2XNAC

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
215
structure length
215
Chain Sequence
EDLHDKSELTDLALANAYGQYNHPFIKENIKSDEISGEKDLIFRNQGDSGNDLRVKFATADLAQKFKNKNVDIYGASFYYKCEKISENISECLYGGTTLNSEKLAQERVIGANVWVDGIQKETELIRTNKKNVTLQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
total genus 72
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xnaC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2xnaC01
1PZKD 2SEBD 1SXTA 4RHSA 5ELFA 3DWQA 1SBBB 3BZDB 1HQRD 4O1NA 1YN3A 1KLUD 1BCPB 1CHQD 1JQYD 1RF2D 1GOZA 1HTLD 1V1PB 1PRTC 4RFBA 1EFID 1YN5A 1EU3A 5I4DA 2Z8LA 1BCPD 3GP7A 1I4PA 1LTSD 1FNWA 1JCKB 1M4VA 1QILA 4DXGA 1FNUA 2ICIA 2QEJC 1KTKA 5D3DA 1LTAD 4NZLB 4RHRA 3KLSX 1PYWD 2G9HD 1JR0D 4RGMA 4L6TB 5ELBA 1S5CD 1LTID 3R2TA 1S5FD 1V1PA 4BWGB 3OWEB 1XTCD 1S5BD 1LTRD 1JWSD 3MC0B 1PTOH 1PTOC 1MD2D 1SE3A 3SEBA 1YN4A 2J4XA 1D5MC 5FK9C 1TS4A 1DYQA 1PRTD 1PZJD 2AQ2B 4RH6A 1EEID 1D5ZC 1SJHD 1CHPD 1CK1A 1I4QA 2IJ0A 1UUPA 1B44D 3W2DA 1LT6D 1FD7D 1RCVD 4RGTA 1LTBD 1LTTD 1CT1D 4C56C 1PTOB 1FNVA 2XN9C 2O2LD 1L0YB 4TSSA 1SJED 5FKAC 1AW7A 1SE2A 2CHBD 3TSSA 4UDUC 3BVGA 1I4GA 1SE4A 1RD9D 2TSSA 3BYTB 1PRTF 1JWUD 1BCPF 1DJRD 2XRSD 1TY2A 3EFXD 5ELCA 4DXFA 1EWCA 5ELEA 4RGOS 4ZYSA 1BCPC 5TSSA 1I4HA 2RDHA 3V05A 1D5XC 3BYYB 1F77A 2R61A 1AN8A 3BVZA 4OHJA 1S5DD 1LT5D 1TY0A 1LT3D 1ENFA 1JWMD 1CQVA 1I4XA 1V1OA 1B1ZA 2QILA 3EA6A 4Z9CB 1ET6A 2NTSA 1BXTA 1FGBD 1EU4A 1S5ED 1STEA 1PTOF 3DWAA 1KLGD 1L0XB 1T5XD 4L63B 3R8BA 2WV6D 2AQ1B 1EEFD 1LTGD 3DWPA 1PRTB 3URYA 1UNSA 2AQ3B 1PTOD 1SEBD 1TS5A 1TS3A 1HA5A 1XXGA 2XNAC 3O13A 2RDGA 4K6LA 3BVMA 4RCOA 1G8ZD 1HXYD 3CHBD 3MFGA 1ESFA 2NTTA 1PZID 1ET9A 5D3IB 1I4RA 1LT4D 2IPKD 2XRQD 3R2IA 1LLRD 1LO5D 1TS2A 1D6EC 4RGNA 1RDPD 5ELDA
chains in the Genus database with same CATH superfamily
3NBHA 1EOVA 4K5VA 3AE6B 2K5WA 2Q2HA 4A3IH 2K39A 1SXTA 1VD2A 1S4ZA 2CW0C 4IJHA 2JA8H 1NY4A 4XDXA 2JA6G 3PZDA 1PH3A 2RBMA 3SK6A 3TEHB 3VFKA 2O6VB 3T9LA 5CMDA 3K7AB 3GTGB 2A19A 4J3OD 2NZ1D 3UDIA 2KECA 5IT9c 4DR5L 3L54A 1NCVA 4C3HG 1WFYA 2IGGA 3Q3JA 1QILA 3HP3A 4DXGA 2ZVNA 2EIFA 3J80E 2K03A 2ICIA 2M8SA 3JSVB 3ZKJC 4AJWA 1ILQA 3K5OA 3Q22A 3FKIG 4LNQA 2CJOA 2BDOA 4KSLC 4CDDC 4L6TB 2G5DA 1QUQA 4EE2A 1STGA 2DNEA 2UUAQ 3A8JE 1LTLA 1ZDXA 4IDIA 4BKSD 2ACZB 3OWEB 1E3PA 4LF5Q 1X32A 4IQZA 4P7IA 3SHQA 4C4VB 2DLBA 3L3OC 1PTOC 3PIOA 4DDGD 1YN4A 1NMGA 1PFSA 4IUNA 4GOPA 5IOIA 2XSCA 4UP7A 1O7LA 2Z6KC 2PMZB 2XWJB 2UXDQ 2F0GA 1YX5B 1FCLA 1JRUA 4OWXB 4WWMA 4IUMB 4DUYQ 1EY5A 3K0XA 2KMAA 1VQIA 1QUQB 3G71A 5HGQA 4WWNA 4X65Q 1PXUA 1VF5C 5FKAC 2L0FA 2CHBD 3K7AH 1HCZA 1XMOL 3GTGH 1WGRA 4HJ9A 1WH3A 2J7QB 3T3NA 5CORA 4H13C 3AE3B 3ZW3A 4HKQA 1LQBA 2DJGC 2LHDA 3CRLC 2SDFA 2KOLA 2EDGA 4YTPB 2E2HH 4KY5A 4C7ZA 2VH2A 3NBHB 4F7XA 5BN4A 5TSSA 4IFDI 1YJJA 5KNBA 1WE7A 1ZKHA 2C7HA 1BQQT 4ZUJA 1J5EQ 1GC7A 1IXRA 3CPFA 5M5YB 5HG2A 1B3QA 4R4TA 1N63A 5C0XH 3TP7A 1UZXB 3CSFA 2PE6B 2KN4A 4PMCA 3VUYA 4LK1C 4XZ4A 2KQSA 1DZ1A 4F8CB 4M00A 3OSOA 1ASZA 1N34L 3SHLA 3I4NH 2KK8A 3NVVA 2D07B 2BDNA 1STEA 4KGTA 2D9UA 4EQNA 4PT5A 3GE8C 2WV6D 3DVGX 4NB3A 1EEFD 3CPWA 1BNZA 5IP7H 4WIPA 1AE3A 3P75A 2AQ3B 1TT5B 3PV1A 5G3LF 1K8AC 5C2TB 2Z0DB 4DK0A 2XBBC 3EQLC 3H6NA 3LGJA 3P7JA 3H15A 4R1JA 5JXVA 1SNMA 2KDFB 2E2HB 1ET9A 1TVXA 3PO2B 3H7PB 2IW3A 1VQEA 4KY7A 2Z1CA 1NYRA 5FR6A 2KJRA 2L7RA 4RF1A 5NUCA 5IGBA 2CWPA 2V3SA 4KD4A 4DN4M 1XNRL 4G0NB 4ZRPA 3E9HA 5G3LD 4C2MB 2A6HC 1R9TH 1E8YA 1R4NI 1EY6A 1WJNA 2INCC 2A1AA 4EZLA 3L16A 4G7OC 4KDLB 5G5GA 3KH0A 3S2DH 3U4VA 2Q8IB 4N8X1 1E7VA 4OZAA 2GI9A 4BY7G 1EU3A 2D10A 3QJZA 1E0BA 1VDZA 5E6JA 3ZXRA 3R7RA 1LFDA 1PH4A 4HIDA 5DNFA 1IUEA 3S1RB 3DBHB 5C44H 1O78A 3KJPA 3PO0A 2KEEA 5IT9L 1HNWQ 2JN4A 2L0TA 1SR3A 3TBLD 2WQYB 2MEKA 5C0XJ 2MHJA 4C3HH 2E76C 1J7AA 3HFZB 1LUZA 2LVPA 4LFAL 1H9SB 4BBRH 1GAQB 2J4XA 3J7AV 1TTNA 3U4EG 3RD4A 3W5UB 3UQAA 2WYQA 3HOVG 4DV6L 2ZW0A 4DV7L 3D6WA 4MTNA 1VDVA 2BYTA 2K8BA 1CHPD 2VB3X 3A9JA 1EZ6A 4R4CA 3S14H 2VQFQ 4XWWA 2RHSB 4YT0B 4KTAA 2B8FA 4K0KL 3ERSX 2A6HD 3I3TB 1MBYA 2XN9C 1N61A 3TZDA 5FLXE 4AH6A 4MNOA 5IO9A 2QKIC 1RIPA 1WWTA 2D0OA 4JX1C 1Q8IA 4EEWA 2RGFA 3MXNA 1GHKA 1FRRA 2RKSA 2NVXH 2KQ7A 2W9NA 1YHAA 2LY7A 2B29A 3DQVA 2C9WB 2X6GA 4QIWB 1EY0A 4XYOA 4JPSA 5IOCA 3K57A 1S1QB 1II3A 1UAPA 1IPGA 2J7ZA 4ABNA 3L4PA 1PLFA 1S3SG 4HJGE 1C76A 2PEAA 1GUGA 4BA2I 2L4NA 1L6VA 3DHIC 1FJGQ 3PSIA 3WCQA 1EYGA 3C1FA 2KC1A 1LT5D 1STAA 1V9PA 1TY0A 1PVOA 2JK8A 1I4XA 4FYDA 1HEZE 1CKOA 4ZDVA 3U9SA 2JYEA 3NENA 1J5EL 2E5LL 3ZTCA 2PYKA 1KQSA 1D1IA 1EUVB 2WB1G 1KAWA 4P1BC 1V49A 4RNAA 2L32A 2B2VC 3K5LA 1OXSC 5AZFA 2AEHA 2F4VQ 2IZVB 4B3SL 2ON8A 3VR2A 5LL6X 3KDFA 3F2BA 1H9JA 4LF4L 3A9KA 2QCPX 2INNE 3BDCA 1ESFA 3AB9A 5D3IB 4J6HA 3MXNB 3HOUH 4DHZB 4EFOA 2L1BA 1KM7A 3PIPA 3H91A 3R2IA 1RHPA 1UEBA 4N9PA 3T1HQ 1SIJA 3N20C 3P4QB 4IM0A 2B3GA 3CQZB 4YTNB 4K7SA 4DHZE 3TP8A 2LVQA 1YMHE 4KZ0A 4US8A 1DOXA 1QZEA 2VQEL 1PH6A 3AU4A 2EYJA 4MT5A 4GLXA 2HUGA 3GTOB 2LUEA 5BYQA 2MJ3A 4GXBA 2EYMA 3DWQA 4P73A 1HQRD 3VYTA 4B3ML 2WS3B 3VAWA 1EUJA 1JQYD 1IKMA 2PLPA 1HQMC 1HZ5A 2J42A 2CWAA 