4A90A

Crystal structure of mouse sap18 residues 1-143
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
131
Chain Sequence
ESRVTQEEIPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HISTONE DEACETYLASE COMPLEX SUBUNIT SAP18
publication title The Structure of the Asap Core Complex Reveals the Existence of a Pinin-Containing Psap Complex
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 131
sequence length 138
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06487 SAP18 Sin3 associated polypeptide p18 (SAP18)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.550 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4a90A00
4A8XC 2HDEA 4A6QA 4A90A
chains in the Genus database with same CATH superfamily
3VR9B 4A9AA 4FJVB 3PPAA 4PYUA 1N60A 2LJ5A 1EF1A 3SU8X 4ZHOA 1RLFA 1D5MC 4GB9A 4XZ4A 1BMLC 4JWUC 1TTNA 5IA7A 2VRRB 3AEBB 3BIID 1AARA 5LXHA 4KX6B 1MI0A 2KWCA 4AP4C 1F77A 2ONQA 2FUHB 3ECIA 4IWOA 4EZJA 3UIOB 3HIZA 2NCNA 4HROA 3P4RB 3RULA 1WJUA 1AWDA 2KC1A 3B9JA 4IC7B 3A9KA 3HUIA 1K8RB 1EWYC 2DZKA 4AOFA 3PS6A 3ZGZA 3ZNHB 2JZPA 1WXQA 3Q3MC 3I3TB 2N4FA 2W54A 5J18A 3UQBA 2BT6A 1MJDA 3PRMB 3MHSD 2IO3B 2D5GA 2WGSA 3TJPA 3NOBA 1OFFA 4TMAB 3ENEA 2I1KA 5D3IB 3IT4B 4S17A 2JVCA 3VRBB 1SIFA 2MEKA 2B76B 2JPHA 3Q3FA 3RN9C 3AEEB 2DBYA 3RT3B 2K9XA 2K0PA 4M0WB 4XC2A 4KV2A 4DDID 2CJNA 2WDTB 2JUOA 3ZUNA 4D2KA 4GDLB 3CMMB 3CSTA 4K7UA 1LM8B 1XT9B 4RH6A 2WDQB 2BKRB 1X1MA 3N32A 4LCDE 2D10A 2BW2A 1V97A 4HRSA 2CU3A 2N1WA 1B9RA 2C7MB 1MHXA 3NS8A 4PK1A 4KKIA 4ZDVA 2Y5PA 1C4AA 1I4HA 1P1AA 2R2QA 4DXFA 2KQ4X 2KVRA 4FJYA 2B3AA 4RF0A 1L0XB 1QILA 4HCNB 4N9F4 2KNBA 4BKSD 1RYJA 1KLGD 4YT0B 2QHOA 1E8ZA 1WE6A 2BGFA 1EO6A 1GG3A 5CTRC 4II3B 2KT7A 2GBJA 4WWPA 5BMIA 4W9HA 2FNJB 4TKNA 1D5ZC 4A6QA 3Q8CA 2QDFA 3B2GA 4IKGA 5T8IA 2LASA 2IDYA 1S3SG 4BOZB 4BOSC 1V5OA 2L32A 3I5JC 1J19A 2KDEB 2H89B 2N7DA 4K81A 1YJJA 2AQ2B 3DVNV 3V61A 3O65B 4X57B 1J8CA 2PJHA 1JALA 4ZOHC 1WGGA 1UH6A 1L0VB 4L1BA 1STEA 2Z0DB 2GOWA 5JH5C 2WXNA 4E3CA 1TZ1A 2ASQA 4USAA 4JWSC 2WXQA 3A1QA 3U30A 1N63A 3KW5B 3JW0X 1N61A 1R4MB 3H6NA 2C5LC 2D3AA 3P63A 2WWZA 1J7CA 2WYQA 4HPLB 2CU1A 3UQAA 2K25A 2NTSA 2JYEA 2K8CA 3NHEB 4LJPB 2PKOA 3PLUA 4KGTA 3RUIB 4YXDB 2K3UA 3AE1B 2RDGA 2E3TA 4YL8A 2DLBA 3Q8BA 1D5XC 1JWBD 2KQ7A 3MC9A 1Q10A 3E56A 1YQ3B 2QEJC 5IOIA 4ITKA 2G9HD 4IWPA 4EE2A 3U4EG 1EWCA 4JX1C 2D07B 1G6JA 2IPKD 2GB1A 3HK0A 2NS5A 3OLMD 4HPPA 3P4QB 4PS7A 3DBRB 4HVBA 2N9XA 4G50A 3DBLB 1GUAB 2PEAA 5C1ZA 5LLIA 4DXGA 2G1EA 1WJ6A 4IM2A 2CHZA 3K9OB 2RPVA 5AUIA 2LGXA 3SD5A 1UUPA 3VUYA 1Q0WB 2K22A 3TEZA 3BK2A 1TS3A 3N20C 1JWMD 1WY8A 5D3DA 2IZVB 2KO3A 2SAKA 1T0QC 1WGKA 5CHFA 5TSSA 2N1VA 1RWSA 2ZZPB 3RMKC 2WHIA 3OG5A 3U2SC 3L13A 1XXGA 1ZUD2 1FMAD 1UGMA 4IUMB 3QCAA 3KWLA 4TV3A 1C4PA 1L6VA 5CX3A 1T0YA 4GXBA 3VRAB 1V86A 5HKHA 3H7SA 4NPNA 3NY5A 4P7IA 3LYYA 2E6XA 2PVGC 3CSFA 4A55A 3RNAC 3U52E 2L7RA 3QX1A 3VTUA 3CF6E 2XK5B 4JL9A 3GZNI 4WWMA 5EE9A 3KWVA 1V1PB 4NQKE 2W55A 1IBXB 1F1HA 1SJED 1JWSD 2IGDA 4F1SA 2KACA 2RD0A 4WJNA 1ZP0B 3KUCB 1TIFA 1U4AA 3RPFC 3RNBC 3JSVA 1J7BA 1NEKB 4JPSA 5EE0A 1UZXB 4MDKE 1ET9A 3MFGA 2L83A 2M0AA 4LTUA 1H8CA 1P98A 1SIJA 1R4NI 2INNE 3N1XC 2PLPA 3H7PB 1KTKA 1P0RA 4JQWC 2J0KA 1F9JA 1XLNA 1HQRD 2FAZA 4II2B 4DHJB 4BBNF 3UGBB 1TY0A 3DCGA 2K6DB 4DBGA 4GU2A 1A70A 2FCQA 2IO0B 4S0RA 2ZPNA 2XNAC 3R7QA 4MM3B 1KM7A 2DZIA 1JW9D 1PFDA 1FIQA 2V4IB 2V9HA 3TL5A 4AS1A 1NYQA 2BB5A 3SDLC 1V5TA 4JIOU 3AEFB 1FO4A 2JSVX 2HD5B 2FCNA 1V80A 2SEBD 3ABVB 2LJIA 2JF5A 2WXFA 1FRDA 3DVNU 2DAFA 2MRPA 2PVOD 1TT5B 4FADA 1DOXA 1YN4A 4MJSA 2FBWB 3V6CB 4FN2A 1WX7A 3ZW3A 2X38A 2QSDA 4WH4A 2L52A 3H1UA 2A4ZA 4ZRIA 4BKSA 2LGSA 3ML8A 1NI2A 3PHWB 4WJQA 2QJLA 1QKZA 1TS2A 2BWES 4WWOA 4KIKB 2Q5WD 2AQ1B 2ON8A 1L6UA 3H8HA 1XCTL 4KGSA 2V1YA 3PV1A 1ROEA 4HKQA 2N9PC 4LNKA 4ANVA 1NVID 1XQQA 3GB1A 2CKHB 1WM3A 2AX5A 3AEDB 3EA6A 1JWAD 1MG8A 2RGFA 1LFDA 1FNUA 3AEGB 1L0YB 1WZ0A 1WWTA 4US9A 2KK8A 3NJTA 1VZ7A 1I4PA 3KQ4A 4YSYB 2WDVB 4FLHA 1GAQB 4C56C 4C4VB 3MHZA 2TSSA 3AE2B 1QOGA 2MJDA 3NZ3A 3ZJVA 3DVGX 4UDUC 1NENB 2D3GA 4NAWB 1NDDA 1FXTB 3IFWB 3PZ7A 1GPXA 1JRUA 2GBNA 3MP9A 2K39A 1YJIA 3APDA 2O2VB 3FILA 3AU5A 1KH0A 2AYOB 3QJZA 4E71A 2IJ0A 3VFKA 3AEAB 4J3OD 3BVGA 2IO1B 4GMVA 1RM6C 2WX0A 2GBKA 2D2QA 3LXFA 1Z2MA 4OHJA 3P42A 3ZNGC 2RR9A 4KDLB 4FULA 3RYTA 1EU4A 1OTRB 5FK9C 4ZHPA 3WANA 2NR2A 2EKIA 1SE4A 2J53A 3R66C 4RGTA 1E8XA 3TBLD 2UYZB 1HXYD 3AE4B 5AZFA 4M01A 5KHQA 1PQSA 2O6VA 2X8XX 4XGAB 4FBJB 1C4CA 2V3NA 2MSED 4IM0A 4XWTA 4RFBA 1ENFA 4MH8A 4KGRA 1VD2A 2JQRB 4W9EA 3AV8A 3RZWC 2AL3A 2ZNVC 1GJZA 4F7ZA 3X23A 5JHAA 3EHVA 3DHHC 1DYQA 4HXDA 3NVYA 3QK0A 4N59A 4HPMB 2BKFA 3BWUD 3PREA 3Q2AC 3NVVA 3N30A 3U7DA 3EUB2 3TEYA 3C0RB 5C2TB 5H92C 1E10A 3PZ8A 1TBEA 4DWFA 1V49A 4EUTA 1WSPA 2IBIB 1TJEA 1WJ4A 5MPOA 2ZW0A 4ASWC 2LVPA 4HDQA 3A9JA 3OAWA 1H4RA 2DYMA 4QAYA 2J52A 1WX8A 1WJNA 4RGMA 3RFZB 2MA9B 5HG2A 2NPTB 2KQSA 3M63B 3QQ8B 2JU6X 1WRDB 1TYGB 4GDKA 1MVKA 2ZVNA 2KX0A 1E90A 3B08A 1CQVA 4YWGG 4I6LB 3RZFA 4W9JA 4DHZE 2W3RA 4K3BA 3Q6BA 2ACZB 4YTMB 4RGNA 1XEEA 