1Q1OA

Solution structure of the pb1 domain of cdc24p (long form)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
GPLGSILFRISYNNNSNNTSSSEIFTLLVEKVWNFDDLIMAINSKISNTHNNNISPITKIKYQDEDGDFVVLGSDEDWNVAKEMLAENNEKFLNIRLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cell division control protein 24
publication title The PB1 domain and the PC motif-containing region are structurally similar protein binding modules
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2003-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1q1oA00
4A3PA 2IYDB 2PE9A 3VVWB 2L7RA 3A1QB 1TGZB 3DPDA 2JRHA 4EFOA 1T0YA 2KLCA 2FCSA 1A5RA 1E5WA 4JL9A 2DYMA 4NNJB 4P7IA 4W9GA 2BWFA 4XC2A 2N7DA 2WX1A 1WM2A 1J0GA 1K8RB 4II2B 5GMVA 1WZ3A 2D07B 4KDLB 1UZXB 3HIZA 5E6OA 5DPWA 1WIAA 1WF9A 3MJWA 4G0NB 1GJZA 1U4AA 3AI5A 3PT2B 4ZYNA 1WGYA 2JUOA 4GDKB 1XD3B 4EZJA 5LXHA 2PEAA 3RD2A 2AEHA 4PYUA 2MBOA 2KD0A 5AZGA 2NR2A 4AUQC 5BO4B 3ZDMC 3ZNGC 3PVLA 1L2NA 2ZPYA 3VUXA 4J6IA 4KV2A 2RD0A 2KNBA 3ML8A 4GU2A 2BYVE 2AYOB 1ZKHA 2DYBA 2N9EB 1VCBA 4G11A 4MGKE 4PS7A 3SD5A 2BF8B 2IO1B 3IFWB 2IO2B 4B95A 1F9JA 2FIFA 2ZNVB 2EKEC 2LVPA 1V81A 1LXDA 3BY4B 4IW0A 1E90A 4W9EA 2XK5B 1SE9A 1CMXB 1Q5WB 2GBRA 4GSWA 4HCNB 3VQIA 1ISNA 2FCMA 3ZUNA 2WDTB 3D32A 4KVGB 2FAZA 3LJ3A 4NAWA 4WWNA 3VUWA 3DBSA 1WX9A 2GBMA 4EKUA 2L0FA 1WGDA 2KMCA 4FHJA 2LRWA 3W1SA 1NBFC 1EO6A 4FULA 2JY6A 2D3GA 4W9CA 4BKSD 1P0RA 3SHQA 4DDID 2KX3A 3Q3JA 3WANA 2V1YA 2MBHA 3L54A 3R7QA 3S2AA 1LQBA 1WGHA 4RM8A 2NCNA 1SIFA 2LD9A 4PYZA 2K39A 4IM0A 2MA9B 5IAAC 3DQVA 4FN2A 4DK5A 3B08A 1QZEA 1WYWB 4F7ZA 2IY0B 2A5UA 2JVCA 2LGYA 2O6VD 1IYFA 4ICUA 3M95A 1WR6E 3IVFA 2NBWB 3OAWA 2KJ6A 1WX7A 2GBKA 4FLHA 2KANA 1H8CA 2IZVB 3QC8B 5D2MB 3WAOA 4MELA 2C60A 2QHOA 2YVCA 3X23A 2VRRB 1OTRB 2JXXA 1WXVA 1GG3A 5TR5A 2KDBA 4TV3A 1VD2A 4F1SA 2YLMA 1V2YA 4IUMB 2MW5A 4ZDVA 4GDKA 4HPLB 2R2QA 1WE7A 3HM3A 2W9NA 4NJ7A 4LJOB 2JWZA 4EZLA 4BOSC 2IO3B 3PHXB 5C23A 3V60A 1YX6B 4ZRIA 1WY8A 2ZEQA 4AOFA 3DOWA 4MEMA 3SU8X 3R3MA 3M62B 4A20A 2K6DB 1OQYA 1SGHA 4LDTD 2D10A 3TL5A 2KMAA 3C0RB 1V5TA 2OJRA 4W9DA 4WJNA 5JHAA 4E74A 2MX2A 3DVGX 5KHOA 2JF5A 2M0XA 2KKCA 2MRPA 2Z0DB 2Z59B 2ZCBA 2XK5A 2LASA 3W1YA 3QAQA 2C9WB 4MDKE 2BYEA 1ZW7A 5EDSA 2EMTA 2CHWA 4NQKE 3ZTCA 3ALBA 4TQ1A 5AZFA 3RYTA 1GC7A 2C7MB 3DCGA 2REXA 2LXCA 4BOZB 1EF1A 4F8CB 3U7DA 2KN5A 2ZZPB 4FA6A 2K1FA 1Y8RC 4KSLC 3QARA 3APCA 3CMMB 4WJOA 3L08A 3DVGY 4G3XB 2DZIA 5D6JB 5J17A 2FCQA 1WJ6A 1YQBA 2KZRA 3KUDB 2IO0B 5CHVC 3OJ4B 4BBNF 3MTNB 3V61A 2DZMA 1S1QB 3QA8A 1I42A 3A4RA 4B9KA 1GUAB 4HPMB 2O6VB 3KH0A 1V86A 2AL3A 3H6NA 2C7NB 3HM6X 4IM2A 3TCAA 2Y5BB 3VH3B 4GGQA 1WFYA 1C3TA 3PRZA 3NZSA 3DDCB 2RPQA 4DHJD 2DX5B 2M1MA 3O65B 2KWVB 3PSEB 1WMHB 2L00B 4K7WA 4M8MA 2HE7A 4CYEA 4RMAA 3ECIA 2LJ5A 4DWFA 2BWES 3A9KB 4HK2A 1WJNA 4IM3A 1KLVA 3VXWA 3PRPB 3PS6A 1EUVB 2N7EA 2C5LC 3QQ8B 4HLEA 1RFAA 3CF6E 3VFKA 4BVUC 2KDIA 4KZCA 3ONSA 1FXTB 2FIDA 1G6JA 3M63B 4TQ0A 1ZGUB 4TUUA 3PZDA 2FUHB 4JGHB 4LDTB 3A9JB 3TIXA 3L13A 3M3JA 2KTRB 1KM7A 4RM9A 1OEYA 2ZVOA 2DAFA 4HCPB 3K9PB 1HE8A 5DPSA 2ASQA 5G2NA 2BGFA 2L3ZA 5E6PA 4AWJA 3NY5A 2GBJA 3P2BA 3VDZA 1UELA 4MH0E 3DBLI 4DBGA 2L76A 3QJZA 3PPAA 1YIWA 2L0TA 5DPRA 4N9F4 1WZ0A 2D11A 3ZRCA 3UQAA 1YJ1A 3EFUA 3ENEA 3PREA 1WI0A 2KFJA 4MSMB 4ANXA 2GBNA 3ML9A 2LGDA 2UYZB 2JZ3B 5C1ZA 4WJQA 3IG3A 5DPTA 4PS3A 4GN1A 2KDEB 3GZNI 2KC2A 2PJHA 3A1QA 3A33B 4HWIB 2D2QA 2IBIB 2DZJA 2CHXA 4IG7B 1PQSA 2KFKB 1UGMA 3UF8A 4TKNA 1M94A 2WX0A 4XX5A 2FNJB 2LVQA 2O6VA 1X1MA 3VAWA 3H7SA 2DENB 1NDDA 4G50A 5CHFA 4ANVA 4IWPA 4AJWA 1J19A 2G3QB 2JPHA 4GB9A 4FHKA 2ZJDA 1V80A 1WMHA 2J7QB 2UWQA 3LDZE 1WXMA 4HDOA 5E6NA 3L17A 4ASWC 2NVUI 2J0MA 3A9KA 1Q1OA 4GDLB 4BKGA 4W9JA 4FJVB 2B3AA 3PTFC 3HK0A 3RULA 2XBBC 3WAPA 4DHZB 3CSFA 3N32A 4ZRJA 2KTFA 3VTUA 4MSQB 2O2VB 4WAAA 3QCAA 4JQWC 5CHWA 3RT3B 2BYFA 3QX1A 4JIOU 3JSVB 1E8YA 2KQSA 2A4ZA 3A9JA 2MBQA 4E71A 5DCNA 3TBLD 2KTRA 1S3SG 2DZKA 2OOBB 1P9DU 2L05A 1TBEA 1AARA 2J0JA 4A3OA 4BKTA 3SDLC 3QK0A 1IPGA 3JVZX 3ZRFA 4MGZE 3PGEA 3WALA 1V9JA 3UQBA 4HJKA 3VTVA 4DHZE 4WWOA 3CSTA 4M0WB 2PE6B 1OGWA 2KWUB 3KYDD 4WWPA 2LRUA 4WJPA 4X57B 5L95C 5J2RA 1BT0A 2XEWA 2HJ8A 2CKHB 1P3QU 2MLBA 4GMVA 2CR5A 1Z2MA 1EF5A 3EHVA 4EEWA 1WXSA 2LXAA 4W9FA 5JH5C 2M4NA 2N1WA 3H9DA 4PS8A 1KJTA 1RAXA 2K8CA 3AU5A 2KFKA 4IWQA 2GMIC 3L10B 2K8BA 3ZTDA 4CHKA 3PHWB 2NS5A 3OLMD 2G45B 1H4RA 2KK8A 2KO3A 3U30A 5L83A 2CS4A 1WXAA 2ZCCA 3JW0X 5AEKB 4GXBA 3QIJA 2KX0A 2DYOA 3V62A 2NBVB 2KLGA 1I35A 4MJSB 2KC1A 2I1KA 1OEYJ 3NOBA 2MSED 4LJPB 5D7GA 4XZ4A 4NPNA 5FR6A 2DAJA 3AULA 4GDLA 1J8CA 2MP2B 4ZRKA 1V6EA 3L16A 3K9OB 2LGXA 3EC8A 1KOTA 3TJPA 3KUCB 3ZLZA 3UINB 3DBHI 3V6CB 3ZDTA 2G4SA 2R2OA 4KIKB 4DDGD 3T9LA 3WIMA 2O2VA 2KDFB 1JRUA 3U8ZA 3PRMB 4K81A 3W1SC 5HKHA 3N30A 3OJ3A 4B6WA 5D94A 1MG8A 4FBJB 3JSVA 2V4LA 4I6LB 3JYUA 1GC6A 2RSUA 2K8HA 2MBBB 1L7YA 1WH3A 3KVFB 2KXJA 3A4SC 1RRBA 2AWTA 3WAMA 3T8MA 3APFA 1XT9B 2LVOA 3AU4A 4W9HA 4KZ0A 3ZO5B 3APDA 4AJYB 5CX3A 3WA0A 1UH6A 4LCDE 2ZPNA 4KDIC 2M17A 2NPTB 2IY1B 2KJRA 1XQQA 5AZHA 2K25A 2MWSB 2CU1A 4IC7B 3RZFA 4BKSA 4W9KA 3NZUA 2NBUA 1R4NI 2WWZA 4FADA 4ANWA 1TTNA 3H7PB 3PV1A 2I1JA 5G55A 5IA7A 1WJ4A 2N1VA 2RR9A 3PLUA 4HVBA 3KUZA 4AP4C 3KYCD 3VH4B 1IP9A 1E8ZA 1E7VA 2K6QA 2N9PC 3QWZB 4ANUA 2CHZA 4W9IA 3MHSD 2LZ6A 2GOWA 2V3SA 4ICVA 1GNUA 4OVVA 1UBIA 4NY0A 2JZZA 4GIVA 2HD5B 4NQLB 2HTHA 2AL6A 4MJSA 3R7RA 1LFDA 2LI5A 5LXIB 3PLVA 2LWPA 1WGGA 1E8WA 5KHQA 2ZNVC 4EUTA 2N4FA 3Q3FA 4DHJB 1WE6A 2EMSA 3IBEA 4MM3A 2JT4B 2KQ7A 1P1AA 1WRDB 3UIOB 2PPHA 2G4DB 3ZIMA 2MP2A 2RGFA 3EECA 3ZW3A 1WX8A 5J18A 4W9LA 4IWOA 4E3CA 1RLFA 2KVRA 3RCZA 4CO7A 2MCNB 1E8XA 1WR1A 4KIKA 1YX5B 1UD7A 2L8JA 3N3KB 2Z0EB 3ZNZB 2J0KA 1V5OA 3IHPC 4K7SA 3KW5B 2KHWB 3HHMA 5LLIA 4BBNC 3DVNV 3GOEA 4MGIE 5JZEB 4II3B 3RUIB 3DBRI 1E7UA 1R4MI 3ZKJC 1V49A 4K7UA 4MGYE 2KOXA 4EOYA 3DVNU 1UBQA 1Z5SB 1NI2A 4FJYA 4I6PA 2N9XA 2KJHB 2LUEA 4HXDA 4OVUA 3H1UA 2JRIB 1TZ1A 3I3TB 2NPTA 4FJZA 1Q0WB 1LM8B 3VTWA 3R66C 4URKA 3X0WA 3QHTA 4WQOB 3UGBB 2KWCA 3TMPB 3VHTC 2M8SA 2MBEA 2BPSA 4YL8A 3H7PA 2WYQA 3ZNID 4EZKA 1WM3A 3BINA 3V6EB 5JHBA 3ZNHB 3NS8A 1P98A 4KSKC 2FCNA 1D3ZA 4K1RB 1YD8U 5CTRC 4NAWB 4DXAB 2BKRB 3B0AA 4GOCA 4BFRA 3VUYA 3B1LX 3ZVVA 3UIPB 2DHZA 4M8NA 1WGRA 4JLCA 2BKFA 2MQJA 2ZVNA 1C1YB 1WJUA 3L0WB 3NHEB 3RZWC 4I6NB 2C7HA 4HDQA 3AXCA 4NJ6A
chains in the Genus database with same CATH superfamily