5FO8B 1M1KC 3UF8A 1ISNA 4PYZA 4JV5Q 3U52E 1JE4A 3VTVA 1FGUA 4D2KA 1LTSD 2LGSA 1HZCA 2E75C 1ZOYB 3M3JA 2KACA 4GKJQ 5I2YA 1TWCB 3V6EB 2QF7A 3VVWB 1WD1A 4WJNA 5IA7A 3BJUA 2IL8A 2GBJA 3A5ZB 3M7GA 2XEWA 3KYHC 1YITA 4K2KA 5C4XG 1P16A 1X6OA 2Y5PA 4MM3B 3MA2B 5JVG3 3IHPC 2BF8B 4HCPB 2M0XA 2YEPF 4B0EA 1DM0B 2K33A 1B3AA 1Q7YC 2JA5G 1HZ6A 4X3SA 3HOXH 3RFZB 4U673 2FFKB 2C35B 3TMPB 5M3MG 1CK1A 4MZ9A 3NUCA 2VZKB 2NVTB 2PJHA 4KGRA 2VNUD 3GTMH 4WJ3M 1LTBD 3NWSA 3KDFB 1L1OA 3BS1A 4B3TQ 1WGDA 2KO3A 1Y14B 2EELA 1X3QA 2N9PC 2Y3AA 4DR7L 2KOXA 1Q82C 2ZCBA 5DM73 2JXXA 3DVGY 4DV2Q 4M0WB 1KNEA 4IC7B 3ALBA 4KV6A 2EMSA 2HQLA 2W54A 3SVMA 2RPVA 1WTHA 4IPGA 4C00A 2MQHA 1I4HA 4R3DA 1WXVA 4DAPA 4KKJA 1VQMA 2KANA 4GGQA 4HMJA 2NPTB 4CDFC 3QQ8B 4DGZA 4JYAL 1U4PA 2WB1E 5M5WB 4OELB 2Q2UA 3S1QH 1WR1A 1WTQA 3L13A 4W9HA 4RM9A 3KYCD 3M7NA 4L2YA 1DD2A 1E2WA 2QILA 1V1OA 3J81i 3RZDB 1C77A 4ME5A 1VQDA 4S0RA 2L8JA 3C1EA 1JALA 1XO3A 4HKZE 4G11A 1FGBD 3KWVA 4O2DA 3TEWA 3QIJA 3HOWG 2H5XA 3JVZX 1T5XD 4IOCA 2L1AA 3FKIB 1EOTA 1JOOA 3E0EA 2N0SB 5E7NA 3S1NH 5M5XB 3DLLA 2J0TD 3FAHA 3RNUA 3J81c 2KTFA 4JI3Q 2HE7A 4JI7Q 1YZ6A 1GJXA 2GBKA 4IUQA 2ZJDA 3GTKH 3QX1A 4RF0A 3GO5A 4YWMA 3IAYA 3E3XA 5C3EG 2B2YA 2R7ZG 4X62Q 1D6EC 1T9HA 1WI5A 4DR2L 3SFDB 1XEEA 3N1XC 4B3SQ 2C7NB 4KLKA 2FJ2A 1Y8PB 1CA5A 4LF9Q 2JRIB 4II2B 1PH5A 4AIMA 3NVYA 4BBNC 1F2ZA 1ZDVA 2LJIA 2MRPA 3H6MA 3ITPA 4RAUC 4CBVA 3MAQA 4HRSA 1XT9B 3JAMc 1WTXA 2KVRA 2A69C 4RG1A 4ANVA 1TWHB 5JHAA 4L5TA 5HGTA 1IGDA 4FN2A 1BCPD 3I3CA 2X8XX 3I72A 2ZW1A 4EUTA 1KF6B 1EL0A 2L83A 2MO1A 1E8XA 1M4VA 3CP0A 1D7QA 3CF6E 4ODGA 4DK1A 4DR3Q 4JE3B 3FKIH 5DAUA 4JBJA 1KTKA 1WGYA 4BA1I 4XC2A 3GOEA 5CHFA 1F9RA 1G51A 2A73B 2G9DA 1EWHA 4OWWB 1KRTA 2VZKD 1XF5L 1UE7A 1Z5SB 1NTGA 3UQBA 5C44B 2OTLA 2EMTA 4JL9A 5BO4B 2GMIC 3J80L 1OO9B 1Y8NB 1VZ6A 1SE9A 4EKUA 5BR8L 2LD9A 1BBUA 2JA5B 2LRWA 1F2YA 2SNSA 3UDXA 2BYVE 2AQ2B 2K4KA 2DUDA 5K5PA 3L08A 1N62A 1D5ZC 1B2TA 1A2TA 1FYCA 1I4QA 2XK5A 3HKZB 3Q24A 4KKIA 3P4PB 4MN3A 4ZRJA 1DOYA 5K36H 1HUNA 1JQ4A 1WGHA 4I7ZC 4QIWE 3MEFA 5IIFA 2HDLA 4LAAA 1NEKB 4PNYA 5J39A 2KMCA 4K1RB 1HPCA 5IAAC 4PMBA 4PZ7A 2JA7B 4A3KB 4K8IA 1CZWA 2L55A 1Q8KA 1QQRA 3BDOA 4B3RL 3KUPA 5EE0A 5DEHA 2IY5B 2NVTH 4DAYA 1WZ3A 2FE8A 4DV1Q 1KJTA 2WU2B 4RGOS 1KABA 5CV8A 2F0KA 4F7ZA 3S1MB 2B8GA 4OL7A 4LUVA 2IGHA 4CDCC 5E6NA 1O80A 4LJPB 2R2QA 5CV7A 2WXOA 2B3AA 1A62A 2RDBC 3BVZA 2KTRA 2KLCA 4URKA 4A3KG 1N5XA 3A9KB 4EOYA 3T8MA 2L5TA 3F2UA 1A2UA 2CVRA 3DBLI 1XMOQ 3DWMA 3DCGA 3HRDD 1WCMH 5HY6A 3PLUA 3M95A 3OMGA 2GB1A 3KF6B 3KW5B 1BKBA 2JX5A 1EU4A 2K5NA 3MTSA 1KH0A 3PCOB 4ICVA 1XWEA 3HKZG 4RKLA 4DV3Q 4HAEA 1JMLA 1VQ6A 3J7A5 4AS1A 3M4PA 3U50C 4IUVA 2A68C 3VR5A 5C4ZA 2J52A 4C80A 4TUUA 2EJGC 2GVBA 1EQQA 3D4WA 3SDLC 4LNIA 4MELA 1FXIA 3BVMA 3OW7A 2OCEA 3EHVA 2KEDA 2WGSA 3TZUA 2ZPYA 2SOBA 4JPBW 4LF5L 2B39A 2J0MA 3V60A 1K83B 2DYMA 2K5PA 1E10A 1KOTA 4KI0A 1YHBA 1LT4D 2RA4A 1Y1VG 1ZGUB 3NS8A 2NBFA 1J7CA 1WFQA 5LMNL 2NN6H 1XMQL 2EYPA 4HWIB 2BBCA 3DHQA 5JZEB 1SSNA 3PGEA 5GAGC 1VQ9A 3PUYA 2MCNB 4DKAC 3F8TA 2Z0SA 1B53A 3BZDB 3PRZA 1PHJA 2GLSA 1KLUD 2HDEA 4JI5Q 5HFYA 3C3LA 5DCNA 1L6UA 1HRJA 2W55A 2FBWB 3MEHA 4JI6L 1WY8A 3PMFA 1IKLA 1BBXC 3AEDB 3WAPA 3UE1A 1VMCA 2E5LQ 1TBEA 2JSVX 4FHJA 3U58A 5IYDH 2VRRB 1ZE3D 1RL2A 2UXCQ 1VCIA 1GUWA 4WQOB 1MGSA 3I70A 2KMMA 4KV2A 2ICEC 4RGMA 2JSOA 3TS2A 4OWTB 4PK1A 5LLIA 1PQSA 1V1PA 2K0PA 5CGKA 4LF9L 4XDCA 1K83H 3IG3A 1PGBA 1N8RC 3U7DA 3W1GA 2LFNA 2PQAA 3MTNB 3NVZA 1IBKL 3AE5B 3X3MA 3J81L 4LNKA 4YWKA 2KQ3A 3NPPA 1L4ZB 2OJRA 1BR9A 3AFPA 2N4FA 2JQRB 1GUTA 4PZ8A 4LNOA 4XTCS 3ONSA 2I2YA 2YU9B 1NUCA 1U5KA 3HOWB 2IJ0A 1E7UA 4JWUC 1K8MA 4AQYL 3ZNZB 2F0DA 1VQAA 3AE8B 1P98A 3X0WA 5AEKB 4J15A 2DGYA 3F2DA 4BY7H 2NVQH 3ML9A 1SE2A 2N1WA 1T3QA 1DCZA 5C3EH 3Q69A 5HURA 4DK3C 2FNJB 2DN8A 3KUDB 4KJNA 4AOFA 1F2MA 1JROA 1OEYJ 1TGZB 4WQMA 3P63A 3RN9C 2KDEB 3JAML 1ICWA 3RNBC 4ARIA 4X64Q 3QG1A 3QA8A 2BWFA 1Q90A 2ZXOA 5DM63 2BCOA 1BMLC 2WXPA 1ENAA 2WFWA 3KJOA 3QIAA 1D5XC 2W3SA 3G6EA 1L1OB 2YYZA 1MHHE 2VQEQ 2KKCA 3BYYB 3VUWA 2PMZE 4PG3A 2O5IC 3L17A 1Y1WH 3Q3FA 1PYBA 2Z6BA 3QC8B 3T16A 3GTPB 1E90A 2BE5C 3R93A 2R2OA 2WXQA 2KCCA 1MKHA 4DR7Q 2C5LC 2MJ8A 3CRKC 1X3EA 1B1ZA 2AUJD 5FO7B 4HJ5A 1EIHA 2WDTB 3CMEA 3I63C 1WCMG 5M5WH 4BZAA 5AJ3Q 3KUZA 4MIUA 3CU7A 4APVA 3I4NG 3EBEA 2NCNA 2LXKA 1XX8A 5J22A 4P74A 1SMYD 3NELA 4DFAA 1PH9A 1UNSA 4ASWC 5ISRA 3I55A 3D31A 3OMCA 4A3JH 1N60A 4C3JB 1RLFA 1IL2A 2DBYA 3OJ3A 1I50H 4YSZB 4NMZA 4JI4Q 2OXPA 1ACCA 2KN5A 1VQLA 2LEKA 1Q1OA 2GN5A 2XRQD 1IW7C 3HG9A 4JBKA 3QO2A 3NUHB 2V0GA 2CR5A 4A3BB 3N6RA 4PZ6A 1WJJA 3HOVH 1ASYA 4XE0A 4O0AA 1K8OA 1GJZA 2YTVA 4S17A 5JJLA 2KFKB 1EIGA 2H4OA 5ELFA 1ZXHA 3K80C 1SBBB 3BDLA 4OVVA 1YN3A 4F1SA 1UBIA 4DQOC 1JE5A 3K9PB 1F9SA 1EY4A 4FXDA 1P7EA 2UU7A 1BF4A 1WVLA 2PPBC 3KWLA 4YL8A 4W9IA 4X3UA 2LWPA 5FLXL 1YN5A 2UUAL 1WXAA 2M9VA 5C23A 4FF3A 4N6EB 1QWYA 4FDBA 3ULJA 2LXAA 4G7HC 3H94A 1OQQA 1RWSA 2CHWA 5JHBA 2KVZA 3VDYA 3HM3A 1HZBA 3AI5A 3QK0A 4IPCA 5ELOA 1YNTE 4YWGG 1PGAA 4AYBG 2JYTA 2FIFA 4KKTA 2YLMA 2DYBA 5H92C 1P3QU 