2XNAC

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xnaC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xnaC01
1CQVA 1ET6A 1BCPD 2Z8LA 1FNUA 1SJED 2NTTA 1TY2A 5ELCA 4Z9CB 1LTID 2SEBD 1V1OA 4ZYSA 3URYA 1TS2A 5ELBA 1TS4A 1D5XC 3MC0B 3R2TA 1KLUD 3BYTB 5TSSA 3DWPA 1YN5A 1S5DD 1LTGD 4RGMA 1EWCA 4OHJA 2XRQD 1XTCD 1SE4A 1LT6D 2XN9C 1YN3A 1EU3A 1KLGD 4TSSA 3DWAA 1S5FD 5D3IB 3W2DA 3BYYB 1PTOC 1I4XA 1I4PA 1FGBD 1FNWA 2ICIA 1V1PA 1PTOD 1S5BD 3DWQA 1GOZA 1FD7D 1EEFD 4L6TB 1QILA 4RHSA 2TSSA 1RDPD 1PTOH 3TSSA 1L0YB 1LTRD 3EA6A 1D6EC 1SXTA 1B44D 2WV6D 5ELFA 3EFXD 1LTSD 3BVMA 4DXGA 1PRTF 4O1NA 1HTLD 4RGNA 1UNSA 3MFGA 3GP7A 1SJHD 1JR0D 2NTSA 4UDUC 1LT4D 2AQ3B 1PRTB 2QEJC 4BWGB 2QILA 3BZDB 1JCKB 1CHPD 1RF2D 1SE2A 1HXYD 1JWUD 1UUPA 2R61A 1DYQA 2AQ1B 1LT3D 5ELDA 1TY0A 1I4QA 1M4VA 2G9HD 1I4GA 1STEA 1JWSD 1BCPB 1G8ZD 1JQYD 1LTBD 4RFBA 1CHQD 4RH6A 4C56C 4L63B 1FNVA 1SEBD 5ELEA 1ENFA 3OWEB 2O2LD 2XNAC 1L0XB 1JWMD 4RHRA 1ET9A 3O13A 1DJRD 1D5ZC 1PZJD 1CK1A 3CHBD 5FKAC 3R8BA 4K6LA 4DXFA 1S5CD 1AN8A 1AW7A 2RDGA 1EFID 3SEBA 1XXGA 3KLSX 2RDHA 4RGTA 5I4DA 1RCVD 4NZLB 3V05A 1I4RA 1BXTA 3BVGA 1PTOF 2IPKD 1BCPF 1S5ED 2XRSD 3R2IA 4RGOS 1SBBB 1LTTD 2CHBD 1LTAD 1TS5A 5FK9C 1KTKA 1PYWD 1PTOB 1LO5D 1HA5A 5D3DA 1I4HA 1PRTC 1ESFA 1CT1D 1D5MC 1EU4A 1PZKD 1YN4A 1PRTD 1T5XD 1PZID 1TS3A 1LLRD 1LT5D 1MD2D 2AQ2B 2J4XA 1EEID 2IJ0A 1B1ZA 1V1PB 1F77A 1SE3A 3BVZA 1BCPC 4RCOA 1RD9D 1HQRD
chains in the Genus database with same CATH superfamily
5HGTA 4C00A 4FDBA 2UXDL 2QGQA 1FNUA 2V9HA 4X65Q 2WXHA 1AFPA 2Y5BB 3MP9A 1MI2A 4DQOC 2R2OA 1WTXA 3PT2B 2R7DA 3APFA 2XK5B 4K3CA 2DZIA 2JXTA 2VB2X 5C4XG 1OQYA 4C2MB 1VDZA 1Q1EA 4BKGA 3M3YH 2JY6A 3VRAB 3I63C 3QO2A 4HLEA 4ZHOA 4RF0A 3BS1A 2WINB 2AKWB 1VZ6A 3TEWA 2BKFA 5EPJA 4F87A 2UXDQ 4KLKA 3DWAA 3TIXA 1E1OA 3CW2C 4BZAA 5JAVA 3ZTDA 3ML8A 4X66Q 4BAXA 1VQ6A 1FD7D 1EEFD 3Q22A 1RIPA 1RFAA 1A8VA 1VD2A 4JI2Q 4DV5L 4NXNQ 1WRIA 1C8CA 3ENEA 2A8VA 1D2BA 1NVID 4NJCA 5AZHA 1IBKQ 3I70A 1GUWA 2QDBA 5NUCA 2VUMB 1F9RA 3FVQA 2JA6B 4PYZA 3AU5A 1JORA 4Q5VA 1TWHH 3EROA 2KDBA 4F8CB 4A4IA 1W6KA 1AH9A 2NBWB 4A3IB 2WX0A 3HM6X 2KKCA 4K5WA 3SR1A 5M5YB 2KWUB 3NS1A 1YNND 4JPBW 4NAWA 2ALYB 3I72A 1JROA 3N30A 5ELOA 4BKTA 3K57A 1SNOA 4ZRKA 1JCKB 3N1XC 3CXCA 4W9LA 1ICWA 4PQXA 4IM2A 1I3QB 3K59A 1K83H 4XQNA 4JX1C 1PQSA 2NVYB 2HHHQ 1V5OA 2WYQA 3IAS1 4C7ZA 2JYOA 2H5XA 3NWSA 1QT9A 1KF6B 1QZEA 1A2UA 3APCA 4ZKBB 4HRSA 2JA9A 3J80i 3Q3NC 1R4NI 1P7FA 1PMRA 3FKIG 4ZAIA 2E2HB 3A9KA 3PUWA 4QQBX 3D8GA 1PGXA 1EYDA 2WXPA 4EZJA 1S40A 1FEHA 3SFEB 1PYBA 3Q3MC 1BUIC 4H2AA 3CHBD 4GLSC 2KMCA 1TTNA 3LXFA 1WFQA 4QL5A 1Q90A 2A1AA 2N7JA 2L76A 4MSMB 2EDGA 3TEHB 2QSDA 1V80A 3U50C 2E3TA 1YJNA 2KACA 1WD0A 3H3VI 2WGSA 2HDEA 4ZYNA 1EQQA 4AJYB 2XTIA 5FJ8G 1ZDVA 1EY5A 2NBVB 2IGHA 4HPPA 2N7DA 5HI1A 3X23A 2EPBA 3NK9A 4HJ9A 1XMQQ 3ULPA 1IHZA 4FF1A 4BOSC 2BS2B 1YD8U 1VJKA 3AECB 1TWCH 1Z9FA 1TWFH 1P9DU 3N1YC 2M8SA 3DBLI 2F3VA 1F9PA 1DOKA 1AP0A 3GS2A 1NI2A 3HS0C 4YCWA 4HIMA 2UXCQ 1VR9A 3ALBA 3VHTC 5IP7G 2ACZB 3M85A 1TU2B 2F0IA 3OMGA 2BS4B 2EKEC 2IO0B 4LNIA 5IO9A 1E7UA 4MELA 4LFCQ 4OX9Q 2F0SA 3I73A 3NZ3A 3TJPA 1TS4A 1V6EA 1TKEA 4X6AH 2ZXRA 2ZJDA 1YHBA 1XMOL 4WJ3M 1SNCA 1L5PA 2RPVA 2YVCA 1EY0A 5CV5A 4OHJA 3GTKB 4G50A 2MEKA 3FDTA 4H7BA 3Q23A 5DPTA 2QIEB 4JWSC 1YN3A 5CV9A 3NG0A 1I35A 3QAQA 1WRDB 3IL8A 4DV3Q 1E8XA 1HNXQ 2EKIA 1E10A 4NW2A 1LXDA 5EKLA 5LLIA 3CAMA 2WB1E 4R8IA 1WTOA 1S5BD 3KF8A 1VQMA 2KQ3A 4GOCA 2L0FA 2M4NA 2O2VA 3VQIA 1IPGA 5C1ZA 1QOGA 4IG7B 4EFOA 4HJ5A 2GB1A 3F2DA 3QJYA 1PGBA 4AYBG 5C4XB 4H44C 4PMCA 1FGUA 3I4NG 3HOUB 3DVGX 3M4OH 1OO9B 1FCLA 1WJNA 2KWCA 2YTVA 1B44D 1PH7A 1PHJA 4BBSG 3E9SA 4DR2L 4JG2A 1HR0Q 4KDIC 2BBCA 2IGDA 5KGUA 1WJ4A 2JT4B 3VTVA 3ZJUA 1QNUA 4LDTB 4JBWA 4FBJB 2CVRA 1SGHA 5BYSA 2G9DA 2Q8RE 2EOTA 3K80C 3APDA 4P72A 2WAQB 1ZPSA 4BY1B 5AUIA 4A90A 2R93G 1SSOA 3QIJA 1LT3D 3S16H 1F1HA 1ZDXA 4LJZC 3UDGA 2E5LQ 1L4ZB 2WXKA 2KJRA 1QE6A 2F0QA 3JSVA 1LTBD 2FUHB 1K9MC 4LF4Q 3X3NA 2QCZA 2EVBA 2AYOB 4PK1A 4GN5A 1GB1A 4JI7L 5JXVA 1EQTA 3QCAA 5G5GA 4JI0Q 2PO4A 4NQKE 2MX2A 4KY7A 3OWFA 3PQIA 2NVQB 2FCQA 2NMQA 5EDSA 2KT7A 4ULLA 4BS9A 4C4VA 3DMUA 3B9JA 3AEAB 3MHZA 4XWTA 1XCTL 2YTXA 4B3SL 3MJWA 5IYCG 1AN8A 3AYHB 3G4SA 2LGDA 2YLMA 4P75A 1GC7A 1GNUA 5IKCM 3UI2A 1ISNA 2XRSD 4IPHA 4QY7A 3Q3JA 3I4OA 1B7YB 3DHIC 1F52A 2D5GA 1KL9A 1L1OB 4JI7Q 3DUZA 1QUQA 1MHHE 1PFDA 4MH0E 1HZCA 3L7ZC 5HFYA 1QVCA 1DOIA 5KYIA 2MP2A 1JE5A 1PRTD 1SLJA 4X3TA 5DEHA 4JOIA 3VR6A 1UH6A 2IY1B 2A6ED 5EGTA 3S1QB 3AE3B 2AWTA 1KRTA 4KGSA 5C4ZA 2OEDA 2JA5B 2NVTB 2D2QA 1X65A 4WJWA 3HOZH 4TKNA 3CMMB 2RSOA 5EKIA 4JCVE 4JI1Q 5C23A 3NZSA 3G6JB 3VA5A 3ZNZB 4MJSA 1E2ZA 3UDFA 5LMNL 5ELCA 2KQSA 1T0YA 2KECA 2OJWA 1C77A 1MI0A 2BTEA 1FYCA 2BS3B 3RR5A 4FF2A 4XYOA 4KKIA 3RZWC 1YQ4B 2M1MA 3BZCA 4KI0A 2WXLA 1ZOYB 5CV4A 1ZUD2 3HOYG 5TSSA 5IOIA 1K3RA 4LLGM 1N60A 1VRAB 2N9KA 3K0XA 4DU9A 1VCBA 2IDYA 4GN3B 1GJXA 1CM9A 2KDIA 3WCQA 2K4KA 1OFFA 4X62L 2UYZB 2LXAA 3SK8A 1U4AA 4X57B 4PV1C 2FE8A 1YHAA 1YNXA 3I3TB 2HDLA 