2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
1WE6A 1V6EA 3EHVA 2BPSA 3PTFC 2Y5BB 2L00B 3UQAA 5JHAA 4FLHA 1EF1A 3TMPB 4W9EA 1WR1A 3OJ3A 5CHWA 4KIKA 4HPMB 4KIKB 4N9F4 1PQSA 3HHMA 2IO1B 5D2MB 3ZNGC 2DZJA 3RCZA 2K1FA 3IHPC 2JY6A 1V5TA 3JW0X 4W9KA 4PYUA 4WJNA 3ZO5B 1LXDA 3W1SC 2VRRB 4P7IA 2BWES 2NVUI 1SGHA 2V4LA 3B0AA 4TUUA 2O2VA 2BKFA 3DDCB 4W9JA 3WA0A 2FIDA 1J0GA 1WXMA 2MA9B 1WYWB 2LWPA 1H4RA 3QWZB 2I1KA 4DXAB 2ZCCA 1GJZA 2MWSB 2MBQA 3TBLD 1WRDB 3N32A 3KUZA 3QAQA 2I1JA 3L10B 3H1UA 2C7HA 2M4NA 4KDIC 4DDGD 2R2OA 1ZW7A 3OAWA 3PRZA 5D6JB 1UD7A 2AWTA 4GN1A 2KDFB 3ENEA 3ZNID 3ZNZB 3DQVA 3ZDMC 3ECIA 4CHKA 1XD3B 1I35A 2KZRA 4MEMA 3RULA 2J0KA 4MDKE 4W9FA 5J2RA 3HK0A 4DHJB 1L2NA 3DVGX 3VVWB 4IUMB 1UBQA 4IC7B 4WWNA 2KC2A 2KC1A 4IM3A 1IYFA 3IFWB 3NY5A 4I6LB 4CYEA 3PGEA 2DYOA 5J17A 4JGHB 3VUWA 3DBSA 4XC2A 1TZ1A 2KTRA 3NHEB 1P3QU 4MGKE 4HK2A 5G55A 4FJVB 2CHZA 2GOWA 1NDDA 2LJ5A 2K39A 4FHJA 3X23A 3NOBA 3APFA 3D32A 3ZLZA 3QX1A 4CO7A 1WXVA 3IG3A 1S1QB 4ANVA 3PHWB 4HLEA 5BO4B 1P1AA 1OEYJ 4MJSB 4MJSA 1BT0A 4NNJB 4GDKB 4A20A 3L13A 2MQJA 3ZUNA 4ZRIA 2A5UA 3A9KA 5DCNA 3A9KB 4ICUA 4B95A 1I42A 2N1WA 4FHKA 4NPNA 1WFYA 4G11A 3H7SA 3UF8A 5LLIA 1ISNA 4EZLA 1Z5SB 2LZ6A 1E8ZA 4RM8A 2CU1A 3KVFB 3QHTA 5LXIB 1V81A 4GB9A 1WJUA 3DBRI 1E8XA 2L3ZA 4HJKA 1EF5A 3AXCA 4NAWA 2KWVB 1OTRB 2ZZPB 4BVUC 2K6DB 3DCGA 3ZRFA 3BINA 3R3MA 3AI5A 4JLCA 3CMMB 1EO6A 1LM8B 2MLBA 2D2QA 2MX2A 2KX3A 2L05A 4JL9A 1GG3A 3PZDA 4IWOA 4LDTD 3VQIA 2WX0A 4FJZA 4KZCA 2CKHB 2OOBB 2RD0A 2KMAA 1WF9A 4EKUA 2KXJA 2BYEA 2J7QB 2BF8B 2MSED 2JXXA 2R2QA 4TQ1A 3WALA 4URKA 2Z0EB 5LXHA 1J8CA 4GSWA 2N7EA 1FXTB 1V2YA 3JSVA 3JSVB 4BKSA 4AJWA 5L83A 4G50A 1WE7A 3EECA 3M63B 4XZ4A 3W1YA 1V5OA 3R7QA 2ZVNA 2BYFA 1WM2A 1A5RA 3DVNU 4ICVA 2ZJDA 4GXBA 3RZFA 3Q3FA 1LQBA 4MH0E 2V1YA 4HXDA 1WJNA 2KTFA 4K81A 2EKEC 3MJWA 4W9LA 1UH6A 3NZSA 2KFKB 1L7YA 2KDBA 4ASWC 5KHOA 2AEHA 4FBJB 3O65B 2KDEB 5HKHA 1WJ6A 3VHTC 4YL8A 4EZKA 4GDLB 2G3QB 2DAFA 3ZKJC 1J19A 4GU2A 3B08A 2AYOB 2RPQA 3R66C 5D94A 1VCBA 3ONSA 3L16A 2D07B 2KKCA 2D11A 2IY0B 2O6VA 2LXAA 3X0WA 1UZXB 1KJTA 2UYZB 2MBHA 2PE6B 4WJPA 1EUVB 4HDQA 2FAZA 3VXWA 1K8RB 2ZVOA 2MBBB 3PRMB 1TTNA 3IVFA 1Y8RC 2FCNA 2KJ6A 2KTRB 3PS6A 2MCNB 3V6CB 3WAPA 1Z2MA 2NR2A 2HD5B 3HM6X 1Q1OA 2W9NA 4AWJA 2DZIA 2ZNVC 5CX3A 4A3OA 3T8MA 4HVBA 1IP9A 4FA6A 2AL6A 2ZCBA 2V3SA 2HJ8A 4OVUA 3WIMA 1TGZB 2NPTB 5E6NA 5DPWA 3KUCB 2RSUA 2WX1A 1Q0WB 1YD8U 2MRPA 3MHSD 1S3SG 2G4DB 2MP2A 3L54A 2ZPYA 4MELA 1E90A 4HCPB 3SHQA 2J0JA 4W9CA 3TCAA 3TL5A 2DENB 4E71A 2NBVB 4DHJD 2LVQA 1GUAB 1NI2A 3N30A 4EEWA 4FULA 5J18A 3JYUA 2M0XA 3LDZE 4W9DA 3RUIB 2KFJA 2O6VD 1P98A 4IM2A 4GMVA 2LGYA 1P0RA 1KLVA 3KW5B 3VFKA 2KLCA 1C1YB 2IY1B 2JUOA 2M1MA 3H6NA 2D3GA 3QA8A 4NJ6A 2K6QA 1V80A 2QHOA 5CHVC 2JVCA 2KVRA 2N9XA 4WWPA 2IO0B 3QC8B 1V9JA 4MGYE 3ZNHB 3ZW3A 1E8WA 3H7PB 3ML9A 3DVGY 2HE7A 3C0RB 3PT2B 4BBNC 3M62B 2JRHA 5CTRC 2MBEA 4OVVA 5L95C 2NPTA 1WGHA 4BOSC 1GC6A 4F1SA 2LXCA 5IAAC 2N1VA 4ZDVA 2KJRA 5C1ZA 4GDKA 3ZTCA 2J0MA 5C23A 3L08A 3NZUA 4AOFA 4DK5A 1YIWA 3A9JB 4BKSD 3V61A 3U30A 4IG7B 2IZVB 4IM0A 2WYQA 4EOYA 3W1SA 2EMTA 4DHZB 3PPAA 4DWFA 4BKGA 3APDA 4K1RB 3AU5A 4M0WB 4MSMB 2MBOA 2K8BA 3DVNV 3SU8X 3NS8A 4MGZE 3VH3B 3T9LA 2XK5B 1WMHB 1WMHA 1G6JA 5TR5A 4DBGA 1M94A 1YX5B 2IBIB 4WQOB 5AZHA 2LRWA 1WIAA 1YJ1A 2DYMA 2FUHB 3QJZA 4K7WA 3RZWC 3A1QA 2RR9A 2GBRA 3QCAA 1WGRA 3S2AA 3VTVA 1XT9B 2JZZA 2YLMA 3LJ3A 2CHWA 1R4MI 1E7VA 2KX0A 2DYBA 4BOZB 2LVPA 5G2NA 2G45B 1WX8A 2Z0DB 2L76A 4PS8A 1UGMA 3SDLC 2HTHA 3HIZA 3WAMA 4AP4C 1V49A 4LJPB 2XEWA 2CHXA 2NCNA 2K8HA 4NY0A 2LGDA 1E7UA 2KANA 3UIOB 2DX5B 4KSLC 3ZDTA 2NBUA 2XBBC 1TBEA 2C7MB 2FCMA 3N3KB 4KVGB 3A33B 3OJ4B 2KQSA 2PE9A 3UGBB 4B9KA 1YQBA 2MW5A 5JZEB 1H8CA 2KFKA 2K25A 3V6EB 2GBJA 2XK5A 4LDTB 2LASA 3RYTA 2DAJA 4HPLB 3CSTA 1WR6E 1F9JA 2DHZA 4GIVA 5DPRA 4K7UA 2KO3A 3PLVA 1E5WA 5DPSA 1OQYA 1XQQA 5AEKB 2M8SA 5IA7A 3VTWA 3APCA 2PEAA 3JVZX 3L0WB 3QARA 3QQ8B 4PS3A 4GGQA 5DPTA 2KJHB 3VAWA 3PHXB 4II3B 5AZFA 4DDID 4BBNF 1YX6B 1E8YA 2L8JA 2N9EB 2UWQA 3VUYA 3DOWA 2KD0A 3MTNB 2JZ3B 2LI5A 1LFDA 1C3TA 4NQLB 4M8MA 4LJOB 2IO3B 2N4FA 4HCNB 4DHZE 4EUTA 2YVCA 3ZIMA 4E3CA 5AZGA 5GMVA 2FCSA 3PV1A 3RT3B 4F7ZA 3A4RA 3ZRCA 2FNJB 2N7DA 3DPDA 5D7GA 2KN5A 2WWZA 1GNUA 1OGWA 2WDTB 4FN2A 3VUXA 5JH5C 1R4NI 3OLMD 4F8CB 4HWIB 5EDSA 1WY8A 4LCDE 3I3TB 1WZ0A 2JWZA 2KHWB 3BY4B 4IWQA 2NBWB 3EC8A 3PREA 4NJ7A 3M3JA 2LUEA 4ZRKA 4IW0A 4X57B 3V62A 1MG8A 2ZPNA 3HM3A 1CMXB 1WX9A 2LGXA 4KDLB 2JF5A 4AJYB 3KYCD 4W9GA 1WM3A 4E74A 4W9IA 4MSQB 2JPHA 3R7RA 1RRBA 4RMAA 3VH4B 2GMIC 4WJQA 1UELA 4KV2A 3KYDD 3WAOA 3PRPB 4II2B 3SD5A 3A4SC 4ANUA 2CS4A 5E6PA 1WXSA 4HDOA 2BGFA 3ALBA 1IPGA 1UBIA 2BWFA 2N9PC 1WXAA 2L0FA 4A3PA 2GBKA 3Q3JA 2LVOA 3V60A 3UIPB 4KSKC 4G0NB 2LRUA 4ANXA 4FADA 1WGYA 2PJHA 4BFRA 3KUDB 4KZ0A 3PVLA 5CHFA 4W9HA 4TQ0A 2FCQA 1QZEA 1SIFA 3GZNI 3K9OB 1SE9A 4BKTA 3ZTDA 2B3AA 4GDLA 3AU4A 4PS7A 2EMSA 2KNBA 3A1QB 4B6WA 3H7PA 2C5LC 2L7RA 2C9WB 2MP2B 4I6PA 4XX5A 4TKNA 1U4AA 3P2BA 2C7NB 3ML8A 1V86A 2REXA 2RGFA 1P9DU 4JQWC 1OEYA 1WZ3A 2K8CA 5FR6A 3VTUA 1ZGUB 2ZEQA 3TIXA 3TJPA 3U8ZA 1RLFA 1WI0A 2KWUB 4G3XB 3PLUA 3UINB 3WANA 3L17A 5KHQA 3RD2A 1ZKHA 1NBFC 4I6NB 2L0TA 1X1MA 4K7SA 4ANWA 2KLGA 4NAWB 2AL3A 2DZMA 4M8NA 3GOEA 1T0YA 4AUQC 2IYDB 4EFOA 1KOTA 3EFUA 2KMCA 2NS5A 2G4SA 2PPHA 3KH0A 2BKRB 2JT4B 2GBMA 2D10A 2KDIA 2KK8A 2DZKA 3AULA 4EZJA 4ZYNA 4GOCA 1RFAA 4MM3A 2ZNVB 4ZRJA 1JRUA 1AARA 3DBHI 3K9PB 4JIOU 1KM7A 3DBLI 5E6OA 1VD2A 2FIFA 4TV3A 2A4ZA 2BYVE 4J6IA 3M95A 1GC7A 4PYZA 1HE8A 3B1LX 2JRIB 2O2VB 5JHBA 1WGGA 2C60A 2M17A 1Q5WB 3A9JA 2O6VB 4NQKE 3QK0A 2KOXA 2KQ7A 3UQBA 3IBEA 1WGDA 3QIJA 3CF6E 2OJRA 3CSFA 3ZVVA 4IWPA 2ASQA 1WH3A 4FJYA 1D3ZA 3U7DA 4WWOA 3VDZA 4RM9A 2LD9A 4WJOA 3H9DA 2IO2B 3PSEB 2CR5A 2Z59B 1RAXA 2KWCA 1WJ4A 2GBNA 1WX7A 4MGIE 4WAAA
chains in the Genus database with same CATH superfamily
1V6EA 3EHVA 3UQAA 4FLHA 1I7HA 3TMPB 1WR1A 1FFVA 2N9KA 2VH2A 4HPMB 3HHMA 5D2MB 2DZJA 4MH8A 5LNK1 3IHPC 2JY6A 4PYUA 1C4PA 1LXDA 1SGHA 4TUUA 3DDCB 1VRAB 4WQMA 1WXMA 1H4RA 4RH6A 2AQ2B 4KX6B 1T0SC 2M4NA 4KDIC 4DDGD 2V9HA 1ZW7A 4RF1A 3U4EG 4XDDA 3AEEB 2KDFB 3ZNID 3ECIA 2KZRA 3RULA 2J0KA 1L2NA 4FXCA 1UBQA 3IFWB 5J17A 3ZJUA 3IXSA 4XC2A 1P3QU 2CHZA 2LJ5A 4FHJA 2K39A 3APFA 4LNFA 2N9LA 4P1CC 4CO7A 1WXVA 2WXRA 1S1QB 4ANVA 5BO4B 1TKGA 4MJSB 3ZUNA 3L4PA 4ZRIA 2A5UA 4NPNA 5LLIA 1ISNA 4HROA 4RM8A 1V1PA 3KVFB 3QHTA 1V81A 4GB9A 1XCTL 1EF5A 3AXCA 2KWVB 1OFFA 3ZRFA 1F0ZA 4MACA 3CMMB 1EO6A 1LM8B 1ZDXA 2D2QA 2MX2A 2LMCA 3PZDA 2BQQA 4LNOA 2KVZA 4LTUA 2RD0A 2KXJA 2J7QB 2MSED 2JXXA 1ZDVA 4ZYSA 2WU5B 4JPSA 2Z0EB 5LXHA 2W3RA 3JSVA 1TY0A 2JXTA 3Q8EA 3AM9A 3M63B 2WP9B 1KH0A 3Q3FA 2WXGA 4W9LA 4UDUC 4FBJB 3O65B 2KDEB 1UWMA 2D3BA 5HKHA 1WJ6A 4YL8A 2DAFA 3ZKJC 4GU2A 3B08A 1I4HA 2AYOB 2BB6A 2LJIA 4REZA 2W82A 4MM3B 2IY0B 2LXAA 1UZXB 4WURA 2INNE 2UYZB 1KRHA 2FAZA 1K8RB 3KQ4A 2GRIA 2MBBB 1TTNA 1Y8RC 3PS6A 2KJ6A 3V6CB 4OW0A 5BYSA 3C8YA 2HD5B 1TIFA 2ZNVC 5CX3A 3BVZA 4A3OA 3DBHB 2V3SA 2HJ8A 4OVUA 2WX1A 2MRPA 2G4DB 3L54A 4MELA 2QC8A 1K51A 5EE1A 2LVQA 1GUAB 4EEWA 5J18A 2M0XA 1QOFA 2KFJA 3P42A 2D3AA 