2DZKA

Structure of the ubx domain in mouse ubx domain-containing protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
GSSGSSGRDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDILMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBX domain-containing protein 2
publication title Structure of the UBX domain in Mouse UBX Domain-Containing Protein 2
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dzkA01
4W9EA 3HK0A 4BKGA 1WGYA 1NDDA 2DZMA 2JZ3B 1WI0A 2LXCA 2NR2A 2RD0A 4AWJA 1BT0A 1S3SG 3PRMB 2G3QB 2DYMA 2K1FA 2L0FA 3U8ZA 3DBHI 1JRUA 2O6VD 3ZTCA 2NCNA 4BOSC 1LXDA 4PYUA 2KX0A 2NBVB 4IUMB 4NPNA 5TR5A 3EFUA 3R66C 1ISNA 4HLEA 3P2BA 4TQ0A 4LJOB 4AJWA 4JGHB 2KO3A 2LGDA 2MBEA 4MSMB 4W9CA 3KUCB 1OTRB 1LM8B 2NPTB 2I1JA 2IZVB 3NY5A 1TZ1A 1WM3A 4CHKA 1WZ3A 3WA0A 4ZRJA 4DDGD 2J0JA 3LDZE 2KXJA 3HM6X 5CHVC 3VUYA 4MDKE 2JPHA 4URKA 3V60A 2MCNB 3PLUA 2AYOB 4FJVB 4ZYNA 1M94A 3RZFA 2N4FA 4GOCA 2M17A 1WX8A 2FAZA 5D2MB 5IAAC 3V6CB 2K6DB 2N1WA 1WR6E 3QJZA 4ZDVA 2K8HA 2WX0A 4WJPA 4N9F4 3HHMA 2MX2A 3U7DA 1WJNA 1H4RA 1J8CA 2ZPYA 1WMHB 2KQSA 1AARA 3SHQA 3BINA 3CMMB 2JXXA 3H6NA 1P1AA 3I3TB 1WGRA 4K1RB 4OVUA 2QHOA 2L05A 2LWPA 4DBGA 3O65B 4AOFA 3DVNU 5J18A 1IP9A 3QA8A 4MM3A 2ZNVB 2AL3A 2KJHB 4LJPB 2NBUA 3B1LX 5JHBA 1WE7A 4ANXA 3L16A 3V62A 1ZKHA 4IG7B 1WXSA 2MBQA 2LGYA 3A9JA 1WRDB 1XQQA 4HPLB 2O2VB 1V80A 3LJ3A 4NJ7A 2M4NA 2N7EA 4K7SA 4MGZE 4CO7A 5CHFA 5E6OA 5L95C 1A5RA 1EF1A 2IBIB 2JWZA 4HXDA 3EC8A 3KVFB 3UQAA 4GDKA 3A33B 3WAPA 2FCMA 4GN1A 2Y5BB 2Z59B 4WWPA 5E6PA 1Q0WB 1WH3A 5DCNA 3MJWA 3H7PB 2M8SA 4HK2A 1KM7A 3ZVVA 3QX1A 5AEKB 2BGFA 2KTRB 1Y8RC 4MELA 3RUIB 5EDSA 3VDZA 1E90A 4LDTB 3APCA 1CMXB 1XD3B 2BWES 4EEWA 4P7IA 3ZNHB 5J17A 1R4MI 3APFA 3JSVB 1D3ZA 3NS8A 2GOWA 2HJ8A 3L0WB 4F8CB 4KDLB 1TTNA 2V4LA 4EUTA 1WGHA 3SD5A 4EZJA 4BOZB 3ALBA 1E7VA 3MHSD 5D7GA 3Q3FA 2WWZA 2R2OA 2FCNA 2LI5A 3M62B 4FLHA 3NHEB 4KSKC 4HVBA 4HJKA 1R4NI 1J0GA 2KX3A 1WYWB 4MJSA 3JYUA 2N9XA 5DPWA 3WANA 5G2NA 4A20A 1V81A 2MW5A 3WIMA 4GMVA 1YX5B 2DX5B 2AWTA 3EECA 3IBEA 3CF6E 1Q1OA 4K7WA 3PPAA 2CR5A 2LGXA 1P98A 2NPTA 4KZCA 1SE9A 3WAMA 4GDLA 1V86A 2M0XA 2M1MA 2FCQA 2KWCA 2A5UA 3JW0X 3DVGX 3QARA 2BPSA 1WIAA 1YX6B 2KFKB 3PZDA 2MLBA 1UGMA 3N3KB 3R3MA 4M8MA 4LCDE 4HCNB 1G6JA 2L8JA 2LVPA 4KDIC 4XC2A 5LXHA 2C5LC 2IO2B 2I1KA 2KDEB 2HTHA 3ZRFA 4FULA 1RFAA 1V5OA 4HCPB 3VVWB 2DAFA 2KKCA 2BYEA 3WAOA 2LRWA 1GC7A 2G45B 2L76A 2KN5A 4KIKA 3TCAA 2ZVNA 3DBSA 2FUHB 2BWFA 1V6EA 4E74A 1SIFA 4GSWA 1H8CA 2MWSB 4MGYE 4FA6A 3ZNGC 3RZWC 2KANA 3ML9A 3U30A 3VXWA 3ZDMC 2BKRB 3RT3B 4AJYB 1OQYA 2KDFB 1E8XA 4B9KA 2EMTA 3R7QA 3WALA 1X1MA 3X23A 3VUWA 2KNBA 3QK0A 3S2AA 1C3TA 4HDQA 4WQOB 2D07B 2V3SA 3DVNV 3VH3B 1C1YB 3QC8B 3HM3A 3PRZA 2N1VA 4FJZA 3NZUA 2C7MB 3VTWA 1V5TA 4NNJB 1I42A 2IO1B 2C7HA 3PHXB 4NAWA 2XEWA 1V9JA 4DWFA 4IM3A 3PREA 4KSLC 2NVUI 3IFWB 3QWZB 2O2VA 3PRPB 2DYOA 1WFYA 1WJ6A 2MSED 4W9KA 4PS8A 2DZJA 4YL8A 4ANWA 3C0RB 1WE6A 3OLMD 5CHWA 2ZJDA 3IVFA 3VAWA 2Z0EB 3A1QA 1ZW7A 3UIPB 2D3GA 4TKNA 4B6WA 1SGHA 3ENEA 3ZIMA 3OJ3A 5AZHA 3A4RA 1E8ZA 2DAJA 3A9KA 3H7PA 5DPRA 2D2QA 3DBRI 2KTRA 1WJ4A 1GJZA 4J6IA 2FCSA 2KLCA 2CKHB 1K8RB 3PLVA 2R2QA 3GOEA 4KV2A 2PPHA 2W9NA 3M95A 4ZRIA 1GNUA 2LASA 1IPGA 2G4SA 2DZKA 2G4DB 2IY0B 4FHJA 1EUVB 3H9DA 4TV3A 3OAWA 3ML8A 4NY0A 1YJ1A 4DHJD 4EKUA 5KHQA 1E7UA 2EKEC 1PQSA 2PE9A 4G3XB 3IG3A 3VHTC 1NBFC 1WXAA 4IWQA 1HE8A 4W9FA 3AULA 2XK5B 3KUZA 5AZFA 2DZIA 3D32A 2KWVB 4IC7B 3RYTA 2RR9A 4DK5A 2LRUA 2MP2A 2O6VB 2OJRA 3TL5A 4EOYA 4W9IA 5D6JB 2GBMA 2V1YA 2N9PC 3L17A 3UIOB 4EZKA 2IO3B 4PS7A 4BBNC 4M0WB 3ZTDA 1I35A 2K39A 1UH6A 2B3AA 1LQBA 5GMVA 5IA7A 3KW5B 3DDCB 4HWIB 3PTFC 1WXMA 2ZCBA 4XX5A 4GXBA 5D94A 3VH4B 2GBRA 3DBLI 4F1SA 3TIXA 2ZVOA 4II3B 1GUAB 1MG8A 2KLGA 2AL6A 3KYDD 4TUUA 3SDLC 3QAQA 2K6QA 4I6NB 1IYFA 1E8YA 3KYCD 4W9HA 1XT9B 3PS6A 2ASQA 3R7RA 1NI2A 1Z5SB 2GBKA 3ZRCA 2FNJB 4BKSA 4GGQA 3VUXA 3B0AA 5HKHA 2AEHA 2JRIB 5C1ZA 3B08A 1P0RA 2KJRA 4EZLA 1YIWA 3VTVA 2GBNA 2KTFA 3K9PB 4ICVA 3BY4B 3EHVA 4G11A 2J7QB 2KWUB 4W9JA 3AU5A 2HE7A 2CHXA 4A3OA 4MSQB 1S1QB 2IO0B 3JVZX 2Z0DB 3QIJA 4IWPA 4GU2A 2JZZA 2J0KA 3T8MA 3ZO5B 3VFKA 2YVCA 4NJ6A 2RSUA 2BYVE 2K8BA 2KK8A 1WF9A 2RGFA 3PV1A 2JVCA 4X57B 3V61A 3ZW3A 4MH0E 3NOBA 1VCBA 5L83A 4WJQA 5DPTA 2MBHA 3UGBB 2DYBA 3AXCA 3W1SA 3CSFA 5CTRC 3UINB 4FADA 3X0WA 3PSEB 3CSTA 2GBJA 2KDBA 2MQJA 1WX9A 4ICUA 2KMCA 1U4AA 3DOWA 4IW0A 2UWQA 1V49A 4JQWC 2BKFA 1OEYA 2ZZPB 4I6PA 5JHAA 1UD7A 2BYFA 2UYZB 4M8NA 1WJUA 3TJPA 1WMHA 2DENB 5AZGA 1Z2MA 2YLMA 3PHWB 2LD9A 2MBBB 1F9JA 2ZNVC 4MJSB 3W1YA 2J0MA 4RM9A 5CX3A 4LDTD 5C23A 3UQBA 1LFDA 4WAAA 4DHJB 1FXTB 4AP4C 4IWOA 4B95A 4JL9A 2HD5B 4JIOU 5J2RA 5JZEB 1WXVA 2MRPA 4NQKE 5G55A 1V2YA 4FN2A 4WJNA 4FBJB 3DQVA 2CS4A 4GDLB 3ZLZA 1OGWA 3APDA 3SU8X 2C9WB 1P3QU 2GMIC 5BO4B 1EF5A 1KOTA 1RLFA 2D10A 4MGIE 2NBWB 2WYQA 3AI5A 2CU1A 2L7RA 3AU4A 3KUDB 3H7SA 3UF8A 5JH5C 3VTUA 3V6EB 1WY8A 5FR6A 4NQLB 3ZNID 1TBEA 2C7NB 4I6LB 2KDIA 3HIZA 4OVVA 1ZGUB 2IYDB 3RD2A 3N30A 3VQIA 3ZUNA 1L7YA 3A4SC 1UELA 1VD2A 4KIKB 4A3PA 2WDTB 2KOXA 2XK5A 2JF5A 1RRBA 2LXAA 4GB9A 4IM2A 3M3JA 2O6VA 3PGEA 3ECIA 5LLIA 4W9LA 1E5WA 1TGZB 2RPQA 1KJTA 2JY6A 2VRRB 2OOBB 4KVGB 4BKSD 1P9DU 1T0YA 3JSVA 1WGGA 2KHWB 4EFOA 4G0NB 2KC2A 4HDOA 4E71A 2REXA 4ANVA 1L2NA 3PT2B 4MEMA 2WX1A 2KFJA 1GC6A 2PE6B 2KMAA 3TBLD 3MTNB 4PS3A 2MA9B 5KHOA 3KH0A 2EMSA 2ZCCA 1WZ0A 3QHTA 5E6NA 3Q3JA 3K9OB 3ONSA 2MBOA 2PEAA 4NAWB 4F7ZA 4II2B 2KC1A 4IM0A 3DPDA 2LJ5A 2L00B 4BBNF 4W9GA 2L3ZA 4DDID 1KLVA 4CYEA 3RULA 1OEYJ 3L13A 4BFRA 4RM8A 4K7UA 3ZNZB 4AUQC 2D11A 4HPMB 2CHZA 2KD0A 3A1QB 4GIVA 3TMPB 2JRHA 2K25A 3RCZA 2LUEA 4MGKE 3H1UA 4K81A 4ZRKA 2N9EB 1EO6A 1Q5WB 4PYZA 3L10B 3L08A 3A9KB 1WGDA 2JT4B 2NS5A 2XBBC 3PVLA 2K8CA 4WWOA 3M63B 1GG3A 1UZXB 3NZSA 3QCAA 1UBQA 1WX7A 2C60A 2JUOA 3A9JB 2KFKA 3T9LA 2KZRA 2LZ6A 5LXIB 2KQ7A 2DHZA 2LVOA 3DVGY 2L0TA 1J19A 1WM2A 3ZKJC 1YQBA 1QZEA 3ZDTA 1E8WA 2PJHA 4BVUC 2FIDA 4ASWC 1WR1A 4GDKB 4FJYA 2KVRA 1UBIA 4ANUA 2FIFA 4DHZE 4BKTA 3OJ4B 2N7DA 1YD8U 3GZNI 4RMAA 2A4ZA 4KZ0A 4W9DA 3W1SC 2MP2B 2IY1B 3N32A 4G50A 3L54A 4XZ4A 4WWNA 2KJ6A 2LVQA 4FHKA 2ZEQA 2BF8B 4JLCA 4DHZB 3IHPC 2ZPNA 4DXAB 2CHWA 3QQ8B 4E3CA 3DCGA 5DPSA 4WJOA 4TQ1A 1RAXA
chains in the Genus database with same CATH superfamily
