4A90A

Crystal structure of mouse sap18 residues 1-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
131
Chain Sequence
ESRVTQEEIPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 29
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a90A00
4A6QA 2HDEA 4A8XC 4A90A
chains in the Genus database with same CATH superfamily
1U4AA 3N1YC 2J0MA 2KMMA 4I6NB 5J2RA 3KLSX 3B9JA 3TEZA 3AE5B 2DLBA 1X1MA 2WHIA 2KTRA 2QSDA 1TJEA 4P6VF 4KKJA 4TSSA 1UF0A 3Q8EA 1MJDA 4JX1C 2OOBB 1TS5A 3ZXVA 3VR8B 3NZ3A 5EE1A 4DXGA 4MELA 1T3QA 5G55A 2KVZA 1GJZA 2LMCA 2KT7A 1MG4A 1K52A 1BMLC 2KFKA 3BY4B 3ZJUA 4K81A 4RH6A 4I6PA 2BQQA 3MC8A 3Q2AC 2QDFA 4M0WB 1WSPA 1T5XD 1WXVA 2GBNA 3BVMA 3J9CA 3EA6A 2LHDA 1K8RB 5I4DA 3RNAC 2R61A 4NNJB 3AE9B 1OQQA 5IA7A 2MJEA 2WXQA 4ASWC 1TYGB 3I57A 4LNIA 1C4AA 3AECB 4GDKB 4MEMA 3IVFA 3KWVA 3S2AA 1I4PA 2OJWA 1TIFA 3H8HA 1WWTA 4ICUA 4WQMA 3APFA 1TKYA 2WDTB 3JSVA 2WXIA 4K7SA 1K53A 4C4VA 1C1YB 3OJ3A 2Y3AA 4OVUA 2FUHB 3DBHI 2KVRA 4E71A 3PZ8A 2LHEA 3KW5B 4FLHA 1JROA 3DBRI 1QOBA 4ITKA 4IOIE 2AEHA 2N1VA 1TKEA 3AMZA 4B0MA 4A3OA 1PUTA 2GBJA 1T0SC 4IKGA 5DPRA 2LUEA 3WIMA 4DHJB 2KQ7A 3JVZX 3OAWA 2WP9B 4GDLA 4W9FA 4IG7B 3NVWA 2BB6A 1AW7A 2D10A 3MP9A 2MEKA 3VRAB 1XQQA 4REZA 5JH5C 2KYWA 2DAJA 1YNTE 4YTPB 3PRZA 4PYZA 1WXMA 3ZNID 1V80A 1Q10A 1S1QB 2KC2A 3D32A 3R3MA 2WNMA 2O6VA 1SIFA 1PQSA 1J0GA 3PRPB 4HWIB 4FJZA 2ACZB 3HRDD 1AN8A 2M0XA 2BYFA 2LASA 2WXGA 4TV3A 4CQNA 2M4NA 1TZOA 2A5UA 2MP2B 4C7YA 3W1YA 3MHSD 1NYQA 5L83A 2I2YA 1WJUA 2RR9A 4TQ1A 3W9CB 2WXNA 3ZTDA 3QX1A 1N61A 3PHWB 4OZBA 2RPQA 2WXMA 2J0JA 2V4LA 4LJOB 1WXSA 4MH0E 5C3JB 3N32A 4US8A 2N7JA 2Y5CA 4YSZB 3BYYB 5G5HA 2KK8A 4IUMB 2MA9B 2V0GA 2KJ6A 3VQIA 3ZJVA 1GUAB 2Z8LA 2KDMA 1IUEA 3H7PA 1RLFA 2GLSA 4K1RB 2V9HA 1WJ4A 4LTUA 2PW9A 2W9NA 4TKNA 3FC4A 5LNK1 4AS1A 5DPSA 3KWLA 1D5ZC 2HDEA 4XWTA 2QC8A 5AUKA 4W9IA 4L23A 2LRWA 3A9JA 2O2VA 1VRAB 2CHZA 1KLVA 4BZAA 5G5GA 3QC8B 1GNUA 3TCAA 1QILA 1OFFA 2LGDA 2PE6B 1WH3A 2FE8A 2XK5A 1XO3A 5BYQA 1MG8A 2GBMA 2H89B 1L2NA 1HXYD 3DDCB 3Q8AA 2DZIA 1P7EA 1E10A 2HJ8A 3AE3B 3L0WB 4XWWA 3I3TB 4W9EA 1Y56A 4A90A 2WXPA 1NVID 2ON8A 3DQVA 2N9LA 1WXQA 2HJ1A 2IY0B 2CS4A 2NBVB 3GS2A 4OVVA 2WXJA 3NVZA 4A20A 4JWUC 3AEFB 4MGKE 4MGIE 2JWZA 4E3CA 4ZRKA 1V81A 3LB8C 4NZLB 2D2QA 2MBBB 1Q5WB 1TKGA 1OEYJ 2JXTA 5BMHA 2FUG1 1DOYA 2BF8B 2ZW0A 3V61A 3DWGC 5IN7A 1GOZA 3DHHC 3LXFA 4NJ6A 3NS1A 4F8CB 2ZJDA 2WQYB 2GI9A 2K6QA 2KWUB 2Y5PA 1GB1A 2ZVNA 2VH1A 1ET6A 3M95A 4DHZB 4JE3B 5EE9A 5AZGA 4EE2A 3T3NA 1WM3A 5DPWA 4HDQA 1EO6A 3W1SA 2SAKA 4NAWA 4MH8A 3A4SC 1XLQA 3RMKC 2JVCA 3NRZA 3P63A 1R4MB 1E8WA 1N63A 4HKZE 3KUDB 2EMSA 1UNSA 3IT4B 3RNCC 1VR9A 3A9JB 4KZCA 2ZPYA 3SDLC 2BS4B 4J3OD 2PVGC 3IBEA 2FAZA 4ZYSA 1WGHA 2R2QA 4WIPA 3RI7C 3FILB 2JXXA 2PVOD 4ANUA 3SFEB 1C9FA 4II3B 3QAQA 1YN3A 2DHZA 4PS8A 2DYOA 1TS4A 1HA5A 3AE2B 1TS2A 1L0VB 1V1PA 2HTME 1WGGA 4BBNF 4GB9A 4JL9A 2C5LC 3IAM1 2JSVX 2DNFA 4ARCA 3R8BA 4CHKA 1ENFA 3PV1A 3RPFC 1WFYA 2LXCA 1NI2A 3T8MA 1XCQL 4W9KA 3LYYA 4I6LB 4EOYA 2NS5A 4OZAA 3KYDD 5LXHA 4FJVB 4PS3A 2KC1A 1L4DB 1NI3A 2N9EB 2INPE 4NQLB 4BBNC 4KZ0A 4P7IA 2BVCA 3DHIC 3X0WA 4A55A 1SF0A 4BKTA 3ZUNA 1J7BA 2GOWA 3PVLA 2D3BA 2L00B 4YT0B 4FJYA 1FXIA 2K25A 1E6EB 2CJNA 4JLCA 2IY1B 3ZNHB 5C1ZA 3TEYA 3OLMD 4GN1A 4NAWB 4EUTA 2WDRB 1D4BA 2CHXA 1V86A 1VDVA 2HD5B 1MVKA 1F52A 1FEHA 1EWCA 1FXTB 3ZVVA 2WU2B 3EUB2 3ALBA 4BKGA 1JW9D 3VXWA 2MHJA 2KXJA 1N62A 1ZUD2 3UI3A 4BAXA 4HPLB 3FAHA 2K1FA 2RGFA 3AEAB 2WYQA 1QQRA 3ONSA 1WRIA 4KKIA 3AEDB 4PS7A 3ZQ4A 2INCC 1RFAA 5E6PA 1C3TA 3U8ZA 3ZTCA 1RM6C 1WGKA 3MC9A 1JWBD 1I42A 2INDC 1YMHE 2KKCA 1JWMD 2DZKA 3DVNV 2CU1A 1FCCC 1VD2A 4KIKA 2K5PA 4WJQA 2NCNA 1JRUA 3AN1A 2KACA 2MWSB 4IM2A 5EE3A 4XX5A 4RGNA 1WXAA 3DPDA 3N1XC 4M01A 4BVUC 1A70A 5MPOA 2N7DA 1HEZE 2O6VD 3R2TA 5FR3A 4EEWA 3FKYA 3T3OA 3W5VB 1WYWB 1UZXB 4GGQA 4C00A 2V1YA 2ZVOA 4LJPB 1KRHA 5HKHA 4ZOHC 1J7CA 3AE8B 5CHVC 1LM8B 3ABVB 1ZW7A 1EM7A 4MGYE 2WGSA 3MJ5A 4NAMA 2K8BA 2OEDA 2GBRA 1ACCA 3PS6A 1SJED 1LXDA 2AX5A 3HVZA 3ZO5B 1E9MA 1CQVA 2K3UA 4ZRJA 4XZ4A 1D5XC 3L17A 1VJKA 4P1BC 3APDA 2JZ3B 2RD0A 3R66C 2KMCA 2LD9A 1H8CA 3BVGA 3A4RA 2LWPA 5LLIA 1XLOA 3CWIA 2K9XA 1RFKA 3Q3MC 3GZNB 3O13A 1AYFA 3HM3A 4B0EA 4N6EB 4GIVA 3BYTB 2JYEA 2JYTA 2FIDA 2WX0A 2D3CA 1ZKHA 3Q6BA 4Q2JA 3KH0A 2B3AA 4DXAB 3SEBA 2MW5A 3UQAA 3IHPC 1EU3A 2HE7A 3H1UA 2WDQB 1V97A 3MC0B 1JQ4A 3HIZA 3Q3NC 2ZCBA 2BS2B 2GBKA 4L1BA 1ISNA 2J7QB 3C19A 4EFOA 1SE4A 4YL8A 1Q0WB 2WXLA 3QJZA 3V6CB 2AL3A 1LO5D 1M94A 3UIOB 1C4CA 3NVYA 3QQ8B 3CIRB 4NJ7A 4HJGE 4WJNA 3TUOA 2D07B 4MM3B 2W3RA 2JT4B 2BWES 3N1ZC 4KX6B 4QAYA 4B9KA 1ZP0B 3RZFA 2CKHB 4R3DA 4ZRPA 2C9WB 2K8CA 1TT5B 2IO0B 1A5RA 3VH3B 1AARA 5C23A 1D3ZA 1T0YA 5HG2A 4G50A 2V3SA 5IOIA 4KVGB 4BKSA 4RGOS 2N9PC 1AWDA 1OQYA 2W82A 1IGCA 1YX6B 5CHFA 4HPPA 1IBXA 4HJKA 4YSYB 1B9RA 4G0NB 3ZXRA 1K50A 5EE0A 5HHDG 5D94A 5AZHA 2D5GA 4G3XB 2KTRB 3PT2B 4NQKE 4ZRIA 2LGSA 5J18A 3DBLI 4JGHB 3GB1A 2LVOA 2BS3B 3AE1B 4IWQA 3ZNGC 3WA0A 3AEEB 2KLCA 2YVCA 2ZW1A 1F2RI 4RFBA 4BFRA 