2DZKA

Structure of the ubx domain in mouse ubx domain-containing protein 2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
109
Chain Sequence
GSSGSSGRDRSTIARIQFRLPDGSSFTNQFPSDAPLEEARQFAAQTVGNTYGNFSLATMFPRREFTREDYKRRLLDLELAPSASVVLLPAGRPATSIVHSSSGDILMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBX domain-containing protein 2
publication title Structure of the UBX domain in Mouse UBX Domain-Containing Protein 2
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 16
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dzkA01
4LDTD 4TV3A 2KXJA 4X57B 3VUYA 3O65B 4HCPB 1J8CA 4LJPB 4NY0A 1YD8U 3ZTDA 4BKSA 5LXHA 5LXIB 1UBQA 3U30A 2C7NB 2MBBB 3JSVA 3PVLA 3QAQA 2NS5A 2DZKA 3TCAA 1D3ZA 2KLCA 3NY5A 4HDOA 2IBIB 1J0GA 2IY0B 2LGXA 3PHWB 2MBHA 1UGMA 2LD9A 3T9LA 5IA7A 5GMVA 2V1YA 5DPSA 1R4NI 4W9FA 3PRMB 2V3SA 4ANXA 4EZJA 1V81A 3EFUA 3IBEA 2KJHB 4BKTA 2B3AA 4KZCA 4W9IA 3UIPB 3PSEB 2MWSB 1JRUA 3L10B 3NHEB 2DZIA 3KVFB 4MM3A 3W1SC 1EF1A 3V6CB 5EDSA 1L2NA 2KDEB 3GZNI 2JPHA 3V6EB 4BBNC 3RT3B 3JVZX 2MSED 5JHAA 2XK5A 1OEYA 2LUEA 3PRZA 4BOSC 1E8YA 3SHQA 3MJWA 3N3KB 1H8CA 4KSKC 3AU5A 2LASA 3DVNV 3L54A 2JY6A 2KFKA 2J0KA 2CKHB 3QWZB 4EOYA 4KSLC 4EZLA 5DPRA 4W9EA 4B9KA 2KWVB 3EC8A 5E6NA 3PZDA 2BF8B 1Q0WB 3APCA 1V5OA 3A9KB 4WAAA 3WAOA 1RAXA 1EF5A 2WX0A 3WANA 2BWFA 1KJTA 2KOXA 2MX2A 1CMXB 2D10A 2CHWA 2LVQA 4GDKB 4FJZA 2DX5B 2M4NA 5E6OA 2KQ7A 2R2OA 5KHQA 3QX1A 2PEAA 3QA8A 4LJOB 2FIDA 2NBUA 5CX3A 2MQJA 2MP2A 2ZPYA 4HPMB 1XD3B 2ZPNA 2KD0A 3N30A 3QJZA 1UZXB 2JVCA 2GBRA 2PE6B 3AI5A 5CHWA 2C7MB 1UBIA 2ZJDA 2FNJB 3DBSA 1RLFA 3S2AA 2KFJA 4KDLB 2L76A 1VD2A 2N4FA 1YX5B 2GMIC 4HJKA 1LFDA 4ICVA 3A1QA 3M3JA 2GOWA 5G55A 3DCGA 1BT0A 4N9F4 3L08A 4DHJB 3WAPA 2CS4A 3AXCA 3M62B 3JSVB 5CHVC 2EKEC 3UIOB 2IO1B 5L95C 4WJNA 2NBWB 4AUQC 2N1WA 2D07B 3AULA 2DENB 2C5LC 2M8SA 2LGDA 2JUOA 2C60A 2J0MA 2KQSA 5BO4B 2MCNB 3W1SA 3UQBA 4G11A 4KIKA 4IWQA 4PS3A 2WX1A 2CHZA 2AL3A 4RM8A 1SGHA 1UH6A 4F8CB 1LM8B 4WJPA 2XK5B 4IWOA 4ZRIA 3A33B 2UWQA 4TUUA 3ZVVA 3GOEA 3UINB 2N7EA 3ZNZB 3CF6E 5DCNA 4FADA 5E6PA 3PTFC 1Z2MA 1WX7A 3KUCB 4NJ6A 2RSUA 5CTRC 2FAZA 2L05A 2L8JA 4MGKE 1E90A 4ANWA 2L7RA 2ZVOA 3P2BA 4RMAA 3WAMA 4G3XB 3X0WA 3U7DA 3ML8A 1AARA 3LJ3A 2KZRA 3OJ4B 2K8CA 3M63B 1P1AA 5FR6A 4ZDVA 2G3QB 2C7HA 4G0NB 1WFYA 3DVGX 2KJ6A 2JF5A 4XX5A 5LLIA 3JYUA 4JQWC 2M0XA 4K81A 3VQIA 3WALA 2Y5BB 1NBFC 3OAWA 2FIFA 1IPGA 3JW0X 3PLUA 2J0JA 1YQBA 4BKGA 4KZ0A 3I3TB 2JWZA 2MP2B 3ENEA 3AU4A 2K8HA 3CSFA 4MGZE 3VUXA 4BVUC 2MW5A 2O6VA 4K1RB 3ZW3A 1GNUA 3B08A 3ALBA 2K6DB 3DPDA 4JIOU 1Q5WB 2N7DA 4NJ7A 2JZ3B 2KKCA 3H9DA 2L3ZA 2KO3A 4PS8A 4ZYNA 4E71A 1WE6A 1H4RA 4ANUA 2GBJA 1UELA 1Z5SB 3R7RA 1F9JA 4MGYE 4IG7B 4AP4C 1C3TA 4HK2A 3VTVA 2NCNA 4KDIC 1WZ0A 3WIMA 3A1QB 1EUVB 4MSMB 5L83A 2R2QA 2D11A 1L7YA 5TR5A 4DWFA 3A4RA 2KWUB 4TQ0A 3DBLI 3IHPC 2BYFA 4II2B 4JL9A 3TJPA 1WGYA 3VXWA 3DBRI 3W1YA 2DZJA 4ZRKA 2HD5B 1E7VA 3VFKA 2G4DB 3KUDB 3QIJA 2LJ5A 3L17A 2K1FA 4IUMB 3QHTA 4KIKB 4MEMA 3H6NA 2KVRA 4MGIE 2KNBA 3NZSA 4WJQA 2C9WB 2Z0EB 5AZHA 5JH5C 3MTNB 5D6JB 2DAJA 3ZKJC 2N9XA 5KHOA 1WJ6A 1X1MA 3N32A 4DHZE 4E74A 3RD2A 4AJYB 2OJRA 1WX8A 1WM2A 3Q3JA 2BGFA 2G45B 1RRBA 2AL6A 2V4LA 1V5TA 3DDCB 4GOCA 2Z59B 2GBMA 4MELA 3HM3A 4NQLB 2MRPA 2MBEA 3MHSD 1TGZB 4JLCA 1NDDA 1WGHA 1YJ1A 2ASQA 2NPTA 2W9NA 2ZNVC 2IO3B 2NBVB 2KTRA 3RUIB 4EEWA 1S3SG 3U8ZA 3OLMD 1M94A 2ZNVB 2ZZPB 1FXTB 4HLEA 1P98A 3UQAA 1WH3A 1WRDB 4K7UA 3APDA 4DXAB 1PQSA 3H7PB 1V9JA 1WM3A 1V6EA 1V80A 2KC2A 4FN2A 4IW0A 3HM6X 4TKNA 5AZFA 3VTWA 2K8BA 2DZMA 3CMMB 2O6VB 4ZRJA 2PE9A 3R66C 4HDQA 2IYDB 4IM3A 3SD5A 5HKHA 1SE9A 1I35A 3DOWA 4DDGD 2CHXA 3H1UA 3RZWC 4IWPA 2GBKA 4B6WA 3ZNGC 2DYBA 1IYFA 1P3QU 4FJVB 1S1QB 3ZRFA 1GJZA 2VRRB 4MH0E 3BINA 4GU2A 4W9DA 2RR9A 5C1ZA 2BKFA 5JZEB 2LVOA 3OJ3A 2LRUA 4EUTA 1V2YA 3ZTCA 4HPLB 3PHXB 3IG3A 2KX0A 2G4SA 3IVFA 4AJWA 1WMHA 1ZW7A 2O2VB 5J18A 2AEHA 1WJNA 3TIXA 2LXAA 5D7GA 3RYTA 3VAWA 1UD7A 1V49A 2IO0B 4WWPA 2UYZB 1OGWA 3QK0A 3C0RB 3NZUA 2JRHA 4BOZB 3PGEA 1GUAB 3ONSA 1WGGA 2K25A 4I6LB 2DAFA 2MBOA 2L0FA 4YL8A 1E8XA 1ZGUB 4DHJD 4HCNB 4ASWC 2FCMA 1WYWB 2EMSA 3ZO5B 4A3PA 3B1LX 4LDTB 3PV1A 3ZNID 1TZ1A 3UF8A 1LXDA 5D94A 1GC7A 5AZGA 1Y8RC 2NPTB 3TBLD 2KTRB 1WI0A 3DBHI 3NS8A 2WDTB 3H7PA 4GDLA 1OTRB 1T0YA 1TBEA 2KDBA 3DVGY 3EECA 2D3GA 4W9GA 3ZDMC 4IM2A 2IY1B 2KN5A 3PT2B 3PS6A 5C23A 4CYEA 1K8RB 3VHTC 3RZFA 2K39A 4FHJA 4P7IA 4W9CA 4WJOA 3UGBB 1QZEA 2M1MA 2AWTA 3ECIA 4W9KA 4TQ1A 2JXXA 4XZ4A 2ZEQA 4F7ZA 5DPWA 4DK5A 2WWZA 1A5RA 4OVVA 1HE8A 3CSTA 1WGDA 2L00B 3M95A 2HTHA 5DPTA 4JGHB 2IO2B 1P0RA 3LDZE 2KMAA 3VVWB 4MDKE 4MJSB 3ZNHB 4PYZA 1WX9A 3KYCD 4DDID 4URKA 4NQKE 1WXAA 3KH0A 1WE7A 3ML9A 3QQ8B 1SIFA 4G50A 4WWOA 2GBNA 3QC8B 4CO7A 3K9PB 2PJHA 3NOBA 2O2VA 1GC6A 4GSWA 4FULA 1XT9B 5IAAC 4ANVA 3QCAA 3VUWA 2KMCA 3A9JA 4GMVA 2CR5A 5JHBA 4RM9A 2N9PC 3H7SA 1WMHB 1WR1A 4CHKA 2FCSA 4BFRA 4PYUA 3ZDTA 1IP9A 4I6PA 4FBJB 5J2RA 3DQVA 4K7WA 4OVUA 3APFA 3V61A 2EMTA 2BKRB 4GXBA 4HWIB 4A3OA 3EHVA 3PREA 2A5UA 2LVPA 2JZZA 2FUHB 2BWES 2LWPA 2LZ6A 2ZCBA 4II3B 2FCQA 5CHFA 3VH4B 2L0TA 1KOTA 3B0AA 2HE7A 4IM0A 2KDIA 1WGRA 5J17A 3ZIMA 3ZUNA 2KDFB 3KW5B 2A4ZA 2WYQA 5AEKB 4I6NB 4KV2A 3RCZA 3DVNU 1NI2A 4HVBA 2NR2A 3VTUA 2DYOA 3BY4B 3ZRCA 2I1KA 3KUZA 4WQOB 2KANA 4E3CA 3V62A 4NAWA 4AOFA 1WIAA 1WJUA 1OQYA 2HJ8A 4F1SA 4FLHA 4GDLB 4NNJB 4W9JA 5G2NA 2REXA 1RFAA 1WF9A 1ZKHA 2MLBA 4M8NA 2KX3A 2BYVE 3QARA 3TL5A 4EKUA 1OEYJ 1C1YB 1WR6E 2MBQA 2LXCA 2LRWA 2KC1A 2JT4B 1E5WA 1LQBA 3A4SC 4M0WB 1WXSA 4MJSA 2KLGA 4M8MA 4W9LA 2LI5A 4FHKA 3IFWB 1E8ZA 3L0WB 3R3MA 2KWCA 2ZVNA 2DHZA 3L16A 4GGQA 2KK8A 1KM7A 3V60A 1G6JA 3RULA 4WWNA 2YLMA 4FA6A 3D32A 4NPNA 2BPSA 2Z0DB 2J7QB 2JRIB 4W9HA 2XBBC 1J19A 4DBGA 4GIVA 4GN1A 2M17A 4GB9A 4DHZB 2IZVB 3TMPB 4IC7B 3A9JB 2OOBB 3HK0A 4KVGB 2O6VD 2KTFA 1E7UA 3X23A 2RPQA 2ZCCA 3KYDD 4BBNF 2D2QA 3VDZA 1E8WA 1WJ4A 1V86A 3L13A 2CU1A 4BKSD 4AWJA 1VCBA 4EFOA 1WZ3A 1KLVA 3PRPB 1WXVA 3SU8X 4LCDE 2DYMA 3PLVA 1WXMA 1YIWA 2MA9B 2NVUI 2KHWB 2QHOA 3Q3FA 1U4AA 3A9KA 2N9EB 3SDLC 2KFKB 3HHMA 2BYEA 2KJRA 2YVCA 1GG3A 4HXDA 2PPHA 1I42A 4XC2A 4GDKA 3K9OB 2K6QA 1XQQA 1TTNA 4NAWB 4J6IA 1WY8A 4ICUA 2RD0A 3WA0A 1P9DU 1YX6B 3PPAA 1ISNA 3ZLZA 4B95A 2N1VA 3HIZA 3VH3B 1EO6A 4A20A 2LGYA 3T8MA 3R7QA 2AYOB 2FCNA 4K7SA 1R4MI 4MSQB 2RGFA 2I1JA 5D2MB 4EZKA 1MG8A 4PS7A 1Q1OA 4FJYA 2XEWA
chains in the Genus database with same CATH superfamily