1JW9D 1NDDA 2JZ3B 4RH6A 2PIAA 4IUMB 4NPNA 4YTPB 5TR5A 4HLEA 4C7YA 1L0VB 4JGHB 1MFWA 2WU2B 3BVGA 1HTQA 4WQMA 1WM3A 4CHKA 1FNVA 3WA0A 3KQ4A 3OG5A 2WXFA 4RGTA 2KDMA 3TEWA 3GP7A 2JXTA 3Q8CA 5CHVC 3VUYA 4URKA 4GOCA 1WX8A 2WXOA 3TEYA 3ZXRA 1E6EB 3QJZA 4ZDVA 2WX0A 4PK1A 1QOBA 4WJPA 4N9F4 3L4PA 1TYGB 1L0XB 4K3BA 1H4RA 1J8CA 2JXXA 1PGAA 1P1AA 4K1RB 2QILA 3O65B 3BK2A 4AOFA 1I4HA 3DVNU 1CJEA 2QEJC 3B1LX 4L2YA 3V62A 1ZKHA 2LFIA 4IG7B 1WXSA 2MBQA 2LHEA 3N1ZC 4LLGM 1XQQA 4C4VB 2NMQA 2K9XA 2N7EA 4MGZE 5L95C 1EF1A 3EC8A 3A33B 4GN1A 3H7PB 4HK2A 3QX1A 2BGFA 4MELA 2PLPA 5EDSA 3APCA 1E7PB 3ZNHB 1R4MI 2HJ8A 4EZJA 1XLNA 3M62B 4KSKC 3AE6B 1NEKB 3W5UB 1WYWB 3JYUA 1YNTE 5DPWA 4S0RA 4A20A 2JYTA 3IBEA 1Q1OA 4KZCA 1EWYC 3WAMA 1PGXA 2HJ1A 1IGCA 2AX5A 1YX6B 2KFKB 2MLBA 4KDIC 5LXHA 3ZRFA 4FULA 1RFAA 1V5OA 2DAFA 3U52E 2BYEA 4N6EB 5T8IA 2KN5A 4LNOA 1V6EA 1P7EA 1SIFA 1T6BX 2MWSB 2JSVX 3RZWC 2Y5PA 1ZXIA 3RT3B 1OQYA 3N9YC 4B9KA 4WQOB 2FBWB 4FJZA 3NZUA 1FCCC 3B2FA 4NNJB 2C7HA 3PHXB 4ZHOA 4IM3A 4KSLC 1FO4A 2ZW1A 2O2VA 3PZ7A 3OLMD 1DGJA 1NYQA 2ZJDA 3VAWA 3A1QA 5MPOA 4TKNA 2BT6A 3A9KA 4HJGE 4UDUC 3DBRI 2J53A 2KTRA 1WJ4A 4RCOA 4C7ZA 2CKHB 1K8RB 2JQRB 1SE2A 1TKYA 1IPGA 4TV3A 4US8A 1C9FA 3C19A 1FNUA 4OW0A 2PE9A 3IG3A 2E3TA 1WXAA 4RGOS 1I7HA 2L1AA 2XK5B 5AZFA 2DZIA 3RYTA 3DHHC 2RR9A 2LRUA 2MP2A 1NYRA 3TL5A 5D6JB 3L17A 1VDVA 4KGRA 2B3AA 5IO9A 5GMVA 5IN7A 4XDDA 3DDCB 2CU3A 4GXBA 5D94A 2GBRA 3TIXA 2ZVOA 1GUAB 4A9AA 2AL6A 2W3SA 2BTEA 4I6NB 3W5VB 2JU6X 3KYCD 1PGBA 4WURA 3MHZA 2FNJB 4O1NA 4LNIA 2PTLA 5HKHA 2MJEA 1P0RA 4EZLA 5IKCM 5H92C 1ZUD2 4W9JA 4MSQB 2Z8LA 4ZHPA 3QIJA 4USAA 2K5PA 4IWPA 2KVZA 2X8XX 5DPTA 2MBHA 3UGBB 3AXCA 2WXKA 2PMVA 4L23A 3PSEB 3CSTA 2KMCA 1U4AA 2NTSA 3DOWA 2UWQA 4YWGG 4JQWC 5JHAA 2BW2A 2UYZB 4M8NA 2UU7A 5AZGA 2JYEA 4RM9A 5CX3A 3ABVB 1LFDA 4DHJB 4M00A 4AP4C 1QILA 1JQ4A 5J2RA 1D6EC 1WXVA 3SEBA 1J7CA 1MG4A 4WJNA 1PUTA 1OGWA 1KOTA 2D10A 2WYQA 3AI5A 2IPKD 1YN3A 2L7RA 2WDVB 5JH5C 1D5MC 3FILA 5FR6A 3ZNID 3HIZA 1D4BA 1ZGUB 1SE4A 1FIQA 3RD2A 1UGJA 3N30A 1XLPA 1ENFA 1BUIC 4A3PA 1N60A 2EKIA 4C80A 3ECIA 5LLIA 4RGNA 4XE0A 4JPSA 1KJTA 2JY6A 2JWUA 1T0YA 3JSVA 2ACZB 2KHWB 4EFOA 4G0NB 3PT2B 3AEDB 1GC6A 1UNSA 4C56C 3MTNB 2WHIA 2EMSA 1WZ0A 4LNNA 4XGAB 3K9OB 1L4ZB 4F7ZA 4NJCA 2LJ5A 4BBNF 4A55A 1FFUA 1SEBD 3GB1A 4CYEA 1J7BA 1OEYJ 1EU4A 2WXJA 3Q8EA 4K7UA 2KD0A 3A1QB 1ZE3D 2JRHA 3AE8B 4ZRKA 3L10B 3A9KB 1DYQA 4A90A 3QCAA 1GG3A 3NZSA 1UBQA 1WX7A 3T9LA 1DOIA 2KQ7A 3DVGY 4PT5A 4HRSA 1LGRA 3ZDTA 1QZEA 2FIDA 4ASWC 2MH7A 4XWTA 4BKTA 4RMAA 2A4ZA 2MP2B 1WSPA 1ZDVA 2IY1B 4XZ4A 2ZEQA 3E56A 3RNGC 2CHWA 3QQ8B 3FAHA 1R7SA 4XWWA 1FNWA 1TJEA 4BKGA 5BYSA 2DZMA 1KF6B 4AWJA 1S3SG 3PRMB 5AUIA 2G3QB 2DYMA 2K1FA 2L0FA 2KX0A 2NBVB 1ET9A 3P2BA 1EWCA 4LJOB 3NRZA 2KAJA 2KO3A 2W55A 4MSMB 2QC8A 2EELA 4WAFA 2NPTB 2IZVB 2L32A 1C4PA 2V3PA 1V8CA 2J0JA 2KXJA 3SR6A 2JPHA 1L0YB 2BB6A 2KN4A 1M94A 2WXIA 2M17A 4DXGA 1VZ8A 2K8HA 4B0EA 2IGHA 3HHMA 2BB5A 2J42A 5HFYA 1WJNA 3TUOA 4M0WA 4M02A 4DXFA 3AMZA 3KWVA 4KGTA 5J18A 1AN8A 3QA8A 3AEGB 2KJHB 4LJPB 2NBUA 2DNFA 1WE7A 1R4MB 3A9JA 1NI3A 3R2TA 4HPLB 3BIID 4WWMA 2Y3AA 4K7SA 4WIPA 3WAPA 4YTMB 1WH3A 3W2DA 3MJWA 1WRIA 1D5XC 1P7FA 5AEKB 4L1BA 3RUIB 1E90A 3EA6A 1CMXB 1XD3B 3JSVB 2GOWA 3L0WB 1TTNA 2V4LA 4EUTA 3AV8A 3R2IA 3BYTB 3ALBA 3BK1A 1L4DB 2LI5A 3E9SA 1J0GA 2KYWA 1SIJA 1AYFA 5C3JB 3NG0A 1V1OA 5G2NA 2MW5A 3WIMA 1YX5B 2XN9C 3EECA 2CR5A 2LGXA 1P98A 1SE9A 4GDLA 2M0XA 1IUEA 2FCQA 3P4QB 1VLBA 3DVGX 4YSZB 1WIAA 4M8MA 1C76A 3TSSA 1G6JA 4XC2A 2C5LC 2INCC 2HTHA 2KDEB 3VVWB 2LRWA 2D3BA 1GPXA 4KIKA 1ZDXA 2ZVNA 1L6VA 4E74A 4EE2A 3CIRB 1SBBB 1XCTL 4GSWA 1H8CA 3ZNGC 3U30A 3AEAB 3AE2B 1PFDA 2KDFB 1JWUD 1C4AA 3CWIA 4HDQA 2V3SA 3QC8B 3FKYA 1V5TA 4R3DA 1I4PA 4DWFA 3PREA 1HTOA 4NAMA 2DYOA 1WFYA 2MSED 3I63C 4W9KA 4PS8A 2DZJA 4YL8A 2SEBD 4K3CA 3LXFA 1SGHA 3ENEA 4TSSA 3OJ3A 3A4RA 2DAJA 2WXHA 2OJWA 5DPRA 2D2QA 4J6IA 3RNEC 2KLCA 3PLVA 4KV2A 4B0MA 2W9NA 2G4SA 4FHJA 2DZKA 2IY0B 5EE0A 1I4GA 3H9DA 3OAWA 1E7UA 2EKEC 1PQSA 3Q6BA 4G3XB 1NBFC 1F52A 2KT7A 4AQ7A 2KWVB 3Q8AA 1ZP0B 2INDC 4YTNB 2O6VB 2OJRA 2KWDA 4W9IA 2V1YA 2IO3B 4M0WB 3ZTDA 1I35A 1UH6A 1LQBA 3MC8A 5IA7A 4AS1A 1WXMA 1YOVB 4ACFA 2ZCBA 3MC9A 2INPE 4GLSC 2YEPF 3SDLC 1FEHA 1N5XA 2K6QA 4W9HA 3PS6A 3R7RA 3ZRCA 1RWSA 4RFBA 2W82A 4BKSA 1GOZA 3B0AA 1CZPA 2GB1A 2JRIB 1YN4A 2D5GA 2HDEA 3Q2AC 2K22A 3K9PB 4N58A 3EHVA 4G11A 2VZKB 2KWUB 2CHXA 1S1QB 3Q8FA 2Z0DB 4GU2A 2JZZA 1MVKA 3T8MA 1YQ3B 2WDQB 1K53A 3ZJVA 3VFKA 5GXGB 2WDRB 2JVCA 1DOYA 3W1SA 3CSFA 3V05A 1T0QC 3X0WA 1MJDA 1FM0D 2GBJA 2KDBA 1WX9A 2IGGA 1Y56A 2BKFA 1OEYA 2ZZPB 1UD7A 1WJUA 1Z2MA 2CJOA 2LD9A 3W1YA 3SFDB 1HZ5A 1FRRA 4IWOA 4B95A 2B76B 1MHHE 1V97A 4FN2A 4FBJB 3KWLA 4GDLB 3APDA 3I5JC 3SU8X 1TS4A 1P3QU 1EF5A 5BMHA 4MGIE 2NBWB 2CU1A 3KUDB 3ZJTA 3H7SA 1UWMA 3VTUA 3V6EB 2QMTA 4NQLB 1TBEA 4I6LB 2KDIA 3PO0A 4LNFA 2ZW0A 3IXSA 1T0SC 5EE3A 3VQIA 2Y5CA 1L7YA 4LTUA 3ZUNA 4KIKB 2WDTB 3B9JA 2JF5A 3U2SC 5IOIA 3M3JA 1CQVA 1E5WA 2RPQA 1HA5A 2VRRB 4KVGB 1P9DU 2V0GA 3DBLB 3ZJUA 1WGGA 1VR9A 4N59A 3MC0B 4HDOA 4E71A 2REXA 1HXYD 1L2NA 2PE6B 4OZBA 2KMAA 1YJJA 2FE8A 2ZCCA 5E6NA 1FCLA 1ACCA 2MBOA 2PEAA 2ICIA 4II2B 2KC1A 1EM7A 1QLBB 3RN9C 2DWQA 4W9GA 2L3ZA 4RM8A 2D11A 3TMPB 4GIVA 3RCZA 4MGKE 1KTKA 4K81A 1EO6A 4PYZA 1WGDA 2NS5A 3PVLA 3NS1A 3NVYA 3M63B 1SJED 2C60A 1Q10A 2LVOA 1J19A 1WM2A 2LGIA 2V4IB 1J7AA 4ANUA 4DHZE 1N61A 4YT0B 1YD8U 3GZNI 4KZ0A 3UI3A 3VR9B 3N32A 4G50A 1LO5D 3L54A 3RFZB 5D3DA 1A70A 2BF8B 4ZOHC 4JLCA 1N5WA 1YJIA 3DCGA 5DPSA 1RAXA 1OQQA 3HK0A 2ON8A 1WGYA 2PKOA 2NR2A 2LXCA 1WI0A 1YMHE 1E0ZA 3RPFC 1YN5A 5G5GA 4ZRQA 2MHJA 2O6VD 3ZTCA 4BOSC 1LXDA 4PYUA 4MACA 4TQ0A 4AJWA 2LGDA 2MBEA 2RPVA 4W9CA 3P42A 2BVCA 1LM8B 3KUCB 4H2AA 2I1JA 3NY5A 1TZ1A 4JX1C 1WZ3A 4ZRPA 4DDGD 3AM9A 3LDZE 3Q8BA 2K3UA 4NZLB 2SAKA 3V60A 2MCNB 4FJVB 2N4FA 5IAAC 1KH0A 4J3OD 2N1WA 2VZKD 1ZPSA 2WXMA 5HG2A 3I9V1 2MX2A 3U7DA 2ZPYA 3SHQA 1AARA 3BINA 3CMMB 1TT5B 2BS4B 3H6NA 2LJIA 2LWPA 4DBGA 1IP9A 3WCQA 5BYRA 1SSNA 1BMLC 2AL3A 2GI9A 3L16A 1JWBD 2O2VB 4XYCA 1V80A 2G9HD 3LJ3A 5IP4D 3P4SB 4CO7A 1A5RA 2IBIB 2JWZA 3UQAA 4GDKA 2N9LA 4WWPA 1Q0WB 5DCNA 3B2GA 3HVZA 1N62A 3ZVVA 2KTRB 1Y8RC 2BWES 4EEWA 4RGMA 3APFA 3NVZA 3NS8A 3Q14C 4US9A 1WGHA 2DLBA 3SD5A 4BOZB 1STEA 1E7VA 1FFVA 3MHSD 2WWZA 4DQOC 2R2OA 1HEZE 3GE3C 1R4NI 4MJSA 2N9XA 4KKJA 3OWEB 3WANA 4RNAA 1QOGA 2DX5B 2AWTA 1KLUD 3AEFB 3CF6E 1V86A 2M1MA 2KWCA 5FKAC 1TKEA 3JW0X 4KKIA 2BPSA 3PZDA 4Q2JA 3R3MA 4LCDE 1T0RC 2L8JA 2KKCA 1UWXA 2WXGA 1GB4A 1JWMD 3TCAA 3DBSA 4LK0M 2FUHB 2KQ4X 2BWFA 4C00A 1ET6A 3TEXA 4RF0A 3Q3OC 2JZPA 3ML9A 1FXAA 4AJYB 1E8XA 2EMTA 3R7QA 3R8BA 3VUWA 2KNBA 3QK0A 3AE4B 3ZGZA 3DVNV 3I57A 2N1VA 1F0ZA 2C7MB 3VTWA 1I42A 2IO1B 4NAWA 4KGSA 4OHJA 4C4VA 2BYTA 1XXGA 3C0RB 1WE6A 5CHWA 3IVFA 1OQRA 1ZW7A 2D3CA 3ZIMA 3H7PA 1K52A 1GJZA 2J52A 2WXRA 2WQYB 2PPHA 4ZRIA 3FILB 1KFYB 1GNUA 1WXQA 2G4DB 3C8YA 3BWUD 4JWUC 3ML8A 4NY0A 1YJ1A 4DHJD 5KHQA 3EFCA 3VHTC 2PVGC 2IGDA 4IWQA 1HE8A 4W9FA 3AULA 3O13A 3D32A 2K0PA 4DK5A 2H89B 2WGSA 3UIOB 4EZKA 4PS7A 4BBNC 1TKGA 2BQQA 3KW5B 3VH4B 4F1SA 2LGSA 4II3B 2CJNA 4TUUA 4YXDB 1IYFA 2ASQA 2VH1A 1T3QA 1Z5SB 3TEZA 4GGQA 3VUXA 1E10A 3B08A 2KJRA 4MH8A 2KTFA 3BY4B 2J7QB 3AU5A 2HE7A 4A3OA 2IDYA 2Q5WD 3JVZX 1KLGD 4HEA1 3FC4A 2AQ1B 4NJ6A 2RSUA 2BYVE 2K8BA 3BYYB 1WF9A 2RGFA 3V61A 3ZW3A 2WXNA 3NOBA 1E9MA 3RNCC 4WJQA 1FXIA 2DYBA 2H88B 1N6ZA 5CTRC 3UINB 4ARIA 4FADA 2MQJA 1JCKB 1V49A 1L5PA 1QKZA 4I6PA 2RDBC 1XO3A 1YQ4B 1WMHA 2YLMA 3ZXVA 3NVWA 2MBBB 2N9KA 2YEPB 4KX6B 4MJSB 2J0MA 1ZOYB 3UQBA 1FXTB 3T3OA 2RDHA 2HD5B 4OZCA 5JZEB 2DBYA 1TS5A 3DBRB 2MRPA 4D2KA 1B1ZA 1V2YA 2BBCA 2CS4A 1VJKA 2V9HA 3AE7B 2C9WB 5G5HA 5BO4B 2QCZA 4OVZA 3AECB 3AU4A 3UF8A 1XLOA 1JROA 3IT4B 1F2RC 2C7NB 4OVVA 2QSDA 2IYDB 4S17A 1UELA 4YSXB 2XK5A 2KOXA 3P63A 4GB9A 4IM2A 3PGEA 1TGZB 2OOBB 1JRPA 2KC2A 3RNAC 4ANVA 2KFJA 2LHDA 3P1MA 1V1PA 4PS3A 1VZ7A 5KHOA 5AUKA 1XCQL 3U7ZA 3ONSA 2X38A 4NAWB 4IM0A 3J9CA 3DPDA 1B9RA 1WYGA 2L00B 3EUB2 1QOAA 2QIEB 4DDID 2AQ2B 3RULA 2LUMA 3KLSX 3L13A 4BFRA 2NTTA 3RNFC 4AUQC 4QAYA 