2DZKA

Structure of the ubx domain in mouse ubx domain-containing protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
GSSGSSGRDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDILMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UBX domain-containing protein 2
publication title Structure of the UBX domain in Mouse UBX Domain-Containing Protein 2
rcsb
source organism Mus musculus
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dzkA01
3A9JB 2CHXA 1JRUA 4ASWC 4NQKE 5AEKB 3ZNZB 2N7EA 1KLVA 2L05A 2KTRA 2IYDB 3PHWB 4DK5A 3V62A 4B6WA 2MBBB 3AXCA 3A4RA 2WX1A 1P9DU 2GBNA 3IBEA 3JSVB 4TQ1A 2C9WB 1J8CA 2IO1B 3A9KA 2EKEC 4LCDE 2DZKA 2C7NB 2RSUA 3M62B 5CHVC 5DPSA 2L0FA 4BOZB 1WFYA 3ZNGC 3VXWA 2KO3A 2K6QA 1YX6B 5DCNA 2IO0B 2UYZB 3IHPC 4LJOB 4DHZE 2IO3B 4HPLB 4IWOA 3L08A 3MTNB 4E71A 2JXXA 2BWFA 2L00B 2LVPA 2LXCA 2JZ3B 2K1FA 4XC2A 2O6VD 1V80A 2RGFA 3IG3A 4RM9A 3DVNV 3ZIMA 1NDDA 2LGYA 2PJHA 1I35A 4PS7A 4WJNA 2K8CA 4GOCA 5IAAC 2KOXA 3DBSA 4XZ4A 2FUHB 4E74A 1NBFC 2KC1A 2N9EB 2O2VA 4B9KA 3PLUA 1D3ZA 4BVUC 2D2QA 2YLMA 2NBWB 5DPRA 1UZXB 1IYFA 1WXMA 3QA8A 3QJZA 3PPAA 3K9OB 4IW0A 2DAJA 2RD0A 4BKGA 1V86A 1E8XA 4NQLB 5AZFA 2L7RA 2MBQA 5LLIA 2KDIA 2MX2A 2KWUB 1RRBA 4DXAB 2NR2A 2G4SA 3BY4B 2DHZA 2N9XA 2NCNA 5JHAA 1V2YA 1WMHB 2KJ6A 1Z5SB 2UWQA 2DAFA 3QX1A 2DYMA 2RPQA 3LJ3A 2M1MA 4URKA 3U8ZA 2J7QB 3NZSA 4HJKA 3SHQA 2K8BA 4TV3A 2KTRB 4W9HA 4BBNF 2XEWA 3EECA 4J6IA 4BBNC 2FIFA 2MRPA 3KH0A 4DBGA 1WR6E 3ZNHB 4A3OA 3PRZA 2K6DB 4MSMB 2C5LC 4JLCA 3V6CB 1WM2A 1Y8RC 2BWES 4ICUA 3A1QB 4PS8A 3AULA 2WYQA 4K1RB 5EDSA 1WGDA 3ECIA 1E7UA 3RUIB 2NS5A 4F7ZA 2M0XA 2B3AA 5CHFA 3KW5B 2PPHA 1WJUA 3LDZE 4K7UA 2GOWA 3DBRI 5C1ZA 2KHWB 3L0WB 3A33B 4KDLB 4HWIB 4AUQC 3NS8A 2GBMA 2KWVB 4LJPB 1H4RA 2VRRB 2DYBA 1GG3A 4OVVA 1WH3A 3R66C 4AJWA 1WM3A 4MDKE 2KVRA 2ZPYA 1IP9A 3PREA 4YL8A 4MELA 3KUDB 4HPMB 4LDTB 5TR5A 4HLEA 3ZUNA 3VH4B 2KLGA 1WGHA 2BYEA 4GGQA 4RM8A 5E6NA 3TCAA 2G45B 3AU4A 3W1SA 1QZEA 2L8JA 1Q1OA 3EC8A 3DOWA 3N3KB 3GOEA 4GDKA 3RZFA 3WIMA 2M8SA 2BKFA 1UGMA 1OQYA 1G6JA 3DBLI 5JHBA 1YJ1A 2MP2A 1GC6A 2DZMA 3RULA 1MG8A 1HE8A 1WZ3A 4G50A 3HK0A 2Y5BB 2KFKA 2ZPNA 2OOBB 2KJHB 2WX0A 4GN1A 4B95A 1SIFA 1XT9B 2LVQA 4HK2A 4MM3A 4EOYA 3KUZA 4MSQB 3V6EB 4EZKA 4IC7B 2DZJA 2LVOA 2D3GA 2KFJA 4WAAA 5G55A 1TZ1A 1WGGA 2ZNVB 4ANVA 1EO6A 3ALBA 5CHWA 3VUYA 3ZW3A 1C1YB 2O6VB 2LZ6A 4KIKB 2I1KA 2LJ5A 1EF1A 2JZZA 2K8HA 2KX0A 1X1MA 1R4NI 4MJSA 3RD2A 2FCQA 4DHJD 1P0RA 4FBJB 5D2MB 1WX7A 3ML8A 4GIVA 4KV2A 5KHQA 1WJNA 3U30A 4FA6A 5GMVA 3UGBB 2N1WA 2ZVNA 4EUTA 3TBLD 2AWTA 2CHWA 3CF6E 3APDA 1C3TA 2XK5A 3H7PA 4WWOA 4M8MA 3L17A 3CSTA 1YX5B 4I6PA 3P2BA 3H6NA 3K9PB 3QK0A 4NY0A 3WAMA 4W9GA 3D32A 1LXDA 3NZUA 4NAWB 2N1VA 3PGEA 4EZLA 5D7GA 1LFDA 4DDGD 4GB9A 2MWSB 1E8ZA 1UH6A 4KDIC 4W9FA 3DVGY 3WANA 4I6LB 4JQWC 1XD3B 3SD5A 5IA7A 2OJRA 4EFOA 2ZEQA 3VHTC 3UQAA 2KNBA 3Q3FA 2A4ZA 2NPTA 4MGYE 4W9KA 3ZRCA 1M94A 1GJZA 2CS4A 3VVWB 4II3B 2MBEA 1E5WA 1P1AA 4ANWA 3SDLC 2KX3A 3B1LX 1V49A 3PV1A 3H9DA 1R4MI 2Z59B 3VAWA 2FIDA 3DCGA 2PE6B 3IFWB 2LASA 3KYDD 2KWCA 4FHJA 3UQBA 4RMAA 2MBOA 2JRHA 2QHOA 3DVNU 3PSEB 1WZ0A 3NHEB 4KZ0A 4CO7A 5AZGA 1WR1A 5AZHA 3KVFB 4MJSB 4JL9A 3H1UA 1ZKHA 2G3QB 2KMAA 2KTFA 2V1YA 3A9KB 4M0WB 5J18A 3U7DA 3NOBA 4WWPA 4HXDA 2N7DA 2C60A 2GMIC 3ZTCA 1EF5A 1IPGA 4WQOB 3ZDMC 2DZIA 4W9IA 2HE7A 3ML9A 4GDLA 2RR9A 1K8RB 4FJVB 4MGIE 3B0AA 4KSKC 3VQIA 4CYEA 3PS6A 2ZCCA 4DWFA 3M95A 1UBIA 1WF9A 4JGHB 4NJ6A 1UBQA 1YD8U 2LWPA 4P7IA 2EMSA 3ZLZA 3ZTDA 4BFRA 3A4SC 2DX5B 3KYCD 1WJ4A 2CR5A 4HCNB 4PS3A 2M4NA 3VTUA 3QCAA 1WXAA 2V4LA 1E90A 2ZJDA 3W1YA 2DYOA 3OLMD 3QQ8B 2KQ7A 3V61A 3TMPB 3ZO5B 3JSVA 2BYFA 2LI5A 2O2VB 4EEWA 3UINB 3WALA 1V5TA 1WY8A 4K81A 3PLVA 3PRPB 2J0JA 4ICVA 3R7QA 2NPTB 4IM3A 2J0KA 2AL6A 5L95C 1FXTB 2JVCA 2CHZA 4K7WA 3S2AA 5CTRC 1T0YA 2LXAA 2KXJA 5DPTA 3QAQA 3NY5A 4KVGB 3WA0A 1P98A 2C7HA 3TL5A 1YQBA 2V3SA 3I3TB 5C23A 4MH0E 4DHJB 4BOSC 4WWNA 4NJ7A 3DQVA 2M17A 4KZCA 1SGHA 3PZDA 3HIZA 2CKHB 3PT2B 4GU2A 4KSLC 3TIXA 4FJYA 1L2NA 4FADA 3OJ4B 4GSWA 3WAPA 2BYVE 2MW5A 2BPSA 4MGKE 3R7RA 3VUXA 3HM6X 2ZZPB 2NBUA 1OTRB 1WXVA 3ZKJC 3AU5A 4BKSA 2FAZA 3PTFC 3EHVA 3VH3B 2D07B 4ANXA 2GBKA 1E7VA 2MBHA 3RCZA 5E6OA 3UIOB 3T8MA 1J0GA 2MA9B 2LGXA 1LQBA 3SU8X 2DENB 3ZVVA 1RAXA 2KN5A 1ISNA 1H8CA 5L83A 2ZNVC 3L10B 1WRDB 1S1QB 1J19A 4ZYNA 4FN2A 3VUWA 1WMHA 1KOTA 2FCSA 4G11A 4X57B 2LUEA 4XX5A 5J17A 2HD5B 2BF8B 4TQ0A 4HVBA 4DHZB 2KC2A 4CHKA 4JIOU 4IM0A 1WX8A 1YIWA 3AI5A 4EZJA 2KDFB 3UF8A 3BINA 1OGWA 3L54A 5J2RA 3RT3B 4FJZA 1NI2A 2FNJB 4GMVA 3QHTA 1S3SG 3C0RB 1UELA 2K39A 3VTWA 1Q0WB 3MJWA 3DVGX 2MSED 3APFA 4TUUA 1Z2MA 3A1QA 3X23A 1TGZB 4HDQA 4W9EA 5D94A 2GBJA 4F1SA 2AYOB 4BKTA 2CU1A 2MLBA 4F8CB 4IUMB 4GDKB 1Q5WB 4FHKA 4NPNA 2IO2B 2MQJA 1KJTA 4IG7B 2KJRA 3Q3JA 4W9CA 2MP2B 2G4DB 3W1SC 5DPWA 3JYUA 1OEYA 2IY1B 1L7YA 3ZNID 2L3ZA 2KFKB 1VCBA 2N9PC 3QC8B 4K7SA 5LXIB 4GXBA 4IWPA 1E8YA 1GUAB 2N4FA 3L13A 2GBRA 3DDCB 2R2OA 3KUCB 4W9LA 1LM8B 2D11A 1XQQA 1OEYJ 3R3MA 4TKNA 4ZRJA 2NVUI 4A20A 4II2B 2C7MB 3H7SA 4AOFA 1PQSA 1ZGUB 5CX3A 2PEAA 2XBBC 1E8WA 3UIPB 3PRMB 2ZCBA 3ONSA 2KANA 2KDEB 2IBIB 3RZWC 2REXA 3N32A 1WIAA 1I42A 2D10A 3WAOA 3MHSD 4W9DA 2HTHA 1V6EA 2JPHA 3EFUA 3OAWA 4NNJB 1TTNA 2BKRB 4AP4C 5FR6A 4OVUA 2JY6A 5HKHA 1CMXB 1RFAA 2XK5B 1WJ6A 1WX9A 3H7PB 3T9LA 3GZNI 1UD7A 4ZRKA 4BKSD 5JH5C 3QIJA 2JF5A 4G3XB 2ZVOA 3V60A 3A9JA 3PHXB 3M3JA 3VFKA 3VTVA 2WWZA 4PYZA 3PVLA 1WXSA 1V9JA 5G2NA 2NBVB 4G0NB 2LRWA 2YVCA 2I1JA 2O6VA 4KIKA 2ASQA 5JZEB 3O65B 3JVZX 1WE6A 1BT0A 3IVFA 3HM3A 3OJ3A 1V81A 4WJOA 2R2QA 4N9F4 2BGFA 3DBHI 1RLFA 4ZRIA 4DDID 2J0MA 2JRIB 2K25A 4I6NB 5LXHA 3QARA 5KHOA 3DPDA 2LD9A 2L0TA 2JT4B 2W9NA 1U4AA 2KMCA 2FCNA 4AJYB 4E3CA 2A5UA 3ZDTA 1ZW7A 2LGDA 3L16A 4A3PA 2WDTB 2PE9A 4NAWA 4ANUA 2HJ8A 4MEMA 2MCNB 1WGYA 1GNUA 2KDBA 4IM2A 4AWJA 1TBEA 1V5OA 3APCA 2Z0DB 3CMMB 1WYWB 4ZDVA 3VDZA 1WI0A 5E6PA 4FLHA 4WJPA 1SE9A 5BO4B 5D6JB 4HDOA 2KK8A 2KKCA 1KM7A 1WGRA 4PYUA 2LRUA 4IWQA 3TJPA 3HHMA 3B08A 2KZRA 2AEHA 2L76A 3ENEA 3M63B 4HCPB 2JUOA 3ZRFA 3QWZB 3X0WA 1A5RA 4FULA 2IZVB 1GC7A 2KD0A 2KQSA 2KLCA 3CSFA 2IY0B 4EKUA 2FCMA 4GDLB 1F9JA 4LDTD 4M8NA 1WE7A 2Z0EB 2JWZA 3JW0X 2EMTA 2AL3A 1VD2A 3N30A 4MGZE 4WJQA 3RYTA 4W9JA 1P3QU 1EUVB 1AARA
chains in the Genus database with same CATH superfamily
