2DZKA

Structure of the ubx domain in mouse ubx domain-containing protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
GSSGSSGRDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDILMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the UBX domain in Mouse UBX Domain-Containing Protein 2
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords UBX domain-containing protein 2
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dzkA01
5DPSA 2R2QA 3SU8X 4E3CA 2CHXA 3MHSD 2KKCA 3WAOA 2ZNVB 2Z59B 2KNBA 4HWIB 5AEKB 1EUVB 2MBQA 3I3TB 5AZHA 4WAAA 2D11A 4MGKE 1ZW7A 3EHVA 3RCZA 2DZKA 5CTRC 4HPMB 1V2YA 3ZRCA 2C5LC 2ZNVC 4I6NB 3V6EB 4AOFA 2BKFA 4MGZE 3L0WB 5J2RA 1E7VA 2O6VB 2DZJA 4II2B 1M94A 3HK0A 2DZIA 4GXBA 3QJZA 2KK8A 3TCAA 3BINA 4J6IA 4M8MA 4W9DA 2NBWB 3N30A 5CHVC 1TTNA 2GBNA 3APDA 4A20A 4BOZB 5CX3A 1C1YB 3H9DA 3K9OB 1FXTB 2A5UA 4FADA 2KJ6A 4GGQA 1P98A 2ZEQA 2LJ5A 2PJHA 1NBFC 2L00B 3NZSA 2BYEA 2BWFA 1UBQA 2KVRA 3JW0X 3T9LA 2MBHA 2MA9B 3RD2A 1X1MA 4HJKA 5D6JB 2XK5A 4DK5A 3W1SA 2O6VD 1KOTA 1S1QB 2KWUB 2LXCA 3GOEA 2K39A 2NS5A 3B0AA 3DBLI 2CR5A 4K7SA 1E5WA 3KUCB 3QA8A 4YL8A 4E74A 2V4LA 1WJ4A 2UWQA 1J0GA 1D3ZA 2IO2B 1OEYA 4WWOA 4MJSA 1H4RA 4GDLA 4HK2A 4ZRIA 4NQKE 3TIXA 3VHTC 2LWPA 2LVOA 2OJRA 4JLCA 4CHKA 3R3MA 1Q5WB 2MLBA 3WALA 4BBNF 3EC8A 4JIOU 2LGXA 3AU4A 3APCA 3PSEB 2JF5A 2I1JA 2RPQA 3WAPA 3A9KB 3OAWA 3GZNI 2AL3A 3ZO5B 2PE9A 3KH0A 5TR5A 3ZNZB 3ZNHB 5L95C 5LXIB 3L10B 2K6DB 4ICUA 4PS7A 2AWTA 4FA6A 4ZRKA 3ZUNA 2J0KA 3VUXA 4FHKA 4MEMA 4HVBA 2N4FA 3ZRFA 5J17A 4ICVA 4DDGD 2LVPA 1UD7A 4B9KA 2RD0A 2ASQA 1WI0A 2ZPYA 3L08A 3DVGY 2M0XA 4ANWA 3A4SC 1QZEA 2KTFA 2JXXA 4P7IA 3RZWC 4BKGA 1WZ3A 2KC1A 4MM3A 5G55A 3A9KA 3APFA 1WJ6A 2IYDB 3R66C 1GUAB 2RGFA 5E6PA 2BKRB 3PREA 3N32A 3S2AA 3ZIMA 1YIWA 2DYMA 1R4MI 3U7DA 4FBJB 2W9NA 1RLFA 5D7GA 4LDTB 2LI5A 2MBOA 3KW5B 4GMVA 3QCAA 2JT4B 3W1YA 4B95A 4WJPA 1IP9A 2J7QB 2O2VB 4ZYNA 2IY1B 4KSLC 4EFOA 3KUDB 4HLEA 2J0JA 3DPDA 3VQIA 1EO6A 2MW5A 3JSVA 1T0YA 2KO3A 2IO3B 4GOCA 4N9F4 3KUZA 1WMHA 2M17A 2LVQA 1V49A 2A4ZA 2LZ6A 3AULA 4FULA 2NBUA 2GBMA 2K6QA 1GC7A 2IO0B 1KJTA 2NPTA 2KZRA 4KDIC 2G4DB 2KX3A 3PRZA 4IWQA 4EKUA 2MP2A 4IWOA 4JQWC 3U30A 2WYQA 4F7ZA 3VH3B 4KDLB 2JRHA 4LDTD 3UIPB 2KMAA 3WA0A 2N7DA 1E8WA 1WM3A 2V3SA 2KJHB 4HXDA 4XX5A 3PT2B 1UZXB 1ZKHA 4DHZB 1KM7A 3HIZA 2QHOA 4W9LA 3QQ8B 2LGDA 4W9HA 1EF5A 3QC8B 1AARA 4GDKB 3V6CB 2MQJA 5C23A 3M63B 1BT0A 2XBBC 2KQ7A 2NCNA 1WE6A 2PPHA 2DENB 3PTFC 3ZDMC 3VTWA 3HHMA 1EF1A 3VUYA 2MCNB 2JZZA 1V80A 4WWNA 4GN1A 1KLVA 1WX9A 4TUUA 2G45B 3JYUA 3BY4B 1WGYA 4MGIE 4NPNA 1WRDB 4JL9A 4EEWA 1V9JA 2KHWB 4G11A 5L83A 2N9XA 2PEAA 2G4SA 3H7PB 1UGMA 2JPHA 2MP2B 4K81A 2GBRA 5LLIA 3ZVVA 2FUHB 2WX1A 1OGWA 1VCBA 3OJ3A 4XC2A 2HJ8A 1XQQA 2NVUI 1J19A 2KFKB 3DVNV 1XT9B 2CKHB 3R7QA 3QAQA 4IW0A 4NAWA 3H7SA 3Q3JA 1V5TA 3A9JA 1WGRA 2RR9A 2BF8B 3PS6A 3U8ZA 4K7WA 4AJWA 2EKEC 4BBNC 3ALBA 2JY6A 2N1WA 4G50A 4NNJB 2IY0B 4HDQA 5DPWA 3UF8A 2KOXA 2BWES 2PE6B 3IFWB 3JVZX 4KVGB 3LJ3A 4F8CB 2BPSA 4PS8A 2FIDA 2KD0A 2KX0A 3VDZA 2XEWA 3R7RA 1L7YA 3KVFB 1YQBA 4II3B 2FCNA 4WJNA 1WE7A 4ANXA 5JZEB 4IM0A 3UQBA 1WY8A 2D07B 2FNJB 4RMAA 2JZ3B 3O65B 3D32A 4DHZE 4HPLB 3A1QB 3ZKJC 4ANUA 2I1KA 2REXA 3NY5A 5JHBA 3UIOB 2MX2A 3CSTA 1WXMA 3HM3A 3PRPB 3ONSA 4PYZA 3VAWA 3RYTA 3C0RB 3L13A 2L0TA 3DVGX 4GDLB 3QHTA 4URKA 4CYEA 5LXHA 4EUTA 3QX1A 3NOBA 5AZGA 2WX0A 2VRRB 1WJUA 1UBIA 4I6PA 3AXCA 1TBEA 1P1AA 1U4AA 2KLCA 3HM6X 3K9PB 4TQ1A 2KFJA 2L0FA 4PS3A 5IA7A 2M8SA 3X0WA 2JRIB 2KQSA 2ZCCA 2B3AA 4AUQC 4LCDE 2LUEA 2HTHA 4DDID 4NQLB 1WXVA 1MG8A 2FIFA 3ENEA 2ZJDA 3UQAA 4MSMB 2KTRB 3V62A 1E8ZA 1NI2A 2KMCA 3ZTDA 3L17A 2DX5B 2KDIA 1OTRB 2DAJA 4EOYA 4DHJB 3EECA 2C9WB 2BYFA 4TV3A 4GU2A 2L05A 3RULA 4FHJA 2FCQA 2KC2A 3PVLA 5BO4B 3SDLC 1Q0WB 1LFDA 1YX5B 2C60A 4F1SA 5HKHA 5KHQA 1WYWB 1IPGA 1Z5SB 4BKTA 1SGHA 2JVCA 3PHXB 3Q3FA 3V60A 1LM8B 1WFYA 2ZPNA 3PLVA 4BVUC 1OEYJ 3MJWA 3ZDTA 3DVNU 3DQVA 4KIKB 3L16A 1RRBA 4W9KA 1WGHA 3ZNID 4XZ4A 3QWZB 1YX6B 2LD9A 2L3ZA 2MBBB 2J0MA 4EZKA 4GIVA 2L8JA 1RFAA 4FN2A 4IM3A 3RT3B 4FLHA 4ZDVA 1ISNA 3DBHI 4GB9A 1GG3A 3NZUA 4B6WA 1OQYA 4RM9A 2Z0EB 3CF6E 1LQBA 1RAXA 4MH0E 3AI5A 3DBRI 3DBSA 1WIAA 4IG7B 3ZTCA 2M4NA 4I6LB 4KSKC 3A9JB 2HD5B 2KDEB 4NAWB 4PYUA 3UINB 3IHPC 4A3OA 1V6EA 2KWCA 5D94A 3KYDD 3QK0A 3QARA 1WR6E 1P0RA 4MGYE 1WGDA 3IBEA 5IAAC 1JRUA 1YJ1A 3H1UA 2KDFB 3OJ4B 4AJYB 4LJOB 5J18A 4OVVA 4BKSD 4KZCA 5E6OA 5G2NA 2DHZA 3EFUA 2GMIC 2V1YA 2KTRA 1PQSA 2WWZA 4A3PA 4WWPA 1WZ0A 4FJZA 2IO1B 2NBVB 5JH5C 2K8HA 2EMTA 3PZDA 5DPRA 3VUWA 2M1MA 2DAFA 1UELA 3AU5A 4GDKA 2MWSB 1P3QU 3JSVB 3A33B 1P9DU 1Z2MA 2MBEA 2IZVB 3L54A 4FJVB 4W9FA 2D2QA 2O2VA 4KZ0A 3WAMA 2DYBA 3T8MA 2EMSA 4NJ6A 4W9GA 2K8BA 2N7EA 2ZVOA 4M8NA 3SHQA 1V5OA 1I35A 4DBGA 2OOBB 2JUOA 2Y5BB 4OVUA 5CHFA 1E7UA 1SE9A 4DWFA 4HCPB 3UGBB 1SIFA 3CSFA 1C3TA 1Q1OA 2DYOA 5DCNA 1HE8A 2NPTB 3DCGA 4MSQB 2CS4A 3M95A 4KIKA 2UYZB 4BKSA 4KV2A 1UH6A 1R4NI 1F9JA 1GNUA 1WM2A 2D3GA 2ZZPB 4IUMB 2YLMA 2KXJA 3H6NA 1E8YA 3ZNGC 4HDOA 5CHWA 3WANA 5FR6A 1S3SG 2FCMA 2WDTB 4IC7B 4W9CA 2L76A 3ZW3A 5D2MB 4DXAB 1WH3A 2KN5A 1H8CA 4X57B 2D10A 3VTUA 4K1RB 3NHEB 3PGEA 3TBLD 3N3KB 3ML8A 3M3JA 3KYCD 1GC6A 2GOWA 2R2OA 1E90A 2GBJA 1E8XA 2MRPA 2NR2A 3VTVA 1V81A 2C7NB 2KDBA 5JHAA 1Y8RC 3QIJA 1LXDA 1XD3B 1WJNA 2KJRA 5C1ZA 1WX8A 1GJZA 3PPAA 3A1QA 4MELA 3VVWB 1L2NA 2FCSA 2N1VA 2BGFA 3RZFA 1A5RA 4EZLA 2ZCBA 3H7PA 5GMVA 4FJYA 3RUIB 2LASA 3CMMB 2DZMA 4ASWC 3IG3A 3WIMA 5AZFA 4MJSB 3TL5A 4NJ7A 3DDCB 2LRWA 2CHZA 4IWPA 2KLGA 3VH4B 5EDSA 3LDZE 2K8CA 2ZVNA 4TQ0A 3P2BA 2AL6A 2LRUA 3MTNB 2AEHA 3ML9A 4ANVA 4AP4C 2N9EB 2AYOB 4MDKE 2KFKA 3TJPA 3B08A 3ECIA 1J8CA 1WGGA 4W9IA 4W9JA 4AWJA 2N9PC 3W1SC 3PRMB 2IBIB 3A4RA 4WJOA 1G6JA 2C7HA 2K1FA 5KHOA 4BFRA 4RM8A 3PV1A 4JGHB 3DOWA 3PHWB 2KWVB 2YVCA 1WXAA 2LXAA 4LJPB 4E71A 3SD5A 2MSED 2HE7A 2Z0DB 1VD2A 3VXWA 3X23A 1ZGUB 2JWZA 1K8RB 4WJQA 4NY0A 4WQOB 1I42A 1V86A 3VFKA 4BOSC 2KANA 2G3QB 2BYVE 2CU1A 4K7UA 1CMXB 1IYFA 2FAZA 2L7RA 3PLUA 4G0NB 1TGZB 1WXSA 1TZ1A 2CHWA 1WMHB 2O6VA 2XK5B 3TMPB 3V61A 1WF9A 2C7MB 4GSWA 3NS8A 3OLMD 4ZRJA 4EZJA 4HCNB 1NDDA 5E6NA 3IVFA 2K25A 2LGYA 3M62B 4G3XB 1YD8U 4IM2A 2GBKA 4W9EA 2RSUA 4M0WB 5DPTA 3ZLZA 4DHJD 4TKNA 4CO7A 3B1LX 1WX7A 1WR1A
chains in the Genus database with same CATH superfamily