3GZNB 4HKZE 3LYYA 2LUEA 3H1UA 2HTME 2N9EB 1Q5WB 3L08A 2XBBC 3GS2A 3U4EG 3T3NA 2K8CA 4WWOA 1QOFA 2JUOA 3A9JB 4IKGA 2KZRA 2N7JA 5LXIB 4HPPA 3MFGA 5E6JA 2L0TA 3AE1B 4P1CC 4JWSC 3ZKJC 1YQBA 1E8WA 4FJYA 4A8XC 3OJ4B 1ROEA 2N7DA 1NENB 4W9DA 3ZQ4A 2WU5B 1ZXHA 2LVQA 4DHZB 3IT6B 2RDGA 4DXAB 3HUIA 3HVDA 2W3RA 3DHIC 5BMGA 4W9EA 1MHXA 2KMMA 2RD0A 1JMLA 1BT0A 3NVVA 4LNKA 3U8ZA 3DBHI 1JRUA 4IOIE 2NCNA 1F77A 2FUG1 3EFUA 3R66C 1ISNA 5HHDG 3V3XA 1K51A 1OTRB 4YSYB 2WNMA 3NZ3A 1WGKA 3P4RB 3MP9A 4ZRJA 3HM6X 3RNBC 4MDKE 1OFFA 1XLQA 3PLUA 2AYOB 4ZYNA 3RZFA 1K50A 2FAZA 5D2MB 3V6CB 2K6DB 5LNK1 1WR6E 3RMKC 1AW7A 4XDCA 4ITKA 3SFEB 5FR3A 1WMHB 2KQSA 1DOXA 3I3TB 1WGRA 4OVUA 2QHOA 2L05A 2LMCA 4HROA 3HRDD 1GB1A 1TS2A 4MM3A 2ZNVB 1BXTA 1HQRD 5C2TB 5JHBA 4ANXA 3AE5B 2WP9B 4P16A 2LGYA 3AN1A 1WRDB 1C4CA 4TMAB 4MT5A 4NJ7A 2PW9A 2M4NA 1SE3A 5CHFA 5E6OA 2LEKA 4HXDA 1HZ6A 2R61A 3KVFB 2FCMA 2Y5BB 2Z59B 5E6PA 1R4NB 2M8SA 1KM7A 2QDFA 2QJLA 3VDZA 1VZ6A 4LDTB 2JX5A 3DWGC 1N63A 4P7IA 2INNE 5J17A 1D3ZA 3Q69A 1C77A 4F8CB 4KDLB 1V1PB 1C79A 1MPEA 5D7GA 3Q3FA 2N0SB 1XF5L 2FCNA 4FLHA 3NHEB 1JALA 4HVBA 4HJKA 5H8YE 3LB8C 2KX3A 1MI0A 3N1XC 4P6VF 3AEEB 1V81A 4GMVA 4K7WA 3PPAA 2NPTA 2A5UA 2GRIA 3QARA 3N3KB 1UGMA 2RMMA 4HCNB 1SF0A 2LVPA 2IO2B 2I1KA 4HCPB 2GLSA 3WAOA 3DHGC 2IJ0A 1GC7A 2G45B 2OEDA 2L76A 1T5XD 4MGYE 4FA6A 4P1BC 1QF6A 2KANA 1D5ZC 3VXWA 3ZDMC 2BKRB 1TY2A 3WALA 1X1MA 3X23A 2AQ3B 3S2AA 1KRHA 2W54A 3H8HA 1C3TA 2D07B 4RF1A 2WXQA 2WXPA 1C1YB 3VH3B 3HM3A 3PRZA 1FD6A 2MJDA 1SJHD 2XEWA 1V9JA 2G1EA 2BS3B 2NVUI 3IFWB 3Q3NC 3QWZB 3PRPB 1WJ6A 3VRBB 4ANWA 3IAS1 5HI1A 2Z0EB 1QQRA 3UIPB 2D3GA 3IAM1 4B6WA 5AZHA 1E8ZA 1IBXA 5D3IB 1FPYA 1QT9A 4M01A 2FCSA 1CK1A 4HKQA 2R2QA 3GOEA 3M95A 3AH7A 3Q3MC 3URYA 2LASA 2PVOD 1EUVB 4EKUA 4WH4A 3BVMA 3KUZA 2L83A 4IC7B 1SB3C 4EOYA 2GBMA 3BVZA 2N9PC 3W9CB 2E6XA 2K39A 3GE8C 4HWIB 3PTFC 4XX5A 2KACA 3DBLI 4MM3B 1MG8A 3PZ8A 2KLGA 3KYDD 3QAQA 1E8YA 1AWDA 1XT9B 1NI2A 2GBKA 2TSSA 2AEHA 5C1ZA 4OZAA 1YIWA 3VTVA 2GBNA 4ICVA 3N1YC 4CQNA 1JWSD 2IO0B 2MJ3A 2J0KA 3ZO5B 2BS2B 4BZAA 1GAQB 2YVCA 2M0AA 2KK8A 3PV1A 4X57B 3AE9B 4MH0E 1VCBA 5L83A 1I4QA 1L6UA 4FXCA 5EE9A 3N20C 5BYQA 2WLBA 4ICUA 1ESFA 3AEBB 4IW0A 1NVID 2M19A 4ZYSA 2BYFA 3TJPA 2I2YA 2DENB 2WXLA 5EE1A 3PHWB 1F9JA 2ZNVC 3AE3B 4LDTD 5C23A 4WAAA 2VH2A 4JL9A 4JIOU 2J4XA 3VR8B 3EGRA 1UF0A 5TSSA 4NQKE 4REZA 5G55A 3DQVA 3ZLZA 2MEKA 2GMIC 1EU3A 1RLFA 1SXTA 3VRAB 1WY8A 4ARCA 3P4PB 1FRDA 1FMAD 3A4SC 1VD2A 1RRBA 2LXAA 3RI7C 1I4XA 2O6VA 2WS3B 4W9LA 4A6QA 3BZDB 1WWTA 4BKSD 5I4DA 2OHFA 3AB5A 4MEMA 2WX1A 1JWAD 3TBLD 2MA9B 3NUHB 3KH0A 3QHTA 3Q3JA 1TIFA 2D3AA 3MJ5A 1TY0A 1C78A 2V3NA 1KLVA 3ZNZB 1XEEA 2I38A 4HPMB 2CHZA 1RFKA 1RYJA 1TS3A 4IDIA 2K25A 3NJTA 1PDXA 3ETRA 2JT4B 1RM6C 1IBXB 1F1HA 1UZXB 2L52A 2KFKA 2LZ6A 2DHZA 1PYWD 4JE3B 5FK9C 4BAXA 2PJHA 4BVUC 1UUPA 1WR1A 4GDKB 2KVRA 1UBIA 1M4VA 2FIFA 1I4RA 3DBHB 3ZYYX 3DWMA 3W1SC 2XNAC 1F2RI 4WWNA 2KJ6A 4FHKA 5JXVA 2ONQA 1VRAB 2M56B 3IHPC 2ZPNA 4E3CA 1TZOA 5BMIA 4WJOA 4TQ1A 1IGDA
chains in the Genus database with same CATH topology
4W9EA 3HK0A 4BKGA 1WGYA 1NDDA 2DZMA 2JZ3B 1WI0A 2LXCA 2NR2A 2RD0A 4AWJA 1BT0A 1S3SG 3PRMB 2G3QB 2DYMA 2K1FA 2L0FA 3U8ZA 3DBHI 1JRUA 2O6VD 3ZTCA 2NCNA 4BOSC 1LXDA 4PYUA 2KX0A 2NBVB 4IUMB 4NPNA 5TR5A 3EFUA 3R66C 1ISNA 4HLEA 3P2BA 4TQ0A 4LJOB 4AJWA 4JGHB 2KO3A 2LGDA 2MBEA 4MSMB 4W9CA 3KUCB 1OTRB 1LM8B 2NPTB 2I1JA 2IZVB 3NY5A 1TZ1A 1WM3A 4CHKA 1WZ3A 3WA0A 4ZRJA 4DDGD 2J0JA 3LDZE 2KXJA 3HM6X 5CHVC 3VUYA 4MDKE 2JPHA 4URKA 3V60A 2MCNB 3PLUA 2AYOB 4FJVB 4ZYNA 1M94A 3RZFA 2N4FA 4GOCA 2M17A 1WX8A 2FAZA 5D2MB 5IAAC 3V6CB 2K6DB 2N1WA 1WR6E 3QJZA 4ZDVA 2K8HA 2WX0A 4WJPA 4N9F4 3HHMA 2MX2A 3U7DA 1WJNA 1H4RA 1J8CA 2ZPYA 1WMHB 2KQSA 1AARA 3SHQA 3BINA 3CMMB 2JXXA 3H6NA 1P1AA 3I3TB 1WGRA 4K1RB 4OVUA 2QHOA 2L05A 2LWPA 4DBGA 3O65B 4AOFA 3DVNU 5J18A 1IP9A 3QA8A 4MM3A 2ZNVB 2AL3A 2KJHB 4LJPB 2NBUA 3B1LX 5JHBA 1WE7A 4ANXA 3L16A 3V62A 1ZKHA 4IG7B 1WXSA 2MBQA 2LGYA 3A9JA 1WRDB 1XQQA 4HPLB 2O2VB 1V80A 3LJ3A 4NJ7A 2M4NA 2N7EA 4K7SA 4MGZE 4CO7A 5CHFA 5E6OA 5L95C 1A5RA 1EF1A 2IBIB 2JWZA 4HXDA 3EC8A 3KVFB 3UQAA 4GDKA 3A33B 3WAPA 2FCMA 4GN1A 2Y5BB 2Z59B 4WWPA 5E6PA 1Q0WB 1WH3A 5DCNA 3MJWA 3H7PB 2M8SA 4HK2A 1KM7A 3ZVVA 3QX1A 5AEKB 2BGFA 2KTRB 1Y8RC 4MELA 3RUIB 5EDSA 3VDZA 1E90A 4LDTB 3APCA 1CMXB 1XD3B 2BWES 4EEWA 4P7IA 3ZNHB 5J17A 1R4MI 3APFA 3JSVB 1D3ZA 3NS8A 2GOWA 2HJ8A 3L0WB 4F8CB 4KDLB 1TTNA 2V4LA 4EUTA 1WGHA 3SD5A 4EZJA 4BOZB 3ALBA 1E7VA 3MHSD 5D7GA 3Q3FA 2WWZA 2R2OA 2FCNA 2LI5A 3M62B 4FLHA 3NHEB 4KSKC 4HVBA 4HJKA 1R4NI 1J0GA 2KX3A 1WYWB 4MJSA 3JYUA 2N9XA 5DPWA 3WANA 5G2NA 4A20A 1V81A 2MW5A 3WIMA 4GMVA 1YX5B 2DX5B 2AWTA 3EECA 3IBEA 3CF6E 1Q1OA 4K7WA 3PPAA 2CR5A 2LGXA 1P98A 2NPTA 4KZCA 1SE9A 3WAMA 4GDLA 1V86A 2M0XA 2M1MA 2FCQA 2KWCA 2A5UA 3JW0X 3DVGX 3QARA 2BPSA 1WIAA 1YX6B 2KFKB 3PZDA 2MLBA 1UGMA 3N3KB 3R3MA 4M8MA 4LCDE 4HCNB 1G6JA 2L8JA 2LVPA 4KDIC 4XC2A 5LXHA 2C5LC 2IO2B 2I1KA 2KDEB 2HTHA 3ZRFA 4FULA 1RFAA 1V5OA 4HCPB 3VVWB 2DAFA 2KKCA 2BYEA 3WAOA 2LRWA 1GC7A 2G45B 2L76A 2KN5A 4KIKA 3TCAA 2ZVNA 3DBSA 2FUHB 2BWFA 1V6EA 4E74A 1SIFA 4GSWA 1H8CA 2MWSB 4MGYE 4FA6A 3ZNGC 3RZWC 2KANA 3ML9A 3U30A 3VXWA 3ZDMC 2BKRB 3RT3B 4AJYB 1OQYA 2KDFB 1E8XA 4B9KA 2EMTA 3R7QA 3WALA 1X1MA 3X23A 3VUWA 2KNBA 3QK0A 3S2AA 1C3TA 4HDQA 4WQOB 2D07B 2V3SA 3DVNV 3VH3B 1C1YB 3QC8B 3HM3A 3PRZA 2N1VA 4FJZA 3NZUA 2C7MB 3VTWA 1V5TA 4NNJB 1I42A 2IO1B 2C7HA 3PHXB 4NAWA 2XEWA 1V9JA 4DWFA 4IM3A 3PREA 4KSLC 2NVUI 3IFWB 3QWZB 2O2VA 3PRPB 2DYOA 1WFYA 1WJ6A 2MSED 4W9KA 4PS8A 2DZJA 4YL8A 4ANWA 3C0RB 1WE6A 3OLMD 5CHWA 2ZJDA 3IVFA 3VAWA 2Z0EB 3A1QA 1ZW7A 3UIPB 2D3GA 4TKNA 4B6WA 1SGHA 3ENEA 3ZIMA 3OJ3A 5AZHA 3A4RA 1E8ZA 2DAJA 3A9KA 3H7PA 5DPRA 2D2QA 3DBRI 2KTRA 1WJ4A 1GJZA 4J6IA 2FCSA 2KLCA 2CKHB 1K8RB 3PLVA 2R2QA 3GOEA 4KV2A 2PPHA 2W9NA 3M95A 4ZRIA 1GNUA 2LASA 1IPGA 2G4SA 2DZKA 2G4DB 2IY0B 4FHJA 1EUVB 3H9DA 4TV3A 3OAWA 3ML8A 4NY0A 1YJ1A 4DHJD 4EKUA 5KHQA 1E7UA 2EKEC 1PQSA 2PE9A 4G3XB 3IG3A 3VHTC 1NBFC 1WXAA 4IWQA 1HE8A 4W9FA 3AULA 2XK5B 3KUZA 5AZFA 2DZIA 3D32A 2KWVB 4IC7B 3RYTA 2RR9A 4DK5A 2LRUA 2MP2A 2O6VB 2OJRA 3TL5A 4EOYA 4W9IA 5D6JB 2GBMA 2V1YA 2N9PC 3L17A 3UIOB 4EZKA 2IO3B 4PS7A 4BBNC 4M0WB 3ZTDA 1I35A 2K39A 1UH6A 2B3AA 1LQBA 5GMVA 5IA7A 3KW5B 3DDCB 4HWIB 3PTFC 1WXMA 2ZCBA 4XX5A 4GXBA 5D94A 3VH4B 2GBRA 3DBLI 4F1SA 3TIXA 2ZVOA 4II3B 1GUAB 1MG8A 2KLGA 2AL6A 3KYDD 4TUUA 3SDLC 3QAQA 2K6QA 4I6NB 1IYFA 1E8YA 3KYCD 4W9HA 1XT9B 3PS6A 2ASQA 3R7RA 1NI2A 1Z5SB 2GBKA 3ZRCA 2FNJB 4BKSA 4GGQA 3VUXA 3B0AA 5HKHA 2AEHA 2JRIB 5C1ZA 3B08A 1P0RA 2KJRA 4EZLA 1YIWA 3VTVA 2GBNA 2KTFA 3K9PB 4ICVA 3BY4B 3EHVA 4G11A 2J7QB 2KWUB 4W9JA 3AU5A 2HE7A 2CHXA 4A3OA 4MSQB 1S1QB 2IO0B 3JVZX 2Z0DB 3QIJA 4IWPA 4GU2A 2JZZA 2J0KA 3T8MA 3ZO5B 3VFKA 2YVCA 4NJ6A 2RSUA 2BYVE 2K8BA 2KK8A 1WF9A 2RGFA 3PV1A 2JVCA 4X57B 3V61A 3ZW3A 4MH0E 3NOBA 1VCBA 5L83A 4WJQA 5DPTA 2MBHA 3UGBB 2DYBA 3AXCA 3W1SA 3CSFA 5CTRC 3UINB 4FADA 3X0WA 3PSEB 3CSTA 2GBJA 2KDBA 2MQJA 1WX9A 4ICUA 2KMCA 1U4AA 3DOWA 4IW0A 2UWQA 1V49A 4JQWC 2BKFA 1OEYA 2ZZPB 4I6PA 5JHAA 1UD7A 2BYFA 2UYZB 4M8NA 1WJUA 3TJPA 1WMHA 2DENB 5AZGA 1Z2MA 2YLMA 3PHWB 2LD9A 