4A8XC 2QJLA 4NQKE 3ZNZB 2K5PA 2OEDA 2G1EA 4RFBA 1L0YB 3PHWB 1VDVA 3FC4A 2MBBB 4JE3B 3IBEA 2GBNA 3JSVB 3A9KA 2DZKA 4NZLB 2L0FA 2JWUA 2KO3A 2UYZB 4DHZE 4WQMA 3L08A 2D3AA 4E71A 4N58A 1TZOA 2WGSA 3GP7A 2LEKA 2RGFA 3IXSA 3DVNV 2LGYA 5BYRA 4WJNA 2K8CA 2X8XX 3BYYB 2KOXA 3HVZA 4XZ4A 4E74A 2N9EB 3NVZA 4OW0A 2YLMA 1ZPSA 2NBWB 2RDHA 4IW0A 2DAJA 5FR3A 4BKGA 1V86A 2MBQA 5LLIA 2Z8LA 2KWUB 2NR2A 1F1HA 2RDGA 2UWQA 3QX1A 2DYMA 3LJ3A 4N59A 1SF0A 1E6EB 3KH0A 2MRPA 2AX5A 1JMLA 3BVMA 2K6DB 3W5UB 2PVGC 1SB3C 4XDCA 1UGJA 4K1RB 4OZBA 1TS3A 2MEKA 3RUIB 2M0XA 5CHFA 2IGGA 4RGTA 4KDLB 4HWIB 4NJCA 3N1XC 1H4RA 2VRRB 4ZRQA 4AJWA 2ZPYA 4MELA 3KUDB 4RF1A 4A9AA 3ZUNA 1WGHA 1ET6A 5E6NA 4RM8A 3TCAA 4DQOC 4JWSC 3W1SA 1QZEA 4GDKA 4XWTA 1JWBD 1OQYA 4A55A 1GC6A 1NYRA 2DZMA 1HE8A 1WZ3A 2ZPNA 2OOBB 2WX0A 1E0ZA 4MM3A 3KUZA 3AEDB 2DZJA 1IGCA 3P63A 1WGGA 2L32A 2ZNVB 1GB1A 2LZ6A 1EF1A 2TSSA 3Q3OC 1WGKA 4FBJB 2PW9A 1ESFA 1WX7A 4KV2A 5KHQA 4AS1A 1FNUA 3FAHA 5GMVA 3UGBB 1CJEA 3TBLD 2AWTA 1C3TA 2CJNA 2XK5A 1F77A 3L17A 1FO4A 4KKIA 1C76A 3P2BA 3H6NA 1RFKA 4YSXB 4R3DA 3D32A 3DWMA 3PGEA 3HUIA 3DHHC 1HXYD 1LFDA 1J7BA 1YJJA 3ZYYX 3WANA 2WXIA 2KNBA 3Q3FA 2A4ZA 4MGYE 1GJZA 2M56B 3BK1A 1YJIA 1FFVA 2WXNA 3B1LX 3IAM1 2YEPB 3UQBA 4RMAA 2MBOA 2H88B 1UWXA 4CO7A 5AZGA 5AZHA 4OVZA 3KVFB 4MJSB 4JL9A 3A9KB 1FD6A 1ZE3D 1TY2A 4OZAA 2C60A 3ZTCA 5IN7A 4WQOB 2RR9A 1K8RB 3ABVB 3GE8C 3PS6A 1UBIA 4P7IA 3ZLZA 3BZDB 1XCQL 3A4SC 3B9JA 2CR5A 1N6ZA 2M4NA 2D5GA 3QCAA 1WXAA 1E90A 1P7EA 3L4PA 3OLMD 1QT9A 2LI5A 3AV8A 3RMKC 4EEWA 3WALA 1TKGA 3R7QA 2J0KA 2AL6A 3RNEC 1FXTB 1TY0A 3S2AA 5L95C 3RNAC 3MC9A 3LB8C 1FRDA 3WA0A 1K50A 1NVID 2VZKD 4BOSC 2M17A 1XLOA 2CKHB 3NVYA 1L2NA 3OJ4B 2BYVE 2MW5A 2BPSA 3R7RA 3AE9B 1OTRB 1WXVA 4HRSA 4C00A 1DOIA 4BKSA 3PTFC 3EHVA 3VH3B 2ZW1A 4ANXA 2MBHA 3UIOB 4B0EA 1J0GA 2BYTA 3DBHB 3ZVVA 1PUTA 2KN5A 3VUWA 4L2YA 1WMHA 2BF8B 1WSPA 1L6UA 4HVBA 2KDFB 3BINA 3L54A 2BT6A 4FJZA 2FNJB 3C0RB 2K39A 4P6VF 2Y5CA 1FPYA 1Z2MA 5BYQA 1C77A 1STEA 2WP9B 4GDKB 4KGRA 4FHKA 1VZ8A 2FUG1 1JWMD 3TEYA 4IG7B 2KJRA 4W9CA 3AE3B 2JU6X 3QC8B 3ETRA 1V97A 2IGHA 3P4QB 4US8A 1KF6B 4MM3B 4W9LA 3Q8FA 2NVUI 3MC0B 5CX3A 1K52A 2XBBC 2ZCBA 4LNIA 2KDEB 2V3NA 2D10A 3MHSD 4W9DA 1V6EA 3OG5A 3UI3A 2SEBD 2JY6A 5HKHA 2LGIA 2E6XA 2XK5B 1WJ6A 2K0PA 2WHIA 3GZNI 1C9FA 1UD7A 2KT7A 4MACA 3AE1B 1KFYB 2WXRA 2PVOD 2BVCA 3TUOA 1EWYC 2O6VA 2ASQA 3O65B 2ZW0A 3IT4B 2L83A 1ROEA 1TIFA 3DHGC 1L4ZB 2M19A 4DDID 2J0MA 2JRIB 2K25A 4C80A 1D5MC 2LHDA 5BMIA 3NVVA 1U4AA 2HJ1A 3AM9A 5I4DA 4AJYB 2L1AA 4E3CA 2DLBA 4YSZB 2NMQA 1ZW7A 1L5PA 2WDTB 4A3PA 1TBEA 1Y56A 1V5OA 2Z0DB 5AUKA 4HKQA 1MHXA 1WI0A 4HDOA 1XXGA 3SFDB 3PZ7A 4HCPB 3X0WA 4FULA 2IZVB 2KLCA 4WIPA 1TYGB 3SEBA 2AL3A 4WJQA 2KWDA 1EUVB 2QIEB 3A9JB 2CHXA 4ASWC 5AEKB 3ZXVA 2N7EA 1SE4A 2IYDB 4YT0B 3V62A 3W2DA 2C9WB 2IO1B 4LCDE 1L4DB 3M62B 1KRHA 4BOZB 2WU5B 2K6QA 5HG2A 4HJGE 2JXXA 2BWFA 1I7HA 2LXCA 4XC2A 2K1FA 1V80A 4RM9A 1NDDA 4HEA1 1I35A 1XF5L 2JYEA 5IAAC 3AN1A 4FXCA 2NTSA 1D3ZA 2D2QA 2KN4A 1UZXB 1WXMA 3PPAA 3K9OB 1HTOA 2RD0A 5AZFA 1FNWA 2L7RA 4QAYA 2WXMA 3BY4B 2NCNA 2JQRB 1WMHB 4A6QA 2QEJC 2RPQA 4URKA 3BWUD 2J7QB 3MFGA 1IGDA 3IT6B 4BBNC 3LXFA 4DBGA 1WR6E 3ZNHB 3N9YC 3PRZA 4JLCA 4AQ7A 2BWES 2WYQA 3NJTA 3ECIA 2J53A 2B3AA 2PPHA 1WJUA 3DBRI 2KHWB 3L0WB 3A33B 1T5XD 3NS8A 4ARCA 1J7CA 4C4VB 2KWVB 2R61A 5EE1A 2BW2A 1EU3A 4DXGA 1WM3A 2KVRA 3PREA 4ITKA 4GGQA 1Q1OA 4S17A 3GOEA 3WIMA 2M8SA 3DBLI 2MP2A 3RULA 3AE7B 1MG8A 4G50A 2Q5WD 2KFKA 3VR9B 3U2SC 4B95A 4GN1A 1SJED 4HK2A 4KGSA 4EOYA 4YXDB 1FCCC 3V6EB 4EZKA 4WAAA 2CJOA 1DOXA 1L6VA 1N5XA 1TZ1A 4XWWA 1EM7A 3ALBA 4ANVA 5CHWA 3ZW3A 2O6VB 1E7PB 1ZDVA 1DYQA 2I1KA 2LJ5A 2K8HA 3RD2A 4MJSA 3U7ZA 1HZ6A 2D3CA 4LLGM 3ML8A 3Q3MC 4GIVA 3ZJVA 2G9HD 3NS1A 2N1WA 2ZVNA 4S0RA 5G5GA 4EUTA 2CHWA 3CF6E 3H7PA 4M8MA 3CSTA 4I6PA 4NY0A 1JALA 2GI9A 2N1VA 2LMCA 2WLBA 5D7GA 4P1CC 1QOFA 1VJKA 1E8ZA 4KDIC 4I6LB 1YN4A 4JQWC 3VRAB 5IA7A 4EFOA 4YTNB 2EELA 4W9KA 1KH0A 1M94A 3VVWB 4H2AA 4II3B 1UF0A 2MBEA 1P1AA 1C78A 1SE3A 2KX3A 3PV1A 1PGAA 1R4MI 2Z59B 3PZ8A 2PE6B 2LASA 2KWCA 2JRHA 1ENFA 2QHOA 1WR1A 2V9HA 1JWAD 2G3QB 2V1YA 1JROA 1ZDXA 2N7DA 2GMIC 1IPGA 2HE7A 4KSKC 3I57A 4DWFA 1GOZA 4JGHB 4NJ6A 4BFRA 2EMSA 2DX5B 2OHFA 3KYCD 4HCNB 5TSSA 1K51A 2RMMA 2BS2B 4K3CA 5BMHA 4M00A 4WWMA 2AQ2B 5MPOA 2DYOA 3QQ8B 2KQ7A 5GXGB 2GLSA 2DWQA 1WY8A 1L0XB 4ICVA 2JVCA 1YMHE 2CHZA 4YSYB 5CTRC 2LXAA 5DPTA 4USAA 2VH2A 1P98A 3W5VB 5EE3A 5C23A 3GZNB 4MH0E 4D2KA 3C8YA 2NTTA 4IDIA 4DHJB 4KZCA 4RGMA 3HIZA 1FIQA 2H89B 2IPKD 4FJYA 5JXVA 3EA6A 5BMGA 4MGKE 3VUXA 3HM6X 4WURA 4IKGA 3AU5A 4YTMB 2IGDA 2D07B 2GBKA 1E7VA 2WDRB 2MA9B 2LGXA 2D3BA 4GLSC 3NRZA 1ISNA 5L83A 1WRDB 4JWUC 1KOTA 4KGTA 2LUEA 5J17A 1SJHD 3I9V1 4TQ0A 4DHZB 2LGSA 3KWVA 4O1NA 4IM0A 1WX8A 1GB4A 3QHTA 3VTWA 1Q0WB 2MSED 3A1QA 3X23A 1TGZB 4HDQA 4W9EA 3ZXRA 2CU1A 2MLBA 4F8CB 1QOGA 1YQ4B 2MQJA 4IOIE 2MP2B 5LNK1 3W1SC 5DPWA 3JYUA 1SEBD 2L3ZA 2KFKB 2QDFA 4GXBA 4IWPA 1NENB 3L13A 4HPPA 3KUCB 2V3PA 3R3MA 4ZRJA 4Q2JA 2WU2B 4AOFA 4C7YA 2WQYB 1E8WA 2W3RA 3UIPB 3CIRB 2KANA 2REXA 1WIAA 3WAOA 2J4XA 2JPHA 3P4RB 3EFUA 2ONQA 4JPSA 4AP4C 1CMXB 3H7PB 4BKSD 2BS4B 2ZVOA 3A9JA 3M3JA 3VFKA 3VTVA 2WWZA 5G2NA 2NBVB 4G0NB 5AUIA 2LRWA 2I1JA 5H92C 1OFFA 1XEEA 5JZEB 1WE6A 1BT0A 3IVFA 3OJ3A 1FFUA 1V81A 4WJOA 1JRPA 2R2QA 5T8IA 1RLFA 4I6NB 4P16A 3BVZA 2LD9A 1AN8A 5H8YE 3DWGC 1N60A 3L16A 5IOIA 1XLPA 4ANUA 1TS2A 4NAWA 1M4VA 1P7FA 4AWJA 1B9RA 3CMMB 3NZ3A 3E9SA 3VDZA 5D6JB 2KKCA 2LRUA 3TJPA 1R7SA 2AEHA 2L76A 3ENEA 3M63B 3ZRFA 2JUOA 3QWZB 4ACFA 1A5RA 1PYWD 3CSFA 2PIAA 5HI1A 4EKUA 1YOVB 2FCMA 1QLBB 5E6JA 3DBRB 1F9JA 2KVZA 2JWZA 3KLSX 2EMTA 2BQQA 2N0SB 3RPFC 1JWUD 3NG0A 1JRUA 1UUPA 1V8CA 3T3OA 1KLVA 4RGOS 2LHEA 4B6WA 4M02A 2WX1A 1P9DU 2XNAC 4TQ1A 3RI7C 1J8CA 2EKEC 4M0WA 2C7NB 2RSUA 5CHVC 5DPSA 1WFYA 3ZNGC 3VXWA 4MT5A 2IO0B 4LJOB 3IHPC 4HPLB 1F2RC 3MTNB 3DBLB 2L00B 2O6VD 1PFDA 3LYYA 3IG3A 3ZIMA 4C4VA 2PJHA 4KKJA 3V05A 2X38A 1NBFC 2O2VA 4B9KA 3AE6B 2WXQA 1YN3A 1I4HA 2QILA 1IYFA 1C4CA 4NQLB 1E8XA 4XGAB 1EWCA 2BS3B 2MX2A 2G4SA 3RNFC 2KJ6A 1Z5SB 2DAFA 2M1MA 2BB6A 2BB5A 3SHQA 2K8BA 4TV3A 2KTRB 4BBNF 2XEWA 1FM0D 3EECA 4J6IA 4WH4A 1ZUD2 1VR9A 2FIFA 3AEEB 2J52A 1ZP0B 4A3OA 3V6CB 1WM2A 1Y8RC 3HRDD 4ICUA 3A1QB 2WNMA 3AULA 1WGDA 1E7UA 4F7ZA 3KW5B 1QF6A 4N6EB 5C1ZA 1AYFA 4AUQC 3AE8B 1R4MB 4OVVA 1WH3A 1IP9A 1T0SC 5TR5A 4HLEA 2MH7A 3VH4B 2KLGA 2CU3A 3AU4A 2HDEA 1UWMA 1MPEA 3EC8A 4PK1A 1G6JA 5JHBA 2IJ0A 3ZGZA 3HK0A 1D6EC 2KJHB 1SIFA 3ZQ4A 2LVQA 3I63C 4IC7B 2LVOA 1HEZE 1EO6A 3VRBB 1C1YB 2KX0A 1X1MA 1R4NI 2FCQA 2INNE 4DHJD 1MJDA 2BBCA 3R2TA 4FA6A 1PGBA 2QCZA 1D5XC 3APDA 4WWOA 1K53A 2KAJA 5D3DA 1YX5B 4XDDA 3K9PB 3QK0A 3WAMA 2UU7A 4W9GA 3NZUA 4NAWB 4GB9A 3OWEB 2MWSB 1UH6A 4W9FA 1XD3B 5C2TB 3VHTC 2KACA 4TSSA 3ZRCA 2CS4A 2W82A 4ANWA 1XLNA 2MJ3A 3H9DA 3P42A 4ZRPA 3VAWA 2MHJA 2FIDA 3DCGA 4MH8A 1A70A 3P4PB 1N63A 3KYDD 4FHJA 1ACCA 4ARIA 3BYTB 3DVNU 3PSEB 3NHEB 1VLBA 1ZOYB 1E9MA 1ZKHA 1V1PB 2KTFA 2KMAA 3H8HA 4M0WB 5J18A 4HXDA 1MHHE 1SXTA 1MG4A 1BMLC 4LTUA 2DZIA 4W9IA 4GDLA 4MGIE 4CYEA 3VQIA 2N7JA 2ZCCA 3ZJUA 1WF9A 1UBQA 1YD8U 2LWPA 3ZTDA 1BUIC 1YN5A 1WJ4A 4PS3A 3VTUA 3SR6A 3W1YA 2WXKA 3V61A 3ZO5B 4OZCA 2O2VB 5IP4D 3UINB 1V5TA 1T0QC 2NPTB 1DOYA 1OQRA 4K7WA 4ZOHC 2WXGA 2KXJA 3AEBB 3URYA 2C7HA 3TL5A 2IDYA 2V3SA 3I3TB 4WWNA 2I2YA 2SAKA 2HTME 1SGHA 3PZDA 2LFIA 4GU2A 3TIXA 2WXPA 4HKZE 4RGNA 3Q2AC 4RNAA 2ZZPB 2NBUA 3ZKJC 2WXHA 3CWIA 2EKIA 1XO3A 1D5ZC 4XYCA 3RCZA 5E6OA 2L52A 3SU8X 2DENB 1H8CA 1WWTA 2ZNVC 3HVDA 3L10B 2WDVB 1J19A 3AEAB 4FN2A 2FCSA 2HD5B 2I38A 1TS5A 4CHKA 1TKYA 1B1ZA 2ICIA 4JIOU 3N20C 4KX6B 4EZJA 1JWSD 3UF8A 1OGWA 3TEWA 4GMVA 3Q6BA 1IUEA 1RWSA 3C19A 1NEKB 3DVGX 3APFA 3FKYA 5D94A 3N1YC 3MHZA 4IUMB 1Q5WB 4NPNA 5HFYA 4JX1C 3V3XA 3Q3JA 3Q69A 1NYQA 2IY1B 4YWGG 1VCBA 4K7SA 3TEZA 2W54A 2N4FA 3AE2B 3DDCB 5BYSA 1XQQA 1OEYJ 4TKNA 2C7MB 3H7SA 1ZGUB 1OQQA 2PEAA 3B2GA 2IBIB 2JZPA 3N32A 1GPXA 1C4AA 2HTHA 3T3NA 3OAWA 1TTNA 1JW9D 1V1OA 2BKRB 2W3SA 4OVUA 1QQRA 4ZRKA 5JH5C 1FXIA 1I4PA 4CQNA 2JF5A 4G3XB 3PHXB 