWMA 2D3BA 1V8CA 1XD3B 4JGHB 1KRHA 4OVVA 4BFRA 2LEKA 3R3MA 1XCQL 1UF0A 2KTRB 4H2AA 3N32A 4HDQA 1WY8A 2MW5A 3RNAC 5EE0A 5LXHA 2KHWB 4ARIA 3MTNB 1DOXA 1PGAA 2LRWA 3AEDB 4F8CB 5FK9C 1I4RA 1SE4A 2LUEA 3AE9B 2W54A 3L4PA 4ANUA 1GUAB 4LNIA 3AE6B 4RNAA 1L7YA 1LO5D 3KVFB 1WGHA 3AV8A 2WU5B 3VXWA 4TQ1A 3KLSX 3DHGC 1F1HA 1WI0A 2W3SA 2XEWA 1T5XD 1I4XA 4B95A 3SFEB 1SSNA 2O6VB 2JZZA 2X8XX 3I3TB 4KDLB 2G9HD 4ZRJA 2JWZA 3V6CB 3ALBA 1HXYD 2WXIA 1YMHE 2M19A 2IO0B 2FCSA 4IKGA 4GDLA 3DBHI 1P98A 3DHIC 2D2QA 2JX5A 1T0YA 2Z8LA 4PS3A 2DZKA 1CZPA 1C78A 1D4BA 1TJEA 4E3CA 3Q3JA 1OEYJ 3LJ3A 4NAWA 3AE1B 1C4PA 3J9CA 4AS1A 4B0MA 1WZ0A 4KSKC 4DK5A 1MHHE 1C9FA 2ZZPB 5C3JB 1E6EB 1NVID 2J42A 4TSSA 4N9F4 2L0FA 3BIID 4K3BA 5L95C 4KIKB 3HUIA 3U30A 2FIDA 1PFDA 4GDLB 2RR9A 4N6EB 4MM3A 5FKAC 3R7QA 2Y3AA 3W2DA 1STEA 5J18A 4IM3A 3HVZA 5L83A 1JRPA 2LMCA 3A9JA 3Q6BA 4HK2A 4Q2JA 1NI2A 3KYDD 3Q8CA 1WZ3A 1FPYA 4OW0A 4HPPA 3R7RA 4MJSA 4A3OA 2KVZA 1V1OA 1ET6A 4YXDB 3U8ZA 2XK5B 1R4MB 2WLBA 4CO7A 2BTEA 4BAXA 1V1PB 2KMMA 2GI9A 3PV1A 3VH4B 1FO4A 2FBWB 2M17A 1GJZA 4EEWA 5GXGB 2I1KA 1SBBB 4MH8A 3IAS1 5DCNA 4G11A 1ROEA 1I35A 3CSTA 1P0RA 3LB8C 1UGJA 2KTFA 3TEXA 4OZCA 1XF5L 4KGRA 1D6EC 1J7AA 3ZRFA 1ET9A 3T9LA 3Q8BA 1L0XB 2WYQA 3A4SC 3NZSA 3NZUA 3BWUD 4IOIE 3GZNB 2YEPB 3GE8C 1YX6B 3RZWC 2DENB 3B9JA 3Q14C 1KLGD 3AULA 3Q3OC 2IY0B 3PZ8A 1WGKA 1V2YA 3TJPA 4FLHA 3ZNHB 4BBNF 1CQVA 2JXTA 4GGQA 2LXCA 2K9XA 4IW0A 1V5OA 1YD8U 1JCKB 2R61A 1V49A 1VR9A 1FD6A 4JIOU 2FCMA 3WCQA 1RYJA 1D3ZA 2L83A 2REXA 2MBQA 3APDA 4QAYA 2L05A 3R2TA 1EWYC 3L54A 4GXBA 3ECIA 4W9LA 2K6DB 3VDZA 3NJTA 2Y5CA 1WE6A 2BBCA 5BMIA 2KX0A 4US9A 2G1EA 4G50A 2KQSA 3CIRB 3TCAA 4GDKB 1CMXB 1R4NB 2M1MA 4JWUC 2NS5A 5E6OA 3AE4B 2SAKA 1FXAA 2ZW0A 2JWUA 3AMZA 1SGHA 4N58A 4ANWA 3VRAB 2WU2B 3RD2A 2NTSA 2KQ7A 2GLSA 2WXFA 3P4QB 2JZPA 1VJKA 3UIOB 4C56C 3PLVA 2GBJA 3TIXA 2FAZA 1IP9A 1C4CA 3WANA 2WDVB 4C7ZA 3LDZE 1SE9A 2IGDA 1XEEA 1FNWA 1WRDB 2HJ1A 1FNVA 3HVDA 3L13A 4XWTA 4DXGA 3UIPB 4TV3A 4A20A 3PRMB 2K0PA 2KWDA 3WAMA 5GMVA 3ZO5B 4PS8A 4REZA 4HJKA 2CHZA 4BVUC 1FCCC 1Y56A 3FC4A 1K53A 3H8HA 2C60A 1M94A 2LHDA 3ZNGC 4P7IA 5CTRC 2NCNA 3AEGB 3B08A 5HFYA 2DZMA 3KUZA 1N6ZA 1N60A 2K39A 4ZDVA 1JMLA 4KZCA 1P7FA 2QIEB 3URYA 4EE2A 3C0RB 4HXDA 5EDSA 2LGIA 4BOZB 4YTPB 2XNAC 1WF9A 2L1AA 1I4HA 2JVCA 1RM6C 2L76A 4FHJA 2N9KA 4HEA1 1UNSA 4ZYNA 2D5GA 3HM6X 2G3QB 4ZYSA 3AECB 3TEWA 4RH6A 1MI0A 3ONSA 2NVUI 4YSXB 1GOZA 2LVOA 5J17A 2RSUA 2ZPNA 4AJYB 5D94A 2N9XA 3I57A 2KO3A 2KJHB 2MBHA 2LASA 3R8BA 1T0QC 2M8SA 3UF8A 3R66C 5BYRA 3M62B 3PPAA 2IO1B 4RGNA 4W9FA 3TBLD 1E9MA 3A1QB 1ZGUB 2WXJA 4K1RB 4B6WA 2PPHA 5JHAA 2BS3B 1MVKA 2K5PA 3ML8A 2IYDB 4BBNC 4XDDA 1IBXB 3GP7A 5G5HA 1ZDVA 1ZOYB 4NAMA 1KF6B 2HE7A 3PVLA 2JU6X 2DAFA 2PE9A 4W9GA 3I63C 4W9IA 1T0SC 2WXPA 3HK0A 2KDBA 2QSDA 3O65B 1JWSD 2R2QA 4ARCA 1TKYA 1D5MC 2J0MA 1ACCA 2RGFA 3KUDB 3W1SA 3BVZA 3M63B 2V4LA 5D3DA 2CJOA 1I4PA 2EKEC 3JW0X 2I38A 2WXRA 3RNEC 1L6VA 4FBJB 2Z0DB 2KOXA 4JWSC 3VVWB 1ZDXA 4RM8A 3QIJA 2LWPA 3RNCC 4II3B 4ZRPA 4F7ZA 3H7PA 2D3GA 5CHFA 1Q1OA 2FCQA 3BVGA 3NVYA 3DVNU 2BKFA 2IJ0A 3IT6B 3AE5B 2EMTA 1EWCA 4WQOB 3BYYB 4WH4A 2OOBB 2N0SB 4AQ7A 2N9LA 2BYFA 2FNJB 1I4GA 3QARA 4LLGM 3P2BA 3N20C 1SE2A 3OAWA 3JSVB 1CJEA 1PDXA 3DBRI 1E8YA 3QK0A 4IUMB 3AE3B 1TBEA 2WNMA 4AUQC 2B3AA 3ZRCA 5H92C 4C4VB 1QQRA 4C80A 1OQYA 1RLFA 5H8YE 1YQ3B 2KTRA 2ZCBA 2MWSB 5HG2A 4EZLA 4BOSC 2JQRB 1VRAB 4RM9A 4L1BA 3SEBA 1MG8A 3NRZA 4LJPB 1ISNA 1HA5A 2EELA 1SB3C 3VHTC 1N5WA 4BKSA 5FR3A 3T3OA 3MHSD 3PLUA 5G55A 1DYQA 2AYOB 4ACFA 3AE8B 4XYCA 2PVOD 5AUKA 3S2AA 1UBQA 2K22A 4ANVA 1JRUA 3NUHB 1J19A 3QHTA 4FJZA 4OVUA 2BYTA 3ZXVA 3IT4B 4NY0A 2O6VA 1MFWA 1R7SA 1PYWD 1XT9B 1F2RC 5AZFA 5BYSA 1VZ6A 1WX9A 3UQAA 2ASQA 3N1YC 2J0JA 2J4XA 4DHZB 1N61A 1DOYA 4KZ0A 2J7QB 1RRBA 2V0GA 2CHWA 2KQ4X 4IC7B 3AE2B 1L5PA 3AEAB 1JROA 2SEBD 2KLGA 4C00A 1BXTA 4GMVA 2GBRA 5IKCM 4N59A 4XGAB 2KDFB 2W9NA 5JZEB 3N1XC 1NYQA 2DAJA 3V60A 4NJCA 3E56A 4TUUA 1TS4A 1FRDA 1TYGB 4KIKA 4LNFA 1E90A 1NENB 2NBVB 3BVMA 3R2IA 2FUHB 2LZ6A 1OEYA 2IPKD 1HTQA 4LJOB 2KFJA 2LUMA 4IDIA 4DDGD 4MGZE 1B1ZA 5DPWA 3GE3C 1HZ5A 4A90A 2KWVB 3Q3MC 3ZYYX 2LGSA 1XXGA 4NJ6A 3U7ZA 5IA7A 5MPOA 2BS2B 2V1YA 3BK2A 4LNKA 1AN8A 1SXTA 1BUIC 3QQ8B 2CU1A 2KT7A 2MSED 4GSWA 2XK5A 2N1VA 5KHQA 1V1PA 1T0RC 2CR5A 3N30A 2EMSA 4BKGA 3B2FA 4X57B 1HEZE 1TIFA 3A33B 4MELA 2QJLA 2MEKA 3SD5A 1X1MA 4NNJB 5LNK1 2WWZA 4ICVA 4KGSA 4NQLB 3V62A 2ZEQA 3A9KA 3DBSA 2OJWA 2KK8A 1PUTA 1TS2A 2PTLA 3WIMA 5C2TB 4XZ4A 4ICUA 2WP9B 2GBKA 1FIQA 3EECA 3IAM1 2ZNVC 5E6JA 2ZVOA 3NVZA 2BVCA 3P4RB 5G5GA 5DPSA 2DYMA 4YTNB 4DQOC 1WGRA 3ML9A 1SF0A 4HCPB 1HE8A 2K8CA 2KXJA 3X23A 2AL3A 1VLBA 3FAHA 2I1JA 4HPLB 2J53A 3HM3A 2JPHA 3UI3A 1YOVB 5JHBA 3KWLA 1E7PB 2R2OA 1E8WA 1V9JA 1E8ZA 2Z0EB 4R3DA 2W55A 3M3JA 4P1CC 3A9KB 3V61A 4KVGB 1TZOA 5JXVA 1YQ4B 2MJDA 3C19A 2E3TA 1KOTA 4HKQA 4M8NA 4AWJA 3MC9A 1QILA 1WXVA 1S3SG 2CS4A 4ZHPA 2JYEA 4NQKE 1V80A 4GLSC 1YJJA 5T8IA 2J52A 2N7DA 4XDCA 1XLNA 2DBYA 2BYVE 4JE3B 2CHXA 2WS3B 4K7WA 4RF0A 4GDKA 2IDYA 4AJWA 3EFCA 4GU2A 1WGDA 2L32A 2HDEA 3SDLC 4US8A 1RAXA 1ZXIA 2XN9C 1QOGA 4MGYE 1Q0WB 1NEKB 1QLBB 3OWEB 3MJWA 1F0ZA 2QDFA 2O2VA 3DBLB 2IBIB 4YWGG 2D11A 3HIZA 1QF6A 4S17A 1GPXA 1BT0A 3TMPB 5DPRA 4YSYB 3ZJUA 4YSZB 3OG5A 1UBIA 1WM3A 4RCOA 1FXIA 2JRHA 4WJPA 4TQ0A 3QAQA 5HHDG 1ZXHA 2WXKA 2KFKA 2K8HA 2G4DB 2UWQA 4J3OD 1YN4A 2AL6A 4HCNB 1WMHB 1YJIA 2N4FA 1UGMA 1Z5SB 4MDKE 2H88B 2KC2A 1AYFA 5JH5C 1FRRA 1OGWA 4EKUA 2W82A 1YQBA 3PO0A 2PEAA 2WDRB 1MHXA 3OLMD 1WR6E 4URKA 3W5UB 2WXMA 1WXQA 2KVRA 2JF5A 3W9CB 3BZDB 2BGFA 1QOBA 2O2VB 4KKIA 1R4MI 1I7HA 2BWFA 2D3CA 4RGMA 3SFDB 3KWVA 3PHXB 4FADA 3AXCA 3ZLZA 1TKEA 4L2YA 3QA8A 2GBNA 3FKYA 3NHEB 2KDIA 3D32A 2KFKB 3PTFC 2WHIA 4NPNA 3AEBB 2K1FA 3KUCB 4P16A 4DHJD 1HTOA 2ACZB 3BINA 4P1BC 2ONQA 2BW2A 2JY6A 5D7GA 4LDTD 1SIFA 1CK1A 3ZXRA 1WE7A 2NPTB 3AB5A 3DOWA 1UUPA 4HKZE 3M95A 4F1SA 4PYZA 3W5VB 3A1QA 2QCZA 3LYYA 1FFVA 1FMAD 1XCTL 3APCA 2RPVA 3GZNI 2WXHA 2ZCCA 4FJYA 2DYOA 1YJ1A 2Y5PA 4FHKA 2QILA 2BKRB 1IBXA 1G6JA 3V05A 3GOEA 1V97A 2PJHA 