5DPSA 5HHDG 4DXGA 2R2QA 2CHXA 1IUEA 2V4IB 1IBXA 2H89B 4HWIB 1EUVB 4O1NA 1ZW7A 3RCZA 1I4RA 5CTRC 4WAFA 2C5LC 2ZNVC 4AOFA 4Q2JA 2EELA 4DXFA 5J2RA 1B1ZA 2DZIA 5BYQA 3BINA 1V1OA 2FUG1 2CJNA 2D5GA 3P1MA 1DYQA 1JALA 3H9DA 2A5UA 5HI1A 5G5GA 1RWSA 2BWFA 2KVRA 3JW0X 3V05A 1X1MA 4YSYB 2O6VD 1KOTA 2LXCA 2K39A 1YNTE 1ZE3D 1K50A 2V4LA 5EE1A 2UWQA 2INPE 2ZW0A 4OW0A 3AB5A 1T0SC 1I4QA 4HK2A 3P4SB 4NQKE 2MJDA 2MLBA 4BBNF 2LGXA 3APCA 2I1JA 2RPQA 3VR8B 4RF1A 3KH0A 5L95C 5LXIB 4PS7A 2BB5A 4M01A 4MEMA 1AN8A 5J17A 2VZKB 2LGIA 3U52E 2ASQA 3L08A 1FRDA 4ANWA 2KTFA 5H92C 2JXXA 2BQQA 3RZWC 1T0QC 1K52A 3RN9C 1VZ6A 2VZKD 4MM3A 4RCOA 5G55A 3R66C 3PREA 1YIWA 4FBJB 3OG5A 1YN3A 3AH7A 4GMVA 4C4VA 1YJIA 4WJPA 2J7QB 1OQRA 1EO6A 3JSVA 1ENFA 5FK9C 1UF0A 1N62A 2D3AA 1WMHA 1E9MA 2LVQA 2NBUA 2GBMA 2K6QA 1UWMA 1GC7A 2IO0B 1KJTA 3PRZA 2MP2A 1ET9A 1R4NB 4IWOA 4JQWC 4F7ZA 4KDLB 4LDTD 2JZPA 1E8WA 1ROEA 1R4MB 3FAHA 4B0EA 1YN4A 4XX5A 2W55A 1L6UA 2QHOA 2LGDA 4C7YA 1F0ZA 3M63B 4L1BA 3HHMA 4TMAB 1EF1A 3VUYA 4WWNA 1KLVA 4OVZA 1WX9A 1HEZE 2G45B 4NPNA 4JL9A 2WLBA 1V9JA 2KHWB 2N9XA 2JWUA 1UGMA 1HTQA 3ZVVA 2FUHB 1VCBA 2WXHA 1HTOA 3LB8C 1XQQA 1L0YB 4A55A 2KFKB 2W54A 4IW0A 3Q3JA 3URYA 1XXGA 5DPWA 4G50A 2WXIA 2PE6B 2KX0A 1NVID 2XEWA 3VDZA 2MJEA 2FCNA 1WY8A 2D07B 2FNJB 4DHZE 3O65B 3D32A 4HJGE 4HPLB 3A1QB 4ANUA 2HDEA 3NY5A 5JHBA 3T3OA 3U2SC 2LUMA 4IOIE 1TIFA 1NI3A 2L0TA 4N6EB 4URKA 3QX1A 2WX0A 1BMLC 1WJUA 1SE2A 3HM6X 2KFJA 2PVGC 2PLPA 1XLNA 2KQSA 4DDID 3N1YC 3ENEA 2FIFA 2WXQA 4XGAB 1PFDA 3L17A 3Q8BA 4EOYA 2R61A 4GU2A 1BXTA 5BO4B 5HKHA 2WDQB 4F1SA 5KHQA 1WYWB 1ESFA 1YMHE 2JVCA 3Q3FA 3V60A 4PT5A 1KTKA 3DVNU 2D3BA 2L3ZA 2MBBB 4EZKA 4RFBA 1ISNA 4GB9A 4HEA1 4BZAA 4KGSA 2Z0EB 3I63C 1RAXA 3AI5A 1C4PA 3DBRI 3DBSA 1WIAA 4IG7B 4I6LB 4KSKC 1FIQA 4NAWB 1QOGA 3IHPC 3P42A 5D3DA 1WR6E 4MT5A 2QSDA 1VZ8A 3IBEA 3NS1A 3ZJVA 4LJOB 1FEHA 4KZCA 2DHZA 2AX5A 2KTRA 1PQSA 2WWZA 4A3PA 3AE7B 4FJZA 3RFZB 4ARIA 1SJED 2DAFA 2MBEA 4FJVB 4ACFA 2KAJA 3T8MA 1J7AA 3RNBC 3KWLA 3SHQA 1V5OA 1XF5L 2GB1A 4DBGA 1RYJA 2KWDA 2WDRB 1SF0A 1SSNA 4MSQB 2CS4A 2KVZA 4KV2A 3MC8A 3ZQ4A 4JPSA 2D3GA 1N60A 2KXJA 1E8YA 4HDOA 1EM7A 1IGCA 3WANA 2JYTA 2FCMA 4IC7B 4DXAB 1YJJA 1H8CA 4A9AA 1SE4A 1JWAD 1D5ZC 3NHEB 3PGEA 1BUIC 5C2TB 2GOWA 2R2OA 3U7ZA 2GBJA 1SIJA 3VTVA 1KLUD 2KJRA 3Q2AC 1GJZA 1KH0A 3TSSA 4WQMA 3A1QA 3VVWB 3R2TA 2N1VA 2BGFA 4EZLA 3H7PA 2DZMA 3WIMA 5AZFA 1ZPSA 4NJ7A 3E56A 2XN9C 1XLQA 4IWPA 2ZVNA 3MTNB 1E0ZA 3AE9B 4MDKE 2KFKA 3B08A 2WP9B 3AEGB 4AWJA 5BYSA 2WU2B 4BFRA 2ONQA 3DOWA 3PHWB 4A90A 1VR9A 3FC4A 3X23A 4XDCA 3EFCA 3R8BA 4BOSC 2HJ1A 1WXSA 2W82A 3NZ3A 2C7MB 1JCKB 3IVFA 2K25A 4IM2A 2GBKA 4KKJA 4TKNA 5HG2A 1ZXIA 3WAOA 1CK1A 3I3TB 1Y56A 1FFVA 2AQ3B 2D11A 4MGKE 4M0WA 2DZKA 4HPMB 1V2YA 3L0WB 2O6VB 2DZJA 1D5MC 4GXBA 2W3RA 3QJZA 2KK8A 4NZLB 5T8IA 4J6IA 4A20A 5CHVC 3KLSX 1P98A 1NBFC 3NZSA 1N63A 1UBQA 4GLSC 3T9LA 1JWSD 3RD2A 5HFYA 4KKIA 5D6JB 1QQRA 1XCTL 2L52A 1S1QB 3GOEA 2OHFA 4K7SA 3DBLI 4WURA 1WJ4A 1OEYA 3SFDB 4WWOA 1SXTA 2OJRA 4CHKA 1Q5WB 2RMMA 4LLGM 4LNOA 3WALA 1KLGD 4JIOU 3PSEB 3B9JA 3I57A 2AL3A 5BYRA 1QILA 2QIEB 3L10B 2K6DB 4ZRKA 3ZUNA 4HVBA 4ICVA 3DHIC 1UD7A 1N5XA 2J52A 1UNSA 2RD0A 3SR6A 5BMIA 3A4SC 1QZEA 2HTME 1VJKA 3A9KA 1QLBB 1WJ6A 2RGFA 5E6PA 5AUIA 3N32A 2N7JA 3Q8EA 3ZIMA 4RGTA 1R4MI 4XYCA 1KFYB 5D7GA 4C80A 1QOBA 4LDTB 2LI5A 3KW5B 3QCAA 1V1PB 2RDHA 2O2VB 4USAA 3KUDB 1SE3A 3DPDA 1T0YA 2KO3A 4GOCA 4EE2A 2CJOA 2LZ6A 2M17A 1PGXA 2W3SA 4LTUA 2G4DB 4IWQA 2KMMA 1N5WA 2WYQA 2WHIA 3WA0A 2KJHB 3PT2B 1UZXB 1KM7A 3HIZA 4WWMA 3BIID 1AARA 5C23A 2K0PA 2TSSA 2NCNA 2RPVA 1WE6A 2PPHA 1JWBD 2JZZA 4TUUA 1WGKA 3ZXVA 2JQRB 3LXFA 1WGYA 3AECB 3WCQA 5L83A 2MP2B 2GBRA 2WX1A 1OGWA 4OZAA 2PKOA 1XT9B 4RGMA 2WU5B 3R7QA 2N9KA 2IGHA 1NEKB 4NAWA 3EA6A 1RFKA 3MC9A 2RR9A 3J9CA 1M4VA 1MVKA 4BBNC 2N1WA 4HDQA 3MP9A 2KOXA 3IFWB 2M56B 4KVGB 2LGSA 4F8CB 1FM0D 3R7RA 3N1XC 4II3B 4WJNA 1WE7A 2AQ1B 5JZEB 4AQ7A 3GB1A 4RMAA 2JZ3B 1GAQB 2MHJA 2I1KA 3UIOB 2MX2A 3MHZA 3PRPB 3ONSA 4HRSA 3DHHC 4KGRA 1J7CA 1EWCA 2WXMA 3HUIA 4GDLB 3QHTA 1PGAA 1YOVB 4KGTA 2VRRB 1K53A 4I6PA 1TBEA 1U4AA 2KLCA 2L0FA 5IA7A 2M8SA 1FO4A 1C76A 1GPXA 2B3AA 2HTHA 3RNFC 2INCC 3DBRB 4ARCA 1E8ZA 1VRAB 1NI2A 1P7EA 1ZDVA 3ZTDA 2QC8A 3BWUD 2C9WB 2BYFA 4TV3A 3RULA 1TS5A 2KC2A 3PVLA 3SDLC 1LFDA 1WYGA 2LEKA 1IPGA 4YSXB 1PGBA 4BKTA 3PHXB 3PO0A 1LM8B 4BVUC 1OEYJ 3MJWA 3ZDTA 2BS3B 4KIKB 3PZ7A 2LHEA 3ZNID 3QWZB 1YX6B 4XDDA 3AN1A 2J0MA 1NYQA 1XCQL 3RNCC 3RT3B 4ZDVA 1KF6B 1SJHD 1OQYA 4RM9A 3PZ8A 4US8A 2V0GA 5FR3A 1MJDA 2E6XA 1MG4A 2HD5B 3W5VB 3UI3A 3UINB 2RDGA 3DWMA 4A3OA 1V6EA 3Q8FA 2G9HD 2WNMA 3QARA 3RNEC 1JRUA 3OJ4B 5BMHA 4LNNA 5IP4D 4AJYB 1DOXA 1L5PA 1E10A 3EFUA 2I2YA 4K3BA 2GMIC 4WWPA 2NBVB 2GI9A 2QEJC 3NG0A 5DPRA 4BAXA 2M1MA 3AU5A 2MWSB 2PVOD 1P3QU 2UU7A 4HROA 3L54A 4W9FA 2D2QA 3WAMA 2EMSA 4W9GA 3IAM1 1E7UA 4DWFA 4HCPB 1SIFA 1C3TA 2DYOA 4YTNB 1UH6A 1WM2A 2JYEA 4IUMB 1OQQA 5FR6A 1S3SG 2IGGA 2L76A 5D2MB 2M0AA 2D10A 3VTUA 2K22A 3GS2A 3TBLD 3M3JA 2WXNA 1E90A 2KDBA 2SAKA 3QIJA 3BVMA 5C1ZA 3PPAA 3FILA 3Q3OC 2FCSA 1LGRA 3B2FA 2ZCBA 3RUIB 3ZYYX 3CMMB 3IG3A 1FNWA 4MJSB 1PUTA 1AW7A 2CHZA 4N59A 4TQ0A 2AL6A 1AYFA 3ML9A 4ANVA 3Q3MC 4AP4C 2AYOB 3ECIA 3BVZA 3NJTA 3W1SC 3PRMB 4WJOA 2C7HA 4JGHB 2KWVB 2D3CA 2LXAA 4LJPB 4E71A 1OFFA 3MC0B 2PTLA 4WH4A 1CQVA 3VXWA 4WJQA 1ZGUB 2Y5CA 1V86A 3KQ4A 1A70A 1F2RC 1K51A 2CU1A 2WXOA 4G0NB 3DBHB 1TGZB 3TMPB 3U4EG 3NS8A 4ZRJA 4HCNB 1NDDA 5E6NA 2LGYA 3M62B 4G3XB 1YD8U 4RF0A 1JWMD 4DHJD 2E3TA 3B1LX 1WX7A 1TS3A 1UUPA 5EE9A 4E3CA 3MHSD 2KKCA 3DHGC 2Z59B 2KNBA 5AEKB 5AZHA 4HKZE 2INDC 3ZRCA 3V6EB 2J4XA 2BKFA 1E7VA 3RPFC 4II2B 3HK0A 2LHDA 1FD6A 3W5UB 3ETRA 3GP7A 4W9DA 2WXJA 2NBWB 1CZPA 2GBNA 3TEWA 3AE2B 1IBXB 4ZHPA 4FADA 2KJ6A 4GGQA 2PJHA 2BYEA 4REZA 3BK1A 2QILA 3LYYA 2MBHA 2MA9B 5I4DA 2Y5PA 2KWUB 2NS5A 3B0AA 1GB4A 3Q3NC 1ZXHA 1E5WA 3AMZA 3QA8A 4YL8A 4ZOHC 2BS2B 1J0GA 1D3ZA 2IO2B 4MJSA 1H4RA 4GDLA 4ZRIA 3TIXA 3VHTC 1TJEA 1STEA 2LWPA 2LVOA 2PW9A 2K3UA 3R3MA 4OZCA 2LFIA 3EC8A 3AU4A 1WWTA 3OAWA 3GZNI 1JW9D 1V8CA 3ZO5B 2PE9A 4RNAA 3ZNHB 4D2KA 2AWTA 3VUXA 4FHKA 1VDVA 2LVPA 2ZPYA 2WXKA 1FMAD 3DVGY 2M0XA 3KWVA 1WZ3A 2IYDB 1GUAB 1ZOYB 3S2AA 2Z8LA 3HRDD 2DYMA 3U7DA 2M19A 5D3IB 2W9NA 4ZRPA 5IKCM 3VRAB 2JT4B 1VZ7A 3W1YA 1IP9A 1F2RI 3I9V1 3AE5B 2IY1B 4KSLC 4HLEA 2J0JA 2MW5A 4HPPA 2IO3B 2KYWA 4N9F4 3KUZA 3AULA 1V49A 2A4ZA 1C78A 2DLBA 1ZP0B 2IJ0A 1L4ZB 4EKUA 2ICIA 3U30A 4JE3B 2KDMA 2JRHA 2KMAA 4XE0A 2N7DA 1QF6A 2V3SA 3AE8B 4LNKA 3VRBB 4DHZB 3QQ8B 1D4BA 4B0MA 4GDKB 3QC8B 3W2DA 2V3NA 1UWXA 2XBBC 2KQ7A 2DENB 3ZDMC 2MCNB 1V80A 2N0SB 4C7ZA 2NTSA 3JYUA 3BY4B 3HVDA 2WGSA 4MGIE 2WXLA 1WRDB 4EEWA 1D5XC 3P4QB 2G4SA 3H7PB 4K81A 5LLIA 1F1HA 1I4HA 2WXPA 3OJ3A 2NVUI 1J19A 1FCCC 3A9JA 2BF8B 3PS6A 3U8ZA 4AJWA 2EKEC 1SB3C 4OHJA 3JVZX 2BPSA 4PS8A 2KD0A 3AEBB 1V97A 3KVFB 3GE3C 4ANXA 3UQBA 3Q69A 2REXA 2RDBC 1FFUA 3CSTA 1WXMA 4PYZA 1XO3A 1L6VA 3RYTA 3C0RB 3L13A 3DVGX 3AEAB 2MEKA 4CYEA 4EUTA 5AZGA 1UBIA 2DBYA 3AXCA 3K9PB 1IGDA 2WXRA 1MPEA 2IGDA 4LNIA 3X0WA 2ZCCA 4AUQC 2L83A 2LUEA 1R7SA 4K3CA 4NQLB 2KTRB 3V62A 3TEZA 2KMCA 3O13A 1EU4A 1OTRB 2DAJA 3BZDB 3EECA 4DQOC 3FKYA 1JWUD 1F52A 1Q0WB 1YX5B 4JX1C 1CJEA 3Q6BA 5JXVA 1TS4A 2EKIA 1WFYA 2ZPNA 3IT4B 2JSVX 3DQVA 3L16A 1RRBA 4W9KA 1N61A 4XZ4A 1VLBA 1FNVA 4M02A 5IO9A 3ZGZA 2L8JA 1RFAA 4FN2A 4IM3A 4FLHA 5BMGA 1GG3A 1MI0A 3NZUA 1LQBA 3AEDB 1WSPA 2M4NA 1TKEA 5H8YE 4PYUA 1EWYC 5D94A 3KYDD 3QK0A 2KN4A 4MGYE 1T5XD 1YJ1A 1AWDA 2KDFB 1JROA 1HA5A 3N20C 1T0RC 2CU3A 2PMVA 4PK1A 2V1YA 1MHHE 1WZ0A 4XWWA 2IO1B 5JH5C 2K8HA 3PZDA 3Q8AA 1C79A 3AEEB 1TYGB 1Z2MA 2IZVB 1ZDXA 4RGNA 4JWUC 3AV8A 1FNUA 2O2VA 1TZOA 3TEYA 2K8BA 1PDXA 1XEEA 2N7EA 2L1AA 2OOBB 2Y5BB 4QAYA 1ET6A 5DCNA 1HE8A 2NPTB 3DCGA 3M95A 4KIKA 4BKSA 1R4NI 4XWTA 1F9JA 2GLSA 3ZNGC 4W9CA 2QDFA 2X8XX 3ZW3A 2KN5A 3V3XA 1MHXA 5EE0A 4X57B 1D6EC 3N3KB 3ML8A 3KYCD 3AE4B 4KX6B 2C7NB 1TKYA 5JHAA 1Y8RC 1LXDA 2SEBD 1WJNA 1JQ4A 1NYRA 4MH8A 2MJ3A 5GMVA 4RGOS 2VH1A 3TL5A 4YWGG 1I7HA 3IXSA 2LRWA 3P4PB 2AEHA 2N9EB 3TJPA 1YN5A 4P1CC 1J8CA 