3PVLA 1WXSA 1V9JA 4BAXA 4KIKA 2FBWB 3JVZX 1FCLA 1WRIA 3HM3A 4N9F4 2BGFA 1C4PA 1BXTA 1HQRD 1SE2A 4ZHPA 1KTKA 5LXHA 3QARA 3Q8CA 1LGRA 2KMCA 2FCNA 1CZPA 2A5UA 2LGDA 3GS2A 2PE9A 2HJ8A 1WGYA 1FNVA 1F2RI 3FILB 3APCA 3WCQA 4ZDVA 5E6PA 4WJPA 5BO4B 1WXQA 2KK8A 2RDBC 2INCC 2KZRA 2PKOA 1GC7A 1NI3A 4GDLB 2PMVA 4M8NA 3GE3C 2Z0EB 3JW0X 1T3QA 2GRIA 1VD2A 1CQVA 2XN9C 4W9JA 3IAS1 2L05A 1IBXA 3RNBC 4UDUC 2KTRA 3MJ5A 1RM6C 5C3JB 4DK5A 1QOAA 3AXCA 3A4RA 5EE9A 1YX6B 4RH6A 5DCNA 2KMMA 4C56C 2IO3B 2N9LA 4IWOA 2LVPA 1RYJA 2JZ3B 1LO5D 2E3TA 2PTLA 2K22A 4PS7A 4GOCA 1I4RA 3DBSA 1HTQA 2FUHB 3RFZB 2KC1A 3PLUA 2ON8A 4BVUC 5DPRA 1R4NB 4NAMA 3QA8A 3QJZA 4L23A 1TKEA 2KDIA 1ZXHA 1RRBA 4DXAB 2DHZA 1QOBA 2N9XA 5JHAA 1V2YA 4WAFA 1DGJA 1JCKB 3U8ZA 3NZSA 4HJKA 3R8BA 1N61A 4LNFA 3O13A 4W9HA 3KWLA 2KQ4X 4RCOA 4DXFA 4MSMB 2C5LC 3AH7A 1XCTL 5IKCM 3Q8BA 4PS8A 5EDSA 1AW7A 3EGRA 3P4SB 2NS5A 3LDZE 4K7UA 2GOWA 3Q8EA 2GBMA 3N1ZC 4LJPB 2FE8A 2DYBA 1GG3A 1ET9A 3R66C 1SIJA 2JXTA 4MDKE 1MI0A 4YL8A 1C79A 4HPMB 4LDTB 2K9XA 2BYEA 3U52E 3BK2A 2G45B 1GAQB 2L8JA 2WS3B 1YQ3B 3DOWA 3N3KB 2INDC 3Q8AA 3RZFA 4LNOA 2BKFA 1UGMA 4EE2A 1YJ1A 2Y5BB 4YTPB 2DNFA 1XT9B 4REZA 4MSQB 2D3GA 2KFJA 1QKZA 5G55A 3U4EG 3KQ4A 3VUYA 3RN9C 4KIKB 4A90A 2JZZA 2LJIA 3AB5A 1V1PA 1P0RA 5D2MB 1WJNA 3U30A 1SSNA 3MP9A 2GB1A 2Y3AA 3R2IA 1F0ZA 1MFWA 2JYTA 1LXDA 1Q10A 3RNGC 4EZLA 3SFEB 1CK1A 4DDGD 4B0MA 3DVGY 3SD5A 1FEHA 2OJRA 2ZEQA 3UQAA 1EU4A 1TJEA 2NPTA 1SBBB 1E5WA 3SDLC 1I4GA 1V49A 3EFCA 1MVKA 3IFWB 5HHDG 3AMZA 1IBXB 2WXOA 3J9CA 3RNCC 1WZ0A 3ZJTA 4KZ0A 2WXFA 3TSSA 4ZYSA 3H1UA 4OHJA 2V4IB 2WXLA 3NOBA 4WWPA 3U7DA 3NUHB 1EF5A 3ZDMC 1FXAA 3ML9A 4FJVB 2RPVA 3B0AA 2M0AA 3M95A 1T6BX 2Y5PA 3AEFB 4K3BA 1AWDA 3NVWA 2V4LA 2INPE 2QMTA 4LK0M 4ZHOA 2ZJDA 4LNKA 3TMPB 3JSVA 2BYFA 5G5HA 2MJEA 4K81A 3PLVA 3PRPB 2J0JA 1HZ5A 1E10A 4IM3A 2ACZB 2KDMA 1T0YA 1ZXIA 3QAQA 3NY5A 2VH1A 4KVGB 1YQBA 3VR8B 1N5WA 1F52A 4NJ7A 3DQVA 3PT2B 4KSLC 4TMAB 4FADA 1TS4A 4GSWA 3WAPA 1WYGA 1D4BA 3GB1A 3E56A 1KLUD 5FKAC 4L1BA 2FAZA 1J7AA 5IO9A 3T8MA 1LQBA 1KLGD 1RAXA 2J42A 2WXJA 2MJDA 1S1QB 4ZYNA 4G11A 4X57B 1TT5B 4P1BC 4XX5A 2KC2A 3MC8A 2JSVX 1YIWA 3AI5A 2B76B 2AQ1B 3B2FA 5J2RA 3W9CB 3RT3B 1NI2A 2AQ3B 1S3SG 1VZ6A 2QC8A 1UELA 3MJWA 2BTEA 4TUUA 2GBJA 2W55A 1XLQA 4F1SA 2AYOB 4BKTA 1QILA 4PT5A 5FK9C 2IO2B 1KJTA 2KYWA 2G4DB 3BIID 1OEYA 1L7YA 3ZNID 2K3UA 2N9PC 5LXIB 1E8YA 1GUAB 2GBRA 2R2OA 3Q14C 1LM8B 2D11A 3Q3NC 2WDQB 1JQ4A 4A20A 4II2B 3PO0A 1PQSA 3FILA 3AE5B 1FRRA 2YEPF 3PRMB 3ONSA 1PDXA 3AEGB 3RZWC 1I42A 1VZ7A 4NNJB 2PLPA 5FR6A 1UNSA 3AECB 2V0GA 1RFAA 1WX9A 3T9LA 2LUMA 3QIJA 4M01A 3V60A 3BVGA 4PYZA 1L0VB 4C7ZA 1FMAD 4US9A 1I4XA 2YVCA 3DHIC 1HA5A 2VZKB 2N9KA 3DBHI 4ZRIA 5KHOA 3DPDA 2L0TA 2JT4B 4RF0A 2W9NA 3TEXA 1I4QA 5EE0A 3ZDTA 4XE0A 4MEMA 2MCNB 2DBYA 1GNUA 2KDBA 3AE4B 4IM2A 2QSDA 1WYWB 3EUB2 4FLHA 2JX5A 1SE9A 5D3IB 4BZAA 1KM7A 1PGXA 1WGRA 4PYUA 4IWQA 3HHMA 3B08A 2OJWA 3P1MA 4LNNA 2KD0A 2KQSA 1T0RC 2IY0B 4J3OD 4LDTD 3I5JC 1WE7A 4HROA 3N30A 4MGZE 1VRAB 3RYTA 1P3QU 1YNTE 1AARA 1N62A
chains in the Genus database with same CATH topology
3A9JB 2CHXA 1JRUA 4ASWC 4NQKE 5AEKB 3ZNZB 2N7EA 1KLVA 2L05A 2KTRA 2IYDB 3PHWB 4DK5A 3V62A 4B6WA 2MBBB 3AXCA 3A4RA 2WX1A 1P9DU 2GBNA 3IBEA 3JSVB 4TQ1A 2C9WB 1J8CA 2IO1B 3A9KA 2EKEC 4LCDE 2DZKA 2C7NB 2RSUA 3M62B 5CHVC 5DPSA 2L0FA 4BOZB 1WFYA 3ZNGC 3VXWA 2KO3A 2K6QA 1YX6B 5DCNA 2IO0B 2UYZB 3IHPC 4LJOB 4DHZE 2IO3B 4HPLB 4IWOA 3L08A 3MTNB 4E71A 2JXXA 2BWFA 2L00B 2LVPA 2LXCA 2JZ3B 2K1FA 4XC2A 2O6VD 1V80A 2RGFA 3IG3A 4RM9A 3DVNV 3ZIMA 1NDDA 2LGYA 2PJHA 1I35A 4PS7A 4WJNA 2K8CA 4GOCA 5IAAC 2KOXA 3DBSA 4XZ4A 2FUHB 4E74A 1NBFC 2KC1A 2N9EB 2O2VA 4B9KA 3PLUA 1D3ZA 4BVUC 2D2QA 2YLMA 2NBWB 5DPRA 1UZXB 1IYFA 1WXMA 3QA8A 3QJZA 3PPAA 3K9OB 4IW0A 2DAJA 2RD0A 4BKGA 1V86A 1E8XA 4NQLB 5AZFA 2L7RA 2MBQA 5LLIA 2KDIA 2MX2A 2KWUB 1RRBA 4DXAB 2NR2A 2G4SA 3BY4B 2DHZA 2N9XA 2NCNA 5JHAA 1V2YA 1WMHB 2KJ6A 1Z5SB 2UWQA 2DAFA 3QX1A 2DYMA 2RPQA 3LJ3A 2M1MA 4URKA 3U8ZA 2J7QB 3NZSA 4HJKA 3SHQA 2K8BA 4TV3A 2KTRB 4W9HA 4BBNF 2XEWA 3EECA 4J6IA 4BBNC 2FIFA 2MRPA 3KH0A 4DBGA 1WR6E 3ZNHB 4A3OA 3PRZA 2K6DB 4MSMB 2C5LC 4JLCA 3V6CB 1WM2A 1Y8RC 2BWES 4ICUA 3A1QB 4PS8A 3AULA 2WYQA 4K1RB 5EDSA 1WGDA 3ECIA 1E7UA 3RUIB 2NS5A 4F7ZA 2M0XA 2B3AA 5CHFA 3KW5B 2PPHA 1WJUA 3LDZE 4K7UA 2GOWA 3DBRI 5C1ZA 2KHWB 3L0WB 3A33B 4KDLB 4HWIB 4AUQC 3NS8A 2GBMA 2KWVB 4LJPB 1H4RA 2VRRB 2DYBA 1GG3A 4OVVA 1WH3A 3R66C 4AJWA 1WM3A 4MDKE 2KVRA 2ZPYA 1IP9A 3PREA 4YL8A 4MELA 3KUDB 4HPMB 4LDTB 5TR5A 4HLEA 3ZUNA 3VH4B 2KLGA 1WGHA 2BYEA 4GGQA 4RM8A 5E6NA 3TCAA 2G45B 3AU4A 3W1SA 1QZEA 2L8JA 1Q1OA 3EC8A 3DOWA 3N3KB 3GOEA 4GDKA 3RZFA 3WIMA 2M8SA 2BKFA 1UGMA 1OQYA 1G6JA 3DBLI 5JHBA 1YJ1A 2MP2A 1GC6A 2DZMA 3RULA 1MG8A 1HE8A 1WZ3A 4G50A 3HK0A 2Y5BB 2KFKA 2ZPNA 2OOBB 2KJHB 2WX0A 4GN1A 4B95A 1SIFA 1XT9B 2LVQA 4HK2A 4MM3A 4EOYA 3KUZA 4MSQB 3V6EB 4EZKA 4IC7B 2DZJA 2LVOA 2D3GA 2KFJA 4WAAA 5G55A 1TZ1A 1WGGA 2ZNVB 4ANVA 1EO6A 3ALBA 5CHWA 3VUYA 3ZW3A 1C1YB 2O6VB 2LZ6A 4KIKB 2I1KA 2LJ5A 1EF1A 2JZZA 2K8HA 2KX0A 1X1MA 1R4NI 4MJSA 3RD2A 2FCQA 4DHJD 1P0RA 4FBJB 5D2MB 1WX7A 3ML8A 4GIVA 4KV2A 5KHQA 1WJNA 3U30A 4FA6A 5GMVA 3UGBB 2N1WA 2ZVNA 4EUTA 3TBLD 2AWTA 2CHWA 3CF6E 3APDA 1C3TA 2XK5A 3H7PA 4WWOA 4M8MA 3L17A 3CSTA 1YX5B 4I6PA 3P2BA 3H6NA 3K9PB 3QK0A 4NY0A 3WAMA 4W9GA 3D32A 1LXDA 3NZUA 4NAWB 2N1VA 3PGEA 4EZLA 5D7GA 1LFDA 4DDGD 4GB9A 2MWSB 1E8ZA 1UH6A 4KDIC 4W9FA 3DVGY 3WANA 4I6LB 4JQWC 1XD3B 3SD5A 5IA7A 2OJRA 4EFOA 2ZEQA 3VHTC 3UQAA 2KNBA 3Q3FA 2A4ZA 2NPTA 4MGYE 4W9KA 3ZRCA 1M94A 1GJZA 2CS4A 3VVWB 4II3B 2MBEA 1E5WA 1P1AA 4ANWA 3SDLC 2KX3A 3B1LX 1V49A 3PV1A 3H9DA 1R4MI 2Z59B 3VAWA 2FIDA 3DCGA 2PE6B 3IFWB 2LASA 3KYDD 2KWCA 4FHJA 3UQBA 4RMAA 2MBOA 2JRHA 2QHOA 3DVNU 3PSEB 1WZ0A 3NHEB 4KZ0A 4CO7A 5AZGA 1WR1A 5AZHA 3KVFB 4MJSB 4JL9A 3H1UA 1ZKHA 2G3QB 2KMAA 2KTFA 2V1YA 3A9KB 4M0WB 5J18A 3U7DA 3NOBA 4WWPA 4HXDA 2N7DA 2C60A 2GMIC 3ZTCA 1EF5A 1IPGA 4WQOB 3ZDMC 2DZIA 4W9IA 2HE7A 3ML9A 4GDLA 2RR9A 1K8RB 4FJVB 4MGIE 3B0AA 4KSKC 3VQIA 4CYEA 3PS6A 2ZCCA 4DWFA 3M95A 1UBIA 1WF9A 4JGHB 4NJ6A 1UBQA 1YD8U 2LWPA 4P7IA 2EMSA 3ZLZA 3ZTDA 4BFRA 3A4SC 2DX5B 3KYCD 1WJ4A 2CR5A 4HCNB 4PS3A 2M4NA 3VTUA 3QCAA 1WXAA 2V4LA 1E90A 2ZJDA 3W1YA 2DYOA 3OLMD 3QQ8B 2KQ7A 3V61A 3TMPB 3ZO5B 3JSVA 2BYFA 2LI5A 2O2VB 4EEWA 3UINB 3WALA 1V5TA 1WY8A 4K81A 3PLVA 3PRPB 2J0JA 4ICVA 3R7QA 2NPTB 4IM3A 2J0KA 2AL6A 5L95C 1FXTB 2JVCA 2CHZA 4K7WA 3S2AA 5CTRC 1T0YA 2LXAA 2KXJA 5DPTA 3QAQA 3NY5A 4KVGB 3WA0A 1P98A 2C7HA 3TL5A 1YQBA 2V3SA 3I3TB 5C23A 4MH0E 4DHJB 4BOSC 4WWNA 4NJ7A 3DQVA 2M17A 4KZCA 1SGHA 3PZDA 3HIZA 2CKHB 3PT2B 4GU2A 4KSLC 3TIXA 4FJYA 1L2NA 4FADA 3OJ4B 4GSWA 3WAPA 2BYVE 2MW5A 2BPSA 4MGKE 3R7RA 3VUXA 3HM6X 2ZZPB 2NBUA 1OTRB 1WXVA 3ZKJC 3AU5A 4BKSA 2FAZA 3PTFC 3EHVA 3VH3B 2D07B 4ANXA 2GBKA 1E7VA 2MBHA 3RCZA 5E6OA 3UIOB 3T8MA 1J0GA 2MA9B 2LGXA 1LQBA 3SU8X 2DENB 3ZVVA 1RAXA 2KN5A 1ISNA 1H8CA 5L83A 2ZNVC 3L10B 1WRDB 1S1QB 1J19A 4ZYNA 4FN2A 3VUWA 1WMHA 1KOTA 2FCSA 4G11A 4X57B 2LUEA 4XX5A 5J17A 2HD5B 2BF8B 4TQ0A 4HVBA 4DHZB 2KC2A 4CHKA 4JIOU 4IM0A 1WX8A 1YIWA 3AI5A 4EZJA 2KDFB 3UF8A 3BINA 1OGWA 3L54A 5J2RA 3RT3B 4FJZA 1NI2A 