1S5FD 4LWCA 2OWOA 2NMQA 1AP0A 2UUCQ 4Y52H 4OZCA 5CV5A 4RMAA 3DEOA 1YNJC 1CQFA 5IP9H 4FXGC 4P71A 2ZJQA 5H8YE 1Y56A 1TS4A 3PRMB 2FUG1 2D3BA 5IP9G 5M3MH 2KUMA 2HTME 3RNEC 5C3WA 2R6GA 2IHFA 2L12A 3RZOB 1GUOA 3IKJA 2MGSA 5KNCA 1WX9A 3JSVA 4DPGA 1N36Q 1F9QA 1SNCA 3FPUB 1XQQA 4KJOA 1LT6D 5JEAG 4DV3L 4XT1B 3CC7A 3HIZA 2K3UA 4LNFA 2FAZA 4MGZE 3TCAA 4IURA 4LFAQ 5L37A 1RJTA 2BS4B 2N55A 4NXNL 3UI3A 2JWZA 5IY0A 4GMVA 2TSSA 3BYTB 1KNAA 3ND8A 5CC4A 1O7IA 4JI2Q 4B08A 1J19A 1WXMA 4LF8L 1PH2A 3DMUA 2DZIA 3EFXD 1SROA 4H02A 3T51B 1EY9A 2WNMA 4A3EH 4C3IG 1N32L 2JP1A 4C1NI 4WH4A 2K32A 3KF6A 3CQZH 2C60A 1YHQA 2O6VD 2ZJRA 2EYFA 4C3IH 5EDSA 1CUKA 4OXPA 3L0OA 4IKGA 1YVCA 4DUZQ 4JI6Q 1KRSA 1GB4A 2A6ED 1C3TA 2KWUB 2FUHB 1MIUA 1F77A 3PHWB 3IRBA 2HCCA 4EVOA 4EQOA 2RDFA 3DVNU 3AM9A 2INDC 2MH7A 5KYIA 2JA8B 1MVKA 3MJWA 4H2AA 4KVGB 4LDTD 3M3YH 1WGGA 3RLOA 1LM8B 1DOIA 1JWAD 3W5OA 1TKEA 2XVSA 3KOJA 4NY0A 1LV9A 5GMVA 1VJKA 2OOBB 3OIPA 4XT3B 4A3FB 4F8MA 4IPHA 2LGYA 3KQ4A 3GTLB 3B9JA 4IUPA 5CHVC 2KD0A 3ZNHB 1G291 2AQ1B 2NYZD 4GDLB 2PNHA 3EJIA 4BY1H 2L00B 2L76A 4ILWA 2V3PA 3H1UA 2N3SA 4YHHL 2LASA 1XNQL 3S2AA 4TMAB 1VQ8A 2AUKA 2IWHA 5G5HA 3Q23A 3FKYA 1EIFA 5GADC 3S2HH 2RSUA 1PZID 3A0JA 2N9XA 5DLQE 1K53A 3PO2G 4FJYA 3KVFB 3QB3A 3QR8A 2N7EA 5CTRC 1TS2A 4RGNA 2BYFA 3GQBA 2L11A 5GQOA 5JPNC 1N5WA 2F0NA 3HOZG 3GDEA 4U68A 4YCUA 3RMHA 1ZEQX 1FXTB 1E7ZA 3A1QA 1KAAA 4HXDA 1U4RA 2ZTCA 2EXZA 3VA5A 1VR9A 5BMHA 4M8MA 1IW7D 4RHSA 3CCUA 2TMPA 4HIOA 1SNQA 2RHQB 2EYHA 2KFJA 4OONA 1HNWL 1WR6E 2QDBA 3PV0A 5IWAL 3M4OB 2MBEA 2F0UA 2VUMG 4ZCKA 1QVCA 4DAYB 2N88A 2WXNA 3AEFB 2DAFA 3OPOA 4C3JG 5C0XG 5KGUA 1JCKB 3TP5A 1SSOA 1PUTA 3PUZA 2E3TA 2F3IA 4IM2A 5TR5A 4UP8A 5DPSA 1DXMA 1JR0D 2DY8A 4JI3L 5C44G 2KHJA 3NQTA 4DR2Q 2MBBB 4LCDE 2F3VA 4B3RQ 3U2SC 2UXDL 1N36L 4R9WA 4MACA 2I46A 1Q81C 1A5RA 2L3ZA 3OLMD 1X3GA 1JWSD 3I4LA 5EPLA 4JI0L 4BBSH 2F1MA 5T1GA 4QCLA 1MD2D 4A3PA 4BBSG 1Y1VB 1C9OA 5D14A 5H1SE 2PVOD 1NR2A 1HH2P 1PRTD 1PZJD 3E9SA 5EGTA 1JB7A 4ZYNA 3ERQA 4JVZA 2NB0A 1B8AA 3W2DA 2MJEA 2D2CC 4QMGA 1YNND 3BK2A 2KZRA 3ZNGC 4G3XB 1V97A 5I2XA 1PV4A 4TSSA 2R92H 1JICA 4WJQA 3GTKB 4BY1G 5IGFA 2PQAB 1B50A 1JWUD 1BCPF 2MFIA 4WFN3 2YEPB 1DJRD 2XRSD 3RZOH 3GZNB 5AZGA 4JYAQ 5KHOA 2F0TA 4DV5L 4LF7L 1QJOA 2NVQB 1D2BA 4DXAB 3C0RB 5BN3A 5C3EB 3WWVA 1BCPC 2OQKA 4GS3A 2NN6I 3HK0A 4LFCQ 2E8GA 3J81j 3AU5A 1IZ6A 2K14A 2RDHA 4B0MA 1C0AA 2BOSA 1M94A 2AL3A 3HOZH 4K14A 1TT2A 3VYSA 4C2MH 1R9TB 2L05A 2MNAA 3C19A 2REXA 1SN8A 3DOWA 4GIVA 2ZT9C 1D4BA 2HD3A 2ZXRA 4L1BA 2A74C 1W3SA 4YWLA 1VQ5A 3K8AA 1A63A 1WRDB 4M0WA 4DHJB 4QUFA 3Q3OC 2MUYA 1GXDC 1MG4A 1Y8RC 5EBDA 3QAQA 3BWUD 3A7LA 3P4RB 1HNZQ 3A5UA 1CTMA 2NWGA 1VZ8A 5EBCA 1EYDA 4HR7B 2AYOB 1F2LA 2CCZA 1C7YA 2F52A 3OHXC 1SYDA 2RD0A 3IFTA 4FP5D 2UUCL 1B4OA 2FMCA 3OIQA 3K9OB 4DR1L 1RFKA 1Z2MA 1Q1BA 3CCRA 1FD6A 1UEAB 5IWAQ 4J6IA 4WJ4A 4FA6A 3I90A 5FLMG 4JI1L 2KLGA 4B9XA 4K6LA 3ZJVA 1KXLA 4A3FH 1PFMA 2DNFA 4K7WA 4EZJA 3CCMA 2WP9B 2WXJA 2RCNA 3S16B 2IO2B 2QDFA 1PH7A 2NN6G 3VTUA 2B76B 1IBMQ 4LDTB 2QMTA 1T5EA 2IHEA 2VH1A 2HDMA 2ZTDA 3AULA 1O7ZA 2GRIA 3OTOQ 1BBWA 4ZUIA 4B3MQ 5C4JB 4A3DH 4DBGA 3RNCC 4KZCA 4BVUC 2OEOA 3A54A 4WJOA 1RFAA 2CH4A 5EKKA 3PS6A 4W9LA 1RRBA 3E6ZX 3VYUA 3UDGA 3NHEB 3KBXA 3CC4A 1YQ4B 3TIXA 3T3OA 4BKTA 2PW7A 1FNWA 4LJZC 1WMHA 5AFWA 4JI4L 2EYLA 2I07B 4MDKE 4DDID 4IW0A 4B3TL 1KHIA 1L5PA 4HJKA 4W9GA 1B9NA 3KLSX 3MWYW 3Q6BA 1G2TA 3CAMA 1B70B 4JI1Q 5GAEC 2EY5A 4DV2L 2Q2TA 2FCSA 1T6BX 1E22A 4YIJA 1YOVB 2B2YC 5J3BA 5M3FH 2E2IB 5DPRA 2VS1A 2UXBL 3MC0B 1QOBA 1PTOH 2F0OA 3U9OA 1SE3A 3W1SA 5C6AA 1N6ZA 3CCEA 4GNXC 2D11A 5FR3A 2EXDA 1GNUA 1DYQA 4ID6A 2R7ZB 3OOCA 4LUOA 2BH2A 1JJGA 3B1LX 3RZWC 2F0JA 3NEMA 4W9KA 4PV1C 1EEID 1XNRQ 4KD3A 4CKCA 1YQBA 1YBYA 2KHWB 2E2JB 2LFIA 4RGTA 2K50A 3N30A 4HPPA 4ZAIA 2F0MA 2Z4IA 3PSEB 1PFDA 1WSPA 2PZTA 4BBRG 4A93G 1MJCA 3QARA 4K3CA 4OVUA 4FF2A 1TQOA 3W9CB 3UDFA 3K59A 4A55A 2WDRB 5T8IA 3SXHA 4JCVE 1WYWB 1X9NA 1AZQA 5IGCA 1OXUA 3FDTA 3I7FA 1LGRA 3R3MA 1XPUA 4E71A 1EZ8A 5JJIA 4X66L 4XIGS 4JG2A 2I0QA 4IFDG 3KF8A 3VRAB 4JI5L 3MJ5A 3CD6A 2IYDB 2KJHB 3W1SC 1WF9A 1VQ4A 1W2BA 4JV5L 1BDOA 3ECIA 5M3FB 3IL8A 1GUNA 3GTJH 1WJ6A 3RNFC 4W9DA 5C3JB 3V2TA 3AECB 5IP7G 3A4SC 3ABVB 3IXSA 1SLJA 2NS5A 1W6JA 3E5SA 4YTMB 1CSQA 3FEWX 1GB1A 4A3OA 1Q1EA 3CCJA 2BS3B 5LHY1 2FINB 1J8IA 3V6CB 1ET6A 2NTSA 1WXSA 4HPMB 1VF7A 4KN4C 3LDZE 3M3YB 2L9HA 1JB3A 5M5YH 1IGCA 4FXCA 4NJ7A 3S14B 2ALYB 1GUAB 2K52A 1LTGD 3TREA 3HOXG 1PYSB 4ME3A 3X3NA 4IFDJ 1VQGA 4DR1Q 1P1AA 1YNJD 1VQOA 1N33L 2BB5A 1FXAA 4X57B 4RA8A 3GTLH 2BKRB 4MSQB 4JGHB 1HTPA 1H9SA 2QIEB 1G8ZD 5E4XA 4NKLA 1NJIC 2N7DA 3LYYA 1AZPA 2JA9A 4BY1B 2ZZPB 3Q8FA 3MXPA 4DUYL 1Z47A 3MHBA 2AX5A 1V1QA 2WXIA 1L2NA 2SAKA 2LSSA 3I4MB 1WYGA 3AEVA 1WYDA 1SYBA 1VQKA 3MHSD 4NAWB 5E1FA 4IOIE 4KGSA 2CQOA 2JEAI 4DNRB 3CMAA 1C4AA 3EC8A 3Q6SA 2IBIB 3CWIA 4OIJA 2F0VA 2F3WA 4G50A 1HTLD 3KLWA 3MXUA 1D3ZA 1KDBA 1EQTA 1N33Q 4LNNA 3HOYG 3GD7A 2WINB 4HJ7A 4A3LG 2PPHA 1C48A 2F0QA 1AARA 1CZGA 2K1FA 1QG7A 1XNQQ 4IG7B 4NQKE 4L5SA 3HGBA 2HJ1A 2MX2A 3EFUA 