2KVRA

Solution nmr structure of human ubiquitin specific protease usp7 ubl domain (residues 537-664). nesg target hr4395c/ sgc-toronto
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
PQQLVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 7
publication title solution structure of the ubiquitin specific protease Usp7 ubiquitin-like domain
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 24
structure length 128
sequence length 128
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2kvrA00
3OJ4B 2KWVB 3L17A 4IWOA 4MGZE 2XK5B 1QZEA 4X57B 2D3GA 5D94A 4FADA 4EFOA 3NOBA 4DHZE 1WZ3A 3UINB 2MP2B 2KDIA 2LXAA 1C1YB 3NZUA 3SHQA 5CHWA 2FUHB 2BYEA 3VUYA 3OLMD 3QX1A 2MBQA 2PEAA 2M4NA 3B08A 3I3TB 4JL9A 2JF5A 2LD9A 4K7SA 4FJVB 3V62A 1TZ1A 2LZ6A 4G3XB 4KDIC 2KTRB 1E8XA 4K7WA 2BYVE 2I1JA 2N9PC 4PS8A 1FXTB 1VD2A 2AWTA 3TL5A 3DCGA 4MEMA 4LCDE 5EDSA 4LDTD 3T8MA 4DXAB 2YVCA 1WFYA 3RYTA 5E6PA 1GUAB 2BWFA 4IWPA 3N32A 4CO7A 3SU8X 1Z2MA 1IPGA 3UF8A 2NPTB 4W9FA 3W1SC 2BGFA 1WE7A 2K6QA 3PLUA 4W9KA 5E6NA 4B9KA 5D7GA 1IYFA 4GMVA 3ZTCA 1F9JA 1YX6B 3VQIA 1LM8B 3C0RB 3PHXB 1GNUA 3P2BA 3R3MA 3QWZB 1J8CA 3VH3B 1ISNA 1P3QU 2C7HA 5DPTA 4DHJB 3A9JA 1WX7A 1UD7A 4YL8A 2A5UA 2D11A 4ASWC 4PYUA 5KHQA 1XT9B 3PRPB 4B6WA 3A1QB 2CKHB 4G11A 4F1SA 2K6DB 2JZZA 4G0NB 4IUMB 3VTUA 2KLCA 4K81A 2JUOA 3IVFA 4AJYB 2DX5B 3MHSD 2KFKA 2LVOA 5LLIA 1E8ZA 2ZPNA 2KN5A 2EMTA 1VCBA 5CX3A 2LUEA 1E8WA 2KX0A 3ZKJC 4GXBA 1RLFA 2DZMA 2N1VA 2D10A 4HCNB 4M8NA 2V4LA 3QJZA 2M0XA 2M8SA 4HWIB 1M94A 1WR6E 2MQJA 4W9CA 2MX2A 3TCAA 1UH6A 2KMAA 4IG7B 2GBRA 3ZRFA 4B95A 4KZ0A 2ZEQA 4AUQC 4J6IA 1LQBA 4DHJD 2KD0A 2L7RA 1EO6A 3PREA 2ASQA 4GGQA 2N9XA 5G2NA 2JVCA 4DDID 4MGKE 3L13A 1EF5A 1H4RA 1E5WA 2KQ7A 4HDQA 3UIPB 2RD0A 3QIJA 2GOWA 4ZRIA 4DDGD 2FCQA 4E3CA 1GC7A 2K1FA 4I6PA 4JLCA 2HTHA 4W9LA 5E6OA 2KKCA 1J19A 4NAWA 4MJSA 4N9F4 3VVWB 3ZLZA 3VDZA 3B1LX 2DENB 1WXVA 2KO3A 3PVLA 5IAAC 2ZNVB 1KOTA 2KLGA 4A20A 2A4ZA 2L0FA 3A9KA 1JRUA 2G45B 2V1YA 4KIKA 5DPWA 2KQSA 1GG3A 2GBKA 3DVGY 3ZIMA 4WQOB 3TMPB 4TQ0A 2KVRA 3ZNID 2G4DB 2UWQA 3NS8A 2LGYA 4HJKA 1ZGUB 2DZIA 1WIAA 4FBJB 1WXMA 4NQLB 2MCNB 1HE8A 2JZ3B 1WY8A 4ZRKA 2D2QA 3TIXA 4HPLB 2BKRB 1KLVA 3KH0A 3DVNV 1WJ4A 3APFA 3VTWA 2LASA 2C9WB 2W9NA 4W9HA 2JPHA 3ECIA 4OVVA 3RT3B 2J0MA 1EF1A 4HCPB 4EKUA 2RSUA 3QAQA 4FJZA 4FHJA 3IBEA 4KSLC 3DVGX 4M8MA 3RD2A 3AU5A 1Q5WB 4AWJA 1OGWA 4F7ZA 2KMCA 1YQBA 5FR6A 3QCAA 2MBEA 4GB9A 2OOBB 4PYZA 1WM3A 2KJRA 3PLVA 1Z5SB 3ALBA 3APDA 4NNJB 2N9EB 4GIVA 2ZNVC 2IZVB 1WGDA 2WWZA 1V6EA 2ZCBA 4KV2A 1E7UA 1WJ6A 4IWQA 1WMHA 1LXDA 2K8HA 1E90A 4I6NB 1WJNA 5BO4B 5DPRA 3WALA 3S2AA 3ZNHB 2IBIB 5AZHA 4FJYA 2G3QB 3AULA 1LFDA 1P98A 2VRRB 4BKGA 1WYWB 3Q3FA 3VTVA 3HIZA 2JXXA 2CR5A 5CTRC 3WAPA 1UELA 2G4SA 3VH4B 3UQBA 2K25A 1WM2A 2LWPA 3QHTA 2MBOA 3CSTA 2DAFA 3KW5B 3M63B 3A9JB 2Z0DB 1AARA 2BWES 2Y5BB 1CMXB 2D07B 4KDLB 4F8CB 4IC7B 2J0JA 2Z0EB 5C23A 2Z59B 3V61A 4ANXA 1V80A 2ZCCA 2C60A 1NI2A 4MELA 4GDKA 1UZXB 4W9EA 5DCNA 2KFKB 3LJ3A 3AU4A 3Q3JA 3QARA 3TBLD 4KSKC 1A5RA 2JRIB 2PJHA 3A4SC 5LXIB 1V5OA 2WX0A 1R4MI 3IHPC 2EKEC 2MRPA 4BFRA 3UGBB 2XBBC 3PSEB 1V9JA 1WE6A 4FULA 3M3JA 3WIMA 4W9DA 1E7VA 2O2VA 4JQWC 3KYDD 3BINA 1J0GA 5JHBA 2LJ5A 2AL6A 4AOFA 4RMAA 5KHOA 4KZCA 3WAMA 3EECA 3UQAA 2MWSB 2NPTA 3L10B 1OEYA 5LXHA 4II3B 4NAWB 4WWPA 3UIOB 1Y8RC 2FCNA 3EHVA 4W9IA 4EZLA 3VAWA 4MH0E 2O6VA 2FIDA 3A9KB 2K39A 4KIKB 4FHKA 1WJUA 1WGYA 4HDOA 3JVZX 2IO0B 3WAOA 3K9PB 2FCSA 2NVUI 2WX1A 2O6VD 4OVUA 3JW0X 1MG8A 2JRHA 2IY1B 2WYQA 2ZJDA 3DBSA 1WR1A 4K1RB 4TV3A 1ZW7A 5J18A 2K8CA 4GOCA 1H8CA 3TJPA 3QC8B 1EUVB 3VHTC 4BOSC 4EZJA 5D2MB 4P7IA 4GU2A 1OEYJ 2LVQA 4HK2A 1WX9A 2KZRA 4LJPB 2KDBA 2IO2B 2RR9A 3O65B 4MSQB 3PPAA 1RRBA 2KDFB 1SE9A 3U30A 2AL3A 4M0WB 3ML9A 4TUUA 3KUCB 3ZRCA 2IO1B 2RGFA 2KJ6A 2V3SA 2QHOA 4BBNF 2CHXA 3ZNZB 1V81A 3NY5A 3RUIB 3ML8A 3U8ZA 3JSVA 3ZDTA 2GBJA 1WMHB 3DBLI 4GDLA 5C1ZA 2MW5A 3M95A 4ANWA 1RAXA 1P9DU 3CSFA 1WGRA 4HXDA 4TKNA 2FNJB 4HLEA 4DWFA 1UGMA 3ZDMC 5J17A 2B3AA 3H6NA 2BYFA 2IO3B 1P1AA 4WJPA 4EOYA 3ZVVA 4I6LB 4JGHB 4PS3A 4TQ1A 2L00B 3ZTDA 1GJZA 3MTNB 2JT4B 3X23A 3T9LA 2IY0B 4NPNA 4ICUA 3VUXA 3RZWC 4BKSA 1I42A 2JY6A 1WXAA 3W1YA 3ZW3A 4CHKA 2AYOB 5JZEB 2C7NB 3KVFB 4BOZB 3DQVA 2MSED 4XX5A 4MDKE 4GSWA 3APCA 5G55A 1V2YA 4BKSD 4GDKB 3ZO5B 4NJ7A 2LI5A 3GZNI 2DZJA 4DHZB 3NHEB 3R7RA 2LXCA 2C7MB 3WA0A 5HKHA 3HHMA 3N30A 1SIFA 5TR5A 2FCMA 3IFWB 2EMSA 3EFUA 2L76A 3LDZE 5CHVC 4NY0A 3DBHI 3H7PA 3KUZA 4DBGA 3DVNU 2KK8A 3W1SA 2I1KA 2CU1A 1D3ZA 2ZVNA 1KJTA 2K8BA 2NBWB 3WANA 2BF8B 1OQYA 2XK5A 1L7YA 2L8JA 1TTNA 2KC2A 2N1WA 4AJWA 4K7UA 4XC2A 2KX3A 2MBHA 3PS6A 3RCZA 3HM6X 2NBUA 2MP2A 2O2VB 3QQ8B 3U7DA 1XD3B 2DYOA 4DK5A 2BPSA 2JWZA 4XZ4A 5J2RA 4KVGB 2PPHA 2R2OA 2RPQA 4IM2A 5L83A 4II2B 1YIWA 1ZKHA 2L3ZA 3OJ3A 3OAWA 3QK0A 2KC1A 3X0WA 4BVUC 1YD8U 2DAJA 2LRUA 2J0KA 2KXJA 4MM3A 4EEWA 3QA8A 2J7QB 2LGDA 1NDDA 2N7EA 1S3SG 4HPMB 3PRMB 4IW0A 3PT2B 2KTRA 3EC8A 2AEHA 2DHZA 4ZRJA 1WH3A 3PRZA 1Q0WB 1TBEA 1WRDB 2NBVB 2O6VB 1WF9A 2CHZA 2IYDB 3M62B 1SGHA 4EZKA 2M1MA 3PHWB 3DPDA 2CHWA 2KNBA 1V49A 4CYEA 1BT0A 1WX8A 2KHWB 2ZVOA 4LJOB 4E71A 1WGHA 3ENEA 3GOEA 2REXA 2NCNA 1WZ0A 3HK0A 3L0WB 1IP9A 4EUTA 1WI0A 4W9GA 2KJHB 4MGYE 4MJSB 2CS4A 2HJ8A 2LGXA 3ONSA 5L95C 2DYMA 2GMIC 3R66C 1GC6A 3PV1A 2L05A 2NR2A 5D6JB 3ZNGC 4WJNA 5DPSA 2DZKA 4IM0A 4FA6A 2XEWA 3HM3A 4A3PA 1UBQA 4WJQA 4HVBA 4ZDVA 1E8YA 1YX5B 3L54A 1UBIA 4WWNA 4ZYNA 3RZFA 3V6CB 4BKTA 1T0YA 1RFAA 1KM7A 1WGGA 1PQSA 3A1QA 3A4RA 3IG3A 3CF6E 5GMVA 2PE6B 1WXSA 2M17A 4MSMB 2FAZA 2GBNA 1XQQA 2KOXA 4RM8A 2N7DA 3DOWA 2ZPYA 3SDLC 1I35A 3V60A 1V5TA 2LVPA 2GBMA 5IA7A 5AZGA 3JSVB 4GN1A 1Q1OA 4GDLB 3V6EB 1P0RA 3DBRI 3CMMB 2KTFA 1OTRB 4ANUA 5AEKB 2R2QA 3RULA 1S1QB 5CHFA 5JHAA 1G6JA 4URKA 2KANA 2WDTB 3AXCA 3L08A 2UYZB 2KDEB 4NJ6A 4WAAA 3VFKA 2KWUB 4E74A 1K8RB 4ANVA 3DDCB 3ZUNA 3NZSA 3PZDA 3D32A 4WWOA 4BBNC 2PE9A 4RM9A 3PGEA 1R4NI 3VUWA 2KWCA 1TGZB 2YLMA 2DYBA 3B0AA 1L2NA 4WJOA 1NBFC 2N4FA 3H7SA 4NQKE 3SD5A 2NS5A 2MBBB 4ICVA 3BY4B 5AZFA 3MJWA 2KFJA 1U4AA 1X1MA 4G50A 2HD5B 2FIFA 2HE7A 2MA9B 3H1UA 2MLBA 2ZZPB 4IM3A 4MGIE 1C3TA 3PTFC 4FN2A 3JYUA 1V86A 2OJRA 3AI5A 3A33B 4PS7A 4A3OA 3L16A 3K9OB 3N3KB 3R7QA 5JH5C 4W9JA 3H7PB 2BKFA 3H9DA 3KUDB 4JIOU 3KYCD 2L0TA 4AP4C 4FLHA 1YJ1A 2LRWA 4LDTB 2C5LC 3VXWA
chains in the Genus database with same CATH superfamily
