2XNAC

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xnaC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xnaC01
4L6TB 2XNAC 4RGNA 2XRSD 3EFXD 1BCPB 1TS3A 1LT6D 1HQRD 3TSSA 1PRTC 2CHBD 3R2TA 1BCPF 1FGBD 3MC0B 1TY2A 5I4DA 3DWPA 4NZLB 1AW7A 1LTAD 1PTOC 1FNUA 1LLRD 1M4VA 1KLUD 1LTGD 3BYTB 2O2LD 1GOZA 1I4PA 1DJRD 1RD9D 1S5BD 1LTBD 5FK9C 2WV6D 1G8ZD 4ZYSA 1TY0A 4TSSA 2AQ1B 1I4GA 1SEBD 2XRQD 1F77A 1EFID 3O13A 5D3DA 4DXGA 1B1ZA 1YN3A 5D3IB 2NTSA 3SEBA 1D5MC 1UUPA 3URYA 1FNWA 2RDGA 4RH6A 1ESFA 1TS5A 4RGOS 1JWMD 2IJ0A 1SE3A 1LTTD 1L0XB 1DYQA 2AQ2B 4RHSA 4C56C 1V1PB 3BZDB 5FKAC 1AN8A 1SJED 1BCPC 1XTCD 1S5DD 2ICIA 1L0YB 1EU4A 3KLSX 1STEA 1EU3A 1ENFA 1EEFD 1JWUD 5ELFA 2RDHA 1PRTD 1TS2A 1I4QA 3EA6A 5ELDA 1HTLD 1JQYD 1SJHD 1D5ZC 1CHPD 1PTOD 2NTTA 1LTSD 1S5FD 1PZID 5ELEA 1PZJD 1QILA 1KLGD 1LT3D 1SBBB 2XN9C 1D5XC 1SE4A 3GP7A 3BYYB 1SXTA 4K6LA 1KTKA 3CHBD 1CT1D 1S5ED 1V1PA 1EWCA 1LTRD 4RGMA 1LT5D 2R61A 5ELCA 3OWEB 4Z9CB 1V1OA 1I4HA 1YN5A 1LO5D 1MD2D 2J4XA 1PRTB 1YN4A 1B44D 1UNSA 2IPKD 2Z8LA 1HXYD 3DWAA 4L63B 3BVZA 1PTOB 3W2DA 4BWGB 1D6EC 4DXFA 1CK1A 4OHJA 1TS4A 1PTOF 1LT4D 3BVGA 1PTOH 1SE2A 4RGTA 3V05A 4RFBA 1I4RA 4UDUC 3MFGA 5TSSA 2QILA 1RCVD 2AQ3B 1S5CD 4RHRA 1PZKD 2TSSA 3DWQA 1BCPD 2QEJC 1FD7D 3BVMA 1CHQD 1PYWD 1JWSD 1HA5A 1LTID 2G9HD 1EEID 1CQVA 1RF2D 2SEBD 1JR0D 1XXGA 1BXTA 3R8BA 1I4XA 3R2IA 1ET9A 1ET6A 1JCKB 1PRTF 4O1NA 4RCOA 1RDPD 5ELBA 1FNVA 1T5XD
chains in the Genus database with same CATH superfamily
4K3CA 3BG3A 2LWPA 2MBHA 4JI4L 4YSYB 3A5ZB 1LT6D 3E6ZX 3TSSA 2R93B 2ACZB 1STHA 5LL6X 3S17H 2KTRA 2NUCA 4PZ8A 5IY0A 5I9PA 4LF7Q 1L7YA 5HKHA 1VQEA 3LYYA 1K8RB 1TIID 2MBEA 1HH2P 2IHEA 2O2LD 3FPUB 4CJ2C 4WWMA 2C60A 3RNCC 1HTPA 1NUCA 2E2JB 3WANA 3FKIB 3VR6A 1J7AA 2INDC 1HZAA 2WP9B 3NZ3A 3QQ8B 4F87A 3CMMB 4B9WA 4GKKQ 2CU3A 1U4RA 3AU5A 1O7ZA 1JALA 5E3FA 1NI2A 3ND9A 2YVCA 3ML8A 4FULA 4WFN3 1IL2A 1WJUA 4X65Q 4DAPA 2JZZA 2N1VA 2QDLA 4YWMA 1MIUA 2L8JA 1U4PA 1JE5A 2NPTB 1PGAA 2BS2B 3KBGA 1HNZQ 3X0WA 1E7UA 2W3SA 5E7NA 2FIDA 3DCGA 4H02A 4UP9A 2N88A 3VUYA 2Z0SA 5I2YA 4PYZA 4Q0FA 2PYKA 1Q10A 1I3QB 2L83A 4LJPB 5E6OA 1K3BC 4N6EB 2FINB 1L0WA 4HIDA 4PQXA 2KFJA 1WE6A 3A0JA 4GOPB 1NJIC 1KFYB 2KDBA 4EEWA 2BYEA 2FXQA 1K83B 2L5TA 2ICIA 2PQAA 1VQNA 1YNTE 3MHBA 1PH7A 1BMLC 4A93B 2GBKA 3PZDA 1WFQA 3LGJA 3PVLA 3GE3C 1F2YA 4C1NI 2QCPX 4HJAA 4C2MH 1N36L 4FF2A 1I42A 3ZYYX 2JVCA 1K53A 1PV4A 4KV2A 1TXYA 1O7YA 1YNNC 3FMCA 1ZP0B 2LD9A 3EVQA 1O80A 3MC8A 1D5ZC 1CHPD 4K7UA 1P1AA 2XTIA 4JI0L 2AL3A 3L0OA 1SBBB 3GTMH 2J42A 1CA6A 1SE4A 4S17A 4APVA 4TQ1A 4II2B 1J8CA 2N0SB 3NOBA 1CT1D 3S1RH 2IO3B 2JRHA 3G48A 4IG7B 4KSKC 1EY5A 4HIKA 2DJGC 1E8YA 4JQWC 1SLJA 4OGQC 2JA7B 1N34Q 4IO9A 2R93G 2BOSA 4C2MB 1K8OA 4BXXH 2QJLA 3PSEB 2ZXPA 4L5RC 3RZDH 2K5VA 4L63B 1R4MB 1TWAH 4A3LH 5H8YE 5C4HA 2KVZA 2UXBL 3J81c 1XYIA 1FD6A 1PTOF 4BAXA 1QOGA 3IVFA 2F0SA 3DBLB 1QJOA 2OT2A 4RFBA 2A5HA 4LF9Q 3FKIG 1SE9A 2KDIA 3DWMA 3QCAA 4DXAB 3AEGB 4V190 4DR4L 2MQHA 4NW2A 2WDTB 2LJ5A 4KY7A 3QG1A 4EGVA 3PF5A 4BY7H 1WTWA 1BVSA 1NYRA 3I4OA 2WHIA 3E5SA 4ARIA 1X3QA 5HGTA 1JRPA 1EIFA 4ZOHC 3AEAB 4DR2Q 2K8HA 4MELA 3STBC 2L0CA 2MJDA 1XPRA 2N9KA 3BDLA 4L23A 2KQ7A 2WXGA 4RCOA 2W54A 2YYZA 4IUPA 5D65A 3M4OH 3TL5A 4JBJA 2X6LA 4CO7A 3MZ5A 2VL6A 4KKJA 1QVFA 2N49A 3MHZA 1VQFA 1BOSA 1TKYA 1WE7A 1ICFB 2GLSA 2K39A 2FBWB 5L37A 1PRTC 2Y5BB 2Q8TA 2XBBC 5J1ZA 1WX7A 5GROA 3PZ7A 5HURA 3R3MA 4OL7A 1KLUD 5C0XG 1LTGD 2N7DA 4P1CC 2L7RA 2WDRB 5BYRA 2NBFA 2IW3A 4PV1C 1FFUA 4GKJQ 3NS8A 1E3PA 3PO0A 1G2SA 1SNOA 2PNRC 4OW0A 3S15B 2K5PA 3DVNU 3L4PA 4X3SA 3AM9A 1VR9A 2D5GA 4XIGS 1RM6C 2BB6A 4JI6L 5G3LF 4M00A 5HI1A 3AEFB 1EQVA 4LDTD 3RI7C 2PPHA 1G6JA 4IFDJ 1QQRA 3G4SA 3MEHA 5HGQA 3IFWB 5D3IB 1G291 3N52A 3C46A 3OMGA 1GUSA 4OZBA 3RYTA 2V0GA 5AZHA 4DV6Q 2PVGC 2EXDA 4DR3Q 2GB1A 2PW9A 5IP7G 4QL5A 3DVNV 3PO3B 2F0JA 4IM3A 1LTTD 2JE6I 2IY1B 5JJLA 3UGBB 1A3UA 3SK6A 2YTXA 1VQ8A 4IFDH 3J80c 2KANA 4HPLB 3VH4B 4KK7A 3AFQA 4V0BA 2D11A 3H8HA 3CRLC 2BH8A 5JEAG 4I6LB 2REXA 1A0IA 1RFKA 1YIWA 2K8CA 1XNQL 2DZJA 1IBLQ 4ZRJA 2GBRA 3HFZB 1JWUD 2KQ3A 5M5YH 2FFKB 4X62L 2LXCA 4HDOA 1HZ6A 2NZ1D 5ELDA 4R9WA 3E0JA 5AJ3Q 3IXSA 3MA2B 2D2QA 2QHOA 2K05A 3PQIA 4GN5A 4A4IA 4AIMA 4JI7L 2JZPA 3HRDD 4JE3B 1Y56A 2GVAA 3ZJVA 1JORA 1PZJD 3ITPA 3KDFA 5IT9c 2KEEA 2FMCA 1A6XA 1S5ED 3PZ8A 2F4VL 2WQYB 1TWFH 1XJVA 1QOHA 3OWEB 3DXJC 3RUIB 1WF9A 2MPMA 2G45B 1VJKA 4KKIA 4L8JA 2UXDL 3RMHA 1WSPA 5EPLA 4N59A 3B1LX 4DV1Q 2KJRA 1D6EC 2F0TA 1OTRB 4HJKA 1HHVA 3HG9A 3KVFB 4FXDA 1Q0WB 3BVGA 3K7UC 1YVCA 1H9JA 3EFCA 5IGBA 2F0MA 2B2YA 3CIRB 1YD8U 2EY5A 3H94A 2FIFA 1HFGA 1LACA 2ZCBA 2ZNVC 2VZAA 4K7SA 2TSSA 1E2ZA 4XWTA 3AEEB 3OOCA 3ZJYC 2VQFQ 1B50A 2EJFC 1IBKL 3PHXB 1L2NA 2K7VA 3FVQA 4LUVA 4FF1A 2NS5A 5IKCM 4XXEA 2AWTA 3A8IE 4OXPA 5DPRA 5EBDA 4N9TA 5CV8A 3N30A 1JR0D 5C3EB 1G51A 1RFAA 1Y69U 1CM9A 4W9IA 4XDDA 1VQ4A 1WJJA 1VLBA 1K9MC 3GB1A 3A8KE 3NUHB 1FNVA 2Q8IB 1UE7A 2C5LC 4BY1B 3CCEA 3B08A 1KL9A 4RF0A 1E2VA 2QSDA 1MSHA 4PMBA 1SMYD 2KHSA 3R2TA 1N60A 4GOCA 4GKKL 