2MLBA 4HK2A 4FXKC 3SDZA 3SK5A 2MBQA 3EN2A 5I6YA 2DZMA 3HM6X 1Z7TA 1FNUA 2BA1A 1XLPA 1SNDA 1I3QB 4BKGA 4A3DG 1K0SA 3VXWA 1H9KA 1Q46A 2JY6A 2KFKA 1C4QA 2B2WA 3BZCA 2VQFL 3H0GB 3T56B 1VQ7A 2IO1B 2KQ4X 3DDCB 1H8CA 4GU2A 1S5BD 4C1NK 3ZQ4A 3PUVA 1T0SC 2ASBA 2A4ZA 3Q2AC 1WTPA 3NS1A 5JVH3 4MSMB 3K81C 2K01A 4NP5A 1C78A 2JT4B 1OXVA 4FF1A 4GLSC 5J2RA 4DWFA 2J53A 3AMZA 1OXXK 4DUZL 2R93G 3K5NA 3GV6A 2R93B 2Y5CA 4XX5A 4HVBA 1RTNA 3WOFA 2HHHL 3A8IE 4HN7A 1OGWA 4L23A 2WDQB 3EGRA 1PTOB 1X65A 2WXRA 3D8GA 5E4WC 1ZYRC 4A3MH 4BBRB 1SJED 1F2RC 4USAA 4A3JB 2LS01 3ZTDA 3HVDA 3Q8DA 4AYBE 2G1EA 1C1YB 1C4PA 1BVSA 1I5FA 4EGVA 4AQYQ 2PZWA 3QOJA 1UE1A 4ZRKA 4A4IA 4UP9A 4DV1L 3R3OA 1LACA 2O5JC 1N9WA 4X62L 2JYOA 2A5UA 1Y8OB 1X1MA 4JOIA 2KT7A 4GDLA 4PS3A 3QWNA 1Y1WG 2K6QA 1X56A 4AP4C 5M9OA 3PO3B 2UXBQ 1A3VA 4XQJA 2ZTEA 4AUQC 3VR4A 1EM7A 4KN7C 2A69D 1KIXA 2K1BA 3HHMA 1QOGA 2L0CA 4ZLTF 1JRPA 3O65B 2QSDA 1IBXA 2JA6H 2QW7A 3UINB 1TWHH 4Z9CB 2CS4A 3ZYYX 4A90A 3DM3A 2UUBL 1TWFH 1CMXB 1S5ED 3RCZA 4YSXB 1K50A 3DWAA 2CFMA 4P72A 1RTOA 3WALA 4A8XC 2DYOA 3R8BA 1C79A 3CXCA 1GM5A 4QUCA 3DWPA 5KYLA 3V62A 2X6LA 4CQNA 3HVZA 4XDDA 3TP6A 4N9TA 1UE5A 2GOWA 2XNAC 1K51A 2K28A 5C3XA 3AN1A 1L2FA 5A2QL 4S3SA 5A2QE 2RR9A 4US9A 4KHZA 3VRBB 1V8CA 1AH9A 3DUZA 3J81E 3PREA 1Q86C 4MJSB 4K5XA 3S15B 5G2NA 4BKSA 4WJWA 5ELDA 2B2TC 4KK7A 1L0WA 1I6VC 4ARCA 4UPAA 1A70A 4ITKA 1R4NB 4KMUC 2MP2B 4WORA 4FJVB 2F03A 4OGQC 1H9RA 2JEBI 4MGIE 2FIDA 2Z4HA 2BS2B 2KENA 3QWZB 3A8KE 5EAYA 5JEAH 3HOUB 2KWDA 1J8CA 2EVBA 3S1RH 5IODA 2F4IA 2RPQA 3RUIB 4IZ8A 3BG3A 4EQ5A 4QAYA 4JI2L 4CO7A 3VQIA 5GROA 1HNXL 3PUWA 3JAME 2CHZA 1EQVA 1I35A 3B2FA 3H9DA 3Q8CA 2F0FA 3I2ZA 3MXGA 2I1KA 3DBRI 2MP1A 1K8RB 1JJCB 2R92G 3BY4B 1SNPA 4BOSC 4X65L 1UWXA 4FULA 3SFEB 1GVPA 4NAMA 3L10B 4I65A 1SYGA 3NWTA 1WCMB 4CHKA 3D0FA 3STBD 1TZOA 5IYBH 3H0GH 4H7BA 4OZBA 3VR6A 3A1QB 1B44D 2L15A 1TJEA 4JC0A 1V5OA 2NR2A 1NE3A 1TWGH 3OYYA 4BS9A 1K8GA 2KWVB 2Z6KA 2Z9HA 4X66Q 3WDNA 3W1BA 1VLBA 1HR0W 4IOAA 2WAQG 4KHPL 2KNBA 1UE6A 2N1VA 2KTRB 2WAQE 1SE4A 2SNMA 2JJQA 3Q14C 3W1YA 3SR1A 1P7FA 4ZKCB 4CKEA 2R93H 4BOZB 1HFGA 4K2LA 2KDMA 4X64L 2KYWA 2LXCA 3J7ZC 3IVFA 4LF6L 1R4QB 3EIVA 3BU2A 1HR0Q 1EO6A 4ANUA 2HTHA 1DGSA 2AMCB 1NNXA 1IYUA 2A68D 4IPDA 3AB5A 3IFWB 1B9RA 5LMNW 1BOSA 3I4NB 3H3VC 1P9DU 4IN3A 1WX7A 4YXDB 2G45B 3NRZA 4WJPA 3M62B 3ZXVA 1AN8A 3AE7B 4HLEA 3VR8B 4MTKA 3ZUNA 1RAXA 3DXJC 1HZ9A 1YI2A 2WXLA 4MM3A 1E5WA 1U4LA 2MJDA 1FMAD 4JK1C 2HD5B 2F0WA 1WMHB 1XCTL 5D2MB 3SD5A 3K0YA 4ANWA 1DOKA 2KHSA 1BXTA 5AJ3L 3AU7A 3PZ8A 2BWES 3FC4A 2D3AA 1TWGB 5D6JB 1G2SA 1L0XB 3PPAA 4L63B 4HROA 3PIP3 1DOMA 1HZAA 2NUCA 3MFYA 3L2PA 3F2CA 3CCSA 2UXCL 1LABA 1SRUA 3FP9A 4GN4B 1FFVA 4YY3Q 4XGAB 4K7UA 1XTDA 1KFYB 3Q3MC 3GTQH 4LFCL 3EFCA 1WE6A 4A3IG 4OW0A 4JW0A 5I9OA 2MBOA 5K36G 3M85A 4GOPC 2N9KA 2MSED 3MHZA 5LXHA 4UHVA 4RM8A 2UU9L 1JORA 1K9MC 4NXNQ 3J80i 4CKBA 2G3QB 4A20A 1ZW7A 4OX9Q 4GKKL 3S1NB 3QJYA 1VQNA 4DR6L 2L52A 3R66C 3N1YC 1NBFC 3NXWA 2CU3A 2JVCA 3WOEA 3LXFA 3Q0AA 4WAFA 3BIID 1F52A 3FILB 4GNXB 3T1YQ 4K8JA 2D62A 1QVGA 5CR3A 1GOZA 4CJ0B 4II3B 3K7UC 2M1MA 1BUVT 1ENCA 3GTOH 5EE1A 3IAM1 2I5LX 5FJ8G 2K9XA 1EWYC 3CKIB 3TJPA 3SK4A 2OQ0A 3GP7A 2H89B 4KSKC 4P6VF 3NOBA 3LNNA 1WX8A 4C3HB 2CKHB 3BK1A 4JI0Q 4MJSA 3RD2A 1UELA 5KHQA 4ZOHC 4GSWA 3S17B 1WJUA 4NAWA 4E74A 1TZ1A 3NQIA 4A3EG 3D6CA 1PH1A 3GTQB 3VH3B 4RHRA 4OX9L 1PYWD 2G9HD 1STYA 2YTYA 1I94L 4GKKQ 2O2VA 2RMMA 2V4LA 4XXEA 4B95A 3R2TA 1QB5D 2EY6A 4OIKA 1HJPA 2CW0D 1E9MA 1XTCD 3GE3C 4I6NB 2LGDA 5JEAJ 1F0ZA 1J7BA 3DBRB 2EPBA 4ULLA 3GTMB 5IYDG 5IGDA 3DBHI 2PCFB 5GXGB 3P1HA 1LXDA 1WM2A 5E6PA 4TV3A 4IUTA 1L0VB 2PQEA 1V81A 4G4KA 1XYIA 4LFBQ 4AYBB 1WXQA 2KJXA 4ZQ3A 3G4SA 2O2LD 4POFA 1L0YB 3DPDA 5CX3A 2I5MX 2RVLA 4DV4L 4NXMQ 4EZKA 4YY3L 3T4AC 2CJNA 3I91A 1IHZA 4A76A 2FMMA 2DZKA 3JAMi 2XIWA 2F0HA 5J1ZA 3Q3NC 1FIQA 2K8CA 2MW5A 1IBXB 5BMGA 3NTKA 5ELCA 3VYRA 5A35A 1OQYA 1XLOA 4W9FA 5D94A 3VHTC 1QOAA 1EWCA 4MEMA 4WWOA 1K73C 1G6JA 4JBWA 1KRHA 3VR9B 1E24A 3PVLA 1SF0A 2H88B 4A3BH 3EROA 1QLBB 2EQSA 2ENBA 3V05A 4P75A 5M3FG 3C46A 2JA7H 2BB6A 4M1UB 4KHVA 2OEDA 3JYUA 4GDKA 3ZLZA 4M8NA 2JA7G 3ZJUA 4GZYC 4CHTB 4N8FA 4TKOB 1X3PA 2MBHA 2WX1A 3Q8EA 4ACFA 2QC8A 5KRUA 1MJEA 1QOFA 2M0AA 1GD7A 2BW2A 1Y69U 3NJTA 1ENFA 1JWMD 3PO3H 2BH8A 3ZO5B 2RSOA 1OXTA 2KCMA 4MGKE 2Z0EB 5JJZA 4K0KQ 2Z59B 1HUMA 5DPWA 3P42A 1A3TA 4N9F4 2KXJA 4I6LB 1H95A 1EYCA 3RZDH 1JC7A 3AMUA 4NJ6A 5KNDA 4NW2A 2EYOA 2JZPA 1HE8A 1TS3A 2WLBA 3FHWA 4L8JA 1Q5WB 2RDGA 2DENB 3P1MA 4QB4A 1U4MA 4HCEA 2GBRA 2LGXA 1HXYD 1XPRA 3CHBD 2M17A 1N32Q 1CI3M 3FRPB 4DNIA 1RODA 4FO2A 4JOIC 2WWZA 4ZKBB 2R7ZH 4DAVA 1GUSA 4DR3L 4WURA 3CCLA 1F9PA 4A3BG 3DBLB 1LLRD 2X38A 2ONQA 3T1HL 5IYCH 4DK6C 4FF4A 2AKWB 4UAIA 4ZRIA 1M8AA 4TQUS 2JUOA 3KBGA 2SEBD 2LI5A 3RR5A 3AH7A 5JOBA 5CBAE 4CDEC 2V9HA 1ML0D 2N49A 2EY2A 2NVUI 4K6DA 4GDKB 1TWCH 4LW1A 3DHGC 1CHQD 2DAJA 2YV5A 1V8QA 3CCQA 1STNA 1TWAH 3ER0A 3NP8A 2WXHA 3HUIA 1X3FA 4HCNB 2KJ6A 5I4DA 3RLNA 4YCVA 4RKBA 4YHHQ 2AHOB 1VQJA 5JH5C 2ZPNA 2D2QA 3W3AA 4HMIA 3L0WB 1DGJA 4YSYB 