2FNJB 4GMVA 3QHTA 1S3SG 3C0RB 1UELA 2K39A 3VTWA 1Q0WB 3MJWA 3DVGX 2MSED 3APFA 4TUUA 1Z2MA 3A1QA 3X23A 1TGZB 4HDQA 4W9EA 5D94A 2GBJA 4F1SA 2AYOB 4BKTA 2CU1A 2MLBA 4F8CB 4IUMB 4GDKB 1Q5WB 4FHKA 4NPNA 2IO2B 2MQJA 1KJTA 4IG7B 2KJRA 3Q3JA 4W9CA 2MP2B 2G4DB 3W1SC 5DPWA 3JYUA 1OEYA 2IY1B 1L7YA 3ZNID 2L3ZA 2KFKB 1VCBA 2N9PC 3QC8B 4K7SA 5LXIB 4GXBA 4IWPA 1E8YA 1GUAB 2N4FA 3L13A 2GBRA 3DDCB 2R2OA 3KUCB 4W9LA 1LM8B 2D11A 1XQQA 1OEYJ 3R3MA 4TKNA 4ZRJA 2NVUI 4A20A 4II2B 2C7MB 3H7SA 4AOFA 1PQSA 1ZGUB 5CX3A 2PEAA 2XBBC 1E8WA 3UIPB 3PRMB 2ZCBA 3ONSA 2KANA 2KDEB 2IBIB 3RZWC 2REXA 3N32A 1WIAA 1I42A 2D10A 3WAOA 3MHSD 4W9DA 2HTHA 1V6EA 2JPHA 3EFUA 3OAWA 4NNJB 1TTNA 2BKRB 4AP4C 5FR6A 4OVUA 2JY6A 5HKHA 1CMXB 1RFAA 2XK5B 1WJ6A 1WX9A 3H7PB 3T9LA 3GZNI 1UD7A 4ZRKA 4BKSD 5JH5C 3QIJA 2JF5A 4G3XB 2ZVOA 3V60A 3A9JA 3PHXB 3M3JA 3VFKA 3VTVA 2WWZA 4PYZA 3PVLA 1WXSA 1V9JA 5G2NA 2NBVB 4G0NB 2LRWA 2YVCA 2I1JA 2O6VA 4KIKA 2ASQA 5JZEB 3O65B 3JVZX 1WE6A 1BT0A 3IVFA 3HM3A 3OJ3A 1V81A 4WJOA 2R2QA 4N9F4 2BGFA 3DBHI 1RLFA 4ZRIA 4DDID 2J0MA 2JRIB 2K25A 4I6NB 5LXHA 3QARA 5KHOA 3DPDA 2LD9A 2L0TA 2JT4B 2W9NA 1U4AA 2KMCA 2FCNA 4AJYB 4E3CA 2A5UA 3ZDTA 1ZW7A 2LGDA 3L16A 4A3PA 2WDTB 2PE9A 4NAWA 4ANUA 2HJ8A 4MEMA 2MCNB 1WGYA 1GNUA 2KDBA 4IM2A 4AWJA 1TBEA 1V5OA 3APCA 2Z0DB 3CMMB 1WYWB 4ZDVA 3VDZA 1WI0A 5E6PA 4FLHA 4WJPA 1SE9A 5BO4B 5D6JB 4HDOA 2KK8A 2KKCA 1KM7A 1WGRA 4PYUA 2LRUA 4IWQA 3TJPA 3HHMA 3B08A 2KZRA 2AEHA 2L76A 3ENEA 3M63B 4HCPB 2JUOA 3ZRFA 3QWZB 3X0WA 1A5RA 4FULA 2IZVB 1GC7A 2KD0A 2KQSA 2KLCA 3CSFA 2IY0B 4EKUA 2FCMA 4GDLB 1F9JA 4LDTD 4M8NA 1WE7A 2Z0EB 2JWZA 3JW0X 2EMTA 2AL3A 1VD2A 3N30A 4MGZE 4WJQA 3RYTA 4W9JA 1P3QU 1EUVB 1AARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A9J B;  2CHX A;  1JRU A;  4ASW C;  4NQK E;  5AEK B;  3ZNZ B;  2N7E A;  1KLV A;  2L05 A;  2KTR A;  2IYD B;  3PHW B;  4DK5 A;  3V62 A;  4B6W A;  2MBB B;  3AXC A;  3A4R A;  2WX1 A;  1P9D U;  2GBN A;  3IBE A;  3JSV B;  4TQ1 A;  2C9W B;  1J8C A;  2IO1 B;  3A9K A;  2EKE C;  4LCD E;  2DZK A;  2C7N B;  2RSU A;  3M62 B;  5CHV C;  5DPS A;  2L0F A;  4BOZ B;  1WFY A;  3ZNG C;  3VXW A;  2KO3 A;  2K6Q A;  1YX6 B;  5DCN A;  2IO0 B;  2UYZ B;  3IHP C;  4LJO B;  4DHZ E;  2IO3 B;  4HPL B;  4IWO A;  3L08 A;  3MTN B;  4E71 A;  2JXX A;  2BWF A;  2L00 B;  2LVP A;  2LXC A;  2JZ3 B;  2K1F A;  4XC2 A;  2O6V D;  1V80 A;  2RGF A;  3IG3 A;  4RM9 A;  3DVN V;  3ZIM A;  1NDD A;  2LGY A;  2PJH A;  1I35 A;  4PS7 A;  4WJN A;  2K8C A;  4GOC A;  5IAA C;  2KOX A;  3DBS A;  4XZ4 A;  2FUH B;  4E74 A;  1NBF C;  2KC1 A;  2N9E B;  2O2V A;  4B9K A;  3PLU A;  1D3Z A;  4BVU C;  2D2Q A;  2YLM A;  2NBW B;  5DPR A;  1UZX B;  1IYF A;  1WXM A;  3QA8 A;  3QJZ A;  3PPA A;  3K9O B;  4IW0 A;  2DAJ A;  2RD0 A;  4BKG A;  1V86 A;  1E8X A;  4NQL B;  5AZF A;  2L7R A;  2MBQ A;  5LLI A;  2KDI A;  2MX2 A;  2KWU B;  1RRB A;  4DXA B;  2NR2 A;  2G4S A;  3BY4 B;  2DHZ A;  2N9X A;  2NCN A;  5JHA A;  1V2Y A;  1WMH B;  2KJ6 A;  1Z5S B;  2UWQ A;  2DAF A;  3QX1 A;  2DYM A;  2RPQ A;  3LJ3 A;  2M1M A;  4URK A;  3U8Z A;  2J7Q B;  3NZS A;  4HJK A;  3SHQ A;  2K8B A;  4TV3 A;  2KTR B;  4W9H A;  4BBN F;  2XEW A;  3EEC A;  4J6I A;  4BBN C;  2FIF A;  2MRP A;  3KH0 A;  4DBG A;  1WR6 E;  3ZNH B;  4A3O A;  3PRZ A;  2K6D B;  4MSM B;  2C5L C;  4JLC A;  3V6C B;  1WM2 A;  1Y8R C;  2BWE S;  4ICU A;  3A1Q B;  4PS8 A;  3AUL A;  2WYQ A;  4K1R B;  5EDS A;  1WGD A;  3ECI A;  1E7U A;  3RUI B;  2NS5 A;  4F7Z A;  2M0X A;  2B3A A;  5CHF A;  3KW5 B;  2PPH A;  1WJU A;  3LDZ E;  4K7U A;  2GOW A;  3DBR I;  5C1Z A;  2KHW B;  3L0W B;  3A33 B;  4KDL B;  4HWI B;  4AUQ C;  3NS8 A;  2GBM A;  2KWV B;  4LJP B;  1H4R A;  2VRR B;  2DYB A;  1GG3 A;  4OVV A;  1WH3 A;  3R66 C;  4AJW A;  1WM3 A;  4MDK E;  2KVR A;  2ZPY A;  1IP9 A;  3PRE A;  4YL8 A;  4MEL A;  3KUD B;  4HPM B;  4LDT B;  5TR5 A;  4HLE A;  3ZUN A;  3VH4 B;  2KLG A;  1WGH A;  2BYE A;  4GGQ A;  4RM8 A;  5E6N A;  3TCA A;  2G45 B;  3AU4 A;  3W1S A;  1QZE A;  2L8J A;  1Q1O A;  3EC8 A;  3DOW A;  3N3K B;  3GOE A;  4GDK A;  3RZF A;  3WIM A;  2M8S A;  2BKF A;  1UGM A;  1OQY A;  1G6J A;  3DBL I;  5JHB A;  1YJ1 A;  2MP2 A;  1GC6 A;  2DZM A;  3RUL A;  1MG8 A;  1HE8 A;  1WZ3 A;  4G50 A;  3HK0 A;  2Y5B B;  2KFK A;  2ZPN A;  2OOB B;  2KJH B;  2WX0 A;  4GN1 A;  4B95 A;  1SIF A;  1XT9 B;  2LVQ A;  4HK2 A;  4MM3 A;  4EOY A;  3KUZ A;  4MSQ B;  3V6E B;  4EZK A;  4IC7 B;  2DZJ A;  2LVO A;  2D3G A;  2KFJ A;  4WAA A;  5G55 A;  1TZ1 A;  1WGG A;  2ZNV B;  4ANV A;  1EO6 A;  3ALB A;  5CHW A;  3VUY A;  3ZW3 A;  1C1Y B;  2O6V B;  2LZ6 A;  4KIK B;  2I1K A;  2LJ5 A;  1EF1 A;  2JZZ A;  2K8H A;  2KX0 A;  1X1M A;  1R4N I;  4MJS A;  3RD2 A;  2FCQ A;  4DHJ D;  1P0R A;  4FBJ B;  5D2M B;  1WX7 A;  3ML8 A;  4GIV A;  4KV2 A;  5KHQ A;  1WJN A;  3U30 A;  4FA6 A;  5GMV A;  3UGB B;  2N1W A;  2ZVN A;  4EUT A;  3TBL D;  2AWT A;  2CHW A;  3CF6 E;  3APD A;  1C3T A;  2XK5 A;  3H7P A;  4WWO A;  4M8M A;  3L17 A;  3CST A;  1YX5 B;  4I6P A;  3P2B A;  3H6N A;  3K9P B;  3QK0 A;  4NY0 A;  3WAM A;  4W9G A;  3D32 A;  1LXD A;  3NZU A;  4NAW B;  2N1V A;  3PGE A;  4EZL A;  5D7G A;  1LFD A;  4DDG D;  4GB9 A;  2MWS B;  1E8Z A;  1UH6 A;  4KDI C;  4W9F A;  3DVG Y;  3WAN A;  4I6L B;  4JQW C;  1XD3 B;  3SD5 A;  5IA7 A;  2OJR A;  4EFO A;  2ZEQ A;  3VHT C;  3UQA A;  2KNB A;  3Q3F A;  2A4Z A;  2NPT A;  4MGY E;  4W9K A;  3ZRC A;  1M94 A;  1GJZ A;  2CS4 A;  3VVW B;  4II3 B;  2MBE A;  1E5W A;  1P1A A;  4ANW A;  3SDL C;  2KX3 A;  3B1L X;  1V49 A;  3PV1 A;  3H9D A;  1R4M I;  2Z59 B;  3VAW A;  2FID A;  3DCG A;  2PE6 B;  3IFW B;  2LAS A;  3KYD D;  2KWC A;  4FHJ A;  3UQB A;  4RMA A;  2MBO A;  2JRH A;  2QHO A;  3DVN U;  3PSE B;  1WZ0 A;  3NHE B;  4KZ0 A;  4CO7 A;  5AZG A;  1WR1 A;  5AZH A;  3KVF B;  4MJS B;  4JL9 A;  3H1U A;  1ZKH A;  2G3Q B;  2KMA A;  2KTF A;  2V1Y A;  3A9K B;  4M0W B;  5J18 A;  3U7D A;  3NOB A;  4WWP A;  4HXD A;  2N7D A;  2C60 A;  2GMI C;  3ZTC A;  1EF5 A;  1IPG A;  4WQO B;  3ZDM C;  2DZI A;  4W9I A;  2HE7 A;  3ML9 A;  4GDL A;  2RR9 A;  1K8R B;  4FJV B;  4MGI E;  3B0A A;  4KSK C;  3VQI A;  4CYE A;  3PS6 A;  2ZCC A;  4DWF A;  3M95 A;  1UBI A;  1WF9 A;  4JGH B;  4NJ6 A;  1UBQ A;  1YD8 U;  2LWP A;  4P7I A;  2EMS A;  3ZLZ A;  3ZTD A;  4BFR A;  3A4S C;  2DX5 B;  3KYC D;  1WJ4 A;  2CR5 A;  4HCN B;  4PS3 A;  2M4N A;  3VTU A;  3QCA A;  1WXA A;  2V4L A;  1E90 A;  2ZJD A;  3W1Y A;  2DYO A;  3OLM D;  3QQ8 B;  2KQ7 A;  3V61 A;  3TMP B;  3ZO5 B;  3JSV A;  2BYF A;  2LI5 A;  2O2V B;  4EEW A;  3UIN B;  3WAL A;  1V5T A;  1WY8 A;  4K81 A;  3PLV A;  3PRP B;  2J0J A;  4ICV A;  3R7Q A;  2NPT B;  4IM3 A;  2J0K A;  2AL6 A;  5L95 C;  1FXT B;  2JVC A;  2CHZ A;  4K7W A;  3S2A A;  5CTR C;  1T0Y A;  2LXA A;  2KXJ A;  5DPT A;  3QAQ A;  3NY5 A;  4KVG B;  3WA0 A;  1P98 A;  2C7H A;  3TL5 A;  1YQB A;  2V3S A;  3I3T B;  5C23 A;  4MH0 E;  4DHJ B;  4BOS C;  4WWN A;  4NJ7 A;  3DQV A;  2M17 A;  4KZC A;  1SGH A;  3PZD A;  3HIZ A;  2CKH B;  3PT2 B;  4GU2 A;  4KSL C;  3TIX A;  4FJY A;  1L2N A;  4FAD A;  3OJ4 B;  4GSW A;  3WAP A;  2BYV E;  2MW5 A;  2BPS A;  4MGK E;  3R7R A;  3VUX A;  3HM6 