2BVCA 2EKIA 4LDTD 4TV3A 2KXJA 4X57B 3VUYA 3O65B 5HFYA 1J8CA 4NY0A 3ZTDA 4BKSA 5LXIB 2C7NB 3P42A 3T9LA 2V1YA 1WRIA 1V81A 3DHHC 1TS2A 3L10B 4MM3A 5AUKA 1E7PB 1ZXIA 5JHAA 1VZ8A 4LTUA 1E8YA 4P16A 3J9CA 4R3DA 5GXGB 5MPOA 3N3KB 3AU5A 3L54A 2VZKB 3PZ8A 3KQ4A 2J0KA 4EOYA 5DPRA 2BF8B 1Q0WB 3APCA 1V5OA 1RAXA 2BWFA 1HEZE 2D10A 2KQ7A 2AQ1B 2R2OA 2PEAA 3AEDB 2N9KA 1J7CA 5D3DA 1TKYA 4IDIA 2ZPYA 5CHWA 2C7MB 1UBIA 2WNMA 2ZJDA 3BVZA 1ZDVA 4REZA 4KDLB 2L76A 3AEGB 1YX5B 1QOGA 4ICVA 3IAM1 1HXYD 4N9F4 1TT5B 2CS4A 2EKEC 2PMVA 2IO1B 5L95C 1F2RI 2DENB 2J0MA 5BO4B 1E10A 2BT6A 2MCNB 1T0RC 4IWQA 4PS3A 4RH6A 4JX1C 3AE6B 4F8CB 2XK5B 3A33B 4YXDB 2BB6A 3ZNZB 3I5JC 1CJEA 1Z2MA 1WX7A 3KUCB 3EFCA 4A6QA 4NJ6A 2RSUA 1L6VA 1E90A 5IN7A 4D2KA 2L7RA 1TKGA 4RMAA 2PKOA 3U7DA 1N61A 3ML8A 4ZDVA 2JZPA 1L4ZB 5TSSA 2C7HA 1WFYA 1FRRA 1L4DB 3WALA 2Y5BB 1NBFC 3JW0X 2TSSA 1YQBA 2J4XA 1K52A 1KLGD 4ARIA 4K1RB 1GNUA 2KKCA 3H9DA 2KO3A 1IBXB 3AV8A 1UELA 2K3UA 1JWBD 4MGYE 4AP4C 2D3BA 4YSXB 5L83A 1OQRA 3AE4B 2BYFA 4JL9A 4WAFA 3VXWA 3DHIC 1BXTA 1R4NB 1E7VA 2G4DB 3KUDB 2K1FA 5BMIA 4KIKB 3U4EG 3H6NA 1ZXHA 5AZHA 5JH5C 5D6JB 2DAJA 4HKZE 5KHOA 3AE7B 3N32A 3KWLA 4AJYB 2OJRA 1WX8A 2BGFA 1EM7A 1QOBA 1XF5L 4JLCA 3MHSD 1WGHA 2W9NA 4NZLB 2KTRA 1B9RA 3OLMD 4WWMA 3H8HA 2ZZPB 2AQ3B 4N59A 4HLEA 4NAMA 1L6UA 1UF0A 4IOIE 4XGAB 1XEEA 4WH4A 4M00A 4K7UA 1YOVB 3H7PB 1MPEA 1QT9A 4FN2A 1V9JA 1V6EA 1V80A 1WM3A 3HM6X 4TKNA 2Q5WD 4B0MA 3SD5A 3T3NA 3NUHB 3RI7C 1SXTA 4FJVB 3BVMA 4MH0E 1N62A 5JZEB 3KLSX 2LRUA 3CIRB 3DWMA 5BYRA 2L1AA 1WMHA 2O2VB 1WJNA 3TIXA 3RYTA 1D5ZC 1V49A 2IPKD 1ZE3D 2JRHA 2N0SB 3C0RB 2K25A 2L0FA 3NVZA 1E8XA 1ET6A 4ASWC 3OWEB 2FCMA 4LDTB 1TZ1A 1LXDA 4P1CC 1GC7A 3TBLD 3NS8A 2WDTB 4KX6B 1F0ZA 4WURA 3EECA 1T0YA 2D3GA 1XLOA 1HQRD 4IM2A 2KN5A 5C23A 3GE8C 4W9CA 4W9KA 4TQ1A 1K51A 4XZ4A 2ZEQA 5DPWA 4OVVA 1HE8A 2EELA 5DPTA 1P0RA 1XO3A 2G9HD 1TY0A 4DDID 3EA6A 3KH0A 3DBLB 4G50A 4WWOA 4CO7A 3QC8B 1ZDXA 5IAAC 1XT9B 2E6XA 2RMMA 3BYYB 4RGTA 4GMVA 5JHBA 4K3CA 2K22A 1WR1A 2Y3AA 4PYUA 1IP9A 1B1ZA 1HA5A 3V61A 2WXOA 2BS4B 2MEKA 1UNSA 2INDC 5H8YE 2LVPA 2BWES 5CHFA 1VZ7A 3B0AA 2WU5B 1I4HA 5J17A 2KDFB 2A4ZA 3RCZA 2NR2A 3VTUA 1JWMD 2DYOA 3BY4B 3ZRCA 2I1KA 4WQOB 1FIQA 4AOFA 4O1NA 4FLHA 4GDLB 1M4VA 4W9JA 5G2NA 2V3NA 1YQ4B 1WF9A 3N20C 2BYVE 3QARA 1OEYJ 1N5WA 1WR6E 3RNEC 2LRWA 3RFZB 1E5WA 4MJSA 1D5XC 1WXSA 4DXGA 4M8MA 1PDXA 2SAKA 1E8ZA 2KWCA 3ABVB 4B0EA 3EGRA 3Q3NC 2BPSA 1TS3A 2Z0DB 2J7QB 4ZOHC 3VRBB 4W9HA 1PGAA 2H89B 2M17A 3ZQ4A 4MH8A 1E0ZA 2IJ0A 2W82A 3TMPB 4IC7B 3A9JB 2OOBB 3P63A 1E7UA 3X23A 2ZCCA 5EE3A 5FKAC 1E8WA 4RCOA 1VCBA 4RGNA 2QMTA 3BZDB 1FNUA 2DYMA 2WXJA 3PLVA 1YIWA 2L83A 2KHWB 2QHOA 4PK1A 1U4AA 2Z8LA 3A9KA 2N9EB 1FFUA 1IGDA 4XC2A 2DWQA 1MVKA 1TZOA 1WY8A 4ICUA 1NI3A 4YT0B 1VDVA 2N1VA 4ZHPA 3AE5B 3R7QA 2ZW1A 1R4MI 4C80A 5D2MB 1N63A 4XE0A 3C8YA 1I4QA 3DWGC 3LYYA 1YD8U 1XLNA 1UBQA 2MBBB 3NRZA 2I2YA 2NS5A 3FILB 1FXAA 2CJNA 5FR3A 2INPE 1D3ZA 1C9FA 4HDOA 1UGMA 2JSVX 5IA7A 2BS2B 5DPSA 4ANXA 4BKTA 2KJHB 2DNFA 1JRUA 2DZIA 4P1BC 5EDSA 4C00A 4OHJA 2JPHA 2MSED 1D6EC 2LUEA 4BOSC 1AW7A 4RF0A 4LNKA 3MJWA 3DVNV 2AX5A 2CKHB 1YQ3B 2KWVB 1JWSD 1NEKB 3WAOA 3WANA 2MX2A 2FE8A 2M4NA 2FIDA 2KQ4X 1XD3B 3NVWA 3QJZA 1UZXB 2KWDA 2GBRA 2PE6B 3AI5A 1ET9A 1JROA 2VH2A 3Q8BA 2N9LA 3S2AA 2MJDA 3A1QA 2GOWA 1YNTE 3DHGC 3JSVB 5CHVC 2D07B 5IP4D 3AULA 3TEXA 3HUIA 3SFEB 4G11A 1KTKA 3V05A 5JXVA 2CHZA 1SGHA 5HI1A 1K50A 4TUUA 2N7EA 4FADA 5E6PA 3PTFC 1BMLC 3V3XA 5CTRC 2L05A 2L8JA 4ANWA 3P2BA 3WAMA 1SE2A 3LJ3A 3M63B 1RFKA 3B9JA 4G0NB 3WCQA 2KJ6A 1JWUD 4K81A 3VQIA 4C4VA 1JALA 1D4BA 3I3TB 2MP2B 2K8HA 3CSFA 3VUXA 2MW5A 2O6VA 3B08A 2K6DB 1Q5WB 1KRHA 4PS8A 1H4RA 3E56A 2GBJA 3NS1A 2WDVB 2D3AA 1HTOA 4IG7B 2NCNA 3WIMA 1FRDA 1EUVB 1QQRA 3Q69A 2R2QA 2D11A 1XCQL 4TQ0A 2E3TA 1TIFA 1ACCA 1CQVA 4II2B 2LEKA 3DBRI 2JXTA 3QIJA 2XN9C 4IUMB 3RNFC 3QHTA 1OQQA 1FNVA 2W54A 2KVRA 4MGIE 2X8XX 4WJQA 2C9WB 3GZNB 2LHDA 3MTNB 4KKJA 2N9XA 5E6JA 1V1PB 4A8XC 1SE3A 3Q3JA 2V4LA 4C7ZA 3AE1B 4MELA 4NQLB 3URYA 1TGZB 4H2AA 3RUIB 2V9HA 1M94A 1WWTA 1FXTB 1ZP0B 1P98A 4RF1A 3MC0B 1WH3A 3R2IA 4DXAB 2KC2A 5AZFA 3VTWA 3ZJVA 2I38A 2K8BA 4DQOC 4WIPA 4EE2A 4HRSA 2WXMA 1I35A 4YSZB 2GBKA 1L0YB 2WU2B 2DYBA 1IYFA 1S1QB 1VRAB 3BINA 4ITKA 2RR9A 1ENFA 5C1ZA 2WXQA 3OJ3A 3B2GA 1VR9A 3ZTCA 1DOYA 2KX0A 2G4SA 3IVFA 5J18A 2AEHA 3VAWA 1WYGA 1UD7A 2B76B 2IO0B 4WWPA 2UYZB 5T8IA 3SR6A 4BOZB 1JRPA 4I6LB 3ZJTA 3NVVA 1ZGUB 4HCNB 2W3SA 3Q3MC 3P4QB 3ZNID 3W9CB 5H92C 5AZGA 2NPTB 3AEBB 1PYWD 2GB1A 1C77A 1TBEA 3DVGY 2DBYA 4CYEA 1K8RB 3RZFA 2FUG1 4WJOA 3ECIA 1A5RA 3LDZE 2KMAA 3ZNHB 4MDKE 4MJSB 2D3CA 4PYZA 3KYCD 3Q6BA 2XNAC 1T5XD 4URKA 4A9AA 3GE3C 1WXAA 3ML9A 3QQ8B 1FXIA 1SIFA 2QJLA 4M02A 1GC6A 3PZ7A 2LFIA 2JYEA 4RM9A 4LK0M 4YTNB 2N9PC 1MHHE 3IXSA 3ZDTA 4FBJB 2QCZA 5J2RA 3DQVA 3APFA 4J3OD 2CJOA 2EMTA 2BKRB 4GXBA 3U52E 2PLPA 3EHVA 1C76A 1YJJA 2FUHB 2L0TA 3GS2A 2HE7A 2KDIA 1T6BX 3Q14C 4LLGM 3KW5B 2WYQA 4HVBA 1R7SA 2WGSA 1XXGA 2WXLA 1PUTA 1WIAA 4OZAA 2HJ8A 3AN1A 4NNJB 1RFAA 2KX3A 1SEBD 1C1YB 1FD6A 1YMHE 4M01A 5AUIA 3AE3B 3FAHA 4M0WB 1VLBA 5HHDG 2KLGA 1PFDA 3U2SC 4FHKA 3IFWB 3R3MA 2DHZA 2G1EA 2AQ2B 1AN8A 3RULA 2RPVA 2YLMA 4FA6A 2JRIB 3Q2AC 1J19A 2KACA 4GB9A 2IZVB 4KVGB 2JQRB 2KTFA 2WXRA 4TMAB 4FXCA 2D2QA 1I4GA 3HVDA 4PT5A 4AWJA 1WZ3A 1KLVA 3PRPB 3SU8X 4LCDE 2YEPB 1WXMA 2MA9B 3RMKC 4HEA1 4ZRPA 3AB5A 3HHMA 2BYEA 2KJRA 2YVCA 1F1HA 1GPXA 4L1BA 3DBHB 1TTNA 4NAWB 1EWCA 3HVZA 1ISNA 3ZLZA 2V0GA 1TY2A 4K3BA 4HPPA 3HIZA 3VH3B 5C2TB 4HKQA 3P4PB 4A20A 2LGYA 3T8MA 2FCNA 1FM0D 4K7SA 1D5MC 2RGFA 1QOFA 4EZKA 4CQNA 2XEWA 2LMCA 3ZXRA 1PGBA 3U30A 4IKGA 2KLCA 4C7YA 1J0GA 1WXQA 2MBHA 2LD9A 1P7FA 1V1OA 2PTLA 1R4NI 3RPFC 4W9FA 2V3SA 1VJKA 3IBEA 3VR8B 4RNAA 4W9IA 3UIPB 3PSEB 2MWSB 4A55A 4UDUC 2PVOD 4GLSC 3V6EB 1HTQA 3RT3B 1YJIA 2XK5A 4LNFA 3PRZA 3AEAB 1YN5A 3SHQA 1IUEA 2JY6A 4WQMA 4ACFA 3QWZB 4W9EA 3EC8A 3PZDA 2MHJA 3I9V1 3BK2A 1EF5A 1TKEA 2KOXA 4S17A 2JYTA 4GDKB 4FJZA 5E6OA 3QX1A 3RNAC 3TEWA 5CX3A 4HPMB 3W2DA 4C4VB 2X38A 4AS1A 1J7AA 1E9MA 1IBXA 2FNJB 3DBSA 2KFJA 3AE2B 2N4FA 4XYCA 3AXCA 2HTME 4WJNA 2N1WA 4L23A 2C5LC 2LGDA 2JUOA 2C60A 3W1SA 3UQBA 4KIKA 1GAQB 4MM3B 2WX1A 2AL3A 4RM8A 1LM8B 2ON8A 4IWOA 2UWQA 2H88B 3U7ZA 3CF6E 2WQYB 3RNCC 2FAZA 1AARA 2KZRA 2K8CA 3TUOA 1P1AA 5FR6A 3DVGX 1AWDA 1RM6C 2JF5A 4XX5A 1I4RA 5LLIA 3JYUA 4JQWC 1NVID 1QF6A 2KAJA 1IPGA 1MJDA 2IDYA 4BZAA 4BKGA 4KZ0A 1STEA 2OJWA 3ENEA 1P7EA 5EE1A 4MGZE 1N60A 4BVUC 5IO9A 3ALBA 3AH7A 4MACA 2JZ3B 1L0XB 2L3ZA 4E71A 1SIJA 1Z5SB 5FK9C 3R7RA 1F9JA 3N1YC 2R61A 4KGSA 2W55A 4KDIC 1WZ0A 1NYQA 3IT6B 5TR5A 3DBLI 3IHPC 5EE9A 3TJPA 4ZRKA 2HD5B 4MEMA 1QILA 3NZSA 1N6ZA 3MFGA 3ZKJC 2K0PA 2GI9A 1WJ6A 1X1MA 4E74A 2BQQA 1ZPSA 1RRBA 1V5TA 2GBMA 3HM3A 2MRPA 4P6VF 3GB1A 1NDDA 2WS3B 1YJ1A 1MHXA 2ASQA 2ZNVC 2IO3B 2NBVB 4EEWA 1S3SG 3U8ZA 3BVGA 2ZNVB 4ZHOA 3UQAA 1WRDB 1PQSA 1FCLA 1WGKA 1OFFA 2OEDA 3N9YC 2INNE 3CMMB 2OHFA 1XLQA 2IYDB 3C19A 5HKHA 2IGHA 2D5GA 4DDGD 2CHXA 1FNWA 3Q3OC 4N6EB 2KN4A 3RZWC 4B6WA 3I57A 3ZRFA 1GJZA 4GU2A 1F2RC 2LVOA 3CWIA 3N1ZC 1C4CA 3TSSA 1ROEA 2VH1A 3PHXB 2M56B 4AJWA 3NVYA 1V97A 1ZW7A 4JWUC 5G5GA 1GOZA 2LXAA 5D7GA 2V4IB 1OGWA 3QK0A 3BWUD 3LB8C 3NZUA 1GUAB 1WGGA 4DHJD 2MJ3A 4N58A 3FC4A 3B1LX 3PV1A 3UF8A 1Y8RC 2KTRB 1WI0A 3NZ3A 1E6EB 4KGRA 1C79A 4GDLA 2KDBA 3ZYYX 2WXGA 3ZDMC 2IY1B 2M19A 1TS5A 2SEBD 3UGBB 3L4PA 1QZEA 2M1MA 2NTTA 2JXXA 2HJ1A 4F7ZA 2WWZA 3CSTA 2HTHA 2IO2B 2INCC 1WX9A 4KKIA 3MC8A 1WE7A 3NOBA 4GSWA 4FULA 4ANVA 3QCAA 1I4PA 2KMCA 2GRIA 3A9JA 1KFYB 2QSDA 2CR5A 3H7SA 1TJEA 1WMHB 2FCSA 4BFRA 2LUMA 4I6PA 2PIAA 5IOIA 4K7WA 4OVUA 1JW9D 3PREA 3P4RB 2A5UA 4L2YA 2JZZA 1FEHA 2FCQA 2L52A 3NJTA 1MI0A 3ZUNA 5AEKB 4I6NB 4KV2A 3MJ5A 3DVNU 3KUZA 5BMGA 4XDDA 1WJUA 1OQYA 4F1SA 1EU3A 2DLBA 3ETRA 4EKUA 3W5UB 2J52A 2MBQA 2LXCA 2KC1A 3A4SC 4JPSA 3MC9A 3L0WB 2WXHA 2ZVNA 3L16A 4GGQA 1KM7A 1G6JA 4NPNA 3FILA 1RWSA 3ZGZA 4MT5A 1EU4A 4GIVA 1HZ6A 1RYJA 2UU7A 3Q8AA 2O6VD 2QC8A 1VZ6A 3KYDD 4BBNF 1EWYC 1UWXA 