4KKJA 1YMHE 3VFKA 1JCKB 2AX5A 4A6QA 2GI9A 3PZ8A 1NEKB 2QHOA 5CHVC 2KVRA 2LFIA 1V9JA 3ZW3A 3OG5A 3AE9B 1HA5A 5EE9A 2MBEA 5L95C 1FEHA 2NPTA 1GC6A 2LXCA 5IAAC 4ZDVA 1ZXHA 1F77A 4GDKA 3ZTCA 1ZOYB 3L08A 3NZUA 2IGHA 4HJGE 4BKSD 4IG7B 5BMGA 4EOYA 2EMTA 3PPAA 3APDA 3I9V1 3TEWA 3VH3B 2XK5B 3U7ZA 4DBGA 1M94A 2IBIB 5AZHA 2OEDA 1YJIA 3AE5B 4DXGA 2YLMA 1IBXA 1MHXA 2CHWA 4H2AA 2KWDA 3PO0A 3PZ7A 5G2NA 3IAS1 1CK1A 2I2YA 4LJPB 2Y3AA 2WS3B 1XLPA 2LGDA 2DLBA 2DX5B 2NBUA 3NVVA 3OJ4B 5JZEB 1H8CA 1QOBA 2GBJA 2LASA 2DAJA 1WR6E 1F9JA 2DHZA 3Q2AC 5IO9A 3PLVA 2IJ0A 2KAJA 5AEKB 2M8SA 4NAMA 4PS3A 4C4VA 2KJHB 3PHXB 2L8JA 2UWQA 2INPE 1ENFA 1YQ4B 1LFDA 4LJOB 2N4FA 4EUTA 3NVWA 5BYQA 2WXPA 3O13A 2L52A 4F7ZA 1IGDA 2FNJB 2N7DA 3RFZB 3Q8AA 4KGTA 3VUXA 4FN2A 4J3OD 5IP4D 4HWIB 2NBWB 1YQ3B 3BZDB 3M3JA 2QEJC 3V62A 1MG8A 3BK2A 2JF5A 2IGGA 3RMKC 4W9IA 1SB3C 1AYFA 4RF0A 4K3CA 3TSSA 2MJ3A 1IUEA 3PRPB 4ANUA 4ACFA 1WXSA 4HDOA 1M4VA 2BWFA 2PVGC 1JRPA 1WXAA 2L0FA 1AWDA 4A3PA 3Q3JA 3T3NA 5IOIA 4KSKC 3EGRA 2ZW0A 1WGYA 2PJHA 1C78A 4KZ0A 3E56A 1AN8A 1DGJA 1T0RC 1QOAA 4XE0A 3K9OB 3ZTDA 4GDLA 1N63A 4B6WA 1E9MA 5BMHA 1NI3A 1YJJA 1V86A 2RGFA 2ON8A 1K53A 1P9DU 2MJEA 1WZ3A 1J7CA 3B2GA 2RPVA 2ZEQA 1F2RI 3TIXA 2KWUB 4G3XB 1XLQA 4I6NB 1X1MA 2QILA 2KLGA 2AL3A 3VRAB 2DZMA 4M8NA 1T0YA 1KOTA 2Y5PA 4XWTA 1HQRD 2G4SA 2JT4B 2GBMA 2MJDA 2KK8A 3AULA 4EZJA 4ZRJA 1AARA 2AQ3B 3K9PB 4JIOU 1KM7A 3N9YC 2A4ZA 4J6IA 3M95A 1SE4A 1HE8A 2JRIB 3RN9C 5JHBA 1WGGA 1Q5WB 3IT4B 2BBCA 3IBEA 2J4XA 1WGDA 1FMAD 3CF6E 2OJRA 1EWYC 3ZGZA 4FJYA 1TKYA 2JX5A 1JMLA 3PSEB 1FM0D 3ZXVA 2WU2B 1WJ4A 3BK1A 3HVZA 3T3OA 2BPSA 3PTFC 2Y5BB 3W9CB 5JHAA 3AE2B 1EF1A 4W9EA 3NJTA 4N9F4 3ZNGC 3RCZA 2WLBA 3ZO5B 3JW0X 3Q6BA 4KGSA 4P7IA 2V4LA 1QLBB 2BKFA 3AE6B 2HJ1A 1BMLC 1GJZA 2MBQA 3AEGB 3N32A 3KUZA 3H1UA 3IAM1 2C7HA 3AEAB 4RGOS 2R2OA 4TSSA 3OAWA 3PRZA 2IGDA 4YWGG 1UD7A 2JYTA 2QJLA 1I35A 2CU3A 4B0EA 4MDKE 1KTKA 1FO4A 2KC1A 4IM3A 4N58A 3NY5A 4CYEA 3PGEA 3VUWA 3DBSA 1TZ1A 1OQQA 1VR9A 2GOWA 3NOBA 2L32A 3IG3A 3PHWB 1B9RA 4HLEA 1WGKA 1FRRA 4MJSA 4YT0B 2L83A 1JWUD 4AQ7A 3A9KA 5DCNA 4ICUA 1I42A 4FHKA 4S17A 1FD6A 1C79A 3UF8A 1FNVA 1XLOA 2CU1A 1E8XA 4HJKA 1D5XC 1MG4A 4NAWA 1OTRB 2KN4A 2ZZPB 2N7JA 2K6DB 3TEXA 3BINA 3R3MA 3Q8CA 4A55A 3ZJVA 2WX0A 2KMAA 1WF9A 1ROEA 1SE2A 2BYEA 4JWUC 1ET6A 2N7EA 1FXTB 5L83A 4AJWA 4G50A 3EECA 4DXFA 4XZ4A 3W1YA 3V3XA 3R7QA 1FNWA 2BYFA 4RGMA 1WM2A 1A5RA 2PLPA 4GXBA 1NVID 3LXFA 3VRBB 4MH0E 2V1YA 4DQOC 1WYGA 3MJWA 1UH6A 2KFKB 1WWTA 2KDBA 5KHOA 3VR9B 2OHFA 4BAXA 3R66C 3ONSA 1ESFA 2KKCA 2D11A 1T3QA 2O6VA 4ZHOA 4WJPA 3AMZA 3N20C 3IVFA 3W5UB 2FCNA 3AE8B 2MCNB 4LNNA 2NR2A 3AE1B 1N6ZA 4AWJA 3DHHC 3J9CA 2AL6A 2R61A 2ZCBA 3FILB 5E6NA 1S3SG 1AW7A 2ZPYA 1HTOA 2J0JA 4W9CA 1DOIA 2DENB 1N62A 1WRIA 4S0RA 3JYUA 3LDZE 4ZHPA 1TT5B 4IM2A 4GMVA 1KLVA 1L0VB 1C1YB 2IY1B 4NJ6A 2K6QA 1V80A 2N0SB 1YN3A 1NENB 2JVCA 5FK9C 4WWPA 2MEKA 4GLSC 3P63A 1J7AA 1E8WA 3DVGY 1YNTE 3C0RB 1I4GA 1P7EA 4OVVA 3HUIA 4F1SA 1SJHD 3DBLB 3V05A 2J0MA 5H8YE 1MJDA 2BS2B 1WXQA 3Q3NC 4DK5A 2IZVB 4IM0A 2QIEB 4XDCA 5D3DA 4K1RB 1DOYA 3AU5A 4MSMB 1KFYB 3T9LA 1WMHB 2WGSA 4OZCA 3U52E 1YJ1A 2FUHB 5MPOA 1N5XA 3A1QA 1C76A 1XCQL 2JZZA 1V97A 1XXGA 1E7VA 2DYBA 3BIID 4OZBA 1VDVA 3I57A 3KWVA 1VJKA 2L76A 2HTHA 4AP4C 2FBWB 2KACA 2ONQA 4WAFA 2KANA 3UIOB 3KLSX 4KSLC 2KQSA 2PE9A 4ZRQA 4B9KA 2MW5A 3Q8FA 3V6EB 1QF6A 1FIQA 2XK5A 2WDVB 3RYTA 2RDHA 4HPLB 3HVDA 4K7UA 1VZ8A 3VTWA 3APCA 2PEAA 4B0MA 5BYRA 3QQ8B 1N60A 4GGQA 4KKIA 1PFDA 1E8YA 3VUYA 3GP7A 1MVKA 2KD0A 3DOWA 2LI5A 3W2DA 2IO3B 3CIRB 4DHZE 4HCNB 2QCZA 4HRSA 5EE3A 5AZGA 1CQVA 2FCSA 3MC8A 3ZRCA 3DPDA 1GNUA 1GPXA 1QILA 2WXIA 4BZAA 2KHWB 1EWCA 4NJ7A 2G9HD 2NTSA 4IW0A 4X57B 3HM3A 2LGXA 3AE7B 4KDLB 4AJYB 3KYCD 4W9GA 4E74A 2JPHA 3R7RA 1RRBA 4RMAA 2ACZB 3H8HA 3AB5A 2CS4A 5E6PA 2BGFA 3ALBA 1UBIA 2WXNA 2D3CA 1QOGA 2BS3B 4EE2A 3RI7C 1TY2A 4A9AA 2KMMA 4BFRA 4JE3B 3KUDB 2INDC 2J52A 4R3DA 4MT5A 1L0YB 4W9HA 3TUOA 2QSDA 1SIFA 3SFEB 1SE9A 1Q10A 3RNGC 2KNBA 3H7PA 2M0AA 4RNAA 2L7RA 2WNMA 4XX5A 3R2TA 1TS3A 4TKNA 4US8A 1OEYA 2K8CA 3VTUA 1ZGUB 2E6XA 1RLFA 4RFBA 3PLUA 3L17A 1ZKHA 2Q5WD 2L0TA 5TSSA 5FKAC 3ETRA 4AUQC 2IYDB 4EFOA 1KLGD 2SEBD 2PPHA 1FRDA 4O1NA 2KDIA 2DZKA 4M02A 4ZYNA 2PKOA 4C7YA 4MM3A 2ZNVB 1JRUA 2VZKD 3DBHI 5C2TB 1PGXA 4LK0M 3DBLI 2JSVX 4TV3A 1OQRA 2BTEA 4PYZA 4YTMB 1UGJA 2O2VB 2M17A 2W54A 4OVZA 3A9JA 2KQ7A 4C80A 1C4AA 3DHIC 3FKYA 3H9DA 1RM6C 2CR5A 4WH4A 1KF6B 1RAXA 1WX7A 4MGIE 5HHDG 2L00B 1R4MB 4KIKA 1ZP0B 4ZOHC 2XNAC 3SFDB 4OHJA 2IO1B 4N6EB 4C7ZA 2K1FA 4W9KA 4A90A 1ZPSA 3W1SC 2VRRB 3WA0A 2FIDA 2MA9B 3AE4B 2I1KA 1I4XA 2LHDA 4DXAB 2GLSA 3GE8C 2MWSB 2K9XA 2BT6A 2I1JA 3C19A 5D6JB 1TS5A 4M01A 2AWTA 4K3BA 4GN1A 3ENEA 4LLGM 2FE8A 3DQVA 1PYWD 4CHKA 1XD3B 4MEMA 2KDMA 5J2RA 4DHJB 4IC7B 4WWNA 2KC2A 3ZJTA 4I6LB 2DBYA 1SBBB 2VZKB 3NHEB 2V3PA 4HK2A 3NS1A 1NDDA 1PUTA 3D32A 1YN4A 3QX1A 2WXLA 3GE3C 1OEYJ 1BT0A 4NNJB 4A20A 1L4DB 3H7SA 4D2KA 2LZ6A 1E8ZA 2IDYA 1EM7A 1WJUA 3DBRI 1RWSA 4M0WA 2JWUA 4BVUC 4YXDB 4JLCA 1D6EC 2L05A 4JL9A 4WWMA 2TSSA 4IWOA 4FJZA 2JYEA 4KZCA 1C4CA 2OOBB 1FCLA 3B2FA 2R2QA 1SIJA 1IGCA 4GSWA 2M56B 3R8BA 1V2YA 4BKSA 1KLUD 2K22A 1WE7A 2WXQA 1V5OA 1FNUA 2ZVNA 1A70A 2J42A 2ZJDA 4XWWA 3NUHB 1HZ5A 3P4QB 4HXDA 2EKEC 3NZSA 4ASWC 3VHTC 3GB1A 2J53A 2PVOD 4GDLB 4EZKA 2G3QB 1J19A 3RNCC 2L1AA 3WCQA 3Q3MC 1VCBA 1C77A 3L16A 2B76B 1VLBA 3RNFC 3X0WA 2D5GA 3MHZA 2MBHA 3VXWA 1EUVB 3N1ZC 3PRMB 2WDRB 3WAPA 1Q1OA 2W9NA 5JXVA 2DZIA 2BYTA 1IP9A 3FILA 4FA6A 5DPWA 1TGZB 3KUCB 3CWIA 1Q0WB 1YD8U 2Y5CA 4N59A 2MP2A 2LHEA 1FPYA 4HCPB 3TCAA 3TL5A 4E71A 4DHJD 1B1ZA 1NI2A 3RUIB 1JW9D 1P98A 1P0RA 3KW5B 2KLCA 3QA8A 2CJOA 2N9XA 2EELA 3EA6A 3QC8B 1UF0A 3RNBC 3H7PB 3P4PB 2HE7A 2ICIA 3PT2B 4JWSC 4BBNC 3M62B 5CTRC 1GB4A 1XO3A 2WXOA 4BOSC 1T5XD 2N1VA 2V0GA 2KT7A 2VH1A 2KJRA 4QAYA 1T6BX 2BB5A 4AOFA 1YIWA 4AS1A 4P16A 3U30A 4XYCA 4BKGA 1CJEA 2MBOA 2K8BA 1WSPA 4IOIE 3SU8X 1NYRA 2DNFA 1ZXIA 2WXHA 1MHHE 5TR5A 1YX5B 1E0ZA 4WQOB 1WIAA 3NVZA 3QJZA 1ET9A 4K7WA 3RZWC 4LNKA 2RR9A 2GBRA 1L6UA 1WGRA 2YEPF 3VTVA 1XT9B 1IBXB 3LB8C 1J7BA 1V1PB 1DOXA 4WIPA 2Z0DB 4PS8A 3WAMA 2H88B 1GOZA 3HIZA 2XEWA 2NCNA 4NY0A 2JQRB 5GXGB 3ZDTA 1STEA 2XBBC 4KVGB 3A33B 3UI3A 2KFKA 2K25A 4PT5A 1V8CA 4HKQA 3CSTA 1TKEA 1JROA 4GIVA 5DPRA 1ZUD2 1XQQA 2WQYB 5IA7A 2IPKD 2OJWA 3E9SA 3JVZX 3Q3OC 3QARA 5DPTA 3VAWA 1L0XB 4DDID 4BBNF 3AECB 1N5WA 1FCCC 4RGTA 1C3TA 4M8MA 4ZRPA 2YVCA 3ZIMA 4E3CA 2V4IB 1RYJA 2PW9A 3PV1A 3RT3B 3VR8B 3A4RA 3TEYA 2E3TA 2K3UA 2KN5A 1HTQA 2WWZA 1OGWA 1EU4A 1R4NI 4HPPA 2PIAA 5EDSA 4LCDE 1F1HA 5G5GA 3FAHA 2LUEA 1I4RA 4KGRA 1JWAD 1RFKA 2ZPNA 1CMXB 2X38A 1WM3A 4MSQB 3MFGA 2NMQA 2KQ4X 2GMIC 1I4PA 2HTME 1UNSA 1BXTA 4II2B 1EU3A 2YEPB 1F2RC 1IPGA 2N9PC 1XEEA 3UIPB 4G0NB 3DWMA 2LRUA 4ANXA 4FADA 3BVGA 5CHFA 5C3JB 2FCQA 1QZEA 2AQ1B 3GZNI 4BKTA 2JZPA 2QDFA 3R2IA 2B3AA 3HRDD 3AU4A 4PS7A 3A1QB 2C5LC 5HG2A 2C9WB 5AUKA 4I6PA 3P2BA 3P4SB 2REXA 3NZ3A 1LO5D 3TJPA 3U8ZA 1WI0A 4L2YA 3UINB 3RD2A 1NBFC 4ANWA 4K7SA 3I63C 2WXFA 3GOEA 3EFUA 2NS5A 4ITKA 2BKRB 2EKIA 3AEFB 4HEA1 4GOCA 3N1YC 2PTLA 1TJEA 3OWEB 5HI1A 3FC4A 1FXAA 5E6OA 2FIFA 