1P1AA 5FR3A 4FADA 4K5VA 3BWUD 4HPLB 3F2UA 4NB3A 3NHHA 2GBJA 4W9JA 4M0WB 3FMCA 1N8RC 3M4YA 4IUTA 1MG4A 2LUMA 1XWEA 2DJGC 1PFMA 1WYGA 3GTMH 3U8ZA 1B3QA 4NNJB 3NBIA 3H0GH 4RM8A 4APVA 4W9EA 4YY3L 2EY2A 2ZT9C 2B2WA 1D6EC 4OONA 3MZ5A 1Y1WH 3T56B 3CCUA 1RAXA 2ATWA 2GOWA 4AP4C 3GB1A 2F0VA 1RL2A 1WTRA 3NZUA 2JA8G 3TEYA 4KJOA 2VNUD 5IP4D 1PRTF 2W9NA 4HVBA 4JLCA 2KCCA 4OL7A 2LS01 2B29A 4IALA 1JR0D 2QEJC 4GNXB 3P42A 2O4XA 2RPQA 1FXTB 2PIAA 2JQOA 1C7YA 1UF0A 2JYEA 2B2YA 1XLNA 3PV0A 2F0FA 3VTWA 1HXYD 3GOEA 2QDLA 4KSLC 1C4AA 4KKJA 3F2BA 4IO9A 1GUTA 3AQQA 2BYEA 3CF5A 1I4GA 3CCMA 2UUCQ 1WD1A 5C4JH 2KFKA 4P2CB 2ES2A 3KF6B 4CHTB 4A3KB 1KFYB 3WOFA 3RLFA 4IPGA 2CKHB 2LVQA 4BBSB 3DPDA 4FXGC 3W1SC 3AEEB 1Z47A 1ET9A 3RZDB 2K5WA 1VMCA 2KQ7A 4LW1A 3RNAC 4MTNA 4ME5A 5KRUA 4OWWB 4A3LG 3HEJA 1CK1A 3CCJA 4A3EB 4L5SA 4UPAA 1R4PB 1NE3A 3T13A 4MIUA 3HM3A 2HCIA 2R3ZA 4IPDA 1VQOA 1IL2A 2K6QA 3SFDB 2GBNA 1RCVD 2R93B 4LF5L 2WQYB 4HJ7A 4K5XA 4JI6Q 2PVOD 1T6BX 3EFUA 1XEEA 2CHBD 2A6HD 1WZ3A 4HJKA 2MBBB 2BB5A 4OZCA 1I4HA 2WKDA 2PE6B 2K8CA 5KHQA 3J7A5 4A93H 2KEEA 1YN4A 4URKA 3D3RA 2CKZB 1LT5D 2RMMA 3VDZA 3WIMA 2LGXA 4B3ML 1M8AA 1M94A 2FNJB 3TBIB 2N1VA 1FPYA 2K3UA 3AU7A 2R6GA 2ZTCA 4J8QA 5GAEC 2INPE 1HQRD 2JUOA 2Z1CA 1O78A 3J81j 4ZDVA 3VYSA 4LUVA 3VH3B 1HZAA 1SJED 2WXMA 4O0AA 1K8RB 4FVMA 4YXDB 5BN3A 3J80L 4WJPA 2ID0A 1Q8KA 3NVZA 1NR2A 1MIUA 1X3FA 1WZ0A 4DR5Q 2MO0A 3L2PA 3Q3FA 4EKUA 2IX3A 2JZPA 2Z0SA 2NVUI 2VQFL 3Q3OC 1JQ4A 3RD4A 1SE9A 2BQQA 3AEDB 4KX6B 5E6JA 1SE4A 3A56A 2Z4IA 4BXXG 1EU3A 1OTRB 3RFZB 3KLSA 4TSSA 1LM8B 1S5FD 1Y1VH 1EOVA 1L1OC 2Q2HA 5KNCA 2NS5A 2WXNA 2N78A 1T3QA 2DUDA 2ICIA 4RHSA 1OXXK 1XD3B 2QC8A 1RTOA 5C4HA 5C3JB 4ANUA 3K5OA 4YTMB 5IWAQ 4I6PA 2Q2UA 1SFOB 1LTRD 3HVZA 1NYQA 1UBQA 4BY7G 3S1NB 1V9PA 3HOYB 3P7JA 1V2YA 3GQBA 1G51A 2HD5B 3O65B 2F1MA 1JOQA 1RHPA 3MVVA 4WWNA 3MHBA 5M3MH 1A2TA 1HTPA 3S9WA 5HGQA 2ZM6L 4A3GB 3M7NA 3OSOA 4A3CG 4LFBQ 2KTRB 4F7ZA 1Y8PB 3A5ZB 1C78A 1UWXA 4JGHB 4RF1A 2CWPA 1SF0A 1K3BC 3N52A 2PQAA 4YWLA 1J6QA 3DOWA 1RTNA 1GM5A 2KX0A 4PS3A 1H9SA 3GE8C 3RZFA 3L13A 5T1GA 2IX1A 4DHJD 3BZDB 1JRPA 4YWMA 2PW5A 1AZQA 2K0PA 2L83A 4EEWA 1EIYB 1XNQQ 4IWOA 4A3FG 4BBRB 1EY7A 2WHIA 1E8WA 2E2IB 4YWGG 2B2TA 3PRZA 1XTDA 4DR7Q 3HVDA 1TWGB 1WJJA 3H91A 2RSNA 4FHJA 2OWOA 4P71A 1SEBD 1OXVA 4P1BC 4DF7A 4DV2L 3NQTA 4C3HH 1Q82C 1WJ6A 4N8X1 3GTPB 2WDRB 1WFYA 2J0MA 1E7ZA 3H15A 2MQJA 3A9JA 1AZPA 2FAZA 1I6HH 4ABNA 1B3AA 1IYVA 3QQ8B 3Q8CA 1DONA 3QR8A 1R4NB 2X8XX 2G5DA 2OOBB 1MSGA 1SDFA 5H92C 3ABVB 2K50A 2HUGA 5IN7A 4LFAL 4ANXA 1XXGA 4R1JA 3LX0A 4RGTA 1Y8RC 1KDAA 3S2DB 1HTOA 1LGRA 4JBJA 2CR5A 4II3B 1XO3A 1KOTA 5G55A 5KNDA 1KNAA 2OJRA 1CKOA 1WTVA 3P63A 1HNZL 2ZW0A 1I6VC 1VQEA 1V97A 2JF5A 2OHFA 5D3DA 3S2HB 4GNXC 1Q3LA 3Q8AA 4II2B 3GE3C 3VUXA 2UU9L 5EE0A 4E6IA 2E74C 5JH5C 3SU8X 4DN4M 4DDGD 1WR1A 2NB0A 4DAYA 4TRDA 2V4IB 4KIKB 1KIXA 1YX5B 2ZCBA 3PUZA 3BVZA 3VFKA 1PXUA 1Q10A 2DGYA 1UGMA 3AV8A 1I50B 4W9KA 2DNCA 1WTWA 3GTOB 4DDID 3BJUA 3TMEA 3M4PA 3DBLB 3ONSA 3M63B 4WJQA 1V1OA 3SE0A 4CJ1B 1JOOA 1PUTA 2RHQB 4I6NB 4AWJA 2MLBA 4PZ6A 3FKIH 3GTLH 5EKKA 3A1QB 4L2YA 4K0KL 2O6VD 2KO3A 1KLUD 2WXIA 3P1HA 2WDVB 3BINA 2QMTA 4E71A 4QCLA 1TWAB 3KWVA 2DENB 1X1MA 4QIWB 3ZXVA 1D8LA 3KLRA 4AIMA 2XN9C 1NAPA 2AL3A 2EIFA 4E74A 1CZPA 1Y8OB 4ZRZA 3I3CA 3HHMA 1EQRA 1XNRL 3VTUA 1Z6HA 5K5PA 4DUYL 1N36Q 2JRIB 3S14B 2Q5WD 3AN1A 5IGCA 4A3MB 2BDOA 2ZPNA 4X64L 2SDFA 1YQBA 1LTLA 3T3OA 4GN4B 5C44H 1B70B 1C79A 3KQ4A 1K8GA 5JVG3 2PLPA 1SROA 4MM3B 4BKSD 3BG3A 4PZ7A 3T16A 5FLMG 3EA6A 3IFDA 1WXVA 4JI8Q 3TS2A 4JQWC 1NR4A 3DM1A 2C7MB 4MNOA 2EXDA 2L5TA 1JWBD 2WDTB 1BO0A 2GRIA 1KRSA 1KAWA 1X55A 3AB9A 5CV6A 5IGFA 4X3UA 4DUYQ 3K7UC 3NTHA 3ZJYC 4UDUC 2NVXB 1IYJB 1LT4D 1JMLA 3M7GA 4NJ6A 2XWBB 4AH6A 2VZAA 1CSQA 5I6WA 1WMHA 2N9PC 4R4QA 5COYA 4Y7NH 3NRZA 4O2DA 1A0IA 4IW0A 4O42A 2EZVA 5E4XA 4K7UA 1P8LA 5LL6S 1PH4A 2KDEB 3W3AA 5A35A 4AYBE 1QKZA 3BIID 3PSEB 1BCPB 4JI4L 1PH1A 1CHQD 3NTKA 3JAMi 1G6PA 3RN9C 4BBNC 5I2XA 1PA6A 1ENFA 1FXIA 4MT5A 1VQFA 4S17A 4CO7A 5A2QL 4A55A 2JP1A 5FO8B 2DLBA 1WXMA 1WGYA 2RKSA 3NXWA 1VLBA 3PF5A 2K8HA 2UUBQ 2GN5A 1D5ZC 3DVNU 3GTQH 4CJ2C 3PZ7A 3VH4B 4C3JH 3VR5A 3ML9A 5DPSA 3EC8A 2D62A 1XPOA 2SOBA 1V43A 3TRZA 1QOBA 1HEZE 3MXNA 3I4NH 2N8NA 2JJQA 5EJWA 4JI4Q 5LXIB 2ENBA 1A3UA 4XT3B 4GOPA 2N7EA 1JWAD 2B2VC 1SBBB 2CFMA 4QAYA 4K2KA 2MUYA 2DNFA 3NUCA 2M0AA 5G3LD 2FCMA 1E7PB 2B63G 2A5HA 4Y52H 3NJTA 5M5WH 2F0JA 1TS3A 3CKIB 3OIPA 4LF7L 5JHAA 1MD2D 2OTLA 4HCPB 1NNXA 5M3FH 5HKHA 2KJHB 1CKNA 1YEZA 2YU9H 2MNAA 1ACCA 4KZCA 1WVLA 2AEHA 2DYOA 2I2YA 2SNSA 4KK7A 2NPTB 1IBLL 2MJDA 2F0TA 3NP8A 2L05A 3DBRI 1NMFA 2UUAQ 1GKHA 2R7ZH 5A2QE 1YJWA 2N55A 2KJXA 3CIRB 4X65L 1N9WA 1SNQA 2FBWB 2I5HA 1QQRA 3BYTB 2VQEQ 2L0TA 3Q6BA 3RI7C 1JMCA 1S5DD 3PPAA 1ML0D 4MEMA 1UEAB 1WYDA 4F88A 4DR1Q 4E3CA 3MTSA 4K3BA 4MZ9A 3G6EA 2HE7A 3ZRCA 4LMQD 4DK0A 5IYCH 3PMFA 4FP5D 3RLOA 4PYUA 2NN6H 1N61A 1DD2A 4EZLA 2I5LX 2Z4HA 4DV6Q 4R8NA 3U2SC 2E76C 3W2DA 2AUJD 4IQZA 1NYRA 4DV0Q 3TEXA 2DHZA 3ZIMA 4JV5Q 