1KLGD 3VUXA 3IXSA 2KFKB 1SXTA 1QLBB 3H7SA 1EF5A 2N9XA 2KO3A 4EZKA 2KFJA 3NS8A 1WMHA 3H9DA 2MBEA 4URKA 2INNE 4B6WA 3VTUA 1R7SA 3KYCD 1J8CA 1L7YA 4W9DA 1UD7A 4WWMA 2BPSA 3ZGZA 2BYEA 1ZOYB 2KDEB 2AWTA 2MSED 3RZWC 2NPTA 3RULA 1E7VA 1NBFC 2FCNA 2OHFA 1HQRD 5TR5A 3WALA 2N4FA 2VZKB 2SEBD 3CSTA 3AH7A 2PPHA 3URYA 1YOVB 3B2GA 3GE3C 4PK1A 2KWVB 1I35A 3U30A 2BGFA 5BO4B 4RM8A 1P9DU 3JSVB 2NTTA 3QARA 5T8IA 5G2NA 4C4VB 1TZ1A 3U2SC 2KANA 3AV8A 1IGDA 2XEWA 2I1JA 4FA6A 2D3GA 1QKZA 1IPGA 2M17A 1L6UA 3NZSA 1YN4A 1EF1A 3Q8FA 3EECA 3PSEB 1E5WA 4D2KA 1RYJA 1EU4A 3R7QA 2PMVA 1Y8RC 4WQOB 5CX3A 1J19A 1OGWA 4JQWC 5GMVA 2MBOA 3GOEA 3ZDTA 4KDIC 3RNFC 4GDLB 2ICIA 3IAS1 4X57B 2RDHA 3ZRCA 4KGRA 2E6XA 2XNAC 4TUUA 3VUWA 3DBHB 4DDGD 2IYDB 4A8XC 4HXDA 4MJSA 1XLPA 3NJTA 3DBRB 3P4RB 4FADA 2O6VB 3DOWA 2PLPA 1MI0A 4UDUC 3AE6B 3V6EB 3B2FA 1KTKA 1V1OA 2V3PA 1E90A 1YQBA 2L0FA 4FXCA 2QCZA 3AXCA 3OJ4B 1JCKB 1L4ZB 3DVGX 2CHWA 1VZ6A 2JZZA 3NUHB 1KOTA 3BZDB 2LVPA 1YX5B 4WAFA 1KJTA 1C76A 4G11A 2Z59B 3APCA 4AJWA 2JRHA 2KZRA 2D11A 5HI1A 1FRDA 1HE8A 4KV2A 1H4RA 3B08A 4HRSA 3ZW3A 2IZVB 1N5WA 3CMMB 1T0QC 3RCZA 5DPTA 1WR1A 3VVWB 5D3IB 2V4IB 2MQJA 1WF9A 4C56C 2N0SB 3H7PB 3B0AA 1DOIA 5HFYA 3QK0A 3VTVA 4RMAA 1DOXA 1F0ZA 2NBUA 3KQ4A 1I7HA 2KHWB 1FM0D 1QF6A 4II2B 2KD0A 3P42A 2LJIA 4FULA 2LEKA 1SBBB 2QILA 4TQ0A 2O2VB 1V5OA 5E6OA 1WGYA 1Z5SB 5DCNA 1TBEA 2CJOA 2L32A 3M63B 2UU7A 2AQ2B 2WXOA 5AEKB 2XK5B 2M0AA 2N7EA 4RGTA 2WXHA 3AU5A 1LFDA 3A9KA 2CR5A 1SE9A 2HTHA 1TY2A 4F7ZA 5CTRC 4ANWA 4F1SA 3L54A 3VHTC 4GU2A 2PTLA 5C2TB 1WX7A 1V6EA 5BMGA 4IC7B 1ET9A 1K51A 2UWQA 3DHGC 3L16A 1NDDA 1V49A 3SR6A 2IGGA 5E6NA 1R4NI 4FN2A 1XEEA 4K3CA 1L0YB 3A1QA 3WAMA 3QIJA 4KDLB 1SE2A 5BYRA 4OVZA 3L10B 4KGTA 2DYMA 2M8SA 2M1MA 2DZJA 2IO3B 1OTRB 2NR2A 3NG0A 1N6ZA 3V3XA 1GB4A 3ZLZA 2G4DB 2G1EA 2RSUA 3LJ3A 1NEKB 2KAJA 1EWYC 3M62B 2WLBA 1DYQA 2KTFA 4N59A 5JHAA 2KQ4X 4JWSC 3SU8X 4XDDA 3AE7B 3KUCB 4DBGA 3NOBA 3T9LA 3AEBB 3DCGA 1FNWA 2MCNB 4NJCA 3U52E 3U7DA 4BKSD 2DBYA 1ZDXA 2X8XX 2AQ1B 3JW0X 2ASQA 3PLVA 2B76B 4JPSA 2KMAA 1SB3C 2OJRA 2IGHA 2LI5A 3P2BA 4BOSC 2XBBC 3RNBC 1WZ0A 2DZMA 1MPEA 2RMMA 3B1LX 2D3AA 4WJPA 1SIJA 1V8CA 1V1PB 4PT5A 1HZ5A 4EZJA 5CHWA 4IM3A 3M3JA 3W2DA 3RT3B 3N3KB 3ZKJC 5D2MB 2ZEQA 4RNAA 3N30A 4WWNA 4M0WA 3RNGC 3BK1A 3VAWA 1FNUA 2VH2A 2C7HA 3C0RB 4FBJB 3IFWB 3PLUA 2EKEC 4MACA 2J4XA 2KNBA 2IJ0A 1QOAA 2JWUA 4DWFA 2ZZPB 3TJPA 3TMPB 5IKCM 3ECIA 4C7ZA 3SHQA 2L8JA 3VFKA 2YLMA 4GDKA 3L08A 1ZPSA 3ML9A 2FCMA 2Z0DB 1WE6A 3RUIB 3OG5A 1WRDB 1GPXA 3EC8A 2G3QB 4GLSC 1JRPA 2WXFA 2KWCA 2AQ3B 2FIFA 1OEYA 4RM9A 4HCPB 3NZUA 1N5XA 2I1KA 3ML8A 3AI5A 2L83A 2RDBC 4N58A 3HVDA 2FCSA 2KQSA 1SJHD 4W9CA 4MDKE 3HM6X 2IBIB 3QWZB 1N60A 1CZPA 3RN9C 3Q3OC 1C77A 1ESFA 3PO0A 2KOXA 4K3BA 2BKRB 1LGRA 1WI0A 4S17A 3KUZA 2WS3B 3KVFB 3UINB 1YQ3B 3AULA 5JZEB 1P98A 3ZNZB 1E7PB 3DWMA 2J52A 3NVVA 4HLEA 5BMIA 3BVZA 3V62A 1PDXA 4RF0A 4IDIA 1JWUD 4KIKB 2GRIA 1L6VA 2QMTA 4E74A 2WXKA 1BT0A 1L5PA 1S3SG 1FFVA 3SFDB 4IWOA 2MJDA 4BOZB 2YEPF 1HTOA 3P4SB 2IPKD 2JZPA 2DX5B 4LDTD 5E6JA 4WURA 2ZPNA 4WH4A 2MP2A 2BYVE 4XGAB 3BIID 3ZDMC 2KN4A 2VRRB 1UWMA 3UF8A 5D3DA 4K7WA 1T6BX 4IW0A 3N9YC 2EELA 2M19A 1FFUA 1B1ZA 3I9V1 4KSKC 1RRBA 4HK2A 3TEXA 1J7AA 1XXGA 2DAFA 1RWSA 1F77A 1WJNA 2J42A 4A9AA 3VR9B 4AOFA 1ROEA 2C7NB 3DBSA 3DVNU 3V05A 3VH4B 1MFWA 4GMVA 4P16A 5H92C 3HHMA 1SGHA 4LNOA 1CK1A 2LXAA 2K8HA 4TMAB 2N9KA 2Y5BB 3V60A 1E0ZA 4M8NA 1FNVA 1YD8U 1WE7A 2LFIA 3U4EG 3HK0A 5IO9A 3O65B 3N20C 1PGAA 3NY5A 4M00A 4XYCA 2L05A 3W1SC 2JUOA 1TTNA 2MX2A 4AQ7A 1YJ1A 3DVGY 1F9JA 3PHXB 4WWOA 1CJEA 1I4QA 1V5TA 4DQOC 4W9HA 5TSSA 2BB5A 1YJIA 3WAPA 4WJOA 4OZCA 2TSSA 3ENEA 1FMAD 4M02A 2AYOB 2XN9C 3ZJTA 1UGMA 4OW0A 1JMLA 3PTFC 3ZYYX 3JYUA 3P4PB 3SD5A 1EUVB 4AP4C 2KX3A 1QT9A 4DXFA 1I4XA 4MGZE 1P0RA 2GB1A 2C7MB 3L13A 4O1NA 1UBIA 2QEJC 3RNEC 1ZXIA 1FD6A 1D6EC 3Q69A 4ZDVA 2R2OA 1IYFA 5J17A 3QCAA 4HKQA 4IWPA 1R4MI 4US9A 1P1AA 3VDZA 4XC2A 4ACFA 3PGEA 1TGZB 3VRBB 2PE9A 3EGRA 4WWPA 3RFZB 4PYUA 3TL5A 3BINA 3ZIMA 1CMXB 1PGXA 2Q5WD 2GMIC 3WANA 1FIQA 3WCQA 2NBWB 5FR6A 3GP7A 3TEWA 1IBXB 2KDFB 4EZLA 3PZ7A 5D6JB 1WGDA 2IO2B 3QA8A 2J0KA 2FCQA 1FCLA 2QHOA 3AU4A 3PRMB 2MJ3A 1C79A 1VCBA 2LGXA 2WDVB 3LDZE 2L52A 1VZ7A 2MBQA 2EMTA 3Q8CA 5IP4D 2BYTA 2W54A 2PIAA 1L0XB 3GE8C 4W9LA 3K9OB 1SEBD 3UGBB 1M4VA 1TY0A 1WR6E 3L4PA 5L95C 4GXBA 2L7RA 3ETRA 4LCDE 4C80A 4MSMB 2JRIB 4HDOA 2KLGA 4HPMB 3FILA 3MFGA 3EFCA 2JU6X 4CO7A 1WMHB 1KLUD 3VTWA 1RAXA 4XE0A 2QIEB 3MJWA 3E9SA 1UGJA 3BK2A 2CU3A 2UYZB 4GSWA 2REXA 4M8MA 1DGJA 2X38A 1VZ8A 2DWQA 2MRPA 1I4RA 1Q1OA 3DBLB 1ZXHA 3MTNB 2BT6A 4YXDB 1GAQB 5D7GA 4DHZE 2RDGA 3PREA 3TIXA 2NPTB 4RGMA 4XDCA 3K9PB 4LNFA 1WM2A 1E8YA 1GC6A 3TSSA 2Z0EB 5AUIA 2I38A 3E56A 2JPHA 2K39A 2V3NA 3R2IA 1BXTA 4IM0A 5KHOA 1XF5L 1D5MC 1MHHE 1STEA 4MT5A 2DENB 3I63C 2ZNVB 3ZRFA 4CYEA 3HUIA 3P1MA 1GG3A 4ANVA 1FXAA 2K6DB 2WXRA 1FO4A 1Z2MA 2W55A 1KFYB 3AE4B 1WX8A 1V9JA 2FNJB 3EHVA 2BBCA 2BKFA 4HROA 4LLGM 2IGDA 4JIOU 3P4QB 2KWDA 2NVUI 1PYWD 5AZFA 2KN5A 