2F0FA 5LNK1 3MTSA 2BCOA 1GOZA 4X65L 1P9DU 3NHHA 3A1QB 3KLRA 1G8ZD 2LI5A 2LVOA 3NXWA 2WB1B 2LFIA 4S3SA 3ZNID 3AH7A 3M7GA 4IFDG 1SEBD 2IX1A 3K6OA 2BYFA 1XQQA 3PSIA 2MO1A 1P0RA 2L0FA 2BB5A 3AE4B 1PFSA 3S1NB 3NJTA 3Q0AA 1IPGA 2LRWA 1X1MA 1KNAA 1SYFA 2JA5B 2PI2A 4FHJA 3Q8DA 2PZUA 3GTGB 4XT1B 3FDTA 2Y3AA 1TS5A 2KLGA 3LNNA 3IBEA 3R66C 3M4YA 3R7QA 2KA7A 5IGEA 2M56B 1CSPA 3CCQA 4AJYB 1JWAD 4HEA1 1OXTA 2MCNB 1NYQA 1C79A 2I38A 4IOAA 2KX0A 1J7CA 1WTOA 2IGHA 4YT0B 3WDNA 5C5LA 2KCNA 2K50A 1VMPA 2K5QA 2MHVA 1ROEA 2IGGA 4WJQA 5EPJA 3VFKA 4MGYE 3P4SB 4MSQB 1LYLA 4B0EA 3CKIB 1QF6A 3OG5A 1E6EB 3W1BA 3CCSA 1Q1OA 1LTSD 1E7VA 1EZ6A 5C6AA 1NSNS 3GTKB 1D1IA 2LS01 3LX0A 4CKCA 4F8MA 1N34L 2RA4A 5C3EG 3J80E 3RD4A 5FLXc 2J52A 4TQUS 3BYYB 3TP6A 3CC7A 2L0TA 2ZZPB 4WH4A 3ER0A 2C9OA 2GRIA 4FBJB 2FCQA 4RGMA 1V2YA 1VQKA 3NE5B 5DLQE 5JOBA 5A2QE 3AE8B 3Q3MC 4F1SA 1MD2D 1MHWC 1TKWB 2JP1A 5A2QL 3HHMA 1W6JA 3OLMD 2NBVB 5BYSA 5CMDA 4LNQA 1XMQQ 3R3OA 1P3QU 1PTOB 3DVGX 1CK1A 2HCCA 4GNXA 2KN4A 1VQMA 2E3TA 2JX5A 2ID0A 1UEAB 1SE2A 1KDCA 2K1BA 3I7FA 4IN3A 4IPDA 2WAQE 5IT9E 1YQ3B 3SFEB 3H0GB 3CPWA 5IT9L 1GVPA 1VDVA 1Y1WH 1L1OB 4DR2L 1PXUA 2QIEB 4AP4C 1N61A 2YEPF 5C3JB 4A3GB 2LKVA 4HAEA 4B3TL 2JYTA 2HHHQ 2SAKA 1JWSD 3NWTA 2PI2E 4GN3B 3FILA 3IRBA 3VR3A 3KJPA 3AE9B 5C23A 3B6YA 4JBWA 2EJMA 4DV4Q 3GTOH 2N9EB 2BT6A 3S14B 3MTNB 2F0QA 4BBRH 1B7YB 5KNBA 1YNND 4FP5D 2ASQA 1A15A 4DDGD 1VZ7A 2I0QA 2MJEA 3H3VH 4A9AA 4P75A 3AYHB 4DBGA 2M0AA 2B8FA 3U4ZA 3EJIA 2A8VA 2FJ2A 2PPBC 2RVLA 2XNAC 2XVSA 1YBYA 3KF8A 5GMVA 3W9CB 3S16B 3OPOA 3QIAA 1FJGQ 2OTLA 3HOVB 4ZRKA 3NWSA 1XT9B 3HOWB 1FMAD 2R7DA 2R7ZB 3APCA 1GHJA 3RR5A 3BYTB 5LMNW 4NKLA 3L16A 4W9HA 2Q2HA 2JZ3B 2G1EA 1I4PA 1DJRD 4GLXA 1TWHB 3Q3FA 5C3WA 2NN6H 4C3IH 4K8IA 1E9MA 2I46A 3SR6A 1E7ZA 3UDFA 1PH6A 4DV6L 4JI2Q 4DR3L 3AULA 3KFUA 1DGSA 4LNKA 5AZGA 1L4DB 1X3PA 2OEOA 1ZOYB 4ZDVA 1K28A 4JOIA 1D7QA 2B2TA 2KXJA 3MXUA 1EFID 2Y5PA 3IG3A 1L6UA 1J0GA 3ZUNA 4CDDC 2H89B 2NTSA 1Q81C 3I4MB 5JJKA 2K5WA 3URYA 2C7NB 5KRUA 1LV9A 3GTPH 2LASA 4E71A 1SYDA 3TZUA 1N63A 1HZ5A 3STBD 2R92H 1SSOA 4IQZA 4WAAA 2LMCA 2EZVA 2M17A 1OGWA 3M4PA 5AJ3L 5BR8L 3RZFA 2K6DB 2LZ6A 2J0JA 4YCUA 4CDCC 4X64Q 3NP8A 4DF7A 2M1MA 2QDBA 1T3QA 3K81C 1V81A 1MHXA 3VTUA 1FCCC 1V6EA 1STGA 1FPYA 2D3AA 2WNMA 4OX9L 1TIFA 4JI8Q 4LK0M 1PFMA 1PRTD 1I4QA 1ZEQX 2RF4A 1QUQB 1WZ3A 3A9JA 4NDXA 1T0QC 4DK5A 1C9OA 1PZID 1CUKA 4LF8Q 4K6LA 1KTKA 5J17A 2AWOA 4A75A 3F2UA 2MEKA 1WI5A 3MXPA 2UXCQ 1MBYA 2WXJA 1ZE3D 3HKSA 1Y1WG 4BBSH 1FRRA 3P2BA 4G11A 5CYUA 4HROA 4WJNA 3DQVA 4J6HA 1HXYD 3UE1A 5FOBB 1WI0A 1SAPA 3VA5A 2R7ZG 1H8CA 2IDYA 3S1QB 3Q8EA 2VQFL 1QT9A 2DENB 2K01A 5LMNL 4GDLB 4KD4A 2KHIA 3V05A 5FLXE 1G91A 4MH0E 1WFYA 5FLXL 1WVLA 4MTNA 4IZ8A 3PO2B 4UY8C 1PZKD 1KDAA 3ND8A 1VMCA 3PPAA 2WINB 2K9XA 2RCFA 2IX3A 2L00B 4ZRIA 1VCBA 2K32A 1N5WA 4QY7A 4HWIB 1WR1A 3DBRI 2WS3B 4PYUA 4DHJD 1R9TB 2MQJA 3QOJA 1I50H 1X55A 3BDCA 4MJSB 4BKGA 2E2DC 2OJWA 4R4IA 4TUUA 3RLOA 4L6TB 3DBHB 4RGNA 3L54A 2WB1E 4ZHOA 4E6IA 1WYGA 2HT1A 4P1BC 1B9NA 4CBVA 1V9JA 1L1OA 2QF7A 3MC0B 1TY2A 4RAUC 4DV7Q 5JH5C 3G7LA 1Q1BA 4H0LC 2QEXA 3K5MA 4MH8A 4H44C 2VUMH 2ATWA 3PRZA 2BKFA 1ILQA 4LDTB 3VYUA 2IBIB 4FO2A 1RJTA 1S72A 1XNRQ 1TU2B 4IKGA 1M90C 5BYQA 3LDZE 1Q46A 2R92G 2AMCB 1F77A 2VH2A 1K50A 2FUHB 1D8LA 2GI9A 1J8IA 1KRHA 1ZDXA 5KHQA 3T51B 2Z9HA 3QX1A 3NPPA 2NVXH 2ZPNA 1RL2A 2WX0A 4IUMB 1RIPA 4PG3A 5FO8B 4AS1A 1VZ6A 4NMZA 4KMUC 3K5NA 5DEHA 3GZNI 3NS1A 1CI3M 4NAWA 2AWNA 2JYEA 2BVCA 3BZDB 1VRAB 3GE8C 4GXBA 2WGSA 4LF4Q 2UUBQ 4AH6A 1MKHA 2J0MA 3A5UA 2AUJD 2WXFA 1PH1A 1BCPC 1WIAA 2EMTA 4HKZE 3PT2B 3WCQA 5FJ8H 2J7ZA 3F2BA 3PO2G 4JI5L 2LRUA 2MGSA 4CQNA 1ENFA 2B2WA 1J6QA 2XSCA 1TVXA 4PNYA 1U4MA 2I1JA 1T6BX 1WMHB 1H9SA 1QVGA 1EWHA 1ZYRC 2V3SA 5M3FB 4BS9A 4QIWE 2EPBA 4W9EA 1CFMA 2KUMA 2Z6BA 1Z2MA 1QILA 4GZYC 5C44H 4K0KQ 1XMQL 1WTRA 1EM7A 2NVYH 1QKZA 2DWQA 4WORA 4KGRA 4WQOB 3PV0A 1MVKA 1ONLA 2B76B 5KYLA 1Z47A 4GB9A 1LO5D 2OJRA 3UIOB 3V2TA 2L11A 3UINB 5BO4B 3IAS1 3NVWA 1JB3A 4Q5VA 2Y0SB 3W1SC 2LXKA 3PLUA 1TS4A 5JJZA 4RCNA 4RM8A 1QNKA 2HHHL 3I91A 4K3BA 1QUQA 4I7ZC 4ICUA 1EY0A 1I4RA 4DV4L 2MP1A 1IP9A 4ABNA 2YEPB 2NN6I 4U68A 1ISNA 4MGZE 1GG3A 3RFZB 2A1AA 1FD7D 4MHEA 3S1MB 3H7SA 3RCZA 4C3JB 2WDVB 1FCLA 3MXGA 4GU2A 2A6HC 3PRMB 5LMUQ 1A2UA 4A3DH 3M3JA 4LUZA 2JF5A 1E8ZA 3I2ZA 1V43A 5G5GA 4ANWA 2I5LX 3RNAC 1L2FA 4M8MA 1U0LA 4KLKA 1SNDA 2P5ZX 4DK6C 1XCTL 2K1FA 2KQ4X 2L3ZA 1I6VC 1T5EA 3HM6X 4YXDB 2MA9B 4KV6A 3HP3A 3SGIA 3A9KB 4AQ7A 3M85A 2HDMA 1YJ9A 1FGBD 2FHTA 2WWZA 1TGZB 1FM0D 3TDQA 1IXRA 2R93H 3AE6B 5FO7B 2UUCQ 1WGKA 1TZOA 1KABA 5M3FG 2L32A 4B3MQ 2MRPA 4GN4B 1ZGUB 1WD0A 2E2JH 1K51A 1F9SA 1CKOA 1VQHA 3FKIH 4XTCS 1MG4A 2MWSB 2NBWB 4W9FA 1TWGB 5BN5A 1EIHA 5KHOA 5JHBA 2W82A 1O7LA 3IT6B 4J6IA 2KVMA 1X9NA 3PLVA 4JWSC 1WTHA 5FJ8G 1A3TA 1RTNA 2EQSA 2AKWB 1FNWA 2HQEA 2E8GA 1H9KA 2XWJB 4X64L 1OEYJ 2FCNA 3PIOA 3QR8A 2GMIC 1IUEA 1GUNA 2R3ZA 3AEDB 3FP9A 1JJ2A 3QARA 1L0XB 2EJGC 4OO1I 2DNEA 3NZUA 4O42A 4DAYB 4K8JA 1Q3LA 1I3QH 4X3KA 4IC7B 