4A90A

Crystal structure of mouse sap18 residues 1-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
131
Chain Sequence
ESRVTQEEIPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
total genus 29
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a90A00
4A8XC 4A90A 4A6QA 2HDEA
chains in the Genus database with same CATH superfamily
4II3B 2JX5A 2GBNA 2A4ZA 1N5WA 1Z2MA 3ZRCA 2WXNA 1WZ3A 1J7CA 4BZAA 3AE7B 4TMAB 5MPOA 5DPTA 4BKSA 3DVGY 3QX1A 2XNAC 3V6CB 1KOTA 4OZAA 1E8XA 3M3JA 2NMQA 1KLUD 2NBVB 2N0SB 3V05A 3PTFC 1VLBA 1V2YA 2N9KA 3NJTA 4MM3A 1Y56A 1JWBD 3ECIA 2KJ6A 4N59A 2ZEQA 3L54A 1I4GA 2K3UA 4IM3A 3SHQA 1FCLA 2WXIA 3RN9C 3JYUA 3DCGA 1DOXA 3RNFC 2NS5A 3EECA 3W9CB 4XWWA 1WJNA 2IZVB 3WAPA 1SSNA 4J3OD 3A4RA 3H6NA 2WU2B 3I9V1 3ZQ4A 1VZ6A 3P2BA 1IPGA 2KVZA 2MBOA 2BTEA 1ZE3D 3H9DA 1X1MA 4GN1A 3DPDA 2HD5B 1NYQA 3W1YA 2WXGA 2QCZA 2L7RA 2KD0A 3ZKJC 1UELA 2CJOA 4N9F4 1EU3A 1VCBA 2ZW1A 3GP7A 5BMIA 2J52A 3ZW3A 4GU2A 4BOSC 2KYWA 4WIPA 3NZUA 5E6PA 1ET9A 4WAFA 2MBBB 4IG7B 3RD2A 1P9DU 3AULA 5CTRC 3P4QB 2NBWB 3PSEB 1ZXHA 2KJHB 3BINA 4E74A 1CK1A 1D5XC 1NI2A 2DWQA 3OJ4B 3N9YC 2MJEA 1XO3A 3MTNB 3SDLC 1D3ZA 3BVGA 2V3PA 5HKHA 1C4CA 1IBXB 1ZKHA 3BIID 4LK0M 2MJDA 4HPPA 1DOIA 2R61A 4ZHOA 2MW5A 4USAA 3A9JA 2LD9A 3HVZA 4KZ0A 4DXGA 3MHSD 1TZ1A 2E3TA 1KH0A 2RMMA 2OOBB 2NCNA 1KLGD 4XWTA 1GOZA 3VTVA 2M1MA 2WXMA 3PZ7A 4A3OA 2XBBC 4LTUA 2JY6A 2AWTA 2JWUA 2R2OA 1E8YA 4HPLB 3AXCA 3ZRFA 3ZJTA 4C00A 4MDKE 3KQ4A 3O65B 2KTRA 2WXRA 3DBRI 3P1MA 1YN5A 2ICIA 1J7BA 1E10A 3TSSA 2HDEA 2A5UA 2O6VA 3QK0A 3U4EG 3BZDB 3Q8FA 2KDBA 5KHQA 1QOAA 1NYRA 4B9KA 2MH7A 1WFYA 4EOYA 4PYUA 2LRUA 1TIFA 2KLCA 3U52E 2J42A 3RULA 5FK9C 1V1OA 4KDIC 2N9XA 1GJZA 1T0YA 3RNAC 2LVPA 4F7ZA 3IG3A 1IBXA 2Z0EB 5EE3A 1WE7A 2JWZA 4DHJB 2LGDA 1RFAA 2KMAA 1EF1A 2Q5WD 2RPQA 3PO0A 2LUEA 5IN7A 4JIOU 4NQLB 1IGDA 3U7DA 1LO5D 2AL3A 2KWDA 4HKQA 1E0ZA 3PRMB 3TJPA 2WYQA 4DBGA 4DHZE 1SF0A 4HWIB 3AH7A 5JHAA 3UINB 3W1SC 4K3BA 4AUQC 1T0SC 1T3QA 2RDGA 3A9JB 3A9KB 2BQQA 2H89B 1VR9A 2PPHA 3M95A 2RDBC 2FCQA 1MG8A 4PK1A 4HJGE 1VZ7A 4WQOB 5L95C 3MJ5A 2DZMA 3Q3FA 2NTTA 1E8ZA 3R7RA 3WA0A 3NVZA 3P63A 1J7AA 1Q0WB 3KUCB 3QARA 2ZNVB 1QZEA 1K50A 1UBIA 4BBNF 4JWSC 2IGDA 1CQVA 2PJHA 3Q2AC 4O1NA 3X0WA 1WX8A 1ESFA 3AEAB 1YJJA 2ZVNA 4CYEA 3ZJUA 1UWXA 1HZ6A 4OW0A 1EWYC 2RSUA 1E8WA 1RRBA 1RAXA 2ACZB 2BYEA 4FJYA 4K7UA 2M0XA 2KOXA 1F77A 2J0KA 4S17A 4GOCA 3QJZA 2HE7A 2D2QA 2BVCA 2MSED 4JLCA 3J9CA 2G4SA 4L23A 3W2DA 1L4DB 2FIDA 3TL5A 4EEWA 1WGKA 4YSXB 3ML9A 1MJDA 3U30A 4MH8A 5AZFA 4P1CC 1WM3A 2Y3AA 2J0JA 3BY4B 1KRHA 4PT5A 1XEEA 3UIPB 1GNUA 3P4SB 2ZPNA 1HTOA 1GG3A 3VR8B 1FD6A 1C9FA 2ONQA 1ROEA 2C9WB 3WALA 3ZTCA 3BYTB 2KMMA 4A55A 3VTWA 3D32A 1SGHA 3ZDTA 2KQ7A 5AUIA 2KX0A 2ZCCA 1R7SA 3H8HA 3N1XC 3UIOB 2ZVOA 3JW0X 2O6VD 3FKYA 1FFUA 3ETRA 2LHEA 2INDC 1YN4A 2H88B 1I4PA 1WXVA 4W9EA 1YX6B 4XZ4A 3EGRA 2WWZA 2EKIA 1QOFA 2K25A 2MRPA 2DX5B 2QHOA 2JF5A 4DHZB 1QQRA 3C19A 3EFCA 3URYA 1FXAA 3L17A 2AL6A 3A1QB 3RUIB 2KLGA 3WAOA 4WQMA 4ANVA 5DCNA 3GE3C 1E9MA 2BB6A 2KZRA 1T0QC 3UGBB 4EFOA 3AEGB 3NY5A 4RM9A 3AU5A 3OWEB 1C77A 3APCA 5D94A 1IYFA 1T0RC 2INPE 1V97A 3DVNU 2KNBA 1TKEA 2KDFB 1BXTA 4A6QA 4ARIA 1FPYA 1RYJA 1TTNA 4AOFA 4URKA 2I1JA 5T8IA 2R2QA 3RPFC 5D3DA 4BKGA 1XD3B 2UU7A 4W9CA 3EC8A 4YTPB 4EUTA 2DZJA 1F2RC 4K7SA 2OEDA 2V3NA 1YJIA 1TY0A 2WU5B 5EE9A 3TBLD 2X38A 3NVWA 1WYGA 5IOIA 4IW0A 1P0RA 3BK1A 2AQ3B 3TUOA 2EELA 3H7SA 3R2TA 5HFYA 2KMCA 2CU1A 2AYOB 4TSSA 2Y5BB 3IHPC 4GDLB 3L08A 2HTME 4DWFA 1E7UA 4GGQA 1C1YB 2RD0A 2BW2A 4CQNA 1KFYB 2GOWA 4ZOHC 3DVGX 1YMHE 1WGGA 3AMZA 1I35A 1WF9A 1MI0A 3LDZE 4EZKA 2GB1A 3P4RB 1RWSA 3A9KA 3KUDB 2NR2A 4AS1A 5FR3A 5I4DA 1Q5WB 1ET6A 1MG4A 5CHWA 4NAWB 1V81A 2CJNA 3KH0A 5IAAC 3R7QA 2FCNA 1GAQB 3L4PA 1YJ1A 2AEHA 2L32A 2MHJA 2ZCBA 1PFDA 3TEXA 2M17A 1UH6A 3IXSA 4FADA 3Q3NC 1KJTA 2O2VA 2LGYA 2G3QB 1TT5B 1AYFA 1WJ6A 4HVBA 2IO2B 4RGMA 4MELA 5TR5A 2UWQA 1WRIA 1ZGUB 1V5TA 5JZEB 1DOYA 3B08A 1WMHA 3DWGC 2JT4B 2FUG1 3AE1B 1D6EC 3KWVA 4K3CA 4RNAA 1HQRD 3V60A 2KTFA 1WZ0A 4EZJA 2DAFA 2KQSA 2LHDA 2KDEB 5EDSA 3Q14C 2J7QB 1JALA 1IUEA 1F9JA 1SE9A 2WX1A 4L1BA 1YQ4B 2KFJA 2N7DA 1UBQA 1SJED 1TGZB 4A9AA 3PHWB 4JGHB 3ENEA 4JQWC 4MT5A 2ZNVC 5KHOA 1YOVB 3JVZX 3AECB 2JZ3B 2YVCA 4B95A 1YD8U 4K81A 4W9JA 5D2MB 4JPSA 2HJ8A 4L2YA 2LUMA 2KO3A 4A8XC 3ZVVA 4XE0A 4FBJB 4WURA 1N60A 2KXJA 2VH2A 1L7YA 4JE3B 1I4XA 2QC8A 4RGOS 3WCQA 1E7PB 3AM9A 3X23A 5LLIA 3ZXRA 1SBBB 2VH1A 4YSZB 2PE9A 3CMMB 1EU4A 4GLSC 1UWMA 3IBEA 1OGWA 4ANUA 3GZNB 1YNTE 4DQOC 1V1PB 3Q3OC 4B0MA 4LCDE 1C78A 1HTQA 3ZNHB 1M94A 4D2KA 2KKCA 1L6VA 1V80A 4TQ0A 1XLPA 2WXQA 3QCAA 1JWAD 1C3TA 1J0GA 2HJ1A 2N1WA 1SXTA 2IBIB 1UUPA 4ZDVA 3VVWB 2Z0DB 4A20A 1K53A 3L0WB 2V9HA 2LGXA 4MGYE 1BMLC 3IAM1 1K8RB 4WJNA 3AE4B 3MFGA 1KF6B 1I42A 2K8CA 4ZRIA 2NTSA 3WIMA 2WHIA 4WWMA 5DPSA 2M56B 2YEPF 2LI5A 2MBQA 5G2NA 5CX3A 3RMKC 1WJUA 2L52A 2IGGA 1KLVA 1H4RA 1ISNA 4M00A 1B1ZA 4XGAB 4FULA 2D07B 3L16A 2J4XA 3LYYA 2MBEA 1TS3A 3KVFB 1RFKA 2XK5B 3EUB2 2IO1B 3APFA 4K7WA 