3TUOA 2IYDB 2PE9A 2W3SA 2FCSA 2FBWB 1A5RA 1E5WA 4JL9A 4P7IA 3HVDA 2M19A 2BWFA 4LNOA 3IAM1 3FKYA 1L6VA 3MJWA 4G0NB 3AI5A 4RF1A 3PT2B 2TSSA 1XD3B 2AEHA 3DHGC 3RNAC 2KD0A 5AZGA 1TY0A 5BO4B 3ZDMC 3PVLA 3SR6A 3ML8A 2BYVE 2AYOB 1ZKHA 4YWGG 4B0MA 2DYBA 1VCBA 2INNE 3R8BA 4B95A 2LGSA 2W82A 3AE5B 2EKEC 3BY4B 1V81A 2K0PA 3RNCC 2LMCA 2WU5B 2XK5B 2GBRA 2PVOD 3BIID 1MG4A 1ISNA 3NG0A 2KVZA 3D32A 2FAZA 3LJ3A 4NAWA 3DBSA 2KMCA 4DDID 3OWEB 3Q3JA 3R7QA 3S2AA 1E6EB 3U4EG 4IM0A 3V05A 1QZEA 1WYWB 1C78A 2LGYA 1IYFA 3IVFA 3WAOA 2YVCA 3MC0B 1HEZE 2WLBA 1UNSA 2JXXA 5TR5A 1TKGA 1V2YA 2OJWA 3Q69A 4HPLB 4N59A 2K5PA 2W9NA 3J9CA 3PHXB 4ZRIA 1WY8A 1C76A 1V5TA 3AMZA 4W9DA 5KHOA 2KKCA 3DBLB 2XK5A 3DWGC 1QT9A 2E6XA 2WXFA 4KGRA 4L1BA 1SJED 3DHIC 2EMTA 4OHJA 3ZTCA 3NRZA 3AEDB 1EF1A 3B2FA 1P7EA 4MH8A 4REZA 3AEEB 3APCA 3DVGY 4G3XB 4WIPA 2FCQA 1WJ6A 5CHVC 1FRDA 2DBYA 1S1QB 1I42A 3A4RA 4B9KA 1GUAB 3H6NA 2C7NB 3HM6X 4IM2A 2Y5BB 1XCQL 2X38A 1C3TA 3NZSA 4DHJD 3PSEB 1SE4A 4CYEA 4DWFA 4HK2A 2SAKA 4IM3A 1KLGD 1RM6C 4BVUC 3ONSA 4AS1A 2FIDA 4TQ0A 4TUUA 1XEEA 4LDTB 4US8A 2MEKA 1GB1A 2WXMA 2DAFA 1Y56A 2DNFA 4YTNB 2BGFA 1AW7A 2IGDA 2KACA 1UELA 3DBLI 4DBGA 3HUIA 4WURA 1YIWA 2L0TA 2N0SB 2HTME 3ZRCA 1YJ1A 3EFUA 3PREA 1WI0A 1DYQA 4MSMB 2IJ0A 4P1BC 3I63C 2UYZB 2JZ3B 5HHDG 4A9AA 4PS3A 3A33B 2INPE 2D2QA 1K53A 4LK0M 1PQSA 2J53A 1UGMA 2KFKB 1M94A 2IGHA 1E7PB 2Y3AA 4FHKA 2UWQA 4L23A 1HTQA 4HDOA 3GP7A 3L17A 2GB1A 2NVUI 1J7BA 4BKGA 4FJVB 1SE3A 3RULA 3NS1A 2XBBC 1LO5D 3CSFA 3FILB 1CZPA 2PVGC 1JWAD 2VH2A 1E8YA 2A4ZA 5DCNA 1L6UA 1P9DU 2L05A 4MT5A 4KGSA 4Q2JA 3WALA 1C79A 3ZXRA 2PKOA 2WXGA 2PE6B 4WWPA 1LGRA 2HJ8A 2J52A 5IOIA 2CKHB 3IXSA 2MLBA 4EEWA 2LXAA 4W9FA 3P4QB 2N1WA 1D5MC 3BK1A 2KFKA 3AN1A 5LNK1 2RPVA 2K8BA 4CHKA 2NS5A 1H4RA 2KK8A 2KO3A 1WXAA 3JW0X 1HQRD 5EE0A 2KC1A 4HJGE 1L5PA 2I1KA 3NOBA 2MSED 3UI3A 2WGSA 4XZ4A 4YTMB 1C9FA 2BYTA 2DAJA 3AULA 2MP2B 3IT6B 3EC8A 3KUCB 3V6CB 4KIKB 4DDGD 2KDMA 3T9LA 3W1SC 3PRMB 4K81A 3AH7A 1R4MB 4B6WA 5FR3A 2V4LA 1GC6A 2PLPA 2MBBB 1L7YA 1CJEA 2MH7A 2JYEA 2KXJA 2AWTA 2FE8A 2M0AA 2KAJA 3RI7C 2JQRB 1XLPA 3ZO5B 4AJYB 4KDIC 2NPTB 2KJRA 4ARIA 5AZHA 2MWSB 4EE2A 2NBUA 1R4NI 3AE1B 4FADA 1TTNA 5IA7A 3PLUA 4AP4C 3KYCD 1WXQA 1IP9A 3AE6B 3NUHB 3R2IA 2K6QA 2WXHA 1QOFA 3PO0A 3ZJVA 4ANUA 4W9IA 3P4PB 1UBIA 2HD5B 4NQLB 2HTHA 1LFDA 3PLVA 1AN8A 2ZNVC 1N6ZA 3Q3FA 4DHJB 2EMSA 3IBEA 1P1AA 5G5GA 2KQ4X 2MP2A 3W9CB 3EFCA 4KIKA 3RNFC 3ZNZB 4K3BA 3IHPC 4K7SA 1RWSA 4ZOHC 3Q8FA 4HKQA 4BBNC 3DVNV 4MGIE 3RUIB 1L0VB 1MJDA 1R4MI 3P42A 1V49A 3ABVB 4K7UA 3DVNU 3E9SA 1VZ6A 4OVUA 3BYTB 1TZ1A 3I3TB 1I4RA 2NPTA 4FJZA 3R66C 4WQOB 3UGBB 5BMIA 2BPSA 3ZNID 3AE7B 2J4XA 3MC9A 4XWWA 3V6EB 2JWUA 3ZNHB 3NS8A 1EU4A 1R7SA 1JW9D 4OZAA 1ZOYB 2I2YA 3B1LX 4QAYA 3UIPB 5HFYA 4LLGM 2MQJA 3RZWC 3NHEB 4HDQA 4NJ6A 4EFOA 1DOIA 2N7DA 1WM2A 5D3IB 2MJ3A 1K8RB 4KDLB 4XE0A 2PIAA 4KGTA 4UDUC 5DPWA 1XLQA 4ZYNA 4EZJA 2PEAA 3RD2A 3VR9B 4AUQC 1NI3A 3ZNGC 1L2NA 4J6IA 2WDVB 4C4VB 3SD5A 3BYYB 2IO2B 2ZNVB 2V3NA 4JWSC 1CMXB 1Q5WB 2FCMA 1KLUD 2WDTB 4KVGB 1SF0A 4WWNA 3VUWA 1WX9A 1EWYC 1WGDA 3W1SA 1EO6A 1PFDA 3BVMA 4W9CA 1P0RA 3WANA 2V1YA 1LQBA 1IBXB 2NCNA 2LD9A 4FN2A 2A5UA 2JVCA 1HTOA 4YTPB 2OHFA 2KJ6A 4KKIA 2GBKA 2KANA 2IZVB 3QC8B 4MELA 2C60A 2MJDA 3NVWA 3X23A 1BXTA 1OTRB 1VD2A 4F1SA 2MW5A 2ICIA 3C8YA 2GI9A 3HM3A 4LJOB 4BOSC 4AOFA 2Q5WD 4MEMA 3SU8X 5MPOA 4C56C 3R3MA 1BUIC 2WXOA 3M62B 5IKCM 4A20A 4C4VA 2K6DB 4LDTD 3TL5A 3C0RB 5JHAA 2MX2A 2QCZA 5BYRA 3U2SC 1D6EC 2Z59B 4MDKE 5AZFA 2C7MB 3KQ4A 3DCGA 2REXA 1SXTA 2CU3A 2D3AA 2WXRA 2K1FA 3QARA 1IBXA 5J17A 1QILA 1N60A 1YQBA 2KZRA 2K22A 3PZ8A 3MFGA 3V61A 4HKZE 4HPMB 2O6VB 2AL3A 3TCAA 3VH3B 4GGQA 1MVKA 4KX6B 2RPQA 3O65B 2INDC 2WXIA 4K7WA 4M8MA 3VRAB 3ECIA 2BWES 1KLVA 1WJNA 4BZAA 3PRPB 4N58A 1EUVB 2N7EA 2C5LC 1HXYD 3VFKA 2G1EA 2KDIA 1MHHE 4B0EA 4DQOC 1V97A 1FXTB 2K9XA 3PZDA 2FUHB 3L13A 3M3JA 4RM9A 1KM7A 1OEYA 2KT7A 5DPSA 2ASQA 1F77A 5E6PA 5IN7A 1FM0D 3QJZA 3P1MA 3Q14C 1SSNA 3UQAA 3ENEA 2BT6A 2KFJA 4C7YA 3ML9A 2DWQA 2LGDA 1SB3C 3IG3A 2KDEB 4RF0A 2IBIB 2CHXA 4WH4A 3P4RB 3UF8A 2O6VA 2AQ2B 3GE8C 5HG2A 3ZQ4A 3MC8A 2ZJDA 4HEA1 3DBHB 1A70A 1VDVA 1Q1OA 4GDLB 1FNUA 1QKZA 2IGGA 2K3UA 3H8HA 2EELA 4JQWC 2BYFA 3QX1A 4JIOU 2W55A 1I4GA 2KQSA 3TBLD 2DZKA 1XF5L 1AARA 4A3OA 2CJOA 3JVZX 4ITKA 3ZRFA 1EM7A 1V9JA 4DHZE 4M0WB 2LRUA 4WJPA 4X57B 4A6QA 2XEWA 2CR5A 1GAQB 2NTSA 3EHVA 2M4NA 1FPYA 1RAXA 2K8CA 3AU5A 4IWQA 3ZTDA 3Q3MC 3U30A 5L83A 2CS4A 2ZCCA 3AEBB 1NYRA 5AEKB 5EE3A 3QIJA 1I35A 2KLGA 2W54A 5H8YE 4NZLB 2WXLA 2QC8A 3RNGC 4GDLA 1QQRA 3L16A 1N5WA 1AYFA 1KOTA 3V3XA 1T3QA 3DBHI 3ZDTA 1B9RA 1VLBA 3N30A 5D94A 4FBJB 4I6LB 3JYUA 1QOGA 2K8HA 1WH3A 2LUMA 2QMTA 2R61A 1XT9B 2LVOA 3AU4A 4ZHOA 5C3JB 4IDIA 5CX3A 3WA0A 2ACZB 1UH6A 4LCDE 1B1ZA 1AWDA 1VZ7A 2B76B 2IY1B 1XQQA 3RNEC 1FNVA 4IC7B 4W9KA 3NZUA 3H7PB 2N1VA 2RR9A 2NTTA 3NZ3A 3VH4B 2LHDA 4ZRPA 1E7VA 4LNNA 3Q6BA 2JXTA 4OVVA 1GNUA 1FCLA 2WXQA 2JZZA 3R7RA 5IP4D 5LXIB 2LI5A 1WGGA 3TEZA 3I9V1 2N4FA 4EUTA 1WE6A 2KQ7A 2PPHA 3ZIMA 1JROA 3ETRA 3I57A 5J18A 2KVRA 3RCZA 1GPXA 2LJIA 1E8XA 2L8JA 3MP9A 1ET6A 1EU3A 2Z0EB 2L52A 1JMLA 1SJHD 1HZ6A 3VR8B 2BW2A 1K50A 1E7UA 3HVZA 3ZKJC 4A55A 4EOYA 2DLBA 1NI2A 4FJYA 3DHHC 4I6PA 2LUEA 1DOYA 3IT4B 4GLSC 3RPFC 1R4NB 1VZ8A 3VTWA 3ZYYX 3X0WA 1J7AA 2MBEA 1SBBB 4YL8A 3H7PA 1XXGA 4K1RB 1V1PB 5CTRC 1JRPA 2BKRB 3B0AA 4GOCA 4BFRA 3MHZA 3VUYA 2BB6A 2QIEB 3AEGB 1C1YB 1WJUA 2C7HA 4PT5A 3AXCA 3W5UB 1V1OA 3A1QB 1T0YA 2KLCA 3AEFB 3FILA 3T3OA 1J0GA 2D5GA 4YSYB 4II2B 1WZ3A 2D07B 1N63A 3CIRB 1UZXB 2L83A 3KLSX 3HIZA 2QDFA 1GJZA 1U4AA 3AB5A 1P7FA 2NR2A 1RYJA 2WS3B 4ZRQA 2D3BA 3P4SB 2KNBA 3ZXVA 1PDXA 2N9EB 4MGKE 4PS7A 3IFWB 2CJNA 1F9JA 2FIFA 1T0QC 2QSDA 4W9EA 1TT5B 4IKGA 1SE9A 2YEPF 4GSWA 2WXJA 1V1PA 1FRRA 2M56B 2GBMA 4EKUA 2L0FA 4FHJA 4FULA 2D3GA 3SHQA 2KX3A 3L54A 1FFVA 1WGHA 4RM8A 1SIFA 4PYZA 2K39A 1CQVA 3NVVA 5IAAC 3DQVA 4DK5A 3B08A 1J7CA 4RFBA 1UGJA 2IY0B 4LNIA 2O6VD 4ICUA 3M95A 3LXFA 1YNTE 2HDEA 2PMVA 1H8CA 3U52E 2VRRB 1GG3A 2KDBA 2Y5PA 4TV3A 2R2QA 1T5XD 1ZPSA 1YJIA 2IO3B 4RH6A 3V60A 1BMLC 1VRAB 3DOWA 1OQYA 1SGHA 2D10A 4XYCA 2OJRA 4RGMA 4WJNA 4E74A 2M0XA 2Z0DB 2ZCBA 4C7ZA 1MI0A 5HI1A 4P16A 1ZW7A 3RYTA 2LFIA 4BOZB 3TEYA 4F8CB 2KN5A 4HRSA 4FA6A 4P1CC 4KSLC 3CMMB 3L08A 2RMMA 2DZIA 2L1AA 5D6JB 1TY2A 3KUDB 2IO0B 3OJ4B 3BWUD 1WFYA 1PGAA 2ON8A 2DX5B 2M1MA 2KWVB 4A90A 1WSPA 1M4VA 4RNAA 3WCQA 2LJ5A 4KKJA 1E0ZA 4YSXB 3B9JA 3VXWA 3T3NA 1DGJA 4YT0B 4RCOA 1RFAA 3CF6E 2AQ3B 2IPKD 4KZCA 3N9YC 1F1HA 1G6JA 3M63B 4JGHB 1FO4A 4RGTA 3A9JB 3TIXA 1KRHA 2ZVOA 3K9PB 2MJEA 3NY5A 1YQ4B 3VDZA 2WQYB 1I4PA 1YOVB 1UF0A 2QJLA 2OEDA 1I4XA 3N1ZC 4N9F4 1WZ0A 3DWMA 2D11A 2W3RA 2JYTA 4XDDA 4ANXA 2GBNA 5FKAC 5C1ZA 1TZOA 4GN1A 3Q8EA 1DOXA 2KC2A 2PJHA 2DZJA 4IG7B 2WX0A 4IOIE 2FNJB 1X1MA 3R2TA 3OG5A 2N7JA 3Q3NC 4JE3B 4G50A 1MHXA 5CHFA 4ANVA 4IWPA 4AJWA 1ZXHA 2G3QB 1XLNA 2JPHA 3W5VB 4GB9A 4LNKA 1YN5A 1V80A 2J7QB 1WXMA 5E6NA 1ZDXA 2J0MA 3EUB2 2B3AA 3PTFC 3Q3OC 4OZBA 3N32A 4ZRJA 2KTFA 4MSQB 3QCAA 5CHWA 3KWLA 3JSVB 1JALA 2BQQA 4USAA 3A9JA 2MBQA 4E71A 4PK1A 2OOBB 1TBEA 1GB4A 3QK0A 1IPGA 1ZUD2 4MGZE 3PGEA 3UQBA 3CSTA 1YN4A 2BVCA 1OGWA 4M00A 5L95C 2KMMA 4GMVA 1Z2MA 4AQ7A 1WXSA 5JH5C 4N6EB 3H9DA 4PS8A 4LTUA 3RNBC 2GMIC 3OLMD 2G45B 2KX0A 2DYOA 3AE4B 4MJSB 1OEYJ 4MM3B 5D7GA 4NPNA 5FR6A 1V8CA 4US9A 4ZRKA 1FCCC 1V6EA 1TS3A 3E56A 2R2OA 3WIMA 3U8ZA 1K51A 1ZE3D 3OJ3A 2WNMA 1MG8A 3JSVA 1I4HA 1JQ4A 3A4SC 2N9KA 3WAMA 3BK2A 2N9LA 3T8MA 4W9HA 4XWTA 4KZ0A 3APDA 1QOBA 1FMAD 2M17A 3N20C 2JSVX 2K25A 1TKEA 4WQMA 2WWZA 5G55A 1WJ4A 3KUZA 1C4PA 1E8ZA 5IO9A 3AECB 3QWZB 2CHZA 4JX1C 1I4QA 4NY0A 4GIVA 1VJKA 2AL6A 4MJSA 2LWPA 1E8WA 5KHQA 4MM3A 1NEKB 3RFZB 2RDGA 4BAXA 2G4DB 1WX8A 1N62A 4W9LA 4IWOA 3AM9A 1RLFA 2MCNB 1UUPA 4TSSA 1WR1A 1YX5B 1OQQA 4RGOS 2INCC 3W2DA 3KW5B 1WYGA 2KHWB 5BMHA 2WP9B 2FUG1 4K3CA 5JZEB 4II3B 2LHEA 4MGYE 2KOXA 3TSSA 5H92C 1E10A 1WRIA 3AV8A 2N9XA 4HXDA 3H1UA 3BZDB 2JRIB 3AE3B 3N1XC 1Q0WB 1LM8B 1FD6A 4URKA 