1GUWA 5C0XJ 5C44G 1A63A 2QMTA 1YHAA 4QJFA 4GLVB 3RLNA 1L6VA 3NTHA 4QF4A 3R93A 1KOTA 2AL6A 1K83H 3ONSA 1VQDA 3Q23A 2CJOA 2RDFA 1ICWA 2HDLA 4A93H 2I2YA 4OWWB 4C3JG 1V9PA 5F2DA 1YITA 2F0KA 3K7AB 2EYMA 4EQ5A 1X32A 2EY6A 2PZWA 4UP8A 5C0XH 2UXCL 2R6GA 4R4QA 4REZA 3X23A 5IWAQ 2B2UC 4DV0Q 1LQBA 2BWFA 1UD7A 2K3UA 4FXCA 5IYBG 3KDFB 5H92C 3NTKA 3QC8B 4B3RL 1SXTA 1H4RA 1Y1VB 2K52A 1WJ6A 4JL9A 2C7HA 2ICEC 3EROA 4N8FA 4A3JB 4K5WA 2WXLA 2NCNA 1V1OA 5JPMC 4HCPB 4BBNF 2EOTA 4DNRB 1X6OA 4DAMA 1K3RA 4LTUA 3Q6BA 2X38A 2JA7H 5JEAJ 2N9LA 1BBXC 2YU9B 3QO2A 3TBIB 5IP7H 4A3DG 1WMHA 4KGTA 1PHJA 3F2DA 3I63C 4KDIC 4GOPC 1EY7A 1G6PA 1SNQA 4LCDE 4H2AA 4WAFA 3T3NA 2WU5B 4IPCA 2DUDA 2GA4B 2R7FA 3JAMi 2KKCA 5JEAH 5T1GA 2Z4HA 3DWQA 1NCVA 1GJZA 3NENA 3CSFA 2OHFA 2HTME 4W9KA 1QVCA 2E75C 2JSVX 3QIJA 5LXIB 3A54A 4TQ0A 4LFBL 2CQOA 2XIWA 3CP0A 2OTJA 1C4CA 1DOXA 4A3KB 3N1XC 2A6EC 4BA2I 3NK9A 3D4RA 4KI0A 2KC2A 4LNIA 2BS3B 1WZ0A 3PS6A 2WXNA 2O5JC 3ML9A 1NNXA 1WXQA 1O7IA 3C2PA 4DWFA 3GTJB 2E6XA 4PT5A 3S2DB 3KUZA 1C78A 1B3AA 2C35B 2KDFB 4EUTA 3AECB 3KLWA 1AFPA 3WAMA 1FYCA 1QE6A 5CV5A 2DNFA 2RHQB 1E1TA 4HTHA 1AW7A 1LTAD 2LEKA 4OZCA 1FNUA 4FJVB 4HIMA 3ULPA 5EE9A 2F0IA 2F03A 2JYOA 2ZTEA 3DHIC 4TKOB 3CW2C 4L5QA 1NR4A 3D6WA 1C4PA 1B9RA 3EUB2 2WV6D 4B3SL 3U52E 4F88A 1OQYA 3I55A 1PFBA 2WAQB 3H6MA 4G3XB 4NQKE 5IP4D 4POGA 4B95A 4KSLC 1Y1VG 3EBEA 3S15H 4IWPA 1QZHA 1N33Q 4A3JG 2LJIA 1TKGA 3PRPB 3RULA 4KY5A 3B0AA 5IE8A 4HJ5A 4DXGA 4EKUA 2N8NA 4P2CB 4IUUA 4LF4L 2UUBL 4DK0A 2NVQB 3A9KA 5IOIA 3SEBA 2RCNA 1E0ZA 1WOCA 1SYBA 2HCIA 4MTKA 4A93G 1OQQA 3KF6B 5G2NA 3HOYH 1PFNA 3KOJA 1PH3A 3DDCB 3L13A 2F4IA 3QJYA 1EF1A 1C4QA 1HZCA 3PO3H 4DK3C 3U4EG 1C48A 1FGUA 1WX8A 2D2CC 1GKHA 1F1HA 1M94A 2GBJA 3GTLB 3ZRCA 2NVTB 3GV3A 2ASBA 2K22A 3M63B 2JN4A 1KDBA 3OYYA 2A19A 3X3NA 1BT0A 1IKLA 2GVBA 1G2TA 4NAMA 3TCAA 1S5FD 4A3KG 1SYEA 2Y0SE 2KJHB 2XN9C 2JA7G 4JI3Q 2M2LA 3HOYB 2IHFA 5J2RA 4M01A 1HR0Q 3I3TB 1R4NB 4DPGA 1V1QA 4MSMB 1LT5D 4OIJA 4DAYA 2F0PA 2KCTA 3FPPA 1F2LA 2JPHA 5AFWA 1DD2A 2KDMA 5JAVA 1ENAA 1IGDA 2O6VB 3A8JE 1XLOA 3NY5A 4KVGB 4L5TA 1JMCA 1WD1A 4G0NB 1CTMA 4ZHPA 3T3OA 4XC2A 2HIVA 1VZ8A 4GNXB 2VZKD 2JA6B 1T9HA 4W9LA 5C4XB 1HFNA 2G4SA 5LMUL 4QCLA 1LXDA 2KACA 1WCMB 3B2GA 4A3BB 2WAQG 4Y7NH 5E4XA 2DZKA 2CHZA 3TMPB 4DHJB 2ONQA 1BCPD 3C19A 1B3QA 3TZDA 5IOCA 4MNOA 2L4NA 5IP9G 3KJOA 4NP5A 1WX9A 4BVUC 5JHAA 3FILB 2VY3A 2B39A 1WGRA 4JCVE 4ZRPA 3WIMA 1H9MA 2EYOA 4DUYQ 2CS4A 3TEXA 4HJGE 5AZFA 1E22A 3I56A 2DZMA 5GQOA 3T1HQ 3VVWB 3DOWA 2ZJQA 3PGEA 1ZYRD 4RF1A 2G9DA 1P7EA 3D4DA 4QGUA 4JBKA 1YJJA 2PCFB 3TQYA 4O1NA 2YTYA 1RDPD 3F2CA 5C3EH 1F52A 4HPPA 3GQBA 2UUCL 2NB0A 5AUIA 1YJNA 4RKBA 3KF8B 1CJEA 4Y7NB 2KBNA 2K0PA 4NQLB 4NY0A 4BY1H 4MGIE 3UQBA 2BYTA 1A70A 2V1YA 2M00A 1D2BA 2EYHA 1TYGB 3VRAB 1GHKA 1CKNB 3TREA 1LLRD 1J9OA 4IUVA 1AWDA 1CKMA 3K0XA 3RNFC 4EQNA 4XZ4A 3DPDA 2BKRB 2WDQB 5ELOA 4NJCA 1DM0B 2N4FA 4I7AA 1OTCA 3HOYG 2KYWA 2XGTA 1E1OA 1Y8NB 3RN9C 4ANXA 2BWES 2ZT9C 1C0AA 3PO3G 2HDEA 4LF7L 3CMEA 1NDDA 2MBOA 3W5OA 1GXDC 3E9IA 4P72A 2D3CA 4US9A 2QKIC 1OQRA 1YN3A 2VNUD 2ZW0A 1FL0A 4ZCKA 1VQLA 1JICA 1TJEA 4YWGG 2KHJA 3S1NH 2D0PA 2RPQA 2A6HD 2X6GA 4DA2A 3ZIMA 3ZXVA 2JA5H 4WJOA 1JOKA 3J7ZC 1JJGA 2AQ2B 3GTGH 1JJCB 2X69A 2FAZA 1QNUA 1SYCA 5FR6A 5FKAC 1WTPA 2V4LA 2JA6G 4ME5A 2LMCB 1KLVA 1DOMA 1ML0D 3L10B 4LUOA 1BDOA 4IM0A 1KM7A 5CORA 2FNJB 2ZCCA 1WCMG 4DV0L 1HNZL 3DBLI 3OMCA 3VR2A 4A3BG 4WJ4A 3T53B 1C77A 1HA6A 1KQSA 2RDHA 1EIYB 2KMCA 3KYHC 3N6RA 1IBMQ 3AXCA 1JQYD 3A9JB 4JPSA 4ZLTF 3APFA 4A3PA 2B2VC 1KF6B 1LM8B 1C1YB 1PYSB 4DR1Q 4C1NK 1PVOA 1XLNA 3KF6A 3P42A 1MSGA 5EAYA 2DNCA 4HEDA 3GTKH 2B29A 3VR9B 4WQMA 4KIKA 3HOXB 4DQOC 4MZ9A 4C3HH 1YMHE 1IYJB 1SFOB 3NQIA 3T16A 2HTHA 1P16A 1FVIA 2OXPA 3Q69A 2DHZA 2VXWA 1FO4A 2EY1A 3FEWX 1Y8RC 1GB1A 2JA8B 1S4ZA 3K9OB 1YJIA 2K6AA 4HDQA 4W9CA 3RNEC 1II3A 4J15A 4ZUIA 4UHVA 1PTOH 1X65A 2BE5D 3JVZX 4IOIE 3U9SA 3PIP3 1YQBA 2QILA 2JRIB 5J22A 1UH6A 1OO9B 4CGYB 3ZGZA 3HKZB 1AZPA 5IO9A 2KCCA 2JK8A 2L15A 4RHRA 2I07B 2MFIA 4C3HB 3H0GH 3H15A 2PMVA 1HR0W 2ZEQA 2F0GA 5TR5A 2ALYB 2W9NA 1W3SA 1ZDVA 1F2RC 2CJNA 1CZGA 3DHHC 3D0FA 4HRSA 4A3GH 4G57A 4BY1G 2N9XA 2O6VA 3SVMA 5JZEB 2UUAQ 3HOUB 1AARA 1GM5A 4LF9L 5HHDG 1GUAB 5JVH3 3O65B 3LWEA 1I4XA 3R2IA 3S14H 1ET9A 4QIWB 5M5WB 4QUFA 2F0LA 3DBRB 3U7DA 2LVQA 3Q8AA 4DV2Q 2NYZD 3WAPA 1PH9A 1Z6HA 1E7PB 1SNPA 1UBQA 1O78A 5LLIA 2PO4A 1SB3C 4HCNB 1PDQA 2WKCA 2D3BA 3LWUA 4K5XA 4HK2A 1EIGA 5GAEC 2WB1G 3QAQA 2K4KA 4B0MA 1IZ6A 2O2VA 2CHXA 4DHZB 2B3AA 3A74A 1HJPA 1PTOC 3S16H 1SF0A 1UGMA 3EC8A 1K8GA 3NVVA 4HPMB 3HOVH 2JWZA 2UU7A 1HNXQ 4ZRQA 3HOWH 3U30A 1N33L 4YIJA 4G50A 4J1MA 2R7ZH 3AMUA 5IGFA 1IGCA 2DX5B 1VD2A 4FADA 1STBA 3MXNB 4YWLA 5KNDA 5CBAE 2JA5G 2PLPA 4PZ7A 1Z5SB 4A3EB 4TSSA 1L1OC 3OJ4B 1TWHH 3RZOB 3MWYW 3R7RA 4GGQA 3SDLC 1MJCA 2BPSA 4IFDI 4M02A 3EHVA 3E9HA 3KYCD 1XMOQ 4DFAA 5IYDH 1KHIA 2NWGA 2Z1CA 4GKJL 2BW2A 4MM3B 4GMVA 4YCVA 2L12A 3CF6E 3HOZB 3H6NA 2JA8G 3VXWA 2OWOA 3I4MH 1CKNA 2PW5A 4NAWB 1HNWL 1VQ6A 3GDEA 3ULJA 1HZ9A 