2BTEA 1V86A 4BKSD 2QDFA 1KF6B 2BW2A 1WXVA 3OG5A 3AEEB 1NYRA 1NENB 2NVUI 1SBBB 2FBWB 3SDLC 1XCTL 4XDCA 4HXDA 1GG3A 2V3PA 4S0RA 1J7BA 1XQQA 1AYFA 1FMAD 1IGCA 3RNBC 3WA0A 1YX6B 3PPAA 4B95A 3TEZA 1FPYA 3SEBA 2WXNA 2AYOB 4MSQB 4OW0A 4YWGG 2KVZA 4PS7A 4FJYA 1MFWA 4HCPB 4LJPB 2K5PA 2WXFA 5LXHA 2LGSA 3JSVA 3PVLA 3QAQA 3TCAA 2DZKA 3NY5A 2IBIB 2IY0B 2LGXA 3PHWB 2RDGA 4RGOS 2N7JA 5GMVA 4C56C 1Q10A 3PRMB 4EZJA 3EFUA 2B3AA 2YEPF 4KZCA 3NHEB 3W1SC 3KVFB 1EF1A 3V6CB 1L2NA 2KDEB 3GZNI 4JWSC 5EE0A 3VR9B 4BBNC 3JVZX 5IKCM 1OEYA 1QKZA 1H8CA 4KSKC 2LASA 2KFKA 3PO0A 4KSLC 4EZLA 4B9KA 5E6NA 4WAAA 3A9KB 2WXIA 2WX0A 1N5XA 1QLBB 2KMMA 4USAA 1KJTA 1F77A 1CMXB 2LVQA 2CHWA 2DX5B 5KHQA 3QA8A 4LJOB 4NJCA 2NBUA 3HRDD 2MQJA 2MP2A 1L0VB 2ZPNA 2KD0A 3N30A 3Q8CA 1CK1A 2JVCA 1ESFA 1I7HA 2HDEA 4LNIA 4US8A 1T3QA 1RLFA 1VD2A 2GMIC 4HJKA 1LFDA 3M3JA 5G55A 2K9XA 4AQ7A 3DCGA 1TYGB 1BT0A 4DHJB 3L08A 3WAPA 1FO4A 3M62B 3UIOB 2NBWB 2PW9A 4AUQC 2M8SA 2J42A 1JCKB 2KQSA 1JMLA 4Q2JA 3O13A 1JWAD 3IT4B 1UH6A 2W3RA 4WJPA 4ZRIA 3ZVVA 3GOEA 3UINB 1V1PA 5DCNA 2WLBA 4MGKE 1JQ4A 1UUPA 2ZVOA 3RN9C 4G3XB 3X0WA 3B2FA 3OJ4B 4LNNA 2ZW0A 2G3QB 4DXFA 1UWMA 2M0XA 4LNOA 3OAWA 2FIFA 3PLUA 2J0JA 1HZ5A 2GLSA 2JWZA 2NMQA 3BYTB 2BBCA 3AU4A 4RGMA 4JE3B 3ZW3A 1R4MB 4JIOU 3DPDA 1DOXA 2N7DA 4NJ7A 2ACZB 4ZYNA 2RDHA 1WE6A 4ANUA 3AEFB 1C3TA 1ZUD2 4HK2A 3UI3A 3VTVA 3A1QB 4MSMB 1L7YA 4DWFA 1C4PA 1SE4A 3A4RA 2KWUB 1SB3C 2IGDA 1ZOYB 1WGYA 3W1YA 2DZJA 3VFKA 4YTMB 2LJ5A 3L17A 2LGIA 2KNBA 3TEYA 4OVZA 2Z0EB 3RNGC 2MH7A 4DHZE 3RD2A 3NG0A 1WM2A 2M0AA 2G45B 2AL6A 4GOCA 3DDCB 2Y5CA 2Z59B 4YTPB 2MBEA 2BB5A 1C4AA 1DOIA 2NPTA 3BIID 5BYQA 1FCCC 1K53A 2WDQB 5C3JB 1A70A 3APDA 4IW0A 2NTSA 2DZMA 2O6VB 4ZRJA 2ICIA 2PE9A 2VZKD 3R66C 4HDQA 4IM3A 4US9A 1SE9A 3DOWA 1SF0A 2CU3A 3H1UA 4ZYSA 4IWPA 3ZNGC 1P3QU 4TSSA 2WHIA 2PVGC 2VRRB 1LGRA 4W9DA 2JX5A 1CZPA 2BKFA 4EUTA 1V2YA 1BUIC 4HPLB 1KH0A 3IG3A 1T0SC 2Y5PA 1GB1A 2IGGA 1T0QC 3AMZA 1F52A 1XLPA 1GB4A 1DYQA 2ONQA 2QIEB 3PGEA 3ONSA 4YL8A 3LXFA 2DAFA 2MBOA 1SJED 2RDBC 1TS4A 1PGXA 1WYWB 2EMSA 3ZO5B 3E9SA 4A3PA 2WDRB 4XWWA 4KGTA 5D94A 1LO5D 3MP9A 1L5PA 3DBHI 1YN3A 3H7PA 3ZXVA 4A90A 1OTRB 2L32A 1MG4A 4HJGE 4RFBA 4W9GA 5I4DA 3PT2B 3PS6A 2J53A 3VHTC 3EUB2 2K39A 4FHJA 4P7IA 2QEJC 3N1XC 4M0WA 2AWTA 4DK5A 3M95A 1WGDA 2L00B 3KWVA 4JGHB 2QILA 5D3IB 3VVWB 3Q8FA 1Y56A 3VRAB 4NQKE 2GBNA 3K9PB 2PJHA 2O2VA 3DBRB 4OZCA 3SFDB 3VUWA 3BK1A 1FFVA 1UGJA 2BS3B 2WXPA 4CHKA 1V8CA 3P1MA 1QOAA 3AM9A 4A3OA 4HWIB 2LWPA 2LZ6A 4QAYA 2ZCBA 4II3B 2BYTA 3VH4B 1KOTA 2JU6X 4IM0A 1WGRA 3ZIMA 3AECB 1NI2A 3P4SB 3W5VB 4ZRQA 4E3CA 2KANA 3V62A 4NAWA 5LNK1 5G5HA 5BMHA 3AE8B 2REXA 1ZKHA 2MLBA 4M8NA 3TL5A 1SJHD 2JT4B 1LQBA 2KYWA 4W9LA 3FKYA 2LI5A 4HROA 1YN4A 5BYSA 5HG2A 2KK8A 3V60A 4WWNA 3D32A 1WSPA 3R8BA 3T3OA 2XBBC 4DBGA 4GN1A 2MJEA 4DHZB 3R2TA 2WP9B 3HK0A 3MHZA 2RPQA 1SSNA 3VDZA 1WJ4A 3L13A 2CU1A 4EFOA 1KLUD 2LJIA 4YSYB 1DGJA 3ZJUA 3I63C 3Q8EA 2KT7A 3Q3FA 3IAS1 2WXKA 2KFKB 3AE9B 4BAXA 2PPHA 1I42A 4GDKA 3K9OB 2K6QA 2JWUA 4J6IA 2RD0A 4XWTA 1P9DU 4ARCA 4OZBA 1EO6A 2KDMA 1I4XA 2LHEA 2I1JA 1MG8A 1C78A 1Q1OA 3GP7A
chains in the Genus database with same CATH topology
4LDTD 4TV3A 2KXJA 4X57B 3VUYA 3O65B 4HCPB 1J8CA 4LJPB 4NY0A 1YD8U 3ZTDA 4BKSA 5LXHA 5LXIB 1UBQA 3U30A 2C7NB 2MBBB 3JSVA 3PVLA 3QAQA 2NS5A 2DZKA 3TCAA 1D3ZA 2KLCA 3NY5A 4HDOA 2IBIB 1J0GA 2IY0B 2LGXA 3PHWB 2MBHA 1UGMA 2LD9A 3T9LA 5IA7A 5GMVA 2V1YA 5DPSA 1R4NI 4W9FA 3PRMB 2V3SA 4ANXA 4EZJA 1V81A 3EFUA 3IBEA 2KJHB 4BKTA 2B3AA 4KZCA 4W9IA 3UIPB 3PSEB 2MWSB 1JRUA 3L10B 3NHEB 2DZIA 3KVFB 4MM3A 3W1SC 1EF1A 3V6CB 5EDSA 1L2NA 2KDEB 3GZNI 2JPHA 3V6EB 4BBNC 3RT3B 3JVZX 2MSED 5JHAA 2XK5A 1OEYA 2LUEA 3PRZA 4BOSC 1E8YA 3SHQA 3MJWA 3N3KB 1H8CA 4KSKC 3AU5A 2LASA 3DVNV 3L54A 2JY6A 2KFKA 2J0KA 2CKHB 3QWZB 4EOYA 4KSLC 4EZLA 5DPRA 4W9EA 4B9KA 2KWVB 3EC8A 5E6NA 3PZDA 2BF8B 1Q0WB 3APCA 1V5OA 3A9KB 4WAAA 3WAOA 1RAXA 1EF5A 2WX0A 3WANA 2BWFA 1KJTA 2KOXA 2MX2A 1CMXB 2D10A 2CHWA 2LVQA 4GDKB 4FJZA 2DX5B 2M4NA 5E6OA 2KQ7A 2R2OA 5KHQA 3QX1A 2PEAA 3QA8A 4LJOB 2FIDA 2NBUA 5CX3A 2MQJA 2MP2A 2ZPYA 4HPMB 1XD3B 2ZPNA 2KD0A 3N30A 3QJZA 1UZXB 2JVCA 2GBRA 2PE6B 3AI5A 5CHWA 2C7MB 1UBIA 2ZJDA 2FNJB 3DBSA 1RLFA 3S2AA 2KFJA 4KDLB 2L76A 1VD2A 2N4FA 1YX5B 2GMIC 4HJKA 1LFDA 4ICVA 3A1QA 3M3JA 2GOWA 5G55A 3DCGA 1BT0A 4N9F4 3L08A 4DHJB 3WAPA 2CS4A 3AXCA 3M62B 3JSVB 5CHVC 2EKEC 3UIOB 2IO1B 5L95C 4WJNA 2NBWB 4AUQC 2N1WA 2D07B 3AULA 2DENB 2C5LC 2M8SA 2LGDA 2JUOA 2C60A 2J0MA 2KQSA 5BO4B 2MCNB 3W1SA 3UQBA 4G11A 4KIKA 4IWQA 4PS3A 2WX1A 2CHZA 2AL3A 4RM8A 1SGHA 1UH6A 4F8CB 1LM8B 4WJPA 2XK5B 4IWOA 4ZRIA 3A33B 2UWQA 4TUUA 3ZVVA 3GOEA 3UINB 2N7EA 3ZNZB 3CF6E 5DCNA 4FADA 5E6PA 3PTFC 1Z2MA 1WX7A 3KUCB 4NJ6A 2RSUA 5CTRC 2FAZA 2L05A 2L8JA 4MGKE 1E90A 4ANWA 2L7RA 2ZVOA 3P2BA 4RMAA 3WAMA 4G3XB 3X0WA 3U7DA 3ML8A 1AARA 3LJ3A 2KZRA 3OJ4B 2K8CA 3M63B 1P1AA 5FR6A 4ZDVA 2G3QB 2C7HA 4G0NB 1WFYA 3DVGX 2KJ6A 2JF5A 4XX5A 5LLIA 3JYUA 4JQWC 2M0XA 4K81A 3VQIA 3WALA 2Y5BB 1NBFC 3OAWA 2FIFA 1IPGA 3JW0X 3PLUA 2J0JA 1YQBA 4BKGA 4KZ0A 3I3TB 2JWZA 2MP2B 3ENEA 3AU4A 2K8HA 3CSFA 4MGZE 3VUXA 4BVUC 2MW5A 2O6VA 4K1RB 3ZW3A 1GNUA 3B08A 3ALBA 2K6DB 3DPDA 4JIOU 1Q5WB 2N7DA 4NJ7A 2JZ3B 2KKCA 3H9DA 2L3ZA 2KO3A 4PS8A 4ZYNA 4E71A 1WE6A 1H4RA 4ANUA 2GBJA 1UELA 1Z5SB 3R7RA 1F9JA 4MGYE 4IG7B 4AP4C 1C3TA 4HK2A 3VTVA 2NCNA 4KDIC 1WZ0A 3WIMA 3A1QB 1EUVB 4MSMB 5L83A 2R2QA 2D11A 1L7YA 5TR5A 4DWFA 3A4RA 2KWUB 4TQ0A 3DBLI 3IHPC 2BYFA 4II2B 4JL9A 3TJPA 1WGYA 3VXWA 3DBRI 3W1YA 2DZJA 4ZRKA 2HD5B 1E7VA 3VFKA 2G4DB 3KUDB 3QIJA 2LJ5A 3L17A 2K1FA 4IUMB 3QHTA 4KIKB 4MEMA 3H6NA 2KVRA 4MGIE 2KNBA 3NZSA 4WJQA 2C9WB 2Z0EB 5AZHA 5JH5C 3MTNB 5D6JB 2DAJA 3ZKJC 2N9XA 5KHOA 1WJ6A 1X1MA 3N32A 4DHZE 4E74A 3RD2A 4AJYB 2OJRA 1WX8A 1WM2A 3Q3JA 2BGFA 2G45B 1RRBA 2AL6A 2V4LA 1V5TA 3DDCB 4GOCA 2Z59B 2GBMA 4MELA 3HM3A 4NQLB 2MRPA 2MBEA 3MHSD 1TGZB 4JLCA 1NDDA 1WGHA 1YJ1A 2ASQA 2NPTA 2W9NA 2ZNVC 2IO3B 2NBVB 2KTRA 3RUIB 4EEWA 1S3SG 3U8ZA 3OLMD 1M94A 2ZNVB 2ZZPB 1FXTB 4HLEA 1P98A 3UQAA 1WH3A 1WRDB 4K7UA 3APDA 4DXAB 1PQSA 3H7PB 1V9JA 1WM3A 1V6EA 1V80A 2KC2A 4FN2A 4IW0A 3HM6X 4TKNA 5AZFA 3VTWA 2K8BA 2DZMA 3CMMB 2O6VB 4ZRJA 2PE9A 3R66C 4HDQA 2IYDB 4IM3A 3SD5A 5HKHA 1SE9A 1I35A 3DOWA 4DDGD 2CHXA 3H1UA 3RZWC 4IWPA 2GBKA 4B6WA 3ZNGC 2DYBA 1IYFA 1P3QU 4FJVB 1S1QB 3ZRFA 1GJZA 2VRRB 4MH0E 3BINA 4GU2A 4W9DA 2RR9A 5C1ZA 2BKFA 5JZEB 2LVOA 3OJ3A 2LRUA 4EUTA 1V2YA 3ZTCA 4HPLB 3PHXB 3IG3A 2KX0A 2G4SA 3IVFA 4AJWA 1WMHA 1ZW7A 2O2VB 5J18A 2AEHA 1WJNA 3TIXA 2LXAA 5D7GA 3RYTA 3VAWA 1UD7A 1V49A 2IO0B 4WWPA 2UYZB 1OGWA 3QK0A 3C0RB 3NZUA 2JRHA 4BOZB 3PGEA 1GUAB 3ONSA 1WGGA 2K25A 4I6LB 2DAFA 2MBOA 2L0FA 4YL8A 1E8XA 1ZGUB 4DHJD 4HCNB 4ASWC 2FCMA 1WYWB 2EMSA 3ZO5B 4A3PA 3B1LX 4LDTB 3PV1A 3ZNID 1TZ1A 3UF8A 1LXDA 5D94A 1GC7A 5AZGA 1Y8RC 2NPTB 3TBLD 2KTRB 1WI0A 3DBHI 3NS8A 2WDTB 3H7PA 4GDLA 1OTRB 1T0YA 1TBEA 2KDBA 3DVGY 3EECA 2D3GA 4W9GA 3ZDMC 4IM2A 2IY1B 2KN5A 3PT2B 3PS6A 5C23A 4CYEA 1K8RB 3VHTC 3RZFA 2K39A 4FHJA 4P7IA 4W9CA 4WJOA 3UGBB 1QZEA 2M1MA 2AWTA 3ECIA 4W9KA 4TQ1A 2JXXA 4XZ4A 2ZEQA 4F7ZA 5DPWA 4DK5A 2WWZA 1A5RA 4OVVA 1HE8A 3CSTA 1WGDA 2L00B 3M95A 2HTHA 5DPTA 4JGHB 2IO2B 1P0RA 