1I4XA 1ZXHA 2D3GA 4DHZE 1FNVA 3O13A 1YN4A 2KDIA 2GRIA 4WQMA 2M4NA 4N59A 1ZDXA 3I3TB 2LD9A 3V62A 4KDIC 2KTRB 1I4QA 1VD2A 1YN5A 3DCGA 3T3NA 4MEMA 1C79A 1WFYA 5E6PA 4IWPA 3N32A 4CO7A 2I2YA 3AH7A 1FXAA 4B9KA 3IT6B 1XO3A 3VH3B 2LHEA 1UD7A 2D11A 4ASWC 1VRAB 5HHDG 5KHQA 3GP7A 3FC4A 3BYTB 2ACZB 4RFBA 3TUOA 2K9XA 4MH8A 3IVFA 1NEKB 5LLIA 5H92C 2BYTA 1E8ZA 2WXJA 2EMTA 2QDFA 1RLFA 2LUMA 3QJZA 1T6BX 1UH6A 4DHJD 3DBRB 4J6IA 2KD0A 2AQ3B 3HUIA 2N9XA 4DDID 4OZAA 2KQ7A 3QIJA 4IKGA 4HKQA 3DWGC 4JLCA 4WURA 3B1LX 3GB1A 3RNEC 2L32A 1KF6B 2KO3A 2ZNVB 4OHJA 2L0FA 5TSSA 2GBKA 3ZIMA 4WQOB 2KVRA 2UWQA 3NS8A 2D3CA 3KWLA 4HJKA 1ZGUB 1WIAA 4XE0A 3Q3MC 1WY8A 3TIXA 2BKRB 1KLVA 3KH0A 1SE2A 2PW9A 1WJ4A 3APFA 1FMAD 3VTWA 3RT3B 2JXTA 4IOIE 2VZKD 5BMHA 3AU5A 4OVZA 1OGWA 5MPOA 3QCAA 1WM3A 2KJRA 3IT4B 1Z5SB 2N9EB 3AECB 1WGDA 1V6EA 1WMHA 2W54A 3AE7B 3IAM1 5DPRA 3S2AA 2ZW0A 4DQOC 3AE3B 4FJYA 1LFDA 1WYWB 3Q3FA 4OZCA 3VTVA 3HIZA 1T0QC 1ET9A 1UELA 2G4SA 3VH4B 1EWYC 2LWPA 1WM2A 2DAFA 4RGMA 2BWES 2KAJA 3N9YC 2J0JA 1GB4A 4ANXA 1F2RI 2RMMA 2C60A 1SF0A 4RCOA 3LJ3A 1AN8A 1F77A 3TBLD 1A5RA 3WCQA 3A4SC 2QSDA 1R4MI 2AQ1B 3M3JA 1SJED 1XLNA 3BINA 5JHBA 2AL6A 4AOFA 2LEKA 5KHOA 2E6XA 1B1ZA 2MWSB 1TZOA 3L10B 1QOFA 3N1ZC 4II3B 4NAWB 2PTLA 3EHVA 4P6VF 4XDCA 2XNAC 2E3TA 3A9KB 3AE6B 3WAOA 2FCSA 1IBXB 1MG8A 2INPE 2JRHA 4ZYSA 5J18A 3V05A 3TJPA 3QC8B 2VZKB 1QT9A 3KWVA 1OQRA 2IGDA 3NUHB 1E10A 4MT5A 1K53A 1SE9A 3U30A 4HRSA 4C7YA 1XCTL 2RGFA 1ZUD2 5AUKA 2XN9C 2MW5A 3CSFA 1WGRA 3OWEB 2FNJB 1UGMA 2LJIA 1D4BA 2B3AA 2K3UA 3NRZA 1VDVA 4I6LB 4TQ1A 2BS4B 1XLOA 3ZTDA 2JT4B 3KQ4A 4NPNA 1PUTA 3VUXA 4BKSA 5IN7A 1CJEA 1UUPA 4YSXB 4ACFA 3DQVA 2MSED 4XX5A 4GSWA 3DBHB 2LI5A 1DOXA 3WA0A 4HROA 2FCMA 5H8YE 2OHFA 5CHVC 4NY0A 3TEZA 3H7PA 4ZRQA 3W1SA 2INCC 4A8XC 2CU1A 1FCLA 2ZVNA 2NBWB 2K5PA 2WQYB 3NVVA 4AJWA 3RCZA 2MBHA 3PS6A 3HM6X 3U7DA 2DYOA 4KVGB 5GXGB 2J52A 1YNTE 2FE8A 3QK0A 3BYYB 3MC8A 2J0KA 2KXJA 2J7QB 2LGDA 1NDDA 2KTRA 2AEHA 2DHZA 4ZRJA 1WRDB 4EZKA 3PHWB 3DPDA 4OZBA 1HEZE 1V49A 1WX8A 2ONQA 1KLGD 1ESFA 3HK0A 2REXA 3P4SB 4EUTA 2KJHB 4BZAA 2W3RA 1TS2A 2LGXA 1FNUA 1YJJA 4XGAB 1GC6A 2L05A 5D6JB 2PLPA 3HM3A 4A3PA 4HVBA 1YX5B 4A90A 1SSNA 1WGKA 1T0YA 1KM7A 1FRRA 4OW0A 3A4RA 1F1HA 3CF6E 3IG3A 3VR8B 2M17A 4MSMB 2FAZA 2GBNA 3DOWA 3SDLC 2QEJC 1I35A 4PT5A 5IA7A 5AZGA 4GDLB 1P0RA 1HZ6A 3Q8FA 1ET6A 5AEKB 1JRPA 1S1QB 5JHAA 3AXCA 4NJ6A 3VFKA 1E6EB 2KWUB 3RNCC 1J7BA 1FCCC 3B2GA 2WXMA 5FKAC 1JROA 4XWTA 2MA9B 4MGIE 4IM3A 2ZZPB 4A9AA 1TKYA 4A3OA 2G9HD 3L16A 3R7QA 2BKFA 1L4DB 4JIOU 4ZHPA 3AM9A 2LRWA 4IWOA 2XK5B 1I4RA 1QZEA 1ZPSA 5D94A 4EFOA 3Q8BA 3P63A 2MP2B 3NZUA 2LXAA 3AMZA 4ZHOA 2FUHB 2I38A 3QX1A 3B08A 2IPKD 4RGNA 2JF5A 4MM3B 3N1YC 1TZ1A 2BS2B 3ZYYX 4G3XB 4K7WA 2I1JA 2AWTA 3TL5A 3RN9C 1VJKA 3C8YA 4LCDE 5EDSA 4M00A 3N20C 2D5GA 2WDVB 2VH2A 3ETRA 1FM0D 3ABVB 3C19A 2RDGA 2KDMA 4W9KA 1GPXA 5E6NA 5D7GA 1IYFA 4XWWA 1YX6B 3RMKC 1LM8B 3PHXB 4US9A 5I4DA 3P2BA 3NVYA 1P3QU 1WX7A 1MJDA 3Q69A 1VZ6A 1XT9B 1GOZA 2RDBC 4G0NB 4AJYB 2DX5B 3MHSD 2LVOA 4ZOHC 2BS3B 1XF5L 2ZPNA 3I63C 1AWDA 1VCBA 5CX3A 2KX0A 4YTMB 4GXBA 2DZMA 2N1VA 4M8NA 4EE2A 4HWIB 3PO0A 1WR6E 4W9CA 2MX2A 1BXTA 2KMAA 4IG7B 2WLBA 4KZ0A 4AUQC 1LQBA 1EO6A 2FBWB 1TS5A 3AEDB 2QC8A 3MC0B 4MGKE 1KLUD 3OG5A 3P42A 4RGTA 1H4RA 4HDQA 1V8CA 2GOWA 4ZRIA 2FCQA 2Q5WD 2WDQB 2WXFA 5G5HA 1GC7A 4I6PA 2HTHA 4NAWA 1ZP0B 4MJSA 4N9F4 1NYRA 1KOTA 4A20A 3A9KA 1QOBA 5DPWA 3DVGY 1GG3A 3ZNID 2G4DB 1IBXA 1WXMA 5LNK1 3LXFA 4ZRKA 3TEYA 4AQ7A 1L0VB 4C56C 1C4AA 2LASA 2C9WB 1V1OA 4W9HA 2JPHA 3ECIA 4OVVA 1EF1A 3QAQA 4FHJA 3IBEA 3BK1A 3E9SA 1EM7A 2AX5A 3RD2A 2KMCA 4HEA1 1YQBA 1GB1A 3ALBA 3RNGC 2IZVB 2ZCBA 3UI3A 4KV2A 4IWQA 4I6NB 2K8HA 3AEFB 5FK9C 3ZNHB 3EUB2 2DBYA 2G3QB 1P98A 1SE3A 1SJHD 2JXXA 3IAS1 1J7CA 1C76A 2K25A 3QHTA 4A6QA 1AW7A 3KW5B 1L5PA 4HKZE 2Y5BB 3U2SC 1JWBD 5C23A 2Z59B 1QQRA 1VR9A 2MJ3A 3U4EG 4MELA 1UZXB 4W9EA 2KFKB 1R4MB 1F0ZA 5LXIB 1K51A 1V5OA 1PGBA 1ZDVA 3IHPC 1YJIA 2EKEC 2MRPA 4BFRA 5BYQA 3WIMA 4W9DA 1WRIA 4JQWC 3BK2A 1J0GA 3WAMA 2VH1A 2LHDA 4YWGG 2NPTA 1OEYA 5IOIA 1TYGB 2W3SA 2KVZA 4MH0E 2H89B 1D5MC 2K39A 4KIKB 1TKGA 3JVZX 3K9PB 2WYQA 2QJLA 4N6EB 2GI9A 2K8CA 4GOCA 3HVDA 1V97A 2EELA 3SR6A 1QOAA 2LVQA 2INNE 1UNSA 1HTQA 1TS4A 2IO2B 2RR9A 1RRBA 2G1EA 2KDFB 2AL3A 4M0WB 3KUCB 4KGSA 3NY5A 3NZ3A 3ZDTA 2GBJA 3DBLI 4GDLA 4JPSA 3SFEB 3M95A 1L4ZB 4ANWA 1FEHA 1P9DU 1QILA 1RAXA 4TKNA 5HG2A 4EOYA 2TSSA 4JGHB 1HZ5A 1GJZA 2IY0B 1I42A 2CJOA 5JZEB 3MP9A 1KTKA 4MDKE 3APCA 3Q2AC 3ZO5B 4WWMA 4DHZB 3NHEB 5HKHA 3AEGB 3HHMA 5TR5A 2PVGC 3IFWB 4FXCA 3DWMA 2HTME 3EFUA 3GE3C 3LDZE 2EKIA 3DVNU 2I1KA 3FILB 1WYGA 3R2TA 4XDDA 1KJTA 3VRAB 3WANA 2BF8B 1OQYA 2XK5A 1L7YA 1MHXA 2GB1A 2NBUA 2MP2A 4C00A 4LTUA 2BPSA 2JWZA 4XZ4A 2PPHA 2R2OA 2RPQA 5IP4D 1Q10A 3OJ3A 3OAWA 4TSSA 2KC1A 3X0WA 4BVUC 4MM3A 1S3SG 1RWSA 2R61A 1JWAD 3EC8A 2IGGA 1Q0WB 1WF9A 1VLBA 1SGHA 2D3AA 1N5WA 5EE3A 2CHWA 1F2RC 2DNFA 2KNBA 1WGHA 1IP9A 2NCNA 1WZ0A 4MJSB 2HJ8A 5L95C 3HVZA 3URYA 2WS3B 1TY0A 2V3PA 4WJNA 2INDC 5DPSA 2DZKA 2ON8A 1UBQA 1XLQA 3RNFC 1R7SA 3L54A 1UBIA 4ZYNA 1WXSA 1B9RA 3Q6BA 2KOXA 1TS3A 4RM8A 2W82A 2SAKA 2GBMA 1UF0A 3JSVB 4GN1A 1Q1OA 2JSVX 3DBRI 1V1PB 1OTRB 1PGAA 2R2QA 3RULA 5CHFA 1T3QA 4LNOA 2UYZB 4WAAA 1YN3A 3T3OA 3D32A 2PE9A 1R4NI 2KWCA 2YLMA 5HI1A 3B0AA 3BVGA 1NBFC 4NQKE 5AZFA 3MJWA 4KGRA 4G50A 3H1UA 1DOIA 5BYRA 3ZXVA 3JYUA 1V86A 2OJRA 1N63A 3AE4B 3ZGZA 3R8BA 4KKIA 1QLBB 3N3KB 3K9OB 5JH5C 4C4VB 3KYCD 1T5XD 1F52A 2L0TA 4FLHA 4LDTB 2C5LC 1EWCA 4HJGE 3OJ4B 1PYWD 4RH6A 4X57B 4FADA 5C3JB 1ROEA 3P4QB 3SHQA 3W2DA 2BYEA 3VUYA 4XYCA 2CJNA 2MBQA 2WXPA 1C9FA 2WXLA 4FJVB 5T8IA 2LZ6A 3PZ7A 1E8XA 2BYVE 4PS8A 1FXTB 3EA6A 4WIPA 5EE9A 3PZ8A 1VZ8A 1MFWA 4LK0M 1DOYA 2Z8LA 3AE9B 4DXAB 4ARIA 2FUG1 1GUAB 2Y5PA 1Z2MA 2NPTB 1SIJA 3ZTCA 1GNUA 4USAA 3QWZB 1J8CA 1ISNA 2C7HA 4YL8A 2A5UA 5BYSA 2RPVA 4K3CA 1K50A 1I4HA 1YQ3B 1LGRA 4LLGM 5BMGA 2K6DB 3J9CA 4IUMB 2KLCA 2JUOA 3NJTA 2KFKA 2KN5A 3SFDB 1L0YB 2WDRB 2KN4A 3ZKJC 1E8WA 3EFCA 4HCNB 2D10A 4P1BC 2V4LA 2M8SA 2BW2A 2MHJA 4A55A 3W5UB 2GBRA 2OEDA 3ZRFA 2ZEQA 4B0EA 4GLSC 2JVCA 3AE5B 3L13A 2IGHA 3W9CB 2RD0A 4D2KA 4E3CA 1BUIC 4W9LA 2KKCA 1QKZA 3VVWB 3ZLZA 2DENB 1WXVA 1JCKB 2A4ZA 2G45B 2L1AA 2V1YA 4KIKA 5G5GA 2KQSA 3TMPB 2V9HA 4RF1A 2LGYA 3Q8CA 1QOGA 3GE8C 2MCNB 2K22A 2JZ3B 2NTSA 4B0MA 2D2QA 4L2YA 1FIQA 2W9NA 4NAMA 2J0MA 4HCPB 4EKUA 3Q8AA 1FD6A 2RSUA 1EU4A 1RFKA 3P1MA 4FJZA 4KSLC 1C4PA 4M0WA 4M8MA 1UWXA 1Q5WB 4AWJA 4F7ZA 1M4VA 2BVCA 5FR6A 4GB9A 4PYZA 3PLVA 3APDA 4NNJB 4REZA 4GIVA 2HDEA 2BB6A 1E90A 1AYFA 3WALA 2IBIB 3AULA 4BKGA 5BMIA 2CR5A 5CTRC 3WAPA 3DHHC 2JYTA 3UQBA 4N58A 2MBOA 3M63B 3A9JB 2Z0DB 1AARA 2D07B 4F8CB 1SBBB 4IC7B 1D5ZC 1I4PA 1V80A 2BT6A 3NVWA 4YTNB 4KGTA 3AU4A 3QARA 4KSKC 1TKEA 1BMLC 1FFUA 3FILA 2JWUA 4KX6B 3UGBB 2XBBC 1LO5D 4FULA 3LB8C 4KKJA 1SE4A 3KYDD 1N5XA 4RMAA 4KZCA 2JZPA 3EECA 3UQAA 4QAYA 2WXQA 2M19A 5LXHA 3BIID 5C2TB 2KMMA 3UIOB 2FCNA 3VAWA 1CQVA 2D3BA 2FIDA 2WXHA 4FHKA 3V3XA 1WJUA 1WGYA 4HDOA 1C77A 2WX1A 2O6VD 4OVUA 3JW0X 2IY1B 2X38A 2V3NA 2ZJDA 3DBSA 1WR1A 1FRDA 1ZW7A 4L1BA 4EZJA 4GU2A 4HK2A 4HPPA 1WX9A 2QILA 2KDBA 3O65B 2WGSA 3PPAA 4DXGA 1KRHA 2QCZA 3ZRCA 2V3SA 3Q3OC 2CHXA 3ZNZB 5EE0A 1T0RC 3RUIB 4NZLB 2SEBD 3JSVA 3U8ZA 5C1ZA 1I7HA 1V1PA 2W55A 1T0SC 4HLEA 4DWFA 2M0AA 3BWUD 5J17A 3MJ5A 3H6NA 1P1AA 3ZVVA 3H8HA 4PS3A 2L00B 2WHIA 2JYEA 2JY6A 3ZJTA 5D3DA 3W1YA 4CHKA 3KVFB 4J3OD 4BOZB 5G55A 1V2YA 4GDKB 1ZE3D 4NJ7A 3GZNI 2DZJA 2N7JA 3R7RA 2DLBA 2C7MB 4P1CC 1SIFA 2EMSA 2RDHA 4C4VA 2CU3A 3KUZA 4DBGA 3Q3NC 1D3ZA 4R3DA 1HXYD 1FFVA 2L8JA 1TTNA 2KC2A 4K7UA 4XC2A 2O2VB 3QQ8B 3AV8A 3N1XC 1XD3B 4DK5A 5L83A 1N6ZA 2DWQA 1ZKHA 3FKYA 1MG4A 2LRUA 4EEWA 3PRMB 3PT2B 3FAHA 1WH3A 1ENFA 4WH4A 5E6JA 2O6VB 1JWMD 2IYDB 2CHZA 3SEBA 2H88B 4RNAA 2PVOD 2M1MA 1L6VA 3TEWA 2WNMA 3AEAB 4CYEA 2V4IB 1BT0A 3ENEA 3E56A 3MHZA 2HJ1A 2DYMA 2GMIC 3R66C 1XCQL 3B9JA 3ZXRA 2GLSA 4M01A 3ZNGC 2XEWA 4ZDVA 4CQNA 3Q14C 3I57A 3V6CB 4BKTA 3RZFA 4C7ZA 1RFAA 1WGGA 2PE6B 3RI7C 4YSYB 