2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
2Z0EB 2NPTB 4E71A 1YD8U 1G6JA 4MSMB 3PHWB 3JVZX 1NI2A 4FBJB 5IA7A 3ONSA 4ZRIA 4AOFA 3NHEB 5D2MB 2K8BA 2Z0DB 1XD3B 3WAPA 2LGDA 2KX0A 2ZEQA 3UINB 2MP2A 4ASWC 1WJ6A 3TCAA 2OJRA 1OEYA 2D2QA 2L0FA 2FUHB 4AWJA 1WXSA 3QQ8B 4HK2A 4LCDE 4NQKE 4LDTB 4KSKC 2W9NA 1IP9A 4PYZA 2DYBA 3GZNI 1TTNA 2N1WA 4OVUA 4ANWA 2KFKA 4GSWA 4FA6A 1TGZB 4DWFA 4I6NB 4ICUA 2CHXA 2WX1A 1Q1OA 4KDLB 4IM2A 4RM8A 5D94A 3Q3FA 3KUZA 5LXIB 4WWNA 1WH3A 2KTRA 4KZCA 3TMPB 2MLBA 2IY1B 2N9EB 2L05A 4AJYB 2DAFA 2NS5A 1WI0A 1MG8A 1E8YA 2GBRA 1ZGUB 4GIVA 2NCNA 1IPGA 1TBEA 3H9DA 2M8SA 2LUEA 3AXCA 4DHZB 4W9KA 2C60A 2MBOA 4BBNF 5KHQA 4M8NA 4II3B 5CHFA 2KJHB 3A4SC 1UELA 2JRHA 3SHQA 1WY8A 1P9DU 5TR5A 4N9F4 1YJ1A 4ZYNA 4IM0A 3IG3A 1WIAA 4W9FA 1WMHA 3M95A 1T0YA 2MW5A 3VUYA 1J8CA 4J6IA 3ZVVA 2LD9A 2NVUI 3QA8A 3DBRI 1LXDA 1E7VA 5EDSA 2J7QB 4HDQA 3OAWA 2KTFA 3M62B 4PS8A 2KHWB 4EOYA 2V4LA 2JUOA 3UGBB 3K9PB 3PTFC 2RSUA 5IAAC 1OEYJ 1EO6A 5G55A 2GOWA 3PLVA 2DZKA 4JLCA 4AP4C 1R4MI 2JT4B 4BOSC 3HK0A 5CHWA 3B1LX 1H8CA 4X57B 2WYQA 3TIXA 2I1KA 3JSVB 3VHTC 3V60A 2R2QA 4ANUA 4NQLB 2KWCA 1WE7A 4FJVB 1S1QB 3V6EB 4ANXA 2K6DB 4KVGB 4MDKE 5C1ZA 4WJQA 3RYTA 5LLIA 2ZZPB 4I6LB 1Z5SB 1J0GA 2D3GA 2O2VB 3ENEA 3PRZA 1V86A 2MX2A 3HM3A 2ZNVC 2BWFA 4WQOB 2FCSA 4IC7B 3TBLD 2FAZA 3ZNZB 4EZJA 2ASQA 2KMCA 2L0TA 3PZDA 2CKHB 4PS3A 4GB9A 2KZRA 3ZTCA 4EKUA 5CTRC 3H7PB 3MTNB 2PEAA 4DHJD 5JH5C 4K7SA 2B3AA 2KK8A 3APDA 4XX5A 3R7QA 3LJ3A 2IO3B 1WGGA 5DPTA 2JVCA 3PSEB 1WZ3A 3V61A 1QZEA 2K6QA 2NBVB 1L7YA 2XK5B 3ML8A 2AYOB 1V6EA 3ALBA 3PREA 4XZ4A 4I6PA 2RR9A 3O65B 2NR2A 1YQBA 3H1UA 4CHKA 1A5RA 3WALA 3ZO5B 4HWIB 5J2RA 3IHPC 1J19A 2EKEC 3NS8A 1NBFC 3ZLZA 5CHVC 3DBHI 3K9OB 4ZRJA 4LDTD 1Y8RC 2D11A 2BPSA 4B6WA 2UWQA 2BWES 2HTHA 1Q0WB 3W1SA 5L95C 3CSTA 3UIOB 2OOBB 2WDTB 4K1RB 1KJTA 3U30A 4GDLA 4W9JA 4WWOA 3ECIA 3MJWA 3QC8B 1R4NI 3QX1A 2N9PC 5JZEB 2MBQA 2KDIA 1WM3A 1X1MA 2FNJB 2KWUB 3R7RA 2M17A 3KVFB 1RFAA 3JW0X 4BVUC 1KM7A 3DCGA 2XBBC 1E8WA 1ZW7A 1E7UA 2PJHA 3A9JB 4FADA 2LGYA 2RD0A 2ZJDA 4G0NB 3UQBA 3VH3B 2MBBB 2J0JA 5AZGA 4JL9A 4GDKB 3WAOA 4DXAB 4F8CB 3KYDD 2D10A 2MA9B 3L08A 1OGWA 4HPMB 1WX7A 2DZJA 2AL3A 3DVNV 4BKGA 2L76A 4CO7A 3WIMA 4KIKB 2J0MA 5L83A 3HIZA 3M3JA 2BYVE 2N9XA 3AU5A 2KDFB 2NBUA 1WJNA 2C5LC 2RGFA 3QK0A 1S3SG 3ZKJC 3UQAA 2BF8B 2AEHA 2JWZA 1LQBA 3VTVA 2JPHA 4HXDA 4NY0A 4AUQC 3RT3B 3HHMA 3JYUA 4TQ1A 2LZ6A 2PE9A 4JGHB 2ZPNA 2LWPA 2O6VB 2LVPA 2V1YA 4ZRKA 2CS4A 2GBKA 1GG3A 3ZDTA 3KYCD 1ZKHA 2I1JA 1E90A 2ZVOA 4RMAA 4NAWA 2MBHA 2EMTA 2C7NB 3B08A 3PHXB 2DX5B 4GU2A 4NPNA 1AARA 4DK5A 4FHJA 3ZNHB 1U4AA 1YX6B 4GN1A 2LVOA 3DVGY 4KSLC 2FCMA 2N1VA 1GC7A 2XEWA 1GJZA 3W1YA 3SD5A 4G3XB 2AL6A 2KJRA 4GMVA 2PPHA 3KW5B 3RULA 3WAMA 3VAWA 4A20A 4MJSB 3PLUA 4GOCA 3ML9A 4IWOA 3VQIA 1WYWB 2KO3A 4E3CA 2KD0A 1L2NA 1WX9A 2ZCBA 4B9KA 1WX8A 3NZUA 3CMMB 1LM8B 1GUAB 2ZCCA 4W9CA 1K8RB 3RZWC 2ZNVB 3A9KA 4YL8A 1WGRA 1UH6A 1WJUA 4E74A 4W9EA 2LRUA 3A1QA 1I42A 4EFOA 3CSFA 4II2B 2L7RA 4G11A 2NPTA 3ZW3A 2BYFA 4ICVA 3APCA 4RM9A 3QIJA 2C9WB 3L0WB 3X0WA 2LXCA 1P1AA 2BKFA 4NNJB 2K1FA 3NZSA 4DDID 2IO2B 4W9LA 3CF6E 2KLCA 4MM3A 3PV1A 4M8MA 2ZPYA 2D07B 3SU8X 1TZ1A 2DHZA 2RPQA 2K8HA 4XC2A 4B95A 4FJZA 3RD2A 4F1SA 2KLGA 2KQSA 4W9DA 5HKHA 1VD2A 2KFKB 3L16A 3TJPA 3L54A 2G3QB 1EUVB 4FHKA 3VUXA 3A4RA 2CHZA 5C23A 3U7DA 1LFDA 2MBEA 3KUDB 2KVRA 2KTRB 4HVBA 4MELA 3GOEA 4M0WB 2KFJA 2JY6A 4WWPA 1WRDB 3T9LA 3VDZA 1RRBA 3ZRCA 1UZXB 4WJPA 4FULA 3WA0A 1M94A 2WX0A 2M0XA 4K7UA 5JHAA 3KH0A 2KX3A 1NDDA 2G45B 3ZNID 2IY0B 1C3TA 4HLEA 1WMHB 2KWVB 3C0RB 3NY5A 4IM3A 2K25A 3EFUA 2EMSA 3DVNU 2DZMA 5CX3A 2IYDB 1Q5WB 4PYUA 4EZLA 4KZ0A 1EF1A 2FIFA 1XT9B 2LRWA 3DBSA 4IW0A 4FLHA 1SIFA 4HCNB 3QAQA 1UGMA 1WXMA 3D32A 3BY4B 3QHTA 4FJYA 2KJ6A 4MH0E 3UIPB 4K81A 4BKSA 4DHZE 1GC6A 4MGYE 4GXBA 3IBEA 3WANA 4MEMA 2KXJA 2IZVB 3R3MA 2O6VD 2YLMA 1GNUA 4DHJB 2HD5B 4BKTA 3EC8A 4HDOA 4P7IA 2GMIC 3JSVA 2AWTA 1WFYA 4BOZB 2IO1B 3QARA 3DVGX 2LJ5A 2C7MB 3IFWB 3VUWA 4EZKA 3OJ3A 2J0KA 4OVVA 3RZFA 1V5OA 4W9IA 3ZNGC 2M4NA 3PGEA 2N4FA 4IWPA 3AULA 1RAXA 3UF8A 3VTUA 1I35A 1E8XA 2WWZA 2MWSB 1P0RA 4BKSD 2O2VA 3SDLC 4FN2A 1WR6E 1P3QU 3EHVA 2VRRB 1UBIA 4EEWA 2DENB 3PPAA 5DPSA 4HJKA 1YIWA 4JQWC 3AU4A 2KN5A 5DPWA 1SGHA 2BKRB 4LJOB 3VFKA 2DZIA 3PRPB 4IG7B 1KOTA 2JRIB 1WJ4A 2KMAA 4DBGA 3M63B 3ZIMA 3H7SA 3H7PA 2K8CA 2GBMA 4GGQA 4A3PA 1KLVA 5JHBA 4A3OA 2LVQA 1Z2MA 3AI5A 5E6OA 3U8ZA 4K7WA 3DDCB 5G2NA 2C7HA 2G4DB 2CU1A 2A4ZA 2MRPA 3OJ4B 3HM6X 1OTRB 2XK5A 2CHWA 5J17A 2KOXA 3L17A 2DYMA 2QHOA 2R2OA 5GMVA 2IBIB 1FXTB 1JRUA 2Y5BB 2KDEB 4EUTA 5DPRA 2KANA 2YVCA 1WR1A 3P2BA 2L3ZA 3A33B 4TUUA 3V6CB 1WXVA 3TL5A 4NJ6A 1WF9A 4ZDVA 5BO4B 3EECA 2UYZB 4BFRA 4URKA 2KQ7A 1H4RA 3OLMD 3X23A 3VTWA 5LXHA 3N32A 2K39A 2BGFA 3VXWA 2DAJA 3T8MA 2ZVNA 4GDLB 5AZFA 2KC1A 1WXAA 3V62A 1P98A 2Z59B 3N30A 5D7GA 3ZRFA 1E8ZA 2GBNA 3H6NA 4HPLB 2MP2B 4IWQA 5FR6A 4W9GA 5AZHA 1HE8A 2KNBA 3PVLA 4MGZE 5D6JB 3A9JA 1ISNA 2PE6B 3L13A 3W1SC 2JF5A 3L10B 2LXAA 4BBNC 2JZZA 2L8JA 2HJ8A 2MSED 1IYFA 3BINA 5E6PA 4GDKA 2DYOA 2REXA 1WGHA 4DDGD 4KV2A 3Q3JA 2LI5A 3DPDA 1XQQA 1WGDA 4KDIC 1V80A 3KUCB 4KIKA 2L00B 3DQVA 3PS6A 2GBJA 1C1YB 1UD7A 1RLFA 3LDZE 4LJPB 2MCNB 2CR5A 4JIOU 3APFA 3PRMB 3VH4B 2KKCA 1V49A 4NJ7A 4G50A 3R66C 1WGYA 3NOBA 1F9JA 5J18A 4MGKE 3ZDMC 1D3ZA 1YX5B 1V81A 2O6VA 3DBLI 5KHOA 1V9JA 4MSQB 2N7DA 1CMXB 1V5TA 3MHSD 3QJZA 4ANVA 2IO0B 2KC2A 3DOWA 2JXXA 4W9HA 4NAWB 1WE6A 3B0AA 3ZUNA 1WZ0A 1UBQA 2M1MA 1EF5A 2A5UA 2BYEA 2NBWB 2V3SA 1PQSA 2HE7A 2JZ3B 4AJWA 1VCBA 3RCZA 3ZTDA 1BT0A 1SE9A 4IUMB 4HCPB 2FCQA 4CYEA 2KDBA 3IVFA 3QCAA 2G4SA 4WJOA 3RUIB 1E5WA 4TQ0A 3S2AA 3VVWB 4MGIE 2FIDA 4MJSA 5AEKB 2N7EA 2LGXA 3PT2B 5DCNA 1OQYA 3I3TB 4WAAA 1WM2A 3N3KB 2MQJA 4TKNA 4WJNA 1V2YA 2FCNA 4TV3A 3A9KB 3QWZB 5E6NA 4F7ZA 3A1QB 4PS7A 2LASA
chains in the Genus database with same CATH superfamily
2HDEA 4E71A 1YD8U 3LB8C 5IA7A 4FBJB 5D2MB 2K0PA 3UINB 4MM3B 2MP2A 4ASWC 3TCAA 2OJRA 1OEYA 2D2QA 4LCDE 3KWVA 4LDTB 2W9NA 2M56B 2N1WA 3FKYA 1K51A 1TGZB 1D5XC 5BYSA 4P1CC 4IM2A 2IJ0A 2QILA 2OHFA 5D94A 3Q3FA 1WH3A 4KZCA 2IY1B 1MI0A 3H8HA 2KAJA 2DAFA 1EWCA 2YEPF 1CZPA 4RGNA 1E8YA 2GBRA 2VZKB 1IPGA 2LUEA 1XCTL 4RGTA 1WY8A 5TR5A 1PGAA 3IG3A 2MW5A 3VUYA 1J8CA 1WSPA 1TYGB 3AE5B 1LXDA 2J7QB 3FILB 2W82A 3PTFC 5IAAC 1OEYJ 4AP4C 3CWIA 1R4MI 2JT4B 3HK0A 1SIJA 4X57B 2WYQA 3MC8A 3TIXA 3JSVB 3IXSA 2LGIA 2R2QA 2WLBA 2KWCA 1XLPA 3EUB2 2K6DB 4TSSA 5IKCM 1MG4A 1N62A 3RYTA 2DWQA 2ZZPB 4HRSA 1Z5SB 4I6LB 1J0GA 1J7AA 3ENEA 2BTEA 3HM3A 2LUMA 2ASQA 4LK0M 3P4RB 4PS3A 4EKUA 3H7PB 4DHJD 2PEAA 4C00A 4K7SA 5FK9C 1V8CA 3PSEB 3V61A 1QZEA 1GB4A 3NJTA 2NBVB 2XN9C 2AYOB 3ALBA 4XYCA 2NR2A 2PVOD 4ZHPA 5J2RA 3IHPC 3NVZA 1J19A 1I4PA 5CHVC 3DBHI 4RCOA 3K9OB 4LDTD 1N5WA 1J7BA 2BW2A 2BPSA 2PLPA 1CQVA 2AQ3B 1FM0D 2L83A 1AN8A 2RDHA 3W1SA 3UIOB 1B9RA 2KQ4X 3QC8B 2MBQA 2KDIA 1VR9A 2XBBC 1E8WA 2VZKD 2PJHA 3A9JB 1GOZA 2WQYB 4LNNA 3Q8CA 2MH7A 2MBBB 3KYDD 2MA9B 3L08A 1SJHD 3HVZA 2AL3A 4R3DA 1WWTA 3AEAB 2J0MA 2BYVE 2N9XA 3ZKJC 3UQAA 2RGFA 1LQBA 1N5XA 4OZCA 4PK1A 3JYUA 2V0GA 4HKQA 4DXGA 1HA5A 3KYCD 3AE4B 2BS2B 