2XNAC

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
b'EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xnaC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xnaC01
3DWAA 1D5MC 1F77A 2SEBD 1JWSD 1I4HA 3KLSX 1FNUA 1B44D 1PTOH 3BYTB 4RHSA 2XN9C 4L63B 1LT3D 1L0YB 2O2LD 1PRTC 1EU4A 1PRTD 1JWMD 5I4DA 4UDUC 1V1OA 1CT1D 2J4XA 1V1PA 5ELFA 1SE2A 2XRSD 1BCPC 1FD7D 1BCPD 1LTGD 1LT4D 2CHBD 3W2DA 2RDHA 1CK1A 4RGNA 1SE3A 1FNVA 1STEA 1UUPA 4RFBA 1PRTF 1RF2D 3DWQA 1ET6A 1PTOC 4K6LA 3OWEB 2QILA 1EU3A 4RCOA 4BWGB 1ESFA 1M4VA 1I4RA 1SJHD 4RGOS 1PYWD 1GOZA 2QEJC 1KTKA 4DXFA 1BCPF 1CHQD 4DXGA 2IPKD 1LT5D 1S5FD 1D5ZC 1SXTA 1ENFA 1TS2A 1LTAD 1CQVA 1LTBD 5ELEA 3O13A 1I4PA 1B1ZA 1EEID 1QILA 3R2TA 1YN4A 1PTOF 1JQYD 2NTTA 1SBBB 3DWPA 3EA6A 1RDPD 4RGMA 3URYA 2AQ3B 1T5XD 1I4GA 5FK9C 1TS4A 2WV6D 3MC0B 1DYQA 1S5CD 2Z8LA 2TSSA 5ELDA 1PRTB 1JWUD 1HXYD 1PTOD 4RH6A 4Z9CB 5ELBA 3TSSA 3CHBD 1I4QA 3R2IA 3BVZA 1HA5A 1YN5A 1YN3A 1RCVD 1BCPB 1LTID 3SEBA 1S5DD 2XNAC 1AN8A 3R8BA 4OHJA 1PZID 1TS3A 2G9HD 3BVGA 1KLGD 1RD9D 5D3IB 1PZJD 1LTRD 1PZKD 1PTOB 3EFXD 3GP7A 1KLUD 2AQ1B 3MFGA 1S5BD 1FGBD 1I4XA 5TSSA 1XTCD 4TSSA 1UNSA 5ELCA 1L0XB 2AQ2B 1AW7A 1D5XC 1LTTD 2R61A 1EEFD 5FKAC 1TS5A 4ZYSA 1EWCA 1SEBD 1SE4A 4O1NA 4C56C 2ICIA 1TY2A 5D3DA 1FNWA 2XRQD 4NZLB 1JR0D 3V05A 1LO5D 1EFID 1XXGA 4RHRA 1JCKB 1LLRD 1LT6D 4RGTA 1V1PB 2IJ0A 3BZDB 1MD2D 1G8ZD 1HQRD 1LTSD 1TY0A 4L6TB 1BXTA 2RDGA 1S5ED 3BVMA 1SJED 3BYYB 1CHPD 1D6EC 1HTLD 1DJRD 1ET9A 2NTSA
chains in the Genus database with same CATH superfamily
2Y0SG 1O7IA 2Y0SE 5M9OA 1JWSD 1V5OA 3C0RB 2EJFC 2JA5G 1EY0A 3A1QA 2ASQA 1I6HB 3OOCA 5IT9c 2FCQA 1FRRA 2RR9A 5DPRA 1EU4A 2BKRB 1QVGA 2KDEB 4PS3A 1BBXC 4OVUA 5IOIA 2ZVNA 1EWHA 1EYCA 2EE1A 5FLXE 1G2TA 1CSQA 1WXQA 3TEHB 1L1OA 3A5ZB 2UUCL 3LB8C 2B2YA 4M8NA 4DR1L 4FF3A 4KHZA 3HFZB 3PSEB 5KNCA 2A5HA 2UWQA 2OT2A 1LTGD 2RDHA 5C4XH 2KEEA 3ICEA 5IY0A 4WORA 2ZNVC 4ZRJA 4Q2JA 3TP5A 2F0MA 4NAMA 3AECB 1EO6A 5IGEA 2KQ4X 4RCOA 4X57B 1HNXL 1WXAA 4AJYB 1M4VA 3VTVA 3T51B 2GBJA 2XK5B 1GOZA 5E6PA 4QUCA 2JA7G 3P20A 2PQAB 1VQMA 1JORA 1XCQL 2WXKA 3AE7B 3A9KB 4NAWA 1QKZA 4RWSC 3U4ZA 1A8VA 3M4PA 1CM9A 4DGZA 2C5LC 1D1IA 4EQNA 3QJYA 1FVIA 2DZJA 2VH1A 1F0ZA 3APDA 2F0EA 2E74C 1FGUA 4G7OC 4CJ1B 3RD2A 3CCLA 1GM5A 3HVDA 4JI6Q 1HNWQ 2KDMA 3DWMA 3UF8A 1KJTA 3J81j 1L4DB 1WR1A 4F8MA 2E2IH 4X3KA 2Z0DB 4G50A 4BY1H 1WFQA 1ZXTA 4KY5A 3TP6A 4DV7L 1PRTB 2REXA 4KMUC 2MWSB 3DM1A 1K9MC 2KVZA 2E5LL 2ATWA 1XX8A 2VUMH 4ZDVA 1KXLA 1ZUD2 4QQBX 3HM6X 1HA5A 2NVXB 1B7YB 1SYFA 2CH4W 1J5EQ 3SEBA 2A68D 3R93A 5NUCA 2E2JH 3FILA 2BB6A 4WFN3 3H94A 1FJGQ 2B8FA 3F2DA 1EY6A 1F2ZA 4JI2L 4DR5L 1MJCA 1TT2A 3IT6B 2QGQA 3VR9B 3ZNID 1IW7C 4YTPB 2WACA 3JAME 1UBIA 3CW2C 2Y5BB 4FF2A 1S5BD 2F0SA 3WAOA 1II3A 4A3JB 3A4SC 4IM2A 5DM63 1L4ZB 3U4EG 4P6VF 1AH9A 3PV1A 3S1RB 3W1BA 2ZPYA 3M62B 5C4JB 1TYGB 2D3BA 4PV1C 1TS5A 2CHWA 5D7GA 3BDCA 4B08A 2N78A 2QA4A 3V61A 3WIMA 3HM3A 3M9BA 1E2VA 2EZVA 4DV1Q 2DYMA 2W82A 4A3IH 3EBEA 4IPHA 2PW9A 1TVXA 2QDFA 1BXTA 1I94Q 3I4NB 4DV6L 1W6KA 2KUMA 4LDTB 3RLNA 5LXHA 2INCC 2D11A 4AQYQ 2L3ZA 1FM0D 2WX1A 3LWEA 3AU4A 3HOZH 2K03A 4A75A 3S24A 1IBKL 3SK5A 4IOCA 1B44D 1PDQA 4X66Q 4YWKA 3HOWB 3OG5A 1ZDVA 3PLVA 3L54A 1X3EA 4DAYA 3X3NA 1I3QB 2Z6KC 1PRTC 2BH2A 3S1NB 4DAMA 1JWMD 2ALYB 1L0VB 2I5LX 3CKIB 1X56A 5IP7H 1YIWA 4LF6Q 1WI5A 4NXNL 2RA4A 4A3JG 3GTQH 3QC8B 4GMVA 2A19A 2E6XA 4IUMB 3AI5A 2N7EA 2AUJD 1QOHA 1TWHB 4IN3A 1OQQA 5FJ8G 1K83H 1YNXA 1U9RA 2K7VA 4QL5A 3X3MA 2I0QA 3KVFB 2GB1A 4HIOA 3K6OA 2MBOA 3JSVA 3OJ4B 1WGHA 2KT7A 1SR3A 2RQXA 2RDBC 4MDKE 3SE0A 1Y1WH 1Q7YC 4K7WA 2F0KA 3VYSA 4I6LB 4R4IA 2C7HA 3ZJVA 2RHSB 4OONA 1JJGA 4GN4B 1LACA 5JXVA 3I4NG 4X64Q 1XLOA 2K05A 3ND9A 1BCPF 1GVPA 2V9HA 1E7PB 3J80E 1KC8C 4GLVB 1IL2A 2A4ZA 2C9WB 1PH7A 1TR5A 5FO9B 3D6WA 4EOYA 3P1HA 2N9XA 1C4QA 1H9JA 1LABA 3GV3A 3HOWG 4BA2I 4A9AA 3I4MH 4A3DB 1V5TA 2B2UC 4C3HH 1XNRQ 2X6LA 4II3B 1UE6A 1VD2A 1LGRA 2N7JA 5I9OA 1QNUA 2A74C 3IXSA 2MLBA 1A3VA 3J81L 4GKKQ 1ZE3D 4QAYA 1R9TB 2K5PA 3AE2B 5KRUA 1XMOQ 1N32Q 1XYIA 2FCMA 4MSQB 4Z9CB 2MP2A 2B29A 2PI2A 1HTOA 2KCTA 1DOKA 5LMUQ 3GTLH 1P7FA 1WM3A 2V3NA 3OIPA 4XIGS 1Q5WB 1YQ3B 3DHIC 5BMIA 3NPPA 2EIFA 2KJXA 4XYOA 4H7BA 4K7UA 4G3XB 1YI2A 2KX0A 3ZUNA 1ZP0B 1KAAA 5HI1A 4AH6A 2BF8B 1XEEA 1UGMA 5KIXA 2E2HB 1PZJD 2KFJA 2KTRA 4MELA 4DR3Q 4B9WA 3GP7A 4DAVA 2BE5C 2HCCA 4HIMA 1C48A 2HIXA 1PH9A 4J6HA 3PIPA 3NE5B 1M90C 3AH7A 1X6OA 3UINB 2F0GA 5J1ZA 4A3DG 4HJAA 3RCZA 3KBXA 4WWPA 1EEFD 4K3CA 2KYWA 1EWCA 1SEBD 3NELA 4HMIA 4DPGA 1XNQL 3DBHB 4DQOC 3V2TA 1WD0A 4WWOA 1FCLA 1NUCA 4DV0L 3W5OA 3V05A 1OXTA 1XLPA 2IJ0A 1NAPA 1YMHE 2PQEA 1MD2D 4YHHL 3DBRI 1JRUA 2EVBA 4LK1C 1BQQT 3MHBA 1AYFA 2RDGA 2JVCA 4CDDC 2K4KA 1YEZA 2F4IA 3NUCA 1ET9A 2K8HA 3EUB2 2ZXOA 3N3KB 4EEWA 2WU2B 4CDFC 3F2BA 2ASBA 3DM3A 2KACA 2RDFA 2EY6A 2ZJRA 1H9SB 3PUWA 4ODGA 1CZGA 3HG9A 3AE5B 1E5WA 3HOUH 4K2LA 2MUYA 3B2FA 2CW0D 5CV9A 3E9IA 1SNMA 2LGIA 2K5HA 3GB1A 1RFAA 1N33L 5CBAE 2XRSD 2L76A 1JC7A 2WP9B 4DV2Q 4E6IA 3W2DA 2N4FA 4HPPA 4JQWC 