3LDZE 2KMAA 3VVWB 4MDKE 4MJSB 3ZNHB 4PYZA 1WX9A 3KYCD 4DDID 4URKA 4NQKE 1WXAA 3KH0A 1WE7A 3ML9A 3QQ8B 1SIFA 4G50A 4WWOA 2GBNA 3QC8B 4CO7A 3K9PB 2PJHA 3NOBA 2O2VA 1GC6A 4GSWA 4FULA 1XT9B 5IAAC 4ANVA 3QCAA 3VUWA 2KMCA 3A9JA 4GMVA 2CR5A 5JHBA 4RM9A 2N9PC 3H7SA 1WMHB 1WR1A 4CHKA 2FCSA 4BFRA 4PYUA 3ZDTA 1IP9A 4I6PA 4FBJB 5J2RA 3DQVA 4K7WA 4OVUA 3APFA 3V61A 2EMTA 2BKRB 4GXBA 4HWIB 4A3OA 3EHVA 3PREA 2A5UA 2LVPA 2JZZA 2FUHB 2BWES 2LWPA 2LZ6A 2ZCBA 4II3B 2FCQA 5CHFA 3VH4B 2L0TA 1KOTA 3B0AA 2HE7A 4IM0A 2KDIA 1WGRA 5J17A 3ZIMA 3ZUNA 2KDFB 3KW5B 2A4ZA 2WYQA 5AEKB 4I6NB 4KV2A 3RCZA 3DVNU 1NI2A 4HVBA 2NR2A 3VTUA 2DYOA 3BY4B 3ZRCA 2I1KA 3KUZA 4WQOB 2KANA 4E3CA 3V62A 4NAWA 4AOFA 1WIAA 1WJUA 1OQYA 2HJ8A 4F1SA 4FLHA 4GDLB 4NNJB 4W9JA 5G2NA 2REXA 1RFAA 1WF9A 1ZKHA 2MLBA 4M8NA 2KX3A 2BYVE 3QARA 3TL5A 4EKUA 1OEYJ 1C1YB 1WR6E 2MBQA 2LXCA 2LRWA 2KC1A 2JT4B 1E5WA 1LQBA 3A4SC 4M0WB 1WXSA 4MJSA 2KLGA 4M8MA 4W9LA 2LI5A 4FHKA 3IFWB 1E8ZA 3L0WB 3R3MA 2KWCA 2ZVNA 2DHZA 3L16A 4GGQA 2KK8A 1KM7A 3V60A 1G6JA 3RULA 4WWNA 2YLMA 4FA6A 3D32A 4NPNA 2BPSA 2Z0DB 2J7QB 2JRIB 4W9HA 2XBBC 1J19A 4DBGA 4GIVA 4GN1A 2M17A 4GB9A 4DHZB 2IZVB 3TMPB 4IC7B 3A9JB 2OOBB 3HK0A 4KVGB 2O6VD 2KTFA 1E7UA 3X23A 2RPQA 2ZCCA 3KYDD 4BBNF 2D2QA 3VDZA 1E8WA 1WJ4A 1V86A 3L13A 2CU1A 4BKSD 4AWJA 1VCBA 4EFOA 1WZ3A 1KLVA 3PRPB 1WXVA 3SU8X 4LCDE 2DYMA 3PLVA 1WXMA 1YIWA 2MA9B 2NVUI 2KHWB 2QHOA 3Q3FA 1U4AA 3A9KA 2N9EB 3SDLC 2KFKB 3HHMA 2BYEA 2KJRA 2YVCA 1GG3A 4HXDA 2PPHA 1I42A 4XC2A 4GDKA 3K9OB 2K6QA 1XQQA 1TTNA 4NAWB 4J6IA 1WY8A 4ICUA 2RD0A 3WA0A 1P9DU 1YX6B 3PPAA 1ISNA 3ZLZA 4B95A 2N1VA 3HIZA 3VH3B 1EO6A 4A20A 2LGYA 3T8MA 3R7QA 2AYOB 2FCNA 4K7SA 1R4MI 4MSQB 2RGFA 2I1JA 5D2MB 4EZKA 1MG8A 4PS7A 1Q1OA 4FJYA 2XEWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDT D;  4TV3 A;  2KXJ A;  4X57 B;  3VUY A;  3O65 B;  4HCP B;  1J8C A;  4LJP B;  4NY0 A;  1YD8 U;  3ZTD A;  4BKS A;  5LXH A;  5LXI B;  1UBQ A;  3U30 A;  2C7N B;  2MBB B;  3JSV A;  3PVL A;  3QAQ A;  2NS5 A;  2DZK A;  3TCA A;  1D3Z A;  2KLC A;  3NY5 A;  4HDO A;  2IBI B;  1J0G A;  2IY0 B;  2LGX A;  3PHW B;  2MBH A;  1UGM A;  2LD9 A;  3T9L A;  5IA7 A;  5GMV A;  2V1Y A;  5DPS A;  1R4N I;  4W9F A;  3PRM B;  2V3S A;  4ANX A;  4EZJ A;  1V81 A;  3EFU A;  3IBE A;  2KJH B;  4BKT A;  2B3A A;  4KZC A;  4W9I A;  3UIP B;  3PSE B;  2MWS B;  1JRU A;  3L10 B;  3NHE B;  2DZI A;  3KVF B;  4MM3 A;  3W1S C;  1EF1 A;  3V6C B;  5EDS A;  1L2N A;  2KDE B;  3GZN I;  2JPH A;  3V6E B;  4BBN C;  3RT3 B;  3JVZ X;  2MSE D;  5JHA A;  2XK5 A;  1OEY A;  2LUE A;  3PRZ A;  4BOS C;  1E8Y A;  3SHQ A;  3MJW A;  3N3K B;  1H8C A;  4KSK C;  3AU5 A;  2LAS A;  3DVN V;  3L54 A;  2JY6 A;  2KFK A;  2J0K A;  2CKH B;  3QWZ B;  4EOY A;  4KSL C;  4EZL A;  5DPR A;  4W9E A;  4B9K A;  2KWV B;  3EC8 A;  5E6N A;  3PZD A;  2BF8 B;  1Q0W B;  3APC A;  1V5O A;  3A9K B;  4WAA A;  3WAO A;  1RAX A;  1EF5 A;  2WX0 A;  3WAN A;  2BWF A;  1KJT A;  2KOX A;  2MX2 A;  1CMX B;  2D10 A;  2CHW A;  2LVQ A;  4GDK B;  4FJZ A;  2DX5 B;  2M4N A;  5E6O A;  2KQ7 A;  2R2O A;  5KHQ A;  3QX1 A;  2PEA A;  3QA8 A;  4LJO B;  2FID A;  2NBU A;  5CX3 A;  2MQJ A;  2MP2 A;  2ZPY A;  4HPM B;  1XD3 B;  2ZPN A;  2KD0 A;  3N30 A;  3QJZ A;  1UZX B;  2JVC A;  2GBR A;  2PE6 B;  3AI5 A;  5CHW A;  2C7M B;  1UBI A;  2ZJD A;  2FNJ B;  3DBS A;  1RLF A;  3S2A A;  2KFJ A;  4KDL B;  2L76 A;  1VD2 A;  2N4F A;  1YX5 B;  2GMI C;  4HJK A;  1LFD A;  4ICV A;  3A1Q A;  3M3J A;  2GOW A;  5G55 A;  3DCG A;  1BT0 A;  4N9F 4;  3L08 A;  4DHJ B;  3WAP A;  2CS4 A;  3AXC A;  3M62 B;  3JSV B;  5CHV C;  2EKE C;  3UIO B;  2IO1 B;  5L95 C;  4WJN A;  2NBW B;  4AUQ C;  2N1W A;  2D07 B;  3AUL A;  2DEN B;  2C5L C;  2M8S A;  2LGD A;  2JUO A;  2C60 A;  2J0M A;  2KQS A;  5BO4 B;  2MCN B;  3W1S A;  3UQB A;  4G11 A;  4KIK A;  4IWQ A;  4PS3 A;  2WX1 A;  2CHZ A;  2AL3 A;  4RM8 A;  1SGH A;  1UH6 A;  4F8C B;  1LM8 B;  4WJP A;  2XK5 B;  4IWO A;  4ZRI A;  3A33 B;  2UWQ A;  4TUU A;  3ZVV A;  3GOE A;  3UIN B;  2N7E A;  3ZNZ B;  3CF6 E;  5DCN A;  4FAD A;  5E6P A;  3PTF C;  1Z2M A;  1WX7 A;  3KUC B;  4NJ6 A;  2RSU A;  5CTR C;  2FAZ A;  2L05 A;  2L8J A;  4MGK E;  1E90 A;  4ANW A;  2L7R A;  2ZVO A;  3P2B A;  4RMA A;  3WAM A;  4G3X B;  3X0W A;  3U7D A;  3ML8 A;  1AAR A;  3LJ3 A;  2KZR A;  3OJ4 B;  2K8C A;  3M63 B;  1P1A A;  5FR6 A;  4ZDV A;  2G3Q B;  2C7H A;  4G0N B;  1WFY A;  3DVG X;  2KJ6 A;  2JF5 A;  4XX5 A;  5LLI A;  3JYU A;  4JQW C;  2M0X A;  4K81 A;  3VQI A;  3WAL A;  2Y5B B;  1NBF C;  3OAW A;  2FIF A;  1IPG A;  3JW0 X;  3PLU A;  2J0J A;  1YQB A;  4BKG A;  4KZ0 A;  3I3T B;  2JWZ A;  2MP2 B;  3ENE A;  3AU4 A;  2K8H A;  3CSF A;  4MGZ E;  3VUX A;  4BVU C;  2MW5 A;  2O6V A;  4K1R B;  3ZW3 A;  1GNU A;  3B08 A;  3ALB A;  2K6D B;  3DPD A;  4JIO U;  1Q5W B;  2N7D A;  4NJ7 A;  2JZ3 B;  2KKC A;  3H9D A;  2L3Z A;  2KO3 A;  4PS8 A;  4ZYN A;  4E71 A;  1WE6 A;  1H4R A;  4ANU A;  2GBJ A;  1UEL A;  1Z5S B;  3R7R A;  1F9J A;  4MGY E;  4IG7 B;  4AP4 C;  1C3T A;  4HK2 A;  3VTV A;  2NCN A;  4KDI C;  1WZ0 A;  3WIM A;  3A1Q B;  1EUV B;  4MSM B;  5L83 A;  2R2Q A;  2D11 A;  1L7Y A;  5TR5 A;  4DWF A;  3A4R A;  2KWU B;  4TQ0 A;  3DBL I;  3IHP C;  2BYF A;  4II2 B;  4JL9 A;  3TJP A;  1WGY A;  3VXW A;  3DBR I;  3W1Y A;  2DZJ A;  4ZRK A;  2HD5 B;  1E7V A;  3VFK A;  2G4D B;  3KUD B;  3QIJ A;  2LJ5 A;  3L17 A;  2K1F A;  4IUM B;  3QHT A;  4KIK B;  4MEM A;  3H6N A;  2KVR A;  4MGI E;  2KNB A;  3NZS A;  4WJQ A;  2C9W B;  2Z0E B;  5AZH A;  5JH5 C;  3MTN B;  5D6J B;  2DAJ A;  3ZKJ C;  2N9X A;  5KHO A;  1WJ6 A;  1X1M A;  3N32 A;  4DHZ E;  4E74 A;  3RD2 A;  4AJY B;  2OJR A;  1WX8 A;  1WM2 A;  3Q3J A;  2BGF A;  2G45 B;  1RRB A;  2AL6 A;  2V4L A;  1V5T A;  3DDC B;  4GOC A;  2Z59 B;  2GBM A;  4MEL A;  3HM3 A;  4NQL B;  2MRP A;  2MBE A;  3MHS D;  1TGZ B;  4JLC A;  1NDD A;  1WGH A;  1YJ1 A;  2ASQ A;  2NPT A;  2W9N A;  2ZNV C;  2IO3 B;  2NBV B;  2KTR A;  3RUI B;  4EEW A;  1S3S G;  3U8Z A;  3OLM D;  1M94 A;  2ZNV B;  2ZZP B;  1FXT B;  4HLE A;  1P98 A;  3UQA A;  1WH3 A;  1WRD B;  4K7U A;  3APD A;  4DXA B;  1PQS A;  3H7P B;  1V9J A;  1WM3 A;  1V6E A;  1V80 A;  2KC2 A;  4FN2 A;  4IW0 A;  3HM6 X;  4TKN A;  5AZF A;  3VTW A;  2K8B A;  2DZM A;  3CMM B;  2O6V B;  4ZRJ A;  2PE9 A;  3R66 C;  4HDQ A;  2IYD B;  4IM3 A;  3SD5 A;  5HKH A;  1SE9 A;  1I35 A;  3DOW A;  4DDG D;  2CHX A;  3H1U A;  3RZW C;  4IWP A;  2GBK A;  4B6W A;  3ZNG C;  2DYB A;  1IYF A;  1P3Q U;  4FJV B;  1S1Q B;  3ZRF A;  1GJZ A;  2VRR B;  4MH0 E;  3BIN A;  4GU2 A;  4W9D A;  2RR9 A;  5C1Z A;  2BKF A;  5JZE B;  2LVO A;  3OJ3 A;  2LRU A;  4EUT A;  1V2Y A;  3ZTC A;  4HPL B;  3PHX B;  3IG3 A;  2KX0 A;  2G4S A;  3IVF A;  4AJW A;  1WMH A;  1ZW7 A;  2O2V B;  5J18 A;  2AEH A;  1WJN A;  3TIX A;  2LXA A;  5D7G A;  3RYT A;  3VAW A;  1UD7 A;  1V49 A;  2IO0 B;  4WWP A;  2UYZ B;  1OGW A;  3QK0 A;  3C0R B;  3NZU A;  2JRH A;  4BOZ B;  3PGE A;  1GUA B;  3ONS A;  1WGG A;  2K25 A;  4I6L B;  2DAF A;  2MBO A;  2L0F A;  4YL8 A;  1E8X A;  1ZGU B;  4DHJ D;  4HCN B;  4ASW C;  2FCM A;  1WYW B;  2EMS A;  3ZO5 B;  4A3P A;  3B1L X;  4LDT B;  3PV1 A;  3ZNI