2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
4URKA 3V62A 5DPWA 1UZXB 2I1KA 2MW5A 4HDQA 2KLCA 3AU5A 2FNJB 2FAZA 2Y5BB 3H1UA 3PZDA 3L17A 4G50A 4A3PA 1WFYA 4ICUA 5G2NA 2KJHB 3WA0A 2XK5B 3SDLC 2NBUA 5CHVC 2I1JA 3NZUA 4DXAB 2IO1B 1Q1OA 3N3KB 3B08A 2FCNA 4GSWA 3PGEA 3DQVA 1WIAA 2L0FA 5DCNA 1WZ3A 4AJWA 1NBFC 3M63B 3APCA 2JRIB 2MP2A 3DCGA 4I6NB 1YD8U 3DVNU 1P1AA 2DAJA 2YVCA 1MG8A 2B3AA 4FHKA 3VVWB 1WM2A 2PE9A 4EUTA 1KJTA 3R3MA 2LWPA 2V1YA 4GDLA 3TIXA 1P0RA 2CU1A 4F7ZA 3PHWB 4WJQA 5C1ZA 1Y8RC 3A33B 2IBIB 4DHJB 3JSVB 2GBKA 2GOWA 3QQ8B 4FHJA 2DYOA 3AI5A 2KWUB 3IHPC 4G3XB 4KIKA 1KM7A 2NS5A 4NQLB 1WZ0A 2RGFA 1EF1A 1UBIA 3DOWA 2OOBB 4XZ4A 2MQJA 4I6LB 4FJYA 1J19A 2ZCBA 4I6PA 4PYUA 4CHKA 2ZZPB 1WF9A 2LXCA 3SD5A 4F1SA 2KLGA 3ZLZA 5LXIB 3ML8A 4FLHA 3Q3FA 1UGMA 4ZDVA 4MGKE 2FCQA 3A4SC 1YIWA 2MBBB 4EOYA 4ZRKA 2AL6A 2LD9A 1GG3A 2D10A 1LM8B 2M4NA 1E7VA 1TZ1A 2C7HA 5TR5A 3IVFA 3A1QB 2GBNA 2JXXA 4FULA 5J2RA 2AL3A 2N7DA 4EFOA 4M8MA 5L95C 3QARA 4HPLB 2PPHA 1WGGA 2ZCCA 3TBLD 2WYQA 2NR2A 2MBEA 3DPDA 2ZVNA 4GB9A 3VH4B 2FCSA 2IYDB 1Z5SB 1I42A 1WGYA 4ZRIA 3WAMA 4MDKE 2K25A 2D07B 3HHMA 3NZSA 2N9XA 1GC6A 4BKSD 1WJUA 2DX5B 2K1FA 2Z59B 4PS3A 3U8ZA 3VHTC 1V80A 2G4SA 3D32A 4NQKE 3NHEB 1WJ4A 4HXDA 4IUMB 3DVNV 2IO3B 2GBRA 2XK5A 2EMSA 4WJNA 2HD5B 4AJYB 2KK8A 1IYFA 3PVLA 1XD3B 4IC7B 2A5UA 2KNBA 2L0TA 3NY5A 1WGDA 3QCAA 4MH0E 3ECIA 2NCNA 1LXDA 4MJSB 5GMVA 1RAXA 3RCZA 4ASWC 1E8WA 3V6EB 4BOZB 2LRWA 3V60A 4GDKA 3AULA 1EO6A 2DZJA 2K8BA 4K81A 3RT3B 3L10B 1UH6A 1KLVA 4B9KA 4DHZB 3B1LX 1WX9A 1CMXB 3QHTA 2MRPA 1H8CA 3PRPB 4HWIB 5AZGA 2HTHA 3KH0A 3BINA 4A3OA 1V81A 3A4RA 5IAAC 2RPQA 1OGWA 4DWFA 1E8ZA 3CF6E 4WJPA 1BT0A 3HM3A 4PYZA 3AXCA 3KUCB 4JQWC 4DDGD 4IWOA 2ZEQA 5IA7A 3PLVA 3ZNHB 4NNJB 1J8CA 2KTRA 2D11A 4II2B 2M17A 2K8CA 3K9PB 3QK0A 2MBQA 3LDZE 4DHJD 3PV1A 3ZNZB 3QC8B 4WWNA 3ZDTA 2PJHA 2K39A 4MGYE 2KQSA 1Q5WB 4TQ0A 5EDSA 5KHQA 2O2VB 1ZKHA 3KUZA 2REXA 3VAWA 2C7NB 4IWPA 5HKHA 2LGXA 2KMCA 2L8JA 1XT9B 1R4MI 1WR6E 5G55A 3ALBA 1OQYA 2BF8B 3ZTDA 1V86A 4LDTB 2UYZB 4GOCA 4GN1A 2C7MB 3H7SA 5JH5C 3A1QA 4BBNF 4HCPB 4BKGA 3PLUA 1M94A 1Z2MA 1WY8A 2BWES 3I3TB 3KUDB 3UQAA 2ZJDA 3X23A 2G4DB 2KXJA 4IM3A 2LVPA 4MGZE 4FN2A 1WYWB 3VTUA 2KDEB 3JYUA 2BGFA 3A9KA 3EECA 1X1MA 4B6WA 1F9JA 4E74A 3S2AA 4W9CA 2WX0A 3M62B 1YQBA 2KTFA 1NDDA 2VRRB 3Q3JA 3PSEB 3V6CB 3QX1A 3ZTCA 1E8XA 2KO3A 1OEYA 1UD7A 2BKFA 3GZNI 5LLIA 3RZFA 2R2QA 1E7UA 3QAQA 1V9JA 3UF8A 2L00B 2ZPNA 1FXTB 3MJWA 2JWZA 2W9NA 3TCAA 2Z0EB 2IZVB 2RSUA 2GBMA 4MJSA 1ZGUB 1ZW7A 4G11A 3RYTA 4TV3A 4TQ1A 2HE7A 1V6EA 3W1SC 2DHZA 5DPRA 2LVOA 3QIJA 5CHWA 3QJZA 3H9DA 3VUWA 4W9LA 2KMAA 3RD2A 1S3SG 2IY1B 3L0WB 4BKSA 2KD0A 5D7GA 5E6NA 1WXVA 3DBHI 4IM0A 2KZRA 2QHOA 1RLFA 3WAOA 3WIMA 3ZO5B 2FIFA 3R66C 4W9FA 2PEAA 4NAWA 2WX1A 2DZIA 4HVBA 5KHOA 2YLMA 2C60A 3MTNB 1RRBA 1WJNA 3B0AA 2MP2B 3UQBA 4W9KA 2KJ6A 3L54A 1T0YA 4JGHB 5E6PA 4IW0A 4BKTA 2JVCA 1WMHA 2K6DB 2J0JA 2N1WA 1SGHA 4NJ6A 4EEWA 4RM8A 2D2QA 2MWSB 4B95A 1E5WA 5CTRC 2ASQA 2KVRA 3ZW3A 1IPGA 1GC7A 2MX2A 4K7UA 3U30A 3SHQA 4ANVA 2O6VB 2C9WB 1WE6A 4HDOA 4IG7B 2V3SA 3VQIA 2JY6A 2L7RA 4DDID 2IO0B 2M0XA 3PREA 5JHBA 2MBHA 4F8CB 1WGRA 3UIPB 2L76A 3P2BA 1SE9A 3APDA 3EHVA 2LGYA 2N4FA 1VD2A 4KIKB 2HJ8A 2XEWA 2DENB 4WQOB 2CS4A 2UWQA 3IFWB 4E71A 3A9JB 2N9PC 3VTWA 4P7IA 4WJOA 2KC1A 3V61A 2NPTB 1WRDB 3ZRFA 3K9OB 3DVGX 5C23A 4MELA 4CO7A 5DPTA 3IBEA 4HK2A 3CSTA 3L13A 3N32A 1UBQA 4OVUA 1YX6B 3RULA 1WXSA 2BPSA 2CHXA 4K7SA 2V4LA 3JSVA 4II3B 1P98A 4LDTD 2PE6B 3DVGY 1EUVB 1C1YB 3W1YA 1YX5B 1WM3A 1WXAA 2KX0A 3H6NA 4KZCA 4PS8A 1WX7A 2MCNB 4GMVA 3SU8X 3VDZA 4EZLA 1J0GA 1U4AA 4GU2A 4XX5A 4AUQC 2GMIC 4TUUA 2K6QA 3PTFC 4JIOU 3ZUNA 1VCBA 1WGHA 4FJVB 2LI5A 2M8SA 3ENEA 3HIZA 1QZEA 2LGDA 1JRUA 2JPHA 3R7RA 2N1VA 4LJOB 1XQQA 2ZNVB 4MM3A 2N9EB 3HM6X 4RM9A 2K8HA 2AWTA 3R7QA 4M0WB 3M95A 4MSQB 4N9F4 4W9DA 1GJZA 2ZNVC 4MEMA 3ML9A 4W9IA 3KYDD 3DBSA 2G3QB 4E3CA 5AEKB 3VTVA 3PRZA 1AARA 1P9DU 4X57B 4WWPA 4OVVA 1K8RB 4XC2A 1IP9A 1V49A 3DBRI 3RZWC 3DBLI 2G45B 3JVZX 3PT2B 3WANA 1TGZB 2DZMA 5LXHA 1GNUA 2FCMA 2GBJA 3ZRCA 3ZIMA 1G6JA 1C3TA 2BWFA 3OJ3A 4W9HA 2J0MA 2KHWB 3LJ3A 4HCNB 4AWJA 4DHZE 4NPNA 3N30A 2LZ6A 2DYBA 4EKUA 1L2NA 1HE8A 2FUHB 3ZNID 3ZKJC 4BFRA 4CYEA 3ZNGC 5D94A 4G0NB 5E6OA 2KFKB 2ZVOA 5L83A 2EMTA 4W9JA 4GDKB 1ISNA 4BVUC 3KW5B 2DZKA 4KSLC 4ANUA 2JZZA 2CHZA 1KOTA 1NI2A 3H7PB 3QWZB 3EC8A 2JRHA 2O6VA 3NS8A 2KX3A 2L3ZA 3M3JA 3MHSD 1WE7A 3VH3B 2NVUI 4HLEA 3ONSA 1E90A 4BBNC 3KVFB 2CHWA 1SIFA 2MA9B 1UELA 2AYOB 3KYCD 4GGQA 2CKHB 3JW0X 3RUIB 4EZJA 2KTRB 3VXWA 2O6VD 3TL5A 1WR1A 2BYEA 3A9JA 5AZFA 1WXMA 4JL9A 4J6IA 2KN5A 5CHFA 1R4NI 2IO2B 2NPTA 2ZPYA 4HPMB 2R2OA 2DAFA 2RD0A 3OLMD 5CX3A 1TTNA 4MSMB 2JZ3B 4PS7A 4AOFA 2LJ5A 1S1QB 2KKCA 2M1MA 3ZVVA 4WAAA 4MGIE 5AZHA 5D6JB 3PHXB 3TJPA 2KDFB 3L08A 3APFA 4FA6A 1A5RA 3VFKA 4LJPB 2OJRA 5J18A 3PS6A 3UINB 3GOEA 2WDTB 4LCDE 4JLCA 4KVGB 2WWZA 4M8NA 4K1RB 4AP4C 3CMMB 4NY0A 4IM2A 4GDLB 2JUOA 4RMAA 1PQSA 3EFUA 4EZKA 1V5OA 1TBEA 1WJ6A 3NOBA 4TKNA 2NBWB 2KDBA 3O65B 1LFDA 2A4ZA 2O2VA 4BOSC 5JHAA 4WWOA 2DYMA 4KV2A 3A9KB 4A20A 2J7QB 5JZEB 1WH3A 1EF5A 2BKRB 4ICVA 5D2MB 1D3ZA 2KC2A 4KSKC 3TMPB 5BO4B 3QA8A 1RFAA 2L05A 3WALA 2N7EA 4DBGA 2KFJA 3OAWA 4W9GA 1LQBA 2J0KA 2JF5A 2LXAA 4ZRJA 3VUXA 3L16A 2KQ7A 4HJKA 2FIDA 2KDIA 2BYFA 2KOXA 3DDCB 2C5LC 2MLBA 4GIVA 2D3GA 4GXBA 4FBJB 1Q0WB 2LRUA 1OTRB 2KWVB 4ANXA 2EKEC 3PRMB 2LASA 4NJ7A 2IY0B 4KDLB 1L7YA 4K7WA 2XBBC 3ZDMC 3C0RB 3PPAA 2KJRA 1GUAB 2AEHA 2BYVE 2KFKA 3AU4A 4YL8A 3UGBB 5J17A 2JT4B 3HK0A 5DPSA 3VUYA 2KWCA 4KDIC 1H4RA 4KZ0A 1V2YA 2RR9A 1V5TA 2MBOA 2NBVB 3H7PA 3IG3A 4FJZA 3T8MA 1WI0A 1E8YA 2LUEA 2LVQA 3CSFA 3WAPA 3X0WA 1P3QU 1YJ1A 3BY4B 3UIOB 5FR6A 4ANWA 4DK5A 2MSED 4FADA 2KANA 4IWQA 1WX8A 4NAWB 4ZYNA 1I35A 2CR5A 4W9EA 3OJ4B 3T9LA 3W1SA 1OEYJ 1WMHB 2Z0DB 3U7DA
chains in the Genus database with same CATH superfamily
2DNFA 3VRAB 1UZXB 5TSSA 1ROEA 2FAZA 3PZDA 4A3PA 1LO5D 4ICUA 2BTEA 5CHVC 2I1JA 1Q1OA 3W5UB 1TKYA 5C3JB 2BB5A 1I7HA 4AJWA 3M63B 2JRIB 2WU2B 4I6NB 3DVNU 2DAJA 1L4DB 1LGRA 1WM2A 2DLBA 1HZ5A 4EUTA 1KJTA 2V0GA 3R3MA 2LWPA 3IXSA 4GDLA 3TIXA 2CU1A 3PHWB 3LB8C 1IGDA 1PUTA 4L2YA 1HA5A 2DYOA 3GB1A 3AI5A 1V1OA 1CJEA 2L52A 2VZKD 4KIKA 2NS5A 2V4IB 3N1ZC 2OOBB 2MQJA 4FJYA 2WS3B 2ZZPB 3ZLZA 3P42A 4FLHA 2N7JA 4R3DA 4ZDVA 2JSVX 4MGKE 2ZW0A 2WDQB 2BYTA 1YIWA 3NG0A 2MBBB 4EOYA 3W2DA 3N1XC 2D10A 2C7HA 2GBNA 2N7DA 3Q6BA 1DOYA 3NVZA 1GPXA 4N59A 1T3QA 2ZCCA 4GB9A 2WYQA 2OHFA 2IYDB 1WGKA 3VR8B 4JPSA 5HFYA 5IP4D 2K25A 2D07B 3HHMA 3EGRA 4BKSD 1CK1A 2W3SA 2Z59B 1DYQA 3U8ZA 3VHTC 1WJ4A 4HXDA 3TUOA 2IO3B 2XK5A 4M02A 2GI9A 3SFDB 3MC0B 4AJYB 3NY5A 1WGDA 2CU3A 4AQ7A 3MC9A 4ASWC 1E8WA 3IAS1 4P6VF 3V60A 3AULA 1EO6A 2DZJA 2K8BA 3B2GA 3RT3B 3ZJUA 3B1LX 1C79A 4ARIA 4HWIB 5D3IB 3BINA 4DWFA 1ET6A 1OGWA 3CF6E 4PYZA 1ZXHA 3AXCA 5IA7A 3BVGA 3ZNHB 1J8CA 1T0QC 4YTNB 2MBQA 4DHJD 2V9HA 1NEKB 2M19A 3ZDTA 3IT4B 5EDSA 5D3DA 3KUZA 2REXA 1TKEA 3VAWA 3Q8AA 4C00A 2L8JA 1R4MI 5G55A 2YEPF 2J52A 1V86A 2UYZB 2JU6X 2C7MB 4A6QA 3A1QA 4B0MA 4HCPB 4BKGA 2BWES 3I3TB 1Y56A 1ESFA 1JALA 4JWSC 1IGCA 1WYWB 1NENB 2AQ2B 2BGFA 