2XNAC

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xnaC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xnaC01
3EFXD 4RGMA 1XXGA 4RHSA 4NZLB 2WV6D 4RFBA 1JR0D 1S5BD 3R8BA 1ET6A 1I4PA 1JWUD 1SJHD 3O13A 4K6LA 5ELDA 5FKAC 1LO5D 2XNAC 3OWEB 3URYA 1FNWA 2RDHA 1SE2A 1PTOB 4L63B 1SBBB 1RCVD 4ZYSA 1S5FD 2AQ2B 2NTSA 1SJED 1LT3D 1CQVA 1KTKA 1TS5A 1PRTF 1SXTA 1TS2A 1UUPA 1HTLD 1B1ZA 5ELCA 3V05A 5TSSA 1V1OA 1LTRD 1BXTA 1D5XC 1UNSA 1CT1D 3DWAA 3MFGA 3BVMA 5I4DA 1B44D 1LTSD 2AQ3B 1V1PA 1TY2A 3DWQA 1PZJD 1YN3A 3TSSA 1PTOD 1PTOH 2XRSD 1STEA 1SEBD 1BCPF 1LTTD 1PRTD 1PRTB 1PZKD 2XRQD 1LT4D 1QILA 1I4RA 1LTAD 1TY0A 4C56C 1JCKB 1I4GA 1MD2D 3BVZA 1D5MC 2O2LD 1LLRD 1DYQA 1D5ZC 1EU3A 1RD9D 1SE3A 2AQ1B 1KLGD 1RDPD 3CHBD 4OHJA 1T5XD 4RHRA 1YN4A 1EEID 1PYWD 1V1PB 1HXYD 2G9HD 2TSSA 5FK9C 4RGNA 3EA6A 3DWPA 2ICIA 1LTBD 1LT6D 1JWMD 3R2TA 4BWGB 5ELEA 1F77A 1KLUD 1FNVA 1I4QA 1D6EC 1XTCD 2XN9C 1AW7A 1CK1A 1HQRD 4DXFA 1S5DD 1FGBD 2SEBD 3BYTB 1SE4A 4RCOA 1JQYD 3GP7A 5D3IB 1BCPB 5ELBA 1AN8A 5ELFA 4RH6A 1I4XA 1G8ZD 1PTOF 1LTGD 2QEJC 3BVGA 1FNUA 2CHBD 1I4HA 2Z8LA 2R61A 3SEBA 2J4XA 1PTOC 1EU4A 3KLSX 1DJRD 1CHQD 1FD7D 1EEFD 1ENFA 1M4VA 1PRTC 1S5CD 4Z9CB 1CHPD 1PZID 3W2DA 1GOZA 1YN5A 1RF2D 3BYYB 1L0XB 1ET9A 2RDGA 3R2IA 3MC0B 2IPKD 2QILA 4O1NA 1TS4A 2IJ0A 4UDUC 1EFID 5D3DA 1BCPD 1EWCA 1S5ED 1BCPC 4RGOS 1L0YB 4TSSA 4RGTA 1LTID 3BZDB 4L6TB 1HA5A 2NTTA 1LT5D 1ESFA 1JWSD 4DXGA 1TS3A
chains in the Genus database with same CATH superfamily
4TKOB 1WXSA 3V60A 3H3VH 1K8MA 2A69D 4KK7A 4OW0A 4K7UA 2AUKA 3M4YA 2ACZB 1SNMA 3SHQA 3FVQA 4X3UA 2LGSA 2RDHA 2L05A 3A8JE 3P4SB 3SDLC 1S3OA 2OJRA 4POFA 3JAMc 5C3EB 1KDBA 1S5FD 3PIOA 2ASQA 1D7QA 4E3CA 5M5YH 1TS2A 3TREA 2BA0A 1CKOA 4GOPB 3ULLA 2F0PA 4C3IH 5IYDH 1X6OA 2AX5A 4JQWC 3OJ3A 2BB6A 1HJPA 2E74C 2IX0A 5IP7H 3TUOA 4J6IA 2IO3B 1QNKA 2K1FA 1PTOD 1Q82C 5L83A 3GTJB 3MC8A 4WWMA 3OTOQ 5KIXA 1PH8A 1C7YA 3C2PA 1J8IA 2PPHA 5FR6A 5GADC 1EY6A 1W2BA 1TWFB 3SK8A 1TYGB 1CA6A 1V5TA 3QIAA 3HOXB 2PW7A 3K58A 3MEHA 5EE3A 2KVRA 1RD9D 3D3RA 3I5JC 1EOVA 2MWSB 2NVYB 1P0RA 5C0XG 4C7YA 1KDAA 2FXQA 5JPNC 2ZNVC 3LXFA 4BY1G 4YHHL 3T1HL 4QCLA 2FBWB 4Q5VA 2QSDA 2VZKB 1DOXA 4JI6Q 4IUPA 3PHWB 2K3UA 2GBMA 2NVTH 1BBWA 1KQSA 2INNE 2Z0DB 3Q3NC 5D94A 1O80A 5JPMC 3Q24A 1YNNC 2CHXA 2KOXA 1C4AA 1Z2MA 1IKMA 4WURA 1V8CA 1S72A 1BR9A 3L10B 1Q10A 5C0XJ 5KNBA 2EY5A 4KKTA 2NPTB 5EDSA 3CU7A 4OXPA 1H8CA 5IO9A 4FYDA 4GKKL 3PS6A 4GN4B 3NS8A 4BKGA 1KL9A 2FUG1 3LYYA 4HJ7A 5HHDG 4LF7Q 3NHEB 1PVOA 4S17A 3PRZA 1IYVA 1PTOF 3MXGA 4ME5A 5C44B 3RLOA 3VH3B 2V3SA 2LKVA 3SEBA 2J4XA 3ITPA 1KIXA 4BFRA 1OXVA 1JOOA 2KFKA 3KWVA 4CJ0B 4R8NA 1JROA 5C0XI 2GBRA 4A3JG 4YTMB 4FXKC 2D5DA 2WP8J 2K5WA 2A68C 4I7AA 4MGIE 4MGZE 2BDOA 5J22A 2LD9A 3G6JB 2BVCA 4WJOA 2DJFC 4HTHA 2X38A 1ZYRD 4W9IA 5A35A 4AJYB 2MBOA 2LUEA 1MHHE 3RNCC 3CCJA 3A9KA 5JVH3 5D7GA 2JSOA 3P4PB 1BDOA 1TS4A 4BXXG 1K53A 3J81L 1KABA 2N9PC 1BCPD 3UIPB 3A1QB 3HS0C 2DZIA 3VYUA 1MJCA 2L32A 1XNRQ 2K4KA 2KXJA 2GVAA 2GMIC 2K8HA 2N9EB 3GDEA 3CPFA 2XK5B 1KAWA 3HKZG 3QQ8B 4RA8A 4X3TA 4MGYE 3TBLD 1J0GA 4LUVA 5IP9H 1P3QU 2W3SA 1EUVB 5E6OA 1P9DU 4CDDC 3BY4B 4OVVA 5G5HA 3H7PB 2NYZD 3UI2A 5BMHA 4BY7H 4FO2A 3S1NH 1VQ8A 2AUJD 4DDGD 2L11A 4ALPA 3KK7A 4A3PA 4MH0E 2HHHL 5C3WA 1HTQA 1SJED 3UDIA 2ZJDA 4XYOA 1GAQB 3ETRA 3Q3JA 1SXTA 3DBLI 3OG5A 3UE0A 2B63H 4JI7Q 2HDLA 4XQJA 2F0KA 5M5XB 3MFGA 1QOBA 3AE6B 4D2KA 4OEMB 3RR5A 1EZ6A 4L8JA 2V3PA 4X64Q 2O2VB 2OCEA 2VXWA 1K8GA 1J7BA 1K52A 1K8RB 2JWZA 5CV6A 2RSUA 2JRHA 4L5TA 2UYZB 4RF1A 4QIWB 2V4DA 2NCNA 2LXKA 5IP9G 3DOWA 3Q2AC 4OZAA 5GAHC 3CSTA 1YQBA 2BW2A 3SFEB 2WX0A 1Q5WB 2A6EC 1NMGA 4P16A 5G55A 2JK8A 4DR2Q 4LNIA 1I4GA 1T0SC 1QT9A 3CCMA 1XMQL 2WDQB 2I07B 5M5WH 2ZZPB 2O2LD 2SNSA 3R93A 2JA5H 3C3LA 3RN5A 2L9HA 1PGAA 3I4MB 3EJIA 4FF3A 4GKJL 1YN4A 2CFMA 3L4PA 1E6EB 4HJAA 4XXEA 2WS3B 4E74A 4WJ4A 4B3RQ 1U4RA 3L3OC 3IBEA 2XWBB 2O2VA 5IGFA 2FIDA 4GS3A 1NMFA 4ACFA 1WJNA 3L0OA 1E7PB 3ZJUA 1EL0A 2A73B 2FMCA 4IOAA 1FNVA 2VB3X 1UZXB 2IY0B 1TWCH 1VQCA 5EJWA 3ABVB 2XVSA 3HM3A 3A54A 1XTCD 2AL6A 2MJ3A 1YVCA 2VS1A 4JCVE 3TEZA 3NTHA 3A74A 1FEHA 2KCTA 1WTRA 2ZXPA 1YNXA 1LQBA 1IP9A 3CWIA 4XDCA 3AE2B 1AE3A 2Q8TA 3AULA 3GTGH 1A5RA 1Q7YC 3C0RB 3H7PA 1AZPA 2D3AA 2CWPA 4IM0A 4M01A 2C9OA 1E8WA 4PMCA 1EFWA 4K8JA 4KGSA 4DBGA 3JSVB 4NQKE 1FNUA 4BA1I 5L37A 2DBYA 1HEZE 2N1VA 4HRSA 4MNOA 4WWPA 5C4XG 1UBIA 2QW7A 2PVOD 1GUGA 5DNFA 2HJ8A 3A7LA 4B3RL 5C2TB 2CHWA 2D3CA 2UXDQ 4KKUA 4N8FA 1N9WA 1YHAA 1YX5B 3CCSA 2B76B 1SNDA 3RUZA 4NAMA 3FPUB 5T1GA 3TS0A 1XCQL 2M1MA 3BWUD 3J7AV 1IUEA 4UDUC 4I6PA 4C80A 4XDDA 4JVZA 2K75A 3HOZH 3MHZA 1RFAA 1Y1WG 4X6AH 4TKNA 4G7ZC 2J0TD 1M94A 2JXTA 4YWMA 2KFKB 2KNBA 4LNQA 2LGYA 4HDQA 1C3TA 1Q90A 1U5KA 2F0MA 1L6VA 4OVZA 3K81C 2UWQA 4R1JA 1YITA 2EE1A 1Q0WB 1GB4A 4JBWA 4MIUA 1RJTA 1ZPSA 2L3ZA 3AE5B 3RN9C 3CIRB 3J81j 2JYTA 2EKIA 1V80A 2Q8RE 1IGCA 4OWTB 5C3EG 5AEKB 1I42A 4C3JG 1H9SA 1WZ3A 1B3AA 2K1BA 2WXMA 4NXML 2N88A 4JI7L 1EWYC 1NR2A 4C3IB 2I5LX 1VQHA 1TS5A 1KTKA 2B2WC 2KTRA 3B2FA 4A93B 