1QT9A 3ZXRA 1WGGA 4W9JA 4M00A 1TY0A 3A4RA 2K1FA 4US9A 5KHOA 1ACCA 3ZJTA 2YVCA 1DGJA 1WXAA 2NTTA 3SD5A 2MSED 2HE7A 2Z0DB 1VD2A 4OZBA 4NY0A 4WQOB 4LNFA 4R3DA 3VFKA 2H88B 2KANA 3IAS1 4K7UA 1CMXB 2FAZA 2L7RA 3PLUA 1EU3A 3NVZA 2O6VA 2CHWA 2XK5B 1WMHB 3V61A 1WF9A 3OLMD 4EZJA 2QMTA 4UDUC 4W9EA 4M0WB 5DPTA 3SFEB 4C4VB 3SU8X 3HVZA 1TY2A 2ZNVB 1F77A 4P1BC 1L0VB 3Q8CA 2MBQA 4WAAA 2B76B 3EHVA 4I6NB 4MGZE 1XLOA 1M94A 1FXIA 3TCAA 4M8MA 3MFGA 4WIPA 3N30A 1TTNA 4BOZB 3APDA 5CX3A 1C1YB 2FE8A 1QOFA 3K9OB 1FXTB 2YEPB 2V9HA 2ZEQA 2LJ5A 4AS1A 2L00B 1JMLA 5MPOA 1B9RA 4HJKA 4HKQA 1HZ6A 2XK5A 4DK5A 3W1SA 1I4PA 1RM6C 2CR5A 3KUCB 4E74A 1XLPA 3BYTB 4JLCA 3RI7C 3NUHB 2J53A 1C9FA 2JF5A 3WAPA 4H2AA 3A9KB 2G1EA 1T3QA 1NENB 5IN7A 5TR5A 4LK0M 2FBWB 3ZNZB 2BVCA 4ICUA 1LO5D 2GRIA 4FA6A 2J0KA 3RMKC 2VH2A 2LJIA 4S17A 1UGJA 2N4FA 3ZRFA 2BW2A 4DDGD 4B9KA 1WI0A 4J3OD 3L4PA 4P7IA 3AE1B 4BKGA 1HXYD 1ZUD2 2KC1A 3APFA 4YTMB 2QJLA 2BKRB 1P7FA 4P16A 1RLFA 2MBOA 3Q14C 4B95A 5E6JA 3BVGA 4ZYNA 2BS4B 4ZHOA 4EFOA 2BYTA 1FRRA 3VQIA 3N1ZC 2DNFA 4FULA 1E6EB 2NPTA 2K9XA 1WXQA 2JU6X 2KZRA 3IT6B 4KDIC 2KX3A 5EE3A 1HZ5A 5FKAC 5TSSA 3VH3B 3UIPB 3EGRA 1WM3A 4HXDA 2WXGA 2MH7A 3P63A 3ABVB 1ZKHA 4W9LA 1DOYA 4W9HA 1EF5A 3RNAC 3V6CB 3VR9B 2MQJA 2WS3B 1BT0A 3PTFC 3VTWA 4GN1A 2PIAA 3MJ5A 2Q5WD 2BB6A 4N58A 4G11A 1L0XB 4C00A 2WQYB 2I38A 2PEAA 2JPHA 3ZJUA 3BK2A 4XC2A 1MFWA 2HJ8A 4MM3B 3DVNV 4ZYSA 2CKHB 3H8HA 3QAQA 3N9YC 3H7SA 1I4GA 1V5TA 3AE6B 3DWGC 1WGRA 3GZNB 4K7WA 3ALBA 2JY6A 1C4CA 4NNJB 1J7BA 2IY0B 3UF8A 2BWES 1TKGA 3LJ3A 1GB1A 2FIDA 3NRZA 1L7YA 2AQ2B 1YQBA 3B2GA 4IM0A 1FCLA 2V3PA 2INNE 3FILB 1QKZA 3ZKJC 1TT5B 2OEDA 3HM3A 2NMQA 4NJCA 3P4RB 3VAWA 1KRHA 5G5HA 3NVYA 5LXHA 3NOBA 1QOAA 4IDIA 1YQ3B 3CIRB 2J42A 4TQ1A 1P1AA 2YEPF 4PS3A 5GXGB 4TSSA 4NAMA 2JRIB 4LCDE 1WXVA 1MG8A 3UQAA 2ZJDA 4MSMB 2BT6A 3CWIA 3NVVA 2DX5B 2KDIA 5LNK1 4RH6A 4DHJB 2L05A 4ITKA 5IOIA 1C77A 2FCQA 4FHJA 2C60A 4L23A 1Z5SB 1SGHA 3RNGC 4MACA 3PLVA 3T3NA 3C19A 1WGHA 2LD9A 1SBBB 2BTEA 4GIVA 4IKGA 4A6QA 1JRPA 3DBHI 1Q10A 4B6WA 3CF6E 4MH0E 1HQRD 4ZRQA 3ZTCA 4A8XC 1YQ4B 2QCZA 4S0RA 3A9JB 2KDEB 2KWCA 2IDYA 3TUOA 1P0RA 1SEBD 1WGDA 5IAAC 3H1UA 1I4XA 4YXDB 2JX5A 5J18A 2OJWA 4OVVA 1V1PA 2ON8A 4BKSD 2WXFA 1GOZA 3AEFB 5E6OA 5G2NA 5AUKA 5C3JB 1C4AA 3E9SA 2WDVB 3I5JC 2EMTA 2IPKD 3VUWA 1UELA 1TS2A 4GDKA 1PYWD 3JSVB 3NVWA 3A33B 3EUB2 1P9DU 3C8YA 2KT7A 1FPYA 3SEBA 4KZ0A 4YSZB 2DYBA 3AM9A 4NJ6A 3W9CB 2ZVOA 3BYYB 4M8NA 1I35A 2JUOA 4OVUA 5CHFA 1SE9A 3UGBB 3CSFA 1Q1OA 1L4DB 3TEXA 3AE3B 2LMCA 2UYZB 1GNUA 2ZZPB 2YLMA 3H6NA 5CHWA 2WDTB 4L2YA 4P6VF 1WH3A 3R2IA 4K1RB 1N6ZA 1GC6A 2DWQA 1E8XA 2MRPA 2NR2A 1V81A 3DBLB 2KQ4X 1T6BX 1XD3B 2K5PA 1WX8A 2ZW1A 4MELA 1L2NA 3RZFA 1A5RA 2KACA 4FJYA 2LASA 4ASWC 2ACZB 4CQNA 3DDCB 4FXCA 1FXAA 1E7PB 2KLGA 3VH4B 5EDSA 3LDZE 2K8CA 2Y3AA 3P2BA 2LRUA 3OWEB 1DOIA 4JWSC 4W9IA 2N9PC 4C56C 1WRIA 2IBIB 1G6JA 4YTPB 2L32A 4RM8A 3PV1A 2JWZA 1K8RB 1I42A 2BBCA 2G3QB 2X38A 2N9LA 2BYVE 4YT0B 1IYFA 1TZ1A 4GSWA 2JXTA 3GE8C 3ZLZA 2RSUA 4CO7A 2XNAC 1WR1A
chains in the Genus database with same CATH topology
5DPSA 2R2QA 3SU8X 4E3CA 2CHXA 3MHSD 2KKCA 3WAOA 2ZNVB 2Z59B 2KNBA 4HWIB 5AEKB 1EUVB 2MBQA 3I3TB 5AZHA 4WAAA 2D11A 4MGKE 1ZW7A 3EHVA 3RCZA 2DZKA 5CTRC 4HPMB 1V2YA 3ZRCA 2C5LC 2ZNVC 4I6NB 3V6EB 4AOFA 2BKFA 4MGZE 3L0WB 5J2RA 1E7VA 2O6VB 2DZJA 4II2B 1M94A 3HK0A 2DZIA 4GXBA 3QJZA 2KK8A 3TCAA 3BINA 4J6IA 4M8MA 4W9DA 2NBWB 3N30A 5CHVC 1TTNA 2GBNA 3APDA 4A20A 4BOZB 5CX3A 1C1YB 3H9DA 3K9OB 1FXTB 2A5UA 4FADA 2KJ6A 4GGQA 1P98A 2ZEQA 2LJ5A 2PJHA 1NBFC 2L00B 3NZSA 2BYEA 2BWFA 1UBQA 2KVRA 3JW0X 3T9LA 2MBHA 2MA9B 3RD2A 1X1MA 4HJKA 5D6JB 2XK5A 4DK5A 3W1SA 2O6VD 1KOTA 1S1QB 2KWUB 2LXCA 3GOEA 2K39A 2NS5A 3B0AA 3DBLI 2CR5A 4K7SA 1E5WA 3KUCB 3QA8A 4YL8A 4E74A 2V4LA 1WJ4A 2UWQA 1J0GA 1D3ZA 2IO2B 1OEYA 4WWOA 4MJSA 1H4RA 4GDLA 4HK2A 4ZRIA 4NQKE 3TIXA 3VHTC 2LWPA 2LVOA 2OJRA 4JLCA 4CHKA 3R3MA 1Q5WB 2MLBA 3WALA 4BBNF 3EC8A 4JIOU 2LGXA 3AU4A 3APCA 3PSEB 2JF5A 2I1JA 2RPQA 3WAPA 3A9KB 3OAWA 3GZNI 2AL3A 3ZO5B 2PE9A 3KH0A 5TR5A 3ZNZB 3ZNHB 5L95C 5LXIB 3L10B 2K6DB 4ICUA 4PS7A 2AWTA 4FA6A 4ZRKA 3ZUNA 2J0KA 3VUXA 4FHKA 4MEMA 4HVBA 2N4FA 3ZRFA 5J17A 4ICVA 4DDGD 2LVPA 1UD7A 4B9KA 2RD0A 2ASQA 1WI0A 2ZPYA 3L08A 3DVGY 2M0XA 4ANWA 3A4SC 1QZEA 2KTFA 2JXXA 4P7IA 3RZWC 4BKGA 1WZ3A 2KC1A 4MM3A 5G55A 3A9KA 3APFA 1WJ6A 2IYDB 3R66C 1GUAB 2RGFA 5E6PA 2BKRB 3PREA 3N32A 3S2AA 3ZIMA 1YIWA 2DYMA 1R4MI 3U7DA 4FBJB 2W9NA 1RLFA 5D7GA 4LDTB 2LI5A 2MBOA 3KW5B 4GMVA 3QCAA 2JT4B 3W1YA 4B95A 4WJPA 1IP9A 2J7QB 2O2VB 4ZYNA 2IY1B 4KSLC 4EFOA 3KUDB 4HLEA 2J0JA 3DPDA 3VQIA 1EO6A 2MW5A 3JSVA 1T0YA 2KO3A 2IO3B 4GOCA 4N9F4 3KUZA 1WMHA 2M17A 2LVQA 1V49A 2A4ZA 2LZ6A 3AULA 4FULA 2NBUA 2GBMA 2K6QA 1GC7A 2IO0B 1KJTA 2NPTA 2KZRA 4KDIC 2G4DB 2KX3A 3PRZA 4IWQA 4EKUA 2MP2A 4IWOA 4JQWC 3U30A 2WYQA 4F7ZA 3VH3B 4KDLB 2JRHA 4LDTD 3UIPB 2KMAA 3WA0A 2N7DA 1E8WA 1WM3A 2V3SA 2KJHB 4HXDA 4XX5A 3PT2B 1UZXB 1ZKHA 4DHZB 1KM7A 3HIZA 2QHOA 4W9LA 3QQ8B 2LGDA 4W9HA 1EF5A 3QC8B 1AARA 4GDKB 3V6CB 2MQJA 5C23A 3M63B 1BT0A 2XBBC 2KQ7A 2NCNA 1WE6A 2PPHA 2DENB 3PTFC 3ZDMC 3VTWA 3HHMA 1EF1A 3VUYA 2MCNB 2JZZA 1V80A 4WWNA 4GN1A 1KLVA 1WX9A 4TUUA 2G45B 3JYUA 3BY4B 1WGYA 4MGIE 4NPNA 1WRDB 4JL9A 4EEWA 1V9JA 2KHWB 4G11A 5L83A 2N9XA 2PEAA 2G4SA 3H7PB 1UGMA 2JPHA 2MP2B 4K81A 2GBRA 5LLIA 3ZVVA 2FUHB 2WX1A 1OGWA 1VCBA 3OJ3A 4XC2A 2HJ8A 1XQQA 2NVUI 1J19A 2KFKB 3DVNV 1XT9B 2CKHB 3R7QA 3QAQA 4IW0A 4NAWA 3H7SA 3Q3JA 1V5TA 3A9JA 1WGRA 2RR9A 2BF8B 3PS6A 3U8ZA 4K7WA 4AJWA 2EKEC 4BBNC 3ALBA 2JY6A 2N1WA 4G50A 4NNJB 2IY0B 4HDQA 5DPWA 3UF8A 2KOXA 2BWES 2PE6B 3IFWB 3JVZX 4KVGB 3LJ3A 4F8CB 2BPSA 4PS8A 2FIDA 2KD0A 2KX0A 3VDZA 2XEWA 3R7RA 1L7YA 3KVFB 1YQBA 4II3B 2FCNA 4WJNA 1WE7A 4ANXA 5JZEB 4IM0A 3UQBA 1WY8A 2D07B 2FNJB 4RMAA 2JZ3B 3O65B 3D32A 4DHZE 4HPLB 3A1QB 3ZKJC 4ANUA 2I1KA 2REXA 3NY5A 5JHBA 3UIOB 2MX2A 3CSTA 1WXMA 3HM3A 3PRPB 3ONSA 4PYZA 3VAWA 3RYTA 3C0RB 3L13A 2L0TA 3DVGX 4GDLB 3QHTA 4URKA 4CYEA 5LXHA 4EUTA 3QX1A 3NOBA 5AZGA 2WX0A 2VRRB 1WJUA 1UBIA 4I6PA 3AXCA 1TBEA 1P1AA 1U4AA 2KLCA 3HM6X 3K9PB 4TQ1A 2KFJA 2L0FA 4PS3A 5IA7A 2M8SA 3X0WA 2JRIB 2KQSA 2ZCCA 2B3AA 4AUQC 4LCDE 2LUEA 2HTHA 4DDID 4NQLB 1WXVA 1MG8A 2FIFA 3ENEA 2ZJDA 3UQAA 4MSMB 2KTRB 3V62A 1E8ZA 1NI2A 2KMCA 3ZTDA 3L17A 2DX5B 2KDIA 1OTRB 2DAJA 4EOYA 4DHJB 3EECA 2C9WB 2BYFA 4TV3A 4GU2A 2L05A 3RULA 4FHJA 2FCQA 2KC2A 3PVLA 5BO4B 3SDLC 1Q0WB 1LFDA 1YX5B 2C60A 4F1SA 5HKHA 5KHQA 1WYWB 1IPGA 1Z5SB 4BKTA 1SGHA 2JVCA 3PHXB 3Q3FA 3V60A 1LM8B 1WFYA 2ZPNA 3PLVA 4BVUC 1OEYJ 3MJWA 3ZDTA 3DVNU 3DQVA 4KIKB 3L16A 1RRBA 4W9KA 1WGHA 3ZNID 4XZ4A 3QWZB 1YX6B 2LD9A 2L3ZA 2MBBB 2J0MA 4EZKA 4GIVA 2L8JA 1RFAA 4FN2A 4IM3A 3RT3B 4FLHA 4ZDVA 1ISNA 3DBHI 4GB9A 1GG3A 3NZUA 4B6WA 1OQYA 4RM9A 2Z0EB 3CF6E 1LQBA 1RAXA 4MH0E 3AI5A 3DBRI 3DBSA 1WIAA 4IG7B 3ZTCA 2M4NA 4I6LB 4KSKC 3A9JB 2HD5B 2KDEB 4NAWB 4PYUA 3UINB 3IHPC 4A3OA 1V6EA 2KWCA 5D94A 3KYDD 3QK0A 3QARA 1WR6E 1P0RA 4MGYE 1WGDA 3IBEA 5IAAC 1JRUA 1YJ1A 3H1UA 2KDFB 3OJ4B 4AJYB 4LJOB 5J18A 4OVVA 4BKSD 4KZCA 5E6OA 5G2NA 2DHZA 3EFUA 2GMIC 2V1YA 2KTRA 1PQSA 2WWZA 4A3PA 4WWPA 1WZ0A 4FJZA 2IO1B 2NBVB 5JH5C 2K8HA 2EMTA 3PZDA 