2L05A 4W9FA 2JRHA 2JYTA 3NS1A 3H7PA 4NZLB 1V1PA 1TS5A 3RT3B 1WIAA 5IKCM 5C23A 3DVNV 3Q69A 5LXIB 5JHBA 1JCKB 1N5XA 4IWPA 2BKRB 4HCNB 4PS3A 1E90A 5TSSA 3NZSA 1HXYD 1N63A 2D3CA 2W82A 3KUZA 4WWNA 2K8BA 1TYGB 2QEJC 2DAJA 1NEKB 3A33B 3DBHI 5IP4D 2KFKB 2RDHA 1FRRA 1S1QB 2N9EB 2XN9C 3DOWA 3Q3JA 4KKIA 3GB1A 3ZYYX 2BT6A 4RF0A 1F52A 4M0WB 2KTRB 2Y5PA 3ZTDA 5BYQA 1UF0A 4LJPB 1VJKA 2INCC 4FN2A 2O6VB 3ZJVA 2N7EA 5E6OA 1HE8A 1QOBA 3FILB 2DZKA 3IT6B 3AEDB 2JSVX 3PPAA 4ZHPA 2D3BA 3ZUNA 1QF6A 2KDIA 2MA9B 3C8YA 3E9SA 4NJ6A 3KLSX 2B76B 4BFRA 3B2GA 4MEMA 1MFWA 1V8CA 3JSVB 4XC2A 2W3RA 2K6QA 1LM8B 3E56A 1LFDA 1KTKA 2QSDA 3RZFA 4PS8A 2REXA 2WLBA 1TJEA 2W9NA 4X57B 5JH5C 2NPTB 2KT7A 5HG2A 5CHVC 4QAYA 2KAJA 1KM7A 4W9DA 1CJEA 1SJHD 4ZYNA 3ZNID 4NQKE 2G1EA 2N7JA 1WXAA 1DYQA 3V62A 4W9KA 2N9LA 3PLVA 3SU8X 4LNFA 4GDKA 5JXVA 2JPHA 4WJPA 2N4FA 4GXBA 1L0YB 3TEWA 4RGTA 4KSKC 1ZDXA 1JW9D 3ZNZB 3VUXA 1LXDA 1K52A 1OEYJ 4DK5A 1TBEA 4CO7A 3NZ3A 2TSSA 1WWTA 3RYTA 1MVKA 4JX1C 1R4NB 1CZPA 5C2TB 4G50A 2RGFA 2DNFA 4P7IA 2LVQA 3FILA 1E6EB 2M4NA 3RNCC 3L10B 2CS4A 5HI1A 5G55A 2BPSA 1I4QA 1WGDA 2E6XA 1JROA 2D3GA 4OZBA 1NVID 1V86A 4AJWA 5IO9A 2EMTA 2VZKB 1HA5A 2BYVE 1XLOA 4H2AA 5FKAC 3U8ZA 4LNOA 4ZRJA 1QOGA 3VXWA 2WXLA 2L0TA 2M0AA 5D7GA 1J8CA 4GB9A 3DHHC 3VQIA 3BK2A 3APDA 4S0RA 4ANWA 3NHEB 4EE2A 1J19A 3OLMD 1XLQA 2KANA 4F1SA 1MHXA 3MJWA 3BVMA 2PLPA 1PGXA 2KC1A 2V3SA 5BMHA 4LDTD 4RM8A 1ZPSA 2L3ZA 4AQ7A 4GDKB 3AB5A 4WAAA 2V4IB 1WX7A 4BAXA 1L0XB 1C4PA 3I57A 4C4VB 2O2VB 3PLUA 4RH6A 5H92C 3VAWA 1E5WA 4W9GA 2VZKD 3NUHB 1Z5SB 4FJVB 1TZOA 3AE6B 3AE2B 2Z8LA 1WE6A 3CIRB 4P6VF 3M63B 2GBJA 2LEKA 4WH4A 5LXHA 4NPNA 2M19A 1NBFC 3VRAB 4P16A 4BKTA 3MC0B 3PS6A 1P7EA 2FBWB 1WM2A 1FNVA 2IO3B 3R2IA 2WDQB 3GE8C 4C7ZA 4BKSD 2OJRA 3N32A 5G5GA 4HPMB 4M0WA 1EUVB 3AN1A 4LDTB 4DDID 2PEAA 3FC4A 2OJWA 4LJOB 3TMPB 2IDYA 3SFEB 1P98A 2GMIC 3VHTC 2IGHA 3DBRB 4W9HA 3KYCD 1EM7A 2FE8A 3L13A 4LNKA 4BVUC 1FNWA 2QMTA 4LLGM 1N61A 2WXJA 2BYTA 5J18A 2OHFA 1V9JA 5EE0A 1GC7A 1FO4A 4G3XB 2K39A 1TKGA 1PGBA 2I2YA 4HKZE 1EO6A 3ALBA 1OQQA 1VD2A 3QIJA 2JVCA 4KVGB 1TS2A 1WJ4A 4ITKA 4IM0A 4M02A 3M62B 3TEZA 1GUAB 2DENB 3ZLZA 3CWIA 4J6IA 4CHKA 4LNIA 4P1BC 2KWCA 2NVUI 3V3XA 2X8XX 3SEBA 1P1AA 3B2FA 1PYWD 2DHZA 3UQAA 3KYDD 2N9PC 2J0MA 3NOBA 3T3OA 5J17A 2K6DB 2SEBD 1SE3A 2K5PA 4I6NB 4EKUA 2RR9A 3NS8A 1GB4A 4HLEA 4M8MA 2PVOD 5LNK1 2IJ0A 4HJKA 2DZIA 1F1HA 4II2B 1SB3C 2GLSA 1YN3A 2CU3A 5E6NA 1GPXA 2GBMA 3O13A 4RCOA 2K9XA 2MEKA 4M01A 2NBUA 1WX9A 2WXPA 2JUOA 3NVVA 3IFWB 3N3KB 2BWES 1S3SG 1TS4A 1FRDA 2KN4A 1EWCA 1BT0A 3IT4B 3RFZB 5G5HA 2CHXA 1SEBD 5FR6A 1Q10A 3LXFA 1YIWA 2W55A 2G9HD 2KFKA 1XF5L 2L00B 4NJCA 2VRRB 1ZP0B 1XCTL 3PZ8A 2K22A 2KQ4X 2LZ6A 4MGZE 2GBKA 3AE9B 3S2AA 4ARCA 1VDVA 2C7HA 5DPWA 2V1YA 1OQYA 4HK2A 3N30A 1SE4A 4RGNA 4KV2A 3MC9A 2QIEB 1G6JA 3DBLB 3A4SC 1ZXIA 2BF8B 1FMAD 1RLFA 2W54A 1C76A 3U2SC 2BS4B 3CF6E 3UF8A 4E3CA 2WXFA 1I7HA 1D4BA 3IVFA 2ZW0A 1I4RA 3BWUD 1QILA 2GBRA 4TUUA 3I3TB 5BMGA 2BS3B 3ZNGC 4G11A 1MPEA 4ICUA 1UGMA 1GC6A 3Q8AA 3TEYA 3VUWA 2MBHA 3R8BA 3R66C 1R4MI 1YQBA 1NENB 1IGCA 3K9OB 2M8SA 5D3IB 1EF5A 4XDDA 4GDLA 4DDGD 1D5ZC 4KSLC 3PZDA 3DHGC 4REZA 1FXTB 2ZJDA 3AI5A 4F8CB 2LRWA 1UNSA 2FCMA 5HHDG 3VRBB 3CSTA 3UQBA 3EA6A 3NG0A 2WQYB 3DDCB 2BWFA 2MX2A 2L0FA 3OJ3A 1OEYA 2D10A 2LGSA 1V49A 3Q8EA 3HIZA 1Q1OA 3PV1A 2L76A 3BVZA 4HXDA 3HVDA 4YL8A 2MQJA 1LGRA 2DYMA 2WDRB 3VDZA 2JZZA 2KHWB 2KK8A 3AEEB 1WSPA 1XQQA 1P7FA 1U4AA 1RM6C 5H8YE 4YWGG 4PYZA 2IY1B 1VZ8A 3IAS1 3N1ZC 4KDLB 3DWMA 3U7ZA 3VFKA 3KWLA 4G0NB 4WWPA 1WGRA 4DXFA 4ZYSA 3VR9B 1V6EA 2MCNB 4HRSA 2FUHB 5J2RA 4MSQB 2C7NB 3BYYB 3B0AA 5IA7A 2FAZA 3HM3A 2V4LA 2WNMA 3QWZB 3QQ8B 5D6JB 3DBHB 3MC8A 3SR6A 4ZRKA 2MWSB 1UZXB 4IOIE 2LJ5A 3T8MA 4ZRQA 1WGYA 1F0ZA 4ZRPA 4FXCA 3DHIC 1H8CA 1XLNA 3WANA 1F2RI 3FAHA 4FHJA 3Q3MC 3DQVA 3P42A 3GZNI 1UD7A 3ML8A 4DHJD 3QC8B 4OZCA 2YLMA 3WAMA 4HDQA 1PGAA 2LGIA 5GXGB 4OVUA 1FNUA 1K51A 2WP9B 3AEFB 1JWUD 2I1KA 5BYRA 2CKHB 4E71A 4W9LA 3TCAA 2BKFA 2D5GA 3B9JA 3MP9A 4MGKE 4C56C 4FA6A 5BYSA 1V5OA 4IWQA 4KKJA 5AEKB 1AN8A 3ZXVA 1FFVA 1JQ4A 2IYDB 4GMVA 1FM0D 5AZGA 2CHWA 3H1UA 3HUIA 3H7PB 3OAWA 4RFBA 1IP9A 3C0RB 3N1YC 2INNE 2PVGC 3JSVA 2JYEA 4IDIA 1XXGA 2C7MB 2W3SA 3HK0A 2V0GA 4HEA1 3B1LX 1DGJA 3GS2A 2C5LC 4KGRA 3ZO5B 4FLHA 2WGSA 1ZUD2 2UYZB 4RMAA 1C4AA 2NPTA 1WY8A 4NY0A 4GSWA 4KX6B 3AU4A 4AWJA 1ENFA 1WR6E 5BO4B 3Q8CA 5L83A 3I5JC 1PDXA 1PUTA 1PQSA 2YEPB 3TIXA 2MJ3A 1QLBB 3QAQA 4ANXA 3GOEA 1BUIC 2BS2B 4FJZA 1N6ZA 4B0EA 3CSFA 1WGHA 1L2NA 3NVYA 4C7YA 2JRIB 1T6BX 3PVLA 1C79A 1T5XD 2L1AA 1WR1A 3AE8B 4YTMB 1OQRA 4MH0E 2LMCA 3QA8A 1XT9B 1E7VA 4JL9A 4TKNA 1ACCA 2MP2B 3K9PB 3NRZA 2L8JA 1I4HA 2WDVB 4N6EB 2XK5A 1D5MC 3HM6X 1TKYA 2K0PA 2PMVA 4XDCA 2IY0B 1OTRB 3RNGC 3EHVA 3R3MA 5CHFA 1SIFA 3SFDB 1L6UA 2EMSA 3A1QA 4OHJA 4NNJB 4KIKA 4RF1A 1HZ5A 2I38A 4KGSA 4C80A 1ZW7A 3V61A 4IWOA 5AUKA 1AWDA 3PRZA 3RCZA 3HHMA 3RZWC 4B6WA 2LVOA 1UGJA 4MJSA 2XEWA 4A3PA 3EFUA 3I63C 4NAWA 1GB1A 4ASWC 1WI0A 5DPRA 4MGIE 4XYCA 1R4MB 