3R3OA 3CCVA 4LF7L 4TQUS 3T4AC 2KHWB 2NN6I 4M0WA 4AUQC 1R4PB 3KF8B 2ZJQA 3BJUA 3CD6A 1WMHA 3CMAA 3E56A 2M56B 3KH0A 5AUIA 1YJ1A 3Q22A 2INPE 4BWGB 4ZUIA 4A3LG 2KWUB 4FULA 4W9FA 3VDZA 2F4VQ 4DR7L 4XTCS 2VB2X 4MGIE 3VRAB 1EIGA 1CHQD 2ZXRA 3H0GH 1PGBA 3L13A 2FE8A 4LLGM 3VR5A 1IP9A 2WXQA 2B2WA 2A68C 3FEWX 2KDBA 2WDRB 5L83A 1TBEA 1K8AC 1WCMH 3EROA 3NG0A 1QWYA 4MN3A 4XT3B 4X65L 2JZ3B 1L2FA 2L12A 3H3VH 1UELA 2A73B 1J9OA 2DJGC 2IWHA 2AQ3B 4IFDI 5J17A 1KLVA 4A3BB 4TMAB 1SYDA 2QEXA 1GHJA 2MGSA 1JMCA 1HFNA 5AZGA 4DK0A 3S2HB 4PS7A 5C44B 1JE4A 4CKEA 2BA1A 1HR0L 3LJ3A 1C4AA 1DOLA 2OHFA 3F8TA 5IGBA 4A3KB 2R7ZH 5C0XI 3NVVA 3VUYA 5IA7A 1DCZA 4FHJA 5C3EH 4H0LC 2KNBA 2PLPA 3OW2A 2FXQA 3K0XA 5ELOA 1ZEQX 3ONAB 4MZ9A 1CA6A 2XNAC 1GD7A 1WF9A 2OTJA 2D2QA 2F1MA 2UUCQ 2I46A 5J3BA 4DR1Q 4OHJA 2NMQA 3CMMB 2GBMA 3PZDA 4IG7B 2G9HD 3QB3A 4QB4A 5BR8L 3GTGH 1E8ZA 3TL5A 3BY4B 5M5WH 1NBFC 1HNZL 2LXCA 1A3TA 4CJ2C 4JPBW 3LNNA 1X1MA 4CKCA 1UE5A 1J7AA 1MG4A 4DR2L 3GTKH 1FGBD 1EIYB 5LHY1 5JJIA 1UNSA 3P7JA 1FYCA 5C23A 1HNXQ 1MBYA 4KSLC 1AW7A 3I90A 3RNUA 3PZ8A 2JYEA 2F0HA 4A3BG 3R66C 2E2DC 5E6JA 3MP9A 4A3GB 1Y14B 3U58A 2WQYB 4BFRA 1FXAA 2PIAA 3M7NA 4XQJA 1LO5D 5C44G 1PHJA 4FBJB 4FP5D 1V8CA 4RGTA 3NQTA 4FXCA 1PLFA 4A3KG 2K9XA 2R92H 3M7GA 1LTSD 2GRIA 2J7ZA 5L95C 1WTPA 4A8XC 3PO3H 5IYDG 4YSXB 1DJRD 4GDLB 5EKLA 1VF5C 1F9QA 5F2DA 3PTFC 3RT3B 5FLMH 1XMQL 1Z7TA 4MTNA 2OF1A 4JI1L 3S15H 4Y7NB 3W1SC 5D2MB 1EM7A 2IX1A 1WZ3A 4S0RA 4DV7Q 2NBVB 3VQIA 1B70B 2HTHA 2ID0A 4U68A 4IURA 1IBML 1HZ6A 4DV3L 1WE7A 2G45B 1IKLA 2CQOA 2DN8A 4DDID 5IP9G 4NJ7A 5AEKB 4WIPA 1E2ZA 1DONA 4LF8L 1V1PA 3N1YC 3SU8X 5J39A 3FKYA 3AEGB 3QHTA 4NNJB 1YJIA 2SAKA 4FXGC 2ENBA 3IAS1 3ZQ4A 3I3TB 3T8MA 4LNNA 4A3GG 2AMCB 1STEA 4DR5Q 1UGJA 1K8OA 4APVA 3VR8B 1PMRA 1RF2D 4HCSA 5DPTA 3STBD 1F2MA 4HCEA 3SD5A 1SSOA 2AL6A 4DHZE 3OWEB 2CQAA 4AYBB 4ANXA 4JI0L 5EPLA 3AEBB 4H13C 2F0TA 4R9WA 2O2VB 1PYWD 1IYJB 4JCVE 2ICEC 2G4SA 3NJTA 2F0DA 3PHWB 3AV8A 2KECA 1C3TA 4P73A 1BMLC 4IM0A 1J0GA 1TS2A 1GUAB 1U4AA 1BF4A 2L8JA 4MACA 2JXMB 3K7AB 1WY8A 1L5PA 2LGDA 3E9SA 3EHVA 4KVGB 4LW1A 1BT0A 2LGSA 3IT4B 3V6EB 4R4QA 5I2XA 2PVGC 4YSYB 3ZDTA 2D3CA 3L17A 5BMGA 2PJHA 3ZNGC 3PUXA 1KNEA 1R4NB 1YQ4B 4DV6Q 2F0UA 1DYQA 4N9TA 3M95A 4GDKB 1V1QA 3PLUA 3AEFB 1QUQB 3UE1A 4U673 4RH6A 4USAA 1CSPA 3A8KE 1IBKQ 5DEHA 5CV6A 2Z59B 4DK5A 3WCQA 1CZWA 4WQOB 4WJOA 3FKIH 5FO8B 3TSSA 4IFDH 3IBEA 3WA0A 3CHBD 2KCNA 2GBKA 4F1SA 2EJMA 1WGDA 3C1EA 2C9OA 2NZOA 1Y8RC 2PE6B 3APCA 4JBMA 1H9MA 3E6ZX 1O7ZA 3QWNA 5J22A 4NXNQ 5IAAC 3U4VA 2WIIB 3RZFA 4AYBG 5FLXL 4BS9A 1LM8B 3CSFA 3DBLB 3DVNU 4JOIC 1Q46A 4LFBL 1KFYB 2MW5A 2M0XA 2R3ZA 3W1GA 1XO3A 4BKSD 2L1BA 4HSVA 1ZW7A 1E10A 3QOLA 4CHKA 1TZOA 3MXNB 2WXFA 1Q90A 1UEBA 1F1HA 3DEOA 3VRBB 4LNFA 5ELCA 2DBYA 2K39A 3RN5A 3I3CA 4A3MB 1YZ6A 3TZUA 1HEZE 5TR5A 3VR6A 3QX1A 1TXYA 1E0ZA 4KIKB 4GXBA 1FL0A 1KQSA 2BS4B 3RD4A 1VQGA 4DN4M 2CW0C 5GQOA 2UUAL 2CJNA 3J81i 2L1AA 4GOPB 4KSKC 5LMNL 1JCKB 4RM8A 2LXKA 1QOFA 2NZ1D 2K5NA 4MTKA 1K52A 1PGAA 1EYAA 4EQPA 2BKFA 1YX6B 3Q6SA 4XDDA 2E8GA 2HDLA 3JW0X 1UBQA 1A3UA 1S5ED 3BU2A 4JL9A 2PEAA 2WXHA 3IAM1 1GPXA 1SMYD 4NXML 3N20C 1FMAD 4BVUC 1XPRA 1QZGA 4JLCA 4XQNA 3JYUA 3KLWA 1HA6A 3S2AA 2AEHA 4RHSA 3SK4A 3L4PA 5JVG3 1N62A 2VZKB 3ZJTA 3BS1A 5JVH3 1B2TA 4AJWA 1M94A 1XLNA 2KC1A 2HCIA 1QT9A 2IO3B 1Q82C 2HQEA 1ZKOA 1K51A 2KZRA 2Q2HA 4IPDA 1JJCB 1CZPA 3L10B 3QA8A 2QDLA 3PGZA 2KHIA 2CS4A 3VFKA 4B0EA 4A3MG 4I6PA 2JSVX 3H6MA 1LT4D 2EELA 3FMCA 4KKUA 2V4LA 4KKJA 5EPKA 2PMZE 4YXDB 4A93B 1TT5B 3IKJA 4RMFA 3CSTA 1B53A 1PRTF 1WX8A 1ET6A 5IIFA 3HRDD 3I56A 3T1HL 1PH4A 4LNKA 1V43A 2CCZA 1G6JA 5E3FA 3JAML 2M19A 4BBSH 1CKMA 4NKLA 3AFQA 1WR6E 1WX9A 1R4MB 3A56A 1ROEA 1A2UA 2QEJC 1FPYA 4TRDA 3DUZA 1TKEA 1U4MA 4DXGA 2WWZA 1IBXB 5T1GA 4CGYB 1TKGA 2Q8RE 1I50B 1NR2A 1S5FD 4F7ZA 2W9NA 1AZPA 3LDZE 4WRDA 4DV0Q 2JZZA 4R3DA 4A3FB 3I2ZA 1CTMA 1QE6A 1UAPA 1JWBD 1UE1A 4P71A 1HZ5A 2LI5A 2K8CA 2C35B 4YHHQ 4HMJA 1QLBB 2L32A 3Q8BA 3RUIB 4W9CA 1EF1A 2HD3A 1X55A 4ULLA 1HTQA 3SK6A 1S5CD 3U8ZA 1TWAH 3TREA 2OJWA 5DPWA 2FHTA 1YHAA 4ZRPA 3RZDH 1HJPA 5EBDA 2J42A 2NBFA 3M3YH 1KH0A 2FBWB 4A93G 4ITKA 2YV5A 4ALPA 2RD0A 1Q3LA 2BW2A 3J7ZC 1VQ6A 2I1JA 2A69D 4L1BA 3RNGC 4YTMB 1DM0B 2JA9A 2RPQA 1FFUA 2LVOA 1N33Q 3HS0C 1VQFA 3I73A 2K25A 2UU9L 3NEMA 1V9JA 1IZ6A 3I8ZA 5C3JB 2NS5A 2EY5A 3T3OA 4OIKA 1SNCA 2VS1A 4JX1C 3OMCA 4NMZA 4LF7Q 4TQ1A 4A3FG 3AEDB 2ZW0A 3PO2B 1IUEA 4WJ3M 2J52A 2BPSA 1SYGA 2Z0SA 3OWFA 3QR8A 4L5RC 2RSOA 3UQAA 1DXMA 2EOTA 3NTHA 2AL3A 4DR7Q 1WYGA 3H7SA 4D2KA 4IO9A 1OQRA 2ICIA 4JI3L 2B63H 2N1VA 2WXJA 5LNK1 5C4XB 1WD1A 2G4DB 2PYKA 2EJGC 5CX3A 3CC2A 1U4LA 1PFNA 4HJ8A 1TIFA 4HEDA 5AFWA 4X65Q 4ZKBB 2N0SB 4V0BA 3BZCA 4IDIA 4NDXA 1DOIA 3H6NA 3VA7A 1SJED 3HOXB 3S1QH 2L15A 2CWAA 4IFDJ 1GUGA 3RMKC 1KOTA 1QOAA 1Y8OB 1HR0Q 2DY7A 3I91A 5EKIA 1YNNC 1N5WA 1BR9A 1N60A 2SOBA 1HHVA 4UDUC 2V4DA 2KX3A 2KAJA 2VNUD 3OW7A 3RZOB 4RMAA 3ERQA 5C0XJ 2UXBL 1XWEA 1PXUA 2B2UA 1A6XA 4HAEA 3PO2G 1YD8U 2O6VB 4UAIA 3HOVH 4MIUA 4IZ8A 4K14A 2K75A 1GUTA 