5BYRA 4ARCA 1JWBD 3PSEB 3ZTCA 4MACA 2BKFA 3RZFA 2R2QA 1MG4A 3QAQA 4XDCA 3MJWA 1XXGA 2Z0EB 3AE1B 4OZCA 4MJSA 1ZGUB 3RYTA 4US8A 4TV3A 2BW2A 2X38A 1KH0A 1V6EA 2OEDA 2LVOA 3QJZA 1XEEA 5D7GA 1T0RC 2QMTA 1FM0D 4XE0A 2QHOA 3WIMA 2LUMA 4XWWA 3P4QB 4KGTA 1R4MB 2MP2B 2WHIA 3EUB2 2KJ6A 1T0YA 3E9SA 2JVCA 1WMHA 2J0JA 2N1WA 4KKIA 2WXLA 2D2QA 5CTRC 2MX2A 1XCTL 3ZJTA 3I9V1 2C9WB 1WE6A 1I4PA 2K9XA 3PREA 3UIPB 2L76A 2J42A 1SE9A 3J9CA 2HJ8A 4E71A 3IFWB 3A9JB 3AEFB 3VTWA 1KLUD 4P7IA 3V61A 3ZRFA 3DVGX 4MELA 3V05A 1T5XD 1WXSA 2BPSA 4II3B 2PE6B 4B0EA 1C1YB 5HG2A 5HHDG 4PT5A 3W1YA 1WM3A 4C4VA 3SU8X 1HXYD 2BBCA 1U4AA 4GU2A 3RNGC 2IPKD 3U2SC 3PTFC 4IOIE 1WGHA 2LI5A 2M8SA 1JRUA 1I4HA 4TSSA 2JPHA 3BIID 3V6CB 4MM3A 4MSQB 4N9F4 3ML9A 1AARA 1K8RB 2IGDA 4GLSC 2GBJA 2AQ1B 3BZDB 3WCQA 2IDYA 2LFIA 5H92C 3U4EG 3ZJVA 2DYBA 1FD6A 1HE8A 1TKGA 1MPEA 3ZKJC 2KT7A 5LNK1 5E6OA 3KW5B 2DZKA 4ANUA 1KOTA 2CHZA 2CJNA 4YSXB 4HKQA 1SE2A 3DWMA 3HVZA 1DOXA 4US9A 3M3JA 3ONSA 1SBBB 3Q8BA 1E90A 1AYFA 3URYA 1UELA 3HVDA 2AYOB 3T3OA 3RUIB 2WXFA 2O6VD 2BYEA 5EE9A 3DHGC 3MHZA 4JL9A 3SEBA 1R4NI 2IO2B 2NPTA 1XCQL 2R2OA 1TTNA 4PS7A 3ZVVA 1K53A 2JWUA 2INCC 4MGIE 5AZHA 2KDFB 3APFA 4YXDB 3PS6A 3UINB 3P4SB 2WDTB 2WQYB 4IM2A 4ZRQA 2VZKB 4EZKA 1K50A 4LNFA 1MFWA 1TBEA 3KWVA 4TKNA 1P7FA 2A4ZA 4WWOA 2DYMA 4KV2A 3A9KB 2W55A 2J7QB 1EF5A 2BKRB 5H8YE 2G9HD 3TMPB 3QA8A 1RFAA 2L05A 2N7EA 4S17A 2K3UA 5E6JA 4HJKA 2KDIA 3DDCB 2C5LC 2BB6A 4GXBA 2KWVB 4ANXA 3NJTA 3AEAB 2M56B 2LJIA 3ZYYX 3MFGA 3PPAA 2AEHA 4YL8A 1MHXA 3VUYA 4KDIC 1V2YA 1R4NB 2MBOA 3IG3A 3T8MA 1WI0A 2LUEA 5FR6A 1VZ8A 1I35A 3KWLA 4W9EA 2X8XX 3W1SA 2E6XA 4RNAA 4URKA 2I1KA 2KLCA 1N62A 2EKIA 2FNJB 3KLSX 1WFYA 3SDLC 2NBUA 3NZUA 2NTSA 4YTPB 1YN4A 3DQVA 4KX6B 1ZXIA 4WIPA 1ZUD2 2QSDA 3AB5A 3APCA 3DCGA 2MHJA 1YD8U 1P1AA 2FBWB 2YVCA 1E7PB 3VVWB 1MJDA 2V1YA 2PIAA 4DHJB 3JSVB 2GOWA 3QQ8B 4FHJA 2RDGA 2RMMA 3AE8B 2KWUB 3IHPC 4G3XB 4NQLB 1YJJA 2RGFA 4XZ4A 1STEA 4I6PA 1WF9A 2LXCA 3RNBC 4F1SA 5LXIB 3ML8A 3GS2A 2ONQA 1BXTA 3A4SC 2AL6A 4RGNA 5T8IA 1TZ1A 2AL3A 2RDBC 1WGGA 2BS3B 2WGSA 1QLBB 1JRPA 1WGYA 4ZRIA 3WAMA 4MDKE 3RI7C 1GC6A 1WJUA 1HTQA 4MH8A 1V80A 2G4SA 3BYTB 2GBRA 4WJNA 2HD5B 1OQQA 2KK8A 4K3CA 3PVLA 1XD3B 2QDFA 3QCAA 4MH0E 1PYWD 2V3PA 3ECIA 2NCNA 1E0ZA 1F0ZA 1SIJA 3V6EB 1ACCA 1IUEA 3L10B 4REZA 1KLVA 4B9KA 4DHZB 3AEEB 1WX9A 2G1EA 3QHTA 1HTOA 1UNSA 3KH0A 4A3OA 5IAAC 2VH1A 4N58A 1E8ZA 1N61A 2K5PA 2ACZB 4H2AA 3KUCB 4JQWC 4WURA 2KTRA 4II2B 3W5VB 2M17A 3QK0A 2WDVB 4RF1A 1N63A 4KKJA 1Q5WB 2LEKA 3IT6B 4TQ0A 2KAJA 1C76A 2O2VB 1RWSA 3TSSA 4ZYSA 1T0SC 3O13A 3C8YA 1WR6E 2LHDA 3AH7A 4GOCA 3H7SA 3NVWA 1IBXB 3PLUA 1WY8A 3UQAA 3FC4A 3R2TA 2QCZA 2D5GA 3BK2A 2HDEA 1TS5A 1N60A 1JW9D 3EECA 4RH6A 4HRSA 3S2AA 2WX0A 3M62B 1FXAA 3Q3JA 3QX1A 2KO3A 2KYWA 1VZ7A 2RDHA 1N6ZA 1FXTB 4YT0B 2W9NA 3TCAA 2IZVB 4LNKA 2RSUA 4DXFA 1XLNA 1MVKA 4P1CC 2HE7A 3W1SC 2DHZA 5DPRA 3FILA 5HI1A 2EELA 3T3NA 4W9LA 1PGBA 3RD2A 1S3SG 3L0WB 2J4XA 4M01A 3RMKC 5E6NA 3DBHI 3ZO5B 4IM0A 3WAOA 2BVCA 3R66C 2WX1A 5KHOA 2YLMA 3MTNB 3UQBA 3L54A 4JGHB 1HZ6A 5E6PA 3U7ZA 4C7YA 3L4PA 1SGHA 4NJ6A 4RM8A 3Q8EA 4B95A 2KVRA 1GC7A 4ANVA 2O6VB 4HDOA 1D5XC 1TY0A 1JWAD 2M0XA 4F8CB 2H89B 1DGJA 2LGYA 1VD2A 2K22A 4KIKB 1GB1A 1BUIC 2UWQA 3AM9A 1SJHD 1FIQA 2KQ4X 3K9OB 4CO7A 4HK2A 3CSTA 3RULA 3SFEB 1YX5B 1WXAA 4KZCA 2MCNB 1V1PB 4GMVA 3VDZA 4EZLA 3Q69A 4FJVB 2JQRB 3DBHB 3ENEA 1QZEA 4C7ZA 1XQQA 2AWTA 4LTUA 1GJZA 2ZNVC 4MEMA 1F1HA 4KGRA 4W9IA 2G3QB 4E3CA 3AEGB 4WWPA 3Q2AC 3Q3OC 3NRZA 1TGZB 5LXHA 1NYRA 2FCMA 3ZRCA 4YTMB 3LJ3A 4DHZE 2BQQA 3N30A 4EKUA 2FUHB 3BK1A 4EE2A 4OZAA 1EWCA 4BFRA 4YSYB 2SAKA 5D94A 2LHEA 2N0SB 2KFKB 2WXNA 2EMTA 4W9JA 2QILA 4KSLC 4P16A 2WDRB 3H7PB 2UU7A 5I4DA 2WXIA 3RNCC 1ZDVA 4BBNC 1FRDA 2I38A 4GGQA 3ABVB 3AE2B 3A9JA 1KRHA 2KN5A 3EFCA 3TEZA 3P63A 2ZPYA 5CX3A 2RD0A 4AOFA 4KGSA 1S1QB 2KKCA 2XN9C 1WWTA 2IJ0A 5D6JB 3L08A 4FA6A 3VFKA 2MJEA 1VLBA 4JLCA 4KVGB 5EE0A 1L5PA 1VDVA 4AP4C 3CMMB 4C56C 3N20C 1J7BA 2PVGC 3KQ4A 1UWXA 2KDBA 3O65B 4A90A 2K0PA 4BZAA 5MPOA 5JZEB 3I5JC 2KC2A 5BO4B 4DBGA 1JWMD 2PW9A 2LXAA 3L16A 2KN4A 3MC8A 1VR9A 2BYFA 4NJCA 2LRUA 3Q8CA 1OTRB 2EKEC 4USAA 2IY0B 4KDLB 1ZE3D 4K7WA 2XBBC 2JZPA 2R61A 3PO0A 5J17A 4XGAB 3UGBB 2JT4B 3HK0A 5DPSA 1H4RA 4XWTA 1C4CA 4UDUC 4FJZA 2LVQA 1YJ1A 4DK5A 3UIOB 4FADA 4IWQA 1WX8A 1OEYJ 1WMHB 1A70A 3P4RB 1OQRA 2MW5A 1UWMA 3H1UA 4G50A 3N1YC 4DXAB 3IAM1 2IO1B 1B9RA 2HJ1A 2FCNA 3B08A 3PGEA 2L0FA 5DCNA 1WZ3A 1NBFC 2TSSA 3AE4B 3AN1A 2CJOA 3E56A 1MG8A 2B3AA 3Q8FA 4RFBA 4FHKA 1L0VB 1I4XA 1F52A 1P0RA 2XNAC 1I4QA 4WJQA 1F77A 4OW0A 5C1ZA 3A33B 2IBIB 1AWDA 2WXKA 2IGGA 1UGJA 3MJ5A 4ACFA 3DOWA 2MH7A 1PGXA 2JYEA 1J19A 1F2RC 1TIFA 3SD5A 1WYGA 3Q3FA 1UGMA 2FCQA 3HUIA 1GG3A 4HJGE 1ZDXA 2M4NA 5TR5A 4FULA 5J2RA 4K3BA 4M8MA 5L95C 3QARA 4HPLB 3TBLD 1E6EB 2MBEA 2NR2A 3DPDA 3VH4B 1KFYB 3VR9B 1JMLA 1I42A 3AEBB 4XYCA 3RPFC 1QT9A 2DX5B 1CZPA 2K1FA 2M0AA 3LYYA 4PS3A 4NQKE 4IUMB 3DVNV 1AW7A 4LLGM 2EMSA 1IYFA 4IC7B 2L0TA 2KNBA 4L23A 1LXDA 3LXFA 5GMVA 3RCZA 2Y5PA 1PGAA 4JWUC 4BOZB 4GDKA 3NUHB 2QIEB 4ITKA 1KLGD 2ICIA 1N5WA 2SEBD 3PRPB 5G5GA 3NVYA 3A4RA 4WJPA 4MT5A 2JXTA 1XLOA 4DDGD 1XF5L 3NS1A 4ZOHC 2WXJA 4WWNA 1QQRA 4C80A 2PJHA 3TEYA 2K39A 4MGYE 4LNOA 5KHQA 1QKZA 2C7NB 2KDMA 4IWPA 2LGXA 5HKHA 1XT9B 3TEWA 2W3RA 3ZTDA 2MJ3A 1SJED 2N9KA 3NZ3A 1YQ3B 1RFKA 3AE6B 3KUDB 4FN2A 2HTME 3B9JA 2KDEB 5IOIA 3JYUA 1J7CA 2WNMA 4B6WA 4E74A 1L0XB 1YQBA 1OEYA 1UD7A 3GZNI 2QEJC 3UF8A 1V9JA 2ZPNA 3DHHC 4YSZB 4OHJA 2BS4B 4RGOS 1TT5B 3QIJA 5CHWA 4LNIA 3VUWA 3FKYA 3C19A 2KMAA 3SR6A 1WXVA 2KZRA 1RLFA 2INPE 1EWYC 2FIFA 2KVZA 4FXCA 2PEAA 4NAWA 4W9FA 4BAXA 1WJNA 3B0AA 1XLQA 4BKTA 2K6DB 1P7EA 4D2KA 2MWSB 3ZW3A 1IPGA 5IO9A 1VRAB 2L7RA 4DDID 2IO0B 5JHBA 3P2BA 3APDA 5FK9C 3R2IA 2DENB 4WQOB 2QJLA 2N9PC 3GZNB 1JROA 4WJOA 5C23A 4A8XC 1YQ4B 2FE8A 4OVUA 3N32A 1UBQA 1V97A 2CHXA 4K7SA 4LDTD 3AMZA 3H6NA 2GRIA 4PS8A 1WX7A 1J0GA 1YN3A 3EA6A 3PZ7A 4AUQC 3R8BA 4JIOU 2Q5WD 1OFFA 1FPYA 1N5XA 2LGSA 3HIZA 1ZOYB 2LGDA 4RCOA 3R7RA 4LJOB 2ZNVB 2N9EB 3HM6X 3R7QA 2K8HA 2MJDA 4M0WB 3OG5A 3KYDD 3RNEC 4WQMA 3VTVA 3CWIA 4X57B 1YJIA 3GP7A 4XC2A 1IP9A 3DBRI 3DBLI 3PT2B 3WANA 5AUKA 1GNUA 2KWDA 1G6JA 1K51A 3HRDD 4W9HA 2J0MA 1RM6C 2KHWB 4HCNB 3ZXVA 4AWJA 2LZ6A 4RF0A 1L2NA 3ZNID 4NZLB 4CYEA 2WXHA 3AV8A 5FKAC 5IN7A 1WRIA 2ZVOA 5L83A 1ISNA 4BVUC 1FMAD 2JZZA 5EE1A 1NI2A 3TEXA 2PTLA 3EC8A 2O6VA 3AEDB 2BS2B 2L3ZA 1Q10A 2FUG1 2NVUI 4HLEA 4WWMA 2IGHA 1V8CA 5BYQA 1YMHE 2CHWA 2MA9B 3KYCD 2CKHB 2KTRB 2WXRA 1D4BA 3TL5A 5AUIA 1WR1A 5AZFA 4J6IA 1TY2A 3ETRA 3OLMD 2DAFA 2M1MA 3DWGC 4WAAA 4L1BA 3PHXB 5FR3A 1A5RA 4XDDA 4LJPB 2OJRA 5J18A 3ZQ4A 1V1PA 1DOIA 3DBRB 3DBLB 2NTTA 1SEBD 2JYTA 4K1RB 2D3AA 4GDLB 4RMAA 1FRRA 3BVZA 3NOBA 4BOSC 5JHAA 4A20A 4RGMA 1WH3A 3AECB 5D2MB 3BVMA 2KFJA 3OAWA 1R7SA 3AE9B 4ZRJA 3VUXA 1JQ4A 4FBJB 1Q0WB 2LASA 3FAHA 1L7YA 3ZDMC 3W9CB 3VRBB 2KJRA 2KFKA 3AU4A 3FILB 3PZ8A 4KZ0A 2RR9A 1JWUD 1V5TA 3H7PA 1F2RI 1P3QU 4ANWA 2MSED 2JX5A 2ZW1A 1D6EC 3OJ4B 4RGTA 2V3NA 3U7DA 2D3BA 3V62A 5DPWA 4NAMA 4HDQA 3AE5B 3AU5A 2Y5BB 3L17A 5G2NA 2I2YA 1CQVA 2KJHB 3WA0A 2XK5B 4GSWA 1ZP0B 3N3KB 