4R3DA 1AW7A 3KW5B 2WDTB 4KZCA 4PS7A 2DYBA 4UDUC 1FEHA 3ZGZA 2MP2A 2BB5A 2ZPYA 2DYOA 3QHTA 1QKZA 4C4VA 4MM3B 1M4VA 3HRDD 1VRAB 2JZPA 2DLBA 4IKGA 1NI3A 2BYFA 3V6EB 4AP4C 3W5UB 2IO0B 3RNBC 2BGFA 4KGTA 3VTUA 1XCQL 2GI9A 2K8HA 3W1SA 1TY2A 2CHZA 2PE6B 1ZOYB 2KN5A 4GIVA 2JXTA 4I6LB 4HROA 2LASA 4TV3A 5C1ZA 2KWVB 4N58A 3DBLI 2J53A 3OG5A 2WXKA 3SD5A 4A90A 3LB8C 1L0VB 4KIKB 2KJRA 2PTLA 4Q2JA 5GMVA 2AQ1B 4IM2A 3DBSA 5AZHA 2LWPA 4NJ7A 1Y8RC 5EE1A 1L5PA 5E6JA 4ACFA 2SAKA 1WXQA 1WXMA 1YX5B 4I6PA 3Q6BA 2PIAA 3Q8BA 3PREA 3PRPB 4M8NA 4MJSB 1R4NI 2LJIA 2DBYA 1STEA 4HCPB 3PT2B 1JWSD 4OVVA 2D11A 3N20C 2LXAA 1JRUA 2RPVA 2LXCA 4JWUC 2FIFA 1A5RA 1SE2A 2G45B 2ON8A 2AX5A 1AARA 2JU6X 4MSMB 1ZDVA 1WMHB 1JMLA 4TQ1A 3VH3B 1WRDB 2PKOA 4MACA 2ASQA 2HTHA 1OFFA 2GRIA 1LQBA 4IC7B 3AE5B 4DXAB 2KDMA 4K1RB 3P4PB 4YXDB 2ZZPB 1FCCC 2G4DB 2KC2A 2QILA 3W5VB 4ICVA 1JRPA 3PHXB 2IPKD 4OVZA 4WJQA 2QDFA 1WH3A 2WXOA 4AJYB 1MHHE 2WXHA 3ABVB 3AE3B 3ONSA 2WS3B 3T3NA 1NDDA 3RI7C 2C60A 2LFIA 4FHKA 1JWMD 1YQ3B 4YT0B 3VH4B 3ZIMA 2KWUB 4WJOA 2Y5CA 2QJLA 3RNEC 1HEZE 1L4ZB 4HDOA 2K1FA 1FXIA 4NAMA 1WXSA 2B3AA 4US9A 2BBCA 1FIQA 1SIJA 2L83A 2CR5A 3VUYA 4W9IA 3ZDMC 2JXXA 2KACA 2N1VA 4US8A 3T9LA 1CMXB 3PGEA 2AQ2B 3LJ3A 4BBNC 3UI3A 5C3JB 4LNNA 4BOZB 1QT9A 2D3AA 1P3QU 2EKEC 2KX3A 3MHZA 4WWOA 4YSYB 1WYWB 1B9RA 3AEBB 3AV8A 2JQRB 1N62A 1A70A 2PW9A 2MLBA 2FCSA 4XX5A 2Z59B 4EZLA 2FNJB 2KVRA 4IUMB 2WX0A 4YTNB
chains in the Genus database with same CATH topology
1F2RC 1I4QA 2JX5A 2E6XA 2OEDA 4IOIE 2V3NA 1YJIA 1TY0A 2WU5B 1JROA 1N5WA 4OZBA 4ZRQA 1NVID 5EE9A 2WXNA 2X38A 1F0ZA 1J7CA 4FXCA 4ZRPA 3AE7B 1XLNA 4TMAB 3NVWA 1WYGA 5MPOA 1F2RI 2VZKB 3FAHA 1HA5A 2XNAC 3BK1A 1XLOA 2AQ3B 3P42A 4OZAA 3TUOA 4H2AA 5FKAC 4OZCA 2EELA 2NMQA 1PGAA 2LGIA 1KLUD 1QOGA 3R2TA 5GXGB 2N0SB 3V05A 5HFYA 1FNUA 2WXLA 1K51A 1VLBA 2M0AA 4TSSA 5D7GA 4GDLB 2N9KA 2WP9B 3AEFB 1JWUD 5BYRA 2HTME 3VQIA 2D5GA 1Y56A 3B9JA 3BK2A 3MP9A 1JWBD 4N59A 4EE2A 4C56C 5BYSA 1I4GA 2K3UA 1FCLA 4KKJA 2BW2A 2WXIA 4CQNA 1KFYB 1XLQA 1AN8A 1MHXA 4ZOHC 1FFVA 1YMHE 1JQ4A 3AMZA 1DOXA 3BVMA 1FM0D 2PLPA 1MI0A 1PGXA 5BMHA 3W9CB 2GB1A 4XWWA 3P4RB 1RWSA 1ZPSA 3HUIA 4AS1A 5FR3A 1SSNA 4RFBA 4AQ7A 4J3OD 5I4DA 4IDIA 2INNE 2PVGC 1ET6A 2JYEA 1XXGA 4GDKB 3AB5A 2WU2B 2V4IB 2W3SA 3I9V1 3ZQ4A 1VZ6A 2V0GA 4NAWB 4HEA1 1L0XB 1DGJA 3GS2A 2CJNA 2BTEA 1C4PA 1ZE3D 4KGRA 3I57A 1ZUD2 1NYQA 1GAQB 3L4PA 1C4AA 2WXGA 4RH6A 2L32A 5H92C 1PFDA 3TEXA 3IXSA 4KX6B 2VZKD 3NUHB 1TZOA 3AE6B 1ENFA 3AE2B 2Z8LA 2CJOA 3CIRB 3Q8CA 4P6VF 1EU3A 2ZW1A 1AYFA 1PDXA 2LEKA 3GP7A 4WH4A 5BMIA 1PUTA 4RGMA 2J52A 2YEPB 4WIPA 2MJ3A 1WRIA 1QLBB 1ET9A 2M19A 4WAFA 1BUIC 1DOYA 3VRAB 2BS2B 4P16A 4B0EA 3MC0B 3DWGC 3P4QB 1P7EA 2FBWB 2FUG1 3AE1B 1D6EC 3NVYA 3KWVA 1FNVA 4C7YA 1T6BX 3R2IA 4RNAA 1HQRD 2WDQB 1ZXHA 1C79A 1T5XD 2L1AA 4C7ZA 1CK1A 5G5GA 1D5XC 2LHDA 2DWQA 4M0WA 3AE8B 3N9YC 2MJEA 3AN1A 1XO3A 4YTMB 1OQRA 2LMCA 3BVGA 1JALA 3FC4A 1ACCA 1IUEA 2V3PA 1C4CA 3NRZA 1I4HA 2WDVB 4L1BA 1YQ4B 1IBXB 4N6EB 2IDYA 3BIID 4LK0M 3SFEB 1D5MC 2MJDA 2IGHA 1DOIA 2R61A 4ZHOA 4USAA 1SJED 1EM7A 4A9AA 2FE8A 3HVZA 1TKYA 2K0PA 2PMVA 1FNWA 2QMTA 4LLGM 4MT5A 2E3TA 2RMMA 1KH0A 1N61A 2WXJA 4DXGA 2BYTA 3AECB 1KLGD 4XWTA 1GOZA 2OHFA 2WXMA 3PZ7A 4JPSA 4L2YA 3SFDB 1L6UA 5EE0A 2LUMA 4LTUA 4A8XC 4OHJA 2JWUA 4XE0A 4RF1A 4WURA 1N60A 1FO4A 1HZ5A 2I38A 4JE3B 1I4XA 3ZJTA 4KGSA 1TKGA 1PGBA 4C80A 3KQ4A 4RGOS 2I2YA 2WXRA 4HKZE 3WCQA 3P1MA 1OQQA 1E7PB 1YN5A 5AUKA 3AM9A 1SBBB 2ICIA 1AWDA 1J7BA 1E10A 3TSSA 1TS2A 2HDEA 4YSZB 4ITKA 1EU4A 4GLSC 1UWMA 3TEZA 1UGJA 3U4EG 3BZDB 3Q8FA 1QOAA 1YNTE 3CWIA 4DQOC 1V1PB 1NYRA 2MH7A 4B0MA 1GB1A 1C78A 4D2KA 3V3XA 1L6VA 3U52E 3SEBA 2J42A 4TQ0A 1XLPA 2WXQA 1JWAD 3B2FA 5FK9C 1PYWD 1V1OA 4R3DA 1AW7A 1SXTA 4UDUC 1FEHA 3ZGZA 1UUPA 2BB5A 3T3OA 1IBXA 1K53A 2DYOA 5EE3A 2SEBD 1QKZA 1SE3A 2K5PA 1BMLC 3IAM1 2Q5WD 4MM3B 3PO0A 1M4VA 3HRDD 1VRAB 3AE4B 2JZPA 1GB4A 2DLBA 1KF6B 3MFGA 4IKGA 2PVOD 1NI3A 1IGDA 1E0ZA 1LO5D 2KWDA 4HKQA 5LNK1 2IJ0A 3W5UB 2NTSA 1SF0A 4WWMA 1SB3C 2M56B 3AH7A 2YEPF 4KGTA 1YN3A 2CU3A 1XCQL 1GPXA 3O13A 2GI9A 4RCOA 2K9XA 2L52A 2MEKA 3W1SA 2IGGA 2WXPA 1T3QA 2RDGA 1TY2A 3NVVA 1ZOYB 1B1ZA 2H89B 1VR9A 1TS4A 2JXTA 4HROA 1FRDA 2KN4A 1EWCA 3IT4B 4N58A 3RFZB 2J4XA 3LYYA 2J53A 4HJGE 1VZ7A 5G5HA 1TS3A 2WXKA 1RFKA 4A90A 3EUB2 3LB8C 3MJ5A 1L0VB 1SEBD 2NTTA 2PTLA 3NVZA 2JYTA 3NS1A 2AQ1B 4Q2JA 1Q10A 3P63A 1J7AA 3LXFA 4NZLB 1V1PA 2W55A 2G9HD 1TS5A 1XF5L 4NJCA 1ZP0B 1K50A 1XCTL 5EE1A 1L5PA 3PZ8A 2IGDA 1CQVA 2K22A 2KQ4X 4JWSC 3Q69A 4O1NA 5E6JA 1JCKB 1N5XA 2SAKA 1WXQA 3AE9B 1ESFA 4ARCA 2PIAA 1VDVA 3Q8BA 3AEAB 5TSSA 1YJJA 3ZJUA 1UWXA 1HXYD 1HZ6A 4OW0A 1EWYC 1N63A 1SE4A 2LJIA 4RGNA 2DBYA 2W82A 2QIEB 2ACZB 1STEA 1TYGB 1ZXIA 1FMAD 2QEJC 1F77A 2W54A 1JWSD 1C76A 1NEKB 3U2SC 2BS4B 2WXFA 2RDHA 1I7HA 2RPVA 1FRRA 2XN9C 4JWUC 1D4BA 3J9CA 1SE2A 2ZW0A 1I4RA 4KKIA 3GB1A 3ZYYX 2BT6A 2ON8A 4RF0A 4L23A 3W2DA 2AX5A 1L4DB 3BWUD 1QILA 1WGKA 2JU6X 2Y5PA 4YSXB 1ZDVA 4MH8A 5BYQA 4TQ1A 1JMLA 1VJKA 5BMGA 