2R93H 4OO1I 4M8AA 2WHIA 3RNFC 3CRLC 3W9CB 1D5XC 3I4OA 5E1FA 3C8YA 2IX3A 5AZHA 3S1MH 2EMTA 4QGUA 4L5RC 2DLBA 1Y69U 1PTOH 5GAGC 5FJ8G 4IFDI 1L1OC 2N0SB 1I50B 5IYBG 4K5XA 3WAOA 1BBUA 1LTTD 4MJSA 3TP7A 3FILB 1K3BC 3TCAA 3R7QA 3VR9B 2ASBA 3J80E 1EIYB 4A76A 2KQ3A 1HR0L 1WIAA 2KYWA 1QUQB 3QHTA 2EYJA 4DXAB 5I9PA 3GOEA 2JT4B 4IOIE 4NJCA 4R4OA 3DHHC 2R3ZA 3E5SA 1LACA 2O6VD 3BK1A 3K59A 3D4DA 1KLGD 3J7AF 3VR6A 4ZKCB 2BKFA 1HNXQ 1PUTA 2G9HD 4EUTA 5JEAG 1KD1C 1XCTL 4C4VB 3K57A 2B63B 1TTNA 2FCNA 3QCAA 4DR1Q 3TP8A 5DLQE 2PI2A 2PI2E 1I6HB 3D32A 5IGCA 1GPXA 1UE6A 3U4EG 4DV3L 3K9OB 2EJGC 4XYCA 2EZVA 3CF6E 4GLVB 1AWDA 4LFAQ 1HHVA 2EDGA 2YTYA 4POGA 2NS5A 1CZGA 3PHXB 3I4MH 4HSPA 1E7VA 1KF6B 1VS0A 2REXA 2C7HA 3KW5B 4AQ7A 1GUTA 1SE4A 3ZQ4A 1UELA 1JQYD 2KQ7A 3GP7A 1WTOA 2NZ1D 5CC4A 1E90A 2YVCA 1WJJA 4DUYL 3NRZA 3UDXA 3A5UA 4G0NB 3WWVA 2JPHA 4WQMA 5JH5C 2DAJA 4WRDA 2QA4A 1P7FA 1JJCB 2K14A 3SVMA 1WM3A 1N32L 3M7NA 3R66C 2ZJPA 4BBRB 4DPGA 3W1SA 1FJGQ 1PH2A 3P42A 3GO5A 4GDLB 3NY5A 2K9XA 3OJ4B 4A3JH 1O7IA 3QOJA 1WX8A 4PS7A 3MHSD 3HP3A 1WTXA 2KZRA 2AWOA 1X3FA 3S17H 2G1EA 5HFYA 3EN2A 1W6JA 1WGKA 2JUOA 2QKIC 3LJ3A 1ZYRC 1BQQT 2AHOB 4R4CA 5IT9c 2PVGC 4DHJB 4CO7A 1ET9A 1F0ZA 5CV8A 1Q1BA 1UD7A 2NBVB 3S16H 2M00A 2K04A 3NELA 2QJLA 3BIID 4JWUC 1OQYA 2DENB 3KYCD 5D3DA 1JWAD 2PQAB 3CC4A 3ER0A 1NCVA 3Q8FA 1Y8PB 3S24A 4RM8A 1IL2A 3VH4B 2K01A 3IT4B 4MTNA 2JYEA 1F9SA 3QC8B 2DJGC 2EXZA 2E2HB 5ELDA 1OO9B 1UE7A 3F2BA 4NW2A 3DCGA 4YSYB 5JAVA 1IBXA 1MIUA 1F9QA 1EZ8A 1RL2A 1N32Q 4ZRJA 5IP7G 5M3FH 3DBRI 2VZKD 2MBEA 3DWGC 3M95A 2N7EA 3M85A 2HHHQ 3NXWA 3K9PB 1FL0A 3A9JA 1LTRD 1BXTA 1AH9A 1NI2A 1WFQA 3DHIC 3EGRA 3GZNB 4FN2A 2DYMA 4DNIA 3F1ZA 4TQUS 2KCMA 5K36G 1S3SG 1F2RI 1I3QB 5EKIA 4K2KA 2B2UA 5IGBA 4KHPQ 2W54A 3ZO5B 1R4PB 2I1JA 3GV3A 2IBIB 1STEA 2K5NA 3RNUA 2PJHA 3DBSA 3RD4A 3ZNHB 2K28A 2XTIA 1L7YA 3GTLH 4ZRKA 5M5WB 4IKGA 4JBKA 5FOBB 5GQOA 1QILA 1GC6A 4BS9A 1JC7A 3ZGZA 1L4ZB 5HKHA 1TIFA 2LRUA 4IPGA 3SD5A 2WKCA 2HTHA 1FD6A 1GUNA 3AYHB 3PSEB 1VR9A 1VQOA 2LJIA 1B50A 3VA7A 1DOMA 2CKZB 2QEXA 4IURA 4A3DH 3QOLA 3V61A 3T56B 3DM1A 3K7AH 1GG3A 1GUAB 2KANA 2QC8A 3O65B 2PE6B 2P5ZX 2I2YA 1OQQA 4AOFA 2KQ4X 2WDVB 4CDEC 1C8CA 4B6WA 4DR7L 1WXVA 4NB3A 2MX2A 2M4NA 3B0AA 3ICEA 3QB3A 4LF4Q 1EYDA 5ELOA 1N33L 4A90A 5CV7A 1UE5A 2N55A 2Q2HA 4G57A 4LFAL 4N8X1 4AH6A 3PF5A 2INPE 3M62B 1CK1A 3NTIA 2DNFA 3A56A 2C7MB 2RPVA 3UINB 3TRZA 4JI0L 5C4ZA 4X66Q 5L95C 2NVQB 4ODGA 4ANXA 4MHEA 4B3SL 4N9TA 5ELBA 3PV1A 2KLCA 2RKSA 2Y0SE 3D31A 2EY1A 2IGGA 2JX5A 3NVWA 2RPQA 4KD3A 5LMUQ 1JB7A 1T3QA 2MBHA 4OX9Q 4H02A 2ZPNA 4M0WB 3T9LA 4P71A 1N36L 1VCBA 2JE6I 2Y5PA 1Z47A 4LDTD 1XO3A 3K5MA 3S1QH 5BYRA 4OZBA 4G11A 5M3FB 4LJZC 4UHVA 1M4VA 5LNK1 5CHWA 2EJFC 1BNZA 4EVOA 5DPRA 4IO9A 4HDOA 3VTVA 1PFDA 4DV6L 4JK1C 2KN5A 1YQ3B 1O7LA 3ZNGC 1N5XA 3DVNV 4OIJA 1WRDB 1IHZA 4HKZE 5BMIA 3SDZA 2UUBL 1D2BA 1VQ7A 2ICEC 3AEEB 1RHPA 2KJHB 2K22A 4CKEA 2D5GA 2KHSA 2FCMA 4A9AA 3FILA 3I57A 2KLGA 3GB1A 1RAXA 2YEPB 2KMAA 1FCCC 3VUXA 4RHSA 2VQFL 4IM2A 3ERQA 1HNWQ 1N34L 1CUKA 1VQLA 5AJ3L 2WXJA 2WAQG 4A3EB 5JJKA 1YJ1A 1FO4A 2UXCL 2NVUI 4W9DA 2V0GA 2KENA 2CQAA 4ZYSA 2Z0SA 4QL5A 5IGGA 4F1SA 3NWSA 4J1MA 4ID6A 2V4LA 1HFGA 4A3EH 3D6WA 5C0XH 4A3DB 2DYOA 4LLGM 4K3BA 1HZBA 4TUUA 4LAAA 3JW0X 4B0MA 2WKDA 4RKBA 4OONA 2WB1E 2MA9B 4E71A 2H88B 1UGMA 2CJOA 2WGSA 1RTNA 1TY2A 3DWQA 4PYZA 1BUVT 3DVGX 1KNAA 2VL6A 4MTKA 3V3XA 4BKTA 2LVQA 5JZEB 1OXUA 1D8LA 2TMPA 4DN4M 4QY7A 2VH2A 3S15H 4HJKA 1BF4A 2OTLA 1AARA 1GUWA 3T16A 3PIPA 2PNHA 2I46A 4KY6A 1EY7A 4LW1A 2K5PA 1JCKB 3A5ZB 4O2DA 2LHEA 4HIKA 5I6YA 1WM2A 2BGFA 2QIEB 1I3QH 1EYCA 4HMJA 1G51A 2WXOA 4RMAA 1SIJA 1G6PA 4KV6A 1WGDA 2LEKA 1F2MA 4FXCA 4W9JA 4ANWA 2E5LQ 1RYJA 4PZ7A 2PCFB 3FHWA 1A2TA 3H6NA 1R4QB 3DWPA 1WD0A 2MJDA 3IG3A 3BK2A 2CQOA 1SMYC 2ICIA 3K6OA 4XT3B 3TIXA 4QMGA 3PCOB 4K2LA 4KJNA 4DV4L 3KUZA 4BWGB 3ULPA 1WCMG 5M5YB 3OOCA 2XBBC 1EWIA 3PZDA 2FUHB 3MAQA 4DK0A 1II3A 4BXXH 1D1KA 1TJEA 1ZXHA 2ES2A 5EE0A 4ZCKA 3KDFB 3QWZB 3C19A 1HQRD 1HNZQ 4IJHA 4DR5L 3P2BA 2L15A 1AE2A 3J81E 1LABA 3CQZB 2PW9A 2EYOA 2B39A 5D3IB 3T1HQ 2H4OA 5JOBA 4ME3A 4IUTA 4LFBL 4NNJB 3ZXVA 1ZE3D 2D3BA 3FAHA 1I4XA 1SRUA 1CM9A 2KN4A 4KTAA 4EE2A 3FKIG 3NK9A 1X3EA 1VQ6A 2F0JA 5C4XB 2KDEB 2KMMA 3F8TA 3HOXH 1JICA 4A3MB 1X3GA 2MEKA 1WYDA 4K6DA 2KC1A 2WU5B 1Q1OA 3I7FA 2ENBA 4YIJA 4BZAA 4H2AA 2OF1A 3E9HA 1N36Q 1PDQA 2I5HA 3MVVA 1J5EL 1CHPD 2OQKA 5C1ZA 2F3VA 2RDGA 2JY6A 3PZ8A 4H7BA 1R9TH 4XZ4A 2G5DA 2DNCA 4HAEA 3ZIMA 1IBMQ 3I9V1 2IYDB 2QILA 4EOYA 1X56A 2DZKA 1VDVA 1N6ZA 1XD3B 4JI0Q 2MBQA 1O7ZA 2F0FA 1G91A 2ZJQA 4HCEA 4L6TB 1N62A 4XDXA 3KUCB 2LVOA 3H8HA 4HPLB 3NEMA 2WIIB 2LZ6A 1TS3A 3LWUA 2BCOA 1D3ZA 2CWAA 1A8VA 2WV6D 1VQEA 1I4PA 3CMAA 2Y0SB 2D0PA 3IL8A 2JF5A 1RWSA 2W82A 4LF6Q 1AZQA 4KKIA 2IY5B 2FIFA 2IL8A 4KSLC 1ICWA 1OXTA 5D65A 1XMOQ 5BYSA 3NZSA 2ATWA 2I1KA 3IAYA 2F4VQ 1I7HA 2K8BA 4ZRIA 1B1ZA 3DEOA 5ELCA 3N32A 1X32A 1YJ9A 2HIVA 1KHIA 4HPMB 1E8YA 4GN3B 3ECIA 4NY0A 1STGA 4QUFA 4K5WA 1J6QA 4WQOB 3ZDTA 4L2YA 2R7ZH 2RHSB 