3ETRA 1IBXA 3S1RB 2K03A 4DV7Q 3W5OA 2W55A 3AEFB 3U7DA 5AZFA 4BVUC 3ZJVA 3A0JA 5BMHA 3H3VC 4GDKA 2X6GA 3A7LA 4X66L 3PVLA 4A3BB 3T3NA 3VRBB 4JI2L 4NXNL 1IGDA 2MP1A 1AE3A 3A8JE 1BR9A 5E4WC 3Q6SA 4I6LB 1QF6A 3EIVA 1KJTA 3A9KB 1IBKL 3HOUG 2W3SA 2NN6I 4AQYQ 5G3LF 3EFXD 3TS0A 1WM3A 3FPPA 5D65A 2LGIA 1WH3A 1XQQA 4AS1A 4OIJA 1VDVA 1WGDA 3MFGA 3KUZA 3SR6A 1SJHD 4R4OA 4BWGB 5T8IA 2BVCA 3ERSX 3KUCB 2Z6KC 1OXUA 3ZRFA 1RF2D 3S17B 4DV1L 5CORA 2K39A 3Q2AC 4OWTB 2PPHA 3TUOA 5EE3A 4H13C 2R61A 3ZGZA 4CKEA 1WI0A 2WAQG 4FULA 4BY1G 4XDXA 4HWIB 1WGKA 1BBWA 1BDOA 4PMBA 5CC4A 2KXJA 1PLFA 3AEGB 3R7QA 3SDLC 2I0QA 1EFWA 3HG9A 5DNFA 5BO4B 1GPXA 2B2UA 3ZDTA 5ISRA 4CJ0B 4KHZA 2HHHL 3BK2A 3EHVA 4N6EB 4WQOB 1EOTA 5J2RA 3R3MA 3GTJH 1HR0W 4RHRA 2C5LC 1NBFC 2KLCA 1BNZA 2HJ8A 4EUTA 1CZWA 3NBHA 1DJRD 3AFPA 4PZ8A 1A6XA 3H94A 1FFUA 4HIOA 3SGIA 4DV1Q 2UU7A 3L3OC 2NCNA 3X3MA 2O6VA 4C1NK 1TT2A 4K6LA 3G7LA 1VQKA 3RN5A 2ICEC 2D3AA 3EECA 4IPCA 1PV4A 2IT1A 1EQVA 2RDHA 5LHY1 4OGQC 3WAPA 2Z0EB 2A74C 4ZQ3A 2JA8H 4HKQA 3QJZA 5GAHC 1EUJA 1OQRA 1M90C 2CH4W 3AM9A 2R92B 3J7YW 4LDTD 1PZKD 2Y0SB 1WTHA 2DN8A 4LF9Q 2K22A 1JALA 4R4CA 2CCZA 2KHSA 3PGZA 5FOBB 2EY6A 1J0GA 2V1CC 3S24A 1XMQL 3AXCA 2JA5G 1BCPC 1YZ6A 4MGYE 5C3EB 1G291 1WF9A 4A8XC 5JJIA 1CQVA 1FIQA 1FR3A 2O2VB 2L11A 2K5QA 4FYDA 1HQMC 3FILB 1UELA 4KHPL 2UXCL 2JEBI 1L6UA 4TV3A 1I5FA 3J7AF 2N9EB 4N58A 2DNEA 3AMUA 5JEAJ 2M56B 3R2TA 3ZNID 2K5HA 3CSTA 2NYZD 3OYYA 4XQJA 1YN5A 4LFCL 4OX9L 2B63B 3CD6A 3EQLC 3A4SC 4KD3A 4K2LA 3LYYA 1HNWQ 3CQZH 4QIWE 1SNMA 3JW0X 4NP5A 3ULLA 4CQNA 3DDCB 2KN4A 1LT6D 4IUQA 2BPSA 2GA4B 4ZRIA 3S1MH 2TMPA 5GQOA 3H9DA 3KW5B 1GUGA 3PO3B 1ZE3D 1FGBD 1FNWA 4LUOA 4KHPQ 1V1PA 4W9DA 1ENCA 2A69C 3IBEA 3CCEA 1K53A 4XIGS 4DV3L 1RDPD 1HNXL 5HG2A 2WS3B 1WCMH 3MAQA 3AEVA 3L9AX 1J5EQ 2DYMA 1Q46A 3RZOH 2F0LA 1XF5L 2DAJA 4HCEA 4MHEA 2AWOA 2HQLA 3VR3A 1XLPA 3U4VA 2ZW1A 1EIGA 1SXTA 4AUQC 2OQ0A 4RCNA 5H1SE 4GLXA 2LHDA 3N20C 3SK6A 5M5XH 3V6CB 1HFGA 3SVMA 3K5NA 4DNRB 4WJ4A 2MH7A 4DNTB 1STBA 5FR6A 3IAYA 3U58A 3K7AB 3DVNV 1FD6A 3DEPA 2A68C 2QA4A 2JZZA 4XX5A 4LJOB 1QG7A 2L9HA 1DCZA 2WXOA 3HOVB 4RWSC 4WQMA 1HR0L 2JQRB 1X3GA 2QILA 5E7NA 2FIFA 1CHPD 3IT4B 1K28A 2V0GA 3TQYA 1UUPA 4KD4A 3VA7A 2F0UA 1EY6A 3A8KE 1QJOA 2GVAA 1J19A 1I4QA 3ND9A 4IFDH 3VUYA 4CHKA 3MXUA 4B0EA 2JRHA 1N33Q 1EY9A 1K0RA 3EJIA 4BXXH 3N3KB 3PUVA 2K75A 3FKYA 2N49A 2I46A 3KOJA 2KMMA 2VY3A 2VB3X 2E5LL 3ZYYX 3OWEB 2F0DA 2O2LD 2XNAC 4A3KG 3CC4A 4HDOA 4LCDE 2NZOA 4XT1B 4LF4L 1YBYA 1X6OA 4XC2A 1STYA 1TIID 4POGA 2JU6X 1DOMA 1GB4A 2F0PA 3W1GA 5JJKA 1ZXTA 5IYBH 3WA0A 4K7WA 1EYCA 4DK3C 4FXKC 2BF8B 2L7RA 4JE3B 4JI0L 1V8CA 2MBOA 2G4SA 3GD7A 4BY7H 4A3EG 2IX0A 1JW9D 2PJHA 2RGFA 5HURA 2B39A 2BH2A 1T5EA 2E2JH 2PW7A 5I4DA 2VH2A 4ZRQA 1IYUA 3GV3A 2LASA 4RKLA 2D10A 1YIWA 2KMAA 1R9TH 5IYDH 4L1BA 3ZLZA 3R2IA 1VS0A 4J15A 1X3EA 3KJOA 4HEA1 1V5TA 4A3DB 4OO1G 3CSFA 1VQLA 1PVOA 1MFWA 1SN8A 1CJEA 1YNJC 1EYAA 1GHJA 2BCOA 4CKBA 3CCQA 1T5XD 3P20A 1O7YA 2AUKA 1ZGUB 5BMIA 3EUB2 1L0VB 1C9OA 2J52A 3JVZX 4KN7C 2F52A 4JYAL 4A3FH 3K6OA 1K73C 4ILWA 1RFKA 1R7SA 2LGSA 2RDBC 3H6MA 2QEXA 3IFTA 1D1IA 2KBNA 5G5HA 2P5ZX 1QOAA 1CA5A 2GBKA 3V3XA 3UDIA 5C0XH 5IGBA 2WU5B 4G0NB 1QNKA 2NTTA 3HOXH 2LMCA 3PS6A 1E1TA 3GTGB 4ME3A 4JI1L 1QLBB 3DM3A 2KOXA 1CA6A 4REZA 1J7AA 2ZTEA 3DBHI 4UP8A 4ZHPA 3OIQA 2N9XA 3I4MG 2LVPA 2Z9HA 3KUPA 1P16A 4OZAA 1DOYA 2LXKA 4DPGA 2KCTA 4F7XA 4JYAQ 4PS7A 2VS1A 3J80c 4RM9A 2O5JC 2OXPA 1R4QB 1WX9A 3HOWG 4HK2A 2YTYA 4NDXA 1KM7A 1A5RA 1ZXIA 3A5UA 2PE9A 4DWFA 1WOCA 3G48A 3AI5A 5DPWA 4J1MA 2KOLA 1MSHA 4F8MA 1A63A 1P98A 4LNNA 2PZTA 3W1SA 1PDQA 3OW7A 4RKBA 5K36H 2KTFA 1L0YB 4MN3A 2ZZPB 4LAAA 1O7ZA 4HKZE 3HKSA 3UF8A 4NMZA 2G1EA 5M9OA 2B3GA 3V60A 4A3JH 3NVYA 1F2YA 1PH8A 5ELFA 1E6EB 2KJ6A 4KVGB 3S15H 5EPLA 4A3GG 5D94A 3PO2H 5IAAC 4KV6A 1NY4A 3WDNA 3P4QB 1QZGA 1SIFA 2PTLA 2EE1A 3IFWB 2F0GA 4EQNA 2INNE 4WRDA 1JJGA 3MHSD 1GJZA 4IWPA 4K1RB 2DY8A 2FINB 5GAGC 4PG3A 4HPMB 1KC8C 4GDLB 1U4PA 3K0YA 4M1UB 2V3NA 2GI9A 1L2FA 1VQGA 4C2MH 4BBRG 3E5SA 1NJIC 2LD9A 4IDIA 1ZXHA 4LJPB 2G9HD 1F2RI 1AEXA 1EL0A 2NR2A 4K14A 2W3RA 3KDFB 2IO2B 3NS8A 1VQ9A 4MTKA 1WXAA 2V3PA 1YX6B 2YYZA 4JI5Q 4FNFA 5IODA 4LNQA 1ZW7A 2UUCL 2V1YA 2MCNB 2R7FA 1UE1A 1T0QC 2MWSB 2PQEA 1STNA 1AE2A 4DK1A 1Y69U 1B50A 1ILQA 4V0BA 2RHSB 4OZBA 5CTRC 1SNDA 3NQIA 1D4BA 2CJOA 1HZ9A 3DHQA 5FLMH 1E2VA 1C9FA 2VUMH 4DHZB 1B8AA 4DUZQ 2VXWA 4EGVA 4RGOS 4L5QA 2JA6H 3P4RB 3PRPB 2EYFA 4YT0B 2D0OA 4PNYA 1UWVA 1JJCB 4A3IH 1PTOB 2L15A 1K0SA 1U4MA 1LO5D 2EXZA 1L1OA 5M5YH 3SK5A 4JWUC 1N34Q 1IBMQ 4JI6L 2XGTA 5BYQA 2C5CA 2CQOA 2HCCA 2EYPA 3ERQA 3PUYA 1PH5A 4GIVA 2J7ZA 4A9AA 4IUUA 2K1FA 5J3BA 3ZO5B 3I56A 1QB5D 4B3RL 1VMPA 2J0TD 3NY5A 1HH2P 2LHEA 1B1ZA 1UWMA 1I3QH 3K9PB 2IHFA 2WXJA 3SDZA 1HUNA 4JOIC 3DXJC 2UXBQ 4HIDA 2NVYH 4QB4A 3NPPA 2CHZA 2PMVA 3PREA 2VH1A 1PH9A 1HZ6A 4B08A 5IGDA 4P16A 2LJIA 1TYGB 1S1QB 1FJGQ 2GLSA 3URYA 1GVPA 3K8AA 2IO3B 3Q8BA 2KAJA 2JA7B 2C60A 2E2HH 3UQAA 3DBRB 1EWIA 1GHKA 4NKLA 4B3RQ 4RGMA 3QOJA 1YNNC 3J9CA 5IT9L 