2PKOA 4MACA 2BS3B 1OFFA 2Y3AA 2GRIA 1MPEA 3AE5B 3ZJVA 2KDMA 3P4PB 1KRHA 4YXDB 3Q8AA 3TEYA 1FCCC 4PT5A 1XEEA 2QILA 3W5VB 1JRPA 3P4SB 1QOBA 2IPKD 4OVZA 3R8BA 3FILB 3VR8B 1FD6A 1C9FA 2ONQA 1ROEA 1NENB 1IGCA 2WXOA 3BYTB 1MHHE 2KMMA 4A55A 2WXHA 3ABVB 3AEDB 3AE3B 3IT6B 5D3IB 2WS3B 2JSVX 4ZHPA 4XDDA 3T3NA 5AUIA 1QF6A 1D5ZC 4REZA 3C8YA 1R7SA 3H8HA 3E9SA 3KLSX 1UNSA 1FFUA 2B76B 3B2GA 5HHDG 3VRBB 3EA6A 3ETRA 2LFIA 1V8CA 2LHEA 2WQYB 2W3RA 1YN4A 2H88B 1JWMD 1YQ3B 4YT0B 1I4PA 3E56A 3Q8EA 1KTKA 2QSDA 3EGRA 2Y5CA 2EKIA 1QOFA 2QJLA 2WLBA 3BVZA 1HEZE 1L4ZB 3HVDA 1TJEA 2DYMA 1FXIA 2WDRB 1QQRA 4NAMA 5HG2A 4US9A 3AEEB 1WSPA 2BBCA 1P7FA 1FIQA 1SIJA 2L83A 2KAJA 1RM6C 3URYA 1FXAA 5H8YE 1CJEA 2KACA 1SJHD 4US8A 4YWGG 2G1EA 2AQ2B 2N7JA 1VZ8A 1DYQA 4WQMA 3IAS1 2N9LA 3UI3A 1E9MA 2BB6A 5C3JB 3DWMA 3U7ZA 3AEGB 5JXVA 3KWLA 4XDCA 1QT9A 3OWEB 1C77A 4DXFA 4ZYSA 2INPE 3MHZA 3VR9B 1L0YB 4YSYB 3TEWA 4RGTA 1V97A 4HRSA 1B9RA 1ZDXA 3AEBB 1JW9D 3AV8A 1TKEA 2JQRB 1N62A 3BYYB 1K52A 1A70A 2PW9A 1BXTA 3NZ3A 4A6QA 2TSSA 4ARIA 1WWTA 1MVKA 4JX1C 2WNMA 1RYJA 1CZPA 5C2TB 5T8IA 3RPFC 3FILA 5D3DA 3SR6A 1E6EB 4YTPB 5HI1A 4YTNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8X C;  4A90 A;  4A6Q A;  2HDE A; 
#chains in the Genus database with same CATH topology
 4II3 B;  2JX5 A;  2GBN A;  2A4Z A;  1N5W A;  1Z2M A;  3ZRC A;  2WXN A;  1WZ3 A;  1J7C A;  4BZA A;  3AE7 B;  4TMA B;  5MPO A;  5DPT A;  4BKS A;  3DVG Y;  3QX1 A;  2XNA C;  3V6C B;  1KOT A;  4OZA A;  1E8X A;  3M3J A;  2NMQ A;  1KLU D;  2NBV B;  2N0S B;  3V05 A;  3PTF C;  1VLB A;  1V2Y A;  2N9K A;  3NJT A;  4MM3 A;  1Y56 A;  1JWB D;  3ECI A;  2KJ6 A;  4N59 A;  2ZEQ A;  3L54 A;  1I4G A;  2K3U A;  4IM3 A;  3SHQ A;  1FCL A;  2WXI A;  3RN9 C;  3JYU A;  3DCG A;  1DOX A;  3RNF C;  2NS5 A;  3EEC A;  3W9C B;  4XWW A;  1WJN A;  2IZV B;  3WAP A;  1SSN A;  4J3O D;  3A4R A;  3H6N A;  2WU2 B;  3I9V 1;  3ZQ4 A;  1VZ6 A;  3P2B A;  1IPG A;  2KVZ A;  2MBO A;  2BTE A;  1ZE3 D;  3H9D A;  1X1M A;  4GN1 A;  3DPD A;  2HD5 B;  1NYQ A;  3W1Y A;  2WXG A;  2QCZ A;  2L7R A;  2KD0 A;  3ZKJ C;  1UEL A;  2CJO A;  4N9F 4;  1EU3 A;  1VCB A;  2ZW1 A;  3GP7 A;  5BMI A;  2J52 A;  3ZW3 A;  4GU2 A;  4BOS C;  2KYW A;  4WIP A;  3NZU A;  5E6P A;  1ET9 A;  4WAF A;  2MBB B;  4IG7 B;  3RD2 A;  1P9D U;  3AUL A;  5CTR C;  3P4Q B;  2NBW B;  3PSE B;  1ZXH A;  2KJH B;  3BIN A;  4E74 A;  1CK1 A;  1D5X C;  1NI2 A;  2DWQ A;  3OJ4 B;  3N9Y C;  2MJE A;  1XO3 A;  3MTN B;  3SDL C;  1D3Z A;  3BVG A;  2V3P A;  5HKH A;  1C4C A;  1IBX B;  1ZKH A;  3BII D;  4LK0 M;  2MJD A;  4HPP A;  1DOI A;  2R61 A;  4ZHO A;  2MW5 A;  4USA A;  3A9J A;  2LD9 A;  3HVZ A;  4KZ0 A;  4DXG A;  3MHS D;  1TZ1 A;  2E3T A;  1KH0 A;  2RMM A;  2OOB B;  2NCN A;  1KLG D;  4XWT A;  1GOZ A;  3VTV A;  2M1M A;  2WXM A;  3PZ7 A;  4A3O A;  2XBB C;  4LTU A;  2JY6 A;  2AWT A;  2JWU A;  2R2O A;  1E8Y A;  4HPL B;  3AXC A;  3ZRF A;  3ZJT A;  4C00 A;  4MDK E;  3KQ4 A;  3O65 B;  2KTR A;  2WXR A;  3DBR I;  3P1M A;  1YN5 A;  2ICI A;  1J7B A;  1E10 A;  3TSS A;  2HDE A;  2A5U A;  2O6V A;  3QK0 A;  3U4E G;  3BZD B;  3Q8F A;  2KDB A;  5KHQ A;  1QOA A;  1NYR A;  4B9K A;  2MH7 A;  1WFY A;  4EOY A;  4PYU A;  2LRU A;  1TIF A;  2KLC A;  3U52 E;  2J42 A;  3RUL A;  5FK9 C;  1V1O A;  4KDI C;  2N9X A;  1GJZ A;  1T0Y A;  3RNA C;  2LVP A;  4F7Z A;  3IG3 A;  1IBX A;  2Z0E B;  5EE3 A;  1WE7 A;  2JWZ A;  4DHJ B;  2LGD A;  1RFA A;  2KMA A;  1EF1 A;  2Q5W D;  2RPQ A;  3PO0 A;  2LUE A;  5IN7 A;  4JIO U;  4NQL B;  1IGD A;  3U7D A;  1LO5 D;  2AL3 A;  2KWD A;  4HKQ A;  1E0Z A;  3PRM B;  3TJP A;  2WYQ A;  4DBG A;  4DHZ E;  1SF0 A;  4HWI B;  3AH7 A;  5JHA A;  3UIN B;  3W1S C;  4K3B A;  4AUQ C;  1T0S C;  1T3Q A;  2RDG A;  3A9J B;  3A9K B;  2BQQ A;  2H89 B;  1VR9 A;  2PPH A;  3M95 A;  2RDB C;  2FCQ A;  1MG8 A;  4PK1 A;  4HJG E;  1VZ7 A;  4WQO B;  5L95 C;  3MJ5 A;  2DZM A;  3Q3F A;  2NTT A;  1E8Z A;  3R7R A;  3WA0 A;  3NVZ A;  3P63 A;  1J7A A;  1Q0W B;  3KUC B;  3QAR A;  2ZNV B;  1QZE A;  1K50 A;  1UBI A;  4BBN F;  4JWS C;  2IGD A;  1CQV A;  2PJH A;  3Q2A C;  4O1N A;  3X0W A;  1WX8 A;  1ESF A;  3AEA B;  1YJJ A;  2ZVN A;  4CYE A;  3ZJU A;  1UWX A;  1HZ6 A;  4OW0 A;  1EWY C;  2RSU A;  1E8W A;  1RRB A;  1RAX A;  2ACZ B;  2BYE A;  4FJY A;  4K7U A;  2M0X A;  2KOX A;  1F77 A;  2J0K A;  4S17 A;  4GOC A;  3QJZ A;  2HE7 A;  2D2Q A;  2BVC A;  2MSE D;  4JLC A;  3J9C A;  2G4S A;  4L23 A;  3W2D A;  1L4D B;  2FID A;  3TL5 A;  4EEW A;  1WGK A;  4YSX B;  3ML9 A;  1MJD A;  3U30 A;  4MH8 A;  5AZF A;  4P1C C;  1WM3 A;  2Y3A A;  2J0J A;  3BY4 B;  1KRH A;  4PT5 A;  1XEE A;  3UIP B;  1GNU A;  3P4S B;  2ZPN A;  1HTO A;  1GG3 A;  3VR8 B;  1FD6 A;  1C9F A;  2ONQ A;  1ROE A;  2C9W B;  3WAL A;  3ZTC A;  3BYT B;  2KMM A;  4A55 A;  3VTW A;  3D32 A;  1SGH A;  3ZDT A;  2KQ7 A;  5AUI A;  2KX0 A;  2ZCC A;  1R7S A;  3H8H A;  3N1X C;  3UIO B;  2ZVO A;  3JW0 X;  2O6V D;  3FKY A;  1FFU A;  3ETR A;  2LHE A;  2IND C;  1YN4 A;  2H88 