3FDTA 1Q1EA 3JC66 3TP8A 2BDNA 2DZMA 2N9EB 2O4XA 5G3LD 3V6CB 2R6GA 5BR8Q 2G3QB 1J8CA 3VUWA 4POFA 1F2RC 4W9HA 1LXDA 2C7NB 1HNZQ 3K5LA 3UDGA 3M85A 5C4XG 3P2BA 2PPBC 3WOFA 3Q0AA 3ZDMC 3GD7A 1HZBA 1VCIA 2YTYA 1BOSA 4K6LA 4DR2Q 1NDDA 4ILWA 1ZGUB 4NJ6A 1EU3A 3ERSX 3VR3A 4FXDA 1J19A 1E90A 3B2GA 5E6NA 5AUKA 5IYCG 4B3SL 3M3JA 1E6EB 5JAVA 5IYBH 5C1ZA 5IGDA 1IPGA 1ZXIA 3ENEA 3HOXG 3Q3NC 3H9DA 1YBYA 2DJFC 1E3PA 1PFSA 1PYSB 3AB9A 2JA6H 1LTAD 2JA8B 4C3JH 1ZOYB 2IY1B 2LFIA 3H1UA 4IKGA 5IP4D 5LL6S 5IN7A 2XVSA 3CQZB 2RMMA 3ZLZA 4DHJB 4PZ7A 3TDQA 2EY2A 3DWPA 1P8LA 1WTXA 3HEJA 2B2VC 1C4CA 3P4QB 4KDLB 1VQAA 1Y1VH 5C3WA 2L7RA 1YNJC 1XMQQ 3VA5A 3FPUB 4YWLA 2E75C 4J15A 4JI1Q 3EFCA 3PRMB 5M3MH 1T0QC 1VQ8A 4CQNA 3RR5A 3FAHA 1NSNS 1IBMQ 4TKNA 3PSIA 3NBHB 4DV3Q 1GNUA 3AYHB 1UZXB 4M8MA 4W9KA 4YWMA 1EWIA 4LWCA 2VZAA 4GB9A 2M00A 1SROA 2JYOA 2F0JA 1CKNB 1K3RA 3R8BA 2I5MX 4LF8Q 1N5XA 3NVZA 1WJNA 2KENA 4KV6A 4B3ML 1IYVA 4CYEA 3GE3C 3P63A 3ZRFA 1SMYC 2F0LA 2VL6A 3EFXD 2R7FA 4MHEA 5EBCA 1EQQA 2JA5H 1K3BC 2QCZA 5IGFA 3NXWA 1OXXK 2JA8G 1TWCB 1NI2A 2YEPB 3ZIMA 4C2MB 4BXXH 3ETRA 4DUZL 1MHXA 2AQ2B 1E8YA 4JI0Q 2IT1A 2PW7A 1JB7A 4EZKA 1OXSC 4C4VB 2F0QA 3KWLA 1ICWA 1K83B 4C56C 1H8CA 1EQTA 1TY2A 5D3DA 2D3GA 1AEXA 3KK7A 1KRTA 3WWVA 3G6JB 3TEWA 4PT5A 4DUYQ 1TTNA 4A4IA 1K8GA 2L4NA 1WVLA 2QW7A 2WLBA 4LTUA 3RN9C 1WZ0A 2C7MB 2FINB 1Y1WB 3VYUA 2ZJDA 3CCJA 2V1YA 4G4KA 1TZ1A 4KY6A 4DWFA 3MTSA 2B39A 4OX9L 1F77A 3I4OA 2EKEC 1H9KA 1FRDA 4BZAA 2RHQB 2JA7H 3PPAA 4PZ8A 3NVWA 1LT3D 1K53A 1HH2P 1L0WA 1VQCA 3N9YC 4HJKA 3L7ZC 2KCMA 3Q8AA 1CT1D 1TKWB 3I4MB 3S1MB 4TKOB 4C3HB 1I6HH 4C1NI 1WGRA 1Z2MA 2V3SA 5CHVC 2CHXA 3A7LA 1K50A 3S9WA 3L2PA 4P75A 2CU1A 2OEDA 4ANVA 5BYSA 1RWSA 5EPJA 4IM3A 1SYCA 3DXJC 4RGNA 2AHOB 1VJKA 4PYUA 4RM9A 1NTGA 4N58A 4RF0A 2K5QA 4LF9L 5HG2A 4XWWA 1VQ7A 1EY8A 4MEMA 1Z6HA 3GZNI 5EE3A 3Q24A 1XLQA 2BYVE 2Q2TA 2R93B 1EYDA 4KJNA 1H9SA 1MFWA 1Y1WG 5KNBA 1YHQA 1T0RC 3EIVA 1WTRA 1HZAA 1O7LA 3MZ5A 3V62A 5IT9L 3PIOA 2A69C 3I55A 2QMTA 3PS6A 2XEWA 1SXTA 2UUAQ 4L23A 4K7SA 1Y8PB 5BMHA 3PZ7A 1G2SA 1S3OA 2LMCB 3U2SC 2K6AA 1N34L 2E3TA 5LMNQ 3SGIA 1C76A 1JQYD 4B9XA 3D32A 2Y5PA 4P16A 1WTVA 3IAYA 1E2WA 4MSMB 2AWNA 3I4MG 4MGZE 4C3HG 1I4GA 5FK9C 1ZXHA 1TS4A 3PREA 3S17H 3SHLA 2CHZA 4NXMQ 2A6HC 2BBCA 2TSSA 3A55A 2K04A 3NK9A 1B3AA 4GN3B 5KEEA 4DA2A 1WJ4A 4POGA 1L7YA 4EE2A 3H3VI 4TUUA 3Q3OC 1JQ4A 1EQVA 2RVLA 2Q8IB 2DZIA 1RCVD 2IHEA 4A20A 5CV4A 4LFCL 1JW9D 4PMBA 1L1OB 2ZJPA 3GTOH 3GTJB 3S14H 2R93G 2PCFB 2NVXH 1T6BX 3JAMi 1FR3A 3CAMA 1GUWA 1L6UA 5HY6A 3K57A 1AZQA 2O5JC 1HUNA 2IZVB 4XC2A 3B0AA 2LEKA 4DNTB 3HOYB 1RJTA 4HDOA 4JWUC 3EN2A 4ARCA 2BDOA 4KK7A 2JK8A 4W9GA 4ZHOA 5EDSA 4DNRB 3H15A 4PNYA 2GLSA 2VRRB 1GO3E 3T1HQ 3J9CA 4P7IA 2IY0B 4HN7A 2Z4IA 2UUBL 3WANA 3GTPB 1VZ6A 4A3JH 4LF4L 2HD5B 1QF6A 4JYAL 2ZZPB 3MJ5A 3S1RH 2KC2A 5CBEE 4NZLB 5C4JH 1KF6B 4RHRA 1TWGB 4BBRB 1NCVA 1V2YA 4YY3L 1Q1BA 1U4PA 3GS2A 1JOQA 4LMQD 1G6ZA 3P1MA 2KEDA 4C3IH 4L6TB 1YJJA 2BQQA 2TMPA 1DOYA 2K33A 3MHSD 2EYLA 4ZLTF 3QCAA 2KOLA 2YTXA 4B3TL 4YTNB 5BN3A 3H0GB 1ACCA 2X69A 2QF7A 1WRIA 3BWUD 2A8VA 3AQQA 5E7NA 1FIQA 4WJ4A 1PTOH 2XN9C 3KF6B 2DENB 3TBIB 3PF4A 1E7UA 3HOYG 4HROA 1WSPA 5I4DA 4L2YA 1V1OA 2EYMA 2MA9B 2KCCA 1PH3A 1V6EA 4ICUA 5M5YB 1KNAA 3A54A 5ELFA 1Q1OA 2K0PA 4TQ0A 1K73C 1RHPA 1MI0A 3WDNA 4C7ZA 1BCPD 1L1OC 2KWCA 1PQSA 3OJ3A 1EUVB 4WAAA 4RG1A 3W5UB 4KGRA 5AJ3L 1TWHH 4KTAA 2UU9Q 5DPSA 1U4RA 1AARA 2ES2A 4K8JA 1EWYC 4BBRG 2M0AA 3MXGA 3J80i 2KOXA 3K59A 4PMWA 2RCFA 2WDQB 1YHBA 2F0VA 2NBWB 1I4RA 2RF4A 1N63A 1NI3A 3PIP3 2N9LA 4F88A 4FDBA 3ABVB 1ZPSA 4JOIA 5JJZA 3J7YW 4JVZA 5M5WB 1ENFA 3H0GG 1VQ9A 1VQKA 1BBUA 1P16A 4JI3Q 4MJSA 3TCAA 1FD6A 1WE6A 3LWUA 5ELEA 1UF0A 1V86A 2C5CA 5C4ZA 1X9NA 4G7HC 1ASZA 4RGMA 1C0AA 1UD7A 1XJVA 2VW9A 1M1KC 3U7ZA 3GQBA 4A3DH 1V9PA 3PQIA 5E4WC 3KYDD 1KRHA 5K36G 3IRBA 2SNSA 3NUHB 4HEA1 2EMTA 1BO0A 1NMGA 3I72A 3C2PA 4FF1A 4GIVA 4I6NB 4HKQA 1B9RA 2O2VA 5DAUA 1MSGA 1WIAA 3KDFB 4DAYB 2K6QA 4KV2A 1I4QA 1HRJA 5E4XA 2KWDA 2NVTH 4US8A 3X0WA 2INNE 2UXBQ 4WJWA 2HHHL 4UP8A 2V3PA 2HIVA 4A3EB 1B8AA 1TS3A 1T3QA 3MEHA 1G291 1C8CA 2OCEA 1WGKA 2L52A 4HSPA 2GBRA 4KGTA 2L0CA 4LJOB 3AN1A 1VRAB 3CCRA 1QVFA 5GXGB 4CJ0B 2JXTA 4OO1G 4GDKA 3E0EA 3MFGA 4HK2A 2A6ED 4UY8C 2E2HH 2KFKA 2ONQA 5TSSA 4IUVA 4H02A 4LNOA 4NPNA 3PT2B 2NVYB 1SYEA 5EE1A 1XF5L 1WWTA 5HFYA 4GLSC 2L0TA 3HHMA 3K5MA 4AS1A 4C80A 1GC7A 2WX0A 4B3SQ 4V190 1NR4A 4BAXA 4YT0B 5DCNA 2QC8A 2ZCCA 3KYCD 2WDVB 4II2B 2Y3AA 2VXWA 1T5EA 3HZXA 4OGQC 3WALA 1EFID 1FFVA 2LHDA 3F1ZA 1WRDB 4ZRQA 3ZNZB 1LTLA 2KXJA 4W9DA 4BY7H 2KN4A 3JVZX 3L0WB 1NENB 3UIOB 1SFOB 2K50A 3BVMA 3MXNA 5G55A 5M5XB 1CHPD 1Q8IA 3OPOA 3AE8B 5C4HA 4DR4L 2UYZB 4A3LH 3VH3B 2E76C 4CDEC 2PMVA 1STAA 4A3EG 3MHZA 2B2TC 1JROA 2DHZA 2FUHB 3A0JA 1L2NA 3CWIA 2KJ6A 4QMGA 2NUCA 2B3AA 3AM9A 4OVVA 2EQSA 1G51A 2MNAA 2NBUA 3OLMD 2AWTA 3AMZA 4L5SA 2EYJA 4GOPA 1V81A 2XGTA 2JSOA 1Q0WB 3ML9A 3NSWA 4ZUJA 3CMEA 1VQPA 2UU7A 1JOOA 2PZWA 4DFAA 5A2QE 2M1MA 2NVUI 1STGA 2BA0A 1EL0A 5CR3A 1K0RA 1QCBD 1E1OA 