3QHTA 4WAFA 2KWCA 3FAHA 2Z8LA 3VHTC 1ESFA 4EZKA 1WM3A 1P98A 2JX5A 1YD8U 1YMHE 3U7ZA 3ZVVA 1WGRA 2VZKD 4JLCA 3LYYA 2BKFA 2ZVNA 4HROA 1TIFA 4A3PA 3VVWB 1TJEA 2L7RA 1KFYB 1TGZB 2D3CA 3DPDA 1IGDA 2JRHA 3SEBA 2WXKA 3CWIA 4S0RA 1GOZA 4NNJB 2DYMA 4W9GA 4XC2A 1YN3A 2WX1A 4NJCA 2RDBC 5GMVA 1FXIA 1QOAA 2H88B 1MPEA 5E6OA 1WIAA 1WF9A 1WGYA 2JUOA 4GDKB 5LXHA 4PYUA 2MBOA 3L4PA 4FXCA 4MACA 2ZPYA 3VUXA 4O1NA 4KV2A 2RD0A 4DXGA 4GU2A 4M01A 4G11A 2BF8B 4M0WA 1TYGB 2IO1B 1K52A 1JWSD 2LVPA 1LXDA 4IW0A 1E90A 1IGCA 3EGRA 4OVZA 5E6JA 2UU7A 2BS4B 4HCNB 3VQIA 1HZ5A 1PGXA 2V0GA 3NJTA 3ZUNA 3VRBB 2LRWA 3BVZA 1NBFC 1ZDVA 1UWMA 2JY6A 3P63A 4BKSD 3C19A 2MBHA 4LNFA 2MA9B 4F7ZA 1N5XA 2AX5A 1WR6E 3OAWA 2NBWB 1ACCA 1WX7A 4FLHA 5D2MB 5BYQA 1L0YB 2LGIA 2QHOA 1WGKA 1WXVA 2YLMA 4DXFA 4IUMB 4ZDVA 4GDKA 1WE7A 1QF6A 2WXPA 1ZXIA 4NJ7A 2JWZA 4EZLA 2JU6X 2G9HD 5C23A 2JZPA 1YX6B 1TS2A 2WXNA 2ZEQA 3B2GA 1TKYA 3Q8CA 1E9MA 2KMAA 1KTKA 3DVGX 5I4DA 4S17A 2JF5A 2MRPA 2XNAC 2AQ1B 1YJJA 2LASA 3RMKC 5BYSA 1FNWA 3W1YA 3QAQA 2C9WB 2BYEA 5EDSA 4NQKE 2CHWA 3ALBA 4TQ1A 1GC7A 3O13A 2LXCA 4H2AA 4JWUC 3GE3C 3U7DA 1T6BX 2ZZPB 2GRIA 3GZNB 5FK9C 3URYA 1EWCA 1Y8RC 1NVID 1TS5A 4ARCA 4WJOA 3N1YC 3AE2B 4C80A 5G5HA 4BBNF 3MTNB 4NAMA 2DZMA 2J42A 3QA8A 3FC4A 3KH0A 2BS2B 1V86A 1WWTA 3PRZA 3DDCB 3ZGZA 5AUKA 2HJ1A 2QEJC 1WMHB 2L00B 4OW0A 2HE7A 4RMAA 1D5XC 5EE9A 4C00A 3A9KB 2V9HA 3PS6A 3NVZA 3QQ8B 2WHIA 4TMAB 4HLEA 4J3OD 3SFEB 1UWXA 2QILA 1IUEA 1ZGUB 3BVGA 2KTRB 3I5JC 1TS4A 4HCPB 1HE8A 2WDRB 5G2NA 2L3ZA 1SE2A 4AWJA 2GBJA 3P2BA 4ZYSA 4MH0E 2ONQA 3Q2AC 2L76A 2V4IB 1F2RC 3PPAA 2NMQA 5DPRA 4OZCA 2GLSA 3GB1A 2VZKB 4WJQA 5DPTA 1D4BA 2WDQB 3GZNI 3A1QA 4HWIB 1MFWA 1JCKB 5T8IA 1I7HA 4TKNA 5D3DA 1VR9A 4XX5A 5BMGA 2LVQA 4YXDB 1JWBD 3VAWA 3NVYA 3H7SA 3MJ5A 2DENB 1NDDA 1ROEA 1T0RC 1J19A 1WMHA 3IAS1 3LDZE 2LEKA 1NENB 4JPSA 4XGAB 4ASWC 3A9KA 4W9JA 4YSZB 2EKIA 3HK0A 3WAPA 4DHZB 3VTUA 3EA6A 2O2VB 2X8XX 4WAAA 1XO3A 3RT3B 3KWVA 3LB8C 2KWDA 1PGBA 4XDCA 1L4DB 1XCTL 2ZW0A 2KTRA 2SEBD 1S3SG 1F0ZA 1PUTA 2WU2B 1T0SC 2J0JA 4BKTA 3SDLC 1QLBB 4HJKA 3VTVA 4WWOA 3HRDD 4ACFA 4WWMA 4CQNA 2KWUB 3KYDD 1L0XB 5J2RA 1BT0A 2I38A 1P3QU 1FFUA 1EF5A 4R3DA 1F52A 3SFDB 1HA5A 1KJTA 3L10B 1ENFA 3TEXA 1JWUD 3PHWB 3AEAB 2BB5A 3AE8B 2V3PA 2IDYA 2PW9A 4A8XC 4GXBA 3V62A 2NBVB 5JXVA 1FXAA 1CK1A 4LJPB 1SIJA 3Q8AA 2KN4A 1J8CA 2VH1A 5GXGB 3K9OB 2LGXA 1PYWD 4P6VF 3TJPA 3ZLZA 3UINB 2G4SA 2O2VA 2KDFB 3DBRB 1JRUA 5HKHA 1C4AA 2RSUA 4L2YA 3KVFB 1RRBA 5C2TB 1ZP0B 3APFA 3ZJUA 3Q8BA 2ZPNA 5EE1A 1ET9A 4ZHPA 2CU1A 4RGNA 3RZFA 4BKSA 4ANWA 3PV1A 2I1JA 4HVBA 1OFFA 2KYWA 1C4CA 1KF6B 2N9PC 3MHSD 2LZ6A 2GOWA 2V3SA 2MHJA 4ICVA 3TEWA 1OQRA 1KH0A 2XN9C 2BS3B 5AUIA 1JWMD 2BTEA 1FEHA 3GS2A 2JT4B 1WRDB 3RN9C 3UIOB 1NYQA 2RGFA 3ZW3A 3EECA 4E3CA 2Y5CA 4CO7A 1UD7A 3N3KB 1F2RI 1V5OA 2J0KA 3ZJTA 3HHMA 5LLIA 3GOEA 3DBRI 1L4ZB 1SEBD 1UBQA 2RDHA 1Z5SB 3AE9B 3PZ7A 5TSSA 2KJHB 2E3TA 1N61A 2L32A 2YEPB 1XLOA 3TMPB 2M8SA 1D5ZC 2BBCA 2WYQA 5JHBA 3BINA 2H89B 4KSKC 2FCNA 1D3ZA 2PTLA 1YQ3B 4M02A 1STEA 4NAWB 4DXAB 1Q10A 4HPPA 1RFKA 2DHZA 2ZW1A 4M8NA 4D2KA 3L0WB 4I6NB 1FIQA 1C77A
chains in the Genus database with same CATH topology
4A3PA 2IYDB 2PE9A 3VVWB 2L7RA 3A1QB 1TGZB 3DPDA 2JRHA 4EFOA 1T0YA 2KLCA 2FCSA 1A5RA 1E5WA 4JL9A 2DYMA 4NNJB 4P7IA 4W9GA 2BWFA 4XC2A 2N7DA 2WX1A 1WM2A 1J0GA 1K8RB 4II2B 5GMVA 1WZ3A 2D07B 4KDLB 1UZXB 3HIZA 5E6OA 5DPWA 1WIAA 1WF9A 3MJWA 4G0NB 1GJZA 1U4AA 3AI5A 3PT2B 4ZYNA 1WGYA 2JUOA 4GDKB 1XD3B 4EZJA 5LXHA 2PEAA 3RD2A 2AEHA 4PYUA 2MBOA 2KD0A 5AZGA 2NR2A 4AUQC 5BO4B 3ZDMC 3ZNGC 3PVLA 1L2NA 2ZPYA 3VUXA 4J6IA 4KV2A 2RD0A 2KNBA 3ML8A 4GU2A 2BYVE 2AYOB 1ZKHA 2DYBA 2N9EB 1VCBA 4G11A 4MGKE 4PS7A 3SD5A 2BF8B 2IO1B 3IFWB 2IO2B 4B95A 1F9JA 2FIFA 2ZNVB 2EKEC 2LVPA 1V81A 1LXDA 3BY4B 4IW0A 1E90A 4W9EA 2XK5B 1SE9A 1CMXB 1Q5WB 2GBRA 4GSWA 4HCNB 3VQIA 1ISNA 2FCMA 3ZUNA 2WDTB 3D32A 4KVGB 2FAZA 3LJ3A 4NAWA 4WWNA 3VUWA 3DBSA 1WX9A 2GBMA 4EKUA 2L0FA 1WGDA 2KMCA 4FHJA 2LRWA 3W1SA 1NBFC 1EO6A 4FULA 2JY6A 2D3GA 4W9CA 4BKSD 1P0RA 3SHQA 4DDID 2KX3A 3Q3JA 3WANA 2V1YA 2MBHA 3L54A 3R7QA 3S2AA 1LQBA 1WGHA 4RM8A 2NCNA 1SIFA 2LD9A 4PYZA 2K39A 4IM0A 2MA9B 5IAAC 3DQVA 4FN2A 4DK5A 3B08A 1QZEA 1WYWB 4F7ZA 2IY0B 2A5UA 2JVCA 2LGYA 2O6VD 1IYFA 4ICUA 3M95A 1WR6E 3IVFA 2NBWB 3OAWA 2KJ6A 1WX7A 2GBKA 4FLHA 2KANA 1H8CA 2IZVB 3QC8B 5D2MB 3WAOA 4MELA 2C60A 2QHOA 2YVCA 3X23A 2VRRB 1OTRB 2JXXA 1WXVA 1GG3A 5TR5A 2KDBA 4TV3A 1VD2A 4F1SA 2YLMA 1V2YA 4IUMB 2MW5A 4ZDVA 4GDKA 4HPLB 2R2QA 1WE7A 3HM3A 2W9NA 4NJ7A 4LJOB 2JWZA 4EZLA 4BOSC 2IO3B 3PHXB 5C23A 3V60A 1YX6B 4ZRIA 1WY8A 2ZEQA 4AOFA 3DOWA 4MEMA 3SU8X 3R3MA 3M62B 4A20A 2K6DB 1OQYA 1SGHA 4LDTD 2D10A 3TL5A 2KMAA 3C0RB 1V5TA 2OJRA 4W9DA 4WJNA 5JHAA 4E74A 2MX2A 3DVGX 5KHOA 2JF5A 2M0XA 2KKCA 2MRPA 2Z0DB 2Z59B 2ZCBA 2XK5A 2LASA 3W1YA 3QAQA 2C9WB 4MDKE 2BYEA 1ZW7A 5EDSA 2EMTA 2CHWA 4NQKE 3ZTCA 3ALBA 4TQ1A 5AZFA 3RYTA 1GC7A 2C7MB 3DCGA 2REXA 2LXCA 4BOZB 1EF1A 4F8CB 3U7DA 2KN5A 2ZZPB 4FA6A 2K1FA 1Y8RC 4KSLC 3QARA 3APCA 3CMMB 4WJOA 3L08A 3DVGY 4G3XB 2DZIA 5D6JB 5J17A 2FCQA 1WJ6A 1YQBA 2KZRA 3KUDB 2IO0B 5CHVC 3OJ4B 4BBNF 3MTNB 3V61A 2DZMA 1S1QB 3QA8A 1I42A 3A4RA 4B9KA 1GUAB 4HPMB 2O6VB 3KH0A 1V86A 2AL3A 3H6NA 2C7NB 3HM6X 4IM2A 3TCAA 2Y5BB 3VH3B 4GGQA 1WFYA 1C3TA 3PRZA 3NZSA 3DDCB 2RPQA 4DHJD 2DX5B 2M1MA 3O65B 2KWVB 3PSEB 1WMHB 2L00B 4K7WA 4M8MA 2HE7A 4CYEA 4RMAA 3ECIA 2LJ5A 4DWFA 2BWES 3A9KB 4HK2A 1WJNA 4IM3A 1KLVA 3VXWA 3PRPB 3PS6A 1EUVB 2N7EA 2C5LC 3QQ8B 4HLEA 1RFAA 3CF6E 3VFKA 4BVUC 2KDIA 4KZCA 3ONSA 1FXTB 2FIDA 1G6JA 3M63B 4TQ0A 1ZGUB 4TUUA 3PZDA 2FUHB 4JGHB 4LDTB 3A9JB 3TIXA 3L13A 3M3JA 2KTRB 1KM7A 4RM9A 1OEYA 2ZVOA 2DAFA 4HCPB 3K9PB 1HE8A 5DPSA 2ASQA 5G2NA 2BGFA 2L3ZA 5E6PA 4AWJA 3NY5A 2GBJA 3P2BA 3VDZA 1UELA 4MH0E 3DBLI 4DBGA 2L76A 3QJZA 3PPAA 1YIWA 2L0TA 5DPRA 4N9F4 1WZ0A 2D11A 3ZRCA 3UQAA 1YJ1A 3EFUA 3ENEA 3PREA 1WI0A 2KFJA 4MSMB 4ANXA 2GBNA 3ML9A 2LGDA 2UYZB 2JZ3B 5C1ZA 4WJQA 3IG3A 5DPTA 4PS3A 4GN1A 2KDEB 3GZNI 2KC2A 2PJHA 3A1QA 3A33B 4HWIB 2D2QA 2IBIB 2DZJA 2CHXA 4IG7B 1PQSA 2KFKB 1UGMA 3UF8A 4TKNA 1M94A 2WX0A 4XX5A 2FNJB 2LVQA 2O6VA 1X1MA 3VAWA 3H7SA 2DENB 1NDDA 4G50A 5CHFA 4ANVA 4IWPA 4AJWA 1J19A 2G3QB 2JPHA 4GB9A 4FHKA 2ZJDA 1V80A 1WMHA 2J7QB 2UWQA 3LDZE 1WXMA 4HDOA 5E6NA 3L17A 4ASWC 2NVUI 2J0MA 3A9KA 1Q1OA 4GDLB 4BKGA 4W9JA 4FJVB 2B3AA 3PTFC 3HK0A 3RULA 2XBBC 3WAPA 4DHZB 3CSFA 3N32A 4ZRJA 2KTFA 3VTUA 4MSQB 2O2VB 4WAAA 3QCAA 4JQWC 5CHWA 3RT3B 2BYFA 3QX1A 4JIOU 3JSVB 1E8YA 2KQSA 2A4ZA 3A9JA 2MBQA 4E71A 5DCNA 3TBLD 2KTRA 1S3SG 2DZKA 2OOBB 1P9DU 2L05A 1TBEA 1AARA 2J0JA 4A3OA 4BKTA 3SDLC 3QK0A 1IPGA 3JVZX 3ZRFA 4MGZE 3PGEA 3WALA 1V9JA 3UQBA 4HJKA 3VTVA 4DHZE 4WWOA 3CSTA 4M0WB 2PE6B 1OGWA 2KWUB 3KYDD 4WWPA 2LRUA 4WJPA 4X57B 5L95C 5J2RA 1BT0A 2XEWA 2HJ8A 2CKHB 1P3QU 2MLBA 4GMVA 2CR5A 1Z2MA 1EF5A 3EHVA 4EEWA 1WXSA 2LXAA 4W9FA 5JH5C 2M4NA 2N1WA 3H9DA 4PS8A 1KJTA 1RAXA 2K8CA 3AU5A 2KFKA 4IWQA 2GMIC 3L10B 2K8BA 3ZTDA 4CHKA 3PHWB 2NS5A 3OLMD 2G45B 1H4RA 2KK8A 2KO3A 3U30A 5L83A 2CS4A 1WXAA 2ZCCA 3JW0X 5AEKB 4GXBA 3QIJA 2KX0A 2DYOA 3V62A 2NBVB 2KLGA 1I35A 4MJSB 2KC1A 2I1KA 1OEYJ 3NOBA 2MSED 4LJPB 5D7GA 4XZ4A 4NPNA 5FR6A 2DAJA 3AULA 