1NJIC 5JEAJ 2BH2A 3I55A 1K50A 4GN5A 4R4QA 3WIMA 4NJ7A 4MN3A 3H09A 2YU9H 2R6GA 1IPGA 4DGZA 2F0IA 2EYMA 2JSVX 1E5WA 3PRMB 3PLVA 4IC7B 3A1QA 3N9YC 2ON8A 1K28A 3GZNI 1PFNA 2DX5B 2K05A 5CV4A 3STBD 2FMMA 1DGSA 2KD0A 5HG2A 4A3KB 5DM63 2KEEA 4A3GG 2ZEQA 1Q8KA 1WY8A 4J6HA 1H9MA 1SSNA 3Q69A 2CHZA 1VQBA 1SROA 3D0FA 4OVUA 3SR6A 3OSOA 3Q23A 2B8FA 4URKA 1LTBD 1ZW7A 2YYZA 2WXLA 4JE3B 1EY4A 4TQ0A 4QJFA 3GE3C 2EYHA 2EELA 2F0OA 4DNRB 1WZ0A 2PMVA 1VD2A 4X57B 1LM8B 4R8IA 1X55A 2ZTCA 3HHMA 3VXWA 3TQYA 5BYQA 1FGBD 4JI5L 5IGDA 2SNMA 1BBXC 3QK0A 3KF8A 2YEPF 3VAWA 4CHKA 3VTWA 3MXNA 3HOZG 3HOXG 2NPTA 4FJZA 4A75A 1BCPB 3JC66 1WI5A 1TT5B 1JWBD 1VQ9A 3CCVA 2HQEA 3CRKC 1G2TA 2J0MA 1G8ZD 1WH3A 1KRTA 2RGFA 2JA6G 1LTGD 4CHTB 1HUNA 1V9JA 4AYBG 2MCNB 4KV2A 4BBSH 4K1RB 2KOLA 3ZLZA 1OFFA 1NTGA 2JP1A 2R7ZG 2B2VA 1WRIA 4GMVA 3W5OA 2NR2A 1JE4A 5CV5A 5DPWA 1WX7A 3P7JA 2EVBA 5D14A 2FCSA 4W9GA 5G3LD 1BOSA 1ZGUB 3OW7A 3DVGY 3SU8X 2X8XX 3G6EA 2R93G 4FJYA 5CMDA 3HK0A 3D8GA 3HVDA 2MNAA 2FNJB 3R2IA 3RFZB 1EYAA 1PDXA 3CKIB 3F2DA 3IFWB 3GTJH 3GTQH 2V3NA 4PNYA 4RNAA 3HVZA 2VH1A 3AB5A 4O1NA 1R4MI 1Z7TA 3S2HB 1TXYA 1VMCA 1CKMA 2JA7G 4WJNA 4CQNA 3AN1A 1A15A 3RT3B 3N52A 1U4PA 2NBFA 4JI5Q 4I6NB 2VB2X 3PSIA 1SFOB 4Y52H 4H13C 3N3KB 1E8ZA 4DXGA 3Q6SA 4UP7A 5BR8Q 4ZKBB 1WR6E 2MH7A 2NVYH 4BY1B 2VQFQ 2MHVA 4OX9L 3APCA 4DK3C 4F7XA 4DHZE 1QOGA 5HI1A 1E22A 4L63B 5CR3A 3PIP3 4JV5L 1FIQA 3J7A5 3V62A 1MHXA 5FO7B 1FR3A 3CD6A 4ICVA 4DAYB 4KGRA 1A62A 1PRTF 2CW0D 1WMHA 2J53A 4P74A 3H1UA 3V05A 4JV5Q 3I4LA 3ZYYX 2BE5C 1VCIA 4MSMB 4X3SA 3DWAA 3HM6X 3BVMA 2X6LA 1STNA 2KDMA 5AUKA 1CKNA 2CKHB 1RRBA 2AQ3B 2CVRA 3M4PA 4TVAB 4WJQA 4DR3Q 2WXNA 1PZJD 3QIJA 1IGDA 3Q8BA 4XX5A 2E8GA 2XRSD 1L2FA 1SNOA 2KJ6A 1WX9A 4C4VA 1PLFA 3NBHB 4MZ9A 1UWXA 2WWZA 1EM7A 4JI3L 5AZGA 1HTPA 4XQQA 1FYCA 4DV2L 4JBMA 3HOUH 4YXDB 1B2TA 2PPBC 2ZXRA 4DK5A 1D5ZC 1K8AC 1DD2A 4A3JB 1HNXL 5IE8A 2DY8A 2KT7A 3ZXRA 3UF8A 3U50C 4F8CB 1QB5D 2UXBQ 3CAMA 1V1PB 3OYYA 3MTSA 4MJSB 4A3FG 3DQVA 5K5PA 4K5VA 3JAME 1WCMB 2N49A 3TDQA 4F8MA 3HRDD 4JI1L 4KDLB 1C4PA 4B3ML 4FF1A 2B8GA 2RCFA 4C1NK 4A93H 2R93B 1M1KC 1ML0D 2E2IB 3T1YL 1QNUA 4BOZB 1YBYA 4JI1Q 5E6NA 1WE7A 2BWFA 3ZDMC 3CQZH 1NNXA 3UDFA 4OL7A 3PVLA 3SR1A 4DR7Q 2IGHA 1XNRL 2E2IH 1MHWC 4H44C 3DEPA 1KM7A 2JZPA 3WALA 2KA7A 5IN7A 4KVGB 3J81i 4DR1L 2MLBA 1PH7A 3H0GG 2N7JA 5LHY1 4DV5Q 4A3BH 3TEHB 1X3PA 4FF4A 1U4MA 4A3BG 4NQLB 3U4ZA 3AEFB 3J7ZC 1KC8C 4GU2A 2BDNA 5CHFA 1MJEA 2F52A 4ASWC 1TQOA 1D4BA 5M5XH 5A2QE 2J52A 4DV4Q 5IIFA 2B3AA 1S5CD 3S2DH 2HDEA 4Z9CB 4KSKC 1IW7C 2MJ8A 3IAM1 1PZID 1DCZA 2NN6G 3RZDB 3ML9A 4GXBA 3ULJA 5G5GA 2VUMG 4KHPL 4W9LA 2F0SA 4ARIA 3Q8AA 3RZDH 4BY7G 1L0VB 3LB8C 1IYUA 1PH1A 4HXDA 1L0YB 1LV9A 1JALA 2WFWA 3AMUA 2MSED 5E4XA 2KQSA 2EMSA 4FVMA 2JEBI 1DZ1A 3PUVA 3P75A 1ESFA 1P1AA 1SIFA 4RF0A 1JQ4A 1HUMA 5C3XA 2KVZA 1PFMA 4M8MA 3T8MA 3W3AA 4PYUA 4YY3Q 2A69C 5KRUA 4NAWB 1ET6A 1U9RA 1GO3E 4G4KA 1XYIA 1SYBA 1KJTA 1B3QA 2LVPA 2WXPA 4IW0A 1CMXB 3APFA 4RM9A 3URYA 1SYFA 3QJZA 3B1LX 4DAMA 3OLMD 5C4XH 5C6AA 4MM3B 3A4RA 3KLSA 4K81A 1XMOL 1R7SA 2D10A 3FPPA 2VRRB 3HIZA 3DM3A 3N1ZC 3PZ7A 5IP4D 1TWHH 1YJWA 1B53A 4JPBW 1VQKA 3EFCA 2E3TA 3ENEA 1B44D 1V9PA 1R4NI 3RNAC 1YIJA 2UU9Q 2W55A 2RHQB 4V0BA 2VQEQ 1Q8IA 1P8LA 2HQLA 3DLLA 4II3B 5IA7A 1VQDA 2UXDL 2AMCB 3T53B 4EQ5A 4DHZB 1SEBD 3S16B 1WJ6A 1BCPF 2D11A 2E6XA 2A68D 1BVSA 2LXCA 1FJGL 1NAPA 3HOWH 1CJEA 1IBKL 1UF0A 1L1OA 3H0GB 2WNMA 4C56C 2DGYA 4B95A 1WYWB 1VQNA 4DV7Q 3IXSA 2K0PA 3BDOA 4PV1C 1LLRD 1RIPA 4UPAA 2NBUA 2GLSA 5CYUA 3KUDB 4TQ1A 2RCNA 1T5XD 4AP4C 4F88A 4KIKA 2F4VL 3E6ZX 4DV6Q 3OWFA 2C9WB 2IWHA 5CGKA 2N7DA 1YIWA 1SAPA 2Z4HA 3MA2B 2LFIA 4TMAB 3R3MA 3S14H 1JWMD 1XJVA 1C9OA 2JA5G 1SLJA 2WLBA 4G3XB 5FO8B 5ELEA 1SNPA 1QZGA 4CKCA 5CBAE 2UU9L 4B3MQ 3KLRA 2Q2UA 3RNEC 1NYQA 4AQYL 2M56B 4AYBE 4LCDE 1MSGA 2H5XA 1ACCA 5AUIA 3VR3A 2UUCQ 3VYRA 5ELNA 2R92B 2KHJA 2ZJRA 2HJ1A 4GIVA 2BH8A 3P4RB 2KJRA 3OIPA 2UUCL 4QB4A 5ELFA 3UQAA 1HZ9A 5MPOA 4YCUA 1HNZL 1U0LA 3SHLA 1M90C 4B3TL 2QEJC 1SMXA 3PO3H 1RTOA 2B63G 2Z8LA 1OQRA 5BO4B 2MW5A 1DM0B 2VNUD 1QOHA 4DR2L 4KMUC 1WXMA 1MVKA 1C4CA 1A2UA 3X3NA 5LMNL 1NDDA 2OEOA 1PRTC 2LMCB 3L2PA 3PREA 3GTQB 1MKHA 2RA4A 3A9KB 3D4RA 3ZJYC 1AFPA 1T0QC 3AE7B 2OWOA 1PH6A 2HT1A 1MI2A 4C3JB 1I50H 1LTLA 3IKJA 1F2RC 2ZCCA 1CA5A 3AEGB 4A3MH 1F9JA 3DBRB 3S15B 1SN8A 3VHTC 1T9HA 2J42A 4C3HH 4FJVB 2N8NA 1CTMA 1S5ED 1XLQA 5JEAH 1HRJA 4KI0A 5F2DA 1VQ5A 1LTID 5H1SE 2OTJA 2MHJA 3V96A 4HEA1 1XQQA 4JOIA 3N20C 4MM3A 1GUSA 1YJIA 2HCCA 4JYAL 1UE1A 4KN4C 3NWTA 3HOWB 2IGDA 4L1BA 1C79A 3R7RA 2HD3A 2JA8B 1A3UA 1SYCA 4KN7C 3E0JA 4XQNA 4PQXA 3CCLA 4P1CC 1QCBD 2WB1B 1QVGA 2KUMA 4YWLA 3CC2A 5J2RA 2XEWA 4IUVA 1MJDA 4WFN3 2NTSA 4IPCA 4LF9L 2B29A 2B2UC 1VZ8A 3Q3OC 2CW0C 4KY7A 2E76C 5TSSA 1ASZA 4YT0B 1UNSA 4APVA 3VFKA 3RZOB 4NP5A 1CSPA 5CBEE 2WDTB 5D2MB 4BKSD 2A4ZA 2Z6BA 1X54A 1F2LA 2J0JA 4ZQ3A 5M9OA 3CCUA 5DEHA 2UUAQ 4HR7B 1N61A 2ZCBA 1CQFA 3STBC 2SOBA 3CCRA 3E9IA 1PZKD 1PRTB 1U4LA 2MPMA 2UUAL 4JI6L 3PO0A 1GB1A 5C4JH 4CBVA 1D1IA 