3TP7A 1SNOA 1RIPA 1GC6A 1CK1A 4WH4A 4Y52H 4K2KA 1X3QA 3DOWA 4GNXA 4N8FA 3T16A 2MQJA 3MAQA 3FPPA 4ZQ3A 5CGKA 5G5GA 4E74A 5MPOA 1BVSA 3VYTA 2FIDA 4DUZQ 4DHZB 3OHXC 4OWXB 4W9JA 2Z9HA 1XT9B 2E5LQ 2IPKD 4OXPA 3S2DH 4GZYC 3AU7A 5CC4A 1DZ1A 2NN6G 1GHKA 4MH0E 3T3NA 3KJOA 5K5PA 5EE0A 4R4TA 1X3PA 1C9OA 5CYUA 1NVID 1J7BA 3AE1B 3FC4A 1QILA 3PCOB 1E8WA 1R4NI 1YN4A 2DNFA 2XSCA 1YX5B 2NTTA 2PI2E 3URYA 3W5VB 1TWFB 4BKGA 2GMIC 5JPMC 1PV4A 4XYQA 4JI2Q 1GUOA 4KKSA 1K8MA 2WV6D 1S40A 2JWUA 3RI7C 2D5GA 3J7A5 4F8CB 1ZYRD 2J0TD 4OX9Q 1G6PA 4K5XA 3BINA 2BWFA 4IOIE 4JI8L 2LXAA 1IBXA 4L5TA 5C44H 3SFDB 1JE5A 4EGVA 3M4OH 2ZXPA 2F3VA 4EQ5A 4QCLA 5GROA 4DDGD 2I2YA 2MBQA 4IFDG 4DU9A 4IC7B 2KLCA 3W1YA 4DV5L 3LGJA 5I6WA 2OTLA 1TQOA 3IFWB 2J0MA 1O7YA 2LVPA 4HIKA 1SE8A 4P1CC 4LFAL 2B3GA 5JZEB 5CV8A 1HNWL 1NNXA 1MKHA 3SR1A 5C0XG 3AE4B 3DHHC 3HK0A 2K1BA 1FCCC 2WNMA 3H09A 3H91A 2FMMA 4EFOA 1XTDA 4LCDE 1VZ7A 4ZCKA 4LF9Q 1QZEA 1B4OA 4P74A 4HKZE 1WMHB 2MJ3A 4B0MA 4OELB 4M1UB 1HZCA 2D62A 2WB1E 3HUIA 1EQRA 4N9PA 3D0FA 5JEAH 5FKAC 1K0SA 3D31A 1PH2A 1SB3C 3P4RB 3AULA 5AZFA 1SE9A 4QF4A 3A74A 2WGSA 5KYIA 1FXIA 2LHEA 3DDCB 3I57A 3Q8CA 3MXPA 4A3GH 3NWTA 1S1QB 4TV3A 4XWTA 1N34Q 3C19A 1HQRD 4AWJA 2X6GA 4BOSC 4XZ4A 1XQQA 2LVQA 4GN1A 4JW0A 2AKWB 2WKDA 3M63B 4UP7A 1D5MC 3NZUA 1CJEA 4E3CA 4IUUA 2KK8A 2MO0A 2LRWA 5H1SE 1STHA 3ULJA 4L63B 3KQ4A 2JF5A 2K6DB 4E71A 2WS3B 1DGJA 2O2LD 2N9KA 4Y7NH 2N3SA 1LUZA 2IO0B 4YCVA 2SNMA 2MHVA 2PMZB 3KLRA 4GU2A 3EECA 2BTEA 2DWQA 4WJQA 3MJWA 4LFCQ 2PNRC 4HJ5A 5COYA 2B2VA 2ZW1A 2WXGA 2F3IA 4IJHA 2N1WA 4F7XA 3NZ3A 1E7VA 2Z1CA 4MM3B 3CF5A 1ILPA 2VY3A 3PHXB 3I4LA 2KTFA 3M3YB 4N59A 3I7FA 2DZKA 1ENAA 3Q2AC 1D4BA 1EY9A 3L0OA 2QILA 1BUVT 4IUPA 2MCNB 1ESFA 1WXSA 3MTNB 4B95A 1I6VC 2CFMA 1DOXA 3CP0A 2UUBQ 4J1MA 2JEAI 4S17A 2NYZD 3D4RA 1BUIC 4OW0A 4LF4Q 2O6VA 3SDZA 1YNTE 2HDEA 4JYAQ 1X3FA 2CU3A 2F3WA 2X38A 3B1LX 3DVNV 4J3OD 4ANUA 1DGSA 2MJEA 4KKTA 1FXTB 2DX5B 3MA2B 2CWPA 3ZJUA 3CIRB 3H7PA 4YY3Q 3R2TA 3RFZB 1HR0W 3RPFC 4HCPB 3VTWA 2KDIA 3AE6B 3EA6A 2DAFA 4KLKA 4O42A 3ECIA 4ZOHC 4X62L 4MGYE 2MBEA 1T5XD 2DYOA 1XPUA 4WAFA 2YEPF 3K7AH 4HDQA 1PYBA 1B9MA 4B3TQ 2BYEA 4XDCA 2GN5A 5ELDA 1PGXA 2Z4HA 4X3TA 3T53B 4X64L 3J7AF 2WAQB 1JICA 3GV6A 5ELBA 3ZXRA 1VQ5A 3G6EA 4NW2A 4URKA 1WGGA 3CF6E 3N32A 3A9JB 4MGKE 3E9HA 4NB3A 5M3FB 2YU9B 1XNQQ 3J7AV 3QJZA 3N1XC 2KVRA 4A6QA 2HJ1A 3CU7A 5A35A 2UXCL 1F2YA 4LUZA 3BG3A 2LUEA 3A4RA 3CCQA 2DNCA 4FYDA 2H89B 1VF7A 3HIZA 3QWZB 2MRPA 1LTRD 1PZKD 2WXOA 2BVCA 1N36L 3Q23A 1Y56A 3H8HA 1IW7D 2J0KA 2MFIA 2M2LA 1PUTA 3ER0A 4ARIA 4BKTA 2EYPA 5IGCA 1P0RA 4IPCA 4KD3A 1T0SC 2CJOA 3D6CA 2XK5A 5IOCA 3HOVB 3ZKJC 2PQAA 3CPWA 2HQLA 3RUZA 1KM7A 3A9KA 3TEZA 1YJNA 3LX0A 2N88A 1X54A 3C46A 2X8XX 3TBLD 5GAHC 1CKNA 1UWMA 4KZ0A 2EY1A 2ZT9C 1EY7A 1OGWA 3RLFA 4QUFA 2K1FA 2ZEQA 3BZDB 2WAQG 2WAQE 1ASYA 2JRIB 2IGGA 2F0FA 1MG8A 2DYBA 1STYA 2KBNA 4HLEA 4DBGA 4FF4A 4EZLA 2KD0A 3CCSA 1A62A 4IWQA 4EX5A 5M3FG 2JWZA 1NYQA 1WXVA 1IHZA 1HCZA 3OTOL 1NMFA 2K28A 2Z6KA 2J0JA 3SK8A 4ZHPA 4BA1I 3WAPA 2LFNA 3MWYW 4YCWA 3BYTB 4KHPL 2W3SA 4KKIA 5IKCM 1PDXA 4IUNA 5EQ0A 4C4VA 2MH7A 1PRTD 4PG3A 3DHGC 1GAQB 2BYTA 1GB4A 1KAWA 3FRPB 2K5VA 1S72A 2G9DA 4JI7L 4Q0FA 2QJLA 1WGYA 4HPMB 3CC7A 5D6JB 2HHHQ 3ZO5B 3J80L 1Z9FA 3NENA 3HOVG 3ULPA 4OWWB 1JWAD 3DVGX 1V97A 3CCMA 3NBIA 3OIQA 1SE3A 2KDFB 1KDCA 1IGDA 1UUPA 3OAWA 2WXNA 5EE9A 5LXIB 1UWVA 3ZTCA 3STBC 1ZDXA 2PW5A 4NP5A 2ZTDA 5JEAJ 1HPCA 4I7AA 1Q8KA 4A76A 1OFFA 4JI4L 3EJIA 1N9WA 3HGBA 1VR9A 3NOBA 4XQQA 3PF5A 1VQOA 1C78A 2K32A 2RPVA 1X65A 1D1KA 4DXFA 4K0KL 3SXHA 2JYTA 3AU5A 3DCGA 4JBWA 1WM2A 2R7DA 2FAZA 3Q8FA 4A3PA 1KDBA 5IO9A 1EFWA 2F0IA 4A3CH 5C5LA 3KW5B 2RBMA 4DAPA 3KUDB 2NWGA 2LJ5A 4UHVA 2BOSA 5C3XA 3KJPA 2N9PC 2E2IB 4C7YA 1RFKA 1KABA 4BY1B 4A3FH 3Q6BA 3K8AA 2V0GA 1ML0D 3QG1A 2J53A 3QQ8B 1NYRA 4ZRIA 4DR4Q 2VUMB 5D14A 1QNKA 4ZAIA 2IX3A 1XCTL 1PTOD 4LDTD 4MNOA 5IGGA 3PRZA 1WH3A 3P4SB 1A63A 3AE3B 2VB3X 3KUPA 3R2IA 1OXVA 2E2JB 2NVQH 3RZWC 3V96A 3VR2A 2RKSA 1MHHE 4O2DA 1IBLL 4RNAA 5CHWA 2LMCA 1N6ZA 3CC4A 2HDMA 4O0AA 5IE8A 1SYBA 1CA5A 1D2BA 1PFBA 1PZID 2IL8A 4GS3A 2D5DA 4XGAB 2EYFA 1RRBA 3BDOA 1CUKA 4B9KA 3IG3A 4FJZA 2DY8A 4HRSA 1EIFA 3DQVA 3U9SA 4EUTA 3S16H 1PH1A 2WDTB 3WOEA 3GTMH 5LMNW 1KDAA 3TJPA 4BY1G 4DKAC 1ESRA 4BXXG 3PO2H 3DVGY 2KKCA 1TGZB 2LGXA 1B9NA 1JOKA 4O1NA 3VAWA 2YYZA 1FNWA 5HHDG 2DGYA 4A3IB 3NVYA 1JR0D 2VUMG 2PO4A 4US9A 2IO2B 5H8YE 3U7DA 1IYUA 2WXRA 3L3OC 3OMGA 3RNEC 3RN2A 3G48A 2NPTB 1A2TA 3CCEA 2MX2A 2JP1A 3HOZB 1MI2A 1ENCA 1SDFA 2MPMA 4K3BA 3ULLA 3BYYB 3WAMA 1RYJA 1J7CA 1VQBA 3TS2A 4DK1A 4RF1A 3PVLA 5IYCH 2RSNA 3T1YL 3UI2A 4JG2A 2RGFA 2Z6BA 4LUOA 4ACFA 2ZPNA 5JOBA 3HOXH 5IODA 4GLXA 4K1RB 1PA6A 1YVCA 3GTQB 2WU5B 1L0YB 4JI8Q 2A1AA 2M8SA 1Q81C 4PZ6A 2J4XA 4G7ZC 4DK3C 3ZGZA 1GJXA 2IY5B 1SE2A 2YTVA 3CRKC 2LKVA 3DPDA 4GSWA 4DV5Q 3RZOH 3S17B 1VZ8A 3Q3MC 2CHBD 1SIFA 2LGYA 5BN5A 1I42A 4JV5L 4LFAQ 1C7YA 3SVMA 2DAJA 5EKKA 1JRPA 1FNVA 4GOCA 3J81c 2JEBI 3IHPC 4A3IG 3NWSA 4LNQA 3DHQA 4QGUA 3NRZA 1NY4A 3KF6A 4I7ZC 