4GDLA 1J8CA 2MP2B 4ZRKA 1V6EA 3L16A 3K9OB 2LGXA 3EC8A 1KOTA 3TJPA 3KUCB 3ZLZA 3UINB 3DBHI 3V6CB 3ZDTA 2G4SA 2R2OA 4KIKB 4DDGD 3T9LA 3WIMA 2O2VA 2KDFB 1JRUA 3U8ZA 3PRMB 4K81A 3W1SC 5HKHA 3N30A 3OJ3A 4B6WA 5D94A 1MG8A 4FBJB 3JSVA 2V4LA 4I6LB 3JYUA 1GC6A 2RSUA 2K8HA 2MBBB 1L7YA 1WH3A 3KVFB 2KXJA 3A4SC 1RRBA 2AWTA 3WAMA 3T8MA 3APFA 1XT9B 2LVOA 3AU4A 4W9HA 4KZ0A 3ZO5B 3APDA 4AJYB 5CX3A 3WA0A 1UH6A 4LCDE 2ZPNA 4KDIC 2M17A 2NPTB 2IY1B 2KJRA 1XQQA 5AZHA 2K25A 2MWSB 2CU1A 4IC7B 3RZFA 4BKSA 4W9KA 3NZUA 2NBUA 1R4NI 2WWZA 4FADA 4ANWA 1TTNA 3H7PB 3PV1A 2I1JA 5G55A 5IA7A 1WJ4A 2N1VA 2RR9A 3PLUA 4HVBA 3KUZA 4AP4C 3KYCD 3VH4B 1IP9A 1E8ZA 1E7VA 2K6QA 2N9PC 3QWZB 4ANUA 2CHZA 4W9IA 3MHSD 2LZ6A 2GOWA 2V3SA 4ICVA 1GNUA 4OVVA 1UBIA 4NY0A 2JZZA 4GIVA 2HD5B 4NQLB 2HTHA 2AL6A 4MJSA 3R7RA 1LFDA 2LI5A 5LXIB 3PLVA 2LWPA 1WGGA 1E8WA 5KHQA 2ZNVC 4EUTA 2N4FA 3Q3FA 4DHJB 1WE6A 2EMSA 3IBEA 4MM3A 2JT4B 2KQ7A 1P1AA 1WRDB 3UIOB 2PPHA 2G4DB 3ZIMA 2MP2A 2RGFA 3EECA 3ZW3A 1WX8A 5J18A 4W9LA 4IWOA 4E3CA 1RLFA 2KVRA 3RCZA 4CO7A 2MCNB 1E8XA 1WR1A 4KIKA 1YX5B 1UD7A 2L8JA 3N3KB 2Z0EB 3ZNZB 2J0KA 1V5OA 3IHPC 4K7SA 3KW5B 2KHWB 3HHMA 5LLIA 4BBNC 3DVNV 3GOEA 4MGIE 5JZEB 4II3B 3RUIB 3DBRI 1E7UA 1R4MI 3ZKJC 1V49A 4K7UA 4MGYE 2KOXA 4EOYA 3DVNU 1UBQA 1Z5SB 1NI2A 4FJYA 4I6PA 2N9XA 2KJHB 2LUEA 4HXDA 4OVUA 3H1UA 2JRIB 1TZ1A 3I3TB 2NPTA 4FJZA 1Q0WB 1LM8B 3VTWA 3R66C 4URKA 3X0WA 3QHTA 4WQOB 3UGBB 2KWCA 3TMPB 3VHTC 2M8SA 2MBEA 2BPSA 4YL8A 3H7PA 2WYQA 3ZNID 4EZKA 1WM3A 3BINA 3V6EB 5JHBA 3ZNHB 3NS8A 1P98A 4KSKC 2FCNA 1D3ZA 4K1RB 1YD8U 5CTRC 4NAWB 4DXAB 2BKRB 3B0AA 4GOCA 4BFRA 3VUYA 3B1LX 3ZVVA 3UIPB 2DHZA 4M8NA 1WGRA 4JLCA 2BKFA 2MQJA 2ZVNA 1C1YB 1WJUA 3L0WB 3NHEB 3RZWC 4I6NB 2C7HA 4HDQA 3AXCA 4NJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3P A;  2IYD B;  2PE9 A;  3VVW B;  2L7R A;  3A1Q B;  1TGZ B;  3DPD A;  2JRH A;  4EFO A;  1T0Y A;  2KLC A;  2FCS A;  1A5R A;  1E5W A;  4JL9 A;  2DYM A;  4NNJ B;  4P7I A;  4W9G A;  2BWF A;  4XC2 A;  2N7D A;  2WX1 A;  1WM2 A;  1J0G A;  1K8R B;  4II2 B;  5GMV A;  1WZ3 A;  2D07 B;  4KDL B;  1UZX B;  3HIZ A;  5E6O A;  5DPW A;  1WIA A;  1WF9 A;  3MJW A;  4G0N B;  1GJZ A;  1U4A A;  3AI5 A;  3PT2 B;  4ZYN A;  1WGY A;  2JUO A;  4GDK B;  1XD3 B;  4EZJ A;  5LXH A;  2PEA A;  3RD2 A;  2AEH A;  4PYU A;  2MBO A;  2KD0 A;  5AZG A;  2NR2 A;  4AUQ C;  5BO4 B;  3ZDM C;  3ZNG C;  3PVL A;  1L2N A;  2ZPY A;  3VUX A;  4J6I A;  4KV2 A;  2RD0 A;  2KNB A;  3ML8 A;  4GU2 A;  2BYV E;  2AYO B;  1ZKH A;  2DYB A;  2N9E B;  1VCB A;  4G11 A;  4MGK E;  4PS7 A;  3SD5 A;  2BF8 B;  2IO1 B;  3IFW B;  2IO2 B;  4B95 A;  1F9J A;  2FIF A;  2ZNV B;  2EKE C;  2LVP A;  1V81 A;  1LXD A;  3BY4 B;  4IW0 A;  1E90 A;  4W9E A;  2XK5 B;  1SE9 A;  1CMX B;  1Q5W B;  2GBR A;  4GSW A;  4HCN B;  3VQI A;  1ISN A;  2FCM A;  3ZUN A;  2WDT B;  3D32 A;  4KVG B;  2FAZ A;  3LJ3 A;  4NAW A;  4WWN A;  3VUW A;  3DBS A;  1WX9 A;  2GBM A;  4EKU A;  2L0F A;  1WGD A;  2KMC A;  4FHJ A;  2LRW A;  3W1S A;  1NBF C;  1EO6 A;  4FUL A;  2JY6 A;  2D3G A;  4W9C A;  4BKS D;  1P0R A;  3SHQ A;  4DDI D;  2KX3 A;  3Q3J A;  3WAN A;  2V1Y A;  2MBH A;  3L54 A;  3R7Q A;  3S2A A;  1LQB A;  1WGH A;  4RM8 A;  2NCN A;  1SIF A;  2LD9 A;  4PYZ A;  2K39 A;  4IM0 A;  2MA9 B;  5IAA C;  3DQV A;  4FN2 A;  4DK5 A;  3B08 A;  1QZE A;  1WYW B;  4F7Z A;  2IY0 B;  2A5U A;  2JVC A;  2LGY A;  2O6V D;  1IYF A;  4ICU A;  3M95 A;  1WR6 E;  3IVF A;  2NBW B;  3OAW A;  2KJ6 A;  1WX7 A;  2GBK A;  4FLH A;  2KAN A;  1H8C A;  2IZV B;  3QC8 B;  5D2M B;  3WAO A;  4MEL A;  2C60 A;  2QHO A;  2YVC A;  3X23 A;  2VRR B;  1OTR B;  2JXX A;  1WXV A;  1GG3 A;  5TR5 A;  2KDB A;  4TV3 A;  1VD2 A;  4F1S A;  2YLM A;  1V2Y A;  4IUM B;  2MW5 A;  4ZDV A;  4GDK A;  4HPL B;  2R2Q A;  1WE7 A;  3HM3 A;  2W9N A;  4NJ7 A;  4LJO B;  2JWZ A;  4EZL A;  4BOS C;  2IO3 B;  3PHX B;  5C23 A;  3V60 A;  1YX6 B;  4ZRI A;  1WY8 A;  2ZEQ A;  4AOF A;  3DOW A;  4MEM A;  3SU8 X;  3R3M A;  3M62 B;  4A20 A;  2K6D B;  1OQY A;  1SGH A;  4LDT D;  2D10 A;  3TL5 A;  2KMA A;  3C0R B;  1V5T A;  2OJR A;  4W9D A;  4WJN A;  5JHA A;  4E74 A;  2MX2 A;  3DVG X;  5KHO A;  2JF5 A;  2M0X A;  2KKC A;  2MRP A;  2Z0D B;  2Z59 B;  2ZCB A;  2XK5 A;  2LAS A;  3W1Y A;  3QAQ A;  2C9W B;  4MDK E;  2BYE A;  1ZW7 A;  5EDS A;  2EMT A;  2CHW A;  4NQK E;  3ZTC A;  3ALB A;  4TQ1 A;  5AZF A;  3RYT A;  1GC7 A;  2C7M B;  3DCG A;  2REX A;  2LXC A;  4BOZ B;  1EF1 A;  4F8C B;  3U7D A;  2KN5 A;  2ZZP B;  4FA6 A;  2K1F A;  1Y8R C;  4KSL C;  3QAR A;  3APC A;  3CMM B;  4WJO A;  3L08 A;  3DVG Y;  4G3X B;  2DZI A;  5D6J B;  5J17 A;  2FCQ A;  1WJ6 A;  1YQB A;  2KZR A;  3KUD B;  2IO0 B;  5CHV C;  3OJ4 B;  4BBN F;  3MTN B;  3V61 A;  2DZM A;  1S1Q B;  3QA8 A;  1I42 A;  3A4R A;  4B9K A;  1GUA B;  4HPM B;  2O6V B;  3KH0 A;  1V86 A;  2AL3 A;  3H6N A;  2C7N B;  3HM6 X;  4IM2 A;  3TCA A;  2Y5B B;  3VH3 B;  4GGQ A;  1WFY A;  1C3T A;  3PRZ A;  3NZS A;  3DDC B;  2RPQ A;  4DHJ D;  2DX5 B;  2M1M A;  3O65 B;  2KWV B;  3PSE B;  1WMH B;  2L00 B;  4K7W A;  4M8M A;  2HE7 A;  4CYE A;  4RMA A;  3ECI A;  2LJ5 A;  4DWF A;  2BWE S;  3A9K B;  4HK2 A;  1WJN A;  4IM3 A;  1KLV A;  3VXW A;  3PRP B;  3PS6 A;  1EUV B;  2N7E A;  2C5L C;  3QQ8 B;  4HLE A;  1RFA A;  3CF6 E;  3VFK A;  4BVU C;  2KDI A;  4KZC A;  3ONS A;  1FXT B;  2FID A;  1G6J A;  3M63 B;  4TQ0 A;  1ZGU B;  4TUU A;  3PZD A;  2FUH B;  4JGH B;  4LDT B;  3A9J B;  3TIX A;  3L13 A;  3M3J A;  2KTR B;  1KM7 A;  4RM9 A;  1OEY A;  2ZVO A;  2DAF A;  4HCP B;  3K9P B;  1HE8 A;  5DPS A;  2ASQ A;  5G2N A;  2BGF A;  2L3Z A;  5E6P A;  4AWJ A;  3NY5 A;  2GBJ A;  3P2B A;  3VDZ A;  1UEL A;  4MH0 E;  3DBL I;  4DBG A;  2L76 A;  3QJZ A;  3PPA A;  1YIW A;  2L0T A;  5DPR A;  4N9F 4;  1WZ0 A;  2D11 A;  3ZRC A;  3UQA A;  1YJ1 A;  3EFU A;  3ENE A;  3PRE A;  1WI0 A;  2KFJ A;  4MSM B;  4ANX A;  2GBN A;  3ML9 A;  2LGD A;  2UYZ B;  2JZ3 B;  5C1Z A;  4WJQ A;  3IG3 A;  5DPT A;  4PS3 A;  4GN1 A;  2KDE B;  3GZN I;  2KC2 A;  2PJH A;  3A1Q A;  3A33 B;  4HWI B;  2D2Q A;  2IBI B;  2DZJ A;  2CHX A;  4IG7 B;  1PQS A;  2KFK B;  1UGM A;  3UF8 A;  4TKN A;  1M94 A;  2WX0 A;  4XX5 A;  2FNJ B;  2LVQ A;  2O6V A;  1X1M A;  3VAW A;  3H7S A;  2DEN B;  1NDD A;  4G50 A;  5CHF A;  4ANV A;  4IWP A;  4AJW A;  1J19 A;  2G3Q B;  2JPH A;  4GB9 A;  4FHK A;  2ZJD A;  1V80 A;  1WMH A;  2J7Q B;  2UWQ A;  3LDZ E;  1WXM A;  4HDO A;  5E6N A;  3L17 A;  4ASW C;  2NVU I;  2J0M A;  3A9K A;  1Q1O A;  4GDL B;  4BKG A;  4W9J A;  4FJV B;  2B3A A;  3PTF C;  3HK0 A;  3RUL A;  2XBB C;  3WAP A;  4DHZ B;  3CSF A;  3N32 A;  4ZRJ A;  2KTF A;  3VTU A;  4MSQ B;  2O2V B;  4WAA A;  3QCA A;  4JQW C;  5CHW A;  3RT3 B;  2BYF A;  3QX1 A;  4JIO U;  3JSV B;  1E8Y A;  2KQS A;  2A4Z A;  3A9J A;  2MBQ A;  4E71 A;  5DCN A;  3TBL D;  2KTR A;  1S3S G;  2DZK A;  2OOB B;  1P9D U;  2L05 A;  1TBE A;  1AAR A;  2J0J A;  4A3O A;  4BKT A;  3SDL C;  3QK0 A;  1IPG A;  3JVZ X;  3ZRF A;  4MGZ E;  3PGE A;  3WAL A;  1V9J A;  3UQB A;  4HJK A;  3VTV A;  4DHZ E;  4WWO A;  3CST A;  4M0W B;  2PE6 B;  1OGW A;  2KWU B;  3KYD D;  4WWP A;  2LRU A;  4WJP A;  4X57 B;  5L95 C;  5J2R A;  