2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
3PVLA 1E7UA 1NDDA 2BPSA 2V4LA 4NQKE 4IM2A 2I1KA 4NQLB 4BKTA 2JF5A 2KDFB 2NBUA 2ZPNA 1M94A 4DK5A 1JRUA 5FR6A 4MSQB 2CHZA 2KKCA 2C7MB 3JSVA 1R4MI 3PLUA 3AULA 4MDKE 2KDIA 4I6NB 4TV3A 2MBHA 2KJHB 2XEWA 4JL9A 4HVBA 1WGGA 4K7SA 5GMVA 3RYTA 1TTNA 3ECIA 2GBJA 4NJ6A 3HM6X 2HD5B 2IO1B 3LDZE 5L95C 2Z59B 3ML8A 5DPSA 3WALA 4BVUC 4CO7A 4HCNB 4W9DA 4M0WB 3PV1A 4ANVA 3A4RA 3A9JA 1WMHB 4TQ1A 4PYZA 1L7YA 4NPNA 1E5WA 5IA7A 3ZRFA 3N3KB 3ONSA 1V80A 2BYFA 2MRPA 2ZCBA 5G2NA 4EEWA 1ZW7A 2IO2B 3HIZA 3QAQA 2LVPA 2HJ8A 4HCPB 5DCNA 1GC6A 3B08A 2N1VA 3ZTDA 4FJVB 4ZRJA 2D10A 2JZ3B 3A9KA 4NNJB 3UQAA 3VXWA 3QIJA 5DPTA 1LM8B 2M17A 1XQQA 2YLMA 3MTNB 4W9IA 4ZRKA 3U30A 3VTVA 3H1UA 3X0WA 1WR1A 3RZWC 4A3PA 4MGKE 5KHOA 2IYDB 2N7DA 3ZDTA 2ZCCA 4EOYA 1GC7A 3OAWA 1YQBA 5DPRA 3VTWA 1P9DU 3V6CB 1WR6E 1WFYA 3H7SA 3M63B 3CSFA 1E7VA 2IY0B 3QA8A 3PHXB 1KOTA 4LJOB 4GB9A 2KJRA 3D32A 2DENB 4ICUA 2FCNA 2C7NB 2OOBB 2LVQA 2MQJA 3IHPC 2UWQA 3WAMA 4JLCA 2JZZA 3WIMA 2KOXA 3P2BA 3KVFB 2ZZPB 4MJSB 1OEYJ 4ICVA 2KLGA 5AZFA 2GOWA 1RLFA 2MP2A 1IPGA 1E8XA 5J2RA 3AI5A 3T9LA 1IYFA 2LUEA 4BOZB 4FBJB 2HE7A 2BWFA 2KC2A 1J19A 4GXBA 2REXA 3SHQA 3TL5A 4TKNA 2O6VB 3AXCA 2LASA 1WGHA 4AP4C 3ZKJC 1V5OA 3PSEB 2M4NA 3B1LX 2LXCA 3QQ8B 3RCZA 2ZEQA 4WWNA 1S1QB 3IVFA 2IBIB 4W9KA 2MWSB 1H8CA 4BKGA 2DZIA 4GDLB 2KWUB 4M8NA 4GDKB 4AJYB 2CU1A 4GSWA 4FHKA 4GIVA 3VVWB 2L7RA 4E74A 4W9HA 2OJRA 4II2B 2XK5A 5L83A 1H4RA 4FJZA 2WDTB 4ANWA 3JYUA 2ZNVB 4PS8A 1WJ6A 3ZVVA 2XBBC 4DHZB 1GG3A 3L08A 3O65B 3Q3JA 3OLMD 1WX9A 3QHTA 4DHJD 4FULA 4WJQA 1BT0A 1UD7A 4NY0A 2LVOA 3N30A 3L16A 3JVZX 4G11A 2IO3B 4KIKA 3RZFA 5C1ZA 4E3CA 3R66C 3SDLC 4GDKA 3ENEA 3VH3B 2KHWB 2J0JA 2M1MA 4XC2A 4BKSD 4IM3A 4KZCA 3W1SC 2MBOA 3A1QA 2FUHB 2QHOA 4MGYE 4I6PA 2C5LC 2N1WA 1YD8U 2AYOB 2DAFA 2M0XA 4FLHA 3PRZA 1KM7A 2EMSA 2WWZA 4BBNC 1WXAA 4MH0E 1E8WA 1WX8A 1YJ1A 4TUUA 1WE7A 3UF8A 3H7PA 2KQ7A 3ZO5B 3VQIA 3WAPA 3QWZB 4IWOA 5JZEB 4URKA 3PRMB 2KMCA 4MJSA 5J17A 1XT9B 2G4DB 1Y8RC 2KK8A 2WYQA 4OVUA 3B0AA 2MBQA 3KUCB 4K81A 2KMAA 2FIFA 1NBFC 2CS4A 4PYUA 2MSED 2K8HA 2RR9A 3DQVA 3KUDB 3KH0A 2PPHA 3NY5A 3UGBB 1I42A 5JH5C 1EUVB 2K8CA 2KFKA 1YX6B 4K7UA 3VDZA 1YX5B 4MELA 4RM8A 3ZNHB 2C7HA 2MW5A 2CHWA 3OJ3A 2IY1B 2L0FA 4LJPB 5IAAC 4EZKA 1OGWA 4F7ZA 1YIWA 3JSVB 4HPMB 1WXMA 1LXDA 2KDBA 1P0RA 3MJWA 3DDCB 2CHXA 2GBKA 5BO4B 5LLIA 4HLEA 2AL3A 1S3SG 5KHQA 4W9JA 1WF9A 2D07B 5D94A 2EMTA 5E6PA 2MCNB 4EKUA 1V81A 5E6OA 4A20A 2NPTB 2ZPYA 4W9FA 1GJZA 3M3JA 4JIOU 3VHTC 2FAZA 2R2OA 2V3SA 3N32A 2LGYA 4AOFA 2MX2A 3APFA 2BYEA 4PS7A 1OQYA 4MM3A 3OJ4B 2FCMA 3GZNI 1GUAB 3DVGX 4ANXA 3I3TB 4BOSC 3UQBA 2K6DB 4K1RB 4KVGB 4WJNA 1PQSA 2W9NA 2NS5A 3DOWA 2RGFA 1P1AA 4GDLA 4EUTA 2J0MA 3VTUA 3NZUA 2EKEC 3EECA 3V60A 3QC8B 5DPWA 3DVNV 2N4FA 4WQOB 4W9LA 4WWPA 2C60A 3H9DA 3TCAA 2K25A 2UYZB 1KLVA 3DBRI 1FXTB 2KTFA 3U8ZA 2L3ZA 3TMPB 5CHVC 3L17A 4NAWA 2O6VD 3ZNZB 3NS8A 4IM0A 3ZLZA 4MGIE 2BGFA 3DBSA 1EF5A 4DBGA 1EF1A 5E6NA 3L13A 3ML9A 5AZHA 5C23A 1TZ1A 1NI2A 3QJZA 2PEAA 2NBWB 1WM3A 1WY8A 2L8JA 3DVNU 2BF8B 3PTFC 4AJWA 4DHZE 4NJ7A 1CMXB 2PE6B 4WJPA 2NR2A 4I6LB 1WM2A 4RMAA 4OVVA 3A9JB 4B95A 2CR5A 2JPHA 2N9EB 2V1YA 2RSUA 4G50A 4HK2A 1RRBA 3RULA 3K9PB 2FCQA 2N7EA 3U7DA 2K8BA 5CHWA 4HJKA 3DBLI 1V49A 2DHZA 3PRPB 4G0NB 3UINB 4N9F4 5AEKB 1J8CA 4IUMB 5G55A 1UGMA 2D11A 1OTRB 2O2VB 3HHMA 2BWES 3NHEB 2DYMA 2KVRA 4CYEA 5LXIB 1P3QU 1WZ0A 1RFAA 2GBNA 2MBEA 2DZMA 2Z0EB 4WAAA 3APDA 1XD3B 2LXAA 3S2AA 4KDIC 5JHAA 4EZJA 1UELA 3M62B 2NPTA 1G6JA 4GMVA 3PZDA 4MEMA 4FA6A 3QK0A 2KLCA 1RAXA 2I1JA 2L05A 3LJ3A 1AARA 2GBMA 2GMIC 1UZXB 2A5UA 3C0RB 4ANUA 1WZ3A 5CX3A 3Q3FA 3VUXA 2D3GA 2D2QA 3TJPA 3RD2A 1I35A 2K1FA 1ZGUB 2WX1A 1V9JA 3ALBA 2KO3A 3DPDA 3PS6A 3RT3B 1WGDA 1WXVA 3KW5B 3MHSD 3DBHI 4WWOA 3KUZA 1WRDB 2LD9A 2IZVB 4BBNF 2NBVB 2JUOA 1GNUA 2KN5A 4DWFA 1K8RB 2BKFA 2DYOA 4W9GA 4GOCA 1V5TA 1Z2MA 4FADA 1Q5WB 3KYDD 1F9JA 1E8ZA 4IG7B 2KX3A 4DDID 3SU8X 4X57B 4KDLB 1WI0A 4HWIB 2MP2B 1UBQA 4NAWB 1WJ4A 2K6QA 2KWCA 2LZ6A 5D6JB 3X23A 3BY4B 2KTRB 2Z0DB 4WJOA 2BYVE 1OEYA 4IC7B 4ZRIA 1Q0WB 5LXHA 1ZKHA 1WJNA 2C9WB 2KC1A 3APCA 4AUQC 3VAWA 3K9OB 2L0TA 4BKSA 3AU4A 4FJYA 4HDOA 1WGYA 2DYBA 1C1YB 4K7WA 4DXAB 3TBLD 1SGHA 3VUYA 3PGEA 3ZUNA 2JVCA 1HE8A 1UBIA 3A1QB 1WYWB 4PS3A 3R7RA 2KNBA 3A33B 4W9EA 2ZVNA 3A4SC 3VFKA 5JHBA 2LRWA 3R7QA 4KV2A 3JW0X 1MG8A 3VH4B 2FCSA 3ZIMA 4B9KA 2G4SA 2IO0B 1TGZB 2AEHA 4ASWC 2LWPA 3UIOB 1V86A 2KWVB 3CF6E 4JQWC 4TQ0A 2DAJA 4BFRA 4EZLA 2L00B 2B3AA 4AWJA 2LRUA 2Y5BB 4LCDE 3R3MA 4J6IA 1X1MA 3EFUA 4G3XB 3ZDMC 4ZDVA 2DZJA 2A4ZA 3NOBA 4GN1A 3WA0A 1E90A 2ZNVC 1WE6A 4EFOA 2NCNA 2KX0A 1U4AA 2KANA 2KDEB 2JT4B 2KXJA 2GBRA 3L0WB 4W9CA 3ZW3A 3PREA 3WAOA 3UIPB 5AZGA 1J0GA 1VD2A 2AWTA 4FN2A 4GU2A 4IWQA 4FHJA 3RUIB 2PE9A 3TIXA 5TR5A 1UH6A 1IP9A 3IBEA 4DHJB 1LQBA 3VUWA 2O2VA 5D7GA 2L76A 3ZNGC 2BKRB 1Q1OA 1SIFA 1T0YA 2O6VA 3ZTCA 1WH3A 3ZRCA 3CMMB 4MGZE 3PHWB 1A5RA 2FNJB 2KD0A 3V6EB 2G45B 4F1SA 4ZYNA 4JGHB 3BINA 3H6NA 4HXDA 2JRIB 2NVUI 4RM9A 4YL8A 2KFJA 2MA9B 1V2YA 3V61A 4GGQA 1TBEA 4KIKB 3W1YA 4XX5A 4E71A 3QARA 2KQSA 3M95A 1EO6A 4KSLC 2KFKB 3V62A 1WMHA 4HPLB 3PT2B 2XK5B 2JY6A 2KTRA 3DCGA 2DX5B 1WX7A 3CSTA 3L54A 4II3B 4A3OA 5CTRC 1WJUA 1SE9A 3IG3A 1LFDA 2G3QB 3DVGY 3SD5A 2R2QA 1QZEA 4IW0A 1D3ZA 4M8MA 5J18A 1L2NA 2J7QB 3A9KB 1VCBA 2JWZA 2K39A 3QCAA 5CHFA 2N9XA 3L10B 2AL6A 4XZ4A 2LJ5A 2PJHA 2ASQA 1KJTA 3ZNID 2YVCA 3WANA 3GOEA 1WXSA 2HTHA 3IFWB 5EDSA 1WIAA 3AU5A 4IWPA 4LDTB 4CHKA 2ZVOA 2LGXA 4LDTD 3KYCD 2FIDA 2RD0A 3EHVA 4HDQA 2M8SA 2J0KA 3HK0A 2LI5A 4B6WA 1C3TA 2RPQA 2ZJDA 5D2MB 4F8CB 4MSMB 1P98A 4P7IA 2N9PC 2WX0A 2CKHB 3NZSA 1V6EA 3H7PB 4DDGD 1E8YA 3EC8A 3PPAA 2VRRB 3W1SA 1ISNA 4KSKC 2JRHA 2MLBA 3T8MA 2LGDA 3PLVA 3QX1A 1Z5SB 1R4NI 2MBBB 1WGRA 2KZRA 3HM3A 4KZ0A 2JXXA 2DZKA 2KJ6A 5HKHA
chains in the Genus database with same CATH superfamily
3PVLA 1E7UA 2V4LA 3AM9A 4BKTA 2I1KA 3TEZA 2ZPNA 4WURA 5FR6A 4MSQB 1CQVA 2C7MB 4I6NB 4TV3A 2V3PA 3VRBB 3LDZE 2QIEB 1SBBB 4M0WB 3RNCC 2BYFA 4EEWA 2LHEA 3HIZA 2HJ8A 2ONQA 4S17A 2K3UA 3ZTDA 3IAM1 2D10A 1HZ5A 4JE3B 3UQAA 2JZPA 1I7HA 2YLMA 3IXSA 3VTVA 3H1UA 1WR1A 4MGKE 3FAHA 3RNEC 1T0RC 1C4CA 2G1EA 1P9DU 1IBXA 3CWIA 1WYGA 1WFYA 3MHZA 1E7VA 1WXQA 2KJRA 3D32A 4LNOA 3Q8AA 4ICUA 2FE8A 2LVQA 2UWQA 1AN8A 5I4DA 2ZZPB 5HI1A 3N20C 1KH0A 1UF0A 3N1YC 2INPE 1TKEA 2MP2A 1E8XA 4P6VF 2IJ0A 2PVGC 3T9LA 1IYFA 2LUEA 1FO4A 1WRIA 4GXBA 2WS3B 4A9AA 1V5OA 1TKGA 2LXCA 2QCZA 1R4MB 2QC8A 2ZEQA 2BVCA 4W9KA 4BKGA 2DZIA 4M8NA 1B9RA 3IAS1 1R7SA 2XK5A 1H4RA 3ZVVA 2XBBC 1GG3A 2RDGA 5IOIA 1JWUD 1I4XA 2IGGA 2J52A 4WJQA 1JWAD 2MJEA 3DBLB 3N30A 3JVZX 1XO3A 2MEKA 3FKYA 4GDKA 2J0JA 2MBOA 4M02A 3A1QA 4N58A 1HTOA 2C5LC 2N1WA 2AYOB 2KYWA 4MACA 1VZ8A 1KM7A 1UGJA 2EMSA 2HJ1A 1WX8A 1LO5D 1SB3C 2INNE 1JALA 2BS2B 3VQIA 2CU3A 2M56B 3FILA 4URKA 2KACA 2KK8A 2WYQA 3B0AA 2MBQA 4BZAA 3KUCB 2KMAA 2CS4A 2K8HA 2RR9A 3UGBB 3KUDB 5JH5C 4MELA 5D3IB 3ZNHB 2WNMA 5HFYA 1SXTA 2IY1B 5IAAC 2W82A 1OGWA 2E6XA 4F7ZA 3JSVB 1J7AA 4HPMB 1MVKA 3DDCB 2CHXA 5BO4B 2Y3AA 4W9JA 2D07B 4A20A 2ZPYA 2WHIA 3M3JA 4JIOU 1FFUA 2ICIA 2LGYA 2MX2A 