D;  1TZ1 A;  3UF8 A;  1LXD A;  5D94 A;  1GC7 A;  5AZG A;  1Y8R C;  2NPT B;  3TBL D;  2KTR B;  1WI0 A;  3DBH I;  3NS8 A;  2WDT B;  3H7P A;  4GDL A;  1OTR B;  1T0Y A;  1TBE A;  2KDB A;  3DVG Y;  3EEC A;  2D3G A;  4W9G A;  3ZDM C;  4IM2 A;  2IY1 B;  2KN5 A;  3PT2 B;  3PS6 A;  5C23 A;  4CYE A;  1K8R B;  3VHT C;  3RZF A;  2K39 A;  4FHJ A;  4P7I A;  4W9C A;  4WJO A;  3UGB B;  1QZE A;  2M1M A;  2AWT A;  3ECI A;  4W9K A;  4TQ1 A;  2JXX A;  4XZ4 A;  2ZEQ A;  4F7Z A;  5DPW A;  4DK5 A;  2WWZ A;  1A5R A;  4OVV A;  1HE8 A;  3CST A;  1WGD A;  2L00 B;  3M95 A;  2HTH A;  5DPT A;  4JGH B;  2IO2 B;  1P0R A;  3LDZ E;  2KMA A;  3VVW B;  4MDK E;  4MJS B;  3ZNH B;  4PYZ A;  1WX9 A;  3KYC D;  4DDI D;  4URK A;  4NQK E;  1WXA A;  3KH0 A;  1WE7 A;  3ML9 A;  3QQ8 B;  1SIF A;  4G50 A;  4WWO A;  2GBN A;  3QC8 B;  4CO7 A;  3K9P B;  2PJH A;  3NOB A;  2O2V A;  1GC6 A;  4GSW A;  4FUL A;  1XT9 B;  5IAA C;  4ANV A;  3QCA A;  3VUW A;  2KMC A;  3A9J A;  4GMV A;  2CR5 A;  5JHB A;  4RM9 A;  2N9P C;  3H7S A;  1WMH B;  1WR1 A;  4CHK A;  2FCS A;  4BFR A;  4PYU A;  3ZDT A;  1IP9 A;  4I6P A;  4FBJ B;  5J2R A;  3DQV A;  4K7W A;  4OVU A;  3APF A;  3V61 A;  2EMT A;  2BKR B;  4GXB A;  4HWI B;  4A3O A;  3EHV A;  3PRE A;  2A5U A;  2LVP A;  2JZZ A;  2FUH B;  2BWE S;  2LWP A;  2LZ6 A;  2ZCB A;  4II3 B;  2FCQ A;  5CHF A;  3VH4 B;  2L0T A;  1KOT A;  3B0A A;  2HE7 A;  4IM0 A;  2KDI A;  1WGR A;  5J17 A;  3ZIM A;  3ZUN A;  2KDF B;  3KW5 B;  2A4Z A;  2WYQ A;  5AEK B;  4I6N B;  4KV2 A;  3RCZ A;  3DVN U;  1NI2 A;  4HVB A;  2NR2 A;  3VTU A;  2DYO A;  3BY4 B;  3ZRC A;  2I1K A;  3KUZ A;  4WQO B;  2KAN A;  4E3C A;  3V62 A;  4NAW A;  4AOF A;  1WIA A;  1WJU A;  1OQY A;  2HJ8 A;  4F1S A;  4FLH A;  4GDL B;  4NNJ B;  4W9J A;  5G2N A;  2REX A;  1RFA A;  1WF9 A;  1ZKH A;  2MLB A;  4M8N A;  2KX3 A;  2BYV E;  3QAR A;  3TL5 A;  4EKU A;  1OEY J;  1C1Y B;  1WR6 E;  2MBQ A;  2LXC A;  2LRW A;  2KC1 A;  2JT4 B;  1E5W A;  1LQB A;  3A4S C;  4M0W B;  1WXS A;  4MJS A;  2KLG A;  4M8M A;  4W9L A;  2LI5 A;  4FHK A;  3IFW B;  1E8Z A;  3L0W B;  3R3M A;  2KWC A;  2ZVN A;  2DHZ A;  3L16 A;  4GGQ A;  2KK8 A;  1KM7 A;  3V60 A;  1G6J A;  3RUL A;  4WWN A;  2YLM A;  4FA6 A;  3D32 A;  4NPN A;  2BPS A;  2Z0D B;  2J7Q B;  2JRI B;  4W9H A;  2XBB C;  1J19 A;  4DBG A;  4GIV A;  4GN1 A;  2M17 A;  4GB9 A;  4DHZ B;  2IZV B;  3TMP B;  4IC7 B;  3A9J B;  2OOB B;  3HK0 A;  4KVG B;  2O6V D;  2KTF A;  1E7U A;  3X23 A;  2RPQ A;  2ZCC A;  3KYD D;  4BBN F;  2D2Q A;  3VDZ A;  1E8W A;  1WJ4 A;  1V86 A;  3L13 A;  2CU1 A;  4BKS D;  4AWJ A;  1VCB A;  4EFO A;  1WZ3 A;  1KLV A;  3PRP B;  1WXV A;  3SU8 X;  4LCD E;  2DYM A;  3PLV A;  1WXM A;  1YIW A;  2MA9 B;  2NVU I;  2KHW B;  2QHO A;  3Q3F A;  1U4A A;  3A9K A;  2N9E B;  3SDL C;  2KFK B;  3HHM A;  2BYE A;  2KJR A;  2YVC A;  1GG3 A;  4HXD A;  2PPH A;  1I42 A;  4XC2 A;  4GDK A;  3K9O B;  2K6Q A;  1XQQ A;  1TTN A;  4NAW B;  4J6I A;  1WY8 A;  4ICU A;  2RD0 A;  3WA0 A;  1P9D U;  1YX6 B;  3PPA A;  1ISN A;  3ZLZ A;  4B95 A;  2N1V A;  3HIZ A;  3VH3 B;  1EO6 A;  4A20 A;  2LGY A;  3T8M A;  3R7Q A;  2AYO B;  2FCN A;  4K7S A;  1R4M I;  4MSQ B;  2RGF A;  2I1J A;  5D2M B;  4EZK A;  1MG8 A;  4PS7 A;  1Q1O A;  4FJY A;  2XEW A; 
#chains in the Genus database with same CATH topology
 2BVC A;  2EKI A;  4LDT D;  4TV3 A;  2KXJ A;  4X57 B;  3VUY A;  3O65 B;  5HFY A;  1J8C A;  4NY0 A;  3ZTD A;  4BKS A;  5LXI B;  2C7N B;  3P42 A;  3T9L A;  2V1Y A;  1WRI A;  1V81 A;  3DHH C;  1TS2 A;  3L10 B;  4MM3 A;  5AUK A;  1E7P B;  1ZXI A;  5JHA A;  1VZ8 A;  4LTU A;  1E8Y A;  4P16 A;  3J9C A;  4R3D A;  5GXG B;  5MPO A;  3N3K B;  3AU5 A;  3L54 A;  2VZK B;  3PZ8 A;  3KQ4 A;  2J0K A;  4EOY A;  5DPR A;  2BF8 B;  1Q0W B;  3APC A;  1V5O A;  1RAX A;  2BWF A;  1HEZ E;  2D10 A;  2KQ7 A;  2AQ1 B;  2R2O A;  2PEA A;  3AED B;  2N9K A;  1J7C A;  5D3D A;  1TKY A;  4IDI A;  2ZPY A;  5CHW A;  2C7M B;  1UBI A;  2WNM A;  2ZJD A;  3BVZ A;  1ZDV A;  4REZ A;  4KDL B;  2L76 A;  3AEG B;  1YX5 B;  1QOG A;  4ICV A;  3IAM 1;  1HXY D;  4N9F 4;  1TT5 B;  2CS4 A;  2EKE C;  2PMV A;  2IO1 B;  5L95 C;  1F2R I;  2DEN B;  2J0M A;  5BO4 B;  1E10 A;  2BT6 A;  2MCN B;  1T0R C;  4IWQ A;  4PS3 A;  4RH6 A;  4JX1 C;  3AE6 B;  4F8C B;  2XK5 B;  3A33 B;  4YXD B;  2BB6 A;  3ZNZ B;  3I5J C;  1CJE A;  1Z2M A;  1WX7 A;  3KUC B;  3EFC A;  4A6Q A;  4NJ6 A;  2RSU A;  1L6V A;  1E90 A;  5IN7 A;  4D2K A;  2L7R A;  1TKG A;  4RMA A;  2PKO A;  3U7D A;  1N61 A;  3ML8 A;  4ZDV A;  2JZP A;  1L4Z B;  5TSS A;  2C7H A;  1WFY A;  1FRR A;  1L4D B;  3WAL A;  2Y5B B;  1NBF C;  3JW0 X;  2TSS A;  1YQB A;  2J4X A;  1K52 A;  1KLG D;  4ARI A;  4K1R B;  1GNU A;  2KKC A;  3H9D A;  2KO3 A;  1IBX B;  3AV8 A;  1UEL A;  2K3U A;  1JWB D;  4MGY E;  4AP4 C;  2D3B A;  4YSX B;  5L83 A;  1OQR A;  3AE4 B;  2BYF A;  4JL9 A;  4WAF A;  3VXW A;  3DHI C;  1BXT A;  1R4N B;  1E7V A;  2G4D B;  3KUD B;  2K1F A;  5BMI A;  4KIK B;  3U4E G;  3H6N A;  1ZXH A;  5AZH A;  5JH5 C;  5D6J B;  2DAJ A;  4HKZ E;  5KHO A;  3AE7 B;  3N32 A;  3KWL A;  4AJY B;  2OJR A;  1WX8 A;  2BGF A;  1EM7 A;  1QOB A;  1XF5 L;  4JLC A;  3MHS D;  1WGH A;  2W9N A;  4NZL B;  2KTR A;  1B9R A;  3OLM D;  4WWM A;  3H8H A;  2ZZP B;  2AQ3 B;  4N59 A;  4HLE A;  4NAM A;  1L6U A;  1UF0 A;  4IOI E;  4XGA B;  1XEE A;  4WH4 A;  4M00 A;  4K7U A;  1YOV B;  3H7P B;  1MPE A;  1QT9 A;  4FN2 A;  1V9J A;  1V6E A;  1V80 A;  1WM3 A;  3HM6 X;  4TKN A;  2Q5W D;  4B0M A;  3SD5 A;  3T3N A;  3NUH B;  3RI7 C;  1SXT A;  4FJV B;  3BVM A;  4MH0 E;  1N62 A;  5JZE B;  3KLS X;  2LRU A;  3CIR B;  3DWM A;  5BYR A;  2L1A A;  1WMH A;  2O2V B;  1WJN A;  3TIX A;  3RYT A;  1D5Z C;  1V49 A;  2IPK D;  1ZE3 D;  2JRH A;  2N0S B;  3C0R B;  2K25 A;  2L0F A;  3NVZ A;  1E8X A;  1ET6 A;  4ASW C;  3OWE B;  2FCM A;  4LDT B;  1TZ1 A;  1LXD A;  4P1C C;  1GC7 A;  3TBL D;  3NS8 A;  2WDT B;  4KX6 B;  1F0Z A;  4WUR A;  3EEC A;  1T0Y A;  2D3G A;  1XLO A;  1HQR D;  4IM2 A;  2KN5 A;  5C23 A;  3GE8 C;  4W9C A;  4W9K A;  4TQ1 A;  1K51 A;  4XZ4 A;  2ZEQ A;  5DPW A;  4OVV A;  1HE8 A;  2EEL A;  5DPT A;  1P0R A;  1XO3 A;  2G9H D;  1TY0 A;  4DDI D;  3EA6 A;  3KH0 A;  3DBL B;  4G50 A;  4WWO A;  4CO7 A;  3QC8 B;  1ZDX A;  5IAA C;  1XT9 B;  2E6X A;  2RMM A;  3BYY B;  4RGT A;  4GMV A;  5JHB A;  4K3C A;  2K22 A;  1WR1 A;  2Y3A A;  4PYU A;  1IP9 A;  1B1Z A;  1HA5 A;  3V61 A;  2WXO A;  2BS4 B;  2MEK A;  1UNS A;  2IND C;  5H8Y E;  2LVP A;  2BWE S;  5CHF A;  1VZ7 A;  3B0A A;  2WU5 B;  1I4H A;  5J17 A;  2KDF B;  2A4Z A;  3RCZ A;  2NR2 A;  3VTU A;  1JWM D;  2DYO A;  3BY4 B;  3ZRC A;  2I1K A;  4WQO B;  1FIQ A;  4AOF A;  4O1N A;  4FLH A;  4GDL B;  1M4V A;  4W9J A;  5G2N A;  2V3N A;  1YQ4 B;  1WF9 A;  3N20 C;  2BYV E;  3QAR A;  1OEY J;  1N5W A;  1WR6 E;  3RNE C;  2LRW A;  3RFZ B;  1E5W A;  4MJS A;  1D5X C;  1WXS A;  4DXG A;  4M8M A;  1PDX A;  2SAK A;  1E8Z A;  2KWC A;  3ABV B;  4B0E A;  3EGR A;  3Q3N C;  2BPS A;  1TS3 A;  2Z0D B;  2J7Q B;  4ZOH C;  3VRB B;  4W9H A;  1PGA A;  2H89 B;  2M17 A;  3ZQ4 A;  4MH8 A;  1E0Z A;  2IJ0 A;  2W82 A;  3TMP B;  4IC7 B;  3A9J B;  2OOB B;  3P63 A;  1E7U A;  