2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
b'PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
3DBRI 1CMXB 2V1YA 3HHMA 2MP2B 2KZRA 4NPNA 3SDLC 3ZW3A 4M0WB 1LQBA 1LM8B 2MLBA 5DCNA 3N32A 4W9IA 4HJKA 2RPQA 1VD2A 1OEYJ 1GG3A 1Q0WB 1WR1A 3OLMD 2UYZB 5D7GA 2YLMA 3SHQA 5KHQA 1ZGUB 3UQBA 2R2OA 3JYUA 4N9F4 4DHZE 3H7PB 4MJSA 3X0WA 1WYWB 4G11A 4HWIB 4IC7B 3PREA 2LRUA 4NNJB 2IY0B 2KD0A 2ZNVC 2LVPA 5CX3A 2DZJA 2N9EB 3AXCA 5C1ZA 1PQSA 3AI5A 4BVUC 3KUCB 3B0AA 2D10A 4FJZA 1QZEA 2A5UA 3VVWB 4A3OA 3IBEA 1UBIA 1E8XA 2JF5A 1Z5SB 2DYOA 1WRDB 4AOFA 3N3KB 4EEWA 1S3SG 1WE7A 1WH3A 2MBHA 2N7DA 3PRZA 2L00B 3UGBB 1I35A 1HE8A 3UF8A 1GJZA 1M94A 1XD3B 3QCAA 1RRBA 5KHOA 4HVBA 3MHSD 5JH5C 2NPTB 3I3TB 2XEWA 3K9OB 3ENEA 3CSFA 3HM6X 4OVUA 3PT2B 2M8SA 3EC8A 3RD2A 1WX9A 3VUYA 4CO7A 2KMAA 4URKA 1V9JA 3A1QB 4KVGB 3KW5B 1OGWA 2D11A 5E6NA 3VDZA 3PTFC 3M62B 3RUIB 4J6IA 3T8MA 4K7WA 3B1LX 3KYCD 3L54A 2K6QA 2ZZPB 4MDKE 4FJVB 4W9FA 4GIVA 1F9JA 4RM8A 4NAWA 5DPRA 3BINA 3RYTA 1L2NA 3PS6A 1WR6E 1P1AA 2MBEA 1Y8RC 2G45B 1ZKHA 3JSVA 4HDQA 4I6PA 4BKSD 4ANUA 3ZTDA 5J17A 1UD7A 2FCMA 1C3TA 3AULA 1UZXB 4B9KA 3JVZX 4DHJD 4W9LA 2DAFA 4G0NB 2BKRB 2K39A 2C7MB 4P7IA 3MTNB 3R7RA 1P0RA 2DYBA 1R4NI 1P9DU 4RM9A 1NI2A 4EZJA 3GOEA 2LUEA 3X23A 3GZNI 2Z0DB 3A9KA 3JW0X 2IZVB 3ZNGC 4WQOB 3V62A 2WDTB 2NBVB 3UINB 1V49A 2LGXA 2GMIC 3V60A 3R3MA 2D07B 2O2VB 4EZLA 1E90A 2NVUI 3VAWA 3M63B 2L7RA 4MELA 3ONSA 5DPTA 2RD0A 5LXIB 1WZ0A 2OJRA 2MSED 2L0FA 2WYQA 3A9JA 1WF9A 3ECIA 2HTHA 2L0TA 2FCNA 5CTRC 2MCNB 2BYVE 2DENB 4WAAA 5L83A 4K1RB 2D2QA 2LD9A 3TL5A 1H8CA 2LXCA 1GC6A 1V5TA 2CR5A 3VHTC 2J7QB 2KJRA 4MSMB 4WWOA 2R2QA 2MQJA 3NOBA 4PS8A 4KIKA 2K1FA 3DBSA 4K81A 4F1SA 2KXJA 4ZRKA 3W1YA 2CHZA 2XK5B 2AEHA 2IBIB 2LWPA 3PRPB 2KANA 1TTNA 2L05A 1L7YA 2IO0B 3ZNID 4PS3A 2JVCA 3WAPA 2NS5A 4MGIE 2PE9A 4II2B 4ZYNA 2L3ZA 3H6NA 2O6VD 2K8HA 1E8WA 4JIOU 4KV2A 1IYFA 1EUVB 4W9HA 2GBRA 4WJPA 3PPAA 3NZUA 3R66C 4IWQA 3OAWA 4B6WA 2N1VA 1K8RB 2RSUA 2M17A 4HPMB 2JRHA 2GBNA 4MJSB 3NHEB 3PHXB 2IO1B 2JY6A 2N9XA 4ANXA 1TGZB 1E5WA 3MJWA 3PV1A 2M0XA 3W1SA 2BYEA 2ZPYA 3QK0A 5CHFA 4ZRIA 1A5RA 3DQVA 3ZO5B 1FXTB 2ZJDA 2Z0EB 5D2MB 4WJOA 2MW5A 1GNUA 4BKSA 4LDTD 2DZIA 4X57B 2KHWB 3ZVVA 2Z59B 4IUMB 1TBEA 2KJ6A 2FCQA 3TMPB 3V6EB 5E6OA 4FHJA 4MGZE 3NZSA 3WIMA 1WI0A 2CHWA 2KJHB 4GGQA 2MBQA 4GN1A 4PYUA 2ZNVB 2ZEQA 4GDKA 1YX6B 4IWOA 1WJ6A 5JHBA 2KWVB 3APFA 2DHZA 2C9WB 5LXHA 2MBOA 4GXBA 1WM3A 3H9DA 2IYDB 1U4AA 4K7SA 2DAJA 3U30A 2I1JA 3AU4A 1NDDA 4IW0A 2KNBA 4BOSC 2C60A 5AZGA 1KJTA 4BKTA 1UBQA 1Q1OA 4ZDVA 2WX1A 3L08A 3QQ8B 2J0KA 2MWSB 2LGDA 2AYOB 2ZPNA 3JSVB 4RMAA 2L8JA 1WM2A 3ZRCA 3ZIMA 3RZFA 1WJ4A 3ML9A 4WJQA 2KDEB 4WWNA 3OJ4B 3ZNZB 4EKUA 2KX3A 2CU1A 3TIXA 2RR9A 1OTRB 2EMTA 4A3PA 1J8CA 2KDIA 4ANVA 1EO6A 1V2YA 4CYEA 3DVGX 5JZEB 1EF5A 3WANA 3L13A 2M1MA 1WMHB 2KFKA 1J0GA 2KLGA 2REXA 3O65B 4K7UA 4BFRA 3A9KB 4IM2A 2W9NA 1LXDA 4BBNC 5G55A 1Q5WB 2KWUB 4PYZA 5CHWA 3EHVA 2O6VA 3TBLD 2N7EA 3UIOB 2N9PC 4LCDE 3UIPB 1YIWA 2LJ5A 1Z2MA 1I42A 2KTFA 2KQ7A 4W9CA 3RT3B 4AP4C 4DK5A 3RCZA 2JUOA 2V3SA 2KTRA 3IVFA 4G50A 3AU5A 2KC1A 2ZVNA 3ZRFA 4EZKA 3U8ZA 3A9JB 2HD5B 1TZ1A 3H7SA 4MGYE 4W9EA 3A4RA 4KSLC 3RULA 1ZW7A 2ZCBA 3RZWC 4A20A 2A4ZA 2BWFA 1SIFA 2CS4A 2NR2A 2MA9B 3P2BA 1IPGA 4FLHA 1YX5B 2FIFA 3ZLZA 4EOYA 1V80A 2K6DB 3HM3A 2DZMA 2GOWA 1XT9B 3PLUA 4KIKB 3ZNHB 1WX7A 4MH0E 2JWZA 3APDA 4DBGA 4NJ7A 1E8ZA 3PSEB 3VUXA 3VUWA 2NBWB 2BKFA 4FHKA 3VFKA 4JGHB 4G3XB 5J2RA 4E74A 2N4FA 5J18A 4MGKE 1IP9A 4IG7B 2CHXA 2KWCA 1OQYA 4AJWA 3VTVA 3B08A 4FA6A 1NBFC 1V6EA 2DX5B 4AJYB 2I1KA 2OOBB 3VXWA 3PHWB 1WJUA 1GUAB 3VH4B 1WIAA 3CF6E 3KYDD 2VRRB 2DYMA 2DZKA 3NS8A 4B95A 4GDLA 3W1SC 1WGDA 2Y5BB 3CSTA 2FUHB 2JPHA 2KOXA 5TR5A 3N30A 4AWJA 1SE9A 2N1WA 2EKEC 4JL9A 4OVVA 5DPSA 3KUZA 3QAQA 3V6CB 3L10B 2KFJA 4KZCA 2B3AA 1WGGA 2FAZA 4GOCA 3L17A 2WWZA 4MEMA 2BGFA 2JT4B 1WGHA 2RGFA 4HCNB 4DHJB 5BO4B 2KN5A 4MM3A 2K25A 4ANWA 3NY5A 1OEYA 1WE6A 2J0MA 4CHKA 3A33B 3D32A 3ZUNA 1MG8A 2LRWA 2IO3B 4W9KA 3DPDA 1BT0A 1UGMA 2FNJB 4GU2A 2AL6A 4W9GA 2LI5A 2HE7A 1V5OA 4DDGD 4I6NB 2KMCA 2MRPA 4HDOA 1AARA 3KUDB 2FCSA 5LLIA 3WA0A 3VH3B 1YD8U 2AWTA 3ZKJC 4MSQB 1P3QU 2KQSA 4ASWC 2WX0A 4I6LB 2UWQA 4BBNF 4W9JA 1V86A 5DPWA 3SU8X 2ASQA 2M4NA 4GSWA 1WXVA 2LZ6A 2PE6B 3QX1A 4XC2A 1KM7A 4XZ4A 2KFKB 2LVOA 2GBMA 1X1MA 2KVRA 4FADA 3TJPA 1R4MI 2KX0A 4NAWB 4IM3A 1KOTA 4DDID 2MP2A 2IO2B 4NQLB 5L95C 2KKCA 2KC2A 2O6VB 3T9LA 3VTUA 3V61A 5D94A 3DVNU 3C0RB 2JXXA 3DVNV 5FR6A 4NY0A 4HLEA 3DVGY 5EDSA 3OJ3A 1VCBA 2BF8B 5GMVA 1J19A 5AZFA 2KTRB 4TV3A 4TQ1A 2JZ3B 3HK0A 3EECA 4BKGA 1KLVA 1E7VA 1RLFA 2KDFB 2ZVOA 3HIZA 1E8YA 4HPLB 3H7PA 1SGHA 2C7HA 3Q3JA 2AL3A 2G3QB 4BOZB 1YQBA 3QA8A 4FJYA 4NJ6A 1UH6A 2J0JA 2L76A 1T0YA 3APCA 3ML8A 4HXDA 1EF1A 4E71A 4E3CA 3A4SC 1XQQA 3H1UA 3QARA 4JQWC 1WGRA 4DXAB 4EFOA 4WWPA 4LDTB 1YJ1A 4DHZB 3DDCB 2GBKA 2QHOA 3DCGA 2LGYA 4KDIC 1WY8A 4TUUA 1H4RA 2IY1B 1RAXA 4FBJB 1ISNA 3SD5A 4JLCA 2FIDA 3U7DA 4EUTA 3PRMB 4PS7A 2G4SA 1P98A 4IWPA 3DBHI 2NPTA 4KDLB 1WX8A 1WXAA 2EMSA 3TCAA 3M3JA 2KLCA 1E7UA 2PJHA 3PGEA 3VTWA 2JRIB 4F8CB 1D3ZA 1LFDA 4W9DA 2ZCCA 3DBLI 1WGYA 3A1QA 3IFWB 2PPHA 2YVCA 4GDLB 4GMVA 1WMHA 4II3B 4YL8A 5D6JB 3ALBA 5AEKB 3WAMA 2KO3A 2HJ8A 4ICUA 4TKNA 5AZHA 2CKHB 4WJNA 2K8CA 5IA7A 1GC7A 1WXSA 1JRUA 3QC8B 4LJOB 5IAAC 3QHTA 3KH0A 2NBUA 4FULA 3ZDTA 2D3GA 3PLVA 4GB9A 1S1QB 3S2AA 1WFYA 2JZZA 3Q3FA 4KSKC 3WAOA 2KK8A 4FN2A 1RFAA 3QJZA 4KZ0A 3CMMB 3R7QA 4M8MA 3IHPC 4DWFA 3BY4B 2MX2A 4HCPB 3LDZE 2KDBA 3KVFB 2NCNA 3QIJA 2BWES 3PZDA 2LVQA 2GBJA 4IM0A 4F7ZA 3UQAA 2O2VA 5G2NA 3EFUA 2LASA 3VQIA 4TQ0A 5C23A 2C5LC 1V81A 5CHVC 3QWZB 2G4DB 2BPSA 3LJ3A 4GDKB 2LXAA 2XBBC 3L0WB 3L16A 4HK2A 2BYFA 1UELA 4NQKE 2C7NB 5E6PA 1WZ3A 4LJPB 3IG3A 2PEAA 5JHAA 3PVLA 5HKHA 3DOWA 3ZTCA 1WJNA 3K9PB 3WALA 1G6JA 3ZDMC 4M8NA 1WXMA 2V4LA 4ICVA 2K8BA 3M95A 4AUQC 2MBBB 2XK5A 4XX5A 4ZRJA 1C1YB
chains in the Genus database with same CATH superfamily
1PGBA 3HHMA 2MP2B 4NPNA 4M0WB 1LQBA 1VD2A 1WR1A 1GG3A 1MPEA 3OLMD 1GOZA 3SHQA 1FXIA 1PUTA 3H7PB 4MJSA 1I4XA 3PREA 4IC7B 1FEHA 2IY0B 2KACA 3TEWA 2LVPA 1JMLA 1UF0A 2WXOA 1E0ZA 3KUCB 2D10A 2PLPA 1YN4A 3VVWB 3T3NA 4A3OA 3P63A 2WP9B 1QF6A 2JF5A 3FILB 3N3KB 4QAYA 1YQ3B 4EEWA 3UGBB 1LO5D 3PRZA 1HE8A 3DWMA 1WRIA 3QCAA 4XDCA 1RRBA 1ROEA 3MHSD 4YSXB 4OVUA 2K9XA 3EC8A 3VUYA 1ZXIA 1FD6A 3T8MA 3RUIB 1YN5A 3L54A 2K6QA 2WXLA 1V8CA 2ZZPB 4W9FA 2AQ2B 3WCQA 1AWDA 5DPRA 3RYTA 1WR6E 1JALA 1P1AA 2INPE 4BKSD 3ZTDA 1UD7A 2FCMA 3AULA 1UZXB 4DXFA 2DAFA 4G0NB 2K39A 2C7MB 3R7RA 2DYBA 2GI9A 4RM9A 3GZNI 3JW0X 1AYFA 3IAM1 1SSNA 1XXGA 2ACZB 3V60A 3R3MA 2D07B 1EU3A 2NVUI 3P4RB 3M63B 3AB5A 2WYQA 1WF9A 2BYVE 4OZCA 2LD9A 1H8CA 2RDHA 3HRDD 4DQOC 2J7QB 4MSMB 4WWOA 4PS8A 4F1SA 1SEBD 2BS3B 2AEHA 2LWPA 3AH7A 3AEEB 2IO0B 2PE9A 4II2B 4ZYNA 2L3ZA 2QSDA 3H6NA 2K8HA 4R3DA 4S17A 2L83A 4IWQA 5BMHA 2RSUA 3BVMA 4ANXA 1TGZB 4HROA 1SB3C 3QK0A 3AECB 5D2MB 1P7EA 4X57B 1TBEA 3TMPB 2OJWA 2VH2A 3V6EB 1WXQA 5E6OA 4MGZE 2JXTA 2X38A 2CHWA 1TS2A 1R7SA 1RYJA 4GDKA 4IWOA 1SJHD 5JHBA 1C77A 2DHZA 2C9WB 1WM3A 2BBCA 2DAJA 2EKIA 2I1JA 2KAJA 2KNBA 4BOSC 2PVOD 2JYTA 1DOYA 4BKTA 