1C4PA 1JWSD 2PKOA 4LK0M 2FBWB 1YJJA 4YSXB 1XD3B 1UELA 1WGRA 2BW2A 3Q3FA 1WIAA 3Q8BA 1ZE3D 3RYTA 2LVQA 2K0PA 2NTSA 2J53A 4GOCA 3R7RA 4DDID 3AB5A 4MJSB 2IO1B 4L2YA 2JY6A 1KH0A 5LXIB 1XCTL 2NMQA 2MBHA 4LDTB 1YN5A 3PPAA 5FK9C 4NPNA 3X23A 4USAA 3Q14C 4DHJD 4FHJA 1C78A 3OWEB 3BWUD 1ZDVA 2WX1A 2C60A 1KF6B 1UH6A 4YTNB 2A4ZA 2L1AA 2LGYA 3UIPB 3PZDA 1I4GA 4RCOA 4RF1A 2YEPB 1IP9A 2ONQA 4DK5A 4P1CC 1T0RC 1V2YA 2N1WA 2E3TA 1SE3A 3C8YA 1JWAD 1F1HA 2IDYA 4ZRQA 1HZ6A 4N9F4 2ZCCA 2MH7A 1OQRA 2LUMA 1QZEA 4HVBA 1E8XA 2PEAA 3CSFA 1WX9A 4B95A 3Q3JA 1PGBA 3GZNI 2PJHA 4J6IA 2KJRA 5IAAC 3W5UB 3AEGB 4A3PA 2MLBA 1E7UA 1WYGA 5FKAC 2K22A 4WAAA 1YQ4B 3UQBA 2VZKD 2WU5B 1SSNA 1QOFA 4LNNA 4ZHPA 1LQBA 1ZGUB 5BYSA 2JX5A 4ZHOA 1UBQA 2JQRB 1XT9B 3IG3A 2LJ5A 4YWGG 1JALA 1FPYA 3CF6E 4MSQB 2LGIA 2WWZA 3H6NA 2AL6A 5JHBA 4W9GA 4H2AA 5EDSA 4A6QA 1KM7A 1G6JA 1GC7A 2G9HD 1YIWA 4OHJA 3A9KB 1UWXA 2DYBA 2QJLA 1HTQA 4EKUA 2KX0A 4NY0A 4W9JA 4KSLC 2KDBA 4ANXA 1TS3A 3IT6B 2JF5A 4FHKA 2LZ6A 1NENB 2M56B 4HCNB 1VLBA 1PFDA 2G4SA 4AJYB 4ZYNA 4AWJA 2BTEA 4YTMB 2BWFA 3A1QB 4LNKA 4ARIA 2RPVA 4K7UA 2LRUA 5KHQA 1BUIC 5H8YE 1I4HA 1MHXA 4KGSA 1P7FA 1WJ6A 4ICVA 3RD2A 3NHEB 4MM3A 2L76A 3EFUA 1QOGA 2L0TA 1E8ZA 2KDIA 1UUPA 4AUQC 3VUYA 3MHZA 2H88B 1F2RC 2KJHB 3A33B 1R4NB 4HEA1 3U7ZA 2G45B 3TBLD 2W3SA 1NYRA 5GXGB 3I5JC 1WZ3A 2L3ZA 2EKIA 2ZNVC 1P3QU 3QHTA 5JXVA 3AM9A 1WY8A 1XLNA 4S0RA 1FRRA 3WAOA
chains in the Genus database with same CATH topology
4OZCA 3BZDB 2KMMA 4A55A 1SF0A 2TSSA 3KLSX 4WAFA 1C76A 1J7BA 1FMAD 3B9JA 3TEZA 3AE5B 4YT0B 2DLBA 2XN9C 1FXIA 1E6EB 3ZJTA 2CJNA 2QSDA 1TJEA 4P6VF 4KKJA 4TSSA 3Q8EA 1JMLA 4OW0A 1FRDA 5HI1A 3ZYYX 3P4PB 4HRSA 3TEYA 1N5WA 4JX1C 1TS5A 4NAWB 1D4BA 2WDRB 3VR8B 3NZ3A 5EE1A 4DXGA 1T3QA 1QT9A 5D3IB 2V4IB 4DXFA 1I4XA 1VDVA 1MVKA 4C56C 2LMCA 1FEHA 1EWCA 2GB1A 2N0SB 2WU2B 3EUB2 3ZJUA 1K52A 1BMLC 1DOIA 4O1NA 5HFYA 4RH6A 2QEJC 1JW9D 1ZXIA 1FD6A 1D6EC 1N62A 3Q69A 1ZUD2 3UI3A 1DOXA 1F0ZA 3KQ4A 1I7HA 1FM0D 1WSPA 4HKQA 1QF6A 1T5XD 3FAHA 4US9A 3AEAB 1QQRA 3P42A 3BVMA 1WRIA 2LJIA 3J9CA 3EGRA 4KKIA 2LEKA 3AEDB 3VRBB 3ZQ4A 1SBBB 2QILA 3EA6A 4TQ0A 3RFZB 1RM6C 1WGKA 1JWBD 2LHDA 1YMHE 1JWMD 1PGXA 2CJOA 5I4DA 2Q5WD 3WCQA 1FIQA 2L32A 2R61A 3AE9B 1OQQA 3GP7A 2AQ2B 2MJEA 3TEWA 2WXOA 1IBXB 2WXQA 1FCCC 3PZ7A 2M0AA 2K5PA 1TYGB 3I57A 4RGTA 2WXHA 2KACA 3AN1A 1C4AA 3AECB 1FCLA 5EE3A 4GDKB 4RGNA 3KWVA 1A70A 1I4PA 2MJ3A 1TY2A 1WWTA 3H8HA 4WQMA 1HEZE 5MPOA 1C79A 1TKYA 3R2TA 2WDVB 2WXIA 5FR3A 2L52A 1K53A 1VZ7A 3T3OA 2Y3AA 3Q8CA 2PTLA 2BYTA 2W54A 5C2TB 2PIAA 1L0XB 3W5VB 1SEBD 5BMGA 1M4VA 1ET9A 1K51A 1TY0A 3L4PA 1KRHA 3PZ8A 2LHEA 4ZOHC 1J7CA 3ETRA 1JROA 2IGGA 3AE8B 3SR6A 1QOBA 3ABVB 4ITKA 4C80A 4IOIE 1XEEA 3FILA 1EM7A 1TKEA 3AMZA 1L0YB 4B0MA 3MFGA 2JU6X 3MJ5A 4NAMA 1KLUD 1PUTA 2OEDA 1SE2A 4XE0A 5BYRA 2QIEB 1ACCA 4OVZA 1SJED 4KGTA 3E9SA 1UGJA 2DYMA 2AX5A 3BK2A 3HVZA 4IKGA 2CU3A 1E9MA 1CQVA 2K3UA 2WP9B 3NVWA 1DGJA 2X38A 2BB6A 3V3XA 1VZ8A 2DWQA 1GB4A 1AW7A 1I4RA 1D5XC 1ZXHA 2G1EA 1VJKA 2BT6A 3MP9A 4YXDB 1GAQB 5D7GA 2RDGA 2MEKA 1NEKB 3VRAB 4RGMA 4REZA 2KAJA 4XDCA 1EWYC 1YNTE 4YTPB 2WLBA 3BVGA 1DYQA 1Q10A 3TSSA 1XLOA 3CWIA 5AUIA 2I38A 2K9XA 1RFKA 3E56A 2WNMA 3O13A 2V3NA 1AYFA 3R2IA 4B0EA 1BXTA 4N59A 1XF5L 4N6EB 2KQ4X 4JWSC 4XDDA 1D5MC 1MHHE 2ACZB 3AE7B 3BYTB 3HRDD 1AN8A 2JYEA 1STEA 2JYTA 4MT5A 2WXGA 3AEBB 1FNWA 4CQNA 4Q2JA 4NJCA 3U52E 3HUIA 1TZOA 4C7YA 3P1MA 2DBYA 1NYQA 1FXAA 1ZDXA 3SEBA 1EU3A 2I2YA 2WXRA 2AQ1B 4TQ1A 3W9CB 1FO4A 2WDQB 1V97A 2WXNA 3MC0B 2W55A 1KFYB 3AE4B 1JQ4A 1N61A 4OZBA 2B76B 4JPSA 2BS2B 4L1BA 1SB3C 2WXMA 2BBCA 4HROA 4LLGM 2IGHA 2IGDA 3P4QB 2KWDA 5C3JB 1SE4A 1PYWD 4US8A 2N7JA 2Y5CA 1MPEA 2WXLA 2RMMA 4YSZB 1C4PA 3BYYB 1JWSD 5G5HA 2PKOA 4LK0M 2FBWB 2V0GA 1LO5D 1YJJA 4YSXB 1SIJA 1C4CA 3NVYA 1V8CA 3VQIA 3ZJVA 3CIRB 2BW2A 4HJGE 3TUOA 1V1PB 3Q8BA 2Z8LA 1ZE3D 4MM3B 2KDMA 1IUEA 4PT5A 2W3RA 1HZ5A 4KX6B 4LTUA 2PW9A 2K0PA 1ZP0B 3W2DA 2NTSA 2J53A 3FC4A 5LNK1 4R3DA 4RNAA 4AS1A 4ZRPA 3AB5A 3KWLA 4M0WA 4L2YA 1D5ZC 1KH0A 1XCTL 2HDEA 4XWTA 2NMQA 3BK1A 5AUKA 1YN5A 5FK9C 4L23A 5HG2A 4USAA 1FNUA 4RGOS 1VRAB 1AWDA 1C78A 2J4XA 4MACA 3OWEB 3BWUD 1ZDVA 2W82A 1IGCA 2IJ0A 5G5GA 1KF6B 1QOAA 2JWUA 1QILA 1OFFA 4YTNB 2L1AA 1IBXA 2FE8A 1XO3A 5BYQA 1I4GA 4RCOA 4C7ZA 2H89B 4YSYB 1HXYD 2YEPB 4RF1A 1B9RA 1ZPSA 1K50A 2ONQA 5EE0A 3Q8AA 5HHDG 1P7EA 1E10A 3AE3B 4XWWA 2D5GA 4A90A 1Y56A 2E3TA 1SE3A 3C8YA 2WXPA 1NVID 2ON8A 1JWAD 1GPXA 3GB1A 2N9LA 2IDYA 4ZRQA 1WXQA 2BS3B 1HZ6A 3AE1B 1JRPA 4GLSC 3GS2A 2WXJA 2WXFA 3NVZA 4JWUC 3AEEB 3AEFB 2MH7A 2AQ3B 1OQRA 2LUMA 2ZW1A 1F2RI 3LB8C 4RFBA 4NZLB 1N5XA 1KLGD 1TKGA 3IXSA 2JXTA 2L83A 1PGBA 1SXTA 4N58A 3HVDA 1QLBB 5BMHA 2FUG1 1DOYA 1SJHD 3W5UB 3AEGB 1N60A 1CZPA 2ZW0A 1WYGA 5FKAC 1C77A 1ESFA 2K22A 2INNE 3PO0A 3DWGC 1R7SA 1YQ4B 1GOZA 2VZKD 3LXFA 3NS1A 2WU5B 1SSNA 1QOFA 4ZHPA 2WS3B 5BYSA 2JX5A 4WWMA 1YQ3B 2WQYB 3ZGZA 2GI9A 2JQRB 4ZHOA 1ZOYB 4YWGG 1JALA 1E7PB 2Y5PA 2LGIA 1GB1A 3DWMA 2J52A 3NVVA 2OHFA 5BMIA 3BVZA 4H2AA 1PDXA 