2A6ED 3E56A 5CHWA 1C4AA 4DUZQ 2A68C 1AE3A 2LVPA 4MIUA 2UWQA 4QQBX 2FMMA 1EU4A 4WIPA 3NZSA 1A62A 4UPAA 1VDZA 4K2KA 4JI3L 3PUZA 4C3HG 2DN8A 3PUYA 3M95A 3CPFA 2GBMA 2F0DA 1HR0L 3V6EB 3DBSA 2UYZB 3C8YA 2WP8J 5C2TB 4A3CH 1H9SB 1SJHD 3X3MA 4X66Q 3AN1A 1YJ1A 5CR3A 2KOXA 3HOUG 4KKTA 3VTWA 3T4AC 3H3VC 2Q2UA 3GP7A 1EWIA 4IUQA 3SXHA 4JV5Q 2I5MX 3M9BA 1IBLL 3J7AF 1XX8A 4DNTB 4FYDA 3GO5A 3IAM1 2R61A 5MPOA 1VQ7A 4GS3A 3PUVA 1YN5A 1HCZA 1GUGA 4IOCA 2PMZB 1X54A 3H0GG 3ICEA 1YN4A 1BBWA 2IPKD 1UF0A 4A8XC 3I4LA 1BNZA 3PV1A 1TZ1A 1KRSA 4LJZC 3OW7A 1GNUA 1L4ZB 1JWBD 2K5HA 4BA1I 1WTXA 3CCRA 4A3GG 2KTFA 2QC8A 2VRRB 4MT5A 2F3IA 2Z6KA 4DR5Q 1BQQT 2YLMA 1XLPA 2BBCA 3S1QH 4K14A 3OTOQ 4JPBW 4A3EG 2GN5A 3I72A 3UIPB 2F3VA 1NE3A 3S9WA 3PO2H 3UQAA 1STYA 4HR7B 4DV1L 4AQYQ 3MFYA 3AB5A 1I35A 3NUCA 3OIQA 3ZNHB 4C00A 2N7EA 3P7JA 4RMFA 1CQVA 3I4NB 3S2HB 4ITKA 1W2BA 3I9V1 2SEBD 1N62A 2JY6A 3L2PA 1BXTA 4ZKCB 3JAML 3R8BA 3A4SC 3HOVG 3Q3OC 4A20A 3HOZG 2R2QA 3HOWG 3A4RA 4DGZA 3OW2A 3JW0X 1Q7YC 2OOBB 1R9TH 3KWVA 1KAWA 4I65A 4K6DA 3BJUA 4B08A 3NEMA 2OQKA 1FFVA 2VH1A 1ZXTA 4H13C 5A35A 1EF5A 2K25A 3ZNGC 2CHBD 1BF4A 3K9PB 1U9RA 3QK0A 3ECIA 2G5DA 1AP0A 2NZHA 2E2IB 4NB3A 2JA9A 4RG1A 2LUMA 5IYDG 1Q90A 4CDEC 2IY5B 2HJ8A 1UEBA 2L9HA 1GJXA 3FAHA 1F9RA 3AB9A 3Q22A 1TR5A 5EKIA 5M5XB 3I4MG 3CF5A 4XDCA 3CMAA 1YX6B 3A56A 1GB4A 3H7PA 4LWCA 3V60A 1Q8KA 4X57B 5KYIA 3I70A 1QLBB 3QWNA 2SDFA 2MW5A 3TP7A 3MEFA 1HEZE 1B1ZA 5M3MB 5C4JB 1V5OA 4ZRZA 1LFDA 1N36Q 4I6PA 2RDGA 1YZ6A 2D10A 2IO0B 2EYLA 1GUOA 3W1YA 2H88B 1TWCB 1FXIA 1XPUA 4A3CG 2SNSA 1V1PB 3SE0A 2L05A 4MDKE 1UE5A 2KFKB 1SGHA 3TEHB 3CC2A 1MGSA 1IBML 4MN3A 2F0EA 1NBFC 3MXNA 2Y5CA 1HUMA 5H1SE 2GOWA 3TEZA 4AYBE 3U2SC 2MH7A 2ZVOA 3ZTCA 4DR1L 2HUGA 1Q5WB 2W3RA 3UI2A 1PH2A 2ZVNA 1PFDA 3G6JB 2R2OA 2DY7A 1EZ8A 3J7A5 3KUDB 1TS2A 4A76A 1KC8C 3CC4A 1K0RA 4JWUC 3I4NG 4HCSA 3V96A 1EO6A 2D9UA 1LT3D 2JEBI 2ON8A 4MM3A 1D5XC 5M3FH 2Q5WD 2UXBQ 4GSWA 4WJWA 3J81i 4OONA 2LY7A 1K0SA 4JBMA 1C8CA 4GN1A 1E10A 3MJ5A 4TRDA 4Z9CB 2WXIA 4P71A 1A5RA 3F8TA 3HKZE 5E4WC 3Q3NC 2LGDA 1JE4A 4CKEA 3P4QB 4BOZB 3GTQB 1B44D 1A2TA 1JT8A 3TEWA 4A3MB 2SOBA 1K8AC 4XT3B 3RMKC 1S40A 4G4KA 3ZQ4A 1I6HB 2K6QA 1YHBA 2EELA 2F0NA 4YCWA 1Z9FA 4HMJA 2BS4B 5E6PA 3CCJA 2UU9Q 1DOKA 3S2AA 3HK0A 4R3DA 2UUAL 1S5CD 2N55A 1QG7A 3CQZB 3VRBB 1BUIC 5GADC 3ZTDA 1AE2A 2IX0A 5ISRA 3H3VI 5FLMH 4DV2L 3Q3JA 4N9F4 2BDNA 2JU6X 1NAPA 1YI2A 1PA6A 3IFDA 1EEID 2EDGA 3S1MH 1JROA 4DHZE 3RPFC 4C3JH 5M3MG 1BKBA 5D94A 2EVBA 5BN4A 1IW7C 1CQFA 1QOFA 1LM0A 2ZXOA 1ET6A 2F0UA 4FF3A 1JCKB 2K8BA 1VS0A 2ZM6Q 1V8CA 4KDLB 2E2HB 2PZTA 3KW5B 1X3FA 2EIFA 4ULLA 3PCOB 5IYBH 3IAYA 1F2ZA 3ULLA 2KK8A 1EY9A 2OEDA 1HNXL 1HUNA 3IKJA 3KQ4A 4CHKA 2TMPA 1KXLA 2CWPA 1WYWB 5DM63 4JI6Q 2YV5A 3KUPA 5I4DA 5T8IA 3DWPA 2H4OA 1N5XA 2OF1A 3N1ZC 1EYDA 3F1ZA 1M4VA 2XK5A 4J3OD 2IY0B 3EECA 1WM3A 2MP2B 3AE5B 3NG0A 3QB3A 1TBEA 1SYGA 2V3NA 4L1BA 3PHWB 1V8QA 2KJXA 1XMOL 1H95A 3M3YB 4P74A 5EGTA 2EMSA 2RKSA 1E2WA 1FXTB 2B63H 1PYBA 4BOSC 1FJGL 1JQ4A 4R4CA 3SK8A 3J80i 3AE7B 4EFOA 2M19A 1TWGH 5D3DA 4HJ7A 2DJFC 4DUZL 4ODGA 1YHQA 2ZJDA 4RH6A 4K5VA 1JWMD 3TP8A 4A3OA 4OIKA 4JI2L 2KDEB 1ZKOA 1VQCA 5LXHA 2J0KA 1UAPA 1K8MA 4LJOB 1LABA 2KHWB 4YTMB 2ZJRA 1L0YB 2AHOB 2B63B 3EFUA 1LUZA 3RD2A 4HVBA 2O4XA 4XYOA 1L0VB 4UAIA 2KAJA 1UWVA 4ILWA 2LHEA 4ACFA 1T0YA 3W1GA 3AE2B 2PTLA 4CYEA 4JV5L 3L0WB 1WR6E 2PMZE 5CTRC 1PTOD 2KCMA 2CH4W 2HQLA 2NTTA 5I2XA 3VTVA 5CV9A 3DHGC 4FJYA 3K7AH 2CH4A 4CDFC 3OJ3A 2DAJA 3Q14C 3TEYA 4RA8A 3VHTC 2JT4B 2VS1A 3NVZA 1QB5D 2PQEA 2BE5C 1CA5A 2D5DA 2Y0SG 1CZPA 5E6NA 1V1PA 1EWCA 3DM3A 1LTRD 4HMIA 2PVOD 4BKTA 2KFKA 4A3FB 1BO0A 5KIXA 2EKIA 2KX3A 4JI8L 1Y1VH 2ZTDA 2K5NA 4DR5L 2IYDB 4A3JH 1Q1EA 1Y14B 1CZWA 4AUQC 2V4DA 3OTOL 1M8AA 5LL6S 1IBKQ 2VB3X 4KN7C 2CKZB 5FLMG 1GC6A 3ENEA 4NNJB 2A73B 2JJQA 4KKSA 3W3AA 1LGRA 3BIID 4WWOA 5CHVC 4LF8L 3LXFA 3SK5A 2PE6B 1FXAA 3VR8B 4AQYL 2I5HA 2A74C 2YU9H 2AX5A 4PS3A 5D14A 3PF4A 5TSSA 2BTEA 3VDYA 1D4BA 2NMQA 5G55A 1P8LA 3ERQA 3OWFA 2A68D 3ZLZA 5EKKA 1T0RC 4N58A 2N3SA 4G7HC 3Q8BA 1CHQD 2EYJA 1PH5A 1HA5A 4NJ6A 3J7YW 4X3TA 2K5DA 3UF8A 4TMAB 1LTLA 3WA0A 4EZKA 2WXRA 3H91A 1B2TA 2RSUA 1OXSC 1C76A 1MG8A 2MBBB 2QW7A 3KWLA 1VQGA 3T1YQ 3DMUA 2KWCA 3RNBC 4A3KH 5CV7A 5C5MA 4GIVA 5G3LD 3T8MA 3NBHA 4A3IH 3UDXA 1I7HA 3TS0A 5IYCH 3S17B 5EE3A 1EYAA 3GTJH 3S2DH 4KHPQ 4FVMA 3JSVA 1Q12A 2B63G 1UWXA 1N6ZA 2A69C 1RODA 5J18A 1DOLA 2MHJA 3N20C 4ZQ3A 4ALPA 3OHXC 3G6EA 3BU2A 4JYAQ 1K52A 4R4OA 4FN2A 2Z4IA 1WGDA 3ZRFA 4FDBA 1U5KA 3M62B 2HE7A 1R4PB 4BKSD 2B2YC 1WRIA 4ZKBB 4URKA 3MVVA 1XO3A 1STAA 2AQ1B 3BWUD 1HQMC 4DNIA 4NPNA 3TN2A 2KJ6A 3L7ZC 4S0RA 4A3IB 2HD5B 2KT7A 4JG2A 4DV7L 1E8XA 4A3FG 3K5LA 1MPEA 2LGXA 4K1RB 4LNNA 5IP9H 3HGBA 2IT1A 3SDZA 4X6AH 1D5MC 1UUPA 2YTVA 5C3XA 4JC0A 5CC4A 4NXNQ 2QCZA 3W1SA 1VQJA 4ZAIA 3D6CA 3HIZA 3D3RA 2NVQH 3C1EA 1XNRL 2M8SA 2NR2A 1ZUD2 4L5SA 2EXZA 2MP2A 2WKDA 1ASZA 2PKOA 4XYCA 2DYBA 4K7WA 4OWXB 1HNWQ 4UP7A 4OZAA 1F9QA 2XWBB 3K80C 4GLAC 1HZBA 1EU3A 1WYDA 4XWWA 4R1JA 1SIFA 4KN4C 