2VQEL 1LM0A 3TMPB 4GKJL 3HOZG 3GTOB 2KN5A 3S14B 3T9LA 2H4OA 1WJJA 1EYGA 5JJKA 2H88B 5D94A 1EZ8A 1U0LA 1GUNA 4DK6C 3EQLC 1WYWB 2QKIC 1P1AA 1H9RA 2KA7A 4LNIA 4HVBA 2L5TA 4PMCA 1IYFA 2ZM6L 4WQMA 1E9MA 1F9JA 5IP7G 3K5NA 5BYQA 4K6DA 1EEID 2CVRA 1HTPA 2BWES 2JA8H 1G91A 1NEKB 3BK2A 1IGCA 3EGRA 3Q8EA 4LFBQ 3R7QA 1A5RA 3TIXA 3CQZH 4LF5L 5CV7A 1RTNA 1OEYA 1HFGA 1ILQA 2UXDL 1QJOA 1F52A 3GTLB 3K7UC 1CI3M 4LK0M 1NBWA 2AX5A 2VQFL 1VS0A 2FMCA 3G7LA 4GN5A 2WKCA 4RCNA 2L00B 1VDVA 1YOVB 1TKYA 4GGQA 4K8IA 2N49A 5GAGC 3RNFC 4C3IB 1K8RB 1QOGA 1Y8NB 3R7RA 1S5DD 1RKNA 1D7QA 1O80A 1DOMA 4R4CA 5CTRC 1QOBA 1S4ZA 5D3IB 4HPLB 5A2QL 3Q3FA 1PTOB 2B2TA 2OQKA 4DV4L 4M8AA 3A7AB 3KF8A 3KBGA 4XDXA 1LQBA 3ZVVA 1XTCD 1AE2A 4TSSA 3ZJYC 3W9CB 3ZTDA 1TU2B 4ABNA 1MJDA 4REZA 3KDFA 4WJPA 3A1QB 3BIID 2K22A 5G5HA 1TWCH 3SR6A 4C2MH 3PUZA 2RCNA 2MQHA 4A55A 3D4DA 1XXGA 2WXIA 2HJ8A 3N30A 2R2QA 1MGSA 3EVQA 1PH5A 3G71A 3PIO3 4RKBA 4XXEA 1I35A 2M17A 4M00A 1VQ4A 5D65A 2EYHA 2R2OA 3W1SA 4K5VA 4YWGG 4BBNC 4X62Q 4C3IG 1HTLD 4FLHA 1OQYA 4RAUC 1QVCA 1ICFB 1QB5D 3P4PB 2SEBD 3SDLC 4CKBA 4JWSC 2PZUA 1E22A 2F0OA 3UE0A 3GZNB 3HOUB 3F2CA 3DBHI 1MSHA 1VLBA 1J6QA 2K52A 4FXKC 2LXJA 3G4SA 4JI5L 3ALBA 3QARA 5T8IA 3Q3JA 2JXXA 4NAWB 1OXUA 3MVVA 5FJ8H 3K9OB 2OEOA 2KQ7A 2EPBA 3VH4B 1FD7D 3S1MH 4ME5A 3C8YA 2G1EA 2UXCQ 1BNZA 3NY5A 3T13A 4HIDA 1SSNA 2WYQA 2YVCA 4TVAB 4IWOA 4KN7C 3N1ZC 5AZHA 1QG7A 1H4RA 1N36Q 1MPEA 3KFUA 1HUMA 1PTOC 3AFPA 4FJYA 4KD4A 3I4NH 2NVTB 4HJGE 1SJHD 4R4OA 4RGOS 4OO1I 1WCMB 4B3RL 2R93H 5IWAL 1JMLA 4NY0A 3KUZA 4FA6A 1EF5A 2KVMA 4CDCC 2HUGA 3PMFA 3HOWH 3GO5A 1GKHA 3IVFA 4N6EB 2BS2B 4PYZA 4IUTA 1I3QH 3CPFA 1CQVA 1LTBD 3S1NH 2FFKB 3PUVA 3HOUG 1GG3A 1VCBA 4R1JA 2D3AA 4HJ9A 3FILB 2D2CC 2Q2UA 4HCNB 2ZCBA 2KJHB 1VQDA 1WTHA 1RDPD 2B2YC 2ACZB 2JPHA 3VVWB 1M8AA 4GDLA 1V8QA 4AIMA 2R7ZB 4KJOA 2ZVOA 2L05A 2EKIA 2D10A 2XTIA 5C3EB 3OTOQ 1GXDC 3OSOA 2I1KA 3HVZA 3X23A 3K5OA 5HURA 2FCSA 3UQBA 5EJWA 1VQEA 4HWIB 4KHPQ 2LJIA 2L11A 1W2BA 3ONSA 2F0WA 1D3ZA 2HE7A 5CV5A 4BY7B 4HTHA 4ICVA 2Q8TA 1YJ9A 3GTGB 1GB1A 4ZRKA 2CR5A 2MBBB 2GI9A 4JI7Q 4FJVB 4A3OA 3A5UA 3F2UA 1KLGD 1RD9D 1WCMG 4HR7B 3GTKB 3RYTA 4PQXA 3GTJH 1UWXA 4IPGA 1OTRB 2I07B 2FNJB 4JGHB 1KLUD 3I9V1 3UGBB 2AQ1B 1VQJA 1UE7A 4KI0A 2HTME 1I4XA 3DWGC 4LUVA 3HOYH 3GE8C 4KHVA 4F87A 3V60A 4DR6L 3ZW3A 2YLMA 1Y69U 2KJRA 4JI4Q 2D0PA 1CMXB 2N55A 5DLQE 1KIXA 4LAAA 2PTLA 2W54A 4ZYSA 2KHJA 1CFMA 1SE4A 2GA4B 4FNFA 4UPAA 1R9TH 2R7ZG 4K0KQ 2R92B 2MEKA 2MSED 3DBSA 3D8GA 3GTPH 5C3EG 5KHQA 3PO3B 3ZXVA 2LWPA 3H3VC 5CORA 4G57A 1TWGH 4BBRH 4IUQA 3S15B 2EMSA 4BY7G 3E3XA 3KLSA 4I65A 2PPHA 2Z0EB 1D6EC 2KQ3A 3DBRB 5KHOA 3NTIA 1T0YA 3JSVB 2MP1A 1H95A 3DWAA 2EYOA 4YSZB 1UEAB 2BCOA 5KNDA 1QUQA 3VDYA 3K0YA 1FNUA 1WYDA 1EUJA 5ELNA 2IGHA 4OZCA 2PZTA 3N52A 3S2DB 3T56B 2BB5A 1PH6A 4QIWB 5DM73 2QCPX 1RAXA 1YITA 2BT6A 4R8IA 1X32A 3D4WA 4IALA 1IXRA 1A70A 4JBJA 4JIOU 1VQLA 3R3MA 1PVOA 1O78A 3AE9B 1IBLQ 4IJLA 3UDIA 1KHIA 1EY5A 2JJQA 1STNA 2XWBB 2K14A 4FO2A 1F9RA 3AEAB 3CRLC 5K36H 4DNIA 5M5YH 2DLBA 3NS8A 3B6YA 2EDGA 1QZHA 1RL2A 2R92G 2MHJA 2BGFA 5BO4B 2QIEB 4RFBA 1ISNA 3M4OB 3PO3G 3PO0A 3VUXA 1RTOA 1JT8A 3VTUA 3ML8A 1N8RC 5FLMG 2MP2B 3BZKA 4KIKA 1VDZA 4H2AA 4M01A 3QOJA 1LV9A 1B3QA 3GOEA 3NS1A 3AMUA 5GAEC 2IO1B 3VXWA 5FLXc 3U30A 1CKOA 1Q12A 1SGHA 4JE3B 2JT4B 2DUDA 3O13A 1B1ZA 4MM3A 3K80C 4QIWE 4OO1H 2CKHB 2AYOB 3SHQA 1EZ6A 4ZK9B 3NZSA 5E6OA 1XPOA 4IOAA 4B3MQ 1E1TA 2B76B 2KTRB 4DXAB 5H92C 1NJIC 3V3XA 3FKIB 3K9PB 5IT9E 3T1YQ 1SIJA 5C6AA 4R8NA 1EY4A 2FJ2A 3OYYA 4L8JA 3UDXA 3DLLA 4FHKA 1WFYA 5JH5C 1W6JA 4NQLB 1LYLA 1YN3A 5FR3A 4OZBA 3GDEA 4EQOA 2VZKD 4UP9A 3KUCB 1EOVA 1BCPB 1LTID 4X3SA 5DNFA 3TRZA 2WHIA 1WTWA 3U52E 2QHOA 1J8IA 4YIJA 5HGQA 3RLOA 1AWDA 2RSUA 2JY6A 4AQ7A 2WB1B 2LRUA 1CQFA 4WWNA 1PFDA 3O65B 1RODA 2JN4A 4J8QA 4A3EH 4JV5Q 2JQRB 3LXFA 3UI3A 1P9DU 5FR6A 3A8JE 2DNEA 3BDLA 1UH6A 1VMCA 2M9VA 4HXDA 4J6IA 4DF7A 1SF0A 4W9EA 5C2TB 1QQRA 4GLAC 4B6WA 4ME3A 1K28A 4A3BH 2F52A 2VQEQ 4FVMA 5BYRA 1LTTD 4GKJQ 1FEHA 3S2HH 2ON8A 4K81A 2NVYH 2HT1A 3A9JA 5CHFA 2L9HA 1OTCA 4IW0A 3ZRCA 5JEAG 4EVOA 2KANA 3FKIG 4A3KH 3DBLI 1E7ZA 4PK1A 1RM6C 1Z5SB 2CKZB 1V49A 3BK1A 1LLRD 2IGDA 4MJSB 5JPNC 3QK0A 2ZM6Q 5IYDH 2JRHA 4JI6L 1TY0A 3J81E 1A0IA 2OJRA 4NPSA 4ASWC 3TZDA 3VHTC 5CMDA 1N61A 2ZTCA 4LF5Q 4M0WB 3JAMc 2JX5A 2KQSA 4NQKE 3M4YA 1SFOH 2UXDQ 5M5XH 3QO2A 3APFA 4ZKCB 5EGTA 2WB1G 1YNND 5IP9H 2VQFQ 3EC8A 2Y5CA 2K3UA 2PNHA 3NHHA 3PV0A 2KHSA 3AEVA 2WXPA 3DEPA 5G2NA 2NN6H 5HKHA 1J5EL 1SLJA 3K81C 4DUYL 2QSDA 3HKSA 1S3SG 2K8BA 1F9SA 1FJGL 1BCPC 2GBNA 5KYLA 3PRPB 3IFDA 1YJWA 4N9F4 1B50A 1NE3A 4YCUA 2FCNA 4BBSB 2V4IB 4DV4Q 4M02A 2MO1A 4OIJA 1HZ9A 2XIWA 2KFKB 3E5SA 4G11A 4P72A 1DD2A 3D3RA 5JJLA 3RMHA 1GUSA 1WX7A 3I63C 3TUOA 1C79A 4CBVA 2WINB 1ZKHA 2MBHA 1WTQA 4OZAA 4OWTB 4AP4C 4A90A 3EFUA 5KGUA 2GVAA 2IHFA 5ISRA 2N7DA 1WTOA 4JK1C 4RA8A 2PKOA 3ZYYX 1LT5D 1Z47A 1E24A 3B9JA 4BKSA 2D07B 4DV1L 4CO7A 1MJEA 1R7SA 4AYBE 1VQIA 3ITPA 4S3SA 5C0XH 1I4PA 2KO3A 1R4QB 1TIID 1I94L 3NQIA 3P75A 2KMCA 