3APFA 1N63A 4PS7A 4S0RA 4MM3A 3OJ4B 4ANXA 2W9NA 2RGFA 1F2RI 1TYGB 3I63C 3V60A 1PGAA 5DPWA 4WQOB 2C60A 3H9DA 2K25A 2J42A 2LEKA 3TMPB 3DWGC 2O6VD 1IGCA 1EF5A 2V9HA 1WM3A 1L6UA 1RM6C 2JX5A 1SSNA 4DHZE 1CMXB 2PE6B 2NR2A 1CZPA 1WM2A 3J9CA 1ESFA 4OVVA 1TS4A 3T3NA 4B95A 2JPHA 2N9EB 4G50A 4HK2A 3ZXVA 3U7DA 1OFFA 2FCQA 2N7EA 4WAFA 1J8CA 1F77A 1XLQA 1DYQA 2M19A 2D11A 2BWES 5LXIB 2Z8LA 2GBNA 2R61A 2DZMA 2Z0EB 3GP7A 1V97A 3APDA 2LXAA 3ZGZA 1G6JA 4QAYA 2GBMA 1UZXB 3Q3FA 3RD2A 1V9JA 2KO3A 4CQNA 1N60A 4L1BA 4ZHOA 3P42A 1WXVA 3KW5B 3AE7B 1WRDB 2KWDA 2JUOA 1GNUA 2KN5A 3Q8BA 4DWFA 1T5XD 4GOCA 3KYDD 4IG7B 4YSZB 1WI0A 4HWIB 3Q2AC 5D6JB 2KTRB 2Z0DB 4MH8A 4TMAB 1OEYA 1WSPA 1QOAA 2C9WB 4AUQC 4WWMA 3AU4A 1C1YB 2WDVB 3GZNB 3T3OA 3PGEA 3EFCA 1HE8A 4RF0A 3A1QB 3B2FA 3AEBB 5JHBA 2LRWA 3EA6A 4KX6B 4A90A 2WXNA 3VH4B 4YT0B 4B9KA 2G4SA 2IO0B 2AEHA 1B1ZA 3UIOB 1F0ZA 4BFRA 2LRUA 2Y5BB 4LCDE 4KGSA 2A4ZA 3NOBA 1E90A 2KANA 2KXJA 3L0WB 2JT4B 3NVVA 4W9CA 1I4GA 3ZW3A 5AZGA 1J0GA 1VD2A 2AWTA 4FN2A 5H8YE 3RUIB 3TIXA 5TR5A 3IBEA 1TY2A 1LQBA 1VZ6A 5C3JB 3ZNGC 1C78A 1XCTL 3N9YC 3ZTCA 2O6VA 3P4QB 1WH3A 3ZRCA 1LGRA 2V3NA 4XDCA 1ZP0B 1JWBD 3ZJTA 3AEEB 1OQQA 3BINA 3H6NA 4AS1A 3ZXRA 2KFJA 1UWMA 2SEBD 3W1YA 4E71A 3QARA 1ACCA 2KFKB 1WMHA 2WLBA 2JY6A 1FPYA 2DX5B 1WX7A 3CSTA 1MI0A 4USAA 5CTRC 3BVGA 1QZEA 4IW0A 2J7QB 3AE8B 1KFYB 2JWZA 1C76A 4XZ4A 2AL6A 3W2DA 4YWGG 3WANA 3GOEA 3IFWB 1T0SC 3AU5A 2ZVOA 3TEYA 1QOBA 2AQ3B 3Q8CA 4HPPA 3EHVA 1C3TA 2J0KA 2RPQA 2ZJDA 4NZLB 4P7IA 2N9PC 1E8YA 1N62A 4RFBA 2PKOA 3W1SA 1E10A 1L4DB 3AEFB 4C4VA 2JRHA 3RPFC 3TEXA 1N5WA 2QEJC 2HTME 4RF1A 2JXXA 2GI9A 2LJIA 2BPSA 2PIAA 4NQKE 4IM2A 1K50A 2AX5A 2CHZA 2KKCA 3KWVA 4LNNA 4C56C 2KJHB 2XEWA 2Y5CA 1WGGA 5GMVA 3RYTA 1Q10A 2HD5B 2Z59B 5DPSA 3WALA 4BVUC 4W9DA 3PV1A 1WMHB 4TQ1A 5IA7A 2NTSA 3NS1A 3ONSA 2IO2B 1UWXA 5DCNA 4N6EB 3HRDD 2N1VA 3GE3C 3QIJA 1ZDXA 5DPTA 3E56A 1XQQA 3MTNB 3U30A 1IUEA 3X0WA 3RZWC 5KHOA 2WXKA 3HVDA 2N7DA 3ZDTA 2ZCCA 4EOYA 1GC7A 3E9SA 2FBWB 4JPSA 5DPRA 1YN5A 1ZUD2 3V6CB 1NEKB 3H7SA 3R8BA 2IY0B 3PHXB 4LJOB 4GB9A 4YTPB 2C7NB 2MQJA 3IHPC 4JLCA 4MJSB 1RLFA 2VH1A 1IPGA 2QDFA 3AI5A 2HE7A 4XWWA 2REXA 1WGKA 4TKNA 1FNUA 3ZQ4A 1PUTA 4P16A 3R2TA 3ZKJC 1M4VA 3PSEB 3BVMA 4TSSA 5EE1A 1S1QB 3IVFA 2GB1A 4IDIA 1H8CA 2KWUB 2X8XX 4GDKB 3SFDB 4GSWA 4ARCA 2OEDA 4PT5A 5L83A 4FJZA 4ANWA 3JYUA 3RNGC 3HVZA 4DHZB 3Q3JA 1TZOA 4RGTA 1WX9A 4HJGE 1BT0A 1HXYD 2LVOA 3P4PB 3C19A 2IO3B 3MC9A 4KIKA 3RZFA 4E3CA 3R66C 3ENEA 1N5XA 3ZYYX 4KZCA 3W1SC 4UDUC 3BVZA 4M01A 1YD8U 3OWEB 2JQRB 4JWSC 3BK1A 3PRZA 5C2TB 1WXAA 1E8WA 1ZPSA 1WE7A 3UF8A 3W9CB 5FR3A 1OQRA 5JZEB 4MJSA 1XT9B 2G4DB 1DGJA 4K81A 2FIFA 2W3RA 3DQVA 3KH0A 2PPHA 1I42A 3VDZA 1E0ZA 3OJ3A 1QF6A 3Q3MC 3MC8A 3PZ8A 2WP9B 2GBKA 1XCQL 1WF9A 5D94A 2MCNB 4EKUA 2BBCA 1GJZA 3N32A 1YQ3B 2BYEA 1C77A 1GUAB 4BOSC 1JMLA 4KVGB 4WJNA 1PQSA 2NS5A 1P1AA 4GDLA 2INCC 2PW9A 3EECA 3DVNV 2GRIA 3NVZA 4WWPA 1SE3A 3P1MA 2KTFA 2L3ZA 2J4XA 2PLPA 3L17A 4DBGA 3DBSA 2RPVA 5C23A 3Q6BA 2JSVX 3DVNU 4ARIA 4I6LB 2V1YA 2RSUA 1RRBA 3RULA 1N61A 5CHWA 1V49A 1KF6B 1K53A 2JWUA 1I4HA 2KVZA 1OTRB 1MJDA 1HA5A 1FMAD 3PZ7A 5JHAA 4EZJA 2ON8A 1RAXA 3FC4A 3LJ3A 2I1JA 2KN4A 4US9A 3VUXA 1JCKB 2D3GA 3BWUD 1I35A 1ZGUB 2WX1A 1YN3A 2K9XA 3VR8B 3MHSD 3KUZA 1FD6A 1KLGD 2Y5PA 1DOIA 1Z2MA 4FADA 3HUIA 4X57B 2MP2B 4NAWB 2K6QA 2LZ6A 3BY4B 1YNTE 2LGIA 4A8XC 4WJOA 2B76B 2BYVE 2N9KA 3Q3NC 2BT6A 1E7PB 4ZRIA 1ZKHA 2KC1A 3APCA 3V05A 3K9OB 2L0TA 4BKSA 3MJ5A 1D5MC 3VUYA 3RNFC 3VFKA 2ZVNA 3WCQA 3ABVB 1SE2A 3NVYA 3RNAC 1V86A 2KWVB 4EZLA 2DAJA 2L00B 2B3AA 4J6IA 3EFUA 2DZJA 2K5PA 1L5PA 1WE6A 4EFOA 2NCNA 3P63A 1YQ4B 1U4AA 2KDEB 2INDC 2WXIA 3AH7A 3PREA 3AV8A 3WAOA 4IWQA 4FHJA 2PE9A 4YSYB 1BMLC 3VUWA 2O2VA 1YN4A 1SJED 4LTUA 2L83A 3CMMB 4MGZE 1MHHE 3MP9A 4ZYNA 4JGHB 4HXDA 2JRIB 4YL8A 2MA9B 2ZW1A 1TBEA 3EGRA 4XX5A 2L32A 2KQSA 1T0QC 3V62A 4HPLB 3RMKC 3PT2B 2XK5B 4JX1C 4MM3B 4C7YA 3NZ3A 4II3B 1WJUA 1SE9A 4KGTA 2G3QB 2WXPA 2OHFA 2G9HD 3CIRB 1BXTA 3GE8C 2K39A 5CHFA 2N9XA 3GB1A 2ASQA 3ZNID 2K0PA 1WXSA 5EDSA 1C9FA 1RFKA 2E3TA 4LDTD 5HG2A 2VZKD 2RD0A 5FK9C 1L0YB 4MSMB 1P98A 2GLSA 1GB1A 4FXCA 2WX0A 3NZSA 1V6EA 4RGNA 5JXVA 5T8IA 1ISNA 5IP4D 1JROA 2MLBA 2RDBC 5BMIA 4M00A 1UNSA 2LGDA 1Z5SB 3N1ZC 2KZRA 4KKIA 3GS2A 3HM3A 3SR6A 2DZKA 1L0VB 1C4PA 4XDDA 2NBUA 1M94A 1JRUA 4K3BA 1R4MI 3PLUA 4MDKE 2EELA 2J53A 4OZBA 3MC0B 2PVOD 4JL9A 4HVBA 5BMGA 4K7SA 3ECIA 3HM6X 2IO1B 3IT6B 2X38A 1XLOA 4ANVA 2MJDA 3A9JA 1L7YA 4NPNA 4LNKA 3AN1A 1MHXA 3ZRFA 1EWCA 3N3KB 1YJJA 1V80A 3O13A 5G2NA 1XLNA 1ZW7A 1QT9A 2LVPA 4HCPB 1GC6A 4FJVB 4ZRJA 2NTTA 4YXDB 2JZ3B 3W5UB 4NNJB 1LM8B 1TT5B 2WXJA 2CJNA 2MH7A 2BQQA 1EWYC 2IYDB 4YTNB 2YEPB 2KT7A 3VTWA 2N0SB 1WR6E 3M63B 1KRHA 3I57A 3QA8A 1KOTA 2BS3B 4C00A 3DHIC 2FCNA 2FUG1 2OOBB 3WAMA 2KOXA 3P2BA 1ET9A 4ICVA 2KLGA 5AZFA 2GOWA 3NVWA 1K51A 3P4RB 5J2RA 1D5XC 4BOZB 1EU3A 1FEHA 2BWFA 2KC2A 3SHQA 1BUIC 2O6VB 3AXCA 2LASA 1WGHA 1V1OA 4AP4C 4RH6A 3B1LX 3QQ8B 4XGAB 5AUIA 4WWNA 2IBIB 1QOFA 4L23A 4AJYB 2CU1A 3VVWB 2V4IB 4E74A 3UI3A 4PS8A 1N6ZA 1WJ6A 3L08A 4HROA 3O65B 3QHTA 1VR9A 3L16A 4GLSC 3Q8EA 3SDLC 2M1MA 4XC2A 4IM3A 1VDVA 2QHOA 4MGYE 4I6PA 3Q8FA 2DAFA 1HQRD 2WQYB 4IKGA 2WWZA 4BBNC 4MH0E 1YJ1A 1JWSD 3H7PA 2KQ7A 3ZO5B 1XEEA 2KMCA 5J17A 3RN9C 4OVUA 1EM7A 1NBFC 4OZCA 3NY5A 1STEA 2K8CA 4K7UA 4D2KA 4EE2A 1FCCC 2HDEA 2L0FA 4LJPB 1YIWA 5G5HA 2WXQA 5H92C 1WXMA 3MJWA 1LXDA 2KDBA 2AL3A 1S3SG 2PMVA 1PYWD 1T3QA 2WXMA 2V3SA 2R2OA 4MT5A 4AOFA 4C7ZA 3LXFA 1OQYA 1E9MA 2FCMA 1QQRA 3DVGX 3GZNI 3I3TB 1SEBD 2K6DB 2DBYA 4K1RB 3BIID 5GXGB 3NZUA 2EKEC 2N4FA 1I4PA 4C4VB 3TCAA 2UYZB 3DHGC 1KLVA 2CJOA 1FXTB 3U8ZA 1FIQA 4NAWA 2LUMA 3ZNZB 3NS8A 4YTMB 3VR9B 5E6NA 3L13A 3ML9A 5AZHA 1NI2A 3BYYB 2PEAA 2NBWB 2L8JA 4OZAA 1JQ4A 1SIJA 4WJPA 4US8A 2CR5A 4HEA1 1D4BA 1KTKA 3DBLI 2DHZA 4G0NB 4K3CA 1ZXHA 4IUMB 1UGMA 3HHMA 4RNAA 3NHEB 5D3DA 2KVRA 3KWLA 3U52E 2VZKB 1XLPA 1DOYA 3S2AA 1UELA 2D5GA 4GMVA 1FNVA 2DNFA 3QK0A 4ANUA 2KQ4X 3LB8C 2A5UA 1F52A 2WXGA 5CX3A 1IBXB 2D2QA 2K1FA 2KAJA 5BMHA 3RT3B 3DBHI 2LD9A 2IZVB 2NBVB 3U7ZA 4B0EA 1K8RB 4W9GA 1Q5WB 3DHHC 1E6EB 3I9V1 1E8ZA 1NENB 2KX3A 4DDID 3DBRB 1WJ4A 2KWCA 3X23A 4WQMA 1P7EA 1PFDA 4IC7B 1XF5L 2V0GA 1WJNA 4RGMA 1GOZA 3VAWA 4FJYA 1WGYA 4DXAB 3TBLD 3ZUNA 4WIPA 1TS2A 1TS3A 2KNBA 3A33B 5G5GA 3Q3OC 3TEWA 4LK0M 1I4QA 2FCSA 4P1BC 1TGZB 4ASWC 2LWPA 4JQWC 3AB5A 3R3MA 1X1MA 4G3XB 2DWQA 4OHJA 4GN1A 3WA0A 2WXOA 5EE0A 4ACFA 2H88B 2K22A 1C79A 2JU6X 2BB6A 3UIPB 3Q69A 1Y56A 1UH6A 4DHJB 5D7GA 2L76A 2Q5WD 2L1AA 4OW0A 2BKRB 1T0YA 3H8HA 3PHWB 2FNJB 3V6EB 4F1SA 4H2AA 1C4AA 2QMTA 3M95A 1SJHD 2D3CA 1ENFA 2BYTA 4ZOHC 3TSSA 3L54A 1V8CA 4A3OA 3N1XC 3AEDB 1L6VA 3SD5A 1AYFA 4M8MA 5J18A 3ZJUA 2NMQA 3A9KB 2WXHA 1VCBA 1CJEA 3VRAB 2LJ5A 5MPOA 2D3AA 1VRAB 4LDTB 1JRPA 1GPXA 4CHKA 1TS5A 2LGXA 2FIDA 4HDQA 4B6WA 4F8CB 2TSSA 3SFEB 4DDGD 4KGRA 3PPAA 1YMHE 2VRRB 3ZJVA 1FNWA 3PLVA 3W5VB 1WGRA 5TSSA 4KZ0A 5LXHA 1PDXA 1NDDA 4R3DA 4NQLB 4DK5A 2JF5A 2KDFB 2WGSA 1XXGA 2WU5B 3JSVA 3AULA 5AUKA 4A6QA 2KDIA 2LFIA 1GB4A 2MBHA 4XWTA 5EE9A 2LGSA 1TTNA 3KQ4A 2GBJA 4NJ6A 5L95C 3ML8A 2WXRA 4CO7A 4HCNB 5IN7A 