3GTLH 3D4WA 1OFFA 4POFA 2CU1A 2NVTH 3Q8CA 3TBLD 1AH9A 3VUXA 4JI1Q 1PMRA 3NELA 1A3VA 3DUZA 3GTMB 1HRJA 2IZVB 2MLBA 2K04A 3MC9A 3NBIA 3N3KB 4C4VB 5ELEA 3HEJA 2Z0EB 1EY4A 5HFYA 3AEBB 1C3TA 3S1RB 4MEMA 2MJ8A 2K14A 1V86A 5L83A 4J8QA 1E8WA 1KH0A 1WGGA 2H1EA 1XWEA 1WY8A 4KIKB 4LFAQ 5CBEE 3RZDB 3RLFA 1TWAB 2RHSB 1PRTB 2UU9L 4JVZA 2E5LQ 2V3PA 3L9AX 2DYMA 4B3TQ 2J7QB 2WXOA 4IALA 4K0KL 2KMAA 1YNJC 2V9HA 5E6JA 2DYOA 3HUIA 2DBYA 2WU2B 4KJNA 3T56B 1QOBA 4MACA 3U58A 1NMGA 2F0VA 3B2FA 1BR9A 2QGQA 1WGYA 3MFGA 4LNFA 3RT3B 1OXXK 2BA1A 3Q6SA 3OIPA 2JA6H 2I1KA 2ZW1A 4BY7B 1J19A 2IO2B 1XD3B 4IJLA 5C4XH 5JJIA 3JYUA 5I6YA 3WALA 4C7ZA 5EDSA 3N9YC 4A3IG 1WCMH 2VB2X 3CAMA 5IYCG 2ZM6L 1YJWA 4A3BH 3QOLA 3UDGA 3WOFA 1DOYA 4W9DA 1HTOA 5C1ZA 5I9OA 2M9VA 4DV3Q 3HVDA 4P6VF 3L3OC 3J81j 1N32Q 3HZXA 3M4OB 1WGHA 1EWYC 2PEAA 3VAWA 2L1AA 4PZ6A 5DAUA 3Q2AC 3NHEB 2VW9A 2VQEQ 1UZXB 2LXAA 4WJ3M 4XE0A 1T5XD 4C80A 3AEVA 1QZGA 4M0WB 5FR3A 4G7ZC 1DGJA 1JOOA 1VQ9A 1XLQA 1FR3A 3U50C 2JWUA 3AI5A 5GAGC 4NZLB 4B9KA 5JVG3 4WWPA 2O2VB 4DKAC 3U7ZA 4TVAB 5HG2A 3DEOA 4ZUJA 4EQOA 4GNXC 2LGYA 2WXMA 3PUWA 4OVUA 1UE6A 2LXJA 2B2UA 2HD3A 5LHY1 2L52A 2C9WB 1Z7TA 2A4ZA 3CXCA 1S3SG 3W5VB 2JXMB 5EE1A 3MP9A 3N32A 1Q82C 4C7YA 5DPTA 2G4DB 2KOLA 4TKNA 2K75A 4B6WA 5BR8Q 3E0EA 2NPTA 4JK1C 4BXXG 3P4RB 1EOVA 3VA7A 1A8VA 1EUVB 5IGCA 4PK1A 1E24A 4FA6A 4A3LG 2KWDA 3DHQA 3A33B 1EUJA 1ESFA 1EYCA 4B3ML 3CCMA 4OX9Q 1MJDA 2NBUA 1SE3A 1IKMA 1UWMA 1R7SA 1S1QB 3B9JA 1MHHE 1IW7D 2DY8A 2IL8A 5E1FA 1OEYA 1YOVB 1XTDA 2KENA 4GOPA 4KKUA 2CR5A 2D0OA 2CW0C 1SJED 1SR3A 3APDA 4Q2JA 4YTPB 4ID6A 4R8NA 3SFDB 1ZKHA 2F0HA 3P1HA 3MAQA 4ARCA 5C0XI 2Z59B 1GD7A 5M5YB 3NRZA 1SDFA 1MI2A 2ZTCA 4BY7G 3FHWA 4FNFA 3AQQA 2ZNVB 5CHFA 3K0YA 4TV3A 4YSZB 4OELB 1QCBD 4H7BA 1NENB 3VYRA 3T9LA 2PNHA 4LNOA 1IL8A 2WFWA 3PGZA 2GBNA 3QWZB 2EKEC 3RNUA 2KQSA 3SU8X 1JB7A 4FHKA 1TWFB 1IYFA 3ZW3A 3CHBD 5LMNQ 1TQOA 1E90A 1WJNA 4IPGA 3EQLC 4EVOA 4IURA 4JOIC 2B2TC 1WTQA 2RDBC 3ONAB 1P7FA 4R4TA 1R4MI 3HOXH 4KGSA 1B9MA 4K2LA 3J81E 1SFOH 1J5EQ 5C4XG 1PGBA 1SMXA 1V80A 2A5UA 5IWAL 2KMMA 2KN5A 2LGIA 2K33A 3J81L 3GD7A 5J39A 3BVZA 1PGXA 1N9WA 3NQTA 4DXFA 1ZXIA 2RGFA 3UE0A 3PTFC 3VQIA 4A55A 4OHJA 3ZJTA 4I6NB 4LAAA 1JOQA 1MFWA 2Q2TA 1MJEA 2ENBA 2JA8H 1RLFA 4RGTA 2L1BA 1QWYA 4KHZA 4C4VA 4KX6B 4YHHQ 1DZ1A 2PE9A 1PDXA 3T1YL 1DONA 1XEEA 2WIIB 3WWVA 2FCSA 5IGGA 4AYBB 2MUYA 4LW1A 4DK1A 3U8ZA 1M1KC 4KD3A 4RWSC 2Z6KC 3AV8A 2EY2A 2RD0A 2G9HD 1AZQA 1BBUA 3TJPA 2D07B 1WH3A 4KHPL 4LFCQ 1XXGA 4WRDA 1QOAA 1E0BA 2INNE 1SN8A 1SNMA 1NVID 4KY6A 2XEWA 4O2DA 3HOUH 5BN3A 5IODA 3JAMc 3NVYA 1FIQA 3CWIA 4P73A 5M5WH 4BBNC 4JYAL 4HCEA 1EQTA 1I94Q 1V97A 2MJ3A 1BCPF 3NTIA 4A6QA 5BMGA 2G3QB 3KLSA 3ZVVA 4F8CB 4Y52H 1UBIA 3SHQA 3I5JC 1B53A 4IUTA 2IWHA 1KD1C 1RD9D 4HLEA 2AUKA 1R4QB 1CSQA 5EJWA 4ZYSA 2V1CC 1TY0A 3AU7A 4CJ0B 2MSED 3GS2A 4PMCA 4JIOU 1B8AA 5DPSA 3I57A 1I4GA 1HPCA 4NXNL 2F3WA 4NJ7A 3FRPB 3SK4A 1EL0A 5IIFA 3H7PB 4A3EH 3RZOH 2J0TD 4LF5Q 3O13A 2K03A 2DAFA 4YSXB 1EYGA 1UE1A 2LSSA 5D2MB 4GLSC 3KK7A 4M0WA 3ZNZB 4A90A 1R4NI 4JI5Q 3RUZA 4DR6Q 2JUOA 5BMHA 3I90A 2DZIA 5EBCA 3QJZA 4DDID 4RGOS 5K5PA 1X3GA 3J80L 4MGKE 3SD5A 4RHSA 1E5WA 4C56C 3CCUA 5COYA 3HOZH 4LF6Q 3VH3B 5L95C 4JI1L 2E74C 1NTGA 5KEEA 3SR1A 2D62A 1XTCD 1S5DD 4AOFA 1IYVA 2FCMA 4FLHA 2B3GA 1Y8PB 2JQOA 5M9OA 3BINA 1SRUA 1NEKB 3V62A 1UGJA 3C3LA 4ANVA 1NR2A 1STEA 3J7AV 1EQRA 2C5CA 4AYBG 2A69D 3HOXG 3BY4B 4ANUA 3BZCA 1ENCA 1HTLD 2RBMA 4LFAL 4IWQA 1SROA 3ZDMC 1P98A 2NZOA 5DCNA 1D3ZA 1F9JA 2E5LL 4BFRA 1VQPA 4NXMQ 3ALBA 2KECA 3ETRA 2K28A 5ELCA 3RNGC 1GPXA 2EE1A 3RN5A 3K8AA 1U4LA 1C7YA 3GZNB 5CGKA 2BGFA 4KHVA 4DU9A 1RWSA 4YY3Q 1UNSA 1WWTA 1DXMA 3DWAA 4BWGB 1JC7A 3I3CA 3HKZG 1OXUA 2N78A 5K36H 4ZK9B 4P16A 2KWVB 4LK1C 2CFMA 2QA4A 4HKQA 4RKLA 1Y1WB 2WACA 2MX2A 2N7JA 4IM2A 4DV3L 1RCVD 1DCZA 1N32L 1T0SC 1TTNA 2RR9A 3C1FA 3ZDTA 4QAYA 5GXGB 3GTOB 3DLLA 2B2WC 2F0WA 3BDOA 1PYWD 3SHLA 4IPHA 4BBRB 2VQEL 1B4OA 3GV6A 4PS8A 3ZJUA 1LTID 3MHSD 3J9CA 1B70B 1YNXA 4IWOA 3W5UB 2JXXA 3VYSA 1JRUA 1RF2D 5JXVA 4R8IA 4DV5Q 1C9FA 1Y8OB 3I4NH 3S2HH 3K58A 1YX5B 3TP5A 4EOYA 5ELBA 3PMFA 2LHDA 4DAVA 2Q2IA 2LGSA 4FF4A 2H5XA 4PMWA 3TIXA 1IHZA 3KBXA 2RSNA 3D31A 2EYFA 4DR7Q 4DUYL 1ZW7A 3T1HL 1FRDA 2AEHA 1AYFA 1S3OA 2XK5B 3T13A 4C3IB 1N8RC 3IT4B 3KYDD 4JI4Q 3IL8A 2BF8B 2JSOA 1RHPA 2IGDA 1SNCA 2PJHA 1NY4A 3A1QA 3BK2A 5FK9C 4E3CA 2B2VA 2E2IH 2CHWA 2X8XX 1YNJD 4EE2A 2KC1A 2J53A 3JAME 4EX5A 4IJHA 4HJ8A 5EQ0A 4FJZA 4HSVA 3FKYA 2XRQD 2INPE 2D3GA 5M5XH 2E76C 1EQQA 1XCQL 1V5TA 3GOEA 3ZKJC 1RAXA 3Q24A 1VF5C 3TMEA 2Z0DB 2RQXA 5CV4A 1TT5B 4XQQA 1XPOA 1KJTA 3GTPB 2DLBA 2NVUI 4ZYNA 1F0ZA 3EN2A 2F1MA 1H9RA 2R92B 4HXDA 2IJ0A 5M3MH 2WLBA 5C4JH 1DYQA 3PIO3 1EFWA 2W55A 4W9JA 1WXVA 1XF5L 2M0XA 1AN8A 1TWCH 1GO3E 5NUCA 3CCVA 4WURA 1SSNA 2KLCA 4B3RQ 4W9GA 4EQPA 3RN2A 1VF7A 3K57A 1F2RI 3EIVA 4OO1H 1I5FA 2JQRB 1ZPSA 1EEFD 5ELFA 2O6VD 4USAA 4F7ZA 3BZKA 2BQQA 2RSOA 2C7MB 4M8AA 4BBRG 4KJOA 1MI0A 3D32A 3OSOA 2ZJPA 5IGDA 2RPVA 2BDOA 4RM9A 4M1UB 4QMGA 2JEAI 1YQ4B 