3TSSA 2ZPYA 1V5TA 2LVPA 3V6EB 3CMMB 4ANUA 1R4NB 2YEPF 2KANA 2KDEB 3IXSA 3NZSA 3PZDA 4BBNC 4RM9A 1TGZB 4WJOA 2AQ2B 3MFGA 1L6UA 4ICVA 3BY4B 1TIFA 2L83A 3BZDB 3R2IA 1WXQA 4K3BA 1U4AA 1X1MA 4P16A 2FIFA 3RFZB 2MLBA 3CWIA 4ITKA 4FN2A 3AI5A 1KFYB 3KUDB 2JU6X 2ICIA 1SB3C 1P7EA 3DHGC 1STEA 2KWVB 3L17A 4MGZE 3NOBA 5AUIA 1IGDA 1NVID 1WZ3A 3UINB 1C1YB 1IUEA 5CHWA 1N60A 3OLMD 2PEAA 4UDUC 1FXIA 2V0GA 1PDXA 4JL9A 4K7SA 4YXDB 2WXIA 2N9PC 4S17A 2KYWA 4H2AA 1OQQA 2K0PA 1PGXA 4LDTD 3T8MA 2YVCA 3RYTA 5HFYA 2BWFA 1YOVB 3SU8X 3UF8A 1IPGA 4W9FA 2NMQA 3W1SC 2BGFA 1WE7A 2K6QA 3PLUA 1YQ4B 4GMVA 1F9JA 1RM6C 3VQIA 3C0RB 3R3MA 5DPTA 4DHJB 3A9JA 4PYUA 5JXVA 3PRPB 4B6WA 2YEPB 3A1QB 3AE2B 2CKHB 4G11A 4F1SA 3BVZA 2JZZA 2ZW1A 3VTUA 4K81A 2KT7A 2QIEB 2OJWA 2JX5A 1FO4A 2N9KA 2LUEA 1D6EC 3VR9B 2M0XA 1M94A 2MQJA 3B2FA 3TCAA 4B95A 3AB5A 2L7RA 3PREA 4S0RA 2ASQA 4GGQA 5G2NA 1I4GA 4TMAB 1EF5A 1E5WA 3UIPB 2JQRB 2PMVA 3MC9A 4DDGD 2K1FA 5E6OA 1KH0A 3I9V1 1J19A 3VDZA 1ZXIA 3PVLA 5IAAC 2KLGA 2J42A 1JRUA 4MACA 2KACA 4TQ0A 2L52A 4YTPB 5IKCM 2DZIA 1TY2A 4FBJB 1GAQB 4NJCA 4NQLB 3AN1A 1HE8A 1ACCA 4HPLB 2J4XA 3DVNV 1WSPA 4DXFA 1NI3A 1HQRD 2LFIA 1C4CA 4PK1A 1HTOA 3DVGX 2Y3AA 1NENB 2N9LA 2MBEA 1FPYA 2OOBB 2N0SB 1UGJA 2BBCA 2ZNVC 2WWZA 3W5VB 1E7UA 1WJ6A 1LXDA 1WJNA 5BO4B 2IDYA 2MJDA 1P7FA 1SXTA 2M56B 5AZHA 2VRRB 3GS2A 3L4PA 1XLPA 1QF6A 1JW9D 1JWSD 2PKOA 3VRBB 3CSTA 1JMLA 1CMXB 4KDLB 2Z0EB 3V61A 3P4RB 2ZCCA 1E0ZA 4LNIA 1NI2A 4GDKA 4ARCA 5DCNA 1JWUD 3NS1A 4L23A 3Q3JA 3U52E 2WXNA 4M02A 2JRIB 2PJHA 1MVKA 2WX0A 3DHIC 4RF0A 3PSEB 1V9JA 1WE6A 4Q2JA 1C78A 1E7VA 2O2VA 2LMCA 4RGOS 2LJ5A 3KLSX 1HA5A 5EE1A 4WWPA 1ZOYB 1Y8RC 2BQQA 1L0XB 4W9IA 4EZLA 2O6VA 1EU3A 2IO0B 1IGCA 2NVUI 4IDIA 4K1RB 4TV3A 3RNBC 1H8CA 1EUVB 3VHTC 4BOSC 5D2MB 4P7IA 4JWUC 1OEYJ 2LGSA 4LJPB 2KZRA 4MSQB 2X8XX 2J53A 4LNKA 3ML9A 4TUUA 1E9MA 1TJEA 2IO1B 2KJ6A 4BBNF 2QHOA 4WAFA 1J7AA 1V81A 3CIRB 2WP9B 3ML8A 1WMHB 3BVMA 1NYQA 4HXDA 1SEBD 3ZJUA 1OFFA 3ZDMC 2BYFA 2IO3B 4WJPA 1PFDA 2MJEA 3MTNB 3X23A 4O1NA 3T9LA 4ICUA 3TEXA 1N62A 1MHHE 4JE3B 3RZWC 1WXAA 3GZNB 3ZW3A 2AYOB 2C7NB 2NTTA 4JX1C 3AE1B 1A70A 4BKSD 1MI0A 2LXCA 3N30A 1N61A 2WXRA 3ZJVA 3NVZA 2L76A 3DBHI 4LNFA 2KK8A 3Q8EA 2K8BA 3P4PB 2WXGA 2N1WA 2KX3A 2MH7A 4C80A 3U7ZA 2WXOA 5J2RA 4IM2A 4II2B 1YIWA 2L3ZA 2BTEA 1YD8U 1MPEA 2DAJA 3QA8A 4HPMB 2N7EA 4IW0A 3AEEB 1CK1A 3PRZA 1TBEA 2NBVB 3M62B 4YT0B 2KHWB 4LJOB 4E71A 2ZVOA 2QMTA 3GOEA 3L0WB 1WI0A 4W9GA 4US8A 4MGYE 3I5JC 2CS4A 2LGIA 3ONSA 2WXKA 1XXGA 1E7PB 3PV1A 2NR2A 2IJ0A 2Y5CA 4ZRPA 2B76B 1VZ7A 4IM0A 2PIAA 4FA6A 4WJQA 1E8YA 1WWTA 2MEKA 1YMHE 4WWNA 2KQ4X 1PQSA 3A1QA 5FR3A 5GMVA 1Y56A 3HRDD 3NG0A 2UU7A 1JQ4A 2WU5B 1XQQA 2N7DA 3V60A 2KWDA 1CZPA 5IO9A 2KTFA 3AEBB 1FNWA 3AE8B 3RPFC 1G6JA 3EGRA 1RYJA 4URKA 2WDTB 3ZQ4A 4AS1A 3L08A 4E74A 3DBLB 1K52A 1K8RB 4ANVA 3DDCB 3RNAC 3ZUNA 4WWOA 3PGEA 3VUWA 1TT5B 3LYYA 5D3IB 2DYBA 1L2NA 2BB5A 1UWMA 2N4FA 3H7SA 3SD5A 4YSZB 2NS5A 2MBBB 2KFJA 1DYQA 2WU2B 4BAXA 2HD5B 2HE7A 1C3TA 3PTFC 1D5XC 1XEEA 3A33B 4PS7A 4JWSC 4W9JA 3H7PB 3H9DA 4AP4C 1DGJA 1YJ1A 1JALA 4LNNA 3VXWA
chains in the Genus database with same CATH topology
3OJ4B 2KWVB 3L17A 4IWOA 4MGZE 2XK5B 1QZEA 4X57B 2D3GA 5D94A 4FADA 4EFOA 3NOBA 4DHZE 1WZ3A 3UINB 2MP2B 2KDIA 2LXAA 1C1YB 3NZUA 3SHQA 5CHWA 2FUHB 2BYEA 3VUYA 3OLMD 3QX1A 2MBQA 2PEAA 2M4NA 3B08A 3I3TB 4JL9A 2JF5A 2LD9A 4K7SA 4FJVB 3V62A 1TZ1A 2LZ6A 4G3XB 4KDIC 2KTRB 1E8XA 4K7WA 2BYVE 2I1JA 2N9PC 4PS8A 1FXTB 1VD2A 2AWTA 3TL5A 3DCGA 4MEMA 4LCDE 5EDSA 4LDTD 3T8MA 4DXAB 2YVCA 1WFYA 3RYTA 5E6PA 1GUAB 2BWFA 4IWPA 3N32A 4CO7A 3SU8X 1Z2MA 1IPGA 3UF8A 2NPTB 4W9FA 3W1SC 2BGFA 1WE7A 2K6QA 3PLUA 4W9KA 5E6NA 4B9KA 5D7GA 1IYFA 4GMVA 3ZTCA 1F9JA 1YX6B 3VQIA 1LM8B 3C0RB 3PHXB 1GNUA 3P2BA 3R3MA 3QWZB 1J8CA 3VH3B 1ISNA 1P3QU 2C7HA 5DPTA 4DHJB 3A9JA 1WX7A 1UD7A 4YL8A 2A5UA 2D11A 4ASWC 4PYUA 5KHQA 1XT9B 3PRPB 4B6WA 3A1QB 2CKHB 4G11A 4F1SA 2K6DB 2JZZA 4G0NB 4IUMB 3VTUA 2KLCA 4K81A 2JUOA 3IVFA 4AJYB 2DX5B 3MHSD 2KFKA 2LVOA 5LLIA 1E8ZA 2ZPNA 2KN5A 2EMTA 1VCBA 5CX3A 2LUEA 1E8WA 2KX0A 3ZKJC 4GXBA 1RLFA 2DZMA 2N1VA 2D10A 4HCNB 4M8NA 2V4LA 3QJZA 2M0XA 2M8SA 4HWIB 1M94A 1WR6E 2MQJA 4W9CA 2MX2A 3TCAA 1UH6A 2KMAA 4IG7B 2GBRA 3ZRFA 4B95A 4KZ0A 2ZEQA 4AUQC 4J6IA 1LQBA 4DHJD 2KD0A 2L7RA 1EO6A 3PREA 2ASQA 4GGQA 2N9XA 5G2NA 2JVCA 4DDID 4MGKE 3L13A 1EF5A 1H4RA 1E5WA 2KQ7A 4HDQA 3UIPB 2RD0A 3QIJA 2GOWA 4ZRIA 4DDGD 2FCQA 4E3CA 1GC7A 2K1FA 4I6PA 4JLCA 2HTHA 4W9LA 5E6OA 2KKCA 1J19A 4NAWA 4MJSA 4N9F4 3VVWB 3ZLZA 3VDZA 3B1LX 2DENB 1WXVA 2KO3A 3PVLA 5IAAC 2ZNVB 1KOTA 2KLGA 4A20A 2A4ZA 2L0FA 3A9KA 1JRUA 2G45B 2V1YA 4KIKA 5DPWA 2KQSA 1GG3A 2GBKA 3DVGY 3ZIMA 4WQOB 3TMPB 4TQ0A 2KVRA 3ZNID 2G4DB 2UWQA 3NS8A 2LGYA 4HJKA 1ZGUB 2DZIA 1WIAA 4FBJB 1WXMA 4NQLB 2MCNB 1HE8A 2JZ3B 1WY8A 4ZRKA 2D2QA 3TIXA 4HPLB 2BKRB 1KLVA 3KH0A 3DVNV 1WJ4A 3APFA 3VTWA 2LASA 2C9WB 2W9NA 4W9HA 2JPHA 3ECIA 4OVVA 3RT3B 2J0MA 1EF1A 4HCPB 4EKUA 2RSUA 3QAQA 4FJZA 4FHJA 3IBEA 4KSLC 3DVGX 4M8MA 3RD2A 3AU5A 1Q5WB 4AWJA 1OGWA 4F7ZA 2KMCA 1YQBA 5FR6A 3QCAA 2MBEA 4GB9A 2OOBB 4PYZA 1WM3A 2KJRA 3PLVA 1Z5SB 3ALBA 3APDA 4NNJB 2N9EB 4GIVA 2ZNVC 2IZVB 1WGDA 2WWZA 1V6EA 2ZCBA 4KV2A 1E7UA 1WJ6A 4IWQA 1WMHA 1LXDA 2K8HA 1E90A 4I6NB 1WJNA 5BO4B 5DPRA 3WALA 3S2AA 3ZNHB 2IBIB 5AZHA 4FJYA 2G3QB 3AULA 1LFDA 1P98A 2VRRB 4BKGA 1WYWB 3Q3FA 3VTVA 3HIZA 2JXXA 2CR5A 5CTRC 3WAPA 1UELA 2G4SA 3VH4B 3UQBA 2K25A 1WM2A 2LWPA 3QHTA 2MBOA 3CSTA 2DAFA 3KW5B 3M63B 3A9JB 2Z0DB 1AARA 2BWES 2Y5BB 1CMXB 2D07B 4KDLB 4F8CB 4IC7B 2J0JA 2Z0EB 5C23A 2Z59B 3V61A 4ANXA 1V80A 2ZCCA 2C60A 1NI2A 4MELA 4GDKA 1UZXB 4W9EA 5DCNA 2KFKB 3LJ3A 3AU4A 3Q3JA 3QARA 3TBLD 4KSKC 1A5RA 2JRIB 2PJHA 3A4SC 5LXIB 1V5OA 2WX0A 1R4MI 3IHPC 2EKEC 2MRPA 4BFRA 3UGBB 2XBBC 3PSEB 1V9JA 1WE6A 4FULA 3M3JA 3WIMA 4W9DA 1E7VA 2O2VA 4JQWC 3KYDD 3BINA 1J0GA 5JHBA 2LJ5A 2AL6A 4AOFA 4RMAA 5KHOA 4KZCA 3WAMA 3EECA 3UQAA 2MWSB 2NPTA 3L10B 1OEYA 5LXHA 4II3B 4NAWB 4WWPA 3UIOB 1Y8RC 2FCNA 3EHVA 4W9IA 4EZLA 3VAWA 4MH0E 2O6VA 2FIDA 3A9KB 2K39A 4KIKB 4FHKA 1WJUA 1WGYA 4HDOA 3JVZX 2IO0B 3WAOA 3K9PB 2FCSA 2NVUI 2WX1A 2O6VD 4OVUA 3JW0X 1MG8A 2JRHA 2IY1B 2WYQA 2ZJDA 3DBSA 1WR1A 4K1RB 4TV3A 1ZW7A 5J18A 2K8CA 4GOCA 1H8CA 3TJPA 3QC8B 1EUVB 3VHTC 4BOSC 4EZJA 5D2MB 4P7IA 4GU2A 1OEYJ 2LVQA 4HK2A 1WX9A 2KZRA 4LJPB 2KDBA 2IO2B 2RR9A 3O65B 4MSQB 3PPAA 1RRBA 2KDFB 1SE9A 3U30A 2AL3A 4M0WB 3ML9A 4TUUA 3KUCB 3ZRCA 2IO1B 2RGFA 2KJ6A 2V3SA 2QHOA 4BBNF 2CHXA 3ZNZB 1V81A 3NY5A 3RUIB 3ML8A 3U8ZA 3JSVA 3ZDTA 2GBJA 1WMHB 3DBLI 4GDLA 5C1ZA 2MW5A 3M95A 4ANWA 1RAXA 1P9DU 3CSFA 1WGRA 4HXDA 4TKNA 2FNJB 4HLEA 4DWFA 1UGMA 3ZDMC 5J17A 2B3AA 3H6NA 2BYFA 2IO3B 1P1AA 4WJPA 4EOYA 3ZVVA 4I6LB 4JGHB 4PS3A 4TQ1A 2L00B 3ZTDA 1GJZA 3MTNB 2JT4B 3X23A 3T9LA 2IY0B 4NPNA 4ICUA 3VUXA 3RZWC 4BKSA 1I42A 2JY6A 1WXAA 3W1YA 3ZW3A 4CHKA 2AYOB 5JZEB 2C7NB 3KVFB 4BOZB 3DQVA 2MSED 4XX5A 4MDKE 4GSWA 3APCA 5G55A 1V2YA 4BKSD 4GDKB 3ZO5B 4NJ7A 2LI5A 3GZNI 2DZJA 4DHZB 3NHEB 3R7RA 2LXCA 2C7MB 3WA0A 5HKHA 3HHMA 3N30A 1SIFA 5TR5A 2FCMA 3IFWB 2EMSA 3EFUA 2L76A 3LDZE 5CHVC 4NY0A 3DBHI 3H7PA 3KUZA 4DBGA 3DVNU 2KK8A 3W1SA 2I1KA 2CU1A 1D3ZA 2ZVNA 1KJTA 2K8BA 2NBWB 3WANA 2BF8B 1OQYA 