1JW9D 5CHWA 3KH0A 1C3TA 3CSFA 3IXSA 3KYCD 1MPEA 2EKIA 4PT5A 1C79A 1WJNA 2LVPA 2IY1B 2D10A 2KMAA 3H6NA 5C1ZA 3HRDD 3TEYA 2QHOA 5D3IB 1JQ4A 1YNTE 3AI5A 3AU5A 2DWQA 4I6NB 3E9SA 4DHZE 1WXAA 1K51A 1VCBA 1WIAA 3EHVA 1KTKA 3EFUA 5IP4D 2KNBA 4DXFA 2X38A 4YT0B 1D5XC 3RNGC 1C77A 1R4NI 4OVZA 1XLQA 2AQ2B 3PSEB 3VUXA 2MCNB 2J0KA 1H8CA 1N5XA 2YVCA 5I4DA 4K7UA 3EGRA 2DZJA 2RD0A 1I4QA 2PKOA 4OZBA 3RUIB 1AARA 3L10B 1RFAA 2PIAA 3IG3A 2ZVNA 4G3XB 3RN9C 3VTVA 1K50A 4A9AA 4USAA 1XQQA 2N9PC 3JSVA 1QOAA 3VR9B 2ZNVB 2IO3B 1WH3A 3L0WB 2KACA 3IVFA 2LRUA 2BB5A 3X0WA 4C4VA 2PLPA 2WX1A 4IM0A 5IO9A 1SJED 1WGYA 1E0ZA 3DVGX 4TMAB 5BYQA 1UELA 3FILA 1P9DU 3QJZA 4GOCA 4ASWC 3RULA 1TTNA 3ZGZA 3VFKA 2L00B 5KHOA 3NS8A 4KKJA 2BS4B 2MJEA 5TSSA 2WXQA 3ZJTA 3OJ3A 4MSQB 1YN5A 3DHHC 2TSSA 3TL5A 2WXLA 3P63A 1GNUA 1XO3A 1L0YB 5C23A 3I9V1 1D5ZC 3ETRA 4MH0E 2BQQA 2LHEA 1ENFA 2N1WA 3DVNV 4UDUC 2E6XA 3ZTDA 1RWSA 2MX2A 5HKHA 1SE3A 4J6IA 4I6PA 1VD2A 1SJHD 3ENEA 1J7BA 3P1MA 1FEHA 1K52A 3DWMA 1C1YB 3HHMA 1WX8A 3DWGC 4HRSA 1YX5B 2BT6A 3DBHB 2D3AA 2M0XA 2HD5B 3WAOA 2KN4A 3FILB 3WALA 1QZEA 1GG3A 2A4ZA 2PE6B 1DOIA 3Q69A 1Q10A 4LNOA 4M0WB 4W9EA 3ZW3A 2LGYA 4B9KA 1F52A 4XE0A 1WFYA 2Z59B 3RZFA 4WJQA 2QC8A 2HTME 1Z2MA 2ZPYA 4RF1A 2GOWA 1WXSA 3L08A 2KDMA 2DYBA 2KDEB 2ON8A 4I6LB 2V4IB 2OJRA 4WIPA 3GS2A 2Q5WD 2V9HA 2KLCA 1PGXA 2JT4B 3ZNID 1KLVA 4W9JA 2V3PA 3AE7B 2L0TA 4HJGE 1N62A 5BO4B 3NOBA 3VUWA 4CHKA 2I2YA 5BMHA 3TUOA 1EO6A 3PGEA 2XBBC 3AH7A 1FM0D 2IGGA 1B9RA 2WDTB 2N9EB 3B1LX 3KQ4A 4S0RA 2N7JA 3PS6A 3BK1A 4MT5A 1FFUA 3PREA 4IWOA 3VQIA 1EF5A 1HQRD 4CQNA 1OQQA 4JX1C 3QWZB 2C9WB 4K81A 2AEHA 2IO2B 2GBMA 3P4PB 2WGSA 3Q8FA 1T3QA 1UWMA 2KANA 4ZRQA 4KSLC 1ZP0B 1TY2A 2MBEA 3BY4B 4HLEA 5E6NA 3ZJVA 4G0NB 1IPGA 2DLBA 5CX3A 2INDC 2KWUB 1JWUD 2FE8A 2LVQA 3AEFB 2FUG1 3SU8X 1C4AA 3VRBB 2VRRB 1T6BX 4PK1A 3ZDTA 4EOYA 4YTMB 1KLUD 3EA6A 3ZUNA 3K9OB 1LGRA 3IHPC 1TY0A 1VDVA 2KZRA 1RFKA 2JYTA 3N1ZC 4DWFA 3VR8B 2AWTA 3MP9A 3UQBA 3ZNZB 4CYEA 1IGCA 1TGZB 1LFDA 3H1UA 2IGHA 4EZKA 4RGTA 3SHQA 3RNBC 2UU7A 1L0VB 4KGTA 1HZ6A 3QX1A 3Q3FA 3MFGA 2M0AA 4LTUA 3VUYA 4XC2A 2PVGC 3TEZA 3O13A 4P6VF 3VTWA 2LJ5A 5HI1A 4DHJB 3BYTB 4IWQA 4AOFA 5J2RA 1AW7A 2N7EA 1UWXA 4LDTB 2CU3A 1DGJA 4KDIC 5AZGA 1TS5A 3RFZB 4W9CA 2ICIA 2HJ8A 2ZW1A 3PRZA 3UGBB 4W9HA 1GC6A 1WXMA 3DCGA 4JL9A 2MJ3A 4A3PA 2BWES 2QMTA 2D07B 2RDGA 1WYGA 1TS3A 3MJ5A 3V3XA 4NAWB 1WWTA 2AX5A 2VZKD 2NMQA 3U4EG 2RDBC 2K8BA
chains in the Genus database with same CATH topology
1ZW7A 2KHWB 3VVWB 4RM8A 3MTNB 2LWPA 3QIJA 4NPNA 2LRWA 4II3B 4F8CB 2K1FA 2LUEA 3KUCB 4ZRIA 4F7ZA 3H7PA 4E71A 4DHJD 1P3QU 4EFOA 4ANUA 1GUAB 3BINA 3DDCB 2D3GA 2MA9B 5CHFA 2JY6A 1Q1OA 5D7GA 2FCQA 1L7YA 3QCAA 4LDTD 1SIFA 4RMAA 3DVNU 2BKFA 1WE7A 2L7RA 2NPTB 2NBWB 3KVFB 3KW5B 1WGHA 1EF1A 3DOWA 2EMTA 3W1SC 4GIVA 3M95A 4F1SA 4II2B 3VXWA 4PYZA 4TQ1A 4WQOB 4MGIE 3A1QA 2FCNA 2OOBB 3APCA 3GZNI 2ZCCA 3A9JB 2DYOA 4FJYA 2KKCA 1WMHA 1WI0A 1YJ1A 2BYFA 4FHKA 2XEWA 2BKRB 4B95A 2MRPA 1G6JA 4WWNA 2FNJB 2O6VB 2JZZA 3GOEA 3I3TB 4KDLB 5DPTA 4ZRJA 2JWZA 3QARA 3V6CB 1U4AA 3ALBA 2PJHA 5CHWA 4MJSB 3KH0A 3P2BA 1C3TA 2IO0B 2FCSA 3OAWA 3JSVB 3CSFA 2KN5A 4GDLA 3ZTCA 3DBRI 1E8YA 3DBHI 5E6PA 1P98A 3H7SA 3KYCD 2YLMA 3QK0A 1P1AA 2D2QA 3DPDA 4IUMB 5AEKB 1T0YA 1TBEA 1WJNA 1UZXB 2L3ZA 2LGXA 2LVPA 4AUQC 1Q5WB 2B3AA 4PS3A 4DBGA 2DZKA 3ZRCA 2IY1B 2D10A 2KMAA 3H6NA 5C1ZA 4E3CA 3Q3JA 2QHOA 1OEYJ 4NJ7A 4IG7B 1OQYA 1RLFA 3LJ3A 4NAWA 4BKSD 2C7MB 2KTRA 1WZ0A 4KSKC 3AI5A 4DK5A 3AU5A 2ZCBA 4I6NB 2MWSB 2ZZPB 4DHZE 1WXAA 4EZLA 1H4RA 1E8XA 4BOSC 1VCBA 1WIAA 3DQVA 3EHVA 3IFWB 3EFUA 1E5WA 1LM8B 4RM9A 2KNBA 3QC8B 4N9F4 2L0FA 1MG8A 4LJPB 1ISNA 2KWCA 1R4NI 3W1YA 4EZJA 5L95C 4KIKB 2O6VD 1NBFC 3VHTC 4BKSA 4FN2A 3U30A 2C5LC 2NPTA 3PSEB 3MHSD 3PLUA 5G55A 3VUXA 2FIDA 2MCNB 4GDLB 2J0KA 2RR9A 1H8CA 4WWPA 2AYOB 2YVCA 4K7UA 2BF8B 2LXAA 3CMMB 4MM3A 4FA6A 3R7QA 2DZJA 2RD0A 3S2AA 5J18A 3RUIB 3PRPB 4IM3A 5L83A 1UBQA 1AARA 4ANVA 3A9JA 3L10B 1JRUA 1RFAA 1J19A 3QHTA 4HK2A 1NI2A 3IG3A 3KYDD 2ZVNA 4FJZA 4OVUA 3EC8A 5AZHA 1WZ3A 4AP4C 4G3XB 4NY0A 2O6VA 1XT9B 3UQAA 5AZFA 1E7UA 1WX9A 3VTVA 3NY5A 3R7RA 4MJSA 1GC7A 4A3OA 1XQQA 2N9PC 3JSVA 2ASQA 2K6QA 2J0JA 3U8ZA 2XK5B 2DX5B 1K8RB 2MQJA 2UYZB 2JXXA 4DHZB 2ZNVB 4CO7A 2IO3B 1IYFA 1WH3A 3L0WB 2BPSA 4KZ0A 4MEMA 2J7QB 2IZVB 1RRBA 3PV1A 2CHWA 3IVFA 2GMIC 4JQWC 3VH4B 2M17A 2LRUA 4IC7B 4WWOA 1GJZA 4EEWA 3X0WA 3UINB 4PS7A 3N3KB 1V5TA 2I1KA 2L8JA 3ZVVA 2WX1A 1F9JA 4IM0A 3PT2B 4ZRKA 3U7DA 5DCNA 1LQBA 1WGYA 2KLGA 3DVGX 4G11A 1I35A 1UELA 4GOCA 1P9DU 3DVGY 3QJZA 4WJNA 3RULA 4ASWC 3CSTA 1TTNA 4GMVA 1P0RA 5IAAC 2GBRA 3VFKA 2L00B 2KDFB 5KHOA 3NS8A 1V81A 2W9NA 5JZEB 2KTFA 1Y8RC 3ZIMA 1NDDA 2DAJA 3V60A 3OJ3A 1TZ1A 4MSQB 4TUUA 2A5UA 3TL5A 3ZRFA 2ZJDA 4KIKA 4E74A 1E90A 1GNUA 2LI5A 2NBVB 3T9LA 5C23A 2FIFA 2WYQA 2FUHB 3A4SC 2LZ6A 3NZSA 3NZUA 4MH0E 1OEYA 4W9KA 2CKHB 2N1WA 3DVNV 2MP2A 4BKTA 2KX3A 3ZTDA 2MX2A 2KFJA 1YX6B 4LJOB 4DDGD 3VAWA 3B0AA 1WYWB 2DENB 3RZWC 3RCZA 5HKHA 3PHWB 1KM7A 1VD2A 4I6PA 4J6IA 3AULA 4MGZE 4HVBA 5DPWA 2IY0B 3ENEA 3DBLI 4GN1A 1V2YA 3TJPA 4FLHA 3ZNHB 4BBNF 2KWVB 2LGDA 1C1YB 4GGQA 2LXCA 4IW0A 1V5OA 3HHMA 4NJ6A 1WX8A 5IA7A 1YD8U 1YX5B 2M0XA 2V1YA 2HD5B 3WAOA 1V49A 2JZ3B 3VH3B 3WALA 3QQ8B 1QZEA 4FULA 4JIOU 2CU1A 1GG3A 1J8CA 2FCMA 2MSED 2A4ZA 4GSWA 2PE6B 2XK5A 2N1VA 1D3ZA 2REXA 2MBQA 3APDA 5TR5A 5KHQA 1UD7A 2L05A 2C7HA 3H9DA 2CR5A 3N30A 1PQSA 4M0WB 4W9EA 2EMSA 4BKGA 3L54A 4GXBA 4X57B 3ECIA 4XX5A 3ZW3A 2LGYA 4B9KA 3OJ4B 4LCDE 4HDOA 4W9LA 1WFYA 2K6DB 3A33B 2Z59B 4MELA 2KMCA 2DZIA 3RZFA 4WJQA 3SD5A 1X1MA 4NNJB 3VDZA 4KV2A 1Z2MA 1WE6A 2WWZA 5FR6A 4ICVA 2KX0A 4JLCA 4NQLB 2ZPYA 3V62A 2ZEQA 3A9KA 3DBSA 4G50A 2KQSA 2KK8A 2Y5BB 4MGKE 3JVZX 2GOWA 1WXSA 2MP2B 3L08A 1KJTA 3WIMA 4MSMB 2JRIB 3TCAA 2DYBA 4GDKB 1CMXB 2KDEB 2M1MA 2NS5A 2BYEA 4XZ4A 4I6LB 4ICUA 5E6OA 2OJRA 2G4SA 2GBKA 3EECA 3L16A 2ZNVC 2ZVOA 1SGHA 2KLCA 1V6EA 2JT4B 3ZNID 4ANWA 4M8MA 1KLVA 5DPSA 3RD2A 4W9JA 2DYMA 2KQ7A 2L0TA 2KD0A 5BO4B 4WJOA 1WGRA 3ML9A 3NOBA 4HCPB 3VUWA 1WJ6A 3UIOB 1HE8A 5D6JB 2K8CA 