3A4RA 4PYZA 2M0AA 1E5WA 2BTEA 2ZCBA 2MRPA 1FRDA 3QAQA 3B08A 2DLBA 3A9KA 3P4SB 3VXWA 2M17A 4A55A 4W9IA 4ZRKA 4DQOC 4XE0A 4A3PA 3OAWA 1YQBA 4REZA 1UUPA 4ZRQA 3DBHB 1RYJA 3RFZB 3CSFA 4DXFA 2DENB 2AQ1B 1PGXA 1TIFA 2I2YA 3WIMA 1FM0D 2JZZA 3KVFB 1OEYJ 3U4EG 1JWMD 4M0WA 1JW9D 1ET6A 4FBJB 3TL5A 1J19A 3U2SC 2ACZB 2YEPF 3AE6B 2M4NA 2SAKA 3BZDB 1FRRA 2IPKD 3RCZA 1TKYA 2IDYA 3BK2A 2MWSB 4GDLB 3RI7C 2OJWA 4FHKA 4GIVA 2L7RA 3BYTB 2OJRA 4W9HA 4II2B 3EUB2 3AECB 2WDTB 4LLGM 2ZNVB 2KDMA 2WDQB 1RWSA 4PK1A 3AE3B 3B2GA 3OLMD 3AE2B 3AEGB 4DHJD 4FULA 1AW7A 1L4ZB 2W55A 2KMMA 1UD7A 4NY0A 4G11A 1TY0A 5C1ZA 3RNBC 3VH3B 4BKSD 2KHWB 5HHDG 3IT4B 4ZYSA 2FUHB 2M0XA 4DXGA 5LNK1 4FLHA 4O1NA 1NI3A 4TUUA 5BYQA 3NRZA 1PGBA 3WAPA 3QWZB 5IKCM 1SF0A 4IWOA 2JYTA 3PRMB 1Y8RC 2BW2A 4PYUA 2XN9C 2JYEA 2MSED 1NVID 1EUVB 1QOGA 2KFKA 1YX6B 1YX5B 4RM8A 3AE1B 4IOIE 2C7HA 2MW5A 2CHWA 2XNAC 4EZKA 2BS4B 1VJKA 1YJIA 1J7CA 1VZ7A 1P0RA 1T6BX 2IGDA 5LLIA 4HLEA 5KHQA 2EMTA 5E6PA 1V1PA 1V81A 5E6OA 4N59A 2NPTB 2I38A 4W9FA 2JXTA 3VHTC 2FAZA 4C80A 1CK1A 4RCOA 2IGHA 4ZRPA 1P7FA 3UQBA 2RMMA 3DOWA 1WWTA 4EUTA 2J0MA 1J7BA 3VTUA 3ETRA 3QC8B 2WU2B 4W9LA 4P1CC 3DBRI 1R4NB 2ZW0A 5CHVC 1QLBB 4IM0A 3ZLZA 4MGIE 2BGFA 3LYYA 1EF1A 4XYCA 2D3BA 2W54A 2UU7A 1TZ1A 3R2IA 3QJZA 1WY8A 1IGDA 1ZDVA 3PTFC 2BF8B 3FILB 4AJWA 4KKJA 3PO0A 4NJ7A 2WDRB 1QKZA 4RMAA 4BAXA 3A9JB 2W3SA 3B9JA 3K9PB 2K8BA 3AMZA 4HJKA 3PRPB 4OVZA 3UINB 3V3XA 4N9F4 5AEKB 1MPEA 5G55A 1SE4A 2LMCA 2O2VB 2DYMA 4CYEA 1P3QU 1KLUD 3NG0A 1WZ0A 1RFAA 2MBEA 3C8YA 4WAAA 2EKIA 1XD3B 3AE9B 1DOXA 4KDIC 1V1PB 4NAMA 3M62B 1ROEA 2NPTA 1HZ6A 3PZDA 4MEMA 4FA6A 1MG4A 2KLCA 1FXIA 1EU4A 2L05A 1AARA 2GMIC 3C0RB 1MFWA 3AE4B 1WZ3A 1F1HA 3TJPA 2MHJA 1HEZE 3ALBA 3DPDA 3PS6A 1FFVA 1WGDA 5BYSA 4WWOA 4HKQA 4ITKA 4BBNF 2BKFA 2DYOA 1V5TA 1F9JA 2QILA 4NJCA 4AQ7A 5IO9A 3SU8X 4KDLB 1UBQA 2H89B 1Q0WB 4JWUC 4HDOA 2N7JA 2DYBA 4K7WA 5FKAC 1SGHA 1ZOYB 1NYQA 2JVCA 1UBIA 3NJTA 3OG5A 5EE3A 1WYWB 4PS3A 3R7RA 4W9EA 3A4SC 4L2YA 3R7QA 4KV2A 3JW0X 1MG8A 2PTLA 3ZIMA 2VH2A 3I5JC 4LNFA 3AEAB 3CF6E 4LNIA 4TQ0A 4AWJA 1D5ZC 3ZDMC 4ZDVA 1K52A 2ZNVC 2KX0A 1ZXIA 2GBRA 1FXAA 4GU2A 1IP9A 1FCLA 3URYA 4Q2JA 1NYRA 1Q1OA 1SIFA 1YOVB 2QSDA 1ZE3D 2LHDA 1A5RA 2KD0A 2G45B 4HKZE 2N9LA 2NVUI 4RM9A 3V61A 1V2YA 4GGQA 3NUHB 4KIKB 1EO6A 4KSLC 1F2RC 3SEBA 4WH4A 2KTRA 3DCGA 3KLSX 4YSXB 5BYRA 3IG3A 1LFDA 3DVGY 1VLBA 3AE5B 2R2QA 2MJ3A 1D3ZA 1L2NA 2WXLA 1I4RA 4HRSA 3QCAA 3L10B 2PJHA 1KJTA 1QILA 1TJEA 2YVCA 3TUOA 1GAQB 3MFGA 2HTHA 4B0MA 1WIAA 5E6JA 4IWPA 3KYCD 2L52A 3L4PA 2M8SA 3HK0A 2LI5A 2RDHA 1A70A 1D6EC 5D2MB 2WXFA 2BB5A 3Q14C 2AQ2B 2CKHB 3H7PB 3EC8A 1AWDA 2QJLA 3DWMA 4ZHPA 4RGOS 1HTQA 4KSKC 4J3OD 3T8MA 1L0XB 3QX1A 1R4NI 2MBBB 2KJ6A 5HKHA
chains in the Genus database with same CATH topology
3PVLA 1E7UA 1NDDA 2BPSA 2V4LA 4NQKE 4IM2A 2I1KA 4NQLB 4BKTA 2JF5A 2KDFB 2NBUA 2ZPNA 1M94A 4DK5A 1JRUA 5FR6A 4MSQB 2CHZA 2KKCA 2C7MB 3JSVA 1R4MI 3PLUA 3AULA 4MDKE 2KDIA 4I6NB 4TV3A 2MBHA 2KJHB 2XEWA 4JL9A 4HVBA 1WGGA 4K7SA 5GMVA 3RYTA 1TTNA 3ECIA 2GBJA 4NJ6A 3HM6X 2HD5B 2IO1B 3LDZE 5L95C 2Z59B 3ML8A 5DPSA 3WALA 4BVUC 4CO7A 4HCNB 4W9DA 4M0WB 3PV1A 4ANVA 3A4RA 3A9JA 1WMHB 4TQ1A 4PYZA 1L7YA 4NPNA 1E5WA 5IA7A 3ZRFA 3N3KB 3ONSA 1V80A 2BYFA 2MRPA 2ZCBA 5G2NA 4EEWA 1ZW7A 2IO2B 3HIZA 3QAQA 2LVPA 2HJ8A 4HCPB 5DCNA 1GC6A 3B08A 2N1VA 3ZTDA 4FJVB 4ZRJA 2D10A 2JZ3B 3A9KA 4NNJB 3UQAA 3VXWA 3QIJA 5DPTA 1LM8B 2M17A 1XQQA 2YLMA 3MTNB 4W9IA 4ZRKA 3U30A 3VTVA 3H1UA 3X0WA 1WR1A 3RZWC 4A3PA 4MGKE 5KHOA 2IYDB 2N7DA 3ZDTA 2ZCCA 4EOYA 1GC7A 3OAWA 1YQBA 5DPRA 3VTWA 1P9DU 3V6CB 1WR6E 1WFYA 3H7SA 3M63B 3CSFA 1E7VA 2IY0B 3QA8A 3PHXB 1KOTA 4LJOB 4GB9A 2KJRA 3D32A 2DENB 4ICUA 2FCNA 2C7NB 2OOBB 2LVQA 2MQJA 3IHPC 2UWQA 3WAMA 4JLCA 2JZZA 3WIMA 2KOXA 3P2BA 3KVFB 2ZZPB 4MJSB 1OEYJ 4ICVA 2KLGA 5AZFA 2GOWA 1RLFA 2MP2A 1IPGA 1E8XA 5J2RA 3AI5A 3T9LA 1IYFA 2LUEA 4BOZB 4FBJB 2HE7A 2BWFA 2KC2A 1J19A 4GXBA 2REXA 3SHQA 3TL5A 4TKNA 2O6VB 3AXCA 2LASA 1WGHA 4AP4C 3ZKJC 1V5OA 3PSEB 2M4NA 3B1LX 2LXCA 3QQ8B 3RCZA 2ZEQA 4WWNA 1S1QB 3IVFA 2IBIB 4W9KA 2MWSB 1H8CA 4BKGA 2DZIA 4GDLB 2KWUB 4M8NA 4GDKB 4AJYB 2CU1A 4GSWA 4FHKA 4GIVA 3VVWB 2L7RA 4E74A 4W9HA 2OJRA 4II2B 2XK5A 5L83A 1H4RA 4FJZA 2WDTB 4ANWA 3JYUA 2ZNVB 4PS8A 1WJ6A 3ZVVA 2XBBC 4DHZB 1GG3A 3L08A 3O65B 3Q3JA 3OLMD 1WX9A 3QHTA 4DHJD 4FULA 4WJQA 1BT0A 1UD7A 4NY0A 2LVOA 3N30A 3L16A 3JVZX 4G11A 2IO3B 4KIKA 3RZFA 5C1ZA 4E3CA 3R66C 3SDLC 4GDKA 3ENEA 3VH3B 2KHWB 2J0JA 2M1MA 4XC2A 4BKSD 4IM3A 4KZCA 3W1SC 2MBOA 3A1QA 2FUHB 2QHOA 4MGYE 4I6PA 2C5LC 2N1WA 1YD8U 2AYOB 2DAFA 2M0XA 4FLHA 3PRZA 1KM7A 2EMSA 2WWZA 4BBNC 1WXAA 4MH0E 1E8WA 1WX8A 1YJ1A 4TUUA 1WE7A 3UF8A 3H7PA 2KQ7A 3ZO5B 3VQIA 3WAPA 3QWZB 4IWOA 5JZEB 4URKA 3PRMB 2KMCA 4MJSA 5J17A 1XT9B 2G4DB 1Y8RC 2KK8A 2WYQA 4OVUA 3B0AA 2MBQA 3KUCB 4K81A 2KMAA 2FIFA 1NBFC 2CS4A 4PYUA 2MSED 2K8HA 2RR9A 3DQVA 3KUDB 3KH0A 2PPHA 3NY5A 3UGBB 1I42A 5JH5C 1EUVB 2K8CA 2KFKA 1YX6B 4K7UA 3VDZA 1YX5B 4MELA 4RM8A 3ZNHB 2C7HA 2MW5A 2CHWA 3OJ3A 2IY1B 2L0FA 4LJPB 5IAAC 4EZKA 1OGWA 4F7ZA 1YIWA 3JSVB 4HPMB 1WXMA 1LXDA 2KDBA 1P0RA 3MJWA 3DDCB 2CHXA 2GBKA 5BO4B 5LLIA 4HLEA 2AL3A 1S3SG 5KHQA 4W9JA 1WF9A 2D07B 5D94A 2EMTA 5E6PA 2MCNB 4EKUA 1V81A 5E6OA 4A20A 2NPTB 2ZPYA 4W9FA 1GJZA 3M3JA 4JIOU 3VHTC 2FAZA 2R2OA 2V3SA 3N32A 2LGYA 4AOFA 2MX2A 3APFA 2BYEA 4PS7A 1OQYA 4MM3A 3OJ4B 2FCMA 3GZNI 1GUAB 3DVGX 4ANXA 3I3TB 4BOSC 3UQBA 2K6DB 4K1RB 4KVGB 4WJNA 1PQSA 2W9NA 2NS5A 3DOWA 2RGFA 1P1AA 4GDLA 4EUTA 2J0MA 3VTUA 3NZUA 2EKEC 3EECA 3V60A 3QC8B 5DPWA 3DVNV 2N4FA 4WQOB 4W9LA 4WWPA 2C60A 3H9DA 3TCAA 2K25A 2UYZB 1KLVA 3DBRI 1FXTB 2KTFA 3U8ZA 2L3ZA 3TMPB 5CHVC 3L17A 4NAWA 2O6VD 3ZNZB 3NS8A 4IM0A 3ZLZA 4MGIE 2BGFA 3DBSA 1EF5A 4DBGA 1EF1A 5E6NA 3L13A 3ML9A 5AZHA 5C23A 1TZ1A 1NI2A 3QJZA 2PEAA 2NBWB 1WM3A 1WY8A 2L8JA 3DVNU 2BF8B 3PTFC 4AJWA 4DHZE 4NJ7A 1CMXB 2PE6B 4WJPA 2NR2A 4I6LB 1WM2A 4RMAA 4OVVA 3A9JB 4B95A 2CR5A 2JPHA 2N9EB 2V1YA 2RSUA 4G50A 4HK2A 1RRBA 3RULA 3K9PB 2FCQA 2N7EA 3U7DA 2K8BA 5CHWA 4HJKA 3DBLI 1V49A 2DHZA 3PRPB 4G0NB 3UINB 4N9F4 5AEKB 1J8CA 4IUMB 5G55A 1UGMA 2D11A 1OTRB 2O2VB 3HHMA 2BWES 3NHEB 2DYMA 2KVRA 4CYEA 5LXIB 1P3QU 1WZ0A 1RFAA 2GBNA 2MBEA 2DZMA 2Z0EB 4WAAA 3APDA 1XD3B 2LXAA 3S2AA 4KDIC 5JHAA 4EZJA 1UELA 3M62B 2NPTA 1G6JA 4GMVA 3PZDA 4MEMA 4FA6A 3QK0A 2KLCA 1RAXA 2I1JA 2L05A 3LJ3A 1AARA 2GBMA 2GMIC 1UZXB 2A5UA 3C0RB 4ANUA 1WZ3A 5CX3A 3Q3FA 3VUXA 2D3GA 2D2QA 3TJPA 3RD2A 1I35A 2K1FA 1ZGUB 2WX1A 1V9JA 3ALBA 2KO3A 3DPDA 3PS6A 3RT3B 1WGDA 1WXVA 3KW5B 3MHSD 3DBHI 4WWOA 3KUZA 1WRDB 2LD9A 2IZVB 4BBNF 2NBVB 2JUOA 1GNUA 2KN5A 4DWFA 1K8RB 2BKFA 2DYOA 4W9GA 4GOCA 1V5TA 1Z2MA 4FADA 1Q5WB 3KYDD 1F9JA 1E8ZA 4IG7B 2KX3A 4DDID 3SU8X 4X57B 4KDLB 1WI0A 4HWIB 2MP2B 1UBQA 4NAWB 1WJ4A 2K6QA 2KWCA 2LZ6A 5D6JB 3X23A 3BY4B 2KTRB 2Z0DB 4WJOA 2BYVE 1OEYA 4IC7B 4ZRIA 1Q0WB 5LXHA 1ZKHA 1WJNA 2C9WB 2KC1A 3APCA 4AUQC 3VAWA 3K9OB 2L0TA 4BKSA 3AU4A 4FJYA 4HDOA 1WGYA 2DYBA 1C1YB 4K7WA 4DXAB 3TBLD 1SGHA 3VUYA 3PGEA 3ZUNA 2JVCA 1HE8A 1UBIA 3A1QB 1WYWB 4PS3A 3R7RA 2KNBA 3A33B 4W9EA 2ZVNA 3A4SC 3VFKA 5JHBA 2LRWA 3R7QA 4KV2A 3JW0X 1MG8A 3VH4B 