B;  1I4P A;  1WXV A;  4W9E A;  1YX6 B;  4XZ4 A;  3EGR A;  2WWZ A;  2EKI A;  1QOF A;  2K25 A;  2MRP A;  2DX5 B;  2QHO A;  2JF5 A;  4DHZ B;  1QQR A;  3C19 A;  3EFC A;  3URY A;  1FXA A;  3L17 A;  2AL6 A;  3A1Q B;  3RUI B;  2KLG A;  3WAO A;  4WQM A;  4ANV A;  5DCN A;  3GE3 C;  1E9M A;  2BB6 A;  2KZR A;  1T0Q C;  3UGB B;  4EFO A;  3AEG B;  3NY5 A;  4RM9 A;  3AU5 A;  3OWE B;  1C77 A;  3APC A;  5D94 A;  1IYF A;  1T0R C;  2INP E;  1V97 A;  3DVN U;  2KNB A;  1TKE A;  2KDF B;  1BXT A;  4A6Q A;  4ARI A;  1FPY A;  1RYJ A;  1TTN A;  4AOF A;  4URK A;  2I1J A;  5T8I A;  2R2Q A;  3RPF C;  5D3D A;  4BKG A;  1XD3 B;  2UU7 A;  4W9C A;  3EC8 A;  4YTP B;  4EUT A;  2DZJ A;  1F2R C;  4K7S A;  2OED A;  2V3N A;  1YJI A;  1TY0 A;  2WU5 B;  5EE9 A;  3TBL D;  2X38 A;  3NVW A;  1WYG A;  5IOI A;  4IW0 A;  1P0R A;  3BK1 A;  2AQ3 B;  3TUO A;  2EEL A;  3H7S A;  3R2T A;  5HFY A;  2KMC A;  2CU1 A;  2AYO B;  4TSS A;  2Y5B B;  3IHP C;  4GDL B;  3L08 A;  2HTM E;  4DWF A;  1E7U A;  4GGQ A;  1C1Y B;  2RD0 A;  2BW2 A;  4CQN A;  1KFY B;  2GOW A;  4ZOH C;  3DVG X;  1YMH E;  1WGG A;  3AMZ A;  1I35 A;  1WF9 A;  1MI0 A;  3LDZ E;  4EZK A;  2GB1 A;  3P4R B;  1RWS A;  3A9K A;  3KUD B;  2NR2 A;  4AS1 A;  5FR3 A;  5I4D A;  1Q5W B;  1ET6 A;  1MG4 A;  5CHW A;  4NAW B;  1V81 A;  2CJN A;  3KH0 A;  5IAA C;  3R7Q A;  2FCN A;  1GAQ B;  3L4P A;  1YJ1 A;  2AEH A;  2L32 A;  2MHJ A;  2ZCB A;  1PFD A;  3TEX A;  2M17 A;  1UH6 A;  3IXS A;  4FAD A;  3Q3N C;  1KJT A;  2O2V A;  2LGY A;  2G3Q B;  1TT5 B;  1AYF A;  1WJ6 A;  4HVB A;  2IO2 B;  4RGM A;  4MEL A;  5TR5 A;  2UWQ A;  1WRI A;  1ZGU B;  1V5T A;  5JZE B;  1DOY A;  3B08 A;  1WMH A;  3DWG C;  2JT4 B;  2FUG 1;  3AE1 B;  1D6E C;  3KWV A;  4K3C A;  4RNA A;  1HQR D;  3V60 A;  2KTF A;  1WZ0 A;  4EZJ A;  2DAF A;  2KQS A;  2LHD A;  2KDE B;  5EDS A;  3Q14 C;  2J7Q B;  1JAL A;  1IUE A;  1F9J A;  1SE9 A;  2WX1 A;  4L1B A;  1YQ4 B;  2KFJ A;  2N7D A;  1UBQ A;  1SJE D;  1TGZ B;  4A9A A;  3PHW B;  4JGH B;  3ENE A;  4JQW C;  4MT5 A;  2ZNV C;  5KHO A;  1YOV B;  3JVZ X;  3AEC B;  2JZ3 B;  2YVC A;  4B95 A;  1YD8 U;  4K81 A;  4W9J A;  5D2M B;  4JPS A;  2HJ8 A;  4L2Y A;  2LUM A;  2KO3 A;  4A8X C;  3ZVV A;  4XE0 A;  4FBJ B;  4WUR A;  1N60 A;  2KXJ A;  2VH2 A;  1L7Y A;  4JE3 B;  1I4X A;  2QC8 A;  4RGO S;  3WCQ A;  1E7P B;  3AM9 A;  3X23 A;  5LLI A;  3ZXR A;  1SBB B;  2VH1 A;  4YSZ B;  2PE9 A;  3CMM B;  1EU4 A;  4GLS C;  1UWM A;  3IBE A;  1OGW A;  4ANU A;  3GZN B;  1YNT E;  4DQO C;  1V1P B;  3Q3O C;  4B0M A;  4LCD E;  1C78 A;  1HTQ A;  3ZNH B;  1M94 A;  4D2K A;  2KKC A;  1L6V A;  1V80 A;  4TQ0 A;  1XLP A;  2WXQ A;  3QCA A;  1JWA D;  1C3T A;  1J0G A;  2HJ1 A;  2N1W A;  1SXT A;  2IBI B;  1UUP A;  4ZDV A;  3VVW B;  2Z0D B;  4A20 A;  1K53 A;  3L0W B;  2V9H A;  2LGX A;  4MGY E;  1BML C;  3IAM 1;  1K8R B;  4WJN A;  3AE4 B;  3MFG A;  1KF6 B;  1I42 A;  2K8C A;  4ZRI A;  2NTS A;  3WIM A;  2WHI A;  4WWM A;  5DPS A;  2M56 B;  2YEP F;  2LI5 A;  2MBQ A;  5G2N A;  5CX3 A;  3RMK C;  1WJU A;  2L52 A;  2IGG A;  1KLV A;  1H4R A;  1ISN A;  4M00 A;  1B1Z A;  4XGA B;  4FUL A;  2D07 B;  3L16 A;  2J4X A;  3LYY A;  2MBE A;  1TS3 A;  3KVF B;  1RFK A;  2XK5 B;  3EUB 2;  2IO1 B;  3APF A;  4K7W A;  2L05 A;  4W9F A;  2JRH A;  2JYT A;  3NS1 A;  3H7P A;  4NZL B;  1V1P A;  1TS5 A;  3RT3 B;  1WIA A;  5IKC M;  5C23 A;  3DVN V;  3Q69 A;  5LXI B;  5JHB A;  1JCK B;  1N5X A;  4IWP A;  2BKR B;  4HCN B;  4PS3 A;  1E90 A;  5TSS A;  3NZS A;  1HXY D;  1N63 A;  2D3C A;  2W82 A;  3KUZ A;  4WWN A;  2K8B A;  1TYG B;  2QEJ C;  2DAJ A;  1NEK B;  3A33 B;  3DBH I;  5IP4 D;  2KFK B;  2RDH A;  1FRR A;  1S1Q B;  2N9E B;  2XN9 C;  3DOW A;  3Q3J A;  4KKI A;  3GB1 A;  3ZYY X;  2BT6 A;  4RF0 A;  1F52 A;  4M0W B;  2KTR B;  2Y5P A;  3ZTD A;  5BYQ A;  1UF0 A;  4LJP B;  1VJK A;  2INC C;  4FN2 A;  2O6V B;  3ZJV A;  2N7E A;  5E6O A;  1HE8 A;  1QOB A;  3FIL B;  2DZK A;  3IT6 B;  3AED B;  2JSV X;  3PPA A;  4ZHP A;  2D3B A;  3ZUN A;  1QF6 A;  2KDI A;  2MA9 B;  3C8Y A;  3E9S A;  4NJ6 A;  3KLS X;  2B76 B;  4BFR A;  3B2G A;  4MEM A;  1MFW A;  1V8C A;  3JSV B;  4XC2 A;  2W3R A;  2K6Q A;  1LM8 B;  3E56 A;  1LFD A;  1KTK A;  2QSD A;  3RZF A;  4PS8 A;  2REX A;  2WLB A;  1TJE A;  2W9N A;  4X57 B;  5JH5 C;  2NPT B;  2KT7 A;  5HG2 A;  5CHV C;  4QAY A;  2KAJ A;  1KM7 A;  4W9D A;  1CJE A;  1SJH D;  4ZYN A;  3ZNI D;  4NQK E;  2G1E A;  2N7J A;  1WXA A;  1DYQ A;  3V62 A;  4W9K A;  2N9L A;  3PLV A;  3SU8 X;  4LNF A;  4GDK A;  5JXV A;  2JPH A;  4WJP A;  2N4F A;  4GXB A;  1L0Y B;  3TEW A;  4RGT A;  4KSK C;  1ZDX A;  1JW9 D;  3ZNZ B;  3VUX A;  1LXD A;  1K52 A;  1OEY J;  4DK5 A;  1TBE A;  4CO7 A;  3NZ3 A;  2TSS A;  1WWT A;  3RYT A;  1MVK A;  4JX1 C;  1R4N B;  1CZP A;  5C2T B;  4G50 A;  2RGF A;  2DNF A;  4P7I A;  2LVQ A;  3FIL A;  1E6E B;  2M4N A;  3RNC C;  3L10 B;  2CS4 A;  5HI1 A;  5G55 A;  2BPS A;  1I4Q A;  1WGD A;  2E6X A;  1JRO A;  2D3G A;  4OZB A;  1NVI D;  1V86 A;  4AJW A;  5IO9 