2XRQD 2GMIC 2PW9A 4DR5L 5IOCA 3OW2A 3B0AA 1LQBA 4GLAC 2MHJA 1BUVT 1J9OA 4WURA 3PUXA 3AE1B 3RD2A 4N59A 4GKJL 2KYWA 4DV4Q 3RCZA 1ONLA 1VF5C 5JVH3 4TKOB 4HJGE 1Y8NB 3I90A 5D7GA 2OTJA 1TXYA 4M0WA 3TSSA 4A3MG 1BOSA 1IL8A 1DZ1A 3VAWA 3W5VB 1VQAA 1YIJA 1C4QA 1TR5A 1H8CA 5IWAL 2K52A 5IA7A 3I4MB 3TBLD 4LK1C 3PIOA 4FJZA 4C3IG 2EJMA 4B6WA 5FLXL 1SR3A 4IJHA 2K14A 1NDDA 1IKMA 1LTSD 3MC9A 3HOWB 2LKVA 2L55A 3MXPA 5C3WA 4GKJQ 1HTLD 4U68A 2RVLA 1TZ1A 4XTCS 3WWVA 3IVFA 4LFBL 3TN2A 2L12A 1P3QU 1SE2A 2OF1A 2B3AA 1WTQA 2Y3AA 5EAYA 4QJFA 1F2LA 1KD1C 5IP9H 3KUDB 4JK1C 4B3TL 2D9UA 3GTKH 1XNQL 2KFJA 4JI3Q 3N32A 1W3SA 5AZGA 2B2YC 3SXHA 3CU7A 3NELA 4RH6A 2J7QB 1Q81C 1P7EA 1JRUA 3KF6A 4IUVA 1IXRA 4I7AA 4GXBA 4US9A 2PZWA 4DR7L 1Q7YC 3M3YB 1EO6A 4DR4Q 3J80E 3H7PB 2KDFB 4JBMA 1ROEA 2PPBC 4YSXB 2M17A 3PV1A 4TMAB 3ZNGC 4B0MA 4DBGA 3CC7A 5KNBA 4R4TA 4B3TQ 2WAQE 1SYGA 3KYDD 5C4XH 3QX1A 3HOUH 2NBUA 4EQPA 1SRUA 2RQXA 2MFIA 3LNNA 2XSCA 4RMAA 1KTKA 2IWHA 2RF4A 1HA5A 2LVOA 4YTNB 5KYLA 1RYJA 4OVVA 1QOHA 1A70A 3D6CA 3VVWB 5GXGB 2G4DB 2RCFA 4NQLB 3KBGA 4FF3A 3MEFA 1N5WA 1WM2A 1XCQL 4MGZE 1TWHB 3KVFB 2FIDA 4BY1H 4XQQA 1R4MI 3VXWA 4L8JA 4HSVA 1RODA 2EMSA 4RMFA 3U30A 1BCPD 4A75A 2JXXA 4IKGA 2Z8LA 2AWNA 2KZRA 3KYCD 2MQHA 5TR5A 2SEBD 3TCAA 1F2MA 1IUEA 1NSNS 2N3SA 3C8YA 2ASQA 5C2TB 3X0WA 2CU1A 5D6JB 3R66C 1K83B 2IHEA 4HEDA 1PH6A 2BYVE 2JYTA 5CHVC 2NVQH 2I1KA 1LTGD 5I6YA 1J7BA 4WAFA 5KIXA 1L4DB 5FO7B 3TP8A 1DM0B 1C3TA 4A3OA 1I94Q 1YJ1A 2KVMA 4QMGA 4KV2A 3DBSA 4FA6A 2XEWA 2K5VA 2A4ZA 3FP9A 3BU2A 4IOCA 1PTOC 2F3IA 4EX5A 2FCSA 2DZMA 4L6TB 3DWQA 1CSPA 4HR7B 2R2QA 3HOZG 2WXFA 2LI5A 3FC4A 1N36L 1WWTA 2C9WB 4YCUA 3AEBB 3UGBB 1TBEA 1VQNA 4LF8Q 3S1QH 4A3BG 2HIVA 2ZJPA 3N6RA 2BYTA 3I8ZA 2Q2IA 4DAPA 2K6AA 1EM7A 4W9FA 4HMIA 5C6AA 2JA5H 5KHOA 2NVTH 1SYBA 2HIXA 4ITKA 3RUIB 4JI8L 3CPWA 3QOLA 3RPFC 2EQSA 1VQDA 4DNIA 1F9QA 4HAEA 4WJOA 2B2VA 4R9WA 2BB6A 3LB8C 2A68D 5FO9B 3KJPA 1TWCB 1TWFB 2OT2A 2YEPB 3AE7B 2KLGA 3HUIA 1JOKA 4GOPB 5FJ8H 5LL6X 2XBBC 1PYSB 3B08A 1DYQA 1IGCA 1H9JA 1QVGA 5H8YE 3UIPB 1F2ZA 2WXRA 3QK0A 1B53A 2PNRC 2PI2A 5JJZA 1G8ZD 4AJWA 4RFBA 1XPUA 1SIJA 4IZ8A 2LUEA 4C3IB 3PRMB 1N32Q 1QCBD 2NWGA 4P6VF 5ELEA 2D0PA 1E2WA 4U673 5DLQE 1N6ZA 3H0GG 2FHTA 1BMLC 3F2CA 1E5WA 2DJFC 4DFAA 1YQ3B 4G4KA 5IP7H 3I7FA 1T0SC 3PIP3 5JEAG 3PIPA 1TGZB 2BA0A 2CJNA 3V62A 4PS8A 3L08A 2UUBL 4G7HC 1K52A 4H0LC 4CDDC 2ON8A 3TMPB 1IW7C 2JWZA 5EE1A 1I4RA 5F2DA 3GZNI 1BXTA 4CDCC 4TQ1A 3I5JC 1JE4A 3RULA 4I7ZC 3Q8EA 1K8AC 1F9JA 1B9MA 2EYMA 5IY0A 3FRPB 5EE9A 2F0EA 3T1HL 4GSWA 1ZKOA 4KTAA 1U9RA 4IM3A 1X56A 1O7LA 2MBQA 4KZ0A 2D5DA 3L4PA 4L23A 3GO5A 2R92G 1YNJD 4HIKA 1PDXA 3EFCA 3NVVA 2MPMA 2Y0SG 4CBVA 3DHGC 3VUWA 3KK7A 3M4OB 1STAA 1EEID 2F0NA 2GVBA 2BGFA 5CX3A 4BA2I 5J39A 3BDLA 4A3PA 3HKZG 2JSVX 4IOIE 1SMYC 2D11A 2PCFB 2KX3A 2WB1B 3HFZB 5C3EG 3K58A 2EMTA 5J22A 2BE5C 4GDKB 2JVCA 3PZDA 3RUZA 4CKCA 2DYBA 3W5UB 3E0EA 1ZEQX 3T1HQ 4A3KH 1NMGA 5C5LA 3AE4B 3SD5A 4BBSH 1X3QA 3QIAA 1D5XC 3QG1A 2UUAL 2HTME 3A1QA 3D31A 2K6DB 2HD3A 4IM0A 4TQ0A 3RZDH 1H9RA 5CR3A 3S16B 1E8YA 3ZQ4A 4J6IA 2Z6KA 3E6ZX 1D1KA 1EWCA 2D3CA 1UE5A 3I9V1 4ZRJA 4A3EH 3NE5B 2F3WA 2VQEL 4XYQA 3DBHB 1DOLA 1EUVB 1VCIA 4LUZA 1H4RA 4EQOA 4A93G 4DR1L 2K1BA 2BWFA 1WTPA 2R93H 3CRLC 3OHXC 1U5KA 2V4DA 1I4PA 3MWYW 1YMHE 3IG3A 1HTQA 3E56A 3SHLA 3PO3G 4OO1H 3NOBA 4DV6L 3ULJA 3KWLA 2VZKB 4DV0L 2EJGC 3PF4A 2F4IA 5I9PA 3RNEC 3AE5B 1HZBA 4JV5L 2L32A 4P73A 3VYTA 4DV7L 1TJEA 1VQBA 2EELA 2J42A 2MRPA 2H89B 2OCEA 3Q0AA 3DHHC 1NTGA 4K6DA 4G57A 2KWVB 2C7HA 4NAWB 3RMKC 1CFMA 1SAPA 1UNSA 5MPOA 4WAAA 4AQYL 1FO4A 2PMZB 1KXLA 4MACA 3J7AV 4KN4C 1G2TA 3T1YL 2MBHA 3HOVG 4W9CA 3V6EB 1FFVA 3BZKA 2LFNA 2LSSA 1JJ2A 1HCZA 2JE6I 1PGAA 1W6JA 3HOZB 3UI3A 1Y1VG 2ZJQA 1KNEA 1O80A 2AQ1B 2I1JA 4XDDA 3PO0A 5ELDA 3B1LX 3ZJTA 1JWSD 1EYGA 1HZ5A 1Z7TA 3R93A 1O7IA 4OXPA 4B9WA 2OQKA 3NTIA 4KKUA 4LNOA 4ZOHC 2BKRB 1L0WA 2J0KA 3O13A 3A7AB 3C1EA 1OEYA 4DR3L 3T1YQ 4W9IA 5AFWA 4WH4A 5JHBA 3B6YA 3M9BA 5GROA 1Y14B 4H02A 1M1KC 2K01A 1RLFA 1SFOH 3K5MA 4YIJA 1DGSA 3J81i 5L95C 3KLSX 3S1NH 2XIWA 1UGJA 4OIKA 2AX5A 4KDLB 4YSYB 3HOYH 1HA6A 1C4PA 2PI2E 3ECIA 5BYRA 2MGSA 4A3GH 4S3SA 1E24A 1VQ7A 4A3DG 1E8ZA 2C35B 3GTMB 3OTOQ 4DR3Q 3KFUA 1KLVA 5IE8A 4GOPC 3H0GB 1B4OA 2EYLA 4R4IA 3RNGC 4OW0A 1Y1WB 5JJLA 1GUNA 1VQIA 1A15A 1V1PB 4N9TA 3T53B 4BBRH 1CQFA 1T9HA 4LF9L 1FCCC 1MG8A 2E2IH 2D3BA 4C3HG 4MDKE 1PH3A 4IOAA 1GG3A 4D2KA 3CCVA 3N9YC 2NPTA 1TY2A 3QWZB 2O5IC 1TWGH 2IZVB 3OPOA 2B8GA 3TP5A 1CUKA 2X6LA 4ZYSA 2QHOA 3WALA 1TS2A 4GKKL 2KVRA 1U0LA 2LZ6A 5C3XA 2CH4A 3U4EG 4YSZB 3GTPH 5EBDA 1EWYC 1ZYRC 1YOVB 3PLVA 1A3VA 3JC66 3UDXA 3JAMc 3HIZA 5C4JB 2F0OA 5M3FG 3ZW3A 4IUMB 2W82A 3LGJA 4BKSA 1HNWL 3HKZB 5DAUA 4DV5Q 2K8BA 1YJIA 3S2DH 1WX7A 1MHXA 2ZXPA 3KF8B 4WWOA 4FXCA 2BT6A 2INCC 4A6QA 4WORA 3VR4A 2K25A 2EY5A 4GKKQ 4ZUJA 2L8JA 4KMUC 3ZDMC 4HJAA 2QCPX 3S2HH 4JW0A 2B76B 3VR8B 3ONAB 1JT8A 1CMXB 1UBIA 1OXSC 1NI3A 2M9VA 2KC1A 3DQVA 1QOFA 3H3VH 2XK5A 1E90A 2QKIC 1J5EL 2N0SB 5KEEA 1ASZA 4A3LH 4PMWA 1UAPA 