2MBBB 1F9JA 2ZNVC 4MJSB 3W1YA 2J0MA 4RM9A 5CX3A 4LDTD 5C23A 3UQBA 1LFDA 4WAAA 4DHJB 1FXTB 4AP4C 4IWOA 4B95A 4JL9A 2HD5B 4JIOU 5J2RA 5JZEB 1WXVA 2MRPA 4NQKE 5G55A 1V2YA 4FN2A 4WJNA 4FBJB 3DQVA 2CS4A 4GDLB 3ZLZA 1OGWA 3APDA 3SU8X 2C9WB 1P3QU 2GMIC 5BO4B 1EF5A 1KOTA 1RLFA 2D10A 4MGIE 2NBWB 2WYQA 3AI5A 2CU1A 2L7RA 3AU4A 3KUDB 3H7SA 3UF8A 5JH5C 3VTUA 3V6EB 1WY8A 5FR6A 4NQLB 3ZNID 1TBEA 2C7NB 4I6LB 2KDIA 3HIZA 4OVVA 1ZGUB 2IYDB 3RD2A 3N30A 3VQIA 3ZUNA 1L7YA 3A4SC 1UELA 1VD2A 4KIKB 4A3PA 2WDTB 2KOXA 2XK5A 2JF5A 1RRBA 2LXAA 4GB9A 4IM2A 3M3JA 2O6VA 3PGEA 3ECIA 5LLIA 4W9LA 1E5WA 1TGZB 2RPQA 1KJTA 2JY6A 2VRRB 2OOBB 4KVGB 4BKSD 1P9DU 1T0YA 3JSVA 1WGGA 2KHWB 4EFOA 4G0NB 2KC2A 4HDOA 4E71A 2REXA 4ANVA 1L2NA 3PT2B 4MEMA 2WX1A 2KFJA 1GC6A 2PE6B 2KMAA 3TBLD 3MTNB 4PS3A 2MA9B 5KHOA 3KH0A 2EMSA 2ZCCA 1WZ0A 3QHTA 5E6NA 3Q3JA 3K9OB 3ONSA 2MBOA 2PEAA 4NAWB 4F7ZA 4II2B 2KC1A 4IM0A 3DPDA 2LJ5A 2L00B 4BBNF 4W9GA 2L3ZA 4DDID 1KLVA 4CYEA 3RULA 1OEYJ 3L13A 4BFRA 4RM8A 4K7UA 3ZNZB 4AUQC 2D11A 4HPMB 2CHZA 2KD0A 3A1QB 4GIVA 3TMPB 2JRHA 2K25A 3RCZA 2LUEA 4MGKE 3H1UA 4K81A 4ZRKA 2N9EB 1EO6A 1Q5WB 4PYZA 3L10B 3L08A 3A9KB 1WGDA 2JT4B 2NS5A 2XBBC 3PVLA 2K8CA 4WWOA 3M63B 1GG3A 1UZXB 3NZSA 3QCAA 1UBQA 1WX7A 2C60A 2JUOA 3A9JB 2KFKA 3T9LA 2KZRA 2LZ6A 5LXIB 2KQ7A 2DHZA 2LVOA 3DVGY 2L0TA 1J19A 1WM2A 3ZKJC 1YQBA 1QZEA 3ZDTA 1E8WA 2PJHA 4BVUC 2FIDA 4ASWC 1WR1A 4GDKB 4FJYA 2KVRA 1UBIA 4ANUA 2FIFA 4DHZE 4BKTA 3OJ4B 2N7DA 1YD8U 3GZNI 4RMAA 2A4ZA 4KZ0A 4W9DA 3W1SC 2MP2B 2IY1B 3N32A 4G50A 3L54A 4XZ4A 4WWNA 2KJ6A 2LVQA 4FHKA 2ZEQA 2BF8B 4JLCA 4DHZB 3IHPC 2ZPNA 4DXAB 2CHWA 3QQ8B 4E3CA 3DCGA 5DPSA 4WJOA 4TQ1A 1RAXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W9E A;  3HK0 A;  4BKG A;  1WGY A;  1NDD A;  2DZM A;  2JZ3 B;  1WI0 A;  2LXC A;  2NR2 A;  2RD0 A;  4AWJ A;  1BT0 A;  1S3S G;  3PRM B;  2G3Q B;  2DYM A;  2K1F A;  2L0F A;  3U8Z A;  3DBH I;  1JRU A;  2O6V D;  3ZTC A;  2NCN A;  4BOS C;  1LXD A;  4PYU A;  2KX0 A;  2NBV B;  4IUM B;  4NPN A;  5TR5 A;  3EFU A;  3R66 C;  1ISN A;  4HLE A;  3P2B A;  4TQ0 A;  4LJO B;  4AJW A;  4JGH B;  2KO3 A;  2LGD A;  2MBE A;  4MSM B;  4W9C A;  3KUC B;  1OTR B;  1LM8 B;  2NPT B;  2I1J A;  2IZV B;  3NY5 A;  1TZ1 A;  1WM3 A;  4CHK A;  1WZ3 A;  3WA0 A;  4ZRJ A;  4DDG D;  2J0J A;  3LDZ E;  2KXJ A;  3HM6 X;  5CHV C;  3VUY A;  4MDK E;  2JPH A;  4URK A;  3V60 A;  2MCN B;  3PLU A;  2AYO B;  4FJV B;  4ZYN A;  1M94 A;  3RZF A;  2N4F A;  4GOC A;  2M17 A;  1WX8 A;  2FAZ A;  5D2M B;  5IAA C;  3V6C B;  2K6D B;  2N1W A;  1WR6 E;  3QJZ A;  4ZDV A;  2K8H A;  2WX0 A;  4WJP A;  4N9F 4;  3HHM A;  2MX2 A;  3U7D A;  1WJN A;  1H4R A;  1J8C A;  2ZPY A;  1WMH B;  2KQS A;  1AAR A;  3SHQ A;  3BIN A;  3CMM B;  2JXX A;  3H6N A;  1P1A A;  3I3T B;  1WGR A;  4K1R B;  4OVU A;  2QHO A;  2L05 A;  2LWP A;  4DBG A;  3O65 B;  4AOF A;  3DVN U;  5J18 A;  1IP9 A;  3QA8 A;  4MM3 A;  2ZNV B;  2AL3 A;  2KJH B;  4LJP B;  2NBU A;  3B1L X;  5JHB A;  1WE7 A;  4ANX A;  3L16 A;  3V62 A;  1ZKH A;  4IG7 B;  1WXS A;  2MBQ A;  2LGY A;  3A9J A;  1WRD B;  1XQQ A;  4HPL B;  2O2V B;  1V80 A;  3LJ3 A;  4NJ7 A;  2M4N A;  2N7E A;  4K7S A;  4MGZ E;  4CO7 A;  5CHF A;  5E6O A;  5L95 C;  1A5R A;  1EF1 A;  2IBI B;  2JWZ A;  4HXD A;  3EC8 A;  3KVF B;  3UQA A;  4GDK A;  3A33 B;  3WAP A;  2FCM A;  4GN1 A;  2Y5B B;  2Z59 B;  4WWP A;  5E6P A;  1Q0W B;  1WH3 A;  5DCN A;  3MJW A;  3H7P B;  2M8S A;  4HK2 A;  1KM7 A;  3ZVV A;  3QX1 A;  5AEK B;  2BGF A;  2KTR B;  1Y8R C;  4MEL A;  3RUI B;  5EDS A;  3VDZ A;  1E90 A;  4LDT B;  3APC A;  1CMX B;  1XD3 B;  2BWE S;  4EEW A;  4P7I A;  3ZNH B;  5J17 A;  1R4M I;  3APF A;  3JSV B;  1D3Z A;  3NS8 A;  2GOW A;  2HJ8 A;  3L0W B;  4F8C B;  4KDL B;  1TTN A;  2V4L A;  4EUT A;  1WGH A;  3SD5 A;  4EZJ A;  4BOZ B;  3ALB A;  1E7V A;  3MHS D;  5D7G A;  3Q3F A;  2WWZ A;  2R2O A;  2FCN A;  2LI5 A;  3M62 B;  4FLH A;  3NHE B;  4KSK C;  4HVB A;  4HJK A;  1R4N I;  1J0G A;  2KX3 A;  1WYW B;  4MJS A;  3JYU A;  2N9X A;  5DPW A;  3WAN A;  5G2N A;  4A20 A;  1V81 A;  2MW5 A;  3WIM A;  4GMV A;  1YX5 B;  2DX5 B;  2AWT A;  3EEC A;  3IBE A;  3CF6 E;  1Q1O A;  4K7W A;  3PPA A;  2CR5 A;  2LGX A;  1P98 A;  2NPT A;  4KZC A;  1SE9 A;  3WAM A;  4GDL A;  1V86 A;  2M0X A;  2M1M A;  2FCQ A;  2KWC A;  2A5U A;  3JW0 X;  3DVG X;  3QAR A;  2BPS A;  1WIA A;  1YX6 B;  2KFK B;  3PZD A;  2MLB A;  1UGM A;  3N3K B;  3R3M A;  4M8M A;  4LCD E;  4HCN B;  1G6J A;  2L8J A;  2LVP A;  4KDI C;  4XC2 A;  5LXH A;  2C5L C;  2IO2 B;  2I1K A;  2KDE B;  2HTH A;  3ZRF A;  4FUL A;  1RFA A;  1V5O A;  4HCP B;  3VVW B;  2DAF A;  2KKC A;  2BYE A;  3WAO A;  2LRW A;  1GC7 A;  2G45 B;  2L76 A;  2KN5 A;  4KIK A;  3TCA A;  2ZVN A;  3DBS A;  2FUH B;  2BWF A;  1V6E A;  4E74 A;  1SIF A;  4GSW A;  1H8C A;  2MWS B;  4MGY E;  4FA6 A;  3ZNG C;  3RZW C;  2KAN A;  3ML9 A;  3U30 A;  3VXW A;  3ZDM C;  2BKR B;  3RT3 B;  4AJY B;  1OQY A;  2KDF B;  1E8X A;  4B9K A;  2EMT A;  3R7Q A;  3WAL A;  1X1M A;  3X23 A;  3VUW A;  2KNB A;  3QK0 A;  3S2A A;  1C3T A;  4HDQ A;  4WQO B;  2D07 B;  2V3S A;  3DVN V;  3VH3 B;  1C1Y B;  3QC8 B;  3HM3 A;  3PRZ A;  2N1V A;  4FJZ A;  3NZU A;  2C7M B;  3VTW A;  1V5T A;  4NNJ B;  1I42 A;  2IO1 B;  2C7H A;  3PHX B;  4NAW A;  2XEW A;  1V9J A;  4DWF A;  4IM3 A;  3PRE A;  4KSL C;  2NVU I;  3IFW B;  3QWZ B;  2O2V A;  3PRP B;  2DYO A;  1WFY A;  1WJ6 A;  2MSE D;  4W9K A;  4PS8 A;  2DZJ A;  4YL8 A;  4ANW A;  3C0R B;  1WE6 A;  3OLM D;  5CHW A;  2ZJD A;  3IVF A;  3VAW A;  2Z0E B;  3A1Q A;  1ZW7 A;  3UIP B;  2D3G A;  4TKN A;  4B6W A;  1SGH A;  3ENE A;  3ZIM A;  3OJ3 A;  5AZH A;  3A4R A;  1E8Z A;  2DAJ A;  3A9K A;  3H7P A;  5DPR A;  2D2Q A;  3DBR I;  2KTR A;  1WJ4 A;  1GJZ A;  4J6I A;  2FCS A;  2KLC A;  2CKH B;  1K8R B;  3PLV A;  2R2Q A;  3GOE A;  4KV2 A;  2PPH A;  2W9N A;  3M95 A;  4ZRI A;  1GNU A;  2LAS A;  1IPG A;  2G4S A;  2DZK A;  2G4D B;  2IY0 B;  4FHJ A;  1EUV B;  3H9D A;  4TV3 A;  3OAW A;  3ML8 A;  4NY0 A;  1YJ1 A;  4DHJ D;  4EKU A;  5KHQ A;  1E7U A;  2EKE C;  1PQS A;  2PE9 A;  4G3X B;  3IG3 A;  3VHT C;  1NBF C;  1WXA A;  4IWQ A;  1HE8 A;  4W9F A;  3AUL A;  2XK5 B;  3KUZ A;  5AZF A;  2DZI A;  3D32 A;  2KWV B;  4IC7 B;  3RYT A;  2RR9 A;  4DK5 A;  2LRU A;  2MP2 A;  2O6V B;  2OJR A;  3TL5 A;  4EOY A;  4W9I A;  5D6J B;  2GBM A;  2V1Y A;  2N9P C;  3L17 A;  3UIO B;  4EZK A;  2IO3 B;  4PS7 A;  4BBN C;  4M0W B;  3ZTD A;  1I35 A;  2K39 A;  1UH6 A;  2B3A A;  1LQB A;  5GMV A;  5IA7 A;  3KW5 B;  3DDC B;  4HWI B;  3PTF C;  1WXM A;  2ZCB A;  4XX5 A;  4GXB A;  5D94 A;  3VH4 B;  2GBR A;  3DBL I;  4F1S A;  3TIX A;  2ZVO A;  4II3 B;  1GUA B;  1MG8 A;  2KLG A;  2AL6 A;  3KYD D;  4TUU A;  3SDL C;  3QAQ A;  2K6Q A;  4I6N B;  1IYF A;  1E8Y A;  3KYC D;  4W9H A;  1XT9 B;  3PS6 A;  2ASQ A;  3R7R A;  1NI2 A;  1Z5S B;  2GBK A;  3ZRC A;  2FNJ B;  4BKS A;  4GGQ A;  3VUX A;  3B0A A;  5HKH A;  2AEH A;  2JRI B;  5C1Z A;  3B08 A;  1P0R A;  2KJR A;  4EZL A;  1YIW A;  3VTV A;  2GBN A;  2KTF A;  3K9P B;  4ICV A;  3BY4 B;  3EHV A;  4G11 A;  2J7Q B;  2KWU B;  4W9J A;  3AU5 A;  2HE7 A;  2CHX A;  4A3O A;  4MSQ B;  1S1Q