2ZVOA 1LO5D 3BYYB 2EMTA 3RNEC 2DBYA 2GRIA 2LVOA 2N1VA 4MH8A 4NZLB 2XEWA 1GJZA 1Y56A 4WIPA 4YTNB 1I4GA 3RULA 3BIID 3WAMA 4A20A 3VQIA 1L2NA 4E3CA 1K53A 2K5PA 1SJED 2ZCBA 4B9KA 3CMMB 2CJNA 1XLQA 2D3BA 4E74A 4W9EA 3N1XC 4EFOA 4II2B 2BBCA 1EU3A 4G11A 4P16A 3ZW3A 4RGOS 1I4RA 1MHXA 2C9WB 1QOAA 3X0WA 3P42A 1P1AA 4NNJB 4MM3A 1TZ1A 2D3AA 2DHZA 4B95A 1QF6A 1VZ8A 4ZHOA 1ZXHA 3NVYA 3L16A 1ESFA 3TJPA 4OW0A 3U7DA 4NAMA 2KTRB 4MELA 1QILA 4M0WB 2KFJA 3T9LA 1F1HA 2M0AA 3ZRCA 3KH0A 5C3JB 3I5JC 1C3TA 3ZNID 1QQRA 2KWVB 4IM3A 3C0RB 4P6VF 5CX3A 2W55A 2FIFA 1XT9B 2LRWA 2WU2B 3U52E 4JPSA 1SIFA 4HCNB 1UGMA 3KWLA 3T3NA 4XDDA 4K81A 3FILA 4MGYE 3AEFB 1L0VB 2MJ3A 4MEMA 1AWDA 4HPPA 1RM6C 4A9AA 2PIAA 3NUHB 4BKTA 4HDOA 4P7IA 3JSVA 2IGHA 4BOZB 3DVGX 4M00A 2WXNA 3VUWA 1UGJA 1QOGA 1V5OA 4IWPA 4CQNA 2LHDA 2WWZA 2MWSB 2WGSA 1P0RA 4FN2A 3EA6A 2KT7A 3BVMA 4JQWC 3AU4A 2KN5A 1XLNA 1L6VA 3VFKA 2DZIA 3PRPB 1KOTA 3H7PA 1E0ZA 5GXGB 4O1NA 2GBMA 1KLVA 5JHBA 1WGKA 3CIRB 2INPE 2G4DB 3OJ4B 3W2DA 2LGSA 4H2AA 2KOXA 3TEZA 2DYMA 3J9CA 3AB5A 2Y5BB 5IN7A 3P4QB 1R4NB 3P2BA 2L3ZA 4LNIA 1TJEA 4TUUA 4YSYB 3TL5A 5BO4B 3AMZA 2UYZB 4BFRA 1NEKB 3SFDB 2WXLA 3ETRA 3X23A 2AQ1B 3VTWA 2BVCA 5LXHA 3MJ5A 2VH2A 3E9SA 2DAJA 4KGRA 4UDUC 3V62A 1J7CA 4ARIA 3ZRFA 1E8ZA 4HPLB 3ZXRA 2MP2B 4IWQA 1FRDA 1YQ3B 3W1SC 3A9JA 2PE6B 1L4ZB 2L52A 4RFBA 2HJ8A 1WGHA 1SE3A 3Q3JA 2LI5A 3AN1A 1XQQA 4KDIC 3DQVA 1RLFA 3BYTB 2MCNB 3C19A 3APFA 1V49A 2BS4B 1F0ZA 3PZ7A 1FXAA 1CMXB 3MHSD 2KC2A 3ZUNA 3AE3B 1N63A 3Q8EA 1DOIA 2JYEA 2JZ3B 1ZXIA 1V1OA 3MC0B 1D4BA 3DHIC 3IVFA 4CYEA 4Q2JA 1T5XD 3VVWB 5EE1A 2FIDA 1WXQA 2LGXA 1OQYA 3I3TB 4WJNA 1WM2A 3NZ3A 4TV3A 4L1BA 5E6NA 3QAQA 3A1QB 2E6XA 1G6JA 4MSMB 1OFFA 3JVZX 1NI2A 1YQ4B 4AOFA 1XD3B 3WAPA 5G5HA 2LGDA 2FBWB 2FUHB 3QQ8B 4HK2A 3BK1A 4KSKC 2DYBA 3GZNI 4ANWA 2UU7A 1FNWA 1MJDA 4GSWA 4B0MA 4DWFA 4I6NB 4ICUA 1T3QA 1Q1OA 3W5VB 3RI7C 3KUZA 1P7FA 4WWNA 3Q3OC 2KTRA 2N9EB 4M0WA 2JSVX 2EKIA 2NS5A 4JWSC 3AE9B 1ZGUB 4GIVA 1SE4A 3H9DA 2WNMA 3HUIA 4W9KA 4BBNF 4M8NA 5CHFA 3A4SC 2JRHA 3SHQA 2Y5PA 1YN5A 1YJ1A 1WIAA 4W9FA 3IAM1 1P7EA 1KH0A 5FKAC 2NVUI 3DBRI 1E7VA 2MEKA 5IOIA 3AE8B 2V4LA 2JUOA 3K9PB 2RSUA 2GOWA 3PLVA 2DZKA 1NENB 1H8CA 2WU5B 2I1KA 2WXGA 1WE7A 4FJVB 1HTQA 2JWUA 4ANXA 4S0RA 4KVGB 4B0EA 2Q5WD 1TY0A 1C9FA 1QOFA 4YTMB 2MX2A 2ON8A 1SSNA 4IC7B 5H92C 4EZJA 2KMCA 2LMCA 1B1ZA 4DQOC 3TEWA 2L1AA 3ZTCA 4P1BC 4ZRPA 5JH5C 2B3AA 2E3TA 3FC4A 3SR6A 3APDA 3R7QA 2IO3B 1WGGA 4REZA 2SEBD 1WZ3A 3NS1A 1YN3A 2RR9A 2QC8A 1YQBA 3H1UA 1A5RA 3AM9A 3HRDD 1JCKB 1EWYC 2EKEC 1NBFC 3ZLZA 1VRAB 4ZRJA 1QT9A 2D11A 4C56C 2QJLA 2B76B 1C79A 1I4QA 4YWGG 2OOBB 1RYJA 4WWOA 4W9JA 1R4NI 5JZEB 1TIFA 2GI9A 2HTME 1FCCC 1KM7A 3DCGA 2K22A 2BT6A 2LGYA 3HVDA 3W9CB 2ZJDA 1HZ6A 2Z8LA 4JL9A 4GDKB 3WAOA 1WX7A 3DBLB 2L76A 4XE0A 5L83A 2KDFB 2G1EA 4YXDB 3O13A 2BF8B 1XF5L 4XWWA 4PT5A 4HXDA 1VZ6A 2O6VB 4ZRKA 1STEA 1N60A 1PDXA 3AEDB 3AEGB 4RMAA 2MBHA 2C7NB 3B08A 4GU2A 1AARA 5I4DA 2WXPA 3ZNHB 1U4AA 4GN1A 1T0QC 3DVGY 4G3XB 2KJRA 4GMVA 2J42A 3KW5B 2INDC 1TKGA 4MJSB 3BVZA 2QCZA 1WX9A 2INNE 5FR3A 4W9CA 2ZCCA 2BS3B 1QLBB 4YL8A 1WGRA 1UH6A 3LYYA 2KWDA 2LRUA 3A1QA 2L7RA 2BYFA 3APCA 1KLGD 1TKEA 3L0WB 3MFGA 2LXCA 3NZSA 1XXGA 2IO2B 2KLCA 1XCQL 1YMHE 1VD2A 2KFKB 4L23A 2WDVB 2WXJA 1KTKA 3A4RA 2WXOA 2CHZA 1LFDA 4JX1C 3KUDB 2KVRA 1BMLC 2JY6A 1WRDB 3VDZA 1RRBA 5HI1A 2HJ1A 3WA0A 2RPVA 5JHAA 3LXFA 4K3CA 1HTOA 1TY2A 2EMSA 2QDFA 2DZMA 2IYDB 4EZLA 4KGTA 4IW0A 1M4VA 4KKIA 3D32A 3UIPB 4MH0E 4BKSA 3IBEA 3WANA 3U7ZA 1UWXA 2O6VD 1GNUA 2HD5B 3L4PA 2V3PA 3WCQA 1SEBD 2GMIC 2AWTA 3AV8A 2LJ5A 2C7MB 3IFWB 4W9IA 4RGMA 3ZNGC 3VTUA 4AS1A 3SDLC 1P3QU 3EHVA 2VRRB 4IKGA 1K50A 2DENB 3DHGC 3PPAA 4XDCA 3VRBB 4EEWA 1TS2A 1AW7A 3V05A 3H7SA 4J3OD 2JQRB 1VDVA 2RDBC 2Y5CA 3DDCB 4YT0B 5G2NA 2CU1A 2MRPA 4RH6A 5G5GA 1OTRB 3RMKC 2V9HA 3L17A 1FCLA 1L6UA 2QHOA 2R2OA 5GMVA 2IBIB 1JRUA 4BZAA 4EUTA 5H8YE 5DPRA 3V6CB 1C78A 1WXVA 4A6QA 4NJ6A 4MT5A 2WXRA 2YEPB 3UI3A 2CJOA 3N20C 2R61A 1H4RA 3OLMD 5D3IB 4MACA 2K39A 2BGFA 1JWUD 2Z59B 5D7GA 4HKZE 2V4IB 3VR9B 1JWSD 1UF0A 2KN4A 3NRZA 4MGZE 3L13A 4HEA1 2JZZA 2L8JA 3AE2B 3SFEB 1WYGA 4GDKA 2XNAC 3E56A 3PS6A 2WS3B 3B2GA 1C1YB 2INCC 5IO9A 2CR5A 1C4CA 1T6BX 4NJ7A 1WGYA 1F9JA 3DHHC 4MGKE 3ZDMC 2O6VA 3DBLI 4YTPB 4MSQB 3OG5A 1XO3A 1V5TA 2BB6A 3DOWA 1BXTA 3B0AA 4OHJA 1WZ0A 2KACA 1UBQA 2BYEA 3TEXA 2J52A 1PQSA 1KRHA 2FUG1 1BT0A 4HCPB 1C77A 4XWTA 1KLUD 3RUIB 1E5WA 1ZOYB 3S2AA 4MGIE 4MJSA 5AEKB 1FXIA 2N7EA 3P4SB 3PT2B 1OQRA 1FNUA 1V2YA 5EE0A 4F7ZA 2Z0EB 2WDRB 3PHWB 3ONSA 4ZRIA 1HEZE 2M19A 2K8BA 3NHEB 5LNK1 3MHZA 2KX0A 2L0FA 4AWJA 2JXTA 1L5PA 1IP9A 1DOYA 4OVUA 2KFKA 2CHXA 4KDLB 1IUEA 5LXIB 1ZP0B 2MLBA 1JALA 2L05A 4AJYB 2WDQB 3ZJUA 1WI0A 1MG8A 4LTUA 3AXCA 1EU4A 4DHZB 2C60A 5KHQA 2AX5A 4YSXB 4ZYNA 4IM0A 3AECB 3M95A 1T0YA 4LNFA 1UWMA 5MPOA 4J6IA 2LD9A 1SXTA 3QA8A 1JRPA 3EGRA 3AEEB 2GLSA 4EOYA 4GLSC 1VLBA 3AE7B 3UGBB 5G55A 4JLCA 3KQ4A 5EE9A 1L4DB 4BOSC 3B1LX 2KVZA 2PKOA 3VHTC 4ANUA 2NTTA 1JWMD 1V97A 1UUPA 3V6EB 4BAXA 5C1ZA 2G9HD 1E7PB 4WJQA 2ICIA 5LLIA 3NG0A 1JROA 2ZNVC 3TBLD 1NYQA 3MC9A 4RNAA 1YOVB 2CKHB 2PVGC 4GB9A 2BB5A 3SEBA 4C4VB 2KK8A 3Q8BA 3LJ3A 5DPTA 2JVCA 2KMMA 1FNVA 1L7YA 2XK5B 5E6JA 3O65B 4WWMA 2J53A 4CHKA 1RWSA 1QKZA 3P4PB 1Y8RC 1R4MB 3NVWA 4FXCA 4B6WA 3RNBC 2BWES 2TSSA 3CSTA 2WDTB 2KYWA 3Q14C 4K1RB 1KJTA 3U30A 1SB3C 3MJWA 2LJIA 3QX1A 2N9PC 1WM3A 2FNJB 2M17A 1KF6B 1RFAA 1ZW7A 4TMAB 2RD0A 2K9XA 2J0JA 1UNSA 5AZGA 4DXAB 2D10A 4HPMB 1OGWA 2BYTA 5BYQA 3DVNV 4BKGA 4IOIE 3WIMA 1TT5B 2C5LC 1GPXA 2AEHA 2JWZA 3VTVA 2JPHA 1GAQB 3RT3B 3HHMA 2LZ6A 4JGHB 2V1YA 3ZXVA 1FO4A 4USAA 2GBKA 1GG3A 2EELA 3ZDTA 1TKYA 2I1JA 3P1MA 1YJIA 5HFYA 1AYFA 1E90A 3RN9C 3PHXB 2DX5B 2QIEB 4DK5A 2WHIA 1YX6B 1GC7A 2QMTA 4GOCA 1WYWB 1HXYD 2KD0A 3NZUA 1LM8B 1GUAB 3GE3C 2WXKA 3ZJTA 1K8RB 2ZNVB 1I42A 3QIJA 2D5GA 1MPEA 1TS4A 2IGDA 4W9LA 3CF6E 4LLGM 2PMVA 3AE6B 3PV1A 4M8MA 2ZPYA 2D07B 3SU8X 2RPQA 4XC2A 2X38A 2N7JA 5HKHA 4W9DA 2G3QB 5C23A 2MBEA 1D6EC 3B9JA 4XGAB 4WWPA 1C4AA 1ET6A 1UZXB 3BK2A 4KX6B 4FULA 2WX0A 2KX3A 1NI3A 1NDDA 2G45B 3OWEB 4K3BA 4HLEA 1FIQA 1WMHB 5JXVA 5EE3A 2K25A 3DVNU 3BVGA 3DBSA 4NJCA 4FLHA 3QHTA 2KJ6A 4DHZE 4L2YA 4GXBA 1D5MC 3I63C 3I9V1 1ZDVA 3B2FA 3VRAB 2D3CA 1YJJA 2KXJA 3R3MA 5BMHA 2YLMA 4DHJB 3ZQ4A 1L0YB 2IO1B 3QARA 4US9A 4EZKA 2J0KA 4OVVA 1SBBB 2M4NA 2JU6X 1RAXA 1T0RC 1E8XA 4BKSD 1HZ5A 2K3UA 3Q3NC 5DPSA 4HJKA 1SGHA 3Q3MC 4LJOB 1F2RC 4IG7B 4AQ7A 2KMAA 4C80A 4C4VA 3T3OA 4GGQA 2OEDA 2LVQA 1Z2MA 3AI5A 5E6OA 3U8ZA 4K7WA 2LHEA 2C7HA 2A4ZA 4ZYSA 2XK5A 2CHWA 5J17A 3EFCA 1FXTB 3RNCC 1I4HA 2KANA 4ACFA 4ARCA 1L0XB 1WRIA 2YVCA 1WR1A 2ACZB 3IT4B 2Y3AA 3A33B 1LGRA 1WF9A 1JWAD 3ZYYX 3EECA 1XLOA 4OZBA 3VXWA 2ZVNA 4GDLB 5AZFA 2KC1A 3RPFC 1P98A 1KFYB 5BMGA 3H6NA 2GBNA 4RF0A 1HE8A 2KNBA 5D6JB 1ISNA 2DLBA 2LXAA 1IYFA 2MSED 3BINA 1C76A 1FD6A 3DPDA 4A90A 1WGDA 3GB1A 1V80A 1FPYA 2IDYA 2GBJA 1UD7A 1PFDA 4JIOU 1OQQA 3VH4B 2KKCA 4G50A 3NOBA 1NVID 1D3ZA 1YX5B 1V81A 3V3XA 3PZ8A 4ANVA 3QJZA 2JXXA 2LFIA 4NAWB 1WE6A 2AQ2B 1FRRA 3GS2A 3URYA 2M1MA 1EF5A 2A5UA 2HE7A 4AJWA 1VCBA 3RCZA 2W54A 1MVKA 2FCQA 1R7SA 3QCAA 1PGXA 