1BT0 A;  2XEW A;  2HJ8 A;  2CKH B;  1P3Q U;  2MLB A;  4GMV A;  2CR5 A;  1Z2M A;  1EF5 A;  3EHV A;  4EEW A;  1WXS A;  2LXA A;  4W9F A;  5JH5 C;  2M4N A;  2N1W A;  3H9D A;  4PS8 A;  1KJT A;  1RAX A;  2K8C A;  3AU5 A;  2KFK A;  4IWQ A;  2GMI C;  3L10 B;  2K8B A;  3ZTD A;  4CHK A;  3PHW B;  2NS5 A;  3OLM D;  2G45 B;  1H4R A;  2KK8 A;  2KO3 A;  3U30 A;  5L83 A;  2CS4 A;  1WXA A;  2ZCC A;  3JW0 X;  5AEK B;  4GXB A;  3QIJ A;  2KX0 A;  2DYO A;  3V62 A;  2NBV B;  2KLG A;  1I35 A;  4MJS B;  2KC1 A;  2I1K A;  1OEY J;  3NOB A;  2MSE D;  4LJP B;  5D7G A;  4XZ4 A;  4NPN A;  5FR6 A;  2DAJ A;  3AUL A;  4GDL A;  1J8C A;  2MP2 B;  4ZRK A;  1V6E A;  3L16 A;  3K9O B;  2LGX A;  3EC8 A;  1KOT A;  3TJP A;  3KUC B;  3ZLZ A;  3UIN B;  3DBH I;  3V6C B;  3ZDT A;  2G4S A;  2R2O A;  4KIK B;  4DDG D;  3T9L A;  3WIM A;  2O2V A;  2KDF B;  1JRU A;  3U8Z A;  3PRM B;  4K81 A;  3W1S C;  5HKH A;  3N30 A;  3OJ3 A;  4B6W A;  5D94 A;  1MG8 A;  4FBJ B;  3JSV A;  2V4L A;  4I6L B;  3JYU A;  1GC6 A;  2RSU A;  2K8H A;  2MBB B;  1L7Y A;  1WH3 A;  3KVF B;  2KXJ A;  3A4S C;  1RRB A;  2AWT A;  3WAM A;  3T8M A;  3APF A;  1XT9 B;  2LVO A;  3AU4 A;  4W9H A;  4KZ0 A;  3ZO5 B;  3APD A;  4AJY B;  5CX3 A;  3WA0 A;  1UH6 A;  4LCD E;  2ZPN A;  4KDI C;  2M17 A;  2NPT B;  2IY1 B;  2KJR A;  1XQQ A;  5AZH A;  2K25 A;  2MWS B;  2CU1 A;  4IC7 B;  3RZF A;  4BKS A;  4W9K A;  3NZU A;  2NBU A;  1R4N I;  2WWZ A;  4FAD A;  4ANW A;  1TTN A;  3H7P B;  3PV1 A;  2I1J A;  5G55 A;  5IA7 A;  1WJ4 A;  2N1V A;  2RR9 A;  3PLU A;  4HVB A;  3KUZ A;  4AP4 C;  3KYC D;  3VH4 B;  1IP9 A;  1E8Z A;  1E7V A;  2K6Q A;  2N9P C;  3QWZ B;  4ANU A;  2CHZ A;  4W9I A;  3MHS D;  2LZ6 A;  2GOW A;  2V3S A;  4ICV A;  1GNU A;  4OVV A;  1UBI A;  4NY0 A;  2JZZ A;  4GIV A;  2HD5 B;  4NQL B;  2HTH A;  2AL6 A;  4MJS A;  3R7R A;  1LFD A;  2LI5 A;  5LXI B;  3PLV A;  2LWP A;  1WGG A;  1E8W A;  5KHQ A;  2ZNV C;  4EUT A;  2N4F A;  3Q3F A;  4DHJ B;  1WE6 A;  2EMS A;  3IBE A;  4MM3 A;  2JT4 B;  2KQ7 A;  1P1A A;  1WRD B;  3UIO B;  2PPH A;  2G4D B;  3ZIM A;  2MP2 A;  2RGF A;  3EEC A;  3ZW3 A;  1WX8 A;  5J18 A;  4W9L A;  4IWO A;  4E3C A;  1RLF A;  2KVR A;  3RCZ A;  4CO7 A;  2MCN B;  1E8X A;  1WR1 A;  4KIK A;  1YX5 B;  1UD7 A;  2L8J A;  3N3K B;  2Z0E B;  3ZNZ B;  2J0K A;  1V5O A;  3IHP C;  4K7S A;  3KW5 B;  2KHW B;  3HHM A;  5LLI A;  4BBN C;  3DVN V;  3GOE A;  4MGI E;  5JZE B;  4II3 B;  3RUI B;  3DBR I;  1E7U A;  1R4M I;  3ZKJ C;  1V49 A;  4K7U A;  4MGY E;  2KOX A;  4EOY A;  3DVN U;  1UBQ A;  1Z5S B;  1NI2 A;  4FJY A;  4I6P A;  2N9X A;  2KJH B;  2LUE A;  4HXD A;  4OVU A;  3H1U A;  2JRI B;  1TZ1 A;  3I3T B;  2NPT A;  4FJZ A;  1Q0W B;  1LM8 B;  3VTW A;  3R66 C;  4URK A;  3X0W A;  3QHT A;  4WQO B;  3UGB B;  2KWC A;  3TMP B;  3VHT C;  2M8S A;  2MBE A;  2BPS A;  4YL8 A;  3H7P A;  2WYQ A;  3ZNI D;  4EZK A;  1WM3 A;  3BIN A;  3V6E B;  5JHB A;  3ZNH B;  3NS8 A;  1P98 A;  4KSK C;  2FCN A;  1D3Z A;  4K1R B;  1YD8 U;  5CTR C;  4NAW B;  4DXA B;  2BKR B;  3B0A A;  4GOC A;  4BFR A;  3VUY A;  3B1L X;  3ZVV A;  3UIP B;  2DHZ A;  4M8N A;  1WGR A;  4JLC A;  2BKF A;  2MQJ A;  2ZVN A;  1C1Y B;  1WJU A;  3L0W B;  3NHE B;  3RZW C;  4I6N B;  2C7H A;  4HDQ A;  3AXC A;  4NJ6 A; 
#chains in the Genus database with same CATH topology
 3TUO A;  2IYD B;  2PE9 A;  2W3S A;  2FCS A;  2FBW B;  1A5R A;  1E5W A;  4JL9 A;  4P7I A;  3HVD A;  2M19 A;  2BWF A;  4LNO A;  3IAM 1;  3FKY A;  1L6V A;  3MJW A;  4G0N B;  3AI5 A;  4RF1 A;  3PT2 B;  2TSS A;  1XD3 B;  2AEH A;  3DHG C;  3RNA C;  2KD0 A;  5AZG A;  1TY0 A;  5BO4 B;  3ZDM C;  3PVL A;  3SR6 A;  3ML8 A;  2BYV E;  2AYO B;  1ZKH A;  4YWG G;  4B0M A;  2DYB A;  1VCB A;  2INN E;  3R8B A;  4B95 A;  2LGS A;  2W82 A;  3AE5 B;  2EKE C;  3BY4 B;  1V81 A;  2K0P A;  3RNC C;  2LMC A;  2WU5 B;  2XK5 B;  2GBR A;  2PVO D;  3BII D;  1MG4 A;  1ISN A;  3NG0 A;  2KVZ A;  3D32 A;  2FAZ A;  3LJ3 A;  4NAW A;  3DBS A;  2KMC A;  4DDI D;  3OWE B;  3Q3J A;  3R7Q A;  3S2A A;  1E6E B;  3U4E G;  4IM0 A;  3V05 A;  1QZE A;  1WYW B;  1C78 A;  2LGY A;  1IYF A;  3IVF A;  3WAO A;  2YVC A;  3MC0 B;  1HEZ E;  2WLB A;  1UNS A;  2JXX A;  5TR5 A;  1TKG A;  1V2Y A;  2OJW A;  3Q69 A;  4HPL B;  4N59 A;  2K5P A;  2W9N A;  3J9C A;  3PHX B;  4ZRI A;  1WY8 A;  1C76 A;  1V5T A;  3AMZ A;  4W9D A;  5KHO A;  2KKC A;  3DBL B;  2XK5 A;  3DWG C;  1QT9 A;  2E6X A;  2WXF A;  4KGR A;  4L1B A;  1SJE D;  3DHI C;  2EMT A;  4OHJ A;  3ZTC A;  3NRZ A;  3AED B;  1EF1 A;  3B2F A;  1P7E A;  4MH8 A;  4REZ A;  3AEE B;  3APC A;  3DVG Y;  4G3X B;  4WIP A;  2FCQ A;  1WJ6 A;  5CHV C;  1FRD A;  2DBY A;  1S1Q B;  1I42 A;  3A4R A;  4B9K A;  1GUA B;  3H6N A;  2C7N B;  3HM6 X;  4IM2 A;  2Y5B B;  1XCQ L;  2X38 A;  1C3T A;  3NZS A;  4DHJ D;  3PSE B;  1SE4 A;  4CYE A;  4DWF A;  4HK2 A;  2SAK A;  4IM3 A;  1KLG D;  1RM6 C;  4BVU C;  3ONS A;  4AS1 A;  2FID A;  4TQ0 A;  4TUU A;  1XEE A;  4LDT B;  4US8 A;  2MEK A;  1GB1 A;  2WXM A;  2DAF A;  1Y56 A;  2DNF A;  4YTN B;  2BGF A;  1AW7 A;  2IGD A;  2KAC A;  1UEL A;  3DBL I;  4DBG A;  3HUI A;  4WUR A;  1YIW A;  2L0T A;  2N0S B;  2HTM E;  3ZRC A;  1YJ1 A;  3EFU A;  3PRE A;  1WI0 A;  1DYQ A;  4MSM B;  2IJ0 A;  4P1B C;  3I63 C;  2UYZ B;  2JZ3 B;  5HHD G;  4A9A A;  4PS3 A;  3A33 B;  2INP E;  2D2Q A;  1K53 A;  4LK0 M;  1PQS A;  2J53 A;  1UGM A;  2KFK B;  1M94 A;  2IGH A;  1E7P B;  2Y3A A;  4FHK A;  2UWQ A;  4L23 A;  1HTQ A;  4HDO A;  3GP7 A;  3L17 A;  2GB1 A;  2NVU I;  1J7B A;  4BKG A;  4FJV B;  1SE3 A;  3RUL A;  3NS1 A;  2XBB C;  1LO5 D;  3CSF A;  3FIL B;  1CZP A;  2PVG C;  1JWA D;  2VH2 A;  1E8Y A;  2A4Z A;  5DCN A;  1L6U A;  1P9D U;  2L05 A;  4MT5 A;  4KGS A;  4Q2J A;  3WAL A;  1C79 A;  3ZXR A;  2PKO A;  2WXG A;  2PE6 B;  4WWP A;  1LGR A;  2HJ8 A;  2J52 A;  5IOI A;  2CKH B;  3IXS A;  2MLB A;  4EEW A;  2LXA A;  4W9F A;  3P4Q B;  2N1W A;  1D5M C;  3BK1 A;  2KFK A;  3AN1 A;  5LNK 1;  2RPV A;  2K8B A;  4CHK A;  2NS5 A;  1H4R A;  2KK8 A;  2KO3 A;  1WXA A;  3JW0 X;  1HQR D;  5EE0 A;  2KC1 A;  4HJG E;  1L5P A;  2I1K A;  3NOB A;  2MSE D;  3UI3 A;  2WGS A;  4XZ4 A;  4YTM B;  1C9F A;  2BYT A;  2DAJ A;  3AUL A;  2MP2 B;  3IT6 B;  3EC8 A;  3KUC B;  3V6C B;  4KIK B;  4DDG D;  2KDM A;  3T9L A;  3W1S C;  3PRM B;  4K81 A;  3AH7 A;  1R4M B;  4B6W A;  5FR3 A;  2V4L A;  1GC6 A;  2PLP A;  2MBB B;  1L7Y A;  1CJE A;  2MH7 A;  2JYE A;  2KXJ A;  2AWT A;  2FE8 A;  2M0A A;  2KAJ A;  3RI7 C;  2JQR B;  1XLP A;  3ZO5 B;  4AJY B;  4KDI C;  2NPT B;  2KJR A;  4ARI A;  5AZH A;  2MWS B;  4EE2 A;  2NBU A;  1R4N I;  3AE1 B;  4FAD A;  1TTN A;  5IA7 A;  3PLU A;  4AP4 C;  3KYC D;  1WXQ A;  1IP9 A;  3AE6 B;  3NUH B;  3R2I A;  2K6Q A;  2WXH A;  1QOF A;  3PO0 A;  3ZJV A;  4ANU A;  4W9I A;  3P4P B;  1UBI A;  2HD5 B;  4NQL B;  2HTH A;  1LFD A;  3PLV A;  1AN8 A;  2ZNV C;  1N6Z A;  3Q3F A;  4DHJ B;  2EMS A;  3IBE A;  1P1A A;  5G5G A;  2KQ4 X;  2MP2 A;  3W9C B;  3EFC A;  4KIK A;  3RNF C;  3ZNZ B;  4K3B A;  3IHP C;  4K7S A;  1RWS A;  4ZOH C;  3Q8F A;  4HKQ A;  4BBN C;  3DVN V;  4MGI E;  3RUI B;  1L0V B;  1MJD A;  1R4M I;  3P42 A;  1V49 A;  3ABV B;  4K7U A;  3DVN U;  3E9S