2FCSA 3ZIMA 4B9KA 2G4SA 2IO0B 1TGZB 2AEHA 4ASWC 2LWPA 3UIOB 1V86A 2KWVB 3CF6E 4JQWC 4TQ0A 2DAJA 4BFRA 4EZLA 2L00B 2B3AA 4AWJA 2LRUA 2Y5BB 4LCDE 3R3MA 4J6IA 1X1MA 3EFUA 4G3XB 3ZDMC 4ZDVA 2DZJA 2A4ZA 3NOBA 4GN1A 3WA0A 1E90A 2ZNVC 1WE6A 4EFOA 2NCNA 2KX0A 1U4AA 2KANA 2KDEB 2JT4B 2KXJA 2GBRA 3L0WB 4W9CA 3ZW3A 3PREA 3WAOA 3UIPB 5AZGA 1J0GA 1VD2A 2AWTA 4FN2A 4GU2A 4IWQA 4FHJA 3RUIB 2PE9A 3TIXA 5TR5A 1UH6A 1IP9A 3IBEA 4DHJB 1LQBA 3VUWA 2O2VA 5D7GA 2L76A 3ZNGC 2BKRB 1Q1OA 1SIFA 1T0YA 2O6VA 3ZTCA 1WH3A 3ZRCA 3CMMB 4MGZE 3PHWB 1A5RA 2FNJB 2KD0A 3V6EB 2G45B 4F1SA 4ZYNA 4JGHB 3BINA 3H6NA 4HXDA 2JRIB 2NVUI 4RM9A 4YL8A 2KFJA 2MA9B 1V2YA 3V61A 4GGQA 1TBEA 4KIKB 3W1YA 4XX5A 4E71A 3QARA 2KQSA 3M95A 1EO6A 4KSLC 2KFKB 3V62A 1WMHA 4HPLB 3PT2B 2XK5B 2JY6A 2KTRA 3DCGA 2DX5B 1WX7A 3CSTA 3L54A 4II3B 4A3OA 5CTRC 1WJUA 1SE9A 3IG3A 1LFDA 2G3QB 3DVGY 3SD5A 2R2QA 1QZEA 4IW0A 1D3ZA 4M8MA 5J18A 1L2NA 2J7QB 3A9KB 1VCBA 2JWZA 2K39A 3QCAA 5CHFA 2N9XA 3L10B 2AL6A 4XZ4A 2LJ5A 2PJHA 2ASQA 1KJTA 3ZNID 2YVCA 3WANA 3GOEA 1WXSA 2HTHA 3IFWB 5EDSA 1WIAA 3AU5A 4IWPA 4LDTB 4CHKA 2ZVOA 2LGXA 4LDTD 3KYCD 2FIDA 2RD0A 3EHVA 4HDQA 2M8SA 2J0KA 3HK0A 2LI5A 4B6WA 1C3TA 2RPQA 2ZJDA 5D2MB 4F8CB 4MSMB 1P98A 4P7IA 2N9PC 2WX0A 2CKHB 3NZSA 1V6EA 3H7PB 4DDGD 1E8YA 3EC8A 3PPAA 2VRRB 3W1SA 1ISNA 4KSKC 2JRHA 2MLBA 3T8MA 2LGDA 3PLVA 3QX1A 1Z5SB 1R4NI 2MBBB 1WGRA 2KZRA 3HM3A 4KZ0A 2JXXA 2DZKA 2KJ6A 5HKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PVL A;  1E7U A;  1NDD A;  2BPS A;  2V4L A;  4NQK E;  4IM2 A;  2I1K A;  4NQL B;  4BKT A;  2JF5 A;  2KDF B;  2NBU A;  2ZPN A;  1M94 A;  4DK5 A;  1JRU A;  5FR6 A;  4MSQ B;  2CHZ A;  2KKC A;  2C7M B;  3JSV A;  1R4M I;  3PLU A;  3AUL A;  4MDK E;  2KDI A;  4I6N B;  4TV3 A;  2MBH A;  2KJH B;  2XEW A;  4JL9 A;  4HVB A;  1WGG A;  4K7S A;  5GMV A;  3RYT A;  1TTN A;  3ECI A;  2GBJ A;  4NJ6 A;  3HM6 X;  2HD5 B;  2IO1 B;  3LDZ E;  5L95 C;  2Z59 B;  3ML8 A;  5DPS A;  3WAL A;  4BVU C;  4CO7 A;  4HCN B;  4W9D A;  4M0W B;  3PV1 A;  4ANV A;  3A4R A;  3A9J A;  1WMH B;  4TQ1 A;  4PYZ A;  1L7Y A;  4NPN A;  1E5W A;  5IA7 A;  3ZRF A;  3N3K B;  3ONS A;  1V80 A;  2BYF A;  2MRP A;  2ZCB A;  5G2N A;  4EEW A;  1ZW7 A;  2IO2 B;  3HIZ A;  3QAQ A;  2LVP A;  2HJ8 A;  4HCP B;  5DCN A;  1GC6 A;  3B08 A;  2N1V A;  3ZTD A;  4FJV B;  4ZRJ A;  2D10 A;  2JZ3 B;  3A9K A;  4NNJ B;  3UQA A;  3VXW A;  3QIJ A;  5DPT A;  1LM8 B;  2M17 A;  1XQQ A;  2YLM A;  3MTN B;  4W9I A;  4ZRK A;  3U30 A;  3VTV A;  3H1U A;  3X0W A;  1WR1 A;  3RZW C;  4A3P A;  4MGK E;  5KHO A;  2IYD B;  2N7D A;  3ZDT A;  2ZCC A;  4EOY A;  1GC7 A;  3OAW A;  1YQB A;  5DPR A;  3VTW A;  1P9D U;  3V6C B;  1WR6 E;  1WFY A;  3H7S A;  3M63 B;  3CSF A;  1E7V A;  2IY0 B;  3QA8 A;  3PHX B;  1KOT A;  4LJO B;  4GB9 A;  2KJR A;  3D32 A;  2DEN B;  4ICU A;  2FCN A;  2C7N B;  2OOB B;  2LVQ A;  2MQJ A;  3IHP C;  2UWQ A;  3WAM A;  4JLC A;  2JZZ A;  3WIM A;  2KOX A;  3P2B A;  3KVF B;  2ZZP B;  4MJS B;  1OEY J;  4ICV A;  2KLG A;  5AZF A;  2GOW A;  1RLF A;  2MP2 A;  1IPG A;  1E8X A;  5J2R A;  3AI5 A;  3T9L A;  1IYF A;  2LUE A;  4BOZ B;  4FBJ B;  2HE7 A;  2BWF A;  2KC2 A;  1J19 A;  4GXB A;  2REX A;  3SHQ A;  3TL5 A;  4TKN A;  2O6V B;  3AXC A;  2LAS A;  1WGH A;  4AP4 C;  3ZKJ C;  1V5O A;  3PSE B;  2M4N A;  3B1L X;  2LXC A;  3QQ8 B;  3RCZ A;  2ZEQ A;  4WWN A;  1S1Q B;  3IVF A;  2IBI B;  4W9K A;  2MWS B;  1H8C A;  4BKG A;  2DZI A;  4GDL B;  2KWU B;  4M8N A;  4GDK B;  4AJY B;  2CU1 A;  4GSW A;  4FHK A;  4GIV A;  3VVW B;  2L7R A;  4E74 A;  4W9H A;  2OJR A;  4II2 B;  2XK5 A;  5L83 A;  1H4R A;  4FJZ A;  2WDT B;  4ANW A;  3JYU A;  2ZNV B;  4PS8 A;  1WJ6 A;  3ZVV A;  2XBB C;  4DHZ B;  1GG3 A;  3L08 A;  3O65 B;  3Q3J A;  3OLM D;  1WX9 A;  3QHT A;  4DHJ D;  4FUL A;  4WJQ A;  1BT0 A;  1UD7 A;  4NY0 A;  2LVO A;  3N30 A;  3L16 A;  3JVZ X;  4G11 A;  2IO3 B;  4KIK A;  3RZF A;  5C1Z A;  4E3C A;  3R66 C;  3SDL C;  4GDK A;  3ENE A;  3VH3 B;  2KHW B;  2J0J A;  2M1M A;  4XC2 A;  4BKS D;  4IM3 A;  4KZC A;  3W1S C;  2MBO A;  3A1Q A;  2FUH B;  2QHO A;  4MGY E;  4I6P A;  2C5L C;  2N1W A;  1YD8 U;  2AYO B;  2DAF A;  2M0X A;  4FLH A;  3PRZ A;  1KM7 A;  2EMS A;  2WWZ A;  4BBN C;  1WXA A;  4MH0 E;  1E8W A;  1WX8 A;  1YJ1 A;  4TUU A;  1WE7 A;  3UF8 A;  3H7P A;  2KQ7 A;  3ZO5 B;  3VQI A;  3WAP A;  3QWZ B;  4IWO A;  5JZE B;  4URK A;  3PRM B;  2KMC A;  4MJS A;  5J17 A;  1XT9 B;  2G4D B;  1Y8R C;  2KK8 A;  2WYQ A;  4OVU A;  3B0A A;  2MBQ A;  3KUC B;  4K81 A;  2KMA A;  2FIF A;  1NBF C;  2CS4 A;  4PYU A;  2MSE D;  2K8H A;  2RR9 A;  3DQV A;  3KUD B;  3KH0 A;  2PPH A;  3NY5 A;  3UGB B;  1I42 A;  5JH5 C;  1EUV B;  2K8C A;  2KFK A;  1YX6 B;  4K7U A;  3VDZ A;  1YX5 B;  4MEL A;  4RM8 A;  3ZNH B;  2C7H A;  2MW5 A;  2CHW A;  3OJ3 A;  2IY1 B;  2L0F A;  4LJP B;  5IAA C;  4EZK A;  1OGW A;  4F7Z A;  1YIW A;  3JSV B;  4HPM B;  1WXM A;  1LXD A;  2KDB A;  1P0R A;  3MJW A;  3DDC B;  2CHX A;  2GBK A;  5BO4 B;  5LLI A;  4HLE A;  2AL3 A;  1S3S G;  5KHQ A;  4W9J A;  1WF9 A;  2D07 B;  5D94 A;  2EMT A;  5E6P A;  2MCN B;  4EKU A;  1V81 A;  5E6O A;  4A20 A;  2NPT B;  2ZPY A;  4W9F A;  1GJZ A;  3M3J A;  4JIO U;  3VHT C;  2FAZ A;  2R2O A;  2V3S A;  3N32 A;  2LGY A;  4AOF A;  2MX2 A;  3APF A;  2BYE A;  4PS7 A;  1OQY A;  4MM3 A;  3OJ4 B;  2FCM A;  3GZN I;  1GUA B;  3DVG X;  4ANX A;  3I3T B;  4BOS C;  3UQB A;  2K6D B;  4K1R B;  4KVG B;  4WJN A;  1PQS A;  2W9N A;  2NS5 A;  3DOW A;  2RGF A;  1P1A A;  4GDL A;  4EUT A;  2J0M A;  3VTU A;  3NZU A;  2EKE C;  3EEC A;  3V60 A;  3QC8 B;  5DPW A;  3DVN V;  2N4F A;  4WQO B;  4W9L A;  4WWP A;  2C60 A;  3H9D A;  3TCA A;  2K25 A;  2UYZ B;  1KLV A;  3DBR I;  1FXT B;  2KTF A;  3U8Z A;  2L3Z A;  3TMP B;  5CHV C;  3L17 A;  4NAW A;  2O6V D;  3ZNZ B;  3NS8 A;  4IM0 A;  3ZLZ A;  4MGI E;  2BGF A;  3DBS A;  1EF5 A;  4DBG A;  1EF1 A;  5E6N A;  3L13 A;  3ML9 A;  5AZH A;  5C23 A;  1TZ1 A;  1NI2 A;  3QJZ A;  2PEA A;  2NBW B;  1WM3 A;  1WY8 A;  2L8J A;  3DVN U;  2BF8 B;  3PTF C;  4AJW A;  4DHZ E;  4NJ7 A;  1CMX B;  2PE6 B;  4WJP A;  2NR2 A;  4I6L B;  1WM2 A;  4RMA A;  4OVV A;  3A9J B;  4B95 A;  2CR5 A;  2JPH A;  2N9E B;  2V1Y A;  2RSU A;  4G50 A;  4HK2 A;  1RRB A;  3RUL A;  3K9P B;  2FCQ A;  2N7E A;  3U7D A;  2K8B A;  5CHW A;  4HJK A;  3DBL I;  1V49 A;  2DHZ A;  3PRP B;  4G0N B;  3UIN B;  4N9F 4;  5AEK B;  1J8C A;  4IUM B;  5G55 A;  1UGM A;  2D11 A;  1OTR B;  2O2V B;  3HHM A;  2BWE S;  3NHE B;  2DYM A;  2KVR A;  4CYE A;  5LXI B;  1P3Q U;  1WZ0 A;  1RFA A;  2GBN A;  2MBE A;  2DZM A;  2Z0E B;  4WAA A;  3APD A;  1XD3 B;  2LXA A;  3S2A A;  4KDI C;  5JHA A;  4EZJ A;  1UEL A;  3M62 B;  2NPT A;  1G6J A;  4GMV A;  3PZD A;  4MEM A;  4FA6 A;  3QK0 A;  2KLC A;  1RAX A;  2I1J A;  2L05 A;  3LJ3 A;  1AAR A;  2GBM A;  2GMI C;  1UZX B;  2A5U A;  3C0R B;  4ANU A;  1WZ3 A;  5CX3 A;  3Q3F A;  3VUX A;  2D3G A;  2D2Q A;  3TJP A;  3RD2 A;  1I35 A;  2K1F A;  1ZGU B;  2WX1 A;  1V9J A;  3ALB A;  2KO3 A;  3DPD A;  3PS6 A;  3RT3 B;  1WGD A;  1WXV A;  3KW5 B;  3MHS D;  3DBH I;  4WWO A;  3KUZ A;  1WRD