3X23 A;  2ZCC A;  5EE3 A;  5FKA C;  1E8W A;  4RCO A;  1VCB A;  4RGN A;  2QMT A;  3BZD B;  1FNU A;  2DYM A;  2WXJ A;  3PLV A;  1YIW A;  2L83 A;  2KHW B;  2QHO A;  4PK1 A;  1U4A A;  2Z8L A;  3A9K A;  2N9E B;  1FFU A;  1IGD A;  4XC2 A;  2DWQ A;  1MVK A;  1TZO A;  1WY8 A;  4ICU A;  1NI3 A;  4YT0 B;  1VDV A;  2N1V A;  4ZHP A;  3AE5 B;  3R7Q A;  2ZW1 A;  1R4M I;  4C80 A;  5D2M B;  1N63 A;  4XE0 A;  3C8Y A;  1I4Q A;  3DWG C;  3LYY A;  1YD8 U;  1XLN A;  1UBQ A;  2MBB B;  3NRZ A;  2I2Y A;  2NS5 A;  3FIL B;  1FXA A;  2CJN A;  5FR3 A;  2INP E;  1D3Z A;  1C9F A;  4HDO A;  1UGM A;  2JSV X;  5IA7 A;  2BS2 B;  5DPS A;  4ANX A;  4BKT A;  2KJH B;  2DNF A;  1JRU A;  2DZI A;  4P1B C;  5EDS A;  4C00 A;  4OHJ A;  2JPH A;  2MSE D;  1D6E C;  2LUE A;  4BOS C;  1AW7 A;  4RF0 A;  4LNK A;  3MJW A;  3DVN V;  2AX5 A;  2CKH B;  1YQ3 B;  2KWV B;  1JWS D;  1NEK B;  3WAO A;  3WAN A;  2MX2 A;  2FE8 A;  2M4N A;  2FID A;  2KQ4 X;  1XD3 B;  3NVW A;  3QJZ A;  1UZX B;  2KWD A;  2GBR A;  2PE6 B;  3AI5 A;  1ET9 A;  1JRO A;  2VH2 A;  3Q8B A;  2N9L A;  3S2A A;  2MJD A;  3A1Q A;  2GOW A;  1YNT E;  3DHG C;  3JSV B;  5CHV C;  2D07 B;  5IP4 D;  3AUL A;  3TEX A;  3HUI A;  3SFE B;  4G11 A;  1KTK A;  3V05 A;  5JXV A;  2CHZ A;  1SGH A;  5HI1 A;  1K50 A;  4TUU A;  2N7E A;  4FAD A;  5E6P A;  3PTF C;  1BML C;  3V3X A;  5CTR C;  2L05 A;  2L8J A;  4ANW A;  3P2B A;  3WAM A;  1SE2 A;  3LJ3 A;  3M63 B;  1RFK A;  3B9J A;  4G0N B;  3WCQ A;  2KJ6 A;  1JWU D;  4K81 A;  3VQI A;  4C4V A;  1JAL A;  1D4B A;  3I3T B;  2MP2 B;  2K8H A;  3CSF A;  3VUX A;  2MW5 A;  2O6V A;  3B08 A;  2K6D B;  1Q5W B;  1KRH A;  4PS8 A;  1H4R A;  3E56 A;  2GBJ A;  3NS1 A;  2WDV B;  2D3A A;  1HTO A;  4IG7 B;  2NCN A;  3WIM A;  1FRD A;  1EUV B;  1QQR A;  3Q69 A;  2R2Q A;  2D11 A;  1XCQ L;  4TQ0 A;  2E3T A;  1TIF A;  1ACC A;  1CQV A;  4II2 B;  2LEK A;  3DBR I;  2JXT A;  3QIJ A;  2XN9 C;  4IUM B;  3RNF C;  3QHT A;  1OQQ A;  1FNV A;  2W54 A;  2KVR A;  4MGI E;  2X8X X;  4WJQ A;  2C9W B;  3GZN B;  2LHD A;  3MTN B;  4KKJ A;  2N9X A;  5E6J A;  1V1P B;  4A8X C;  1SE3 A;  3Q3J A;  2V4L A;  4C7Z A;  3AE1 B;  4MEL A;  4NQL B;  3URY A;  1TGZ B;  4H2A A;  3RUI B;  2V9H A;  1M94 A;  1WWT A;  1FXT B;  1ZP0 B;  1P98 A;  4RF1 A;  3MC0 B;  1WH3 A;  3R2I A;  4DXA B;  2KC2 A;  5AZF A;  3VTW A;  3ZJV A;  2I38 A;  2K8B A;  4DQO C;  4WIP A;  4EE2 A;  4HRS A;  2WXM A;  1I35 A;  4YSZ B;  2GBK A;  1L0Y B;  2WU2 B;  2DYB A;  1IYF A;  1S1Q B;  1VRA B;  3BIN A;  4ITK A;  2RR9 A;  1ENF A;  5C1Z A;  2WXQ A;  3OJ3 A;  3B2G A;  1VR9 A;  3ZTC A;  1DOY A;  2KX0 A;  2G4S A;  3IVF A;  5J18 A;  2AEH A;  3VAW A;  1WYG A;  1UD7 A;  2B76 B;  2IO0 B;  4WWP A;  2UYZ B;  5T8I A;  3SR6 A;  4BOZ B;  1JRP A;  4I6L B;  3ZJT A;  3NVV A;  1ZGU B;  4HCN B;  2W3S A;  3Q3M C;  3P4Q B;  3ZNI D;  3W9C B;  5H92 C;  5AZG A;  2NPT B;  3AEB B;  1PYW D;  2GB1 A;  1C77 A;  1TBE A;  3DVG Y;  2DBY A;  4CYE A;  1K8R B;  3RZF A;  2FUG 1;  4WJO A;  3ECI A;  1A5R A;  3LDZ E;  2KMA A;  3ZNH B;  4MDK E;  4MJS B;  2D3C A;  4PYZ A;  3KYC D;  3Q6B A;  2XNA C;  1T5X D;  4URK A;  4A9A A;  3GE3 C;  1WXA A;  3ML9 A;  3QQ8 B;  1FXI A;  1SIF A;  2QJL A;  4M02 A;  1GC6 A;  3PZ7 A;  2LFI A;  2JYE A;  4RM9 A;  4LK0 M;  4YTN B;  2N9P C;  1MHH E;  3IXS A;  3ZDT A;  4FBJ B;  2QCZ A;  5J2R A;  3DQV A;  3APF A;  4J3O D;  2CJO A;  2EMT A;  2BKR B;  4GXB A;  3U52 E;  2PLP A;  3EHV A;  1C76 A;  1YJJ A;  2FUH B;  2L0T A;  3GS2 A;  2HE7 A;  2KDI A;  1T6B X;  3Q14 C;  4LLG M;  3KW5 B;  2WYQ A;  4HVB A;  1R7S A;  2WGS A;  1XXG A;  2WXL A;  1PUT A;  1WIA A;  4OZA A;  2HJ8 A;  3AN1 A;  4NNJ B;  1RFA A;  2KX3 A;  1SEB D;  1C1Y B;  1FD6 A;  1YMH E;  4M01 A;  5AUI A;  3AE3 B;  3FAH A;  4M0W B;  1VLB A;  5HHD G;  2KLG A;  1PFD A;  3U2S C;  4FHK A;  3IFW B;  3R3M A;  2DHZ A;  2G1E A;  2AQ2 B;  1AN8 A;  3RUL A;  2RPV A;  2YLM A;  4FA6 A;  2JRI B;  3Q2A C;  1J19 A;  2KAC A;  4GB9 A;  2IZV B;  4KVG B;  2JQR B;  2KTF A;  2WXR A;  4TMA B;  4FXC A;  2D2Q A;  1I4G A;  3HVD A;  4PT5 A;  4AWJ A;  1WZ3 A;  1KLV A;  3PRP B;  3SU8 X;  4LCD E;  2YEP B;  1WXM A;  2MA9 B;  3RMK C;  4HEA 1;  4ZRP A;  3AB5 A;  3HHM A;  2BYE A;  2KJR A;  2YVC A;  1F1H A;  1GPX A;  4L1B A;  3DBH B;  1TTN A;  4NAW B;  1EWC A;  3HVZ A;  1ISN A;  3ZLZ A;  2V0G A;  1TY2 A;  4K3B A;  4HPP A;  3HIZ A;  3VH3 B;  5C2T B;  4HKQ A;  3P4P B;  4A20 A;  2LGY A;  3T8M A;  2FCN A;  1FM0 D;  4K7S A;  1D5M C;  2RGF A;  1QOF A;  4EZK A;  4CQN A;  2XEW A;  2LMC A;  3ZXR A;  1PGB A;  3U30 A;  4IKG A;  2KLC A;  4C7Y A;  1J0G A;  1WXQ A;  2MBH A;  2LD9 A;  1P7F A;  1V1O A;  2PTL A;  1R4N I;  3RPF C;  4W9F A;  2V3S A;  1VJK A;  3IBE A;  3VR8 B;  4RNA A;  4W9I A;  3UIP B;  3PSE B;  2MWS B;  4A55 A;  4UDU C;  2PVO D;  4GLS C;  3V6E B;  1HTQ A;  3RT3 B;  1YJI A;  2XK5 A;  4LNF A;  3PRZ A;  3AEA B;  1YN5 A;  3SHQ A;  1IUE A;  2JY6 A;  4WQM A;  4ACF A;  3QWZ B;  4W9E A;  3EC8 A;  3PZD A;  2MHJ A;  3I9V 1;  3BK2 A;  1EF5 A;  1TKE A;  2KOX A;  4S17 A;  2JYT A;  4GDK B;  4FJZ A;  5E6O A;  3QX1 A;  3RNA C;  3TEW A;  5CX3 A;  4HPM B;  3W2D A;  4C4V B;  2X38 A;  4AS1 A;  1J7A A;  1E9M A;  1IBX A;  2FNJ B;  3DBS A;  2KFJ A;  3AE2 B;  2N4F A;  4XYC A;  3AXC A;  2HTM E;  4WJN A;  2N1W A;  4L23 A;  2C5L C;  2LGD A;  2JUO A;  2C60 A;  3W1S A;  3UQB A;  4KIK A;  1GAQ B;  4MM3 B;  2WX1 A;  2AL3 A;  4RM8 A;  1LM8 B;  2ON8 A;  4IWO A;  2UWQ A;  2H88 B;  3U7Z A;  3CF6 E;  2WQY B;  3RNC C;  2FAZ A;  1AAR A;  2KZR A;  2K8C A;  3TUO A;  1P1A A;  5FR6 A;  3DVG X;  1AWD A;  1RM6 C;  2JF5 A;  4XX5 A;  1I4R A;  5LLI A;  3JYU A;  4JQW C;  1NVI D;  1QF6 A;  2KAJ A;  1IPG A;  1MJD A;  2IDY A;  4BZA A;  4BKG A;  4KZ0 A;  1STE A;  2OJW A;  3ENE A;  1P7E A;  5EE1 A;  4MGZ E;  1N60 A;  4BVU C;  5IO9 A;  3ALB A;  3AH7 A;  4MAC A;  2JZ3 B;  1L0X B;  2L3Z A;  4E71 A;  1SIJ A;  1Z5S B;  5FK9 C;  3R7R A;  1F9J A;  3N1Y C;  2R61 A;  4KGS A;  2W55 A;  4KDI C;  1WZ0 A;  1NYQ A;  3IT6 B;  5TR5 A;  3DBL I;  3IHP C;  5EE9 A;  3TJP A;  4ZRK A;  2HD5 B;  4MEM A;  1QIL A;  3NZS A;  1N6Z A;  3MFG A;  3ZKJ C;  2K0P A;  2GI9 A;  1WJ6 A;  1X1M A;  4E74 A;  2BQQ A;  1ZPS A;  1RRB A;  1V5T A;  2GBM A;  3HM3 A;  2MRP A;  4P6V F;  3GB1 A;  1NDD A;  2WS3 B;  1YJ1 A;  1MHX A;  2ASQ A;  2ZNV C;  2IO3 B;  2NBV B;  4EEW A;  1S3S G;  3U8Z A;  3BVG A;  2ZNV B;  4ZHO A;  3UQA A;  1WRD B;  1PQS A;  1FCL A;  1WGK A;  1OFF A;  2OED A;  3N9Y C;  2INN E;  3CMM B;  2OHF A;  1XLQ A;  2IYD B;  3C19 A;  5HKH A;  2IGH A;  2D5G A;  4DDG D;  2CHX A;  1FNW A;  3Q3O C;  4N6E B;  2KN4 A;  3RZW C;  4B6W A;  3I57 A;  3ZRF A;  1GJZ A;  4GU2 A;  1F2R C;  2LVO A;  3CWI A;  3N1Z C;  1C4C A;  3TSS A;  1ROE A;  2VH1 A;  3PHX B;  2M56 B;  4AJW A;  3NVY A;  1V97 A;  1ZW7 A;  4JWU C;  5G5G A;  1GOZ A;  2LXA A;  5D7G A;  2V4I B;  1OGW A;  3QK0 A;  3BWU D;  3LB8 C;  3NZU A;  1GUA B;  1WGG A;  4DHJ D;  2MJ3 A;  4N58 A;  3FC4 A;  3B1L X;  3PV1 A;  3UF8 A;  1Y8R C;  2KTR B;  1WI0 A;  3NZ3 A;  1E6E B;  4KGR A;  1C79 A;  4GDL A;  2KDB A;  3ZYY X;  2WXG A;  3ZDM C;  2IY1 B;  2M19 A;  1TS5 A;  2SEB D;  3UGB B;  3L4P A;  1QZE