1TY2A 4FXCA 2QCZA 3T3OA 4ZYSA 5IN7A 4WIPA 1BT0A 1UBQA 5JXVA 2BS3B 3L08A 1WFYA 4YSXB 1QQRA 1TKGA 4CHKA 3DHIC 1SXTA 5H8YE 3J9CA 3PZDA 5JZEB 4WAAA 2HTHA 4WQMA 1PGAA 3T8MA 3RCZA 2KDBA 4HJGE 2MP2A 2MW5A 5BYSA 3ZRCA 2KFKB 3KYCD 1IYFA 4YSZB 1GB4A 3SFEB 4O1NA 3VUXA 5IO9A 1M94A 2ZW1A 1WMHB 2MBHA 2RSUA 2HTME 3W2DA 4ICVA 3RI7C 3PRZA 1V2YA 2Y3AA 4HKZE 3W5UB 2K8BA 3B1LX 3NG0A 3VH4B 2ZEQA 4NJCA 3ZTDA 4LK0M 2DWQA 3ZVVA 2OHFA 2LXCA 3AECB 4AWJA 1D3ZA 4DK5A 3ZJUA 3UINB 3P4PB 1I35A 3WAPA 1IPGA 4G0NB 1WIAA 2LFIA 2WXHA 1J0GA 2BWFA 2INCC 2LEKA 3N3KB 1UGJA 2ZPYA 3JVZX 1FM0D 1YQ4B 4GOCA 2KTRA 3Q3NC 1YX5B 2M0XA 1CZPA 3K9PB 3Q8EA 3TEXA 4MGZE 2MHJA 2KDIA 2MWSB 2FCSA 3URYA 3EECA 2WXJA 1KRHA 1YJ1A 2MH7A 4BFRA 2LWPA 2AEHA 3ZDMC 2AWTA 2KZRA 2FE8A 1LQBA 4WQOB 2MQJA 2KXJA 1N62A 1QT9A 2BPSA 5EDSA 1ZKHA 2DHZA 1KJTA 3FKYA 2RDBC 3A9KB 4MT5A 1KLVA 4W9DA 1E7VA 4DXAB 1WXMA 3ZNID 1JCKB 1ZXIA 4HEA1 3FC4A 2BYEA 4H2AA 5DPSA 4DHZB 4B0EA 3N1ZC 3MJ5A 3AE5B 4G11A 4JE3B 1FNWA 3LB8C 1T3QA 3UF8A 3VDZA 5L95C 3DOWA 2JZ3B 1L2NA 3IBEA 1EUVB 5TR5A 2EKEC 3I9V1 1TZOA 3QIJA 2Z59B 2L0FA 4M8MA 2GI9A 3P4SB 1ZDVA 4E74A 3PO0A 3L0WB 4W9GA 3GP7A 3H9DA 3BVZA 4TQ0A 4HLEA 2ZVOA 3IAM1 3DWGC 4RCOA 3KUZA 3PLVA 1YOVB 1N5WA 5IAAC 1IGCA 1ZOYB 2PW9A 3WAOA 1I4RA 2Z8LA 3PSEB 2A5UA 3VHTC 1ESFA 2KC2A 1IP9A 3P1MA 1HTOA 4BKGA 3V3XA 1YN5A 2WXMA 4JGHB 5BMHA 1Q1OA 3AE6B 1WGDA 2KANA 3MC0B 4PS8A 1ISNA 3ZJTA 2BBCA 1V81A 3QA8A 5AEKB 3R7RA 1ET6A 3U8ZA 2BYTA 3IAS1 3QC8B 5BYRA 5LXIB 3B2FA 4RF1A 2LUMA 2KMAA 1QLBB 3BY4B 1IGDA 5C3JB 2N0SB 3APFA 5AUKA 4EKUA 5C23A 1T0RC 3ETRA 1VZ8A 4OZCA 3UI3A 3WAMA 2M17A 1YIWA 2BQQA 2PMVA 5L83A 3BINA 3KVFB 4XX5A 3A1QB 3TCAA 2KTFA 2K6QA 4GLSC 2L1AA 3ZQ4A 1VR9A 1IUEA 1WE7A 3ZYYX 1KOTA 1HA5A 2JX5A 3BZDB 2XBBC 3IT6B 3PTFC 1C77A 2WDRB 1I4QA 3A4RA 5I4DA 2KFJA 2M19A 2BYVE 4ZRPA 2KDMA 1WR6E 2QILA 3L10B 2KKCA 3BYTB 1DOIA 2JXTA 3RNEC 3RD2A 1MG4A 2KHWB 1AYFA 1TS4A 1WGHA 3PVLA 2W3SA 1FCCC 3Q14C 3C19A 3WIMA 4EFOA 4MELA 1LO5D 2HJ1A 3GZNB 3WALA 1QZEA 2H88B 5IP4D 3AMZA 1P3QU 2DENB 2MX2A 3V60A 4XYCA 5HFYA 1F52A 3NUHB 4IW0A 4ICUA 3HRDD 3D32A 2MJ3A 2DNFA 2KWDA 4P6VF 1ZDXA 1WH3A 4L23A 2YLMA 1XF5L 1EM7A 2IGHA 1SE3A 4A90A 2V3PA 1R4NB 1UNSA 4XDCA 3MC8A 2BTEA 5LNK1 4DHJD 3L16A 2Y5CA 4EEWA 3FAHA 2N9EB 4RMAA 1VRAB 3KUDB 2V0GA 1YN3A 1XCQL 4ZRKA 2DX5B 2YVCA 1E5WA 2JYTA 4NJ7A 2ZCBA 2AL6A 3B0AA 1SB3C 1FRRA 1T6BX 1VCBA 2N9KA 4M0WA 2LVOA 2KX3A 2CR5A 2KMMA 3A33B 2GLSA 4TUUA 1OEYJ 3DBHI 2KAJA 4GDLA 1FXIA 4K3CA 1F2RC 4GSWA 3AE9B 1V8CA 3RNGC 2J42A 2WLBA 2W82A 3R2IA 4EZLA 2JXXA 1I42A 3Q8AA 1K51A 4M02A 5IKCM 4XWWA 1WRIA 1OQYA 2OJRA 4W9KA 5DPTA 4A3PA 4I6PA 4IWQA 1ZPSA 3W9CB 2KWVB 4AJWA 3R8BA 2GMIC 1HEZE 2KDFB 4FHKA 1ACCA 4MGYE 2NMQA 3WA0A 1S1QB 2CHWA 3R2TA 4Q2JA 3APCA 4US8A 1YX6B 2LHDA 2MJEA 4HK2A 1V1OA 2I1JA 3Q8FA 2ICIA 5FR3A 3I57A 1F2RI 3JSVB 1E7PB 2WX1A 2JRIB 2N7EA 1QOAA 2C9WB 3L54A 3T3NA 4B6WA 1N5XA 2PIAA 3HVDA 3PT2B 4IM3A 2LRUA 1LXDA 3DWMA 1C9FA 3V05A 4I6NB 2D3BA 3ZKJC 2WXRA 1Q5WB 2HDEA 4ZRJA 4PYZA 4URKA 1DOYA 3DDCB 2L00B 2Y5BB 3C8YA 2M56B 2J0MA 2C7HA 5JHBA 5HHDG 3TSSA 3DBHB 3W5VB 2G3QB 2KYWA 2FIDA 4WJOA 2WQYB 4ZYNA 4FHJA 3ONSA 1WX9A 4HWIB 2DAJA 4FA6A 3X0WA 2RMMA 3VAWA 1QF6A 4GIVA 1FXAA 3HM6X 4TQ1A 1ZXHA 3IVFA 1B1ZA 4NNJB 4MJSB 3NZUA 4NAMA 1XLQA 1ZW7A 4A3OA 2N9LA 4TSSA 4B95A 3OWEB 2OEDA 5G55A 2DYOA 1PGXA 4KSKC 5BO4B 3IHPC 1UELA 3VXWA 4C7ZA 4OVZA 1UF0A 2G4SA 1I4GA 1WR1A 2KJHB 3ZRFA 1SGHA 2K1FA 2HJ8A 1FFUA 1NYRA 3R3MA 4PT5A 1XLOA 1D4BA 2G4DB 3NZSA 4NJ6A 5G5HA 3QAQA 4JLCA 2PE9A 2MCNB 3V62A 2LGDA 2KN5A 2LXAA 1AN8A 1HZ6A 5J17A 1ZE3D 2JWZA 2J4XA 1K53A 4FJZA 3AE7B 2DYBA 3W1SA 2KVZA 3BK1A 2Z0EB 5G2NA 1FPYA 3MTNB 4EZKA 1BXTA 5D94A 2CHXA 2J0JA 1NBFC 3CWIA 1HZ5A 1F0ZA 4R3DA 5DPRA 4XE0A 1OQRA 2WS3B 4OVVA 1L7YA 2KJRA 4HCPB 1RFKA 5DCNA 3PHXB 1QOFA 1C79A 4IOIE 1R4MI 4P1BC 1KF6B 3WCQA 2FIFA 5FKAC 4HDOA 3ZDTA 1RAXA 2NBUA 1T5XD 1GC7A 2LUEA 1WXAA 2N7JA 4PS3A 3EGRA 3FILB 2ZNVB 3AB5A 1PYWD 1J7AA 4WWNA 2M8SA 3DHGC 4AUQC 3AXCA 2INDC 4RM9A 3W1SC 3ZLZA 2IYDB 4AQ7A 1SJHD 2K8HA 3NVZA 2L8JA 4MH0E 1FEHA 4YTPB 5E6NA 2DZMA 2XK5A 1C78A 1UD7A 4GN1A 2LI5A 1V1PA 2GBRA 2LZ6A 2WU5B 1WXSA 1WGRA 3SFDB 1IBXA 1UBIA 5GXGB 1SBBB 3GE8C 3HVZA 3DBRI 4WURA 3DBLI 3DPDA 1YNTE 1HTQA 2J7QB 3HM3A 5EE1A 2O6VB 2V4LA 1VJKA 1P7EA 2ZJDA 1E6EB 3AE8B 3ZXVA 2QIEB 2BVCA 1A5RA 2EELA 2D3CA 4REZA 3RNFC 1RFAA 3Q69A 2R2OA 1MFWA 2KLCA 4A20A 3VR8B 4M00A 4LLGM 2VZKB 2I2YA 4BVUC 3H7PA 5EE3A 4DQOC 4MACA 3IXSA 2PTLA 2WXIA 1C3TA 5CHVC 1UWXA 3NVWA 2MBEA 2EMSA 2FUG1 4LNFA 2LGYA 3Q3OC 4K7WA 2NVUI 3DQVA 2RPQA 3M62B 3A4SC 4MM3A 1WYWB 1FNVA 4WAFA 1SE9A 3MJWA 1K52A 1P7FA 2XN9C 1QOBA 3A9JB 4MGKE 4CO7A 2INPE 4RGOS 1VZ6A 1JMLA 2VH2A 4G3XB 5FR6A 2JZZA 1WM2A 4LNOA 1OQQA 1PGBA 2BB6A 3U7ZA 4C80A 4GDKB 4BZAA 3OJ3A 2JT4B 4J6IA 1WZ3A 4MSMB 2KD0A 3JYUA 3AI5A 1WGYA 2O6VD 4NQLB 3SHQA 1N6ZA 5E6OA 1E7UA 3AU4A 4N58A 4KIKA 1CK1A 2FCMA 2KOXA 2WXOA 1R7SA 3ZTCA 3VH3B 4OZAA 4B9KA 1KFYB 3P2BA 5AZGA 4A8XC 2VZKD 4NZLB 2NTTA 4W9IA 3KLSX 3SEBA 3PGEA 2CJOA 4AJYB 1YMHE 2PPHA 4MGIE 1I7HA 1VDVA 1XO3A 3GE3C 3I63C 