3PUXA 1SE8A 3G7LA 4P2CB 1SMYC 4A3EB 2KDIA 3NK9A 1LTAD 4NZLB 3HOXB 3JC66 1KD1C 4HEDA 3TRZA 2K5HA 3RN2A 5J18A 1DOLA 4UY8C 3QCAA 1WJ4A 3ZDMC 2RQXA 4OO1H 1TKGA 2ZXPA 1WIAA 3G48A 2K5VA 1R4MI 4A75A 1P8LA 3HEJA 2D5GA 2BVCA 1D5MC 2F0SA 1KDCA 4A3GG 1JWBD 3APCA 3DHHC 4JWSC 1E0ZA 4RH6A 3J7AF 1ROEA 3CIRB 2N7JA 2V4DA 3S9WA 1XJVA 4DR4L 3AXCA 1UUPA 1I42A 2JXMB 3HZXA 3AEBB 4E3CA 3ZGZA 1OTRB 1UWVA 4YCWA 4RCNA 4DV4Q 4NXML 2B63G 1MPEA 3TSSA 4L5QA 3HOUG 3ENEA 3IT4B 3S1MH 4N58A 2HT1A 3CW2C 3N3KB 1L1OC 1ZUD2 1TY2A 4DXFA 4PYUA 1H4RA 4MGYE 3RLFA 3S2HB 4BBNF 2LRUA 3ETRA 2NBVB 2BPSA 4QF4A 2DX5B 4DHJD 1L4DB 2MP2A 3N52A 1YJIA 2M00A 1HTOA 2INPE 2WACA 1STHA 1WD0A 4V190 3TBIB 1JMCA 4MHEA 2GA4B 4QJFA 1YJWA 3S24A 1YNXA 4LMQD 4A3CH 5IP4D 3CF5A 4DF7A 1JJ2A 4R4OA 3M9BA 4F88A 1CQVA 2K75A 2WXFA 4FBJB 3H3VI 2H1EA 1QKZA 4NJCA 5M3MB 4JI8L 4GOPB 1YIJA 3NTIA 1AWDA 3CMMB 2KBNA 4G57A 4Q0FA 3MC8A 4FADA 4HEA1 3TUOA 2J0JA 2FCMA 4ANXA 3HKSA 4TVAB 3GTPH 3NTHA 4A93H 2D5DA 2CU1A 4DU9A 2KDBA 3SR6A 3URYA 1PRTB 4B6WA 3ZJYC 2BKFA 4FJZA 3RNAC 1PFNA 3FILA 1R7SA 3IT6B 4PS8A 2K6DB 5LMUQ 3PO3G 3I8ZA 4BXXG 2WAQB 4E6IA 5IE8A 3A56A 3V96A 4Y7NB 3NZSA 4DAMA 4B9KA 2KWCA 4ZRZA 5FLXc 4IWQA 1NI3A 4HDQA 4PS7A 1NR4A 2M4NA 2WU5B 2WXMA 3RT3B 1YD8U 3M4YA 3D4DA 1SYFA 2DZJA 4J1MA 2C7MB 2IDYA 4P1CC 4DK5A 2LHEA 2X69A 1IP9A 3Q8AA 2P5ZX 2LVOA 4A3CG 4A3MB 3QHTA 3Q8BA 2N78A 3PQIA 2ZVOA 3PZ7A 1BCPB 4A3LH 2K05A 3OG5A 2R92B 1ZYRD 2ZM6Q 1NYQA 2B2UA 1PDQA 3A55A 1SB3C 3DM1A 1C8CA 2KAJA 3JW0X 1ONLA 2B2VA 2AWTA 3A4RA 3ZDTA 1HTQA 1NI2A 4GN5A 4ZRQA 1BUIC 1TKWB 4IM3A 2F0IA 3H7SA 3AEAB 2NZHA 4I6PA 2K7VA 3RYTA 1HNXQ 1LM0A 3RPFC 3SU8X 1X55A 2HIXA 3QOLA 4GOCA 2K5DA 1STBA 3VA7A 5EKLA 1YX6B 2VY3A 1LTID 3OW2A 1TR5A 3AEEB 3OWFA 2YU9H 1K28A 3I57A 1TYGB 4Y7NH 2PTLA 3U30A 1PMRA 3SEBA 3I56A 4FHKA 1FJGL 1HR0L 1B9MA 2Y0SG 1SGHA 2IGDA 4A3KH 1VCBA 2JZ3B 2QHOA 3P2BA 2KCTA 1VZ7A 1QNUA 2J0KA 3NVWA 5COYA 3K5MA 2NBWB 3WANA 4ZK9B 3ONAB 4IWPA 2AL6A 1XCQL 1RCVD 3EUB2 4O42A 4KKUA 4OVZA 2RF4A 3SK8A 3TN2A 1HFNA 1AW7A 5AUIA 2KCNA 4XYQA 2E74C 3U4ZA 2ZJPA 3BVGA 2XTIA 3NZUA 5BYRA 1BO0A 1SMXA 1UBQA 4JIOU 2LKVA 3TDQA 2JWUA 1M90C 1DONA 3NBIA 1D1KA 3GS2A 5CHWA 2GVAA 4R4QA 1JW9D 5ELEA 1P0RA 1NAPA 2NVYH 3IAS1 4H0LC 4M8AA 3I4MG 5L95C 5LL6S 4LJOB 1V9JA 2NBUA 5C1ZA 1E8WA 3I73A 3NY5A 1W6KA 1IL8A 1VS0A 2K6AA 3DBSA 1AE2A 1GKHA 2KHIA 4F87A 4GLVB 1GHJA 2MPMA 3TS0A 4ICUA 2YVCA 1SYEA 2VW9A 4XQNA 3C2PA 2VZAA 1IBKQ 1FRDA 3VUXA 2PIAA 3U8ZA 4BBSB 5FLMH 4C3IB 3WA0A 1UGJA 2WXKA 4OO1G 3KUCB 1FO4A 1F1HA 2D3CA 2WX0A 4IALA 2BT6A 4KX6B 1Q0WB 5HI1A 2LZ6A 2B2UC 2I5HA 3B2GA 1ESRA 2FXQA 3B6YA 1FCCC 3C8YA 2PW9A 1PTOD 1TS5A 2ID0A 1HA5A 3RN5A 4HIKA 1EFWA 1K3BC 4A3GH 3PHXB 3W5VB 5F2DA 1YJ1A 5HHDG 4RCOA 2OJWA 1WM3A 3MFGA 4LF7Q 2E2IH 3PTFC 1PFBA 1YIWA 2B2WC 3OAWA 2IPKD 4NQLB 3A9JB 3D4RA 1TXYA 1LO5D 3WAMA 3F1ZA 3TEZA 4C3JH 3RZFA 4HSPA 1MG8A 1WTRA 4ZHOA 5IGEA 1UGMA 4KIKA 1QE6A 3B0AA 4H44C 4L5RC 4O1NA 1RKNA 4CYEA 1V80A 4P16A 1I94Q 4LF6Q 2EKEC 2I38A 4B9WA 1IYJB 1E6EB 3DVNV 4IUUA 3A33B 3ZJTA 2ZM6L 1ZKOA 5J17A 5LMNQ 1XMQQ 5E6OA 5C5LA 2UUBQ 1I4PA 3WIMA 1IBLL 2IY0B 3HS0C 1X54A 2C5CA 3OTOL 1SFOH 2QEJC 1QZGA 3ICEA 4RMFA 5D3DA 4HJ8A 1I7HA 1ICFB 3G6JB 2GBMA 3KYDD 1IBML 1S3OA 3RULA 2Q5WD 2JF5A 4DA2A 3H09A 3V61A 1N34Q 4BAXA 1S5CD 3N32A 3HOWH 4HPLB 1KC8C 2ZCCA 2MHVA 4TKNA 5CBEE 1WTWA 2O6VA 1C4CA 4HTHA 3ND9A 1U9RA 2OF1A 1OEYA 4BY7B 2K8HA 2AWNA 3UIOB 5FK9C 2CQAA 1J0GA 1MHXA 3TEXA 4QL5A 2LXJA 4W9EA 3M4QA 5DPTA 2DNCA 1NENB 1CJEA 4CJ2C 1FFUA 3I9V1 2JXTA 1RM6C 3BZKA 3AEGB 2WXGA 4MH0E 3H0GG 1H9MA 2IY1B 1LTTD 1PGXA 1CA6A 2Y0SE 3CC2A 4TRDA 1VMPA 3A7AB 1FM0D 3DEPA 1EYAA 2RCFA 3S2DB 3PRPB 2KVMA 1RD9D 2CH4W 4ALPA 5IYCG 3B08A 4OEMB 4XYCA 2BQQA 4K3BA 3PF4A 2DJFC 1VQCA 3KLSA 3ULLA 4AWJA 2R7FA 2WP8J 3T53B 1EY8A 5ELNA 5BYSA 2EJMA 4Q2JA 2OHFA 4JQWC 3ZRFA 2LMCB 2EJFC 3I4MH 1R4PB 2LUMA 4W9CA 1CSPA 5IT9E 4QQBX 2IX0A 1KDAA 2QA4A 2DWQA 4A9AA 3KLRA 1MI0A 3E0JA 5C4XB 2MQJA 1SYCA 2R61A 1GG3A 4EX5A 1Q10A 2IO0B 3EVQA 5BR8Q 2B2TA 2JA5H 2NVYB 2F0LA 4KHPQ 1U0LA 1PA6A 1CKNB 1K0RA 3EA6A 2PI2A 2PI2E 1QZHA 4V0BA 5C5MA 5LMUL 3LB8C 3NZ3A 2N9LA 2V1YA 1D8LA 4TQ0A 2O2VB 3D32A 3UE0A 3AE9B 4CJ1B 3MC9A 2MWSB 3AE4B 4GN3B 2WB1B 4NPSA 1SEBD 3J9CA 2XWBB 4J8QA 3AE1B 1XXGA 1Q12A 3O13A 1TU2B 4K5WA 1FVIA 5C4HA 4GNXA 4HCSA 4WAAA 3K6OA 2KX0A 4JI8Q 2VB2X 1UWMA 5D7GA 4A93B 4FVMA 2FCNA 5E3FA 1NMFA 5CV4A 3HOYH 3PLVA 2N9EB 2Y0SB 2JZZA 5I6WA 4NNJB 2NVXB 4DV0L 2RSNA 3ZNID 2FCQA 3FPPA 2Q8TA 5BMIA 1SNOA 3AE2B 2HCIA 1EF1A 5IYBG 4ZHPA 1B7YB 2B63B 1XLNA 1HA6A 3S16H 5FJ8H 1RYJA 2DY7A 4RFBA 2F4VL 3VH4B 2JE6I 3L7ZC 5EJWA 1HNZL 1WOCA 3EECA 4AJYB 3OJ4B 4JI7L 3GV3A 5LXIB 2PZUA 1CKNA 2HQEA 1E8ZA 1QNKA 4GN1A 1OQRA 5G55A 2LMCA 3AYHB 5EQ0A 2IT1A 3M4OH 1YEZA 1YQ3B 2K25A 2OT2A 4A6QA 2WDVB 3FMCA 1ZXTA 1IYVA 3E56A 1GC6A 1MFWA 2NPTA 5ELBA 4LK0M 1Y1WB 1FPYA 3IBEA 2N8NA 3NG0A 4BWGB 1YNNC 1VQPA 2C9OA 5GAHC 4DV5Q 3R7QA 1CZPA 4XWTA 1WGKA 2V1CC 2WKCA 4JBMA 1F2RI 1VRAB 2WKDA 1MJDA 3E9IA 1E7PB 1PDXA 5IKCM 2PW5A 4DR4Q 4DR6Q 1SJHD 2PNRC 2ZNVB 3I4OA 1PH8A 1AEXA 2Q8RE 4A3JG 3AV8A 