A;  1VZ6 A;  4OVU A;  3BYT B;  1TZ1 A;  3I3T B;  1I4R A;  2NPT A;  4FJZ A;  3R66 C;  4WQO B;  3UGB B;  5BMI A;  2BPS A;  3ZNI D;  3AE7 B;  2J4X A;  3MC9 A;  4XWW A;  3V6E B;  2JWU A;  3ZNH B;  3NS8 A;  1EU4 A;  1R7S A;  1JW9 D;  4OZA A;  1ZOY B;  2I2Y A;  3B1L X;  4QAY A;  3UIP B;  5HFY A;  4LLG M;  2MQJ A;  3RZW C;  3NHE B;  4HDQ A;  4NJ6 A;  4EFO A;  1DOI A;  2N7D A;  1WM2 A;  5D3I B;  2MJ3 A;  1K8R B;  4KDL B;  4XE0 A;  2PIA A;  4KGT A;  4UDU C;  5DPW A;  1XLQ A;  4ZYN A;  4EZJ A;  2PEA A;  3RD2 A;  3VR9 B;  4AUQ C;  1NI3 A;  3ZNG C;  1L2N A;  4J6I A;  2WDV B;  4C4V B;  3SD5 A;  3BYY B;  2IO2 B;  2ZNV B;  2V3N A;  4JWS C;  1CMX B;  1Q5W B;  2FCM A;  1KLU D;  2WDT B;  4KVG B;  1SF0 A;  4WWN A;  3VUW A;  1WX9 A;  1EWY C;  1WGD A;  3W1S A;  1EO6 A;  1PFD A;  3BVM A;  4W9C A;  1P0R A;  3WAN A;  2V1Y A;  1LQB A;  1IBX B;  2NCN A;  2LD9 A;  4FN2 A;  2A5U A;  2JVC A;  1HTO A;  4YTP B;  2OHF A;  2KJ6 A;  4KKI A;  2GBK A;  2KAN A;  2IZV B;  3QC8 B;  4MEL A;  2C60 A;  2MJD A;  3NVW A;  3X23 A;  1BXT A;  1OTR B;  1VD2 A;  4F1S A;  2MW5 A;  2ICI A;  3C8Y A;  2GI9 A;  3HM3 A;  4LJO B;  4BOS C;  4AOF A;  2Q5W D;  4MEM A;  3SU8 X;  5MPO A;  4C56 C;  3R3M A;  1BUI C;  2WXO A;  3M62 B;  5IKC M;  4A20 A;  4C4V A;  2K6D B;  4LDT D;  3TL5 A;  3C0R B;  5JHA A;  2MX2 A;  2QCZ A;  5BYR A;  3U2S C;  1D6E C;  2Z59 B;  4MDK E;  5AZF A;  2C7M B;  3KQ4 A;  3DCG A;  2REX A;  1SXT A;  2CU3 A;  2D3A A;  2WXR A;  2K1F A;  3QAR A;  1IBX A;  5J17 A;  1QIL A;  1N60 A;  1YQB A;  2KZR A;  2K22 A;  3PZ8 A;  3MFG A;  3V61 A;  4HKZ E;  4HPM B;  2O6V B;  2AL3 A;  3TCA A;  3VH3 B;  4GGQ A;  1MVK A;  4KX6 B;  2RPQ A;  3O65 B;  2IND C;  2WXI A;  4K7W A;  4M8M A;  3VRA B;  3ECI A;  2BWE S;  1KLV A;  1WJN A;  4BZA A;  3PRP B;  4N58 A;  1EUV B;  2N7E A;  2C5L C;  1HXY D;  3VFK A;  2G1E A;  2KDI A;  1MHH E;  4B0E A;  4DQO C;  1V97 A;  1FXT B;  2K9X A;  3PZD A;  2FUH B;  3L13 A;  3M3J A;  4RM9 A;  1KM7 A;  1OEY A;  2KT7 A;  5DPS A;  2ASQ A;  1F77 A;  5E6P A;  5IN7 A;  1FM0 D;  3QJZ A;  3P1M A;  3Q14 C;  1SSN A;  3UQA A;  3ENE A;  2BT6 A;  2KFJ A;  4C7Y A;  3ML9 A;  2DWQ A;  2LGD A;  1SB3 C;  3IG3 A;  2KDE B;  4RF0 A;  2IBI B;  2CHX A;  4WH4 A;  3P4R B;  3UF8 A;  2O6V A;  2AQ2 B;  3GE8 C;  5HG2 A;  3ZQ4 A;  3MC8 A;  2ZJD A;  4HEA 1;  3DBH B;  1A70 A;  1VDV A;  1Q1O A;  4GDL B;  1FNU A;  1QKZ A;  2IGG A;  2K3U A;  3H8H A;  2EEL A;  4JQW C;  2BYF A;  3QX1 A;  4JIO U;  2W55 A;  1I4G A;  2KQS A;  3TBL D;  2DZK A;  1XF5 L;  1AAR A;  4A3O A;  2CJO A;  3JVZ X;  4ITK A;  3ZRF A;  1EM7 A;  1V9J A;  4DHZ E;  4M0W B;  2LRU A;  4WJP A;  4X57 B;  4A6Q A;  2XEW A;  2CR5 A;  1GAQ B;  2NTS A;  3EHV A;  2M4N A;  1FPY A;  1RAX A;  2K8C A;  3AU5 A;  4IWQ A;  3ZTD A;  3Q3M C;  3U30 A;  5L83 A;  2CS4 A;  2ZCC A;  3AEB B;  1NYR A;  5AEK B;  5EE3 A;  3QIJ A;  1I35 A;  2KLG A;  2W54 A;  5H8Y E;  4NZL B;  2WXL A;  2QC8 A;  3RNG C;  4GDL A;  1QQR A;  3L16 A;  1N5W A;  1AYF A;  1KOT A;  3V3X A;  1T3Q A;  3DBH I;  3ZDT A;  1B9R A;  1VLB A;  3N30 A;  5D94 A;  4FBJ B;  4I6L B;  3JYU A;  1QOG A;  2K8H A;  1WH3 A;  2LUM A;  2QMT A;  2R61 A;  1XT9 B;  2LVO A;  3AU4 A;  4ZHO A;  5C3J B;  4IDI A;  5CX3 A;  3WA0 A;  2ACZ B;  1UH6 A;  4LCD E;  1B1Z A;  1AWD A;  1VZ7 A;  2B76 B;  2IY1 B;  1XQQ A;  3RNE C;  1FNV A;  4IC7 B;  4W9K A;  3NZU A;  3H7P B;  2N1V A;  2RR9 A;  2NTT A;  3NZ3 A;  3VH4 B;  2LHD A;  4ZRP A;  1E7V A;  4LNN A;  3Q6B A;  2JXT A;  4OVV A;  1GNU A;  1FCL A;  2WXQ A;  2JZZ A;  3R7R A;  5IP4 D;  5LXI B;  2LI5 A;  1WGG A;  3TEZ A;  3I9V 1;  2N4F A;  4EUT A;  1WE6 A;  2KQ7 A;  2PPH A;  3ZIM A;  1JRO A;  3ETR A;  3I57 A;  5J18 A;  2KVR A;  3RCZ A;  1GPX A;  2LJI A;  1E8X A;  2L8J A;  3MP9 A;  1ET6 A;  1EU3 A;  2Z0E B;  2L52 A;  1JML A;  1SJH D;  1HZ6 A;  3VR8 B;  2BW2 A;  1K50 A;  1E7U A;  3HVZ A;  3ZKJ C;  4A55 A;  4EOY A;  2DLB A;  1NI2 A;  4FJY A;  3DHH C;  4I6P A;  2LUE A;  1DOY A;  3IT4 B;  4GLS C;  3RPF C;  1R4N B;  1VZ8 A;  3VTW A;  3ZYY X;  3X0W A;  1J7A A;  2MBE A;  1SBB B;  4YL8 A;  3H7P A;  1XXG A;  4K1R B;  1V1P B;  5CTR C;  1JRP A;  2BKR B;  3B0A A;  4GOC A;  4BFR A;  3MHZ A;  3VUY A;  2BB6 A;  2QIE B;  3AEG B;  1C1Y B;  1WJU A;  2C7H A;  4PT5 A;  3AXC A;  3W5U B;  1V1O A;  3A1Q B;  1T0Y A;  2KLC A;  3AEF B;  3FIL A;  3T3O A;  1J0G A;  2D5G A;  4YSY B;  4II2 B;  1WZ3 A;  2D07 B;  1N63 A;  3CIR B;  1UZX B;  2L83 A;  3KLS X;  3HIZ A;  2QDF A;  1GJZ A;  1U4A A;  3AB5 A;  1P7F A;  2NR2 A;  1RYJ A;  2WS3 B;  4ZRQ A;  2D3B A;  3P4S B;  2KNB A;  3ZXV A;  1PDX A;  2N9E B;  4MGK E;  4PS7 A;  3IFW B;  2CJN A;  1F9J A;  2FIF A;  1T0Q C;  2QSD A;  4W9E A;  1TT5 B;  4IKG A;  1SE9 A;  2YEP F;  4GSW A;  2WXJ A;  1V1P A;  1FRR A;  2M56 B;  2GBM A;  4EKU A;  2L0F A;  4FHJ A;  4FUL A;  2D3G A;  3SHQ A;  2KX3 A;  3L54 A;  1FFV A;  1WGH A;  4RM8 A;  1SIF A;  4PYZ A;  2K39 A;  1CQV A;  3NVV A;  5IAA C;  3DQV A;  4DK5 A;  3B08 A;  1J7C A;  4RFB A;  1UGJ A;  2IY0 B;  4LNI A;  2O6V D;  4ICU A;  3M95 A;  3LXF A;  1YNT E;  2HDE A;  2PMV A;  1H8C A;  3U52 E;  2VRR B;  1GG3 A;  2KDB A;  2Y5P A;  4TV3 A;  2R2Q A;  1T5X D;  1ZPS A;  1YJI A;  2IO3 B;  4RH6 A;  3V60 A;  1BML C;  1VRA B;  3DOW A;  1OQY A;  1SGH A;  2D10 A;  4XYC A;  2OJR A;  4RGM A;  4WJN A;  4E74 A;  2M0X A;  2Z0D B;  2ZCB A;  4C7Z A;  1MI0 A;  5HI1 A;  4P16 A;  1ZW7 A;  3RYT A;  2LFI A;  4BOZ B;  3TEY A;  4F8C B;  2KN5 A;  4HRS A;  4FA6 A;  4P1C C;  4KSL C;  3CMM B;  3L08 A;  2RMM A;  2DZI A;  2L1A A;  5D6J B;  1TY2 A;  3KUD B;  2IO0 B;  3OJ4 B;  3BWU D;  1WFY A;  1PGA A;  2ON8 A;  2DX5 B;  2M1M A;  2KWV B;  4A90 A;  1WSP A;  1M4V A;  4RNA A;  3WCQ A;  2LJ5 A;  4KKJ A;  1E0Z A;  4YSX B;  3B9J A;  3VXW A;  3T3N A;  1DGJ A;  4YT0 B;  4RCO A;  1RFA A;  3CF6 E;  2AQ3 B;  2IPK D;  4KZC A;  3N9Y C;  1F1H A;  1G6J A;  3M63 B;  4JGH B;  1FO4 A;  4RGT A;  3A9J B;  3TIX A;  1KRH A;  2ZVO A;  3K9P B;  2MJE A;  3NY5 A;  1YQ4 B;  3VDZ A;  2WQY B;  1I4P A;  1YOV B;  1UF0 A;  2QJL A;  2OED A;  1I4X A;  3N1Z C;  4N9F 4;  1WZ0 A;  3DWM A;  2D11 A;  2W3R A;  2JYT A;  4XDD A;  4ANX A;  2GBN A;  5FKA C;  5C1Z A;  1TZO A;  4GN1 A;  3Q8E A;  1DOX A;  2KC2 A;  2PJH A;  2DZJ A;  4IG7 B;  2WX0 A;  4IOI E;  2FNJ B;  1X1M A;  3R2T A;  3OG5 A;  2N7J A;  3Q3N C;  4JE3 B;  4G50 A;  1MHX A;  5CHF A;  4ANV A;  4IWP A;  4AJW A;  1ZXH A;  2G3Q B;  1XLN A;  2JPH A;  3W5V B;  4GB9 A;  4LNK A;  1YN5 A;  1V80 A;  2J7Q B;  1WXM A;  5E6N A;  1ZDX A;  2J0M A;  3EUB 2;  2B3A A;  3PTF C;  3Q3O C;  4OZB A;  3N32 A;  4ZRJ A;  2KTF A;  4MSQ B;  3QCA A;  5CHW A;  3KWL A;  3JSV B;  1JAL A;  2BQQ A;  4USA A;  3A9J A;  2MBQ A;  4E71 A;  4PK1 A;  2OOB B;  1TBE A;  1GB4 A;  3QK0 A;  1IPG A;  1ZUD 2;  4MGZ E;  3PGE A;  3UQB A;  3CST A;  1YN4 A;  2BVC A;  1OGW A;  4M00 A;  5L95 C;  2KMM A;  4GMV A;  1Z2M A;  4AQ7 A;  1WXS A;  5JH5 C;  4N6E B;  3H9D A;  4PS8 A;  4LTU A;  3RNB C;  2GMI C;  3OLM D;  2G45 B;  2KX0 A;  2DYO A;  3AE4 B;  4MJS B;  1OEY J;  4MM3 B;  5D7G A;  4NPN A;  5FR6 A;  1V8C A;  4US9 A;  4ZRK A;  1FCC C;  1V6E A;  1TS3 A;  3E56 A;  2R2O