3ZXRA 1WIAA 4JX1C 4DQOC 2MP2A 1L6UA 5G5HA 1QOFA 3H8HA 1EM7A 2PE9A 1C4PA 4F7ZA 5IKCM 1Y8RC 1E9MA 2GBKA 3RNAC 1KM7A 1WZ0A 1EF1A 1UBIA 1NI3A 4I6LB 1QOAA 2ZCBA 4PYUA 4CHKA 2KLGA 3Q3NC 1KF6B 5BMGA 2PLPA 1TYGB 2D3CA 1GB4A 2J53A 4ZRKA 2LD9A 1LM8B 4OZBA 1E7VA 3IVFA 3A1QB 2JXXA 2Y5CA 4EFOA 2PPHA 2WXQA 3NVVA 3AE7B 2ZVNA 4A9AA 2FCSA 1GOZA 1Z5SB 2W82A 3DHIC 3NZSA 4TMAB 2N9XA 1L4ZB 4ZHOA 2OJWA 1HEZE 3U52E 3D32A 3NHEB 3Q3MC 5C2TB 2WU5B 4LNNA 4LK0M 1RYJA 2A5UA 1FNWA 4MJSB 1RAXA 1FCCC 1FFVA 5BYSA 3I57A 2LRWA 3MP9A 4K81A 1E10A 1UH6A 1CMXB 2MRPA 1H8CA 1ZPSA 2E3TA 5AZGA 3Q14C 2HTHA 1V81A 2RPQA 1BT0A 1UUPA 3HM3A 3CIRB 4P1BC 2DBYA 4WH4A 4IWOA 2ZEQA 3PLVA 1PDXA 4NNJB 1VZ6A 2D11A 1D5MC 2K8CA 3K9PB 4IKGA 1SSNA 1XLPA 1FFUA 3LDZE 1UF0A 3PV1A 2LMCA 3ZNZB 3QC8B 2VH2A 2LGIA 2WXMA 2KQSA 4A55A 4J3OD 1QOGA 4AS1A 1ZKHA 1QF6A 1D5ZC 1I4GA 2KMCA 3ALBA 1OQYA 1JWSD 2BF8B 4LDTB 1FO4A 4GN1A 5JH5C 4BBNF 4ZHPA 2WP9B 1M94A 1Z2MA 2ZJDA 3X23A 1TS2A 2G4DB 2KXJA 4IM3A 2LVPA 1ENFA 1HQRD 4MGZE 2ON8A 3VTUA 3A9KA 4C4VB 5GXGB 1X1MA 1F9JA 3RN9C 4W9CA 5BMIA 1I4RA 2KTFA 1NDDA 2VRRB 1E8XA 5LLIA 2BT6A 1E7UA 4MM3B 1QILA 2L00B 2JWZA 1TZOA 1FNUA 2GBMA 2QC8A 2MEKA 1ZW7A 4G11A 4N6EB 1FEHA 4TQ1A 2INDC 3OWEB 4OVZA 4JE3B 1TS3A 3H9DA 1EU4A 2IY1B 4BKSA 2KD0A 3ZGZA 2DZIA 4HVBA 2C60A 1RRBA 2WLBA 4W9KA 4IW0A 4EEWA 2PMVA 1E5WA 2ASQA 4PK1A 4K7UA 3U30A 3SHQA 4IG7B 2V3SA 3VQIA 2JY6A 1PFDA 2GB1A 2MBHA 1WGRA 1WSPA 3EHVA 4M00A 1L0YB 1YNTE 2N4FA 4HEA1 2XEWA 2CS4A 1KTKA 2KACA 2KC1A 3GE8C 2NPTB 1WRDB 1JCKB 2WXPA 3I63C 4IDIA 5DPTA 3IBEA 3L13A 1YX6B 2V4LA 1M4VA 3JSVA 2AX5A 1P98A 3DVGY 1EUVB 2KX0A 2PVOD 4ZRPA 2H88B 4XX5A 2GMIC 4TUUA 2L83A 2K6QA 3ZUNA 1VCBA 2B76B 4YWGG 3UI3A 2N1VA 4RM9A 5BMHA 3M95A 2WXOA 4QAYA 4W9DA 1T6BX 3DBSA 5AEKB 3PRZA 1P9DU 4OVVA 1V49A 3RZWC 3P1MA 2G45B 3JVZX 1C9FA 2DZMA 3ZIMA 1C3TA 1B1ZA 2GLSA 1YOVB 1MHHE 1XO3A 2BWFA 3OJ3A 2WXGA 4NPNA 1VJKA 2N9LA 3ZNGC 1ET9A 4G0NB 3N9YC 5EE3A 1TJEA 4GDKB 4HKZE 1SE4A 3RFZB 1TS4A 3RNFC 1SF0A 2YEPB 3QWZB 4HPPA 1L6VA 2JRHA 3NS8A 2KX3A 3MHSD 1WE7A 3VH3B 1FXIA 1GAQB 4HROA 3KVFB 1SIFA 1C78A 3JW0X 4EZJA 5JXVA 3VXWA 1SE3A 4Q2JA 1C4AA 2INNE 1WXMA 1QOBA 1EU3A 5CHFA 2PKOA 4HPMB 1FCLA 4MSMB 2JZ3B 2LJ5A 2Z8LA 4S0RA 2NMQA 3TJPA 3AE3B 1K52A 1SB3C 1AN8A 3GOEA 4LCDE 2WWZA 4M8NA 2KMMA 3B2FA 4CQNA 2AQ3B 4NY0A 2JUOA 1PQSA 3EFUA 1V5OA 1FNVA 1WJ6A 1BMLC 2NBWB 4M0WA 1LFDA 2O2VA 4ICVA 1D3ZA 1WXQA 4KSKC 2L1AA 3WALA 4W9GA 1LQBA 4DXGA 2J0KA 2JF5A 1SXTA 1IBXA 2KQ7A 1MI0A 2FIDA 2KOXA 4O1NA 1J7AA 2MLBA 4GIVA 2D3GA 3V3XA 3PRMB 4NJ7A 3C0RB 3BYYB 3BWUD 1GUAB 2BYVE 2L32A 3GE3C 1NVID 2KWCA 2Y3AA 1C77A 2DWQA 2NBVB 1E8YA 3WAPA 3CSFA 3X0WA 1YN5A 3BY4B 2W54A 2KANA 3P4PB 1NYQA 4NAWB 4ZYNA 2CR5A 2RPVA 4WAFA 3T9LA 2Z0DB
chains in the Genus database with same CATH topology
4URKA 3V62A 5DPWA 1UZXB 2I1KA 2MW5A 4HDQA 2KLCA 3AU5A 2FNJB 2FAZA 2Y5BB 3H1UA 3PZDA 3L17A 4G50A 4A3PA 1WFYA 4ICUA 5G2NA 2KJHB 3WA0A 2XK5B 3SDLC 2NBUA 5CHVC 2I1JA 3NZUA 4DXAB 2IO1B 1Q1OA 3N3KB 3B08A 2FCNA 4GSWA 3PGEA 3DQVA 1WIAA 2L0FA 5DCNA 1WZ3A 4AJWA 1NBFC 3M63B 3APCA 2JRIB 2MP2A 3DCGA 4I6NB 1YD8U 3DVNU 1P1AA 2DAJA 2YVCA 1MG8A 2B3AA 4FHKA 3VVWB 1WM2A 2PE9A 4EUTA 1KJTA 3R3MA 2LWPA 2V1YA 4GDLA 3TIXA 1P0RA 2CU1A 4F7ZA 3PHWB 4WJQA 5C1ZA 1Y8RC 3A33B 2IBIB 4DHJB 3JSVB 2GBKA 2GOWA 3QQ8B 4FHJA 2DYOA 3AI5A 2KWUB 3IHPC 4G3XB 4KIKA 1KM7A 2NS5A 4NQLB 1WZ0A 2RGFA 1EF1A 1UBIA 3DOWA 2OOBB 4XZ4A 2MQJA 4I6LB 4FJYA 1J19A 2ZCBA 4I6PA 4PYUA 4CHKA 2ZZPB 1WF9A 2LXCA 3SD5A 4F1SA 2KLGA 3ZLZA 5LXIB 3ML8A 4FLHA 3Q3FA 1UGMA 4ZDVA 4MGKE 2FCQA 3A4SC 1YIWA 2MBBB 4EOYA 4ZRKA 2AL6A 2LD9A 1GG3A 2D10A 1LM8B 2M4NA 1E7VA 1TZ1A 2C7HA 5TR5A 3IVFA 3A1QB 2GBNA 2JXXA 4FULA 5J2RA 2AL3A 2N7DA 4EFOA 4M8MA 5L95C 3QARA 4HPLB 2PPHA 1WGGA 2ZCCA 3TBLD 2WYQA 2NR2A 2MBEA 3DPDA 2ZVNA 4GB9A 3VH4B 2FCSA 2IYDB 1Z5SB 1I42A 1WGYA 4ZRIA 3WAMA 4MDKE 2K25A 2D07B 3HHMA 3NZSA 2N9XA 1GC6A 4BKSD 1WJUA 2DX5B 2K1FA 2Z59B 4PS3A 3U8ZA 3VHTC 1V80A 2G4SA 3D32A 4NQKE 3NHEB 1WJ4A 4HXDA 4IUMB 3DVNV 2IO3B 2GBRA 2XK5A 2EMSA 4WJNA 2HD5B 4AJYB 2KK8A 1IYFA 3PVLA 1XD3B 4IC7B 2A5UA 2KNBA 2L0TA 3NY5A 1WGDA 3QCAA 4MH0E 3ECIA 2NCNA 1LXDA 4MJSB 5GMVA 1RAXA 3RCZA 4ASWC 1E8WA 3V6EB 4BOZB 2LRWA 3V60A 4GDKA 3AULA 1EO6A 2DZJA 2K8BA 4K81A 3RT3B 3L10B 1UH6A 1KLVA 4B9KA 4DHZB 3B1LX 1WX9A 1CMXB 3QHTA 2MRPA 1H8CA 3PRPB 4HWIB 5AZGA 2HTHA 3KH0A 3BINA 4A3OA 1V81A 3A4RA 5IAAC 2RPQA 1OGWA 4DWFA 1E8ZA 3CF6E 4WJPA 1BT0A 3HM3A 4PYZA 3AXCA 3KUCB 4JQWC 4DDGD 4IWOA 2ZEQA 5IA7A 3PLVA 3ZNHB 4NNJB 1J8CA 2KTRA 2D11A 4II2B 2M17A 2K8CA 3K9PB 3QK0A 2MBQA 3LDZE 4DHJD 3PV1A 3ZNZB 3QC8B 4WWNA 3ZDTA 2PJHA 2K39A 4MGYE 2KQSA 1Q5WB 4TQ0A 5EDSA 5KHQA 2O2VB 1ZKHA 3KUZA 2REXA 3VAWA 2C7NB 4IWPA 5HKHA 2LGXA 2KMCA 2L8JA 1XT9B 1R4MI 1WR6E 5G55A 3ALBA 1OQYA 2BF8B 3ZTDA 1V86A 4LDTB 2UYZB 4GOCA 4GN1A 2C7MB 3H7SA 5JH5C 3A1QA 4BBNF 4HCPB 4BKGA 3PLUA 1M94A 1Z2MA 1WY8A 2BWES 3I3TB 3KUDB 3UQAA 2ZJDA 3X23A 2G4DB 2KXJA 4IM3A 2LVPA 4MGZE 4FN2A 1WYWB 3VTUA 2KDEB 3JYUA 2BGFA 3A9KA 3EECA 1X1MA 4B6WA 1F9JA 4E74A 3S2AA 4W9CA 2WX0A 3M62B 1YQBA 2KTFA 1NDDA 2VRRB 3Q3JA 3PSEB 3V6CB 3QX1A 3ZTCA 1E8XA 2KO3A 1OEYA 1UD7A 2BKFA 3GZNI 5LLIA 3RZFA 2R2QA 1E7UA 3QAQA 1V9JA 3UF8A 2L00B 2ZPNA 1FXTB 3MJWA 2JWZA 2W9NA 3TCAA 2Z0EB 2IZVB 2RSUA 2GBMA 4MJSA 1ZGUB 1ZW7A 4G11A 3RYTA 4TV3A 4TQ1A 2HE7A 1V6EA 3W1SC 2DHZA 5DPRA 2LVOA 3QIJA 5CHWA 3QJZA 3H9DA 3VUWA 4W9LA 2KMAA 3RD2A 1S3SG 2IY1B 3L0WB 4BKSA 2KD0A 5D7GA 5E6NA 1WXVA 3DBHI 4IM0A 2KZRA 2QHOA 1RLFA 3WAOA 3WIMA 3ZO5B 2FIFA 3R66C 4W9FA 2PEAA 4NAWA 2WX1A 2DZIA 4HVBA 5KHOA 2YLMA 2C60A 3MTNB 1RRBA 1WJNA 3B0AA 2MP2B 3UQBA 4W9KA 2KJ6A 3L54A 1T0YA 4JGHB 5E6PA 4IW0A 4BKTA 2JVCA 1WMHA 2K6DB 2J0JA 2N1WA 1SGHA 4NJ6A 4EEWA 4RM8A 2D2QA 2MWSB 4B95A 1E5WA 5CTRC 2ASQA 2KVRA 3ZW3A 1IPGA 1GC7A 2MX2A 4K7UA 3U30A 3SHQA 4ANVA 2O6VB 2C9WB 1WE6A 4HDOA 4IG7B 2V3SA 3VQIA 2JY6A 2L7RA 4DDID 2IO0B 2M0XA 3PREA 5JHBA 2MBHA 4F8CB 1WGRA 3UIPB 2L76A 3P2BA 1SE9A 3APDA 3EHVA 2LGYA 2N4FA 1VD2A 4KIKB 2HJ8A 2XEWA 2DENB 4WQOB 2CS4A 2UWQA 3IFWB 4E71A 3A9JB 2N9PC 3VTWA 4P7IA 4WJOA 2KC1A 3V61A 2NPTB 1WRDB 3ZRFA 3K9OB 3DVGX 5C23A 4MELA 4CO7A 5DPTA 3IBEA 4HK2A 3CSTA 3L13A 3N32A 1UBQA 4OVUA 1YX6B 3RULA 1WXSA 2BPSA 2CHXA 4K7SA 2V4LA 3JSVA 4II3B 1P98A 4LDTD 2PE6B 3DVGY 1EUVB 1C1YB 3W1YA 1YX5B 1WM3A 1WXAA 2KX0A 3H6NA 4KZCA 4PS8A 1WX7A 2MCNB 4GMVA 3SU8X 3VDZA 4EZLA 1J0GA 1U4AA 4GU2A 4XX5A 4AUQC 2GMIC 4TUUA 2K6QA 3PTFC 4JIOU 3ZUNA 1VCBA 1WGHA 4FJVB 2LI5A 2M8SA 3ENEA 3HIZA 1QZEA 2LGDA 1JRUA 2JPHA 3R7RA 2N1VA 4LJOB 1XQQA 2ZNVB 4MM3A 2N9EB 3HM6X 4RM9A 2K8HA 2AWTA 3R7QA 4M0WB 3M95A 4MSQB 4N9F4 4W9DA 1GJZA 2ZNVC 4MEMA 3ML9A 4W9IA 3KYDD 3DBSA 2G3QB 4E3CA 5AEKB 3VTVA 3PRZA 1AARA 1P9DU 4X57B 4WWPA 4OVVA 1K8RB 4XC2A 1IP9A 1V49A 3DBRI 3RZWC 3DBLI 2G45B 3JVZX 3PT2B 3WANA 1TGZB 2DZMA 5LXHA 1GNUA 2FCMA 2GBJA 3ZRCA 3ZIMA 1G6JA 1C3TA 2BWFA 3OJ3A 4W9HA 2J0MA 2KHWB 3LJ3A 4HCNB 4AWJA 4DHZE 4NPNA 3N30A 2LZ6A 2DYBA 4EKUA 1L2NA 1HE8A 2FUHB 3ZNID 3ZKJC 4BFRA 4CYEA 3ZNGC 5D94A 4G0NB 5E6OA 2KFKB 2ZVOA 5L83A 2EMTA 4W9JA 4GDKB 1ISNA 4BVUC 3KW5B 2DZKA 4KSLC 4ANUA 2JZZA 2CHZA 1KOTA 1NI2A 3H7PB 3QWZB 3EC8A 