1FD7D 1IYFA 2B63H 4X3KA 1CT1D 4C56C 2V3NA 4M01A 1SDFA 1SAPA 1GPXA 3APDA 2PE9A 2UWQA 1I4GA 1A0IA 2F0EA 4I7AA 3U7ZA 2IX3A 2E2DC 4RWSC 1IBLQ 3RUZA 3HKZE 2HJ8A 1U4AA 2M2LA 4OO1I 1MHWC 3HOZB 5IGGA 3BINA 1Z9FA 4ZYSA 4Q5VA 3HOVB 4DV6Q 1AYFA 1G6ZA 3S15H 3LWUA 3N1ZC 3KFUA 4QGUA 1LYLA 4LUZA 2V4IB 2BGFA 3TMEA 5EE9A 1A3UA 3GB1A 4OHJA 1TWAB 2R3ZA 4M02A 1S5DD 2A8VA 1XPOA 1JOKA 2FHTA 2VL6A 1R4MB 2ZEQA 3APFA 1I6HB 1CKMA 3CSTA 2DHZA 1Q3LA 4LLGM 1NSNS 4BXXH 5JJKA 4AQ7A 1EWIA 4HSVA 4QY7A 2A5HA 4LF8Q 3CCVA 2HHHQ 1WZ0A 1VQBA 3P20A 5CYUA 1WRIA 2EOTA 3P4SB 4NPNA 1TIFA 4C7YA 1QT9A 2VXWA 3UI2A 4X6AH 1V86A 1UH6A 1V43A 3TQYA 4KIKB 3LJ3A 3ULPA 3PT2B 3ML8A 1E1OA 4GB9A 3ZIMA 2LGIA 3SE0A 2EZVA 4POGA 4W9JA 1ILPA 3RI7C 3TL5A 1O7YA 5I9PA 3KK7A 5CV6A 4DNTB 5AZHA 1K3RA 1CM9A 2NTTA 1V5TA 1G6PA 1YJ9A 4GKJL 1XD3B 2ASQA 2LJ5A 2UYZB 3RMKC 1I4RA 5KEEA 3DWGC 1QVFA 4A3GB 5C4JH 4DV0Q 4A3DB 1AFPA 3H3VH 1RDPD 4A3MG 2PKOA 2NZOA 1G91A 5FOBB 1KLVA 1A8VA 1PZKD 3D3RA 2M19A 1WTOA 2JU6X 4TQ1A 4IJLA 4R8IA 2WHIA 2I1JA 1QOHA 1WTVA 5T1IA 1I6HH 1BT0A 1RF2D 3NSWA 5LNK1 1V1PB 3HOYB 4JLCA 3PGZA 1OFFA 1PRTC 3S1QB 3UGBB 3UIPB 1QCBD 1S40A 1EFID 5CV9A 2BE5D 4DV7Q 1JOQA 4C4VA 2Z8LA 5EE3A 1MSGA 1NVID 3STBC 5JAVA 5C0XI 2Y5BB 2D3GA 5EPJA 3LWEA 2WIIB 1T0RC 1TWFB 1EQRA 3VDZA 3WAOA 5D65A 1MI2A 1Z6HA 4GLAC 3MP9A 4HJAA 2QDLA 1NBWA 4NDXA 2EE1A 4PQXA 3J7YW 1J6QA 4LF4Q 4IFDH 1XLQA 4LFBL 3X23A 5M5XH 1UD7A 1V6EA 2W82A 1VQHA 2PO4A 1SFOB 4DR5Q 3J80c 1ZPSA 2VUMB 2ZNVC 1CFMA 1I50B 1LTRD 2UU9Q 2ATWA 2PVGC 4XQQA 3AFQA 1TIID 2Q2IA 2E6XA 1FR3A 2AWOA 3K58A 1OTCA 1I3QH 4EQPA 4X3TA 3L9AX 5IN7A 3NE5B 2IX1A 5JPMC 4FNFA 1TKYA 1ZP0B 2KC2A 2ES2A 3KF8B 2BA0A 1KL9A 1S72A 4LTUA 2O4XA 3MZ5A 3HRZC 2OTJA 5FO9B 1GO3E 2K5QA 2M56B 3A74A 4REZA 2BTEA 1FNVA 1WI0A 4HDOA 4FLHA 2EY1A 2JRHA 4R4IA 4UDUC 2BYEA 2GBNA 1A15A 3ZRCA 2IO3B 2K04A 1PRTF 2E2JH 1C9FA 1MSHA 3GZNI 4K81A 1T0YA 2QJLA 3ZVVA 1E2VA 4PMWA 1L7YA 3VTWA 3PIO3 3GTJB 3T13A 1EIYB 5MPOA 2XGTA 2MA9B 1FL0A 3M63B 1HHVA 1EF5A 2K22A 1E1TA 2EKIA 1NDDA 4KDIC 3V3XA 2CHXA 1YJNA 2VUMH 2D0PA 2QGQA 4G7ZC 1ZXIA 3VR3A 4A3IB 4KKSA 4KY6A 2KX3A 5BN5A 1V2YA 3T1YL 2YTXA 2JA8G 2G4SA 1LT3D 4R8NA 3SGIA 5C4XH 3H7PA 4N59A 4WRDA 5EPKA 3FVQA 1F9JA 1E2ZA 4IO9A 4HIMA 1PTOF 1KLGD 2JPHA 2QEXA 3PO2H 3MVVA 3TEYA 1UF0A 2CKZB 2MO0A 1A6XA 5EKIA 3PF5A 3I5JC 4MH8A 3S17H 2KA7A 1FEHA 5L83A 1JT8A 2JA6B 1T0QC 2QCZA 2A6EC 2G4DB 1J9OA 1VQFA 3N9YC 3AQQA 1EY7A 4CGYB 4BFRA 5HKHA 4A3FG 1Y1VH 2R7DA 2F0PA 2PMVA 3LX0A 3IFDA 1K52A 1SIFA 4IWOA 4WWPA 3H8HA 3RNGC 1QF6A 2XK5B 5KIXA 2W3RA 5AUKA 2HIVA 2JQOA 3NHHA
chains in the Genus database with same CATH topology
3NBHA 4K5VA 3AE6B 2K5WA 1SXTA 1S4ZA 2CW0C 4XDXA 2RBMA 3SK6A 5CMDA 3K7AB 3GTGB 4J3OD 2NZ1D 2KECA 1NCVA 4C3HG 2IGGA 1QILA 3HP3A 4DXGA 3J80E 2K03A 2ICIA 1ILQA 3K5OA 3Q22A 2CJOA 2BDOA 4L6TB 4EE2A 1STGA 2DNEA 4IDIA 3A8JE 1ZDXA 2ACZB 3OWEB 1X32A 4IQZA 2DLBA 3L3OC 1PTOC 1YN4A 4IUNA 2XSCA 1O7LA 2PMZB 2XWJB 2F0GA 1FCLA 4WWMA 1EY5A 1PXUA 1VF5C 5FKAC 2CHBD 1HCZA 3T3NA 5CORA 4H13C 3AE3B 4HKQA 2LHDA 3CRLC 2SDFA 2KOLA 2EDGA 4YTPB 4C7ZA 4KY5A 4F7XA 5BN4A 5TSSA 4IFDI 1YJJA 5KNBA 1BQQT 4ZUJA 5M5YB 5HG2A 1N63A 5C0XH 3TP7A 2KN4A 4PMCA 4LK1C 1DZ1A 3OSOA 3SHLA 3NVVA 2BDNA 1STEA 4KGTA 2D9UA 4EQNA 4PT5A 2WV6D 1EEFD 1BNZA 4WIPA 3P75A 2AQ3B 5G3LF 5C2TB 4DK0A 3EQLC 3P7JA 5JXVA 1SNMA 2E2HB 1ET9A 1TVXA 3PO2B 2IW3A 4KY7A 2Z1CA 1NYRA 4RF1A 5NUCA 5IGBA 4KD4A 4DN4M 4ZRPA 5G3LD 4C2MB 2A6HC 1EY6A 4G7OC 5G5GA 2Q8IB 4OZAA 2GI9A 1EU3A 1E0BA 1VDZA 5E6JA 5DNFA 1IUEA 3S1RB 1O78A 3PO0A 2KEEA 5IT9L 2WQYB 2MEKA 5C0XJ 2E76C 1J7AA 1H9SB 1GAQB 2J4XA 3J7AV 3U4EG 3RD4A 3W5UB 2ZW0A 3D6WA 1VDVA 2BYTA 1CHPD 2VB3X 1EZ6A 4XWWA 4YT0B 4KTAA 2B8FA 2A6HD 1MBYA 2XN9C 1N61A 3TZDA 5FLXE 2QKIC 1WWTA 4JX1C 1Q8IA 3MXNA 1GHKA 1FRRA 2RKSA 2LY7A 2X6GA 4QIWB 1EY0A 4XYOA 4JPSA 5IOCA 3K57A 1II3A 1UAPA 3L4PA 2J7ZA 4ABNA 1PLFA 4HJGE 1C76A 1GUGA 4BA2I 2L4NA 1L6VA 3WCQA 3C1FA 1LT5D 1STAA 1TY0A 1I4XA 4FYDA 1HEZE 3U9SA 2JYEA 2PYKA 1D1IA 4RNAA 2L32A 2B2VC 3K5LA 1OXSC 2ON8A 3VR2A 5LL6X 1H9JA 2QCPX 2INNE 3BDCA 1ESFA 3AB9A 5D3IB 4J6HA 2L1BA 2PVOD 3H91A 1RHPA 3R2IA 1SIJA 4N9PA 3P4QB 4YTNB 3CQZB 1DOXA 3TP8A 1YMHE 4US8A 4MT5A 2EYJA 3GTOB 2HUGA 5BYQA 2MJ3A 2EYMA 3DWQA 1HQRD 3VYTA 2WS3B 1JQYD 1IKMA 2PLPA 1HQMC 1HZ5A 2J42A 5FO8B 3U52E 1JE4A 4D2KA 1LTSD 2E75C 1ZOYB 2KACA 5I2YA 1TWCB 2QF7A 1WD1A 2IL8A 3M7GA 2Y5PA 4K2KA 4MM3B 3MA2B 5JVG3 2YEPF 4B0EA 1DM0B 2K33A 1B3AA 1HZ6A 4X3SA 3RFZB 4U673 2FFKB 1CK1A 4KGRA 3NUCA 2VZKB 2NVTB 2VNUD 1LTBD 3NWSA 3BS1A 2EELA 1X3QA 2Y3AA 5DM73 1KNEA 4KV6A 2W54A 3SVMA 2RPVA 1I4HA 4R3DA 4DAPA 4KKJA 4HMJA 4DGZA 1U4PA 5M5WB 1WTQA 3M7NA 4L2YA 1DD2A 1E2WA 2QILA 1V1OA 3RZDB 1C77A 4ME5A 3C1EA 1JALA 1XO3A 4HKZE 1FGBD 3KWVA 3TEWA 1T5XD 2L1AA 3FKIB 1EOTA 1JOOA 2N0SB 5M5XB 2J0TD 3FAHA 1GJXA 4IUQA 4RF0A 3GO5A 3IAYA 2B2YA 1D6EC 3SFDB 1XEEA 2FJ2A 1Y8PB 1CA5A 3NVYA 1F2ZA 1ZDVA 2LJIA 3H6MA 3ITPA 4RAUC 4CBVA 3MAQA 4HRSA 1WTXA 2A69C 1TWHB 5HGTA 1IGDA 1BCPD 3I3CA 3I72A 2ZW1A 1KF6B 1EL0A 2L83A 1M4VA 4ODGA 4DK1A 4JE3B 5DAUA 1KTKA 4BA1I 1F9RA 