3HKZE 2ZW0A 1VQPA 3RYTA 2PTLA 4DA2A 1EUJA 4XTCS 2EYPA 2WXIA 5C4JB 1J7CA 1TWFH 3CHBD 4HWIB 1Q81C 2AEHA 3LNNA 2JQRB 1OEYJ 4BY1H 3HOVH 3BDLA 1UWVA 1Y1WH 4RGNA 2DHZA 2HTME 3GQBA 2LMCA 5COYA 3H9DA 3OIQA 1LUZA 1L2NA 3PGZA 1Y1WB 1PMRA 4FP5D 4JIOU 2E2JH 5KGUA 4LFCL 4P75A 1PFBA 2V9HA 4US8A 3PGEA 1NBWA 3B6YA 2JU6X 4GDKB 2LGDA 4DXFA 1B8AA 3UGBB 1C4QA 1XT9B 3PUWA 2RF4A 2LS01 3H0GH 3M4QA 2PYKA 2PKOA 3CMMB 1HA6A 4RAUC 4C3HG 2JA6B 3CCEA 2IT1A 5IGEA 1VQ4A 4MH8A 4S3SA 4OGQC 1TWAH 1ROEA 2Z9HA 5AJ3Q 3MJ5A 5FR3A 1UEBA 4LF6L 1JT8A 3KJOA 2MP2B 2JZ3B 1TWAB 3S14B 2DNEA 2IW3A 4OO1H 2K50A 3E0EA 2I5MX 2WXGA 4O42A 5JXVA 5EKLA 4B08A 1C76A 3BYYB 1VQMA 1WCMH 1VF5C 3P1MA 2J7QB 1CKNB 2EXDA 2AYOB 1F9PA 4YSZB 4WJWA 3OMGA 2BA1A 3C46A 2E75C 4LUZA 4BVUC 1L1OB 1FXAA 1BCPC 1WTHA 2IO2B 1L6UA 4M1UB 1CI3M 3TN2A 3EFXD 5J18A 1E0BA 4RFBA 3TMEA 2ZM6L 3DWMA 4JWSC 2F4IA 2L0CA 3DVNU 5KNCA 1LO5D 2K7VA 2DY7A 3S1MB 3WCQA 3NVZA 2JQOA 3VVWB 1FNWA 1SMYD 1E9MA 1A0IA 1HZAA 1XLNA 4ZRPA 1TWHB 4CKBA 4USAA 4A55A 2AQ2B 3A7AB 1VQIA 3U8ZA 3RCZA 3HEJA 4HMIA 1HPCA 2QCPX 3C1FA 3GTKB 1K0RA 4DR5Q 2B2TA 4DKAC 2X69A 3NUCA 5IT9E 1QG7A 1MFWA 2EYFA 1F1HA 1TZOA 1WF9A 2BOSA 4IOCA 3DHGC 5CTRC 1HR0W 2NZHA 3KUPA 2PZWA 3A8IE 3NE5B 3SE0A 5C4HA 1UEAB 2KCCA 1I5FA 3QR8A 2XIWA 5G3LF 1WGRA 2BBCA 1PH9A 4EQOA 3OPOA 4U673 4WWOA 1WOCA 1XTDA 1I6VC 5HGQA 1LT4D 1E1TA 4XT1B 3I8ZA 4R4TA 4QUCA 4DFAA 5HGTA 5EPJA 4A3CG 2O6VA 2M19A 1TKGA 2JA8H 4XE0A 2B2TC 2FJ2A 4J15A 2JA6H 4HJGE 3VDZA 5I2YA 1E3PA 3Q3FA 1FVIA 5M3FG 4Q2JA 1Z6HA 5J39A 3W1YA 4R9WA 4AS1A 3IRBA 2H89B 2L1BA 2TSSA 1Y14B 2F0GA 3QO2A 4FDBA 2JA5B 1BUIC 4HCSA 3EROA 3CCQA 1QF6A 2A6HC 2J7ZA 4QF4A 4DHJD 1CFMA 4OZCA 1Y56A 2CCZA 4ZLTF 4K0KL 3WOEA 1I4QA 1YQ4B 2K5DA 3A8KE 2CJNA 3KJPA 3PUZA 5I2XA 2GOWA 1YZ6A 5IOIA 1ONLA 1LM0A 5T8IA 1IBXB 4PMWA 3HOVB 1I35A 2SEBD 4LNNA 4RCOA 4JI2Q 4JI4L 2GBKA 4N9F4 3TZUA 4CJ2C 3I70A 3H3VI 3CW2C 1DOYA 2BE5D 2MGSA 2WAQB 1L0WA 4A3EG 4HCNB 1V86A 1X65A 5GAEC 3PF4A 4IZ8A 3X3MA 1OXSC 1HNWL 4HN7A 2OEDA 3RNBC 3JAMi 2D0OA 3QARA 1U4AA 1N8RC 3U4VA 3VYTA 3MWYW 1B9NA 2K03A 1OTRB 3IHPC 3SFDB 1P7EA 3TEXA 1CSQA 2M0XA 4KLKA 3AV8A 3QAQA 1NENB 2IO1B 2PNRC 3EBEA 2N9LA 4M02A 2K39A 5FLXc 4DV1L 2HD5B 4MSQB 2A5HA 1EYGA 2ZW1A 2YV5A 1UBQA 5CX3A 2BYVE 2A8VA 3E56A 3OMCA 4GDLA 4YCWA 2C7NB 1AYFA 1ZOYB 4IALA 1GXDC 1H9JA 3H7SA 2HE7A 2L76A 1EY9A 4NJ6A 3KH0A 1KOTA 3NOBA 3KVFB 2LSSA 4LF9Q 1XMQQ 2L83A 3GV6A 4JL9A 1X3QA 3PO2G 2ZNVB 1SE8A 3BJUA 2RDBC 3TL5A 4RGTA 4CGYB 3J80c 3VR5A 3I56A 5KNDA 3Q8EA 4BBNC 1AEXA 2N9XA 3RULA 3MP9A 5EPLA 1XXGA 4DUZQ 1OGWA 1WFYA 4KGTA 3D6CA 1STYA 5EGTA 4X62L 4GNXB 1EWHA 4A20A 2PO4A 2WB1G 4KKJA 1FCLA 3U2SC 2F0LA 1Y1VG 2BT6A 1A70A 3RD2A 1WE6A 2ID0A 4F7ZA 1KH0A 1WMHB 3GS2A 1UUPA 2MFIA 3T4AC 4JPSA 1V6EA 3G48A 5AFWA 3K5LA 3KLWA 4AQYQ 1C77A 2Q2IA 5HY6A 3Q3MC 2N9KA 1GVPA 1QWYA 3P63A 4R3DA 2EIFA 4A3IG 3TSSA 3HOUG 4LNFA 1IXRA 5EQ0A 1NSNS 2BYEA 2Z0EB 1FXIA 2KFJA 3RZFA 5AZFA 4OO1G 2JJQA 3FKIB 2W3RA 1MPEA 1Q3LA 4CDCC 4RMFA 4EZLA 1SYEA 1GC7A 2ONQA 4MGKE 3OTOL 2MJEA 3ZW3A 4TRDA 1DOIA 1IBLL 4HEDA 1D5MC 4YL8A 3ZKJC 4FXGC 3ZUNA 2LFNA 1LFDA 3IFDA 2K5QA 1FRDA 4DNTB 1HXYD 2OT2A 3R3OA 4NKLA 3EUB2 3ZRFA 2A5UA 2M9VA 1GUOA 1J5EQ 1R9TB 4YTPB 4GLXA 2PEAA 1ZXTA 1LT6D 4IUUA 4NXNL 3D4WA 4I65A 2GI9A 3T1YQ 2UXCQ 2Z1CA 3PLUA 3TEYA 1QOFA 3UI3A 4LWCA 2KMCA 4ULLA 3LGJA 3NPPA 1NBFC 4JOIC 1YNTE 2CU1A 1TVXA 5JJIA 2L8JA 2WP9B 1WSPA 3HOYB 2L5TA 2N78A 5IWAQ 5IODA 3PO2H 1KXLA 1YNJC 2J0KA 5EBDA 3VTUA 1WTQA 1P98A 2LASA 3GE8C 4B9KA 3K5NA 5BMGA 1DOKA 2CU3A 2V1YA 2AKWB 2KACA 3NSWA 5E3FA 2K32A 4KHVA 4Y7NH 2CH4W 5IAAC 4WWNA 3IVFA 3ZTDA 4JLCA 4FA6A 3RMHA 1YJNA 1SR3A 3PRPB 2AWTA 2R61A 1F2ZA 2SDFA 4ZRZA 1EU4A 1PYBA 2BF8B 3FKYA 5FO9B 2KWVB 4PS3A 4DR4L 4HJ9A 1E2VA 4A3LH 1EEFD 3KF6A 2WU2B 4BA2I 3AMZA 3IFTA 5T1IA 1EQTA 4LNOA 1MSHA 2DAFA 4BBSG 1YN5A 4GLAC 1HTOA 2F03A 5EPKA 2AL3A 3TP5A 2IZVB 4MEMA 5J17A 1BT0A 2H1EA 2JRIB 2MBBB 2JVCA 4DR3L 1E7ZA 1FFVA 3T51B 2L55A 1VQFA 3ZRCA 2EJMA 3FMCA 3MJWA 2MUYA 4JI2L 4JI4Q 4K8IA 3I90A 2A74C 3SK6A 3HOWG 3DBHB 4DAVA 1LGRA 4H0LC 1A3TA 1CHQD 1STHA 4M00A 3U30A 5EKKA 1PV4A 1MG4A 5IOCA 1MG8A 4L23A 2KDIA 3ZJTA 1S5BD 1E7UA 1XLPA 1JWUD 1SJHD 5BN3A 1YOVB 2F3WA 1Y8OB 1GHKA 3QG1A 2K52A 3AU7A 4GNXA 3GTOB 1JRPA 1NY4A 1WGYA 1V97A 3W1SC 4X62Q 4KKSA 3NJTA 2KO3A 1KFYB 2ZVNA 1WXAA 4QAYA 1XX8A 5C44H 4C00A 3G71A 4IUMB 3TZDA 2FINB 5H8YE 2AWNA 2EKEC 1KNEA 1N60A 3RMKC 4XGAB 3UDGA 1R4NB 2BYFA 2BTEA 1CT1D 3I63C 2VUMH 4WH4A 1HE8A 5I4DA 3W1BA 4K7WA 3P1HA 2L52A 2MP1A 3HGBA 4NPNA 3HOZB 1YN3A 2WXFA 3QX1A 2EYLA 3NQIA 5LL6S 4BOSC 5LXIB 1N34Q 2R92H 3KBGA 4JC0A 1LYLA 4XC2A 2ZPYA 1PRTD 3AQQA 4ZRQA 1TIID 4PZ6A 4LF5L 4JI8L 2Y3AA 4NMZA 2F0VA 4V190 2LRWA 3L54A 4FNFA 1YHBA 4PZ8A 2AQ1B 1DYQA 1SE3A 1E2WA 1VDZA 3L7ZC 3SK5A 3K7AB 3PPAA 4GB9A 1IBLQ 1T0YA 2EPBA 4A3OA 1V1QA 4FBJB 3EC8A 2BPSA 1EEID 1HR0Q 1B9MA 3PTFC 3VUWA 1CZWA 1QZHA 1V43A 3LX0A 3GTMH 3A33B 2FFKB 1EY8A 3I72A 2JA7H 3JAML 1Q86C 3Q14C 4EKUA 3ZVVA 1K73C 1WTPA 5TR5A 2LXAA 2JXMB 1F9RA 3K5OA 2K6DB 4ANVA 3AECB 3R2TA 1EY0A 