2QDFA 3P4SB 2Z0DB 1H95A 3NENA 3TREA 4USAA 3BVMA 2K28A 2KVZA 5E6OA 5L37A 1I50H 2Q8IB 3D0FA 3GTOH 4A93B 3STBC 2IY5B 4RGNA 2C7NB 2V3SA 4K7SA 1SYCA 3R7RA 3GP7A 2ONQA 2NTSA 2AQ3B 3PGEA 2MBEA 1B9RA 3HK0A 3F1ZA 2ZTDA 2CW0C 1UD7A 3ND8A 3P4PB 1WX8A 2WNMA 3D4DA 2EJFC 3K81C 5CBAE 4ALPA 4AQ7A 3DCGA 3L0OA 1SMXA 3JSVB 1TWAH 5ELNA 2JXMB 1JQYD 3RNUA 3C19A 3V2TA 1KDCA 5AUKA 5C44G 1D7QA 2MA9B 2LEKA 1N33L 4KY6A 2LWPA 4UAIA 1WI5A 4KJNA 3U9OA 3HGBA 2FCNA 3NUHB 2CWAA 4C1NI 1GAQB 2QF7A 3S14H 4C4VB 4A3MH 1K8MA 3C2PA 2B2UC 2Z59B 2PYKA 3TZUA 3I57A 1E22A 3VYUA 1HRJA 2E8GA 4ODGA 4QUFA 4UY8C 1C48A 1GUSA 2LMCB 2LXCA 1HJPA 5HY6A 1Z2MA 1NENB 3OJ3A 2WKCA 1Y1VB 2EY1A 1FRDA 2J53A 4C3IH 1L6VA 2FUG1 2H88B 3WANA 5J18A 1YI2A 2ZPYA 3KYHC 1QUQB 3L54A 4P74A 1LTTD 4DK5A 1TS5A 4I65A 3RNFC 2WIIB 4IN3A 4J6HA 2DBYA 2MP2B 2RCNA 1CT1D 3C0RB 1T0RC 1EU4A 3R3OA 4JIOU 1K8OA 4IURA 1WXQA 4EE2A 3TEZA 2NVXH 2WWZA 2MJEA 2CHWA 5LMNW 5M3MB 1GC6A 4IJLA 3V05A 4HJ8A 1HE8A 4OEMB 4MJSB 1ET6A 2KCNA 2K32A 5IGEA 1P0RA 2L1AA 1FL0A 1GUAB 2L1BA 4KKSA 2D3GA 4Z9CB 5CHWA 3J81c 4C3JG 1SYEA 1VQ4A 1XMOQ 3P75A 4IFDI 2KUMA 1F2RC 1R4MB 3FILA 4JPSA 4QUCA 4YHHL 5ELBA 1YITA 1N63A 3E3XA 3MC0B 3U9SA 4A3CH 1BT0A 3ZTCA 1II3A 2N1WA 1SYFA 2BOSA 1U4LA 2JA7G 5EPKA 3DLLA 3DWPA 1WGGA 3AMZA 1KABA 1J8IA 4YTPB 1V81A 3W1YA 3TDQA 1U4RA 4LF6L 1Z5SB 1XTCD 3MC8A 4HXDA 3U4ZA 2L0CA 1LFDA 3IKJA 4ZUIA 1WSPA 3AH7A 4HCSA 4XXEA 2L00B 4J3OD 4C3HB 1X3PA 4X3KA 4JBKA 3BK1A 2BH8A 3A54A 1PTOD 4UP7A 3W1BA 1GOZA 1PFSA 5IT9c 5BN4A 1A3TA 1QILA 2JEAI 2B8FA 1FVIA 2TSSA 4YHHQ 1I6HB 4RNAA 4UHVA 2W54A 2NUCA 3JAML 3FHWA 1STHA 3CC2A 1VZ7A 2M0XA 2AMCB 3LJ3A 4KSKC 3UIOB 4XWWA 2KDMA 4DR6L 3PHWB 4DR2Q 2ZNVB 4LF6Q 2R7ZG 1MGSA 2X69A 4B95A 4G11A 1H9KA 1YJ9A 2WV6D 1VQHA 1WE6A 1G6JA 1G91A 3MEHA 4DXGA 1E3PA 4XDCA 3M3JA 2PMZE 4ZRPA 4IUNA 1DXMA 5C0XI 5FLXc 5G2NA 2F0KA 2NN6G 3U52E 4FJYA 4WJNA 4DR6Q 1RM6C 3VR9B 4BA1I 2KANA 4G3XB 3KH0A 1TKYA 2ZXOA 1WJUA 2KFKB 2LJ5A 4RA8A 3RT3B 2X38A 2I07B 3ICEA 5LMUL 4Q0FA 2BWES 3AU4A 4NXML 3MJ5A 3NHEB 4L5TA 5E6NA 2RDFA 3AE9B 3FKIB 3GTLB 1L0XB 2KNBA 2DY7A 1GO3E 1W2BA 1XT9B 4B3SQ 2RD0A 4JI5L 3JAME 4OVZA 3S1RH 1PZJD 3DVGY 1PFBA 3R8BA 1WR6E 1J8CA 4LWCA 4CDEC 3QA8A 1EF5A 5DPRA 4A3BH 5T1IA 1AW7A 5BR8L 2K5PA 2LGYA 3I4LA 2F0HA 2I38A 2KQ4X 4ACFA 3M62B 2GBMA 3Q69A 1PTOF 1IW7D 1ILPA 1OQQA 5LMUQ 2OEOA 4NXMQ 2JWUA 2KEDA 4GS3A 4BOZB 2G3QB 1PYWD 4ICUA 4DUZL 4QGUA 2A19A 3VDYA 5C44B 3E9IA 1ESFA 1D5MC 3GZNB 3AE6B 1XX8A 4WWMA 1EZ6A 1KAAA 1F9SA 1LLRD 1UEBA 4K8IA 2RR9A 4M01A 4TUUA 3FAHA 3H8HA 2LFIA 4B9XA 1N34L 1IBML 4LNKA 3S17H 1YHQA 4IC7B 2HT1A 3FPUB 2IJ0A 4RCOA 5BR8Q 3VYRA 5LMNQ 1YNTE 2WU2B 1RD9D 2EYHA 1UE7A 2NBFA 2CQAA 1SMYD 2ZEQA 3Q8FA 3E9HA 1KRHA 1WIAA 3OAWA 2BE5D 2JPHA 4KHVA 4KGTA 1FXAA 3F8TA 1OGWA 1X54A 4F1SA 2UXBL 4ARIA 4K8JA 1HHVA 5L83A 4Y7NB 1Q1BA 4QF4A 4X62Q 4W9HA 3OLMD 1FJGL 4IUPA 1KHIA 3UQBA 2FXQA 4M8MA 2KWDA 2Y0SE 5JEAH 2ASBA 3IRBA 2RA4A 2PVGC 4CDFC 2DZKA 2REXA 2IBIB 1KQSA 2A5UA 1KLGD 3J81L 3HKZE 1QZHA 1E9MA 4GGQA 4DXAB 3RN2A 5D3IB 3HP3A 3ITPA 3OMCA 1G6ZA 4MGKE 5CHFA 5JPNC 1EY4A 2KD0A 3GTQB 4ANWA 1TIFA 1E0ZA 1LABA 1RJTA 4C3JB 4YY3Q 3PZ8A 1E7VA 2R92H 4DV4L 4WWPA 1BKBA 2E2DC 3MA2B 1NUCA 3A55A 4AYBB 4X3SA 2FMMA 3PTFC 3I4NB 3A4RA 4JC0A 4ANVA 3PSIA 2H1EA 3Q14C 4M8NA 4MSQB 1WYWB 4C80A 3T4AC 1V49A 2Z6BA 2YV5A 2IGGA 2AL6A 1GXDC 4ZCKA 1Y56A 2XVSA 5C3EH 1CKMA 2LRUA 2V4LA 4HMJA 4HTHA 2PQAB 3D4WA 5JPMC 3H09A 1H9SB 4BBNF 5M5WB 2VW9A 4N9PA 2I5MX 2M19A 3BDCA 1IKLA 1PRTB 5M3FB 3FEWX 2K5NA 1IYFA 2YU9B 1JWUD 1LUZA 1MKHA 1PH2A 1MPEA 4GDLA 3UE1A 1MJEA 2Q2TA 2HDMA 5HHDG 2B63H 3KBXA 1F0ZA 5GADC 3J81E 1ZKHA 3B2GA 3IHPC 3W9CB 4ZK9B 2R7ZB 5DM73 1S3SG 2KK8A 1WCMG 2C9OA 1Q5WB 4CGYB 3KDFA 1BF4A 3PIO3 5D14A 1AYFA 5BN5A 3EBEA 4JI3L 3KLWA 3PO3H 3A9JB 3L16A 2NZHA 3CPFA 2WXQA 2NZ1D 1XPRA 2QJLA 3M4QA 1BBUA 1VQPA 1JC7A 5D2MB 2B2WC 2LY7A 1RWSA 1XLOA 2ZVNA 3UINB 2ZNVC 4LF5Q 4DXFA 2KC2A 1S5CD 4DR4L 1XLQA 2LRWA 4LK0M 1EY8A 1EFID 4GNXA 5GMVA 4NZLB 2ZJRA 2WACA 4PT5A 2J0JA 5IT9E 1TZOA 1UZXB 1ZP0B 3L17A 1S5ED 4RAUC 4A76A 1CTMA 1HPCA 2F03A 5FK9C 1LTAD 1FMAD 2Q8TA 4W9GA 1N62A 4FJVB 5BMGA 2WX1A 4B3MQ 4EOYA 4XE0A 3K7AH 4L5RC 3QHTA 4DGZA 4IFDG 2K04A 2E6XA 4DAYB 2L3ZA 3HOVH 4K81A 1Q1OA 1JICA 2AQ2B 2J4XA 4EVOA 5C5MA 4YL8A 2DX5B 1GD7A 5DCNA 1AARA 4GMVA 5IGGA 2XWJB 1OTCA 1SE3A 3NWTA 4FXDA 2WLBA 1D3ZA 4NY0A 1MHWC 2FMCA 3AE2B 4HN7A 1S3OA 1V8QA 3ZUNA 1I42A 4XZ4A 2WB1G 2RSUA 1WGHA 3TZDA 5IYBG 4ICVA 5FLXE 2ZVOA 3P1MA 2IL8A 1YJJA 1FM0D 3T8MA 4R3DA 2JZ3B 2K05A 1CI3M 2Y5PA 2BW2A 2VQFQ 3DEOA 5I9OA 2HQEA 4KGRA 2N4FA 2MJ3A 3QARA 1TKGA 2JSOA 3CRKC 2INDC 4KKTA 2HTHA 1MJDA 1RRBA 3PCOB 5IYDG 1XJVA 1ASYA 2G45B 1QWYA 1B9NA 1ZYRD 4GLVB 3ZVVA 1IP9A 3QC8B 2IW3A 3RMHA 1FRRA 2DZJA 4WFN3 1HUMA 1EIHA 3QB3A 3GTJB 3BYYB 2PNHA 3CF6E 3CWIA 1I4XA 1LYLA 5CMDA 1I94L 4DKAC 4JVZA 4A3DH 3S2AA 1WE7A 3A8IE 1PFNA 2LXJA 2FFKB 1QVFA 3NVWA 4HSPA 2Y5CA 2K5DA 2KHIA 3I55A 5C0XG 2ZM6Q 1X32A 2AHOB 1YVCA 2BA1A 2IY0B 1KDBA 3HOXG 2GBRA 3JYUA 3TP7A 3K9OB 4BFRA 2CHXA 3LDZE 3K5LA 2JA8B 2D07B 