1WOCA 1GJZA 3TMEA 1TWAB 1BBWA 2JE6I 3KOJA 4AQYL 2K01A 2L55A 5LL6X 1T9HA 3RZDB 4G0NB 3FP9A 1RLFA 3MC0B 2P5ZX 1TWFH 2Z8LA 4X66L 2IDYA 2NR2A 3TEXA 5I6YA 1R4MI 1SN8A 1YNJD 3AXCA 1JWUD 4KDIC 4WURA 1SAPA 2IW3A 1VQHA 2NB0A 4YL8A 2LASA 3C1FA 1JALA 4JPSA 3BVZA 4LF6L 1STBA 2KMAA 1YN5A 4BBSG 4JI5Q 1LFDA 1MIUA 2J7QB 5FO7B 3J80c 2VH2A 1AN8A 4XT1B 3U50C 5L37A 3P42A 2LY7A 5LLIA 4JBKA 1EOTA 2B2WC 2SDFA 3BVGA 2C60A 2O6VD 3SFEB 1SNPA 3CCUA 2LUMA 4KX6B 2FUG1 1SNQA 1KRSA 1JJ2A 3ZNHB 3IL8A 4XYCA 3FVQA 2A6EC 2OWOA 2WXLA 4GNXB 2JQOA 1OEYJ 2JUOA 2PE9A 1EIHA 3N6RA 2B63B 1U5KA 4QY7A 1AFPA 2INDC 3CXCA 2A5UA 1ONLA 2R61A 2W3RA 1X3GA 1HE8A 3L08A 4P2CB 4KN4C 2NCNA 1Q10A 1MVKA 4B3RQ 1JB3A 2EXZA 2V1CC 3RNBC 5IWAQ 3A8IE 2XRQD 3HRZC 1F2RI 3L16A 1A15A 1IKMA 1L6VA 4ID6A 1V1PB 3Q14C 2BS3B 2LZ6A 4JC0A 3S1QB 1WJ6A 1WJUA 1XD3B 1XNRL 3UDFA 1SRUA 2OXPA 5FOBB 4IWPA 4DHJD 2FIFA 4GKKL 5J2RA 5AJ3Q 2NTSA 2WP8J 1XMOL 1N32L 1I4HA 3KLSX 3KYHC 2F03A 4OEMB 2XBBC 3TEYA 2NZHA 5LMUL 2KMMA 4OL7A 4BOZB 1SNDA 2O5IC 5JHBA 3NBHA 5GADC 2H1EA 3E0JA 3I5JC 2F0NA 2LD9A 1WI0A 4A3MH 4L5QA 1AE3A 3VYRA 2W55A 5JHAA 4BBNF 3NP8A 1C9FA 2LS01 2NPTA 1P3QU 2B63G 4GOPC 2N8NA 4KY7A 2Q5WD 1C4PA 1V80A 2I38A 4W9LA 4DR3L 4XX5A 3HKZB 1VMPA 4AOFA 4IQZA 3Q69A 3L9AX 3ND8A 5EAYA 4CHTB 1TJEA 1SMXA 3PUYA 2B8GA 1YQBA 4EKUA 4EZJA 2Q2IA 4XE0A 3DWQA 3MXUA 5T1IA 2CH4A 3KWVA 1IL8A 5GMVA 2NVQB 4X6AH 4KGSA 3TS0A 2IBIB 2BH8A 3AEEB 4DR6Q 4GNXC 3QIJA 3TN2A 2JA6B 1KTKA 1MHWC 1D8LA 4C3JB 3B08A 4ZYNA 5G3LF 1I5FA 1BDOA 2KWVB 1D5ZC 4LJPB 2LSSA 3LYYA 3S16B 1PTOF 2WFWA 3RNAC 4A3CG 1PH8A 1SBBB 2D9UA 1Y1VB 3K58A 4H44C 4HJ7A 3GTMB 2WXMA 4OVZA 2K5DA 2OOBB 2MJDA 2BE5D 3UIPB 4FADA 2H5XA 2OQ0A 5M3MB 1YIJA 2L0FA 3MC9A 1ZYRC 2A6HD 1AP0A 4WJNA 3HP3A 4PS8A 1F2LA 1HXYD 4W9IA 1FO4A 3Q8DA 4A93H 4P1BC 3HKZG 2M4NA 3HKZE 3QAQA 3MC8A 1E0BA 4RKLA 2G5DA 3IFTA 3DMUA 2MJ8A 4QJFA 1KL9A 5HGTA 5C5MA 4Q5VA 4WWMA 2F0PA 5IYBG 4C00A 2Y0SB 4N8X1 3AB5A 2GVBA 2IYDB 4DV2L 3RULA 1P98A 5I2YA 5E1FA 2ZNVB 1Q86C 2JA5B 2AWOA 5BN4A 5M3FH 4K5WA 1I50H 2I5HA 4ZRZA 2YU9H 2JA6G 1I7HA 4C3JG 3A33B 1HQMC 2D0OA 1P7EA 2QDBA 5J18A 3TQYA 1OO9B 2L83A 3I70A 2EXDA 2IX0A 2BYFA 2F4VL 1L0XB 2JZPA 1BKBA 5I9PA 1KD1C 1C77A 1D5XC 1Y1VG 4MH8A 3C3LA 4NJCA 3M4QA 3NTKA 4X3UA 3MFYA 1WXMA 4C1NK 2PVOD 4FN2A 5M3MG 1F9PA 3U9OA 1LT6D 4MT5A 3RNCC 1VQNA 2JU6X 1C1YB 3QIAA 3VR4A 3H7PB 1E8XA 2K5WA 1G8ZD 1W3SA 2AUKA 3PGEA 2ZTEA 2XWJB 4KZCA 2KLGA 2JA7B 4ANWA 4LJZC 1PFMA 3MEFA 2GOWA 3NHEB 3FHWA 3W3AA
chains in the Genus database with same CATH topology
5M9OA 1JWSD 2EJFC 1EY0A 1I6HB 3OOCA 1FRRA 1EU4A 1BBXC 1EWHA 1EYCA 2EE1A 5FLXE 1G2TA 1WXQA 3LB8C 2B2YA 4FF3A 4KHZA 5KNCA 2A5HA 2OT2A 1LTGD 2RDHA 2KEEA 4WORA 4Q2JA 3TP5A 2F0MA 4NAMA 3AECB 2KQ4X 5IGEA 4RCOA 1M4VA 3T51B 1GOZA 4QUCA 3P20A 1JORA 1XCQL 2WXKA 3AE7B 1QKZA 4RWSC 4DGZA 1CM9A 1D1IA 4EQNA 3QJYA 1F0ZA 2F0EA 2E74C 4G7OC 4CJ1B 3HVDA 2KDMA 3DWMA 1L4DB 4F8MA 4X3KA 1ZXTA 4KY5A 3TP6A 1PRTB 4KMUC 3DM1A 1XX8A 1ZUD2 1HA5A 2NVXB 1SYFA 3SEBA 2A68D 3R93A 5NUCA 3FILA 2BB6A 4WFN3 3H94A 2B8FA 1EY6A 1F2ZA 3VR9B 1TT2A 3IT6B 1IW7C 4YTPB 2WACA 3JAME 4FF2A 1S5BD 2F0SA 1II3A 4A3JB 3U4EG 5DM63 1L4ZB 4P6VF 3S1RB 5C4JB 1TYGB 4PV1C 1TS5A 5D7GA 3BDCA 4B08A 1E2VA 2EZVA 2DYMA 2W82A 2PW9A 1TVXA 1BXTA 3I4NB 1W6KA 2KUMA 1FM0D 3LWEA 2K03A 3SK5A 1B44D 1PDQA 3HOWB 1ZDVA 4DAYA 3X3NA 1I3QB 1PRTC 3S1NB 1JWMD 1L0VB 3CKIB 2RA4A 2E6XA 2AUJD 1QOHA 1TWHB 4IN3A 1OQQA 1U9RA 2K7VA 3X3MA 2GB1A 3K6OA 2RQXA 3SE0A 2F0KA 3VYSA 3ZJVA 5JXVA 1LACA 1XLOA 2K05A 3ND9A 1BCPF 1E7PB 3J80E 1TR5A 5FO9B 3D6WA 3P1HA 1C4QA 1H9JA 1LABA 3GV3A 4BA2I 4A9AA 4A3DB 2B2UC 2X6LA 2N7JA 5I9OA 1QNUA 2A74C 3IXSA 1A3VA 3J81L 1ZE3D 1R9TB 2K5PA 3AE2B 5KRUA 1XYIA 4Z9CB 1P7FA 1DOKA 2V3NA 3OIPA 4XIGS 1YQ3B 5BMIA 3NPPA 2KJXA 4XYOA 4H7BA 1ZP0B 1KAAA 5HI1A 1XEEA 5KIXA 2E2HB 1PZJD 4B9WA 3GP7A 4DAVA 2BE5C 2HCCA 1C48A 4J6HA 3NE5B 3AH7A 2F0GA 5J1ZA 3KBXA 1EEFD 1EWCA 1SEBD 4HMIA 4DQOC 3V2TA 1WD0A 1FCLA 1NUCA 3V05A 1OXTA 1XLPA 2IJ0A 1NAPA 1YMHE 2PQEA 1MD2D 2EVBA 4LK1C 1BQQT 3MHBA 1AYFA 2RDGA 2F4IA 3NUCA 1ET9A 3EUB2 2ZXOA 2WU2B 2KACA 2RDFA 2EY6A 4ODGA 1H9SB 3PUWA 1CZGA 3HG9A 3AE5B 4K2LA 2MUYA 3B2FA 2CW0D 5CV9A 2LGIA 1SNMA 3GB1A 5CBAE 2XRSD 1JC7A 2WP9B 4E6IA 3W2DA 3R3OA 4TQUS 3T4AC 2NN6I 4M0WA 1R4PB 3E56A 2M56B 5AUIA 3Q22A 2INPE 4BWGB 4ZUIA 4XTCS 2VB2X 3VRAB 1EIGA 1CHQD 2ZXRA 1PGBA 4LLGM 2FE8A 3VR5A 2WXQA 2B2WA 2A68C 3FEWX 2WDRB 3EROA 1QWYA 4MN3A 4XT3B 2L12A 2A73B 1J9OA 2IWHA 2AQ3B 4IFDI 4A3BB 4TMAB 1SYDA 1GHJA 2MGSA 1HFNA 4DK0A 3S2HB 5C44B 1JE4A 4CKEA 2BA1A 1C4AA 1DOLA 2OHFA 5IGBA 4A3KB 5C0XI 3NVVA 1DCZA 4H0LC 2PLPA 1ZEQX 3ONAB 1CA6A 2XNAC 2NMQA 2F1MA 2I46A 4OHJA 2G9HD 3QB3A 4QB4A 1A3TA 4CJ2C 3LNNA 4CKCA 1J7AA 1FGBD 5LHY1 1UNSA 3P7JA 1FYCA 1MBYA 1AW7A 3I90A 3PZ8A 2JYEA 2F0HA 2E2DC 5E6JA 3MP9A 4A3GB 2WQYB 1FXAA 2PIAA 3M7NA 4XQJA 1LO5D 4FP5D 1V8CA 4RGTA 3NQTA 4FXCA 1PLFA 2K9XA 3M7GA 1LTSD 2GRIA 2J7ZA 1WTPA 4A8XC 4YSXB 1DJRD 4GDLB 5EKLA 1VF5C 1F9QA 5F2DA 1Z7TA 2OF1A 4Y7NB 1EM7A 2IX1A 3VQIA 2ID0A 4U68A 4IURA 1HZ6A 