2R7DA 4HJ5A 3AU5A 2JA7B 3L13A 4BKSA 5IYBH 1H95A 4ITKA 3CC7A 5LMUL 1D6EC 2QMTA 3WA0A 3HOVG 4DK6C 2JN4A 1M8AA 4B9WA 1TBEA 2XSCA 3VR4A 2XN9C 5ISRA 1EQRA 4JYAQ 4KZ0A 1SB3C 3SK4A 4DU9A 4DV3Q 3TS2A 2C5LC 4NAWA 4HVBA 1TGZB 1AP0A 2ZTEA 3FDTA 2BS2B 2JZZA 3H91A 2KJXA 2BQQA 4AUQC 3S2DB 2XK5A 1HQMC 2L12A 2A1AA 4NXMQ 3DBLB 1EQVA 2NVTB 3ND9A 3V2TA 2QGQA 3HKZB 4LF4L 4ILWA 5C3EH 1ZKOA 1N33Q 1XLOA 3H6MA 5IT9L 2MO0A 1WTWA 3IAS1 4N59A 3EQLC 5LMNQ 4J8QA 3S2AA 1SF0A 1NR4A 1DGJA 4YHHQ 1FD7D 1V49A 3NVYA 4S0RA 3NG0A 4IWQA 3OW2A 3I4MG 4DR4Q 3TEWA 3T13A 1GOZA 2N1WA 4WAFA 2XGTA 3E3XA 4DR6L 2PQEA 5M3MG 4DK1A 4IFDG 2DZMA 2V4IB 4HCPB 1W3SA 4YWGG 2D3GA 3PO2B 1MGSA 3AE8B 4N9PA 1JE5A 1V2YA 4JX1C 1EWCA 3M4OH 4RGOS 4FULA 3ZJVA 1H4RA 3W1GA 3S1RB 5KHOA 5NUCA 2HUGA 2EY2A 1YEZA 4A3GB 5KYIA 4GZYC 1VJKA 3ONSA 3RLNA 4RGMA 2RMMA 3RZWC 4BBRH 5IY0A 1VZ6A 4K6LA 1G291 3O13A 1QVFA 1UGJA 4DUZL 3S1RH 2L0TA 3VR8B 2BYTA 1ZEQX 2W9NA 5LL6X 4IFDJ 2C5CA 2YTXA 4IQZA 1B9RA 1B7YB 1GD7A 1SBBB 5GXGB 3MC9A 3RLFA 1Z5SB 2KDBA 4RCNA 2CS4A 4LF7L 1CQVA 5FLMH 2LUMA 2Z6KC 4GNXC 1EIGA 2PLPA 3KWLA 1Z9FA 3TMPB 2PE9A 5LMNW 1V1OA 4PK1A 4ZHOA 4A3IB 1STAA 1EY5A 1YMHE 5JHAA 1ENAA 3I2ZA 1HZCA 3F2CA 1Y1VH 4BY7B 1V1PA 2DYBA 1J7AA 3MHBA 3ML8A 2KCNA 4EX5A 4X65L 1EQQA 2GBNA 4GN1A 4P6VF 4A3FB 2UU7A 4P1BC 5C5MA 3U7ZA 1I94L 3X23A 4FHJA 3J81c 4LF5Q 1JJGA 3IT6B 2INDC 2R2QA 2MQJA 1IBKQ 2M17A 2ZVOA 4A3BB 3V6EB 1JB3A 3I3CA 4C3IG 5IYDG 4KHZA 3RPFC 3I3TB 5JVG3 2NVQH 2EOTA 2G45B 2O5JC 3NBHA 5DPSA 1TKYA 4LF8Q 4DAPA 2KWDA 1FFUA 4IPHA 4GSWA 3L17A 4MT5A 1WJUA 4K14A 2BS3B 3FC4A 4RG1A 5E6JA 1OEYA 2EQSA 1YX6B 4MDKE 2NVXB 1PGBA 4GKKQ 4LFBQ 2FAZA 1KDCA 3M3YB 2VUMB 4MELA 2NWGA 4GOPA 2RD0A 1RKNA 4B0EA 3S1QB 3KQ4A 4K7SA 1ICFB 2DN8A 4DAYA 4M0WA 3DHQA 1KLUD 4UAIA 2KX0A 2IHEA 4GOCA 1ENCA 1S40A 4A93G 1N5WA 4II2B 2ZTDA 1WD1A 4X64L 1YD8U 4NPSA 3KYDD 2KDFB 5EAYA 2KWUB 2WQYB 4C7ZA 3S2HH 4DV5L 3CPWA 3BS1A 5IWAL 3M4OB 4Q0FA 2KHWB 1GNUA 3RI7C 3BG3A 1E0ZA 4W9FA 3FKIH 5IYCG 2KVMA 2O5IC 3NP8A 4CYEA 1PFSA 1TWCB 2NN6H 5J3BA 3WDNA 1TR5A 2CHBD 1P16A 3S9WA 3FEWX 4ABNA 5BR8L 4LF8L 4A3CH 1EIHA 1BMLC 4IM3A 3VQIA 4A8XC 1FMAD 2QDLA 1E10A 1DJRD 2INCC 4LUOA 4F87A 2KX3A 1K0SA 2NZOA 4I7ZC 2L0FA 2XWJB 1XNQL 1C48A 3W2DA 3PO3G 1RF2D 1HZ6A 3OAWA 1ASYA 3B08A 1VLBA 1I6HH 5JHBA 3MC0B 1NEKB 1Y8NB 1HZ5A 4N58A 1S1QB 1EFID 4DV1Q 2Y5CA 1V5OA 4BBNF 2RSNA 1JMLA 4YSXB 4HPPA 4JGHB 2HIXA 3I4NH 3AE3B 1WXQA 4P7IA 3BZDB 1EF5A 2KTRB 2NTTA 2F0TA 3GTPB 4LMQD 3EECA 3HOYH 5DCNA 3X0WA 3MXNB 1FM0D 3DDCB 4NZLB 4I6LB 1HCZA 1GJZA 3R8BA 5JJZA 3AE1B 1GKHA 2XNAC 3OWEB 1NVID 4NXNQ 1SSOA 4ZAIA 1SNCA 1R4MB 1RCVD 5IKCM 2QDBA 1WJ4A 3DPDA 2GA4B 2KK8A 1LT3D 3A4SC 1S4ZA 5LXHA 3NUHB 2ALYB 4M8NA 3NZUA 3PMFA 3EIVA 4FXDA 1VQJA 3M3YH 3HOUB 3AM9A 1K9MC 2UUBQ 4C2MH 4DR6Q 1RM6C 4EQNA 4LFCQ 1L5PA 3N30A 3L0WB 1JOKA 2R92G 1SE9A 4PG3A 5C23A 1PQSA 1J8CA 3CXCA 1FRRA 3LDZE 4JI3Q 2BB5A 1WGGA 2DZJA 2LHDA 1E24A 5BN5A 4AJWA 5FLXE 1ZDVA 3Q8DA 5CHVC 1KLVA 1JJ2A 2XRQD 4YCVA 2KAJA 5E4WC 2HDMA 2K5VA 4HIMA 1G2SA 2YLMA 2G4DB 1B70B 2F0UA 1LTAD 3KFUA 1KAAA 4A3IH 1SYGA 2LJ5A 1PYSB 5C5LA 3DXJC 4EEWA 1IZ6A 2E2JB 1IYJB 1ZUD2 3JSVA 3AE9B 3BZKA 1QKZA 1RDPD 1E2ZA 2B2YA 4OHJA 2Z4IA 1C78A 4GLSC 4IWOA 2B2VC 2KECA 1PA6A 3K0YA 2G4SA 4IUQA 2GB1A 4BBRG 3EA6A 2R7FA 1EIFA 3VR2A 4C1NI 1C0AA 4A6QA 1V81A 1C1YB 2GN5A 4HK2A 4DV0L 1VF7A 3PUXA 3K8AA 2MP2A 4KDIC 1F77A 2MRPA 4A3FH 5M3MB 4LK1C 5BN4A 1WR1A 3U52E 1UWMA 2RSOA 3J80i 4WJPA 2X6GA 2ZM6Q 2A6HD 4RKLA 4IFDH 2BWES 4DDID 5M3MH 3BYTB 3PT2B 4DWFA 4FADA 1KRSA 2HCIA 2F0WA 4QIWE 2JA8G 1A3VA 2LGXA 3C1EA 3L16A 3CP0A 4JBJA 3RUIB 3MXPA 1ZXIA 1H9KA 2SAKA 4GDKA 3PQIA 2F0DA 1A63A 1STBA 2E5LL 2K33A 4DQOC 3H3VC 2WXRA 4MACA 5JJLA 2F0HA 4WAAA 2WDRB 5C3JB 3RN2A 2KC2A 2PZTA 3WAMA 1PTOC 1UH6A 4LJPB 3I91A 3KLSX 3WOFA 1WYGA 5C44G 2Q5WD 3N1XC 3ND8A 4BBSB 4XWWA 2Z6KA 1WI0A 1NI3A 5I6WA 1ZKHA 3L9AX 2A19A 1N63A 3NZ3A 1XF5L 4LJOB 3F2UA 1OTCA 1V8QA 3VUYA 1L0XB 1VZ7A 4G7OC 3NENA 2LWPA 1Q1EA 2IPKD 2L1AA 1SDFA 2M0AA 3G4SA 1NYRA 2IJ0A 3KF6B 3DMUA 5FLXL 3CMEA 1QUQA 4YWKA 2F1MA 2LGIA 4ARCA 2ZT9C 1UAPA 4IUNA 4ZUIA 3MTNB 1HA5A 4HJ8A 1PGXA 1RLFA 1FXTB 4LDTB 4OELB 2CR5A 1BKBA 3AB9A 1JR0D 3H15A 4LTUA 1K51A 2F0QA 4UP9A 4EZJA 2F3IA 3N1YC 2ZXOA 3M9BA 3AI5A 2PMZE 4K0KQ 2IY1B 3AU4A 4TV3A 1JORA 3VRAB 4EZKA 3ZTCA 3KDFA 1F52A 2VY3A 1MI0A 3ALBA 1HTLD 1WWTA 1YHQA 4A3MG 3T3OA 3W5VB 4X66L 2RVLA 3MFYA 1H9SB 2GBJA 3AEBB 3TP6A 1ILQA 1QVCA 4W9EA 5H92C 3AXCA 3GTOH 3EFUA 4EFOA 2K25A 1DOLA 4K3CA 1VRAB 5KEEA 4IN3A 4PMBA 5A2QL 2G9DA 3I4NB 5FLMG 5DPTA 5J1ZA 3DUZA 4HSVA 1G6JA 3P4QB 3BU2A 5GMVA 2VW9A 1ILPA 4IG7B 2MO1A 2B2WA 1PH3A 3VRBB 3T3NA 4HIDA 3VDYA 2M2LA 1GJXA 1I4RA 4Y7NB 1Y8RC 2JYOA 2WACA 4W9CA 1MBYA 5HURA 1XPRA 3RNGC 2OQ0A 4FF2A 2C35B 3EVQA 2K6QA 5LLIA 2NVXH 4W9KA 3PUYA 1L4DB 2PZUA 3AE4B 4RHRA 2F0NA 5E7NA 3Q22A 1FGUA 3CF5A 1PYWD 1T0RC 4ZOHC 2KTFA 1IW7D 2Q2TA 1J9OA 2CH4A 5FK9C 3SGIA 3QA8A 2I0QA 4HLEA 1RFKA 1EO6A 2OHFA 1QE6A 1XWEA 1W6KA 3N6RA 4A4IA 3U58A 1JOQA 2R2OA 4CDFC 2PIAA 1PXUA 2C60A 1T5EA 4X65Q 2L4NA 