1OGWA 5E6PA 1YD8U 4IG7B 1MPEA 2BYFA 4YTNB 1YQBA 2MP2B 4KZ0A 1XD3B 4K7SA 4N6EB 4OZBA 1UWMA 1L4ZB 3ZXRA 3EFUA 4P16A 2NBVB 5D6JB 4K1RB 1GNUA 2DZJA 2ZCCA 1WF9A 2IY0B 1L5PA 4C4VA 1JROA 3EFCA 3E9SA 1GOZA 1TS5A 3O13A 4DDGD 4LDTB 4LJOB 4LNIA 2QMTA 3VQIA 1E8YA 4NAWA 4BBNC 4C00A 1PUTA 5GMVA 3EC8A 1AW7A 2UWQA 4CYEA 2WXLA 3VUWA 4W9LA 3L17A 1V9JA 2L05A 2O2VA 3M95A 3QHTA 4XDDA 4ZRQA 3PRPB 4ARCA 4HJKA 1BUIC 1E0ZA 1K50A 1TGZB 4ANXA 2LHEA 3ZO5B 2R61A 4C7YA 4BAXA 3NRZA 3DVGY 2QC8A 2C7NB 1T0SC 4P1CC 2WU2B 1NI3A 2KN4A 2WXPA 2KTRB 1GC6A 2IO2B 3UIPB 1P9DU 4ANUA 2BS2B 3OJ4B 2M4NA 2NBWB 2JWUA 1ZGUB 5HI1A 3TMPB 2KMCA 5CHWA 3IG3A 1CMXB 3GOEA 3LJ3A 1KLUD 3SR6A 2KJ6A 1Z5SB 1JWUD 5J2RA 2L3ZA 3ALBA 1MHHE 4RM8A 2MBOA 4WJPA 2M1MA 2JRHA 1RRBA 4LDTD 1TKYA 4NY0A 5AZHA 5D7GA 1FD6A 3AH7A 3VVWB 3RNCC 4RNAA 2AQ3B 2REXA 3HHMA 4CQNA 4KZCA 3KYDD 2BS4B 3N1YC 1GB1A 3DBSA 2WXGA 3V6EB 2D11A 2LD9A 1SSNA 2WNMA 3VTVA 4F8CB 2NPTA 2LGIA 4OW0A 3ZNZB 2C60A 4W9FA 2BF8B 3TUOA 1D6EC 1HE8A 2OOBB 2W9NA 4OVUA 3AULA 1VLBA 1E8WA 1Y8RC 4LNNA 3KH0A 5BMGA 1I4XA 1XLPA 1WXVA 4IDIA 4KDIC 5E6JA 3ML9A 4MEMA 1SF0A 3LDZE 2V3SA 1TKEA 3S2AA 4KKJA 3W1YA 4KSLC 3Q3JA 3CIRB 1Y56A 2WP9B 2G45B 1WYGA 2KLGA 2VH1A 1FCLA 5BYQA 2LVQA 5G5GA 3BYYB 2MLBA 4KVGB 2YEPF 2KWUB 3QARA 1WI0A 3N9YC 3AN1A 4L2YA 5D2MB 2JY6A 3M3JA 2KFKA 2XEWA 1SEBD 1PDXA 2OJWA 1EF5A 1EU3A 3AE3B 3T9LA 2IY1B 1JRPA 2L76A 1E9MA 2MBQA 2LRWA 1C76A 1DGJA 2PE6B 2MBBB 4M8NA 4ANWA 1WMHA 3BVMA 5KHOA 4ACFA 1C1YB 1JQ4A 4MSQB 1OEYA 3ZIMA 4B0MA 3TEWA 2GRIA 1FFVA 3NS1A 3QWZB 4BKTA 4ARIA 3L4PA 1SE2A 2L0TA 1V6EA 2K5PA 4EOYA 4W9CA 3VTWA 1M4VA 2UU7A 1LGRA 2I38A 2WXKA 1CJEA 3TIXA 2HE7A 5DPWA 4GGQA 2RDHA 2YEPB 2EMTA 2IGGA 3AM9A 3GS2A 1L4DB 2GBMA 2LMCA 2CS4A
chains in the Genus database with same CATH topology
2QSDA 3DWGC 2L52A 4RCOA 4WH4A 3VR9B 4A9AA 3NVZA 4YTPB 1FEHA 1N5WA 1C78A 1IGCA 1ZOYB 2PW9A 2QJLA 1QKZA 1I4RA 1TS2A 2Z8LA 1V1PA 2WU5B 1N60A 3SFDB 1IBXA 4ZHOA 5GXGB 1SBBB 1D5MC 1ESFA 2Q5WD 3HVZA 4WURA 2AQ1B 2ON8A 1L6UA 3H8HA 1XCTL 1BMLC 3P1MA 4KGSA 1YNTE 1ROEA 4JWUC 5EE1A 4HKQA 3V3XA 1YN5A 3AEBB 1VJKA 1P7EA 1NVID 1E6EB 3AE8B 3BIID 2WXMA 2QIEB 3GB1A 4KX6B 5BMHA 2EELA 1MI0A 2AX5A 3AEDB 3EA6A 1F77A 1JWAD 3AE6B 2ONQA 4REZA 3MC0B 3Q69A 4HROA 3P4RB 3ZJTA 3VR8B 2BBCA 1FNUA 1AWDA 2VZKB 3AEGB 3B9JA 1L0YB 4LLGM 3HUIA 2I2YA 1EWYC 5EE3A 4DQOC 1ET6A 4MACA 3ZGZA 2JZPA 3IXSA 2BYTA 1WWTA 1WXQA 2PTLA 2WXIA 3IAS1 5BYRA 4US9A 1UWXA 3B2FA 3NVWA 4RF1A 2W54A 1VZ7A 2FUG1 2LUMA 2BT6A 1I4PA 3KQ4A 1QLBB 4YSYB 2WDVB 2D5GA 1IGDA 1GAQB 1OFFA 4C56C 3MHZA 4TMAB 5C3JB 2N0SB 5D3IB 2TSSA 3AE2B 5AUKA 1QOGA 3IT4B 2MJDA 3NZ3A 3ZJVA 1FNVA 3ETRA 4WAFA 3VRBB 1VZ8A 4OZCA 4UDUC 2MEKA 1NENB 3UI3A 2B76B 2PMVA 4NAWB 1K52A 3PZ7A 1P7FA 4GLSC 2XN9C 1QOBA 1GPXA 3MP9A 2L1AA 3AEEB 2DBYA 1VR9A 1IUEA 3ZQ4A 1YJIA 2K9XA 3ZYYX 2INPE 2K0PA 4RGOS 1VZ6A 3FILA 1HA5A 2JX5A 3BZDB 1JMLA 2CJNA 1KH0A 3IT6B 2IJ0A 4D2KA 4GDLB 3AEAB 4J3OD 1C77A 2WDRB 3BVGA 1I4QA 1RM6C 5I4DA 2M19A 3LXFA 4RH6A 1OQQA 2WDQB 1PGBA 2BB6A 4OHJA 3P42A 4ZRPA 4GDKB 3U7ZA 2BW2A 2KDMA 4C80A 1V97A 4HRSA 2CU3A 1B9RA 1EU4A 1MHXA 2QILA 5FK9C 4ZHPA 3BYTB 1DOIA 4KKIA 2EKIA 2JXTA 2Y5PA 1C4AA 1I4HA 4DXFA 2KQ4X 1SE4A 2J53A 4RGTA 1AYFA 4N58A 1TS4A 4RF0A 1L0XB 1QILA 1CK1A 2W3SA 1HXYD 2WXOA 3AE4B 1FCCC 1RYJA 1KLGD 1R7SA 4YT0B 4OZAA 1LO5D 2H88B 1C4CA 1KFYB 2V3NA 4A8XC 2VZKD 4NZLB 5BMIA 2NTTA 4XWTA 4RFBA 1ENFA 3AMZA 3KLSX 3SEBA 2CJOA 1YMHE 4MH8A 4KGRA 5HFYA 2JQRB 3AV8A 1D5ZC 1I7HA 4A6QA 1VDVA 3NUHB 1XO3A 3Q8CA 3B2GA 4IKGA 5T8IA 1MPEA 2IDYA 4YTNB 3HRDD 1DYQA 2MJ3A 2KWDA 4P6VF 1ZDXA 3NVYA 4L23A 4N59A 3BWUD 1XF5L 4N6EB 1EM7A 4OZBA 2IGHA 1UWMA 1L4ZB 2L32A 1SE3A 3NVVA 4A90A 2V3PA 1UNSA 2H89B 4P16A 4XDCA 1YJJA 2BTEA 3EUB2 2AQ2B 3TEYA 5LNK1 1L5PA 5C2TB 5H92C 1E10A 1JROA 3E9SA 1GOZA 3PZ8A 1JALA 2Y5CA 4ZOHC 3FAHA 1VRAB 1L0VB 1TS5A 4L1BA 3O13A 2V0GA 1STEA 1WSPA 1YN3A 1XCQL 2QMTA 2WXNA 3VQIA 1TJEA 4USAA 2JYTA 4JWSC 1PUTA 5MPOA 2ZW0A 2WXQA 1AW7A 1N63A 1SB3C 1FRRA 1T6BX 2DYMA 2WXLA 2N9KA 4M0WA 1N61A 4XDDA 4ZRQA 2J52A 2KMMA 4ARCA 1BUIC 4RGMA 3RFZB 3P63A 1J7CA 1E0ZA 5HG2A 2KAJA 1FXIA 1K50A 2NTSA 1F2RC 2JYEA 2JU6X 1TYGB 3AE9B 1V8CA 1MVKA 2J42A 2PKOA 2W82A 2WLBA 3R2IA 2LHEA 4KGTA 2R61A 4C7YA 3NRZA 4YXDB 3Q8AA 1CQVA 2K3UA 1K51A 4YWGG 4XWWA 1WRIA 3AE1B 2W3RA 2RDGA 2E3TA 2ACZB 4YTMB 4RGNA 1XEEA 2DLBA 3Q8BA 1D5XC 2WU2B 1JWBD 1ZPSA 3W9CB 1NI3A 1TY2A 2KN4A 2WXPA 1Q10A 4FXCA 3E56A 1YQ3B 3T3OA 2QEJC 3R8BA 1HEZE 4ZYSA 4ITKA 2G9HD 1ACCA 4WIPA 2BS2B 2NMQA 5JXVA 4Q2JA 3R2TA 2BS3B 4EE2A 4YSXB 3U4EG 1QQRA 1EWCA 1TKGA 4US8A 4JX1C 2IPKD 2GB1A 2JWUA 5HI1A 3P4QB 2LHDA 2MJEA 1SXTA 1V1OA 5H8YE 3J9CA 3Q8FA 2ICIA 5FR3A 3I57A 1F2RI 4DXGA 1KLUD 2G1EA 1E7PB 3SR6A 4WQMA 1JWUD 1PGAA 1QOAA 2RPVA 4HJGE 3T3NA 1MHHE 1N5XA 5BYSA 5AUIA 2PIAA 3HVDA 1UUPA 4YSZB 3DWMA 1C9FA 3SFEB 3V05A 1GB4A 2K22A 3TEZA 4O1NA 3BK2A 1TS3A 1TKYA 2WXRA 1JWMD 2HDEA 5D7GA 5D3DA 1DOYA 1FD6A 3AH7A 2SAKA 2ZW1A 1WGKA 2HTME 3W2DA 4RNAA 3C8YA 2M56B 2Y3AA 5TSSA 4HKZE 2AQ3B 3W5UB 5HHDG 3TSSA 4CQNA 4NJCA 1RWSA 2BS4B 4LK0M 2DWQA 3U2SC 