B;  2LD9 A;  2IZV B;  4BBN F;  2NBV B;  2JUO A;  1GNU A;  2KN5 A;  4DWF A;  1K8R B;  2BKF A;  2DYO A;  4W9G A;  4GOC A;  1V5T A;  1Z2M A;  4FAD A;  1Q5W B;  3KYD D;  1F9J A;  1E8Z A;  4IG7 B;  2KX3 A;  4DDI D;  3SU8 X;  4X57 B;  4KDL B;  1WI0 A;  4HWI B;  2MP2 B;  1UBQ A;  4NAW B;  1WJ4 A;  2K6Q A;  2KWC A;  2LZ6 A;  5D6J B;  3X23 A;  3BY4 B;  2KTR B;  2Z0D B;  4WJO A;  2BYV E;  1OEY A;  4IC7 B;  4ZRI A;  1Q0W B;  5LXH A;  1ZKH A;  1WJN A;  2C9W B;  2KC1 A;  3APC A;  4AUQ C;  3VAW A;  3K9O B;  2L0T A;  4BKS A;  3AU4 A;  4FJY A;  4HDO A;  1WGY A;  2DYB A;  1C1Y B;  4K7W A;  4DXA B;  3TBL D;  1SGH A;  3VUY A;  3PGE A;  3ZUN A;  2JVC A;  1HE8 A;  1UBI A;  3A1Q B;  1WYW B;  4PS3 A;  3R7R A;  2KNB A;  3A33 B;  4W9E A;  2ZVN A;  3A4S C;  3VFK A;  5JHB A;  2LRW A;  3R7Q A;  4KV2 A;  3JW0 X;  1MG8 A;  3VH4 B;  2FCS A;  3ZIM A;  4B9K A;  2G4S A;  2IO0 B;  1TGZ B;  2AEH A;  4ASW C;  2LWP A;  3UIO B;  1V86 A;  2KWV B;  3CF6 E;  4JQW C;  4TQ0 A;  2DAJ A;  4BFR A;  4EZL A;  2L00 B;  2B3A A;  4AWJ A;  2LRU A;  2Y5B B;  4LCD E;  3R3M A;  4J6I A;  1X1M A;  3EFU A;  4G3X B;  3ZDM C;  4ZDV A;  2DZJ A;  2A4Z A;  3NOB A;  4GN1 A;  3WA0 A;  1E90 A;  2ZNV C;  1WE6 A;  4EFO A;  2NCN A;  2KX0 A;  1U4A A;  2KAN A;  2KDE B;  2JT4 B;  2KXJ A;  2GBR A;  3L0W B;  4W9C A;  3ZW3 A;  3PRE A;  3WAO A;  3UIP B;  5AZG A;  1J0G A;  1VD2 A;  2AWT A;  4FN2 A;  4GU2 A;  4IWQ A;  4FHJ A;  3RUI B;  2PE9 A;  3TIX A;  5TR5 A;  1UH6 A;  1IP9 A;  3IBE A;  4DHJ B;  1LQB A;  3VUW A;  2O2V A;  5D7G A;  2L76 A;  3ZNG C;  2BKR B;  1Q1O A;  1SIF A;  1T0Y A;  2O6V A;  3ZTC A;  1WH3 A;  3ZRC A;  3CMM B;  4MGZ E;  3PHW B;  1A5R A;  2FNJ B;  2KD0 A;  3V6E B;  2G45 B;  4F1S A;  4ZYN A;  4JGH B;  3BIN A;  3H6N A;  4HXD A;  2JRI B;  2NVU I;  4RM9 A;  4YL8 A;  2KFJ A;  2MA9 B;  1V2Y A;  3V61 A;  4GGQ A;  1TBE A;  4KIK B;  3W1Y A;  4XX5 A;  4E71 A;  3QAR A;  2KQS A;  3M95 A;  1EO6 A;  4KSL C;  2KFK B;  3V62 A;  1WMH A;  4HPL B;  3PT2 B;  2XK5 B;  2JY6 A;  2KTR A;  3DCG A;  2DX5 B;  1WX7 A;  3CST A;  3L54 A;  4II3 B;  4A3O A;  5CTR C;  1WJU A;  1SE9 A;  3IG3 A;  1LFD A;  2G3Q B;  3DVG Y;  3SD5 A;  2R2Q A;  1QZE A;  4IW0 A;  1D3Z A;  4M8M A;  5J18 A;  1L2N A;  2J7Q B;  3A9K B;  1VCB A;  2JWZ A;  2K39 A;  3QCA A;  5CHF A;  2N9X A;  3L10 B;  2AL6 A;  4XZ4 A;  2LJ5 A;  2PJH A;  2ASQ A;  1KJT A;  3ZNI D;  2YVC A;  3WAN A;  3GOE A;  1WXS A;  2HTH A;  3IFW B;  5EDS A;  1WIA A;  3AU5 A;  4IWP A;  4LDT B;  4CHK A;  2ZVO A;  2LGX A;  4LDT D;  3KYC D;  2FID A;  2RD0 A;  3EHV A;  4HDQ A;  2M8S A;  2J0K A;  3HK0 A;  2LI5 A;  4B6W A;  1C3T A;  2RPQ A;  2ZJD A;  5D2M B;  4F8C B;  4MSM B;  1P98 A;  4P7I A;  2N9P C;  2WX0 A;  2CKH B;  3NZS A;  1V6E A;  3H7P B;  4DDG D;  1E8Y A;  3EC8 A;  3PPA A;  2VRR B;  3W1S A;  1ISN A;  4KSK C;  2JRH A;  2MLB A;  3T8M A;  2LGD A;  3PLV A;  3QX1 A;  1Z5S B;  1R4N I;  2MBB B;  1WGR A;  2KZR A;  3HM3 A;  4KZ0 A;  2JXX A;  2DZK A;  2KJ6 A;  5HKH A; 
#chains in the Genus database with same CATH topology
 3PVL A;  1E7U A;  2V4L A;  3AM9 A;  4BKT A;  2I1K A;  3TEZ A;  2ZPN A;  4WUR A;  5FR6 A;  4MSQ B;  1CQV A;  2C7M B;  4I6N B;  4TV3 A;  2V3P A;  3VRB B;  3LDZ E;  2QIE B;  1SBB B;  4M0W B;  3RNC C;  2BYF A;  4EEW A;  2LHE A;  3HIZ A;  2HJ8 A;  2ONQ A;  4S17 A;  2K3U A;  3ZTD A;  3IAM 1;  2D10 A;  1HZ5 A;  4JE3 B;  3UQA A;  2JZP A;  1I7H A;  2YLM A;  3IXS A;  3VTV A;  3H1U A;  1WR1 A;  4MGK E;  3FAH A;  3RNE C;  1T0R C;  1C4C A;  2G1E A;  1P9D U;  1IBX A;  3CWI A;  1WYG A;  1WFY A;  3MHZ A;  1E7V A;  1WXQ A;  2KJR A;  3D32 A;  4LNO A;  3Q8A A;  4ICU A;  2FE8 A;  2LVQ A;  2UWQ A;  1AN8 A;  5I4D A;  2ZZP B;  5HI1 A;  3N20 C;  1KH0 A;  1UF0 A;  3N1Y C;  2INP E;  1TKE A;  2MP2 A;  1E8X A;  4P6V F;  2IJ0 A;  2PVG C;  3T9L A;  1IYF A;  2LUE A;  1FO4 A;  1WRI A;  4GXB A;  2WS3 B;  4A9A A;  1V5O A;  1TKG A;  2LXC A;  2QCZ A;  1R4M B;  2QC8 A;  2ZEQ A;  2BVC A;  4W9K A;  4BKG A;  2DZI A;  4M8N A;  1B9R A;  3IAS 1;  1R7S A;  2XK5 A;  1H4R A;  3ZVV A;  2XBB C;  1GG3 A;  2RDG A;  5IOI A;  1JWU D;  1I4X A;  2IGG A;  2J52 A;  4WJQ A;  1JWA D;  2MJE A;  3DBL B;  3N30 A;  3JVZ X;  1XO3 A;  2MEK A;  3FKY A;  4GDK A;  2J0J A;  2MBO A;  4M02 A;  3A1Q A;  4N58 A;  1HTO A;  2C5L C;  2N1W A;  2AYO B;  2KYW A;  4MAC A;  1VZ8 A;  1KM7 A;  1UGJ A;  2EMS A;  2HJ1 A;  1WX8 A;  1LO5 D;  1SB3 C;  2INN E;  1JAL A;  2BS2 B;  3VQI A;  2CU3 A;  2M56 B;  3FIL A;  4URK A;  2KAC A;  2KK8 A;  2WYQ A;  3B0A A;  2MBQ A;  4BZA A;  3KUC B;  2KMA A;  2CS4 A;  2K8H A;  2RR9 A;  3UGB B;  3KUD B;  5JH5 C;  4MEL A;  5D3I B;  3ZNH B;  2WNM A;  5HFY A;  1SXT A;  2IY1 B;  5IAA C;  2W82 A;  1OGW A;  2E6X A;  4F7Z A;  3JSV B;  1J7A A;  4HPM B;  1MVK A;  3DDC B;  2CHX A;  5BO4 B;  2Y3A A;  4W9J A;  2D07 B;  4A20 A;  2ZPY A;  2WHI A;  3M3J A;  4JIO U;  1FFU A;  2ICI A;  2LGY A;  2MX2 A;  3APF A;  1N63 A;  4PS7 A;  4S0R A;  4MM3 A;  3OJ4 B;  4ANX A;  2W9N A;  2RGF A;  1F2R I;  1TYG B;  3I63 C;  3V60 A;  1PGA A;  5DPW A;  4WQO B;  2C60 A;  3H9D A;  2K25 A;  2J42 A;  2LEK A;  3TMP B;  3DWG C;  2O6V D;  1IGC A;  1EF5 A;  2V9H A;  1WM3 A;  1L6U A;  1RM6 C;  2JX5 A;  1SSN A;  4DHZ E;  1CMX B;  2PE6 B;  2NR2 A;  1CZP A;  1WM2 A;  3J9C A;  1ESF A;  4OVV A;  1TS4 A;  3T3N A;  4B95 A;  2JPH A;  2N9E B;  4G50 A;  4HK2 A;  3ZXV A;  3U7D A;  1OFF A;  2FCQ A;  2N7E A;  4WAF A;  1J8C A;  1F77 A;  1XLQ A;  1DYQ A;  2M19 A;  2D11 A;  2BWE S;  5LXI B;  2Z8L A;  2GBN A;  2R61 A;  2DZM A;  2Z0E B;  3GP7 A;  1V97 A;  3APD A;  2LXA A;  3ZGZ A;  1G6J A;  4QAY A;  2GBM A;  1UZX B;  3Q3F A;  3RD2 A;  1V9J A;  2KO3 A;  4CQN A;  1N60 A;  4L1B A;  4ZHO A;  3P42 A;  1WXV A;  3KW5 B;  3AE7 B;  1WRD B;  2KWD A;  2JUO A;  1GNU A;  2KN5 A;  3Q8B A;  4DWF A;  1T5X D;  4GOC A;  3KYD D;  4IG7 B;  4YSZ B;  1WI0 A;  4HWI B;  3Q2A C;  5D6J B;  2KTR B;  2Z0D B;  4MH8 A;  4TMA B;  1OEY A;  1WSP A;  1QOA A;  2C9W B;  4AUQ C;  4WWM A;  3AU4 A;  1C1Y B;  2WDV B;  3GZN B;  3T3O A;  3PGE A;  3EFC A;  1HE8 A;  4RF0 A;  3A1Q B;  3B2F A;  3AEB B;  5JHB A;  2LRW A;  3EA6 A;  4KX6 B;  4A90 A;  2WXN A;  3VH4 B;  4YT0 B;  4B9K A;  2G4S A;  2IO0 B;  2AEH A;  1B1Z A;  3UIO B;  1F0Z A;  4BFR A;  2LRU A;  2Y5B B;  4LCD E;  4KGS A;  2A4Z A;  3NOB A;  1E90 A;  2KAN A;  2KXJ A;  3L0W B;  2JT4 B;  3NVV A;  4W9C A;  1I4G A;  3ZW3 A;  5AZG A;  1J0G A;  1VD2 A;  2AWT A;  4FN2 A;  5H8Y E;  3RUI B;  3TIX A;  5TR5 A;  3IBE A;  1TY2 A;  1LQB A;  1VZ6 A;  5C3J B;  3ZNG C;  1C78 A;  1XCT L;  3N9Y C;  3ZTC A;  2O6V A;  3P4Q B;  1WH3 A;  3ZRC A;  1LGR A;  2V3N A;  4XDC A;  1ZP0 B;  1JWB D;  3ZJT A;  3AEE B;  1OQQ A;  3BIN A;  3H6N A;  4AS1 A;  3ZXR A;  2KFJ A;  1UWM A;  2SEB D;  3W1Y A;  4E71 A;  3QAR A;  1ACC A;  2KFK B;  1WMH A;  2WLB A;  2JY6 A;  1FPY A;  2DX5 B;  1WX7 A;  3CST A;  1MI0 A;  4USA A;  5CTR C;  3BVG A;  1QZE A;  4IW0 A;  2J7Q B;  3AE8 B;  1KFY B;  2JWZ A;  1C76 A;  4XZ4 A;  2AL6 A;  3W2D A;  4YWG G;  3WAN A;  3GOE A;  3IFW B;  1T0S C;  3AU5 A;  2ZVO A;  3TEY A;  1QOB A;  2AQ3 