4ARIA 4YSXB 3BWUD 2C60A 3BYTB 2O6VB 4NQKE 3QK0A 3UQBA 3AV8A 2MH7A 3QIJA 3CSFA 5E6JA 2ASQA 1D3ZA 3U7DA 3VDZA 2V3NA 2Z59B 2KWCA 2GBNA 1ACCA 1WE6A 4NZLB 3OJ3A 5CHWA 4KIKB 2DWQA 1PQSA 3N1XC 1V5TA 4WJNA 3SR6A 4P6VF 2BWES 2NVUI 3B0AA 4W9JA 2O2VA 1J0GA 2W3SA 1WYWB 2LWPA 3QWZB 2ZCCA 3TBLD 1PGAA 1WRDB 3QAQA 3L10B 2CJNA 4RCOA 4OZAA 3RNEC 5BMIA 3ZNZB 3ZDMC 4W9FA 3HK0A 4USAA 3DVGX 3VVWB 1TS4A 4IUMB 5IN7A 1MFWA 1IYFA 5T8IA 2DYOA 4JGHB 2KTRA 4XGAB 4YSYB 2NTTA 4MGKE 5G55A 4FJVB 3X23A 4HKZE 1C9FA 3ZLZA 4RGNA 3W5VB 1P1AA 2Z8LA 3ZQ4A 4GDKB 3L13A 2MQJA 1YN5A 3A9KB 4B95A 2N1WA 1Y56A 4TMAB 1WFYA 4G11A 4CQNA 3ZXRA 1QQRA 4EZLA 1SXTA 1Z5SB 5LXIB 2KYWA 5I4DA 2L3ZA 3DCGA 4ARCA 3AI5A 3Q69A 2MLBA 2INCC 1TYGB 2KX3A 1GG3A 4LDTD 3VQIA 2CKHB 2QMTA 4L23A 4EKUA 2BF8B 4TQ1A 3WALA 4URKA 1J8CA 1E10A 1LGRA 4A8XC 3JSVB 1E7PB 4Q2JA 3AH7A 1NYQA 3DVNU 4ICVA 3GZNB 3RZFA 1LQBA 2LEKA 4K81A 1WJNA 2KTFA 1L7YA 1SJED 2AEHA 2WHIA 1HXYD 2RPQA 1FXIA 1QKZA 5D94A 3KWLA 1R7SA 3AE3B 2D07B 1JQ4A 5FR3A 1KJTA 2RDGA 2PE6B 4HDQA 2ZVOA 3AN1A 3EFCA 1UUPA 2WXMA 2KTRB 1Z2MA 2BVCA 3HM6X 4US9A 3MJ5A 3T8MA 4HVBA 3WIMA 4C00A 2NPTB 2RSUA 1N61A 3MHSD 1P7FA 1E90A 3SHQA 2RMMA 2NBVB 3EUB2 3N30A 4FULA 4W9DA 2O6VD 2LGYA 2JUOA 2M1MA 3H6NA 2D3GA 1QT9A 3AEDB 1SF0A 4P1BC 2IO0B 2XN9C 4M00A 4MGYE 3ZNHB 1TS2A 3ML9A 1JWMD 2JRHA 1V1OA 3GS2A 2LUMA 2K0PA 1WGHA 5IKCM 2UU7A 5C1ZA 5C23A 1L4ZB 3DWGC 2BW2A 3A9JB 3V61A 2PMVA 1SEBD 2WYQA 3W1SA 4DHZB 4DWFA 1GAQB 1ZE3D 4M0WB 3ABVB 1PDXA 2M19A 2WXKA 3DVNV 3NS8A 4MGZE 1F52A 1WMHA 1G6JA 2LRWA 2DYMA 3DBRB 3QCAA 3S2AA 3LJ3A 1R4MI 2I38A 2KX0A 4L1BA 4YTNB 4BOZB 2LVPA 2G45B 1WX8A 1UGMA 3SDLC 4YSZB 1D5ZC 1V49A 1E6EB 2CHXA 3NVYA 2K8HA 1E7UA 1TBEA 2C7MB 2FCMA 3N3KB 3UGBB 1YQBA 2WXJA 1L6VA 3URYA 4LDTB 3RPFC 4IDIA 5D3IB 2KO3A 1E5WA 5DPSA 1OQYA 3Q8BA 2ZW1A 3L0WB 4C4VB 4II3B 5AZFA 1YX6B 1FFUA 2N9EB 5EE0A 3MTNB 2JZ3B 1K50A 2WDQB 4NQLB 2HDEA 5GMVA 5D7GA 1D4BA 1JWSD 3TEZA 3SEBA 2SAKA 2WDTB 1CZPA 5JH5C 3LYYA 4YTPB 3OLMD 4F8CB 1HZ6A 1L5PA 1MI0A 1WY8A 3I3TB 1WZ0A 2JWZA 3BY4B 3P4RB 4IWQA 1MPEA 3EC8A 3PREA 4ZRKA 4C56C 3BYYB 1WX9A 3AEBB 2GB1A 2LGSA 3RNAC 2G1EA 3NRZA 1VZ7A 3B9JA 1JWBD 2W55A 3VH4B 4WJQA 1UELA 4KV2A 5H92C 3IT6B 3KYDD 3WAOA 3SD5A 3A4SC 2H89B 1T0QC 3ZYYX 2MHJA 1JALA 2GBKA 2LVOA 2BS4B 1UWXA 4NJCA 3V60A 1I4QA 1SSNA 3MP9A 3MC9A 4PK1A 1HEZE 4LNIA 1TZOA 1XF5L 3PVLA 4TQ0A 1PGBA 2EMSA 5AUIA 1YOVB 2MP2B 1U4AA 2C7NB 3ML8A 4IKGA 4JQWC 5FR6A 3WANA 5KHQA 2K5PA 3P1MA 4NAWB 1BUIC 3U2SC 2KMCA 1SE3A 3KH0A 1GB1A 2D10A 1R4NB 2LGIA 1RFAA 3I5JC 4JX1C 2FUG1 1VD2A 2RDBC 1K52A 2BYVE 1DYQA 1GC7A 1XLNA 3DHGC 3B1LX 5G5HA 3NG0A 2KOXA 3Q14C 5HFYA 3BVMA 3MC0B 3ZVVA 4IWPA 1WH3A 4WWOA 1D5MC 4RM9A 2X8XX 2LD9A 4WJOA 2JU6X 2IO2B 1VZ6A 4WAAA
chains in the Genus database with same CATH topology
1WE6A 1V6EA 3EHVA 2BPSA 3PTFC 2Y5BB 2L00B 3UQAA 5JHAA 4FLHA 1EF1A 3TMPB 4W9EA 1WR1A 3OJ3A 5CHWA 4KIKA 4HPMB 4KIKB 4N9F4 1PQSA 3HHMA 2IO1B 5D2MB 3ZNGC 2DZJA 3RCZA 2K1FA 3IHPC 2JY6A 1V5TA 3JW0X 4W9KA 4PYUA 4WJNA 3ZO5B 1LXDA 3W1SC 2VRRB 4P7IA 2BWES 2NVUI 1SGHA 2V4LA 3B0AA 4TUUA 2O2VA 2BKFA 3DDCB 4W9JA 3WA0A 2FIDA 1J0GA 1WXMA 2MA9B 1WYWB 2LWPA 1H4RA 3QWZB 2I1KA 4DXAB 2ZCCA 1GJZA 2MWSB 2MBQA 3TBLD 1WRDB 3N32A 3KUZA 3QAQA 2I1JA 3L10B 3H1UA 2C7HA 2M4NA 4KDIC 4DDGD 2R2OA 1ZW7A 3OAWA 3PRZA 5D6JB 1UD7A 2AWTA 4GN1A 2KDFB 3ENEA 3ZNID 3ZNZB 3DQVA 3ZDMC 3ECIA 4CHKA 1XD3B 1I35A 2KZRA 4MEMA 3RULA 2J0KA 4MDKE 4W9FA 5J2RA 3HK0A 4DHJB 1L2NA 3DVGX 3VVWB 4IUMB 1UBQA 4IC7B 4WWNA 2KC2A 2KC1A 4IM3A 1IYFA 3IFWB 3NY5A 4I6LB 4CYEA 3PGEA 2DYOA 5J17A 4JGHB 3VUWA 3DBSA 4XC2A 1TZ1A 2KTRA 3NHEB 1P3QU 4MGKE 4HK2A 5G55A 4FJVB 2CHZA 2GOWA 1NDDA 2LJ5A 2K39A 4FHJA 3X23A 3NOBA 3APFA 3D32A 3ZLZA 3QX1A 4CO7A 1WXVA 3IG3A 1S1QB 4ANVA 3PHWB 4HLEA 5BO4B 1P1AA 1OEYJ 4MJSB 4MJSA 1BT0A 4NNJB 4GDKB 4A20A 3L13A 2MQJA 3ZUNA 4ZRIA 2A5UA 3A9KA 5DCNA 3A9KB 4ICUA 4B95A 1I42A 2N1WA 4FHKA 4NPNA 1WFYA 4G11A 3H7SA 3UF8A 5LLIA 1ISNA 4EZLA 1Z5SB 2LZ6A 1E8ZA 4RM8A 2CU1A 3KVFB 3QHTA 5LXIB 1V81A 4GB9A 1WJUA 3DBRI 1E8XA 2L3ZA 4HJKA 1EF5A 3AXCA 4NAWA 2KWVB 1OTRB 2ZZPB 4BVUC 2K6DB 3DCGA 3ZRFA 3BINA 3R3MA 3AI5A 4JLCA 3CMMB 1EO6A 1LM8B 2MLBA 2D2QA 2MX2A 2KX3A 2L05A 4JL9A 1GG3A 3PZDA 4IWOA 4LDTD 3VQIA 2WX0A 4FJZA 4KZCA 2CKHB 2OOBB 2RD0A 2KMAA 1WF9A 4EKUA 2KXJA 2BYEA 2J7QB 2BF8B 2MSED 2JXXA 2R2QA 4TQ1A 3WALA 4URKA 2Z0EB 5LXHA 1J8CA 4GSWA 2N7EA 1FXTB 1V2YA 3JSVA 3JSVB 4BKSA 4AJWA 5L83A 4G50A 1WE7A 3EECA 3M63B 4XZ4A 3W1YA 1V5OA 3R7QA 2ZVNA 2BYFA 1WM2A 1A5RA 3DVNU 4ICVA 2ZJDA 4GXBA 3RZFA 3Q3FA 1LQBA 4MH0E 2V1YA 4HXDA 1WJNA 2KTFA 4K81A 2EKEC 3MJWA 4W9LA 1UH6A 3NZSA 2KFKB 1L7YA 2KDBA 4ASWC 5KHOA 2AEHA 4FBJB 3O65B 2KDEB 5HKHA 1WJ6A 3VHTC 4YL8A 4EZKA 4GDLB 2G3QB 2DAFA 3ZKJC 1J19A 4GU2A 3B08A 2AYOB 2RPQA 3R66C 5D94A 1VCBA 3ONSA 3L16A 2D07B 2KKCA 2D11A 2IY0B 2O6VA 2LXAA 3X0WA 1UZXB 1KJTA 2UYZB 2MBHA 2PE6B 4WJPA 1EUVB 4HDQA 2FAZA 3VXWA 1K8RB 2ZVOA 2MBBB 3PRMB 1TTNA 3IVFA 1Y8RC 2FCNA 2KJ6A 2KTRB 3PS6A 2MCNB 3V6CB 3WAPA 1Z2MA 2NR2A 2HD5B 3HM6X 1Q1OA 2W9NA 4AWJA 2DZIA 2ZNVC 5CX3A 4A3OA 3T8MA 4HVBA 1IP9A 4FA6A 2AL6A 2ZCBA 2V3SA 2HJ8A 4OVUA 3WIMA 1TGZB 2NPTB 5E6NA 5DPWA 3KUCB 2RSUA 2WX1A 1Q0WB 1YD8U 2MRPA 3MHSD 1S3SG 2G4DB 2MP2A 3L54A 2ZPYA 4MELA 1E90A 4HCPB 3SHQA 2J0JA 4W9CA 3TCAA 3TL5A 2DENB 4E71A 2NBVB 4DHJD 2LVQA 1GUAB 1NI2A 3N30A 4EEWA 4FULA 5J18A 3JYUA 2M0XA 3LDZE 4W9DA 3RUIB 2KFJA 2O6VD 1P98A 4IM2A 4GMVA 2LGYA 1P0RA 1KLVA 3KW5B 3VFKA 2KLCA 1C1YB 2IY1B 2JUOA 2M1MA 3H6NA 2D3GA 3QA8A 4NJ6A 2K6QA 1V80A 2QHOA 5CHVC 2JVCA 2KVRA 2N9XA 4WWPA 2IO0B 3QC8B 1V9JA 4MGYE 3ZNHB 3ZW3A 1E8WA 3H7PB 3ML9A 3DVGY 2HE7A 3C0RB 3PT2B 4BBNC 3M62B 2JRHA 5CTRC 2MBEA 4OVVA 5L95C 2NPTA 1WGHA 4BOSC 1GC6A 4F1SA 2LXCA 5IAAC 2N1VA 4ZDVA 2KJRA 5C1ZA 4GDKA 3ZTCA 2J0MA 5C23A 3L08A 3NZUA 4AOFA 4DK5A 1YIWA 3A9JB 4BKSD 3V61A 3U30A 4IG7B 2IZVB 4IM0A 2WYQA 4EOYA 3W1SA 2EMTA 4DHZB 3PPAA 4DWFA 4BKGA 3APDA 4K1RB 3AU5A 4M0WB 4MSMB 2MBOA 2K8BA 3DVNV 3SU8X 3NS8A 4MGZE 3VH3B 3T9LA 2XK5B 1WMHB 1WMHA 1G6JA 5TR5A 4DBGA 1M94A 1YX5B 2IBIB 4WQOB 5AZHA 2LRWA 1WIAA 1YJ1A 2DYMA 2FUHB 3QJZA 4K7WA 3RZWC 3A1QA 2RR9A 2GBRA 3QCAA 1WGRA 3S2AA 3VTVA 1XT9B 2JZZA 2YLMA 3LJ3A 2CHWA 1R4MI 1E7VA 2KX0A 2DYBA 4BOZB 2LVPA 5G2NA 2G45B 1WX8A 2Z0DB 2L76A 4PS8A 1UGMA 3SDLC 2HTHA 3HIZA 3WAMA 4AP4C 1V49A 4LJPB 2XEWA 2CHXA 2NCNA 2K8HA 4NY0A 2LGDA 1E7UA 2KANA 3UIOB 2DX5B 4KSLC 3ZDTA 2NBUA 2XBBC 1TBEA 2C7MB 2FCMA 3N3KB 4KVGB 3A33B 3OJ4B 2KQSA 2PE9A 3UGBB 4B9KA 1YQBA 2MW5A 5JZEB 1H8CA 2KFKA 2K25A 3V6EB 2GBJA 2XK5A 4LDTB 2LASA 3RYTA 2DAJA 4HPLB 3CSTA 1WR6E 1F9JA 2DHZA 4GIVA 5DPRA 4K7UA 2KO3A 3PLVA 1E5WA 5DPSA 1OQYA 1XQQA 5AEKB 2M8SA 5IA7A 3VTWA 3APCA 2PEAA 3JVZX 3L0WB 3QARA 3QQ8B 4PS3A 4GGQA 5DPTA 2KJHB 3VAWA 3PHXB 4II3B 5AZFA 4DDID 4BBNF 1YX6B 1E8YA 2L8JA 2N9EB 2UWQA 3VUYA 3DOWA 2KD0A 3MTNB 2JZ3B 2LI5A 1LFDA 1C3TA 4NQLB 4M8MA 4LJOB 2IO3B 2N4FA 4HCNB 4DHZE 4EUTA 2YVCA 3ZIMA 4E3CA 5AZGA 5GMVA 2FCSA 3PV1A 3RT3B 4F7ZA 3A4RA 3ZRCA 2FNJB 2N7DA 3DPDA 5D7GA 2KN5A 2WWZA 1GNUA 1OGWA 2WDTB 4FN2A 3VUXA 5JH5C 1R4NI 3OLMD 4F8CB 4HWIB 5EDSA 1WY8A 4LCDE 3I3TB 1WZ0A 2JWZA 2KHWB 3BY4B 4IWQA 2NBWB 