2XK5A 1L7YA 2L8JA 1TTNA 2KC2A 2N1WA 4AJWA 4K7UA 4XC2A 2KX3A 2MBHA 3PS6A 3RCZA 3HM6X 2NBUA 2MP2A 2O2VB 3QQ8B 3U7DA 1XD3B 2DYOA 4DK5A 2BPSA 2JWZA 4XZ4A 5J2RA 4KVGB 2PPHA 2R2OA 2RPQA 4IM2A 5L83A 4II2B 1YIWA 1ZKHA 2L3ZA 3OJ3A 3OAWA 3QK0A 2KC1A 3X0WA 4BVUC 1YD8U 2DAJA 2LRUA 2J0KA 2KXJA 4MM3A 4EEWA 3QA8A 2J7QB 2LGDA 1NDDA 2N7EA 1S3SG 4HPMB 3PRMB 4IW0A 3PT2B 2KTRA 3EC8A 2AEHA 2DHZA 4ZRJA 1WH3A 3PRZA 1Q0WB 1TBEA 1WRDB 2NBVB 2O6VB 1WF9A 2CHZA 2IYDB 3M62B 1SGHA 4EZKA 2M1MA 3PHWB 3DPDA 2CHWA 2KNBA 1V49A 4CYEA 1BT0A 1WX8A 2KHWB 2ZVOA 4LJOB 4E71A 1WGHA 3ENEA 3GOEA 2REXA 2NCNA 1WZ0A 3HK0A 3L0WB 1IP9A 4EUTA 1WI0A 4W9GA 2KJHB 4MGYE 4MJSB 2CS4A 2HJ8A 2LGXA 3ONSA 5L95C 2DYMA 2GMIC 3R66C 1GC6A 3PV1A 2L05A 2NR2A 5D6JB 3ZNGC 4WJNA 5DPSA 2DZKA 4IM0A 4FA6A 2XEWA 3HM3A 4A3PA 1UBQA 4WJQA 4HVBA 4ZDVA 1E8YA 1YX5B 3L54A 1UBIA 4WWNA 4ZYNA 3RZFA 3V6CB 4BKTA 1T0YA 1RFAA 1KM7A 1WGGA 1PQSA 3A1QA 3A4RA 3IG3A 3CF6E 5GMVA 2PE6B 1WXSA 2M17A 4MSMB 2FAZA 2GBNA 1XQQA 2KOXA 4RM8A 2N7DA 3DOWA 2ZPYA 3SDLC 1I35A 3V60A 1V5TA 2LVPA 2GBMA 5IA7A 5AZGA 3JSVB 4GN1A 1Q1OA 4GDLB 3V6EB 1P0RA 3DBRI 3CMMB 2KTFA 1OTRB 4ANUA 5AEKB 2R2QA 3RULA 1S1QB 5CHFA 5JHAA 1G6JA 4URKA 2KANA 2WDTB 3AXCA 3L08A 2UYZB 2KDEB 4NJ6A 4WAAA 3VFKA 2KWUB 4E74A 1K8RB 4ANVA 3DDCB 3ZUNA 3NZSA 3PZDA 3D32A 4WWOA 4BBNC 2PE9A 4RM9A 3PGEA 1R4NI 3VUWA 2KWCA 1TGZB 2YLMA 2DYBA 3B0AA 1L2NA 4WJOA 1NBFC 2N4FA 3H7SA 4NQKE 3SD5A 2NS5A 2MBBB 4ICVA 3BY4B 5AZFA 3MJWA 2KFJA 1U4AA 1X1MA 4G50A 2HD5B 2FIFA 2HE7A 2MA9B 3H1UA 2MLBA 2ZZPB 4IM3A 4MGIE 1C3TA 3PTFC 4FN2A 3JYUA 1V86A 2OJRA 3AI5A 3A33B 4PS7A 4A3OA 3L16A 3K9OB 3N3KB 3R7QA 5JH5C 4W9JA 3H7PB 2BKFA 3H9DA 3KUDB 4JIOU 3KYCD 2L0TA 4AP4C 4FLHA 1YJ1A 2LRWA 4LDTB 2C5LC 3VXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJ4 B;  2KWV B;  3L17 A;  4IWO A;  4MGZ E;  2XK5 B;  1QZE A;  4X57 B;  2D3G A;  5D94 A;  4FAD A;  4EFO A;  3NOB A;  4DHZ E;  1WZ3 A;  3UIN B;  2MP2 B;  2KDI A;  2LXA A;  1C1Y B;  3NZU A;  3SHQ A;  5CHW A;  2FUH B;  2BYE A;  3VUY A;  3OLM D;  3QX1 A;  2MBQ A;  2PEA A;  2M4N A;  3B08 A;  3I3T B;  4JL9 A;  2JF5 A;  2LD9 A;  4K7S A;  4FJV B;  3V62 A;  1TZ1 A;  2LZ6 A;  4G3X B;  4KDI C;  2KTR B;  1E8X A;  4K7W A;  2BYV E;  2I1J A;  2N9P C;  4PS8 A;  1FXT B;  1VD2 A;  2AWT A;  3TL5 A;  3DCG A;  4MEM A;  4LCD E;  5EDS A;  4LDT D;  3T8M A;  4DXA B;  2YVC A;  1WFY A;  3RYT A;  5E6P A;  1GUA B;  2BWF A;  4IWP A;  3N32 A;  4CO7 A;  3SU8 X;  1Z2M A;  1IPG A;  3UF8 A;  2NPT B;  4W9F A;  3W1S C;  2BGF A;  1WE7 A;  2K6Q A;  3PLU A;  4W9K A;  5E6N A;  4B9K A;  5D7G A;  1IYF A;  4GMV A;  3ZTC A;  1F9J A;  1YX6 B;  3VQI A;  1LM8 B;  3C0R B;  3PHX B;  1GNU A;  3P2B A;  3R3M A;  3QWZ B;  1J8C A;  3VH3 B;  1ISN A;  1P3Q U;  2C7H A;  5DPT A;  4DHJ B;  3A9J A;  1WX7 A;  1UD7 A;  4YL8 A;  2A5U A;  2D11 A;  4ASW C;  4PYU A;  5KHQ A;  1XT9 B;  3PRP B;  4B6W A;  3A1Q B;  2CKH B;  4G11 A;  4F1S A;  2K6D B;  2JZZ A;  4G0N B;  4IUM B;  3VTU A;  2KLC A;  4K81 A;  2JUO A;  3IVF A;  4AJY B;  2DX5 B;  3MHS D;  2KFK A;  2LVO A;  5LLI A;  1E8Z A;  2ZPN A;  2KN5 A;  2EMT A;  1VCB A;  5CX3 A;  2LUE A;  1E8W A;  2KX0 A;  3ZKJ C;  4GXB A;  1RLF A;  2DZM A;  2N1V A;  2D10 A;  4HCN B;  4M8N A;  2V4L A;  3QJZ A;  2M0X A;  2M8S A;  4HWI B;  1M94 A;  1WR6 E;  2MQJ A;  4W9C A;  2MX2 A;  3TCA A;  1UH6 A;  2KMA A;  4IG7 B;  2GBR A;  3ZRF A;  4B95 A;  4KZ0 A;  2ZEQ A;  4AUQ C;  4J6I A;  1LQB A;  4DHJ D;  2KD0 A;  2L7R A;  1EO6 A;  3PRE A;  2ASQ A;  4GGQ A;  2N9X A;  5G2N A;  2JVC A;  4DDI D;  4MGK E;  3L13 A;  1EF5 A;  1H4R A;  1E5W A;  2KQ7 A;  4HDQ A;  3UIP B;  2RD0 A;  3QIJ A;  2GOW A;  4ZRI A;  4DDG D;  2FCQ A;  4E3C A;  1GC7 A;  2K1F A;  4I6P A;  4JLC A;  2HTH A;  4W9L A;  5E6O A;  2KKC A;  1J19 A;  4NAW A;  4MJS A;  4N9F 4;  3VVW B;  3ZLZ A;  3VDZ A;  3B1L X;  2DEN B;  1WXV A;  2KO3 A;  3PVL A;  5IAA C;  2ZNV B;  1KOT A;  2KLG A;  4A20 A;  2A4Z A;  2L0F A;  3A9K A;  1JRU A;  2G45 B;  2V1Y A;  4KIK A;  5DPW A;  2KQS A;  1GG3 A;  2GBK A;  3DVG Y;  3ZIM A;  4WQO B;  3TMP B;  4TQ0 A;  2KVR A;  3ZNI D;  2G4D B;  2UWQ A;  3NS8 A;  2LGY A;  4HJK A;  1ZGU B;  2DZI A;  1WIA A;  4FBJ B;  1WXM A;  4NQL B;  2MCN B;  1HE8 A;  2JZ3 B;  1WY8 A;  4ZRK A;  2D2Q A;  3TIX A;  4HPL B;  2BKR B;  1KLV A;  3KH0 A;  3DVN V;  1WJ4 A;  3APF A;  3VTW A;  2LAS A;  2C9W B;  2W9N A;  4W9H A;  2JPH A;  3ECI A;  4OVV A;  3RT3 B;  2J0M A;  1EF1 A;  4HCP B;  4EKU A;  2RSU A;  3QAQ A;  4FJZ A;  4FHJ A;  3IBE A;  4KSL C;  3DVG X;  4M8M A;  3RD2 A;  3AU5 A;  1Q5W B;  4AWJ A;  1OGW A;  4F7Z A;  2KMC A;  1YQB A;  5FR6 A;  3QCA A;  2MBE A;  4GB9 A;  2OOB B;  4PYZ A;  1WM3 A;  2KJR A;  3PLV A;  1Z5S B;  3ALB A;  3APD A;  4NNJ B;  2N9E B;  4GIV A;  2ZNV C;  2IZV B;  1WGD A;  2WWZ A;  1V6E A;  2ZCB A;  4KV2 A;  1E7U A;  1WJ6 A;  4IWQ A;  1WMH A;  1LXD A;  2K8H A;  1E90 A;  4I6N B;  1WJN A;  5BO4 B;  5DPR A;  3WAL A;  3S2A A;  3ZNH B;  2IBI B;  5AZH A;  4FJY A;  2G3Q B;  3AUL A;  1LFD A;  1P98 A;  2VRR B;  4BKG A;  1WYW B;  3Q3F A;  3VTV A;  3HIZ A;  2JXX A;  2CR5 A;  5CTR C;  3WAP A;  1UEL A;  2G4S A;  3VH4 B;  3UQB A;  2K25 A;  1WM2 A;  2LWP A;  3QHT A;  2MBO A;  3CST A;  2DAF A;  3KW5 B;  3M63 B;  3A9J B;  2Z0D B;  1AAR A;  2BWE S;  2Y5B B;  1CMX B;  2D07 B;  4KDL B;  4F8C B;  4IC7 B;  2J0J A;  2Z0E B;  5C23 A;  2Z59 B;  3V61 A;  4ANX A;  1V80 A;  2ZCC A;  2C60 A;  1NI2 A;  4MEL A;  4GDK A;  1UZX B;  4W9E A;  5DCN A;  2KFK B;  3LJ3 A;  3AU4 A;  3Q3J A;  3QAR A;  3TBL D;  4KSK C;  1A5R A;  2JRI B;  2PJH A;  3A4S C;  5LXI B;  1V5O A;  2WX0 A;  1R4M I;  3IHP C;  2EKE C;  2MRP A;  4BFR A;  3UGB B;  2XBB C;  3PSE B;  1V9J A;  1WE6 A;  4FUL A;  3M3J A;  3WIM A;  4W9D A;  1E7V A;  2O2V A;  4JQW C;  3KYD D;  3BIN A;  1J0G A;  5JHB A;  2LJ5 A;  2AL6 A;  4AOF A;  4RMA A;  5KHO A;  4KZC A;  3WAM A;  3EEC A;  3UQA A;  2MWS B;  2NPT A;  3L10 B;  1OEY A;  5LXH A;  4II3 B;  4NAW B;  4WWP A;  3UIO B;  1Y8R C;  2FCN A;  3EHV A;  4W9I A;  4EZL A;  3VAW A;  4MH0 E;  2O6V A;  2FID A;  3A9K B;  2K39 A;  4KIK B;  4FHK A;  1WJU A;  1WGY A;  4HDO A;  3JVZ X;  2IO0 B;  3WAO A;  3K9P B;  2FCS A;  2NVU I;  2WX1 A;  2O6V D;  4OVU A;  3JW0 X;  1MG8 A;  2JRH A;  2IY1 B;  2WYQ A;  2ZJD A;  3DBS A;  1WR1 A;  4K1R B;  4TV3 A;  1ZW7 A;  5J18 A;  2K8C A;  4GOC A;  1H8C A;  3TJP A;  3QC8 B;  1EUV B;  3VHT C;  4BOS C;  4EZJ A;  5D2M B;  4P7I A;  4GU2 A;  1OEY J;  2LVQ A;  4HK2 A;  1WX9 A;  2KZR A;  4LJP B;  2KDB A;  2IO2 B;  2RR9 A;  3O65 B;  4MSQ B;  3PPA A;  1RRB A;  2KDF B;  1SE9 A;  3U30 A;  2AL3 A;  4M0W B;  3ML9 A;  4TUU A;  3KUC B;  3ZRC A;  2IO1 B;  2RGF A;  2KJ6 A;  2V3S A;  2QHO A;  4BBN F;  2CHX A;  3ZNZ B;  1V81 A;  3NY5 A;  3RUI B;  3ML8 A;  3U8Z A;  3JSV A;  3ZDT A;  2GBJ A;  1WMH B;  3DBL I;  4GDL A;  5C1Z A;  2MW5 A;  3M95 A;  4ANW A;  1RAX A;  1P9D U;  3CSF A;  1WGR A;  4HXD A;  4TKN A;  2FNJ B;  4HLE A;  4DWF A;  1UGM A;  3ZDM C;  5J17 A;  2B3A A;  3H6N A;  2BYF A;  2IO3 B;  1P1A A;  4WJP A;  4EOY A;  3ZVV A;  4I6L B;  4JGH B;  4PS3 A;  4TQ1 A;  2L00 B;  3ZTD A;  1GJZ A;  3MTN B;  2JT4 B;  3X23 A;  3T9L A;  2IY0 