A;  3WIM A;  3U8Z A;  1K51 A;  1ZE3 D;  3OJ3 A;  2WNM A;  1MG8 A;  3JSV A;  1I4H A;  1JQ4 A;  3A4S C;  2N9K A;  3WAM A;  3BK2 A;  2N9L A;  3T8M A;  4W9H A;  4XWT A;  4KZ0 A;  3APD A;  1QOB A;  1FMA D;  2M17 A;  3N20 C;  2JSV X;  2K25 A;  1TKE A;  4WQM A;  2WWZ A;  5G55 A;  1WJ4 A;  3KUZ A;  1C4P A;  1E8Z A;  5IO9 A;  3AEC B;  3QWZ B;  2CHZ A;  4JX1 C;  1I4Q A;  4NY0 A;  4GIV A;  1VJK A;  2AL6 A;  4MJS A;  2LWP A;  1E8W A;  5KHQ A;  4MM3 A;  1NEK B;  3RFZ B;  2RDG A;  4BAX A;  2G4D B;  1WX8 A;  1N62 A;  4W9L A;  4IWO A;  3AM9 A;  1RLF A;  2MCN B;  1UUP A;  4TSS A;  1WR1 A;  1YX5 B;  1OQQ A;  4RGO S;  2INC C;  3W2D A;  3KW5 B;  1WYG A;  2KHW B;  5BMH A;  2WP9 B;  2FUG 1;  4K3C A;  5JZE B;  4II3 B;  2LHE A;  4MGY E;  2KOX A;  3TSS A;  5H92 C;  1E10 A;  1WRI A;  3AV8 A;  2N9X A;  4HXD A;  3H1U A;  3BZD B;  2JRI B;  3AE3 B;  3N1X C;  1Q0W B;  1LM8 B;  1FD6 A;  4URK A;  3QHT A;  4WAF A;  2KWC A;  3FAH A;  2Z8L A;  3VHT C;  1ESF A;  4EZK A;  1WM3 A;  1P98 A;  2JX5 A;  1YD8 U;  1YMH E;  3U7Z A;  3ZVV A;  1WGR A;  2VZK D;  4JLC A;  3LYY A;  2BKF A;  2ZVN A;  4HRO A;  1TIF A;  4A3P A;  3VVW B;  1TJE A;  2L7R A;  1KFY B;  1TGZ B;  2D3C A;  3DPD A;  1IGD A;  2JRH A;  3SEB A;  2WXK A;  3CWI A;  4S0R A;  1GOZ A;  4NNJ B;  2DYM A;  4W9G A;  4XC2 A;  1YN3 A;  2WX1 A;  4NJC A;  2RDB C;  5GMV A;  1FXI A;  1QOA A;  2H88 B;  1MPE A;  5E6O A;  1WIA A;  1WF9 A;  1WGY A;  2JUO A;  4GDK B;  5LXH A;  4PYU A;  2MBO A;  3L4P A;  4FXC A;  4MAC A;  2ZPY A;  3VUX A;  4O1N A;  4KV2 A;  2RD0 A;  4DXG A;  4GU2 A;  4M01 A;  4G11 A;  2BF8 B;  4M0W A;  1TYG B;  2IO1 B;  1K52 A;  1JWS D;  2LVP A;  1LXD A;  4IW0 A;  1E90 A;  1IGC A;  3EGR A;  4OVZ A;  5E6J A;  2UU7 A;  2BS4 B;  4HCN B;  3VQI A;  1HZ5 A;  1PGX A;  2V0G A;  3NJT A;  3ZUN A;  3VRB B;  2LRW A;  3BVZ A;  1NBF C;  1ZDV A;  1UWM A;  2JY6 A;  3P63 A;  4BKS D;  3C19 A;  2MBH A;  4LNF A;  2MA9 B;  4F7Z A;  1N5X A;  2AX5 A;  1WR6 E;  3OAW A;  2NBW B;  1ACC A;  1WX7 A;  4FLH A;  5D2M B;  5BYQ A;  1L0Y B;  2LGI A;  2QHO A;  1WGK A;  1WXV A;  2YLM A;  4DXF A;  4IUM B;  4ZDV A;  4GDK A;  1WE7 A;  1QF6 A;  2WXP A;  1ZXI A;  4NJ7 A;  2JWZ A;  4EZL A;  2JU6 X;  2G9H D;  5C23 A;  2JZP A;  1YX6 B;  1TS2 A;  2WXN A;  2ZEQ A;  3B2G A;  1TKY A;  3Q8C A;  1E9M A;  2KMA A;  1KTK A;  3DVG X;  5I4D A;  4S17 A;  2JF5 A;  2MRP A;  2XNA C;  2AQ1 B;  1YJJ A;  2LAS A;  3RMK C;  5BYS A;  1FNW A;  3W1Y A;  3QAQ A;  2C9W B;  2BYE A;  5EDS A;  4NQK E;  2CHW A;  3ALB A;  4TQ1 A;  1GC7 A;  3O13 A;  2LXC A;  4H2A A;  4JWU C;  3GE3 C;  3U7D A;  1T6B X;  2ZZP B;  2GRI A;  3GZN B;  5FK9 C;  3URY A;  1EWC A;  1Y8R C;  1NVI D;  1TS5 A;  4ARC A;  4WJO A;  3N1Y C;  3AE2 B;  4C80 A;  5G5H A;  4BBN F;  3MTN B;  4NAM A;  2DZM A;  2J42 A;  3QA8 A;  3FC4 A;  3KH0 A;  2BS2 B;  1V86 A;  1WWT A;  3PRZ A;  3DDC B;  3ZGZ A;  5AUK A;  2HJ1 A;  2QEJ C;  1WMH B;  2L00 B;  4OW0 A;  2HE7 A;  4RMA A;  1D5X C;  5EE9 A;  4C00 A;  3A9K B;  2V9H A;  3PS6 A;  3NVZ A;  3QQ8 B;  2WHI A;  4TMA B;  4HLE A;  4J3O D;  3SFE B;  1UWX A;  2QIL A;  1IUE A;  1ZGU B;  3BVG A;  2KTR B;  3I5J C;  1TS4 A;  4HCP B;  1HE8 A;  2WDR B;  5G2N A;  2L3Z A;  1SE2 A;  4AWJ A;  2GBJ A;  3P2B A;  4ZYS A;  4MH0 E;  2ONQ A;  3Q2A C;  2L76 A;  2V4I B;  1F2R C;  3PPA A;  2NMQ A;  5DPR A;  4OZC A;  2GLS A;  3GB1 A;  2VZK B;  4WJQ A;  5DPT A;  1D4B A;  2WDQ B;  3GZN I;  3A1Q A;  4HWI B;  1MFW A;  1JCK B;  5T8I A;  1I7H A;  4TKN A;  5D3D A;  1VR9 A;  4XX5 A;  5BMG A;  2LVQ A;  4YXD B;  1JWB D;  3VAW A;  3NVY A;  3H7S A;  3MJ5 A;  2DEN B;  1NDD A;  1ROE A;  1T0R C;  1J19 A;  1WMH A;  3IAS 1;  3LDZ E;  2LEK A;  1NEN B;  4JPS A;  4XGA B;  4ASW C;  3A9K A;  4W9J A;  4YSZ B;  2EKI A;  3HK0 A;  3WAP A;  4DHZ B;  3VTU A;  3EA6 A;  2O2V B;  2X8X X;  4WAA A;  1XO3 A;  3RT3 B;  3KWV A;  3LB8 C;  2KWD A;  1PGB A;  4XDC A;  1L4D B;  1XCT L;  2ZW0 A;  2KTR A;  2SEB D;  1S3S G;  1F0Z A;  1PUT A;  2WU2 B;  1T0S C;  2J0J A;  4BKT A;  3SDL C;  1QLB B;  4HJK A;  3VTV A;  4WWO A;  3HRD D;  4ACF A;  4WWM A;  4CQN A;  2KWU B;  3KYD D;  1L0X B;  5J2R A;  1BT0 A;  2I38 A;  1P3Q U;  1FFU A;  1EF5 A;  4R3D A;  1F52 A;  3SFD B;  1HA5 A;  1KJT A;  3L10 B;  1ENF A;  3TEX A;  1JWU D;  3PHW B;  3AEA B;  2BB5 A;  3AE8 B;  2V3P A;  2IDY A;  2PW9 A;  4A8X C;  4GXB A;  3V62 A;  2NBV B;  5JXV A;  1FXA A;  1CK1 A;  4LJP B;  1SIJ A;  3Q8A A;  2KN4 A;  1J8C A;  2VH1 A;  5GXG B;  3K9O B;  2LGX A;  1PYW D;  4P6V F;  3TJP A;  3ZLZ A;  3UIN B;  2G4S A;  2O2V A;  2KDF B;  3DBR B;  1JRU A;  5HKH A;  1C4A A;  2RSU A;  4L2Y A;  3KVF B;  1RRB A;  5C2T B;  1ZP0 B;  3APF A;  3ZJU A;  3Q8B A;  2ZPN A;  5EE1 A;  1ET9 A;  4ZHP A;  2CU1 A;  4RGN A;  3RZF A;  4BKS A;  4ANW A;  3PV1 A;  2I1J A;  4HVB A;  1OFF A;  2KYW A;  1C4C A;  1KF6 B;  2N9P C;  3MHS D;  2LZ6 A;  2GOW A;  2V3S A;  2MHJ A;  4ICV A;  3TEW A;  1OQR A;  1KH0 A;  2XN9 C;  2BS3 B;  5AUI A;  1JWM D;  2BTE A;  1FEH A;  3GS2 A;  2JT4 B;  1WRD B;  3RN9 C;  3UIO B;  1NYQ A;  2RGF A;  3ZW3 A;  3EEC A;  4E3C A;  2Y5C A;  4CO7 A;  1UD7 A;  3N3K B;  1F2R I;  1V5O A;  2J0K A;  3ZJT A;  3HHM A;  5LLI A;  3GOE A;  3DBR I;  1L4Z B;  1SEB D;  1UBQ A;  2RDH A;  1Z5S B;  3AE9 B;  3PZ7 A;  5TSS A;  2KJH B;  2E3T A;  1N61 A;  2L32 A;  2YEP B;  1XLO A;  3TMP B;  2M8S A;  1D5Z C;  2BBC A;  2WYQ A;  5JHB A;  3BIN A;  2H89 B;  4KSK C;  2FCN A;  1D3Z A;  2PTL A;  1YQ3 B;  4M02 A;  1STE A;  4NAW B;  4DXA B;  1Q10 A;  4HPP A;  1RFK A;  2DHZ A;  2ZW1 A;  4M8N A;  4D2K A;  3L0W B;  4I6N B;  1FIQ A;  1C77 A; 
#chains in the Genus database with same CATH homology
 4A3P A;  2IYD B;  2PE9 A;  3VVW B;  2L7R A;  3A1Q B;  1TGZ B;  3DPD A;  2JRH A;  4EFO A;  1T0Y A;  2KLC A;  2FCS A;  1A5R A;  1E5W A;  4JL9 A;  2DYM A;  4NNJ B;  4P7I A;  4W9G A;  2BWF A;  4XC2 A;  2N7D A;  2WX1 A;  1WM2 A;  1J0G A;  1K8R B;  4II2 B;  5GMV A;  1WZ3 A;  2D07 B;  4KDL B;  1UZX B;  3HIZ A;  5E6O A;  5DPW A;  1WIA A;  1WF9 A;  3MJW A;  4G0N B;  1GJZ A;  1U4A A;  3AI5 A;  3PT2 B;  4ZYN A;  1WGY A;  2JUO A;  4GDK B;  1XD3 B;  4EZJ A;  5LXH A;  2PEA A;  3RD2 A;  2AEH A;  4PYU A;  2MBO A;  2KD0 A;  5AZG A;  2NR2 A;  4AUQ C;  5BO4 B;  3ZDM C;  3ZNG C;  3PVL A;  1L2N A;  2ZPY A;  3VUX A;  4J6I A;  4KV2 A;  2RD0 A;  2KNB A;  3ML8 A;  4GU2 A;  2BYV E;  2AYO B;  1ZKH A;  2DYB A;  2N9E B;  1VCB A;  4G11 A;  4MGK E;  4PS7 A;  3SD5 A;  2BF8 B;  2IO1 B;  3IFW B;  2IO2 B;  4B95 A;  1F9J A;  2FIF A;  2ZNV B;  2EKE C;  2LVP A;  1V81 A;  1LXD A;  3BY4 B;  4IW0 A;  1E90 A;  4W9E A;  2XK5 B;  1SE9 A;  1CMX B;  1Q5W B;  2GBR A;  4GSW A;  4HCN B;  3VQI A;  1ISN A;  2FCM A;  3ZUN A;  2WDT B;  3D32 A;  4KVG B;  2FAZ A;  3LJ3 A;  4NAW A;  4WWN A;  3VUW A;  3DBS A;  1WX9 A;  2GBM A;  4EKU A;  2L0F A;  1WGD A;  2KMC A;  4FHJ A;  2LRW A;  3W1S A;  1NBF C;  1EO6 A;  4FUL A;  2JY6 A;  2D3G A;  4W9C A;  4BKS D;  1P0R A;  3SHQ A;  4DDI D;  2KX3 A;  3Q3J A;  3WAN A;  2V1Y A;  2MBH A;  3L54 A;  3R7Q A;  3S2A A;  1LQB A;  1WGH A;  4RM8 A;  2NCN A;  1SIF A;  2LD9 A;  4PYZ A;  2K39 A;  4IM0 A;  2MA9 B;  5IAA C;  3DQV A;  4FN2 A;  