B;  2IO0 B;  3JVZ X;  2Z0D B;  3QIJ A;  4IWP A;  4GU2 A;  2JZZ A;  2J0K A;  3T8M A;  3ZO5 B;  3VFK A;  2YVC A;  4NJ6 A;  2RSU A;  2BYV E;  2K8B A;  2KK8 A;  1WF9 A;  2RGF A;  3PV1 A;  2JVC A;  4X57 B;  3V61 A;  3ZW3 A;  4MH0 E;  3NOB A;  1VCB A;  5L83 A;  4WJQ A;  5DPT A;  2MBH A;  3UGB B;  2DYB A;  3AXC A;  3W1S A;  3CSF A;  5CTR C;  3UIN B;  4FAD A;  3X0W A;  3PSE B;  3CST A;  2GBJ A;  2KDB A;  2MQJ A;  1WX9 A;  4ICU A;  2KMC A;  1U4A A;  3DOW A;  4IW0 A;  2UWQ A;  1V49 A;  4JQW C;  2BKF A;  1OEY A;  2ZZP B;  4I6P A;  5JHA A;  1UD7 A;  2BYF A;  2UYZ B;  4M8N A;  1WJU A;  3TJP A;  1WMH A;  2DEN B;  5AZG A;  1Z2M A;  2YLM A;  3PHW B;  2LD9 A;  2MBB B;  1F9J A;  2ZNV C;  4MJS B;  3W1Y A;  2J0M A;  4RM9 A;  5CX3 A;  4LDT D;  5C23 A;  3UQB A;  1LFD A;  4WAA A;  4DHJ B;  1FXT B;  4AP4 C;  4IWO A;  4B95 A;  4JL9 A;  2HD5 B;  4JIO U;  5J2R A;  5JZE B;  1WXV A;  2MRP A;  4NQK E;  5G55 A;  1V2Y A;  4FN2 A;  4WJN A;  4FBJ B;  3DQV A;  2CS4 A;  4GDL B;  3ZLZ A;  1OGW A;  3APD A;  3SU8 X;  2C9W B;  1P3Q U;  2GMI C;  5BO4 B;  1EF5 A;  1KOT A;  1RLF A;  2D10 A;  4MGI E;  2NBW B;  2WYQ A;  3AI5 A;  2CU1 A;  2L7R A;  3AU4 A;  3KUD B;  3H7S A;  3UF8 A;  5JH5 C;  3VTU A;  3V6E B;  1WY8 A;  5FR6 A;  4NQL B;  3ZNI D;  1TBE A;  2C7N B;  4I6L B;  2KDI A;  3HIZ A;  4OVV A;  1ZGU B;  2IYD B;  3RD2 A;  3N30 A;  3VQI A;  3ZUN A;  1L7Y A;  3A4S C;  1UEL A;  1VD2 A;  4KIK B;  4A3P A;  2WDT B;  2KOX A;  2XK5 A;  2JF5 A;  1RRB A;  2LXA A;  4GB9 A;  4IM2 A;  3M3J A;  2O6V A;  3PGE A;  3ECI A;  5LLI A;  4W9L A;  1E5W A;  1TGZ B;  2RPQ A;  1KJT A;  2JY6 A;  2VRR B;  2OOB B;  4KVG B;  4BKS D;  1P9D U;  1T0Y A;  3JSV A;  1WGG A;  2KHW B;  4EFO A;  4G0N B;  2KC2 A;  4HDO A;  4E71 A;  2REX A;  4ANV A;  1L2N A;  3PT2 B;  4MEM A;  2WX1 A;  2KFJ A;  1GC6 A;  2PE6 B;  2KMA A;  3TBL D;  3MTN B;  4PS3 A;  2MA9 B;  5KHO A;  3KH0 A;  2EMS A;  2ZCC A;  1WZ0 A;  3QHT A;  5E6N A;  3Q3J A;  3K9O B;  3ONS A;  2MBO A;  2PEA A;  4NAW B;  4F7Z A;  4II2 B;  2KC1 A;  4IM0 A;  3DPD A;  2LJ5 A;  2L00 B;  4BBN F;  4W9G A;  2L3Z A;  4DDI D;  1KLV A;  4CYE A;  3RUL A;  1OEY J;  3L13 A;  4BFR A;  4RM8 A;  4K7U A;  3ZNZ B;  4AUQ C;  2D11 A;  4HPM B;  2CHZ A;  2KD0 A;  3A1Q B;  4GIV A;  3TMP B;  2JRH A;  2K25 A;  3RCZ A;  2LUE A;  4MGK E;  3H1U A;  4K81 A;  4ZRK A;  2N9E B;  1EO6 A;  1Q5W B;  4PYZ A;  3L10 B;  3L08 A;  3A9K B;  1WGD A;  2JT4 B;  2NS5 A;  2XBB C;  3PVL A;  2K8C A;  4WWO A;  3M63 B;  1GG3 A;  1UZX B;  3NZS A;  3QCA A;  1UBQ A;  1WX7 A;  2C60 A;  2JUO A;  3A9J B;  2KFK A;  3T9L A;  2KZR A;  2LZ6 A;  5LXI B;  2KQ7 A;  2DHZ A;  2LVO A;  3DVG Y;  2L0T A;  1J19 A;  1WM2 A;  3ZKJ C;  1YQB A;  1QZE A;  3ZDT A;  1E8W A;  2PJH A;  4BVU C;  2FID A;  4ASW C;  1WR1 A;  4GDK B;  4FJY A;  2KVR A;  1UBI A;  4ANU A;  2FIF A;  4DHZ E;  4BKT A;  3OJ4 B;  2N7D A;  1YD8 U;  3GZN I;  4RMA A;  2A4Z A;  4KZ0 A;  4W9D A;  3W1S C;  2MP2 B;  2IY1 B;  3N32 A;  4G50 A;  3L54 A;  4XZ4 A;  4WWN A;  2KJ6 A;  2LVQ A;  4FHK A;  2ZEQ A;  2BF8 B;  4JLC A;  4DHZ B;  3IHP C;  2ZPN A;  4DXA B;  2CHW A;  3QQ8 B;  4E3C A;  3DCG A;  5DPS A;  4WJO A;  4TQ1 A;  1RAX A; 
#chains in the Genus database with same CATH topology
 1JW9 D;  1NDD A;  2JZ3 B;  4RH6 A;  2PIA A;  4IUM B;  4NPN A;  4YTP B;  5TR5 A;  4HLE A;  4C7Y A;  1L0V B;  4JGH B;  1MFW A;  2WU2 B;  3BVG A;  1HTQ A;  4WQM A;  1WM3 A;  4CHK A;  1FNV A;  3WA0 A;  3KQ4 A;  3OG5 A;  2WXF A;  4RGT A;  2KDM A;  3TEW A;  3GP7 A;  2JXT A;  3Q8C A;  5CHV C;  3VUY A;  4URK A;  4GOC A;  1WX8 A;  2WXO A;  3TEY A;  3ZXR A;  1E6E B;  3QJZ A;  4ZDV A;  2WX0 A;  4PK1 A;  1QOB A;  4WJP A;  4N9F 4;  3L4P A;  1TYG B;  1L0X B;  4K3B A;  1H4R A;  1J8C A;  2JXX A;  1PGA A;  1P1A A;  4K1R B;  2QIL A;  3O65 B;  3BK2 A;  4AOF A;  1I4H A;  3DVN U;  1CJE A;  2QEJ C;  3B1L X;  4L2Y A;  3V62 A;  1ZKH A;  2LFI A;  4IG7 B;  1WXS A;  2MBQ A;  2LHE A;  3N1Z C;  4LLG M;  1XQQ A;  4C4V B;  2NMQ A;  2K9X A;  2N7E A;  4MGZ E;  5L95 C;  1EF1 A;  3EC8 A;  3A33 B;  4GN1 A;  3H7P B;  4HK2 A;  3QX1 A;  2BGF A;  4MEL A;  2PLP A;  5EDS A;  3APC A;  1E7P B;  3ZNH B;  1R4M I;  2HJ8 A;  4EZJ A;  1XLN A;  3M62 B;  4KSK C;  3AE6 B;  1NEK B;  3W5U B;  1WYW B;  3JYU A;  1YNT E;  5DPW A;  4S0R A;  4A20 A;  2JYT A;  3IBE A;  1Q1O A;  4KZC A;  1EWY C;  3WAM A;  1PGX A;  2HJ1 A;  1IGC A;  2AX5 A;  1YX6 B;  2KFK B;  2MLB A;  4KDI C;  5LXH A;  3ZRF A;  4FUL A;  1RFA A;  1V5O A;  2DAF A;  3U52 E;  2BYE A;  4N6E B;  5T8I A;  2KN5 A;  4LNO A;  1V6E A;  1P7E A;  1SIF A;  1T6B X;  2MWS B;  2JSV X;  3RZW C;  2Y5P A;  1ZXI A;  3RT3 B;  1OQY A;  3N9Y C;  4B9K A;  4WQO B;  2FBW B;  4FJZ A;  3NZU A;  1FCC C;  3B2F A;  4NNJ B;  2C7H A;  3PHX B;  4ZHO A;  4IM3 A;  4KSL C;  1FO4 A;  2ZW1 A;  2O2V A;  3PZ7 A;  3OLM D;  1DGJ A;  1NYQ A;  2ZJD A;  3VAW A;  3A1Q A;  5MPO A;  4TKN A;  2BT6 A;  3A9K A;  4HJG E;  4UDU C;  3DBR I;  2J53 A;  2KTR A;  1WJ4 A;  4RCO A;  4C7Z A;  2CKH B;  1K8R B;  2JQR B;  1SE2 A;  1TKY A;  1IPG A;  4TV3 A;  4US8 A;  1C9F A;  3C19 A;  1FNU A;  4OW0 A;  2PE9 A;  3IG3 A;  2E3T A;  1WXA A;  4RGO S;  1I7H A;  2L1A A;  2XK5 B;  5AZF A;  2DZI A;  3RYT A;  3DHH C;  2RR9 A;  2LRU A;  2MP2 A;  1NYR A;  3TL5 A;  5D6J B;  3L17 A;  1VDV A;  4KGR A;  2B3A A;  5IO9 A;  5GMV A;  5IN7 A;  4XDD A;  3DDC B;  2CU3 A;  4GXB A;  5D94 A;  2GBR A;  3TIX A;  2ZVO A;  1GUA B;  4A9A A;  2AL6 A;  2W3S A;  2BTE A;  4I6N B;  3W5V B;  2JU6 X;  3KYC D;  1PGB A;  4WUR A;  3MHZ A;  2FNJ B;  4O1N A;  4LNI A;  2PTL A;  5HKH A;  2MJE A;  1P0R A;  4EZL A;  5IKC M;  5H92 C;  1ZUD 2;  4W9J A;  4MSQ B;  2Z8L A;  4ZHP A;  3QIJ A;  4USA A;  2K5P A;  4IWP A;  2KVZ A;  2X8X X;  5DPT A;  2MBH A;  3UGB B;  3AXC A;  2WXK A;  2PMV A;  4L23 A;  3PSE B;  3CST A;  2KMC A;  1U4A A;  2NTS A;  3DOW A;  2UWQ A;  4YWG G;  4JQW C;  5JHA A;  2BW2 A;  2UYZ B;  4M8N A;  2UU7 A;  5AZG A;  2JYE A;  4RM9 A;  5CX3 A;  3ABV B;  1LFD A;  4DHJ B;  4M00 A;  4AP4 C;  1QIL A;  1JQ4 A;  5J2R A;  1D6E C;  1WXV A;  3SEB A;  1J7C A;  1MG4 A;  4WJN A;  1PUT A;  1OGW A;  1KOT A;  2D10 A;  2WYQ A;  3AI5 A;  2IPK D;  1YN3 A;  2L7R A;  2WDV B;  5JH5 C;  1D5M C;  3FIL A;  5FR6 A;  3ZNI D;  3HIZ A;  1D4B A;  1ZGU B;  1SE4 A;  1FIQ A;  3RD2 A;  1UGJ A;  3N30 A;  1XLP A;  1ENF A;  1BUI C;  4A3P A;  1N60 A;  2EKI A;  4C80 A;  3ECI A;  5LLI A;  4RGN A;  4XE0 A;  4JPS A;  1KJT A;  2JY6 A;  2JWU A;  1T0Y A;  3JSV A;  2ACZ B;  2KHW B;  4EFO A;  4G0N B;  3PT2 B;  3AED B;  1GC6 A;  1UNS A;  4C56 C;  3MTN B;  2WHI A;  2EMS A;  1WZ0 A;  4LNN A;  4XGA B;  3K9O B;  1L4Z B;  4F7Z A;  4NJC A;  2LJ5 A;  4BBN F;  4A55 A;  1FFU A;  1SEB D;  3GB1 A;  4CYE A;  1J7B A;  1OEY J;  1EU4 A;  2WXJ A;  3Q8E A;  4K7U A;  2KD0 A;  3A1Q B;  1ZE3 D;  2JRH A;  3AE8 B;  4ZRK A;  3L10 B;  3A9K B;  1DYQ A;  4A90 A;  3QCA A;  1GG3 A;  3NZS A;  1UBQ A;  1WX7 A;  3T9L A;  1DOI A;  2KQ7 A;  3DVG Y;  4PT5 A;  4HRS A;  1LGR A;  3ZDT A;  1QZE A;  2FID A;  4ASW C;  2MH7 A;  4XWT A;  4BKT A;  4RMA A;  2A4Z A;  2MP2 B;  1WSP A;  1ZDV A;  2IY1 B;  4XZ4 A;  2ZEQ A;  