2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
4DWFA 3VQIA 1S3SG 4W9GA 2BYVE 2MBOA 4LJPB 3ZRFA 1NBFC 2PPHA 2DZKA 2C7NB 2C60A 3PPAA 2ZCCA 3WANA 2KTRB 2MBHA 3KYCD 5DCNA 3QAQA 4E74A 4HVBA 4MGZE 1E8WA 2RGFA 1TBEA 2K6QA 3APFA 2HD5B 4JLCA 5DPWA 4E71A 2JF5A 1TTNA 1I42A 3IBEA 4FHJA 2WWZA 3RD2A 2KC1A 3N30A 1V80A 1WX8A 2M8SA 4GDKA 3B0AA 2PE9A 2Z0EB 4K1RB 5FR6A 3U7DA 1V49A 1M94A 3VAWA 3DCGA 1OEYJ 3Q3FA 3ZNZB 4B9KA 2N9EB 4JL9A 3VUYA 4AP4C 1UBQA 2KO3A 2KTRA 1T0YA 4ANXA 3CF6E 2KQ7A 1YD8U 3MHSD 4FLHA 3K9PB 2ZVOA 4PS3A 4GOCA 4DHJD 5JHAA 1UELA 4P7IA 4HDQA 2O6VB 5G2NA 1R4NI 2DHZA 4HWIB 3QARA 4NQKE 1RLFA 3HIZA 3U8ZA 2MSED 2CU1A 3ZIMA 2V1YA 2DYMA 2DZIA 2O2VA 1WE7A 2V3SA 4KV2A 2JUOA 1X1MA 3PRZA 4B6WA 3QJZA 3OAWA 2R2OA 1P1AA 1E7UA 1U4AA 2HTHA 2O6VD 3QIJA 4FHKA 2PEAA 3W1SA 2LVOA 2BWFA 3VTWA 2KFKB 2MQJA 2REXA 2M1MA 1IPGA 1TGZB 2K8HA 3JVZX 3N3KB 4WJOA 3V62A 3WA0A 3KUZA 3I3TB 3EECA 2ZJDA 3U30A 3ZW3A 4KSLC 5LLIA 4FJYA 3V6EB 1ZW7A 4KDIC 3HHMA 2BKRB 1V9JA 4RM8A 4I6PA 1EF1A 2LRUA 4NAWB 2MCNB 4EEWA 3JSVB 5AZHA 4KSKC 1LM8B 2CR5A 1QZEA 2GBNA 4M8NA 1WGYA 5L83A 3A33B 1KM7A 1WRDB 3W1YA 2V4LA 5CHFA 3X23A 4ZRKA 5JZEB 2JRIB 4TV3A 3PLVA 4F1SA 3VTVA 3DBHI 3UIPB 2KWVB 4JQWC 2M4NA 4W9FA 2KXJA 3RUIB 4RM9A 3R7RA 5LXHA 2LZ6A 1UD7A 2CS4A 3EHVA 1GUAB 3KUCB 1C1YB 1WXMA 4K7SA 4B95A 1Y8RC 2LJ5A 5LXIB 1WZ0A 3M63B 2JXXA 4CO7A 2RD0A 4AOFA 2LI5A 2N7DA 1WH3A 4BKTA 3ENEA 3PSEB 4BOSC 4IM2A 2UYZB 3PLUA 3APCA 2MW5A 3UINB 2MA9B 4AUQC 4AJWA 3H1UA 3L54A 3KW5B 2KJRA 4IWOA 2CHZA 2DX5B 4W9HA 5D7GA 4ANWA 4W9DA 3PHXB 1WJ4A 4A3OA 4F7ZA 2LGXA 3UIOB 3VHTC 3L13A 4KDLB 1WF9A 4URKA 2PJHA 1SE9A 2GMIC 4EFOA 4YL8A 2BYEA 2BWES 3R7QA 1SIFA 4MJSA 4DDID 4IWPA 3CMMB 1WFYA 3T8MA 2ZNVC 4EOYA 3JW0X 4KIKA 4NNJB 2N1VA 3UQAA 2EMSA 3ZUNA 3H7SA 1V5TA 5J18A 2FCMA 3S2AA 5L95C 1OGWA 1FXTB 2BYFA 2C7MB 2G45B 3DQVA 4J6IA 4GXBA 2L8JA 2LWPA 3SD5A 3MTNB 3CSFA 1WY8A 2C9WB 4WWPA 1E8ZA 5D94A 3QX1A 4BFRA 1CMXB 4WJPA 4MDKE 2WX0A 2MRPA 5G55A 1GC7A 3CSTA 4HCPB 4F8CB 3T9LA 2ZPNA 5J17A 2G4DB 2JT4B 2KDBA 3IHPC 1ISNA 2LD9A 4MSMB 1WZ3A 4W9CA 1NI2A 2O2VB 5CX3A 2JZ3B 3H9DA 1WM3A 1WM2A 5HKHA 4BKGA 1HE8A 2W9NA 2LGYA 2YLMA 3WAMA 2MP2B 1KJTA 2K1FA 2KN5A 2BPSA 1F9JA 3M3JA 3NZSA 1SGHA 1D3ZA 4NQLB 4A3PA 3DOWA 3DBRI 4GU2A 5GMVA 3QHTA 3N32A 2VRRB 4RMAA 4GDLA 2KX3A 3UQBA 4XZ4A 1V2YA 3VH4B 2GOWA 1WE6A 2QHOA 3ML9A 2L76A 1C3TA 1RAXA 2PE6B 3NY5A 4IM0A 2IO1B 2MX2A 4MJSB 2NBUA 2WX1A 1TZ1A 2FCNA 4GMVA 2ZVNA 3PTFC 4HJKA 1V6EA 2MP2A 2N4FA 1OEYA 2J0KA 4KZCA 3ZNHB 4ZRIA 3QA8A 1WJNA 2BF8B 3WAPA 1JRUA 2IBIB 2LUEA 4ZYNA 4IC7B 3M62B 3ZTCA 4HDOA 2IO2B 4ICUA 1WX7A 5JH5C 4HCNB 2FIDA 1WGRA 3GZNI 1WXVA 4FULA 3ZNID 2NR2A 3SDLC 1WR1A 2DAJA 3PT2B 4W9KA 3WIMA 4HXDA 3ZLZA 3AI5A 4HPMB 1H4RA 2G4SA 3ECIA 3SU8X 2KFJA 4IG7B 4JGHB 5C1ZA 2KZRA 2KMCA 4FJZA 2D07B 1WJUA 2N7EA 3ZNGC 2UWQA 4HLEA 2LXAA 3EFUA 2L00B 5BO4B 1IYFA 2M0XA 1L2NA 4FBJB 4II3B 1GC6A 3OJ3A 4NJ7A 2NBWB 1PQSA 4CHKA 2ZCBA 3DVGX 2D11A 3B1LX 2DENB 2OOBB 3B08A 3H7PA 4BVUC 3C0RB 3DBLI 3A1QA 1OTRB 2MLBA 3NOBA 4XC2A 1H8CA 4AJYB 1YQBA 4LDTB 4IM3A 4CYEA 3DVNU 4ICVA 3RCZA 2LVQA 2ZEQA 4BOZB 3H6NA 4A20A 3ZVVA 3OJ4B 3AU4A 4E3CA 3TCAA 2D10A 2GBJA 3KYDD 2KFKA 2N9PC 2KQSA 2K39A 2Y5BB 3PREA 4ZRJA 2EMTA 3PRPB 3TMPB 3VTUA 4BKSA 4KVGB 3ZDMC 1KLVA 2MBBB 3HM3A 1RFAA 1E8XA 4PYUA 2AL3A 3QWZB 2IY1B 4NY0A 3NZUA 1V5OA 2AWTA 2XK5A 1R4MI 3Q3JA 1P9DU 2KTFA 3AXCA 2ASQA 3A1QB 4W9IA 3RT3B 1G6JA 2G3QB 2J0JA 4NAWA 3W1SC 2N1WA 2N9XA 2WDTB 3L16A 2B3AA 1Q0WB 5JHBA 2BGFA 4JIOU 3WAOA 5CTRC 3A9KA 1MG8A 1K8RB 2J0MA 1E90A 1I35A 2KLCA 3A9JA 4OVUA 4EZLA 4FN2A 1IP9A 1E7VA 3K9OB 2CKHB 4K81A 4MM3A 2L05A 2LVPA 2JY6A 2O6VA 3DPDA 2XK5B 2KMAA 4OVVA 2DAFA 2KD0A 3ZKJC 5AEKB 2IZVB 2IY0B 2KHWB 3BINA 2LGDA 2JVCA 1UGMA 2KLGA 3VUXA 4DBGA 4G3XB 2NVUI 4MGIE 3M95A 4GB9A 3L10B 4DHJB 4LJOB 3IFWB 4TQ1A 3V6CB 3L08A 1Z2MA 4PS8A 1J19A 3VDZA 4X57B 3TBLD 3QCAA 1J0GA 2ZNVB 1AARA 2KX0A 1P0RA 2DYBA 3A9JB 1S1QB 2A5UA 2LXCA 2AYOB 1V81A 2K8CA 4HK2A 3VFKA 1UZXB 3ZRCA 2AL6A 4G50A 2NCNA 3GOEA 2WYQA 4WJQA 5E6NA 3APDA 3DBSA 3HM6X 1RRBA 5IA7A 3DDCB 1WMHA 2RPQA 3NHEB 2MBQA 3A4SC 4EKUA 2ZPYA 4TKNA 1L7YA 4TUUA 5KHQA 1YIWA 5DPSA 1XT9B 2HE7A 4GGQA 4GN1A 3JSVA 2L7RA 3IG3A 2Z59B 3VUWA 3WALA 1WI0A 4FJVB 4EZKA 3ZTDA 2KK8A 1WYWB 4IW0A 3KVFB 4KIKB 2HJ8A 2L0TA 1Z5SB 2BKFA 1P98A 3RULA 4N9F4 2M17A 2I1JA 2YVCA 3PV1A 3A9KB 3R3MA 5E6OA 3O65B 4EUTA 2D3GA 2R2QA 2DZJA 3PHWB 4NPNA 4PS7A 1WMHB 2KJHB 2OJRA 4MELA 5D6JB 4LCDE 4M8MA 3KUDB 1BT0A 1E5WA 2LRWA 2FUHB 1GNUA 2FCSA 1OQYA 4XX5A 1WGHA 4FADA 1Q5WB 2KDEB 4W9LA 4WJNA 4G0NB 2JWZA 2KOXA 5AZGA 2XEWA 1KOTA 3LJ3A 2FCQA 4DXAB 1V86A 3A4RA 4WWNA 3DVNV 2KWUB 1YX5B 3L0WB 4G11A 4MEMA 3VVWB 2FAZA 2C7HA 3JYUA 1VD2A 2KVRA 1Q1OA 5D2MB 1NDDA 4LDTD 5KHOA 2NS5A 3ZDTA 2L3ZA 2K8BA 2NBVB 3R66C 3RYTA 3UGBB 1GG3A 1J8CA 4W9JA 4BBNF 4HPLB 1A5RA 3QK0A 2IO3B 3V60A 4WAAA 4K7UA 3IVFA 1WGGA 2KNBA 4MSQB 2JPHA 3SHQA 1LQBA 2DYOA 2KDFB 2XBBC 4PYZA 1YX6B 3BY4B 2GBKA 3NS8A 2KJ6A 4WWOA 3ML8A 1WR6E 4KZ0A 3RZFA 2DZMA 2K25A 4MH0E 1WGDA 2FNJB 2RSUA 3HK0A 4GSWA 3ALBA 1EO6A 3AU5A 2JRHA 4WQOB 2KWCA 1XQQA 2Z0DB 5C23A 2KANA 1P3QU 4DHZE 3UF8A 4II2B 2FIFA 3AULA 2JZZA 4I6NB 2NPTB 5E6PA 4BBNC 3TL5A 4ZDVA 1UH6A 2RR9A 2MBEA 1ZGUB 2L0FA 4ASWC 2D2QA 3OLMD 4I6LB 5J2RA 1LXDA 2KDIA 2CHXA 1EF5A 4MGKE 1WX9A 4EZJA 4DK5A 3L17A 3D32A 3TJPA 4MGYE 3ONSA 1WIAA 4GDKB 4M0WB 1WXSA 2K6DB 5IAAC 3TIXA 2GBRA 3MJWA 5TR5A 2C5LC 2CHWA 3PGEA 3X0WA 1XD3B 1ZKHA 2ZZPB 3PRMB 4IWQA 3DVGY 2EKEC 1WXAA 3EC8A 2NPTA 4TQ0A 3PVLA 2AEHA 2MWSB 2LASA 1WJ6A 3V61A 3VH3B 1YJ1A 2J7QB 2IO0B 3ZO5B 1LFDA 3LDZE 4IUMB 5DPRA 4DDGD 3KH0A 4BKSD 4K7WA 4GDLB 4ANUA 4FA6A 2A4ZA 3VXWA 4GIVA 2IYDB 5DPTA 1UBIA 3RZWC 4W9EA 2KKCA 5CHVC 2GBMA 4DHZB 4ANVA 3H7PB 1GJZA 3P2BA 4NJ6A 3PZDA 3PS6A 3QQ8B 2I1KA 5EDSA 1E8YA 1EUVB 1VCBA 5CHWA 4AWJA 3QC8B 5AZFA 2KC2A
chains in the Genus database with same CATH superfamily
4W9GA 1XLOA 3U2SC 3ZRFA 2C7NB 3WANA 1MFWA 3DWGC 3QAQA 5IO9A 1E8WA 1TT5B 2D3CA 2RGFA 3APFA 4JLCA 2HD5B 4R3DA 2JF5A 1TTNA 3IBEA 4DQOC 2WWZA 3N30A 4GDKA 2V9HA 5FR6A 4WH4A 4ZRQA 2PTLA 3ZNZB 3VUYA 2KTRA 3SR6A 2MHJA 4P7IA 4HDQA 1HQRD 5G2NA 1R4NI 3O13A 1RLFA 4RF1A 2CU1A 3ZIMA 2DZIA 4KV2A 2V3SA 3AE4B 5BMHA 4RFBA 3PRZA 4HEA1 4B6WA 3QJZA 1P1AA 3QIJA 1ZXIA 3W1SA 2LVOA 3VTWA 1IPGA 3V62A 3N3KB 1MPEA 2N9KA 3I3TB 2K3UA 2ZJDA 5LLIA 3V6EB 3CWIA 1VZ8A 1EF1A 2IGGA 2LRUA 2MCNB 2JWUA 2AX5A 2CR5A 4M8NA 1WGYA 1N61A 1M4VA 2VZKB 2N0SB 2V4LA 4ZRKA 4F1SA 3DBHI 1HEZE 4JQWC 4W9FA 1YOVB 1R4NB 3AB5A 4RM9A 3R7RA 5AUIA 1P7FA 5LXHA 2CS4A 2VH1A 2W54A 3M63B 2JXXA 2VH2A 3R2TA 4AOFA 4N6EB 4ZYSA 2ZW0A 2WXPA 3SFDB 1AWDA 4IM2A 2MH7A 2MW5A 4AJWA 4KGSA 2PVOD 3H1UA 2KJRA 2CHZA 3IT6B 4DXFA 1WJ4A 2LGXA 4H2AA 4EFOA 3AEBB 2BYEA 2BWES 3C19A 1DYQA 1QOFA 2FE8A 1WFYA 3CMMB 3T8MA 4EOYA 3H7SA 4C4VA 2FCMA 5L95C 4A55A 4YTMB 4OW0A 2AQ1B 2C7MB 2OEDA 4GXBA 5BMGA 3NJTA 1WY8A 4WWPA 4XE0A 1CMXB 1PFDA 5G55A 4HCPB 1XEEA 3T9LA 3J9CA 2KDBA 4C80A 3RNGC 4C4VB 5HKHA 3N1ZC 2YLMA 2MP2B 1IBXB 2QSDA 1F9JA 2QILA 3VR9B 4A3PA 3DOWA 2WP9B 3QHTA 4RMAA 1ET6A 3FILA 3ZJTA 4XZ4A 1V2YA 4NJCA 1C3TA 1XF5L 4OZBA 2IO1B 3VR8B 4MJSB 2SEBD 4GMVA 