2JRHA 2O6VA 3NS8A 2KX3A 2L3ZA 3M3JA 3MHSD 1WE7A 3VH3B 2NVUI 4HLEA 3ONSA 1E90A 4BBNC 3KVFB 2CHWA 1SIFA 2MA9B 1UELA 2AYOB 3KYCD 4GGQA 2CKHB 3JW0X 3RUIB 4EZJA 2KTRB 3VXWA 2O6VD 3TL5A 1WR1A 2BYEA 3A9JA 5AZFA 1WXMA 4JL9A 4J6IA 2KN5A 5CHFA 1R4NI 2IO2B 2NPTA 2ZPYA 4HPMB 2R2OA 2DAFA 2RD0A 3OLMD 5CX3A 1TTNA 4MSMB 2JZ3B 4PS7A 4AOFA 2LJ5A 1S1QB 2KKCA 2M1MA 3ZVVA 4WAAA 4MGIE 5AZHA 5D6JB 3PHXB 3TJPA 2KDFB 3L08A 3APFA 4FA6A 1A5RA 3VFKA 4LJPB 2OJRA 5J18A 3PS6A 3UINB 3GOEA 2WDTB 4LCDE 4JLCA 4KVGB 2WWZA 4M8NA 4K1RB 4AP4C 3CMMB 4NY0A 4IM2A 4GDLB 2JUOA 4RMAA 1PQSA 3EFUA 4EZKA 1V5OA 1TBEA 1WJ6A 3NOBA 4TKNA 2NBWB 2KDBA 3O65B 1LFDA 2A4ZA 2O2VA 4BOSC 5JHAA 4WWOA 2DYMA 4KV2A 3A9KB 4A20A 2J7QB 5JZEB 1WH3A 1EF5A 2BKRB 4ICVA 5D2MB 1D3ZA 2KC2A 4KSKC 3TMPB 5BO4B 3QA8A 1RFAA 2L05A 3WALA 2N7EA 4DBGA 2KFJA 3OAWA 4W9GA 1LQBA 2J0KA 2JF5A 2LXAA 4ZRJA 3VUXA 3L16A 2KQ7A 4HJKA 2FIDA 2KDIA 2BYFA 2KOXA 3DDCB 2C5LC 2MLBA 4GIVA 2D3GA 4GXBA 4FBJB 1Q0WB 2LRUA 1OTRB 2KWVB 4ANXA 2EKEC 3PRMB 2LASA 4NJ7A 2IY0B 4KDLB 1L7YA 4K7WA 2XBBC 3ZDMC 3C0RB 3PPAA 2KJRA 1GUAB 2AEHA 2BYVE 2KFKA 3AU4A 4YL8A 3UGBB 5J17A 2JT4B 3HK0A 5DPSA 3VUYA 2KWCA 4KDIC 1H4RA 4KZ0A 1V2YA 2RR9A 1V5TA 2MBOA 2NBVB 3H7PA 3IG3A 4FJZA 3T8MA 1WI0A 1E8YA 2LUEA 2LVQA 3CSFA 3WAPA 3X0WA 1P3QU 1YJ1A 3BY4B 3UIOB 5FR6A 4ANWA 4DK5A 2MSED 4FADA 2KANA 4IWQA 1WX8A 4NAWB 4ZYNA 1I35A 2CR5A 4W9EA 3OJ4B 3T9LA 3W1SA 1OEYJ 1WMHB 2Z0DB 3U7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4URK A;  3V62 A;  5DPW A;  1UZX B;  2I1K A;  2MW5 A;  4HDQ A;  2KLC A;  3AU5 A;  2FNJ B;  2FAZ A;  2Y5B B;  3H1U A;  3PZD A;  3L17 A;  4G50 A;  4A3P A;  1WFY A;  4ICU A;  5G2N A;  2KJH B;  3WA0 A;  2XK5 B;  3SDL C;  2NBU A;  5CHV C;  2I1J A;  3NZU A;  4DXA B;  2IO1 B;  1Q1O A;  3N3K B;  3B08 A;  2FCN A;  4GSW A;  3PGE A;  3DQV A;  1WIA A;  2L0F A;  5DCN A;  1WZ3 A;  4AJW A;  1NBF C;  3M63 B;  3APC A;  2JRI B;  2MP2 A;  3DCG A;  4I6N B;  1YD8 U;  3DVN U;  1P1A A;  2DAJ A;  2YVC A;  1MG8 A;  2B3A A;  4FHK A;  3VVW B;  1WM2 A;  2PE9 A;  4EUT A;  1KJT A;  3R3M A;  2LWP A;  2V1Y A;  4GDL A;  3TIX A;  1P0R A;  2CU1 A;  4F7Z A;  3PHW B;  4WJQ A;  5C1Z A;  1Y8R C;  3A33 B;  2IBI B;  4DHJ B;  3JSV B;  2GBK A;  2GOW A;  3QQ8 B;  4FHJ A;  2DYO A;  3AI5 A;  2KWU B;  3IHP C;  4G3X B;  4KIK A;  1KM7 A;  2NS5 A;  4NQL B;  1WZ0 A;  2RGF A;  1EF1 A;  1UBI A;  3DOW A;  2OOB B;  4XZ4 A;  2MQJ A;  4I6L B;  4FJY A;  1J19 A;  2ZCB A;  4I6P A;  4PYU A;  4CHK A;  2ZZP B;  1WF9 A;  2LXC A;  3SD5 A;  4F1S A;  2KLG A;  3ZLZ A;  5LXI B;  3ML8 A;  4FLH A;  3Q3F A;  1UGM A;  4ZDV A;  4MGK E;  2FCQ A;  3A4S C;  1YIW A;  2MBB B;  4EOY A;  4ZRK A;  2AL6 A;  2LD9 A;  1GG3 A;  2D10 A;  1LM8 B;  2M4N A;  1E7V A;  1TZ1 A;  2C7H A;  5TR5 A;  3IVF A;  3A1Q B;  2GBN A;  2JXX A;  4FUL A;  5J2R A;  2AL3 A;  2N7D A;  4EFO A;  4M8M A;  5L95 C;  3QAR A;  4HPL B;  2PPH A;  1WGG A;  2ZCC A;  3TBL D;  2WYQ A;  2NR2 A;  2MBE A;  3DPD A;  2ZVN A;  4GB9 A;  3VH4 B;  2FCS A;  2IYD B;  1Z5S B;  1I42 A;  1WGY A;  4ZRI A;  3WAM A;  4MDK E;  2K25 A;  2D07 B;  3HHM A;  3NZS A;  2N9X A;  1GC6 A;  4BKS D;  1WJU A;  2DX5 B;  2K1F A;  2Z59 B;  4PS3 A;  3U8Z A;  3VHT C;  1V80 A;  2G4S A;  3D32 A;  4NQK E;  3NHE B;  1WJ4 A;  4HXD A;  4IUM B;  3DVN V;  2IO3 B;  2GBR A;  2XK5 A;  2EMS A;  4WJN A;  2HD5 B;  4AJY B;  2KK8 A;  1IYF A;  3PVL A;  1XD3 B;  4IC7 B;  2A5U A;  2KNB A;  2L0T A;  3NY5 A;  1WGD A;  3QCA A;  4MH0 E;  3ECI A;  2NCN A;  1LXD A;  4MJS B;  5GMV A;  1RAX A;  3RCZ A;  4ASW C;  1E8W A;  3V6E B;  4BOZ B;  2LRW A;  3V60 A;  4GDK A;  3AUL A;  1EO6 A;  2DZJ A;  2K8B A;  4K81 A;  3RT3 B;  3L10 B;  1UH6 A;  1KLV A;  4B9K A;  4DHZ B;  3B1L X;  1WX9 A;  1CMX B;  3QHT A;  2MRP A;  1H8C A;  3PRP B;  4HWI B;  5AZG A;  2HTH A;  3KH0 A;  3BIN A;  4A3O A;  1V81 A;  3A4R A;  5IAA C;  2RPQ A;  1OGW A;  4DWF A;  1E8Z A;  3CF6 E;  4WJP A;  1BT0 A;  3HM3 A;  4PYZ A;  3AXC A;  3KUC B;  4JQW C;  4DDG D;  4IWO A;  2ZEQ A;  5IA7 A;  3PLV A;  3ZNH B;  4NNJ B;  1J8C A;  2KTR A;  2D11 A;  4II2 B;  2M17 A;  2K8C A;  3K9P B;  3QK0 A;  2MBQ A;  3LDZ E;  4DHJ D;  3PV1 A;  3ZNZ B;  3QC8 B;  4WWN A;  3ZDT A;  2PJH A;  2K39 A;  4MGY E;  2KQS A;  1Q5W B;  4TQ0 A;  5EDS A;  5KHQ A;  2O2V B;  1ZKH A;  3KUZ A;  2REX A;  3VAW A;  2C7N B;  4IWP A;  5HKH A;  2LGX A;  2KMC A;  2L8J A;  1XT9 B;  1R4M I;  1WR6 E;  5G55 A;  3ALB A;  1OQY A;  2BF8 B;  3ZTD A;  1V86 A;  4LDT B;  2UYZ B;  4GOC A;  4GN1 A;  2C7M B;  3H7S A;  5JH5 C;  3A1Q A;  4BBN F;  4HCP B;  4BKG A;  3PLU A;  1M94 A;  1Z2M A;  1WY8 A;  2BWE S;  3I3T B;  3KUD B;  3UQA A;  2ZJD A;  3X23 A;  2G4D B;  2KXJ A;  4IM3 A;  2LVP A;  4MGZ E;  4FN2 A;  1WYW B;  3VTU A;  2KDE B;  3JYU A;  2BGF A;  3A9K A;  3EEC A;  1X1M A;  4B6W A;  1F9J A;  4E74 A;  3S2A A;  4W9C A;  2WX0 A;  3M62 B;  1YQB A;  2KTF A;  1NDD A;  2VRR B;  3Q3J A;  3PSE B;  3V6C B;  3QX1 A;  3ZTC A;  1E8X A;  2KO3 A;  1OEY A;  1UD7 A;  2BKF A;  3GZN I;  5LLI A;  3RZF A;  2R2Q A;  1E7U A;  3QAQ A;  1V9J A;  3UF8 A;  2L00 B;  2ZPN A;  1FXT B;  3MJW A;  2JWZ A;  2W9N A;  3TCA A;  2Z0E B;  2IZV B;  2RSU A;  2GBM A;  4MJS A;  1ZGU B;  1ZW7 A;  4G11 A;  3RYT A;  4TV3 A;  4TQ1 A;  2HE7 A;  1V6E A;  3W1S C;  2DHZ A;  5DPR A;  2LVO A;  3QIJ A;  5CHW A;  3QJZ A;  3H9D A;  3VUW A;  4W9L A;  2KMA A;  3RD2 A;  1S3S G;  2IY1 B;  3L0W B;  4BKS A;  2KD0 A;  5D7G A;  5E6N A;  1WXV A;  3DBH I;  4IM0 A;  2KZR A;  2QHO A;  1RLF A;  3WAO A;  3WIM A;  3ZO5 B;  2FIF A;  3R66 C;  4W9F A;  2PEA A;  4NAW A;  2WX1 A;  2DZI A;  4HVB A;  5KHO A;  2YLM A;  2C60 A;  3MTN B;  1RRB A;  1WJN A;  3B0A A;  2MP2 B;  3UQB A;  4W9K A;  2KJ6 A;  3L54 A;  1T0Y A;  4JGH B;  5E6P A;  4IW0 A;  4BKT A;  2JVC A;  1WMH A;  2K6D B;  2J0J A;  2N1W A;  1SGH A;  4NJ6 A;  4EEW A;  4RM8 A;  2D2Q A;  2MWS B;  4B95 A;  1E5W A;  5CTR C;  2ASQ A;  2KVR A;  3ZW3 A;  1IPG A;  1GC7 A;  2MX2 A;  4K7U A;  3U30 A;  3SHQ A;  4ANV A;  2O6V B;  2C9W B;  1WE6 A;  4HDO A;  4IG7 B;  2V3S A;  3VQI A;  2JY6 A;  2L7R A;  4DDI D;  2IO0 B;  2M0X A;  3PRE A;  5JHB A;  2MBH A;  4F8C B;  1WGR A;  3UIP B;  2L76 A;  3P2B A;  1SE9 A;  3APD A;  3EHV A;  2LGY A;  2N4F A;  1VD2 A;  4KIK B;  2HJ8 A;  2XEW A;  2DEN B;  4WQO B;  2CS4 A;  2UWQ A;  3IFW B;  4E71 A;  3A9J B;  2N9P C;  3VTW A;  4P7I A;  4WJO A;  2KC1 A;  3V61 A;  2NPT B;  1WRD B;  3ZRF A;  3K9O B;  3DVG X;  5C23 A;  4MEL A;  4CO7 A;  5DPT A;  3IBE A;  4HK2 A;  3CST A;  3L13 A;  3N32 A;  1UBQ A;  4OVU A;  1YX6 B;  3RUL A;  1WXS A;  2BPS A;  2CHX A;  4K7S A;  2V4L A;  3JSV A;  4II3 B;  1P98 A;  4LDT D;  2PE6 B;  3DVG Y;  1EUV B;  1C1Y B;  3W1Y A;  1YX5 B;  1WM3 A;  1WXA A;  2KX0 A;  3H6N A;  4KZC A;  4PS8 A;  1WX7 A;  2MCN B;  4GMV A;  3SU8 X;  3VDZ A;  4EZL A;  1J0G A;  1U4A A;  4GU2 A;  4XX5 A;  4AUQ C;  2GMI C;  4TUU A;  2K6Q A;  3PTF C;  4JIO U;  3ZUN A;  1VCB A;  1WGH A;  4FJV B;  2LI5 A;  2M8S A;  3ENE A;  3HIZ A;  1QZE A;  2LGD A;  1JRU A;  2JPH A;  3R7R A;  2N1V A;  4LJO B;  1XQQ A;  2ZNV B;  4MM3 A;  2N9E B;  3HM6 X;  4RM9 