3EC8A 3PREA 4NJ7A 3M3JA 2LUEA 4ZRKA 4IW0A 4X57B 3V62A 1MG8A 2ZPNA 3HM3A 1CMXB 1WX9A 2LGXA 4KDLB 2JF5A 4AJYB 3KYCD 4W9GA 1WM3A 4E74A 4W9IA 4MSQB 2JPHA 3R7RA 1RRBA 4RMAA 3VH4B 2GMIC 4WJQA 1UELA 4KV2A 3KYDD 3WAOA 3PRPB 4II2B 3SD5A 3A4SC 4ANUA 2CS4A 5E6PA 1WXSA 4HDOA 2BGFA 3ALBA 1IPGA 1UBIA 2BWFA 2N9PC 1WXAA 2L0FA 4A3PA 2GBKA 3Q3JA 2LVOA 3V60A 3UIPB 4KSKC 4G0NB 2LRUA 4ANXA 4FADA 1WGYA 2PJHA 4BFRA 3KUDB 4KZ0A 3PVLA 5CHFA 4W9HA 4TQ0A 2FCQA 1QZEA 1SIFA 3GZNI 3K9OB 1SE9A 4BKTA 3ZTDA 2B3AA 4GDLA 3AU4A 4PS7A 2EMSA 2KNBA 3A1QB 4B6WA 3H7PA 2C5LC 2L7RA 2C9WB 2MP2B 4I6PA 4XX5A 4TKNA 1U4AA 3P2BA 2C7NB 3ML8A 1V86A 2REXA 2RGFA 1P9DU 4JQWC 1OEYA 1WZ3A 2K8CA 5FR6A 3VTUA 1ZGUB 2ZEQA 3TIXA 3TJPA 3U8ZA 1RLFA 1WI0A 2KWUB 4G3XB 3PLUA 3UINB 3WANA 3L17A 5KHQA 3RD2A 1ZKHA 1NBFC 4I6NB 2L0TA 1X1MA 4K7SA 4ANWA 2KLGA 4NAWB 2AL3A 2DZMA 4M8NA 3GOEA 1T0YA 4AUQC 2IYDB 4EFOA 1KOTA 3EFUA 2KMCA 2NS5A 2G4SA 2PPHA 3KH0A 2BKRB 2JT4B 2GBMA 2D10A 2KDIA 2KK8A 2DZKA 3AULA 4EZJA 4ZYNA 4GOCA 1RFAA 4MM3A 2ZNVB 4ZRJA 1JRUA 1AARA 3DBHI 3K9PB 4JIOU 1KM7A 3DBLI 5E6OA 1VD2A 2FIFA 4TV3A 2A4ZA 2BYVE 4J6IA 3M95A 1GC7A 4PYZA 1HE8A 3B1LX 2JRIB 2O2VB 5JHBA 1WGGA 2C60A 2M17A 1Q5WB 3A9JA 2O6VB 4NQKE 3QK0A 2KOXA 2KQ7A 3UQBA 3IBEA 1WGDA 3QIJA 3CF6E 2OJRA 3CSFA 3ZVVA 4IWPA 2ASQA 1WH3A 4FJYA 1D3ZA 3U7DA 4WWOA 3VDZA 4RM9A 2LD9A 4WJOA 3H9DA 2IO2B 3PSEB 2CR5A 2Z59B 1RAXA 2KWCA 1WJ4A 2GBNA 1WX7A 4MGIE 4WAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WE6 A;  1V6E A;  3EHV A;  2BPS A;  3PTF C;  2Y5B B;  2L00 B;  3UQA A;  5JHA A;  4FLH A;  1EF1 A;  3TMP B;  4W9E A;  1WR1 A;  3OJ3 A;  5CHW A;  4KIK A;  4HPM B;  4KIK B;  4N9F 4;  1PQS A;  3HHM A;  2IO1 B;  5D2M B;  3ZNG C;  2DZJ A;  3RCZ A;  2K1F A;  3IHP C;  2JY6 A;  1V5T A;  3JW0 X;  4W9K A;  4PYU A;  4WJN A;  3ZO5 B;  1LXD A;  3W1S C;  2VRR B;  4P7I A;  2BWE S;  2NVU I;  1SGH A;  2V4L A;  3B0A A;  4TUU A;  2O2V A;  2BKF A;  3DDC B;  4W9J A;  3WA0 A;  2FID A;  1J0G A;  1WXM A;  2MA9 B;  1WYW B;  2LWP A;  1H4R A;  3QWZ B;  2I1K A;  4DXA B;  2ZCC A;  1GJZ A;  2MWS B;  2MBQ A;  3TBL D;  1WRD B;  3N32 A;  3KUZ A;  3QAQ A;  2I1J A;  3L10 B;  3H1U A;  2C7H A;  2M4N A;  4KDI C;  4DDG D;  2R2O A;  1ZW7 A;  3OAW A;  3PRZ A;  5D6J B;  1UD7 A;  2AWT A;  4GN1 A;  2KDF B;  3ENE A;  3ZNI D;  3ZNZ B;  3DQV A;  3ZDM C;  3ECI A;  4CHK A;  1XD3 B;  1I35 A;  2KZR A;  4MEM A;  3RUL A;  2J0K A;  4MDK E;  4W9F A;  5J2R A;  3HK0 A;  4DHJ B;  1L2N A;  3DVG X;  3VVW B;  4IUM B;  1UBQ A;  4IC7 B;  4WWN A;  2KC2 A;  2KC1 A;  4IM3 A;  1IYF A;  3IFW B;  3NY5 A;  4I6L B;  4CYE A;  3PGE A;  2DYO A;  5J17 A;  4JGH B;  3VUW A;  3DBS A;  4XC2 A;  1TZ1 A;  2KTR A;  3NHE B;  1P3Q U;  4MGK E;  4HK2 A;  5G55 A;  4FJV B;  2CHZ A;  2GOW A;  1NDD A;  2LJ5 A;  2K39 A;  4FHJ A;  3X23 A;  3NOB A;  3APF A;  3D32 A;  3ZLZ A;  3QX1 A;  4CO7 A;  1WXV A;  3IG3 A;  1S1Q B;  4ANV A;  3PHW B;  4HLE A;  5BO4 B;  1P1A A;  1OEY J;  4MJS B;  4MJS A;  1BT0 A;  4NNJ B;  4GDK B;  4A20 A;  3L13 A;  2MQJ A;  3ZUN A;  4ZRI A;  2A5U A;  3A9K A;  5DCN A;  3A9K B;  4ICU A;  4B95 A;  1I42 A;  2N1W A;  4FHK A;  4NPN A;  1WFY A;  4G11 A;  3H7S A;  3UF8 A;  5LLI A;  1ISN A;  4EZL A;  1Z5S B;  2LZ6 A;  1E8Z A;  4RM8 A;  2CU1 A;  3KVF B;  3QHT A;  5LXI B;  1V81 A;  4GB9 A;  1WJU A;  3DBR I;  1E8X A;  2L3Z A;  4HJK A;  1EF5 A;  3AXC A;  4NAW A;  2KWV B;  1OTR B;  2ZZP B;  4BVU C;  2K6D B;  3DCG A;  3ZRF A;  3BIN A;  3R3M A;  3AI5 A;  4JLC A;  3CMM B;  1EO6 A;  1LM8 B;  2MLB A;  2D2Q A;  2MX2 A;  2KX3 A;  2L05 A;  4JL9 A;  1GG3 A;  3PZD A;  4IWO A;  4LDT D;  3VQI A;  2WX0 A;  4FJZ A;  4KZC A;  2CKH B;  2OOB B;  2RD0 A;  2KMA A;  1WF9 A;  4EKU A;  2KXJ A;  2BYE A;  2J7Q B;  2BF8 B;  2MSE D;  2JXX A;  2R2Q A;  4TQ1 A;  3WAL A;  4URK A;  2Z0E B;  5LXH A;  1J8C A;  4GSW A;  2N7E A;  1FXT B;  1V2Y A;  3JSV A;  3JSV B;  4BKS A;  4AJW A;  5L83 A;  4G50 A;  1WE7 A;  3EEC A;  3M63 B;  4XZ4 A;  3W1Y A;  1V5O A;  3R7Q A;  2ZVN A;  2BYF A;  1WM2 A;  1A5R A;  3DVN U;  4ICV A;  2ZJD A;  4GXB A;  3RZF A;  3Q3F A;  1LQB A;  4MH0 E;  2V1Y A;  4HXD A;  1WJN A;  2KTF A;  4K81 A;  2EKE C;  3MJW A;  4W9L A;  1UH6 A;  3NZS A;  2KFK B;  1L7Y A;  2KDB A;  4ASW C;  5KHO A;  2AEH A;  4FBJ B;  3O65 B;  2KDE B;  5HKH A;  1WJ6 A;  3VHT C;  4YL8 A;  4EZK A;  4GDL B;  2G3Q B;  2DAF A;  3ZKJ C;  1J19 A;  4GU2 A;  3B08 A;  2AYO B;  2RPQ A;  3R66 C;  5D94 A;  1VCB A;  3ONS A;  3L16 A;  2D07 B;  2KKC A;  2D11 A;  2IY0 B;  2O6V A;  2LXA A;  3X0W A;  1UZX B;  1KJT A;  2UYZ B;  2MBH A;  2PE6 B;  4WJP A;  1EUV B;  4HDQ A;  2FAZ A;  3VXW A;  1K8R B;  2ZVO A;  2MBB B;  3PRM B;  1TTN A;  3IVF A;  1Y8R C;  2FCN A;  2KJ6 A;  2KTR B;  3PS6 A;  2MCN B;  3V6C B;  3WAP A;  1Z2M A;  2NR2 A;  2HD5 B;  3HM6 X;  1Q1O A;  2W9N A;  4AWJ A;  2DZI A;  2ZNV C;  5CX3 A;  4A3O A;  3T8M A;  4HVB A;  1IP9 A;  4FA6 A;  2AL6 A;  2ZCB A;  2V3S A;  2HJ8 A;  4OVU A;  3WIM A;  1TGZ B;  2NPT B;  5E6N A;  5DPW A;  3KUC B;  2RSU A;  2WX1 A;  1Q0W B;  1YD8 U;  2MRP A;  3MHS D;  1S3S G;  2G4D B;  2MP2 A;  3L54 A;  2ZPY A;  4MEL A;  1E90 A;  4HCP B;  3SHQ A;  2J0J A;  4W9C A;  3TCA A;  3TL5 A;  2DEN B;  4E71 A;  2NBV B;  4DHJ D;  2LVQ A;  1GUA B;  1NI2 A;  3N30 A;  4EEW A;  4FUL A;  5J18 A;  3JYU A;  2M0X A;  3LDZ E;  4W9D A;  3RUI B;  2KFJ A;  2O6V D;  1P98 A;  4IM2 A;  4GMV A;  2LGY A;  1P0R A;  1KLV A;  3KW5 B;  3VFK A;  2KLC A;  1C1Y B;  2IY1 B;  2JUO A;  2M1M A;  3H6N A;  2D3G A;  3QA8 A;  4NJ6 A;  2K6Q A;  1V80 A;  2QHO A;  5CHV C;  2JVC A;  2KVR A;  2N9X A;  4WWP A;  2IO0 B;  3QC8 B;  1V9J A;  4MGY E;  3ZNH B;  3ZW3 A;  1E8W A;  3H7P B;  3ML9 A;  3DVG Y;  2HE7 A;  3C0R B;  3PT2 B;  4BBN C;  3M62 B;  2JRH A;  5CTR C;  2MBE A;  4OVV A;  5L95 C;  2NPT A;  1WGH A;  4BOS C;  1GC6 A;  4F1S A;  2LXC A;  5IAA C;  2N1V A;  4ZDV A;  2KJR A;  5C1Z A;  4GDK A;  3ZTC A;  2J0M A;  5C23 A;  3L08 A;  3NZU A;  4AOF A;  4DK5 A;  1YIW A;  3A9J B;  4BKS D;  3V61 A;  3U30 A;  4IG7 B;  2IZV B;  4IM0 A;  2WYQ A;  4EOY A;  3W1S A;  2EMT A;  4DHZ B;  3PPA A;  4DWF A;  4BKG A;  3APD A;  4K1R B;  3AU5 A;  4M0W B;  4MSM B;  2MBO A;  2K8B A;  3DVN V;  3SU8 X;  3NS8 A;  4MGZ E;  3VH3 B;  3T9L A;  2XK5 B;  1WMH B;  1WMH A;  1G6J A;  5TR5 A;  4DBG A;  1M94 A;  1YX5 B;  2IBI B;  4WQO B;  5AZH A;  2LRW A;  1WIA A;  1YJ1 A;  2DYM A;  2FUH B;  3QJZ A;  4K7W A;  3RZW C;  3A1Q A;  2RR9 A;  2GBR A;  3QCA A;  1WGR A;  3S2A A;  3VTV A;  1XT9 B;  2JZZ A;  2YLM A;  3LJ3 A;  2CHW A;  1R4M I;  1E7V A;  2KX0 A;  2DYB A;  4BOZ B;  2LVP A;  5G2N A;  2G45 B;  1WX8 A;  2Z0D B;  2L76 A;  4PS8 A;  1UGM A;  3SDL C;  2HTH A;  3HIZ A;  3WAM A;  4AP4 C;  1V49 A;  4LJP B;  2XEW A;  2CHX A;  2NCN A;  2K8H A;  4NY0 A;  2LGD A;  1E7U A;  2KAN A;  3UIO B;  2DX5 B;  4KSL C;  3ZDT A;  2NBU A;  2XBB C;  1TBE A;  2C7M B;  2FCM A;  3N3K B;  4KVG B;  3A33 B;  3OJ4 B;  2KQS A;  2PE9 A;  3UGB B;  4B9K A;  1YQB A;  2MW5 A;  5JZE B;  1H8C A;  2KFK A;  2K25 A;  3V6E B;  2GBJ A;  2XK5 A;  4LDT B;  2LAS A;  3RYT A;  2DAJ A;  4HPL B;  3CST