2A73B 2G9DA 1EWHA 2VZKD 1XF5L 5C44B 3J80L 1OO9B 1Y8NB 1VZ6A 2JA5B 1F2YA 2SNSA 2AQ2B 5K5PA 1N62A 1D5ZC 1B2TA 1A2TA 1FYCA 1I4QA 3HKZB 3Q24A 4KKIA 3P4PB 4MN3A 1DOYA 1JQ4A 5K36H 1HUNA 4I7ZC 5IIFA 2HDLA 4LAAA 1NEKB 4PNYA 5J39A 1HPCA 4PMBA 2JA7B 4A3KB 4K8IA 1CZWA 2L55A 1QQRA 3BDOA 3KUPA 5EE0A 5DEHA 4DAYA 2FE8A 2WU2B 4RGOS 1KABA 5CV8A 2F0KA 3S1MB 2B8GA 4OL7A 2IGHA 1O80A 5CV7A 2WXOA 3BVZA 1N5XA 2L5TA 3F2UA 1A2UA 2CVRA 3DWMA 3HRDD 3OMGA 2GB1A 2JX5A 1EU4A 3MTSA 1KH0A 1XWEA 4RKLA 4HAEA 1JMLA 4AS1A 4IUVA 2A68C 3VR5A 5C4ZA 2J52A 4C80A 2EJGC 3D4WA 1FXIA 3BVMA 3OW7A 2KEDA 3TZUA 2SOBA 2B39A 1K83B 2DYMA 2K5PA 1E10A 4KI0A 1LT4D 2RA4A 2NBFA 1J7CA 2NN6H 2EYPA 2BBCA 3DHQA 1SSNA 3PUYA 1B53A 3BZDB 1KLUD 2HDEA 5HFYA 3C3LA 1L6UA 1HRJA 2W55A 2FBWB 3MEHA 3PMFA 1IKLA 1BBXC 3AEDB 1VMCA 2JSVX 1ZE3D 1VCIA 1GUWA 1MGSA 3I70A 2KMMA 2ICEC 4RGMA 2JSOA 1V1PA 2K0PA 5CGKA 4XDCA 1PGBA 2LFNA 3NVZA 3AE5B 3X3MA 3J81L 2KQ3A 3NPPA 1L4ZB 1BR9A 2JQRB 1GUTA 4XTCS 2I2YA 2YU9B 1NUCA 3HOWB 2IJ0A 4JWUC 1K8MA 2F0DA 3AE8B 1SE2A 1T3QA 1DCZA 3Q69A 5HURA 2DN8A 4KJNA 1F2MA 1JROA 4WQMA 3P63A 3JAML 1ICWA 4ARIA 3QG1A 1Q90A 2ZXOA 5DM63 2BCOA 1BMLC 2WXPA 1ENAA 3QIAA 1D5XC 2W3SA 1MHHE 2YYZA 3BYYB 2O5IC 3T16A 3GTPB 2BE5C 3R93A 2WXQA 2KCCA 2MJ8A 3CRKC 2AUJD 1B1ZA 5FO7B 1EIHA 4MIUA 3CU7A 1XX8A 5J22A 1SMYD 4DFAA 1UNSA 5ISRA 3D31A 3OMCA 1N60A 4C3JB 2DBYA 4YSZB 4NMZA 2OXPA 1ACCA 2LEKA 2V0GA 2XRQD 3NUHB 1IW7C 3HG9A 3QO2A 4A3BB 3N6RA 4XE0A 1K8OA 1EIGA 2H4OA 5ELFA 1ZXHA 1SBBB 3BDLA 1YN3A 4DQOC 1F9SA 1EY4A 4FXDA 1P7EA 3KWLA 1BF4A 1WVLA 2PPBC 4X3UA 5FLXL 1YN5A 2M9VA 4FF3A 4N6EB 1QWYA 4G7HC 3H94A 1OQQA 1RWSA 1YNTE 4YWGG 1PGAA 2JYTA 4KKTA 5H92C 1S5FD 2NMQA 1AP0A 4OZCA 5CV5A 3DEOA 1YNJC 1CQFA 4FXGC 5H8YE 1Y56A 1TS4A 2FUG1 2KUMA 2HTME 5C3WA 2R6GA 2L12A 3RZOB 1GUOA 3IKJA 2MGSA 5KNCA 1F9QA 1SNCA 3FPUB 4KJOA 1LT6D 5JEAG 4XT1B 2K3UA 4IURA 2BS4B 1RJTA 2N55A 3UI3A 2TSSA 3BYTB 1KNAA 3ND8A 5CC4A 4B08A 3DMUA 3EFXD 3T51B 1EY9A 2WNMA 4C3IG 4WH4A 2JP1A 4C1NI 2K32A 2EYFA 4IKGA 1GB4A 2A6ED 1F77A 4EVOA 2HCCA 4EQOA 2RDFA 3AM9A 2MH7A 5KYIA 2JA8B 1MVKA 4H2AA 1DOIA 1JWAD 1TKEA 2XVSA 1LV9A 1VJKA 3OIPA 4XT3B 4A3FB 4F8MA 3KQ4A 3GTLB 3B9JA 4IUPA 1G291 2AQ1B 2NYZD 4GDLB 3EJIA 4ILWA 2V3PA 4TMAB 2AUKA 2IWHA 5G5HA 3Q23A 1PZID 1K53A 3QB3A 1TS2A 4RGNA 3GQBA 2L11A 5JPNC 1N5WA 2F0NA 4U68A 3RMHA 1ZEQX 1KAAA 1U4RA 2EXZA 3VA5A 1VR9A 5BMHA 1IW7D 4RHSA 2TMPA 1SNQA 2EYHA 2QDBA 3PV0A 3M4OB 2F0UA 2N88A 2WXNA 3AEFB 3OPOA 4C3JG 5C0XG 5KGUA 1JCKB 3TP5A 1SSOA 1PUTA 3PUZA 2E3TA 1DXMA 1JR0D 2DY8A 3NQTA 2F3VA 3U2SC 4R9WA 4MACA 2I46A 1JWSD 3I4LA 5EPLA 2F1MA 5T1GA 4QCLA 1MD2D 1Y1VB 5D14A 1NR2A 1PRTD 1PZJD 3E9SA 5EGTA 3ERQA 2NB0A 3W2DA 2MJEA 2D2CC 4QMGA 1YNND 3BK2A 1V97A 5I2XA 4TSSA 1JICA 3GTKB 5IGFA 1B50A 1JWUD 1BCPF 4WFN3 2YEPB 1DJRD 2XRSD 2F0TA 2NVQB 1QJOA 1D2BA 5BN3A 5C3EB 1BCPC 2NN6I 2RDHA 4B0MA 2BOSA 4K14A 1TT2A 3VYSA 1R9TB 2ZT9C 1D4BA 2ZXRA 4L1BA 2A74C 4M0WA 4QUFA 2MUYA 1GXDC 5EBDA 3BWUD 3A7LA 3P4RB 1CTMA 2NWGA 1VZ8A 5EBCA 1EYDA 4HR7B 1F2LA 3OHXC 1SYDA 3IFTA 4FP5D 1B4OA 2FMCA 3OIQA 1RFKA 1Q1BA 1FD6A 1UEAB 3I90A 4B9XA 4K6LA 3ZJVA 1PFMA 2WP9B 2WXJA 3S16B 2NN6G 2B76B 2QMTA 1T5EA 2HDMA 1O7ZA 2GRIA 4ZUIA 5C4JB 2OEOA 3A54A 5EKKA 3E6ZX 3VYUA 3KBXA 3T3OA 1YQ4B 2PW7A 1FNWA 4LJZC 5AFWA 2EYLA 2I07B 1L5PA 1B9NA 3KLSX 3MWYW 1G2TA 2EY5A 1T6BX 4YIJA 2B2YC 2E2IB 3MC0B 1QOBA 1PTOH 2F0OA 3U9OA 1SE3A 3W1SA 5C6AA 5FR3A 1DYQA 4ID6A 2R7ZB 3OOCA 2F0JA 4PV1C 1EEID 4KD3A 4CKCA 2E2JB 2LFIA 4RGTA 4ZAIA 2F0MA 2Z4IA 1PFDA 1WSPA 2PZTA 3W9CB 4FF2A 1TQOA 3K59A 4A55A 2WDRB 5T8IA 3SXHA 1AZQA 5IGCA 1OXUA 3FDTA 1EZ8A 4XIGS 4IFDG 3KF8A 3VRAB 3MJ5A 1BDOA 5C3JB 5M3FB 3IL8A 1GUNA 3V2TA 3AECB 3ABVB 3IXSA 1W6JA 3E5SA 4YTMB 3FEWX 1GB1A 1Q1EA 2BS3B 5LHY1 2FINB 1J8IA 1ET6A 2NTSA 1VF7A 4KN4C 3M3YB 2L9HA 1JB3A 4FXCA 1IGCA 3S14B 1LTGD 3X3NA 4IFDJ 1YNJD 2BB5A 1FXAA 4RA8A 1HTPA 1H9SA 2QIEB 1G8ZD 5E4XA 4NKLA 3LYYA 1AZPA 4BY1B 3Q8FA 3MXPA 1Z47A 3MHBA 2AX5A 2WXIA 2SAKA 3I4MB 1WYGA 1SYBA 4NAWB 5E1FA 4IOIE 4KGSA 2JEAI 4DNRB 1C4AA 3Q6SA 3CWIA 4OIJA 2F0VA 2F3WA 1HTLD 3MXUA 1KDBA 1EQTA 3GD7A 2WINB 1C48A 2F0QA 1CZGA 1QG7A 3HGBA 4FXKC 3SDZA 3SK5A 5I6YA 1Z7TA 1FNUA 2BA1A 1XLPA 1SNDA 1I3QB 1H9KA 1C4QA 2B2WA 3H0GB 3T56B 2KQ4X 1S5BD 4C1NK 3ZQ4A 3PUVA 1WTPA 3NS1A 5JVH3 1C78A 2K01A 4NP5A 1OXVA 4FF1A 4GLSC 2J53A 3AMZA 1OXXK 3K5NA 3GV6A 2R93B 2Y5CA 1RTNA 3WOFA 3A8IE 4HN7A 4L23A 2WDQB 3EGRA 1PTOB 2WXRA 3D8GA 5E4WC 1ZYRC 4BBRB 1SJED 1F2RC 4USAA 4A3JB 2LS01 3HVDA 2G1EA 1C4PA 4EGVA 2PZWA 3QOJA 3R3OA 1LACA 2O5JC 2JYOA 1Y8OB 3QWNA 5M9OA 3PO3B 1A3VA 4XQJA 3VR4A 1EM7A 4KN7C 2A69D 2K1BA 1QOGA 2L0CA 4ZLTF 1JRPA 2QSDA 1IBXA 4Z9CB 3ZYYX 4A90A 4YSXB 1S5ED 1K50A 3DWAA 4A8XC 1RTOA 2DYOA 3R8BA 1C79A 4QUCA 3DWPA 5KYLA 2X6LA 4CQNA 3HVZA 4XDDA 3TP6A 4N9TA 2XNAC 1K51A 2K28A 5C3XA 3AN1A 5A2QL 4S3SA 5A2QE 4US9A 4KHZA 3VRBB 1V8CA 3DUZA 3J81E 4K5XA 3S15B 4WJWA 5ELDA 2B2TC 4KK7A 1I6VC 4ARCA 1A70A 4ITKA 4KMUC 4WORA 2F03A 4OGQC 1H9RA 2JEBI 2Z4HA 2BS2B 3A8KE 3HOUB 5JEAH 2KWDA 2EVBA 5IODA 2F4IA 4IZ8A 3BG3A 3VQIA 3PUWA 3JAME 1EQVA 