4A90A

Crystal structure of mouse sap18 residues 1-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
131
Chain Sequence
ESRVTQEEIPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
total genus 29
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a90A00
4A8XC 4A90A 4A6QA 2HDEA
chains in the Genus database with same CATH superfamily
5KHOA 4W9DA 3H1UA 4IC7B 2MBEA 1BT0A 2W9NA 2K5PA 1YNTE 2K39A 3HVZA 3V6CB 2J7QB 3BK1A 1D6EC 3SD5A 3U8ZA 4YSXB 3ZXRA 2MBQA 3K9OB 2D3GA 3QK0A 4XX5A 1VZ7A 1YOVB 2ZNVB 4RF0A 4JX1C 1FNWA 4HROA 2VZKD 2N7JA 3VR9B 1VDVA 4HCNB 3GE8C 4KDLB 2YLMA 4ICVA 2MX2A 3FILA 2GRIA 3I63C 1IBXB 4EOYA 4N59A 1J0GA 1KH0A 3C0RB 2CU3A 3V05A 2GB1A 2WXQA 3PVLA 4ZRKA 4IDIA 3QC8B 2M1MA 1JWAD 4ZOHC 1MHHE 1TBEA 3RNAC 3W2DA 2PPHA 2V1YA 3PZ7A 5C2TB 3WANA 4ZDVA 2IJ0A 3I5JC 4JE3B 3EECA 3QHTA 3DBLB 5C3JB 3Q69A 4IUMB 1V2YA 4L23A 1CZPA 1ZGUB 4TMAB 4BAXA 2Z59B 4XGAB 4TSSA 5BYQA 5G55A 4A3PA 1XT9B 1ZPSA 2KC1A 2ACZB 5HHDG 4B0MA 3L10B 1OQRA 3OWEB 4TQ0A 4MEMA 3DWMA 1Y56A 2KFKA 1YN4A 3ZDMC 3AH7A 1WJUA 4P7IA 1SSNA 1V1PB 3QJZA 4DHJD 2RMMA 4MSMB 5IP4D 2AYOB 3ZJTA 3QIJA 3BYYB 5EE1A 2MBBB 1QKZA 1KFYB 4HPPA 3KYDD 1SE2A 2KK8A 1PUTA 2J4XA 2N9EB 5AEKB 4P16A 2X8XX 4MDKE 3AMZA 3Q3FA 1VRAB 4XE0A 4BBNC 1HTQA 3UQAA 2BYVE 2LEKA 1WRDB 3W9CB 4D2KA 2OOBB 1A70A 4GLSC 1FRDA 2WXGA 4II2B 2PW9A 3EUB2 4NJCA 3ENEA 4C7YA 5J17A 2NPTB 3ZXVA 3GOEA 3LYYA 2VH2A 1KLVA 4LLGM 1P9DU 2L1AA 1P3QU 2DWQA 1SBBB 2GLSA 4JIOU 2LRUA 3U2SC 1YJJA 1YMHE 2ZPYA 2KQ4X 2QMTA 4HCPB 4TQ1A 1IYFA 2JYTA 2HTHA 4R3DA 5KHQA 2BQQA 2MRPA 2RPQA 4EEWA 4M00A 4KSLC 3VUXA 1C3TA 3ZVVA 1ZKHA 1FCCC 2EKIA 2LJIA 1XLPA 3QA8A 2REXA 2QCZA 4GU2A 1JRUA 4KGSA 1QOBA 4KSKC 2LHDA 2OHFA 5FR6A 2K1FA 1EM7A 2O6VB 2KJHB 4KZ0A 1FEHA 3UQBA 1WF9A 1F1HA 3W1SA 2LMCA 2PE6B 1WMHA 3I9V1 3APDA 1OEYJ 1UELA 4FBJB 1DOXA 4HJGE 5GXGB 1IGCA 4FN2A 4I6PA 2MJEA 2G4DB 1PGXA 1B9RA 4LNIA 2Y5PA 1T6BX 2WXHA 1JMLA 3AN1A 4AP4C 2JT4B 2KO3A 2V9HA 1FFUA 2M4NA 4ZYSA 1PDXA 2W82A 1TKGA 5CX3A 4WURA 2HE7A 4E3CA 3C19A 2XK5A 1AWDA 3ZNZB 4XDDA 2AEHA 4FULA 2KLGA 2WX1A 1Q5WB 3Q3MC 1VZ8A 2HJ8A 2MBHA 3T9LA 3TUOA 1HA5A 1T3QA 1TYGB 3VUWA 4UDUC 1FNUA 2GBRA 4RGTA 1WXAA 3DOWA 4MH0E 4HPLB 4I6NB 4M8MA 3BY4B 4LK0M 2J0MA 2JSVX 4FJVB 2G9HD 1WXSA 3AECB 4K1RB 3E56A 3RUIB 2WDQB 3B0AA 4HK2A 4ARCA 3FILB 1SB3C 2CU1A 3GS2A 3RNEC 1TS3A 1V80A 2FAZA 5I4DA 5H8YE 1GC7A 4NAWB 2BTEA 5IA7A 3PSEB 1WGRA 4WJPA 2FCMA 3AU4A 3VUYA 1F9JA 1FD6A 2BBCA 3EA6A 4IW0A 2GBMA 4BKSA 2BGFA 3WAOA 1HXYD 1UGMA 1P98A 1NENB 4ZRIA 2OJWA 5G5HA 4YSZB 1EWCA 4GSWA 3R7QA 3WAPA 3N9YC 4HLEA 3KUCB 3TL5A 2K0PA 1Q10A 1PYWD 3AXCA 4KIKA 1BUIC 2MA9B 3DHHC 3AV8A 4NJ7A 3TIXA 1NVID 2NS5A 1K8RB 4IM3A 1UH6A 3NZUA 1V6EA 3H7PA 2FBWB 5D3DA 4EUTA 1BXTA 2LVOA 3OG5A 4FADA 3VXWA 3SFEB 4MGYE 2ONQA 2W3SA 3JW0X 5C23A 2IGGA 4TKNA 2WU2B 2AL6A 2QHOA 1C9FA 2ICIA 1WX8A 1SEBD 2KWDA 2J42A 1ISNA 4BKTA 1T0SC 2NVUI 2RR9A 3U30A 2W54A 2KX0A 4WJNA 1V1PA 2JX5A 2I1JA 2N7DA 2INCC 1WZ3A 1SJED 1WJ4A 5EE0A 5CHFA 4GDLA 2KYWA 1STEA 3RNFC 2GBJA 2Z0EB 4EFOA 1R7SA 2L3ZA 3PLUA 1OQQA 2HDEA 2KJ6A 4W9KA 3P42A 4JQWC 2D10A 3ML9A 3PRPB 4KGTA 4AUQC 5JHAA 3R2TA 4J6IA 4DHZB 1NDDA 3RI7C 2N7EA 3PHXB 3RNCC 1H8CA 4W9CA 2N0SB 4YTMB 2D07B 1WJNA 4PYZA 1N5WA 3PPAA 2LJ5A 2WXIA 2QJLA 2K8CA 4BFRA 4LNFA 1TJEA 2RPVA 3SFDB 2WWZA 2MCNB 1ET9A 2M56B 5D7GA 3IT4B 3JSVA 1WFYA 3KW5B 1NBFC 1Z2MA 3OLMD 4CYEA 3DBSA 2WU5B 1GUAB 2WXFA 1T0RC 1KOTA 4I6LB 4ZRQA 2N1WA 3P4QB 1ZXHA 3C8YA 4A20A 2MLBA 1WX9A 3ZKJC 2C60A 3DBLI 3DCGA 2PEAA 4IWOA 3R2IA 4M01A 5D3IB 2KZRA 5IAAC 3X23A 1JALA 2BB6A 4IM0A 1SE4A 1Z5SB 4X57B 5J2RA 3LB8C 1JWUD 1BMLC 3Q8EA 2BYTA 3E9SA 4C00A 4B9KA 2XNAC 3DQVA 3VHTC 1HQRD 4WJQA 1QILA 2Y3AA 5AZHA 1T0QC 3ZW3A 5AUIA 3R7RA 3RNGC 5JHBA 2KJRA 3H7SA 1ET6A 1CMXB 2X38A 3KQ4A 2XK5B 4EE2A 4ZRPA 4P1BC 1RAXA 4N58A 4W9JA 1EU4A 4RCOA 1OFFA 2Z0DB 1TTNA 5FR3A 3V61A 1E7PB 1TS5A 1KM7A 3AE8B 4LJOB 4G3XB 4YT0B 3K9PB 1WWTA 3PLVA 3QCAA 4DXFA 2KX3A 1D4BA 2XBBC 4P1CC 2RGFA 1YX5B 1VJKA 4ASWC 1RFKA 3LJ3A 3BK2A 1WMHB 3OJ3A 2N9LA 1ZDVA 1T5XD 3JVZX 2QEJC 4W9FA 4OZBA 4AWJA 2BWFA 3PZ8A 1UF0A 2DAFA 1N63A 3NS8A 1C79A 2V3SA 3A4RA 4B95A 2D3AA 1JROA 2YVCA 1CJEA 4B0EA 2VZKB 2FCSA 1VLBA 1LM8B 1LGRA 2EMTA 1FM0D 4ACFA 3HHMA 3V3XA 2B3AA 2K22A 1HE8A 3SU8X 2G3QB 2ZJDA 2PMVA 5D2MB 2WDVB 2MJDA 1SJHD 2I2YA 1XLNA 4YSYB 1E7VA 1GG3A 1WGDA 3NOBA 3IHPC 1CQVA 3U52E 3VVWB 3Q3NC 1E10A 2KC2A 2O2VB 2QDFA 4H2AA 2KDMA 3CMMB 2Z8LA 1IPGA 3GE3C 1TZ1A 5L83A 1E6EB 4E74A 1OEYA 4S0RA 4HWIB 5EE3A 1WY8A 1Y8RC 4L2YA 2ZVOA 4AOFA 3RULA 3TEWA 2GBNA 2IO2B 4MJSB 3BINA 2ZPNA 1FMAD 2ON8A 1RWSA 5JZEB 2C7HA 1L6VA 1KLUD 1QOGA 2B76B 1MG4A 5EE9A 4DHJB 1PFDA 2KNBA 2LXAA 1C1YB 3DHIC 1E8XA 2A4ZA 2ZEQA 3VH4B 4XYCA 3Q8BA 4KDIC 2LGDA 3AE1B 1WX7A 4PS7A 1EF1A 2IY0B 3MFGA 2JWZA 3NY5A 3VTUA 3NUHB 2IO0B 2M19A 5BMIA 4F7ZA 1M94A 3ML8A 2LASA 2BWES 3NS1A 2KQSA 4USAA 2ZVNA 1WIAA 2L0FA 2QIEB 3BYTB 1MPEA 3VQIA 4NQLB 4YTNB 3PO0A 2IYDB 1EF5A 1ACCA 3JSVB 4YTPB 4PK1A 2L0TA 4O1NA 1UD7A 1OGWA 2AQ1B 1D3ZA 1UWXA 3A4SC 1JWBD 1V5TA 