1GB1A 3W5VB 2OHFA 1XXGA 3AECB 2WXGA 1ZUD2 2WQYB 1FMAD 3ZJUA 1SSNA 2WNMA 3KWLA 3P4PB 1C4PA 1L6VA 2LGIA 2RMMA 4OW0A 3VRAB 1QF6A 3TUOA 1D6EC 1FXAA 2LFIA 2WXHA 4TQ1A 1ZXHA 1VLBA 1B1ZA 4NAMA 1XLQA 5BMGA 1I4XA 1XLPA 3LYYA 4IDIA 2E6XA 2LEKA 2N9LA 2PVGC 1UGJA 5E6JA 4A55A 4TSSA 1SF0A 1FM0D 1YQ4B 3OWEB 2OEDA 3U52E 2DYOA 1TKEA 1PGXA 1CZPA 4KKJA 4WWMA 4C7ZA 4OVZA 5EE9A 1I4GA 3Q8EA 3KWVA 1V1PB 3TEXA 3CIRB 1Y56A 2W55A 2WP9B 1IBXB 1WYGA 1FCLA 5BYQA 1SJED 1JWSD 3URYA 2IGDA 5G5GA 1FFUA 1NYRA 2KACA 3BYYB 1ZP0B 4PT5A 2WXJA 1XLOA 1D4BA 2YEPF 1KRHA 2MH7A 3RPFC 5G5HA 1J7BA 1NEKB 4JPSA 5EE0A 3N9YC 1ET9A 3AN1A 2FE8A 1AN8A 4L2YA 1HZ6A 3MFGA 2L83A 2M0AA 4LTUA 1ZE3D 1SEBD 1PDXA 1N62A 2J4XA 1K53A 1QT9A 1SIJA 3AE7B 1EU3A 3AE3B 3W1SA 2INNE 3BK1A 2PLPA 1JRPA 1KTKA 4MT5A 1E9MA 1XLNA 1BXTA 1HQRD 1C76A 1DGJA 3CWIA 3BVMA 1HZ5A 1F0ZA 4R3DA 1JCKB 1TY0A 1ZXIA 4HEA1 4XE0A 1OQRA 2WS3B 3FC4A 1JQ4A 4H2AA 1A70A 4B0MA 1RFKA 4B0EA 3TEWA 2XNAC 2GRIA 1FFVA 1QOFA 1JW9D 3MJ5A 3NS1A 1PFDA 4MM3B 3AE5B 4JE3B 1FIQA 1C79A 2V4IB 1FNWA 4IOIE 4ARIA 4AS1A 3L4PA 1NYQA 2BB5A 3LB8C 1T3QA 1SE2A 3AEFB 1KF6B 3WCQA 1FO4A 2K5PA 5FKAC 2JSVX 1M4VA 1T5XD 2SEBD 3ABVB 3I9V1 1TZOA 2LJIA 2I38A 2WXFA 4AQ7A 2WXKA 2N7JA 1FRDA 3EGRA 1CJEA 3FILB 2GI9A 3AB5A 2PVOD 1ZDVA 3P4SB 3PO0A 1PYWD 1J7AA 3GP7A 1DOXA 1YN4A 2FBWB 3BVZA 2RDHA 2YEPB 2IGGA 3AM9A 3GS2A 4TQ0A 1L4DB 2LMCA 3IAM1 1SJHD 2X38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A8X C;  2HDE A;  4A6Q A;  4A90 A; 
#chains in the Genus database with same CATH topology
 3VR9 B;  4A9A A;  4FJV B;  3PPA A;  4PYU A;  1N60 A;  2LJ5 A;  1EF1 A;  3SU8 X;  4ZHO A;  1RLF A;  1D5M C;  4GB9 A;  4XZ4 A;  1BML C;  4JWU C;  1TTN A;  5IA7 A;  2VRR B;  3AEB B;  3BII D;  1AAR A;  5LXH A;  4KX6 B;  1MI0 A;  2KWC A;  4AP4 C;  1F77 A;  2ONQ A;  2FUH B;  3ECI A;  4IWO A;  4EZJ A;  3UIO B;  3HIZ A;  2NCN A;  4HRO A;  3P4R B;  3RUL A;  1WJU A;  1AWD A;  2KC1 A;  3B9J A;  4IC7 B;  3A9K A;  3HUI A;  1K8R B;  1EWY C;  2DZK A;  4AOF A;  3PS6 A;  3ZGZ A;  3ZNH B;  2JZP A;  1WXQ A;  3Q3M C;  3I3T B;  2N4F A;  2W54 A;  5J18 A;  3UQB A;  2BT6 A;  1MJD A;  3PRM B;  3MHS D;  2IO3 B;  2D5G A;  2WGS A;  3TJP A;  3NOB A;  1OFF A;  4TMA B;  3ENE A;  2I1K A;  5D3I B;  3IT4 B;  4S17 A;  2JVC A;  3VRB B;  1SIF A;  2MEK A;  2B76 B;  2JPH A;  3Q3F A;  3RN9 C;  3AEE B;  2DBY A;  3RT3 B;  2K9X A;  2K0P A;  4M0W B;  4XC2 A;  4KV2 A;  4DDI D;  2CJN A;  2WDT B;  2JUO A;  3ZUN A;  4D2K A;  4GDL B;  3CMM B;  3CST A;  4K7U A;  1LM8 B;  1XT9 B;  4RH6 A;  2WDQ B;  2BKR B;  1X1M A;  3N32 A;  4LCD E;  2D10 A;  2BW2 A;  1V97 A;  4HRS A;  2CU3 A;  2N1W A;  1B9R A;  2C7M B;  1MHX A;  3NS8 A;  4PK1 A;  4KKI A;  4ZDV A;  2Y5P A;  1C4A A;  1I4H A;  1P1A A;  2R2Q A;  4DXF A;  2KQ4 X;  2KVR A;  4FJY A;  2B3A A;  4RF0 A;  1L0X B;  1QIL A;  4HCN B;  4N9F 4;  2KNB A;  4BKS D;  1RYJ A;  1KLG D;  4YT0 B;  2QHO A;  1E8Z A;  1WE6 A;  2BGF A;  1EO6 A;  1GG3 A;  5CTR C;  4II3 B;  2KT7 A;  2GBJ A;  4WWP A;  5BMI A;  4W9H A;  2FNJ B;  4TKN A;  1D5Z C;  4A6Q A;  3Q8C A;  2QDF A;  3B2G A;  4IKG A;  5T8I A;  2LAS A;  2IDY A;  1S3S G;  4BOZ B;  4BOS C;  1V5O A;  2L32 A;  3I5J C;  1J19 A;  2KDE B;  2H89 B;  2N7D A;  4K81 A;  1YJJ A;  2AQ2 B;  3DVN V;  3V61 A;  3O65 B;  4X57 B;  1J8C A;  2PJH A;  1JAL A;  4ZOH C;  1WGG A;  1UH6 A;  1L0V B;  4L1B A;  1STE A;  2Z0D B;  2GOW A;  5JH5 C;  2WXN A;  4E3C A;  1TZ1 A;  2ASQ A;  4USA A;  4JWS C;  2WXQ A;  3A1Q A;  3U30 A;  1N63 A;  3KW5 B;  3JW0 X;  1N61 A;  1R4M B;  3H6N A;  2C5L C;  2D3A A;  3P63 A;  2WWZ A;  1J7C A;  2WYQ A;  4HPL B;  2CU1 A;  3UQA A;  2K25 A;  2NTS A;  2JYE A;  2K8C A;  3NHE B;  4LJP B;  2PKO A;  3PLU A;  4KGT A;  3RUI B;  4YXD B;  2K3U A;  3AE1 B;  2RDG A;  2E3T A;  4YL8 A;  2DLB A;  3Q8B A;  1D5X C;  1JWB D;  2KQ7 A;  3MC9 A;  1Q10 A;  3E56 A;  1YQ3 B;  2QEJ C;  5IOI A;  4ITK A;  2G9H D;  4IWP A;  4EE2 A;  3U4E G;  1EWC A;  4JX1 C;  2D07 B;  1G6J A;  2IPK D;  2GB1 A;  3HK0 A;  2NS5 A;  3OLM D;  4HPP A;  3P4Q B;  4PS7 A;  3DBR B;  4HVB A;  2N9X A;  4G50 A;  3DBL B;  1GUA B;  2PEA A;  5C1Z A;  5LLI A;  4DXG A;  2G1E A;  1WJ6 A;  4IM2 A;  2CHZ A;  3K9O B;  2RPV A;  5AUI A;  2LGX A;  3SD5 A;  1UUP A;  3VUY A;  1Q0W B;  2K22 A;  3TEZ A;  3BK2 A;  1TS3 A;  3N20 C;  1JWM D;  1WY8 A;  5D3D A;  2IZV B;  2KO3 A;  2SAK A;  1T0Q C;  1WGK A;  5CHF A;  5TSS A;  2N1V A;  1RWS A;  2ZZP B;  3RMK C;  2WHI A;  3OG5 A;  3U2S C;  3L13 A;  1XXG A;  1ZUD 2;  1FMA D;  1UGM A;  4IUM B;  3QCA A;  3KWL A;  4TV3 A;  1C4P A;  1L6V A;  5CX3 A;  1T0Y A;  4GXB A;  3VRA B;  1V86 A;  5HKH A;  3H7S A;  4NPN A;  3NY5 A;  4P7I A;  3LYY A;  2E6X A;  2PVG C;  3CSF A;  4A55 A;  3RNA C;  3U52 E;  2L7R A;  3QX1 A;  3VTU A;  3CF6 E;  2XK5 B;  4JL9 A;  3GZN I;  4WWM A;  5EE9 A;  3KWV A;  1V1P B;  4NQK E;  2W55 A;  1IBX B;  1F1H A;  1SJE D;  1JWS D;  2IGD A;  4F1S A;  2KAC A;  2RD0 A;  4WJN A;  1ZP0 B;  3KUC B;  1TIF A;  1U4A A;  3RPF C;  3RNB C;  3JSV A;  1J7B A;  1NEK B;  4JPS A;  5EE0 A;  