4CHKA 3PLVA 2GBJA 1EO6A 2KXJA 3TIXA 3PGEA 3X23A 2G45B 2XBBC 3WA0A 2FAZA 1IP9A 2AL3A 4IWPA 2K25A 3WANA 2WDTB 1I42A 2N9EB 1SE9A 3LDZE 3B1LX 2LD9A 3IBEA 1WRDB 2I1JA 1LXDA 4HPLB 3HM3A 2JPHA 5JHBA 3PS6A 1FXTB 3L13A 2R2OA 1E8WA 1V9JA 1E8ZA 2Z0EB 4TV3A 3UIPB 4A20A 3M3JA 3PREA 3PRMB 3A9KB 4IWOA 3VQIA 1EF5A 3V61A 4KVGB 3WAMA 5GMVA 3ZO5B 4PS8A 1OTRB 3QWZB 3JYUA 2C9WB 4HJKA 4K81A 2AEHA 2CHZA 2IO2B 2GBMA 4HWIB 4BVUC 3AU4A 1KOTA 2C60A 2KANA 4GB9A 1M94A 4M8NA 4KSLC 4AWJA 4DDID 3V6EB 2MBEA 1WXVA 2V3SA 3BY4B 4P7IA 5E6NA 1S3SG 3ZNGC 4HLEA 1EUVB 5CTRC 2NCNA 3B08A 2CS4A 2DZMA 1WJUA 2JUOA 4G0NB 1IPGA 5CX3A 3KUZA 2K39A 4NQKE 5D2MB 1V80A 2KWUB 4HPMB 3VTUA 4ZDVA 4IM2A 4KZCA 2LVQA 2KC1A 2MLBA 1YIWA 1WGGA 5EDSA 3C0RB 4HXDA 3SU8X 2N7DA 2BYVE 2MBBB 4BOZB 2CHXA 4K7WA 2VRRB 3ZKJC 4ANXA 2NR2A 3ZDTA 1WF9A 4GDKA 4EOYA 2C7NB 4AJWA 4GU2A 3ZUNA 1WGDA 2JVCA 2L76A 3K9OB 4FHJA 3IHPC 4YL8A 1WR1A 3RYTA 3SDLC 4ZYNA 2KZRA 3T8MA 3HM6X 4PYUA 1RAXA 2G3QB 1A5RA 2MBOA 3ONSA 2NVUI 4MGYE 1Q0WB 4DWFA 2LVOA 5J17A 2AWTA 1L2NA 2RSUA 3MJWA 2HTHA 3ZNZB 1WX7A 4CYEA 3L17A 2WX0A 2O2VA 3UQBA 3H7PB 2IBIB 1TGZB 2ZPNA 4AJYB 5D94A 2D11A 1LFDA 4K7SA 2N9XA 3ZDMC 3H1UA 2KO3A 3HIZA 4EZKA 3SHQA 1BT0A 3TMPB 3WAPA 5DPRA 2KJHB 2MBHA 2RPQA 3PZDA 3QX1A 3APFA 3Q3FA 3CF6E 2LASA 1UBIA 1WM3A 5G2NA 1WM2A 2JRHA 4WJPA 2M8SA 3UF8A 4TQ0A 3QAQA 3R66C 3VUYA 5CHVC 2KFKA 3M62B 3PPAA 2IO1B 4WAAA 2KJ6A 1S1QB 4W9FA 4XC2A 2K8HA 3TBLD 2G4DB 3A1QB 1ZGUB 2UWQA 4K1RB 2KJRA 3A4RA 4B6WA 2NBUA 2PPHA 2AL6A 4HCNB 5JHAA 3VTWA 5LLIA 2LJ5A 4DHJB 1WMHB 4IWQA 2N4FA 3ML8A 3K9PB 1UGMA 1Z5SB 2IYDB 4MDKE 4AOFA 4BBNC 2KC2A 4EUTA 5J2RA 2N7EA 5JH5C 1OGWA 4LDTB 4EKUA 1YQBA 4KDIC 1WJ4A 2PEAA 5LXIB 4TKNA 1ZKHA 5AZGA 4W9DA 2M4NA 1V86A 4FJVB 1E7VA 3OLMD 1WR6E 4URKA 1J0GA 2DHZA 3RT3B 2HE7A 2KVRA 2JF5A 4W9CA 3PVLA 4DXAB 2DAFA 2HJ8A 2PE9A 2BGFA 4W9GA 3PRZA 4W9IA 3UGBB 3HK0A 4W9HA 1GC6A 1UH6A 2KDBA 1WXMA 2O2VB 3DCGA 3PTFC 4JL9A 1R4MI 4A3PA 3O65B 2BWES 2R2QA 1XD3B 2BWFA 2D07B 2J0MA 4JGHB 2RGFA 3KUDB 4OVVA 4BFRA 3W1SA 3M63B 2V4LA 3R3MA 3PHXB 4NAWB 4FADA 2KTRB 3AXCA 3ZLZA 2EKEC 3JW0X 3N32A 1WY8A 3QA8A 4HDQA 2GBNA 2MW5A 3NHEB 2KDIA 3D32A 4FBJB 2KFKB 2Z0DB 2KOXA 2K8BA 5LXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW7 A;  2KHW B;  3VVW B;  4RM8 A;  3MTN B;  2LWP A;  3QIJ A;  4NPN A;  2LRW A;  4II3 B;  4F8C B;  2K1F A;  2LUE A;  3KUC B;  4ZRI A;  4F7Z A;  3H7P A;  4E71 A;  4DHJ D;  1P3Q U;  4EFO A;  4ANU A;  1GUA B;  3BIN A;  3DDC B;  2D3G A;  2MA9 B;  5CHF A;  2JY6 A;  1Q1O A;  5D7G A;  2FCQ A;  1L7Y A;  3QCA A;  4LDT D;  1SIF A;  4RMA A;  3DVN U;  2BKF A;  1WE7 A;  2L7R A;  2NPT B;  2NBW B;  3KVF B;  3KW5 B;  1WGH A;  1EF1 A;  3DOW A;  2EMT A;  3W1S C;  4GIV A;  3M95 A;  4F1S A;  4II2 B;  3VXW A;  4PYZ A;  4TQ1 A;  4WQO B;  4MGI E;  3A1Q A;  2FCN A;  2OOB B;  3APC A;  3GZN I;  2ZCC A;  3A9J B;  2DYO A;  4FJY A;  2KKC A;  1WMH A;  1WI0 A;  1YJ1 A;  2BYF A;  4FHK A;  2XEW A;  2BKR B;  4B95 A;  2MRP A;  1G6J A;  4WWN A;  2FNJ B;  2O6V B;  2JZZ A;  3GOE A;  3I3T B;  4KDL B;  5DPT A;  4ZRJ A;  2JWZ A;  3QAR A;  3V6C B;  1U4A A;  3ALB A;  2PJH A;  5CHW A;  4MJS B;  3KH0 A;  3P2B A;  1C3T A;  2IO0 B;  2FCS A;  3OAW A;  3JSV B;  3CSF A;  2KN5 A;  4GDL A;  3ZTC A;  3DBR I;  1E8Y A;  3DBH I;  5E6P A;  1P98 A;  3H7S A;  3KYC D;  2YLM A;  3QK0 A;  1P1A A;  2D2Q A;  3DPD A;  4IUM B;  5AEK B;  1T0Y A;  1TBE A;  1WJN A;  1UZX B;  2L3Z A;  2LGX A;  2LVP A;  4AUQ C;  1Q5W B;  2B3A A;  4PS3 A;  4DBG A;  2DZK A;  3ZRC A;  2IY1 B;  2D10 A;  2KMA A;  3H6N A;  5C1Z A;  4E3C A;  3Q3J A;  2QHO A;  1OEY J;  4NJ7 A;  4IG7 B;  1OQY A;  1RLF A;  3LJ3 A;  4NAW A;  4BKS D;  2C7M B;  2KTR A;  1WZ0 A;  4KSK C;  3AI5 A;  4DK5 A;  3AU5 A;  2ZCB A;  4I6N B;  2MWS B;  2ZZP B;  4DHZ E;  1WXA A;  4EZL A;  1H4R A;  1E8X A;  4BOS C;  1VCB A;  1WIA A;  3DQV A;  3EHV A;  3IFW B;  3EFU A;  1E5W A;  1LM8 B;  4RM9 A;  2KNB A;  3QC8 B;  4N9F 4;  2L0F A;  1MG8 A;  4LJP B;  1ISN A;  2KWC A;  1R4N I;  3W1Y A;  4EZJ A;  5L95 C;  4KIK B;  2O6V D;  1NBF C;  3VHT C;  4BKS A;  4FN2 A;  3U30 A;  2C5L C;  2NPT A;  3PSE B;  3MHS D;  3PLU A;  5G55 A;  3VUX A;  2FID A;  2MCN B;  4GDL B;  2J0K A;  2RR9 A;  1H8C A;  4WWP A;  2AYO B;  2YVC A;  4K7U A;  2BF8 B;  2LXA A;  3CMM B;  4MM3 A;  4FA6 A;  3R7Q A;  2DZJ A;  2RD0 A;  3S2A A;  5J18 A;  3RUI B;  3PRP B;  4IM3 A;  5L83 A;  1UBQ A;  1AAR A;  4ANV A;  3A9J A;  3L10 B;  1JRU A;  1RFA A;  1J19 A;  3QHT A;  4HK2 A;  1NI2 A;  3IG3 A;  3KYD D;  2ZVN A;  4FJZ A;  4OVU A;  3EC8 A;  5AZH A;  1WZ3 A;  4AP4 C;  4G3X B;  4NY0 A;  2O6V A;  1XT9 B;  3UQA A;  5AZF A;  1E7U A;  1WX9 A;  3VTV A;  3NY5 A;  3R7R A;  4MJS A;  1GC7 A;  4A3O A;  1XQQ A;  2N9P C;  3JSV A;  2ASQ A;  2K6Q A;  2J0J A;  3U8Z A;  2XK5 B;  2DX5 B;  1K8R B;  2MQJ A;  2UYZ B;  2JXX A;  4DHZ B;  2ZNV B;  4CO7 A;  2IO3 B;  1IYF A;  1WH3 A;  3L0W B;  2BPS A;  4KZ0 A;  4MEM A;  2J7Q B;  2IZV B;  1RRB A;  3PV1 A;  2CHW A;  3IVF A;  2GMI C;  4JQW C;  3VH4 B;  2M17 A;  2LRU A;  4IC7 B;  4WWO A;  1GJZ A;  4EEW A;  3X0W A;  3UIN B;  4PS7 A;  3N3K B;  1V5T A;  2I1K A;  2L8J A;  3ZVV A;  2WX1 A;  1F9J A;  4IM0 A;  3PT2 B;  4ZRK A;  3U7D A;  5DCN A;  1LQB A;  1WGY A;  2KLG A;  3DVG X;  4G11 A;  1I35 A;  1UEL A;  4GOC A;  1P9D U;  3DVG Y;  3QJZ A;  4WJN A;  3RUL A;  4ASW C;  3CST A;  1TTN A;  4GMV A;  1P0R A;  5IAA C;  2GBR A;  3VFK A;  2L00 B;  2KDF B;  5KHO A;  3NS8 A;  1V81 A;  2W9N A;  5JZE B;  2KTF A;  1Y8R C;  3ZIM A;  1NDD A;  2DAJ A;  3V60 A;  3OJ3 A;  1TZ1 A;  4MSQ B;  4TUU A;  2A5U A;  3TL5 A;  3ZRF A;  2ZJD A;  4KIK A;  4E74 A;  1E90 A;  1GNU A;  2LI5 A;  2NBV B;  3T9L A;  5C23 A;  2FIF A;  2WYQ A;  2FUH B;  3A4S C;  2LZ6 A;  3NZS A;  3NZU A;  4MH0 E;  1OEY A;  4W9K A;  2CKH B;  2N1W A;  3DVN V;  2MP2 A;  4BKT A;  2KX3 A;  3ZTD A;  2MX2 A;  2KFJ A;  1YX6 B;  4LJO B;  4DDG D;  3VAW A;  3B0A A;  1WYW B;  2DEN B;  3RZW C;  3RCZ A;  5HKH A;  3PHW B;  1KM7 A;  1VD2 A;  4I6P A;  4J6I A;  3AUL A;  4MGZ E;  4HVB A;  