4US9A 5FJ8H 3NHHA 4OIKA 4KZCA 1SNQA 3HG9A 4HIOA 4A3KH 4G50A 1VMPA 1SGHA 3A0JA 4IPDA 4W9HA 1J19A 2RBMA 2YU9B 1K83H 1S5DD 4ZHPA 3E9SA 3J80L 2EY6A 3CSFA 3U9SA 3LWEA 2VZAA 4LK0M 2OXPA 3NQTA 4UY8C 1FPYA 1Q46A 4GOPC 2BS4B 1JRUA 1SYDA 1LXDA 1K83B 2JEAI 2LXJA 1QQRA 4KX6B 4R4IA 2D62A 3MEFA 1WVLA 4A3LG 2NBWB 4QQBX 4GGQA 1XPUA 2GRIA 5G2NA 4C3JH 4O0AA 5D6JB 3WAPA 2GVBA 4YY3L 3OHXC 4L5SA 2IDYA 1I4HA 4ANUA 3MXUA 5GROA 3SXHA 4P2CB 4KY5A 2D07B 2B3GA 3MZ5A 5EBCA 4ZYNA 2OOBB 2DWQA 3HZXA 5CORA 3GTKH 3AFQA 3AEAB 3A55A 3AH7A 1ENFA 1O78A 2KEDA 4XIGS 3FRPB 4JW0A 1JW9D 3QJYA 2G3QB 2KHIA 2D2CC 4KIKB 4A3DG 3L08A 4FHKA 1QLBB 1X9NA 4XWTA 3AEDB 1CZPA 1X1MA 5EE1A 4WIPA 2WX1A 3K7UC 2D9UA 3I4NG 5DAUA 3U7DA 3AFPA 4J3OD 1YI2A 1BO0A 3EHVA 3G7LA 1LT5D 2NN6I 2YTVA 3J9CA 3H94A 2KWCA 5KYLA 3RZOH 2V1CC 5FKAC 2IX1A 2OJWA 5DM73 2M8SA 4ZDVA 2WAQE 4ZUJA 5I9OA 2Z59B 3B9JA 3Q6BA 2WYQA 4ICUA 1SE2A 1PTOB 2E2DC 1Q12A 5K36H 2JXXA 4B3SQ 3HUIA 4OWXB 3AEVA 2JA9A 1IL8A 1EF1A 4L5QA 1TT2A 2JWUA 1SFOH 3NVVA 3BINA 4A3GH 3K80C 2LI5A 3HKSA 4XYQA 3M63B 3W5UB 2R7ZB 4IDIA 3QWNA 1ISNA 1TZ1A 3ZNZB 3JVZX 1LTSD 2F0EA 2D2QA 4BAXA 3JYUA 4C3HB 2LY7A 1H9RA 1T6BX 3BDCA 4DF7A 2L7RA 2Y5BB 4FLHA 3NTKA 1JMCA 3GTGB 1TWGH 2WXKA 1WGHA 4ZK9B 3NS1A 2K6AA 4DV0Q 3TBIB 1WTVA 4U68A 2QDFA 2RDFA 3KBXA 1NE3A 1TY0A 1MD2D 3PV0A 1I94Q 4REZA 3BVZA 3KYHC 3GTPH 1Y1VB 1IKLA 4AIMA 2BKRB 1EU3A 1K3RA 4RWSC 4GKJQ 3DBHI 1G6ZA 4DUYQ 2VQEL 2MQHA 4E6IA 2O6VB 1XNQQ 4DV2Q 4EGVA 2RR9A 3PIO3 3UQBA 2K8CA 4P72A 2Y0SG 3VA5A 1GM5A 1QOAA 3KF8B 3M7GA 3VYSA 1ZP0B 2QCZA 1ESRA 1TKWB 3A9JB 2WXQA 2IHFA 4KD4A 3APDA 3ONAB 2DUDA 3Q0AA 3Q8CA 4HROA 1C9FA 1B4OA 2FHTA 3I73A 3TJPA 1YNND 1A6XA 1YJJA 3UIOB 2B2YC 5CV9A 4C2MB 1AW7A 2NMQA 3P20A 1XPOA 1PHJA 1ZDXA 3NBIA 1XEEA 3ZNID 1VQGA 3ERSX 3GD7A 5KHQA 2PMZB 2Q8IB 3BZCA 1YNJD 4WORA 1GHJA 3S17B 4PT5A 3B2GA 2PW5A 4EQPA 1AN8A 4G7HC 2QF7A 4RH6A 4UP8A 1PH5A 3GTLB 4IWPA 2NB0A 4YTNB 2UXBL 2FE8A 1DXMA 5EE9A 4IJLA 1E1OA 2A6ED 3BVGA 1DONA 4N6EB 2K5HA 1F2YA 3KOJA 2FCQA 4PS8A 1KRHA 1NUCA 2WXHA 2N4FA 2WINB 4X3KA 3J7YW 4KJOA 1E8XA 2I38A 2KKCA 4HKQA 2O4XA 2PQAA 4NDXA 2RQXA 3PO3B 5IYCH 1QJOA 1RODA 1PH4A 3HRZC 4A3KG 1QZEA 3GTMB 3WANA 1VQAA 1OXXK 2E2HH 1IYFA 3U9OA 3UE1A 2QHOA 4OWWB 3HOYG 1TU2B 4B3TQ 3S1NB 1TKEA 4JI8Q 3M3JA 5E6PA 4B9XA 3HFZB 4AYBB 1IBML 2L00B 2IO0B 1EOTA 4AWJA 2N3SA 4DV7L 1O7YA 1K8OA 2KBNA 4TSSA 1HH2P 3FP9A 4CJ1B 3K0XA 1HFNA 3V6CB 4WJ3M 4LNKA 2NUCA 1JWSD 1TWGB 4JG2A 4P73A
chains in the Genus database with same CATH topology
4TKOB 1K8MA 2A69D 4KK7A 4OW0A 2AUKA 3M4YA 2ACZB 1SNMA 3FVQA 4X3UA 2RDHA 3A8JE 3P4SB 5C3EB 1KDBA 1S5FD 1TS2A 2BA0A 2F0PA 2AX5A 2BB6A 2E74C 2IX0A 3TUOA 1QNKA 1PTOD 3GTJB 4WWMA 5KIXA 3C2PA 1J8IA 1EY6A 1TWFB 3SK8A 1TYGB 1CA6A 3QIAA 3HOXB 2PW7A 3K58A 3MEHA 5EE3A 1RD9D 3D3RA 2NVYB 4C7YA 5C0XG 1KDAA 5JPNC 3LXFA 2FBWB 4QCLA 2QSDA 4Q5VA 2VZKB 1DOXA 4IUPA 2K3UA 2INNE 1O80A 5JPMC 3Q24A 1YNNC 1C4AA 1IKMA 4WURA 1V8CA 1BR9A 1Q10A 5C0XJ 5KNBA 2EY5A 4KKTA 3CU7A 4FYDA 2FUG1 3LYYA 5HHDG 1IYVA 1PTOF 3MXGA 4ME5A 5C44B 2LKVA 3SEBA 2J4XA 3ITPA 1OXVA 1JOOA 3KWVA 4CJ0B 4R8NA 1JROA 5C0XI 4YTMB 4FXKC 2D5DA 2WP8J 2K5WA 2A68C 2BDOA 5J22A 3G6JB 4HTHA 2X38A 1ZYRD 5A35A 1MHHE 5JVH3 5D7GA 2JSOA 3P4PB 1BDOA 1TS4A 1K53A 3J81L 1KABA 1BCPD 3HS0C 3VYUA 2L32A 4RA8A 4X3TA 2W3SA 5G5HA 2NYZD 3UI2A 5BMHA 4FO2A 2AUJD 2L11A 3KK7A 5C3WA 1SJED 4XYOA 1GAQB 3ETRA 1SXTA 2HDLA 4XQJA 2F0KA 5M5XB 3MFGA 1QOBA 3AE6B 4D2KA 1EZ6A 4L8JA 2V3PA 2VXWA 1J7BA 1K52A 5CV6A 4RF1A 4QIWB 2V4DA 4OZAA 3SFEB 2BW2A 2A6EC 4P16A 1I4GA 1QT9A 2WDQB 2I07B 2O2LD 2SNSA 3R93A 3C3LA 2L9HA 1PGAA 3I4MB 3EJIA 4FF3A 1YN4A 3L4PA 1E6EB 4XXEA 2WS3B 1U4RA 3L3OC 2XWBB 5IGFA 1E7PB 3ZJUA 1EL0A 2A73B 2FMCA 1FNVA 2VB3X 5EJWA 3ABVB 2XVSA 3A54A 1XTCD 2MJ3A 3TEZA 3NTHA 1FEHA 1WTRA 2ZXPA 3CWIA 4XDCA 3AE2B 2Q8TA 1AZPA 2C9OA 4PMCA 4K8JA 4KGSA 1FNUA 4BA1I 2DBYA 1HEZE 4HRSA 2PVOD 1GUGA 5DNFA 3A7LA 5C2TB 4KKUA 2B76B 1SNDA 3RUZA 4NAMA 3FPUB 5T1GA 1XCQL 3BWUD 3J7AV 1IUEA 4UDUC 4C80A 4XDDA 3MHZA 4G7ZC 2J0TD 2JXTA 1Q90A 2F0MA 4OVZA 1L6VA 1GB4A 2EE1A 4JBWA 4MIUA 1RJTA 1ZPSA 3AE5B 3CIRB 2JYTA 2EKIA 2Q8RE 1IGCA 4C3JG 1H9SA 1B3AA 2K1BA 2WXMA 2N88A 1EWYC 1NR2A 4C3IB 1TS5A 1KTKA 2B2WC 3B2FA 4A93B 4OO1I 4M8AA 3CRLC 3W9CB 1D5XC 5E1FA 3C8YA 2IX3A 2DLBA 1Y69U 1PTOH 4IFDI 2N0SB 1I50B 4K5XA 1LTTD 3TP7A 3FILB 3VR9B 3J80E 2KQ3A 2EYJA 5I9PA 4IOIE 4NJCA 2R3ZA 3E5SA 1LACA 3BK1A 3K59A 3D4DA 1KLGD 3J7AF 3VR6A 4ZKCB 1PUTA 2G9HD 5JEAG 1XCTL 3K57A 2B63B 3TP8A 1I6HB 5IGCA 1GPXA 3U4EG 2EJGC 2EZVA 1AWDA 1HHVA 2EDGA 1CZGA 4HSPA 1KF6B 4AQ7A 1GUTA 1SE4A 3ZQ4A 1JQYD 3GP7A 1WTOA 2NZ1D 5CC4A 3NRZA 4WQMA 4WRDA 1P7FA 3SVMA 3M7NA 4BBRB 3W1SA 3P42A 3GO5A 4GDLB 2K9XA 3QOJA 3HP3A 1WTXA 2AWOA 2G1EA 5HFYA 1WGKA 1W6JA 2QKIC 1ZYRC 1BQQT 2PVGC 1ET9A 1F0ZA 5CV8A 1Q1BA 2M00A 2K04A 2QJLA 3BIID 4JWUC 5D3DA 1JWAD 1NCVA 3Q8FA 1Y8PB 2K01A 3IT4B 2JYEA 1F9SA 2EXZA 2E2HB 5ELDA 1OO9B 4YSYB 4NW2A 5JAVA 1IBXA 1F9QA 1EZ8A 2VZKD 3DWGC 3M85A 3NXWA 1LTRD 1BXTA 3EGRA 2DYMA 4TQUS 5K36G 1F2RI 1I3QB 