5DPRA 3VUWA 2M1MA 2DAFA 1UELA 3AU5A 4GDKA 2MWSB 1P3QU 3JSVB 3A33B 1P9DU 1Z2MA 2MBEA 2IZVB 3L54A 4FJVB 4W9FA 2D2QA 2O2VA 4KZ0A 3WAMA 2DYBA 3T8MA 2EMSA 4NJ6A 4W9GA 2K8BA 2N7EA 2ZVOA 4M8NA 3SHQA 1V5OA 1I35A 4DBGA 2OOBB 2JUOA 2Y5BB 4OVUA 5CHFA 1E7UA 1SE9A 4DWFA 4HCPB 3UGBB 1SIFA 3CSFA 1C3TA 1Q1OA 2DYOA 5DCNA 1HE8A 2NPTB 3DCGA 4MSQB 2CS4A 3M95A 4KIKA 2UYZB 4BKSA 4KV2A 1UH6A 1R4NI 1F9JA 1GNUA 1WM2A 2D3GA 2ZZPB 4IUMB 2YLMA 2KXJA 3H6NA 1E8YA 3ZNGC 4HDOA 5CHWA 3WANA 5FR6A 1S3SG 2FCMA 2WDTB 4IC7B 4W9CA 2L76A 3ZW3A 5D2MB 4DXAB 1WH3A 2KN5A 1H8CA 4X57B 2D10A 3VTUA 4K1RB 3NHEB 3PGEA 3TBLD 3N3KB 3ML8A 3M3JA 3KYCD 1GC6A 2GOWA 2R2OA 1E90A 2GBJA 1E8XA 2MRPA 2NR2A 3VTVA 1V81A 2C7NB 2KDBA 5JHAA 1Y8RC 3QIJA 1LXDA 1XD3B 1WJNA 2KJRA 5C1ZA 1WX8A 1GJZA 3PPAA 3A1QA 4MELA 3VVWB 1L2NA 2FCSA 2N1VA 2BGFA 3RZFA 1A5RA 4EZLA 2ZCBA 3H7PA 5GMVA 4FJYA 3RUIB 2LASA 3CMMB 2DZMA 4ASWC 3IG3A 3WIMA 5AZFA 4MJSB 3TL5A 4NJ7A 3DDCB 2LRWA 2CHZA 4IWPA 2KLGA 3VH4B 5EDSA 3LDZE 2K8CA 2ZVNA 4TQ0A 3P2BA 2AL6A 2LRUA 3MTNB 2AEHA 3ML9A 4ANVA 4AP4C 2N9EB 2AYOB 4MDKE 2KFKA 3TJPA 3B08A 3ECIA 1J8CA 1WGGA 4W9IA 4W9JA 4AWJA 2N9PC 3W1SC 3PRMB 2IBIB 3A4RA 4WJOA 1G6JA 2C7HA 2K1FA 5KHOA 4BFRA 4RM8A 3PV1A 4JGHB 3DOWA 3PHWB 2KWVB 2YVCA 1WXAA 2LXAA 4LJPB 4E71A 3SD5A 2MSED 2HE7A 2Z0DB 1VD2A 3VXWA 3X23A 1ZGUB 2JWZA 1K8RB 4WJQA 4NY0A 4WQOB 1I42A 1V86A 3VFKA 4BOSC 2KANA 2G3QB 2BYVE 2CU1A 4K7UA 1CMXB 1IYFA 2FAZA 2L7RA 3PLUA 4G0NB 1TGZB 1WXSA 1TZ1A 2CHWA 1WMHB 2O6VA 2XK5B 3TMPB 3V61A 1WF9A 2C7MB 4GSWA 3NS8A 3OLMD 4ZRJA 4EZJA 4HCNB 1NDDA 5E6NA 3IVFA 2K25A 2LGYA 3M62B 4G3XB 1YD8U 4IM2A 2GBKA 4W9EA 2RSUA 4M0WB 5DPTA 3ZLZA 4DHJD 4TKNA 4CO7A 3B1LX 1WX7A 1WR1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPS A;  2R2Q A;  3SU8 X;  4E3C A;  2CHX A;  3MHS D;  2KKC A;  3WAO A;  2ZNV B;  2Z59 B;  2KNB A;  4HWI B;  5AEK B;  1EUV B;  2MBQ A;  3I3T B;  5AZH A;  4WAA A;  2D11 A;  4MGK E;  1ZW7 A;  3EHV A;  3RCZ A;  2DZK A;  5CTR C;  4HPM B;  1V2Y A;  3ZRC A;  2C5L C;  2ZNV C;  4I6N B;  3V6E B;  4AOF A;  2BKF A;  4MGZ E;  3L0W B;  5J2R A;  1E7V A;  2O6V B;  2DZJ A;  4II2 B;  1M94 A;  3HK0 A;  2DZI A;  4GXB A;  3QJZ A;  2KK8 A;  3TCA A;  3BIN A;  4J6I A;  4M8M A;  4W9D A;  2NBW B;  3N30 A;  5CHV C;  1TTN A;  2GBN A;  3APD A;  4A20 A;  4BOZ B;  5CX3 A;  1C1Y B;  3H9D A;  3K9O B;  1FXT B;  2A5U A;  4FAD A;  2KJ6 A;  4GGQ A;  1P98 A;  2ZEQ A;  2LJ5 A;  2PJH A;  1NBF C;  2L00 B;  3NZS A;  2BYE A;  2BWF A;  1UBQ A;  2KVR A;  3JW0 X;  3T9L A;  2MBH A;  2MA9 B;  3RD2 A;  1X1M A;  4HJK A;  5D6J B;  2XK5 A;  4DK5 A;  3W1S A;  2O6V D;  1KOT A;  1S1Q B;  2KWU B;  2LXC A;  3GOE A;  2K39 A;  2NS5 A;  3B0A A;  3DBL I;  2CR5 A;  4K7S A;  1E5W A;  3KUC B;  3QA8 A;  4YL8 A;  4E74 A;  2V4L A;  1WJ4 A;  2UWQ A;  1J0G A;  1D3Z A;  2IO2 B;  1OEY A;  4WWO A;  4MJS A;  1H4R A;  4GDL A;  4HK2 A;  4ZRI A;  4NQK E;  3TIX A;  3VHT C;  2LWP A;  2LVO A;  2OJR A;  4JLC A;  4CHK A;  3R3M A;  1Q5W B;  2MLB A;  3WAL A;  4BBN F;  3EC8 A;  4JIO U;  2LGX A;  3AU4 A;  3APC A;  3PSE B;  2JF5 A;  2I1J A;  2RPQ A;  3WAP A;  3A9K B;  3OAW A;  3GZN I;  2AL3 A;  3ZO5 B;  2PE9 A;  3KH0 A;  5TR5 A;  3ZNZ B;  3ZNH B;  5L95 C;  5LXI B;  3L10 B;  2K6D B;  4ICU A;  4PS7 A;  2AWT A;  4FA6 A;  4ZRK A;  3ZUN A;  2J0K A;  3VUX A;  4FHK A;  4MEM A;  4HVB A;  2N4F A;  3ZRF A;  5J17 A;  4ICV A;  4DDG D;  2LVP A;  1UD7 A;  4B9K A;  2RD0 A;  2ASQ A;  1WI0 A;  2ZPY A;  3L08 A;  3DVG Y;  2M0X A;  4ANW A;  3A4S C;  1QZE A;  2KTF A;  2JXX A;  4P7I A;  3RZW C;  4BKG A;  1WZ3 A;  2KC1 A;  4MM3 A;  5G55 A;  3A9K A;  3APF A;  1WJ6 A;  2IYD B;  3R66 C;  1GUA B;  2RGF A;  5E6P A;  2BKR B;  3PRE A;  3N32 A;  3S2A A;  3ZIM A;  1YIW A;  2DYM A;  1R4M I;  3U7D A;  4FBJ B;  2W9N A;  1RLF A;  5D7G A;  4LDT B;  2LI5 A;  2MBO A;  3KW5 B;  4GMV A;  3QCA A;  2JT4 B;  3W1Y A;  4B95 A;  4WJP A;  1IP9 A;  2J7Q B;  2O2V B;  4ZYN A;  2IY1 B;  4KSL C;  4EFO A;  3KUD B;  4HLE A;  2J0J A;  3DPD A;  3VQI A;  1EO6 A;  2MW5 A;  3JSV A;  1T0Y A;  2KO3 A;  2IO3 B;  4GOC A;  4N9F 4;  3KUZ A;  1WMH A;  2M17 A;  2LVQ A;  1V49 A;  2A4Z A;  2LZ6 A;  3AUL A;  4FUL A;  2NBU A;  2GBM A;  2K6Q A;  1GC7 A;  2IO0 B;  1KJT A;  2NPT A;  2KZR A;  4KDI C;  2G4D B;  2KX3 A;  3PRZ A;  4IWQ A;  4EKU A;  2MP2 A;  4IWO A;  4JQW C;  3U30 A;  2WYQ A;  4F7Z A;  3VH3 B;  4KDL B;  2JRH A;  4LDT D;  3UIP B;  2KMA A;  3WA0 A;  2N7D A;  1E8W A;  1WM3 A;  2V3S A;  2KJH B;  4HXD A;  4XX5 A;  3PT2 B;  1UZX B;  1ZKH A;  4DHZ B;  1KM7 A;  3HIZ A;  2QHO A;  4W9L A;  3QQ8 B;  2LGD A;  4W9H A;  1EF5 A;  3QC8 B;  1AAR A;  4GDK B;  3V6C B;  2MQJ A;  5C23 A;  3M63 B;  1BT0 A;  2XBB C;  2KQ7 A;  2NCN A;  1WE6 A;  2PPH A;  2DEN B;  3PTF C;  3ZDM C;  3VTW A;  3HHM A;  1EF1 A;  3VUY A;  2MCN B;  2JZZ A;  1V80 A;  4WWN A;  4GN1 A;  1KLV A;  1WX9 A;  4TUU A;  2G45 B;  3JYU A;  3BY4 B;  1WGY A;  4MGI E;  4NPN A;  1WRD B;  4JL9 A;  4EEW A;  1V9J A;  2KHW B;  4G11 A;  5L83 A;  2N9X A;  2PEA A;  2G4S A;  3H7P B;  1UGM A;  2JPH A;  2MP2 B;  4K81 A;  2GBR A;  5LLI A;  3ZVV A;  2FUH B;  2WX1 A;  1OGW A;  1VCB A;  3OJ3 A;  4XC2 A;  2HJ8 A;  1XQQ A;  2NVU I;  1J19 A;  2KFK B;  3DVN V;  1XT9 B;  2CKH B;  3R7Q A;  3QAQ A;  4IW0 A;  4NAW A;  3H7S A;  3Q3J A;  1V5T A;  3A9J A;  1WGR A;  2RR9 A;  2BF8 B;  3PS6 A;  3U8Z A;  4K7W A;  4AJW A;  2EKE C;  4BBN C;  3ALB A;  2JY6 A;  2N1W A;  4G50 A;  4NNJ B;  2IY0 B;  4HDQ A;  5DPW A;  3UF8 A;  2KOX A;  2BWE S;  2PE6 B;  3IFW B;  3JVZ X;  4KVG B;  3LJ3 A;  4F8C B;  2BPS A;  4PS8 A;  2FID A;  2KD0 A;  2KX0 A;  3VDZ A;  2XEW A;  3R7R A;  1L7Y A;  3KVF B;  1YQB A;  4II3 B;  2FCN A;  4WJN A;  1WE7 A;  4ANX A;  5JZE B;  4IM0 A;  3UQB A;  1WY8 A;  2D07 B;  2FNJ B;  4RMA A;  2JZ3 B;  3O65 B;  3D32 A;  4DHZ E;  4HPL B;  3A1Q B;  3ZKJ C;  4ANU A;  2I1K A;  2REX A;  3NY5 A;  5JHB A;  3UIO B;  2MX2 A;  3CST A;  1WXM A;  3HM3 A;  3PRP B;  3ONS A;  4PYZ A;  3VAW A;  3RYT A;  3C0R B;  3L13 A;  2L0T A;  3DVG X;  4GDL B;  3QHT A;  4URK A;  4CYE A;  5LXH A;  4EUT A;  3QX1 A;  3NOB A;  5AZG A;  2WX0 A;  2VRR B;  1WJU A;  1UBI A;  4I6P A;  3AXC A;  1TBE A;  1P1A A;  1U4A A;  2KLC A;  3HM6 X;  3K9P B;  4TQ1 A;  2KFJ A;  2L0F A;  4PS3 A;  5IA7 A;  2M8S A;  3X0W A;  2JRI B;  2KQS A;  2ZCC A;  2B3A A;  4AUQ C;  4LCD E;  2LUE A;  2HTH A;  4DDI D;  4NQL B;  1WXV A;  1MG8 A;  2FIF A;  3ENE A;  2ZJD A;  3UQA A;  4MSM B;  2KTR B;  3V62 A;  1E8Z A;  1NI2 A;  2KMC A;  3ZTD A;  3L17 A;  2DX5 B;  2KDI A;  1OTR B;  2DAJ A;  4EOY A;  4DHJ B;  3EEC A;  2C9W B;  2BYF A;  4TV3 A;  4GU2 A;  2L05 A;  3RUL A;  4FHJ A;  2FCQ A;  2KC2 A;  3PVL A;  5BO4 B;  3SDL C;  1Q0W B;  1LFD A;  1YX5 B;  2C60 A;  4F1S A;  5HKH A;  5KHQ A;  1WYW B;  1IPG A;  1Z5S B;  4BKT A;  1SGH A;  2JVC A;  3PHX B;  3Q3F A;  3V60 A;  1LM8 B;  1WFY A;  2ZPN A;  3PLV A;  4BVU C;  1OEY J;  3MJW A;  3ZDT A;  3DVN U;  3DQV A;  4KIK B;  3L16 A;  1RRB A;  4W9K A;  1WGH A;  3ZNI D;  4XZ4 A;  3QWZ B;  1YX6 B;  2LD9 A;  2L3Z A;  2MBB B;  2J0M A;  4EZK A;  4GIV A;  2L8J A;  1RFA A;  4FN2 A;  4IM3 A;  3RT3 B;  4FLH A;  4ZDV A;  1ISN A;  