4ZDVA 3L08A 2MWSB 2AYOB 1B1ZA 2ZPNA 3JSVB 2L8JA 3OJ4B 2BW2A 3RNGC 4A3PA 1EO6A 1V2YA 4RGMA 3WANA 3L13A 2M1MA 1A70A 3KWLA 3GZNB 2KFKA 2REXA 4K7UA 4BBNC 4PYZA 1XO3A 3TBLD 3UIPB 1I42A 2V3PA 2KTRA 4BZAA 1TKYA 3ZRFA 3U8ZA 1N60A 1ZW7A 4A20A 3R2TA 1SIFA 2MA9B 3ZLZA 1Y56A 1MFWA 4MH0E 4DBGA 1E8ZA 1FFUA 3VUXA 4FHKA 3VFKA 3RNCC 1P7FA 4E74A 3E9SA 5J18A 3P4SB 1OQYA 3B08A 4OHJA 4REZA 3PHWB 2DBYA 2WDQB 4OVZA 2DZKA 3SEBA 4GDLA 1WGDA 3CSTA 1QILA 3DHHC 2KOXA 3N30A 1OFFA 4LNOA 2Y3AA 2H88B 5DPSA 1HZ5A 2ON8A 3V6CB 4RGTA 1Q10A 1WGGA 2FAZA 3L17A 2WWZA 4HCNB 2JT4B 2RGFA 5BO4B 1JWSD 5EE9A 4HKQA 1IGDA 4RF1A 3AEAB 2PKOA 2M19A 2WXHA 2WXIA 1YMHE 2WNMA 4JWUC 3AE7B 2FNJB 3TEXA 1HA5A 1VLBA 3V3XA 5FR3A 4WH4A 2KMCA 2AQ3B 1AARA 1SIJA 3VH3B 2AWTA 1P3QU 2KQSA 5DPWA 2KQ4X 4GSWA 2PE6B 1XCQL 1KM7A 2GBMA 2WU5B 3Q8CA 5AUKA 2KKCA 2KC2A 2O6VB 4C7ZA 3V61A 1T6BX 5D94A 3OJ3A 5GMVA 3AE1B 3W5VB 3EECA 4BKGA 2KDFB 3IT6B 2ZVOA 3HIZA 2E6XA 2Y5CA 4FJYA 4NJ6A 3O13A 1EF1A 4LNFA 4YSZB 4JQWC 4DHZB 3KLSX 4PK1A 4C4VA 1H4RA 2IY1B 1RAXA 2BTEA 1PGAA 4XYCA 3U7DA 2G4SA 1P98A 3TCAA 2Y5PA 4RGOS 4UDUC 2INNE 1EU4A 2JRIB 4W9DA 1FRDA 2PPHA 2YVCA 4GMVA 1WMHA 5AEKB 2KO3A 1IBXA 2WLBA 4TKNA 4WJNA 2J42A 3ETRA 3AE8B 3QC8B 3QHTA 4NAMA 2NBUA 2Z8LA 3ZDTA 3MP9A 3RNFC 3WAOA 4KZ0A 3QJZA 3CMMB 3R7QA 3RMKC 5IOIA 4BAXA 4M8MA 2LGSA 2D5GA 1QOFA 2LVQA 2UU7A 1J7AA 1F2RC 1FNUA 1V81A 3QWZB 4RFBA 2V4IB 2LXAA 2XBBC 3L16A 3W2DA 2BYFA 1UELA 2PEAA 1ZE3D 1FNWA 2MEKA 3DOWA 3ZTCA 1WJNA 4MACA 3WALA 2V4LA 3R2IA 3M95A 2MBBB 2XK5A 4XX5A 1C1YB 4FXCA 2KZRA 1ET6A 5G5HA 4IOIE 5DCNA 2R61A 1K52A 4YT0B 4L1BA 1C4PA 5KHQA 1ZGUB 4LTUA 2R2OA 3JYUA 4N9F4 2WQYB 2V3NA 1WYGA 2K3UA 2AX5A 1VZ6A 5C1ZA 1KLGD 1ZP0B 4NZLB 4FJZA 1QZEA 3VRAB 1KH0A 2W3RA 3IBEA 1CJEA 4YTNB 1E8XA 1Z5SB 1WRDB 3NZ3A 1WH3A 2N7DA 2L00B 1I35A 3UF8A 4HVBA 3DHGC 1GB1A 3HM6X 3PT2B 2M8SA 2INCC 1WX9A 4URKA 4L2YA 3A1QB 4KVGB 3KW5B 1OGWA 1B9RA 4JPSA 3RI7C 3M62B 4J6IA 3KYCD 4D2KA 3LYYA 4A9AA 3AEDB 4K3CA 3BVZA 2G45B 4HDQA 5E6JA 4B9KA 1K51A 3GOEA 3X23A 1E6EB 2Z0DB 3A9KA 2IZVB 3DWGC 3UI3A 2WDTB 1UNSA 2LHEA 5EE0A 2NBVB 3UINB 2O2VB 4M01A 5DPTA 2IJ0A 3A9JA 5LNK1 2L0FA 3ECIA 2HTHA 3NVZA 5L83A 4WAAA 3TL5A 2JSVX 2ZW1A 2CR5A 2FUG1 3VHTC 3HVZA 2XNAC 2MQJA 2KXJA 3BIID 2IBIB 3PRPB 1TTNA 2L05A 1L7YA 3ZNID 3WAPA 2JVCA 4MGIE 4L23A 4KV2A 4JIOU 2X8XX 2GBRA 4WJPA 3PPAA 3NZUA 2TSSA 5EE1A 4B6WA 1BXTA 2M17A 4HPMB 4MJSB 3NHEB 1TYGB 2J52A 1L0VB 2PVGC 2IO1B 2NMQA 3GP7A 1XF5L 1E5WA 3I9V1 3PV1A 3RNAC 3W1SA 2BYEA 2ZPYA 3I63C 1FXTB 2ZJDA 3C19A 4BKSA 3VR8B 1PYWD 1KFYB 2KJ6A 3GB1A 4FHJA 4A55A 3J9CA 3RPFC 2MBQA 5HHDG 2N9LA 1YX6B 5FK9C 1WJ6A 3Q14C 3APFA 2MBOA 1I7HA 1U4AA 1DGJA 3U30A 2C60A 2G1EA 1UBQA 2L32A 2BT6A 2WX1A 1JROA 4WWNA 1TY2A 2CU1A 3TIXA 2RR9A 2EMTA 1J8CA 2RPVA 1TS3A 2WXFA 4M02A 1EWYC 2N7JA 1TJEA 3BYYB 2BQQA 1T0QC 2SAKA 3IAS1 4IM2A 2W9NA 1LXDA 4YTPB 1MHHE 5CHWA 1TY0A 3UIOB 4LCDE 1YIWA 2KTFA 4G50A 3T3OA 1I4QA 2KC1A 3BK1A 4EZKA 2QC8A 4MGYE 3ZGZA 1AW7A 5BMIA 2ZCBA 1PDXA 2J53A 3AE6B 2ONQA 4ARIA 1V80A 2DZMA 1XT9B 3PLUA 3ZNHB 1WX7A 4ACFA 2MJEA 2JWZA 5C2TB 3PSEB 3P42A 2NBWB 4JGHB 4N58A 1YJIA 4IG7B 4B0EA 4FA6A 2D3CA 2DX5B 4AJYB 1I4HA 2M0AA 4LLGM 3VH4B 4EE2A 3CF6E 3KYDD 1D5ZC 2JPHA 1OQRA 5TR5A 1SE9A 2EKEC 3AN1A 2LUMA 1TT5B 2KMMA 2YEPF 3ZQ4A 2Q5WD 4OZBA 2B3AA 2VZKB 4HRSA 1D4BA 4DHJB 2BGFA 1WGHA 2H89B 2E3TA 1N5XA 5D3IB 2K25A 4ANWA 2V0GA 3NY5A 3HVDA 2IO3B 2LRWA 2MJ3A 4W9KA 3DPDA 3GS2A 4LNNA 1UGMA 2AL6A 4KX6B 4DDGD 1UWXA 3AE4B 1KLUD 3KUDB 1HZ6A 4RGNA 1JWAD 4IKGA 4XGAB 1PFDA 1ZDXA 4HKZE 3WA0A 1YD8U 3MC8A 3ZJTA 2WXMA 1V86A 2ASQA 1WXVA 2LZ6A 3QX1A 5IO9A 2KFKB 2LVOA 3U52E 4FADA 4O1NA 4NAWB 4IM3A 3BYTB 2MH7A 3VTUA 3T9LA 3DVNU 4NY0A 1E10A 4US9A 2KTRB 4TV3A 2JZ3B 3SFEB 4RCOA 3Q69A 4HPLB 3Q3JA 2AL3A 2G3QB 2W3SA 2FE8A 4BOZB 1YQBA 2J0JA 3APCA 1T0YA 4E3CA 2WXRA 3A4SC 2MHJA 1NEKB 1QKZA 2W54A 3Q8AA 4LDTB 4EFOA 1UWMA 3DDCB 2GBKA 4TUUA 2LJIA 4USAA 4JLCA 1FXAA 3P1MA 4IDIA 4EUTA 1XLOA 3AEBB 2QDFA 1ZDVA 4PS7A 3B2GA 4IWPA 2NPTA 4ARCA 1D3ZA 1LFDA 1WGYA 4GDLB 4WURA 5D6JB 3WAMA 3NUHB 2HJ8A 4ICUA 2DLBA 3EGRA 3AEGB 5AZHA 2CKHB 3Q3MC 2K8CA 1VZ8A 4LJOB 2GRIA 3DHIC 5EE3A 2D3GA 3S2AA 4FN2A 4DWFA 3BY4B 4HCPB 3LDZE 4C56C 4DXGA 1L0XB 2GBJA 1L6VA 3DBRB 5C23A 2C5LC 2LHDA 2G4DB 2BPSA 3L0WB 2KDMA 1VR9A 5HKHA 3ZXVA 1G6JA 4M8NA 4ICVA 1TZOA 4ZRJA 1T0SC 3KQ4A 2V1YA 1F2RI 3SDLC 3ZW3A 1JCKB 3N32A 4W9IA 4HJKA 1Q0WB 1SE3A 2UYZB 5D7GA 3X0WA 4G11A 4HWIB 2LRUA 4NNJB 2ZNVC 3AXCA 3AI5A 4BVUC 2A5UA 4C4VB 4AOFA 2CJNA 1S3SG 2MBHA 1GJZA 1M94A 2IPKD 3I3TB 1JW9D 3RD2A 1MG4A 4CO7A 2KMAA 1V9JA 1R4NB 3VDZA 3PTFC 4K7WA 1IBXB 3AE2B 4GIVA 3AEFB 1F9JA 4RM8A 1M4VA 1Y8RC 3V05A 4W9LA 4WAFA 2I2YA 3MTNB 2CJOA 1P9DU 4HEA1 2KWDA 4YSYB 1FPYA 2LUEA 2CU3A 3ZYYX 3ZNGC 1C4AA 2LGXA 1I4PA 2KYWA 1E90A 4YXDB 2L7RA 3ONSA 1VDVA 1WZ0A 2OJRA 5CTRC 2MCNB 2DENB 1N62A 4A8XC 1GC6A 4P16A 2KJRA 3P4QB 1KTKA 2BYTA 2R2QA 4KIKA 1E9MA 3DBSA 4K81A 3I5JC 4ZRKA 2PTLA 3FKYA 1CK1A 2XK5B 5D3DA 2G9HD 3BVGA 1NYQA 1XLPA 4PS3A 1C4CA 2NS5A 4Q2JA 4KGTA 2O6VD 1IYFA 1E8WA 1EUVB 3SR6A 1F1HA 3B9JA 1DOXA 3TEZA 3R66C 4YWGG 2N1VA 1K8RB 2GBNA 2ZW0A 2JY6A 2BB6A 3C8YA 2J4XA 3EA6A 3N1XC 3NVVA 2FBWB 3MJWA 4J3OD 2M0XA 4ZRIA 5CHFA 1A5RA 1GPXA 3ZO5B 2KVZA 3ZJUA 4K3BA 1YQ4B 5H8YE 1XLQA 2AQ1B 3ZJVA 3WIMA 2JU6X 1FCLA 2KJHB 2W82A 2YEPB 4GGQA 2K22A 4GN1A 3FAHA 2RDBC 4YTMB 2B76B 3FC4A 4KKIA 1NENB 4GXBA 4K7SA 3AU4A 1NDDA 5AZGA 3Q8EA 1I4RA 1Q1OA 2RMMA 3N20C 4RMAA 1WM2A 3ZRCA 3ZIMA 3ML9A 4WJQA 3TEYA 1JWBD 2KX3A 2EELA 1V1PA 3DVGX 1EF5A 3AMZA 2KLGA 4BFRA 3LB8C 3A9KB 1ET9A 1Q5WB 2KWUB 2M56B 1C76A 2N7EA 2LJ5A 3RT3B 2KQ7A 1JWMD 4W9CA 4AP4C 3RCZA 2JUOA 2V3SA 3IVFA 3AU5A 1MHXA 1C78A 2ZVNA 4H2AA 1MI0A 3A9JB 1XCTL 3H7SA 1ZXHA 4W9EA 3BZDB 3AM9A 3RZWC 2A4ZA 3P2BA 1IPGA 4FLHA 2FIFA 3NVYA 1NI3A 4EOYA 1JWUD 2K6DB 3HM3A 3I57A 4NJ7A 2BKFA 5J2RA 2WXNA 1CQVA 4MGKE 1IP9A 1K50A 2CHXA 1ZPSA 4AJWA 5JXVA 2IGGA 4M00A 4CQNA 2I1KA 2OOBB 3VXWA 4P6VF 1WGKA 1WJUA 1GUAB 1QOAA 1WIAA 4ZOHC 3NS8A 4B95A 3W1SC 2NTSA 2Y5BB 1HTOA 1ACCA 1WSPA 2V9HA 2KFJA 1TKEA 2PMVA 1L6UA 4MM3A 4RH6A 5FKAC 5G5GA 4B0MA 4C00A 1OEYA 4CHKA 3A33B 3Q6BA 3D32A 3ZUNA 4TMAB 1AN8A 3Q2AC 5HG2A 1BT0A 1TKGA 2LI5A 2HE7A 4JE3B 4I6NB 2MRPA 4HDOA 1V97A 5BYRA 5IP4D 5LLIA 3ZKJC 5IKCM 2WX0A 4I6LB 2UWQA 4LNIA 3RN9C 4W9JA 3B2FA 4XC2A 2M4NA 2KVRA 1FMAD 3TJPA 5BYSA 2KX0A 4S0RA 1SE2A 4DDID 2MP2A 2IO2B 3R8BA 4NQLB 5L95C 3DVNV 4HLEA 4M0WA 1LGRA 1NVID 2XN9C 1VCBA 2BF8B 1J19A 5AZFA 1QLBB 3PZ7A 2MJDA 3ABVB 3HK0A 1E7VA 1RLFA 3MC9A 1HEZE 3H7PA 1SGHA 2C7HA 3QA8A 1UH6A 3ML8A 2L76A 3HUIA 1XQQA 3QARA 1TS4A 4DXAB 2JQRB 4KDIC 4MH8A 1FCCC 2K5PA 3FILA 3SD5A 2FIDA 2QIEB 1ESFA 3PRMB 1N61A 4HJGE 3DBHI 2WDRB 2I38A 4KDLB 1WXAA 2EMSA 3Q3NC 1D5XC 3VTWA 4F8CB 2ZCCA 3DBLI 1STEA 3MHZA 3NG0A 4KKJA 3IFWB 4YL8A 4II3B 4N6EB 3ALBA 3GE8C 4ZHPA 1DYQA 1XLNA 1BMLC 1KRHA 5IAAC 2BS4B 3KH0A 4LNKA 3MJ5A 2D3AA 1I4GA 2JX5A 1J7BA 3PLVA 2JZZA 3Q3FA 1SF0A 4KSKC 2KK8A 1FRRA 3IHPC 1ENFA 2MX2A 2KDBA 3KVFB 3AE5B 2NCNA 3QIJA 3IT4B 3UQAA 5G2NA 3EFUA 2LASA 3VQIA 4OZAA 3ZXRA 1HXYD 3NS1A 5HFYA 4GDKB 4HK2A 1FM0D 2LMCA 5E6PA 3K9PB 1UUPA 4ZHOA 4AUQC 3DBRI 1CMXB 3E56A 1V1OA 2OHFA 