5EKIA 4K2KA 2B2UA 5IGBA 2W54A 1R4PB 3GV3A 1STEA 3RD4A 2K28A 5M5WB 4IKGA 5FOBB 1QILA 4BS9A 1JC7A 3ZGZA 1L4ZB 2WKCA 1FD6A 1GUNA 1VR9A 2LJIA 1B50A 3VA7A 1DOMA 4IURA 3QOLA 3T56B 3DM1A 2I2YA 1OQQA 2KQ4X 2WDVB 1C8CA 3QB3A 1EYDA 4A90A 5CV7A 2N55A 4G57A 2INPE 1CK1A 3NTIA 3A56A 2RPVA 5C4ZA 2NVQB 4ODGA 4MHEA 4N9TA 5ELBA 2RKSA 3D31A 2EY1A 2IGGA 2JX5A 3NVWA 4KD3A 1T3QA 2JE6I 2Y5PA 1Z47A 1XO3A 3K5MA 5BYRA 4OZBA 5M3FB 4LJZC 5LNK1 1M4VA 2EJFC 1BNZA 4EVOA 1PFDA 4JK1C 1YQ3B 1O7LA 1N5XA 4OIJA 1IHZA 4HKZE 5BMIA 3SDZA 1D2BA 2ICEC 3AEEB 1RHPA 2K22A 4CKEA 2D5GA 2KHSA 4A9AA 3FILA 3I57A 3GB1A 2YEPB 1FCCC 4RHSA 3ERQA 1FO4A 2WXJA 4A3EB 2V0GA 2CQAA 4ZYSA 5IGGA 3NWSA 4J1MA 4ID6A 1HFGA 4LLGM 3D6WA 5C0XH 4A3DB 2DYOA 4LAAA 4B0MA 2WKDA 4RKBA 2H88B 2CJOA 1RTNA 1TY2A 3DWQA 1BUVT 1KNAA 3V3XA 1OXUA 2TMPA 4DN4M 1BF4A 1GUWA 3T16A 2I46A 4KY6A 1EY7A 2K5PA 1JCKB 2LHEA 5I6YA 2QIEB 2WXOA 1EYCA 4HMJA 1SIJA 4KV6A 2LEKA 1F2MA 4FXCA 1RYJA 2PCFB 1A2TA 1R4QB 3DWPA 1WD0A 2MJDA 3BK2A 1SMYC 2ICIA 3K6OA 4XT3B 4QMGA 4K2LA 4KJNA 4BWGB 5M5YB 3OOCA 3MAQA 4DK0A 1II3A 1D1KA 1TJEA 1ZXHA 5EE0A 1HQRD 3J81E 1LABA 3CQZB 2PW9A 2EYOA 2B39A 5D3IB 2H4OA 5JOBA 4IUTA 1ZE3D 3FAHA 1I4XA 1CM9A 2KN4A 4KTAA 4EE2A 3NK9A 2F0JA 5C4XB 2KMMA 2MEKA 1JICA 4A3MB 4K6DA 2WU5B 2ENBA 4YIJA 4H2AA 2OF1A 1PDQA 3MVVA 1CHPD 2F3VA 2RDGA 3PZ8A 4H7BA 2DNCA 4HAEA 3I9V1 2QILA 1VDVA 1O7ZA 2F0FA 1G91A 4HCEA 4L6TB 1N62A 4XDXA 3H8HA 2WIIB 1TS3A 3LWUA 2BCOA 2WV6D 1I4PA 2Y0SB 3IL8A 1RWSA 2W82A 1AZQA 4KKIA 2IL8A 1ICWA 1OXTA 5D65A 5BYSA 3IAYA 1I7HA 1B1ZA 3DEOA 5ELCA 1X32A 1STGA 4QUFA 4K5WA 4L2YA 5JEAJ 1K50A 4MN3A 3H09A 2JSVX 2R6GA 4DGZA 2F0IA 2EYMA 3N9YC 2ON8A 1PFNA 2K05A 5CV4A 5HG2A 2FMMA 4A3KB 5DM63 2KEEA 4J6HA 1H9MA 1SSNA 3Q69A 3SR6A 3OSOA 3Q23A 2B8FA 1LTBD 2WXLA 2YYZA 4JE3B 1EY4A 4TQ0A 2EYHA 2EELA 2F0OA 4DNRB 2PMVA 4R8IA 5BYQA 1FGBD 5IGDA 2SNMA 1BBXC 3KF8A 2YEPF 3MXNA 1BCPB 1JWBD 2HQEA 3CRKC 1G2TA 1G8ZD 1LTGD 4CHTB 1HUNA 2KOLA 1OFFA 2JP1A 1WRIA 2B2VA 1JE4A 5CV5A 3P7JA 2EVBA 5D14A 5G3LD 1BOSA 3OW7A 5CMDA 3D8GA 3HVDA 3R2IA 3RFZB 1EYAA 1PDXA 3CKIB 2V3NA 4PNYA 4RNAA 3HVZA 3AB5A 4O1NA 1Z7TA 3S2HB 1VMCA 4CQNA 3AN1A 1A15A 3N52A 1U4PA 2NBFA 2VB2X 1SFOB 4H13C 4DXGA 3Q6SA 4ZKBB 2MH7A 4BY1B 2MHVA 4F7XA 1QOGA 5HI1A 4L63B 5CR3A 3PIP3 1FIQA 1MHXA 5FO7B 1FR3A 4KGRA 1PRTF 2CW0D 2J53A 3V05A 3I4LA 3ZYYX 2BE5C 1VCIA 4X3SA 3DWAA 3BVMA 2X6LA 1STNA 2KDMA 5AUKA 2AQ3B 2CVRA 2WXNA 1PZJD 1IGDA 3Q8BA 2XRSD 1SNOA 1PLFA 1UWXA 1EM7A 1HTPA 4XQQA 1FYCA 4YXDB 1B2TA 2PPBC 2ZXRA 1D5ZC 1DD2A 4A3JB 2DY8A 1QB5D 1V1PB 3MTSA 5K5PA 4K5VA 3JAME 1WCMB 3TDQA 4F8MA 3HRDD 1C4PA 4FF1A 2B8GA 4C1NK 2R93B 1ML0D 2E2IB 1QNUA 4OL7A 3SR1A 2IGHA 4H44C 3DEPA 2JZPA 2KA7A 2N7JA 5LHY1 1X3PA 4FF4A 1U4MA 3AEFB 2BDNA 1TQOA 1D4BA 5A2QE 2J52A 5IIFA 1S5CD 2HDEA 4Z9CB 1IW7C 2MJ8A 3IAM1 1PZID 1DCZA 2NN6G 3RZDB 5G5GA 2F0SA 4ARIA 3Q8AA 1L0VB 3LB8C 1IYUA 1L0YB 1LV9A 1JALA 3AMUA 5E4XA 4FVMA 2JEBI 1DZ1A 3PUVA 3P75A 1ESFA 4RF0A 1JQ4A 1HUMA 5C3XA 1PFMA 3W3AA 2A69C 5KRUA 4NAWB 1XYIA 1ET6A 1U9RA 4G4KA 1SYBA 2WXPA 3URYA 1SYFA 5C6AA 4MM3B 3KLSA 1R7SA 3FPPA 3PZ7A 1B53A 2E3TA 1B44D 2W55A 4V0BA 1Q8IA 3T53B 1SEBD 3S16B 1BCPF 2E6XA 2A68D 1NAPA 1CJEA 2WNMA 3H0GB 4C56C 3IXSA 2K0PA 3BDOA 4PV1C 1LLRD 5CYUA 4TQ1A 1T5XD 4F88A 3E6ZX 3OWFA 2IWHA 5CGKA 1SAPA 2Z4HA 3MA2B 2LFIA 4TMAB 1JWMD 2WLBA 5FO8B 5ELEA 1SNPA 4CKCA 5CBAE 3KLRA 1NYQA 2M56B 1MSGA 1ACCA 5AUIA 3VR3A 3VYRA 2R92B 3P4RB 3OIPA 4QB4A 5ELFA 5MPOA 3SHLA 2QEJC 1RTOA 2Z8LA 1OQRA 1DM0B 2VNUD 1QOHA 4KMUC 1MVKA 1C4CA 1A2UA 3X3NA 2OEOA 1PRTC 2LMCB 3GTQB 2RA4A 3D4RA 1AFPA 3AE7B 1MI2A 4C3JB 3IKJA 1F2RC 3AEGB 1CA5A 3S15B 2J42A 1CTMA 1S5ED 1XLQA 5JEAH 1HRJA 4KI0A 5F2DA 1LTID 3V96A 4HEA1 1GUSA 1YJIA 2HCCA 2IGDA 4KN4C 3NWTA 3HOWB 4L1BA 1C79A 2JA8B 1A3UA 1SYCA 4KN7C 3E0JA 4XQNA 4PQXA 1QCBD 2WB1B 2KUMA 4IUVA 4WFN3 2NTSA 2B2UC 1VZ8A 2CW0C 4KY7A 2E76C 5TSSA 4YT0B 1UNSA 3RZOB 4NP5A 5CBEE 1F2LA 4ZQ3A 5M9OA 5DEHA 1N61A 4HR7B 1CQFA 2SOBA 1PZKD 1PRTB 1U4LA 2MPMA 1GB1A 3PO0A 4CBVA 1D1IA 2ZW0A 2PTLA 4DA2A 2WXIA 4XTCS 2EYPA 5C4JB 1J7CA 3CHBD 3LNNA 2JQRB 3BDLA 4RGNA 2HTME 3GQBA 2LMCA 5COYA 3OIQA 1Y1WB 1PMRA 4FP5D 5KGUA 1PFBA 4US8A 2JU6X 4GDKB 4DXFA 1C4QA 3PUWA 2LS01 2PYKA 2PKOA 1HA6A 4RAUC 4C3HG 2JA6B 2IT1A 5IGEA 4MH8A 4S3SA 4OGQC 1ROEA 3MJ5A 5FR3A 1TWAB 3S14B 2DNEA 2IW3A 4OO1H 2WXGA 4O42A 5JXVA 5EKLA 4B08A 1C76A 3BYYB 1VF5C 3P1MA 4YSZB 1F9PA 4WJWA 3OMGA 2BA1A 3C46A 2E75C 1FXAA 1BCPC 1L6UA 4M1UB 1CI3M 3TN2A 3EFXD 1E0BA 4RFBA 3TMEA 3DWMA 4JWSC 2F4IA 2L0CA 5KNCA 1LO5D 2K7VA 2DY7A 3S1MB 3WCQA 3NVZA 1FNWA 1SMYD 1E9MA 1XLNA 4ZRPA 1TWHB 4CKBA 4USAA 4A55A 2AQ2B 3A7AB 3HEJA 4HMIA 1HPCA 2QCPX 3C1FA 3GTKB 2B2TA 2X69A 3NUCA 5IT9E 1QG7A 2EYFA 1TZOA 2BOSA 3KUPA 2PZWA 5LL6X 3A8IE 3NE5B 3SE0A 1UEAB 2KCCA 5C4HA 2BBCA 2XIWA 5G3LF 4EQOA 3OPOA 4U673 1I6VC 1LT4D 4DFAA 4XT1B 3I8ZA 4QUCA 5HGTA 5EPJA 2M19A 1TKGA 4XE0A 2B2TC 2FJ2A 4HJGE 5I2YA 4Q2JA 1Z6HA 5J39A 4R9WA 4AS1A 2H89B 2L1BA 2TSSA 2F0GA 3QO2A 1BUIC 2JA5B 4HCSA 3EROA 1QF6A 2A6HC 2J7ZA 4QF4A 1CFMA 4OZCA 