4RF0A 1HQRD 4A6QA 2VZKB 1ET6A 4IDIA 1JWUD 4JE3B 2GRIA 2SEBD 5EE9A 1L6VA 2QMTA 4EE2A 3T3NA 3AH7A 2G9HD 2WXKA 4OHJA 3URYA 1L5PA 3B2GA 3W1SA 2SAKA 1FFVA 1UWXA 4MH8A 3SFDB 2QJLA 2MJDA 1XLQA 2YEPF 3P4SB 2NTTA 3NRZA 3P63A 5T8IA 2IPKD 2JZPA 3U2SC 1N63A 4HKZE 5E6JA 1UNSA 3IT4B 4WURA 3AV8A 1TS3A 4WH4A 1IGDA 3IT6B 1VR9A 3BIID 1QKZA 1NENB 2KN4A 1L6UA 1UWMA 1YN4A 2M56B 1VLBA 1PFDA 2BS4B 3Q8FA 4J3OD 5D3DA 2PVGC 4D2KA 1RYJA 1T6BX 3N9YC 4ZYSA 1EU4A 2BTEA 2EELA 2M19A 1FFUA 2PMVA 1B1ZA 4WIPA 3FILB 3I9V1 4YTMB 2PVOD 3TEXA 4ARIA 1J7AA 1XXGA 2RPVA 1RWSA 3SFEB 1F77A 2J42A 1BUIC 4A9AA 3VR9B 1C9FA 5H8YE 1ROEA 1I4HA 1MHXA 4KGSA 3V05A 4GDLB 1P7FA 2ICIA 1YN3A 3IAS1 2RDHA 2DYOA 1TS4A 1HA5A 3AE2B 4KGRA 1TS2A 1L0VB 1V1PA 4P16A 5H92C 2HTME 1CK1A 1QOGA 2E6XA 2XNAC 4TMAB 2N9KA 1UUPA 1E0ZA 1FNVA 3MHZA 2H88B 1F2RC 2LFIA 3IAM1 3U4EG 2JSVX 4A8XC 1XLPA 1PGAA 3P4RB 4ARCA 3R8BA 4HEA1 1ENFA 3RPFC 2PLPA 1MI0A 4UDUC 3U7ZA 3AE6B 2W3SA 1XCQL 3B2FA 1KTKA 1NYRA 1V1OA 2V3PA 4AQ7A 3LYYA 5GXGB 4FXCA 4OZAA 2EKIA 1CJEA 5JXVA 3AM9A 1JCKB 1L4ZB 1XLNA 1I4QA 4DQOC 1L4DB 1NI3A 5TSSA 2BB5A 2INPE 1FRRA 1VZ6A 1YJIA 3NUHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6Q A;  2HDE A;  4A8X C;  4A90 A; 
#chains in the Genus database with same CATH topology
 1U4A A;  3N1Y C;  2J0M A;  2KMM A;  4I6N B;  5J2R A;  3KLS X;  3B9J A;  3TEZ A;  3AE5 B;  2DLB A;  1X1M A;  2WHI A;  2KTR A;  2QSD A;  1TJE A;  4P6V F;  4KKJ A;  4TSS A;  1UF0 A;  3Q8E A;  1MJD A;  4JX1 C;  2OOB B;  1TS5 A;  3ZXV A;  3VR8 B;  3NZ3 A;  5EE1 A;  4DXG A;  4MEL A;  1T3Q A;  5G55 A;  2KVZ A;  1GJZ A;  2LMC A;  2KT7 A;  1MG4 A;  1K52 A;  1BML C;  2KFK A;  3BY4 B;  3ZJU A;  4K81 A;  4RH6 A;  4I6P A;  2BQQ A;  3MC8 A;  3Q2A C;  2QDF A;  4M0W B;  1WSP A;  1T5X D;  1WXV A;  2GBN A;  3BVM A;  3J9C A;  3EA6 A;  2LHD A;  1K8R B;  5I4D A;  3RNA C;  2R61 A;  4NNJ B;  3AE9 B;  1OQQ A;  5IA7 A;  2MJE A;  2WXQ A;  4ASW C;  1TYG B;  3I57 A;  4LNI A;  1C4A A;  3AEC B;  4GDK B;  4MEM A;  3IVF A;  3KWV A;  3S2A A;  1I4P A;  2OJW A;  1TIF A;  3H8H A;  1WWT A;  4ICU A;  4WQM A;  3APF A;  1TKY A;  2WDT B;  3JSV A;  2WXI A;  4K7S A;  1K53 A;  4C4V A;  1C1Y B;  3OJ3 A;  2Y3A A;  4OVU A;  2FUH B;  3DBH I;  2KVR A;  4E71 A;  3PZ8 A;  2LHE A;  3KW5 B;  4FLH A;  1JRO A;  3DBR I;  1QOB A;  4ITK A;  4IOI E;  2AEH A;  2N1V A;  1TKE A;  3AMZ A;  4B0M A;  4A3O A;  1PUT A;  2GBJ A;  1T0S C;  4IKG A;  5DPR A;  2LUE A;  3WIM A;  4DHJ B;  2KQ7 A;  3JVZ X;  3OAW A;  2WP9 B;  4GDL A;  4W9F A;  4IG7 B;  3NVW A;  2BB6 A;  1AW7 A;  2D10 A;  3MP9 A;  2MEK A;  3VRA B;  1XQQ A;  4REZ A;  5JH5 C;  2KYW A;  2DAJ A;  1YNT E;  4YTP B;  3PRZ A;  4PYZ A;  1WXM A;  3ZNI D;  1V80 A;  1Q10 A;  1S1Q B;  2KC2 A;  3D32 A;  3R3M A;  2WNM A;  2O6V A;  1SIF A;  1PQS A;  1J0G A;  3PRP B;  4HWI B;  4FJZ A;  2ACZ B;  3HRD D;  1AN8 A;  2M0X A;  2BYF A;  2LAS A;  2WXG A;  4TV3 A;  4CQN A;  2M4N A;  1TZO A;  2A5U A;  2MP2 B;  4C7Y A;  3W1Y A;  3MHS D;  1NYQ A;  5L83 A;  2I2Y A;  1WJU A;  2RR9 A;  4TQ1 A;  3W9C B;  2WXN A;  3ZTD A;  3QX1 A;  1N61 A;  3PHW B;  4OZB A;  2RPQ A;  2WXM A;  2J0J A;  2V4L A;  4LJO B;  1WXS A;  4MH0 E;  5C3J B;  3N32 A;  4US8 A;  2N7J A;  2Y5C A;  4YSZ B;  3BYY B;  5G5H A;  2KK8 A;  4IUM B;  2MA9 B;  2V0G A;  2KJ6 A;  3VQI A;  3ZJV A;  1GUA B;  2Z8L A;  2KDM A;  1IUE A;  3H7P A;  1RLF A;  2GLS A;  4K1R B;  2V9H A;  1WJ4 A;  4LTU A;  2PW9 A;  2W9N A;  4TKN A;  3FC4 A;  5LNK 1;  4AS1 A;  5DPS A;  3KWL A;  1D5Z C;  2HDE A;  4XWT A;  2QC8 A;  5AUK A;  4W9I A;  4L23 A;  2LRW A;  3A9J A;  2O2V A;  1VRA B;  2CHZ A;  1KLV A;  4BZA A;  5G5G A;  3QC8 B;  1GNU A;  3TCA A;  1QIL A;  1OFF A;  2LGD A;  2PE6 B;  1WH3 A;  2FE8 A;  2XK5 A;  1XO3 A;  5BYQ A;  1MG8 A;  2GBM A;  2H89 B;  1L2N A;  1HXY D;  3DDC B;  3Q8A A;  2DZI A;  1P7E A;  1E10 A;  2HJ8 A;  3AE3 B;  3L0W B;  4XWW A;  3I3T B;  4W9E A;  1Y56 A;  4A90 A;  2WXP A;  1NVI D;  2ON8 A;  3DQV A;  2N9L A;  1WXQ A;  2HJ1 A;  2IY0 B;  2CS4 A;  2NBV B;  3GS2 A;  4OVV A;  2WXJ A;  3NVZ A;  4A20 A;  4JWU C;  3AEF B;  4MGK E;  4MGI E;  2JWZ A;  4E3C A;  4ZRK A;  1V81 A;  3LB8 C;  4NZL B;  2D2Q A;  2MBB B;  1Q5W B;  1TKG A;  1OEY J;  2JXT A;  5BMH A;  2FUG 1;  1DOY A;  2BF8 B;  2ZW0 A;  3V61 A;  3DWG C;  5IN7 A;  1GOZ A;  3DHH C;  3LXF A;  4NJ6 A;  3NS1 A;  4F8C B;  2ZJD A;  2WQY B;  2GI9 A;  2K6Q A;  2KWU B;  2Y5P A;  1GB1 A;  2ZVN A;  2VH1 A;  1ET6 A;  3M95 A;  4DHZ B;  4JE3 B;  5EE9 A;  5AZG A;  4EE2 A;  3T3N A;  1WM3 A;  5DPW A;  4HDQ A;  1EO6 A;  3W1S A;  2SAK A;  4NAW A;  4MH8 A;  3A4S C;  1XLQ A;  3RMK C;  2JVC A;  3NRZ A;  3P63 A;  1R4M B;  1E8W A;  1N63 A;  4HKZ E;  3KUD B;  2EMS A;  1UNS A;  3IT4 B;  3RNC C;  1VR9 A;  3A9J B;  4KZC A;  2ZPY A;  3SDL C;  2BS4 B;  4J3O D;  2PVG C;  3IBE A;  2FAZ A;  4ZYS A;  1WGH A;  2R2Q A;  4WIP A;  3RI7 C;  3FIL B;  2JXX A;  2PVO D;  4ANU A;  3SFE B;  1C9F A;  4II3 B;  3QAQ A;  1YN3 A;  2DHZ A;  4PS8 A;  2DYO A;  