3B2FA 3Q8CA 2F0FA 3MXGA 2MP1A 1SNPA 1UWXA 3SFEB 4NAMA 4I65A 1SYGA 3NWTA 1WCMB 1TZOA 4H7BA 4OZBA 3VR6A 1B44D 1TJEA 4BS9A 3WDNA 1VLBA 2SNMA 1SE4A 3SR1A 1P7FA 4ZKCB 4CKEA 1HFGA 4K2LA 2KDMA 1R4QB 1IYUA 2A68D 3AB5A 1B9RA 1BOSA 3I4NB 3H3VC 4IN3A 4YXDB 3NRZA 1AN8A 3AE7B 3VR8B 3DXJC 2WXLA 1U4LA 2MJDA 1FMAD 4JK1C 2F0WA 1XCTL 3K0YA 1DOKA 2KHSA 1BXTA 3PZ8A 3AU7A 3FC4A 1TWGB 1G2SA 1L0XB 4L63B 4HROA 3PIP3 1DOMA 2NUCA 3MFYA 1LABA 1FFVA 1KFYB 4OW0A 5I9OA 5K36G 3M85A 2N9KA 3MHZA 1JORA 3S1NB 3QJYA 2L52A 3NXWA 2CU3A 3WOEA 3LXFA 3Q0AA 4WAFA 3BIID 3FILB 4K8JA 2D62A 5CR3A 1GOZA 4CJ0B 1BUVT 1ENCA 5EE1A 3IAM1 2K9XA 1EWYC 3CKIB 3SK4A 3GP7A 2H89B 4P6VF 3LNNA 4C3HB 3BK1A 4ZOHC 3S17B 3NQIA 3D6CA 3GTQB 4RHRA 1PYWD 2G9HD 1STYA 2RMMA 4XXEA 3R2TA 1QB5D 2EY6A 2CW0D 4OIKA 1E9MA 1XTCD 5JEAJ 1F0ZA 1J7BA 2EPBA 4ULLA 3GTMB 5IGDA 2PCFB 5GXGB 3P1HA 4IUTA 1L0VB 2PQEA 4G4KA 1XYIA 4AYBB 1WXQA 2KJXA 4ZQ3A 2O2LD 1L0YB 2RVLA 3T4AC 2CJNA 3I91A 1IHZA 2FMMA 2XIWA 2F0HA 5J1ZA 1FIQA 1IBXB 5BMGA 3NTKA 5ELCA 3VYRA 5A35A 1XLOA 1QOAA 1EWCA 4JBWA 1KRHA 3VR9B 1SF0A 2H88B 3EROA 1QLBB 3V05A 2ENBA 3C46A 2OEDA 2BB6A 4M1UB 4KHVA 3ZJUA 4GZYC 4CHTB 4TKOB 1X3PA 3Q8EA 5KRUA 1QOFA 2M0AA 2BW2A 1Y69U 1ENFA 1JWMD 2RSOA 1OXTA 5JJZA 1HUMA 3P42A 1A3TA 1EYCA 3AMUA 1JC7A 5KNDA 4NW2A 2EYOA 2JZPA 2WLBA 1TS3A 4L8JA 2RDGA 3P1MA 4QB4A 1U4MA 4HCEA 1HXYD 3CHBD 1CI3M 3FRPB 1RODA 4FO2A 4ZKBB 4DAVA 1GUSA 4WURA 1F9PA 1LLRD 2X38A 2ONQA 4FF4A 4UAIA 1M8AA 4TQUS 3KBGA 2SEBD 3AH7A 5JOBA 5CBAE 1ML0D 2EY2A 4K6DA 4GDKB 1CHQD 1V8QA 1STNA 3NP8A 2WXHA 3HUIA 5I4DA 4RKBA 3W3AA 4HMIA 1DGJA 4YSYB 3PUXA 3G7LA 1SMYC 4P2CB 4A3EB 3NK9A 1LTAD 4NZLB 3HOXB 4HEDA 1DOLA 2RQXA 4OO1H 1TKGA 2ZXPA 3HEJA 2D5GA 1D5MC 2F0SA 1KDCA 1JWBD 4JWSC 1E0ZA 4RH6A 3J7AF 1ROEA 3CIRB 2N7JA 2V4DA 3S9WA 1UUPA 2JXMB 3HZXA 3AEBB 3ZGZA 4RCNA 1MPEA 3TSSA 3IT4B 4N58A 1ZUD2 1TY2A 4DXFA 3RLFA 3S2HB 3ETRA 4QF4A 1L4DB 3N52A 1YJIA 2M00A 2INPE 2WACA 1STHA 1WD0A 4V190 3TBIB 4MHEA 2GA4B 4LMQD 4DF7A 4F88A 1CQVA 2WXFA 2H1EA 1QKZA 4NJCA 5M3MB 1AWDA 3NTIA 4G57A 4Q0FA 4HEA1 3TUOA 3NTHA 2D5DA 4DU9A 3SR6A 3URYA 1PRTB 1PFNA 3FILA 1R7SA 3IT6B 3I8ZA 2WAQB 4E6IA 3A56A 3V96A 4Y7NB 4ZRZA 1NI3A 1NR4A 2WU5B 2WXMA 3M4YA 3D4DA 1SYFA 2IDYA 4J1MA 2LHEA 2X69A 3Q8AA 4A3MB 3Q8BA 3PZ7A 1BCPB 2K05A 2R92B 1ZYRD 1NYQA 2B2UA 1PDQA 3A55A 1SB3C 3DM1A 1C8CA 2KAJA 1ONLA 2B2VA 4ZRQA 1BUIC 1TKWB 2F0IA 3AEAB 2K7VA 3RPFC 3QOLA 2K5DA 1STBA 3VA7A 5EKLA 1LTID 1TR5A 3AEEB 3OWFA 3I57A 1TYGB 2PTLA 1PMRA 3SEBA 1B9MA 2IGDA 1VZ7A 1QNUA 3NVWA 5COYA 3K5MA 4ZK9B 3ONAB 1XCQL 1RCVD 3EUB2 4O42A 4KKUA 4OVZA 3SK8A 3TN2A 1HFNA 1AW7A 5AUIA 2KCNA 4XYQA 2E74C 3BVGA 5BYRA 1BO0A 2LKVA 3TDQA 2JWUA 1DONA 3NBIA 1D1KA 3GS2A 1JW9D 5ELEA 1NAPA 3IAS1 4H0LC 4M8AA 5LL6S 3I73A 1W6KA 1IL8A 2K6AA 4F87A 1GHJA 2MPMA 1SYEA 4XQNA 3C2PA 1FRDA 2PIAA 4BBSB 4C3IB 1UGJA 2WXKA 4OO1G 1FO4A 4IALA 2BT6A 4KX6B 5HI1A 2B2UC 3B2GA 1ESRA 1FCCC 3C8YA 2PW9A 1PTOD 1TS5A 2ID0A 1HA5A 3W5VB 5F2DA 5HHDG 4RCOA 3MFGA 1PFBA 2B2WC 2IPKD 3D4RA 1LO5D 3TEZA 4HSPA 4ZHOA 1WTRA 5IGEA 1QE6A 4H44C 4O1NA 1RKNA 4P16A 2I38A 4B9WA 1E6EB 3ZJTA 4IUUA 1ZKOA 5C5LA 1I4PA 3HS0C 2C5CA 2QEJC 5D3DA 1I7HA 3G6JB 2Q5WD 4DA2A 3H09A 1S5CD 2MHVA 5CBEE 1WTWA 1C4CA 4HTHA 3ND9A 1U9RA 2OF1A 4BY7B 2AWNA 5FK9C 2CQAA 1MHXA 3TEXA 2DNCA 1NENB 1CJEA 4CJ2C 1FFUA 3I9V1 2JXTA 1RM6C 3AEGB 2WXGA 1H9MA 1LTTD 1PGXA 1CA6A 4TRDA 1VMPA 3A7AB 1FM0D 3DEPA 1EYAA 3S2DB 2KVMA 1RD9D 3KLSA 2WP8J 3T53B 1EY8A 5BYSA 2EJMA 4Q2JA 2OHFA 2LMCB 2EJFC 1R4PB 2LUMA 5IT9E 2IX0A 1KDAA 2DWQA 4A9AA 3KLRA 1MI0A 3E0JA 5C4XB 1SYCA 2R61A 1Q10A 3EVQA 2B2TA 2NVYB 2F0LA 3EA6A 4V0BA 5C5MA 3LB8C 3NZ3A 2N9LA 4TQ0A 3AE9B 4CJ1B 3AE4B 2WB1B 1SEBD 3J9CA 2XWBB 4J8QA 3AE1B 1XXGA 1Q12A 3O13A 1TU2B 4K5WA 5C4HA 4HCSA 3K6OA 2VB2X 1UWMA 5D7GA 4A93B 4FVMA 5E3FA 5CV4A 2Y0SB 5I6WA 2NVXB 2RSNA 3FPPA 2Q8TA 5BMIA 1SNOA 3AE2B 2HCIA 4ZHPA 2B63B 1XLNA 1HA6A 1RYJA 2DY7A 4RFBA 2JE6I 3L7ZC 5EJWA 3GV3A 2PZUA 2HQEA 1QNKA 1OQRA 2LMCA 5EQ0A 2IT1A 1YQ3B 2OT2A 4A6QA 2WDVB 3FMCA 1ZXTA 1IYVA 3E56A 5ELBA 4LK0M 1Y1WB 4BWGB 1YNNC 2C9OA 1CZPA 4XWTA 1WGKA 2WKCA 1F2RI 1VRAB 2WKDA 1E7PB 1PDXA 2PW5A 1SJHD 2PNRC 1AEXA 2Q8RE 3AV8A 1FD7D 4X3KA 1CT1D 4C56C 2V3NA 1SDFA 1SAPA 1GPXA 1I4GA 2F0EA 3U7ZA 2IX3A 2E2DC 4RWSC 3RUZA 2M2LA 4OO1I 3HOZB 5IGGA 4ZYSA 4Q5VA 3HOVB 1AYFA 1G6ZA 3LWUA 2V4IB 3TMEA 5EE9A 1A3UA 3GB1A 4OHJA 1TWAB 2R3ZA 1S5DD 1JOKA 2FHTA 1I6HB 1Q3LA 4LLGM 1NSNS 4AQ7A 4HSVA 2A5HA 3P20A 5CYUA 1WRIA 2EOTA 3P4SB 4C7YA 1QT9A 2VXWA 3UI2A 1V43A 2LGIA 3SE0A 2EZVA 1ILPA 1O7YA 5I9PA 3KK7A 5CV6A 4DNTB 1CM9A 2NTTA 1I4RA 5KEEA 3DWGC 4A3GB 4A3DB 1AFPA 1RDPD 2PKOA 1G91A 5FOBB 1PZKD 3D3RA 2M19A 1WTOA 2JU6X 4TQ1A 4R8IA 1QOHA 1WTVA 5T1IA 1RF2D 3NSWA 5LNK1 3HOYB 1V1PB 1OFFA 1PRTC 3S1QB 1QCBD 1JOQA 1EFID 5CV9A 2BE5D 2Z8LA 5EE3A 1MSGA 1NVID 5JAVA 5C0XI 5EPJA 3LWEA 2WIIB 1TWFB 5D65A 1MI2A 1Z6HA 3MP9A 4NDXA 4PQXA 2EE1A 3J7YW 4IFDH 1XLQA 2W82A 2PO4A 1SFOB 1ZPSA 2VUMB 1CFMA 1I50B 1LTRD 2PVGC 4XQQA 1TIID 2E6XA 1FR3A 2AWOA 3K58A 4EQPA 4X3TA 3L9AX 3NE5B 2IX1A 5JPMC 4FNFA 1TKYA 1ZP0B 2BA0A 4LTUA