4LF8L 1Q12A 3ZNHB 1X9NA 2EYOA 2VRRB 1BVSA 4M8AA 5AJ3L 1MBYA 1K50A 4YWKA 2YEPF 3RNCC 3IT6B 3STBD 3GTGH 4V190 1SSNA 1WMHB 2RBMA 3LWUA 2L52A 1H9MA 4ASWC 4OELB 2CW0D 2VL6A 2A69D 3WAOA 1TY0A 3G71A 3AULA 3M95A 2MHVA 4A20A 2L4NA 4FN2A 3A74A 3C1FA 3CMEA 2KN5A 1STEA 5EBCA 1V1QA 5I2YA 3AFQA 4DV2Q 1LV9A 3B2FA 4GN1A 2M00A 1CZGA 3V96A 3MFYA 2MW5A 4CYEA 3OJ4B 4L63B 3RYTA 3ZKJC 5K36G 2KHWB 3WOEA 2DWQA 4WIPA 5AJ3Q 1WXSA 4TVAB 1BBXC 3N1ZC 3T51B 3EGRA 4NPSA 1L2NA 4GZYC 2KTRA 1N32L 4A3JG 4LFAQ 1TQOA 4ZLTF 3CCRA 2VZKD 3RNBC 3CQZB 2BDNA 1RKNA 3H7PA 4US8A 3PO2G 3MXNB 3S1MB 2RDGA 3GV6A 3TP6A 1HNZQ 5JZEB 3H7SA 5J17A 2PKOA 1OXTA 1MJCA 3BVGA 1ENAA 5JOBA 2IPKD 1BCPF 1DOXA 1J7CA 3Q8DA 2UU9Q 4EQ5A 3H1UA 2K9XA 2CU3A 3WAMA 1PRTC 1WCMB 4KY5A 4NAMA 5AEKB 1JB3A 2A6EC 4P7IA 3RZOB 4LNFA 4ARCA 1PZID 1SE8A 1GUOA 2B2TC 3AE8B 3CCLA 1CKNB 4FLHA 2F0MA 1DGJA 2K7VA 2SAKA 1Y1WG 1AWDA 5DM63 3IAM1 4N9F4 5M5XB 3T9LA 4XGAB 3SHQA 4YCVA 3EVQA 3QWNA 3H6NA 2H4OA 2KCMA 5J1ZA 5CV7A 1V9JA 4K0KQ 1S4ZA 3NEMA 1LTID 4DHZE 1VQJA 5E1FA 2WDQB 2M2LA 3MTNB 4IWQA 3HRZC 4DHJB 2VUMG 1VQ5A 1LACA 2QW7A 3RLNA 2WFWA 1E0BA 3CCSA 2F4VL 3J7ZC 4AOFA 1SYDA 4LTUA 4RG1A 3SK4A 1L7YA 1EIFA 1XYIA 2JA6G 2KENA 3HRDD 3L10B 4DAMA 2SNMA 3D6WA 4A3IG 4FF4A 1XNRQ 1K51A 2IYDB 3D32A 3V61A 1G2SA 4UP9A 3D4RA 4GU2A 4X64Q 2PZUA 4KIKA 1IBXB 1MVKA 4G7ZC 2N9LA 2MJ8A 4HCNB 4HDQA 1BQQT 4GB9A 4M02A 1ESRA 1EF1A 3Q24A 1PTOH 2HJ1A 1STGA 4TQUS 4N8FA 4XYCA 4DK6C 2F4VQ 3ZXRA 2N88A 4BY7B 1I7HA 1ICFB 4DAVA 2E2JB 2D2CC 2KHJA 4FHKA 5CBEE 2ZCCA 2K33A 4Q2JA 2A73B 1R9TB 2E75C 4DA2A 3CP0A 4FO2A 4C7YA 4HROA 1LM0A 1N5XA 2EYJA 3PHXB 1Q8IA 2BYFA 4O1NA 2KA7A 3VR2A 1S72A 1V86A 4ZKCB 1VF7A 3C3LA 3I91A 1Q0WB 2FJ2A 3LWEA 3C46A 4A3FB 2WP9B 4POFA 4IFDJ 2JA7H 4OWXB 4S0RA 3GDEA 2IO1B 3AB5A 5E6PA 1M4VA 5CGKA 3P2BA 3OOCA 3EN2A 5LNK1 1C0AA 2MSED 3BDOA 2MO1A 3E0JA 3HOXB 3UE0A 4MM3A 4C56C 1JB7A 1FNVA 3IXSA 3ER0A 3TL5A 1WY8A 1TT5B 3NSWA 1JWMD 4EZKA 3NBHB 5CYUA 3U7ZA 5EQ0A 1EWHA 1VQCA 1VQ8A 1C1YB 5IIFA 2DAFA 2O6VB 3HZXA 1C4CA 2JX5A 3L0WB 5FKAC 4OO1I 3OG5A 4M00A 1A62A 3SEBA 4MH8A 3DWMA 4OVUA 4P1CC 2JK8A 1OEYJ 1NCVA 2WP8J 5CV8A 1IZ6A 3I4MH 3I2ZA 1SB3C 2JN4A 2A6HC 1TVXA 2F0WA 3CMAA 1Q86C 2WXGA 3DWGC 4NJ7A 1HFNA 2PEAA 1NBWA 5LXHA 4LF7Q 3MXGA 3HOWH 1EZ8A 1TKWB 1VZ8A 3PLUA 1SNPA 4ID6A 5IP9G 1NEKB 4NPNA 1B2TA 1WGRA 2UWQA 4G7OC 1UE6A 1KH0A 4A3JB 5E3FA 3BY4B 1IBLQ 1C76A 3OTOL 4MGIE 4JL9A 5C0XJ 1F77A 2CS4A 5M3MG 3S15B 3A33B 4B9KA 3PO2B
chains in the Genus database with same CATH topology
5HGTA 1FNUA 2WXHA 1AFPA 3MP9A 1MI2A 1WTXA 2JXTA 2VB2X 4C2MB 1VDZA 1Q1EA 3VRAB 3QO2A 4ZHOA 4RF0A 3BS1A 2WINB 1VZ6A 3TEWA 5EPJA 4F87A 3DWAA 5JAVA 1FD7D 1EEFD 3Q22A 1WRIA 1C8CA 1D2BA 1NVID 4NJCA 3I70A 1GUWA 2QDBA 5NUCA 2VUMB 1F9RA 3FVQA 2JA6B 1JORA 4Q5VA 3EROA 1W6KA 4A3IB 4K5WA 3SR1A 5M5YB 3NS1A 1YNND 3I72A 1JROA 3K57A 1SNOA 1JCKB 1ICWA 4PQXA 1I3QB 3K59A 4XQNA 4JX1C 2NVYB 3IAS1 4C7ZA 2JYOA 3NWSA 1QT9A 1KF6B 1A2UA 4ZKBB 4HRSA 1P7FA 1PMRA 4ZAIA 2E2HB 3PUWA 3D8GA 1PGXA 1EYDA 2WXPA 3SFEB 1FEHA 1BUIC 3CHBD 4GLSC 3LXFA 1Q90A 2N7JA 2EDGA 2QSDA 2E3TA 2KACA 1WD0A 2HDEA 1ZDVA 1EY5A 2IGHA 5HI1A 2EPBA 3NK9A 1IHZA 4FF1A 2BS2B 1VJKA 3AECB 2F3VA 1F9PA 1DOKA 1AP0A 3GS2A 3HS0C 1VR9A 2ACZB 3M85A 1TU2B 2F0IA 3OMGA 2BS4B 2F0SA 3I73A 3NZ3A 1TS4A 1TKEA 2ZXRA 1SNCA 1L5PA 2RPVA 1EY0A 5CV5A 4OHJA 3GTKB 2MEKA 3FDTA 4H7BA 3Q23A 2QIEB 4JWSC 1YN3A 5CV9A 3IL8A 2EKIA 1E10A 4NW2A 5EKLA 4R8IA 1WTOA 1S5BD 3KF8A 2KQ3A 3VQIA 1QOGA 2GB1A 3QJYA 1PGBA 5C4XB 4H44C 4PMCA 3HOUB 1OO9B 1FCLA 1B44D 3E9SA 2BBCA 2IGDA 5KGUA 3ZJUA 1QNUA 4JBWA 2CVRA 5BYSA 2G9DA 2Q8RE 2EOTA 2WAQB 1ZPSA 4BY1B 5AUIA 1SSOA 1LT3D 1ZDXA 4LJZC 1L4ZB 2WXKA 1QE6A 2F0QA 1LTBD 3X3NA 2EVBA 1GB1A 5JXVA 1EQTA 5G5GA 2PO4A 4KY7A 3OWFA 2NVQB 2NMQA 4ULLA 4BS9A 3DMUA 3B9JA 3AEAB 3MHZA 4XWTA 1XCTL 1AN8A 3UI2A 2XRSD 2D5GA 1MHHE 1PFDA 3DUZA 5HFYA 3L7ZC 1DOIA 5KYIA 1PRTD 4X3TA 5DEHA 3VR6A 3AE3B 2A6ED 5EGTA 3S1QB 4KGSA 5C4ZA 2OEDA 2JA5B 2NVTB 4WJWA 2RSOA 5EKIA 3G6JB 3VA5A 1E2ZA 5ELCA 2KECA 1C77A 1MI0A 2BTEA 1FYCA 2BS3B 4FF2A 4KKIA 4XYOA 1YQ4B 4KI0A 2WXLA 1ZOYB 5CV4A 1ZUD2 5TSSA 4LLGM 1N60A 1VRAB 2N9KA 4DU9A 2IDYA 1GJXA 1CM9A 3WCQA 1OFFA 3SK8A 4PV1C 2FE8A 2HDLA 5FR3A 4K5VA 3BWUD 3F2UA 3NHHA 3FMCA 3M4YA 4IUTA 2LUMA 1XWEA 1PFMA 1WYGA 3NBIA 2EY2A 2ZT9C 2B2WA 1D6EC 3MZ5A 3T56B 3GB1A 2F0VA 1WTRA 3TEYA 4KJOA 2VNUD 1PRTF 2KCCA 4OL7A 2LS01 4IALA 1JR0D 2QEJC 3P42A 2O4XA 2PIAA 2JYEA 2B2YA 1XLNA 3PV0A 2F0FA 1HXYD 1C4AA 4KKJA 1GUTA 1I4GA 1WD1A 4P2CB 4CHTB 4A3KB 1KFYB 3WOFA 3RLFA 4BBSB 4FXGC 3AEEB 1Z47A 1ET9A 3RZDB 2K5WA 1VMCA 4ME5A 5KRUA 3HEJA 1CK1A 4A3EB 1R4PB 3T13A 4MIUA 2HCIA 2R3ZA 3SFDB 1RCVD 2R93B 2WQYB 4K5XA 2PVOD 1T6BX 1XEEA 2CHBD 2A6HD 2BB5A 4OZCA 1I4HA 2WKDA 2KEEA 1YN4A 3D3RA 2RMMA 1LT5D 1M8AA 3TBIB 2K3UA 3AU7A 2R6GA 4J8QA 2INPE 1HQRD 2Z1CA 1O78A 3VYSA 1SJED 2WXMA 4FVMA 4YXDB 5BN3A 3J80L 2ID0A 3NVZA 1NR2A 2IX3A 2JZPA 1JQ4A 3RD4A 3AEDB 4KX6B 5E6JA 1SE4A 3A56A 2Z4IA 1EU3A 3RFZB 3KLSA 4TSSA 1S5FD 5KNCA 2WXNA 2ICIA 4RHSA 1OXXK 1RTOA 