1TS4 A;  1HA5 A;  3AE2 B;  1TS2 A;  1L0V B;  1V1P A;  2HTM E;  1WGG A;  4BBN F;  4GB9 A;  4JL9 A;  2C5L C;  3IAM 1;  2JSV X;  2DNF A;  4ARC A;  3R8B A;  4CHK A;  1ENF A;  3PV1 A;  3RPF C;  1WFY A;  2LXC A;  1NI2 A;  3T8M A;  1XCQ L;  4W9K A;  3LYY A;  4I6L B;  4EOY A;  2NS5 A;  4OZA A;  3KYD D;  5LXH A;  4FJV B;  4PS3 A;  2KC1 A;  1L4D B;  1NI3 A;  2N9E B;  2INP E;  4NQL B;  4BBN C;  4KZ0 A;  4P7I A;  2BVC A;  3DHI C;  3X0W A;  4A55 A;  1SF0 A;  4BKT A;  3ZUN A;  1J7B A;  2GOW A;  3PVL A;  2D3B A;  2L00 B;  4YT0 B;  4FJY A;  1FXI A;  2K25 A;  1E6E B;  2CJN A;  4JLC A;  2IY1 B;  3ZNH B;  5C1Z A;  3TEY A;  3OLM D;  4GN1 A;  4NAW B;  4EUT A;  2WDR B;  1D4B A;  2CHX A;  1V86 A;  1VDV A;  2HD5 B;  1MVK A;  1F52 A;  1FEH A;  1EWC A;  1FXT B;  3ZVV A;  2WU2 B;  3EUB 2;  3ALB A;  4BKG A;  1JW9 D;  3VXW A;  2MHJ A;  2KXJ A;  1N62 A;  1ZUD 2;  3UI3 A;  4BAX A;  4HPL B;  3FAH A;  2K1F A;  2RGF A;  3AEA B;  2WYQ A;  1QQR A;  3ONS A;  1WRI A;  4KKI A;  3AED B;  4PS7 A;  3ZQ4 A;  2INC C;  1RFA A;  5E6P A;  1C3T A;  3U8Z A;  3ZTC A;  1RM6 C;  1WGK A;  3MC9 A;  1JWB D;  1I42 A;  2IND C;  1YMH E;  2KKC A;  1JWM D;  2DZK A;  3DVN V;  2CU1 A;  1FCC C;  1VD2 A;  4KIK A;  2K5P A;  4WJQ A;  2NCN A;  1JRU A;  3AN1 A;  2KAC A;  2MWS B;  4IM2 A;  5EE3 A;  4XX5 A;  4RGN A;  1WXA A;  3DPD A;  3N1X C;  4M01 A;  4BVU C;  1A70 A;  5MPO A;  2N7D A;  1HEZ E;  2O6V D;  3R2T A;  5FR3 A;  4EEW A;  3FKY A;  3T3O A;  3W5V B;  1WYW B;  1UZX B;  4GGQ A;  4C00 A;  2V1Y A;  2ZVO A;  4LJP B;  1KRH A;  5HKH A;  4ZOH C;  1J7C A;  3AE8 B;  5CHV C;  1LM8 B;  3ABV B;  1ZW7 A;  1EM7 A;  4MGY E;  2WGS A;  3MJ5 A;  4NAM A;  2K8B A;  2OED A;  2GBR A;  1ACC A;  3PS6 A;  1SJE D;  1LXD A;  2AX5 A;  3HVZ A;  3ZO5 B;  1E9M A;  1CQV A;  2K3U A;  4ZRJ A;  4XZ4 A;  1D5X C;  3L17 A;  1VJK A;  4P1B C;  3APD A;  2JZ3 B;  2RD0 A;  3R66 C;  2KMC A;  2LD9 A;  1H8C A;  3BVG A;  3A4R A;  2LWP A;  5LLI A;  1XLO A;  3CWI A;  2K9X A;  1RFK A;  3Q3M C;  3GZN B;  3O13 A;  1AYF A;  3HM3 A;  4B0E A;  4N6E B;  4GIV A;  3BYT B;  2JYE A;  2JYT A;  2FID A;  2WX0 A;  2D3C A;  1ZKH A;  3Q6B A;  4Q2J A;  3KH0 A;  2B3A A;  4DXA B;  3SEB A;  2MW5 A;  3UQA A;  3IHP C;  1EU3 A;  2HE7 A;  3H1U A;  2WDQ B;  1V97 A;  3MC0 B;  1JQ4 A;  3HIZ A;  3Q3N C;  2ZCB A;  2BS2 B;  2GBK A;  4L1B A;  1ISN A;  2J7Q B;  3C19 A;  4EFO A;  1SE4 A;  4YL8 A;  1Q0W B;  2WXL A;  3QJZ A;  3V6C B;  2AL3 A;  1LO5 D;  1M94 A;  3UIO B;  1C4C A;  3NVY A;  3QQ8 B;  3CIR B;  4NJ7 A;  4HJG E;  4WJN A;  3TUO A;  2D07 B;  4MM3 B;  2W3R A;  2JT4 B;  2BWE S;  3N1Z C;  4KX6 B;  4QAY A;  4B9K A;  1ZP0 B;  3RZF A;  2CKH B;  4R3D A;  4ZRP A;  2C9W B;  2K8C A;  1TT5 B;  2IO0 B;  1A5R A;  3VH3 B;  1AAR A;  5C23 A;  1D3Z A;  1T0Y A;  5HG2 A;  4G50 A;  2V3S A;  5IOI A;  4KVG B;  4BKS A;  4RGO S;  2N9P C;  1AWD A;  1OQY A;  2W82 A;  1IGC A;  1YX6 B;  5CHF A;  4HPP A;  1IBX A;  4HJK A;  4YSY B;  1B9R A;  4G0N B;  3ZXR A;  1K50 A;  5EE0 A;  5HHD G;  5D94 A;  5AZH A;  2D5G A;  4G3X B;  2KTR B;  3PT2 B;  4NQK E;  4ZRI A;  2LGS A;  5J18 A;  3DBL I;  4JGH B;  3GB1 A;  2LVO A;  2BS3 B;  3AE1 B;  4IWQ A;  3ZNG C;  3WA0 A;  3AEE B;  2KLC A;  2YVC A;  2ZW1 A;  1F2R I;  4RFB A;  4BFR A;  1KLG D;  3VUX A;  3IXS A;  2KFK B;  1SXT A;  1QLB B;  3H7S A;  1EF5 A;  2N9X A;  2KO3 A;  4EZK A;  2KFJ A;  3NS8 A;  1WMH A;  3H9D A;  2MBE A;  4URK A;  2INN E;  4B6W A;  3VTU A;  1R7S A;  3KYC D;  1J8C A;  1L7Y A;  4W9D A;  1UD7 A;  4WWM A;  2BPS A;  3ZGZ A;  2BYE A;  1ZOY B;  2KDE B;  2AWT A;  2MSE D;  3RZW C;  2NPT A;  3RUL A;  1E7V A;  1NBF C;  2FCN A;  2OHF A;  1HQR D;  5TR5 A;  3WAL A;  2N4F A;  2VZK B;  2SEB D;  3CST A;  3AH7 A;  2PPH A;  3URY A;  1YOV B;  3B2G A;  3GE3 C;  4PK1 A;  2KWV B;  1I35 A;  3U30 A;  2BGF A;  5BO4 B;  4RM8 A;  1P9D U;  3JSV B;  2NTT A;  3QAR A;  5T8I A;  5G2N A;  4C4V B;  1TZ1 A;  3U2S C;  2KAN A;  3AV8 A;  1IGD A;  2XEW A;  2I1J A;  4FA6 A;  2D3G A;  1QKZ A;  1IPG A;  2M17 A;  1L6U A;  3NZS A;  1YN4 A;  1EF1 A;  3Q8F A;  3EEC A;  3PSE B;  1E5W A;  4D2K A;  1RYJ A;  1EU4 A;  3R7Q A;  2PMV A;  1Y8R C;  4WQO B;  5CX3 A;  1J19 A;  1OGW A;  4JQW C;  5GMV A;  2MBO A;  3GOE A;  3ZDT A;  4KDI C;  3RNF C;  4GDL B;  2ICI A;  3IAS 1;  4X57 B;  2RDH A;  3ZRC A;  4KGR A;  2E6X A;  2XNA C;  4TUU A;  3VUW A;  3DBH B;  4DDG D;  2IYD B;  4A8X C;  4HXD A;  4MJS A;  1XLP A;  3NJT A;  3DBR B;  3P4R B;  4FAD A;  2O6V B;  3DOW A;  2PLP A;  1MI0 A;  4UDU C;  3AE6 B;  3V6E B;  3B2F A;  1KTK A;  1V1O A;  2V3P A;  1E90 A;  1YQB A;  2L0F A;  4FXC A;  2QCZ A;  3AXC A;  3OJ4 B;  1JCK B;  1L4Z B;  3DVG X;  2CHW A;  1VZ6 A;  2JZZ A;  3NUH B;  1KOT A;  3BZD B;  2LVP A;  1YX5 B;  4WAF A;  1KJT A;  1C76 A;  4G11 A;  2Z59 B;  3APC A;  4AJW A;  2JRH A;  2KZR A;  2D11 A;  5HI1 A;  1FRD A;  1HE8 A;  4KV2 A;  1H4R A;  3B08 A;  4HRS A;  3ZW3 A;  2IZV B;  1N5W A;  3CMM B;  1T0Q C;  3RCZ A;  5DPT A;  1WR1 A;  3VVW B;  5D3I B;  