5DPW A;  2IY0 B;  3ENE A;  3DBL I;  4GN1 A;  1V2Y A;  3TJP A;  4FLH A;  3ZNH B;  4BBN F;  2KWV B;  2LGD A;  1C1Y B;  4GGQ A;  2LXC A;  4IW0 A;  1V5O A;  3HHM A;  4NJ6 A;  1WX8 A;  5IA7 A;  1YD8 U;  1YX5 B;  2M0X A;  2V1Y A;  2HD5 B;  3WAO A;  1V49 A;  2JZ3 B;  3VH3 B;  3WAL A;  3QQ8 B;  1QZE A;  4FUL A;  4JIO U;  2CU1 A;  1GG3 A;  1J8C A;  2FCM A;  2MSE D;  2A4Z A;  4GSW A;  2PE6 B;  2XK5 A;  2N1V A;  1D3Z A;  2REX A;  2MBQ A;  3APD A;  5TR5 A;  5KHQ A;  1UD7 A;  2L05 A;  2C7H A;  3H9D A;  2CR5 A;  3N30 A;  1PQS A;  4M0W B;  4W9E A;  2EMS A;  4BKG A;  3L54 A;  4GXB A;  4X57 B;  3ECI A;  4XX5 A;  3ZW3 A;  2LGY A;  4B9K A;  3OJ4 B;  4LCD E;  4HDO A;  4W9L A;  1WFY A;  2K6D B;  3A33 B;  2Z59 B;  4MEL A;  2KMC A;  2DZI A;  3RZF A;  4WJQ A;  3SD5 A;  1X1M A;  4NNJ B;  3VDZ A;  4KV2 A;  1Z2M A;  1WE6 A;  2WWZ A;  5FR6 A;  4ICV A;  2KX0 A;  4JLC A;  4NQL B;  2ZPY A;  3V62 A;  2ZEQ A;  3A9K A;  3DBS A;  4G50 A;  2KQS A;  2KK8 A;  2Y5B B;  4MGK E;  3JVZ X;  2GOW A;  1WXS A;  2MP2 B;  3L08 A;  1KJT A;  3WIM A;  4MSM B;  2JRI B;  3TCA A;  2DYB A;  4GDK B;  1CMX B;  2KDE B;  2M1M A;  2NS5 A;  2BYE A;  4XZ4 A;  4I6L B;  4ICU A;  5E6O A;  2OJR A;  2G4S A;  2GBK A;  3EEC A;  3L16 A;  2ZNV C;  2ZVO A;  1SGH A;  2KLC A;  1V6E A;  2JT4 B;  3ZNI D;  4ANW A;  4M8M A;  1KLV A;  5DPS A;  3RD2 A;  4W9J A;  2DYM A;  2KQ7 A;  2L0T A;  2KD0 A;  5BO4 B;  4WJO A;  1WGR A;  3ML9 A;  3NOB A;  4HCP B;  3VUW A;  1WJ6 A;  3UIO B;  1HE8 A;  5D6J B;  2K8C A;  4CHK A;  3PLV A;  2GBJ A;  1EO6 A;  2KXJ A;  3TIX A;  3PGE A;  3X23 A;  2G45 B;  2XBB C;  3WA0 A;  2FAZ A;  1IP9 A;  2AL3 A;  4IWP A;  2K25 A;  3WAN A;  2WDT B;  1I42 A;  2N9E B;  1SE9 A;  3LDZ E;  3B1L X;  2LD9 A;  3IBE A;  1WRD B;  2I1J A;  1LXD A;  4HPL B;  3HM3 A;  2JPH A;  5JHB A;  3PS6 A;  1FXT B;  3L13 A;  2R2O A;  1E8W A;  1V9J A;  1E8Z A;  2Z0E B;  4TV3 A;  3UIP B;  4A20 A;  3M3J A;  3PRE A;  3PRM B;  3A9K B;  4IWO A;  3VQI A;  1EF5 A;  3V61 A;  4KVG B;  3WAM A;  5GMV A;  3ZO5 B;  4PS8 A;  1OTR B;  3QWZ B;  3JYU A;  2C9W B;  4HJK A;  4K81 A;  2AEH A;  2CHZ A;  2IO2 B;  2GBM A;  4HWI B;  4BVU C;  3AU4 A;  1KOT A;  2C60 A;  2KAN A;  4GB9 A;  1M94 A;  4M8N A;  4KSL C;  4AWJ A;  4DDI D;  3V6E B;  2MBE A;  1WXV A;  2V3S A;  3BY4 B;  4P7I A;  5E6N A;  1S3S G;  3ZNG C;  4HLE A;  1EUV B;  5CTR C;  2NCN A;  3B08 A;  2CS4 A;  2DZM A;  1WJU A;  2JUO A;  4G0N B;  1IPG A;  5CX3 A;  3KUZ A;  2K39 A;  4NQK E;  5D2M B;  1V80 A;  2KWU B;  4HPM B;  3VTU A;  4ZDV A;  4IM2 A;  4KZC A;  2LVQ A;  2KC1 A;  2MLB A;  1YIW A;  1WGG A;  5EDS A;  3C0R B;  4HXD A;  3SU8 X;  2N7D A;  2BYV E;  2MBB B;  4BOZ B;  2CHX A;  4K7W A;  2VRR B;  3ZKJ C;  4ANX A;  2NR2 A;  3ZDT A;  1WF9 A;  4GDK A;  4EOY A;  2C7N B;  4AJW A;  4GU2 A;  3ZUN A;  1WGD A;  2JVC A;  2L76 A;  3K9O B;  4FHJ A;  3IHP C;  4YL8 A;  1WR1 A;  3RYT A;  3SDL C;  4ZYN A;  2KZR A;  3T8M A;  3HM6 X;  4PYU A;  1RAX A;  2G3Q B;  1A5R A;  2MBO A;  3ONS A;  2NVU I;  4MGY E;  1Q0W B;  4DWF A;  2LVO A;  5J17 A;  2AWT A;  1L2N A;  2RSU A;  3MJW A;  2HTH A;  3ZNZ B;  1WX7 A;  4CYE A;  3L17 A;  2WX0 A;  2O2V A;  3UQB A;  3H7P B;  2IBI B;  1TGZ B;  2ZPN A;  4AJY B;  5D94 A;  2D11 A;  1LFD A;  4K7S A;  2N9X A;  3ZDM C;  3H1U A;  2KO3 A;  3HIZ A;  4EZK A;  3SHQ A;  1BT0 A;  3TMP B;  3WAP A;  5DPR A;  2KJH B;  2MBH A;  2RPQ A;  3PZD A;  3QX1 A;  3APF A;  3Q3F A;  3CF6 E;  2LAS A;  1UBI A;  1WM3 A;  5G2N A;  1WM2 A;  2JRH A;  4WJP A;  2M8S A;  3UF8 A;  4TQ0 A;  3QAQ A;  3R66 C;  3VUY A;  5CHV C;  2KFK A;  3M62 B;  3PPA A;  2IO1 B;  4WAA A;  2KJ6 A;  1S1Q B;  4W9F A;  4XC2 A;  2K8H A;  3TBL D;  2G4D B;  3A1Q B;  1ZGU B;  2UWQ A;  4K1R B;  2KJR A;  3A4R A;  4B6W A;  2NBU A;  2PPH A;  2AL6 A;  4HCN B;  5JHA A;  3VTW A;  5LLI A;  2LJ5 A;  4DHJ B;  1WMH B;  4IWQ A;  2N4F A;  3ML8 A;  3K9P B;  1UGM A;  1Z5S B;  2IYD B;  4MDK E;  4AOF A;  4BBN C;  2KC2 A;  4EUT A;  5J2R A;  2N7E A;  5JH5 C;  1OGW A;  4LDT B;  4EKU A;  1YQB A;  4KDI C;  1WJ4 A;  2PEA A;  5LXI B;  4TKN A;  1ZKH A;  5AZG A;  4W9D A;  2M4N A;  1V86 A;  4FJV B;  1E7V A;  3OLM D;  1WR6 E;  4URK A;  1J0G A;  2DHZ A;  3RT3 B;  2HE7 A;  2KVR A;  2JF5 A;  4W9C A;  3PVL A;  4DXA B;  2DAF A;  2HJ8 A;  2PE9 A;  2BGF A;  4W9G A;  3PRZ A;  4W9I A;  3UGB B;  3HK0 A;  4W9H A;  1GC6 A;  1UH6 A;  2KDB A;  1WXM A;  2O2V B;  3DCG A;  3PTF C;  4JL9 A;  1R4M I;  4A3P A;  3O65 B;  2BWE S;  2R2Q A;  1XD3 B;  2BWF A;  2D07 B;  2J0M A;  4JGH B;  2RGF A;  3KUD B;  4OVV A;  4BFR A;  3W1S A;  3M63 B;  2V4L A;  3R3M A;  3PHX B;  4NAW B;  4FAD A;  2KTR B;  3AXC A;  3ZLZ A;  2EKE C;  3JW0 X;  3N32 A;  1WY8 A;  3QA8 A;  4HDQ A;  2GBN A;  2MW5 A;  3NHE B;  2KDI A;  3D32 A;  4FBJ B;  2KFK B;  2Z0D B;  2KOX A;  2K8B A;  5LXH A; 
#chains in the Genus database with same CATH topology
 3RMK C;  1ZW7 A;  3ABV B;  4ZHO A;  1L6U A;  4RFB A;  1QOF A;  4ZRI A;  4E71 A;  1EM7 A;  1P3Q U;  4EFO A;  3DDC B;  3NVW A;  2MA9 B;  4KX6 B;  3P4S B;  3QCA A;  4RMA A;  2INP E;  2L7R A;  2NBW B;  3KW5 B;  3EUB 2;  1EF1 A;  4K3C A;  1IGD A;  3W1S C;  4GIV A;  1ZUD 2;  3Q8E A;  4II2 B;  1OQR A;  1XLP A;  2VH2 A;  4MM3 B;  4MGI E;  2FCN A;  4M00 A;  3A9J B;  2KKC A;  1WMH A;  3NVV A;  3TSS A;  1L4D B;  2V3N A;  2MRP A;  1ZPS A;  4ZOH C;  2H89 B;  4WWN A;  5DPT A;  1U4A A;  4MJS B;  1ESF A;  1OFF A;  2KN5 A;  3MHZ A;  3ZTC A;  5E6P A;  3H7S A;  2YLM A;  1P1A A;  3DPD A;  5AEK B;  4M01 A;  1N63 A;  2LJI A;  1UZX B;  3GB1 A;  2L3Z A;  2LGX A;  1Q5W B;  4DBG A;  4RGO S;  3Q3N C;  4NJ7 A;  4IG7 B;  4BKS D;  2C7M B;  2W3R A;  1H4R A;  1E8X A;  3DQV A;  3IFW B;  1F77 A;  1E5W A;  1LM8 B;  3T3N A;  3QC8 B;  2DNF A;  4C7Y A;  2KWC A;  3W1Y A;  4EZJ A;  3MC8 A;  1VZ7 A;  2O6V D;  1NBF C;  4FN2 A;  2C5L C;  2NPT A;  1L4Z B;  4WWP A;  3CWI A;  2BF8 B;  2LXA A;  3CMM B;  5EE9 A;  4FA6 A;  1NI3 A;  3PRP B;  1JWB D;  5AZH A;  2INC C;  3EC8 A;  4AP4 C;  1E7U A;  5EE1 A;  2YEP F;  3NY5 A;  2AQ3 B;  3U2S C;  