3E56 A;  3RNG C;  2CHW A;  3QQ8 B;  3FAH A;  1R7S A;  4XWW A;  1FNW A;  1TJE A;  4BKG A;  5BYS A;  2DZM A;  1KF6 B;  4AWJ A;  1S3S G;  3PRM B;  5AUI A;  2G3Q B;  2DYM A;  2K1F A;  2L0F A;  2KX0 A;  2NBV B;  1ET9 A;  3P2B A;  1EWC A;  4LJO B;  3NRZ A;  2KAJ A;  2KO3 A;  2W55 A;  4MSM B;  2QC8 A;  2EEL A;  4WAF A;  2NPT B;  2IZV B;  2L32 A;  1C4P A;  2V3P A;  1V8C A;  2J0J A;  2KXJ A;  3SR6 A;  2JPH A;  1L0Y B;  2BB6 A;  2KN4 A;  1M94 A;  2WXI A;  2M17 A;  4DXG A;  1VZ8 A;  2K8H A;  4B0E A;  2IGH A;  3HHM A;  2BB5 A;  2J42 A;  5HFY A;  1WJN A;  3TUO A;  4M0W A;  4M02 A;  4DXF A;  3AMZ A;  3KWV A;  4KGT A;  5J18 A;  1AN8 A;  3QA8 A;  3AEG B;  2KJH B;  4LJP B;  2NBU A;  2DNF A;  1WE7 A;  1R4M B;  3A9J A;  1NI3 A;  3R2T A;  4HPL B;  3BII D;  4WWM A;  2Y3A A;  4K7S A;  4WIP A;  3WAP A;  4YTM B;  1WH3 A;  3W2D A;  3MJW A;  1WRI A;  1D5X C;  1P7F A;  5AEK B;  4L1B A;  3RUI B;  1E90 A;  3EA6 A;  1CMX B;  1XD3 B;  3JSV B;  2GOW A;  3L0W B;  1TTN A;  2V4L A;  4EUT A;  3AV8 A;  3R2I A;  3BYT B;  3ALB A;  3BK1 A;  1L4D B;  2LI5 A;  3E9S A;  1J0G A;  2KYW A;  1SIJ A;  1AYF A;  5C3J B;  3NG0 A;  1V1O A;  5G2N A;  2MW5 A;  3WIM A;  1YX5 B;  2XN9 C;  3EEC A;  2CR5 A;  2LGX A;  1P98 A;  1SE9 A;  4GDL A;  2M0X A;  1IUE A;  2FCQ A;  3P4Q B;  1VLB A;  3DVG X;  4YSZ B;  1WIA A;  4M8M A;  1C76 A;  3TSS A;  1G6J A;  4XC2 A;  2C5L C;  2INC C;  2HTH A;  2KDE B;  3VVW B;  2LRW A;  2D3B A;  1GPX A;  4KIK A;  1ZDX A;  2ZVN A;  1L6V A;  4E74 A;  4EE2 A;  3CIR B;  1SBB B;  1XCT L;  4GSW A;  1H8C A;  3ZNG C;  3U30 A;  3AEA B;  3AE2 B;  1PFD A;  2KDF B;  1JWU D;  1C4A A;  3CWI A;  4HDQ A;  2V3S A;  3QC8 B;  3FKY A;  1V5T A;  4R3D A;  1I4P A;  4DWF A;  3PRE A;  1HTO A;  4NAM A;  2DYO A;  1WFY A;  2MSE D;  3I63 C;  4W9K A;  4PS8 A;  2DZJ A;  4YL8 A;  2SEB D;  4K3C A;  3LXF A;  1SGH A;  3ENE A;  4TSS A;  3OJ3 A;  3A4R A;  2DAJ A;  2WXH A;  2OJW A;  5DPR A;  2D2Q A;  4J6I A;  3RNE C;  2KLC A;  3PLV A;  4KV2 A;  4B0M A;  2W9N A;  2G4S A;  4FHJ A;  2DZK A;  2IY0 B;  5EE0 A;  1I4G A;  3H9D A;  3OAW A;  1E7U A;  2EKE C;  1PQS A;  3Q6B A;  4G3X B;  1NBF C;  1F52 A;  2KT7 A;  4AQ7 A;  2KWV B;  3Q8A A;  1ZP0 B;  2IND C;  4YTN B;  2O6V B;  2OJR A;  2KWD A;  4W9I A;  2V1Y A;  2IO3 B;  4M0W B;  3ZTD A;  1I35 A;  1UH6 A;  1LQB A;  3MC8 A;  5IA7 A;  4AS1 A;  1WXM A;  1YOV B;  4ACF A;  2ZCB A;  3MC9 A;  2INP E;  4GLS C;  2YEP F;  3SDL C;  1FEH A;  1N5X A;  2K6Q A;  4W9H A;  3PS6 A;  3R7R A;  3ZRC A;  1RWS A;  4RFB A;  2W82 A;  4BKS A;  1GOZ A;  3B0A A;  1CZP A;  2GB1 A;  2JRI B;  1YN4 A;  2D5G A;  2HDE A;  3Q2A C;  2K22 A;  3K9P B;  4N58 A;  3EHV A;  4G11 A;  2VZK B;  2KWU B;  2CHX A;  1S1Q B;  3Q8F A;  2Z0D B;  4GU2 A;  2JZZ A;  1MVK A;  3T8M A;  1YQ3 B;  2WDQ B;  1K53 A;  3ZJV A;  3VFK A;  5GXG B;  2WDR B;  2JVC A;  1DOY A;  3W1S A;  3CSF A;  3V05 A;  1T0Q C;  3X0W A;  1MJD A;  1FM0 D;  2GBJ A;  2KDB A;  1WX9 A;  2IGG A;  1Y56 A;  2BKF A;  1OEY A;  2ZZP B;  1UD7 A;  1WJU A;  1Z2M A;  2CJO A;  2LD9 A;  3W1Y A;  3SFD B;  1HZ5 A;  1FRR A;  4IWO A;  4B95 A;  2B76 B;  1MHH E;  1V97 A;  4FN2 A;  4FBJ B;  3KWL A;  4GDL B;  3APD A;  3I5J C;  3SU8 X;  1TS4 A;  1P3Q U;  1EF5 A;  5BMH A;  4MGI E;  2NBW B;  2CU1 A;  3KUD B;  3ZJT A;  3H7S A;  1UWM A;  3VTU A;  3V6E B;  2QMT A;  4NQL B;  1TBE A;  4I6L B;  2KDI A;  3PO0 A;  4LNF A;  2ZW0 A;  3IXS A;  1T0S C;  5EE3 A;  3VQI A;  2Y5C A;  1L7Y A;  4LTU A;  3ZUN A;  4KIK B;  2WDT B;  3B9J A;  2JF5 A;  3U2S C;  5IOI A;  3M3J A;  1CQV A;  1E5W A;  2RPQ A;  1HA5 A;  2VRR B;  4KVG B;  1P9D U;  2V0G A;  3DBL B;  3ZJU A;  1WGG A;  1VR9 A;  4N59 A;  3MC0 B;  4HDO A;  4E71 A;  2REX A;  1HXY D;  1L2N A;  2PE6 B;  4OZB A;  2KMA A;  1YJJ A;  2FE8 A;  2ZCC A;  5E6N A;  1FCL A;  1ACC A;  2MBO A;  2PEA A;  2ICI A;  4II2 B;  2KC1 A;  1EM7 A;  1QLB B;  3RN9 C;  2DWQ A;  4W9G A;  2L3Z A;  4RM8 A;  2D11 A;  3TMP B;  4GIV A;  3RCZ A;  4MGK E;  1KTK A;  4K81 A;  1EO6 A;  4PYZ A;  1WGD A;  2NS5 A;  3PVL A;  3NS1 A;  3NVY A;  3M63 B;  1SJE D;  2C60 A;  1Q10 A;  2LVO A;  1J19 A;  1WM2 A;  2LGI A;  2V4I B;  1J7A A;  4ANU A;  4DHZ E;  1N61 A;  4YT0 B;  1YD8 U;  3GZN I;  4KZ0 A;  3UI3 A;  3VR9 B;  3N32 A;  4G50 A;  1LO5 D;  3L54 A;  3RFZ B;  5D3D A;  1A70 A;  2BF8 B;  4ZOH C;  4JLC A;  1N5W A;  1YJI A;  3DCG A;  5DPS A;  1RAX A;  1OQQ A;  3HK0 A;  2ON8 A;  1WGY A;  2PKO A;  2NR2 A;  2LXC A;  1WI0 A;  1YMH E;  1E0Z A;  3RPF C;  1YN5 A;  5G5G A;  4ZRQ A;  2MHJ A;  2O6V D;  3ZTC A;  4BOS C;  1LXD A;  4PYU A;  4MAC A;  4TQ0 A;  4AJW A;  2LGD A;  2MBE A;  2RPV A;  4W9C A;  3P42 A;  2BVC A;  1LM8 B;  3KUC B;  4H2A A;  2I1J A;  3NY5 A;  1TZ1 A;  4JX1 C;  1WZ3 A;  4ZRP A;  4DDG D;  3AM9 A;  3LDZ E;  3Q8B A;  2K3U A;  4NZL B;  2SAK A;  3V60 A;  2MCN B;  4FJV B;  2N4F A;  5IAA C;  1KH0 A;  4J3O D;  2N1W A;  2VZK D;  1ZPS A;  2WXM A;  5HG2 A;  3I9V 1;  2MX2 A;  3U7D A;  2ZPY A;  3SHQ A;  1AAR A;  3BIN A;  3CMM B;  1TT5 B;  2BS4 B;  3H6N A;  2LJI A;  2LWP A;  4DBG A;  1IP9 A;  3WCQ A;  5BYR A;  1SSN A;  1BML C;  2AL3 A;  2GI9 A;  3L16 A;  1JWB D;  2O2V B;  4XYC A;  1V80 A;  2G9H D;  3LJ3 A;  5IP4 D;  3P4S B;  4CO7 A;  1A5R A;  2IBI B;  2JWZ A;  3UQA A;  4GDK A;  2N9L A;  4WWP A;  1Q0W B;  5DCN A;  3B2G A;  3HVZ A;  1N62 A;  3ZVV A;  2KTR B;  1Y8R C;  2BWE S;  4EEW A;  4RGM A;  3APF A;  3NVZ A;  3NS8 A;  3Q14 C;  4US9 A;  1WGH A;  2DLB A;  3SD5 A;  4BOZ B;  1STE A;  1E7V A;  1FFV A;  3MHS D;  2WWZ A;  4DQO C;  2R2O A;  1HEZ E;  3GE3 C;  1R4N I;  4MJS A;  2N9X A;  4KKJ A;  3OWE B;  3WAN A;  4RNA A;  1QOG A;  2DX5 B;  2AWT A;  1KLU D;  3AEF B;  3CF6 E;  1V86 A;  2M1M A;  2KWC A;  5FKA C;  1TKE A;  3JW0 X;  4KKI A;  2BPS A;  3PZD A;  4Q2J A;  3R3M A;  4LCD E;  1T0R C;  2L8J A;  2KKC A;  1UWX A;  2WXG A;  1GB4 A;  1JWM D;  3TCA A;  3DBS A;  4LK0 M;  2FUH B;  2KQ4 X;  2BWF A;  4C00 A;  1ET6 A;  3TEX A;  4RF0 A;  3Q3O C;  2JZP A;  3ML9 A;  1FXA A;  4AJY B;  1E8X A;  2EMT A;  3R7Q A;  3R8B A;  3VUW A;  2KNB A;  3QK0 A;  3AE4 B;  3ZGZ A;  3DVN V;  3I57 A;  2N1V A;  1F0Z A;  2C7M B;  3VTW A;  1I42 A;  2IO1 B;  4NAW A;  4KGS A;  4OHJ A;  4C4V A;  2BYT A;  1XXG A;  3C0R B;  1WE6 A;  5CHW A;  3IVF A;  1OQR A;  1ZW7 A;  2D3C A;  3ZIM A;  3H7P A;  1K52 A;  1GJZ A;  2J52 A;  2WXR A;  2WQY B;  2PPH A;  4ZRI A;  3FIL B;  1KFY B;  1GNU A;  1WXQ A;  2G4D B;  3C8Y A;  3BWU D;  4JWU C;  3ML8 A;  4NY0 A;  1YJ1 A;  4DHJ D;  5KHQ A;  3EFC A;  3VHT C;  2PVG C;  2IGD A;  4IWQ A;  1HE8 A;  4W9F A;  3AUL A;  3O13 A;  3D32 A;  2K0P A;  4DK5 A;  2H89 B;  2WGS A;  3UIO B;  4EZK A;  4PS7 A;  4BBN C;  1TKG A;  2BQQ A;  3KW5 B;  3VH4 B;  4F1S A;  2LGS A;  4II3 B;  2CJN A;  4TUU A;  4YXD B;  1IYF A;  2ASQ A;  2VH1 A;  1T3Q A;  1Z5S B;  3TEZ A;  4GGQ A;  3VUX A;  1E10 A;  3B08 A;  2KJR A;  4MH8 A;  2KTF A;  3BY4 B;  2J7Q B;  3AU5 A;  2HE7 A;  4A3O A;  2IDY A;  2Q5W D;  3JVZ X;  1KLG D;  4HEA 1;  3FC4 A;  2AQ1 B;  4NJ6 A;  2RSU A;  2BYV E;  2K8B A;  3BYY B;  1WF9 A;  2RGF A;  3V61 A;  3ZW3 A;  2WXN A;  3NOB A;  1E9M A;  3RNC C;  4WJQ A;  1FXI A;  2DYB A;  