2V4I B;  2MQJ A;  1WF9 A;  4C56 C;  2N0S B;  3H7P B;  3B0A A;  1DOI A;  5HFY A;  3QK0 A;  3VTV A;  4RMA A;  1DOX A;  1F0Z A;  2NBU A;  3KQ4 A;  1I7H A;  2KHW B;  1FM0 D;  1QF6 A;  4II2 B;  2KD0 A;  3P42 A;  2LJI A;  4FUL A;  2LEK A;  1SBB B;  2QIL A;  4TQ0 A;  2O2V B;  1V5O A;  5E6O A;  1WGY A;  1Z5S B;  5DCN A;  1TBE A;  2CJO A;  2L32 A;  3M63 B;  2UU7 A;  2AQ2 B;  2WXO A;  5AEK B;  2XK5 B;  2M0A A;  2N7E A;  4RGT A;  2WXH A;  3AU5 A;  1LFD A;  3A9K A;  2CR5 A;  1SE9 A;  2HTH A;  1TY2 A;  4F7Z A;  5CTR C;  4ANW A;  4F1S A;  3L54 A;  3VHT C;  4GU2 A;  2PTL A;  5C2T B;  1WX7 A;  1V6E A;  5BMG A;  4IC7 B;  1ET9 A;  1K51 A;  2UWQ A;  3DHG C;  3L16 A;  1NDD A;  1V49 A;  3SR6 A;  2IGG A;  5E6N A;  1R4N I;  4FN2 A;  1XEE A;  4K3C A;  1L0Y B;  3A1Q A;  3WAM A;  3QIJ A;  4KDL B;  1SE2 A;  5BYR A;  4OVZ A;  3L10 B;  4KGT A;  2DYM A;  2M8S A;  2M1M A;  2DZJ A;  2IO3 B;  1OTR B;  2NR2 A;  3NG0 A;  1N6Z A;  3V3X A;  1GB4 A;  3ZLZ A;  2G4D B;  2G1E A;  2RSU A;  3LJ3 A;  1NEK B;  2KAJ A;  1EWY C;  3M62 B;  2WLB A;  1DYQ A;  2KTF A;  4N59 A;  5JHA A;  2KQ4 X;  4JWS C;  3SU8 X;  4XDD A;  3AE7 B;  3KUC B;  4DBG A;  3NOB A;  3T9L A;  3AEB B;  3DCG A;  1FNW A;  2MCN B;  4NJC A;  3U52 E;  3U7D A;  4BKS D;  2DBY A;  1ZDX A;  2X8X X;  2AQ1 B;  3JW0 X;  2ASQ A;  3PLV A;  2B76 B;  4JPS A;  2KMA A;  1SB3 C;  2OJR A;  2IGH A;  2LI5 A;  3P2B A;  4BOS C;  2XBB C;  3RNB C;  1WZ0 A;  2DZM A;  1MPE A;  2RMM A;  3B1L X;  2D3A A;  4WJP A;  1SIJ A;  1V8C A;  1V1P B;  4PT5 A;  1HZ5 A;  4EZJ A;  5CHW A;  4IM3 A;  3M3J A;  3W2D A;  3RT3 B;  3N3K B;  3ZKJ C;  5D2M B;  2ZEQ A;  4RNA A;  3N30 A;  4WWN A;  4M0W A;  3RNG C;  3BK1 A;  3VAW A;  1FNU A;  2VH2 A;  2C7H A;  3C0R B;  4FBJ B;  3IFW B;  3PLU A;  2EKE C;  4MAC A;  2J4X A;  2KNB A;  2IJ0 A;  1QOA A;  2JWU A;  4DWF A;  2ZZP B;  3TJP A;  3TMP B;  5IKC M;  3ECI A;  4C7Z A;  3SHQ A;  2L8J A;  3VFK A;  2YLM A;  4GDK A;  3L08 A;  1ZPS A;  3ML9 A;  2FCM A;  2Z0D B;  1WE6 A;  3RUI B;  3OG5 A;  1WRD B;  1GPX A;  3EC8 A;  2G3Q B;  4GLS C;  1JRP A;  2WXF A;  2KWC A;  2AQ3 B;  2FIF A;  1OEY A;  4RM9 A;  4HCP B;  3NZU A;  1N5X A;  2I1K A;  3ML8 A;  3AI5 A;  2L83 A;  2RDB C;  4N58 A;  3HVD A;  2FCS A;  2KQS A;  1SJH D;  4W9C A;  4MDK E;  3HM6 X;  2IBI B;  3QWZ B;  1N60 A;  1CZP A;  3RN9 C;  3Q3O C;  1C77 A;  1ESF A;  3PO0 A;  2KOX A;  4K3B A;  2BKR B;  1LGR A;  1WI0 A;  4S17 A;  3KUZ A;  2WS3 B;  3KVF B;  3UIN B;  1YQ3 B;  3AUL A;  5JZE B;  1P98 A;  3ZNZ B;  1E7P B;  3DWM A;  2J52 A;  3NVV A;  4HLE A;  5BMI A;  3BVZ A;  3V62 A;  1PDX A;  4RF0 A;  4IDI A;  1JWU D;  4KIK B;  2GRI A;  1L6V A;  2QMT A;  4E74 A;  2WXK A;  1BT0 A;  1L5P A;  1S3S G;  1FFV A;  3SFD B;  4IWO A;  2MJD A;  4BOZ B;  2YEP F;  1HTO A;  3P4S B;  2IPK D;  2JZP A;  2DX5 B;  4LDT D;  5E6J A;  4WUR A;  2ZPN A;  4WH4 A;  2MP2 A;  2BYV E;  4XGA B;  3BII D;  3ZDM C;  2KN4 A;  2VRR B;  1UWM A;  3UF8 A;  5D3D A;  4K7W A;  1T6B X;  4IW0 A;  3N9Y C;  2EEL A;  2M19 A;  1FFU A;  1B1Z A;  3I9V 1;  4KSK C;  1RRB A;  4HK2 A;  3TEX A;  1J7A A;  1XXG A;  2DAF A;  1RWS A;  1F77 A;  1WJN A;  2J42 A;  4A9A A;  3VR9 B;  4AOF A;  1ROE A;  2C7N B;  3DBS A;  3DVN U;  3V05 A;  3VH4 B;  1MFW A;  4GMV A;  4P16 A;  5H92 C;  3HHM A;  1SGH A;  4LNO A;  1CK1 A;  2LXA A;  2K8H A;  4TMA B;  2N9K A;  2Y5B B;  3V60 A;  1E0Z A;  4M8N A;  1FNV A;  1YD8 U;  1WE7 A;  2LFI A;  3U4E G;  3HK0 A;  5IO9 A;  3O65 B;  3N20 C;  1PGA A;  3NY5 A;  4M00 A;  4XYC A;  2L05 A;  3W1S C;  2JUO A;  1TTN A;  2MX2 A;  4AQ7 A;  1YJ1 A;  3DVG Y;  1F9J A;  3PHX B;  4WWO A;  1CJE A;  1I4Q A;  1V5T A;  4DQO C;  4W9H A;  5TSS A;  2BB5 A;  1YJI A;  3WAP A;  4WJO A;  4OZC A;  2TSS A;  3ENE A;  1FMA D;  4M02 A;  2AYO B;  2XN9 C;  3ZJT A;  1UGM A;  4OW0 A;  1JML A;  3PTF C;  3ZYY X;  3JYU A;  3P4P B;  3SD5 A;  1EUV B;  4AP4 C;  2KX3 A;  1QT9 A;  4DXF A;  1I4X A;  4MGZ E;  1P0R A;  2GB1 A;  2C7M B;  3L13 A;  4O1N A;  1UBI A;  2QEJ C;  3RNE C;  1ZXI A;  1FD6 A;  1D6E C;  3Q69 A;  4ZDV A;  2R2O A;  1IYF A;  5J17 A;  3QCA A;  4HKQ A;  4IWP A;  1R4M I;  4US9 A;  1P1A A;  3VDZ A;  4XC2 A;  4ACF A;  3PGE A;  1TGZ B;  3VRB B;  2PE9 A;  3EGR A;  4WWP A;  3RFZ B;  4PYU A;  3TL5 A;  3BIN A;  3ZIM A;  1CMX B;  1PGX A;  2Q5W D;  2GMI C;  3WAN A;  1FIQ A;  3WCQ A;  2NBW B;  5FR6 A;  3GP7 A;  3TEW A;  1IBX B;  2KDF B;  4EZL A;  3PZ7 A;  5D6J B;  1WGD A;  2IO2 B;  3QA8 A;  2J0K A;  2FCQ A;  1FCL A;  2QHO A;  3AU4 A;  3PRM B;  2MJ3 A;  1C79 A;  1VCB A;  2LGX A;  2WDV B;  3LDZ E;  2L52 A;  1VZ7 A;  2MBQ A;  2EMT A;  3Q8C A;  5IP4 D;  2BYT A;  2W54 A;  2PIA A;  1L0X B;  3GE8 C;  4W9L A;  3K9O B;  1SEB D;  3UGB B;  1M4V A;  1TY0 A;  1WR6 E;  3L4P A;  5L95 C;  4GXB A;  2L7R A;  3ETR A;  4LCD E;  4C80 A;  4MSM B;  2JRI B;  4HDO A;  2KLG A;  4HPM B;  3FIL A;  3MFG A;  3EFC A;  2JU6 X;  4CO7 A;  1WMH B;  1KLU D;  3VTW A;  1RAX A;  4XE0 A;  2QIE B;  3MJW A;  3E9S A;  1UGJ A;  3BK2 A;  