X;  2ZZP B;  2NBU A;  1OTR B;  1WXV A;  3ZKJ C;  3AU5 A;  4BKS A;  2FAZ A;  3PTF C;  3EHV A;  3VH3 B;  2D07 B;  4ANX A;  2GBK A;  1E7V A;  2MBH A;  3RCZ A;  5E6O A;  3UIO B;  3T8M A;  1J0G A;  2MA9 B;  2LGX A;  1LQB A;  3SU8 X;  2DEN B;  3ZVV A;  1RAX A;  2KN5 A;  1ISN A;  1H8C A;  5L83 A;  2ZNV C;  3L10 B;  1WRD B;  1S1Q B;  1J19 A;  4ZYN A;  4FN2 A;  3VUW A;  1WMH A;  1KOT A;  2FCS A;  4G11 A;  4X57 B;  2LUE A;  4XX5 A;  5J17 A;  2HD5 B;  2BF8 B;  4TQ0 A;  4HVB A;  4DHZ B;  2KC2 A;  4CHK A;  4JIO U;  4IM0 A;  1WX8 A;  1YIW A;  3AI5 A;  4EZJ A;  2KDF B;  3UF8 A;  3BIN A;  1OGW A;  3L54 A;  5J2R A;  3RT3 B;  4FJZ A;  1NI2 A;  2FNJ B;  4GMV A;  3QHT A;  1S3S G;  3C0R B;  1UEL A;  2K39 A;  3VTW A;  1Q0W B;  3MJW A;  3DVG X;  2MSE D;  3APF A;  4TUU A;  1Z2M A;  3A1Q A;  3X23 A;  1TGZ B;  4HDQ A;  4W9E A;  5D94 A;  2GBJ A;  4F1S A;  2AYO B;  4BKT A;  2CU1 A;  2MLB A;  4F8C B;  4IUM B;  4GDK B;  1Q5W B;  4FHK A;  4NPN A;  2IO2 B;  2MQJ A;  1KJT A;  4IG7 B;  2KJR A;  3Q3J A;  4W9C A;  2MP2 B;  2G4D B;  3W1S C;  5DPW A;  3JYU A;  1OEY A;  2IY1 B;  1L7Y A;  3ZNI D;  2L3Z A;  2KFK B;  1VCB A;  2N9P C;  3QC8 B;  4K7S A;  5LXI B;  4GXB A;  4IWP A;  1E8Y A;  1GUA B;  2N4F A;  3L13 A;  2GBR A;  3DDC B;  2R2O A;  3KUC B;  4W9L A;  1LM8 B;  2D11 A;  1XQQ A;  1OEY J;  3R3M A;  4TKN A;  4ZRJ A;  2NVU I;  4A20 A;  4II2 B;  2C7M B;  3H7S A;  4AOF A;  1PQS A;  1ZGU B;  5CX3 A;  2PEA A;  2XBB C;  1E8W A;  3UIP B;  3PRM B;  2ZCB A;  3ONS A;  2KAN A;  2KDE B;  2IBI B;  3RZW C;  2REX A;  3N32 A;  1WIA A;  1I42 A;  2D10 A;  3WAO A;  3MHS D;  4W9D A;  2HTH A;  1V6E A;  2JPH A;  3EFU A;  3OAW A;  4NNJ B;  1TTN A;  2BKR B;  4AP4 C;  5FR6 A;  4OVU A;  2JY6 A;  5HKH A;  1CMX B;  1RFA A;  2XK5 B;  1WJ6 A;  1WX9 A;  3H7P B;  3T9L A;  3GZN I;  1UD7 A;  4ZRK A;  4BKS D;  5JH5 C;  3QIJ A;  2JF5 A;  4G3X B;  2ZVO A;  3V60 A;  3A9J A;  3PHX B;  3M3J A;  3VFK A;  3VTV A;  2WWZ A;  4PYZ A;  3PVL A;  1WXS A;  1V9J A;  5G2N A;  2NBV B;  4G0N B;  2LRW A;  2YVC A;  2I1J A;  2O6V A;  4KIK A;  2ASQ A;  5JZE B;  3O65 B;  3JVZ X;  1WE6 A;  1BT0 A;  3IVF A;  3HM3 A;  3OJ3 A;  1V81 A;  4WJO A;  2R2Q A;  4N9F 4;  2BGF A;  3DBH I;  1RLF A;  4ZRI A;  4DDI D;  2J0M A;  2JRI B;  2K25 A;  4I6N B;  5LXH A;  3QAR A;  5KHO A;  3DPD A;  2LD9 A;  2L0T A;  2JT4 B;  2W9N A;  1U4A A;  2KMC A;  2FCN A;  4AJY B;  4E3C A;  2A5U A;  3ZDT A;  1ZW7 A;  2LGD A;  3L16 A;  4A3P A;  2WDT B;  2PE9 A;  4NAW A;  4ANU A;  2HJ8 A;  4MEM A;  2MCN B;  1WGY A;  1GNU A;  2KDB A;  4IM2 A;  4AWJ A;  1TBE A;  1V5O A;  3APC A;  2Z0D B;  3CMM B;  1WYW B;  4ZDV A;  3VDZ A;  1WI0 A;  5E6P A;  4FLH A;  4WJP A;  1SE9 A;  5BO4 B;  5D6J B;  4HDO A;  2KK8 A;  2KKC A;  1KM7 A;  1WGR A;  4PYU A;  2LRU A;  4IWQ A;  3TJP A;  3HHM A;  3B08 A;  2KZR A;  2AEH A;  2L76 A;  3ENE A;  3M63 B;  4HCP B;  2JUO A;  3ZRF A;  3QWZ B;  3X0W A;  1A5R A;  4FUL A;  2IZV B;  1GC7 A;  2KD0 A;  2KQS A;  2KLC A;  3CSF A;  2IY0 B;  4EKU A;  2FCM A;  4GDL B;  1F9J A;  4LDT D;  4M8N A;  1WE7 A;  2Z0E B;  2JWZ A;  3JW0 X;  2EMT A;  2AL3 A;  1VD2 A;  3N30 A;  4MGZ E;  4WJQ A;  3RYT A;  4W9J A;  1P3Q U;  1EUV B;  1AAR A; 
#chains in the Genus database with same CATH topology
 4A8X C;  2QJL A;  4NQK E;  3ZNZ B;  2K5P A;  2OED A;  2G1E A;  4RFB A;  1L0Y B;  3PHW B;  1VDV A;  3FC4 A;  2MBB B;  4JE3 B;  3IBE A;  2GBN A;  3JSV B;  3A9K A;  2DZK A;  4NZL B;  2L0F A;  2JWU A;  2KO3 A;  2UYZ B;  4DHZ E;  4WQM A;  3L08 A;  2D3A A;  4E71 A;  4N58 A;  1TZO A;  2WGS A;  3GP7 A;  2LEK A;  2RGF A;  3IXS A;  3DVN V;  2LGY A;  5BYR A;  4WJN A;  2K8C A;  2X8X X;  3BYY B;  2KOX A;  3HVZ A;  4XZ4 A;  4E74 A;  2N9E B;  3NVZ A;  4OW0 A;  2YLM A;  1ZPS A;  2NBW B;  2RDH A;  4IW0 A;  2DAJ A;  5FR3 A;  4BKG A;  1V86 A;  2MBQ A;  5LLI A;  2Z8L A;  2KWU B;  2NR2 A;  1F1H A;  2RDG A;  2UWQ A;  3QX1 A;  2DYM A;  3LJ3 A;  4N59 A;  1SF0 A;  1E6E B;  3KH0 A;  2MRP A;  2AX5 A;  1JML A;  3BVM A;  2K6D B;  3W5U B;  2PVG C;  1SB3 C;  4XDC A;  1UGJ A;  4K1R B;  4OZB A;  1TS3 A;  2MEK A;  3RUI B;  2M0X A;  5CHF A;  2IGG A;  4RGT A;  4KDL B;  4HWI B;  4NJC A;  3N1X C;  1H4R A;  2VRR B;  4ZRQ A;  4AJW A;  2ZPY A;  4MEL A;  3KUD B;  4RF1 A;  4A9A A;  3ZUN A;  1WGH A;  1ET6 A;  5E6N A;  4RM8 A;  3TCA A;  4DQO C;  4JWS C;  3W1S A;  1QZE A;  4GDK A;  4XWT A;  1JWB D;  1OQY A;  4A55 A;  1GC6 A;  1NYR A;  2DZM A;  1HE8 A;  1WZ3 A;  2ZPN A;  2OOB B;  2WX0 A;  1E0Z A;  4MM3 A;  3KUZ A;  3AED B;  2DZJ A;  1IGC A;  3P63 A;  1WGG A;  2L32 A;  2ZNV B;  1GB1 A;  2LZ6 A;  1EF1 A;  2TSS A;  3Q3O C;  1WGK A;  4FBJ B;  2PW9 A;  1ESF A;  1WX7 A;  4KV2 A;  5KHQ A;  4AS1 A;  1FNU A;  3FAH A;  5GMV A;  3UGB B;  1CJE A;  3TBL D;  2AWT A;  1C3T A;  2CJN A;  2XK5 A;  1F77 A;  3L17 A;  1FO4 A;  4KKI A;  1C76 A;  3P2B A;  3H6N A;  1RFK A;  4YSX B;  4R3D A;  3D32 A;  3DWM A;  3PGE A;  3HUI A;  3DHH C;  1HXY D;  1LFD A;  1J7B A;  1YJJ A;  3ZYY X;  3WAN A;  2WXI A;  2KNB A;  3Q3F A;  2A4Z A;  4MGY E;  1GJZ A;  2M56 B;  3BK1 A;  1YJI A;  1FFV A;  2WXN A;  3B1L X;  3IAM 1;  2YEP B;  3UQB A;  4RMA A;  2MBO A;  2H88 B;  1UWX A;  4CO7 A;  5AZG A;  5AZH A;  4OVZ A;  3KVF B;  4MJS B;  4JL9 A;  3A9K B;  1FD6 A;  1ZE3 D;  1TY2 A;  4OZA A;  2C60 A;  3ZTC A;  5IN7 A;  4WQO B;  2RR9 A;  1K8R B;  3ABV B;  3GE8 C;  3PS6 A;  1UBI A;  4P7I A;  3ZLZ A;  3BZD B;  1XCQ L;  3A4S C;  3B9J A;  2CR5 A;  1N6Z A;  2M4N A;  2D5G A;  3QCA A;  1WXA A;  1E90 A;  1P7E A;  3L4P A;  3OLM D;  1QT9 A;  2LI5 A;  3AV8 A;  3RMK C;  4EEW A;  3WAL A;  1TKG A;  3R7Q A;  2J0K A;  2AL6 A;  3RNE C;  1FXT B;  1TY0 A;  3S2A A;  5L95 C;  3RNA C;  3MC9 A;  3LB8 C;  1FRD A;  3WA0 A;  1K50 A;  1NVI D;  2VZK D;  4BOS C;  2M17 A;  1XLO A;  2CKH B;  3NVY A;  1L2N A;  3OJ4 B;  2BYV E;  2MW5 A;  2BPS A;  3R7R A;  3AE9 B;  1OTR B;  1WXV A;  4HRS A;  4C00 A;  1DOI A;  4BKS A;  3PTF C;  3EHV A;  3VH3 B;  2ZW1 A;  4ANX A;  2MBH A;  3UIO B;  4B0E A;  1J0G A;  2BYT A;  3DBH B;  3ZVV A;  1PUT A;  2KN5 A;  3VUW A;  4L2Y A;  1WMH A;  2BF8 B;  1WSP A;  1L6U A;  4HVB A;  2KDF B;  3BIN A;  3L54 A;  2BT6 A;  4FJZ A;  2FNJ B;  3C0R B;  2K39 A;  4P6V F;  2Y5C A;  1FPY A;  1Z2M A;  5BYQ A;  1C77 A;  1STE A;  2WP9 B;  4GDK B;  4KGR A;  4FHK A;  1VZ8 A;  2FUG 1;  1JWM D;  3TEY A;  4IG7 B;  2KJR A;  4W9C A;  3AE3 B;  2JU6 X;  3QC8 B;  3ETR A;  1V97 A;  2IGH A;  3P4Q B;  4US8 A;  1KF6 B;  4MM3 B;  4W9L A;  3Q8F A;  2NVU I;  3MC0 B;  5CX3 A;  1K52 A;  2XBB C;  2ZCB A;  4LNI A;  2KDE B;  2V3N A;  2D10 A;  3MHS D;  4W9D A;  1V6E A;  3OG5 A;  3UI3 A;  2SEB D;  2JY6 A;  5HKH A;  2LGI A;  2E6X A;  2XK5 B;  1WJ6 A;  2K0P A;  2WHI A;  3GZN I;  1C9F A;  1UD7 A;  2KT7 A;  4MAC A;  3AE1 B;  1KFY B;  2WXR A;  2PVO D;  2BVC A;  3TUO A;  1EWY C;  2O6V A;  2ASQ A;  3O65 B;  2ZW0 A;  3IT4 B;  2L83 A;  1ROE A;  1TIF A;  3DHG C;  1L4Z B;  2M19 A;  4DDI D;  2J0M A;  2JRI B;  2K25 A;  4C80 A;  1D5M C;  2LHD A;  5BMI A;  3NVV A;  1U4A A;  2HJ1 A;  3AM9 A;  5I4D A;  4AJY B;  2L1A A;  4E3C A;  2DLB A;  4YSZ B;  2NMQ A;  1ZW7 A;  1L5P A;  2WDT B;  4A3P