1UZX B;  4MDK E;  1ET9 A;  3MFG A;  2L83 A;  2M0A A;  4LTU A;  1H8C A;  1P98 A;  1SIJ A;  1R4N I;  2INN E;  3N1X C;  2PLP A;  3H7P B;  1KTK A;  1P0R A;  4JQW C;  2J0K A;  1F9J A;  1XLN A;  1HQR D;  2FAZ A;  4II2 B;  4DHJ B;  4BBN F;  3UGB B;  1TY0 A;  3DCG A;  2K6D B;  4DBG A;  4GU2 A;  1A70 A;  2FCQ A;  2IO0 B;  4S0R A;  2ZPN A;  2XNA C;  3R7Q A;  4MM3 B;  1KM7 A;  2DZI A;  1JW9 D;  1PFD A;  1FIQ A;  2V4I B;  2V9H A;  3TL5 A;  4AS1 A;  1NYQ A;  2BB5 A;  3SDL C;  1V5T A;  4JIO U;  3AEF B;  1FO4 A;  2JSV X;  2HD5 B;  2FCN A;  1V80 A;  2SEB D;  3ABV B;  2LJI A;  2JF5 A;  2WXF A;  1FRD A;  3DVN U;  2DAF A;  2MRP A;  2PVO D;  1TT5 B;  4FAD A;  1DOX A;  1YN4 A;  4MJS A;  2FBW B;  3V6C B;  4FN2 A;  1WX7 A;  3ZW3 A;  2X38 A;  2QSD A;  4WH4 A;  2L52 A;  3H1U A;  2A4Z A;  4ZRI A;  4BKS A;  2LGS A;  3ML8 A;  1NI2 A;  3PHW B;  4WJQ A;  2QJL A;  1QKZ A;  1TS2 A;  2BWE S;  4WWO A;  4KIK B;  2Q5W D;  2AQ1 B;  2ON8 A;  1L6U A;  3H8H A;  1XCT L;  4KGS A;  2V1Y A;  3PV1 A;  1ROE A;  4HKQ A;  2N9P C;  4LNK A;  4ANV A;  1NVI D;  1XQQ A;  3GB1 A;  2CKH B;  1WM3 A;  2AX5 A;  3AED B;  3EA6 A;  1JWA D;  1MG8 A;  2RGF A;  1LFD A;  1FNU A;  3AEG B;  1L0Y B;  1WZ0 A;  1WWT A;  4US9 A;  2KK8 A;  3NJT A;  1VZ7 A;  1I4P A;  3KQ4 A;  4YSY B;  2WDV B;  4FLH A;  1GAQ B;  4C56 C;  4C4V B;  3MHZ A;  2TSS A;  3AE2 B;  1QOG A;  2MJD A;  3NZ3 A;  3ZJV A;  3DVG X;  4UDU C;  1NEN B;  2D3G A;  4NAW B;  1NDD A;  1FXT B;  3IFW B;  3PZ7 A;  1GPX A;  1JRU A;  2GBN A;  3MP9 A;  2K39 A;  1YJI A;  3APD A;  2O2V B;  3FIL A;  3AU5 A;  1KH0 A;  2AYO B;  3QJZ A;  4E71 A;  2IJ0 A;  3VFK A;  3AEA B;  4J3O D;  3BVG A;  2IO1 B;  4GMV A;  1RM6 C;  2WX0 A;  2GBK A;  2D2Q A;  3LXF A;  1Z2M A;  4OHJ A;  3P42 A;  3ZNG C;  2RR9 A;  4KDL B;  4FUL A;  3RYT A;  1EU4 A;  1OTR B;  5FK9 C;  4ZHP A;  3WAN A;  2NR2 A;  2EKI A;  1SE4 A;  2J53 A;  3R66 C;  4RGT A;  1E8X A;  3TBL D;  2UYZ B;  1HXY D;  3AE4 B;  5AZF A;  4M01 A;  5KHQ A;  1PQS A;  2O6V A;  2X8X X;  4XGA B;  4FBJ B;  1C4C A;  2V3N A;  2MSE D;  4IM0 A;  4XWT A;  4RFB A;  1ENF A;  4MH8 A;  4KGR A;  1VD2 A;  2JQR B;  4W9E A;  3AV8 A;  3RZW C;  2AL3 A;  2ZNV C;  1GJZ A;  4F7Z A;  3X23 A;  5JHA A;  3EHV A;  3DHH C;  1DYQ A;  4HXD A;  3NVY A;  3QK0 A;  4N59 A;  4HPM B;  2BKF A;  3BWU D;  3PRE A;  3Q2A C;  3NVV A;  3N30 A;  3U7D A;  3EUB 2;  3TEY A;  3C0R B;  5C2T B;  5H92 C;  1E10 A;  3PZ8 A;  1TBE A;  4DWF A;  1V49 A;  4EUT A;  1WSP A;  2IBI B;  1TJE A;  1WJ4 A;  5MPO A;  2ZW0 A;  4ASW C;  2LVP A;  4HDQ A;  3A9J A;  3OAW A;  1H4R A;  2DYM A;  4QAY A;  2J52 A;  1WX8 A;  1WJN A;  4RGM A;  3RFZ B;  2MA9 B;  5HG2 A;  2NPT B;  2KQS A;  3M63 B;  3QQ8 B;  2JU6 X;  1WRD B;  1TYG B;  4GDK A;  1MVK A;  2ZVN A;  2KX0 A;  1E90 A;  3B08 A;  1CQV A;  4YWG G;  4I6L B;  3RZF A;  4W9J A;  4DHZ E;  2W3R A;  4K3B A;  3Q6B A;  2ACZ B;  4YTM B;  4RGN A;  1XEE A;  1TY2 A;  4FXC A;  2QCZ A;  3T3O A;  4ZYS A;  5IN7 A;  4WIP A;  1BT0 A;  1UBQ A;  5JXV A;  2BS3 B;  3L08 A;  1WFY A;  4YSX B;  1QQR A;  1TKG A;  4CHK A;  3DHI C;  1SXT A;  5H8Y E;  3J9C A;  3PZD A;  5JZE B;  4WAA A;  2HTH A;  4WQM A;  1PGA A;  3T8M A;  3RCZ A;  2KDB A;  4HJG E;  2MP2 A;  2MW5 A;  5BYS A;  3ZRC A;  2KFK B;  3KYC D;  1IYF A;  4YSZ B;  1GB4 A;  3SFE B;  4O1N A;  3VUX A;  5IO9 A;  1M94 A;  2ZW1 A;  1WMH B;  2MBH A;  2RSU A;  2HTM E;  3W2D A;  4ICV A;  3RI7 C;  3PRZ A;  1V2Y A;  2Y3A A;  4HKZ E;  3W5U B;  2K8B A;  3B1L X;  3NG0 A;  3VH4 B;  2ZEQ A;  4NJC A;  3ZTD A;  4LK0 M;  2DWQ A;  3ZVV A;  2OHF A;  2LXC A;  3AEC B;  4AWJ A;  1D3Z A;  4DK5 A;  3ZJU A;  3UIN B;  3P4P B;  1I35 A;  3WAP A;  1IPG A;  4G0N B;  1WIA A;  2LFI A;  2WXH A;  1J0G A;  2BWF A;  2INC C;  2LEK A;  3N3K B;  1UGJ A;  2ZPY A;  3JVZ X;  1FM0 D;  1YQ4 B;  4GOC A;  2KTR A;  3Q3N C;  1YX5 B;  2M0X A;  1CZP A;  3K9P B;  3Q8E A;  3TEX A;  4MGZ E;  2MHJ A;  2KDI A;  2MWS B;  2FCS A;  3URY A;  3EEC A;  2WXJ A;  1KRH A;  1YJ1 A;  2MH7 A;  4BFR A;  2LWP A;  2AEH A;  3ZDM C;  2AWT A;  2KZR A;  2FE8 A;  1LQB A;  4WQO B;  2MQJ A;  2KXJ A;  1N62 A;  1QT9 A;  2BPS A;  5EDS A;  1ZKH A;  2DHZ A;  1KJT A;  3FKY A;  2RDB C;  3A9K B;  4MT5 A;  1KLV A;  4W9D A;  1E7V A;  4DXA B;  1WXM A;  3ZNI D;  1JCK B;  1ZXI A;  4HEA 1;  3FC4 A;  2BYE A;  4H2A A;  5DPS A;  4DHZ B;  4B0E A;  3N1Z C;  3MJ5 A;  3AE5 B;  4G11 A;  4JE3 B;  1FNW A;  3LB8 C;  1T3Q A;  3UF8 A;  3VDZ A;  5L95 C;  3DOW A;  2JZ3 B;  1L2N A;  3IBE A;  1EUV B;  5TR5 A;  2EKE C;  3I9V 1;  1TZO A;  3QIJ A;  2Z59 B;  2L0F A;  4M8M A;  2GI9 A;  3P4S B;  1ZDV A;  4E74 A;  3PO0 A;  3L0W B;  4W9G A;  3GP7 A;  3H9D A;  3BVZ A;  4TQ0 A;  4HLE A;  2ZVO A;  3IAM 1;  3DWG C;  4RCO A;  3KUZ A;  3PLV A;  1YOV B;  1N5W A;  5IAA C;  1IGC A;  1ZOY B;  2PW9 A;  3WAO A;  1I4R A;  2Z8L A;  3PSE B;  2A5U A;  3VHT C;  1ESF A;  2KC2 A;  1IP9 A;  3P1M A;  1HTO A;  4BKG A;  3V3X A;  1YN5 A;  2WXM A;  4JGH B;  5BMH A;  1Q1O A;  3AE6 B;  1WGD A;  2KAN A;  3MC0 B;  4PS8 A;  1ISN A;  3ZJT A;  2BBC