5C4HA 5C3JB 3K5OA 4YTMB 1SFOB 1LTRD 3HVZA 1NYQA 3S1NB 3HOYB 3P7JA 3GQBA 2F1MA 1JOQA 1RHPA 3MVVA 3MHBA 1A2TA 1HTPA 3S9WA 4A3GB 3M7NA 3OSOA 1Y8PB 1C78A 1UWXA 4RF1A 1SF0A 3N52A 1RTNA 1H9SA 5T1GA 2IX1A 3BZDB 1JRPA 2K0PA 2PW5A 1AZQA 2L83A 4BBRB 1EY7A 2E2IB 4YWGG 2B2TA 3HVDA 1TWGB 3H91A 2RSNA 1SEBD 1OXVA 4DF7A 3NQTA 3GTPB 2WDRB 1AZPA 4ABNA 1B3AA 1IYVA 3Q8CA 1DONA 1MSGA 1SDFA 5H92C 3ABVB 2HUGA 1XXGA 4RGTA 3LX0A 1KDAA 3S2DB 1XO3A 5KNDA 1KNAA 1WTVA 3P63A 2ZW0A 1I6VC 1V97A 2OHFA 5D3DA 3S2HB 1Q3LA 3Q8AA 5EE0A 4E6IA 2E74C 4DN4M 2NB0A 4DAYA 4TRDA 2V4IB 3PUZA 3BVZA 1PXUA 1Q10A 3AV8A 1I50B 2DNCA 1WTWA 3GTOB 3TMEA 1V1OA 3SE0A 4CJ1B 1JOOA 1PUTA 5EKKA 4L2YA 1KLUD 2WXIA 3P1HA 2WDVB 2QMTA 4QCLA 1TWAB 3KWVA 4QIWB 3KLRA 2XN9C 1NAPA 1CZPA 1Y8OB 4ZRZA 3I3CA 1Z6HA 5K5PA 2Q5WD 3S14B 3AN1A 5IGCA 4A3MB 2BDOA 2SDFA 3T3OA 1C79A 3KQ4A 5JVG3 2PLPA 4MM3B 3BG3A 3T16A 3EA6A 3IFDA 1NR4A 3DM1A 2L5TA 1JWBD 1BO0A 2GRIA 3AB9A 5CV6A 5IGFA 4X3UA 2NVXB 3NTHA 4UDUC 1LT4D 1JMLA 3M7GA 2XWBB 5I6WA 3NRZA 5COYA 4O42A 2EZVA 5E4XA 5LL6S 3W3AA 5A35A 1QKZA 3BIID 1BCPB 1CHQD 3NTKA 5I2XA 1ENFA 1FXIA 4MT5A 5A2QL 4A55A 2JP1A 5FO8B 2DLBA 2RKSA 3NXWA 1VLBA 1D5ZC 4CJ2C 3PZ7A 3VR5A 2D62A 2SOBA 1V43A 1QOBA 1HEZE 3MXNA 5EJWA 2ENBA 1A3UA 4XT3B 1JWAD 2B2VC 1SBBB 4K2KA 2MUYA 3NUCA 2M0AA 5G3LD 1E7PB 2A5HA 2F0JA 1TS3A 3CKIB 3OIPA 1MD2D 1ACCA 2I2YA 1WVLA 2DYOA 2SNSA 4KK7A 2MJDA 2F0TA 3NP8A 5A2QE 2N55A 2KJXA 3CIRB 1SNQA 2FBWB 1QQRA 3BYTB 1S5DD 1ML0D 1UEAB 4F88A 3MTSA 4LMQD 4DK0A 3PMFA 4FP5D 2NN6H 1N61A 1DD2A 2Z4HA 3U2SC 4R8NA 2E76C 3W2DA 2AUJD 4IQZA 1NYRA 3TEXA 3ETRA 1IBXA 3S1RB 2K03A 2W55A 3AEFB 5BMHA 3H3VC 2X6GA 3A7LA 3T3NA 4A3BB 3VRBB 1IGDA 2MP1A 5E4WC 3A8JE 1BR9A 3Q6SA 1QF6A 2W3SA 2NN6I 5G3LF 3EFXD 3FPPA 5D65A 2LGIA 4AS1A 4OIJA 1VDVA 3MFGA 3SR6A 1SJHD 4BWGB 5T8IA 1OXUA 1RF2D 3S17B 5CORA 3TUOA 5EE3A 4H13C 2R61A 3ZGZA 4CKEA 4XDXA 1WGKA 1BDOA 4PMBA 5CC4A 1PLFA 3AEGB 3HG9A 5DNFA 1GPXA 2B2UA 5ISRA 4CJ0B 4KHZA 3BK2A 4N6EB 1EOTA 4RHRA 1BNZA 1CZWA 3NBHA 1DJRD 1A6XA 1FFUA 2W82A 3H94A 3L3OC 3X3MA 4C1NK 1TT2A 4K6LA 3G7LA 2ICEC 2IT1A 1EQVA 2RDHA 5LHY1 4OGQC 4HKQA 2A74C 4ZQ3A 1OQRA 3AM9A 2R92B 3J7YW 1PZKD 2Y0SB 2DN8A 2K22A 1JALA 2KHSA 5FOBB 2EY6A 1BCPC 4A8XC 5C3EB 1G291 1CQVA 1FIQA 1FR3A 2L11A 2K5QA 4FYDA 1HQMC 3FILB 2JEBI 1L6UA 3J7AF 4N58A 2DNEA 3AMUA 5JEAJ 2M56B 3R2TA 2NYZD 4XQJA 1YN5A 2B63B 3EQLC 4KD3A 4K2LA 3LYYA 1SNMA 4NP5A 4CQNA 2KN4A 1LT6D 4IUQA 2GA4B 2TMPA 1GUGA 3PO3B 1ZE3D 1FGBD 1FNWA 1V1PA 1ENCA 2A69C 1K53A 4XIGS 1RDPD 5HG2A 2WS3B 3MAQA 3L9AX 2DYMA 2F0LA 1XF5L 4HCEA 4MHEA 2AWOA 3VR3A 1XLPA 2ZW1A 1EIGA 1SXTA 4RCNA 2LHDA 3SK6A 1HFGA 3SVMA 3K5NA 4DNRB 2MH7A 4DNTB 1STBA 1FD6A 3IAYA 3K7AB 3DEPA 2A68C 1QG7A 2L9HA 1DCZA 2WXOA 3HOVB 4RWSC 4WQMA 2JQRB 2QILA 3IT4B 1CHPD 2V0GA 1UUPA 4KD4A 3VA7A 2F0UA 1EY6A 3A8KE 1QJOA 1I4QA 3ND9A 4IFDH 3MXUA 4B0EA 1EY9A 3EJIA 3PUVA 2I46A 2KMMA 2VB3X 3ZYYX 3OWEB 2F0DA 2O2LD 2XNAC 4XT1B 1STYA 1TIID 2JU6X 1DOMA 1GB4A 2F0PA 1ZXTA 1EYCA 4FXKC 4JE3B 1V8CA 3GD7A 1JW9D 2IX0A 5HURA 2B39A 1T5EA 2PW7A 5I4DA 4ZRQA 1IYUA 3GV3A 4RKLA 4L1BA 3R2IA 4HEA1 4A3DB 4OO1G 1CJEA 1YNJC 1EYAA 1GHJA 2BCOA 4CKBA 1T5XD 3P20A 1O7YA 2AUKA 5BMIA 3EUB2 1L0VB 2J52A 4KN7C 3K6OA 4ILWA 1RFKA 1R7SA 3H6MA 3IFTA 1D1IA 5G5HA 1QOAA 3V3XA 1CA5A 5C0XH 5IGBA 2WU5B 1QNKA 2NTTA 2LMCA 3GTGB 1QLBB 1CA6A 4REZA 1J7AA 4ZHPA 3OIQA 3KUPA 4OZAA 1DOYA 4F7XA 2O5JC 2OXPA 1R4QB 4NDXA 1ZXIA 4J1MA 2KOLA 1MSHA 4F8MA 2PZTA 3W1SA 1PDQA 3OW7A 4RKBA 5K36H 1L0YB 4MN3A 4LAAA 1O7ZA 4HKZE 4NMZA 2G1EA 5M9OA 3NVYA 1F2YA 5ELFA 1E6EB 5EPLA 4KV6A 3WDNA 3P4QB 2PTLA 2EE1A 2F0GA 4EQNA 2INNE 4WRDA 2DY8A 2FINB 4GDLB 1U4PA 3K0YA 4M1UB 2V3NA 2GI9A 4IDIA 3E5SA 1ZXHA 2G9HD 1F2RI 1AEXA 1EL0A 4K14A 2W3RA 2V3PA 2YYZA 4FNFA 5IODA 2PQEA 1STNA 1Y69U 4DK1A 1B50A 1ILQA 4V0BA 4OZBA 1SNDA 3NQIA 1D4BA 2CJOA 3DHQA 1E2VA 1C9FA 2VXWA 4EGVA 4RGOS 4YT0B 3P4RB 2EYFA 4PNYA 1PTOB 4DQOC 1U4MA 1LO5D 2EXZA 4JWUC 3SK5A 5BYQA 2C5CA 2HCCA 3PUYA 2EYPA 3ERQA 4A9AA 2J7ZA 4IUUA 1QB5D 1VMPA 2J0TD 2LHEA 1B1ZA 1UWMA 2WXJA 3SDZA 1HUNA 3DXJC 4QB4A 3NPPA 2PMVA 1HZ6A 4B08A 5IGDA 4P16A 2LJIA 1TYGB 3URYA 3Q8BA 2KAJA 2JA7B 1GHKA 4NKLA 4RGMA 3QOJA 1YNNC 3J9CA 5IT9L 2XRQD 2PW9A 5IOCA 1BUVT 1J9OA 4WURA 3PUXA 3AE1B 4N59A 1ONLA 1VF5C 5JVH3 4TKOB 4HJGE 1Y8NB 3I90A 5D7GA 4M0WA 3TSSA 1BOSA 1IL8A 1DZ1A 3W5VB 1C4QA 1TR5A 3I4MB 4LK1C 4C3IG 2EJMA 5FLXL 1IKMA 1LTSD 3HOWB 2LKVA 2L55A 3MXPA 5C3WA 1HTLD 4U68A 2RVLA 4XTCS 3TN2A 2L12A 1SE2A 2OF1A 1WTQA 2Y3AA 1F2LA 4JK1C 2D9UA 2B2YC 3SXHA 3CU7A 4RH6A 1P7EA 4IUVA 4US9A 2PZWA 3M3YB 3J80E 1ROEA 2PPBC 4YSXB 4TMAB 4B0MA 5KNBA 1SYGA 4EQPA 2RQXA 3LNNA 2XSCA 1KTKA 2IWHA 1HA5A 4YTNB 5KYLA 1RYJA 1QOHA 1A70A 3D6CA 5GXGB 3KBGA 4FF3A 1N5WA 1XCQL 1TWHB 4XQQA 4L8JA 4HSVA 1RODA 1BCPD 4IKGA 2Z8LA 2AWNA 2SEBD 1F2MA 1IUEA 1NSNS 3C8YA 5C2TB 1K83B 4HEDA 2JYTA 1LTGD 5I6YA 1J7BA 4WAFA 5KIXA 1L4DB 5FO7B 3TP8A 1DM0B 2KVMA 4QMGA 1PTOC 4L6TB 3DWQA 4HR7B 2WXFA 3FC4A 1WWTA 3AEBB 3N6RA 2BYTA 3I8ZA 4DAPA 2K6AA 1EM7A 4HMIA 5C6AA 1SYBA 4ITKA 3RPFC 