1IKLA 2DN8A 4WIPA 1E2ZA 1DONA 1V1PA 5J39A 3AEGB 1YJIA 2SAKA 4FXGC 2ENBA 3IAS1 3ZQ4A 1STEA 1UGJA 1K8OA 3VR8B 1PMRA 1RF2D 4HCSA 1F2MA 4HCEA 1SSOA 3OWEB 2CQAA 4AYBB 5EPLA 3AEBB 4H13C 2F0TA 4R9WA 1PYWD 2ICEC 2F0DA 3AV8A 2KECA 1BMLC 1TS2A 1BF4A 4MACA 2JXMB 3K7AB 1L5PA 3E9SA 3IT4B 5I2XA 4YSYB 2PVGC 5BMGA 3PUXA 1KNEA 1YQ4B 2F0UA 1DYQA 4N9TA 4GDKB 3AEFB 4USAA 4U673 4RH6A 3A8KE 5DEHA 5CV6A 3WCQA 1CZWA 5FO8B 3TSSA 4IFDH 3CHBD 2KCNA 2EJMA 3C1EA 2C9OA 1H9MA 3E6ZX 1O7ZA 3QWNA 5J22A 2WIIB 5FLXL 4BS9A 1KFYB 2R3ZA 1XO3A 2L1BA 4HSVA 1E10A 3QOLA 1TZOA 2WXFA 1Q90A 3VRBB 3DEOA 5ELCA 2DBYA 3I3CA 4A3MB 1HEZE 3TZUA 3VR6A 1E0ZA 2BS4B 3RD4A 2CJNA 4DN4M 2CW0C 2L1AA 1JCKB 1QOFA 2NZ1D 1K52A 1PGAA 1EYAA 4EQPA 3Q6SA 4XDDA 2HDLA 1A3UA 1S5ED 1GPXA 2WXHA 3IAM1 1SMYD 1FMAD 4XQNA 1HA6A 4RHSA 3SK4A 3L4PA 5JVG3 1N62A 2VZKB 3ZJTA 3BS1A 5JVH3 1B2TA 1XLNA 2HCIA 1QT9A 2HQEA 1ZKOA 1K51A 1CZPA 4B0EA 2JSVX 3H6MA 1LT4D 2EELA 3FMCA 4KKUA 4KKJA 5EPKA 4YXDB 4A93B 3IKJA 1B53A 1PRTF 1ET6A 5IIFA 3HRDD 1V43A 5E3FA 3JAML 2M19A 4NKLA 3A56A 1ROEA 1A2UA 2QEJC 4TRDA 3DUZA 1TKEA 1U4MA 4DXGA 1IBXB 5T1GA 4CGYB 1TKGA 2Q8RE 1I50B 1NR2A 1S5FD 1AZPA 4WRDA 4R3DA 4A3FB 1CTMA 1QE6A 1UAPA 1JWBD 1HZ5A 4HMJA 1QLBB 2L32A 3Q8BA 4ULLA 3SK6A 1S5CD 2FHTA 4ZRPA 5EBDA 2J42A 2NBFA 1KH0A 2FBWB 4ITKA 1Q3LA 2BW2A 4L1BA 4YTMB 2A69D 1DM0B 1FFUA 3HS0C 3I73A 3I8ZA 5C3JB 2EY5A 3T3OA 4OIKA 1SNCA 4JX1C 3OMCA 4NMZA 4TQ1A 3AEDB 2ZW0A 3PO2B 1IUEA 2J52A 1SYGA 3OWFA 2RSOA 1DXMA 2EOTA 3NTHA 1WYGA 4D2KA 1OQRA 2ICIA 5LNK1 2WXJA 5C4XB 1WD1A 2PYKA 2EJGC 1U4LA 1PFNA 4HEDA 5AFWA 4ZKBB 2N0SB 4V0BA 4IDIA 4NDXA 1DOIA 3VA7A 1SJED 3HOXB 4IFDJ 1GUGA 1QOAA 1Y8OB 2DY7A 3I91A 5EKIA 1YNNC 1N5WA 1BR9A 1N60A 2SOBA 1HHVA 4UDUC 2V4DA 2KAJA 2VNUD 3OW7A 3RZOB 3ERQA 5C0XJ 1A6XA 1XWEA 1PXUA 2B2UA 4HAEA 4UAIA 4MIUA 4IZ8A 4K14A 1GUTA 1Q1EA 3FDTA 3TP8A 2BDNA 2O4XA 5G3LD 2R6GA 1F2RC 3K5LA 3M85A 2PPBC 3WOFA 3Q0AA 3GD7A 1VCIA 4K6LA 1BOSA 4ILWA 5AUKA 1EU3A 3VR3A 4FXDA 3B2GA 1E6EB 5JAVA 5IGDA 1ZXIA 3AB9A 2JA8B 1ZOYB 1LTAD 4IKGA 2LFIA 5LL6S 2XVSA 3CQZB 2RMMA 3TDQA 2EY2A 3DWPA 1WTXA 3HEJA 2B2VC 1C4CA 3P4QB 5C3WA 1YNJC 3VA5A 3FPUB 2E75C 4CQNA 3FAHA 1NSNS 2M00A 2JYOA 2F0JA 3R8BA 1N5XA 3NVZA 4KV6A 1IYVA 3P63A 5EBCA 1SMYC 2F0LA 3EFXD 4MHEA 5IGFA 3NXWA 1OXXK 1TWCB 2YEPB 4C2MB 3ETRA 1MHXA 2AQ2B 2IT1A 2PW7A 1OXSC 2F0QA 3KWLA 1ICWA 1K83B 4C56C 1EQTA 1TY2A 5D3DA 1AEXA 3KK7A 3G6JB 3TEWA 4PT5A 2L4NA 1WVLA 2WLBA 4LTUA 2FINB 1Y1WB 3VYUA 4G4KA 4KY6A 3MTSA 2B39A 1F77A 1H9KA 1FRDA 3NVWA 1LT3D 1K53A 3N9YC 3L7ZC 3Q8AA 1CT1D 1TKWB 3I4MB 3S1MB 4TKOB 4C3HB 4C1NI 3A7LA 1K50A 3S9WA 2OEDA 5BYSA 1RWSA 5EPJA 1SYCA 3DXJC 4RGNA 1VJKA 4N58A 4RF0A 2K5QA 5HG2A 4XWWA 1EY8A 1Z6HA 5EE3A 3Q24A 1XLQA 2R93B 1EYDA 4KJNA 1H9SA 5KNBA 1WTRA 1O7LA 3MZ5A 5IT9L 2A69C 2QMTA 1SXTA 4L23A 1Y8PB 5BMHA 3PZ7A 1G2SA 2LMCB 3U2SC 2K6AA 2E3TA 1C76A 1JQYD 4B9XA 2Y5PA 4P16A 1WTVA 3IAYA 1E2WA 2AWNA 4C3HG 1I4GA 5FK9C 1ZXHA 1TS4A 3SHLA 2A6HC 2BBCA 2TSSA 3A55A 2K04A 3NK9A 1B3AA 5KEEA 4DA2A 4EE2A 1JQ4A 1EQVA 2RVLA 2Q8IB 1RCVD 5CV4A 1JW9D 4PMBA 3GTJB 2PCFB 1T6BX 1FR3A 1GUWA 1L6UA 2O5JC 3K57A 1AZQA 1HUNA 2LEKA 4DNTB 3HOYB 1RJTA 4JWUC 4ARCA 2BDOA 4KK7A 4ZHOA 4DNRB 4PNYA 3J9CA 4HN7A 2Z4IA 3GTPB 1VZ6A 1QF6A 3MJ5A 5CBEE 4NZLB 1KF6B 4RHRA 1TWGB 4BBRB 1NCVA 1Q1BA 1U4PA 3GS2A 1JOQA 4LMQD 1G6ZA 3P1MA 2KEDA 4L6TB 1YJJA 2TMPA 1DOYA 2K33A 2EYLA 4ZLTF 2KOLA 4YTNB 5BN3A 3H0GB 1ACCA 2X69A 2QF7A 1WRIA 3BWUD 1FIQA 1PTOH 2XN9C 3TBIB 4HROA 1WSPA 5I4DA 4L2YA 1V1OA 2EYMA 2KCCA 5M5YB 1KNAA 3A54A 5ELFA 4TQ0A 2K0PA 1RHPA 1MI0A 3WDNA 4C7ZA 1BCPD 3W5UB 4KGRA 4KTAA 1U4RA 4K8JA 1EWYC 2M0AA 3MXGA 3K59A 4PMWA 2WDQB 2F0VA 1I4RA 1N63A 1NI3A 3PIP3 2N9LA 4F88A 3ABVB 1ZPSA 5JJZA 3J7YW 5M5WB 1ENFA 1FD6A 3LWUA 5ELEA 2C5CA 5C4ZA 4G7HC 4RGMA 3U7ZA 3GQBA 5E4WC 3NUHB 1KRHA 5K36G 2SNSA 4HEA1 1BO0A 4FF1A 3I72A 3C2PA 4HKQA 1B9RA 5DAUA 1MSGA 1I4QA 1HRJA 5E4XA 2KWDA 4US8A 2INNE 4WJWA 2V3PA 4A3EB 1TS3A 1T3QA 3MEHA 1G291 1C8CA 1WGKA 2L52A 4KGTA 4HSPA 2L0CA 3AN1A 1VRAB 5GXGB 4CJ0B 2JXTA 4OO1G 3MFGA 2A6ED 2ONQA 5TSSA 4IUVA 5EE1A 2NVYB 1SYEA 5HFYA 1XF5L 1WWTA 4GLSC 3K5MA 4AS1A 4C80A 4V190 1NR4A 4YT0B 2WDVB 2Y3AA 2VXWA 1T5EA 3HZXA 4OGQC 1EFID 1FFVA 2LHDA 4ZRQA 2KN4A 1NENB 1SFOB 3BVMA 3MXNA 5M5XB 1CHPD 1Q8IA 3OPOA 3AE8B 5C4HA 2E76C 2PMVA 1STAA 3MHZA 2B2TC 1JROA 3CWIA 4QMGA 2NUCA 3AM9A 3AMZA 2EYJA 2JSOA 3NSWA 4ZUJA 1JOOA 2PZWA 4DFAA 5A2QE 1STGA 2BA0A 1EL0A 5CR3A 1QCBD 3TP7A 1SNOA 1CK1A 4WH4A 4K2KA 1X3QA 3T16A 3MAQA 3FPPA 4ZQ3A 5CGKA 5G5GA 5MPOA 3VYTA 3OHXC 2IPKD 4GZYC 3AU7A 5CC4A 1DZ1A 2NN6G 1GHKA 3T3NA 5K5PA 5EE0A 1X3PA 5CYUA 1NVID 3AE1B 1J7BA 3FC4A 1QILA 1YN4A 2XSCA 3W5VB 2NTTA 3URYA 1TWFB 5JPMC 4XYQA 1GUOA 4KKSA 1K8MA 2WV6D 2JWUA 2D5GA 1ZYRD 2J0TD 4K5XA 4IOIE 1IBXA 3SFDB 4EGVA 2ZXPA 2F3VA 4QCLA 2I2YA 4IFDG 4DU9A 5I6WA 1TQOA 1O7YA 5CV8A 3SR1A 5C0XG 3AE4B 2K1BA 1FCCC 2WNMA 3H09A 3H91A 2FMMA 1VZ7A 4B0MA 1B4OA 4HKZE 2MJ3A 4M1UB 2D62A 3HUIA 4N9PA 5JEAH 5FKAC 3D31A 1SB3C 3P4RB 4QF4A 5KYIA 1FXIA 2LHEA 3I57A 4XWTA 3Q8CA 3MXPA 3NWTA 