2INPE 2J0KA 5EE1A 3WAPA 1YN4A 2LUEA 3M62B 4HDOA 3U4EG 1TS3A 1R4MB 4FULA 1FO4A 1I4PA 3SDLC 1KRHA 1WR1A 5LNK1 1A70A 4W9KA 3WIMA 2JU6X 5EE0A 1WWTA 2G4SA 3Q3OC 4FJZA 3OG5A 2LXAA 3Q6BA 4P6VF 2WGSA 2ACZB 2ZCBA 3AV8A 3DVGX 2D11A 4L2YA 4P1CC 1RYJA 2I38A 3B08A 2V4IB 1C78A 4BVUC 1VR9A 1OTRB 3A1QA 3NOBA 4XC2A 1JROA 3RFZB 3RI7C 1YQBA 4IM3A 4ICVA 3RCZA 2LVQA 1VZ7A 4A20A 3OJ4B 2BVCA 2JSVX 3NUHB 2K39A 3PREA 3FC4A 4BKSA 1KLVA 4ITKA 2UU7A 3N1YC 5AUKA 2K0PA 4HROA 3Q8EA 2IY1B 3ZGZA 3AE6B 3A1QB 2G3QB 3L16A 2N9XA 4US9A 1MJDA 2B3AA 1Q0WB 3WAOA 5CTRC 1UUPA 2Z8LA 2V3NA 4FN2A 3DHGC 1E7VA 4K81A 2CKHB 5AEKB 1HXYD 1UGMA 4XYCA 2QDFA 4DBGA 2NVUI 1VDVA 4YTPB 4LJOB 3IFWB 3V6CB 2WXIA 1Z2MA 1UNSA 3L08A 3EUB2 3VDZA 2WXGA 1AARA 1YJJA 1KH0A 3P42A 1I4HA 3AE1B 3GOEA 5E6NA 3APDA 5MPOA 2IGHA 3DDCB 1JW9D 1MI0A 2XN9C 4UDUC 3GE8C 4TKNA 1L7YA 2K9XA 3ABVB 5DPSA 2HE7A 4WWMA 3VUWA 2KK8A 3RNAC 3KVFB 1SJED 1P98A 3RULA 3PV1A 2R2QA 3PHWB 4PS7A 5IP4D 2KJHB 5D6JB 3KUDB 3AE8B 3B2GA 3KQ4A 3NVVA 1VZ6A 1OQYA 1KTKA 4XX5A 1WGHA 1Q5WB 4W9LA 4G0NB 2KOXA 5AZGA 2XEWA 4KKIA 4ZHPA 4MEMA 2FAZA 1Q1OA 1Y56A 1NYQA 3Q8FA 1TS2A 5KHOA 3ZDTA 3RYTA 4W9JA 1A5RA 1KF6B 2M0AA 5IOIA 1WGGA 4MSQB 1LQBA 2XBBC 2GBKA 4WWOA 4B0EA 4MH8A 4DXGA 2KANA 2NPTB 5E6PA 2BBCA 1XLQA 1CJEA 4ASWC 2D2QA 1MHHE 4I6LB 5I4DA 4EZJA 3DBLB 3TJPA 2OJWA 2PVGC 5TR5A 5FR3A 1N60A 2PW9A 3I63C 1N63A 1MHXA 2WXQA 2NPTA 3PVLA 3LDZE 5DPRA 3KH0A 4BKSD 4K7WA 3BZDB 2A4ZA 3RZWC 1FNWA 2KKCA 2GBMA 1EU3A 4ANVA 3H7PB 3RPFC 3PZ7A 2PKOA 3QQ8B 1HZ6A 5EDSA 4KGTA 2X8XX 5HHDG 1JMLA 1S3SG 3BVZA 2BYVE 2C60A 3PPAA 2WXLA 1J7AA 4HVBA 1I4XA 1TBEA 2K6QA 1KFYB 5DPWA 2M19A 4FHJA 1DGJA 3RD2A 1TY0A 1WX8A 3L4PA 2NTSA 3U7DA 2CJOA 3VAWA 1OEYJ 3Q3FA 2L1AA 4AP4C 1UBQA 1V97A 2KO3A 1T0YA 2KQ7A 3MHSD 3NVYA 2ZVOA 4PS3A 2DHZA 2OHFA 2YEPF 3QARA 3PO0A 1TS5A 4WAFA 3U8ZA 5BYSA 1WE7A 1ZUD2 1F2RI 3OAWA 1E7UA 2HTHA 4FHKA 5FKAC 2KFKB 1ZDVA 2D5GA 3ETRA 2IPKD 2BB5A 3W9CB 5BYRA 3AH7A 4KDIC 2BKRB 1V9JA 4RM8A 4I6PA 3P4RB 2QCZA 4EEWA 4WQMA 5AZHA 2I2YA 1K53A 2R61A 2WU5B 3FAHA 5JZEB 1OQRA 3Q3MC 2JRIB 4TV3A 1FNVA 3UIPB 3V3XA 2QEJC 2M4NA 2K22A 3EHVA 1E10A 1D5MC 2JQRB 3AE9B 3Q3NC 4CO7A 3KWLA 2N7DA 1F77A 4BOSC 1QOGA 3APCA 2MA9B 2DX5B 1XXGA 2QIEB 3VHTC 3L13A 4URKA 5IN7A 1SE9A 2IJ0A 1F1HA 5G5GA 1VJKA 3AE2B 2ZNVC 1V5TA 1FRRA 5J18A 2BYFA 2G45B 2L8JA 1FNUA 3RNBC 3CSFA 4BFRA 4HKZE 4WJPA 2MRPA 3HUIA 4JE3B 1SB3C 2WDVB 4F8CB 2ZPNA 4MSMB 1WZ3A 1ROEA 5CX3A 1WM3A 4LNIA 2PIAA 2KN5A 2BPSA 4USAA 5EE9A 3NZSA 2JX5A 1SGHA 2LGIA 4NQLB 5GMVA 2KX3A 3Q8AA 3VRBB 4A9AA 2L76A 1FMAD 3R2IA 2PE6B 4IM0A 1DOYA 4JWUC 1TZ1A 1GOZA 1I4GA 2ICIA 2MP2A 1P7EA 5H92C 3ZNHB 4ZRIA 1WJNA 1QT9A 1R7SA 1C9FA 1WX7A 2RPVA 2FIDA 3ZNID 3AE7B 4M0WA 2DAJA 3PT2B 3AI5A 1N62A 1V8CA 4IG7B 2KMCA 2D07B 2N7EA 3ZNGC 1E9MA 2JXTA 3PZ8A 2L00B 1IYFA 4P16A 4N59A 1L2NA 2DLBA 4II3B 3OJ3A 1PQSA 4CHKA 1XCTL 2DENB 1HTQA 3H7PA 3C0RB 2AQ2B 1TKEA 1V1PB 3AU4A 5H8YE 3TCAA 3KYDD 2KFKA 1YMHE 2WXNA 2KQSA 2EMTA 2G1EA 1RFAA 4PYUA 3QWZB 2MEKA 1UWXA 5C2TB 1R4MI 2SAKA 1P9DU 2KTFA 3U7ZA 2ASQA 2WHIA 4W9IA 3RN9C 3W1SC 2N1WA 2WDTB 2WQYB 2W55A 5JHBA 2BS3B 1F52A 3MC8A 1I35A 3A9JA 4EZLA 2NTTA 1IP9A 4MM3A 2XNAC 2KMAA 4RGOS 2DAFA 2LFIA 2KHWB 3VUXA 4G3XB 2KWDA 4RCOA 4DHJB 1TKGA 4X57B 1J0GA 1HA5A 2ZNVB 1S1QB 1E7PB 2A5UA 2AYOB 4HK2A 3VFKA 3ZRCA 2AL6A 2NCNA 3DBSA 3HM6X 3RNEC 4AQ7A 5IA7A 1QILA 1ZE3D 4GN1A 3JSVA 2L7RA 3IG3A 4FJVB 2Y3AA 1WYWB 4PK1A 1TS4A 2HJ8A 2EELA 2I1JA 2YVCA 2AQ3B 4FXCA 4L1BA 4NPNA 2X38A 2CJNA 4A8XC 1T3QA 1E5WA 2LRWA 2FCSA 4FADA 2KDEB 1KOTA 2KYWA 4YSYB 4DXAB 4WWNA 4LNFA 3JYUA 3NG0A 1NDDA 4C00A 4LDTD 2L3ZA 2K8BA 2NBVB 3UGBB 4HPPA 3TUOA 1XLNA 4WAAA 4K7UA 5TSSA 2KDFB 4PYZA 4AS1A 4O1NA 1I4QA 3NS8A 3Q8CA 2BB6A 2RSUA 2K5PA 4WQOB 4QAYA 1L0XB 2V0GA 1VLBA 1T0SC 4DHZE 3UF8A 2LGSA 3TEYA 2FIFA 2JZZA 3TL5A 2MBEA 1ZGUB 2L0FA 2Y5CA 4L23A 1WX9A 3MJ5A 4GDKB 2LHEA 4M0WB 2PLPA 3MJWA 2INNE 3PGEA 3TSSA 4IOIE 3PRMB 2EKEC 1UGJA 3EC8A 2MWSB 1UWMA 3V61A 3ZO5B 2J7QB 1BUIC 1WGKA 1LGRA 4ANUA 4FA6A 3VXWA 2IYDB 1C79A 5FK9C 1GJZA 3N9YC 3PZDA 3PS6A 4HKQA 4TMAB 1E8YA 4AWJA 3QC8B 4HJGE 1JWMD 2BQQA 5AZFA 1WYGA 3URYA 2CU3A 4LJPB 2YEPB 1L6VA 2PPHA 1KLUD 2ZCCA 2J4XA 1D6EC 2IDYA 3OWEB 2Y5PA 4MGZE 3MC0B 2LHDA 1I42A 2KC1A 5BMIA 2WLBA 2Z0EB 1V1OA 1ZP0B 2N9EB 4PT5A 3CF6E 1ACCA 1FXIA 3K9PB 4ACFA 2MJEA 4DHJD 4HWIB 2FBWB 1WSPA 2MSED 2DYMA 2O2VA 2JUOA 3GS2A 1X1MA 1JWSD 2BT6A 2M1MA 1TGZB 1QLBB 2K8HA 4WJOA 1NI3A 3LXFA 1T5XD 3U30A 3ZW3A 1L0YB 4KSLC 1B9RA 3AE3B 4NAWB 3JSVB 1LM8B 2GBNA 3I5JC 1DOIA 3EFCA 1N5WA 5L83A 3A33B 1WRDB 1KLGD 3PLVA 2KVZA 3VTVA 2KWVB 4MM3B 1NYRA 3RUIB 2LZ6A 4YXDB 1UD7A 3Q69A 2DBYA 1WXMA 3RNCC 4B95A 3GB1A 2RD0A 1WH3A 3ENEA 2LMCA 3PSEB 3E56A 2UYZB 3PLUA 5C3JB 1YQ4B 3UINB 3L54A 1MVKA 3KW5B 4M01A 4IWOA 4ANWA 4W9HA 5D7GA 3HVZA 4W9DA 4A3OA 4F7ZA 3DBRB 3UIOB 5JXVA 2WU2B 4KDLB 1WF9A 3P4PB 2PJHA 5HG2A 2RDBC 3R7QA 1SIFA 2ONQA 4DDID 4IWPA 4RGMA 2W82A 3P4SB 3ZXVA 2EMSA 3ZUNA 4OZAA 1GB1A 2ON8A 2N7JA 3MC9A 3DQVA 4J6IA 3MTNB 4K3BA 2C9WB 2EKIA 1E8ZA 2BYTA 3AE5B 5D94A 2WNMA 2VZKD 1RFKA 1K52A 4LNKA 5J17A 4W9CA 2LD9A 1VRAB 2N9LA 2JZ3B 2WDQB 1WM2A 4BKGA 2LGYA 2K1FA 1SEBD 3TEXA 4GU2A 3N32A 2VRRB 1C4AA 4HRSA 3UQBA 3B9JA 3VH4B 1WE6A 1EM7A 3ML9A 3NVWA 1RAXA 1TIFA 2MX2A 2NBUA 2WX1A 3AEAB 1FEHA 1C4CA 1SIJA 3QA8A 4RGNA 2WXJA 1QF6A 4ZYNA 2QC8A 4IC7B 4ICUA 1Q10A 3HVDA 4HCNB 5JH5C 3GZNI 1WXVA 1RWSA 2NR2A 4OHJA 2L83A 1TZOA 3ZLZA 1JWUD 1N5XA 2WXOA 3AEDB 1I7HA 1H4RA 2B76B 2D3AA 3SU8X 4JGHB 5C1ZA 2KZRA 1DOXA 5T8IA 1FRDA 2UWQA 4LNOA 4HLEA 3EFUA 5BO4B 2M0XA 4FBJB 4NJ7A 3B1LX 4D2KA 2J52A 3RMKC 3FILB 3RNFC 4A6QA 4XWTA 3MP9A 3DBLI 2KACA 3Q2AC 2HTME 2Q5WD 4ARIA 4LDTB 1SXTA 4REZA 2N9PC 2Y5BB 1EWYC 4NAMA 3PRPB 4KVGB 3ZDMC 3E9SA 2MJDA 2MBBB 3HM3A 1K51A 1V5OA 1GPXA 1J7CA 2AWTA 2XK5A 3Q3JA 3U52E 3RT3B 1J7BA 4NAWA 1ZDXA 4LK0M 1V1PA 1LO5D 4JIOU 1AYFA 3A9KA 5EE3A 3ZXRA 4YT0B 3IT4B 1C76A 2KLCA 1STEA 4XWWA 1IBXA 2L05A 2JY6A 2HJ1A 3DPDA 4OVVA 3ZKJC 2KD0A 4S0RA 2E6XA 3BINA 3DHHC 1K50A 1ZPSA 3Q8BA 1RM6C 4GB9A 3L10B 4PS8A 1AW7A 2WXRA 3TBLD 3QCAA 3T3NA 2DYBA 3A9JB 4E74A 1V81A 2L52A 1UZXB 2W3SA 4G50A 4RGTA 2RMMA 4JX1C 1PDXA 2QMTA 2WXHA 3NHEB 4EKUA 5KHQA 1YIWA 4MT5A 4GGQA 3SEBA 4J3OD 1WI0A 4EZKA 1CQVA 2L0TA 2BKFA 2H89B 4N9F4 2M17A 3N20C 2L32A 3R3MA 5E6OA 3C8YA 1FD6A 2OJRA 4LCDE 4M8MA 1XLPA 2KN4A 2FUHB 3EGRA 1GNUA 2BW2A 3IAS1 3IAM1 2INCC 2JWZA 3Q14C 3LJ3A 2FCQA 3DVNV 2KWUB 1YX5B 3L0WB 5HFYA 3VVWB 1QQRA 2KVRA 4BZAA 4YSZB 2KAJA 2NS5A 3HRDD 2IO3B 3ZQ4A 3V60A 1TY2A 3IVFA 3SHQA 3I9V1 3BY4B 3UI3A 3RZFA 1YQ3B 3AEFB 2LEKA 1JALA 2K25A 4MH0E 4GSWA 2LUMA 3W5UB 1SSNA 2JRHA 3P4QB 2G9HD 5C23A 4II2B 1WRIA 3AULA 3LB8C 4BBNC 1UH6A 3BIID 5HI1A 4B0MA 5J2RA 2KDIA 2CHXA 4DK5A 1YN5A 3B2FA 1WXSA 2K6DB 3TIXA 2QJLA 1N6ZA 2CHWA 3X0WA 1XD3B 1NENB 2ZZPB 2M56B 3DVGY 3ZYYX 1TJEA 4TQ0A 2AEHA 2LASA 1WJ6A 3VH3B 2IO0B 3W2DA 1LFDA 4IUMB 2E3TA 3BK1A 3BYYB 1SF0A 2BS4B 4GIVA 4US8A 4OVZA 5CHVC 1YN3A 1B1ZA 4DHZB 4NJ6A 1HZ5A 2WXMA 1GAQB 1FCLA 4RNAA 2NMQA 4JPSA 3MHZA 4DWFA 3VQIA 2MBOA 3WCQA 4N58A 1NBFC 4ZHOA 2DZKA 4MACA 2KTRB 3P1MA 4IKGA 4M00A 3NRZA 2MBHA 3KYCD 5DCNA 3TEWA 1PUTA 4A90A 4E71A 2JYEA 