2H88 B;  1N6Z A;  5CTR C;  3UIN B;  4ARI A;  4FAD A;  2MQJ A;  1JCK B;  1V49 A;  1L5P A;  1QKZ A;  4I6P A;  2RDB C;  1XO3 A;  1YQ4 B;  1WMH A;  2YLM A;  3ZXV A;  3NVW A;  2MBB B;  2N9K A;  2YEP B;  4KX6 B;  4MJS B;  2J0M A;  1ZOY B;  3UQB A;  1FXT B;  3T3O A;  2RDH A;  2HD5 B;  4OZC A;  5JZE B;  2DBY A;  1TS5 A;  3DBR B;  2MRP A;  4D2K A;  1B1Z A;  1V2Y A;  2BBC A;  2CS4 A;  1VJK A;  2V9H A;  3AE7 B;  2C9W B;  5G5H A;  5BO4 B;  2QCZ A;  4OVZ A;  3AEC B;  3AU4 A;  3UF8 A;  1XLO A;  1JRO A;  3IT4 B;  1F2R C;  2C7N B;  4OVV A;  2QSD A;  2IYD B;  4S17 A;  1UEL A;  4YSX B;  2XK5 A;  2KOX A;  3P63 A;  4GB9 A;  4IM2 A;  3PGE A;  1TGZ B;  2OOB B;  1JRP A;  2KC2 A;  3RNA C;  4ANV A;  2KFJ A;  2LHD A;  3P1M A;  1V1P A;  4PS3 A;  1VZ7 A;  5KHO A;  5AUK A;  1XCQ L;  3U7Z A;  3ONS A;  2X38 A;  4NAW B;  4IM0 A;  3J9C A;  3DPD A;  1B9R A;  1WYG A;  2L00 B;  3EUB 2;  1QOA A;  2QIE B;  4DDI D;  2AQ2 B;  3RUL A;  2LUM A;  3KLS X;  3L13 A;  4BFR A;  2NTT A;  3RNF C;  4AUQ C;  4QAY A;  3GZN B;  4HKZ E;  3LYY A;  2LUE A;  3H1U A;  2HTM E;  2N9E B;  1Q5W B;  3L08 A;  2XBB C;  3GS2 A;  3U4E G;  3T3N A;  2K8C A;  4WWO A;  1QOF A;  2JUO A;  3A9J B;  4IKG A;  2KZR A;  2N7J A;  5LXI B;  4HPP A;  3MFG A;  5E6J A;  2L0T A;  3AE1 B;  4P1C C;  4JWS C;  3ZKJ C;  1YQB A;  1E8W A;  4FJY A;  4A8X C;  3OJ4 B;  1ROE A;  2N7D A;  1NEN B;  4W9D A;  3ZQ4 A;  2WU5 B;  1ZXH A;  2LVQ A;  4DHZ B;  3IT6 B;  2RDG A;  4DXA B;  3HUI A;  3HVD A;  2W3R A;  3DHI C;  5BMG A;  4W9E A;  1MHX A;  2KMM A;  2RD0 A;  1JML A;  1BT0 A;  3NVV A;  4LNK A;  3U8Z A;  3DBH I;  1JRU A;  4IOI E;  2NCN A;  1F77 A;  2FUG 1;  3EFU A;  3R66 C;  1ISN A;  5HHD G;  3V3X A;  1K51 A;  1OTR B;  4YSY B;  2WNM A;  3NZ3 A;  1WGK A;  3P4R B;  3MP9 A;  4ZRJ A;  3HM6 X;  3RNB C;  4MDK E;  1OFF A;  1XLQ A;  3PLU A;  2AYO B;  4ZYN A;  3RZF A;  1K50 A;  2FAZ A;  5D2M B;  3V6C B;  2K6D B;  5LNK 1;  1WR6 E;  3RMK C;  1AW7 A;  4XDC A;  4ITK A;  3SFE B;  5FR3 A;  1WMH B;  2KQS A;  1DOX A;  3I3T B;  1WGR A;  4OVU A;  2QHO A;  2L05 A;  2LMC A;  4HRO A;  3HRD D;  1GB1 A;  1TS2 A;  4MM3 A;  2ZNV B;  1BXT A;  1HQR D;  5C2T B;  5JHB A;  4ANX A;  3AE5 B;  2WP9 B;  4P16 A;  2LGY A;  3AN1 A;  1WRD B;  1C4C A;  4TMA B;  4MT5 A;  4NJ7 A;  2PW9 A;  2M4N A;  1SE3 A;  5CHF A;  5E6O A;  2LEK A;  4HXD A;  1HZ6 A;  2R61 A;  3KVF B;  2FCM A;  2Y5B B;  2Z59 B;  5E6P A;  1R4N B;  2M8S A;  1KM7 A;  2QDF A;  2QJL A;  3VDZ A;  1VZ6 A;  4LDT B;  2JX5 A;  3DWG C;  1N63 A;  4P7I A;  2INN E;  5J17 A;  1D3Z A;  3Q69 A;  1C77 A;  4F8C B;  4KDL B;  1V1P B;  1C79 A;  1MPE A;  5D7G A;  3Q3F A;  2N0S B;  1XF5 L;  2FCN A;  4FLH A;  3NHE B;  1JAL A;  4HVB A;  4HJK A;  5H8Y E;  3LB8 C;  2KX3 A;  1MI0 A;  3N1X C;  4P6V F;  3AEE B;  1V81 A;  4GMV A;  4K7W A;  3PPA A;  2NPT A;  2A5U A;  2GRI A;  3QAR A;  3N3K B;  1UGM A;  2RMM A;  4HCN B;  1SF0 A;  2LVP A;  2IO2 B;  2I1K A;  4HCP B;  2GLS A;  3WAO A;  3DHG C;  2IJ0 A;  1GC7 A;  2G45 B;  2OED A;  2L76 A;  1T5X D;  4MGY E;  4FA6 A;  4P1B C;  1QF6 A;  2KAN A;  1D5Z C;  3VXW A;  3ZDM C;  2BKR B;  1TY2 A;  3WAL A;  1X1M A;  3X23 A;  2AQ3 B;  3S2A A;  1KRH A;  2W54 A;  3H8H A;  1C3T A;  2D07 B;  4RF1 A;  2WXQ A;  2WXP A;  1C1Y B;  3VH3 B;  3HM3 A;  3PRZ A;  1FD6 A;  2MJD A;  1SJH D;  2XEW A;  1V9J A;  2G1E A;  2BS3 B;  2NVU I;  3IFW B;  3Q3N C;  3QWZ B;  3PRP B;  1WJ6 A;  3VRB B;  4ANW A;  3IAS 1;  5HI1 A;  2Z0E B;  1QQR A;  3UIP B;  2D3G A;  3IAM 1;  4B6W A;  5AZH A;  1E8Z A;  1IBX A;  5D3I B;  1FPY A;  1QT9 A;  4M01 A;  2FCS A;  1CK1 A;  4HKQ A;  2R2Q A;  3GOE A;  3M95 A;  3AH7 A;  3Q3M C;  3URY A;  2LAS A;  2PVO D;  1EUV B;  4EKU A;  4WH4 A;  3BVM A;  3KUZ A;  2L83 A;  4IC7 B;  1SB3 C;  4EOY A;  2GBM A;  3BVZ A;  2N9P C;  3W9C B;  2E6X A;  2K39 A;  3GE8 C;  4HWI B;  3PTF C;  4XX5 A;  2KAC A;  3DBL I;  4MM3 B;  1MG8 A;  3PZ8 A;  2KLG A;  3KYD D;  3QAQ A;  1E8Y A;  1AWD A;  1XT9 B;  1NI2 A;  2GBK A;  2TSS A;  2AEH A;  5C1Z A;  4OZA A;  1YIW A;  3VTV A;  2GBN A;  4ICV A;  3N1Y C;  4CQN A;  1JWS D;  2IO0 B;  2MJ3 A;  2J0K A;  3ZO5 B;  2BS2 B;  4BZA A;  1GAQ B;  2YVC A;  2M0A A;  2KK8 A;  3PV1 A;  4X57 B;  3AE9 B;  4MH0 E;  1VCB A;  5L83 A;  1I4Q A;  1L6U A;  4FXC A;  5EE9 A;  3N20 C;  5BYQ A;  2WLB A;  4ICU A;  1ESF A;  3AEB B;  4IW0 A;  1NVI D;  2M19 A;  4ZYS A;  2BYF A;  3TJP A;  2I2Y A;  2DEN B;  2WXL A;  5EE1 A;  3PHW B;  1F9J A;  2ZNV C;  3AE3 B;  4LDT D;  5C23 A;  4WAA A;  2VH2 A;  4JL9 A;  4JIO U;  2J4X A;  3VR8 B;  3EGR A;  1UF0 A;  5TSS A;  4NQK E;  4REZ A;  5G55 A;  3DQV A;  3ZLZ A;  2MEK A;  2GMI C;  1EU3 A;  1RLF A;  1SXT A;  3VRA B;  1WY8 A;  4ARC A;  3P4P B;  1FRD A;  1FMA D;  3A4S C;  1VD2 A;  1RRB A;  2LXA A;  3RI7 C;  1I4X A;  2O6V A;  2WS3 B;  4W9L A;  4A6Q A;  3BZD B;  1WWT A;  4BKS D;  5I4D A;  2OHF A;  3AB5 A;  4MEM A;  2WX1 A;  1JWA D;  3TBL D;  2MA9 B;  3NUH B;  3KH0 A;  3QHT A;  3Q3J A;  1TIF A;  2D3A A;  3MJ5 A;  1TY0 A;  1C78 A;  2V3N A;  1KLV A;  3ZNZ B;  1XEE A;  2I38 A;  4HPM B;  2CHZ A;  1RFK A;  1RYJ A;  1TS3 A;  4IDI A;  2K25 A;  3NJT A;  1PDX A;  3ETR A;  2JT4 B;  1RM6 C;  1IBX B;  1F1H A;  1UZX B;  2L52 A;  2KFK A;  2LZ6 A;  2DHZ A;  1PYW D;  4JE3 B;  5FK9 C;  4BAX A;  2PJH A;  4BVU C;  1UUP A;  1WR1 A;  4GDK B;  2KVR A;  1UBI A;  1M4V A;  2FIF A;  1I4R A;  3DBH B;  3ZYY X;  3DWM A;  3W1S C;  2XNA C;  1F2R I;  4WWN A;  2KJ6 A;  4FHK A;  5JXV A;  2ONQ A;  1VRA B;  2M56 B;  3IHP C;  2ZPN A;  4E3C A;  1TZO A;  5BMI A;  4WJO A;  4TQ1 A;  1IGD A; 
#chains in the Genus database with same CATH homology
 4W9E A;  3HK0 A;  4BKG A;  1WGY A;  1NDD A;  2DZM A;  2JZ3 B;  1WI0 A;  2LXC A;  2NR2 A;  2RD0 A;  4AWJ A;  1BT0 A;  1S3S G;  3PRM B;  2G3Q B;  2DYM A;  2K1F A;  2L0F A;  3U8Z A;  3DBH I;  1JRU A;  2O6V D;  3ZTC A;  2NCN A;  4BOS C;  1LXD A;  4PYU A;  2KX0 A;  2NBV B;  4IUM B;  4NPN A;  5TR5 A;  3EFU A;  3R66 C;  1ISN A;  4HLE A;  3P2B A;  4TQ0 A;  4LJO B;  4AJW A;  4JGH B;  2KO3 A;  2LGD A;  2MBE A;  4MSM B;  4W9C A;  3KUC B;  1OTR B;  1LM8 B;  2NPT B;  2I1J A;  2IZV B;  3NY5 A;  1TZ1 A;  1WM3 A;  4CHK A;  1WZ3 A;  3WA0 A;  4ZRJ A;  4DDG D;  2J0J A;  3LDZ E;  2KXJ A;  3HM6 X;  5CHV C;  3VUY A;  4MDK E;  2JPH A;  4URK A;  3V60 A;  2MCN B;  3PLU A;  2AYO B;  4FJV B;  4ZYN A;  1M94 A;  3RZF A;  2N4F A;  4GOC A;  2M17 A;  1WX8 A;  2FAZ A;  5D2M B;  5IAA C;  3V6C B;  2K6D B;  2N1W A;  1WR6 E;  3QJZ A;  4ZDV A;  2K8H A;  2WX0 A;  4WJP A;  4N9F 4;  3HHM A;  2MX2 A;  3U7D A;  1WJN A;  1H4R A;  1J8C A;  2ZPY A;  1WMH B;  2KQS A;  1AAR A;  3SHQ A;  3BIN A;  3CMM B;  2JXX A;  3H6N A;  1P1A A;  3I3T B;  1WGR A;  4K1R B;  4OVU A;  2QHO A;  2L05 A;  2LWP A;  4DBG A;  3O65 B;  4AOF A;  3DVN U;  5J18 A;  1IP9 A;  3QA8 A;  4MM3 A;  2ZNV B;  2AL3 A;  2KJH B;  4LJP B;  2NBU A;  3B1L X;  5JHB A;  1WE7 A;  4ANX A;  3L16 A;  3V62 A;  1ZKH A;  4IG7 B;  1WXS A;  2MBQ A;  2LGY A;  3A9J A;  1WRD B;  1XQQ A;  4HPL B;  2O2V B;  1V80 A;  3LJ3 A;  4NJ7 A;  2M4N A;  2N7E A;  4K7S A;  4MGZ E;  4CO7 A;  5CHF A;  5E6O A;  5L95 C;  1A5R A;  1EF1 A;  2IBI B;  