4DK5 A;  3B08 A;  1QZE A;  1WYW B;  4F7Z A;  2IY0 B;  2A5U A;  2JVC A;  2LGY A;  2O6V D;  1IYF A;  4ICU A;  3M95 A;  1WR6 E;  3IVF A;  2NBW B;  3OAW A;  2KJ6 A;  1WX7 A;  2GBK A;  4FLH A;  2KAN A;  1H8C A;  2IZV B;  3QC8 B;  5D2M B;  3WAO A;  4MEL A;  2C60 A;  2QHO A;  2YVC A;  3X23 A;  2VRR B;  1OTR B;  2JXX A;  1WXV A;  1GG3 A;  5TR5 A;  2KDB A;  4TV3 A;  1VD2 A;  4F1S A;  2YLM A;  1V2Y A;  4IUM B;  2MW5 A;  4ZDV A;  4GDK A;  4HPL B;  2R2Q A;  1WE7 A;  3HM3 A;  2W9N A;  4NJ7 A;  4LJO B;  2JWZ A;  4EZL A;  4BOS C;  2IO3 B;  3PHX B;  5C23 A;  3V60 A;  1YX6 B;  4ZRI A;  1WY8 A;  2ZEQ A;  4AOF A;  3DOW A;  4MEM A;  3SU8 X;  3R3M A;  3M62 B;  4A20 A;  2K6D B;  1OQY A;  1SGH A;  4LDT D;  2D10 A;  3TL5 A;  2KMA A;  3C0R B;  1V5T A;  2OJR A;  4W9D A;  4WJN A;  5JHA A;  4E74 A;  2MX2 A;  3DVG X;  5KHO A;  2JF5 A;  2M0X A;  2KKC A;  2MRP A;  2Z0D B;  2Z59 B;  2ZCB A;  2XK5 A;  2LAS A;  3W1Y A;  3QAQ A;  2C9W B;  4MDK E;  2BYE A;  1ZW7 A;  5EDS A;  2EMT A;  2CHW A;  4NQK E;  3ZTC A;  3ALB A;  4TQ1 A;  5AZF A;  3RYT A;  1GC7 A;  2C7M B;  3DCG A;  2REX A;  2LXC A;  4BOZ B;  1EF1 A;  4F8C B;  3U7D A;  2KN5 A;  2ZZP B;  4FA6 A;  2K1F A;  1Y8R C;  4KSL C;  3QAR A;  3APC A;  3CMM B;  4WJO A;  3L08 A;  3DVG Y;  4G3X B;  2DZI A;  5D6J B;  5J17 A;  2FCQ A;  1WJ6 A;  1YQB A;  2KZR A;  3KUD B;  2IO0 B;  5CHV C;  3OJ4 B;  4BBN F;  3MTN B;  3V61 A;  2DZM A;  1S1Q B;  3QA8 A;  1I42 A;  3A4R A;  4B9K A;  1GUA B;  4HPM B;  2O6V B;  3KH0 A;  1V86 A;  2AL3 A;  3H6N A;  2C7N B;  3HM6 X;  4IM2 A;  3TCA A;  2Y5B B;  3VH3 B;  4GGQ A;  1WFY A;  1C3T A;  3PRZ A;  3NZS A;  3DDC B;  2RPQ A;  4DHJ D;  2DX5 B;  2M1M A;  3O65 B;  2KWV B;  3PSE B;  1WMH B;  2L00 B;  4K7W A;  4M8M A;  2HE7 A;  4CYE A;  4RMA A;  3ECI A;  2LJ5 A;  4DWF A;  2BWE S;  3A9K B;  4HK2 A;  1WJN A;  4IM3 A;  1KLV A;  3VXW A;  3PRP B;  3PS6 A;  1EUV B;  2N7E A;  2C5L C;  3QQ8 B;  4HLE A;  1RFA A;  3CF6 E;  3VFK A;  4BVU C;  2KDI A;  4KZC A;  3ONS A;  1FXT B;  2FID A;  1G6J A;  3M63 B;  4TQ0 A;  1ZGU B;  4TUU A;  3PZD A;  2FUH B;  4JGH B;  4LDT B;  3A9J B;  3TIX A;  3L13 A;  3M3J A;  2KTR B;  1KM7 A;  4RM9 A;  1OEY A;  2ZVO A;  2DAF A;  4HCP B;  3K9P B;  1HE8 A;  5DPS A;  2ASQ A;  5G2N A;  2BGF A;  2L3Z A;  5E6P A;  4AWJ A;  3NY5 A;  2GBJ A;  3P2B A;  3VDZ A;  1UEL A;  4MH0 E;  3DBL I;  4DBG A;  2L76 A;  3QJZ A;  3PPA A;  1YIW A;  2L0T A;  5DPR A;  4N9F 4;  1WZ0 A;  2D11 A;  3ZRC A;  3UQA A;  1YJ1 A;  3EFU A;  3ENE A;  3PRE A;  1WI0 A;  2KFJ A;  4MSM B;  4ANX A;  2GBN A;  3ML9 A;  2LGD A;  2UYZ B;  2JZ3 B;  5C1Z A;  4WJQ A;  3IG3 A;  5DPT A;  4PS3 A;  4GN1 A;  2KDE B;  3GZN I;  2KC2 A;  2PJH A;  3A1Q A;  3A33 B;  4HWI B;  2D2Q A;  2IBI B;  2DZJ A;  2CHX A;  4IG7 B;  1PQS A;  2KFK B;  1UGM A;  3UF8 A;  4TKN A;  1M94 A;  2WX0 A;  4XX5 A;  2FNJ B;  2LVQ A;  2O6V A;  1X1M A;  3VAW A;  3H7S A;  2DEN B;  1NDD A;  4G50 A;  5CHF A;  4ANV A;  4IWP A;  4AJW A;  1J19 A;  2G3Q B;  2JPH A;  4GB9 A;  4FHK A;  2ZJD A;  1V80 A;  1WMH A;  2J7Q B;  2UWQ A;  3LDZ E;  1WXM A;  4HDO A;  5E6N A;  3L17 A;  4ASW C;  2NVU I;  2J0M A;  3A9K A;  1Q1O A;  4GDL B;  4BKG A;  4W9J A;  4FJV B;  2B3A A;  3PTF C;  3HK0 A;  3RUL A;  2XBB C;  3WAP A;  4DHZ B;  3CSF A;  3N32 A;  4ZRJ A;  2KTF A;  3VTU A;  4MSQ B;  2O2V B;  4WAA A;  3QCA A;  4JQW C;  5CHW A;  3RT3 B;  2BYF A;  3QX1 A;  4JIO U;  3JSV B;  1E8Y A;  2KQS A;  2A4Z A;  3A9J A;  2MBQ A;  4E71 A;  5DCN A;  3TBL D;  2KTR A;  1S3S G;  2DZK A;  2OOB B;  1P9D U;  2L05 A;  1TBE A;  1AAR A;  2J0J A;  4A3O A;  4BKT A;  3SDL C;  3QK0 A;  1IPG A;  3JVZ X;  3ZRF A;  4MGZ E;  3PGE A;  3WAL A;  1V9J A;  3UQB A;  4HJK A;  3VTV A;  4DHZ E;  4WWO A;  3CST A;  4M0W B;  2PE6 B;  1OGW A;  2KWU B;  3KYD D;  4WWP A;  2LRU A;  4WJP A;  4X57 B;  5L95 C;  5J2R A;  1BT0 A;  2XEW A;  2HJ8 A;  2CKH B;  1P3Q U;  2MLB A;  4GMV A;  2CR5 A;  1Z2M A;  1EF5 A;  3EHV A;  4EEW A;  1WXS A;  2LXA A;  4W9F A;  5JH5 C;  2M4N A;  2N1W A;  3H9D A;  4PS8 A;  1KJT A;  1RAX A;  2K8C A;  3AU5 A;  2KFK A;  4IWQ A;  2GMI C;  3L10 B;  2K8B A;  3ZTD A;  4CHK A;  3PHW B;  2NS5 A;  3OLM D;  2G45 B;  1H4R A;  2KK8 A;  2KO3 A;  3U30 A;  5L83 A;  2CS4 A;  1WXA A;  2ZCC A;  3JW0 X;  5AEK B;  4GXB A;  3QIJ A;  2KX0 A;  2DYO A;  3V62 A;  2NBV B;  2KLG A;  1I35 A;  4MJS B;  2KC1 A;  2I1K A;  1OEY J;  3NOB A;  2MSE D;  4LJP B;  5D7G A;  4XZ4 A;  4NPN A;  5FR6 A;  2DAJ A;  3AUL A;  4GDL A;  1J8C A;  2MP2 B;  4ZRK A;  1V6E A;  3L16 A;  3K9O B;  2LGX A;  3EC8 A;  1KOT A;  3TJP A;  3KUC B;  3ZLZ A;  3UIN B;  3DBH I;  3V6C B;  3ZDT A;  2G4S A;  2R2O A;  4KIK B;  4DDG D;  3T9L A;  3WIM A;  2O2V A;  2KDF B;  1JRU A;  3U8Z A;  3PRM B;  4K81 A;  3W1S C;  5HKH A;  3N30 A;  3OJ3 A;  4B6W A;  5D94 A;  1MG8 A;  4FBJ B;  3JSV A;  2V4L A;  4I6L B;  3JYU A;  1GC6 A;  2RSU A;  2K8H A;  2MBB B;  1L7Y A;  1WH3 A;  3KVF B;  2KXJ A;  3A4S C;  1RRB A;  2AWT A;  3WAM A;  3T8M A;  3APF A;  1XT9 B;  2LVO A;  3AU4 A;  4W9H A;  4KZ0 A;  3ZO5 B;  3APD A;  4AJY B;  5CX3 A;  3WA0 A;  1UH6 A;  4LCD E;  2ZPN A;  4KDI C;  2M17 A;  2NPT B;  2IY1 B;  2KJR A;  1XQQ A;  5AZH A;  2K25 A;  2MWS B;  2CU1 A;  4IC7 B;  3RZF A;  4BKS A;  4W9K A;  3NZU A;  2NBU A;  1R4N I;  2WWZ A;  4FAD A;  4ANW A;  1TTN A;  3H7P B;  3PV1 A;  2I1J A;  5G55 A;  5IA7 A;  1WJ4 A;  2N1V A;  2RR9 A;  3PLU A;  4HVB A;  3KUZ A;  4AP4 C;  3KYC D;  3VH4 B;  1IP9 A;  1E8Z A;  1E7V A;  2K6Q A;  2N9P C;  3QWZ B;  4ANU A;  2CHZ A;  4W9I A;  3MHS D;  2LZ6 A;  2GOW A;  2V3S A;  4ICV A;  1GNU A;  4OVV A;  1UBI A;  4NY0 A;  2JZZ A;  4GIV A;  2HD5 B;  4NQL B;  2HTH A;  2AL6 A;  4MJS A;  3R7R A;  1LFD A;  2LI5 A;  5LXI B;  3PLV A;  2LWP A;  1WGG A;  1E8W A;  5KHQ A;  2ZNV C;  4EUT A;  2N4F A;  3Q3F A;  4DHJ B;  1WE6 A;  2EMS A;  3IBE A;  4MM3 A;  2JT4 B;  2KQ7 A;  1P1A A;  1WRD B;  3UIO B;  2PPH A;  2G4D B;  3ZIM A;  2MP2 A;  2RGF A;  3EEC A;  3ZW3 A;  1WX8 A;  5J18 A;  4W9L A;  4IWO A;  4E3C A;  1RLF A;  2KVR A;  3RCZ A;  4CO7 A;  2MCN B;  1E8X A;  1WR1 A;  4KIK A;  1YX5 B;  1UD7 A;  2L8J A;  3N3K B;  2Z0E B;  3ZNZ B;  2J0K A;  1V5O A;  3IHP C;  4K7S A;  3KW5 B;  2KHW B;  3HHM A;  5LLI A;  4BBN C;  3DVN V;  3GOE A;  4MGI E;  5JZE B;  4II3 B;  3RUI B;  3DBR I;  1E7U A;  1R4M I;  3ZKJ C;  1V49 A;  4K7U A;  4MGY E;  2KOX A;  4EOY A;  3DVN U;  1UBQ A;  1Z5S B;  1NI2 A;  4FJY A;  4I6P A;  2N9X A;  2KJH B;  2LUE A;  4HXD A;  4OVU A;  3H1U A;  2JRI B;  1TZ1 A;  3I3T B;  2NPT A;  4FJZ A;  1Q0W B;  1LM8 B;  3VTW A;  3R66 C;  4URK A;  3X0W A;  3QHT A;  4WQO B;  3UGB B;  2KWC A;  3TMP B;  3VHT C;  2M8S A;  2MBE A;  2BPS A;  4YL8 A;  3H7P A;  2WYQ A;  3ZNI D;  4EZK A;  1WM3 A;  3BIN A;  3V6E B;  5JHB A;  3ZNH B;  3NS8 A;  1P98 A;  4KSK C;  2FCN A;  1D3Z A;  4K1R B;  1YD8 U;  5CTR C;  4NAW B;  4DXA B;  2BKR B;  3B0A A;  4GOC A;  4BFR A;  3VUY A;  3B1L X;  3ZVV A;  3UIP B;  2DHZ A;  4M8N A;  1WGR A;  4JLC A;  2BKF A;  2MQJ A;  2ZVN A;  1C1Y B;  1WJU A;  3L0W B;  3NHE B;  3RZW C;  4I6N B;  2C7H A;  4HDQ A;  3AXC A;  4NJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...