1V80A 2KT7A 2M8SA 4BAXA 3NVZA 3B0AA 2PE9A 4K1RB 4ARCA 1V49A 1D5ZC 1M94A 1IGCA 3DCGA 4WURA 2BTEA 1FFUA 1XO3A 4JL9A 4B9KA 4ANXA 4M02A 1YD8U 4FLHA 1C4PA 5JHAA 4GOCA 1UELA 2O6VB 2WDRB 4NQKE 4GLSC 3BVGA 3HIZA 4ZOHC 2GRIA 2V1YA 1ET9A 3BWUD 2GLSA 1D4BA 3AMZA 2R2OA 1U4AA 2O6VD 2PEAA 2BWFA 2REXA 2MQJA 1ZOYB 2PMVA 3JVZX 1SE2A 3TEZA 3WA0A 3KUZA 3EECA 4FJYA 1ZW7A 4TSSA 4EE2A 3HHMA 4K3CA 2FUG1 3CIRB 4KX6B 5IKCM 1E0ZA 4KSKC 1FIQA 1QZEA 1ESFA 1KM7A 3W1YA 3X23A 5CHFA 4C7YA 2RDGA 2HDEA 2GI9A 3SFEB 2KXJA 1GUAB 1NEKB 3KUCB 3V05A 1C1YB 2JZPA 4K7SA 1PGAA 1Y8RC 2LJ5A 1JQ4A 1HTOA 1WZ0A 3VRAB 5LXIB 1QOAA 3DWMA 2LI5A 4BKTA 4OZCA 3KWVA 3I57A 2JYTA 4AUQC 2KMMA 2ZW1A 2DWQA 2DNFA 3PHXB 2MJ3A 1TKYA 4LTUA 2GMIC 4YL8A 3BK2A 1TYGB 4MJSA 2BS2B 3AM9A 3JW0X 4KIKA 4NNJB 2N1VA 3UQAA 2J53A 3S2AA 1OGWA 1FXTB 1SE4A 1CK1A 2LWPA 3SD5A 1FPYA 1JRPA 2RDHA 3QX1A 2INDC 2W3RA 4MDKE 2WX0A 3AECB 1GC7A 3CSTA 1L4ZB 2G4DB 2JT4B 3IHPC 1ISNA 3P63A 1NI2A 2O2VB 3H9DA 4LNNA 1HE8A 2W9NA 2KQ4X 3WAMA 1KJTA 1MG4A 3M3JA 1D3ZA 3DBRI 1L0VB 1IGDA 4GDLA 1AN8A 2WXKA 5E6JA 3W5VB 2J42A 4JWSC 2GOWA 2QHOA 3NY5A 4XDDA 2FCNA 2ZVNA 3PTFC 4HJKA 1V6EA 5D3DA 2N4FA 1OEYA 4KZCA 3GE3C 2BF8B 1JRUA 2IBIB 2KDMA 3ZTCA 2IO2B 1E6EB 1T0RC 3AN1A 1WGRA 1C77A 4C56C 4HXDA 1WXQA 3BYTB 4HPMB 2GB1A 4RH6A 3ECIA 4YSXB 2KFJA 1WJUA 1YNTE 1GC6A 2NBWB 2OOBB 5BYQA 1SE3A 5GXGB 1L4DB 2MLBA 4CQNA 1H8CA 1I4RA 4AJYB 4CYEA 3DVNU 3BVMA 2ZEQA 4BOZB 3H6NA 3ZVVA 4E3CA 2D10A 2GBJA 3NZ3A 3DBHB 4ZRJA 3TMPB 3VTUA 1E8XA 4YTNB 1BXTA 2AL3A 4NY0A 3NZUA 3GZNB 3AXCA 1G6JA 1GB4A 2LJIA 2J0JA 1L5PA 3LYYA 2BGFA 1JCKB 1MG8A 1K8RB 2J0MA 1E90A 4OVUA 3K9OB 1FCCC 2LVPA 2O6VA 2XK5B 1JWAD 1IUEA 2IZVB 3IXSA 1YJIA 2IY0B 1JWBD 1QKZA 2H88B 2JVCA 2LGDA 2KLGA 4S17A 2D3BA 4MGIE 3M95A 4TQ1A 1J19A 3H8HA 1PGBA 2KX0A 1P0RA 2LXCA 2K8CA 1EU4A 1OFFA 1OQQA 4YWGG 4C7ZA 2WYQA 4WJQA 4Q2JA 1RRBA 1WMHA 2RPQA 2MBQA 3A4SC 2ZPYA 4TUUA 1F2RC 3NS1A 1XT9B 1F0ZA 2Z59B 3WALA 3ZTDA 3KLSX 1CZPA 4IW0A 4KIKB 3FKYA 1Z5SB 3N1XC 3A9KB 4EUTA 3O65B 2D3GA 1T0QC 2DZJA 3ZJUA 1WMHB 4MELA 1BT0A 3AEEB 1PGXA 4WJNA 1V86A 3A4RA 4G11A 2C7HA 1VD2A 5D2MB 1XCQL 1T6BX 1PYWD 4P1BC 2V3PA 3EA6A 3R8BA 3MFGA 1J8CA 3R66C 1GG3A 2TSSA 4BBNF 4HPLB 3QK0A 4LLGM 3AEGB 1SBBB 4NZLB 3T3OA 2KNBA 2JPHA 2DYOA 1QOBA 1YX6B 2KJ6A 3ML8A 1WR6E 2WXFA 4KZ0A 5G5HA 2DZMA 1WGDA 2FNJB 3HK0A 3ALBA 1EO6A 4IDIA 4WIPA 3AU5A 4KGRA 2KWCA 1XQQA 2Z0DB 1P3QU 4XGAB 4I6NB 1FXAA 4ZDVA 2RR9A 3OLMD 1LXDA 1EF5A 4MGKE 3ZJVA 3L17A 3D32A 4MGYE 3ONSA 1WIAA 5IAAC 2GBRA 2C5LC 1ZKHA 1FFVA 4IWQA 1L6UA 1WXAA 5D3IB 1SJHD 1ZXHA 3GP7A 1YJ1A 4DDGD 2IGDA 4GDLB 4KKJA 1NVID 4RF0A 5DPTA 1UBIA 1D5XC 1ENFA 4W9EA 4ZRPA 3P2BA 3DHIC 2WS3B 1FM0D 1UF0A 2I1KA 1EUVB 1VCBA 1BMLC 5CHWA 1EWCA 4XDCA 2KC2A
chains in the Genus database with same CATH topology
4DWFA 3VQIA 1S3SG 4W9GA 2BYVE 2MBOA 4LJPB 3ZRFA 1NBFC 2PPHA 2DZKA 2C7NB 2C60A 3PPAA 2ZCCA 3WANA 2KTRB 2MBHA 3KYCD 5DCNA 3QAQA 4E74A 4HVBA 4MGZE 1E8WA 2RGFA 1TBEA 2K6QA 3APFA 2HD5B 4JLCA 5DPWA 4E71A 2JF5A 1TTNA 1I42A 3IBEA 4FHJA 2WWZA 3RD2A 2KC1A 3N30A 1V80A 1WX8A 2M8SA 4GDKA 3B0AA 2PE9A 2Z0EB 4K1RB 5FR6A 3U7DA 1V49A 1M94A 3VAWA 3DCGA 1OEYJ 3Q3FA 3ZNZB 4B9KA 2N9EB 4JL9A 3VUYA 4AP4C 1UBQA 2KO3A 2KTRA 1T0YA 4ANXA 3CF6E 2KQ7A 1YD8U 3MHSD 4FLHA 3K9PB 2ZVOA 4PS3A 4GOCA 4DHJD 5JHAA 1UELA 4P7IA 4HDQA 2O6VB 5G2NA 1R4NI 2DHZA 4HWIB 3QARA 4NQKE 1RLFA 3HIZA 3U8ZA 2MSED 2CU1A 3ZIMA 2V1YA 2DYMA 2DZIA 2O2VA 1WE7A 2V3SA 4KV2A 2JUOA 1X1MA 3PRZA 4B6WA 3QJZA 3OAWA 2R2OA 1P1AA 1E7UA 1U4AA 2HTHA 2O6VD 3QIJA 4FHKA 2PEAA 3W1SA 2LVOA 2BWFA 3VTWA 2KFKB 2MQJA 2REXA 2M1MA 1IPGA 1TGZB 2K8HA 3JVZX 3N3KB 4WJOA 3V62A 3WA0A 3KUZA 3I3TB 3EECA 2ZJDA 3U30A 3ZW3A 4KSLC 5LLIA 4FJYA 3V6EB 1ZW7A 4KDIC 3HHMA 2BKRB 1V9JA 4RM8A 4I6PA 1EF1A 2LRUA 4NAWB 2MCNB 4EEWA 3JSVB 5AZHA 4KSKC 1LM8B 2CR5A 1QZEA 2GBNA 4M8NA 1WGYA 5L83A 3A33B 1KM7A 1WRDB 3W1YA 2V4LA 5CHFA 3X23A 4ZRKA 5JZEB 2JRIB 4TV3A 3PLVA 4F1SA 3VTVA 3DBHI 3UIPB 2KWVB 4JQWC 2M4NA 4W9FA 2KXJA 3RUIB 4RM9A 3R7RA 5LXHA 2LZ6A 1UD7A 2CS4A 3EHVA 1GUAB 3KUCB 1C1YB 1WXMA 4K7SA 4B95A 1Y8RC 2LJ5A 5LXIB 1WZ0A 3M63B 2JXXA 4CO7A 2RD0A 4AOFA 2LI5A 2N7DA 1WH3A 4BKTA 3ENEA 3PSEB 4BOSC 4IM2A 2UYZB 3PLUA 3APCA 2MW5A 3UINB 2MA9B 4AUQC 4AJWA 3H1UA 3L54A 3KW5B 2KJRA 4IWOA 2CHZA 2DX5B 4W9HA 5D7GA 4ANWA 4W9DA 3PHXB 1WJ4A 4A3OA 4F7ZA 2LGXA 3UIOB 3VHTC 3L13A 4KDLB 1WF9A 4URKA 2PJHA 1SE9A 2GMIC 4EFOA 4YL8A 2BYEA 2BWES 3R7QA 1SIFA 4MJSA 4DDID 4IWPA 3CMMB 1WFYA 3T8MA 2ZNVC 4EOYA 3JW0X 4KIKA 4NNJB 2N1VA 3UQAA 2EMSA 3ZUNA 3H7SA 1V5TA 5J18A 2FCMA 3S2AA 5L95C 1OGWA 1FXTB 2BYFA 2C7MB 2G45B 3DQVA 4J6IA 4GXBA 2L8JA 2LWPA 3SD5A 3MTNB 3CSFA 1WY8A 2C9WB 4WWPA 1E8ZA 5D94A 3QX1A 4BFRA 1CMXB 4WJPA 4MDKE 2WX0A 2MRPA 5G55A 1GC7A 3CSTA 4HCPB 4F8CB 3T9LA 2ZPNA 5J17A 2G4DB 2JT4B 2KDBA 3IHPC 1ISNA 2LD9A 4MSMB 1WZ3A 4W9CA 1NI2A 2O2VB 5CX3A 2JZ3B 3H9DA 1WM3A 1WM2A 5HKHA 4BKGA 1HE8A 2W9NA 2LGYA 2YLMA 3WAMA 2MP2B 1KJTA 2K1FA 2KN5A 2BPSA 1F9JA 3M3JA 3NZSA 1SGHA 1D3ZA 4NQLB 4A3PA 3DOWA 3DBRI 4GU2A 5GMVA 3QHTA 3N32A 2VRRB 4RMAA 4GDLA 2KX3A 3UQBA 4XZ4A 1V2YA 3VH4B 2GOWA 1WE6A 2QHOA 3ML9A 2L76A 1C3TA 1RAXA 2PE6B 3NY5A 4IM0A 2IO1B 2MX2A 4MJSB 2NBUA 2WX1A 1TZ1A 2FCNA 4GMVA 2ZVNA 3PTFC 4HJKA 1V6EA 2MP2A 2N4FA 1OEYA 2J0KA 4KZCA 3ZNHB 4ZRIA 3QA8A 1WJNA 2BF8B 3WAPA 1JRUA 2IBIB 2LUEA 4ZYNA 4IC7B 3M62B 3ZTCA 4HDOA 2IO2B 4ICUA 1WX7A 5JH5C 4HCNB 2FIDA 1WGRA 3GZNI 1WXVA 4FULA 3ZNID 2NR2A 3SDLC 1WR1A 2DAJA 3PT2B 4W9KA 3WIMA 4HXDA 3ZLZA 3AI5A 4HPMB 1H4RA 2G4SA 3ECIA 3SU8X 2KFJA 4IG7B 4JGHB 5C1ZA 2KZRA 2KMCA 4FJZA 2D07B 1WJUA 2N7EA 3ZNGC 2UWQA 4HLEA 2LXAA 3EFUA 2L00B 5BO4B 1IYFA 2M0XA 1L2NA 4FBJB 4II3B 1GC6A 3OJ3A 4NJ7A 2NBWB 1PQSA 4CHKA 2ZCBA 3DVGX 2D11A 3B1LX 2DENB 2OOBB 3B08A 3H7PA 4BVUC 3C0RB 3DBLI 3A1QA 1OTRB 2MLBA 3NOBA 4XC2A 1H8CA 4AJYB 1YQBA 4LDTB 4IM3A 4CYEA 3DVNU 4ICVA 3RCZA 2LVQA 2ZEQA 4BOZB 3H6NA 4A20A 3ZVVA 3OJ4B 3AU4A 4E3CA 3TCAA 2D10A 2GBJA 3KYDD 2KFKA 2N9PC 2KQSA 2K39A 2Y5BB 3PREA 4ZRJA 2EMTA 3PRPB 3TMPB 3VTUA 4BKSA 4KVGB 3ZDMC 1KLVA 2MBBB 3HM3A 1RFAA 1E8XA 4PYUA 2AL3A 3QWZB 2IY1B 4NY0A 3NZUA 1V5OA 2AWTA 2XK5A 1R4MI 3Q3JA 1P9DU 2KTFA 3AXCA 2ASQA 3A1QB 4W9IA 3RT3B 1G6JA 2G3QB 2J0JA 4NAWA 3W1SC 2N1WA 2N9XA 2WDTB 3L16A 2B3AA 1Q0WB 5JHBA 2BGFA 4JIOU 3WAOA 5CTRC 3A9KA 1MG8A 1K8RB 2J0MA 1E90A 1I35A 2KLCA 3A9JA 4OVUA 4EZLA 4FN2A 1IP9A 1E7VA 3K9OB 2CKHB 4K81A 4MM3A 2L05A 2LVPA 2JY6A 2O6VA 3DPDA 2XK5B 2KMAA 4OVVA 2DAFA 2KD0A 3ZKJC 5AEKB 2IZVB 2IY0B 2KHWB 3BINA 2LGDA 2JVCA 1UGMA 2KLGA 3VUXA 4DBGA 4G3XB 2NVUI 4MGIE 3M95A 4GB9A 3L10B 4DHJB 4LJOB 3IFWB 4TQ1A 3V6CB 3L08A 1Z2MA 4PS8A 1J19A 3VDZA 4X57B 3TBLD 3QCAA 1J0GA 2ZNVB 1AARA 2KX0A 1P0RA 2DYBA 3A9JB 1S1QB 2A5UA 2LXCA 2AYOB 1V81A 2K8CA 4HK2A 3VFKA 1UZXB 3ZRCA 2AL6A 4G50A 2NCNA 3GOEA 2WYQA 4WJQA 5E6NA 3APDA 3DBSA 3HM6X 1RRBA 5IA7A 3DDCB 1WMHA 2RPQA 3NHEB 2MBQA 3A4SC 4EKUA 2ZPYA 4TKNA 1L7YA 4TUUA 5KHQA 1YIWA 5DPSA 1XT9B 2HE7A 4GGQA 4GN1A 3JSVA 2L7RA 3IG3A 2Z59B 3VUWA 3WALA 1WI0A 4FJVB 4EZKA 3ZTDA 2KK8A 1WYWB 4IW0A 3KVFB 4KIKB 2HJ8A 2L0TA 1Z5SB 2BKFA 1P98A 3RULA 4N9F4 2M17A 2I1JA 2YVCA 3PV1A 3A9KB 3R3MA 5E6OA 3O65B 4EUTA 2D3GA 