4KKJA 2G4SA 4WJOA 2WXHA 2OJWA 4WAAA 3N3KB 3A9KB 1YNTE 4ZOHC 2NPTB 2Z0DB 2L32A 2ZEQA 3TSSA 1WJ6A 2I38A 1WXSA 4NQKE 4PYZA 2NMQA 1TTNA 3Q2AC 4FA6A 2PW9A 1SE2A 4HJGE 2WX1A 1F52A 4RM8A 4M01A 1N61A 3TMPB 1ET9A 2IGGA 1MHHE 2DNFA 2NCNA 1TBEA 1MFWA 2M8SA 1E9MA 2MBOA 4II3B 2KJHB 1UELA 1SF0A 1E6EB 1P9DU 5AUIA 4N9F4 4YSZB 5HHDG 1WMHA 1CK1A 4D2KA 3ZVVA 3GP7A 5EDSA 4HDQA 3C8YA 3OAWA 2KTFA 3M62B 4PS8A 2KHWB 4EE2A 2VH1A 2RDGA 3DWGC 1PGBA 1EO6A 1HQRD 3FAHA 5CHWA 3Q6BA 4N6EB 3V60A 3ABVB 4NQLB 1S1QB 1Q10A 1NYRA 2H89B 1V1PB 3GZNB 4MDKE 3U4EG 4C7ZA 4RF1A 2SAKA 2D3GA 2O2VB 3PRZA 1V86A 2BWFA 4WQOB 2FCSA 2FAZA 3ZNZB 3RNFC 3N9YC 2L0TA 2I2YA 2JZPA 3PZDA 2N9KA 1ZUD2 2KZRA 5CTRC 3MTNB 2WXFA 2H88B 4XX5A 2N0SB 2K6QA 3ML8A 3PREA 1V6EA 4XZ4A 4I6PA 5TSSA 2QEJC 3DBRB 2X8XX 3WALA 3ZO5B 4HWIB 3NS8A 1JMLA 1DYQA 2ONQA 4ZRQA 1K52A 3R2TA 2UWQA 1ENFA 2HTHA 1Q0WB 5L95C 3BZDB 2CU3A 4GDLA 3ECIA 1X1MA 2RMMA 2KWUB 3R7RA 3KVFB 3JW0X 5T8IA 4BVUC 2W3SA 1E7UA 4FADA 1I7HA 3KLSX 4G0NB 3UQBA 1IGCA 3VH3B 1ZDXA 3Q69A 1DGJA 4F8CB 2J4XA 4M02A 3ZGZA 1FMAD 2DZJA 4CO7A 4KIKB 3HIZA 3M3JA 3RFZB 3AU5A 2NBUA 1WJNA 3QK0A 1S3SG 1T0SC 4NY0A 2WXMA 4JWUC 4AUQC 4TQ1A 2PE9A 2ZPNA 2LWPA 2LVPA 1FFVA 2CS4A 2MJDA 1IBXB 4OVZA 1ZKHA 4HROA 4NAWA 4NPNA 4FHJA 4KSLC 2FCMA 3W1YA 3SD5A 1XEEA 2AL6A 2PPHA 3VAWA 3R2IA 3PLUA 4IWOA 3ML9A 3P63A 2KO3A 3TEYA 1WX8A 4A8XC 2WXQA 3RZWC 3A9KA 1WJUA 3GE8C 2PTLA 3CSFA 2NPTA 4KGSA 4ICVA 4RM9A 1D5ZC 2N9LA 3TUOA 4S17A 2BKFA 2K1FA 4DDID 2JX5A 1TS5A 2WP9B 2K8HA 3U2SC 3AE1B 4FJZA 4OZAA 3RD2A 4F1SA 2KLGA 2KQSA 1F2RI 3L54A 3VUXA 1EUVB 4FHKA 3NVVA 4LNKA 2KDMA 2JYTA 1PUTA 3RNAC 4HVBA 3GOEA 2LEKA 4WJPA 1M94A 2M0XA 4K7UA 2IPKD 2GB1A 4US8A 3W5UB 2IY0B 4A55A 5BMIA 4QAYA 3NY5A 1I4XA 4N59A 3EFUA 1Q5WB 4PYUA 4KZ0A 3AEBB 1EF1A 1FFUA 1IGDA 1WXMA 4FJYA 3BY4B 1FEHA 1GC6A 5D3DA 4N58A 1BUIC 3Q8AA 1CJEA 4IDIA 2IZVB 2WXIA 4DXFA 2MJEA 1GB1A 3EC8A 1TZOA 1QOBA 1WFYA 1ACCA 1JQ4A 3R8BA 3OJ3A 3RZFA 1V1PA 3PGEA 2N4FA 3AULA 3UF8A 1I35A 1ZPSA 2O2VA 3ZJVA 1WR6E 2QSDA 1UBIA 3N1YC 4JE3B 3RNGC 1YIWA 5DPWA 4WAFA 2BKRB 2JRIB 1WJ4A 4DBGA 3BWUD 1C4PA 3M63B 3ZIMA 4C7YA 2K8CA 4A3PA 4A3OA 3DBHB 3IT6B 3HM6X 3Q8FA 1PYWD 1RFKA 5C2TB 2KDEB 5IP4D 1F77A 4ZDVA 3AH7A 4URKA 2KQ7A 3N32A 2V3NA 3VR8B 3T8MA 1WXAA 2BQQA 4LNOA 3N30A 4WQMA 1ZE3D 1ROEA 1DOXA 2MHJA 5FR6A 4W9GA 5AZHA 1TS3A 3PVLA 2JF5A 1YN4A 3L10B 4BBNC 5E6PA 2DYOA 2REXA 1VZ7A 1EM7A 3MP9A 3PO0A 4KV2A 4DDGD 1A70A 3IAS1 3KUCB 4KIKA 2L00B 3LDZE 4WH4A 4LJPB 3PRMB 5HG2A 3R66C 5J18A 5KHOA 1JWBD 1V9JA 1N6ZA 2N7DA 1IBXA 1JW9D 2IO0B 4W9HA 1VJKA 2NTSA 3N1ZC 2ZW1A 2FE8A 5AUKA 2NBWB 2V3SA 2ZW0A 3DWMA 5BYRA 3ZTDA 1SE9A 4IUMB 2KDBA 4TQ0A 4WURA 2W3RA 3I57A 5DCNA 4TKNA 2MQJA 4ITKA 2FCNA 1E10A 3QWZB 4PS7A 2LASA
chains in the Genus database with same CATH topology
2Z0EB 2NPTB 4E71A 1YD8U 1G6JA 4MSMB 3PHWB 3JVZX 1NI2A 4FBJB 5IA7A 3ONSA 4ZRIA 4AOFA 3NHEB 5D2MB 2K8BA 2Z0DB 1XD3B 3WAPA 2LGDA 2KX0A 2ZEQA 3UINB 2MP2A 4ASWC 1WJ6A 3TCAA 2OJRA 1OEYA 2D2QA 2L0FA 2FUHB 4AWJA 1WXSA 3QQ8B 4HK2A 4LCDE 4NQKE 4LDTB 4KSKC 2W9NA 1IP9A 4PYZA 2DYBA 3GZNI 1TTNA 2N1WA 4OVUA 4ANWA 2KFKA 4GSWA 4FA6A 1TGZB 4DWFA 4I6NB 4ICUA 2CHXA 2WX1A 1Q1OA 4KDLB 4IM2A 4RM8A 5D94A 3Q3FA 3KUZA 5LXIB 4WWNA 1WH3A 2KTRA 4KZCA 3TMPB 2MLBA 2IY1B 2N9EB 2L05A 4AJYB 2DAFA 2NS5A 1WI0A 1MG8A 1E8YA 2GBRA 1ZGUB 4GIVA 2NCNA 1IPGA 1TBEA 3H9DA 2M8SA 2LUEA 3AXCA 4DHZB 4W9KA 2C60A 2MBOA 4BBNF 5KHQA 4M8NA 4II3B 5CHFA 2KJHB 3A4SC 1UELA 2JRHA 3SHQA 1WY8A 1P9DU 5TR5A 4N9F4 1YJ1A 4ZYNA 4IM0A 3IG3A 1WIAA 4W9FA 1WMHA 3M95A 1T0YA 2MW5A 3VUYA 1J8CA 4J6IA 3ZVVA 2LD9A 2NVUI 3QA8A 3DBRI 1LXDA 1E7VA 5EDSA 2J7QB 4HDQA 3OAWA 2KTFA 3M62B 4PS8A 2KHWB 4EOYA 2V4LA 2JUOA 3UGBB 3K9PB 3PTFC 2RSUA 5IAAC 1OEYJ 1EO6A 5G55A 2GOWA 3PLVA 2DZKA 4JLCA 4AP4C 1R4MI 2JT4B 4BOSC 3HK0A 5CHWA 3B1LX 1H8CA 4X57B 2WYQA 3TIXA 2I1KA 3JSVB 3VHTC 3V60A 2R2QA 4ANUA 4NQLB 2KWCA 1WE7A 4FJVB 1S1QB 3V6EB 4ANXA 2K6DB 4KVGB 4MDKE 5C1ZA 4WJQA 3RYTA 5LLIA 2ZZPB 4I6LB 1Z5SB 1J0GA 2D3GA 2O2VB 3ENEA 3PRZA 1V86A 2MX2A 3HM3A 2ZNVC 2BWFA 4WQOB 2FCSA 4IC7B 3TBLD 2FAZA 3ZNZB 4EZJA 2ASQA 2KMCA 2L0TA 3PZDA 2CKHB 4PS3A 4GB9A 2KZRA 3ZTCA 4EKUA 5CTRC 3H7PB 3MTNB 2PEAA 4DHJD 5JH5C 4K7SA 2B3AA 2KK8A 3APDA 4XX5A 3R7QA 3LJ3A 2IO3B 1WGGA 5DPTA 2JVCA 3PSEB 1WZ3A 3V61A 1QZEA 2K6QA 2NBVB 1L7YA 2XK5B 3ML8A 2AYOB 1V6EA 3ALBA 3PREA 4XZ4A 4I6PA 2RR9A 3O65B 2NR2A 1YQBA 3H1UA 4CHKA 1A5RA 3WALA 3ZO5B 4HWIB 5J2RA 3IHPC 1J19A 2EKEC 3NS8A 1NBFC 3ZLZA 5CHVC 3DBHI 3K9OB 4ZRJA 4LDTD 1Y8RC 2D11A 2BPSA 4B6WA 2UWQA 2BWES 2HTHA 1Q0WB 3W1SA 5L95C 3CSTA 3UIOB 2OOBB 2WDTB 4K1RB 1KJTA 3U30A 4GDLA 4W9JA 4WWOA 3ECIA 3MJWA 3QC8B 1R4NI 3QX1A 2N9PC 5JZEB 2MBQA 2KDIA 1WM3A 1X1MA 2FNJB 2KWUB 3R7RA 2M17A 3KVFB 1RFAA 3JW0X 4BVUC 1KM7A 3DCGA 2XBBC 1E8WA 1ZW7A 1E7UA 2PJHA 3A9JB 4FADA 2LGYA 2RD0A 2ZJDA 4G0NB 3UQBA 3VH3B 2MBBB 2J0JA 5AZGA 4JL9A 4GDKB 3WAOA 4DXAB 4F8CB 3KYDD 2D10A 2MA9B 3L08A 1OGWA 4HPMB 1WX7A 2DZJA 2AL3A 3DVNV 4BKGA 2L76A 4CO7A 3WIMA 4KIKB 2J0MA 5L83A 3HIZA 3M3JA 2BYVE 2N9XA 3AU5A 2KDFB 2NBUA 1WJNA 2C5LC 2RGFA 3QK0A 1S3SG 3ZKJC 3UQAA 2BF8B 2AEHA 2JWZA 1LQBA 3VTVA 2JPHA 4HXDA 4NY0A 4AUQC 3RT3B 3HHMA 3JYUA 4TQ1A 2LZ6A 2PE9A 4JGHB 2ZPNA 2LWPA 2O6VB 2LVPA 2V1YA 4ZRKA 2CS4A 2GBKA 1GG3A 3ZDTA 3KYCD 1ZKHA 2I1JA 1E90A 2ZVOA 4RMAA 4NAWA 2MBHA 2EMTA 2C7NB 3B08A 3PHXB 2DX5B 4GU2A 4NPNA 1AARA 4DK5A 4FHJA 3ZNHB 1U4AA 1YX6B 4GN1A 2LVOA 3DVGY 4KSLC 2FCMA 2N1VA 1GC7A 2XEWA 1GJZA 3W1YA 3SD5A 4G3XB 2AL6A 2KJRA 4GMVA 2PPHA 3KW5B 3RULA 3WAMA 3VAWA 4A20A 4MJSB 3PLUA 4GOCA 3ML9A 4IWOA 3VQIA 1WYWB 2KO3A 4E3CA 2KD0A 1L2NA 1WX9A 2ZCBA 4B9KA 1WX8A 3NZUA 3CMMB 1LM8B 1GUAB 2ZCCA 4W9CA 1K8RB 3RZWC 2ZNVB 3A9KA 4YL8A 1WGRA 1UH6A 1WJUA 4E74A 4W9EA 2LRUA 3A1QA 1I42A 4EFOA 3CSFA 4II2B 2L7RA 4G11A 2NPTA 3ZW3A 2BYFA 4ICVA 3APCA 4RM9A 3QIJA 2C9WB 3L0WB 3X0WA 2LXCA 1P1AA 2BKFA 4NNJB 2K1FA 3NZSA 4DDID 2IO2B 4W9LA 3CF6E 2KLCA 4MM3A 3PV1A 4M8MA 2ZPYA 2D07B 3SU8X 1TZ1A 2DHZA 2RPQA 2K8HA 4XC2A 4B95A 4FJZA 3RD2A 4F1SA 2KLGA 2KQSA 4W9DA 5HKHA 1VD2A 2KFKB 3L16A 3TJPA 3L54A 2G3QB 1EUVB 4FHKA 3VUXA 3A4RA 2CHZA 5C23A 3U7DA 1LFDA 2MBEA 3KUDB 2KVRA 2KTRB 4HVBA 4MELA 3GOEA 4M0WB 2KFJA 2JY6A 4WWPA 1WRDB 3T9LA 3VDZA 1RRBA 3ZRCA 1UZXB 4WJPA 4FULA 3WA0A 1M94A 2WX0A 2M0XA 4K7UA 5JHAA 3KH0A 2KX3A 1NDDA 2G45B 3ZNID 2IY0B 1C3TA 4HLEA 1WMHB 2KWVB 3C0RB 3NY5A 4IM3A 2K25A 3EFUA 2EMSA 3DVNU 2DZMA 5CX3A 2IYDB 1Q5WB 4PYUA 4EZLA 4KZ0A 1EF1A 2FIFA 1XT9B 2LRWA 3DBSA 4IW0A 4FLHA 1SIFA 4HCNB 3QAQA 1UGMA 1WXMA 3D32A 3BY4B 3QHTA 4FJYA 2KJ6A 4MH0E 3UIPB 4K81A 4BKSA 4DHZE 1GC6A 4MGYE 4GXBA 3IBEA 3WANA 4MEMA 2KXJA 2IZVB 3R3MA 2O6VD 2YLMA 1GNUA 4DHJB 2HD5B 4BKTA 3EC8A 4HDOA 4P7IA 2GMIC 3JSVA 2AWTA 1WFYA 4BOZB 2IO1B 3QARA 3DVGX 2LJ5A 2C7MB 3IFWB 3VUWA 4EZKA 3OJ3A 2J0KA 4OVVA 3RZFA 1V5OA 4W9IA 3ZNGC 2M4NA 3PGEA 2N4FA 4IWPA 3AULA 1RAXA 3UF8A 3VTUA 1I35A 1E8XA 2WWZA 2MWSB 1P0RA 4BKSD 2O2VA 3SDLC 4FN2A 1WR6E 1P3QU 3EHVA 2VRRB 1UBIA 4EEWA 2DENB 3PPAA 5DPSA 4HJKA 1YIWA 4JQWC 3AU4A 2KN5A 5DPWA 1SGHA 2BKRB 4LJOB 3VFKA 2DZIA 3PRPB 4IG7B 1KOTA 2JRIB 1WJ4A 2KMAA 4DBGA 3M63B 3ZIMA 3H7SA 3H7PA 2K8CA 2GBMA 4GGQA 4A3PA 