A;  2M1M A;  2NTT A;  2JXX A;  2HJ1 A;  4F7Z A;  2WWZ A;  3CST A;  2HTH A;  2IO2 B;  2INC C;  1WX9 A;  4KKI A;  3MC8 A;  1WE7 A;  3NOB A;  4GSW A;  4FUL A;  4ANV A;  3QCA A;  1I4P A;  2KMC A;  2GRI A;  3A9J A;  1KFY B;  2QSD A;  2CR5 A;  3H7S A;  1TJE A;  1WMH B;  2FCS A;  4BFR A;  2LUM A;  4I6P A;  2PIA A;  5IOI A;  4K7W A;  4OVU A;  1JW9 D;  3PRE A;  3P4R B;  2A5U A;  4L2Y A;  2JZZ A;  1FEH A;  2FCQ A;  2L52 A;  3NJT A;  1MI0 A;  3ZUN A;  5AEK B;  4I6N B;  4KV2 A;  3MJ5 A;  3DVN U;  3KUZ A;  5BMG A;  4XDD A;  1WJU A;  1OQY A;  4F1S A;  1EU3 A;  2DLB A;  3ETR A;  4EKU A;  3W5U B;  2J52 A;  2MBQ A;  2LXC A;  2KC1 A;  3A4S C;  4JPS A;  3MC9 A;  3L0W B;  2WXH A;  2ZVN A;  3L16 A;  4GGQ A;  1KM7 A;  1G6J A;  4NPN A;  3FIL A;  1RWS A;  3ZGZ A;  4MT5 A;  1EU4 A;  4GIV A;  1HZ6 A;  1RYJ A;  2UU7 A;  3Q8A A;  2O6V D;  2QC8 A;  1VZ6 A;  3KYD D;  4BBN F;  1EWY C;  1UWX A;  2BTE A;  1V86 A;  4BKS D;  2QDF A;  1KF6 B;  2BW2 A;  1WXV A;  3OG5 A;  3AEE B;  1NYR A;  1NEN B;  2NVU I;  1SBB B;  2FBW B;  3SDL C;  1XCT L;  4XDC A;  4HXD A;  1GG3 A;  2V3P A;  4S0R A;  1J7B A;  1XQQ A;  1AYF A;  1FMA D;  1IGC A;  3RNB C;  3WA0 A;  1YX6 B;  3PPA A;  4B95 A;  3TEZ A;  1FPY A;  3SEB A;  2WXN A;  2AYO B;  4MSQ B;  4OW0 A;  4YWG G;  2KVZ A;  4PS7 A;  4FJY A;  1MFW A;  4HCP B;  4LJP B;  2K5P A;  2WXF A;  5LXH A;  2LGS A;  3JSV A;  3PVL A;  3QAQ A;  3TCA A;  2DZK A;  3NY5 A;  2IBI B;  2IY0 B;  2LGX A;  3PHW B;  2RDG A;  4RGO S;  2N7J A;  5GMV A;  4C56 C;  1Q10 A;  3PRM B;  4EZJ A;  3EFU A;  2B3A A;  2YEP F;  4KZC A;  3NHE B;  3W1S C;  3KVF B;  1EF1 A;  3V6C B;  1L2N A;  2KDE B;  3GZN I;  4JWS C;  5EE0 A;  3VR9 B;  4BBN C;  3JVZ X;  5IKC M;  1OEY A;  1QKZ A;  1H8C A;  4KSK C;  2LAS A;  2KFK A;  3PO0 A;  4KSL C;  4EZL A;  4B9K A;  5E6N A;  4WAA A;  3A9K B;  2WXI A;  2WX0 A;  1N5X A;  1QLB B;  2KMM A;  4USA A;  1KJT A;  1F77 A;  1CMX B;  2LVQ A;  2CHW A;  2DX5 B;  5KHQ A;  3QA8 A;  4LJO B;  4NJC A;  2NBU A;  3HRD D;  2MQJ A;  2MP2 A;  1L0V B;  2ZPN A;  2KD0 A;  3N30 A;  3Q8C A;  1CK1 A;  2JVC A;  1ESF A;  1I7H A;  2HDE A;  4LNI A;  4US8 A;  1T3Q A;  1RLF A;  1VD2 A;  2GMI C;  4HJK A;  1LFD A;  3M3J A;  5G55 A;  2K9X A;  4AQ7 A;  3DCG A;  1TYG B;  1BT0 A;  4DHJ B;  3L08 A;  3WAP A;  1FO4 A;  3M62 B;  3UIO B;  2NBW B;  2PW9 A;  4AUQ C;  2M8S A;  2J42 A;  1JCK B;  2KQS A;  1JML A;  4Q2J A;  3O13 A;  1JWA D;  3IT4 B;  1UH6 A;  2W3R A;  4WJP A;  4ZRI A;  3ZVV A;  3GOE A;  3UIN B;  1V1P A;  5DCN A;  2WLB A;  4MGK E;  1JQ4 A;  1UUP A;  2ZVO A;  3RN9 C;  4G3X B;  3X0W A;  3B2F A;  3OJ4 B;  4LNN A;  2ZW0 A;  2G3Q B;  4DXF A;  1UWM A;  2M0X A;  4LNO A;  3OAW A;  2FIF A;  3PLU A;  2J0J A;  1HZ5 A;  2GLS A;  2JWZ A;  2NMQ A;  3BYT B;  2BBC A;  3AU4 A;  4RGM A;  4JE3 B;  3ZW3 A;  1R4M B;  4JIO U;  3DPD A;  1DOX A;  2N7D A;  4NJ7 A;  2ACZ B;  4ZYN A;  2RDH A;  1WE6 A;  4ANU A;  3AEF B;  1C3T A;  1ZUD 2;  4HK2 A;  3UI3 A;  3VTV A;  3A1Q B;  4MSM B;  1L7Y A;  4DWF A;  1C4P A;  1SE4 A;  3A4R A;  2KWU B;  1SB3 C;  2IGD A;  1ZOY B;  1WGY A;  3W1Y A;  2DZJ A;  3VFK A;  4YTM B;  2LJ5 A;  3L17 A;  2LGI A;  2KNB A;  3TEY A;  4OVZ A;  2Z0E B;  3RNG C;  2MH7 A;  4DHZ E;  3RD2 A;  3NG0 A;  1WM2 A;  2M0A A;  2G45 B;  2AL6 A;  4GOC A;  3DDC B;  2Y5C A;  2Z59 B;  4YTP B;  2MBE A;  2BB5 A;  1C4A A;  1DOI A;  2NPT A;  3BII D;  5BYQ A;  1FCC C;  1K53 A;  2WDQ B;  5C3J B;  1A70 A;  3APD A;  4IW0 A;  2NTS A;  2DZM A;  2O6V B;  4ZRJ A;  2ICI A;  2PE9 A;  2VZK D;  3R66 C;  4HDQ A;  4IM3 A;  4US9 A;  1SE9 A;  3DOW A;  1SF0 A;  2CU3 A;  3H1U A;  4ZYS A;  4IWP A;  3ZNG C;  1P3Q U;  4TSS A;  2WHI A;  2PVG C;  2VRR B;  1LGR A;  4W9D A;  2JX5 A;  1CZP A;  2BKF A;  4EUT A;  1V2Y A;  1BUI C;  4HPL B;  1KH0 A;  3IG3 A;  1T0S C;  2Y5P A;  1GB1 A;  2IGG A;  1T0Q C;  3AMZ A;  1F52 A;  1XLP A;  1GB4 A;  1DYQ A;  2ONQ A;  2QIE B;  3PGE A;  3ONS A;  4YL8 A;  3LXF A;  2DAF A;  2MBO A;  1SJE D;  2RDB C;  1TS4 A;  1PGX A;  1WYW B;  2EMS A;  3ZO5 B;  3E9S A;  4A3P A;  2WDR B;  4XWW A;  4KGT A;  5D94 A;  1LO5 D;  3MP9 A;  1L5P A;  3DBH I;  1YN3 A;  3H7P A;  3ZXV A;  4A90 A;  1OTR B;  2L32 A;  1MG4 A;  4HJG E;  4RFB A;  4W9G A;  5I4D A;  3PT2 B;  3PS6 A;  2J53 A;  3VHT C;  3EUB 2;  2K39 A;  4FHJ A;  4P7I A;  2QEJ C;  3N1X C;  4M0W A;  2AWT A;  4DK5 A;  3M95 A;  1WGD A;  2L00 B;  3KWV A;  4JGH B;  2QIL A;  5D3I B;  3VVW B;  3Q8F A;  1Y56 A;  3VRA B;  4NQK E;  2GBN A;  3K9P B;  2PJH A;  2O2V A;  3DBR B;  4OZC A;  3SFD B;  3VUW A;  3BK1 A;  1FFV A;  1UGJ A;  2BS3 B;  2WXP A;  4CHK A;  1V8C A;  3P1M A;  1QOA A;  3AM9 A;  4A3O A;  4HWI B;  2LWP A;  2LZ6 A;  4QAY A;  2ZCB A;  4II3 B;  2BYT A;  3VH4 B;  1KOT A;  2JU6 X;  4IM0 A;  1WGR A;  3ZIM A;  3AEC B;  1NI2 A;  3P4S B;  3W5V B;  4ZRQ A;  4E3C A;  2KAN A;  3V62 A;  4NAW A;  5LNK 1;  5G5H A;  5BMH A;  3AE8 B;  2REX A;  1ZKH A;  2MLB A;  4M8N A;  3TL5 A;  1SJH D;  2JT4 B;  1LQB A;  2KYW A;  4W9L A;  3FKY A;  2LI5 A;  4HRO A;  1YN4 A;  5BYS A;  5HG2 A;  2KK8 A;  3V60 A;  4WWN A;  3D32 A;  1WSP A;  3R8B A;  3T3O A;  2XBB C;  4DBG A;  4GN1 A;  2MJE A;  4DHZ B;  3R2T A;  2WP9 B;  3HK0 A;  3MHZ A;  2RPQ A;  1SSN A;  3VDZ A;  1WJ4 A;  3L13 A;  2CU1 A;  4EFO A;  1KLU D;  2LJI A;  4YSY B;  1DGJ A;  3ZJU A;  3I63 C;  3Q8E A;  2KT7 A;  3Q3F A;  3IAS 1;  2WXK A;  2KFK B;  3AE9 B;  4BAX A;  2PPH A;  1I42 A;  4GDK A;  3K9O B;  2K6Q A;  2JWU A;  4J6I A;  2RD0 A;  4XWT A;  1P9D U;  4ARC A;  4OZB A;  1EO6 A;  2KDM A;  1I4X A;  2LHE A;  2I1J A;  1MG8 A;  1C78 A;  1Q1O A;  3GP7 A; 
#chains in the Genus database with same CATH homology
 4LDT D;  4TV3 A;  2KXJ A;  4X57 B;  3VUY A;  3O65 B;  4HCP B;  1J8C A;  4LJP B;  4NY0 A;  1YD8 U;  3ZTD A;  4BKS A;  5LXH A;  5LXI B;  1UBQ A;  3U30 A;  2C7N B;  2MBB B;  3JSV A;  3PVL A;  3QAQ A;  2NS5 A;  2DZK A;  3TCA A;  1D3Z A;  2KLC A;  3NY5 A;  4HDO A;  2IBI B;  1J0G A;  2IY0 B;  2LGX A;  3PHW B;  2MBH A;  1UGM A;  2LD9 A;  3T9L A;  5IA7 A;  5GMV A;  2V1Y A;  5DPS A;  1R4N I;  4W9F A;  3PRM B;  2V3S A;  4ANX A;  4EZJ A;  1V81 A;  3EFU A;  3IBE A;  2KJH B;  4BKT A;  2B3A A;  4KZC A;  4W9I A;  3UIP B;  3PSE B;  2MWS B;  1JRU A;  3L10 B;  3NHE B;  2DZI A;  3KVF B;  4MM3 A;  3W1S C;  1EF1 A;  3V6C B;  5EDS A;  1L2N A;  2KDE B;  3GZN I;  2JPH A;  3V6E B;  4BBN C;  3RT3 B;  3JVZ X;  2MSE D;  5JHA A;  2XK5 A;  1OEY A;  2LUE A;  3PRZ A;  4BOS C;  1E8Y A;  3SHQ A;  3MJW A;  3N3K B;  1H8C A;  4KSK C;  3AU5 A;  2LAS A;  3DVN V;  3L54 A;  2JY6 A;  2KFK A;  2J0K A;  2CKH B;  3QWZ B;  4EOY A;  4KSL C;  4EZL A;  5DPR A;  4W9E A;  4B9K A;  2KWV B;  3EC8 A;  5E6N A;  3PZD A;  2BF8 B;  1Q0W B;  3APC A;  1V5O A;  3A9K B;  4WAA A;  3WAO A;  1RAX A;  1EF5 A;  2WX0 A;  3WAN A;  2BWF A;  1KJT A;  2KOX A;  2MX2 A;  1CMX B;  2D10 A;  2CHW A;  2LVQ A;  4GDK B;  4FJZ A;  2DX5 B;  2M4N A;  5E6O A;  2KQ7 A;  2R2O A;  5KHQ A;  3QX1 A;  2PEA A;  3QA8 A;  4LJO B;  2FID A;  2NBU A;  5CX3 A;  2MQJ A;  2MP2 A;  2ZPY A;  4HPM B;  1XD3 B;  2ZPN A;  2KD0 A;  3N30 A;  3QJZ A;  1UZX B;  2JVC A;  2GBR A;  2PE6 B;  3AI5 A;  5CHW A;  2C7M B;  