A;  1TBE A;  1Y56 A;  1V5O A;  2Z0D B;  5AUK A;  4HKQ A;  1MHX A;  1WI0 A;  4HDO A;  1XXG A;  3SFD B;  3PZ7 A;  4HCP B;  3X0W A;  4FUL A;  2IZV B;  2KLC A;  4WIP A;  1TYG B;  3SEB A;  2AL3 A;  4WJQ A;  2KWD A;  1EUV B;  2QIE B;  3A9J B;  2CHX A;  4ASW C;  5AEK B;  3ZXV A;  2N7E A;  1SE4 A;  2IYD B;  4YT0 B;  3V62 A;  3W2D A;  2C9W B;  2IO1 B;  4LCD E;  1L4D B;  3M62 B;  1KRH A;  4BOZ B;  2WU5 B;  2K6Q A;  5HG2 A;  4HJG E;  2JXX A;  2BWF A;  1I7H A;  2LXC A;  4XC2 A;  2K1F A;  1V80 A;  4RM9 A;  1NDD A;  4HEA 1;  1I35 A;  1XF5 L;  2JYE A;  5IAA C;  3AN1 A;  4FXC A;  2NTS A;  1D3Z A;  2D2Q A;  2KN4 A;  1UZX B;  1WXM A;  3PPA A;  3K9O B;  1HTO A;  2RD0 A;  5AZF A;  1FNW A;  2L7R A;  4QAY A;  2WXM A;  3BY4 B;  2NCN A;  2JQR B;  1WMH B;  4A6Q A;  2QEJ C;  2RPQ A;  4URK A;  3BWU D;  2J7Q B;  3MFG A;  1IGD A;  3IT6 B;  4BBN C;  3LXF A;  4DBG A;  1WR6 E;  3ZNH B;  3N9Y C;  3PRZ A;  4JLC A;  4AQ7 A;  2BWE S;  2WYQ A;  3NJT A;  3ECI A;  2J53 A;  2B3A A;  2PPH A;  1WJU A;  3DBR I;  2KHW B;  3L0W B;  3A33 B;  1T5X D;  3NS8 A;  4ARC A;  1J7C A;  4C4V B;  2KWV B;  2R61 A;  5EE1 A;  2BW2 A;  1EU3 A;  4DXG A;  1WM3 A;  2KVR A;  3PRE A;  4ITK A;  4GGQ A;  1Q1O A;  4S17 A;  3GOE A;  3WIM A;  2M8S A;  3DBL I;  2MP2 A;  3RUL A;  3AE7 B;  1MG8 A;  4G50 A;  2Q5W D;  2KFK A;  3VR9 B;  3U2S C;  4B95 A;  4GN1 A;  1SJE D;  4HK2 A;  4KGS A;  4EOY A;  4YXD B;  1FCC C;  3V6E B;  4EZK A;  4WAA A;  2CJO A;  1DOX A;  1L6V A;  1N5X A;  1TZ1 A;  4XWW A;  1EM7 A;  3ALB A;  4ANV A;  5CHW A;  3ZW3 A;  2O6V B;  1E7P B;  1ZDV A;  1DYQ A;  2I1K A;  2LJ5 A;  2K8H A;  3RD2 A;  4MJS A;  3U7Z A;  1HZ6 A;  2D3C A;  4LLG M;  3ML8 A;  3Q3M C;  4GIV A;  3ZJV A;  2G9H D;  3NS1 A;  2N1W A;  2ZVN A;  4S0R A;  5G5G A;  4EUT A;  2CHW A;  3CF6 E;  3H7P A;  4M8M A;  3CST A;  4I6P A;  4NY0 A;  1JAL A;  2GI9 A;  2N1V A;  2LMC A;  2WLB A;  5D7G A;  4P1C C;  1QOF A;  1VJK A;  1E8Z A;  4KDI C;  4I6L B;  1YN4 A;  4JQW C;  3VRA B;  5IA7 A;  4EFO A;  4YTN B;  2EEL A;  4W9K A;  1KH0 A;  1M94 A;  3VVW B;  4H2A A;  4II3 B;  1UF0 A;  2MBE A;  1P1A A;  1C78 A;  1SE3 A;  2KX3 A;  3PV1 A;  1PGA A;  1R4M I;  2Z59 B;  3PZ8 A;  2PE6 B;  2LAS A;  2KWC A;  2JRH A;  1ENF A;  2QHO A;  1WR1 A;  2V9H A;  1JWA D;  2G3Q B;  2V1Y A;  1JRO A;  1ZDX A;  2N7D A;  2GMI C;  1IPG A;  2HE7 A;  4KSK C;  3I57 A;  4DWF A;  1GOZ A;  4JGH B;  4NJ6 A;  4BFR A;  2EMS A;  2DX5 B;  2OHF A;  3KYC D;  4HCN B;  5TSS A;  1K51 A;  2RMM A;  2BS2 B;  4K3C A;  5BMH A;  4M00 A;  4WWM A;  2AQ2 B;  5MPO A;  2DYO A;  3QQ8 B;  2KQ7 A;  5GXG B;  2GLS A;  2DWQ A;  1WY8 A;  1L0X B;  4ICV A;  2JVC A;  1YMH E;  2CHZ A;  4YSY B;  5CTR C;  2LXA A;  5DPT A;  4USA A;  2VH2 A;  1P98 A;  3W5V B;  5EE3 A;  5C23 A;  3GZN B;  4MH0 E;  4D2K A;  3C8Y A;  2NTT A;  4IDI A;  4DHJ B;  4KZC A;  4RGM A;  3HIZ A;  1FIQ A;  2H89 B;  2IPK D;  4FJY A;  5JXV A;  3EA6 A;  5BMG A;  4MGK E;  3VUX A;  3HM6 X;  4WUR A;  4IKG A;  3AU5 A;  4YTM B;  2IGD A;  2D07 B;  2GBK A;  1E7V A;  2WDR B;  2MA9 B;  2LGX A;  2D3B A;  4GLS C;  3NRZ A;  1ISN A;  5L83 A;  1WRD B;  4JWU C;  1KOT A;  4KGT A;  2LUE A;  5J17 A;  1SJH D;  3I9V 1;  4TQ0 A;  4DHZ B;  2LGS A;  3KWV A;  4O1N A;  4IM0 A;  1WX8 A;  1GB4 A;  3QHT A;  3VTW A;  1Q0W B;  2MSE D;  3A1Q A;  3X23 A;  1TGZ B;  4HDQ A;  4W9E A;  3ZXR A;  2CU1 A;  2MLB A;  4F8C B;  1QOG A;  1YQ4 B;  2MQJ A;  4IOI E;  2MP2 B;  5LNK 1;  3W1S C;  5DPW A;  3JYU A;  1SEB D;  2L3Z A;  2KFK B;  2QDF A;  4GXB A;  4IWP A;  1NEN B;  3L13 A;  4HPP A;  3KUC B;  2V3P A;  3R3M A;  4ZRJ A;  4Q2J A;  2WU2 B;  4AOF A;  4C7Y A;  2WQY B;  1E8W A;  2W3R A;  3UIP B;  3CIR B;  2KAN A;  2REX A;  1WIA A;  3WAO A;  2J4X A;  2JPH A;  3P4R B;  3EFU A;  2ONQ A;  4JPS A;  4AP4 C;  1CMX B;  3H7P B;  4BKS D;  2BS4 B;  2ZVO A;  3A9J A;  3M3J A;  3VFK A;  3VTV A;  2WWZ A;  5G2N A;  2NBV B;  4G0N B;  5AUI A;  2LRW A;  2I1J A;  5H92 C;  1OFF A;  1XEE A;  5JZE B;  1WE6 A;  1BT0 A;  3IVF A;  3OJ3 A;  1FFU A;  1V81 A;  4WJO A;  1JRP A;  2R2Q A;  5T8I A;  1RLF A;  4I6N B;  4P16 A;  3BVZ A;  2LD9 A;  1AN8 A;  5H8Y E;  3DWG C;  1N60 A;  3L16 A;  5IOI A;  1XLP A;  4ANU A;  1TS2 A;  4NAW A;  1M4V A;  1P7F A;  4AWJ A;  1B9R A;  3CMM B;  3NZ3 A;  3E9S A;  3VDZ A;  5D6J B;  2KKC A;  2LRU A;  3TJP A;  1R7S A;  2AEH A;  2L76 A;  3ENE A;  3M63 B;  3ZRF A;  2JUO A;  3QWZ B;  4ACF A;  1A5R A;  1PYW D;  3CSF A;  2PIA A;  5HI1 A;  4EKU A;  1YOV B;  2FCM A;  1QLB B;  5E6J A;  3DBR B;  1F9J A;  2KVZ A;  2JWZ A;  3KLS X;  2EMT A;  2BQQ A;  2N0S B;  3RPF C;  1JWU D;  3NG0 A;  1JRU A;  1UUP A;  1V8C A;  3T3O A;  1KLV A;  4RGO S;  2LHE A;  4B6W A;  4M02 A;  2WX1 A;  1P9D U;  2XNA C;  4TQ1 A;  3RI7 C;  1J8C A;  2EKE C;  4M0W A;  2C7N B;  2RSU A;  5CHV C;  5DPS A;  1WFY A;  3ZNG C;  3VXW A;  4MT5 A;  2IO0 B;  4LJO B;  3IHP C;  4HPL B;  1F2R C;  3MTN B;  3DBL B;  2L00 B;  2O6V D;  1PFD A;  3LYY A;  3IG3 A;  3ZIM A;  4C4V A;  2PJH A;  4KKJ A;  3V05 A;  2X38 A;  1NBF C;  2O2V A;  4B9K A;  3AE6 B;  2WXQ A;  1YN3 A;  1I4H A;  2QIL A;  1IYF A;  1C4C A;  4NQL B;  1E8X A;  4XGA B;  1EWC A;  2BS3 B;  2MX2 A;  2G4S A;  3RNF C;  2KJ6 A;  1Z5S B;  2DAF A;  2M1M A;  2BB6 A;  2BB5 A;  3SHQ A;  2K8B A;  4TV3 A;  2KTR B;  4BBN F;  2XEW A;  1FM0 D;  3EEC A;  4J6I A;  4WH4 A;  1ZUD 2;  1VR9 A;  2FIF A;  3AEE B;  2J52 A;  1ZP0 B;  4A3O A;  3V6C B;  1WM2 A;  1Y8R C;  3HRD D;  4ICU A;  3A1Q B;  2WNM A;  3AUL A;  1WGD A;  1E7U A;  4F7Z A;  3KW5 B;  1QF6 A;  4N6E B;  5C1Z A;  1AYF A;  4AUQ C;  3AE8 B;  1R4M B;  4OVV A;  1WH3 A;  1IP9 A;  1T0S C;  5TR5 A;  4HLE A;  2MH7 A;  3VH4 B;  2KLG A;  2CU3 A;  3AU4 A;  2HDE A;  1UWM A;  1MPE A;  3EC8 A;  4PK1 A;  1G6J A;  5JHB A;  2IJ0 A;  3ZGZ A;  3HK0 A;  1D6E C;  2KJH B;  1SIF A;  3ZQ4 A;  2LVQ A;  3I63 C;  4IC7 B;  2LVO A;  1HEZ E;  1EO6 A;  3VRB B;  1C1Y B;  2KX0 A;  1X1M A;  1R4N I;  2FCQ A;  2INN E;  4DHJ D;  1MJD A;  2BBC A;  3R2T A;  4FA6 A;  1PGB A;  2QCZ A;  1D5X C;  3APD A;  4WWO A;  1K53 A;  2KAJ A;  5D3D A;  1YX5 B;  4XDD A;  3K9P B;  3QK0 A;  3WAM A;  2UU7 A;  4W9G A;  3NZU A;  4NAW B;  4GB9 A;  3OWE B;  2MWS B;  1UH6 A;  4W9F A;  1XD3 B;  5C2T B;  3VHT C;  2KAC A;  4TSS A;  3ZRC A;  2CS4 A;  2W82 A;  4ANW A;  1XLN A;  2MJ3 A;  3H9D A;  3P42 A;  4ZRP A;  3VAW A;  2MHJ A;  2FID A;  3DCG A;  4MH8 A;  1A70 A;  3P4P B;  1N63 A;  3KYD D;  4FHJ A;  1ACC A;  4ARI A;  3BYT B;  3DVN U;  3PSE B;  3NHE B;  1VLB A;  1ZOY B;  1E9M A;  1ZKH A;  1V1P B;  2KTF A;  2KMA A;  3H8H A;  4M0W B;  5J18 A;  4HXD A;  1MHH E;  1SXT A;  1MG4 A;  1BML C;  4LTU A;  2DZI A;  4W9I A;  4GDL A;  4MGI E;  4CYE A;  3VQI A;  2N7J A;  2ZCC A;  3ZJU A;  1WF9 A;  1UBQ A;  1YD8 U;  2LWP A;  3ZTD A;  1BUI C;  1YN5 A;  1WJ4 A;  4PS3 A;  3VTU A;  3SR6 A;  3W1Y A;  2WXK A;  3V61 A;  3ZO5 B;  4OZC A;  2O2V B;  5IP4 D;  3UIN B;  1V5T A;  1T0Q C;  2NPT B;  1DOY A;  1OQR A;  4K7W A;  4ZOH C;  2WXG A;  2KXJ A;  3AEB B;  3URY A;  2C7H A;  3TL5 A;  2IDY A;  2V3S A;  3I3T B;  4WWN A;  2I2Y A;  2SAK A;  2HTM E;  1SGH A;  3PZD A;  2LFI A;  4GU2 A;  3TIX A;  2WXP A;  