1KLVA 5JHBA 4A3OA 2LVQA 1Z2MA 3AI5A 5E6OA 3U8ZA 4K7WA 3DDCB 5G2NA 2C7HA 2G4DB 2CU1A 2A4ZA 2MRPA 3OJ4B 3HM6X 1OTRB 2XK5A 2CHWA 5J17A 2KOXA 3L17A 2DYMA 2QHOA 2R2OA 5GMVA 2IBIB 1FXTB 1JRUA 2Y5BB 2KDEB 4EUTA 5DPRA 2KANA 2YVCA 1WR1A 3P2BA 2L3ZA 3A33B 4TUUA 3V6CB 1WXVA 3TL5A 4NJ6A 1WF9A 4ZDVA 5BO4B 3EECA 2UYZB 4BFRA 4URKA 2KQ7A 1H4RA 3OLMD 3X23A 3VTWA 5LXHA 3N32A 2K39A 2BGFA 3VXWA 2DAJA 3T8MA 2ZVNA 4GDLB 5AZFA 2KC1A 1WXAA 3V62A 1P98A 2Z59B 3N30A 5D7GA 3ZRFA 1E8ZA 2GBNA 3H6NA 4HPLB 2MP2B 4IWQA 5FR6A 4W9GA 5AZHA 1HE8A 2KNBA 3PVLA 4MGZE 5D6JB 3A9JA 1ISNA 2PE6B 3L13A 3W1SC 2JF5A 3L10B 2LXAA 4BBNC 2JZZA 2L8JA 2HJ8A 2MSED 1IYFA 3BINA 5E6PA 4GDKA 2DYOA 2REXA 1WGHA 4DDGD 4KV2A 3Q3JA 2LI5A 3DPDA 1XQQA 1WGDA 4KDIC 1V80A 3KUCB 4KIKA 2L00B 3DQVA 3PS6A 2GBJA 1C1YB 1UD7A 1RLFA 3LDZE 4LJPB 2MCNB 2CR5A 4JIOU 3APFA 3PRMB 3VH4B 2KKCA 1V49A 4NJ7A 4G50A 3R66C 1WGYA 3NOBA 1F9JA 5J18A 4MGKE 3ZDMC 1D3ZA 1YX5B 1V81A 2O6VA 3DBLI 5KHOA 1V9JA 4MSQB 2N7DA 1CMXB 1V5TA 3MHSD 3QJZA 4ANVA 2IO0B 2KC2A 3DOWA 2JXXA 4W9HA 4NAWB 1WE6A 3B0AA 3ZUNA 1WZ0A 1UBQA 2M1MA 1EF5A 2A5UA 2BYEA 2NBWB 2V3SA 1PQSA 2HE7A 2JZ3B 4AJWA 1VCBA 3RCZA 3ZTDA 1BT0A 1SE9A 4IUMB 4HCPB 2FCQA 4CYEA 2KDBA 3IVFA 3QCAA 2G4SA 4WJOA 3RUIB 1E5WA 4TQ0A 3S2AA 3VVWB 4MGIE 2FIDA 4MJSA 5AEKB 2N7EA 2LGXA 3PT2B 5DCNA 1OQYA 3I3TB 4WAAA 1WM2A 3N3KB 2MQJA 4TKNA 4WJNA 1V2YA 2FCNA 4TV3A 3A9KB 3QWZB 5E6NA 4F7ZA 3A1QB 4PS7A 2LASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0E B;  2NPT B;  4E71 A;  1YD8 U;  1G6J A;  4MSM B;  3PHW B;  3JVZ X;  1NI2 A;  4FBJ B;  5IA7 A;  3ONS A;  4ZRI A;  4AOF A;  3NHE B;  5D2M B;  2K8B A;  2Z0D B;  1XD3 B;  3WAP A;  2LGD A;  2KX0 A;  2ZEQ A;  3UIN B;  2MP2 A;  4ASW C;  1WJ6 A;  3TCA A;  2OJR A;  1OEY A;  2D2Q A;  2L0F A;  2FUH B;  4AWJ A;  1WXS A;  3QQ8 B;  4HK2 A;  4LCD E;  4NQK E;  4LDT B;  4KSK C;  2W9N A;  1IP9 A;  4PYZ A;  2DYB A;  3GZN I;  1TTN A;  2N1W A;  4OVU A;  4ANW A;  2KFK A;  4GSW A;  4FA6 A;  1TGZ B;  4DWF A;  4I6N B;  4ICU A;  2CHX A;  2WX1 A;  1Q1O A;  4KDL B;  4IM2 A;  4RM8 A;  5D94 A;  3Q3F A;  3KUZ A;  5LXI B;  4WWN A;  1WH3 A;  2KTR A;  4KZC A;  3TMP B;  2MLB A;  2IY1 B;  2N9E B;  2L05 A;  4AJY B;  2DAF A;  2NS5 A;  1WI0 A;  1MG8 A;  1E8Y A;  2GBR A;  1ZGU B;  4GIV A;  2NCN A;  1IPG A;  1TBE A;  3H9D A;  2M8S A;  2LUE A;  3AXC A;  4DHZ B;  4W9K A;  2C60 A;  2MBO A;  4BBN F;  5KHQ A;  4M8N A;  4II3 B;  5CHF A;  2KJH B;  3A4S C;  1UEL A;  2JRH A;  3SHQ A;  1WY8 A;  1P9D U;  5TR5 A;  4N9F 4;  1YJ1 A;  4ZYN A;  4IM0 A;  3IG3 A;  1WIA A;  4W9F A;  1WMH A;  3M95 A;  1T0Y A;  2MW5 A;  3VUY A;  1J8C A;  4J6I A;  3ZVV A;  2LD9 A;  2NVU I;  3QA8 A;  3DBR I;  1LXD A;  1E7V A;  5EDS A;  2J7Q B;  4HDQ A;  3OAW A;  2KTF A;  3M62 B;  4PS8 A;  2KHW B;  4EOY A;  2V4L A;  2JUO A;  3UGB B;  3K9P B;  3PTF C;  2RSU A;  5IAA C;  1OEY J;  1EO6 A;  5G55 A;  2GOW A;  3PLV A;  2DZK A;  4JLC A;  4AP4 C;  1R4M I;  2JT4 B;  4BOS C;  3HK0 A;  5CHW A;  3B1L X;  1H8C A;  4X57 B;  2WYQ A;  3TIX A;  2I1K A;  3JSV B;  3VHT C;  3V60 A;  2R2Q A;  4ANU A;  4NQL B;  2KWC A;  1WE7 A;  4FJV B;  1S1Q B;  3V6E B;  4ANX A;  2K6D B;  4KVG B;  4MDK E;  5C1Z A;  4WJQ A;  3RYT A;  5LLI A;  2ZZP B;  4I6L B;  1Z5S B;  1J0G A;  2D3G A;  2O2V B;  3ENE A;  3PRZ A;  1V86 A;  2MX2 A;  3HM3 A;  2ZNV C;  2BWF A;  4WQO B;  2FCS A;  4IC7 B;  3TBL D;  2FAZ A;  3ZNZ B;  4EZJ A;  2ASQ A;  2KMC A;  2L0T A;  3PZD A;  2CKH B;  4PS3 A;  4GB9 A;  2KZR A;  3ZTC A;  4EKU A;  5CTR C;  3H7P B;  3MTN B;  2PEA A;  4DHJ D;  5JH5 C;  4K7S A;  2B3A A;  2KK8 A;  3APD A;  4XX5 A;  3R7Q A;  3LJ3 A;  2IO3 B;  1WGG A;  5DPT A;  2JVC A;  3PSE B;  1WZ3 A;  3V61 A;  1QZE A;  2K6Q A;  2NBV B;  1L7Y A;  2XK5 B;  3ML8 A;  2AYO B;  1V6E A;  3ALB A;  3PRE A;  4XZ4 A;  4I6P A;  2RR9 A;  3O65 B;  2NR2 A;  1YQB A;  3H1U A;  4CHK A;  1A5R A;  3WAL A;  3ZO5 B;  4HWI B;  5J2R A;  3IHP C;  1J19 A;  2EKE C;  3NS8 A;  1NBF C;  3ZLZ A;  5CHV C;  3DBH I;  3K9O B;  4ZRJ A;  4LDT D;  1Y8R C;  2D11 A;  2BPS A;  4B6W A;  2UWQ A;  2BWE S;  2HTH A;  1Q0W B;  3W1S A;  5L95 C;  3CST A;  3UIO B;  2OOB B;  2WDT B;  4K1R B;  1KJT A;  3U30 A;  4GDL A;  4W9J A;  4WWO A;  3ECI A;  3MJW A;  3QC8 B;  1R4N I;  3QX1 A;  2N9P C;  5JZE B;  2MBQ A;  2KDI A;  1WM3 A;  1X1M A;  2FNJ B;  2KWU B;  3R7R A;  2M17 A;  3KVF B;  1RFA A;  3JW0 X;  4BVU C;  1KM7 A;  3DCG A;  2XBB C;  1E8W A;  1ZW7 A;  1E7U A;  2PJH A;  3A9J B;  4FAD A;  2LGY A;  2RD0 A;  2ZJD A;  4G0N B;  3UQB A;  3VH3 B;  2MBB B;  2J0J A;  5AZG A;  4JL9 A;  4GDK B;  3WAO A;  4DXA B;  4F8C B;  3KYD D;  2D10 A;  2MA9 B;  3L08 A;  1OGW A;  4HPM B;  1WX7 A;  2DZJ A;  2AL3 A;  3DVN V;  4BKG A;  2L76 A;  4CO7 A;  3WIM A;  4KIK B;  2J0M A;  5L83 A;  3HIZ A;  3M3J A;  2BYV E;  2N9X A;  3AU5 A;  2KDF B;  2NBU A;  1WJN A;  2C5L C;  2RGF A;  3QK0 A;  1S3S G;  3ZKJ C;  3UQA A;  2BF8 B;  2AEH A;  2JWZ A;  1LQB A;  3VTV A;  2JPH A;  4HXD A;  4NY0 A;  4AUQ C;  3RT3 B;  3HHM A;  3JYU A;  4TQ1 A;  2LZ6 A;  2PE9 A;  4JGH B;  2ZPN A;  2LWP A;  2O6V B;  2LVP A;  2V1Y A;  4ZRK A;  2CS4 A;  2GBK A;  1GG3 A;  3ZDT A;  3KYC D;  1ZKH A;  2I1J A;  1E90 A;  2ZVO A;  4RMA A;  4NAW A;  2MBH A;  2EMT A;  2C7N B;  3B08 A;  3PHX B;  2DX5 B;  4GU2 A;  4NPN A;  1AAR A;  4DK5 A;  4FHJ A;  3ZNH B;  1U4A A;  1YX6 B;  4GN1 A;  2LVO A;  3DVG Y;  4KSL C;  2FCM A;  2N1V A;  1GC7 A;  2XEW A;  1GJZ A;  3W1Y A;  3SD5 A;  4G3X B;  2AL6 A;  2KJR A;  4GMV A;  2PPH A;  3KW5 B;  3RUL A;  3WAM A;  3VAW A;  4A20 A;  4MJS B;  3PLU A;  4GOC A;  3ML9 A;  4IWO A;  3VQI A;  1WYW B;  2KO3 A;  4E3C A;  2KD0 A;  1L2N A;  1WX9 A;  2ZCB A;  4B9K A;  1WX8 A;  3NZU A;  3CMM B;  1LM8 B;  1GUA B;  2ZCC A;  4W9C A;  1K8R B;  3RZW C;  2ZNV B;  3A9K A;  4YL8 A;  1WGR A;  1UH6 A;  1WJU A;  4E74 A;  4W9E A;  2LRU A;  3A1Q A;  1I42 A;  4EFO A;  3CSF A;  4II2 B;  2L7R A;  4G11 A;  2NPT A;  3ZW3 A;  2BYF A;  4ICV A;  3APC A;  4RM9 A;  3QIJ A;  2C9W B;  3L0W B;  3X0W A;  2LXC A;  1P1A A;  2BKF A;  4NNJ B;  2K1F A;  3NZS A;  4DDI D;  2IO2 B;  4W9L A;  3CF6 E;  2KLC A;  4MM3 A;  3PV1 A;  4M8M A;  2ZPY A;  2D07 B;  3SU8 X;  1TZ1 A;  2DHZ A;  2RPQ A;  2K8H A;  4XC2 A;  4B95 A;  4FJZ A;  3RD2 A;  4F1S A;  2KLG A;  2KQS A;  4W9D A;  5HKH A;  1VD2 A;  2KFK B;  3L16 A;  3TJP A;  3L54 A;  2G3Q B;  1EUV B;  4FHK A;  3VUX A;  3A4R A;  2CHZ A;  5C23 A;  3U7D A;  1LFD A;  2MBE A;  3KUD B;  2KVR A;  2KTR B;  4HVB A;  4MEL A;  3GOE A;  4M0W B;  2KFJ A;  2JY6 A;  4WWP A;  1WRD B;  3T9L A;  3VDZ A;  1RRB A;  3ZRC A;  1UZX B;  4WJP A;  4FUL A;  3WA0 A;  1M94 A;  2WX0 A;  2M0X A;  4K7U A;  5JHA A;  3KH0 A;  2KX3 A;  1NDD A;  2G45 B;  3ZNI D;  2IY0 B;  1C3T A;  4HLE A;  1WMH B;  2KWV B;  3C0R B;  3NY5 A;  4IM3 A;  2K25 A;  3EFU A;  2EMS A;  3DVN U;  2DZM A;  5CX3 A;  2IYD B;  1Q5W B;  4PYU A;  4EZL A;  4KZ0 A;  1EF1 A;  2FIF A;  1XT9 B;  2LRW A;  3DBS A;  4IW0 A;  4FLH A;  1SIF A;  4HCN B;  3QAQ A;  1UGM A;  1WXM A;  3D32 A;  3BY4 B;  3QHT A;  4FJY A;  2KJ6 A;  4MH0 E;  3UIP B;  4K81 A;  4BKS A;  4DHZ E;  1GC6 A;  4MGY E;  4GXB A;  3IBE A;  3WAN A;  4MEM A;  2KXJ A;  2IZV B;  3R3M A;  2O6V D;  2YLM A;  1GNU A;  4DHJ B;  2HD5 B;  4BKT A;  3EC8 A;  4HDO A;  4P7I A;  2GMI C;  3JSV A;  2AWT A;  1WFY A;  4BOZ B;  2IO1 B;  3QAR A;  3DVG X;  2LJ5 A;  2C7M B;  3IFW B;  3VUW A;  4EZK A;  3OJ3 A;  2J0K A;  4OVV A;  3RZF A;  1V5O A;  4W9I A;  3ZNG C;  2M4N A;  3PGE A;  2N4F A;  4IWP A;  3AUL A;  1RAX A;  3UF8 A;  3VTU A;  1I35 A;  1E8X A;  2WWZ A;  2MWS B;  1P0R A;  4BKS D;  2O2V A;  3SDL C;  4FN2 A;  1WR6 E;  1P3Q U;  3EHV A;  2VRR B;  1UBI A;  4EEW A;  2DEN B;  3PPA A;  5DPS A;  4HJK A;  1YIW A;  4JQW C;  3AU4 A;  2KN5 A;  5DPW A;  1SGH A;  2BKR B;  4LJO B;  3VFK A;  2DZI A;  3PRP B;  4IG7 B;  1KOT A;  2JRI B;  1WJ4 A;  2KMA A;  4DBG A;  3M63 B;  3ZIM A;  3H7S A;  3H7P A;  2K8C A;  2GBM A;  4GGQ A;  4A3P A;  1KLV A;  5JHB A;  4A3O A;  2LVQ A;  1Z2M A;  3AI5 A;  5E6O A;  3U8Z A;  4K7W A;  3DDC B;  5G2N A;  2C7H A;  2G4D B;  2CU1 A;  2A4Z A;  2MRP A;  3OJ4 B;  3HM6 X;  1OTR B;  2XK5 A;  2CHW A;  5J17 A;  2KOX A;  3L17 A;  2DYM A;  2QHO A;  2R2O A;  5GMV A;  2IBI B;  1FXT B;  1JRU A;  2Y5B B;  2KDE B;  4EUT A;  5DPR A;  2KAN A;  2YVC A;  1WR1 A;  3P2B A;  2L3Z A;  3A33 B;  4TUU A;  3V6C B;  1WXV A;  3TL5 A;  4NJ6 A;  1WF9 A;  4ZDV A;  5BO4 B;  3EEC A;  2UYZ B;  4BFR A;  4URK A;  2KQ7 A;  1H4R A;  3OLM D;  3X23 A;  3VTW A;  5LXH A;  3N32 A;  2K39 A;  2BGF A;  3VXW A;  2DAJ A;  3T8M A;  2ZVN A;  4GDL B;  5AZF A;  2KC1 A;  1WXA A;  3V62 A;  1P98 A;  2Z59 B;  3N30 A;  5D7G A;  3ZRF A;  1E8Z A;  2GBN A;  3H6N A;  4HPL B;  2MP2 B;  4IWQ A;  5FR6 A;  4W9G A;  5AZH A;  1HE8 A;  2KNB A;  3PVL A;  4MGZ E;  5D6J B;  3A9J A;  1ISN A;  2PE6 B;  3L13 A;  3W1S C;  2JF5 A;  3L10 B;  2LXA A;  4BBN C;  2JZZ A;  2L8J A;  2HJ8 A;  2MSE D;  1IYF A;  3BIN A;  5E6P A;  4GDK A;  2DYO A;  2REX A;  1WGH A;  4DDG D;  4KV2 A;  3Q3J A;  2LI5 A;  3DPD A;  1XQQ A;  1WGD A;  4KDI C;  1V80 A;  3KUC B;  4KIK A;  2L00 B;  3DQV A;  3PS6 A;  2GBJ A;  1C1Y B;  1UD7 A;  1RLF A;  3LDZ E;  4LJP B;  2MCN B;  2CR5 A;  4JIO U;  3APF A;  3PRM B;  3VH4 B;  2KKC A;  1V49 A;  4NJ7 A;  4G50 A;  3R66 C;  1WGY A;  3NOB A;  1F9J A;  5J18 A;  4MGK E;  3ZDM C;  1D3Z A;  1YX5 B;  1V81 A;  2O6V A;  3DBL I;  5KHO A;  1V9J A;  4MSQ B;  2N7D A;  1CMX B;  1V5T A;  3MHS D;  3QJZ A;  4ANV A;  2IO0 B;  2KC2 A;  3DOW A;  2JXX A;  4W9H A;  4NAW B;  1WE6 A;  3B0A A;  3ZUN A;  1WZ0 A;  1UBQ A;  2M1M A;  1EF5 A;  2A5U A;  2BYE A;  2NBW B;  2V3S A;  1PQS A;  2HE7 A;  2JZ3 B;  4AJW A;  1VCB A;  3RCZ A;  3ZTD A;  1BT0 A;  1SE9 A;  4IUM B;  4HCP B;  2FCQ A;  4CYE A;  2KDB A;  3IVF A;  3QCA A;  2G4S A;  4WJO A;  3RUI B;  1E5W A;  4TQ0 A;  3S2A A;  3VVW B;  4MGI E;  2FID A;  4MJS A;  5AEK B;  2N7E A;  2LGX A;  3PT2 B;  5DCN A;  1OQY A;  3I3T B;  4WAA A;  1WM2 A;  3N3K B;  2MQJ A;  4TKN A;  4WJN A;  1V2Y A;  2FCN A;  4TV3 A;  3A9K B;  3QWZ B;  5E6N A;  4F7Z A;  3A1Q B;  4PS7 A;  2LAS A; 
#chains in the Genus database with same CATH topology
 2HDE A;  4E71 A;  1YD8 U;  3LB8 C;  5IA7 A;  4FBJ B;  5D2M B;  2K0P A;  3UIN B;  4MM3 B;  2MP2 A;  4ASW C;  3TCA A;  2OJR A;  1OEY A;  2D2Q A;  4LCD E;  3KWV A;  4LDT B;  2W9N A;  2M56 B;  2N1W A;  3FKY A;  1K51 A;  1TGZ B;  1D5X C;  5BYS A;  4P1C C;  4IM2 A;  2IJ0 A;  2QIL A;  2OHF A;  5D94 A;  3Q3F A;  1WH3 A;  4KZC A;  2IY1 B;  1MI0 A;  3H8H A;  2KAJ A;  2DAF A;  1EWC A;  2YEP F;  1CZP A;  4RGN A;  1E8Y A;  2GBR A;  2VZK B;  1IPG A;  2LUE A;  1XCT L;  4RGT A;  1WY8 A;  5TR5 A;  1PGA A;  3IG3 A;  2MW5 A;  3VUY A;  1J8C A;  1WSP A;  1TYG B;  3AE5 B;  1LXD A;  2J7Q B;  3FIL B;  2W82 A;  3PTF C;  5IAA C;  1OEY J;  4AP4 C;  3CWI A;  1R4M I;  2JT4 B;  3HK0 A;  1SIJ A;  4X57 B;  2WYQ A;  3MC8 A;  3TIX A;  3JSV B;  3IXS A;  2LGI A;  2R2Q A;  2WLB A;  2KWC A;  1XLP A;  3EUB 2;  2K6D B;  4TSS A;  5IKC M;  1MG4 A;  1N62 A;  3RYT A;  2DWQ A;  2ZZP B;  4HRS A;  1Z5S B;  4I6L B;  1J0G A;  1J7A A;  3ENE A;  2BTE A;  3HM3 A;  2LUM A;  2ASQ A;  4LK0 M;  3P4R B;  4PS3 A;  4EKU A;  3H7P B;  4DHJ D;  2PEA A;  4C00 A;  4K7S A;  5FK9 C;  1V8C A;  3PSE B;  3V61 A;  1QZE A;  1GB4 A;  3NJT A;  2NBV B;  2XN9 C;  2AYO B;  3ALB A;  4XYC A;  2NR2 A;  2PVO D;  4ZHP A;  5J2R A;  3IHP C;  3NVZ A;  1J19 A;  1I4P A;  5CHV C;  3DBH I;  4RCO A;  3K9O B;  4LDT D;  1N5W A;  1J7B A;  2BW2 A;  2BPS A;  2PLP A;  1CQV A;  2AQ3 B;  1FM0 D;  2L83 A;  1AN8 A;  2RDH A;  3W1S A;  3UIO B;  1B9R A;  2KQ4 X;  3QC8 B;  2MBQ A;  2KDI A;  1VR9 A;  2XBB C;  1E8W A;  2VZK D;  2PJH A;  3A9J B;  1GOZ A;  2WQY B;  4LNN A;  3Q8C A;  2MH7 A;  2MBB B;  3KYD D;  2MA9 B;  3L08 A;  1SJH D;  3HVZ A;  2AL3 A;  4R3D A;  1WWT A;  3AEA B;  2J0M A;  2BYV E;  2N9X A;  3ZKJ C;  3UQA A;  2RGF A;  1LQB A;  1N5X A;  4OZC A;  4PK1 A;  3JYU A;  2V0G A;  4HKQ A;  4DXG A;  1HA5 A;  3KYC D;  3AE4 B;  2BS2 B;  2ZVO A;  1LO5 D;  3BYY B;  2EMT A;  3RNE C;  2DBY A;  2GRI A;  2LVO A;  2N1V A;  4MH8 A;  4NZL B;  2XEW A;  1GJZ A;  1Y56 A;  4WIP A;  4YTN B;  1I4G A;  3RUL A;  3BII D;  3WAM A;  4A20 A;  3VQI A;  1L2N A;  4E3C A;  1K53 A;  2K5P A;  1SJE D;  2ZCB A;  4B9K A;  3CMM B;  2CJN A;  1XLQ A;  2D3B A;  4E74 A;  4W9E A;  3N1X C;  4EFO A;  4II2 B;  2BBC A;  1EU3 A;  4G11 A;  4P16 A;  3ZW3 A;  4RGO S;  1I4R A;  1MHX A;  2C9W B;  1QOA A;  3X0W A;  3P42 A;  1P1A A;  4NNJ B;  4MM3 A;  1TZ1 A;  2D3A A;  2DHZ A;  4B95 A;  1QF6 A;  1VZ8 A;  4ZHO A;  1ZXH A;  3NVY A;  3L16 A;  1ESF A;  3TJP A;  4OW0 A;  3U7D A;  4NAM A;  2KTR B;  4MEL A;  1QIL A;  4M0W B;  2KFJ A;  3T9L A;  1F1H A;  2M0A A;  3ZRC A;  3KH0 A;  5C3J B;  3I5J C;  1C3T A;  3ZNI D;  1QQR A;  2KWV B;  4IM3 A;  3C0R B;  4P6V F;  5CX3 A;  2W55 A;  2FIF A;  1XT9 B;  2LRW A;  2WU2 B;  3U52 E;  4JPS A;  1SIF A;  4HCN B;  1UGM A;  3KWL A;  3T3N A;  4XDD A;  4K81 A;  3FIL A;  4MGY E;  3AEF B;  1L0V B;  2MJ3 A;  4MEM A;  1AWD A;  4HPP A;  1RM6 C;  4A9A A;  2PIA A;  3NUH B;  4BKT A;  4HDO A;  4P7I A;  3JSV A;  2IGH A;  4BOZ B;  3DVG X;  4M00 A;  2WXN A;  3VUW A;  1UGJ A;  1QOG A;  1V5O A;  4IWP A;  4CQN A;  2LHD A;  2WWZ A;  2MWS B;  2WGS A;  1P0R A;  4FN2 A;  3EA6 A;  2KT7 A;  3BVM A;  4JQW C;  3AU4 A;  2KN5 A;  1XLN A;  1L6V A;  3VFK A;  2DZI A;  3PRP B;  1KOT A;  3H7P A;  1E0Z A;  5GXG B;  4O1N A;  2GBM A;  1KLV A;  5JHB A;  1WGK A;  3CIR B;  2INP E;  2G4D B;  3OJ4 B;  3W2D A;  2LGS A;  4H2A A;  2KOX A;  3TEZ A;  2DYM A;  3J9C A;  3AB5 A;  2Y5B B;  5IN7 A;  3P4Q B;  1R4N B;  3P2B A;  2L3Z A;  4LNI A;  1TJE A;  4TUU A;  4YSY B;  3TL5 A;  5BO4 B;  3AMZ A;  2UYZ B;  4BFR A;  1NEK B;  3SFD B;  2WXL A;  3ETR A;  3X23 A;  2AQ1 B;  3VTW A;  2BVC A;  5LXH A;  3MJ5 A;  2VH2 A;  3E9S A;  2DAJ A;  4KGR A;  4UDU C;  3V62 A;  1J7C A;  4ARI A;  3ZRF A;  1E8Z A;  4HPL B;  3ZXR A;  2MP2 B;  4IWQ A;  1FRD A;  1YQ3 B;  3W1S C;  3A9J A;  2PE6 B;  1L4Z B;  2L52 A;  4RFB A;  2HJ8 A;  1WGH A;  1SE3 A;  3Q3J A;  2LI5 A;  3AN1 A;  1XQQ A;  4KDI C;  3DQV A;  1RLF A;  3BYT B;  2MCN B;  3C19 A;  3APF A;  1V49 A;  2BS4 B;  1F0Z A;  3PZ7 A;  1FXA A;  1CMX B;  3MHS D;  2KC2 A;  3ZUN A;  3AE3 B;  1N63 A;  3Q8E A;  1DOI A;  2JYE A;  2JZ3 B;  1ZXI A;  1V1O A;  3MC0 B;  1D4B A;  3DHI C;  3IVF A;  4CYE A;  4Q2J A;  1T5X D;  3VVW B;  5EE1 A;  2FID A;  1WXQ A;  2LGX A;  1OQY A;  3I3T B;  4WJN A;  1WM2 A;  3NZ3 A;  4TV3 A;  4L1B A;  5E6N A;  3QAQ A;  3A1Q B;  2E6X A;  1G6J A;  4MSM B;  1OFF A;  3JVZ X;  1NI2 A;  1YQ4 B;  4AOF A;  1XD3 B;  3WAP A;  5G5H A;  2LGD A;  2FBW B;  2FUH B;  3QQ8 B;  4HK2 A;  3BK1 A;  4KSK C;  2DYB A;  3GZN I;  4ANW A;  2UU7 A;  1FNW A;  1MJD A;  4GSW A;  4B0M A;  4DWF A;  4I6N B;  4ICU A;  1T3Q A;  1Q1O A;  3W5V B;  3RI7 C;  3KUZ A;  1P7F A;  4WWN A;  3Q3O C;  2KTR A;  2N9E B;  4M0W A;  2JSV X;  2EKI A;  2NS5 A;  4JWS C;  3AE9 B;  1ZGU B;  4GIV A;  1SE4 A;  3H9D A;  2WNM A;  3HUI A;  4W9K A;  4BBN F;  4M8N A;  5CHF A;  3A4S C;  2JRH A;  3SHQ A;  2Y5P A;  1YN5 A;  1YJ1 A;  1WIA A;  4W9F A;  3IAM 1;  1P7E A;  1KH0 A;  5FKA C;  2NVU I;  3DBR I;  1E7V A;  2MEK A;  5IOI A;  3AE8 B;  2V4L A;  2JUO A;  3K9P B;  2RSU A;  2GOW A;  3PLV A;  2DZK A;  1NEN B;  1H8C A;  2WU5 B;  2I1K A;  2WXG A;  1WE7 A;  4FJV B;  1HTQ A;  2JWU A;  4ANX A;  4S0R A;  4KVG B;  4B0E A;  2Q5W D;  1TY0 A;  1C9F A;  1QOF A;  4YTM B;  2MX2 A;  2ON8 A;  1SSN A;  4IC7 B;  5H92 C;  4EZJ A;  2KMC A;  2LMC A;  1B1Z A;  4DQO C;  3TEW A;  2L1A A;  3ZTC A;  4P1B C;  4ZRP A;  5JH5 C;  2B3A A;  2E3T A;  3FC4 A;  3SR6 A;  3APD A;  3R7Q A;  2IO3 B;  1WGG A;  4REZ A;  2SEB D;  1WZ3 A;  3NS1 A;  1YN3 A;  2RR9 A;  2QC8 A;  1YQB A;  3H1U A;  1A5R A;  3AM9 A;  3HRD D;  1JCK B;  1EWY C;  2EKE C;  1NBF C;  3ZLZ A;  1VRA B;  4ZRJ A;  1QT9 A;  2D11 A;  4C56 C;  2QJL A;  2B76 B;  1C79 A;  1I4Q A;  4YWG G;  2OOB B;  1RYJ A;  4WWO A;  4W9J A;  1R4N I;  5JZE B;  1TIF A;  2GI9 A;  2HTM E;  1FCC C;  1KM7 A;  3DCG A;  2K22 A;  2BT6 A;  2LGY A;  3HVD A;  3W9C B;  2ZJD A;  1HZ6 A;  2Z8L A;  4JL9 A;  4GDK B;  3WAO A;  1WX7 A;  3DBL B;  2L76 A;  4XE0 A;  5L83 A;  2KDF B;  2G1E A;  4YXD B;  3O13 A;  2BF8 B;  1XF5 L;  4XWW A;  4PT5 A;  4HXD A;  1VZ6 A;  2O6V B;  4ZRK A;  1STE A;  1N60 A;  1PDX A;  3AED B;  3AEG B;  4RMA A;  2MBH A;  2C7N B;  3B08 A;  4GU2 A;  1AAR A;  5I4D A;  2WXP A;  3ZNH B;  1U4A A;  4GN1 A;  1T0Q C;  3DVG Y;  4G3X B;  2KJR A;  4GMV A;  2J42 A;  3KW5 B;  2IND C;  1TKG A;  4MJS B;  3BVZ A;  2QCZ A;  1WX9 A;  2INN E;  5FR3 A;  4W9C A;  2ZCC A;  2BS3 B;  1QLB B;  4YL8 A;  1WGR A;  1UH6 A;  3LYY A;  2KWD A;  2LRU A;  3A1Q A;  2L7R A;  2BYF A;  3APC A;  1KLG D;  1TKE A;  3L0W B;  3MFG A;  2LXC A;  3NZS A;  1XXG A;  2IO2 B;  2KLC A;  1XCQ L;  1YMH E;  1VD2 A;  2KFK B;  4L23 A;  2WDV B;  2WXJ A;  1KTK A;  3A4R A;  2WXO A;  2CHZ A;  1LFD A;  4JX1 C;  3KUD B;  2KVR A;  1BML C;  2JY6 A;  1WRD B;  3VDZ A;  1RRB A;  5HI1 A;  2HJ1 A;  3WA0 A;  2RPV A;  5JHA A;  3LXF A;  4K3C A;  1HTO A;  1TY2 A;  2EMS A;  2QDF A;  2DZM A;  2IYD B;  4EZL A;  4KGT A;  4IW0 A;  1M4V A;  4KKI A;  3D32 A;  3UIP B;  4MH0 E;  4BKS A;  3IBE A;  3WAN A;  3U7Z A;  1UWX A;  2O6V D;  1GNU A;  2HD5 B;  3L4P A;  2V3P A;  3WCQ A;  1SEB D;  2GMI C;  2AWT A;  3AV8 A;  2LJ5 A;  2C7M B;  3IFW B;  4W9I A;  4RGM A;  3ZNG C;  3VTU A;  4AS1 A;  3SDL C;  1P3Q U;  3EHV A;  2VRR B;  4IKG A;  1K50 A;  2DEN B;  3DHG C;  3PPA A;  4XDC A;  3VRB B;  4EEW A;  1TS2 A;  1AW7 A;  3V05 A;  3H7S A;  4J3O D;  2JQR B;  1VDV A;  2RDB C;  2Y5C A;  3DDC B;  4YT0 B;  5G2N A;  2CU1 A;  2MRP A;  4RH6 A;  5G5G A;  1OTR B;  3RMK C;  2V9H A;  3L17 A;  1FCL A;  1L6U A;  2QHO A;  2R2O A;  5GMV A;  2IBI B;  1JRU A;  4BZA A;  4EUT A;  5H8Y E;  5DPR A;  3V6C B;  1C78 A;  1WXV A;  4A6Q A;  4NJ6 A;  4MT5 A;  2WXR A;  2YEP B;  3UI3 A;  2CJO A;  3N20 C;  2R61 A;  1H4R A;  3OLM D;  5D3I B;  4MAC A;  2K39 A;  2BGF A;  1JWU D;  2Z59 B;  5D7G A;  4HKZ E;  2V4I B;  3VR9 B;  1JWS D;  1UF0 A;  2KN4 A;  3NRZ A;  4MGZ E;  3L13 A;  4HEA 1;  2JZZ A;  2L8J A;  3AE2 B;  3SFE B;  1WYG A;  4GDK A;  2XNA C;  3E56 A;  3PS6 A;  2WS3 B;  3B2G A;  1C1Y B;  2INC C;  5IO9 A;  2CR5 A;  1C4C A;  1T6B X;  4NJ7 A;  1WGY A;  1F9J A;  3DHH C;  4MGK E;  3ZDM C;  2O6V A;  3DBL I;  4YTP B;  4MSQ B;  3OG5 A;  1XO3 A;  1V5T A;  2BB6 A;  3DOW A;  1BXT A;  3B0A A;  4OHJ A;  1WZ0 A;  2KAC A;  1UBQ A;  2BYE A;  3TEX A;  2J52 A;  1PQS A;  1KRH A;  2FUG 1;  1BT0 A;  4HCP B;  1C77 A;  4XWT A;  1KLU D;  3RUI B;  1E5W A;  1ZOY B;  3S2A A;  4MGI E;  4MJS A;  5AEK B;  1FXI A;  2N7E A;  3P4S B;  3PT2 B;  1OQR A;  1FNU A;  1V2Y A;  5EE0 A;  4F7Z A;  2Z0E B;  2WDR B;  3PHW B;  3ONS A;  4ZRI A;  1HEZ E;  2M19 A;  2K8B A;  3NHE B;  5LNK 1;  3MHZ A;  2KX0 A;  2L0F A;  4AWJ A;  2JXT A;  1L5P A;  1IP9 A;  1DOY A;  4OVU A;  2KFK A;  2CHX A;  4KDL B;  1IUE A;  5LXI B;  1ZP0 B;  2MLB A;  1JAL A;  2L05 A;  4AJY B;  2WDQ B;  3ZJU A;  1WI0 A;  1MG8 A;  4LTU A;  3AXC A;  1EU4 A;  4DHZ B;  2C60 A;  5KHQ A;  2AX5 A;  4YSX B;  4ZYN A;  4IM0 A;  3AEC B;  3M95 A;  1T0Y A;  4LNF A;  1UWM A;  5MPO A;  4J6I A;  2LD9 A;  1SXT A;  3QA8 A;  1JRP A;  3EGR A;  3AEE B;  2GLS A;  4EOY A;  4GLS C;  1VLB A;  3AE7 B;  3UGB B;  5G55 A;  4JLC A;  3KQ4 A;  5EE9 A;  1L4D B;  4BOS C;  3B1L X;  2KVZ A;  2PKO A;  3VHT C;  4ANU A;  2NTT A;  1JWM D;  1V97 A;  1UUP A;  3V6E B;  4BAX A;  5C1Z A;  2G9H D;  1E7P B;  4WJQ A;  2ICI A;  5LLI A;  3NG0 A;  1JRO A;  2ZNV C;  3TBL D;  1NYQ A;  3MC9 A;  4RNA A;  1YOV B;  2CKH B;  2PVG C;  4GB9 A;  2BB5 A;  3SEB A;  4C4V B;  2KK8 A;  3Q8B A;  3LJ3 A;  5DPT A;  2JVC A;  2KMM A;  1FNV A;  1L7Y A;  2XK5 B;  5E6J A;  3O65 B;  4WWM A;  2J53 A;  4CHK A;  1RWS A;  1QKZ A;  3P4P B;  1Y8R C;  1R4M B;  3NVW A;  4FXC A;  4B6W A;  3RNB C;  2BWE S;  2TSS A;  3CST A;  2WDT B;  2KYW A;  3Q14 C;  4K1R B;  1KJT A;  3U30 A;  1SB3 C;  3MJW A;  2LJI A;  3QX1 A;  2N9P C;  1WM3 A;  2FNJ B;  2M17 A;  1KF6 B;  1RFA A;  1ZW7 A;  4TMA B;  2RD0 A;  2K9X A;  2J0J A;  1UNS A;  5AZG A;  4DXA B;  2D10 A;  4HPM B;  1OGW A;  2BYT A;  5BYQ A;  3DVN V;  4BKG A;  4IOI E;  3WIM A;  1TT5 B;  2C5L C;  1GPX A;  2AEH A;  2JWZ A;  3VTV A;  2JPH A;  1GAQ B;  3RT3 B;  3HHM A;  2LZ6 A;  4JGH B;  2V1Y A;  3ZXV A;  1FO4 A;  4USA A;  2GBK A;  1GG3 A;  2EEL A;  3ZDT A;  1TKY A;  2I1J A;  3P1M A;  1YJI A;  5HFY A;  1AYF A;  1E90 A;  3RN9 C;  3PHX B;  2DX5 B;  2QIE B;  4DK5 A;  2WHI A;  1YX6 B;  1GC7 A;  2QMT A;  4GOC A;  1WYW B;  1HXY D;  2KD0 A;  3NZU A;  1LM8 B;  1GUA B;  3GE3 C;  2WXK A;  3ZJT A;  1K8R B;  2ZNV B;  1I42 A;  3QIJ A;  2D5G A;  1MPE A;  1TS4 A;  2IGD A;  4W9L A;  3CF6 E;  4LLG M;  2PMV A;  3AE6 B;  3PV1 A;  4M8M A;  2ZPY A;  2D07 B;  3SU8 X;  2RPQ A;  4XC2 A;  2X38 A;  2N7J A;  5HKH A;  4W9D A;  2G3Q B;  5C23 A;  2MBE A;  1D6E C;  3B9J A;  4XGA B;  4WWP A;  1C4A A;  1ET6 A;  1UZX B;  3BK2 A;  4KX6 B;  4FUL A;  2WX0 A;  2KX3 A;  1NI3 A;  1NDD A;  2G45 B;  3OWE B;  4K3B A;  4HLE A;  1FIQ A;  1WMH B;  5JXV A;  5EE3 A;  2K25 A;  3DVN U;  3BVG A;  3DBS A;  4NJC A;  4FLH A;  3QHT A;  2KJ6 A;  4DHZ E;  4L2Y A;  4GXB A;  1D5M C;  3I63 C;  3I9V 1;  