1GC7 A;  1M4V A;  2K6Q A;  4MAC A;  2DX5 B;  1K8R B;  2B76 B;  2MQJ A;  2UYZ B;  2JXX A;  1TKG A;  1IYF A;  1EU3 A;  2BPS A;  3U52 E;  4MEM A;  2IZV B;  2GMI C;  4JQW C;  4WWO A;  1P7E A;  2MHJ A;  3UIN B;  4PS7 A;  4OZA A;  3N3K B;  1V5T A;  1QKZ A;  2L8J A;  3ZVV A;  1F9J A;  4ZRK A;  2WXN A;  3PT2 B;  1BML C;  3U7D A;  1LQB A;  1YN3 A;  1WSP A;  3DVG Y;  4WJN A;  3SR6 A;  5IAA C;  5BMG A;  4WUR A;  4M02 A;  4L23 A;  1SIJ A;  5EE3 A;  1IUE A;  1V81 A;  3AN1 A;  1Y8R C;  3ZIM A;  1NDD A;  1TZ1 A;  1J7C A;  2A5U A;  3LXF A;  2ZJD A;  4E74 A;  2LI5 A;  4ITK A;  2FIF A;  4W9K A;  2CKH B;  1JWA D;  2MP2 A;  4BKT A;  2KX3 A;  2NTT A;  2M56 B;  3MC0 B;  3B0A A;  1WYW B;  2PMV A;  3VAW A;  3RCZ A;  3PHW B;  1KM7 A;  4HVB A;  3PZ7 A;  4HRO A;  3DBL I;  4GN1 A;  1NYR A;  4FXC A;  3RPF C;  3NG0 A;  4WAF A;  2OHF A;  2AQ1 B;  2LGD A;  1GB1 A;  3NS1 A;  3DBR B;  1XLO A;  1GB4 A;  2WDQ B;  3AEE B;  2JZ3 B;  4BZA A;  2CJN A;  3VH3 B;  3RNF C;  4FUL A;  1J8C A;  5AUI A;  1VZ8 A;  2RDH A;  5TR5 A;  1JWM D;  1GAQ B;  1UD7 A;  2C7H A;  3H9D A;  3Q8A A;  1PQS A;  4XX5 A;  5IN7 A;  3OJ4 B;  4LCD E;  4HDO A;  1SEB D;  2KMC A;  2DZI A;  1MG4 A;  1MJD A;  4KV2 A;  5FR6 A;  4JLC A;  2GB1 A;  3B2G A;  3Q2A C;  1AWD A;  2Y5B B;  4MGK E;  3JVZ X;  2WXO A;  4O1N A;  1PGB A;  2MP2 B;  2INN E;  1KJT A;  4MSM B;  2JRI B;  2BYE A;  2JSV X;  2G4S A;  2BB6 A;  2WQY B;  3L16 A;  3N9Y C;  1V6E A;  4M8M A;  2OED A;  2KD0 A;  4WJO A;  1WJ6 A;  1A70 A;  5D6J B;  2GRI A;  3RI7 C;  2G45 B;  3WA0 A;  1TT5 B;  4IWP A;  1KFY B;  2K25 A;  1I42 A;  1F2R I;  2LD9 A;  3IBE A;  4A55 A;  1LXD A;  1WRI A;  1FXT B;  1ZE3 D;  4XWW A;  3P42 A;  3AM9 A;  4WQM A;  3I5J C;  1QT9 A;  1OTR B;  2MH7 A;  3JYU A;  4HWI B;  3AU4 A;  4GB9 A;  4DDI D;  4B0E A;  4M0W A;  3V6E B;  2V3S A;  3C8Y A;  1EUV B;  2KAJ A;  1C76 A;  1WJU A;  2JUO A;  3NZ3 A;  1EU4 A;  2L52 A;  2PW9 A;  5D2M B;  4HPM B;  3VTU A;  4NZL B;  4IM2 A;  2VH1 A;  2KC1 A;  2MLB A;  1YIW A;  1WGG A;  2MBB B;  3ZKJ C;  4ANX A;  2NR2 A;  4D2K A;  2WXG A;  2C7N B;  3ZQ4 A;  4A8X C;  1KH0 A;  2KYW A;  4YL8 A;  1WR1 A;  3RYT A;  3T8M A;  4JPS A;  4PYU A;  1FNU A;  1A5R A;  2MBO A;  1L2N A;  4LNN A;  1E10 A;  2HTH A;  1WX7 A;  3L17 A;  2WX0 A;  3H7P B;  4K7S A;  3ZDM C;  4A6Q A;  3WAP A;  2RPQ A;  3PZD A;  2K3U A;  3APF A;  3CF6 E;  5G2N A;  1WM2 A;  2VZK B;  1JAL A;  4LK0 M;  2LFI A;  5CHV C;  4WAA A;  2KJ6 A;  1S1Q B;  2KJR A;  3A4R A;  2NBU A;  2RMM A;  5LLI A;  3K9P B;  5IOI A;  4EUT A;  4OHJ A;  1FCL A;  1WJ4 A;  5LXI B;  4TKN A;  1ZKH A;  2QEJ C;  4W9D A;  2M4N A;  1V86 A;  4FJV B;  1E7V A;  1J0G A;  2DHZ A;  3RT3 B;  4DXA B;  1UH6 A;  4WWM A;  2D3B A;  1V8C A;  1XD3 B;  4JGH B;  1KRH A;  4OVV A;  4BFR A;  2LEK A;  3R3M A;  1XCQ L;  1UF0 A;  2KTR B;  4H2A A;  3N32 A;  4HDQ A;  1WY8 A;  2MW5 A;  3RNA C;  5EE0 A;  5LXH A;  2KHW B;  4ARI A;  3MTN B;  1DOX A;  1PGA A;  2LRW A;  3AED B;  4F8C B;  5FK9 C;  1I4R A;  1SE4 A;  2LUE A;  3AE9 B;  2W54 A;  3L4P A;  4ANU A;  1GUA B;  4LNI A;  3AE6 B;  4RNA A;  1L7Y A;  1LO5 D;  3KVF B;  1WGH A;  3AV8 A;  2WU5 B;  3VXW A;  4TQ1 A;  3KLS X;  3DHG C;  1F1H A;  1WI0 A;  2W3S A;  2XEW A;  1T5X D;  1I4X A;  4B95 A;  3SFE B;  1SSN A;  2O6V B;  2JZZ A;  2X8X X;  3I3T B;  4KDL B;  2G9H D;  4ZRJ A;  2JWZ A;  3V6C B;  3ALB A;  1HXY D;  2WXI A;  1YMH E;  2M19 A;  2IO0 B;  2FCS A;  4IKG A;  4GDL A;  3DBH I;  1P98 A;  3DHI C;  2D2Q A;  2JX5 A;  1T0Y A;  2Z8L A;  4PS3 A;  2DZK A;  1CZP A;  1C78 A;  1D4B A;  1TJE A;  4E3C A;  3Q3J A;  1OEY J;  3LJ3 A;  4NAW A;  3AE1 B;  1C4P A;  3J9C A;  4AS1 A;  4B0M A;  1WZ0 A;  4KSK C;  4DK5 A;  1MHH E;  1C9F A;  2ZZP B;  5C3J B;  1E6E B;  1NVI D;  2J42 A;  4TSS A;  4N9F 4;  2L0F A;  3BII D;  4K3B A;  5L95 C;  4KIK B;  3HUI A;  3U30 A;  2FID A;  1PFD A;  4GDL B;  2RR9 A;  4N6E B;  4MM3 A;  5FKA C;  3R7Q A;  2Y3A A;  3W2D A;  1STE A;  5J18 A;  4IM3 A;  3HVZ A;  5L83 A;  1JRP A;  2LMC A;  3A9J A;  3Q6B A;  4HK2 A;  4Q2J A;  1NI2 A;  3KYD D;  3Q8C A;  1WZ3 A;  1FPY A;  4OW0 A;  4HPP A;  3R7R A;  4MJS A;  4A3O A;  2KVZ A;  1V1O A;  1ET6 A;  4YXD B;  3U8Z A;  2XK5 B;  1R4M B;  2WLB A;  4CO7 A;  2BTE A;  4BAX A;  1V1P B;  2KMM A;  2GI9 A;  3PV1 A;  3VH4 B;  1FO4 A;  2FBW B;  2M17 A;  1GJZ A;  4EEW A;  5GXG B;  2I1K A;  1SBB B;  4MH8 A;  3IAS 1;  5DCN A;  4G11 A;  1ROE A;  1I35 A;  3CST A;  1P0R A;  3LB8 C;  1UGJ A;  2KTF A;  3TEX A;  4OZC A;  1XF5 L;  4KGR A;  1D6E C;  1J7A A;  3ZRF A;  1ET9 A;  3T9L A;  3Q8B A;  1L0X B;  2WYQ A;  3A4S C;  3NZS A;  3NZU A;  3BWU D;  4IOI E;  3GZN B;  2YEP B;  3GE8 C;  1YX6 B;  3RZW C;  2DEN B;  3B9J A;  3Q14 C;  1KLG D;  3AUL A;  3Q3O C;  2IY0 B;  3PZ8 A;  1WGK A;  1V2Y A;  3TJP A;  4FLH A;  3ZNH B;  4BBN F;  1CQV A;  2JXT A;  4GGQ A;  2LXC A;  2K9X A;  4IW0 A;  1V5O A;  1YD8 U;  1JCK B;  2R61 A;  1V49 A;  1VR9 A;  1FD6 A;  4JIO U;  2FCM A;  3WCQ A;  1RYJ A;  1D3Z A;  2L83 A;  2REX A;  2MBQ A;  3APD A;  4QAY A;  2L05 A;  3R2T A;  1EWY C;  3L54 A;  4GXB A;  3ECI A;  4W9L A;  2K6D B;  3VDZ A;  3NJT A;  2Y5C A;  1WE6 A;  2BBC A;  5BMI A;  2KX0 A;  4US9 A;  2G1E A;  4G50 A;  2KQS A;  3CIR B;  3TCA A;  4GDK B;  1CMX B;  1R4N B;  2M1M A;  4JWU C;  2NS5 A;  5E6O A;  3AE4 B;  2SAK A;  1FXA A;  2ZW0 A;  2JWU A;  3AMZ A;  1SGH A;  4N58 A;  4ANW A;  3VRA B;  2WU2 B;  3RD2 A;  2NTS A;  2KQ7 A;  2GLS A;  2WXF A;  3P4Q B;  2JZP A;  1VJK A;  3UIO B;  4C56 C;  3PLV A;  2GBJ A;  3TIX A;  2FAZ A;  1IP9 A;  1C4C A;  3WAN A;  2WDV B;  4C7Z A;  3LDZ E;  1SE9 A;  2IGD A;  1XEE A;  1FNW A;  1WRD B;  2HJ1 A;  1FNV A;  3HVD A;  3L13 A;  4XWT A;  4DXG A;  3UIP B;  4TV3 A;  4A20 A;  3PRM B;  2K0P A;  2KWD A;  3WAM A;  5GMV A;  3ZO5 B;  4PS8 A;  4REZ A;  4HJK A;  2CHZ A;  4BVU C;  1FCC C;  1Y56 A;  3FC4 A;  1K53 A;  3H8H A;  2C60 A;  1M94 A;  2LHD A;  3ZNG C;  4P7I A;  5CTR C;  2NCN A;  3AEG B;  3B08 A;  5HFY A;  2DZM A;  3KUZ A;  1N6Z A;  1N60 A;  2K39 A;  4ZDV A;  1JML A;  