4HKZ E;  4RGN A;  3Q2A C;  4RNA A;  2ZZP B;  2NBU A;  3ZKJ C;  2WXH A;  3CWI A;  2EKI A;  1XO3 A;  1D5Z C;  4XYC A;  3RCZ A;  5E6O A;  2L52 A;  3SU8 X;  2DEN B;  1H8C A;  1WWT A;  2ZNV C;  3HVD A;  3L10 B;  2WDV B;  1J19 A;  3AEA B;  4FN2 A;  2FCS A;  2HD5 B;  2I38 A;  1TS5 A;  4CHK A;  1TKY A;  1B1Z A;  2ICI A;  4JIO U;  3N20 C;  4KX6 B;  4EZJ A;  1JWS D;  3UF8 A;  1OGW A;  3TEW A;  4GMV A;  3Q6B A;  1IUE A;  1RWS A;  3C19 A;  1NEK B;  3DVG X;  3APF A;  3FKY A;  5D94 A;  3N1Y C;  3MHZ A;  4IUM B;  1Q5W B;  4NPN A;  5HFY A;  4JX1 C;  3V3X A;  3Q3J A;  3Q69 A;  1NYQ A;  2IY1 B;  4YWG G;  1VCB A;  4K7S A;  3TEZ A;  2W54 A;  2N4F A;  3AE2 B;  3DDC B;  5BYS A;  1XQQ A;  1OEY J;  4TKN A;  2C7M B;  3H7S A;  1ZGU B;  1OQQ A;  2PEA A;  3B2G A;  2IBI B;  2JZP A;  3N32 A;  1GPX A;  1C4A A;  2HTH A;  3T3N A;  3OAW A;  1TTN A;  1JW9 D;  1V1O A;  2BKR B;  2W3S A;  4OVU A;  1QQR A;  4ZRK A;  5JH5 C;  1FXI A;  1I4P A;  4CQN A;  2JF5 A;  4G3X B;  3PHX B;  3PVL A;  1WXS A;  1V9J A;  4BAX A;  4KIK A;  2FBW B;  3JVZ X;  1FCL A;  1WRI A;  3HM3 A;  4N9F 4;  2BGF A;  1C4P A;  1BXT A;  1HQR D;  1SE2 A;  4ZHP A;  1KTK A;  5LXH A;  3QAR A;  3Q8C A;  1LGR A;  2KMC A;  2FCN A;  1CZP A;  2A5U A;  2LGD A;  3GS2 A;  2PE9 A;  2HJ8 A;  1WGY A;  1FNV A;  1F2R I;  3FIL B;  3APC A;  3WCQ A;  4ZDV A;  5E6P A;  4WJP A;  5BO4 B;  1WXQ A;  2KK8 A;  2RDB C;  2INC C;  2KZR A;  2PKO A;  1GC7 A;  1NI3 A;  4GDL B;  2PMV A;  4M8N A;  3GE3 C;  2Z0E B;  3JW0 X;  1T3Q A;  2GRI A;  1VD2 A;  1CQV A;  2XN9 C;  4W9J A;  3IAS 1;  2L05 A;  1IBX A;  3RNB C;  4UDU C;  2KTR A;  3MJ5 A;  1RM6 C;  5C3J B;  4DK5 A;  1QOA A;  3AXC A;  3A4R A;  5EE9 A;  1YX6 B;  4RH6 A;  5DCN A;  2KMM A;  4C56 C;  2IO3 B;  2N9L A;  4IWO A;  2LVP A;  1RYJ A;  2JZ3 B;  1LO5 D;  2E3T A;  2PTL A;  2K22 A;  4PS7 A;  4GOC A;  1I4R A;  3DBS A;  1HTQ A;  2FUH B;  3RFZ B;  2KC1 A;  3PLU A;  2ON8 A;  4BVU C;  5DPR A;  1R4N B;  4NAM A;  3QA8 A;  3QJZ A;  4L23 A;  1TKE A;  2KDI A;  1ZXH A;  1RRB A;  4DXA B;  2DHZ A;  1QOB A;  2N9X A;  5JHA A;  1V2Y A;  4WAF A;  1DGJ A;  1JCK B;  3U8Z A;  3NZS A;  4HJK A;  3R8B A;  1N61 A;  4LNF A;  3O13 A;  4W9H A;  3KWL A;  2KQ4 X;  4RCO A;  4DXF A;  4MSM B;  2C5L C;  3AH7 A;  1XCT L;  5IKC M;  3Q8B A;  4PS8 A;  5EDS A;  1AW7 A;  3EGR A;  3P4S B;  2NS5 A;  3LDZ E;  4K7U A;  2GOW A;  3Q8E A;  2GBM A;  3N1Z C;  4LJP B;  2FE8 A;  2DYB A;  1GG3 A;  1ET9 A;  3R66 C;  1SIJ A;  2JXT A;  4MDK E;  1MI0 A;  4YL8 A;  1C79 A;  4HPM B;  4LDT B;  2K9X A;  2BYE A;  3U52 E;  3BK2 A;  2G45 B;  1GAQ B;  2L8J A;  2WS3 B;  1YQ3 B;  3DOW A;  3N3K B;  2IND C;  3Q8A A;  3RZF A;  4LNO A;  2BKF A;  1UGM A;  4EE2 A;  1YJ1 A;  2Y5B B;  4YTP B;  2DNF A;  1XT9 B;  4REZ A;  4MSQ B;  2D3G A;  2KFJ A;  1QKZ A;  5G55 A;  3U4E G;  3KQ4 A;  3VUY A;  3RN9 C;  4KIK B;  4A90 A;  2JZZ A;  2LJI A;  3AB5 A;  1V1P A;  1P0R A;  5D2M B;  1WJN A;  3U30 A;  1SSN A;  3MP9 A;  2GB1 A;  2Y3A A;  3R2I A;  1F0Z A;  1MFW A;  2JYT A;  1LXD A;  1Q10 A;  3RNG C;  4EZL A;  3SFE B;  1CK1 A;  4DDG D;  4B0M A;  3DVG Y;  3SD5 A;  1FEH A;  2OJR A;  2ZEQ A;  3UQA A;  1EU4 A;  1TJE A;  2NPT A;  1SBB B;  1E5W A;  3SDL C;  1I4G A;  1V49 A;  3EFC A;  1MVK A;  3IFW B;  5HHD G;  3AMZ A;  1IBX B;  2WXO A;  3J9C A;  3RNC C;  1WZ0 A;  3ZJT A;  4KZ0 A;  2WXF A;  3TSS A;  4ZYS A;  3H1U A;  4OHJ A;  2V4I B;  2WXL A;  3NOB A;  4WWP A;  3U7D A;  3NUH B;  1EF5 A;  3ZDM C;  1FXA A;  3ML9 A;  4FJV B;  2RPV A;  3B0A A;  2M0A A;  3M95 A;  1T6B X;  2Y5P A;  3AEF B;  4K3B A;  1AWD A;  3NVW A;  2V4L A;  2INP E;  2QMT A;  4LK0 M;  4ZHO A;  2ZJD A;  4LNK A;  3TMP B;  3JSV A;  2BYF A;  5G5H A;  2MJE A;  4K81 A;  3PLV A;  3PRP B;  2J0J A;  1HZ5 A;  1E10 A;  4IM3 A;  2ACZ B;  2KDM A;  1T0Y A;  1ZXI A;  3QAQ A;  3NY5 A;  2VH1 A;  4KVG B;  1YQB A;  3VR8 B;  1N5W A;  1F52 A;  4NJ7 A;  3DQV A;  3PT2 B;  4KSL C;  4TMA B;  4FAD A;  1TS4 A;  4GSW A;  3WAP A;  1WYG A;  1D4B A;  3GB1 A;  3E56 A;  1KLU D;  5FKA C;  4L1B A;  2FAZ A;  1J7A A;  5IO9 A;  3T8M A;  1LQB A;  1KLG D;  1RAX A;  2J42 A;  2WXJ A;  2MJD A;  1S1Q B;  4ZYN A;  4G11 A;  4X57 B;  1TT5 B;  4P1B C;  4XX5 A;  2KC2 A;  3MC8 A;  2JSV X;  1YIW A;  3AI5 A;  2B76 B;  2AQ1 B;  3B2F A;  5J2R A;  3W9C B;  3RT3 B;  1NI2 A;  2AQ3 B;  1S3S G;  1VZ6 A;  2QC8 A;  1UEL A;  3MJW A;  2BTE A;  4TUU A;  2GBJ A;  2W55 A;  1XLQ A;  4F1S A;  2AYO B;  4BKT A;  1QIL A;  4PT5 A;  5FK9 C;  2IO2 B;  1KJT A;  2KYW A;  2G4D B;  3BII D;  1OEY A;  1L7Y A;  3ZNI D;  2K3U A;  2N9P C;  5LXI B;  1E8Y A;  1GUA B;  2GBR A;  2R2O A;  3Q14 C;  1LM8 B;  2D11 A;  3Q3N C;  2WDQ B;  1JQ4 A;  4A20 A;  4II2 B;  3PO0 A;  1PQS A;  3FIL A;  3AE5 B;  1FRR A;  2YEP F;  3PRM B;  3ONS A;  1PDX A;  3AEG B;  3RZW C;  1I42 A;  1VZ7 A;  4NNJ B;  2PLP A;  5FR6 A;  1UNS A;  3AEC B;  2V0G A;  1RFA A;  1WX9 A;  3T9L A;  2LUM A;  3QIJ A;  4M01 A;  3V60 A;  3BVG A;  4PYZ A;  1L0V B;  4C7Z A;  1FMA D;  4US9 A;  1I4X A;  2YVC A;  3DHI C;  1HA5 A;  2VZK B;  2N9K A;  3DBH I;  4ZRI A;  5KHO A;  3DPD A;  2L0T A;  2JT4 B;  4RF0 A;  2W9N A;  3TEX A;  1I4Q A;  5EE0 A;  3ZDT A;  4XE0 A;  4MEM A;  2MCN B;  2DBY A;  1GNU A;  2KDB A;  3AE4 B;  4IM2 A;  2QSD A;  1WYW B;  3EUB 2;  4FLH A;  2JX5 A;  1SE9 A;  5D3I B;  4BZA A;  1KM7 A;  1PGX A;  1WGR A;  4PYU A;  4IWQ A;  3HHM A;  3B08 A;  2OJW A;  3P1M A;  4LNN A;  2KD0 A;  2KQS A;  1T0R C;  2IY0 B;  4J3O D;  4LDT D;  3I5J C;  1WE7 A;  4HRO A;  3N30 A;  4MGZ E;  1VRA B;  3RYT A;  1P3Q U;  1YNT E;  1AAR A;  1N62 A; 
#chains in the Genus database with same CATH homology
 3A9J B;  2CHX A;  1JRU A;  4ASW C;  4NQK E;  5AEK B;  3ZNZ B;  2N7E A;  1KLV A;  2L05 A;  2KTR A;  2IYD B;  3PHW B;  4DK5 A;  3V62 A;  4B6W A;  2MBB B;  3AXC A;  3A4R A;  2WX1 A;  1P9D U;  2GBN A;  3IBE A;  3JSV B;  4TQ1 A;  2C9W B;  1J8C A;  2IO1 B;  3A9K A;  2EKE C;  4LCD E;  2DZK A;  2C7N B;  2RSU A;  3M62 B;  5CHV C;  5DPS A;  2L0F A;  4BOZ B;  1WFY A;  3ZNG C;  3VXW A;  2KO3 A;  2K6Q A;  1YX6 B;  5DCN A;  2IO0 B;  2UYZ B;  3IHP C;  4LJO B;  4DHZ E;  2IO3 B;  4HPL B;  4IWO A;  3L08 A;  3MTN B;  4E71 A;  2JXX A;  2BWF A;  2L00 B;  2LVP A;  2LXC A;  2JZ3 B;  2K1F A;  4XC2 A;  2O6V D;  1V80 A;  2RGF A;  3IG3 A;  4RM9 A;  3DVN V;  3ZIM A;  1NDD A;  2LGY A;  2PJH A;  1I35 A;  4PS7 A;  4WJN A;  2K8C A;  4GOC A;  5IAA C;  2KOX A;  3DBS A;  4XZ4 A;  2FUH B;  4E74 A;  1NBF C;  2KC1 A;  2N9E B;  2O2V A;  4B9K A;  3PLU A;  1D3Z A;  4BVU C;  2D2Q A;  2YLM A;  2NBW B;  5DPR A;  1UZX B;  1IYF A;  1WXM A;  3QA8 A;  3QJZ A;  3PPA A;  3K9O B;  4IW0 A;  2DAJ A;  2RD0 A;  4BKG A;  1V86 A;  1E8X A;  4NQL B;  5AZF A;  2L7R A;  2MBQ A;  5LLI A;  2KDI A;  2MX2 A;  2KWU B;  1RRB A;  4DXA B;  2NR2 A;  2G4S A;  3BY4 B;  2DHZ A;  2N9X A;  2NCN A;  5JHA A;  1V2Y A;  1WMH B;  2KJ6 A;  1Z5S B;  2UWQ A;  2DAF A;  3QX1 A;  2DYM A;  2RPQ A;  3LJ3 A;  2M1M A;  4URK A;  3U8Z A;  2J7Q B;  3NZS A;  4HJK A;  3SHQ A;  2K8B A;  4TV3 A;  2KTR B;  4W9H A;  4BBN F;  2XEW A;  3EEC A;  4J6I A;  4BBN C;  2FIF A;  2MRP A;  3KH0 A;  4DBG A;  1WR6 E;  3ZNH B;  