B;  4NPN A;  4ICU A;  3VUX A;  3RZW C;  4BKS A;  1I42 A;  2JY6 A;  1WXA A;  3W1Y A;  3ZW3 A;  4CHK A;  2AYO B;  5JZE B;  2C7N B;  3KVF B;  4BOZ B;  3DQV A;  2MSE D;  4XX5 A;  4MDK E;  4GSW A;  3APC A;  5G55 A;  1V2Y A;  4BKS D;  4GDK B;  3ZO5 B;  4NJ7 A;  2LI5 A;  3GZN I;  2DZJ A;  4DHZ B;  3NHE B;  3R7R A;  2LXC A;  2C7M B;  3WA0 A;  5HKH A;  3HHM A;  3N30 A;  1SIF A;  5TR5 A;  2FCM A;  3IFW B;  2EMS A;  3EFU A;  2L76 A;  3LDZ E;  5CHV C;  4NY0 A;  3DBH I;  3H7P A;  3KUZ A;  4DBG A;  3DVN U;  2KK8 A;  3W1S A;  2I1K A;  2CU1 A;  1D3Z A;  2ZVN A;  1KJT A;  2K8B A;  2NBW B;  3WAN A;  2BF8 B;  1OQY A;  2XK5 A;  1L7Y A;  2L8J A;  1TTN A;  2KC2 A;  2N1W A;  4AJW A;  4K7U A;  4XC2 A;  2KX3 A;  2MBH A;  3PS6 A;  3RCZ A;  3HM6 X;  2NBU A;  2MP2 A;  2O2V B;  3QQ8 B;  3U7D A;  1XD3 B;  2DYO A;  4DK5 A;  2BPS A;  2JWZ A;  4XZ4 A;  5J2R A;  4KVG B;  2PPH A;  2R2O A;  2RPQ A;  4IM2 A;  5L83 A;  4II2 B;  1YIW A;  1ZKH A;  2L3Z A;  3OJ3 A;  3OAW A;  3QK0 A;  2KC1 A;  3X0W A;  4BVU C;  1YD8 U;  2DAJ A;  2LRU A;  2J0K A;  2KXJ A;  4MM3 A;  4EEW A;  3QA8 A;  2J7Q B;  2LGD A;  1NDD A;  2N7E A;  1S3S G;  4HPM B;  3PRM B;  4IW0 A;  3PT2 B;  2KTR A;  3EC8 A;  2AEH A;  2DHZ A;  4ZRJ A;  1WH3 A;  3PRZ A;  1Q0W B;  1TBE A;  1WRD B;  2NBV B;  2O6V B;  1WF9 A;  2CHZ A;  2IYD B;  3M62 B;  1SGH A;  4EZK A;  2M1M A;  3PHW B;  3DPD A;  2CHW A;  2KNB A;  1V49 A;  4CYE A;  1BT0 A;  1WX8 A;  2KHW B;  2ZVO A;  4LJO B;  4E71 A;  1WGH A;  3ENE A;  3GOE A;  2REX A;  2NCN A;  1WZ0 A;  3HK0 A;  3L0W B;  1IP9 A;  4EUT A;  1WI0 A;  4W9G A;  2KJH B;  4MGY E;  4MJS B;  2CS4 A;  2HJ8 A;  2LGX A;  3ONS A;  5L95 C;  2DYM A;  2GMI C;  3R66 C;  1GC6 A;  3PV1 A;  2L05 A;  2NR2 A;  5D6J B;  3ZNG C;  4WJN A;  5DPS A;  2DZK A;  4IM0 A;  4FA6 A;  2XEW A;  3HM3 A;  4A3P A;  1UBQ A;  4WJQ A;  4HVB A;  4ZDV A;  1E8Y A;  1YX5 B;  3L54 A;  1UBI A;  4WWN A;  4ZYN A;  3RZF A;  3V6C B;  4BKT A;  1T0Y A;  1RFA A;  1KM7 A;  1WGG A;  1PQS A;  3A1Q A;  3A4R A;  3IG3 A;  3CF6 E;  5GMV A;  2PE6 B;  1WXS A;  2M17 A;  4MSM B;  2FAZ A;  2GBN A;  1XQQ A;  2KOX A;  4RM8 A;  2N7D A;  3DOW A;  2ZPY A;  3SDL C;  1I35 A;  3V60 A;  1V5T A;  2LVP A;  2GBM A;  5IA7 A;  5AZG A;  3JSV B;  4GN1 A;  1Q1O A;  4GDL B;  3V6E B;  1P0R A;  3DBR I;  3CMM B;  2KTF A;  1OTR B;  4ANU A;  5AEK B;  2R2Q A;  3RUL A;  1S1Q B;  5CHF A;  5JHA A;  1G6J A;  4URK A;  2KAN A;  2WDT B;  3AXC A;  3L08 A;  2UYZ B;  2KDE B;  4NJ6 A;  4WAA A;  3VFK A;  2KWU B;  4E74 A;  1K8R B;  4ANV A;  3DDC B;  3ZUN A;  3NZS A;  3PZD A;  3D32 A;  4WWO A;  4BBN C;  2PE9 A;  4RM9 A;  3PGE A;  1R4N I;  3VUW A;  2KWC A;  1TGZ B;  2YLM A;  2DYB A;  3B0A A;  1L2N A;  4WJO A;  1NBF C;  2N4F A;  3H7S A;  4NQK E;  3SD5 A;  2NS5 A;  2MBB B;  4ICV A;  3BY4 B;  5AZF A;  3MJW A;  2KFJ A;  1U4A A;  1X1M A;  4G50 A;  2HD5 B;  2FIF A;  2HE7 A;  2MA9 B;  3H1U A;  2MLB A;  2ZZP B;  4IM3 A;  4MGI E;  1C3T A;  3PTF C;  4FN2 A;  3JYU A;  1V86 A;  2OJR A;  3AI5 A;  3A33 B;  4PS7 A;  4A3O A;  3L16 A;  3K9O B;  3N3K B;  3R7Q A;  5JH5 C;  4W9J A;  3H7P B;  2BKF A;  3H9D A;  3KUD B;  4JIO U;  3KYC D;  2L0T A;  4AP4 C;  4FLH A;  1YJ1 A;  2LRW A;  4LDT B;  2C5L C;  3VXW A; 
#chains in the Genus database with same CATH topology
 1I4X A;  1ZXH A;  2D3G A;  4DHZ E;  1FNV A;  3O13 A;  1YN4 A;  2KDI A;  2GRI A;  4WQM A;  2M4N A;  4N59 A;  1ZDX A;  3I3T B;  2LD9 A;  3V62 A;  4KDI C;  2KTR B;  1I4Q A;  1VD2 A;  1YN5 A;  3DCG A;  3T3N A;  4MEM A;  1C79 A;  1WFY A;  5E6P A;  4IWP A;  3N32 A;  4CO7 A;  2I2Y A;  3AH7 A;  1FXA A;  4B9K A;  3IT6 B;  1XO3 A;  3VH3 B;  2LHE A;  1UD7 A;  2D11 A;  4ASW C;  1VRA B;  5HHD G;  5KHQ A;  3GP7 A;  3FC4 A;  3BYT B;  2ACZ B;  4RFB A;  3TUO A;  2K9X A;  4MH8 A;  3IVF A;  1NEK B;  5LLI A;  5H92 C;  2BYT A;  1E8Z A;  2WXJ A;  2EMT A;  2QDF A;  1RLF A;  2LUM A;  3QJZ A;  1T6B X;  1UH6 A;  4DHJ D;  3DBR B;  4J6I A;  2KD0 A;  2AQ3 B;  3HUI A;  2N9X A;  4DDI D;  4OZA A;  2KQ7 A;  3QIJ A;  4IKG A;  4HKQ A;  3DWG C;  4JLC A;  4WUR A;  3B1L X;  3GB1 A;  3RNE C;  2L32 A;  1KF6 B;  2KO3 A;  2ZNV B;  4OHJ A;  2L0F A;  5TSS A;  2GBK A;  3ZIM A;  4WQO B;  2KVR A;  2UWQ A;  3NS8 A;  2D3C A;  3KWL A;  4HJK A;  1ZGU B;  1WIA A;  4XE0 A;  3Q3M C;  1WY8 A;  3TIX A;  2BKR B;  1KLV A;  3KH0 A;  1SE2 A;  2PW9 A;  1WJ4 A;  3APF A;  1FMA D;  3VTW A;  3RT3 B;  2JXT A;  4IOI E;  2VZK D;  5BMH A;  3AU5 A;  4OVZ A;  1OGW A;  5MPO A;  3QCA A;  1WM3 A;  2KJR A;  3IT4 B;  1Z5S B;  2N9E B;  3AEC B;  1WGD A;  1V6E A;  1WMH A;  2W54 A;  3AE7 B;  3IAM 1;  5DPR A;  3S2A A;  2ZW0 A;  4DQO C;  3AE3 B;  4FJY A;  1LFD A;  1WYW B;  3Q3F A;  4OZC A;  3VTV A;  3HIZ A;  1T0Q C;  1ET9 A;  1UEL A;  2G4S A;  3VH4 B;  1EWY C;  2LWP A;  1WM2 A;  2DAF A;  4RGM A;  2BWE S;  2KAJ A;  3N9Y C;  2J0J A;  1GB4 A;  4ANX A;  1F2R I;  2RMM A;  2C60 A;  1SF0 A;  4RCO A;  3LJ3 A;  1AN8 A;  1F77 A;  3TBL D;  1A5R A;  3WCQ A;  3A4S C;  2QSD A;  1R4M I;  2AQ1 B;  3M3J A;  1SJE D;  1XLN A;  3BIN A;  5JHB A;  2AL6 A;  4AOF A;  2LEK A;  5KHO A;  2E6X A;  1B1Z A;  2MWS B;  1TZO A;  3L10 B;  1QOF A;  3N1Z C;  4II3 B;  4NAW B;  2PTL A;  3EHV A;  4P6V F;  4XDC A;  2XNA C;  2E3T A;  3A9K B;  3AE6 B;  3WAO A;  2FCS A;  1IBX B;  1MG8 A;  2INP E;  2JRH A;  4ZYS A;  5J18 A;  3V05 A;  3TJP A;  3QC8 B;  2VZK B;  1QT9 A;  3KWV A;  1OQR A;  2IGD A;  3NUH B;  1E10 A;  4MT5 A;  1K53 A;  1SE9 A;  3U30 A;  4HRS A;  4C7Y A;  1XCT L;  2RGF A;  1ZUD 2;  5AUK A;  2XN9 C;  2MW5 A;  3CSF A;  1WGR A;  3OWE B;  2FNJ B;  1UGM A;  2LJI A;  1D4B A;  2B3A A;  2K3U A;  3NRZ A;  1VDV A;  4I6L B;  4TQ1 A;  2BS4 B;  1XLO A;  3ZTD A;  2JT4 B;  3KQ4 A;  4NPN A;  1PUT A;  3VUX A;  4BKS A;  5IN7 A;  1CJE A;  1UUP A;  4YSX B;  4ACF A;  3DQV A;  2MSE D;  4XX5 A;  4GSW A;  3DBH B;  2LI5 A;  1DOX A;  3WA0 A;  4HRO A;  2FCM A;  5H8Y E;  2OHF A;  5CHV C;  4NY0 A;  3TEZ A;  3H7P A;  4ZRQ A;  3W1S A;  2INC C;  4A8X C;  2CU1 A;  1FCL A;  2ZVN A;  2NBW B;  2K5P A;  2WQY B;  3NVV A;  4AJW A;  3RCZ A;  2MBH A;  3PS6 A;  3HM6 X;  3U7D A;  2DYO A;  4KVG B;  5GXG B;  2J52 A;  1YNT E;  2FE8 A;  3QK0 A;  3BYY B;  3MC8 A;  2J0K A;  2KXJ A;  2J7Q B;  2LGD A;  1NDD A;  2KTR A;  2AEH A;  2DHZ A;  4ZRJ A;  1WRD B;  4EZK A;  3PHW B;  3DPD A;  4OZB A;  1HEZ E;  1V49 A;  1WX8 A;  2ONQ A;  1KLG D;  1ESF A;  3HK0 A;  2REX A;  3P4S B;  4EUT A;  2KJH B;  4BZA A;  2W3R A;  1TS2 A;  2LGX A;  1FNU A;  1YJJ A;  4XGA B;  1GC6 A;  2L05 A;  5D6J B;  2PLP A;  3HM3 A;  4A3P A;  4HVB A;  1YX5 B;  4A90 A;  1SSN A;  1WGK A;  1T0Y A;  1KM7 A;  1FRR A;  4OW0 A;  3A4R A;  1F1H A;  3CF6 E;  3IG3 A;  3VR8 B;  2M17 A;  4MSM B;  2FAZ A;  2GBN A;  3DOW A;  3SDL C;  2QEJ C;  1I35 A;  4PT5 A;  5IA7 A;  5AZG A;  4GDL B;  1P0R A;  1HZ6 A;  3Q8F A;  1ET6 A;  5AEK B;  1JRP A;  1S1Q B;  5JHA A;  3AXC A;  4NJ6 A;  3VFK A;  1E6E B;  2KWU B;  3RNC C;  1J7B A;  1FCC C;  3B2G A;  2WXM A;  5FKA C;  1JRO A;  4XWT A;  2MA9 B;  4MGI E;  4IM3 A;  2ZZP B;  4A9A A;  1TKY A;  4A3O A;  2G9H D;  3L16 A;  3R7Q A;  2BKF A;  1L4D B;  4JIO U;  4ZHP A;  3AM9 A;  2LRW A;  4IWO