A;  1V81 A;  3QA8 A;  5AEK B;  3R7R A;  1ET6 A;  3U8Z A;  2BYT A;  3IAS 1;  3QC8 B;  5BYR A;  5LXI B;  3B2F A;  4RF1 A;  2LUM A;  2KMA A;  1QLB B;  3BY4 B;  1IGD A;  5C3J B;  2N0S B;  3APF A;  5AUK A;  4EKU A;  5C23 A;  1T0R C;  3ETR A;  1VZ8 A;  4OZC A;  3UI3 A;  3WAM A;  2M17 A;  1YIW A;  2BQQ A;  2PMV A;  5L83 A;  3BIN A;  3KVF B;  4XX5 A;  3A1Q B;  3TCA A;  2KTF A;  2K6Q A;  4GLS C;  2L1A A;  3ZQ4 A;  1VR9 A;  1IUE A;  1WE7 A;  3ZYY X;  1KOT A;  1HA5 A;  2JX5 A;  3BZD B;  2XBB C;  3IT6 B;  3PTF C;  1C77 A;  2WDR B;  1I4Q A;  3A4R A;  5I4D A;  2KFJ A;  2M19 A;  2BYV E;  4ZRP A;  2KDM A;  1WR6 E;  2QIL A;  3L10 B;  2KKC A;  3BYT B;  1DOI A;  2JXT A;  3RNE C;  3RD2 A;  1MG4 A;  2KHW B;  1AYF A;  1TS4 A;  1WGH A;  3PVL A;  2W3S A;  1FCC C;  3Q14 C;  3C19 A;  3WIM A;  4EFO A;  4MEL A;  1LO5 D;  2HJ1 A;  3GZN B;  3WAL A;  1QZE A;  2H88 B;  5IP4 D;  3AMZ A;  1P3Q U;  2DEN B;  2MX2 A;  3V60 A;  4XYC A;  5HFY A;  1F52 A;  3NUH B;  4IW0 A;  4ICU A;  3HRD D;  3D32 A;  2MJ3 A;  2DNF A;  2KWD A;  4P6V F;  1ZDX A;  1WH3 A;  4L23 A;  2YLM A;  1XF5 L;  1EM7 A;  2IGH A;  1SE3 A;  4A90 A;  2V3P A;  1R4N B;  1UNS A;  4XDC A;  3MC8 A;  2BTE A;  5LNK 1;  4DHJ D;  3L16 A;  2Y5C A;  4EEW A;  3FAH A;  2N9E B;  4RMA A;  1VRA B;  3KUD B;  2V0G A;  1YN3 A;  1XCQ L;  4ZRK A;  2DX5 B;  2YVC A;  1E5W A;  2JYT A;  4NJ7 A;  2ZCB A;  2AL6 A;  3B0A A;  1SB3 C;  1FRR A;  1T6B X;  1VCB A;  2N9K A;  4M0W A;  2LVO A;  2KX3 A;  2CR5 A;  2KMM A;  3A33 B;  2GLS A;  4TUU A;  1OEY J;  3DBH I;  2KAJ A;  4GDL A;  1FXI A;  4K3C A;  1F2R C;  4GSW A;  3AE9 B;  1V8C A;  3RNG C;  2J42 A;  2WLB A;  2W82 A;  3R2I A;  4EZL A;  2JXX A;  1I42 A;  3Q8A A;  1K51 A;  4M02 A;  5IKC M;  4XWW A;  1WRI A;  1OQY A;  2OJR A;  4W9K A;  5DPT A;  4A3P A;  4I6P A;  4IWQ A;  1ZPS A;  3W9C B;  2KWV B;  4AJW A;  3R8B A;  2GMI C;  1HEZ E;  2KDF B;  4FHK A;  1ACC A;  4MGY E;  2NMQ A;  3WA0 A;  1S1Q B;  2CHW A;  3R2T A;  4Q2J A;  3APC A;  4US8 A;  1YX6 B;  2LHD A;  2MJE A;  4HK2 A;  1V1O A;  2I1J A;  3Q8F A;  2ICI A;  5FR3 A;  3I57 A;  1F2R I;  3JSV B;  1E7P B;  2WX1 A;  2JRI B;  2N7E A;  1QOA A;  2C9W B;  3L54 A;  3T3N A;  4B6W A;  1N5X A;  2PIA A;  3HVD A;  3PT2 B;  4IM3 A;  2LRU A;  1LXD A;  3DWM A;  1C9F A;  3V05 A;  4I6N B;  2D3B A;  3ZKJ C;  2WXR A;  1Q5W B;  2HDE A;  4ZRJ A;  4PYZ A;  4URK A;  1DOY A;  3DDC B;  2L00 B;  2Y5B B;  3C8Y A;  2M56 B;  2J0M A;  2C7H A;  5JHB A;  5HHD G;  3TSS A;  3DBH B;  3W5V B;  2G3Q B;  2KYW A;  2FID A;  4WJO A;  2WQY B;  4ZYN A;  4FHJ A;  3ONS A;  1WX9 A;  4HWI B;  2DAJ A;  4FA6 A;  3X0W A;  2RMM A;  3VAW A;  1QF6 A;  4GIV A;  1FXA A;  3HM6 X;  4TQ1 A;  1ZXH A;  3IVF A;  1B1Z A;  4NNJ B;  4MJS B;  3NZU A;  4NAM A;  1XLQ A;  1ZW7 A;  4A3O A;  2N9L A;  4TSS A;  4B95 A;  3OWE B;  2OED A;  5G55 A;  2DYO A;  1PGX A;  4KSK C;  5BO4 B;  3IHP C;  1UEL A;  3VXW A;  4C7Z A;  4OVZ A;  1UF0 A;  2G4S A;  1I4G A;  1WR1 A;  2KJH B;  3ZRF A;  1SGH A;  2K1F A;  2HJ8 A;  1FFU A;  1NYR A;  3R3M A;  4PT5 A;  1XLO A;  1D4B A;  2G4D B;  3NZS A;  4NJ6 A;  5G5H A;  3QAQ A;  4JLC A;  2PE9 A;  2MCN B;  3V62 A;  2LGD A;  2KN5 A;  2LXA A;  1AN8 A;  1HZ6 A;  5J17 A;  1ZE3 D;  2JWZ A;  2J4X A;  1K53 A;  4FJZ A;  3AE7 B;  2DYB A;  3W1S A;  2KVZ A;  3BK1 A;  2Z0E B;  5G2N A;  1FPY A;  3MTN B;  4EZK A;  1BXT A;  5D94 A;  2CHX A;  2J0J A;  1NBF C;  3CWI A;  1HZ5 A;  1F0Z A;  4R3D A;  5DPR A;  4XE0 A;  1OQR A;  2WS3 B;  4OVV A;  1L7Y A;  2KJR A;  4HCP B;  1RFK A;  5DCN A;  3PHX B;  1QOF A;  1C79 A;  4IOI E;  1R4M I;  4P1B C;  1KF6 B;  3WCQ A;  2FIF A;  5FKA C;  4HDO A;  3ZDT A;  1RAX A;  2NBU A;  1T5X D;  1GC7 A;  2LUE A;  1WXA A;  2N7J A;  4PS3 A;  3EGR A;  3FIL B;  2ZNV B;  3AB5 A;  1PYW D;  1J7A A;  4WWN A;  2M8S A;  3DHG C;  4AUQ C;  3AXC A;  2IND C;  4RM9 A;  3W1S C;  3ZLZ A;  2IYD B;  4AQ7 A;  1SJH D;  2K8H A;  3NVZ A;  2L8J A;  4MH0 E;  1FEH A;  4YTP B;  5E6N A;  2DZM A;  2XK5 A;  1C78 A;  1UD7 A;  4GN1 A;  2LI5 A;  1V1P A;  2GBR A;  2LZ6 A;  2WU5 B;  1WXS A;  1WGR A;  3SFD B;  1IBX A;  1UBI A;  5GXG B;  1SBB B;  3GE8 C;  3HVZ A;  3DBR I;  4WUR A;  3DBL I;  3DPD A;  1YNT E;  1HTQ A;  2J7Q B;  3HM3 A;  5EE1 A;  2O6V B;  2V4L A;  1VJK A;  1P7E A;  2ZJD A;  1E6E B;  3AE8 B;  3ZXV A;  2QIE B;  2BVC A;  1A5R A;  2EEL A;  2D3C A;  4REZ A;  3RNF C;  1RFA A;  3Q69 A;  2R2O A;  1MFW A;  2KLC A;  4A20 A;  3VR8 B;  4M00 A;  4LLG M;  2VZK B;  2I2Y A;  4BVU C;  3H7P A;  5EE3 A;  4DQO C;  4MAC A;  3IXS A;  2PTL A;  2WXI A;  1C3T A;  5CHV C;  1UWX A;  3NVW A;  2MBE A;  2EMS A;  2FUG 1;  4LNF A;  2LGY A;  3Q3O C;  4K7W A;  2NVU I;  3DQV A;  2RPQ A;  3M62 B;  3A4S C;  4MM3 A;  1WYW B;  1FNV A;  4WAF A;  1SE9 A;  3MJW A;  1K52 A;  1P7F A;  2XN9 C;  1QOB A;  3A9J B;  4MGK E;  4CO7 A;  2INP E;  4RGO S;  1VZ6 A;  1JML A;  2VH2 A;  4G3X B;  5FR6 A;  2JZZ A;  1WM2 A;  4LNO A;  1OQQ A;  1PGB A;  2BB6 A;  3U7Z A;  4C80 A;  4GDK B;  4BZA A;  3OJ3 A;  2JT4 B;  4J6I A;  1WZ3 A;  4MSM B;  2KD0 A;  