3QOLA 1F9QA 4HAEA 2B2VA 4R9WA 2BB6A 3LB8C 2A68D 5FO9B 1TWCB 1TWFB 2OT2A 2YEPB 3AE7B 3HUIA 1JOKA 5LL6X 1DYQA 1IGCA 1H9JA 5H8YE 1F2ZA 2WXRA 1B53A 2PNRC 5JJZA 1G8ZD 4RFBA 1SIJA 4IZ8A 4C3IB 4P6VF 1QCBD 2NWGA 5ELEA 1E2WA 4U673 2FHTA 1BMLC 4DFAA 1YQ3B 4G4KA 3PIP3 5JEAG 2BA0A 2CJNA 4G7HC 1K52A 4H0LC 2ON8A 1IW7C 5EE1A 1I4RA 5F2DA 4TQ1A 1BXTA 1JE4A 4I7ZC 3Q8EA 1B9MA 2EYMA 3FRPB 5EE9A 2F0EA 1ZKOA 4KTAA 1U9RA 1O7LA 4L23A 2D5DA 3L4PA 3GO5A 1PDXA 1YNJD 3NVVA 2MPMA 4CBVA 3KK7A 3M4OB 1STAA 1EEID 2F0NA 4BA2I 5J39A 3BDLA 2JSVX 4IOIE 1SMYC 2PCFB 2WB1B 3K58A 5J22A 2BE5C 4GDKB 3RUZA 4CKCA 3W5UB 1ZEQX 5C5LA 3AE4B 1X3QA 3QIAA 1D5XC 3QG1A 2HTME 3D31A 4TQ0A 1H9RA 5CR3A 3S16B 3ZQ4A 3E6ZX 1D1KA 1EWCA 3I9V1 3NE5B 2F3WA 4XYQA 1DOLA 1VCIA 4EQOA 2K1BA 1WTPA 3CRLC 2V4DA 3MWYW 3OHXC 1I4PA 1YMHE 3E56A 3SHLA 4OO1H 3KWLA 2VZKB 2EJGC 2F4IA 5I9PA 3AE5B 2L32A 3VYTA 1TJEA 2EELA 2J42A 2H89B 3Q0AA 4K6DA 4G57A 4NAWB 1CFMA 1SAPA 1UNSA 5MPOA 1FO4A 2PMZB 4MACA 3J7AV 4KN4C 1G2TA 1FFVA 2LFNA 1PGAA 1HCZA 2JE6I 3UI3A 1W6JA 3HOZB 1KNEA 1O80A 2AQ1B 4XDDA 3PO0A 5ELDA 3ZJTA 1JWSD 1HZ5A 1Z7TA 3R93A 4B9WA 3NTIA 4KKUA 4ZOHC 3O13A 3A7AB 3C1EA 5AFWA 4WH4A 2K01A 3K5MA 4YIJA 3KLSX 4YSYB 2XIWA 1UGJA 4OIKA 2AX5A 1HA6A 1C4PA 5BYRA 2MGSA 4S3SA 3GTMB 3H0GB 1B4OA 2EYLA 4OW0A 1Y1WB 1GUNA 1A15A 1V1PB 4N9TA 3T53B 1CQFA 1FCCC 4C3HG 4D2KA 3N9YC 1TY2A 2O5IC 3OPOA 2B8GA 3TP5A 2X6LA 4ZYSA 1TS2A 5C3XA 3U4EG 4YSZB 1EWYC 5EBDA 1ZYRC 1A3VA 5C4JB 2F0OA 3HKZB 5DAUA 1YJIA 1MHXA 2ZXPA 4FXCA 2BT6A 4A6QA 3VR4A 4WORA 2EY5A 4ZUJA 4KMUC 2QCPX 2B76B 3VR8B 3ONAB 1OXSC 1NI3A 2M9VA 1QOFA 2QKIC 2N0SB 5KEEA 4PMWA 1UAPA 3P4SB 4USAA 3BVMA 2K28A 2Q8IB 4A93B 4RGNA 1SYCA 3GP7A 2ONQA 2NTSA 2AQ3B 1B9RA 2CW0C 3ND8A 3P4PB 2WNMA 3D4DA 2EJFC 5CBAE 4AQ7A 2JXMB 1JQYD 3V2TA 1KDCA 5AUKA 2LEKA 4KY6A 4UAIA 4KJNA 3U9OA 3HGBA 3NUHB 4C1NI 1GAQB 2QF7A 1K8MA 3C2PA 2B2UC 2PYKA 3TZUA 3I57A 3VYUA 1HRJA 4ODGA 4QUFA 1C48A 1GUSA 2LMCB 1NENB 2WKCA 1Y1VB 2EY1A 1FRDA 2J53A 1L6VA 2FUG1 2H88B 1LTTD 1TS5A 4I65A 2WIIB 4J6HA 4IN3A 2DBYA 1CT1D 1EU4A 3R3OA 1K8OA 4IURA 1WXQA 4EE2A 3TEZA 2MJEA 5M3MB 3V05A 1ET6A 2KCNA 2K32A 5IGEA 2L1AA 2L1BA 4KKSA 4Z9CB 4C3JG 1SYEA 4IFDI 3FILA 3P75A 1F2RC 2KUMA 4JPSA 4QUCA 1N63A 5ELBA 3ZJVA 3MC0B 3U9SA 1II3A 1SYFA 2BOSA 1U4LA 3AMZA 5EPKA 3DWPA 1KABA 1J8IA 4YTPB 3TDQA 1U4RA 1XTCD 2L0CA 3IKJA 4ZUIA 1WSPA 3AH7A 4HCSA 4XXEA 4J3OD 4C3HB 1X3PA 4X3KA 3BK1A 3A54A 1PTOD 1GOZA 2JEAI 1I6HB 5BN4A 1A3TA 1QILA 1T3QA 2B8FA 2TSSA 4H2AA 4RNAA 2W54A 2NUCA 3JAML 1VZ7A 1STHA 4XWWA 2KDMA 1MGSA 2X69A 1H9KA 2WV6D 1G91A 3MEHA 4DXGA 4XDCA 4ZRPA 4IUNA 1DXMA 5C0XI 2F0KA 2NN6G 3U52E 1RM6C 3VR9B 4BA1I 1TKYA 2ZXOA 4RA8A 2X38A 2I07B 3MJ5A 4Q0FA 2RDFA 3AE9B 3FKIB 3GTLB 1L0XB 2DY7A 4OVZA 3JAME 1PZJD 1PFBA 3R8BA 5T1IA 1AW7A 2K5PA 3I4LA 2F0HA 2I38A 2KQ4X 3Q69A 1PTOF 1IW7D 1ILPA 1OQQA 2OEOA 2JWUA 2KEDA 1PYWD 5C44B 1ESFA 1D5MC 3AE6B 1XX8A 4WWMA 1EZ6A 1KAAA 1F9SA 1LLRD 4K8IA 3FAHA 3H8HA 2LFIA 4B9XA 3FPUB 2IJ0A 4RCOA 3VYRA 1YNTE 2WU2B 1RD9D 2EYHA 2NBFA 2CQAA 1SMYD 3Q8FA 1KRHA 2BE5D 4KGTA 4KHVA 1FXAA 4ARIA 4K8JA 1HHVA 4Y7NB 1Q1BA 4QF4A 4IUPA 2KWDA 5JEAH 2RA4A 2PVGC 1KLGD 3J81L 1E9MA 1G6ZA 5D3IB 3HP3A 3ITPA 3OMCA 5JPNC 1EY4A 3GTQB 1E0ZA 1LABA 1RJTA 4C3JB 3PZ8A 2E2DC 3MA2B 1NUCA 3A55A 4AYBB 4X3SA 2FMMA 3I4NB 2H1EA 4C80A 3T4AC 2IGGA 1GXDC 1Y56A 2XVSA 4HMJA 4HTHA 3D4WA 5JPMC 3H09A 1H9SB 5M5WB 4N9PA 2M19A 3BDCA 1IKLA 1PRTB 5M3FB 3FEWX 2YU9B 1JWUD 1MPEA 2HDMA 5HHDG 3KBXA 1F0ZA 3J81E 3B2GA 3W9CB 4ZK9B 2R7ZB 5DM73 2C9OA 4CGYB 1AYFA 1BF4A 3PIO3 5D14A 5BN5A 2WXQA 2NZ1D 2QJLA 1JC7A 2B2WC 2LY7A 1RWSA 1XLOA 4DXFA 1S5CD 1XLQA 4LK0M 1EY8A 1EFID 4NZLB 2WACA 4PT5A 5IT9E 1TZOA 1ZP0B 1S5ED 4RAUC 1CTMA 1HPCA 2F03A 5FK9C 1LTAD 1FMAD 2Q8TA 1N62A 5BMGA 4XE0A 4DGZA 4IFDG 2K04A 2E6XA 1JICA 2AQ2B 2J4XA 4EVOA 5C5MA 5IGGA 2XWJB 4FXDA 1SE3A 3NWTA 2WLBA 2FMCA 3AE2B 4HN7A 1V8QA 3TZDA 5FLXE 3P1MA 2IL8A 1YJJA 1FM0D 4R3DA 2K05A 1CI3M 2Y5PA 2BW2A 3DEOA 5I9OA 2HQEA 4KGRA 2MJ3A 1TKGA 2JSOA 3CRKC 4KKTA 1QWYA 1B9NA 1ZYRD 2IW3A 3RMHA 1FRRA 4WFN3 1HUMA 1EIHA 3QB3A 3GTJB 3BYYB 3CWIA 1I4XA 5CMDA 3A8IE 1PFNA 2FFKB 3NVWA 4HSPA 2Y5CA 2K5DA 5C0XG 1X32A 2BA1A 1KDBA 3TP7A 3K5LA 2JA8B 1Q12A 2EYOA 4M8AA 1MBYA 1K50A 2YEPF 3IT6B 1SSNA 4V190 2RBMA 3LWUA 2L52A 1H9MA 2CW0D 2A69D 1TY0A 2MHVA 2L4NA 3C1FA 1STEA 5EBCA 5I2YA 1LV9A 3B2FA 2M00A 1CZGA 3V96A 3MFYA 4L63B 5K36G 3WOEA 2DWQA 4WIPA 1BBXC 3T51B 3EGRA 4GZYC 2VZKD 1TQOA 4ZLTF 3CQZB 2BDNA 1RKNA 4US8A 3S1MB 2RDGA 3GV6A 3TP6A 2PKOA 1OXTA 3BVGA 1ENAA 5JOBA 2IPKD 1BCPF 1DOXA 1J7CA 2K9XA 2CU3A 1PRTC 1WCMB 4KY5A 4NAMA 1JB3A 2A6EC 3RZOB 4ARCA 1PZID 1GUOA 2B2TC 3AE8B 2F0MA 1DGJA 2K7VA 2SAKA 1AWDA 3IAM1 5DM63 5M5XB 3EVQA 3QWNA 2H4OA 5J1ZA 5CV7A 1S4ZA 1LTID 5E1FA 2WDQB 2M2LA 3HRZC 1LACA 1E0BA 1SYDA 4LTUA 3SK4A 1XYIA 3HRDD 2SNMA 3D6WA 4FF4A 1K51A 1G2SA 3D4RA 2PZUA 1IBXB 1MVKA 4G7ZC 2N9LA 2MJ8A 1BQQT 1ESRA 3Q24A 1PTOH 1STGA 4TQUS 2N88A 4BY7B 1I7HA 4DAVA 2E2JB 2D2CC 5CBEE 2K33A 4Q2JA 2A73B 1R9TB 2E75C 4DA2A 4FO2A 4C7YA 4HROA 1N5XA 2EYJA