3LJ3A 4YTNB 3P20A 4KTAA 5K36G 1J5EL 1WRDB 1L5PA 2PIAA 5D7GA 4CKBA 4BBSB 4LMQD 2JXTA 1WXSA 3KH0A 3VR4A 1KAAA 4GDKB 2MO0A 1TT2A 1WTVA 4JI0Q 4M8NA 3CSTA 3K5OA 1DOIA 5EPKA 3QHTA 3P1MA 2O5IC 3Q8FA 1IBXB 2KD0A 4AJWA 2N9PC 4YHHL 4IDIA 3AE3B 3VYTA 3GTQH 1TKEA 1WJ4A 1STNA 5C4ZA 2NN6G 4C3IG 4A3MH 4LFBQ 4P7IA 3RZWC 3PIPA 3M4QA 2CCZA 2WXQA 3C0RB 1W6KA 4XYQA 4XQJA 1I6HH 4UDUC 2CQAA 1GAQB 3VUWA 2KTRB 2CW0D 3E3XA 4LFCL 1VCIA 2QEJC 3K59A 4HSPA 3P4PB 3MJWA 5J3BA 5G5HA 4EZJA 3NSWA 3CQZH 3V61A 4K81A 3PUXA 1CMXB 2INCC 1J7BA 4DR4Q 1PH4A 1I50B 1YIJA 1ESRA 5IAAC 1BUVT 1I94L 1ASYA 2VZKB 4ICVA 3TUOA 2CWAA 2HIXA 1VQ5A 3DWGC 1G6ZA 3FC4A 3P63A 4RNAA 4G7OC 1U4AA 1PRTF 2MNAA 2WXHA 1ACCA 4HN7A 3WAOA 1WM2A 3NBHB 2AYOB 4ME3A 2XRSD 3EFXD 3I8ZA 4B3SQ 1ILPA 1BCPB 1TS3A 2E2HH 3A55A 3EGRA 3N1YC 1HQRD 3AE1B 3JSVB 3CU7A 1YEZA 1NMFA 1KRTA 3OAWA 5EE0A 3LB8C 3E9SA 2VUMB 4BZAA 1ZXHA 3DM1A 2IO1B 2M4NA 2KZRA 5AEKB 2OQ0A 4OVVA 4LF5L 3L08A 1S5BD 1LTBD 5ELNA 2L76A 2PQAB 1EOTA 4ASWC 1NI3A 1KIXA 5CV6A 1JMLA 2ZPYA 2EYPA 1UELA 2LFNA 1AEXA 3AFPA 4DR6L 5D6JB 4N9PA 3PREA 4HJ9A 4JW0A 3M3YH 2WXPA 4BBSG 2NVXB 3ZXRA 2CVRA 4NPSA 2ZXRA 3IHPC 1Q86C 1RKNA 1SIJA 1EY6A 3UDIA 4LF6L 3JC66 3D8GA 5DM73 1JW9D 3ZO5B 1SE8A 4OO1G 2FUG1 3TRZA 2MBQA 2PW7A 4OEMB 1X3EA 4DN4M 1FEHA 4OWTB 1VQOA 3I73A 1F2MA 4L2YA 4BKSA 5IN7A 2F52A 3CD6A 4US8A 4IUNA 3ABVB 3P75A 3ERSX 2WXKA 3M7NA 4FXGC 2SNMA 4FXKC 3AU4A 4YWKA 1QZEA 1RYJA 1Q8IA 2KNBA 2WYQA 4YL8A 1OXVA 5I6WA 5JPNC 1PUTA 4XDXA 3KLSX 3VR5A 4JLCA 4HIOA 1VQIA 1PH8A 4E74A 1GC7A 2KVRA 5AUKA 3HRZC 1X56A 5DNFA 2FE8A 2OCEA 3WOEA 1NBWA 3G71A 2DGYA 4NXML 2HJ1A 3EA6A 3DVGY 1HTQA 5C44B 3HVZA 2KEDA 4XGAB 4EZLA 2NVYB 4WJPA 1KNEA 5GAHC 1XNQQ 3V6CB 1KLGD 4D2KA 1EY8A 2ES2A 4KZ0A 4YY3L 3L17A 4IW0A 5EKLA 4A3MG 2CKHB 3IFTA 4X62Q 4CJ1B 5BMIA 1VQBA 2Q8RE 1SMYC 3CCLA 4KZCA 4JX1C 1GUTA 4X3UA 1I4HA 4JI7Q 2V4IB 4O0AA 2J4XA 4N8X1 1PQSA 4JGHB 4A3FH 4X66L 3QA8A 4QUCA 3TS2A 2Z8LA 2QDFA 1IYUA 2KWUB 3W2DA 5KNCA 2LUEA 3CRKC 3H09A 2VUMG 2F4VQ 4LLGM 2BH2A 2B8GA 3A7AB 5HY6A 1LT4D 5T1IA 1V49A 3H1UA 4GDLA 4QB4A 4B9XA 2RMMA 4OVZA 3UI3A 2UXDQ 2BYVE 2F0OA 3U9OA 1HE8A 3BK1A 2AQ3B 3HM3A 3KUCB 3VDZA 1WXMA 4DV5L 5IA7A 1F9PA 2N1WA 4AWJA 1PLFA 4RMAA 1RTOA 3BVMA 5FO9B 4A3DB 4XX5A 2BA0A 3AMZA 4U673 3A7LA 1VQAA 3HS0C 3S24A 5KGUA 1WXAA 2WX1A 4PS7A 4GDKA 3H9DA 3U4VA 4CHTB 1K73C 2L55A 3BS1A 3DEPA 5CX3A 4DR7L 1RRBA 1IBXA 4F7XA 4MJSA 4WWNA 3DBHI 3V3XA 1D1KA 2KO3A 4II3B 5DPWA 4XQNA
chains in the Genus database with same CATH topology
3BG3A 4YSYB 1LT6D 3E6ZX 3TSSA 2R93B 2ACZB 1STHA 5LL6X 2NUCA 5I9PA 3LYYA 1TIID 3FPUB 2O2LD 4CJ2C 4WWMA 1HTPA 1NUCA 2E2JB 3FKIB 3VR6A 1J7AA 2WP9B 3NZ3A 4F87A 4B9WA 2CU3A 1U4RA 1O7ZA 1JALA 5E3FA 3ND9A 4WFN3 4DAPA 1U4PA 1PGAA 2BS2B 3KBGA 2W3SA 2N88A 5I2YA 4Q0FA 2PYKA 1Q10A 1I3QB 2L83A 4N6EB 2FINB 4PQXA 1KFYB 1K83B 2L5TA 2ICIA 1YNTE 3MHBA 1BMLC 4A93B 1F2YA 4C1NI 2QCPX 4FF2A 3ZYYX 1K53A 1O7YA 1YNNC 3FMCA 1ZP0B 3EVQA 1O80A 1D5ZC 1CHPD 1SBBB 2J42A 1CA6A 1SE4A 4TQ1A 2N0SB 1CT1D 1EY5A 4OGQC 2JA7B 2BOSA 4C2MB 1K8OA 2QJLA 2ZXPA 4L63B 5H8YE 5C4HA 1XYIA 1FD6A 1PTOF 1QOGA 2F0SA 1QJOA 2OT2A 4RFBA 2A5HA 3DWMA 3AEGB 4V190 4NW2A 4KY7A 3QG1A 4EGVA 1WTWA 1NYRA 3E5SA 4ARIA 1X3QA 5HGTA 1JRPA 4ZOHC 3AEAB 2L0CA 2MJDA 2N9KA 3BDLA 4L23A 2WXGA 4RCOA 2W54A 2YYZA 4IUPA 5D65A 2X6LA 3MZ5A 4KKJA 3MHZA 1TKYA 1BOSA 2FBWB 1PRTC 2Q8TA 5J1ZA 3PZ7A 5HURA 4OL7A 1KLUD 5C0XG 1LTGD 5BYRA 2WDRB 2NBFA 2IW3A 4PV1C 1FFUA 3PO0A 1G2SA 1SNOA 2PNRC 3S15B 2K5PA 3L4PA 4X3SA 3AM9A 1VR9A 2D5GA 4XIGS 1RM6C 2BB6A 5G3LF 5HI1A 3AEFB 1EQVA 4IFDJ 1QQRA 3MEHA 5D3IB 1G291 3N52A 3C46A 3OMGA 1GUSA 4OZBA 2V0GA 2PVGC 2GB1A 2PW9A 3PO3B 2F0JA 1LTTD 2JE6I 1A3UA 3SK6A 4IFDH 4KK7A 4V0BA 3H8HA 3CRLC 5JEAG 1RFKA 1JWUD 2KQ3A 2FFKB 1HZ6A 2NZ1D 5ELDA 4R9WA 3E0JA 3IXSA 3MA2B 2K05A 2JZPA 4JE3B 3HRDD 1Y56A 3ZJVA 1JORA 1PZJD 3ITPA 2KEEA 2FMCA 1A6XA 1S5ED 3PZ8A 2WQYB 1QOHA 3OWEB 3DXJC 2MPMA 1VJKA 4KKIA 4L8JA 3RMHA 1WSPA 5EPLA 4N59A 1D6EC 2F0TA 1HHVA 3HG9A 4FXDA 3BVGA 1H9JA 5IGBA 2F0MA 2B2YA 3CIRB 2EY5A 3H94A 1HFGA 1LACA 2TSSA 1E2ZA 4XWTA 3AEEB 3OOCA 1B50A 2EJFC 2K7VA 3FVQA 4FF1A 4XXEA 3A8IE 5EBDA 4N9TA 5CV8A 1JR0D 5C3EB 1Y69U 1CM9A 4XDDA 1VLBA 3GB1A 3A8KE 3NUHB 1FNVA 2Q8IB 4BY1B 4RF0A 1E2VA 2QSDA 1MSHA 4PMBA 1SMYD 2KHSA 3R2TA 1N60A 2F0FA 5LNK1 3MTSA 2BCOA 1GOZA 3NHHA 3KLRA 1G8ZD 3NXWA 2WB1B 2LFIA 4S3SA 3AH7A 3M7GA 4IFDG 1SEBD 2IX1A 3K6OA 2BB5A 3AE4B 3S1NB 3Q0AA 1KNAA 1SYFA 2JA5B 2PZUA 3GTGB 4XT1B 3FDTA 2Y3AA 1TS5A 3LNNA 3M4YA 2KA7A 5IGEA 2M56B 1JWAD 4HEA1 1OXTA 1NYQA 1C79A 2I38A 1J7CA 1WTOA 2IGHA 4YT0B 3WDNA 5C5LA 2KCNA 1VMPA 2K5QA 2MHVA 1ROEA 2IGGA 5EPJA 3P4SB 4B0EA 1QF6A 3CKIB 1E6EB 1LTSD 1EZ6A 5C6AA 1NSNS 3GTKB 1D1IA 2LS01 3LX0A 4F8MA 4CKCA 3RFZB 2RA4A 3J80E 2J52A 3RD4A 4TQUS 3BYYB 3TP6A 4WH4A 2C9OA 2GRIA 4RGMA 3NE5B 5JOBA 5A2QE 3AE8B 1MD2D 1TKWB 2JP1A 5A2QL 1W6JA 5BYSA 5CMDA 3R3OA 1PTOB 1CK1A 2HCCA 2KN4A 2E3TA 2JX5A 2ID0A 1UEAB 1SE2A 1KDCA 2K1BA 4IN3A 5IT9E 1YQ3B 3SFEB 3H0GB 5IT9L 1VDVA 1PXUA 2QIEB 5C3JB 1N61A 