3JYU A;  3AI5 A;  1WGY A;  2O6V D;  4NQL B;  3SHQ A;  1N6Z A;  5E6O A;  1E7U A;  3AU4 A;  4N58 A;  4KIK A;  1CK1 A;  2FCM A;  2KOX A;  2WXO A;  1R7S A;  3ZTC A;  3VH3 B;  4OZA A;  4B9K A;  1KFY B;  3P2B A;  5AZG A;  4A8X C;  2VZK D;  4NZL B;  2NTT A;  4W9I A;  3KLS X;  3SEB A;  3PGE A;  2CJO A;  4AJY B;  1YMH E;  2PPH A;  4MGI E;  1I7H A;  1VDV A;  1XO3 A;  3GE3 C;  3I63 C;  1OGW A;  5E6P A;  1YD8 U;  4IG7 B;  1MPE A;  2BYF A;  4YTN B;  1YQB A;  2MP2 B;  4KZ0 A;  1XD3 B;  4K7S A;  4N6E B;  4OZB A;  1UWM A;  1L4Z B;  3ZXR A;  3EFU A;  4P16 A;  2NBV B;  5D6J B;  4K1R B;  1GNU A;  2DZJ A;  2ZCC A;  1WF9 A;  2IY0 B;  1L5P A;  4C4V A;  1JRO A;  3EFC A;  3E9S A;  1GOZ A;  1TS5 A;  3O13 A;  4DDG D;  4LDT B;  4LJO B;  4LNI A;  2QMT A;  3VQI A;  1E8Y A;  4NAW A;  4BBN C;  4C00 A;  1PUT A;  5GMV A;  3EC8 A;  1AW7 A;  2UWQ A;  4CYE A;  2WXL A;  3VUW A;  4W9L A;  3L17 A;  1V9J A;  2L05 A;  2O2V A;  3M95 A;  3QHT A;  4XDD A;  4ZRQ A;  3PRP B;  4ARC A;  4HJK A;  1BUI C;  1E0Z A;  1K50 A;  1TGZ B;  4ANX A;  2LHE A;  3ZO5 B;  2R61 A;  4C7Y A;  4BAX A;  3NRZ A;  3DVG Y;  2QC8 A;  2C7N B;  1T0S C;  4P1C C;  2WU2 B;  1NI3 A;  2KN4 A;  2WXP A;  2KTR B;  1GC6 A;  2IO2 B;  3UIP B;  1P9D U;  4ANU A;  2BS2 B;  3OJ4 B;  2M4N A;  2NBW B;  2JWU A;  1ZGU B;  5HI1 A;  3TMP B;  2KMC A;  5CHW A;  3IG3 A;  1CMX B;  3GOE A;  3LJ3 A;  1KLU D;  3SR6 A;  2KJ6 A;  1Z5S B;  1JWU D;  5J2R A;  2L3Z A;  3ALB A;  1MHH E;  4RM8 A;  2MBO A;  4WJP A;  2M1M A;  2JRH A;  1RRB A;  4LDT D;  1TKY A;  4NY0 A;  5AZH A;  5D7G A;  1FD6 A;  3AH7 A;  3VVW B;  3RNC C;  4RNA A;  2AQ3 B;  2REX A;  3HHM A;  4CQN A;  4KZC A;  3KYD D;  2BS4 B;  3N1Y C;  1GB1 A;  3DBS A;  2WXG A;  3V6E B;  2D11 A;  2LD9 A;  1SSN A;  2WNM A;  3VTV A;  4F8C B;  2NPT A;  2LGI A;  4OW0 A;  3ZNZ B;  2C60 A;  4W9F A;  2BF8 B;  3TUO A;  1D6E C;  1HE8 A;  2OOB B;  2W9N A;  4OVU A;  3AUL A;  1VLB A;  1E8W A;  1Y8R C;  4LNN A;  3KH0 A;  5BMG A;  1I4X A;  1XLP A;  1WXV A;  4IDI A;  4KDI C;  5E6J A;  3ML9 A;  4MEM A;  1SF0 A;  3LDZ E;  2V3S A;  1TKE A;  3S2A A;  4KKJ A;  3W1Y A;  4KSL C;  3Q3J A;  3CIR B;  1Y56 A;  2WP9 B;  2G45 B;  1WYG A;  2KLG A;  2VH1 A;  1FCL A;  5BYQ A;  2LVQ A;  5G5G A;  3BYY B;  2MLB A;  4KVG B;  2YEP F;  2KWU B;  3QAR A;  1WI0 A;  3N9Y C;  3AN1 A;  4L2Y A;  5D2M B;  2JY6 A;  3M3J A;  2KFK A;  2XEW A;  1SEB D;  1PDX A;  2OJW A;  1EF5 A;  1EU3 A;  3AE3 B;  3T9L A;  2IY1 B;  1JRP A;  2L76 A;  1E9M A;  2MBQ A;  2LRW A;  1C76 A;  1DGJ A;  2PE6 B;  2MBB B;  4M8N A;  4ANW A;  1WMH A;  3BVM A;  5KHO A;  4ACF A;  1C1Y B;  1JQ4 A;  4MSQ B;  1OEY A;  3ZIM A;  4B0M A;  3TEW A;  2GRI A;  1FFV A;  3NS1 A;  3QWZ B;  4BKT A;  4ARI A;  3L4P A;  1SE2 A;  2L0T A;  1V6E A;  2K5P A;  4EOY A;  4W9C A;  3VTW A;  1M4V A;  2UU7 A;  1LGR A;  2I38 A;  2WXK A;  1CJE A;  3TIX A;  2HE7 A;  5DPW A;  4GGQ A;  2RDH A;  2YEP B;  2EMT A;  2IGG A;  3AM9 A;  3GS2 A;  1L4D B;  2GBM A;  2LMC A;  2CS4 A; 
#chains in the Genus database with same CATH homology
 2QSD A;  3DWG C;  2L52 A;  4RCO A;  4WH4 A;  3VR9 B;  4A9A A;  3NVZ A;  4YTP B;  1FEH A;  1N5W A;  1C78 A;  1IGC A;  1ZOY B;  2PW9 A;  2QJL A;  1QKZ A;  1I4R A;  1TS2 A;  2Z8L A;  1V1P A;  2WU5 B;  1N60 A;  3SFD B;  1IBX A;  4ZHO A;  5GXG B;  1SBB B;  1D5M C;  1ESF A;  2Q5W D;  3HVZ A;  4WUR A;  2AQ1 B;  2ON8 A;  1L6U A;  3H8H A;  1XCT L;  1BML C;  3P1M A;  4KGS A;  1YNT E;  1ROE A;  4JWU C;  5EE1 A;  4HKQ A;  3V3X A;  1YN5 A;  3AEB B;  1VJK A;  1P7E A;  1NVI D;  1E6E B;  3AE8 B;  3BII D;  2WXM A;  2QIE B;  3GB1 A;  4KX6 B;  5BMH A;  2EEL A;  1MI0 A;  2AX5 A;  3AED B;  3EA6 A;  1F77 A;  1JWA D;  3AE6 B;  2ONQ A;  4REZ A;  3MC0 B;  3Q69 A;  4HRO A;  3P4R B;  3ZJT A;  3VR8 B;  2BBC A;  1FNU A;  1AWD A;  2VZK B;  3AEG B;  3B9J A;  1L0Y B;  4LLG M;  3HUI A;  2I2Y A;  1EWY C;  5EE3 A;  4DQO C;  1ET6 A;  4MAC A;  3ZGZ A;  2JZP A;  3IXS A;  2BYT A;  1WWT A;  1WXQ A;  2PTL A;  2WXI A;  3IAS 1;  5BYR A;  4US9 A;  1UWX A;  3B2F A;  3NVW A;  4RF1 A;  2W54 A;  1VZ7 A;  2FUG 1;  2LUM A;  2BT6 A;  1I4P A;  3KQ4 A;  1QLB B;  4YSY B;  2WDV B;  2D5G A;  1IGD A;  1GAQ B;  1OFF A;  4C56 C;  3MHZ A;  4TMA B;  5C3J B;  2N0S B;  5D3I B;  2TSS A;  3AE2 B;  5AUK A;  1QOG A;  3IT4 B;  2MJD A;  3NZ3 A;  3ZJV A;  1FNV A;  3ETR A;  4WAF A;  3VRB B;  1VZ8 A;  4OZC A;  4UDU C;  2MEK A;  1NEN B;  3UI3 A;  2B76 B;  2PMV A;  4NAW B;  1K52 A;  3PZ7 A;  1P7F A;  4GLS C;  2XN9 C;  1QOB A;  1GPX A;  3MP9 A;  2L1A A;  3AEE B;  2DBY A;  1VR9 A;  1IUE A;  3ZQ4 A;  1YJI A;  2K9X A;  3ZYY X;  2INP E;  2K0P A;  4RGO S;  1VZ6 A;  3FIL A;  1HA5 A;  2JX5 A;  3BZD B;  1JML A;  2CJN A;  1KH0 A;  3IT6 B;  2IJ0 A;  4D2K A;  4GDL B;  3AEA B;  4J3O D;  1C77 A;  2WDR B;  3BVG A;  1I4Q A;  1RM6 C;  5I4D A;  2M19 A;  3LXF A;  4RH6 A;  1OQQ A;  2WDQ B;  1PGB A;  2BB6 A;  4OHJ A;  3P42 A;  4ZRP A;  4GDK B;  3U7Z A;  2BW2 A;  2KDM A;  4C80 A;  1V97 A;  4HRS A;  2CU3 A;  1B9R A;  1EU4 A;  1MHX A;  2QIL A;  5FK9 C;  