4KZC A;  1P7F A;  2QIE B;  3URY A;  4EE2 A;  3C0R B;  4HXD A;  5EDS A;  2LGI A;  4BOZ B;  4YTP B;  2XNA C;  1WF9 A;  2L1A A;  1I4H A;  2JVC A;  1RM6 C;  2L76 A;  4FHJ A;  2N9K A;  4HEA 1;  1UNS A;  4ZYN A;  2D5G A;  3HM6 X;  2G3Q B;  4ZYS A;  3AEC B;  3TEW A;  4RH6 A;  1MI0 A;  3ONS A;  2NVU I;  4YSX B;  1GOZ A;  2LVO A;  5J17 A;  2RSU A;  2ZPN A;  4AJY B;  5D94 A;  2N9X A;  3I57 A;  2KO3 A;  2KJH B;  2MBH A;  2LAS A;  3R8B A;  1T0Q C;  2M8S A;  3UF8 A;  3R66 C;  5BYR A;  3M62 B;  3PPA A;  2IO1 B;  4RGN A;  4W9F A;  3TBL D;  1E9M A;  3A1Q B;  1ZGU B;  2WXJ A;  4K1R B;  4B6W A;  2PPH A;  5JHA A;  2BS3 B;  1MVK A;  2K5P A;  3ML8 A;  2IYD B;  4BBN C;  4XDD A;  1IBX B;  3GP7 A;  5G5H A;  1ZDV A;  1ZOY B;  4NAM A;  1KF6 B;  2HE7 A;  3PVL A;  2JU6 X;  2DAF A;  2PE9 A;  4W9G A;  3I63 C;  4W9I A;  1T0S C;  2WXP A;  3HK0 A;  2KDB A;  2QSD A;  3O65 B;  1JWS D;  2R2Q A;  4ARC A;  1TKY A;  1D5M C;  2J0M A;  1ACC A;  2RGF A;  3KUD B;  3W1S A;  3BVZ A;  3M63 B;  2V4L A;  5D3D A;  2CJO A;  1I4P A;  2EKE C;  3JW0 X;  2I38 A;  2WXR A;  3RNE C;  1L6V A;  4FBJ B;  2Z0D B;  2KOX A;  4JWS C;  3VVW B;  1ZDX A;  4RM8 A;  3QIJ A;  2LWP A;  3RNC C;  4II3 B;  4ZRP A;  4F7Z A;  3H7P A;  2D3G A;  5CHF A;  1Q1O A;  2FCQ A;  3BVG A;  3NVY A;  3DVN U;  2BKF A;  2IJ0 A;  3IT6 B;  3AE5 B;  2EMT A;  1EWC A;  4WQO B;  3BYY B;  4WH4 A;  2OOB B;  2N0S B;  4AQ7 A;  2N9L A;  2BYF A;  2FNJ B;  1I4G A;  3QAR A;  4LLG M;  3P2B A;  3N20 C;  1SE2 A;  3OAW A;  3JSV B;  1CJE A;  1PDX A;  3DBR I;  1E8Y A;  3QK0 A;  4IUM B;  3AE3 B;  1TBE A;  2WNM A;  4AUQ C;  2B3A A;  3ZRC A;  5H92 C;  4C4V B;  1QQR A;  4C80 A;  1OQY A;  1RLF A;  5H8Y E;  1YQ3 B;  2KTR A;  2ZCB A;  2MWS B;  5HG2 A;  4EZL A;  4BOS C;  2JQR B;  1VRA B;  4RM9 A;  4L1B A;  3SEB A;  1MG8 A;  3NRZ A;  4LJP B;  1ISN A;  1HA5 A;  2EEL A;  1SB3 C;  3VHT C;  1N5W A;  4BKS A;  5FR3 A;  3T3O A;  3MHS D;  3PLU A;  5G55 A;  1DYQ A;  2AYO B;  4ACF A;  3AE8 B;  4XYC A;  2PVO D;  5AUK A;  3S2A A;  1UBQ A;  2K22 A;  4ANV A;  1JRU A;  3NUH B;  1J19 A;  3QHT A;  4FJZ A;  4OVU A;  2BYT A;  3ZXV A;  3IT4 B;  4NY0 A;  2O6V A;  1MFW A;  1R7S A;  1PYW D;  1XT9 B;  1F2R C;  5AZF A;  5BYS A;  1VZ6 A;  1WX9 A;  3UQA A;  2ASQ A;  3N1Y C;  2J0J A;  2J4X A;  4DHZ B;  1N61 A;  1DOY A;  4KZ0 A;  2J7Q B;  1RRB A;  2V0G A;  2CHW A;  2KQ4 X;  4IC7 B;  3AE2 B;  1L5P A;  3AEA B;  1JRO A;  2SEB D;  2KLG A;  4C00 A;  1BXT A;  4GMV A;  2GBR A;  5IKC M;  4N59 A;  4XGA B;  2KDF B;  2W9N A;  5JZE B;  3N1X C;  1NYQ A;  2DAJ A;  3V60 A;  4NJC A;  3E56 A;  4TUU A;  1TS4 A;  1FRD A;  1TYG B;  4KIK A;  4LNF A;  1E90 A;  1NEN B;  2NBV B;  3BVM A;  3R2I A;  2FUH B;  2LZ6 A;  1OEY A;  2IPK D;  1HTQ A;  4LJO B;  2KFJ A;  2LUM A;  4IDI A;  4DDG D;  4MGZ E;  1B1Z A;  5DPW A;  3GE3 C;  1HZ5 A;  4A90 A;  2KWV B;  3Q3M C;  3ZYY X;  2LGS A;  1XXG A;  4NJ6 A;  3U7Z A;  5IA7 A;  5MPO A;  2BS2 B;  2V1Y A;  3BK2 A;  4LNK A;  1AN8 A;  1SXT A;  1BUI C;  3QQ8 B;  2CU1 A;  2KT7 A;  2MSE D;  4GSW A;  2XK5 A;  2N1V A;  5KHQ A;  1V1P A;  1T0R C;  2CR5 A;  3N30 A;  2EMS A;  4BKG A;  3B2F A;  4X57 B;  1HEZ E;  1TIF A;  3A33 B;  4MEL A;  2QJL A;  2MEK A;  3SD5 A;  1X1M A;  4NNJ B;  5LNK 1;  2WWZ A;  4ICV A;  4KGS A;  4NQL B;  3V62 A;  2ZEQ A;  3A9K A;  3DBS A;  2OJW A;  2KK8 A;  1PUT A;  1TS2 A;  2PTL A;  3WIM A;  5C2T B;  4XZ4 A;  4ICU A;  2WP9 B;  2GBK A;  1FIQ A;  3EEC A;  3IAM 1;  2ZNV C;  5E6J A;  2ZVO A;  3NVZ A;  2BVC A;  3P4R B;  5G5G A;  5DPS A;  2DYM A;  4YTN B;  4DQO C;  1WGR A;  3ML9 A;  1SF0 A;  4HCP B;  1HE8 A;  2K8C A;  2KXJ A;  3X23 A;  2AL3 A;  1VLB A;  3FAH A;  2I1J A;  4HPL B;  2J53 A;  3HM3 A;  2JPH A;  3UI3 A;  1YOV B;  5JHB A;  3KWL A;  1E7P B;  2R2O A;  1E8W A;  1V9J A;  1E8Z A;  2Z0E B;  4R3D A;  2W55 A;  3M3J A;  4P1C C;  3A9K B;  3V61 A;  4KVG B;  1TZO A;  5JXV A;  1YQ4 B;  2MJD A;  3C19 A;  2E3T A;  1KOT A;  4HKQ A;  4M8N A;  4AWJ A;  3MC9 A;  1QIL A;  1WXV A;  1S3S G;  2CS4 A;  4ZHP A;  2JYE A;  4NQK E;  1V80 A;  4GLS C;  1YJJ A;  5T8I A;  2J52 A;  2N7D A;  4XDC A;  1XLN A;  2DBY A;  2BYV E;  4JE3 B;  2CHX A;  2WS3 B;  4K7W A;  4RF0 A;  4GDK A;  2IDY A;  4AJW A;  3EFC A;  4GU2 A;  1WGD A;  2L32 A;  2HDE A;  3SDL C;  4US8 A;  1RAX A;  1ZXI A;  2XN9 C;  1QOG A;  4MGY E;  1Q0W B;  1NEK B;  1QLB B;  3OWE B;  3MJW A;  1F0Z A;  2QDF A;  2O2V A;  3DBL B;  2IBI B;  4YWG G;  2D11 A;  3HIZ A;  1QF6 A;  4S17 A;  1GPX A;  1BT0 A;  3TMP B;  5DPR A;  4YSY B;  3ZJU A;  4YSZ B;  3OG5 A;  1UBI A;  1WM3 A;  4RCO A;  1FXI A;  2JRH A;  4WJP A;  4TQ0 A;  3QAQ A;  5HHD G;  1ZXH A;  2WXK A;  2KFK A;  2K8H A;  2G4D B;  2UWQ A;  4J3O D;  1YN4 A;  2AL6 A;  4HCN B;  1WMH B;  1YJI A;  2N4F A;  1UGM A;  1Z5S B;  4MDK E;  2H88 B;  2KC2 A;  1AYF A;  5JH5 C;  1FRR A;  1OGW A;  4EKU A;  2W82 A;  1YQB A;  3PO0 A;  2PEA A;  2WDR B;  1MHX A;  3OLM D;  1WR6 E;  4URK A;  3W5U B;  2WXM A;  1WXQ A;  2KVR A;  2JF5 A;  3W9C B;  3BZD B;  2BGF A;  1QOB A;  2O2V B;  4KKI A;  1R4M I;  1I7H A;  2BWF A;  2D3C A;  4RGM A;  3SFD B;  3KWV A;  3PHX B;  4FAD A;  3AXC A;  3ZLZ A;  1TKE A;  4L2Y A;  3QA8 A;  2GBN A;  3FKY A;  3NHE B;  2KDI A;  3D32 A;  2KFK B;  3PTF C;  2WHI A;  4NPN A;  3AEB B;  2K1F A;  3KUC B;  4P16 A;  4DHJ D;  1HTO A;  2ACZ B;  3BIN A;  4P1B C;  2ONQ A;  2BW2 A;  2JY6 A;  5D7G A;  4LDT D;  1SIF A;  1CK1 A;  3ZXR A;  1WE7 A;  2NPT B;  3AB5 A;  3DOW A;  1UUP A;  4HKZ E;  3M95 A;  4F1S A;  4PYZ A;  3W5V B;  3A1Q A;  2QCZ A;  3LYY A;  1FFV A;  1FMA D;  1XCT L;  3APC A;  2RPV A;  3GZN I;  2WXH A;  2ZCC A;  4FJY A;  2DYO A;  1YJ1 A;  2Y5P A;  4FHK A;  2QIL A;  2BKR B;  1IBX A;  1G6J A;  3V05 A;  3GOE A;  1V97 A;  2PJH A;  1JW9 D;  5CHW A;  3KH0 A;  1C3T A;  3CSF A;  3IXS A;  3KYC D;  1MPE A;  2EKI A;  4PT5 A;  1C79 A;  1WJN A;  2LVP A;  2IY1 B;  2D10 A;  2KMA A;  3H6N A;  5C1Z A;  3HRD D;  3TEY A;  2QHO A;  5D3I B;  1JQ4 A;  1YNT E;  3AI5 A;  3AU5 A;  2DWQ A;  4I6N B;  3E9S A;  4DHZ E;  1WXA A;  1K51 