A;  2EMT A;  2VZK B;  1HA5 A;  2BYV E;  1XLO A;  4H2A A;  5FKA C;  3U8Z A;  4LNO A;  4ZRJ A;  1QOG A;  3VXW A;  2WXL A;  2L0T A;  2M0A A;  5D7G A;  1J8C A;  4GB9 A;  3DHH C;  3VQI A;  3BK2 A;  3APD A;  4S0R A;  4ANW A;  3NHE B;  4EE2 A;  1J19 A;  3OLM D;  1XLQ A;  2KAN A;  4F1S A;  1MHX A;  3MJW A;  3BVM A;  2PLP A;  1PGX A;  2KC1 A;  2V3S A;  5BMH A;  4LDT D;  4RM8 A;  1ZPS A;  2L3Z A;  4AQ7 A;  4GDK B;  3AB5 A;  4WAA A;  2V4I B;  1WX7 A;  4BAX A;  1L0X B;  1C4P A;  3I57 A;  4C4V B;  2O2V B;  3PLU A;  4RH6 A;  5H92 C;  3VAW A;  1E5W A;  4W9G A;  2VZK D;  3NUH B;  1Z5S B;  4FJV B;  1TZO A;  3AE6 B;  3AE2 B;  2Z8L A;  1WE6 A;  3CIR B;  4P6V F;  3M63 B;  2GBJ A;  2LEK A;  4WH4 A;  5LXH A;  4NPN A;  2M19 A;  1NBF C;  3VRA B;  4P16 A;  4BKT A;  3MC0 B;  3PS6 A;  1P7E A;  2FBW B;  1WM2 A;  1FNV A;  2IO3 B;  3R2I A;  2WDQ B;  3GE8 C;  4C7Z A;  4BKS D;  2OJR A;  3N32 A;  5G5G A;  4HPM B;  4M0W A;  1EUV B;  3AN1 A;  4LDT B;  4DDI D;  2PEA A;  3FC4 A;  2OJW A;  4LJO B;  3TMP B;  2IDY A;  3SFE B;  1P98 A;  2GMI C;  3VHT C;  2IGH A;  3DBR B;  4W9H A;  3KYC D;  1EM7 A;  2FE8 A;  3L13 A;  4LNK A;  4BVU C;  1FNW A;  2QMT A;  4LLG M;  1N61 A;  2WXJ A;  2BYT A;  5J18 A;  2OHF A;  1V9J A;  5EE0 A;  1GC7 A;  1FO4 A;  4G3X B;  2K39 A;  1TKG A;  1PGB A;  2I2Y A;  4HKZ E;  1EO6 A;  3ALB A;  1OQQ A;  1VD2 A;  3QIJ A;  2JVC A;  4KVG B;  1TS2 A;  1WJ4 A;  4ITK A;  4IM0 A;  4M02 A;  3M62 B;  3TEZ A;  1GUA B;  2DEN B;  3ZLZ A;  3CWI A;  4J6I A;  4CHK A;  4LNI A;  4P1B C;  2KWC A;  2NVU I;  3V3X A;  2X8X X;  3SEB A;  1P1A A;  3B2F A;  1PYW D;  2DHZ A;  3UQA A;  3KYD D;  2N9P C;  2J0M A;  3NOB A;  3T3O A;  5J17 A;  2K6D B;  2SEB D;  1SE3 A;  2K5P A;  4I6N B;  4EKU A;  2RR9 A;  3NS8 A;  1GB4 A;  4HLE A;  4M8M A;  2PVO D;  5LNK 1;  2IJ0 A;  4HJK A;  2DZI A;  1F1H A;  4II2 B;  1SB3 C;  2GLS A;  1YN3 A;  2CU3 A;  5E6N A;  1GPX A;  2GBM A;  3O13 A;  4RCO A;  2K9X A;  2MEK A;  4M01 A;  2NBU A;  1WX9 A;  2WXP A;  2JUO A;  3NVV A;  3IFW B;  3N3K B;  2BWE S;  1S3S G;  1TS4 A;  1FRD A;  2KN4 A;  1EWC A;  1BT0 A;  3IT4 B;  3RFZ B;  5G5H A;  2CHX A;  1SEB D;  5FR6 A;  1Q10 A;  3LXF A;  1YIW A;  2W55 A;  2G9H D;  2KFK A;  1XF5 L;  2L00 B;  4NJC A;  2VRR B;  1ZP0 B;  1XCT L;  3PZ8 A;  2K22 A;  2KQ4 X;  2LZ6 A;  4MGZ E;  2GBK A;  3AE9 B;  3S2A A;  4ARC A;  1VDV A;  2C7H A;  5DPW A;  2V1Y A;  1OQY A;  4HK2 A;  3N30 A;  1SE4 A;  4RGN A;  4KV2 A;  3MC9 A;  2QIE B;  1G6J A;  3DBL B;  3A4S C;  1ZXI A;  2BF8 B;  1FMA D;  1RLF A;  2W54 A;  1C76 A;  3U2S C;  2BS4 B;  3CF6 E;  3UF8 A;  4E3C A;  2WXF A;  1I7H A;  1D4B A;  3IVF A;  2ZW0 A;  1I4R A;  3BWU D;  1QIL A;  2GBR A;  4TUU A;  3I3T B;  5BMG A;  2BS3 B;  3ZNG C;  4G11 A;  1MPE A;  4ICU A;  1UGM A;  1GC6 A;  3Q8A A;  3TEY A;  3VUW A;  2MBH A;  3R8B A;  3R66 C;  1R4M I;  1YQB A;  1NEN B;  1IGC A;  3K9O B;  2M8S A;  5D3I B;  1EF5 A;  4XDD A;  4GDL A;  4DDG D;  1D5Z C;  4KSL C;  3PZD A;  3DHG C;  4REZ A;  1FXT B;  2ZJD A;  3AI5 A;  4F8C B;  2LRW A;  1UNS A;  2FCM A;  5HHD G;  3VRB B;  3CST A;  3UQB A;  3EA6 A;  3NG0 A;  2WQY B;  3DDC B;  2BWF A;  2MX2 A;  2L0F A;  3OJ3 A;  1OEY A;  2D10 A;  2LGS A;  1V49 A;  3Q8E A;  3HIZ A;  1Q1O A;  3PV1 A;  2L76 A;  3BVZ A;  4HXD A;  3HVD A;  4YL8 A;  2MQJ A;  1LGR A;  2DYM A;  2WDR B;  3VDZ A;  2JZZ A;  2KHW B;  2KK8 A;  3AEE B;  1WSP A;  1XQQ A;  1P7F A;  1U4A A;  1RM6 C;  5H8Y E;  4YWG G;  4PYZ A;  2IY1 B;  1VZ8 A;  3IAS 1;  3N1Z C;  4KDL B;  3DWM A;  3U7Z A;  3VFK A;  3KWL A;  4G0N B;  4WWP A;  1WGR A;  4DXF A;  4ZYS A;  3VR9 B;  1V6E A;  2MCN B;  4HRS A;  2FUH B;  5J2R A;  4MSQ B;  2C7N B;  3BYY B;  3B0A A;  5IA7 A;  2FAZ A;  3HM3 A;  2V4L A;  2WNM A;  3QWZ B;  3QQ8 B;  5D6J B;  3DBH B;  3MC8 A;  3SR6 A;  4ZRK A;  2MWS B;  1UZX B;  4IOI E;  2LJ5 A;  3T8M A;  4ZRQ A;  1WGY A;  1F0Z A;  4ZRP A;  4FXC A;  3DHI C;  1H8C A;  1XLN A;  3WAN A;  1F2R I;  3FAH A;  4FHJ A;  3Q3M C;  3DQV A;  3P42 A;  3GZN I;  1UD7 A;  3ML8 A;  4DHJ D;  3QC8 B;  4OZC A;  2YLM A;  3WAM A;  4HDQ A;  1PGA A;  2LGI A;  5GXG B;  4OVU A;  1FNU A;  1K51 A;  2WP9 B;  3AEF B;  1JWU D;  2I1K A;  5BYR A;  2CKH B;  4E71 A;  4W9L A;  3TCA A;  2BKF A;  2D5G A;  3B9J A;  3MP9 A;  4MGK E;  4C56 C;  4FA6 A;  5BYS A;  1V5O A;  4IWQ A;  4KKJ A;  5AEK B;  1AN8 A;  3ZXV A;  1FFV A;  1JQ4 A;  2IYD B;  4GMV A;  1FM0 D;  5AZG A;  2CHW A;  3H1U A;  3HUI A;  3H7P B;  3OAW A;  4RFB A;  1IP9 A;  3C0R B;  3N1Y C;  2INN E;  2PVG C;  3JSV A;  2JYE A;  4IDI A;  1XXG A;  2C7M B;  2W3S A;  3HK0 A;  2V0G A;  4HEA 1;  3B1L X;  1DGJ A;  3GS2 A;  2C5L C;  4KGR A;  3ZO5 B;  4FLH A;  2WGS A;  1ZUD 2;  2UYZ B;  4RMA A;  1C4A A;  2NPT A;  1WY8 A;  4NY0 A;  4GSW A;  4KX6 B;  3AU4 A;  4AWJ A;  1ENF A;  1WR6 E;  5BO4 B;  3Q8C A;  5L83 A;  3I5J C;  1PDX A;  1PUT A;  1PQS A;  2YEP B;  3TIX A;  2MJ3 A;  1QLB B;  3QAQ A;  4ANX A;  3GOE A;  1BUI C;  2BS2 B;  4FJZ A;  1N6Z A;  4B0E A;  3CSF A;  1WGH