1ZDV A;  3B2F A;  3VRA B;  2D3C A;  1YJJ A;  2KXJ A;  3R3M A;  5BMH A;  2YLM A;  4DHJ B;  3ZQ4 A;  1L0Y B;  2IO1 B;  3QAR A;  4US9 A;  4EZK A;  2J0K A;  4OVV A;  1SBB B;  2M4N A;  2JU6 X;  1RAX A;  1T0R C;  1E8X A;  4BKS D;  1HZ5 A;  2K3U A;  3Q3N C;  5DPS A;  4HJK A;  1SGH A;  3Q3M C;  4LJO B;  1F2R C;  4IG7 B;  4AQ7 A;  2KMA A;  4C80 A;  4C4V A;  3T3O A;  4GGQ A;  2OED A;  2LVQ A;  1Z2M A;  3AI5 A;  5E6O A;  3U8Z A;  4K7W A;  2LHE A;  2C7H A;  2A4Z A;  4ZYS A;  2XK5 A;  2CHW A;  5J17 A;  3EFC A;  1FXT B;  3RNC C;  1I4H A;  2KAN A;  4ACF A;  4ARC A;  1L0X B;  1WRI A;  2YVC A;  1WR1 A;  2ACZ B;  3IT4 B;  2Y3A A;  3A33 B;  1LGR A;  1WF9 A;  1JWA D;  3ZYY X;  3EEC A;  1XLO A;  4OZB A;  3VXW A;  2ZVN A;  4GDL B;  5AZF A;  2KC1 A;  3RPF C;  1P98 A;  1KFY B;  5BMG A;  3H6N A;  2GBN A;  4RF0 A;  1HE8 A;  2KNB A;  5D6J B;  1ISN A;  2DLB A;  2LXA A;  1IYF A;  2MSE D;  3BIN A;  1C76 A;  1FD6 A;  3DPD A;  4A90 A;  1WGD A;  3GB1 A;  1V80 A;  1FPY A;  2IDY A;  2GBJ A;  1UD7 A;  1PFD A;  4JIO U;  1OQQ A;  3VH4 B;  2KKC A;  4G50 A;  3NOB A;  1NVI D;  1D3Z A;  1YX5 B;  1V81 A;  3V3X A;  3PZ8 A;  4ANV A;  3QJZ A;  2JXX A;  2LFI A;  4NAW B;  1WE6 A;  2AQ2 B;  1FRR A;  3GS2 A;  3URY A;  2M1M A;  1EF5 A;  2A5U A;  2HE7 A;  4AJW A;  1VCB A;  3RCZ A;  2W54 A;  1MVK A;  2FCQ A;  1R7S A;  3QCA A;  1PGX A;  4KKJ A;  2G4S A;  4WJO A;  2WXH A;  2OJW A;  4WAA A;  3N3K B;  3A9K B;  1YNT E;  4ZOH C;  2NPT B;  2Z0D B;  2L32 A;  2ZEQ A;  3TSS A;  1WJ6 A;  2I38 A;  1WXS A;  4NQK E;  4PYZ A;  2NMQ A;  1TTN A;  3Q2A C;  4FA6 A;  2PW9 A;  1SE2 A;  4HJG E;  2WX1 A;  1F52 A;  4RM8 A;  4M01 A;  1N61 A;  3TMP B;  1ET9 A;  2IGG A;  1MHH E;  2DNF A;  2NCN A;  1TBE A;  1MFW A;  2M8S A;  1E9M A;  2MBO A;  4II3 B;  2KJH B;  1UEL A;  1SF0 A;  1E6E B;  1P9D U;  5AUI A;  4N9F 4;  4YSZ B;  5HHD G;  1WMH A;  1CK1 A;  4D2K A;  3ZVV A;  3GP7 A;  5EDS A;  4HDQ A;  3C8Y A;  3OAW A;  2KTF A;  3M62 B;  4PS8 A;  2KHW B;  4EE2 A;  2VH1 A;  2RDG A;  3DWG C;  1PGB A;  1EO6 A;  1HQR D;  3FAH A;  5CHW A;  3Q6B A;  4N6E B;  3V60 A;  3ABV B;  4NQL B;  1S1Q B;  1Q10 A;  1NYR A;  2H89 B;  1V1P B;  3GZN B;  4MDK E;  3U4E G;  4C7Z A;  4RF1 A;  2SAK A;  2D3G A;  2O2V B;  3PRZ A;  1V86 A;  2BWF A;  4WQO B;  2FCS A;  2FAZ A;  3ZNZ B;  3RNF C;  3N9Y C;  2L0T A;  2I2Y A;  2JZP A;  3PZD A;  2N9K A;  1ZUD 2;  2KZR A;  5CTR C;  3MTN B;  2WXF A;  2H88 B;  4XX5 A;  2N0S B;  2K6Q A;  3ML8 A;  3PRE A;  1V6E A;  4XZ4 A;  4I6P A;  5TSS A;  2QEJ C;  3DBR B;  2X8X X;  3WAL A;  3ZO5 B;  4HWI B;  3NS8 A;  1JML A;  1DYQ A;  2ONQ A;  4ZRQ A;  1K52 A;  3R2T A;  2UWQ A;  1ENF A;  2HTH A;  1Q0W B;  5L95 C;  3BZD B;  2CU3 A;  4GDL A;  3ECI A;  1X1M A;  2RMM A;  2KWU B;  3R7R A;  3KVF B;  3JW0 X;  5T8I A;  4BVU C;  2W3S A;  1E7U A;  4FAD A;  1I7H A;  3KLS X;  4G0N B;  3UQB A;  1IGC A;  3VH3 B;  1ZDX A;  3Q69 A;  1DGJ A;  4F8C B;  2J4X A;  4M02 A;  3ZGZ A;  1FMA D;  2DZJ A;  4CO7 A;  4KIK B;  3HIZ A;  3M3J A;  3RFZ B;  3AU5 A;  2NBU A;  1WJN A;  3QK0 A;  1S3S G;  1T0S C;  4NY0 A;  2WXM A;  4JWU C;  4AUQ C;  4TQ1 A;  2PE9 A;  2ZPN A;  2LWP A;  2LVP A;  1FFV A;  2CS4 A;  2MJD A;  1IBX B;  4OVZ A;  1ZKH A;  4HRO A;  4NAW A;  4NPN A;  4FHJ A;  4KSL C;  2FCM A;  3W1Y A;  3SD5 A;  1XEE A;  2AL6 A;  2PPH A;  3VAW A;  3R2I A;  3PLU A;  4IWO A;  3ML9 A;  3P63 A;  2KO3 A;  3TEY A;  1WX8 A;  4A8X C;  2WXQ A;  3RZW C;  3A9K A;  1WJU A;  3GE8 C;  2PTL A;  3CSF A;  2NPT A;  4KGS A;  4ICV A;  4RM9 A;  1D5Z C;  2N9L A;  3TUO A;  4S17 A;  2BKF A;  2K1F A;  4DDI D;  2JX5 A;  1TS5 A;  2WP9 B;  2K8H A;  3U2S C;  3AE1 B;  4FJZ A;  4OZA A;  3RD2 A;  4F1S A;  2KLG A;  2KQS A;  1F2R I;  3L54 A;  3VUX A;  1EUV B;  4FHK A;  3NVV A;  4LNK A;  2KDM A;  2JYT A;  1PUT A;  3RNA C;  4HVB A;  3GOE A;  2LEK A;  4WJP A;  1M94 A;  2M0X A;  4K7U A;  2IPK D;  2GB1 A;  4US8 A;  3W5U B;  2IY0 B;  4A55 A;  5BMI A;  4QAY A;  3NY5 A;  1I4X A;  4N59 A;  3EFU A;  1Q5W B;  4PYU A;  4KZ0 A;  3AEB B;  1EF1 A;  1FFU A;  1IGD A;  1WXM A;  4FJY A;  3BY4 B;  1FEH A;  1GC6 A;  5D3D A;  4N58 A;  1BUI C;  3Q8A A;  1CJE A;  4IDI A;  2IZV B;  2WXI A;  4DXF A;  2MJE A;  1GB1 A;  3EC8 A;  1TZO A;  1QOB A;  1WFY A;  1ACC A;  1JQ4 A;  3R8B A;  3OJ3 A;  3RZF A;  1V1P A;  3PGE A;  2N4F A;  3AUL A;  3UF8 A;  1I35 A;  1ZPS A;  2O2V A;  3ZJV A;  1WR6 E;  2QSD A;  1UBI A;  3N1Y C;  4JE3 B;  3RNG C;  1YIW A;  5DPW A;  4WAF A;  2BKR B;  2JRI B;  1WJ4 A;  4DBG A;  3BWU D;  1C4P A;  3M63 B;  3ZIM A;  4C7Y A;  2K8C A;  4A3P A;  4A3O A;  3DBH B;  3IT6 B;  3HM6 X;  3Q8F A;  1PYW D;  1RFK A;  5C2T B;  2KDE B;  5IP4 D;  1F77 A;  4ZDV A;  3AH7 A;  4URK A;  2KQ7 A;  3N32 A;  2V3N A;  3VR8 B;  3T8M A;  1WXA A;  2BQQ A;  4LNO A;  3N30 A;  4WQM A;  1ZE3 D;  1ROE A;  1DOX A;  2MHJ A;  5FR6 A;  4W9G A;  5AZH A;  1TS3 A;  3PVL A;  2JF5 A;  1YN4 A;  3L10 B;  4BBN C;  5E6P A;  2DYO A;  2REX A;  1VZ7 A;  1EM7 A;  3MP9 A;  3PO0 A;  4KV2 A;  4DDG D;  1A70 A;  3IAS 1;  3KUC B;  4KIK A;  2L00 B;  3LDZ E;  4WH4 A;  4LJP B;  3PRM B;  5HG2 A;  3R66 C;  5J18 A;  5KHO A;  1JWB D;  1V9J A;  1N6Z A;  2N7D A;  1IBX A;  1JW9 D;  2IO0 B;  4W9H A;  1VJK A;  2NTS A;  3N1Z C;  2ZW1 A;  2FE8 A;  5AUK A;  2NBW B;  2V3S A;  2ZW0 A;  3DWM A;  5BYR A;  3ZTD A;  1SE9 A;  4IUM B;  2KDB A;  4TQ0 A;  4WUR A;  2W3R A;  3I57 A;  5DCN A;  4TKN A;  2MQJ A;  4ITK A;  2FCN A;  1E10 A;  3QWZ B;  4PS7 A;  2LAS A; 
#chains in the Genus database with same CATH homology
 2Z0E B;  2NPT B;  4E71 A;  1YD8 U;  1G6J A;  4MSM B;  3PHW B;  3JVZ X;  1NI2 A;  4FBJ B;  5IA7 A;  3ONS A;  4ZRI A;  4AOF A;  3NHE B;  5D2M B;  2K8B A;  2Z0D B;  1XD3 B;  3WAP A;  2LGD A;  2KX0 A;  2ZEQ A;  3UIN B;  2MP2 A;  4ASW C;  1WJ6 A;  3TCA A;  2OJR A;  1OEY A;  2D2Q A;  2L0F A;  2FUH B;  4AWJ A;  1WXS A;  3QQ8 B;  4HK2 A;  4LCD E;  4NQK E;  4LDT B;  4KSK C;  2W9N A;  1IP9 A;  4PYZ A;  2DYB A;  3GZN I;  1TTN A;  2N1W A;  4OVU A;  4ANW A;  2KFK A;  4GSW A;  4FA6 A;  1TGZ B;  4DWF A;  4I6N B;  4ICU A;  2CHX A;  2WX1 A;  1Q1O A;  4KDL B;  4IM2 A;  4RM8 A;  5D94 A;  3Q3F A;  3KUZ A;  5LXI B;  4WWN A;  1WH3 A;  2KTR A;  4KZC A;  3TMP B;  2MLB A;  2IY1 B;  2N9E B;  2L05 A;  4AJY B;  2DAF A;  2NS5 A;  1WI0 A;  1MG8 A;  1E8Y A;  2GBR A;  1ZGU B;  4GIV A;  2NCN A;  1IPG A;  1TBE A;  3H9D A;  2M8S A;  2LUE A;  3AXC A;  4DHZ B;  4W9K A;  2C60 A;  2MBO A;  4BBN F;  5KHQ A;  4M8N A;  4II3 B;  5CHF A;  2KJH B;  3A4S C;  1UEL A;  2JRH A;  3SHQ A;  1WY8 A;  1P9D U;  5TR5 A;  4N9F 4;  1YJ1 A;  4ZYN A;  4IM0 A;  3IG3 A;  1WIA A;  4W9F A;  1WMH A;  3M95 A;  1T0Y A;  2MW5 A;  3VUY A;  1J8C A;  4J6I A;  3ZVV A;  2LD9 A;  2NVU I;  3QA8 A;  3DBR I;  1LXD A;  1E7V A;  5EDS A;  2J7Q B;  4HDQ A;  3OAW A;  2KTF A;  3M62 B;  4PS8 A;  2KHW B;  4EOY A;  2V4L A;  2JUO A;  3UGB B;  3K9P B;  3PTF C;  2RSU A;  5IAA C;  1OEY J;  1EO6 A;  5G55 A;  2GOW A;  3PLV A;  2DZK A;  4JLC A;  4AP4 C;  1R4M I;  2JT4 B;  4BOS C;  3HK0 A;  5CHW A;  3B1L X;  1H8C A;  4X57 B;  2WYQ A;  3TIX A;  2I1K A;  3JSV B;  