4RNAA 1LM8B 2MLBA 2RPQA 1OEYJ 1HTQA 1L4DB 5GXGB 2IGDA 2YLMA 3UQBA 4DHZE 1FFVA 1HQRD 1WYWB 4WQMA 2DWQA 2KD0A 1YN3A 5CX3A 2DZJA 2N9EB 1PQSA 2NTTA 3N9YC 3B0AA 1L5PA 2QEJC 4AS1A 2LFIA 5H92C 1UBIA 2DYOA 3LXFA 1WE7A 3DBHB 1XD3B 5KHOA 5JH5C 2JYEA 3N1ZC 2NPTB 1RWSA 2XEWA 3K9OB 3ENEA 3U2SC 3CSFA 3EUB2 3DBLB 3OG5A 2WXGA 3AV8A 2IGHA 2D11A 5E6NA 1N6ZA 1GB4A 4NJCA 3B1LX 4MDKE 4FJVB 4NAWA 3BINA 4ZRQA 1L2NA 2JWUA 3PS6A 4P1BC 1E7PB 4I6PA 1EWCA 1IGCA 2MBEA 1ZKHA 3JSVA 4ANUA 1K53A 1OQQA 5J17A 1QOBA 1C3TA 2VZKD 3JVZX 4DHJD 2PW9A 1SBBB 2BVCA 2BKRB 4P7IA 3Q8FA 1P0RA 1R4NI 4P1CC 1NI2A 4EZJA 2RDGA 4WQOB 3V62A 1N5WA 1D5MC 4A90A 1V49A 2WDVB 2GMIC 4KGRA 4EZLA 3EFCA 3VAWA 4JX1C 4MELA 2ICIA 2RD0A 5LXIB 2MSED 2L0TA 2FCNA 1QQRA 5HI1A 4K1RB 2D2QA 3L4PA 1JRPA 1L4ZB 2LXCA 2IDYA 1V5TA 2QILA 1JQ4A 3NOBA 2K1FA 3W1YA 2CHZA 5TSSA 1FNVA 2KANA 4JWSC 3U7ZA 2WGSA 2JZPA 1UGJA 2WS3B 4W9HA 3VR9B 3OAWA 3TUOA 1J7CA 2JRHA 3PO0A 3PHXB 3W5UB 3N1YC 2N9XA 1SE4A 3PZ8A 3H8HA 3DQVA 2Z0EB 4WJOA 2MW5A 1GNUA 4LDTD 2DZIA 2KHWB 1ZOYB 3ZVVA 2Z59B 4IUMB 2BS2B 2FCQA 1F77A 3NZSA 1WI0A 2QCZA 4GLSC 4PYUA 2ZNVB 4WWMA 2ZEQA 2KWVB 1BUIC 5LXHA 2N9KA 4ITKA 2WXQA 1VZ7A 4MT5A 3H9DA 2IYDB 3RNEC 4IW0A 4XWWA 1ZUD2 5I4DA 1KJTA 1GAQB 3QQ8B 2J0KA 3RFZB 2LGDA 3Q3OC 3MFGA 3RZFA 1WJ4A 3ZNZB 4EKUA 2KDEB 3AE9B 1OTRB 3GE3C 2KDIA 4ANVA 2KT7A 4CYEA 1YNTE 5JZEB 1WMHB 3AE3B 1J0GA 1QOGA 1IUEA 3O65B 2D3BA 2K0PA 5G55A 2N0SB 3EHVA 2O6VA 3URYA 2GLSA 2N9PC 1Z2MA 3KWVA 3P4PB 2VH1A 4DK5A 4XWTA 2HD5B 1TZ1A 2W55A 3A4RA 4KSLC 3RULA 2BWFA 2L1AA 2CS4A 1MVKA 2NR2A 1YX5B 4C7YA 2GOWA 1C79A 4KIKB 4C80A 3APDA 3NRZA 2LEKA 2HDEA 5BYQA 3VUWA 4TSSA 4G3XB 2N4FA 2PIAA 2KWCA 3VTVA 2BB5A 1NBFC 1V6EA 2SEBD 2INDC 2VRRB 2DYMA 4AQ7A 2FUHB 4AWJA 4OVVA 2N1WA 4JL9A 4ZYSA 5T8IA 3KUZA 1DOIA 3QAQA 1WWTA 3L10B 4KZCA 4GOCA 4MEMA 4A6QA 1RM6C 2WXPA 1N63A 2KN5A 3NVWA 4ZRPA 1T3QA 2WU2B 1WE6A 2J0MA 1MG8A 3CIRB 4GU2A 4W9GA 1V5OA 4XE0A 1NYRA 2DNFA 2LGIA 2OEDA 1FIQA 2GB1A 1EM7A 2FCSA 2HJ1A 4MSQB 4ASWC 4BBNF 3CWIA 1V1PB 3SU8X 4N59A 4HPPA 4XZ4A 1X1MA 3BWUD 1R4MI 3TSSA 3BK2A 1KOTA 4OW0A 1L0YB 3C0RB 2JXXA 5FR6A 3DVGY 4PT5A 5EDSA 4US8A 1RFKA 4TQ1A 1F0ZA 1KLVA 1E8YA 1TS5A 1TIFA 3IXSA 4HXDA 1D6EC 4E71A 3H1UA 1WGRA 4WWPA 1YJ1A 1YOVB 2QHOA 1KF6B 3DCGA 2LGYA 1WY8A 4FBJB 1ISNA 1T5XD 1F52A 4WIPA 5BMGA 3MC0B 3NJTA 1WX8A 1VRAB 4LK0M 4KGSA 3M3JA 2KLCA 2QMTA 1E7UA 2PJHA 3PGEA 3RNBC 3U4EG 3A1QA 3OWEB 1SJED 1PGXA 2HTME 1QT9A 5C3JB 3Q8BA 3W9CB 1GC7A 1WXSA 5IA7A 1JRUA 5AUIA 4XDDA 5MPOA 4FULA 2QJLA 4MM3B 1MJDA 2WHIA 4GB9A 1S1QB 3VRBB 1WFYA 3SFDB 1RFAA 2L52A 2WXJA 2BWES 3PZDA 4IM0A 4F7ZA 2KN4A 2O2VA 4TQ0A 5CHVC 3LJ3A 1VJKA 4NQKE 2C7NB 1WZ3A 4LJPB 5IN7A 3IG3A 1C9FA 5JHAA 1FO4A 1YJJA 3PVLA 4RF0A 3ZDMC 1WXMA 1R4MB 2K8BA 1CZPA 1SXTA 2WXKA 1XEEA 1T0RC
chains in the Genus database with same CATH topology
3DBRI 1CMXB 2V1YA 3HHMA 2MP2B 2KZRA 4NPNA 3SDLC 3ZW3A 4M0WB 1LQBA 1LM8B 2MLBA 5DCNA 3N32A 4W9IA 4HJKA 2RPQA 1VD2A 1OEYJ 1GG3A 1Q0WB 1WR1A 3OLMD 2UYZB 5D7GA 2YLMA 3SHQA 5KHQA 1ZGUB 3UQBA 2R2OA 3JYUA 4N9F4 4DHZE 3H7PB 4MJSA 3X0WA 1WYWB 4G11A 4HWIB 4IC7B 3PREA 2LRUA 4NNJB 2IY0B 2KD0A 2ZNVC 2LVPA 5CX3A 2DZJA 2N9EB 3AXCA 5C1ZA 1PQSA 3AI5A 4BVUC 3KUCB 3B0AA 2D10A 4FJZA 1QZEA 2A5UA 3VVWB 4A3OA 3IBEA 1UBIA 1E8XA 2JF5A 1Z5SB 2DYOA 1WRDB 4AOFA 3N3KB 4EEWA 1S3SG 1WE7A 1WH3A 2MBHA 2N7DA 3PRZA 2L00B 3UGBB 1I35A 1HE8A 3UF8A 1GJZA 1M94A 1XD3B 3QCAA 1RRBA 5KHOA 4HVBA 3MHSD 5JH5C 2NPTB 3I3TB 2XEWA 3K9OB 3ENEA 3CSFA 3HM6X 4OVUA 3PT2B 2M8SA 3EC8A 3RD2A 1WX9A 3VUYA 4CO7A 2KMAA 4URKA 1V9JA 3A1QB 4KVGB 3KW5B 1OGWA 2D11A 5E6NA 3VDZA 3PTFC 3M62B 3RUIB 4J6IA 3T8MA 4K7WA 3B1LX 3KYCD 3L54A 2K6QA 2ZZPB 4MDKE 4FJVB 4W9FA 4GIVA 1F9JA 4RM8A 4NAWA 5DPRA 3BINA 3RYTA 1L2NA 3PS6A 1WR6E 1P1AA 2MBEA 1Y8RC 2G45B 1ZKHA 3JSVA 4HDQA 4I6PA 4BKSD 4ANUA 3ZTDA 5J17A 1UD7A 2FCMA 1C3TA 3AULA 1UZXB 4B9KA 3JVZX 4DHJD 4W9LA 2DAFA 4G0NB 2BKRB 2K39A 2C7MB 4P7IA 3MTNB 3R7RA 1P0RA 2DYBA 1R4NI 1P9DU 4RM9A 1NI2A 4EZJA 3GOEA 2LUEA 3X23A 3GZNI 2Z0DB 3A9KA 3JW0X 2IZVB 3ZNGC 4WQOB 3V62A 2WDTB 2NBVB 3UINB 1V49A 2LGXA 2GMIC 3V60A 3R3MA 2D07B 2O2VB 4EZLA 1E90A 2NVUI 3VAWA 3M63B 2L7RA 4MELA 3ONSA 5DPTA 2RD0A 5LXIB 1WZ0A 2OJRA 2MSED 2L0FA 2WYQA 3A9JA 1WF9A 3ECIA 2HTHA 2L0TA 2FCNA 5CTRC 2MCNB 2BYVE 2DENB 4WAAA 5L83A 4K1RB 2D2QA 2LD9A 3TL5A 1H8CA 2LXCA 1GC6A 1V5TA 2CR5A 3VHTC 2J7QB 2KJRA 4MSMB 4WWOA 2R2QA 2MQJA 3NOBA 4PS8A 4KIKA 2K1FA 3DBSA 4K81A 4F1SA 2KXJA 4ZRKA 3W1YA 2CHZA 2XK5B 2AEHA 2IBIB 2LWPA 3PRPB 2KANA 1TTNA 2L05A 1L7YA 2IO0B 3ZNID 4PS3A 2JVCA 3WAPA 2NS5A 4MGIE 2PE9A 4II2B 4ZYNA 2L3ZA 3H6NA 2O6VD 2K8HA 1E8WA 4JIOU 4KV2A 1IYFA 1EUVB 4W9HA 2GBRA 4WJPA 3PPAA 3NZUA 3R66C 4IWQA 3OAWA 4B6WA 2N1VA 1K8RB 2RSUA 2M17A 4HPMB 2JRHA 2GBNA 4MJSB 3NHEB 3PHXB 2IO1B 2JY6A 2N9XA 4ANXA 1TGZB 1E5WA 3MJWA 3PV1A 2M0XA 3W1SA 2BYEA 2ZPYA 3QK0A 5CHFA 4ZRIA 1A5RA 3DQVA 3ZO5B 1FXTB 2ZJDA 2Z0EB 5D2MB 4WJOA 2MW5A 1GNUA 4BKSA 4LDTD 2DZIA 4X57B 2KHWB 3ZVVA 2Z59B 4IUMB 1TBEA 2KJ6A 2FCQA 3TMPB 3V6EB 5E6OA 4FHJA 4MGZE 3NZSA 3WIMA 1WI0A 2CHWA 2KJHB 4GGQA 2MBQA 4GN1A 4PYUA 2ZNVB 2ZEQA 4GDKA 1YX6B 4IWOA 1WJ6A 5JHBA 2KWVB 3APFA 2DHZA 2C9WB 5LXHA 2MBOA 4GXBA 1WM3A 3H9DA 2IYDB 1U4AA 4K7SA 2DAJA 3U30A 2I1JA 3AU4A 1NDDA 4IW0A 2KNBA 4BOSC 2C60A 5AZGA 1KJTA 4BKTA 1UBQA 1Q1OA 4ZDVA 2WX1A 3L08A 3QQ8B 2J0KA 2MWSB 2LGDA 2AYOB 2ZPNA 3JSVB 4RMAA 2L8JA 1WM2A 3ZRCA 3ZIMA 3RZFA 1WJ4A 3ML9A 4WJQA 2KDEB 4WWNA 3OJ4B 3ZNZB 4EKUA 2KX3A 2CU1A 3TIXA 2RR9A 1OTRB 2EMTA 4A3PA 1J8CA 2KDIA 4ANVA 1EO6A 1V2YA 4CYEA 3DVGX 5JZEB 1EF5A 3WANA 3L13A 2M1MA 1WMHB 2KFKA 1J0GA 2KLGA 2REXA 3O65B 4K7UA 4BFRA 3A9KB 4IM2A 2W9NA 1LXDA 4BBNC 5G55A 1Q5WB 2KWUB 4PYZA 5CHWA 3EHVA 2O6VA 3TBLD 2N7EA 3UIOB 2N9PC 4LCDE 3UIPB 1YIWA 2LJ5A 1Z2MA 1I42A 2KTFA 2KQ7A 4W9CA 3RT3B 4AP4C 4DK5A 3RCZA 2JUOA 2V3SA 2KTRA 3IVFA 4G50A 3AU5A 2KC1A 2ZVNA 3ZRFA 4EZKA 3U8ZA 3A9JB 2HD5B 1TZ1A 3H7SA 4MGYE 4W9EA 3A4RA 4KSLC 3RULA 1ZW7A 2ZCBA 3RZWC 4A20A 2A4ZA 2BWFA 1SIFA 2CS4A 2NR2A 2MA9B 3P2BA 1IPGA 4FLHA 1YX5B 2FIFA 3ZLZA 4EOYA 1V80A 2K6DB 3HM3A 2DZMA 2GOWA 1XT9B 3PLUA 4KIKB 3ZNHB 1WX7A 4MH0E 2JWZA 3APDA 4DBGA 4NJ7A 1E8ZA 3PSEB 3VUXA 3VUWA 2NBWB 2BKFA 4FHKA 3VFKA 4JGHB 4G3XB 5J2RA 4E74A 2N4FA 5J18A 4MGKE 1IP9A 4IG7B 2CHXA 2KWCA 1OQYA 4AJWA 3VTVA 3B08A 4FA6A 1NBFC 1V6EA 2DX5B 4AJYB 2I1KA 2OOBB 3VXWA 3PHWB 1WJUA 1GUAB 3VH4B 1WIAA 3CF6E 3KYDD 2VRRB 2DYMA 2DZKA 3NS8A 4B95A 4GDLA 3W1SC 1WGDA 2Y5BB 3CSTA 2FUHB 2JPHA 2KOXA 5TR5A 3N30A 4AWJA 1SE9A 2N1WA 2EKEC 4JL9A 4OVVA 5DPSA 3KUZA 3QAQA 3V6CB 3L10B 2KFJA 4KZCA 2B3AA 1WGGA 2FAZA 4GOCA 3L17A 2WWZA 4MEMA 2BGFA 2JT4B 1WGHA 2RGFA 4HCNB 4DHJB 5BO4B 2KN5A 4MM3A 2K25A 4ANWA 3NY5A 1OEYA 1WE6A 2J0MA 4CHKA 3A33B 3D32A 3ZUNA 1MG8A 2LRWA 2IO3B 4W9KA 3DPDA 1BT0A 1UGMA 2FNJB 4GU2A 2AL6A 4W9GA 2LI5A 2HE7A 1V5OA 4DDGD 4I6NB 2KMCA 2MRPA 4HDOA 1AARA 3KUDB 2FCSA 5LLIA 3WA0A 3VH3B 1YD8U 2AWTA 3ZKJC 4MSQB 1P3QU 2KQSA 4ASWC 2WX0A 4I6LB 2UWQA 4BBNF 4W9JA 1V86A 5DPWA 3SU8X 2ASQA 2M4NA 4GSWA 1WXVA 2LZ6A 2PE6B 3QX1A 4XC2A 1KM7A 4XZ4A 2KFKB 2LVOA 2GBMA 1X1MA 2KVRA 4FADA 3TJPA 1R4MI 2KX0A 4NAWB 4IM3A 1KOTA 4DDID 2MP2A 2IO2B 4NQLB 5L95C 