2YEPF 4A3GB 2LKVA 4HAEA 2JYTA 2SAKA 1JWSD 3NWTA 3FILA 3VR3A 3AE9B 5AUIA 4JBWA 2EJMA 2BT6A 3S14B 2F0QA 5KNBA 1YNND 4FP5D 1A15A 1VZ7A 2MJEA 4A9AA 2M0AA 2B8FA 3EJIA 2FJ2A 2PPBC 2RVLA 2XNAC 2XVSA 3KF8A 3W9CB 3S16B 3OPOA 3QIAA 3HOVB 3NWSA 3HOWB 1FMAD 2R7ZB 1GHJA 3BYTB 4NKLA 2G1EA 1I4PA 1DJRD 1TWHB 5C3WA 2NN6H 4K8IA 1E9MA 2I46A 3SR6A 1L4DB 1X3PA 2OEOA 1ZOYB 2B2TA 3MXUA 1EFID 2Y5PA 1L6UA 2H89B 2NTSA 3I4MB 2K5WA 3URYA 5KRUA 1LV9A 1SYDA 3TZUA 1N63A 1HZ5A 1SSOA 4IQZA 2LMCA 2EZVA 3NP8A 4DF7A 2QDBA 1T3QA 1MHXA 1FCCC 1STGA 2WNMA 4LK0M 1PFMA 1PRTD 1I4QA 1ZEQX 4NDXA 1PZID 4K6LA 1KTKA 2AWOA 3F2UA 2MEKA 3MXPA 1MBYA 2WXJA 1ZE3D 1FRRA 5CYUA 4HROA 4J6HA 1HXYD 5FOBB 1SAPA 3VA5A 2IDYA 3S1QB 3Q8EA 1QT9A 2K01A 4GDLB 4KD4A 3V05A 5FLXE 1G91A 5FLXL 1WVLA 3PO2B 4IZ8A 1PZKD 1KDAA 3ND8A 1VMCA 2WINB 2K9XA 2IX3A 2K32A 1N5WA 2WS3B 1R9TB 3QOJA 3BDCA 2E2DC 4L6TB 4RGNA 4ZHOA 4E6IA 1WYGA 1B9NA 4CBVA 2QF7A 3MC0B 1TY2A 4RAUC 3G7LA 1Q1BA 4H0LC 3K5MA 4MH8A 4H44C 1ILQA 3VYUA 4FO2A 1RJTA 1TU2B 4IKGA 5BYQA 1F77A 1K50A 2GI9A 1J8IA 1KRHA 1ZDXA 3T51B 3NPPA 5FO8B 4AS1A 1VZ6A 4NMZA 4KMUC 3K5NA 5DEHA 3NS1A 1CI3M 2AWNA 2JYEA 3BZDB 1VRAB 2WXFA 2AUJD 1BCPC 4HKZE 3WCQA 2J7ZA 4CQNA 2MGSA 1ENFA 2B2WA 2XSCA 1TVXA 4PNYA 1U4MA 1T6BX 1H9SA 1EWHA 1ZYRC 5M3FB 4BS9A 2EPBA 1CFMA 2KUMA 1QILA 4GZYC 1WTRA 1EM7A 1QKZA 2DWQA 4WORA 4KGRA 3PV0A 1MVKA 1ONLA 2B76B 5KYLA 1Z47A 1LO5D 3V2TA 2L11A 3IAS1 3NVWA 1JB3A 4Q5VA 2Y0SB 1TS4A 5JJZA 4RCNA 1QNKA 3I91A 4I7ZC 1EY0A 1I4RA 2MP1A 4ABNA 2YEPB 2NN6I 4U68A 1FD7D 4MHEA 3S1MB 4C3JB 2WDVB 1FCLA 3MXGA 2A6HC 1A2UA 1V43A 5G5GA 1SNDA 1XCTL 2KQ4X 1I6VC 1T5EA 4YXDB 4KV6A 3HP3A 4AQ7A 3M85A 2HDMA 1FGBD 2FHTA 1FM0D 3TDQA 3AE6B 5FO7B 1WGKA 1TZOA 1KABA 2L32A 1WD0A 1K51A 1F9SA 4XTCS 1TWGB 5BN5A 1EIHA 2W82A 1O7LA 3IT6B 2KVMA 4JWSC 1A3TA 1RTNA 1FNWA 2HQEA 1H9KA 2XWJB 3MP9A 3AEDB 1IUEA 1GUNA 2R3ZA 1L0XB 2EJGC 4OO1I 2DNEA 4O42A 4K8JA 1Q3LA 4X3KA 1GUWA 5C0XJ 2QMTA 1L6VA 3NTHA 4QF4A 3R93A 3Q23A 2CJOA 2RDFA 1ICWA 2HDLA 2I2YA 4C3JG 5F2DA 2F0KA 2EYMA 3K7AB 1X32A 2EY6A 2PZWA 5C0XH 2R6GA 4REZA 2B2UC 2K3UA 4FXCA 5H92C 3NTKA 1SXTA 1Y1VB 2ICEC 3EROA 4A3JB 4K5WA 2WXLA 1V1OA 5JPMC 2EOTA 4DNRB 4LTUA 2X38A 5JEAJ 2N9LA 1BBXC 2YU9B 3QO2A 3TBIB 4KGTA 1EY7A 1SNQA 4H2AA 4WAFA 3T3NA 2WU5B 2GA4B 5JEAH 5T1GA 2Z4HA 1NCVA 3DWQA 2OHFA 2HTME 2E75C 2JSVX 3A54A 4TQ0A 2XIWA 1C4CA 1DOXA 4A3KB 2A6EC 4BA2I 3NK9A 3D4RA 4KI0A 2BS3B 2WXNA 2O5JC 1WXQA 3C2PA 3GTJB 2E6XA 4PT5A 3S2DB 1C78A 1B3AA 3AECB 1AFPA 1FYCA 1QE6A 5CV5A 4HTHA 1AW7A 1LTAD 2LEKA 4OZCA 1FNUA 5EE9A 2F0IA 2F03A 2JYOA 4TKOB 1NR4A 3D6WA 1C4PA 1B9RA 3EUB2 2WV6D 3U52E 4F88A 1PFBA 2WAQB 3H6MA 2LJIA 1TKGA 4KY5A 4DXGA 4P2CB 4IUUA 4DK0A 2NVQB 3SEBA 1E0ZA 2HCIA 1SYBA 1OQQA 1PFNA 2F4IA 3QJYA 1C4QA 3U4EG 1C48A 2D2CC 3GTLB 2NVTB 3GV3A 2K22A 1KDBA 3X3NA 1IKLA 1G2TA 4NAMA 1S5FD 1SYEA 2XN9C 3HOYB 2M2LA 1LT5D 4OIJA 4DAYA 2F0PA 3FPPA 1F2LA 5AFWA 1DD2A 2KDMA 5JAVA 1ENAA 1IGDA 3A8JE 1XLOA 1WD1A 1CTMA 4ZHPA 3T3OA 1VZ8A 2VZKD 2JA6B 5C4XB 1HFNA 4QCLA 2KACA 1WCMB 3B2GA 4A3BB 5E4XA 2ONQA 1BCPD 3TZDA 5IOCA 2L4NA 4NP5A 3FILB 2B39A 4ZRPA 1H9MA 2EYOA 3TEXA 4HJGE 4RF1A 1ZYRD 2G9DA 1P7EA 3D4DA 1YJJA 2PCFB 4O1NA 1RDPD 3GQBA 2NB0A 4RKBA 1CJEA 4Y7NB 2K0PA 2BYTA 1A70A 2M00A 1D2BA 2EYHA 1TYGB 3VRAB 1GHKA 1LLRD 1J9OA 4IUVA 1AWDA 4EQNA 2WDQB 4NJCA 1DM0B 1Y8NB 2ZT9C 2HDEA 1GXDC 4US9A 2QKIC 1OQRA 1YN3A 2VNUD 2ZW0A 1TJEA 1JICA 4YWGG 2A6HD 2X6GA 4DA2A 1JOKA 2AQ2B 2X69A 1QNUA 1SYCA 5FKAC 1WTPA 4ME5A 2LMCB 1DOMA 1ML0D 1BDOA 5CORA 3OMCA 3VR2A 3T53B 1C77A 1HA6A 2RDHA 3N6RA 1JQYD 4JPSA 4ZLTF 2B2VC 1KF6B 4C1NK 1XLNA 3P42A 1MSGA 2DNCA 4HEDA 3VR9B 4WQMA 4DQOC 3HOXB 1YMHE 1SFOB 3NQIA 3T16A 2OXPA 3Q69A 2VXWA 1FO4A 2EY1A 3FEWX 1GB1A 2JA8B 1S4ZA 1YJIA 2K6AA 1II3A 4ZUIA 1PTOH 2BE5D 4IOIE 3U9SA 3PIP3 2QILA 5J22A 1OO9B 4CGYB 3ZGZA 3HKZB 1AZPA 2KCCA 4RHRA 2PMVA 2I07B 4C3HB 2F0GA 1ZDVA 1F2RC 2CJNA 1CZGA 4HRSA 4G57A 3SVMA 3HOUB 5HHDG 5JVH3 3LWEA 1I4XA 3R2IA 1ET9A 4QIWB 5M5WB 4QUFA 2F0LA 3Q8AA 2NYZD 1Z6HA 1E7PB 1SNPA 1O78A 2PO4A 1SB3C 1PDQA 2WKCA 3LWUA 4K5XA 1EIGA 4B0MA 1SF0A 1PTOC 3NVVA 4ZRQA 4YIJA 4J1MA 3AMUA 1IGCA 5IGFA 1STBA 2PLPA 5KNDA 5CBAE 4A3EB 4TSSA 3RZOB 3MWYW 4IFDI 4DFAA 2NWGA 2Z1CA 2BW2A 4MM3B 2L12A 3HOZB 2PW5A 4NAWB 2A6ED 3E56A 1C4AA 2A68C 4MIUA 2FMMA 1EU4A 4WIPA 1VDZA 4K2KA 3PUZA 4C3HG 2DN8A 3PUYA 2F0DA 3C8YA 2WP8J 5C2TB 1H9SB 1SJHD 3X3MA 3AN1A 5CR3A 4KKTA 3T4AC 3H3VC 3GP7A 4IUQA 3SXHA 3J7AF 1XX8A 4DNTB 4FYDA 3GO5A 3IAM1 2R61A 5MPOA 1YN5A 3PUVA 1HCZA 1GUGA 2PMZB 1YN4A 4A8XC 2IPKD 3I4LA 1BNZA 4LJZC 3OW7A 1L4ZB 1JWBD 4BA1I 1WTXA 4MT5A 1BQQT 1XLPA 2BBCA 4K14A 3I72A 2F3VA 3S9WA 1STYA 4HR7B 3MFYA 3AB5A 3NUCA 3OIQA 3P7JA 1CQVA 3I4NB 3S2HB 4ITKA 3I9V1 2SEBD 1N62A 1BXTA 4ZKCB 3JAML 3R8BA 4DGZA 3KWVA 4I65A 4K6DA 4B08A 1FFVA 1ZXTA 4H13C 5A35A 2CHBD 1BF4A 1U9RA 1AP0A 2E2IB 2LUMA 1Q90A 2L9HA 1GJXA 3FAHA 1F9RA 3AB9A 3Q22A 1TR5A 5EKIA 5M5XB 4XDCA 3A56A 1GB4A 5KYIA 3I70A 1QLBB 3QWNA 2SDFA 3TP7A 1HEZE 1B1ZA 5M3MB 5C4JB 4ZRZA 2RDGA 2EYLA 1GUOA 2H88B 1TWCB 1FXIA 2SNSA 1V1PB 3SE0A 1MGSA 4MN3A 2F0EA 3MXNA 2Y5CA 1HUMA 3U2SC 2MH7A 2HUGA 2W3RA 3UI2A 1PFDA 3G6JB 2DY7A 1EZ8A 1TS2A 4JWUC 4HCSA 3V96A 2ON8A 2D9UA 1LT3D 2JEBI 1D5XC 2Q5WD 4WJWA 2LY7A 1C8CA 1E10A 3MJ5A 4TRDA 4Z9CB 2WXIA 5E4WC 3TEWA 1JE4A 4CKEA 3P4QB 3GTQB 1B44D 1A2TA 4A3MB 2SOBA 4XT3B 4G4KA 3ZQ4A 1I6HB 2EELA 2F0NA 2BS4B 4HMJA 1DOKA 4R3DA 1S5CD 2N55A 1QG7A 3CQZB 3VRBB 1BUIC 2IX0A 5ISRA 2BDNA 2JU6X 1NAPA 3IFDA 1EEID 2EDGA 1JROA 3RPFC 2EVBA 5BN4A 1IW7C 1CQFA 1QOFA 2ZXOA 1ET6A 2F0UA 4FF3A 1JCKB 1V8CA 4OW0A 2E2HB 2PZTA 4LLGM 3IAYA 4ULLA 1F2ZA 2OEDA 1EY9A 3KQ4A 1HUNA 3IKJA 2TMPA 5DM63 3KUPA 5I4DA 5T8IA 3DWPA 2H4OA 1N5XA 2OF1A 1EYDA 1M4VA 4J3OD 3AE5B 3QB3A 1SYGA 2V3NA 4L1BA 1V8QA 2KJXA 3M3YB 5EGTA 2RKSA 1E2WA 1JQ4A 3SK8A 3AE7B 2M19A 5D3DA 4ODGA 4RH6A 4K5VA 1JWMD 3TP8A 4OIKA 1ZKOA 1UAPA 1K8MA 1LABA 4YTMB 1L0YB 2B63B 2O4XA 4XYOA 1L0VB 4UAIA 2KAJA 4ILWA 2LHEA 3AE2B 2PTLA 1PTOD 5I2XA 2NTTA 5CV9A 3TEYA 4RA8A 3NVZA 1QB5D 2PQEA 2BE5C 1CA5A 2D5DA 1CZPA 1V1PA 1EWCA 2PVOD 1LTRD 4HMIA 4A3FB 1BO0A 5KIXA 2EKIA 1Q1EA 1CZWA 2V4DA 1M8AA 5LL6S 2VB3X 4KN7C 2A73B 4KKSA 3W3AA 3BIID 3LXFA 3SK5A 3VR8B 1FXAA 2A74C 2AX5A 5D14A 2BTEA 5TSSA 1D4BA 2NMQA 3ERQA 3OWFA 2A68D 5EKKA 4N58A 4G7HC 3Q8BA 1CHQD 2EYJA 1HA5A 3J7YW 4X3TA 2K5DA 4TMAB 2WXRA 3H91A 1B2TA 1OXSC 1C76A 3KWLA 3DMUA 5CV7A 5C5MA 5G3LD 3NBHA 1I7HA 3S17B 5EE3A 1EYAA 4FVMA 1Q12A 1UWXA 2A69C 1RODA 1DOLA 4ZQ3A 3OHXC 1K52A 2Z4IA 1R4PB 2B2YC 1WRIA 4ZKBB 3MVVA 1XO3A 1STAA 2AQ1B 3BWUD 1HQMC 3TN2A 3L7ZC 4A3IB 3K5LA 1MPEA 3HGBA 2IT1A 3SDZA 1D5MC 1UUPA 5C3XA 5CC4A 3W1SA 4ZAIA 3D6CA 3D3RA 3C1EA 1ZUD2 2EXZA 2WKDA 2PKOA 4OZAA 1F9QA 2XWBB 1EU3A 4XWWA 4KN4C 1OFFA 3D4WA 3Q8CA 1PMRA 1HRJA 1A3VA 3DUZA 3GTMB 2K04A 3NBIA 5ELEA 3HEJA 1EY4A 5HFYA 3AEBB 3S1RB 2MJ8A 4J8QA 1KH0A 2H1EA 1XWEA 5CBEE 3RZDB 3RLFA 1TWAB 1PRTB 2V3PA 3L9AX 2DYMA 2WXOA 4IALA 1YNJC 5E6JA 2DYOA 3HUIA 2DBYA 2WU2B 4KJNA 3T56B 1QOBA 4MACA 2F0VA 3B2FA 1BR9A 3MFGA 1OXXK 2BA1A 3Q6SA 3OIPA 2ZW1A 4BY7B 3TEZA 4C7ZA 5I6YA 3N9YC 2VB2X 3QOLA 1DOYA 3WOFA 5I9OA 2M9VA 3HVDA 4P6VF 3L3OC 3HZXA 3M4OB 1EWYC 2L1AA 5DAUA 4XE0A 1T5XD 4C80A 5FR3A 4G7ZC 1DGJA 1JOOA 1XLQA 1FR3A 2JWUA 4NZLB 5JVG3 3U7ZA 5HG2A 3DEOA 4ZUJA 4EQOA 2WXMA 3PUWA 5LHY1 2B2UA 2L52A 1Z7TA 3W5VB 2JXMB 5EE1A 4C7YA 2KOLA 4JK1C 3P4RB 3VA7A 5IGCA 2KWDA 3DHQA 1ESFA 1EYCA 1SE3A 1IKMA 1UWMA 1R7SA 3B9JA 1MHHE 1IW7D 2DY8A 2IL8A 5E1FA 4KKUA 4Q2JA 2CW0C 1SJED 3SFDB 4YTPB 4ID6A 4R8NA 2F0HA 3P1HA 3MAQA 4ARCA 5C0XI 5M5YB 3NRZA 1SDFA 1MI2A 4FNFA 3K0YA 4YSZB 1QCBD 4H7BA 1NENB 3VYRA 1IL8A 1TWFB 3CHBD 1TQOA 3EQLC 4EVOA 4IURA 2B2TC 1WTQA 3ONAB 1P7FA 4KGSA 1B9MA 4K2LA 3J81E 1PGBA 2KMMA 2LGIA 2K33A 3J81L 3GD7A 5J39A 3BVZA 1PGXA 1ZXIA 3NQTA 4DXFA 3VQIA 4A55A 3ZJTA 4OHJA 4LAAA 1JOQA 2ENBA 4RGTA 2L1BA 1QWYA 4KHZA 4KX6B 1DZ1A 1PDXA 1DONA 1XEEA 2WIIB 5IGGA 4AYBB 2MUYA 4DK1A 4KD3A 4RWSC 3AV8A 2EY2A 2G9HD 1AZQA 1XXGA 4WRDA 1QOAA 1E0BA 2INNE 1SNMA 1NVID 4KY6A 5BN3A 5IODA 3NVYA 1FIQA 3CWIA 4HCEA 1EQTA 1V97A 2MJ3A 1BCPF 3NTIA 4A6QA 5BMGA 3KLSA 1B53A 4IUTA 2IWHA 1RD9D 2AUKA 1R4QB 5EJWA 4ZYSA 1TY0A 3AU7A 4CJ0B 3GS2A 4PMCA 3I57A 1I4GA 1HPCA 2F3WA 3FRPB 3SK4A 1EL0A 5IIFA 2J0TD 3O13A 2K03A 4YSXB 4GLSC 3KK7A 4M0WA 4A90A 3RUZA 5BMHA 3I90A 5EBCA 4RGOS 5K5PA 3J80L 4RHSA 4C56C 5COYA 2E74C 5KEEA 3SR1A 2D62A 1XTCD 1S5DD 1IYVA 1Y8PB 5M9OA 1NEKB 1UGJA 3C3LA 1NR2A 1STEA 3J7AV 2C5CA 2A69D 1ENCA 1HTLD 2RBMA 2KECA 3ETRA 2K28A 5ELCA 1GPXA 2EE1A 1U4LA 5CGKA 4KHVA 4DU9A 1RWSA 1UNSA 1WWTA 1DXMA 3DWAA 4BWGB 1JC7A 3I3CA 1OXUA 5K36H 4P16A 4ZK9B 4LK1C 4HKQA 4RKLA 1Y1WB 2WACA 2N7JA 1RCVD 1DCZA 3C1FA 5GXGB 3GTOB 2B2WC 2F0WA 3BDOA 1PYWD 3SHLA 4BBRB 1B4OA 3GV6A 3ZJUA 1LTID 3J9CA 3W5UB 3VYSA 1RF2D 5JXVA 4R8IA 1C9FA 1Y8OB 3K58A 3TP5A 5ELBA 3PMFA 2LHDA 4DAVA 4FF4A 4PMWA 1IHZA 3KBXA 2RSNA 3D31A 2EYFA 1FRDA 1AYFA 3T13A 4C3IB 3IT4B 3IL8A 2IGDA 2JSOA 1RHPA 1SNCA 3BK2A 4EE2A 5FK9C 2B2VA 1YNJD 2J53A 3JAME 5EQ0A 4HSVA 2XRQD 2INPE 2E76C 1XCQL 3Q24A 1VF5C 3TMEA 2RQXA 5CV4A 1F0ZA 4XQQA 3GTPB 2DLBA 2F1MA 1H9RA 2R92B 2IJ0A 2WLBA 1DYQA 3PIO3 2W55A 1XF5L 1AN8A 5NUCA 4WURA 1SSNA 4EQPA 1VF7A 3K57A 1F2RI 2JQRB 4OO1H 1ZPSA 1EEFD 5ELFA 4USAA 2RSOA 4M8AA 1MI0A 4KJOA 3OSOA 5IGDA 2RPVA 2BDOA 4M1UB 4QMGA 2JEAI 1YQ4B 4YTNB 3P20A 4KTAA 5K36G 1L5PA 2PIAA 5D7GA 4CKBA 4BBSB 4LMQD 2JXTA 3VR4A 1KAAA 4GDKB 1TT2A 1WTVA 3K5OA 1DOIA 5EPKA 3P1MA 2O5IC 3Q8FA 1IBXB 4IDIA 3AE3B 3VYTA 1TKEA 1STNA 5C4ZA 2NN6G 4C3IG 2WXQA 1W6KA 4XYQA 4XQJA 4UDUC 2CQAA 1GAQB 2CW0D 1VCIA 2QEJC 3K59A 4HSPA 3P4PB 5G5HA 3NSWA 3PUXA 1J7BA 1I50B 1ESRA 1BUVT 2VZKB 3TUOA 3DWGC 3FC4A 1G6ZA 3P63A 4RNAA 4G7OC 1PRTF 2WXHA 1ACCA 4HN7A 2XRSD 3EFXD 3I8ZA 1ILPA 3EGRA 1BCPB 1TS3A 3A55A 1HQRD 3AE1B 3CU7A 5EE0A 3LB8C 3E9SA 2VUMB 1ZXHA 3DM1A 1S5BD 1LTBD 1EOTA 1NI3A 5CV6A 1JMLA 2EYPA 2LFNA 1AEXA 4N9PA 2WXPA 2NVXB 2CVRA 2ZXRA 1RKNA 1SIJA 1EY6A 3D8GA 5DM73 1JW9D 4OO1G 2FUG1 2PW7A 4DN4M 1FEHA 3I73A 1F2MA 4L2YA 4US8A 4IUNA 3ABVB 3P75A 2WXKA 3M7NA 4FXGC 2SNMA 4FXKC 1RYJA 1Q8IA 1OXVA 5I6WA 5JPNC 1PUTA 4XDXA 3KLSX