3DBH I;  4GB9 A;  1GG3 A;  3NZU A;  4B6W A;  1OQY A;  4RM9 A;  2Z0E B;  3CF6 E;  1LQB A;  1RAX A;  4MH0 E;  3AI5 A;  3DBR I;  3DBS A;  1WIA A;  4IG7 B;  3ZTC A;  2M4N A;  4I6L B;  4KSK C;  3A9J B;  2HD5 B;  2KDE B;  4NAW B;  4PYU A;  3UIN B;  3IHP C;  4A3O A;  1V6E A;  2KWC A;  5D94 A;  3KYD D;  3QK0 A;  3QAR A;  1WR6 E;  1P0R A;  4MGY E;  1WGD A;  3IBE A;  5IAA C;  1JRU A;  1YJ1 A;  3H1U A;  2KDF B;  3OJ4 B;  4AJY B;  4LJO B;  5J18 A;  4OVV A;  4BKS D;  4KZC A;  5E6O A;  5G2N A;  2DHZ A;  3EFU A;  2GMI C;  2V1Y A;  2KTR A;  1PQS A;  2WWZ A;  4A3P A;  4WWP A;  1WZ0 A;  4FJZ A;  2IO1 B;  2NBV B;  5JH5 C;  2K8H A;  2EMT A;  3PZD A;  5DPR A;  3VUW A;  2M1M A;  2DAF A;  1UEL A;  3AU5 A;  4GDK A;  2MWS B;  1P3Q U;  3JSV B;  3A33 B;  1P9D U;  1Z2M A;  2MBE A;  2IZV B;  3L54 A;  4FJV B;  4W9F A;  2D2Q A;  2O2V A;  4KZ0 A;  3WAM A;  2DYB A;  3T8M A;  2EMS A;  4NJ6 A;  4W9G A;  2K8B A;  2N7E A;  2ZVO A;  4M8N A;  3SHQ A;  1V5O A;  1I35 A;  4DBG A;  2OOB B;  2JUO A;  2Y5B B;  4OVU A;  5CHF A;  1E7U A;  1SE9 A;  4DWF A;  4HCP B;  3UGB B;  1SIF A;  3CSF A;  1C3T A;  1Q1O A;  2DYO A;  5DCN A;  1HE8 A;  2NPT B;  3DCG A;  4MSQ B;  2CS4 A;  3M95 A;  4KIK A;  2UYZ B;  4BKS A;  4KV2 A;  1UH6 A;  1R4N I;  1F9J A;  1GNU A;  1WM2 A;  2D3G A;  2ZZP B;  4IUM B;  2YLM A;  2KXJ A;  3H6N A;  1E8Y A;  3ZNG C;  4HDO A;  5CHW A;  3WAN A;  5FR6 A;  1S3S G;  2FCM A;  2WDT B;  4IC7 B;  4W9C A;  2L76 A;  3ZW3 A;  5D2M B;  4DXA B;  1WH3 A;  2KN5 A;  1H8C A;  4X57 B;  2D10 A;  3VTU A;  4K1R B;  3NHE B;  3PGE A;  3TBL D;  3N3K B;  3ML8 A;  3M3J A;  3KYC D;  1GC6 A;  2GOW A;  2R2O A;  1E90 A;  2GBJ A;  1E8X A;  2MRP A;  2NR2 A;  3VTV A;  1V81 A;  2C7N B;  2KDB A;  5JHA A;  1Y8R C;  3QIJ A;  1LXD A;  1XD3 B;  1WJN A;  2KJR A;  5C1Z A;  1WX8 A;  1GJZ A;  3PPA A;  3A1Q A;  4MEL A;  3VVW B;  1L2N A;  2FCS A;  2N1V A;  2BGF A;  3RZF A;  1A5R A;  4EZL A;  2ZCB A;  3H7P A;  5GMV A;  4FJY A;  3RUI B;  2LAS A;  3CMM B;  2DZM A;  4ASW C;  3IG3 A;  3WIM A;  5AZF A;  4MJS B;  3TL5 A;  4NJ7 A;  3DDC B;  2LRW A;  2CHZ A;  4IWP A;  2KLG A;  3VH4 B;  5EDS A;  3LDZ E;  2K8C A;  2ZVN A;  4TQ0 A;  3P2B A;  2AL6 A;  2LRU A;  3MTN B;  2AEH A;  3ML9 A;  4ANV A;  4AP4 C;  2N9E B;  2AYO B;  4MDK E;  2KFK A;  3TJP A;  3B08 A;  3ECI A;  1J8C A;  1WGG A;  4W9I A;  4W9J A;  4AWJ A;  2N9P C;  3W1S C;  3PRM B;  2IBI B;  3A4R A;  4WJO A;  1G6J A;  2C7H A;  2K1F A;  5KHO A;  4BFR A;  4RM8 A;  3PV1 A;  4JGH B;  3DOW A;  3PHW B;  2KWV B;  2YVC A;  1WXA A;  2LXA A;  4LJP B;  4E71 A;  3SD5 A;  2MSE D;  2HE7 A;  2Z0D B;  1VD2 A;  3VXW A;  3X23 A;  1ZGU B;  2JWZ A;  1K8R B;  4WJQ A;  4NY0 A;  4WQO B;  1I42 A;  1V86 A;  3VFK A;  4BOS C;  2KAN A;  2G3Q B;  2BYV E;  2CU1 A;  4K7U A;  1CMX B;  1IYF A;  2FAZ A;  2L7R A;  3PLU A;  4G0N B;  1TGZ B;  1WXS A;  1TZ1 A;  2CHW A;  1WMH B;  2O6V A;  2XK5 B;  3TMP B;  3V61 A;  1WF9 A;  2C7M B;  4GSW A;  3NS8 A;  3OLM D;  4ZRJ A;  4EZJ A;  4HCN B;  1NDD A;  5E6N A;  3IVF A;  2K25 A;  2LGY A;  3M62 B;  4G3X B;  1YD8 U;  4IM2 A;  2GBK A;  4W9E A;  2RSU A;  4M0W B;  5DPT A;  3ZLZ A;  4DHJ D;  4TKN A;  4CO7 A;  3B1L X;  1WX7 A;  1WR1 A; 
#chains in the Genus database with same CATH topology
 5DPS A;  5HHD G;  4DXG A;  2R2Q A;  2CHX A;  1IUE A;  2V4I B;  1IBX A;  2H89 B;  4HWI B;  1EUV B;  4O1N A;  1ZW7 A;  3RCZ A;  1I4R A;  5CTR C;  4WAF A;  2C5L C;  2ZNV C;  4AOF A;  4Q2J A;  2EEL A;  4DXF A;  5J2R A;  1B1Z A;  2DZI A;  5BYQ A;  3BIN A;  1V1O A;  2FUG 1;  2CJN A;  2D5G A;  3P1M A;  1DYQ A;  1JAL A;  3H9D A;  2A5U A;  5HI1 A;  5G5G A;  1RWS A;  2BWF A;  2KVR A;  3JW0 X;  3V05 A;  1X1M A;  4YSY B;  2O6V D;  1KOT A;  2LXC A;  2K39 A;  1YNT E;  1ZE3 D;  1K50 A;  2V4L A;  5EE1 A;  2UWQ A;  2INP E;  2ZW0 A;  4OW0 A;  3AB5 A;  1T0S C;  1I4Q A;  4HK2 A;  3P4S B;  4NQK E;  2MJD A;  2MLB A;  4BBN F;  2LGX A;  3APC A;  2I1J A;  2RPQ A;  3VR8 B;  4RF1 A;  3KH0 A;  5L95 C;  5LXI B;  4PS7 A;  2BB5 A;  4M01 A;  4MEM A;  1AN8 A;  5J17 A;  2VZK B;  2LGI A;  3U52 E;  2ASQ A;  3L08 A;  1FRD A;  4ANW A;  2KTF A;  5H92 C;  2JXX A;  2BQQ A;  3RZW C;  1T0Q C;  1K52 A;  3RN9 C;  1VZ6 A;  2VZK D;  4MM3 A;  4RCO A;  5G55 A;  3R66 C;  3PRE A;  1YIW A;  4FBJ B;  3OG5 A;  1YN3 A;  3AH7 A;  4GMV A;  4C4V A;  1YJI A;  4WJP A;  2J7Q B;  1OQR A;  1EO6 A;  3JSV A;  1ENF A;  5FK9 C;  1UF0 A;  1N62 A;  2D3A A;  1WMH A;  1E9M A;  2LVQ A;  2NBU A;  2GBM A;  2K6Q A;  1UWM A;  1GC7 A;  2IO0 B;  1KJT A;  3PRZ A;  2MP2 A;  1ET9 A;  1R4N B;  4IWO A;  4JQW C;  4F7Z A;  4KDL B;  4LDT D;  2JZP A;  1E8W A;  1ROE A;  1R4M B;  3FAH A;  4B0E A;  1YN4 A;  4XX5 A;  2W55 A;  1L6U A;  2QHO A;  2LGD A;  4C7Y A;  1F0Z A;  3M63 B;  4L1B A;  3HHM A;  4TMA B;  1EF1 A;  3VUY A;  4WWN A;  1KLV A;  4OVZ A;  1WX9 A;  1HEZ E;  2G45 B;  4NPN A;  4JL9 A;  2WLB A;  1V9J A;  2KHW B;  2N9X A;  2JWU A;  1UGM A;  1HTQ A;  3ZVV A;  2FUH B;  1VCB A;  2WXH A;  1HTO A;  3LB8 C;  1XQQ A;  1L0Y B;  4A55 A;  2KFK B;  2W54 A;  4IW0 A;  3Q3J A;  3URY A;  1XXG A;  5DPW A;  4G50 A;  2WXI A;  2PE6 B;  2KX0 A;  1NVI D;  2XEW A;  3VDZ A;  2MJE A;  2FCN A;  1WY8 A;  2D07 B;  2FNJ B;  4DHZ E;  3O65 B;  3D32 A;  4HJG E;  4HPL B;  3A1Q B;  4ANU A;  2HDE A;  3NY5 A;  5JHB A;  3T3O A;  3U2S C;  2LUM A;  4IOI E;  1TIF A;  1NI3 A;  2L0T A;  4N6E B;  4URK A;  3QX1 A;  2WX0 A;  1BML C;  1WJU A;  1SE2 A;  3HM6 X;  2KFJ A;  2PVG C;  2PLP A;  1XLN A;  2KQS A;  4DDI D;  3N1Y C;  3ENE A;  2FIF A;  2WXQ A;  4XGA B;  1PFD A;  3L17 A;  3Q8B A;  4EOY A;  2R61 A;  4GU2 A;  1BXT A;  5BO4 B;  5HKH A;  2WDQ B;  4F1S A;  5KHQ A;  1WYW B;  1ESF A;  1YMH E;  2JVC A;  3Q3F A;  3V60 A;  4PT5 A;  1KTK A;  3DVN U;  2D3B A;  2L3Z A;  2MBB B;  4EZK A;  4RFB A;  1ISN A;  4GB9 A;  4HEA 1;  4BZA A;  4KGS A;  2Z0E B;  3I63 C;  1RAX A;  3AI5 A;  1C4P A;  3DBR I;  3DBS A;  1WIA A;  4IG7 B;  4I6L B;  4KSK C;  1FIQ A;  4NAW B;  1QOG A;  3IHP C;  3P42 A;  5D3D A;  1WR6 E;  4MT5 A;  2QSD A;  1VZ8 A;  3IBE A;  3NS1 A;  3ZJV A;  4LJO B;  1FEH A;  4KZC A;  2DHZ A;  2AX5 A;  2KTR A;  1PQS A;  2WWZ A;  4A3P A;  3AE7 B;  4FJZ A;  3RFZ B;  4ARI A;  1SJE D;  2DAF A;  2MBE A;  4FJV B;  4ACF A;  2KAJ A;  3T8M A;  1J7A A;  3RNB C;  3KWL A;  3SHQ A;  1V5O A;  1XF5 L;  2GB1 A;  4DBG A;  1RYJ A;  2KWD A;  2WDR B;  1SF0 A;  1SSN A;  4MSQ B;  2CS4 A;  2KVZ A;  4KV2 A;  3MC8 A;  3ZQ4 A;  4JPS A;  2D3G A;  1N60 A;  2KXJ A;  1E8Y A;  4HDO A;  1EM7 A;  1IGC A;  3WAN A;  2JYT A;  2FCM A;  4IC7 B;  4DXA B;  1YJJ A;  1H8C A;  4A9A A;  1SE4 A;  1JWA D;  1D5Z C;  3NHE B;  3PGE A;  1BUI C;  5C2T B;  2GOW A;  2R2O A;  3U7Z A;  2GBJ A;  1SIJ A;  3VTV A;  1KLU D;  2KJR A;  3Q2A C;  1GJZ A;  1KH0 A;  3TSS A;  4WQM A;  3A1Q A;  3VVW B;  3R2T A;  2N1V A;  2BGF A;  4EZL A;  3H7P A;  2DZM A;  3WIM A;  5AZF A;  1ZPS A;  4NJ7 A;  3E56 A;  2XN9 C;  1XLQ A;  4IWP A;  2ZVN A;  3MTN B;  1E0Z A;  3AE9 B;  4MDK E;  2KFK A;  3B08 A;  2WP9 B;  3AEG B;  4AWJ A;  5BYS A;  2WU2 B;  4BFR A;  2ONQ A;  3DOW A;  3PHW B;  4A90 A;  1VR9 A;  3FC4 A;  3X23 A;  4XDC A;  3EFC A;  3R8B A;  4BOS C;  2HJ1 A;  1WXS A;  2W82 A;  3NZ3 A;  2C7M B;  1JCK B;  3IVF A;  2K25 A;  4IM2 A;  2GBK A;  4KKJ A;  4TKN A;  5HG2 A;  1ZXI A;  3WAO A;  1CK1 A;  3I3T B;  1Y56 A;  1FFV A;  2AQ3 B;  2D11 A;  4MGK E;  4M0W A;  2DZK A;  4HPM B;  1V2Y A;  3L0W B;  2O6V B;  2DZJ A;  1D5M C;  4GXB A;  2W3R A;  3QJZ A;  2KK8 A;  4NZL B;  5T8I A;  4J6I A;  4A20 A;  5CHV C;  3KLS X;  1P98 A;  1NBF C;  3NZS A;  1N63 A;  1UBQ A;  4GLS C;  3T9L A;  1JWS D;  3RD2 A;  5HFY A;  4KKI A;  5D6J B;  1QQR A;  1XCT L;  2L52 A;  1S1Q B;  3GOE A;  2OHF A;  4K7S A;  3DBL I;  4WUR A;  1WJ4 A;  1OEY A;  3SFD B;  4WWO A;  1SXT A;  2OJR A;  4CHK A;  1Q5W B;  2RMM A;  4LLG M;  4LNO A;  3WAL A;  1KLG D;  4JIO U;  3PSE B;  3B9J A;  3I57 A;  2AL3 A;  5BYR A;  1QIL A;  2QIE B;  3L10 B;  2K6D B;  4ZRK A;  3ZUN A;  4HVB A;  4ICV A;  3DHI C;  1UD7 A;  1N5X A;  2J52 A;  1UNS A;  2RD0 A;  3SR6 A;  5BMI A;  3A4S C;  1QZE A;  2HTM E;  1VJK A;  3A9K A;  1QLB B;  1WJ6 A;  2RGF A;  5E6P A;  5AUI A;  3N32 A;  2N7J A;  3Q8E A;  3ZIM A;  4RGT A;  1R4M I;  4XYC A;  1KFY B;  5D7G A;  4C80 A;  1QOB A;  4LDT B;  2LI5 A;  3KW5 B;  3QCA A;  1V1P B;  2RDH A;  2O2V B;  4USA A;  3KUD B;  1SE3 A;  3DPD A;  1T0Y A;  2KO3 A;  4GOC A;  4EE2 A;  2CJO A;  2LZ6 A;  2M17 A;  1PGX A;  2W3S A;  4LTU A;  2G4D B;  4IWQ A;  2KMM A;  1N5W A;  2WYQ A;  2WHI A;  3WA0 A;  2KJH B;  3PT2 B;  1UZX B;  1KM7 A;  3HIZ A;  4WWM A;  3BII D;  1AAR A;  5C23 A;  2K0P A;  2TSS A;  2NCN A;  2RPV A;  1WE6 A;  2PPH A;  1JWB D;  2JZZ A;  4TUU A;  1WGK A;  3ZXV A;  2JQR B;  3LXF A;  1WGY A;  3AEC B;  3WCQ A;  5L83 A;  2MP2 B;  2GBR A;  2WX1 A;  1OGW A;  4OZA A;  2PKO A;  1XT9 B;  4RGM A;  2WU5 B;  3R7Q A;  2N9K A;  2IGH A;  1NEK B;  4NAW A;  3EA6 A;  1RFK A;  3MC9 A;  2RR9 A;  3J9C A;  1M4V A;  1MVK A;  4BBN C;  2N1W A;  4HDQ A;  3MP9 A;  2KOX A;  3IFW B;  2M56 B;  4KVG B;  2LGS A;  4F8C B;  1FM0 D;  3R7R A;  3N1X C;  4II3 B;  4WJN A;  1WE7 A;  2AQ1 B;  5JZE B;  4AQ7 A;  3GB1 A;  4RMA A;  2JZ3 B;  1GAQ B;  2MHJ A;  2I1K A;  3UIO B;  2MX2 A;  3MHZ A;  3PRP B;  3ONS A;  4HRS A;  3DHH C;  4KGR A;  1J7C A;  1EWC A;  2WXM A;  3HUI A;  4GDL B;  3QHT A;  1PGA A;  1YOV B;  4KGT A;  2VRR B;  1K53 A;  4I6P A;  1TBE A;  1U4A A;  2KLC A;  2L0F A;  5IA7 A;  2M8S A;  1FO4 A;  1C76 A;  1GPX A;  2B3A A;  2HTH A;  3RNF C;  2INC C;  3DBR B;  4ARC A;  1E8Z A;  1VRA B;  1NI2 A;  1P7E A;  1ZDV A;  3ZTD A;  2QC8 A;  3BWU D;  2C9W B;  2BYF A;  4TV3 A;  3RUL A;  1TS5 A;  2KC2 A;  3PVL A;  3SDL C;  1LFD A;  1WYG A;  2LEK A;  1IPG A;  4YSX B;  1PGB A;  4BKT A;  3PHX B;  3PO0 A;  1LM8 B;  4BVU C;  1OEY J;  3MJW A;  3ZDT A;  2BS3 B;  4KIK B;  3PZ7 A;  2LHE A;  3ZNI D;  3QWZ B;  1YX6 B;  4XDD A;  3AN1 A;  2J0M A;  1NYQ A;  1XCQ L;  3RNC C;  3RT3 B;  4ZDV A;  1KF6 B;  1SJH D;  1OQY A;  4RM9 A;  3PZ8 A;  4US8 A;  2V0G A;  5FR3 A;  1MJD A;  2E6X A;  1MG4 A;  2HD5 B;  3W5V B;  3UI3 A;  3UIN B;  2RDG A;  3DWM A;  4A3O A;  1V6E A;  3Q8F A;  2G9H D;  2WNM A;  3QAR A;  3RNE C;  1JRU A;  3OJ4 B;  5BMH A;  4LNN A;  5IP4 D;  4AJY B;  1DOX A;  1L5P A;  1E10 A;  3EFU A;  2I2Y A;  4K3B A;  2GMI C;  4WWP A;  2NBV B;  2GI9 A;  2QEJ C;  3NG0 A;  5DPR A;  4BAX A;  2M1M A;  3AU5 A;  2MWS B;  2PVO D;  1P3Q U;  2UU7 A;  4HRO A;  3L54 A;  4W9F A;  2D2Q A;  3WAM A;  2EMS A;  4W9G A;  3IAM 1;  1E7U A;  4DWF A;  4HCP B;  1SIF A;  1C3T A;  2DYO A;  4YTN B;  1UH6 A;  1WM2 A;  2JYE A;  4IUM B;  1OQQ A;  5FR6 A;  1S3S G;  2IGG A;  2L76 A;  5D2M B;  2M0A A;  2D10 A;  3VTU A;  2K22 A;  3GS2 A;  3TBL D;  3M3J A;  2WXN A;  1E90 A;  2KDB A;  2SAK A;  3QIJ A;  3BVM A;  5C1Z A;  3PPA A;  3FIL A;  3Q3O C;  2FCS A;  1LGR A;  3B2F A;  2ZCB A;  3RUI B;  3ZYY X;  3CMM B;  3IG3 A;  1FNW A;  4MJS B;  1PUT A;  1AW7 A;  2CHZ A;  4N59 A;  4TQ0 A;  2AL6 A;  1AYF A;  3ML9 A;  4ANV A;  3Q3M C;  4AP4 C;  2AYO B;  3ECI A;  3BVZ A;  3NJT A;  3W1S C;  3PRM B;  4WJO A;  2C7H A;  4JGH B;  2KWV B;  2D3C A;  2LXA A;  4LJP B;  4E71 A;  1OFF A;  3MC0 B;  2PTL A;  4WH4 A;  1CQV A;  3VXW A;  4WJQ A;  1ZGU B;  2Y5C A;  1V86 A;  3KQ4 A;  1A70 A;  1F2R C;  1K51 A;  2CU1 A;  2WXO A;  4G0N B;  3DBH B;  1TGZ B;  3TMP B;  3U4E G;  3NS8 A;  4ZRJ A;  4HCN B;  1NDD A;  5E6N A;  2LGY A;  3M62 B;  4G3X B;  1YD8 U;  4RF0 A;  1JWM D;  4DHJ D;  2E3T A;  3B1L X;  1WX7 A;  1TS3 A;  1UUP A;  5EE9 A;  4E3C A;  3MHS D;  2KKC A;  3DHG C;  2Z59 B;  2KNB A;  5AEK B;  5AZH A;  4HKZ E;  2IND C;  3ZRC A;  3V6E B;  2J4X A;  2BKF A;  1E7V A;  3RPF C;  4II2 B;  3HK0 A;  2LHD A;  1FD6 A;  3W5U B;  3ETR A;  3GP7 A;  4W9D A;  2WXJ A;  2NBW B;  1CZP A;  2GBN A;  3TEW A;  3AE2 B;  1IBX B;  4ZHP A;  4FAD A;  2KJ6 A;  4GGQ A;  2PJH A;  2BYE A;  4REZ A;  3BK1 A;  2QIL A;  3LYY A;  2MBH A;  2MA9 B;  5I4D A;  2Y5P A;  2KWU B;  2NS5 A;  3B0A A;  1GB4 A;  3Q3N C;  1ZXH A;  1E5W A;  3AMZ A;  3QA8 A;  4YL8 A;  4ZOH C;  2BS2 B;  1J0G A;  1D3Z A;  2IO2 B;  4MJS A;  1H4R A;  4GDL A;  4ZRI A;  3TIX A;  3VHT C;  1TJE A;  1STE A;  2LWP A;  2LVO A;  2PW9 A;  2K3U A;  3R3M A;  4OZC A;  2LFI A;  3EC8 A;  3AU4 A;  1WWT A;  3OAW A;  3GZN I;  1JW9 D;  1V8C A;  3ZO5 B;  2PE9 A;  4RNA A;  3ZNH B;  4D2K A;  2AWT A;  3VUX A;  4FHK A;  1VDV A;  2LVP A;  2ZPY A;  2WXK A;  1FMA D;  3DVG Y;  2M0X A;  3KWV A;  1WZ3 A;  2IYD B;  1GUA B;  1ZOY B;  3S2A A;  2Z8L A;  3HRD D;  2DYM A;  3U7D A;  2M19 A;  5D3I B;  2W9N A;  4ZRP A;  5IKC M;  3VRA B;  2JT4 B;  1VZ7 A;  3W1Y A;  1IP9 A;  1F2R I;  3I9V 1;  3AE5 B;  2IY1 B;  4KSL C;  4HLE A;  2J0J A;  2MW5 A;  4HPP A;  2IO3 B;  2KYW A;  4N9F 4;  3KUZ A;  3AUL A;  1V49 A;  2A4Z A;  1C78 A;  2DLB A;  1ZP0 B;  2IJ0 A;  1L4Z B;  4EKU A;  2ICI A;  3U30 A;  4JE3 B;  2KDM A;  2JRH A;  2KMA A;  4XE0 A;  2N7D A;  1QF6 A;  2V3S A;  3AE8 B;  4LNK A;  3VRB B;  4DHZ B;  3QQ8 B;  1D4B A;  4B0M A;  4GDK B;  3QC8 B;  3W2D A;  2V3N A;  1UWX A;  2XBB C;  2KQ7 A;  2DEN B;  3ZDM C;  2MCN B;  1V80 A;  2N0S B;  4C7Z A;  2NTS A;  3JYU A;  3BY4 B;  3HVD A;  2WGS A;  4MGI E;  2WXL A;  1WRD B;  4EEW A;  1D5X C;  3P4Q B;  2G4S A;  3H7P B;  4K81 A;  5LLI A;  1F1H A;  1I4H A;  2WXP A;  3OJ3 A;  2NVU I;  1J19 A;  1FCC C;  3A9J A;  2BF8 B;  3PS6 A;  3U8Z A;  4AJW A;  2EKE C;  1SB3 C;  4OHJ A;  3JVZ X;  2BPS A;  4PS8 A;  2KD0 A;  3AEB B;  1V97 A;  3KVF B;  3GE3 C;  4ANX A;  3UQB A;  3Q69 A;  2REX A;  2RDB C;  1FFU A;  3CST A;  1WXM A;  4PYZ A;  1XO3 A;  1L6V A;  3RYT A;  3C0R B;  3L13 A;  3DVG X;  3AEA B;  2MEK A;  4CYE A;  4EUT A;  5AZG A;  1UBI A;  2DBY A;  3AXC A;  3K9P B;  1IGD A;  2WXR A;  1MPE A;  2IGD A;  4LNI A;  3X0W A;  2ZCC A;  4AUQ C;  2L83 A;  2LUE A;  1R7S A;  4K3C A;  4NQL B;  2KTR B;  3V62 A;  3TEZ A;  2KMC A;  3O13 A;  1EU4 A;  1OTR B;  2DAJ A;  3BZD B;  3EEC A;  4DQO C;  3FKY A;  1JWU D;  1F52 A;  1Q0W B;  1YX5 B;  4JX1 C;  1CJE A;  3Q6B A;  5JXV A;  1TS4 A;  2EKI A;  1WFY A;  2ZPN A;  3IT4 B;  2JSV X;  3DQV A;  3L16 A;  1RRB A;  4W9K A;  1N61 A;  4XZ4 A;  1VLB A;  1FNV A;  4M02 A;  5IO9 A;  3ZGZ A;  2L8J A;  1RFA A;  4FN2 A;  4IM3 A;  4FLH A;  5BMG A;  1GG3 A;  1MI0 A;  3NZU A;  1LQB A;  