A;  2XK5 B;  1I4R A;  1QZE A;  1ZPS A;  5D94 A;  4EFO A;  3Q8B A;  3P63 A;  2MP2 B;  3NZU A;  2LXA A;  3AMZ A;  4ZHO A;  2FUH B;  2I38 A;  3QX1 A;  3B08 A;  2IPK D;  4RGN A;  2JF5 A;  4MM3 B;  3N1Y C;  1TZ1 A;  2BS2 B;  3ZYY X;  4G3X B;  4K7W A;  2I1J A;  2AWT A;  3TL5 A;  3RN9 C;  1VJK A;  3C8Y A;  4LCD E;  5EDS A;  4M00 A;  3N20 C;  2D5G A;  2WDV B;  2VH2 A;  3ETR A;  1FM0 D;  3ABV B;  3C19 A;  2RDG A;  2KDM A;  4W9K A;  1GPX A;  5E6N A;  5D7G A;  1IYF A;  4XWW A;  1YX6 B;  3RMK C;  1LM8 B;  3PHX B;  4US9 A;  5I4D A;  3P2B A;  3NVY A;  1P3Q U;  1WX7 A;  1MJD A;  3Q69 A;  1VZ6 A;  1XT9 B;  1GOZ A;  2RDB C;  4G0N B;  4AJY B;  2DX5 B;  3MHS D;  2LVO A;  4ZOH C;  2BS3 B;  1XF5 L;  2ZPN A;  3I63 C;  1AWD A;  1VCB A;  5CX3 A;  2KX0 A;  4YTM B;  4GXB A;  2DZM A;  2N1V A;  4M8N A;  4EE2 A;  4HWI B;  3PO0 A;  1WR6 E;  4W9C A;  2MX2 A;  1BXT A;  2KMA A;  4IG7 B;  2WLB A;  4KZ0 A;  4AUQ C;  1LQB A;  1EO6 A;  2FBW B;  1TS5 A;  3AED B;  2QC8 A;  3MC0 B;  4MGK E;  1KLU D;  3OG5 A;  3P42 A;  4RGT A;  1H4R A;  4HDQ A;  1V8C A;  2GOW A;  4ZRI A;  2FCQ A;  2Q5W D;  2WDQ B;  2WXF A;  5G5H A;  1GC7 A;  4I6P A;  2HTH A;  4NAW A;  1ZP0 B;  4MJS A;  4N9F 4;  1NYR A;  1KOT A;  4A20 A;  3A9K A;  1QOB A;  5DPW A;  3DVG Y;  1GG3 A;  3ZNI D;  2G4D B;  1IBX A;  1WXM A;  5LNK 1;  3LXF A;  4ZRK A;  3TEY A;  4AQ7 A;  1L0V B;  4C56 C;  1C4A A;  2LAS A;  2C9W B;  1V1O A;  4W9H A;  2JPH A;  3ECI A;  4OVV A;  1EF1 A;  3QAQ A;  4FHJ A;  3IBE A;  3BK1 A;  3E9S A;  1EM7 A;  2AX5 A;  3RD2 A;  2KMC A;  4HEA 1;  1YQB A;  1GB1 A;  3ALB A;  3RNG C;  2IZV B;  2ZCB A;  3UI3 A;  4KV2 A;  4IWQ A;  4I6N B;  2K8H A;  3AEF B;  5FK9 C;  3ZNH B;  3EUB 2;  2DBY A;  2G3Q B;  1P98 A;  1SE3 A;  1SJH D;  2JXX A;  3IAS 1;  1J7C A;  1C76 A;  2K25 A;  3QHT A;  4A6Q A;  1AW7 A;  3KW5 B;  1L5P A;  4HKZ E;  2Y5B B;  3U2S C;  1JWB D;  5C23 A;  2Z59 B;  1QQR A;  1VR9 A;  2MJ3 A;  3U4E G;  4MEL A;  1UZX B;  4W9E A;  2KFK B;  1R4M B;  1F0Z A;  5LXI B;  1K51 A;  1V5O A;  1PGB A;  1ZDV A;  3IHP C;  1YJI A;  2EKE C;  2MRP A;  4BFR A;  5BYQ A;  3WIM A;  4W9D A;  1WRI A;  4JQW C;  3BK2 A;  1J0G A;  3WAM A;  2VH1 A;  2LHD A;  4YWG G;  2NPT A;  1OEY A;  5IOI A;  1TYG B;  2W3S A;  2KVZ A;  4MH0 E;  2H89 B;  1D5M C;  2K39 A;  4KIK B;  1TKG A;  3JVZ X;  3K9P B;  2WYQ A;  2QJL A;  4N6E B;  2GI9 A;  2K8C A;  4GOC A;  3HVD A;  1V97 A;  2EEL A;  3SR6 A;  1QOA A;  2LVQ A;  2INN E;  1UNS A;  1HTQ A;  1TS4 A;  2IO2 B;  2RR9 A;  1RRB A;  2G1E A;  2KDF B;  2AL3 A;  4M0W B;  3KUC B;  4KGS A;  3NY5 A;  3NZ3 A;  3ZDT A;  2GBJ A;  3DBL I;  4GDL A;  4JPS A;  3SFE B;  3M95 A;  1L4Z B;  4ANW A;  1FEH A;  1P9D U;  1QIL A;  1RAX A;  4TKN A;  5HG2 A;  4EOY A;  2TSS A;  4JGH B;  1HZ5 A;  1GJZ A;  2IY0 B;  1I42 A;  2CJO A;  5JZE B;  3MP9 A;  1KTK A;  4MDK E;  3APC A;  3Q2A C;  3ZO5 B;  4WWM A;  4DHZ B;  3NHE B;  5HKH A;  3AEG B;  3HHM A;  5TR5 A;  2PVG C;  3IFW B;  4FXC A;  3DWM A;  2HTM E;  3EFU A;  3GE3 C;  3LDZ E;  2EKI A;  3DVN U;  2I1K A;  3FIL B;  1WYG A;  3R2T A;  4XDD A;  1KJT A;  3VRA B;  3WAN A;  2BF8 B;  1OQY A;  2XK5 A;  1L7Y A;  1MHX A;  2GB1 A;  2NBU A;  2MP2 A;  4C00 A;  4LTU A;  2BPS A;  2JWZ A;  4XZ4 A;  2PPH A;  2R2O A;  2RPQ A;  5IP4 D;  1Q10 A;  3OJ3 A;  3OAW A;  4TSS A;  2KC1 A;  3X0W A;  4BVU C;  4MM3 A;  1S3S G;  1RWS A;  2R61 A;  1JWA D;  3EC8 A;  2IGG A;  1Q0W B;  1WF9 A;  1VLB A;  1SGH A;  2D3A A;  1N5W A;  5EE3 A;  2CHW A;  1F2R C;  2DNF A;  2KNB A;  1WGH A;  1IP9 A;  2NCN A;  1WZ0 A;  4MJS B;  2HJ8 A;  5L95 C;  3HVZ A;  3URY A;  2WS3 B;  1TY0 A;  2V3P A;  4WJN A;  2IND C;  5DPS A;  2DZK A;  2ON8 A;  1UBQ A;  1XLQ A;  3RNF C;  1R7S A;  3L54 A;  1UBI A;  4ZYN A;  1WXS A;  1B9R A;  3Q6B A;  2KOX A;  1TS3 A;  4RM8 A;  2W82 A;  2SAK A;  2GBM A;  1UF0 A;  3JSV B;  4GN1 A;  1Q1O A;  2JSV X;  3DBR I;  1V1P B;  1OTR B;  1PGA A;  2R2Q A;  3RUL A;  5CHF A;  1T3Q A;  4LNO A;  2UYZ B;  4WAA A;  1YN3 A;  3T3O A;  3D32 A;  2PE9 A;  1R4N I;  2KWC A;  2YLM A;  5HI1 A;  3B0A A;  3BVG A;  1NBF C;  4NQK E;  5AZF A;  3MJW A;  4KGR A;  4G50 A;  3H1U A;  1DOI A;  5BYR A;  3ZXV A;  3JYU A;  1V86 A;  2OJR A;  1N63 A;  3AE4 B;  3ZGZ A;  3R8B A;  4KKI A;  1QLB B;  3N3K B;  3K9O B;  5JH5 C;  4C4V B;  3KYC D;  1T5X D;  1F52 A;  2L0T A;  4FLH A;  4LDT B;  2C5L C;  1EWC A;  4HJG E;  3OJ4 B;  1PYW D;  4RH6 A;  4X57 B;  4FAD A;  5C3J B;  1ROE A;  3P4Q B;  3SHQ A;  3W2D A;  2BYE A;  3VUY A;  4XYC A;  2CJN A;  2MBQ A;  2WXP A;  1C9F A;  2WXL A;  4FJV B;  5T8I A;  2LZ6 A;  3PZ7 A;  1E8X A;  2BYV E;  4PS8 A;  1FXT B;  3EA6 A;  4WIP A;  5EE9 A;  3PZ8 A;  1VZ8 A;  1MFW A;  4LK0 M;  1DOY A;  2Z8L A;  3AE9 B;  4DXA B;  4ARI A;  2FUG 1;  1GUA B;  2Y5P A;  1Z2M A;  2NPT B;  1SIJ A;  3ZTC A;  1GNU A;  4USA A;  3QWZ B;  1J8C A;  1ISN A;  2C7H A;  4YL8 A;  2A5U A;  5BYS A;  2RPV A;  4K3C A;  1K50 A;  1I4H A;  1YQ3 B;  1LGR A;  4LLG M;  5BMG A;  2K6D B;  3J9C A;  4IUM B;  2KLC A;  2JUO A;  3NJT A;  2KFK A;  2KN5 A;  3SFD B;  1L0Y B;  2WDR B;  2KN4 A;  3ZKJ C;  1E8W A;  3EFC A;  4HCN B;  2D10 A;  4P1B C;  2V4L A;  2M8S A;  2BW2 A;  2MHJ A;  4A55 A;  3W5U B;  2GBR A;  2OED A;  3ZRF A;  2ZEQ A;  4B0E A;  4GLS C;  2JVC A;  3AE5 B;  3L13 A;  2IGH A;  3W9C B;  2RD0 A;  4D2K A;  4E3C A;  1BUI C;  4W9L A;  2KKC A;  1QKZ A;  3VVW B;  3ZLZ A;  2DEN B;  1WXV A;  1JCK B;  2A4Z A;  2G45 B;  2L1A A;  2V1Y A;  4KIK A;  5G5G A;  2KQS A;  3TMP B;  2V9H A;  4RF1 A;  2LGY A;  3Q8C A;  1QOG A;  3GE8 C;  2MCN B;  2K22 A;  2JZ3 B;  2NTS A;  4B0M A;  2D2Q A;  4L2Y A;  1FIQ A;  2W9N A;  4NAM A;  2J0M A;  4HCP B;  4EKU A;  3Q8A A;  1FD6 A;  2RSU A;  1EU4 A;  1RFK A;  3P1M A;  4FJZ A;  4KSL C;  1C4P A;  4M0W A;  4M8M A;  1UWX A;  1Q5W B;  4AWJ A;  4F7Z A;  1M4V A;  2BVC A;  5FR6 A;  4GB9 A;  4PYZ A;  3PLV A;  3APD A;  4NNJ B;  4REZ A;  4GIV A;  2HDE A;  2BB6 A;  1E90 A;  1AYF A;  3WAL A;  2IBI B;  3AUL A;  4BKG A;  5BMI A;  2CR5 A;  5CTR C;  3WAP A;  3DHH C;  2JYT A;  3UQB A;  4N58 A;  2MBO A;  3M63 B;  3A9J B;  2Z0D B;  1AAR A;  2D07 B;  4F8C B;  1SBB B;  4IC7 B;  1D5Z C;  1I4P A;  1V80 A;  2BT6 A;  3NVW A;  4YTN B;  4KGT A;  3AU4 A;  3QAR A;  4KSK C;  1TKE A;  1BML C;  1FFU A;  3FIL A;  2JWU A;  4KX6 B;  3UGB B;  2XBB C;  1LO5 D;  4FUL A;  3LB8 C;  4KKJ A;  1SE4 A;  3KYD D;  1N5X A;  4RMA A;  4KZC A;  2JZP A;  3EEC A;  3UQA A;  4QAY A;  2WXQ A;  2M19 A;  5LXH A;  3BII D;  5C2T B;  2KMM A;  3UIO B;  2FCN A;  3VAW A;  1CQV A;  2D3B A;  2FID A;  2WXH A;  4FHK A;  3V3X A;  1WJU A;  1WGY A;  4HDO A;  1C77 A;  2WX1 A;  2O6V D;  4OVU A;  3JW0 X;  2IY1 B;  2X38 A;  2V3N A;  2ZJD A;  3DBS A;  1WR1 A;  1FRD A;  1ZW7 A;  4L1B A;  4EZJ A;  4GU2 A;  4HK2 A;  4HPP A;  1WX9 A;  2QIL A;  2KDB A;  3O65 B;  2WGS A;  3PPA A;  4DXG A;  1KRH A;  2QCZ A;  3ZRC A;  2V3S A;  3Q3O C;  2CHX A;  3ZNZ B;  5EE0 A;  1T0R C;  3RUI B;  4NZL B;  2SEB D;  3JSV A;  3U8Z A;  5C1Z A;  1I7H A;  1V1P A;  2W55 A;  1T0S C;  4HLE A;  4DWF A;  2M0A A;  3BWU D;  5J17 A;  3MJ5 A;  3H6N A;  1P1A A;  3ZVV A;  3H8H A;  4PS3 A;  2L00 B;  2WHI A;  2JYE A;  2JY6 