2R2QA 2DZJA 3PHWB 4NPNA 4PS7A 1WMHB 2KJHB 2OJRA 4MELA 5D6JB 4LCDE 4M8MA 3KUDB 1BT0A 1E5WA 2LRWA 2FUHB 1GNUA 2FCSA 1OQYA 4XX5A 1WGHA 4FADA 1Q5WB 2KDEB 4W9LA 4WJNA 4G0NB 2JWZA 2KOXA 5AZGA 2XEWA 1KOTA 3LJ3A 2FCQA 4DXAB 1V86A 3A4RA 4WWNA 3DVNV 2KWUB 1YX5B 3L0WB 4G11A 4MEMA 3VVWB 2FAZA 2C7HA 3JYUA 1VD2A 2KVRA 1Q1OA 5D2MB 1NDDA 4LDTD 5KHOA 2NS5A 3ZDTA 2L3ZA 2K8BA 2NBVB 3R66C 3RYTA 3UGBB 1GG3A 1J8CA 4W9JA 4BBNF 4HPLB 1A5RA 3QK0A 2IO3B 3V60A 4WAAA 4K7UA 3IVFA 1WGGA 2KNBA 4MSQB 2JPHA 3SHQA 1LQBA 2DYOA 2KDFB 2XBBC 4PYZA 1YX6B 3BY4B 2GBKA 3NS8A 2KJ6A 4WWOA 3ML8A 1WR6E 4KZ0A 3RZFA 2DZMA 2K25A 4MH0E 1WGDA 2FNJB 2RSUA 3HK0A 4GSWA 3ALBA 1EO6A 3AU5A 2JRHA 4WQOB 2KWCA 1XQQA 2Z0DB 5C23A 2KANA 1P3QU 4DHZE 3UF8A 4II2B 2FIFA 3AULA 2JZZA 4I6NB 2NPTB 5E6PA 4BBNC 3TL5A 4ZDVA 1UH6A 2RR9A 2MBEA 1ZGUB 2L0FA 4ASWC 2D2QA 3OLMD 4I6LB 5J2RA 1LXDA 2KDIA 2CHXA 1EF5A 4MGKE 1WX9A 4EZJA 4DK5A 3L17A 3D32A 3TJPA 4MGYE 3ONSA 1WIAA 4GDKB 4M0WB 1WXSA 2K6DB 5IAAC 3TIXA 2GBRA 3MJWA 5TR5A 2C5LC 2CHWA 3PGEA 3X0WA 1XD3B 1ZKHA 2ZZPB 3PRMB 4IWQA 3DVGY 2EKEC 1WXAA 3EC8A 2NPTA 4TQ0A 3PVLA 2AEHA 2MWSB 2LASA 1WJ6A 3V61A 3VH3B 1YJ1A 2J7QB 2IO0B 3ZO5B 1LFDA 3LDZE 4IUMB 5DPRA 4DDGD 3KH0A 4BKSD 4K7WA 4GDLB 4ANUA 4FA6A 2A4ZA 3VXWA 4GIVA 2IYDB 5DPTA 1UBIA 3RZWC 4W9EA 2KKCA 5CHVC 2GBMA 4DHZB 4ANVA 3H7PB 1GJZA 3P2BA 4NJ6A 3PZDA 3PS6A 3QQ8B 2I1KA 5EDSA 1E8YA 1EUVB 1VCBA 5CHWA 4AWJA 3QC8B 5AZFA 2KC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DWF A;  3VQI A;  1S3S G;  4W9G A;  2BYV E;  2MBO A;  4LJP B;  3ZRF A;  1NBF C;  2PPH A;  2DZK A;  2C7N B;  2C60 A;  3PPA A;  2ZCC A;  3WAN A;  2KTR B;  2MBH A;  3KYC D;  5DCN A;  3QAQ A;  4E74 A;  4HVB A;  4MGZ E;  1E8W A;  2RGF A;  1TBE A;  2K6Q A;  3APF A;  2HD5 B;  4JLC A;  5DPW A;  4E71 A;  2JF5 A;  1TTN A;  1I42 A;  3IBE A;  4FHJ A;  2WWZ A;  3RD2 A;  2KC1 A;  3N30 A;  1V80 A;  1WX8 A;  2M8S A;  4GDK A;  3B0A A;  2PE9 A;  2Z0E B;  4K1R B;  5FR6 A;  3U7D A;  1V49 A;  1M94 A;  3VAW A;  3DCG A;  1OEY J;  3Q3F A;  3ZNZ B;  4B9K A;  2N9E B;  4JL9 A;  3VUY A;  4AP4 C;  1UBQ A;  2KO3 A;  2KTR A;  1T0Y A;  4ANX A;  3CF6 E;  2KQ7 A;  1YD8 U;  3MHS D;  4FLH A;  3K9P B;  2ZVO A;  4PS3 A;  4GOC A;  4DHJ D;  5JHA A;  1UEL A;  4P7I A;  4HDQ A;  2O6V B;  5G2N A;  1R4N I;  2DHZ A;  4HWI B;  3QAR A;  4NQK E;  1RLF A;  3HIZ A;  3U8Z A;  2MSE D;  2CU1 A;  3ZIM A;  2V1Y A;  2DYM A;  2DZI A;  2O2V A;  1WE7 A;  2V3S A;  4KV2 A;  2JUO A;  1X1M A;  3PRZ A;  4B6W A;  3QJZ A;  3OAW A;  2R2O A;  1P1A A;  1E7U A;  1U4A A;  2HTH A;  2O6V D;  3QIJ A;  4FHK A;  2PEA A;  3W1S A;  2LVO A;  2BWF A;  3VTW A;  2KFK B;  2MQJ A;  2REX A;  2M1M A;  1IPG A;  1TGZ B;  2K8H A;  3JVZ X;  3N3K B;  4WJO A;  3V62 A;  3WA0 A;  3KUZ A;  3I3T B;  3EEC A;  2ZJD A;  3U30 A;  3ZW3 A;  4KSL C;  5LLI A;  4FJY A;  3V6E B;  1ZW7 A;  4KDI C;  3HHM A;  2BKR B;  1V9J A;  4RM8 A;  4I6P A;  1EF1 A;  2LRU A;  4NAW B;  2MCN B;  4EEW A;  3JSV B;  5AZH A;  4KSK C;  1LM8 B;  2CR5 A;  1QZE A;  2GBN A;  4M8N A;  1WGY A;  5L83 A;  3A33 B;  1KM7 A;  1WRD B;  3W1Y A;  2V4L A;  5CHF A;  3X23 A;  4ZRK A;  5JZE B;  2JRI B;  4TV3 A;  3PLV A;  4F1S A;  3VTV A;  3DBH I;  3UIP B;  2KWV B;  4JQW C;  2M4N A;  4W9F A;  2KXJ A;  3RUI B;  4RM9 A;  3R7R A;  5LXH A;  2LZ6 A;  1UD7 A;  2CS4 A;  3EHV A;  1GUA B;  3KUC B;  1C1Y B;  1WXM A;  4K7S A;  4B95 A;  1Y8R C;  2LJ5 A;  5LXI B;  1WZ0 A;  3M63 B;  2JXX A;  4CO7 A;  2RD0 A;  4AOF A;  2LI5 A;  2N7D A;  1WH3 A;  4BKT A;  3ENE A;  3PSE B;  4BOS C;  4IM2 A;  2UYZ B;  3PLU A;  3APC A;  2MW5 A;  3UIN B;  2MA9 B;  4AUQ C;  4AJW A;  3H1U A;  3L54 A;  3KW5 B;  2KJR A;  4IWO A;  2CHZ A;  2DX5 B;  4W9H A;  5D7G A;  4ANW A;  4W9D A;  3PHX B;  1WJ4 A;  4A3O A;  4F7Z A;  2LGX A;  3UIO B;  3VHT C;  3L13 A;  4KDL B;  1WF9 A;  4URK A;  2PJH A;  1SE9 A;  2GMI C;  4EFO A;  4YL8 A;  2BYE A;  2BWE S;  3R7Q A;  1SIF A;  4MJS A;  4DDI D;  4IWP A;  3CMM B;  1WFY A;  3T8M A;  2ZNV C;  4EOY A;  3JW0 X;  4KIK A;  4NNJ B;  2N1V A;  3UQA A;  2EMS A;  3ZUN A;  3H7S A;  1V5T A;  5J18 A;  2FCM A;  3S2A A;  5L95 C;  1OGW A;  1FXT B;  2BYF A;  2C7M B;  2G45 B;  3DQV A;  4J6I A;  4GXB A;  2L8J A;  2LWP A;  3SD5 A;  3MTN B;  3CSF A;  1WY8 A;  2C9W B;  4WWP A;  1E8Z A;  5D94 A;  3QX1 A;  4BFR A;  1CMX B;  4WJP A;  4MDK E;  2WX0 A;  2MRP A;  5G55 A;  1GC7 A;  3CST A;  4HCP B;  4F8C B;  3T9L A;  2ZPN A;  5J17 A;  2G4D B;  2JT4 B;  2KDB A;  3IHP C;  1ISN A;  2LD9 A;  4MSM B;  1WZ3 A;  4W9C A;  1NI2 A;  2O2V B;  5CX3 A;  2JZ3 B;  3H9D A;  1WM3 A;  1WM2 A;  5HKH A;  4BKG A;  1HE8 A;  2W9N A;  2LGY A;  2YLM A;  3WAM A;  2MP2 B;  1KJT A;  2K1F A;  2KN5 A;  2BPS A;  1F9J A;  3M3J A;  3NZS A;  1SGH A;  1D3Z A;  4NQL B;  4A3P A;  3DOW A;  3DBR I;  4GU2 A;  5GMV A;  3QHT A;  3N32 A;  2VRR B;  4RMA A;  4GDL A;  2KX3 A;  3UQB A;  4XZ4 A;  1V2Y A;  3VH4 B;  2GOW A;  1WE6 A;  2QHO A;  3ML9 A;  2L76 A;  1C3T A;  1RAX A;  2PE6 B;  3NY5 A;  4IM0 A;  2IO1 B;  2MX2 A;  4MJS B;  2NBU A;  2WX1 A;  1TZ1 A;  2FCN A;  4GMV A;  2ZVN A;  3PTF C;  4HJK A;  1V6E A;  2MP2 A;  2N4F A;  1OEY A;  2J0K A;  4KZC A;  3ZNH B;  4ZRI A;  3QA8 A;  1WJN A;  2BF8 B;  3WAP A;  1JRU A;  2IBI B;  2LUE A;  4ZYN A;  4IC7 B;  3M62 B;  3ZTC A;  4HDO A;  2IO2 B;  4ICU A;  1WX7 A;  5JH5 C;  4HCN B;  2FID A;  1WGR A;  3GZN I;  1WXV A;  4FUL A;  3ZNI D;  2NR2 A;  3SDL C;  1WR1 A;  2DAJ A;  3PT2 B;  4W9K A;  3WIM A;  4HXD A;  3ZLZ A;  3AI5 A;  4HPM B;  1H4R A;  2G4S A;  3ECI A;  3SU8 X;  2KFJ A;  4IG7 B;  4JGH B;  5C1Z A;  2KZR A;  2KMC A;  4FJZ A;  2D07 B;  1WJU A;  2N7E A;  3ZNG C;  2UWQ A;  4HLE A;  2LXA A;  3EFU A;  2L00 B;  5BO4 B;  1IYF A;  2M0X A;  1L2N A;  4FBJ B;  4II3 B;  1GC6 A;  3OJ3 A;  4NJ7 A;  2NBW B;  1PQS A;  4CHK A;  2ZCB A;  3DVG X;  2D11 A;  3B1L X;  2DEN B;  2OOB B;  3B08 A;  3H7P A;  4BVU C;  3C0R B;  3DBL I;  3A1Q A;  1OTR B;  2MLB A;  3NOB A;  4XC2 A;  1H8C A;  4AJY B;  1YQB A;  4LDT B;  4IM3 A;  4CYE A;  3DVN U;  4ICV A;  3RCZ A;  2LVQ A;  2ZEQ A;  4BOZ B;  3H6N A;  4A20 A;  3ZVV A;  3OJ4 B;  3AU4 A;  4E3C A;  3TCA A;  2D10 A;  2GBJ A;  3KYD D;  2KFK A;  2N9P C;  2KQS A;  2K39 A;  2Y5B B;  3PRE A;  4ZRJ A;  2EMT A;  3PRP B;  3TMP B;  3VTU A;  4BKS A;  4KVG B;  3ZDM C;  1KLV A;  2MBB B;  3HM3 A;  1RFA A;  1E8X A;  4PYU A;  2AL3 A;  3QWZ B;  2IY1 B;  4NY0 A;  3NZU A;  1V5O A;  2AWT A;  2XK5 A;  1R4M I;  3Q3J A;  1P9D U;  2KTF A;  3AXC A;  2ASQ A;  3A1Q B;  4W9I A;  3RT3 B;  1G6J A;  2G3Q B;  2J0J A;  4NAW A;  3W1S C;  2N1W A;  2N9X A;  2WDT B;  3L16 A;  2B3A A;  1Q0W B;  5JHB A;  2BGF A;  4JIO U;  3WAO A;  5CTR C;  3A9K A;  1MG8 A;  1K8R B;  2J0M A;  1E90 A;  1I35 A;  2KLC A;  3A9J A;  4OVU A;  4EZL A;  4FN2 A;  1IP9 A;  1E7V A;  3K9O B;  2CKH B;  4K81 A;  4MM3 A;  2L05 A;  2LVP A;  2JY6 A;  2O6V A;  3DPD A;  2XK5 B;  2KMA A;  4OVV A;  2DAF A;  2KD0 A;  3ZKJ C;  5AEK B;  2IZV B;  2IY0 B;  2KHW B;  3BIN A;  2LGD A;  2JVC A;  1UGM A;  2KLG A;  3VUX A;  4DBG A;  4G3X B;  2NVU I;  4MGI E;  3M95 A;  4GB9 A;  3L10 B;  4DHJ B;  4LJO