3AED B;  1WSP A;  2M4N A;  1TKE A;  5H8Y E;  4PYU A;  1EWY C;  5D94 A;  3KYD D;  3QK0 A;  2KN4 A;  4MGY E;  1T5X D;  1YJ1 A;  1AWD A;  2KDF B;  1JRO A;  1HA5 A;  3N20 C;  1T0R C;  2CU3 A;  2PMV A;  4PK1 A;  2V1Y A;  1MHH E;  1WZ0 A;  4XWW A;  2IO1 B;  5JH5 C;  2K8H A;  3PZD A;  3Q8A A;  1C79 A;  3AEE B;  1TYG B;  1Z2M A;  2IZV B;  1ZDX A;  4RGN A;  4JWU C;  3AV8 A;  1FNU A;  2O2V A;  1TZO A;  3TEY A;  2K8B A;  1PDX A;  1XEE A;  2N7E A;  2L1A A;  2OOB B;  2Y5B B;  4QAY A;  1ET6 A;  5DCN A;  1HE8 A;  2NPT B;  3DCG A;  3M95 A;  4KIK A;  4BKS A;  1R4N I;  4XWT A;  1F9J A;  2GLS A;  3ZNG C;  4W9C A;  2QDF A;  2X8X X;  3ZW3 A;  2KN5 A;  3V3X A;  1MHX A;  5EE0 A;  4X57 B;  1D6E C;  3N3K B;  3ML8 A;  3KYC D;  3AE4 B;  4KX6 B;  2C7N B;  1TKY A;  5JHA A;  1Y8R C;  1LXD A;  2SEB D;  1WJN A;  1JQ4 A;  1NYR A;  4MH8 A;  2MJ3 A;  5GMV A;  4RGO S;  2VH1 A;  3TL5 A;  4YWG G;  1I7H A;  3IXS A;  2LRW A;  3P4P B;  2AEH A;  2N9E B;  3TJP A;  1YN5 A;  4P1C C;  1J8C A;  1QT9 A;  3ZXR A;  1WGG A;  4W9J A;  4M00 A;  1TY0 A;  3A4R A;  2K1F A;  4US9 A;  5KHO A;  1ACC A;  3ZJT A;  2YVC A;  1DGJ A;  1WXA A;  2NTT A;  3SD5 A;  2MSE D;  2HE7 A;  2Z0D B;  1VD2 A;  4OZB A;  4NY0 A;  4WQO B;  4LNF A;  4R3D A;  3VFK A;  2H88 B;  2KAN A;  3IAS 1;  4K7U A;  1CMX B;  2FAZ A;  2L7R A;  3PLU A;  1EU3 A;  3NVZ A;  2O6V A;  2CHW A;  2XK5 B;  1WMH B;  3V61 A;  1WF9 A;  3OLM D;  4EZJ A;  2QMT A;  4UDU C;  4W9E A;  4M0W B;  5DPT A;  3SFE B;  4C4V B;  3SU8 X;  3HVZ A;  1TY2 A;  2ZNV B;  1F77 A;  4P1B C;  1L0V B;  3Q8C A;  2MBQ A;  4WAA A;  2B76 B;  3EHV A;  4I6N B;  4MGZ E;  1XLO A;  1M94 A;  1FXI A;  3TCA A;  4M8M A;  3MFG A;  4WIP A;  3N30 A;  1TTN A;  4BOZ B;  3APD A;  5CX3 A;  1C1Y B;  2FE8 A;  1QOF A;  3K9O B;  1FXT B;  2YEP B;  2V9H A;  2ZEQ A;  2LJ5 A;  4AS1 A;  2L00 B;  1JML A;  5MPO A;  1B9R A;  4HJK A;  4HKQ A;  1HZ6 A;  2XK5 A;  4DK5 A;  3W1S A;  1I4P A;  1RM6 C;  2CR5 A;  3KUC B;  4E74 A;  1XLP A;  3BYT B;  4JLC A;  3RI7 C;  3NUH B;  2J53 A;  1C9F A;  2JF5 A;  3WAP A;  4H2A A;  3A9K B;  2G1E A;  1T3Q A;  1NEN B;  5IN7 A;  5TR5 A;  4LK0 M;  2FBW B;  3ZNZ B;  2BVC A;  4ICU A;  1LO5 D;  2GRI A;  4FA6 A;  2J0K A;  3RMK C;  2VH2 A;  2LJI A;  4S17 A;  1UGJ A;  2N4F A;  3ZRF A;  2BW2 A;  4DDG D;  4B9K A;  1WI0 A;  4J3O D;  3L4P A;  4P7I A;  3AE1 B;  4BKG A;  1HXY D;  1ZUD 2;  2KC1 A;  3APF A;  4YTM B;  2QJL A;  2BKR B;  1P7F A;  4P16 A;  1RLF A;  2MBO A;  3Q14 C;  4B95 A;  5E6J A;  3BVG A;  4ZYN A;  2BS4 B;  4ZHO A;  4EFO A;  2BYT A;  1FRR A;  3VQI A;  3N1Z C;  2DNF A;  4FUL A;  1E6E B;  2NPT A;  2K9X A;  1WXQ A;  2JU6 X;  2KZR A;  3IT6 B;  4KDI C;  2KX3 A;  5EE3 A;  1HZ5 A;  5FKA C;  5TSS A;  3VH3 B;  3UIP B;  3EGR A;  1WM3 A;  4HXD A;  2WXG A;  2MH7 A;  3P63 A;  3ABV B;  1ZKH A;  4W9L A;  1DOY A;  4W9H A;  1EF5 A;  3RNA C;  3V6C B;  3VR9 B;  2MQJ A;  2WS3 B;  1BT0 A;  3PTF C;  3VTW A;  4GN1 A;  2PIA A;  3MJ5 A;  2Q5W D;  2BB6 A;  4N58 A;  4G11 A;  1L0X B;  4C00 A;  2WQY B;  2I38 A;  2PEA A;  2JPH A;  3ZJU A;  3BK2 A;  4XC2 A;  1MFW A;  2HJ8 A;  4MM3 B;  3DVN V;  4ZYS A;  2CKH B;  3H8H A;  3QAQ A;  3N9Y C;  3H7S A;  1I4G A;  1V5T A;  3AE6 B;  3DWG C;  1WGR A;  3GZN B;  4K7W A;  3ALB A;  2JY6 A;  1C4C A;  4NNJ B;  1J7B A;  2IY0 B;  3UF8 A;  2BWE S;  1TKG A;  3LJ3 A;  1GB1 A;  2FID A;  3NRZ A;  1L7Y A;  2AQ2 B;  1YQB A;  3B2G A;  4IM0 A;  1FCL A;  2V3P A;  2INN E;  3FIL B;  1QKZ A;  3ZKJ C;  1TT5 B;  2OED A;  3HM3 A;  2NMQ A;  4NJC A;  3P4R B;  3VAW A;  1KRH A;  5G5H A;  3NVY A;  5LXH A;  3NOB A;  1QOA A;  4IDI A;  1YQ3 B;  3CIR B;  2J42 A;  4TQ1 A;  1P1A A;  2YEP F;  4PS3 A;  5GXG B;  4TSS A;  4NAM A;  2JRI B;  4LCD E;  1WXV A;  1MG8 A;  3UQA A;  2ZJD A;  4MSM B;  2BT6 A;  3CWI A;  3NVV A;  2DX5 B;  2KDI A;  5LNK 1;  4RH6 A;  4DHJ B;  2L05 A;  4ITK A;  5IOI A;  1C77 A;  2FCQ A;  4FHJ A;  2C60 A;  4L23 A;  1Z5S B;  1SGH A;  3RNG C;  4MAC A;  3PLV A;  3T3N A;  3C19 A;  1WGH A;  2LD9 A;  1SBB B;  2BTE A;  4GIV A;  4IKG A;  4A6Q A;  1JRP A;  3DBH I;  1Q10 A;  4B6W A;  3CF6 E;  4MH0 E;  1HQR D;  4ZRQ A;  3ZTC A;  4A8X C;  1YQ4 B;  2QCZ A;  4S0R A;  3A9J B;  2KDE B;  2KWC A;  2IDY A;  3TUO A;  1P0R A;  1SEB D;  1WGD A;  5IAA C;  3H1U A;  1I4X A;  4YXD B;  2JX5 A;  5J18 A;  2OJW A;  4OVV A;  1V1P A;  2ON8 A;  4BKS D;  2WXF A;  1GOZ A;  3AEF B;  5E6O A;  5G2N A;  5AUK A;  5C3J B;  1C4A A;  3E9S A;  2WDV B;  3I5J C;  2EMT A;  2IPK D;  3VUW A;  1UEL A;  1TS2 A;  4GDK A;  1PYW D;  3JSV B;  3NVW A;  3A33 B;  3EUB 2;  1P9D U;  3C8Y A;  2KT7 A;  1FPY A;  3SEB A;  4KZ0 A;  4YSZ B;  2DYB A;  3AM9 A;  4NJ6 A;  3W9C B;  2ZVO A;  3BYY B;  4M8N A;  1I35 A;  2JUO A;  4OVU A;  5CHF A;  1SE9 A;  3UGB B;  3CSF A;  1Q1O A;  1L4D B;  3TEX A;  3AE3 B;  2LMC A;  2UYZ B;  1GNU A;  2ZZP B;  2YLM A;  3H6N A;  5CHW A;  2WDT B;  4L2Y A;  4P6V F;  1WH3 A;  3R2I A;  4K1R B;  1N6Z A;  1GC6 A;  2DWQ A;  1E8X A;  2MRP A;  2NR2 A;  1V81 A;  3DBL B;  2KQ4 X;  1T6B X;  1XD3 B;  2K5P A;  1WX8 A;  2ZW1 A;  4MEL A;  1L2N A;  3RZF A;  1A5R A;  2KAC A;  4FJY A;  2LAS A;  4ASW C;  2ACZ B;  4CQN A;  3DDC B;  4FXC A;  1FXA A;  1E7P B;  2KLG A;  3VH4 B;  5EDS A;  3LDZ E;  2K8C A;  2Y3A A;  3P2B A;  2LRU A;  3OWE B;  1DOI A;  4JWS C;  4W9I A;  2N9P C;  4C56 C;  1WRI A;  2IBI B;  1G6J A;  4YTP B;  2L32 A;  4RM8 A;  3PV1 A;  2JWZ A;  1K8R B;  1I42 A;  2BBC A;  2G3Q B;  2X38 A;  2N9L A;  2BYV E;  4YT0 B;  1IYF A;  1TZ1 A;  4GSW A;  2JXT A;  3GE8 C;  3ZLZ A;  2RSU A;  4CO7 A;  2XNA C;  1WR1 A; 
#chains in the Genus database with same CATH homology
 5DPS A;  2R2Q A;  3SU8 X;  4E3C A;  2CHX A;  3MHS D;  2KKC A;  3WAO A;  2ZNV B;  2Z59 B;  2KNB A;  4HWI B;  5AEK B;  1EUV B;  2MBQ A;  3I3T B;  5AZH A;  4WAA A;  2D11 A;  4MGK E;  1ZW7 A;  3EHV A;  3RCZ A;  2DZK A;  5CTR C;  4HPM B;  1V2Y A;  3ZRC A;  2C5L C;  2ZNV C;  4I6N B;  3V6E B;  4AOF A;  2BKF A;  4MGZ E;  3L0W B;  5J2R A;  1E7V A;  2O6V B;  2DZJ A;  4II2 B;  1M94 A;  3HK0 A;  2DZI A;  4GXB A;  3QJZ A;  2KK8 A;  3TCA A;  3BIN A;  4J6I A;  4M8M A;  4W9D A;  2NBW B;  3N30 A;  5CHV C;  1TTN A;  2GBN A;  3APD A;  4A20 A;  4BOZ B;  5CX3 A;  1C1Y B;  3H9D A;  3K9O B;  1FXT B;  2A5U A;  4FAD A;  2KJ6 A;  4GGQ A;  1P98 A;  2ZEQ A;  2LJ5 A;  2PJH A;  1NBF C;  2L00 B;  3NZS A;  2BYE A;  2BWF A;  1UBQ A;  2KVR A;  3JW0 X;  3T9L A;  2MBH A;  2MA9 B;  3RD2 A;  1X1M A;  4HJK A;  5D6J B;  2XK5 A;  4DK5 A;  3W1S A;  2O6V D;  1KOT A;  1S1Q B;  2KWU B;  2LXC A;  3GOE A;  2K39 A;  2NS5 A;  3B0A A;  3DBL I;  2CR5 A;  4K7S A;  1E5W A;  3KUC B;  3QA8 A;  4YL8 A;  4E74 A;  2V4L A;  1WJ4 A;  2UWQ A;  1J0G A;  1D3Z A;  2IO2 B;  1OEY A;  4WWO A;  4MJS A;  1H4R A;  4GDL A;  4HK2 A;  4ZRI A;  4NQK E;  3TIX A;  3VHT C;  2LWP A;  2LVO A;  2OJR A;  4JLC A;  4CHK A;  3R3M A;  1Q5W B;  2MLB A;  3WAL A;  4BBN F;  3EC8 A;  4JIO U;  2LGX A;  3AU4 A;  3APC A;  3PSE B;  2JF5 A;  2I1J A;  2RPQ A;  3WAP A;  3A9K B;  3OAW A;  3GZN I;  2AL3 A;  3ZO5 B;  2PE9 A;  3KH0 A;  5TR5 A;  3ZNZ B;  3ZNH B;  5L95 C;  5LXI B;  3L10 B;  2K6D B;  4ICU A;  4PS7 A;  2AWT