A;  3ZJT A;  5D3D A;  3W1Y A;  4CHK A;  3KVF B;  4J3O D;  4BOZ B;  5G55 A;  1V2Y A;  4GDK B;  1ZE3 D;  4NJ7 A;  3GZN I;  2DZJ A;  2N7J A;  3R7R A;  2DLB A;  2C7M B;  4P1C C;  1SIF A;  2EMS A;  2RDH A;  4C4V A;  2CU3 A;  3KUZ A;  4DBG A;  3Q3N C;  1D3Z A;  4R3D A;  1HXY D;  1FFV A;  2L8J A;  1TTN A;  2KC2 A;  4K7U A;  4XC2 A;  2O2V B;  3QQ8 B;  3AV8 A;  3N1X C;  1XD3 B;  4DK5 A;  5L83 A;  1N6Z A;  2DWQ A;  1ZKH A;  3FKY A;  1MG4 A;  2LRU A;  4EEW A;  3PRM B;  3PT2 B;  3FAH A;  1WH3 A;  1ENF A;  4WH4 A;  5E6J A;  2O6V B;  1JWM D;  2IYD B;  2CHZ A;  3SEB A;  2H88 B;  4RNA A;  2PVO D;  2M1M A;  1L6V A;  3TEW A;  2WNM A;  3AEA B;  4CYE A;  2V4I B;  1BT0 A;  3ENE A;  3E56 A;  3MHZ A;  2HJ1 A;  2DYM A;  2GMI C;  3R66 C;  1XCQ L;  3B9J A;  3ZXR A;  2GLS A;  4M01 A;  3ZNG C;  2XEW A;  4ZDV A;  4CQN A;  3Q14 C;  3I57 A;  3V6C B;  4BKT A;  3RZF A;  4C7Z A;  1RFA A;  1WGG A;  2PE6 B;  3RI7 C;  4YSY B;  3TSS A;  2ZPY A;  1V5T A;  2LVP A;  3V6E B;  3CMM B;  4ANU A;  1R4N B;  2YEP F;  2KAN A;  2KDE B;  3IXS A;  3NZS A;  3PZD A;  4BBN C;  4RM9 A;  1TGZ B;  4WJO A;  2AQ2 B;  3MFG A;  1L6U A;  4ICV A;  3BY4 B;  1TIF A;  2L83 A;  3BZD B;  3R2I A;  1WXQ A;  4K3B A;  1U4A A;  1X1M A;  4P16 A;  2FIF A;  3RFZ B;  2MLB A;  3CWI A;  4ITK A;  4FN2 A;  3AI5 A;  1KFY B;  3KUD B;  2JU6 X;  2ICI A;  1SB3 C;  1P7E A;  3DHG C;  1STE A;  2KWV B;  3L17 A;  4MGZ E;  3NOB A;  5AUI A;  1IGD A;  1NVI D;  1WZ3 A;  3UIN B;  1C1Y B;  1IUE A;  5CHW A;  1N60 A;  3OLM D;  2PEA A;  4UDU C;  1FXI A;  2V0G A;  1PDX A;  4JL9 A;  4K7S A;  4YXD B;  2WXI A;  2N9P C;  4S17 A;  2KYW A;  4H2A A;  1OQQ A;  2K0P A;  1PGX A;  4LDT D;  3T8M A;  2YVC A;  3RYT A;  5HFY A;  2BWF A;  1YOV B;  3SU8 X;  3UF8 A;  1IPG A;  4W9F A;  2NMQ A;  3W1S C;  2BGF A;  1WE7 A;  2K6Q A;  3PLU A;  1YQ4 B;  4GMV A;  1F9J A;  1RM6 C;  3VQI A;  3C0R B;  3R3M A;  5DPT A;  4DHJ B;  3A9J A;  4PYU A;  5JXV A;  3PRP B;  4B6W A;  2YEP B;  3A1Q B;  3AE2 B;  2CKH B;  4G11 A;  4F1S A;  3BVZ A;  2JZZ A;  2ZW1 A;  3VTU A;  4K81 A;  2KT7 A;  2QIE B;  2OJW A;  2JX5 A;  1FO4 A;  2N9K A;  2LUE A;  1D6E C;  3VR9 B;  2M0X A;  1M94 A;  2MQJ A;  3B2F A;  3TCA A;  4B95 A;  3AB5 A;  2L7R A;  3PRE A;  4S0R A;  2ASQ A;  4GGQ A;  5G2N A;  1I4G A;  4TMA B;  1EF5 A;  1E5W A;  3UIP B;  2JQR B;  2PMV A;  3MC9 A;  4DDG D;  2K1F A;  5E6O A;  1KH0 A;  3I9V 1;  1J19 A;  3VDZ A;  1ZXI A;  3PVL A;  5IAA C;  2KLG A;  2J42 A;  1JRU A;  4MAC A;  2KAC A;  4TQ0 A;  2L52 A;  4YTP B;  5IKC M;  2DZI A;  1TY2 A;  4FBJ B;  1GAQ B;  4NJC A;  4NQL B;  3AN1 A;  1HE8 A;  1ACC A;  4HPL B;  2J4X A;  3DVN V;  1WSP A;  4DXF A;  1NI3 A;  1HQR D;  2LFI A;  1C4C A;  4PK1 A;  1HTO A;  3DVG X;  2Y3A A;  1NEN B;  2N9L A;  2MBE A;  1FPY A;  2OOB B;  2N0S B;  1UGJ A;  2BBC A;  2ZNV C;  2WWZ A;  3W5V B;  1E7U A;  1WJ6 A;  1LXD A;  1WJN A;  5BO4 B;  2IDY A;  2MJD A;  1P7F A;  1SXT A;  2M56 B;  5AZH A;  2VRR B;  3GS2 A;  3L4P A;  1XLP A;  1QF6 A;  1JW9 D;  1JWS D;  2PKO A;  3VRB B;  3CST A;  1JML A;  1CMX B;  4KDL B;  2Z0E B;  3V61 A;  3P4R B;  2ZCC A;  1E0Z A;  4LNI A;  1NI2 A;  4GDK A;  4ARC A;  5DCN A;  1JWU D;  3NS1 A;  4L23 A;  3Q3J A;  3U52 E;  2WXN A;  4M02 A;  2JRI B;  2PJH A;  1MVK A;  2WX0 A;  3DHI C;  4RF0 A;  3PSE B;  1V9J A;  1WE6 A;  4Q2J A;  1C78 A;  1E7V A;  2O2V A;  2LMC A;  4RGO S;  2LJ5 A;  3KLS X;  1HA5 A;  5EE1 A;  4WWP A;  1ZOY B;  1Y8R C;  2BQQ A;  1L0X B;  4W9I A;  4EZL A;  2O6V A;  1EU3 A;  2IO0 B;  1IGC A;  2NVU I;  4IDI A;  4K1R B;  4TV3 A;  3RNB C;  1H8C A;  1EUV B;  3VHT C;  4BOS C;  5D2M B;  4P7I A;  4JWU C;  1OEY J;  2LGS A;  4LJP B;  2KZR A;  4MSQ B;  2X8X X;  2J53 A;  4LNK A;  3ML9 A;  4TUU A;  1E9M A;  1TJE A;  2IO1 B;  2KJ6 A;  4BBN F;  2QHO A;  4WAF A;  1J7A A;  1V81 A;  3CIR B;  2WP9 B;  3ML8 A;  1WMH B;  3BVM A;  1NYQ A;  4HXD A;  1SEB D;  3ZJU A;  1OFF A;  3ZDM C;  2BYF A;  2IO3 B;  4WJP A;  1PFD A;  2MJE A;  3MTN B;  3X23 A;  4O1N A;  3T9L A;  4ICU A;  3TEX A;  1N62 A;  1MHH E;  4JE3 B;  3RZW C;  1WXA A;  3GZN B;  3ZW3 A;  2AYO B;  2C7N B;  2NTT A;  4JX1 C;  3AE1 B;  1A70 A;  4BKS D;  1MI0 A;  2LXC A;  3N30 A;  1N61 A;  2WXR A;  3ZJV A;  3NVZ A;  2L76 A;  3DBH I;  4LNF A;  2KK8 A;  3Q8E A;  2K8B A;  3P4P B;  2WXG A;  2N1W A;  2KX3 A;  2MH7 A;  4C80 A;  3U7Z A;  2WXO A;  5J2R A;  4IM2 A;  4II2 B;  1YIW A;  2L3Z A;  2BTE A;  1YD8 U;  1MPE A;  2DAJ A;  3QA8 A;  4HPM B;  2N7E A;  4IW0 A;  3AEE B;  1CK1 A;  3PRZ A;  1TBE A;  2NBV B;  3M62 B;  4YT0 B;  2KHW B;  4LJO B;  4E71 A;  2ZVO A;  2QMT A;  3GOE A;  3L0W B;  1WI0 A;  4W9G A;  4US8 A;  4MGY E;  3I5J C;  2CS4 A;  2LGI A;  3ONS A;  2WXK A;  1XXG A;  1E7P B;  3PV1 A;  2NR2 A;  2IJ0 A;  2Y5C A;  4ZRP A;  2B76 B;  1VZ7 A;  4IM0 A;  2PIA A;  4FA6 A;  4WJQ A;  1E8Y A;  1WWT A;  2MEK A;  1YMH E;  4WWN A;  2KQ4 X;  1PQS A;  3A1Q A;  5FR3 A;  5GMV A;  1Y56 A;  3HRD D;  3NG0 A;  2UU7 A;  1JQ4 A;  2WU5 B;  1XQQ A;  2N7D A;  3V60 A;  2KWD A;  1CZP A;  5IO9 A;  2KTF A;  3AEB B;  1FNW A;  3AE8 B;  3RPF C;  1G6J A;  3EGR A;  1RYJ A;  4URK A;  2WDT B;  3ZQ4 A;  4AS1 A;  3L08 A;  4E74 A;  3DBL B;  1K52 A;  1K8R B;  4ANV A;  3DDC B;  3RNA C;  3ZUN A;  4WWO A;  3PGE A;  3VUW A;  1TT5 B;  3LYY A;  5D3I B;  2DYB A;  1L2N A;  2BB5 A;  1UWM A;  2N4F A;  3H7S A;  3SD5 A;  4YSZ B;  2NS5 A;  2MBB B;  2KFJ A;  1DYQ A;  2WU2 B;  4BAX A;  2HD5 B;  2HE7 A;  1C3T A;  3PTF C;  1D5X C;  1XEE A;  3A33 B;  4PS7 A;  4JWS C;  4W9J A;  3H7P B;  3H9D A;  4AP4 C;  1DGJ A;  1YJ1 A;  1JAL A;  4LNN A;  3VXW A; 
#chains in the Genus database with same CATH homology
 3OJ4 B;  2KWV B;  3L17 A;  4IWO A;  4MGZ E;  2XK5 B;  1QZE A;  4X57 B;  2D3G A;  5D94 A;  4FAD A;  4EFO A;  3NOB A;  4DHZ E;  1WZ3 A;  3UIN B;  2MP2 B;  2KDI A;  2LXA A;  1C1Y B;  3NZU A;  3SHQ A;  5CHW A;  2FUH B;  2BYE A;  3VUY A;  3OLM D;  3QX1 A;  2MBQ A;  2PEA A;  2M4N A;  3B08 A;  3I3T B;  4JL9 A;  2JF5 A;  2LD9 A;  4K7S A;  4FJV B;  3V62 A;  1TZ1 A;  2LZ6 A;  4G3X B;  4KDI C;  2KTR B;  1E8X A;  4K7W A;  2BYV E;  2I1J A;  2N9P C;  4PS8 A;  1FXT B;  1VD2 A;  2AWT A;  3TL5 A;  3DCG A;  4MEM A;  4LCD E;  5EDS A;  4LDT D;  3T8M A;  4DXA B;  2YVC A;  1WFY A;  3RYT A;  5E6P A;  1GUA B;  2BWF A;  4IWP A;  3N32 A;  4CO7 A;  3SU8 X;  1Z2M A;  1IPG A;  3UF8 A;  2NPT B;  4W9F A;  3W1S C;  2BGF A;  1WE7 A;  2K6Q A;  3PLU A;  4W9K A;  5E6N A;  4B9K A;  5D7G A;  1IYF A;  4GMV A;  3ZTC A;  1F9J A;  1YX6 B;  3VQI A;  1LM8 B;  3C0R B;  3PHX B;  1GNU A;  3P2B A;  3R3M A;  3QWZ B;  1J8C A;  3VH3 B;  1ISN A;  1P3Q U;  2C7H A;  5DPT A;  4DHJ B;  3A9J A;  1WX7 A;  1UD7 A;  4YL8 A;  2A5U A;  2D11 A;  4ASW C;  4PYU A;  5KHQ A;  1XT9 B;  3PRP B;  4B6W A;  3A1Q B;  2CKH B;  4G11 A;  4F1S A;  2K6D B;  2JZZ A;  4G0N B;  4IUM B;  3VTU A;  2KLC A;  4K81 A;  2JUO A;  3IVF A;  4AJY B;  2DX5 B;  3MHS D;  2KFK A;  2LVO A;  5LLI A;  1E8Z A;  2ZPN A;  2KN5 A;  2EMT A;  1VCB A;  5CX3 A;  2LUE A;  1E8W A;  2KX0 A;  3ZKJ C;  4GXB A;  1RLF A;  2DZM A;  2N1V A;  2D10 A;  4HCN B;  4M8N A;  2V4L A;  3QJZ A;  2M0X A;  2M8S A;  4HWI B;  1M94 A;  1WR6 