3MC9A 3R3MA 3Q8CA 4Q2JA 3DWGC 1WXVA 3KUZA 2WXNA 3H7PB 2KANA 2Y5BB 2H89B 1V86A 2K6DB 4RF1A 1K50A 2CJNA 1XF5L 4WWNA 3KVFB 3ABVB 1WI0A 3AM9A 2PLPA 1HZ5A 2IGHA 3QARA 1TIFA 2PVGC 1I4GA 2L00B 1Q1OA 2FUG1 1FXTB 4AJWA 4GIVA 1WXQA 1L7YA 4W9HA 5LXIB 3L4PA 1V81A 2JPHA 1FFVA 3LDZE 1N61A 3NVWA 4DWFA 4HXDA 2V4IB 3QWZB 4IWQA 2FUHB 3B1LX 2KAJA 3BWUD 4EZJA 4EZLA 2AL3A 2INPE 5DPSA 4HKZE 1YQ3B 2GMIC 2KN5A 2Y5CA 1M4VA 3ETRA 3WAMA 1V49A 3MHZA 2V0GA 2I38A 4MM3A 3NZ3A 1YN3A 1P1AA 2L7RA 2QILA 2L32A 2VH1A 4EKUA 4GDKA 2L05A 2XN9C 3CIRB 3P2BA 3W5VB 1YD8U 2FCNA 3P4PB 1YQBA 3ZYYX 4TV3A 4ANUA 2IO1B 2CS4A 2WP9B 3PGEA 5BMHA 2CKHB 4RNAA 1NI2A 3ZNHB 2JZPA 2KKCA 2LZ6A 5L95C 1J19A 3NVZA 2AQ2B 4MGZE 2KWVB 2BS4B 2IDYA 2GI9A 3ZGZA 3CF6E 3FC4A 3TJPA 3L08A 1RFAA 1VCBA 2WXKA 4WWPA 4XWWA 3VTWA 4RGNA 3PZDA 1NYQA 2PTLA 3T3NA 1R4NB 4NPNA 3RD2A 2DZKA 2O6VD 4FA6A 2RD0A 1K53A 1ZDXA 3HK0A 3APCA 3RT3B 1AARA 3IXSA 4F1SA 3ZO5B 3CWIA 2BS2B 1TT5B 1XCQL 2ZNVC 4CQNA 4RFBA 3VFKA 5CHWA 3X0WA 2M17A 2C9WB 4PS3A 2OJRA 3MJWA 2RSUA 3AEEB 3N20C 1DGJA 2N1VA 2NTTA 3HM3A 3P63A 4FLHA 3PTFC 2IZVB 1UZXB 2WXLA 2KOXA 3AE7B 4EZKA 3ZJVA 4PYUA 2UYZB 5BO4B 1OQYA 4LCDE 1UWMA 3DDCB 3KLSX 5HKHA 4KKJA 1V97A 1SGHA 3PRZA 1QOAA 2MP2B 1YJIA 4HEA1 4MACA 5LLIA 1J7BA 3RZFA 3L16A 3V6EB 4BOZB 3AULA 1T0YA 3EFUA 2KACA 3TCAA 1UGJA 4IKGA 5BYSA 1E8WA 2DLBA 1H4RA 3A1QB 4DXAB 1WGKA 4JGHB 3OAWA 1HEZE 4ANWA 1K51A 4HJKA 2G4SA 2KN4A 1MJDA 1J7AA 4HDQA 1FNVA 1FIQA 2NMQA 4CO7A 4KV2A 2DHZA 3ALBA 4LJPB 1RM6C 3PT2B 2W3RA 2NBWB 5E6PA 4XDCA 4DDID 2DENB 1JWMD 1PGBA 2JRIB 2JRHA 4RMAA 2GBKA 3ZQ4A 1D5XC 2J0KA 3A1QA 2AWTA 2WXJA 1PGAA 2FNJB 3ZLZA 4E71A 4K81A 2BS3B 1F77A 4PS8A 2D5GA 2FIFA 5LNK1 3VH3B 2ZW1A 1E9MA 5AUKA 2MJ3A 3KUDB 4OW0A 4FHKA 2OEDA 5IKCM 5H92C 3KH0A 1QQRA 2KHWB 1EO6A 2BVCA 4BKSD 5TR5A 3IG3A 2XEWA 2KQ7A 1TS4A 2ASQA 4A9AA 4RM8A 4KGRA 2FIDA 1ESFA 2NR2A 1F52A 3UF8A 2PE9A 3V62A 1N62A 1L5PA 2WX0A 4XWTA 4YXDB 1QT9A 1RLFA 3AE2B 4LDTB 3FAHA 3URYA 3HM6X 4M0WA 2BPSA 3NZSA 4OVVA 3DBRI 4C4VA 4RGMA 2G1EA 1FXAA 3W1SC 1U4AA 4N6EB 4YL8A 4WAAA 4BVUC 4ITKA 1NI3A 1MG8A 1GB4A 1E90A 2R2QA 1XEEA 3NJTA 4A3OA 2CJOA 2L83A 2JQRB 3IFWB 1JRPA 2WXMA 2GOWA 1GPXA 4KVGB 2ZCCA 2VRRB 3SHQA 1D5ZC 4MGIE 4JWSC 4FHJA 3T8MA 3ONSA 1LXDA 2R61A 3O13A 3W1YA 1L0XB 3AEFB 1ENFA 4GDKB 3NVVA 2E3TA 1EWYC 3B08A 2DAJA 1C4CA 3P4RB 4OVZA 1AN8A 2MEKA 1SIFA 2ZCBA 2K25A 1WM2A 1WZ0A 1TY0A 2KFJA 1I42A 2LFIA 3L17A 4TUUA 2FCQA 3I3TB 3ZRFA 1JCKB 2KWCA 1DOYA 5DPTA 2NBUA 3P4SB 2ZZPB 2WQYB 3OJ4B 2NTSA 3RN9C 2LGYA 3Q14C 2WDTB 3NG0A 3RZWC 2WXPA 2R2OA 1L2NA 4GMVA 3EGRA 1I4HA 1C78A 5C1ZA 2DYBA 3RMKC 3Q8FA 1GOZA 1MVKA 3Q3JA 5DPRA 5GMVA 1I4QA 4L1BA 1E8YA 2BKFA 5DPWA 2WNMA 1LO5D 3UINB 4K7SA 2QC8A 1S1QB 3AE3B 1UBQA 4C7ZA 3MC0B 3TEXA 4JPSA 4A55A 2MH7A 3A9KA 2K8HA 3M95A 3U4EG 1TKEA 3MJ5A 1WR6E 2IGDA 2J53A 5HFYA 1SIJA 1FPYA 1WM3A 3AE6B 3WCQA 3B9JA 1S3SG 1GB1A 2JWUA 5LXHA 1RYJA 3B2GA 5MPOA 4A6QA 3VR8B 1X1MA 1JWSD 3DBHB 5DCNA 2YEPB 3DVGY 4BKGA 2MP2A 4NQKE 2KLCA 3N32A 1E8ZA 2KDEB 1KJTA 1N6ZA 4BBNF 3W5UB 2KT7A 2Q5WD 1YN5A 3NRZA 2D3CA 2RDHA 1I4RA 1ZW7A 2J52A 3DVGX 2LXCA 3BIID 1R4MI 3BZDB 2PKOA 5EDSA 1FRRA 3L13A 1PQSA 4LNNA 4PT5A 1XLQA 4IWPA 5AZFA 3H8HA 2CR5A 2IO3B 4C56C 3Q6BA 2NCNA 2LGXA 3N1ZC 2HJ1A 2DBYA 1L6UA 1AYFA 2K9XA 3CSFA 4OZAA 1FO4A 1JQ4A 1HZ6A 4GOCA 1NYRA 1WGHA 1F0ZA 4HRSA 1VR9A 4K7WA 3EC8A 3WA0A 1UNSA 3BVGA 1EU3A 1GC6A 1GNUA 3UIOB 1ROEA 2PIAA 2LD9A 3GZNI 1I4PA 2TSSA 2M8SA 1NEKB 2JF5A 5E6NA 2G45B 3GB1A 3N1YC 3AE9B 1WGYA 4WQMA 3DBRB 1GJZA 1A5RA 2D11A 3KWLA 4N9F4 3ZNID 1I4XA 1N5XA 2BT6A 2LHEA 4K7UA 4NY0A 5HG2A 4QAYA 1G6JA 3L0WB 4W9IA 3PV1A 4MM3B 2BYFA 3TMPB 3P1MA 2KDBA 3ZIMA 1VD2A 3IVFA 4CHKA 3CSTA 2IPKD 1C76A 2HTME 4OVUA 2DNFA 1Q0WB 2EMSA 3AEGB 4RH6A 2RDGA 4HDOA 5E6JA 1E0ZA 3T3OA 2WHIA 1I7HA 3QX1A 1D5MC 2D3BA 4WAFA 2DX5B 4KX6B 1V5OA 5D94A 1E5WA 2DZJA 2LGSA 4IM2A 4NAMA 4A90A 3ZTCA 2I1KA 1OTRB 5G5GA 2H88B 2M0XA 4IG7B 3H9DA 5FKAC 3S2AA 1RRBA 1XD3B 3BVMA 4WWOA 3Q8AA 1E7UA 2BF8B 4DXGA 5IN7A 4GXBA 4W9EA 5HI1A 2LGIA 4REZA 3AEDB 1SE3A 2A5UA 5BMGA 3AI5A 3V60A 3LXFA 1WJ6A 2C7MB 4MT5A 1YJ1A 2SEBD 4URKA 3PS6A 2AX5A 2NPTA 3JYUA 3MTNB 1MI0A 3ZJUA 4US8A 2N9KA 4FJYA 1ZOYB 1J8CA 3M3JA 1TGZB 1QOFA 1KF6B 1YQ4B 2KVRA 4ZRJA 3J9CA 2KTFA 3U7ZA 4BOSC 3ZTDA 2KXJA 4IOIE 2WGSA 3A9JB 4ZYNA 4WH4A 4JL9A 1F2RC 4S17A 4NNJB 2L52A 3DPDA 1N60A 2KFKB 1XQQA 1P7FA 3DHGC 3UIPB 1TS2A 5G2NA 1AW7A 2KVZA 3AE4B 3ZDTA 2D2QA 2MWSB 3A33B 1IP9A 1TY2A 2EKEC 3IAM1 1IBXA 2KDIA 4ZHPA 2BB5A 2LRWA 2MHJA 3MC8A 1L0YB 2V3NA 3VRAB 4G11A 3GP7A 2HD5B 4J3OD 2L8JA 2WDRB 3RPFC 3RNBC 2QSDA 3KYCD 2E6XA 3UGBB 1P0RA 4W9GA 3QAQA 1WSPA 3A9JA 1LFDA 2BW2A 2V3PA 2LVPA 3L54A 3TSSA 1XCTL 1ZXIA 2K6QA 4DDGD 3Q3OC 2MSED 3AEAB 2LUMA 2LWPA 4II3B 4C4VB 4MGKE 2JY6A 4M0WB 2MBOA 3IAS1 3N3KB 2CHZA 4HPMB 4WQOB 1L0VB 1TKYA 1MFWA 3HRDD 3HUIA 3VRBB 3MP9A 2EELA 3I57A 4LTUA 1ZP0B 4G0NB 2O2VA 3RFZB 3SEBA 2N9XA 2WXOA 4JLCA 2YEPF 2LI5A 4MH8A 4DK5A 1UUPA 2N9PC 4GN1A 1V1OA 3VDZA 4GDLB 3B2FA 5J18A 1V8CA 4DHZE 4A8XC 2INNE 1XXGA 