A;  4FA6 A;  4ZRK A;  3ZUN A;  2J0K A;  3VUX A;  4FHK A;  4MEM A;  4HVB A;  2N4F A;  3ZRF A;  5J17 A;  4ICV A;  4DDG D;  2LVP A;  1UD7 A;  4B9K A;  2RD0 A;  2ASQ A;  1WI0 A;  2ZPY A;  3L08 A;  3DVG Y;  2M0X A;  4ANW A;  3A4S C;  1QZE A;  2KTF A;  2JXX A;  4P7I A;  3RZW C;  4BKG A;  1WZ3 A;  2KC1 A;  4MM3 A;  5G55 A;  3A9K A;  3APF A;  1WJ6 A;  2IYD B;  3R66 C;  1GUA B;  2RGF A;  5E6P A;  2BKR B;  3PRE A;  3N32 A;  3S2A A;  3ZIM A;  1YIW A;  2DYM A;  1R4M I;  3U7D A;  4FBJ B;  2W9N A;  1RLF A;  5D7G A;  4LDT B;  2LI5 A;  2MBO A;  3KW5 B;  4GMV A;  3QCA A;  2JT4 B;  3W1Y A;  4B95 A;  4WJP A;  1IP9 A;  2J7Q B;  2O2V B;  4ZYN A;  2IY1 B;  4KSL C;  4EFO A;  3KUD B;  4HLE A;  2J0J A;  3DPD A;  3VQI A;  1EO6 A;  2MW5 A;  3JSV A;  1T0Y A;  2KO3 A;  2IO3 B;  4GOC A;  4N9F 4;  3KUZ A;  1WMH A;  2M17 A;  2LVQ A;  1V49 A;  2A4Z A;  2LZ6 A;  3AUL A;  4FUL A;  2NBU A;  2GBM A;  2K6Q A;  1GC7 A;  2IO0 B;  1KJT A;  2NPT A;  2KZR A;  4KDI C;  2G4D B;  2KX3 A;  3PRZ A;  4IWQ A;  4EKU A;  2MP2 A;  4IWO A;  4JQW C;  3U30 A;  2WYQ A;  4F7Z A;  3VH3 B;  4KDL B;  2JRH A;  4LDT D;  3UIP B;  2KMA A;  3WA0 A;  2N7D A;  1E8W A;  1WM3 A;  2V3S A;  2KJH B;  4HXD A;  4XX5 A;  3PT2 B;  1UZX B;  1ZKH A;  4DHZ B;  1KM7 A;  3HIZ A;  2QHO A;  4W9L A;  3QQ8 B;  2LGD A;  4W9H A;  1EF5 A;  3QC8 B;  1AAR A;  4GDK B;  3V6C B;  2MQJ A;  5C23 A;  3M63 B;  1BT0 A;  2XBB C;  2KQ7 A;  2NCN A;  1WE6 A;  2PPH A;  2DEN B;  3PTF C;  3ZDM C;  3VTW A;  3HHM A;  1EF1 A;  3VUY A;  2MCN B;  2JZZ A;  1V80 A;  4WWN A;  4GN1 A;  1KLV A;  1WX9 A;  4TUU A;  2G45 B;  3JYU A;  3BY4 B;  1WGY A;  4MGI E;  4NPN A;  1WRD B;  4JL9 A;  4EEW A;  1V9J A;  2KHW B;  4G11 A;  5L83 A;  2N9X A;  2PEA A;  2G4S A;  3H7P B;  1UGM A;  2JPH A;  2MP2 B;  4K81 A;  2GBR A;  5LLI A;  3ZVV A;  2FUH B;  2WX1 A;  1OGW A;  1VCB A;  3OJ3 A;  4XC2 A;  2HJ8 A;  1XQQ A;  2NVU I;  1J19 A;  2KFK B;  3DVN V;  1XT9 B;  2CKH B;  3R7Q A;  3QAQ A;  4IW0 A;  4NAW A;  3H7S A;  3Q3J A;  1V5T A;  3A9J A;  1WGR A;  2RR9 A;  2BF8 B;  3PS6 A;  3U8Z A;  4K7W A;  4AJW A;  2EKE C;  4BBN C;  3ALB A;  2JY6 A;  2N1W A;  4G50 A;  4NNJ B;  2IY0 B;  4HDQ A;  5DPW A;  3UF8 A;  2KOX A;  2BWE S;  2PE6 B;  3IFW B;  3JVZ X;  4KVG B;  3LJ3 A;  4F8C B;  2BPS A;  4PS8 A;  2FID A;  2KD0 A;  2KX0 A;  3VDZ A;  2XEW A;  3R7R A;  1L7Y A;  3KVF B;  1YQB A;  4II3 B;  2FCN A;  4WJN A;  1WE7 A;  4ANX A;  5JZE B;  4IM0 A;  3UQB A;  1WY8 A;  2D07 B;  2FNJ B;  4RMA A;  2JZ3 B;  3O65 B;  3D32 A;  4DHZ E;  4HPL B;  3A1Q B;  3ZKJ C;  4ANU A;  2I1K A;  2REX A;  3NY5 A;  5JHB A;  3UIO B;  2MX2 A;  3CST A;  1WXM A;  3HM3 A;  3PRP B;  3ONS A;  4PYZ A;  3VAW A;  3RYT A;  3C0R B;  3L13 A;  2L0T A;  3DVG X;  4GDL B;  3QHT A;  4URK A;  4CYE A;  5LXH A;  4EUT A;  3QX1 A;  3NOB A;  5AZG A;  2WX0 A;  2VRR B;  1WJU A;  1UBI A;  4I6P A;  3AXC A;  1TBE A;  1P1A A;  1U4A A;  2KLC A;  3HM6 X;  3K9P B;  4TQ1 A;  2KFJ A;  2L0F A;  4PS3 A;  5IA7 A;  2M8S A;  3X0W A;  2JRI B;  2KQS A;  2ZCC A;  2B3A A;  4AUQ C;  4LCD E;  2LUE A;  2HTH A;  4DDI D;  4NQL B;  1WXV A;  1MG8 A;  2FIF A;  3ENE A;  2ZJD A;  3UQA A;  4MSM B;  2KTR B;  3V62 A;  1E8Z A;  1NI2 A;  2KMC A;  3ZTD A;  3L17 A;  2DX5 B;  2KDI A;  1OTR B;  2DAJ A;  4EOY A;  4DHJ B;  3EEC A;  2C9W B;  2BYF A;  4TV3 A;  4GU2 A;  2L05 A;  3RUL A;  4FHJ A;  2FCQ A;  2KC2 A;  3PVL A;  5BO4 B;  3SDL C;  1Q0W B;  1LFD A;  1YX5 B;  2C60 A;  4F1S A;  5HKH A;  5KHQ A;  1WYW B;  1IPG A;  1Z5S B;  4BKT A;  1SGH A;  2JVC A;  3PHX B;  3Q3F A;  3V60 A;  1LM8 B;  1WFY A;  2ZPN A;  3PLV A;  4BVU C;  1OEY J;  3MJW A;  3ZDT A;  3DVN U;  3DQV A;  4KIK B;  3L16 A;  1RRB A;  4W9K A;  1WGH A;  3ZNI D;  4XZ4 A;  3QWZ B;  1YX6 B;  2LD9 A;  2L3Z A;  2MBB B;  2J0M A;  4EZK A;  4GIV A;  2L8J A;  1RFA A;  4FN2 A;  4IM3 A;  3RT3 B;  4FLH A;  4ZDV A;  1ISN A;  3DBH I;  4GB9 A;  1GG3 A;  3NZU A;  4B6W A;  1OQY A;  4RM9 A;  2Z0E B;  3CF6 E;  1LQB A;  1RAX A;  4MH0 E;  3AI5 A;  3DBR I;  3DBS A;  1WIA A;  4IG7 B;  3ZTC A;  2M4N A;  4I6L B;  4KSK C;  3A9J B;  2HD5 B;  2KDE B;  4NAW B;  4PYU A;  3UIN B;  3IHP C;  4A3O A;  1V6E A;  2KWC A;  5D94 A;  3KYD D;  3QK0 A;  3QAR A;  1WR6 E;  1P0R A;  4MGY E;  1WGD A;  3IBE A;  5IAA C;  1JRU A;  1YJ1 A;  3H1U A;  2KDF B;  3OJ4 B;  4AJY B;  4LJO B;  5J18 A;  4OVV A;  4BKS D;  4KZC A;  5E6O A;  5G2N A;  2DHZ A;  3EFU A;  2GMI C;  2V1Y A;  2KTR A;  1PQS A;  2WWZ A;  4A3P A;  4WWP A;  1WZ0 A;  4FJZ A;  2IO1 B;  2NBV B;  5JH5 C;  2K8H A;  2EMT A;  3PZD A;  5DPR A;  3VUW A;  2M1M A;  2DAF A;  1UEL A;  3AU5 A;  4GDK A;  2MWS B;  1P3Q U;  3JSV B;  3A33 B;  1P9D U;  1Z2M A;  2MBE A;  2IZV B;  3L54 A;  4FJV B;  4W9F A;  2D2Q A;  2O2V A;  4KZ0 A;  3WAM A;  2DYB A;  3T8M A;  2EMS A;  4NJ6 A;  4W9G A;  2K8B A;  2N7E A;  2ZVO A;  4M8N A;  3SHQ A;  1V5O A;  1I35 A;  4DBG A;  2OOB B;  2JUO A;  2Y5B B;  4OVU A;  5CHF A;  1E7U A;  1SE9 A;  4DWF A;  4HCP B;  3UGB B;  1SIF A;  3CSF A;  1C3T A;  1Q1O A;  2DYO A;  5DCN A;  1HE8 A;  2NPT B;  3DCG A;  4MSQ B;  2CS4 A;  3M95 A;  4KIK A;  2UYZ B;  4BKS A;  4KV2 A;  1UH6 A;  1R4N I;  1F9J A;  1GNU A;  1WM2 A;  2D3G A;  2ZZP B;  4IUM B;  2YLM A;  2KXJ A;  3H6N A;  1E8Y A;  3ZNG C;  4HDO A;  5CHW A;  3WAN A;  5FR6 A;  1S3S G;  2FCM A;  2WDT B;  4IC7 B;  4W9C A;  2L76 A;  3ZW3 A;  5D2M B;  4DXA B;  1WH3 A;  2KN5 A;  1H8C A;  4X57 B;  2D10 A;  3VTU A;  4K1R B;  3NHE B;  3PGE A;  3TBL D;  3N3K B;  3ML8 A;  3M3J A;  3KYC D;  1GC6 A;  2GOW A;  2R2O A;  1E90 A;  2GBJ A;  1E8X A;  2MRP A;  2NR2 A;  3VTV A;  1V81 A;  2C7N B;  2KDB A;  5JHA A;  1Y8R C;  3QIJ A;  1LXD A;  1XD3 B;  1WJN A;  2KJR A;  5C1Z A;  1WX8 A;  1GJZ A;  3PPA A;  3A1Q A;  4MEL A;  3VVW B;  1L2N A;  2FCS A;  2N1V A;  2BGF A;  3RZF A;  1A5R A;  4EZL A;  2ZCB A;  3H7P A;  5GMV A;  4FJY A;  3RUI B;  2LAS A;  3CMM B;  2DZM A;  4ASW C;  3IG3 A;  3WIM A;  5AZF A;  4MJS B;  3TL5 A;  4NJ7 A;  3DDC B;  2LRW A;  2CHZ A;  4IWP A;  2KLG A;  3VH4 B;  5EDS A;  3LDZ E;  2K8C A;  2ZVN A;  4TQ0 A;  3P2B A;  2AL6 A;  2LRU A;  3MTN B;  2AEH A;  3ML9 A;  4ANV A;  4AP4 C;  2N9E B;  2AYO B;  4MDK E;  2KFK A;  3TJP A;  3B08 A;  3ECI A;  1J8C A;  1WGG A;  4W9I A;  4W9J A;  4AWJ A;  2N9P C;  3W1S C;  3PRM B;  2IBI B;  3A4R A;  4WJO A;  1G6J A;  2C7H A;  2K1F A;  5KHO A;  4BFR A;  4RM8 A;  3PV1 A;  4JGH B;  3DOW A;  3PHW B;  2KWV B;  2YVC A;  1WXA A;  2LXA A;  4LJP B;  4E71 A;  3SD5 A;  2MSE D;  2HE7 A;  2Z0D B;  1VD2 A;  3VXW A;  3X23 A;  1ZGU B;  2JWZ A;  1K8R B;  4WJQ A;  4NY0 A;  4WQO B;  1I42 A;  1V86 A;  3VFK A;  4BOS C;  2KAN A;  2G3Q B;  2BYV E;  2CU1 A;  4K7U A;  1CMX B;  1IYF A;  2FAZ A;  2L7R A;  3PLU A;  4G0N B;  1TGZ B;  1WXS A;  1TZ1 A;  2CHW A;  1WMH B;  2O6V A;  2XK5 B;  3TMP B;  3V61 A;  1WF9 A;  2C7M B;  4GSW A;  3NS8 A;  3OLM D;  4ZRJ A;  4EZJ A;  4HCN B;  1NDD A;  5E6N A;  3IVF A;  2K25 A;  2LGY A;  3M62 B;  4G3X B;  1YD8 U;  4IM2 A;  2GBK A;  4W9E A;  2RSU A;  4M0W B;  5DPT A;  3ZLZ A;  4DHJ D;  4TKN A;  4CO7 A;  3B1L X;  1WX7 A;  1WR1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...