4A3O A;  3PRZ A;  2K6D B;  4MSM B;  2C5L C;  4JLC A;  3V6C B;  1WM2 A;  1Y8R C;  2BWE S;  4ICU A;  3A1Q B;  4PS8 A;  3AUL A;  2WYQ A;  4K1R B;  5EDS A;  1WGD A;  3ECI A;  1E7U A;  3RUI B;  2NS5 A;  4F7Z A;  2M0X A;  2B3A A;  5CHF A;  3KW5 B;  2PPH A;  1WJU A;  3LDZ E;  4K7U A;  2GOW A;  3DBR I;  5C1Z A;  2KHW B;  3L0W B;  3A33 B;  4KDL B;  4HWI B;  4AUQ C;  3NS8 A;  2GBM A;  2KWV B;  4LJP B;  1H4R A;  2VRR B;  2DYB A;  1GG3 A;  4OVV A;  1WH3 A;  3R66 C;  4AJW A;  1WM3 A;  4MDK E;  2KVR A;  2ZPY A;  1IP9 A;  3PRE A;  4YL8 A;  4MEL A;  3KUD B;  4HPM B;  4LDT B;  5TR5 A;  4HLE A;  3ZUN A;  3VH4 B;  2KLG A;  1WGH A;  2BYE A;  4GGQ A;  4RM8 A;  5E6N A;  3TCA A;  2G45 B;  3AU4 A;  3W1S A;  1QZE A;  2L8J A;  1Q1O A;  3EC8 A;  3DOW A;  3N3K B;  3GOE A;  4GDK A;  3RZF A;  3WIM A;  2M8S A;  2BKF A;  1UGM A;  1OQY A;  1G6J A;  3DBL I;  5JHB A;  1YJ1 A;  2MP2 A;  1GC6 A;  2DZM A;  3RUL A;  1MG8 A;  1HE8 A;  1WZ3 A;  4G50 A;  3HK0 A;  2Y5B B;  2KFK A;  2ZPN A;  2OOB B;  2KJH B;  2WX0 A;  4GN1 A;  4B95 A;  1SIF A;  1XT9 B;  2LVQ A;  4HK2 A;  4MM3 A;  4EOY A;  3KUZ A;  4MSQ B;  3V6E B;  4EZK A;  4IC7 B;  2DZJ A;  2LVO A;  2D3G A;  2KFJ A;  4WAA A;  5G55 A;  1TZ1 A;  1WGG A;  2ZNV B;  4ANV A;  1EO6 A;  3ALB A;  5CHW A;  3VUY A;  3ZW3 A;  1C1Y B;  2O6V B;  2LZ6 A;  4KIK B;  2I1K A;  2LJ5 A;  1EF1 A;  2JZZ A;  2K8H A;  2KX0 A;  1X1M A;  1R4N I;  4MJS A;  3RD2 A;  2FCQ A;  4DHJ D;  1P0R A;  4FBJ B;  5D2M B;  1WX7 A;  3ML8 A;  4GIV A;  4KV2 A;  5KHQ A;  1WJN A;  3U30 A;  4FA6 A;  5GMV A;  3UGB B;  2N1W A;  2ZVN A;  4EUT A;  3TBL D;  2AWT A;  2CHW A;  3CF6 E;  3APD A;  1C3T A;  2XK5 A;  3H7P A;  4WWO A;  4M8M A;  3L17 A;  3CST A;  1YX5 B;  4I6P A;  3P2B A;  3H6N A;  3K9P B;  3QK0 A;  4NY0 A;  3WAM A;  4W9G A;  3D32 A;  1LXD A;  3NZU A;  4NAW B;  2N1V A;  3PGE A;  4EZL A;  5D7G A;  1LFD A;  4DDG D;  4GB9 A;  2MWS B;  1E8Z A;  1UH6 A;  4KDI C;  4W9F A;  3DVG Y;  3WAN A;  4I6L B;  4JQW C;  1XD3 B;  3SD5 A;  5IA7 A;  2OJR A;  4EFO A;  2ZEQ A;  3VHT C;  3UQA A;  2KNB A;  3Q3F A;  2A4Z A;  2NPT A;  4MGY E;  4W9K A;  3ZRC A;  1M94 A;  1GJZ A;  2CS4 A;  3VVW B;  4II3 B;  2MBE A;  1E5W A;  1P1A A;  4ANW A;  3SDL C;  2KX3 A;  3B1L X;  1V49 A;  3PV1 A;  3H9D A;  1R4M I;  2Z59 B;  3VAW A;  2FID A;  3DCG A;  2PE6 B;  3IFW B;  2LAS A;  3KYD D;  2KWC A;  4FHJ A;  3UQB A;  4RMA A;  2MBO A;  2JRH A;  2QHO A;  3DVN U;  3PSE B;  1WZ0 A;  3NHE B;  4KZ0 A;  4CO7 A;  5AZG A;  1WR1 A;  5AZH A;  3KVF B;  4MJS B;  4JL9 A;  3H1U A;  1ZKH A;  2G3Q B;  2KMA A;  2KTF A;  2V1Y A;  3A9K B;  4M0W B;  5J18 A;  3U7D A;  3NOB A;  4WWP A;  4HXD A;  2N7D A;  2C60 A;  2GMI C;  3ZTC A;  1EF5 A;  1IPG A;  4WQO B;  3ZDM C;  2DZI A;  4W9I A;  2HE7 A;  3ML9 A;  4GDL A;  2RR9 A;  1K8R B;  4FJV B;  4MGI E;  3B0A A;  4KSK C;  3VQI A;  4CYE A;  3PS6 A;  2ZCC A;  4DWF A;  3M95 A;  1UBI A;  1WF9 A;  4JGH B;  4NJ6 A;  1UBQ A;  1YD8 U;  2LWP A;  4P7I A;  2EMS A;  3ZLZ A;  3ZTD A;  4BFR A;  3A4S C;  2DX5 B;  3KYC D;  1WJ4 A;  2CR5 A;  4HCN B;  4PS3 A;  2M4N A;  3VTU A;  3QCA A;  1WXA A;  2V4L A;  1E90 A;  2ZJD A;  3W1Y A;  2DYO A;  3OLM D;  3QQ8 B;  2KQ7 A;  3V61 A;  3TMP B;  3ZO5 B;  3JSV A;  2BYF A;  2LI5 A;  2O2V B;  4EEW A;  3UIN B;  3WAL A;  1V5T A;  1WY8 A;  4K81 A;  3PLV A;  3PRP B;  2J0J A;  4ICV A;  3R7Q A;  2NPT B;  4IM3 A;  2J0K A;  2AL6 A;  5L95 C;  1FXT B;  2JVC A;  2CHZ A;  4K7W A;  3S2A A;  5CTR C;  1T0Y A;  2LXA A;  2KXJ A;  5DPT A;  3QAQ A;  3NY5 A;  4KVG B;  3WA0 A;  1P98 A;  2C7H A;  3TL5 A;  1YQB A;  2V3S A;  3I3T B;  5C23 A;  4MH0 E;  4DHJ B;  4BOS C;  4WWN A;  4NJ7 A;  3DQV A;  2M17 A;  4KZC A;  1SGH A;  3PZD A;  3HIZ A;  2CKH B;  3PT2 B;  4GU2 A;  4KSL C;  3TIX A;  4FJY A;  1L2N A;  4FAD A;  3OJ4 B;  4GSW A;  3WAP A;  2BYV E;  2MW5 A;  2BPS A;  4MGK E;  3R7R A;  3VUX A;  3HM6 X;  2ZZP B;  2NBU A;  1OTR B;  1WXV A;  3ZKJ C;  3AU5 A;  4BKS A;  2FAZ A;  3PTF C;  3EHV A;  3VH3 B;  2D07 B;  4ANX A;  2GBK A;  1E7V A;  2MBH A;  3RCZ A;  5E6O A;  3UIO B;  3T8M A;  1J0G A;  2MA9 B;  2LGX A;  1LQB A;  3SU8 X;  2DEN B;  3ZVV A;  1RAX A;  2KN5 A;  1ISN A;  1H8C A;  5L83 A;  2ZNV C;  3L10 B;  1WRD B;  1S1Q B;  1J19 A;  4ZYN A;  4FN2 A;  3VUW A;  1WMH A;  1KOT A;  2FCS A;  4G11 A;  4X57 B;  2LUE A;  4XX5 A;  5J17 A;  2HD5 B;  2BF8 B;  4TQ0 A;  4HVB A;  4DHZ B;  2KC2 A;  4CHK A;  4JIO U;  4IM0 A;  1WX8 A;  1YIW A;  3AI5 A;  4EZJ A;  2KDF B;  3UF8 A;  3BIN A;  1OGW A;  3L54 A;  5J2R A;  3RT3 B;  4FJZ A;  1NI2 A;  2FNJ B;  4GMV A;  3QHT A;  1S3S G;  3C0R B;  1UEL A;  2K39 A;  3VTW A;  1Q0W B;  3MJW A;  3DVG X;  2MSE D;  3APF A;  4TUU A;  1Z2M A;  3A1Q A;  3X23 A;  1TGZ B;  4HDQ A;  4W9E A;  5D94 A;  2GBJ A;  4F1S A;  2AYO B;  4BKT A;  2CU1 A;  2MLB A;  4F8C B;  4IUM B;  4GDK B;  1Q5W B;  4FHK A;  4NPN A;  2IO2 B;  2MQJ A;  1KJT A;  4IG7 B;  2KJR A;  3Q3J A;  4W9C A;  2MP2 B;  2G4D B;  3W1S C;  5DPW A;  3JYU A;  1OEY A;  2IY1 B;  1L7Y A;  3ZNI D;  2L3Z A;  2KFK B;  1VCB A;  2N9P C;  3QC8 B;  4K7S A;  5LXI B;  4GXB A;  4IWP A;  1E8Y A;  1GUA B;  2N4F A;  3L13 A;  2GBR A;  3DDC B;  2R2O A;  3KUC B;  4W9L A;  1LM8 B;  2D11 A;  1XQQ A;  1OEY J;  3R3M A;  4TKN A;  4ZRJ A;  2NVU I;  4A20 A;  4II2 B;  2C7M B;  3H7S A;  4AOF A;  1PQS A;  1ZGU B;  5CX3 A;  2PEA A;  2XBB C;  1E8W A;  3UIP B;  3PRM B;  2ZCB A;  3ONS A;  2KAN A;  2KDE B;  2IBI B;  3RZW C;  2REX A;  3N32 A;  1WIA A;  1I42 A;  2D10 A;  3WAO A;  3MHS D;  4W9D A;  2HTH A;  1V6E A;  2JPH A;  3EFU A;  3OAW A;  4NNJ B;  1TTN A;  2BKR B;  4AP4 C;  5FR6 A;  4OVU A;  2JY6 A;  5HKH A;  1CMX B;  1RFA A;  2XK5 B;  1WJ6 A;  1WX9 A;  3H7P B;  3T9L A;  3GZN I;  1UD7 A;  4ZRK A;  4BKS D;  5JH5 C;  3QIJ A;  2JF5 A;  4G3X B;  2ZVO A;  3V60 A;  3A9J A;  3PHX B;  3M3J A;  3VFK A;  3VTV A;  2WWZ A;  4PYZ A;  3PVL A;  1WXS A;  1V9J A;  5G2N A;  2NBV B;  4G0N B;  2LRW A;  2YVC A;  2I1J A;  2O6V A;  4KIK A;  2ASQ A;  5JZE B;  3O65 B;  3JVZ X;  1WE6 A;  1BT0 A;  3IVF A;  3HM3 A;  3OJ3 A;  1V81 A;  4WJO A;  2R2Q A;  4N9F 4;  2BGF A;  3DBH I;  1RLF A;  4ZRI A;  4DDI D;  2J0M A;  2JRI B;  2K25 A;  4I6N B;  5LXH A;  3QAR A;  5KHO A;  3DPD A;  2LD9 A;  2L0T A;  2JT4 B;  2W9N A;  1U4A A;  2KMC A;  2FCN A;  4AJY B;  4E3C A;  2A5U A;  3ZDT A;  1ZW7 A;  2LGD A;  3L16 A;  4A3P A;  2WDT B;  2PE9 A;  4NAW A;  4ANU A;  2HJ8 A;  4MEM A;  2MCN B;  1WGY A;  1GNU A;  2KDB A;  4IM2 A;  4AWJ A;  1TBE A;  1V5O A;  3APC A;  2Z0D B;  3CMM B;  1WYW B;  4ZDV A;  3VDZ A;  1WI0 A;  5E6P A;  4FLH A;  4WJP A;  1SE9 A;  5BO4 B;  5D6J B;  4HDO A;  2KK8 A;  2KKC A;  1KM7 A;  1WGR A;  4PYU A;  2LRU A;  4IWQ A;  3TJP A;  3HHM A;  3B08 A;  2KZR A;  2AEH A;  2L76 A;  3ENE A;  3M63 B;  4HCP B;  2JUO A;  3ZRF A;  3QWZ B;  3X0W A;  1A5R A;  4FUL A;  2IZV B;  1GC7 A;  2KD0 A;  2KQS A;  2KLC A;  3CSF A;  2IY0 B;  4EKU A;  2FCM A;  4GDL B;  1F9J A;  4LDT D;  4M8N A;  1WE7 A;  2Z0E B;  2JWZ A;  3JW0 X;  2EMT A;  2AL3 A;  1VD2 A;  3N30 A;  4MGZ E;  4WJQ A;  3RYT A;  4W9J A;  1P3Q U;  1EUV B;  1AAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...