2CU3 A;  2UYZ B;  4GSW A;  2REX A;  4M8M A;  1DGJ A;  2X38 A;  1VZ8 A;  2DWQ A;  2MRP A;  1I4R A;  1Q1O A;  3DBL B;  1ZXH A;  3MTN B;  2BT6 A;  4YXD B;  1GAQ B;  5D7G A;  4DHZ E;  2RDG A;  3PRE A;  3TIX A;  2NPT B;  4RGM A;  4XDC A;  3K9P B;  4LNF A;  1WM2 A;  1E8Y A;  1GC6 A;  3TSS A;  2Z0E B;  5AUI A;  2I38 A;  3E56 A;  2JPH A;  2K39 A;  2V3N A;  3R2I A;  1BXT A;  4IM0 A;  5KHO A;  1XF5 L;  1D5M C;  1MHH E;  1STE A;  4MT5 A;  2DEN B;  3I63 C;  2ZNV B;  3ZRF A;  4CYE A;  3HUI A;  3P1M A;  1GG3 A;  4ANV A;  1FXA A;  2K6D B;  2WXR A;  1FO4 A;  1Z2M A;  2W55 A;  1KFY B;  3AE4 B;  1WX8 A;  1V9J A;  2FNJ B;  3EHV A;  2BBC A;  2BKF A;  4HRO A;  4LLG M;  2IGD A;  4JIO U;  3P4Q B;  2KWD A;  2NVU I;  1PYW D;  5AZF A;  2KN5 A;  1C4P A;  1JWS D;  2PKO A;  4LK0 M;  2FBW B;  1YJJ A;  4YSX B;  1XD3 B;  1UEL A;  1WGR A;  2BW2 A;  3Q3F A;  1WIA A;  3Q8B A;  1ZE3 D;  3RYT A;  2LVQ A;  2K0P A;  2NTS A;  2J53 A;  4GOC A;  3R7R A;  4DDI D;  3AB5 A;  4MJS B;  2IO1 B;  4L2Y A;  2JY6 A;  1KH0 A;  5LXI B;  1XCT L;  2NMQ A;  2MBH A;  4LDT B;  1YN5 A;  3PPA A;  5FK9 C;  4NPN A;  3X23 A;  4USA A;  3Q14 C;  4DHJ D;  4FHJ A;  1C78 A;  3OWE B;  3BWU D;  1ZDV A;  2WX1 A;  2C60 A;  1KF6 B;  1UH6 A;  4YTN B;  2A4Z A;  2L1A A;  2LGY A;  3UIP B;  3PZD A;  1I4G A;  4RCO A;  4RF1 A;  2YEP B;  1IP9 A;  2ONQ A;  4DK5 A;  4P1C C;  1T0R C;  1V2Y A;  2N1W A;  2E3T A;  1SE3 A;  3C8Y A;  1JWA D;  1F1H A;  2IDY A;  4ZRQ A;  1HZ6 A;  4N9F 4;  2ZCC A;  2MH7 A;  1OQR A;  2LUM A;  1QZE A;  4HVB A;  1E8X A;  2PEA A;  3CSF A;  1WX9 A;  4B95 A;  3Q3J A;  1PGB A;  3GZN I;  2PJH A;  4J6I A;  2KJR A;  5IAA C;  3W5U B;  3AEG B;  4A3P A;  2MLB A;  1E7U A;  1WYG A;  5FKA C;  2K22 A;  4WAA A;  1YQ4 B;  3UQB A;  2VZK D;  2WU5 B;  1SSN A;  1QOF A;  4LNN A;  4ZHP A;  1LQB A;  1ZGU B;  5BYS A;  2JX5 A;  4ZHO A;  1UBQ A;  2JQR B;  1XT9 B;  3IG3 A;  2LJ5 A;  4YWG G;  1JAL A;  1FPY A;  3CF6 E;  4MSQ B;  2LGI A;  2WWZ A;  3H6N A;  2AL6 A;  5JHB A;  4W9G A;  4H2A A;  5EDS A;  4A6Q A;  1KM7 A;  1G6J A;  1GC7 A;  2G9H D;  1YIW A;  4OHJ A;  3A9K B;  1UWX A;  2DYB A;  2QJL A;  1HTQ A;  4EKU A;  2KX0 A;  4NY0 A;  4W9J A;  4KSL C;  2KDB A;  4ANX A;  1TS3 A;  3IT6 B;  2JF5 A;  4FHK A;  2LZ6 A;  1NEN B;  2M56 B;  4HCN B;  1VLB A;  1PFD A;  2G4S A;  4AJY B;  4ZYN A;  4AWJ A;  2BTE A;  4YTM B;  2BWF A;  3A1Q B;  4LNK A;  4ARI A;  2RPV A;  4K7U A;  2LRU A;  5KHQ A;  1BUI C;  5H8Y E;  1I4H A;  1MHX A;  4KGS A;  1P7F A;  1WJ6 A;  4ICV A;  3RD2 A;  3NHE B;  4MM3 A;  2L76 A;  3EFU A;  1QOG A;  2L0T A;  1E8Z A;  2KDI A;  1UUP A;  4AUQ C;  3VUY A;  3MHZ A;  2H88 B;  1F2R C;  2KJH B;  3A33 B;  1R4N B;  4HEA 1;  3U7Z A;  2G45 B;  3TBL D;  2W3S A;  1NYR A;  5GXG B;  3I5J C;  1WZ3 A;  2L3Z A;  2EKI A;  2ZNV C;  1P3Q U;  3QHT A;  5JXV A;  3AM9 A;  1WY8 A;  1XLN A;  4S0R A;  1FRR A;  3WAO A; 
#chains in the Genus database with same CATH homology
 4OZC A;  3BZD B;  2KMM A;  4A55 A;  1SF0 A;  2TSS A;  3KLS X;  4WAF A;  1C76 A;  1J7B A;  1FMA D;  3B9J A;  3TEZ A;  3AE5 B;  4YT0 B;  2DLB A;  2XN9 C;  1FXI A;  1E6E B;  3ZJT A;  2CJN A;  2QSD A;  1TJE A;  4P6V F;  4KKJ A;  4TSS A;  3Q8E A;  1JML A;  4OW0 A;  1FRD A;  5HI1 A;  3ZYY X;  3P4P B;  4HRS A;  3TEY A;  1N5W A;  4JX1 C;  1TS5 A;  4NAW B;  1D4B A;  2WDR B;  3VR8 B;  3NZ3 A;  5EE1 A;  4DXG A;  1T3Q A;  1QT9 A;  5D3I B;  2V4I B;  4DXF A;  1I4X A;  1VDV A;  1MVK A;  4C56 C;  2LMC A;  1FEH A;  1EWC A;  2GB1 A;  2N0S B;  2WU2 B;  3EUB 2;  3ZJU A;  1K52 A;  1BML C;  1DOI A;  4O1N A;  5HFY A;  4RH6 A;  2QEJ C;  1JW9 D;  1ZXI A;  1FD6 A;  1D6E C;  1N62 A;  3Q69 A;  1ZUD 2;  3UI3 A;  1DOX A;  1F0Z A;  3KQ4 A;  1I7H A;  1FM0 D;  1WSP A;  4HKQ A;  1QF6 A;  1T5X D;  3FAH A;  4US9 A;  3AEA B;  1QQR A;  3P42 A;  3BVM A;  1WRI A;  2LJI A;  3J9C A;  3EGR A;  4KKI A;  2LEK A;  3AED B;  3VRB B;  3ZQ4 A;  1SBB B;  2QIL A;  3EA6 A;  4TQ0 A;  3RFZ B;  1RM6 C;  1WGK A;  1JWB D;  2LHD A;  1YMH E;  1JWM D;  1PGX A;  2CJO A;  5I4D A;  2Q5W D;  3WCQ A;  1FIQ A;  2L32 A;  2R61 A;  3AE9 B;  1OQQ A;  3GP7 A;  2AQ2 B;  2MJE A;  3TEW A;  2WXO A;  1IBX B;  2WXQ A;  1FCC C;  3PZ7 A;  2M0A A;  2K5P A;  1TYG B;  3I57 A;  4RGT A;  2WXH A;  2KAC A;  3AN1 A;  1C4A A;  3AEC B;  1FCL A;  5EE3 A;  4GDK B;  4RGN A;  3KWV A;  1A70 A;  1I4P A;  2MJ3 A;  1TY2 A;  1WWT A;  3H8H A;  4WQM A;  1HEZ E;  5MPO A;  1C79 A;  1TKY A;  3R2T A;  2WDV B;  2WXI A;  5FR3 A;  2L52 A;  1K53 A;  1VZ7 A;  3T3O A;  2Y3A A;  3Q8C A;  2PTL A;  2BYT A;  2W54 A;  5C2T B;  2PIA A;  1L0X B;  3W5V B;  1SEB D;  5BMG A;  1M4V A;  1ET9 A;  1K51 A;  1TY0 A;  3L4P A;  1KRH A;  3PZ8 A;  2LHE A;  4ZOH C;  1J7C A;  3ETR A;  1JRO A;  2IGG A;  3AE8 B;  3SR6 A;  1QOB A;  3ABV B;  4ITK A;  4C80 A;  4IOI E;  1XEE A;  3FIL A;  1EM7 A;  1TKE A;  3AMZ A;  1L0Y B;  4B0M A;  3MFG A;  2JU6 X;  3MJ5 A;  4NAM A;  1KLU D;  1PUT A;  2OED A;  1SE2 A;  4XE0 A;  5BYR A;  2QIE B;  1ACC A;  4OVZ A;  1SJE D;  4KGT A;  3E9S A;  1UGJ A;  2DYM A;  2AX5 A;  3BK2 A;  3HVZ A;  4IKG A;  2CU3 A;  1E9M A;  1CQV A;  2K3U A;  2WP9 B;  3NVW A;  1DGJ A;  2X38 A;  2BB6 A;  3V3X A;  1VZ8 A;  2DWQ A;  1GB4 A;  1AW7 A;  1I4R A;  1D5X C;  1ZXH A;  2G1E A;  1VJK A;  2BT6 A;  3MP9 A;  4YXD B;  1GAQ B;  5D7G A;  2RDG A;  2MEK A;  1NEK B;  3VRA B;  4RGM A;  4REZ A;  2KAJ A;  4XDC A;  1EWY C;  1YNT E;  4YTP B;  2WLB A;  3BVG A;  1DYQ A;  1Q10 A;  3TSS A;  1XLO A;  3CWI A;  5AUI A;  2I38 A;  2K9X A;  1RFK A;  3E56 A;  2WNM A;  3O13 A;  2V3N A;  1AYF A;  3R2I A;  4B0E A;  1BXT A;  4N59 A;  1XF5 L;  4N6E B;  2KQ4 X;  4JWS C;  4XDD A;  1D5M C;  1MHH E;  2ACZ B;  3AE7 B;  3BYT B;  3HRD D;  1AN8 A;  2JYE A;  1STE A;  2JYT A;  4MT5 A;  2WXG A;  3AEB B;  1FNW A;  4CQN A;  4Q2J A;  4NJC A;  3U52 E;  3HUI A;  1TZO A;  4C7Y A;  3P1M A;  2DBY A;  1NYQ A;  1FXA A;  1ZDX A;  3SEB A;  1EU3 A;  2I2Y A;  2WXR A;  2AQ1 B;  4TQ1 A;  3W9C B;  1FO4 A;  2WDQ B;  1V97 A;  2WXN A;  3MC0 B;  2W55 A;  1KFY B;  3AE4 B;  1JQ4 A;  1N61 A;  4OZB A;  2B76 B;  4JPS A;  2BS2 B;  4L1B A;  1SB3 C;  2WXM A;  2BBC A;  4HRO A;  4LLG M;  2IGH A;  2IGD A;  3P4Q B;  2KWD A;  5C3J B;  1SE4 A;  1PYW D;  4US8 A;  2N7J A;  2Y5C A;  1MPE A;  2WXL A;  2RMM A;  4YSZ B;  1C4P A;  3BYY B;  1JWS D;  5G5H A;  2PKO A;  4LK0 M;  2FBW B;  2V0G A;  1LO5 D;  1YJJ A;  4YSX B;  1SIJ A;  1C4C A;  3NVY A;  1V8C A;  3VQI A;  3ZJV A;  3CIR B;  2BW2 A;  4HJG E;  3TUO A;  1V1P B;  3Q8B A;  2Z8L A;  1ZE3 D;  4MM3 B;  2KDM A;  1IUE A;  4PT5 A;  2W3R A;  1HZ5 A;  4KX6 B;  4LTU A;  2PW9 A;  2K0P A;  1ZP0 B;  3W2D A;  2NTS A;  2J53 A;  3FC4 A;  5LNK 1;  4R3D A;  4RNA A;  4AS1 A;  4ZRP A;  3AB5 A;  3KWL A;  4M0W A;  4L2Y A;  1D5Z C;  1KH0 A;  1XCT L;  2HDE A;  4XWT A;  2NMQ A;  3BK1 A;  5AUK A;  1YN5 A;  5FK9 C;  4L23 A;  5HG2 A;  4USA A;  1FNU A;  4RGO S;  1VRA B;  1AWD A;  1C78 A;  2J4X A;  4MAC A;  3OWE B;  3BWU D;  1ZDV A;  2W82 A;  1IGC A;  2IJ0 A;  5G5G A;  1KF6 B;  1QOA A;  2JWU A;  1QIL A;  1OFF A;  4YTN B;  2L1A A;  1IBX A;  2FE8 A;  1XO3 A;  5BYQ A;  1I4G A;  4RCO A;  4C7Z A;  2H89 B;  4YSY B;  1HXY D;  2YEP B;  4RF1 A;  1B9R A;  1ZPS A;  1K50 A;  2ONQ A;  5EE0 A;  3Q8A A;  5HHD G;  1P7E A;  1E10 A;  3AE3 B;  4XWW A;  2D5G A;  4A90 A;  1Y56 A;  2E3T A;  1SE3 A;  3C8Y A;  2WXP A;  1NVI D;  2ON8 A;  1JWA D;  1GPX A;  3GB1 A;  2N9L A;  2IDY A;  4ZRQ A;  1WXQ A;  2BS3 B;  1HZ6 A;  3AE1 B;  1JRP A;  4GLS C;  3GS2 A;  2WXJ A;  2WXF A;  3NVZ A;  4JWU C;  3AEE B;  3AEF B;  2MH7 A;  2AQ3 B;  1OQR A;  2LUM A;  2ZW1 A;  1F2R I;  3LB8 C;  4RFB A;  4NZL B;  1N5X A;  1KLG D;  1TKG A;  3IXS A;  2JXT A;  2L83 A;  1PGB A;  1SXT A;  4N58 A;  3HVD A;  1QLB B;  5BMH A;  2FUG 1;  1DOY A;  1SJH D;  3W5U B;  3AEG B;  1N60 A;  1CZP A;  2ZW0 A;  1WYG A;  5FKA C;  1C77 A;  1ESF A;  2K22 A;  2INN E;  3PO0 A;  3DWG C;  1R7S A;  1YQ4 B;  1GOZ A;  2VZK D;  3LXF A;  3NS1 A;  2WU5 B;  1SSN A;  1QOF A;  4ZHP A;  2WS3 B;  5BYS A;  2JX5 A;  4WWM A;  1YQ3 B;  2WQY B;  3ZGZ A;  2GI9 A;  2JQR B;  4ZHO A;  1ZOY B;  4YWG G;  1JAL A;  1E7P B;  2Y5P A;  2LGI A;  1GB1 A;  3DWM A;  2J52 A;  3NVV A;  2OHF A;  5BMI A;  3BVZ A;  4H2A A;  1PDX A;  4RF0 A;  1HQR D;  4A6Q A;  2VZK B;  1ET6 A;  4IDI A;  1JWU D;  4JE3 B;  2GRI A;  2SEB D;  5EE9 A;  1L6V A;  2QMT A;  4EE2 A;  3T3N A;  3AH7 A;  2G9H D;  2WXK A;  4OHJ A;  3URY A;  1L5P A;  3B2G A;  3W1S A;  2SAK A;  1FFV A;  1UWX A;  4MH8 A;  3SFD B;  2QJL A;  2MJD A;  1XLQ A;  2YEP F;  3P4S B;  2NTT A;  3NRZ A;  3P63 A;  5T8I A;  2IPK D;  2JZP A;  3U2S C;  1N63 A;  4HKZ E;  5E6J A;  1UNS A;  3IT4 B;  4WUR A;  3AV8 A;  1TS3 A;  4WH4 A;  1IGD A;  3IT6 B;  1VR9 A;  3BII D;  1QKZ A;  1NEN B;  2KN4 A;  1L6U A;  1UWM A;  1YN4 A;  2M56 B;  1VLB A;  1PFD A;  2BS4 B;  3Q8F A;  4J3O D;  5D3D A;  2PVG C;  4D2K A;  1RYJ A;  1T6B X;  3N9Y C;  4ZYS A;  1EU4 A;  2BTE A;  2EEL A;  2M19 A;  1FFU A;  2PMV A;  1B1Z A;  4WIP A;  3FIL B;  3I9V 1;  4YTM B;  2PVO D;  3TEX A;  4ARI A;  1J7A A;  1XXG A;  2RPV A;  1RWS A;  3SFE B;  1F77 A;  2J42 A;  1BUI C;  4A9A A;  3VR9 B;  1C9F A;  5H8Y E;  1ROE A;  1I4H A;  1MHX A;  4KGS A;  3V05 A;  4GDL B;  1P7F A;  2ICI A;  1YN3 A;  3IAS 1;  2RDH A;  2DYO A;  1TS4 A;  1HA5 A;  3AE2 B;  4KGR A;  1TS2 A;  1L0V B;  1V1P A;  4P16 A;  5H92 C;  2HTM E;  1CK1 A;  1QOG A;  2E6X A;  2XNA C;  4TMA B;  2N9K A;  1UUP A;  1E0Z A;  1FNV A;  3MHZ A;  2H88 B;  1F2R C;  2LFI A;  3IAM 1;  3U4E G;  2JSV X;  4A8X C;  1XLP A;  1PGA A;  3P4R B;  4ARC A;  3R8B A;  4HEA 1;  1ENF A;  3RPF C;  2PLP A;  1MI0 A;  4UDU C;  3U7Z A;  3AE6 B;  2W3S A;  1XCQ L;  3B2F A;  1KTK A;  1NYR A;  1V1O A;  2V3P A;  4AQ7 A;  3LYY A;  5GXG B;  4FXC A;  4OZA A;  2EKI A;  1CJE A;  5JXV A;  3AM9 A;  1JCK B;  1L4Z B;  1XLN A;  1I4Q A;  4DQO C;  1L4D B;  1NI3 A;  5TSS A;  2BB5 A;  2INP E;  1FRR A;  1VZ6 A;  1YJI A;  3NUH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...