3GZNB 1C4PA 2FE8A 3SR6A 2PVOD 5T8IA 1HTOA 1DOIA 2MW5A 3WALA 2DZMA 4YWGG 1WXMA 3DBHI 4JWUC 4DQOC 3TEZA 2KDFB 3FKYA 4FJZA 3TBLD 4AQ7A 3NVYA 4ZHOA 3RCZA 3Q2AC 4F8CB 1R4NI 5BYRA 2INDC 3WIMA 4XZ4A 4NZLB 4B6WA 1LQBA 4NJ6A 2JUOA 3N30A 1YIWA 4P6VF 3O65B 3H6NA 3R66C 3HIZA 2W55A 5CHVC 5IO9A 4KZCA 1K52A 1DYQA 2RDBC 1B1ZA 1UBIA 1XLOA 3PREA 5IOIA 2CHWA 3UI3A 1YX6B 2LVQA 3SDLC 1KLGD 1SXTA 2PJHA 4BZAA 1L4DB 4LNKA 1SF0A 3QQ8B 4ARIA 4KIKB 4XC2A 2V4LA 1QF6A 1WGGA 4LNOA 3IBEA 2JXTA 1WRIA 2DYMA 4OHJA 1WYWB 4K3BA 1QZEA 2WXRA 2DZIA 2KTRA 4RM9A 1KTKA 2K8BA 2JXXA 4MJSA 4GB9A 2DYOA 1MHXA 1P7EA 3RYTA 1F2RI 2L76A 3M63B 4NAWA 3VAWA 3ZUNA 1ZE3D 3ECIA 2AQ3B 3EHVA 1WH3A 1C4AA 1XO3A 3NHEB 1EUVB 2UU7A 1WYGA 1CK1A 4ICUA 4RGOS 5JXVA 2KWUB 2NBVB 3ZRCA 2CHXA 4DBGA 3EFCA 2JVCA 1R4MB 2IY1B 4GGQA 2LUEA 4HKQA 4AS1A 2WYQA 2JZ3B 4M02A 4ANVA 2C5LC 3AEBB 1IUEA 4OZCA 2N4FA 1V9JA 3AB5A 2K3UA 5JH5C 1JW9D 1KRHA 1I35A 1L4ZB 4LDTD 1WE7A 1QLBB 2KMAA 3R8BA 2BYEA 4K3CA 1FXIA 3PRMB 3DVNV 1TZOA 3M62B 2JZZA 3U7DA 3VTVA 2KTRB 2MQJA 3ZNGC 3D32A 4WWMA 4MELA 2ZW0A 4WIPA 4KKIA 1WE6A 3AE5B 4ANXA 5E6OA 4C80A 3TEYA 2BKRB 2KMCA 4WJOA 3PHWB 2IBIB 2JU6X 4M8NA 2UWQA 4FXCA 4HVBA 1FCLA 5TSSA 4AJYB 3KWVA 4MSQB 2M0AA 3IT6B 3A9KB 1SE9A 2KMMA 5D6JB 5FK9C 1J7CA 2WLBA 2JYEA 1C77A 1GAQB 2C7NB 4US9A 2WS3B 3HVDA 3MHSD 2SAKA 3BVZA 2KD0A 4W9LA 3AU5A 2J0JA 3N1XC 5CTRC 1VZ6A 2O6VA 1WR1A 5AZGA 1ZUD2 1IGDA 4G50A 3APFA 3DVNU
chains in the Genus database with same CATH topology
3FC4A 4KGTA 2WXKA 3GB1A 3R2TA 3AE9B 4WQMA 4XWWA 2K5PA 1YNTE 3KWLA 3HVZA 4RGNA 3BK1A 1D6EC 1I4XA 1NYQA 2PTLA 3T3NA 1N5XA 2N0SB 4YSXB 4YTMB 1K53A 2BT6A 1ZDXA 2LHEA 1N5WA 5HG2A 2WXIA 2QJLA 3IXSA 3CWIA 1TJEA 2RPVA 1VZ7A 3SFDB 4MM3B 1ET9A 4RF0A 2M56B 4JX1C 5D7GA 2BS2B 1FNWA 1XCQL 2VZKD 2N7JA 4HROA 3IT4B 3VR9B 4CQNA 3P1MA 4RFBA 1VDVA 2IPKD 1C76A 2HTME 3AEEB 3FILA 2GRIA 2WU5B 2WXFA 1IBXB 3AEGB 4N59A 4RH6A 2RDGA 1DGJA 2NTTA 5E6JA 1E0ZA 3T3OA 3P63A 4ZRQA 1KH0A 1I7HA 3P4QB 1D5MC 2CU3A 1ZXHA 2WXLA 3V05A 3AE7B 2GB1A 4WAFA 3ZJVA 2WXQA 4KX6B 3C8YA 4NAMA 4A90A 1UWMA 3KLSX 4IDIA 4KKJA 1V97A 5G5GA 1JWAD 4ZOHC 3R2IA 2H88B 1QOAA 5D3IB 1YJIA 4HEA1 1MHHE 4MACA 5FKAC 1J7BA 3BVMA 1JALA 3W2DA 2BB6A 3Q8AA 1SE4A 4DXGA 2KACA 3PZ7A 5HI1A 1UGJA 2LGIA 5C2TB 4IKGA 2IJ0A 4REZA 5BYSA 2DLBA 3LB8C 3AEDB 4JE3B 1JWUD 5C3JB 3Q69A 1SE3A 5BMGA 1BMLC 3Q8EA 1WGKA 4L23A 1CZPA 3LXFA 4TMAB 2BYTA 3E9SA 1HEZE 2XNAC 4MT5A 1K51A 4TSSA 2SEBD 2AX5A 1HQRD 2KN4A 5BYQA 1J7AA 1FNVA 1MI0A 1QILA 2Y3AA 1ZPSA 3ZJUA 1FIQA 2NMQA 2N9KA 2ACZB 5HHDG 4US8A 1ZOYB 4B0MA 1RM6C 5AUIA 1QOFA 1KF6B 1YQ4B 1OQRA 3OWEB 3J9CA 3U7ZA 4TQ0A 4IOIE 3DWMA 2W3RA 4WH4A 1ET6A 2X38A 3KQ4A 4EE2A 1F2RC 4XDCA 4ZRPA 1Y56A 2L52A 1YN4A 4N58A 1EU4A 1N60A 4RCOA 1OFFA 1P7FA 3AH7A 1JWMD 1PGBA 1TS2A 1SSNA 1V1PB 1AW7A 3AE4B 5FR3A 2RMMA 1E7PB 3ZQ4A 1D5XC 1TS5A 3ZJTA 3BYYB 5EE1A 2WXJA 1QKZA 1KFYB 1PGAA 3AE8B 4YT0B 1SE2A 1PUTA 1TY2A 2J4XA 4P16A 1WWTA 2BS3B 3IAM1 1F77A 1IBXA 3AMZA 1VRAB 4XE0A 2BB5A 4DXFA 4ZHPA 1D4BA 2LEKA 2D5GA 3W9CB 5LNK1 1L0YB 4D2KA 2V3NA 2ZW1A 3VRAB 1E9MA 1A70A 3GP7A 5AUKA 4GLSC 1FRDA 1VJKA 4J3OD 2WDRB 1RFKA 2WXGA 3RPFC 2MJ3A 3BK2A 4OW0A 2N9LA 2PW9A 1ZDVA 3EUB2 2OEDA 1T5XD 4NJCA 2QEJC 5H92C 2QSDA 1QQRA 2E6XA 4C7YA 4OZBA 3PZ8A 3LYYA 4LLGM 1WSPA 1TS4A 1N63A 2L1AA 1C79A 4A9AA 1JROA 4B0EA 1CJEA 4KGRA 2DWQA 1ESFA 2VZKB 2BW2A 1SBBB 1VLBA 2V3PA 3TSSA 1FM0D 1N62A 1L5PA 4XWTA 1XCTL 1ZXIA 3U2SC 1YJJA 4YXDB 1QT9A 1YMHE 3V3XA 3AEAB 2K22A 2LUMA 2KQ4X 2QMTA 3AE2B 4TQ1A 3FAHA 1NEKB 3URYA 2JYTA 3IAS1 2PMVA 4M0WA 4R3DA 2WDVB 2MJDA 1SJHD 1L0VB 4RGMA 2G1EA 1TKYA 1FXAA 2I2YA 1XLNA 4YSYB 4N6EB 3HRDD 3HUIA 3VRBB 4ITKA 3MP9A 1NI3A 1GB4A 2EELA 3I57A 1XEEA 4LTUA 1ZP0B 1CQVA 3U52E 2CJOA 2L83A 1E10A 1FCCC 2EKIA 2JQRB 2LJIA 3RFZB 1XLPA 3SEBA 2WXOA 1JRPA 2WXMA 4H2AA 2YEPF 2KDMA 4KGSA 1GPXA 1QOBA 2Z8LA 4MH8A 2LHDA 2OHFA 1UUPA 1E6EB 1V1OA 1D5ZC 1EM7A 5EE3A 4L2YA 4GDLB 4JWSC 3TEWA 1FEHA 3B2FA 3W1SA 1V8CA 2LMCA 4A8XC 2INNE 3I9V1 1XXGA 2R61A 1C4PA 2FE8A 3O13A 1FMAD 3SR6A 1DOXA 1L0XB 2PVOD 4HJGE 2ON8A 1DOIA 5GXGB 1RWSA 3AEFB 5T8IA 1IGCA 1L6VA 1ENFA 2MJEA 4YWGG 4GDKB 1PGXA 4JWUC 1KLUD 3NVVA 1B9RA 1QOGA 2B76B 2Y5PA 2E3TA 5EE9A 4DQOC 3TEZA 1EWYC 1T6BX 2WXHA 1PFDA 1JMLA 4AQ7A 3AN1A 1C4CA 3P4RB 3NVYA 4ZHOA 5BYRA 1FFUA 4ZYSA 1PDXA 4NZLB 2W82A 1TKGA 4OVZA 1AN8A 2MEKA 4P6VF 3Q8BA 1TY0A 3AE1B 2W55A 4WURA 3MFGA 1K52A 2LFIA 1DYQA 1B1ZA 1JCKB 1DOYA 1XLOA 3NUHB 1AWDA 4XDDA 3UI3A 1KLGD 2M19A 3P4SB 5BMIA 1SXTA 2WQYB 1L4DB 1SF0A 1VZ8A 4ARIA 2NTSA 3TUOA 1HA5A 1QF6A 3NS1A 2WXPA 2JXTA 1T3QA 1TYGB 1WRIA 4USAA 4UDUC 2DYMA 1FNUA 3EGRA 4OHJA 1I4HA 4RGTA 1C78A 2WXRA 3Q8FA 1GOZA 1MVKA 2QIEB 3BYTB 1MPEA 1KTKA 4LK0M 2JSVX 3VQIA 2G9HD 4YTNB 3PO0A 1ACCA 1I4QA 4L1BA 3AECB 4YTPB 3E56A 4O1NA 2WDQB 2DYOA 1MHXA 1P7EA 2WNMA 4ARCA 1LO5D 2AQ1B 3FILB 1F2RI 1SB3C 3GS2A 1ZE3D 1UWXA 2AQ3B 1TS3A 1XO3A 1C4AA 1JWBD 3AE3B 5I4DA 4C7ZA 1WYGA 1CK1A 3MC0B 5H8YE 3TEXA 4JPSA 4A55A 2MH7A 4NAWB 4RGOS 2BTEA 5JXVA 3U4EG 1TKEA 3MJ5A 3Q8CA 4Q2JA 2IGDA 3DWGC 2J53A 5HFYA 1SIJA 2WXNA 1FD6A 3AE6B 3WCQA 2H89B 4HKQA 2BBCA 3B9JA 3EA6A 1GB1A 4AS1A 2JWUA 1RYJA 3B2GA 4RF1A 5MPOA 1HXYD 1K50A 2CJNA 1XF5L 4A6QA 1NENB 3VR8B 3ABVB 3AEBB 5G5HA 3AM9A 1IUEA 1JWSD 1HZ5A 2PLPA 2IGHA 4OZCA 1EWCA 4YSZB 3AB5A 3N9YC 2PVGC 1I4GA 2K3UA 1JW9D 1KRHA 2K0PA 2FUG1 1Q10A 1PYWD 1L4ZB 2YEPB 1BUIC 1WXQA 1QLBB 3AV8A 3R8BA 3L4PA 1FXIA 1FFVA 1NVID 1TZOA 1N61A 3W5UB 3NVWA 2V4IB 2Q5WD 1YN5A 3NRZA 2RDHA 1I4RA 4WWMA 2KAJA 3BWUD 2J52A 2ZW0A 2FBWB 4WIPA 5D3DA 3BIID 2INPE 1BXTA 4HKZE 4KKIA 1YQ3B 3AE5B 3BZDB 3SFEB 2PKOA 2ONQA 2W3SA 2Y5CA 4C80A 3TEYA 1FRRA 1M4VA 3ETRA 2IGGA 4PT5A 1XLQA 2WU2B 3MHZA 2V0GA 2JU6X 3H8HA 4C56C 2I38A 1C9FA 4FXCA 3NZ3A 2ICIA 5TSSA 1YN3A 1FCLA 3KWVA 1SEBD 2M0AA 2QILA 2L32A 3IT6B 2KWDA 2KMMA 2J42A 5FK9C 1J7CA 2XN9C 3CIRB 2WLBA 2DBYA 3W5VB 1L6UA 1AYFA 2K9XA 3P4PB 4OZAA 2JYEA 1FO4A 1JQ4A 1HZ6A 1C77A 1GAQB 3ZYYX 1NYRA 2W54A 4US9A 2WS3B 1F0ZA 4HRSA 3HVDA 1VR9A 1V1PA 2JX5A 2WP9B 5BMHA 1UNSA 2SAKA 3BVZA 3BVGA 1EU3A 1SJED 4RNAA 5EE0A 2JZPA 1VZ6A 1STEA 1ROEA 2PIAA 3NVZA 1R7SA 2AQ2B 1OQQA 2HDEA 1ZUD2 2BS4B 1I4PA 1IGDA 2IDYA 3P42A 2TSSA 2GI9A 3ZGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8X C;  4A90 A;  4A6Q A;  2HDE A; 
#chains in the Genus database with same CATH topology
 5KHO A;  4W9D A;  3H1U A;  4IC7 B;  2MBE A;  1BT0 A;  2W9N A;  2K5P A;  1YNT E;  2K39 A;  3HVZ A;  3V6C B;  2J7Q B;  3BK1 A;  1D6E C;  3SD5 A;  3U8Z A;  4YSX B;  3ZXR A;  2MBQ A;  3K9O B;  2D3G A;  3QK0 A;  4XX5 A;  1VZ7 A;  1YOV B;  2ZNV B;  4RF0 A;  4JX1 C;  1FNW A;  4HRO A;  2VZK D;  2N7J A;  3VR9 B;  1VDV A;  4HCN B;  3GE8 C;  4KDL B;  2YLM A;  4ICV A;  2MX2 A;  3FIL A;  2GRI A;  3I63 C;  1IBX B;  4EOY A;  4N59 A;  1J0G A;  1KH0 A;  3C0R B;  2CU3 A;  3V05 A;  2GB1 A;  2WXQ A;  3PVL A;  4ZRK A;  4IDI A;  3QC8 B;  2M1M A;  1JWA D;  4ZOH C;  1MHH E;  1TBE A;  3RNA C;  3W2D A;  2PPH A;  2V1Y A;  3PZ7 A;  5C2T B;  3WAN A;  4ZDV A;  2IJ0 A;  3I5J C;  4JE3 B;  3EEC A;  3QHT A;  3DBL B;  5C3J B;  3Q69 A;  4IUM B;  1V2Y A;  4L23 A;  1CZP A;  1ZGU B;  4TMA B;  4BAX A;  2Z59 B;  4XGA B;  4TSS A;  5BYQ A;  5G55 A;  4A3P A;  1XT9 B;  1ZPS A;  2KC1 A;  2ACZ B;  5HHD G;  4B0M A;  3L10 B;  1OQR A;  3OWE B;  4TQ0 A;  4MEM A;  3DWM A;  1Y56 A;  2KFK A;  1YN4 A;  3ZDM C;  3AH7 A;  1WJU A;  4P7I A;  1SSN A;  1V1P B;  3QJZ A;  4DHJ D;  2RMM A;  4MSM B;  5IP4 D;  2AYO B;  3ZJT A;  3QIJ A;  3BYY B;  5EE1 A;  2MBB B;  1QKZ A;  1KFY B;  4HPP A;  3KYD D;  1SE2 A;  2KK8 A;  1PUT A;  2J4X A;  2N9E B;  5AEK B;  4P16 A;  2X8X X;  4MDK E;  3AMZ A;  3Q3F A;  1VRA B;  4XE0 A;  4BBN C;  1HTQ A;  3UQA A;  2BYV E;  2LEK A;  1WRD B;  3W9C B;  4D2K A;  2OOB B;  1A70 A;  4GLS C;  1FRD A;  2WXG A;  4II2 B;  2PW9 A;  3EUB 2;  4NJC A;  3ENE A;  4C7Y A;  5J17 A;  2NPT B;  3ZXV A;  3GOE A;  3LYY A;  2VH2 A;  1KLV A;  4LLG M;  1P9D U;  2L1A A;  1P3Q U;  2DWQ A;  1SBB B;  2GLS A;  4JIO U;  2LRU A;  3U2S C;  1YJJ A;  1YMH E;  2ZPY A;  2KQ4 X;  2QMT A;  4HCP B;  4TQ1 A;  1IYF A;  2JYT A;  2HTH A;  4R3D A;  5KHQ A;  2BQQ A;  2MRP A;  2RPQ A;  4EEW A;  4M00 A;  4KSL C;  3VUX A;  1C3T A;  3ZVV A;  1ZKH A;  1FCC C;  2EKI A;  2LJI A;  1XLP A;  3QA8 A;  2REX A;  2QCZ A;  4GU2 A;  1JRU A;  4KGS A;  1QOB A;  4KSK C;  2LHD A;  2OHF A;  5FR6 A;  2K1F A;  1EM7 A;  2O6V B;  2KJH B;  4KZ0 A;  1FEH A;  3UQB A;  1WF9 A;  1F1H A;  3W1S A;  2LMC A;  2PE6 B;  1WMH A;  3I9V 1;  3APD A;  1OEY J;  1UEL A;  4FBJ B;  1DOX A;  4HJG E;  5GXG B;  1IGC A;  4FN2 A;  4I6P A;  2MJE A;  2G4D B;  1PGX A;  1B9R A;  4LNI A;  2Y5P A;  1T6B X;  2WXH A;  1JML A;  3AN1 A;  4AP4 C;  2JT4 B;  2KO3 A;  2V9H A;  1FFU A;  2M4N A;  4ZYS A;  1PDX A;  2W82 A;  1TKG A;  5CX3 A;  4WUR A;  2HE7 A;  4E3C A;  3C19 A;  2XK5 A;  1AWD A;  3ZNZ B;  4XDD A;  2AEH A;  4FUL A;  2KLG A;  2WX1 A;  1Q5W B;  3Q3M C;  1VZ8 A;  2HJ8 A;  2MBH A;  3T9L A;  3TUO A;  1HA5 A;  1T3Q A;  1TYG B;  3VUW A;  4UDU C;  1FNU A;  2GBR A;  4RGT A;  1WXA A;  3DOW A;  4MH0 E;  4HPL B;  4I6N B;  4M8M A;  3BY4 B;  4LK0 M;  2J0M A;  2JSV X;  4FJV B;  2G9H D;  1WXS A;  3AEC B;  4K1R B;  3E56 A;  3RUI B;  2WDQ B;  3B0A A;  4HK2 A;  4ARC A;  3FIL B;  1SB3 C;  2CU1 A;  3GS2 A;  3RNE C;  1TS3 A;  1V80 A;  2FAZ A;  5I4D A;  5H8Y E;  1GC7 A;  4NAW B;  2BTE A;  5IA7 A;  3PSE B;  1WGR A;  4WJP A;  2FCM A;  3AU4 A;  3VUY A;  1F9J A;  1FD6 A;  2BBC A;  3EA6 A;  4IW0 A;  2GBM A;  4BKS A;  2BGF A;  3WAO A;  1HXY D;  1UGM A;  1P98 A;  1NEN B;  4ZRI A;  2OJW A;  5G5H A;  4YSZ B;  1EWC A;  4GSW A;  3R7Q A;  3WAP A;  3N9Y C;  4HLE A;  3KUC B;  3TL5 A;  2K0P A;  1Q10 A;  1PYW D;  3AXC A;  4KIK A;  1BUI C;  2MA9 B;  3DHH C;  3AV8 A;  4NJ7 A;  3TIX A;  1NVI D;  2NS5 A;  1K8R B;  4IM3 A;  1UH6 A;  3NZU A;  1V6E A;  3H7P A;  2FBW B;  5D3D A;  4EUT A;  1BXT A;  2LVO A;  3OG5 A;  4FAD A;  3VXW A;  3SFE B;  4MGY E;  2ONQ A;  2W3S A;  3JW0 X;  5C23 A;  2IGG A;  4TKN A;  2WU2 B;  2AL6 A;  2QHO A;  1C9F A;  2ICI