2JWZ A;  4HXD A;  3EC8 A;  3KVF B;  3UQA A;  4GDK A;  3A33 B;  3WAP A;  2FCM A;  4GN1 A;  2Y5B B;  2Z59 B;  4WWP A;  5E6P A;  1Q0W B;  1WH3 A;  5DCN A;  3MJW A;  3H7P B;  2M8S A;  4HK2 A;  1KM7 A;  3ZVV A;  3QX1 A;  5AEK B;  2BGF A;  2KTR B;  1Y8R C;  4MEL A;  3RUI B;  5EDS A;  3VDZ A;  1E90 A;  4LDT B;  3APC A;  1CMX B;  1XD3 B;  2BWE S;  4EEW A;  4P7I A;  3ZNH B;  5J17 A;  1R4M I;  3APF A;  3JSV B;  1D3Z A;  3NS8 A;  2GOW A;  2HJ8 A;  3L0W B;  4F8C B;  4KDL B;  1TTN A;  2V4L A;  4EUT A;  1WGH A;  3SD5 A;  4EZJ A;  4BOZ B;  3ALB A;  1E7V A;  3MHS D;  5D7G A;  3Q3F A;  2WWZ A;  2R2O A;  2FCN A;  2LI5 A;  3M62 B;  4FLH A;  3NHE B;  4KSK C;  4HVB A;  4HJK A;  1R4N I;  1J0G A;  2KX3 A;  1WYW B;  4MJS A;  3JYU A;  2N9X A;  5DPW A;  3WAN A;  5G2N A;  4A20 A;  1V81 A;  2MW5 A;  3WIM A;  4GMV A;  1YX5 B;  2DX5 B;  2AWT A;  3EEC A;  3IBE A;  3CF6 E;  1Q1O A;  4K7W A;  3PPA A;  2CR5 A;  2LGX A;  1P98 A;  2NPT A;  4KZC A;  1SE9 A;  3WAM A;  4GDL A;  1V86 A;  2M0X A;  2M1M A;  2FCQ A;  2KWC A;  2A5U A;  3JW0 X;  3DVG X;  3QAR A;  2BPS A;  1WIA A;  1YX6 B;  2KFK B;  3PZD A;  2MLB A;  1UGM A;  3N3K B;  3R3M A;  4M8M A;  4LCD E;  4HCN B;  1G6J A;  2L8J A;  2LVP A;  4KDI C;  4XC2 A;  5LXH A;  2C5L C;  2IO2 B;  2I1K A;  2KDE B;  2HTH A;  3ZRF A;  4FUL A;  1RFA A;  1V5O A;  4HCP B;  3VVW B;  2DAF A;  2KKC A;  2BYE A;  3WAO A;  2LRW A;  1GC7 A;  2G45 B;  2L76 A;  2KN5 A;  4KIK A;  3TCA A;  2ZVN A;  3DBS A;  2FUH B;  2BWF A;  1V6E A;  4E74 A;  1SIF A;  4GSW A;  1H8C A;  2MWS B;  4MGY E;  4FA6 A;  3ZNG C;  3RZW C;  2KAN A;  3ML9 A;  3U30 A;  3VXW A;  3ZDM C;  2BKR B;  3RT3 B;  4AJY B;  1OQY A;  2KDF B;  1E8X A;  4B9K A;  2EMT A;  3R7Q A;  3WAL A;  1X1M A;  3X23 A;  3VUW A;  2KNB A;  3QK0 A;  3S2A A;  1C3T A;  4HDQ A;  4WQO B;  2D07 B;  2V3S A;  3DVN V;  3VH3 B;  1C1Y B;  3QC8 B;  3HM3 A;  3PRZ A;  2N1V A;  4FJZ A;  3NZU A;  2C7M B;  3VTW A;  1V5T A;  4NNJ B;  1I42 A;  2IO1 B;  2C7H A;  3PHX B;  4NAW A;  2XEW A;  1V9J A;  4DWF A;  4IM3 A;  3PRE A;  4KSL C;  2NVU I;  3IFW B;  3QWZ B;  2O2V A;  3PRP B;  2DYO A;  1WFY A;  1WJ6 A;  2MSE D;  4W9K A;  4PS8 A;  2DZJ A;  4YL8 A;  4ANW A;  3C0R B;  1WE6 A;  3OLM D;  5CHW A;  2ZJD A;  3IVF A;  3VAW A;  2Z0E B;  3A1Q A;  1ZW7 A;  3UIP B;  2D3G A;  4TKN A;  4B6W A;  1SGH A;  3ENE A;  3ZIM A;  3OJ3 A;  5AZH A;  3A4R A;  1E8Z A;  2DAJ A;  3A9K A;  3H7P A;  5DPR A;  2D2Q A;  3DBR I;  2KTR A;  1WJ4 A;  1GJZ A;  4J6I A;  2FCS A;  2KLC A;  2CKH B;  1K8R B;  3PLV A;  2R2Q A;  3GOE A;  4KV2 A;  2PPH A;  2W9N A;  3M95 A;  4ZRI A;  1GNU A;  2LAS A;  1IPG A;  2G4S A;  2DZK A;  2G4D B;  2IY0 B;  4FHJ A;  1EUV B;  3H9D A;  4TV3 A;  3OAW A;  3ML8 A;  4NY0 A;  1YJ1 A;  4DHJ D;  4EKU A;  5KHQ A;  1E7U A;  2EKE C;  1PQS A;  2PE9 A;  4G3X B;  3IG3 A;  3VHT C;  1NBF C;  1WXA A;  4IWQ A;  1HE8 A;  4W9F A;  3AUL A;  2XK5 B;  3KUZ A;  5AZF A;  2DZI A;  3D32 A;  2KWV B;  4IC7 B;  3RYT A;  2RR9 A;  4DK5 A;  2LRU A;  2MP2 A;  2O6V B;  2OJR A;  3TL5 A;  4EOY A;  4W9I A;  5D6J B;  2GBM A;  2V1Y A;  2N9P C;  3L17 A;  3UIO B;  4EZK A;  2IO3 B;  4PS7 A;  4BBN C;  4M0W B;  3ZTD A;  1I35 A;  2K39 A;  1UH6 A;  2B3A A;  1LQB A;  5GMV A;  5IA7 A;  3KW5 B;  3DDC B;  4HWI B;  3PTF C;  1WXM A;  2ZCB A;  4XX5 A;  4GXB A;  5D94 A;  3VH4 B;  2GBR A;  3DBL I;  4F1S A;  3TIX A;  2ZVO A;  4II3 B;  1GUA B;  1MG8 A;  2KLG A;  2AL6 A;  3KYD D;  4TUU A;  3SDL C;  3QAQ A;  2K6Q A;  4I6N B;  1IYF A;  1E8Y A;  3KYC D;  4W9H A;  1XT9 B;  3PS6 A;  2ASQ A;  3R7R A;  1NI2 A;  1Z5S B;  2GBK A;  3ZRC A;  2FNJ B;  4BKS A;  4GGQ A;  3VUX A;  3B0A A;  5HKH A;  2AEH A;  2JRI B;  5C1Z A;  3B08 A;  1P0R A;  2KJR A;  4EZL A;  1YIW A;  3VTV A;  2GBN A;  2KTF A;  3K9P B;  4ICV A;  3BY4 B;  3EHV A;  4G11 A;  2J7Q B;  2KWU B;  4W9J A;  3AU5 A;  2HE7 A;  2CHX A;  4A3O A;  4MSQ B;  1S1Q B;  2IO0 B;  3JVZ X;  2Z0D B;  3QIJ A;  4IWP A;  4GU2 A;  2JZZ A;  2J0K A;  3T8M A;  3ZO5 B;  3VFK A;  2YVC A;  4NJ6 A;  2RSU A;  2BYV E;  2K8B A;  2KK8 A;  1WF9 A;  2RGF A;  3PV1 A;  2JVC A;  4X57 B;  3V61 A;  3ZW3 A;  4MH0 E;  3NOB A;  1VCB A;  5L83 A;  4WJQ A;  5DPT A;  2MBH A;  3UGB B;  2DYB A;  3AXC A;  3W1S A;  3CSF A;  5CTR C;  3UIN B;  4FAD A;  3X0W A;  3PSE B;  3CST A;  2GBJ A;  2KDB A;  2MQJ A;  1WX9 A;  4ICU A;  2KMC A;  1U4A A;  3DOW A;  4IW0 A;  2UWQ A;  1V49 A;  4JQW C;  2BKF A;  1OEY A;  2ZZP B;  4I6P A;  5JHA A;  1UD7 A;  2BYF A;  2UYZ B;  4M8N A;  1WJU A;  3TJP A;  1WMH A;  2DEN B;  5AZG A;  1Z2M A;  2YLM A;  3PHW B;  2LD9 A;  2MBB B;  1F9J A;  2ZNV C;  4MJS B;  3W1Y A;  2J0M A;  4RM9 A;  5CX3 A;  4LDT D;  5C23 A;  3UQB A;  1LFD A;  4WAA A;  4DHJ B;  1FXT B;  4AP4 C;  4IWO A;  4B95 A;  4JL9 A;  2HD5 B;  4JIO U;  5J2R A;  5JZE B;  1WXV A;  2MRP A;  4NQK E;  5G55 A;  1V2Y A;  4FN2 A;  4WJN A;  4FBJ B;  3DQV A;  2CS4 A;  4GDL B;  3ZLZ A;  1OGW A;  3APD A;  3SU8 X;  2C9W B;  1P3Q U;  2GMI C;  5BO4 B;  1EF5 A;  1KOT A;  1RLF A;  2D10 A;  4MGI E;  2NBW B;  2WYQ A;  3AI5 A;  2CU1 A;  2L7R A;  3AU4 A;  3KUD B;  3H7S A;  3UF8 A;  5JH5 C;  3VTU A;  3V6E B;  1WY8 A;  5FR6 A;  4NQL B;  3ZNI D;  1TBE A;  2C7N B;  4I6L B;  2KDI A;  3HIZ A;  4OVV A;  1ZGU B;  2IYD B;  3RD2 A;  3N30 A;  3VQI A;  3ZUN A;  1L7Y A;  3A4S C;  1UEL A;  1VD2 A;  4KIK B;  4A3P A;  2WDT B;  2KOX A;  2XK5 A;  2JF5 A;  1RRB A;  2LXA A;  4GB9 A;  4IM2 A;  3M3J A;  2O6V A;  3PGE A;  3ECI A;  5LLI A;  4W9L A;  1E5W A;  1TGZ B;  2RPQ A;  1KJT A;  2JY6 A;  2VRR B;  2OOB B;  4KVG B;  4BKS D;  1P9D U;  1T0Y A;  3JSV A;  1WGG A;  2KHW B;  4EFO A;  4G0N B;  2KC2 A;  4HDO A;  4E71 A;  2REX A;  4ANV A;  1L2N A;  3PT2 B;  4MEM A;  2WX1 A;  2KFJ A;  1GC6 A;  2PE6 B;  2KMA A;  3TBL D;  3MTN B;  4PS3 A;  2MA9 B;  5KHO A;  3KH0 A;  2EMS A;  2ZCC A;  1WZ0 A;  3QHT A;  5E6N A;  3Q3J A;  3K9O B;  3ONS A;  2MBO A;  2PEA A;  4NAW B;  4F7Z A;  4II2 B;  2KC1 A;  4IM0 A;  3DPD A;  2LJ5 A;  2L00 B;  4BBN F;  4W9G A;  2L3Z A;  4DDI D;  1KLV A;  4CYE A;  3RUL A;  1OEY J;  3L13 A;  4BFR A;  4RM8 A;  4K7U A;  3ZNZ B;  4AUQ C;  2D11 A;  4HPM B;  2CHZ A;  2KD0 A;  3A1Q B;  4GIV A;  3TMP B;  2JRH A;  2K25 A;  3RCZ A;  2LUE A;  4MGK E;  3H1U A;  4K81 A;  4ZRK A;  2N9E B;  1EO6 A;  1Q5W B;  4PYZ A;  3L10 B;  3L08 A;  3A9K B;  1WGD A;  2JT4 B;  2NS5 A;  2XBB C;  3PVL A;  2K8C A;  4WWO A;  3M63 B;  1GG3 A;  1UZX B;  3NZS A;  3QCA A;  1UBQ A;  1WX7 A;  2C60 A;  2JUO A;  3A9J B;  2KFK A;  3T9L A;  2KZR A;  2LZ6 A;  5LXI B;  2KQ7 A;  2DHZ A;  2LVO A;  3DVG Y;  2L0T A;  1J19 A;  1WM2 A;  3ZKJ C;  1YQB A;  1QZE A;  3ZDT A;  1E8W A;  2PJH A;  4BVU C;  2FID A;  4ASW C;  1WR1 A;  4GDK B;  4FJY A;  2KVR A;  1UBI A;  4ANU A;  2FIF A;  4DHZ E;  4BKT A;  3OJ4 B;  2N7D A;  1YD8 U;  3GZN I;  4RMA A;  2A4Z A;  4KZ0 A;  4W9D A;  3W1S C;  2MP2 B;  2IY1 B;  3N32 A;  4G50 A;  3L54 A;  4XZ4 A;  4WWN A;  2KJ6 A;  2LVQ A;  4FHK A;  2ZEQ A;  2BF8 B;  4JLC A;  4DHZ B;  3IHP C;  2ZPN A;  4DXA B;  2CHW A;  3QQ8 B;  4E3C A;  3DCG A;  5DPS A;  4WJO A;  4TQ1 A;  1RAX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...