B;  3Q8C A;  4HPP A;  3EHV A;  1C3T A;  2J0K A;  2RPQ A;  2ZJD A;  4NZL B;  4P7I A;  2N9P C;  1E8Y A;  1N62 A;  4RFB A;  2PKO A;  3W1S A;  1E10 A;  1L4D B;  3AEF B;  4C4V A;  2JRH A;  3RPF C;  3TEX A;  1N5W A;  2QEJ C;  2HTM E;  4RF1 A;  2JXX A;  2GI9 A;  2LJI A;  2BPS A;  2PIA A;  4NQK E;  4IM2 A;  1K50 A;  2AX5 A;  2CHZ A;  2KKC A;  3KWV A;  4LNN A;  4C56 C;  2KJH B;  2XEW A;  2Y5C A;  1WGG A;  5GMV A;  3RYT A;  1Q10 A;  2HD5 B;  2Z59 B;  5DPS A;  3WAL A;  4BVU C;  4W9D A;  3PV1 A;  1WMH B;  4TQ1 A;  5IA7 A;  2NTS A;  3NS1 A;  3ONS A;  2IO2 B;  1UWX A;  5DCN A;  4N6E B;  3HRD D;  2N1V A;  3GE3 C;  3QIJ A;  1ZDX A;  5DPT A;  3E56 A;  1XQQ A;  3MTN B;  3U30 A;  1IUE A;  3X0W A;  3RZW C;  5KHO A;  2WXK A;  3HVD A;  2N7D A;  3ZDT A;  2ZCC A;  4EOY A;  1GC7 A;  3E9S A;  2FBW B;  4JPS A;  5DPR A;  1YN5 A;  1ZUD 2;  3V6C B;  1NEK B;  3H7S A;  3R8B A;  2IY0 B;  3PHX B;  4LJO B;  4GB9 A;  4YTP B;  2C7N B;  2MQJ A;  3IHP C;  4JLC A;  4MJS B;  1RLF A;  2VH1 A;  1IPG A;  2QDF A;  3AI5 A;  2HE7 A;  4XWW A;  2REX A;  1WGK A;  4TKN A;  1FNU A;  3ZQ4 A;  1PUT A;  4P16 A;  3R2T A;  3ZKJ C;  1M4V A;  3PSE B;  3BVM A;  4TSS A;  5EE1 A;  1S1Q B;  3IVF A;  2GB1 A;  4IDI A;  1H8C A;  2KWU B;  2X8X X;  4GDK B;  3SFD B;  4GSW A;  4ARC A;  2OED A;  4PT5 A;  5L83 A;  4FJZ A;  4ANW A;  3JYU A;  3RNG C;  3HVZ A;  4DHZ B;  3Q3J A;  1TZO A;  4RGT A;  1WX9 A;  4HJG E;  1BT0 A;  1HXY D;  2LVO A;  3P4P B;  3C19 A;  2IO3 B;  3MC9 A;  4KIK A;  3RZF A;  4E3C A;  3R66 C;  3ENE A;  1N5X A;  3ZYY X;  4KZC A;  3W1S C;  4UDU C;  3BVZ A;  4M01 A;  1YD8 U;  3OWE B;  2JQR B;  4JWS C;  3BK1 A;  3PRZ A;  5C2T B;  1WXA A;  1E8W A;  1ZPS A;  1WE7 A;  3UF8 A;  3W9C B;  5FR3 A;  1OQR A;  5JZE B;  4MJS A;  1XT9 B;  2G4D B;  1DGJ A;  4K81 A;  2FIF A;  2W3R A;  3DQV A;  3KH0 A;  2PPH A;  1I42 A;  3VDZ A;  1E0Z A;  3OJ3 A;  1QF6 A;  3Q3M C;  3MC8 A;  3PZ8 A;  2WP9 B;  2GBK A;  1XCQ L;  1WF9 A;  5D94 A;  2MCN B;  4EKU A;  2BBC A;  1GJZ A;  3N32 A;  1YQ3 B;  2BYE A;  1C77 A;  1GUA B;  4BOS C;  1JML A;  4KVG B;  4WJN A;  1PQS A;  2NS5 A;  1P1A A;  4GDL A;  2INC C;  2PW9 A;  3EEC A;  3DVN V;  2GRI A;  3NVZ A;  4WWP A;  1SE3 A;  3P1M A;  2KTF A;  2L3Z A;  2J4X A;  2PLP A;  3L17 A;  4DBG A;  3DBS A;  2RPV A;  5C23 A;  3Q6B A;  2JSV X;  3DVN U;  4ARI A;  4I6L B;  2V1Y A;  2RSU A;  1RRB A;  3RUL A;  1N61 A;  5CHW A;  1V49 A;  1KF6 B;  1K53 A;  2JWU A;  1I4H A;  2KVZ A;  1OTR B;  1MJD A;  1HA5 A;  1FMA D;  3PZ7 A;  5JHA A;  4EZJ A;  2ON8 A;  1RAX A;  3FC4 A;  3LJ3 A;  2I1J A;  2KN4 A;  4US9 A;  3VUX A;  1JCK B;  2D3G A;  3BWU D;  1I35 A;  1ZGU B;  2WX1 A;  1YN3 A;  2K9X A;  3VR8 B;  3MHS D;  3KUZ A;  1FD6 A;  1KLG D;  2Y5P A;  1DOI A;  1Z2M A;  4FAD A;  3HUI A;  4X57 B;  2MP2 B;  4NAW B;  2K6Q A;  2LZ6 A;  3BY4 B;  1YNT E;  2LGI A;  4A8X C;  4WJO A;  2B76 B;  2BYV E;  2N9K A;  3Q3N C;  2BT6 A;  1E7P B;  4ZRI A;  1ZKH A;  2KC1 A;  3APC A;  3V05 A;  3K9O B;  2L0T A;  4BKS A;  3MJ5 A;  1D5M C;  3VUY A;  3RNF C;  3VFK A;  2ZVN A;  3WCQ A;  3ABV B;  1SE2 A;  3NVY A;  3RNA C;  1V86 A;  2KWV B;  4EZL A;  2DAJ A;  2L00 B;  2B3A A;  4J6I A;  3EFU A;  2DZJ A;  2K5P A;  1L5P A;  1WE6 A;  4EFO A;  2NCN A;  3P63 A;  1YQ4 B;  1U4A A;  2KDE B;  2IND C;  2WXI A;  3AH7 A;  3PRE A;  3AV8 A;  3WAO A;  4IWQ A;  4FHJ A;  2PE9 A;  4YSY B;  1BML C;  3VUW A;  2O2V A;  1YN4 A;  1SJE D;  4LTU A;  2L83 A;  3CMM B;  4MGZ E;  1MHH E;  3MP9 A;  4ZYN A;  4JGH B;  4HXD A;  2JRI B;  4YL8 A;  2MA9 B;  2ZW1 A;  1TBE A;  3EGR A;  4XX5 A;  2L32 A;  2KQS A;  1T0Q C;  3V62 A;  4HPL B;  3RMK C;  3PT2 B;  2XK5 B;  4JX1 C;  4MM3 B;  4C7Y A;  3NZ3 A;  4II3 B;  1WJU A;  1SE9 A;  4KGT A;  2G3Q B;  2WXP A;  2OHF A;  2G9H D;  3CIR B;  1BXT A;  3GE8 C;  2K39 A;  5CHF A;  2N9X A;  3GB1 A;  2ASQ A;  3ZNI D;  2K0P A;  1WXS A;  5EDS A;  1C9F A;  1RFK A;  2E3T A;  4LDT D;  5HG2 A;  2VZK D;  2RD0 A;  5FK9 C;  1L0Y B;  4MSM B;  1P98 A;  2GLS A;  1GB1 A;  4FXC A;  2WX0 A;  3NZS A;  1V6E A;  4RGN A;  5JXV A;  5T8I A;  1ISN A;  5IP4 D;  1JRO A;  2MLB A;  2RDB C;  5BMI A;  4M00 A;  1UNS A;  2LGD A;  1Z5S B;  3N1Z C;  2KZR A;  4KKI A;  3GS2 A;  3HM3 A;  3SR6 A;  2DZK A;  1L0V B;  1C4P A;  4XDD A;  2NBU A;  1M94 A;  1JRU A;  4K3B A;  1R4M I;  3PLU A;  4MDK E;  2EEL A;  2J53 A;  4OZB A;  3MC0 B;  2PVO D;  4JL9 A;  4HVB A;  5BMG A;  4K7S A;  3ECI A;  3HM6 X;  2IO1 B;  3IT6 B;  2X38 A;  1XLO A;  4ANV A;  2MJD A;  3A9J A;  1L7Y A;  4NPN A;  4LNK A;  3AN1 A;  1MHX A;  3ZRF A;  1EWC A;  3N3K B;  1YJJ A;  1V80 A;  3O13 A;  5G2N A;  1XLN A;  1ZW7 A;  1QT9 A;  2LVP A;  4HCP B;  1GC6 A;  4FJV B;  4ZRJ A;  2NTT A;  4YXD B;  2JZ3 B;  3W5U B;  4NNJ B;  1LM8 B;  1TT5 B;  2WXJ A;  2CJN A;  2MH7 A;  2BQQ A;  1EWY C;  2IYD B;  4YTN B;  2YEP B;  2KT7 A;  3VTW A;  2N0S B;  1WR6 E;  3M63 B;  1KRH A;  3I57 A;  3QA8 A;  1KOT A;  2BS3 B;  4C00 A;  3DHI C;  2FCN A;  2FUG 1;  2OOB B;  3WAM A;  2KOX A;  3P2B A;  1ET9 A;  4ICV A;  2KLG A;  5AZF A;  2GOW A;  3NVW A;  1K51 A;  3P4R B;  5J2R A;  1D5X C;  4BOZ B;  1EU3 A;  1FEH A;  2BWF A;  2KC2 A;  3SHQ A;  1BUI C;  2O6V B;  3AXC A;  2LAS A;  1WGH A;  1V1O A;  4AP4 C;  4RH6 A;  3B1L X;  3QQ8 B;  4XGA B;  5AUI A;  4WWN A;  2IBI B;  1QOF A;  4L23 A;  4AJY B;  2CU1 A;  3VVW B;  2V4I B;  4E74 A;  3UI3 A;  4PS8 A;  1N6Z A;  1WJ6 A;  3L08 A;  4HRO A;  3O65 B;  3QHT A;  1VR9 A;  3L16 A;  4GLS C;  3Q8E A;  3SDL C;  2M1M A;  4XC2 A;  4IM3 A;  1VDV A;  2QHO A;  4MGY E;  4I6P A;  3Q8F A;  2DAF A;  1HQR D;  2WQY B;  4IKG A;  2WWZ A;  4BBN C;  4MH0 E;  1YJ1 A;  1JWS D;  3H7P A;  2KQ7 A;  3ZO5 B;  1XEE A;  2KMC A;  5J17 A;  3RN9 C;  4OVU A;  1EM7 A;  1NBF C;  4OZC A;  3NY5 A;  1STE A;  2K8C A;  4K7U A;  4D2K A;  4EE2 A;  1FCC C;  2HDE A;  2L0F A;  4LJP B;  1YIW A;  5G5H A;  2WXQ A;  5H92 C;  1WXM A;  3MJW A;  1LXD A;  2KDB A;  2AL3 A;  1S3S G;  2PMV A;  1PYW D;  1T3Q A;  2WXM A;  2V3S A;  2R2O A;  4MT5 A;  4AOF A;  4C7Z A;  3LXF A;  1OQY A;  1E9M A;  2FCM A;  1QQR A;  3DVG X;  3GZN I;  3I3T B;  1SEB D;  2K6D B;  2DBY A;  4K1R B;  3BII D;  5GXG B;  3NZU A;  2EKE C;  2N4F A;  1I4P A;  4C4V B;  3TCA A;  2UYZ B;  3DHG C;  1KLV A;  2CJO A;  1FXT B;  3U8Z A;  1FIQ A;  4NAW A;  2LUM A;  3ZNZ B;  3NS8 A;  4YTM B;  3VR9 B;  5E6N A;  3L13 A;  3ML9 A;  5AZH A;  1NI2 A;  3BYY B;  2PEA A;  2NBW B;  2L8J A;  4OZA A;  1JQ4 A;  1SIJ A;  4WJP A;  4US8 A;  2CR5 A;  4HEA 1;  1D4B A;  1KTK A;  3DBL I;  2DHZ A;  4G0N B;  4K3C A;  1ZXH A;  4IUM B;  1UGM A;  3HHM A;  4RNA A;  3NHE B;  5D3D A;  2KVR A;  3KWL A;  3U52 E;  2VZK B;  1XLP A;  1DOY A;  3S2A A;  1UEL A;  2D5G A;  4GMV A;  1FNV A;  2DNF A;  3QK0 A;  4ANU A;  2KQ4 X;  3LB8 C;  2A5U A;  1F52 A;  2WXG A;  5CX3 A;  1IBX B;  2D2Q A;  2K1F A;  2KAJ A;  5BMH A;  3RT3 B;  3DBH I;  2LD9 A;  2IZV B;  2NBV B;  3U7Z A;  4B0E A;  1K8R B;  4W9G A;  1Q5W B;  3DHH C;  1E6E B;  3I9V 1;  1E8Z A;  1NEN B;  2KX3 A;  4DDI D;  3DBR B;  1WJ4 A;  2KWC A;  3X23 A;  4WQM A;  1P7E A;  1PFD A;  4IC7 B;  1XF5 L;  2V0G A;  