4ZHP A;  3BYT B;  1DOI A;  4KKI A;  2EKI A;  2JXT A;  2Y5P A;  1C4A A;  1I4H A;  4DXF A;  2KQ4 X;  1SE4 A;  2J53 A;  4RGT A;  1AYF A;  4N58 A;  1TS4 A;  4RF0 A;  1L0X B;  1QIL A;  1CK1 A;  2W3S A;  1HXY D;  2WXO A;  3AE4 B;  1FCC C;  1RYJ A;  1KLG D;  1R7S A;  4YT0 B;  4OZA A;  1LO5 D;  2H88 B;  1C4C A;  1KFY B;  2V3N A;  4A8X C;  2VZK D;  4NZL B;  5BMI A;  2NTT A;  4XWT A;  4RFB A;  1ENF A;  3AMZ A;  3KLS X;  3SEB A;  2CJO A;  1YMH E;  4MH8 A;  4KGR A;  5HFY A;  2JQR B;  3AV8 A;  1D5Z C;  1I7H A;  4A6Q A;  1VDV A;  3NUH B;  1XO3 A;  3Q8C A;  3B2G A;  4IKG A;  5T8I A;  1MPE A;  2IDY A;  4YTN B;  3HRD D;  1DYQ A;  2MJ3 A;  2KWD A;  4P6V F;  1ZDX A;  3NVY A;  4L23 A;  4N59 A;  3BWU D;  1XF5 L;  4N6E B;  1EM7 A;  4OZB A;  2IGH A;  1UWM A;  1L4Z B;  2L32 A;  1SE3 A;  3NVV A;  4A90 A;  2V3P A;  1UNS A;  2H89 B;  4P16 A;  4XDC A;  1YJJ A;  2BTE A;  3EUB 2;  2AQ2 B;  3TEY A;  5LNK 1;  1L5P A;  5C2T B;  5H92 C;  1E10 A;  1JRO A;  3E9S A;  1GOZ A;  3PZ8 A;  1JAL A;  2Y5C A;  4ZOH C;  3FAH A;  1VRA B;  1L0V B;  1TS5 A;  4L1B A;  3O13 A;  2V0G A;  1STE A;  1WSP A;  1YN3 A;  1XCQ L;  2QMT A;  2WXN A;  3VQI A;  1TJE A;  4USA A;  2JYT A;  4JWS C;  1PUT A;  5MPO A;  2ZW0 A;  2WXQ A;  1AW7 A;  1N63 A;  1SB3 C;  1FRR A;  1T6B X;  2DYM A;  2WXL A;  2N9K A;  4M0W A;  1N61 A;  4XDD A;  4ZRQ A;  2J52 A;  2KMM A;  4ARC A;  1BUI C;  4RGM A;  3RFZ B;  3P63 A;  1J7C A;  1E0Z A;  5HG2 A;  2KAJ A;  1FXI A;  1K50 A;  2NTS A;  1F2R C;  2JYE A;  2JU6 X;  1TYG B;  3AE9 B;  1V8C A;  1MVK A;  2J42 A;  2PKO A;  2W82 A;  2WLB A;  3R2I A;  2LHE A;  4KGT A;  2R61 A;  4C7Y A;  3NRZ A;  4YXD B;  3Q8A A;  1CQV A;  2K3U A;  1K51 A;  4YWG G;  4XWW A;  1WRI A;  3AE1 B;  2W3R A;  2RDG A;  2E3T A;  2ACZ B;  4YTM B;  4RGN A;  1XEE A;  2DLB A;  3Q8B A;  1D5X C;  2WU2 B;  1JWB D;  1ZPS A;  3W9C B;  1NI3 A;  1TY2 A;  2KN4 A;  2WXP A;  1Q10 A;  4FXC A;  3E56 A;  1YQ3 B;  3T3O A;  2QEJ C;  3R8B A;  1HEZ E;  4ZYS A;  4ITK A;  2G9H D;  1ACC A;  4WIP A;  2BS2 B;  2NMQ A;  5JXV A;  4Q2J A;  3R2T A;  2BS3 B;  4EE2 A;  4YSX B;  3U4E G;  1QQR A;  1EWC A;  1TKG A;  4US8 A;  4JX1 C;  2IPK D;  2GB1 A;  2JWU A;  5HI1 A;  3P4Q B;  2LHD A;  2MJE A;  1SXT A;  1V1O A;  5H8Y E;  3J9C A;  3Q8F A;  2ICI A;  5FR3 A;  3I57 A;  1F2R I;  4DXG A;  1KLU D;  2G1E A;  1E7P B;  3SR6 A;  4WQM A;  1JWU D;  1PGA A;  1QOA A;  2RPV A;  4HJG E;  3T3N A;  1MHH E;  1N5X A;  5BYS A;  5AUI A;  2PIA A;  3HVD A;  1UUP A;  4YSZ B;  3DWM A;  1C9F A;  3SFE B;  3V05 A;  1GB4 A;  2K22 A;  3TEZ A;  4O1N A;  3BK2 A;  1TS3 A;  1TKY A;  2WXR A;  1JWM D;  2HDE A;  5D7G A;  5D3D A;  1DOY A;  1FD6 A;  3AH7 A;  2SAK A;  2ZW1 A;  1WGK A;  2HTM E;  3W2D A;  4RNA A;  3C8Y A;  2M56 B;  2Y3A A;  5TSS A;  4HKZ E;  2AQ3 B;  3W5U B;  5HHD G;  3TSS A;  4CQN A;  4NJC A;  1RWS A;  2BS4 B;  4LK0 M;  2DWQ A;  3U2S C;  1GB1 A;  3W5V B;  2OHF A;  1XXG A;  3AEC B;  2WXG A;  1ZUD 2;  2WQY B;  1FMA D;  3ZJU A;  1SSN A;  2WNM A;  3KWL A;  3P4P B;  1C4P A;  1L6V A;  2LGI A;  2RMM A;  4OW0 A;  3VRA B;  1QF6 A;  3TUO A;  1D6E C;  1FXA A;  2LFI A;  2WXH A;  4TQ1 A;  1ZXH A;  1VLB A;  1B1Z A;  4NAM A;  1XLQ A;  5BMG A;  1I4X A;  1XLP A;  3LYY A;  4IDI A;  2E6X A;  2LEK A;  2N9L A;  2PVG C;  1UGJ A;  5E6J A;  4A55 A;  4TSS A;  1SF0 A;  1FM0 D;  1YQ4 B;  3OWE B;  2OED A;  3U52 E;  2DYO A;  1TKE A;  1PGX A;  1CZP A;  4KKJ A;  4WWM A;  4C7Z A;  4OVZ A;  5EE9 A;  1I4G A;  3Q8E A;  3KWV A;  1V1P B;  3TEX A;  3CIR B;  1Y56 A;  2W55 A;  2WP9 B;  1IBX B;  1WYG A;  1FCL A;  5BYQ A;  1SJE D;  1JWS D;  3URY A;  2IGD A;  5G5G A;  1FFU A;  1NYR A;  2KAC A;  3BYY B;  1ZP0 B;  4PT5 A;  2WXJ A;  1XLO A;  1D4B A;  2YEP F;  1KRH A;  2MH7 A;  3RPF C;  5G5H A;  1J7B A;  1NEK B;  4JPS A;  5EE0 A;  3N9Y C;  1ET9 A;  3AN1 A;  2FE8 A;  1AN8 A;  4L2Y A;  1HZ6 A;  3MFG A;  2L83 A;  2M0A A;  4LTU A;  1ZE3 D;  1SEB D;  1PDX A;  1N62 A;  2J4X A;  1K53 A;  1QT9 A;  1SIJ A;  3AE7 B;  1EU3 A;  3AE3 B;  3W1S A;  2INN E;  3BK1 A;  2PLP A;  1JRP A;  1KTK A;  4MT5 A;  1E9M A;  1XLN A;  1BXT A;  1HQR D;  1C76 A;  1DGJ A;  3CWI A;  3BVM A;  1HZ5 A;  1F0Z A;  4R3D A;  1JCK B;  1TY0 A;  1ZXI A;  4HEA 1;  4XE0 A;  1OQR A;  2WS3 B;  3FC4 A;  1JQ4 A;  4H2A A;  1A70 A;  4B0M A;  1RFK A;  4B0E A;  3TEW A;  2XNA C;  2GRI A;  1FFV A;  1QOF A;  1JW9 D;  3MJ5 A;  3NS1 A;  1PFD A;  4MM3 B;  3AE5 B;  4JE3 B;  1FIQ A;  1C79 A;  2V4I B;  1FNW A;  4IOI E;  4ARI A;  4AS1 A;  3L4P A;  1NYQ A;  2BB5 A;  3LB8 C;  1T3Q A;  1SE2 A;  3AEF B;  1KF6 B;  3WCQ A;  1FO4 A;  2K5P A;  5FKA C;  2JSV X;  1M4V A;  1T5X D;  2SEB D;  3ABV B;  3I9V 1;  1TZO A;  2LJI A;  2I38 A;  2WXF A;  4AQ7 A;  2WXK A;  2N7J A;  1FRD A;  3EGR A;  1CJE A;  3FIL B;  2GI9 A;  3AB5 A;  2PVO D;  1ZDV A;  3P4S B;  3PO0 A;  1PYW D;  1J7A A;  3GP7 A;  1DOX A;  1YN4 A;  2FBW B;  3BVZ A;  2RDH A;  2YEP B;  2IGG A;  3AM9 A;  3GS2 A;  4TQ0 A;  1L4D B;  2LMC A;  3IAM 1;  1SJH D;  2X38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...