2KKCA 2KC2A 2O6VB 3T9LA 3VTUA 3V61A 5D94A 3DVNU 3C0RB 2JXXA 3DVNV 5FR6A 4NY0A 4HLEA 3DVGY 5EDSA 3OJ3A 1VCBA 2BF8B 5GMVA 1J19A 5AZFA 2KTRB 4TV3A 4TQ1A 2JZ3B 3HK0A 3EECA 4BKGA 1KLVA 1E7VA 1RLFA 2KDFB 2ZVOA 3HIZA 1E8YA 4HPLB 3H7PA 1SGHA 2C7HA 3Q3JA 2AL3A 2G3QB 4BOZB 1YQBA 3QA8A 4FJYA 4NJ6A 1UH6A 2J0JA 2L76A 1T0YA 3APCA 3ML8A 4HXDA 1EF1A 4E71A 4E3CA 3A4SC 1XQQA 3H1UA 3QARA 4JQWC 1WGRA 4DXAB 4EFOA 4WWPA 4LDTB 1YJ1A 4DHZB 3DDCB 2GBKA 2QHOA 3DCGA 2LGYA 4KDIC 1WY8A 4TUUA 1H4RA 2IY1B 1RAXA 4FBJB 1ISNA 3SD5A 4JLCA 2FIDA 3U7DA 4EUTA 3PRMB 4PS7A 2G4SA 1P98A 4IWPA 3DBHI 2NPTA 4KDLB 1WX8A 1WXAA 2EMSA 3TCAA 3M3JA 2KLCA 1E7UA 2PJHA 3PGEA 3VTWA 2JRIB 4F8CB 1D3ZA 1LFDA 4W9DA 2ZCCA 3DBLI 1WGYA 3A1QA 3IFWB 2PPHA 2YVCA 4GDLB 4GMVA 1WMHA 4II3B 4YL8A 5D6JB 3ALBA 5AEKB 3WAMA 2KO3A 2HJ8A 4ICUA 4TKNA 5AZHA 2CKHB 4WJNA 2K8CA 5IA7A 1GC7A 1WXSA 1JRUA 3QC8B 4LJOB 5IAAC 3QHTA 3KH0A 2NBUA 4FULA 3ZDTA 2D3GA 3PLVA 4GB9A 1S1QB 3S2AA 1WFYA 2JZZA 3Q3FA 4KSKC 3WAOA 2KK8A 4FN2A 1RFAA 3QJZA 4KZ0A 3CMMB 3R7QA 4M8MA 3IHPC 4DWFA 3BY4B 2MX2A 4HCPB 3LDZE 2KDBA 3KVFB 2NCNA 3QIJA 2BWES 3PZDA 2LVQA 2GBJA 4IM0A 4F7ZA 3UQAA 2O2VA 5G2NA 3EFUA 2LASA 3VQIA 4TQ0A 5C23A 2C5LC 1V81A 5CHVC 3QWZB 2G4DB 2BPSA 3LJ3A 4GDKB 2LXAA 2XBBC 3L0WB 3L16A 4HK2A 2BYFA 1UELA 4NQKE 2C7NB 5E6PA 1WZ3A 4LJPB 3IG3A 2PEAA 5JHAA 3PVLA 5HKHA 3DOWA 3ZTCA 1WJNA 3K9PB 3WALA 1G6JA 3ZDMC 4M8NA 1WXMA 2V4LA 4ICVA 2K8BA 3M95A 4AUQC 2MBBB 2XK5A 4XX5A 4ZRJA 1C1YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBR I;  1CMX B;  2V1Y A;  3HHM A;  2MP2 B;  2KZR A;  4NPN A;  3SDL C;  3ZW3 A;  4M0W B;  1LQB A;  1LM8 B;  2MLB A;  5DCN A;  3N32 A;  4W9I A;  4HJK A;  2RPQ A;  1VD2 A;  1OEY J;  1GG3 A;  1Q0W B;  1WR1 A;  3OLM D;  2UYZ B;  5D7G A;  2YLM A;  3SHQ A;  5KHQ A;  1ZGU B;  3UQB A;  2R2O A;  3JYU A;  4N9F 4;  4DHZ E;  3H7P B;  4MJS A;  3X0W A;  1WYW B;  4G11 A;  4HWI B;  4IC7 B;  3PRE A;  2LRU A;  4NNJ B;  2IY0 B;  2KD0 A;  2ZNV C;  2LVP A;  5CX3 A;  2DZJ A;  2N9E B;  3AXC A;  5C1Z A;  1PQS A;  3AI5 A;  4BVU C;  3KUC B;  3B0A A;  2D10 A;  4FJZ A;  1QZE A;  2A5U A;  3VVW B;  4A3O A;  3IBE A;  1UBI A;  1E8X A;  2JF5 A;  1Z5S B;  2DYO A;  1WRD B;  4AOF A;  3N3K B;  4EEW A;  1S3S G;  1WE7 A;  1WH3 A;  2MBH A;  2N7D A;  3PRZ A;  2L00 B;  3UGB B;  1I35 A;  1HE8 A;  3UF8 A;  1GJZ A;  1M94 A;  1XD3 B;  3QCA A;  1RRB A;  5KHO A;  4HVB A;  3MHS D;  5JH5 C;  2NPT B;  3I3T B;  2XEW A;  3K9O B;  3ENE A;  3CSF A;  3HM6 X;  4OVU A;  3PT2 B;  2M8S A;  3EC8 A;  3RD2 A;  1WX9 A;  3VUY A;  4CO7 A;  2KMA A;  4URK A;  1V9J A;  3A1Q B;  4KVG B;  3KW5 B;  1OGW A;  2D11 A;  5E6N A;  3VDZ A;  3PTF C;  3M62 B;  3RUI B;  4J6I A;  3T8M A;  4K7W A;  3B1L X;  3KYC D;  3L54 A;  2K6Q A;  2ZZP B;  4MDK E;  4FJV B;  4W9F A;  4GIV A;  1F9J A;  4RM8 A;  4NAW A;  5DPR A;  3BIN A;  3RYT A;  1L2N A;  3PS6 A;  1WR6 E;  1P1A A;  2MBE A;  1Y8R C;  2G45 B;  1ZKH A;  3JSV A;  4HDQ A;  4I6P A;  4BKS D;  4ANU A;  3ZTD A;  5J17 A;  1UD7 A;  2FCM A;  1C3T A;  3AUL A;  1UZX B;  4B9K A;  3JVZ X;  4DHJ D;  4W9L A;  2DAF A;  4G0N B;  2BKR B;  2K39 A;  2C7M B;  4P7I A;  3MTN B;  3R7R A;  1P0R A;  2DYB A;  1R4N I;  1P9D U;  4RM9 A;  1NI2 A;  4EZJ A;  3GOE A;  2LUE A;  3X23 A;  3GZN I;  2Z0D B;  3A9K A;  3JW0 X;  2IZV B;  3ZNG C;  4WQO B;  3V62 A;  2WDT B;  2NBV B;  3UIN B;  1V49 A;  2LGX A;  2GMI C;  3V60 A;  3R3M A;  2D07 B;  2O2V B;  4EZL A;  1E90 A;  2NVU I;  3VAW A;  3M63 B;  2L7R A;  4MEL A;  3ONS A;  5DPT A;  2RD0 A;  5LXI B;  1WZ0 A;  2OJR A;  2MSE D;  2L0F A;  2WYQ A;  3A9J A;  1WF9 A;  3ECI A;  2HTH A;  2L0T A;  2FCN A;  5CTR C;  2MCN B;  2BYV E;  2DEN B;  4WAA A;  5L83 A;  4K1R B;  2D2Q A;  2LD9 A;  3TL5 A;  1H8C A;  2LXC A;  1GC6 A;  1V5T A;  2CR5 A;  3VHT C;  2J7Q B;  2KJR A;  4MSM B;  4WWO A;  2R2Q A;  2MQJ A;  3NOB A;  4PS8 A;  4KIK A;  2K1F A;  3DBS A;  4K81 A;  4F1S A;  2KXJ A;  4ZRK A;  3W1Y A;  2CHZ A;  2XK5 B;  2AEH A;  2IBI B;  2LWP A;  3PRP B;  2KAN A;  1TTN A;  2L05 A;  1L7Y A;  2IO0 B;  3ZNI D;  4PS3 A;  2JVC A;  3WAP A;  2NS5 A;  4MGI E;  2PE9 A;  4II2 B;  4ZYN A;  2L3Z A;  3H6N A;  2O6V D;  2K8H A;  1E8W A;  4JIO U;  4KV2 A;  1IYF A;  1EUV B;  4W9H A;  2GBR A;  4WJP A;  3PPA A;  3NZU A;  3R66 C;  4IWQ A;  3OAW A;  4B6W A;  2N1V A;  1K8R B;  2RSU A;  2M17 A;  4HPM B;  2JRH A;  2GBN A;  4MJS B;  3NHE B;  3PHX B;  2IO1 B;  2JY6 A;  2N9X A;  4ANX A;  1TGZ B;  1E5W A;  3MJW A;  3PV1 A;  2M0X A;  3W1S A;  2BYE A;  2ZPY A;  3QK0 A;  5CHF A;  4ZRI A;  1A5R A;  3DQV A;  3ZO5 B;  1FXT B;  2ZJD A;  2Z0E B;  5D2M B;  4WJO A;  2MW5 A;  1GNU A;  4BKS A;  4LDT D;  2DZI A;  4X57 B;  2KHW B;  3ZVV A;  2Z59 B;  4IUM B;  1TBE A;  2KJ6 A;  2FCQ A;  3TMP B;  3V6E B;  5E6O A;  4FHJ A;  4MGZ E;  3NZS A;  3WIM A;  1WI0 A;  2CHW A;  2KJH B;  4GGQ A;  2MBQ A;  4GN1 A;  4PYU A;  2ZNV B;  2ZEQ A;  4GDK A;  1YX6 B;  4IWO A;  1WJ6 A;  5JHB A;  2KWV B;  3APF A;  2DHZ A;  2C9W B;  5LXH A;  2MBO A;  4GXB A;  1WM3 A;  3H9D A;  2IYD B;  1U4A A;  4K7S A;  2DAJ A;  3U30 A;  2I1J A;  3AU4 A;  1NDD A;  4IW0 A;  2KNB A;  4BOS C;  2C60 A;  5AZG A;  1KJT A;  4BKT A;  1UBQ A;  1Q1O A;  4ZDV A;  2WX1 A;  3L08 A;  3QQ8 B;  2J0K A;  2MWS B;  2LGD A;  2AYO B;  2ZPN A;  3JSV B;  4RMA A;  2L8J A;  1WM2 A;  3ZRC A;  3ZIM A;  3RZF A;  1WJ4 A;  3ML9 A;  4WJQ A;  2KDE B;  4WWN A;  3OJ4 B;  3ZNZ B;  4EKU A;  2KX3 A;  2CU1 A;  3TIX A;  2RR9 A;  1OTR B;  2EMT A;  4A3P A;  1J8C A;  2KDI A;  4ANV A;  1EO6 A;  1V2Y A;  4CYE A;  3DVG X;  5JZE B;  1EF5 A;  3WAN A;  3L13 A;  2M1M A;  1WMH B;  2KFK A;  1J0G A;  2KLG A;  2REX A;  3O65 B;  4K7U A;  4BFR A;  3A9K B;  4IM2 A;  2W9N A;  1LXD A;  4BBN C;  5G55 A;  1Q5W B;  2KWU B;  4PYZ A;  5CHW A;  3EHV A;  2O6V A;  3TBL D;  2N7E A;  3UIO B;  2N9P C;  4LCD E;  3UIP B;  1YIW A;  2LJ5 A;  1Z2M A;  1I42 A;  2KTF A;  2KQ7 A;  4W9C A;  3RT3 B;  4AP4 C;  4DK5 A;  3RCZ A;  2JUO A;  2V3S A;  2KTR A;  3IVF A;  4G50 A;  3AU5 A;  2KC1 A;  2ZVN A;  3ZRF A;  4EZK A;  3U8Z A;  3A9J B;  2HD5 B;  1TZ1 A;  3H7S A;  4MGY E;  4W9E A;  3A4R A;  4KSL C;  3RUL A;  1ZW7 A;  2ZCB A;  3RZW C;  4A20 A;  2A4Z A;  2BWF A;  1SIF A;  2CS4 A;  2NR2 A;  2MA9 B;  3P2B A;  1IPG A;  4FLH A;  1YX5 B;  2FIF A;  3ZLZ A;  4EOY A;  1V80 A;  2K6D B;  3HM3 A;  2DZM A;  2GOW A;  1XT9 B;  3PLU A;  4KIK B;  3ZNH B;  1WX7 A;  4MH0 E;  2JWZ A;  3APD A;  4DBG A;  4NJ7 A;  1E8Z A;  3PSE B;  3VUX A;  3VUW A;  2NBW B;  2BKF A;  4FHK A;  3VFK A;  4JGH B;  4G3X B;  5J2R A;  4E74 A;  2N4F A;  5J18 A;  4MGK E;  1IP9 A;  4IG7 B;  2CHX A;  2KWC A;  1OQY A;  4AJW A;  3VTV A;  3B08 A;  4FA6 A;  1NBF C;  1V6E A;  2DX5 B;  4AJY B;  2I1K A;  2OOB B;  3VXW A;  3PHW B;  1WJU A;  1GUA B;  3VH4 B;  1WIA A;  3CF6 E;  3KYD D;  2VRR B;  2DYM A;  2DZK A;  3NS8 A;  4B95 A;  4GDL A;  3W1S C;  1WGD A;  2Y5B B;  3CST A;  2FUH B;  2JPH A;  2KOX A;  5TR5 A;  3N30 A;  4AWJ A;  1SE9 A;  2N1W A;  2EKE C;  4JL9 A;  4OVV A;  5DPS A;  3KUZ A;  3QAQ A;  3V6C B;  3L10 B;  2KFJ A;  4KZC A;  2B3A A;  1WGG A;  2FAZ A;  4GOC A;  3L17 A;  2WWZ A;  4MEM A;  2BGF A;  2JT4 B;  1WGH A;  2RGF A;  4HCN B;  4DHJ B;  5BO4 B;  2KN5 A;  4MM3 A;  2K25 A;  4ANW A;  3NY5 A;  1OEY A;  1WE6 A;  2J0M A;  4CHK A;  3A33 B;  3D32 A;  3ZUN A;  1MG8 A;  2LRW A;  2IO3 B;  4W9K A;  3DPD A;  1BT0 A;  1UGM A;  2FNJ B;  4GU2 A;  2AL6 A;  4W9G A;  2LI5 A;  2HE7 A;  1V5O A;  4DDG D;  4I6N B;  2KMC A;  2MRP A;  4HDO A;  1AAR A;  3KUD B;  2FCS A;  5LLI A;  3WA0 A;  3VH3 B;  1YD8 U;  2AWT A;  3ZKJ C;  4MSQ B;  1P3Q U;  2KQS A;  4ASW C;  2WX0 A;  4I6L B;  2UWQ A;  4BBN F;  4W9J A;  1V86 A;  5DPW A;  3SU8 X;  2ASQ A;  2M4N A;  4GSW A;  1WXV A;  2LZ6 A;  2PE6 B;  3QX1 A;  4XC2 A;  1KM7 A;  4XZ4 A;  2KFK B;  2LVO A;  2GBM A;  1X1M A;  2KVR A;  4FAD A;  3TJP A;  1R4M I;  2KX0 A;  4NAW B;  4IM3 A;  1KOT A;  4DDI D;  2MP2 A;  2IO2 B;  4NQL B;  5L95 C;  2KKC A;  2KC2 A;  2O6V B;  3T9L A;  3VTU A;  3V61 A;  5D94 A;  3DVN U;  3C0R B;  2JXX A;  3DVN V;  5FR6 A;  4NY0 A;  4HLE A;  3DVG Y;  5EDS A;  3OJ3 A;  1VCB A;  2BF8 B;  5GMV A;  1J19 A;  5AZF A;  2KTR B;  4TV3 A;  4TQ1 A;  2JZ3 B;  3HK0 A;  3EEC A;  4BKG A;  1KLV A;  1E7V A;  1RLF A;  2KDF B;  2ZVO A;  3HIZ A;  1E8Y A;  4HPL B;  3H7P A;  1SGH A;  2C7H A;  3Q3J A;  2AL3 A;  2G3Q B;  4BOZ B;  1YQB A;  3QA8 A;  4FJY A;  4NJ6 A;  1UH6 A;  2J0J A;  2L76 A;  1T0Y A;  3APC A;  3ML8 A;  4HXD A;  1EF1 A;  4E71 A;  4E3C A;  3A4S C;  1XQQ A;  3H1U A;  3QAR A;  4JQW C;  1WGR A;  4DXA B;  4EFO A;  4WWP A;  4LDT B;  1YJ1 A;  4DHZ B;  3DDC B;  2GBK A;  2QHO A;  3DCG A;  2LGY A;  4KDI C;  1WY8 A;  4TUU A;  1H4R A;  2IY1 B;  1RAX A;  4FBJ B;  1ISN A;  3SD5 A;  4JLC A;  2FID A;  3U7D A;  4EUT A;  3PRM B;  4PS7 A;  2G4S A;  1P98 A;  4IWP A;  3DBH I;  2NPT A;  4KDL B;  1WX8 A;  1WXA A;  2EMS A;  3TCA A;  3M3J A;  2KLC A;  1E7U A;  2PJH A;  3PGE A;  3VTW A;  2JRI B;  4F8C B;  1D3Z A;  1LFD A;  4W9D A;  2ZCC A;  3DBL I;  1WGY A;  3A1Q A;  3IFW B;  2PPH A;  2YVC A;  4GDL B;  4GMV A;  1WMH A;  4II3 B;  4YL8 A;  5D6J B;  3ALB A;  5AEK B;  3WAM A;  2KO3 A;  2HJ8 A;  4ICU A;  4TKN A;  5AZH A;  2CKH B;  4WJN A;  2K8C A;  5IA7 A;  1GC7 A;  1WXS A;  1JRU A;  3QC8 B;  4LJO B;  5IAA C;  3QHT A;  3KH0 A;  2NBU A;  4FUL A;  3ZDT A;  2D3G A;  3PLV A;  4GB9 A;  1S1Q B;  3S2A A;  1WFY A;  2JZZ A;  3Q3F A;  4KSK C;  3WAO A;  2KK8 A;  4FN2 A;  1RFA A;  3QJZ A;  4KZ0 A;  3CMM B;  3R7Q A;  4M8M A;  3IHP C;  4DWF A;  3BY4 B;  2MX2 A;  4HCP B;  3LDZ E;  2KDB A;  3KVF B;  2NCN A;  3QIJ A;  2BWE S;  3PZD A;  2LVQ A;  2GBJ A;  4IM0 A;  4F7Z A;  3UQA A;  2O2V A;  5G2N A;  3EFU A;  2LAS A;  3VQI A;  4TQ0 A;  5C23 A;  2C5L C;  1V81 A;  5CHV C;  3QWZ B;  2G4D B;  2BPS A;  3LJ3 A;  4GDK B;  2LXA A;  2XBB C;  3L0W B;  3L16 A;  4HK2 A;  2BYF A;  1UEL A;  4NQK E;  2C7N B;  5E6P A;  1WZ3 A;  4LJP B;  3IG3 A;  2PEA A;  5JHA A;  3PVL A;  5HKH A;  3DOW A;  3ZTC A;  1WJN A;  3K9P B;  3WAL A;  1G6J A;  3ZDM C;  4M8N A;  1WXM A;  2V4L A;  4ICV A;  2K8B A;  3M95 A;  4AUQ C;  2MBB B;  2XK5 A;  4XX5 A;  4ZRJ A;  1C1Y B; 
#chains in the Genus database with same CATH topology
 1PGB A;  3HHM A;  2MP2 B;  4NPN A;  4M0W B;  1LQB A;  1VD2 A;  1WR1 A;  1GG3 A;  1MPE A;  3OLM D;  1GOZ A;  3SHQ A;  1FXI A;  1PUT A;  3H7P B;  4MJS A;  1I4X A;  3PRE A;  4IC7 B;  1FEH A;  2IY0 B;  2KAC A;  3TEW A;  2LVP A;  1JML A;  1UF0 A;  2WXO A;  1E0Z A;  3KUC B;  2D10 A;  2PLP A;  1YN4 A;  3VVW B;  3T3N A;  4A3O A;  3P63 A;  2WP9 B;  1QF6 A;  2JF5 A;  3FIL B;  3N3K B;  4QAY A;  1YQ3 B;  4EEW A;  3UGB B;  1LO5 D;  3PRZ A;  1HE8 A;  3DWM A;  1WRI A;  3QCA A;  4XDC A;  1RRB A;  1ROE A;  3MHS D;  4YSX B;  4OVU A;  2K9X A;  3EC8 A;  3VUY A;  1ZXI A;  1FD6 A;  3T8M A;  3RUI B;  1YN5 A;  3L54 A;  2K6Q A;  2WXL A;  1V8C A;  2ZZP B;  4W9F A;  2AQ2 B;  3WCQ A;  1AWD A;  5DPR A;  3RYT A;  1WR6 E;  1JAL A;  1P1A A;  2INP E;  4BKS D;  3ZTD A;  1UD7 A;  2FCM A;  3AUL A;  1UZX B;  4DXF A;  2DAF A;  4G0N B;  2K39 A;  2C7M B;  3R7R A;  2DYB A;  2GI9 A;  4RM9 A;  3GZN I;  3JW0 X;  1AYF A;  3IAM 1;  1SSN A;  1XXG A;  2ACZ B;  3V60 A;  3R3M A;  2D07 B;  1EU3 A;  2NVU I;  3P4R B;  3M63 B;  3AB5 A;  2WYQ A;  1WF9 A;  2BYV E;  4OZC A;  2LD9 A;  1H8C A;  2RDH A;  3HRD D;  4DQO C;  2J7Q B;  4MSM B;  4WWO A;  4PS8 A;  4F1S A;  1SEB D;  2BS3 B;  2AEH A;  2LWP A;  3AH7 A;  3AEE B;  2IO0 B;  2PE9 A;  4II2 B;  4ZYN A;  2L3Z A;  2QSD A;  3H6N A;  2K8H A;  4R3D A;  4S17 A;  2L83 A;  4IWQ A;  5BMH A;  2RSU A;  3BVM A;  4ANX A;  1TGZ B;  4HRO A;  1SB3 C;  3QK0 A;  3AEC B;  5D2M B;  1P7E A;  4X57 B;  1TBE A;  3TMP B;  2OJW A;  2VH2 A;  3V6E B;  1WXQ A;  5E6O A;  4MGZ E;  2JXT A;  2X38 A;  2CHW A;  1TS2 A;  1R7S A;  1RYJ A;  4GDK A;  4IWO A;  1SJH D;  5JHB A;  1C77 A;  2DHZ A;  2C9W B;  1WM3 A;  2BBC A;  2DAJ A;  2EKI A;  2I1J A;  2KAJ A;  2KNB A;  4BOS C;  2PVO D;  2JYT A;  1DOY A;  4BKT A;  4ZDV A;  3L08 A;  2MWS B;  2AYO B;  1B1Z A;  2ZPN A;  3JSV B;  2L8J A;  3OJ4 B;  2BW2 A;  3RNG C;  4A3P A;  1EO6 A;  1V2Y A;  4RGM A;  3WAN A;  3L13 A;  2M1M A;  1A70 A;  3KWL A;  3GZN B;  2KFK A;  2REX A;  4K7U A;  4BBN C;  4PYZ A;  1XO3 A;  3TBL D;  3UIP B;  1I42 A;  2V3P A;  2KTR A;  4BZA A;  1TKY A;  3ZRF A;  3U8Z A;  1N60 A;  1ZW7 A;  4A20 A;  3R2T A;  1SIF A;  2MA9 B;  3ZLZ A;  1Y56 A;  1MFW A;  4MH0 E;  4DBG A;  1E8Z A;  1FFU A;  3VUX A;  4FHK A;  3VFK A;  3RNC C;  1P7F A;  4E74 A;  3E9S A;  5J18 A;  3P4S B;  1OQY A;  3B08 A;  4OHJ A;  4REZ A;  3PHW B;  2DBY A;  2WDQ B;  4OVZ A;  2DZK A;  3SEB A;  4GDL A;  1WGD A;  3CST A;  1QIL A;  3DHH C;  2KOX A;  3N30 A;  1OFF A;  4LNO A;  2Y3A A;  2H88 B;  5DPS A;  1HZ5 A;  2ON8 A;  3V6C B;  4RGT A;  1Q10 A;  1WGG A;  2FAZ A;  3L17 A;  2WWZ A;  4HCN B;  2JT4 B;  2RGF A;  5BO4 B;  1JWS D;  5EE9 A;  4HKQ A;  1IGD A;  4RF1 A;  3AEA B;  2PKO A;  2M19 A;  2WXH A;  2WXI A;  1YMH E;  2WNM A;  4JWU C;  3AE7 B;  2FNJ B;  3TEX A;  1HA5 A;  1VLB A;  3V3X A;  5FR3 A;  4WH4 A;  2KMC A;  2AQ3 B;  1AAR A;  1SIJ A;  3VH3 B;  2AWT A;  1P3Q U;  2KQS A;  5DPW A;  2KQ4 X;  4GSW A;  2PE6 B;  1XCQ L;  1KM7 A;  2GBM A;  2WU5 B;  3Q8C A;  5AUK A;  2KKC A;  2KC2 A;  2O6V B;  4C7Z A;  3V61 A;  1T6B X;  5D94 A;  3OJ3 A;  5GMV A;  3AE1 B;  3W5V B;  3EEC A;  4BKG A;  2KDF B;  3IT6 B;  2ZVO A;  3HIZ A;  2E6X A;  2Y5C A;  4FJY A;  4NJ6 A;  3O13 A;  1EF1 A;  4LNF A;  4YSZ B;  4JQW C;  4DHZ B;  3KLS X;  4PK1 A;  4C4V A;  1H4R A;  2IY1 B;  1RAX A;  2BTE A;  1PGA A;  4XYC A;  3U7D A;  2G4S A;  1P98 A;  3TCA A;  2Y5P A;  4RGO S;  4UDU C;  2INN E;  1EU4 A;  2JRI B;  4W9D A;  1FRD A;  2PPH A;  2YVC A;  4GMV A;  1WMH A;  5AEK B;  2KO3 A;  1IBX A;  2WLB A;  4TKN A;  4WJN A;  2J42 A;  3ETR A;  3AE8 B;  3QC8 B;  3QHT A;  4NAM A;  2NBU A;  2Z8L A;  3ZDT A;  3MP9 A;  3RNF C;  3WAO A;  4KZ0 A;  3QJZ A;  3CMM B;  3R7Q A;  3RMK C;  5IOI A;  4BAX A;  4M8M A;  2LGS A;  2D5G A;  1QOF A;  2LVQ A;  2UU7 A;  1J7A A;  1F2R C;  1FNU A;  1V81 A;  3QWZ B;  4RFB A;  2V4I B;  2LXA A;  2XBB C;  3L16 A;  3W2D A;  2BYF A;  1UEL A;  2PEA A;  1ZE3 D;  1FNW A;  2MEK A;  3DOW A;  3ZTC A;  1WJN A;  4MAC A;  