3VHT C;  3V60 A;  2R2Q A;  4ANU A;  4NQL B;  2KWC A;  1WE7 A;  4FJV B;  1S1Q B;  3V6E B;  4ANX A;  2K6D B;  4KVG B;  4MDK E;  5C1Z A;  4WJQ A;  3RYT A;  5LLI A;  2ZZP B;  4I6L B;  1Z5S B;  1J0G A;  2D3G A;  2O2V B;  3ENE A;  3PRZ A;  1V86 A;  2MX2 A;  3HM3 A;  2ZNV C;  2BWF A;  4WQO B;  2FCS A;  4IC7 B;  3TBL D;  2FAZ A;  3ZNZ B;  4EZJ A;  2ASQ A;  2KMC A;  2L0T A;  3PZD A;  2CKH B;  4PS3 A;  4GB9 A;  2KZR A;  3ZTC A;  4EKU A;  5CTR C;  3H7P B;  3MTN B;  2PEA A;  4DHJ D;  5JH5 C;  4K7S A;  2B3A A;  2KK8 A;  3APD A;  4XX5 A;  3R7Q A;  3LJ3 A;  2IO3 B;  1WGG A;  5DPT A;  2JVC A;  3PSE B;  1WZ3 A;  3V61 A;  1QZE A;  2K6Q A;  2NBV B;  1L7Y A;  2XK5 B;  3ML8 A;  2AYO B;  1V6E A;  3ALB A;  3PRE A;  4XZ4 A;  4I6P A;  2RR9 A;  3O65 B;  2NR2 A;  1YQB A;  3H1U A;  4CHK A;  1A5R A;  3WAL A;  3ZO5 B;  4HWI B;  5J2R A;  3IHP C;  1J19 A;  2EKE C;  3NS8 A;  1NBF C;  3ZLZ A;  5CHV C;  3DBH I;  3K9O B;  4ZRJ A;  4LDT D;  1Y8R C;  2D11 A;  2BPS A;  4B6W A;  2UWQ A;  2BWE S;  2HTH A;  1Q0W B;  3W1S A;  5L95 C;  3CST A;  3UIO B;  2OOB B;  2WDT B;  4K1R B;  1KJT A;  3U30 A;  4GDL A;  4W9J A;  4WWO A;  3ECI A;  3MJW A;  3QC8 B;  1R4N I;  3QX1 A;  2N9P C;  5JZE B;  2MBQ A;  2KDI A;  1WM3 A;  1X1M A;  2FNJ B;  2KWU B;  3R7R A;  2M17 A;  3KVF B;  1RFA A;  3JW0 X;  4BVU C;  1KM7 A;  3DCG A;  2XBB C;  1E8W A;  1ZW7 A;  1E7U A;  2PJH A;  3A9J B;  4FAD A;  2LGY A;  2RD0 A;  2ZJD A;  4G0N B;  3UQB A;  3VH3 B;  2MBB B;  2J0J A;  5AZG A;  4JL9 A;  4GDK B;  3WAO A;  4DXA B;  4F8C B;  3KYD D;  2D10 A;  2MA9 B;  3L08 A;  1OGW A;  4HPM B;  1WX7 A;  2DZJ A;  2AL3 A;  3DVN V;  4BKG A;  2L76 A;  4CO7 A;  3WIM A;  4KIK B;  2J0M A;  5L83 A;  3HIZ A;  3M3J A;  2BYV E;  2N9X A;  3AU5 A;  2KDF B;  2NBU A;  1WJN A;  2C5L C;  2RGF A;  3QK0 A;  1S3S G;  3ZKJ C;  3UQA A;  2BF8 B;  2AEH A;  2JWZ A;  1LQB A;  3VTV A;  2JPH A;  4HXD A;  4NY0 A;  4AUQ C;  3RT3 B;  3HHM A;  3JYU A;  4TQ1 A;  2LZ6 A;  2PE9 A;  4JGH B;  2ZPN A;  2LWP A;  2O6V B;  2LVP A;  2V1Y A;  4ZRK A;  2CS4 A;  2GBK A;  1GG3 A;  3ZDT A;  3KYC D;  1ZKH A;  2I1J A;  1E90 A;  2ZVO A;  4RMA A;  4NAW A;  2MBH A;  2EMT A;  2C7N B;  3B08 A;  3PHX B;  2DX5 B;  4GU2 A;  4NPN A;  1AAR A;  4DK5 A;  4FHJ A;  3ZNH B;  1U4A A;  1YX6 B;  4GN1 A;  2LVO A;  3DVG Y;  4KSL C;  2FCM A;  2N1V A;  1GC7 A;  2XEW A;  1GJZ A;  3W1Y A;  3SD5 A;  4G3X B;  2AL6 A;  2KJR A;  4GMV A;  2PPH A;  3KW5 B;  3RUL A;  3WAM A;  3VAW A;  4A20 A;  4MJS B;  3PLU A;  4GOC A;  3ML9 A;  4IWO A;  3VQI A;  1WYW B;  2KO3 A;  4E3C A;  2KD0 A;  1L2N A;  1WX9 A;  2ZCB A;  4B9K A;  1WX8 A;  3NZU A;  3CMM B;  1LM8 B;  1GUA B;  2ZCC A;  4W9C A;  1K8R B;  3RZW C;  2ZNV B;  3A9K A;  4YL8 A;  1WGR A;  1UH6 A;  1WJU A;  4E74 A;  4W9E A;  2LRU A;  3A1Q A;  1I42 A;  4EFO A;  3CSF A;  4II2 B;  2L7R A;  4G11 A;  2NPT A;  3ZW3 A;  2BYF A;  4ICV A;  3APC A;  4RM9 A;  3QIJ A;  2C9W B;  3L0W B;  3X0W A;  2LXC A;  1P1A A;  2BKF A;  4NNJ B;  2K1F A;  3NZS A;  4DDI D;  2IO2 B;  4W9L A;  3CF6 E;  2KLC A;  4MM3 A;  3PV1 A;  4M8M A;  2ZPY A;  2D07 B;  3SU8 X;  1TZ1 A;  2DHZ A;  2RPQ A;  2K8H A;  4XC2 A;  4B95 A;  4FJZ A;  3RD2 A;  4F1S A;  2KLG A;  2KQS A;  4W9D A;  5HKH A;  1VD2 A;  2KFK B;  3L16 A;  3TJP A;  3L54 A;  2G3Q B;  1EUV B;  4FHK A;  3VUX A;  3A4R A;  2CHZ A;  5C23 A;  3U7D A;  1LFD A;  2MBE A;  3KUD B;  2KVR A;  2KTR B;  4HVB A;  4MEL A;  3GOE A;  4M0W B;  2KFJ A;  2JY6 A;  4WWP A;  1WRD B;  3T9L A;  3VDZ A;  1RRB A;  3ZRC A;  1UZX B;  4WJP A;  4FUL A;  3WA0 A;  1M94 A;  2WX0 A;  2M0X A;  4K7U A;  5JHA A;  3KH0 A;  2KX3 A;  1NDD A;  2G45 B;  3ZNI D;  2IY0 B;  1C3T A;  4HLE A;  1WMH B;  2KWV B;  3C0R B;  3NY5 A;  4IM3 A;  2K25 A;  3EFU A;  2EMS A;  3DVN U;  2DZM A;  5CX3 A;  2IYD B;  1Q5W B;  4PYU A;  4EZL A;  4KZ0 A;  1EF1 A;  2FIF A;  1XT9 B;  2LRW A;  3DBS A;  4IW0 A;  4FLH A;  1SIF A;  4HCN B;  3QAQ A;  1UGM A;  1WXM A;  3D32 A;  3BY4 B;  3QHT A;  4FJY A;  2KJ6 A;  4MH0 E;  3UIP B;  4K81 A;  4BKS A;  4DHZ E;  1GC6 A;  4MGY E;  4GXB A;  3IBE A;  3WAN A;  4MEM A;  2KXJ A;  2IZV B;  3R3M A;  2O6V D;  2YLM A;  1GNU A;  4DHJ B;  2HD5 B;  4BKT A;  3EC8 A;  4HDO A;  4P7I A;  2GMI C;  3JSV A;  2AWT A;  1WFY A;  4BOZ B;  2IO1 B;  3QAR A;  3DVG X;  2LJ5 A;  2C7M B;  3IFW B;  3VUW A;  4EZK A;  3OJ3 A;  2J0K A;  4OVV A;  3RZF A;  1V5O A;  4W9I A;  3ZNG C;  2M4N A;  3PGE A;  2N4F A;  4IWP A;  3AUL A;  1RAX A;  3UF8 A;  3VTU A;  1I35 A;  1E8X A;  2WWZ A;  2MWS B;  1P0R A;  4BKS D;  2O2V A;  3SDL C;  4FN2 A;  1WR6 E;  1P3Q U;  3EHV A;  2VRR B;  1UBI A;  4EEW A;  2DEN B;  3PPA A;  5DPS A;  4HJK A;  1YIW A;  4JQW C;  3AU4 A;  2KN5 A;  5DPW A;  1SGH A;  2BKR B;  4LJO B;  3VFK A;  2DZI A;  3PRP B;  4IG7 B;  1KOT A;  2JRI B;  1WJ4 A;  2KMA A;  4DBG A;  3M63 B;  3ZIM A;  3H7S A;  3H7P A;  2K8C A;  2GBM A;  4GGQ A;  4A3P A;  1KLV A;  5JHB A;  4A3O A;  2LVQ A;  1Z2M A;  3AI5 A;  5E6O A;  3U8Z A;  4K7W A;  3DDC B;  5G2N A;  2C7H A;  2G4D B;  2CU1 A;  2A4Z A;  2MRP A;  3OJ4 B;  3HM6 X;  1OTR B;  2XK5 A;  2CHW A;  5J17 A;  2KOX A;  3L17 A;  2DYM A;  2QHO A;  2R2O A;  5GMV A;  2IBI B;  1FXT B;  1JRU A;  2Y5B B;  2KDE B;  4EUT A;  5DPR A;  2KAN A;  2YVC A;  1WR1 A;  3P2B A;  2L3Z A;  3A33 B;  4TUU A;  3V6C B;  1WXV A;  3TL5 A;  4NJ6 A;  1WF9 A;  4ZDV A;  5BO4 B;  3EEC A;  2UYZ B;  4BFR A;  4URK A;  2KQ7 A;  1H4R A;  3OLM D;  3X23 A;  3VTW A;  5LXH A;  3N32 A;  2K39 A;  2BGF A;  3VXW A;  2DAJ A;  3T8M A;  2ZVN A;  4GDL B;  5AZF A;  2KC1 A;  1WXA A;  3V62 A;  1P98 A;  2Z59 B;  3N30 A;  5D7G A;  3ZRF A;  1E8Z A;  2GBN A;  3H6N A;  4HPL B;  2MP2 B;  4IWQ A;  5FR6 A;  4W9G A;  5AZH A;  1HE8 A;  2KNB A;  3PVL A;  4MGZ E;  5D6J B;  3A9J A;  1ISN A;  2PE6 B;  3L13 A;  3W1S C;  2JF5 A;  3L10 B;  2LXA A;  4BBN C;  2JZZ A;  2L8J A;  2HJ8 A;  2MSE D;  1IYF A;  3BIN A;  5E6P A;  4GDK A;  2DYO A;  2REX A;  1WGH A;  4DDG D;  4KV2 A;  3Q3J A;  2LI5 A;  3DPD A;  1XQQ A;  1WGD A;  4KDI C;  1V80 A;  3KUC B;  4KIK A;  2L00 B;  3DQV A;  3PS6 A;  2GBJ A;  1C1Y B;  1UD7 A;  1RLF A;  3LDZ E;  4LJP B;  2MCN B;  2CR5 A;  4JIO U;  3APF A;  3PRM B;  3VH4 B;  2KKC A;  1V49 A;  4NJ7 A;  4G50 A;  3R66 C;  1WGY A;  3NOB A;  1F9J A;  5J18 A;  4MGK E;  3ZDM C;  1D3Z A;  1YX5 B;  1V81 A;  2O6V A;  3DBL I;  5KHO A;  1V9J A;  4MSQ B;  2N7D A;  1CMX B;  1V5T A;  3MHS D;  3QJZ A;  4ANV A;  2IO0 B;  2KC2 A;  3DOW A;  2JXX A;  4W9H A;  4NAW B;  1WE6 A;  3B0A A;  3ZUN A;  1WZ0 A;  1UBQ A;  2M1M A;  1EF5 A;  2A5U A;  2BYE A;  2NBW B;  2V3S A;  1PQS A;  2HE7 A;  2JZ3 B;  4AJW A;  1VCB A;  3RCZ A;  3ZTD A;  1BT0 A;  1SE9 A;  4IUM B;  4HCP B;  2FCQ A;  4CYE A;  2KDB A;  3IVF A;  3QCA A;  2G4S A;  4WJO A;  3RUI B;  1E5W A;  4TQ0 A;  3S2A A;  3VVW B;  4MGI E;  2FID A;  4MJS A;  5AEK B;  2N7E A;  2LGX A;  3PT2 B;  5DCN A;  1OQY A;  3I3T B;  4WAA A;  1WM2 A;  3N3K B;  2MQJ A;  4TKN A;  4WJN A;  1V2Y A;  2FCN A;  4TV3 A;  3A9K B;  3QWZ B;  5E6N A;  4F7Z A;  3A1Q B;  4PS7 A;  2LAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...