A;  2K8H A;  2AWT A;  3R7Q A;  4M0W B;  3M95 A;  4MSQ B;  4N9F 4;  4W9D A;  1GJZ A;  2ZNV C;  4MEM A;  3ML9 A;  4W9I A;  3KYD D;  3DBS A;  2G3Q B;  4E3C A;  5AEK B;  3VTV A;  3PRZ A;  1AAR A;  1P9D U;  4X57 B;  4WWP A;  4OVV A;  1K8R B;  4XC2 A;  1IP9 A;  1V49 A;  3DBR I;  3RZW C;  3DBL I;  2G45 B;  3JVZ X;  3PT2 B;  3WAN A;  1TGZ B;  2DZM A;  5LXH A;  1GNU A;  2FCM A;  2GBJ A;  3ZRC A;  3ZIM A;  1G6J A;  1C3T A;  2BWF A;  3OJ3 A;  4W9H A;  2J0M A;  2KHW B;  3LJ3 A;  4HCN B;  4AWJ A;  4DHZ E;  4NPN A;  3N30 A;  2LZ6 A;  2DYB A;  4EKU A;  1L2N A;  1HE8 A;  2FUH B;  3ZNI D;  3ZKJ C;  4BFR A;  4CYE A;  3ZNG C;  5D94 A;  4G0N B;  5E6O A;  2KFK B;  2ZVO A;  5L83 A;  2EMT A;  4W9J A;  4GDK B;  1ISN A;  4BVU C;  3KW5 B;  2DZK A;  4KSL C;  4ANU A;  2JZZ A;  2CHZ A;  1KOT A;  1NI2 A;  3H7P B;  3QWZ B;  3EC8 A;  2JRH A;  2O6V A;  3NS8 A;  2KX3 A;  2L3Z A;  3M3J A;  3MHS D;  1WE7 A;  3VH3 B;  2NVU I;  4HLE A;  3ONS A;  1E90 A;  4BBN C;  3KVF B;  2CHW A;  1SIF A;  2MA9 B;  1UEL A;  2AYO B;  3KYC D;  4GGQ A;  2CKH B;  3JW0 X;  3RUI B;  4EZJ A;  2KTR B;  3VXW A;  2O6V D;  3TL5 A;  1WR1 A;  2BYE A;  3A9J A;  5AZF A;  1WXM A;  4JL9 A;  4J6I A;  2KN5 A;  5CHF A;  1R4N I;  2IO2 B;  2NPT A;  2ZPY A;  4HPM B;  2R2O A;  2DAF A;  2RD0 A;  3OLM D;  5CX3 A;  1TTN A;  4MSM B;  2JZ3 B;  4PS7 A;  4AOF A;  2LJ5 A;  1S1Q B;  2KKC A;  2M1M A;  3ZVV A;  4WAA A;  4MGI E;  5AZH A;  5D6J B;  3PHX B;  3TJP A;  2KDF B;  3L08 A;  3APF A;  4FA6 A;  1A5R A;  3VFK A;  4LJP B;  2OJR A;  5J18 A;  3PS6 A;  3UIN B;  3GOE A;  2WDT B;  4LCD E;  4JLC A;  4KVG B;  2WWZ A;  4M8N A;  4K1R B;  4AP4 C;  3CMM B;  4NY0 A;  4IM2 A;  4GDL B;  2JUO A;  4RMA A;  1PQS A;  3EFU A;  4EZK A;  1V5O A;  1TBE A;  1WJ6 A;  3NOB A;  4TKN A;  2NBW B;  2KDB A;  3O65 B;  1LFD A;  2A4Z A;  2O2V A;  4BOS C;  5JHA A;  4WWO A;  2DYM A;  4KV2 A;  3A9K B;  4A20 A;  2J7Q B;  5JZE B;  1WH3 A;  1EF5 A;  2BKR B;  4ICV A;  5D2M B;  1D3Z A;  2KC2 A;  4KSK C;  3TMP B;  5BO4 B;  3QA8 A;  1RFA A;  2L05 A;  3WAL A;  2N7E A;  4DBG A;  2KFJ A;  3OAW A;  4W9G A;  1LQB A;  2J0K A;  2JF5 A;  2LXA A;  4ZRJ A;  3VUX A;  3L16 A;  2KQ7 A;  4HJK A;  2FID A;  2KDI A;  2BYF A;  2KOX A;  3DDC B;  2C5L C;  2MLB A;  4GIV A;  2D3G A;  4GXB A;  4FBJ B;  1Q0W B;  2LRU A;  1OTR B;  2KWV B;  4ANX A;  2EKE C;  3PRM B;  2LAS A;  4NJ7 A;  2IY0 B;  4KDL B;  1L7Y A;  4K7W A;  2XBB C;  3ZDM C;  3C0R B;  3PPA A;  2KJR A;  1GUA B;  2AEH A;  2BYV E;  2KFK A;  3AU4 A;  4YL8 A;  3UGB B;  5J17 A;  2JT4 B;  3HK0 A;  5DPS A;  3VUY A;  2KWC A;  4KDI C;  1H4R A;  4KZ0 A;  1V2Y A;  2RR9 A;  1V5T A;  2MBO A;  2NBV B;  3H7P A;  3IG3 A;  4FJZ A;  3T8M A;  1WI0 A;  1E8Y A;  2LUE A;  2LVQ A;  3CSF A;  3WAP A;  3X0W A;  1P3Q U;  1YJ1 A;  3BY4 B;  3UIO B;  5FR6 A;  4ANW A;  4DK5 A;  2MSE D;  4FAD A;  2KAN A;  4IWQ A;  1WX8 A;  4NAW B;  4ZYN A;  1I35 A;  2CR5 A;  4W9E A;  3OJ4 B;  3T9L A;  3W1S A;  1OEY J;  1WMH B;  2Z0D B;  3U7D A; 
#chains in the Genus database with same CATH topology
 2DNF A;  3VRA B;  1UZX B;  5TSS A;  1ROE A;  2FAZ A;  3PZD A;  4A3P A;  1LO5 D;  4ICU A;  2BTE A;  5CHV C;  2I1J A;  1Q1O A;  3W5U B;  1TKY A;  5C3J B;  2BB5 A;  1I7H A;  4AJW A;  3M63 B;  2JRI B;  2WU2 B;  4I6N B;  3DVN U;  2DAJ A;  1L4D B;  1LGR A;  1WM2 A;  2DLB A;  1HZ5 A;  4EUT A;  1KJT A;  2V0G A;  3R3M A;  2LWP A;  3IXS A;  4GDL A;  3TIX A;  2CU1 A;  3PHW B;  3LB8 C;  1IGD A;  1PUT A;  4L2Y A;  1HA5 A;  2DYO A;  3GB1 A;  3AI5 A;  1V1O A;  1CJE A;  2L52 A;  2VZK D;  4KIK A;  2NS5 A;  2V4I B;  3N1Z C;  2OOB B;  2MQJ A;  4FJY A;  2WS3 B;  2ZZP B;  3ZLZ A;  3P42 A;  4FLH A;  2N7J A;  4R3D A;  4ZDV A;  2JSV X;  4MGK E;  2ZW0 A;  2WDQ B;  2BYT A;  1YIW A;  3NG0 A;  2MBB B;  4EOY A;  3W2D A;  3N1X C;  2D10 A;  2C7H A;  2GBN A;  2N7D A;  3Q6B A;  1DOY A;  3NVZ A;  1GPX A;  4N59 A;  1T3Q A;  2ZCC A;  4GB9 A;  2WYQ A;  2OHF A;  2IYD B;  1WGK A;  3VR8 B;  4JPS A;  5HFY A;  5IP4 D;  2K25 A;  2D07 B;  3HHM A;  3EGR A;  4BKS D;  1CK1 A;  2W3S A;  2Z59 B;  1DYQ A;  3U8Z A;  3VHT C;  1WJ4 A;  4HXD A;  3TUO A;  2IO3 B;  2XK5 A;  4M02 A;  2GI9 A;  3SFD B;  3MC0 B;  4AJY B;  3NY5 A;  1WGD A;  2CU3 A;  4AQ7 A;  3MC9 A;  4ASW C;  1E8W A;  3IAS 1;  4P6V F;  3V60 A;  3AUL A;  1EO6 A;  2DZJ A;  2K8B A;  3B2G A;  3RT3 B;  3ZJU A;  3B1L X;  1C79 A;  4ARI A;  4HWI B;  5D3I B;  3BIN A;  4DWF A;  1ET6 A;  1OGW A;  3CF6 E;  4PYZ A;  1ZXH A;  3AXC A;  5IA7 A;  3BVG A;  3ZNH B;  1J8C A;  1T0Q C;  4YTN B;  2MBQ A;  4DHJ D;  2V9H A;  1NEK B;  2M19 A;  3ZDT A;  3IT4 B;  5EDS A;  5D3D A;  3KUZ A;  2REX A;  1TKE A;  3VAW A;  3Q8A A;  4C00 A;  2L8J A;  1R4M I;  5G55 A;  2YEP F;  2J52 A;  1V86 A;  2UYZ B;  2JU6 X;  2C7M B;  4A6Q A;  3A1Q A;  4B0M A;  4HCP B;  4BKG A;  2BWE S;  3I3T B;  1Y56 A;  1ESF A;  1JAL A;  4JWS C;  1IGC A;  1WYW B;  1NEN B;  2AQ2 B;  2BGF A;  5BYR A;  4ARC A;  1JWB D;  3PSE B;  3ZTC A;  4MAC A;  2BKF A;  3RZF A;  2R2Q A;  1MG4 A;  3QAQ A;  4XDC A;  3MJW A;  1XXG A;  2Z0E B;  3AE1 B;  4OZC A;  4MJS A;  1ZGU B;  3RYT A;  4US8 A;  4TV3 A;  2BW2 A;  2X38 A;  1KH0 A;  1V6E A;  2OED A;  2LVO A;  3QJZ A;  1XEE A;  5D7G A;  1T0R C;  2QMT A;  1FM0 D;  4XE0 A;  2QHO A;  3WIM A;  2LUM A;  4XWW A;  3P4Q B;  4KGT A;  1R4M B;  2MP2 B;  2WHI A;  3EUB 2;  2KJ6 A;  1T0Y A;  3E9S A;  2JVC A;  1WMH A;  2J0J A;  2N1W A;  4KKI A;  2WXL A;  2D2Q A;  5CTR C;  2MX2 A;  1XCT L;  3ZJT A;  3I9V 1;  2C9W B;  1WE6 A;  1I4P A;  2K9X A;  3PRE A;  3UIP B;  2L76 A;  2J42 A;  1SE9 A;  3J9C A;  2HJ8 A;  4E71 A;  3IFW B;  3A9J B;  3AEF B;  3VTW A;  1KLU D;  4P7I A;  3V61 A;  3ZRF A;  3DVG X;  4MEL A;  3V05 A;  1T5X D;  1WXS A;  2BPS A;  4II3 B;  2PE6 B;  4B0E A;  1C1Y B;  5HG2 A;  5HHD G;  4PT5 A;  3W1Y A;  1WM3 A;  4C4V A;  3SU8 X;  1HXY D;  2BBC A;  1U4A A;  4GU2 A;  3RNG C;  2IPK D;  3U2S C;  3PTF C;  4IOI E;  1WGH A;  2LI5 A;  2M8S A;  1JRU A;  1I4H A;  4TSS A;  2JPH A;  3BII D;  3V6C B;  4MM3 A;  4MSQ B;  4N9F 4;  3ML9 A;  1AAR A;  1K8R B;  2IGD A;  4GLS C;  2GBJ A;  2AQ1 B;  3BZD B;  3WCQ A;  2IDY A;  2LFI A;  5H92 C;  3U4E G;  3ZJV A;  2DYB A;  1FD6 A;  1HE8 A;  1TKG A;  1MPE A;  3ZKJ C;  2KT7 A;  5LNK 1;  5E6O A;  3KW5 B;  2DZK A;  4ANU A;  1KOT A;  2CHZ A;  2CJN A;  4YSX B;  4HKQ A;  1SE2 A;  3DWM A;  3HVZ A;  1DOX A;  4US9 A;  3M3J A;  3ONS A;  1SBB B;  3Q8B A;  1E90 A;  1AYF A;  3URY A;  1UEL A;  3HVD A;  2AYO B;  3T3O A;  3RUI B;  2WXF A;  2O6V D;  2BYE A;  5EE9 A;  3DHG C;  3MHZ A;  4JL9 A;  3SEB A;  1R4N I;  2IO2 B;  2NPT A;  1XCQ L;  2R2O A;  1TTN A;  4PS7 A;  3ZVV A;  1K53 A;  2JWU A;  2INC C;  4MGI E;  5AZH A;  2KDF B;  3APF A;  4YXD B;  3PS6 A;  3UIN B;  3P4S B;  2WDT B;  2WQY B;  4IM2 A;  4ZRQ A;  2VZK B;  4EZK A;  1K50 A;  4LNF A;  1MFW A;  1TBE A;  3KWV A;  4TKN A;  1P7F A;  2A4Z A;  4WWO A;  2DYM A;  4KV2 A;  3A9K B;  2W55 A;  2J7Q B;  1EF5 A;  2BKR B;  5H8Y E;  2G9H D;  3TMP B;  3QA8 A;  1RFA A;  2L05 A;  2N7E A;  4S17 A;  2K3U A;  5E6J A;  4HJK A;  2KDI A;  3DDC B;  2C5L C;  2BB6 A;  4GXB