A;  1L2N A;  3NVY A;  4C7Y A;  2JRI B;  1T6B X;  3PVL A;  1C79 A;  1T5X D;  2L1A A;  1WR1 A;  3AE8 B;  4YTM B;  1OQR A;  4MH0 E;  2LMC A;  3QA8 A;  1XT9 B;  1E7V A;  4JL9 A;  4TKN A;  1ACC A;  2MP2 B;  3K9P B;  3NRZ A;  2L8J A;  1I4H A;  2WDV B;  4N6E B;  2XK5 A;  1D5M C;  3HM6 X;  1TKY A;  2K0P A;  2PMV A;  4XDC A;  2IY0 B;  1OTR B;  3RNG C;  3EHV A;  3R3M A;  5CHF A;  1SIF A;  3SFD B;  1L6U A;  2EMS A;  3A1Q A;  4OHJ A;  4NNJ B;  4KIK A;  4RF1 A;  1HZ5 A;  2I38 A;  4KGS A;  4C80 A;  1ZW7 A;  3V61 A;  4IWO A;  5AUK A;  1AWD A;  3PRZ A;  3RCZ A;  3HHM A;  3RZW C;  4B6W A;  2LVO A;  1UGJ A;  4MJS A;  2XEW A;  4A3P A;  3EFU A;  3I63 C;  4NAW A;  1GB1 A;  4ASW C;  1WI0 A;  5DPR A;  4MGI E;  4XYC A;  1R4M B;  4R3D A;  1AW7 A;  3KW5 B;  2WDT B;  4KZC A;  4PS7 A;  2DYB A;  4UDU C;  1FEH A;  3ZGZ A;  2MP2 A;  2BB5 A;  2ZPY A;  2DYO A;  3QHT A;  1QKZ A;  4C4V A;  4MM3 B;  1M4V A;  3HRD D;  1VRA B;  2JZP A;  2DLB A;  4IKG A;  1NI3 A;  2BYF A;  3V6E B;  4AP4 C;  3W5U B;  2IO0 B;  3RNB C;  2BGF A;  4KGT A;  3VTU A;  1XCQ L;  2GI9 A;  2K8H A;  3W1S A;  1TY2 A;  2CHZ A;  2PE6 B;  1ZOY B;  2KN5 A;  4GIV A;  2JXT A;  4I6L B;  4HRO A;  2LAS A;  4TV3 A;  5C1Z A;  2KWV B;  4N58 A;  3DBL I;  2J53 A;  3OG5 A;  2WXK A;  3SD5 A;  4A90 A;  3LB8 C;  1L0V B;  4KIK B;  2KJR A;  2PTL A;  4Q2J A;  5GMV A;  2AQ1 B;  4IM2 A;  3DBS A;  5AZH A;  2LWP A;  4NJ7 A;  1Y8R C;  5EE1 A;  1L5P A;  5E6J A;  4ACF A;  2SAK A;  1WXQ A;  1WXM A;  1YX5 B;  4I6P A;  3Q6B A;  2PIA A;  3Q8B A;  3PRE A;  3PRP B;  4M8N A;  4MJS B;  1R4N I;  2LJI A;  2DBY A;  1STE A;  4HCP B;  3PT2 B;  1JWS D;  4OVV A;  2D11 A;  3N20 C;  2LXA A;  1JRU A;  2RPV A;  2LXC A;  4JWU C;  2FIF A;  1A5R A;  1SE2 A;  2G45 B;  2ON8 A;  2AX5 A;  1AAR A;  2JU6 X;  4MSM B;  1ZDV A;  1WMH B;  1JML A;  4TQ1 A;  3VH3 B;  1WRD B;  2PKO A;  4MAC A;  2ASQ A;  2HTH A;  1OFF A;  2GRI A;  1LQB A;  4IC7 B;  3AE5 B;  4DXA B;  2KDM A;  4K1R B;  3P4P B;  4YXD B;  2ZZP B;  1FCC C;  2G4D B;  2KC2 A;  2QIL A;  3W5V B;  4ICV A;  1JRP A;  3PHX B;  2IPK D;  4OVZ A;  4WJQ A;  2QDF A;  1WH3 A;  2WXO A;  4AJY B;  1MHH E;  2WXH A;  3ABV B;  3AE3 B;  3ONS A;  2WS3 B;  3T3N A;  1NDD A;  3RI7 C;  2C60 A;  2LFI A;  4FHK A;  1JWM D;  1YQ3 B;  4YT0 B;  3VH4 B;  3ZIM A;  2KWU B;  4WJO A;  2Y5C A;  2QJL A;  3RNE C;  1HEZ E;  1L4Z B;  4HDO A;  2K1F A;  1FXI A;  4NAM A;  1WXS A;  2B3A A;  4US9 A;  2BBC A;  1FIQ A;  1SIJ A;  2L83 A;  2CR5 A;  3VUY A;  4W9I A;  3ZDM C;  2JXX A;  2KAC A;  2N1V A;  4US8 A;  3T9L A;  1CMX B;  3PGE A;  2AQ2 B;  3LJ3 A;  4BBN C;  3UI3 A;  5C3J B;  4LNN A;  4BOZ B;  1QT9 A;  2D3A A;  1P3Q U;  2EKE C;  2KX3 A;  3MHZ A;  4WWO A;  4YSY B;  1WYW B;  1B9R A;  3AEB B;  3AV8 A;  2JQR B;  1N62 A;  1A70 A;  2PW9 A;  2MLB A;  2FCS A;  4XX5 A;  2Z59 B;  4EZL A;  2FNJ B;  2KVR A;  4IUM B;  2WX0 A;  4YTN B; 
#chains in the Genus database with same CATH homology
 1F2R C;  1I4Q A;  2JX5 A;  2E6X A;  2OED A;  4IOI E;  2V3N A;  1YJI A;  1TY0 A;  2WU5 B;  1JRO A;  1N5W A;  4OZB A;  4ZRQ A;  1NVI D;  5EE9 A;  2WXN A;  2X38 A;  1F0Z A;  1J7C A;  4FXC A;  4ZRP A;  3AE7 B;  1XLN A;  4TMA B;  3NVW A;  1WYG A;  5MPO A;  1F2R I;  2VZK B;  3FAH A;  1HA5 A;  2XNA C;  3BK1 A;  1XLO A;  2AQ3 B;  3P42 A;  4OZA A;  3TUO A;  4H2A A;  5FKA C;  4OZC A;  2EEL A;  2NMQ A;  1PGA A;  2LGI A;  1KLU D;  1QOG A;  3R2T A;  5GXG B;  2N0S B;  3V05 A;  5HFY A;  1FNU A;  2WXL A;  1K51 A;  1VLB A;  2M0A A;  4TSS A;  5D7G A;  4GDL B;  2N9K A;  2WP9 B;  3AEF B;  1JWU D;  5BYR A;  2HTM E;  3VQI A;  2D5G A;  1Y56 A;  3B9J A;  3BK2 A;  3MP9 A;  1JWB D;  4N59 A;  4EE2 A;  4C56 C;  5BYS A;  1I4G A;  2K3U A;  1FCL A;  4KKJ A;  2BW2 A;  2WXI A;  4CQN A;  1KFY B;  1XLQ A;  1AN8 A;  1MHX A;  4ZOH C;  1FFV A;  1YMH E;  1JQ4 A;  3AMZ A;  1DOX A;  3BVM A;  1FM0 D;  2PLP A;  1MI0 A;  1PGX A;  5BMH A;  3W9C B;  2GB1 A;  4XWW A;  3P4R B;  1RWS A;  1ZPS A;  3HUI A;  4AS1 A;  5FR3 A;  1SSN A;  4RFB A;  4AQ7 A;  4J3O D;  5I4D A;  4IDI A;  2INN E;  2PVG C;  1ET6 A;  2JYE A;  1XXG A;  4GDK B;  3AB5 A;  2WU2 B;  2V4I B;  2W3S A;  3I9V 1;  3ZQ4 A;  1VZ6 A;  2V0G A;  4NAW B;  4HEA 1;  1L0X B;  1DGJ A;  3GS2 A;  2CJN A;  2BTE A;  1C4P A;  1ZE3 D;  4KGR A;  3I57 A;  1ZUD 2;  1NYQ A;  1GAQ B;  3L4P A;  1C4A A;  2WXG A;  4RH6 A;  2L32 A;  5H92 C;  1PFD A;  3TEX A;  3IXS A;  4KX6 B;  2VZK D;  3NUH B;  1TZO A;  3AE6 B;  1ENF A;  3AE2 B;  2Z8L A;  2CJO A;  3CIR B;  3Q8C A;  4P6V F;  1EU3 A;  2ZW1 A;  1AYF A;  1PDX A;  2LEK A;  3GP7 A;  4WH4 A;  5BMI A;  1PUT A;  4RGM A;  2J52 A;  2YEP B;  4WIP A;  2MJ3 A;  1WRI A;  1QLB B;  1ET9 A;  2M19 A;  4WAF A;  1BUI C;  1DOY A;  3VRA B;  2BS2 B;  4P16 A;  4B0E A;  3MC0 B;  3DWG C;  3P4Q B;  1P7E A;  2FBW B;  2FUG 1;  3AE1 B;  1D6E C;  3NVY A;  3KWV A;  1FNV A;  4C7Y A;  1T6B X;  3R2I A;  4RNA A;  1HQR D;  2WDQ B;  1ZXH A;  1C79 A;  1T5X D;  2L1A A;  4C7Z A;  1CK1 A;  5G5G A;  1D5X C;  2LHD