1WJN A;  4RGM A;  1GOZ A;  3VAW A;  4FJY A;  1WGY A;  4DXA B;  3TBL D;  3ZUN A;  4WIP A;  1TS2 A;  1TS3 A;  2KNB A;  3A33 B;  5G5G A;  3Q3O C;  3TEW A;  4LK0 M;  1I4Q A;  2FCS A;  4P1B C;  1TGZ B;  4ASW C;  2LWP A;  4JQW C;  3AB5 A;  3R3M A;  1X1M A;  4G3X B;  2DWQ A;  4OHJ A;  4GN1 A;  3WA0 A;  2WXO A;  5EE0 A;  4ACF A;  2H88 B;  2K22 A;  1C79 A;  2JU6 X;  2BB6 A;  3UIP B;  3Q69 A;  1Y56 A;  1UH6 A;  4DHJ B;  5D7G A;  2L76 A;  2Q5W D;  2L1A A;  4OW0 A;  2BKR B;  1T0Y A;  3H8H A;  3PHW B;  2FNJ B;  3V6E B;  4F1S A;  4H2A A;  1C4A A;  2QMT A;  3M95 A;  1SJH D;  2D3C A;  1ENF A;  2BYT A;  4ZOH C;  3TSS A;  3L54 A;  1V8C A;  4A3O A;  3N1X C;  3AED B;  1L6V A;  3SD5 A;  1AYF A;  4M8M A;  5J18 A;  3ZJU A;  2NMQ A;  3A9K B;  2WXH A;  1VCB A;  1CJE A;  3VRA B;  2LJ5 A;  5MPO A;  2D3A A;  1VRA B;  4LDT B;  1JRP A;  1GPX A;  4CHK A;  1TS5 A;  2LGX A;  2FID A;  4HDQ A;  4B6W A;  4F8C B;  2TSS A;  3SFE B;  4DDG D;  4KGR A;  3PPA A;  1YMH E;  2VRR B;  3ZJV A;  1FNW A;  3PLV A;  3W5V B;  1WGR A;  5TSS A;  4KZ0 A;  5LXH A;  1PDX A;  1NDD A;  4R3D A;  4NQL B;  4DK5 A;  2JF5 A;  2KDF B;  2WGS A;  1XXG A;  2WU5 B;  3JSV A;  3AUL A;  5AUK A;  4A6Q A;  2KDI A;  2LFI A;  1GB4 A;  2MBH A;  4XWT A;  5EE9 A;  2LGS A;  1TTN A;  3KQ4 A;  2GBJ A;  4NJ6 A;  5L95 C;  3ML8 A;  2WXR A;  4CO7 A;  4HCN B;  5IN7 A;  3A4R A;  4PYZ A;  2M0A A;  1E5W A;  2BTE A;  2ZCB A;  2MRP A;  1FRD A;  3QAQ A;  3B08 A;  2DLB A;  3A9K A;  3P4S B;  3VXW A;  2M17 A;  4A55 A;  4W9I A;  4ZRK A;  4DQO C;  4XE0 A;  4A3P A;  3OAW A;  1YQB A;  4REZ A;  1UUP A;  4ZRQ A;  3DBH B;  1RYJ A;  3RFZ B;  3CSF A;  4DXF A;  2DEN B;  2AQ1 B;  1PGX A;  1TIF A;  2I2Y A;  3WIM A;  1FM0 D;  2JZZ A;  3KVF B;  1OEY J;  3U4E G;  1JWM D;  4M0W A;  1JW9 D;  1ET6 A;  4FBJ B;  3TL5 A;  1J19 A;  3U2S C;  2ACZ B;  2YEP F;  3AE6 B;  2M4N A;  2SAK A;  3BZD B;  1FRR A;  2IPK D;  3RCZ A;  1TKY A;  2IDY A;  3BK2 A;  2MWS B;  4GDL B;  3RI7 C;  2OJW A;  4FHK A;  4GIV A;  2L7R A;  3BYT B;  2OJR A;  4W9H A;  4II2 B;  3EUB 2;  3AEC B;  2WDT B;  4LLG M;  2ZNV B;  2KDM A;  2WDQ B;  1RWS A;  4PK1 A;  3AE3 B;  3B2G A;  3OLM D;  3AE2 B;  3AEG B;  4DHJ D;  4FUL A;  1AW7 A;  1L4Z B;  2W55 A;  2KMM A;  1UD7 A;  4NY0 A;  4G11 A;  1TY0 A;  5C1Z A;  3RNB C;  3VH3 B;  4BKS D;  2KHW B;  5HHD G;  3IT4 B;  4ZYS A;  2FUH B;  2M0X A;  4DXG A;  5LNK 1;  4FLH A;  4O1N A;  1NI3 A;  4TUU A;  5BYQ A;  3NRZ A;  1PGB A;  3WAP A;  3QWZ B;  5IKC M;  1SF0 A;  4IWO A;  2JYT A;  3PRM B;  1Y8R C;  2BW2 A;  4PYU A;  2XN9 C;  2JYE A;  2MSE D;  1NVI D;  1EUV B;  1QOG A;  2KFK A;  1YX6 B;  1YX5 B;  4RM8 A;  3AE1 B;  4IOI E;  2C7H A;  2MW5 A;  2CHW A;  2XNA C;  4EZK A;  2BS4 B;  1VJK A;  1YJI A;  1J7C A;  1VZ7 A;  1P0R A;  1T6B X;  2IGD A;  5LLI A;  4HLE A;  5KHQ A;  2EMT A;  5E6P A;  1V1P A;  1V81 A;  5E6O A;  4N59 A;  2NPT B;  2I38 A;  4W9F A;  2JXT A;  3VHT C;  2FAZ A;  4C80 A;  1CK1 A;  4RCO A;  2IGH A;  4ZRP A;  1P7F A;  3UQB A;  2RMM A;  3DOW A;  1WWT A;  4EUT A;  2J0M A;  1J7B A;  3VTU A;  3ETR A;  3QC8 B;  2WU2 B;  4W9L A;  4P1C C;  3DBR I;  1R4N B;  2ZW0 A;  5CHV C;  1QLB B;  4IM0 A;  3ZLZ A;  4MGI E;  2BGF A;  3LYY A;  1EF1 A;  4XYC A;  2D3B A;  2W54 A;  2UU7 A;  1TZ1 A;  3R2I A;  3QJZ A;  1WY8 A;  1IGD A;  1ZDV A;  3PTF C;  2BF8 B;  3FIL B;  4AJW A;  4KKJ A;  3PO0 A;  4NJ7 A;  2WDR B;  1QKZ A;  4RMA A;  4BAX A;  3A9J B;  2W3S A;  3B9J A;  3K9P B;  2K8B A;  3AMZ A;  4HJK A;  3PRP B;  4OVZ A;  3UIN B;  3V3X A;  4N9F 4;  5AEK B;  1MPE A;  5G55 A;  1SE4 A;  2LMC A;  2O2V B;  2DYM A;  4CYE A;  1P3Q U;  1KLU D;  3NG0 A;  1WZ0 A;  1RFA A;  2MBE A;  3C8Y A;  4WAA A;  2EKI A;  1XD3 B;  3AE9 B;  1DOX A;  4KDI C;  1V1P B;  4NAM A;  3M62 B;  1ROE A;  2NPT A;  1HZ6 A;  3PZD A;  4MEM A;  4FA6 A;  1MG4 A;  2KLC A;  1FXI A;  1EU4 A;  2L05 A;  1AAR A;  2GMI C;  3C0R B;  1MFW A;  3AE4 B;  1WZ3 A;  1F1H A;  3TJP A;  2MHJ A;  1HEZ E;  3ALB A;  3DPD A;  3PS6 A;  1FFV A;  1WGD A;  5BYS A;  4WWO A;  4HKQ A;  4ITK A;  4BBN F;  2BKF A;  2DYO A;  1V5T A;  1F9J A;  2QIL A;  4NJC A;  4AQ7 A;  5IO9 A;  3SU8 X;  4KDL B;  1UBQ A;  2H89 B;  1Q0W B;  4JWU C;  4HDO A;  2N7J A;  2DYB A;  4K7W A;  5FKA C;  1SGH A;  1ZOY B;  1NYQ A;  2JVC A;  1UBI A;  3NJT A;  3OG5 A;  5EE3 A;  1WYW B;  4PS3 A;  3R7R A;  4W9E A;  3A4S C;  4L2Y A;  3R7Q A;  4KV2 A;  3JW0 X;  1MG8 A;  2PTL A;  3ZIM A;  2VH2 A;  3I5J C;  4LNF A;  3AEA B;  3CF6 E;  4LNI A;  4TQ0 A;  4AWJ A;  1D5Z C;  3ZDM C;  4ZDV A;  1K52 A;  2ZNV C;  2KX0 A;  1ZXI A;  2GBR A;  1FXA A;  4GU2 A;  1IP9 A;  1FCL A;  3URY A;  4Q2J A;  1NYR A;  1Q1O A;  1SIF A;  1YOV B;  2QSD A;  1ZE3 D;  2LHD A;  1A5R A;  2KD0 A;  2G45 B;  4HKZ E;  2N9L A;  2NVU I;  4RM9 A;  3V61 A;  1V2Y A;  4GGQ A;  3NUH B;  4KIK B;  1EO6 A;  4KSL C;  1F2R C;  3SEB A;  4WH4 A;  2KTR A;  3DCG A;  3KLS X;  4YSX B;  5BYR A;  3IG3 A;  1LFD A;  3DVG Y;  1VLB A;  3AE5 B;  2R2Q A;  2MJ3 A;  1D3Z A;  1L2N A;  2WXL A;  1I4R A;  4HRS A;  3QCA A;  3L10 B;  2PJH A;  1KJT A;  1QIL A;  1TJE A;  2YVC A;  3TUO A;  1GAQ B;  3MFG A;  2HTH A;  4B0M A;  1WIA A;  5E6J A;  4IWP A;  3KYC D;  2L52 A;  3L4P A;  2M8S A;  3HK0 A;  2LI5 A;  2RDH A;  1A70 A;  1D6E C;  5D2M B;  2WXF A;  2BB5 A;  3Q14 C;  2AQ2 B;  2CKH B;  3H7P B;  3EC8 A;  1AWD A;  2QJL A;  3DWM A;  4ZHP A;  4RGO S;  1HTQ A;  4KSK C;  4J3O D;  3T8M A;  1L0X B;  3QX1 A;  1R4N I;  2MBB B;  2KJ6 A;  5HKH A; 
#chains in the Genus database with same CATH homology
 3PVL A;  1E7U A;  1NDD A;  2BPS A;  2V4L A;  4NQK E;  4IM2 A;  2I1K A;  4NQL B;  4BKT A;  2JF5 A;  2KDF B;  2NBU A;  2ZPN A;  1M94 A;  4DK5 A;  1JRU A;  5FR6 A;  4MSQ B;  2CHZ A;  2KKC A;  2C7M B;  3JSV A;  1R4M I;  3PLU A;  3AUL A;  4MDK E;  2KDI A;  4I6N B;  4TV3 A;  2MBH A;  2KJH B;  2XEW A;  4JL9 A;  4HVB A;  1WGG A;  4K7S A;  5GMV A;  3RYT A;  1TTN A;  3ECI A;  2GBJ A;  4NJ6 A;  3HM6 X;  2HD5 B;  2IO1 B;  3LDZ E;  5L95 C;  2Z59 B;  3ML8 A;  5DPS A;  3WAL A;  4BVU C;  4CO7 A;  4HCN B;  4W9D A;  4M0W B;  3PV1 A;  4ANV A;  3A4R A;  3A9J A;  1WMH B;  4TQ1 A;  4PYZ A;  1L7Y A;  4NPN A;  1E5W A;  5IA7 A;  3ZRF A;  3N3K B;  3ONS A;  1V80 A;  2BYF A;  2MRP A;  2ZCB A;  5G2N A;  4EEW A;  1ZW7 A;  2IO2 B;  3HIZ A;  3QAQ A;  2LVP A;  2HJ8 A;  4HCP B;  5DCN A;  1GC6 A;  3B08 A;  2N1V A;  3ZTD A;  4FJV B;  4ZRJ A;  2D10 A;  2JZ3 B;  3A9K A;  4NNJ B;  3UQA A;  3VXW A;  3QIJ A;  5DPT A;  1LM8 B;  2M17 A;  1XQQ A;  2YLM A;  3MTN B;  4W9I A;  4ZRK A;  3U30 A;  3VTV A;  3H1U A;  3X0W A;  1WR1 A;  3RZW C;  4A3P A;  4MGK E;  5KHO A;  2IYD B;  2N7D A;  3ZDT A;  2ZCC A;  4EOY A;  1GC7 A;  3OAW A;  1YQB A;  5DPR A;  3VTW A;  1P9D U;  3V6C B;  1WR6 E;  1WFY A;  3H7S A;  3M63 B;  3CSF A;  1E7V A;  2IY0 B;  3QA8 A;  3PHX B;  1KOT A;  4LJO B;  4GB9 A;  2KJR A;  3D32 A;  2DEN B;  4ICU A;  2FCN A;  2C7N B;  2OOB B;  2LVQ A;  2MQJ A;  3IHP C;  2UWQ A;  3WAM A;  4JLC A;  2JZZ A;  3WIM A;  2KOX A;  3P2B A;  3KVF B;  2ZZP B;  4MJS B;  1OEY J;  4ICV A;  2KLG A;  5AZF A;  2GOW A;  1RLF A;  2MP2 A;  