A;  1VCB A;  1WIA A;  3EHV A;  1KTK A;  3EFU A;  5IP4 D;  2KNB A;  4DXF A;  2X38 A;  4YT0 B;  1D5X C;  3RNG C;  1C77 A;  1R4N I;  4OVZ A;  1XLQ A;  2AQ2 B;  3PSE B;  3VUX A;  2MCN B;  2J0K A;  1H8C A;  1N5X A;  2YVC A;  5I4D A;  4K7U A;  3EGR A;  2DZJ A;  2RD0 A;  1I4Q A;  2PKO A;  4OZB A;  3RUI B;  1AAR A;  3L10 B;  1RFA A;  2PIA A;  3IG3 A;  2ZVN A;  4G3X B;  3RN9 C;  3VTV A;  1K50 A;  4A9A A;  4USA A;  1XQQ A;  2N9P C;  3JSV A;  1QOA A;  3VR9 B;  2ZNV B;  2IO3 B;  1WH3 A;  3L0W B;  2KAC A;  3IVF A;  2LRU A;  2BB5 A;  3X0W A;  4C4V A;  2PLP A;  2WX1 A;  4IM0 A;  5IO9 A;  1SJE D;  1WGY A;  1E0Z A;  3DVG X;  4TMA B;  5BYQ A;  1UEL A;  3FIL A;  1P9D U;  3QJZ A;  4GOC A;  4ASW C;  3RUL A;  1TTN A;  3ZGZ A;  3VFK A;  2L00 B;  5KHO A;  3NS8 A;  4KKJ A;  2BS4 B;  2MJE A;  5TSS A;  2WXQ A;  3ZJT A;  3OJ3 A;  4MSQ B;  1YN5 A;  3DHH C;  2TSS A;  3TL5 A;  2WXL A;  3P63 A;  1GNU A;  1XO3 A;  1L0Y B;  5C23 A;  3I9V 1;  1D5Z C;  3ETR A;  4MH0 E;  2BQQ A;  2LHE A;  1ENF A;  2N1W A;  3DVN V;  4UDU C;  2E6X A;  3ZTD A;  1RWS A;  2MX2 A;  5HKH A;  1SE3 A;  4J6I A;  4I6P A;  1VD2 A;  1SJH D;  3ENE A;  1J7B A;  3P1M A;  1FEH A;  1K52 A;  3DWM A;  1C1Y B;  3HHM A;  1WX8 A;  3DWG C;  4HRS A;  1YX5 B;  2BT6 A;  3DBH B;  2D3A A;  2M0X A;  2HD5 B;  3WAO A;  2KN4 A;  3FIL B;  3WAL A;  1QZE A;  1GG3 A;  2A4Z A;  2PE6 B;  1DOI A;  3Q69 A;  1Q10 A;  4LNO A;  4M0W B;  4W9E A;  3ZW3 A;  2LGY A;  4B9K A;  1F52 A;  4XE0 A;  1WFY A;  2Z59 B;  3RZF A;  4WJQ A;  2QC8 A;  2HTM E;  1Z2M A;  2ZPY A;  4RF1 A;  2GOW A;  1WXS A;  3L08 A;  2KDM A;  2DYB A;  2KDE B;  2ON8 A;  4I6L B;  2V4I B;  2OJR A;  4WIP A;  3GS2 A;  2Q5W D;  2V9H A;  2KLC A;  1PGX A;  2JT4 B;  3ZNI D;  1KLV A;  4W9J A;  2V3P A;  3AE7 B;  2L0T A;  4HJG E;  1N62 A;  5BO4 B;  3NOB A;  3VUW A;  4CHK A;  2I2Y A;  5BMH A;  3TUO A;  1EO6 A;  3PGE A;  2XBB C;  3AH7 A;  1FM0 D;  2IGG A;  1B9R A;  2WDT B;  2N9E B;  3B1L X;  3KQ4 A;  4S0R A;  2N7J A;  3PS6 A;  3BK1 A;  4MT5 A;  1FFU A;  3PRE A;  4IWO A;  3VQI A;  1EF5 A;  1HQR D;  4CQN A;  1OQQ A;  4JX1 C;  3QWZ B;  2C9W B;  4K81 A;  2AEH A;  2IO2 B;  2GBM A;  3P4P B;  2WGS A;  3Q8F A;  1T3Q A;  1UWM A;  2KAN A;  4ZRQ A;  4KSL C;  1ZP0 B;  1TY2 A;  2MBE A;  3BY4 B;  4HLE A;  5E6N A;  3ZJV A;  4G0N B;  1IPG A;  2DLB A;  5CX3 A;  2IND C;  2KWU B;  1JWU D;  2FE8 A;  2LVQ A;  3AEF B;  2FUG 1;  3SU8 X;  1C4A A;  3VRB B;  2VRR B;  1T6B X;  4PK1 A;  3ZDT A;  4EOY A;  4YTM B;  1KLU D;  3EA6 A;  3ZUN A;  3K9O B;  1LGR A;  3IHP C;  1TY0 A;  1VDV A;  2KZR A;  1RFK A;  2JYT A;  3N1Z C;  4DWF A;  3VR8 B;  2AWT A;  3MP9 A;  3UQB A;  3ZNZ B;  4CYE A;  1IGC A;  1TGZ B;  1LFD A;  3H1U A;  2IGH A;  4EZK A;  4RGT A;  3SHQ A;  3RNB C;  2UU7 A;  1L0V B;  4KGT A;  1HZ6 A;  3QX1 A;  3Q3F A;  3MFG A;  2M0A A;  4LTU A;  3VUY A;  4XC2 A;  2PVG C;  3TEZ A;  3O13 A;  4P6V F;  3VTW A;  2LJ5 A;  5HI1 A;  4DHJ B;  3BYT B;  4IWQ A;  4AOF A;  5J2R A;  1AW7 A;  2N7E A;  1UWX A;  4LDT B;  2CU3 A;  1DGJ A;  4KDI C;  5AZG A;  1TS5 A;  3RFZ B;  4W9C A;  2ICI A;  2HJ8 A;  2ZW1 A;  3PRZ A;  3UGB B;  4W9H A;  1GC6 A;  1WXM A;  3DCG A;  4JL9 A;  2MJ3 A;  4A3P A;  2BWE S;  2QMT A;  2D07 B;  2RDG A;  1WYG A;  1TS3 A;  3MJ5 A;  3V3X A;  4NAW B;  1WWT A;  2AX5 A;  2VZK D;  2NMQ A;  3U4E G;  2RDB C;  2K8B A; 
#chains in the Genus database with same CATH homology
 1ZW7 A;  2KHW B;  3VVW B;  4RM8 A;  3MTN B;  2LWP A;  3QIJ A;  4NPN A;  2LRW A;  4II3 B;  4F8C B;  2K1F A;  2LUE A;  3KUC B;  4ZRI A;  4F7Z A;  3H7P A;  4E71 A;  4DHJ D;  1P3Q U;  4EFO A;  4ANU A;  1GUA B;  3BIN A;  3DDC B;  2D3G A;  2MA9 B;  5CHF A;  2JY6 A;  1Q1O A;  5D7G A;  2FCQ A;  1L7Y A;  3QCA A;  4LDT D;  1SIF A;  4RMA A;  3DVN U;  2BKF A;  1WE7 A;  2L7R A;  2NPT B;  2NBW B;  3KVF B;  3KW5 B;  1WGH A;  1EF1 A;  3DOW A;  2EMT A;  3W1S C;  4GIV A;  3M95 A;  4F1S A;  4II2 B;  3VXW A;  4PYZ A;  4TQ1 A;  4WQO B;  4MGI E;  3A1Q A;  2FCN A;  2OOB B;  3APC A;  3GZN I;  2ZCC A;  3A9J B;  2DYO A;  4FJY A;  2KKC A;  1WMH A;  1WI0 A;  1YJ1 A;  2BYF A;  4FHK A;  2XEW A;  2BKR B;  4B95 A;  2MRP A;  1G6J A;  4WWN A;  2FNJ B;  2O6V B;  2JZZ A;  3GOE A;  3I3T B;  4KDL B;  5DPT A;  4ZRJ A;  2JWZ A;  3QAR A;  3V6C B;  1U4A A;  3ALB A;  2PJH A;  5CHW A;  4MJS B;  3KH0 A;  3P2B A;  1C3T A;  2IO0 B;  2FCS A;  3OAW A;  3JSV B;  3CSF A;  2KN5 A;  4GDL A;  3ZTC A;  3DBR I;  1E8Y A;  3DBH I;  5E6P A;  1P98 A;  3H7S A;  3KYC D;  2YLM A;  3QK0 A;  1P1A A;  2D2Q A;  3DPD A;  4IUM B;  5AEK B;  1T0Y A;  1TBE A;  1WJN A;  1UZX B;  2L3Z A;  2LGX A;  2LVP A;  4AUQ C;  1Q5W B;  2B3A A;  4PS3 A;  4DBG A;  2DZK A;  3ZRC A;  2IY1 B;  2D10 A;  2KMA A;  3H6N A;  5C1Z A;  4E3C A;  3Q3J A;  2QHO A;  1OEY J;  4NJ7 A;  4IG7 B;  1OQY A;  1RLF A;  3LJ3 A;  4NAW A;  4BKS D;  2C7M B;  2KTR A;  1WZ0 A;  4KSK C;  3AI5 A;  4DK5 A;  3AU5 A;  2ZCB A;  4I6N B;  2MWS B;  2ZZP B;  4DHZ E;  1WXA A;  4EZL A;  1H4R A;  1E8X A;  4BOS C;  1VCB A;  1WIA A;  3DQV A;  3EHV A;  3IFW B;  3EFU A;  1E5W A;  1LM8 B;  4RM9 A;  2KNB A;  3QC8 B;  4N9F 4;  2L0F A;  1MG8 A;  4LJP B;  1ISN A;  2KWC A;  1R4N I;  3W1Y A;  4EZJ A;  5L95 C;  4KIK B;  2O6V D;  1NBF C;  3VHT C;  4BKS A;  4FN2 A;  3U30 A;  2C5L C;  2NPT A;  3PSE B;  3MHS D;  3PLU A;  5G55 A;  3VUX A;  2FID A;  2MCN B;  4GDL B;  2J0K A;  2RR9 A;  1H8C A;  4WWP A;  2AYO B;  2YVC A;  4K7U A;  2BF8 B;  2LXA A;  3CMM B;  4MM3 A;  4FA6 A;  3R7Q A;  2DZJ A;  2RD0 A;  3S2A A;  5J18 A;  3RUI B;  3PRP B;  4IM3 A;  5L83 A;  1UBQ A;  1AAR A;  4ANV A;  3A9J A;  3L10 B;  1JRU A;  1RFA A;  1J19 A;  3QHT A;  4HK2 A;  1NI2 A;  3IG3 A;  3KYD D;  2ZVN A;  4FJZ A;  4OVU A;  3EC8 A;  5AZH A;  1WZ3 A;  4AP4 C;  4G3X B;  4NY0 A;  2O6V A;  1XT9 B;  3UQA A;  5AZF A;  1E7U A;  1WX9 A;  3VTV A;  3NY5 A;  3R7R A;  4MJS A;  1GC7 A;  4A3O A;  1XQQ A;  2N9P C;  3JSV A;  2ASQ A;  2K6Q A;  2J0J A;  3U8Z A;  2XK5 B;  2DX5 B;  1K8R B;  2MQJ A;  2UYZ B;  2JXX A;  4DHZ B;  2ZNV B;  4CO7 A;  2IO3 