3WAL A;  2V4L A;  3R2I A;  3M95 A;  2MBB B;  2XK5 A;  4XX5 A;  1C1Y B;  4FXC A;  2KZR A;  1ET6 A;  5G5H A;  4IOI E;  5DCN A;  2R61 A;  1K52 A;  4YT0 B;  4L1B A;  1C4P A;  5KHQ A;  1ZGU B;  4LTU A;  2R2O A;  3JYU A;  4N9F 4;  2WQY B;  2V3N A;  1WYG A;  2K3U A;  2AX5 A;  1VZ6 A;  5C1Z A;  1KLG D;  1ZP0 B;  4NZL B;  4FJZ A;  1QZE A;  3VRA B;  1KH0 A;  2W3R A;  3IBE A;  1CJE A;  4YTN B;  1E8X A;  1Z5S B;  1WRD B;  3NZ3 A;  1WH3 A;  2N7D A;  2L00 B;  1I35 A;  3UF8 A;  4HVB A;  3DHG C;  1GB1 A;  3HM6 X;  3PT2 B;  2M8S A;  2INC C;  1WX9 A;  4URK A;  4L2Y A;  3A1Q B;  4KVG B;  3KW5 B;  1OGW A;  1B9R A;  4JPS A;  3RI7 C;  3M62 B;  4J6I A;  3KYC D;  4D2K A;  3LYY A;  4A9A A;  3AED B;  4K3C A;  3BVZ A;  2G45 B;  4HDQ A;  5E6J A;  4B9K A;  1K51 A;  3GOE A;  3X23 A;  1E6E B;  2Z0D B;  3A9K A;  2IZV B;  3DWG C;  3UI3 A;  2WDT B;  1UNS A;  2LHE A;  5EE0 A;  2NBV B;  3UIN B;  2O2V B;  4M01 A;  5DPT A;  2IJ0 A;  3A9J A;  5LNK 1;  2L0F A;  3ECI A;  2HTH A;  3NVZ A;  5L83 A;  4WAA A;  3TL5 A;  2JSV X;  2ZW1 A;  2CR5 A;  2FUG 1;  3VHT C;  3HVZ A;  2XNA C;  2MQJ A;  2KXJ A;  3BII D;  2IBI B;  3PRP B;  1TTN A;  2L05 A;  1L7Y A;  3ZNI D;  3WAP A;  2JVC A;  4MGI E;  4L23 A;  4KV2 A;  4JIO U;  2X8X X;  2GBR A;  4WJP A;  3PPA A;  3NZU A;  2TSS A;  5EE1 A;  4B6W A;  1BXT A;  2M17 A;  4HPM B;  4MJS B;  3NHE B;  1TYG B;  2J52 A;  1L0V B;  2PVG C;  2IO1 B;  2NMQ A;  3GP7 A;  1XF5 L;  1E5W A;  3I9V 1;  3PV1 A;  3RNA C;  3W1S A;  2BYE A;  2ZPY A;  3I63 C;  1FXT B;  2ZJD A;  3C19 A;  4BKS A;  3VR8 B;  1PYW D;  1KFY B;  2KJ6 A;  3GB1 A;  4FHJ A;  4A55 A;  3J9C A;  3RPF C;  2MBQ A;  5HHD G;  2N9L A;  1YX6 B;  5FK9 C;  1WJ6 A;  3Q14 C;  3APF A;  2MBO A;  1I7H A;  1U4A A;  1DGJ A;  3U30 A;  2C60 A;  2G1E A;  1UBQ A;  2L32 A;  2BT6 A;  2WX1 A;  1JRO A;  4WWN A;  1TY2 A;  2CU1 A;  3TIX A;  2RR9 A;  2EMT A;  1J8C A;  2RPV A;  1TS3 A;  2WXF A;  4M02 A;  1EWY C;  2N7J A;  1TJE A;  3BYY B;  2BQQ A;  1T0Q C;  2SAK A;  3IAS 1;  4IM2 A;  2W9N A;  1LXD A;  4YTP B;  1MHH E;  5CHW A;  1TY0 A;  3UIO B;  4LCD E;  1YIW A;  2KTF A;  4G50 A;  3T3O A;  1I4Q A;  2KC1 A;  3BK1 A;  4EZK A;  2QC8 A;  4MGY E;  3ZGZ A;  1AW7 A;  5BMI A;  2ZCB A;  1PDX A;  2J53 A;  3AE6 B;  2ONQ A;  4ARI A;  1V80 A;  2DZM A;  1XT9 B;  3PLU A;  3ZNH B;  1WX7 A;  4ACF A;  2MJE A;  2JWZ A;  5C2T B;  3PSE B;  3P42 A;  2NBW B;  4JGH B;  4N58 A;  1YJI A;  4IG7 B;  4B0E A;  4FA6 A;  2D3C A;  2DX5 B;  4AJY B;  1I4H A;  2M0A A;  4LLG M;  3VH4 B;  4EE2 A;  3CF6 E;  3KYD D;  1D5Z C;  2JPH A;  1OQR A;  5TR5 A;  1SE9 A;  2EKE C;  3AN1 A;  2LUM A;  1TT5 B;  2KMM A;  2YEP F;  3ZQ4 A;  2Q5W D;  4OZB A;  2B3A A;  2VZK B;  4HRS A;  1D4B A;  4DHJ B;  2BGF A;  1WGH A;  2H89 B;  2E3T A;  1N5X A;  5D3I B;  2K25 A;  4ANW A;  2V0G A;  3NY5 A;  3HVD A;  2IO3 B;  2LRW A;  2MJ3 A;  4W9K A;  3DPD A;  3GS2 A;  4LNN A;  1UGM A;  2AL6 A;  4KX6 B;  4DDG D;  1UWX A;  3AE4 B;  1KLU D;  3KUD B;  1HZ6 A;  4RGN A;  1JWA D;  4IKG A;  4XGA B;  1PFD A;  1ZDX A;  4HKZ E;  3WA0 A;  1YD8 U;  3MC8 A;  3ZJT A;  2WXM A;  1V86 A;  2ASQ A;  1WXV A;  2LZ6 A;  3QX1 A;  5IO9 A;  2KFK B;  2LVO A;  3U52 E;  4FAD A;  4O1N A;  4NAW B;  4IM3 A;  3BYT B;  2MH7 A;  3VTU A;  3T9L A;  3DVN U;  4NY0 A;  1E10 A;  4US9 A;  2KTR B;  4TV3 A;  2JZ3 B;  3SFE B;  4RCO A;  3Q69 A;  4HPL B;  3Q3J A;  2AL3 A;  2G3Q B;  2W3S A;  2FE8 A;  4BOZ B;  1YQB A;  2J0J A;  3APC A;  1T0Y A;  4E3C A;  2WXR A;  3A4S C;  2MHJ A;  1NEK B;  1QKZ A;  2W54 A;  3Q8A A;  4LDT B;  4EFO A;  1UWM A;  3DDC B;  2GBK A;  4TUU A;  2LJI A;  4USA A;  4JLC A;  1FXA A;  3P1M A;  4IDI A;  4EUT A;  1XLO A;  3AEB B;  2QDF A;  1ZDV A;  4PS7 A;  3B2G A;  4IWP A;  2NPT A;  4ARC A;  1D3Z A;  1LFD A;  1WGY A;  4GDL B;  4WUR A;  5D6J B;  3WAM A;  3NUH B;  2HJ8 A;  4ICU A;  2DLB A;  3EGR A;  3AEG B;  5AZH A;  2CKH B;  3Q3M C;  2K8C A;  1VZ8 A;  4LJO B;  2GRI A;  3DHI C;  5EE3 A;  2D3G A;  3S2A A;  4FN2 A;  4DWF A;  3BY4 B;  4HCP B;  3LDZ E;  4C56 C;  4DXG A;  1L0X B;  2GBJ A;  1L6V A;  3DBR B;  5C23 A;  2C5L C;  2LHD A;  2G4D B;  2BPS A;  3L0W B;  2KDM A;  1VR9 A;  5HKH A;  3ZXV A;  1G6J A;  4M8N A;  4ICV A;  1TZO A;  4ZRJ A;  1T0S C;  3KQ4 A;  2V1Y A;  1F2R I;  3SDL C;  3ZW3 A;  1JCK B;  3N32 A;  4W9I A;  4HJK A;  1Q0W B;  1SE3 A;  2UYZ B;  5D7G A;  3X0W A;  4G11 A;  4HWI B;  2LRU A;  4NNJ B;  2ZNV C;  3AXC A;  3AI5 A;  4BVU C;  2A5U A;  4C4V B;  4AOF A;  2CJN A;  1S3S G;  2MBH A;  1GJZ A;  1M94 A;  2IPK D;  3I3T B;  1JW9 D;  3RD2 A;  1MG4 A;  4CO7 A;  2KMA A;  1V9J A;  1R4N B;  3VDZ A;  3PTF C;  4K7W A;  1IBX B;  3AE2 B;  4GIV A;  3AEF B;  1F9J A;  4RM8 A;  1M4V A;  1Y8R C;  3V05 A;  4W9L A;  4WAF A;  2I2Y A;  3MTN B;  2CJO A;  1P9D U;  4HEA 1;  2KWD A;  4YSY B;  1FPY A;  2LUE A;  2CU3 A;  3ZYY X;  3ZNG C;  1C4A A;  2LGX A;  1I4P A;  2KYW A;  1E90 A;  4YXD B;  2L7R A;  3ONS A;  1VDV A;  1WZ0 A;  2OJR A;  5CTR C;  2MCN B;  2DEN B;  1N62 A;  4A8X C;  1GC6 A;  4P16 A;  2KJR A;  3P4Q B;  1KTK A;  2BYT A;  2R2Q A;  4KIK A;  1E9M A;  3DBS A;  4K81 A;  3I5J C;  4ZRK A;  2PTL A;  3FKY A;  1CK1 A;  2XK5 B;  5D3D A;  2G9H D;  3BVG A;  1NYQ A;  1XLP A;  4PS3 A;  1C4C A;  2NS5 A;  4Q2J A;  4KGT A;  2O6V D;  1IYF A;  1E8W A;  1EUV B;  3SR6 A;  1F1H A;  3B9J A;  1DOX A;  3TEZ A;  3R66 C;  4YWG G;  2N1V A;  1K8R B;  2GBN A;  2ZW0 A;  2JY6 A;  2BB6 A;  3C8Y A;  2J4X A;  3EA6 A;  3N1X C;  3NVV A;  2FBW B;  3MJW A;  4J3O D;  2M0X A;  4ZRI A;  5CHF A;  1A5R A;  1GPX A;  3ZO5 B;  2KVZ A;  3ZJU A;  4K3B A;  1YQ4 B;  5H8Y E;  1XLQ A;  2AQ1 B;  3ZJV A;  3WIM A;  2JU6 X;  1FCL A;  2KJH B;  2W82 A;  2YEP B;  4GGQ A;  2K22 A;  4GN1 A;  3FAH A;  2RDB C;  4YTM B;  2B76 B;  3FC4 A;  4KKI A;  1NEN B;  4GXB A;  4K7S A;  3AU4 A;  1NDD A;  5AZG A;  3Q8E A;  1I4R A;  1Q1O A;  2RMM A;  3N20 C;  4RMA A;  1WM2 A;  3ZRC A;  3ZIM A;  3ML9 A;  4WJQ A;  3TEY A;  1JWB D;  2KX3 A;  2EEL A;  1V1P A;  3DVG X;  1EF5 A;  3AMZ A;  2KLG A;  4BFR A;  3LB8 C;  3A9K B;  1ET9 A;  1Q5W B;  2KWU B;  2M56 B;  1C76 A;  2N7E A;  2LJ5 A;  3RT3 B;  2KQ7 A;  1JWM D;  4W9C A;  4AP4 C;  3RCZ A;  2JUO A;  2V3S A;  3IVF A;  3AU5 A;  1MHX A;  1C78 A;  2ZVN A;  4H2A A;  1MI0 A;  3A9J B;  1XCT L;  3H7S A;  1ZXH A;  4W9E A;  3BZD B;  3AM9 A;  3RZW C;  2A4Z A;  3P2B A;  1IPG A;  4FLH A;  2FIF A;  3NVY A;  1NI3 A;  4EOY A;  1JWU D;  2K6D B;  3HM3 A;  3I57 A;  4NJ7 A;  2BKF A;  5J2R A;  2WXN A;  1CQV A;  4MGK E;  1IP9 A;  1K50 A;  2CHX A;  1ZPS A;  4AJW A;  5JXV A;  2IGG A;  4M00 A;  4CQN A;  2I1K A;  2OOB B;  3VXW A;  4P6V F;  1WGK A;  1WJU A;  1GUA B;  1QOA A;  1WIA A;  4ZOH C;  3NS8 A;  4B95 A;  3W1S C;  2NTS A;  2Y5B B;  1HTO A;  1ACC A;  1WSP A;  2V9H A;  2KFJ A;  1TKE A;  2PMV A;  1L6U A;  4MM3 A;  4RH6 A;  5FKA C;  5G5G A;  4B0M A;  4C00 A;  1OEY A;  4CHK A;  3A33 B;  3Q6B A;  3D32 A;  3ZUN A;  4TMA B;  1AN8 A;  3Q2A C;  5HG2 A;  1BT0 A;  1TKG A;  2LI5 A;  2HE7 A;  4JE3 B;  4I6N B;  2MRP A;  4HDO A;  1V97 A;  5BYR A;  5IP4 D;  5LLI A;  3ZKJ C;  5IKC M;  2WX0 A;  4I6L B;  2UWQ A;  4LNI A;  3RN9 C;  4W9J A;  3B2F A;  4XC2 A;  2M4N A;  2KVR A;  1FMA D;  3TJP A;  5BYS A;  2KX0 A;  4S0R A;  1SE2 A;  4DDI D;  2MP2 A;  2IO2 B;  3R8B A;  4NQL B;  5L95 C;  3DVN V;  4HLE A;  4M0W A;  1LGR A;  1NVI D;  2XN9 C;  1VCB A;  2BF8 B;  1J19 A;  5AZF A;  1QLB B;  3PZ7 A;  2MJD A;  3ABV B;  3HK0 A;  1E7V A;  1RLF A;  3MC9 A;  1HEZ E;  3H7P A;  1SGH A;  2C7H A;  3QA8 A;  1UH6 A;  3ML8 A;  2L76 A;  3HUI A;  1XQQ A;  3QAR A;  1TS4 A;  4DXA B;  2JQR B;  4KDI C;  4MH8 A;  1FCC C;  2K5P A;  3FIL A;  3SD5 A;  2FID A;  2QIE B;  1ESF A;  3PRM B;  1N61 A;  4HJG E;  3DBH I;  2WDR B;  2I38 A;  4KDL B;  1WXA A;  2EMS A;  3Q3N C;  1D5X C;  3VTW A;  4F8C B;  2ZCC A;  3DBL I;  1STE A;  3MHZ A;  3NG0 A;  4KKJ A;  3IFW B;  4YL8 A;  4II3 B;  4N6E B;  3ALB A;  3GE8 C;  4ZHP A;  1DYQ A;  1XLN A;  1BML C;  1KRH A;  5IAA C;  2BS4 B;  3KH0 A;  4LNK A;  3MJ5 A;  2D3A A;  1I4G A;  2JX5 A;  1J7B A;  3PLV A;  2JZZ A;  3Q3F A;  1SF0 A;  4KSK C;  2KK8 A;  1FRR A;  3IHP C;  1ENF A;  2MX2 A;  2KDB A;  3KVF B;  3AE5 B;  2NCN A;  3QIJ A;  3IT4 B;  3UQA A;  5G2N A;  3EFU A;  2LAS A;  3VQI A;  4OZA A;  3ZXR A;  1HXY D;  3NS1 A;  5HFY A;  4GDK B;  4HK2 A;  1FM0 D;  2LMC A;  5E6P A;  3K9P B;  1UUP A;  4ZHO A;  4AUQ C;  3DBR I;  1CMX B;  3E56 A;  1V1O A;  2OHF A;  4RNA A;  1LM8 B;  2MLB A;  2RPQ A;  1OEY J;  1HTQ A;  1L4D B;  5GXG B;  2IGD A;  2YLM A;  3UQB A;  4DHZ E;  1FFV A;  1HQR D;  1WYW B;  4WQM A;  2DWQ A;  2KD0 A;  1YN3 A;  5CX3 A;  2DZJ A;  2N9E B;  1PQS A;  2NTT A;  3N9Y C;  3B0A A;  1L5P A;  2QEJ C;  4AS1 A;  2LFI A;  5H92 C;  1UBI A;  2DYO A;  3LXF A;  1WE7 A;  3DBH B;  1XD3 B;  5KHO A;  5JH5 C;  2JYE A;  3N1Z C;  2NPT B;  1RWS A;  2XEW A;  3K9O B;  3ENE A;  3U2S C;  3CSF A;  3EUB 2;  3DBL B;  3OG5 A;  2WXG A;  3AV8 A;  2IGH A;  2D11 A;  5E6N A;  1N6Z A;  1GB4 A;  4NJC A;  3B1L X;  4MDK E;  4FJV B;  4NAW A;  3BIN A;  4ZRQ A;  1L2N A;  2JWU A;  3PS6 A;  4P1B C;  1E7P B;  4I6P A;  1EWC A;  1IGC A;  2MBE A;  1ZKH A;  3JSV A;  4ANU A;  1K53 A;  1OQQ A;  5J17 A;  1QOB A;  1C3T A;  2VZK D;  3JVZ X;  4DHJ D;  2PW9 A;  1SBB B;  2BVC A;  2BKR B;  4P7I A;  3Q8F A;  1P0R A;  1R4N I;  4P1C C;  1NI2 A;  4EZJ A;  2RDG A;  4WQO B;  3V62 A;  1N5W A;  1D5M C;  4A90 A;  1V49 A;  2WDV B;  2GMI C;  4KGR A;  4EZL A;  3EFC A;  3VAW A;  4JX1 C;  4MEL A;  2ICI A;  2RD0 A;  5LXI B;  2MSE D;  2L0T A;  2FCN A;  1QQR A;  5HI1 A;  4K1R B;  2D2Q A;  3L4P A;  1JRP A;  1L4Z B;  2LXC A;  2IDY A;  1V5T A;  2QIL A;  1JQ4 A;  3NOB A;  2K1F A;  3W1Y A;  2CHZ A;  5TSS A;  1FNV A;  2KAN A;  4JWS C;  3U7Z A;  2WGS A;  2JZP A;  1UGJ A;  2WS3 B;  4W9H A;  3VR9 B;  3OAW A;  3TUO A;  1J7C A;  2JRH A;  3PO0 A;  3PHX B;  3W5U B;  3N1Y C;  2N9X A;  1SE4 A;  3PZ8 A;  3H8H A;  3DQV A;  2Z0E B;  4WJO A;  2MW5 A;  1GNU A;  4LDT D;  2DZI A;  2KHW B;  1ZOY B;  3ZVV A;  2Z59 B;  4IUM B;  2BS2 B;  2FCQ A;  1F77 A;  3NZS A;  1WI0 A;  2QCZ A;  4GLS C;  4PYU A;  2ZNV B;  4WWM A;  2ZEQ A;  2KWV B;  1BUI C;  5LXH A;  2N9K A;  4ITK A;  2WXQ A;  1VZ7 A;  4MT5 A;  3H9D A;  2IYD B;  3RNE C;  4IW0 A;  4XWW A;  1ZUD 2;  5I4D A;  1KJT A;  1GAQ B;  3QQ8 B;  2J0K A;  3RFZ B;  2LGD A;  3Q3O C;  3MFG A;  3RZF A;  1WJ4 A;  3ZNZ B;  4EKU A;  2KDE B;  3AE9 B;  1OTR B;  3GE3 C;  2KDI A;  4ANV A;  2KT7 A;  4CYE A;  1YNT E;  5JZE B;  1WMH B;  3AE3 B;  1J0G A;  1QOG A;  1IUE A;  3O65 B;  2D3B A;  2K0P A;  5G55 A;  2N0S B;  3EHV A;  2O6V A;  3URY A;  2GLS A;  2N9P C;  1Z2M A;  3KWV A;  3P4P B;  2VH1 A;  4DK5 A;  4XWT A;  2HD5 B;  1TZ1 A;  2W55 A;  3A4R A;  4KSL C;  3RUL A;  2BWF A;  2L1A A;  2CS4 A;  1MVK A;  2NR2 A;  1YX5 B;  4C7Y A;  2GOW A;  1C79 A;  4KIK B;  4C80 A;  3APD A;  3NRZ A;  2LEK A;  2HDE A;  5BYQ A;  3VUW A;  4TSS A;  4G3X B;  2N4F A;  2PIA A;  2KWC A;  3VTV A;  2BB5 A;  1NBF C;  1V6E A;  2SEB D;  2IND C;  2VRR B;  2DYM A;  4AQ7 A;  2FUH B;  4AWJ A;  4OVV A;  2N1W A;  4JL9 A;  4ZYS A;  5T8I A;  3KUZ A;  1DOI A;  3QAQ A;  1WWT A;  3L10 B;  4KZC A;  4GOC A;  4MEM A;  4A6Q A;  1RM6 C;  2WXP A;  1N63 A;  2KN5 A;  3NVW A;  4ZRP A;  1T3Q A;  2WU2 B;  1WE6 A;  2J0M A;  1MG8 A;  3CIR B;  4GU2 A;  4W9G A;  1V5O A;  4XE0 A;  1NYR A;  2DNF A;  2LGI A;  2OED A;  1FIQ A;  2GB1 A;  1EM7 A;  2FCS A;  2HJ1 A;  4MSQ B;  4ASW C;  4BBN F;  3CWI A;  1V1P B;  3SU8 X;  4N59 A;  4HPP A;  4XZ4 A;  1X1M A;  3BWU D;  1R4M I;  3TSS A;  3BK2 A;  1KOT A;  4OW0 A;  1L0Y B;  3C0R B;  2JXX A;  5FR6 A;  3DVG Y;  4PT5 A;  5EDS A;  4US8 A;  1RFK A;  4TQ1 A;  1F0Z A;  1KLV A;  1E8Y A;  1TS5 A;  1TIF A;  3IXS A;  4HXD A;  1D6E C;  4E71 A;  3H1U A;  1WGR A;  4WWP A;  1YJ1 A;  1YOV B;  2QHO A;  1KF6 B;  3DCG A;  2LGY A;  1WY8 A;  4FBJ B;  1ISN A;  1T5X D;  1F52 A;  4WIP A;  5BMG A;  3MC0 B;  3NJT A;  1WX8 A;  1VRA B;  4LK0 M;  4KGS A;  3M3J A;  2KLC A;  2QMT A;  1E7U A;  2PJH A;  3PGE A;  3RNB C;  3U4E G;  3A1Q A;  3OWE B;  1SJE D;  1PGX A;  2HTM E;  1QT9 A;  5C3J B;  3Q8B A;  3W9C B;  1GC7 A;  1WXS A;  5IA7 A;  1JRU A;  5AUI A;  4XDD A;  5MPO A;  4FUL A;  2QJL A;  4MM3 B;  1MJD A;  2WHI A;  4GB9 A;  1S1Q B;  3VRB B;  1WFY A;  3SFD B;  1RFA A;  2L52 A;  2WXJ A;  2BWE S;  3PZD A;  4IM0 A;  4F7Z A;  2KN4 A;  2O2V A;  4TQ0 A;  5CHV C;  3LJ3 A;  1VJK A;  4NQK E;  2C7N B;  1WZ3 A;  4LJP B;  5IN7 A;  3IG3 A;  1C9F A;  5JHA A;  1FO4 A;  1YJJ A;  3PVL A;  4RF0 A;  3ZDM C;  1WXM A;  1R4M B;  2K8B A;  1CZP A;  1SXT A;  2WXK A;  1XEE A;  1T0R C; 
#chains in the Genus database with same CATH homology
 3DBR I;  1CMX B;  2V1Y A;  3HHM A;  2MP2 B;  2KZR A;  4NPN A;  3SDL C;  3ZW3 A;  4M0W B;  1LQB A;  1LM8 B;  2MLB A;  5DCN A;  3N32 A;  4W9I A;  4HJK A;  2RPQ A;  1VD2 A;  1OEY J;  1GG3 A;  1Q0W B;  1WR1 A;  3OLM D;  2UYZ B;  5D7G A;  2YLM A;  3SHQ A;  5KHQ A;  1ZGU B;  3UQB A;  2R2O A;  3JYU A;  4N9F 4;  4DHZ E;  3H7P B;  4MJS A;  3X0W A;  1WYW B;  4G11 A;  4HWI B;  4IC7 B;  3PRE A;  2LRU A;  4NNJ B;  2IY0 B;  2KD0 A;  2ZNV C;  2LVP A;  5CX3 A;  2DZJ A;  2N9E B;  3AXC A;  5C1Z A;  1PQS A;  3AI5 A;  4BVU C;  3KUC B;  3B0A A;  2D10 A;  4FJZ A;  1QZE A;  2A5U A;  3VVW B;  4A3O A;  3IBE A;  1UBI A;  1E8X A;  2JF5 A;  1Z5S B;  2DYO A;  1WRD B;  4AOF A;  3N3K B;  4EEW A;  1S3S G;  1WE7 A;  1WH3 A;  2MBH A;  2N7D A;  3PRZ A;  2L00 B;  3UGB B;  1I35 A;  1HE8 A;  3UF8 A;  1GJZ A;  1M94 A;  1XD3 B;  3QCA A;  1RRB A;  5KHO A;  4HVB A;  3MHS D;  5JH5 C;  2NPT B;  3I3T B;  2XEW A;  3K9O B;  3ENE A;  3CSF A;  3HM6 X;  4OVU A;  3PT2 B;  2M8S A;  3EC8 A;  3RD2 A;  1WX9 A;  3VUY A;  4CO7 A;  2KMA A;  4URK A;  1V9J A;  3A1Q B;  4KVG B;  3KW5 B;  1OGW A;  2D11 A;  5E6N A;  3VDZ A;  3PTF C;  3M62 B;  3RUI B;  4J6I A;  3T8M A;  4K7W A;  3B1L X;  3KYC D;  3L54 A;  2K6Q A;  2ZZP B;  4MDK E;  4FJV B;  4W9F A;  4GIV A;  1F9J A;  4RM8 A;  4NAW A;  5DPR A;  3BIN A;  3RYT A;  1L2N A;  3PS6 A;  1WR6 E;  1P1A A;  2MBE A;  1Y8R C;  2G45 B;  1ZKH A;  3JSV A;  4HDQ A;  4I6P A;  4BKS D;  4ANU A;  3ZTD A;  5J17 A;  1UD7 A;  2FCM A;  1C3T A;  3AUL A;  1UZX B;  4B9K A;  3JVZ X;  4DHJ D;  4W9L A;  