B;  3IFW B;  4TQ1 A;  3V6C B;  3L08 A;  1Z2M A;  4PS8 A;  1J19 A;  3VDZ A;  4X57 B;  3TBL D;  3QCA A;  1J0G A;  2ZNV B;  1AAR A;  2KX0 A;  1P0R A;  2DYB A;  3A9J B;  1S1Q B;  2A5U A;  2LXC A;  2AYO B;  1V81 A;  2K8C A;  4HK2 A;  3VFK A;  1UZX B;  3ZRC A;  2AL6 A;  4G50 A;  2NCN A;  3GOE A;  2WYQ A;  4WJQ A;  5E6N A;  3APD A;  3DBS A;  3HM6 X;  1RRB A;  5IA7 A;  3DDC B;  1WMH A;  2RPQ A;  3NHE B;  2MBQ A;  3A4S C;  4EKU A;  2ZPY A;  4TKN A;  1L7Y A;  4TUU A;  5KHQ A;  1YIW A;  5DPS A;  1XT9 B;  2HE7 A;  4GGQ A;  4GN1 A;  3JSV A;  2L7R A;  3IG3 A;  2Z59 B;  3VUW A;  3WAL A;  1WI0 A;  4FJV B;  4EZK A;  3ZTD A;  2KK8 A;  1WYW B;  4IW0 A;  3KVF B;  4KIK B;  2HJ8 A;  2L0T A;  1Z5S B;  2BKF A;  1P98 A;  3RUL A;  4N9F 4;  2M17 A;  2I1J A;  2YVC A;  3PV1 A;  3A9K B;  3R3M A;  5E6O A;  3O65 B;  4EUT A;  2D3G A;  2R2Q A;  2DZJ A;  3PHW B;  4NPN A;  4PS7 A;  1WMH B;  2KJH B;  2OJR A;  4MEL A;  5D6J B;  4LCD E;  4M8M A;  3KUD B;  1BT0 A;  1E5W A;  2LRW A;  2FUH B;  1GNU A;  2FCS A;  1OQY A;  4XX5 A;  1WGH A;  4FAD A;  1Q5W B;  2KDE B;  4W9L A;  4WJN A;  4G0N B;  2JWZ A;  2KOX A;  5AZG A;  2XEW A;  1KOT A;  3LJ3 A;  2FCQ A;  4DXA B;  1V86 A;  3A4R A;  4WWN A;  3DVN V;  2KWU B;  1YX5 B;  3L0W B;  4G11 A;  4MEM A;  3VVW B;  2FAZ A;  2C7H A;  3JYU A;  1VD2 A;  2KVR A;  1Q1O A;  5D2M B;  1NDD A;  4LDT D;  5KHO A;  2NS5 A;  3ZDT A;  2L3Z A;  2K8B A;  2NBV B;  3R66 C;  3RYT A;  3UGB B;  1GG3 A;  1J8C A;  4W9J A;  4BBN F;  4HPL B;  1A5R A;  3QK0 A;  2IO3 B;  3V60 A;  4WAA A;  4K7U A;  3IVF A;  1WGG A;  2KNB A;  4MSQ B;  2JPH A;  3SHQ A;  1LQB A;  2DYO A;  2KDF B;  2XBB C;  4PYZ A;  1YX6 B;  3BY4 B;  2GBK A;  3NS8 A;  2KJ6 A;  4WWO A;  3ML8 A;  1WR6 E;  4KZ0 A;  3RZF A;  2DZM A;  2K25 A;  4MH0 E;  1WGD A;  2FNJ B;  2RSU A;  3HK0 A;  4GSW A;  3ALB A;  1EO6 A;  3AU5 A;  2JRH A;  4WQO B;  2KWC A;  1XQQ A;  2Z0D B;  5C23 A;  2KAN A;  1P3Q U;  4DHZ E;  3UF8 A;  4II2 B;  2FIF A;  3AUL A;  2JZZ A;  4I6N B;  2NPT B;  5E6P A;  4BBN C;  3TL5 A;  4ZDV A;  1UH6 A;  2RR9 A;  2MBE A;  1ZGU B;  2L0F A;  4ASW C;  2D2Q A;  3OLM D;  4I6L B;  5J2R A;  1LXD A;  2KDI A;  2CHX A;  1EF5 A;  4MGK E;  1WX9 A;  4EZJ A;  4DK5 A;  3L17 A;  3D32 A;  3TJP A;  4MGY E;  3ONS A;  1WIA A;  4GDK B;  4M0W B;  1WXS A;  2K6D B;  5IAA C;  3TIX A;  2GBR A;  3MJW A;  5TR5 A;  2C5L C;  2CHW A;  3PGE A;  3X0W A;  1XD3 B;  1ZKH A;  2ZZP B;  3PRM B;  4IWQ A;  3DVG Y;  2EKE C;  1WXA A;  3EC8 A;  2NPT A;  4TQ0 A;  3PVL A;  2AEH A;  2MWS B;  2LAS A;  1WJ6 A;  3V61 A;  3VH3 B;  1YJ1 A;  2J7Q B;  2IO0 B;  3ZO5 B;  1LFD A;  3LDZ E;  4IUM B;  5DPR A;  4DDG D;  3KH0 A;  4BKS D;  4K7W A;  4GDL B;  4ANU A;  4FA6 A;  2A4Z A;  3VXW A;  4GIV A;  2IYD B;  5DPT A;  1UBI A;  3RZW C;  4W9E A;  2KKC A;  5CHV C;  2GBM A;  4DHZ B;  4ANV A;  3H7P B;  1GJZ A;  3P2B A;  4NJ6 A;  3PZD A;  3PS6 A;  3QQ8 B;  2I1K A;  5EDS A;  1E8Y A;  1EUV B;  1VCB A;  5CHW A;  4AWJ A;  3QC8 B;  5AZF A;  2KC2 A; 
#chains in the Genus database with same CATH topology
 4W9G A;  1XLO A;  3U2S C;  3ZRF A;  2C7N B;  3WAN A;  1MFW A;  3DWG C;  3QAQ A;  5IO9 A;  1E8W A;  1TT5 B;  2D3C A;  2RGF A;  3APF A;  4JLC A;  2HD5 B;  4R3D A;  2JF5 A;  1TTN A;  3IBE A;  4DQO C;  2WWZ A;  3N30 A;  4GDK A;  2V9H A;  5FR6 A;  4WH4 A;  4ZRQ A;  2PTL A;  3ZNZ B;  3VUY A;  2KTR A;  3SR6 A;  2MHJ A;  4P7I A;  4HDQ A;  1HQR D;  5G2N A;  1R4N I;  3O13 A;  1RLF A;  4RF1 A;  2CU1 A;  3ZIM A;  2DZI A;  4KV2 A;  2V3S A;  3AE4 B;  5BMH A;  4RFB A;  3PRZ A;  4HEA 1;  4B6W A;  3QJZ A;  1P1A A;  3QIJ A;  1ZXI A;  3W1S A;  2LVO A;  3VTW A;  1IPG A;  3V62 A;  3N3K B;  1MPE A;  2N9K A;  3I3T B;  2K3U A;  2ZJD A;  5LLI A;  3V6E B;  3CWI A;  1VZ8 A;  1EF1 A;  2IGG A;  2LRU A;  2MCN B;  2JWU A;  2AX5 A;  2CR5 A;  4M8N A;  1WGY A;  1N61 A;  1M4V A;  2VZK B;  2N0S B;  2V4L A;  4ZRK A;  4F1S A;  3DBH I;  1HEZ E;  4JQW C;  4W9F A;  1YOV B;  1R4N B;  3AB5 A;  4RM9 A;  3R7R A;  5AUI A;  1P7F A;  5LXH A;  2CS4 A;  2VH1 A;  2W54 A;  3M63 B;  2JXX A;  2VH2 A;  3R2T A;  4AOF A;  4N6E B;  4ZYS A;  2ZW0 A;  2WXP A;  3SFD B;  1AWD A;  4IM2 A;  2MH7 A;  2MW5 A;  4AJW A;  4KGS A;  2PVO D;  3H1U A;  2KJR A;  2CHZ A;  3IT6 B;  4DXF A;  1WJ4 A;  2LGX A;  4H2A A;  4EFO A;  3AEB B;  2BYE A;  2BWE S;  3C19 A;  1DYQ A;  1QOF A;  2FE8 A;  1WFY A;  3CMM B;  3T8M A;  4EOY A;  3H7S A;  4C4V A;  2FCM A;  5L95 C;  4A55 A;  4YTM B;  4OW0 A;  2AQ1 B;  2C7M B;  2OED A;  4GXB A;  5BMG A;  3NJT A;  1WY8 A;  4WWP A;  4XE0 A;  1CMX B;  1PFD A;  5G55 A;  4HCP B;  1XEE A;  3T9L A;  3J9C A;  2KDB A;  4C80 A;  3RNG C;  4C4V B;  5HKH A;  3N1Z C;  2YLM A;  2MP2 B;  1IBX B;  2QSD A;  1F9J A;  2QIL A;  3VR9 B;  4A3P A;  3DOW A;  2WP9 B;  3QHT A;  4RMA A;  1ET6 A;  3FIL A;  3ZJT A;  4XZ4 A;  1V2Y A;  4NJC A;  1C3T A;  1XF5 L;  4OZB A;  2IO1 B;  3VR8 B;  4MJS B;  2SEB D;  4GMV A;  2INP E;  2J0K A;  5EE1 A;  3WAP A;  1YN4 A;  2LUE A;  3M62 B;  4HDO A;  3U4E G;  1TS3 A;  1R4M B;  4FUL A;  1FO4 A;  1I4P A;  3SDL C;  1KRH A;  1WR1 A;  5LNK 1;  1A70 A;  4W9K A;  3WIM A;  2JU6 X;  5EE0 A;  1WWT A;  2G4S A;  3Q3O C;  4FJZ A;  3OG5 A;  2LXA A;  3Q6B A;  4P6V F;  2WGS A;  2ACZ B;  2ZCB A;  3AV8 A;  3DVG X;  2D11 A;  4L2Y A;  4P1C C;  1RYJ A;  2I38 A;  3B08 A;  2V4I B;  1C78 A;  4BVU C;  1VR9 A;  1OTR B;  3A1Q A;  3NOB A;  4XC2 A;  1JRO A;  3RFZ B;  3RI7 C;  1YQB A;  4IM3 A;  4ICV A;  3RCZ A;  2LVQ A;  1VZ7 A;  4A20 A;  3OJ4 B;  2BVC A;  2JSV X;  3NUH B;  2K39 A;  3PRE A;  3FC4 A;  4BKS A;  1KLV A;  4ITK A;  2UU7 A;  3N1Y C;  5AUK A;  2K0P A;  4HRO A;  3Q8E A;  2IY1 B;  3ZGZ A;  3AE6 B;  3A1Q B;  2G3Q B;  3L16 A;  2N9X A;  4US9 A;  1MJD A;  2B3A A;  1Q0W B;  3WAO A;  5CTR C;  1UUP A;  2Z8L A;  2V3N A;  4FN2 A;  3DHG C;  1E7V A;  4K81 A;  2CKH B;  5AEK B;  1HXY D;  1UGM A;  4XYC A;  2QDF A;  4DBG A;  2NVU I;  1VDV A;  4YTP B;  4LJO B;  3IFW B;  3V6C B;  2WXI A;  1Z2M A;  1UNS A;  3L08 A;  3EUB 2;  3VDZ A;  2WXG A;  1AAR A;  1YJJ A;  1KH0 A;  3P42 A;  1I4H A;  3AE1 B;  3GOE A;  5E6N A;  3APD A;  5MPO A;  2IGH A;  3DDC B;  1JW9 D;  1MI0 A;  2XN9 C;  4UDU C;  3GE8 C;  4TKN A;  1L7Y A;  2K9X A;  3ABV B;  5DPS A;  2HE7 A;  4WWM A;  3VUW A;  2KK8 A;  3RNA C;  3KVF B;  1SJE D;  1P98 A;  3RUL A;  3PV1 A;  2R2Q A;  3PHW B;  4PS7 A;  5IP4 D;  2KJH B;  5D6J B;  3KUD B;  3AE8 B;  3B2G A;  3KQ4 A;  3NVV A;  1VZ6 A;  1OQY A;  1KTK A;  4XX5 A;  1WGH A;  1Q5W B;  4W9L A;  4G0N B;  2KOX A;  5AZG A;  2XEW A;  4KKI A;  4ZHP A;  4MEM A;  2FAZ A;  1Q1O A;  1Y56 A;  1NYQ A;  3Q8F A;  1TS2 A;  5KHO A;  3ZDT A;  3RYT A;  4W9J A;  1A5R A;  1KF6 B;  2M0A A;  5IOI A;  1WGG A;  4MSQ B;  1LQB A;  2XBB C;  2GBK A;  4WWO A;  4B0E A;  4MH8 A;  4DXG A;  2KAN A;  2NPT B;  5E6P A;  2BBC A;  1XLQ A;  1CJE A;  4ASW C;  2D2Q A;  1MHH E;  4I6L B;  5I4D A;  4EZJ A;  3DBL B;  3TJP A;  2OJW A;  2PVG C;  5TR5 A;  5FR3 A;  1N60 A;  2PW9 A;  3I63 C;  1N63 A;  1MHX A;  2WXQ A;  2NPT A;  3PVL A;  3LDZ E;  5DPR A;  3KH0 A;  4BKS D;  4K7W A;  3BZD B;  2A4Z A;  3RZW C;  1FNW