A;  1WR6 E;  1F9J A;  2DHZ A;  4GIV A;  5DPR A;  4K7U A;  2KO3 A;  3PLV A;  1E5W A;  5DPS A;  1OQY A;  1XQQ A;  5AEK B;  2M8S A;  5IA7 A;  3VTW A;  3APC A;  2PEA A;  3JVZ X;  3L0W B;  3QAR A;  3QQ8 B;  4PS3 A;  4GGQ A;  5DPT A;  2KJH B;  3VAW A;  3PHX B;  4II3 B;  5AZF A;  4DDI D;  4BBN F;  1YX6 B;  1E8Y A;  2L8J A;  2N9E B;  2UWQ A;  3VUY A;  3DOW A;  2KD0 A;  3MTN B;  2JZ3 B;  2LI5 A;  1LFD A;  1C3T A;  4NQL B;  4M8M A;  4LJO B;  2IO3 B;  2N4F A;  4HCN B;  4DHZ E;  4EUT A;  2YVC A;  3ZIM A;  4E3C A;  5AZG A;  5GMV A;  2FCS A;  3PV1 A;  3RT3 B;  4F7Z A;  3A4R A;  3ZRC A;  2FNJ B;  2N7D A;  3DPD A;  5D7G A;  2KN5 A;  2WWZ A;  1GNU A;  1OGW A;  2WDT B;  4FN2 A;  3VUX A;  5JH5 C;  1R4N I;  3OLM D;  4F8C B;  4HWI B;  5EDS A;  1WY8 A;  4LCD E;  3I3T B;  1WZ0 A;  2JWZ A;  2KHW B;  3BY4 B;  4IWQ A;  2NBW B;  3EC8 A;  3PRE A;  4NJ7 A;  3M3J A;  2LUE A;  4ZRK A;  4IW0 A;  4X57 B;  3V62 A;  1MG8 A;  2ZPN A;  3HM3 A;  1CMX B;  1WX9 A;  2LGX A;  4KDL B;  2JF5 A;  4AJY B;  3KYC D;  4W9G A;  1WM3 A;  4E74 A;  4W9I A;  4MSQ B;  2JPH A;  3R7R A;  1RRB A;  4RMA A;  3VH4 B;  2GMI C;  4WJQ A;  1UEL A;  4KV2 A;  3KYD D;  3WAO A;  3PRP B;  4II2 B;  3SD5 A;  3A4S C;  4ANU A;  2CS4 A;  5E6P A;  1WXS A;  4HDO A;  2BGF A;  3ALB A;  1IPG A;  1UBI A;  2BWF A;  2N9P C;  1WXA A;  2L0F A;  4A3P A;  2GBK A;  3Q3J A;  2LVO A;  3V60 A;  3UIP B;  4KSK C;  4G0N B;  2LRU A;  4ANX A;  4FAD A;  1WGY A;  2PJH A;  4BFR A;  3KUD B;  4KZ0 A;  3PVL A;  5CHF A;  4W9H A;  4TQ0 A;  2FCQ A;  1QZE A;  1SIF A;  3GZN I;  3K9O B;  1SE9 A;  4BKT A;  3ZTD A;  2B3A A;  4GDL A;  3AU4 A;  4PS7 A;  2EMS A;  2KNB A;  3A1Q B;  4B6W A;  3H7P A;  2C5L C;  2L7R A;  2C9W B;  2MP2 B;  4I6P A;  4XX5 A;  4TKN A;  1U4A A;  3P2B A;  2C7N B;  3ML8 A;  1V86 A;  2REX A;  2RGF A;  1P9D U;  4JQW C;  1OEY A;  1WZ3 A;  2K8C A;  5FR6 A;  3VTU A;  1ZGU B;  2ZEQ A;  3TIX A;  3TJP A;  3U8Z A;  1RLF A;  1WI0 A;  2KWU B;  4G3X B;  3PLU A;  3UIN B;  3WAN A;  3L17 A;  5KHQ A;  3RD2 A;  1ZKH A;  1NBF C;  4I6N B;  2L0T A;  1X1M A;  4K7S A;  4ANW A;  2KLG A;  4NAW B;  2AL3 A;  2DZM A;  4M8N A;  3GOE A;  1T0Y A;  4AUQ C;  2IYD B;  4EFO A;  1KOT A;  3EFU A;  2KMC A;  2NS5 A;  2G4S A;  2PPH A;  3KH0 A;  2BKR B;  2JT4 B;  2GBM A;  2D10 A;  2KDI A;  2KK8 A;  2DZK A;  3AUL A;  4EZJ A;  4ZYN A;  4GOC A;  1RFA A;  4MM3 A;  2ZNV B;  4ZRJ A;  1JRU A;  1AAR A;  3DBH I;  3K9P B;  4JIO U;  1KM7 A;  3DBL I;  5E6O A;  1VD2 A;  2FIF A;  4TV3 A;  2A4Z A;  2BYV E;  4J6I A;  3M95 A;  1GC7 A;  4PYZ A;  1HE8 A;  3B1L X;  2JRI B;  2O2V B;  5JHB A;  1WGG A;  2C60 A;  2M17 A;  1Q5W B;  3A9J A;  2O6V B;  4NQK E;  3QK0 A;  2KOX A;  2KQ7 A;  3UQB A;  3IBE A;  1WGD A;  3QIJ A;  3CF6 E;  2OJR A;  3CSF A;  3ZVV A;  4IWP A;  2ASQ A;  1WH3 A;  4FJY A;  1D3Z A;  3U7D A;  4WWO A;  3VDZ A;  4RM9 A;  2LD9 A;  4WJO A;  3H9D A;  2IO2 B;  3PSE B;  2CR5 A;  2Z59 B;  1RAX A;  2KWC A;  1WJ4 A;  2GBN A;  1WX7 A;  4MGI E;  4WAA A; 
#chains in the Genus database with same CATH topology
 1V6E A;  3EHV A;  3UQA A;  4FLH A;  1I7H A;  3TMP B;  1WR1 A;  1FFV A;  2N9K A;  2VH2 A;  4HPM B;  3HHM A;  5D2M B;  2DZJ A;  4MH8 A;  5LNK 1;  3IHP C;  2JY6 A;  4PYU A;  1C4P A;  1LXD A;  1SGH A;  4TUU A;  3DDC B;  1VRA B;  4WQM A;  1WXM A;  1H4R A;  4RH6 A;  2AQ2 B;  4KX6 B;  1T0S C;  2M4N A;  4KDI C;  4DDG D;  2V9H A;  1ZW7 A;  4RF1 A;  3U4E G;  4XDD A;  3AEE B;  2KDF B;  3ZNI D;  3ECI A;  2KZR A;  3RUL A;  2J0K A;  1L2N A;  4FXC A;  1UBQ A;  3IFW B;  5J17 A;  3ZJU A;  3IXS A;  4XC2 A;  1P3Q U;  2CHZ A;  2LJ5 A;  4FHJ A;  2K39 A;  3APF A;  4LNF A;  2N9L A;  4P1C C;  4CO7 A;  1WXV A;  2WXR A;  1S1Q B;  4ANV A;  5BO4 B;  1TKG A;  4MJS B;  3ZUN A;  3L4P A;  4ZRI A;  2A5U A;  4NPN A;  5LLI A;  1ISN A;  4HRO A;  4RM8 A;  1V1P A;  3KVF B;  3QHT A;  1V81 A;  4GB9 A;  1XCT L;  1EF5 A;  3AXC A;  2KWV B;  1OFF A;  3ZRF A;  1F0Z A;  4MAC A;  3CMM B;  1EO6 A;  1LM8 B;  1ZDX A;  2D2Q A;  2MX2 A;  2LMC A;  3PZD A;  2BQQ A;  4LNO A;  2KVZ A;  4LTU A;  2RD0 A;  2KXJ A;  2J7Q B;  2MSE D;  2JXX A;  1ZDV A;  4ZYS A;  2WU5 B;  4JPS A;  2Z0E B;  5LXH A;  2W3R A;  3JSV A;  1TY0 A;  2JXT A;  3Q8E A;  3AM9 A;  3M63 B;  2WP9 B;  1KH0 A;  3Q3F A;  2WXG A;  4W9L A;  4UDU C;  4FBJ B;  3O65 B;  2KDE B;  1UWM A;  2D3B A;  5HKH A;  1WJ6 A;  4YL8 A;  2DAF A;  3ZKJ C;  4GU2 A;  3B08 A;  1I4H A;  2AYO B;  2BB6 A;  2LJI A;  4REZ A;  2W82 A;  4MM3 B;  2IY0 B;  2LXA A;  1UZX B;  4WUR A;  2INN E;  2UYZ B;  1KRH A;  2FAZ A;  1K8R B;  3KQ4 A;  2GRI A;  2MBB B;  1TTN A;  1Y8R C;  3PS6 A;  2KJ6 A;  3V6C B;  4OW0 A;  5BYS A;  3C8Y A;  2HD5 B;  1TIF A;  2ZNV C;  5CX3 A;  3BVZ A;  4A3O A;  3DBH B;  2V3S A;  2HJ8 A;  4OVU A;  2WX1 A;  2MRP A;  2G4D B;  3L54 A;  4MEL A;  2QC8 A;  1K51 A;  5EE1 A;  2LVQ A;  1GUA B;  4EEW A;  5J18 A;  2M0X A;  1QOF A;  2KFJ A;  3P42 A;  2D3A A;  4KKJ A;  1YMH E;  3VFK A;  1JCK B;  2AX5 A;  4A6Q A;  2GI9 A;  3PZ8 A;  1NEK B;  2QHO A;  5CHV C;  2KVR A;  2LFI A;  1V9J A;  3ZW3 A;  3OG5 A;  3AE9 B;  1HA5 A;  5EE9 A;  2MBE A;  5L95 C;  1FEH A;  2NPT A;  1GC6 A;  2LXC A;  5IAA C;  4ZDV A;  1ZXH A;  1F77 A;  4GDK A;  3ZTC A;  1ZOY B;  3L08 A;  3NZU A;  2IGH A;  4HJG E;  4BKS D;  4IG7 B;  5BMG A;  4EOY A;  2EMT A;  3PPA A;  3APD A;  3I9V 1;  3TEW A;  3VH3 B;  2XK5 B;  3U7Z A;  4DBG A;  1M94 A;  2IBI B;  5AZH A;  2OED A;  1YJI A;  3AE5 B;  4DXG A;  2YLM A;  1IBX A;  1MHX A;  2CHW A;  4H2A A;  2KWD A;  3PO0 A;  3PZ7 A;  5G2N A;  3IAS 1;  1CK1 A;  2I2Y A;  4LJP B;  2Y3A A;  2WS3 B;  1XLP A;  2LGD A;  2DLB A;  2DX5 B;  2NBU A;  3NVV A;  3OJ4 B;  5JZE B;  1H8C A;  1QOB A;  2GBJ A;  2LAS A;  2DAJ A;  1WR6 E;  1F9J A;  2DHZ A;  3Q2A C;  5IO9 A;  3PLV A;  2IJ0 A;  2KAJ A;  5AEK B;  2M8S A;  4NAM A;  4PS3 A;  4C4V A;  2KJH B;  3PHX B;  2L8J A;  2UWQ A;  2INP E;  1ENF A;  1YQ4 B;  1LFD A;  4LJO B;  2N4F A;  4EUT A;  3NVW A;  5BYQ A;  2WXP A;  3O13 A;  2L52 A;  4F7Z A;  1IGD A;  2FNJ B;  2N7D A;  3RFZ B;  3Q8A A;  4KGT A;  3VUX A;  4FN2 A;  4J3O D;  5IP4 D;  4HWI B;  2NBW B;  1YQ3 B;  3BZD B;  3M3J A;  2QEJ C;  3V62 A;  1MG8 A;  3BK2 A;  2JF5 A;  2IGG A;  3RMK C;  4W9I A;  1SB3 C;  1AYF A;  4RF0 A;  4K3C A;  3TSS A;  2MJ3 A;  1IUE A;  3PRP B;  4ANU A;  4ACF A;  1WXS A;  4HDO A;  1M4V A;  2BWF A;  2PVG C;  1JRP A;  1WXA A;  2L0F A;  1AWD A;  4A3P A;  3Q3J A;  3T3N A;  5IOI A;  4KSK C;  3EGR A;  2ZW0 A;  1WGY A;  2PJH A;  1C78 A;  4KZ0 A;  3E56 A;  1AN8 A;  1DGJ A;  1T0R C;  1QOA A;  4XE0 A;  3K9O B;  3ZTD A;  4GDL A;  1N63 A;  4B6W A;  1E9M A;  5BMH A;  1NI3 A;  1YJJ A;  1V86 A;  2RGF A;  2ON8 A;  1K53 A;  1P9D U;  2MJE A;  1WZ3 A;  1J7C A;  3B2G A;  2RPV A;  2ZEQ A;  1F2R I;  3TIX A;  2KWU B;  4G3X B;  1XLQ A;  4I6N B;  1X1M A;  2QIL A;  2KLG A;  2AL3 A;  3VRA B;  2DZM A;  4M8N A;  1T0Y A;  1KOT A;  2Y5P A;  4XWT A;  1HQR D;  2G4S A;  2JT4 B;  2GBM A;  2MJD A;  2KK8 A;  3AUL A;  4EZJ A;  4ZRJ A;  1AAR A;  2AQ3 B;  3K9P B;  4JIO U;  1KM7 A;  3N9Y C;  2A4Z A;  4J6I A;  3M95 A;  1SE4 A;  1HE8 A;  2JRI