A;  2KWV B;  4ANX A;  3NJT A;  3AEA B;  2M56 B;  2LJI A;  3ZYY X;  3MFG A;  3PPA A;  2AEH A;  4YL8 A;  1MHX A;  3VUY A;  4KDI C;  1V2Y A;  1R4N B;  2MBO A;  3IG3 A;  3T8M A;  1WI0 A;  2LUE A;  5FR6 A;  1VZ8 A;  1I35 A;  3KWL A;  4W9E A;  2X8X X;  3W1S A;  2E6X A;  4RNA A;  4URK A;  2I1K A;  2KLC A;  1N62 A;  2EKI A;  2FNJ B;  3KLS X;  1WFY A;  3SDL C;  2NBU A;  3NZU A;  2NTS A;  4YTP B;  1YN4 A;  3DQV A;  4KX6 B;  1ZXI A;  4WIP A;  1ZUD 2;  2QSD A;  3AB5 A;  3APC A;  3DCG A;  2MHJ A;  1YD8 U;  1P1A A;  2FBW B;  2YVC A;  1E7P B;  3VVW B;  1MJD A;  2V1Y A;  2PIA A;  4DHJ B;  3JSV B;  2GOW A;  3QQ8 B;  4FHJ A;  2RDG A;  2RMM A;  3AE8 B;  2KWU B;  3IHP C;  4G3X B;  4NQL B;  1YJJ A;  2RGF A;  4XZ4 A;  1STE A;  4I6P A;  1WF9 A;  2LXC A;  3RNB C;  4F1S A;  5LXI B;  3ML8 A;  3GS2 A;  2ONQ A;  1BXT A;  3A4S C;  2AL6 A;  4RGN A;  5T8I A;  1TZ1 A;  2AL3 A;  2RDB C;  1WGG A;  2BS3 B;  2WGS A;  1QLB B;  1JRP A;  1WGY A;  4ZRI A;  3WAM A;  4MDK E;  3RI7 C;  1GC6 A;  1WJU A;  1HTQ A;  4MH8 A;  1V80 A;  2G4S A;  3BYT B;  2GBR A;  4WJN A;  2HD5 B;  1OQQ A;  2KK8 A;  4K3C A;  3PVL A;  1XD3 B;  2QDF A;  3QCA A;  4MH0 E;  1PYW D;  2V3P A;  3ECI A;  2NCN A;  1E0Z A;  1F0Z A;  1SIJ A;  3V6E B;  1ACC A;  1IUE A;  3L10 B;  4REZ A;  1KLV A;  4B9K A;  4DHZ B;  3AEE B;  1WX9 A;  2G1E A;  3QHT A;  1HTO A;  1UNS A;  3KH0 A;  4A3O A;  5IAA C;  2VH1 A;  4N58 A;  1E8Z A;  1N61 A;  2K5P A;  2ACZ B;  4H2A A;  3KUC B;  4JQW C;  4WUR A;  2KTR A;  4II2 B;  3W5V B;  2M17 A;  3QK0 A;  2WDV B;  4RF1 A;  1N63 A;  4KKJ A;  1Q5W B;  2LEK A;  3IT6 B;  4TQ0 A;  2KAJ A;  1C76 A;  2O2V B;  1RWS A;  3TSS A;  4ZYS A;  1T0S C;  3O13 A;  3C8Y A;  1WR6 E;  2LHD A;  3AH7 A;  4GOC A;  3H7S A;  3NVW A;  1IBX B;  3PLU A;  1WY8 A;  3UQA A;  3FC4 A;  3R2T A;  2QCZ A;  2D5G A;  3BK2 A;  2HDE A;  1TS5 A;  1N60 A;  1JW9 D;  3EEC A;  4RH6 A;  4HRS A;  3S2A A;  2WX0 A;  3M62 B;  1FXA A;  3Q3J A;  3QX1 A;  2KO3 A;  2KYW A;  1VZ7 A;  2RDH A;  1N6Z A;  1FXT B;  4YT0 B;  2W9N A;  3TCA A;  2IZV B;  4LNK A;  2RSU A;  4DXF A;  1XLN A;  1MVK A;  4P1C C;  2HE7 A;  3W1S C;  2DHZ A;  5DPR A;  3FIL A;  5HI1 A;  2EEL A;  3T3N A;  4W9L A;  1PGB A;  3RD2 A;  1S3S G;  3L0W B;  2J4X A;  4M01 A;  3RMK C;  5E6N A;  3DBH I;  3ZO5 B;  4IM0 A;  3WAO A;  2BVC A;  3R66 C;  2WX1 A;  5KHO A;  2YLM A;  3MTN B;  3UQB A;  3L54 A;  4JGH B;  1HZ6 A;  5E6P A;  3U7Z A;  4C7Y A;  3L4P A;  1SGH A;  4NJ6 A;  4RM8 A;  3Q8E A;  4B95 A;  2KVR A;  1GC7 A;  4ANV A;  2O6V B;  4HDO A;  1D5X C;  1TY0 A;  1JWA D;  2M0X A;  4F8C B;  2H89 B;  1DGJ A;  2LGY A;  1VD2 A;  2K22 A;  4KIK B;  1GB1 A;  1BUI C;  2UWQ A;  3AM9 A;  1SJH D;  1FIQ A;  2KQ4 X;  3K9O B;  4CO7 A;  4HK2 A;  3CST A;  3RUL A;  3SFE B;  1YX5 B;  1WXA A;  4KZC A;  2MCN B;  1V1P B;  4GMV A;  3VDZ A;  4EZL A;  3Q69 A;  4FJV B;  2JQR B;  3DBH B;  3ENE A;  1QZE A;  4C7Z A;  1XQQ A;  2AWT A;  4LTU A;  1GJZ A;  2ZNV C;  4MEM A;  1F1H A;  4KGR A;  4W9I A;  2G3Q B;  4E3C A;  3AEG B;  4WWP A;  3Q2A C;  3Q3O C;  3NRZ A;  1TGZ B;  5LXH A;  1NYR A;  2FCM A;  3ZRC A;  4YTM B;  3LJ3 A;  4DHZ E;  2BQQ A;  3N30 A;  4EKU A;  2FUH B;  3BK1 A;  4EE2 A;  4OZA A;  1EWC A;  4BFR A;  4YSY B;  2SAK A;  5D94 A;  2LHE A;  2N0S B;  2KFK B;  2WXN A;  2EMT A;  4W9J A;  2QIL A;  4KSL C;  4P16 A;  2WDR B;  3H7P B;  2UU7 A;  5I4D A;  2WXI A;  3RNC C;  1ZDV A;  4BBN C;  1FRD A;  2I38 A;  4GGQ A;  3ABV B;  3AE2 B;  3A9J A;  1KRH A;  2KN5 A;  3EFC A;  3TEZ A;  3P63 A;  2ZPY A;  5CX3 A;  2RD0 A;  4AOF A;  4KGS A;  1S1Q B;  2KKC A;  2XN9 C;  1WWT A;  2IJ0 A;  5D6J B;  3L08 A;  4FA6 A;  3VFK A;  2MJE A;  1VLB A;  4JLC A;  4KVG B;  5EE0 A;  1L5P A;  1VDV A;  4AP4 C;  3CMM B;  4C56 C;  3N20 C;  1J7B A;  2PVG C;  3KQ4 A;  1UWX A;  2KDB A;  3O65 B;  4A90 A;  2K0P A;  4BZA A;  5MPO A;  5JZE B;  3I5J C;  2KC2 A;  5BO4 B;  4DBG A;  1JWM D;  2PW9 A;  2LXA A;  3L16 A;  2KN4 A;  3MC8 A;  1VR9 A;  2BYF A;  4NJC A;  2LRU A;  3Q8C A;  1OTR B;  2EKE C;  4USA A;  2IY0 B;  4KDL B;  1ZE3 D;  4K7W A;  2XBB C;  2JZP A;  2R61 A;  3PO0 A;  5J17 A;  4XGA B;  3UGB B;  2JT4 B;  3HK0 A;  5DPS A;  1H4R A;  4XWT A;  1C4C A;  4UDU C;  4FJZ A;  2LVQ A;  1YJ1 A;  4DK5 A;  3UIO B;  4FAD A;  4IWQ A;  1WX8 A;  1OEY J;  1WMH B;  1A70 A;  3P4R B;  1OQR A;  2MW5 A;  1UWM A;  3H1U A;  4G50 A;  3N1Y C;  4DXA B;  3IAM 1;  2IO1 B;  1B9R A;  2HJ1 A;  2FCN A;  3B08 A;  3PGE A;  2L0F A;  5DCN A;  1WZ3 A;  1NBF C;  2TSS A;  3AE4 B;  3AN1 A;  2CJO A;  3E56 A;  1MG8 A;  2B3A A;  3Q8F A;  4RFB A;  4FHK A;  1L0V B;  1I4X A;  1F52 A;  1P0R A;  2XNA C;  1I4Q A;  4WJQ A;  1F77 A;  4OW0 A;  5C1Z A;  3A33 B;  2IBI B;  1AWD A;  2WXK A;  2IGG A;  1UGJ A;  3MJ5 A;  4ACF A;  3DOW A;  2MH7 A;  1PGX A;  2JYE A;  1J19 A;  1F2R C;  1TIF A;  3SD5 A;  1WYG A;  3Q3F A;  1UGM A;  2FCQ A;  3HUI A;  1GG3 A;  4HJG E;  1ZDX A;  2M4N A;  5TR5 A;  4FUL A;  5J2R A;  4K3B A;  4M8M A;  5L95 C;  3QAR A;  4HPL B;  3TBL D;  1E6E B;  2MBE A;  2NR2 A;  3DPD A;  3VH4 B;  1KFY B;  3VR9 B;  1JML A;  1I42 A;  3AEB B;  4XYC A;  3RPF C;  1QT9 A;  2DX5 B;  1CZP A;  2K1F A;  2M0A A;  3LYY A;  4PS3 A;  4NQK E;  4IUM B;  3DVN V;  1AW7 A;  4LLG M;  2EMS A;  1IYF A;  4IC7 B;  2L0T A;  2KNB A;  4L23 A;  1LXD A;  3LXF A;  5GMV A;  3RCZ A;  2Y5P A;  1PGA A;  4JWU C;  4BOZ B;  4GDK A;  3NUH B;  2QIE B;  4ITK A;  1KLG D;  2ICI A;  1N5W A;  2SEB D;  3PRP B;  5G5G A;  3NVY A;  3A4R A;  4WJP A;  4MT5 A;  2JXT A;  1XLO A;  4DDG D;  1XF5 L;  3NS1 A;  4ZOH C;  2WXJ A;  4WWN A;  1QQR A;  4C80 A;  2PJH A;  3TEY A;  2K39 A;  4MGY E;  4LNO A;  5KHQ A;  1QKZ A;  2C7N B;  2KDM A;  4IWP A;  2LGX A;  5HKH A;  1XT9 B;  3TEW A;  2W3R A;  3ZTD A;  2MJ3 A;  1SJE D;  2N9K A;  3NZ3 A;  1YQ3 B;  1RFK A;  3AE6 B;  3KUD B;  4FN2 A;  2HTM E;  3B9J A;  2KDE B;  5IOI A;  3JYU A;  1J7C A;  2WNM A;  4B6W A;  4E74 A;  1L0X B;  1YQB A;  1OEY A;  1UD7 A;  3GZN I;  2QEJ C;  3UF8 A;  1V9J A;  2ZPN A;  3DHH C;  4YSZ B;  4OHJ A;  2BS4 B;  4RGO S;  1TT5 B;  3QIJ A;  5CHW A;  4LNI A;  3VUW A;  3FKY A;  3C19 A;  2KMA A;  3SR6 A;  1WXV A;  2KZR A;  1RLF A;  2INP E;  1EWY C;  2FIF A;  2KVZ A;  4FXC A;  2PEA A;  4NAW A;  4W9F A;  4BAX A;  1WJN A;  3B0A A;  1XLQ A;  4BKT A;  2K6D B;  1P7E A;  4D2K A;  2MWS B;  3ZW3 A;  1IPG A;  5IO9 A;  1VRA B;  2L7R A;  4DDI D;  2IO0 B;  5JHB A;  3P2B A;  3APD A;  5FK9 C;  3R2I A;  2DEN B;  4WQO B;  2QJL A;  2N9P C;  3GZN B;  1JRO A;  4WJO A;  5C23 A;  4A8X C;  1YQ4 B;  2FE8 A;  4OVU A;  3N32 A;  1UBQ A;  1V97 A;  2CHX A;  4K7S A;  4LDT D;  3AMZ A;  3H6N A;  2GRI A;  4PS8 A;  1WX7 A;  1J0G A;  1YN3 A;  3EA6 A;  3PZ7 A;  4AUQ C;  3R8B A;  4JIO U;  2Q5W D;  1OFF A;  1FPY A;  1N5X A;  2LGS A;  3HIZ A;  1ZOY B;  2LGD A;  4RCO A;  3R7R A;  4LJO B;  2ZNV B;  2N9E B;  3HM6 X;  3R7Q A;  2K8H A;  2MJD A;  4M0W B;  3OG5 A;  3KYD D;  3RNE C;  4WQM A;  3VTV A;  3CWI A;  4X57 B;  1YJI A;  3GP7 A;  4XC2 A;  1IP9 A;  3DBR I;  3DBL I;  3PT2 B;  3WAN A;  5AUK A;  1GNU A;  2KWD A;  1G6J A;  1K51 A;  3HRD D;  4W9H A;  