1HQRD 2X6GA 2WKDA 1D5MC 1CJEA 4IUUA 1STHA 3KQ4A 4L63B 2WS3B 1DGJA 2O2LD 2N9KA 2SNMA 2MHVA 2PMZB 3KLRA 2BTEA 2DWQA 2PNRC 5COYA 2B2VA 2ZW1A 2WXGA 4F7XA 3NZ3A 2Z1CA 4MM3B 1ILPA 3I4LA 4N59A 3M3YB 1ENAA 1D4BA 1EY9A 2QILA 1BUVT 4IUPA 1ESFA 1I6VC 1DOXA 4J1MA 2JEAI 2NYZD 3D4RA 1BUIC 4OW0A 3SDZA 1YNTE 2HDEA 2X38A 2CU3A 4J3OD 2F3WA 2MJEA 4KKTA 3MA2B 3ZJUA 3CIRB 3R2TA 3RFZB 3RPFC 3AE6B 3EA6A 4ZOHC 4O42A 1T5XD 2DYOA 4WAFA 2YEPF 1B9MA 4XDCA 5ELDA 1PGXA 2Z4HA 4X3TA 3T53B 3J7AF 2WAQB 1JICA 3GV6A 5ELBA 4NW2A 5M3FB 2YU9B 3J7AV 4A6QA 3CU7A 5A35A 1F2YA 3BG3A 2DNCA 4FYDA 2H89B 1VF7A 1LTRD 1PZKD 2WXOA 3Q23A 1Y56A 3H8HA 1IW7D 2M2LA 1PUTA 4ARIA 2EYPA 5IGCA 4KD3A 2CJOA 3D6CA 5IOCA 3HOVB 3RUZA 3TEZA 3LX0A 2N88A 3C46A 1UWMA 2EY1A 2ZT9C 1EY7A 3RLFA 4QUFA 3BZDB 2IGGA 2F0FA 1STYA 4FF4A 1NYQA 1IHZA 1HCZA 2K28A 3SK8A 4ZHPA 4BA1I 2LFNA 3MWYW 3BYTB 2W3SA 4KKIA 1PDXA 4IUNA 5EQ0A 2MH7A 1PRTD 1GAQB 2BYTA 1GB4A 3FRPB 2G9DA 4Q0FA 2QJLA 3J80L 1JWAD 1V97A 3NBIA 3OIQA 1SE3A 1KDCA 1IGDA 1UUPA 2WXNA 5EE9A 1ZDXA 2PW5A 4NP5A 5JEAJ 1HPCA 1OFFA 3EJIA 3HGBA 1VR9A 4XQQA 2RPVA 1C78A 2K32A 4DXFA 1D1KA 2JYTA 3SXHA 4JBWA 3Q8FA 1KDBA 2F0IA 5C5LA 2RBMA 4DAPA 2NWGA 5C3XA 2BOSA 2E2IB 4C7YA 1RFKA 1KABA 4BY1B 2V0GA 1ML0D 3QG1A 2J53A 1NYRA 2VUMB 5D14A 1QNKA 4ZAIA 2IX3A 1XCTL 1PTOD 5IGGA 3P4SB 3AE3B 2VB3X 3KUPA 3R2IA 1OXVA 2E2JB 3V96A 3VR2A 2RKSA 1MHHE 4RNAA 2LMCA 2HDMA 1CA5A 1SYBA 1D2BA 1PFBA 1PZID 2IL8A 2D5DA 2EYFA 3BDOA 4HRSA 2DY8A 3U9SA 3WOEA 1KDAA 1ESRA 1B9NA 1JOKA 4O1NA 2YYZA 1FNWA 5HHDG 4A3IB 3NVYA 1JR0D 4US9A 2PO4A 5H8YE 1IYUA 2WXRA 3L3OC 3OMGA 1A2TA 2JP1A 3HOZB 1MI2A 1ENCA 1SDFA 2MPMA 3BYYB 1RYJA 1J7CA 4DK1A 4RF1A 2RSNA 3UI2A 5JOBA 5IODA 3GTQB 2WU5B 1L0YB 2J4XA 4G7ZC 3ZGZA 1GJXA 1SE2A 3CRKC 2LKVA 3S17B 1VZ8A 2CHBD 5BN5A 3SVMA 5EKKA 1JRPA 1FNVA 2JEBI 3NWSA 3DHQA 3NRZA 4I7ZC 3GTOB 3S14B 2H4OA 2H88B 1EZ8A 1GUNA 3EQLC 2QKIC 1H9RA 2KA7A 2L5TA 4PMCA 4WQMA 1E9MA 5BYQA 3K5NA 4K6DA 1EEID 2CVRA 1HTPA 3BK2A 1G91A 1NEKB 1IGCA 3EGRA 3Q8EA 5CV7A 1RTNA 1HFGA 1ILQA 1QJOA 3GTLB 1CI3M 4LK0M 2AX5A 2FMCA 3G7LA 2WKCA 4RCNA 1VDVA 1TKYA 4K8IA 4C3IB 1QOGA 1Y8NB 1S5DD 1RKNA 1O80A 1DOMA 1QOBA 1S4ZA 5D3IB 5A2QL 1PTOB 2B2TA 4M8AA 3A7AB 3KF8A 3KBGA 4XDXA 1XTCD 4TSSA 3W9CB 1TU2B 4ABNA 4REZA 3BIID 5G5HA 2K22A 3SR6A 3PUZA 4A55A 3D4DA 1XXGA 2WXIA 1MGSA 3EVQA 3PIO3 4RKBA 4XXEA 5D65A 2EYHA 3W1SA 4K5VA 4YWGG 4C3IG 1HTLD 4RAUC 3P4PB 1QB5D 2SEBD 4CKBA 4JWSC 2PZUA 2F0OA 3HOUB 1MSHA 1VLBA 4FXKC 5T8IA 4NAWB 1OXUA 3MVVA 2OEOA 2EPBA 1FD7D 4ME5A 3C8YA 2G1EA 1BNZA 3T13A 1SSNA 4KN7C 1QG7A 1MPEA 1HUMA 1PTOC 4KD4A 2NVTB 4HJGE 1SJHD 4RGOS 4OO1I 1WCMB 1JMLA 2KVMA 2HUGA 3PMFA 3GO5A 4N6EB 2BS2B 4IUTA 1CQVA 1LTBD 2FFKB 3PUVA 3FILB 2D2CC 2B2YC 1RDPD 2ACZB 1M8AA 1V8QA 2R7ZB 4KJOA 2EKIA 5C3EB 3HVZA 1GXDC 3OSOA 3K5OA 5HURA 5EJWA 2LJIA 2L11A 2F0WA 5CV5A 4BY7B 4HTHA 2Q8TA 3GTGB 1GB1A 2GI9A 3F2UA 1KLGD 1RD9D 4HR7B 3GTKB 4PQXA 1UWXA 2I07B 1KLUD 3I9V1 2AQ1B 4KI0A 2HTME 1I4XA 3DWGC 4KHVA 4F87A 1Y69U 2N55A 2W54A 4LAAA 2PTLA 4ZYSA 1CFMA 1SE4A 2GA4B 4FNFA 2R92B 2MEKA 3D8GA 3PO3B 3H3VC 5CORA 4G57A 4IUQA 3S15B 3KLSA 4I65A 1D6EC 2KQ3A 3NTIA 2MP1A 3DWAA 2EYOA 4YSZB 1UEAB 2BCOA 5KNDA 3K0YA 1FNUA 2IGHA 4OZCA 2PZTA 3N52A 3S2DB 3T56B 2BB5A 4QIWB 5DM73 2QCPX 2BT6A 4R8IA 1X32A 3D4WA 4IALA 1A70A 1O78A 3AE9B 1EY5A 1STNA 2XWBB 4FO2A 3AEAB 1F9RA 3CRLC 5K36H 2DLBA 2EDGA 2QIEB 4RFBA 3M4OB 3PO0A 1RTOA 1VDZA 4H2AA 3QOJA 1LV9A 3NS1A 3AMUA 1Q12A 4JE3B 3O13A 1B1ZA 4OO1H 1EZ6A 4ZK9B 2B76B 5H92C 3V3XA 3FKIB 5IT9E 1SIJA 5C6AA 4R8NA 1EY4A 2FJ2A 4L8JA 1W6JA 5FR3A 1YN3A 4OZBA 4EQOA 2VZKD 1BCPB 1LTID 4X3SA 5DNFA 3U52E 1WTWA 1J8IA 4YIJA 1AWDA 4AQ7A 2WB1B 1CQFA 1PFDA 1RODA 2JQRB 4J8QA 3LXFA 3UI3A 3A8JE 2DNEA 3BDLA 1VMCA 2M9VA 4DF7A 1SF0A 5C2TB 1QQRA 4FVMA 5BYRA 1LTTD 1FEHA 2ON8A 2L9HA 5JEAG 4EVOA 1RM6C 3BK1A 1LLRD 2IGDA 5JPNC 1TY0A 3J81E 3TZDA 5CMDA 1N61A 2JX5A 3M4YA 3QO2A 4ZKCB 5EGTA 1YNND 2Y5CA 2K3UA 3NHHA 3PV0A 2WXPA 2KHSA 3DEPA 2NN6H 2QSDA 1F9SA 1BCPC 5KYLA 3IFDA 1B50A 4BBSB 2V4IB 4OIJA 2XIWA 3E5SA 1DD2A 3D3RA 3RMHA 1GUSA 3TUOA 1C79A 4CBVA 2WINB 4OZAA 1WTQA 4A90A 5KGUA 5ISRA 1WTOA 4JK1C 4RA8A 2PKOA 3ZYYX 1LT5D 1Z47A 3B9JA 1R7SA 3ITPA 4S3SA 5C0XH 1I4PA 1R4QB 1TIID 3NQIA 3P75A 3TMEA 1TWAB 2JE6I 2K01A 2L55A 5LL6X 3RZDB 3MC0B 2Z8LA 3TEXA 2IDYA 5I6YA 1YNJD 4WURA 1JWUD 1SAPA 2IW3A 2NB0A 3C1FA 1JALA 4JPSA 3BVZA 1STBA 1YN5A 5FO7B 3P42A 1AN8A 4XT1B 2LY7A 3SFEB 1EOTA 2B2WC 2SDFA 3BVGA 1SNPA 2LUMA 4KX6B 2FUG1 1SNQA 3IL8A 3FVQA 2A6EC 2WXLA 1EIHA 3N6RA 2B63B 1AFPA 2W3RA 1ONLA 2R61A 4P2CB 4KN4C 1Q10A 1MVKA 1JB3A 2EXZA 1F2RI 3A8IE 2XRQD 3HRZC 1A15A 1IKMA 1L6VA 4ID6A 1V1PB 2BS3B 3S1QB 2OXPA 5FOBB 2NTSA 2WP8J 1I4HA 3KLSX 2F03A 3TEYA 2KMMA 4OL7A 1SNDA 2O5IC 3NBHA 2H1EA 3E0JA 2F0NA 2W55A 3VYRA 3NP8A 1C9FA 2LS01 4KY7A 2Q5WD 1C4PA 2I38A 3HKZB 1VMPA 4IQZA 3Q69A 3L9AX 3ND8A 4CHTB 1TJEA 3PUYA 2B8GA 4XE0A 3DWQA 3MXUA 5T1IA 3KWVA 1IL8A 2NVQB 4KGSA 3AEEB 3TN2A 2JA6B 1KTKA 4C3JB 5G3LF 1BDOA 1D5ZC 3LYYA 3S16B 1PTOF 1SBBB 2D9UA 1Y1VB 3K58A 4H44C 3GTMB 4OVZA