B;  3RN9 C;  5JHB A;  1WGG A;  1Q5W B;  3IT4 B;  2BBC A;  3IBE A;  2J4X A;  1WGD A;  1FMA D;  3CF6 E;  2OJR A;  1EWY C;  3ZGZ A;  4FJY A;  1TKY A;  2JX5 A;  1JML A;  3PSE B;  1FM0 D;  3ZXV A;  2WU2 B;  1WJ4 A;  3BK1 A;  3HVZ A;  3T3O A;  2BPS A;  3PTF C;  2Y5B B;  3W9C B;  5JHA A;  3AE2 B;  1EF1 A;  4W9E A;  3NJT A;  4N9F 4;  3ZNG C;  3RCZ A;  2WLB A;  3ZO5 B;  3JW0 X;  3Q6B A;  4KGS A;  4P7I A;  2V4L A;  1QLB B;  2BKF A;  3AE6 B;  2HJ1 A;  1BML C;  1GJZ A;  2MBQ A;  3AEG B;  3N32 A;  3KUZ A;  3H1U A;  3IAM 1;  2C7H A;  3AEA B;  4RGO S;  2R2O A;  4TSS A;  3OAW A;  3PRZ A;  2IGD A;  4YWG G;  1UD7 A;  2JYT A;  2QJL A;  1I35 A;  2CU3 A;  4B0E A;  4MDK E;  1KTK A;  1FO4 A;  2KC1 A;  4IM3 A;  4N58 A;  3NY5 A;  4CYE A;  3PGE A;  3VUW A;  3DBS A;  1TZ1 A;  1OQQ A;  1VR9 A;  2GOW A;  3NOB A;  2L32 A;  3IG3 A;  3PHW B;  1B9R A;  4HLE A;  1WGK A;  1FRR A;  4MJS A;  4YT0 B;  2L83 A;  1JWU D;  4AQ7 A;  3A9K A;  5DCN A;  4ICU A;  1I42 A;  4FHK A;  4S17 A;  1FD6 A;  1C79 A;  3UF8 A;  1FNV A;  1XLO A;  2CU1 A;  1E8X A;  4HJK A;  1D5X C;  1MG4 A;  4NAW A;  1OTR B;  2KN4 A;  2ZZP B;  2N7J A;  2K6D B;  3TEX A;  3BIN A;  3R3M A;  3Q8C A;  4A55 A;  3ZJV A;  2WX0 A;  2KMA A;  1WF9 A;  1ROE A;  1SE2 A;  2BYE A;  4JWU C;  1ET6 A;  2N7E A;  1FXT B;  5L83 A;  4AJW A;  4G50 A;  3EEC A;  4DXF A;  4XZ4 A;  3W1Y A;  3V3X A;  3R7Q A;  1FNW A;  2BYF A;  4RGM A;  1WM2 A;  1A5R A;  2PLP A;  4GXB A;  1NVI D;  3LXF A;  3VRB B;  4MH0 E;  2V1Y A;  4DQO C;  1WYG A;  3MJW A;  1UH6 A;  2KFK B;  1WWT A;  2KDB A;  5KHO A;  3VR9 B;  2OHF A;  4BAX A;  3R66 C;  3ONS A;  1ESF A;  2KKC A;  2D11 A;  1T3Q A;  2O6V A;  4ZHO A;  4WJP A;  3AMZ A;  3N20 C;  3IVF A;  3W5U B;  2FCN A;  3AE8 B;  2MCN B;  4LNN A;  2NR2 A;  3AE1 B;  1N6Z A;  4AWJ A;  3DHH C;  3J9C A;  2AL6 A;  2R61 A;  2ZCB A;  3FIL B;  5E6N A;  1S3S G;  1AW7 A;  2ZPY A;  1HTO A;  2J0J A;  4W9C A;  1DOI A;  2DEN B;  1N62 A;  1WRI A;  4S0R A;  3JYU A;  3LDZ E;  4ZHP A;  1TT5 B;  4IM2 A;  4GMV A;  1KLV A;  1L0V B;  1C1Y B;  2IY1 B;  4NJ6 A;  2K6Q A;  1V80 A;  2N0S B;  1YN3 A;  1NEN B;  2JVC A;  5FK9 C;  4WWP A;  2MEK A;  4GLS C;  3P63 A;  1J7A A;  1E8W A;  3DVG Y;  1YNT E;  3C0R B;  1I4G A;  1P7E A;  4OVV A;  3HUI A;  4F1S A;  1SJH D;  3DBL B;  3V05 A;  2J0M A;  5H8Y E;  1MJD A;  2BS2 B;  1WXQ A;  3Q3N C;  4DK5 A;  2IZV B;  4IM0 A;  2QIE B;  4XDC A;  5D3D A;  4K1R B;  1DOY A;  3AU5 A;  4MSM B;  1KFY B;  3T9L A;  1WMH B;  2WGS A;  4OZC A;  3U52 E;  1YJ1 A;  2FUH B;  5MPO A;  1N5X A;  3A1Q A;  1C76 A;  1XCQ L;  2JZZ A;  1V97 A;  1XXG A;  1E7V A;  2DYB A;  3BII D;  4OZB A;  1VDV A;  3I57 A;  3KWV A;  1VJK A;  2L76 A;  2HTH A;  4AP4 C;  2FBW B;  2KAC A;  2ONQ A;  4WAF A;  2KAN A;  3UIO B;  3KLS X;  4KSL C;  2KQS A;  2PE9 A;  4ZRQ A;  4B9K A;  2MW5 A;  3Q8F A;  3V6E B;  1QF6 A;  1FIQ A;  2XK5 A;  2WDV B;  3RYT A;  2RDH A;  4HPL B;  3HVD A;  4K7U A;  1VZ8 A;  3VTW A;  3APC A;  2PEA A;  4B0M A;  5BYR A;  3QQ8 B;  1N60 A;  4GGQ A;  4KKI A;  1PFD A;  1E8Y A;  3VUY A;  3GP7 A;  1MVK A;  2KD0 A;  3DOW A;  2LI5 A;  3W2D A;  2IO3 B;  3CIR B;  4DHZ E;  4HCN B;  2QCZ A;  4HRS A;  5EE3 A;  5AZG A;  1CQV A;  2FCS A;  3MC8 A;  3ZRC A;  3DPD A;  1GNU A;  1GPX A;  1QIL A;  2WXI A;  4BZA A;  2KHW B;  1EWC A;  4NJ7 A;  2G9H D;  2NTS A;  4IW0 A;  4X57 B;  3HM3 A;  2LGX A;  3AE7 B;  4KDL B;  4AJY B;  3KYC D;  4W9G A;  4E74 A;  2JPH A;  3R7R A;  1RRB A;  4RMA A;  2ACZ B;  3H8H A;  3AB5 A;  2CS4 A;  5E6P A;  2BGF A;  3ALB A;  1UBI A;  2WXN A;  2D3C A;  1QOG A;  2BS3 B;  4EE2 A;  3RI7 C;  1TY2 A;  4A9A A;  2KMM A;  4BFR A;  4JE3 B;  3KUD B;  2IND C;  2J52 A;  4R3D A;  4MT5 A;  1L0Y B;  4W9H A;  3TUO A;  2QSD A;  1SIF A;  3SFE B;  1SE9 A;  1Q10 A;  3RNG C;  2KNB A;  3H7P A;  2M0A A;  4RNA A;  2L7R A;  2WNM A;  4XX5 A;  3R2T A;  1TS3 A;  4TKN A;  4US8 A;  1OEY A;  2K8C A;  3VTU A;  1ZGU B;  2E6X A;  1RLF A;  4RFB A;  3PLU A;  3L17 A;  1ZKH A;  2Q5W D;  2L0T A;  5TSS A;  5FKA C;  3ETR A;  4AUQ C;  2IYD B;  4EFO A;  1KLG D;  2SEB D;  2PPH A;  1FRD A;  4O1N A;  2KDI A;  2DZK A;  4M02 A;  4ZYN A;  2PKO A;  4C7Y A;  4MM3 A;  2ZNV B;  1JRU A;  2VZK D;  3DBH I;  5C2T B;  1PGX A;  4LK0 M;  3DBL I;  2JSV X;  4TV3 A;  1OQR A;  2BTE A;  4PYZ A;  4YTM B;  1UGJ A;  2O2V B;  2M17 A;  2W54 A;  4OVZ A;  3A9J A;  2KQ7 A;  4C80 A;  1C4A A;  3DHI C;  3FKY A;  3H9D A;  1RM6 C;  2CR5 A;  4WH4 A;  1KF6 B;  1RAX A;  1WX7 A;  4MGI E;  5HHD G;  2L00 B;  1R4M B;  4KIK A;  1ZP0 B;  4ZOH C;  2XNA C;  3SFD B;  4OHJ A;  2IO1 B;  4N6E B;  4C7Z A;  2K1F A;  4W9K A;  4A90 A;  1ZPS A;  3W1S C;  2VRR B;  3WA0 A;  2FID A;  2MA9 B;  3AE4 B;  2I1K A;  1I4X A;  2LHD A;  4DXA B;  2GLS A;  3GE8 C;  2MWS B;  2K9X A;  2BT6 A;  2I1J A;  3C19 A;  5D6J B;  1TS5 A;  4M01 A;  2AWT A;  4K3B A;  4GN1 A;  3ENE A;  4LLG M;  2FE8 A;  3DQV A;  1PYW D;  4CHK A;  1XD3 B;  4MEM A;  2KDM A;  5J2R A;  4DHJ B;  4IC7 B;  4WWN A;  2KC2 A;  3ZJT A;  4I6L B;  2DBY A;  1SBB B;  2VZK B;  3NHE B;  2V3P A;  4HK2 A;  3NS1 A;  1NDD A;  1PUT A;  3D32 A;  1YN4 A;  3QX1 A;  2WXL A;  3GE3 C;  1OEY J;  1BT0 A;  4NNJ B;  4A20 A;  1L4D B;  3H7S A;  4D2K A;  2LZ6 A;  1E8Z A;  2IDY A;  1EM7 A;  1WJU A;  3DBR I;  1RWS A;  4M0W A;  2JWU A;  4BVU C;  4YXD B;  4JLC A;  1D6E C;  2L05 A;  4JL9 A;  4WWM A;  2TSS A;  4IWO A;  4FJZ A;  2JYE A;  4KZC A;  1C4C A;  2OOB B;  1FCL A;  3B2F A;  2R2Q A;  1SIJ A;  1IGC A;  4GSW A;  2M56 B;  3R8B A;  1V2Y A;  4BKS A;  1KLU D;  2K22 A;  1WE7 A;  2WXQ A;  1V5O A;  1FNU A;  2ZVN A;  1A70 A;  2J42 A;  2ZJD A;  4XWW A;  3NUH B;  1HZ5 A;  3P4Q B;  4HXD A;  2EKE C;  3NZS A;  4ASW C;  3VHT C;  3GB1 A;  2J53 A;  2PVO D;  4GDL B;  4EZK A;  2G3Q B;  1J19 A;  3RNC C;  2L1A A;  3WCQ A;  3Q3M C;  1VCB A;  1C77 A;  3L16 A;  2B76 B;  1VLB A;  3RNF C;  3X0W A;  2D5G A;  3MHZ A;  2MBH A;  3VXW A;  1EUV B;  3N1Z C;  3PRM B;  2WDR B;  3WAP A;  1Q1O A;  2W9N A;  5JXV A;  2DZI A;  2BYT A;  1IP9 A;  3FIL A;  4FA6 A;  5DPW A;  1TGZ B;  3KUC B;  3CWI A;  1Q0W B;  1YD8 U;  2Y5C A;  4N59 A;  2MP2 A;  2LHE A;  1FPY A;  4HCP B;  3TCA A;  3TL5 A;  4E71 A;  4DHJ D;  1B1Z A;  1NI2 A;  3RUI B;  1JW9 D;  1P98 A;  1P0R A;  3KW5 B;  2KLC A;  3QA8 A;  2CJO A;  2N9X A;  2EEL A;  3EA6 A;  3QC8 B;  1UF0 A;  3RNB C;  3H7P B;  3P4P B;  2HE7 A;  2ICI A;  3PT2 B;  4JWS C;  4BBN C;  3M62 B;  5CTR C;  1GB4 A;  1XO3 A;  2WXO A;  4BOS C;  1T5X D;  2N1V A;  2V0G A;  2KT7 A;  2VH1 A;  2KJR A;  4QAY A;  1T6B X;  2BB5 A;  4AOF A;  1YIW A;  4AS1 A;  4P16 A;  3U30 A;  4XYC A;  4BKG A;  1CJE A;  2MBO A;  2K8B A;  1WSP A;  4IOI E;  3SU8 X;  1NYR A;  2DNF A;  1ZXI A;  2WXH A;  1MHH E;  5TR5 A;  1YX5 B;  1E0Z A;  4WQO B;  1WIA A;  3NVZ A;  3QJZ A;  1ET9 A;  4K7W A;  3RZW C;  4LNK A;  2RR9 A;  2GBR A;  1L6U A;  1WGR A;  2YEP F;  3VTV A;  1XT9 B;  1IBX B;  3LB8 C;  1J7B A;  1V1P B;  1DOX A;  4WIP A;  2Z0D B;  4PS8 A;  3WAM A;  2H88 B;  1GOZ A;  3HIZ A;  2XEW A;  2NCN A;  4NY0 A;  2JQR B;  5GXG B;  3ZDT A;  1STE A;  2XBB C;  4KVG B;  3A33 B;  