A;  1WX8 A;  1SEB D;  2KWD A;  2J42 A;  1ISN A;  4BKT A;  1T0S C;  2NVU I;  2RR9 A;  3U30 A;  2W54 A;  2KX0 A;  4WJN A;  1V1P A;  2JX5 A;  2I1J A;  2N7D A;  2INC C;  1WZ3 A;  1SJE D;  1WJ4 A;  5EE0 A;  5CHF A;  4GDL A;  2KYW A;  1STE A;  3RNF C;  2GBJ A;  2Z0E B;  4EFO A;  1R7S A;  2L3Z A;  3PLU A;  1OQQ A;  2HDE A;  2KJ6 A;  4W9K A;  3P42 A;  4JQW C;  2D10 A;  3ML9 A;  3PRP B;  4KGT A;  4AUQ C;  5JHA A;  3R2T A;  4J6I A;  4DHZ B;  1NDD A;  3RI7 C;  2N7E A;  3PHX B;  3RNC C;  1H8C A;  4W9C A;  2N0S B;  4YTM B;  2D07 B;  1WJN A;  4PYZ A;  1N5W A;  3PPA A;  2LJ5 A;  2WXI A;  2QJL A;  2K8C A;  4BFR A;  4LNF A;  1TJE A;  2RPV A;  3SFD B;  2WWZ A;  2MCN B;  1ET9 A;  2M56 B;  5D7G A;  3IT4 B;  3JSV A;  1WFY A;  3KW5 B;  1NBF C;  1Z2M A;  3OLM D;  4CYE A;  3DBS A;  2WU5 B;  1GUA B;  2WXF A;  1T0R C;  1KOT A;  4I6L B;  4ZRQ A;  2N1W A;  3P4Q B;  1ZXH A;  3C8Y A;  4A20 A;  2MLB A;  1WX9 A;  3ZKJ C;  2C60 A;  3DBL I;  3DCG A;  2PEA A;  4IWO A;  3R2I A;  4M01 A;  5D3I B;  2KZR A;  5IAA C;  3X23 A;  1JAL A;  2BB6 A;  4IM0 A;  1SE4 A;  1Z5S B;  4X57 B;  5J2R A;  3LB8 C;  1JWU D;  1BML C;  3Q8E A;  2BYT A;  3E9S A;  4C00 A;  4B9K A;  2XNA C;  3DQV A;  3VHT C;  1HQR D;  4WJQ A;  1QIL A;  2Y3A A;  5AZH A;  1T0Q C;  3ZW3 A;  5AUI A;  3R7R A;  3RNG C;  5JHB A;  2KJR A;  3H7S A;  1ET6 A;  1CMX B;  2X38 A;  3KQ4 A;  2XK5 B;  4EE2 A;  4ZRP A;  4P1B C;  1RAX A;  4N58 A;  4W9J A;  1EU4 A;  4RCO A;  1OFF A;  2Z0D B;  1TTN A;  5FR3 A;  3V61 A;  1E7P B;  1TS5 A;  1KM7 A;  3AE8 B;  4LJO B;  4G3X B;  4YT0 B;  3K9P B;  1WWT A;  3PLV A;  3QCA A;  4DXF A;  2KX3 A;  1D4B A;  2XBB C;  4P1C C;  2RGF A;  1YX5 B;  1VJK A;  4ASW C;  1RFK A;  3LJ3 A;  3BK2 A;  1WMH B;  3OJ3 A;  2N9L A;  1ZDV A;  1T5X D;  3JVZ X;  2QEJ C;  4W9F A;  4OZB A;  4AWJ A;  2BWF A;  3PZ8 A;  1UF0 A;  2DAF A;  1N63 A;  3NS8 A;  1C79 A;  2V3S A;  3A4R A;  4B95 A;  2D3A A;  1JRO A;  2YVC A;  1CJE A;  4B0E A;  2VZK B;  2FCS A;  1VLB A;  1LM8 B;  1LGR A;  2EMT A;  1FM0 D;  4ACF A;  3HHM A;  3V3X A;  2B3A A;  2K22 A;  1HE8 A;  3SU8 X;  2G3Q B;  2ZJD A;  2PMV A;  5D2M B;  2WDV B;  2MJD A;  1SJH D;  2I2Y A;  1XLN A;  4YSY B;  1E7V A;  1GG3 A;  1WGD A;  3NOB A;  3IHP C;  1CQV A;  3U52 E;  3VVW B;  3Q3N C;  1E10 A;  2KC2 A;  2O2V B;  2QDF A;  4H2A A;  2KDM A;  3CMM B;  2Z8L A;  1IPG A;  3GE3 C;  1TZ1 A;  5L83 A;  1E6E B;  4E74 A;  1OEY A;  4S0R A;  4HWI B;  5EE3 A;  1WY8 A;  1Y8R C;  4L2Y A;  2ZVO A;  4AOF A;  3RUL A;  3TEW A;  2GBN A;  2IO2 B;  4MJS B;  3BIN A;  2ZPN A;  1FMA D;  2ON8 A;  1RWS A;  5JZE B;  2C7H A;  1L6V A;  1KLU D;  1QOG A;  2B76 B;  1MG4 A;  5EE9 A;  4DHJ B;  1PFD A;  2KNB A;  2LXA A;  1C1Y B;  3DHI C;  1E8X A;  2A4Z A;  2ZEQ A;  3VH4 B;  4XYC A;  3Q8B A;  4KDI C;  2LGD A;  3AE1 B;  1WX7 A;  4PS7 A;  1EF1 A;  2IY0 B;  3MFG A;  2JWZ A;  3NY5 A;  3VTU A;  3NUH B;  2IO0 B;  2M19 A;  5BMI A;  4F7Z A;  1M94 A;  3ML8 A;  2LAS A;  2BWE S;  3NS1 A;  2KQS A;  4USA A;  2ZVN A;  1WIA A;  2L0F A;  2QIE B;  3BYT B;  1MPE A;  3VQI A;  4NQL B;  4YTN B;  3PO0 A;  2IYD B;  1EF5 A;  1ACC A;  3JSV B;  4YTP B;  4PK1 A;  2L0T A;  4O1N A;  1UD7 A;  1OGW A;  2AQ1 B;  1D3Z A;  1UWX A;  3A4S C;  1JWB D;  1V5T A;  3MC9 A;  3R3M A;  3Q8C A;  4Q2J A;  3DWG C;  1WXV A;  3KUZ A;  2WXN A;  3H7P B;  2KAN A;  2Y5B B;  2H89 B;  1V86 A;  2K6D B;  4RF1 A;  1K50 A;  2CJN A;  1XF5 L;  4WWN A;  3KVF B;  3ABV B;  1WI0 A;  3AM9 A;  2PLP A;  1HZ5 A;  2IGH A;  3QAR A;  1TIF A;  2PVG C;  1I4G A;  2L00 B;  1Q1O A;  2FUG 1;  1FXT B;  4AJW A;  4GIV A;  1WXQ A;  1L7Y A;  4W9H A;  5LXI B;  3L4P A;  1V81 A;  2JPH A;  1FFV A;  3LDZ E;  1N61 A;  3NVW A;  4DWF A;  4HXD A;  2V4I B;  3QWZ B;  4IWQ A;  2FUH B;  3B1L X;  2KAJ A;  3BWU D;  4EZJ A;  4EZL A;  2AL3 A;  2INP E;  5DPS A;  4HKZ E;  1YQ3 B;  2GMI C;  2KN5 A;  2Y5C A;  1M4V A;  3ETR A;  3WAM A;  1V49 A;  3MHZ A;  2V0G A;  2I38 A;  4MM3 A;  3NZ3 A;  1YN3 A;  1P1A A;  2L7R A;  2QIL A;  2L32 A;  2VH1 A;  4EKU A;  4GDK A;  2L05 A;  2XN9 C;  3CIR B;  3P2B A;  3W5V B;  1YD8 U;  2FCN A;  3P4P B;  1YQB A;  3ZYY X;  4TV3 A;  4ANU A;  2IO1 B;  2CS4 A;  2WP9 B;  3PGE A;  5BMH A;  2CKH B;  4RNA A;  1NI2 A;  3ZNH B;  2JZP A;  2KKC A;  2LZ6 A;  5L95 C;  1J19 A;  3NVZ A;  2AQ2 B;  4MGZ E;  2KWV B;  2BS4 B;  2IDY A;  2GI9 A;  3ZGZ A;  3CF6 E;  3FC4 A;  3TJP A;  3L08 A;  1RFA A;  1VCB A;  2WXK A;  4WWP A;  4XWW A;  3VTW A;  4RGN A;  3PZD A;  1NYQ A;  2PTL A;  3T3N A;  1R4N B;  4NPN A;  3RD2 A;  2DZK A;  2O6V D;  4FA6 A;  2RD0 A;  1K53 A;  1ZDX A;  3HK0 A;  3APC A;  3RT3 B;  1AAR A;  3IXS A;  4F1S A;  3ZO5 B;  3CWI A;  2BS2 B;  1TT5 B;  1XCQ L;  2ZNV C;  4CQN A;  4RFB A;  3VFK A;  5CHW A;  3X0W A;  2M17 A;  2C9W B;  4PS3 A;  2OJR A;  3MJW A;  2RSU A;  3AEE B;  3N20 C;  1DGJ A;  2N1V A;  2NTT A;  3HM3 A;  3P63 A;  4FLH A;  3PTF C;  2IZV B;  1UZX B;  2WXL A;  2KOX A;  3AE7 B;  4EZK A;  3ZJV A;  4PYU A;  2UYZ B;  5BO4 B;  1OQY A;  4LCD