1UBI A;  2ZJD A;  2FNJ B;  3DBS A;  1RLF A;  3S2A A;  2KFJ A;  4KDL B;  2L76 A;  1VD2 A;  2N4F A;  1YX5 B;  2GMI C;  4HJK A;  1LFD A;  4ICV A;  3A1Q A;  3M3J A;  2GOW A;  5G55 A;  3DCG A;  1BT0 A;  4N9F 4;  3L08 A;  4DHJ B;  3WAP A;  2CS4 A;  3AXC A;  3M62 B;  3JSV B;  5CHV C;  2EKE C;  3UIO B;  2IO1 B;  5L95 C;  4WJN A;  2NBW B;  4AUQ C;  2N1W A;  2D07 B;  3AUL A;  2DEN B;  2C5L C;  2M8S A;  2LGD A;  2JUO A;  2C60 A;  2J0M A;  2KQS A;  5BO4 B;  2MCN B;  3W1S A;  3UQB A;  4G11 A;  4KIK A;  4IWQ A;  4PS3 A;  2WX1 A;  2CHZ A;  2AL3 A;  4RM8 A;  1SGH A;  1UH6 A;  4F8C B;  1LM8 B;  4WJP A;  2XK5 B;  4IWO A;  4ZRI A;  3A33 B;  2UWQ A;  4TUU A;  3ZVV A;  3GOE A;  3UIN B;  2N7E A;  3ZNZ B;  3CF6 E;  5DCN A;  4FAD A;  5E6P A;  3PTF C;  1Z2M A;  1WX7 A;  3KUC B;  4NJ6 A;  2RSU A;  5CTR C;  2FAZ A;  2L05 A;  2L8J A;  4MGK E;  1E90 A;  4ANW A;  2L7R A;  2ZVO A;  3P2B A;  4RMA A;  3WAM A;  4G3X B;  3X0W A;  3U7D A;  3ML8 A;  1AAR A;  3LJ3 A;  2KZR A;  3OJ4 B;  2K8C A;  3M63 B;  1P1A A;  5FR6 A;  4ZDV A;  2G3Q B;  2C7H A;  4G0N B;  1WFY A;  3DVG X;  2KJ6 A;  2JF5 A;  4XX5 A;  5LLI A;  3JYU A;  4JQW C;  2M0X A;  4K81 A;  3VQI A;  3WAL A;  2Y5B B;  1NBF C;  3OAW A;  2FIF A;  1IPG A;  3JW0 X;  3PLU A;  2J0J A;  1YQB A;  4BKG A;  4KZ0 A;  3I3T B;  2JWZ A;  2MP2 B;  3ENE A;  3AU4 A;  2K8H A;  3CSF A;  4MGZ E;  3VUX A;  4BVU C;  2MW5 A;  2O6V A;  4K1R B;  3ZW3 A;  1GNU A;  3B08 A;  3ALB A;  2K6D B;  3DPD A;  4JIO U;  1Q5W B;  2N7D A;  4NJ7 A;  2JZ3 B;  2KKC A;  3H9D A;  2L3Z A;  2KO3 A;  4PS8 A;  4ZYN A;  4E71 A;  1WE6 A;  1H4R A;  4ANU A;  2GBJ A;  1UEL A;  1Z5S B;  3R7R A;  1F9J A;  4MGY E;  4IG7 B;  4AP4 C;  1C3T A;  4HK2 A;  3VTV A;  2NCN A;  4KDI C;  1WZ0 A;  3WIM A;  3A1Q B;  1EUV B;  4MSM B;  5L83 A;  2R2Q A;  2D11 A;  1L7Y A;  5TR5 A;  4DWF A;  3A4R A;  2KWU B;  4TQ0 A;  3DBL I;  3IHP C;  2BYF A;  4II2 B;  4JL9 A;  3TJP A;  1WGY A;  3VXW A;  3DBR I;  3W1Y A;  2DZJ A;  4ZRK A;  2HD5 B;  1E7V A;  3VFK A;  2G4D B;  3KUD B;  3QIJ A;  2LJ5 A;  3L17 A;  2K1F A;  4IUM B;  3QHT A;  4KIK B;  4MEM A;  3H6N A;  2KVR A;  4MGI E;  2KNB A;  3NZS A;  4WJQ A;  2C9W B;  2Z0E B;  5AZH A;  5JH5 C;  3MTN B;  5D6J B;  2DAJ A;  3ZKJ C;  2N9X A;  5KHO A;  1WJ6 A;  1X1M A;  3N32 A;  4DHZ E;  4E74 A;  3RD2 A;  4AJY B;  2OJR A;  1WX8 A;  1WM2 A;  3Q3J A;  2BGF A;  2G45 B;  1RRB A;  2AL6 A;  2V4L A;  1V5T A;  3DDC B;  4GOC A;  2Z59 B;  2GBM A;  4MEL A;  3HM3 A;  4NQL B;  2MRP A;  2MBE A;  3MHS D;  1TGZ B;  4JLC A;  1NDD A;  1WGH A;  1YJ1 A;  2ASQ A;  2NPT A;  2W9N A;  2ZNV C;  2IO3 B;  2NBV B;  2KTR A;  3RUI B;  4EEW A;  1S3S G;  3U8Z A;  3OLM D;  1M94 A;  2ZNV B;  2ZZP B;  1FXT B;  4HLE A;  1P98 A;  3UQA A;  1WH3 A;  1WRD B;  4K7U A;  3APD A;  4DXA B;  1PQS A;  3H7P B;  1V9J A;  1WM3 A;  1V6E A;  1V80 A;  2KC2 A;  4FN2 A;  4IW0 A;  3HM6 X;  4TKN A;  5AZF A;  3VTW A;  2K8B A;  2DZM A;  3CMM B;  2O6V B;  4ZRJ A;  2PE9 A;  3R66 C;  4HDQ A;  2IYD B;  4IM3 A;  3SD5 A;  5HKH A;  1SE9 A;  1I35 A;  3DOW A;  4DDG D;  2CHX A;  3H1U A;  3RZW C;  4IWP A;  2GBK A;  4B6W A;  3ZNG C;  2DYB A;  1IYF A;  1P3Q U;  4FJV B;  1S1Q B;  3ZRF A;  1GJZ A;  2VRR B;  4MH0 E;  3BIN A;  4GU2 A;  4W9D A;  2RR9 A;  5C1Z A;  2BKF A;  5JZE B;  2LVO A;  3OJ3 A;  2LRU A;  4EUT A;  1V2Y A;  3ZTC A;  4HPL B;  3PHX B;  3IG3 A;  2KX0 A;  2G4S A;  3IVF A;  4AJW A;  1WMH A;  1ZW7 A;  2O2V B;  5J18 A;  2AEH A;  1WJN A;  3TIX A;  2LXA A;  5D7G A;  3RYT A;  3VAW A;  1UD7 A;  1V49 A;  2IO0 B;  4WWP A;  2UYZ B;  1OGW A;  3QK0 A;  3C0R B;  3NZU A;  2JRH A;  4BOZ B;  3PGE A;  1GUA B;  3ONS A;  1WGG A;  2K25 A;  4I6L B;  2DAF A;  2MBO A;  2L0F A;  4YL8 A;  1E8X A;  1ZGU B;  4DHJ D;  4HCN B;  4ASW C;  2FCM A;  1WYW B;  2EMS A;  3ZO5 B;  4A3P A;  3B1L X;  4LDT B;  3PV1 A;  3ZNI D;  1TZ1 A;  3UF8 A;  1LXD A;  5D94 A;  1GC7 A;  5AZG A;  1Y8R C;  2NPT B;  3TBL D;  2KTR B;  1WI0 A;  3DBH I;  3NS8 A;  2WDT B;  3H7P A;  4GDL A;  1OTR B;  1T0Y A;  1TBE A;  2KDB A;  3DVG Y;  3EEC A;  2D3G A;  4W9G A;  3ZDM C;  4IM2 A;  2IY1 B;  2KN5 A;  3PT2 B;  3PS6 A;  5C23 A;  4CYE A;  1K8R B;  3VHT C;  3RZF A;  2K39 A;  4FHJ A;  4P7I A;  4W9C A;  4WJO A;  3UGB B;  1QZE A;  2M1M A;  2AWT A;  3ECI A;  4W9K A;  4TQ1 A;  2JXX A;  4XZ4 A;  2ZEQ A;  4F7Z A;  5DPW A;  4DK5 A;  2WWZ A;  1A5R A;  4OVV A;  1HE8 A;  3CST A;  1WGD A;  2L00 B;  3M95 A;  2HTH A;  5DPT A;  4JGH B;  2IO2 B;  1P0R A;  3LDZ E;  2KMA A;  3VVW B;  4MDK E;  4MJS B;  3ZNH B;  4PYZ A;  1WX9 A;  3KYC D;  4DDI D;  4URK A;  4NQK E;  1WXA A;  3KH0 A;  1WE7 A;  3ML9 A;  3QQ8 B;  1SIF A;  4G50 A;  4WWO A;  2GBN A;  3QC8 B;  4CO7 A;  3K9P B;  2PJH A;  3NOB A;  2O2V A;  1GC6 A;  4GSW A;  4FUL A;  1XT9 B;  5IAA C;  4ANV A;  3QCA A;  3VUW A;  2KMC A;  3A9J A;  4GMV A;  2CR5 A;  5JHB A;  4RM9 A;  2N9P C;  3H7S A;  1WMH B;  1WR1 A;  4CHK A;  2FCS A;  4BFR A;  4PYU A;  3ZDT A;  1IP9 A;  4I6P A;  4FBJ B;  5J2R A;  3DQV A;  4K7W A;  4OVU A;  3APF A;  3V61 A;  2EMT A;  2BKR B;  4GXB A;  4HWI B;  4A3O A;  3EHV A;  3PRE A;  2A5U A;  2LVP A;  2JZZ A;  2FUH B;  2BWE S;  2LWP A;  2LZ6 A;  2ZCB A;  4II3 B;  2FCQ A;  5CHF A;  3VH4 B;  2L0T A;  1KOT A;  3B0A A;  2HE7 A;  4IM0 A;  2KDI A;  1WGR A;  5J17 A;  3ZIM A;  3ZUN A;  2KDF B;  3KW5 B;  2A4Z A;  2WYQ A;  5AEK B;  4I6N B;  4KV2 A;  3RCZ A;  3DVN U;  1NI2 A;  4HVB A;  2NR2 A;  3VTU A;  2DYO A;  3BY4 B;  3ZRC A;  2I1K A;  3KUZ A;  4WQO B;  2KAN A;  4E3C A;  3V62 A;  4NAW A;  4AOF A;  1WIA A;  1WJU A;  1OQY A;  2HJ8 A;  4F1S A;  4FLH A;  4GDL B;  4NNJ B;  4W9J A;  5G2N A;  2REX A;  1RFA A;  1WF9 A;  1ZKH A;  2MLB A;  4M8N A;  2KX3 A;  2BYV E;  3QAR A;  3TL5 A;  4EKU A;  1OEY J;  1C1Y B;  1WR6 E;  2MBQ A;  2LXC A;  2LRW A;  2KC1 A;  2JT4 B;  1E5W A;  1LQB A;  3A4S C;  4M0W B;  1WXS A;  4MJS A;  2KLG A;  4M8M A;  4W9L A;  2LI5 A;  4FHK A;  3IFW B;  1E8Z A;  3L0W B;  3R3M A;  2KWC A;  2ZVN A;  2DHZ A;  3L16 A;  4GGQ A;  2KK8 A;  1KM7 A;  3V60 A;  1G6J A;  3RUL A;  4WWN A;  2YLM A;  4FA6 A;  3D32 A;  4NPN A;  2BPS A;  2Z0D B;  2J7Q B;  2JRI B;  4W9H A;  2XBB C;  1J19 A;  4DBG A;  4GIV A;  4GN1 A;  2M17 A;  4GB9 A;  4DHZ B;  2IZV B;  3TMP B;  4IC7 B;  3A9J B;  2OOB B;  3HK0 A;  4KVG B;  2O6V D;  2KTF A;  1E7U A;  3X23 A;  2RPQ A;  2ZCC A;  3KYD D;  4BBN F;  2D2Q A;  3VDZ A;  1E8W A;  1WJ4 A;  1V86 A;  3L13 A;  2CU1 A;  4BKS D;  4AWJ A;  1VCB A;  4EFO A;  1WZ3 A;  1KLV A;  3PRP B;  1WXV A;  3SU8 X;  4LCD E;  2DYM A;  3PLV A;  1WXM A;  1YIW A;  2MA9 B;  2NVU I;  2KHW B;  2QHO A;  3Q3F A;  1U4A A;  3A9K A;  2N9E B;  3SDL C;  2KFK B;  3HHM A;  2BYE A;  2KJR A;  2YVC A;  1GG3 A;  4HXD A;  2PPH A;  1I42 A;  4XC2 A;  4GDK A;  3K9O B;  2K6Q A;  1XQQ A;  1TTN A;  4NAW B;  4J6I A;  1WY8 A;  4ICU A;  2RD0 A;  3WA0 A;  1P9D U;  1YX6 B;  3PPA A;  1ISN A;  3ZLZ A;  4B95 A;  2N1V A;  3HIZ A;  3VH3 B;  1EO6 A;  4A20 A;  2LGY A;  3T8M A;  3R7Q A;  2AYO B;  2FCN A;  4K7S A;  1R4M I;  4MSQ B;  2RGF A;  2I1J A;  5D2M B;  4EZK A;  1MG8 A;  4PS7 A;  1Q1O A;  4FJY A;  2XEW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...