3UI3 A;  2KFK A;  2K25 A;  4PT5 A;  1V8C A;  4HKQ A;  3CST A;  1TKE A;  1JRO A;  4GIV A;  5DPR A;  1ZUD 2;  1XQQ A;  2WQY B;  5IA7 A;  2IPK D;  2OJW A;  3E9S A;  3JVZ X;  3Q3O C;  3QAR A;  5DPT A;  3VAW A;  1L0X B;  4DDI D;  4BBN F;  3AEC B;  1N5W A;  1FCC C;  4RGT A;  1C3T A;  4M8M A;  4ZRP A;  2YVC A;  3ZIM A;  4E3C A;  2V4I B;  1RYJ A;  2PW9 A;  3PV1 A;  3RT3 B;  3VR8 B;  3A4R A;  3TEY A;  2E3T A;  2K3U A;  2KN5 A;  1HTQ A;  2WWZ A;  1OGW A;  1EU4 A;  1R4N I;  4HPP A;  2PIA A;  5EDS A;  4LCD E;  1F1H A;  5G5G A;  3FAH A;  2LUE A;  1I4R A;  4KGR A;  1JWA D;  1RFK A;  2ZPN A;  1CMX B;  2X38 A;  1WM3 A;  4MSQ B;  3MFG A;  2NMQ A;  2KQ4 X;  2GMI C;  1I4P A;  2HTM E;  1UNS A;  1BXT A;  4II2 B;  1EU3 A;  2YEP B;  1F2R C;  1IPG A;  2N9P C;  1XEE A;  3UIP B;  4G0N B;  3DWM A;  2LRU A;  4ANX A;  4FAD A;  3BVG A;  5CHF A;  5C3J B;  2FCQ A;  1QZE A;  2AQ1 B;  3GZN I;  4BKT A;  2JZP A;  2QDF A;  3R2I A;  2B3A A;  3HRD D;  3AU4 A;  4PS7 A;  3A1Q B;  2C5L C;  5HG2 A;  2C9W B;  5AUK A;  4I6P A;  3P2B A;  3P4S B;  2REX A;  3NZ3 A;  1LO5 D;  3TJP A;  3U8Z A;  1WI0 A;  4L2Y A;  3UIN B;  3RD2 A;  1NBF C;  4ANW A;  4K7S A;  3I63 C;  2WXF A;  3GOE A;  3EFU A;  2NS5 A;  4ITK A;  2BKR B;  2EKI A;  3AEF B;  4HEA 1;  4GOC A;  3N1Y C;  2PTL A;  1TJE A;  3OWE B;  5HI1 A;  3FC4 A;  1FXA A;  5E6O A;  2FIF A;  4ARI A;  4YSX B;  3BWU D;  2C60 A;  3BYT B;  2O6V B;  4NQK E;  3QK0 A;  3UQB A;  3AV8 A;  2MH7 A;  3QIJ A;  3CSF A;  5E6J A;  2ASQ A;  1D3Z A;  3U7D A;  3VDZ A;  2V3N A;  2Z59 B;  2KWC A;  2GBN A;  1ACC A;  1WE6 A;  4NZL B;  3OJ3 A;  5CHW A;  4KIK B;  2DWQ A;  1PQS A;  3N1X C;  1V5T A;  4WJN A;  3SR6 A;  4P6V F;  2BWE S;  2NVU I;  3B0A A;  4W9J A;  2O2V A;  1J0G A;  2W3S A;  1WYW B;  2LWP A;  3QWZ B;  2ZCC A;  3TBL D;  1PGA A;  1WRD B;  3QAQ A;  3L10 B;  2CJN A;  4RCO A;  4OZA A;  3RNE C;  5BMI A;  3ZNZ B;  3ZDM C;  4W9F A;  3HK0 A;  4USA A;  3DVG X;  3VVW B;  1TS4 A;  4IUM B;  5IN7 A;  1MFW A;  1IYF A;  5T8I A;  2DYO A;  4JGH B;  2KTR A;  4XGA B;  4YSY B;  2NTT A;  4MGK E;  5G55 A;  4FJV B;  3X23 A;  4HKZ E;  1C9F A;  3ZLZ A;  4RGN A;  3W5V B;  1P1A A;  2Z8L A;  3ZQ4 A;  4GDK B;  3L13 A;  2MQJ A;  1YN5 A;  3A9K B;  4B95 A;  2N1W A;  1Y56 A;  4TMA B;  1WFY A;  4G11 A;  4CQN A;  3ZXR A;  1QQR A;  4EZL A;  1SXT A;  1Z5S B;  5LXI B;  2KYW A;  5I4D A;  2L3Z A;  3DCG A;  4ARC A;  3AI5 A;  3Q69 A;  2MLB A;  2INC C;  1TYG B;  2KX3 A;  1GG3 A;  4LDT D;  3VQI A;  2CKH B;  2QMT A;  4L23 A;  4EKU A;  2BF8 B;  4TQ1 A;  3WAL A;  4URK A;  1J8C A;  1E10 A;  1LGR A;  4A8X C;  3JSV B;  1E7P B;  4Q2J A;  3AH7 A;  1NYQ A;  3DVN U;  4ICV A;  3GZN B;  3RZF A;  1LQB A;  2LEK A;  4K81 A;  1WJN A;  2KTF A;  1L7Y A;  1SJE D;  2AEH A;  2WHI A;  1HXY D;  2RPQ A;  1FXI A;  1QKZ A;  5D94 A;  3KWL A;  1R7S A;  3AE3 B;  2D07 B;  1JQ4 A;  5FR3 A;  1KJT A;  2RDG A;  2PE6 B;  4HDQ A;  2ZVO A;  3AN1 A;  3EFC A;  1UUP A;  2WXM A;  2KTR B;  1Z2M A;  2BVC A;  3HM6 X;  4US9 A;  3MJ5 A;  3T8M A;  4HVB A;  3WIM A;  4C00 A;  2NPT B;  2RSU A;  1N61 A;  3MHS D;  1P7F A;  1E90 A;  3SHQ A;  2RMM A;  2NBV B;  3EUB 2;  3N30 A;  4FUL A;  4W9D A;  2O6V D;  2LGY A;  2JUO A;  2M1M A;  3H6N A;  2D3G A;  1QT9 A;  3AED B;  1SF0 A;  4P1B C;  2IO0 B;  2XN9 C;  4M00 A;  4MGY E;  3ZNH B;  1TS2 A;  3ML9 A;  1JWM D;  2JRH A;  1V1O A;  3GS2 A;  2LUM A;  2K0P A;  1WGH A;  5IKC M;  2UU7 A;  5C1Z A;  5C23 A;  1L4Z B;  3DWG C;  2BW2 A;  3A9J B;  3V61 A;  2PMV A;  1SEB D;  2WYQ A;  3W1S A;  4DHZ B;  4DWF A;  1GAQ B;  1ZE3 D;  4M0W B;  3ABV B;  1PDX A;  2M19 A;  2WXK A;  3DVN V;  3NS8 A;  4MGZ E;  1F52 A;  1WMH A;  1G6J A;  2LRW A;  2DYM A;  3DBR B;  3QCA A;  3S2A A;  3LJ3 A;  1R4M I;  2I38 A;  2KX0 A;  4L1B A;  4YTN B;  4BOZ B;  2LVP A;  2G45 B;  1WX8 A;  1UGM A;  3SDL C;  4YSZ B;  1D5Z C;  1V49 A;  1E6E B;  2CHX A;  3NVY A;  2K8H A;  1E7U A;  1TBE A;  2C7M B;  2FCM A;  3N3K B;  3UGB B;  1YQB A;  2WXJ A;  1L6V A;  3URY A;  4LDT B;  3RPF C;  4IDI A;  5D3I B;  2KO3 A;  1E5W A;  5DPS A;  1OQY A;  3Q8B A;  2ZW1 A;  3L0W B;  4C4V B;  4II3 B;  5AZF A;  1YX6 B;  1FFU A;  2N9E B;  5EE0 A;  3MTN B;  2JZ3 B;  1K50 A;  2WDQ B;  4NQL B;  2HDE A;  5GMV A;  5D7G A;  1D4B A;  1JWS D;  3TEZ A;  3SEB A;  2SAK A;  2WDT B;  1CZP A;  5JH5 C;  3LYY A;  4YTP B;  3OLM D;  4F8C B;  1HZ6 A;  1L5P A;  1MI0 A;  1WY8 A;  3I3T B;  1WZ0 A;  2JWZ A;  3BY4 B;  3P4R B;  4IWQ A;  1MPE A;  3EC8 A;  3PRE A;  4ZRK A;  4C56 C;  3BYY B;  1WX9 A;  3AEB B;  2GB1 A;  2LGS A;  3RNA C;  2G1E A;  3NRZ A;  1VZ7 A;  3B9J A;  1JWB D;  2W55 A;  3VH4 B;  4WJQ A;  1UEL A;  4KV2 A;  5H92 C;  3IT6 B;  3KYD D;  3WAO A;  3SD5 A;  3A4S C;  2H89 B;  1T0Q C;  3ZYY X;  2MHJ A;  1JAL A;  2GBK A;  2LVO A;  2BS4 B;  1UWX A;  4NJC A;  3V60 A;  1I4Q A;  1SSN A;  3MP9 A;  3MC9 A;  4PK1 A;  1HEZ E;  4LNI A;  1TZO A;  1XF5 L;  3PVL A;  4TQ0 A;  1PGB A;  2EMS A;  5AUI A;  1YOV B;  2MP2 B;  1U4A A;  2C7N B;  3ML8 A;  4IKG A;  4JQW C;  5FR6 A;  3WAN A;  5KHQ A;  2K5P A;  3P1M A;  4NAW B;  1BUI C;  3U2S C;  2KMC A;  1SE3 A;  3KH0 A;  1GB1 A;  2D10 A;  1R4N B;  2LGI A;  1RFA A;  3I5J C;  4JX1 C;  2FUG 1;  1VD2 A;  2RDB C;  1K52 A;  2BYV E;  1DYQ A;  1GC7 A;  1XLN A;  3DHG C;  3B1L X;  5G5H A;  3NG0 A;  2KOX A;  3Q14 C;  5HFY A;  3BVM A;  3MC0 B;  3ZVV A;  4IWP A;  1WH3 A;  4WWO A;  1D5M C;  4RM9 A;  2X8X X;  2LD9 A;  4WJO A;  2JU6 X;  2IO2 B;  1VZ6 A;  4WAA A; 
#chains in the Genus database with same CATH homology
 1WE6 A;  1V6E A;  3EHV A;  2BPS A;  3PTF C;  2Y5B B;  2L00 B;  3UQA A;  5JHA A;  4FLH A;  1EF1 A;  3TMP B;  4W9E A;  1WR1 A;  3OJ3 A;  5CHW A;  4KIK A;  4HPM B;  4KIK B;  4N9F 4;  1PQS A;  3HHM A;  2IO1 B;  5D2M B;  3ZNG C;  2DZJ A;  3RCZ A;  2K1F A;  3IHP C;  2JY6 A;  1V5T A;  3JW0 X;  4W9K A;  4PYU A;  4WJN A;  3ZO5 B;  1LXD A;  3W1S C;  2VRR B;  4P7I A;  2BWE S;  2NVU I;  1SGH A;  2V4L A;  3B0A A;  4TUU A;  2O2V A;  2BKF A;  3DDC B;  4W9J A;  3WA0 A;  2FID A;  1J0G A;  1WXM A;  2MA9 B;  1WYW B;  2LWP A;  1H4R A;  3QWZ B;  2I1K A;  4DXA B;  2ZCC A;  1GJZ A;  2MWS B;  2MBQ A;  3TBL D;  1WRD B;  3N32 A;  3KUZ A;  3QAQ A;  2I1J A;  3L10 B;  3H1U A;  2C7H A;  2M4N A;  4KDI C;  4DDG D;  2R2O A;  1ZW7 A;  3OAW A;  3PRZ A;  5D6J B;  1UD7 A;  2AWT A;  4GN1 A;  2KDF B;  3ENE A;  3ZNI D;  3ZNZ B;  3DQV A;  3ZDM C;  3ECI A;  4CHK A;  1XD3 B;  1I35 A;  2KZR A;  4MEM A;  3RUL A;  2J0K A;  4MDK E;  4W9F A;  5J2R A;  3HK0 A;  4DHJ B;  1L2N A;  3DVG X;  3VVW B;  4IUM B;  1UBQ A;  4IC7 B;  4WWN A;  2KC2 A;  2KC1 A;  4IM3 A;  1IYF A;  3IFW B;  3NY5 A;  4I6L B;  4CYE A;  3PGE A;  2DYO A;  5J17 A;  4JGH B;  3VUW A;  3DBS A;  4XC2 A;  1TZ1 A;  2KTR A;  3NHE B;  1P3Q U;  4MGK E;  4HK2 A;  5G55 A;  4FJV B;  2CHZ A;  2GOW A;  1NDD A;  2LJ5 A;  2K39 A;  4FHJ A;  3X23 A;  3NOB A;  3APF A;  3D32 A;  3ZLZ A;  3QX1 A;  4CO7 A;  1WXV A;  3IG3 A;  1S1Q B;  4ANV A;  3PHW B;  4HLE A;  5BO4 B;  1P1A A;  1OEY J;  4MJS B;  4MJS A;  1BT0 A;  4NNJ B;  4GDK B;  4A20 A;  3L13 A;  2MQJ A;  3ZUN A;  4ZRI A;  