2DAF A;  4G0N B;  2BKR B;  2K39 A;  2C7M B;  4P7I A;  3MTN B;  3R7R A;  1P0R A;  2DYB A;  1R4N I;  1P9D U;  4RM9 A;  1NI2 A;  4EZJ A;  3GOE A;  2LUE A;  3X23 A;  3GZN I;  2Z0D B;  3A9K A;  3JW0 X;  2IZV B;  3ZNG C;  4WQO B;  3V62 A;  2WDT B;  2NBV B;  3UIN B;  1V49 A;  2LGX A;  2GMI C;  3V60 A;  3R3M A;  2D07 B;  2O2V B;  4EZL A;  1E90 A;  2NVU I;  3VAW A;  3M63 B;  2L7R A;  4MEL A;  3ONS A;  5DPT A;  2RD0 A;  5LXI B;  1WZ0 A;  2OJR A;  2MSE D;  2L0F A;  2WYQ A;  3A9J A;  1WF9 A;  3ECI A;  2HTH A;  2L0T A;  2FCN A;  5CTR C;  2MCN B;  2BYV E;  2DEN B;  4WAA A;  5L83 A;  4K1R B;  2D2Q A;  2LD9 A;  3TL5 A;  1H8C A;  2LXC A;  1GC6 A;  1V5T A;  2CR5 A;  3VHT C;  2J7Q B;  2KJR A;  4MSM B;  4WWO A;  2R2Q A;  2MQJ A;  3NOB A;  4PS8 A;  4KIK A;  2K1F A;  3DBS A;  4K81 A;  4F1S A;  2KXJ A;  4ZRK A;  3W1Y A;  2CHZ A;  2XK5 B;  2AEH A;  2IBI B;  2LWP A;  3PRP B;  2KAN A;  1TTN A;  2L05 A;  1L7Y A;  2IO0 B;  3ZNI D;  4PS3 A;  2JVC A;  3WAP A;  2NS5 A;  4MGI E;  2PE9 A;  4II2 B;  4ZYN A;  2L3Z A;  3H6N A;  2O6V D;  2K8H A;  1E8W A;  4JIO U;  4KV2 A;  1IYF A;  1EUV B;  4W9H A;  2GBR A;  4WJP A;  3PPA A;  3NZU A;  3R66 C;  4IWQ A;  3OAW A;  4B6W A;  2N1V A;  1K8R B;  2RSU A;  2M17 A;  4HPM B;  2JRH A;  2GBN A;  4MJS B;  3NHE B;  3PHX B;  2IO1 B;  2JY6 A;  2N9X A;  4ANX A;  1TGZ B;  1E5W A;  3MJW A;  3PV1 A;  2M0X A;  3W1S A;  2BYE A;  2ZPY A;  3QK0 A;  5CHF A;  4ZRI A;  1A5R A;  3DQV A;  3ZO5 B;  1FXT B;  2ZJD A;  2Z0E B;  5D2M B;  4WJO A;  2MW5 A;  1GNU A;  4BKS A;  4LDT D;  2DZI A;  4X57 B;  2KHW B;  3ZVV A;  2Z59 B;  4IUM B;  1TBE A;  2KJ6 A;  2FCQ A;  3TMP B;  3V6E B;  5E6O A;  4FHJ A;  4MGZ E;  3NZS A;  3WIM A;  1WI0 A;  2CHW A;  2KJH B;  4GGQ A;  2MBQ A;  4GN1 A;  4PYU A;  2ZNV B;  2ZEQ A;  4GDK A;  1YX6 B;  4IWO A;  1WJ6 A;  5JHB A;  2KWV B;  3APF A;  2DHZ A;  2C9W B;  5LXH A;  2MBO A;  4GXB A;  1WM3 A;  3H9D A;  2IYD B;  1U4A A;  4K7S A;  2DAJ A;  3U30 A;  2I1J A;  3AU4 A;  1NDD A;  4IW0 A;  2KNB A;  4BOS C;  2C60 A;  5AZG A;  1KJT A;  4BKT A;  1UBQ A;  1Q1O A;  4ZDV A;  2WX1 A;  3L08 A;  3QQ8 B;  2J0K A;  2MWS B;  2LGD A;  2AYO B;  2ZPN A;  3JSV B;  4RMA A;  2L8J A;  1WM2 A;  3ZRC A;  3ZIM A;  3RZF A;  1WJ4 A;  3ML9 A;  4WJQ A;  2KDE B;  4WWN A;  3OJ4 B;  3ZNZ B;  4EKU A;  2KX3 A;  2CU1 A;  3TIX A;  2RR9 A;  1OTR B;  2EMT A;  4A3P A;  1J8C A;  2KDI A;  4ANV A;  1EO6 A;  1V2Y A;  4CYE A;  3DVG X;  5JZE B;  1EF5 A;  3WAN A;  3L13 A;  2M1M A;  1WMH B;  2KFK A;  1J0G A;  2KLG A;  2REX A;  3O65 B;  4K7U A;  4BFR A;  3A9K B;  4IM2 A;  2W9N A;  1LXD A;  4BBN C;  5G55 A;  1Q5W B;  2KWU B;  4PYZ A;  5CHW A;  3EHV A;  2O6V A;  3TBL D;  2N7E A;  3UIO B;  2N9P C;  4LCD E;  3UIP B;  1YIW A;  2LJ5 A;  1Z2M A;  1I42 A;  2KTF A;  2KQ7 A;  4W9C A;  3RT3 B;  4AP4 C;  4DK5 A;  3RCZ A;  2JUO A;  2V3S A;  2KTR A;  3IVF A;  4G50 A;  3AU5 A;  2KC1 A;  2ZVN A;  3ZRF A;  4EZK A;  3U8Z A;  3A9J B;  2HD5 B;  1TZ1 A;  3H7S A;  4MGY E;  4W9E A;  3A4R A;  4KSL C;  3RUL A;  1ZW7 A;  2ZCB A;  3RZW C;  4A20 A;  2A4Z A;  2BWF A;  1SIF A;  2CS4 A;  2NR2 A;  2MA9 B;  3P2B A;  1IPG A;  4FLH A;  1YX5 B;  2FIF A;  3ZLZ A;  4EOY A;  1V80 A;  2K6D B;  3HM3 A;  2DZM A;  2GOW A;  1XT9 B;  3PLU A;  4KIK B;  3ZNH B;  1WX7 A;  4MH0 E;  2JWZ A;  3APD A;  4DBG A;  4NJ7 A;  1E8Z A;  3PSE B;  3VUX A;  3VUW A;  2NBW B;  2BKF A;  4FHK A;  3VFK A;  4JGH B;  4G3X B;  5J2R A;  4E74 A;  2N4F A;  5J18 A;  4MGK E;  1IP9 A;  4IG7 B;  2CHX A;  2KWC A;  1OQY A;  4AJW A;  3VTV A;  3B08 A;  4FA6 A;  1NBF C;  1V6E A;  2DX5 B;  4AJY B;  2I1K A;  2OOB B;  3VXW A;  3PHW B;  1WJU A;  1GUA B;  3VH4 B;  1WIA A;  3CF6 E;  3KYD D;  2VRR B;  2DYM A;  2DZK A;  3NS8 A;  4B95 A;  4GDL A;  3W1S C;  1WGD A;  2Y5B B;  3CST A;  2FUH B;  2JPH A;  2KOX A;  5TR5 A;  3N30 A;  4AWJ A;  1SE9 A;  2N1W A;  2EKE C;  4JL9 A;  4OVV A;  5DPS A;  3KUZ A;  3QAQ A;  3V6C B;  3L10 B;  2KFJ A;  4KZC A;  2B3A A;  1WGG A;  2FAZ A;  4GOC A;  3L17 A;  2WWZ A;  4MEM A;  2BGF A;  2JT4 B;  1WGH A;  2RGF A;  4HCN B;  4DHJ B;  5BO4 B;  2KN5 A;  4MM3 A;  2K25 A;  4ANW A;  3NY5 A;  1OEY A;  1WE6 A;  2J0M A;  4CHK A;  3A33 B;  3D32 A;  3ZUN A;  1MG8 A;  2LRW A;  2IO3 B;  4W9K A;  3DPD A;  1BT0 A;  1UGM A;  2FNJ B;  4GU2 A;  2AL6 A;  4W9G A;  2LI5 A;  2HE7 A;  1V5O A;  4DDG D;  4I6N B;  2KMC A;  2MRP A;  4HDO A;  1AAR A;  3KUD B;  2FCS A;  5LLI A;  3WA0 A;  3VH3 B;  1YD8 U;  2AWT A;  3ZKJ C;  4MSQ B;  1P3Q U;  2KQS A;  4ASW C;  2WX0 A;  4I6L B;  2UWQ A;  4BBN F;  4W9J A;  1V86 A;  5DPW A;  3SU8 X;  2ASQ A;  2M4N A;  4GSW A;  1WXV A;  2LZ6 A;  2PE6 B;  3QX1 A;  4XC2 A;  1KM7 A;  4XZ4 A;  2KFK B;  2LVO A;  2GBM A;  1X1M A;  2KVR A;  4FAD A;  3TJP A;  1R4M I;  2KX0 A;  4NAW B;  4IM3 A;  1KOT A;  4DDI D;  2MP2 A;  2IO2 B;  4NQL B;  5L95 C;  2KKC A;  2KC2 A;  2O6V B;  3T9L A;  3VTU A;  3V61 A;  5D94 A;  3DVN U;  3C0R B;  2JXX A;  3DVN V;  5FR6 A;  4NY0 A;  4HLE A;  3DVG Y;  5EDS A;  3OJ3 A;  1VCB A;  2BF8 B;  5GMV A;  1J19 A;  5AZF A;  2KTR B;  4TV3 A;  4TQ1 A;  2JZ3 B;  3HK0 A;  3EEC A;  4BKG A;  1KLV A;  1E7V A;  1RLF A;  2KDF B;  2ZVO A;  3HIZ A;  1E8Y A;  4HPL B;  3H7P A;  1SGH A;  2C7H A;  3Q3J A;  2AL3 A;  2G3Q B;  4BOZ B;  1YQB A;  3QA8 A;  4FJY A;  4NJ6 A;  1UH6 A;  2J0J A;  2L76 A;  1T0Y A;  3APC A;  3ML8 A;  4HXD A;  1EF1 A;  4E71 A;  4E3C A;  3A4S C;  1XQQ A;  3H1U A;  3QAR A;  4JQW C;  1WGR A;  4DXA B;  4EFO A;  4WWP A;  4LDT B;  1YJ1 A;  4DHZ B;  3DDC B;  2GBK A;  2QHO A;  3DCG A;  2LGY A;  4KDI C;  1WY8 A;  4TUU A;  1H4R A;  2IY1 B;  1RAX A;  4FBJ B;  1ISN A;  3SD5 A;  4JLC A;  2FID A;  3U7D A;  4EUT A;  3PRM B;  4PS7 A;  2G4S A;  1P98 A;  4IWP A;  3DBH I;  2NPT A;  4KDL B;  1WX8 A;  1WXA A;  2EMS A;  3TCA A;  3M3J A;  2KLC A;  1E7U A;  2PJH A;  3PGE A;  3VTW A;  2JRI B;  4F8C B;  1D3Z A;  1LFD A;  4W9D A;  2ZCC A;  3DBL I;  1WGY A;  3A1Q A;  3IFW B;  2PPH A;  2YVC A;  4GDL B;  4GMV A;  1WMH A;  4II3 B;  4YL8 A;  5D6J B;  3ALB A;  5AEK B;  3WAM A;  2KO3 A;  2HJ8 A;  4ICU A;  4TKN A;  5AZH A;  2CKH B;  4WJN A;  2K8C A;  5IA7 A;  1GC7 A;  1WXS A;  1JRU A;  3QC8 B;  4LJO B;  5IAA C;  3QHT A;  3KH0 A;  2NBU A;  4FUL A;  3ZDT A;  2D3G A;  3PLV A;  4GB9 A;  1S1Q B;  3S2A A;  1WFY A;  2JZZ A;  3Q3F A;  4KSK C;  3WAO A;  2KK8 A;  4FN2 A;  1RFA A;  3QJZ A;  4KZ0 A;  3CMM B;  3R7Q A;  4M8M A;  3IHP C;  4DWF A;  3BY4 B;  2MX2 A;  4HCP B;  3LDZ E;  2KDB A;  3KVF B;  2NCN A;  3QIJ A;  2BWE S;  3PZD A;  2LVQ A;  2GBJ A;  4IM0 A;  4F7Z A;  3UQA A;  2O2V A;  5G2N A;  3EFU A;  2LAS A;  3VQI A;  4TQ0 A;  5C23 A;  2C5L C;  1V81 A;  5CHV C;  3QWZ B;  2G4D B;  2BPS A;  3LJ3 A;  4GDK B;  2LXA A;  2XBB C;  3L0W B;  3L16 A;  4HK2 A;  2BYF A;  1UEL A;  4NQK E;  2C7N B;  5E6P A;  1WZ3 A;  4LJP B;  3IG3 A;  2PEA A;  5JHA A;  3PVL A;  5HKH A;  3DOW A;  3ZTC A;  1WJN A;  3K9P B;  3WAL A;  1G6J A;  3ZDM C;  4M8N A;  1WXM A;  2V4L A;  4ICV A;  2K8B A;  3M95 A;  4AUQ C;  2MBB B;  2XK5 A;  4XX5 A;  4ZRJ A;  1C1Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...