2J0M A;  1RM6 C;  2KHW B;  4HCN B;  3ZXV A;  4AWJ A;  2LZ6 A;  4RF0 A;  1L2N A;  3ZNI D;  4NZL B;  4CYE A;  2WXH A;  3AV8 A;  5FKA C;  5IN7 A;  1WRI A;  2ZVO A;  5L83 A;  1ISN A;  4BVU C;  1FMA D;  2JZZ A;  5EE1 A;  1NI2 A;  3TEX A;  2PTL A;  3EC8 A;  2O6V A;  3AED B;  2BS2 B;  2L3Z A;  1Q10 A;  2FUG 1;  2NVU I;  4HLE A;  4WWM A;  2IGH A;  1V8C A;  5BYQ A;  1YMH E;  2CHW A;  2MA9 B;  3KYC D;  2CKH B;  2KTR B;  2WXR A;  1D4B A;  3TL5 A;  5AUI A;  1WR1 A;  5AZF A;  4J6I A;  1TY2 A;  3ETR A;  3OLM D;  2DAF A;  2M1M A;  3DWG C;  4WAA A;  4L1B A;  3PHX B;  5FR3 A;  1A5R A;  4XDD A;  4LJP B;  2OJR A;  5J18 A;  3ZQ4 A;  1V1P A;  1DOI A;  3DBR B;  3DBL B;  2NTT A;  1SEB D;  2JYT A;  4K1R B;  2D3A A;  4GDL B;  4RMA A;  1FRR A;  3BVZ A;  3NOB A;  4BOS C;  5JHA A;  4A20 A;  4RGM A;  1WH3 A;  3AEC B;  5D2M B;  3BVM A;  2KFJ A;  3OAW A;  1R7S A;  3AE9 B;  4ZRJ A;  3VUX A;  1JQ4 A;  4FBJ B;  1Q0W B;  2LAS A;  3FAH A;  1L7Y A;  3ZDM C;  3W9C B;  3VRB B;  2KJR A;  2KFK A;  3AU4 A;  3FIL B;  3PZ8 A;  4KZ0 A;  2RR9 A;  1JWU D;  1V5T A;  3H7P A;  1F2R I;  1P3Q U;  4ANW A;  2MSE D;  2JX5 A;  2ZW1 A;  1D6E C;  3OJ4 B;  4RGT A;  2V3N A;  3U7D A;  2D3B A;  3V62 A;  5DPW A;  4NAM A;  4HDQ A;  3AE5 B;  3AU5 A;  2Y5B B;  3L17 A;  5G2N A;  2I2Y A;  1CQV A;  2KJH B;  3WA0 A;  2XK5 B;  4GSW A;  1ZP0 B;  3N3K B;  3ZXR A;  1WIA A;  4JX1 C;  4DQO C;  2MP2 A;  1L6U A;  5G5H A;  1QOF A;  3H8H A;  1EM7 A;  2PE9 A;  1C4P A;  4F7Z A;  5IKC M;  1Y8R C;  1E9M A;  2GBK A;  3RNA C;  1KM7 A;  1WZ0 A;  1EF1 A;  1UBI A;  1NI3 A;  4I6L B;  1QOA A;  2ZCB A;  4PYU A;  4CHK A;  2KLG A;  3Q3N C;  1KF6 B;  5BMG A;  2PLP A;  1TYG B;  2D3C A;  1GB4 A;  2J53 A;  4ZRK A;  2LD9 A;  1LM8 B;  4OZB A;  1E7V A;  3IVF A;  3A1Q B;  2JXX A;  2Y5C A;  4EFO A;  2PPH A;  2WXQ A;  3NVV A;  3AE7 B;  2ZVN A;  4A9A A;  2FCS A;  1GOZ A;  1Z5S B;  2W82 A;  3DHI C;  3NZS A;  4TMA B;  2N9X A;  1L4Z B;  4ZHO A;  2OJW A;  1HEZ E;  3U52 E;  3D32 A;  3NHE B;  3Q3M C;  5C2T B;  2WU5 B;  4LNN A;  4LK0 M;  1RYJ A;  2A5U A;  1FNW A;  4MJS B;  1RAX A;  1FCC C;  1FFV A;  5BYS A;  3I57 A;  2LRW A;  3MP9 A;  4K81 A;  1E10 A;  1UH6 A;  1CMX B;  2MRP A;  1H8C A;  1ZPS A;  2E3T A;  5AZG A;  3Q14 C;  2HTH A;  1V81 A;  2RPQ A;  1BT0 A;  1UUP A;  3HM3 A;  3CIR B;  4P1B C;  2DBY A;  4WH4 A;  4IWO A;  2ZEQ A;  3PLV A;  1PDX A;  4NNJ B;  1VZ6 A;  2D11 A;  1D5M C;  2K8C A;  3K9P B;  4IKG A;  1SSN A;  1XLP A;  1FFU A;  3LDZ E;  1UF0 A;  3PV1 A;  2LMC A;  3ZNZ B;  3QC8 B;  2VH2 A;  2LGI A;  2WXM A;  2KQS A;  4A55 A;  4J3O D;  1QOG A;  4AS1 A;  1ZKH A;  1QF6 A;  1D5Z C;  1I4G A;  2KMC A;  3ALB A;  1OQY A;  1JWS D;  2BF8 B;  4LDT B;  1FO4 A;  4GN1 A;  5JH5 C;  4BBN F;  4ZHP A;  2WP9 B;  1M94 A;  1Z2M A;  2ZJD A;  3X23 A;  1TS2 A;  2G4D B;  2KXJ A;  4IM3 A;  2LVP A;  1ENF A;  1HQR D;  4MGZ E;  2ON8 A;  3VTU A;  3A9K A;  4C4V B;  5GXG B;  1X1M A;  1F9J A;  3RN9 C;  4W9C A;  5BMI A;  1I4R A;  2KTF A;  1NDD A;  2VRR B;  1E8X A;  5LLI A;  2BT6 A;  1E7U A;  4MM3 B;  1QIL A;  2L00 B;  2JWZ A;  1TZO A;  1FNU A;  2GBM A;  2QC8 A;  2MEK A;  1ZW7 A;  4G11 A;  4N6E B;  1FEH A;  4TQ1 A;  2IND C;  3OWE B;  4OVZ A;  4JE3 B;  1TS3 A;  3H9D A;  1EU4 A;  2IY1 B;  4BKS A;  2KD0 A;  3ZGZ A;  2DZI A;  4HVB A;  2C60 A;  1RRB A;  2WLB A;  4W9K A;  4IW0 A;  4EEW A;  2PMV A;  1E5W A;  2ASQ A;  4PK1 A;  4K7U A;  3U30 A;  3SHQ A;  4IG7 B;  2V3S A;  3VQI A;  2JY6 A;  1PFD A;  2GB1 A;  2MBH A;  1WGR A;  1WSP A;  3EHV A;  4M00 A;  1L0Y B;  1YNT E;  2N4F A;  4HEA 1;  2XEW A;  2CS4 A;  1KTK A;  2KAC A;  2KC1 A;  3GE8 C;  2NPT B;  1WRD B;  1JCK B;  2WXP A;  3I63 C;  4IDI A;  5DPT A;  3IBE A;  3L13 A;  1YX6 B;  2V4L A;  1M4V A;  3JSV A;  2AX5 A;  1P98 A;  3DVG Y;  1EUV B;  2KX0 A;  2PVO D;  4ZRP A;  2H88 B;  4XX5 A;  2GMI C;  4TUU A;  2L83 A;  2K6Q A;  3ZUN A;  1VCB A;  2B76 B;  4YWG G;  3UI3 A;  2N1V A;  4RM9 A;  5BMH A;  3M95 A;  2WXO A;  4QAY A;  4W9D A;  1T6B X;  3DBS A;  5AEK B;  3PRZ A;  1P9D U;  4OVV A;  1V49 A;  3RZW C;  3P1M A;  2G45 B;  3JVZ X;  1C9F A;  2DZM A;  3ZIM A;  1C3T A;  1B1Z A;  2GLS A;  1YOV B;  1MHH E;  1XO3 A;  2BWF A;  3OJ3 A;  2WXG A;  4NPN A;  1VJK A;  2N9L A;  3ZNG C;  1ET9 A;  4G0N B;  3N9Y C;  5EE3 A;  1TJE A;  4GDK B;  4HKZ E;  1SE4 A;  3RFZ B;  1TS4 A;  3RNF C;  1SF0 A;  2YEP B;  3QWZ B;  4HPP A;  1L6V A;  2JRH A;  3NS8 A;  2KX3 A;  3MHS D;  1WE7 A;  3VH3 B;  1FXI A;  1GAQ B;  4HRO A;  3KVF B;  1SIF A;  1C78 A;  3JW0 X;  4EZJ A;  5JXV A;  3VXW A;  1SE3 A;  4Q2J A;  1C4A A;  2INN E;  1WXM A;  1QOB A;  1EU3 A;  5CHF A;  2PKO A;  4HPM B;  1FCL A;  4MSM B;  2JZ3 B;  2LJ5 A;  2Z8L A;  4S0R A;  2NMQ A;  3TJP A;  3AE3 B;  1K52 A;  1SB3 C;  1AN8 A;  3GOE A;  4LCD E;  2WWZ A;  4M8N A;  2KMM A;  3B2F A;  4CQN A;  2AQ3 B;  4NY0 A;  2JUO A;  1PQS A;  3EFU A;  1V5O A;  1FNV A;  1WJ6 A;  1BML C;  2NBW B;  4M0W A;  1LFD A;  2O2V A;  4ICV A;  1D3Z A;  1WXQ A;  4KSK C;  2L1A A;  3WAL A;  4W9G A;  1LQB A;  4DXG A;  2J0K A;  2JF5 A;  1SXT A;  1IBX A;  2KQ7 A;  1MI0 A;  2FID A;  2KOX A;  4O1N A;  1J7A A;  2MLB A;  4GIV A;  2D3G A;  3V3X A;  3PRM B;  4NJ7 A;  3C0R B;  3BYY B;  3BWU D;  1GUA B;  2BYV E;  2L32 A;  3GE3 C;  1NVI D;  2KWC A;  2Y3A A;  1C77 A;  2DWQ A;  2NBV B;  1E8Y A;  3WAP A;  3CSF A;  3X0W A;  1YN5 A;  3BY4 B;  2W54 A;  2KAN A;  3P4P B;  1NYQ A;  4NAW B;  4ZYN A;  2CR5 A;  2RPV A;  4WAF A;  3T9L A;  2Z0D B; 
#chains in the Genus database with same CATH homology
 4URK A;  3V62 A;  5DPW A;  1UZX B;  2I1K A;  2MW5 A;  4HDQ A;  2KLC A;  3AU5 A;  2FNJ B;  2FAZ A;  2Y5B B;  3H1U A;  3PZD A;  3L17 A;  4G50 A;  4A3P A;  1WFY A;  4ICU A;  5G2N A;  2KJH B;  3WA0 A;  2XK5 B;  3SDL C;  2NBU A;  5CHV C;  2I1J A;  3NZU A;  4DXA B;  2IO1 B;  1Q1O A;  3N3K B;  3B08 A;  2FCN A;  4GSW A;  3PGE A;  3DQV A;  1WIA A;  2L0F A;  5DCN A;  1WZ3 A;  4AJW A;  1NBF C;  3M63 B;  3APC A;  2JRI B;  2MP2 A;  3DCG A;  4I6N B;  1YD8 U;  3DVN U;  1P1A A;  2DAJ A;  2YVC A;  1MG8 A;  2B3A A;  4FHK A;  3VVW B;  1WM2 A;  2PE9 A;  4EUT A;  1KJT A;  3R3M A;  2LWP A;  2V1Y A;  4GDL A;  3TIX A;  1P0R A;  2CU1 A;  4F7Z A;  3PHW B;  4WJQ A;  5C1Z A;  1Y8R C;  3A33 B;  2IBI B;  4DHJ B;  3JSV B;  2GBK A;  2GOW A;  3QQ8 B;  4FHJ A;  2DYO A;  3AI5 A;  2KWU B;  3IHP C;  4G3X B;  4KIK A;  1KM7 A;  2NS5 A;  4NQL B;  1WZ0 A;  2RGF A;  1EF1 A;  1UBI A;  3DOW A;  2OOB B;  4XZ4 A;  2MQJ A;  4I6L B;  4FJY A;  1J19 A;  2ZCB A;  4I6P A;  4PYU A;  4CHK A;  2ZZP B;  1WF9 A;  2LXC A;  3SD5 A;  4F1S A;  2KLG A;  3ZLZ A;  5LXI B;  3ML8 A;  4FLH A;  3Q3F A;  1UGM A;  4ZDV A;  4MGK E;  2FCQ A;  3A4S C;  1YIW A;  2MBB B;  4EOY A;  4ZRK A;  2AL6 A;  2LD9 A;  1GG3 A;  2D10 A;  1LM8 B;  2M4N A;  1E7V A;  1TZ1 A;  2C7H A;  5TR5 A;  3IVF A;  3A1Q B;  2GBN A;  2JXX A;  4FUL A;  5J2R A;  2AL3 A;  2N7D A;  4EFO A;  4M8M A;  5L95 C;  3QAR A;  4HPL B;  2PPH A;  1WGG A;  2ZCC A;  3TBL D;  2WYQ A;  2NR2 A;  2MBE A;  3DPD A;  2ZVN A;  4GB9 A;  3VH4 B;  2FCS A;  2IYD B;  1Z5S B;  1I42 A;  1WGY A;  4ZRI