1IPG A;  1E8X A;  5J2R A;  3AI5 A;  3T9L A;  1IYF A;  2LUE A;  4BOZ B;  4FBJ B;  2HE7 A;  2BWF A;  2KC2 A;  1J19 A;  4GXB A;  2REX A;  3SHQ A;  3TL5 A;  4TKN A;  2O6V B;  3AXC A;  2LAS A;  1WGH A;  4AP4 C;  3ZKJ C;  1V5O A;  3PSE B;  2M4N A;  3B1L X;  2LXC A;  3QQ8 B;  3RCZ A;  2ZEQ A;  4WWN A;  1S1Q B;  3IVF A;  2IBI B;  4W9K A;  2MWS B;  1H8C A;  4BKG A;  2DZI A;  4GDL B;  2KWU B;  4M8N A;  4GDK B;  4AJY B;  2CU1 A;  4GSW A;  4FHK A;  4GIV A;  3VVW B;  2L7R A;  4E74 A;  4W9H A;  2OJR A;  4II2 B;  2XK5 A;  5L83 A;  1H4R A;  4FJZ A;  2WDT B;  4ANW A;  3JYU A;  2ZNV B;  4PS8 A;  1WJ6 A;  3ZVV A;  2XBB C;  4DHZ B;  1GG3 A;  3L08 A;  3O65 B;  3Q3J A;  3OLM D;  1WX9 A;  3QHT A;  4DHJ D;  4FUL A;  4WJQ A;  1BT0 A;  1UD7 A;  4NY0 A;  2LVO A;  3N30 A;  3L16 A;  3JVZ X;  4G11 A;  2IO3 B;  4KIK A;  3RZF A;  5C1Z A;  4E3C A;  3R66 C;  3SDL C;  4GDK A;  3ENE A;  3VH3 B;  2KHW B;  2J0J A;  2M1M A;  4XC2 A;  4BKS D;  4IM3 A;  4KZC A;  3W1S C;  2MBO A;  3A1Q A;  2FUH B;  2QHO A;  4MGY E;  4I6P A;  2C5L C;  2N1W A;  1YD8 U;  2AYO B;  2DAF A;  2M0X A;  4FLH A;  3PRZ A;  1KM7 A;  2EMS A;  2WWZ A;  4BBN C;  1WXA A;  4MH0 E;  1E8W A;  1WX8 A;  1YJ1 A;  4TUU A;  1WE7 A;  3UF8 A;  3H7P A;  2KQ7 A;  3ZO5 B;  3VQI A;  3WAP A;  3QWZ B;  4IWO A;  5JZE B;  4URK A;  3PRM B;  2KMC A;  4MJS A;  5J17 A;  1XT9 B;  2G4D B;  1Y8R C;  2KK8 A;  2WYQ A;  4OVU A;  3B0A A;  2MBQ A;  3KUC B;  4K81 A;  2KMA A;  2FIF A;  1NBF C;  2CS4 A;  4PYU A;  2MSE D;  2K8H A;  2RR9 A;  3DQV A;  3KUD B;  3KH0 A;  2PPH A;  3NY5 A;  3UGB B;  1I42 A;  5JH5 C;  1EUV B;  2K8C A;  2KFK A;  1YX6 B;  4K7U A;  3VDZ A;  1YX5 B;  4MEL A;  4RM8 A;  3ZNH B;  2C7H A;  2MW5 A;  2CHW A;  3OJ3 A;  2IY1 B;  2L0F A;  4LJP B;  5IAA C;  4EZK A;  1OGW A;  4F7Z A;  1YIW A;  3JSV B;  4HPM B;  1WXM A;  1LXD A;  2KDB A;  1P0R A;  3MJW A;  3DDC B;  2CHX A;  2GBK A;  5BO4 B;  5LLI A;  4HLE A;  2AL3 A;  1S3S G;  5KHQ A;  4W9J A;  1WF9 A;  2D07 B;  5D94 A;  2EMT A;  5E6P A;  2MCN B;  4EKU A;  1V81 A;  5E6O A;  4A20 A;  2NPT B;  2ZPY A;  4W9F A;  1GJZ A;  3M3J A;  4JIO U;  3VHT C;  2FAZ A;  2R2O A;  2V3S A;  3N32 A;  2LGY A;  4AOF A;  2MX2 A;  3APF A;  2BYE A;  4PS7 A;  1OQY A;  4MM3 A;  3OJ4 B;  2FCM A;  3GZN I;  1GUA B;  3DVG X;  4ANX A;  3I3T B;  4BOS C;  3UQB A;  2K6D B;  4K1R B;  4KVG B;  4WJN A;  1PQS A;  2W9N A;  2NS5 A;  3DOW A;  2RGF A;  1P1A A;  4GDL A;  4EUT A;  2J0M A;  3VTU A;  3NZU A;  2EKE C;  3EEC A;  3V60 A;  3QC8 B;  5DPW A;  3DVN V;  2N4F A;  4WQO B;  4W9L A;  4WWP A;  2C60 A;  3H9D A;  3TCA A;  2K25 A;  2UYZ B;  1KLV A;  3DBR I;  1FXT B;  2KTF A;  3U8Z A;  2L3Z A;  3TMP B;  5CHV C;  3L17 A;  4NAW A;  2O6V D;  3ZNZ B;  3NS8 A;  4IM0 A;  3ZLZ A;  4MGI E;  2BGF A;  3DBS A;  1EF5 A;  4DBG A;  1EF1 A;  5E6N A;  3L13 A;  3ML9 A;  5AZH A;  5C23 A;  1TZ1 A;  1NI2 A;  3QJZ A;  2PEA A;  2NBW B;  1WM3 A;  1WY8 A;  2L8J A;  3DVN U;  2BF8 B;  3PTF C;  4AJW A;  4DHZ E;  4NJ7 A;  1CMX B;  2PE6 B;  4WJP A;  2NR2 A;  4I6L B;  1WM2 A;  4RMA A;  4OVV A;  3A9J B;  4B95 A;  2CR5 A;  2JPH A;  2N9E B;  2V1Y A;  2RSU A;  4G50 A;  4HK2 A;  1RRB A;  3RUL A;  3K9P B;  2FCQ A;  2N7E A;  3U7D A;  2K8B A;  5CHW A;  4HJK A;  3DBL I;  1V49 A;  2DHZ A;  3PRP B;  4G0N B;  3UIN B;  4N9F 4;  5AEK B;  1J8C A;  4IUM B;  5G55 A;  1UGM A;  2D11 A;  1OTR B;  2O2V B;  3HHM A;  2BWE S;  3NHE B;  2DYM A;  2KVR A;  4CYE A;  5LXI B;  1P3Q U;  1WZ0 A;  1RFA A;  2GBN A;  2MBE A;  2DZM A;  2Z0E B;  4WAA A;  3APD A;  1XD3 B;  2LXA A;  3S2A A;  4KDI C;  5JHA A;  4EZJ A;  1UEL A;  3M62 B;  2NPT A;  1G6J A;  4GMV A;  3PZD A;  4MEM A;  4FA6 A;  3QK0 A;  2KLC A;  1RAX A;  2I1J A;  2L05 A;  3LJ3 A;  1AAR A;  2GBM A;  2GMI C;  1UZX B;  2A5U A;  3C0R B;  4ANU A;  1WZ3 A;  5CX3 A;  3Q3F A;  3VUX A;  2D3G A;  2D2Q A;  3TJP A;  3RD2 A;  1I35 A;  2K1F A;  1ZGU B;  2WX1 A;  1V9J A;  3ALB A;  2KO3 A;  3DPD A;  3PS6 A;  3RT3 B;  1WGD A;  1WXV A;  3KW5 B;  3MHS D;  3DBH I;  4WWO A;  3KUZ A;  1WRD B;  2LD9 A;  2IZV B;  4BBN F;  2NBV B;  2JUO A;  1GNU A;  2KN5 A;  4DWF A;  1K8R B;  2BKF A;  2DYO A;  4W9G A;  4GOC A;  1V5T A;  1Z2M A;  4FAD A;  1Q5W B;  3KYD D;  1F9J A;  1E8Z A;  4IG7 B;  2KX3 A;  4DDI D;  3SU8 X;  4X57 B;  4KDL B;  1WI0 A;  4HWI B;  2MP2 B;  1UBQ A;  4NAW B;  1WJ4 A;  2K6Q A;  2KWC A;  2LZ6 A;  5D6J B;  3X23 A;  3BY4 B;  2KTR B;  2Z0D B;  4WJO A;  2BYV E;  1OEY A;  4IC7 B;  4ZRI A;  1Q0W B;  5LXH A;  1ZKH A;  1WJN A;  2C9W B;  2KC1 A;  3APC A;  4AUQ C;  3VAW A;  3K9O B;  2L0T A;  4BKS A;  3AU4 A;  4FJY A;  4HDO A;  1WGY A;  2DYB A;  1C1Y B;  4K7W A;  4DXA B;  3TBL D;  1SGH A;  3VUY A;  3PGE A;  3ZUN A;  2JVC A;  1HE8 A;  1UBI A;  3A1Q B;  1WYW B;  4PS3 A;  3R7R A;  2KNB A;  3A33 B;  4W9E A;  2ZVN A;  3A4S C;  3VFK A;  5JHB A;  2LRW A;  3R7Q A;  4KV2 A;  3JW0 X;  1MG8 A;  3VH4 B;  2FCS A;  3ZIM A;  4B9K A;  2G4S A;  2IO0 B;  1TGZ B;  2AEH A;  4ASW C;  2LWP A;  3UIO B;  1V86 A;  2KWV B;  3CF6 E;  4JQW C;  4TQ0 A;  2DAJ A;  4BFR A;  4EZL A;  2L00 B;  2B3A A;  4AWJ A;  2LRU A;  2Y5B B;  4LCD E;  3R3M A;  4J6I A;  1X1M A;  3EFU A;  4G3X B;  3ZDM C;  4ZDV A;  2DZJ A;  2A4Z A;  3NOB A;  4GN1 A;  3WA0 A;  1E90 A;  2ZNV C;  1WE6 A;  4EFO A;  2NCN A;  2KX0 A;  1U4A A;  2KAN A;  2KDE B;  2JT4 B;  2KXJ A;  2GBR A;  3L0W B;  4W9C A;  3ZW3 A;  3PRE A;  3WAO A;  3UIP B;  5AZG A;  1J0G A;  1VD2 A;  2AWT A;  4FN2 A;  4GU2 A;  4IWQ A;  4FHJ A;  3RUI B;  2PE9 A;  3TIX A;  5TR5 A;  1UH6 A;  1IP9 A;  3IBE A;  4DHJ B;  1LQB A;  3VUW A;  2O2V A;  5D7G A;  2L76 A;  3ZNG C;  2BKR B;  1Q1O A;  1SIF A;  1T0Y A;  2O6V A;  3ZTC A;  1WH3 A;  3ZRC A;  3CMM B;  4MGZ E;  3PHW B;  1A5R A;  2FNJ B;  2KD0 A;  3V6E B;  2G45 B;  4F1S A;  4ZYN A;  4JGH B;  3BIN A;  3H6N A;  4HXD A;  2JRI B;  2NVU I;  4RM9 A;  4YL8 A;  2KFJ A;  2MA9 B;  1V2Y A;  3V61 A;  4GGQ A;  1TBE A;  4KIK B;  3W1Y A;  4XX5 A;  4E71 A;  3QAR A;  2KQS A;  3M95 A;  1EO6 A;  4KSL C;  2KFK B;  3V62 A;  1WMH A;  4HPL B;  3PT2 B;  2XK5 B;  2JY6 A;  2KTR A;  3DCG A;  2DX5 B;  1WX7 A;  3CST A;  3L54 A;  4II3 B;  4A3O A;  5CTR C;  1WJU A;  1SE9 A;  3IG3 A;  1LFD A;  2G3Q B;  3DVG Y;  3SD5 A;  2R2Q A;  1QZE A;  4IW0 A;  1D3Z A;  4M8M A;  5J18 A;  1L2N A;  2J7Q B;  3A9K B;  1VCB A;  2JWZ A;  2K39 A;  3QCA A;  5CHF A;  2N9X A;  3L10 B;  2AL6 A;  4XZ4 A;  2LJ5 A;  2PJH A;  2ASQ A;  1KJT A;  3ZNI D;  2YVC A;  3WAN A;  3GOE A;  1WXS A;  2HTH A;  3IFW B;  5EDS A;  1WIA A;  3AU5 A;  4IWP A;  4LDT B;  4CHK A;  2ZVO A;  2LGX A;  4LDT D;  3KYC D;  2FID A;  2RD0 A;  3EHV A;  4HDQ A;  2M8S A;  2J0K A;  3HK0 A;  2LI5 A;  4B6W A;  1C3T A;  2RPQ A;  2ZJD A;  5D2M B;  4F8C B;  4MSM B;  1P98 A;  4P7I A;  2N9P C;  2WX0 A;  2CKH B;  3NZS A;  1V6E A;  3H7P B;  4DDG D;  1E8Y A;  3EC8 A;  3PPA A;  2VRR B;  3W1S A;  1ISN A;  4KSK C;  2JRH A;  2MLB A;  3T8M A;  2LGD A;  3PLV A;  3QX1 A;  1Z5S B;  1R4N I;  2MBB B;  1WGR A;  2KZR A;  3HM3 A;  4KZ0 A;  2JXX A;  2DZK A;  2KJ6 A;  5HKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...