E;  2MQJ A;  4W9C A;  2MX2 A;  3TCA A;  1UH6 A;  2KMA A;  4IG7 B;  2GBR A;  3ZRF A;  4B95 A;  4KZ0 A;  2ZEQ A;  4AUQ C;  4J6I A;  1LQB A;  4DHJ D;  2KD0 A;  2L7R A;  1EO6 A;  3PRE A;  2ASQ A;  4GGQ A;  2N9X A;  5G2N A;  2JVC A;  4DDI D;  4MGK E;  3L13 A;  1EF5 A;  1H4R A;  1E5W A;  2KQ7 A;  4HDQ A;  3UIP B;  2RD0 A;  3QIJ A;  2GOW A;  4ZRI A;  4DDG D;  2FCQ A;  4E3C A;  1GC7 A;  2K1F A;  4I6P A;  4JLC A;  2HTH A;  4W9L A;  5E6O A;  2KKC A;  1J19 A;  4NAW A;  4MJS A;  4N9F 4;  3VVW B;  3ZLZ A;  3VDZ A;  3B1L X;  2DEN B;  1WXV A;  2KO3 A;  3PVL A;  5IAA C;  2ZNV B;  1KOT A;  2KLG A;  4A20 A;  2A4Z A;  2L0F A;  3A9K A;  1JRU A;  2G45 B;  2V1Y A;  4KIK A;  5DPW A;  2KQS A;  1GG3 A;  2GBK A;  3DVG Y;  3ZIM A;  4WQO B;  3TMP B;  4TQ0 A;  2KVR A;  3ZNI D;  2G4D B;  2UWQ A;  3NS8 A;  2LGY A;  4HJK A;  1ZGU B;  2DZI A;  1WIA A;  4FBJ B;  1WXM A;  4NQL B;  2MCN B;  1HE8 A;  2JZ3 B;  1WY8 A;  4ZRK A;  2D2Q A;  3TIX A;  4HPL B;  2BKR B;  1KLV A;  3KH0 A;  3DVN V;  1WJ4 A;  3APF A;  3VTW A;  2LAS A;  2C9W B;  2W9N A;  4W9H A;  2JPH A;  3ECI A;  4OVV A;  3RT3 B;  2J0M A;  1EF1 A;  4HCP B;  4EKU A;  2RSU A;  3QAQ A;  4FJZ A;  4FHJ A;  3IBE A;  4KSL C;  3DVG X;  4M8M A;  3RD2 A;  3AU5 A;  1Q5W B;  4AWJ A;  1OGW A;  4F7Z A;  2KMC A;  1YQB A;  5FR6 A;  3QCA A;  2MBE A;  4GB9 A;  2OOB B;  4PYZ A;  1WM3 A;  2KJR A;  3PLV A;  1Z5S B;  3ALB A;  3APD A;  4NNJ B;  2N9E B;  4GIV A;  2ZNV C;  2IZV B;  1WGD A;  2WWZ A;  1V6E A;  2ZCB A;  4KV2 A;  1E7U A;  1WJ6 A;  4IWQ A;  1WMH A;  1LXD A;  2K8H A;  1E90 A;  4I6N B;  1WJN A;  5BO4 B;  5DPR A;  3WAL A;  3S2A A;  3ZNH B;  2IBI B;  5AZH A;  4FJY A;  2G3Q B;  3AUL A;  1LFD A;  1P98 A;  2VRR B;  4BKG A;  1WYW B;  3Q3F A;  3VTV A;  3HIZ A;  2JXX A;  2CR5 A;  5CTR C;  3WAP A;  1UEL A;  2G4S A;  3VH4 B;  3UQB A;  2K25 A;  1WM2 A;  2LWP A;  3QHT A;  2MBO A;  3CST A;  2DAF A;  3KW5 B;  3M63 B;  3A9J B;  2Z0D B;  1AAR A;  2BWE S;  2Y5B B;  1CMX B;  2D07 B;  4KDL B;  4F8C B;  4IC7 B;  2J0J A;  2Z0E B;  5C23 A;  2Z59 B;  3V61 A;  4ANX A;  1V80 A;  2ZCC A;  2C60 A;  1NI2 A;  4MEL A;  4GDK A;  1UZX B;  4W9E A;  5DCN A;  2KFK B;  3LJ3 A;  3AU4 A;  3Q3J A;  3QAR A;  3TBL D;  4KSK C;  1A5R A;  2JRI B;  2PJH A;  3A4S C;  5LXI B;  1V5O A;  2WX0 A;  1R4M I;  3IHP C;  2EKE C;  2MRP A;  4BFR A;  3UGB B;  2XBB C;  3PSE B;  1V9J A;  1WE6 A;  4FUL A;  3M3J A;  3WIM A;  4W9D A;  1E7V A;  2O2V A;  4JQW C;  3KYD D;  3BIN A;  1J0G A;  5JHB A;  2LJ5 A;  2AL6 A;  4AOF A;  4RMA A;  5KHO A;  4KZC A;  3WAM A;  3EEC A;  3UQA A;  2MWS B;  2NPT A;  3L10 B;  1OEY A;  5LXH A;  4II3 B;  4NAW B;  4WWP A;  3UIO B;  1Y8R C;  2FCN A;  3EHV A;  4W9I A;  4EZL A;  3VAW A;  4MH0 E;  2O6V A;  2FID A;  3A9K B;  2K39 A;  4KIK B;  4FHK A;  1WJU A;  1WGY A;  4HDO A;  3JVZ X;  2IO0 B;  3WAO A;  3K9P B;  2FCS A;  2NVU I;  2WX1 A;  2O6V D;  4OVU A;  3JW0 X;  1MG8 A;  2JRH A;  2IY1 B;  2WYQ A;  2ZJD A;  3DBS A;  1WR1 A;  4K1R B;  4TV3 A;  1ZW7 A;  5J18 A;  2K8C A;  4GOC A;  1H8C A;  3TJP A;  3QC8 B;  1EUV B;  3VHT C;  4BOS C;  4EZJ A;  5D2M B;  4P7I A;  4GU2 A;  1OEY J;  2LVQ A;  4HK2 A;  1WX9 A;  2KZR A;  4LJP B;  2KDB A;  2IO2 B;  2RR9 A;  3O65 B;  4MSQ B;  3PPA A;  1RRB A;  2KDF B;  1SE9 A;  3U30 A;  2AL3 A;  4M0W B;  3ML9 A;  4TUU A;  3KUC B;  3ZRC A;  2IO1 B;  2RGF A;  2KJ6 A;  2V3S A;  2QHO A;  4BBN F;  2CHX A;  3ZNZ B;  1V81 A;  3NY5 A;  3RUI B;  3ML8 A;  3U8Z A;  3JSV A;  3ZDT A;  2GBJ A;  1WMH B;  3DBL I;  4GDL A;  5C1Z A;  2MW5 A;  3M95 A;  4ANW A;  1RAX A;  1P9D U;  3CSF A;  1WGR A;  4HXD A;  4TKN A;  2FNJ B;  4HLE A;  4DWF A;  1UGM A;  3ZDM C;  5J17 A;  2B3A A;  3H6N A;  2BYF A;  2IO3 B;  1P1A A;  4WJP A;  4EOY A;  3ZVV A;  4I6L B;  4JGH B;  4PS3 A;  4TQ1 A;  2L00 B;  3ZTD A;  1GJZ A;  3MTN B;  2JT4 B;  3X23 A;  3T9L A;  2IY0 B;  4NPN A;  4ICU A;  3VUX A;  3RZW C;  4BKS A;  1I42 A;  2JY6 A;  1WXA A;  3W1Y A;  3ZW3 A;  4CHK A;  2AYO B;  5JZE B;  2C7N B;  3KVF B;  4BOZ B;  3DQV A;  2MSE D;  4XX5 A;  4MDK E;  4GSW A;  3APC A;  5G55 A;  1V2Y A;  4BKS D;  4GDK B;  3ZO5 B;  4NJ7 A;  2LI5 A;  3GZN I;  2DZJ A;  4DHZ B;  3NHE B;  3R7R A;  2LXC A;  2C7M B;  3WA0 A;  5HKH A;  3HHM A;  3N30 A;  1SIF A;  5TR5 A;  2FCM A;  3IFW B;  2EMS A;  3EFU A;  2L76 A;  3LDZ E;  5CHV C;  4NY0 A;  3DBH I;  3H7P A;  3KUZ A;  4DBG A;  3DVN U;  2KK8 A;  3W1S A;  2I1K A;  2CU1 A;  1D3Z A;  2ZVN A;  1KJT A;  2K8B A;  2NBW B;  3WAN A;  2BF8 B;  1OQY A;  2XK5 A;  1L7Y A;  2L8J A;  1TTN A;  2KC2 A;  2N1W A;  4AJW A;  4K7U A;  4XC2 A;  2KX3 A;  2MBH A;  3PS6 A;  3RCZ A;  3HM6 X;  2NBU A;  2MP2 A;  2O2V B;  3QQ8 B;  3U7D A;  1XD3 B;  2DYO A;  4DK5 A;  2BPS A;  2JWZ A;  4XZ4 A;  5J2R A;  4KVG B;  2PPH A;  2R2O A;  2RPQ A;  4IM2 A;  5L83 A;  4II2 B;  1YIW A;  1ZKH A;  2L3Z A;  3OJ3 A;  3OAW A;  3QK0 A;  2KC1 A;  3X0W A;  4BVU C;  1YD8 U;  2DAJ A;  2LRU A;  2J0K A;  2KXJ A;  4MM3 A;  4EEW A;  3QA8 A;  2J7Q B;  2LGD A;  1NDD A;  2N7E A;  1S3S G;  4HPM B;  3PRM B;  4IW0 A;  3PT2 B;  2KTR A;  3EC8 A;  2AEH A;  2DHZ A;  4ZRJ A;  1WH3 A;  3PRZ A;  1Q0W B;  1TBE A;  1WRD B;  2NBV B;  2O6V B;  1WF9 A;  2CHZ A;  2IYD B;  3M62 B;  1SGH A;  4EZK A;  2M1M A;  3PHW B;  3DPD A;  2CHW A;  2KNB A;  1V49 A;  4CYE A;  1BT0 A;  1WX8 A;  2KHW B;  2ZVO A;  4LJO B;  4E71 A;  1WGH A;  3ENE A;  3GOE A;  2REX A;  2NCN A;  1WZ0 A;  3HK0 A;  3L0W B;  1IP9 A;  4EUT A;  1WI0 A;  4W9G A;  2KJH B;  4MGY E;  4MJS B;  2CS4 A;  2HJ8 A;  2LGX A;  3ONS A;  5L95 C;  2DYM A;  2GMI C;  3R66 C;  1GC6 A;  3PV1 A;  2L05 A;  2NR2 A;  5D6J B;  3ZNG C;  4WJN A;  5DPS A;  2DZK A;  4IM0 A;  4FA6 A;  2XEW A;  3HM3 A;  4A3P A;  1UBQ A;  4WJQ A;  4HVB A;  4ZDV A;  1E8Y A;  1YX5 B;  3L54 A;  1UBI A;  4WWN A;  4ZYN A;  3RZF A;  3V6C B;  4BKT A;  1T0Y A;  1RFA A;  1KM7 A;  1WGG A;  1PQS A;  3A1Q A;  3A4R A;  3IG3 A;  3CF6 E;  5GMV A;  2PE6 B;  1WXS A;  2M17 A;  4MSM B;  2FAZ A;  2GBN A;  1XQQ A;  2KOX A;  4RM8 A;  2N7D A;  3DOW A;  2ZPY A;  3SDL C;  1I35 A;  3V60 A;  1V5T A;  2LVP A;  2GBM A;  5IA7 A;  5AZG A;  3JSV B;  4GN1 A;  1Q1O A;  4GDL B;  3V6E B;  1P0R A;  3DBR I;  3CMM B;  2KTF A;  1OTR B;  4ANU A;  5AEK B;  2R2Q A;  3RUL A;  1S1Q B;  5CHF A;  5JHA A;  1G6J A;  4URK A;  2KAN A;  2WDT B;  3AXC A;  3L08 A;  2UYZ B;  2KDE B;  4NJ6 A;  4WAA A;  3VFK A;  2KWU B;  4E74 A;  1K8R B;  4ANV A;  3DDC B;  3ZUN A;  3NZS A;  3PZD A;  3D32 A;  4WWO A;  4BBN C;  2PE9 A;  4RM9 A;  3PGE A;  1R4N I;  3VUW A;  2KWC A;  1TGZ B;  2YLM A;  2DYB A;  3B0A A;  1L2N A;  4WJO A;  1NBF C;  2N4F A;  3H7S A;  4NQK E;  3SD5 A;  2NS5 A;  2MBB B;  4ICV A;  3BY4 B;  5AZF A;  3MJW A;  2KFJ A;  1U4A A;  1X1M A;  4G50 A;  2HD5 B;  2FIF A;  2HE7 A;  2MA9 B;  3H1U A;  2MLB A;  2ZZP B;  4IM3 A;  4MGI E;  1C3T A;  3PTF C;  4FN2 A;  3JYU A;  1V86 A;  2OJR A;  3AI5 A;  3A33 B;  4PS7 A;  4A3O A;  3L16 A;  3K9O B;  3N3K B;  3R7Q A;  5JH5 C;  4W9J A;  3H7P B;  2BKF A;  3H9D A;  3KUD B;  4JIO U;  3KYC D;  2L0T A;  4AP4 C;  4FLH A;  1YJ1 A;  2LRW A;  4LDT B;  2C5L C;  3VXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...