1Y56A 4ZLTF 3WOEA 1I4QA 1YQ4B 2K5DA 3A8KE 2CJNA 3PUZA 5I2XA 1ONLA 5T8IA 1IBXB 4PMWA 3HOVB 2SEBD 4RCOA 3TZUA 4CJ2C 3I70A 1DOYA 2BE5D 2MGSA 2WAQB 4IZ8A 3X3MA 1OXSC 2OEDA 4HN7A 3VYTA 3MWYW 1B9NA 2K03A 3SFDB 1P7EA 3TEXA 3AV8A 1NENB 2PNRC 2N9LA 2A5HA 2ZW1A 3E56A 3OMCA 1AYFA 1ZOYB 4IALA 1GXDC 1H9JA 1EY9A 2L83A 3GV6A 1X3QA 4RGTA 4CGYB 3VR5A 5KNDA 3Q8EA 1AEXA 3MP9A 5EPLA 1XXGA 4KGTA 3D6CA 1STYA 5EGTA 1EWHA 2PO4A 4KKJA 1FCLA 3U2SC 2F0LA 2BT6A 1A70A 2ID0A 1KH0A 3GS2A 1UUPA 3T4AC 4JPSA 3K5LA 5AFWA 1C77A 2N9KA 1QWYA 3P63A 4R3DA 3TSSA 5EQ0A 1NSNS 1FXIA 4OO1G 3FKIB 2W3RA 1MPEA 1Q3LA 1SYEA 2ONQA 2MJEA 4TRDA 1DOIA 4HEDA 1D5MC 4FXGC 2LFNA 3IFDA 2K5QA 1FRDA 4DNTB 1HXYD 2OT2A 3R3OA 4NKLA 3EUB2 2M9VA 1GUOA 1R9TB 4YTPB 1ZXTA 1LT6D 4IUUA 3D4WA 4I65A 2GI9A 2Z1CA 3TEYA 1QOFA 3UI3A 4ULLA 3NPPA 1YNTE 1TVXA 2WP9B 1WSPA 3HOYB 2L5TA 5IODA 1YNJC 5EBDA 1WTQA 3K5NA 5BMGA 1DOKA 2CU3A 2KACA 3NSWA 5E3FA 2K32A 4KHVA 3RMHA 2R61A 1F2ZA 2SDFA 4ZRZA 1EU4A 5FO9B 1E2VA 1EEFD 2WU2B 4BA2I 3AMZA 3IFTA 5T1IA 1EQTA 1MSHA 1YN5A 2F03A 5EPKA 3TP5A 2H1EA 1FFVA 3T51B 2L55A 2EJMA 3FMCA 2MUYA 4K8IA 3I90A 2A74C 3SK6A 4DAVA 4H0LC 1A3TA 1STHA 1CHQD 5EKKA 4L23A 3ZJTA 5IOCA 1S5BD 1XLPA 1JWUD 1SJHD 5BN3A 2F3WA 1Y8OB 1GHKA 3QG1A 3AU7A 3GTOB 1JRPA 1V97A 4KKSA 1KFYB 1XX8A 3TZDA 2FINB 5H8YE 2AWNA 1KNEA 1N60A 2BTEA 1CT1D 4WH4A 5I4DA 3P1HA 2L52A 2MP1A 3HGBA 3HOZB 1YN3A 2WXFA 2EYLA 3NQIA 5LL6S 3KBGA 1PRTD 4ZRQA 1TIID 2Y3AA 4NMZA 2F0VA 4V190 4FNFA 2AQ1B 1DYQA 1SE3A 1E2WA 1VDZA 3L7ZC 3SK5A 3K7AB 2EPBA 1EEID 1B9MA 1CZWA 1V43A 3LX0A 2FFKB 1EY8A 3I72A 3JAML 1WTPA 2JXMB 1F9RA 3K5OA 3AECB 3R2TA 1EY0A 2JA7B 4ITKA 1D6EC 2QMTA 1M8AA 4B9WA 2XSCA 3VR4A 2XN9C 5ISRA 1SB3C 3SK4A 4DU9A 1AP0A 3FDTA 2BS2B 3H91A 2KJXA 3S2DB 1HQMC 2L12A 1EQVA 2NVTB 3ND9A 3V2TA 3HKZB 4ILWA 1ZKOA 1XLOA 3H6MA 5IT9L 1WTWA 3IAS1 4N59A 3EQLC 4J8QA 1SF0A 1NR4A 1DGJA 1FD7D 3NVYA 3TEWA 3T13A 1GOZA 4WAFA 2PQEA 4DK1A 4IFDG 2V4IB 4YWGG 3PO2B 1MGSA 3AE8B 4N9PA 4JX1C 1EWCA 4RGOS 3ZJVA 3S1RB 5NUCA 2HUGA 2EY2A 4A3GB 5KYIA 4GZYC 1VJKA 4RGMA 2RMMA 1VZ6A 4K6LA 1G291 3O13A 1UGJA 3VR8B 2BYTA 1ZEQX 4IFDJ 2C5CA 4IQZA 1B9RA 1SBBB 5GXGB 3RLFA 4RCNA 1CQVA 2LUMA 1EIGA 2PLPA 3KWLA 1V1OA 4ZHOA 4A3IB 1STAA 1EY5A 1YMHE 1ENAA 4BY7B 1V1PA 1J7AA 3MHBA 2KCNA 4P6VF 4A3FB 5C5MA 3U7ZA 3IT6B 4A3BB 1JB3A 3I3CA 4C3IG 4KHZA 3RPFC 5JVG3 2EOTA 2O5JC 3NBHA 1TKYA 4DAPA 2KWDA 1FFUA 4MT5A 4K14A 2BS3B 3FC4A 5E6JA 2NVXB 1PGBA 1KDCA 3M3YB 2VUMB 4B0EA 2NWGA 1RKNA 3S1QB 3KQ4A 2DN8A 4DAYA 4M0WA 3DHQA 1KLUD 4UAIA 1ENCA 1N5WA 1WD1A 2WQYB 4C7ZA 3BS1A 3M4OB 4Q0FA 3BG3A 1E0ZA 2KVMA 2O5IC 3NP8A 1TWCB 2NN6H 3WDNA 3S9WA 1TR5A 2CHBD 1EIHA 1BMLC 3FEWX 4ABNA 4A8XC 3VQIA 1FMAD 1E10A 1DJRD 4F87A 4I7ZC 2XWJB 1C48A 3W2DA 1RF2D 1HZ6A 1VLBA 3MC0B 1NEKB 1Y8NB 1HZ5A 4N58A 1EFID 2Y5CA 2RSNA 1JMLA 4YSXB 3AE3B 1WXQA 3BZDB 2NTTA 2F0TA 3GTPB 4LMQD 1FM0D 4NZLB 1HCZA 3R8BA 5JJZA 3AE1B 2XNAC 3OWEB 1NVID 1SSOA 4ZAIA 1SNCA 1RCVD 2QDBA 2GA4B 1LT3D 1S4ZA 3NUHB 3PMFA 4FXDA 3HOUB 3AM9A 1RM6C 4EQNA 1L5PA 1JOKA 1FRRA 2BB5A 2LHDA 5BN5A 5FLXE 1ZDVA 2XRQD 2KAJA 5E4WC 2HDMA 1G2SA 2F0UA 1LTAD 1KAAA 1SYGA 5C5LA 3DXJC 1ZUD2 2E2JB 3AE9B 1QKZA 1RDPD 1E2ZA 2B2YA 4OHJA 2Z4IA 1C78A 4GLSC 2B2VC 2KECA 3K0YA 4IUQA 2GB1A 3EA6A 3VR2A 4C1NI 4A6QA 1VF7A 3PUXA 1F77A 5M3MB 4LK1C 5BN4A 3U52E 1UWMA 2RSOA 2X6GA 2A6HD 4RKLA 4IFDH 3BYTB 2HCIA 2F0WA 1A3VA 3C1EA 3MXPA 1ZXIA 1H9KA 2SAKA 2F0DA 1STBA 2K33A 4DQOC 3H3VC 2WXRA 4MACA 2F0HA 2WDRB 5C3JB 2PZTA 1PTOC 3I91A 3KLSX 3WOFA 1WYGA 2Q5WD 3ND8A 4BBSB 4XWWA 1NI3A 5I6WA 3L9AX 3NZ3A 1N63A 1XF5L 3F2UA 1V8QA 1L0XB 1VZ7A 4G7OC 1Q1EA 2IPKD 2L1AA 1SDFA 2M0AA 1NYRA 2IJ0A 3DMUA 5FLXL 4ARCA 2F1MA 2LGIA 2ZT9C 1UAPA 4IUNA 4ZUIA 1HA5A 1PGXA 3AB9A 1JR0D 4LTUA 1K51A 2F0QA 2ZXOA 1JORA 3VRAB 1MI0A 1HTLD 1WWTA 3T3OA 3W5VB 2RVLA 3MFYA 1H9SB 3AEBB 3TP6A 1ILQA 5H92C 1DOLA 1VRAB 5KEEA 4IN3A 4PMBA 5A2QL 2G9DA 3I4NB 5J1ZA 3DUZA 4HSVA 3P4QB 1ILPA 2B2WA 3VRBB 3T3NA 1GJXA 2M2LA 1I4RA 4Y7NB 2JYOA 2WACA 1MBYA 5HURA 4FF2A 3EVQA 3PUYA 1L4DB 2PZUA 3AE4B 4RHRA 2F0NA 3Q22A 4ZOHC 1PYWD 1IW7D 1J9OA 5FK9C 1RFKA 2OHFA 1QE6A 1XWEA 1W6KA 3N6RA 1JOQA 2PIAA 1PXUA 1T5EA 2L4NA 4US9A 3NHHA 4OIKA 1SNQA 3HG9A 1VMPA 2RBMA 2YU9B 1S5DD 4ZHPA 3E9SA 3J80L 2EY6A 3U9SA 3LWEA 4LK0M 2OXPA 3NQTA 2BS4B 1SYDA 1K83B 2JEAI 1QQRA 4KX6B 2D62A 1WVLA 2GRIA 3OHXC 2IDYA 1I4HA 3MXUA 3SXHA 4P2CB 4KY5A 3MZ5A 5EBCA 2DWQA 3HZXA 5CORA 3AEAB 3A55A 3AH7A 1ENFA 1O78A 2KEDA 4XIGS 3FRPB 1JW9D 3QJYA 2D2CC 1QLBB 4XWTA 3AEDB 1CZPA 5EE1A 4WIPA 2D9UA 5DAUA 4J3OD 1BO0A 3G7LA 1LT5D 2NN6I 3J9CA 3H94A 5KYLA 5FKAC 2IX1A 5DM73 4ZUJA 5I9OA 3B9JA 1SE2A 1PTOB 2E2DC 1Q12A 5K36H 3HUIA 1IL8A 1TT2A 2JWUA 3NVVA 3W5UB 4XYQA 2R7ZB 4IDIA 3QWNA 1LTSD 2F0EA 4C3HB 2LY7A 1H9RA 1T6BX 3BDCA 4DF7A 3NTKA 3GTGB 2WXKA 4ZK9B 3NS1A 2K6AA 3TBIB 1WTVA 4U68A 2RDFA 3KBXA 1TY0A 1MD2D 3PV0A 4REZA 3BVZA 1Y1VB 1IKLA 1EU3A 4RWSC 1G6ZA 4E6IA 4EGVA 3PIO3 3VA5A 1QOAA 3M7GA 3VYSA 1ZP0B 1ESRA 1TKWB 2WXQA 4KD4A 3ONAB 3Q0AA 3Q8CA 4HROA 1C9FA 1B4OA 2FHTA 3I73A 1YNND 1A6XA 1YJJA