A;  2KKC A;  2GBM A;  1EU3 A;  4ANV A;  3H7P B;  3RPF C;  3PZ7 A;  2PKO A;  3QQ8 B;  1HZ6 A;  5EDS A;  4KGT A;  2X8X X;  5HHD G;  1JML A;  1S3S G;  3BVZ A;  2BYV E;  2C60 A;  3PPA A;  2WXL A;  1J7A A;  4HVB A;  1I4X A;  1TBE A;  2K6Q A;  1KFY B;  5DPW A;  2M19 A;  4FHJ A;  1DGJ A;  3RD2 A;  1TY0 A;  1WX8 A;  3L4P A;  2NTS A;  3U7D A;  2CJO A;  3VAW A;  1OEY J;  3Q3F A;  2L1A A;  4AP4 C;  1UBQ A;  1V97 A;  2KO3 A;  1T0Y A;  2KQ7 A;  3MHS D;  3NVY A;  2ZVO A;  4PS3 A;  2DHZ A;  2OHF A;  2YEP F;  3QAR A;  3PO0 A;  1TS5 A;  4WAF A;  3U8Z A;  5BYS A;  1WE7 A;  1ZUD 2;  1F2R I;  3OAW A;  1E7U A;  2HTH A;  4FHK A;  5FKA C;  2KFK B;  1ZDV A;  2D5G A;  3ETR A;  2IPK D;  2BB5 A;  3W9C B;  5BYR A;  3AH7 A;  4KDI C;  2BKR B;  1V9J A;  4RM8 A;  4I6P A;  3P4R B;  2QCZ A;  4EEW A;  4WQM A;  5AZH A;  2I2Y A;  1K53 A;  2R61 A;  2WU5 B;  3FAH A;  5JZE B;  1OQR A;  3Q3M C;  2JRI B;  4TV3 A;  1FNV A;  3UIP B;  3V3X A;  2QEJ C;  2M4N A;  2K22 A;  3EHV A;  1E10 A;  1D5M C;  2JQR B;  3AE9 B;  3Q3N C;  4CO7 A;  3KWL A;  2N7D A;  1F77 A;  4BOS C;  1QOG A;  3APC A;  2MA9 B;  2DX5 B;  1XXG A;  2QIE B;  3VHT C;  3L13 A;  4URK A;  5IN7 A;  1SE9 A;  2IJ0 A;  1F1H A;  5G5G A;  1VJK A;  3AE2 B;  2ZNV C;  1V5T A;  1FRR A;  5J18 A;  2BYF A;  2G45 B;  2L8J A;  1FNU A;  3RNB C;  3CSF A;  4BFR A;  4HKZ E;  4WJP A;  2MRP A;  3HUI A;  4JE3 B;  1SB3 C;  2WDV B;  4F8C B;  2ZPN A;  4MSM B;  1WZ3 A;  1ROE A;  5CX3 A;  1WM3 A;  4LNI A;  2PIA A;  2KN5 A;  2BPS A;  4USA A;  5EE9 A;  3NZS A;  2JX5 A;  1SGH A;  2LGI A;  4NQL B;  5GMV A;  2KX3 A;  3Q8A A;  3VRB B;  4A9A A;  2L76 A;  1FMA D;  3R2I A;  2PE6 B;  4IM0 A;  1DOY A;  4JWU C;  1TZ1 A;  1GOZ A;  1I4G A;  2ICI A;  2MP2 A;  1P7E A;  5H92 C;  3ZNH B;  4ZRI A;  1WJN A;  1QT9 A;  1R7S A;  1C9F A;  1WX7 A;  2RPV A;  2FID A;  3ZNI D;  3AE7 B;  4M0W A;  2DAJ A;  3PT2 B;  3AI5 A;  1N62 A;  1V8C A;  4IG7 B;  2KMC A;  2D07 B;  2N7E A;  3ZNG C;  1E9M A;  2JXT A;  3PZ8 A;  2L00 B;  1IYF A;  4P16 A;  4N59 A;  1L2N A;  2DLB A;  4II3 B;  3OJ3 A;  1PQS A;  4CHK A;  1XCT L;  2DEN B;  1HTQ A;  3H7P A;  3C0R B;  2AQ2 B;  1TKE A;  1V1P B;  3AU4 A;  5H8Y E;  3TCA A;  3KYD D;  2KFK A;  1YMH E;  2WXN A;  2KQS A;  2EMT A;  2G1E A;  1RFA A;  4PYU A;  3QWZ B;  2MEK A;  1UWX A;  5C2T B;  1R4M I;  2SAK A;  1P9D U;  2KTF A;  3U7Z A;  2ASQ A;  2WHI A;  4W9I A;  3RN9 C;  3W1S C;  2N1W A;  2WDT B;  2WQY B;  2W55 A;  5JHB A;  2BS3 B;  1F52 A;  3MC8 A;  1I35 A;  3A9J A;  4EZL A;  2NTT A;  1IP9 A;  4MM3 A;  2XNA C;  2KMA A;  4RGO S;  2DAF A;  2LFI A;  2KHW B;  3VUX A;  4G3X B;  2KWD A;  4RCO A;  4DHJ B;  1TKG A;  4X57 B;  1J0G A;  1HA5 A;  2ZNV B;  1S1Q B;  1E7P B;  2A5U A;  2AYO B;  4HK2 A;  3VFK A;  3ZRC A;  2AL6 A;  2NCN A;  3DBS A;  3HM6 X;  3RNE C;  4AQ7 A;  5IA7 A;  1QIL A;  1ZE3 D;  4GN1 A;  3JSV A;  2L7R A;  3IG3 A;  4FJV B;  2Y3A A;  1WYW B;  4PK1 A;  1TS4 A;  2HJ8 A;  2EEL A;  2I1J A;  2YVC A;  2AQ3 B;  4FXC A;  4L1B A;  4NPN A;  2X38 A;  2CJN A;  4A8X C;  1T3Q A;  1E5W A;  2LRW A;  2FCS A;  4FAD A;  2KDE B;  1KOT A;  2KYW A;  4YSY B;  4DXA B;  4WWN A;  4LNF A;  3JYU A;  3NG0 A;  1NDD A;  4C00 A;  4LDT D;  2L3Z A;  2K8B A;  2NBV B;  3UGB B;  4HPP A;  3TUO A;  1XLN A;  4WAA A;  4K7U A;  5TSS A;  2KDF B;  4PYZ A;  4AS1 A;  4O1N A;  1I4Q A;  3NS8 A;  3Q8C A;  2BB6 A;  2RSU A;  2K5P A;  4WQO B;  4QAY A;  1L0X B;  2V0G A;  1VLB A;  1T0S C;  4DHZ E;  3UF8 A;  2LGS A;  3TEY A;  2FIF A;  2JZZ A;  3TL5 A;  2MBE A;  1ZGU B;  2L0F A;  2Y5C A;  4L23 A;  1WX9 A;  3MJ5 A;  4GDK B;  2LHE A;  4M0W B;  2PLP A;  3MJW A;  2INN E;  3PGE A;  3TSS A;  4IOI E;  3PRM B;  2EKE C;  1UGJ A;  3EC8 A;  2MWS B;  1UWM A;  3V61 A;  3ZO5 B;  2J7Q B;  1BUI C;  1WGK A;  1LGR A;  4ANU A;  4FA6 A;  3VXW A;  2IYD B;  1C79 A;  5FK9 C;  1GJZ A;  3N9Y C;  3PZD A;  3PS6 A;  4HKQ A;  4TMA B;  1E8Y A;  4AWJ A;  3QC8 B;  4HJG E;  1JWM D;  2BQQ A;  5AZF A;  1WYG A;  3URY A;  2CU3 A;  4LJP B;  2YEP B;  1L6V A;  2PPH A;  1KLU D;  2ZCC A;  2J4X A;  1D6E C;  2IDY A;  3OWE B;  2Y5P A;  4MGZ E;  3MC0 B;  2LHD A;  1I42 A;  2KC1 A;  5BMI A;  2WLB A;  2Z0E B;  1V1O A;  1ZP0 B;  2N9E B;  4PT5 A;  3CF6 E;  1ACC A;  1FXI A;  3K9P B;  4ACF A;  2MJE A;  4DHJ D;  4HWI B;  2FBW B;  1WSP A;  2MSE D;  2DYM A;  2O2V A;  2JUO A;  3GS2 A;  1X1M A;  1JWS D;  2BT6 A;  2M1M A;  1TGZ B;  1QLB B;  2K8H A;  4WJO A;  1NI3 A;  3LXF A;  1T5X D;  3U30 A;  3ZW3 A;  1L0Y B;  4KSL C;  1B9R A;  3AE3 B;  4NAW B;  3JSV B;  1LM8 B;  2GBN A;  3I5J C;  1DOI A;  3EFC A;  1N5W A;  5L83 A;  3A33 B;  1WRD B;  1KLG D;  3PLV A;  2KVZ A;  3VTV A;  2KWV B;  4MM3 B;  1NYR A;  3RUI B;  2LZ6 A;  4YXD B;  1UD7 A;  3Q69 A;  2DBY A;  1WXM A;  3RNC C;  4B95 A;  3GB1 A;  2RD0 A;  1WH3 A;  3ENE A;  2LMC A;  3PSE B;  3E56 A;  2UYZ B;  3PLU A;  5C3J B;  1YQ4 B;  3UIN B;  3L54 A;  1MVK A;  3KW5 B;  4M01 A;  4IWO A;  4ANW A;  4W9H A;  5D7G A;  3HVZ A;  4W9D A;  4A3O A;  4F7Z A;  3DBR B;  3UIO B;  5JXV A;  2WU2 B;  4KDL B;  1WF9 A;  3P4P B;  2PJH A;  5HG2 A;  2RDB C;  3R7Q A;  1SIF A;  2ONQ A;  4DDI D;  4IWP A;  4RGM A;  2W82 A;  3P4S B;  3ZXV A;  2EMS A;  3ZUN A;  4OZA A;  1GB1 A;  2ON8 A;  2N7J A;  3MC9 A;  3DQV A;  4J6I A;  3MTN B;  4K3B A;  2C9W B;  2EKI A;  1E8Z A;  2BYT A;  3AE5 B;  5D94 A;  2WNM A;  2VZK D;  1RFK A;  1K52 A;  4LNK A;  5J17 A;  4W9C A;  2LD9 A;  1VRA B;  2N9L A;  2JZ3 B;  2WDQ B;  1WM2 A;  4BKG A;  2LGY A;  2K1F A;  1SEB D;  3TEX A;  4GU2 A;  3N32 A;  2VRR B;  1C4A A;  4HRS A;  3UQB A;  3B9J A;  3VH4 B;  1WE6 A;  1EM7 A;  3ML9 A;  3NVW A;  1RAX A;  1TIF A;  2MX2 A;  2NBU A;  2WX1 A;  3AEA B;  1FEH A;  1C4C A;  1SIJ A;  3QA8 A;  4RGN A;  2WXJ A;  1QF6 A;  4ZYN A;  2QC8 A;  4IC7 B;  4ICU A;  1Q10 A;  3HVD A;  4HCN B;  5JH5 C;  3GZN I;  1WXV A;  1RWS A;  2NR2 A;  4OHJ A;  2L83 A;  1TZO A;  3ZLZ A;  1JWU D;  1N5X A;  2WXO A;  3AED B;  1I7H A;  1H4R A;  2B76 B;  2D3A A;  3SU8 X;  4JGH B;  5C1Z A;  2KZR A;  1DOX A;  5T8I A;  1FRD A;  2UWQ A;  4LNO A;  4HLE A;  3EFU A;  5BO4 B;  2M0X A;  4FBJ B;  4NJ7 A;  3B1L X;  4D2K A;  2J52 A;  3RMK C;  3FIL B;  3RNF C;  4A6Q A;  4XWT A;  3MP9 A;  3DBL I;  2KAC A;  3Q2A C;  2HTM E;  2Q5W D;  4ARI A;  4LDT B;  1SXT A;  4REZ A;  2N9P C;  2Y5B B;  1EWY C;  4NAM A;  3PRP B;  4KVG B;  3ZDM C;  3E9S A;  2MJD A;  2MBB B;  3HM3 A;  1K51 A;  1V5O A;  1GPX A;  1J7C A;  2AWT A;  2XK5 A;  3Q3J A;  3U52 E;  3RT3 B;  1J7B A;  4NAW A;  1ZDX A;  4LK0 M;  1V1P A;  1LO5 D;  4JIO U;  1AYF A;  3A9K A;  5EE3 A;  3ZXR A;  4YT0 B;  3IT4 B;  1C76 A;  2KLC A;  1STE A;  4XWW A;  1IBX A;  2L05 A;  2JY6 A;  2HJ1 A;  3DPD A;  4OVV A;  3ZKJ C;  2KD0 A;  4S0R A;  2E6X A;  3BIN A;  3DHH C;  1K50 A;  1ZPS A;  3Q8B A;  1RM6 C;  4GB9 A;  3L10 B;  4PS8 A;  1AW7 A;  2WXR A;  3TBL D;  3QCA A;  3T3N A;  2DYB A;  3A9J B;  4E74 A;  1V81 A;  2L52 A;  1UZX B;  2W3S A;  4G50 A;  4RGT A;  2RMM A;  4JX1 C;  1PDX A;  2QMT A;  2WXH A;  3NHE B;  4EKU A;  5KHQ A;  1YIW A;  4MT5 A;  4GGQ A;  3SEB A;  4J3O D;  1WI0 A;  4EZK A;  1CQV A;  