B;  1IYF A;  1WH3 A;  3L0W B;  2BPS A;  4KZ0 A;  4MEM A;  2J7Q B;  2IZV B;  1RRB A;  3PV1 A;  2CHW A;  3IVF A;  2GMI C;  4JQW C;  3VH4 B;  2M17 A;  2LRU A;  4IC7 B;  4WWO A;  1GJZ A;  4EEW A;  3X0W A;  3UIN B;  4PS7 A;  3N3K B;  1V5T A;  2I1K A;  2L8J A;  3ZVV A;  2WX1 A;  1F9J A;  4IM0 A;  3PT2 B;  4ZRK A;  3U7D A;  5DCN A;  1LQB A;  1WGY A;  2KLG A;  3DVG X;  4G11 A;  1I35 A;  1UEL A;  4GOC A;  1P9D U;  3DVG Y;  3QJZ A;  4WJN A;  3RUL A;  4ASW C;  3CST A;  1TTN A;  4GMV A;  1P0R A;  5IAA C;  2GBR A;  3VFK A;  2L00 B;  2KDF B;  5KHO A;  3NS8 A;  1V81 A;  2W9N A;  5JZE B;  2KTF A;  1Y8R C;  3ZIM A;  1NDD A;  2DAJ A;  3V60 A;  3OJ3 A;  1TZ1 A;  4MSQ B;  4TUU A;  2A5U A;  3TL5 A;  3ZRF A;  2ZJD A;  4KIK A;  4E74 A;  1E90 A;  1GNU A;  2LI5 A;  2NBV B;  3T9L A;  5C23 A;  2FIF A;  2WYQ A;  2FUH B;  3A4S C;  2LZ6 A;  3NZS A;  3NZU A;  4MH0 E;  1OEY A;  4W9K A;  2CKH B;  2N1W A;  3DVN V;  2MP2 A;  4BKT A;  2KX3 A;  3ZTD A;  2MX2 A;  2KFJ A;  1YX6 B;  4LJO B;  4DDG D;  3VAW A;  3B0A A;  1WYW B;  2DEN B;  3RZW C;  3RCZ A;  5HKH A;  3PHW B;  1KM7 A;  1VD2 A;  4I6P A;  4J6I A;  3AUL A;  4MGZ E;  4HVB A;  5DPW A;  2IY0 B;  3ENE A;  3DBL I;  4GN1 A;  1V2Y A;  3TJP A;  4FLH A;  3ZNH B;  4BBN F;  2KWV B;  2LGD A;  1C1Y B;  4GGQ A;  2LXC A;  4IW0 A;  1V5O A;  3HHM A;  4NJ6 A;  1WX8 A;  5IA7 A;  1YD8 U;  1YX5 B;  2M0X A;  2V1Y A;  2HD5 B;  3WAO A;  1V49 A;  2JZ3 B;  3VH3 B;  3WAL A;  3QQ8 B;  1QZE A;  4FUL A;  4JIO U;  2CU1 A;  1GG3 A;  1J8C A;  2FCM A;  2MSE D;  2A4Z A;  4GSW A;  2PE6 B;  2XK5 A;  2N1V A;  1D3Z A;  2REX A;  2MBQ A;  3APD A;  5TR5 A;  5KHQ A;  1UD7 A;  2L05 A;  2C7H A;  3H9D A;  2CR5 A;  3N30 A;  1PQS A;  4M0W B;  4W9E A;  2EMS A;  4BKG A;  3L54 A;  4GXB A;  4X57 B;  3ECI A;  4XX5 A;  3ZW3 A;  2LGY A;  4B9K A;  3OJ4 B;  4LCD E;  4HDO A;  4W9L A;  1WFY A;  2K6D B;  3A33 B;  2Z59 B;  4MEL A;  2KMC A;  2DZI A;  3RZF A;  4WJQ A;  3SD5 A;  1X1M A;  4NNJ B;  3VDZ A;  4KV2 A;  1Z2M A;  1WE6 A;  2WWZ A;  5FR6 A;  4ICV A;  2KX0 A;  4JLC A;  4NQL B;  2ZPY A;  3V62 A;  2ZEQ A;  3A9K A;  3DBS A;  4G50 A;  2KQS A;  2KK8 A;  2Y5B B;  4MGK E;  3JVZ X;  2GOW A;  1WXS A;  2MP2 B;  3L08 A;  1KJT A;  3WIM A;  4MSM B;  2JRI B;  3TCA A;  2DYB A;  4GDK B;  1CMX B;  2KDE B;  2M1M A;  2NS5 A;  2BYE A;  4XZ4 A;  4I6L B;  4ICU A;  5E6O A;  2OJR A;  2G4S A;  2GBK A;  3EEC A;  3L16 A;  2ZNV C;  2ZVO A;  1SGH A;  2KLC A;  1V6E A;  2JT4 B;  3ZNI D;  4ANW A;  4M8M A;  1KLV A;  5DPS A;  3RD2 A;  4W9J A;  2DYM A;  2KQ7 A;  2L0T A;  2KD0 A;  5BO4 B;  4WJO A;  1WGR A;  3ML9 A;  3NOB A;  4HCP B;  3VUW A;  1WJ6 A;  3UIO B;  1HE8 A;  5D6J B;  2K8C A;  4CHK A;  3PLV A;  2GBJ A;  1EO6 A;  2KXJ A;  3TIX A;  3PGE A;  3X23 A;  2G45 B;  2XBB C;  3WA0 A;  2FAZ A;  1IP9 A;  2AL3 A;  4IWP A;  2K25 A;  3WAN A;  2WDT B;  1I42 A;  2N9E B;  1SE9 A;  3LDZ E;  3B1L X;  2LD9 A;  3IBE A;  1WRD B;  2I1J A;  1LXD A;  4HPL B;  3HM3 A;  2JPH A;  5JHB A;  3PS6 A;  1FXT B;  3L13 A;  2R2O A;  1E8W A;  1V9J A;  1E8Z A;  2Z0E B;  4TV3 A;  3UIP B;  4A20 A;  3M3J A;  3PRE A;  3PRM B;  3A9K B;  4IWO A;  3VQI A;  1EF5 A;  3V61 A;  4KVG B;  3WAM A;  5GMV A;  3ZO5 B;  4PS8 A;  1OTR B;  3QWZ B;  3JYU A;  2C9W B;  4HJK A;  4K81 A;  2AEH A;  2CHZ A;  2IO2 B;  2GBM A;  4HWI B;  4BVU C;  3AU4 A;  1KOT A;  2C60 A;  2KAN A;  4GB9 A;  1M94 A;  4M8N A;  4KSL C;  4AWJ A;  4DDI D;  3V6E B;  2MBE A;  1WXV A;  2V3S A;  3BY4 B;  4P7I A;  5E6N A;  1S3S G;  3ZNG C;  4HLE A;  1EUV B;  5CTR C;  2NCN A;  3B08 A;  2CS4 A;  2DZM A;  1WJU A;  2JUO A;  4G0N B;  1IPG A;  5CX3 A;  3KUZ A;  2K39 A;  4NQK E;  5D2M B;  1V80 A;  2KWU B;  4HPM B;  3VTU A;  4ZDV A;  4IM2 A;  4KZC A;  2LVQ A;  2KC1 A;  2MLB A;  1YIW A;  1WGG A;  5EDS A;  3C0R B;  4HXD A;  3SU8 X;  2N7D A;  2BYV E;  2MBB B;  4BOZ B;  2CHX A;  4K7W A;  2VRR B;  3ZKJ C;  4ANX A;  2NR2 A;  3ZDT A;  1WF9 A;  4GDK A;  4EOY A;  2C7N B;  4AJW A;  4GU2 A;  3ZUN A;  1WGD A;  2JVC A;  2L76 A;  3K9O B;  4FHJ A;  3IHP C;  4YL8 A;  1WR1 A;  3RYT A;  3SDL C;  4ZYN A;  2KZR A;  3T8M A;  3HM6 X;  4PYU A;  1RAX A;  2G3Q B;  1A5R A;  2MBO A;  3ONS A;  2NVU I;  4MGY E;  1Q0W B;  4DWF A;  2LVO A;  5J17 A;  2AWT A;  1L2N A;  2RSU A;  3MJW A;  2HTH A;  3ZNZ B;  1WX7 A;  4CYE A;  3L17 A;  2WX0 A;  2O2V A;  3UQB A;  3H7P B;  2IBI B;  1TGZ B;  2ZPN A;  4AJY B;  5D94 A;  2D11 A;  1LFD A;  4K7S A;  2N9X A;  3ZDM C;  3H1U A;  2KO3 A;  3HIZ A;  4EZK A;  3SHQ A;  1BT0 A;  3TMP B;  3WAP A;  5DPR A;  2KJH B;  2MBH A;  2RPQ A;  3PZD A;  3QX1 A;  3APF A;  3Q3F A;  3CF6 E;  2LAS A;  1UBI A;  1WM3 A;  5G2N A;  1WM2 A;  2JRH A;  4WJP A;  2M8S A;  3UF8 A;  4TQ0 A;  3QAQ A;  3R66 C;  3VUY A;  5CHV C;  2KFK A;  3M62 B;  3PPA A;  2IO1 B;  4WAA A;  2KJ6 A;  1S1Q B;  4W9F A;  4XC2 A;  2K8H A;  3TBL D;  2G4D B;  3A1Q B;  1ZGU B;  2UWQ A;  4K1R B;  2KJR A;  3A4R A;  4B6W A;  2NBU A;  2PPH A;  2AL6 A;  4HCN B;  5JHA A;  3VTW A;  5LLI A;  2LJ5 A;  4DHJ B;  1WMH B;  4IWQ A;  2N4F A;  3ML8 A;  3K9P B;  1UGM A;  1Z5S B;  2IYD B;  4MDK E;  4AOF A;  4BBN C;  2KC2 A;  4EUT A;  5J2R A;  2N7E A;  5JH5 C;  1OGW A;  4LDT B;  4EKU A;  1YQB A;  4KDI C;  1WJ4 A;  2PEA A;  5LXI B;  4TKN A;  1ZKH A;  5AZG A;  4W9D A;  2M4N A;  1V86 A;  4FJV B;  1E7V A;  3OLM D;  1WR6 E;  4URK A;  1J0G A;  2DHZ A;  3RT3 B;  2HE7 A;  2KVR A;  2JF5 A;  4W9C A;  3PVL A;  4DXA B;  2DAF A;  2HJ8 A;  2PE9 A;  2BGF A;  4W9G A;  3PRZ A;  4W9I A;  3UGB B;  3HK0 A;  4W9H A;  1GC6 A;  1UH6 A;  2KDB A;  1WXM A;  2O2V B;  3DCG A;  3PTF C;  4JL9 A;  1R4M I;  4A3P A;  3O65 B;  2BWE S;  2R2Q A;  1XD3 B;  2BWF A;  2D07 B;  2J0M A;  4JGH B;  2RGF A;  3KUD B;  4OVV A;  4BFR A;  3W1S A;  3M63 B;  2V4L A;  3R3M A;  3PHX B;  4NAW B;  4FAD A;  2KTR B;  3AXC A;  3ZLZ A;  2EKE C;  3JW0 X;  3N32 A;  1WY8 A;  3QA8 A;  4HDQ A;  2GBN A;  2MW5 A;  3NHE B;  2KDI A;  3D32 A;  4FBJ B;  2KFK B;  2Z0D B;  2KOX A;  2K8B A;  5LXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...