A;  3WAM A;  4MDK E;  2K25 A;  2D07 B;  3HHM A;  3NZS A;  2N9X A;  1GC6 A;  4BKS D;  1WJU A;  2DX5 B;  2K1F A;  2Z59 B;  4PS3 A;  3U8Z A;  3VHT C;  1V80 A;  2G4S A;  3D32 A;  4NQK E;  3NHE B;  1WJ4 A;  4HXD A;  4IUM B;  3DVN V;  2IO3 B;  2GBR A;  2XK5 A;  2EMS A;  4WJN A;  2HD5 B;  4AJY B;  2KK8 A;  1IYF A;  3PVL A;  1XD3 B;  4IC7 B;  2A5U A;  2KNB A;  2L0T A;  3NY5 A;  1WGD A;  3QCA A;  4MH0 E;  3ECI A;  2NCN A;  1LXD A;  4MJS B;  5GMV A;  1RAX A;  3RCZ A;  4ASW C;  1E8W A;  3V6E B;  4BOZ B;  2LRW A;  3V60 A;  4GDK A;  3AUL A;  1EO6 A;  2DZJ A;  2K8B A;  4K81 A;  3RT3 B;  3L10 B;  1UH6 A;  1KLV A;  4B9K A;  4DHZ B;  3B1L X;  1WX9 A;  1CMX B;  3QHT A;  2MRP A;  1H8C A;  3PRP B;  4HWI B;  5AZG A;  2HTH A;  3KH0 A;  3BIN A;  4A3O A;  1V81 A;  3A4R A;  5IAA C;  2RPQ A;  1OGW A;  4DWF A;  1E8Z A;  3CF6 E;  4WJP A;  1BT0 A;  3HM3 A;  4PYZ A;  3AXC A;  3KUC B;  4JQW C;  4DDG D;  4IWO A;  2ZEQ A;  5IA7 A;  3PLV A;  3ZNH B;  4NNJ B;  1J8C A;  2KTR A;  2D11 A;  4II2 B;  2M17 A;  2K8C A;  3K9P B;  3QK0 A;  2MBQ A;  3LDZ E;  4DHJ D;  3PV1 A;  3ZNZ B;  3QC8 B;  4WWN A;  3ZDT A;  2PJH A;  2K39 A;  4MGY E;  2KQS A;  1Q5W B;  4TQ0 A;  5EDS A;  5KHQ A;  2O2V B;  1ZKH A;  3KUZ A;  2REX A;  3VAW A;  2C7N B;  4IWP A;  5HKH A;  2LGX A;  2KMC A;  2L8J A;  1XT9 B;  1R4M I;  1WR6 E;  5G55 A;  3ALB A;  1OQY A;  2BF8 B;  3ZTD A;  1V86 A;  4LDT B;  2UYZ B;  4GOC A;  4GN1 A;  2C7M B;  3H7S A;  5JH5 C;  3A1Q A;  4BBN F;  4HCP B;  4BKG A;  3PLU A;  1M94 A;  1Z2M A;  1WY8 A;  2BWE S;  3I3T B;  3KUD B;  3UQA A;  2ZJD A;  3X23 A;  2G4D B;  2KXJ A;  4IM3 A;  2LVP A;  4MGZ E;  4FN2 A;  1WYW B;  3VTU A;  2KDE B;  3JYU A;  2BGF A;  3A9K A;  3EEC A;  1X1M A;  4B6W A;  1F9J A;  4E74 A;  3S2A A;  4W9C A;  2WX0 A;  3M62 B;  1YQB A;  2KTF A;  1NDD A;  2VRR B;  3Q3J A;  3PSE B;  3V6C B;  3QX1 A;  3ZTC A;  1E8X A;  2KO3 A;  1OEY A;  1UD7 A;  2BKF A;  3GZN I;  5LLI A;  3RZF A;  2R2Q A;  1E7U A;  3QAQ A;  1V9J A;  3UF8 A;  2L00 B;  2ZPN A;  1FXT B;  3MJW A;  2JWZ A;  2W9N A;  3TCA A;  2Z0E B;  2IZV B;  2RSU A;  2GBM A;  4MJS A;  1ZGU B;  1ZW7 A;  4G11 A;  3RYT A;  4TV3 A;  4TQ1 A;  2HE7 A;  1V6E A;  3W1S C;  2DHZ A;  5DPR A;  2LVO A;  3QIJ A;  5CHW A;  3QJZ A;  3H9D A;  3VUW A;  4W9L A;  2KMA A;  3RD2 A;  1S3S G;  2IY1 B;  3L0W B;  4BKS A;  2KD0 A;  5D7G A;  5E6N A;  1WXV A;  3DBH I;  4IM0 A;  2KZR A;  2QHO A;  1RLF A;  3WAO A;  3WIM A;  3ZO5 B;  2FIF A;  3R66 C;  4W9F A;  2PEA A;  4NAW A;  2WX1 A;  2DZI A;  4HVB A;  5KHO A;  2YLM A;  2C60 A;  3MTN B;  1RRB A;  1WJN A;  3B0A A;  2MP2 B;  3UQB A;  4W9K A;  2KJ6 A;  3L54 A;  1T0Y A;  4JGH B;  5E6P A;  4IW0 A;  4BKT A;  2JVC A;  1WMH A;  2K6D B;  2J0J A;  2N1W A;  1SGH A;  4NJ6 A;  4EEW A;  4RM8 A;  2D2Q A;  2MWS B;  4B95 A;  1E5W A;  5CTR C;  2ASQ A;  2KVR A;  3ZW3 A;  1IPG A;  1GC7 A;  2MX2 A;  4K7U A;  3U30 A;  3SHQ A;  4ANV A;  2O6V B;  2C9W B;  1WE6 A;  4HDO A;  4IG7 B;  2V3S A;  3VQI A;  2JY6 A;  2L7R A;  4DDI D;  2IO0 B;  2M0X A;  3PRE A;  5JHB A;  2MBH A;  4F8C B;  1WGR A;  3UIP B;  2L76 A;  3P2B A;  1SE9 A;  3APD A;  3EHV A;  2LGY A;  2N4F A;  1VD2 A;  4KIK B;  2HJ8 A;  2XEW A;  2DEN B;  4WQO B;  2CS4 A;  2UWQ A;  3IFW B;  4E71 A;  3A9J B;  2N9P C;  3VTW A;  4P7I A;  4WJO A;  2KC1 A;  3V61 A;  2NPT B;  1WRD B;  3ZRF A;  3K9O B;  3DVG X;  5C23 A;  4MEL A;  4CO7 A;  5DPT A;  3IBE A;  4HK2 A;  3CST A;  3L13 A;  3N32 A;  1UBQ A;  4OVU A;  1YX6 B;  3RUL A;  1WXS A;  2BPS A;  2CHX A;  4K7S A;  2V4L A;  3JSV A;  4II3 B;  1P98 A;  4LDT D;  2PE6 B;  3DVG Y;  1EUV B;  1C1Y B;  3W1Y A;  1YX5 B;  1WM3 A;  1WXA A;  2KX0 A;  3H6N A;  4KZC A;  4PS8 A;  1WX7 A;  2MCN B;  4GMV A;  3SU8 X;  3VDZ A;  4EZL A;  1J0G A;  1U4A A;  4GU2 A;  4XX5 A;  4AUQ C;  2GMI C;  4TUU A;  2K6Q A;  3PTF C;  4JIO U;  3ZUN A;  1VCB A;  1WGH A;  4FJV B;  2LI5 A;  2M8S A;  3ENE A;  3HIZ A;  1QZE A;  2LGD A;  1JRU A;  2JPH A;  3R7R A;  2N1V A;  4LJO B;  1XQQ A;  2ZNV B;  4MM3 A;  2N9E B;  3HM6 X;  4RM9 A;  2K8H A;  2AWT A;  3R7Q A;  4M0W B;  3M95 A;  4MSQ B;  4N9F 4;  4W9D A;  1GJZ A;  2ZNV C;  4MEM A;  3ML9 A;  4W9I A;  3KYD D;  3DBS A;  2G3Q B;  4E3C A;  5AEK B;  3VTV A;  3PRZ A;  1AAR A;  1P9D U;  4X57 B;  4WWP A;  4OVV A;  1K8R B;  4XC2 A;  1IP9 A;  1V49 A;  3DBR I;  3RZW C;  3DBL I;  2G45 B;  3JVZ X;  3PT2 B;  3WAN A;  1TGZ B;  2DZM A;  5LXH A;  1GNU A;  2FCM A;  2GBJ A;  3ZRC A;  3ZIM A;  1G6J A;  1C3T A;  2BWF A;  3OJ3 A;  4W9H A;  2J0M A;  2KHW B;  3LJ3 A;  4HCN B;  4AWJ A;  4DHZ E;  4NPN A;  3N30 A;  2LZ6 A;  2DYB A;  4EKU A;  1L2N A;  1HE8 A;  2FUH B;  3ZNI D;  3ZKJ C;  4BFR A;  4CYE A;  3ZNG C;  5D94 A;  4G0N B;  5E6O A;  2KFK B;  2ZVO A;  5L83 A;  2EMT A;  4W9J A;  4GDK B;  1ISN A;  4BVU C;  3KW5 B;  2DZK A;  4KSL C;  4ANU A;  2JZZ A;  2CHZ A;  1KOT A;  1NI2 A;  3H7P B;  3QWZ B;  3EC8 A;  2JRH A;  2O6V A;  3NS8 A;  2KX3 A;  2L3Z A;  3M3J A;  3MHS D;  1WE7 A;  3VH3 B;  2NVU I;  4HLE A;  3ONS A;  1E90 A;  4BBN C;  3KVF B;  2CHW A;  1SIF A;  2MA9 B;  1UEL A;  2AYO B;  3KYC D;  4GGQ A;  2CKH B;  3JW0 X;  3RUI B;  4EZJ A;  2KTR B;  3VXW A;  2O6V D;  3TL5 A;  1WR1 A;  2BYE A;  3A9J A;  5AZF A;  1WXM A;  4JL9 A;  4J6I A;  2KN5 A;  5CHF A;  1R4N I;  2IO2 B;  2NPT A;  2ZPY A;  4HPM B;  2R2O A;  2DAF A;  2RD0 A;  3OLM D;  5CX3 A;  1TTN A;  4MSM B;  2JZ3 B;  4PS7 A;  4AOF A;  2LJ5 A;  1S1Q B;  2KKC A;  2M1M A;  3ZVV A;  4WAA A;  4MGI E;  5AZH A;  5D6J B;  3PHX B;  3TJP A;  2KDF B;  3L08 A;  3APF A;  4FA6 A;  1A5R A;  3VFK A;  4LJP B;  2OJR A;  5J18 A;  3PS6 A;  3UIN B;  3GOE A;  2WDT B;  4LCD E;  4JLC A;  4KVG B;  2WWZ A;  4M8N A;  4K1R B;  4AP4 C;  3CMM B;  4NY0 A;  4IM2 A;  4GDL B;  2JUO A;  4RMA A;  1PQS A;  3EFU A;  4EZK A;  1V5O A;  1TBE A;  1WJ6 A;  3NOB A;  4TKN A;  2NBW B;  2KDB A;  3O65 B;  1LFD A;  2A4Z A;  2O2V A;  4BOS C;  5JHA A;  4WWO A;  2DYM A;  4KV2 A;  3A9K B;  4A20 A;  2J7Q B;  5JZE B;  1WH3 A;  1EF5 A;  2BKR B;  4ICV A;  5D2M B;  1D3Z A;  2KC2 A;  4KSK C;  3TMP B;  5BO4 B;  3QA8 A;  1RFA A;  2L05 A;  3WAL A;  2N7E A;  4DBG A;  2KFJ A;  3OAW A;  4W9G A;  1LQB A;  2J0K A;  2JF5 A;  2LXA A;  4ZRJ A;  3VUX A;  3L16 A;  2KQ7 A;  4HJK A;  2FID A;  2KDI A;  2BYF A;  2KOX A;  3DDC B;  2C5L C;  2MLB A;  4GIV A;  2D3G A;  4GXB A;  4FBJ B;  1Q0W B;  2LRU A;  1OTR B;  2KWV B;  4ANX A;  2EKE C;  3PRM B;  2LAS A;  4NJ7 A;  2IY0 B;  4KDL B;  1L7Y A;  4K7W A;  2XBB C;  3ZDM C;  3C0R B;  3PPA A;  2KJR A;  1GUA B;  2AEH A;  2BYV E;  2KFK A;  3AU4 A;  4YL8 A;  3UGB B;  5J17 A;  2JT4 B;  3HK0 A;  5DPS A;  3VUY A;  2KWC A;  4KDI C;  1H4R A;  4KZ0 A;  1V2Y A;  2RR9 A;  1V5T A;  2MBO A;  2NBV B;  3H7P A;  3IG3 A;  4FJZ A;  3T8M A;  1WI0 A;  1E8Y A;  2LUE A;  2LVQ A;  3CSF A;  3WAP A;  3X0W A;  1P3Q U;  1YJ1 A;  3BY4 B;  3UIO B;  5FR6 A;  4ANW A;  4DK5 A;  2MSE D;  4FAD A;  2KAN A;  4IWQ A;  1WX8 A;  4NAW B;  4ZYN A;  1I35 A;  2CR5 A;  4W9E A;  3OJ4 B;  3T9L A;  3W1S A;  1OEY J;  1WMH B;  2Z0D B;  3U7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...