E;  1UWM A;  3DDC B;  3KLS X;  5HKH A;  4KKJ A;  1V97 A;  1SGH A;  3PRZ A;  1QOA A;  2MP2 B;  1YJI A;  4HEA 1;  4MAC A;  5LLI A;  1J7B A;  3RZF A;  3L16 A;  3V6E B;  4BOZ B;  3AUL A;  1T0Y A;  3EFU A;  2KAC A;  3TCA A;  1UGJ A;  4IKG A;  5BYS A;  1E8W A;  2DLB A;  1H4R A;  3A1Q B;  4DXA B;  1WGK A;  4JGH B;  3OAW A;  1HEZ E;  4ANW A;  1K51 A;  4HJK A;  2G4S A;  2KN4 A;  1MJD A;  1J7A A;  4HDQ A;  1FNV A;  1FIQ A;  2NMQ A;  4CO7 A;  4KV2 A;  2DHZ A;  3ALB A;  4LJP B;  1RM6 C;  3PT2 B;  2W3R A;  2NBW B;  5E6P A;  4XDC A;  4DDI D;  2DEN B;  1JWM D;  1PGB A;  2JRI B;  2JRH A;  4RMA A;  2GBK A;  3ZQ4 A;  1D5X C;  2J0K A;  3A1Q A;  2AWT A;  2WXJ A;  1PGA A;  2FNJ B;  3ZLZ A;  4E71 A;  4K81 A;  2BS3 B;  1F77 A;  4PS8 A;  2D5G A;  2FIF A;  5LNK 1;  3VH3 B;  2ZW1 A;  1E9M A;  5AUK A;  2MJ3 A;  3KUD B;  4OW0 A;  4FHK A;  2OED A;  5IKC M;  5H92 C;  3KH0 A;  1QQR A;  2KHW B;  1EO6 A;  2BVC A;  4BKS D;  5TR5 A;  3IG3 A;  2XEW A;  2KQ7 A;  1TS4 A;  2ASQ A;  4A9A A;  4RM8 A;  4KGR A;  2FID A;  1ESF A;  2NR2 A;  1F52 A;  3UF8 A;  2PE9 A;  3V62 A;  1N62 A;  1L5P A;  2WX0 A;  4XWT A;  4YXD B;  1QT9 A;  1RLF A;  3AE2 B;  4LDT B;  3FAH A;  3URY A;  3HM6 X;  4M0W A;  2BPS A;  3NZS A;  4OVV A;  3DBR I;  4C4V A;  4RGM A;  2G1E A;  1FXA A;  3W1S C;  1U4A A;  4N6E B;  4YL8 A;  4WAA A;  4BVU C;  4ITK A;  1NI3 A;  1MG8 A;  1GB4 A;  1E90 A;  2R2Q A;  1XEE A;  3NJT A;  4A3O A;  2CJO A;  2L83 A;  2JQR B;  3IFW B;  1JRP A;  2WXM A;  2GOW A;  1GPX A;  4KVG B;  2ZCC A;  2VRR B;  3SHQ A;  1D5Z C;  4MGI E;  4JWS C;  4FHJ A;  3T8M A;  3ONS A;  1LXD A;  2R61 A;  3O13 A;  3W1Y A;  1L0X B;  3AEF B;  1ENF A;  4GDK B;  3NVV A;  2E3T A;  1EWY C;  3B08 A;  2DAJ A;  1C4C A;  3P4R B;  4OVZ A;  1AN8 A;  2MEK A;  1SIF A;  2ZCB A;  2K25 A;  1WM2 A;  1WZ0 A;  1TY0 A;  2KFJ A;  1I42 A;  2LFI A;  3L17 A;  4TUU A;  2FCQ A;  3I3T B;  3ZRF A;  1JCK B;  2KWC A;  1DOY A;  5DPT A;  2NBU A;  3P4S B;  2ZZP B;  2WQY B;  3OJ4 B;  2NTS A;  3RN9 C;  2LGY A;  3Q14 C;  2WDT B;  3NG0 A;  3RZW C;  2WXP A;  2R2O A;  1L2N A;  4GMV A;  3EGR A;  1I4H A;  1C78 A;  5C1Z A;  2DYB A;  3RMK C;  3Q8F A;  1GOZ A;  1MVK A;  3Q3J A;  5DPR A;  5GMV A;  1I4Q A;  4L1B A;  1E8Y A;  2BKF A;  5DPW A;  2WNM A;  1LO5 D;  3UIN B;  4K7S A;  2QC8 A;  1S1Q B;  3AE3 B;  1UBQ A;  4C7Z A;  3MC0 B;  3TEX A;  4JPS A;  4A55 A;  2MH7 A;  3A9K A;  2K8H A;  3M95 A;  3U4E G;  1TKE A;  3MJ5 A;  1WR6 E;  2IGD A;  2J53 A;  5HFY A;  1SIJ A;  1FPY A;  1WM3 A;  3AE6 B;  3WCQ A;  3B9J A;  1S3S G;  1GB1 A;  2JWU A;  5LXH A;  1RYJ A;  3B2G A;  5MPO A;  4A6Q A;  3VR8 B;  1X1M A;  1JWS D;  3DBH B;  5DCN A;  2YEP B;  3DVG Y;  4BKG A;  2MP2 A;  4NQK E;  2KLC A;  3N32 A;  1E8Z A;  2KDE B;  1KJT A;  1N6Z A;  4BBN F;  3W5U B;  2KT7 A;  2Q5W D;  1YN5 A;  3NRZ A;  2D3C A;  2RDH A;  1I4R A;  1ZW7 A;  2J52 A;  3DVG X;  2LXC A;  3BII D;  1R4M I;  3BZD B;  2PKO A;  5EDS A;  1FRR A;  3L13 A;  1PQS A;  4LNN A;  4PT5 A;  1XLQ A;  4IWP A;  5AZF A;  3H8H A;  2CR5 A;  2IO3 B;  4C56 C;  3Q6B A;  2NCN A;  2LGX A;  3N1Z C;  2HJ1 A;  2DBY A;  1L6U A;  1AYF A;  2K9X A;  3CSF A;  4OZA A;  1FO4 A;  1JQ4 A;  1HZ6 A;  4GOC A;  1NYR A;  1WGH A;  1F0Z A;  4HRS A;  1VR9 A;  4K7W A;  3EC8 A;  3WA0 A;  1UNS A;  3BVG A;  1EU3 A;  1GC6 A;  1GNU A;  3UIO B;  1ROE A;  2PIA A;  2LD9 A;  3GZN I;  1I4P A;  2TSS A;  2M8S A;  1NEK B;  2JF5 A;  5E6N A;  2G45 B;  3GB1 A;  3N1Y C;  3AE9 B;  1WGY A;  4WQM A;  3DBR B;  1GJZ A;  1A5R A;  2D11 A;  3KWL A;  4N9F 4;  3ZNI D;  1I4X A;  1N5X A;  2BT6 A;  2LHE A;  4K7U A;  4NY0 A;  5HG2 A;  4QAY A;  1G6J A;  3L0W B;  4W9I A;  3PV1 A;  4MM3 B;  2BYF A;  3TMP B;  3P1M A;  2KDB A;  3ZIM A;  1VD2 A;  3IVF A;  4CHK A;  3CST A;  2IPK D;  1C76 A;  2HTM E;  4OVU A;  2DNF A;  1Q0W B;  2EMS A;  3AEG B;  4RH6 A;  2RDG A;  4HDO A;  5E6J A;  1E0Z A;  3T3O A;  2WHI A;  1I7H A;  3QX1 A;  1D5M C;  2D3B A;  4WAF A;  2DX5 B;  4KX6 B;  1V5O A;  5D94 A;  1E5W A;  2DZJ A;  2LGS A;  4IM2 A;  4NAM A;  4A90 A;  3ZTC A;  2I1K A;  1OTR B;  5G5G A;  2H88 B;  2M0X A;  4IG7 B;  3H9D A;  5FKA C;  3S2A A;  1RRB A;  1XD3 B;  3BVM A;  4WWO A;  3Q8A A;  1E7U A;  2BF8 B;  4DXG A;  5IN7 A;  4GXB A;  4W9E A;  5HI1 A;  2LGI A;  4REZ A;  3AED B;  1SE3 A;  2A5U A;  5BMG A;  3AI5 A;  3V60 A;  3LXF A;  1WJ6 A;  2C7M B;  4MT5 A;  1YJ1 A;  2SEB D;  4URK A;  3PS6 A;  2AX5 A;  2NPT A;  3JYU A;  3MTN B;  1MI0 A;  3ZJU A;  4US8 A;  2N9K A;  4FJY A;  1ZOY B;  1J8C A;  3M3J A;  1TGZ B;  1QOF A;  1KF6 B;  1YQ4 B;  2KVR A;  4ZRJ A;  3J9C A;  2KTF A;  3U7Z A;  4BOS C;  3ZTD A;  2KXJ A;  4IOI E;  2WGS A;  3A9J B;  4ZYN A;  4WH4 A;  4JL9 A;  1F2R C;  4S17 A;  4NNJ B;  2L52 A;  3DPD A;  1N60 A;  2KFK B;  1XQQ A;  1P7F A;  3DHG C;  3UIP B;  1TS2 A;  5G2N A;  1AW7 A;  2KVZ A;  3AE4 B;  3ZDT A;  2D2Q A;  2MWS B;  3A33 B;  1IP9 A;  1TY2 A;  2EKE C;  3IAM 1;  1IBX A;  2KDI A;  4ZHP A;  2BB5 A;  2LRW A;  2MHJ A;  3MC8 A;  1L0Y B;  2V3N