2L0T A;  2BKF A;  2H89 B;  4N9F 4;  2M17 A;  3N20 C;  2L32 A;  3R3M A;  5E6O A;  3C8Y A;  1FD6 A;  2OJR A;  4LCD E;  4M8M A;  1XLP A;  2KN4 A;  2FUH B;  3EGR A;  1GNU A;  2BW2 A;  3IAS 1;  3IAM 1;  2INC C;  2JWZ A;  3Q14 C;  3LJ3 A;  2FCQ A;  3DVN V;  2KWU B;  1YX5 B;  3L0W B;  5HFY A;  3VVW B;  1QQR A;  2KVR A;  4BZA A;  4YSZ B;  2KAJ A;  2NS5 A;  3HRD D;  2IO3 B;  3ZQ4 A;  3V60 A;  1TY2 A;  3IVF A;  3SHQ A;  3I9V 1;  3BY4 B;  3UI3 A;  3RZF A;  1YQ3 B;  3AEF B;  2LEK A;  1JAL A;  2K25 A;  4MH0 E;  4GSW A;  2LUM A;  3W5U B;  1SSN A;  2JRH A;  3P4Q B;  2G9H D;  5C23 A;  4II2 B;  1WRI A;  3AUL A;  3LB8 C;  4BBN C;  1UH6 A;  3BII D;  5HI1 A;  4B0M A;  5J2R A;  2KDI A;  2CHX A;  4DK5 A;  1YN5 A;  3B2F A;  1WXS A;  2K6D B;  3TIX A;  2QJL A;  1N6Z A;  2CHW A;  3X0W A;  1XD3 B;  1NEN B;  2ZZP B;  2M56 B;  3DVG Y;  3ZYY X;  1TJE A;  4TQ0 A;  2AEH A;  2LAS A;  1WJ6 A;  3VH3 B;  2IO0 B;  3W2D A;  1LFD A;  4IUM B;  2E3T A;  3BK1 A;  3BYY B;  1SF0 A;  2BS4 B;  4GIV A;  4US8 A;  4OVZ A;  5CHV C;  1YN3 A;  1B1Z A;  4DHZ B;  4NJ6 A;  1HZ5 A;  2WXM A;  1GAQ B;  1FCL A;  4RNA A;  2NMQ A;  4JPS A;  3MHZ A;  4DWF A;  3VQI A;  2MBO A;  3WCQ A;  4N58 A;  1NBF C;  4ZHO A;  2DZK A;  4MAC A;  2KTR B;  3P1M A;  4IKG A;  4M00 A;  3NRZ A;  2MBH A;  3KYC D;  5DCN A;  3TEW A;  1PUT A;  4A90 A;  4E71 A;  2JYE A;  1V80 A;  2KT7 A;  2M8S A;  4BAX A;  3NVZ A;  3B0A A;  2PE9 A;  4K1R B;  4ARC A;  1V49 A;  1D5Z C;  1M94 A;  1IGC A;  3DCG A;  4WUR A;  2BTE A;  1FFU A;  1XO3 A;  4JL9 A;  4B9K A;  4ANX A;  4M02 A;  1YD8 U;  4FLH A;  1C4P A;  5JHA A;  4GOC A;  1UEL A;  2O6V B;  2WDR B;  4NQK E;  4GLS C;  3BVG A;  3HIZ A;  4ZOH C;  2GRI A;  2V1Y A;  1ET9 A;  3BWU D;  2GLS A;  1D4B A;  3AMZ A;  2R2O A;  1U4A A;  2O6V D;  2PEA A;  2BWF A;  2REX A;  2MQJ A;  1ZOY B;  2PMV A;  3JVZ X;  1SE2 A;  3TEZ A;  3WA0 A;  3KUZ A;  3EEC A;  4FJY A;  1ZW7 A;  4TSS A;  4EE2 A;  3HHM A;  4K3C A;  2FUG 1;  3CIR B;  4KX6 B;  5IKC M;  1E0Z A;  4KSK C;  1FIQ A;  1QZE A;  1ESF A;  1KM7 A;  3W1Y A;  3X23 A;  5CHF A;  4C7Y A;  2RDG A;  2HDE A;  2GI9 A;  3SFE B;  2KXJ A;  1GUA B;  1NEK B;  3KUC B;  3V05 A;  1C1Y B;  2JZP A;  4K7S A;  1PGA A;  1Y8R C;  2LJ5 A;  1JQ4 A;  1HTO A;  1WZ0 A;  3VRA B;  5LXI B;  1QOA A;  3DWM A;  2LI5 A;  4BKT A;  4OZC A;  3KWV A;  3I57 A;  2JYT A;  4AUQ C;  2KMM A;  2ZW1 A;  2DWQ A;  2DNF A;  3PHX B;  2MJ3 A;  1TKY A;  4LTU A;  2GMI C;  4YL8 A;  3BK2 A;  1TYG B;  4MJS A;  2BS2 B;  3AM9 A;  3JW0 X;  4KIK A;  4NNJ B;  2N1V A;  3UQA A;  2J53 A;  3S2A A;  1OGW A;  1FXT B;  1SE4 A;  1CK1 A;  2LWP A;  3SD5 A;  1FPY A;  1JRP A;  2RDH A;  3QX1 A;  2IND C;  2W3R A;  4MDK E;  2WX0 A;  3AEC B;  1GC7 A;  3CST A;  1L4Z B;  2G4D B;  2JT4 B;  3IHP C;  1ISN A;  3P63 A;  1NI2 A;  2O2V B;  3H9D A;  4LNN A;  1HE8 A;  2W9N A;  2KQ4 X;  3WAM A;  1KJT A;  1MG4 A;  3M3J A;  1D3Z A;  3DBR I;  1L0V B;  1IGD A;  4GDL A;  1AN8 A;  2WXK A;  5E6J A;  3W5V B;  2J42 A;  4JWS C;  2GOW A;  2QHO A;  3NY5 A;  4XDD A;  2FCN A;  2ZVN A;  3PTF C;  4HJK A;  1V6E A;  5D3D A;  2N4F A;  1OEY A;  4KZC A;  3GE3 C;  2BF8 B;  1JRU A;  2IBI B;  2KDM A;  3ZTC A;  2IO2 B;  1E6E B;  1T0R C;  3AN1 A;  1WGR A;  1C77 A;  4C56 C;  4HXD A;  1WXQ A;  3BYT B;  4HPM B;  2GB1 A;  4RH6 A;  3ECI A;  4YSX B;  2KFJ A;  1WJU A;  1YNT E;  1GC6 A;  2NBW B;  2OOB B;  5BYQ A;  1SE3 A;  5GXG B;  1L4D B;  2MLB A;  4CQN A;  1H8C A;  1I4R A;  4AJY B;  4CYE A;  3DVN U;  3BVM A;  2ZEQ A;  4BOZ B;  3H6N A;  3ZVV A;  4E3C A;  2D10 A;  2GBJ A;  3NZ3 A;  3DBH B;  4ZRJ A;  3TMP B;  3VTU A;  1E8X A;  4YTN B;  1BXT A;  2AL3 A;  4NY0 A;  3NZU A;  3GZN B;  3AXC A;  1G6J A;  1GB4 A;  2LJI A;  2J0J A;  1L5P A;  3LYY A;  2BGF A;  1JCK B;  1MG8 A;  1K8R B;  2J0M A;  1E90 A;  4OVU A;  3K9O B;  1FCC C;  2LVP A;  2O6V A;  2XK5 B;  1JWA D;  1IUE A;  2IZV B;  3IXS A;  1YJI A;  2IY0 B;  1JWB D;  1QKZ A;  2H88 B;  2JVC A;  2LGD A;  2KLG A;  4S17 A;  2D3B A;  4MGI E;  3M95 A;  4TQ1 A;  1J19 A;  3H8H A;  1PGB A;  2KX0 A;  1P0R A;  2LXC A;  2K8C A;  1EU4 A;  1OFF A;  1OQQ A;  4YWG G;  4C7Z A;  2WYQ A;  4WJQ A;  4Q2J A;  1RRB A;  1WMH A;  2RPQ A;  2MBQ A;  3A4S C;  2ZPY A;  4TUU A;  1F2R C;  3NS1 A;  1XT9 B;  1F0Z A;  2Z59 B;  3WAL A;  3ZTD A;  3KLS X;  1CZP A;  4IW0 A;  4KIK B;  3FKY A;  1Z5S B;  3N1X C;  3A9K B;  4EUT A;  3O65 B;  2D3G A;  1T0Q C;  2DZJ A;  3ZJU A;  1WMH B;  4MEL A;  1BT0 A;  3AEE B;  1PGX A;  4WJN A;  1V86 A;  3A4R A;  4G11 A;  2C7H A;  1VD2 A;  5D2M B;  1XCQ L;  1T6B X;  1PYW D;  4P1B C;  2V3P A;  3EA6 A;  3R8B A;  3MFG A;  1J8C A;  3R66 C;  1GG3 A;  2TSS A;  4BBN F;  4HPL B;  3QK0 A;  4LLG M;  3AEG B;  1SBB B;  4NZL B;  3T3O A;  2KNB A;  2JPH A;  2DYO A;  1QOB A;  1YX6 B;  2KJ6 A;  3ML8 A;  1WR6 E;  2WXF A;  4KZ0 A;  5G5H A;  2DZM A;  1WGD A;  2FNJ B;  3HK0 A;  3ALB A;  1EO6 A;  4IDI A;  4WIP A;  3AU5 A;  4KGR A;  2KWC A;  1XQQ A;  2Z0D B;  1P3Q U;  4XGA B;  4I6N B;  1FXA A;  4ZDV A;  2RR9 A;  3OLM D;  1LXD A;  1EF5 A;  4MGK E;  3ZJV A;  3L17 A;  3D32 A;  4MGY E;  3ONS A;  1WIA A;  5IAA C;  2GBR A;  2C5L C;  1ZKH A;  1FFV A;  4IWQ A;  1L6U A;  1WXA A;  5D3I B;  1SJH D;  1ZXH A;  3GP7 A;  1YJ1 A;  4DDG D;  2IGD A;  4GDL B;  4KKJ A;  1NVI D;  4RF0 A;  5DPT A;  1UBI A;  1D5X C;  1ENF A;  4W9E A;  4ZRP A;  3P2B A;  3DHI C;  2WS3 B;  1FM0 D;  1UF0 A;  2I1K A;  1EUV B;  1VCB A;  1BML C;  5CHW A;  1EWC A;  4XDC A;  2KC2 A; 
#chains in the Genus database with same CATH homology
 4DWF A;  3VQI A;  1S3S G;  4W9G A;  2BYV E;  2MBO A;  4LJP B;  3ZRF A;  1NBF C;  2PPH A;  2DZK A;  2C7N B;  2C60 A;  3PPA A;  2ZCC A;  3WAN A;  2KTR B;  2MBH A;  3KYC D;  5DCN A;  3QAQ A;  4E74 A;  4HVB A;  4MGZ E;  1E8W A;  2RGF A;  1TBE A;  2K6Q A;  3APF A;  2HD5 B;  4JLC A;  5DPW A;  4E71 A;  2JF5 A;  1TTN A;  1I42 A;  3IBE A;  4FHJ A;  2WWZ A;  3RD2 A;  2KC1 A;  3N30 A;  1V80 A;  1WX8 A;  2M8S A;  4GDK A;  3B0A A;  2PE9 A;  2Z0E B;  4K1R B;  5FR6 A;  3U7D A;  1V49 A;  1M94 A;  3VAW A;  3DCG A;  1OEY J;  3Q3F A;  3ZNZ B;  4B9K A;  2N9E B;  4JL9 A;  3VUY A;  4AP4 C;  1UBQ A;  2KO3 A;  2KTR A;  1T0Y A;  4ANX A;  3CF6 E;  2KQ7 A;  1YD8 U;  3MHS D;  4FLH A;  3K9P B;  2ZVO A;  4PS3 A;  4GOC A;  4DHJ D;  5JHA A;  1UEL A;  4P7I A;  4HDQ A;  2O6V B;  5G2N A;  1R4N I;  2DHZ A;  4HWI B;  3QAR A;  4NQK E;  1RLF A;  3HIZ A;  3U8Z A;  2MSE D;  2CU1 A;  3ZIM A;  2V1Y A;  2DYM A;  2DZI A;  2O2V A;  1WE7 A;  2V3S A;  4KV2 A;  2JUO A;  1X1M A;  3PRZ A;  4B6W A;  3QJZ A;  3OAW A;  2R2O A;  1P1A A;  1E7U A;  1U4A A;  2HTH A;  2O6V D;  3QIJ A;  4FHK A;  2PEA A;  3W1S A;  2LVO A;  2BWF A;  3VTW A;  2KFK B;  2MQJ A;  2REX A;  2M1M A;  1IPG A;  1TGZ B;  2K8H A;  3JVZ X;  3N3K B;  4WJO A;  3V62 A;  3WA0 A;  3KUZ A;  3I3T B;  3EEC A;  2ZJD A;  3U30 A;  3ZW3 A;  4KSL C;  5LLI A;  4FJY A;  3V6E B;  1ZW7 A;  4KDI C;  3HHM A;  2BKR B;  1V9J A;  4RM8 A;  4I6P A;  1EF1 A;  2LRU A;  4NAW B;  2MCN B;  4EEW A;  3JSV B;  5AZH A;  4KSK C;  1LM8 B;  2CR5 A;  1QZE A;  2GBN A;  4M8N A;  1WGY A;  5L83 A;  