A;  2DWQ A;  4M0W A;  3AE8 B;  3N9Y C;  2MJE A;  3AN1 A;  1XO3 A;  4YTM B;  1OQR A;  2LMC A;  3BVG A;  1JAL A;  3FC4 A;  1ACC A;  1IUE A;  2V3P A;  1C4C A;  3NRZ A;  1I4H A;  2WDV B;  4L1B A;  1YQ4 B;  1IBX B;  4N6E B;  2IDY A;  3BII D;  4LK0 M;  3SFE B;  1D5M C;  2MJD A;  2IGH A;  1DOI A;  2R61 A;  4ZHO A;  4USA A;  1SJE D;  1EM7 A;  4A9A A;  2FE8 A;  3HVZ A;  1TKY A;  2K0P A;  2PMV A;  1FNW A;  2QMT A;  4LLG M;  4MT5 A;  2E3T A;  2RMM A;  1KH0 A;  1N61 A;  2WXJ A;  4DXG A;  2BYT A;  3AEC B;  1KLG D;  4XWT A;  1GOZ A;  2OHF A;  2WXM A;  3PZ7 A;  4JPS A;  4L2Y A;  3SFD B;  1L6U A;  5EE0 A;  2LUM A;  4LTU A;  4A8X C;  4OHJ A;  2JWU A;  4XE0 A;  4RF1 A;  4WUR A;  1N60 A;  1FO4 A;  1HZ5 A;  2I38 A;  4JE3 B;  1I4X A;  3ZJT A;  4KGS A;  1TKG A;  1PGB A;  4C80 A;  3KQ4 A;  4RGO S;  2I2Y A;  2WXR A;  4HKZ E;  3WCQ A;  3P1M A;  1OQQ A;  1E7P B;  1YN5 A;  5AUK A;  3AM9 A;  1SBB B;  2ICI A;  1AWD A;  1J7B A;  1E10 A;  3TSS A;  1TS2 A;  2HDE A;  4YSZ B;  4ITK A;  1EU4 A;  4GLS C;  1UWM A;  3TEZ A;  1UGJ A;  3U4E G;  3BZD B;  3Q8F A;  1QOA A;  1YNT E;  3CWI A;  4DQO C;  1V1P B;  1NYR A;  2MH7 A;  4B0M A;  1GB1 A;  1C78 A;  4D2K A;  3V3X A;  1L6V A;  3U52 E;  3SEB A;  2J42 A;  4TQ0 A;  1XLP A;  2WXQ A;  1JWA D;  3B2F A;  5FK9 C;  1PYW D;  1V1O A;  4R3D A;  1AW7 A;  1SXT A;  4UDU C;  1FEH A;  3ZGZ A;  1UUP A;  2BB5 A;  3T3O A;  1IBX A;  1K53 A;  2DYO A;  5EE3 A;  2SEB D;  1QKZ A;  1SE3 A;  2K5P A;  1BML C;  3IAM 1;  2Q5W D;  4MM3 B;  3PO0 A;  1M4V A;  3HRD D;  1VRA B;  3AE4 B;  2JZP A;  1GB4 A;  2DLB A;  1KF6 B;  3MFG A;  4IKG A;  2PVO D;  1NI3 A;  1IGD A;  1E0Z A;  1LO5 D;  2KWD A;  4HKQ A;  5LNK 1;  2IJ0 A;  3W5U B;  2NTS A;  1SF0 A;  4WWM A;  1SB3 C;  2M56 B;  3AH7 A;  2YEP F;  4KGT A;  1YN3 A;  2CU3 A;  1XCQ L;  1GPX A;  3O13 A;  2GI9 A;  4RCO A;  2K9X A;  2L52 A;  2MEK A;  3W1S A;  2IGG A;  2WXP A;  1T3Q A;  2RDG A;  1TY2 A;  3NVV A;  1ZOY B;  1B1Z A;  2H89 B;  1VR9 A;  1TS4 A;  2JXT A;  4HRO A;  1FRD A;  2KN4 A;  1EWC A;  3IT4 B;  4N58 A;  3RFZ B;  2J4X A;  3LYY A;  2J53 A;  4HJG E;  1VZ7 A;  5G5H A;  1TS3 A;  2WXK A;  1RFK A;  4A90 A;  3EUB 2;  3LB8 C;  3MJ5 A;  1L0V B;  1SEB D;  2NTT A;  2PTL A;  3NVZ A;  2JYT A;  3NS1 A;  2AQ1 B;  4Q2J A;  1Q10 A;  3P63 A;  1J7A A;  3LXF A;  4NZL B;  1V1P A;  2W55 A;  2G9H D;  1TS5 A;  1XF5 L;  4NJC A;  1ZP0 B;  1K50 A;  1XCT L;  5EE1 A;  1L5P A;  3PZ8 A;  2IGD A;  1CQV A;  2K22 A;  2KQ4 X;  4JWS C;  3Q69 A;  4O1N A;  5E6J A;  1JCK B;  1N5X A;  2SAK A;  1WXQ A;  3AE9 B;  1ESF A;  4ARC A;  2PIA A;  1VDV A;  3Q8B A;  3AEA B;  5TSS A;  1YJJ A;  3ZJU A;  1UWX A;  1HXY D;  1HZ6 A;  4OW0 A;  1EWY C;  1N63 A;  1SE4 A;  2LJI A;  4RGN A;  2DBY A;  2W82 A;  2QIE B;  2ACZ B;  1STE A;  1TYG B;  1ZXI A;  1FMA D;  2QEJ C;  1F77 A;  2W54 A;  1JWS D;  1C76 A;  1NEK B;  3U2S C;  2BS4 B;  2WXF A;  2RDH A;  1I7H A;  2RPV A;  1FRR A;  2XN9 C;  4JWU C;  1D4B A;  3J9C A;  1SE2 A;  2ZW0 A;  1I4R A;  4KKI A;  3GB1 A;  3ZYY X;  2BT6 A;  2ON8 A;  4RF0 A;  4L23 A;  3W2D A;  2AX5 A;  1L4D B;  3BWU D;  1QIL A;  1WGK A;  2JU6 X;  2Y5P A;  4YSX B;  1ZDV A;  4MH8 A;  5BYQ A;  4TQ1 A;  1JML A;  1VJK A;  5BMG A;  2PKO A;  4MAC A;  2BS3 B;  1OFF A;  2Y3A A;  2GRI A;  1MPE A;  3AE5 B;  3ZJV A;  2KDM A;  3P4P B;  1KRH A;  4YXD B;  3Q8A A;  3TEY A;  1FCC C;  4PT5 A;  1XEE A;  2QIL A;  3W5V B;  1JRP A;  3P4S B;  1QOB A;  2IPK D;  4OVZ A;  3R8B A;  3FIL B;  3VR8 B;  1FD6 A;  1C9F A;  2ONQ A;  1ROE A;  1NEN B;  1IGC A;  2WXO A;  3BYT B;  1MHH E;  2KMM A;  4A55 A;  2WXH A;  3ABV B;  3AED B;  3AE3 B;  3IT6 B;  5D3I B;  2WS3 B;  2JSV X;  4ZHP A;  4XDD A;  3T3N A;  5AUI A;  1QF6 A;  1D5Z C;  4REZ A;  3C8Y A;  1R7S A;  3H8H A;  3E9S A;  3KLS X;  1UNS A;  1FFU A;  2B76 B;  3B2G A;  5HHD G;  3VRB B;  3EA6 A;  3ETR A;  2LFI A;  1V8C A;  2LHE A;  2WQY B;  2W3R A;  1YN4 A;  2H88 B;  1JWM D;  1YQ3 B;  4YT0 B;  1I4P A;  3E56 A;  3Q8E A;  1KTK A;  2QSD A;  3EGR A;  2Y5C A;  2EKI A;  1QOF A;  2QJL A;  2WLB A;  3BVZ A;  1HEZ E;  1L4Z B;  3HVD A;  1TJE A;  2DYM A;  1FXI A;  2WDR B;  1QQR A;  4NAM A;  5HG2 A;  4US9 A;  3AEE B;  1WSP A;  2BBC A;  1P7F A;  1FIQ A;  1SIJ A;  2L83 A;  2KAJ A;  1RM6 C;  3URY A;  1FXA A;  5H8Y E;  1CJE A;  2KAC A;  1SJH D;  4US8 A;  4YWG G;  2G1E A;  2AQ2 B;  2N7J A;  1VZ8 A;  1DYQ A;  4WQM A;  3IAS 1;  2N9L A;  3UI3 A;  1E9M A;  2BB6 A;  5C3J B;  3DWM A;  3U7Z A;  3AEG B;  5JXV A;  3KWL A;  4XDC A;  1QT9 A;  3OWE B;  1C77 A;  4DXF A;  4ZYS A;  2INP E;  3MHZ A;  3VR9 B;  1L0Y B;  4YSY B;  3TEW A;  4RGT A;  1V97 A;  4HRS A;  1B9R A;  1ZDX A;  3AEB B;  1JW9 D;  3AV8 A;  1TKE A;  2JQR B;  1N62 A;  3BYY B;  1K52 A;  1A70 A;  2PW9 A;  1BXT A;  3NZ3 A;  4A6Q A;  2TSS A;  4ARI A;  1WWT A;  1MVK A;  4JX1 C;  2WNM A;  1RYJ A;  1CZP A;  5C2T B;  5T8I A;  3RPF C;  3FIL A;  5D3D A;  3SR6 A;  1E6E B;  4YTP B;  5HI1 A;  4YTN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...