A;  3VRA B;  4G11 A;  3GP7 A;  2HD5 B;  4J3O D;  2L8J A;  2WDR B;  3RPF C;  3RNB C;  2QSD A;  3KYC D;  2E6X A;  3UGB B;  1P0R A;  4W9G A;  3QAQ A;  1WSP A;  3A9J A;  1LFD A;  2BW2 A;  2V3P A;  2LVP A;  3L54 A;  3TSS A;  1XCT L;  1ZXI A;  2K6Q A;  4DDG D;  3Q3O C;  2MSE D;  3AEA B;  2LUM A;  2LWP A;  4II3 B;  4C4V B;  4MGK E;  2JY6 A;  4M0W B;  2MBO A;  3IAS 1;  3N3K B;  2CHZ A;  4HPM B;  4WQO B;  1L0V B;  1TKY A;  1MFW A;  3HRD D;  3HUI A;  3VRB B;  3MP9 A;  2EEL A;  3I57 A;  4LTU A;  1ZP0 B;  4G0N B;  2O2V A;  3RFZ B;  3SEB A;  2N9X A;  2WXO A;  4JLC A;  2YEP F;  2LI5 A;  4MH8 A;  4DK5 A;  1UUP A;  2N9P C;  4GN1 A;  1V1O A;  3VDZ A;  4GDL B;  3B2F A;  5J18 A;  1V8C A;  4DHZ E;  4A8X C;  2INN E;  1XXG A;  3GZN B;  1C4P A;  2FE8 A;  3SR6 A;  2PVO D;  5T8I A;  1HTO A;  1DOI A;  2MW5 A;  3WAL A;  2DZM A;  4YWG G;  1WXM A;  3DBH I;  4JWU C;  4DQO C;  3TEZ A;  2KDF B;  3FKY A;  4FJZ A;  3TBL D;  4AQ7 A;  3NVY A;  4ZHO A;  3RCZ A;  3Q2A C;  4F8C B;  1R4N I;  5BYR A;  2IND C;  3WIM A;  4XZ4 A;  4NZL B;  4B6W A;  1LQB A;  4NJ6 A;  2JUO A;  3N30 A;  1YIW A;  4P6V F;  3O65 B;  3H6N A;  3R66 C;  3HIZ A;  2W55 A;  5CHV C;  5IO9 A;  4KZC A;  1K52 A;  1DYQ A;  2RDB C;  1B1Z A;  1UBI A;  1XLO A;  3PRE A;  5IOI A;  2CHW A;  3UI3 A;  1YX6 B;  2LVQ A;  3SDL C;  1KLG D;  1SXT A;  2PJH A;  4BZA A;  1L4D B;  4LNK A;  1SF0 A;  3QQ8 B;  4ARI A;  4KIK B;  4XC2 A;  2V4L A;  1QF6 A;  1WGG A;  4LNO A;  3IBE A;  2JXT A;  1WRI A;  2DYM A;  4OHJ A;  1WYW B;  4K3B A;  1QZE A;  2WXR A;  2DZI A;  2KTR A;  4RM9 A;  1KTK A;  2K8B A;  2JXX A;  4MJS A;  4GB9 A;  2DYO A;  1MHX A;  1P7E A;  3RYT A;  1F2R I;  2L76 A;  3M63 B;  4NAW A;  3VAW A;  3ZUN A;  1ZE3 D;  3ECI A;  2AQ3 B;  3EHV A;  1WH3 A;  1C4A A;  1XO3 A;  3NHE B;  1EUV B;  2UU7 A;  1WYG A;  1CK1 A;  4ICU A;  4RGO S;  5JXV A;  2KWU B;  2NBV B;  3ZRC A;  2CHX A;  4DBG A;  3EFC A;  2JVC A;  1R4M B;  2IY1 B;  4GGQ A;  2LUE A;  4HKQ A;  4AS1 A;  2WYQ A;  2JZ3 B;  4M02 A;  4ANV A;  2C5L C;  3AEB B;  1IUE A;  4OZC A;  2N4F A;  1V9J A;  3AB5 A;  2K3U A;  5JH5 C;  1JW9 D;  1KRH A;  1I35 A;  1L4Z B;  4LDT D;  1WE7 A;  1QLB B;  2KMA A;  3R8B A;  2BYE A;  4K3C A;  1FXI A;  3PRM B;  3DVN V;  1TZO A;  3M62 B;  2JZZ A;  3U7D A;  3VTV A;  2KTR B;  2MQJ A;  3ZNG C;  3D32 A;  4WWM A;  4MEL A;  2ZW0 A;  4WIP A;  4KKI A;  1WE6 A;  3AE5 B;  4ANX A;  5E6O A;  4C80 A;  3TEY A;  2BKR B;  2KMC A;  4WJO A;  3PHW B;  2IBI B;  2JU6 X;  4M8N A;  2UWQ A;  4FXC A;  4HVB A;  1FCL A;  5TSS A;  4AJY B;  3KWV A;  4MSQ B;  2M0A A;  3IT6 B;  3A9K B;  1SE9 A;  2KMM A;  5D6J B;  5FK9 C;  1J7C A;  2WLB A;  2JYE A;  1C77 A;  1GAQ B;  2C7N B;  4US9 A;  2WS3 B;  3HVD A;  3MHS D;  2SAK A;  3BVZ A;  2KD0 A;  4W9L A;  3AU5 A;  2J0J A;  3N1X C;  5CTR C;  1VZ6 A;  2O6V A;  1WR1 A;  5AZG A;  1ZUD 2;  1IGD A;  4G50 A;  3APF A;  3DVN U; 
#chains in the Genus database with same CATH homology
 3FC4 A;  4KGT A;  2WXK A;  3GB1 A;  3R2T A;  3AE9 B;  4WQM A;  4XWW A;  2K5P A;  1YNT E;  3KWL A;  3HVZ A;  4RGN A;  3BK1 A;  1D6E C;  1I4X A;  1NYQ A;  2PTL A;  3T3N A;  1N5X A;  2N0S B;  4YSX B;  4YTM B;  1K53 A;  2BT6 A;  1ZDX A;  2LHE A;  1N5W A;  5HG2 A;  2WXI A;  2QJL A;  3IXS A;  3CWI A;  1TJE A;  2RPV A;  1VZ7 A;  3SFD B;  4MM3 B;  1ET9 A;  4RF0 A;  2M56 B;  4JX1 C;  5D7G A;  2BS2 B;  1FNW A;  1XCQ L;  2VZK D;  2N7J A;  4HRO A;  3IT4 B;  3VR9 B;  4CQN A;  3P1M A;  4RFB A;  1VDV A;  2IPK D;  1C76 A;  2HTM E;  3AEE B;  3FIL A;  2GRI A;  2WU5 B;  2WXF A;  1IBX B;  3AEG B;  4N59 A;  4RH6 A;  2RDG A;  1DGJ A;  2NTT A;  5E6J A;  1E0Z A;  3T3O A;  3P63 A;  4ZRQ A;  1KH0 A;  1I7H A;  3P4Q B;  1D5M C;  2CU3 A;  1ZXH A;  2WXL A;  3V05 A;  3AE7 B;  2GB1 A;  4WAF A;  3ZJV A;  2WXQ A;  4KX6 B;  3C8Y A;  4NAM A;  4A90 A;  1UWM A;  3KLS X;  4IDI A;  4KKJ A;  1V97 A;  5G5G A;  1JWA D;  4ZOH C;  3R2I A;  2H88 B;  1QOA A;  5D3I B;  1YJI A;  4HEA 1;  1MHH E;  4MAC A;  5FKA C;  1J7B A;  3BVM A;  1JAL A;  3W2D A;  2BB6 A;  3Q8A A;  1SE4 A;  4DXG A;  2KAC A;  3PZ7 A;  5HI1 A;  1UGJ A;  2LGI A;  5C2T B;  4IKG A;  2IJ0 A;  4REZ A;  5BYS A;  2DLB A;  3LB8 C;  3AED B;  4JE3 B;  1JWU D;  5C3J B;  3Q69 A;  1SE3 A;  5BMG A;  1BML C;  3Q8E A;  1WGK A;  4L23 A;  1CZP A;  3LXF A;  4TMA B;  2BYT A;  3E9S A;  1HEZ E;  2XNA C;  4MT5 A;  1K51 A;  4TSS A;  2SEB D;  2AX5 A;  1HQR D;  2KN4 A;  5BYQ A;  1J7A A;  1FNV A;  1MI0 A;  1QIL A;  2Y3A A;  1ZPS A;  3ZJU A;  1FIQ A;  2NMQ A;  2N9K A;  2ACZ B;  5HHD G;  4US8 A;  1ZOY B;  4B0M A;  1RM6 C;  5AUI A;  1QOF A;  1KF6 B;  1YQ4 B;  1OQR A;  3OWE B;  3J9C A;  3U7Z A;  4TQ0 A;  4IOI E;  3DWM A;  2W3R A;  4WH4 A;  1ET6 A;  2X38 A;  3KQ4 A;  4EE2 A;  1F2R C;  4XDC A;  4ZRP A;  1Y56 A;  2L52 A;  1YN4 A;  4N58 A;  1EU4 A;  1N60 A;  4RCO A;  1OFF A;  1P7F A;  3AH7 A;  1JWM D;  1PGB A;  1TS2 A;  1SSN A;  1V1P B;  1AW7 A;  3AE4 B;  5FR3 A;  2RMM A;  1E7P B;  3ZQ4 A;  1D5X C;  1TS5 A;  3ZJT A;  3BYY