3A33 B;  1KM7 A;  1WRD B;  3W1Y A;  2V4L A;  5CHF A;  3X23 A;  4ZRK A;  5JZE B;  2JRI B;  4TV3 A;  3PLV A;  4F1S A;  3VTV A;  3DBH I;  3UIP B;  2KWV B;  4JQW C;  2M4N A;  4W9F A;  2KXJ A;  3RUI B;  4RM9 A;  3R7R A;  5LXH A;  2LZ6 A;  1UD7 A;  2CS4 A;  3EHV A;  1GUA B;  3KUC B;  1C1Y B;  1WXM A;  4K7S A;  4B95 A;  1Y8R C;  2LJ5 A;  5LXI B;  1WZ0 A;  3M63 B;  2JXX A;  4CO7 A;  2RD0 A;  4AOF A;  2LI5 A;  2N7D A;  1WH3 A;  4BKT A;  3ENE A;  3PSE B;  4BOS C;  4IM2 A;  2UYZ B;  3PLU A;  3APC A;  2MW5 A;  3UIN B;  2MA9 B;  4AUQ C;  4AJW A;  3H1U A;  3L54 A;  3KW5 B;  2KJR A;  4IWO A;  2CHZ A;  2DX5 B;  4W9H A;  5D7G A;  4ANW A;  4W9D A;  3PHX B;  1WJ4 A;  4A3O A;  4F7Z A;  2LGX A;  3UIO B;  3VHT C;  3L13 A;  4KDL B;  1WF9 A;  4URK A;  2PJH A;  1SE9 A;  2GMI C;  4EFO A;  4YL8 A;  2BYE A;  2BWE S;  3R7Q A;  1SIF A;  4MJS A;  4DDI D;  4IWP A;  3CMM B;  1WFY A;  3T8M A;  2ZNV C;  4EOY A;  3JW0 X;  4KIK A;  4NNJ B;  2N1V A;  3UQA A;  2EMS A;  3ZUN A;  3H7S A;  1V5T A;  5J18 A;  2FCM A;  3S2A A;  5L95 C;  1OGW A;  1FXT B;  2BYF A;  2C7M B;  2G45 B;  3DQV A;  4J6I A;  4GXB A;  2L8J A;  2LWP A;  3SD5 A;  3MTN B;  3CSF A;  1WY8 A;  2C9W B;  4WWP A;  1E8Z A;  5D94 A;  3QX1 A;  4BFR A;  1CMX B;  4WJP A;  4MDK E;  2WX0 A;  2MRP A;  5G55 A;  1GC7 A;  3CST A;  4HCP B;  4F8C B;  3T9L A;  2ZPN A;  5J17 A;  2G4D B;  2JT4 B;  2KDB A;  3IHP C;  1ISN A;  2LD9 A;  4MSM B;  1WZ3 A;  4W9C A;  1NI2 A;  2O2V B;  5CX3 A;  2JZ3 B;  3H9D A;  1WM3 A;  1WM2 A;  5HKH A;  4BKG A;  1HE8 A;  2W9N A;  2LGY A;  2YLM A;  3WAM A;  2MP2 B;  1KJT A;  2K1F A;  2KN5 A;  2BPS A;  1F9J A;  3M3J A;  3NZS A;  1SGH A;  1D3Z A;  4NQL B;  4A3P A;  3DOW A;  3DBR I;  4GU2 A;  5GMV A;  3QHT A;  3N32 A;  2VRR B;  4RMA A;  4GDL A;  2KX3 A;  3UQB A;  4XZ4 A;  1V2Y A;  3VH4 B;  2GOW A;  1WE6 A;  2QHO A;  3ML9 A;  2L76 A;  1C3T A;  1RAX A;  2PE6 B;  3NY5 A;  4IM0 A;  2IO1 B;  2MX2 A;  4MJS B;  2NBU A;  2WX1 A;  1TZ1 A;  2FCN A;  4GMV A;  2ZVN A;  3PTF C;  4HJK A;  1V6E A;  2MP2 A;  2N4F A;  1OEY A;  2J0K A;  4KZC A;  3ZNH B;  4ZRI A;  3QA8 A;  1WJN A;  2BF8 B;  3WAP A;  1JRU A;  2IBI B;  2LUE A;  4ZYN A;  4IC7 B;  3M62 B;  3ZTC A;  4HDO A;  2IO2 B;  4ICU A;  1WX7 A;  5JH5 C;  4HCN B;  2FID A;  1WGR A;  3GZN I;  1WXV A;  4FUL A;  3ZNI D;  2NR2 A;  3SDL C;  1WR1 A;  2DAJ A;  3PT2 B;  4W9K A;  3WIM A;  4HXD A;  3ZLZ A;  3AI5 A;  4HPM B;  1H4R A;  2G4S A;  3ECI A;  3SU8 X;  2KFJ A;  4IG7 B;  4JGH B;  5C1Z A;  2KZR A;  2KMC A;  4FJZ A;  2D07 B;  1WJU A;  2N7E A;  3ZNG C;  2UWQ A;  4HLE A;  2LXA A;  3EFU A;  2L00 B;  5BO4 B;  1IYF A;  2M0X A;  1L2N A;  4FBJ B;  4II3 B;  1GC6 A;  3OJ3 A;  4NJ7 A;  2NBW B;  1PQS A;  4CHK A;  2ZCB A;  3DVG X;  2D11 A;  3B1L X;  2DEN B;  2OOB B;  3B08 A;  3H7P A;  4BVU C;  3C0R B;  3DBL I;  3A1Q A;  1OTR B;  2MLB A;  3NOB A;  4XC2 A;  1H8C A;  4AJY B;  1YQB A;  4LDT B;  4IM3 A;  4CYE A;  3DVN U;  4ICV A;  3RCZ A;  2LVQ A;  2ZEQ A;  4BOZ B;  3H6N A;  4A20 A;  3ZVV A;  3OJ4 B;  3AU4 A;  4E3C A;  3TCA A;  2D10 A;  2GBJ A;  3KYD D;  2KFK A;  2N9P C;  2KQS A;  2K39 A;  2Y5B B;  3PRE A;  4ZRJ A;  2EMT A;  3PRP B;  3TMP B;  3VTU A;  4BKS A;  4KVG B;  3ZDM C;  1KLV A;  2MBB B;  3HM3 A;  1RFA A;  1E8X A;  4PYU A;  2AL3 A;  3QWZ B;  2IY1 B;  4NY0 A;  3NZU A;  1V5O A;  2AWT A;  2XK5 A;  1R4M I;  3Q3J A;  1P9D U;  2KTF A;  3AXC A;  2ASQ A;  3A1Q B;  4W9I A;  3RT3 B;  1G6J A;  2G3Q B;  2J0J A;  4NAW A;  3W1S C;  2N1W A;  2N9X A;  2WDT B;  3L16 A;  2B3A A;  1Q0W B;  5JHB A;  2BGF A;  4JIO U;  3WAO A;  5CTR C;  3A9K A;  1MG8 A;  1K8R B;  2J0M A;  1E90 A;  1I35 A;  2KLC A;  3A9J A;  4OVU A;  4EZL A;  4FN2 A;  1IP9 A;  1E7V A;  3K9O B;  2CKH B;  4K81 A;  4MM3 A;  2L05 A;  2LVP A;  2JY6 A;  2O6V A;  3DPD A;  2XK5 B;  2KMA A;  4OVV A;  2DAF A;  2KD0 A;  3ZKJ C;  5AEK B;  2IZV B;  2IY0 B;  2KHW B;  3BIN A;  2LGD A;  2JVC A;  1UGM A;  2KLG A;  3VUX A;  4DBG A;  4G3X B;  2NVU I;  4MGI E;  3M95 A;  4GB9 A;  3L10 B;  4DHJ B;  4LJO B;  3IFW B;  4TQ1 A;  3V6C B;  3L08 A;  1Z2M A;  4PS8 A;  1J19 A;  3VDZ A;  4X57 B;  3TBL D;  3QCA A;  1J0G A;  2ZNV B;  1AAR A;  2KX0 A;  1P0R A;  2DYB A;  3A9J B;  1S1Q B;  2A5U A;  2LXC A;  2AYO B;  1V81 A;  2K8C A;  4HK2 A;  3VFK A;  1UZX B;  3ZRC A;  2AL6 A;  4G50 A;  2NCN A;  3GOE A;  2WYQ A;  4WJQ A;  5E6N A;  3APD A;  3DBS A;  3HM6 X;  1RRB A;  5IA7 A;  3DDC B;  1WMH A;  2RPQ A;  3NHE B;  2MBQ A;  3A4S C;  4EKU A;  2ZPY A;  4TKN A;  1L7Y A;  4TUU A;  5KHQ A;  1YIW A;  5DPS A;  1XT9 B;  2HE7 A;  4GGQ A;  4GN1 A;  3JSV A;  2L7R A;  3IG3 A;  2Z59 B;  3VUW A;  3WAL A;  1WI0 A;  4FJV B;  4EZK A;  3ZTD A;  2KK8 A;  1WYW B;  4IW0 A;  3KVF B;  4KIK B;  2HJ8 A;  2L0T A;  1Z5S B;  2BKF A;  1P98 A;  3RUL A;  4N9F 4;  2M17 A;  2I1J A;  2YVC A;  3PV1 A;  3A9K B;  3R3M A;  5E6O A;  3O65 B;  4EUT A;  2D3G A;  2R2Q A;  2DZJ A;  3PHW B;  4NPN A;  4PS7 A;  1WMH B;  2KJH B;  2OJR A;  4MEL A;  5D6J B;  4LCD E;  4M8M A;  3KUD B;  1BT0 A;  1E5W A;  2LRW A;  2FUH B;  1GNU A;  2FCS A;  1OQY A;  4XX5 A;  1WGH A;  4FAD A;  1Q5W B;  2KDE B;  4W9L A;  4WJN A;  4G0N B;  2JWZ A;  2KOX A;  5AZG A;  2XEW A;  1KOT A;  3LJ3 A;  2FCQ A;  4DXA B;  1V86 A;  3A4R A;  4WWN A;  3DVN V;  2KWU B;  1YX5 B;  3L0W B;  4G11 A;  4MEM A;  3VVW B;  2FAZ A;  2C7H A;  3JYU A;  1VD2 A;  2KVR A;  1Q1O A;  5D2M B;  1NDD A;  4LDT D;  5KHO A;  2NS5 A;  3ZDT A;  2L3Z A;  2K8B A;  2NBV B;  3R66 C;  3RYT A;  3UGB B;  1GG3 A;  1J8C A;  4W9J A;  4BBN F;  4HPL B;  1A5R A;  3QK0 A;  2IO3 B;  3V60 A;  4WAA A;  4K7U A;  3IVF A;  1WGG A;  2KNB A;  4MSQ B;  2JPH A;  3SHQ A;  1LQB A;  2DYO A;  2KDF B;  2XBB C;  4PYZ A;  1YX6 B;  3BY4 B;  2GBK A;  3NS8 A;  2KJ6 A;  4WWO A;  3ML8 A;  1WR6 E;  4KZ0 A;  3RZF A;  2DZM A;  2K25 A;  4MH0 E;  1WGD A;  2FNJ B;  2RSU A;  3HK0 A;  4GSW A;  3ALB A;  1EO6 A;  3AU5 A;  2JRH A;  4WQO B;  2KWC A;  1XQQ A;  2Z0D B;  5C23 A;  2KAN A;  1P3Q U;  4DHZ E;  3UF8 A;  4II2 B;  2FIF A;  3AUL A;  2JZZ A;  4I6N B;  2NPT B;  5E6P A;  4BBN C;  3TL5 A;  4ZDV A;  1UH6 A;  2RR9 A;  2MBE A;  1ZGU B;  2L0F A;  4ASW C;  2D2Q A;  3OLM D;  4I6L B;  5J2R A;  1LXD A;  2KDI A;  2CHX A;  1EF5 A;  4MGK E;  1WX9 A;  4EZJ A;  4DK5 A;  3L17 A;  3D32 A;  3TJP A;  4MGY E;  3ONS A;  1WIA A;  4GDK B;  4M0W B;  1WXS A;  2K6D B;  5IAA C;  3TIX A;  2GBR A;  3MJW A;  5TR5 A;  2C5L C;  2CHW A;  3PGE A;  3X0W A;  1XD3 B;  1ZKH A;  2ZZP B;  3PRM B;  4IWQ A;  3DVG Y;  2EKE C;  1WXA A;  3EC8 A;  2NPT A;  4TQ0 A;  3PVL A;  2AEH A;  2MWS B;  2LAS A;  1WJ6 A;  3V61 A;  3VH3 B;  1YJ1 A;  2J7Q B;  2IO0 B;  3ZO5 B;  1LFD A;  3LDZ E;  4IUM B;  5DPR A;  4DDG D;  3KH0 A;  4BKS D;  4K7W A;  4GDL B;  4ANU A;  4FA6 A;  2A4Z A;  3VXW A;  4GIV A;  2IYD B;  5DPT A;  1UBI A;  3RZW C;  4W9E A;  2KKC A;  5CHV C;  2GBM A;  4DHZ B;  4ANV A;  3H7P B;  1GJZ A;  3P2B A;  4NJ6 A;  3PZD A;  3PS6 A;  3QQ8 B;  2I1K A;  5EDS A;  1E8Y A;  1EUV B;  1VCB A;  5CHW A;  4AWJ A;  3QC8 B;  5AZF A;  2KC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...