2A5U A;  3A9K A;  5DCN A;  3A9K B;  4ICU A;  4B95 A;  1I42 A;  2N1W A;  4FHK A;  4NPN A;  1WFY A;  4G11 A;  3H7S A;  3UF8 A;  5LLI A;  1ISN A;  4EZL A;  1Z5S B;  2LZ6 A;  1E8Z A;  4RM8 A;  2CU1 A;  3KVF B;  3QHT A;  5LXI B;  1V81 A;  4GB9 A;  1WJU A;  3DBR I;  1E8X A;  2L3Z A;  4HJK A;  1EF5 A;  3AXC A;  4NAW A;  2KWV B;  1OTR B;  2ZZP B;  4BVU C;  2K6D B;  3DCG A;  3ZRF A;  3BIN A;  3R3M A;  3AI5 A;  4JLC A;  3CMM B;  1EO6 A;  1LM8 B;  2MLB A;  2D2Q A;  2MX2 A;  2KX3 A;  2L05 A;  4JL9 A;  1GG3 A;  3PZD A;  4IWO A;  4LDT D;  3VQI A;  2WX0 A;  4FJZ A;  4KZC A;  2CKH B;  2OOB B;  2RD0 A;  2KMA A;  1WF9 A;  4EKU A;  2KXJ A;  2BYE A;  2J7Q B;  2BF8 B;  2MSE D;  2JXX A;  2R2Q A;  4TQ1 A;  3WAL A;  4URK A;  2Z0E B;  5LXH A;  1J8C A;  4GSW A;  2N7E A;  1FXT B;  1V2Y A;  3JSV A;  3JSV B;  4BKS A;  4AJW A;  5L83 A;  4G50 A;  1WE7 A;  3EEC A;  3M63 B;  4XZ4 A;  3W1Y A;  1V5O A;  3R7Q A;  2ZVN A;  2BYF A;  1WM2 A;  1A5R A;  3DVN U;  4ICV A;  2ZJD A;  4GXB A;  3RZF A;  3Q3F A;  1LQB A;  4MH0 E;  2V1Y A;  4HXD A;  1WJN A;  2KTF A;  4K81 A;  2EKE C;  3MJW A;  4W9L A;  1UH6 A;  3NZS A;  2KFK B;  1L7Y A;  2KDB A;  4ASW C;  5KHO A;  2AEH A;  4FBJ B;  3O65 B;  2KDE B;  5HKH A;  1WJ6 A;  3VHT C;  4YL8 A;  4EZK A;  4GDL B;  2G3Q B;  2DAF A;  3ZKJ C;  1J19 A;  4GU2 A;  3B08 A;  2AYO B;  2RPQ A;  3R66 C;  5D94 A;  1VCB A;  3ONS A;  3L16 A;  2D07 B;  2KKC A;  2D11 A;  2IY0 B;  2O6V A;  2LXA A;  3X0W A;  1UZX B;  1KJT A;  2UYZ B;  2MBH A;  2PE6 B;  4WJP A;  1EUV B;  4HDQ A;  2FAZ A;  3VXW A;  1K8R B;  2ZVO A;  2MBB B;  3PRM B;  1TTN A;  3IVF A;  1Y8R C;  2FCN A;  2KJ6 A;  2KTR B;  3PS6 A;  2MCN B;  3V6C B;  3WAP A;  1Z2M A;  2NR2 A;  2HD5 B;  3HM6 X;  1Q1O A;  2W9N A;  4AWJ A;  2DZI A;  2ZNV C;  5CX3 A;  4A3O A;  3T8M A;  4HVB A;  1IP9 A;  4FA6 A;  2AL6 A;  2ZCB A;  2V3S A;  2HJ8 A;  4OVU A;  3WIM A;  1TGZ B;  2NPT B;  5E6N A;  5DPW A;  3KUC B;  2RSU A;  2WX1 A;  1Q0W B;  1YD8 U;  2MRP A;  3MHS D;  1S3S G;  2G4D B;  2MP2 A;  3L54 A;  2ZPY A;  4MEL A;  1E90 A;  4HCP B;  3SHQ A;  2J0J A;  4W9C A;  3TCA A;  3TL5 A;  2DEN B;  4E71 A;  2NBV B;  4DHJ D;  2LVQ A;  1GUA B;  1NI2 A;  3N30 A;  4EEW A;  4FUL A;  5J18 A;  3JYU A;  2M0X A;  3LDZ E;  4W9D A;  3RUI B;  2KFJ A;  2O6V D;  1P98 A;  4IM2 A;  4GMV A;  2LGY A;  1P0R A;  1KLV A;  3KW5 B;  3VFK A;  2KLC A;  1C1Y B;  2IY1 B;  2JUO A;  2M1M A;  3H6N A;  2D3G A;  3QA8 A;  4NJ6 A;  2K6Q A;  1V80 A;  2QHO A;  5CHV C;  2JVC A;  2KVR A;  2N9X A;  4WWP A;  2IO0 B;  3QC8 B;  1V9J A;  4MGY E;  3ZNH B;  3ZW3 A;  1E8W A;  3H7P B;  3ML9 A;  3DVG Y;  2HE7 A;  3C0R B;  3PT2 B;  4BBN C;  3M62 B;  2JRH A;  5CTR C;  2MBE A;  4OVV A;  5L95 C;  2NPT A;  1WGH A;  4BOS C;  1GC6 A;  4F1S A;  2LXC A;  5IAA C;  2N1V A;  4ZDV A;  2KJR A;  5C1Z A;  4GDK A;  3ZTC A;  2J0M A;  5C23 A;  3L08 A;  3NZU A;  4AOF A;  4DK5 A;  1YIW A;  3A9J B;  4BKS D;  3V61 A;  3U30 A;  4IG7 B;  2IZV B;  4IM0 A;  2WYQ A;  4EOY A;  3W1S A;  2EMT A;  4DHZ B;  3PPA A;  4DWF A;  4BKG A;  3APD A;  4K1R B;  3AU5 A;  4M0W B;  4MSM B;  2MBO A;  2K8B A;  3DVN V;  3SU8 X;  3NS8 A;  4MGZ E;  3VH3 B;  3T9L A;  2XK5 B;  1WMH B;  1WMH A;  1G6J A;  5TR5 A;  4DBG A;  1M94 A;  1YX5 B;  2IBI B;  4WQO B;  5AZH A;  2LRW A;  1WIA A;  1YJ1 A;  2DYM A;  2FUH B;  3QJZ A;  4K7W A;  3RZW C;  3A1Q A;  2RR9 A;  2GBR A;  3QCA A;  1WGR A;  3S2A A;  3VTV A;  1XT9 B;  2JZZ A;  2YLM A;  3LJ3 A;  2CHW A;  1R4M I;  1E7V A;  2KX0 A;  2DYB A;  4BOZ B;  2LVP A;  5G2N A;  2G45 B;  1WX8 A;  2Z0D B;  2L76 A;  4PS8 A;  1UGM A;  3SDL C;  2HTH A;  3HIZ A;  3WAM A;  4AP4 C;  1V49 A;  4LJP B;  2XEW A;  2CHX A;  2NCN A;  2K8H A;  4NY0 A;  2LGD A;  1E7U A;  2KAN A;  3UIO B;  2DX5 B;  4KSL C;  3ZDT A;  2NBU A;  2XBB C;  1TBE A;  2C7M B;  2FCM A;  3N3K B;  4KVG B;  3A33 B;  3OJ4 B;  2KQS A;  2PE9 A;  3UGB B;  4B9K A;  1YQB A;  2MW5 A;  5JZE B;  1H8C A;  2KFK A;  2K25 A;  3V6E B;  2GBJ A;  2XK5 A;  4LDT B;  2LAS A;  3RYT A;  2DAJ A;  4HPL B;  3CST A;  1WR6 E;  1F9J A;  2DHZ A;  4GIV A;  5DPR A;  4K7U A;  2KO3 A;  3PLV A;  1E5W A;  5DPS A;  1OQY A;  1XQQ A;  5AEK B;  2M8S A;  5IA7 A;  3VTW A;  3APC A;  2PEA A;  3JVZ X;  3L0W B;  3QAR A;  3QQ8 B;  4PS3 A;  4GGQ A;  5DPT A;  2KJH B;  3VAW A;  3PHX B;  4II3 B;  5AZF A;  4DDI D;  4BBN F;  1YX6 B;  1E8Y A;  2L8J A;  2N9E B;  2UWQ A;  3VUY A;  3DOW A;  2KD0 A;  3MTN B;  2JZ3 B;  2LI5 A;  1LFD A;  1C3T A;  4NQL B;  4M8M A;  4LJO B;  2IO3 B;  2N4F A;  4HCN B;  4DHZ E;  4EUT A;  2YVC A;  3ZIM A;  4E3C A;  5AZG A;  5GMV A;  2FCS A;  3PV1 A;  3RT3 B;  4F7Z A;  3A4R A;  3ZRC A;  2FNJ B;  2N7D A;  3DPD A;  5D7G A;  2KN5 A;  2WWZ A;  1GNU A;  1OGW A;  2WDT B;  4FN2 A;  3VUX A;  5JH5 C;  1R4N I;  3OLM D;  4F8C B;  4HWI B;  5EDS A;  1WY8 A;  4LCD E;  3I3T B;  1WZ0 A;  2JWZ A;  2KHW B;  3BY4 B;  4IWQ A;  2NBW B;  3EC8 A;  3PRE A;  4NJ7 A;  3M3J A;  2LUE A;  4ZRK A;  4IW0 A;  4X57 B;  3V62 A;  1MG8 A;  2ZPN A;  3HM3 A;  1CMX B;  1WX9 A;  2LGX A;  4KDL B;  2JF5 A;  4AJY B;  3KYC D;  4W9G A;  1WM3 A;  4E74 A;  4W9I A;  4MSQ B;  2JPH A;  3R7R A;  1RRB A;  4RMA A;  3VH4 B;  2GMI C;  4WJQ A;  1UEL A;  4KV2 A;  3KYD D;  3WAO A;  3PRP B;  4II2 B;  3SD5 A;  3A4S C;  4ANU A;  2CS4 A;  5E6P A;  1WXS A;  4HDO A;  2BGF A;  3ALB A;  1IPG A;  1UBI A;  2BWF A;  2N9P C;  1WXA A;  2L0F A;  4A3P A;  2GBK A;  3Q3J A;  2LVO A;  3V60 A;  3UIP B;  4KSK C;  4G0N B;  2LRU A;  4ANX A;  4FAD A;  1WGY A;  2PJH A;  4BFR A;  3KUD B;  4KZ0 A;  3PVL A;  5CHF A;  4W9H A;  4TQ0 A;  2FCQ A;  1QZE A;  1SIF A;  3GZN I;  3K9O B;  1SE9 A;  4BKT A;  3ZTD A;  2B3A A;  4GDL A;  3AU4 A;  4PS7 A;  2EMS A;  2KNB A;  3A1Q B;  4B6W A;  3H7P A;  2C5L C;  2L7R A;  2C9W B;  2MP2 B;  4I6P A;  4XX5 A;  4TKN A;  1U4A A;  3P2B A;  2C7N B;  3ML8 A;  1V86 A;  2REX A;  2RGF A;  1P9D U;  4JQW C;  1OEY A;  1WZ3 A;  2K8C A;  5FR6 A;  3VTU A;  1ZGU B;  2ZEQ A;  3TIX A;  3TJP A;  3U8Z A;  1RLF A;  1WI0 A;  2KWU B;  4G3X B;  3PLU A;  3UIN B;  3WAN A;  3L17 A;  5KHQ A;  3RD2 A;  1ZKH A;  1NBF C;  4I6N B;  2L0T A;  1X1M A;  4K7S A;  4ANW A;  2KLG A;  4NAW B;  2AL3 A;  2DZM A;  4M8N A;  3GOE A;  1T0Y A;  4AUQ C;  2IYD B;  4EFO A;  1KOT A;  3EFU A;  2KMC A;  2NS5 A;  2G4S A;  2PPH A;  3KH0 A;  2BKR B;  2JT4 B;  2GBM A;  2D10 A;  2KDI A;  2KK8 A;  2DZK A;  3AUL A;  4EZJ A;  4ZYN A;  4GOC A;  1RFA A;  4MM3 A;  2ZNV B;  4ZRJ A;  1JRU A;  1AAR A;  3DBH I;  3K9P B;  4JIO U;  1KM7 A;  3DBL I;  5E6O A;  1VD2 A;  2FIF A;  4TV3 A;  2A4Z A;  2BYV E;  4J6I A;  3M95 A;  1GC7 A;  4PYZ A;  1HE8 A;  3B1L X;  2JRI B;  2O2V B;  5JHB A;  1WGG A;  2C60 A;  2M17 A;  1Q5W B;  3A9J A;  2O6V B;  4NQK E;  3QK0 A;  2KOX A;  2KQ7 A;  3UQB A;  3IBE A;  1WGD A;  3QIJ A;  3CF6 E;  2OJR A;  3CSF A;  3ZVV A;  4IWP A;  2ASQ A;  1WH3 A;  4FJY A;  1D3Z A;  3U7D A;  4WWO A;  3VDZ A;  4RM9 A;  2LD9 A;  4WJO A;  3H9D A;  2IO2 B;  3PSE B;  2CR5 A;  2Z59 B;  1RAX A;  2KWC A;  1WJ4 A;  2GBN A;  1WX7 A;  4MGI E;  4WAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...