B;  5EE1 A;  2WXJ A;  1QKZ A;  1KFY B;  1PGA A;  3AE8 B;  4YT0 B;  1SE2 A;  1PUT A;  1TY2 A;  2J4X A;  4P16 A;  1WWT A;  2BS3 B;  3IAM 1;  1F77 A;  1IBX A;  3AMZ A;  1VRA B;  4XE0 A;  2BB5 A;  4DXF A;  4ZHP A;  1D4B A;  2LEK A;  2D5G A;  3W9C B;  5LNK 1;  1L0Y B;  4D2K A;  2V3N A;  2ZW1 A;  3VRA B;  1E9M A;  1A70 A;  3GP7 A;  5AUK A;  4GLS C;  1FRD A;  1VJK A;  4J3O D;  2WDR B;  1RFK A;  2WXG A;  3RPF C;  2MJ3 A;  3BK2 A;  4OW0 A;  2N9L A;  2PW9 A;  1ZDV A;  3EUB 2;  2OED A;  1T5X D;  4NJC A;  2QEJ C;  5H92 C;  2QSD A;  1QQR A;  2E6X A;  4C7Y A;  4OZB A;  3PZ8 A;  3LYY A;  4LLG M;  1WSP A;  1TS4 A;  1N63 A;  2L1A A;  1C79 A;  4A9A A;  1JRO A;  4B0E A;  1CJE A;  4KGR A;  2DWQ A;  1ESF A;  2VZK B;  2BW2 A;  1SBB B;  1VLB A;  2V3P A;  3TSS A;  1FM0 D;  1N62 A;  1L5P A;  4XWT A;  1XCT L;  1ZXI A;  3U2S C;  1YJJ A;  4YXD B;  1QT9 A;  1YMH E;  3V3X A;  3AEA B;  2K22 A;  2LUM A;  2KQ4 X;  2QMT A;  3AE2 B;  4TQ1 A;  3FAH A;  1NEK B;  3URY A;  2JYT A;  3IAS 1;  2PMV A;  4M0W A;  4R3D A;  2WDV B;  2MJD A;  1SJH D;  1L0V B;  4RGM A;  2G1E A;  1TKY A;  1FXA A;  2I2Y A;  1XLN A;  4YSY B;  4N6E B;  3HRD D;  3HUI A;  3VRB B;  4ITK A;  3MP9 A;  1NI3 A;  1GB4 A;  2EEL A;  3I57 A;  1XEE A;  4LTU A;  1ZP0 B;  1CQV A;  3U52 E;  2CJO A;  2L83 A;  1E10 A;  1FCC C;  2EKI A;  2JQR B;  2LJI A;  3RFZ B;  1XLP A;  3SEB A;  2WXO A;  1JRP A;  2WXM A;  4H2A A;  2YEP F;  2KDM A;  4KGS A;  1GPX A;  1QOB A;  2Z8L A;  4MH8 A;  2LHD A;  2OHF A;  1UUP A;  1E6E B;  1V1O A;  1D5Z C;  1EM7 A;  5EE3 A;  4L2Y A;  4GDL B;  4JWS C;  3TEW A;  1FEH A;  3B2F A;  3W1S A;  1V8C A;  2LMC A;  4A8X C;  2INN E;  3I9V 1;  1XXG A;  2R61 A;  1C4P A;  2FE8 A;  3O13 A;  1FMA D;  3SR6 A;  1DOX A;  1L0X B;  2PVO D;  4HJG E;  2ON8 A;  1DOI A;  5GXG B;  1RWS A;  3AEF B;  5T8I A;  1IGC A;  1L6V A;  1ENF A;  2MJE A;  4YWG G;  4GDK B;  1PGX A;  4JWU C;  1KLU D;  3NVV A;  1B9R A;  1QOG A;  2B76 B;  2Y5P A;  2E3T A;  5EE9 A;  4DQO C;  3TEZ A;  1EWY C;  1T6B X;  2WXH A;  1PFD A;  1JML A;  4AQ7 A;  3AN1 A;  1C4C A;  3P4R B;  3NVY A;  4ZHO A;  5BYR A;  1FFU A;  4ZYS A;  1PDX A;  4NZL B;  2W82 A;  1TKG A;  4OVZ A;  1AN8 A;  2MEK A;  4P6V F;  3Q8B A;  1TY0 A;  3AE1 B;  2W55 A;  4WUR A;  3MFG A;  1K52 A;  2LFI A;  1DYQ A;  1B1Z A;  1JCK B;  1DOY A;  1XLO A;  3NUH B;  1AWD A;  4XDD A;  3UI3 A;  1KLG D;  2M19 A;  3P4S B;  5BMI A;  1SXT A;  2WQY B;  1L4D B;  1SF0 A;  1VZ8 A;  4ARI A;  2NTS A;  3TUO A;  1HA5 A;  1QF6 A;  3NS1 A;  2WXP A;  2JXT A;  1T3Q A;  1TYG B;  1WRI A;  4USA A;  4UDU C;  2DYM A;  1FNU A;  3EGR A;  4OHJ A;  1I4H A;  4RGT A;  1C78 A;  2WXR A;  3Q8F A;  1GOZ A;  1MVK A;  2QIE B;  3BYT B;  1MPE A;  1KTK A;  4LK0 M;  2JSV X;  3VQI A;  2G9H D;  4YTN B;  3PO0 A;  1ACC A;  1I4Q A;  4L1B A;  3AEC B;  4YTP B;  3E56 A;  4O1N A;  2WDQ B;  2DYO A;  1MHX A;  1P7E A;  2WNM A;  4ARC A;  1LO5 D;  2AQ1 B;  3FIL B;  1F2R I;  1SB3 C;  3GS2 A;  1ZE3 D;  1UWX A;  2AQ3 B;  1TS3 A;  1XO3 A;  1C4A A;  1JWB D;  3AE3 B;  5I4D A;  4C7Z A;  1WYG A;  1CK1 A;  3MC0 B;  5H8Y E;  3TEX A;  4JPS A;  4A55 A;  2MH7 A;  4NAW B;  4RGO S;  2BTE A;  5JXV A;  3U4E G;  1TKE A;  3MJ5 A;  3Q8C A;  4Q2J A;  2IGD A;  3DWG C;  2J53 A;  5HFY A;  1SIJ A;  2WXN A;  1FD6 A;  3AE6 B;  3WCQ A;  2H89 B;  4HKQ A;  2BBC A;  3B9J A;  3EA6 A;  1GB1 A;  4AS1 A;  2JWU A;  1RYJ A;  3B2G A;  4RF1 A;  5MPO A;  1HXY D;  1K50 A;  2CJN A;  1XF5 L;  4A6Q A;  1NEN B;  3VR8 B;  3ABV B;  3AEB B;  5G5H A;  3AM9 A;  1IUE A;  1JWS D;  1HZ5 A;  2PLP A;  2IGH A;  4OZC A;  1EWC A;  4YSZ B;  3AB5 A;  3N9Y C;  2PVG C;  1I4G A;  2K3U A;  1JW9 D;  1KRH A;  2K0P A;  2FUG 1;  1Q10 A;  1PYW D;  1L4Z B;  2YEP B;  1BUI C;  1WXQ A;  1QLB B;  3AV8 A;  3R8B A;  3L4P A;  1FXI A;  1FFV A;  1NVI D;  1TZO A;  1N61 A;  3W5U B;  3NVW A;  2V4I B;  2Q5W D;  1YN5 A;  3NRZ A;  2RDH A;  1I4R A;  4WWM A;  2KAJ A;  3BWU D;  2J52 A;  2ZW0 A;  2FBW B;  4WIP A;  5D3D A;  3BII D;  2INP E;  1BXT A;  4HKZ E;  4KKI A;  1YQ3 B;  3AE5 B;  3BZD B;  3SFE B;  2PKO A;  2ONQ A;  2W3S A;  2Y5C A;  4C80 A;  3TEY A;  1FRR A;  1M4V A;  3ETR A;  2IGG A;  4PT5 A;  1XLQ A;  2WU2 B;  3MHZ A;  2V0G A;  2JU6 X;  3H8H A;  4C56 C;  2I38 A;  1C9F A;  4FXC A;  3NZ3 A;  2ICI A;  5TSS A;  1YN3 A;  1FCL A;  3KWV A;  1SEB D;  2M0A A;  2QIL A;  2L32 A;  3IT6 B;  2KWD A;  2KMM A;  2J42 A;  5FK9 C;  1J7C A;  2XN9 C;  3CIR B;  2WLB A;  2DBY A;  3W5V B;  1L6U A;  1AYF A;  2K9X A;  3P4P B;  4OZA A;  2JYE A;  1FO4 A;  1JQ4 A;  1HZ6 A;  1C77 A;  1GAQ B;  3ZYY X;  1NYR A;  2W54 A;  4US9 A;  2WS3 B;  1F0Z A;  4HRS A;  3HVD A;  1VR9 A;  1V1P A;  2JX5 A;  2WP9 B;  5BMH A;  1UNS A;  2SAK A;  3BVZ A;  3BVG A;  1EU3 A;  1SJE D;  4RNA A;  5EE0 A;  2JZP A;  1VZ6 A;  1STE A;  1ROE A;  2PIA A;  3NVZ A;  1R7S A;  2AQ2 B;  1OQQ A;  2HDE A;  1ZUD 2;  2BS4 B;  1I4P A;  1IGD A;  2IDY A;  3P42 A;  2TSS A;  2GI9 A;  3ZGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...